4KHPQ

Structure of the thermus thermophilus 30s ribosomal subunit in complex with de-6-msa-pactamycin
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
99
structure length
99
Chain Sequence
b'PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S Ribosomal RNA
publication title Crystal Structure of a Bioactive Pactamycin Analog Bound to the 30S Ribosomal Subunit.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 22
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4khpQ00
5C0XJ 4LF9Q 4JI7Q 3A74A 2WB1E 4DV5L 1WOCA 1Q1BA 4UP7A 4DR4Q 1BBWA 1V43A 2A1AA 3E9HA 4LF5L 4A3BG 4LFAQ 4JI8L 4DV1L 1MIUA 4JCVE 2UUBL 1D8LA 1YHBA 2RHQB 1VQCA 1MJEA 5EAYA 3KLWA 2N49A 3A0JA 5IT9c 2HHHL 4GLAC 1TXYA 2RHSB 4JI3L 4A3DH 2Q2IA 4JI5L 1HZ9A 4X62Q 2YTVA 3UDXA 2C35B 2VZAA 2PI2A 2R7FA 1XPOA 1N33Q 5JJIA 4LFBL 3HOXG 3KF6A 3CCMA 1N8RC 4JI7L 3UE0A 4GNXB 4DAMA 4P72A 3UDGA 1WFQA 4DR4L 1EFWA 2VUMG 2UXBQ 1UE6A 1PH7A 3K80C 1LUZA 1L2FA 4LFAL 1YJWA 3H15A 3I4NG 4DUYQ 4UPAA 1IBLQ 2IY5B 4A3IG 2JEBI 4P74A 4GOPA 1JJGA 4YHHQ 3TS2A 4L5RC 1L1OB 3B6YA 2I5LX 1VQHA 4RG1A 1JB7A 4HJ5A 4X62L 1NMGA 3CXCA 1QVGA 2BA1A 2E8GA 3CCRA 4JI2Q 3CCLA 4B3TL 3S1NH 2K5NA 1K8GA 1VQPA 3FKIG 1N33L 4BBSH 1SMXA 2R92G 1YVCA 3KDFA 4MZ9A 2WB1G 4LW1A 2UXBL 4KI0A 2KCMA 4X64Q 4QL5A 1WI5A 3PUZA 4DUYL 4NXNQ 1IBLL 4BY7H 1I3QH 1HNZQ 2E2HH 3EBEA 1K73C 4YHHL 2ZTEA 1YBYA 3S15H 4RMFA 3GTOH 1SRUA 2VS1A 3BU2A 1O7IA 5M3MG 1YHQA 5FJ8G 1HH2P 1R9TH 1OXVA 1UE1A 4EX5A 1JE5A 2MO0A 4GNXC 1ASYA 1AH9A 4B3RL 4DR6Q 5HY6A 1KC8C 5IP9H 1W2BA 2AMCB 3G4SA 1I6HH 4GNXA 2LSSA 3PCOB 3KJOA 4X64L 5M5YH 1AE3A 4NXNL 4A3GG 1HNZL 3J80c 2ID0A 3HOWG 1XNQL 3TREA 4LUVA 4A93H 1YITA 1VQLA 1PYSB 4X65Q 2EIFA 3RZDH 1M90C 2K75A 3WWVA 3M4OH 3HOVH 3M85A 3D0FA 1PVOA 5M3FH 1KL9A 1L1OA 1Z9FA 4JI6Q 2N78A 2E5LL 4DV3Q 2K52A 5J3BA 1IBML 4B3SQ 3E9IA 3PUYA 3S24A 3U4VA 1VQEA 3RLNA 1XTDA 1VCIA 3CCJA 4GN4B 3CC7A 2GVBA 2Q2UA 4JOIC 5M5WH 5IYBG 3GTJH 2JJQA 4DUZL 3U58A 3J80i 5IYDG 1FJGQ 2BH2A 1EOVA 1VQKA 3CCEA 4IPCA 4JOIA 4P73A 5GROA 3RZOH 2IHFA 3GTMH 5IE8A 4R4IA 3AQQA 4IOAA 2NN6I 4A3KG 1K8AC 2B63H 2F4VQ 2E2IH 4JI6L 5IWAL 4B3MQ 2EXDA 3ER0A 4DV3L 3J81j 1K3RA 5IYCG 4DV0Q 1FGUA 1SN8A 2IHEA 4HIKA 1Q7YC 1ASZA 4HIMA 4A3FH 3M7NA 2GVAA 5GAHC 4JC0A 2WFWA 4JBKA 1VQDA 1MKHA 3I55A 1UWVA 3AFQA 3PIPA 1B7YB 3F2CA 1K83H 4DV6Q 2Z6KC 1EIYB 5K36G 1WCMG 2VY3A 3K8AA 1HNXQ 1N32Q 4HIOA 1N34Q 2JA9A 2MQHA 2N3SA 2RCNA 1TWAH 2HQLA 2RF4A 4XTCS 2Z6KA 3U50C 4H02A 4OONA 5M5XH 4NXML 3J7ZC 2F4VL 5FLXc 2R6GA 4IPHA 3RN2A 3A5UA 1YJ9A 2AWNA 3S1MH 1HZCA 2KHJA 3H0GH 3CF5A 4LF8L 4DV0L 4OO1I 5C4XH 2HT1A 4DR3Q 2YTYA 4IJHA 4DV5Q 5GAEC 1HNWQ 3ULLA 4R1JA 4LF5Q 4A3LH 4L5SA 3HOUH 3I4MG 4JI8Q 1A0IA 1IZ6A 1NTGA 1PH3A 4NPSA 1HNXL 2A8VA 1NJIC 1QVFA 3HOYH 1I94Q 2OTJA 3KDFB 3KYHC 1M1KC 3HOZH 4LFCQ 4JI3Q 3W5OA 3CCQA 4JI5Q 1N9WA 3OW2A 2OTLA 1S72A 4X66L 4C3HH 1UE5A 4LFBQ 4GLVB 4GLXA 4EQ5A 2JA7G 4DK3C 1CUKA 4TQUS 1NY4A 1IXRA 4DR3L 3S1RH 4A4IA 1Z47A 3PO3G 1HNWL 3HFZB 2ASBA 2D62A 4BY1G 3SGIA 1SLJA 4IFDG 1PA6A 3UE1A 4HJ8A 4AYBE 3IRBA 4HJ7A 2R7ZH 3AFPA 5LMUL 3CCVA 1BVSA 1J6QA 5JEAJ 1I94L 4PG3A 2IX0A 4PZ7A 1A63A 5C44H 4LFCL 4LF7Q 1G6PA 4DV4Q 3CPFA 1JT8A 4DPGA 2JQOA 4OWXB 2JA5G 5IP7G 1JMCA 1A8VA 3PF5A 1G51A 4C2MH 3T1YL 1Q81C 4APVA 4J15A 1Y1WG 1VQ8A 3PUXA 4GOPC 2R7DA 5DLQE 3PIOA 1CKMA 1UE7A 1XMOQ 1D7QA 3ULPA 2UXCQ 1S3OA 3T1HQ 5IY0A 4A76A 1SFOH 4LF7L 3S14H 4DV4L 3PO2H 1U0LA 4JI0Q 4IO9A 2PMZE 1NBWA 5BR8L 2N8NA 3ERSX 3GTPH 1FL0A 4B3RQ 2ZTCA 4JI1Q 2ZJPA 4A3BH 4GKKQ 3GD7A 2Y0SE 1K9MC 5LMNL 5GAGC 4DAYB 1PH8A 4GKJL 2VNUD 3HKZE 4O2DA 1Y1VG 2QA4A 1XMOL 1PH9A 1X54A 4AYBG 3JAMc 3T1HL 1XNQQ 2UXCL 1WJJA 4LWCA 1EIFA 4JI0L 3HOXH 1VQNA 4BBRG 2K50A 1XMQL 1LTLA 4YCVA 3KOJA 2Q2TA 4JI4L 3S16H 3H3VI 4A3CH 2E5LQ 1OXUA 2Q2HA 1IBMQ 2VUMH 2AWOA 3GDEA 3NELA 4JI1L 1EYGA 1VQJA 5ELOA 2JEAI 1CSQA 3I4NH 3CCSA 5FLMG 3CD6A 4GKKL 2JA8G 4A3IH 2ES2A 1OXXK 4FDBA 3NBHB 3H3VH 3M4QA 1PH4A 4R4QA 4DUZQ 1KD1C 4DR7Q 3GTLH 1L1OC 3JAMi 4DKAC 3KF8B 4GN5A 2ZM6Q 5C3EG 1UEBA 3FKIH 3M9BA 3CMAA 1SR3A 3TS0A 4R4TA 4HIDA 1VQ4A 3PV0A 2DUDA 2UUAL 2R92H 2JA6G 1N36L 4TVAB 1YHAA 5IWAQ 2PNHA 1XPUA 4A3JG 1RIPA 1VQ7A 4QQBX 3U4ZA 2MO1A 3AYHB 3G6EA 3E0EA 3M3YH 2R93H 3NEMA 1PYBA 4IPDA 1QZHA 1GM5A 2Y0SG 2I0QA 4POGA 2KHIA 4A3MG 3ICEA 4JG2A 4DR7L 2ALYB 5C0XG 3VDYA 3HKZG 1J5EQ 4A3FG 2IX1A 5M3MH 5FJ8H 1JJCB 1YNXA 2ZM6L 1IYJB 4OWWB 3DLLA 4B3TQ 4NXMQ 4YCWA 4O0AA 3RNUA 2WAQE 2IT1A 1YIJA 2QGQA 3CPWA 4LF8Q 1VQBA 4A3EG 1YZ6A 2EQSA 3MXNB 1GD7A 4QJFA 4A3GH 4POFA 2UU9L 1MJCA 1XPRA 1AE2A 2DGYA 3HOWH 4DV2Q 1TWHH 2I5MX 3UDIA 1J5EL 2WP8J 1C7YA 5JJKA 1BBUA 1NMFA 1X3GA 2PI2E 2ZTDA 4PZ6A 3CMEA 3CCUA 2XGTA 1U5KA 3GTQH 2HIVA 1B8AA 4IOCA 4A3LG 4BXXG 1I5FA 2K4KA 2F52A 4X66Q 4DV7L 2XTIA 4ME3A 1E3PA 1IBKQ 2NVXH 2HIXA 5IYBH 4QIWE 2VW9A 1Q82C 4OX9Q 5IYDH 4DV2L 4LF4L 2KBNA 2K5VA 4KHZA 1KHIA 5AJ3L 5GQOA 4A3KH 4DR1Q 1EUJA 4QGUA 5LMUQ 3PUVA 2KENA 3RN5A 3A5ZB 3TEHB 3W1BA 5LMNW 5IYCH 2CCZA 3ULJA 2ZJQA 1Q46A 3TRZA 3GTKH 2OQKA 1HZAA 4ALPA 1JJ2A 2WAQG 3BJUA 1IBKL 3CC2A 2OWOA 4Y52H 1QVCA 2D0OA 3T1YQ 1YEZA 4A3DG 4OX9L 1G291 3GTGH 3I4OA 1OXTA 4DR1L 1A62A 3F2DA 2UXDQ 1KAWA 2OQ0A 2FXQA 2K14A 3F2BA 1PH5A 1HR0L 5BR8Q 4GN3B 1NE3A 3J81c 3I4MH 3PO2G 2L15A 1C0AA 4AQYQ 2R93G 1KRSA 3I2ZA 5C4JH 4A75A 1I50H 5LMNQ 3J7A5 4GKJQ 1KXLA 4BBSG 4HJAA 3G71A 2UUCQ 1VQIA 2E2JH 3S2DH 1V9PA 1E1TA 1PH1A 2UXDL 1S40A 2LXJA 1LYLA 4LUZA 4IFDI 3M4PA 2JA7H 4BY7G 3LGJA 4C3IH 1XMQQ 4JYAQ 1XJVA 4JI4Q 3PO3H 3PUWA 5E7NA 3J81i 1P8LA 4BY1H 1H95A 4AQYL 4LF9L 1OXSC 1X65A 4NB3A 5H1SE 4A3CG 4UP9A 1SE8A 3PSIA 4KLKA 4BA1I 4DR5Q 2UUCL 2MFIA 2OCEA 4JBWA 3TQYA 5IP9G 2CWPA 1X9NA 2ATWA 2JA5H 5IP7H 1L0WA 2UUAQ 4Y7NH 4JYAL 1N36Q 1Y1WH 4A93G 1B70B 2CFMA 1RL2A 3G48A 4R4CA 2VQFQ 1EQQA 5M3FG 2LXKA 3W1GA 3HOVG 1CSPA 4UP8A 2BH8A 4DR5L 1X6OA 3GO5A 3ZJYC 3KFUA 2I5HA 2ZJRA 3K7UC 1PH2A 4QY7A 3CQZH 3S1QH 3D31A 3KJPA 4IPGA 4KHPQ 1Q8KA 1WYDA 1TWCH 3HKSA 4PZ8A 2D0PA 3BZKA 4LUOA 2B29A 1KRTA 4OWTB 1PFSA 1X56A 4DNIA 1DGSA 1TWGH 3FP9A 2VQEQ 1VQAA 1EWIA 4JI2L 2CQOA 3OTOQ 1VQ6A 5JJLA 1LM0A 4YWKA 2VQFL 4IFDJ 2B63G 1XNRQ 1Y1VH 2UU9Q 1Q1EA 3BZCA 1VQMA 1QUQB 4JBJA 3CW2C 2QEXA 4DR2Q 3I56A 2CWAA 1FVIA 2NN6G 3OYYA 1Y14B 4KHPL 2AHOB 2VL6A 3S17H 2H5XA 3F8TA 4BBRH 1SROA 2YTXA 1CKNB 4UY8C 2A19A 2MNAA 4YWLA 5GADC 1CKOA 3STBC 4AH6A 2VQEL 4DV7Q 4XIGS 1VS0A 5JEAG 5FLMH 3K7AH 3L0OA 4L5TA 3OTOL 1VQ9A 2JA8H 1XNRL 3PF4A 2KCTA 4DR6L 4R4OA 2BA0A 3H0GG 3K0XA 4DR2L 1HR0W 4LF4Q 4L5QA 5C4XG 1GO3E 4JBMA 4P71A 1V1QA 5AJ3Q 1PHJA 4WJ3M 5C3EH 4AIMA 4DK6C 2NZOA 3S2HH 2K5HA 3EIVA 2JA6H 3HOUG 4JV5Q 2PQAB 1BKBA 3RLOA 4A3JH 4X65L 5C0XI 3PGZA 4OO1G 4YWMA 1VQGA 1E7ZA 2B3GA 2JE6I 4GS3A 1W3SA 4IJLA 4HJ9A 1YJNA 3Q8DA 4LNQA 3HOYG 2JK8A 3FHWA 3HOZG 1KIXA 4B3SL 4A3MH 2F3IA 5HGQA 2CKZB 3K81C 4LF6Q 4BA2I 1E24A 2V1CC 1VQOA 1QUQA 4K0KQ 3DM3A 1FJGL 2YV5A 1IL2A 1P16A 3AEVA 1TWFH 1PH6A 1PV4A 1QZGA 4JV5L 3CAMA 4OXPA 3STBD 4YCUA 4YY3Q 4A3EH 1CKNA 2R7ZG 4PMWA 1KQSA 1GVPA 4MTNA 1HR0Q 3KF6B 3UDFA 4B3ML 5C44G 2YU9H 1E22A 3CP0A 3RLFA 3I7FA 4C3JH 1K0RA 4LF6L 2NZHA 3JC66 2NVQH 4WJ4A 1C9OA 1HJPA 1WCMH 1Q86C 2NVTH 3L7ZC 2Z0SA 1HZBA 1X3FA 3EN2A 1X3EA 4MNOA 4BXXH 5ELNA 4K0KL 2AKWB 4GOPB 4DV1Q 3RR5A 4DV6L 3L2PA 1Q12A 4P75A 1OTCA 2UUBQ 1VQ5A 3CC4A 1N32L 4YY3L 3NENA 1N34L 2HHHQ 1GKHA 3F1ZA 2YYZA 2PQAA 1EQRA 1X55A 1T9HA 3MEFA 1E1OA 2GN5A 2NVYH 4X6AH 1YI2A 1VQFA
chains in the Genus database with same CATH superfamily
4LF9Q 4JI7Q 3A74A 4ME5A 2EJGC 2OXPA 1Q1BA 1WVLA 4DR4Q 2A1AA 1V43A 5EPJA 2DY7A 4FYDA 4DV1L 1MIUA 2RHQB 1YHBA 1VQCA 3EFXD 1CK1A 1V8QA 5EAYA 2HHHL 3RD4A 1B3QA 1TQOA 4JI3L 4A3DH 4X62Q 4LFBL 3SK5A 5G3LD 1XTCD 5KYIA 3D4WA 1EFWA 2I07B 1ENCA 1SYFA 1UE6A 1LUZA 4LFAL 4KD3A 4XYQA 1V1PB 4GOPA 4YHHQ 3BVGA 1L1OB 3B6YA 5C3WA 4ZKCB 4JI2Q 1YVCA 3KDFA 4G57A 4MZ9A 2WB1G 4LW1A 2UXBL 4KI0A 2KCMA 4X64Q 4NXNQ 2JN4A 2BE5C 4BY7H 1I3QH 5I2XA 2E2HH 2RBMA 5DNFA 2ZTEA 1NR2A 5FO8B 3S15H 4RMFA 2VS1A 1QNUA 3TZUA 1FYCA 1D1KA 1HH2P 1R9TH 1TWFB 2MO0A 4FF3A 4H44C 4B3RL 3TP5A 3HGBA 3EQLC 1I6VC 1I6HH 1DCZA 1D6EC 4GNXA 1TWAB 2LSSA 3PCOB 3KJOA 4A3GG 1HNZL 1NNXA 2ID0A 5C4XB 4HCSA 1XNQL 1VF5C 3TREA 3HOWG 4DF7A 4A93H 2NVQB 2Z1CA 1M90C 5KNCA 3HOVH 5D3DA 5M3FH 1ET6A 2L4NA 1WD0A 3BS1A 3CCJA 4ODGA 2RA4A 2BH2A 3KLSX 1VQKA 4P2CB 3RZOH 2QDBA 1B44D 1TVXA 4JI6L 1O80A 2EXDA 3FRPB 1FGUA 3T16A 2NN6H 5GAHC 2MGSA 2WFWA 1B7YB 2Z6KC 1WCMG 2O5IC 5JEAH 2IX3A 2JA9A 4XTCS 1IYVA 2HQLA 5M5XH 4NXML 1HCZA 4H02A 2R6GA 3NUCA 3A5UA 3S1MH 4OO1I 3CF5A 2HT1A 2FHTA 5J39A 4DR3Q 2KEDA 2EDGA 1RHPA 3MXGA 1KAAA 1H9KA 3HOUH 1A0IA 3X3MA 3GTPB 1IZ6A 1NTGA 3OWFA 4OIKA 2OTJA 3KYHC 4LFCQ 4JI3Q 5CV4A 1N9WA 3WDNA 1S72A 2F0JA 4KY5A 4LFBQ 1PZKD 1G6PA 2ENBA 1IW7D 2Z4IA 4A4IA 2L11A 3PO3G 1HNWL 4RKBA 4M1UB 4DXGA 1BOSA 1JWUD 3S16B 2FMMA 5LMUL 5JEAJ 1A63A 4PG3A 4L6TB 3RMHA 4A3IB 1G2SA 4DPGA 3IAYA 4OWXB 2JA5G 5IP7G 5IGGA 5L37A 1G51A 3QIAA 3R3OA 3T1YL 1Q81C 4APVA 3RZDB 3A8JE 1B50A 2A68C 1FNWA 3PIOA 1SYCA 1UE7A 1S3OA 4DK0A 3T1HQ 4KTAA 4Q5VA 4IO9A 2K1BA 1U4LA 2PMZE 2VB2X 4OELB 1STAA 1FL0A 4B3RQ 4K5XA 4GKKQ 3MTSA 1PH8A 1QE6A 4DAYB 5GAGC 3QG1A 5I6YA 5KNBA 2EPBA 3JAMc 1XNQQ 1G2TA 2K5QA 3OW7A 1VQNA 2Q2TA 2IWHA 4YCVA 2B39A 5EKKA 1GHKA 1WTQA 2CH4W 1O78A 1CSQA 1TKWB 3MFYA 2ES2A 3H3VH 1KD1C 3GTLH 1TIID 2KCNA 3JAMi 3DEOA 3LX0A 1A2TA 3K5OA 1UEBA 5C3EG 5IIFA 2V4DA 1KABA 2WACA 3NSWA 2PNHA 5ELBA 