3GV3A

Cxcl12 (sdf) in trigonal space group
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
62
structure length
62
Chain Sequence
LSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytokine
molecule keywords CXCL12 protein
publication title Heterologous quaternary structure of CXCL12 and its relationship to the CC chemokine family.
pubmed doi rcsb
source organism Homo sapiens
total genus 12
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2009-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3gv3A00
5EPLA 1X32A 4CJ1B 1EQTA 1U4RA 2B2TC 1WTRA 1VMCA 1WD1A 1DONA 1BBXC 2HUGA 2J7ZA 2JYOA 5T1IA 1CA5A 2X6LA 4ZAIA 2L12A 1ILPA 4HSVA 1X3PA 1F2LA 4OIKA 4IUTA 2KEDA 3QO2A 1AZQA 1ZXTA 1U4LA 1QNKA 2RSOA 1EL0A 2L11A 4LMQD 3DEPA 2XIWA 1BNZA 2MGSA 3HP3A 4UAIA 1X3QA 2NYZD 1WTOA 1RTNA 4ZK9B 2B2YC 4RWSC 1IKLA 1QG7A 2L1BA 2MJ8A 3G7LA 1WVLA 2B2VC 1S4ZA 1HFGA 1BO0A 2RA4A 1LV9A 2SDFA 2K01A 1RHPA 1B4OA 2X6GA 1WTQA 3MWYW 4XT3B 1AZPA 1M8AA 1BF4A 4X3UA 2EPBA 2MP1A 4RA8A 2KUMA 2X69A 1HA6A 4R9WA 3I90A 1DOLA 3I8ZA 4IURA 5EPJA 1DOMA 2EOTA 1PFNA 3LWEA 2KEEA 2K03A 2EE1A 4O42A 2BDNA 5EJWA 1G2SA 2FINB 5CMDA 2DY7A 1WTXA 1JE4A 1F9RA 4IUVA 3FDTA 5E4WC 1J9OA 4XDXA 3Q6SA 1WD0A 3F2UA 1G2TA 1G91A 1G6ZA 2L9HA 3IL8A 1WTWA 1KNEA 2CVRA 5CBEE 2RVLA 1MI2A 1ML0D 2HDMA 5JJZA 2H1EA 1AP0A 2K05A 1PFBA 3KUPA 4NW2A 5COYA 5EQ0A 1XYIA 1B2TA 2DY8A 2L4NA 2B2UC 2MPMA 3I91A 1DZ1A 1JICA 4ZKBB 2D9UA 1MGSA 5D14A 2FFKB 2Q8TA 2N88A 3I3CA 4R8IA 1GUWA 4X3KA 2FMMA 5CORA 4DN4M 2B2WA 1ESRA 1HUNA 1EIGA 1B50A 1KNAA 1O7YA 1A15A 1SSOA 5EPKA 2FJ2A 1RJTA 1XX8A 1IKMA 1F9QA 4QUFA 1HRJA 4HCSA 1F9SA 1MSHA 3N52A 1SAPA 4HEDA 4ZLTF 3SVMA 2KECA 3FPUB 2Q8RE 2M2LA 3TZDA 2IL8A 4IUPA 3GV3A 1O80A 2FHTA 2B2TA 1DOKA 5EKIA 1VMPA 1J8IA 2N55A 5CBAE 1NAPA 1ILQA 1IL8A 1QE6A 2JP1A 4QUCA 1WTVA 1C8CA 3DM1A 3UI2A 3R93A 5D65A 1NR4A 2K04A 5AFWA 4MN3A 1PFMA 2K28A 1PDQA 2HCCA 1EOTA 1HHVA 3TN2A 1ICWA 1WTPA 1B3AA 5E4XA 2HDLA 3IFDA 4XT1B 4ZKCB 3GV6A 1EIHA 2KVMA 4OIJA 2VXWA 2B2YA 1U4PA 3ONAB 3D6WA 4RAUC 4U68A 4X3TA 2K1BA 1SDFA 2NZ1D 1O7ZA 2B2VA 2HCIA 4CJ2C 2B2WC 2NWGA 2B2UA 4IUQA 1CA6A 5DNFA 2KOLA 2RSNA 1HFNA 1NR2A 1U4MA 4CJ0B 1F9PA 1HUMA 1PLFA 1B53A 1Q3LA 1NCVA 1RTOA 3H91A 3DEOA 1MSGA 1E0BA 3P7JA 4HAEA 1CM9A 4MHEA 1RODA 4X3SA 3KBXA 5T1GA 3MTSA 2R3ZA 4IUUA 1TVXA
chains in the Genus database with same CATH superfamily
4JV5Q 2B63H 2X6LA 1HR0Q 2KEDA 3HOXB 3SK4A 1M90C 1EL0A 5EBCA 3GTGB 3UE1A 5C44G 4H02A 5CC4A 4LK1C 3TQYA 3VYRA 2R61A 1OXUA 3AYHB 1RF2D 3PUWA 4A3MG 3HRZC 3VR4A 4IO9A 3S2DH 2WP8J 4LF4Q 2CH4W 3KDFA 4JI3Q 1RKNA 4AH6A 4DV2Q 3QWNA 1GUTA 1LLRD 3KJOA 1Z47A 3OOCA 4AYBG 4DR3L 5BN4A 1VQCA 1WTXA 1XNQL 1K0RA 3KLWA 1HZCA 4B3ML 3OWFA 3D3RA 1CZGA 4XYQA 3A54A 1G2TA 1D6EC 2Q2HA 2L5TA 1WTWA 1KNEA 4JI6Q 5GROA 2NB0A 3HG9A 3A56A 3A55A 3AFQA 4RKLA 1SE4A 4PZ7A 1FGBD 1AH9A 3A8KE 5M3MB 1OXTA 4A3KG 1WTHA 1CKMA 3ZJYC 4C3HG 2FJ2A 2A19A 1E2WA 1F9QA 5JJIA 1PZID 1L1OB 2AKWB 1GD7A 2VB2X 2E75C 3PF4A 2OF1A 1KRTA 1Q86C 2JQOA 4O1NA 1DOKA 2EXDA 3ND8A 2N55A 1LACA 1X65A 2AMCB 3MFGA 4MZ9A 1KIXA 5AFWA 1V1QA 4K0KL 1BOSA 1EOVA 3CPWA 3FP9A 2EYHA 1PYWD 1TS5A 1W3SA 2MFIA 3E5SA 5K36G 1VQDA 4P73A 2F0QA 3CCLA 2A8VA 2EY5A 1EUJA 5IGFA 2E2DC 5LHY1 1ENFA 5DAUA 3OPOA 5C3WA 2K33A 3HGBA 2KENA 3FEWX 3T1HQ 1UNSA 2CKZB 4MHEA 1RODA 4H7BA 5T1GA 1PH8A 5IYBH 3T1YL 3NBIA 4R4IA 4MNOA 4OIKA 3JAME 3CCRA 3OIQA 2EYOA 4X65Q 1Y8NB 4JC0A 1Z9FA 5HGQA 4K5VA 3RLOA 4YY3L 4LWCA 1XNRL 2NYZD 2YV5A 4ZK9B 4CKEA 5FO9B 3SDZA 4FF2A 2RA4A 1WTQA 4KKUA 2SNSA 3MWYW 5IYCG 1NY4A 2WACA 1JE5A 2PZTA 4R9WA 3I90A 1SBBB 2HT1A 4DV4L 3NSWA 2EJMA 4JI7L 3PO2G 2BDOA 2F0LA 1B7YB 1DGSA 3OSOA 4P74A 1KQSA 2G5DA 3H0GH 1PTOD 3J81c 1YZ6A 1WD0A 2Z6KC 2R92B 1ZYRD 1PTOH 2RF4A 1G91A 4JI4L 2R93B 1CKOA 4LW1A 2PPBC 5IE8A 1AP0A 1HPCA 4A3FB 2DGYA 2DUDA 4IFDH 2A6ED 2MPMA 1IBKL 2ZXOA 5ELEA 1O7LA 1VQBA 2F0MA 1GUWA 2FMMA 2WKCA 4LFAL 1QB5D 1CI3M 1LT6D 1IBLQ 1TIID 3STBD 1J6QA 2NZOA 3CCSA 4C1NK 1E2VA 2N3SA 4BY7G 2JN4A 4LUOA 4LF5L 3S1NB 2IWHA 4QY7A 2KECA 1SNQA 1WCMH 1ZEQX 3ITPA 2Q8IB 4PMWA 3I4NB 1Q46A 1YJ9A 3S14H 3K6OA 4O0AA 4QUCA 5FK9C 3W5OA 1VCIA 1RD9D 3SK8A 3G6JB 1U5KA 1I4PA 2HDLA 3ICEA 2B2YA 4RAUC 2NZ1D 3DLLA 1KDAA 2B2VA 3ZYYX 3GD7A 4FF3A 5I4DA 1NR2A 3JC66 4N8FA 2VZAA 4GNXB 1RIPA 2AHOB 4HCEA 1N36L 1PH6A 1E0BA 3KF8B 1SFOB 1QUQB 4JOIA 2MUYA 3PUVA 1AN8A 1PFSA 1D1IA 1D5MC 3U58A 2AWOA 2CH4A 2AQ1B 4AYBB 1TWGB 4LF4L 3S16B 5IGBA 1VQMA 4M1UB 2K5WA 4JI3L 3GTJH 2PQEA 3F1ZA 3TP6A 4FF1A 3EROA 4LMQD 3R8BA 3C46A 2FXQA 1EFID 3BVGA 3GTPH 5C4JB 3PO3G 3EVQA 4BY1H 1QJOA 3H3VI 2KCTA 2A1AA 1DM0B 2XGTA 2ZTCA 4NB3A 4X3UA 4F87A 2JE6I 2F0IA 3GP7A 3HOYB 1NMFA 1ET9A 4C3HB 4DR2Q 4QJFA 1HR0W 5ELCA 5ELDA 4KHPQ 2JA5G 3KBGA 2EE1A 2F0VA 2JA7H 2AQ2B 4C2MB 3ULPA 1JB3A 1PTOC 1N34Q 2I5MX 3AQQA 3BYYB 4FO2A 2H1EA 3OTOQ 1XMOQ 1H9MA 2L4NA 4GN3B 4I65A 1DZ1A 4YCVA 5D14A 2F3WA 4BXXG 1LABA 2A6EC 4TQUS 3OW2A 2CW0D 4PZ8A 1K8GA 4DFAA 1K73C 4JOIC 3X3NA 4EVOA 1JR0D 4ZYSA 4YHHQ 3NQIA 1R9TH 4MTKA 1F77A 4PNYA 3URYA 4R4OA 3STBC 3F2CA 4A3DG 3O13A 1DJRD 3J80E 1EWCA 2PO4A 1NAPA 4P2CB 4A3EG 1TKWB 5D65A 2K04A 3C1EA 3DUZA 2HCCA 2VB3X 4CDCC 1S5DD 4HMJA 2ASBA 4A3BG 5KNCA 4XQNA 5EKIA 4C3IH 4A3JB 4KY7A 2PQAA 4GOPB 4XXEA 4WJWA 2B2WC 3A8IE 5FLXE 1K3BC 1F9PA 5C3XA 4N8X1 3S9WA 1CTMA 1B44D 1I94Q 1SLJA 3PMFA 2Z9HA 1H9RA 4ZCKA 1X32A 2E74C 2F0TA 3PO2B 3S24A 1V9PA 1T5EA 2IPKD 1CA5A 4ZAIA 1Q90A 1QNKA 1JOOA 2L11A 3I4LA 3HOWG 3HOVG 2ALYB 3HP3A 1A3UA 1S5BD 4OWXB 3JAMc 1X3QA 4CDEC 3P75A 1RTNA 2JXMB 2L1BA 1I4RA 4XTCS 4HIOA 1HZ9A 2A69D 3CPFA 4CKCA 1EY0A 4YCUA 4HJAA 1EFWA 4GN4B 1AZPA 3QJYA 4K2KA 4RA8A 2ID0A 2KUMA 3PSIA 4DKAC 2EOTA 4Y52H 2IX3A 3C2PA 3HOZH 4DF7A 4BY7B 5KIXA 3TEHB 3SGIA 1HNWL 1UE7A 3CCMA 1ZKOA 1KL9A 1OXSC 5KRUA 3TRZA 3S1MB 1YITA 4HJ5A 4RMFA 3MZ5A 1PFBA 2LXJA 2H5XA 3MA2B 1I50H 4CGYB 1JICA 1VQFA 3D6CA 3PV0A 4UP9A 5IT9E 2C5CA 2ES2A 4WJ4A 5CV7A 4CKBA 3V96A 1HTPA 1A15A 3CCUA 1IKMA 3H6MA 2I5HA 4X6AH 5C4ZA 5C3EG 2CW0C 3CAMA 1MSHA 4HCSA 4L5QA 3CCVA 4DK3C 2JK8A 1I3QH 2XN9C 3HOXG 3FKIB 3GTOB 4LFCQ 5IGGA 1T5XD 2IL8A 4NXMQ 4JI8Q 4BBSG 4ODGA 1WTVA 2B39A 2JP1A 1X56A 1KDBA 2UUAQ 4ABNA 2VUMH 1BKBA 3S2HB 5M3FB 5E4XA 5BR8Q 2K7VA 2Z1CA 3D6WA 2HCIA 4DV7Q 4AIMA 3K0YA 3SHLA 3PO3B 3W1GA 5FOBB 2GVAA 2XRQD 4LUVA 1TWAB 4ZUIA 3NWSA 4C56C 4HAEA 1HZBA 2F3VA 1P16A 3ND9A 1C4QA 5IGEA 1PTOF 1SNOA 5M5YB 4DUYQ 4AYBE 2JA6G 4CJ1B 2JA5B 1VMCA 1WD1A 2I5LX 4K8JA 3I2ZA 1VF5C 2L12A 4X66L 3K80C 4IUTA 4UP7A 2F4VL 2HIXA 4H44C 2QKIC 3HOUH 2EIFA 2UXBQ 1JORA 1BCPB 4B3TQ 3RUZA 2EY6A 3PIP3 4C3JG 4JI5Q 1JJCB 4XT3B 4JBMA 5FJ8G 5IP7H 1N34L 2A69C 2F1MA 2K14A 1VQ8A 1DOLA 1KHIA 3OTOL 3GQBA 4KHZA 1GJXA 1PRTB 1EU4A 3CW2C 1FJGQ 1DD2A 5CMDA 2VQFQ 2DY7A 4A3GG 4EQ5A 3PIO3 3E0JA 4DAYA 3OW7A 3IL8A 3TMEA 4EGVA 1E2ZA 1MI2A 3M7GA 1W6KA 2HDMA 4A3EB 2K05A 4NW2A 2JSOA 1Y1VH 2UXCQ 4DV1L 2FFKB 1QOHA 2I07B 4ME3A 2B29A 4Z9CB 4L63B 3T4AC 1VQ5A 1STHA 4RGMA 1GHJA 2IHFA 1XPRA 4ZLTF 5LMNQ 1EY4A 3MHBA 1J5EQ 2M2LA 4JI2L 1N33L 1CT1D 3GTQB 3S1QB 3QIAA 1VMPA 1SEBD 4NDXA 1PVOA 1PYBA 3UDFA 1Q82C 2EYFA 2QEXA 1N32L 3K0XA 4MN3A 3T13A 2F0HA 3J80c 1I94L 4PG3A 1UAPA 3NTIA 3M4OH 2VXWA 2IT1A 3HOVB 4S3SA 4L6TB 1A6XA 1X55A 3OWEB 1CQVA 5H1SE 3NBHB 2XNAC 3NP8A 5DNFA 2EJFC 4DAVA 4KMUC 4CJ0B 3Q23A 1IZ6A 3L0OA 2CHBD 2R92G 1JT8A 4DNTB 2ZT9C 5FLXc 2R93G 1CKNB 3G4SA 2K5VA 1XXGA 1YNND 5EPLA 4A3FG 1DONA 1PH5A 1B9NA 2XVSA 1K3RA 1VQIA 2PI2E 1F2LA 3SE0A 3Q24A 3P20A 3RMHA 3CF5A 4B3RQ 3AMUA 3DWPA 4YIJA 1ENAA 4HIKA 5ISRA 1S72A 1L1OC 1B1ZA 3L2PA 4BWGB 2F0SA 3G7LA 3RZOB 1JQYD 1S4ZA 5I2XA 2VY3A 3ULLA 3KLRA 2H4OA 3I4NG 3KLSX 1LYLA 1TY0A 3TREA 4LF6Q 3PQIA 3PCOB 4NXNQ 5C4XB 1U0LA 1EZ8A 2BH8A 3CHBD 1EIFA 2EYMA 3DWAA 4DXFA 1C9OA 3NEMA 2K5HA 5C3EB 4O42A 1KAWA 1I6VC 1G2SA 2IY5B 1G8ZD 1PZJD 3PGZA 5C44H 2HQEA 2PW5A 2NUCA 4BBSB 3RZDH 1G6ZA 4A3MH 1I4HA 2CVRA 2V4DA 1ML0D 2WKDA 1STBA 5EQ0A 4DR1Q 3SK6A 2DY8A 3MXNA 1X3EA 4OWTB 4QIWE 2YU9H 5GAEC 4NXML 2YTVA 2ZM6Q 3I4MG 2N88A 1G6PA 4IOCA 1LTID 1WJJA 1A2TA 3GTKB 3ERSX 1CFMA 2F0NA 5IT9c 2F0UA 1YVCA 2D5DA 1HRJA 5LL6X 1IXRA 3N52A 5TSSA 1CK1A 4CHTB 4YWMA 3W2DA 1N9WA 4XYOA 4DUZL 2O5JC 5C4JH 1HTLD 2FHTA 3C1FA 2JA6B 1LT4D 1IL8A 1WI5A 2NN6G 5KYLA 3CQZB 1IBMQ 1YI2A 3T51B 4A3KH 4BBRB 4ALPA 4RG1A 4DR5Q 1SE3A 2HQLA 4C3HH 3A5ZB 1B3AA 1DYQA 3BU2A 3HOYG 1YHAA 1O78A 4DUYL 1XTCD 2NVXB 1E3PA 1S5ED 2KOLA 4C2MH 1FNWA 1HFNA 4C3JB 1ASYA 2LKVA 4RFBA 4OO1I 1NBWA 1BBWA 2UXBL 3CXCA 5EKKA 3RN2A 5M5XH 1BDOA 1Q8IA 2SEBD 1VQ6A 5AJ3L 2BA1A 4IN3A 2B2TC 4JI5L 