3GV3A

Cxcl12 (sdf) in trigonal space group
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
62
structure length
62
Chain Sequence
LSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CXCL12 protein
publication title Heterologous quaternary structure of CXCL12 and its relationship to the CC chemokine family.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
total genus 12
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2009-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3gv3A00
5D65A 3IFDA 1SDFA 2B2WC 1Q3LA 2KUMA 2FINB 2MJ8A 3H91A 2B2WA 4XDXA 5T1IA 1XX8A 1RODA 2HCIA 2K05A 3N52A 1QE6A 2B2YC 3KBXA 4IURA 2CVRA 2FFKB 4RA8A 3MWYW 1RTOA 1EOTA 3I8ZA 2B2YA 4IUVA 1U4PA 1J8IA 1G2TA 1TVXA 1EIGA 1X3PA 2K04A 1HHVA 1CA5A 1HUNA 3KUPA 3FDTA 2X69A 1BNZA 1ILQA 3DEPA 5DNFA 3IL8A 1X3QA 1F9PA 4X3SA 2FJ2A 1HRJA 4MHEA 1DOKA 3F2UA 3ONAB 2D9UA 4MN3A 1F9SA 1SSOA 4NW2A 2MPMA 2XIWA 2B2UC 4QUCA 2M2LA 1AP0A 3I90A 2B2UA 1RTNA 4OIKA 1G2SA 3SVMA 4R8IA 1S4ZA 3FPUB 1PDQA 2KVMA 2HDLA 5JJZA 1F9RA 5D14A 4ZKCB 2L11A 1NAPA 2Q8TA 5CBAE 5E4WC 1HFNA 5EPLA 1PFBA 2J7ZA 2R3ZA 4OIJA 1U4LA 4XT1B 1WD0A 5CORA 1B2TA 1EL0A 2L9HA 1WVLA 1O80A 2RSOA 1ZXTA 4HAEA 5EKIA 2KEDA 1A15A 1VMCA 1F2LA 3D6WA 1AZPA 2MP1A 4X3KA 5EJWA 1B53A 2KEEA 5EPKA 1HA6A 3DM1A 1PFMA 4X3TA 4LMQD 1O7ZA 1BO0A 2X6LA 2EOTA 2K01A 1J9OA 1DOMA 2DY8A 3DEOA 4RWSC 2H1EA 4XT3B 5EPJA 4ZAIA 1U4MA 3HP3A 4R9WA 1WTOA 1PLFA 1QG7A 2K28A 3QO2A 1KNEA 1DOLA 1HUMA 4HEDA 1ICWA 1DONA 1U4RA 2X6GA 5EQ0A 1BBXC 1IKMA 1RHPA 3MTSA 2Q8RE 3LWEA 1VMPA 2N55A 4U68A 1NR2A 1C8CA 1PFNA 1IL8A 1IKLA 1CM9A 1ESRA 1G6ZA 4IUTA 1E0BA 1GUWA 1JE4A 2VXWA 1WTPA 1BF4A 1AZQA 2B2VC 2B2VA 4HSVA 4QUFA 1EIHA 1F9QA 2SDFA 2FHTA 1O7YA 3GV3A 4HCSA 1HFGA 2EE1A 2HDMA 4CJ0B 2L4NA 5AFWA 1NCVA 2IL8A 1CA6A 1WTQA 1MSHA 1M8AA 3P7JA 2RA4A 3R93A 1WTVA 2JP1A 4ZK9B 5T1GA 2KOLA 2HUGA 5COYA 3TZDA 1B3AA 2RVLA 3TN2A 1JICA 2RSNA 2B2TC 2HCCA 1ML0D 1WTWA 4IUUA 5CMDA 4ZLTF 1XYIA 1ILPA 1B4OA 2B2TA 1G91A 2K03A 3UI2A 4CJ2C 3GV6A 1EQTA 4IUPA 4O42A 2N88A 4X3UA 5E4XA 5CBEE 1WD1A 1MI2A 2NYZD 4DN4M 1MGSA 4RAUC 1NR4A 2EPBA 2L12A 2MGSA 2FMMA 2NZ1D 2NWGA 3I3CA 2L1BA 2BDNA 3G7LA 3I91A 1RJTA 1KNAA 4ZKBB 1SAPA 4CJ1B 1QNKA 1WTRA 1DZ1A 1X32A 1MSGA 2DY7A 2JYOA 3Q6SA 4UAIA 2K1BA 1B50A 1LV9A 1WTXA 2KECA 4IUQA
chains in the Genus database with same CATH superfamily
3D4WA 2JA5G 3E0JA 2F0GA 4JBWA 1Y69U 3DMUA 2VB3X 1JJGA 4XDXA 4B08A 2BOSA 2R61A 4P71A 1XX8A 5GADC 1XPUA 3NK9A 2WV6D 1U4PA 2WKCA 3S1NH 1K8GA 4AYBB 1HUNA 4K5WA 4A3KG 1VQNA 2GVBA 2KCTA 3CCVA 2WACA 5IWAL 2UUBL 4OEMB 2HIVA 5IE8A 2B2UC 4OX9L 1PDQA 2LY7A 3GO5A 3OSOA 5M5XH 1PFBA 1I94Q 1RF2D 4OIJA 4XT1B 2K52A 5GQOA 3G71A 1K0SA 4FXGC 4HAEA 1E1OA 3CCMA 2MP1A 3T51B 1H9RA 1A2TA 1XPRA 3GTKH 4FYDA 4YCUA 2JJQA 2WAQE 1BO0A 4ABNA 4LFBL 2K01A 4RWSC 4C3HG 5C0XJ 1WTOA 1K83B 1GUTA 2K14A 3C3LA 1RKNA 5J22A 2R7ZB 1D6EC 2X6GA 3MC0B 3R2IA 4GLVB 1BBXC 1VQ5A 4APVA 3MTSA 3M3YH 4LF9Q 2V4DA 3PO3B 1VQ9A 3RR5A 2JA6B 4DUYL 1PYBA 1K8MA 5CC4A 1G6ZA 4PG3A 1E2ZA 1KXLA 2PI2A 2AHOB 1VDZA 2VXWA 2LKVA 2XSCA 3MXGA 2Z6KC 1SYCA 3BDLA 4XIGS 3VYUA 1Q12A 4A3FB 3HOZB 3RZOB 1D1KA 4C2MH 4A3MH 3PO2H 1DM0B 3R93A 4YHHL 5M5WH 3AU7A 3TZDA 2YV5A 3QB3A 4MNOA 1ZEQX 1CI3M 3GD7A 3PF5A 4X3UA 2EVBA 3HGBA 4X65L 1HPCA 1NR4A 4DFAA 1SEBD 2I07B 1K73C 1WTXA 3BVGA 1SR3A 1B8AA 5D65A 3CC4A 1YVCA 2E2JH 2Z4IA 3SXHA 1QE6A 1A8VA 4RHRA 3T1HQ 3KLSX 1QCBD 4A3EH 2V1CC 5C4JB 4XQQA 1TVXA 1ESFA 3FDTA 3CU7A 4LF7L 1TY2A 3IKJA 2EDGA 3KOJA 1PH1A 2H5XA 2RBMA 1VQHA 4DV4L 4OGQC 1TWGH 4QUCA 3RN2A 4KI0A 1YJNA 1BUVT 2B2UA 2Y0SB 4IPDA 3H15A 2KVMA 1TWAH 4JI3Q 1E22A 5EBDA 4A3LG 4DV7Q 3TEHB 3R8BA 3M4OB 1EWCA 3HOYB 1G291 1U4LA 1B70B 2K50A 2MNAA 5EKIA 3T13A 4BBRH 1S5FD 4GN3B 4ZUIA 4F8MA 2KEEA 1HQRD 4CKBA 4R9WA 2K28A 4C1NI 2PI2E 1D5ZC 1JQYD 3CC7A 1NJIC 5C4XH 3K80C 4N8X1 1N32L 1JWUD 2OXPA 1PRTB 4FF1A 1ET9A 4OWWB 1IKLA 4BY7G 2NVXB 3JAML 1WTHA 4CKEA 5C3EH 4WRDA 4OO1I 4LF6L 2KCNA 5FLMG 1UE1A 2UXBL 3VR5A 1AFPA 3PUWA 1NCVA 2IX1A 2RA4A 3K8AA 2VQEQ 5K36H 1TIID 2RDHA 2KHJA 4K2LA 3S2HH 5NUCA 1U0LA 4A3JG 4P75A 2R93B 2B2TC 3D31A 1WTWA 4A93H 3TSSA 4TRDA 3A8JE 3CXCA 1LUZA 4DV0L 4IUPA 3Q24A 2Z9HA 3L9AX 1P16A 3U9OA 2NYZD 4YY3L 1HH2P 1XMOL 4DR6Q 1TWFB 3DHQA 1CKNB 4EGVA 1QZHA 2UXCQ 4KHZA 4EX5A 5KIXA 3AFPA 4HMJA 3CCQA 3S14B 5GAEC 3D0FA 2PMZB 1MIUA 1WCMB 3H91A 5FLXc 2ID0A 3OW2A 2HCIA 3K5LA 3I4NG 2CWAA 4JI4Q 3M4YA 4UDUC 1E3PA 1QVCA 2B39A 1C48A 2RQXA 2K33A 4IJHA 5I2YA 2M00A 1S5ED 5FKAC 4C56C 2R7FA 4BBSH 4Z9CB 1V8QA 4X3SA 3DLLA 1RD9D 2PCFB 5ELOA 2NVQH 3GTOB 1AP0A 2EYHA 3VR4A 3KJOA 1S4ZA 3SK4A 5CV4A 3ITPA 3HOZG 1HFNA 3GTLH 5BN3A 1B2TA 2Z1CA 1D7QA 1WVLA 2NZHA 2RSOA 3TP7A 2K75A 4NXML 2F0LA 4EQNA 1IBML 2WAQG 4IJLA 1W3SA 1MD2D 3I2ZA 4V190 2DY8A 2H1EA 3HOWB 4KY5A 2DN8A 2JEBI 4F88A 3I7FA 4A3GB 1KNEA 1HUMA 1ONLA 1DONA 1QNUA 3DXJC 2Q8IB 4B9XA 2RDGA 1B7YB 3T1YL 2GVAA 4B3TL 3F2BA 1EY5A 3PGZA 1ASZA 3PV0A 4WJWA 2O4XA 5C4ZA 1CM9A 1ESRA 2E2HH 1HNZQ 3VR6A 5ELBA 2GN5A 4KLKA 4DV3Q 1WTPA 1FJGL 2UU9Q 1PRTF 3KDFA 4JYAQ 2JA7G 2SDFA 2FHTA 1G8ZD 4KN7C 2ZJPA 3RLOA 3PUXA 3HOUG 5ELCA 4NP5A 3KFUA 3TN2A 4LFAL 2VQFQ 2E2IB 2B2TA 1TU2B 3M7GA 5C5MA 3NWSA 4L5QA 4EVOA 2K5VA 3BG3A 2F4VL 4IN3A 2K7VA 3HOVG 4WORA 4XYQA 1LTTD 1LABA 1MJCA 3T56B 1T5XD 4GLAC 3PMFA 2XTIA 1M1KC 5ELFA 3HKZB 1O7IA 2AMCB 1WOCA 2ICEC 2BDOA 3N52A 2L0CA 5GROA 1V1PA 1GD7A 3H0GB 2ALYB 3K7UC 4IUVA 5C44B 2KA7A 4B3SQ 1EYAA 1IYJB 1EIGA 1JJCB 1GOZA 1NY4A 1JOQA 4K5XA 2LFNA 2O5IC 1TY0A 1T9HA 1EU4A 1STBA 1HXYD 1DOKA 1CZWA 4UP7A 2D9UA 3FKIB 3K7AH 4K0KL 1Y1WG 3KLRA 4K8IA 3BYYB 4R8IA 4YCVA 1V1QA 5FLXE 3M85A 4G7ZC 2ES2A 2K5WA 1I3QB 4YWMA 2PNRC 2VUMB 2Q8TA 1SNPA 1I50B 4L5SA 1QUQB 1RDPD 4DAYB 5A35A 5LL6S 4DR3Q 3SGIA 3VR2A 2NTTA 1YI2A 5EPKA 5M3FB 4HCEA 2I0QA 1O7ZA 3DEOA 4DV7L 3FPPA 4LUOA 1VF5C 2R92G 4L5TA 4IO9A 2BA1A 5IGEA 4JI2L 3I4MG 1KLGD 3HRZC 1HTPA 3WDNA 3FEWX 5HURA 1VMPA 2BA0A 4UPAA 4B3MQ 4JI7L 4L5RC 3MEFA 4PV1C 4BY1B 4JG2A 2YTVA 4XQNA 1IZ6A 1FGBD 4GKKQ 1Q8IA 1AH9A 5KNBA 2ZTCA 4GOPB 2JA5B 3G6EA 1K3RA 3RD4A 2ASBA 3CCEA 2N8NA 4YCWA 1Y1VG 3DUZA 3VYTA 2UUAQ 1R4PB 1IHZA 4HJ8A 2RVLA 1AE3A 4A3KB 4FNFA 2KENA 1OXUA 5LMUQ 3MXUA 1EQTA 1WD1A 1A2UA 1K83H 3VA7A 4IFDG 4CJ1B 5CV9A 5CV8A 5ELEA 4K2KA 3S15B 1UWVA 3CP0A 3KLWA 3PO3H 2JA6H 2UXDQ 3OW7A 3UE1A 2Z0SA 2CFMA 1N33Q 2QILA 1KD1C 1D5MC 3S2DH 4JI6L 5C5LA 3K57A 4DR1Q 4R4CA 5M5YB 1PH5A 2ZXRA 3S24A 1J8IA 1X6OA 1VS0A 2IX3A 3S16H 1FYCA 1EWHA 1BKBA 1SE4A 1EY9A 2AUJD 3CCJA 2VS1A 2QA4A 1PHJA 4IOCA 1X3QA 3E9HA 4A3FH 2CWPA 1JE5A 4C3HB 4Y7NB 3C2PA 1H9SA 2EY2A 3F2UA 2MPMA 2B3GA 5I2XA 3MHBA 4OIKA 3FRPB 2WIIB 2AUKA 1SJHD 1HCZA 5JPMC 4JV5L 4QMGA 4JCVE 4X66Q 1V43A 3D6CA 2NN6I 3FHWA 1IYVA 5CORA 3ZJYC 4LFCQ 2KHSA 4QF4A 1D2BA 4TVAB 5EJWA 1HA6A 5BN4A 1B44D 4XT3B 1ENCA 1QG7A 2XGTA 1JC7A 3PUYA 2AQ3B 4HEDA 1XXGA 3CQZB 5C4JH 4KY7A 2FMCA 4A3CH 3V05A 1XMQL 1HQMC 4WJ4A 3A7AB 1YNXA 1IL8A 5G3LF 1SJED 4DF7A 2KQ3A 2CQAA 1BBWA 1JWMD 4HJ9A 1DD2A 1BF4A 3PCOB 2P5ZX 1CFMA 4DV5Q 3KF6B 1HNWQ 1FNVA 1SNCA 1EIFA 1MHWC 1PRTC 3ER0A 3M4OH 3HZXA 1CT1D 3OMCA 1QVFA 1OXXK 5FJ8G 1AEXA 1H9JA 4C1NK 4LNQA 1Q81C 1HNZL 3DWAA 3NELA 4POFA 4KV6A 1JICA 2WP8J 4FVMA 1YZ6A 1PTOB 1LTLA 1XJVA 4KTAA 3NHHA 1PXUA 4JYAL 3ND9A 2K5NA 2OQ0A 3A56A 2AKWB 5A2QE 1X32A 2F0SA 4ILWA 3NTHA 1FNUA 1Q3LA 2MJ8A 4LJZC 1S40A 4HSPA 4NXNQ 2NVXH 4IURA 2A6HC 4QIWE 1RTOA 2R7DA 3L0OA 1YJWA 3EVQA 1II3A 1X3PA 2PQAB 3V96A 1VQ4A 1FD7D 4X6AH 3A5ZB 4B9WA 2B8GA 5JJKA 1PZID 4J1MA 4C3IG 1E7ZA 3E6ZX 4PNYA 2R93H 1EIYB 4R8NA 5E7NA 3SK5A 1ZYRC 1PH2A 4ZKCB 4BXXG 1BVSA 4BY7B 1AW7A 1L1OA 4KY6A 1PH8A 1P8LA 1ZXTA 1VQGA 2KEDA 3S14H 1HNXL 3SE0A 3U4ZA 5C0XH 1WCMH 1T5EA 2Q2HA 2A6HD 1U4MA 4KN4C 2E75C 3J80L 4A3JB 3QWNA 1YNJD 4DUZQ 1EZ6A 1TS3A 1PH3A 2Q8RE 3LWEA 5LMNQ 1RCVD 1JCKB 1SE3A 2BH8A 1PH7A 3BJUA 4DR7L 2EYFA 3J81L 1TS5A 2JE6I 2PNHA 3GTOH 3RNUA 4NPSA 1YJ9A 4A3IG 4QL5A 4HR7B 4JI1Q 5IYCH 4HIMA 1HR0L 1DCZA 3WOFA 1Y14B 1ZYRD 1C0AA 5IYBG 3HG9A 3VYSA 3GDEA 3WOEA 2A19A 2ZM6L 1GXDC 1FGUA 1EQQA 4B3ML 4ZCKA 3I4NB 2WINB 2O5JC 4DXGA 1YHQA 3X3NA 4Q5VA 5J1ZA 3K5NA 2KCMA 2F3WA 5IGFA 2K32A 1MKHA 3FVQA 4J6HA 3HOWH 3ULLA 5IP7G 4GKJQ 3I70A 3I91A 4B3RQ 1PTOF 2F0EA 2UUAL 1SAPA 3WWVA 3RLNA 1QJOA 1SYFA 1Q90A 2JYOA 5H1SE 3S9WA 4JVZA 4LF5Q 2KUMA 1U9RA 1IBLL 5EGTA 1AN8A 4MTNA 3L2PA 3OTOQ 4IFDJ 4LF8Q 1CKNA 4QJFA 1NTGA 3ERSX 1HHVA 1EEID 2EXZA 1EWIA 4X62Q 3ULJA 2J0TD 1G6PA 3UDXA 1NUCA 2F0MA 2WAQB 1J5EQ 2D2CC 4X64Q 3O13A 2WFWA 5DLQE 1EFID 4IOAA 1F9SA 4OWXB 3KF8A 2M2LA 4DK1A 3GTMH 