2EJMA 4A3KB 3U4ZA 4FXDA 1GUGA 4OEMB 4IPDA 1QZHA 5ELEA 2ALYB 5C0XG 2NB0A 1LT5D 1J5EQ 1MI2A 2IX1A 4XDXA 5EPLA 3S1RB 3KBXA 4ZCKA 2ZM6L 1LO5D 4NXMQ 4YCWA 1NR4A 1KDAA 3BYTB 4XT3B 1YZ6A 4XQNA 1GD7A 4A3GH 2UU9L 1JOKA 1XPRA 5E3FA 1TS5A 1SYGA 3HOWH 1QG7A 3N6RA 3NBHA 2PI2E 1X3GA 2ZTDA 5CORA 3CCUA 1SNQA 4DNTB 3KF8A 3A8IE 2KOLA 3KLSA 1E3PA 4LJZC 1DM0B 1SNOA 2A73B 3S14B 4QIWE 2G5DA 1STEA 2LS01 5J1ZA 1CHQD 1LV9A 1EUJA 4QGUA 2ZXRA 5LMUQ 3TEHB 3W1BA 3SK6A 3MHBA 3O13A 3ULJA 3GTKH 1EIHA 2OQKA 1PTOB 1IBKL 1BDOA 4RGNA 3T1YQ 2K32A 1YEZA 1PTOF 1I4QA 1U4PA 4OX9L 3MXNA 1DZ1A 3GTGH 1DD2A 3I4OA 2F3WA 2RDHA 1EY0A 1BF4A 2XRQD 5CV5A 2UXDQ 5HURA 4RHSA 2F0UA 2KA7A 4K2LA 1HXYD 4I7AA 4DNRB 2B2YA 1PRTB 1I50H 5JOBA 4OHJA 4BBSG 1E2VA 1ENFA 3AU7A 3K5MA 1LYLA 1Y1VB 4IFDI 3J80E 2EYMA 2KCCA 4AYBB 4JYAQ 1SYDA 1LT6D 2RVLA 3H6MA 3PO3H 3PUWA 1NAPA 3S17B 4BBRB 3F2UA 3EROA 1OXSC 4A3CG 4HEDA 5D65A 1SE8A 2E74C 3UI2A 2F0WA 1SNDA 3OWEB 5IP9G 5IGCA 2JA5H 5IP7H 1L0WA 1HPCA 1UNSA 3NQIA 1CHPD 3M7GA 3S2HB 1EQQA 1PRTC 5EKLA 2LXKA 3W1GA 4RWSC 2BH8A 4DR5L 1D1IA 1QOHA 2NBFA 4I7ZC 5A2QL 3D31A 3S1QH 2XNAC 3CRLC 4KHPQ 2D0PA 1PTOD 4LUOA 5COYA 2B63G 5FLXE 2UU9Q 1II3A 1VQMA 1X32A 2QEXA 1B9MA 2QILA 1D2BA 2L5TA 1FVIA 1JOQA 3MXUA 4L8JA 4V0BA 3FPPA 2A19A 5CV6A 4KV6A 3QJYA 5GADC 3STBC 4AH6A 4DN4M 1VQ9A 2PW7A 1Y8OB 4L5QA 2EZVA 4WJ3M 5C3EH 2P5ZX 4BS9A 2K5HA 4FVMA 1LTTD 4OO1G 3S2DB 1E7ZA 1E0BA 1W3SA 4HJ9A 1YJNA 5ELDA 2RSOA 2Q8IB 3VR5A 5C0XH 2TSSA 2WAQB 3D8GA 4BA2I 2O5JC 2B8GA 1H9SB 1HTPA 1FJGL 1TWFH 1QZGA 5JJZA 1XWEA 3CKIB 3STBD 1CKNA 2F0PA 1SE3A 1X3QA 4B3ML 2YU9H 5KGUA 5EBCA 1ILPA 4QF4A 3RLFA 1ILQA 4LF6L 3JC66 2NVQH 1C9OA 1HJPA 1X3FA 4K0KL 2AKWB 3RR5A 2IW3A 4CDFC 1RTOA 2UUBQ 1VQ5A 1N32L 4YY3L 4UDUC 3F1ZA 3TSSA 4X3KA 1ZEQX 5C0XJ 4OL7A 4X3TA 4KY7A 4UP7A 1GUSA 1C8CA 4QMGA 4LF5L 1O7ZA 1TWGB 3C2PA 4CBVA 4FP5D 4JCVE 2K5WA 3R93A 5IT9c 3A0JA 1GJXA 4FXGC 2C35B 2VZAA 2R7FA 5JJIA 1N33Q 1S4ZA 3CCMA 4JI7L 4J1MA 2ICIA 4B08A 1WFQA 3OMGA 4DR4L 1QCBD 3BDCA 3M4OB 5C3XA 4CDDC 3H15A 3I4NG 1B4OA 4DUYQ 2N55A 3EJIA 2I5LX 4HJ5A 4X62L 1NMGA 3CXCA 3CCLA 3S1NH 3GTJB 3Q24A 1VQPA 3FKIG 4BBSH 1SMXA 3CHBD 4A3JB 4YIJA 1G6ZA 4IALA 1WI5A 3PUZA 3EBEA 4YHHL 1BR9A 1YBYA 4JK1C 4A3FB 2D2CC 2NTTA 3GTOH 1DOMA 3BU2A 2A69D 4WRDA 1SAPA 1JE5A 3GP7A 1ASYA 2H1EA 1AP0A 5IP9H 1W2BA 1GHJA 2AMCB 3VYTA 1F9RA 1LT3D 4X64L 5M5YH 1AE3A 4NXNL 2J0TD 1SXTA 3J80c 3H0GB 4LUVA 1YNJC 1YITA 3RZDH 3WWVA 1EYCA 2HD3A 1PVOA 1ML0D 3D0FA 5IODA 2E5LL 4DV3Q 1EEFD 1B2TA 2B2TC 1IBML 5NUCA 2K6AA 3U4VA 3RLNA 5C6AA 1VCIA 1SE4A 3NWSA 4GN4B 3HOZB 2GVBA 4JOIC 2BCOA 3ND8A 4C3HB 4RFBA 5IYBG 1FJGQ 4KKUA 3U58A 3J80i 5CV7A 3BZDB 4IPCA 4N8FA 3TP8A 2IHFA 3GTMH 5IE8A 4R4IA 4L63B 2QKIC 2B63H 2F4VQ 1TT2A 4B3MQ 3ER0A 3J81j 1K3RA 2R7ZB 1T5EA 3M7NA 5C44B 3IFDA 3OMCA 2PZWA 4JC0A 3J81E 1ET9A 1RJTA 1UWVA 3IL8A 3KK7A 3AFQA 5T1IA 4C2MB 5IGBA 3K8AA 1N32Q 2RF4A 4B3TL 4G7ZC 3NP8A 2K28A 5FLXc 3RN2A 1EWHA 2DNCA 4CKBA 1HZCA 2KHJA 4LF8L 2F1MA 4CHTB 3ULLA 4R1JA 4LF5Q 4A3LH 1STNA 2XSCA 1LABA 4OO1H 2QCPX 4NPSA 4A3BB 1NJIC 3R2TA 4QUCA 1FNVA 4WORA 5M9OA 2JA7G 1BQQT 4Y52H 1CUKA 4TQUS 1NY4A 4C3IG 4DR3L 3S1RH 1DONA 1Z47A 5FKAC 5IGEA 1JC7A 4BY1G 1SLJA 4IFDG 5EJWA 2AQ2B 4AYBE 3VR3A 4HJ7A 2ZT9C 2VUMB 3CCVA 2TMPA 4LFCL 4KKSA 4LF7Q 1SJED 1JMCA 3SK4A 4U673 5I4DA 4RKLA 1LTSD 1R4PB 4GZYC 5DLQE 2A6EC 1EWCA 1XMOQ 1WTRA 5KIXA 2UXCQ 1SFOH 3S14H 3PO2H 2JSOA 1U0LA 1J8IA 1F77A 5M5WB 5EKIA 1NBWA 1QNKA 4JI1Q 5M3MB 3VR6A 2Y0SE 1K9MC 2A5HA 2Z8LA 2E2IB 3I90A 1X54A 2EYLA 3T1HL 4U68A 3SEBA 1LTLA 1GXDC 3KOJA 4JI4L 5C4HA 2E5LQ 1IBMQ 2Q2HA 1EYGA 1VQJA 2N88A 3I4NH 4GKKL 3CCSA 5FLMG 5TSSA 2A6ED 3H91A 1ONLA 5CC4A 1HA5A 3DEPA 1PH4A 4DR7Q 1L1OC 4UAIA 2K33A 3FKIH 1SR3A 3TS0A 4R4TA 4HIDA 1N36L 3OPOA 1XPUA 4A3JG 1RIPA 4M8AA 4QQBX 4IZ8A 3HOYB 2MO1A 3D4RA 3G6EA 3OIQA 3M3YH 2E75C 3NEMA 2I0QA 1ZXTA 1C4QA 2CH4A 4A3MG 1WTXA 4RCOA 4CGYB 1DOLA 4OGQC 4A3FG 1QWYA 2JYOA 1YNXA 3JAML 5KEEA 2CQAA 4B3TQ 1W6JA 4O0AA 2WAQE 2IT1A 4FO2A 4LF8Q 1GUWA 2PNRC 3TP7A 4ZKBB 1IW7C 4QJFA 1I4XA 3C1EA 2ZXPA 2FINB 2DGYA 4DV2Q 4KJOA 1E2ZA 2I5MX 5DAUA 1J5EL 1EQTA 3GTQH 1SSOA 1U5KA 4IOCA 5C5LA 3TZDA 5C4JB 3PIO3 2F52A 4MIUA 3VA7A 4DV7L 2XTIA 4ME3A 1J9OA 4K5VA 1MSGA 2O2LD 2LFNA 4CKCA 1KLUD 5IYBH 4IQZA 3I8ZA 2KEEA 3FMCA 1SYEA 2C5CA 4KHZA 5GQOA 3LWUA 4RGOS 2F0TA 3A5ZB 3VA5A 1RF2D 5EGTA 4K5WA 4XYOA 5CGKA 1HZAA 1JJ2A 4DAPA 3CC2A 2JXMB 2D0OA 5BN4A 1RDPD 4CJ0B 3QO2A 1CZGA 5E1FA 1UUPA 5JPMC 1Y1WB 5D3IB 4ZYSA 1G91A 1A62A 3F2DA 2MP1A 2PZTA 4KJNA 3TMEA 2JP1A 5CBAE 3KBGA 2FXQA 2K14A 3DWAA 3P1HA 1HR0L 2PCFB 4KHVA 3J81c 4AQYQ 1KRSA 1B53A 4EQOA 3T13A 3S2DH 2PO4A 5EBDA 4NMZA 1PH1A 2UXDL 2RQXA 2LXJA 1S40A 5J22A 2JA7H 4DA2A 3LGJA 4C3IH 2LMCB 1XJVA 4JI4Q 3J81i 4BY1H 1AN8A 5IGFA 1X65A 4IFDH 1QJOA 3DMUA 4BWGB 3PSIA 4KLKA 1JQYD 5LHY1 4UHVA 1LTGD 2MFIA 3PQIA 2OCEA 3NXWA 1ESRA 1X9NA 2OEOA 3PIP3 4JYAL 1TWHB 1N36Q 1EY6A 4FF1A 1EEID 2F0FA 3OHXC 4WFN3 4R4CA 4HCEA 1QILA 1SE2A 4UP8A 1X6OA 3AB9A 3ZJYC 3K7UC 2L9HA 4QY7A 3CQZH 3G6JB 3KJPA 4IPGA 3I4LA 2NVXB 4IN3A 1WYDA 1TWCH 2CHBD 3BZKA 1KRTA 4EQNA 2NZ1D 4DNIA 1TWGH 1CA6A 2VQEQ 1TS4A 1EWIA 1VQAA 2CQOA 3OTOQ 2XWBB 3T56B 4IFDJ 1BCPB 1DYQA 1BCPF 1QUQB 4A3EB 3CW2C 2CWAA 4KHPL 2AHOB 5E4XA 2VL6A 1RKNA 2H5XA 3F8TA 4O42A 1SROA 2YTXA 1AW7A 1B9NA 2NVTB 4DV7Q 2DN8A 4XIGS 1VS0A 5FLMH 5I9OA 2SEBD 3K6OA 3PF4A 2KCTA 4R4OA 3T51B 3K0XA 2I46A 1HR0W 1AFPA 1F2YA 5C4XG 4HAEA 2SNSA 4P71A 3CRKC 1NSNS 2NZOA 3EIVA 2BDNA 1XYIA 1LT4D 2PQAB 1BKBA 2XVSA 4RH6A 3RLOA 4A3JH 2LKVA 2JE6I 4MTKA 1STYA 2E2JB 2F0VA 3L9AX 5IT9E 3HOYG 3U9SA 2MHVA 1EQVA 2JK8A 4TRDA 4B3SL 4A3MH 2KQ3A 5ELCA 2CKZB 3BVZA 3TDQA 1E24A 1VQOA 3KLRA 4J8QA 4CDCC 2KHSA 4K2KA 2K5DA 3HP3A 2L55A 1MD2D 1Y69U 4G7OC 4MTNA 1HR0Q 1HUNA 3UDFA 4R8NA 3C3LA 4X3UA 3I7FA 1K0RA 3LWEA 2DNEA 4Y7NB 1WCMH 4DK1A 3L7ZC 4I65A 4MNOA 4GOPB 4DAVA 3L2PA 1N34L 2B2WA 2M9VA 2YYZA 1BCPD 3MEFA 1X55A 2QEJC 5BN5A 3KDFB 1VQFA 1I3QB 4BY7B 2E2HB 1CFMA 1WOCA 3S15B 2XN9C 1R9TB 2UUBL 1BO0A 1D8LA 3KLWA 3WOEA 1TXYA 1PTOC 2F0OA 2YTVA 3MZ5A 3UDXA 5JAVA 2PI2A 1XPOA 2KVMA 4HN7A 3KF6A 3UE0A 2F0GA 4EVOA 4GNXB 3UDGA 2PYKA 1SNMA 3HOVB 2EVBA 3K80C 1HFGA 2LY7A 3K7AB 1IBLQ 4A3IG 2JEBI 1O7YA 5FOBB 4L5RC 1IL8A 4QB4A 1VQHA 3I72A 1QVGA 2E8GA 3CCRA 1N33L 3K57A 1PMRA 2X69A 3RZOB 4N8X1 4RCNA 1TY2A 4TKOB 4DUYL 3TP6A 2Y0SB 5D14A 1K73C 4K8JA 1YHQA 5FJ8G 1LLRD 1AH9A 1OXVA 1UE1A 4GNXC 2F3VA 3E0JA 2HDLA 3BDOA 5CR3A 5HY6A 3D6WA 3P7JA 3S1MB 3HG9A 4C3JB 2XRSD 1VQLA 1PYSB 1V1PA 2K75A 3MEHA 3M85A 1L1OA 3HOUB 1WD1A 2AQ3B 2N78A 2K52A 4B3SQ 2EY2A 3ITPA 3E9IA 2X6GA 3A7LA 4PV1C 2Q2UA 1LTBD 3V2TA 1XX8A 5M5WH 3Q6SA 4DUZL 5IYDG 1EOVA 4DGZA 3CCEA 4P73A 2VB3X 3AQQA 2KUMA 4A3KG 1K8AC 1Y8PB 3GQBA 1TR5A 2E2IH 5IWAL 4DV3L 4DV0Q 1Q7YC 2IHEA 4H13C 5EPKA 4HIMA 1X3PA 1A3VA 3MVVA 1VQDA 1MKHA 3P75A 1CTMA 3I55A 3D3RA 3J80L 4FXKC 1HNXQ 2A6HD 3J7AF 1N34Q 2RCNA 1TWAH 3U50C 2Z6KA 2F4VL 4OONA 2C9OA 3J7ZC 4IPHA 2B2VC 4J6HA 2AWNA 5C4XH 2Z9HA 3NQTA 2YTYA 4IJHA 4HSPA 5GAEC 2WKCA 4ILWA 2R93B 1HQRD 3OIPA 4PMCA 1LTRD 3SXHA 2A8VA 3VYUA 3HOYH 1I94Q 2IPKD 2EYHA 3OW2A 2OTLA 4X66L 1TS3A 1LACA 2L0CA 1IXRA 1PFNA 2F0NA 3HFZB 1D5XC 2D62A 3SGIA 4G4KA 1VDZA 1PA6A 3UE1A 1U4MA 1CT1D 3IRBA 3NE5B 1BVSA 1A15A 2IX0A 4PZ7A 2OT2A 4DV4Q 3CPFA 4F8MA 1JT8A 1I4GA 2JQOA 1RTNA 2A69C 2SOBA 5FLXL 3PF5A 2EY5A 4IUUA 4J15A 4HR7B 1CI3M 1CKMA 1V1OA 3FDTA 1D7QA 3HZXA 3ULPA 1F2MA 5C5MA 2PQEA 5IY0A 5KNDA 4A76A 4LF7L 4NW2A 3K5LA 4JI0Q 2QF7A 2H4OA 5BR8L 2N8NA 3ERSX 3GTPH 4ZLTF 3VYRA 2WV6D 2F4IA 3GD7A 5LMNL 2VNUD 3HKZE 2F0HA 4O2DA 1Y1VG 3NTIA 2QA4A 1XMOL 1PH9A 1EU3A 4AYBG 2UXCL 1WJJA 2IJ0A 1EIFA 2DY8A 4IUVA 4K8IA 3HOWB 4BBRG 4A3CH 3S16H 1K83B 1GUOA 3SR1A 2AWOA 3GDEA 4JI1L 4FF2A 1OO9B 3CD6A 3QOJA 4A3IH 1OXXK 4FDBA 1F9QA 2IL8A 3NBHB 4R4QA 4DUZQ 4DKAC 1U4RA 3NPPA 1Y8NB 3KF8B 1KDBA 3M9BA 3CMAA 3PV0A 4OIJA 1FR3A 3G7LA 3T4AC 5IWAQ 2HUGA 1M4VA 2EYOA 2F0DA 1WTWA 2G9DA 4ULLA 1EIGA 3HS0C 2K04A 4RGMA 1PYBA 1GM5A 3ICEA 2Y0SG 2KHIA 4DR7L 3QR8A 5T1GA 4DAYA 4PNYA 1EYAA 5FJ8H 1JJCB 4S3SA 4OWWB 4IURA 1SMYC 2NYZD 3I91A 3RNUA 4KK7A 3Q0AA 2VXWA 2EQSA 3MXNB 1HA6A 4POFA 3ONAB 2PPBC 1AE2A 5E4WC 3A56A 1TWHH 4C3JG 1C7YA 1NMFA 1BBUA 4PZ6A 3CMEA 2XGTA 1B3AA 4JVZA 2HIVA 1B8AA 3X3NA 1I5FA 2K4KA 1I50B 1D5ZC 1SNCA 2F0SA 4FNFA 2Q8TA 5FO9B 4X66Q 4JW0A 2RSNA 4HTHA 2F0LA 2NVXH 1BUVT 5I9PA 2VW9A 1Q82C 5IYDH 4DV2L 3RUZA 2K5VA 5AJ3L 3PO3B 4A3KH 4DR1Q 2J7ZA 1SMYD 4C1NK 5LMNW 1HUMA 1Z6HA 2CCZA 1UEAB 2ZJQA 3TRZA 3VYSA 4ALPA 2WAQG 2F0EA 2OWOA 1XXGA 4B9WA 1G291 3HOXB 4XQQA 3A55A 1OXTA 4DU9A 4ID6A 1K8MA 4NP5A 2G9HD 5AFWA 2EY1A 2B2YC 4RHRA 3F2BA 5BR8Q 1NE3A 3S1QB 3V96A 1H9JA 3BVMA 1C0AA 2R93G 3MWYW 4HMJA 1MHWC 5LMNQ 4HJAA 2UUCQ 1H9MA 2E2JH 5LL6S 2R92B 1VMPA 1E1TA 2RDGA 4LUZA 3H94A 3M4PA 2F0QA 2PW5A 3A8KE 3FVQA 4AQYL 5JVG3 4F87A 1JWMD 4HSVA 4BA1I 1S5FD 1PTOH 4JBWA 3TQYA 3MFGA 1ICWA 1CQVA 2CWPA 3LNNA 1LTAD 1PFMA 3BG3A 4Y7NH 1S5DD 3GV3A 1Z7TA 2NWGA 5C3EB 2CFMA 1RL2A 3G48A 3J81L 2VQFQ 5EQ0A 3H09A 1CSPA 3KFUA 2I5HA 4CJ2C 2ZJRA 1PH2A 1ZKOA 5K5PA 3HKSA 4PZ8A 1BXTA 2B29A 1MSHA 4OWTB 1PFSA 1X56A 1DGSA 3FP9A 5JJLA 1VQ6A 1KLGD 2FFKB 1XNRQ 1Y1VH 1Q1EA 4JBJA 1O7LA 4DR2Q 3I56A 1AEXA 4B9XA 1CQFA 1Y14B 5IGDA 2YU9B 3S17H 4BBRH 1JCKB 3VR2A 1CKNB 4UY8C 3SHLA 2MNAA 4MHEA 1CKOA 2VQEL 4NDXA 2K03A 3C1FA 3OTOL 4F7XA 3K7AH 3L0OA 4L5TA 1AZQA 3I3CA 5I6WA 1RD9D 4DR6L 4H0LC 