4KHPQ

Structure of the thermus thermophilus 30s ribosomal subunit in complex with de-6-msa-pactamycin
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
99
structure length
99
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S Ribosomal RNA
publication title Crystal Structure of a Bioactive Pactamycin Analog Bound to the 30S Ribosomal Subunit.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 22
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4khpQ00
4YHHL 3RLFA 4DV2Q 1HNWL 2CQOA 3HOXG 1S3OA 4A3GH 3LGJA 4IJHA 3UE1A 1N33Q 1PH6A 3GTMH 3A5UA 1E7ZA 1PH9A 2MNAA 1YHQA 3RNUA 1HZAA 3HOVH 3WWVA 4AQYQ 2D62A 5GROA 3M4OH 4JV5L 4J15A 4JI1Q 2R92G 1KQSA 5DLQE 4BY1G 2NVTH 2ZJQA 3HFZB 3PUXA 4PZ8A 3S1RH 4JI3Q 3F2CA 1P16A 2B29A 3GTGH 2MFIA 4DV5L 2K5HA 2R93H 1PH7A 4ALPA 2KENA 3TQYA 2A19A 4BBSG 1Z9FA 4DNIA 4O0AA 4JI5Q 2JA7H 4C2MH 1R9TH 3AFPA 4LFCL 3CCMA 1I94Q 2Q2IA 2UUCQ 2NN6I 3FP9A 1K8GA 2JA6G 1XMQQ 2UUAQ 4A3IG 2IT1A 4DV4Q 4LF9L 1PH5A 3G6EA 1N32L 1HNXL 1VQ7A 1Q82C 4K0KQ 1WJJA 4JYAL 5HGQA 4IPGA 3D0FA 2FXQA 2BH2A 3OW2A 1Q12A 2LSSA 1TWFH 4DR3Q 1FJGQ 3A5ZB 3RN2A 2H5XA 4POFA 1X56A 4DUYQ 2JEAI 4A3BG 1KXLA 1LM0A 4GNXC 1Y14B 2JE6I 3HOZH 4GOPC 4BY1H 4GS3A 2QEXA 2KHIA 1VQ4A 4OONA 5M5YH 4B3TL 4JI7L 4A3EG 4DAYB 4PG3A 2UUBL 4DR7L 1PH4A 2JQOA 3K0XA 4Y52H 1TWAH 1Y1VG 3U4VA 3HKZE 3NENA 4GN4B 5H1SE 2ZM6Q 2Y0SE 5C0XG 3PO3G 4BBSH 3CCEA 1I6HH 3S16H 1K83H 1SRUA 4AYBG 1QVGA 1WFQA 4X64L 4DPGA 5M3FG 1AE3A 3KF6B 2QA4A 3PUVA 1RL2A 4GKKL 1HNZQ 3GTPH 3U58A 1PYBA 4JBJA 4A3IH 1KIXA 2GN5A 1PH3A 2MO0A 4QJFA 5C3EH 2XTIA 2YU9H 1UEBA 2KHJA 3HOUG 3OTOL 1A63A 3AFQA 4YHHQ 3PF5A 1IZ6A 1EQRA 4AH6A 2IHFA 3I4OA 2K5NA 1KD1C 4LF6L 4OO1G 4L5SA 4MZ9A 4R4QA 1XTDA 4DV6Q 4A3JG 1I3QH 3GD7A 2VNUD 3CCSA 3W1BA 5LMUL 2IX1A 5LMNQ 1BBUA 3T1HQ 1NJIC 2OQKA 2VUMH 4KHPL 1QZGA 1HH2P 2HIVA 3UDIA 1AH9A 2HIXA 4YCVA 3K7UC 2PI2A 4DV5Q 3KF6A 1NBWA 3HKZG 1X3EA 5GAGC 1PFSA 4PMWA 3S1QH 4DK6C 1G51A 2AWNA 3D31A 3F2DA 4DUZL 4WJ3M 1YHBA 2AWOA 3TS0A 4B3ML 3BJUA 2NZOA 2F3IA 2WAQE 1TWGH 2N8NA 2WB1E 3ERSX 3NELA 5FLXc 4LF9Q 2UXDL 1N32Q 1LTLA 1C9OA 5E7NA 5M3MH 5IWAL 1KHIA 4A4IA 1FL0A 3CMAA 3UE0A 2PNHA 4A3JH 4DR4Q 4C3HH 4X6AH 2OCEA 1V43A 3RN5A 1XPUA 3CAMA 5JEAJ 2JJQA 1WI5A 3CCJA 4DV0L 1E1OA 4A3MG 2YTVA 1W2BA 2ES2A 3S2DH 4LUOA 1H95A 5ELOA 4PZ7A 2I0QA 1YEZA 2UUBQ 2UU9Q 3CQZH 4IJLA 4B3SL 4LF7L 1GVPA 3I4MG 1VQEA 1VS0A 2VQEL 4APVA 2I5HA 2ZTCA 4LFBL 3FKIH 2B63H 5JJLA 1TWCH 1XPRA 1YJ9A 2E2JH 1DGSA 1L1OB 4GKKQ 1B70B 1MIUA 4DKAC 1EUJA 2VQFQ 3H15A 3CD6A 2UXCQ 4WJ4A 2ID0A 3T1YQ 2CFMA 3CPFA 2WAQG 4A3KH 2VY3A 4HJ7A 3G71A 5GQOA 1CKMA 2KCMA 4QL5A 1K8AC 3J81c 1AE2A 4RMFA 1O7IA 3PCOB 4LF6Q 1V1QA 1YZ6A 3L7ZC 4A3CH 2R7ZH 2EIFA 4OO1I 3M4PA 3KJOA 3DM3A 3RZDH 1GM5A 3TS2A 4LWCA 5IP9G 2E8GA 5LMUQ 2HHHQ 1PH8A 3J80c 4BBRH 4A3MH 1MJCA 3CCUA 4NXNL 4IFDJ 1IBLQ 1CSQA 1YI2A 1JMCA 4UP7A 3E9IA 3DLLA 1OXXK 1L1OA 3I2ZA 2A8VA 2CKZB 4IPHA 3JC66 1Q7YC 3PIOA 2E2HH 2ALYB 2OWOA 5M5XH 1U5KA 2JA9A 3SGIA 3HOYH 2YYZA 5IYCG 3PO2G 4YWKA 1JJCB 3ULJA 1Q46A 4A3DG 3F1ZA 1HR0W 1YJWA 4B3RL 5FLMG 4X66L 3J7ZC 1XNRQ 4L5TA 2D0OA 4QY7A 3MEFA 4R4CA 4OWXB 2E5LL 2Q2UA 4A3LH 4JI0Q 4A3FG 4A93H 5IYBG 4DR5Q 2K4KA 1UE1A 3W1GA 3G4SA 3HOXH 4L5QA 1KC8C 4DV0Q 4GLVB 4YY3L 4BY7G 2WP8J 2N49A 1Q1EA 1SE8A 5IE8A 2JA8G 3HKSA 1SN8A 2QGQA 4LF7Q 5ELNA 2K14A 4JOIA 4LUZA 4R4OA 2VQEQ 4OX9L 2NZHA 4FDBA 3F8TA 3K8AA 4YWMA 1NE3A 3I55A 4L5RC 3CF5A 2R92H 5IYCH 4P72A 5IP7G 3H3VI 5AJ3L 1IBKL 5FJ8G 3PGZA 4A3DH 1N34L 3ULPA 3IRBA 1CKOA 5FLMH 1VQPA 1XMOL 1J5EL 1UE6A 2HT1A 2PI2E 4LW1A 3EIVA 4A3FH 2UXBL 4JI8L 2JA6H 4UY8C 4BXXH 1L0WA 2PMZE 2KCTA 4GN3B 5JJIA 4DAMA 1I50H 4NXMQ 3K7AH 1Z47A 1C7YA 1D7QA 2JA5G 2Q2HA 1HNWQ 2JA8H 3E9HA 3GDEA 1IBML 1WYDA 4GN5A 3J7A5 4TVAB 4DR6L 2VL6A 1CKNB 3MXNB 4JBMA 4LFAL 4A3BH 1VQLA 3CC4A 1E1TA 1EIFA 1A8VA 3BZCA 1A62A 4JV5Q 3PUWA 1RIPA 1X65A 4A3EH 2ASBA 3RLNA 3U50C 3JAMi 1Y1VH 2Z6KA 1VQCA 3PO3H 4IOAA 4C3IH 5M3FH 4DV1L 3BZKA 3CPWA 2Y0SG 1IYJB 1XNQL 2CWAA 3EBEA 5C4XG 1PVOA 1JE5A 2MQHA 4DV7L 4LFCQ 3S1MH 1PYSB 2MO1A 3RLOA 4R4TA 3HOUH 2ZTEA 2F4VL 2BH8A 3S17H 4PZ6A 5LMNW 2V1CC 1HNXQ 4HJAA 4HIKA 1YJNA 4DR2L 1CKNA 1VQJA 4YY3Q 1SFOH 1HR0L 4JYAQ 4GNXB 4GLXA 1Q1BA 3ZJYC 2EXDA 4DV3L 4GOPB 1IL2A 3TREA 3KLWA 4OX9Q 1JJGA 1YBYA 1WCMG 2OTLA 4JI6L 3GO5A 1VQHA 2PQAB 3OYYA 1PH1A 4JI7Q 5JJKA 1LUZA 4B3TQ 2NVYH 1VQMA 2GVAA 4P74A 3J81j 3S2HH 3KJPA 4JI1L 4DR7Q 5EAYA 3I56A 1OXUA 1YHAA 5K36G 2CWPA 1QVFA 1KRTA 1XMOQ 2K52A 4JOIC 1A0IA 2L15A 2ZTDA 4X64Q 1GKHA 3CCRA 2R6GA 1QZHA 4JI8Q 4MNOA 4H02A 4HIOA 4LF5L 4JI4L 2RF4A 4LF4L 1OXVA 2A1AA 4HJ5A 2C35B 1HZ9A 3UDXA 1X3GA 1B8AA 4GNXA 3OTOQ 2UUCL 1EWIA 1XMQL 2I5LX 2WB1G 1HZBA 3CCQA 4GOPA 4DV4L 5IY0A 1CSPA 2UUAL 4JI2L 4P71A 5JEAG 3AYHB 4BXXG 4R1JA 1YIJA 1X54A 2PQAA 4DR6Q 4LFAQ 4DR1L 1EOVA 2E2IH 3ULLA 1W3SA 4A3GG 1FJGL 1I5FA 1VQNA 4C3JH 5C4JH 2EQSA 1I94L 4DUYL 1UE7A 4KHPQ 3HOVG 1SROA 4OXPA 4X62L 3I4MH 1QUQB 3GTQH 2LXJA 4OWTB 1FVIA 2RHQB 1PV4A 1N8RC 3H3VH 1GO3E 2F52A 4XIGS 2JEBI 4KLKA 4YCWA 2ZM6L 4DV1Q 1Y1WG 2IY5B 2Z0SA 3UDGA 1XNQQ 2R93G 1VQOA 2WFWA 4DUZQ 2VZAA 1ASYA 4B3MQ 1L2FA 1VQFA 2JA7G 4KI0A 2HQLA 2CCZA 2RHSB 1HNZL 1E24A 2UXDQ 2F4VQ 1TXYA 2AHOB 2Z6KC 2AMCB 4HIMA 1JT8A 3L0OA 1BVSA 3E0EA 3TEHB 2IHEA 3I7FA 4QIWE 5IWAQ 4A76A 2NVQH 1MKHA 1HJPA 4DV3Q 2YTYA 3W5OA 4IFDG 1HZCA 4UP9A 5IP9H 3S14H 3CC7A 3PSIA 1E3PA 4JI6Q 1QUQA 4DV6L 4LF8L 5BR8L 4TQUS 2R7DA 3RZOH 3U4ZA 5LMNL 3T1HL 3HOZG 1KL9A 4P75A 4B3SQ 3K80C 1Y1WH 4LFBQ 3CW2C 1VQAA 4AYBE 4Y7NH 1PA6A 3GTJH 3GTOH 2XGTA 4NB3A 1TWHH 3PO2H 1NMGA 4LF5Q 1SMXA 2LXKA 4NPSA 4YCUA 1KRSA 4JI4Q 4LF4Q 3GTLH 2R7FA 4IO9A 3CP0A 1BKBA 2N78A 5C0XJ 3CXCA 1SR3A 1NTGA 1VQIA 1B7YB 4JI2Q 3HOWG 1JB7A 4QQBX 3A0JA 3ER0A 5C3EG 1X3FA 3M3YH 1FGUA 5IYBH 2DUDA 4R4IA 3NEMA 1QVCA 4QGUA 4IOCA 4DR1Q 3G48A 1C0AA 3NBHB 5C44G 3B6YA 4DR4L 4BY7H 3KYHC 1GD7A 4JCVE 4X62Q 5M5WH 3F2BA 4HJ8A 4NXNQ 2VUMG 4BA1I 2UU9L 2N3SA 1E22A 1NY4A 1X9NA 3VDYA 1EQQA 2Q2TA 3KOJA 4GKJL 3GTKH 4UP8A 5IP7H 1M1KC 1MJEA 2K50A 3TRZA 4XTCS 5FJ8H 2ZJRA 4IPCA 3KF8B 3KFUA 1OTCA 3AQQA 2VQFL 2YTXA 1N36L 3HOWH 2UXCL 4AIMA 3T1YL 1Q86C 4B3RQ 2RCNA 3BU2A 1YNXA 4X66Q 5GADC 4HIDA 1VQ5A 2ATWA 1L1OC 2E5LQ 3I4NG 3S15H 2VS1A 5C44H 3PUYA 4GLAC 5M3MG 2D0PA 1X55A 2K5VA 1KAWA 2IX0A 3Q8DA 4X65L 3J81i 2ZJPA 1VQ8A 2JA5H 1XJVA 5IYDG 4IFDI 2YV5A 5IT9c 2BA0A 4LF8Q 5BR8Q 2HHHL 1VQ9A 4LNQA 3ICEA 4DV2L 2OTJA 3FHWA 4O2DA 1T9HA 3J80i 1S72A 1IBLL 3EN2A 1N33L 3L2PA 1VQBA 2KBNA 1K0RA 1K73C 2JK8A 3KDFB 1VQKA 4UPAA 5HY6A 5GAEC 3STBD 1Q8KA 3STBC 4HJ9A 4AQYL 2DGYA 2BA1A 3FKIG 5J3BA 5AJ3Q 1IBKQ 5GAHC 2GVBA 2B63G 3PIPA 1N34Q 1J6QA 4JI3L 4EX5A 5C4XH 1NMFA 1J5EQ 1UE5A 1S40A 3H0GG 3CCVA 3I4NH 4A3KG 1UWVA 4JI5L 1XNRL 1VQGA 2NN6G 4MTNA 4A75A 1VCIA 4ME3A 4KHZA 4JI0L 1K3RA 1P8LA 5IYDH 3M7NA 4DR5L 4POGA 1LYLA 1M90C 4A3CG 3S24A 3A74A 2R7ZG 3PF4A 1IBMQ 3UDFA 4JBWA 4K0KL 1OXSC 3KDFA 4BBRG 1G6PA 2OQ0A 1WCMH 3RR5A 4BA2I 2I5MX 4JG2A 1IXRA 1D8LA 1VQDA 1WOCA 4LUVA 2VW9A 4DR3L 1XPOA 2NVXH 3AEVA 1YVCA 4GKJQ 2AKWB 3M4QA 1EYGA 4NXML 3JAMc 3PUZA 3CCLA 1V9PA 5C0XI 1EFWA 1ASZA 1VQ6A 3CMEA 1N36Q 1PH2A 1JJ2A 3HOYG 3H0GH 4EQ5A 4P73A 1CUKA 4DV7Q 4IPDA 3M85A 1K9MC 2K75A 1BBWA 3PV0A 1Q81C 1U0LA 3S1NH 1EIYB 1PHJA 1OXTA 1X6OA 3M9BA 4DK3C 4YWLA 1N9WA 4X65Q 4RG1A 3CC2A 4JBKA 4A3LG 4A93G 4JC0A 3K81C 2UXBQ 1G291 4OWWB 4DR2Q 1YITA 2B3GA 1HR0Q 1SLJA
chains in the Genus database with same CATH superfamily
3RLFA 2RVLA 4DV2Q 1HNWL 2VB2X 3HOXG 3TZUA 3MXGA 1PH9A 1YHQA 4ZK9B 1HZAA 1BF4A 3HOVH 4AQYQ 2D62A 2F0EA 5GROA 4JI1Q 4RFBA 5DLQE 2ZJQA 2DNCA 1R4QB 3K5OA 2A6EC 4DV5L 3FMCA 3HOWB 2R93H 1BQQT 1JORA 4K8IA 4DNIA 1SNMA 1I94Q 1FNWA 4S3SA 3AU7A 2JA6G 5IGFA 2JA5B 1VQ7A 3V96A 1A2UA 4RHSA 1Q12A 1U4MA 2LSSA 1GUWA 3A5ZB 3TBIB 1LM0A 4GNXC 1Y14B 4DAPA 5J39A 3AMUA 1XTCD 3E5SA 1ENFA 4DAYB 3ND9A 1PH4A 3K0XA 2ZM6Q 3U4VA 3HKZE 3I3CA 4DXFA 1K83H 4ZUIA 1AE3A 3KF6B 2XIWA 3KLSA 5EKIA 3J81L 1BNZA 1HNZQ 1IW7C 2YU9H 2GN5A 2XTIA 1UEBA 2KHJA 1J8IA 3I91A 3J80L 3OPOA 2K5NA 2KOLA 4MZ9A 4DV6Q 4A3JG 1XX8A 2A73B 1MI2A 2IX1A 4K6DA 4L6TB 3R8BA 2F4IA 1B4OA 1AH9A 4FF2A 3QOLA 2NTTA 3NSWA 3TSSA 3H0GB 1CFMA 4DK6C 1DOKA 2A5HA 3F2DA 4EQPA 1PTOH 2F3IA 5ELFA 1N32Q 4L63B 5E7NA 5M3MH 5IWAL 4A4IA 1D1IA 1FL0A 1I4PA 3CRLC 4QF4A 2PNHA 4O1NA 2K1BA 1D2BA 2X69A 1QNKA 3CAMA 1SNPA 4C3JG 4DV0L 1E1OA 1YNNC 1W2BA 2ES2A 1H95A 2UU9Q 1DJRD 4B3SL 3QIAA 1VQEA 1F9PA 2VQEL 3S1RB 2B63H 5JJLA 1RHPA 4K6LA 1DGSA 4RCNA 2JA7B 4OIJA 1MIUA 4DKAC 1EUJA 4HN7A 2UXCQ 2CFMA 4J1MA 2B2WA 4TSSA 5GQOA 1UAPA 1AE2A 1A15A 1PMRA 4RMFA 4LF6Q 4KJNA 3M4PA 1RDPD 3RZDH 2EYJA 2E8GA 4X3UA 2HHHQ 5CORA 4A3MH 2EOTA 1CSQA 1IKLA 1YI2A 2IWHA 1JMCA 3E9IA 2AQ3B 1L1OA 2HD3A 3RMHA 1U4RA 2BE5C 3JC66 4BBSB 3PIOA 2E2HH 3SGIA 3HOYH 2YYZA 2JP1A 1SE3A 4FXGC 4B08A 3K5LA 3PO2G 2SNSA 1F9RA 3ULJA 4RGTA 1Q46A 3LWEA 5FLXL 1AN8A 2D0OA 4QY7A 1SNQA 1GUGA 3EA6A 2VXWA 1GUSA 4F8MA 2SOBA 1E2WA 3HOXH 3PIO3 3NQTA 4YY3L 5IE8A 3HKSA 5ELNA 3KK7A 4OX9L 4LUZA 2NZHA 4FDBA 1TR5A 3F8TA 4L5RC 5IYCH 4P72A 3MA2B 2CW0D 5AJ3L 2AQ1B 3PGZA 3NPPA 1DZ1A 1CKOA 2EYMA 5FLMH 1WTOA 4ZYSA 2RDFA 3EIVA 3CKIB 3TMEA 3PMFA 3OIQA 2JA6H 4LMQD 4DN4M 2K5WA 4C3HB 1C7YA 2JA5G 2FHTA 1TS3A 3E0JA 3KLRA 3S2DB 2VL6A 1FNUA 2PW7A 1ICFB 4FF4A 1A62A 3FKIB 4CDEC 1RIPA 4ZCKA 1TWCB 5CYUA 2E2JB 2DY7A 2Z6KA 4HEDA 2K04A 3A7LA 1PXUA 3BZKA 4OIKA 1IYJB 1IYVA 3EBEA 1PVOA 5ELEA 2K7VA 