5DEHA 2C9OA 4F88A 2Z6KA 3IFTA 3TSSA 1ILPA 5GAGC 3GTLB 2QDBA 4A3GB 4HSVA 1YNNC 5EAYA 2Y0SG 5ELFA 4LF9Q 1KTKA 2UUBQ 2KHIA 2JA8B 1SYGA 5G3LD 4GS3A 1WOCA 4K6DA 3K7AH 4P75A 1FYCA 3GTMB 4WJ3M 4DV6L 4A93B 2JEAI 1SNMA 3Q0AA 2F4IA 3CC4A 1L0WA 1K8MA 4A3IG 3BZKA 4H0LC 1I4QA 1PFNA 2VQEL 2UXCL 3TBIB 5I6YA 4DR6Q 5E4WC 4XDXA 4FXGC 2AQ3B 3I4OA 2RDHA 4A3JG 2EJGC 2K75A 3NWTA 4BA2I 3NXWA 1O7IA 5IYCH 3CRKC 1NNXA 2F0JA 4DV3L 3FVQA 4GNXC 3PF5A 1J5EL 3BG3A 1X3GA 1JJGA 3F8TA 2LMCB 5JVH3 3PO2H 2NN6I 4DN4M 1N8RC 4OHJA 3VA7A 1TWCH 1PXUA 3PIPA 3D4RA 2YYZA 4EX5A 3H3VH 5EBDA 1VQNA 4CDDC 5IYDH 1HNXL 4IOAA 3M4YA 3J7A5 1JOKA 2BCOA 4O2DA 1HZAA 3J81j 2ZXPA 3UI2A 3PIOA 2E2IB 4Y7NB 1A63A 3N6RA 4KD3A 3OMGA 5M5WB 1SNDA 4B3SQ 3C3LA 4JBWA 2CCZA 2R6GA 4BY7H 3ONAB 1SDFA 2K4KA 1U9RA 5LMNW 3T56B 2B2UA 4IUQA 4G7HC 2K32A 1U4MA 4B3RL 1NTGA 2CWAA 4LFBL 1E22A 1MSGA 4WORA 1CZWA 3KBXA 1TVXA 1EYGA 4G57A 4IFDG 3UDIA 2Q2TA 2QILA 3A7LA 4R1JA 3D0FA 2J7ZA 3KDFB 2K5QA 2GVBA 1C48A 2P5ZX 4QGUA 5C0XG 2OXPA 1LT3D 1ZXTA 1YJNA 3NPPA 3MC0B 2JEBI 4KV6A 5CV4A 4JV5L 2J4XA 2XIWA 1EYAA 5FLMG 2EDGA 1HR0L 2A73B 1I6HB 3S17B 1YJWA 2MJ8A 1TWFB 2IX0A 4LUZA 2N49A 2NBFA 2BH2A 3M3YH 3FKIG 1TWHH 2SDFA 1LO5D 3I4MB 3VYTA 5C4HA 1UUPA 1BF4A 3FPPA 5J3BA 1HXYD 2GN5A 2DNCA 4FF4A 2OTLA 2A6HD 4HIMA 2RHSB 5C0XJ 4Q5VA 2J0TD 2K03A 5EJWA 5L37A 5M3FG 5A35A 4DV2L 1QZHA 1QZGA 3BZCA 3PUYA 5ELBA 2FMCA 4GOPC 3PO3H 2XSCA 5KNBA 1PH2A 2Z6BA 3S2DB 4KJNA 2K5DA 1XMQQ 2B2UC 2KCMA 3I91A 4YCWA 3EA6A 1AW7A 2O4XA 3TS2A 4JI6L 3D4WA 5JEAG 2JA5H 2B2WA 2HHHQ 2LS01 3EBEA 3HKZG 3Q22A 1BBUA 1IBML 3BVZA 2O2LD 4J15A 1E7ZA 3RLFA 3T16A 1E1TA 3M85A 1BCPD 3KF6A 4B9WA 1A0IA 3H3VC 3TZDA 3R2TA 1KABA 3E0EA 1H9SA 1K83B 2PNHA 4ME5A 3GO5A 1SJHD 4UP8A 2BOSA 1LUZA 3AU7A 1ZYRC 4F8MA 2R7ZG 5BN3A 2WAQG 4X64Q 3J80L 3K59A 4GKJQ 1PRTD 2Y0SB 4FP5D 2NTSA 5LMUQ 1WTPA 1D2BA 3J7AV 4ZKCB 2A5HA 1MBYA 4ID6A 4U673 5DLQE 3B6YA 4A3DH 5C0XI 3L9AX 1UWVA 4JYAQ 3E6ZX 1VS0A 3UE0A 3G71A 1Z7TA 2RDGA 2QDLA 1PH4A 3LX0A 4A3EH 3H15A 1NJIC 4KD4A 4A3IB 3S15B 4JW0A 1GUOA 4A3BH 4JBJA 2IJ0A 4GLAC 3X3MA 1EQTA 1U4RA 4QQBX 3T1HL 1YNXA 5K5PA 4IPHA 3D4DA 1UE5A 1AZQA 1LTRD 3QO2A 1V1OA 2F0KA 5M9OA 1OXXK 1QVCA 2MGSA 4NMZA 2F0DA 1JWMD 3I73A 4K6LA 2F0GA 4DK0A 5JOBA 3CD6A 3GTQH 3S1QH 3WOEA 4X65L 2DJFC 3MVVA 3BJUA 4PMCA 2X69A 3PUXA 1KDCA 1DOMA 2VS1A 1TY2A 2CQAA 4RKBA 3AEVA 3HOWH 4YWKA 4WFN3 1YIJA 2A6HC 1D5XC 1JE4A 1SYDA 4R4QA 4K14A 4Q0FA 2F0PA 3K7UC 3NQTA 3M4QA 3KUPA 1JJ2A 4A3LG 3NHHA 4ZKBB 1MGSA 1K8AC 1YHBA 1GUGA 2QF7A 3NE5B 4JBKA 5IT9L 1VQLA 3CMAA 4DV0Q 1YNJD 1VQ7A 2ZJRA 3CRLC 3QB3A 3HFZB 1NE3A 2OQKA 5I2YA 1IYVA 1WYDA 1QWYA 1PHJA 1EYCA 1A62A 1SNPA 5A2QE 3VR2A 5FO8B 1IBLL 1SYEA 2NVTH 1BCPC 1J8IA 1K28A 1VQHA 2MO1A 3AB9A 4R4CA 5G3LF 5KNDA 4DR7Q 2MHVA 2DNEA 4TRDA 1H95A 4QMGA 1ICFB 5KYIA 1SMYD 4DV5Q 3IFDA 4L8JA 5FKAC 1Y1WG 5C4XG 5HY6A 1U4PA 1ONLA 1PRTC 2F0WA 3HOXH 1H9KA 1FR3A 2NWGA 1WCMB 2D0PA 1KRSA 2GA4B 3LGJA 1A2UA 4ZUJA 3GTGH 2PZUA 3U50C 3S14B 1NCVA 3NK9A 3OIPA 4KI0A 3HKSA 1MJEA 2N78A 2R3ZA 4HJ7A 1A3TA 3DXJC 3MAQA 4KLKA 4KJOA 1W2BA 2NVQB 3TDQA 2ICIA 1TXYA 3G6EA 1IHZA 1UEAB 1Q1EA 3KJPA 2E5LQ 4KTAA 4FVMA 2CQOA 4UAIA 4L5SA 2KA7A 1V1PA 1QG7A 1WVLA 1M4VA 2JA6H 2YTXA 3CQZH 3RN5A 4DNRB 3BDOA 3HKZB 1S5CD 4JI1Q 1XMQL 5M3MH 2VUMG 1Z6HA 1VF7A 4BBRG 2KEEA 3GTJB 2HIVA 3V05A 4L5TA 4DR2L 2B3GA 1PYSB 2WB1G 5JVG3 4KHPL 3GTPB 4BY1B 1Q8KA 1SN8A 1SXTA 4GN5A 2R7ZB 4KN7C 2WAQB 1XYIA 4G7ZC 4X3KA 2K6AA 2QEJC 1OO9B 1UE1A 1XMOL 1FL0A 4I7ZC 5CR3A 4JK1C 1YBYA 4X64L 4A3CH 3J81L 1TS2A 2WFWA 1SYCA 1YNJC 3IRBA 4J1MA 1QILA 2PQAB 3HOUG 4K0KQ 4GLVB 1EEID 2JA8G 4YHHL 1Q7YC 4JPBW 4EQNA 2K50A 1ILQA 2Y0SE 3MXGA 4QF4A 2N8NA 5CV6A 4A93G 1VQEA 2K28A 5CYUA 1EY5A 1SROA 5IP9H 3CC7A 3ERQA 4LF7Q 2A74C 1L1OA 1CSQA 3MEHA 4DNIA 2IHEA 3FRPB 4DPGA 1PMRA 3K5LA 5D3IB 5DM63 4BS9A 1SMYC 1EY8A 1AE3A 4JG2A 1SYBA 2IX1A 3K5NA 3AFPA 3RLNA 2ZTDA 1PLFA 4XIGS 1B53A 1RTOA 4K5WA 4DK6C 3T1YQ 2EYPA 3H91A 1PV4A 4IJLA 2UUCQ 1D5ZC 1WTRA 1BBXC 1XNRQ 1IL2A 3U4VA 4IQZA 3J7ZC 2XRSD 3K5OA 4QB4A 1VQKA 2XTIA 1Y14B 2R92H 2KCCA 2F3IA 2R93H 3QOJA 1K0SA 1PH7A 2VL6A 1LV9A 2L0CA 4DV4Q 3VR5A 4A3FH 4JI7Q 5JJKA 1BCPF 4P72A 3UDGA 4RGNA 2E76C 1JC7A 1BXTA 4JI4Q 1V43A 2BDNA 1STNA 1C7YA 4OO1H 2ZJQA 2BE5D 2D0OA 2ENBA 4OL7A 4X62Q 4HJ9A 3VDYA 1IBKQ 3S1NH 2RVLA 3EJIA 1ASZA 1I4XA 1E1OA 3RNUA 3I4NH 1HQRD 5COYA 3OHXC 1B2TA 1D7QA 3R2IA 1Y1WB 3KOJA 3S1RB 3HOZB 3D31A 3KLSA 4XQJA 2KCNA 1KNAA 1WFQA 2TSSA 3EFXD 4KK7A 4FYDA 2EVBA 4TKOB 4K8IA 2KBNA 3QOLA 4R4TA 5HURA 1B3QA 1TWFH 2I0QA 1HA5A 1EY9A 2B2TA 2CFMA 5C5MA 3I4MH 1QE6A 1HCZA 1SFOH 3BDCA 4LFCL 4ZRZA 3R93A 1FNUA 2KJXA 4JI8L 5D3DA 2E2HB 1TWGH 4LJZC 3S16H 4LF8Q 2B63G 4EQOA 1N36Q 2KHSA 2UUAL 3GDEA 4CJ2C 1I3QB 1V8QA 3SR1A 4DU9A 5FO7B 5BR8L 1SRUA 1S5FD 2E5LL 3V2TA 2NN6H 1IYUA 4DV7L 2KHJA 1I5FA 3NTKA 1L2FA 4DGZA 2VUMB 1VQGA 3HOYH 1LTTD 2JA9A 3FHWA 1T9HA 2JYOA 5T1IA 4N9TA 1IW7D 4KKTA 4RCNA 3DM3A 1MJCA 2WB1B 4JI1L 1VQPA 2PW7A 4ZQ3A 4GNXA 5IWAQ 4FXDA 3KF8A 2NVYB 1K83H 2M00A 1G291 1QUQA 4DAYB 2MQHA 4H13C 1B4OA 3HKZE 4FXKC 5HGTA 1M8AA 5CV9A 4B3TL 2EPBA 2MP1A 3EIVA 4KY5A 1HA6A 1STGA 3HEJA 4IURA 2DN8A 4LNQA 1X54A 2OQ0A 2Z8LA 5K36H 3CU7A 1S40A 3P1HA 2M9VA 5IODA 4NKLA 4KKSA 3Q8DA 1F9RA 1MHWC 3U9OA 3HOUB 1J9OA 3JAML 1GVPA 3OYYA 1D1KA 2JJQA 2WAQE 1BR9A 5JPMC 5KGUA 2BE5C 1FJGL 2VQFL 1KLUD 4HSPA 4TSSA 4DAMA 1VDZA 4UHVA 2WIIB 4A3IH 3H09A 3S15H 3W3AA 3BDLA 2Q8TA 3I3CA 4M8AA 5CORA 5ELOA 3CCEA 1GKHA 1ESFA 1EIGA 2WINB 5NUCA 2YTYA 1YHQA 3I55A 1UE6A 4KN4C 2EQSA 4A3JH 4HEDA 3M9BA 1MIUA 4LF7L 2L15A 1MKHA 4OGQC 4OWWB 4IUPA 1SYFA 2XWJB 1Y1VB 5F2DA 5LMNL 5CV5A 3OMCA 3BVMA 5GAHC 1PDQA 5IYBG 1EOTA 1QVGA 1RDPD 4XT1B 2UUCL 3U9SA 1GO3E 2AUKA 1FVIA 2R7DA 1EWIA 2F0FA 4HTHA 1JB7A 1CHQD 4POGA 3FMCA 1NMGA 3RD4A 4R8NA 4JVZA 2QGQA 1AFPA 4OEMB 5KEEA 1SNCA 3I7FA 2TMPA 3MTSA 4LAAA 3GV6A 4DA2A 5ELNA 3A5UA 3LNNA 3CCQA 3A8JE 4E6IA 4F7XA 4GOPA 3M4OB 1X3PA 4OELB 3E9IA 1KLGD 4HN7A 1IW7C 1EYDA 2B8GA 1VQOA 1AEXA 1GXDC 3H0GG 1LTBD 3S1MH 5IYDG 4NPSA 1BO0A 4X62L 2D2CC 2Q2IA 3EQLC 3JAMi 1X9NA 2RCNA 2CWPA 2K5NA 4J6HA 3MXNB 3I8ZA 3M7NA 4OX9Q 1HNWQ 5C0XH 4IPDA 1KC8C 3F2BA 2PI2A 1KXLA 2L55A 3CC2A 1X3FA 1XPUA 4IALA 4LF6L 4YWLA 1TR5A 4NXNL 5FLMH 3UDXA 2E2JB 4HJ8A 1HJPA 3FKIH 2L9HA 1GUNA 3GTOH 4GKKQ 2F03A 5CBEE 1WCMG 3E3XA 3SEBA 3BZDB 1F2ZA 2D9UA 4BA1I 4IFDJ 2Z4IA 5IOCA 2NVQH 2EYLA 1ESRA 4DR1L 2B63B 1HUNA 3S2HH 5IGCA 4JCVE 5M3FH 1DCZA 4WRDA 5EPKA 1KD1C 1GUSA 2ZM6L 1XX8A 3IAYA 5C44B 4CBVA 2RQXA 3RZDB 3KYHC 4A3MB 4LF8L 3R3OA 3KK7A 2PMZB 1TWAH 4DR4Q 1E24A 1D8LA 3E9HA 3CP0A 5CBAE 2YU9B 5JEAH 3VYSA 4UPAA 5M5YH 3J7YW 3TS0A 2Z4HA 2PZWA 4MTNA 1GM5A 2KVMA 4DAPA 3K8AA 4HIDA 1O7ZA 4DR5L 3MXUA 4HMIA 1NUCA 5I9PA 1UEBA 1EWHA 4HR7B 1Q3LA 3J7AF 2EYJA 4RGOS 2R7ZH 5IWAL 4X66Q 1LTGD 4BY1G 4A3KB 4BXXH 1HNZQ 1AE2A 2F4VQ 1F2YA 5JEAJ 2WB1E 4IFDI 3VYUA 2UXDQ 2ZTEA 2BA0A 2EXZA 2VW9A 2O5IC 1BNZA 2JA7G 1L0XB 4PV1C 1CSPA 5BN5A 1WTOA 5IGDA 4LF9L 2B2YC 2UUBL 5C6AA 1JCKB 1Y69U 2B2VC 5FLXL 5M5XB 2X6GA 1CQFA 4QL5A 3WDNA 1SR3A 5E1FA 1OTCA 1SE8A 1EY6A 2SOBA 2VNUD 1II3A 1STYA 3A7AB 2KQ3A 4RH6A 1M1KC 3FDTA 4G7OC 3Q6SA 4FDBA 2LFNA 3F2UA 3K7AB 4JI0Q 4DV1Q 1W6JA 1X6OA 4IUNA 4DR6L 4CDFC 4PMBA 4IZ8A 2Q2UA 2C35B 2QW7A 1Y8OB 3SK5A 3L3OC 2UU9Q 2B8FA 5EKLA 1B50A 4AQYQ 4JI2Q 1N33Q 3SXHA 3NUCA 1RJTA 1EQQA 3VR3A 1TS3A 3HOVH 4C3IG 1TT2A 1LTAD 1K9MC 1GOZA 1L0YB 3FPUB 3DWQA 3DMUA 2Q8RE 3NTHA 1EQVA 1N32Q 3L7ZC 4N9PA 1BVSA 4A3LH 3LWUA 1B9MA 5A2QL 3ER0A 1NSNS 2RDFA 4RGTA 1C8CA 1ET6A 3DM1A 1CUKA 3DHQA 1VQAA 5CV8A 1PFMA 2PNRC 3TN2A 1ICWA 1TWCB 1YEZA 1JWUD 1XJVA 3KFUA 5EGTA 4MIUA 2ZJPA 4X3TA 2K1BA 1C0AA 1FD7D 3H0GB 3J80i 4B3SL 1PTOB 3H94A 4V190 1CA6A 1KAAA 2NTTA 3RR5A 2F0OA 2EY1A 3RZOH 3QR8A 2WV6D 3P7JA 2LSSA 5GADC 5JPNC 4IUUA 1IYJB 5C4XH 3BS1A 1Y1WH 2HUGA 3S1RH 4G4KA 4P71A 2E8GA 3A0JA 1HH2P 1P8LA 1XWEA 3NBHA 5C3EH 3HOZG 2RSOA 4OX9L 2SNMA 2ICEC 2F52A 2EY2A 5J39A 1Q1BA 2QCPX 4RWSC 4BBSH 3W1BA 1IKLA 1CKNA 2EZVA 4C1NI 1HFGA 1EU3A 2K01A 5I6WA 4I7AA 4GKKL 3TP7A 4QIWB 2OTJA 4J8QA 1LTSD 4L5RC 1SMXA 1PH1A 2RKSA 3K58A 2IW3A 1XPOA 3LWEA 2D62A 2E2HH 3GTKH 1PH9A 3K57A 4A75A 1EQRA 4KY6A 4PZ6A 1GHKA 3MEFA 4B08A 1LT5D 4V0BA 4ULLA 3M3YB 4K2LA 3KF6B 1TWHB 1TQOA 3CMEA 4XQQA 1H9SB 4NP5A 5J1ZA 2RHQB 4B9XA 1S3OA 4DR3Q 1XNQQ 4BBRH 4DR4L 4EQPA 2DJGC 4B3MQ 4IJHA 5DM73 4DUZQ 5LL6S 1LTLA 2NVXH 1VQ4A 1F9SA 1SAPA 1PH3A 2HHHL 1XTDA 3CCJA 1RL2A 1PZKD 2HD3A 2PMZE 2RBMA 4PQXA 2MNAA 2NVYH 4C3JH 3GV3A 4DXGA 1FGUA 4RHSA 5FJ8H 1TS4A 3MXPA 5JJLA 1EY7A 3G48A 3VR6A 3K81C 5IIFA 2OCEA 2MO0A 3T53B 5M3MG 5JAVA 4OIJA 3GTLH 4A3GH 1HNZL 2JA7B 4U68A 4POFA 4GKJL 1G51A 1JWSD 5LMUL 4GZYC 3PUZA 2JA8H 4K5XA 2RSNA 2UXDL 2LY7A 1RCVD 3I70A 1A8VA 2A68D 5AJ3Q 3GTMH 3VA5A 3I72A 1CM9A 4A93H 1HQMC 4JYAL 1OXVA 1EEFD 1BQQT 4RCOA 5I9OA 2PCFB 1SJED 4GLXA 2ZXRA 5IP7G 2K52A 1B8AA 3D8GA 3ULJA 1U4LA 3CKIB 1LM0A 2I46A 4A3DB 1R9TB 2Z0SA 4APVA 1K8OA 3DEPA 4DV6Q 4A3CG 2ATWA 2V1CC 2RCFA 5C5LA 3NENA 4QCLA 1ENCA 3BYTB 4TVAB 1JOQA 2QA4A 1RHPA 1H9JA 2OEOA 2AUJD 2VQEQ 4JI0L 4A3BB 1F2MA 3NELA 1JMCA 1Y1VG 2OT2A 2R7FA 1FNVA 3HS0C 5EPJA 4DK1A 3J81E 4YY3Q 5IP9G 1SE2A 4UDUC 1Q12A 4C3IB 1R4QB 2FINB 4OONA 1R4PB 4IUVA 2UU9L 1EIYB 1BUVT 4DV3Q 4AQYL 3F2DA 3I56A 1PA6A 1MD2D 1TU2B 3M4PA 4RHRA 5JJZA 1CHPD 3A74A 3EN2A 5IY0A 2F0EA 4R8IA 2E2IH 1DXMA 4Y7NH 3WOFA 1QVFA 3HOWB 5M5WH 1QNUA 1O7YA 1HNXQ 4IPCA 1SSOA 3QG1A 4UY8C 4QUFA 3TZUA 2G9HD 3SVMA 3TP8A 4DV0L 2AWNA 1PRTF 5GQOA 5CGKA 2NZHA 1EZ6A 1O80A 2XWBB 4A4IA 4OXPA 5J22A 1I4GA 4LFAQ 1VQ9A 4KHVA 3J81i 1NR4A 3WWVA 1STEA 2G9DA 1HHVA 4LF5Q 4ILWA 4FNFA 3U4ZA 1EIHA 4LFBQ 1STAA 1VQJA 4DR7L 1B70B 1Y8PB 4OO1G 2E2JH 1A3VA 1QCBD 4DV5L 1Q81C 2PYKA 3TP5A 2NVTB 5E7NA 1I6HH 1HUMA 3S17H 3K5MA 3IKJA 3HZXA 2LXKA 3DEOA 1V1PB 1I50B 5E3FA 4IPGA 4X3SA 2OWOA 3MFYA 2A68C 4A76A