1BBUA 3EFXD 3K5MA 1JT8A 1AE2A 5JJZA 1E2WA 4KJOA 2L11A 1NAPA 5E4WC 4OHJA 2YYZA 3P1HA 4R4IA 3RZDB 1IW7C 1TQOA 4H44C 3U4VA 1BCPB 1TKWB 3M7NA 2BE5C 2A69C 4LMQD 2JA7B 3PIO3 4DR2Q 4DV6Q 3I4LA 3H0GH 3BZKA 1V1OA 3HOUB 4X66L 5C44H 1DOLA 2JA8G 5JAVA 3F2CA 1SFOH 1IXRA 1YHAA 2N55A 4U68A 4KMUC 5CV5A 4UY8C 2E74C 3FKIH 1XNQQ 1E0BA 1LT6D 4IPGA 3A5UA 2A8VA 3HOVB 1EYGA 2KBNA 5KGUA 3G6JB 3CKIB 3PIOA 5AJ3L 4HSVA 3DM3A 1N8RC 1FNWA 4HCSA 2F0IA 2JQOA 1U5KA 1F2MA 3I72A 3A8KE 4DK3C 3DWPA 2BE5D 4YIJA 1B3AA 5M3FH 2F3IA 1O7LA 3GV6A 2B63H 5CV6A 4IPCA 1Q1EA 1Y1WB 2NZ1D 4ZRZA 1QNKA 2L55A 2Z6KA 1TWCB 2WB1E 1X55A 3STBC 1CSPA 1F2YA 4BY1H 2XRQD 3Q22A 2CVRA 2HQLA 3HOXG 1EOTA 4IPHA 5JJLA 1L0WA 1DGSA 4H7BA 5IYDH 2JA5H 2DNCA 5J39A 2DJFC 2VY3A 1ILQA 5HGTA 4EQOA 4MHEA 1N36Q 2R92B 2AQ1B 4P72A 1SSOA 1UNSA 1KAWA 4FXKC 1XNRQ 3I4MB 2DJGC 3J7AV 3MXNA 1Q8KA 3GTQB 5C0XI 3U58A 4FDBA 4KD3A 1A0IA 4RKBA 5JOBA 4LUZA 4JI5Q 1X3GA 1IL2A 2R3ZA 4DR4L 3RN5A 3SK8A 3U50C 4HIOA 1I4HA 2K4KA 5IGCA 1A15A 4GZYC 3S15H 1B53A 3STBD 1D1IA 1K8OA 4CDEC 1HA5A 1Y1VB 2C35B 3HP3A 5KEEA 1BCPF 5M5YH 1CK1A 1S3OA 3QJYA 1ICWA 1U4RA 5IODA 4G4KA 1EEFD 2D0OA 5JEAG 1ASYA 4C3JG 1NR2A 3BZDB 1PH9A 1PFNA 1PMRA 4KKUA 2F3VA 5I9PA 1C9OA 1EFWA 1YEZA 1I6HB 2F0OA 5M3MG 1WI5A 3VR3A 4DUZL 2RCNA 1QWYA 1EY0A 2OF1A 3NTKA 3NBHA 5FO9B 3VDYA 3K5OA 3R2TA 1I94L 2NN6H 4BS9A 1WTQA 4PZ7A 3EROA 4J15A 2FXQA 3OWEB 1SLJA 1Y8OB 4AQYQ 2N49A 4LAAA 3JAMc 1XYIA 2K03A 3UI2A 2TMPA 1F77A 1I4XA 1D5XC 4LF4Q 3J7A5 1LLRD 1VQCA 3CQZH 1N34Q 4JPBW 5BN5A 4DR5Q 3NTIA 1N9WA 1CKOA 4DV2Q 1H95A 4JW0A 1PTOC 4LF9L 4KHPQ 2F0FA 1SDFA 1GO3E 5T1IA 3TP8A 1RODA 1VF7A 2FFKB 4A3BG 4GKJL 4A3DG 1LACA 1TS4A 2EJMA 2IW3A 5IT9c 4ZUJA 1DXMA 4WJ3M 2X69A 3DEPA 1NBWA 4A3CG 1E24A 3IL8A 5KNDA 1UE6A 4DXFA 3S1MB 4JI8Q 3AEVA 1C7YA 2YTYA 4N9PA 4JBMA 1PTOH 1TR5A 2DUDA 1MBYA 5I6WA 4ULLA 4X62L 2JXMB 1Z7TA 2O2LD 3K58A 2OQKA 5GAHC 1HR0W 1S5CD 4OWTB 2A6EC 2F0DA 2NBFA 2HHHQ 3J7YW 1FR3A 2L9HA 4PMCA 5D3IB 1JB7A 4GN4B 1KTKA 2EOTA 1G2TA 3TDQA 3N6RA 2RCFA 3CPWA 3T1HL 4KKTA 4M8AA 4QY7A 1LTAD 2PZTA 3W1BA 3QR8A 1TWGB 4P74A 5I6YA 2CH4A 3IRBA 3QG1A 1S5DD 1TWAB 1SNDA 4DR2L 3CCLA 1L2FA 1TWHB 3SHLA 3S17B 3A54A 1VCIA 2B2VC 1VQMA 2QGQA 4JI3L 4QUFA 4OO1G 1HFGA 3QOJA 1KDBA 5AFWA 2HQEA 1XNQL 3MVVA 3P7JA 1KC8C 2QDLA 5DM73 3QOLA 4OX9Q 2EJGC 2I5LX 1QVGA 3TQYA 2BCOA 4IUUA 1M90C 3OPOA 2GA4B 4CJ2C 1X56A 1I4PA 2K5QA 2Z4HA 2E5LQ 4DN4M 2D5DA 4RAUC 3LGJA 4BWGB 4C3IB 4A76A 2E2DC 2PPBC 1KNAA 4A3JH 5K5PA 2DY7A 2IWHA 2KECA 4QQBX 2WB1G 2B2WC 3U9SA 2ZTEA 4ID6A 2Z8LA 5C0XG 2F0UA 1VQOA 5EBCA 3JAME 3AB9A 2PQEA 1CA5A 3ICEA 3S2HB 1SE2A 3S1RB 1PVOA 5IGBA 1CQFA 4PMBA 2Q2IA 4I65A 2D0PA 3ONAB 4KK7A 2R7ZH 1LTGD 5CYUA 2VQEL 3X3MA 4YWLA 1SMYC 2K5DA 1YNNC 1J6QA 1RTNA 1Q46A 2PW5A 5IY0A 2F0PA 2F0VA 1BDOA 2LS01 3KDFB 2PQAA 1CZGA 1KIXA 3EBEA 5CBAE 4DR6L 4QGUA 1C4QA 5IT9E 3K0XA 4A3IB 4YHHQ 2UXCL 1GUSA 4P73A 1ZKOA 3BVMA 2AWNA 3HOZH 1M4VA 1PFMA 3DM1A 3RZOH 1GUOA 3A8IE 5EPJA 1VQLA 4GLXA 3CC2A 1GUNA 1QILA 1RL2A 4JI4L 5BR8Q 3C46A 2NVQB 2IHFA 3NWTA 1JOOA 4FF3A 1R9TB 1RHPA 4HJ7A 4FF4A 1KLUD 4P2CB 1JB3A 1B9NA 2EY6A 1V1PB 1YNND 5C3WA 4A3MG 5C4HA 3PO2G 1PA6A 4V0BA 3GTLB 1H9KA 4OL7A 5IOCA 2B2VA 3KBGA 1LT3D 2EY5A 3NE5B 5JEAJ 2MO1A 1O7YA 3RZDH 4DNRB 3GTGB 3IFTA 2EYOA 4RH6A 1CSQA 4XXEA 5M9OA 3S1QB 4R4OA 4JOIC 1SYBA 4CGYB 2CH4W 1YIJA 1MI2A 3JAMi 2L12A 2EYJA 2FMMA 2NWGA 3PF4A 2PZWA 2E2HB 4DNIA 1NSNS 3H3VC 1EY6A 4A3EG 1ENFA 3TP6A 4AQYL 3KLSA 5C3XA 1A3TA 3HOYH 2B2WA 2K05A 5CGKA 2EXDA 2MHVA 3NQIA 4IZ8A 5FO8B 2I5HA 3HOVH 1B3QA 4DV3L 2UU9L 1QB5D 3TS0A 1ET6A 1BNZA 4M1UB 4DV2L 2RF4A 1N32Q 5JVG3 2LMCB 4CBVA 2CCZA 1E1TA 4MN3A 2ZJRA 1KRTA 2JA8B 3H3VH 3D4RA 1GKHA 1SYGA 4FO2A 2A74C 1SNQA 4BBRG 2VQFL 1F9RA 4GN5A 4LF6Q 3SR1A 3NQTA 2UXBQ 5HY6A 1CUKA 2AQ2B 4ODGA 2B8FA 1SMXA 2C5CA 3MEHA 1Y1WH 2UUCQ 2J4XA 2LXKA 1A62A 5ISRA 1GUGA 2IX0A 2VW9A 4AYBE 1PRTD 1TWCH 4F87A 3TZUA 5C4XG 1VQ6A 1SROA 4YY3Q 1XMOQ 3HFZB 3C1FA 1PLFA 2B63G 2HHHL 2F0JA 3QO2A 3A7LA 1EOVA 1EY7A 3K7AB 4RHSA 4B3SL 1X65A 1Q82C 5C3EG 1VQKA 1CHPD 2QCPX 3H94A 2OTLA 4KD4A 1TWFH 2R92H 1OTCA 4GNXB 2CKZB 1JMCA 4RGNA 2I5MX 2KHIA 2PO4A 1DJRD 3OIQA 3I4MH 1BXTA 3MFYA 5K36G 3EQLC 3GTQH 1MJEA 5EKKA 5KYIA 1Z47A 4A93G 2E76C 1LM0A 3A74A 3DWQA 4QIWB 1H9SB 2L4NA 3CD6A 2IL8A 1Z6HA 1CA6A 3HOXB 1MSHA 2G5DA 2EJFC 3HS0C 4DR3L 2KJXA 2I46A 1G91A 2NTSA 2DNEA 4JOIA 2IHEA 1XPOA 1Y1VH 2N88A 3A0JA 3FP9A 2HT1A 4ZLTF 3I3CA 4LWCA 1SN8A 4R4TA 5GAGC 3H09A 4MIUA 3MA2B 2NVYB 1B50A 1EYCA 4KKSA 1QZGA 3D3RA 4IUQA 3NEMA 3ERQA 1PH4A 1K9MC 1KAAA 4NXMQ 1LO5D 2EY1A 3MXPA 1IBMQ 1F2ZA 4I7AA 4BBSG 1EUJA 1O78A 4HN7A 3AQQA 4IFDH 1A6XA 2JA9A 2B29A 2E5LL 1I6HH 1HJPA 3I8ZA 4GKKL 3CCSA 4B3TQ 3T1YQ 4DAMA 4FF2A 1STEA 3I56A 5IP9H 1WYDA 1VQAA 1K0RA 4N9TA 1YITA 4A3GH 4NW2A 2SOBA 4BA2I 1PZKD 1FJGQ 3W5OA 1STGA 3FPUB 2A68C 1X54A 3Q0AA 4NB3A 3CMAA 2D62A 4C3JB 1EZ8A 4PZ6A 5LMUL 2VB2X 1D8LA 3S2DB 4RGTA 3UDIA 4JI0Q 2RDFA 4NDXA 5M3MB 1UE7A 2NN6G 4Q0FA 3S16B 4LFAQ 2UXDL 1DYQA 1N33L 3T53B 4XQJA 1JJ2A 2NVTB 1JWSD 4DV1Q 4DR1L 3AYHB 4O2DA 3OWFA 1SNMA 4ME3A 2F4VQ 1QOHA 4K5VA 3VYRA 4K14A 2XNAC 2Y0SE 2E2IH 4PMWA 2Q2UA 2ZXOA 4LUVA 2QKIC 3RUZA 2F4IA 2ZXPA 3S1MH 1R4QB 3C1EA 2YU9B 4O0AA 2L15A 1GUWA 2EZVA 1OXTA 2A68D 5BR8L 3L7ZC 4E6IA 3GTPB 2OEOA 2XN9C 1EIHA 3J80c 3LNNA 4IALA 3GV3A 3H6MA 1EY4A 4CJ0B 4G7OC 4A3BB 4K0KQ 4I7ZC 4A3DB 2F03A 4LFCL 2N3SA 1IBKQ 5FLXL 3UDFA 3J81c 3R3OA 1STHA 1UEBA 4XTCS 1Y8PB 1HZCA 2H4OA 5FJ8H 4RGMA 1L1OB 1PYWD 1LTSD 4TKOB 1TXYA 4UAIA 5FOBB 1I3QH 4JBJA 1KRSA 3W3AA 2VUMH 1Q7YC 4RFBA 2CQOA 3GTJB 1A3UA 2JSOA 1IW7D 1I50H 1I5FA 4ZYSA 3KBXA 4RA8A 3MWYW 1JOKA 1TWHH 3H3VI 1VQPA 3S17H 2A69D 4JI2Q 4GOPC 4CDDC 1SE8A 3CHBD 2OT2A 5E1FA 1Q1BA 4CDFC 3E0EA 4DV5L 4DAPA 1HNWL 4JI7Q 3EA6A 2RHQB 1EYDA 1K8AC 3NSWA 5F2DA 2PYKA 3Q23A 5IGDA 2PZUA 4RCNA 5C6AA 4QB4A 3SVMA 3T4AC 1H9MA 1W6JA 3E5SA 4CKCA 4L6TB 2XWJB 3B6YA 1VQEA 2PMZE 4DAVA 3BYTB 3P20A 4C3IH 3F1ZA 5G3LD 3PUVA 1WD0A 1O80A 2ZTDA 5EAYA 1VMCA 2CW0C 3D6WA 4AYBG 4DGZA 1XTDA 4XYOA 4BXXH 3FMCA 1UUPA 2OCEA 4FP5D 3PQIA 3URYA 1LTRD 2X6LA 2ZT9C 4ZAIA 3UE0A 1KDCA 4NXNL 2RHSB 2QEXA 2UUCL 1SYEA 1Z9FA 2VZAA 3ND8A 1X9NA 1NMGA 2Q2TA 3NP8A 4A3KH 1K3BC 1IKMA 3S1RH 2F0WA 3GQBA 4HJ5A 4U673 4H02A 2A73B 4JI6Q 1VQ7A 5IT9L 4RCOA 3S1NB 1PZJD 4DK6C 2WB1B 4A4IA 5FO7B 1SXTA 1K28A 2SEBD 1F9QA 3CW2C 1YHBA 1HZBA 1UAPA 2EE1A 4HJAA 4A3IH 1ENAA 1QUQA 1STNA 1X3EA 4OONA 3KF8B 1WTVA 2CW0D 4DAYA 5IYBH 2R7ZG 2IT1A 1TT2A 2RSNA 4ALPA 3AMUA 2F0NA 4C3HH 1YBYA 4Y7NH 3HKSA 1ILPA 1X3FA 5I9OA 4IFDI 4JV5Q 3PO3G 4DU9A 2JA6G 3F8TA 5M5XB 1MGSA 1PH6A 3BVZA 1LT5D 2L1BA 2TSSA 1E2VA 1RJTA 4OXPA 1HTLD 3J80E 3J7ZC 3BS1A 1WTRA 1R9TH 1MSGA 2ICIA 3CCUA 1EU3A 3GTKB 5LMNL 4POGA 4UP8A 2FINB 2F0KA 1SRUA 3NBIA 4A3FG 5DNFA 3D4DA 5IP7H 3J7AF 3J81E 1VQIA 1CQVA 1UE5A 2G9DA 3QIAA 4JI1L 1HZ9A 2RKSA 4RGOS 3MZ5A 2F0HA 1XMQQ 4GOPA 2F0TA 1S72A 3M3YB 1F9PA 2EYLA 2EYPA 1HRJA 3GTGH 4RMFA 3LWUA 5CV7A 3TBIB 4H13C 3I90A 3KYHC 3S1QH 5LL6X 4JC0A 4TSSA 4HIDA 5D14A 3GP7A 3HEJA 3HKZE 2J7ZA 1V9PA 3CF5A 4EQPA 2SNSA 3BZCA 5D3DA 4B3RL 4A3MB 4C2MB 3PO2B 1STYA 1SYDA 3W1GA 4A75A 5M5WB 3M9BA 3PSIA 3TREA 3CPFA 4L8JA 4LF5L 1VQ8A 5E3FA 1J9OA 3D8GA 5CR3A 1EQVA 2IPKD 3OTOL 3BDCA 5A2QL 1KQSA 4BA1I 4LF8L 4K6DA 4JI0L 1L0YB 3KJPA 2Y0SG 1GJXA 5DAUA 2HD3A 4G57A 5ELNA 3GTMB 3JC66 2QEJC 1L0XB 1LTID 1J5EL 2G9HD 4X64L 5DM63 2E2JB 2EQSA 3HOYG 2JA8H 4DV1L 3SEBA 1PTOD 3PUZA 4A3EB 1GHKA 1AZQA 4A3LH 3OMGA 3M4QA 2DGYA 1JR0D 4GNXC 4GS3A 3J80i 3I4OA 2JP1A 3UDGA 5COYA 1A63A 2QF7A 1BR9A 1PV4A 3MXNB 4Y52H 3K0YA 1SFOB 5CMDA 4QCLA 1B4OA 3J81i 1OO9B 1NNXA 4DV6L 2NZOA 4O42A 5CBEE 5E4XA 2OTJA 2F52A 3Q8DA 3G7LA 3G4SA 3OHXC 3AFQA 3KK7A 3TS2A 3M4PA 2LSSA 4MTKA 1IBKL 4BBRB 3SDZA 3EJIA 2A6ED 1HNXQ 4BY7H 4LW1A 1KABA 5IWAQ 2UUBQ 1GHJA 2QDBA 3EN2A 3VA5A 5L37A 4HTHA 4HIKA 2B2YC 3NXWA 2WKDA 2JK8A 2ENBA 1Y8NB 4H0LC 2K04A 3SK6A 5I4DA 5FLMH 4OELB 2R93G 2IY5B 5EKLA 3KF6A 5C4XB 2FJ2A 1GM5A 2K6AA 4G7HC 4DR7Q 3T16A 3HOXH 5DEHA 2B63B 2XIWA 1KL9A 1LYLA 4FXDA 3TP5A 1XWEA 1HR0Q 4JK1C 4JBKA 5C3EB 1B1ZA 3OYYA 2MFIA 2ZM6Q 2ZJQA 1IYUA 4LFBQ 3NBHB 3G48A 4KHVA 1WCMG 5EPLA 3ULPA 3V2TA 3K81C 2F1MA 1LTBD 4WFN3 1EL0A 1S5BD 2NVYH 1SBBB 1F2LA 1B9MA 5JJIA 4X3KA 4X3TA 2NB0A 4ME5A 3I4NH 4A93B 4DUYQ 1VQJA 3CAMA 1NE3A 3P75A 3W2DA 1BOSA 1GVPA 1LT4D 1FVIA 4IQZA 5IIFA 1I6VC 1CTMA 1SNOA 2K5HA 3OIPA 1W2BA 5EQ0A 3NENA 5KYLA 5IYCG 1W6KA 3J81j 1N36L 1OXVA 1VQFA 1IBLQ 4DKAC 4DA2A 3I73A 2YTXA 1JE4A 1XNRL 2AWOA 5JEAH 3RLFA 4C3JH 2Z6BA 4BBSB 4IUNA 2SNMA 4R4QA 4X65Q 4S3SA 4NMZA 4K6LA 2HDMA 4JI5L 1ICFB 1I4QA 4F7XA 1PFSA 5IP9G 1EQRA 3HOWG 1JORA 4GNXA 1M8AA 5M3MH 4ZK9B 1BCPC 4A3GG 1BQQT 4TQUS 1STAA 3TRZA 3NUCA 2HCCA 1ML0D 3I55A 1PYSB 2HIXA 2JEAI 2NVTH 3RMHA 1SMYD 2EIFA 2EYMA 2MGSA 5LHY1 2VNUD 4EQ5A 2BDNA 5KRUA 3K6OA 1DZ1A 1VQBA 3NPPA 3Q6SA 2A5HA 4R1JA 4LF7Q 4RKLA 4K8JA 4PQXA 1NMFA 3IFDA 4DPGA 2QW7A 4DV4Q 4J8QA 2YU9H 3F2DA 5J3BA 1L1OC 2LXJA 3CRKC 3TMEA 2OWOA 2B2YA 2PW7A 2MQHA 2XRSD 3GTPH 2JA7H 4N8FA 3KUPA 1CHQD 2E8GA 1XTCD 3HOUH 4A3BH 4AH6A 1EY8A 3CCRA 4A3DH 1BCPD 3A55A 1Q86C 4CHTB 2MO0A 3MFGA 2XWBB 1G2SA 4HMIA 5AJ3Q 2HDLA 2JN4A 5JPNC 2N78A 3ZYYX 1G51A 5JVH3 3HKZG 2MUYA 1VQDA 5IGGA 3CRLC 4LF4L 3EIVA 1N34L 5HGQA 3H0GG 3MAQA 1KDAA 2KCCA 4DR5L 5C44G 1AZPA 4KHPL 3GTJH 1HZAA 4KJNA 5TSSA 4UP9A 3PIP3 1DOMA 2BH2A 2CHBD 3FKIG 2ATWA 5FK9C 1KHIA 2C9OA 2A1AA 4DNTB 1TS2A 1CKMA 1WJJA 2M9VA 3IAYA 2R6GA 1C8CA 1I4GA 2F0QA 2VUMG 4MZ9A 4JI8L 2IJ0A 1FL0A 2VL6A 4IUTA 1A3VA 4UHVA 4NKLA 5LMNW 1UEAB 3PIPA 1I4RA 5ELDA 2XVSA 2NUCA 3OOCA 1OXSC 4L63B 5M3FG 3E9IA 4AIMA 4ZQ3A 4DV0Q 4O1NA 4RG1A 1WFQA 3K59A 4YWKA 3E3XA 4CDCC 5T1GA 2KOLA 2HUGA 1RIPA 2L5TA 4OO1H 4DK0A 1YNJC 4LK1C 3L3OC 3BDOA 4BY1G 3LX0A 2EPBA 4DR4Q 4ZKBB 5KNCA 4PZ8A 3BU2A 2K1BA 1LV9A 3CMEA 5IYDG