1PYSB 5I2XA 2MP1A 1S5CD 1LT6D 2BH8A 4ZUJA 3R2IA 4DR2L 1CKNA 2L5TA 3TN2A 2K6AA 4DV3L 4DNRB 3KLWA 1YBYA 2BOSA 1SNOA 1LT5D 4JI7Q 3W3AA 4B3TQ 1VQMA 3FPPA 5M5XB 3S2HH 2ZXRA 4JI1L 5K36G 2CWPA 4ULLA 2K52A 4RWSC 4X64Q 3G6JB 3NWTA 1QZHA 2OF1A 4JI8Q 4ABNA 3K6OA 4H02A 4HIOA 2NWGA 1I94L 3GTPH 1PZKD 4KD4A 2PQEA 1B8AA 1EWIA 3R93A 2I5LX 5IGGA 3BS1A 2K28A 3AYHB 4DFAA 1LACA 1YIJA 3W2DA 2MHVA 4HAEA 4C1NI 4C3JH 1EY5A 5C4JH 2F0NA 4R8IA 4OXPA 1QUQB 3GTQH 2LXJA 2B8FA 1PV4A 2RDGA 3DXJC 2ZM6L 1XNQQ 2CHBD 4DUZQ 2VZAA 1LO5D 2JA7G 4KI0A 1O7YA 2UXDQ 2RHSB 1HNZL 1E24A 4DXGA 1Y8OB 2Z6KC 2AMCB 2XWBB 5JEAH 3L0OA 2CVRA 3E0EA 4QIWE 2JA8B 4ZKBB 1B50A 3CC7A 1YNJD 1AFPA 4DV6L 1SYEA 5BR8L 3U4ZA 3H94A 1RKNA 5FKAC 3I73A 3A56A 1KLUD 3CW2C 2XN9C 1VQAA 4Y7NH 1PA6A 3PO2H 2CW0C 5LL6X 4JI4Q 1STGA 2F0HA 2KCCA 4IO9A 2ZXPA 4CKEA 1DONA 2N78A 1O7LA 5EPJA 1SR3A 4JI2Q 2H1EA 1JB7A 2G9HD 3M3YH 1FGUA 5JPMC 1SFOB 4J6HA 2DUDA 2F0JA 4R4IA 4DR1Q 3NBHB 5C44G 3B6YA 4ILWA 2I46A 2QDBA 4FVMA 4PV1C 3KYHC 1JOKA 3K58A 4X62Q 4HJ8A 4N8FA 2F0UA 4KKSA 2UU9L 1A2TA 1E22A 2K05A 2L9HA 1I4HA 4GKJL 2Y0SB 1MJEA 1M1KC 3TRZA 3TP6A 1V1PB 4DA2A 1CA5A 2DY8A 4HMJA 4R9WA 3HOWH 2UXCL 4AIMA 1LTBD 2NZ1D 4G57A 1Q86C 2RCNA 4HIDA 1YNXA 2M2LA 4M1UB 2WIIB 3R2TA 3I4NG 3NBIA 3Q8DA 3MAQA 3OWEB 2JA5H 2PYKA 4C3HG 2PPBC 2BA0A 2HHHL 1VQ9A 1LTGD 1KNEA 5EKLA 3ICEA 2L12A 1XXGA 5F2DA 1WTRA 4O2DA 1S72A 3EN2A 1PFMA 3F2UA 3KF8A 2IW3A 1ESFA 4TRDA 5GAEC 4I65A 3FKIG 2BA1A 5J3BA 2EJGC 2F0GA 3GV3A 2KHSA 2WV6D 2EY2A 5T1GA 3CCVA 2F03A 4JI5L 3EVQA 1VCIA 1P8LA 2KEDA 3M7NA 4POGA 1LYLA 5CV7A 2PW5A 3PF4A 1IBMQ 3UDFA 5M9OA 1UNSA 2GA4B 3IL8A 3UI2A 1WOCA 1SJED 1YVCA 3M4QA 4N9TA 1EYGA 3PUZA 3OHXC 3Q0AA 1TWHB 1EFWA 5K36H 3CMEA 2FINB 3H0GH 1PRTF 4DNTB 4UDUC 2FMCA 1AZQA 1PTOD 4YWLA 1N9WA 3SDZA 3CC2A 2UXBQ 4OWWB 1QJOA 1YITA 2CQOA 1DM0B 1S3OA 1MSHA 3LGJA 3UE1A 2PZUA 4UHVA 2B2VA 1GJXA 3A5UA 1E7ZA 2F0PA 1ZKOA 1YNJC 5IGEA 3GTKB 3C46A 4CJ0B 1NR2A 3S1RH 4NW2A 3F2CA 1P16A 1U4PA 2B29A 3QO2A 1PH7A 2NTSA 4ALPA 2KENA 2A19A 4RGNA 1Z9FA 2JA7H 1R9TH 2UUCQ 3ND8A 2XNAC 3P75A 4DV4Q 4O42A 4IUNA 5IOCA 3G6EA 3VR2A 2O2LD 1JR0D 4KKUA 4C1NK 1D5XC 1MSGA 3OW2A 5CV4A 1FJGQ 4BS9A 2JEAI 1X56A 2QKIC 1JQYD 1HA5A 2JE6I 2F0QA 2F0TA 4EQOA 4BY1H 4GS3A 4JI7L 1VQ4A 1GHKA 4OONA 4B3TL 4XYQA 2PNRC 2JQOA 4BBSH 2F1MA 1F2YA 5C4XB 4X64L 1RL2A 5IGBA 3MVVA 4GKKL 2EY1A 3U58A 3Q23A 2PMZB 1PH3A 2MO0A 1TIID 4QJFA 2XWJB 1SAPA 2BDOA 3AFQA 4YHHQ 3PF5A 1BBXC 4AH6A 1ILPA 3D8GA 4OGQC 4L5SA 3DWPA 2VNUD 5LMUL 4U68A 5KYIA 3D4WA 2HCIA 4Q5VA 1CQFA 3J7YW 2HIXA 1BCPF 1ILQA 5IGDA 1NBWA 2B2VC 5GAGC 1CHPD 1PFSA 4PMWA 3I90A 3WOEA 2Z4IA 3D31A 4UAIA 4DUZL 1LTTD 4WJ3M 3J7AF 2AWOA 3TS0A 1IYUA 1GUTA 3ERSX 3NELA 5FLXc 4LF9Q 2UXDL 5KNDA 3CMAA 4A3GB 4K5WA 3NTKA 1W6KA 4C3HH 3LNNA 1CA6A 3RN5A 3GTMB 1PFBA 3D6CA 5JEAJ 1Y69U 1YNND 3M7GA 2YTVA 4RHRA 4A3MG 3S2DH 2UUBQ 4PZ7A 3PIP3 2I0QA 4LF7L 1GVPA 3GTGB 3FKIH 1STYA 1PRTB 1KDAA 1TWCH 3JAME 1YJ9A 2E2JH 1L1OB 5J1ZA 4C2MB 2VQFQ 3CD6A 3H15A 4ODGA 5C4ZA 1NAPA 2LFNA 5ELBA 3CPFA 4R8NA 2A68D 4DU9A 1HCZA 2VY3A 3G71A 2KCMA 1K8AC 1KDBA 1B1ZA 4CKBA 4Q0FA 1O7IA 3DEOA 3P7JA 1YZ6A 1SEBD 3L7ZC 1S5FD 1TWFB 1VF7A 1PH8A 2XRQD 3A8KE 3OIPA 4I7AA 5M5YB 4DGZA 2B8GA 3DLLA 5D3IB 3Q24A 1HUMA 1TWAB 2CKZB 2BE5D 1LT4D 4IPHA 2EYPA 1I6HB 5CGKA 2OWOA 5M5XH 1LTSD 5IYCG 4Z9CB 4YWKA 5E4WC 1IKMA 1WVLA 5C3EB 5FLMG 1XNRQ 2Q2UA 4IUVA 4RH6A 4JI0Q 1QG7A 5HGTA 4B9WA 2IPKD 3W1GA 3G4SA 1B53A 1I3QB 4L5QA 5I2YA 4X3SA 1WD1A 2WP8J 1E0BA 1SE8A 1X32A 1SN8A 1D5MC 2K14A 4R4OA 3IAYA 2LKVA 4GZYC 1DXMA 1Y8PB 3K8AA 4OELB 3S1QB 4RKLA 1OO9B 4XQNA 2F0SA 1ZXTA 5FJ8G 1EY8A 2QW7A 4A3DH 4IQZA 2QDLA 1NSNS 1TWGB 5DEHA 1U4LA 1TY2A 2PI2E 4LK1C 2F0FA 4UY8C 4DAMA 1KDCA 1F2MA 2PZWA 3SK6A 2Q2HA 1C4QA 2JA8H 1EZ8A 3E9HA 3MEHA 1IBML 3J7A5 5LHY1 5KYLA 1CKNB 4JBMA 4LFAL 1HRJA 3CQZB 2A74C 5KGUA 1VQLA 1BCPB 2F0KA 3NQIA 4RA8A 3QJYA 1MGSA 1X65A 3NXWA 3RLNA 4JK1C 5A35A 4EQNA 1Z6HA 4IOAA 1PRTD 4DV1L 3WDNA 4A3KB 5C4XG 4LAAA 4LFCQ 2ENBA 4RCOA 3MTSA 2MO1A 4R4TA 2ZTEA 3EFXD 4PZ6A 2V1CC 4HIKA 1SFOH 4JYAQ 4GLXA 1TY0A 2EXDA 1NR4A 4KD3A 3FPUB 5JVH3 3OYYA 1PH1A 1LUZA 2GVAA 3KJPA 4DR7Q 2PZTA 2OXPA 3DWQA 5C3XA 1XMOQ 1EU4A 2L15A 3GV6A 1R9TB 4LF5L 2WINB 2L1BA 2RF4A 1JB3A 1OXVA 1B9MA 4A93B 3UDXA 2UUCL 3OTOQ 2EYOA 4NMZA 4CDCC 2EYHA 4GOPA 2A68C 3CCQA 1SSOA 5IY0A 1CSPA 4DV4L 3J7AV 5JEAG 3KLSX 1X54A 2PQAA 1HQMC 4DR6Q 1EOVA 4A3GG 3ULLA 1W3SA 2E76C 1FJGL 1EYCA 1I5FA 1VQNA 1UE7A 4KHPQ 1SNDA 1SROA 1TS5A 4BY1B 5FO8B 1GUOA 2RBMA 2XRSD 3ONAB 3EQLC 5A2QE 3BVGA 3HS0C 2F52A 2JEBI 4KLKA 4KN7C 2Z0SA 3UDGA 3OSOA 1VQOA 2M00A 2SDFA 4N9PA 3VYUA 3MXUA 1ASYA 4OHJA 4B3MQ 1L2FA 1VQFA 2MUYA 4A3FB 1C8CA 2F4VQ 2A6HC 1STNA 3K7AB 3TEHB 3I7FA 4A76A 1MKHA 3D6WA 4UP9A 1BUVT 3PSIA 4JI6Q 4A3BB 4LF8L 1O78A 1C48A 4A3EB 5CR3A 4P75A 4IUUA 1II3A 4BWGB 1BCPD 3DWAA 4B9XA 1WTQA 4LFBQ 2JXMB 1TWHH 2A69C 4NPSA 4LF4Q 2RKSA 3CXCA 1B7YB 3HOWG 2KECA 3A0JA 3ER0A 5C3EG 2CH4W 5C5LA 1H9SA 1KAAA 3DMUA 2QF7A 2E2DC 1PDQA 3G48A 1EFID 4F88A 1UUPA 2XSCA 1GD7A 5AFWA 2B2WC 3F2BA 3JAML 2DN8A 2NVYB 1MHWC 4BA1I 2B39A 1VDZA 2E75C 3E6ZX 2N3SA 4IN3A 1EQQA 2Q2TA 3GTKH 2K50A 5FJ8H 3KF8B 5C4HA 1OTCA 3AQQA 1FGBD 2YTXA 2VQFL 1PRTC 4X66Q 3T4AC 1L1OC 2E5LQ 1QWYA 5G3LF 4GLAC 3J81i 1SXTA 2IX0A 2ZJPA 2E2IB 2Z8LA 1MD2D 5IT9c 3QB3A 1M4VA 4DV2L 1SE2A 3FHWA 3I4MB 3J80i 1G8ZD 1LV9A 1K73C 2JK8A 1VQKA 1BOSA 5HY6A 4HJ9A 4AQYL 1T5EA 1IBKQ 3H91A 3SR1A 5GAHC 3K59A 4ZKCB 1ZEQX 3IFDA 2WAQB 2WB1B 5C4XH 4G4KA 1UE5A 2NB0A 3H0GG 4ZAIA 4A3KG 1XNRL 4MTNA 3RD4A 4A75A 3HP3A 4KHZA 4JI0L 5IYDH 1ML0D 2PCFB 2Z4HA 1M90C 3S14B 3G7LA 3S24A 4A3CG 2X6LA 3HG9A 3RZOB 1OXSC 3KDFA 1SDFA 4JG2A 4LUVA 1VQDA 3WOFA 1SNCA 2VW9A 1Y1WB 1V9PA 5C0XI 1CM9A 3GTLB 1B2TA 1VQ6A 1N36Q 4PNYA 4A3DB 4EQ5A 1PZJD 2I07B 2J4XA 3M85A 2F0OA 4FXKC 1EIYB 1OXTA 1X6OA 1MBYA 3M9BA 1QILA 4DK3C 4X65Q 1EIHA 5FO7B 4A93G 1G291 1V8QA 2G5DA 4EVOA 4BY7B 1T5XD 3T53B 4A3GH 5M5WB 3U9SA 1TU2B 3SK4A 1N33Q 4DK1A 3GTMH 4RAUC 2MNAA 3RNUA 2KVMA 3SVMA 4J15A 1KQSA 4BY1G 1S5ED 3TP8A 3BDCA 1JWUD 3HFZB 3K0YA 4PZ8A 1BCPC 4JI3Q 2Z9HA 3IKJA 3GTGH 4CJ1B 3TQYA 3X3NA 4BBSG 4C2MH 1CQVA 4LFCL 3CCMA 4JW0A 2Q2IA 2RQXA 1K8GA 4G7HC 1XMQQ 1EOTA 2IT1A 2LY7A 1PH5A 4IUTA 1N32L 4K0KQ 4KJOA 5FOBB 1WJJA 5EBCA 4JYAL 2WACA 3I8ZA 4IPGA 1STHA 2FXQA 4G7ZC 2ZXOA 1TWFH 4DR3Q 2O4XA 1H9KA 4A3BG 1FD7D 3SHLA 2QEXA 5M5YH 4A3EG 3TZDA 1LT3D 4DR7L 1TWAH 4ID6A 2Y0SE 1I6HH 1GXDC 2NUCA 1WFQA 2DJFC 2R61A 3I4LA 3PUVA 1FR3A 3HZXA 4A3IH 5C3EH 3OTOL 4HCEA 1IZ6A 1EQRA 4MIUA 3A55A 4TKOB 1KD1C 4LF6L 4OO1G 1WCMB 1XTDA 2NVXB 1I3QH 4X3KA 5LL6S 4DK0A 3CCSA 2K5QA 3HGBA 3W1BA 5JOBA 1G91A 1BBUA 1TS2A 3T1HQ 2OQKA 4KHPL 1QZGA 3UDIA 2HIVA 2K32A 4XQJA 2F0IA 5J22A 5C0XH 4DV5Q 3S1QH 1X3EA 2AWNA 4U673 1WTVA 4B3ML 1GOZA 3BJUA 2NZOA 4WORA 4M8AA 1TWGH 1L0XB 2N8NA 4FNFA 1H9RA 1LTLA 2K01A 1KHIA 5BN3A 3VYSA 2B2UA 4X6AH 5D65A 1LTID 5EPLA 3NTHA 2JJQA 4JVZA 1EY9A 2EJMA 3M4OB 4IZ8A 4LUOA 5ELOA 1YEZA 3I4MG 3CQZH 2NVTB 1VS0A 2B2YA 5EKKA 1K3BC 4APVA 4CDDC 2I5HA 5E3FA 4HSVA 4XXEA 4LFBL 5ELDA 1RODA 1B70B 3T1YQ 3A54A 1STAA 2WAQG 4A3KH 4HJ7A 4QL5A 2FMMA 3J81c 4HR7B 2EVBA 3PCOB 4K5VA 1V1QA 1HFNA 4XYOA 4A3CH 4OO1I 5I6WA 3KJOA 3TS2A 1GM5A 3VA7A 3MZ5A 4LWCA 5IP9G 2RSNA 4E6IA 3J80c 1R4PB 1JWMD 1MJCA 3HOZB 3CCUA 4XQQA 4IFDJ 1STBA 1JC7A 4CBVA 4WJWA 3I2ZA 1JE4A 1D1KA 5E1FA 2EYFA 2ALYB 4KMUC 3S16B 1VMPA 2JA9A 2EJFC 4FP5D 2EY5A 4A3DG 3F1ZA 1NUCA 1Q3LA 4X66L 2EE1A 3J7ZC 4OWXB 2E5LL 4R4CA 4A93H 5IYBG 1TKWB 1W6JA 4DR5Q 1XWEA 2KCNA 2K4KA 4CJ2C 1UE1A 1L0YB 1QCBD 1KC8C 4DV0Q 4GLVB 4BY7G 3KBGA 2JA8G 2VUMB 4HCSA 2QGQA 4P2CB 3TDQA 2VQEQ 1A6XA 3S9WA 2B2UC 3VYRA 1NE3A 3I55A 3CF5A 1HQRD 5IP7G 2MGSA 1LTRD 1IBKL 1RJTA 3IRBA 2L55A 1S4ZA 2Q8RE 1UE6A 5DAUA 3TP5A 2F0MA 4A3FH 4JI8L 4DAVA 1L0WA 2PMZE 2KCTA 4GN3B 4A3JB 1TVXA 4NXMQ 3K7AH 4FO2A 3IFTA 4GN5A 4ZQ3A 1SYFA 4A3BH 3GQBA 3CC4A 1QNUA 2B2TA 2M9VA 1E1TA 1EIFA 4JPBW 4JV5Q 2HDMA 4A3EH 3U50C 3OWFA 3CPWA 2Y0SG 3OOCA 1XNQL 1JE5A 1NNXA 2D5DA 1X3QA 3RLOA 3S17H 2R7ZB 2AUKA 5FLXE 4HJAA 1YJNA 2KA7A 1HNXQ 3O13A 1VQJA 3MXNA 4YY3Q 4G7OC 4BBRB 4OO1H 4GOPB 3TREA 5DNFA 4OX9Q 2ICEC 1JJGA 1WCMG 2OTLA 2R3ZA 1S5BD 3GO5A 1VQHA 2PQAB 3SE0A 2FJ2A 2NVYH 3J81j 4OL7A 5EAYA 4FXDA 3I56A 3URYA 1QVFA 3EROA 1CT1D 1A0IA 2ZTDA 3NP8A 2KEEA 1ENAA 2R6GA 3QG1A 1EYDA 4ZRZA 4JI4L 4HJ5A 2C35B 1HZ9A 4GNXA 1X3GA 4H0LC 4EGVA 1XMQL 4JI2L 3LX0A 5EBDA 5I6YA 2RSOA 4K5XA 4ME5A 5DM63 4BXXG 4MTKA 1AEXA 4KY6A 4R1JA 2E2IH 4DR1L 1PYWD 1HA6A 3SK5A 4MHEA 5FK9C 2R92B 3ZYYX 4X62L 3I4MH 1SYDA 1EWCA 2EDGA 1FVIA 4OWTB 2RHQB 1N8RC 4KY7A 2IY5B 4XIGS 4OEMB 4YCWA 3NE5B 3BYTB 1DOMA 2NYZD 1WTPA 4HSPA 2A6HD 4A3IB 2HCCA 1TXYA 2AHOB 3VR5A 5JJZA 1I50B 1JT8A 1JWSD 2WKCA 1BVSA 2NVQH 1HJPA 4DV3Q 4IFDG 1HZCA 5IP9H 3S14H 1H9SB 3BYYB 5KIXA 4NP5A 4TQUS 3RZOH 5D14A 2RDHA 2JN4A 3T1HL 3HOZG 1Q90A 3V2TA 1HXYD 1Y1VB 3PO3B 2FFKB 1Y1WH 4FF1A 4C3IB 4AYBE 4KKTA 2D2CC 4AYBB 5M3FB 4NB3A 4I7ZC 3K57A 1EQVA 2A69D 3GTLH 4IURA 4KN4C 4YCUA 2RA4A 3S1MB 1A3TA 4K14A 5C0XJ 3HOUB 1I4QA 1VQIA 1CTMA 5IYBH 3NEMA 1QVCA 3L3OC 4IUPA 5EGTA 3BVMA 2AQ2B 5I9OA 5IIFA 3VR6A 4BY7H 4NXNQ 4QUCA 5M5WH 4KHVA 2VUMG 3NTIA 4KTAA 3VDYA 3HKZB 1HTLD 3KOJA 4UP8A 5IP7H 1SYBA 5BN5A 3AB9A 3KFUA 1M8AA 3T1YL 4B3RQ 3BU2A 5GADC 2O5IC 1VQ5A 2ATWA 3KUPA 4CDFC 2VS1A 3PUYA 2KJXA 2K5VA 4IFDI 2UXBL 2QEJC 1VQ8A 1XJVA 5IYDG 3MC0B 5BR8Q 2BDNA 4QCLA 3FRPB 2OTJA 