4KHPQ

Structure of the thermus thermophilus 30s ribosomal subunit in complex with de-6-msa-pactamycin
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
99
structure length
99
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S Ribosomal RNA
publication title Crystal Structure of a Bioactive Pactamycin Analog Bound to the 30S Ribosomal Subunit.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 22
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4khpQ00
3KF6A 4R4CA 3CXCA 4LF6Q 4A3BG 4BY7G 1M90C 4PZ6A 3J80i 1XNQQ 2OWOA 1XNRQ 4GN4B 1EYGA 1YJWA 4P74A 4JI1Q 4LNQA 2R92G 3GTLH 1L1OC 3D31A 3CCRA 1KXLA 2D0OA 3PO3H 2E5LQ 4JI6L 1NBWA 4DV4L 2VL6A 4J15A 1YBYA 1Q1BA 3H0GG 4GN3B 1PH2A 3OW2A 1HH2P 3CW2C 4ME3A 5H1SE 4HIDA 1NMFA 3G6EA 1O7IA 1XMOQ 3KOJA 3CF5A 1Q81C 4DV0Q 1X3FA 3M85A 3VDYA 1KC8C 3KJPA 3HOXG 1PH5A 2N8NA 4KHZA 2LXKA 5C4XH 2NZOA 5IYBH 4HIOA 2R7ZH 1NMGA 4A3MH 4B3RL 3RLNA 3ZJYC 2AWNA 4A3KH 1HNZL 3CC4A 4B3TL 3K81C 1PYBA 4GKJQ 1JB7A 2E5LL 4YCWA 4X64L 2VUMH 2ALYB 3HOUG 4IJLA 1X6OA 2HIXA 1WJJA 1YITA 1UE6A 1BBWA 2UXBL 4JI0Q 4GKKL 1E24A 2GVAA 4B3MQ 4BXXH 1A8VA 5FJ8H 2K5HA 2UU9L 4JI7Q 1GO3E 2F4VL 4PZ7A 4LF9L 4DR6Q 1HNWQ 3HOZG 3RN2A 4YCVA 1K8GA 4IFDG 4YHHQ 4HJ7A 1I50H 1UE1A 1NJIC 4IJHA 2A1AA 4LF8L 1OXSC 1SMXA 1GKHA 1Q86C 1FL0A 1A63A 3T1YL 3MXNB 4O0AA 3ERSX 4P72A 3HKZG 4A3JG 2YV5A 1G6PA 3K7AH 1YZ6A 2YTYA 4DK6C 4JOIC 2IX1A 1FJGL 2KCMA 3CPFA 4JI3L 4QGUA 1V43A 2PI2E 1N34L 1S3OA 1TWAH 4KHPL 2AWOA 4DV1Q 2RHQB 4X66Q 4OO1I 4DV2L 4DR3L 4A3EG 5GAEC 1IYJB 1XPUA 3GO5A 1K0RA 1Q12A 1I94Q 3RLFA 4YY3Q 3HOVG 1EFWA 3S1MH 3E0EA 1EIYB 1VQPA 1EWIA 5M3MG 3GTPH 4UPAA 4A3FG 1N33Q 1J5EL 2CCZA 4UP9A 5M3FG 3I4MG 3GTKH 4BY1G 1V1QA 3PO2G 1XMQQ 2NVQH 4PG3A 3I56A 1Y1WH 3BU2A 3KLWA 3CCQA 1IBKQ 2ZTCA 1VQ4A 2B29A 2UUBQ 2B63H 3H15A 4LFBL 4IFDJ 4BBRH 4HJAA 4IPCA 2KCTA 1TWGH 2EQSA 1KQSA 2ATWA 4IFDI 4HJ9A 2Z6KA 1T9HA 2ZTDA 5LMNW 4LF5Q 3HOWG 1Q7YC 5JJLA 1H95A 1L2FA 2UXCQ 1ASZA 4DKAC 2DUDA 2KHIA 1QUQA 3A0JA 5ELOA 2JA8H 2BH8A 1N33L 4DR5L 2HQLA 4LFAQ 3CPWA 1QVGA 4IOAA 1X54A 4OONA 1Z47A 1Y1VH 5AJ3L 1IXRA 4A3IG 4A3LH 4R4IA 2ZJPA 3BJUA 5K36G 2HHHQ 3A74A 4AYBE 4A93G 4R4TA 3I7FA 3G4SA 2ZJQA 1MIUA 1G51A 4Y7NH 4JYAL 2MO0A 4R1JA 1L1OA 3U50C 1K73C 2IX0A 4LF4Q 5C0XG 4MNOA 2JA9A 4AQYQ 4AYBG 2JA7H 5GAHC 3M7NA 1LUZA 3ULPA 4O2DA 1SROA 1EQRA 4BY7H 2EIFA 3NENA 2JEBI 2NVXH 4JV5Q 4DR7L 1E1TA 1YIJA 5JJIA 1IBLL 2L15A 1CSQA 4HJ8A 2Q2IA 1GD7A 5IYCG 2N78A 1N36L 3JAMi 3PUZA 1PH9A 3FHWA 5HY6A 4TQUS 5C44G 2YYZA 1M1KC 1VQ6A 4C3JH 4JBMA 4L5QA 2JA5G 1CKMA 2Y0SE 3CCLA 3FP9A 4DR2Q 1FVIA 4DUYQ 3K0XA 2UUCL 1VQ7A 1SN8A 3I2ZA 4C3HH 3NBHB 3A5ZB 1AE2A 1OXTA 4IPDA 1SE8A 5GQOA 4DV6L 2WP8J 1KD1C 3HOVH 1LM0A 1HNXQ 3FKIG 1U0LA 2Y0SG 1JJGA 5GROA 1SRUA 3RNUA 3HFZB 5FLMH 1QZGA 1HR0W 1CKNA 4X65Q 3GTOH 2VNUD 3E9HA 2RF4A 2VQFQ 5C0XJ 1YI2A 5C0XI 2KHJA 4A3DH 3ICEA 1A62A 1Y14B 2YTXA 5GADC 4JOIA 2I5LX 4XTCS 1MJEA 1VS0A 1HZBA 2NVTH 1I5FA 4X62L 3E9IA 4JI5Q 2PQAA 1GM5A 1WCMH 3HOZH 2KENA 3PUXA 1CSPA 1N32L 5C3EG 3UDXA 2E2IH 4JI2L 1VQNA 1K9MC 3F2DA 4LF6L 1X3GA 3DM3A 3UDFA 3STBC 1X56A 2QGQA 4EQ5A 2VQFL 1XNQL 1XNRL 4FDBA 4OO1G 2JA6G 1RIPA 4GN5A 4JI1L 2ASBA 1AH9A 1YHBA 5IP7G 3HOYG 1I3QH 5LMNQ 3GTQH 1CUKA 1PV4A 3S2DH 1MJCA 4NXMQ 4JC0A 4A3GH 2Z0SA 1XMOL 4OWXB 4PMWA 4GNXB 4DK3C 3D0FA 1WFQA 4EX5A 4DV0L 4POGA 5IWAQ 2BH2A 2K5VA 2K75A 3KYHC 2NN6G 2PI2A 5M5XH 4GOPB 3T1HQ 3J81j 3HKZE 1OTCA 4LF7Q 4X6AH 2R6GA 2I5HA 3M4QA 4JI8Q 3RLOA 3I4MH 2ZM6Q 4GKJL 1UWVA 4BY1H 3CC2A 1Q46A 3AFQA 1EUJA 4BA2I 4JI0L 4B3ML 1K83H 5IP9H 5C4JH 4JI7L 4TVAB 3F1ZA 3PSIA 4GLAC 1TWFH 4K0KQ 4DR6L 1KHIA 1QZHA 1HNWL 3S1RH 4YCUA 3PO3G 1VQKA 4KI0A 4YHHL 3S1QH 1UE7A 4XIGS 2Q2HA 1YVCA 1EQQA 2I5MX 1ASYA 1PH6A 1VQDA 2VQEQ 1JT8A 1Q82C 3CCSA 3TRZA 3CCMA 4POFA 4LWCA 3PGZA 5C4XG 1XJVA 1KL9A 1YEZA 3K7UC 3JAMc 5IYBG 1VQGA 3PF5A 4OX9Q 2I0QA 4Y52H 4A3MG 5M5YH 4WJ4A 1VQ9A 1NY4A 2VY3A 1VQIA 4LUOA 3J7A5 5IYDG 3CCJA 1X55A 2NN6I 4C3IH 4DV1L 4X66L 4DR1Q 2VUMG 3CP0A 2VW9A 3CC7A 2E2JH 1QUQB 1HR0Q 4BXXG 1VQFA 2H5XA 1X3EA 2R7DA 4ALPA 4RG1A 1R9TH 1C0AA 5FJ8G 1I94L 4YY3L 3S15H 4UY8C 3TEHB 3S2HH 3EN2A 4OX9L 4HJ5A 4LFCQ 5ELNA 3OTOQ 3J80c 1VQ8A 3Q8DA 1XMQL 1I6HH 3UDGA 1IBKL 1U5KA 1HZCA 4YWMA 2JEAI 2UUBL 1L1OB 1PHJA 4R4QA 2MFIA 3UDIA 4HIMA 2OQKA 1C9OA 4LF5L 4BBSG 2V1CC 2OTLA 2R93G 2UXCL 3FKIH 4QJFA 4C2MH 1B70B 4GNXC 3IRBA 2WB1G 4DUZQ 4LFAL 4A3BH 1YHQA 2HT1A 3W1GA 4A4IA 4GOPC 1OXXK 4B3SQ 1VQMA 2EXDA 2GVBA 2HHHL 1C7YA 3B6YA 3TS0A 1SR3A 3NELA 3L7ZC 2R92H 4PZ8A 3WWVA 1DGSA 1UEBA 4QY7A 4LF4L 1W3SA 2ZTEA 4AQYL 3GDEA 1IBMQ 3MEFA 1Y1WG 2OQ0A 3CQZH 3H0GH 2F3IA 2Q2TA 4JI4Q 4QIWE 3W1BA 4DV7Q 4BBRG 4DPGA 3TS2A 3S17H 3HOXH 5BR8Q 3KF6B 5HGQA 4B3SL 3M4OH 1CKNB 3GTMH 4JV5L 2E2HH 4IO9A 2VZAA 4DV5Q 1VQLA 4JBKA 2UXDQ 3PV0A 2QA4A 4DV3Q 1QVCA 4NXNQ 5IP7H 5JEAJ 2JA8G 3I4NG 3CCUA 3CD6A 3K8AA 3HOUH 1PH8A 3AQQA 2IHEA 3ULLA 1EIFA 4DR2L 1PH1A 1TWHH 3PCOB 1J6QA 1Y1VG 4BA1I 4DUYL 4A3LG 4AH6A 3CCEA 1K3RA 4QQBX 2IT1A 2JK8A 3PUYA 2DGYA 2R7FA 1LTLA 3OYYA 1BKBA 1VQOA 1HNXL 1L0WA 3KDFA 3CCVA 3EIVA 3I4OA 4UP7A 2MO1A 2UXDL 3UE1A 1B8AA 1E3PA 2XTIA 5LMUQ 2BA0A 1OXUA 4DV3L 1YNXA 4JI6Q 3ER0A 4H02A 2NZHA 2JA7G 4X65L 2LSSA 1X9NA 2MNAA 4A3CG 4YWKA 1KIXA 4OWWB 1JMCA 3GD7A 3HKSA 2C35B 5E7NA 4A3JH 2NVYH 4GLVB 3H3VI 4B3RQ 1HNZQ 3CMEA 4B3TQ 1X65A 1MKHA 4JI5L 1FGUA 4MZ9A 3U4ZA 4X64Q 5LMUL 1PH4A 2WFWA 1HJPA 1JJCB 4NB3A 4A3EH 2UXBQ 4GKKQ 4RMFA 2D0PA 4YWLA 4L5TA 2UU9Q 2LXJA 2F4VQ 3SGIA 4JBJA 4KLKA 3STBD 1K8AC 1VQCA 4LF9Q 5M3MH 1IZ6A 4MTNA 1VQJA 4DAMA 4A3FH 2KBNA 5FLMG 3RZDH 5M3FH 5LMNL 3PO2H 1Q8KA 4LF8Q 3RN5A 4APVA 3CMAA 4JI4L 2YTVA 3RZOH 2CWAA 3J81i 4NXML 2A8VA 3T1YQ 5DLQE 4L5RC 2HIVA 4A3DG 3HOWH 1NE3A 4LUZA 5IWAL 5GAGC 2B3GA 2JE6I 2CFMA 3F8TA 1N8RC 1FJGQ 3U58A 2FXQA 1YJ9A 3T1HL 3I55A 1XPOA 4WJ3M 4JI3Q 1KAWA 4LF7L 1NTGA 1N34Q 1WCMG 1CKOA 4KHPQ 2RHSB 3L0OA 1G291 5EAYA 4JI8L 4GNXA 1IL2A 2ZM6L 3F2BA 3K80C 3KF8B 4DV2Q 4DR3Q 4R4OA 4A3IH 4GOPA 1YHAA 2ID0A 1N9WA 4A76A 2F52A 2R7ZG 4A93H 3LGJA 2CKZB 1TWCH 4P71A 3PIOA 4A3KG 2ZJRA 4BBSH 4K0KL 2A19A 2R93H 3F2CA 1J5EQ 1GVPA 3TQYA 1W2BA 5IYDH 3ULJA 2VQEL 2PMZE 4LFBQ 2WAQE 1P16A 3S16H 4HIKA 4A3GG 4LW1A 2K14A 1VQEA 4IOCA 3PIPA 3NEMA 1PVOA 1E7ZA 3W5OA 5IYCH 2PNHA 3AFPA 2WAQG 2K50A 2JQOA 5C44H 1S72A 1PYSB 2IY5B 1PFSA 4OWTB 4L5SA 4OXPA 4A75A 4DR5Q 2JA5H 1WYDA 3JC66 2GN5A 2IHFA 3AYHB 1XTDA 2OCEA 3GTJH 4DR1L 5AJ3Q 2UUAQ 2BA1A 4JBWA 2K4KA 4JCVE 4QL5A 3M9BA 1E22A 2WB1E 5JEAG 4GLXA 1HR0L 3H3VH 3S1NH 3BZCA 5IP9G 1WI5A 1VQAA 4JYAQ 1TXYA 2CWPA 2JJQA 4LFCL 1LYLA 3OTOL 1XPRA 5M5WH 5IT9c 3TREA 1PH3A 3UE0A 3I4NH 1VQBA 1KRSA 1EOVA 3KFUA 2UUAL 2AHOB 3M4PA 4DR7Q 3CAMA 3PUVA 1VQHA 3G48A 4IPGA 4DAYB 2QEXA 1PH7A 1IBLQ 2VS1A 1N36Q 2D62A 1RL2A 4GS3A 5IY0A 3J7ZC 2ES2A 1SFOH 3PF4A 1Q1EA 2B63G 3GTGH 1B7YB 5C3EH 4P75A 1SLJA 1D8LA 1HZAA 4AIMA 3G71A 4DUZL 1VCIA 3KJOA 1QVFA 2UUCQ 1BBUA 3S14H 1UE5A 1YJNA 2OTJA 2XGTA 4DV6Q 4A3CH 5IE8A 2JA6H 5JJKA 1OXVA 2K5NA 4IPHA 4JG2A 4DNIA 4DR4Q 1A0IA 3M3YH 2MQHA 1KRTA 3HOYH 1HZ9A 1P8LA 3RR5A 2N49A 3S24A 3U4VA 3J81c 1IBML 1BVSA 1JE5A 3EBEA 4NPSA 3DLLA 1JJ2A 2Q2UA 3AEVA 1E1OA 2AKWB 2AMCB 3KDFB 2YU9H 1D7QA 1V9PA 2PQAB 2E8GA 2K52A 1AE3A 3PUWA 5J3BA 3A5UA 2CQOA 3L2PA 4DV7L 2Z6KC 4UP8A 3BZKA 1VQ5A 5BR8L 2N3SA 4LUVA 4DV5L 1PA6A 4DV4Q 4X62Q 1S40A 4NXNL 4DR4L 1WOCA 2RCNA 1N32Q 5FLXc 4JI2Q 4P73A 1Z9FA
chains in the Genus database with same CATH superfamily
3CXCA 4BY7G 1TS2A 1CA5A 2NVYB 4GN4B 1VDZA 1EYCA 2KVMA 4RHRA 2R92G 3GTLH 1L0YB 3D31A 5M9OA 3PO3H 4JI6L 1MHWC 1R4PB 2VL6A 2K32A 2SDFA 4B08A 1HH2P 4H0LC 1NMFA 3KOJA 3CF5A 3PQIA 1FNUA 2R7ZH 1JWUD 1CM9A 5CC4A 2EYHA 1K83B 4IN3A 4GKJQ 3HOWB 2VUMH 2ALYB 4KTAA 1WJJA 4EQPA 4R8NA 1GUWA 2UXBL 2GVAA 4B3MQ 1RTNA 2MP1A 5FJ8H 2UU9L 3P20A 1SYGA 1HNWQ 2A6HD 3HOZG 2SNMA 3RN2A 4OIKA 5CV4A 4IJHA 4LF8L 2K5WA 2BCOA 1FL0A 4X3SA 5I4DA 4O0AA 3ERSX 1B3QA 2RBMA 2YV5A 2CH4A 1G6PA 2YTYA 1LT5D 1FJGL 2KCMA 1LACA 3S16B 3KLSX 4QGUA 1V43A 2NTSA 2XRSD 1N34L 4X3UA 2AWOA 3EROA 4LJZC 2J7ZA 2F0NA 5GAEC 2D9UA 1VF7A 2MPMA 1EIYB 1EWIA 5M3MG 3OWEB 1J5EL 2CCZA 5M3FG 4BY1G 1XMQQ 5FO8B 4ABNA 3KLWA 1WD1A 2CVRA 4TKOB 4LFBL 4IFDI 2EQSA 1KQSA 3MWYW 5LMNW 4JVZA 2KA7A 4QIWB 1L2FA 2UXCQ 3L3OC 4ZCKA 2B2TC 1QUQA 2Z9HA 4F88A 2HQLA 1ILPA 4A3LH 4V0BA 1B44D 4A93G 2K03A 3OWFA 1MIUA 1G51A 1ZYRD 3CRKC 1GOZA 3K5MA 2A69C 4KK7A 5C5MA 4WFN3 2EYMA 3T53B 2JA7H 1LUZA 1K8OA 4X3TA 4ILWA 1U4PA 2JEBI 1YIJA 1IBLL 1CSQA 4N8X1 1X3QA 3OIQA 1M1KC 3JAMi 3PUZA 1X3PA 3OIPA 2DY8A 1SNPA 2JA5G 1CKMA 1FR3A 4FP5D 4DR2Q 1FVIA 1XTCD 1WTQA 1Z6HA 4XQQA 5L37A 1KD1C 5BN5A 2WP8J 1LM0A 1H9SA 1QILA 4K2KA 1JJGA 5GROA 3HFZB 5FLMH 2NUCA 1HR0W 4XDXA 4FYDA 1CKNA 4X65Q 1F9SA 3GTOH 1K28A 2VNUD 1Y8OB 3BZDB 5C0XI 1LABA 2KHJA 1F77A 1HZBA 2SNSA 4X62L 4JI5Q 1EQTA 3PUXA 5C3EG 3UDXA 2RDGA 3NTHA 4N8FA 1VQNA 3F2DA 1X3GA 1I4PA 4A3MB 2RQXA 3STBC 1O7ZA 2F4IA 2F0OA 1XNQL 4FDBA 4OO1G 2DN8A 1RIPA 3D6CA 4GN5A 1YNJD 4JI1L 5JPNC 1NR4A 1RDPD 3GTQH 4FO2A 1H9JA 3QB3A 2Z8LA 1JICA 1PDQA 4Q5VA 2NYZD 2Z0SA 5KYLA 4DK3C 3D0FA 1I50B 2K75A 2A6HC 3CHBD 5M5XH 3P1HA 4X6AH 2XN9C 1FNWA 2EYJA 4ZUIA 3J81E 3I4MH 4BBSB 1Q46A 3AFQA 3J7AV 1ZEQX 1EUJA 2KEDA 1K0SA 1K83H 5IP9H 4JI7L 2RCFA 4K0KQ 1TWFH 3X3NA 3Q22A 3S1RH 1A2UA 4YCUA 1NCVA 4IALA 1EY8A 1EQQA 3NHHA 1ASYA 5FLXE 2NWGA 1PTOC 1JOOA 3TRZA 2HCCA 4POFA 2RA4A 1OO9B 1XJVA 3JAMc 2NVQB 1QB5D 5FO9B 