chains in the Genus database with same CATH topology
3D4WA 3E0JA 2F0GA 4JBWA 1Y69U 3DMUA 2VB3X 4XDXA 4B08A 2BOSA 2R61A 1XX8A 3NK9A 2WV6D 1U4PA 2WKCA 4AYBB 1HUNA 4K5WA 2WACA 2B2UC 1PDQA 2LY7A 3GO5A 3OSOA 1PFBA 1RF2D 4OIJA 4XT1B 4FXGC 4HAEA 2MP1A 3T51B 1H9RA 1A2TA 4FYDA 1BO0A 4ABNA 2K01A 4RWSC 4C3HG 5C0XJ 1WTOA 1K83B 1GUTA 3C3LA 1RKNA 5J22A 2R7ZB 1D6EC 2X6GA 3MC0B 3R2IA 1BBXC 3MTSA 2V4DA 3PO3B 2JA6B 1K8MA 5CC4A 1G6ZA 1E2ZA 2VXWA 1VDZA 2LKVA 2XSCA 3MXGA 1SYCA 3BDLA 4XIGS 3VYUA 1Q12A 4A3FB 3HOZB 3RZOB 1D1KA 1DM0B 3R93A 3AU7A 3TZDA 3QB3A 1ZEQX 1CI3M 3GD7A 4X3UA 2EVBA 3HGBA 1HPCA 1NR4A 4DFAA 1SEBD 2I07B 1WTXA 3BVGA 5D65A 2Z4IA 3SXHA 1QE6A 4RHRA 3KLSX 1QCBD 5C4JB 4XQQA 1TVXA 1ESFA 3FDTA 3CU7A 1TY2A 3IKJA 2EDGA 2RBMA 4OGQC 4QUCA 4KI0A 1BUVT 2B2UA 2Y0SB 2KVMA 5EBDA 3R8BA 3M4OB 1EWCA 3HOYB 1G291 1U4LA 5EKIA 3T13A 1S5FD 4ZUIA 4F8MA 2KEEA 1HQRD 4CKBA 4R9WA 2K28A 4C1NI 1D5ZC 1JQYD 1JWUD 2OXPA 1PRTB 4FF1A 1ET9A 1IKLA 2NVXB 3JAML 4CKEA 4WRDA 4OO1I 2KCNA 3VR5A 1AFPA 3PUWA 1NCVA 2IX1A 2RA4A 5K36H 1TIID 2RDHA 4K2LA 5NUCA 2R93B 2B2TC 3D31A 1WTWA 3TSSA 4TRDA 3A8JE 4IUPA 3Q24A 3L9AX 3U9OA 2NYZD 1TWFB 3DHQA 4EGVA 4KHZA 5KIXA 4HMJA 3S14B 2PMZB 1WCMB 3H91A 2ID0A 2HCIA 3K5LA 3M4YA 4UDUC 2B39A 1C48A 2RQXA 2K33A 5I2YA 2M00A 1S5ED 5FKAC 4C56C 4Z9CB 1V8QA 4X3SA 1RD9D 2PCFB 3GTOB 1AP0A 2EYHA 3VR4A 1S4ZA 3SK4A 5CV4A 3ITPA 1HFNA 5BN3A 1B2TA 2Z1CA 1WVLA 2RSOA 3TP7A 2F0LA 4EQNA 1MD2D 4V190 2DY8A 2H1EA 3HOWB 4KY5A 2DN8A 2JEBI 4F88A 4A3GB 1KNEA 1HUMA 1ONLA 1DONA 1QNUA 3DXJC 2Q8IB 4B9XA 2RDGA 1EY5A 3PV0A 4WJWA 2O4XA 5C4ZA 1CM9A 1ESRA 3VR6A 5ELBA 1WTPA 1PRTF 2SDFA 2FHTA 1G8ZD 4KN7C 3PUXA 5ELCA 4NP5A 3TN2A 2E2IB 2B2TA 1TU2B 3M7GA 5C5MA 3NWSA 4EVOA 3BG3A 4IN3A 2K7VA 4WORA 4XYQA 1LTTD 1LABA 3T56B 1T5XD 3PMFA 5ELFA 3HKZB 2ICEC 2BDOA 3N52A 2L0CA 1V1PA 3H0GB 4IUVA 5C44B 2KA7A 1EYAA 1EIGA 1GOZA 1JOQA 4K5XA 2LFNA 2O5IC 1TY0A 1EU4A 1STBA 1HXYD 1DOKA 1CZWA 2D9UA 3FKIB 3KLRA 4K8IA 3BYYB 4R8IA 5FLXE 3M85A 4G7ZC 2K5WA 1I3QB 2PNRC 2VUMB 2Q8TA 1SNPA 1I50B 1RDPD 5A35A 5LL6S 3VR2A 2NTTA 5EPKA 5M3FB 4HCEA 1O7ZA 3DEOA 3FPPA 1VF5C 2BA1A 5IGEA 1KLGD 3HRZC 1HTPA 3WDNA 3FEWX 5HURA 1VMPA 2BA0A 4PV1C 4BY1B 4XQNA 1FGBD 1Q8IA 5KNBA 2JA5B 3RD4A 3DUZA 3VYTA 1R4PB 1IHZA 2RVLA 4A3KB 4FNFA 1OXUA 3MXUA 1EQTA 1WD1A 1A2UA 3VA7A 4IFDG 4CJ1B 5CV9A 5CV8A 5ELEA 4K2KA 3S15B 3OW7A 2QILA 1D5MC 5C5LA 3K57A 5M5YB 2ZXRA 1J8IA 2IX3A 1FYCA 1EWHA 1SE4A 1EY9A 2AUJD 1X3QA 4C3HB 4Y7NB 3C2PA 1H9SA 2EY2A 3F2UA 2MPMA 5I2XA 3MHBA 4OIKA 3FRPB 2WIIB 2AUKA 1SJHD 1HCZA 5JPMC 4QMGA 1V43A 3D6CA 2NN6I 1IYVA 5CORA 2KHSA 4QF4A 1D2BA 5EJWA 1HA6A 5BN4A 1B44D 4XT3B 1ENCA 1QG7A 1JC7A 3PUYA 2AQ3B 4HEDA 1XXGA 3CQZB 4KY7A 2FMCA 3V05A 1HQMC 3A7AB 1IL8A 5G3LF 1SJED 4DF7A 2KQ3A 2CQAA 1JWMD 1DD2A 1BF4A 1CFMA 1FNVA 1SNCA 1PRTC 3HZXA 1CT1D 3OMCA 1OXXK 1AEXA 1H9JA 4C1NK 3DWAA 4KV6A 1JICA 2WP8J 4FVMA 1PTOB 4KTAA 3NHHA 1PXUA 3ND9A 3A56A 5A2QE 1X32A 2F0SA 4ILWA 3NTHA 1FNUA 1Q3LA 2MJ8A 4LJZC 4HSPA 4IURA 2A6HC 1RTOA 3EVQA 1II3A 1X3PA 3V96A 1FD7D 4B9WA 2B8GA 1PZID 4J1MA 4C3IG 3E6ZX 4PNYA 4R8NA 3SK5A 1ZYRC 4ZKCB 4BY7B 1AW7A 4KY6A 1ZXTA 2KEDA 3SE0A 5C0XH 1T5EA 2A6HD 1U4MA 4KN4C 2E75C 3J80L 4A3JB 3QWNA 1YNJD 1EZ6A 1TS3A 2Q8RE 3LWEA 1RCVD 1JCKB 1SE3A 2EYFA 3J81L 1TS5A 2JE6I 4HR7B 1DCZA 3WOFA 1ZYRD 3HG9A 3VYSA 3WOEA 1GXDC 3I4NB 2WINB 2O5JC 4DXGA 3X3NA 4Q5VA 5J1ZA 3K5NA 2F3WA 5IGFA 2K32A 3FVQA 4J6HA 3I70A 3I91A 1PTOF 2F0EA 1SAPA 1QJOA 1SYFA 1Q90A 2JYOA 3S9WA 2KUMA 1U9RA 5EGTA 1AN8A 4IFDJ 1HHVA 1EEID 2EXZA 2J0TD 1NUCA 2F0MA 2WAQB 2D2CC 3O13A 1EFID 1F9SA 4DK1A 3KF8A 2M2LA 3EFXD 3K5MA 5JJZA 1E2WA 4KJOA 2L11A 1NAPA 5E4WC 4OHJA 2YYZA 3P1HA 3RZDB 1IW7C 1TQOA 4H44C 1BCPB 1TKWB 3M7NA 2BE5C 2A69C 4LMQD 2JA7B 3PIO3 3I4LA 1V1OA 3HOUB 1DOLA 5JAVA 4U68A 2N55A 4KMUC 5CV5A 2E74C 1E0BA 1LT6D 3HOVB 5KGUA 3G6JB 3CKIB 4HSVA 1FNWA 4HCSA 2F0IA 1F2MA 3I72A 3A8KE 3DWPA 2BE5D 4YIJA 1B3AA 1O7LA 3GV6A 5CV6A 1Y1WB 1Q1EA 2NZ1D 4ZRZA 1QNKA 2L55A 1TWCB 1F2YA 2XRQD 3Q22A 2CVRA 1EOTA 4H7BA 2DNCA 5J39A 1ILQA 5HGTA 4EQOA 4MHEA 2R92B 2AQ1B 1SSOA 1UNSA 4FXKC 3I4MB 3J7AV 3MXNA 3GTQB 5C0XI 4KD3A 4RKBA 5JOBA 2R3ZA 3SK8A 1I4HA 5IGCA 1A15A 4GZYC 1B53A 1D1IA 1K8OA 1HA5A 1Y1VB 3HP3A 5KEEA 1BCPF 1CK1A 3QJYA 1ICWA 1U4RA 5IODA 4G4KA 1EEFD 5JEAG 4C3JG 1NR2A 3BZDB 1PFNA 1PMRA 4KKUA 2F3VA 5I9PA 1I6HB 2F0OA 3VR3A 1QWYA 1EY0A 2OF1A 3NTKA 3NBHA 5FO9B 3K5OA 3R2TA 2NN6H 4BS9A 1WTQA 3EROA 3OWEB 1Y8OB 4LAAA 1XYIA 3UI2A 2K03A 2TMPA 1F77A 1I4XA 1D5XC 1LLRD 5BN5A 3NTIA 1PTOC 2F0FA 1SDFA 5T1IA 3TP8A 1RODA 1VF7A 2FFKB 1LACA 1TS4A 2EJMA 2IW3A 4ZUJA 1DXMA 2X69A 3DEPA 3IL8A 5KNDA 4DXFA 3S1MB 4N9PA 1PTOH 1TR5A 1MBYA 5I6WA 4ULLA 2JXMB 1Z7TA 2O2LD 3K58A 1S5CD 2A6EC 2F0DA 2NBFA 3J7YW 1FR3A 2L9HA 4PMCA 5D3IB 1KTKA 2EOTA 1G2TA 3TDQA 3N6RA 4KKTA 4M8AA 1LTAD 2PZTA 1TWGB 5I6YA 3QG1A 1S5DD 1TWAB 1SNDA 1TWHB 3SHLA 3S17B 3A54A 1VCIA 2B2VC 4QUFA 4OO1G 1HFGA 3QOJA 1KDBA 5AFWA 2HQEA 3MVVA 3P7JA 5DM73 3QOLA 2EJGC 2BCOA 4IUUA 3OPOA 2GA4B 4CJ2C 1I4PA 2K5QA 2Z4HA 4DN4M 2D5DA 4RAUC 4BWGB 4C3IB 2E2DC 2PPBC 1KNAA 5K5PA 2DY7A 2IWHA 2KECA 2B2WC 3U9SA 4ID6A 2Z8LA 5C0XG 2F0UA 5EBCA 3JAME 3AB9A 2PQEA 1CA5A 3S2HB 1SE2A 3S1RB 5IGBA 1CQFA 4PMBA 4I65A 3ONAB 4KK7A 1LTGD 5CYUA 3X3MA 1SMYC 2K5DA 1YNNC 1RTNA 2PW5A 2F0PA 2F0VA 1BDOA 2LS01 1CZGA 5CBAE 1C4QA 5IT9E 4A3IB 1GUSA 1ZKOA 3BVMA 2AWNA 1M4VA 1PFMA 3DM1A 1GUOA 3A8IE 5EPJA 1GUNA 1QILA 3C46A 2NVQB 3NWTA 1JOOA 4FF3A 1R9TB 1RHPA 4FF4A 1KLUD 4P2CB 1JB3A 1B9NA 2EY6A 1V1PB 1YNND 5C3WA 5C4HA 4V0BA 3GTLB 1H9KA 4OL7A 5IOCA 2B2VA 3KBGA 1LT3D 2EY5A 3NE5B 5JEAJ 1O7YA 4DNRB 3GTGB 3IFTA 2EYOA 4RH6A 4XXEA 5M9OA 3S1QB 1SYBA 4CGYB 1MI2A 2L12A 2EYJA 2FMMA 2NWGA 2PZWA 2E2HB 1NSNS 3H3VC 1EY6A 1ENFA 3TP6A 3KLSA 5C3XA 1A3TA 2B2WA 2K05A 5CGKA 2MHVA 3NQIA 4IZ8A 5FO8B 1QB5D 1ET6A 1BNZA 4M1UB 5JVG3 2LMCB 4CBVA 4MN3A 2JA8B 3D4RA 1SYGA 4FO2A 2A74C 1SNQA 1F9RA 3SR1A 3NQTA 2AQ2B 4ODGA 2B8FA 2C5CA 3MEHA 2J4XA 5ISRA 1GUGA 2IX0A 1PRTD 4F87A 3TZUA 3C1FA 1PLFA 2F0JA 3A7LA 3QO2A 1EY7A 3K7AB 4RHSA 1CHPD 2QCPX 3H94A 4KD4A 4RGNA 2PO4A 1DJRD 3OIQA 1BXTA 3MFYA 5K36G 3EQLC 5EKKA 5KYIA 1Z47A 2E76C 3DWQA 4QIWB 1H9SB 2L4NA 2IL8A 1Z6HA 1CA6A 3HOXB 1MSHA 2EJFC 3HS0C 2KJXA 2I46A 1G91A 2NTSA 2DNEA 2N88A 4ZLTF 3I3CA 3H09A 4MIUA 3MA2B 2NVYB 1B50A 1EYCA 4KKSA 3D3RA 4IUQA 3ERQA 1KAAA 1LO5D 2EY1A 3MXPA 1F2ZA 1O78A 4HN7A 4IFDH 1A6XA 3I8ZA 4FF2A 1STEA 4N9TA 4NW2A 2SOBA 4BA2I 1PZKD 1STGA 3FPUB 2A68C 3Q0AA 2D62A 4C3JB 1EZ8A 2VB2X 3S2DB 4RGTA 2RDFA 4NDXA 5M3MB 2NN6G 4Q0FA 3S16B 1DYQA 3T53B 4XQJA 2NVTB 1JWSD 3OWFA 1SNMA 1QOHA 4K5VA 3VYRA 4K14A 2XNAC 4PMWA 2ZXOA 2QKIC 3RUZA 2F4IA 2ZXPA 1R4QB 3C1EA 2YU9B 1GUWA 2EZVA 1OXTA 2A68D 3L7ZC 4E6IA 3GTPB 2OEOA 2XN9C 1EIHA 3LNNA 4IALA 3GV3A 3H6MA 1EY4A 4CJ0B 4G7OC 4A3BB 4I7ZC 4A3DB 2F03A 5FLXL 3R3OA 1STHA 4XTCS 1Y8PB 2H4OA 4RGMA 1PYWD 1LTSD 4TKOB 4UAIA 5FOBB 3W3AA 4RFBA 3GTJB 1A3UA 2JSOA 1IW7D 4ZYSA 3KBXA 4RA8A 3MWYW 1JOKA 2A69D 3CHBD 2OT2A 5E1FA 1Q1BA 4DAPA 3EA6A 1EYDA 3NSWA 5F2DA 2PYKA 3Q23A 5IGDA 2PZUA 4RCNA 5C6AA 4QB4A 3SVMA 3T4AC 1H9MA 1W6JA 3E5SA 4CKCA 4L6TB 2XWJB 4DAVA 3BYTB 3P20A 5G3LD 3PUVA 1WD0A 1O80A 1VMCA 2CW0C 3D6WA 4DGZA 4XYOA 3FMCA 1UUPA 4FP5D 3URYA 1LTRD 2X6LA 2ZT9C 4ZAIA 1KDCA 1SYEA 