1CI3M 1EEFD 1T9HA 2QCPX 5KRUA 1VQBA 1K0RA 3KDFB 1EZ6A 3STBC 1EWHA 1DOLA 2K5DA 3FDTA 1N34Q 1F2LA 1NMFA 1J5EQ 1KABA 1VQGA 2NN6G 1DCZA 1I6VC 3NHHA 1ENCA 3DM1A 2K33A 4DR5L 2R7ZG 1EQTA 3A74A 2Z6BA 5IGCA 3FVQA 1QOHA 4JBWA 2KQ3A 3N6RA 5CV9A 4BBRG 1BXTA 1WCMH 1SMYD 3RR5A 2I5MX 1EYAA 2NVXH 4GKJQ 1F77A 1LABA 2AKWB 4XDXA 4DF7A 3GTOB 3GTJB 4QMGA 4RGOS 1JJ2A 1PH2A 1EY4A 3K5MA 2LMCB 4P73A 2CQAA 1CUKA 2DJGC 4PMCA 2L11A 4DV7Q 3MFYA 3T56B 2K75A 1BBWA 3PV0A 1Q81C 1CZWA 3A8JE 4A3LG 1B3QA 4CGYB 1V1OA 1BDOA 3SXHA 4NXML 4BXXH 1HR0Q 1Z7TA 1SLJA 4YHHL 4IJHA 1PH6A 1G6ZA 5EJWA 2HUGA 5JVG3 3WWVA 2HDLA 3M4OH 3FEWX 4JV5L 3GP7A 2R92G 5ISRA 2NVTH 3PUXA 4WRDA 2J7ZA 2MFIA 2K5HA 3QOJA 4O0AA 4RGMA 4JI5Q 1KTKA 1AP0A 3AFPA 1F2ZA 3K5NA 3S15B 5C44B 5C5MA 2NN6I 3FP9A 3SK8A 2UUAQ 1SYGA 4A3IG 4LF9L 3S17B 3U9OA 3T16A 1HNXL 1Q82C 4IFDH 3VYTA 3OW7A 5HGQA 3MWYW 3D0FA 2BH2A 1ET9A 3RN2A 2H5XA 5BN4A 4POFA 1HTPA 4DUYQ 1KXLA 3HOZH 5KNCA 4GOPC 1A3UA 2KHIA 5CV8A 4PG3A 2UUBL 4Y52H 1Y1VG 3PO3G 3NENA 4GN4B 1VMCA 5H1SE 5C0XG 4XT3B 1FNVA 3CCEA 4C3IG 3S16H 1SRUA 1QVGA 4AYBG 5M3FG 4DPGA 2QA4A 2SEBD 3I4NB 5KNBA 1EEID 1PTOF 1O80A 1PYBA 4JBJA 1KIXA 4F87A 3HOUG 1RTNA 2HQEA 2QILA 3D4DA 1A63A 4X3TA 1EIGA 3C3LA 2F0LA 2IHFA 3I4OA 2TSSA 1B9NA 4R4QA 2CH4A 3GD7A 1IHZA 4DAYA 2LS01 4C56C 5LMNQ 5IT9E 1NJIC 2VUMH 5CBAE 1SYCA 1CZGA 1HH2P 4F7XA 4YCVA 3K7UC 2PI2A 3KF6A 1S5DD 1STEA 3HKZG 1G51A 1YHBA 4HMIA 3S1NB 2DNEA 1NCVA 2WAQE 2WB1E 5E4XA 1DD2A 1E2ZA 2H4OA 4ZLTF 1C9OA 1EU3A 4N8X1 2NVQB 3EJIA 5TSSA 4FYDA 3A7AB 1SBBB 3UE0A 4A3JH 4DR4Q 5CV5A 2OCEA 1V43A 1WTWA 1XPUA 3HOVB 1WI5A 5EPKA 3CCJA 2MPMA 1DYQA 2F0WA 1SMYC 3V05A 4IJLA 1Q8IA 1HHVA 3RUZA 1XYIA 2R93B 2ZTCA 1XPRA 1RD9D 4IUQA 2K03A 4GKKQ 4HTHA 2C9OA 5KEEA 4WJ4A 2ID0A 4IALA 1ICWA 5DM73 1JCKB 1CKMA 2NN6H 1RCVD 5T1IA 3C1EA 1B44D 1PZID 2EZVA 4CHTB 4YIJA 5JPNC 5EQ0A 2R7ZH 2EIFA 3DM3A 5LMUQ 3E3XA 4BBRH 1LTAD 1TT2A 2J0TD 4NXNL 1ET6A 1IBLQ 2JYOA 5FO9B 4UP7A 2JSOA 1OXXK 1KNAA 1WTXA 1IL8A 2A8VA 1Q7YC 4NDXA 2L4NA 1K83B 1U5KA 1F9SA 3HRZC 4PMBA 2AUJD 1JJCB 2VB3X 2PO4A 5CV6A 2YU9B 2Z1CA 1HR0W 1YJWA 4B3RL 4QIWB 4L5TA 2TMPA 3MEFA 3TP7A 4KK7A 4A3LH 4A3FG 4K2LA 4QB4A 4J8QA 2N49A 1Q1EA 4LF7Q 4JOIA 2F3VA 3D4RA 4YWMA 2R92H 4H7BA 3H3VI 2Q8IB 3C1FA 2F0VA 2P5ZX 1N34L 1PTOB 3ULPA 1EL0A 3H3VC 1LLRD 1VQPA 1XMOL 1J5EL 2HT1A 3QR8A 4LW1A 5M3MB 1G2SA 3H6MA 3I72A 3T51B 5JJIA 1I50H 1Z47A 1D7QA 3QWNA 1HNWQ 4H13C 3GDEA 1HUNA 2SNMA 1K0SA 1WYDA 4TVAB 4DR6L 3MXNB 4FF3A 5A2QL 1X3PA 1A8VA 3BZCA 5I9PA 2B63B 3CRKC 3PUWA 1J9OA 4H44C 1CK1A 2ASBA 1QB5D 1Y1VH 3JAMi 3PO3H 1B3AA 4C3IH 5M3FH 1UEAB 2CWAA 1FYCA 2MQHA 4DV7L 1JICA 3DUZA 1SJHD 3S1MH 1BR9A 2MJ8A 1VF5C 3HOUH 5ELCA 2F4VL 5LMNW 3RZDB 2N88A 1HR0L 4GNXB 1Q1BA 3ZJYC 2F3WA 1I4GA 4A3MB 2N55A 1IL2A 3MHBA 5I4DA 4JI6L 2RCFA 1ESRA 2E2HB 5JJKA 3NWSA 4P74A 1F9QA 1ZYRD 2L0CA 1OXUA 3HOYB 1YHAA 1E2VA 1KRTA 3PQIA 3BDOA 4JOIC 1GKHA 3CCRA 4MNOA 1K28A 3N52A 4LF4L 2A1AA 1PLFA 4NKLA 5D3DA 2WB1G 1HZBA 2UUAL 4P71A 3HOXB 3Q22A 3C2PA 3J81E 4L8JA 4LFAQ 2OEOA 5IODA 3HEJA 3ERQA 2V4DA 2EQSA 3R3OA 4DUYL 1U9RA 3HOVG 3J80E 1TQOA 1Y8NB 1GHJA 2EPBA 1A3VA 1K8MA 3H3VH 1GO3E 4DV1Q 3BVZA 1Y1WG 1ONLA 2R93G 3OMGA 2WFWA 1H9JA 1HPCA 5CBEE 3CU7A 2HQLA 2JA6B 2CCZA 4K2KA 1JOQA 3H09A 3P20A 1K8OA 4HIMA 1PFNA 2IX3A 1D5ZC 4WFN3 5JAVA 5K5PA 2IHEA 5IWAQ 5IT9L 5G3LD 2YTYA 2C5CA 3W5OA 1E3PA 5NUCA 1QUQA 4RKBA 2R7DA 2EY6A 5LMNL 4V0BA 1WD0A 1KL9A 4B3SQ 3K80C 2E74C 4KY5A 2A6ED 4PQXA 4KV6A 3GTOH 3DHQA 3GTJH 2XGTA 3MXPA 1G2TA 1NMGA 2XVSA 1SMXA 2LXKA 4LF5Q 1G6PA 1KRSA 2R7FA 1JOOA 3CP0A 1BKBA 2IL8A 2O5JC 1NTGA 1EY6A 3L9AX 4LJZC 4QQBX 1X3FA 2B2YC 3BG3A 3ITPA 1WTHA 4QGUA 4IOCA 3NUCA 2WKDA 1C0AA 2BCOA 3I70A 4DR4L 4XT1B 3T13A 2ICIA 4JCVE 3DEPA 4QUFA 3S2HB 1AW7A 1X9NA 1NY4A 2X6GA 4XTCS 5CMDA 2ZJRA 4IPCA 1O7ZA 3M4YA 1SE4A 1IW7D 1N36L 3GTPB 3NBHA 1H9MA 3S15H 5C44H 5M3MG 2D0PA 1X55A 1KAWA 4X65L 1QE6A 3VA5A 2YV5A 4LF8Q 4C3JB 5C4JB 4MN3A 2EXZA 2OT2A 4LNQA 3A8IE 3GTQB 1IBLL 1N33L 3P1HA 1V1PA 3L2PA 2KBNA 3MFGA 1GUNA 4UPAA 5C3WA 2D9UA 3STBD 1Q8KA 2DGYA 3NK9A 5L37A 2G9DA 5AJ3Q 2B63G 2GVBA 3PIPA 1ZYRC 1J6QA 4K8JA 1I4XA 4JI3L 2EYLA 2ZT9C 4EX5A 3X3MA 1CHQD 1S40A 3BZDB 4CKCA 3I4NH 1EY7A 1UWVA 4V190 5HURA 4ME3A 1K3RA 5CC4A 3CHBD 3SEBA 4K0KL 1RF2D 2OQ0A 1TS4A 4BA2I 1IXRA 1D8LA 4DR3L 1XPOA 3KBXA 3AEVA 2NBFA 2IJ0A 2KUMA 1BO0A 3JAMc 3BDLA 3CCLA 1KLGD 4Y7NB 1D6EC 3OMCA 5COYA 3PO2B 1ASZA 3VR4A 3HOYG 3LWUA 1HFGA 1AZPA 4IPDA 5C6AA 1K9MC 2B2TC 1I4RA 3M3YB 3Q6SA 2F0DA 1U0LA 3S1NH 1PTOC 3VR3A 1PHJA 4JBKA 4RG1A 1RTOA 2Q8TA 4JC0A 3K81C 1EY0A 3D3RA 4DR2Q 2B3GA 1VQCA
chains in the Genus database with same CATH topology
4YHHL 3RLFA 4DV2Q 1HNWL 2CQOA 3HOXG 1S3OA 4A3GH 3LGJA 4IJHA 3UE1A 1N33Q 1PH6A 3GTMH 3A5UA 1E7ZA 1PH9A 2MNAA 1YHQA 3RNUA 1HZAA 3HOVH 3WWVA 4AQYQ 2D62A 5GROA 3M4OH 4JV5L 4J15A 4JI1Q 2R92G 1KQSA 5DLQE 4BY1G 2NVTH 2ZJQA 3HFZB 3PUXA 4PZ8A 3S1RH 4JI3Q 3F2CA 1P16A 2B29A 3GTGH 2MFIA 4DV5L 2K5HA 2R93H 1PH7A 4ALPA 2KENA 3TQYA 2A19A 4BBSG 1Z9FA 4DNIA 4O0AA 4JI5Q 2JA7H 4C2MH 1R9TH 3AFPA 4LFCL 3CCMA 1I94Q 2Q2IA 2UUCQ 2NN6I 3FP9A 1K8GA 2JA6G 1XMQQ 2UUAQ 4A3IG 2IT1A 4DV4Q 4LF9L 1PH5A 3G6EA 1N32L 1HNXL 1VQ7A 1Q82C 4K0KQ 1WJJA 4JYAL 5HGQA 4IPGA 3D0FA 2FXQA 2BH2A 3OW2A 1Q12A 2LSSA 1TWFH 4DR3Q 1FJGQ 3A5ZB 3RN2A 2H5XA 4POFA 1X56A 4DUYQ 2JEAI 4A3BG 1KXLA 1LM0A 4GNXC 1Y14B 2JE6I 3HOZH 4GOPC 4BY1H 4GS3A 2QEXA 2KHIA 1VQ4A 4OONA 5M5YH 4B3TL 4JI7L 4A3EG 4DAYB 4PG3A 2UUBL 4DR7L 1PH4A 2JQOA 3K0XA 4Y52H 1TWAH 1Y1VG 3U4VA 3HKZE 3NENA 4GN4B 5H1SE 2ZM6Q 2Y0SE 5C0XG 3PO3G 4BBSH 3CCEA 1I6HH 3S16H 1K83H 1SRUA 4AYBG 1QVGA 1WFQA 4X64L 4DPGA 5M3FG 1AE3A 3KF6B 2QA4A 3PUVA 1RL2A 4GKKL 1HNZQ 3GTPH 3U58A 1PYBA 4JBJA 4A3IH 1KIXA 2GN5A 1PH3A 2MO0A 4QJFA 5C3EH 2XTIA 2YU9H 1UEBA 2KHJA 3HOUG 3OTOL 1A63A 3AFQA 4YHHQ 3PF5A 1IZ6A 1EQRA 4AH6A 2IHFA 3I4OA 2K5NA 1KD1C 4LF6L 4OO1G 4L5SA 4MZ9A 4R4QA 1XTDA 4DV6Q 4A3JG 1I3QH 3GD7A 2VNUD 3CCSA 3W1BA 5LMUL 2IX1A 5LMNQ 1BBUA 3T1HQ 1NJIC 2OQKA 2VUMH 4KHPL 1QZGA 1HH2P 2HIVA 3UDIA 1AH9A 2HIXA 4YCVA 3K7UC 2PI2A 4DV5Q 3KF6A 1NBWA 3HKZG 1X3EA 5GAGC 1PFSA 4PMWA 3S1QH 4DK6C 1G51A 2AWNA 3D31A 3F2DA 4DUZL 4WJ3M 1YHBA 2AWOA 3TS0A 4B3ML 3BJUA 2NZOA 2F3IA 2WAQE 1TWGH 2N8NA 2WB1E 3ERSX 3NELA 5FLXc 4LF9Q 2UXDL 1N32Q 1LTLA 1C9OA 5E7NA 5M3MH 5IWAL 1KHIA 4A4IA 1FL0A 3CMAA 3UE0A 2PNHA 4A3JH 4DR4Q 4C3HH 4X6AH 2OCEA 1V43A 3RN5A 1XPUA 3CAMA 5JEAJ 2JJQA 1WI5A 3CCJA 4DV0L 1E1OA 4A3MG 2YTVA 1W2BA 2ES2A 3S2DH 4LUOA 1H95A 5ELOA 4PZ7A 2I0QA 1YEZA 2UUBQ 2UU9Q 3CQZH 4IJLA 4B3SL 4LF7L 1GVPA 3I4MG 1VQEA 1VS0A 2VQEL 4APVA 2I5HA 2ZTCA 4LFBL 3FKIH 2B63H 5JJLA 1TWCH 1XPRA 1YJ9A 2E2JH 1DGSA 1L1OB 4GKKQ 1B70B 1MIUA 4DKAC 1EUJA 2VQFQ 3H15A 3CD6A 2UXCQ 4WJ4A 2ID0A 3T1YQ 2CFMA 3CPFA 2WAQG 4A3KH 2VY3A 4HJ7A 3G71A 5GQOA 1CKMA 2KCMA 4QL5A 1K8AC 3J81c 1AE2A 4RMFA 1O7IA 3PCOB 4LF6Q 1V1QA 1YZ6A 3L7ZC 4A3CH 2R7ZH 2EIFA 4OO1I 3M4PA 3KJOA 3DM3A 3RZDH 1GM5A 3TS2A 4LWCA 5IP9G 2E8GA 5LMUQ 2HHHQ 1PH8A 3J80c 4BBRH 4A3MH 1MJCA 3CCUA 4NXNL 4IFDJ 1IBLQ 1CSQA 1YI2A 1JMCA 4UP7A 3E9IA 3DLLA 1OXXK 1L1OA 3I2ZA 2A8VA 2CKZB 4IPHA 3JC66 1Q7YC 3PIOA 2E2HH 2ALYB 2OWOA 5M5XH 1U5KA 2JA9A 3SGIA 3HOYH 2YYZA 5IYCG 3PO2G 4YWKA 1JJCB 3ULJA 1Q46A 4A3DG 3F1ZA 1HR0W 1YJWA 4B3RL 5FLMG 4X66L 3J7ZC 1XNRQ 4L5TA 2D0OA 4QY7A 3MEFA 4R4CA 4OWXB 2E5LL 2Q2UA 4A3LH 4JI0Q 4A3FG 4A93H 5IYBG 4DR5Q 2K4KA 1UE1A 3W1GA 3G4SA 3HOXH 4L5QA 1KC8C 4DV0Q 4GLVB 4YY3L 4BY7G 2WP8J 2N49A 1Q1EA 1SE8A 5IE8A 2JA8G 3HKSA 1SN8A 2QGQA 4LF7Q 5ELNA 2K14A 4JOIA 4LUZA 4R4OA 2VQEQ 4OX9L 2NZHA 4FDBA 3F8TA 3K8AA 4YWMA 1NE3A 3I55A 4L5RC 3CF5A 2R92H 5IYCH 4P72A 5IP7G 3H3VI 5AJ3L 1IBKL 5FJ8G 3PGZA 4A3DH 1N34L 3ULPA 3IRBA 1CKOA 5FLMH 1VQPA 1XMOL 1J5EL 1UE6A 2HT1A 2PI2E 4LW1A 3EIVA 4A3FH 2UXBL 4JI8L 2JA6H 4UY8C 4BXXH 1L0WA 2PMZE 2KCTA 4GN3B 5JJIA 4DAMA 1I50H 4NXMQ 3K7AH 1Z47A 1C7YA 1D7QA 2JA5G 2Q2HA 1HNWQ 2JA8H 3E9HA 3GDEA 1IBML 1WYDA 4GN5A 3J7A5 4TVAB 4DR6L 2VL6A 1CKNB 3MXNB 4JBMA 4LFAL 4A3BH 1VQLA 3CC4A 1E1TA 1EIFA 1A8VA 3BZCA 1A62A 4JV5Q 3PUWA 1RIPA 1X65A 4A3EH 2ASBA 3RLNA 3U50C 3JAMi 1Y1VH 2Z6KA 1VQCA 3PO3H 4IOAA 4C3IH 5M3FH 4DV1L 3BZKA 3CPWA 2Y0SG 1IYJB 1XNQL 2CWAA 3EBEA 5C4XG 1PVOA 1JE5A 2MQHA 4DV7L 4LFCQ 3S1MH 1PYSB 2MO1A 3RLOA 4R4TA 3HOUH 2ZTEA 2F4VL 2BH8A 3S17H 4PZ6A 5LMNW 2V1CC 1HNXQ 4HJAA 4HIKA 1YJNA 4DR2L 1CKNA 1VQJA 4YY3Q 1SFOH 1HR0L 4JYAQ 4GNXB 4GLXA 1Q1BA 3ZJYC 2EXDA 4DV3L 4GOPB 1IL2A 3TREA 3KLWA 4OX9Q 1JJGA 1YBYA 1WCMG 2OTLA 4JI6L 3GO5A 1VQHA 2PQAB 3OYYA 1PH1A 4JI7Q 5JJKA 1LUZA 4B3TQ 2NVYH 1VQMA 2GVAA 4P74A 3J81j 3S2HH 3KJPA 4JI1L 4DR7Q 5EAYA 3I56A 1OXUA 1YHAA 5K36G 2CWPA 1QVFA 1KRTA 1XMOQ 2K52A 4JOIC 1A0IA 2L15A 2ZTDA 4X64Q 1GKHA 3CCRA 2R6GA 1QZHA 4JI8Q 4MNOA 4H02A 4HIOA 4LF5L 4JI4L 2RF4A 4LF4L 1OXVA 2A1AA 4HJ5A 2C35B 1HZ9A 3UDXA 1X3GA 1B8AA 4GNXA 3OTOQ 2UUCL 1EWIA 1XMQL 2I5LX 2WB1G 1HZBA 3CCQA 4GOPA 4DV4L 5IY0A 1CSPA 2UUAL 4JI2L 4P71A 5JEAG 3AYHB 4BXXG 4R1JA 1YIJA 1X54A 2PQAA 4DR6Q 4LFAQ 4DR1L 1EOVA 2E2IH 3ULLA 1W3SA 4A3GG 1FJGL 1I5FA 1VQNA 4C3JH 5C4JH 2EQSA 1I94L 4DUYL 1UE7A 4KHPQ 3HOVG 1SROA 4OXPA 4X62L 3I4MH 1QUQB 3GTQH 2LXJA 4OWTB 1FVIA 2RHQB 1PV4A 1N8RC 3H3VH 1GO3E 2F52A 4XIGS 2JEBI 4KLKA 4YCWA 2ZM6L 4DV1Q 1Y1WG 2IY5B 2Z0SA 3UDGA 1XNQQ 2R93G 1VQOA 2WFWA 4DUZQ 2VZAA 1ASYA 4B3MQ 1L2FA 1VQFA 2JA7G 4KI0A 2HQLA 2CCZA 2RHSB 1HNZL 1E24A 2UXDQ 2F4VQ 1TXYA 2AHOB 2Z6KC 2AMCB 