4KHPQ

Structure of the thermus thermophilus 30s ribosomal subunit in complex with de-6-msa-pactamycin
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
99
structure length
99
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S Ribosomal RNA
publication title Crystal Structure of a Bioactive Pactamycin Analog Bound to the 30S Ribosomal Subunit.
pubmed doi rcsb
total genus 22
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4khpQ00
3M7NA 4GKJL 2IX1A 4DK6C 1XNRQ 1N33L 1E1TA 4DAYB 4NXML 1P16A 3A5ZB 1VCIA 2EQSA 4O2DA 1B8AA 1S40A 4JBMA 1N32L 3CC4A 1NTGA 3GD7A 5FLXc 4L5SA 2R7ZG 5C4JH 3JC66 5IE8A 3MEFA 4UP7A 4NXNL 4A3CH 1OXTA 4DR4Q 4LF4Q 1FJGQ 2NN6G 1VQEA 4LW1A 1FGUA 3PO3H 2HIVA 5M5WH 4OO1G 5IP7H 4EX5A 1LUZA 4GLXA 1PA6A 2UUBL 1KC8C 1IYJB 1XMOQ 1NBWA 2F3IA 2VW9A 4LNQA 3ULPA 3G4SA 3HFZB 4DV3L 3PF5A 2N3SA 3I4OA 4QGUA 1TXYA 2CWAA 2FXQA 5AJ3L 2B63H 4LFAL 1Q46A 4B3SQ 2WAQG 4YCUA 3KF6B 4IPCA 4WJ3M 1GD7A 4DV0Q 1UE1A 1X3FA 1PH7A 3U4VA 3H0GG 4BBRH 2XGTA 4RMFA 1OXUA 4JI5L 3PV0A 4GN5A 4A3FH 2JA8G 4MNOA 3GTOH 2AKWB 3CCLA 4JYAL 1A8VA 3D31A 1BKBA 5GQOA 4DK3C 4JV5Q 3E9IA 2UXCQ 3HOWG 3RLNA 4IOAA 2I5MX 2UUAL 4K0KL 3K0XA 4HIDA 4C2MH 5FJ8H 3M85A 4LF9Q 3I7FA 5LMUL 4GNXA 5C4XG 2JA9A 2E2HH 1PH3A 2KBNA 1V43A 2HIXA 5M5YH 4NPSA 3CCJA 4BXXG 3Q8DA 4DV1L 3PO3G 1J6QA 4GOPA 1WFQA 3G48A 1HNXQ 1OXSC 4QJFA 2NVQH 4P71A 4OWWB 2JQOA 1NMGA 3K80C 2ASBA 2PMZE 4BBSH 4B3MQ 4A75A 4JI2Q 1K0RA 2Y0SG 1B7YB 3UDGA 3CMEA 1X65A 3KLWA 1WYDA 2KCMA 2N8NA 4DR4L 1PH6A 1QVGA 1FJGL 2R7FA 4IPHA 3I4NH 3PO2H 3CCEA 3HOVH 1G291 3JAMi 4RG1A 3HOYH 3TQYA 3S1NH 2YYZA 3J81c 4GN3B 4DR3Q 3W1GA 1B70B 1U5KA 1L2FA 1I50H 1KXLA 1XMOL 3KDFA 1YVCA 2WB1G 3PUZA 4HJAA 1KL9A 2ZTCA 3PIOA 3FKIH 1YIJA 1HZBA 1IL2A 1IZ6A 4IOCA 5K36G 2UU9Q 1JT8A 4YWLA 3A74A 2QEXA 5FJ8G 5IP9H 1EOVA 4A3GH 1CKNB 5M5XH 1VQJA 3OW2A 3LGJA 5IYBG 4A3IG 3EIVA 3RN5A 4B3SL 4JOIA 4BY1H 3BZCA 2R92H 1QVCA 4YY3Q 1VQNA 4QY7A 4DV0L 3T1HQ 2LSSA 2PNHA 4DV6Q 4A3LH 3TS0A 5LMNQ 3HKSA 4R1JA 1AE3A 1EQRA 3KOJA 5IYDG 5C3EG 1K9MC 3J7A5 2WFWA 4DV4L 4BBSG 1SRUA 4JV5L 1YJNA 4ALPA 1KHIA 3HOZH 1XNQQ 2ZM6Q 1Y1VH 4IFDJ 3I4MG 3CC2A 1C9OA 3HKZE 1ASYA 2JA6G 4BY7H 4OX9Q 1HNZL 1X56A 4DPGA 1IBMQ 1SMXA 4LUVA 5E7NA 1MJEA 2MNAA 5C0XJ 4LWCA 2EXDA 4A3EG 3CXCA 1PHJA 1JMCA 3K81C 5IWAQ 5JEAG 2JJQA 3CMAA 2IHFA 2PQAA 1HNWQ 4R4QA 4LUZA 4A3JH 1X3GA 1VQGA 4B3ML 4GLVB 3CQZH 3J81j 4JI2L 1LM0A 1YHBA 2OQ0A 3S16H 2V1CC 3K8AA 4DR6Q 1SE8A 4P74A 1VS0A 2JE6I 5M3MH 3OTOQ 1SFOH 1ASZA 1VQ8A 2VUMG 3M4QA 3S1RH 1MKHA 5HGQA 3UDXA 3L7ZC 4GNXB 4NB3A 4LF8Q 1I3QH 5M3FG 4B3TQ 3RZDH 2F4VQ 1EQQA 1LYLA 3GTLH 3AQQA 1Y1WG 2I0QA 4A3BH 1A62A 2CFMA 2MQHA 5GROA 4GOPB 1PH4A 1Q12A 1TWCH 5FLMG 1DGSA 2R93G 1H95A 1L1OC 1VQBA 4KHZA 4LFCQ 5ELNA 4DUZQ 3T1HL 4IFDG 3CW2C 5LMNL 4X6AH 5C44G 4C3HH 1VQ6A 2NVXH 4BA1I 5IYCG 2D62A 4QL5A 4R4OA 4TQUS 2RF4A 5IT9c 1YITA 5DLQE 4POFA 3AFQA 2VQFQ 1XPOA 4L5QA 1KD1C 1T9HA 5C0XG 2ZM6L 1EIYB 2R6GA 4OWTB 2E2IH 1XNQL 2OQKA 4JI8Q 3RR5A 4DR2Q 3FP9A 1PFSA 4YHHQ 3I2ZA 4OX9L 3RLFA 4JI7Q 1HZAA 1Z9FA 3KDFB 3J80i 2N78A 2CWPA 2WAQE 3T1YQ 4JBWA 2F52A 1CSPA 1S3OA 1U0LA 2B3GA 2VY3A 2JA5G 4OONA 2Q2HA 2JA7H 3HOXH 1KQSA 1G51A 1JB7A 2UXDQ 1N9WA 2NVTH 3UDFA 2QA4A 2AMCB 4LUOA 1A63A 1YEZA 4A3KG 1IXRA 4JI0Q 3NENA 2DGYA 3ERSX 4XTCS 2ZJRA 1YNXA 2ZTDA 3K7UC 5HY6A 2KENA 2LXKA 1OXXK 1X54A 3S2HH 4MZ9A 4B3RQ 4HJ7A 5JJLA 4IO9A 2GVAA 1N36Q 4DR6L 3OTOL 4JC0A 4A3CG 1I5FA 1CSQA 4XIGS 4JCVE 3U58A 1QZHA 1UEBA 3W1BA 1JE5A 1WJJA 2B29A 2VZAA 1X9NA 3DM3A 4A3DH 1K8GA 4LF5L 2UUCQ 2R7DA 1I6HH 4X62Q 4LF8L 4A93H 4DV2L 5IP7G 4B3TL 2F4VL 4GKKQ 2A8VA 1XNRL 3UE1A 2BA1A 3W5OA 3ULJA 4A3KH 1XJVA 2BH8A 4IPGA 3U4ZA 1PH9A 3AFPA 4KI0A 2OTJA 1L0WA 1IBLQ 2B63G 2GN5A 2PQAB 2CQOA 5JEAJ 2IX0A 4HJ8A 2ID0A 4PZ6A 4A76A 4DUZL 1K73C 4LF4L 2Z0SA 3GTGH 1YI2A 2ZTEA 1Q7YC 1PH5A 4JBKA 3CPFA 4YCWA 1XMQQ 1N34Q 4Y52H 3G6EA 4BBRG 3G71A 1HJPA 4DR7Q 4A3FG 3BU2A 5BR8Q 2VQFL 3RLOA 3RZOH 1X3EA 3ER0A 3CPWA 4AQYQ 4JI8L 1Q81C 4OXPA 1UE7A 1SR3A 2RCNA 4YHHL 4HIKA 3HOUH 1S72A 4JI7L 3CCUA 2OCEA 4ME3A 2DUDA 4P75A 3T1YL 4LFBQ 2VQEQ 4L5RC 3F2DA 1VQCA 4A93G 1D7QA 1VQMA 1K8AC 4JG2A 2UXBQ 5EAYA 4YWKA 3EBEA 4JI0L 2IT1A 3AYHB 4DNIA 4DUYQ 1HR0W 4APVA 3GTPH 1SLJA 4IJLA 1G6PA 2UXCL 4JI4Q 2IY5B 1EWIA 2NN6I 1YHAA 1CKOA 4KHPQ 1TWFH 1IBKQ 1AE2A 4OO1I 2K5HA 2OTLA 4LF9L 1N33Q 4QIWE 4A3MH 1PYBA 2YTYA 4AYBE 4GS3A 3I4NG 3PO2G 5C0XI 3HOVG 4JI1Q 1SN8A 5GAHC 3HOYG 1VQ5A 1NJIC 4X62L 1Y14B 4PG3A 1Z47A 5GAEC 1HNXL 1XPUA 2YTVA 3F2CA 4P73A 4HJ9A 3S14H 2VL6A 3FKIG 1AH9A 2I5LX 5GADC 5IP9G 1VQHA 4A3GG 1PH1A 1IBLL 3TRZA 4YWMA 4IJHA 3WWVA 1YHQA 3H3VI 3UE0A 4BY1G 4JI6Q 2R92G 4J15A 2K52A 1RL2A 2HQLA 2D0PA 3HKZG 4A3LG 1XMQL 4DR3L 4PZ7A 2R7ZH 2K5NA 1J5EQ 2PI2E 4BA2I 3CCRA 1VQ7A 1BBWA 4LF7Q 1MIUA 4P72A 1E24A 1XPRA 3I56A 3HOZG 4AQYL 1PV4A 2E5LQ 1Y1VG 2UU9L 3GO5A 4UY8C 3J80c 3BJUA 2HHHQ 4LF6Q 4BY7G 2AHOB 4X65Q 1FL0A 2AWNA 2H5XA 2VQEL 2UUAQ 4K0KQ 4YY3L 3BZKA 3STBD 1W3SA 4DV6L 1OTCA 2IHEA 3VDYA 2K4KA 4JI3Q 1QVFA 1Q1EA 1EIFA 4A3JG 4DV1Q 1PVOA 3KF8B 4HIOA 1WI5A 4X66Q 5JJIA 4KHPL 3F2BA 1IBKL 3H0GH 2JA8H 3M3YH 1KRTA 3H3VH 3S17H 1L1OA 1UE6A 4HIMA 1JJ2A 3GTKH 4KLKA 1PYSB 5M3MG 3GTMH 1JJCB 4PMWA 3B6YA 4JI1L 4OWXB 1IBML 1VQLA 3HOWH 2K75A 3PUXA 5C4XH 1VQDA 2N49A 2NZOA 5IWAL 1C0AA 2Q2IA 3CC7A 2YV5A 1UWVA 1HNWL 4DR1Q 4YCVA 4GLAC 5J3BA 4BXXH 4A3BG 1KAWA 3CCVA 3CP0A 2YU9H 3S1MH 3D0FA 2L15A 4Y7NH 1O7IA 1HH2P 1M90C 2KHIA 4JI6L 4IPDA 1V1QA 3PSIA 3JAMc 4POGA 4O0AA 1CKMA 5H1SE 2VNUD 1QUQA 1J5EL 1A0IA 4GNXC 1MJCA 1V9PA 3RNUA 4R4CA 3KYHC 1VQIA 4R4TA 1WCMH 3L2PA 4LF7L 1JJGA 3EN2A 3CCSA 2GVBA 2Q2TA 3K7AH 1SROA 2E5LL 2MO0A 2OWOA 1Q82C 4GOPC 4UPAA 4TVAB 2Y0SE 3MXNB 1X55A 2MFIA 3J7ZC 4HJ5A 2HHHL 4LF6L 4WJ4A 4X65L 4UP8A 4X64Q 4DV4Q 2ALYB 3DLLA 2NZHA 2YTXA 1PH2A 3GDEA 4AH6A 1KIXA 3S2DH 4LFCL 1X6OA 2K5VA 4DV7Q 2JA7G 1BBUA 3HOXG 3CF5A 2LXJA 4DV5Q 1OXVA 1HR0Q 3E9HA 2MO1A 3A5UA 1HNZQ 4JI3L 5IYBH 4A3IH 1E7ZA 2E2JH 2WB1E 3SGIA 2K50A 3U50C 3ICEA 1GM5A 1XTDA 4X66L 3E0EA 4FDBA 1P8LA 2I5HA 1I94Q 3M9BA 4DR2L 2ES2A 5IYDH 5C3EH 1QZGA 2E8GA 1VQAA 4DR5Q 1VQ4A 3M4OH 1NMFA 3NEMA 2A19A 3TREA 3GTJH 2CCZA 3I4MH 1LTLA 2PI2A 1E1OA 1PH8A 4A3DG 4UP9A 2JA6H 3F1ZA 3A0JA 1VQ9A 2UXDL 1WCMG 1TWGH 1EFWA 3KJOA 2HT1A 3KFUA 1FVIA 3TEHB 3PUWA 4DAMA 4DR1L 4JOIC 2A1AA 3S15H 4JBJA 4A3EH 4DKAC 4IFDI 1VQFA 5JJKA 3PUYA 4B3RL 1N8RC 1RIPA 1D8LA 3NBHB 4GKJQ 2EIFA 4C3JH 1N36L 3CD6A 1R9TH 4NXMQ 3S24A 3KF6A 1C7YA 1N32Q 3PF4A 5GAGC 2JEBI 4PZ8A 2UUCL 2BA0A 1L1OB 3M4PA 4NXNQ 4C3IH 2JEAI 4GKKL 1E3PA 2WP8J 3TS2A 2RHSB 2KHJA 1Q8KA 2VUMH 3S1QH 1K3RA 3CAMA 2XTIA 1E22A 2BH2A 1EYGA 1M1KC 3PIPA 2RHQB 3HOUG 3J81i 2JK8A 3PCOB 3CCMA 5M3FH 1YJWA 2Q2UA 4X64L 2UUBQ 2AWOA 2C35B 4QQBX 1HZCA 1GO3E 1VQKA 4DV7L 1Y1WH 3ZJYC 1YBYA 2NVYH 4MTNA 2ZJPA 4DV5L 1HR0L 1GVPA 3GTQH 4DV3Q 5FLMH 2R93H 1CUKA 5AJ3Q 1N34L 2CKZB 1NY4A 4LFAQ 2ATWA 3KJPA 4DR7L 3UDIA 1YZ6A 4AIMA 4AYBG 5BR8L 1Q86C 2D0OA 3F8TA 1NE3A 3NELA 1YJ9A 5C44H 1I94L 1BVSA 4EQ5A 5ELOA 1QUQB 5IYCH 3RN2A 1GKHA 4DR5L 4JI5Q 2K14A 1UE5A 2Z6KC 5LMNW 4A3MG 4JYAQ 3CCQA 5IY0A 3H15A 2KCTA 2QGQA 4LFBL 1TWHH 1K83H 3IRBA 3L0OA 4R4IA 2ZJQA 1HZ9A 3PGZA 3OYYA 4A4IA 5LMUQ 2UXBL 3ULLA 4GN4B 4L5TA 1W2BA 1VQOA 4DUYL 2JA5H 1VQPA 2VS1A 1KRSA 3STBC 4H02A 3I55A 4LF5Q 1WOCA 1Q1BA 1TWAH 1CKNA 3PUVA 4DV2Q 4JI4L 2Z6KA 3AEVA 3FHWA 1EUJA
chains in the Genus database with same CATH superfamily
1X32A 3I70A 4GKJL 4KMUC 1I4QA 1N33L 2F0OA 1P16A 1ENFA 1N32L 2FMCA 3EROA 5IE8A 4UP7A 1LT4D 4DXFA 4A3CH 1OXTA 1V1PA 4DR4Q 5EGTA 3DWPA 4OO1G 1B9NA 3X3NA 2UUBL 1KC8C 4RGNA 1QCBD 3KUPA 4G7HC 2KA7A 4FO2A 4KTAA 3PF5A 1LABA 3I4OA 1G2TA 1CT1D 2CWAA 2B63H 3TP7A 5CBEE 3OWFA 1Q46A 4JPBW 3MAQA 4MHEA 1HPCA 1GD7A 1D5XC 1X3FA 1TS2A 3JAME 3H0GG 4OHJA 2JA8G 1OXUA 4JI5L 5EPKA 4MNOA 1EY7A 3D31A 2UXCQ 1E2WA 4IOAA 2I5MX 3T13A 2UUAL 4K0KL 2EYOA 2QW7A 4GNXA 5C4XG 1A3VA 2E2HH 2PPBC 4HCEA 4CBVA 2DJGC 1PRTC 1UEAB 5M5YH 3PO3G 1JWMD 1J6QA 1WFQA 1STNA 4J1MA 2Z8LA 3KLSA 1NMGA 4A75A 4JI2Q 1ICFB 3T51B 2MP1A 3V05A 3PO2H 2P5ZX 4F87A 3W1GA 2BE5C 1U5KA 1KXLA 2WB1G 1WTXA 1CA6A 1KL9A 2ZTCA 4ZUIA 2Y0SB 2UU9Q 3A74A 5FJ8G 5IP9H 4G57A 2QILA 1SMYD 2F0EA 2O4XA 4YY3Q 4QY7A 4DV0L 4DV6Q 5LMNQ 4R1JA 1EQRA 3KOJA 1RHPA 2JXMB 5IYDG 3MFGA 1PTOC 2EZVA 4JV5L 4ALPA 3HOZH 4HN7A 5EQ0A 1MHWC 4OGQC 1XNQQ 4IFDJ 1X3QA 1KLGD 5E7NA 5C0XJ 4QUCA 4IUUA 1KLUD 5FKAC 3K81C 2A69D 5IWAQ 1LO5D 2NWGA 5JEAG 1WD1A 3T4AC 2JA6B 1O80A 1B50A 3CQZH 2PNRC 4F7XA 2EY2A 3PMFA 2V1CC 4K6LA 2AQ3B 2NYZD 4X3KA 4RKBA 3SK4A 1VS0A 5G3LF 1SFOH 1T5EA 5ELEA 1VQ8A 3S1RH 1MKHA 1II3A 4LF8Q 1I3QH 1R9TB 2G5DA 2VB2X 3T53B 3SDZA 2I0QA 4A3BH 1A62A 4ABNA 5GROA 4GOPB 1Z6HA 1NUCA 1TWCH 2R93G 1DGSA 1EQTA 1RTOA 4K5WA 1YNND 3A8IE 5TSSA 3S1QB 2VUMB 1ENCA 3T1HL 4B9XA 4UDUC 4C3HH 3SE0A 4BA1I 3NWSA 3U9OA 2QDBA 3TSSA 3K58A 2VQFQ 2NVYB 1QJOA 3BDLA 2R6GA 2E2IH 2OQKA 3RR5A 3FP9A 1PFSA 3I2ZA 4OX9L 5C4HA 4JI7Q 1Z9FA 3KDFB 1Y8OB 2F52A 2F0IA 2XSCA 3EA6A 2PCFB 4LUOA 5J22A 1IXRA 2O2LD 2ZJRA 1LT6D 2ZTDA 3HEJA 3D8GA 1K83B 3A7AB 3C1EA 1OXXK 3N52A 2LKVA 1DONA 4DR6L 3OTOL 1QNUA 4JC0A 1I5FA 1CSQA 4XIGS 1B4OA 5EKIA 3U58A 1I3QB 1JE5A 2VZAA 3FMCA 4A3KB 5IP7G 1OO9B 2F0VA 4WRDA 1HXYD 3ULJA 4DAPA 2BH8A 1J9OA 4ME5A 1BBXC 4U68A 2EYHA 2CQOA 5JEAJ 4HJ8A 2ID0A 3KF8A 2Z0SA 3GTGH 1Q7YC 2ZTEA 1UAPA 4XQNA 4BBRG 3G6EA 2L1BA 2PW5A 2G9DA 3RLOA 1STBA 3FRPB 4X3TA 3CPWA 1PXUA 