chains in the Genus database with same CATH topology
2X6LA 2KEDA 3HOXB 3SK4A 1EL0A 5EBCA 3GTGB 5CC4A 4LK1C 3VYRA 2R61A 1OXUA 1RF2D 3PUWA 3HRZC 3VR4A 2WP8J 1RKNA 3QWNA 1GUTA 1LLRD 1Z47A 3OOCA 1WTXA 5BN4A 3OWFA 3D3RA 1CZGA 4XYQA 3A54A 1G2TA 1D6EC 2L5TA 1WTWA 1KNEA 2NB0A 3HG9A 3A56A 3A55A 4RKLA 1SE4A 1FGBD 3A8KE 5M3MB 1OXTA 4C3HG 2FJ2A 1E2WA 1F9QA 1PZID 2VB2X 2E75C 2OF1A 4O1NA 1DOKA 3ND8A 2N55A 1LACA 3MFGA 5AFWA 1BOSA 2EYHA 1PYWD 1TS5A 3E5SA 5K36G 2F0QA 2EY5A 5IGFA 2E2DC 5LHY1 1ENFA 5DAUA 3OPOA 5C3WA 2K33A 3HGBA 3FEWX 1UNSA 4MHEA 1RODA 4H7BA 5T1GA 3NBIA 4OIKA 3JAME 3OIQA 2EYOA 1Y8NB 4K5VA 2NYZD 4ZK9B 4CKEA 5FO9B 3SDZA 4FF2A 2RA4A 1WTQA 4KKUA 2SNSA 3MWYW 2WACA 2PZTA 4R9WA 3I90A 1SBBB 3NSWA 2EJMA 2BDOA 2F0LA 3OSOA 1PTOD 1WD0A 2R92B 1ZYRD 1PTOH 1G91A 2R93B 2PPBC 1AP0A 1HPCA 4A3FB 4IFDH 2A6ED 2MPMA 2ZXOA 5ELEA 1O7LA 2F0MA 1GUWA 2FMMA 2WKCA 1QB5D 1CI3M 1LT6D 1TIID 4C1NK 1E2VA 3S1NB 2IWHA 2KECA 1SNQA 1ZEQX 3ITPA 2Q8IB 4PMWA 3I4NB 3K6OA 4QUCA 5FK9C 1VCIA 1RD9D 3SK8A 3G6JB 1I4PA 2HDLA 2B2YA 4RAUC 2NZ1D 1KDAA 2B2VA 3ZYYX 3GD7A 4FF3A 5I4DA 1NR2A 4HCEA 1E0BA 1SFOB 2MUYA 3PUVA 1AN8A 1D1IA 1D5MC 2AWOA 2AQ1B 4AYBB 1TWGB 3S16B 5IGBA 4M1UB 2K5WA 2PQEA 3TP6A 4FF1A 3EROA 4LMQD 3R8BA 3C46A 1EFID 3BVGA 5C4JB 3EVQA 1QJOA 1DM0B 4X3UA 4F87A 3HOYB 2JE6I 2F0IA 3GP7A 1ET9A 4C3HB 5ELCA 5ELDA 3KBGA 2EE1A 2F0VA 2AQ2B 4C2MB 1JB3A 1PTOC 3BYYB 4FO2A 2H1EA 1H9MA 2L4NA 4I65A 1DZ1A 5D14A 2F3WA 1LABA 2A6EC 4TQUS 2CW0D 4DFAA 3X3NA 4EVOA 1JR0D 4ZYSA 3NQIA 1F77A 4PNYA 3URYA 3O13A 1DJRD 3J80E 1EWCA 2PO4A 1NAPA 4P2CB 1TKWB 5D65A 2K04A 3C1EA 3DUZA 2HCCA 2VB3X 1S5DD 4HMJA 5KNCA 4XQNA 5EKIA 4A3JB 4KY7A 4XXEA 4WJWA 2B2WC 3A8IE 5FLXE 1F9PA 5C3XA 3S9WA 1CTMA 1B44D 3PMFA 1H9RA 1X32A 2E74C 2F0TA 3PO2B 1T5EA 2IPKD 1CA5A 4ZAIA 1Q90A 1QNKA 1JOOA 2L11A 3I4LA 3HP3A 1A3UA 1S5BD 1X3QA 3P75A 1RTNA 2JXMB 2L1BA 1I4RA 4XTCS 4CKCA 2A69D 1EY0A 1AZPA 3QJYA 4K2KA 4RA8A 2ID0A 2KUMA 2EOTA 2IX3A 3C2PA 4DF7A 4BY7B 5KIXA 1ZKOA 1OXSC 5KRUA 3S1MB 3MZ5A 1PFBA 3MA2B 4CGYB 1JICA 3D6CA 3PV0A 5IT9E 2C5CA 5CV7A 4CKBA 3V96A 1HTPA 1A15A 1IKMA 3H6MA 5C4ZA 2CW0C 4HCSA 1MSHA 2XN9C 3FKIB 3GTOB 5IGGA 1T5XD 2IL8A 4ODGA 1WTVA 2B39A 2JP1A 1KDBA 4ABNA 3S2HB 5M3FB 5E4XA 2K7VA 2Z1CA 3D6WA 2HCIA 3K0YA 3SHLA 3PO3B 5FOBB 2XRQD 1TWAB 4ZUIA 3NWSA 4C56C 4HAEA 3ND9A 2F3VA 1C4QA 5IGEA 1PTOF 1SNOA 5M5YB 4CJ1B 2JA5B 1VMCA 1WD1A 4K8JA 1VF5C 2L12A 4IUTA 4H44C 2QKIC 1JORA 1BCPB 3RUZA 2EY6A 3PIP3 4C3JG 4XT3B 2A69C 2F1MA 1DOLA 3GQBA 4KHZA 1GJXA 1PRTB 1EU4A 1DD2A 5CMDA 2DY7A 3PIO3 3E0JA 4DAYA 3OW7A 3IL8A 3TMEA 4EGVA 1E2ZA 1MI2A 3M7GA 1W6KA 2HDMA 4A3EB 2K05A 4NW2A 2JSOA 2FFKB 1QOHA 2I07B 4Z9CB 4L63B 3T4AC 1STHA 4RGMA 1GHJA 4ZLTF 1EY4A 3MHBA 2M2LA 1CT1D 3GTQB 3S1QB 3QIAA 1VMPA 1SEBD 4NDXA 2EYFA 4MN3A 3T13A 2F0HA 1UAPA 3NTIA 2VXWA 2IT1A 3HOVB 4S3SA 4L6TB 1A6XA 3OWEB 1CQVA 3NP8A 2XNAC 5DNFA 2EJFC 4DAVA 4KMUC 4CJ0B 3Q23A 2CHBD 4DNTB 2ZT9C 1XXGA 1YNND 5EPLA 1DONA 1B9NA 2XVSA 1F2LA 3SE0A 3Q24A 3P20A 3RMHA 3AMUA 3DWPA 4YIJA 1ENAA 5ISRA 1B1ZA 4BWGB 2F0SA 3G7LA 3RZOB 1JQYD 1S4ZA 5I2XA 3KLRA 2H4OA 3KLSX 1TY0A 5C4XB 1EZ8A 3CHBD 2EYMA 3DWAA 4DXFA 5C3EB 4O42A 1I6VC 1G2SA 1G8ZD 1PZJD 2HQEA 2PW5A 2NUCA 4BBSB 1G6ZA 1I4HA 2CVRA 2V4DA 1ML0D 2WKDA 1STBA 5EQ0A 3SK6A 2DY8A 3MXNA 2N88A 1LTID 1A2TA 3GTKB 1CFMA 2F0NA 2F0UA 2D5DA 1HRJA 5LL6X 3N52A 5TSSA 1CK1A 4CHTB 3W2DA 4XYOA 2O5JC 1HTLD 2FHTA 3C1FA 2JA6B 1LT4D 1IL8A 5KYLA 2NN6G 3CQZB 3T51B 4BBRB 1SE3A 1B3AA 1DYQA 1O78A 1XTCD 2NVXB 1S5ED 2KOLA 1FNWA 1HFNA 4C3JB 2LKVA 4RFBA 4OO1I 5EKKA 1BDOA 1Q8IA 2SEBD 2BA1A 4IN3A 2B2TC 5DEHA 2C9OA 4F88A 3IFTA 3TSSA 1ILPA 3GTLB 4A3GB 2QDBA 4HSVA 1YNNC 5ELFA 1KTKA 2JA8B 1SYGA 5G3LD 4K6DA 1FYCA 3GTMB 4A93B 2JEAI 1SNMA 3Q0AA 2F4IA 1K8MA 4H0LC 1I4QA 1PFNA 3TBIB 5I6YA 5E4WC 4XDXA 4FXGC 2AQ3B 2RDHA 2EJGC 3NWTA 4BA2I 3NXWA 3CRKC 2F0JA 3FVQA 3BG3A 2LMCB 5JVH3 2NN6I 4DN4M 4OHJA 3VA7A 1PXUA 3D4RA 2YYZA 5EBDA 3M4YA 1JOKA 2BCOA 2ZXPA 3UI2A 2E2IB 4Y7NB 3N6RA 4KD3A 3OMGA 5M5WB 1SNDA 3C3LA 4JBWA 2R6GA 3ONAB 1SDFA 1U9RA 3T56B 2B2UA 4IUQA 4G7HC 2K32A 1U4MA 1MSGA 4WORA 1CZWA 3KBXA 1TVXA 4IFDG 4G57A 2QILA 3A7LA 2J7ZA 2K5QA 1C48A 5C0XG 2OXPA 1LT3D 1ZXTA 3NPPA 3MC0B 2JEBI 4KV6A 5CV4A 2J4XA 2XIWA 1EYAA 2EDGA 2A73B 1I6HB 3S17B 2MJ8A 1TWFB 2IX0A 2NBFA 2SDFA 1LO5D 3I4MB 3VYTA 5C4HA 1UUPA 1BF4A 3FPPA 1HXYD 2DNCA 4FF4A 2A6HD 5C0XJ 4Q5VA 2J0TD 2K03A 5EJWA 5A35A 3PUYA 5ELBA 2FMCA 2XSCA 5KNBA 3S2DB 4KJNA 2K5DA 2B2UC 3I91A 3EA6A 1AW7A 2O4XA 3D4WA 5JEAG 2B2WA 2LS01 3Q22A 3BVZA 2O2LD 3RLFA 3T16A 3M85A 1BCPD 4B9WA 3H3VC 3TZDA 1KABA 3R2TA 1H9SA 1K83B 4ME5A 3GO5A 1SJHD 2BOSA 3AU7A 1ZYRC 4F8MA 5BN3A 3J80L 3K59A 1PRTD 2Y0SB 4FP5D 2NTSA 1WTPA 1D2BA 3J7AV 4ZKCB 2A5HA 1MBYA 4ID6A 4U673 5C0XI 3L9AX 3E6ZX 1Z7TA 2RDGA 3LX0A 4KD4A 4A3IB 3S15B 1GUOA 2IJ0A 3X3MA 1EQTA 1U4RA 5K5PA 3D4DA 1AZQA 1LTRD 3QO2A 1V1OA 2F0KA 5M9OA 1OXXK 2MGSA 4NMZA 2F0DA 1JWMD 3I73A 4K6LA 2F0GA 4DK0A 5JOBA 3WOEA 3MVVA 4PMCA 2X69A 3PUXA 1KDCA 1DOMA 1TY2A 2CQAA 4RKBA 4WFN3 2A6HC 1D5XC 1JE4A 1SYDA 4K14A 4Q0FA 2F0PA 3NQTA 3KUPA 3NHHA 4ZKBB 1MGSA 1GUGA 2QF7A 3NE5B 5IT9L 1YNJD 3CRLC 3QB3A 1IYVA 5I2YA 1QWYA 1EYCA 1SNPA 5A2QE 3VR2A 5FO8B 1SYEA 1BCPC 1J8IA 3AB9A 5G3LF 5KNDA 2MHVA 2DNEA 4TRDA 4QMGA 5KYIA 1SMYD 3IFDA 4L8JA 5FKAC 1U4PA 1ONLA 1PRTC 2F0WA 1H9KA 1FR3A 2NWGA 1WCMB 2GA4B 1A2UA 4ZUJA 2PZUA 3S14B 1NCVA 3NK9A 3OIPA 4KI0A 2R3ZA 1A3TA 3DXJC 3MAQA 4KJOA 2NVQB 3TDQA 2ICIA 1IHZA 1UEAB 1Q1EA 4KTAA 4FVMA 4UAIA 2KA7A 1V1PA 1QG7A 1WVLA 1M4VA 4DNRB 3BDOA 3HKZB 1S5CD 1Z6HA 1VF7A 2KEEA 3GTJB 3V05A 5JVG3 3GTPB 4BY1B 1SXTA 2R7ZB 4KN7C 2WAQB 1XYIA 4G7ZC 4X3KA 2K6AA 2QEJC 1OO9B 4I7ZC 5CR3A 4JK1C 3J81L 1TS2A 1SYCA 4J1MA 1YNJC 1QILA 1EEID 4EQNA 1ILQA 3MXGA 4QF4A 5CV6A 2K28A 5CYUA 1EY5A 3ERQA 2A74C 3MEHA 3FRPB 1PMRA 3K5LA 5D3IB 5DM63 4BS9A 1SMYC 1EY8A 1SYBA 2IX1A 3K5NA 1PLFA 4XIGS 1B53A 1RTOA 4K5WA 2EYPA 3H91A 1D5ZC 1WTRA 1BBXC 4IQZA 2XRSD 3K5OA 4QB4A 2KCCA 3QOJA 1LV9A 2L0CA 3VR5A 1BCPF 4RGNA 2E76C 1JC7A 1BXTA 1V43A 2BDNA 1STNA 4OO1H 2BE5D 2ENBA 4OL7A 2RVLA 3EJIA 1I4XA 1HQRD 5COYA 3OHXC 1B2TA 3R2IA 1Y1WB 3S1RB 3HOZB 3D31A 3KLSA 4XQJA 2KCNA 1KNAA 2TSSA 4FYDA 3EFXD 4KK7A 2EVBA 4TKOB 4K8IA 3QOLA 5HURA 1HA5A 1EY9A 2B2TA 5C5MA 1QE6A 1HCZA 3BDCA 3R93A 4ZRZA 1FNUA 2KJXA 5D3DA 2E2HB 4LJZC 4EQOA 2KHSA 4CJ2C 1I3QB 1V8QA 3SR1A 4DU9A 5FO7B 1S5FD 3V2TA 2NN6H 1IYUA 3NTKA 4DGZA 2VUMB 1LTTD 2JYOA 5T1IA 4N9TA 1IW7D 4KKTA 4RCNA 2WB1B 2PW7A 4ZQ3A 4FXDA 3KF8A 2M00A 2NVYB 1G291 4H13C 1B4OA 4FXKC 5HGTA 1M8AA 5CV9A 2EPBA 2MP1A 1HA6A 4KY5A 1STGA 3HEJA 4IURA 2DN8A 5K36H 2Z8LA 3CU7A 3P1HA 2M9VA 5IODA 4NKLA 4KKSA 1F9RA 3HOUB 3U9OA 1J9OA 3JAML 1D1KA 1BR9A 5JPMC 5KGUA 2BE5C 1KLUD 4HSPA 4TSSA 1VDZA 2WIIB 3H09A 3W3AA 3BDLA 2Q8TA 3I3CA 4M8AA 5CORA 1ESFA 1EIGA 2WINB 5NUCA 4KN4C 4HEDA 4OGQC 4IUPA 1SYFA 2XWJB 1Y1VB 5F2DA 5CV5A 3OMCA 3BVMA 1PDQA 1EOTA 1RDPD 4XT1B 3U9SA 2AUKA 2F0FA 4HTHA 1CHQD 3FMCA 3RD4A 4R8NA 1AFPA 5KEEA 1SNCA 2TMPA 3MTSA 4LAAA 3GV6A 4DA2A 3LNNA 3A8JE 4E6IA 4F7XA 3M4OB 1X3PA 1KLGD 4HN7A 1IW7C 1EYDA 2B8GA 1AEXA 1GXDC 1LTBD 1BO0A 2D2CC 3EQLC 4J6HA 3I8ZA 3M7NA 5C0XH 2L55A 4IALA 1TR5A 2E2JB 2L9HA 1GUNA 2F03A 5CBEE 3SEBA 3BZDB 1F2ZA 2D9UA 4BA1I 4IFDJ 2Z4IA 5IOCA 