4HIMA 1JT8A 3L0OA 1BVSA 3E0EA 3TEHB 2IHEA 3I7FA 4QIWE 5IWAQ 4A76A 2NVQH 1MKHA 1HJPA 4DV3Q 2YTYA 3W5OA 4IFDG 1HZCA 4UP9A 5IP9H 3S14H 3CC7A 3PSIA 1E3PA 4JI6Q 1QUQA 4DV6L 4LF8L 5BR8L 4TQUS 2R7DA 3RZOH 3U4ZA 5LMNL 3T1HL 3HOZG 1KL9A 4P75A 4B3SQ 3K80C 1Y1WH 4LFBQ 3CW2C 1VQAA 4AYBE 4Y7NH 1PA6A 3GTJH 3GTOH 2XGTA 4NB3A 1TWHH 3PO2H 1NMGA 4LF5Q 1SMXA 2LXKA 4NPSA 4YCUA 1KRSA 4JI4Q 4LF4Q 3GTLH 2R7FA 4IO9A 3CP0A 1BKBA 2N78A 5C0XJ 3CXCA 1SR3A 1NTGA 1VQIA 1B7YB 4JI2Q 3HOWG 1JB7A 4QQBX 3A0JA 3ER0A 5C3EG 1X3FA 3M3YH 1FGUA 5IYBH 2DUDA 4R4IA 3NEMA 1QVCA 4QGUA 4IOCA 4DR1Q 3G48A 1C0AA 3NBHB 5C44G 3B6YA 4DR4L 4BY7H 3KYHC 1GD7A 4JCVE 4X62Q 5M5WH 3F2BA 4HJ8A 4NXNQ 2VUMG 4BA1I 2UU9L 2N3SA 1E22A 1NY4A 1X9NA 3VDYA 1EQQA 2Q2TA 3KOJA 4GKJL 3GTKH 4UP8A 5IP7H 1M1KC 1MJEA 2K50A 3TRZA 4XTCS 5FJ8H 2ZJRA 4IPCA 3KF8B 3KFUA 1OTCA 3AQQA 2VQFL 2YTXA 1N36L 3HOWH 2UXCL 4AIMA 3T1YL 1Q86C 4B3RQ 2RCNA 3BU2A 1YNXA 4X66Q 5GADC 4HIDA 1VQ5A 2ATWA 1L1OC 2E5LQ 3I4NG 3S15H 2VS1A 5C44H 3PUYA 4GLAC 5M3MG 2D0PA 1X55A 2K5VA 1KAWA 2IX0A 3Q8DA 4X65L 3J81i 2ZJPA 1VQ8A 2JA5H 1XJVA 5IYDG 4IFDI 2YV5A 5IT9c 2BA0A 4LF8Q 5BR8Q 2HHHL 1VQ9A 4LNQA 3ICEA 4DV2L 2OTJA 3FHWA 4O2DA 1T9HA 3J80i 1S72A 1IBLL 3EN2A 1N33L 3L2PA 1VQBA 2KBNA 1K0RA 1K73C 2JK8A 3KDFB 1VQKA 4UPAA 5HY6A 5GAEC 3STBD 1Q8KA 3STBC 4HJ9A 4AQYL 2DGYA 2BA1A 3FKIG 5J3BA 5AJ3Q 1IBKQ 5GAHC 2GVBA 2B63G 3PIPA 1N34Q 1J6QA 4JI3L 4EX5A 5C4XH 1NMFA 1J5EQ 1UE5A 1S40A 3H0GG 3CCVA 3I4NH 4A3KG 1UWVA 4JI5L 1XNRL 1VQGA 2NN6G 4MTNA 4A75A 1VCIA 4ME3A 4KHZA 4JI0L 1K3RA 1P8LA 5IYDH 3M7NA 4DR5L 4POGA 1LYLA 1M90C 4A3CG 3S24A 3A74A 2R7ZG 3PF4A 1IBMQ 3UDFA 4JBWA 4K0KL 1OXSC 3KDFA 4BBRG 1G6PA 2OQ0A 1WCMH 3RR5A 4BA2I 2I5MX 4JG2A 1IXRA 1D8LA 1VQDA 1WOCA 4LUVA 2VW9A 4DR3L 1XPOA 2NVXH 3AEVA 1YVCA 4GKJQ 2AKWB 3M4QA 1EYGA 4NXML 3JAMc 3PUZA 3CCLA 1V9PA 5C0XI 1EFWA 1ASZA 1VQ6A 3CMEA 1N36Q 1PH2A 1JJ2A 3HOYG 3H0GH 4EQ5A 4P73A 1CUKA 4DV7Q 4IPDA 3M85A 1K9MC 2K75A 1BBWA 3PV0A 1Q81C 1U0LA 3S1NH 1EIYB 1PHJA 1OXTA 1X6OA 3M9BA 4DK3C 4YWLA 1N9WA 4X65Q 4RG1A 3CC2A 4JBKA 4A3LG 4A93G 4JC0A 3K81C 2UXBQ 1G291 4OWWB 4DR2Q 1YITA 2B3GA 1HR0Q 1SLJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YHH L;  3RLF A;  4DV2 Q;  1HNW L;  2CQO A;  3HOX G;  1S3O A;  4A3G H;  3LGJ A;  4IJH A;  3UE1 A;  1N33 Q;  1PH6 A;  3GTM H;  3A5U A;  1E7Z A;  1PH9 A;  2MNA A;  1YHQ A;  3RNU A;  1HZA A;  3HOV H;  3WWV A;  4AQY Q;  2D62 A;  5GRO A;  3M4O H;  4JV5 L;  4J15 A;  4JI1 Q;  2R92 G;  1KQS A;  5DLQ E;  4BY1 G;  2NVT H;  2ZJQ A;  3HFZ B;  3PUX A;  4PZ8 A;  3S1R H;  4JI3 Q;  3F2C A;  1P16 A;  2B29 A;  3GTG H;  2MFI A;  4DV5 L;  2K5H A;  2R93 H;  1PH7 A;  4ALP A;  2KEN A;  3TQY A;  2A19 A;  4BBS G;  1Z9F A;  4DNI A;  4O0A A;  4JI5 Q;  2JA7 H;  4C2M H;  1R9T H;  3AFP A;  4LFC L;  3CCM A;  1I94 Q;  2Q2I A;  2UUC Q;  2NN6 I;  3FP9 A;  1K8G A;  2JA6 G;  1XMQ Q;  2UUA Q;  4A3I G;  2IT1 A;  4DV4 Q;  4LF9 L;  1PH5 A;  3G6E A;  1N32 L;  1HNX L;  1VQ7 A;  1Q82 C;  4K0K Q;  1WJJ A;  4JYA L;  5HGQ A;  4IPG A;  3D0F A;  2FXQ A;  2BH2 A;  3OW2 A;  1Q12 A;  2LSS A;  1TWF H;  4DR3 Q;  1FJG Q;  3A5Z B;  3RN2 A;  2H5X A;  4POF A;  1X56 A;  4DUY Q;  2JEA I;  4A3B G;  1KXL A;  1LM0 A;  4GNX C;  1Y14 B;  2JE6 I;  3HOZ H;  4GOP C;  4BY1 H;  4GS3 A;  2QEX A;  2KHI A;  1VQ4 A;  4OON A;  5M5Y H;  4B3T L;  4JI7 L;  4A3E G;  4DAY B;  4PG3 A;  2UUB L;  4DR7 L;  1PH4 A;  2JQO A;  3K0X A;  4Y52 H;  1TWA H;  1Y1V G;  3U4V A;  3HKZ E;  3NEN A;  4GN4 B;  5H1S E;  2ZM6 Q;  2Y0S E;  5C0X G;  3PO3 G;  4BBS H;  3CCE A;  1I6H H;  3S16 H;  1K83 H;  1SRU A;  4AYB G;  1QVG A;  1WFQ A;  4X64 L;  4DPG A;  5M3F G;  1AE3 A;  3KF6 B;  2QA4 A;  3PUV A;  1RL2 A;  4GKK L;  1HNZ Q;  3GTP H;  3U58 A;  1PYB A;  4JBJ A;  4A3I H;  1KIX A;  2GN5 A;  1PH3 A;  2MO0 A;  4QJF A;  5C3E H;  2XTI A;  2YU9 H;  1UEB A;  2KHJ A;  3HOU G;  3OTO L;  1A63 A;  3AFQ A;  4YHH Q;  3PF5 A;  1IZ6 A;  1EQR A;  4AH6 A;  2IHF A;  3I4O A;  2K5N A;  1KD1 C;  4LF6 L;  4OO1 G;  4L5S A;  4MZ9 A;  4R4Q A;  1XTD A;  4DV6 Q;  4A3J G;  1I3Q H;  3GD7 A;  2VNU D;  3CCS A;  3W1B A;  5LMU L;  2IX1 A;  5LMN Q;  1BBU A;  3T1H Q;  1NJI C;  2OQK A;  2VUM H;  4KHP L;  1QZG A;  1HH2 P;  2HIV A;  3UDI A;  1AH9 A;  2HIX A;  4YCV A;  3K7U C;  2PI2 A;  4DV5 Q;  3KF6 A;  1NBW A;  3HKZ G;  1X3E A;  5GAG C;  1PFS A;  4PMW A;  3S1Q H;  4DK6 C;  1G51 A;  2AWN A;  3D31 A;  3F2D A;  4DUZ L;  4WJ3 M;  1YHB A;  2AWO A;  3TS0 A;  4B3M L;  3BJU A;  2NZO A;  2F3I A;  2WAQ E;  1TWG H;  2N8N A;  2WB1 E;  3ERS X;  3NEL A;  5FLX c;  4LF9 Q;  2UXD L;  1N32 Q;  1LTL A;  1C9O A;  5E7N A;  5M3M H;  5IWA L;  1KHI A;  4A4I A;  1FL0 A;  3CMA A;  3UE0 A;  2PNH A;  4A3J H;  4DR4 Q;  4C3H H;  4X6A H;  2OCE A;  1V43 A;  3RN5 A;  1XPU A;  3CAM A;  5JEA J;  2JJQ A;  1WI5 A;  3CCJ A;  4DV0 L;  1E1O A;  4A3M G;  2YTV A;  1W2B A;  2ES2 A;  3S2D H;  4LUO A;  1H95 A;  5ELO A;  4PZ7 A;  2I0Q A;  1YEZ A;  2UUB Q;  2UU9 Q;  3CQZ H;  4IJL A;  4B3S L;  4LF7 L;  1GVP A;  3I4M G;  1VQE A;  1VS0 A;  2VQE L;  4APV A;  2I5H A;  2ZTC A;  4LFB L;  3FKI H;  2B63 H;  5JJL A;  1TWC H;  1XPR A;  1YJ9 A;  2E2J H;  1DGS A;  1L1O B;  4GKK Q;  1B70 B;  1MIU A;  4DKA C;  1EUJ A;  2VQF Q;  3H15 A;  3CD6 A;  2UXC Q;  4WJ4 A;  2ID0 A;  3T1Y Q;  2CFM A;  3CPF A;  2WAQ G;  4A3K H;  2VY3 A;  4HJ7 A;  3G71 A;  5GQO A;  1CKM A;  2KCM A;  4QL5 A;  1K8A C;  3J81 c;  1AE2 A;  4RMF A;  1O7I A;  3PCO B;  4LF6 Q;  1V1Q A;  1YZ6 A;  3L7Z C;  4A3C H;  2R7Z H;  2EIF A;  4OO1 I;  3M4P A;  3KJO A;  3DM3 A;  3RZD H;  1GM5 A;  3TS2 A;  4LWC A;  5IP9 G;  2E8G A;  5LMU Q;  2HHH Q;  1PH8 A;  3J80 c;  4BBR H;  4A3M H;  1MJC A;  3CCU A;  4NXN L;  4IFD J;  1IBL Q;  1CSQ A;  1YI2 A;  1JMC A;  4UP7 A;  3E9I A;  3DLL A;  1OXX K;  1L1O A;  3I2Z A;  2A8V A;  2CKZ B;  4IPH A;  3JC6 6;  1Q7Y C;  3PIO A;  2E2H H;  2ALY B;  2OWO A;  5M5X H;  1U5K A;  2JA9 A;  3SGI A;  3HOY H;  2YYZ A;  5IYC G;  3PO2 G;  4YWK A;  1JJC B;  3ULJ A;  1Q46 A;  4A3D G;  3F1Z A;  1HR0 W;  1YJW A;  4B3R L;  5FLM G;  4X66 L;  3J7Z C;  1XNR Q;  4L5T A;  2D0O A;  4QY7 A;  3MEF A;  4R4C A;  4OWX B;  2E5L L;  2Q2U A;  4A3L H;  4JI0 Q;  4A3F G;  4A93 H;  5IYB G;  4DR5 Q;  2K4K A;  1UE1 A;  3W1G A;  3G4S A;  3HOX H;  4L5Q A;  1KC8 C;  4DV0 Q;  4GLV B;  4YY3 L;  4BY7 G;  2WP8 J;  2N49 A;  1Q1E A;  1SE8 A;  5IE8 A;  2JA8 G;  3HKS A;  1SN8 A;  2QGQ A;  4LF7 Q;  5ELN A;  2K14 A;  4JOI A;  4LUZ A;  4R4O A;  2VQE Q;  4OX9 L;  2NZH A;  4FDB A;  3F8T A;  3K8A A;  4YWM A;  1NE3 A;  3I55 A;  4L5R C;  3CF5 A;  2R92 H;  5IYC H;  4P72 A;  5IP7 G;  3H3V I;  5AJ3 L;  1IBK L;  5FJ8 G;  3PGZ A;  4A3D H;  1N34 L;  3ULP A;  3IRB A;  1CKO A;  5FLM H;  1VQP A;  1XMO L;  1J5E L;  1UE6 A;  2HT1 A;  2PI2 E;  4LW1 A;  3EIV A;  4A3F H;  2UXB L;  4JI8 L;  2JA6 H;  4UY8 C;  4BXX H;  1L0W A;  2PMZ E;  2KCT A;  4GN3 B;  5JJI A;  4DAM A;  1I50 H;  4NXM Q;  3K7A H;  1Z47 A;  1C7Y A;  1D7Q A;  2JA5 G;  2Q2H A;  1HNW Q;  2JA8 H;  3E9H A;  3GDE A;  1IBM L;  1WYD A;  4GN5 A;  3J7A 5;  4TVA B;  4DR6 L;  2VL6 A;  1CKN B;  3MXN B;  4JBM A;  4LFA L;  4A3B H;  1VQL A;  3CC4 A;  1E1T A;  1EIF A;  1A8V A;  3BZC A;  1A62 A;  4JV5 Q;  3PUW A;  1RIP A;  1X65 A;  4A3E H;  2ASB A;  3RLN A;  3U50 C;  3JAM i;  1Y1V H;  2Z6K A;  1VQC A;  3PO3 H;  4IOA A;  4C3I H;  5M3F H;  4DV1 L;  3BZK A;  3CPW A;  2Y0S G;  1IYJ B;  1XNQ L;  2CWA A;  3EBE A;  5C4X G;  1PVO A;  1JE5 A;  2MQH A;  4DV7 L;  4LFC Q;  3S1M H;  1PYS B;  2MO1 A;  3RLO A;  4R4T A;  3HOU H;  2ZTE A;  2F4V L;  2BH8 A;  3S17 H;  4PZ6 A;  5LMN W;  2V1C C;  1HNX Q;  4HJA A;  4HIK A;  1YJN A;  4DR2 L;  1CKN A;  1VQJ A;  4YY3 Q;  1SFO H;  1HR0 L;  4JYA Q;  4GNX B;  4GLX A;  1Q1B A;  3ZJY C;  2EXD A;  4DV3 L;  4GOP B;  1IL2 A;  3TRE A;  3KLW A;  4OX9 Q;  1JJG A;  1YBY A;  1WCM G;  2OTL A;  4JI6 L;  3GO5 A;  1VQH A;  2PQA B;  3OYY A;  1PH1 A;  4JI7 Q;  5JJK A;  1LUZ A;  4B3T Q;  2NVY H;  1VQM A;  2GVA A;  4P74 A;  3J81 j;  3S2H H;  3KJP A;  4JI1 L;  4DR7 Q;  5EAY A;  3I56 A;  1OXU A;  1YHA A;  5K36 G;  2CWP A;  1QVF A;  1KRT A;  1XMO Q;  2K52 A;  4JOI C;  1A0I A;  2L15 A;  2ZTD A;  4X64 Q;  1GKH A;  3CCR A;  2R6G A;  1QZH A;  4JI8 Q;  4MNO A;  4H02 A;  4HIO A;  4LF5 L;  4JI4 L;  2RF4 A;  4LF4 L;  1OXV A;  2A1A A;  4HJ5 A;  2C35 B;  1HZ9 A;  3UDX A;  1X3G A;  1B8A A;  4GNX A;  3OTO Q;  2UUC L;  1EWI A;  1XMQ L;  2I5L X;  2WB1 G;  1HZB A;  3CCQ A;  4GOP A;  4DV4 L;  5IY0 A;  1CSP A;  2UUA L;  4JI2 L;  4P71 A;  5JEA G;  3AYH B;  4BXX G;  4R1J A;  1YIJ A;  1X54 A;  2PQA A;  4DR6 Q;  4LFA Q;  4DR1 L;  1EOV A;  2E2I H;  3ULL A;  1W3S A;  4A3G G;  1FJG L;  1I5F A;  1VQN A;  4C3J H;  5C4J H;  2EQS A;  1I94 L;  4DUY L;  1UE7 A;  4KHP Q;  3HOV G;  1SRO A;  4OXP A;  4X62 L;  3I4M H;  1QUQ B;  3GTQ H;  2LXJ A;  4OWT B;  1FVI A;  2RHQ B;  1PV4 A;  1N8R C;  3H3V H;  1GO3 E;  2F52 A;  4XIG S;  2JEB I;  4KLK A;  4YCW A;  2ZM6 L;  4DV1 Q;  1Y1W G;  2IY5 B;  2Z0S A;  3UDG A;  1XNQ Q;  2R93 G;  1VQO A;  2WFW A;  4DUZ Q;  2VZA A;  1ASY A;  4B3M Q;  1L2F A;  1VQF A;  2JA7 G;  4KI0 A;  2HQL A;  2CCZ A;  2RHS B;  1HNZ L;  1E24 A;  2UXD Q;  2F4V Q;  1TXY A;  2AHO B;  2Z6K C;  2AMC B;  4HIM A;  1JT8 A;  3L0O A;  1BVS A;  3E0E A;  3TEH B;  2IHE A;  3I7F A;  4QIW E;  5IWA Q;  