4BBRB 1QNKA 1LT3D 4LUOA 3J7A5 5IYDG 3CCJA 1V1PA 5LL6X 3CC7A 4RKLA 1X3EA 2JP1A 2F0FA 3K5NA 1STYA 1I94L 5EPJA 4YY3L 1UUPA 3S2HH 3EN2A 3D6WA 1J9OA 4HJ5A 4LFCQ 1SYDA 5ELNA 1QCBD 3J80c 1A2TA 3Q8DA 2UUBL 2AQ1B 2KHSA 4RFBA 1ZYRC 1NNXA 2OTLA 3K58A 2F0PA 5TSSA 2L55A 4K5XA 1B70B 4GNXC 1DOMA 3IRBA 4LFAL 3QJYA 2XNAC 2HT1A 2CH4W 3DWQA 4A4IA 2EXDA 2GVBA 3K5OA 3QIAA 4KV6A 1SR3A 4O1NA 5F2DA 1LT6D 3WWVA 2Q8TA 1DGSA 4IURA 3EA6A 4C3HB 3MTSA 4FF2A 2BOSA 4AQYL 2OQ0A 4R9WA 3W2DA 4DV7Q 1S5CD 4JV5L 3GTMH 4K5WA 4K6LA 4TSSA 1VQLA 2UXDQ 4PV1C 1Q8IA 2JA8G 5EKKA 5LHY1 3K8AA 2A74C 2IHEA 4BA1I 4DUYL 1J6QA 1Y1VG 5ISRA 4QQBX 2JK8A 3BDOA 3PUYA 4ODGA 2HUGA 2DGYA 3T13A 3OYYA 4RGNA 1BKBA 1VQOA 3C3LA 3EIVA 4UP7A 3A8JE 4IFDH 2KCCA 3UE1A 4DV3L 1KLUD 1OXUA 1YNXA 3ER0A 1NR2A 2NZHA 3ND9A 4N9TA 1MSGA 4KKSA 4IUUA 3T4AC 1LTGD 4IZ8A 5A2QE 1KIXA 1I3QB 2C35B 1YNJC 5AFWA 4DXFA 2RVLA 4QUCA 5J22A 5C6AA 1RTOA 3I70A 1CTMA 1JCKB 2NB0A 5KEEA 3FPPA 1CHQD 3SHLA 2IL8A 4NB3A 1JJCB 3N6RA 3DEPA 5J39A 2KOLA 4JBJA 4KLKA 1VQCA 4LF9Q 1IZ6A 4DAMA 5C5LA 3PO2H 1Q8KA 4ULLA 3RN5A 3CMAA 4JW0A 2RKSA 3RZOH 5DLQE 4KY5A 3IAYA 3FRPB 4A3DG 5IWAL 2R61A 4K8IA 2FXQA 4WJ3M 1EOTA 1I4XA 1NTGA 4RGOS 3L0OA 4JI8L 1G2SA 3DMUA 3KF8B 2LKVA 5K36H 2QCPX 3R2IA 1A3TA 2CKZB 1F9QA 4BBSH 3F2CA 3TQYA 1HUNA 5C0XH 1PZKD 2KUMA 3S15B 2VQEL 5C3WA 4FF4A 5ELFA 1XXGA 4HIKA 1HPCA 2K14A 2EXZA 4LW1A 1VQEA 2EZVA 3MVVA 3PIPA 3V05A 1PTOF 1S72A 1PYSB 3GQBA 2ENBA 1PFSA 3SK4A 1AZPA 4OXPA 2K33A 3JC66 2AQ2B 2GN5A 3AYHB 2OCEA 2UUAQ 4JBWA 2K4KA 2F0UA 4GLXA 3M9BA 1Y69U 4DA2A 3H3VH 1ML0D 1RODA 2G5DA 3S1NH 2EOTA 3TP8A 5K5PA 5DNFA 3CRLC 1LYLA 3OTOL 1XPRA 5EBDA 5M5WH 3TREA 1PH3A 4NMZA 1Q3LA 2R92B 5HURA 1JORA 3KFUA 2EPBA 2AHOB 3ZYYX 4TRDA 3M4PA 4DR7Q 3CC4A 3PUVA 4IPGA 4KJNA 4DAYB 2QEXA 2G9DA 4GZYC 2VS1A 3CQZB 5EPKA 5IY0A 2ES2A 1SFOH 5T1GA 3PF4A 3A8IE 1SLJA 3G71A 4DUZL 5CMDA 4J1MA 3KJOA 2E2HB 5KGUA 1W6JA 3S14H 3F2UA 3FPUB 1YJNA 1F2ZA 5BN4A 5IE8A 3JAME 2K5NA 4FXDA 4JG2A 3LX0A 3M3YH 3HOYH 4PMCA 1P8LA 3U4VA 4B9XA 1JT8A 5I6YA 3KDFB 4JI4L 2XRQD 2E8GA 3PUWA 1AE3A 3A5UA 2QEJC 2MHVA 3C1FA 1ZKOA 3BZKA 5I9PA 1C8CA 4R8IA 2N3SA 1O80A 5IODA 1QNUA 1PTOB 1PA6A 2F0GA 4NXNL 4DR4L 2EY6A 4U68A 1RJTA 1SE4A 2L5TA 1N32Q 4PMWA 4LF6Q 4L6TB 3LNNA 1BO0A 2OWOA 4F7XA 1YJWA 2K04A 4CJ0B 2FJ2A 1EL0A 4C3JG 1KXLA 1NBWA 1S5BD 3MFGA 2PNRC 3BVZA 3OW2A 4HIDA 3CW2C 5M3MB 1XMOQ 1O7IA 1Q81C 1PH5A 1X3FA 1CQVA 5M3FB 2N8NA 4KHZA 4KN4C 1IW7D 5C4XH 5IYBH 4HIOA 2MJ8A 1G2TA 2AWNA 4B3TL 1HA5A 4G7ZC 3SK6A 1PYBA 3FMCA 4YCWA 3HOUG 4IJLA 1X6OA 1ENCA 4JI0Q 1BCPD 3S1QB 4GKKL 1E24A 4BXXH 2L11A 2K5HA 1GO3E 1WTOA 4PZ7A 2KJXA 1I6VC 1H9MA 4YHHQ 1UE1A 1NJIC 4A93B 1ILQA 1OXSC 1TY2A 3K5LA 1SMXA 4DNTB 1KNEA 1A63A 4CJ1B 3D8GA 1DM0B 3A7LA 3MXNB 2LMCB 4FXGC 1YZ6A 4Z9CB 2IX1A 3TP7A 2GA4B 2E2JB 3HG9A 3CPFA 2C9OA 3KBXA 1S3OA 1TWAH 4HEDA 5D14A 2A6ED 4OO1I 2F3WA 4DV2L 4A3EG 1UAPA 1XWEA 3RLFA 4OHJA 1EFWA 2I46A 3S1MH 4M1UB 2JA5B 2B8GA 3GTPH 4I65A 2B2YA 4A3FG 1TT2A 3HS0C 1JOQA 1Y1WH 1EWHA 3BU2A 1Q90A 2B63H 1T5XD 3H15A 4IFDJ 2KCTA 2J0TD 2ZTDA 3DEOA 1H95A 1Q7YC 5EKIA 4ZUJA 1G8ZD 1A6XA 1SMYD 3FDTA 3DM1A 5ELOA 1QVGA 3CPWA 1MI2A 1LTAD 2OXPA 1Z47A 1IXRA 5D3DA 4A3IG 4R4IA 4EQNA 1J8IA 2EYOA 2HHHQ 4R4TA 4K8JA 3GTGB 5C3EB 2EE1A 4Y7NH 4JYAL 1K73C 1L1OA 4LF4Q 4MNOA 4KKUA 3MFYA 4KN7C 5GAHC 4ID6A 4O2DA 4BY7H 2EIFA 1DCZA 1E1TA 1LLRD 2A68C 2EDGA 1CI3M 4HJ8A 1GD7A 4RH6A 1N36L 2N78A 2QDBA 3FHWA 5C44G 2YYZA 4DFAA 1KAAA 4P2CB 4CKEA 1V8QA 3BYTB 3K0XA 2UUCL 1D1KA 2M2LA 1AE2A 1OXTA 2KQ3A 5GQOA 4BS9A 4DV6L 5IGDA 1HNXQ 1O7YA 3I4LA 2LS01 1QZGA 2LFNA 1A3VA 3C2PA 3BG3A 2EJMA 1FYCA 2RF4A 5IT9L 2VQFQ 4N9PA 5C0XJ 3FEWX 3ICEA 1A62A 1Y14B 2B2WA 4JOIA 2I5LX 1VS0A 1SYBA 2NZ1D 1I5FA 5CV9A 1HTPA 2PZUA 1WCMH 3HOZH 3NXWA 4JI2L 2Z4HA 2CW0D 2G9HD 3RZDB 5EGTA 4A3KB 1IW7C 1X56A 4EQ5A 2K5DA 1XNRL 1LV9A 2JA6G 2M00A 2KECA 1YHBA 3GV6A 5LMNQ 1PV4A 3OMGA 2Z4IA 1BCPC 4JC0A 4A3GH 4OWXB 2L9HA 1GXDC 4DV0L 4MTKA 2K5VA 4IUVA 2PI2A 4K2LA 4GOPB 4LF7Q 3VYTA 4OIJA 3M4QA 1K8MA 3Q24A 3RLOA 2ZM6Q 1UWVA 4QMGA 4BY1H 4BA2I 3E5SA 3I3CA 4FF1A 1LT4D 1KHIA 4DR6L 3PO3G 1VQKA 2A6EC 2PZWA 3S1QH 3NPPA 1UE7A 1VQDA 3E0JA 1ONLA 3CCMA 2H4OA 2F0DA 3I90A 4L8JA 3X3MA 3GTKB 4OX9Q 1I4QA 1KL9A 1YEZA 3K7UC 2I0QA 1Z7TA 2ICIA 1TWGB 2TMPA 2VUMG 4JPBW 2NN6I 4C3IH 4DV1L 4X66L 5C4HA 2E2JH 4J8QA 1QUQB 1HR0Q 1C0AA 2QKIC 5FJ8G 2NBFA 2JA8B 2F3VA 4K5VA 3TEHB 2QDLA 3DHQA 1WD0A 4UY8C 3H09A 1SMYC 1Y1VB 2MGSA 1WVLA 1IBKL 1U5KA 2JEAI 4YWMA 4ZKBB 3D4DA 2MFIA 1SJED 3TZUA 4LF5L 2V1CC 5IGFA 5D3IB 4CHTB 2EYFA 4C2MH 2NVXB 1JR0D 1R4QB 3SEBA 1NSNS 3R3OA 4A3BH 1YHQA 2AUKA 4B3SQ 1VQMA 4ZRZA 3K57A 1DOKA 2F0WA 3TS0A 3L7ZC 3TDQA 4PZ8A 4G4KA 2VXWA 2ZTEA 3MEFA 3HOVB 1H9SB 3H0GH 4G57A 3V96A 1EU3A 1EEFD 1SNDA 5JOBA 5G3LD 1DONA 4QB4A 3HOXH 3KF6B 1B53A 5JVG3 3M4OH 1CKNB 2R3ZA 3LWEA 4IO9A 2VZAA 4DV5Q 4OO1H 2OEOA 4IUTA 3BDLA 1NUCA 5JEAJ 3NTKA 3I4NG 4A3DB 1PFNA 3H94A 3AQQA 2B2UA 1EIFA 1TWHH 4A3LG 2NVTB 1K3RA 5CV8A 2FMMA 2E2IB 3CCVA 4KD4A 3K0YA 1VF5C 3I4OA 5JAVA 3C1EA 2MO1A 2UXDL 5LMUQ 1E3PA 4JI6Q 2JA7G 2A5HA 3MC0B 2MNAA 1AP0A 3GD7A 4A3JH 4IUNA 3S2DB 2F0QA 2NVYH 5E4WC 3QWNA 3H3VI 3CMEA 1KDCA 1X65A 1MKHA 2D2CC 4RWSC 3U4ZA 1PH4A 3E6ZX 2WFWA 2UXBQ 4V190 4I7ZC 1E2ZA 2CQAA 4RMFA 2D0PA 4L5TA 2UU9Q 5I6WA 1K8AC 1EIGA 2VB3X 3GV3A 4MTNA 2OF1A 5FLMG 3RZDH 4PQXA 4LF8Q 5C4JB 2CWAA 4NXML 5J1ZA 4L5RC 4RCNA 2HIVA 2H1EA 3HOWH 5GAGC 2B3GA 1BCPF 3F8TA 1FJGQ 2HQEA 1JC7A 1YJ9A 1EZ6A 3I55A 3T1HL 3L9AX 1N34Q 2RHSB 1YNND 3NWSA 5EAYA 1EY4A 3IFDA 5M5YB 3OW7A 1N9WA 4I7AA 4A76A 3LGJA 2M9VA 1I4GA 3VA5A 1TVXA 1V1PB 4ME5A 4P71A 1CQFA 4A3KG 2K05A 1JWSD 1J5EQ 4QF4A 1W2BA 1R9TB 3ULJA 1HCZA 4EQOA 4LFBQ 3S16H 3HRZC 1EZ8A 1ET9A 4IOCA 1I6HB 4MIUA 1E7ZA 5IYCH 3AFPA 3TP6A 2JQOA 2ZXPA 1AN8A 1S5ED 4L5SA 4DR1L 2BA1A 3CKIB 2F0KA 1FD7D 4HSPA 1SNQA 3BZCA 5IP9G 1KDBA 1WI5A 1VQAA 1TXYA 2CWPA 1F9RA 3A54A 1B9NA 5IGGA 1VQBA 3U9OA 4XXEA 4C3JB 2UUAL 1UEAB 3CAMA 3G48A 1IBLQ 3HP3A 1RL2A 1BCPB 3J7ZC 4CDFC 1KDAA 1Q1EA 3S17B 2RSNA 1LTBD 3QG1A 1BBUA 2K6AA 2OTJA 4OL7A 2MUYA 5JJKA 1OXVA 1EEID 3HOUB 4WJWA 2B2YC 5KIXA 4UHVA 1IL8A 1ENFA 2MQHA 3T51B 5I9OA 1HZ9A 2N49A 1AEXA 1IBML 1JE5A 2AMCB 2PQAB 1DXMA 3MXGA 2CQOA 4WRDA 4FXKC 5CBEE 5BR8L 5C3XA 3WOEA 2NN6H 4DV4Q 4UDUC 4X62Q 3NBHA 1PFBA 2RCNA 1LTRD 1Z9FA 1VMCA 4PZ6A 1K3BC 1XNQQ 2WIIB 1B9MA 1EYGA 4P74A 4RAUC 4JI1Q 3VR6A 1L1OC 4A3EB 3CCRA 3BVMA 2D0OA 2E5LQ 4OEMB 1GUTA 4J15A 1YBYA 1Q1BA 4GN3B 1PH2A 2F1MA 3D4RA 4ME3A 5H1SE 4A3FB 3HOVG 2F0LA 3VDYA 1MD2D 3KJPA 2F0JA 5CORA 5T1IA 2AUJD 1NMGA 4A3MH 2B39A 4B3RL 3ZJYC 1HNZL 5DEHA 3DWAA 1JB7A 3KLRA 4X64L 5CR3A 1YITA 2AQ3B 2PW7A 3SE0A 4HCEA 2KCNA 1LTSD 5ELEA 4JI7Q 1B50A 2QW7A 2F4VL 2WINB 1D2BA 1ICFB 1K8GA 4IFDG 4A3IB 4HJ7A 1I50H 3OOCA 4DK1A 3D4WA 3NP8A 1DZ1A 1BQQT 1GKHA 3EFXD 1SXTA 3T1YL 2R93B 2EY1A 4P72A 3HKZG 1ET6A 2L12A 3MEHA 2B2WC 4JOIC 4CDDC 4DK6C 2F0IA 4CKBA 4B9WA 4PNYA 2HDLA 3BVGA 4JI3L 2PI2E 4KHPL 3MAQA 1JQYD 2DNEA 4DNRB 4DR3L 4XYQA 1WTHA 5C44B 3GO5A 1K0RA 1I94Q 4YY3Q 1SAPA 1ZXTA 1HTLD 1HUMA 4NKLA 1VQPA 3SK8A 4UPAA 3GTJB 1N33Q 4UP9A 3PO2G 4XYOA 2DY7A 4M8AA 2NVQH 4PG3A 2I07B 3I56A 3CCQA 1STNA 2ZTCA 1VQ4A 2B29A 2UUBQ 4BBRH 4IPCA 2JSOA 4HJ9A 5JJLA 1T9HA 4JK1C 1HA6A 4DKAC 2DUDA 3ND8A 1TR5A 2EY2A 3A0JA 2BH8A 3EQLC 4DR5L 4LFAQ 4IOAA 2CHBD 3A7AB 1X54A 1SEBD 2ZXOA 3WDNA 5AJ3L 1PZID 5K36G 1PYWD 1SYEA 1M8AA 3A74A 4AYBE 3NWTA 1JE4A 2MO0A 2F03A 1E2WA 5C0XG 4AQYQ 2JA9A 2O5JC 3M7NA 2JA6B 3I73A 1SROA 1XX8A 3NENA 2EY5A 2IPKD 4JV5Q 5JJIA 2Q2IA 5HY6A 4TQUS 2YU9B 4C3JH 4JBMA 5DAUA 1KLGD 2Y0SE 1D5MC 3CCLA 4DAYA 1QE6A 4DUYQ 3PIO3 2OT2A 1SN8A 2V4DA 4C3HH 3UI2A 1U4RA 3T56B 3FKIG 1U4LA 5G3LF 2K01A 5IOCA 1STHA 3OPOA 3GTLB 5JJZA 1YI2A 4DGZA 3PO3B 4G7OC 3WOFA 1RHPA 2Z1CA 2B2VA 2KENA 1FGBD 1K9MC 2R7ZB 1SSOA 2QGQA 1II3A 5E4XA 5IGEA 4C1NI 2VQFL 4DK0A 2VUMB 2ASBA 1D5ZC 5IP7G 4Q0FA 3EVQA 3HOYG 1I3QH 1CUKA 2PPBC 1EYDA 3QO2A 4CKCA 1BR9A 4GNXB 4POGA 4EX5A 5IWAQ 2BH2A 4K6DA 3AMUA 5KRUA 3J81j 3HKZE 1DD2A 3MXPA 2I5HA 1GUSA 4JI8Q 4GKJL 4XT3B 2B2UC 5FLXL 5JEAH 2C5CA 4ZYSA 4B3ML 3J7YW 1HHVA 4GLAC 3F1ZA 3PSIA 1EIHA 3QR8A 1HNWL 1EY7A 4KI0A 1TS4A 2DJFC 5KNCA 5CGKA 2I5MX 3TN2A 2VQEQ 1Q82C 2QF7A 1E0BA 4LWCA 4MHEA 3PGZA 5C4XG 5IYBG 1VQGA 2P5ZX 3D3RA 1A3UA 1NY4A 1BUVT 2VY3A 2F0VA 1EY5A 1I4RA 1TIID 2JN4A 4NP5A 4HMIA 1PRTD 2QILA 4BXXG 1VQFA 2R7DA 4ALPA 3P75A 3I4NB 3S15H 4K14A 4OX9L 2NTTA 3OTOQ 1VQ8A 1XMQL 2L1BA 1HZCA 1L1OB 1ENAA 1TY0A 2X69A 4R4QA 1GHKA 1C9OA 2K7VA 2JA7B 2R93G 2UXCL 5EBCA 4EGVA 4G7HC 3M4YA 2WB1G 2PCFB 4DUZQ 1I4HA 4H7BA 3W1GA 2E74C 1C7YA 3KK7A 1KABA 2BDOA 2R92H 1GUNA 2EJFC 4QY7A 3SR1A 3M7GA 1W3SA 1Y1WG 3CQZH 1QJOA 5DM63 2F3IA 2K5QA 2Q2TA 4JI4Q 3W1BA 4DPGA 1G6ZA 2EYLA 4RKBA 5HGQA 4B3SL 1CFMA 2E2HH 3GTOB 3PV0A 2QA4A 1QVCA 3SXHA 4NXNQ 2PZTA 2PYKA 2VB2X 3CCUA 3CD6A 1PH8A 5KYIA 4DR2L 1TS5A 3CCEA 3H3VC 3RUZA 4NW2A 3V2TA 2R7FA 5A2QL 1SNOA 3NQTA 3C46A 1CA6A 1B8AA 2BA0A 4H02A 4X65L 1BNZA 1PTOH 3A8KE 1CT1D 1QOHA 4A3CG 3K6OA 3R93A 1JMCA 3GTQB 3HKSA 5E7NA 1S5DD 5ELBA 4GLVB 4B3TQ 4JI5L 4MZ9A 3BDCA 5LMUL 1WTXA 2XIWA 1KNAA 4E6IA 5M5XB 4GKKQ 4CGYB 5KNBA 1IKLA 3SGIA 3I4MB 3IL8A 3STBD 5M3MH 1VQJA 1EY9A 4LAAA 2K28A 2KBNA 5M3FH 1CHPD 3K7AB 1WTWA 4H44C 2HD3A 1TWFB 2RDHA 3S1RB 2E2DC 1NE3A 4LUZA 3SK5A 2JE6I 2J4XA 2N55A 1AW7A 3U58A 3ONAB 1XPOA 4KJOA 4KHVA 5CV7A 3TMEA 1WCMG 1CKOA 1RKNA 1G291 1IL2A 4J6HA 3F2BA 