2EYLA 1ESRA 2B63B 1HUNA 5IGCA 1DCZA 4WRDA 5EPKA 1GUSA 1XX8A 3IAYA 5C44B 4CBVA 2RQXA 3RZDB 4A3MB 3R3OA 3KK7A 2PMZB 5CBAE 2YU9B 5JEAH 3VYSA 3J7YW 2Z4HA 2PZWA 2KVMA 4DAPA 1O7ZA 3MXUA 4HMIA 1NUCA 5I9PA 1EWHA 4HR7B 1Q3LA 3J7AF 2EYJA 4RGOS 1LTGD 4A3KB 1F2YA 5JEAJ 4IFDI 3VYUA 2BA0A 2EXZA 2O5IC 1BNZA 1L0XB 4PV1C 5BN5A 1WTOA 5IGDA 2B2YC 5C6AA 1JCKB 1Y69U 2B2VC 5FLXL 5M5XB 2X6GA 1CQFA 3WDNA 5E1FA 1EY6A 2SOBA 2VNUD 1II3A 1STYA 3A7AB 2KQ3A 4RH6A 3FDTA 4G7OC 3Q6SA 2LFNA 3F2UA 3K7AB 1W6JA 4IUNA 4PMBA 4IZ8A 1Y8OB 3SK5A 3L3OC 2B8FA 5EKLA 1B50A 3SXHA 3NUCA 1RJTA 3VR3A 1TS3A 4C3IG 1TT2A 1LTAD 1GOZA 1L0YB 3FPUB 3DWQA 3DMUA 2Q8RE 3NTHA 1EQVA 3L7ZC 4N9PA 3LWUA 1B9MA 5A2QL 1NSNS 2RDFA 4RGTA 1C8CA 1ET6A 3DM1A 3DHQA 5CV8A 1PFMA 2PNRC 3TN2A 1ICWA 1TWCB 1JWUD 5EGTA 4MIUA 4X3TA 2K1BA 1FD7D 3H0GB 1PTOB 3H94A 4V190 1CA6A 1KAAA 2NTTA 2F0OA 2EY1A 2WV6D 3P7JA 5JPNC 4IUUA 3BS1A 2HUGA 4G4KA 1XWEA 3NBHA 2RSOA 2SNMA 2ICEC 2EY2A 5J39A 1Q1BA 2QCPX 4RWSC 1IKLA 2EZVA 4C1NI 1HFGA 1EU3A 2K01A 5I6WA 3TP7A 4QIWB 4J8QA 1LTSD 2RKSA 3K58A 2IW3A 3LWEA 2D62A 3K57A 4KY6A 1GHKA 4B08A 1LT5D 4V0BA 4ULLA 3M3YB 4K2LA 1TWHB 1TQOA 4XQQA 1H9SB 4NP5A 5J1ZA 4B9XA 4EQPA 5DM73 5LL6S 1F9SA 1SAPA 1PZKD 4PQXA 2RBMA 3GV3A 4DXGA 4RHSA 1TS4A 3MXPA 1EY7A 3VR6A 5IIFA 3T53B 5JAVA 4OIJA 2JA7B 4U68A 1JWSD 4GZYC 3PUZA 4K5XA 2RSNA 2LY7A 1RCVD 3I70A 2A68D 3VA5A 3I72A 1CM9A 1HQMC 1OXVA 1EEFD 1BQQT 4RCOA 5I9OA 2PCFB 1SJED 2ZXRA 3D8GA 1U4LA 3CKIB 2I46A 4A3DB 1R9TB 1K8OA 3DEPA 5C5LA 4QCLA 1ENCA 3BYTB 1JOQA 1RHPA 1H9JA 2OEOA 2AUJD 4A3BB 1F2MA 2OT2A 1FNVA 3HS0C 5EPJA 4DK1A 3J81E 1SE2A 4UDUC 1Q12A 4C3IB 1R4QB 2FINB 1R4PB 4IUVA 1BUVT 1MD2D 1TU2B 4RHRA 5JJZA 1CHPD 2F0EA 4R8IA 1DXMA 3WOFA 3HOWB 1QNUA 1O7YA 1SSOA 3QG1A 4QUFA 3TZUA 2G9HD 3SVMA 3TP8A 2AWNA 1PRTF 5CGKA 1EZ6A 1O80A 2XWBB 5J22A 1I4GA 4KHVA 1NR4A 1STEA 2G9DA 1HHVA 4ILWA 4FNFA 1EIHA 1STAA 1Y8PB 4OO1G 1A3VA 1QCBD 2PYKA 3TP5A 2NVTB 1HUMA 3K5MA 3IKJA 3HZXA 3DEOA 1V1PB 1I50B 5E3FA 4X3SA 3MFYA 2A68C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EPL A;  1X32 A;  4CJ1 B;  1EQT A;  1U4R A;  2B2T C;  1WTR A;  1VMC A;  1WD1 A;  1DON A;  1BBX C;  2HUG A;  2J7Z A;  2JYO A;  5T1I A;  1CA5 A;  2X6L A;  4ZAI A;  2L12 A;  1ILP A;  4HSV A;  1X3P A;  1F2L A;  4OIK A;  4IUT A;  2KED A;  3QO2 A;  1AZQ A;  1ZXT A;  1U4L A;  1QNK A;  2RSO A;  1EL0 A;  2L11 A;  4LMQ D;  3DEP A;  2XIW A;  1BNZ A;  2MGS A;  3HP3 A;  4UAI A;  1X3Q A;  2NYZ D;  1WTO A;  1RTN A;  4ZK9 B;  2B2Y C;  4RWS C;  1IKL A;  1QG7 A;  2L1B A;  2MJ8 A;  3G7L A;  1WVL A;  2B2V C;  1S4Z A;  1HFG A;  1BO0 A;  2RA4 A;  1LV9 A;  2SDF A;  2K01 A;  1RHP A;  1B4O A;  2X6G A;  1WTQ A;  3MWY W;  4XT3 B;  1AZP A;  1M8A A;  1BF4 A;  4X3U A;  2EPB A;  2MP1 A;  4RA8 A;  2KUM A;  2X69 A;  1HA6 A;  4R9W A;  3I90 A;  1DOL A;  3I8Z A;  4IUR A;  5EPJ A;  1DOM A;  2EOT A;  1PFN A;  3LWE A;  2KEE A;  2K03 A;  2EE1 A;  4O42 A;  2BDN A;  5EJW A;  1G2S A;  2FIN B;  5CMD A;  2DY7 A;  1WTX A;  1JE4 A;  1F9R A;  4IUV A;  3FDT A;  5E4W C;  1J9O A;  4XDX A;  3Q6S A;  1WD0 A;  3F2U A;  1G2T A;  1G91 A;  1G6Z A;  2L9H A;  3IL8 A;  1WTW A;  1KNE A;  2CVR A;  5CBE E;  2RVL A;  1MI2 A;  1ML0 D;  2HDM A;  5JJZ A;  2H1E A;  1AP0 A;  2K05 A;  1PFB A;  3KUP A;  4NW2 A;  5COY A;  5EQ0 A;  1XYI A;  1B2T A;  2DY8 A;  2L4N A;  2B2U C;  2MPM A;  3I91 A;  1DZ1 A;  1JIC A;  4ZKB B;  2D9U A;  1MGS A;  5D14 A;  2FFK B;  2Q8T A;  2N88 A;  3I3C A;  4R8I A;  1GUW A;  4X3K A;  2FMM A;  5COR A;  4DN4 M;  2B2W A;  1ESR A;  1HUN A;  1EIG A;  1B50 A;  1KNA A;  1O7Y A;  1A15 A;  1SSO A;  5EPK A;  2FJ2 A;  1RJT A;  1XX8 A;  1IKM A;  1F9Q A;  4QUF A;  1HRJ A;  4HCS A;  1F9S A;  1MSH A;  3N52 A;  1SAP A;  4HED A;  4ZLT F;  3SVM A;  2KEC A;  3FPU B;  2Q8R E;  2M2L A;  3TZD A;  2IL8 A;  4IUP A;  3GV3 A;  1O80 A;  2FHT A;  2B2T A;  1DOK A;  5EKI A;  1VMP A;  1J8I A;  2N55 A;  5CBA E;  1NAP A;  1ILQ A;  1IL8 A;  1QE6 A;  2JP1 A;  4QUC A;  1WTV A;  1C8C A;  3DM1 A;  3UI2 A;  3R93 A;  5D65 A;  1NR4 A;  2K04 A;  5AFW A;  4MN3 A;  1PFM A;  2K28 A;  1PDQ A;  2HCC A;  1EOT A;  1HHV A;  3TN2 A;  1ICW A;  1WTP A;  1B3A A;  5E4X A;  2HDL A;  3IFD A;  4XT1 B;  4ZKC B;  3GV6 A;  1EIH A;  2KVM A;  4OIJ A;  2VXW A;  2B2Y A;  1U4P A;  3ONA B;  3D6W A;  4RAU C;  4U68 A;  4X3T A;  2K1B A;  1SDF A;  2NZ1 D;  1O7Z A;  2B2V A;  2HCI A;  4CJ2 C;  2B2W C;  2NWG A;  2B2U A;  4IUQ A;  1CA6 A;  5DNF A;  2KOL A;  2RSN A;  1HFN A;  1NR2 A;  1U4M A;  4CJ0 B;  1F9P A;  1HUM A;  1PLF A;  1B53 A;  1Q3L A;  1NCV A;  1RTO A;  3H91 A;  3DEO A;  1MSG A;  1E0B A;  3P7J A;  4HAE A;  1CM9 A;  4MHE A;  1ROD A;  4X3S A;  3KBX A;  5T1G A;  3MTS A;  2R3Z A;  4IUU A;  1TVX A; 
#chains in the Genus database with same CATH topology
 4JV5 Q;  2B63 H;  2X6L A;  1HR0 Q;  2KED A;  3HOX B;  3SK4 A;  1M90 C;  1EL0 A;  5EBC A;  3GTG B;  3UE1 A;  5C44 G;  4H02 A;  5CC4 A;  4LK1 C;  3TQY A;  3VYR A;  2R61 A;  1OXU A;  3AYH B;  1RF2 D;  3PUW A;  4A3M G;  3HRZ C;  3VR4 A;  4IO9 A;  3S2D H;  2WP8 J;  4LF4 Q;  2CH4 W;  3KDF A;  4JI3 Q;  1RKN A;  4AH6 A;  4DV2 Q;  3QWN A;  1GUT A;  1LLR D;  3KJO A;  1Z47 A;  3OOC A;  4AYB G;  4DR3 L;  5BN4 A;  1VQC A;  1WTX A;  1XNQ L;  1K0R A;  3KLW A;  1HZC A;  4B3M L;  3OWF A;  3D3R A;  1CZG A;  4XYQ A;  3A54 A;  1G2T A;  1D6E C;  2Q2H A;  2L5T A;  1WTW A;  1KNE A;  4JI6 Q;  5GRO A;  2NB0 A;  3HG9 A;  3A56 A;  3A55 A;  3AFQ A;  4RKL A;  1SE4 A;  4PZ7 A;  1FGB D;  1AH9 A;  3A8K E;  5M3M B;  1OXT A;  4A3K G;  1WTH A;  1CKM A;  3ZJY C;  4C3H G;  2FJ2 A;  2A19 A;  1E2W A;  1F9Q A;  5JJI A;  1PZI D;  1L1O B;  2AKW B;  1GD7 A;  2VB2 X;  2E75 C;  3PF4 A;  2OF1 A;  1KRT A;  1Q86 C;  2JQO A;  4O1N A;  1DOK A;  2EXD A;  3ND8 A;  2N55 A;  1LAC A;  1X65 A;  2AMC B;  3MFG A;  4MZ9 A;  1KIX A;  5AFW A;  1V1Q A;  4K0K L;  1BOS A;  1EOV A;  3CPW A;  3FP9 A;  2EYH A;  1PYW D;  1TS5 A;  1W3S A;  2MFI A;  3E5S A;  5K36 G;  1VQD A;  4P73 A;  2F0Q A;  3CCL A;  2A8V A;  2EY5 A;  1EUJ A;  5IGF A;  2E2D C;  5LHY 1;  1ENF A;  5DAU A;  3OPO A;  5C3W A;  2K33 A;  3HGB A;  2KEN A;  3FEW X;  3T1H Q;  1UNS A;  2CKZ B;  4MHE A;  1ROD A;  4H7B A;  5T1G A;  1PH8 A;  5IYB H;  3T1Y L;  3NBI A;  4R4I A;  4MNO A;  4OIK A;  3JAM E;  3CCR A;  3OIQ A;  2EYO A;  4X65 Q;  1Y8N B;  4JC0 A;  1Z9F A;  5HGQ A;  4K5V A;  3RLO A;  4YY3 L;  4LWC A;  1XNR L;  2NYZ D;  2YV5 A;  4ZK9 B;  4CKE A;  5FO9 B;  3SDZ A;  4FF2 A;  2RA4 A;  1WTQ A;  4KKU A;  2SNS A;  3MWY W;  5IYC G;  1NY4 A;  2WAC A;  1JE5 A;  2PZT A;  4R9W A;  3I90 A;  1SBB B;  2HT1 A;  4DV4 L;  3NSW A;  2EJM A;  4JI7 L;  3PO2 G;  2BDO A;  2F0L A;  1B7Y B;  1DGS A;  3OSO A;  4P74 A;  1KQS A;  2G5D A;  3H0G H;  1PTO D;  3J81 c;  1YZ6 A;  1WD0 A;  2Z6K C;  2R92 B;  1ZYR D;  1PTO H;  2RF4 A;  1G91 A;  4JI4 L;  2R93 B;  1CKO A;  4LW1 A;  2PPB C;  5IE8 A;  1AP0 A;  1HPC A;  4A3F B;  2DGY A;  2DUD A;  4IFD H;  2A6E D;  2MPM A;  1IBK L;  2ZXO A;  5ELE A;  1O7L A;  1VQB A;  2F0M A;  1GUW A;  2FMM A;  2WKC A;  4LFA L;  1QB5 D;  1CI3 M;  1LT6 D;  1IBL Q;  1TII D;  3STB D;  1J6Q A;  2NZO A;  3CCS A;  4C1N K;  1E2V A;  2N3S A;  4BY7 G;  2JN4 A;  4LUO A;  4LF5 L;  3S1N B;  2IWH A;  4QY7 A;  2KEC A;  1SNQ A;  1WCM H;  1ZEQ X;  3ITP A;  2Q8I B;  4PMW A;  3I4N B;  1Q46 A;  1YJ9 A;  3S14 H;  3K6O A;  4O0A A;  4QUC A;  5FK9 C;  3W5O A;  1VCI A;  1RD9 D;  3SK8 A;  3G6J B;  1U5K A;  1I4P A;  2HDL A;  3ICE A;  2B2Y A;  4RAU C;  2NZ1 D;  3DLL A;  1KDA A;  2B2V A;  3ZYY X;  3GD7 A;  4FF3 A;  5I4D A;  1NR2 A;  3JC6 6;  4N8F A;  2VZA A;  4GNX B;  1RIP A;  2AHO B;  4HCE A;  1N36 L;  1PH6 A;  1E0B A;  3KF8 B;  1SFO B;  1QUQ B;  4JOI A;  2MUY A;  3PUV A;  1AN8 A;  1PFS A;  1D1I A;  1D5M C;  3U58 A;  2AWO A;  2CH4 A;  2AQ1 B;  4AYB B;  1TWG B;  4LF4 L;  3S16 B;  5IGB A;  1VQM A;  4M1U B;  2K5W A;  4JI3 L;  3GTJ H;  2PQE A;  3F1Z A;  3TP6 A;  4FF1 A;  3ERO A;  4LMQ D;  3R8B A;  3C46 A;  2FXQ A;  1EFI D;  3BVG A;  3GTP H;  5C4J B;  3PO3 G;  3EVQ A;  4BY1 H;  1QJO A;  3H3V I;  2KCT A;  2A1A A;  1DM0 B;  2XGT A;  2ZTC A;  4NB3 A;  4X3U A;  4F87 A;  2JE6 I;  2F0I A;  3GP7 A;  3HOY B;  1NMF A;  1ET9 A;  4C3H B;  4DR2 Q;  4QJF A;  1HR0 W;  5ELC A;  5ELD A;  4KHP Q;  2JA5 G;  3KBG A;  2EE1 A;  2F0V A;  2JA7 H;  2AQ2 B;  4C2M B;  3ULP A;  1JB3 A;  1PTO C;  1N34 Q;  2I5M X;  3AQQ A;  3BYY B;  4FO2 A;  2H1E A;  3OTO Q;  1XMO Q;  1H9M A;  2L4N A;  4GN3 B;  4I65 A;  1DZ1 