3URYA 1GUOA 2EDGA 4HIKA 2D9UA 1PRTF 4X3UA 5ISRA 2OCEA 4ME3A 4P75A 3T1YL 4KKTA 3ND9A 1ICWA 4A93G 3EBEA 2L5TA 1CFMA 4ZCKA 2IT1A 4DNIA 4APVA 4IJLA 4C2MB 2UXCL 3M7GA 1YHAA 2FHTA 4FXDA 4KJOA 4A3MH 5IGCA 2PMZB 2NTSA 1PYBA 2YTYA 3U9SA 3I4NG 2KCNA 3HOVG 4UAIA 1SN8A 5CMDA 3P1HA 1Y14B 4R8NA 5GAEC 1XPUA 3F2CA 2N55A 3DXJC 4HJ9A 4BBSB 3S14H 1SEBD 2EYJA 2I5LX 1LACA 4XDXA 4XYQA 4IJHA 3HOYB 1VDZA 5F2DA 1O78A 4HSVA 2OT2A 4KY6A 5ELCA 2HQLA 3BDOA 3E6ZX 1PTOF 1QNKA 3WDNA 2K5NA 3CCRA 5J1ZA 4LF7Q 1MIUA 4P72A 1DXMA 3HS0C 5D3IB 4A3GB 4AQYL 5M5XB 2E5LQ 2UU9L 4OO1H 3C46A 4UY8C 3J80c 4LF6Q 4BY7G 2R92B 2AHOB 1C8CA 3HKZB 4YY3L 3KBXA 4OEMB 4DV6L 3VDYA 2VXWA 4JI3Q 1Q1EA 3FDTA 5BN5A 1PRTB 2QCPX 4DV1Q 3PIO3 4KHPL 1M8AA 3F2BA 3H0GH 2JA8H 3M3YH 1KRTA 1L1OA 1JJ2A 4KLKA 3GTMH 4PMWA 1VQLA 2BOSA 3BZDB 5I2XA 1L0YB 1I4GA 2K75A 5C4XH 1VQDA 2NZOA 5IWAL 2ZXOA 2HDMA 1BQQT 2YV5A 5FO8B 3CP0A 1WTRA 3S1MH 5C4ZA 3P20A 4Y7NH 5M3MB 5C5LA 1M90C 4ULLA 4J6HA 1JR0D 1SXTA 3PSIA 1IW7D 4POGA 1QUQA 1V9PA 3RNUA 4R4CA 1VQIA 4DU9A 4XXEA 2IX3A 2OWOA 4TVAB 4WJ4A 4X65L 3OIQA 1PH2A 4DV4Q 1PTOB 5EBCA 4FYDA 4JW0A 5M9OA 4DV7Q 2MGSA 1BBUA 3HOXG 1XX8A 4FP5D 5C3WA 1SNPA 4DV5Q 3E9HA 1SAPA 2E2JH 1S5DD 1A3TA 4RCNA 4IURA 3M9BA 5IYDH 1HUNA 1VQAA 3M4OH 3S1NB 2JA7B 3BVGA 4KN4C 2MJ8A 3OSOA 2NVTB 5KGUA 4UP9A 2BCOA 4K5VA 1WCMG 3KFUA 3NE5B 2IL8A 3S15H 1NSNS 4QB4A 3PQIA 4IFDI 2K03A 3ITPA 3PUYA 4V0BA 5JEAH 5I6WA 1N8RC 5FK9C 4GKJQ 3H94A 3NUCA 4K8IA 1HRJA 3SK6A 1N32Q 3PF4A 5GAGC 2EE1A 4PMCA 2DN8A 1HCZA 3TS2A 2RHSB 3CAMA 2XTIA 1E22A 3ND8A 1M1KC 3PIPA 2O5IC 3HOUG 2NB0A 3CCMA 1YJWA 2UUBQ 1NCVA 1GO3E 1GUNA 3W3AA 1JWSD 1STYA 2C9OA 1HR0L 3GTQH 3CRLC 2R93H 1XTCD 1NY4A 3RZOB 1Q86C 2D0OA 1PLFA 1I4XA 1EZ8A 3G6JB 1GKHA 1U9RA 2A6ED 4DR5L 4JI5Q 4IN3A 2F0NA 1SNQA 1B3AA 1TWHH 5A2QL 1BCPC 3L0OA 4R4IA 4L5TA 1W2BA 3J80E 2RVLA 1VQOA 1TY0A 3A7LA 3D6WA 4HEDA 4H02A 3I55A 1TY2A 4DV2Q 3AEVA 1EUJA 1TT2A 4DK6C 1CQVA 1VCIA 2EQSA 1S40A 4JBMA 4RWSC 5C4JH 2BDNA 2L4NA 1TS5A 2F0HA 4CDFC 3HP3A 1MI2A 4LW1A 5IP7H 1PA6A 1EYAA 2D2CC 1IYJB 2F1MA 4KY5A 2LMCB 2CH4A 4GZYC 2R7ZB 1JCKB 4DV3L 3VR5A 2N3SA 5FO7B 1LTAD 2FXQA 1AZPA 4FF2A 4LFAL 3BG3A 2WAQG 4YCUA 5E4XA 4IPCA 3VA7A 2F0KA 1KAAA 1RDPD 4DV0Q 1UE1A 3U4VA 1CHQD 1EIHA 3TP5A 4BBRH 2XGTA 4RMFA 2F0PA 3TP8A 3PV0A 2Z4HA 2AKWB 3CCLA 2Z4IA 1GOZA 4JV5Q 3HOWG 5IGBA 3K0XA 4HIDA 3M85A 3NTKA 2CHBD 5KYLA 1CTMA 4XT3B 3RUZA 4BXXG 4DV1L 4GOPA 2PYKA 3G48A 1HNXQ 2HD3A 4DF7A 1OXSC 2C5CA 4P71A 5C3XA 1K0RA 1X65A 1ESRA 3KLWA 1WTWA 2N8NA 2DY7A 1AFPA 1EY9A 4BWGB 1QVGA 2R7FA 1PH6A 3I4NH 1HFGA 2BDOA 3HOVH 2YU9B 3JAMi 3TQYA 3J81c 1ENAA 4EQOA 1NNXA 4PQXA 1XMOL 2X6GA 3KDFA 2KHSA 3PUZA 5IGFA 4HJAA 1IL2A 3PIOA 4C1NI 1YIJA 1A2UA 4QF4A 5K36G 2QEXA 3R2IA 5JPNC 3NQTA 1CKNB 4N8FA 3LGJA 4R9WA 3EIVA 3RN5A 4B3SL 4JOIA 4ZAIA 1ML0D 1E0BA 1SMYC 3T1HQ 2PNHA 3TS0A 1K9MC 2OXPA 2RA4A 2WFWA 4RCOA 4DV4L 4BBSG 1YJNA 1KHIA 1QG7A 5HGTA 3I4MG 2FINB 4A3IB 2SNMA 5I2YA 4BY7H 4OX9Q 4LUVA 1MJEA 5T1IA 4A3EG 3CXCA 5C3EB 1PHJA 4DXGA 3DEPA 2SOBA 3CMAA 4DNRB 4R4QA 4ZKCB 4B08A 1X3GA 1PFBA 3ZYYX 4KK7A 4GLVB 4B3ML 3J81j 1TWGB 2OQ0A 3S16H 3K8AA 1IL8A 4DR6Q 1SE8A 3OTOQ 1ASZA 5AFWA 5HGQA 2RCFA 3UDXA 3SR1A 1SDFA 4C3JB 1SE2A 2EPBA 2RKSA 1LYLA 2K6AA 2H4OA 4J8QA 3JAML 1Y1WG 3L3OC 2MQHA 5CV5A 4C3IB 1LTBD 2WKCA 3I90A 4KHZA 4LFCQ 5ELNA 4FXKC 4IFDG 5M3FB 2K05A 1VQ6A 2D62A 3CHBD 4TQUS 1I4HA 5IT9c 4POFA 3BS1A 1BCPF 5C0XG 2KEEA 3DEOA 2F0SA 4R8IA 3Q24A 1SYCA 2KOLA 2CW0D 4CJ1B 3T1YQ 3EJIA 4JBWA 2JA5G 2B3GA 5C44B 2MHVA 3HOXH 1KQSA 3HZXA 3CKIB 2QA4A 2AMCB 1A63A 1YEZA 4CDCC 3NENA 4XTCS 4L6TB 5HY6A 3S16B 2LXKA 3FPPA 3S2HH 3LX0A 4PNYA 4HJ7A 1Y69U 2XRQD 1TWAB 1QZHA 4YIJA 2B29A 1BO0A 1I6HH 3DM3A 2UUCQ 4DV2L 1TIID 3MVVA 4B3TL 5EKLA 1JQYD 3UE1A 1XJVA 4IPGA 2OTJA 4K5XA 3Q6SA 4LMQD 2WIIB 4PZ6A 1HTPA 4YCWA 1PZKD 4Y52H 4DR7Q 4A3FG 1XYIA 1HHVA 1EY4A 2F03A 1PYWD 5I9PA 1X3EA 1EU4A 2E76C 4AQYQ 1Q81C 2B63B 1SR3A 2RDHA 3HOUH 3J81E 1HUMA 2X6LA 4LFBQ 1RCVD 1D2BA 1D5ZC 1DJRD 1VQCA 1D7QA 3J7YW 1BCPB 1K8AC 5EAYA 1HR0W 1F77A 3EQLC 4RGOS 3GTPH 1SLJA 1G6PA 1Y8PB 2QDLA 2NN6I 2E2HB 1CKOA 1ZYRD 1TWFH 4B9WA 4KHPQ 2K5HA 2OTLA 4QIWE 5M5YB 2KEDA 1IKMA 5J39A 4AYBE 4GS3A 4ODGA 1K0SA 1HTLD 3I4LA 1VQ5A 4X62L 4PG3A 1HNXL 4DK1A 3WOEA 4LK1C 2VL6A 3FKIG 3RD4A 1K8MA 1TS3A 3QOJA 2A6HD 1AW7A 3PO2B 3WWVA 3H3VI 4BY1G 2B2TC 2K52A 5KIXA 5BN3A 2B2UC 4CJ0B 1RL2A 2EYFA 2D0PA 4IUPA 4A3LG 1XMQL 1NR4A 2F4IA 1BBWA 1XPRA 5LL6X 3I56A 1Y1VG 2XVSA 1NR2A 2B39A 4X65Q 2PO4A 4I7ZC 2VQEL 1B9MA 2OF1A 1I4RA 3Q0AA 3MEHA 3STBD 1EEID 1DOKA 3TBIB 1OTCA 1EY0A 2IHEA 2AQ1B 1B3QA 4H0LC 1D1IA 3HOZB 4A3JG 3ERQA 4HIOA 1D6EC 1EY6A 5JJIA 3NPPA 1IBKL 3S17H 4HIMA 3GTKH 1XWEA 1IKLA 3B6YA 5IT9E 4OWXB 3HOWH 4IUNA 2A73B 2JP1A 3HG9A 4HSPA 1STHA 1EOTA 2B2YC 3CQZB 3PIP3 1SNCA 1SYDA 4BXXH 4L63B 4OL7A 1SFOB 4JI6L 4IPDA 3S1RB 2VB3X 4O0AA 2NTTA 2GA4B 3AU7A 4R4TA 3L2PA 4MN3A 4A3BB 3K7AH 3TP6A 1TWCB 2MO0A 4UPAA 3D3RA 2EYLA 2Y0SE 3MXNB 1X55A 2MFIA 3SK5A 4HJ5A 4K6DA 3DLLA 4AH6A 3S2DH 4LFCL 1PRTD 5K36H 1JE4A 2PQEA 4C3HB 2QF7A 2LXJA 2ZXRA 1OXVA 1HR0Q 3A5UA 1LLRD 1ZXTA 1HNZQ 2F0UA 1E7ZA 1QB5D 2E2IB 1I6VC 1XTDA 4X66L 4FDBA 4IZ8A 1CI3M 2I5HA 2IW3A 4IALA 4DR5Q 1VQ4A 4FNFA 3GTJH 3I4MH 4A3DG 1E1OA 3TN2A 3A0JA 1VQ9A 2BE5D 2EJFC 3QWNA 4TRDA 3KJOA 3J7AV 3PUWA 4DR1L 2A68C 1FR3A 4JBJA 3A56A 4A3EH 4DKAC 4QUFA 2A74C 2E75C 3NBHB 1D8LA 2FJ2A 1WTVA 4G4KA 2R61A 1MSGA 4NKLA 1BNZA 1MGSA 1ZEQX 1GHKA 2JEBI 1FYCA 2UUCL 5K5PA 1STAA 1PTOD 4RAUC 2K1BA 1Q8KA 4RA8A 3KBGA 1EYGA 3DMUA 2JK8A 1AEXA 2Q2UA 4X64L 2AWOA 3IFTA 4ZYSA 1HZCA 4QQBX 3GTGB 2EY5A 1EL0A 1VQKA 1L0XB 1Y1WH 4TSSA 5JVH3 3ZJYC 2ZJPA 4NMZA 1GVPA 4DV3Q 1CUKA 4LFAQ 4DR7L 2ATWA 2SNSA 3UDIA 2EVBA 4AIMA 4AYBG 4IFDH 1BVSA 4EQ5A 1LT5D 3RN2A 2PZTA 2WACA 4RHSA 3A54A 3BYYB 3H15A 3GV3A 3G7LA 1E2ZA 5C0XH 5EJWA 4LFBL 1G91A 1TKWB 1HZ9A 3PGZA 3OYYA 1K3BC 3H91A 2JA5H 2VS1A 1KRSA 2HUGA 4LF5Q 1Q1BA 1CKNA 4A3MB 3LWEA 3M7NA 2IX1A 3OPOA 1XNRQ 1E1TA 4DAYB 4NXML 3A5ZB 1SSOA 4O2DA 1ET9A 1B8AA 1UUPA 4WORA 3CC4A 4UHVA 3GD7A 5FLXc 5IODA 4L5SA 3JC66 3S14B 4LF4Q 2NN6G 4KY7A 3PO3H 5M5WH 4GLXA 1XMOQ 1G6ZA 1STEA 2O5JC 4LNQA 2FMMA 4ZUJA 4QGUA 2ZT9C 1C4QA 4V190 1VF7A 4B3SQ 3KF6B 4M1UB 1HQRD 3IAYA 4ZK9B 1LT3D 1U4PA 1YNJC 4RH6A 3GTOH 2F0LA 4A3FH 1A8VA 3DWQA 1BKBA 1XXGA 3E9IA 4CDEC 3E3XA 1FD7D 5FJ8H 4LF9Q 3I7FA 3VR2A 2JA9A 1H9JA 1PH3A 1FNWA 2KBNA 2NBFA 1V43A 2NUCA 3V2TA 4NPSA 2XNAC 1CQFA 3H0GB 2JA8B 4N9PA 3M3YB 4FXGC 2B2VC 1DOMA 4QJFA 3GTMB 4HTHA 4N8X1 4I7AA 3K80C 5LL6S 4NDXA 1RF2D 2PMZE 1K28A 5C4XB 4B3MQ 3E0JA 2EJGC 2Y0SG 1WYDA 1LTRD 1FJGL 3L9AX 2RSNA 1G2SA 1G291 4RG1A 2B2VA 3S1MB 2DY8A 2YYZA 3MFYA 4GN3B 4Y7NB 1ESFA 4L8JA 1L2FA 1I50H 1LTSD 4K8JA 5I6YA 2F3WA 3FKIH 1HZBA 4G7ZC 4IOCA 4MTKA 1JT8A 3Q22A 3OOCA 1EOVA 3DUZA 4Q5VA 1VQJA 3OMGA 5IGGA 4BY1H 4FF4A 1QVCA 1VQNA 1BR9A 3DWAA 4ZLTF 4A3LH 2LSSA 3HKSA 4K2LA 2WB1B 1AE3A 3J80L 1SRUA 2XIWA 1Y1VH 4XYOA 2DNCA 3HKZE 1ASYA 2JA6G 2E2JB 3K6OA 1Q90A 1V8QA 1X56A 1HNZL 4DPGA 1IBMQ 1IYVA 3FEWX 2L12A 3VYRA 4LWCA 2EXDA 4ZKBB 3M4OB 2Z6BA 1HNWQ 2Z1CA 4LUZA 4S3SA 4A3JH 2K5WA 2F0QA 1WD0A 1LM0A 3GP7A 3X3MA 2I46A 5IIFA 3S15B 4PMBA 2JE6I 5JPMC 2VUMG 3M4QA 1B53A 1SNOA 3K5OA 3L7ZC 1DZ1A 5IGDA 5DM63 4B3TQ 3QOLA 2SEBD 3GTLH 3AQQA 1PH4A 1Q12A 5FLMG 1H95A 3WOFA 1WTOA 3VA5A 5COYA 4EQNA 1K8OA 1I4PA 1T5XD 4X6AH 2LFNA 3M4YA 2NVXH 4QCLA 3NP8A 4DFAA 5FLXE 4R4OA 1XPOA 1U4MA 3AFQA 4IUVA 1T9HA 3CRKC 2ZM6L 4KKSA 3GTQB 4Q0FA 2R93B 4DR2Q 2CH4W 3N6RA 4JK1C 3RLFA 1HZAA 5KNCA 4FF3A 2CWPA 1U0LA 3SVMA 2VY3A 3LWUA 1CK1A 4OONA 1G51A 1JB7A 1H9SB 1N9WA 4KN7C 1TQOA 3UDFA 1LV9A 4A3KG 2AQ2B 2DGYA 1YNXA 1TWHB 2XWJB 3MA2B 1X54A 3BVZA 4B3RQ 1F9PA 3VYSA 4C1NK 4H7BA 4IO9A 1KNEA 3I91A 2B2WC 2F0DA 3O13A 4JCVE 1AN8A 1UEBA 4A3DH 4C3HG 4LF5L 4OIJA 2R7DA 4X62Q 4A93H 3D4DA 2F4VL 3SHLA 2EYPA 1XNRL 2FFKB 1EWHA 2BA1A 3W5OA 3MWYW 2H1EA 5C4JB 2Q8RE 1PH9A 3AFPA 1L0WA 2DJFC 2PQAB 4A76A 4DUZL 4LF4L 1LTTD 2JYOA 1F2LA 1PH5A 4HR7B 1XMQQ 5KEEA 1IYUA 1N34Q 3G71A 1HJPA 3BU2A 3NHHA 3NK9A 3VR6A 5DAUA 2IPKD 3QJYA 3ER0A 1O7LA 5I4DA 4JI8L 4EVOA 1UE7A 2RCNA 4YHHL 3D6CA 1F9QA 3CCUA 1KTKA 2DUDA 5D3DA 5CV6A 5EPLA 2VQEQ 4L5RC 1V1OA 3F2DA 4BBRB 3C3LA 2XRSD 3OIPA 1VQMA 4H13C 1QWYA 1KDAA 4JI0L 3R8BA 3AYHB 4DUYQ 1FGBD 1M4VA 2M2LA 3A55A 3AB9A 4JI4Q 2IY5B 1EWIA 1IBKQ 3OWEB 4LF9L 5D14A 2K28A 1X3PA 1B2TA 1CM9A 3HOYG 4FVMA 1Y8NB 2E74C 3MXNA 2KUMA 1WTQA 4P73A 5CV7A 3Q23A 1AH9A 5GADC 2A69C 4A3GG 1PH1A 4OIKA 1IBLL 3I4NB 3TRZA 4O1NA 1YHQA 3HOVB 5CGKA 4I65A 2OEOA 4JI6Q 2R92G 5CV4A 3HKZG 4IQZA 4PZ7A 5EPJA 2Z9HA 4NW2A 1VQ7A 4EGVA 2IJ0A 2NN6H 1GXDC 3UI2A 3FVQA 1BCPD 3GO5A 3BJUA 1GUGA 5NUCA 1FL0A 2H5XA 3GV6A 1W3SA 1SNMA 1YNNC 2K4KA 3NBHA 4CJ2C 1QVFA 1EIFA 2QKIC 4X66Q 4BY7B 1FNUA 3VYTA 3H3VH 2EY1A 5M3MG 1AP0A 1DYQA 4JI1L 1IBML 1JB3A 4TKOB 2CVRA 1MBYA 3PUXA 1C0AA 1UWVA 1HNWL 4DR1Q 4YCVA 1FNVA 1KAWA 3CCVA 4DN4M 2K5QA 2L15A 4XT1B 1PFMA 1HH2P 4DK0A 2XN9C 2NZ1D 5CV8A 3D4RA 2RBMA 1H9MA 4EQPA 3J81L 1CKMA 5H1SE 5A35A 1J5EL 4GNXC 1MJCA 1JJGA 3KYHC 1WCMH 3EN2A 3CCSA 2GVBA 2JSOA 1SROA 1Q82C 3J7ZC 2HHHL 3MC0B 4UP8A 4X64Q 4KKUA 1DOLA 4WFN3 3KLSX 3GDEA 1SYEA 1S4ZA 2ICEC 2K5VA 2JA7G 3CF5A 1U4LA 2MO1A 2K7VA 2I07B 2WV6D 1VF5C 3SGIA 2K50A 3U50C 4DAYA 1GM5A 3K57A 2EOTA 3E0EA 3C1FA 4DR2L 1C48A 2B8FA 2QEJC 2SDFA 3LNNA 1NMFA 2DNEA 2WINB 3HOXB 1LTID 2CCZA 3K5NA 2PI2A 5CR3A 4CDDC 2JA6H 3F1ZA 