3K80C 4DV2Q 4R4OA 2F0TA 4H13C 1GJXA 4GOPA 3MXUA 2R7ZG 4A93H 4O42A 3EJIA 2ZJRA 4K0KL 4AYBB 5HGTA 3BS1A 1SNCA 1GVPA 1STAA 4OGQC 1PRTC 2PMZE 2WAQE 3OMCA 3S2HB 4A3GG 1B3AA 4KY6A 2F0MA 1EWCA 1PTOD 2PW5A 1ESFA 2XWBB 4A75A 2JA5H 1WYDA 2IHFA 4QL5A 4JCVE 2WB1E 2Y0SB 4KKTA 4DN4M 2B8FA 5FOBB 1GUOA 3NQIA 1BBXC 4JYAQ 2JJQA 4LFCL 5CV5A 1HFNA 5IT9c 3UE0A 3I4NH 1HFGA 1EOVA 1KTKA 1STBA 3ERQA 4U673 1N36Q 2D62A 4GS3A 1D1IA 3JAML 4HAEA 3GTGH 2EVBA 5C3EH 4P75A 4AIMA 1D8LA 4C3IG 3Q23A 3GTMB 1VCIA 1F9PA 2UUCQ 1AZQA 1UE5A 3BYYB 2HDMA 4FF3A 4DV6Q 2SOBA 4FVMA 3U9SA 4IPHA 4ZKCB 1D6EC 1KRTA 4WORA 3K59A 5COYA 3RR5A 3S24A 3AEVA 1BVSA 3DLLA 4C1NK 2AKWB 3N52A 3J80L 1D7QA 5CBAE 1MBYA 5J3BA 3NK9A 4DV7L 1RD9D 1STGA 3TSSA 4LUVA 1TU2B 1S40A 1WOCA 1DOLA 2CW0C 4JI2Q 3HKZB 4P73A 2Q2UA 3KF6A 4R4CA 4A3BG 1M90C 3J80i 1U4MA 2Z6BA 4ZLTF 1XNRQ 4LNQA 4HR7B 3ITPA 4DV4L 4DU9A 3H0GG 1PLFA 1PXUA 5A35A 3G6EA 1KC8C 4DV0Q 3M85A 3HOXG 3PO2B 2LXKA 2NZOA 4LMQD 5ELDA 5LL6S 2FMCA 4CDEC 3RZOB 3RLNA 4A3KH 3K81C 3LWUA 4UAIA 2E5LL 5IYDH 1G91A 2HIXA 2RDFA 1UE6A 1BBWA 5BN3A 1A8VA 1CK1A 2ICEC 3RD4A 3VR5A 3W3AA 4DR6Q 4LF9L 3FVQA 1MGSA 4YCVA 3NSWA 4DF7A 1L0XB 3MZ5A 2K1BA 2A1AA 1QWYA 3NTIA 2DNCA 1A15A 1Q86C 1UNSA 4RGMA 4A3JG 3I8ZA 3K7AH 3PMFA 4IQZA 2B2VC 3HEJA 4DV1Q 2RHQB 4X66Q 1IYJB 2WACA 1XPUA 1Q12A 1F2YA 4HTHA 3IFTA 1STEA 4KD3A 3E0EA 4RGTA 2BE5D 3I4MG 1O7LA 3GTKH 1V1QA 3S1NB 1SJHD 1IBKQ 3FKIB 1GHJA 4HJAA 4XQJA 1TS3A 1TWGH 2ATWA 2XVSA 2Z6KA 4LF5Q 3HOWG 1Y8PB 5M5WB 3DWPA 1PRTF 5I2YA 1ASZA 2IJ0A 2KHIA 3VYSA 2JA8H 2JXMB 1N33L 4OONA 1Y1VH 2ZJPA 2XWJB 3BJUA 1TKWB 1SFOB 3VR2A 4RCOA 3G4SA 3I7FA 5C4ZA 2ZJQA 4DXGA 3RMHA 5JVH3 2Q8IB 4R1JA 3U50C 3VR4A 2IX0A 2DJGC 3S14B 3DXJC 4QCLA 4AYBG 2FINB 1ESRA 3ULPA 1WTRA 1EQRA 1H9KA 3M3YB 3HOYB 2NVXH 4DR7L 2L15A 2JYOA 1EFID 5IYCG 1VQ6A 1PH9A 4IUQA 2RSOA 3SDZA 3KUPA 4L5QA 4MN3A 5EKLA 3FP9A 3IKJA 4DAVA 5FO7B 1VQ7A 3I2ZA 1U9RA 3NBHB 4HSVA 3A5ZB 4HMJA 4IPDA 1SE8A 1IHZA 3HOVH 1U0LA 2Y0SG 3VR3A 2A73B 1SRUA 5E1FA 3RNUA 2TSSA 4ZAIA 4S3SA 3E9HA 3PIP3 1JWMD 4A3DH 2YTXA 3GP7A 4CJ2C 5GADC 3SVMA 1PRTB 4XTCS 1MJEA 2NVTH 2EYPA 3E9IA 2PQAA 1GM5A 1SYFA 1O78A 1CSPA 1F2LA 3H91A 2E2IH 1N32L 5C4XB 5IT9E 4LF6L 3DM3A 3UDFA 1B4OA 1SYCA 4EVOA 4XQNA 1VMPA 4PMBA 1AH9A 1WTPA 3S2DH 1MJCA 4CDCC 4KY7A 4QUFA 4NXMQ 1XMOL 4NDXA 3I72A 4HN7A 1WFQA 2PMZB 2WAQB 3KYHC 2NN6G 1YNNC 3MA2B 3T1HQ 4BWGB 1T5EA 2B2TA 3OSOA 4CBVA 2R6GA 4F8MA 1CZGA 1SE2A 1TWCB 3CU7A 3CC2A 2WV6D 4JI0L 1CZWA 3TP5A 1BDOA 1TWAB 4F87A 5C4JH 2WKCA 4TVAB 2WB1B 1Y8NB 3J7AF 1QZHA 1E2VA 5IIFA 4YHHL 4XIGS 2Q2HA 1YVCA 1IYVA 1PH6A 3S1MB 1C48A 3HZXA 3CCSA 3GTPB 3VA7A 3DUZA 2O2LD 5KNDA 4L63B 5NUCA 3PF5A 1SE3A 2BE5C 1Y1WB 4Y52H 3KF8A 3QOJA 5M5YH 4A3MG 1VQ9A 2B63B 4WJ4A 3AB9A 4RHSA 2PQEA 1VQIA 1BXTA 4DR1Q 1X55A 2IX3A 2IW3A 3CP0A 2VW9A 1BOSA 2L4NA 2H5XA 4RG1A 1R9TH 1RCVD 3VYUA 4YIJA 1B2TA 2LY7A 1I6HH 1SBBB 1X32A 3UDGA 4Y7NB 1PHJA 5DM73 3UDIA 5EQ0A 2OQKA 4HIMA 1HRJA 4BBSG 1IKMA 3FKIH 5CV6A 1SNMA 4BY7B 3TZDA 4QJFA 4GOPC 1OXXK 4XT1B 2L0CA 2HHHL 3B6YA 3NELA 1DJRD 1RF2D 1S5FD 1MSHA 4KMUC 1UEBA 1HQMC 1PMRA 3QOLA 4LF4L 1LTID 1B1ZA 3GDEA 1IBMQ 1EY6A 4QIWE 4BBRG 3VYRA 2X6LA 3TS2A 3S17H 2F0SA 2Q8RE 5BR8Q 3NE5B 5EJWA 4ZK9B 2FFKB 1AFPA 4DV3Q 1JB3A 2A68D 5IP7H 1W6KA 3HOUH 3TBIB 3ULLA 1PH1A 3PCOB 4AH6A 2IT1A 1WCMB 3HOZB 2ZXRA 1LTLA 1HNXL 2PO4A 1L0WA 3KDFA 5D65A 4HCSA 1EYAA 2XTIA 5E3FA 2LSSA 1X9NA 3J80E 2HCIA 3R8BA 3H6MA 4YWKA 4OWWB 3URYA 1PZJD 3T16A 1HXYD 4B3RQ 1HNZQ 4A3GB 1FGUA 3J81L 4X64Q 1WTVA 2D5DA 1HJPA 4A3EH 3R2TA 4DAPA 4C3HG 4YWLA 2LXJA 1M4VA 5JPMC 2F4VQ 4IUPA 4BY1B 4A3FH 1SDFA 5LMNL 5EPLA 4APVA 2YTVA 3J81i 3Q0AA 2A8VA 1NAPA 3T1YQ 1EU4A 1DYQA 1V1OA 3KLSA 2CFMA 1N8RC 5ELCA 1EY0A 4JI3Q 1KAWA 4LF7L 4KHPQ 4GNXA 2WKDA 3MHBA 2ZM6L 5I2XA 4DR3Q 1FNVA 2F0HA 4A3IH 1YHAA 2ID0A 2F52A 2ZT9C 1TWCH 3PIOA 4C3IB 5FKAC 2A19A 2X6GA 2R93H 3NUCA 2SEBD 3MXNA 3HGBA 4RA8A 1P16A 3OHXC 3NEMA 3NBIA 1PVOA 2BDNA 4LK1C 3W5OA 2PNHA 1C4QA 2WAQG 2K50A 3AU7A 5C44H 3O13A 5CYUA 2IY5B 3P7JA 2FHTA 4OWTB 4DR5Q 1XTDA 3GTJH 5AJ3Q 2KEEA 4ZQ3A 5JEAG 1ICWA 3G6JB 1E22A 1HR0L 4OELB 1TQOA 1F2MA 4C2MB 3G7LA 4FNFA 1QG7A 3I91A 5IGBA 1LTTD 4A3BB 2XSCA 1H9RA 1KRSA 1EQVA 2O5IC 1VQHA 3A56A 1PH7A 2EJGC 3H0GB 2E76C 2A69D 2F0EA 3A55A 5FK9C 2B63G 3HOXB 1JOKA 1B7YB 1LO5D 3M4OB 1HZAA 1D5XC 1QVFA 1BF4A 3E3XA 1IYUA 2XGTA 4A3CH 2E75C 2JA6H 2O4XA 3Q6SA 1XYIA 1S4ZA 4DNIA 2N88A 4DR4Q 1A0IA 1TWHB 3J81c 1OTCA 4X3KA 3KBGA 4C56C 4NPSA 3EBEA 1JJ2A 1E1OA 1PFMA 1V9PA 2K52A 1VQ5A 2YU9H 4JBKA 3L2PA 1GUGA 2Z6KC 4UP8A 4DV5L 5IGCA 2IWHA 1HQRD 5FLXc 4A3JB 3S9WA
chains in the Genus database with same CATH topology
3KF6A 4R4CA 3CXCA 4LF6Q 4A3BG 4BY7G 1M90C 4PZ6A 3J80i 1XNQQ 2OWOA 1XNRQ 4GN4B 1EYGA 1YJWA 4P74A 4JI1Q 4LNQA 2R92G 3GTLH 1L1OC 3D31A 3CCRA 1KXLA 2D0OA 3PO3H 2E5LQ 4JI6L 1NBWA 4DV4L 2VL6A 4J15A 1YBYA 1Q1BA 3H0GG 4GN3B 1PH2A 3OW2A 1HH2P 3CW2C 4ME3A 5H1SE 4HIDA 1NMFA 3G6EA 1O7IA 1XMOQ 3KOJA 3CF5A 1Q81C 4DV0Q 1X3FA 3M85A 3VDYA 1KC8C 3KJPA 3HOXG 1PH5A 2N8NA 4KHZA 2LXKA 5C4XH 2NZOA 5IYBH 4HIOA 2R7ZH 1NMGA 4A3MH 4B3RL 3RLNA 3ZJYC 2AWNA 4A3KH 1HNZL 3CC4A 4B3TL 3K81C 1PYBA 4GKJQ 1JB7A 2E5LL 4YCWA 4X64L 2VUMH 2ALYB 3HOUG 4IJLA 1X6OA 2HIXA 1WJJA 1YITA 1UE6A 1BBWA 2UXBL 4JI0Q 4GKKL 1E24A 2GVAA 4B3MQ 4BXXH 1A8VA 5FJ8H 2K5HA 2UU9L 4JI7Q 1GO3E 2F4VL 4PZ7A 4LF9L 4DR6Q 1HNWQ 3HOZG 3RN2A 4YCVA 1K8GA 4IFDG 4YHHQ 4HJ7A 1I50H 1UE1A 1NJIC 4IJHA 2A1AA 4LF8L 1OXSC 1SMXA 1GKHA 1Q86C 1FL0A 1A63A 3T1YL 3MXNB 4O0AA 3ERSX 4P72A 3HKZG 4A3JG 2YV5A 1G6PA 3K7AH 1YZ6A 2YTYA 4DK6C 4JOIC 2IX1A 1FJGL 2KCMA 3CPFA 4JI3L 4QGUA 1V43A 2PI2E 1N34L 1S3OA 1TWAH 4KHPL 2AWOA 4DV1Q 2RHQB 4X66Q 4OO1I 4DV2L 4DR3L 4A3EG 5GAEC 1IYJB 1XPUA 3GO5A 1K0RA 1Q12A 1I94Q 3RLFA 4YY3Q 3HOVG 1EFWA 3S1MH 3E0EA 1EIYB 1VQPA 1EWIA 5M3MG 3GTPH 4UPAA 4A3FG 1N33Q 1J5EL 2CCZA 4UP9A 5M3FG 3I4MG 3GTKH 4BY1G 1V1QA 3PO2G 1XMQQ 2NVQH 4PG3A 3I56A 1Y1WH 3BU2A 3KLWA 3CCQA 1IBKQ 2ZTCA 1VQ4A 2B29A 2UUBQ 2B63H 3H15A 4LFBL 4IFDJ 4BBRH 4HJAA 4IPCA 2KCTA 1TWGH 2EQSA 1KQSA 2ATWA 4IFDI 4HJ9A 2Z6KA 1T9HA 2ZTDA 5LMNW 4LF5Q 3HOWG 1Q7YC 5JJLA 1H95A 1L2FA 2UXCQ 1ASZA 4DKAC 2DUDA 2KHIA 1QUQA 3A0JA 5ELOA 2JA8H 2BH8A 1N33L 4DR5L 2HQLA 4LFAQ 3CPWA 1QVGA 4IOAA 1X54A 4OONA 1Z47A 1Y1VH 5AJ3L 1IXRA 4A3IG 4A3LH 4R4IA 2ZJPA 3BJUA 5K36G 2HHHQ 3A74A 4AYBE 4A93G 4R4TA 3I7FA 3G4SA 2ZJQA 1MIUA 1G51A 4Y7NH 4JYAL 2MO0A 4R1JA 1L1OA 3U50C 1K73C 2IX0A 4LF4Q 5C0XG 4MNOA 2JA9A 4AQYQ 4AYBG 2JA7H 5GAHC 3M7NA 1LUZA 3ULPA 4O2DA 1SROA 1EQRA 4BY7H 2EIFA 3NENA 2JEBI 2NVXH 4JV5Q 4DR7L 1E1TA 1YIJA 5JJIA 1IBLL 2L15A 1CSQA 4HJ8A 2Q2IA 1GD7A 5IYCG 2N78A 1N36L 3JAMi 3PUZA 1PH9A 3FHWA 5HY6A 4TQUS 5C44G 2YYZA 1M1KC 1VQ6A 4C3JH 4JBMA 4L5QA 2JA5G 1CKMA 2Y0SE 3CCLA 3FP9A 4DR2Q 1FVIA 4DUYQ 3K0XA 2UUCL 1VQ7A 1SN8A 3I2ZA 4C3HH 3NBHB 3A5ZB 1AE2A 1OXTA 4IPDA 1SE8A 5GQOA 4DV6L 2WP8J 1KD1C 3HOVH 1LM0A 1HNXQ 3FKIG 1U0LA 2Y0SG 1JJGA 5GROA 1SRUA 3RNUA 3HFZB 5FLMH 1QZGA 1HR0W 1CKNA 4X65Q 3GTOH 2VNUD 3E9HA 2RF4A 2VQFQ 5C0XJ 1YI2A 5C0XI 2KHJA 4A3DH 3ICEA 1A62A 1Y14B 2YTXA 5GADC 4JOIA 2I5LX 4XTCS 1MJEA 1VS0A 1HZBA 2NVTH 1I5FA 4X62L 3E9IA 4JI5Q 2PQAA 1GM5A 1WCMH 3HOZH 2KENA 3PUXA 1CSPA 1N32L 5C3EG 3UDXA 2E2IH 4JI2L 1VQNA 1K9MC 3F2DA 4LF6L 1X3GA 3DM3A 3UDFA 3STBC 1X56A 2QGQA 4EQ5A 2VQFL 1XNQL 1XNRL 4FDBA 4OO1G 2JA6G 1RIPA 4GN5A 4JI1L 2ASBA 1AH9A 1YHBA 5IP7G 3HOYG 1I3QH 5LMNQ 3GTQH 1CUKA 1PV4A 3S2DH 1MJCA 4NXMQ 4JC0A 4A3GH 2Z0SA 1XMOL 4OWXB 4PMWA 4GNXB 4DK3C 3D0FA 1WFQA 4EX5A 4DV0L 4POGA 5IWAQ 2BH2A 2K5VA 2K75A 3KYHC 2NN6G 2PI2A 5M5XH 4GOPB 3T1HQ 3J81j 3HKZE 1OTCA 4LF7Q 4X6AH 2R6GA 2I5HA 3M4QA 4JI8Q 3RLOA 3I4MH 2ZM6Q 4GKJL 1UWVA 4BY1H 3CC2A 1Q46A 3AFQA 1EUJA 4BA2I 4JI0L 4B3ML 1K83H 5IP9H 5C4JH 4JI7L 4TVAB 3F1ZA 3PSIA 4GLAC 1TWFH 4K0KQ 4DR6L 1KHIA 1QZHA 1HNWL 3S1RH 4YCUA 3PO3G 1VQKA 4KI0A 4YHHL 3S1QH 1UE7A 4XIGS 2Q2HA 1YVCA 1EQQA 2I5MX 1ASYA 1PH6A 1VQDA 2VQEQ 1JT8A 1Q82C 3CCSA 3TRZA 3CCMA 4POFA 4LWCA 3PGZA 5C4XG 1XJVA 1KL9A 1YEZA 3K7UC 3JAMc 5IYBG 1VQGA 3PF5A 4OX9Q 2I0QA 4Y52H 4A3MG 5M5YH 4WJ4A 1VQ9A 1NY4A 2VY3A 1VQIA 4LUOA 3J7A5 5IYDG 3CCJA 1X55A 2NN6I 4C3IH 4DV1L 4X66L 4DR1Q 2VUMG 3CP0A 2VW9A 3CC7A 2E2JH 1QUQB 1HR0Q 4BXXG 1VQFA 2H5XA 1X3EA 2R7DA 4ALPA 4RG1A 1R9TH 1C0AA 5FJ8G 1I94L 4YY3L 3S15H 4UY8C 3TEHB 3S2HH 3EN2A 4OX9L 4HJ5A 4LFCQ 5ELNA 3OTOQ 3J80c 1VQ8A 3Q8DA 1XMQL 1I6HH 3UDGA 1IBKL 1U5KA 1HZCA 4YWMA 2JEAI 2UUBL 1L1OB 1PHJA 4R4QA 2MFIA 3UDIA 4HIMA 2OQKA 1C9OA 4LF5L 4BBSG 2V1CC 2OTLA 2R93G 2UXCL 3FKIH 4QJFA 4C2MH 1B70B 4GNXC 3IRBA 2WB1G 4DUZQ 4LFAL 4A3BH 1YHQA 2HT1A 3W1GA 4A4IA 4GOPC 1OXXK 4B3SQ 1VQMA 2EXDA 2GVBA 2HHHL 1C7YA 3B6YA 3TS0A 1SR3A 3NELA 3L7ZC 2R92H 4PZ8A 3WWVA 1DGSA 1UEBA 4QY7A 4LF4L 1W3SA 2ZTEA 4AQYL 3GDEA 1IBMQ 3MEFA 1Y1WG 2OQ0A 3CQZH 3H0GH 2F3IA 2Q2TA 4JI4Q 4QIWE 3W1BA 4DV7Q 4BBRG 4DPGA 3TS2A 3S17H 3HOXH 5BR8Q 3KF6B 5HGQA 4B3SL 3M4OH 1CKNB 3GTMH 4JV5L 2E2HH 4IO9A 2VZAA 4DV5Q 1VQLA 4JBKA 2UXDQ 3PV0A 2QA4A 4DV3Q 1QVCA 4NXNQ 5IP7H 5JEAJ 2JA8G 3I4NG 3CCUA 3CD6A 3K8AA 3HOUH 1PH8A 3AQQA 2IHEA 3ULLA 1EIFA 4DR2L 1PH1A 1TWHH 3PCOB 1J6QA 1Y1VG 4BA1I 4DUYL 4A3LG 4AH6A 3CCEA 1K3RA 4QQBX 2IT1A 2JK8A 3PUYA 2DGYA 2R7FA 1LTLA 3OYYA 1BKBA 1VQOA 1HNXL 1L0WA 3KDFA 3CCVA 3EIVA 3I4OA 4UP7A 2MO1A 2UXDL 3UE1A 1B8AA 1E3PA 2XTIA 5LMUQ 2BA0A 1OXUA 4DV3L 1YNXA 4JI6Q 3ER0A 4H02A 2NZHA 2JA7G 4X65L 2LSSA 1X9NA 2MNAA 