3ND8A 3NP8A 1IKMA 2F0WA 3GQBA 4U673 2A73B 5IT9L 4RCOA 3S1NB 1PZJD 2WB1B 5FO7B 1SXTA 2SEBD 1F9QA 1UAPA 2EE1A 1ENAA 1STNA 1WTVA 2CW0D 4DAYA 2IT1A 1TT2A 2RSNA 3AMUA 2F0NA 1ILPA 5I9OA 4IFDI 4DU9A 5M5XB 1MGSA 3BVZA 1LT5D 2L1BA 2TSSA 1E2VA 1RJTA 3BS1A 1HTLD 3J80E 1WTRA 1MSGA 2ICIA 1EU3A 3GTKB 2FINB 2F0KA 3NBIA 5DNFA 3D4DA 3J7AF 3J81E 1CQVA 2G9DA 3QIAA 2RKSA 4RGOS 3MZ5A 2F0HA 2F0TA 3M3YB 1F9PA 2EYLA 2EYPA 1HRJA 3LWUA 5CV7A 3TBIB 4H13C 3I90A 5LL6X 4TSSA 5D14A 3GP7A 3HEJA 2J7ZA 4EQPA 2SNSA 5D3DA 4A3MB 4C2MB 3PO2B 1STYA 1SYDA 5M5WB 4L8JA 5E3FA 1J9OA 3D8GA 5CR3A 1EQVA 2IPKD 3BDCA 5A2QL 4BA1I 4K6DA 1L0YB 1GJXA 5DAUA 4G57A 3GTMB 2QEJC 1L0XB 1LTID 2G9HD 5DM63 2E2JB 3SEBA 1PTOD 3PUZA 4A3EB 1GHKA 1AZQA 3OMGA 1JR0D 2JP1A 5COYA 2QF7A 1BR9A 3K0YA 1SFOB 5CMDA 4QCLA 1B4OA 1OO9B 4O42A 5CBEE 5E4XA 3G7LA 3OHXC 3KK7A 4BBRB 3SDZA 3EJIA 2A6ED 1KABA 1GHJA 2QDBA 3VA5A 4HTHA 2B2YC 3NXWA 2WKDA 2ENBA 1Y8NB 4H0LC 2K04A 3SK6A 5I4DA 5EKLA 5C4XB 2FJ2A 2K6AA 4G7HC 3T16A 5DEHA 2B63B 2XIWA 4FXDA 3TP5A 1XWEA 4JK1C 5C3EB 1B1ZA 1IYUA 4KHVA 5EPLA 3V2TA 2F1MA 1LTBD 4WFN3 1EL0A 1S5BD 1SBBB 1F2LA 1B9MA 4X3KA 4X3TA 2NB0A 4ME5A 4A93B 3P75A 3W2DA 1BOSA 1LT4D 4IQZA 5IIFA 1I6VC 1CTMA 1SNOA 3OIPA 5EQ0A 5KYLA 1W6KA 1OXVA 4DA2A 3I73A 1JE4A 2AWOA 5JEAH 3RLFA 4BBSB 4IUNA 2SNMA 4S3SA 4NMZA 4K6LA 2HDMA 1I4QA 4F7XA 1JORA 1M8AA 4ZK9B 1BCPC 1BQQT 4TQUS 1STAA 3NUCA 2HCCA 1ML0D 2JEAI 3RMHA 1SMYD 2EYMA 2MGSA 5LHY1 2VNUD 2BDNA 5KRUA 3K6OA 1DZ1A 3NPPA 3Q6SA 2A5HA 4RKLA 4K8JA 4PQXA 3IFDA 4J8QA 3CRKC 3TMEA 2B2YA 2PW7A 2XRSD 3KUPA 1CHQD 1XTCD 1EY8A 1BCPD 3A55A 4CHTB 3MFGA 2XWBB 1G2SA 4HMIA 2HDLA 5JPNC 3ZYYX 5JVH3 2MUYA 5IGGA 3CRLC 3MAQA 1KDAA 2KCCA 1AZPA 4KJNA 5TSSA 3PIP3 1DOMA 2CHBD 5FK9C 2C9OA 4DNTB 1TS2A 2M9VA 3IAYA 2R6GA 1C8CA 1I4GA 2F0QA 2IJ0A 4IUTA 1A3VA 4NKLA 1UEAB 1I4RA 5ELDA 2XVSA 2NUCA 3OOCA 1OXSC 4L63B 4ZQ3A 4O1NA 3K59A 5T1GA 2KOLA 2HUGA 2L5TA 4OO1H 4DK0A 1YNJC 4LK1C 3L3OC 3BDOA 3LX0A 2EPBA 4ZKBB 5KNCA 2K1BA 1LV9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D65 A;  3IFD A;  1SDF A;  2B2W C;  1Q3L A;  2KUM A;  2FIN B;  2MJ8 A;  3H91 A;  2B2W A;  4XDX A;  5T1I A;  1XX8 A;  1ROD A;  2HCI A;  2K05 A;  3N52 A;  1QE6 A;  2B2Y C;  3KBX A;  4IUR A;  2CVR A;  2FFK B;  4RA8 A;  3MWY W;  1RTO A;  1EOT A;  3I8Z A;  2B2Y A;  4IUV A;  1U4P A;  1J8I A;  1G2T A;  1TVX A;  1EIG A;  1X3P A;  2K04 A;  1HHV A;  1CA5 A;  1HUN A;  3KUP A;  3FDT A;  2X69 A;  1BNZ A;  1ILQ A;  3DEP A;  5DNF A;  3IL8 A;  1X3Q A;  1F9P A;  4X3S A;  2FJ2 A;  1HRJ A;  4MHE A;  1DOK A;  3F2U A;  3ONA B;  2D9U A;  4MN3 A;  1F9S A;  1SSO A;  4NW2 A;  2MPM A;  2XIW A;  2B2U C;  4QUC A;  2M2L A;  1AP0 A;  3I90 A;  2B2U A;  1RTN A;  4OIK A;  1G2S A;  3SVM A;  4R8I A;  1S4Z A;  3FPU B;  1PDQ A;  2KVM A;  2HDL A;  5JJZ A;  1F9R A;  5D14 A;  4ZKC B;  2L11 A;  1NAP A;  2Q8T A;  5CBA E;  5E4W C;  1HFN A;  5EPL A;  1PFB A;  2J7Z A;  2R3Z A;  4OIJ A;  1U4L A;  4XT1 B;  1WD0 A;  5COR A;  1B2T A;  1EL0 A;  2L9H A;  1WVL A;  1O80 A;  2RSO A;  1ZXT A;  4HAE A;  5EKI A;  2KED A;  1A15 A;  1VMC A;  1F2L A;  3D6W A;  1AZP A;  2MP1 A;  4X3K A;  5EJW A;  1B53 A;  2KEE A;  5EPK A;  1HA6 A;  3DM1 A;  1PFM A;  4X3T A;  4LMQ D;  1O7Z A;  1BO0 A;  2X6L A;  2EOT A;  2K01 A;  1J9O A;  1DOM A;  2DY8 A;  3DEO A;  4RWS C;  2H1E A;  4XT3 B;  5EPJ A;  4ZAI A;  1U4M A;  3HP3 A;  4R9W A;  1WTO A;  1PLF A;  1QG7 A;  2K28 A;  3QO2 A;  1KNE A;  1DOL A;  1HUM A;  4HED A;  1ICW A;  1DON A;  1U4R A;  2X6G A;  5EQ0 A;  1BBX C;  1IKM A;  1RHP A;  3MTS A;  2Q8R E;  3LWE A;  1VMP A;  2N55 A;  4U68 A;  1NR2 A;  1C8C A;  1PFN A;  1IL8 A;  1IKL A;  1CM9 A;  1ESR A;  1G6Z A;  4IUT A;  1E0B A;  1GUW A;  1JE4 A;  2VXW A;  1WTP A;  1BF4 A;  1AZQ A;  2B2V C;  2B2V A;  4HSV A;  4QUF A;  1EIH A;  1F9Q A;  2SDF A;  2FHT A;  1O7Y A;  3GV3 A;  4HCS A;  1HFG A;  2EE1 A;  2HDM A;  4CJ0 B;  2L4N A;  5AFW A;  1NCV A;  2IL8 A;  1CA6 A;  1WTQ A;  1MSH A;  1M8A A;  3P7J A;  2RA4 A;  3R93 A;  1WTV A;  2JP1 A;  4ZK9 B;  5T1G A;  2KOL A;  2HUG A;  5COY A;  3TZD A;  1B3A A;  2RVL A;  3TN2 A;  1JIC A;  2RSN A;  2B2T C;  2HCC A;  1ML0 D;  1WTW A;  4IUU A;  5CMD A;  4ZLT F;  1XYI A;  1ILP A;  1B4O A;  2B2T A;  1G91 A;  2K03 A;  3UI2 A;  4CJ2 C;  3GV6 A;  1EQT A;  4IUP A;  4O42 A;  2N88 A;  4X3U A;  5E4X A;  5CBE E;  1WD1 A;  1MI2 A;  2NYZ D;  4DN4 M;  1MGS A;  4RAU C;  1NR4 A;  2EPB A;  2L12 A;  2MGS A;  2FMM A;  2NZ1 D;  2NWG A;  3I3C A;  2L1B A;  2BDN A;  3G7L A;  3I91 A;  1RJT A;  1KNA A;  4ZKB B;  1SAP A;  4CJ1 B;  1QNK A;  1WTR A;  1DZ1 A;  1X32 A;  1MSG A;  2DY7 A;  2JYO A;  3Q6S A;  4UAI A;  2K1B A;  1B50 A;  1LV9 A;  1WTX A;  2KEC A;  4IUQ A; 
#chains in the Genus database with same CATH topology
 3D4W A;  2JA5 G;  3E0J A;  2F0G A;  4JBW A;  1Y69 U;  3DMU A;  2VB3 X;  1JJG A;  4XDX A;  4B08 A;  2BOS A;  2R61 A;  4P71 A;  1XX8 A;  5GAD C;  1XPU A;  3NK9 A;  2WV6 D;  1U4P A;  2WKC A;  3S1N H;  1K8G A;  4AYB B;  1HUN A;  4K5W A;  4A3K G;  1VQN A;  2GVB A;  2KCT A;  3CCV A;  2WAC A;  5IWA L;  2UUB L;  4OEM B;  2HIV A;  5IE8 A;  2B2U C;  4OX9 L;  1PDQ A;  2LY7 A;  3GO5 A;  3OSO A;  5M5X H;  1PFB A;  1I94 Q;  1RF2 D;  4OIJ A;  4XT1 B;  2K52 A;  5GQO A;  3G71 A;  1K0S A;  4FXG C;  4HAE A;  1E1O A;  3CCM A;  2MP1 A;  3T51 B;  1H9R A;  1A2T A;  1XPR A;  3GTK H;  4FYD A;  4YCU A;  2JJQ A;  2WAQ E;  1BO0 A;  4ABN A;  4LFB L;  2K01 A;  4RWS C;  4C3H G;  5C0X J;  1WTO A;  1K83 B;  1GUT A;  2K14 A;  3C3L A;  1RKN A;  5J22 A;  2R7Z B;  1D6E C;  2X6G A;  3MC0 B;  3R2I A;  4GLV B;  1BBX C;  1VQ5 A;  4APV A;  3MTS A;  3M3Y H;  4LF9 Q;  2V4D A;  3PO3 B;  1VQ9 A;  3RR5 A;  2JA6 B;  4DUY L;  1PYB A;  1K8M A;  5CC4 A;  1G6Z A;  4PG3 A;  1E2Z A;  1KXL A;  2PI2 A;  2AHO B;  1VDZ A;  2VXW A;  2LKV A;  2XSC A;  3MXG A;  2Z6K C;  1SYC A;  3BDL A;  4XIG S;  3VYU A;  1Q12 A;  4A3F B;  3HOZ B;  3RZO B;  1D1K A;  4C2M H;  4A3M H;  3PO2 H;  1DM0 B;  3R93 A;  4YHH L;  5M5W H;  3AU7 A;  3TZD A;  2YV5 A;  3QB3 A;  4MNO A;  1ZEQ X;  1CI3 M;  3GD7 A;  3PF5 A;  4X3U A;  2EVB A;  3HGB A;  4X65 L;  1HPC A;  1NR4 A;  4DFA A;  1SEB D;  2I07 B;  1K73 C;  1WTX A;  3BVG A;  1SR3 A;  1B8A A;  5D65 A;  3CC4 A;  1YVC A;  2E2J H;  2Z4I A;  3SXH A;  1QE6 A;  1A8V A;  4RHR A;  3T1H Q;  3KLS X;  1QCB D;  4A3E H;  2V1C C;  5C4J B;  4XQQ A;  1TVX A;  1ESF A;  3FDT A;  3CU7 A;  4LF7 L;  1TY2 A;  3IKJ A;  2EDG A;  3KOJ A;  1PH1 A;  2H5X A;  2RBM A;  1VQH A;  4DV4 L;  4OGQ C;  1TWG H;  4QUC A;  3RN2 A;  4KI0 A;  1YJN A;  1BUV T;  2B2U A;  2Y0S B;  4IPD A;  3H15 A;  2KVM A;  1TWA H;  4JI3 Q;  1E22 A;  5EBD A;  4A3L G;  4DV7 Q;  3TEH B;  3R8B A;  3M4O B;  1EWC A;  3HOY B;  1G29 1;  1U4L A;  1B70 B;  2K50 A;  2MNA A;  5EKI A;  3T13 A;  4BBR H;  1S5F D;  4GN3 B;  4ZUI A;  4F8M A;  2KEE A;  1HQR D;  4CKB A;  4R9W A;  2K28 A;  4C1N I;  2PI2 E;  1D5Z C;  1JQY D;  3CC7 A;  1NJI C;  5C4X H;  3K80 C;  4N8X 1;  1N32 L;  1JWU D;  2OXP A;  1PRT B;  4FF1 A;  1ET9 A;  4OWW B;  1IKL A;  4BY7 G;  2NVX B;  3JAM L;  1WTH A;  4CKE A;  5C3E H;  4WRD A;  4OO1 I;  4LF6 L;  2KCN A;  5FLM G;  1UE1 A;  2UXB L;  3VR5 A;  1AFP A;  3PUW A;  1NCV A;  2IX1 A;  2RA4 A;  3K8A A;  2VQE Q;  5K36 H;  1TII D;  2RDH A;  2KHJ A;  4K2L A;  3S2H H;  5NUC A;  1U0L A;  4A3J G;  4P75 A;  2R93 B;  2B2T C;  3D31 A;  1WTW A;  4A93 H;  3TSS A;  4TRD A;  3A8J E;  3CXC A;  1LUZ A;  4DV0 L;  4IUP A;  3Q24 A;  2Z9H A;  3L9A X;  1P16 A;  3U9O A;  2NYZ D;  4YY3 L;  1HH2 P;  1XMO L;  4DR6 Q;  1TWF B;  3DHQ A;  1CKN B;  4EGV A;  1QZH A;  2UXC Q;  4KHZ A;  4EX5 A;  5KIX A;  3AFP A;  4HMJ A;  3CCQ A;  3S14 B;  5GAE C;  3D0F A;  2PMZ B;  1MIU A;  1WCM B;  3H91 A;  5FLX c;  2ID0 A;  3OW2 A;  2HCI A;  3K5L A;  3I4N G;  2CWA A;  4JI4 Q;  3M4Y A;  4UDU C;  1E3P A;  1QVC A;  2B39 A;  1C48 A;  2RQX A;  2K33 A;  4IJH A;  5I2Y A;  2M00 A;  1S5E D;  5FKA C;  4C56 C;  2R7F A;  4BBS H;  4Z9C B;  1V8Q A;  4X3S A;  3DLL A;  1RD9 D;  2PCF B;  5ELO A;  2NVQ H;  3GTO B;  1AP0 A;  2EYH A;  3VR4 A;  3KJO A;  1S4Z A;  3SK4 A;  5CV4 A;  3ITP A;  3HOZ G;  1HFN A;  3GTL H;  5BN3 A;  1B2T A;  2Z1C A;  1D7Q A;  1WVL A;  2NZH A;  2RSO A;  3TP7 A;  2K75 A;  4NXM L;  2F0L A;  4EQN A;  1IBM L;  2WAQ G;  4IJL A;  1W3S A;  1MD2 D;  3I2Z A;  4V19 0;  2DY8 A;  2H1E A;  3HOW B;  4KY5 A;  2DN8 A;  2JEB I;  4F88 A;  3I7F A;  4A3G B;  1KNE A;  1HUM A;  1ONL A;  1DON A;  1QNU A;  3DXJ C;  2Q8I B;  4B9X A;  2RDG A;  1B7Y B;  3T1Y L;  2GVA A;  4B3T L;  3F2B A;  1EY5 A;  3PGZ A;  1ASZ A;  3PV0 A;  4WJW A;  2O4X A;  5C4Z A;  1CM9 A;  1ESR A;  2E2H H;  1HNZ Q;  3VR6 A;  5ELB A;  2GN5 A;  4KLK A;  4DV3 Q;  1WTP A;  1FJG L;  2UU9 Q;  1PRT F;  3KDF A;  4JYA Q;  2JA7 G;  2SDF A;  2FHT A;  1G8Z D;  4KN7 C;  2ZJP A;  3RLO A;  3PUX A;  3HOU G;  5ELC A;  4NP5 A;  3KFU A;  3TN2 A;  4LFA L;  2VQF Q;  2E2I B;  2B2T A;  1TU2 B;  3M7G A;  5C5M A;  3NWS A;  4L5Q A;  4EVO A;  2K5V A;  3BG3 A;  2F4V L;  4IN3 A;  2K7V A;  3HOV G;  4WOR A;  4XYQ A;  1LTT D;  1LAB A;  1MJC A;  3T56 B;  1T5X D;  4GLA C;  3PMF A;  2XTI A;  1M1K C;  5ELF A;  3HKZ B;  1O7I A;  2AMC B;  1WOC A;  2ICE C;  2BDO A;  3N52 A;  2L0C A;  5GRO A;  1V1P A;  1GD7 A;  3H0G B;  2ALY B;  3K7U C;  4IUV A;  5C44 B;  2KA7 A;  4B3S Q;  1EYA A;  1IYJ B;  1EIG A;  1JJC B;  1GOZ A;  1NY4 A;  1JOQ A;  4K5X A;  2LFN A;  2O5I C;  1TY0 A;  1T9H A;  1EU4 A;  1STB A;  1HXY D;  1DOK A;  1CZW A;  4UP7 A;  2D9U A;  3FKI B;  3K7A H;  4K0K L;  1Y1W G;  3KLR A;  4K8I A;  3BYY B;  4R8I A;  4YCV A;  1V1Q A;  5FLX E;  3M85 A;  4G7Z C;  2ES2 A;  2K5W A;  1I3Q B;  4YWM A;  2PNR C;  2VUM B;  2Q8T A;  1SNP A;  1I50 B;  4L5S A;  1QUQ B;  1RDP D;  4DAY B;  5A35 A;  5LL6 S;  4DR3 Q;  3SGI A;  3VR2 A;  2NTT A;  1YI2 A;  5EPK A;  5M3F B;  4HCE A;  2I0Q A;  1O7Z A;  3DEO A;  4DV7 L;  3FPP A;  4LUO A;  1VF5 C;  2R92 G;  4L5T A;  4IO9 A;  2BA1 A;  5IGE A;  4JI2 L;  3I4M G;  1KLG D;  3HRZ C;  1HTP A;  3WDN A;  3FEW X;  5HUR A;  1VMP A;  2BA0 A;  4UPA A;  4B3M Q;  4JI7 L;  4L5R C;  3MEF A;  4PV1 C;  4BY1 B;  4JG2 A;  2YTV A;  4XQN A;  1IZ6 A;  1FGB D;  4GKK Q;  1Q8I A;  1AH9 A;  5KNB A;  2ZTC A;  4GOP B;  2JA5 B;  3G6E A;  1K3R A;  3RD4 A;  2ASB A;  3CCE A;  2N8N A;  4YCW A;  1Y1V G;  3DUZ A;  3VYT A;  2UUA Q;  1R4P B;  1IHZ A;  4HJ8 A;  2RVL A;  1AE3 A;  4A3K B;  4FNF A;  2KEN A;  1OXU A;  5LMU Q;  3MXU A;  1EQT A;  1WD1 A;  1A2U A;  1K83 H;  3VA7 A;  4IFD G;  4CJ1 B;  5CV9 A;  5CV8 A;  5ELE A;  4K2K A;  3S15 B;  1UWV A;  3CP0 A;  3KLW A;  3PO3 H;  2JA6 H;  2UXD Q;  3OW7 A;  3UE1 A;  2Z0S A;  2CFM A;  1N33 Q;  2QIL A;  1KD1 C;  1D5M C;  3S2D H;  4JI6 L;  5C5L A;  3K57 A;  4DR1 Q;  4R4C A;  5M5Y B;  1PH5 A;  2ZXR A;  3S24 A;  1J8I A;  1X6O A;  1VS0 A;  2IX3 A;  3S16 H;  1FYC A;  1EWH A;  1BKB A;  1SE4 A;  1EY9 A;  2AUJ D;  3CCJ A;  2VS1 A;  2QA4 A;  1PHJ A;  4IOC A;  1X3Q A;  3E9H A;  4A3F H;  2CWP A;  1JE5 A;  4C3H B;  4Y7N B;  3C2P A;  1H9S A;  2EY2 A;  3F2U A;  2MPM A;  2B3G A;  5I2X A;  3MHB A;  4OIK A;  3FRP B;  2WII B;  2AUK A;  1SJH D;  1HCZ A;  5JPM C;  4JV5 L;  4QMG A;  4JCV E;  4X66 Q;  1V43 A;  3D6C A;  2NN6 I;  3FHW A;  1IYV A;  5COR A;  3ZJY C;  4LFC Q;  2KHS A;  4QF4 A;  1D2B A;  4TVA B;  5EJW A;  1HA6 A;  5BN4 A;  1B44 D;  4XT3 B;  1ENC A;  1QG7 A;  2XGT A;  1JC7 A;  3PUY A;  2AQ3 B;  4HED A;  1XXG A;  3CQZ B;  5C4J H;  4KY7 A;  2FMC A;  4A3C H;  3V05 A;  1XMQ L;  1HQM C;  4WJ4 A;  3A7A B;  1YNX A;  1IL8 A;  5G3L F;  1SJE D;  4DF7 A;  2KQ3 A;  2CQA A;  1BBW A;  1JWM D;  4HJ9 A;  1DD2 A;  1BF4 A;  3PCO B;  2P5Z X;  1CFM A;  4DV5 Q;  3KF6 B;  1HNW Q;  1FNV A;  1SNC A;  1EIF A;  1MHW C;  1PRT C;  3ER0 A;  3M4O H;  3HZX A;  1CT1 D;  3OMC A;  1QVF A;  1OXX K;  5FJ8 G;  1AEX A;  1H9J A;  4C1N K;  4LNQ A;  1Q81 C;  1HNZ L;  3DWA A;  3NEL A;  4POF A;  4KV6 A;  1JIC A;  2WP8 J;  4FVM A;  1YZ6 A;  1PTO B;  1LTL A;  1XJV A;  4KTA A;  3NHH A;  1PXU A;  4JYA L;  3ND9 A;  2K5N A;  2OQ0 A;  3A56 A;  2AKW B;  5A2Q E;  1X32 A;  2F0S A;  4ILW A;  3NTH A;  1FNU A;  1Q3L A;  2MJ8 A;  4LJZ C;  1S40 A;  4HSP A;  4NXN Q;  2NVX H;  4IUR A;  2A6H C;  4QIW E;  1RTO A;  2R7D A;  3L0O A;  1YJW A;  3EVQ A;  1II3 A;  1X3P A;  2PQA B;  3V96 A;  1VQ4 A;  1FD7 D;  4X6A H;  3A5Z B;  4B9W A;  2B8G A;  5JJK A;  1PZI D;  4J1M A;  4C3I G;  1E7Z A;  3E6Z X;  4PNY A;  2R93 H;  1EIY B;  4R8N A;  5E7N A;  3SK5 A;  1ZYR C;  1PH2 A;  4ZKC B;  4BXX G;  1BVS A;  4BY7 B;  1AW7 A;  1L1O A;  4KY6 A;  1PH8 A;  1P8L A;  1ZXT A;  1VQG A;  2KED A;  3S14 H;  1HNX L;  3SE0 A;  3U4Z A;  5C0X H;  1WCM H;  1T5E A;  2Q2H A;  2A6H D;  1U4M A;  4KN4 C;  2E75 C;  3J80 L;  4A3J B;  3QWN A;  1YNJ D;  4DUZ Q;  1EZ6 A;  1TS3 A;  1PH3 A;  2Q8R E;  3LWE A;  5LMN Q;  1RCV D;  1JCK B;  1SE3 A;  2BH8 A;  1PH7 A;  3BJU A;  4DR7 L;  2EYF A;  3J81 L;  1TS5 A;  2JE6 I;  2PNH A;  3GTO H;  3RNU A;  4NPS A;  1YJ9 A;  4A3I G;  4QL5 A;  4HR7 B;  4JI1 Q;  5IYC H;  4HIM A;  1HR0 L;  1DCZ A;  3WOF A;  1Y14 B;  1ZYR D;  1C0A A;  5IYB G;  3HG9 A;  3VYS A;  3GDE A;  3WOE A;  2A19 A;  2ZM6 L;  1GXD C;  1FGU A;  1EQQ A;  4B3M L;  4ZCK A;  3I4N B;  2WIN B;  2O5J C;  4DXG A;  1YHQ A;  3X3N A;  4Q5V A;  5J1Z A;  3K5N A;  2KCM A;  2F3W A;  5IGF A;  2K32 A;  1MKH A;  3FVQ A;  4J6H A;  3HOW H;  3ULL A;  5IP7 G;  4GKJ Q;  3I70 A;  3I91 A;  4B3R Q;  1PTO F;  2F0E A;  2UUA L;  1SAP A;  3WWV A;  3RLN A;  1QJO A;  1SYF A;  1Q90 A;  2JYO A;  5H1S E;  3S9W A;  4JVZ A;  4LF5 Q;  2KUM A;  1U9R A;  1IBL L;  5EGT A;  1AN8 A;  4MTN A;  3L2P A;  3OTO Q;  4IFD J;  4LF8 Q;  1CKN A;  4QJF A;  1NTG A;  3ERS X;  1HHV A;  1EEI D;  2EXZ A;  1EWI A;  4X62 Q;  3ULJ A;  2J0T D;  1G6P A;  3UDX A;  1NUC A;  2F0M A;  2WAQ B;  1J5E Q;  2D2C C;  4X64 Q;  3O13 A;  2WFW A;  5DLQ E;  1EFI D;  4IOA A;  1F9S A;  4OWX B;  3KF8 A;  2M2L A;  4DK1 A;  3GTM H;  1BBU A;  3EFX D;  3K5M A;  1JT8 A;  1AE2 A;  5JJZ A;  1E2W A;  4KJO A;  2L11 A;  1NAP A;  5E4W C;  4OHJ A;  2YYZ A;  3P1H A;  4R4I A;  3RZD B;  1IW7 C;  1TQO A;  4H44 C;  3U4V A;  1BCP B;  1TKW B;  3M7N A;  2BE5 C;  2A69 C;  4LMQ D;  2JA7 B;  3PIO 3;  4DR2 Q;  4DV6 Q;  3I4L A;  3H0G H;  3BZK A;  1V1O A;  3HOU B;  4X66 L;  5C44 H;  1DOL A;  2JA8 G;  5JAV A;  3F2C A;  1SFO H;  1IXR A;  1YHA A;  2N55 A;  4U68 A;  4KMU C;  5CV5 A;  4UY8 C;  2E74 C;  3FKI H;  1XNQ Q;  1E0B A;  1LT6 D;  4IPG A;  3A5U A;  2A8V A;  3HOV B;  1EYG A;  2KBN A;  5KGU A;  3G6J B;  3CKI B;  3PIO A;  5AJ3 L;  4HSV A;  3DM3 A;  1N8R C;  1FNW A;  4HCS A;  2F0I A;  2JQO A;  1U5K A;  1F2M A;  3I72 A;  3A8K E;  4DK3 C;  3DWP A;  2BE5 D;  4YIJ A;  1B3A A;  5M3F H;  2F3I A;  1O7L A;  3GV6 A;  2B63 H;  5CV6 A;  4IPC A;  1Q1E A;  1Y1W B;  2NZ1 D;  4ZRZ A;  1QNK A;  2L55 A;  2Z6K A;  1TWC B;  2WB1 E;  1X55 A;  3STB C;  1CSP A;  1F2Y A;  4BY1 H;  2XRQ D;  3Q22 A;  2CVR A;  2HQL A;  3HOX G;  1EOT A;  4IPH A;  5JJL A;  1L0W A;  1DGS A;  4H7B A;  5IYD H;  2JA5 H;  2DNC A;  5J39 A;  2DJF C;  2VY3 A;  1ILQ A;  5HGT A;  4EQO A;  4MHE A;  1N36 Q;  2R92 B;  2AQ1 B;  4P72 A;  1SSO A;  1UNS A;  1KAW A;  4FXK C;  1XNR Q;  3I4M B;  2DJG C;  3J7A V;  3MXN A;  1Q8K A;  3GTQ B;  5C0X I;  3U58 A;  4FDB A;  4KD3 A;  1A0I A;  4RKB A;  5JOB A;  4LUZ A;  4JI5 Q;  1X3G A;  1IL2 A;  2R3Z A;  4DR4 L;  3RN5 A;  3SK8 A;  3U50 C;  4HIO A;  1I4H A;  2K4K A;  5IGC A;  1A15 A;  4GZY C;  3S15 H;  1B53 A;  3STB D;  1D1I A;  1K8O A;  4CDE C;  1HA5 A;  1Y1V B;  2C35 B;  3HP3 A;  5KEE A;  1BCP F;  5M5Y H;  1CK1 A;  1S3O A;  3QJY A;  1ICW A;  1U4R A;  5IOD A;  4G4K A;  1EEF D;  2D0O A;  5JEA G;  1ASY A;  4C3J G;  1NR2 A;  3BZD B;  1PH9 A;  1PFN A;  1PMR A;  4KKU A;  2F3V A;  5I9P A;  1C9O A;  1EFW A;  1YEZ A;  1I6H B;  2F0O A;  5M3M G;  1WI5 A;  3VR3 A;  4DUZ L;  2RCN A;  1QWY A;  1EY0 A;  2OF1 A;  3NTK A;  3NBH A;  5FO9 B;  3VDY A;  3K5O A;  3R2T A;  1I94 L;  2NN6 H;  4BS9 A;  1WTQ A;  4PZ7 A;  3ERO A;  4J15 A;  2FXQ A;  3OWE B;  1SLJ A;  1Y8O B;  4AQY Q;  2N49 A;  4LAA A;  3JAM c;  1XYI A;  2K03 A;  3UI2 A;  2TMP A;  1F77 A;  1I4X A;  1D5X C;  4LF4 Q;  3J7A 5;  1LLR D;  1VQC A;  3CQZ H;  1N34 Q;  4JPB W;  5BN5 A;  4DR5 Q;  3NTI A;  1N9W A;  1CKO A;  4DV2 Q;  1H95 A;  4JW0 A;  1PTO C;  4LF9 L;  4KHP Q;  2F0F A;  1SDF A;  1GO3 E;  5T1I A;  3TP8 A;  1ROD A;  1VF7 A;  2FFK B;  4A3B G;  4GKJ L;  4A3D G;  1LAC A;  1TS4 A;  2EJM A;  2IW3 A;  5IT9 c;  4ZUJ A;  1DXM A;  4WJ3 M;  2X69 A;  3DEP A;  1NBW A;  4A3C G;  1E24 A;  3IL8 A;  5KND A;  1UE6 A;  4DXF A;  3S1M B;  4JI8 Q;  3AEV A;  1C7Y A;  2YTY A;  4N9P A;  4JBM A;  1PTO H;  1TR5 A;  2DUD A;  1MBY A;  5I6W A;  4ULL A;  4X62 L;  2JXM B;  1Z7T A;  2O2L D;  3K58 A;  2OQK A;  5GAH C;  1HR0 W;  1S5C D;  4OWT B;  2A6E C;  2F0D A;  2NBF A;  2HHH Q;  3J7Y W;  1FR3 A;  2L9H A;  4PMC A;  5D3I B;  1JB7 A;  4GN4 B;  1KTK A;  2EOT A;  1G2T A;  3TDQ A;  