3OHXC 2B8GA 1EFWA 1EWCA 2HT1A 1FVIA 2D5DA 3A8JE 2JN4A 2L55A 3S2HB 1A3UA 3KLRA 1VQFA 5JJKA 4B3RL 1DD2A 3K59A 4HMJA 2RDFA 3QG1A 1BXTA 3NSWA 3MXUA 1R9TH 4NXMQ 3S24A 3KF6A 1I6HB 3SEBA 4H44C 1C7YA 4DAVA 3R2TA 1WCMB 4KD4A 2LS01 4PZ8A 5G3LD 2BA0A 2F0MA 3MTSA 2JEAI 3H09A 2KHJA 2VUMH 3S1QH 1K3RA 2BH2A 1JC7A 2L9HA 2RHQB 1Z7TA 3PCOB 2C35B 1MD2D 1YBYA 2NVYH 4MTNA 5FLMH 1N34L 3J7AF 2CKZB 5IT9L 4ID6A 3F8TA 1NE3A 3HOUB 1A15A 1I94L 5ELOA 3H6MA 1EIGA 4M8AA 4XQJA 3CCQA 2KCTA 2B2TA 3QB3A 2QGQA 2B2UA 1J8IA 1K83H 1QOHA 2ZJQA 3GTPB 3ULLA 4GN4B 4RHRA 2HDLA 5ELFA 4DUYL 5DEHA 1TWFB 2RQXA 1ILPA 1WOCA 4JI4L 3PUVA 3FHWA 4A3KH 3F2UA 1RD9D 5DNFA 1NTGA 2R7ZG 4KD3A 3MEFA 4NXNL 1PZJD 1FJGQ 1GUSA 2R3ZA 5CV9A 1VQEA 1FGUA 1JOKA 2HIVA 1S5ED 4EX5A 1LUZA 3IL8A 5E1FA 1NBWA 2F3IA 2Q8IB 4ZQ3A 1TVXA 2VW9A 5ELDA 3ULPA 3G4SA 1DM0B 3HFZB 1TXYA 5AJ3L 2B2YA 1HFNA 1IW7C 3NBIA 4CGYB 4WJ3M 3FPUB 5KYIA 1PH7A 4HAEA 4GN5A 4JYAL 1KDBA 5JJZA 5GQOA 4DK3C 3RLNA 4C2MH 5LMUL 4K14A 2WAQB 4K2KA 1BDOA 2HIXA 3CCJA 3Q8DA 3S17B 3GTKB 1Q8IA 5FOBB 1HA5A 2NVQH 3HOWB 4OWWB 2JQOA 2ASBA 4LJZC 1SE3A 4BBSH 1AZQA 3UDGA 1B7YB 3CMEA 2KCMA 4DR4L 4IPHA 3CCEA 3HOYH 2K5DA 4DR3Q 1B70B 1F2ZA 4MIUA 3AMUA 1YVCA 1WVLA 4RKLA 4ILWA 1IZ6A 5I9OA 4YWLA 1H9SA 4A3GH 1EEFD 5M5XH 3OW2A 1JOQA 2K33A 3K7AB 5IYBG 4A3IG 2K32A 2R92H 3BZCA 2K04A 2HQEA 5KNBA 1MSHA 4IUTA 5C3EG 3J7A5 3S2DB 1GJXA 1V1PB 2ZM6Q 3K5LA 2J0TD 1STGA 1C9OA 3VR4A 3CC2A 4F8MA 1EY8A 2ENBA 1PDQA 2RSOA 1SMXA 1KABA 2MNAA 2NVQB 4DNTB 1JMCA 1O7YA 3EFXD 2N88A 3MHBA 2JJQA 2IHFA 2PQAA 4KV6A 3GTJB 4C3JG 3I4MB 1VQGA 4JI2L 1YHBA 2ICIA 2M9VA 3OMCA 1SBBB 2A6EC 2KCCA 3I8ZA 4P74A 4C3IG 5M3MH 4A3EB 2EJMA 4CKCA 3NXWA 4GNXB 4NB3A 5M3FG 3RZDH 1H9KA 2F4VQ 1EQQA 5T1GA 4WJWA 1SE4A 1CZGA 2LY7A 2CFMA 2KJXA 3TZUA 1GUWA 1L1OC 3KK7A 1TR5A 1VQBA 5CORA 5CC4A 4RGTA 3NWTA 4DUZQ 4BS9A 1PTOH 1QE6A 3E5SA 1UNSA 3ONAB 3CW2C 5LMNL 5C44G 1ET6A 3K5MA 2J4XA 5IYCG 4QL5A 1YITA 2RF4A 1Y1WB 1KD1C 5DLQE 4QMGA 4L5QA 1XNQL 1EIYB 4OWTB 3S9WA 1IHZA 3IFDA 4JI8Q 1VMPA 4YHHQ 3D4WA 3J80i 2N78A 2WAQE 1CZWA 1CSPA 1S3OA 3S1NH 2JA7H 2Q2HA 4ZRZA 2UXDQ 2NVTH 5LHY1 2KQ3A 4JI0Q 3I3CA 3ERSX 5JAVA 2MUYA 3K7UC 2KENA 4RGMA 2EY6A 4MZ9A 1BOSA 1WTPA 5JJLA 4N9TA 2JA5B 2GVAA 1N36Q 4A3CG 1HQMC 4DA2A 1BF4A 3W1BA 1WJJA 4CHTB 3RZDB 1X9NA 1K8GA 2TMPA 4O42A 4LF8L 3HGBA 4U673 2KVMA 4GKKQ 1SNDA 2A8VA 1SYFA 3SK8A 1B44D 1RTNA 5KRUA 1R4PB 3V96A 2IWHA 4RFBA 3U4ZA 4KI0A 4IUQA 1CA5A 1IBLQ 2B63G 2GN5A 2IX0A 1K73C 4NP5A 1GHJA 3PO3B 5M5WB 5EBDA 1YI2A 4JBKA 3CPFA 1VMCA 3NTIA 5BR8Q 2VQFL 4HMIA 2CQAA 4F88A 5JVG3 3RZOH 2MPMA 4KHVA 5D65A 4OXPA 4HCSA 1KNAA 4LAAA 1S72A 4JI7L 3QIAA 1SYGA 2A68D 1TU2B 1JICA 2RDGA 1EU3A 3GTOB 4A3FB 4JG2A 2UXBQ 4YWKA 1CHPD 1S5BD 3MXPA 3MXGA 2PZUA 4CKBA 1EQVA 1E2VA 3T56B 1AE2A 4OO1I 2PZWA 1N33Q 1EYDA 3PO2G 1G8ZD 5C0XI 4JI1Q 5GAHC 3BYTB 1NJIC 3H3VC 1Z47A 1KDCA 2YTVA 1A2TA 2ZXPA 3TZDA 3VYUA 1DCZA 4Z9CB 1VQHA 5IP9G 4FF1A 5KNDA 3BVMA 3P75A 5FLXL 3C2PA 1SYBA 4YWMA 2L11A 3UE0A 4J15A 1W6KA 1S5CD 3NQIA 1I50B 4DR3L 2R7ZH 1J5EQ 2PI2E 4BA2I 3FKIB 1H9RA 1E24A 3HOZG 5E4WC 1PV4A 1A6XA 4BY1B 2HHHQ 4X3SA 4XQQA 1SJHD 2AWNA 2UUAQ 4K0KQ 1U4RA 3BZKA 5CYUA 1PFNA 1ZKOA 1Y1VB 1F2MA 1F9RA 1PVOA 3KF8B 5FO9B 1JORA 2XWBB 1WI5A 2J7ZA 4P2CB 3BDCA 1EY5A 5EKKA 3I72A 1UE6A 2G9HD 4JVZA 1PYSB 1JJCB 3QO2A 1EZ6A 1W6JA 1Q3LA 1RJTA 2EYMA 2N49A 1F9SA 2Q2IA 1QILA 2CW0C 4A3JB 5IOCA 3CC7A 4GLAC 5J3BA 1EFID 1B1ZA 1WTHA 4A3BG 5C5MA 2YU9H 3GQBA 5A2QE 3D0FA 1O7IA 4C56C 2KHIA 4OELB 2X69A 5L37A 3NTHA 5BN4A 1V1QA 3JAMc 2VNUD 2F0JA 3IKJA 1A0IA 1YNJD 3GTLB 1O7ZA 4LF7L 2Q2TA 1R4QB 2E5LL 4G7OC 2L0CA 4GOPC 3RMHA 1RODA 4LF6L 2ALYB 3P7JA 2NZHA 2YTXA 2B2WA 5CBAE 3A8KE 2KECA 1KIXA 1X6OA 2NVXB 1F2YA 1ILQA 5IGEA 4E6IA 4JI3L 5IYBH 4A3IH 2M00A 2WB1E 3ICEA 1SJED 3EVQA 1P8LA 2WKDA 1I94Q 2ES2A 1HA6A 5C3EH 2E2DC 2E8GA 1QZGA 3NEMA 2A19A 2K01A 3TREA 2F0TA 3K0YA 4KJNA 2TSSA 1LTLA 1S5FD 3DHQA 1PH8A 2F3VA 2UXDL 2A5HA 1BUVT 1TWGH 3TEHB 4DAMA 2HCCA 4JOIC 2A1AA 5ELBA 2F0WA 5E3FA 1D1KA 5HURA 1LTGD 1RIPA 2EIFA 4C3JH 3CU7A 1N36L 3CD6A 4A3DB 1D5MC 4PV1C 4A93B 1PZID 1ZYRC 1EYCA 3I73A 1L1OB 3MZ5A 3M4PA 4NXNQ 4C3IH 4GKKL 1E3PA 2WP8J 2EXZA 3QR8A 2PW7A 3TMEA 2AUJD 2F0FA 3J81i 2V4DA 5M3FH 5JOBA 3VR3A 1JWUD 4DV7L 3DM1A 5C6AA 4DGZA 2AUKA 4DV5L 3OW7A 1RKNA 2A6HC 2HCIA 2Q8TA 5DM73 5AJ3Q 3KJPA 5BR8L 1YZ6A 3R93A 2F0GA 3NELA 1PMRA 1YJ9A 3TDQA 5C44H 1ONLA 1QUQB 5IYCH 1NAPA 2K14A 1UE5A 2Z6KC 5LMNW 4A3MG 4JYAQ 5IY0A 3T16A 3HRZC 1JOOA 3IRBA 4QIWB 4AYBB 4A4IA 5LMUQ 2UXBL 4CKEA 1VQPA 1TS4A 1GUTA 3STBC 3R3OA 3W2DA 1TWAH 3SXHA 2Z6KA
chains in the Genus database with same CATH topology
3M7NA 4GKJL 2IX1A 4DK6C 1XNRQ 1N33L 1E1TA 4DAYB 4NXML 1P16A 3A5ZB 1VCIA 2EQSA 4O2DA 1B8AA 1S40A 4JBMA 1N32L 3CC4A 1NTGA 3GD7A 5FLXc 4L5SA 2R7ZG 5C4JH 3JC66 5IE8A 3MEFA 4UP7A 4NXNL 4A3CH 1OXTA 4DR4Q 4LF4Q 1FJGQ 2NN6G 1VQEA 4LW1A 1FGUA 3PO3H 2HIVA 5M5WH 4OO1G 5IP7H 4EX5A 1LUZA 4GLXA 1PA6A 2UUBL 1KC8C 1IYJB 1XMOQ 1NBWA 2F3IA 2VW9A 4LNQA 3ULPA 3G4SA 3HFZB 4DV3L 3PF5A 2N3SA 3I4OA 4QGUA 1TXYA 2CWAA 2FXQA 5AJ3L 2B63H 4LFAL 1Q46A 4B3SQ 2WAQG 4YCUA 3KF6B 4IPCA 4WJ3M 1GD7A 4DV0Q 1UE1A 1X3FA 1PH7A 3U4VA 3H0GG 4BBRH 2XGTA 4RMFA 1OXUA 4JI5L 3PV0A 4GN5A 4A3FH 2JA8G 4MNOA 3GTOH 2AKWB 3CCLA 4JYAL 1A8VA 3D31A 1BKBA 5GQOA 4DK3C 4JV5Q 3E9IA 2UXCQ 3HOWG 3RLNA 4IOAA 2I5MX 2UUAL 4K0KL 3K0XA 4HIDA 4C2MH 5FJ8H 3M85A 4LF9Q 3I7FA 5LMUL 4GNXA 5C4XG 2JA9A 2E2HH 1PH3A 2KBNA 1V43A 2HIXA 5M5YH 4NPSA 3CCJA 4BXXG 3Q8DA 4DV1L 3PO3G 1J6QA 4GOPA 1WFQA 3G48A 1HNXQ 1OXSC 4QJFA 2NVQH 4P71A 4OWWB 2JQOA 1NMGA 3K80C 2ASBA 2PMZE 4BBSH 4B3MQ 4A75A 4JI2Q 1K0RA 2Y0SG 1B7YB 3UDGA 3CMEA 1X65A 3KLWA 1WYDA 2KCMA 2N8NA 4DR4L 1PH6A 1QVGA 1FJGL 2R7FA 4IPHA 3I4NH 3PO2H 3CCEA 3HOVH 1G291 3JAMi 4RG1A 3HOYH 3TQYA 3S1NH 2YYZA 3J81c 4GN3B 4DR3Q 3W1GA 1B70B 1U5KA 1L2FA 1I50H 1KXLA 1XMOL 3KDFA 1YVCA 2WB1G 3PUZA 4HJAA 1KL9A 2ZTCA 3PIOA 3FKIH 1YIJA 1HZBA 1IL2A 1IZ6A 4IOCA 5K36G 2UU9Q 1JT8A 4YWLA 3A74A 2QEXA 5FJ8G 5IP9H 1EOVA 4A3GH 1CKNB 5M5XH 1VQJA 3OW2A 3LGJA 5IYBG 4A3IG 3EIVA 3RN5A 4B3SL 4JOIA 4BY1H 3BZCA 2R92H 1QVCA 4YY3Q 1VQNA 4QY7A 4DV0L 3T1HQ 2LSSA 2PNHA 4DV6Q 4A3LH 3TS0A 5LMNQ 3HKSA 4R1JA 1AE3A 1EQRA 3KOJA 5IYDG 5C3EG 1K9MC 3J7A5 2WFWA 4DV4L 4BBSG 1SRUA 4JV5L 1YJNA 4ALPA 1KHIA 3HOZH 1XNQQ 2ZM6Q 1Y1VH 4IFDJ 3I4MG 3CC2A 1C9OA 3HKZE 1ASYA 2JA6G 4BY7H 4OX9Q 1HNZL 1X56A 4DPGA 1IBMQ 1SMXA 4LUVA 5E7NA 1MJEA 2MNAA 5C0XJ 4LWCA 2EXDA 4A3EG 3CXCA 1PHJA 1JMCA 3K81C 5IWAQ 5JEAG 2JJQA 3CMAA 2IHFA 2PQAA 1HNWQ 4R4QA 4LUZA 4A3JH 1X3GA 1VQGA 4B3ML 4GLVB 3CQZH 3J81j 4JI2L 1LM0A 1YHBA 2OQ0A 3S16H 2V1CC 3K8AA 4DR6Q 1SE8A 4P74A 1VS0A 2JE6I 5M3MH 3OTOQ 1SFOH 1ASZA 1VQ8A 2VUMG 3M4QA 3S1RH 1MKHA 5HGQA 3UDXA 3L7ZC 4GNXB 4NB3A 4LF8Q 1I3QH 5M3FG 4B3TQ 3RZDH 2F4VQ 1EQQA 1LYLA 3GTLH 3AQQA 1Y1WG 2I0QA 4A3BH 1A62A 2CFMA 2MQHA 5GROA 4GOPB 1PH4A 1Q12A 1TWCH 5FLMG 1DGSA 2R93G 1H95A 1L1OC 1VQBA 4KHZA 4LFCQ 5ELNA 4DUZQ 3T1HL 4IFDG 3CW2C 5LMNL 4X6AH 5C44G 4C3HH 1VQ6A 2NVXH 4BA1I 5IYCG 2D62A 4QL5A 4R4OA 4TQUS 2RF4A 5IT9c 1YITA 5DLQE 4POFA 3AFQA 2VQFQ 1XPOA 4L5QA 1KD1C 1T9HA 5C0XG 2ZM6L 1EIYB 2R6GA 4OWTB 2E2IH 1XNQL 2OQKA 4JI8Q 3RR5A 4DR2Q 3FP9A 1PFSA 4YHHQ 3I2ZA 4OX9L 3RLFA 4JI7Q 1HZAA 1Z9FA 3KDFB 3J80i 2N78A 2CWPA 2WAQE 3T1YQ 4JBWA 2F52A 1CSPA 1S3OA 1U0LA 2B3GA 2VY3A 2JA5G 4OONA 2Q2HA 2JA7H 3HOXH 1KQSA 1G51A 1JB7A 2UXDQ 1N9WA 2NVTH 3UDFA 2QA4A 2AMCB 4LUOA 1A63A 1YEZA 4A3KG 1IXRA 4JI0Q 3NENA 2DGYA 3ERSX 4XTCS 2ZJRA 1YNXA 2ZTDA 3K7UC 5HY6A 2KENA 2LXKA 1OXXK 1X54A 3S2HH 4MZ9A 4B3RQ 4HJ7A 5JJLA 4IO9A 2GVAA 1N36Q 4DR6L 3OTOL 4JC0A 4A3CG 1I5FA 1CSQA 4XIGS 4JCVE 3U58A 1QZHA 1UEBA 3W1BA 1JE5A 1WJJA 2B29A 2VZAA 1X9NA 3DM3A 4A3DH 1K8GA 4LF5L 2UUCQ 2R7DA 1I6HH 4X62Q 4LF8L 4A93H 4DV2L 5IP7G 4B3TL 2F4VL 4GKKQ 2A8VA 1XNRL 3UE1A 2BA1A 3W5OA 3ULJA 4A3KH 1XJVA 2BH8A 4IPGA 3U4ZA 1PH9A 3AFPA 4KI0A 2OTJA 1L0WA 1IBLQ 2B63G 2GN5A 2PQAB 2CQOA 5JEAJ 2IX0A 4HJ8A 2ID0A 4PZ6A 4A76A 4DUZL 1K73C 4LF4L 2Z0SA 3GTGH 1YI2A 2ZTEA 1Q7YC 1PH5A 4JBKA 3CPFA 4YCWA 1XMQQ 1N34Q 4Y52H 3G6EA 4BBRG 3G71A 1HJPA 4DR7Q 4A3FG 3BU2A 5BR8Q 2VQFL 3RLOA 3RZOH 1X3EA 3ER0A 3CPWA 4AQYQ 4JI8L 1Q81C 4OXPA 1UE7A 1SR3A 2RCNA 4YHHL 4HIKA 3HOUH 1S72A 4JI7L 3CCUA 2OCEA 4ME3A 2DUDA 4P75A 3T1YL 4LFBQ 2VQEQ 4L5RC 3F2DA 1VQCA 4A93G 1D7QA 1VQMA 1K8AC 4JG2A 2UXBQ 5EAYA 4YWKA 3EBEA 4JI0L 2IT1A 3AYHB 4DNIA 4DUYQ 1HR0W 4APVA 3GTPH 1SLJA 4IJLA 1G6PA 2UXCL 4JI4Q 2IY5B 1EWIA 2NN6I 1YHAA 1CKOA 4KHPQ 1TWFH 1IBKQ 1AE2A 4OO1I 2K5HA 2OTLA 4LF9L 1N33Q 4QIWE 4A3MH 1PYBA 2YTYA 4AYBE 4GS3A 3I4NG 3PO2G 5C0XI 3HOVG 4JI1Q 1SN8A 5GAHC 3HOYG 1VQ5A 1NJIC 4X62L 1Y14B 4PG3A 1Z47A 5GAEC 1HNXL 1XPUA 2YTVA 3F2CA 4P73A 4HJ9A 3S14H 2VL6A 3FKIG 1AH9A 2I5LX 5GADC 5IP9G 1VQHA 4A3GG 1PH1A 1IBLL 3TRZA 4YWMA 4IJHA 3WWVA 1YHQA 3H3VI 3UE0A 4BY1G 4JI6Q 2R92G 4J15A 2K52A 1RL2A 2HQLA 2D0PA 3HKZG 4A3LG 1XMQL 4DR3L 4PZ7A 2R7ZH 2K5NA 1J5EQ 2PI2E 4BA2I 3CCRA 1VQ7A 1BBWA 4LF7Q 1MIUA 4P72A 1E24A 1XPRA 3I56A 3HOZG 4AQYL 1PV4A 2E5LQ 1Y1VG 2UU9L 3GO5A 4UY8C 3J80c 3BJUA 2HHHQ 4LF6Q 4BY7G 2AHOB 4X65Q 1FL0A 2AWNA 2H5XA 2VQEL 2UUAQ 4K0KQ 4YY3L 3BZKA 3STBD 1W3SA 4DV6L 1OTCA 2IHEA 3VDYA 2K4KA 4JI3Q 1QVFA 1Q1EA 1EIFA 4A3JG 4DV1Q 1PVOA 3KF8B 4HIOA 1WI5A 4X66Q 5JJIA 4KHPL 3F2BA 1IBKL 3H0GH 2JA8H 3M3YH 1KRTA 3H3VH 3S17H 1L1OA 1UE6A 4HIMA 1JJ2A 3GTKH 4KLKA 1PYSB 5M3MG 3GTMH 1JJCB 4PMWA 