4A3CG 4YWKA 1KIXA 4OWWB 1JMCA 3GD7A 3HKSA 2C35B 5E7NA 4A3JH 2NVYH 4GLVB 3H3VI 4B3RQ 1HNZQ 3CMEA 4B3TQ 1X65A 1MKHA 4JI5L 1FGUA 4MZ9A 3U4ZA 4X64Q 5LMUL 1PH4A 2WFWA 1HJPA 1JJCB 4NB3A 4A3EH 2UXBQ 4GKKQ 4RMFA 2D0PA 4YWLA 4L5TA 2UU9Q 2LXJA 2F4VQ 3SGIA 4JBJA 4KLKA 3STBD 1K8AC 1VQCA 4LF9Q 5M3MH 1IZ6A 4MTNA 1VQJA 4DAMA 4A3FH 2KBNA 5FLMG 3RZDH 5M3FH 5LMNL 3PO2H 1Q8KA 4LF8Q 3RN5A 4APVA 3CMAA 4JI4L 2YTVA 3RZOH 2CWAA 3J81i 4NXML 2A8VA 3T1YQ 5DLQE 4L5RC 2HIVA 4A3DG 3HOWH 1NE3A 4LUZA 5IWAL 5GAGC 2B3GA 2JE6I 2CFMA 3F8TA 1N8RC 1FJGQ 3U58A 2FXQA 1YJ9A 3T1HL 3I55A 1XPOA 4WJ3M 4JI3Q 1KAWA 4LF7L 1NTGA 1N34Q 1WCMG 1CKOA 4KHPQ 2RHSB 3L0OA 1G291 5EAYA 4JI8L 4GNXA 1IL2A 2ZM6L 3F2BA 3K80C 3KF8B 4DV2Q 4DR3Q 4R4OA 4A3IH 4GOPA 1YHAA 2ID0A 1N9WA 4A76A 2F52A 2R7ZG 4A93H 3LGJA 2CKZB 1TWCH 4P71A 3PIOA 4A3KG 2ZJRA 4BBSH 4K0KL 2A19A 2R93H 3F2CA 1J5EQ 1GVPA 3TQYA 1W2BA 5IYDH 3ULJA 2VQEL 2PMZE 4LFBQ 2WAQE 1P16A 3S16H 4HIKA 4A3GG 4LW1A 2K14A 1VQEA 4IOCA 3PIPA 3NEMA 1PVOA 1E7ZA 3W5OA 5IYCH 2PNHA 3AFPA 2WAQG 2K50A 2JQOA 5C44H 1S72A 1PYSB 2IY5B 1PFSA 4OWTB 4L5SA 4OXPA 4A75A 4DR5Q 2JA5H 1WYDA 3JC66 2GN5A 2IHFA 3AYHB 1XTDA 2OCEA 3GTJH 4DR1L 5AJ3Q 2UUAQ 2BA1A 4JBWA 2K4KA 4JCVE 4QL5A 3M9BA 1E22A 2WB1E 5JEAG 4GLXA 1HR0L 3H3VH 3S1NH 3BZCA 5IP9G 1WI5A 1VQAA 4JYAQ 1TXYA 2CWPA 2JJQA 4LFCL 1LYLA 3OTOL 1XPRA 5M5WH 5IT9c 3TREA 1PH3A 3UE0A 3I4NH 1VQBA 1KRSA 1EOVA 3KFUA 2UUAL 2AHOB 3M4PA 4DR7Q 3CAMA 3PUVA 1VQHA 3G48A 4IPGA 4DAYB 2QEXA 1PH7A 1IBLQ 2VS1A 1N36Q 2D62A 1RL2A 4GS3A 5IY0A 3J7ZC 2ES2A 1SFOH 3PF4A 1Q1EA 2B63G 3GTGH 1B7YB 5C3EH 4P75A 1SLJA 1D8LA 1HZAA 4AIMA 3G71A 4DUZL 1VCIA 3KJOA 1QVFA 2UUCQ 1BBUA 3S14H 1UE5A 1YJNA 2OTJA 2XGTA 4DV6Q 4A3CH 5IE8A 2JA6H 5JJKA 1OXVA 2K5NA 4IPHA 4JG2A 4DNIA 4DR4Q 1A0IA 3M3YH 2MQHA 1KRTA 3HOYH 1HZ9A 1P8LA 3RR5A 2N49A 3S24A 3U4VA 3J81c 1IBML 1BVSA 1JE5A 3EBEA 4NPSA 3DLLA 1JJ2A 2Q2UA 3AEVA 1E1OA 2AKWB 2AMCB 3KDFB 2YU9H 1D7QA 1V9PA 2PQAB 2E8GA 2K52A 1AE3A 3PUWA 5J3BA 3A5UA 2CQOA 3L2PA 4DV7L 2Z6KC 4UP8A 3BZKA 1VQ5A 5BR8L 2N3SA 4LUVA 4DV5L 1PA6A 4DV4Q 4X62Q 1S40A 4NXNL 4DR4L 1WOCA 2RCNA 1N32Q 5FLXc 4JI2Q 4P73A 1Z9FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KF6 A;  4R4C A;  3CXC A;  4LF6 Q;  4A3B G;  4BY7 G;  1M90 C;  4PZ6 A;  3J80 i;  1XNQ Q;  2OWO A;  1XNR Q;  4GN4 B;  1EYG A;  1YJW A;  4P74 A;  4JI1 Q;  4LNQ A;  2R92 G;  3GTL H;  1L1O C;  3D31 A;  3CCR A;  1KXL A;  2D0O A;  3PO3 H;  2E5L Q;  4JI6 L;  1NBW A;  4DV4 L;  2VL6 A;  4J15 A;  1YBY A;  1Q1B A;  3H0G G;  4GN3 B;  1PH2 A;  3OW2 A;  1HH2 P;  3CW2 C;  4ME3 A;  5H1S E;  4HID A;  1NMF A;  3G6E A;  1O7I A;  1XMO Q;  3KOJ A;  3CF5 A;  1Q81 C;  4DV0 Q;  1X3F A;  3M85 A;  3VDY A;  1KC8 C;  3KJP A;  3HOX G;  1PH5 A;  2N8N A;  4KHZ A;  2LXK A;  5C4X H;  2NZO A;  5IYB H;  4HIO A;  2R7Z H;  1NMG A;  4A3M H;  4B3R L;  3RLN A;  3ZJY C;  2AWN A;  4A3K H;  1HNZ L;  3CC4 A;  4B3T L;  3K81 C;  1PYB A;  4GKJ Q;  1JB7 A;  2E5L L;  4YCW A;  4X64 L;  2VUM H;  2ALY B;  3HOU G;  4IJL A;  1X6O A;  2HIX A;  1WJJ A;  1YIT A;  1UE6 A;  1BBW A;  2UXB L;  4JI0 Q;  4GKK L;  1E24 A;  2GVA A;  4B3M Q;  4BXX H;  1A8V A;  5FJ8 H;  2K5H A;  2UU9 L;  4JI7 Q;  1GO3 E;  2F4V L;  4PZ7 A;  4LF9 L;  4DR6 Q;  1HNW Q;  3HOZ G;  3RN2 A;  4YCV A;  1K8G A;  4IFD G;  4YHH Q;  4HJ7 A;  1I50 H;  1UE1 A;  1NJI C;  4IJH A;  2A1A A;  4LF8 L;  1OXS C;  1SMX A;  1GKH A;  1Q86 C;  1FL0 A;  1A63 A;  3T1Y L;  3MXN B;  4O0A A;  3ERS X;  4P72 A;  3HKZ G;  4A3J G;  2YV5 A;  1G6P A;  3K7A H;  1YZ6 A;  2YTY A;  4DK6 C;  4JOI C;  2IX1 A;  1FJG L;  2KCM A;  3CPF A;  4JI3 L;  4QGU A;  1V43 A;  2PI2 E;  1N34 L;  1S3O A;  1TWA H;  4KHP L;  2AWO A;  4DV1 Q;  2RHQ B;  4X66 Q;  4OO1 I;  4DV2 L;  4DR3 L;  4A3E G;  5GAE C;  1IYJ B;  1XPU A;  3GO5 A;  1K0R A;  1Q12 A;  1I94 Q;  3RLF A;  4YY3 Q;  3HOV G;  1EFW A;  3S1M H;  3E0E A;  1EIY B;  1VQP A;  1EWI A;  5M3M G;  3GTP H;  4UPA A;  4A3F G;  1N33 Q;  1J5E L;  2CCZ A;  4UP9 A;  5M3F G;  3I4M G;  3GTK H;  4BY1 G;  1V1Q A;  3PO2 G;  1XMQ Q;  2NVQ H;  4PG3 A;  3I56 A;  1Y1W H;  3BU2 A;  3KLW A;  3CCQ A;  1IBK Q;  2ZTC A;  1VQ4 A;  2B29 A;  2UUB Q;  2B63 H;  3H15 A;  4LFB L;  4IFD J;  4BBR H;  4HJA A;  4IPC A;  2KCT A;  1TWG H;  2EQS A;  1KQS A;  2ATW A;  4IFD I;  4HJ9 A;  2Z6K A;  1T9H A;  2ZTD A;  5LMN W;  4LF5 Q;  3HOW G;  1Q7Y C;  5JJL A;  1H95 A;  1L2F A;  2UXC Q;  1ASZ A;  4DKA C;  2DUD A;  2KHI A;  1QUQ A;  3A0J A;  5ELO A;  2JA8 H;  2BH8 A;  1N33 L;  4DR5 L;  2HQL A;  4LFA Q;  3CPW A;  1QVG A;  4IOA A;  1X54 A;  4OON A;  1Z47 A;  1Y1V H;  5AJ3 L;  1IXR A;  4A3I G;  4A3L H;  4R4I A;  2ZJP A;  3BJU A;  5K36 G;  2HHH Q;  3A74 A;  4AYB E;  4A93 G;  4R4T A;  3I7F A;  3G4S A;  2ZJQ A;  1MIU A;  1G51 A;  4Y7N H;  4JYA L;  2MO0 A;  4R1J A;  1L1O A;  3U50 C;  1K73 C;  2IX0 A;  4LF4 Q;  5C0X G;  4MNO A;  2JA9 A;  4AQY Q;  4AYB G;  2JA7 H;  5GAH C;  3M7N A;  1LUZ A;  3ULP A;  4O2D A;  1SRO A;  1EQR A;  4BY7 H;  2EIF A;  3NEN A;  2JEB I;  2NVX H;  4JV5 Q;  4DR7 L;  1E1T A;  1YIJ A;  5JJI A;  1IBL L;  2L15 A;  1CSQ A;  4HJ8 A;  2Q2I A;  1GD7 A;  5IYC G;  2N78 A;  1N36 L;  3JAM i;  3PUZ A;  1PH9 A;  3FHW A;  5HY6 A;  4TQU S;  5C44 G;  2YYZ A;  1M1K C;  1VQ6 A;  4C3J H;  4JBM A;  4L5Q A;  2JA5 G;  1CKM A;  2Y0S E;  3CCL A;  3FP9 A;  4DR2 Q;  1FVI A;  4DUY Q;  3K0X A;  2UUC L;  1VQ7 A;  1SN8 A;  3I2Z A;  4C3H H;  3NBH B;  3A5Z B;  1AE2 A;  1OXT A;  4IPD A;  1SE8 A;  5GQO A;  4DV6 L;  2WP8 J;  1KD1 C;  3HOV H;  1LM0 A;  1HNX Q;  3FKI G;  1U0L A;  2Y0S G;  1JJG A;  5GRO A;  1SRU A;  3RNU A;  3HFZ B;  5FLM H;  1QZG A;  1HR0 W;  1CKN A;  4X65 Q;  3GTO H;  2VNU D;  3E9H A;  2RF4 A;  2VQF Q;  5C0X J;  1YI2 A;  5C0X I;  2KHJ A;  4A3D H;  3ICE A;  1A62 A;  1Y14 B;  2YTX A;  5GAD C;  4JOI A;  2I5L X;  4XTC S;  1MJE A;  1VS0 A;  1HZB A;  2NVT H;  1I5F A;  4X62 L;  3E9I A;  4JI5 Q;  2PQA A;  1GM5 A;  1WCM H;  3HOZ H;  2KEN A;  3PUX A;  1CSP A;  1N32 L;  5C3E G;  3UDX A;  2E2I H;  4JI2 L;  1VQN A;  1K9M C;  3F2D A;  4LF6 L;  1X3G A;  3DM3 A;  3UDF A;  3STB C;  1X56 A;  2QGQ A;  4EQ5 A;  2VQF L;  1XNQ L;  1XNR L;  4FDB A;  4OO1 G;  2JA6 G;  1RIP A;  4GN5 A;  4JI1 L;  2ASB A;  1AH9 A;  1YHB A;  5IP7 G;  3HOY G;  1I3Q H;  5LMN Q;  3GTQ H;  1CUK A;  1PV4 A;  3S2D H;  1MJC A;  4NXM Q;  4JC0 A;  4A3G H;  2Z0S A;  1XMO L;  4OWX B;  4PMW A;  4GNX B;  4DK3 C;  3D0F A;  1WFQ A;  4EX5 A;  4DV0 L;  4POG A;  5IWA Q;  2BH2 A;  2K5V A;  2K75 A;  3KYH C;  2NN6 G;  2PI2 A;  5M5X H;  4GOP B;  3T1H Q;  3J81 j;  3HKZ E;  1OTC A;  4LF7 Q;  4X6A H;  2R6G A;  2I5H A;  3M4Q A;  4JI8 Q;  3RLO A;  3I4M H;  2ZM6 Q;  4GKJ L;  1UWV A;  4BY1 H;  3CC2 A;  1Q46 A;  3AFQ A;  1EUJ A;  4BA2 I;  4JI0 L;  4B3M L;  1K83 H;  5IP9 H;  5C4J H;  4JI7 L;  4TVA B;  3F1Z A;  3PSI A;  4GLA C;  1TWF H;  4K0K Q;  4DR6 L;  1KHI A;  1QZH A;  1HNW L;  3S1R H;  4YCU A;  3PO3 G;  1VQK A;  4KI0 A;  4YHH L;  3S1Q H;  1UE7 A;  4XIG S;  2Q2H A;  1YVC A;  1EQQ A;  2I5M X;  1ASY A;  1PH6 A;  1VQD A;  2VQE Q;  1JT8 A;  1Q82 C;  3CCS A;  3TRZ A;  3CCM A;  4POF A;  4LWC A;  3PGZ A;  5C4X G;  1XJV A;  1KL9 A;  1YEZ A;  3K7U C;  3JAM c;  5IYB G;  1VQG A;  3PF5 A;  4OX9 Q;  2I0Q A;  4Y52 H;  4A3M G;  5M5Y H;  4WJ4 A;  1VQ9 A;  1NY4 A;  2VY3 A;  1VQI A;  4LUO A;  3J7A 5;  5IYD G;  3CCJ A;  1X55 A;  2NN6 I;  4C3I H;  4DV1 L;  4X66 L;  4DR1 Q;  2VUM G;  3CP0 A;  2VW9 A;  3CC7 A;  2E2J H;  1QUQ B;  1HR0 Q;  4BXX G;  1VQF A;  2H5X A;  1X3E A;  2R7D A;  4ALP A;  4RG1 A;  1R9T H;  1C0A A;  5FJ8 G;  1I94 L;  4YY3 L;  3S15 H;  4UY8 C;  3TEH B;  3S2H H;  3EN2 A;  4OX9 L;  4HJ5 A;  4LFC Q;  5ELN A;  3OTO Q;  3J80 c;  1VQ8 A;  3Q8D A;  1XMQ L;  1I6H H;  3UDG A;  1IBK L;  1U5K A;  1HZC A;  4YWM A;  2JEA I;  2UUB L;  1L1O B;  1PHJ A;  4R4Q A;  2MFI A;  3UDI A;  4HIM A;  2OQK A;  1C9O A;  4LF5 L;  4BBS G;  2V1C C;  2OTL A;  2R93 G;  2UXC L;  3FKI H;  4QJF A;  4C2M H;  1B70 B;  4GNX C;  3IRB A;  2WB1 G;  4DUZ Q;  4LFA L;  4A3B H;  1YHQ A;  2HT1 A;  3W1G A;  4A4I A;  4GOP C;  1OXX K;  4B3S Q;  1VQM A;  2EXD A;  2GVB A;  2HHH L;  1C7Y A;  3B6Y A;  3TS0 A;  1SR3 A;  3NEL A;  3L7Z C;  2R92 H;  4PZ8 A;  3WWV A;  1DGS A;  1UEB A;  4QY7 A;  4LF4 L;  1W3S A;  2ZTE A;  4AQY L;  3GDE A;  1IBM Q;  3MEF A;  1Y1W G;  2OQ0 A;  3CQZ H;  3H0G H;  2F3I A;  2Q2T A;  4JI4 Q;  4QIW E;  3W1B A;  4DV7 Q;  4BBR G;  4DPG A;  3TS2 A;  3S17 H;  3HOX H;  5BR8 Q;  3KF6 B;  5HGQ A;  4B3S L;  3M4O H;  1CKN B;  3GTM H;  4JV5 L;  2E2H H;  4IO9 A;  2VZA A;  4DV5 Q;  1VQL A;  4JBK A;  2UXD Q;  3PV0 A;  2QA4 A;  4DV3 Q;  1QVC A;  4NXN Q;  5IP7 H;  5JEA J;  2JA8 G;  3I4N G;  3CCU A;  3CD6 A;  3K8A A;  3HOU H;  1PH8 A;  3AQQ A;  2IHE A;  3ULL A;  1EIF A;  4DR2 L;  1PH1 A;  1TWH H;  3PCO B;  1J6Q A;  1Y1V G;  4BA1 I;  4DUY L;  4A3L G;  4AH6 A;  3CCE A;  1K3R A;  4QQB X;  2IT1 A;  2JK8 A;  3PUY A;  2DGY A;  2R7F A;  1LTL A;  3OYY A;  1BKB A;  1VQO A;  1HNX L;  1L0W A;  3KDF A;  3CCV A;  3EIV A;  3I4O A;  4UP7 A;  2MO1 A;  2UXD L;  3UE1 A;  1B8A A;  1E3P A;  2XTI A;  5LMU Q;  2BA0 A;  1OXU A;  4DV3 L;  1YNX A;  4JI6 Q;  3ER0 A;  4H02 A;  2NZH A;  2JA7 G;  4X65 L;  2LSS A;  1X9N A;  2MNA A;  4A3C G;  4YWK A;  1KIX A;  4OWW B;  1JMC A;  3GD7 A;  3HKS A;  2C35 B;  5E7N A;  4A3J H;  2NVY H;  4GLV B;  3H3V I;  4B3R Q;  1HNZ Q;  3CME A;  4B3T Q;  1X65 A;  1MKH A;  4JI5 L;  1FGU A;  4MZ9 A;  3U4Z A;  4X64 Q;  5LMU L;  1PH4 A;  2WFW A;  1HJP A;  1JJC B;  4NB3 A;  4A3E H;  2UXB Q;  4GKK Q;  4RMF A;  2D0P A;  4YWL A;  4L5T A;  2UU9 Q;  2LXJ A;  2F4V Q;  3SGI A;  4JBJ A;  4KLK A;  3STB D;  1K8A C;  1VQC A;  4LF9 Q;  5M3M H;  1IZ6 A;  4MTN A;  1VQJ A;  4DAM A;  4A3F H;  2KBN A;  5FLM G;  3RZD H;  5M3F H;  5LMN L;  3PO2 H;  1Q8K A;  4LF8 Q;  3RN5 A;  4APV A;  3CMA A;  4JI4 L;  2YTV A;  3RZO H;  2CWA A;  3J81 i;  4NXM L;  2A8V A;  3T1Y Q;  5DLQ E;  4L5R C;  2HIV A;  4A3D G;  3HOW H;  1NE3 A;  4LUZ A;  5IWA L;  5GAG C;  2B3G A;  2JE6 I;  2CFM A;  3F8T A;  1N8R C;  1FJG Q;  3U58 A;  2FXQ A;  1YJ9 A;  3T1H L;  3I55 A;  1XPO A;  4WJ3 M;  4JI3 Q;  1KAW A;  4LF7 L;  1NTG A;  1N34 Q;  1WCM G;  1CKO A;  4KHP Q;  2RHS B;  3L0O A;  1G29 1;  5EAY A;  4JI8 L;  4GNX A;  1IL2 A;  2ZM6 L;  3F2B A;  3K80 C;  3KF8 B;  4DV2 Q;  4DR3 Q;  4R4O A;  4A3I H;  4GOP A;  1YHA A;  2ID0 A;  1N9W A;  4A76 A;  2F52 A;  2R7Z G;  4A93 H;  3LGJ A;  2CKZ B;  1TWC H;  4P71 A;  3PIO A;  4A3K G;  2ZJR A;  4BBS H;  4K0K L;  2A19 A;  2R93 H;  3F2C A;  1J5E Q;  1GVP A;  3TQY A;  1W2B A;  5IYD H;  3ULJ A;  2VQE L;  2PMZ E;  4LFB Q;  2WAQ E;  1P16 A;  3S16 H;  4HIK A;  4A3G G;  4LW1 A;  2K14 A;  1VQE A;  4IOC A;  3PIP A;  3NEM A;  1PVO A;  1E7Z A;  3W5O A;  5IYC H;  2PNH A;  3AFP A;  2WAQ G;  2K50 A;  2JQO A;  5C44 H;  1S72 A;  1PYS B;  2IY5 B;  1PFS A;  4OWT B;  4L5S A;  4OXP A;  4A75 A;  4DR5 Q;  2JA5 H;  1WYD A;  3JC6 6;  2GN5 A;  2IHF A;  3AYH B;  1XTD A;  2OCE A;  3GTJ H;  4DR1 L;  5AJ3 Q;  2UUA Q;  2BA1 A;  4JBW A;  2K4K A;  4JCV E;  4QL5 A;  3M9B A;  1E22 A;  2WB1 E;  5JEA G;  4GLX A;  1HR0 L;  3H3V H;  3S1N H;  3BZC A;  5IP9 G;  1WI5 A;  1VQA A;  4JYA Q;  1TXY A;  2CWP A;  2JJQ A;  4LFC L;  1LYL A;  3OTO L;  1XPR A;  5M5W H;  5IT9 c;  3TRE A;  1PH3 A;  3UE0 A;  3I4N H;  1VQB A;  1KRS A;  1EOV A;  3KFU A;  2UUA L;  2AHO B;  3M4P A;  4DR7 Q;  3CAM A;  3PUV A;  1VQH A;  3G48 A;  4IPG A;  4DAY B;  2QEX A;  1PH7 A;  1IBL Q;  2VS1 A;  1N36 Q;  2D62 A;  1RL2 A;  4GS3 A;  5IY0 A;  3J7Z C;  2ES2 A;  1SFO H;  3PF4 A;  1Q1E A;  2B63 G;  3GTG H;  1B7Y B;  5C3E H;  4P75 A;  1SLJ A;  1D8L A;  1HZA A;  4AIM A;  3G71 A;  4DUZ L;  1VCI A;  3KJO A;  1QVF A;  2UUC Q;  1BBU A;  3S14 H;  1UE5 A;  1YJN A;  2OTJ A;  2XGT A;  4DV6 Q;  4A3C H;  5IE8 A;  2JA6 H;  5JJK A;  1OXV A;  2K5N A;  4IPH A;  4JG2 A;  4DNI A;  4DR4 Q;  1A0I A;  3M3Y H;  2MQH A;  1KRT A;  3HOY H;  1HZ9 A;  1P8L A;  3RR5 A;  2N49 A;  3S24 A;  3U4V A;  3J81 c;  1IBM L;  1BVS A;  1JE5 A;  3EBE A;  4NPS A;  3DLL A;  1JJ2 A;  2Q2U A;  3AEV A;  1E1O A;  2AKW B;  2AMC B;  3KDF B;  2YU9 H;  1D7Q A;  1V9P A;  2PQA B;  2E8G A;  2K52 A;  1AE3 A;  3PUW A;  5J3B A;  3A5U A;  2CQO A;  3L2P A;  4DV7 L;  2Z6K C;  4UP8 A;  3BZK A;  1VQ5 A;  5BR8 L;  2N3S A;  4LUV A;  4DV5 L;  1PA6 A;  4DV4 Q;  4X62 Q;  1S40 A;  4NXN L;  4DR4 L;  1WOC A;  2RCN A;  1N32 Q;  5FLX c;  4JI2 Q;  4P73 A;  1Z9F A; 
#chains in the Genus database with same CATH topology
 3CXC A;  4BY7 G;  1TS2 A;  1CA5 A;  2NVY B;  4GN4 B;  1VDZ A;  1EYC A;  2KVM A;  4RHR A;  2R92 G;  3GTL H;  1L0Y B;  3D31 A;  5M9O A;  3PO3 H;  4JI6 L;  1MHW C;  1R4P B;  2VL6 A;  2K32 A;  2SDF A;  4B08 A;  1HH2 P;  4H0L C;  1NMF A;  3KOJ A;  3CF5 A;  3PQI A;  1FNU A;  2R7Z H;  1JWU D;  1CM9 A;  5CC4 A;  2EYH A;  1K83 B;  4IN3 A;  4GKJ Q;  3HOW B;  2VUM H;  2ALY B;  4KTA A;  1WJJ A;  4EQP A;  4R8N A;  1GUW A;  2UXB L;  2GVA A;  4B3M Q;  1RTN A;  2MP1 A;  5FJ8 H;  2UU9 L;  3P20 A;  1SYG A;  1HNW Q;  2A6H D;  3HOZ G;  2SNM A;  3RN2 A;  4OIK A;  5CV4 A;  4IJH A;  4LF8 L;  2K5W A;  2BCO A;  1FL0 A;  4X3S A;  5I4D A;  4O0A A;  3ERS X;  1B3Q A;  2RBM A;  2YV5 A;  2CH4 A;  1G6P A;  2YTY A;  1LT5 D;  1FJG L;  2KCM A;  1LAC A;  3S16 B;  3KLS X;  4QGU A;  1V43 A;  2NTS A;  2XRS D;  1N34 L;  4X3U A;  2AWO A;  3ERO A;  4LJZ C;  2J7Z A;  2F0N A;  5GAE C;  2D9U A;  1VF7 A;  2MPM A;  1EIY B;  1EWI A;  5M3M G;  3OWE B;  1J5E L;  2CCZ A;  5M3F G;  4BY1 G;  1XMQ Q;  5FO8 B;  4ABN A;  3KLW A;  1WD1 A;  2CVR A;  4TKO B;  4LFB L;  4IFD I;  2EQS A;  1KQS A;  3MWY W;  5LMN W;  4JVZ A;  2KA7 A;  4QIW B;  1L2F A;  2UXC Q;  3L3O C;  4ZCK A;  2B2T C;  1QUQ A;  2Z9H A;  4F88 A;  2HQL A;  1ILP A;  4A3L H;  4V0B A;  1B44 D;  4A93 G;  2K03 A;  3OWF A;  1MIU A;  1G51 A;  1ZYR D;  3CRK C;  1GOZ A;  3K5M A;  2A69 C;  4KK7 A;  5C5M A;  4WFN 3;  2EYM A;  3T53 B;  2JA7 H;  1LUZ A;  1K8O A;  4X3T A;  4ILW A;  1U4P A;  2JEB I;  1YIJ A;  1IBL L;  1CSQ A;  4N8X 1;  1X3Q A;  3OIQ A;  1M1K C;  3JAM i;  3PUZ A;  1X3P A;  3OIP A;  2DY8 A;  1SNP A;  2JA5 G;  1CKM A;  1FR3 A;  4FP5 D;  4DR2 Q;  1FVI A;  1XTC D;  1WTQ A;  1Z6H A;  4XQQ A;  5L37 A;  1KD1 C;  5BN5 A;  2WP8 J;  1LM0 A;  1H9S A;  1QIL A;  4K2K A;  1JJG A;  5GRO A;  3HFZ B;  5FLM H;  2NUC A;  1HR0 W;  4XDX A;  4FYD A;  1CKN A;  4X65 Q;  1F9S A;  3GTO H;  1K28 A;  2VNU D;  1Y8O B;  3BZD B;  5C0X I;  1LAB A;  2KHJ A;  1F77 A;  1HZB A;  2SNS A;  4X62 L;  4JI5 Q;  1EQT A;  3PUX A;  5C3E G;  3UDX A;  2RDG A;  3NTH A;  4N8F A;  1VQN A;  3F2D A;  1X3G A;  1I4P A;  4A3M B;  2RQX A;  3STB C;  1O7Z A;  2F4I A;  2F0O A;  1XNQ L;  4FDB A;  4OO1 G;  2DN8 A;  1RIP A;  3D6C A;  4GN5 A;  1YNJ D;  4JI1 L;  5JPN C;  1NR4 A;  1RDP D;  3GTQ H;  4FO2 A;  1H9J A;  3QB3 A;  2Z8L A;  1JIC A;  1PDQ A;  4Q5V A;  2NYZ D;  2Z0S A;  5KYL A;  4DK3 C;  3D0F A;  1I50 B;  2K75 A;  2A6H C;  3CHB D;  5M5X H;  3P1H A;  4X6A H;  2XN9 C;  1FNW A;  2EYJ A;  4ZUI A;  3J81 E;  3I4M H;  4BBS B;  1Q46 A;  3AFQ A;  3J7A V;  1ZEQ X;  1EUJ A;  2KED A;  1K0S A;  1K83 H;  5IP9 H;  4JI7 L;  2RCF A;  4K0K Q;  1TWF H;  3X3N A;  3Q22 A;  3S1R H;  1A2U A;  4YCU A;  1NCV A;  4IAL A;  1EY8 A;  1EQQ A;  3NHH A;  1ASY A;  5FLX E;  2NWG A;  1PTO C;  1JOO A;  3TRZ A;  2HCC A;  4POF A;  2RA4 A;  1OO9 B;  1XJV A;  3JAM c;  2NVQ B;  1QB5 D;  5FO9 B;  4BBR B;  1QNK A;  1LT3 D;  4LUO A;  3J7A 5;  5IYD G;  3CCJ A;  1V1P A;  5LL6 X;  3CC7 A;  4RKL A;  1X3E A;  2JP1 A;  2F0F A;  3K5N A;  1STY A;  1I94 L;  5EPJ A;  4YY3 L;  1UUP A;  3S2H H;  3EN2 A;  3D6W A;  1J9O A;  4HJ5 A;  4LFC Q;  1SYD A;  5ELN A;  1QCB D;  3J80 c;  1A2T A;  3Q8D A;  2UUB L;  2AQ1 B;  2KHS A;  4RFB A;  1ZYR C;  1NNX A;  2OTL A;  3K58 A;  2F0P A;  5TSS A;  2L55 A;  4K5X A;  1B70 B;  4GNX C;  1DOM A;  3IRB A;  4LFA L;  3QJY A;  2XNA C;  2HT1 A;  2CH4 W;  3DWQ A;  4A4I A;  2EXD A;  2GVB A;  3K5O A;  3QIA A;  4KV6 A;  1SR3 A;  4O1N A;  5F2D A;  1LT6 D;  3WWV A;  2Q8T A;  1DGS A;  4IUR A;  3EA6 A;  4C3H B;  3MTS A;  4FF2 A;  2BOS A;  4AQY L;  2OQ0 A;  4R9W A;  3W2D A;  4DV7 Q;  1S5C D;  4JV5 L;  3GTM H;  4K5W A;  4K6L A;  4TSS A;  1VQL A;  2UXD Q;  4PV1 C;  1Q8I A;  2JA8 G;  5EKK A;  5LHY 1;  3K8A A;  2A74 C;  2IHE A;  4BA1 I;  4DUY L;  1J6Q A;  1Y1V G;  5ISR A;  4QQB X;  2JK8 A;  3BDO A;  3PUY A;  4ODG A;  2HUG A;  2DGY A;  3T13 A;  3OYY A;  4RGN A;  1BKB A;  1VQO A;  3C3L A;  3EIV A;  4UP7 A;  3A8J E;  4IFD H;  2KCC A;  3UE1 A;  4DV3 L;  1KLU D;  1OXU A;  1YNX A;  3ER0 A;  1NR2 A;  2NZH A;  3ND9 A;  4N9T A;  1MSG A;  4KKS A;  4IUU A;  3T4A C;  1LTG D;  4IZ8 A;  5A2Q E;  1KIX A;  1I3Q B;  2C35 B;  1YNJ C;  5AFW A;  4DXF A;  2RVL A;  4QUC A;  5J22 A;  5C6A A;  1RTO A;  3I70 A;  1CTM A;  1JCK B;  2NB0 A;  5KEE A;  3FPP A;  1CHQ D;  3SHL A;  2IL8 A;  4NB3 A;  1JJC B;  3N6R A;  3DEP A;  5J39 A;  2KOL A;  4JBJ A;  4KLK A;  1VQC A;  4LF9 Q;  1IZ6 A;  4DAM A;  5C5L A;  3PO2 H;  1Q8K A;  4ULL A;  3RN5 A;  3CMA A;  4JW0 A;  2RKS A;  3RZO H;  5DLQ E;  4KY5 A;  3IAY A;  3FRP B;  4A3D G;  5IWA L;  2R61 A;  4K8I A;  2FXQ A;  4WJ3 M;  1EOT A;  1I4X A;  1NTG A;  4RGO S;  3L0O A;  4JI8 L;  1G2S A;  3DMU A;  3KF8 B;  2LKV A;  5K36 H;  2QCP X;  3R2I A;  1A3T A;  2CKZ B;  1F9Q A;  4BBS H;  3F2C A;  3TQY A;  1HUN A;  5C0X H;  1PZK D;  2KUM A;  3S15 B;  2VQE L;  5C3W A;  4FF4 A;  5ELF A;  1XXG A;  4HIK A;  1HPC A;  2K14 A;  2EXZ A;  4LW1 A;  1VQE A;  2EZV A;  3MVV A;  3PIP A;  3V05 A;  1PTO F;  1S72 A;  1PYS B;  3GQB A;  2ENB A;  1PFS A;  3SK4 A;  1AZP A;  4OXP A;  2K33 A;  3JC6 6;  2AQ2 B;  2GN5 A;  3AYH B;  2OCE A;  2UUA Q;  4JBW A;  2K4K A;  2F0U A;  4GLX A;  3M9B A;  1Y69 U;  4DA2 A;  3H3V H;  1ML0 D;  1ROD A;  2G5D A;  3S1N H;  2EOT A;  3TP8 A;  5K5P A;  5DNF A;  3CRL C;  1LYL A;  3OTO L;  1XPR A;  5EBD A;  5M5W H;  3TRE A;  1PH3 A;  4NMZ A;  1Q3L A;  2R92 B;  5HUR A;  1JOR A;  3KFU A;  2EPB A;  2AHO B;  3ZYY X;  4TRD A;  3M4P A;  4DR7 Q;  3CC4 A;  3PUV A;  4IPG A;  4KJN A;  4DAY B;  2QEX A;  2G9D A;  4GZY C;  2VS1 A;  3CQZ B;  5EPK A;  5IY0 A;  2ES2 A;  1SFO H;  5T1G A;  3PF4 A;  3A8I E;  1SLJ A;  3G71 A;  4DUZ L;  5CMD A;  4J1M A;  3KJO A;  2E2H B;  5KGU A;  1W6J A;  3S14 H;  3F2U A;  3FPU B;  1YJN A;  1F2Z A;  5BN4 A;  5IE8 A;  3JAM E;  2K5N A;  4FXD A;  4JG2 A;  3LX0 A;  3M3Y H;  3HOY H;  4PMC A;  1P8L A;  3U4V A;  4B9X A;  1JT8 A;  5I6Y A;  3KDF B;  4JI4 L;  2XRQ D;  2E8G A;  3PUW A;  1AE3 A;  3A5U A;  2QEJ C;  2MHV A;  3C1F A;  1ZKO A;  3BZK A;  5I9P A;  1C8C A;  4R8I A;  2N3S A;  1O80 A;  5IOD A;  1QNU A;  