3N6R A;  2RCF A;  3CPW A;  3T1H L;  4KKT A;  4M8A A;  4QY7 A;  1LTA D;  2PZT A;  3W1B A;  3QR8 A;  1TWG B;  4P74 A;  5I6Y A;  2CH4 A;  3IRB A;  3QG1 A;  1S5D D;  1TWA B;  1SND A;  4DR2 L;  3CCL A;  1L2F A;  1TWH B;  3SHL A;  3S17 B;  3A54 A;  1VCI A;  2B2V C;  1VQM A;  2QGQ A;  4JI3 L;  4QUF A;  4OO1 G;  1HFG A;  3QOJ A;  1KDB A;  5AFW A;  2HQE A;  1XNQ L;  3MVV A;  3P7J A;  1KC8 C;  2QDL A;  5DM7 3;  3QOL A;  4OX9 Q;  2EJG C;  2I5L X;  1QVG A;  3TQY A;  2BCO A;  4IUU A;  1M90 C;  3OPO A;  2GA4 B;  4CJ2 C;  1X56 A;  1I4P A;  2K5Q A;  2Z4H A;  2E5L Q;  4DN4 M;  2D5D A;  4RAU C;  3LGJ A;  4BWG B;  4C3I B;  4A76 A;  2E2D C;  2PPB C;  1KNA A;  4A3J H;  5K5P A;  2DY7 A;  2IWH A;  2KEC A;  4QQB X;  2WB1 G;  2B2W C;  3U9S A;  2ZTE A;  4ID6 A;  2Z8L A;  5C0X G;  2F0U A;  1VQO A;  5EBC A;  3JAM E;  3AB9 A;  2PQE A;  1CA5 A;  3ICE A;  3S2H B;  1SE2 A;  3S1R B;  1PVO A;  5IGB A;  1CQF A;  4PMB A;  2Q2I A;  4I65 A;  2D0P A;  3ONA B;  4KK7 A;  2R7Z H;  1LTG D;  5CYU A;  2VQE L;  3X3M A;  4YWL A;  1SMY C;  2K5D A;  1YNN C;  1J6Q A;  1RTN A;  1Q46 A;  2PW5 A;  5IY0 A;  2F0P A;  2F0V A;  1BDO A;  2LS0 1;  3KDF B;  2PQA A;  1CZG A;  1KIX A;  3EBE A;  5CBA E;  4DR6 L;  4QGU A;  1C4Q A;  5IT9 E;  3K0X A;  4A3I B;  4YHH Q;  2UXC L;  1GUS A;  4P73 A;  1ZKO A;  3BVM A;  2AWN A;  3HOZ H;  1M4V A;  1PFM A;  3DM1 A;  3RZO H;  1GUO A;  3A8I E;  5EPJ A;  1VQL A;  4GLX A;  3CC2 A;  1GUN A;  1QIL A;  1RL2 A;  4JI4 L;  5BR8 Q;  3C46 A;  2NVQ B;  2IHF A;  3NWT A;  1JOO A;  4FF3 A;  1R9T B;  1RHP A;  4HJ7 A;  4FF4 A;  1KLU D;  4P2C B;  1JB3 A;  1B9N A;  2EY6 A;  1V1P B;  1YNN D;  5C3W A;  4A3M G;  5C4H A;  3PO2 G;  1PA6 A;  4V0B A;  3GTL B;  1H9K A;  4OL7 A;  5IOC A;  2B2V A;  3KBG A;  1LT3 D;  2EY5 A;  3NE5 B;  5JEA J;  2MO1 A;  1O7Y A;  3RZD H;  4DNR B;  3GTG B;  3IFT A;  2EYO A;  4RH6 A;  1CSQ A;  4XXE A;  5M9O A;  3S1Q B;  4R4O A;  4JOI C;  1SYB A;  4CGY B;  2CH4 W;  1YIJ A;  1MI2 A;  3JAM i;  2L12 A;  2EYJ A;  2FMM A;  2NWG A;  3PF4 A;  2PZW A;  2E2H B;  4DNI A;  1NSN S;  3H3V C;  1EY6 A;  4A3E G;  1ENF A;  3TP6 A;  4AQY L;  3KLS A;  5C3X A;  1A3T A;  3HOY H;  2B2W A;  2K05 A;  5CGK A;  2EXD A;  2MHV A;  3NQI A;  4IZ8 A;  5FO8 B;  2I5H A;  3HOV H;  1B3Q A;  4DV3 L;  2UU9 L;  1QB5 D;  3TS0 A;  1ET6 A;  1BNZ A;  4M1U B;  4DV2 L;  2RF4 A;  1N32 Q;  5JVG 3;  2LMC B;  4CBV A;  2CCZ A;  1E1T A;  4MN3 A;  2ZJR A;  1KRT A;  2JA8 B;  3H3V H;  3D4R A;  1GKH A;  1SYG A;  4FO2 A;  2A74 C;  1SNQ A;  4BBR G;  2VQF L;  1F9R A;  4GN5 A;  4LF6 Q;  3SR1 A;  3NQT A;  2UXB Q;  5HY6 A;  1CUK A;  2AQ2 B;  4ODG A;  2B8F A;  1SMX A;  2C5C A;  3MEH A;  1Y1W H;  2UUC Q;  2J4X A;  2LXK A;  1A62 A;  5ISR A;  1GUG A;  2IX0 A;  2VW9 A;  4AYB E;  1PRT D;  1TWC H;  4F87 A;  3TZU A;  5C4X G;  1VQ6 A;  1SRO A;  4YY3 Q;  1XMO Q;  3HFZ B;  3C1F A;  1PLF A;  2B63 G;  2HHH L;  2F0J A;  3QO2 A;  3A7L A;  1EOV A;  1EY7 A;  3K7A B;  4RHS A;  4B3S L;  1X65 A;  1Q82 C;  5C3E G;  1VQK A;  1CHP D;  2QCP X;  3H94 A;  2OTL A;  4KD4 A;  1TWF H;  2R92 H;  1OTC A;  4GNX B;  2CKZ B;  1JMC A;  4RGN A;  2I5M X;  2KHI A;  2PO4 A;  1DJR D;  3OIQ A;  3I4M H;  1BXT A;  3MFY A;  5K36 G;  3EQL C;  3GTQ H;  1MJE A;  5EKK A;  5KYI A;  1Z47 A;  4A93 G;  2E76 C;  1LM0 A;  3A74 A;  3DWQ A;  4QIW B;  1H9S B;  2L4N A;  3CD6 A;  2IL8 A;  1Z6H A;  1CA6 A;  3HOX B;  1MSH A;  2G5D A;  2EJF C;  3HS0 C;  4DR3 L;  2KJX A;  2I46 A;  1G91 A;  2NTS A;  2DNE A;  4JOI A;  2IHE A;  1XPO A;  1Y1V H;  2N88 A;  3A0J A;  3FP9 A;  2HT1 A;  4ZLT F;  3I3C A;  4LWC A;  1SN8 A;  4R4T A;  5GAG C;  3H09 A;  4MIU A;  3MA2 B;  2NVY B;  1B50 A;  1EYC A;  4KKS A;  1QZG A;  3D3R A;  4IUQ A;  3NEM A;  3ERQ A;  1PH4 A;  1K9M C;  1KAA A;  4NXM Q;  1LO5 D;  2EY1 A;  3MXP A;  1IBM Q;  1F2Z A;  4I7A A;  4BBS G;  1EUJ A;  1O78 A;  4HN7 A;  3AQQ A;  4IFD H;  1A6X A;  2JA9 A;  2B29 A;  2E5L L;  1I6H H;  1HJP A;  3I8Z A;  4GKK L;  3CCS A;  4B3T Q;  3T1Y Q;  4DAM A;  4FF2 A;  1STE A;  3I56 A;  5IP9 H;  1WYD A;  1VQA A;  1K0R A;  4N9T A;  1YIT A;  4A3G H;  4NW2 A;  2SOB A;  4BA2 I;  1PZK D;  1FJG Q;  3W5O A;  1STG A;  3FPU B;  2A68 C;  1X54 A;  3Q0A A;  4NB3 A;  3CMA A;  2D62 A;  4C3J B;  1EZ8 A;  4PZ6 A;  5LMU L;  2VB2 X;  1D8L A;  3S2D B;  4RGT A;  3UDI A;  4JI0 Q;  2RDF A;  4NDX A;  5M3M B;  1UE7 A;  2NN6 G;  4Q0F A;  3S16 B;  4LFA Q;  2UXD L;  1DYQ A;  1N33 L;  3T53 B;  4XQJ A;  1JJ2 A;  2NVT B;  1JWS D;  4DV1 Q;  4DR1 L;  3AYH B;  4O2D A;  3OWF A;  1SNM A;  4ME3 A;  2F4V Q;  1QOH A;  4K5V A;  3VYR A;  4K14 A;  2XNA C;  2Y0S E;  2E2I H;  4PMW A;  2Q2U A;  2ZXO A;  4LUV A;  2QKI C;  3RUZ A;  2F4I A;  2ZXP A;  3S1M H;  1R4Q B;  3C1E A;  2YU9 B;  4O0A A;  2L15 A;  1GUW A;  2EZV A;  1OXT A;  2A68 D;  5BR8 L;  3L7Z C;  4E6I A;  3GTP B;  2OEO A;  2XN9 C;  1EIH A;  3J80 c;  3LNN A;  4IAL A;  3GV3 A;  3H6M A;  1EY4 A;  4CJ0 B;  4G7O C;  4A3B B;  4K0K Q;  4I7Z C;  4A3D B;  2F03 A;  4LFC L;  2N3S A;  1IBK Q;  5FLX L;  3UDF A;  3J81 c;  3R3O A;  1STH A;  1UEB A;  4XTC S;  1Y8P B;  1HZC A;  2H4O A;  5FJ8 H;  4RGM A;  1L1O B;  1PYW D;  1LTS D;  4TKO B;  1TXY A;  4UAI A;  5FOB B;  1I3Q H;  4JBJ A;  1KRS A;  3W3A A;  2VUM H;  1Q7Y C;  4RFB A;  2CQO A;  3GTJ B;  1A3U A;  2JSO A;  1IW7 D;  1I50 H;  1I5F A;  4ZYS A;  3KBX A;  4RA8 A;  3MWY W;  1JOK A;  1TWH H;  3H3V I;  1VQP A;  3S17 H;  2A69 D;  4JI2 Q;  4GOP C;  4CDD C;  1SE8 A;  3CHB D;  2OT2 A;  5E1F A;  1Q1B A;  4CDF C;  3E0E A;  4DV5 L;  4DAP A;  1HNW L;  4JI7 Q;  3EA6 A;  2RHQ B;  1EYD A;  1K8A C;  3NSW A;  5F2D A;  2PYK A;  3Q23 A;  5IGD A;  2PZU A;  4RCN A;  5C6A A;  4QB4 A;  3SVM A;  3T4A C;  1H9M A;  1W6J A;  3E5S A;  4CKC A;  4L6T B;  2XWJ B;  3B6Y A;  1VQE A;  2PMZ E;  4DAV A;  3BYT B;  3P20 A;  4C3I H;  3F1Z A;  5G3L D;  3PUV A;  1WD0 A;  1O80 A;  2ZTD A;  5EAY A;  1VMC A;  2CW0 C;  3D6W A;  4AYB G;  4DGZ A;  1XTD A;  4XYO A;  4BXX H;  3FMC A;  1UUP A;  2OCE A;  4FP5 D;  3PQI A;  3URY A;  1LTR D;  2X6L A;  2ZT9 C;  4ZAI A;  3UE0 A;  1KDC A;  4NXN L;  2RHS B;  2QEX A;  2UUC L;  1SYE A;  1Z9F A;  2VZA A;  3ND8 A;  1X9N A;  1NMG A;  2Q2T A;  3NP8 A;  4A3K H;  1K3B C;  1IKM A;  3S1R H;  2F0W A;  3GQB A;  4HJ5 A;  4U67 3;  4H02 A;  2A73 B;  4JI6 Q;  1VQ7 A;  5IT9 L;  4RCO A;  3S1N B;  1PZJ D;  4DK6 C;  2WB1 B;  4A4I A;  5FO7 B;  1SXT A;  1K28 A;  2SEB D;  1F9Q A;  3CW2 C;  1YHB A;  1HZB A;  1UAP A;  2EE1 A;  4HJA A;  4A3I H;  1ENA A;  1QUQ A;  1STN A;  1X3E A;  4OON A;  3KF8 B;  1WTV A;  2CW0 D;  4DAY A;  5IYB H;  2R7Z G;  2IT1 A;  1TT2 A;  2RSN A;  4ALP A;  3AMU A;  2F0N A;  4C3H H;  1YBY A;  4Y7N H;  3HKS A;  1ILP A;  1X3F A;  5I9O A;  4IFD I;  4JV5 Q;  3PO3 G;  4DU9 A;  2JA6 G;  3F8T A;  5M5X B;  1MGS A;  1PH6 A;  3BVZ A;  1LT5 D;  2L1B A;  2TSS A;  1E2V A;  1RJT A;  4OXP A;  1HTL D;  3J80 E;  3J7Z C;  3BS1 A;  1WTR A;  1R9T H;  1MSG A;  2ICI A;  3CCU A;  1EU3 A;  3GTK B;  5LMN L;  4POG A;  4UP8 A;  2FIN B;  2F0K A;  1SRU A;  3NBI A;  4A3F G;  5DNF A;  3D4D A;  5IP7 H;  3J7A F;  3J81 E;  1VQI A;  1CQV A;  1UE5 A;  2G9D A;  3QIA A;  4JI1 L;  1HZ9 A;  2RKS A;  4RGO S;  3MZ5 A;  2F0H A;  1XMQ Q;  4GOP A;  2F0T A;  1S72 A;  3M3Y B;  1F9P A;  2EYL A;  2EYP A;  1HRJ A;  3GTG H;  4RMF A;  3LWU A;  5CV7 A;  3TBI B;  4H13 C;  3I90 A;  3KYH C;  3S1Q H;  5LL6 X;  4JC0 A;  4TSS A;  4HID A;  5D14 A;  3GP7 A;  3HEJ A;  3HKZ E;  2J7Z A;  1V9P A;  3CF5 A;  4EQP A;  2SNS A;  3BZC A;  5D3D A;  4B3R L;  4A3M B;  4C2M B;  3PO2 B;  1STY A;  1SYD A;  3W1G A;  4A75 A;  5M5W B;  3M9B A;  3PSI A;  3TRE A;  3CPF A;  4L8J A;  4LF5 L;  1VQ8 A;  5E3F A;  1J9O A;  3D8G A;  5CR3 A;  1EQV A;  2IPK D;  3OTO L;  3BDC A;  5A2Q L;  1KQS A;  4BA1 I;  4LF8 L;  4K6D A;  4JI0 L;  1L0Y B;  3KJP A;  2Y0S G;  1GJX A;  5DAU A;  2HD3 A;  4G57 A;  5ELN A;  3GTM B;  3JC6 6;  2QEJ C;  1L0X B;  1LTI D;  1J5E L;  2G9H D;  4X64 L;  5DM6 3;  2E2J B;  2EQS A;  3HOY G;  2JA8 H;  4DV1 L;  3SEB A;  1PTO D;  3PUZ A;  4A3E B;  1GHK A;  1AZQ A;  4A3L H;  3OMG A;  3M4Q A;  2DGY A;  1JR0 D;  4GNX C;  4GS3 A;  3J80 i;  3I4O A;  2JP1 A;  3UDG A;  5COY A;  1A63 A;  2QF7 A;  1BR9 A;  1PV4 A;  3MXN B;  4Y52 H;  3K0Y A;  1SFO B;  5CMD A;  4QCL A;  1B4O A;  3J81 i;  1OO9 B;  1NNX A;  4DV6 L;  2NZO A;  4O42 A;  5CBE E;  5E4X A;  2OTJ A;  2F52 A;  3Q8D A;  3G7L A;  3G4S A;  3OHX C;  3AFQ A;  3KK7 A;  3TS2 A;  3M4P A;  2LSS A;  