3B6YA 4JI1L 4OWXB 1IBML 1VQLA 3HOWH 2K75A 3PUXA 5C4XH 1VQDA 2N49A 2NZOA 5IWAL 1C0AA 2Q2IA 3CC7A 2YV5A 1UWVA 1HNWL 4DR1Q 4YCVA 4GLAC 5J3BA 4BXXH 4A3BG 1KAWA 3CCVA 3CP0A 2YU9H 3S1MH 3D0FA 2L15A 4Y7NH 1O7IA 1HH2P 1M90C 2KHIA 4JI6L 4IPDA 1V1QA 3PSIA 3JAMc 4POGA 4O0AA 1CKMA 5H1SE 2VNUD 1QUQA 1J5EL 1A0IA 4GNXC 1MJCA 1V9PA 3RNUA 4R4CA 3KYHC 1VQIA 4R4TA 1WCMH 3L2PA 4LF7L 1JJGA 3EN2A 3CCSA 2GVBA 2Q2TA 3K7AH 1SROA 2E5LL 2MO0A 2OWOA 1Q82C 4GOPC 4UPAA 4TVAB 2Y0SE 3MXNB 1X55A 2MFIA 3J7ZC 4HJ5A 2HHHL 4LF6L 4WJ4A 4X65L 4UP8A 4X64Q 4DV4Q 2ALYB 3DLLA 2NZHA 2YTXA 1PH2A 3GDEA 4AH6A 1KIXA 3S2DH 4LFCL 1X6OA 2K5VA 4DV7Q 2JA7G 1BBUA 3HOXG 3CF5A 2LXJA 4DV5Q 1OXVA 1HR0Q 3E9HA 2MO1A 3A5UA 1HNZQ 4JI3L 5IYBH 4A3IH 1E7ZA 2E2JH 2WB1E 3SGIA 2K50A 3U50C 3ICEA 1GM5A 1XTDA 4X66L 3E0EA 4FDBA 1P8LA 2I5HA 1I94Q 3M9BA 4DR2L 2ES2A 5IYDH 5C3EH 1QZGA 2E8GA 1VQAA 4DR5Q 1VQ4A 3M4OH 1NMFA 3NEMA 2A19A 3TREA 3GTJH 2CCZA 3I4MH 1LTLA 2PI2A 1E1OA 1PH8A 4A3DG 4UP9A 2JA6H 3F1ZA 3A0JA 1VQ9A 2UXDL 1WCMG 1TWGH 1EFWA 3KJOA 2HT1A 3KFUA 1FVIA 3TEHB 3PUWA 4DAMA 4DR1L 4JOIC 2A1AA 3S15H 4JBJA 4A3EH 4DKAC 4IFDI 1VQFA 5JJKA 3PUYA 4B3RL 1N8RC 1RIPA 1D8LA 3NBHB 4GKJQ 2EIFA 4C3JH 1N36L 3CD6A 1R9TH 4NXMQ 3S24A 3KF6A 1C7YA 1N32Q 3PF4A 5GAGC 2JEBI 4PZ8A 2UUCL 2BA0A 1L1OB 3M4PA 4NXNQ 4C3IH 2JEAI 4GKKL 1E3PA 2WP8J 3TS2A 2RHSB 2KHJA 1Q8KA 2VUMH 3S1QH 1K3RA 3CAMA 2XTIA 1E22A 2BH2A 1EYGA 1M1KC 3PIPA 2RHQB 3HOUG 3J81i 2JK8A 3PCOB 3CCMA 5M3FH 1YJWA 2Q2UA 4X64L 2UUBQ 2AWOA 2C35B 4QQBX 1HZCA 1GO3E 1VQKA 4DV7L 1Y1WH 3ZJYC 1YBYA 2NVYH 4MTNA 2ZJPA 4DV5L 1HR0L 1GVPA 3GTQH 4DV3Q 5FLMH 2R93H 1CUKA 5AJ3Q 1N34L 2CKZB 1NY4A 4LFAQ 2ATWA 3KJPA 4DR7L 3UDIA 1YZ6A 4AIMA 4AYBG 5BR8L 1Q86C 2D0OA 3F8TA 1NE3A 3NELA 1YJ9A 5C44H 1I94L 1BVSA 4EQ5A 5ELOA 1QUQB 5IYCH 3RN2A 1GKHA 4DR5L 4JI5Q 2K14A 1UE5A 2Z6KC 5LMNW 4A3MG 4JYAQ 3CCQA 5IY0A 3H15A 2KCTA 2QGQA 4LFBL 1TWHH 1K83H 3IRBA 3L0OA 4R4IA 2ZJQA 1HZ9A 3PGZA 3OYYA 4A4IA 5LMUQ 2UXBL 3ULLA 4GN4B 4L5TA 1W2BA 1VQOA 4DUYL 2JA5H 1VQPA 2VS1A 1KRSA 3STBC 4H02A 3I55A 4LF5Q 1WOCA 1Q1BA 1TWAH 1CKNA 3PUVA 4DV2Q 4JI4L 2Z6KA 3AEVA 3FHWA 1EUJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M7N A;  4GKJ L;  2IX1 A;  4DK6 C;  1XNR Q;  1N33 L;  1E1T A;  4DAY B;  4NXM L;  1P16 A;  3A5Z B;  1VCI A;  2EQS A;  4O2D A;  1B8A A;  1S40 A;  4JBM A;  1N32 L;  3CC4 A;  1NTG A;  3GD7 A;  5FLX c;  4L5S A;  2R7Z G;  5C4J H;  3JC6 6;  5IE8 A;  3MEF A;  4UP7 A;  4NXN L;  4A3C H;  1OXT A;  4DR4 Q;  4LF4 Q;  1FJG Q;  2NN6 G;  1VQE A;  4LW1 A;  1FGU A;  3PO3 H;  2HIV A;  5M5W H;  4OO1 G;  5IP7 H;  4EX5 A;  1LUZ A;  4GLX A;  1PA6 A;  2UUB L;  1KC8 C;  1IYJ B;  1XMO Q;  1NBW A;  2F3I A;  2VW9 A;  4LNQ A;  3ULP A;  3G4S A;  3HFZ B;  4DV3 L;  3PF5 A;  2N3S A;  3I4O A;  4QGU A;  1TXY A;  2CWA A;  2FXQ A;  5AJ3 L;  2B63 H;  4LFA L;  1Q46 A;  4B3S Q;  2WAQ G;  4YCU A;  3KF6 B;  4IPC A;  4WJ3 M;  1GD7 A;  4DV0 Q;  1UE1 A;  1X3F A;  1PH7 A;  3U4V A;  3H0G G;  4BBR H;  2XGT A;  4RMF A;  1OXU A;  4JI5 L;  3PV0 A;  4GN5 A;  4A3F H;  2JA8 G;  4MNO A;  3GTO H;  2AKW B;  3CCL A;  4JYA L;  1A8V A;  3D31 A;  1BKB A;  5GQO A;  4DK3 C;  4JV5 Q;  3E9I A;  2UXC Q;  3HOW G;  3RLN A;  4IOA A;  2I5M X;  2UUA L;  4K0K L;  3K0X A;  4HID A;  4C2M H;  5FJ8 H;  3M85 A;  4LF9 Q;  3I7F A;  5LMU L;  4GNX A;  5C4X G;  2JA9 A;  2E2H H;  1PH3 A;  2KBN A;  1V43 A;  2HIX A;  5M5Y H;  4NPS A;  3CCJ A;  4BXX G;  3Q8D A;  4DV1 L;  3PO3 G;  1J6Q A;  4GOP A;  1WFQ A;  3G48 A;  1HNX Q;  1OXS C;  4QJF A;  2NVQ H;  4P71 A;  4OWW B;  2JQO A;  1NMG A;  3K80 C;  2ASB A;  2PMZ E;  4BBS H;  4B3M Q;  4A75 A;  4JI2 Q;  1K0R A;  2Y0S G;  1B7Y B;  3UDG A;  3CME A;  1X65 A;  3KLW A;  1WYD A;  2KCM A;  2N8N A;  4DR4 L;  1PH6 A;  1QVG A;  1FJG L;  2R7F A;  4IPH A;  3I4N H;  3PO2 H;  3CCE A;  3HOV H;  1G29 1;  3JAM i;  4RG1 A;  3HOY H;  3TQY A;  3S1N H;  2YYZ A;  3J81 c;  4GN3 B;  4DR3 Q;  3W1G A;  1B70 B;  1U5K A;  1L2F A;  1I50 H;  1KXL A;  1XMO L;  3KDF A;  1YVC A;  2WB1 G;  3PUZ A;  4HJA A;  1KL9 A;  2ZTC A;  3PIO A;  3FKI H;  1YIJ A;  1HZB A;  1IL2 A;  1IZ6 A;  4IOC A;  5K36 G;  2UU9 Q;  1JT8 A;  4YWL A;  3A74 A;  2QEX A;  5FJ8 G;  5IP9 H;  1EOV A;  4A3G H;  1CKN B;  5M5X H;  1VQJ A;  3OW2 A;  3LGJ A;  5IYB G;  4A3I G;  3EIV A;  3RN5 A;  4B3S L;  4JOI A;  4BY1 H;  3BZC A;  2R92 H;  1QVC A;  4YY3 Q;  1VQN A;  4QY7 A;  4DV0 L;  3T1H Q;  2LSS A;  2PNH A;  4DV6 Q;  4A3L H;  3TS0 A;  5LMN Q;  3HKS A;  4R1J A;  1AE3 A;  1EQR A;  3KOJ A;  5IYD G;  5C3E G;  1K9M C;  3J7A 5;  2WFW A;  4DV4 L;  4BBS G;  1SRU A;  4JV5 L;  1YJN A;  4ALP A;  1KHI A;  3HOZ H;  1XNQ Q;  2ZM6 Q;  1Y1V H;  4IFD J;  3I4M G;  3CC2 A;  1C9O A;  3HKZ E;  1ASY A;  2JA6 G;  4BY7 H;  4OX9 Q;  1HNZ L;  1X56 A;  4DPG A;  1IBM Q;  1SMX A;  4LUV A;  5E7N A;  1MJE A;  2MNA A;  5C0X J;  4LWC A;  2EXD A;  4A3E G;  3CXC A;  1PHJ A;  1JMC A;  3K81 C;  5IWA Q;  5JEA G;  2JJQ A;  3CMA A;  2IHF A;  2PQA A;  1HNW Q;  4R4Q A;  4LUZ A;  4A3J H;  1X3G A;  1VQG A;  4B3M L;  4GLV B;  3CQZ H;  3J81 j;  4JI2 L;  1LM0 A;  1YHB A;  2OQ0 A;  3S16 H;  2V1C C;  3K8A A;  4DR6 Q;  1SE8 A;  4P74 A;  1VS0 A;  2JE6 I;  5M3M H;  3OTO Q;  1SFO H;  1ASZ A;  1VQ8 A;  2VUM G;  3M4Q A;  3S1R H;  1MKH A;  5HGQ A;  3UDX A;  3L7Z C;  4GNX B;  4NB3 A;  4LF8 Q;  1I3Q H;  5M3F G;  4B3T Q;  3RZD H;  2F4V Q;  1EQQ A;  1LYL A;  3GTL H;  3AQQ A;  1Y1W G;  2I0Q A;  4A3B H;  1A62 A;  2CFM A;  2MQH A;  5GRO A;  4GOP B;  1PH4 A;  1Q12 A;  1TWC H;  5FLM G;  1DGS A;  2R93 G;  1H95 A;  1L1O C;  1VQB A;  4KHZ A;  4LFC Q;  5ELN A;  4DUZ Q;  3T1H L;  4IFD G;  3CW2 C;  5LMN L;  4X6A H;  5C44 G;  4C3H H;  1VQ6 A;  2NVX H;  4BA1 I;  5IYC G;  2D62 A;  4QL5 A;  4R4O A;  4TQU S;  2RF4 A;  5IT9 c;  1YIT A;  5DLQ E;  4POF A;  3AFQ A;  2VQF Q;  1XPO A;  4L5Q A;  1KD1 C;  1T9H A;  5C0X G;  2ZM6 L;  1EIY B;  2R6G A;  4OWT B;  2E2I H;  1XNQ L;  2OQK A;  4JI8 Q;  3RR5 A;  4DR2 Q;  3FP9 A;  1PFS A;  4YHH Q;  3I2Z A;  4OX9 L;  3RLF A;  4JI7 Q;  1HZA A;  1Z9F A;  3KDF B;  3J80 i;  2N78 A;  2CWP A;  2WAQ E;  3T1Y Q;  4JBW A;  2F52 A;  1CSP A;  1S3O A;  1U0L A;  2B3G A;  2VY3 A;  2JA5 G;  4OON A;  2Q2H A;  2JA7 H;  3HOX H;  1KQS A;  1G51 A;  1JB7 A;  2UXD Q;  1N9W A;  2NVT H;  3UDF A;  2QA4 A;  2AMC B;  4LUO A;  1A63 A;  1YEZ A;  4A3K G;  1IXR A;  4JI0 Q;  3NEN A;  2DGY A;  3ERS X;  4XTC S;  2ZJR A;  1YNX A;  2ZTD A;  3K7U C;  5HY6 A;  2KEN A;  2LXK A;  1OXX K;  1X54 A;  3S2H H;  4MZ9 A;  4B3R Q;  4HJ7 A;  5JJL A;  4IO9 A;  2GVA A;  1N36 Q;  4DR6 L;  3OTO L;  4JC0 A;  4A3C G;  1I5F A;  1CSQ A;  4XIG S;  4JCV E;  3U58 A;  1QZH A;  1UEB A;  3W1B A;  1JE5 A;  1WJJ A;  2B29 A;  2VZA A;  1X9N A;  3DM3 A;  4A3D H;  1K8G A;  4LF5 L;  2UUC Q;  2R7D A;  1I6H H;  4X62 Q;  4LF8 L;  4A93 H;  4DV2 L;  5IP7 G;  4B3T L;  2F4V L;  4GKK Q;  2A8V A;  1XNR L;  3UE1 A;  2BA1 A;  3W5O A;  3ULJ A;  4A3K H;  1XJV A;  2BH8 A;  4IPG A;  3U4Z A;  1PH9 A;  3AFP A;  4KI0 A;  2OTJ A;  1L0W A;  1IBL Q;  2B63 G;  2GN5 A;  2PQA B;  2CQO A;  5JEA J;  2IX0 A;  4HJ8 A;  2ID0 A;  4PZ6 A;  4A76 A;  4DUZ L;  1K73 C;  4LF4 L;  2Z0S A;  3GTG H;  1YI2 A;  2ZTE A;  1Q7Y C;  1PH5 A;  4JBK A;  3CPF A;  4YCW A;  1XMQ Q;  1N34 Q;  4Y52 H;  3G6E A;  4BBR G;  3G71 A;  1HJP A;  4DR7 Q;  4A3F G;  3BU2 A;  5BR8 Q;  2VQF L;  3RLO A;  3RZO H;  1X3E A;  3ER0 A;  3CPW A;  4AQY Q;  4JI8 L;  1Q81 C;  4OXP A;  1UE7 A;  1SR3 A;  2RCN A;  4YHH L;  4HIK A;  3HOU H;  1S72 A;  4JI7 L;  3CCU A;  2OCE A;  4ME3 A;  2DUD A;  4P75 A;  3T1Y L;  4LFB Q;  2VQE Q;  4L5R C;  3F2D A;  1VQC A;  4A93 G;  1D7Q A;  1VQM A;  1K8A C;  4JG2 A;  2UXB Q;  5EAY A;  4YWK A;  3EBE A;  4JI0 L;  2IT1 A;  3AYH B;  4DNI A;  4DUY Q;  1HR0 W;  4APV A;  3GTP H;  1SLJ A;  4IJL A;  1G6P A;  2UXC L;  4JI4 Q;  2IY5 B;  1EWI A;  2NN6 I;  1YHA A;  1CKO A;  4KHP Q;  1TWF H;  1IBK Q;  1AE2 A;  4OO1 I;  2K5H A;  2OTL A;  4LF9 L;  1N33 Q;  4QIW E;  4A3M H;  1PYB A;  2YTY A;  4AYB E;  4GS3 A;  3I4N G;  3PO2 G;  5C0X I;  3HOV G;  4JI1 Q;  1SN8 A;  5GAH C;  3HOY G;  1VQ5 A;  1NJI C;  4X62 L;  1Y14 B;  4PG3 A;  1Z47 A;  5GAE C;  1HNX L;  1XPU A;  2YTV A;  3F2C A;  4P73 A;  4HJ9 A;  3S14 H;  2VL6 A;  3FKI G;  1AH9 A;  2I5L X;  5GAD C;  5IP9 G;  1VQH A;  4A3G G;  1PH1 A;  1IBL L;  3TRZ A;  4YWM A;  4IJH A;  3WWV A;  1YHQ A;  3H3V I;  3UE0 A;  4BY1 G;  4JI6 Q;  2R92 G;  4J15 A;  2K52 A;  1RL2 A;  2HQL A;  2D0P A;  3HKZ G;  4A3L G;  1XMQ L;  4DR3 L;  4PZ7 A;  2R7Z H;  2K5N A;  1J5E Q;  2PI2 E;  4BA2 I;  3CCR A;  1VQ7 A;  1BBW A;  4LF7 Q;  1MIU A;  4P72 A;  1E24 A;  1XPR A;  3I56 A;  3HOZ G;  4AQY L;  1PV4 A;  2E5L Q;  1Y1V G;  2UU9 L;  3GO5 A;  4UY8 C;  3J80 c;  3BJU A;  2HHH Q;  4LF6 Q;  4BY7 G;  2AHO B;  4X65 Q;  1FL0 A;  2AWN A;  2H5X A;  2VQE L;  2UUA Q;  4K0K Q;  4YY3 L;  3BZK A;  3STB D;  1W3S A;  4DV6 L;  1OTC A;  2IHE A;  3VDY A;  2K4K A;  4JI3 Q;  1QVF A;  1Q1E A;  1EIF A;  4A3J G;  4DV1 Q;  1PVO A;  3KF8 B;  4HIO A;  1WI5 A;  4X66 Q;  5JJI A;  4KHP L;  3F2B A;  1IBK L;  3H0G H;  2JA8 H;  3M3Y H;  1KRT A;  3H3V H;  3S17 H;  1L1O A;  1UE6 A;  4HIM A;  1JJ2 A;  3GTK H;  4KLK A;  1PYS B;  5M3M G;  3GTM H;  1JJC B;  4PMW A;  3B6Y A;  4JI1 L;  4OWX B;  1IBM L;  1VQL A;  3HOW H;  2K75 A;  3PUX A;  5C4X H;  1VQD