3E5SA 4K6DA 2SDFA 2BA0A 3H0GG 1GO3E 3BYYB 1V1QA 2BE5D 5AJ3Q 2B2UC 4F88A 1PHJA 1ESFA 4DK6C 3S2HH 3I4MB 3A7AB 4XQJA 3HEJA 4JV5Q 2RCFA 1K0SA 4X65L 4YWMA 1VQGA 4IJLA 4LNQA 2F0MA 2DJGC 3FHWA 3HOZG 1KIXA 3W2DA 4C3HG 2J4XA 4LAAA 2V1CC 1D5MC 2K05A 1A3TA 3WOFA 1P16A 5JVH3 1TY0A 3EVQA 3CAMA 3ERQA 4Q0FA 5DM63 1I4RA 2R7ZG 4PMWA 2CW0C 3KUPA 1GVPA 1KQSA 4ABNA 3N52A 2WKDA 3NHHA 5C44G 1E22A 1EY4A 3CP0A 2XWJB 4C3JH 3AMUA 2NZHA 4WJ4A 2B2VA 2WIIB 1HZBA 3S1NB 1YNNC 5ELNA 1CM9A 4DV1Q 4DV6L 4BBSB 1Q12A 3FPUB 4P75A 3L3OC 3CC4A 5A35A 2HHHQ 1GKHA 2AQ1B 1JWSD 1EQRA 4X6AH 1TU2B 3I70A 1E1OA 3R2IA 5DEHA 2WB1E 1PYWD 4DV5L 3GTOB 1BBWA 3E9HA 4A3BG 4LFAQ 4JI8L 3DWQA 3DM1A 1H9SA 1SNPA 2MUYA 3QWNA 1MJEA 2CW0D 2N49A 1KNEA 4GLAC 1F2LA 1I4HA 2RHSB 2Q2IA 4JI5L 1HZ9A 1HHVA 5M5YB 1K28A 2B8FA 3HOXG 1N8RC 1IKMA 1VMCA 4P72A 4DAMA 3OOCA 1YNND 2VUMG 1CZWA 2UXBQ 1PH7A 1L2FA 1YJWA 2OF1A 3IKJA 2JA8B 1K8OA 4UPAA 1MGSA 2EE1A 2IY5B 4P74A 4XXEA 1JJGA 4RAUC 3TS2A 1PLFA 3T53B 4R8IA 4RG1A 1JB7A 2R93H 2WINB 2BA1A 3DWPA 2K5NA 1K8GA 3SVMA 3P20A 1S5CD 2JA6B 1NUCA 3E3XA 2R92G 2EOTA 3GTMB 1I4PA 1QB5D 4RA8A 2B63B 3R8BA 4QL5A 1IBLL 1HNZQ 1EL0A 2NUCA 1AZPA 3HKZB 2BOSA 1SRUA 3TN2A 1HQMC 1O7IA 5M3MG 4QUFA 3D4DA 1SEBD 4EX5A 3SE0A 3SK8A 4DR6Q 2A68D 1KC8C 1FNUA 2D9UA 3G4SA 1SBBB 1M8AA 2DJFC 4C56C 4RGTA 1PXUA 2HCIA 4X65Q 2EIFA 4KMUC 3M4OH 1KL9A 1Z9FA 4JI6Q 5J3BA 5HGTA 3PUYA 3BDLA 3S24A 4NKLA 1VQEA 1XTDA 3CC7A 1BBXC 2B2TA 2NVYB 3GTJH 2JJQA 1VF7A 1A6XA 1Q3LA 4JOIA 5GROA 4IOAA 2NN6I 1IKLA 4LMQD 1T5XD 4N9TA 4JPBW 1BCPC 1JE4A 4IUTA 3DXJC 5IYCG 1FGBD 1SN8A 1WTHA 4HIKA 1ASZA 4A3FH 2GVAA 4A3DB 4JBKA 5CBEE 1HTLD 2KJXA 3SDZA 2M2LA 2O4XA 3PIPA 3F2CA 4DV6Q 1K83H 1EIYB 3TBIB 2VY3A 5A2QE 5K36G 4ZQ3A 4HIOA 4POGA 2MQHA 2N3SA 3K59A 2XIWA 1YJ9A 5ISRA 3H0GH 4DV0L 3C46A 4HMIA 4WJWA 4DV5Q 1WTPA 4CKEA 1SFOB 1TS2A 1HNWQ 3PO2B 4KKTA 4L5SA 3I4MG 4JI8Q 1PH3A 1HNXL 4IUQA 1QVFA 1M1KC 3HOZH 1MBYA 4MN3A 3W5OA 3NTHA 3CCQA 4JI5Q 1STGA 4C3HH 1EFID 2K01A 3E6ZX 5BN3A 1UE5A 2GA4B 4X3SA 4GLVB 4K14A 1KNAA 4EQ5A 4DK3C 4GLXA 2ZXOA 1SYBA 3GV6A 2ASBA 4KN4C 4HJ8A 2R7ZH 3AFPA 5F2DA 3J7YW 1J6QA 5KRUA 1I94L 1I6HB 5C44H 3I4NB 1WTOA 1HFNA 4R9WA 3IFTA 1A8VA 2EYFA 4FF4A 1ICFB 4C2MH 4A93B 1Y1WG 1VQ8A 3PUXA 3FKIB 4GOPC 4E6IA 2R7DA 5M3FB 1PRTF 1NCVA 2KECA 1F9PA 5C4ZA 2L12A 1GOZA 4CJ1B 1EY8A 3M3YB 4DV4L 1WTVA 1EU4A 4KD4A 2RKSA 1E2WA 2HQEA 2R61A 2ZTCA 4A3BH 2ZJPA 4KY6A 2EYPA 4ZRZA 3QB3A 2SNMA 1IHZA 4GKJL 3ND9A 1B1ZA 4LWCA 4PMBA 5LL6X 5IT9L 4JI0L 3HOXH 2BDOA 2A74C 2K50A 1XMQL 2HCCA 3H3VI 4PQXA 1EY9A 1H9RA 2F0KA 1OXUA 2VUMH 3NELA 3GTQB 2Z4HA 5ELOA 2JEAI 5M5XB 2JA8G 1W6KA 1UAPA 3M4QA 1SDFA 4GN5A 2ZM6Q 2A6HC 2RDFA 2UUAL 1VQ4A 2DUDA 2R92H 4ZUJA 2EY6A 4TVAB 1YHAA 2JA6G 1VQ7A 1Q8IA 2K7VA 3AYHB 3E0EA 1RODA 2PZUA 2Z6BA 3NWTA 5I2YA 4JG2A 2R3ZA 3VDYA 3HKZG 3HRZC 4Z9CB 5CMDA 5M3MH 3QOLA 1IYJB 5IOCA 2EXZA 3DLLA 1A2UA 1YIJA 2QGQA 3CPWA 4EGVA 1JB3A 1VQBA 1PRTD 4A3EG 1MJCA 3EA6A 4IUPA 3W3AA 3PMFA 3UDIA 2WP8J 5JJKA 1EZ8A 4A3LG 4BXXG 2MPMA 1EZ6A 2B2UA 4K6LA 2L1BA 1IBKQ 1GUTA 1STBA 2HIXA 3K58A 3U9OA 3I73A 1R4QB 4OX9Q 2JA7B 4LF4L 2KBNA 4C3IB 1KHIA 2FJ2A 1PZID 3MA2B 1K3BC 3PUVA 4BY1B 2KENA 3RN5A 1FD7D 4IUNA 5IYCH 3VR4A 1Q46A 3BJUA 2AUKA 2MJ8A 1QVCA 4A3DG 4XT1B 4C1NI 2CVRA 5K36H 3MC0B 4V190 4DXFA 2F0IA 2ICEC 4DR1L 1F2ZA 3FEWX 1KAWA 2OQ0A 1PH5A 2QW7A 4GN3B 3GTLB 3CQZB 5CYUA 3I4MH 1EY7A 3PO2G 2L15A 1S5ED 1TWCB 3I2ZA 5C4JH 4A75A 3J7A5 1KXLA 4GKJQ 3Q23A 3G71A 1VQIA 2WB1B 3Q22A 1V9PA 1KTKA 3URYA 1PZJD 1JORA 3NTKA 1EYDA 3OSOA 4BY7G 1SJHD 1ENAA 1XMQQ 5E7NA 1DOKA 1P8LA 4TSSA 4LF9L 1H95A 5H1SE 4NB3A 3DUZA 2F03A 5KYLA 1LTID 1JR0D 3A54A 4UP9A 4DFAA 4DR5Q 2UUCL 5JPNC 4KN7C 1EY5A 3M4YA 2HDMA 2ATWA 4A3GB 3MAQA 3H3VC 4N9PA 2UUAQ 1Y1WH 4A93G 1B70B 3HOVG 2NTSA 5M3FG 2PMZB 4H7BA 4ZAIA 3GO5A 3MXPA 5FO7B 2QDLA 4A3MB 1Q8KA 1G8ZD 3NK9A 3ZYYX 4ZUIA 4O1NA 4JI2L 4CDEC 1PDQA 1JICA 3S9WA 2M00A 1LM0A 4YWKA 4EQPA 2VQFL 3BZCA 1A3UA 2E2DC 3GTKB 1GUNA 1U9RA 2NN6G 3OYYA 4QCLA 3K5NA 1ZYRC 5CV8A 1L0YB 4YWLA 1WCMB 3GTGB 5JEAG 2JA8H 1XNRL 5FK9C 2X6LA 1KDCA 4DR2L 4LF4Q 5DM73 3J7AV 4JBMA 1C48A 4AIMA 1CA5A 1S5BD 2Q8RE 5G3LF 2JA6H 3HOUG 2E76C 3K0YA 5C0XI 3PGZA 2B3GA 4GS3A 2AUJD 1IYUA 3NBIA 4LK1C 4G7HC 3Q8DA 1RCVD 3DHQA 1PFBA 2F3IA 5HGQA 1Q90A 3K81C 4LF6Q 1QUQA 4K0KQ 3DM3A 1IL2A 2YV5A 3AEVA 1YNJD 1ZYRD 1PH6A 1PV4A 1F9SA 4JV5L 1DJRD 4OXPA 4YY3Q 3D6CA 4YCUA 4A3EH 4ZK9B 1EOTA 1JOOA 3KF6B 2FMCA 1STHA 1L0XB 5ELFA 3V05A 1BNZA 1HRJA 2JA5B 1DXMA 2NVTH 1Q86C 2Z0SA 3EN2A 1X3EA 2D5DA 4BXXH 4QIWB 2B2WC 1OTCA 5CV9A 3NENA 3CU7A 2EYJA 3JAME 2PQAA 1T9HA 2GN5A 2NVYH 1YI2A 2EJFC
chains in the Genus database with same CATH topology
5C0XJ 4LF9Q 4JI7Q 3A74A 2WB1E 4DV5L 1WOCA 1Q1BA 4UP7A 4DR4Q 1BBWA 1V43A 2A1AA 3E9HA 4LF5L 4A3BG 4LFAQ 4JI8L 4DV1L 1MIUA 4JCVE 2UUBL 1D8LA 1YHBA 2RHQB 1VQCA 1MJEA 5EAYA 3KLWA 2N49A 3A0JA 5IT9c 2HHHL 4GLAC 1TXYA 2RHSB 4JI3L 4A3DH 2Q2IA 4JI5L 1HZ9A 4X62Q 2YTVA 3UDXA 2C35B 2VZAA 2PI2A 2R7FA 1XPOA 1N33Q 5JJIA 4LFBL 3HOXG 3KF6A 3CCMA 1N8RC 4JI7L 3UE0A 4GNXB 4DAMA 4P72A 3UDGA 1WFQA 4DR4L 1EFWA 2VUMG 2UXBQ 1UE6A 1PH7A 3K80C 1LUZA 1L2FA 4LFAL 1YJWA 3H15A 3I4NG 4DUYQ 4UPAA 1IBLQ 2IY5B 4A3IG 2JEBI 4P74A 4GOPA 1JJGA 4YHHQ 3TS2A 4L5RC 1L1OB 3B6YA 2I5LX 1VQHA 4RG1A 1JB7A 4HJ5A 4X62L 1NMGA 3CXCA 1QVGA 2BA1A 2E8GA 3CCRA 4JI2Q 3CCLA 4B3TL 3S1NH 2K5NA 1K8GA 1VQPA 3FKIG 1N33L 4BBSH 1SMXA 2R92G 1YVCA 3KDFA 4MZ9A 2WB1G 4LW1A 2UXBL 4KI0A 2KCMA 4X64Q 4QL5A 1WI5A 3PUZA 4DUYL 4NXNQ 1IBLL 4BY7H 1I3QH 1HNZQ 2E2HH 3EBEA 1K73C 4YHHL 2ZTEA 1YBYA 3S15H 4RMFA 3GTOH 1SRUA 2VS1A 3BU2A 1O7IA 5M3MG 1YHQA 5FJ8G 1HH2P 1R9TH 1OXVA 1UE1A 4EX5A 1JE5A 2MO0A 4GNXC 1ASYA 1AH9A 4B3RL 4DR6Q 5HY6A 1KC8C 5IP9H 1W2BA 2AMCB 3G4SA 1I6HH 4GNXA 2LSSA 3PCOB 3KJOA 4X64L 5M5YH 1AE3A 4NXNL 4A3GG 1HNZL 3J80c 2ID0A 3HOWG 1XNQL 3TREA 4LUVA 4A93H 1YITA 1VQLA 1PYSB 4X65Q 2EIFA 3RZDH 1M90C 2K75A 3WWVA 3M4OH 3HOVH 3M85A 3D0FA 1PVOA 5M3FH 1KL9A 1L1OA 1Z9FA 4JI6Q 2N78A 2E5LL 4DV3Q 2K52A 5J3BA 1IBML 4B3SQ 3E9IA 3PUYA 3S24A 3U4VA 1VQEA 3RLNA 1XTDA 1VCIA 3CCJA 4GN4B 3CC7A 2GVBA 2Q2UA 4JOIC 5M5WH 5IYBG 3GTJH 2JJQA 4DUZL 3U58A 3J80i 5IYDG 1FJGQ 2BH2A 1EOVA 1VQKA 3CCEA 4IPCA 4JOIA 4P73A 5GROA 3RZOH 2IHFA 3GTMH 5IE8A 4R4IA 3AQQA 4IOAA 2NN6I 4A3KG 1K8AC 2B63H 2F4VQ 2E2IH 4JI6L 5IWAL 4B3MQ 2EXDA 3ER0A 4DV3L 3J81j 1K3RA 5IYCG 4DV0Q 1FGUA 1SN8A 2IHEA 4HIKA 1Q7YC 1ASZA 4HIMA 4A3FH 3M7NA 2GVAA 5GAHC 4JC0A 2WFWA 4JBKA 1VQDA 1MKHA 3I55A 1UWVA 3AFQA 3PIPA 1B7YB 3F2CA 1K83H 4DV6Q 2Z6KC 1EIYB 5K36G 1WCMG 2VY3A 3K8AA 1HNXQ 1N32Q 4HIOA 1N34Q 2JA9A 2MQHA 2N3SA 2RCNA 1TWAH 2HQLA 2RF4A 4XTCS 2Z6KA 3U50C 4H02A 4OONA 5M5XH 4NXML 3J7ZC 2F4VL 5FLXc 2R6GA 4IPHA 3RN2A 3A5UA 1YJ9A 2AWNA 3S1MH 1HZCA 2KHJA 3H0GH 3CF5A 4LF8L 4DV0L 4OO1I 5C4XH 2HT1A 4DR3Q 2YTYA 4IJHA 4DV5Q 5GAEC 1HNWQ 3ULLA 4R1JA 4LF5Q 4A3LH 4L5SA 3HOUH 3I4MG 4JI8Q 1A0IA 1IZ6A 1NTGA 1PH3A 4NPSA 1HNXL 2A8VA 1NJIC 1QVFA 3HOYH 1I94Q 2OTJA 3KDFB 3KYHC 1M1KC 3HOZH 4LFCQ 4JI3Q 3W5OA 3CCQA 4JI5Q 1N9WA 3OW2A 2OTLA 1S72A 4X66L 4C3HH 1UE5A 4LFBQ 4GLVB 4GLXA 4EQ5A 2JA7G 4DK3C 1CUKA 4TQUS 1NY4A 1IXRA 4DR3L 3S1RH 4A4IA 1Z47A 3PO3G 1HNWL 3HFZB 2ASBA 2D62A 4BY1G 3SGIA 1SLJA 4IFDG 1PA6A 3UE1A 4HJ8A 4AYBE 3IRBA 4HJ7A 2R7ZH 3AFPA 5LMUL 3CCVA 1BVSA 1J6QA 5JEAJ 1I94L 4PG3A 2IX0A 4PZ7A 1A63A 5C44H 4LFCL 4LF7Q 1G6PA 4DV4Q 3CPFA 1JT8A 4DPGA 2JQOA 4OWXB 2JA5G 5IP7G 1JMCA 1A8VA 3PF5A 1G51A 4C2MH 3T1YL 1Q81C 4APVA 4J15A 1Y1WG 1VQ8A 3PUXA 4GOPC 2R7DA 5DLQE 3PIOA 1CKMA 1UE7A 1XMOQ 1D7QA 3ULPA 2UXCQ 1S3OA 3T1HQ 5IY0A 4A76A 1SFOH 4LF7L 3S14H 4DV4L 3PO2H 1U0LA 4JI0Q 4IO9A 2PMZE 1NBWA 5BR8L 2N8NA 3ERSX 3GTPH 1FL0A 4B3RQ 2ZTCA 4JI1Q 2ZJPA 4A3BH 4GKKQ 3GD7A 2Y0SE 1K9MC 5LMNL 5GAGC 4DAYB 1PH8A 4GKJL 2VNUD 3HKZE 4O2DA 1Y1VG 2QA4A 1XMOL 1PH9A 1X54A 4AYBG 3JAMc 3T1HL 1XNQQ 2UXCL 1WJJA 4LWCA 1EIFA 4JI0L 3HOXH 1VQNA 4BBRG 2K50A 1XMQL 1LTLA 4YCVA 3KOJA 2Q2TA 4JI4L 3S16H 3H3VI 4A3CH 2E5LQ 1OXUA 2Q2HA 1IBMQ 2VUMH 2AWOA 3GDEA 3NELA 4JI1L 1EYGA 1VQJA 5ELOA 2JEAI 1CSQA 3I4NH 3CCSA 5FLMG 3CD6A 4GKKL 2JA8G 4A3IH 2ES2A 1OXXK 4FDBA 3NBHB 3H3VH 3M4QA 1PH4A 4R4QA 4DUZQ 1KD1C 4DR7Q 3GTLH 1L1OC 3JAMi 4DKAC 3KF8B 4GN5A 2ZM6Q 5C3EG 1UEBA 3FKIH 3M9BA 3CMAA 1SR3A 3TS0A 4R4TA 4HIDA 1VQ4A 3PV0A 2DUDA 2UUAL 2R92H 2JA6G 1N36L 4TVAB 1YHAA 5IWAQ 2PNHA 1XPUA 4A3JG 1RIPA 1VQ7A 4QQBX 3U4ZA 2MO1A 3AYHB 3G6EA 3E0EA 3M3YH 2R93H 3NEMA 1PYBA 4IPDA 1QZHA 1GM5A 2Y0SG 2I0QA 4POGA 2KHIA 4A3MG 3ICEA 4JG2A 4DR7L 2ALYB 5C0XG 3VDYA 3HKZG 1J5EQ 4A3FG 2IX1A 5M3MH 5FJ8H 1JJCB 1YNXA 2ZM6L 1IYJB 4OWWB 3DLLA 4B3TQ 4NXMQ 4YCWA 4O0AA 3RNUA 2WAQE 2IT1A 1YIJA 2QGQA 3CPWA 4LF8Q 1VQBA 4A3EG 1YZ6A 2EQSA 3MXNB 1GD7A 4QJFA 4A3GH 4POFA 2UU9L 1MJCA 1XPRA 1AE2A 2DGYA 3HOWH 4DV2Q 1TWHH 2I5MX 3UDIA 1J5EL 2WP8J 1C7YA 5JJKA 1BBUA 1NMFA 1X3GA 2PI2E 2ZTDA 4PZ6A 3CMEA 3CCUA 2XGTA 1U5KA 3GTQH 2HIVA 1B8AA 4IOCA 4A3LG 4BXXG 1I5FA 2K4KA 2F52A 4X66Q 4DV7L 2XTIA 4ME3A 1E3PA 1IBKQ 2NVXH 2HIXA 5IYBH 4QIWE 2VW9A 1Q82C 4OX9Q 5IYDH 4DV2L 4LF4L 2KBNA 2K5VA 4KHZA 1KHIA 5AJ3L 5GQOA 4A3KH 4DR1Q 1EUJA 4QGUA 5LMUQ 3PUVA 2KENA 3RN5A 3A5ZB 3TEHB 3W1BA 5LMNW 5IYCH 2CCZA 3ULJA 2ZJQA 1Q46A 3TRZA 3GTKH 2OQKA 1HZAA 4ALPA 1JJ2A 2WAQG 3BJUA 1IBKL 3CC2A 2OWOA 4Y52H 1QVCA 2D0OA 3T1YQ 1YEZA 4A3DG 4OX9L 1G291 3GTGH 3I4OA 1OXTA 4DR1L 1A62A 3F2DA 2UXDQ 1KAWA 2OQ0A 2FXQA 2K14A 3F2BA 1PH5A 1HR0L 5BR8Q 4GN3B 1NE3A 