4MTK A;  1IBK L;  4BBR B;  3SDZ A;  3EJI A;  2A6E D;  1HNX Q;  4BY7 H;  4LW1 A;  1KAB A;  5IWA Q;  2UUB Q;  1GHJ A;  2QDB A;  3EN2 A;  3VA5 A;  5L37 A;  4HTH A;  4HIK A;  2B2Y C;  3NXW A;  2WKD A;  2JK8 A;  2ENB A;  1Y8N B;  4H0L C;  2K04 A;  3SK6 A;  5I4D A;  5FLM H;  4OEL B;  2R93 G;  2IY5 B;  5EKL A;  3KF6 A;  5C4X B;  2FJ2 A;  1GM5 A;  2K6A A;  4G7H C;  4DR7 Q;  3T16 A;  3HOX H;  5DEH A;  2B63 B;  2XIW A;  1KL9 A;  1LYL A;  4FXD A;  3TP5 A;  1XWE A;  1HR0 Q;  4JK1 C;  4JBK A;  5C3E B;  1B1Z A;  3OYY A;  2MFI A;  2ZM6 Q;  2ZJQ A;  1IYU A;  4LFB Q;  3NBH B;  3G48 A;  4KHV A;  1WCM G;  5EPL A;  3ULP A;  3V2T A;  3K81 C;  2F1M A;  1LTB D;  4WFN 3;  1EL0 A;  1S5B D;  2NVY H;  1SBB B;  1F2L A;  1B9M A;  5JJI A;  4X3K A;  4X3T A;  2NB0 A;  4ME5 A;  3I4N H;  4A93 B;  4DUY Q;  1VQJ A;  3CAM A;  1NE3 A;  3P75 A;  3W2D A;  1BOS A;  1GVP A;  1LT4 D;  1FVI A;  4IQZ A;  5IIF A;  1I6V C;  1CTM A;  1SNO A;  2K5H A;  3OIP A;  1W2B A;  5EQ0 A;  3NEN A;  5KYL A;  5IYC G;  1W6K A;  3J81 j;  1N36 L;  1OXV A;  1VQF A;  1IBL Q;  4DKA C;  4DA2 A;  3I73 A;  2YTX A;  1JE4 A;  1XNR L;  2AWO A;  5JEA H;  3RLF A;  4C3J H;  2Z6B A;  4BBS B;  4IUN A;  2SNM A;  4R4Q A;  4X65 Q;  4S3S A;  4NMZ A;  4K6L A;  2HDM A;  4JI5 L;  1ICF B;  1I4Q A;  4F7X A;  1PFS A;  5IP9 G;  1EQR A;  3HOW G;  1JOR A;  4GNX A;  1M8A A;  5M3M H;  4ZK9 B;  1BCP C;  4A3G G;  1BQQ T;  4TQU S;  1STA A;  3TRZ A;  3NUC A;  2HCC A;  1ML0 D;  3I55 A;  1PYS B;  2HIX A;  2JEA I;  2NVT H;  3RMH A;  1SMY D;  2EIF A;  2EYM A;  2MGS A;  5LHY 1;  2VNU D;  4EQ5 A;  2BDN A;  5KRU A;  3K6O A;  1DZ1 A;  1VQB A;  3NPP A;  3Q6S A;  2A5H A;  4R1J A;  4LF7 Q;  4RKL A;  4K8J A;  4PQX A;  1NMF A;  3IFD A;  4DPG A;  2QW7 A;  4DV4 Q;  4J8Q A;  2YU9 H;  3F2D A;  5J3B A;  1L1O C;  2LXJ A;  3CRK C;  3TME A;  2OWO A;  2B2Y A;  2PW7 A;  2MQH A;  2XRS D;  3GTP H;  2JA7 H;  4N8F A;  3KUP A;  1CHQ D;  2E8G A;  1XTC D;  3HOU H;  4A3B H;  4AH6 A;  1EY8 A;  3CCR A;  4A3D H;  1BCP D;  3A55 A;  1Q86 C;  4CHT B;  2MO0 A;  3MFG A;  2XWB B;  1G2S A;  4HMI A;  5AJ3 Q;  2HDL A;  2JN4 A;  5JPN C;  2N78 A;  3ZYY X;  1G51 A;  5JVH 3;  3HKZ G;  2MUY A;  1VQD A;  5IGG A;  3CRL C;  4LF4 L;  3EIV A;  1N34 L;  5HGQ A;  3H0G G;  3MAQ A;  1KDA A;  2KCC A;  4DR5 L;  5C44 G;  1AZP A;  4KHP L;  3GTJ H;  1HZA A;  4KJN A;  5TSS A;  4UP9 A;  3PIP 3;  1DOM A;  2BH2 A;  2CHB D;  3FKI G;  2ATW A;  5FK9 C;  1KHI A;  2C9O A;  2A1A A;  4DNT B;  1TS2 A;  1CKM A;  1WJJ A;  2M9V A;  3IAY A;  2R6G A;  1C8C A;  1I4G A;  2F0Q A;  2VUM G;  4MZ9 A;  4JI8 L;  2IJ0 A;  1FL0 A;  2VL6 A;  4IUT A;  1A3V A;  4UHV A;  4NKL A;  5LMN W;  1UEA B;  3PIP A;  1I4R A;  5ELD A;  2XVS A;  2NUC A;  3OOC A;  1OXS C;  4L63 B;  5M3F G;  3E9I A;  4AIM A;  4ZQ3 A;  4DV0 Q;  4O1N A;  4RG1 A;  1WFQ A;  3K59 A;  4YWK A;  3E3X A;  4CDC C;  5T1G A;  2KOL A;  2HUG A;  1RIP A;  2L5T A;  4OO1 H;  4DK0 A;  1YNJ C;  4LK1 C;  3L3O C;  3BDO A;  4BY1 G;  3LX0 A;  2EPB A;  4DR4 Q;  4ZKB B;  5KNC A;  4PZ8 A;  3BU2 A;  2K1B A;  1LV9 A;  3CME A;  5IYD G; 
#chains in the Genus database with same CATH homology
 3D4W A;  3E0J A;  2F0G A;  4JBW A;  1Y69 U;  3DMU A;  2VB3 X;  4XDX A;  4B08 A;  2BOS A;  2R61 A;  1XX8 A;  3NK9 A;  2WV6 D;  1U4P A;  2WKC A;  4AYB B;  1HUN A;  4K5W A;  2WAC A;  2B2U C;  1PDQ A;  2LY7 A;  3GO5 A;  3OSO A;  1PFB A;  1RF2 D;  4OIJ A;  4XT1 B;  4FXG C;  4HAE A;  2MP1 A;  3T51 B;  1H9R A;  1A2T A;  4FYD A;  1BO0 A;  4ABN A;  2K01 A;  4RWS C;  4C3H G;  5C0X J;  1WTO A;  1K83 B;  1GUT A;  3C3L A;  1RKN A;  5J22 A;  2R7Z B;  1D6E C;  2X6G A;  3MC0 B;  3R2I A;  1BBX C;  3MTS A;  2V4D A;  3PO3 B;  2JA6 B;  1K8M A;  5CC4 A;  1G6Z A;  1E2Z A;  2VXW A;  1VDZ A;  2LKV A;  2XSC A;  3MXG A;  1SYC A;  3BDL A;  4XIG S;  3VYU A;  1Q12 A;  4A3F B;  3HOZ B;  3RZO B;  1D1K A;  1DM0 B;  3R93 A;  3AU7 A;  3TZD A;  3QB3 A;  1ZEQ X;  1CI3 M;  3GD7 A;  4X3U A;  2EVB A;  3HGB A;  1HPC A;  1NR4 A;  4DFA A;  1SEB D;  2I07 B;  1WTX A;  3BVG A;  5D65 A;  2Z4I A;  3SXH A;  1QE6 A;  4RHR A;  3KLS X;  1QCB D;  5C4J B;  4XQQ A;  1TVX A;  1ESF A;  3FDT A;  3CU7 A;  1TY2 A;  3IKJ A;  2EDG A;  2RBM A;  4OGQ C;  4QUC A;  4KI0 A;  1BUV T;  2B2U A;  2Y0S B;  2KVM A;  5EBD A;  3R8B A;  3M4O B;  1EWC A;  3HOY B;  1G29 1;  1U4L A;  5EKI A;  3T13 A;  1S5F D;  4ZUI A;  4F8M A;  2KEE A;  1HQR D;  4CKB A;  4R9W A;  2K28 A;  4C1N I;  1D5Z C;  1JQY D;  1JWU D;  2OXP A;  1PRT B;  4FF1 A;  1ET9 A;  1IKL A;  2NVX B;  3JAM L;  4CKE A;  4WRD A;  4OO1 I;  2KCN A;  3VR5 A;  1AFP A;  3PUW A;  1NCV A;  2IX1 A;  2RA4 A;  5K36 H;  1TII D;  2RDH A;  4K2L A;  5NUC A;  2R93 B;  2B2T C;  3D31 A;  1WTW A;  3TSS A;  4TRD A;  3A8J E;  4IUP A;  3Q24 A;  3L9A X;  3U9O A;  2NYZ D;  1TWF B;  3DHQ A;  4EGV A;  4KHZ A;  5KIX A;  4HMJ A;  3S14 B;  2PMZ B;  1WCM B;  3H91 A;  2ID0 A;  2HCI A;  3K5L A;  3M4Y A;  4UDU C;  2B39 A;  1C48 A;  2RQX A;  2K33 A;  5I2Y A;  2M00 A;  1S5E D;  5FKA C;  4C56 C;  4Z9C B;  1V8Q A;  4X3S A;  1RD9 D;  2PCF B;  3GTO B;  1AP0 A;  2EYH A;  3VR4 A;  1S4Z A;  3SK4 A;  5CV4 A;  3ITP A;  1HFN A;  5BN3 A;  1B2T A;  2Z1C A;  1WVL A;  2RSO A;  3TP7 A;  2F0L A;  4EQN A;  1MD2 D;  4V19 0;  2DY8 A;  2H1E A;  3HOW B;  4KY5 A;  2DN8 A;  2JEB I;  4F88 A;  4A3G B;  1KNE A;  1HUM A;  1ONL A;  1DON A;  1QNU A;  3DXJ C;  2Q8I B;  4B9X A;  2RDG A;  1EY5 A;  3PV0 A;  4WJW A;  2O4X A;  5C4Z A;  1CM9 A;  1ESR A;  3VR6 A;  5ELB A;  1WTP A;  1PRT F;  2SDF A;  2FHT A;  1G8Z D;  4KN7 C;  3PUX A;  5ELC A;  4NP5 A;  3TN2 A;  2E2I B;  2B2T A;  1TU2 B;  3M7G A;  5C5M A;  3NWS A;  4EVO A;  3BG3 A;  4IN3 A;  2K7V A;  4WOR A;  4XYQ A;  1LTT D;  1LAB A;  3T56 B;  1T5X D;  3PMF A;  5ELF A;  3HKZ B;  2ICE C;  2BDO A;  3N52 A;  2L0C A;  1V1P A;  3H0G B;  4IUV A;  5C44 B;  2KA7 A;  1EYA A;  1EIG A;  1GOZ A;  1JOQ A;  4K5X A;  2LFN A;  2O5I C;  1TY0 A;  1EU4 A;  1STB A;  1HXY D;  1DOK A;  1CZW A;  2D9U A;  3FKI B;  3KLR A;  4K8I A;  3BYY B;  4R8I A;  5FLX E;  3M85 A;  4G7Z C;  2K5W A;  1I3Q B;  2PNR C;  2VUM B;  2Q8T A;  1SNP A;  1I50 B;  1RDP D;  5A35 A;  5LL6 S;  3VR2 A;  2NTT A;  5EPK A;  5M3F B;  4HCE A;  1O7Z A;  3DEO A;  3FPP A;  1VF5 C;  2BA1 A;  5IGE A;  1KLG D;  3HRZ C;  1HTP A;  3WDN A;  3FEW X;  5HUR A;  1VMP A;  2BA0 A;  4PV1 C;  4BY1 B;  4XQN A;  1FGB D;  1Q8I A;  5KNB A;  2JA5 B;  3RD4 A;  3DUZ A;  3VYT A;  1R4P B;  1IHZ A;  2RVL A;  4A3K B;  4FNF A;  1OXU A;  3MXU A;  1EQT A;  1WD1 A;  1A2U A;  3VA7 A;  4IFD G;  4CJ1 B;  5CV9 A;  5CV8 A;  5ELE A;  4K2K A;  3S15 B;  3OW7 A;  2QIL A;  1D5M C;  5C5L A;  3K57 A;  5M5Y B;  2ZXR A;  1J8I A;  2IX3 A;  1FYC A;  1EWH A;  1SE4 A;  1EY9 A;  2AUJ D;  1X3Q A;  4C3H B;  4Y7N B;  3C2P A;  1H9S A;  2EY2 A;  3F2U A;  2MPM A;  5I2X A;  3MHB A;  4OIK A;  3FRP B;  2WII B;  2AUK A;  1SJH D;  1HCZ A;  5JPM C;  4QMG A;  1V43 A;  3D6C A;  2NN6 I;  1IYV A;  5COR A;  2KHS A;  4QF4 A;  1D2B A;  5EJW A;  1HA6 A;  5BN4 A;  1B44 D;  4XT3 B;  1ENC A;  1QG7 A;  1JC7 A;  3PUY A;  2AQ3 B;  4HED A;  1XXG A;  3CQZ B;  4KY7 A;  2FMC A;  3V05 A;  1HQM C;  3A7A B;  1IL8 A;  5G3L F;  1SJE D;  4DF7 A;  2KQ3 A;  2CQA A;  1JWM D;  1DD2 A;  1BF4 A;  1CFM A;  1FNV A;  1SNC A;  1PRT C;  3HZX A;  1CT1 D;  3OMC A;  1OXX K;  1AEX A;  1H9J A;  4C1N K;  3DWA A;  4KV6 A;  1JIC A;  2WP8 J;  4FVM A;  1PTO B;  4KTA A;  3NHH A;  1PXU A;  3ND9 A;  3A56 A;  5A2Q E;  1X32 A;  2F0S A;  4ILW A;  3NTH A;  1FNU A;  1Q3L A;  2MJ8 A;  4LJZ C;  4HSP A;  4IUR A;  2A6H C;  1RTO A;  3EVQ A;  1II3 A;  1X3P A;  3V96 A;  1FD7 D;  4B9W A;  2B8G A;  1PZI D;  4J1M A;  4C3I G;  3E6Z X;  4PNY A;  4R8N A;  3SK5 A;  1ZYR C;  4ZKC B;  4BY7 B;  1AW7 A;  4KY6 A;  1ZXT A;  2KED A;  3SE0 A;  5C0X H;  1T5E A;  2A6H D;  1U4M A;  4KN4 C;  2E75 C;  3J80 L;  4A3J B;  3QWN A;  1YNJ D;  1EZ6 A;  1TS3 A;  2Q8R E;  3LWE A;  1RCV D;  1JCK B;  1SE3 A;  2EYF A;  3J81 L;  1TS5 A;  2JE6 I;  4HR7 B;  1DCZ A;  3WOF A;  1ZYR D;  3HG9 A;  3VYS A;  3WOE A;  1GXD C;  3I4N B;  2WIN B;  2O5J C;  4DXG A;  3X3N A;  4Q5V A;  5J1Z A;  3K5N A;  2F3W A;  5IGF A;  2K32 A;  3FVQ A;  4J6H A;  3I70 A;  3I91 A;  1PTO F;  2F0E A;  1SAP A;  1QJO A;  1SYF A;  1Q90 A;  2JYO A;  3S9W A;  2KUM A;  1U9R A;  5EGT A;  1AN8 A;  4IFD J;  1HHV A;  1EEI D;  2EXZ A;  2J0T D;  1NUC A;  2F0M A;  2WAQ B;  2D2C C;  3O13 A;  1EFI D;  1F9S A;  4DK1 A;  3KF8 A;  2M2L A;  3EFX