A;  2N49 A;  2NZO A;  5IWA L;  1C0A A;  2Q2I A;  3CC7 A;  2YV5 A;  1UWV A;  1HNW L;  4DR1 Q;  4YCV A;  4GLA C;  5J3B A;  4BXX H;  4A3B G;  1KAW A;  3CCV A;  3CP0 A;  2YU9 H;  3S1M H;  3D0F A;  2L15 A;  4Y7N H;  1O7I A;  1HH2 P;  1M90 C;  2KHI A;  4JI6 L;  4IPD A;  1V1Q A;  3PSI A;  3JAM c;  4POG A;  4O0A A;  1CKM A;  5H1S E;  2VNU D;  1QUQ A;  1J5E L;  1A0I A;  4GNX C;  1MJC A;  1V9P A;  3RNU A;  4R4C A;  3KYH C;  1VQI A;  4R4T A;  1WCM H;  3L2P A;  4LF7 L;  1JJG A;  3EN2 A;  3CCS A;  2GVB A;  2Q2T A;  3K7A H;  1SRO A;  2E5L L;  2MO0 A;  2OWO A;  1Q82 C;  4GOP C;  4UPA A;  4TVA B;  2Y0S E;  3MXN B;  1X55 A;  2MFI A;  3J7Z C;  4HJ5 A;  2HHH L;  4LF6 L;  4WJ4 A;  4X65 L;  4UP8 A;  4X64 Q;  4DV4 Q;  2ALY B;  3DLL A;  2NZH A;  2YTX A;  1PH2 A;  3GDE A;  4AH6 A;  1KIX A;  3S2D H;  4LFC L;  1X6O A;  2K5V A;  4DV7 Q;  2JA7 G;  1BBU A;  3HOX G;  3CF5 A;  2LXJ A;  4DV5 Q;  1OXV A;  1HR0 Q;  3E9H A;  2MO1 A;  3A5U A;  1HNZ Q;  4JI3 L;  5IYB H;  4A3I H;  1E7Z A;  2E2J H;  2WB1 E;  3SGI A;  2K50 A;  3U50 C;  3ICE A;  1GM5 A;  1XTD A;  4X66 L;  3E0E A;  4FDB A;  1P8L A;  2I5H A;  1I94 Q;  3M9B A;  4DR2 L;  2ES2 A;  5IYD H;  5C3E H;  1QZG A;  2E8G A;  1VQA A;  4DR5 Q;  1VQ4 A;  3M4O H;  1NMF A;  3NEM A;  2A19 A;  3TRE A;  3GTJ H;  2CCZ A;  3I4M H;  1LTL A;  2PI2 A;  1E1O A;  1PH8 A;  4A3D G;  4UP9 A;  2JA6 H;  3F1Z A;  3A0J A;  1VQ9 A;  2UXD L;  1WCM G;  1TWG H;  1EFW A;  3KJO A;  2HT1 A;  3KFU A;  1FVI A;  3TEH B;  3PUW A;  4DAM A;  4DR1 L;  4JOI C;  2A1A A;  3S15 H;  4JBJ A;  4A3E H;  4DKA C;  4IFD I;  1VQF A;  5JJK A;  3PUY A;  4B3R L;  1N8R C;  1RIP A;  1D8L A;  3NBH B;  4GKJ Q;  2EIF A;  4C3J H;  1N36 L;  3CD6 A;  1R9T H;  4NXM Q;  3S24 A;  3KF6 A;  1C7Y A;  1N32 Q;  3PF4 A;  5GAG C;  2JEB I;  4PZ8 A;  2UUC L;  2BA0 A;  1L1O B;  3M4P A;  4NXN Q;  4C3I H;  2JEA I;  4GKK L;  1E3P A;  2WP8 J;  3TS2 A;  2RHS B;  2KHJ A;  1Q8K A;  2VUM H;  3S1Q H;  1K3R A;  3CAM A;  2XTI A;  1E22 A;  2BH2 A;  1EYG A;  1M1K C;  3PIP A;  2RHQ B;  3HOU G;  3J81 i;  2JK8 A;  3PCO B;  3CCM A;  5M3F H;  1YJW A;  2Q2U A;  4X64 L;  2UUB Q;  2AWO A;  2C35 B;  4QQB X;  1HZC A;  1GO3 E;  1VQK A;  4DV7 L;  1Y1W H;  3ZJY C;  1YBY A;  2NVY H;  4MTN A;  2ZJP A;  4DV5 L;  1HR0 L;  1GVP A;  3GTQ H;  4DV3 Q;  5FLM H;  2R93 H;  1CUK A;  5AJ3 Q;  1N34 L;  2CKZ B;  1NY4 A;  4LFA Q;  2ATW A;  3KJP A;  4DR7 L;  3UDI A;  1YZ6 A;  4AIM A;  4AYB G;  5BR8 L;  1Q86 C;  2D0O A;  3F8T A;  1NE3 A;  3NEL A;  1YJ9 A;  5C44 H;  1I94 L;  1BVS A;  4EQ5 A;  5ELO A;  1QUQ B;  5IYC H;  3RN2 A;  1GKH A;  4DR5 L;  4JI5 Q;  2K14 A;  1UE5 A;  2Z6K C;  5LMN W;  4A3M G;  4JYA Q;  3CCQ A;  5IY0 A;  3H15 A;  2KCT A;  2QGQ A;  4LFB L;  1TWH H;  1K83 H;  3IRB A;  3L0O A;  4R4I A;  2ZJQ A;  1HZ9 A;  3PGZ A;  3OYY A;  4A4I A;  5LMU Q;  2UXB L;  3ULL A;  4GN4 B;  4L5T A;  1W2B A;  1VQO A;  4DUY L;  2JA5 H;  1VQP A;  2VS1 A;  1KRS A;  3STB C;  4H02 A;  3I55 A;  4LF5 Q;  1WOC A;  1Q1B A;  1TWA H;  1CKN A;  3PUV A;  4DV2 Q;  4JI4 L;  2Z6K A;  3AEV A;  3FHW A;  1EUJ A; 
#chains in the Genus database with same CATH topology
 1X32 A;  3I70 A;  4GKJ L;  4KMU C;  1I4Q A;  1N33 L;  2F0O A;  1P16 A;  1ENF A;  1N32 L;  2FMC A;  3ERO A;  5IE8 A;  4UP7 A;  1LT4 D;  4DXF A;  4A3C H;  1OXT A;  1V1P A;  4DR4 Q;  5EGT A;  3DWP A;  4OO1 G;  1B9N A;  3X3N A;  2UUB L;  1KC8 C;  4RGN A;  1QCB D;  3KUP A;  4G7H C;  2KA7 A;  4FO2 A;  4KTA A;  3PF5 A;  1LAB A;  3I4O A;  1G2T A;  1CT1 D;  2CWA A;  2B63 H;  3TP7 A;  5CBE E;  3OWF A;  1Q46 A;  4JPB W;  3MAQ A;  4MHE A;  1HPC A;  1GD7 A;  1D5X C;  1X3F A;  1TS2 A;  3JAM E;  3H0G G;  4OHJ A;  2JA8 G;  1OXU A;  4JI5 L;  5EPK A;  4MNO A;  1EY7 A;  3D31 A;  2UXC Q;  1E2W A;  4IOA A;  2I5M X;  3T13 A;  2UUA L;  4K0K L;  2EYO A;  2QW7 A;  4GNX A;  5C4X G;  1A3V A;  2E2H H;  2PPB C;  4HCE A;  4CBV A;  2DJG C;  1PRT C;  1UEA B;  5M5Y H;  3PO3 G;  1JWM D;  1J6Q A;  1WFQ A;  1STN A;  4J1M A;  2Z8L A;  3KLS A;  1NMG A;  4A75 A;  4JI2 Q;  1ICF B;  3T51 B;  2MP1 A;  3V05 A;  3PO2 H;  2P5Z X;  4F87 A;  3W1G A;  2BE5 C;  1U5K A;  1KXL A;  2WB1 G;  1WTX A;  1CA6 A;  1KL9 A;  2ZTC A;  4ZUI A;  2Y0S B;  2UU9 Q;  3A74 A;  5FJ8 G;  5IP9 H;  4G57 A;  2QIL A;  1SMY D;  2F0E A;  2O4X A;  4YY3 Q;  4QY7 A;  4DV0 L;  4DV6 Q;  5LMN Q;  4R1J A;  1EQR A;  3KOJ A;  1RHP A;  2JXM B;  5IYD G;  3MFG A;  1PTO C;  2EZV A;  4JV5 L;  4ALP A;  3HOZ H;  4HN7 A;  5EQ0 A;  1MHW C;  4OGQ C;  1XNQ Q;  4IFD J;  1X3Q A;  1KLG D;  5E7N A;  5C0X J;  4QUC A;  4IUU A;  1KLU D;  5FKA C;  3K81 C;  2A69 D;  5IWA Q;  1LO5 D;  2NWG A;  5JEA G;  1WD1 A;  3T4A C;  2JA6 B;  1O80 A;  1B50 A;  3CQZ H;  2PNR C;  4F7X A;  2EY2 A;  3PMF A;  2V1C C;  4K6L A;  2AQ3 B;  2NYZ D;  4X3K A;  4RKB A;  3SK4 A;  1VS0 A;  5G3L F;  1SFO H;  1T5E A;  5ELE A;  1VQ8 A;  3S1R H;  1MKH A;  1II3 A;  4LF8 Q;  1I3Q H;  1R9T B;  2G5D A;  2VB2 X;  3T53 B;  3SDZ A;  2I0Q A;  4A3B H;  1A62 A;  4ABN A;  5GRO A;  4GOP B;  1Z6H A;  1NUC A;  1TWC H;  2R93 G;  1DGS A;  1EQT A;  1RTO A;  4K5W A;  1YNN D;  3A8I E;  5TSS A;  3S1Q B;  2VUM B;  1ENC A;  3T1H L;  4B9X A;  4UDU C;  4C3H H;  3SE0 A;  4BA1 I;  3NWS A;  3U9O A;  2QDB A;  3TSS A;  3K58 A;  2VQF Q;  2NVY B;  1QJO A;  3BDL A;  2R6G A;  2E2I H;  2OQK A;  3RR5 A;  3FP9 A;  1PFS A;  3I2Z A;  4OX9 L;  5C4H A;  4JI7 Q;  1Z9F A;  3KDF B;  1Y8O B;  2F52 A;  2F0I A;  2XSC A;  3EA6 A;  2PCF B;  4LUO A;  5J22 A;  1IXR A;  2O2L D;  2ZJR A;  1LT6 D;  2ZTD A;  3HEJ A;  3D8G A;  1K83 B;  3A7A B;  3C1E A;  1OXX K;  3N52 A;  2LKV A;  1DON A;  4DR6 L;  3OTO L;  1QNU A;  4JC0 A;  1I5F A;  1CSQ A;  4XIG S;  1B4O A;  5EKI A;  3U58 A;  1I3Q B;  1JE5 A;  2VZA A;  3FMC A;  4A3K B;  5IP7 G;  1OO9 B;  2F0V A;  4WRD A;  1HXY D;  3ULJ A;  4DAP A;  2BH8 A;  1J9O A;  4ME5 A;  1BBX C;  4U68 A;  2EYH A;  2CQO A;  5JEA J;  4HJ8 A;  2ID0 A;  3KF8 A;  2Z0S A;  3GTG H;  1Q7Y C;  2ZTE A;  1UAP A;  4XQN A;  4BBR G;  3G6E A;  2L1B A;  2PW5 A;  2G9D A;  3RLO A;  1STB A;  3FRP B;  4X3T A;  3CPW A;  1PXU A;  3URY A;  1GUO A;  2EDG A;  4HIK A;  2D9U A;  1PRT F;  4X3U A;  5ISR A;  2OCE A;  4ME3 A;  4P75 A;  3T1Y L;  4KKT A;  3ND9 A;  1ICW A;  4A93 G;  3EBE A;  2L5T A;  1CFM A;  4ZCK A;  2IT1 A;  4DNI A;  4APV A;  4IJL A;  4C2M B;  2UXC L;  3M7G A;  1YHA A;  2FHT A;  4FXD A;  4KJO A;  4A3M H;  5IGC A;  2PMZ B;  2NTS A;  1PYB A;  2YTY A;  3U9S A;  3I4N G;  2KCN A;  3HOV G;  4UAI A;  1SN8 A;  5CMD A;  3P1H A;  1Y14 B;  4R8N A;  5GAE C;  1XPU A;  3F2C A;  2N55 A;  3DXJ C;  4HJ9 A;  4BBS B;  3S14 H;  1SEB D;  2EYJ A;  2I5L X;  1LAC A;  4XDX A;  4XYQ A;  4IJH A;  3HOY B;  1VDZ A;  5F2D A;  1O78 A;  4HSV A;  2OT2 A;  4KY6 A;  5ELC A;  2HQL A;  3BDO A;  3E6Z X;  1PTO F;  1QNK A;  3WDN A;  2K5N A;  3CCR A;  5J1Z A;  4LF7 Q;  1MIU A;  4P72 A;  1DXM A;  3HS0 C;  5D3I B;  4A3G B;  4AQY L;  5M5X B;  2E5L Q;  2UU9 L;  4OO1 H;  3C46 A;  4UY8 C;  3J80 c;  4LF6 Q;  4BY7 G;  2R92 B;  2AHO B;  1C8C A;  3HKZ B;  4YY3 L;  3KBX A;  4OEM B;  4DV6 L;  3VDY A;  2VXW A;  4JI3 Q;  1Q1E A;  3FDT A;  5BN5 A;  1PRT B;  2QCP X;  4DV1 Q;  3PIO 3;  4KHP L;  1M8A A;  3F2B A;  3H0G H;  2JA8 H;  3M3Y H;  1KRT A;  1L1O A;  1JJ2 A;  4KLK A;  3GTM H;  4PMW A;  1VQL A;  2BOS A;  3BZD B;  5I2X A;  1L0Y B;  1I4G A;  2K75 A;  5C4X H;  1VQD A;  2NZO A;  5IWA L;  2ZXO A;  2HDM A;  1BQQ T;  2YV5 A;  5FO8 B;  3CP0 A;  1WTR A;  3S1M H;  5C4Z A;  3P20 A;  4Y7N H;  5M3M B;  5C5L A;  1M90 C;  4ULL A;  4J6H A;  1JR0 D;  1SXT A;  3PSI A;  1IW7 D;  4POG A;  1QUQ A;  1V9P A;  3RNU A;  4R4C A;  1VQI A;  4DU9 A;  4XXE A;  2IX3 A;  2OWO A;  4TVA B;  4WJ4 A;  4X65 L;  3OIQ A;  1PH2 A;  4DV4 Q;  1PTO B;  5EBC A;  4FYD A;  4JW0 A;  5M9O A;  4DV7 Q;  2MGS A;  1BBU A;  3HOX G;  1XX8 A;  4FP5 D;  5C3W A;  1SNP A;  4DV5 Q;  3E9H A;  1SAP A;  2E2J H;  1S5D D;  1A3T A;  4RCN A;  4IUR A;  3M9B A;  5IYD H;  1HUN A;  1VQA A;  3M4O H;  3S1N B;  2JA7 B;  3BVG A;  4KN4 C;  2MJ8 A;  3OSO A;  2NVT B;  5KGU A;  4UP9 A;  2BCO A;  4K5V A;  1WCM G;  3KFU A;  3NE5 B;  2IL8 A;  3S15 H;  1NSN S;  4QB4 A;  3PQI A;  4IFD I;  2K03 A;  3ITP A;  3PUY A;  4V0B A;  5JEA H;  5I6W A;  1N8R C;  5FK9 C;  4GKJ Q;  3H94 A;  3NUC A;  4K8I A;  1HRJ A;  3SK6 A;  1N32 Q;  3PF4 A;  5GAG C;  2EE1 A;  4PMC A;  2DN8 A;  1HCZ A;  3TS2 A;  2RHS B;  3CAM A;  2XTI A;  1E22 A;  3ND8 A;  1M1K C;  3PIP A;  2O5I C;  3HOU G;  2NB0 A;  3CCM A;  1YJW A;  2UUB Q;  1NCV A;  1GO3 E;  1GUN A;  3W3A A;  1JWS D;  1STY A;  2C9O A;  1HR0 L;  3GTQ H;  3CRL C;  2R93 H;  1XTC D;  1NY4 A;  3RZO B;  1Q86 C;  2D0O A;  1PLF A;  1I4X A;  1EZ8 A;  3G6J B;  1GKH A;  1U9R A;  2A6E D;  4DR5 L;  4JI5 Q;  4IN3 A;  2F0N A;  1SNQ A;  1B3A A;  1TWH H;  5A2Q L;  1BCP C;  3L0O A;  4R4I A;  4L5T A;  1W2B A;  3J80 E;  2RVL A;  1VQO A;  1TY0 A;  3A7L A;  3D6W A;  4HED A;  4H02 A;  3I55 A;  1TY2 A;  4DV2 Q;  3AEV A;  1EUJ A;  1TT2 A;  4DK6 C;  1CQV A;  1VCI A;  2EQS A;  1S40 A;  4JBM A;  4RWS C;  5C4J H;  2BDN A;  2L4N A;  1TS5 A;  2F0H A;  4CDF C;  3HP3 A;  1MI2 A;  4LW1 A;  5IP7 H;  1PA6 A;  1EYA A;  2D2C C;  1IYJ B;  2F1M A;  4KY5 A;  2LMC B;  2CH4 A;  4GZY C;  2R7Z B;  1JCK B;  4DV3 L;  3VR5 A;  2N3S A;  5FO7 B;  1LTA D;  2FXQ A;  