3J81c 3I4MH 3PO2G 2L15A 1C0AA 4AQYQ 2R93G 1KRSA 3I2ZA 5C4JH 4A75A 1I50H 5LMNQ 3J7A5 4GKJQ 1KXLA 4BBSG 4HJAA 3G71A 2UUCQ 1VQIA 2E2JH 3S2DH 1V9PA 1E1TA 1PH1A 2UXDL 1S40A 2LXJA 1LYLA 4LUZA 4IFDI 3M4PA 2JA7H 4BY7G 3LGJA 4C3IH 1XMQQ 4JYAQ 1XJVA 4JI4Q 3PO3H 3PUWA 5E7NA 3J81i 1P8LA 4BY1H 1H95A 4AQYL 4LF9L 1OXSC 1X65A 4NB3A 5H1SE 4A3CG 4UP9A 1SE8A 3PSIA 4KLKA 4BA1I 4DR5Q 2UUCL 2MFIA 2OCEA 4JBWA 3TQYA 5IP9G 2CWPA 1X9NA 2ATWA 2JA5H 5IP7H 1L0WA 2UUAQ 4Y7NH 4JYAL 1N36Q 1Y1WH 4A93G 1B70B 2CFMA 1RL2A 3G48A 4R4CA 2VQFQ 1EQQA 5M3FG 2LXKA 3W1GA 3HOVG 1CSPA 4UP8A 2BH8A 4DR5L 1X6OA 3GO5A 3ZJYC 3KFUA 2I5HA 2ZJRA 3K7UC 1PH2A 4QY7A 3CQZH 3S1QH 3D31A 3KJPA 4IPGA 4KHPQ 1Q8KA 1WYDA 1TWCH 3HKSA 4PZ8A 2D0PA 3BZKA 4LUOA 2B29A 1KRTA 4OWTB 1PFSA 1X56A 4DNIA 1DGSA 1TWGH 3FP9A 2VQEQ 1VQAA 1EWIA 4JI2L 2CQOA 3OTOQ 1VQ6A 5JJLA 1LM0A 4YWKA 2VQFL 4IFDJ 2B63G 1XNRQ 1Y1VH 2UU9Q 1Q1EA 3BZCA 1VQMA 1QUQB 4JBJA 3CW2C 2QEXA 4DR2Q 3I56A 2CWAA 1FVIA 2NN6G 3OYYA 1Y14B 4KHPL 2AHOB 2VL6A 3S17H 2H5XA 3F8TA 4BBRH 1SROA 2YTXA 1CKNB 4UY8C 2A19A 2MNAA 4YWLA 5GADC 1CKOA 3STBC 4AH6A 2VQEL 4DV7Q 4XIGS 1VS0A 5JEAG 5FLMH 3K7AH 3L0OA 4L5TA 3OTOL 1VQ9A 2JA8H 1XNRL 3PF4A 2KCTA 4DR6L 4R4OA 2BA0A 3H0GG 3K0XA 4DR2L 1HR0W 4LF4Q 4L5QA 5C4XG 1GO3E 4JBMA 4P71A 1V1QA 5AJ3Q 1PHJA 4WJ3M 5C3EH 4AIMA 4DK6C 2NZOA 3S2HH 2K5HA 3EIVA 2JA6H 3HOUG 4JV5Q 2PQAB 1BKBA 3RLOA 4A3JH 4X65L 5C0XI 3PGZA 4OO1G 4YWMA 1VQGA 1E7ZA 2B3GA 2JE6I 4GS3A 1W3SA 4IJLA 4HJ9A 1YJNA 3Q8DA 4LNQA 3HOYG 2JK8A 3FHWA 3HOZG 1KIXA 4B3SL 4A3MH 2F3IA 5HGQA 2CKZB 3K81C 4LF6Q 4BA2I 1E24A 2V1CC 1VQOA 1QUQA 4K0KQ 3DM3A 1FJGL 2YV5A 1IL2A 1P16A 3AEVA 1TWFH 1PH6A 1PV4A 1QZGA 4JV5L 3CAMA 4OXPA 3STBD 4YCUA 4YY3Q 4A3EH 1CKNA 2R7ZG 4PMWA 1KQSA 1GVPA 4MTNA 1HR0Q 3KF6B 3UDFA 4B3ML 5C44G 2YU9H 1E22A 3CP0A 3RLFA 3I7FA 4C3JH 1K0RA 4LF6L 2NZHA 3JC66 2NVQH 4WJ4A 1C9OA 1HJPA 1WCMH 1Q86C 2NVTH 3L7ZC 2Z0SA 1HZBA 1X3FA 3EN2A 1X3EA 4MNOA 4BXXH 5ELNA 4K0KL 2AKWB 4GOPB 4DV1Q 3RR5A 4DV6L 3L2PA 1Q12A 4P75A 1OTCA 2UUBQ 1VQ5A 3CC4A 1N32L 4YY3L 3NENA 1N34L 2HHHQ 1GKHA 3F1ZA 2YYZA 2PQAA 1EQRA 1X55A 1T9HA 3MEFA 1E1OA 2GN5A 2NVYH 4X6AH 1YI2A 1VQFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C0X J;  4LF9 Q;  4JI7 Q;  3A74 A;  2WB1 E;  4DV5 L;  1WOC A;  1Q1B A;  4UP7 A;  4DR4 Q;  1BBW A;  1V43 A;  2A1A A;  3E9H A;  4LF5 L;  4A3B G;  4LFA Q;  4JI8 L;  4DV1 L;  1MIU A;  4JCV E;  2UUB L;  1D8L A;  1YHB A;  2RHQ B;  1VQC A;  1MJE A;  5EAY A;  3KLW A;  2N49 A;  3A0J A;  5IT9 c;  2HHH L;  4GLA C;  1TXY A;  2RHS B;  4JI3 L;  4A3D H;  2Q2I A;  4JI5 L;  1HZ9 A;  4X62 Q;  2YTV A;  3UDX A;  2C35 B;  2VZA A;  2PI2 A;  2R7F A;  1XPO A;  1N33 Q;  5JJI A;  4LFB L;  3HOX G;  3KF6 A;  3CCM A;  1N8R C;  4JI7 L;  3UE0 A;  4GNX B;  4DAM A;  4P72 A;  3UDG A;  1WFQ A;  4DR4 L;  1EFW A;  2VUM G;  2UXB Q;  1UE6 A;  1PH7 A;  3K80 C;  1LUZ A;  1L2F A;  4LFA L;  1YJW A;  3H15 A;  3I4N G;  4DUY Q;  4UPA A;  1IBL Q;  2IY5 B;  4A3I G;  2JEB I;  4P74 A;  4GOP A;  1JJG A;  4YHH Q;  3TS2 A;  4L5R C;  1L1O B;  3B6Y A;  2I5L X;  1VQH A;  4RG1 A;  1JB7 A;  4HJ5 A;  4X62 L;  1NMG A;  3CXC A;  1QVG A;  2BA1 A;  2E8G A;  3CCR A;  4JI2 Q;  3CCL A;  4B3T L;  3S1N H;  2K5N A;  1K8G A;  1VQP A;  3FKI G;  1N33 L;  4BBS H;  1SMX A;  2R92 G;  1YVC A;  3KDF A;  4MZ9 A;  2WB1 G;  4LW1 A;  2UXB L;  4KI0 A;  2KCM A;  4X64 Q;  4QL5 A;  1WI5 A;  3PUZ A;  4DUY L;  4NXN Q;  1IBL L;  4BY7 H;  1I3Q H;  1HNZ Q;  2E2H H;  3EBE A;  1K73 C;  4YHH L;  2ZTE A;  1YBY A;  3S15 H;  4RMF A;  3GTO H;  1SRU A;  2VS1 A;  3BU2 A;  1O7I A;  5M3M G;  1YHQ A;  5FJ8 G;  1HH2 P;  1R9T H;  1OXV A;  1UE1 A;  4EX5 A;  1JE5 A;  2MO0 A;  4GNX C;  1ASY A;  1AH9 A;  4B3R L;  4DR6 Q;  5HY6 A;  1KC8 C;  5IP9 H;  1W2B A;  2AMC B;  3G4S A;  1I6H H;  4GNX A;  2LSS A;  3PCO B;  3KJO A;  4X64 L;  5M5Y H;  1AE3 A;  4NXN L;  4A3G G;  1HNZ L;  3J80 c;  2ID0 A;  3HOW G;  1XNQ L;  3TRE A;  4LUV A;  4A93 H;  1YIT A;  1VQL A;  1PYS B;  4X65 Q;  2EIF A;  3RZD H;  1M90 C;  2K75 A;  3WWV A;  3M4O H;  3HOV H;  3M85 A;  3D0F A;  1PVO A;  5M3F H;  1KL9 A;  1L1O A;  1Z9F A;  4JI6 Q;  2N78 A;  2E5L L;  4DV3 Q;  2K52 A;  5J3B A;  1IBM L;  4B3S Q;  3E9I A;  3PUY A;  3S24 A;  3U4V A;  1VQE A;  3RLN A;  1XTD A;  1VCI A;  3CCJ A;  4GN4 B;  3CC7 A;  2GVB A;  2Q2U A;  4JOI C;  5M5W H;  5IYB G;  3GTJ H;  2JJQ A;  4DUZ L;  3U58 A;  3J80 i;  5IYD G;  1FJG Q;  2BH2 A;  1EOV A;  1VQK A;  3CCE A;  4IPC A;  4JOI A;  4P73 A;  5GRO A;  3RZO H;  2IHF A;  3GTM H;  5IE8 A;  4R4I A;  3AQQ A;  4IOA A;  2NN6 I;  4A3K G;  1K8A C;  2B63 H;  2F4V Q;  2E2I H;  4JI6 L;  5IWA L;  4B3M Q;  2EXD A;  3ER0 A;  4DV3 L;  3J81 j;  1K3R A;  5IYC G;  4DV0 Q;  1FGU A;  1SN8 A;  2IHE A;  4HIK A;  1Q7Y C;  1ASZ A;  4HIM A;  4A3F H;  3M7N A;  2GVA A;  5GAH C;  4JC0 A;  2WFW A;  4JBK A;  1VQD A;  1MKH A;  3I55 A;  1UWV A;  3AFQ A;  3PIP A;  1B7Y B;  3F2C A;  1K83 H;  4DV6 Q;  2Z6K C;  1EIY B;  5K36 G;  1WCM G;  2VY3 A;  3K8A A;  1HNX Q;  1N32 Q;  4HIO A;  1N34 Q;  2JA9 A;  2MQH A;  2N3S A;  2RCN A;  1TWA H;  2HQL A;  2RF4 A;  4XTC S;  2Z6K A;  3U50 C;  4H02 A;  4OON A;  5M5X H;  4NXM L;  3J7Z C;  2F4V L;  5FLX c;  2R6G A;  4IPH A;  3RN2 A;  3A5U A;  1YJ9 A;  2AWN A;  3S1M H;  1HZC A;  2KHJ A;  3H0G H;  3CF5 A;  4LF8 L;  4DV0 L;  4OO1 I;  5C4X H;  2HT1 A;  4DR3 Q;  2YTY A;  4IJH A;  4DV5 Q;  5GAE C;  1HNW Q;  3ULL A;  4R1J A;  4LF5 Q;  4A3L H;  4L5S A;  3HOU H;  3I4M G;  4JI8 Q;  1A0I A;  1IZ6 A;  1NTG A;  1PH3 A;  4NPS A;  1HNX L;  2A8V A;  1NJI C;  1QVF A;  3HOY H;  1I94 Q;  2OTJ A;  3KDF B;  3KYH C;  1M1K C;  3HOZ H;  4LFC Q;  4JI3 Q;  3W5O A;  3CCQ A;  4JI5 Q;  1N9W A;  3OW2 A;  2OTL A;  1S72 A;  4X66 L;  4C3H H;  1UE5 A;  4LFB Q;  4GLV B;  4GLX A;  4EQ5 A;  2JA7 G;  4DK3 C;  1CUK A;  4TQU S;  1NY4 A;  1IXR A;  4DR3 L;  3S1R H;  4A4I A;  1Z47 A;  3PO3 G;  1HNW L;  3HFZ B;  2ASB A;  2D62 A;  4BY1 G;  3SGI A;  1SLJ A;  4IFD G;  1PA6 A;  3UE1 A;  4HJ8 A;  4AYB E;  3IRB A;  4HJ7 A;  2R7Z H;  3AFP A;  5LMU L;  3CCV A;  1BVS A;  1J6Q A;  5JEA J;  1I94 L;  4PG3 A;  2IX0 A;  4PZ7 A;  1A63 A;  5C44 H;  4LFC L;  4LF7 Q;  1G6P A;  4DV4 Q;  3CPF A;  1JT8 A;  4DPG A;  2JQO A;  4OWX B;  2JA5 G;  5IP7 G;  1JMC A;  1A8V A;  3PF5 A;  1G51 A;  4C2M H;  3T1Y L;  1Q81 C;  4APV A;  4J15 A;  1Y1W G;  1VQ8 A;  3PUX A;  4GOP C;  2R7D A;  5DLQ E;  3PIO A;  1CKM A;  1UE7 A;  1XMO Q;  1D7Q A;  3ULP A;  2UXC Q;  1S3O A;  3T1H Q;  5IY0 A;  4A76 A;  1SFO H;  4LF7 L;  3S14 H;  4DV4 L;  3PO2 H;  1U0L A;  4JI0 Q;  4IO9 A;  2PMZ E;  1NBW A;  5BR8 L;  2N8N A;  3ERS X;  3GTP H;  1FL0 A;  4B3R Q;  2ZTC A;  4JI1 Q;  2ZJP A;  4A3B H;  4GKK Q;  3GD7 A;  2Y0S E;  1K9M C;  5LMN L;  5GAG C;  4DAY B;  1PH8 A;  4GKJ L;  2VNU D;  3HKZ E;  4O2D A;  1Y1V G;  2QA4 A;  1XMO L;  1PH9 A;  1X54 A;  4AYB G;  3JAM c;  3T1H L;  1XNQ Q;  2UXC L;  1WJJ A;  4LWC A;  1EIF A;  4JI0 L;  3HOX H;  1VQN A;  4BBR G;  2K50 A;  1XMQ L;  1LTL A;  4YCV A;  3KOJ A;  2Q2T A;  4JI4 L;  3S16 H;  3H3V I;  4A3C H;  2E5L Q;  1OXU A;  2Q2H A;  1IBM Q;  2VUM H;  2AWO A;  3GDE A;  3NEL A;  4JI1 L;  1EYG A;  1VQJ A;  5ELO A;  2JEA I;  1CSQ A;  3I4N H;  3CCS A;  5FLM G;  3CD6 A;  4GKK L;  2JA8 G;  4A3I H;  2ES2 A;  1OXX K;  4FDB A;  3NBH B;  3H3V H;  3M4Q A;  1PH4 A;  4R4Q A;  4DUZ Q;  1KD1 C;  4DR7 Q;  3GTL H;  1L1O C;  3JAM i;  4DKA C;  3KF8 B;  4GN5 A;  2ZM6 Q;  5C3E G;  1UEB A;  3FKI H;  3M9B A;  3CMA A;  1SR3 A;  3TS0 A;  4R4T A;  4HID A;  1VQ4 A;  3PV0 A;  2DUD A;  2UUA L;  2R92 H;  2JA6 G;  1N36 L;  4TVA B;  1YHA A;  5IWA Q;  2PNH A;  1XPU A;  4A3J G;  1RIP A;  1VQ7 A;  4QQB X;  3U4Z A;  2MO1 A;  3AYH B;  3G6E A;  3E0E A;  3M3Y H;  2R93 H;  3NEM A;  1PYB A;  4IPD A;  1QZH A;  1GM5 A;  2Y0S G;  2I0Q A;  4POG A;  2KHI A;  4A3M G;  3ICE A;  4JG2 A;  4DR7 L;  2ALY B;  5C0X G;  3VDY A;  3HKZ G;  1J5E Q;  4A3F G;  2IX1 A;  5M3M H;  5FJ8 H;  1JJC B;  1YNX A;  2ZM6 L;  1IYJ B;  4OWW B;  3DLL A;  4B3T Q;  4NXM Q;  4YCW A;  4O0A A;  3RNU A;  2WAQ E;  2IT1 A;  1YIJ A;  2QGQ A;  3CPW A;  4LF8 Q;  1VQB A;  4A3E G;  1YZ6 A;  2EQS A;  3MXN B;  1GD7 A;  4QJF A;  4A3G H;  4POF A;  2UU9 L;  1MJC A;  1XPR A;  1AE2 A;  2DGY A;  3HOW H;  4DV2 Q;  1TWH H;  2I5M X;  3UDI A;  1J5E L;  2WP8 J;  1C7Y A;  5JJK A;  1BBU A;  1NMF A;  1X3G A;  2PI2 E;  2ZTD A;  4PZ6 A;  3CME A;  3CCU A;  2XGT A;  1U5K A;  3GTQ H;  2HIV A;  1B8A A;  4IOC A;  4A3L G;  4BXX G;  1I5F A;  2K4K A;  2F52 A;  4X66 Q;  4DV7 L;  2XTI A;  4ME3 A;  1E3P A;  1IBK Q;  2NVX H;  2HIX A;  5IYB H;  4QIW E;  2VW9 A;  1Q82 C;  4OX9 Q;  5IYD H;  4DV2 L;  4LF4 L;  2KBN A;  2K5V A;  4KHZ A;  1KHI A;  5AJ3 L;  5GQO A;  4A3K H;  4DR1 Q;  1EUJ A;  4QGU A;  5LMU Q;  3PUV A;  2KEN A;  3RN5 A;  3A5Z B;  3TEH B;  3W1B A;  5LMN W;  5IYC H;  2CCZ A;  3ULJ A;  2ZJQ A;  1Q46 A;  3TRZ A;  3GTK H;  2OQK A;  1HZA A;  4ALP A;  1JJ2 A;  2WAQ G;  3BJU A;  1IBK L;  3CC2 A;  2OWO A;  4Y52 H;  1QVC A;  2D0O A;  3T1Y Q;  1YEZ A;  4A3D G;  4OX9 L;  1G29 1;  3GTG H;  3I4O A;  1OXT A;  4DR1 L;  1A62 A;  3F2D A;  2UXD Q;  1KAW A;  2OQ0 A;  2FXQ A;  2K14 A;  3F2B A;  1PH5 A;  1HR0 L;  5BR8 Q;  4GN3 B;  1NE3 A;  3J81 c;  3I4M H;  3PO2 G;  2L15 A;  1C0A A;  4AQY Q;  2R93 G;  1KRS A;  3I2Z A;  5C4J H;  4A75 A;  