D;  3K5M A;  5JJZ A;  1E2W A;  4KJO A;  2L11 A;  1NAP A;  5E4W C;  4OHJ A;  2YYZ A;  3P1H A;  3RZD B;  1IW7 C;  1TQO A;  4H44 C;  1BCP B;  1TKW B;  3M7N A;  2BE5 C;  2A69 C;  4LMQ D;  2JA7 B;  3PIO 3;  3I4L A;  1V1O A;  3HOU B;  1DOL A;  5JAV A;  4U68 A;  2N55 A;  4KMU C;  5CV5 A;  2E74 C;  1E0B A;  1LT6 D;  3HOV B;  5KGU A;  3G6J B;  3CKI B;  4HSV A;  1FNW A;  4HCS A;  2F0I A;  1F2M A;  3I72 A;  3A8K E;  3DWP A;  2BE5 D;  4YIJ A;  1B3A A;  1O7L A;  3GV6 A;  5CV6 A;  1Y1W B;  1Q1E A;  2NZ1 D;  4ZRZ A;  1QNK A;  2L55 A;  1TWC B;  1F2Y A;  2XRQ D;  3Q22 A;  2CVR A;  1EOT A;  4H7B A;  2DNC A;  5J39 A;  1ILQ A;  5HGT A;  4EQO A;  4MHE A;  2R92 B;  2AQ1 B;  1SSO A;  1UNS A;  4FXK C;  3I4M B;  3J7A V;  3MXN A;  3GTQ B;  5C0X I;  4KD3 A;  4RKB A;  5JOB A;  2R3Z A;  3SK8 A;  1I4H A;  5IGC A;  1A15 A;  4GZY C;  1B53 A;  1D1I A;  1K8O A;  1HA5 A;  1Y1V B;  3HP3 A;  5KEE A;  1BCP F;  1CK1 A;  3QJY A;  1ICW A;  1U4R A;  5IOD A;  4G4K A;  1EEF D;  5JEA G;  4C3J G;  1NR2 A;  3BZD B;  1PFN A;  1PMR A;  4KKU A;  2F3V A;  5I9P A;  1I6H B;  2F0O A;  3VR3 A;  1QWY A;  1EY0 A;  2OF1 A;  3NTK A;  3NBH A;  5FO9 B;  3K5O A;  3R2T A;  2NN6 H;  4BS9 A;  1WTQ A;  3ERO A;  3OWE B;  1Y8O B;  4LAA A;  1XYI A;  3UI2 A;  2K03 A;  2TMP A;  1F77 A;  1I4X A;  1D5X C;  1LLR D;  5BN5 A;  3NTI A;  1PTO C;  2F0F A;  1SDF A;  5T1I A;  3TP8 A;  1ROD A;  1VF7 A;  2FFK B;  1LAC A;  1TS4 A;  2EJM A;  2IW3 A;  4ZUJ A;  1DXM A;  2X69 A;  3DEP A;  3IL8 A;  5KND A;  4DXF A;  3S1M B;  4N9P A;  1PTO H;  1TR5 A;  1MBY A;  5I6W A;  4ULL A;  2JXM B;  1Z7T A;  2O2L D;  3K58 A;  1S5C D;  2A6E C;  2F0D A;  2NBF A;  3J7Y W;  1FR3 A;  2L9H A;  4PMC A;  5D3I B;  1KTK A;  2EOT A;  1G2T A;  3TDQ A;  3N6R A;  4KKT A;  4M8A A;  1LTA D;  2PZT A;  1TWG B;  5I6Y A;  3QG1 A;  1S5D D;  1TWA B;  1SND A;  1TWH B;  3SHL A;  3S17 B;  3A54 A;  1VCI A;  2B2V C;  4QUF A;  4OO1 G;  1HFG A;  3QOJ A;  1KDB A;  5AFW A;  2HQE A;  3MVV A;  3P7J A;  5DM7 3;  3QOL A;  2EJG C;  2BCO A;  4IUU A;  3OPO A;  2GA4 B;  4CJ2 C;  1I4P A;  2K5Q A;  2Z4H A;  4DN4 M;  2D5D A;  4RAU C;  4BWG B;  4C3I B;  2E2D C;  2PPB C;  1KNA A;  5K5P A;  2DY7 A;  2IWH A;  2KEC A;  2B2W C;  3U9S A;  4ID6 A;  2Z8L A;  5C0X G;  2F0U A;  5EBC A;  3JAM E;  3AB9 A;  2PQE A;  1CA5 A;  3S2H B;  1SE2 A;  3S1R B;  5IGB A;  1CQF A;  4PMB A;  4I65 A;  3ONA B;  4KK7 A;  1LTG D;  5CYU A;  3X3M A;  1SMY C;  2K5D A;  1YNN C;  1RTN A;  2PW5 A;  2F0P A;  2F0V A;  1BDO A;  2LS0 1;  1CZG A;  5CBA E;  1C4Q A;  5IT9 E;  4A3I B;  1GUS A;  1ZKO A;  3BVM A;  2AWN A;  1M4V A;  1PFM A;  3DM1 A;  1GUO A;  3A8I E;  5EPJ A;  1GUN A;  1QIL A;  3C46 A;  2NVQ B;  3NWT A;  1JOO A;  4FF3 A;  1R9T B;  1RHP A;  4FF4 A;  1KLU D;  4P2C B;  1JB3 A;  1B9N A;  2EY6 A;  1V1P B;  1YNN D;  5C3W A;  5C4H A;  4V0B A;  3GTL B;  1H9K A;  4OL7 A;  5IOC A;  2B2V A;  3KBG A;  1LT3 D;  2EY5 A;  3NE5 B;  5JEA J;  1O7Y A;  4DNR B;  3GTG B;  3IFT A;  2EYO A;  4RH6 A;  4XXE A;  5M9O A;  3S1Q B;  1SYB A;  4CGY B;  1MI2 A;  2L12 A;  2EYJ A;  2FMM A;  2NWG A;  2PZW A;  2E2H B;  1NSN S;  3H3V C;  1EY6 A;  1ENF A;  3TP6 A;  3KLS A;  5C3X A;  1A3T A;  2B2W A;  2K05 A;  5CGK A;  2MHV A;  3NQI A;  4IZ8 A;  5FO8 B;  1QB5 D;  1ET6 A;  1BNZ A;  4M1U B;  5JVG 3;  2LMC B;  4CBV A;  4MN3 A;  2JA8 B;  3D4R A;  1SYG A;  4FO2 A;  2A74 C;  1SNQ A;  1F9R A;  3SR1 A;  3NQT A;  2AQ2 B;  4ODG A;  2B8F A;  2C5C A;  3MEH A;  2J4X A;  5ISR A;  1GUG A;  2IX0 A;  1PRT D;  4F87 A;  3TZU A;  3C1F A;  1PLF A;  2F0J A;  3A7L A;  3QO2 A;  1EY7 A;  3K7A B;  4RHS A;  1CHP D;  2QCP X;  3H94 A;  4KD4 A;  4RGN A;  2PO4 A;  1DJR D;  3OIQ A;  1BXT A;  3MFY A;  5K36 G;  3EQL C;  5EKK A;  5KYI A;  1Z47 A;  2E76 C;  3DWQ A;  4QIW B;  1H9S B;  2L4N A;  2IL8 A;  1Z6H A;  1CA6 A;  3HOX B;  1MSH A;  2EJF C;  3HS0 C;  2KJX A;  2I46 A;  1G91 A;  2NTS A;  2DNE A;  2N88 A;  4ZLT F;  3I3C A;  3H09 A;  4MIU A;  3MA2 B;  2NVY B;  1B50 A;  1EYC A;  4KKS A;  3D3R A;  4IUQ A;  3ERQ A;  1KAA A;  1LO5 D;  2EY1 A;  3MXP A;  1F2Z A;  1O78 A;  4HN7 A;  4IFD H;  1A6X A;  3I8Z A;  4FF2 A;  1STE A;  4N9T A;  4NW2 A;  2SOB A;  4BA2 I;  1PZK D;  1STG A;  3FPU B;  2A68 C;  3Q0A A;  2D62 A;  4C3J B;  1EZ8 A;  2VB2 X;  3S2D B;  4RGT A;  2RDF A;  4NDX A;  5M3M B;  2NN6 G;  4Q0F A;  3S16 B;  1DYQ A;  3T53 B;  4XQJ A;  2NVT B;  1JWS D;  3OWF A;  1SNM A;  1QOH A;  4K5V A;  3VYR A;  4K14 A;  2XNA C;  4PMW A;  2ZXO A;  2QKI C;  3RUZ A;  2F4I A;  2ZXP A;  1R4Q B;  3C1E A;  2YU9 B;  1GUW A;  2EZV A;  1OXT A;  2A68 D;  3L7Z C;  4E6I A;  3GTP B;  2OEO A;  2XN9 C;  1EIH A;  3LNN A;  4IAL A;  3GV3 A;  3H6M A;  1EY4 A;  4CJ0 B;  4G7O C;  4A3B B;  4I7Z C;  4A3D B;  2F03 A;  5FLX L;  3R3O A;  1STH A;  4XTC S;  1Y8P B;  2H4O A;  4RGM A;  1PYW D;  1LTS D;  4TKO B;  4UAI A;  5FOB B;  3W3A A;  4RFB A;  3GTJ B;  1A3U A;  2JSO A;  1IW7 D;  4ZYS A;  3KBX A;  4RA8 A;  3MWY W;  1JOK A;  2A69 D;  3CHB D;  2OT2 A;  5E1F A;  1Q1B A;  4DAP A;  3EA6 A;  1EYD A;  3NSW A;  5F2D A;  2PYK A;  3Q23 A;  5IGD A;  2PZU A;  4RCN A;  5C6A A;  4QB4 A;  3SVM A;  3T4A C;  1H9M A;  1W6J A;  3E5S A;  4CKC A;  4L6T B;  2XWJ B;  4DAV A;  3BYT B;  3P20 A;  5G3L D;  3PUV A;  1WD0 A;  1O80 A;  1VMC A;  2CW0 C;  3D6W A;  4DGZ A;  4XYO A;  3FMC A;  1UUP A;  4FP5 D;  3URY A;  1LTR D;  2X6L A;  2ZT9 C;  4ZAI A;  1KDC A;  1SYE A;  3ND8 A;  3NP8 A;  1IKM A;  2F0W A;  3GQB A;  4U67 3;  2A73 B;  5IT9 L;  4RCO A;  3S1N B;  1PZJ D;  2WB1 B;  5FO7 B;  1SXT A;  2SEB D;  1F9Q A;  1UAP A;  2EE1 A;  1ENA A;  1STN A;  1WTV A;  2CW0 D;  4DAY A;  2IT1 A;  1TT2 A;  2RSN A;  3AMU A;  2F0N A;  1ILP A;  5I9O A;  4IFD I;  4DU9 A;  5M5X B;  1MGS A;  3BVZ A;  1LT5 D;  2L1B A;  2TSS A;  1E2V A;  1RJT A;  3BS1 A;  1HTL D;  3J80 E;  1WTR A;  1MSG A;  2ICI A;  1EU3 A;  3GTK B;  2FIN B;  2F0K A;  3NBI A;  5DNF A;  3D4D A;  3J7A F;  3J81 E;  1CQV A;  2G9D A;  3QIA A;  2RKS A;  4RGO S;  3MZ5 A;  2F0H A;  2F0T A;  3M3Y B;  1F9P A;  2EYL A;  2EYP A;  1HRJ A;  3LWU A;  5CV7 A;  3TBI B;  4H13 C;  3I90 A;  5LL6 X;  4TSS A;  5D14 A;  3GP7 A;  3HEJ A;  2J7Z A;  4EQP A;  2SNS A;  5D3D A;  4A3M B;  4C2M B;  3PO2 B;  1STY A;  1SYD A;  5M5W B;  4L8J A;  5E3F A;  1J9O A;  3D8G A;  5CR3 A;  1EQV A;  2IPK D;  3BDC A;  5A2Q L;  4BA1 I;  4K6D A;  1L0Y B;  1GJX A;  5DAU A;  4G57 A;  3GTM B;  2QEJ C;  1L0X B;  1LTI D;  2G9H D;  5DM6 3;  2E2J B;  3SEB A;  1PTO D;  3PUZ A;  4A3E B;  1GHK A;  1AZQ A;  3OMG A;  1JR0 D;  2JP1 A;  5COY A;  2QF7 A;  1BR9 A;  3K0Y A;  1SFO B;  5CMD A;  4QCL A;  1B4O A;  1OO9 B;  4O42 A;  5CBE E;  5E4X A;  3G7L A;  3OHX C;  3KK7 A;  4BBR B;  3SDZ A;  3EJI A;  2A6E D;  1KAB A;  1GHJ A;  2QDB A;  3VA5 A;  4HTH A;  2B2Y C;  3NXW A;  2WKD A;  2ENB A;  1Y8N B;  4H0L C;  2K04 A;  3SK6 A;  5I4D A;  5EKL A;  5C4X B;  2FJ2 A;  2K6A A;  4G7H C;  3T16 A;  5DEH A;  2B63 B;  2XIW A;  4FXD A;  3TP5 A;  1XWE A;  4JK1 C;  5C3E B;  1B1Z A;  1IYU A;  4KHV A;  5EPL A;  3V2T A;  2F1M A;  1LTB D;  4WFN 3;  1EL0 A;  1S5B D;  1SBB B;  1F2L A;  1B9M A;  4X3K A;  4X3T A;  2NB0 A;  4ME5 A;  4A93 B;  3P75 A;  3W2D A;  1BOS A;  1LT4 D;  4IQZ A;  5IIF A;  1I6V C;  1CTM A;  1SNO A;  3OIP A;  5EQ0 A;  5KYL A;  1W6K A;  1OXV A;  4DA2 A;  3I73 A;  1JE4 A;  2AWO A;  5JEA H;  3RLF A;  4BBS B;  4IUN A;  2SNM A;  4S3S A;  4NMZ A;  4K6L A;  2HDM A;  1I4Q A;  4F7X A;  1JOR A;  1M8A A;  4ZK9 B;  1BCP C;  1BQQ T;  4TQU S;  1STA A;  3NUC A;  2HCC A;  1ML0 D;  2JEA I;  3RMH A;  1SMY D;  2EYM A;  2MGS A;  5LHY 1;  2VNU D;  2BDN A;  5KRU A;  3K6O A;  1DZ1 A;  3NPP A;  3Q6S A;  2A5H A;  4RKL A;  4K8J A;  4PQX A;  3IFD A;  4J8Q A;  3CRK C;  3TME A;  2B2Y A;  2PW7 A;  2XRS D;  3KUP A;  1CHQ D;  1XTC D;  1EY8 A;  1BCP D;  3A55 A;  4CHT B;  3MFG A;  2XWB B;  1G2S A;  4HMI A;  2HDL A;  5JPN C;  3ZYY X;  5JVH 3;  2MUY A;  5IGG A;  3CRL C;  3MAQ A;  1KDA A;  2KCC A;  1AZP A;  4KJN A;  5TSS A;  3PIP 3;  1DOM A;  2CHB D;  5FK9 C;  2C9O A;  4DNT B;  1TS2 A;  2M9V A;  3IAY A;  2R6G A;  1C8C A;  1I4G A;  2F0Q A;  2IJ0 A;  4IUT A;  1A3V A;  4NKL A;  1UEA B;  1I4R A;  5ELD A;  2XVS A;  2NUC A;  3OOC A;  1OXS C;  4L63 B;  4ZQ3 A;  4O1N A;  3K59 A;  5T1G A;  2KOL A;  2HUG A;  2L5T A;  4OO1 H;  4DK0 A;  1YNJ C;  4LK1 C;  3L3O C;  3BDO A;  3LX0 A;  2EPB A;  4ZKB B;  5KNC A;  2K1B A;  1LV9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...