1AZP A;  4FF2 A;  4LFA L;  3BG3 A;  2WAQ G;  4YCU A;  5E4X A;  4IPC A;  3VA7 A;  2F0K A;  1KAA A;  1RDP D;  4DV0 Q;  1UE1 A;  3U4V A;  1CHQ D;  1EIH A;  3TP5 A;  4BBR H;  2XGT A;  4RMF A;  2F0P A;  3TP8 A;  3PV0 A;  2Z4H A;  2AKW B;  3CCL A;  2Z4I A;  1GOZ A;  4JV5 Q;  3HOW G;  5IGB A;  3K0X A;  4HID A;  3M85 A;  3NTK A;  2CHB D;  5KYL A;  1CTM A;  4XT3 B;  3RUZ A;  4BXX G;  4DV1 L;  4GOP A;  2PYK A;  3G48 A;  1HNX Q;  2HD3 A;  4DF7 A;  1OXS C;  2C5C A;  4P71 A;  5C3X A;  1K0R A;  1X65 A;  1ESR A;  3KLW A;  1WTW A;  2N8N A;  2DY7 A;  1AFP A;  1EY9 A;  4BWG B;  1QVG A;  2R7F A;  1PH6 A;  3I4N H;  1HFG A;  2BDO A;  3HOV H;  2YU9 B;  3JAM i;  3TQY A;  3J81 c;  1ENA A;  4EQO A;  1NNX A;  4PQX A;  1XMO L;  2X6G A;  3KDF A;  2KHS A;  3PUZ A;  5IGF A;  4HJA A;  1IL2 A;  3PIO A;  4C1N I;  1YIJ A;  1A2U A;  4QF4 A;  5K36 G;  2QEX A;  3R2I A;  5JPN C;  3NQT A;  1CKN B;  4N8F A;  3LGJ A;  4R9W A;  3EIV A;  3RN5 A;  4B3S L;  4JOI A;  4ZAI A;  1ML0 D;  1E0B A;  1SMY C;  3T1H Q;  2PNH A;  3TS0 A;  1K9M C;  2OXP A;  2RA4 A;  2WFW A;  4RCO A;  4DV4 L;  4BBS G;  1YJN A;  1KHI A;  1QG7 A;  5HGT A;  3I4M G;  2FIN B;  4A3I B;  2SNM A;  5I2Y A;  4BY7 H;  4OX9 Q;  4LUV A;  1MJE A;  5T1I A;  4A3E G;  3CXC A;  5C3E B;  1PHJ A;  4DXG A;  3DEP A;  2SOB A;  3CMA A;  4DNR B;  4R4Q A;  4ZKC B;  4B08 A;  1X3G A;  1PFB A;  3ZYY X;  4KK7 A;  4GLV B;  4B3M L;  3J81 j;  1TWG B;  2OQ0 A;  3S16 H;  3K8A A;  1IL8 A;  4DR6 Q;  1SE8 A;  3OTO Q;  1ASZ A;  5AFW A;  5HGQ A;  2RCF A;  3UDX A;  3SR1 A;  1SDF A;  4C3J B;  1SE2 A;  2EPB A;  2RKS A;  1LYL A;  2K6A A;  2H4O A;  4J8Q A;  3JAM L;  1Y1W G;  3L3O C;  2MQH A;  5CV5 A;  4C3I B;  1LTB D;  2WKC A;  3I90 A;  4KHZ A;  4LFC Q;  5ELN A;  4FXK C;  4IFD G;  5M3F B;  2K05 A;  1VQ6 A;  2D62 A;  3CHB D;  4TQU S;  1I4H A;  5IT9 c;  4POF A;  3BS1 A;  1BCP F;  5C0X G;  2KEE A;  3DEO A;  2F0S A;  4R8I A;  3Q24 A;  1SYC A;  2KOL A;  2CW0 D;  4CJ1 B;  3T1Y Q;  3EJI A;  4JBW A;  2JA5 G;  2B3G A;  5C44 B;  2MHV A;  3HOX H;  1KQS A;  3HZX A;  3CKI B;  2QA4 A;  2AMC B;  1A63 A;  1YEZ A;  4CDC C;  3NEN A;  4XTC S;  4L6T B;  5HY6 A;  3S16 B;  2LXK A;  3FPP A;  3S2H H;  3LX0 A;  4PNY A;  4HJ7 A;  1Y69 U;  2XRQ D;  1TWA B;  1QZH A;  4YIJ A;  2B29 A;  1BO0 A;  1I6H H;  3DM3 A;  2UUC Q;  4DV2 L;  1TII D;  3MVV A;  4B3T L;  5EKL A;  1JQY D;  3UE1 A;  1XJV A;  4IPG A;  2OTJ A;  4K5X A;  3Q6S A;  4LMQ D;  2WII B;  4PZ6 A;  1HTP A;  4YCW A;  1PZK D;  4Y52 H;  4DR7 Q;  4A3F G;  1XYI A;  1HHV A;  1EY4 A;  2F03 A;  1PYW D;  5I9P A;  1X3E A;  1EU4 A;  2E76 C;  4AQY Q;  1Q81 C;  2B63 B;  1SR3 A;  2RDH A;  3HOU H;  3J81 E;  1HUM A;  2X6L A;  4LFB Q;  1RCV D;  1D2B A;  1D5Z C;  1DJR D;  1VQC A;  1D7Q A;  3J7Y W;  1BCP B;  1K8A C;  5EAY A;  1HR0 W;  1F77 A;  3EQL C;  4RGO S;  3GTP H;  1SLJ A;  1G6P A;  1Y8P B;  2QDL A;  2NN6 I;  2E2H B;  1CKO A;  1ZYR D;  1TWF H;  4B9W A;  4KHP Q;  2K5H A;  2OTL A;  4QIW E;  5M5Y B;  2KED A;  1IKM A;  5J39 A;  4AYB E;  4GS3 A;  4ODG A;  1K0S A;  1HTL D;  3I4L A;  1VQ5 A;  4X62 L;  4PG3 A;  1HNX L;  4DK1 A;  3WOE A;  4LK1 C;  2VL6 A;  3FKI G;  3RD4 A;  1K8M A;  1TS3 A;  3QOJ A;  2A6H D;  1AW7 A;  3PO2 B;  3WWV A;  3H3V I;  4BY1 G;  2B2T C;  2K52 A;  5KIX A;  5BN3 A;  2B2U C;  4CJ0 B;  1RL2 A;  2EYF A;  2D0P A;  4IUP A;  4A3L G;  1XMQ L;  1NR4 A;  2F4I A;  1BBW A;  1XPR A;  5LL6 X;  3I56 A;  1Y1V G;  2XVS A;  1NR2 A;  2B39 A;  4X65 Q;  2PO4 A;  4I7Z C;  2VQE L;  1B9M A;  2OF1 A;  1I4R A;  3Q0A A;  3MEH A;  3STB D;  1EEI D;  1DOK A;  3TBI B;  1OTC A;  1EY0 A;  2IHE A;  2AQ1 B;  1B3Q A;  4H0L C;  1D1I A;  3HOZ B;  4A3J G;  3ERQ A;  4HIO A;  1D6E C;  1EY6 A;  5JJI A;  3NPP A;  1IBK L;  3S17 H;  4HIM A;  3GTK H;  1XWE A;  1IKL A;  3B6Y A;  5IT9 E;  4OWX B;  3HOW H;  4IUN A;  2A73 B;  2JP1 A;  3HG9 A;  4HSP A;  1STH A;  1EOT A;  2B2Y C;  3CQZ B;  3PIP 3;  1SNC A;  1SYD A;  4BXX H;  4L63 B;  4OL7 A;  1SFO B;  4JI6 L;  4IPD A;  3S1R B;  2VB3 X;  4O0A A;  2NTT A;  2GA4 B;  3AU7 A;  4R4T A;  3L2P A;  4MN3 A;  4A3B B;  3K7A H;  3TP6 A;  1TWC B;  2MO0 A;  4UPA A;  3D3R A;  2EYL A;  2Y0S E;  3MXN B;  1X55 A;  2MFI A;  3SK5 A;  4HJ5 A;  4K6D A;  3DLL A;  4AH6 A;  3S2D H;  4LFC L;  1PRT D;  5K36 H;  1JE4 A;  2PQE A;  4C3H B;  2QF7 A;  2LXJ A;  2ZXR A;  1OXV A;  1HR0 Q;  3A5U A;  1LLR D;  1ZXT A;  1HNZ Q;  2F0U A;  1E7Z A;  1QB5 D;  2E2I B;  1I6V C;  1XTD A;  4X66 L;  4FDB A;  4IZ8 A;  1CI3 M;  2I5H A;  2IW3 A;  4IAL A;  4DR5 Q;  1VQ4 A;  4FNF A;  3GTJ H;  3I4M H;  4A3D G;  1E1O A;  3TN2 A;  3A0J A;  1VQ9 A;  2BE5 D;  2EJF C;  3QWN A;  4TRD A;  3KJO A;  3J7A V;  3PUW A;  4DR1 L;  2A68 C;  1FR3 A;  4JBJ A;  3A56 A;  4A3E H;  4DKA C;  4QUF A;  2A74 C;  2E75 C;  3NBH B;  1D8L A;  2FJ2 A;  1WTV A;  4G4K A;  2R61 A;  1MSG A;  4NKL A;  1BNZ A;  1MGS A;  1ZEQ X;  1GHK A;  2JEB I;  1FYC A;  2UUC L;  5K5P A;  1STA A;  1PTO D;  4RAU C;  2K1B A;  1Q8K A;  4RA8 A;  3KBG A;  1EYG A;  3DMU A;  2JK8 A;  1AEX A;  2Q2U A;  4X64 L;  2AWO A;  3IFT A;  4ZYS A;  1HZC A;  4QQB X;  3GTG B;  2EY5 A;  1EL0 A;  1VQK A;  1L0X B;  1Y1W H;  4TSS A;  5JVH 3;  3ZJY C;  2ZJP A;  4NMZ A;  1GVP A;  4DV3 Q;  1CUK A;  4LFA Q;  4DR7 L;  2ATW A;  2SNS A;  3UDI A;  2EVB A;  4AIM A;  4AYB G;  4IFD H;  1BVS A;  4EQ5 A;  1LT5 D;  3RN2 A;  2PZT A;  2WAC A;  4RHS A;  3A54 A;  3BYY B;  3H15 A;  3GV3 A;  3G7L A;  1E2Z A;  5C0X H;  5EJW A;  4LFB L;  1G91 A;  1TKW B;  1HZ9 A;  3PGZ A;  3OYY A;  1K3B C;  3H91 A;  2JA5 H;  2VS1 A;  1KRS A;  2HUG A;  4LF5 Q;  1Q1B A;  1CKN A;  4A3M B;  3LWE A;  3M7N A;  2IX1 A;  3OPO A;  1XNR Q;  1E1T A;  4DAY B;  4NXM L;  3A5Z B;  1SSO A;  4O2D A;  1ET9 A;  1B8A A;  1UUP A;  4WOR A;  3CC4 A;  4UHV A;  3GD7 A;  5FLX c;  5IOD A;  4L5S A;  3JC6 6;  3S14 B;  4LF4 Q;  2NN6 G;  4KY7 A;  3PO3 H;  5M5W H;  4GLX A;  1XMO Q;  1G6Z A;  1STE A;  2O5J C;  4LNQ A;  2FMM A;  4ZUJ A;  4QGU A;  2ZT9 C;  1C4Q A;  4V19 0;  1VF7 A;  4B3S Q;  3KF6 B;  4M1U B;  1HQR D;  3IAY A;  4ZK9 B;  1LT3 D;  1U4P A;  1YNJ C;  4RH6 A;  3GTO H;  2F0L A;  4A3F H;  1A8V A;  3DWQ A;  1BKB A;  1XXG A;  3E9I A;  4CDE C;  3E3X A;  1FD7 D;  5FJ8 H;  4LF9 Q;  3I7F A;  3VR2 A;  2JA9 A;  1H9J A;  1PH3 A;  1FNW A;  2KBN A;  2NBF A;  1V43 A;  2NUC A;  3V2T A;  4NPS A;  2XNA C;  1CQF A;  3H0G B;  2JA8 B;  4N9P A;  3M3Y B;  4FXG C;  2B2V C;  1DOM A;  4QJF A;  3GTM B;  4HTH A;  4N8X 1;  4I7A A;  3K80 C;  5LL6 S;  4NDX A;  1RF2 D;  2PMZ E;  1K28 A;  5C4X B;  4B3M Q;  3E0J A;  2EJG C;  2Y0S G;  1WYD A;  1LTR D;  1FJG L;  3L9A X;  2RSN A;  1G2S A;  1G29 1;  4RG1 A;  2B2V A;  3S1M B;  2DY8 A;  2YYZ A;  3MFY A;  4GN3 B;  4Y7N B;  1ESF A;  4L8J A;  1L2F A;  1I50 H;  1LTS D;  4K8J A;  5I6Y A;  2F3W A;  3FKI H;  1HZB A;  4G7Z C;  4IOC A;  4MTK A;  1JT8 A;  3Q22 A;  3OOC A;  1EOV A;  3DUZ A;  4Q5V A;  1VQJ A;  3OMG A;  5IGG A;  4BY1 H;  4FF4 A;  1QVC A;  1VQN A;  1BR9 A;  3DWA A;  4ZLT F;  4A3L H;  2LSS A;  3HKS A;  4K2L A;  2WB1 B;  1AE3 A;  3J80 L;  1SRU A;  2XIW A;  1Y1V H;  4XYO A;  2DNC A;  3HKZ E;  1ASY A;  2JA6 G;  2E2J B;  3K6O A;  1Q90 A;  1V8Q A;  1X56 A;  1HNZ L;  4DPG A;  1IBM Q;  1IYV A;  3FEW X;  2L12 A;  3VYR A;  4LWC A;  2EXD A;  4ZKB B;  3M4O B;  2Z6B A;  1HNW Q;  2Z1C A;  4LUZ A;  4S3S A;  4A3J H;  2K5W A;  2F0Q A;  1WD0 A;  1LM0 A;  3GP7 A;  3X3M A;  2I46 A;  5IIF A;  3S15 B;  4PMB A;  2JE6 I;  5JPM C;  2VUM G;  3M4Q A;  1B53 A;  1SNO A;  3K5O A;  3L7Z C;  1DZ1 A;  5IGD A;  5DM6 3;  4B3T Q;  3QOL A;  2SEB D;  3GTL H;  3AQQ A;  1PH4 A;  1Q12 A;  5FLM G;  1H95 A;  3WOF A;  1WTO A;  3VA5 A;  5COY A;  4EQN A;  1K8O A;  1I4P A;  1T5X D;  4X6A H;  2LFN A;  3M4Y A;  2NVX H;  4QCL A;  3NP8 A;  4DFA A;  5FLX E;  4R4O A;  1XPO A;  1U4M A;  3AFQ A;  4IUV A;  1T9H A;  3CRK C;  2ZM6 L;  4KKS A;  3GTQ B;  4Q0F A;  2R93 B;  4DR2 Q;  2CH4 W;  3N6R A;  4JK1 C;  3RLF A;  1HZA A;  5KNC A;  4FF3 A;  2CWP A;  1U0L A;  3SVM A;  2VY3 A;  3LWU A;  1CK1 A;  4OON A;  1G51 A;  1JB7 A;  1H9S B;  1N9W A;  4KN7 C;  1TQO A;  3UDF A;  1LV9 A;  4A3K G;  2AQ2 B;  2DGY A;  1YNX A;  1TWH B;  2XWJ B;  3MA2 B;  1X54 A;  3BVZ A;  4B3R Q;  1F9P A;  3VYS A;  4C1N K;  4H7B A;  4IO9 A;  1KNE A;  3I91 A;  2B2W C;  2F0D A;  3O13 A;  4JCV E;  1AN8 A;  1UEB A;  4A3D H;  4C3H G;  4LF5 L;  4OIJ A;  2R7D A;  4X62 Q;  4A93 H;  3D4D A;  2F4V L;  3SHL A;  2EYP A;  1XNR L;  2FFK B;  1EWH A;  2BA1 A;  3W5O A;  3MWY W;  2H1E A;  5C4J B;  2Q8R E;  1PH9 A;  3AFP A;  1L0W A;  2DJF C;  2PQA B;  4A76 A;  4DUZ L;  4LF4 L;  1LTT D;  2JYO A;  1F2L A;  1PH5 A;  4HR7 B;  1XMQ Q;  5KEE A;  1IYU A;  1N34 Q;  3G71 A;  1HJP A;  3BU2 A;  3NHH A;  3NK9 A;  3VR6 A;  5DAU A;  2IPK D;  3QJY A;  3ER0 A;  1O7L A;  5I4D A;  4JI8 L;  4EVO A;  1UE7 A;  2RCN A;  4YHH L;  3D6C A;  1F9Q A;  3CCU A;  1KTK A;  2DUD A;  5D3D A;  5CV6 A;  5EPL A;  2VQE Q;  4L5R C;  1V1O A;  3F2D A;  4BBR B;  3C3L A;  2XRS D;  3OIP A;  1VQM A;  4H13 C;  1QWY A;  1KDA A;  4JI0 L;  3R8B A;  3AYH B;  4DUY Q;  1FGB D;  1M4V A;  2M2L A;  3A55 A;  3AB9 A;  4JI4 Q;  2IY5 B;  1EWI A;  1IBK Q;  3OWE B;  4LF9 L;  5D14 A;  2K28 A;  1X3P A;  1B2T A;  1CM9 A;  3HOY G;  4FVM A;  1Y8N B;  2E74 C;  3MXN A;  2KUM A;  1WTQ A;  4P73 A;  5CV7 A;  