4A76 A;  2NVQ H;  1MKH A;  1HJP A;  4DV3 Q;  2YTY A;  3W5O A;  4IFD G;  1HZC A;  4UP9 A;  5IP9 H;  3S14 H;  3CC7 A;  3PSI A;  1E3P A;  4JI6 Q;  1QUQ A;  4DV6 L;  4LF8 L;  5BR8 L;  4TQU S;  2R7D A;  3RZO H;  3U4Z A;  5LMN L;  3T1H L;  3HOZ G;  1KL9 A;  4P75 A;  4B3S Q;  3K80 C;  1Y1W H;  4LFB Q;  3CW2 C;  1VQA A;  4AYB E;  4Y7N H;  1PA6 A;  3GTJ H;  3GTO H;  2XGT A;  4NB3 A;  1TWH H;  3PO2 H;  1NMG A;  4LF5 Q;  1SMX A;  2LXK A;  4NPS A;  4YCU A;  1KRS A;  4JI4 Q;  4LF4 Q;  3GTL H;  2R7F A;  4IO9 A;  3CP0 A;  1BKB A;  2N78 A;  5C0X J;  3CXC A;  1SR3 A;  1NTG A;  1VQI A;  1B7Y B;  4JI2 Q;  3HOW G;  1JB7 A;  4QQB X;  3A0J A;  3ER0 A;  5C3E G;  1X3F A;  3M3Y H;  1FGU A;  5IYB H;  2DUD A;  4R4I A;  3NEM A;  1QVC A;  4QGU A;  4IOC A;  4DR1 Q;  3G48 A;  1C0A A;  3NBH B;  5C44 G;  3B6Y A;  4DR4 L;  4BY7 H;  3KYH C;  1GD7 A;  4JCV E;  4X62 Q;  5M5W H;  3F2B A;  4HJ8 A;  4NXN Q;  2VUM G;  4BA1 I;  2UU9 L;  2N3S A;  1E22 A;  1NY4 A;  1X9N A;  3VDY A;  1EQQ A;  2Q2T A;  3KOJ A;  4GKJ L;  3GTK H;  4UP8 A;  5IP7 H;  1M1K C;  1MJE A;  2K50 A;  3TRZ A;  4XTC S;  5FJ8 H;  2ZJR A;  4IPC A;  3KF8 B;  3KFU A;  1OTC A;  3AQQ A;  2VQF L;  2YTX A;  1N36 L;  3HOW H;  2UXC L;  4AIM A;  3T1Y L;  1Q86 C;  4B3R Q;  2RCN A;  3BU2 A;  1YNX A;  4X66 Q;  5GAD C;  4HID A;  1VQ5 A;  2ATW A;  1L1O C;  2E5L Q;  3I4N G;  3S15 H;  2VS1 A;  5C44 H;  3PUY A;  4GLA C;  5M3M G;  2D0P A;  1X55 A;  2K5V A;  1KAW A;  2IX0 A;  3Q8D A;  4X65 L;  3J81 i;  2ZJP A;  1VQ8 A;  2JA5 H;  1XJV A;  5IYD G;  4IFD I;  2YV5 A;  5IT9 c;  2BA0 A;  4LF8 Q;  5BR8 Q;  2HHH L;  1VQ9 A;  4LNQ A;  3ICE A;  4DV2 L;  2OTJ A;  3FHW A;  4O2D A;  1T9H A;  3J80 i;  1S72 A;  1IBL L;  3EN2 A;  1N33 L;  3L2P A;  1VQB A;  2KBN A;  1K0R A;  1K73 C;  2JK8 A;  3KDF B;  1VQK A;  4UPA A;  5HY6 A;  5GAE C;  3STB D;  1Q8K A;  3STB C;  4HJ9 A;  4AQY L;  2DGY A;  2BA1 A;  3FKI G;  5J3B A;  5AJ3 Q;  1IBK Q;  5GAH C;  2GVB A;  2B63 G;  3PIP A;  1N34 Q;  1J6Q A;  4JI3 L;  4EX5 A;  5C4X H;  1NMF A;  1J5E Q;  1UE5 A;  1S40 A;  3H0G G;  3CCV A;  3I4N H;  4A3K G;  1UWV A;  4JI5 L;  1XNR L;  1VQG A;  2NN6 G;  4MTN A;  4A75 A;  1VCI A;  4ME3 A;  4KHZ A;  4JI0 L;  1K3R A;  1P8L A;  5IYD H;  3M7N A;  4DR5 L;  4POG A;  1LYL A;  1M90 C;  4A3C G;  3S24 A;  3A74 A;  2R7Z G;  3PF4 A;  1IBM Q;  3UDF A;  4JBW A;  4K0K L;  1OXS C;  3KDF A;  4BBR G;  1G6P A;  2OQ0 A;  1WCM H;  3RR5 A;  4BA2 I;  2I5M X;  4JG2 A;  1IXR A;  1D8L A;  1VQD A;  1WOC A;  4LUV A;  2VW9 A;  4DR3 L;  1XPO A;  2NVX H;  3AEV A;  1YVC A;  4GKJ Q;  2AKW B;  3M4Q A;  1EYG A;  4NXM L;  3JAM c;  3PUZ A;  3CCL A;  1V9P A;  5C0X I;  1EFW A;  1ASZ A;  1VQ6 A;  3CME A;  1N36 Q;  1PH2 A;  1JJ2 A;  3HOY G;  3H0G H;  4EQ5 A;  4P73 A;  1CUK A;  4DV7 Q;  4IPD A;  3M85 A;  1K9M C;  2K75 A;  1BBW A;  3PV0 A;  1Q81 C;  1U0L A;  3S1N H;  1EIY B;  1PHJ A;  1OXT A;  1X6O A;  3M9B A;  4DK3 C;  4YWL A;  1N9W A;  4X65 Q;  4RG1 A;  3CC2 A;  4JBK A;  4A3L G;  4A93 G;  4JC0 A;  3K81 C;  2UXB Q;  1G29 1;  4OWW B;  4DR2 Q;  1YIT A;  2B3G A;  1HR0 Q;  1SLJ A; 
#chains in the Genus database with same CATH topology
 3RLF A;  2RVL A;  4DV2 Q;  1HNW L;  2VB2 X;  3HOX G;  3TZU A;  3MXG A;  1PH9 A;  1YHQ A;  4ZK9 B;  1HZA A;  1BF4 A;  3HOV H;  4AQY Q;  2D62 A;  2F0E A;  5GRO A;  4JI1 Q;  4RFB A;  5DLQ E;  2ZJQ A;  2DNC A;  1R4Q B;  3K5O A;  2A6E C;  4DV5 L;  3FMC A;  3HOW B;  2R93 H;  1BQQ T;  1JOR A;  4K8I A;  4DNI A;  1SNM A;  1I94 Q;  1FNW A;  4S3S A;  3AU7 A;  2JA6 G;  5IGF A;  2JA5 B;  1VQ7 A;  3V96 A;  1A2U A;  4RHS A;  1Q12 A;  1U4M A;  2LSS A;  1GUW A;  3A5Z B;  3TBI B;  1LM0 A;  4GNX C;  1Y14 B;  4DAP A;  5J39 A;  3AMU A;  1XTC D;  3E5S A;  1ENF A;  4DAY B;  3ND9 A;  1PH4 A;  3K0X A;  2ZM6 Q;  3U4V A;  3HKZ E;  3I3C A;  4DXF A;  1K83 H;  4ZUI A;  1AE3 A;  3KF6 B;  2XIW A;  3KLS A;  5EKI A;  3J81 L;  1BNZ A;  1HNZ Q;  1IW7 C;  2YU9 H;  2GN5 A;  2XTI A;  1UEB A;  2KHJ A;  1J8I A;  3I91 A;  3J80 L;  3OPO A;  2K5N A;  2KOL A;  4MZ9 A;  4DV6 Q;  4A3J G;  1XX8 A;  2A73 B;  1MI2 A;  2IX1 A;  4K6D A;  4L6T B;  3R8B A;  2F4I A;  1B4O A;  1AH9 A;  4FF2 A;  3QOL A;  2NTT A;  3NSW A;  3TSS A;  3H0G B;  1CFM A;  4DK6 C;  1DOK A;  2A5H A;  3F2D A;  4EQP A;  1PTO H;  2F3I A;  5ELF A;  1N32 Q;  4L63 B;  5E7N A;  5M3M H;  5IWA L;  4A4I A;  1D1I A;  1FL0 A;  1I4P A;  3CRL C;  4QF4 A;  2PNH A;  4O1N A;  2K1B A;  1D2B A;  2X69 A;  1QNK A;  3CAM A;  1SNP A;  4C3J G;  4DV0 L;  1E1O A;  1YNN C;  1W2B A;  2ES2 A;  1H95 A;  2UU9 Q;  1DJR D;  4B3S L;  3QIA A;  1VQE A;  1F9P A;  2VQE L;  3S1R B;  2B63 H;  5JJL A;  1RHP A;  4K6L A;  1DGS A;  4RCN A;  2JA7 B;  4OIJ A;  1MIU A;  4DKA C;  1EUJ A;  4HN7 A;  2UXC Q;  2CFM A;  4J1M A;  2B2W A;  4TSS A;  5GQO A;  1UAP A;  1AE2 A;  1A15 A;  1PMR A;  4RMF A;  4LF6 Q;  4KJN A;  3M4P A;  1RDP D;  3RZD H;  2EYJ A;  2E8G A;  4X3U A;  2HHH Q;  5COR A;  4A3M H;  2EOT A;  1CSQ A;  1IKL A;  1YI2 A;  2IWH A;  1JMC A;  3E9I A;  2AQ3 B;  1L1O A;  2HD3 A;  3RMH A;  1U4R A;  2BE5 C;  3JC6 6;  4BBS B;  3PIO A;  2E2H H;  3SGI A;  3HOY H;  2YYZ A;  2JP1 A;  1SE3 A;  4FXG C;  4B08 A;  3K5L A;  3PO2 G;  2SNS A;  1F9R A;  3ULJ A;  4RGT A;  1Q46 A;  3LWE A;  5FLX L;  1AN8 A;  2D0O A;  4QY7 A;  1SNQ A;  1GUG A;  3EA6 A;  2VXW A;  1GUS A;  4F8M A;  2SOB A;  1E2W A;  3HOX H;  3PIO 3;  3NQT A;  4YY3 L;  5IE8 A;  3HKS A;  5ELN A;  3KK7 A;  4OX9 L;  4LUZ A;  2NZH A;  4FDB A;  1TR5 A;  3F8T A;  4L5R C;  5IYC H;  4P72 A;  3MA2 B;  2CW0 D;  5AJ3 L;  2AQ1 B;  3PGZ A;  3NPP A;  1DZ1 A;  1CKO A;  2EYM A;  5FLM H;  1WTO A;  4ZYS A;  2RDF A;  3EIV A;  3CKI B;  3TME A;  3PMF A;  3OIQ A;  2JA6 H;  4LMQ D;  4DN4 M;  2K5W A;  4C3H B;  1C7Y A;  2JA5 G;  2FHT A;  1TS3 A;  3E0J A;  3KLR A;  3S2D B;  2VL6 A;  1FNU A;  2PW7 A;  1ICF B;  4FF4 A;  1A62 A;  3FKI B;  4CDE C;  1RIP A;  4ZCK A;  1TWC B;  5CYU A;  2E2J B;  2DY7 A;  2Z6K A;  4HED A;  2K04 A;  3A7L A;  1PXU A;  3BZK A;  4OIK A;  1IYJ B;  1IYV A;  3EBE A;  1PVO A;  5ELE A;  2K7V A;  1PYS B;  5I2X A;  2MP1 A;  1S5C D;  1LT6 D;  2BH8 A;  4ZUJ A;  3R2I A;  4DR2 L;  1CKN A;  2L5T A;  3TN2 A;  2K6A A;  4DV3 L;  4DNR B;  3KLW A;  1YBY A;  2BOS A;  1SNO A;  1LT5 D;  4JI7 Q;  3W3A A;  4B3T Q;  1VQM A;  3FPP A;  5M5X B;  3S2H H;  2ZXR A;  4JI1 L;  5K36 G;  2CWP A;  4ULL A;  2K52 A;  4RWS C;  4X64 Q;  3G6J B;  3NWT A;  1QZH A;  2OF1 A;  4JI8 Q;  4ABN A;  3K6O A;  4H02 A;  4HIO A;  2NWG A;  1I94 L;  3GTP H;  1PZK D;  4KD4 A;  2PQE A;  1B8A A;  1EWI A;  3R93 A;  2I5L X;  5IGG A;  3BS1 A;  2K28 A;  3AYH B;  4DFA A;  1LAC A;  1YIJ A;  3W2D A;  2MHV A;  4HAE A;  4C1N I;  4C3J H;  1EY5 A;  5C4J H;  2F0N A;  4R8I A;  4OXP A;  1QUQ B;  3GTQ H;  2LXJ A;  2B8F A;  1PV4 A;  2RDG A;  3DXJ C;  2ZM6 L;  1XNQ Q;  2CHB D;  4DUZ Q;  2VZA A;  1LO5 D;  2JA7 G;  4KI0 A;  1O7Y A;  2UXD Q;  2RHS B;  1HNZ L;  1E24 A;  4DXG A;  1Y8O B;  2Z6K C;  2AMC B;  2XWB B;  5JEA H;  3L0O A;  2CVR A;  3E0E A;  4QIW E;  2JA8 B;  4ZKB B;  1B50 A;  3CC7 A;  1YNJ D;  1AFP A;  4DV6 L;  1SYE A;  5BR8 L;  3U4Z A;  3H94 A;  1RKN A;  5FKA C;  3I73 A;  3A56 A;  1KLU D;  3CW2 C;  2XN9 C;  1VQA A;  4Y7N H;  1PA6 A;  3PO2 H;  2CW0 C;  5LL6 X;  4JI4 Q;  1STG A;  2F0H A;  2KCC A;  4IO9 A;  2ZXP A;  4CKE A;  1DON A;  2N78 A;  1O7L A;  5EPJ A;  1SR3 A;  4JI2 Q;  2H1E A;  1JB7 A;  2G9H D;  3M3Y H;  1FGU A;  5JPM C;  1SFO B;  4J6H A;  2DUD A;  2F0J A;  4R4I A;  4DR1 Q;  3NBH B;  5C44 G;  3B6Y A;  4ILW A;  2I46 A;  2QDB A;  4FVM A;  4PV1 C;  3KYH C;  1JOK A;  3K58 A;  4X62 Q;  4HJ8 A;  4N8F A;  2F0U A;  4KKS A;  2UU9 L;  1A2T A;  1E22 A;  2K05 A;  2L9H A;  1I4H A;  4GKJ L;  2Y0S B;  1MJE A;  1M1K C;  3TRZ A;  3TP6 A;  1V1P B;  4DA2 A;  1CA5 A;  2DY8 A;  4HMJ A;  4R9W A;  3HOW H;  2UXC L;  4AIM A;  1LTB D;  2NZ1 D;  4G57 A;  1Q86 C;  2RCN A;  4HID A;  1YNX A;  2M2L A;  4M1U B;  2WII B;  3R2T A;  3I4N G;  3NBI A;  3Q8D A;  3MAQ A;  3OWE B;  2JA5 H;  2PYK A;  4C3H G;  2PPB C;  2BA0 A;  2HHH L;  1VQ9 A;  1LTG D;  1KNE A;  5EKL A;  3ICE A;  2L12 A;  1XXG A;  5F2D A;  1WTR A;  4O2D A;  1S72 A;  3EN2 A;  1PFM A;  3F2U A;  3KF8 A;  2IW3 A;  1ESF A;  4TRD A;  5GAE C;  4I65 A;  3FKI G;  2BA1 A;  5J3B A;  2EJG C;  2F0G A;  3GV3 A;  2KHS A;  2WV6 D;  2EY2 A;  5T1G A;  3CCV A;  2F03 A;  4JI5 L;  3EVQ A;  1VCI A;  1P8L A;  2KED A;  3M7N A;  4POG A;  1LYL A;  5CV7 A;  2PW5 A;  3PF4 A;  1IBM Q;  3UDF A;  5M9O A;  1UNS A;  2GA4 B;  3IL8 A;  3UI2 A;  1WOC A;  1SJE D;  1YVC A;  3M4Q A;  4N9T A;  1EYG A;  3PUZ A;  3OHX C;  3Q0A A;  1TWH B;  1EFW A;  5K36 H;  3CME A;  2FIN B;  3H0G H;  1PRT F;  4DNT B;  4UDU C;  2FMC A;  1AZQ A;  1PTO D;  4YWL A;  1N9W A;  3SDZ A;  3CC2 A;  2UXB Q;  4OWW B;  1QJO A;  1YIT A;  2CQO A;  1DM0 B;  1S3O A;  1MSH A;  3LGJ A;  3UE1 A;  2PZU A;  4UHV A;  2B2V A;  1GJX A;  3A5U A;  1E7Z A;  2F0P A;  1ZKO A;  1YNJ C;  5IGE A;  3GTK B;  3C46 A;  4CJ0 B;  1NR2 A;  3S1R H;  4NW2 A;  3F2C A;  1P16 A;  1U4P A;  2B29 A;  3QO2 A;  1PH7 A;  2NTS A;  4ALP A;  2KEN A;  2A19 A;  4RGN A;  1Z9F A;  2JA7 H;  1R9T H;  2UUC Q;  3ND8 A;  2XNA C;  3P75 A;  4DV4 Q;  4O42 A;  4IUN A;  5IOC A;  3G6E A;  3VR2 A;  2O2L D;  1JR0 D;  4KKU A;  4C1N K;  1D5X C;  1MSG A;  3OW2 A;  