1I50 H;  5LMN Q;  3J7A 5;  4GKJ Q;  1KXL A;  4BBS G;  4HJA A;  3G71 A;  2UUC Q;  1VQI A;  2E2J H;  3S2D H;  1V9P A;  1E1T A;  1PH1 A;  2UXD L;  1S40 A;  2LXJ A;  1LYL A;  4LUZ A;  4IFD I;  3M4P A;  2JA7 H;  4BY7 G;  3LGJ A;  4C3I H;  1XMQ Q;  4JYA Q;  1XJV A;  4JI4 Q;  3PO3 H;  3PUW A;  5E7N A;  3J81 i;  1P8L A;  4BY1 H;  1H95 A;  4AQY L;  4LF9 L;  1OXS C;  1X65 A;  4NB3 A;  5H1S E;  4A3C G;  4UP9 A;  1SE8 A;  3PSI A;  4KLK A;  4BA1 I;  4DR5 Q;  2UUC L;  2MFI A;  2OCE A;  4JBW A;  3TQY A;  5IP9 G;  2CWP A;  1X9N A;  2ATW A;  2JA5 H;  5IP7 H;  1L0W A;  2UUA Q;  4Y7N H;  4JYA L;  1N36 Q;  1Y1W H;  4A93 G;  1B70 B;  2CFM A;  1RL2 A;  3G48 A;  4R4C A;  2VQF Q;  1EQQ A;  5M3F G;  2LXK A;  3W1G A;  3HOV G;  1CSP A;  4UP8 A;  2BH8 A;  4DR5 L;  1X6O A;  3GO5 A;  3ZJY C;  3KFU A;  2I5H A;  2ZJR A;  3K7U C;  1PH2 A;  4QY7 A;  3CQZ H;  3S1Q H;  3D31 A;  3KJP A;  4IPG A;  4KHP Q;  1Q8K A;  1WYD A;  1TWC H;  3HKS A;  4PZ8 A;  2D0P A;  3BZK A;  4LUO A;  2B29 A;  1KRT A;  4OWT B;  1PFS A;  1X56 A;  4DNI A;  1DGS A;  1TWG H;  3FP9 A;  2VQE Q;  1VQA A;  1EWI A;  4JI2 L;  2CQO A;  3OTO Q;  1VQ6 A;  5JJL A;  1LM0 A;  4YWK A;  2VQF L;  4IFD J;  2B63 G;  1XNR Q;  1Y1V H;  2UU9 Q;  1Q1E A;  3BZC A;  1VQM A;  1QUQ B;  4JBJ A;  3CW2 C;  2QEX A;  4DR2 Q;  3I56 A;  2CWA A;  1FVI A;  2NN6 G;  3OYY A;  1Y14 B;  4KHP L;  2AHO B;  2VL6 A;  3S17 H;  2H5X A;  3F8T A;  4BBR H;  1SRO A;  2YTX A;  1CKN B;  4UY8 C;  2A19 A;  2MNA A;  4YWL A;  5GAD C;  1CKO A;  3STB C;  4AH6 A;  2VQE L;  4DV7 Q;  4XIG S;  1VS0 A;  5JEA G;  5FLM H;  3K7A H;  3L0O A;  4L5T A;  3OTO L;  1VQ9 A;  2JA8 H;  1XNR L;  3PF4 A;  2KCT A;  4DR6 L;  4R4O A;  2BA0 A;  3H0G G;  3K0X A;  4DR2 L;  1HR0 W;  4LF4 Q;  4L5Q A;  5C4X G;  1GO3 E;  4JBM A;  4P71 A;  1V1Q A;  5AJ3 Q;  1PHJ A;  4WJ3 M;  5C3E H;  4AIM A;  4DK6 C;  2NZO A;  3S2H H;  2K5H A;  3EIV A;  2JA6 H;  3HOU G;  4JV5 Q;  2PQA B;  1BKB A;  3RLO A;  4A3J H;  4X65 L;  5C0X I;  3PGZ A;  4OO1 G;  4YWM A;  1VQG A;  1E7Z A;  2B3G A;  2JE6 I;  4GS3 A;  1W3S A;  4IJL A;  4HJ9 A;  1YJN A;  3Q8D A;  4LNQ A;  3HOY G;  2JK8 A;  3FHW A;  3HOZ G;  1KIX A;  4B3S L;  4A3M H;  2F3I A;  5HGQ A;  2CKZ B;  3K81 C;  4LF6 Q;  4BA2 I;  1E24 A;  2V1C C;  1VQO A;  1QUQ A;  4K0K Q;  3DM3 A;  1FJG L;  2YV5 A;  1IL2 A;  1P16 A;  3AEV A;  1TWF H;  1PH6 A;  1PV4 A;  1QZG A;  4JV5 L;  3CAM A;  4OXP A;  3STB D;  4YCU A;  4YY3 Q;  4A3E H;  1CKN A;  2R7Z G;  4PMW A;  1KQS A;  1GVP A;  4MTN A;  1HR0 Q;  3KF6 B;  3UDF A;  4B3M L;  5C44 G;  2YU9 H;  1E22 A;  3CP0 A;  3RLF A;  3I7F A;  4C3J H;  1K0R A;  4LF6 L;  2NZH A;  3JC6 6;  2NVQ H;  4WJ4 A;  1C9O A;  1HJP A;  1WCM H;  1Q86 C;  2NVT H;  3L7Z C;  2Z0S A;  1HZB A;  1X3F A;  3EN2 A;  1X3E A;  4MNO A;  4BXX H;  5ELN A;  4K0K L;  2AKW B;  4GOP B;  4DV1 Q;  3RR5 A;  4DV6 L;  3L2P A;  1Q12 A;  4P75 A;  1OTC A;  2UUB Q;  1VQ5 A;  3CC4 A;  1N32 L;  4YY3 L;  3NEN A;  1N34 L;  2HHH Q;  1GKH A;  3F1Z A;  2YYZ A;  2PQA A;  1EQR A;  1X55 A;  1T9H A;  3MEF A;  1E1O A;  2GN5 A;  2NVY H;  4X6A H;  1YI2 A;  1VQF A; 
#chains in the Genus database with same CATH topology
 4LF9 Q;  4JI7 Q;  3A74 A;  4ME5 A;  2EJG C;  2OXP A;  1Q1B A;  1WVL A;  4DR4 Q;  2A1A A;  1V43 A;  5EPJ A;  2DY7 A;  4FYD A;  4DV1 L;  1MIU A;  2RHQ B;  1YHB A;  1VQC A;  3EFX D;  1CK1 A;  1V8Q A;  5EAY A;  2HHH L;  3RD4 A;  1B3Q A;  1TQO A;  4JI3 L;  4A3D H;  4X62 Q;  4LFB L;  3SK5 A;  5G3L D;  1XTC D;  5KYI A;  3D4W A;  1EFW A;  2I07 B;  1ENC A;  1SYF A;  1UE6 A;  1LUZ A;  4LFA L;  4KD3 A;  4XYQ A;  1V1P B;  4GOP A;  4YHH Q;  3BVG A;  1L1O B;  3B6Y A;  5C3W A;  4ZKC B;  4JI2 Q;  1YVC A;  3KDF A;  4G57 A;  4MZ9 A;  2WB1 G;  4LW1 A;  2UXB L;  4KI0 A;  2KCM A;  4X64 Q;  4NXN Q;  2JN4 A;  2BE5 C;  4BY7 H;  1I3Q H;  5I2X A;  2E2H H;  2RBM A;  5DNF A;  2ZTE A;  1NR2 A;  5FO8 B;  3S15 H;  4RMF A;  2VS1 A;  1QNU A;  3TZU A;  1FYC A;  1D1K A;  1HH2 P;  1R9T H;  1TWF B;  2MO0 A;  4FF3 A;  4H44 C;  4B3R L;  3TP5 A;  3HGB A;  3EQL C;  1I6V C;  1I6H H;  1DCZ A;  1D6E C;  4GNX A;  1TWA B;  2LSS A;  3PCO B;  3KJO A;  4A3G G;  1HNZ L;  1NNX A;  2ID0 A;  5C4X B;  4HCS A;  1XNQ L;  1VF5 C;  3TRE A;  3HOW G;  4DF7 A;  4A93 H;  2NVQ B;  2Z1C A;  1M90 C;  5KNC A;  3HOV H;  5D3D A;  5M3F H;  1ET6 A;  2L4N A;  1WD0 A;  3BS1 A;  3CCJ A;  4ODG A;  2RA4 A;  2BH2 A;  3KLS X;  1VQK A;  4P2C B;  3RZO H;  2QDB A;  1B44 D;  1TVX A;  4JI6 L;  1O80 A;  2EXD A;  3FRP B;  1FGU A;  3T16 A;  2NN6 H;  5GAH C;  2MGS A;  2WFW A;  1B7Y B;  2Z6K C;  1WCM G;  2O5I C;  5JEA H;  2IX3 A;  2JA9 A;  4XTC S;  1IYV A;  2HQL A;  5M5X H;  4NXM L;  1HCZ A;  4H02 A;  2R6G A;  3NUC A;  3A5U A;  3S1M H;  4OO1 I;  3CF5 A;  2HT1 A;  2FHT A;  5J39 A;  4DR3 Q;  2KED A;  2EDG A;  1RHP A;  3MXG A;  1KAA A;  1H9K A;  3HOU H;  1A0I A;  3X3M A;  3GTP B;  1IZ6 A;  1NTG A;  3OWF A;  4OIK A;  2OTJ A;  3KYH C;  4LFC Q;  4JI3 Q;  5CV4 A;  1N9W A;  3WDN A;  1S72 A;  2F0J A;  4KY5 A;  4LFB Q;  1PZK D;  1G6P A;  2ENB A;  1IW7 D;  2Z4I A;  4A4I A;  2L11 A;  3PO3 G;  1HNW L;  4RKB A;  4M1U B;  4DXG A;  1BOS A;  1JWU D;  3S16 B;  2FMM A;  5LMU L;  5JEA J;  1A63 A;  4PG3 A;  4L6T B;  3RMH A;  4A3I B;  1G2S A;  4DPG A;  3IAY A;  4OWX B;  2JA5 G;  5IP7 G;  5IGG A;  5L37 A;  1G51 A;  3QIA A;  3R3O A;  3T1Y L;  1Q81 C;  4APV A;  3RZD B;  3A8J E;  1B50 A;  2A68 C;  1FNW A;  3PIO A;  1SYC A;  1UE7 A;  1S3O A;  4DK0 A;  3T1H Q;  4KTA A;  4Q5V A;  4IO9 A;  2K1B A;  1U4L A;  2PMZ E;  2VB2 X;  4OEL B;  1STA A;  1FL0 A;  4B3R Q;  4K5X A;  4GKK Q;  3MTS A;  1PH8 A;  1QE6 A;  4DAY B;  5GAG C;  3QG1 A;  5I6Y A;  5KNB A;  2EPB A;  3JAM c;  1XNQ Q;  1G2T A;  2K5Q A;  3OW7 A;  1VQN A;  2Q2T A;  2IWH A;  4YCV A;  2B39 A;  5EKK A;  1GHK A;  1WTQ A;  2CH4 W;  1O78 A;  1CSQ A;  1TKW B;  3MFY A;  2ES2 A;  3H3V H;  1KD1 C;  3GTL H;  1TII D;  2KCN A;  3JAM i;  3DEO A;  3LX0 A;  1A2T A;  3K5O A;  1UEB A;  5C3E G;  5IIF A;  2V4D A;  1KAB A;  2WAC A;  3NSW A;  2PNH A;  5ELB A;  2EJM A;  4A3K B;  3U4Z A;  4FXD A;  1GUG A;  4OEM B;  4IPD A;  1QZH A;  5ELE A;  2ALY B;  5C0X G;  2NB0 A;  1LT5 D;  1J5E Q;  1MI2 A;  2IX1 A;  4XDX A;  5EPL A;  3S1R B;  3KBX A;  4ZCK A;  2ZM6 L;  1LO5 D;  4NXM Q;  4YCW A;  1NR4 A;  1KDA A;  3BYT B;  4XT3 B;  1YZ6 A;  4XQN A;  1GD7 A;  4A3G H;  2UU9 L;  1JOK A;  1XPR A;  5E3F A;  1TS5 A;  1SYG A;  3HOW H;  1QG7 A;  3N6R A;  3NBH A;  2PI2 E;  1X3G A;  2ZTD A;  5COR A;  3CCU A;  1SNQ A;  4DNT B;  3KF8 A;  3A8I E;  2KOL A;  3KLS A;  1E3P A;  4LJZ C;  1DM0 B;  1SNO A;  2A73 B;  3S14 B;  4QIW E;  2G5D A;  1STE A;  2LS0 1;  5J1Z A;  1CHQ D;  1LV9 A;  1EUJ A;  4QGU A;  2ZXR A;  5LMU Q;  3TEH B;  3W1B A;  3SK6 A;  3MHB A;  3O13 A;  3ULJ A;  3GTK H;  1EIH A;  2OQK A;  1PTO B;  1IBK L;  1BDO A;  4RGN A;  3T1Y Q;  2K32 A;  1YEZ A;  1PTO F;  1I4Q A;  1U4P A;  4OX9 L;  3MXN A;  1DZ1 A;  3GTG H;  1DD2 A;  3I4O A;  2F3W A;  2RDH A;  1EY0 A;  1BF4 A;  2XRQ D;  5CV5 A;  2UXD Q;  5HUR A;  4RHS A;  2F0U A;  2KA7 A;  4K2L A;  1HXY D;  4I7A A;  4DNR B;  2B2Y A;  1PRT B;  1I50 H;  5JOB A;  4OHJ A;  4BBS G;  1E2V A;  1ENF A;  3AU7 A;  3K5M A;  1LYL A;  1Y1V B;  4IFD I;  3J80 E;  2EYM A;  2KCC A;  4AYB B;  4JYA Q;  1SYD A;  1LT6 D;  2RVL A;  3H6M A;  3PO3 H;  3PUW A;  1NAP A;  3S17 B;  4BBR B;  3F2U A;  3ERO A;  1OXS C;  4A3C G;  4HED A;  5D65 A;  1SE8 A;  2E74 C;  3UI2 A;  2F0W A;  1SND A;  3OWE B;  5IP9 G;  5IGC A;  2JA5 H;  5IP7 H;  1L0W A;  1HPC A;  1UNS A;  3NQI A;  1CHP D;  3M7G A;  3S2H B;  1EQQ A;  1PRT C;  5EKL A;  2LXK A;  3W1G A;  4RWS C;  2BH8 A;  4DR5 L;  1D1I A;  1QOH A;  2NBF A;  4I7Z C;  5A2Q L;  3D31 A;  3S1Q H;  2XNA C;  3CRL C;  4KHP Q;  2D0P A;  1PTO D;  4LUO A;  5COY A;  2B63 G;  5FLX E;  2UU9 Q;  1II3 A;  1VQM A;  1X32 A;  2QEX A;  1B9M A;  2QIL A;  1D2B A;  2L5T A;  1FVI A;  1JOQ A;  3MXU A;  4L8J A;  4V0B A;  3FPP A;  2A19 A;  5CV6 A;  4KV6 A;  3QJY A;  5GAD C;  3STB C;  4AH6 A;  4DN4 M;  1VQ9 A;  2PW7 A;  1Y8O B;  4L5Q A;  2EZV A;  4WJ3 M;  5C3E H;  2P5Z X;  4BS9 A;  2K5H A;  4FVM A;  1LTT D;  4OO1 G;  3S2D B;  1E7Z A;  1E0B A;  1W3S A;  4HJ9 A;  1YJN A;  5ELD A;  2RSO A;  2Q8I B;  3VR5 A;  5C0X H;  2TSS A;  2WAQ B;  3D8G A;  4BA2 I;  2O5J C;  2B8G A;  1H9S B;  1HTP A;  1FJG L;  1TWF H;  1QZG A;  5JJZ A;  1XWE A;  3CKI B;  3STB D;  1CKN A;  2F0P A;  1SE3 A;  1X3Q A;  4B3M L;  2YU9 H;  5KGU A;  5EBC A;  1ILP A;  4QF4 A;  3RLF A;  1ILQ A;  4LF6 L;  3JC6 6;  2NVQ H;  1C9O A;  1HJP A;  1X3F A;  4K0K L;  2AKW B;  3RR5 A;  2IW3 A;  4CDF C;  1RTO A;  2UUB Q;  1VQ5 A;  1N32 L;  4YY3 L;  4UDU C;  3F1Z A;  3TSS A;  4X3K A;  1ZEQ X;  5C0X J;  4OL7 A;  4X3T A;  4KY7 A;  4UP7 A;  1GUS A;  1C8C A;  4QMG A;  4LF5 L;  1O7Z A;  1TWG B;  3C2P A;  4CBV A;  4FP5 D;  4JCV E;  2K5W A;  3R93 A;  5IT9 c;  3A0J A;  1GJX A;  4FXG C;  2C35 B;  2VZA A;  2R7F A;  5JJI A;  1N33 Q;  1S4Z A;  3CCM A;  4JI7 L;  4J1M A;  2ICI A;  4B08 A;  1WFQ A;  3OMG A;  4DR4 L;  1QCB D;  3BDC A;  3M4O B;  5C3X A;  4CDD C;  3H15 A;  3I4N G;  1B4O A;  4DUY Q;  2N55 A;  3EJI A;  2I5L X;  4HJ5 A;  4X62 L;  1NMG A;  3CXC A;  3CCL A;  3S1N H;  3GTJ B;  3Q24 A;  1VQP A;  3FKI G;  4BBS H;  1SMX A;  3CHB D;  4A3J B;  4YIJ A;  1G6Z A;  4IAL