A;  4YCV A;  5D14 A;  2F3W A;  4BXX G;  1LAB A;  2A6E C;  4TQU S;  3OW2 A;  2CW0 D;  4PZ8 A;  1K8G A;  4DFA A;  1K73 C;  4JOI C;  3X3N A;  4EVO A;  1JR0 D;  4ZYS A;  4YHH Q;  3NQI A;  1R9T H;  4MTK A;  1F77 A;  4PNY A;  3URY A;  4R4O A;  3STB C;  3F2C A;  4A3D G;  3O13 A;  1DJR D;  3J80 E;  1EWC A;  2PO4 A;  1NAP A;  4P2C B;  4A3E G;  1TKW B;  5D65 A;  2K04 A;  3C1E A;  3DUZ A;  2HCC A;  2VB3 X;  4CDC C;  1S5D D;  4HMJ A;  2ASB A;  4A3B G;  5KNC A;  4XQN A;  5EKI A;  4C3I H;  4A3J B;  4KY7 A;  2PQA A;  4GOP B;  4XXE A;  4WJW A;  2B2W C;  3A8I E;  5FLX E;  1K3B C;  1F9P A;  5C3X A;  4N8X 1;  3S9W A;  1CTM A;  1B44 D;  1I94 Q;  1SLJ A;  3PMF A;  2Z9H A;  1H9R A;  4ZCK A;  1X32 A;  2E74 C;  2F0T A;  3PO2 B;  3S24 A;  1V9P A;  1T5E A;  2IPK D;  1CA5 A;  4ZAI A;  1Q90 A;  1QNK A;  1JOO A;  2L11 A;  3I4L A;  3HOW G;  3HOV G;  2ALY B;  3HP3 A;  1A3U A;  1S5B D;  4OWX B;  3JAM c;  1X3Q A;  4CDE C;  3P75 A;  1RTN A;  2JXM B;  2L1B A;  1I4R A;  4XTC S;  4HIO A;  1HZ9 A;  2A69 D;  3CPF A;  4CKC A;  1EY0 A;  4YCU A;  4HJA A;  1EFW A;  4GN4 B;  1AZP A;  3QJY A;  4K2K A;  4RA8 A;  2ID0 A;  2KUM A;  3PSI A;  4DKA C;  2EOT A;  4Y52 H;  2IX3 A;  3C2P A;  3HOZ H;  4DF7 A;  4BY7 B;  5KIX A;  3TEH B;  3SGI A;  1HNW L;  1UE7 A;  3CCM A;  1ZKO A;  1KL9 A;  1OXS C;  5KRU A;  3TRZ A;  3S1M B;  1YIT A;  4HJ5 A;  4RMF A;  3MZ5 A;  1PFB A;  2LXJ A;  2H5X A;  3MA2 B;  1I50 H;  4CGY B;  1JIC A;  1VQF A;  3D6C A;  3PV0 A;  4UP9 A;  5IT9 E;  2C5C A;  2ES2 A;  4WJ4 A;  5CV7 A;  4CKB A;  3V96 A;  1HTP A;  1A15 A;  3CCU A;  1IKM A;  3H6M A;  2I5H A;  4X6A H;  5C4Z A;  5C3E G;  2CW0 C;  3CAM A;  1MSH A;  4HCS A;  4L5Q A;  3CCV A;  4DK3 C;  2JK8 A;  1I3Q H;  2XN9 C;  3HOX G;  3FKI B;  3GTO B;  4LFC Q;  5IGG A;  1T5X D;  2IL8 A;  4NXM Q;  4JI8 Q;  4BBS G;  4ODG A;  1WTV A;  2B39 A;  2JP1 A;  1X56 A;  1KDB A;  2UUA Q;  4ABN A;  2VUM H;  1BKB A;  3S2H B;  5M3F B;  5E4X A;  5BR8 Q;  2K7V A;  2Z1C A;  3D6W A;  2HCI A;  4DV7 Q;  4AIM A;  3K0Y A;  3SHL A;  3PO3 B;  3W1G A;  5FOB B;  2GVA A;  2XRQ D;  4LUV A;  1TWA B;  4ZUI A;  3NWS A;  4C56 C;  4HAE A;  1HZB A;  2F3V A;  1P16 A;  3ND9 A;  1C4Q A;  5IGE A;  1PTO F;  1SNO A;  5M5Y B;  4DUY Q;  4AYB E;  2JA6 G;  4CJ1 B;  2JA5 B;  1VMC A;  1WD1 A;  2I5L X;  4K8J A;  3I2Z A;  1VF5 C;  2L12 A;  4X66 L;  3K80 C;  4IUT A;  4UP7 A;  2F4V L;  2HIX A;  4H44 C;  2QKI C;  3HOU H;  2EIF A;  2UXB Q;  1JOR A;  1BCP B;  4B3T Q;  3RUZ A;  2EY6 A;  3PIP 3;  4C3J G;  4JI5 Q;  1JJC B;  4XT3 B;  4JBM A;  5FJ8 G;  5IP7 H;  1N34 L;  2A69 C;  2F1M A;  2K14 A;  1VQ8 A;  1DOL A;  1KHI A;  3OTO L;  3GQB A;  4KHZ A;  1GJX A;  1PRT B;  1EU4 A;  3CW2 C;  1FJG Q;  1DD2 A;  5CMD A;  2VQF Q;  2DY7 A;  4A3G G;  4EQ5 A;  3PIO 3;  3E0J A;  4DAY A;  3OW7 A;  3IL8 A;  3TME A;  4EGV A;  1E2Z A;  1MI2 A;  3M7G A;  1W6K A;  2HDM A;  4A3E B;  2K05 A;  4NW2 A;  2JSO A;  1Y1V H;  2UXC Q;  4DV1 L;  2FFK B;  1QOH A;  2I07 B;  4ME3 A;  2B29 A;  4Z9C B;  4L63 B;  3T4A C;  1VQ5 A;  1STH A;  4RGM A;  1GHJ A;  2IHF A;  1XPR A;  4ZLT F;  5LMN Q;  1EY4 A;  3MHB A;  1J5E Q;  2M2L A;  4JI2 L;  1N33 L;  1CT1 D;  3GTQ B;  3S1Q B;  3QIA A;  1VMP A;  1SEB D;  4NDX A;  1PVO A;  1PYB A;  3UDF A;  1Q82 C;  2EYF A;  2QEX A;  1N32 L;  3K0X A;  4MN3 A;  3T13 A;  2F0H A;  3J80 c;  1I94 L;  4PG3 A;  1UAP A;  3NTI A;  3M4O H;  2VXW A;  2IT1 A;  3HOV B;  4S3S A;  4L6T B;  1A6X A;  1X55 A;  3OWE B;  1CQV A;  5H1S E;  3NBH B;  2XNA C;  3NP8 A;  5DNF A;  2EJF C;  4DAV A;  4KMU C;  4CJ0 B;  3Q23 A;  1IZ6 A;  3L0O A;  2CHB D;  2R92 G;  1JT8 A;  4DNT B;  2ZT9 C;  5FLX c;  2R93 G;  1CKN B;  3G4S A;  2K5V A;  1XXG A;  1YNN D;  5EPL A;  4A3F G;  1DON A;  1PH5 A;  1B9N A;  2XVS A;  1K3R A;  1VQI A;  2PI2 E;  1F2L A;  3SE0 A;  3Q24 A;  3P20 A;  3RMH A;  3CF5 A;  4B3R Q;  3AMU A;  3DWP A;  4YIJ A;  1ENA A;  4HIK A;  5ISR A;  1S72 A;  1L1O C;  1B1Z A;  3L2P A;  4BWG B;  2F0S A;  3G7L A;  3RZO B;  1JQY D;  1S4Z A;  5I2X A;  2VY3 A;  3ULL A;  3KLR A;  2H4O A;  3I4N G;  3KLS X;  1LYL A;  1TY0 A;  3TRE A;  4LF6 Q;  3PQI A;  3PCO B;  4NXN Q;  5C4X B;  1U0L A;  1EZ8 A;  2BH8 A;  3CHB D;  1EIF A;  2EYM A;  3DWA A;  4DXF A;  1C9O A;  3NEM A;  2K5H A;  5C3E B;  4O42 A;  1KAW A;  1I6V C;  1G2S A;  2IY5 B;  1G8Z D;  1PZJ D;  3PGZ A;  5C44 H;  2HQE A;  2PW5 A;  2NUC A;  4BBS B;  3RZD H;  1G6Z A;  4A3M H;  1I4H A;  2CVR A;  2V4D A;  1ML0 D;  2WKD A;  1STB A;  5EQ0 A;  4DR1 Q;  3SK6 A;  2DY8 A;  3MXN A;  1X3E A;  4OWT B;  4QIW E;  2YU9 H;  5GAE C;  4NXM L;  2YTV A;  2ZM6 Q;  3I4M G;  2N88 A;  1G6P A;  4IOC A;  1LTI D;  1WJJ A;  1A2T A;  3GTK B;  3ERS X;  1CFM A;  2F0N A;  5IT9 c;  2F0U A;  1YVC A;  2D5D A;  1HRJ A;  5LL6 X;  1IXR A;  3N52 A;  5TSS A;  1CK1 A;  4CHT B;  4YWM A;  3W2D A;  1N9W A;  4XYO A;  4DUZ L;  2O5J C;  5C4J H;  1HTL D;  2FHT A;  3C1F A;  2JA6 B;  1LT4 D;  1IL8 A;  1WI5 A;  2NN6 G;  5KYL A;  3CQZ B;  1IBM Q;  1YI2 A;  3T51 B;  4A3K H;  4BBR B;  4ALP A;  4RG1 A;  4DR5 Q;  1SE3 A;  2HQL A;  4C3H H;  3A5Z B;  1B3A A;  1DYQ A;  3BU2 A;  3HOY G;  1YHA A;  1O78 A;  4DUY L;  1XTC D;  2NVX B;  1E3P A;  1S5E D;  2KOL A;  4C2M H;  1FNW A;  1HFN A;  4C3J B;  1ASY A;  2LKV A;  4RFB A;  4OO1 I;  1NBW A;  1BBW A;  2UXB L;  3CXC A;  5EKK A;  3RN2 A;  5M5X H;  1BDO A;  1Q8I A;  2SEB D;  1VQ6 A;  5AJ3 L;  2BA1 A;  4IN3 A;  2B2T C;  4JI5 L;  5DEH A;  2C9O A;  4F88 A;  2Z6K A;  3IFT A;  3TSS A;  1ILP A;  5GAG C;  3GTL B;  2QDB A;  4A3G B;  4HSV A;  1YNN C;  5EAY A;  2Y0S G;  5ELF A;  4LF9 Q;  1KTK A;  2UUB Q;  2KHI A;  2JA8 B;  1SYG A;  5G3L D;  4GS3 A;  1WOC A;  4K6D A;  3K7A H;  4P75 A;  1FYC A;  3GTM B;  4WJ3 M;  4DV6 L;  4A93 B;  2JEA I;  1SNM A;  3Q0A A;  2F4I A;  3CC4 A;  1L0W A;  1K8M A;  4A3I G;  3BZK A;  4H0L C;  1I4Q A;  1PFN A;  2VQE L;  2UXC L;  3TBI B;  5I6Y A;  4DR6 Q;  5E4W C;  4XDX A;  4FXG C;  2AQ3 B;  3I4O A;  2RDH A;  4A3J G;  2EJG C;  2K75 A;  3NWT A;  4BA2 I;  3NXW A;  1O7I A;  5IYC H;  3CRK C;  1NNX A;  2F0J A;  4DV3 L;  3FVQ A;  4GNX C;  3PF5 A;  1J5E L;  3BG3 A;  1X3G A;  1JJG A;  3F8T A;  2LMC B;  5JVH 3;  3PO2 H;  2NN6 I;  4DN4 M;  1N8R C;  4OHJ A;  3VA7 A;  1TWC H;  1PXU A;  3PIP A;  3D4R A;  2YYZ A;  4EX5 A;  3H3V H;  5EBD A;  1VQN A;  4CDD C;  5IYD H;  1HNX L;  4IOA A;  3M4Y A;  3J7A 5;  1JOK A;  2BCO A;  4O2D A;  1HZA A;  3J81 j;  2ZXP A;  3UI2 A;  3PIO A;  2E2I B;  4Y7N B;  1A63 A;  3N6R A;  4KD3 A;  3OMG A;  5M5W B;  1SND A;  4B3S Q;  3C3L A;  4JBW A;  2CCZ A;  2R6G A;  4BY7 H;  3ONA B;  1SDF A;  2K4K A;  1U9R A;  5LMN W;  3T56 B;  2B2U A;  4IUQ A;  4G7H C;  2K32 A;  1U4M A;  4B3R L;  1NTG A;  2CWA A;  4LFB L;  1E22 A;  1MSG A;  4WOR A;  1CZW A;  3KBX A;  1TVX A;  1EYG A;  4G57 A;  4IFD G;  3UDI A;  2Q2T A;  2QIL A;  3A7L A;  4R1J A;  3D0F A;  2J7Z A;  3KDF B;  2K5Q A;  2GVB A;  1C48 A;  2P5Z X;  4QGU A;  5C0X G;  2OXP A;  1LT3 D;  1ZXT A;  1YJN A;  3NPP A;  3MC0 B;  2JEB I;  4KV6 A;  5CV4 A;  4JV5 L;  2J4X A;  2XIW A;  1EYA A;  5FLM G;  2EDG A;  1HR0 L;  2A73 B;  1I6H B;  3S17 B;  1YJW A;  2MJ8 A;  1TWF B;  2IX0 A;  4LUZ A;  2N49 A;  2NBF A;  2BH2 A;  3M3Y H;  3FKI G;  1TWH H;  2SDF A;  1LO5 D;  3I4M B;  3VYT A;  5C4H A;  1UUP A;  1BF4 A;  3FPP A;  5J3B A;  1HXY D;  2GN5 A;  2DNC A;  4FF4 A;  2OTL A;  2A6H D;  4HIM A;  2RHS B;  5C0X J;  4Q5V A;  2J0T D;  2K03 A;  5EJW A;  5L37 A;  5M3F G;  5A35 A;  4DV2 L;  1QZH A;  1QZG A;  3BZC A;  3PUY A;  5ELB A;  2FMC A;  4GOP C;  3PO3 H;  2XSC A;  5KNB A;  1PH2 A;  2Z6B A;  3S2D B;  4KJN A;  2K5D A;  1XMQ Q;  2B2U C;  2KCM A;  3I91 A;  4YCW A;  3EA6 A;  1AW7 A;  2O4X A;  3TS2 A;  4JI6 L;  3D4W A;  5JEA G;  2JA5 H;  2B2W A;  2HHH Q;  2LS0 1;  3EBE A;  3HKZ G;  3Q22 A;  1BBU A;  1IBM L;  3BVZ A;  2O2L D;  4J15 A;  1E7Z A;  3RLF A;  3T16 A;  1E1T A;  3M85 A;  1BCP D;  3KF6 A;  4B9W A;  1A0I A;  3H3V C;  3TZD A;  3R2T A;  1KAB A;  3E0E A;  1H9S A;  1K83 B;  2PNH A;  4ME5 A;  3GO5 A;  1SJH D;  4UP8 A;  2BOS A;  1LUZ A;  3AU7 A;  1ZYR C;  4F8M A;  2R7Z G;  5BN3 A;  2WAQ G;  4X64 Q;  3J80 L;  3K59 A;  4GKJ Q;  1PRT D;  2Y0S B;  4FP5 D;  2NTS A;  5LMU Q;  1WTP A;  1D2B A;  3J7A V;  4ZKC B;  2A5H A;  1MBY A;  4ID6 A;  4U67 3;  5DLQ E;  3B6Y A;  4A3D H;  5C0X I;  3L9A X;  1UWV A;  4JYA Q;  3E6Z X;  1VS0 A;  3UE0 A;  3G71 A;  1Z7T A;  2RDG A;  2QDL A;  1PH4 A;  3LX0 A;  4A3E H;  3H15 A;  1NJI C;  4KD4 A;  