5CV4 A;  1FJG Q;  4BS9 A;  2JEA I;  1X56 A;  2QKI C;  1JQY D;  1HA5 A;  2JE6 I;  2F0Q A;  2F0T A;  4EQO A;  4BY1 H;  4GS3 A;  4JI7 L;  1VQ4 A;  1GHK A;  4OON A;  4B3T L;  4XYQ A;  2PNR C;  2JQO A;  4BBS H;  2F1M A;  1F2Y A;  5C4X B;  4X64 L;  1RL2 A;  5IGB A;  3MVV A;  4GKK L;  2EY1 A;  3U58 A;  3Q23 A;  2PMZ B;  1PH3 A;  2MO0 A;  1TII D;  4QJF A;  2XWJ B;  1SAP A;  2BDO A;  3AFQ A;  4YHH Q;  3PF5 A;  1BBX C;  4AH6 A;  1ILP A;  3D8G A;  4OGQ C;  4L5S A;  3DWP A;  2VNU D;  5LMU L;  4U68 A;  5KYI A;  3D4W A;  2HCI A;  4Q5V A;  1CQF A;  3J7Y W;  2HIX A;  1BCP F;  1ILQ A;  5IGD A;  1NBW A;  2B2V C;  5GAG C;  1CHP D;  1PFS A;  4PMW A;  3I90 A;  3WOE A;  2Z4I A;  3D31 A;  4UAI A;  4DUZ L;  1LTT D;  4WJ3 M;  3J7A F;  2AWO A;  3TS0 A;  1IYU A;  1GUT A;  3ERS X;  3NEL A;  5FLX c;  4LF9 Q;  2UXD L;  5KND A;  3CMA A;  4A3G B;  4K5W A;  3NTK A;  1W6K A;  4C3H H;  3LNN A;  1CA6 A;  3RN5 A;  3GTM B;  1PFB A;  3D6C A;  5JEA J;  1Y69 U;  1YNN D;  3M7G A;  2YTV A;  4RHR A;  4A3M G;  3S2D H;  2UUB Q;  4PZ7 A;  3PIP 3;  2I0Q A;  4LF7 L;  1GVP A;  3GTG B;  3FKI H;  1STY A;  1PRT B;  1KDA A;  1TWC H;  3JAM E;  1YJ9 A;  2E2J H;  1L1O B;  5J1Z A;  4C2M B;  2VQF Q;  3CD6 A;  3H15 A;  4ODG A;  5C4Z A;  1NAP A;  2LFN A;  5ELB A;  3CPF A;  4R8N A;  2A68 D;  4DU9 A;  1HCZ A;  2VY3 A;  3G71 A;  2KCM A;  1K8A C;  1KDB A;  1B1Z A;  4CKB A;  4Q0F A;  1O7I A;  3DEO A;  3P7J A;  1YZ6 A;  1SEB D;  3L7Z C;  1S5F D;  1TWF B;  1VF7 A;  1PH8 A;  2XRQ D;  3A8K E;  3OIP A;  4I7A A;  5M5Y B;  4DGZ A;  2B8G A;  3DLL A;  5D3I B;  3Q24 A;  1HUM A;  1TWA B;  2CKZ B;  2BE5 D;  1LT4 D;  4IPH A;  2EYP A;  1I6H B;  5CGK A;  2OWO A;  5M5X H;  1LTS D;  5IYC G;  4Z9C B;  4YWK A;  5E4W C;  1IKM A;  1WVL A;  5C3E B;  5FLM G;  1XNR Q;  2Q2U A;  4IUV A;  4RH6 A;  4JI0 Q;  1QG7 A;  5HGT A;  4B9W A;  2IPK D;  3W1G A;  3G4S A;  1B53 A;  1I3Q B;  4L5Q A;  5I2Y A;  4X3S A;  1WD1 A;  2WP8 J;  1E0B A;  1SE8 A;  1X32 A;  1SN8 A;  1D5M C;  2K14 A;  4R4O A;  3IAY A;  2LKV A;  4GZY C;  1DXM A;  1Y8P B;  3K8A A;  4OEL B;  3S1Q B;  4RKL A;  1OO9 B;  4XQN A;  2F0S A;  1ZXT A;  5FJ8 G;  1EY8 A;  2QW7 A;  4A3D H;  4IQZ A;  2QDL A;  1NSN S;  1TWG B;  5DEH A;  1U4L A;  1TY2 A;  2PI2 E;  4LK1 C;  2F0F A;  4UY8 C;  4DAM A;  1KDC A;  1F2M A;  2PZW A;  3SK6 A;  2Q2H A;  1C4Q A;  2JA8 H;  1EZ8 A;  3E9H A;  3MEH A;  1IBM L;  3J7A 5;  5LHY 1;  5KYL A;  1CKN B;  4JBM A;  4LFA L;  1HRJ A;  3CQZ B;  2A74 C;  5KGU A;  1VQL A;  1BCP B;  2F0K A;  3NQI A;  4RA8 A;  3QJY A;  1MGS A;  1X65 A;  3NXW A;  3RLN A;  4JK1 C;  5A35 A;  4EQN A;  1Z6H A;  4IOA A;  1PRT D;  4DV1 L;  3WDN A;  4A3K B;  5C4X G;  4LAA A;  4LFC Q;  2ENB A;  4RCO A;  3MTS A;  2MO1 A;  4R4T A;  2ZTE A;  3EFX D;  4PZ6 A;  2V1C C;  4HIK A;  1SFO H;  4JYA Q;  4GLX A;  1TY0 A;  2EXD A;  1NR4 A;  4KD3 A;  3FPU B;  5JVH 3;  3OYY A;  1PH1 A;  1LUZ A;  2GVA A;  3KJP A;  4DR7 Q;  2PZT A;  2OXP A;  3DWQ A;  5C3X A;  1XMO Q;  1EU4 A;  2L15 A;  3GV6 A;  1R9T B;  4LF5 L;  2WIN B;  2L1B A;  2RF4 A;  1JB3 A;  1OXV A;  1B9M A;  4A93 B;  3UDX A;  2UUC L;  3OTO Q;  2EYO A;  4NMZ A;  4CDC C;  2EYH A;  4GOP A;  2A68 C;  3CCQ A;  1SSO A;  5IY0 A;  1CSP A;  4DV4 L;  3J7A V;  5JEA G;  3KLS X;  1X54 A;  2PQA A;  1HQM C;  4DR6 Q;  1EOV A;  4A3G G;  3ULL A;  1W3S A;  2E76 C;  1FJG L;  1EYC A;  1I5F A;  1VQN A;  1UE7 A;  4KHP Q;  1SND A;  1SRO A;  1TS5 A;  4BY1 B;  5FO8 B;  1GUO A;  2RBM A;  2XRS D;  3ONA B;  3EQL C;  5A2Q E;  3BVG A;  3HS0 C;  2F52 A;  2JEB I;  4KLK A;  4KN7 C;  2Z0S A;  3UDG A;  3OSO A;  1VQO A;  2M00 A;  2SDF A;  4N9P A;  3VYU A;  3MXU A;  1ASY A;  4OHJ A;  4B3M Q;  1L2F A;  1VQF A;  2MUY A;  4A3F B;  1C8C A;  2F4V Q;  2A6H C;  1STN A;  3K7A B;  3TEH B;  3I7F A;  4A76 A;  1MKH A;  3D6W A;  4UP9 A;  1BUV T;  3PSI A;  4JI6 Q;  4A3B B;  4LF8 L;  1O78 A;  1C48 A;  4A3E B;  5CR3 A;  4P75 A;  4IUU A;  1II3 A;  4BWG B;  1BCP D;  3DWA A;  4B9X A;  1WTQ A;  4LFB Q;  2JXM B;  1TWH H;  2A69 C;  4NPS A;  4LF4 Q;  2RKS A;  3CXC A;  1B7Y B;  3HOW G;  2KEC A;  3A0J A;  3ER0 A;  5C3E G;  2CH4 W;  5C5L A;  1H9S A;  1KAA A;  3DMU A;  2QF7 A;  2E2D C;  1PDQ A;  3G48 A;  1EFI D;  4F88 A;  1UUP A;  2XSC A;  1GD7 A;  5AFW A;  2B2W C;  3F2B A;  3JAM L;  2DN8 A;  2NVY B;  1MHW C;  4BA1 I;  2B39 A;  1VDZ A;  2E75 C;  3E6Z X;  2N3S A;  4IN3 A;  1EQQ A;  2Q2T A;  3GTK H;  2K50 A;  5FJ8 H;  3KF8 B;  5C4H A;  1OTC A;  3AQQ A;  1FGB D;  2YTX A;  2VQF L;  1PRT C;  4X66 Q;  3T4A C;  1L1O C;  2E5L Q;  1QWY A;  5G3L F;  4GLA C;  3J81 i;  1SXT A;  2IX0 A;  2ZJP A;  2E2I B;  2Z8L A;  1MD2 D;  5IT9 c;  3QB3 A;  1M4V A;  4DV2 L;  1SE2 A;  3FHW A;  3I4M B;  3J80 i;  1G8Z D;  1LV9 A;  1K73 C;  2JK8 A;  1VQK A;  1BOS A;  5HY6 A;  4HJ9 A;  4AQY L;  1T5E A;  1IBK Q;  3H91 A;  3SR1 A;  5GAH C;  3K59 A;  4ZKC B;  1ZEQ X;  3IFD A;  2WAQ B;  2WB1 B;  5C4X H;  4G4K A;  1UE5 A;  2NB0 A;  3H0G G;  4ZAI A;  4A3K G;  1XNR L;  4MTN A;  3RD4 A;  4A75 A;  3HP3 A;  4KHZ A;  4JI0 L;  5IYD H;  1ML0 D;  2PCF B;  2Z4H A;  1M90 C;  3S14 B;  3G7L A;  3S24 A;  4A3C G;  2X6L A;  3HG9 A;  3RZO B;  1OXS C;  3KDF A;  1SDF A;  4JG2 A;  4LUV A;  1VQD A;  3WOF A;  1SNC A;  2VW9 A;  1Y1W B;  1V9P A;  5C0X I;  1CM9 A;  3GTL B;  1B2T A;  1VQ6 A;  1N36 Q;  4PNY A;  4A3D B;  4EQ5 A;  1PZJ D;  2I07 B;  2J4X A;  3M85 A;  2F0O A;  4FXK C;  1EIY B;  1OXT A;  1X6O A;  1MBY A;  3M9B A;  1QIL A;  4DK3 C;  4X65 Q;  1EIH A;  5FO7 B;  4A93 G;  1G29 1;  1V8Q A;  2G5D A;  4EVO A;  4BY7 B;  1T5X D;  3T53 B;  4A3G H;  5M5W B;  3U9S A;  1TU2 B;  3SK4 A;  1N33 Q;  4DK1 A;  3GTM H;  4RAU C;  2MNA A;  3RNU A;  2KVM A;  3SVM A;  4J15 A;  1KQS A;  4BY1 G;  1S5E D;  3TP8 A;  3BDC A;  1JWU D;  3HFZ B;  3K0Y A;  4PZ8 A;  1BCP C;  4JI3 Q;  2Z9H A;  3IKJ A;  3GTG H;  4CJ1 B;  3TQY A;  3X3N A;  4BBS G;  4C2M H;  1CQV A;  4LFC L;  3CCM A;  4JW0 A;  2Q2I A;  2RQX A;  1K8G A;  4G7H C;  1XMQ Q;  1EOT A;  2IT1 A;  2LY7 A;  1PH5 A;  4IUT A;  1N32 L;  4K0K Q;  4KJO A;  5FOB B;  1WJJ A;  5EBC A;  4JYA L;  2WAC A;  3I8Z A;  4IPG A;  1STH A;  2FXQ A;  4G7Z C;  2ZXO A;  1TWF H;  4DR3 Q;  2O4X A;  1H9K A;  4A3B G;  1FD7 D;  3SHL A;  2QEX A;  5M5Y H;  4A3E G;  3TZD A;  1LT3 D;  4DR7 L;  1TWA H;  4ID6 A;  2Y0S E;  1I6H H;  1GXD C;  2NUC A;  1WFQ A;  2DJF C;  2R61 A;  3I4L A;  3PUV A;  1FR3 A;  3HZX A;  4A3I H;  5C3E H;  3OTO L;  4HCE A;  1IZ6 A;  1EQR A;  4MIU A;  3A55 A;  4TKO B;  1KD1 C;  4LF6 L;  4OO1 G;  1WCM B;  1XTD A;  2NVX B;  1I3Q H;  4X3K A;  5LL6 S;  4DK0 A;  3CCS A;  2K5Q A;  3HGB A;  3W1B A;  5JOB A;  1G91 A;  1BBU A;  1TS2 A;  3T1H Q;  2OQK A;  4KHP L;  1QZG A;  3UDI A;  2HIV A;  2K32 A;  4XQJ A;  2F0I A;  5J22 A;  5C0X H;  4DV5 Q;  3S1Q H;  1X3E A;  2AWN A;  4U67 3;  1WTV A;  4B3M L;  1GOZ A;  3BJU A;  2NZO A;  4WOR A;  4M8A A;  1TWG H;  1L0X B;  2N8N A;  4FNF A;  1H9R A;  1LTL A;  2K01 A;  1KHI A;  5BN3 A;  3VYS A;  2B2U A;  4X6A H;  5D65 A;  1LTI D;  5EPL A;  3NTH A;  2JJQ A;  4JVZ A;  1EY9 A;  2EJM A;  3M4O B;  4IZ8 A;  4LUO A;  5ELO A;  1YEZ A;  3I4M G;  3CQZ H;  2NVT B;  1VS0 A;  2B2Y A;  5EKK A;  1K3B C;  4APV A;  4CDD C;  2I5H A;  5E3F A;  4HSV A;  4XXE A;  4LFB L;  5ELD A;  1ROD A;  1B70 B;  3T1Y Q;  3A54 A;  1STA A;  2WAQ G;  4A3K H;  4HJ7 A;  4QL5 A;  2FMM A;  3J81 c;  4HR7 B;  2EVB A;  3PCO B;  4K5V A;  1V1Q A;  1HFN A;  4XYO A;  4A3C H;  4OO1 I;  5I6W A;  3KJO A;  3TS2 A;  1GM5 A;  3VA7 A;  3MZ5 A;  4LWC A;  5IP9 G;  2RSN A;  4E6I A;  3J80 c;  1R4P B;  1JWM D;  1MJC A;  3HOZ B;  3CCU A;  4XQQ A;  4IFD J;  1STB A;  1JC7 A;  4CBV A;  4WJW A;  3I2Z A;  1JE4 A;  1D1K A;  5E1F A;  2EYF A;  2ALY B;  4KMU C;  3S16 B;  1VMP A;  2JA9 A;  2EJF C;  4FP5 D;  2EY5 A;  4A3D G;  3F1Z A;  1NUC A;  1Q3L A;  4X66 L;  2EE1 A;  3J7Z C;  4OWX B;  2E5L L;  4R4C A;  4A93 H;  5IYB G;  1TKW B;  1W6J A;  4DR5 Q;  1XWE A;  2KCN A;  2K4K A;  4CJ2 C;  1UE1 A;  1L0Y B;  1QCB D;  1KC8 C;  4DV0 Q;  4GLV B;  4BY7 G;  3KBG A;  2JA8 G;  2VUM B;  4HCS A;  2QGQ A;  4P2C B;  3TDQ A;  2VQE Q;  1A6X A;  3S9W A;  2B2U C;  3VYR A;  1NE3 A;  3I55 A;  3CF5 A;  1HQR D;  5IP7 G;  2MGS A;  1LTR D;  1IBK L;  1RJT A;  3IRB A;  2L55 A;  1S4Z A;  2Q8R E;  1UE6 A;  5DAU A;  3TP5 A;  2F0M A;  4A3F H;  4JI8 L;  4DAV A;  1L0W A;  2PMZ E;  2KCT A;  4GN3 B;  4A3J B;  1TVX A;  4NXM Q;  3K7A H;  4FO2 A;  3IFT A;  4GN5 A;  4ZQ3 A;  1SYF A;  4A3B H;  3GQB A;  3CC4 A;  1QNU A;  2B2T A;  2M9V A;  1E1T A;  1EIF A;  4JPB W;  4JV5 Q;  2HDM A;  4A3E H;  3U50 C;  3OWF A;  3CPW A;  2Y0S G;  3OOC A;  1XNQ L;  1JE5 A;  1NNX A;  2D5D A;  1X3Q A;  3RLO A;  3S17 H;  2R7Z B;  2AUK A;  5FLX E;  4HJA A;  1YJN A;  2KA7 A;  1HNX Q;  3O13 A;  1VQJ A;  3MXN A;  4YY3 Q;  4G7O C;  4BBR B;  4OO1 H;  4GOP B;  3TRE A;  5DNF A;  4OX9 Q;  2ICE C;  1JJG A;  1WCM G;  2OTL A;  2R3Z A;  1S5B D;  3GO5 A;  1VQH A;  2PQA B;  3SE0 A;  2FJ2 A;  2NVY H;  3J81 j;  4OL7 A;  5EAY A;  4FXD A;  3I56 A;  3URY A;  1QVF A;  3ERO A;  1CT1 D;  1A0I A;  2ZTD A;  3NP8 A;  2KEE A;  1ENA A;  2R6G A;  3QG1 A;  1EYD A;  4ZRZ A;  4JI4 L;  4HJ5 A;  2C35 B;  1HZ9 A;  4GNX A;  1X3G A;  4H0L C;  4EGV A;  1XMQ L;  4JI2 L;  3LX0 A;  5EBD A;  5I6Y A;  2RSO A;  4K5X A;  4ME5 A;  5DM6 3;  4BXX G;  4MTK