A;  1WI5 A;  3PUZ A;  3EBE A;  4YHH L;  1BR9 A;  1YBY A;  4JK1 C;  4A3F B;  2D2C C;  2NTT A;  3GTO H;  1DOM A;  3BU2 A;  2A69 D;  4WRD A;  1SAP A;  1JE5 A;  3GP7 A;  1ASY A;  2H1E A;  1AP0 A;  5IP9 H;  1W2B A;  1GHJ A;  2AMC B;  3VYT A;  1F9R A;  1LT3 D;  4X64 L;  5M5Y H;  1AE3 A;  4NXN L;  2J0T D;  1SXT A;  3J80 c;  3H0G B;  4LUV A;  1YNJ C;  1YIT A;  3RZD H;  3WWV A;  1EYC A;  2HD3 A;  1PVO A;  1ML0 D;  3D0F A;  5IOD A;  2E5L L;  4DV3 Q;  1EEF D;  1B2T A;  2B2T C;  1IBM L;  5NUC A;  2K6A A;  3U4V A;  3RLN A;  5C6A A;  1VCI A;  1SE4 A;  3NWS A;  4GN4 B;  3HOZ B;  2GVB A;  4JOI C;  2BCO A;  3ND8 A;  4C3H B;  4RFB A;  5IYB G;  1FJG Q;  4KKU A;  3U58 A;  3J80 i;  5CV7 A;  3BZD B;  4IPC A;  4N8F A;  3TP8 A;  2IHF A;  3GTM H;  5IE8 A;  4R4I A;  4L63 B;  2QKI C;  2B63 H;  2F4V Q;  1TT2 A;  4B3M Q;  3ER0 A;  3J81 j;  1K3R A;  2R7Z B;  1T5E A;  3M7N A;  5C44 B;  3IFD A;  3OMC A;  2PZW A;  4JC0 A;  3J81 E;  1ET9 A;  1RJT A;  1UWV A;  3IL8 A;  3KK7 A;  3AFQ A;  5T1I A;  4C2M B;  5IGB A;  3K8A A;  1N32 Q;  2RF4 A;  4B3T L;  4G7Z C;  3NP8 A;  2K28 A;  5FLX c;  3RN2 A;  1EWH A;  2DNC A;  4CKB A;  1HZC A;  2KHJ A;  4LF8 L;  2F1M A;  4CHT B;  3ULL A;  4R1J A;  4LF5 Q;  4A3L H;  1STN A;  2XSC A;  1LAB A;  4OO1 H;  2QCP X;  4NPS A;  4A3B B;  1NJI C;  3R2T A;  4QUC A;  1FNV A;  4WOR A;  5M9O A;  2JA7 G;  1BQQ T;  4Y52 H;  1CUK A;  4TQU S;  1NY4 A;  4C3I G;  4DR3 L;  3S1R H;  1DON A;  1Z47 A;  5FKA C;  5IGE A;  1JC7 A;  4BY1 G;  1SLJ A;  4IFD G;  5EJW A;  2AQ2 B;  4AYB E;  3VR3 A;  4HJ7 A;  2ZT9 C;  2VUM B;  3CCV A;  2TMP A;  4LFC L;  4KKS A;  4LF7 Q;  1SJE D;  1JMC A;  3SK4 A;  4U67 3;  5I4D A;  4RKL A;  1LTS D;  1R4P B;  4GZY C;  5DLQ E;  2A6E C;  1EWC A;  1XMO Q;  1WTR A;  5KIX A;  2UXC Q;  1SFO H;  3S14 H;  3PO2 H;  2JSO A;  1U0L A;  1J8I A;  1F77 A;  5M5W B;  5EKI A;  1NBW A;  1QNK A;  4JI1 Q;  5M3M B;  3VR6 A;  2Y0S E;  1K9M C;  2A5H A;  2Z8L A;  2E2I B;  3I90 A;  1X54 A;  2EYL A;  3T1H L;  4U68 A;  3SEB A;  1LTL A;  1GXD C;  3KOJ A;  4JI4 L;  5C4H A;  2E5L Q;  1IBM Q;  2Q2H A;  1EYG A;  1VQJ A;  2N88 A;  3I4N H;  4GKK L;  3CCS A;  5FLM G;  5TSS A;  2A6E D;  3H91 A;  1ONL A;  5CC4 A;  1HA5 A;  3DEP A;  1PH4 A;  4DR7 Q;  1L1O C;  4UAI A;  2K33 A;  3FKI H;  1SR3 A;  3TS0 A;  4R4T A;  4HID A;  1N36 L;  3OPO A;  1XPU A;  4A3J G;  1RIP A;  4M8A A;  4QQB X;  4IZ8 A;  3HOY B;  2MO1 A;  3D4R A;  3G6E A;  3OIQ A;  3M3Y H;  2E75 C;  3NEM A;  2I0Q A;  1ZXT A;  1C4Q A;  2CH4 A;  4A3M G;  1WTX A;  4RCO A;  4CGY B;  1DOL A;  4OGQ C;  4A3F G;  1QWY A;  2JYO A;  1YNX A;  3JAM L;  5KEE A;  2CQA A;  4B3T Q;  1W6J A;  4O0A A;  2WAQ E;  2IT1 A;  4FO2 A;  4LF8 Q;  1GUW A;  2PNR C;  3TP7 A;  4ZKB B;  1IW7 C;  4QJF A;  1I4X A;  3C1E A;  2ZXP A;  2FIN B;  2DGY A;  4DV2 Q;  4KJO A;  1E2Z A;  2I5M X;  5DAU A;  1J5E L;  1EQT A;  3GTQ H;  1SSO A;  1U5K A;  4IOC A;  5C5L A;  3TZD A;  5C4J B;  3PIO 3;  2F52 A;  4MIU A;  3VA7 A;  4DV7 L;  2XTI A;  4ME3 A;  1J9O A;  4K5V A;  1MSG A;  2O2L D;  2LFN A;  4CKC A;  1KLU D;  5IYB H;  4IQZ A;  3I8Z A;  2KEE A;  3FMC A;  1SYE A;  2C5C A;  4KHZ A;  5GQO A;  3LWU A;  4RGO S;  2F0T A;  3A5Z B;  3VA5 A;  1RF2 D;  5EGT A;  4K5W A;  4XYO A;  5CGK A;  1HZA A;  1JJ2 A;  4DAP A;  3CC2 A;  2JXM B;  2D0O A;  5BN4 A;  1RDP D;  4CJ0 B;  3QO2 A;  1CZG A;  5E1F A;  1UUP A;  5JPM C;  1Y1W B;  5D3I B;  4ZYS A;  1G91 A;  1A62 A;  3F2D A;  2MP1 A;  2PZT A;  4KJN A;  3TME A;  2JP1 A;  5CBA E;  3KBG A;  2FXQ A;  2K14 A;  3DWA A;  3P1H A;  1HR0 L;  2PCF B;  4KHV A;  3J81 c;  4AQY Q;  1KRS A;  1B53 A;  4EQO A;  3T13 A;  3S2D H;  2PO4 A;  5EBD A;  4NMZ A;  1PH1 A;  2UXD L;  2RQX A;  2LXJ A;  1S40 A;  5J22 A;  2JA7 H;  4DA2 A;  3LGJ A;  4C3I H;  2LMC B;  1XJV A;  4JI4 Q;  3J81 i;  4BY1 H;  1AN8 A;  5IGF A;  1X65 A;  4IFD H;  1QJO A;  3DMU A;  4BWG B;  3PSI A;  4KLK A;  1JQY D;  5LHY 1;  4UHV A;  1LTG D;  2MFI A;  3PQI A;  2OCE A;  3NXW A;  1ESR A;  1X9N A;  2OEO A;  3PIP 3;  4JYA L;  1TWH B;  1N36 Q;  1EY6 A;  4FF1 A;  1EEI D;  2F0F A;  3OHX C;  4WFN 3;  4R4C A;  4HCE A;  1QIL A;  1SE2 A;  4UP8 A;  1X6O A;  3AB9 A;  3ZJY C;  3K7U C;  2L9H A;  4QY7 A;  3CQZ H;  3G6J B;  3KJP A;  4IPG A;  3I4L A;  2NVX B;  4IN3 A;  1WYD A;  1TWC H;  2CHB D;  3BZK A;  1KRT A;  4EQN A;  2NZ1 D;  4DNI A;  1TWG H;  1CA6 A;  2VQE Q;  1TS4 A;  1EWI A;  1VQA A;  2CQO A;  3OTO Q;  2XWB B;  3T56 B;  4IFD J;  1BCP B;  1DYQ A;  1BCP F;  1QUQ B;  4A3E B;  3CW2 C;  2CWA A;  4KHP L;  2AHO B;  5E4X A;  2VL6 A;  1RKN A;  2H5X A;  3F8T A;  4O42 A;  1SRO A;  2YTX A;  1AW7 A;  1B9N A;  2NVT B;  4DV7 Q;  2DN8 A;  4XIG S;  1VS0 A;  5FLM H;  5I9O A;  2SEB D;  3K6O A;  3PF4 A;  2KCT A;  4R4O A;  3T51 B;  3K0X A;  2I46 A;  1HR0 W;  1AFP A;  1F2Y A;  5C4X G;  4HAE A;  2SNS A;  4P71 A;  3CRK C;  1NSN S;  2NZO A;  3EIV A;  2BDN A;  1XYI A;  1LT4 D;  2PQA B;  1BKB A;  2XVS A;  4RH6 A;  3RLO A;  4A3J H;  2LKV A;  2JE6 I;  4MTK A;  1STY A;  2E2J B;  2F0V A;  3L9A X;  5IT9 E;  3HOY G;  3U9S A;  2MHV A;  1EQV A;  2JK8 A;  4TRD A;  4B3S L;  4A3M H;  2KQ3 A;  5ELC A;  2CKZ B;  3BVZ A;  3TDQ A;  1E24 A;  1VQO A;  3KLR A;  4J8Q A;  4CDC C;  2KHS A;  4K2K A;  2K5D A;  3HP3 A;  2L55 A;  1MD2 D;  1Y69 U;  4G7O C;  4MTN A;  1HR0 Q;  1HUN A;  3UDF A;  4R8N A;  3C3L A;  4X3U A;  3I7F A;  1K0R A;  3LWE A;  2DNE A;  4Y7N B;  1WCM H;  4DK1 A;  3L7Z C;  4I65 A;  4MNO A;  4GOP B;  4DAV A;  3L2P A;  1N34 L;  2B2W A;  2M9V A;  2YYZ A;  1BCP D;  3MEF A;  1X55 A;  2QEJ C;  5BN5 A;  3KDF B;  1VQF A;  1I3Q B;  4BY7 B;  2E2H B;  1CFM A;  1WOC A;  3S15 B;  2XN9 C;  1R9T B;  2UUB L;  1BO0 A;  1D8L A;  3KLW A;  3WOE A;  1TXY A;  1PTO C;  2F0O A;  2YTV A;  3MZ5 A;  3UDX A;  5JAV A;  2PI2 A;  1XPO A;  2KVM A;  4HN7 A;  3KF6 A;  3UE0 A;  2F0G A;  4EVO A;  4GNX B;  3UDG A;  2PYK A;  1SNM A;  3HOV B;  2EVB A;  3K80 C;  1HFG A;  2LY7 A;  3K7A B;  1IBL Q;  4A3I G;  2JEB I;  1O7Y A;  5FOB B;  4L5R C;  1IL8 A;  4QB4 A;  1VQH A;  3I72 A;  1QVG A;  2E8G A;  3CCR A;  1N33 L;  3K57 A;  1PMR A;  2X69 A;  3RZO B;  4N8X 1;  4RCN A;  1TY2 A;  4TKO B;  4DUY L;  3TP6 A;  2Y0S B;  5D14 A;  1K73 C;  4K8J A;  1YHQ A;  5FJ8 G;  1LLR D;  1AH9 A;  1OXV A;  1UE1 A;  4GNX C;  2F3V A;  3E0J A;  2HDL A;  3BDO A;  5CR3 A;  5HY6 A;  3D6W A;  3P7J A;  3S1M B;  3HG9 A;  4C3J B;  2XRS D;  1VQL A;  1PYS B;  1V1P A;  2K75 A;  3MEH A;  3M85 A;  1L1O A;  3HOU B;  1WD1 A;  2AQ3 B;  2N78 A;  2K52 A;  4B3S Q;  2EY2 A;  3ITP A;  3E9I A;  2X6G A;  3A7L A;  4PV1 C;  2Q2U A;  1LTB D;  3V2T A;  1XX8 A;  5M5W H;  3Q6S A;  4DUZ L;  5IYD G;  1EOV A;  4DGZ A;  3CCE A;  4P73 A;  2VB3 X;  3AQQ A;  2KUM A;  4A3K G;  1K8A C;  1Y8P B;  3GQB A;  1TR5 A;  2E2I H;  5IWA L;  4DV3 L;  4DV0 Q;  1Q7Y C;  2IHE A;  4H13 C;  5EPK A;  4HIM A;  1X3P A;  1A3V A;  3MVV A;  1VQD A;  1MKH A;  3P75 A;  1CTM A;  3I55 A;  3D3R A;  3J80 L;  4FXK C;  1HNX Q;  2A6H D;  3J7A F;  1N34 Q;  2RCN A;  1TWA H;  3U50 C;  2Z6K A;  2F4V L;  4OON A;  2C9O A;  3J7Z C;  4IPH A;  2B2V C;  4J6H A;  2AWN A;  5C4X H;  2Z9H A;  3NQT A;  2YTY A;  4IJH A;  4HSP A;  5GAE C;  2WKC A;  4ILW A;  2R93 B;  1HQR D;  3OIP A;  4PMC A;  1LTR D;  3SXH A;  2A8V A;  3VYU A;  3HOY H;  1I94 Q;  2IPK D;  2EYH A;  3OW2 A;  2OTL A;  4X66 L;  1TS3 A;  1LAC A;  2L0C A;  1IXR A;  1PFN A;  2F0N A;  3HFZ B;  1D5X C;  2D62 A;  3SGI A;  4G4K A;  1VDZ A;  1PA6 A;  3UE1 A;  1U4M A;  1CT1 D;  3IRB A;  3NE5 B;  1BVS A;  1A15 A;  2IX0 A;  4PZ7 A;  2OT2 A;  4DV4 Q;  3CPF A;  4F8M A;  1JT8 A;  1I4G A;  2JQO A;  1RTN A;  2A69 C;  2SOB A;  5FLX L;  3PF5 A;  2EY5 A;  4IUU A;  4J15 A;  4HR7 B;  1CI3 M;  1CKM A;  1V1O A;  3FDT A;  1D7Q A;  3HZX A;  3ULP A;  1F2M A;  5C5M A;  2PQE A;  5IY0 A;  5KND A;  4A76 A;  4LF7 L;  4NW2 A;  3K5L A;  4JI0 Q;  2QF7 A;  2H4O A;  5BR8 L;  2N8N A;  3ERS X;  3GTP H;  4ZLT F;  3VYR A;  2WV6 D;  2F4I A;  3GD7 A;  5LMN L;  2VNU D;  3HKZ E;  2F0H A;  4O2D A;  1Y1V G;  3NTI A;  2QA4 A;  1XMO L;  1PH9 A;  1EU3 A;  4AYB G;  2UXC L;  1WJJ A;  2IJ0 A;  1EIF A;  2DY8 A;  4IUV A;  4K8I A;  3HOW B;  4BBR G;  4A3C H;  3S16 H;  1K83 B;  1GUO A;  3SR1 A;  2AWO A;  3GDE A;  4JI1 L;  4FF2 A;  1OO9 B;  3CD6 A;  3QOJ A;  4A3I H;  1OXX K;  4FDB A;  1F9Q A;  2IL8 A;  3NBH B;  4R4Q A;  4DUZ Q;  4DKA C;  1U4R A;  3NPP A;  1Y8N B;  3KF8 B;  1KDB A;  3M9B A;  3CMA A;  3PV0 A;  4OIJ A;  1FR3 A;  3G7L A;  3T4A C;  5IWA Q;  2HUG A;  1M4V A;  2EYO A;  2F0D A;  1WTW A;  2G9D A;  4ULL A;  1EIG A;  3HS0 C;  2K04 A;  4RGM A;  1PYB A;  1GM5 A;  3ICE A;  2Y0S G;  2KHI A;  4DR7 L;  3QR8 A;  5T1G A;  4DAY A;  4PNY A;  1EYA A;  5FJ8 H;  1JJC B;  4S3S A;  4OWW B;  4IUR A;  1SMY C;  2NYZ D;  3I91 A;  3RNU A;  4KK7 A;  3Q0A A;  2VXW A;  2EQS A;  3MXN B;  1HA6 A;  4POF A;  3ONA B;  2PPB C;  1AE2 A;  5E4W C;  3A56 A;  1TWH H;  4C3J G;  1C7Y A;  1NMF A;  1BBU A;  4PZ6 A;  3CME A;  2XGT A;  1B3A A;  4JVZ A;  2HIV A;  1B8A A;  3X3N A;  1I5F A;  2K4K A;  1I50 B;  1D5Z C;  1SNC A;  2F0S A;  4FNF A;  2Q8T A;  5FO9 B;  4X66 Q;  4JW0 A;  2RSN A;  4HTH A;  2F0L A;  2NVX H;  1BUV T;  5I9P A;  2VW9 A;  1Q82 C;  5IYD H;  4DV2 L;  3RUZ A;  2K5V A;  5AJ3 L;  3PO3 B;  4A3K H;  4DR1 Q;  2J7Z A;  1SMY D;  4C1N K;  5LMN W;  