3Q23 A;  1AH9 A;  5GAD C;  2A69 C;  4A3G G;  1PH1 A;  4OIK A;  1IBL L;  3I4N B;  3TRZ A;  4O1N A;  1YHQ A;  3HOV B;  5CGK A;  4I65 A;  2OEO A;  4JI6 Q;  2R92 G;  5CV4 A;  3HKZ G;  4IQZ A;  4PZ7 A;  5EPJ A;  2Z9H A;  4NW2 A;  1VQ7 A;  4EGV A;  2IJ0 A;  2NN6 H;  1GXD C;  3UI2 A;  3FVQ A;  1BCP D;  3GO5 A;  3BJU A;  1GUG A;  5NUC A;  1FL0 A;  2H5X A;  3GV6 A;  1W3S A;  1SNM A;  1YNN C;  2K4K A;  3NBH A;  4CJ2 C;  1QVF A;  1EIF A;  2QKI C;  4X66 Q;  4BY7 B;  1FNU A;  3VYT A;  3H3V H;  2EY1 A;  5M3M G;  1AP0 A;  1DYQ A;  4JI1 L;  1IBM L;  1JB3 A;  4TKO B;  2CVR A;  1MBY A;  3PUX A;  1C0A A;  1UWV A;  1HNW L;  4DR1 Q;  4YCV A;  1FNV A;  1KAW A;  3CCV A;  4DN4 M;  2K5Q A;  2L15 A;  4XT1 B;  1PFM A;  1HH2 P;  4DK0 A;  2XN9 C;  2NZ1 D;  5CV8 A;  3D4R A;  2RBM A;  1H9M A;  4EQP A;  3J81 L;  1CKM A;  5H1S E;  5A35 A;  1J5E L;  4GNX C;  1MJC A;  1JJG A;  3KYH C;  1WCM H;  3EN2 A;  3CCS A;  2GVB A;  2JSO A;  1SRO A;  1Q82 C;  3J7Z C;  2HHH L;  3MC0 B;  4UP8 A;  4X64 Q;  4KKU A;  1DOL A;  4WFN 3;  3KLS X;  3GDE A;  1SYE A;  1S4Z A;  2ICE C;  2K5V A;  2JA7 G;  3CF5 A;  1U4L A;  2MO1 A;  2K7V A;  2I07 B;  2WV6 D;  1VF5 C;  3SGI A;  2K50 A;  3U50 C;  4DAY A;  1GM5 A;  3K57 A;  2EOT A;  3E0E A;  3C1F A;  4DR2 L;  1C48 A;  2B8F A;  2QEJ C;  2SDF A;  3LNN A;  1NMF A;  2DNE A;  2WIN B;  3HOX B;  1LTI D;  2CCZ A;  3K5N A;  2PI2 A;  5CR3 A;  4CDD C;  2JA6 H;  3F1Z A;  3OHX C;  2B8G A;  1EFW A;  1EWC A;  2HT1 A;  1FVI A;  2D5D A;  3A8J E;  2JN4 A;  2L55 A;  3S2H B;  1A3U A;  3KLR A;  1VQF A;  5JJK A;  4B3R L;  1DD2 A;  3K59 A;  4HMJ A;  2RDF A;  3QG1 A;  1BXT A;  3NSW A;  3MXU A;  1R9T H;  4NXM Q;  3S24 A;  3KF6 A;  1I6H B;  3SEB A;  4H44 C;  1C7Y A;  4DAV A;  3R2T A;  1WCM B;  4KD4 A;  2LS0 1;  4PZ8 A;  5G3L D;  2BA0 A;  2F0M A;  3MTS A;  2JEA I;  3H09 A;  2KHJ A;  2VUM H;  3S1Q H;  1K3R A;  2BH2 A;  1JC7 A;  2L9H A;  2RHQ B;  1Z7T A;  3PCO B;  2C35 B;  1MD2 D;  1YBY A;  2NVY H;  4MTN A;  5FLM H;  1N34 L;  3J7A F;  2CKZ B;  5IT9 L;  4ID6 A;  3F8T A;  1NE3 A;  3HOU B;  1A15 A;  1I94 L;  5ELO A;  3H6M A;  1EIG A;  4M8A A;  4XQJ A;  3CCQ A;  2KCT A;  2B2T A;  3QB3 A;  2QGQ A;  2B2U A;  1J8I A;  1K83 H;  1QOH A;  2ZJQ A;  3GTP B;  3ULL A;  4GN4 B;  4RHR A;  2HDL A;  5ELF A;  4DUY L;  5DEH A;  1TWF B;  2RQX A;  1ILP A;  1WOC A;  4JI4 L;  3PUV A;  3FHW A;  4A3K H;  3F2U A;  1RD9 D;  5DNF A;  1NTG A;  2R7Z G;  4KD3 A;  3MEF A;  4NXN L;  1PZJ D;  1FJG Q;  1GUS A;  2R3Z A;  5CV9 A;  1VQE A;  1FGU A;  1JOK A;  2HIV A;  1S5E D;  4EX5 A;  1LUZ A;  3IL8 A;  5E1F A;  1NBW A;  2F3I A;  2Q8I B;  4ZQ3 A;  1TVX A;  2VW9 A;  5ELD A;  3ULP A;  3G4S A;  1DM0 B;  3HFZ B;  1TXY A;  5AJ3 L;  2B2Y A;  1HFN A;  1IW7 C;  3NBI A;  4CGY B;  4WJ3 M;  3FPU B;  5KYI A;  1PH7 A;  4HAE A;  4GN5 A;  4JYA L;  1KDB A;  5JJZ A;  5GQO A;  4DK3 C;  3RLN A;  4C2M H;  5LMU L;  4K14 A;  2WAQ B;  4K2K A;  1BDO A;  2HIX A;  3CCJ A;  3Q8D A;  3S17 B;  3GTK B;  1Q8I A;  5FOB B;  1HA5 A;  2NVQ H;  3HOW B;  4OWW B;  2JQO A;  2ASB A;  4LJZ C;  1SE3 A;  4BBS H;  1AZQ A;  3UDG A;  1B7Y B;  3CME A;  2KCM A;  4DR4 L;  4IPH A;  3CCE A;  3HOY H;  2K5D A;  4DR3 Q;  1B70 B;  1F2Z A;  4MIU A;  3AMU A;  1YVC A;  1WVL A;  4RKL A;  4ILW A;  1IZ6 A;  5I9O A;  4YWL A;  1H9S A;  4A3G H;  1EEF D;  5M5X H;  3OW2 A;  1JOQ A;  2K33 A;  3K7A B;  5IYB G;  4A3I G;  2K32 A;  2R92 H;  3BZC A;  2K04 A;  2HQE A;  5KNB A;  1MSH A;  4IUT A;  5C3E G;  3J7A 5;  3S2D B;  1GJX A;  1V1P B;  2ZM6 Q;  3K5L A;  2J0T D;  1STG A;  1C9O A;  3VR4 A;  3CC2 A;  4F8M A;  1EY8 A;  2ENB A;  1PDQ A;  2RSO A;  1SMX A;  1KAB A;  2MNA A;  2NVQ B;  4DNT B;  1JMC A;  1O7Y A;  3EFX D;  2N88 A;  3MHB A;  2JJQ A;  2IHF A;  2PQA A;  4KV6 A;  3GTJ B;  4C3J G;  3I4M B;  1VQG A;  4JI2 L;  1YHB A;  2ICI A;  2M9V A;  3OMC A;  1SBB B;  2A6E C;  2KCC A;  3I8Z A;  4P74 A;  4C3I G;  5M3M H;  4A3E B;  2EJM A;  4CKC A;  3NXW A;  4GNX B;  4NB3 A;  5M3F G;  3RZD H;  1H9K A;  2F4V Q;  1EQQ A;  5T1G A;  4WJW A;  1SE4 A;  1CZG A;  2LY7 A;  2CFM A;  2KJX A;  3TZU A;  1GUW A;  1L1O C;  3KK7 A;  1TR5 A;  1VQB A;  5COR A;  5CC4 A;  4RGT A;  3NWT A;  4DUZ Q;  4BS9 A;  1PTO H;  1QE6 A;  3E5S A;  1UNS A;  3ONA B;  3CW2 C;  5LMN L;  5C44 G;  1ET6 A;  3K5M A;  2J4X A;  5IYC G;  4QL5 A;  1YIT A;  2RF4 A;  1Y1W B;  1KD1 C;  5DLQ E;  4QMG A;  4L5Q A;  1XNQ L;  1EIY B;  4OWT B;  3S9W A;  1IHZ A;  3IFD A;  4JI8 Q;  1VMP A;  4YHH Q;  3D4W A;  3J80 i;  2N78 A;  2WAQ E;  1CZW A;  1CSP A;  1S3O A;  3S1N H;  2JA7 H;  2Q2H A;  4ZRZ A;  2UXD Q;  2NVT H;  5LHY 1;  2KQ3 A;  4JI0 Q;  3I3C A;  3ERS X;  5JAV A;  2MUY A;  3K7U C;  2KEN A;  4RGM A;  2EY6 A;  4MZ9 A;  1BOS A;  1WTP A;  5JJL A;  4N9T A;  2JA5 B;  2GVA A;  1N36 Q;  4A3C G;  1HQM C;  4DA2 A;  1BF4 A;  3W1B A;  1WJJ A;  4CHT B;  3RZD B;  1X9N A;  1K8G A;  2TMP A;  4O42 A;  4LF8 L;  3HGB A;  4U67 3;  2KVM A;  4GKK Q;  1SND A;  2A8V A;  1SYF A;  3SK8 A;  1B44 D;  1RTN A;  5KRU A;  1R4P B;  3V96 A;  2IWH A;  4RFB A;  3U4Z A;  4KI0 A;  4IUQ A;  1CA5 A;  1IBL Q;  2B63 G;  2GN5 A;  2IX0 A;  1K73 C;  4NP5 A;  1GHJ A;  3PO3 B;  5M5W B;  5EBD A;  1YI2 A;  4JBK A;  3CPF A;  1VMC A;  3NTI A;  5BR8 Q;  2VQF L;  4HMI A;  2CQA A;  4F88 A;  5JVG 3;  3RZO H;  2MPM A;  4KHV A;  5D65 A;  4OXP A;  4HCS A;  1KNA A;  4LAA A;  1S72 A;  4JI7 L;  3QIA A;  1SYG A;  2A68 D;  1TU2 B;  1JIC A;  2RDG A;  1EU3 A;  3GTO B;  4A3F B;  4JG2 A;  2UXB Q;  4YWK A;  1CHP D;  1S5B D;  3MXP A;  3MXG A;  2PZU A;  4CKB A;  1EQV A;  1E2V A;  3T56 B;  1AE2 A;  4OO1 I;  2PZW A;  1N33 Q;  1EYD A;  3PO2 G;  1G8Z D;  5C0X I;  4JI1 Q;  5GAH C;  3BYT B;  1NJI C;  3H3V C;  1Z47 A;  1KDC A;  2YTV A;  1A2T A;  2ZXP A;  3TZD A;  3VYU A;  1DCZ A;  4Z9C B;  1VQH A;  5IP9 G;  4FF1 A;  5KND A;  3BVM A;  3P75 A;  5FLX L;  3C2P A;  1SYB A;  4YWM A;  2L11 A;  3UE0 A;  4J15 A;  1W6K A;  1S5C D;  3NQI A;  1I50 B;  4DR3 L;  2R7Z H;  1J5E Q;  2PI2 E;  4BA2 I;  3FKI B;  1H9R A;  1E24 A;  3HOZ G;  5E4W C;  1PV4 A;  1A6X A;  4BY1 B;  2HHH Q;  4X3S A;  4XQQ A;  1SJH D;  2AWN A;  2UUA Q;  4K0K Q;  1U4R A;  3BZK A;  5CYU A;  1PFN A;  1ZKO A;  1Y1V B;  1F2M A;  1F9R A;  1PVO A;  3KF8 B;  5FO9 B;  1JOR A;  2XWB B;  1WI5 A;  2J7Z A;  4P2C B;  3BDC A;  1EY5 A;  5EKK A;  3I72 A;  1UE6 A;  2G9H D;  4JVZ A;  1PYS B;  1JJC B;  3QO2 A;  1EZ6 A;  1W6J A;  1Q3L A;  1RJT A;  2EYM A;  2N49 A;  1F9S A;  2Q2I A;  1QIL A;  2CW0 C;  4A3J B;  5IOC A;  3CC7 A;  4GLA C;  5J3B A;  1EFI D;  1B1Z A;  1WTH A;  4A3B G;  5C5M A;  2YU9 H;  3GQB A;  5A2Q E;  3D0F A;  1O7I A;  4C56 C;  2KHI A;  4OEL B;  2X69 A;  5L37 A;  3NTH A;  5BN4 A;  1V1Q A;  3JAM c;  2VNU D;  2F0J A;  3IKJ A;  1A0I A;  1YNJ D;  3GTL B;  1O7Z A;  4LF7 L;  2Q2T A;  1R4Q B;  2E5L L;  4G7O C;  2L0C A;  4GOP C;  3RMH A;  1ROD A;  4LF6 L;  2ALY B;  3P7J A;  2NZH A;  2YTX A;  2B2W A;  5CBA E;  3A8K E;  2KEC A;  1KIX A;  1X6O A;  2NVX B;  1F2Y A;  1ILQ A;  5IGE A;  4E6I A;  4JI3 L;  5IYB H;  4A3I H;  2M00 A;  2WB1 E;  3ICE A;  1SJE D;  3EVQ A;  1P8L A;  2WKD A;  1I94 Q;  2ES2 A;  1HA6 A;  5C3E H;  2E2D C;  2E8G A;  1QZG A;  3NEM A;  2A19 A;  2K01 A;  3TRE A;  2F0T A;  3K0Y A;  4KJN A;  2TSS A;  1LTL A;  1S5F D;  3DHQ A;  1PH8 A;  2F3V A;  2UXD L;  2A5H A;  1BUV T;  1TWG H;  3TEH B;  4DAM A;  2HCC A;  4JOI C;  2A1A A;  5ELB A;  2F0W A;  5E3F A;  1D1K A;  5HUR A;  1LTG D;  1RIP A;  2EIF A;  4C3J H;  3CU7 A;  1N36 L;  3CD6 A;  4A3D B;  1D5M C;  4PV1 C;  4A93 B;  1PZI D;  1ZYR C;  1EYC A;  3I73 A;  1L1O B;  3MZ5 A;  3M4P A;  4NXN Q;  4C3I H;  4GKK L;  1E3P A;  2WP8 J;  2EXZ A;  3QR8 A;  2PW7 A;  3TME A;  2AUJ D;  2F0F A;  3J81 i;  2V4D A;  5M3F H;  5JOB A;  3VR3 A;  1JWU D;  4DV7 L;  3DM1 A;  5C6A A;  4DGZ A;  2AUK A;  4DV5 L;  3OW7 A;  1RKN A;  2A6H C;  2HCI A;  2Q8T A;  5DM7 3;  5AJ3 Q;  3KJP A;  5BR8 L;  1YZ6 A;  3R93 A;  2F0G A;  3NEL A;  1PMR A;  1YJ9 A;  3TDQ A;  5C44 H;  1ONL A;  1QUQ B;  5IYC H;  1NAP A;  2K14 A;  1UE5 A;  2Z6K C;  5LMN W;  4A3M G;  4JYA Q;  5IY0 A;  3T16 A;  3HRZ C;  1JOO A;  3IRB A;  4QIW B;  4AYB B;  4A4I A;  5LMU Q;  2UXB L;  4CKE A;  1VQP A;  1TS4 A;  1GUT A;  3STB C;  3R3O A;  3W2D A;  1TWA H;  3SXH A;  2Z6K A; 
#chains in the Genus database with same CATH homology