1PTO B;  1PA6 A;  2F0G A;  4NXN L;  4DR4 L;  2EY6 A;  4U68 A;  1RJT A;  1SE4 A;  2L5T A;  1N32 Q;  4PMW A;  4LF6 Q;  4L6T B;  3LNN A;  1BO0 A;  2OWO A;  4F7X A;  1YJW A;  2K04 A;  4CJ0 B;  2FJ2 A;  1EL0 A;  4C3J G;  1KXL A;  1NBW A;  1S5B D;  3MFG A;  2PNR C;  3BVZ A;  3OW2 A;  4HID A;  3CW2 C;  5M3M B;  1XMO Q;  1O7I A;  1Q81 C;  1PH5 A;  1X3F A;  1CQV A;  5M3F B;  2N8N A;  4KHZ A;  4KN4 C;  1IW7 D;  5C4X H;  5IYB H;  4HIO A;  2MJ8 A;  1G2T A;  2AWN A;  4B3T L;  1HA5 A;  4G7Z C;  3SK6 A;  1PYB A;  3FMC A;  4YCW A;  3HOU G;  4IJL A;  1X6O A;  1ENC A;  4JI0 Q;  1BCP D;  3S1Q B;  4GKK L;  1E24 A;  4BXX H;  2L11 A;  2K5H A;  1GO3 E;  1WTO A;  4PZ7 A;  2KJX A;  1I6V C;  1H9M A;  4YHH Q;  1UE1 A;  1NJI C;  4A93 B;  1ILQ A;  1OXS C;  1TY2 A;  3K5L A;  1SMX A;  4DNT B;  1KNE A;  1A63 A;  4CJ1 B;  3D8G A;  1DM0 B;  3A7L A;  3MXN B;  2LMC B;  4FXG C;  1YZ6 A;  4Z9C B;  2IX1 A;  3TP7 A;  2GA4 B;  2E2J B;  3HG9 A;  3CPF A;  2C9O A;  3KBX A;  1S3O A;  1TWA H;  4HED A;  5D14 A;  2A6E D;  4OO1 I;  2F3W A;  4DV2 L;  4A3E G;  1UAP A;  1XWE A;  3RLF A;  4OHJ A;  1EFW A;  2I46 A;  3S1M H;  4M1U B;  2JA5 B;  2B8G A;  3GTP H;  4I65 A;  2B2Y A;  4A3F G;  1TT2 A;  3HS0 C;  1JOQ A;  1Y1W H;  1EWH A;  3BU2 A;  1Q90 A;  2B63 H;  1T5X D;  3H15 A;  4IFD J;  2KCT A;  2J0T D;  2ZTD A;  3DEO A;  1H95 A;  1Q7Y C;  5EKI A;  4ZUJ A;  1G8Z D;  1A6X A;  1SMY D;  3FDT A;  3DM1 A;  5ELO A;  1QVG A;  3CPW A;  1MI2 A;  1LTA D;  2OXP A;  1Z47 A;  1IXR A;  5D3D A;  4A3I G;  4R4I A;  4EQN A;  1J8I A;  2EYO A;  2HHH Q;  4R4T A;  4K8J A;  3GTG B;  5C3E B;  2EE1 A;  4Y7N H;  4JYA L;  1K73 C;  1L1O A;  4LF4 Q;  4MNO A;  4KKU A;  3MFY A;  4KN7 C;  5GAH C;  4ID6 A;  4O2D A;  4BY7 H;  2EIF A;  1DCZ A;  1E1T A;  1LLR D;  2A68 C;  2EDG A;  1CI3 M;  4HJ8 A;  1GD7 A;  4RH6 A;  1N36 L;  2N78 A;  2QDB A;  3FHW A;  5C44 G;  2YYZ A;  4DFA A;  1KAA A;  4P2C B;  4CKE A;  1V8Q A;  3BYT B;  3K0X A;  2UUC L;  1D1K A;  2M2L A;  1AE2 A;  1OXT A;  2KQ3 A;  5GQO A;  4BS9 A;  4DV6 L;  5IGD A;  1HNX Q;  1O7Y A;  3I4L A;  2LS0 1;  1QZG A;  2LFN A;  1A3V A;  3C2P A;  3BG3 A;  2EJM A;  1FYC A;  2RF4 A;  5IT9 L;  2VQF Q;  4N9P A;  5C0X J;  3FEW X;  3ICE A;  1A62 A;  1Y14 B;  2B2W A;  4JOI A;  2I5L X;  1VS0 A;  1SYB A;  2NZ1 D;  1I5F A;  5CV9 A;  1HTP A;  2PZU A;  1WCM H;  3HOZ H;  3NXW A;  4JI2 L;  2Z4H A;  2CW0 D;  2G9H D;  3RZD B;  5EGT A;  4A3K B;  1IW7 C;  1X56 A;  4EQ5 A;  2K5D A;  1XNR L;  1LV9 A;  2JA6 G;  2M00 A;  2KEC A;  1YHB A;  3GV6 A;  5LMN Q;  1PV4 A;  3OMG A;  2Z4I A;  1BCP C;  4JC0 A;  4A3G H;  4OWX B;  2L9H A;  1GXD C;  4DV0 L;  4MTK A;  2K5V A;  4IUV A;  2PI2 A;  4K2L A;  4GOP B;  4LF7 Q;  3VYT A;  4OIJ A;  3M4Q A;  1K8M A;  3Q24 A;  3RLO A;  2ZM6 Q;  1UWV A;  4QMG A;  4BY1 H;  4BA2 I;  3E5S A;  3I3C A;  4FF1 A;  1LT4 D;  1KHI A;  4DR6 L;  3PO3 G;  1VQK A;  2A6E C;  2PZW A;  3S1Q H;  3NPP A;  1UE7 A;  1VQD A;  3E0J A;  1ONL A;  3CCM A;  2H4O A;  2F0D A;  3I90 A;  4L8J A;  3X3M A;  3GTK B;  4OX9 Q;  1I4Q A;  1KL9 A;  1YEZ A;  3K7U C;  2I0Q A;  1Z7T A;  2ICI A;  1TWG B;  2TMP A;  2VUM G;  4JPB W;  2NN6 I;  4C3I H;  4DV1 L;  4X66 L;  5C4H A;  2E2J H;  4J8Q A;  1QUQ B;  1HR0 Q;  1C0A A;  2QKI C;  5FJ8 G;  2NBF A;  2JA8 B;  2F3V A;  4K5V A;  3TEH B;  2QDL A;  3DHQ A;  1WD0 A;  4UY8 C;  3H09 A;  1SMY C;  1Y1V B;  2MGS A;  1WVL A;  1IBK L;  1U5K A;  2JEA I;  4YWM A;  4ZKB B;  3D4D A;  2MFI A;  1SJE D;  3TZU A;  4LF5 L;  2V1C C;  5IGF A;  5D3I B;  4CHT B;  2EYF A;  4C2M H;  2NVX B;  1JR0 D;  1R4Q B;  3SEB A;  1NSN S;  3R3O A;  4A3B H;  1YHQ A;  2AUK A;  4B3S Q;  1VQM A;  4ZRZ A;  3K57 A;  1DOK A;  2F0W A;  3TS0 A;  3L7Z C;  3TDQ A;  4PZ8 A;  4G4K A;  2VXW A;  2ZTE A;  3MEF A;  3HOV B;  1H9S B;  3H0G H;  4G57 A;  3V96 A;  1EU3 A;  1EEF D;  1SND A;  5JOB A;  5G3L D;  1DON A;  4QB4 A;  3HOX H;  3KF6 B;  1B53 A;  5JVG 3;  3M4O H;  1CKN B;  2R3Z A;  3LWE A;  4IO9 A;  2VZA A;  4DV5 Q;  4OO1 H;  2OEO A;  4IUT A;  3BDL A;  1NUC A;  5JEA J;  3NTK A;  3I4N G;  4A3D B;  1PFN A;  3H94 A;  3AQQ A;  2B2U A;  1EIF A;  1TWH H;  4A3L G;  2NVT B;  1K3R A;  5CV8 A;  2FMM A;  2E2I B;  3CCV A;  4KD4 A;  3K0Y A;  1VF5 C;  3I4O A;  5JAV A;  3C1E A;  2MO1 A;  2UXD L;  5LMU Q;  1E3P A;  4JI6 Q;  2JA7 G;  2A5H A;  3MC0 B;  2MNA A;  1AP0 A;  3GD7 A;  4A3J H;  4IUN A;  3S2D B;  2F0Q A;  2NVY H;  5E4W C;  3QWN A;  3H3V I;  3CME A;  1KDC A;  1X65 A;  1MKH A;  2D2C C;  4RWS C;  3U4Z A;  1PH4 A;  3E6Z X;  2WFW A;  2UXB Q;  4V19 0;  4I7Z C;  1E2Z A;  2CQA A;  4RMF A;  2D0P A;  4L5T A;  2UU9 Q;  5I6W A;  1K8A C;  1EIG A;  2VB3 X;  3GV3 A;  4MTN A;  2OF1 A;  5FLM G;  3RZD H;  4PQX A;  4LF8 Q;  5C4J B;  2CWA A;  4NXM L;  5J1Z A;  4L5R C;  4RCN A;  2HIV A;  2H1E A;  3HOW H;  5GAG C;  2B3G A;  1BCP F;  3F8T A;  1FJG Q;  2HQE A;  1JC7 A;  1YJ9 A;  1EZ6 A;  3I55 A;  3T1H L;  3L9A X;  1N34 Q;  2RHS B;  1YNN D;  3NWS A;  5EAY A;  1EY4 A;  3IFD A;  5M5Y B;  3OW7 A;  1N9W A;  4I7A A;  4A76 A;  3LGJ A;  2M9V A;  1I4G A;  3VA5 A;  1TVX A;  1V1P B;  4ME5 A;  4P71 A;  1CQF A;  4A3K G;  2K05 A;  1JWS D;  1J5E Q;  4QF4 A;  1W2B A;  1R9T B;  3ULJ A;  1HCZ A;  4EQO A;  4LFB Q;  3S16 H;  3HRZ C;  1EZ8 A;  1ET9 A;  4IOC A;  1I6H B;  4MIU A;  1E7Z A;  5IYC H;  3AFP A;  3TP6 A;  2JQO A;  2ZXP A;  1AN8 A;  1S5E D;  4L5S A;  4DR1 L;  2BA1 A;  3CKI B;  2F0K A;  1FD7 D;  4HSP A;  1SNQ A;  3BZC A;  5IP9 G;  1KDB A;  1WI5 A;  1VQA A;  1TXY A;  2CWP A;  1F9R A;  3A54 A;  1B9N A;  5IGG A;  1VQB A;  3U9O A;  4XXE A;  4C3J B;  2UUA L;  1UEA B;  3CAM A;  3G48 A;  1IBL Q;  3HP3 A;  1RL2 A;  1BCP B;  3J7Z C;  4CDF C;  1KDA A;  1Q1E A;  3S17 B;  2RSN A;  1LTB D;  3QG1 A;  1BBU A;  2K6A A;  2OTJ A;  4OL7 A;  2MUY A;  5JJK A;  1OXV A;  1EEI D;  3HOU B;  4WJW A;  2B2Y C;  5KIX A;  4UHV A;  1IL8 A;  1ENF A;  2MQH A;  3T51 B;  5I9O A;  1HZ9 A;  2N49 A;  1AEX A;  1IBM L;  1JE5 A;  2AMC B;  2PQA B;  1DXM A;  3MXG A;  2CQO A;  4WRD A;  4FXK C;  5CBE E;  5BR8 L;  5C3X A;  3WOE A;  2NN6 H;  4DV4 Q;  4UDU C;  4X62 Q;  3NBH A;  1PFB A;  2RCN A;  1LTR D;  1Z9F A;  1VMC A;  4PZ6 A;  1K3B C;  1XNQ Q;  2WII B;  1B9M A;  1EYG A;  4P74 A;  4RAU C;  4JI1 Q;  3VR6 A;  1L1O C;  4A3E B;  3CCR A;  3BVM A;  2D0O A;  2E5L Q;  4OEM B;  1GUT A;  4J15 A;  1YBY A;  1Q1B A;  4GN3 B;  1PH2 A;  2F1M A;  3D4R A;  4ME3 A;  5H1S E;  4A3F B;  3HOV G;  2F0L A;  3VDY A;  1MD2 D;  3KJP A;  2F0J A;  5COR A;  5T1I A;  2AUJ D;  1NMG A;  4A3M H;  2B39 A;  4B3R L;  3ZJY C;  1HNZ L;  5DEH A;  3DWA A;  1JB7 A;  3KLR A;  4X64 L;  5CR3 A;  1YIT A;  2AQ3 B;  2PW7 A;  3SE0 A;  4HCE A;  2KCN A;  1LTS D;  5ELE A;  4JI7 Q;  1B50 A;  2QW7 A;  2F4V L;  2WIN B;  1D2B A;  1ICF B;  1K8G A;  4IFD G;  4A3I B;  4HJ7 A;  1I50 H;  3OOC A;  4DK1 A;  3D4W A;  3NP8 A;  1DZ1 A;  1BQQ T;  1GKH A;  3EFX D;  1SXT A;  3T1Y L;  2R93 B;  2EY1 A;  4P72 A;  3HKZ G;  1ET6 A;  2L12 A;  3MEH A;  2B2W C;  4JOI C;  4CDD C;  4DK6 C;  2F0I A;  4CKB A;  4B9W A;  4PNY A;  2HDL A;  3BVG A;  4JI3 L;  2PI2 E;  4KHP L;  3MAQ A;  1JQY D;  2DNE A;  4DNR B;  4DR3 L;  4XYQ A;  1WTH A;  5C44 B;  3GO5 A;  1K0R A;  1I94 Q;  4YY3 Q;  1SAP A;  1ZXT A;  1HTL D;  1HUM A;  4NKL A;  1VQP A;  3SK8 A;  4UPA A;  3GTJ B;  1N33 Q;  4UP9 A;  3PO2 G;  4XYO A;  2DY7 A;  4M8A A;  2NVQ H;  4PG3 A;  2I07 B;  3I56 A;  3CCQ A;  1STN A;  2ZTC A;  1VQ4 A;  2B29 A;  2UUB Q;  4BBR H;  4IPC A;  2JSO A;  4HJ9 A;  5JJL A;  1T9H A;  4JK1 C;  1HA6 A;  4DKA C;  2DUD A;  3ND8 A;  1TR5 A;  2EY2 A;  3A0J A;  2BH8 A;  3EQL C;  4DR5 L;  4LFA Q;  4IOA A;  2CHB D;  3A7A B;  1X54 A;  1SEB D;  2ZXO A;  3WDN A;  5AJ3 L;  1PZI D;  5K36 G;  1PYW D;  1SYE A;  1M8A A;  3A74 A;  4AYB E;  3NWT A;  1JE4 A;  2MO0 A;  2F03 A;  1E2W A;  5C0X G;  4AQY Q;  2JA9 A;  2O5J C;  3M7N A;  2JA6 B;  3I73 A;  1SRO A;  1XX8 A;  3NEN A;  2EY5 A;  2IPK D;  4JV5 Q;  5JJI A;  2Q2I A;  5HY6 A;  4TQU S;  2YU9 B;  4C3J H;  4JBM A;  5DAU A;  1KLG D;  2Y0S E;  1D5M C;  3CCL A;  4DAY A;  1QE6 A;  4DUY Q;  3PIO 3;  2OT2 A;  1SN8 A;  2V4D A;  4C3H H;  3UI2 A;  1U4R A;  3T56 B;  3FKI G;  1U4L A;  5G3L F;  2K01 A;  5IOC A;  1STH A;  3OPO A;  3GTL B;  5JJZ A;  1YI2 A;  4DGZ A;  3PO3 B;  4G7O C;  3WOF A;  1RHP A;  2Z1C A;  2B2V A;  2KEN A;  1FGB D;  1K9M C;  2R7Z B;  1SSO A;  2QGQ A;  1II3 A;  5E4X A;  5IGE A;  4C1N I;  2VQF L;  4DK0 A;  2VUM B;  2ASB A;  1D5Z C;  5IP7 G;  4Q0F A;  3EVQ A;  3HOY G;  1I3Q H;  1CUK A;  2PPB C;  1EYD A;  3QO2 A;  4CKC A;  1BR9 A;  4GNX B;  4POG A;  4EX5 A;  5IWA Q;  2BH2 A;  4K6D A;  3AMU A;  5KRU A;  3J81 j;  3HKZ E;  1DD2 A;  3MXP A;  2I5H A;  1GUS A;  4JI8 Q;  4GKJ L;  4XT3 B;  2B2U C;  5FLX L;  5JEA H;  2C5C A;  4ZYS A;  4B3M L;  3J7Y W;  1HHV A;  4GLA C;  3F1Z A;  3PSI A;  1EIH A;  3QR8 A;  1HNW L;  1EY7 A;  4KI0 A;  1TS4 A;  2DJF C;  5KNC A;  5CGK A;  2I5M X;  3TN2 A;  2VQE Q;  1Q82 C;  2QF7 A;  1E0B A;  4LWC A;  4MHE A;  3PGZ A;  5C4X G;  5IYB G;  1VQG A;  2P5Z X;  3D3R A;  1A3U A;  1NY4 A;  1BUV T;  2VY3 A;  2F0V A;  1EY5 A;  1I4R A;  1TII D;  2JN4 A;  4NP5 A;  4HMI A;  1PRT D;  2QIL A;  4BXX G;  1VQF A;  2R7D A;  4ALP A;  3P75 A;  3I4N B;  3S15 H;  4K14 A;  4OX9 L;  2NTT A;  3OTO Q;  1VQ8 A;  1XMQ L;  2L1B A;  1HZC A;  1L1O