1HUM A;  1Z6H A;  2CCZ A;  1UEA B;  2ZJQ A;  3TRZ A;  3VYS A;  4ALP A;  2WAQ G;  2F0E A;  2OWO A;  1XXG A;  4B9W A;  1G29 1;  3HOX B;  4XQQ A;  3A55 A;  1OXT A;  4DU9 A;  4ID6 A;  1K8M A;  4NP5 A;  2G9H D;  5AFW A;  2EY1 A;  2B2Y C;  4RHR A;  3F2B A;  5BR8 Q;  1NE3 A;  3S1Q B;  3V96 A;  1H9J A;  3BVM A;  1C0A A;  2R93 G;  3MWY W;  4HMJ A;  1MHW C;  5LMN Q;  4HJA A;  2UUC Q;  1H9M A;  2E2J H;  5LL6 S;  2R92 B;  1VMP A;  1E1T A;  2RDG A;  4LUZ A;  3H94 A;  3M4P A;  2F0Q A;  2PW5 A;  3A8K E;  3FVQ A;  4AQY L;  5JVG 3;  4F87 A;  1JWM D;  4HSV A;  4BA1 I;  1S5F D;  1PTO H;  4JBW A;  3TQY A;  3MFG A;  1ICW A;  1CQV A;  2CWP A;  3LNN A;  1LTA D;  1PFM A;  3BG3 A;  4Y7N H;  1S5D D;  3GV3 A;  1Z7T A;  2NWG A;  5C3E B;  2CFM A;  1RL2 A;  3G48 A;  3J81 L;  2VQF Q;  5EQ0 A;  3H09 A;  1CSP A;  3KFU A;  2I5H A;  4CJ2 C;  2ZJR A;  1PH2 A;  1ZKO A;  5K5P A;  3HKS A;  4PZ8 A;  1BXT A;  2B29 A;  1MSH A;  4OWT B;  1PFS A;  1X56 A;  1DGS A;  3FP9 A;  5JJL A;  1VQ6 A;  1KLG D;  2FFK B;  1XNR Q;  1Y1V H;  1Q1E A;  4JBJ A;  1O7L A;  4DR2 Q;  3I56 A;  1AEX A;  4B9X A;  1CQF A;  1Y14 B;  5IGD A;  2YU9 B;  3S17 H;  4BBR H;  1JCK B;  3VR2 A;  1CKN B;  4UY8 C;  3SHL A;  2MNA A;  4MHE A;  1CKO A;  2VQE L;  4NDX A;  2K03 A;  3C1F A;  3OTO L;  4F7X A;  3K7A H;  3L0O A;  4L5T A;  1AZQ A;  3I3C A;  5I6W A;  1RD9 D;  4DR6 L;  4H0L C;  3E5S A;  4K6D A;  2SDF A;  2BA0 A;  3H0G G;  1GO3 E;  3BYY B;  1V1Q A;  2BE5 D;  5AJ3 Q;  2B2U C;  4F88 A;  1PHJ A;  1ESF A;  4DK6 C;  3S2H H;  3I4M B;  3A7A B;  4XQJ A;  3HEJ A;  4JV5 Q;  2RCF A;  1K0S A;  4X65 L;  4YWM A;  1VQG A;  4IJL A;  4LNQ A;  2F0M A;  2DJG C;  3FHW A;  3HOZ G;  1KIX A;  3W2D A;  4C3H G;  2J4X A;  4LAA A;  2V1C C;  1D5M C;  2K05 A;  1A3T A;  3WOF A;  1P16 A;  5JVH 3;  1TY0 A;  3EVQ A;  3CAM A;  3ERQ A;  4Q0F A;  5DM6 3;  1I4R A;  2R7Z G;  4PMW A;  2CW0 C;  3KUP A;  1GVP A;  1KQS A;  4ABN A;  3N52 A;  2WKD A;  3NHH A;  5C44 G;  1E22 A;  1EY4 A;  3CP0 A;  2XWJ B;  4C3J H;  3AMU A;  2NZH A;  4WJ4 A;  2B2V A;  2WII B;  1HZB A;  3S1N B;  1YNN C;  5ELN A;  1CM9 A;  4DV1 Q;  4DV6 L;  4BBS B;  1Q12 A;  3FPU B;  4P75 A;  3L3O C;  3CC4 A;  5A35 A;  2HHH Q;  1GKH A;  2AQ1 B;  1JWS D;  1EQR A;  4X6A H;  1TU2 B;  3I70 A;  1E1O A;  3R2I A;  5DEH A;  2WB1 E;  1PYW D;  4DV5 L;  3GTO B;  1BBW A;  3E9H A;  4A3B G;  4LFA Q;  4JI8 L;  3DWQ A;  3DM1 A;  1H9S A;  1SNP A;  2MUY A;  3QWN A;  1MJE A;  2CW0 D;  2N49 A;  1KNE A;  4GLA C;  1F2L A;  1I4H A;  2RHS B;  2Q2I A;  4JI5 L;  1HZ9 A;  1HHV A;  5M5Y B;  1K28 A;  2B8F A;  3HOX G;  1N8R C;  1IKM A;  1VMC A;  4P72 A;  4DAM A;  3OOC A;  1YNN D;  2VUM G;  1CZW A;  2UXB Q;  1PH7 A;  1L2F A;  1YJW A;  2OF1 A;  3IKJ A;  2JA8 B;  1K8O A;  4UPA A;  1MGS A;  2EE1 A;  2IY5 B;  4P74 A;  4XXE A;  1JJG A;  4RAU C;  3TS2 A;  1PLF A;  3T53 B;  4R8I A;  4RG1 A;  1JB7 A;  2R93 H;  2WIN B;  2BA1 A;  3DWP A;  2K5N A;  1K8G A;  3SVM A;  3P20 A;  1S5C D;  2JA6 B;  1NUC A;  3E3X A;  2R92 G;  2EOT A;  3GTM B;  1I4P A;  1QB5 D;  4RA8 A;  2B63 B;  3R8B A;  4QL5 A;  1IBL L;  1HNZ Q;  1EL0 A;  2NUC A;  1AZP A;  3HKZ B;  2BOS A;  1SRU A;  3TN2 A;  1HQM C;  1O7I A;  5M3M G;  4QUF A;  3D4D A;  1SEB D;  4EX5 A;  3SE0 A;  3SK8 A;  4DR6 Q;  2A68 D;  1KC8 C;  1FNU A;  2D9U A;  3G4S A;  1SBB B;  1M8A A;  2DJF C;  4C56 C;  4RGT A;  1PXU A;  2HCI A;  4X65 Q;  2EIF A;  4KMU C;  3M4O H;  1KL9 A;  1Z9F A;  4JI6 Q;  5J3B A;  5HGT A;  3PUY A;  3BDL A;  3S24 A;  4NKL A;  1VQE A;  1XTD A;  3CC7 A;  1BBX C;  2B2T A;  2NVY B;  3GTJ H;  2JJQ A;  1VF7 A;  1A6X A;  1Q3L A;  4JOI A;  5GRO A;  4IOA A;  2NN6 I;  1IKL A;  4LMQ D;  1T5X D;  4N9T A;  4JPB W;  1BCP C;  1JE4 A;  4IUT A;  3DXJ C;  5IYC G;  1FGB D;  1SN8 A;  1WTH A;  4HIK A;  1ASZ A;  4A3F H;  2GVA A;  4A3D B;  4JBK A;  5CBE E;  1HTL D;  2KJX A;  3SDZ A;  2M2L A;  2O4X A;  3PIP A;  3F2C A;  4DV6 Q;  1K83 H;  1EIY B;  3TBI B;  2VY3 A;  5A2Q E;  5K36 G;  4ZQ3 A;  4HIO A;  4POG A;  2MQH A;  2N3S A;  3K59 A;  2XIW A;  1YJ9 A;  5ISR A;  3H0G H;  4DV0 L;  3C46 A;  4HMI A;  4WJW A;  4DV5 Q;  1WTP A;  4CKE A;  1SFO B;  1TS2 A;  1HNW Q;  3PO2 B;  4KKT A;  4L5S A;  3I4M G;  4JI8 Q;  1PH3 A;  1HNX L;  4IUQ A;  1QVF A;  1M1K C;  3HOZ H;  1MBY A;  4MN3 A;  3W5O A;  3NTH A;  3CCQ A;  4JI5 Q;  1STG A;  4C3H H;  1EFI D;  2K01 A;  3E6Z X;  5BN3 A;  1UE5 A;  2GA4 B;  4X3S A;  4GLV B;  4K14 A;  1KNA A;  4EQ5 A;  4DK3 C;  4GLX A;  2ZXO A;  1SYB A;  3GV6 A;  2ASB A;  4KN4 C;  4HJ8 A;  2R7Z H;  3AFP A;  5F2D A;  3J7Y W;  1J6Q A;  5KRU A;  1I94 L;  1I6H B;  5C44 H;  3I4N B;  1WTO A;  1HFN A;  4R9W A;  3IFT A;  1A8V A;  2EYF A;  4FF4 A;  1ICF B;  4C2M H;  4A93 B;  1Y1W G;  1VQ8 A;  3PUX A;  3FKI B;  4GOP C;  4E6I A;  2R7D A;  5M3F B;  1PRT F;  1NCV A;  2KEC A;  1F9P A;  5C4Z A;  2L12 A;  1GOZ A;  4CJ1 B;  1EY8 A;  3M3Y B;  4DV4 L;  1WTV A;  1EU4 A;  4KD4 A;  2RKS A;  1E2W A;  2HQE A;  2R61 A;  2ZTC A;  4A3B H;  2ZJP A;  4KY6 A;  2EYP A;  4ZRZ A;  3QB3 A;  2SNM A;  1IHZ A;  4GKJ L;  3ND9 A;  1B1Z A;  4LWC A;  4PMB A;  5LL6 X;  5IT9 L;  4JI0 L;  3HOX H;  2BDO A;  2A74 C;  2K50 A;  1XMQ L;  2HCC A;  3H3V I;  4PQX A;  1EY9 A;  1H9R A;  2F0K A;  1OXU A;  2VUM H;  3NEL A;  3GTQ B;  2Z4H A;  5ELO A;  2JEA I;  5M5X B;  2JA8 G;  1W6K A;  1UAP A;  3M4Q A;  1SDF A;  4GN5 A;  2ZM6 Q;  2A6H C;  2RDF A;  2UUA L;  1VQ4 A;  2DUD A;  2R92 H;  4ZUJ A;  2EY6 A;  4TVA B;  1YHA A;  2JA6 G;  1VQ7 A;  1Q8I A;  2K7V A;  3AYH B;  3E0E A;  1ROD A;  2PZU A;  2Z6B A;  3NWT A;  5I2Y A;  4JG2 A;  2R3Z A;  3VDY A;  3HKZ G;  3HRZ C;  4Z9C B;  5CMD A;  5M3M H;  3QOL A;  1IYJ B;  5IOC A;  2EXZ A;  3DLL A;  1A2U A;  1YIJ A;  2QGQ A;  3CPW A;  4EGV A;  1JB3 A;  1VQB A;  1PRT D;  4A3E G;  1MJC A;  3EA6 A;  4IUP A;  3W3A A;  3PMF A;  3UDI A;  2WP8 J;  5JJK A;  1EZ8 A;  4A3L G;  4BXX G;  2MPM A;  1EZ6 A;  2B2U A;  4K6L A;  2L1B A;  1IBK Q;  1GUT A;  1STB A;  2HIX A;  3K58 A;  3U9O A;  3I73 A;  1R4Q B;  4OX9 Q;  2JA7 B;  4LF4 L;  2KBN A;  4C3I B;  1KHI A;  2FJ2 A;  1PZI D;  3MA2 B;  1K3B C;  3PUV A;  4BY1 B;  2KEN A;  3RN5 A;  1FD7 D;  4IUN A;  5IYC H;  3VR4 A;  1Q46 A;  3BJU A;  2AUK A;  2MJ8 A;  1QVC A;  4A3D G;  4XT1 B;  4C1N I;  2CVR A;  5K36 H;  3MC0 B;  4V19 0;  4DXF A;  2F0I A;  2ICE C;  4DR1 L;  1F2Z A;  3FEW X;  1KAW A;  2OQ0 A;  1PH5 A;  2QW7 A;  4GN3 B;  3GTL B;  3CQZ B;  5CYU A;  3I4M H;  1EY7 A;  3PO2 G;  2L15 A;  1S5E D;  1TWC B;  3I2Z A;  5C4J H;  4A75 A;  3J7A 5;  1KXL A;  4GKJ Q;  3Q23 A;  3G71 A;  1VQI A;  2WB1 B;  3Q22 A;  1V9P A;  1KTK A;  3URY A;  1PZJ D;  1JOR A;  3NTK A;  1EYD A;  3OSO A;  4BY7 G;  1SJH D;  1ENA A;  1XMQ Q;  5E7N A;  1DOK A;  1P8L A;  4TSS A;  4LF9 L;  1H95 A;  5H1S E;  4NB3 A;  3DUZ A;  2F03 A;  5KYL A;  1LTI D;  1JR0 D;  3A54 A;  4UP9 A;  4DFA A;  4DR5 Q;  2UUC L;  5JPN C;  4KN7 C;  1EY5 A;  3M4Y A;  2HDM A;  2ATW A;  4A3G B;  3MAQ A;  3H3V C;  4N9P A;  2UUA Q;  1Y1W H;  4A93 G;  1B70 B;  3HOV G;  2NTS A;  5M3F G;  2PMZ B;  4H7B A;  4ZAI A;  3GO5 A;  3MXP A;  5FO7 B;  2QDL A;  4A3M B;  1Q8K A;  1G8Z D;  3NK9 A;  3ZYY X;  4ZUI A;  4O1N A;  4JI2 L;  4CDE C;  1PDQ A;  1JIC A;  3S9W A;  2M00 A;  1LM0 A;  4YWK A;  4EQP A;  2VQF L;  3BZC A;  1A3U A;  2E2D C;  3GTK B;  1GUN A;  1U9R A;  2NN6 G;  3OYY A;  4QCL A;  3K5N A;  1ZYR C;  5CV8 A;  1L0Y B;  4YWL A;  1WCM B;  3GTG B;  5JEA G;  2JA8 H;  1XNR L;  5FK9 C;  2X6L A;  1KDC A;  4DR2 L;  4LF4 Q;  5DM7 3;  3J7A V;  4JBM A;  1C48 A;  4AIM A;  1CA5 A;  1S5B D;  2Q8R E;  5G3L F;  2JA6 H;  3HOU G;  2E76 C;  3K0Y A;  5C0X I;  3PGZ A;  2B3G A;  4GS3 A;  2AUJ D;  1IYU A;  3NBI A;  4LK1 C;  4G7H C;  3Q8D A;  1RCV D;  3DHQ A;  1PFB A;  2F3I A;  5HGQ A;  1Q90 A;  3K81 C;  4LF6 Q;  1QUQ A;  4K0K Q;  3DM3 A;  1IL2 A;  2YV5 A;  3AEV A;  1YNJ D;  1ZYR D;  1PH6 A;  1PV4 A;  1F9S A;  4JV5 L;  1DJR D;  4OXP A;  4YY3 Q;  3D6C A;  4YCU A;  4A3E H;  4ZK9 B;  1EOT A;  1JOO A;  3KF6 B;  2FMC A;  1STH A;  1L0X B;  5ELF A;  3V05 A;  1BNZ A;  1HRJ A;  2JA5 B;  1DXM A;  2NVT H;  1Q86 C;  2Z0S A;  3EN2 A;  1X3E A;  2D5D A;  4BXX H;  4QIW B;  2B2W C;  1OTC A;  5CV9 A;  3NEN A;  3CU7 A;  2EYJ A;  3JAM E;  2PQA A;  1T9H A;  2GN5 A;  2NVY H;  1YI2 A;  2EJF C; 
#chains in the Genus database with same CATH homology