 3M7N A;  4GKJ L;  2IX1 A;  4DK6 C;  1XNR Q;  1N33 L;  1E1T A;  4DAY B;  4NXM L;  1P16 A;  3A5Z B;  1VCI A;  2EQS A;  4O2D A;  1B8A A;  1S40 A;  4JBM A;  1N32 L;  3CC4 A;  1NTG A;  3GD7 A;  5FLX c;  4L5S A;  2R7Z G;  5C4J H;  3JC6 6;  5IE8 A;  3MEF A;  4UP7 A;  4NXN L;  4A3C H;  1OXT A;  4DR4 Q;  4LF4 Q;  1FJG Q;  2NN6 G;  1VQE A;  4LW1 A;  1FGU A;  3PO3 H;  2HIV A;  5M5W H;  4OO1 G;  5IP7 H;  4EX5 A;  1LUZ A;  4GLX A;  1PA6 A;  2UUB L;  1KC8 C;  1IYJ B;  1XMO Q;  1NBW A;  2F3I A;  2VW9 A;  4LNQ A;  3ULP A;  3G4S A;  3HFZ B;  4DV3 L;  3PF5 A;  2N3S A;  3I4O A;  4QGU A;  1TXY A;  2CWA A;  2FXQ A;  5AJ3 L;  2B63 H;  4LFA L;  1Q46 A;  4B3S Q;  2WAQ G;  4YCU A;  3KF6 B;  4IPC A;  4WJ3 M;  1GD7 A;  4DV0 Q;  1UE1 A;  1X3F A;  1PH7 A;  3U4V A;  3H0G G;  4BBR H;  2XGT A;  4RMF A;  1OXU A;  4JI5 L;  3PV0 A;  4GN5 A;  4A3F H;  2JA8 G;  4MNO A;  3GTO H;  2AKW B;  3CCL A;  4JYA L;  1A8V A;  3D31 A;  1BKB A;  5GQO A;  4DK3 C;  4JV5 Q;  3E9I A;  2UXC Q;  3HOW G;  3RLN A;  4IOA A;  2I5M X;  2UUA L;  4K0K L;  3K0X A;  4HID A;  4C2M H;  5FJ8 H;  3M85 A;  4LF9 Q;  3I7F A;  5LMU L;  4GNX A;  5C4X G;  2JA9 A;  2E2H H;  1PH3 A;  2KBN A;  1V43 A;  2HIX A;  5M5Y H;  4NPS A;  3CCJ A;  4BXX G;  3Q8D A;  4DV1 L;  3PO3 G;  1J6Q A;  4GOP A;  1WFQ A;  3G48 A;  1HNX Q;  1OXS C;  4QJF A;  2NVQ H;  4P71 A;  4OWW B;  2JQO A;  1NMG A;  3K80 C;  2ASB A;  2PMZ E;  4BBS H;  4B3M Q;  4A75 A;  4JI2 Q;  1K0R A;  2Y0S G;  1B7Y B;  3UDG A;  3CME A;  1X65 A;  3KLW A;  1WYD A;  2KCM A;  2N8N A;  4DR4 L;  1PH6 A;  1QVG A;  1FJG L;  2R7F A;  4IPH A;  3I4N H;  3PO2 H;  3CCE A;  3HOV H;  1G29 1;  3JAM i;  4RG1 A;  3HOY H;  3TQY A;  3S1N H;  2YYZ A;  3J81 c;  4GN3 B;  4DR3 Q;  3W1G A;  1B70 B;  1U5K A;  1L2F A;  1I50 H;  1KXL A;  1XMO L;  3KDF A;  1YVC A;  2WB1 G;  3PUZ A;  4HJA A;  1KL9 A;  2ZTC A;  3PIO A;  3FKI H;  1YIJ A;  1HZB A;  1IL2 A;  1IZ6 A;  4IOC A;  5K36 G;  2UU9 Q;  1JT8 A;  4YWL A;  3A74 A;  2QEX A;  5FJ8 G;  5IP9 H;  1EOV A;  4A3G H;  1CKN B;  5M5X H;  1VQJ A;  3OW2 A;  3LGJ A;  5IYB G;  4A3I G;  3EIV A;  3RN5 A;  4B3S L;  4JOI A;  4BY1 H;  3BZC A;  2R92 H;  1QVC A;  4YY3 Q;  1VQN A;  4QY7 A;  4DV0 L;  3T1H Q;  2LSS A;  2PNH A;  4DV6 Q;  4A3L H;  3TS0 A;  5LMN Q;  3HKS A;  4R1J A;  1AE3 A;  1EQR A;  3KOJ A;  5IYD G;  5C3E G;  1K9M C;  3J7A 5;  2WFW A;  4DV4 L;  4BBS G;  1SRU A;  4JV5 L;  1YJN A;  4ALP A;  1KHI A;  3HOZ H;  1XNQ Q;  2ZM6 Q;  1Y1V H;  4IFD J;  3I4M G;  3CC2 A;  1C9O A;  3HKZ E;  1ASY A;  2JA6 G;  4BY7 H;  4OX9 Q;  1HNZ L;  1X56 A;  4DPG A;  1IBM Q;  1SMX A;  4LUV A;  5E7N A;  1MJE A;  2MNA A;  5C0X J;  4LWC A;  2EXD A;  4A3E G;  3CXC A;  1PHJ A;  1JMC A;  3K81 C;  5IWA Q;  5JEA G;  2JJQ A;  3CMA A;  2IHF A;  2PQA A;  1HNW Q;  4R4Q A;  4LUZ A;  4A3J H;  1X3G A;  1VQG A;  4B3M L;  4GLV B;  3CQZ H;  3J81 j;  4JI2 L;  1LM0 A;  1YHB A;  2OQ0 A;  3S16 H;  2V1C C;  3K8A A;  4DR6 Q;  1SE8 A;  4P74 A;  1VS0 A;  2JE6 I;  5M3M H;  3OTO Q;  1SFO H;  1ASZ A;  1VQ8 A;  2VUM G;  3M4Q A;  3S1R H;  1MKH A;  5HGQ A;  3UDX A;  3L7Z C;  4GNX B;  4NB3 A;  4LF8 Q;  1I3Q H;  5M3F G;  4B3T Q;  3RZD H;  2F4V Q;  1EQQ A;  1LYL A;  3GTL H;  3AQQ A;  1Y1W G;  2I0Q A;  4A3B H;  1A62 A;  2CFM A;  2MQH A;  5GRO A;  4GOP B;  1PH4 A;  1Q12 A;  1TWC H;  5FLM G;  1DGS A;  2R93 G;  1H95 A;  1L1O C;  1VQB A;  4KHZ A;  4LFC Q;  5ELN A;  4DUZ Q;  3T1H L;  4IFD G;  3CW2 C;  5LMN L;  4X6A H;  5C44 G;  4C3H H;  1VQ6 A;  2NVX H;  4BA1 I;  5IYC G;  2D62 A;  4QL5 A;  4R4O A;  4TQU S;  2RF4 A;  5IT9 c;  1YIT A;  5DLQ E;  4POF A;  3AFQ A;  2VQF Q;  1XPO A;  4L5Q A;  1KD1 C;  1T9H A;  5C0X G;  2ZM6 L;  1EIY B;  2R6G A;  4OWT B;  2E2I H;  1XNQ L;  2OQK A;  4JI8 Q;  3RR5 A;  4DR2 Q;  3FP9 A;  1PFS A;  4YHH Q;  3I2Z A;  4OX9 L;  3RLF A;  4JI7 Q;  1HZA A;  1Z9F A;  3KDF B;  3J80 i;  2N78 A;  2CWP A;  2WAQ E;  3T1Y Q;  4JBW A;  2F52 A;  1CSP A;  1S3O A;  1U0L A;  2B3G A;  2VY3 A;  2JA5 G;  4OON A;  2Q2H A;  2JA7 H;  3HOX H;  1KQS A;  1G51 A;  1JB7 A;  2UXD Q;  1N9W A;  2NVT H;  3UDF A;  2QA4 A;  2AMC B;  4LUO A;  1A63 A;  1YEZ A;  4A3K G;  1IXR A;  4JI0 Q;  3NEN A;  2DGY A;  3ERS X;  4XTC S;  2ZJR A;  1YNX A;  2ZTD A;  3K7U C;  5HY6 A;  2KEN A;  2LXK A;  1OXX K;  1X54 A;  3S2H H;  4MZ9 A;  4B3R Q;  4HJ7 A;  5JJL A;  4IO9 A;  2GVA A;  1N36 Q;  4DR6 L;  3OTO L;  4JC0 A;  4A3C G;  1I5F A;  1CSQ A;  4XIG S;  4JCV E;  3U58 A;  1QZH A;  1UEB A;  3W1B A;  1JE5 A;  1WJJ A;  2B29 A;  2VZA A;  1X9N A;  3DM3 A;  4A3D H;  1K8G A;  4LF5 L;  2UUC Q;  2R7D A;  1I6H H;  4X62 Q;  4LF8 L;  4A93 H;  4DV2 L;  5IP7 G;  4B3T L;  2F4V L;  4GKK Q;  2A8V A;  1XNR L;  3UE1 A;  2BA1 A;  3W5O A;  3ULJ A;  4A3K H;  1XJV A;  2BH8 A;  4IPG A;  3U4Z A;  1PH9 A;  3AFP A;  4KI0 A;  2OTJ A;  1L0W A;  1IBL Q;  2B63 G;  2GN5 A;  2PQA B;  2CQO A;  5JEA J;  2IX0 A;  4HJ8 A;  2ID0 A;  4PZ6 A;  4A76 A;  4DUZ L;  1K73 C;  4LF4 L;  2Z0S A;  3GTG H;  1YI2 A;  2ZTE A;  1Q7Y C;  1PH5 A;  4JBK A;  3CPF A;  4YCW A;  1XMQ Q;  1N34 Q;  4Y52 H;  3G6E A;  4BBR G;  3G71 A;  1HJP A;  4DR7 Q;  4A3F G;  3BU2 A;  5BR8 Q;  2VQF L;  3RLO A;  3RZO H;  1X3E A;  3ER0 A;  3CPW A;  4AQY Q;  4JI8 L;  1Q81 C;  4OXP A;  1UE7 A;  1SR3 A;  2RCN A;  4YHH L;  4HIK A;  3HOU H;  1S72 A;  4JI7 L;  3CCU A;  2OCE A;  4ME3 A;  2DUD A;  4P75 A;  3T1Y L;  4LFB Q;  2VQE Q;  4L5R C;  3F2D A;  1VQC A;  4A93 G;  1D7Q A;  1VQM A;  1K8A C;  4JG2 A;  2UXB Q;  5EAY A;  4YWK A;  3EBE A;  4JI0 L;  2IT1 A;  3AYH B;  4DNI A;  4DUY Q;  1HR0 W;  4APV A;  3GTP H;  1SLJ A;  4IJL A;  1G6P A;  2UXC L;  4JI4 Q;  2IY5 B;  1EWI A;  2NN6 I;  1YHA A;  1CKO A;  4KHP Q;  1TWF H;  1IBK Q;  1AE2 A;  4OO1 I;  2K5H A;  2OTL A;  4LF9 L;  1N33 Q;  4QIW E;  4A3M H;  1PYB A;  2YTY A;  4AYB E;  4GS3 A;  3I4N G;  3PO2 G;  5C0X I;  3HOV G;  4JI1 Q;  1SN8 A;  5GAH C;  3HOY G;  1VQ5 A;  1NJI C;  4X62 L;  1Y14 B;  4PG3 A;  1Z47 A;  5GAE C;  1HNX L;  1XPU A;  2YTV A;  3F2C A;  4P73 A;  4HJ9 A;  3S14 H;  2VL6 A;  3FKI G;  1AH9 A;  2I5L X;  5GAD C;  5IP9 G;  1VQH A;  4A3G G;  1PH1 A;  1IBL L;  3TRZ A;  4YWM A;  4IJH A;  3WWV A;  1YHQ A;  3H3V I;  3UE0 A;  4BY1 G;  4JI6 Q;  2R92 G;  4J15 A;  2K52 A;  1RL2 A;  2HQL A;  2D0P A;  3HKZ G;  4A3L G;  1XMQ L;  4DR3 L;  4PZ7 A;  2R7Z H;  2K5N A;  1J5E Q;  2PI2 E;  4BA2 I;  3CCR A;  1VQ7 A;  1BBW A;  4LF7 Q;  1MIU A;  4P72 A;  1E24 A;  1XPR A;  3I56 A;  3HOZ G;  4AQY L;  1PV4 A;  2E5L Q;  1Y1V G;  2UU9 L;  3GO5 A;  4UY8 C;  3J80 c;  3BJU A;  2HHH Q;  4LF6 Q;  4BY7 G;  2AHO B;  4X65 Q;  1FL0 A;  2AWN A;  2H5X A;  2VQE L;  2UUA Q;  4K0K Q;  4YY3 L;  3BZK A;  3STB D;  1W3S A;  4DV6 L;  1OTC A;  2IHE A;  3VDY A;  2K4K A;  4JI3 Q;  1QVF A;  1Q1E A;  1EIF A;  4A3J G;  4DV1 Q;  1PVO A;  3KF8 B;  4HIO A;  1WI5 A;  4X66 Q;  5JJI A;  4KHP L;  3F2B A;  1IBK L;  3H0G H;  2JA8 H;  3M3Y H;  1KRT A;  3H3V H;  3S17 H;  1L1O A;  1UE6 A;  4HIM A;  1JJ2 A;  3GTK H;  4KLK A;  1PYS B;  5M3M G;  3GTM H;  1JJC B;  4PMW A;  3B6Y A;  4JI1 L;  4OWX B;  1IBM L;  1VQL A;  3HOW H;  2K75 A;  3PUX A;  5C4X H;  1VQD A;  2N49 A;  2NZO A;  5IWA L;  1C0A A;  2Q2I A;  3CC7 A;  2YV5 A;  1UWV A;  1HNW L;  4DR1 Q;  4YCV A;  4GLA C;  5J3B A;  4BXX H;  4A3B G;  1KAW A;  3CCV A;  3CP0 A;  2YU9 H;  3S1M H;  3D0F A;  2L15 A;  4Y7N H;  1O7I A;  1HH2 P;  1M90 C;  2KHI A;  4JI6 L;  4IPD A;  1V1Q A;  3PSI A;  3JAM c;  4POG A;  4O0A A;  1CKM A;  5H1S E;  2VNU D;  1QUQ A;  1J5E L;  1A0I A;  4GNX C;  1MJC A;  1V9P A;  3RNU A;  4R4C A;  3KYH C;  1VQI A;  4R4T A;  1WCM H;  3L2P A;  4LF7 L;  1JJG A;  3EN2 A;  3CCS A;  2GVB A;  2Q2T A;  3K7A H;  1SRO A;  2E5L L;  2MO0 A;  2OWO A;  1Q82 C;  4GOP C;  4UPA A;  4TVA B;  2Y0S E;  3MXN B;  1X55 A;  2MFI A;  3J7Z C;  4HJ5 A;  2HHH L;  4LF6 L;  4WJ4 A;  4X65 L;  4UP8 A;  4X64 Q;  4DV4 Q;  2ALY B;  3DLL A;  2NZH A;  2YTX A;  1PH2 A;  3GDE A;  4AH6 A;  1KIX A;  3S2D H;  4LFC L;  1X6O A;  2K5V A;  4DV7 Q;  2JA7 G;  1BBU A;  3HOX G;  3CF5 A;  2LXJ A;  4DV5 Q;  1OXV A;  1HR0 Q;  3E9H A;  2MO1 A;  3A5U A;  1HNZ Q;  4JI3 L;  5IYB H;  4A3I H;  1E7Z A;  2E2J H;  2WB1 E;  3SGI A;  2K50 A;  3U50 C;  3ICE A;  1GM5 A;  1XTD A;  4X66 L;  3E0E A;  4FDB A;  1P8L A;  2I5H A;  1I94 Q;  3M9B A;  4DR2 L;  2ES2 A;  5IYD H;  5C3E H;  1QZG A;  2E8G A;  1VQA A;  4DR5 Q;  1VQ4 A;  3M4O H;  1NMF A;  3NEM A;  2A19 A;  3TRE A;  3GTJ H;  2CCZ A;  3I4M H;  1LTL A;  2PI2 A;  1E1O A;  1PH8 A;  4A3D G;  4UP9 A;  2JA6 H;  3F1Z A;  3A0J A;  1VQ9 A;  2UXD L;  1WCM G;  1TWG H;  1EFW A;  3KJO A;  2HT1 A;  3KFU A;  1FVI A;  3TEH B;  3PUW A;  4DAM A;  4DR1 L;  4JOI C;  2A1A A;  3S15 H;  4JBJ A;  4A3E H;  4DKA C;  4IFD I;  1VQF A;  5JJK A;  3PUY A;  4B3R L;  1N8R C;  1RIP A;  1D8L A;  3NBH B;  4GKJ Q;  2EIF A;  4C3J H;  1N36 L;  3CD6 A;  1R9T H;  4NXM Q;  3S24 A;  3KF6 A;  1C7Y A;  1N32 Q;  3PF4 A;  5GAG C;  2JEB I;  4PZ8 A;  2UUC L;  2BA0 A;  1L1O B;  3M4P A;  4NXN Q;  4C3I H;  2JEA I;  4GKK L;  1E3P A;  2WP8 J;  3TS2 A;  2RHS B;  2KHJ A;  1Q8K A;  2VUM H;  3S1Q H;  1K3R A;  3CAM A;  2XTI A;  1E22 A;  2BH2 A;  1EYG A;  1M1K C;  3PIP A;  2RHQ B;  3HOU G;  3J81 i;  2JK8 A;  3PCO B;  3CCM A;  5M3F H;  1YJW A;  2Q2U A;  4X64 L;  2UUB Q;  2AWO A;  2C35 B;  4QQB X;  1HZC A;  1GO3 E;  1VQK A;  4DV7 L;  1Y1W H;  3ZJY C;  1YBY A;  2NVY H;  4MTN A;  2ZJP A;  4DV5 L;  1HR0 L;  1GVP A;  3GTQ H;  4DV3 Q;  5FLM H;  2R93 H;  1CUK A;  5AJ3 Q;  1N34 L;  2CKZ B;  1NY4 A;  4LFA Q;  2ATW A;  3KJP A;  4DR7 L;  3UDI A;  1YZ6 A;  4AIM A;  4AYB G;  5BR8 L;  1Q86 C;  2D0O A;  3F8T A;  1NE3 A;  3NEL A;  1YJ9 A;  5C44 H;  1I94 L;  1BVS A;  4EQ5 A;  5ELO A;  1QUQ B;  5IYC H;  3RN2 A;  1GKH A;  4DR5 L;  4JI5 Q;  2K14 A;  1UE5 A;  2Z6K C;  5LMN W;  4A3M G;  4JYA Q;  3CCQ A;  5IY0 A;  3H15 A;  2KCT A;  2QGQ A;  4LFB L;  1TWH H;  1K83 H;  3IRB A;  3L0O A;  4R4I A;  2ZJQ A;  1HZ9 A;  3PGZ A;  3OYY A;  4A4I A;  5LMU Q;  2UXB L;  3ULL A;  4GN4 B;  4L5T A;  1W2B A;  1VQO A;  4DUY L;  2JA5 H;  1VQP A;  2VS1 A;  1KRS A;  3STB C;  4H02 A;  3I55 A;  4LF5 Q;  1WOC A;  1Q1B A;  1TWA H;  1CKN A;  3PUV A;  4DV2 Q;  4JI4 L;  2Z6K A;  3AEV A;  3FHW A;  1EUJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...