A;  1AEX A;  4KY6 A;  4R1J A;  2E2I H;  4DR1 L;  1PYW D;  1HA6 A;  3SK5 A;  4MHE A;  5FK9 C;  2R92 B;  3ZYY X;  4X62 L;  3I4M H;  1SYD A;  1EWC A;  2EDG A;  1FVI A;  4OWT B;  2RHQ B;  1N8R C;  4KY7 A;  2IY5 B;  4XIG S;  4OEM B;  4YCW A;  3NE5 B;  3BYT B;  1DOM A;  2NYZ D;  1WTP A;  4HSP A;  2A6H D;  4A3I B;  2HCC A;  1TXY A;  2AHO B;  3VR5 A;  5JJZ A;  1I50 B;  1JT8 A;  1JWS D;  2WKC A;  1BVS A;  2NVQ H;  1HJP A;  4DV3 Q;  4IFD G;  1HZC A;  5IP9 H;  3S14 H;  1H9S B;  3BYY B;  5KIX A;  4NP5 A;  4TQU S;  3RZO H;  5D14 A;  2RDH A;  2JN4 A;  3T1H L;  3HOZ G;  1Q90 A;  3V2T A;  1HXY D;  1Y1V B;  3PO3 B;  2FFK B;  1Y1W H;  4FF1 A;  4C3I B;  4AYB E;  4KKT A;  2D2C C;  4AYB B;  5M3F B;  4NB3 A;  4I7Z C;  3K57 A;  1EQV A;  2A69 D;  3GTL H;  4IUR A;  4KN4 C;  4YCU A;  2RA4 A;  3S1M B;  1A3T A;  4K14 A;  5C0X J;  3HOU B;  1I4Q A;  1VQI A;  1CTM A;  5IYB H;  3NEM A;  1QVC A;  3L3O C;  4IUP A;  5EGT A;  3BVM A;  2AQ2 B;  5I9O A;  5IIF A;  3VR6 A;  4BY7 H;  4NXN Q;  4QUC A;  5M5W H;  4KHV A;  2VUM G;  3NTI A;  4KTA A;  3VDY A;  3HKZ B;  1HTL D;  3KOJ A;  4UP8 A;  5IP7 H;  1SYB A;  5BN5 A;  3AB9 A;  3KFU A;  1M8A A;  3T1Y L;  4B3R Q;  3BU2 A;  5GAD C;  2O5I C;  1VQ5 A;  2ATW A;  3KUP A;  4CDF C;  2VS1 A;  3PUY A;  2KJX A;  2K5V A;  4IFD I;  2UXB L;  2QEJ C;  1VQ8 A;  1XJV A;  5IYD G;  3MC0 B;  5BR8 Q;  2BDN A;  4QCL A;  3FRP B;  2OTJ A;  1CI3 M;  1EEF D;  1T9H A;  2QCP X;  5KRU A;  1VQB A;  1K0R A;  3KDF B;  1EZ6 A;  3STB C;  1EWH A;  1DOL A;  2K5D A;  3FDT A;  1N34 Q;  1F2L A;  1NMF A;  1J5E Q;  1KAB A;  1VQG A;  2NN6 G;  1DCZ A;  1I6V C;  3NHH A;  1ENC A;  3DM1 A;  2K33 A;  4DR5 L;  2R7Z G;  1EQT A;  3A74 A;  2Z6B A;  5IGC A;  3FVQ A;  1QOH A;  4JBW A;  2KQ3 A;  3N6R A;  5CV9 A;  4BBR G;  1BXT A;  1WCM H;  1SMY D;  3RR5 A;  2I5M X;  1EYA A;  2NVX H;  4GKJ Q;  1F77 A;  1LAB A;  2AKW B;  4XDX A;  4DF7 A;  3GTO B;  3GTJ B;  4QMG A;  4RGO S;  1JJ2 A;  1PH2 A;  1EY4 A;  3K5M A;  2LMC B;  4P73 A;  2CQA A;  1CUK A;  2DJG C;  4PMC A;  2L11 A;  4DV7 Q;  3MFY A;  3T56 B;  2K75 A;  1BBW A;  3PV0 A;  1Q81 C;  1CZW A;  3A8J E;  4A3L G;  1B3Q A;  4CGY B;  1V1O A;  1BDO A;  3SXH A;  4NXM L;  4BXX H;  1HR0 Q;  1Z7T A;  1SLJ A;  4YHH L;  4IJH A;  1PH6 A;  1G6Z A;  5EJW A;  2HUG A;  5JVG 3;  3WWV A;  2HDL A;  3M4O H;  3FEW X;  4JV5 L;  3GP7 A;  2R92 G;  5ISR A;  2NVT H;  3PUX A;  4WRD A;  2J7Z A;  2MFI A;  2K5H A;  3QOJ A;  4O0A A;  4RGM A;  4JI5 Q;  1KTK A;  1AP0 A;  3AFP A;  1F2Z A;  3K5N A;  3S15 B;  5C44 B;  5C5M A;  2NN6 I;  3FP9 A;  3SK8 A;  2UUA Q;  1SYG A;  4A3I G;  4LF9 L;  3S17 B;  3U9O A;  3T16 A;  1HNX L;  1Q82 C;  4IFD H;  3VYT A;  3OW7 A;  5HGQ A;  3MWY W;  3D0F A;  2BH2 A;  1ET9 A;  3RN2 A;  2H5X A;  5BN4 A;  4POF A;  1HTP A;  4DUY Q;  1KXL A;  3HOZ H;  5KNC A;  4GOP C;  1A3U A;  2KHI A;  5CV8 A;  4PG3 A;  2UUB L;  4Y52 H;  1Y1V G;  3PO3 G;  3NEN A;  4GN4 B;  1VMC A;  5H1S E;  5C0X G;  4XT3 B;  1FNV A;  3CCE A;  4C3I G;  3S16 H;  1SRU A;  1QVG A;  4AYB G;  5M3F G;  4DPG A;  2QA4 A;  2SEB D;  3I4N B;  5KNB A;  1EEI D;  1PTO F;  1O80 A;  1PYB A;  4JBJ A;  1KIX A;  4F87 A;  3HOU G;  1RTN A;  2HQE A;  2QIL A;  3D4D A;  1A63 A;  4X3T A;  1EIG A;  3C3L A;  2F0L A;  2IHF A;  3I4O A;  2TSS A;  1B9N A;  4R4Q A;  2CH4 A;  3GD7 A;  1IHZ A;  4DAY A;  2LS0 1;  4C56 C;  5LMN Q;  5IT9 E;  1NJI C;  2VUM H;  5CBA E;  1SYC A;  1CZG A;  1HH2 P;  4F7X A;  4YCV A;  3K7U C;  2PI2 A;  3KF6 A;  1S5D D;  1STE A;  3HKZ G;  1G51 A;  1YHB A;  4HMI A;  3S1N B;  2DNE A;  1NCV A;  2WAQ E;  2WB1 E;  5E4X A;  1DD2 A;  1E2Z A;  2H4O A;  4ZLT F;  1C9O A;  1EU3 A;  4N8X 1;  2NVQ B;  3EJI A;  5TSS A;  4FYD A;  3A7A B;  1SBB B;  3UE0 A;  4A3J H;  4DR4 Q;  5CV5 A;  2OCE A;  1V43 A;  1WTW A;  1XPU A;  3HOV B;  1WI5 A;  5EPK A;  3CCJ A;  2MPM A;  1DYQ A;  2F0W A;  1SMY C;  3V05 A;  4IJL A;  1Q8I A;  1HHV A;  3RUZ A;  1XYI A;  2R93 B;  2ZTC A;  1XPR A;  1RD9 D;  4IUQ A;  2K03 A;  4GKK Q;  4HTH A;  2C9O A;  5KEE A;  4WJ4 A;  2ID0 A;  4IAL A;  1ICW A;  5DM7 3;  1JCK B;  1CKM A;  2NN6 H;  1RCV D;  5T1I A;  3C1E A;  1B44 D;  1PZI D;  2EZV A;  4CHT B;  4YIJ A;  5JPN C;  5EQ0 A;  2R7Z H;  2EIF A;  3DM3 A;  5LMU Q;  3E3X A;  4BBR H;  1LTA D;  1TT2 A;  2J0T D;  4NXN L;  1ET6 A;  1IBL Q;  2JYO A;  5FO9 B;  4UP7 A;  2JSO A;  1OXX K;  1KNA A;  1WTX A;  1IL8 A;  2A8V A;  1Q7Y C;  4NDX A;  2L4N A;  1K83 B;  1U5K A;  1F9S A;  3HRZ C;  4PMB A;  2AUJ D;  1JJC B;  2VB3 X;  2PO4 A;  5CV6 A;  2YU9 B;  2Z1C A;  1HR0 W;  1YJW A;  4B3R L;  4QIW B;  4L5T A;  2TMP A;  3MEF A;  3TP7 A;  4KK7 A;  4A3L H;  4A3F G;  4K2L A;  4QB4 A;  4J8Q A;  2N49 A;  1Q1E A;  4LF7 Q;  4JOI A;  2F3V A;  3D4R A;  4YWM A;  2R92 H;  4H7B A;  3H3V I;  2Q8I B;  3C1F A;  2F0V A;  2P5Z X;  1N34 L;  1PTO B;  3ULP A;  1EL0 A;  3H3V C;  1LLR D;  1VQP A;  1XMO L;  1J5E L;  2HT1 A;  3QR8 A;  4LW1 A;  5M3M B;  1G2S A;  3H6M A;  3I72 A;  3T51 B;  5JJI A;  1I50 H;  1Z47 A;  1D7Q A;  3QWN A;  1HNW Q;  4H13 C;  3GDE A;  1HUN A;  2SNM A;  1K0S A;  1WYD A;  4TVA B;  4DR6 L;  3MXN B;  4FF3 A;  5A2Q L;  1X3P A;  1A8V A;  3BZC A;  5I9P A;  2B63 B;  3CRK C;  3PUW A;  1J9O A;  4H44 C;  1CK1 A;  2ASB A;  1QB5 D;  1Y1V H;  3JAM i;  3PO3 H;  1B3A A;  4C3I H;  5M3F H;  1UEA B;  2CWA A;  1FYC A;  2MQH A;  4DV7 L;  1JIC A;  3DUZ A;  1SJH D;  3S1M H;  1BR9 A;  2MJ8 A;  1VF5 C;  3HOU H;  5ELC A;  2F4V L;  5LMN W;  3RZD B;  2N88 A;  1HR0 L;  4GNX B;  1Q1B A;  3ZJY C;  2F3W A;  1I4G A;  4A3M B;  2N55 A;  1IL2 A;  3MHB A;  5I4D A;  4JI6 L;  2RCF A;  1ESR A;  2E2H B;  5JJK A;  3NWS A;  4P74 A;  1F9Q A;  1ZYR D;  2L0C A;  1OXU A;  3HOY B;  1YHA A;  1E2V A;  1KRT A;  3PQI A;  3BDO A;  4JOI C;  1GKH A;  3CCR A;  4MNO A;  1K28 A;  3N52 A;  4LF4 L;  2A1A A;  1PLF A;  4NKL A;  5D3D A;  2WB1 G;  1HZB A;  2UUA L;  4P71 A;  3HOX B;  3Q22 A;  3C2P A;  3J81 E;  4L8J A;  4LFA Q;  2OEO A;  5IOD A;  3HEJ A;  3ERQ A;  2V4D A;  2EQS A;  3R3O A;  4DUY L;  1U9R A;  3HOV G;  3J80 E;  1TQO A;  1Y8N B;  1GHJ A;  2EPB A;  1A3V A;  1K8M A;  3H3V H;  1GO3 E;  4DV1 Q;  3BVZ A;  1Y1W G;  1ONL A;  2R93 G;  3OMG A;  2WFW A;  1H9J A;  1HPC A;  5CBE E;  3CU7 A;  2HQL A;  2JA6 B;  2CCZ A;  4K2K A;  1JOQ A;  3H09 A;  3P20 A;  1K8O A;  4HIM A;  1PFN A;  2IX3 A;  1D5Z C;  4WFN 3;  5JAV A;  5K5P A;  2IHE A;  5IWA Q;  5IT9 L;  5G3L D;  2YTY A;  2C5C A;  3W5O A;  1E3P A;  5NUC A;  1QUQ A;  4RKB A;  2R7D A;  2EY6 A;  5LMN L;  4V0B A;  1WD0 A;  1KL9 A;  4B3S Q;  3K80 C;  2E74 C;  4KY5 A;  2A6E D;  4PQX A;  4KV6 A;  3GTO H;  3DHQ A;  3GTJ H;  2XGT A;  3MXP A;  1G2T A;  1NMG A;  2XVS A;  1SMX A;  2LXK A;  4LF5 Q;  1G6P A;  1KRS A;  2R7F A;  1JOO A;  3CP0 A;  1BKB A;  2IL8 A;  2O5J C;  1NTG A;  1EY6 A;  3L9A X;  4LJZ C;  4QQB X;  1X3F A;  2B2Y C;  3BG3 A;  3ITP A;  1WTH A;  4QGU A;  4IOC A;  3NUC A;  2WKD A;  1C0A A;  2BCO A;  3I70 A;  4DR4 L;  4XT1 B;  3T13 A;  2ICI A;  4JCV E;  3DEP A;  4QUF A;  3S2H B;  1AW7 A;  1X9N A;  1NY4 A;  2X6G A;  4XTC S;  5CMD A;  2ZJR A;  4IPC A;  1O7Z A;  3M4Y A;  1SE4 A;  1IW7 D;  1N36 L;  3GTP B;  3NBH A;  1H9M A;  3S15 H;  5C44 H;  5M3M G;  2D0P A;  1X55 A;  1KAW A;  4X65 L;  1QE6 A;  3VA5 A;  2YV5 A;  4LF8 Q;  4C3J B;  5C4J B;  4MN3 A;  2EXZ A;  2OT2 A;  4LNQ A;  3A8I E;  3GTQ B;  1IBL L;  1N33 L;  3P1H A;  1V1P A;  3L2P A;  2KBN A;  3MFG A;  1GUN A;  4UPA A;  5C3W A;  2D9U A;  3STB D;  1Q8K A;  2DGY A;  3NK9 A;  5L37 A;  2G9D A;  5AJ3 Q;  2B63 G;  2GVB A;  3PIP A;  1ZYR C;  1J6Q A;  4K8J A;  1I4X A;  4JI3 L;  2EYL A;  2ZT9 C;  4EX5 A;  3X3M A;  1CHQ D;  1S40 A;  3BZD B;  4CKC A;  3I4N H;  1EY7 A;  1UWV A;  4V19 0;  5HUR A;  4ME3 A;  1K3R A;  5CC4 A;  3CHB D;  3SEB A;  4K0K L;  1RF2 D;  2OQ0 A;  1TS4 A;  4BA2 I;  1IXR A;  1D8L A;  4DR3 L;  1XPO A;  3KBX A;  3AEV A;  2NBF A;  2IJ0 A;  2KUM A;  1BO0 A;  3JAM c;  3BDL A;  3CCL A;  1KLG D;  4Y7N B;  1D6E C;  3OMC A;  5COY A;  3PO2 B;  1ASZ A;  3VR4 A;  3HOY G;  3LWU A;  1HFG A;  1AZP A;  4IPD A;  5C6A A;  1K9M C;  2B2T C;  1I4R A;  3M3Y B;  3Q6S A;  2F0D A;  1U0L A;  3S1N H;  1PTO C;  3VR3 A;  1PHJ A;  4JBK A;  4RG1 A;  1RTO A;  2Q8T A;  4JC0 A;  3K81 C;  1EY0 A;  3D3R A;  4DR2 Q;  2B3G A;  1VQC A; 
#chains in the Genus database with same CATH homology