 5C0X J;  4LF9 Q;  4JI7 Q;  3A74 A;  2WB1 E;  4DV5 L;  1WOC A;  1Q1B A;  4UP7 A;  4DR4 Q;  1BBW A;  1V43 A;  2A1A A;  3E9H A;  4LF5 L;  4A3B G;  4LFA Q;  4JI8 L;  4DV1 L;  1MIU A;  4JCV E;  2UUB L;  1D8L A;  1YHB A;  2RHQ B;  1VQC A;  1MJE A;  5EAY A;  3KLW A;  2N49 A;  3A0J A;  5IT9 c;  2HHH L;  4GLA C;  1TXY A;  2RHS B;  4JI3 L;  4A3D H;  2Q2I A;  4JI5 L;  1HZ9 A;  4X62 Q;  2YTV A;  3UDX A;  2C35 B;  2VZA A;  2PI2 A;  2R7F A;  1XPO A;  1N33 Q;  5JJI A;  4LFB L;  3HOX G;  3KF6 A;  3CCM A;  1N8R C;  4JI7 L;  3UE0 A;  4GNX B;  4DAM A;  4P72 A;  3UDG A;  1WFQ A;  4DR4 L;  1EFW A;  2VUM G;  2UXB Q;  1UE6 A;  1PH7 A;  3K80 C;  1LUZ A;  1L2F A;  4LFA L;  1YJW A;  3H15 A;  3I4N G;  4DUY Q;  4UPA A;  1IBL Q;  2IY5 B;  4A3I G;  2JEB I;  4P74 A;  4GOP A;  1JJG A;  4YHH Q;  3TS2 A;  4L5R C;  1L1O B;  3B6Y A;  2I5L X;  1VQH A;  4RG1 A;  1JB7 A;  4HJ5 A;  4X62 L;  1NMG A;  3CXC A;  1QVG A;  2BA1 A;  2E8G A;  3CCR A;  4JI2 Q;  3CCL A;  4B3T L;  3S1N H;  2K5N A;  1K8G A;  1VQP A;  3FKI G;  1N33 L;  4BBS H;  1SMX A;  2R92 G;  1YVC A;  3KDF A;  4MZ9 A;  2WB1 G;  4LW1 A;  2UXB L;  4KI0 A;  2KCM A;  4X64 Q;  4QL5 A;  1WI5 A;  3PUZ A;  4DUY L;  4NXN Q;  1IBL L;  4BY7 H;  1I3Q H;  1HNZ Q;  2E2H H;  3EBE A;  1K73 C;  4YHH L;  2ZTE A;  1YBY A;  3S15 H;  4RMF A;  3GTO H;  1SRU A;  2VS1 A;  3BU2 A;  1O7I A;  5M3M G;  1YHQ A;  5FJ8 G;  1HH2 P;  1R9T H;  1OXV A;  1UE1 A;  4EX5 A;  1JE5 A;  2MO0 A;  4GNX C;  1ASY A;  1AH9 A;  4B3R L;  4DR6 Q;  5HY6 A;  1KC8 C;  5IP9 H;  1W2B A;  2AMC B;  3G4S A;  1I6H H;  4GNX A;  2LSS A;  3PCO B;  3KJO A;  4X64 L;  5M5Y H;  1AE3 A;  4NXN L;  4A3G G;  1HNZ L;  3J80 c;  2ID0 A;  3HOW G;  1XNQ L;  3TRE A;  4LUV A;  4A93 H;  1YIT A;  1VQL A;  1PYS B;  4X65 Q;  2EIF A;  3RZD H;  1M90 C;  2K75 A;  3WWV A;  3M4O H;  3HOV H;  3M85 A;  3D0F A;  1PVO A;  5M3F H;  1KL9 A;  1L1O A;  1Z9F A;  4JI6 Q;  2N78 A;  2E5L L;  4DV3 Q;  2K52 A;  5J3B A;  1IBM L;  4B3S Q;  3E9I A;  3PUY A;  3S24 A;  3U4V A;  1VQE A;  3RLN A;  1XTD A;  1VCI A;  3CCJ A;  4GN4 B;  3CC7 A;  2GVB A;  2Q2U A;  4JOI C;  5M5W H;  5IYB G;  3GTJ H;  2JJQ A;  4DUZ L;  3U58 A;  3J80 i;  5IYD G;  1FJG Q;  2BH2 A;  1EOV A;  1VQK A;  3CCE A;  4IPC A;  4JOI A;  4P73 A;  5GRO A;  3RZO H;  2IHF A;  3GTM H;  5IE8 A;  4R4I A;  3AQQ A;  4IOA A;  2NN6 I;  4A3K G;  1K8A C;  2B63 H;  2F4V Q;  2E2I H;  4JI6 L;  5IWA L;  4B3M Q;  2EXD A;  3ER0 A;  4DV3 L;  3J81 j;  1K3R A;  5IYC G;  4DV0 Q;  1FGU A;  1SN8 A;  2IHE A;  4HIK A;  1Q7Y C;  1ASZ A;  4HIM A;  4A3F H;  3M7N A;  2GVA A;  5GAH C;  4JC0 A;  2WFW A;  4JBK A;  1VQD A;  1MKH A;  3I55 A;  1UWV A;  3AFQ A;  3PIP A;  1B7Y B;  3F2C A;  1K83 H;  4DV6 Q;  2Z6K C;  1EIY B;  5K36 G;  1WCM G;  2VY3 A;  3K8A A;  1HNX Q;  1N32 Q;  4HIO A;  1N34 Q;  2JA9 A;  2MQH A;  2N3S A;  2RCN A;  1TWA H;  2HQL A;  2RF4 A;  4XTC S;  2Z6K A;  3U50 C;  4H02 A;  4OON A;  5M5X H;  4NXM L;  3J7Z C;  2F4V L;  5FLX c;  2R6G A;  4IPH A;  3RN2 A;  3A5U A;  1YJ9 A;  2AWN A;  3S1M H;  1HZC A;  2KHJ A;  3H0G H;  3CF5 A;  4LF8 L;  4DV0 L;  4OO1 I;  5C4X H;  2HT1 A;  4DR3 Q;  2YTY A;  4IJH A;  4DV5 Q;  5GAE C;  1HNW Q;  3ULL A;  4R1J A;  4LF5 Q;  4A3L H;  4L5S A;  3HOU H;  3I4M G;  4JI8 Q;  1A0I A;  1IZ6 A;  1NTG A;  1PH3 A;  4NPS A;  1HNX L;  2A8V A;  1NJI C;  1QVF A;  3HOY H;  1I94 Q;  2OTJ A;  3KDF B;  3KYH C;  1M1K C;  3HOZ H;  4LFC Q;  4JI3 Q;  3W5O A;  3CCQ A;  4JI5 Q;  1N9W A;  3OW2 A;  2OTL A;  1S72 A;  4X66 L;  4C3H H;  1UE5 A;  4LFB Q;  4GLV B;  4GLX A;  4EQ5 A;  2JA7 G;  4DK3 C;  1CUK A;  4TQU S;  1NY4 A;  1IXR A;  4DR3 L;  3S1R H;  4A4I A;  1Z47 A;  3PO3 G;  1HNW L;  3HFZ B;  2ASB A;  2D62 A;  4BY1 G;  3SGI A;  1SLJ A;  4IFD G;  1PA6 A;  3UE1 A;  4HJ8 A;  4AYB E;  3IRB A;  4HJ7 A;  2R7Z H;  3AFP A;  5LMU L;  3CCV A;  1BVS A;  1J6Q A;  5JEA J;  1I94 L;  4PG3 A;  2IX0 A;  4PZ7 A;  1A63 A;  5C44 H;  4LFC L;  4LF7 Q;  1G6P A;  4DV4 Q;  3CPF A;  1JT8 A;  4DPG A;  2JQO A;  4OWX B;  2JA5 G;  5IP7 G;  1JMC A;  1A8V A;  3PF5 A;  1G51 A;  4C2M H;  3T1Y L;  1Q81 C;  4APV A;  4J15 A;  1Y1W G;  1VQ8 A;  3PUX A;  4GOP C;  2R7D A;  5DLQ E;  3PIO A;  1CKM A;  1UE7 A;  1XMO Q;  1D7Q A;  3ULP A;  2UXC Q;  1S3O A;  3T1H Q;  5IY0 A;  4A76 A;  1SFO H;  4LF7 L;  3S14 H;  4DV4 L;  3PO2 H;  1U0L A;  4JI0 Q;  4IO9 A;  2PMZ E;  1NBW A;  5BR8 L;  2N8N A;  3ERS X;  3GTP H;  1FL0 A;  4B3R Q;  2ZTC A;  4JI1 Q;  2ZJP A;  4A3B H;  4GKK Q;  3GD7 A;  2Y0S E;  1K9M C;  5LMN L;  5GAG C;  4DAY B;  1PH8 A;  4GKJ L;  2VNU D;  3HKZ E;  4O2D A;  1Y1V G;  2QA4 A;  1XMO L;  1PH9 A;  1X54 A;  4AYB G;  3JAM c;  3T1H L;  1XNQ Q;  2UXC L;  1WJJ A;  4LWC A;  1EIF A;  4JI0 L;  3HOX H;  1VQN A;  4BBR G;  2K50 A;  1XMQ L;  1LTL A;  4YCV A;  3KOJ A;  2Q2T A;  4JI4 L;  3S16 H;  3H3V I;  4A3C H;  2E5L Q;  1OXU A;  2Q2H A;  1IBM Q;  2VUM H;  2AWO A;  3GDE A;  3NEL A;  4JI1 L;  1EYG A;  1VQJ A;  5ELO A;  2JEA I;  1CSQ A;  3I4N H;  3CCS A;  5FLM G;  3CD6 A;  4GKK L;  2JA8 G;  4A3I H;  2ES2 A;  1OXX K;  4FDB A;  3NBH B;  3H3V H;  3M4Q A;  1PH4 A;  4R4Q A;  4DUZ Q;  1KD1 C;  4DR7 Q;  3GTL H;  1L1O C;  3JAM i;  4DKA C;  3KF8 B;  4GN5 A;  2ZM6 Q;  5C3E G;  1UEB A;  3FKI H;  3M9B A;  3CMA A;  1SR3 A;  3TS0 A;  4R4T A;  4HID A;  1VQ4 A;  3PV0 A;  2DUD A;  2UUA L;  2R92 H;  2JA6 G;  1N36 L;  4TVA B;  1YHA A;  5IWA Q;  2PNH A;  1XPU A;  4A3J G;  1RIP A;  1VQ7 A;  4QQB X;  3U4Z A;  2MO1 A;  3AYH B;  3G6E A;  3E0E A;  3M3Y H;  2R93 H;  3NEM A;  1PYB A;  4IPD A;  1QZH A;  1GM5 A;  2Y0S G;  2I0Q A;  4POG A;  2KHI A;  4A3M G;  3ICE A;  4JG2 A;  4DR7 L;  2ALY B;  5C0X G;  3VDY A;  3HKZ G;  1J5E Q;  4A3F G;  2IX1 A;  5M3M H;  5FJ8 H;  1JJC B;  1YNX A;  2ZM6 L;  1IYJ B;  4OWW B;  3DLL A;  4B3T Q;  4NXM Q;  4YCW A;  4O0A A;  3RNU A;  2WAQ E;  2IT1 A;  1YIJ A;  2QGQ A;  3CPW A;  4LF8 Q;  1VQB A;  4A3E G;  1YZ6 A;  2EQS A;  3MXN B;  1GD7 A;  4QJF A;  4A3G H;  4POF A;  2UU9 L;  1MJC A;  1XPR A;  1AE2 A;  2DGY A;  3HOW H;  4DV2 Q;  1TWH H;  2I5M X;  3UDI A;  1J5E L;  2WP8 J;  1C7Y A;  5JJK A;  1BBU A;  1NMF A;  1X3G A;  2PI2 E;  2ZTD A;  4PZ6 A;  3CME A;  3CCU A;  2XGT A;  1U5K A;  3GTQ H;  2HIV A;  1B8A A;  4IOC A;  4A3L G;  4BXX G;  1I5F A;  2K4K A;  2F52 A;  4X66 Q;  4DV7 L;  2XTI A;  4ME3 A;  1E3P A;  1IBK Q;  2NVX H;  2HIX A;  5IYB H;  4QIW E;  2VW9 A;  1Q82 C;  4OX9 Q;  5IYD H;  4DV2 L;  4LF4 L;  2KBN A;  2K5V A;  4KHZ A;  1KHI A;  5AJ3 L;  5GQO A;  4A3K H;  4DR1 Q;  1EUJ A;  4QGU A;  5LMU Q;  3PUV A;  2KEN A;  3RN5 A;  3A5Z B;  3TEH B;  3W1B A;  5LMN W;  5IYC H;  2CCZ A;  3ULJ A;  2ZJQ A;  1Q46 A;  3TRZ A;  3GTK H;  2OQK A;  1HZA A;  4ALP A;  1JJ2 A;  2WAQ G;  3BJU A;  1IBK L;  3CC2 A;  2OWO A;  4Y52 H;  1QVC A;  2D0O A;  3T1Y Q;  1YEZ A;  4A3D G;  4OX9 L;  1G29 1;  3GTG H;  3I4O A;  1OXT A;  4DR1 L;  1A62 A;  3F2D A;  2UXD Q;  1KAW A;  2OQ0 A;  2FXQ A;  2K14 A;  3F2B A;  1PH5 A;  1HR0 L;  5BR8 Q;  4GN3 B;  1NE3 A;  3J81 c;  3I4M H;  3PO2 G;  2L15 A;  1C0A A;  4AQY Q;  2R93 G;  1KRS A;  3I2Z A;  5C4J H;  4A75 A;  1I50 H;  5LMN Q;  3J7A 5;  4GKJ Q;  1KXL A;  4BBS G;  4HJA A;  3G71 A;  2UUC Q;  1VQI A;  2E2J H;  3S2D H;  1V9P A;  1E1T A;  1PH1 A;  2UXD L;  1S40 A;  2LXJ A;  1LYL A;  4LUZ A;  4IFD I;  3M4P A;  2JA7 H;  4BY7 G;  3LGJ A;  4C3I H;  1XMQ Q;  4JYA Q;  1XJV A;  4JI4 Q;  3PO3 H;  3PUW A;  5E7N A;  3J81 i;  1P8L A;  4BY1 H;  1H95 A;  4AQY L;  4LF9 L;  1OXS C;  1X65 A;  4NB3 A;  5H1S E;  4A3C G;  4UP9 A;  1SE8 A;  3PSI A;  4KLK A;  4BA1 I;  4DR5 Q;  2UUC L;  2MFI A;  2OCE A;  4JBW A;  3TQY A;  5IP9 G;  2CWP A;  1X9N A;  2ATW A;  2JA5 H;  5IP7 H;  1L0W A;  2UUA Q;  4Y7N H;  4JYA L;  1N36 Q;  1Y1W H;  4A93 G;  1B70 B;  2CFM A;  1RL2 A;  3G48 A;  4R4C A;  2VQF Q;  1EQQ A;  5M3F G;  2LXK A;  3W1G A;  3HOV G;  1CSP A;  4UP8 A;  2BH8 A;  4DR5 L;  1X6O A;  3GO5 A;  3ZJY C;  3KFU A;  2I5H A;  2ZJR A;  3K7U C;  1PH2 A;  4QY7 A;  3CQZ H;  3S1Q H;  3D31 A;  3KJP A;  4IPG A;  4KHP Q;  1Q8K A;  1WYD A;  1TWC H;  3HKS A;  4PZ8 A;  2D0P A;  3BZK A;  4LUO A;  2B29 A;  1KRT A;  4OWT B;  1PFS A;  1X56 A;  4DNI A;  1DGS A;  1TWG H;  3FP9 A;  2VQE Q;  1VQA A;  1EWI A;  4JI2 L;  2CQO A;  3OTO Q;  1VQ6 A;  5JJL A;  1LM0 A;  4YWK A;  2VQF L;  4IFD J;  2B63 G;  1XNR Q;  1Y1V H;  2UU9 Q;  1Q1E A;  3BZC A;  1VQM A;  1QUQ B;  4JBJ A;  3CW2 C;  2QEX A;  4DR2 Q;  3I56 A;  2CWA A;  1FVI A;  2NN6 G;  3OYY A;  1Y14 B;  4KHP L;  2AHO B;  2VL6 A;  3S17 H;  2H5X A;  3F8T A;  4BBR H;  1SRO A;  2YTX A;  1CKN B;  4UY8 C;  2A19 A;  2MNA A;  4YWL A;  5GAD C;  1CKO A;  3STB C;  4AH6 A;  2VQE L;  4DV7 Q;  4XIG S;  1VS0 A;  5JEA G;  5FLM H;  3K7A H;  3L0O A;  4L5T A;  3OTO L;  1VQ9 A;  2JA8 H;  1XNR L;  3PF4 A;  2KCT A;  4DR6 L;  4R4O A;  2BA0 A;  3H0G G;  3K0X A;  4DR2 L;  1HR0 W;  4LF4 Q;  4L5Q A;  5C4X G;  1GO3 E;  4JBM A;  4P71 A;  1V1Q A;  5AJ3 Q;  1PHJ A;  4WJ3 M;  5C3E H;  4AIM A;  4DK6 C;  2NZO A;  3S2H H;  2K5H A;  3EIV A;  2JA6 H;  3HOU G;  4JV5 Q;  2PQA B;  1BKB A;  3RLO A;  4A3J H;  4X65 L;  5C0X I;  3PGZ A;  4OO1 G;  4YWM A;  1VQG A;  1E7Z A;  2B3G A;  2JE6 I;  4GS3 A;  1W3S A;  4IJL A;  4HJ9 A;  1YJN A;  3Q8D A;  4LNQ A;  3HOY G;  2JK8 A;  3FHW A;  3HOZ G;  1KIX A;  4B3S L;  4A3M H;  2F3I A;  5HGQ A;  2CKZ B;  3K81 C;  4LF6 Q;  4BA2 I;  1E24 A;  2V1C C;  1VQO A;  1QUQ A;  4K0K Q;  3DM3 A;  1FJG L;  2YV5 A;  1IL2 A;  1P16 A;  3AEV A;  1TWF H;  1PH6 A;  1PV4 A;  1QZG A;  4JV5 L;  3CAM A;  4OXP A;  3STB D;  4YCU A;  4YY3 Q;  4A3E H;  1CKN A;  2R7Z G;  4PMW A;  1KQS A;  1GVP A;  4MTN A;  1HR0 Q;  3KF6 B;  3UDF A;  4B3M L;  5C44 G;  2YU9 H;  1E22 A;  3CP0 A;  3RLF A;  3I7F A;  4C3J H;  1K0R A;  4LF6 L;  2NZH A;  3JC6 6;  2NVQ H;  4WJ4 A;  1C9O A;  1HJP A;  1WCM H;  1Q86 C;  2NVT H;  3L7Z C;  2Z0S A;  1HZB A;  1X3F A;  3EN2 A;  1X3E A;  4MNO A;  4BXX H;  5ELN A;  4K0K L;  2AKW B;  4GOP B;  4DV1 Q;  3RR5 A;  4DV6 L;  3L2P A;  1Q12 A;  4P75 A;  1OTC A;  2UUB Q;  1VQ5 A;  3CC4 A;  1N32 L;  4YY3 L;  3NEN A;  1N34 L;  2HHH Q;  1GKH A;  3F1Z A;  2YYZ A;  2PQA A;  1EQR A;  1X55 A;  1T9H A;  3MEF A;  1E1O A;  2GN5 A;  2NVY H;  4X6A H;  1YI2 A;  1VQF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...