4A3I B;  3S15 B;  4JW0 A;  1GUO A;  4A3B H;  4JBJ A;  2IJ0 A;  4GLA C;  3X3M A;  1EQT A;  1U4R A;  4QQB X;  3T1H L;  1YNX A;  5K5P A;  4IPH A;  3D4D A;  1UE5 A;  1AZQ A;  1LTR D;  3QO2 A;  1V1O A;  2F0K A;  5M9O A;  1OXX K;  1QVC A;  2MGS A;  4NMZ A;  2F0D A;  1JWM D;  3I73 A;  4K6L A;  2F0G A;  4DK0 A;  5JOB A;  3CD6 A;  3GTQ H;  3S1Q H;  3WOE A;  4X65 L;  2DJF C;  3MVV A;  3BJU A;  4PMC A;  2X69 A;  3PUX A;  1KDC A;  1DOM A;  2VS1 A;  1TY2 A;  2CQA A;  4RKB A;  3AEV A;  3HOW H;  4YWK A;  4WFN 3;  1YIJ A;  2A6H C;  1D5X C;  1JE4 A;  1SYD A;  4R4Q A;  4K14 A;  4Q0F A;  2F0P A;  3K7U C;  3NQT A;  3M4Q A;  3KUP A;  1JJ2 A;  4A3L G;  3NHH A;  4ZKB B;  1MGS A;  1K8A C;  1YHB A;  1GUG A;  2QF7 A;  3NE5 B;  4JBK A;  5IT9 L;  1VQL A;  3CMA A;  4DV0 Q;  1YNJ D;  1VQ7 A;  2ZJR A;  3CRL C;  3QB3 A;  3HFZ B;  1NE3 A;  2OQK A;  5I2Y A;  1IYV A;  1WYD A;  1QWY A;  1PHJ A;  1EYC A;  1A62 A;  1SNP A;  5A2Q E;  3VR2 A;  5FO8 B;  1IBL L;  1SYE A;  2NVT H;  1BCP C;  1J8I A;  1K28 A;  1VQH A;  2MO1 A;  3AB9 A;  4R4C A;  5G3L F;  5KND A;  4DR7 Q;  2MHV A;  2DNE A;  4TRD A;  1H95 A;  4QMG A;  1ICF B;  5KYI A;  1SMY D;  4DV5 Q;  3IFD A;  4L8J A;  5FKA C;  1Y1W G;  5C4X G;  5HY6 A;  1U4P A;  1ONL A;  1PRT C;  2F0W A;  3HOX H;  1H9K A;  1FR3 A;  2NWG A;  1WCM B;  2D0P A;  1KRS A;  2GA4 B;  3LGJ A;  1A2U A;  4ZUJ A;  3GTG H;  2PZU A;  3U50 C;  3S14 B;  1NCV A;  3NK9 A;  3OIP A;  4KI0 A;  3HKS A;  1MJE A;  2N78 A;  2R3Z A;  4HJ7 A;  1A3T A;  3DXJ C;  3MAQ A;  4KLK A;  4KJO A;  1W2B A;  2NVQ B;  3TDQ A;  2ICI A;  1TXY A;  3G6E A;  1IHZ A;  1UEA B;  1Q1E A;  3KJP A;  2E5L Q;  4KTA A;  4FVM A;  2CQO A;  4UAI A;  4L5S A;  2KA7 A;  1V1P A;  1QG7 A;  1WVL A;  1M4V A;  2JA6 H;  2YTX A;  3CQZ H;  3RN5 A;  4DNR B;  3BDO A;  3HKZ B;  1S5C D;  4JI1 Q;  1XMQ L;  5M3M H;  2VUM G;  1Z6H A;  1VF7 A;  4BBR G;  2KEE A;  3GTJ B;  2HIV A;  3V05 A;  4L5T A;  4DR2 L;  2B3G A;  1PYS B;  2WB1 G;  5JVG 3;  4KHP L;  3GTP B;  4BY1 B;  1Q8K A;  1SN8 A;  1SXT A;  4GN5 A;  2R7Z B;  4KN7 C;  2WAQ B;  1XYI A;  4G7Z C;  4X3K A;  2K6A A;  2QEJ C;  1OO9 B;  1UE1 A;  1XMO L;  1FL0 A;  4I7Z C;  5CR3 A;  4JK1 C;  1YBY A;  4X64 L;  4A3C H;  3J81 L;  1TS2 A;  2WFW A;  1SYC A;  1YNJ C;  3IRB A;  4J1M A;  1QIL A;  2PQA B;  3HOU G;  4K0K Q;  4GLV B;  1EEI D;  2JA8 G;  4YHH L;  1Q7Y C;  4JPB W;  4EQN A;  2K50 A;  1ILQ A;  2Y0S E;  3MXG A;  4QF4 A;  2N8N A;  5CV6 A;  4A93 G;  1VQE A;  2K28 A;  5CYU A;  1EY5 A;  1SRO A;  5IP9 H;  3CC7 A;  3ERQ A;  4LF7 Q;  2A74 C;  1L1O A;  1CSQ A;  3MEH A;  4DNI A;  2IHE A;  3FRP B;  4DPG A;  1PMR A;  3K5L A;  5D3I B;  5DM6 3;  4BS9 A;  1SMY C;  1EY8 A;  1AE3 A;  4JG2 A;  1SYB A;  2IX1 A;  3K5N A;  3AFP A;  3RLN A;  2ZTD A;  1PLF A;  4XIG S;  1B53 A;  1RTO A;  4K5W A;  4DK6 C;  3T1Y Q;  2EYP A;  3H91 A;  1PV4 A;  4IJL A;  2UUC Q;  1D5Z C;  1WTR A;  1BBX C;  1XNR Q;  1IL2 A;  3U4V A;  4IQZ A;  3J7Z C;  2XRS D;  3K5O A;  4QB4 A;  1VQK A;  2XTI A;  1Y14 B;  2R92 H;  2KCC A;  2F3I A;  2R93 H;  3QOJ A;  1K0S A;  1PH7 A;  2VL6 A;  1LV9 A;  2L0C A;  4DV4 Q;  3VR5 A;  4A3F H;  4JI7 Q;  5JJK A;  1BCP F;  4P72 A;  3UDG A;  4RGN A;  2E76 C;  1JC7 A;  1BXT A;  4JI4 Q;  1V43 A;  2BDN A;  1STN A;  1C7Y A;  4OO1 H;  2ZJQ A;  2BE5 D;  2D0O A;  2ENB A;  4OL7 A;  4X62 Q;  4HJ9 A;  3VDY A;  1IBK Q;  3S1N H;  2RVL A;  3EJI A;  1ASZ A;  1I4X A;  1E1O A;  3RNU A;  3I4N H;  1HQR D;  5COY A;  3OHX C;  1B2T A;  1D7Q A;  3R2I A;  1Y1W B;  3KOJ A;  3S1R B;  3HOZ B;  3D31 A;  3KLS A;  4XQJ A;  2KCN A;  1KNA A;  1WFQ A;  2TSS A;  3EFX D;  4KK7 A;  4FYD A;  2EVB A;  4TKO B;  4K8I A;  2KBN A;  3QOL A;  4R4T A;  5HUR A;  1B3Q A;  1TWF H;  2I0Q A;  1HA5 A;  1EY9 A;  2B2T A;  2CFM A;  5C5M A;  3I4M H;  1QE6 A;  1HCZ A;  1SFO H;  3BDC A;  4LFC L;  4ZRZ A;  3R93 A;  1FNU A;  2KJX A;  4JI8 L;  5D3D A;  2E2H B;  1TWG H;  4LJZ C;  3S16 H;  4LF8 Q;  2B63 G;  4EQO A;  1N36 Q;  2KHS A;  2UUA L;  3GDE A;  4CJ2 C;  1I3Q B;  1V8Q A;  3SR1 A;  4DU9 A;  5FO7 B;  5BR8 L;  1SRU A;  1S5F D;  2E5L L;  3V2T A;  2NN6 H;  1IYU A;  4DV7 L;  2KHJ A;  1I5F A;  3NTK A;  1L2F A;  4DGZ A;  2VUM B;  1VQG A;  3HOY H;  1LTT D;  2JA9 A;  3FHW A;  1T9H A;  2JYO A;  5T1I A;  4N9T A;  1IW7 D;  4KKT A;  4RCN A;  3DM3 A;  1MJC A;  2WB1 B;  4JI1 L;  1VQP A;  2PW7 A;  4ZQ3 A;  4GNX A;  5IWA Q;  4FXD A;  3KF8 A;  2NVY B;  1K83 H;  2M00 A;  1G29 1;  1QUQ A;  4DAY B;  2MQH A;  4H13 C;  1B4O A;  3HKZ E;  4FXK C;  5HGT A;  1M8A A;  5CV9 A;  4B3T L;  2EPB A;  2MP1 A;  3EIV A;  4KY5 A;  1HA6 A;  1STG A;  3HEJ A;  4IUR A;  2DN8 A;  4LNQ A;  1X54 A;  2OQ0 A;  2Z8L A;  5K36 H;  3CU7 A;  1S40 A;  3P1H A;  2M9V A;  5IOD A;  4NKL A;  4KKS A;  3Q8D A;  1F9R A;  1MHW C;  3U9O A;  3HOU B;  1J9O A;  3JAM L;  1GVP A;  3OYY A;  1D1K A;  2JJQ A;  2WAQ E;  1BR9 A;  5JPM C;  5KGU A;  2BE5 C;  1FJG L;  2VQF L;  1KLU D;  4HSP A;  4TSS A;  4DAM A;  1VDZ A;  4UHV A;  2WII B;  4A3I H;  3H09 A;  3S15 H;  3W3A A;  3BDL A;  2Q8T A;  3I3C A;  4M8A A;  5COR A;  5ELO A;  3CCE A;  1GKH A;  1ESF A;  1EIG A;  2WIN B;  5NUC A;  2YTY A;  1YHQ A;  3I55 A;  1UE6 A;  4KN4 C;  2EQS A;  4A3J H;  4HED A;  3M9B A;  1MIU A;  4LF7 L;  2L15 A;  1MKH A;  4OGQ C;  4OWW B;  4IUP A;  1SYF A;  2XWJ B;  1Y1V B;  5F2D A;  5LMN L;  5CV5 A;  3OMC A;  3BVM A;  5GAH C;  1PDQ A;  5IYB G;  1EOT A;  1QVG A;  1RDP D;  4XT1 B;  2UUC L;  3U9S A;  1GO3 E;  2AUK A;  1FVI A;  2R7D A;  1EWI A;  2F0F A;  4HTH A;  1JB7 A;  1CHQ D;  4POG A;  3FMC A;  1NMG A;  3RD4 A;  4R8N A;  4JVZ A;  2QGQ A;  1AFP A;  4OEM B;  5KEE A;  1SNC A;  3I7F A;  2TMP A;  3MTS A;  4LAA A;  3GV6 A;  4DA2 A;  5ELN A;  3A5U A;  3LNN A;  3CCQ A;  3A8J E;  4E6I A;  4F7X A;  4GOP A;  3M4O B;  1X3P A;  4OEL B;  3E9I A;  1KLG D;  4HN7 A;  1IW7 C;  1EYD A;  2B8G A;  1VQO A;  1AEX A;  1GXD C;  3H0G G;  1LTB D;  3S1M H;  5IYD G;  4NPS A;  1BO0 A;  4X62 L;  2D2C C;  2Q2I A;  3EQL C;  3JAM i;  1X9N A;  2RCN A;  2CWP A;  2K5N A;  4J6H A;  3MXN B;  3I8Z A;  3M7N A;  4OX9 Q;  1HNW Q;  5C0X H;  4IPD A;  1KC8 C;  3F2B A;  2PI2 A;  1KXL A;  2L55 A;  3CC2 A;  1X3F A;  1XPU A;  4IAL A;  4LF6 L;  4YWL A;  1TR5 A;  4NXN L;  5FLM H;  3UDX A;  2E2J B;  4HJ8 A;  1HJP A;  3FKI H;  2L9H A;  1GUN A;  3GTO H;  4GKK Q;  2F03 A;  5CBE E;  1WCM G;  3E3X A;  3SEB A;  3BZD B;  1F2Z A;  2D9U A;  4BA1 I;  4IFD J;  2Z4I A;  5IOC A;  2NVQ H;  2EYL A;  1ESR A;  4DR1 L;  2B63 B;  1HUN A;  3S2H H;  5IGC A;  4JCV E;  5M3F H;  1DCZ A;  4WRD A;  5EPK A;  1KD1 C;  1GUS A;  2ZM6 L;  1XX8 A;  3IAY A;  5C44 B;  4CBV A;  2RQX A;  3RZD B;  3KYH C;  4A3M B;  4LF8 L;  3R3O A;  3KK7 A;  2PMZ B;  1TWA H;  4DR4 Q;  1E24 A;  1D8L A;  3E9H A;  3CP0 A;  5CBA E;  2YU9 B;  5JEA H;  3VYS A;  4UPA A;  5M5Y H;  3J7Y W;  3TS0 A;  2Z4H A;  2PZW A;  4MTN A;  1GM5 A;  2KVM A;  4DAP A;  3K8A A;  4HID A;  1O7Z A;  4DR5 L;  3MXU A;  4HMI A;  1NUC A;  5I9P A;  1UEB A;  1EWH A;  4HR7 B;  1Q3L A;  3J7A F;  2EYJ A;  4RGO S;  2R7Z H;  5IWA L;  4X66 Q;  1LTG D;  4BY1 G;  4A3K B;  4BXX H;  1HNZ Q;  1AE2 A;  2F4V Q;  1F2Y A;  5JEA J;  2WB1 E;  4IFD I;  3VYU A;  2UXD Q;  2ZTE A;  2BA0 A;  2EXZ A;  2VW9 A;  2O5I C;  1BNZ A;  2JA7 G;  1L0X B;  4PV1 C;  1CSP A;  5BN5 A;  1WTO A;  5IGD A;  4LF9 L;  2B2Y C;  2UUB L;  5C6A A;  1JCK B;  1Y69 U;  2B2V C;  5FLX L;  5M5X B;  2X6G A;  1CQF A;  4QL5 A;  3WDN A;  1SR3 A;  5E1F A;  1OTC A;  1SE8 A;  1EY6 A;  2SOB A;  2VNU D;  1II3 A;  1STY A;  3A7A B;  2KQ3 A;  4RH6 A;  1M1K C;  3FDT A;  4G7O C;  3Q6S A;  4FDB A;  2LFN A;  3F2U A;  3K7A B;  4JI0 Q;  4DV1 Q;  1W6J A;  1X6O A;  4IUN A;  4DR6 L;  4CDF C;  4PMB A;  4IZ8 A;  2Q2U A;  2C35 B;  2QW7 A;  1Y8O B;  3SK5 A;  3L3O C;  2UU9 Q;  2B8F A;  5EKL A;  1B50 A;  4AQY Q;  4JI2 Q;  1N33 Q;  3SXH A;  3NUC A;  1RJT A;  1EQQ A;  3VR3 A;  1TS3 A;  3HOV H;  4C3I G;  1TT2 A;  1LTA D;  1K9M C;  1GOZ A;  1L0Y B;  3FPU B;  3DWQ A;  3DMU A;  2Q8R E;  3NTH A;  1EQV A;  1N32 Q;  3L7Z C;  4N9P A;  1BVS A;  4A3L H;  3LWU A;  1B9M A;  5A2Q L;  3ER0 A;  1NSN S;  2RDF A;  4RGT A;  1C8C A;  1ET6 A;  3DM1 A;  1CUK A;  3DHQ A;  1VQA A;  5CV8 A;  1PFM A;  2PNR C;  3TN2 A;  1ICW A;  1TWC B;  1YEZ A;  1JWU D;  1XJV A;  3KFU A;  5EGT A;  4MIU A;  2ZJP A;  4X3T A;  2K1B A;  1C0A A;  1FD7 D;  3H0G B;  3J80 i;  4B3S L;  1PTO B;  3H94 A;  4V19 0;  1CA6 A;  1KAA A;  2NTT A;  3RR5 A;  2F0O A;  2EY1 A;  3RZO