B;  1ENA A;  1TY0 A;  2X69 A;  4R4Q A;  1GHK A;  1C9O A;  2K7V A;  2JA7 B;  2R93 G;  2UXC L;  5EBC A;  4EGV A;  4G7H C;  3M4Y A;  2WB1 G;  2PCF B;  4DUZ Q;  1I4H A;  4H7B A;  3W1G A;  2E74 C;  1C7Y A;  3KK7 A;  1KAB A;  2BDO A;  2R92 H;  1GUN A;  2EJF C;  4QY7 A;  3SR1 A;  3M7G A;  1W3S A;  1Y1W G;  3CQZ H;  1QJO A;  5DM6 3;  2F3I A;  2K5Q A;  2Q2T A;  4JI4 Q;  3W1B A;  4DPG A;  1G6Z A;  2EYL A;  4RKB A;  5HGQ A;  4B3S L;  1CFM A;  2E2H H;  3GTO B;  3PV0 A;  2QA4 A;  1QVC A;  3SXH A;  4NXN Q;  2PZT A;  2PYK A;  2VB2 X;  3CCU A;  3CD6 A;  1PH8 A;  5KYI A;  4DR2 L;  1TS5 A;  3CCE A;  3H3V C;  3RUZ A;  4NW2 A;  3V2T A;  2R7F A;  5A2Q L;  1SNO A;  3NQT A;  3C46 A;  1CA6 A;  1B8A A;  2BA0 A;  4H02 A;  4X65 L;  1BNZ A;  1PTO H;  3A8K E;  1CT1 D;  1QOH A;  4A3C G;  3K6O A;  3R93 A;  1JMC A;  3GTQ B;  3HKS A;  5E7N A;  1S5D D;  5ELB A;  4GLV B;  4B3T Q;  4JI5 L;  4MZ9 A;  3BDC A;  5LMU L;  1WTX A;  2XIW A;  1KNA A;  4E6I A;  5M5X B;  4GKK Q;  4CGY B;  5KNB A;  1IKL A;  3SGI A;  3I4M B;  3IL8 A;  3STB D;  5M3M H;  1VQJ A;  1EY9 A;  4LAA A;  2K28 A;  2KBN A;  5M3F H;  1CHP D;  3K7A B;  1WTW A;  4H44 C;  2HD3 A;  1TWF B;  2RDH A;  3S1R B;  2E2D C;  1NE3 A;  4LUZ A;  3SK5 A;  2JE6 I;  2J4X A;  2N55 A;  1AW7 A;  3U58 A;  3ONA B;  1XPO A;  4KJO A;  4KHV A;  5CV7 A;  3TME A;  1WCM G;  1CKO A;  1RKN A;  1G29 1;  1IL2 A;  4J6H A;  3F2B A;  3K80 C;  4DV2 Q;  4R4O A;  2F0T A;  4H13 C;  1GJX A;  4GOP A;  3MXU A;  2R7Z G;  4A93 H;  4O42 A;  3EJI A;  2ZJR A;  4K0K L;  4AYB B;  5HGT A;  3BS1 A;  1SNC A;  1GVP A;  1STA A;  4OGQ C;  1PRT C;  2PMZ E;  2WAQ E;  3OMC A;  3S2H B;  4A3G G;  1B3A A;  4KY6 A;  2F0M A;  1EWC A;  1PTO D;  2PW5 A;  1ESF A;  2XWB B;  4A75 A;  2JA5 H;  1WYD A;  2IHF A;  4QL5 A;  4JCV E;  2WB1 E;  2Y0S B;  4KKT A;  4DN4 M;  2B8F A;  5FOB B;  1GUO A;  3NQI A;  1BBX C;  4JYA Q;  2JJQ A;  4LFC L;  5CV5 A;  1HFN A;  5IT9 c;  3UE0 A;  3I4N H;  1HFG A;  1EOV A;  1KTK A;  1STB A;  3ERQ A;  4U67 3;  1N36 Q;  2D62 A;  4GS3 A;  1D1I A;  3JAM L;  4HAE A;  3GTG H;  2EVB A;  5C3E H;  4P75 A;  4AIM A;  1D8L A;  4C3I G;  3Q23 A;  3GTM B;  1VCI A;  1F9P A;  2UUC Q;  1AZQ A;  1UE5 A;  3BYY B;  2HDM A;  4FF3 A;  4DV6 Q;  2SOB A;  4FVM A;  3U9S A;  4IPH A;  4ZKC B;  1D6E C;  1KRT A;  4WOR A;  3K59 A;  5COY A;  3RR5 A;  3S24 A;  3AEV A;  1BVS A;  3DLL A;  4C1N K;  2AKW B;  3N52 A;  3J80 L;  1D7Q A;  5CBA E;  1MBY A;  5J3B A;  3NK9 A;  4DV7 L;  1RD9 D;  1STG A;  3TSS A;  4LUV A;  1TU2 B;  1S40 A;  1WOC A;  1DOL A;  2CW0 C;  4JI2 Q;  3HKZ B;  4P73 A;  2Q2U A;  3KF6 A;  4R4C A;  4A3B G;  1M90 C;  3J80 i;  1U4M A;  2Z6B A;  4ZLT F;  1XNR Q;  4LNQ A;  4HR7 B;  3ITP A;  4DV4 L;  4DU9 A;  3H0G G;  1PLF A;  1PXU A;  5A35 A;  3G6E A;  1KC8 C;  4DV0 Q;  3M85 A;  3HOX G;  3PO2 B;  2LXK A;  2NZO A;  4LMQ D;  5ELD A;  5LL6 S;  2FMC A;  4CDE C;  3RZO B;  3RLN A;  4A3K H;  3K81 C;  3LWU A;  4UAI A;  2E5L L;  5IYD H;  1G91 A;  2HIX A;  2RDF A;  1UE6 A;  1BBW A;  5BN3 A;  1A8V A;  1CK1 A;  2ICE C;  3RD4 A;  3VR5 A;  3W3A A;  4DR6 Q;  4LF9 L;  3FVQ A;  1MGS A;  4YCV A;  3NSW A;  4DF7 A;  1L0X B;  3MZ5 A;  2K1B A;  2A1A A;  1QWY A;  3NTI A;  2DNC A;  1A15 A;  1Q86 C;  1UNS A;  4RGM A;  4A3J G;  3I8Z A;  3K7A H;  3PMF A;  4IQZ A;  2B2V C;  3HEJ A;  4DV1 Q;  2RHQ B;  4X66 Q;  1IYJ B;  2WAC A;  1XPU A;  1Q12 A;  1F2Y A;  4HTH A;  3IFT A;  1STE A;  4KD3 A;  3E0E A;  4RGT A;  2BE5 D;  3I4M G;  1O7L A;  3GTK H;  1V1Q A;  3S1N B;  1SJH D;  1IBK Q;  3FKI B;  1GHJ A;  4HJA A;  4XQJ A;  1TS3 A;  1TWG H;  2ATW A;  2XVS A;  2Z6K A;  4LF5 Q;  3HOW G;  1Y8P B;  5M5W B;  3DWP A;  1PRT F;  5I2Y A;  1ASZ A;  2IJ0 A;  2KHI A;  3VYS A;  2JA8 H;  2JXM B;  1N33 L;  4OON A;  1Y1V H;  2ZJP A;  2XWJ B;  3BJU A;  1TKW B;  1SFO B;  3VR2 A;  4RCO A;  3G4S A;  3I7F A;  5C4Z A;  2ZJQ A;  4DXG A;  3RMH A;  5JVH 3;  2Q8I B;  4R1J A;  3U50 C;  3VR4 A;  2IX0 A;  2DJG C;  3S14 B;  3DXJ C;  4QCL A;  4AYB G;  2FIN B;  1ESR A;  3ULP A;  1WTR A;  1EQR A;  1H9K A;  3M3Y B;  3HOY B;  2NVX H;  4DR7 L;  2L15 A;  2JYO A;  1EFI D;  5IYC G;  1VQ6 A;  1PH9 A;  4IUQ A;  2RSO A;  3SDZ A;  3KUP A;  4L5Q A;  4MN3 A;  5EKL A;  3FP9 A;  3IKJ A;  4DAV A;  5FO7 B;  1VQ7 A;  3I2Z A;  1U9R A;  3NBH B;  4HSV A;  3A5Z B;  4HMJ A;  4IPD A;  1SE8 A;  1IHZ A;  3HOV H;  1U0L A;  2Y0S G;  3VR3 A;  2A73 B;  1SRU A;  5E1F A;  3RNU A;  2TSS A;  4ZAI A;  4S3S A;  3E9H A;  3PIP 3;  1JWM D;  4A3D H;  2YTX A;  3GP7 A;  4CJ2 C;  5GAD C;  3SVM A;  1PRT B;  4XTC S;  1MJE A;  2NVT H;  2EYP A;  3E9I A;  2PQA A;  1GM5 A;  1SYF A;  1O78 A;  1CSP A;  1F2L A;  3H91 A;  2E2I H;  1N32 L;  5C4X B;  5IT9 E;  4LF6 L;  3DM3 A;  3UDF A;  1B4O A;  1SYC A;  4EVO A;  4XQN A;  1VMP A;  4PMB A;  1AH9 A;  1WTP A;  3S2D H;  1MJC A;  4CDC C;  4KY7 A;  4QUF A;  4NXM Q;  1XMO L;  4NDX A;  3I72 A;  4HN7 A;  1WFQ A;  2PMZ B;  2WAQ B;  3KYH C;  2NN6 G;  1YNN C;  3MA2 B;  3T1H Q;  4BWG B;  1T5E A;  2B2T A;  3OSO A;  4CBV A;  2R6G A;  4F8M A;  1CZG A;  1SE2 A;  1TWC B;  3CU7 A;  3CC2 A;  2WV6 D;  4JI0 L;  1CZW A;  3TP5 A;  1BDO A;  1TWA B;  4F87 A;  5C4J H;  2WKC A;  4TVA B;  2WB1 B;  1Y8N B;  3J7A F;  1QZH A;  1E2V A;  5IIF A;  4YHH L;  4XIG S;  2Q2H A;  1YVC A;  1IYV A;  1PH6 A;  3S1M B;  1C48 A;  3HZX A;  3CCS A;  3GTP B;  3VA7 A;  3DUZ A;  2O2L D;  5KND A;  4L63 B;  5NUC A;  3PF5 A;  1SE3 A;  2BE5 C;  1Y1W B;  4Y52 H;  3KF8 A;  3QOJ A;  5M5Y H;  4A3M G;  1VQ9 A;  2B63 B;  4WJ4 A;  3AB9 A;  4RHS A;  2PQE A;  1VQI A;  1BXT A;  4DR1 Q;  1X55 A;  2IX3 A;  2IW3 A;  3CP0 A;  2VW9 A;  1BOS A;  2L4N A;  2H5X A;  4RG1 A;  1R9T H;  1RCV D;  3VYU A;  4YIJ A;  1B2T A;  2LY7 A;  1I6H H;  1SBB B;  1X32 A;  3UDG A;  4Y7N B;  1PHJ A;  5DM7 3;  3UDI A;  5EQ0 A;  2OQK A;  4HIM A;  1HRJ A;  4BBS G;  1IKM A;  3FKI H;  5CV6 A;  1SNM A;  4BY7 B;  3TZD A;  4QJF A;  4GOP C;  1OXX K;  4XT1 B;  2L0C A;  2HHH L;  3B6Y A;  3NEL A;  1DJR D;  1RF2 D;  1S5F D;  1MSH A;  4KMU C;  1UEB A;  1HQM C;  1PMR A;  3QOL A;  4LF4 L;  1LTI D;  1B1Z A;  3GDE A;  1IBM Q;  1EY6 A;  4QIW E;  4BBR G;  3VYR A;  2X6L A;  3TS2 A;  3S17 H;  2F0S A;  2Q8R E;  5BR8 Q;  3NE5 B;  5EJW A;  4ZK9 B;  2FFK B;  1AFP A;  4DV3 Q;  1JB3 A;  2A68 D;  5IP7 H;  1W6K A;  3HOU H;  3TBI B;  3ULL A;  1PH1 A;  3PCO B;  4AH6 A;  2IT1 A;  1WCM B;  3HOZ B;  2ZXR A;  1LTL A;  1HNX L;  2PO4 A;  1L0W A;  3KDF A;  5D65 A;  4HCS A;  1EYA A;  2XTI A;  5E3F A;  2LSS A;  1X9N A;  3J80 E;  2HCI A;  3R8B A;  3H6M A;  4YWK A;  4OWW B;  3URY A;  1PZJ D;  3T16 A;  1HXY D;  4B3R Q;  1HNZ Q;  4A3G B;  1FGU A;  3J81 L;  4X64 Q;  1WTV A;  2D5D A;  1HJP A;  4A3E H;  3R2T A;  4DAP A;  4C3H G;  4YWL A;  2LXJ A;  1M4V A;  5JPM C;  2F4V Q;  4IUP A;  4BY1 B;  4A3F H;  1SDF A;  5LMN L;  5EPL A;  4APV A;  2YTV A;  3J81 i;  3Q0A A;  2A8V A;  1NAP A;  3T1Y Q;  1EU4 A;  1DYQ A;  1V1O A;  3KLS A;  2CFM A;  1N8R C;  5ELC A;  1EY0 A;  4JI3 Q;  1KAW A;  4LF7 L;  4KHP Q;  4GNX A;  2WKD A;  3MHB A;  2ZM6 L;  5I2X A;  4DR3 Q;  1FNV A;  2F0H A;  4A3I H;  1YHA A;  2ID0 A;  2F52 A;  2ZT9 C;  1TWC H;  3PIO A;  4C3I B;  5FKA C;  2A19 A;  2X6G A;  2R93 H;  3NUC A;  2SEB D;  3MXN A;  3HGB A;  4RA8 A;  1P16 A;  3OHX C;  3NEM A;  3NBI A;  1PVO A;  2BDN A;  4LK1 C;  3W5O A;  2PNH A;  1C4Q A;  2WAQ G;  2K50 A;  3AU7 A;  5C44 H;  3O13 A;  5CYU A;  2IY5 B;  3P7J A;  2FHT A;  4OWT B;  4DR5 Q;  1XTD A;  3GTJ H;  5AJ3 Q;  2KEE A;  4ZQ3 A;  5JEA G;  1ICW A;  3G6J B;  1E22 A;  1HR0 L;  4OEL B;  1TQO A;  1F2M A;  4C2M B;  3G7L A;  4FNF A;  1QG7 A;  3I91 A;  5IGB A;  1LTT D;  4A3B B;  2XSC A;  1H9R A;  1KRS A;  1EQV A;  2O5I C;  1VQH A;  3A56 A;  1PH7 A;  2EJG C;  3H0G B;  2E76 C;  2A69 D;  2F0E A;  3A55 A;  5FK9 C;  2B63 G;  3HOX B;  1JOK A;  1B7Y B;  1LO5 D;  3M4O B;  1HZA A;  1D5X C;  1QVF A;  1BF4 A;  3E3X A;  1IYU A;  2XGT A;  4A3C H;  2E75 C;  2JA6 H;  2O4X A;  3Q6S A;  1XYI A;  1S4Z A;  4DNI A;  2N88 A;  4DR4 Q;  1A0I A;  1TWH B;  3J81 c;  1OTC A;  4X3K A;  3KBG A;  4C56 C;  4NPS A;  3EBE A;  1JJ2 A;  1E1O A;  1PFM A;  1V9P A;  2K52 A;  1VQ5 A;  2YU9 H;  4JBK A;  3L2P A;  1GUG A;  2Z6K C;  4UP8 A;  4DV5 L;  5IGC A;  2IWH A;  1HQR D;  5FLX c;  4A3J B;  3S9W A; 
#chains in the Genus database with same CATH homology