 4YHH L;  3RLF A;  4DV2 Q;  1HNW L;  2CQO A;  3HOX G;  1S3O A;  4A3G H;  3LGJ A;  4IJH A;  3UE1 A;  1N33 Q;  1PH6 A;  3GTM H;  3A5U A;  1E7Z A;  1PH9 A;  2MNA A;  1YHQ A;  3RNU A;  1HZA A;  3HOV H;  3WWV A;  4AQY Q;  2D62 A;  5GRO A;  3M4O H;  4JV5 L;  4J15 A;  4JI1 Q;  2R92 G;  1KQS A;  5DLQ E;  4BY1 G;  2NVT H;  2ZJQ A;  3HFZ B;  3PUX A;  4PZ8 A;  3S1R H;  4JI3 Q;  3F2C A;  1P16 A;  2B29 A;  3GTG H;  2MFI A;  4DV5 L;  2K5H A;  2R93 H;  1PH7 A;  4ALP A;  2KEN A;  3TQY A;  2A19 A;  4BBS G;  1Z9F A;  4DNI A;  4O0A A;  4JI5 Q;  2JA7 H;  4C2M H;  1R9T H;  3AFP A;  4LFC L;  3CCM A;  1I94 Q;  2Q2I A;  2UUC Q;  2NN6 I;  3FP9 A;  1K8G A;  2JA6 G;  1XMQ Q;  2UUA Q;  4A3I G;  2IT1 A;  4DV4 Q;  4LF9 L;  1PH5 A;  3G6E A;  1N32 L;  1HNX L;  1VQ7 A;  1Q82 C;  4K0K Q;  1WJJ A;  4JYA L;  5HGQ A;  4IPG A;  3D0F A;  2FXQ A;  2BH2 A;  3OW2 A;  1Q12 A;  2LSS A;  1TWF H;  4DR3 Q;  1FJG Q;  3A5Z B;  3RN2 A;  2H5X A;  4POF A;  1X56 A;  4DUY Q;  2JEA I;  4A3B G;  1KXL A;  1LM0 A;  4GNX C;  1Y14 B;  2JE6 I;  3HOZ H;  4GOP C;  4BY1 H;  4GS3 A;  2QEX A;  2KHI A;  1VQ4 A;  4OON A;  5M5Y H;  4B3T L;  4JI7 L;  4A3E G;  4DAY B;  4PG3 A;  2UUB L;  4DR7 L;  1PH4 A;  2JQO A;  3K0X A;  4Y52 H;  1TWA H;  1Y1V G;  3U4V A;  3HKZ E;  3NEN A;  4GN4 B;  5H1S E;  2ZM6 Q;  2Y0S E;  5C0X G;  3PO3 G;  4BBS H;  3CCE A;  1I6H H;  3S16 H;  1K83 H;  1SRU A;  4AYB G;  1QVG A;  1WFQ A;  4X64 L;  4DPG A;  5M3F G;  1AE3 A;  3KF6 B;  2QA4 A;  3PUV A;  1RL2 A;  4GKK L;  1HNZ Q;  3GTP H;  3U58 A;  1PYB A;  4JBJ A;  4A3I H;  1KIX A;  2GN5 A;  1PH3 A;  2MO0 A;  4QJF A;  5C3E H;  2XTI A;  2YU9 H;  1UEB A;  2KHJ A;  3HOU G;  3OTO L;  1A63 A;  3AFQ A;  4YHH Q;  3PF5 A;  1IZ6 A;  1EQR A;  4AH6 A;  2IHF A;  3I4O A;  2K5N A;  1KD1 C;  4LF6 L;  4OO1 G;  4L5S A;  4MZ9 A;  4R4Q A;  1XTD A;  4DV6 Q;  4A3J G;  1I3Q H;  3GD7 A;  2VNU D;  3CCS A;  3W1B A;  5LMU L;  2IX1 A;  5LMN Q;  1BBU A;  3T1H Q;  1NJI C;  2OQK A;  2VUM H;  4KHP L;  1QZG A;  1HH2 P;  2HIV A;  3UDI A;  1AH9 A;  2HIX A;  4YCV A;  3K7U C;  2PI2 A;  4DV5 Q;  3KF6 A;  1NBW A;  3HKZ G;  1X3E A;  5GAG C;  1PFS A;  4PMW A;  3S1Q H;  4DK6 C;  1G51 A;  2AWN A;  3D31 A;  3F2D A;  4DUZ L;  4WJ3 M;  1YHB A;  2AWO A;  3TS0 A;  4B3M L;  3BJU A;  2NZO A;  2F3I A;  2WAQ E;  1TWG H;  2N8N A;  2WB1 E;  3ERS X;  3NEL A;  5FLX c;  4LF9 Q;  2UXD L;  1N32 Q;  1LTL A;  1C9O A;  5E7N A;  5M3M H;  5IWA L;  1KHI A;  4A4I A;  1FL0 A;  3CMA A;  3UE0 A;  2PNH A;  4A3J H;  4DR4 Q;  4C3H H;  4X6A H;  2OCE A;  1V43 A;  3RN5 A;  1XPU A;  3CAM A;  5JEA J;  2JJQ A;  1WI5 A;  3CCJ A;  4DV0 L;  1E1O A;  4A3M G;  2YTV A;  1W2B A;  2ES2 A;  3S2D H;  4LUO A;  1H95 A;  5ELO A;  4PZ7 A;  2I0Q A;  1YEZ A;  2UUB Q;  2UU9 Q;  3CQZ H;  4IJL A;  4B3S L;  4LF7 L;  1GVP A;  3I4M G;  1VQE A;  1VS0 A;  2VQE L;  4APV A;  2I5H A;  2ZTC A;  4LFB L;  3FKI H;  2B63 H;  5JJL A;  1TWC H;  1XPR A;  1YJ9 A;  2E2J H;  1DGS A;  1L1O B;  4GKK Q;  1B70 B;  1MIU A;  4DKA C;  1EUJ A;  2VQF Q;  3H15 A;  3CD6 A;  2UXC Q;  4WJ4 A;  2ID0 A;  3T1Y Q;  2CFM A;  3CPF A;  2WAQ G;  4A3K H;  2VY3 A;  4HJ7 A;  3G71 A;  5GQO A;  1CKM A;  2KCM A;  4QL5 A;  1K8A C;  3J81 c;  1AE2 A;  4RMF A;  1O7I A;  3PCO B;  4LF6 Q;  1V1Q A;  1YZ6 A;  3L7Z C;  4A3C H;  2R7Z H;  2EIF A;  4OO1 I;  3M4P A;  3KJO A;  3DM3 A;  3RZD H;  1GM5 A;  3TS2 A;  4LWC A;  5IP9 G;  2E8G A;  5LMU Q;  2HHH Q;  1PH8 A;  3J80 c;  4BBR H;  4A3M H;  1MJC A;  3CCU A;  4NXN L;  4IFD J;  1IBL Q;  1CSQ A;  1YI2 A;  1JMC A;  4UP7 A;  3E9I A;  3DLL A;  1OXX K;  1L1O A;  3I2Z A;  2A8V A;  2CKZ B;  4IPH A;  3JC6 6;  1Q7Y C;  3PIO A;  2E2H H;  2ALY B;  2OWO A;  5M5X H;  1U5K A;  2JA9 A;  3SGI A;  3HOY H;  2YYZ A;  5IYC G;  3PO2 G;  4YWK A;  1JJC B;  3ULJ A;  1Q46 A;  4A3D G;  3F1Z A;  1HR0 W;  1YJW A;  4B3R L;  5FLM G;  4X66 L;  3J7Z C;  1XNR Q;  4L5T A;  2D0O A;  4QY7 A;  3MEF A;  4R4C A;  4OWX B;  2E5L L;  2Q2U A;  4A3L H;  4JI0 Q;  4A3F G;  4A93 H;  5IYB G;  4DR5 Q;  2K4K A;  1UE1 A;  3W1G A;  3G4S A;  3HOX H;  4L5Q A;  1KC8 C;  4DV0 Q;  4GLV B;  4YY3 L;  4BY7 G;  2WP8 J;  2N49 A;  1Q1E A;  1SE8 A;  5IE8 A;  2JA8 G;  3HKS A;  1SN8 A;  2QGQ A;  4LF7 Q;  5ELN A;  2K14 A;  4JOI A;  4LUZ A;  4R4O A;  2VQE Q;  4OX9 L;  2NZH A;  4FDB A;  3F8T A;  3K8A A;  4YWM A;  1NE3 A;  3I55 A;  4L5R C;  3CF5 A;  2R92 H;  5IYC H;  4P72 A;  5IP7 G;  3H3V I;  5AJ3 L;  1IBK L;  5FJ8 G;  3PGZ A;  4A3D H;  1N34 L;  3ULP A;  3IRB A;  1CKO A;  5FLM H;  1VQP A;  1XMO L;  1J5E L;  1UE6 A;  2HT1 A;  2PI2 E;  4LW1 A;  3EIV A;  4A3F H;  2UXB L;  4JI8 L;  2JA6 H;  4UY8 C;  4BXX H;  1L0W A;  2PMZ E;  2KCT A;  4GN3 B;  5JJI A;  4DAM A;  1I50 H;  4NXM Q;  3K7A H;  1Z47 A;  1C7Y A;  1D7Q A;  2JA5 G;  2Q2H A;  1HNW Q;  2JA8 H;  3E9H A;  3GDE A;  1IBM L;  1WYD A;  4GN5 A;  3J7A 5;  4TVA B;  4DR6 L;  2VL6 A;  1CKN B;  3MXN B;  4JBM A;  4LFA L;  4A3B H;  1VQL A;  3CC4 A;  1E1T A;  1EIF A;  1A8V A;  3BZC A;  1A62 A;  4JV5 Q;  3PUW A;  1RIP A;  1X65 A;  4A3E H;  2ASB A;  3RLN A;  3U50 C;  3JAM i;  1Y1V H;  2Z6K A;  1VQC A;  3PO3 H;  4IOA A;  4C3I H;  5M3F H;  4DV1 L;  3BZK A;  3CPW A;  2Y0S G;  1IYJ B;  1XNQ L;  2CWA A;  3EBE A;  5C4X G;  1PVO A;  1JE5 A;  2MQH A;  4DV7 L;  4LFC Q;  3S1M H;  1PYS B;  2MO1 A;  3RLO A;  4R4T A;  3HOU H;  2ZTE A;  2F4V L;  2BH8 A;  3S17 H;  4PZ6 A;  5LMN W;  2V1C C;  1HNX Q;  4HJA A;  4HIK A;  1YJN A;  4DR2 L;  1CKN A;  1VQJ A;  4YY3 Q;  1SFO H;  1HR0 L;  4JYA Q;  4GNX B;  4GLX A;  1Q1B A;  3ZJY C;  2EXD A;  4DV3 L;  4GOP B;  1IL2 A;  3TRE A;  3KLW A;  4OX9 Q;  1JJG A;  1YBY A;  1WCM G;  2OTL A;  4JI6 L;  3GO5 A;  1VQH A;  2PQA B;  3OYY A;  1PH1 A;  4JI7 Q;  5JJK A;  1LUZ A;  4B3T Q;  2NVY H;  1VQM A;  2GVA A;  4P74 A;  3J81 j;  3S2H H;  3KJP A;  4JI1 L;  4DR7 Q;  5EAY A;  3I56 A;  1OXU A;  1YHA A;  5K36 G;  2CWP A;  1QVF A;  1KRT A;  1XMO Q;  2K52 A;  4JOI C;  1A0I A;  2L15 A;  2ZTD A;  4X64 Q;  1GKH A;  3CCR A;  2R6G A;  1QZH A;  4JI8 Q;  4MNO A;  4H02 A;  4HIO A;  4LF5 L;  4JI4 L;  2RF4 A;  4LF4 L;  1OXV A;  2A1A A;  4HJ5 A;  2C35 B;  1HZ9 A;  3UDX A;  1X3G A;  1B8A A;  4GNX A;  3OTO Q;  2UUC L;  1EWI A;  1XMQ L;  2I5L X;  2WB1 G;  1HZB A;  3CCQ A;  4GOP A;  4DV4 L;  5IY0 A;  1CSP A;  2UUA L;  4JI2 L;  4P71 A;  5JEA G;  3AYH B;  4BXX G;  4R1J A;  1YIJ A;  1X54 A;  2PQA A;  4DR6 Q;  4LFA Q;  4DR1 L;  1EOV A;  2E2I H;  3ULL A;  1W3S A;  4A3G G;  1FJG L;  1I5F A;  1VQN A;  4C3J H;  5C4J H;  2EQS A;  1I94 L;  4DUY L;  1UE7 A;  4KHP Q;  3HOV G;  1SRO A;  4OXP A;  4X62 L;  3I4M H;  1QUQ B;  3GTQ H;  2LXJ A;  4OWT B;  1FVI A;  2RHQ B;  1PV4 A;  1N8R C;  3H3V H;  1GO3 E;  2F52 A;  4XIG S;  2JEB I;  4KLK A;  4YCW A;  2ZM6 L;  4DV1 Q;  1Y1W G;  2IY5 B;  2Z0S A;  3UDG A;  1XNQ Q;  2R93 G;  1VQO A;  2WFW A;  4DUZ Q;  2VZA A;  1ASY A;  4B3M Q;  1L2F A;  1VQF A;  2JA7 G;  4KI0 A;  2HQL A;  2CCZ A;  2RHS B;  1HNZ L;  1E24 A;  2UXD Q;  2F4V Q;  1TXY A;  2AHO B;  2Z6K C;  2AMC B;  4HIM A;  1JT8 A;  3L0O A;  1BVS A;  3E0E A;  3TEH B;  2IHE A;  3I7F A;  4QIW E;  5IWA Q;  4A76 A;  2NVQ H;  1MKH A;  1HJP A;  4DV3 Q;  2YTY A;  3W5O A;  4IFD G;  1HZC A;  4UP9 A;  5IP9 H;  3S14 H;  3CC7 A;  3PSI A;  1E3P A;  4JI6 Q;  1QUQ A;  4DV6 L;  4LF8 L;  5BR8 L;  4TQU S;  2R7D A;  3RZO H;  3U4Z A;  5LMN L;  3T1H L;  3HOZ G;  1KL9 A;  4P75 A;  4B3S Q;  3K80 C;  1Y1W H;  4LFB Q;  3CW2 C;  1VQA A;  4AYB E;  4Y7N H;  1PA6 A;  3GTJ H;  3GTO H;  2XGT A;  4NB3 A;  1TWH H;  3PO2 H;  1NMG A;  4LF5 Q;  1SMX A;  2LXK A;  4NPS A;  4YCU A;  1KRS A;  4JI4 Q;  4LF4 Q;  3GTL H;  2R7F A;  4IO9 A;  3CP0 A;  1BKB A;  2N78 A;  5C0X J;  3CXC A;  1SR3 A;  1NTG A;  1VQI A;  1B7Y B;  4JI2 Q;  3HOW G;  1JB7 A;  4QQB X;  3A0J A;  3ER0 A;  5C3E G;  1X3F A;  3M3Y H;  1FGU A;  5IYB H;  2DUD A;  4R4I A;  3NEM A;  1QVC A;  4QGU A;  4IOC A;  4DR1 Q;  3G48 A;  1C0A A;  3NBH B;  5C44 G;  3B6Y A;  4DR4 L;  4BY7 H;  3KYH C;  1GD7 A;  4JCV E;  4X62 Q;  5M5W H;  3F2B A;  4HJ8 A;  4NXN Q;  2VUM G;  4BA1 I;  2UU9 L;  2N3S A;  1E22 A;  1NY4 A;  1X9N A;  3VDY A;  1EQQ A;  2Q2T A;  3KOJ A;  4GKJ L;  3GTK H;  4UP8 A;  5IP7 H;  1M1K C;  1MJE A;  2K50 A;  3TRZ A;  4XTC S;  5FJ8 H;  2ZJR A;  4IPC A;  3KF8 B;  3KFU A;  1OTC A;  3AQQ A;  2VQF L;  2YTX A;  1N36 L;  3HOW H;  2UXC L;  4AIM A;  3T1Y L;  1Q86 C;  4B3R Q;  2RCN A;  3BU2 A;  1YNX A;  4X66 Q;  5GAD C;  4HID A;  1VQ5 A;  2ATW A;  1L1O C;  2E5L Q;  3I4N G;  3S15 H;  2VS1 A;  5C44 H;  3PUY A;  4GLA C;  5M3M G;  2D0P A;  1X55 A;  2K5V A;  1KAW A;  2IX0 A;  3Q8D A;  4X65 L;  3J81 i;  2ZJP A;  1VQ8 A;  2JA5 H;  1XJV A;  5IYD G;  4IFD I;  2YV5 A;  5IT9 c;  2BA0 A;  4LF8 Q;  5BR8 Q;  2HHH L;  1VQ9 A;  4LNQ A;  3ICE A;  4DV2 L;  2OTJ A;  3FHW A;  4O2D A;  1T9H A;  3J80 i;  1S72 A;  1IBL L;  3EN2 A;  1N33 L;  3L2P A;  1VQB A;  2KBN A;  1K0R A;  1K73 C;  2JK8 A;  3KDF B;  1VQK A;  4UPA A;  5HY6 A;  5GAE C;  3STB D;  1Q8K A;  3STB C;  4HJ9 A;  4AQY L;  2DGY A;  2BA1 A;  3FKI G;  5J3B A;  5AJ3 Q;  1IBK Q;  5GAH C;  2GVB A;  2B63 G;  3PIP A;  1N34 Q;  1J6Q A;  4JI3 L;  4EX5 A;  5C4X H;  1NMF A;  1J5E Q;  1UE5 A;  1S40 A;  3H0G G;  3CCV A;  3I4N H;  4A3K G;  1UWV A;  4JI5 L;  1XNR L;  1VQG A;  2NN6 G;  4MTN A;  4A75 A;  1VCI A;  4ME3 A;  4KHZ A;  4JI0 L;  1K3R A;  1P8L A;  5IYD H;  3M7N A;  4DR5 L;  4POG A;  1LYL A;  1M90 C;  4A3C G;  3S24 A;  3A74 A;  2R7Z G;  3PF4 A;  1IBM Q;  3UDF A;  4JBW A;  4K0K L;  1OXS C;  3KDF A;  4BBR G;  1G6P A;  2OQ0 A;  1WCM H;  3RR5 A;  4BA2 I;  2I5M X;  4JG2 A;  1IXR A;  1D8L A;  1VQD A;  1WOC A;  4LUV A;  2VW9 A;  4DR3 L;  1XPO A;  2NVX H;  3AEV A;  1YVC A;  4GKJ Q;  2AKW B;  3M4Q A;  1EYG A;  4NXM L;  3JAM c;  3PUZ A;  3CCL A;  1V9P A;  5C0X I;  1EFW A;  1ASZ A;  1VQ6 A;  3CME A;  1N36 Q;  1PH2 A;  1JJ2 A;  3HOY G;  3H0G H;  4EQ5 A;  4P73 A;  1CUK A;  4DV7 Q;  4IPD A;  3M85 A;  1K9M C;  2K75 A;  1BBW A;  3PV0 A;  1Q81 C;  1U0L A;  3S1N H;  1EIY B;  1PHJ A;  1OXT A;  1X6O A;  3M9B A;  4DK3 C;  4YWL A;  1N9W A;  4X65 Q;  4RG1 A;  3CC2 A;  4JBK A;  4A3L G;  4A93 G;  4JC0 A;  3K81 C;  2UXB Q;  1G29 1;  4OWW B;  4DR2 Q;  1YIT A;  2B3G A;  1HR0 Q;  1SLJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...