H;  3QR8 A;  2WV6 D;  3P7J A;  2LSS A;  5GAD C;  5JPN C;  4IUU A;  1IYJ B;  5C4X H;  3BS1 A;  1Y1W H;  2HUG A;  3S1R H;  4G4K A;  4P71 A;  2E8G A;  3A0J A;  1HH2 P;  1P8L A;  1XWE A;  3NBH A;  5C3E H;  3HOZ G;  2RSO A;  4OX9 L;  2SNM A;  2ICE C;  2F52 A;  2EY2 A;  5J39 A;  1Q1B A;  2QCP X;  4RWS C;  4BBS H;  3W1B A;  1IKL A;  1CKN A;  2EZV A;  4C1N I;  1HFG A;  1EU3 A;  2K01 A;  5I6W A;  4I7A A;  4GKK L;  3TP7 A;  4QIW B;  2OTJ A;  4J8Q A;  1LTS D;  4L5R C;  1SMX A;  1PH1 A;  2RKS A;  3K58 A;  2IW3 A;  1XPO A;  3LWE A;  2D62 A;  2E2H H;  3GTK H;  1PH9 A;  3K57 A;  4A75 A;  1EQR A;  4KY6 A;  4PZ6 A;  1GHK A;  3MEF A;  4B08 A;  1LT5 D;  4V0B A;  4ULL A;  3M3Y B;  4K2L A;  3KF6 B;  1TWH B;  1TQO A;  3CME A;  4XQQ A;  1H9S B;  4NP5 A;  5J1Z A;  2RHQ B;  4B9X A;  1S3O A;  4DR3 Q;  1XNQ Q;  4BBR H;  4DR4 L;  4EQP A;  2DJG C;  4B3M Q;  4IJH A;  5DM7 3;  4DUZ Q;  5LL6 S;  1LTL A;  2NVX H;  1VQ4 A;  1F9S A;  1SAP A;  1PH3 A;  2HHH L;  1XTD A;  3CCJ A;  1RL2 A;  1PZK D;  2HD3 A;  2PMZ E;  2RBM A;  4PQX A;  2MNA A;  2NVY H;  4C3J H;  3GV3 A;  4DXG A;  1FGU A;  4RHS A;  5FJ8 H;  1TS4 A;  3MXP A;  5JJL A;  1EY7 A;  3G48 A;  3VR6 A;  3K81 C;  5IIF A;  2OCE A;  2MO0 A;  3T53 B;  5M3M G;  5JAV A;  4OIJ A;  3GTL H;  4A3G H;  1HNZ L;  2JA7 B;  4U68 A;  4POF A;  4GKJ L;  1G51 A;  1JWS D;  5LMU L;  4GZY C;  3PUZ A;  2JA8 H;  4K5X A;  2RSN A;  2UXD L;  2LY7 A;  1RCV D;  3I70 A;  1A8V A;  2A68 D;  5AJ3 Q;  3GTM H;  3VA5 A;  3I72 A;  1CM9 A;  4A93 H;  1HQM C;  4JYA L;  1OXV A;  1EEF D;  1BQQ T;  4RCO A;  5I9O A;  2PCF B;  1SJE D;  4GLX A;  2ZXR A;  5IP7 G;  2K52 A;  1B8A A;  3D8G A;  3ULJ A;  1U4L A;  3CKI B;  1LM0 A;  2I46 A;  4A3D B;  1R9T B;  2Z0S A;  4APV A;  1K8O A;  3DEP A;  4DV6 Q;  4A3C G;  2ATW A;  2V1C C;  2RCF A;  5C5L A;  3NEN A;  4QCL A;  1ENC A;  3BYT B;  4TVA B;  1JOQ A;  2QA4 A;  1RHP A;  1H9J A;  2OEO A;  2AUJ D;  2VQE Q;  4JI0 L;  4A3B B;  1F2M A;  3NEL A;  1JMC A;  1Y1V G;  2OT2 A;  2R7F A;  1FNV A;  3HS0 C;  5EPJ A;  4DK1 A;  3J81 E;  4YY3 Q;  5IP9 G;  1SE2 A;  4UDU C;  1Q12 A;  4C3I B;  1R4Q B;  2FIN B;  4OON A;  1R4P B;  4IUV A;  2UU9 L;  1EIY B;  1BUV T;  4DV3 Q;  4AQY L;  3F2D A;  3I56 A;  1PA6 A;  1MD2 D;  1TU2 B;  3M4P A;  4RHR A;  5JJZ A;  1CHP D;  3A74 A;  3EN2 A;  5IY0 A;  2F0E A;  4R8I A;  2E2I H;  1DXM A;  4Y7N H;  3WOF A;  1QVF A;  3HOW B;  5M5W H;  1QNU A;  1O7Y A;  1HNX Q;  4IPC A;  1SSO A;  3QG1 A;  4UY8 C;  4QUF A;  3TZU A;  2G9H D;  3SVM A;  3TP8 A;  4DV0 L;  2AWN A;  1PRT F;  5GQO A;  5CGK A;  2NZH A;  1EZ6 A;  1O80 A;  2XWB B;  4A4I A;  4OXP A;  5J22 A;  1I4G A;  4LFA Q;  1VQ9 A;  4KHV A;  3J81 i;  1NR4 A;  3WWV A;  1STE A;  2G9D A;  1HHV A;  4LF5 Q;  4ILW A;  4FNF A;  3U4Z A;  1EIH A;  4LFB Q;  1STA A;  1VQJ A;  4DR7 L;  1B70 B;  1Y8P B;  4OO1 G;  2E2J H;  1A3V A;  1QCB D;  4DV5 L;  1Q81 C;  2PYK A;  3TP5 A;  2NVT B;  5E7N A;  1I6H H;  1HUM A;  3S17 H;  3K5M A;  3IKJ A;  3HZX A;  2LXK A;  3DEO A;  1V1P B;  1I50 B;  5E3F A;  4IPG A;  4X3S A;  2OWO A;  3MFY A;  2A68 C;  4A76 A; 
#chains in the Genus database with same CATH homology
 2X6L A;  2KED A;  3HOX B;  3SK4 A;  1EL0 A;  5EBC A;  3GTG B;  5CC4 A;  4LK1 C;  3VYR A;  2R61 A;  1OXU A;  1RF2 D;  3PUW A;  3HRZ C;  3VR4 A;  2WP8 J;  1RKN A;  3QWN A;  1GUT A;  1LLR D;  1Z47 A;  3OOC A;  1WTX A;  5BN4 A;  3OWF A;  3D3R A;  1CZG A;  4XYQ A;  3A54 A;  1G2T A;  1D6E C;  2L5T A;  1WTW A;  1KNE A;  2NB0 A;  3HG9 A;  3A56 A;  3A55 A;  4RKL A;  1SE4 A;  1FGB D;  3A8K E;  5M3M B;  1OXT A;  4C3H G;  2FJ2 A;  1E2W A;  1F9Q A;  1PZI D;  2VB2 X;  2E75 C;  2OF1 A;  4O1N A;  1DOK A;  3ND8 A;  2N55 A;  1LAC A;  3MFG A;  5AFW A;  1BOS A;  2EYH A;  1PYW D;  1TS5 A;  3E5S A;  5K36 G;  2F0Q A;  2EY5 A;  5IGF A;  2E2D C;  5LHY 1;  1ENF A;  5DAU A;  3OPO A;  5C3W A;  2K33 A;  3HGB A;  3FEW X;  1UNS A;  4MHE A;  1ROD A;  4H7B A;  5T1G A;  3NBI A;  4OIK A;  3JAM E;  3OIQ A;  2EYO A;  1Y8N B;  4K5V A;  2NYZ D;  4ZK9 B;  4CKE A;  5FO9 B;  3SDZ A;  4FF2 A;  2RA4 A;  1WTQ A;  4KKU A;  2SNS A;  3MWY W;  2WAC A;  2PZT A;  4R9W A;  3I90 A;  1SBB B;  3NSW A;  2EJM A;  2BDO A;  2F0L A;  3OSO A;  1PTO D;  1WD0 A;  2R92 B;  1ZYR D;  1PTO H;  1G91 A;  2R93 B;  2PPB C;  1AP0 A;  1HPC A;  4A3F B;  4IFD H;  2A6E D;  2MPM A;  2ZXO A;  5ELE A;  1O7L A;  2F0M A;  1GUW A;  2FMM A;  2WKC A;  1QB5 D;  1CI3 M;  1LT6 D;  1TII D;  4C1N K;  1E2V A;  3S1N B;  2IWH A;  2KEC A;  1SNQ A;  1ZEQ X;  3ITP A;  2Q8I B;  4PMW A;  3I4N B;  3K6O A;  4QUC A;  5FK9 C;  1VCI A;  1RD9 D;  3SK8 A;  3G6J B;  1I4P A;  2HDL A;  2B2Y A;  4RAU C;  2NZ1 D;  1KDA A;  2B2V A;  3ZYY X;  3GD7 A;  4FF3 A;  5I4D A;  1NR2 A;  4HCE A;  1E0B A;  1SFO B;  2MUY A;  3PUV A;  1AN8 A;  1D1I A;  1D5M C;  2AWO A;  2AQ1 B;  4AYB B;  1TWG B;  3S16 B;  5IGB A;  4M1U B;  2K5W A;  2PQE A;  3TP6 A;  4FF1 A;  3ERO A;  4LMQ D;  3R8B A;  3C46 A;  1EFI D;  3BVG A;  5C4J B;  3EVQ A;  1QJO A;  1DM0 B;  4X3U A;  4F87 A;  3HOY B;  2JE6 I;  2F0I A;  3GP7 A;  1ET9 A;  4C3H B;  5ELC A;  5ELD A;  3KBG A;  2EE1 A;  2F0V A;  2AQ2 B;  4C2M B;  1JB3 A;  1PTO C;  3BYY B;  4FO2 A;  2H1E A;  1H9M A;  2L4N A;  4I65 A;  1DZ1 A;  5D14 A;  2F3W A;  1LAB A;  2A6E C;  4TQU S;  2CW0 D;  4DFA A;  3X3N A;  4EVO A;  1JR0 D;  4ZYS A;  3NQI A;  1F77 A;  4PNY A;  3URY A;  3O13 A;  1DJR D;  3J80 E;  1EWC A;  2PO4 A;  1NAP A;  4P2C B;  1TKW B;  5D65 A;  2K04 A;  3C1E A;  3DUZ A;  2HCC A;  2VB3 X;  1S5D D;  4HMJ A;  5KNC A;  4XQN A;  5EKI A;  4A3J B;  4KY7 A;  4XXE A;  4WJW A;  2B2W C;  3A8I E;  5FLX E;  1F9P A;  5C3X A;  3S9W A;  1CTM A;  1B44 D;  3PMF A;  1H9R A;  1X32 A;  2E74 C;  2F0T A;  3PO2 B;  1T5E A;  2IPK D;  1CA5 A;  4ZAI A;  1Q90 A;  1QNK A;  1JOO A;  2L11 A;  3I4L A;  3HP3 A;  1A3U A;  1S5B D;  1X3Q A;  3P75 A;  1RTN A;  2JXM B;  2L1B A;  1I4R A;  4XTC S;  4CKC A;  2A69 D;  1EY0 A;  1AZP A;  3QJY A;  4K2K A;  4RA8 A;  2ID0 A;  2KUM A;  2EOT A;  2IX3 A;  3C2P A;  4DF7 A;  4BY7 B;  5KIX A;  1ZKO A;  1OXS C;  5KRU A;  3S1M B;  3MZ5 A;  1PFB A;  3MA2 B;  4CGY B;  1JIC A;  3D6C A;  3PV0 A;  5IT9 E;  2C5C A;  5CV7 A;  4CKB A;  3V96 A;  1HTP A;  1A15 A;  1IKM A;  3H6M A;  5C4Z A;  2CW0 C;  4HCS A;  1MSH A;  2XN9 C;  3FKI B;  3GTO B;  5IGG A;  1T5X D;  2IL8 A;  4ODG A;  1WTV A;  2B39 A;  2JP1 A;  1KDB A;  4ABN A;  3S2H B;  5M3F B;  5E4X A;  2K7V A;  2Z1C A;  3D6W A;  2HCI A;  3K0Y A;  3SHL A;  3PO3 B;  5FOB B;  2XRQ D;  1TWA B;  4ZUI A;  3NWS A;  4C56 C;  4HAE A;  3ND9 A;  2F3V A;  1C4Q A;  5IGE A;  1PTO F;  1SNO A;  5M5Y B;  4CJ1 B;  2JA5 B;  1VMC A;  1WD1 A;  4K8J A;  1VF5 C;  2L12 A;  4IUT A;  4H44 C;  2QKI C;  1JOR A;  1BCP B;  3RUZ A;  2EY6 A;  3PIP 3;  4C3J G;  4XT3 B;  2A69 C;  2F1M A;  1DOL A;  3GQB A;  4KHZ A;  1GJX A;  1PRT B;  1EU4 A;  1DD2 A;  5CMD A;  2DY7 A;  3PIO 3;  3E0J A;  4DAY A;  3OW7 A;  3IL8 A;  3TME A;  4EGV A;  1E2Z A;  1MI2 A;  3M7G A;  1W6K A;  2HDM A;  4A3E B;  2K05 A;  4NW2 A;  2JSO A;  2FFK B;  1QOH A;  2I07 B;  4Z9C B;  4L63 B;  3T4A C;  1STH A;  4RGM A;  1GHJ A;  4ZLT F;  1EY4 A;  3MHB A;  2M2L A;  1CT1 D;  3GTQ B;  3S1Q B;  3QIA A;  1VMP A;  1SEB D;  4NDX A;  2EYF A;  4MN3 A;  3T13 A;  2F0H A;  1UAP A;  3NTI A;  2VXW A;  2IT1 A;  3HOV B;  4S3S A;  4L6T B;  1A6X A;  3OWE B;  1CQV A;  3NP8 A;  2XNA C;  5DNF A;  2EJF C;  4DAV A;  4KMU C;  4CJ0 B;  3Q23 A;  2CHB D;  4DNT B;  2ZT9 C;  1XXG A;  1YNN D;  5EPL A;  1DON A;  1B9N A;  2XVS A;  1F2L A;  3SE0 A;  3Q24 A;  3P20 A;  3RMH A;  3AMU A;  3DWP A;  4YIJ A;  1ENA A;  5ISR A;  1B1Z A;  4BWG B;  2F0S A;  3G7L A;  3RZO B;  1JQY D;  1S4Z A;  5I2X A;  3KLR A;  2H4O A;  3KLS X;  1TY0 A;  5C4X B;  1EZ8 A;  3CHB D;  2EYM A;  3DWA A;  4DXF A;  5C3E B;  4O42 A;  1I6V C;  1G2S A;  1G8Z D;  1PZJ D;  2HQE A;  2PW5 A;  2NUC A;  4BBS B;  1G6Z A;  1I4H A;  2CVR A;  2V4D A;  1ML0 D;  2WKD A;  1STB A;  5EQ0 A;  3SK6 A;  2DY8 A;  3MXN A;  2N88 A;  1LTI D;  1A2T A;  3GTK B;  1CFM A;  2F0N A;  2F0U A;  2D5D A;  1HRJ A;  5LL6 X;  3N52 A;  5TSS A;  1CK1 A;  4CHT B;  3W2D A;  4XYO A;  2O5J C;  1HTL D;  2FHT A;  3C1F A;  2JA6 B;  1LT4 D;  1IL8 A;  5KYL A;  2NN6 G;  3CQZ B;  3T51 B;  4BBR B;  1SE3 A;  1B3A A;  1DYQ A;  1O78 A;  1XTC D;  2NVX B;  1S5E D;  2KOL A;  1FNW A;  1HFN A;  4C3J B;  2LKV A;  4RFB A;  4OO1 I;  5EKK A;  1BDO A;  1Q8I A;  2SEB D;  2BA1 A;  4IN3 A;  2B2T C;  5DEH A;  