 3KF6 A;  4R4C A;  3CXC A;  4LF6 Q;  4A3B G;  4BY7 G;  1M90 C;  4PZ6 A;  3J80 i;  1XNQ Q;  2OWO A;  1XNR Q;  4GN4 B;  1EYG A;  1YJW A;  4P74 A;  4JI1 Q;  4LNQ A;  2R92 G;  3GTL H;  1L1O C;  3D31 A;  3CCR A;  1KXL A;  2D0O A;  3PO3 H;  2E5L Q;  4JI6 L;  1NBW A;  4DV4 L;  2VL6 A;  4J15 A;  1YBY A;  1Q1B A;  3H0G G;  4GN3 B;  1PH2 A;  3OW2 A;  1HH2 P;  3CW2 C;  4ME3 A;  5H1S E;  4HID A;  1NMF A;  3G6E A;  1O7I A;  1XMO Q;  3KOJ A;  3CF5 A;  1Q81 C;  4DV0 Q;  1X3F A;  3M85 A;  3VDY A;  1KC8 C;  3KJP A;  3HOX G;  1PH5 A;  2N8N A;  4KHZ A;  2LXK A;  5C4X H;  2NZO A;  5IYB H;  4HIO A;  2R7Z H;  1NMG A;  4A3M H;  4B3R L;  3RLN A;  3ZJY C;  2AWN A;  4A3K H;  1HNZ L;  3CC4 A;  4B3T L;  3K81 C;  1PYB A;  4GKJ Q;  1JB7 A;  2E5L L;  4YCW A;  4X64 L;  2VUM H;  2ALY B;  3HOU G;  4IJL A;  1X6O A;  2HIX A;  1WJJ A;  1YIT A;  1UE6 A;  1BBW A;  2UXB L;  4JI0 Q;  4GKK L;  1E24 A;  2GVA A;  4B3M Q;  4BXX H;  1A8V A;  5FJ8 H;  2K5H A;  2UU9 L;  4JI7 Q;  1GO3 E;  2F4V L;  4PZ7 A;  4LF9 L;  4DR6 Q;  1HNW Q;  3HOZ G;  3RN2 A;  4YCV A;  1K8G A;  4IFD G;  4YHH Q;  4HJ7 A;  1I50 H;  1UE1 A;  1NJI C;  4IJH A;  2A1A A;  4LF8 L;  1OXS C;  1SMX A;  1GKH A;  1Q86 C;  1FL0 A;  1A63 A;  3T1Y L;  3MXN B;  4O0A A;  3ERS X;  4P72 A;  3HKZ G;  4A3J G;  2YV5 A;  1G6P A;  3K7A H;  1YZ6 A;  2YTY A;  4DK6 C;  4JOI C;  2IX1 A;  1FJG L;  2KCM A;  3CPF A;  4JI3 L;  4QGU A;  1V43 A;  2PI2 E;  1N34 L;  1S3O A;  1TWA H;  4KHP L;  2AWO A;  4DV1 Q;  2RHQ B;  4X66 Q;  4OO1 I;  4DV2 L;  4DR3 L;  4A3E G;  5GAE C;  1IYJ B;  1XPU A;  3GO5 A;  1K0R A;  1Q12 A;  1I94 Q;  3RLF A;  4YY3 Q;  3HOV G;  1EFW A;  3S1M H;  3E0E A;  1EIY B;  1VQP A;  1EWI A;  5M3M G;  3GTP H;  4UPA A;  4A3F G;  1N33 Q;  1J5E L;  2CCZ A;  4UP9 A;  5M3F G;  3I4M G;  3GTK H;  4BY1 G;  1V1Q A;  3PO2 G;  1XMQ Q;  2NVQ H;  4PG3 A;  3I56 A;  1Y1W H;  3BU2 A;  3KLW A;  3CCQ A;  1IBK Q;  2ZTC A;  1VQ4 A;  2B29 A;  2UUB Q;  2B63 H;  3H15 A;  4LFB L;  4IFD J;  4BBR H;  4HJA A;  4IPC A;  2KCT A;  1TWG H;  2EQS A;  1KQS A;  2ATW A;  4IFD I;  4HJ9 A;  2Z6K A;  1T9H A;  2ZTD A;  5LMN W;  4LF5 Q;  3HOW G;  1Q7Y C;  5JJL A;  1H95 A;  1L2F A;  2UXC Q;  1ASZ A;  4DKA C;  2DUD A;  2KHI A;  1QUQ A;  3A0J A;  5ELO A;  2JA8 H;  2BH8 A;  1N33 L;  4DR5 L;  2HQL A;  4LFA Q;  3CPW A;  1QVG A;  4IOA A;  1X54 A;  4OON A;  1Z47 A;  1Y1V H;  5AJ3 L;  1IXR A;  4A3I G;  4A3L H;  4R4I A;  2ZJP A;  3BJU A;  5K36 G;  2HHH Q;  3A74 A;  4AYB E;  4A93 G;  4R4T A;  3I7F A;  3G4S A;  2ZJQ A;  1MIU A;  1G51 A;  4Y7N H;  4JYA L;  2MO0 A;  4R1J A;  1L1O A;  3U50 C;  1K73 C;  2IX0 A;  4LF4 Q;  5C0X G;  4MNO A;  2JA9 A;  4AQY Q;  4AYB G;  2JA7 H;  5GAH C;  3M7N A;  1LUZ A;  3ULP A;  4O2D A;  1SRO A;  1EQR A;  4BY7 H;  2EIF A;  3NEN A;  2JEB I;  2NVX H;  4JV5 Q;  4DR7 L;  1E1T A;  1YIJ A;  5JJI A;  1IBL L;  2L15 A;  1CSQ A;  4HJ8 A;  2Q2I A;  1GD7 A;  5IYC G;  2N78 A;  1N36 L;  3JAM i;  3PUZ A;  1PH9 A;  3FHW A;  5HY6 A;  4TQU S;  5C44 G;  2YYZ A;  1M1K C;  1VQ6 A;  4C3J H;  4JBM A;  4L5Q A;  2JA5 G;  1CKM A;  2Y0S E;  3CCL A;  3FP9 A;  4DR2 Q;  1FVI A;  4DUY Q;  3K0X A;  2UUC L;  1VQ7 A;  1SN8 A;  3I2Z A;  4C3H H;  3NBH B;  3A5Z B;  1AE2 A;  1OXT A;  4IPD A;  1SE8 A;  5GQO A;  4DV6 L;  2WP8 J;  1KD1 C;  3HOV H;  1LM0 A;  1HNX Q;  3FKI G;  1U0L A;  2Y0S G;  1JJG A;  5GRO A;  1SRU A;  3RNU A;  3HFZ B;  5FLM H;  1QZG A;  1HR0 W;  1CKN A;  4X65 Q;  3GTO H;  2VNU D;  3E9H A;  2RF4 A;  2VQF Q;  5C0X J;  1YI2 A;  5C0X I;  2KHJ A;  4A3D H;  3ICE A;  1A62 A;  1Y14 B;  2YTX A;  5GAD C;  4JOI A;  2I5L X;  4XTC S;  1MJE A;  1VS0 A;  1HZB A;  2NVT H;  1I5F A;  4X62 L;  3E9I A;  4JI5 Q;  2PQA A;  1GM5 A;  1WCM H;  3HOZ H;  2KEN A;  3PUX A;  1CSP A;  1N32 L;  5C3E G;  3UDX A;  2E2I H;  4JI2 L;  1VQN A;  1K9M C;  3F2D A;  4LF6 L;  1X3G A;  3DM3 A;  3UDF A;  3STB C;  1X56 A;  2QGQ A;  4EQ5 A;  2VQF L;  1XNQ L;  1XNR L;  4FDB A;  4OO1 G;  2JA6 G;  1RIP A;  4GN5 A;  4JI1 L;  2ASB A;  1AH9 A;  1YHB A;  5IP7 G;  3HOY G;  1I3Q H;  5LMN Q;  3GTQ H;  1CUK A;  1PV4 A;  3S2D H;  1MJC A;  4NXM Q;  4JC0 A;  4A3G H;  2Z0S A;  1XMO L;  4OWX B;  4PMW A;  4GNX B;  4DK3 C;  3D0F A;  1WFQ A;  4EX5 A;  4DV0 L;  4POG A;  5IWA Q;  2BH2 A;  2K5V A;  2K75 A;  3KYH C;  2NN6 G;  2PI2 A;  5M5X H;  4GOP B;  3T1H Q;  3J81 j;  3HKZ E;  1OTC A;  4LF7 Q;  4X6A H;  2R6G A;  2I5H A;  3M4Q A;  4JI8 Q;  3RLO A;  3I4M H;  2ZM6 Q;  4GKJ L;  1UWV A;  4BY1 H;  3CC2 A;  1Q46 A;  3AFQ A;  1EUJ A;  4BA2 I;  4JI0 L;  4B3M L;  1K83 H;  5IP9 H;  5C4J H;  4JI7 L;  4TVA B;  3F1Z A;  3PSI A;  4GLA C;  1TWF H;  4K0K Q;  4DR6 L;  1KHI A;  1QZH A;  1HNW L;  3S1R H;  4YCU A;  3PO3 G;  1VQK A;  4KI0 A;  4YHH L;  3S1Q H;  1UE7 A;  4XIG S;  2Q2H A;  1YVC A;  1EQQ A;  2I5M X;  1ASY A;  1PH6 A;  1VQD A;  2VQE Q;  1JT8 A;  1Q82 C;  3CCS A;  3TRZ A;  3CCM A;  4POF A;  4LWC A;  3PGZ A;  5C4X G;  1XJV A;  1KL9 A;  1YEZ A;  3K7U C;  3JAM c;  5IYB G;  1VQG A;  3PF5 A;  4OX9 Q;  2I0Q A;  4Y52 H;  4A3M G;  5M5Y H;  4WJ4 A;  1VQ9 A;  1NY4 A;  2VY3 A;  1VQI A;  4LUO A;  3J7A 5;  5IYD G;  3CCJ A;  1X55 A;  2NN6 I;  4C3I H;  4DV1 L;  4X66 L;  4DR1 Q;  2VUM G;  3CP0 A;  2VW9 A;  3CC7 A;  2E2J H;  1QUQ B;  1HR0 Q;  4BXX G;  1VQF A;  2H5X A;  1X3E A;  2R7D A;  4ALP A;  4RG1 A;  1R9T H;  1C0A A;  5FJ8 G;  1I94 L;  4YY3 L;  3S15 H;  4UY8 C;  3TEH B;  3S2H H;  3EN2 A;  4OX9 L;  4HJ5 A;  4LFC Q;  5ELN A;  3OTO Q;  3J80 c;  1VQ8 A;  3Q8D A;  1XMQ L;  1I6H H;  3UDG A;  1IBK L;  1U5K A;  1HZC A;  4YWM A;  2JEA I;  2UUB L;  1L1O B;  1PHJ A;  4R4Q A;  2MFI A;  3UDI A;  4HIM A;  2OQK A;  1C9O A;  4LF5 L;  4BBS G;  2V1C C;  2OTL A;  2R93 G;  2UXC L;  3FKI H;  4QJF A;  4C2M H;  1B70 B;  4GNX C;  3IRB A;  2WB1 G;  4DUZ Q;  4LFA L;  4A3B H;  1YHQ A;  2HT1 A;  3W1G A;  4A4I A;  4GOP C;  1OXX K;  4B3S Q;  1VQM A;  2EXD A;  2GVB A;  2HHH L;  1C7Y A;  3B6Y A;  3TS0 A;  1SR3 A;  3NEL A;  3L7Z C;  2R92 H;  4PZ8 A;  3WWV A;  1DGS A;  1UEB A;  4QY7 A;  4LF4 L;  1W3S A;  2ZTE A;  4AQY L;  3GDE A;  1IBM Q;  3MEF A;  1Y1W G;  2OQ0 A;  3CQZ H;  3H0G H;  2F3I A;  2Q2T A;  4JI4 Q;  4QIW E;  3W1B A;  4DV7 Q;  4BBR G;  4DPG A;  3TS2 A;  3S17 H;  3HOX H;  5BR8 Q;  3KF6 B;  5HGQ A;  4B3S L;  3M4O H;  1CKN B;  3GTM H;  4JV5 L;  2E2H H;  4IO9 A;  2VZA A;  4DV5 Q;  1VQL A;  4JBK A;  2UXD Q;  3PV0 A;  2QA4 A;  4DV3 Q;  1QVC A;  4NXN Q;  5IP7 H;  5JEA J;  2JA8 G;  3I4N G;  3CCU A;  3CD6 A;  3K8A A;  3HOU H;  1PH8 A;  3AQQ A;  2IHE A;  3ULL A;  1EIF A;  4DR2 L;  1PH1 A;  1TWH H;  3PCO B;  1J6Q A;  1Y1V G;  4BA1 I;  4DUY L;  4A3L G;  4AH6 A;  3CCE A;  1K3R A;  4QQB X;  2IT1 A;  2JK8 A;  3PUY A;  2DGY A;  2R7F A;  1LTL A;  3OYY A;  1BKB A;  1VQO A;  1HNX L;  1L0W A;  3KDF A;  3CCV A;  3EIV A;  3I4O A;  4UP7 A;  2MO1 A;  2UXD L;  3UE1 A;  1B8A A;  1E3P A;  2XTI A;  5LMU Q;  2BA0 A;  1OXU A;  4DV3 L;  1YNX A;  4JI6 Q;  3ER0 A;  4H02 A;  2NZH A;  2JA7 G;  4X65 L;  2LSS A;  1X9N A;  2MNA A;  4A3C G;  4YWK A;  1KIX A;  4OWW B;  1JMC A;  3GD7 A;  3HKS A;  2C35 B;  5E7N A;  4A3J H;  2NVY H;  4GLV B;  3H3V I;  4B3R Q;  1HNZ Q;  3CME A;  4B3T Q;  1X65 A;  1MKH A;  4JI5 L;  1FGU A;  4MZ9 A;  3U4Z A;  4X64 Q;  5LMU L;  1PH4 A;  2WFW A;  1HJP A;  1JJC B;  4NB3 A;  4A3E H;  2UXB Q;  4GKK Q;  4RMF A;  2D0P A;  4YWL A;  4L5T A;  2UU9 Q;  2LXJ A;  2F4V Q;  3SGI A;  4JBJ A;  4KLK A;  3STB D;  1K8A C;  1VQC A;  4LF9 Q;  5M3M H;  1IZ6 A;  4MTN A;  1VQJ A;  4DAM A;  4A3F H;  2KBN A;  5FLM G;  3RZD H;  5M3F H;  5LMN L;  3PO2 H;  1Q8K A;  4LF8 Q;  3RN5 A;  4APV A;  3CMA A;  4JI4 L;  2YTV A;  3RZO H;  2CWA A;  3J81 i;  4NXM L;  2A8V A;  3T1Y Q;  5DLQ E;  4L5R C;  2HIV A;  4A3D G;  3HOW H;  1NE3 A;  4LUZ A;  5IWA L;  5GAG C;  2B3G A;  2JE6 I;  2CFM A;  3F8T A;  1N8R C;  1FJG Q;  3U58 A;  2FXQ A;  1YJ9 A;  3T1H L;  3I55 A;  1XPO A;  4WJ3 M;  4JI3 Q;  1KAW A;  4LF7 L;  1NTG A;  1N34 Q;  1WCM G;  1CKO A;  4KHP Q;  2RHS B;  3L0O A;  1G29 1;  5EAY A;  4JI8 L;  4GNX A;  1IL2 A;  2ZM6 L;  3F2B A;  3K80 C;  3KF8 B;  4DV2 Q;  4DR3 Q;  4R4O A;  4A3I H;  4GOP A;  1YHA A;  2ID0 A;  1N9W A;  4A76 A;  2F52 A;  2R7Z G;  4A93 H;  3LGJ A;  2CKZ B;  1TWC H;  4P71 A;  3PIO A;  4A3K G;  2ZJR A;  4BBS H;  4K0K L;  2A19 A;  2R93 H;  3F2C A;  1J5E Q;  1GVP A;  3TQY A;  1W2B A;  5IYD H;  3ULJ A;  2VQE L;  2PMZ E;  4LFB Q;  2WAQ E;  1P16 A;  3S16 H;  4HIK A;  4A3G G;  4LW1 A;  2K14 A;  1VQE A;  4IOC A;  3PIP A;  3NEM A;  1PVO A;  1E7Z A;  3W5O A;  5IYC H;  2PNH A;  3AFP A;  2WAQ G;  2K50 A;  2JQO A;  5C44 H;  1S72 A;  1PYS B;  2IY5 B;  1PFS A;  4OWT B;  4L5S A;  4OXP A;  4A75 A;  4DR5 Q;  2JA5 H;  1WYD A;  3JC6 6;  2GN5 A;  2IHF A;  3AYH B;  1XTD A;  2OCE A;  3GTJ H;  4DR1 L;  5AJ3 Q;  2UUA Q;  2BA1 A;  4JBW A;  2K4K A;  4JCV E;  4QL5 A;  3M9B A;  1E22 A;  2WB1 E;  5JEA G;  4GLX A;  1HR0 L;  3H3V H;  3S1N H;  3BZC A;  5IP9 G;  1WI5 A;  1VQA A;  4JYA Q;  1TXY A;  2CWP A;  2JJQ A;  4LFC L;  1LYL A;  3OTO L;  1XPR A;  5M5W H;  5IT9 c;  3TRE A;  1PH3 A;  3UE0 A;  3I4N H;  1VQB A;  1KRS A;  1EOV A;  3KFU A;  2UUA L;  2AHO B;  3M4P A;  4DR7 Q;  3CAM A;  3PUV A;  1VQH A;  3G48 A;  4IPG A;  4DAY B;  2QEX A;  1PH7 A;  1IBL Q;  2VS1 A;  1N36 Q;  2D62 A;  1RL2 A;  4GS3 A;  5IY0 A;  3J7Z C;  2ES2 A;  1SFO H;  3PF4 A;  1Q1E A;  2B63 G;  3GTG H;  1B7Y B;  5C3E H;  4P75 A;  1SLJ A;  1D8L A;  1HZA A;  4AIM A;  3G71 A;  4DUZ L;  1VCI A;  3KJO A;  1QVF A;  2UUC Q;  1BBU A;  3S14 H;  1UE5 A;  1YJN A;  2OTJ A;  2XGT A;  4DV6 Q;  4A3C H;  5IE8 A;  2JA6 H;  5JJK A;  1OXV A;  2K5N A;  4IPH A;  4JG2 A;  4DNI A;  4DR4 Q;  1A0I A;  3M3Y H;  2MQH A;  1KRT A;  3HOY H;  1HZ9 A;  1P8L A;  3RR5 A;  2N49 A;  3S24 A;  3U4V A;  3J81 c;  1IBM L;  1BVS A;  1JE5 A;  3EBE A;  4NPS A;  3DLL A;  1JJ2 A;  2Q2U A;  3AEV A;  1E1O A;  2AKW B;  2AMC B;  3KDF B;  2YU9 H;  1D7Q A;  1V9P A;  2PQA B;  2E8G A;  2K52 A;  1AE3 A;  3PUW A;  5J3B A;  3A5U A;  2CQO A;  3L2P A;  4DV7 L;  2Z6K C;  4UP8 A;  3BZK A;  1VQ5 A;  5BR8 L;  2N3S A;  4LUV A;  4DV5 L;  1PA6 A;  4DV4 Q;  4X62 Q;  1S40 A;  4NXN L;  4DR4 L;  1WOC A;  2RCN A;  1N32 Q;  5FLX c;  4JI2 Q;  4P73 A;  1Z9F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...