2C9O A;  4F88 A;  3IFT A;  3TSS A;  1ILP A;  3GTL B;  4A3G B;  2QDB A;  4HSV A;  1YNN C;  5ELF A;  1KTK A;  2JA8 B;  1SYG A;  5G3L D;  4K6D A;  1FYC A;  3GTM B;  4A93 B;  2JEA I;  1SNM A;  3Q0A A;  2F4I A;  1K8M A;  4H0L C;  1I4Q A;  1PFN A;  3TBI B;  5I6Y A;  5E4W C;  4XDX A;  4FXG C;  2AQ3 B;  2RDH A;  2EJG C;  3NWT A;  4BA2 I;  3NXW A;  3CRK C;  2F0J A;  3FVQ A;  3BG3 A;  2LMC B;  5JVH 3;  2NN6 I;  4DN4 M;  4OHJ A;  3VA7 A;  1PXU A;  3D4R A;  2YYZ A;  5EBD A;  3M4Y A;  1JOK A;  2BCO A;  2ZXP A;  3UI2 A;  2E2I B;  4Y7N B;  3N6R A;  4KD3 A;  3OMG A;  5M5W B;  1SND A;  3C3L A;  4JBW A;  2R6G A;  3ONA B;  1SDF A;  1U9R A;  3T56 B;  2B2U A;  4IUQ A;  4G7H C;  2K32 A;  1U4M A;  1MSG A;  4WOR A;  1CZW A;  3KBX A;  1TVX A;  4IFD G;  4G57 A;  2QIL A;  3A7L A;  2J7Z A;  2K5Q A;  1C48 A;  5C0X G;  2OXP A;  1LT3 D;  1ZXT A;  3NPP A;  3MC0 B;  2JEB I;  4KV6 A;  5CV4 A;  2J4X A;  2XIW A;  1EYA A;  2EDG A;  2A73 B;  1I6H B;  3S17 B;  2MJ8 A;  1TWF B;  2IX0 A;  2NBF A;  2SDF A;  1LO5 D;  3I4M B;  3VYT A;  5C4H A;  1UUP A;  1BF4 A;  3FPP A;  1HXY D;  2DNC A;  4FF4 A;  2A6H D;  5C0X J;  4Q5V A;  2J0T D;  2K03 A;  5EJW A;  5A35 A;  3PUY A;  5ELB A;  2FMC A;  2XSC A;  5KNB A;  3S2D B;  4KJN A;  2K5D A;  2B2U C;  3I91 A;  3EA6 A;  1AW7 A;  2O4X A;  3D4W A;  5JEA G;  2B2W A;  2LS0 1;  3Q22 A;  3BVZ A;  2O2L D;  3RLF A;  3T16 A;  3M85 A;  1BCP D;  4B9W A;  3H3V C;  3TZD A;  1KAB A;  3R2T A;  1H9S A;  1K83 B;  4ME5 A;  3GO5 A;  1SJH D;  2BOS A;  3AU7 A;  1ZYR C;  4F8M A;  5BN3 A;  3J80 L;  3K59 A;  1PRT D;  2Y0S B;  4FP5 D;  2NTS A;  1WTP A;  1D2B A;  3J7A V;  4ZKC B;  2A5H A;  1MBY A;  4ID6 A;  4U67 3;  5C0X I;  3L9A X;  3E6Z X;  1Z7T A;  2RDG A;  3LX0 A;  4KD4 A;  4A3I B;  3S15 B;  1GUO A;  2IJ0 A;  3X3M A;  1EQT A;  1U4R A;  5K5P A;  3D4D A;  1AZQ A;  1LTR D;  3QO2 A;  1V1O A;  2F0K A;  5M9O A;  1OXX K;  2MGS A;  4NMZ A;  2F0D A;  1JWM D;  3I73 A;  4K6L A;  2F0G A;  4DK0 A;  5JOB A;  3WOE A;  3MVV A;  4PMC A;  2X69 A;  3PUX A;  1KDC A;  1DOM A;  1TY2 A;  2CQA A;  4RKB A;  4WFN 3;  2A6H C;  1D5X C;  1JE4 A;  1SYD A;  4K14 A;  4Q0F A;  2F0P A;  3NQT A;  3KUP A;  3NHH A;  4ZKB B;  1MGS A;  1GUG A;  2QF7 A;  3NE5 B;  5IT9 L;  1YNJ D;  3CRL C;  3QB3 A;  1IYV A;  5I2Y A;  1QWY A;  1EYC A;  1SNP A;  5A2Q E;  3VR2 A;  5FO8 B;  1SYE A;  1BCP C;  1J8I A;  3AB9 A;  5G3L F;  5KND A;  2MHV A;  2DNE A;  4TRD A;  4QMG A;  5KYI A;  1SMY D;  3IFD A;  4L8J A;  5FKA C;  1U4P A;  1ONL A;  1PRT C;  2F0W A;  1H9K A;  1FR3 A;  2NWG A;  1WCM B;  2GA4 B;  1A2U A;  4ZUJ A;  2PZU A;  3S14 B;  1NCV A;  3NK9 A;  3OIP A;  4KI0 A;  2R3Z A;  1A3T A;  3DXJ C;  3MAQ A;  4KJO A;  2NVQ B;  3TDQ A;  2ICI A;  1IHZ A;  1UEA B;  1Q1E A;  4KTA A;  4FVM A;  4UAI A;  2KA7 A;  1V1P A;  1QG7 A;  1WVL A;  1M4V A;  4DNR B;  3BDO A;  3HKZ B;  1S5C D;  1Z6H A;  1VF7 A;  2KEE A;  3GTJ B;  3V05 A;  5JVG 3;  3GTP B;  4BY1 B;  1SXT A;  2R7Z B;  4KN7 C;  2WAQ B;  1XYI A;  4G7Z C;  4X3K A;  2K6A A;  2QEJ C;  1OO9 B;  4I7Z C;  5CR3 A;  4JK1 C;  3J81 L;  1TS2 A;  1SYC A;  4J1M A;  1YNJ C;  1QIL A;  1EEI D;  4EQN A;  1ILQ A;  3MXG A;  4QF4 A;  5CV6 A;  2K28 A;  5CYU A;  1EY5 A;  3ERQ A;  2A74 C;  3MEH A;  3FRP B;  1PMR A;  3K5L A;  5D3I B;  5DM6 3;  4BS9 A;  1SMY C;  1EY8 A;  1SYB A;  2IX1 A;  3K5N A;  1PLF A;  4XIG S;  1B53 A;  1RTO A;  4K5W A;  2EYP A;  3H91 A;  1D5Z C;  1WTR A;  1BBX C;  4IQZ A;  2XRS D;  3K5O A;  4QB4 A;  2KCC A;  3QOJ A;  1LV9 A;  2L0C A;  3VR5 A;  1BCP F;  4RGN A;  2E76 C;  1JC7 A;  1BXT A;  1V43 A;  2BDN A;  1STN A;  4OO1 H;  2BE5 D;  2ENB A;  4OL7 A;  2RVL A;  3EJI A;  1I4X A;  1HQR D;  5COY A;  3OHX C;  1B2T A;  3R2I A;  1Y1W B;  3S1R B;  3HOZ B;  3D31 A;  3KLS A;  4XQJ A;  2KCN A;  1KNA A;  2TSS A;  4FYD A;  3EFX D;  4KK7 A;  2EVB A;  4TKO B;  4K8I A;  3QOL A;  5HUR A;  1HA5 A;  1EY9 A;  2B2T A;  5C5M A;  1QE6 A;  1HCZ A;  3BDC A;  3R93 A;  4ZRZ A;  1FNU A;  2KJX A;  5D3D A;  2E2H B;  4LJZ C;  4EQO A;  2KHS A;  4CJ2 C;  1I3Q B;  1V8Q A;  3SR1 A;  4DU9 A;  5FO7 B;  1S5F D;  3V2T A;  2NN6 H;  1IYU A;  3NTK A;  4DGZ A;  2VUM B;  1LTT D;  2JYO A;  5T1I A;  4N9T A;  1IW7 D;  4KKT A;  4RCN A;  2WB1 B;  2PW7 A;  4ZQ3 A;  4FXD A;  3KF8 A;  2M00 A;  2NVY B;  1G29 1;  4H13 C;  1B4O A;  4FXK C;  5HGT A;  1M8A A;  5CV9 A;  2EPB A;  2MP1 A;  1HA6 A;  4KY5 A;  1STG A;  3HEJ A;  4IUR A;  2DN8 A;  5K36 H;  2Z8L A;  3CU7 A;  3P1H A;  2M9V A;  5IOD A;  4NKL A;  4KKS A;  1F9R A;  3HOU B;  3U9O A;  1J9O A;  3JAM L;  1D1K A;  1BR9 A;  5JPM C;  5KGU A;  2BE5 C;  1KLU D;  4HSP A;  4TSS A;  1VDZ A;  2WII B;  3H09 A;  3W3A A;  3BDL A;  2Q8T A;  3I3C A;  4M8A A;  5COR A;  1ESF A;  1EIG A;  2WIN B;  5NUC A;  4KN4 C;  4HED A;  4OGQ C;  4IUP A;  1SYF A;  2XWJ B;  1Y1V B;  5F2D A;  5CV5 A;  3OMC A;  3BVM A;  1PDQ A;  1EOT A;  1RDP D;  4XT1 B;  3U9S A;  2AUK A;  2F0F A;  4HTH A;  1CHQ D;  3FMC A;  3RD4 A;  4R8N A;  1AFP A;  5KEE A;  1SNC A;  2TMP A;  3MTS A;  4LAA A;  3GV6 A;  4DA2 A;  3LNN A;  3A8J E;  4E6I A;  4F7X A;  3M4O B;  1X3P A;  1KLG D;  4HN7 A;  1IW7 C;  1EYD A;  2B8G A;  1AEX A;  1GXD C;  1LTB D;  1BO0 A;  2D2C C;  3EQL C;  4J6H A;  3I8Z A;  3M7N A;  5C0X H;  2L55 A;  4IAL A;  1TR5 A;  2E2J B;  2L9H A;  1GUN A;  2F03 A;  5CBE E;  3SEB A;  3BZD B;  1F2Z A;  2D9U A;  4BA1 I;  4IFD J;  2Z4I A;  5IOC A;  2EYL A;  1ESR A;  2B63 B;  1HUN A;  5IGC A;  1DCZ A;  4WRD A;  5EPK A;  1GUS A;  1XX8 A;  3IAY A;  5C44 B;  4CBV A;  2RQX A;  3RZD B;  4A3M B;  3R3O A;  3KK7 A;  2PMZ B;  5CBA E;  2YU9 B;  5JEA H;  3VYS A;  3J7Y W;  2Z4H A;  2PZW A;  2KVM A;  4DAP A;  1O7Z A;  3MXU A;  4HMI A;  1NUC A;  5I9P A;  1EWH A;  4HR7 B;  1Q3L A;  3J7A F;  2EYJ A;  4RGO S;  1LTG D;  4A3K B;  1F2Y A;  5JEA J;  4IFD I;  3VYU A;  2BA0 A;  2EXZ A;  2O5I C;  1BNZ A;  1L0X B;  4PV1 C;  5BN5 A;  1WTO A;  5IGD A;  2B2Y C;  5C6A A;  1JCK B;  1Y69 U;  2B2V C;  5FLX L;  5M5X B;  2X6G A;  1CQF A;  3WDN A;  5E1F A;  1EY6 A;  2SOB A;  2VNU D;  1II3 A;  1STY A;  3A7A B;  2KQ3 A;  4RH6 A;  3FDT A;  4G7O C;  3Q6S A;  2LFN A;  3F2U A;  3K7A B;  1W6J A;  4IUN A;  4PMB A;  4IZ8 A;  1Y8O B;  3SK5 A;  3L3O C;  2B8F A;  5EKL A;  1B50 A;  3SXH A;  3NUC A;  1RJT A;  3VR3 A;  1TS3 A;  4C3I G;  1TT2 A;  1LTA D;  1GOZ A;  1L0Y B;  3FPU B;  3DWQ A;  3DMU A;  2Q8R E;  3NTH A;  1EQV A;  3L7Z C;  4N9P A;  3LWU A;  1B9M A;  5A2Q L;  1NSN S;  2RDF A;  4RGT A;  1C8C A;  1ET6 A;  3DM1 A;  3DHQ A;  5CV8 A;  1PFM A;  2PNR C;  3TN2 A;  1ICW A;  1TWC B;  1JWU D;  5EGT A;  4MIU A;  4X3T A;  2K1B A;  1FD7 D;  3H0G B;  1PTO B;  3H94 A;  4V19 0;  1CA6 A;  1KAA A;  2NTT A;  2F0O A;  2EY1 A;  2WV6 D;  3P7J A;  5JPN C;  4IUU A;  3BS1 A;  2HUG A;  4G4K A;  1XWE A;  3NBH A;  2RSO A;  2SNM A;  2ICE C;  2EY2 A;  5J39 A;  1Q1B A;  2QCP X;  4RWS C;  1IKL A;  2EZV A;  4C1N I;  1HFG A;  1EU3 A;  2K01 A;  5I6W A;  3TP7 A;  4QIW B;  4J8Q A;  1LTS D;  2RKS A;  3K58 A;  2IW3 A;  3LWE A;  2D62 A;  3K57 A;  4KY6 A;  1GHK A;  4B08 A;  1LT5 D;  4V0B A;  4ULL A;  3M3Y B;  4K2L A;  1TWH B;  1TQO A;  4XQQ A;  1H9S B;  4NP5 A;  5J1Z A;  4B9X A;  4EQP A;  5DM7 3;  5LL6 S;  1F9S A;  1SAP A;  1PZK D;  4PQX A;  2RBM A;  3GV3 A;  4DXG A;  4RHS A;  1TS4 A;  3MXP A;  1EY7 A;  3VR6 A;  5IIF A;  3T53 B;  5JAV A;  4OIJ A;  2JA7 B;  4U68 A;  1JWS D;  4GZY C;  3PUZ A;  4K5X A;  2RSN A;  2LY7 A;  1RCV D;  3I70 A;  2A68 D;  3VA5 A;  3I72 A;  1CM9 A;  1HQM C;  1OXV A;  1EEF D;  1BQQ T;  4RCO A;  5I9O A;  2PCF B;  1SJE D;  2ZXR A;  3D8G A;  1U4L A;  3CKI B;  2I46 A;  4A3D B;  1R9T B;  1K8O A;  3DEP A;  5C5L A;  4QCL A;  1ENC A;  3BYT B;  1JOQ A;  1RHP A;  1H9J A;  2OEO A;  2AUJ D;  4A3B B;  1F2M A;  2OT2 A;  1FNV A;  3HS0 C;  5EPJ A;  4DK1 A;  3J81 E;  1SE2 A;  4UDU C;  1Q12 A;  4C3I B;  1R4Q B;  2FIN B;  1R4P B;  4IUV A;  1BUV T;  1MD2 D;  1TU2 B;  4RHR A;  5JJZ A;  1CHP D;  2F0E A;  4R8I A;  1DXM A;  3WOF A;  3HOW B;  1QNU A;  1O7Y A;  1SSO A;  3QG1 A;  4QUF A;  3TZU A;  2G9H D;  3SVM A;  3TP8 A;  2AWN A;  1PRT F;  5CGK A;  1EZ6 A;  1O80 A;  2XWB B;  5J22 A;  1I4G A;  4KHV A;  1NR4 A;  1STE A;  2G9D A;  1HHV A;  4ILW A;  4FNF A;  1EIH A;  1STA A;  1Y8P B;  4OO1 G;  1A3V A;  1QCB D;  2PYK A;  3TP5 A;  2NVT B;  1HUM A;  3K5M A;  3IKJ A;  3HZX A;  3DEO A;  1V1P B;  1I50 B;  5E3F A;  4X3S A;  3MFY A;  2A68 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...