4KHPQ

Structure of the thermus thermophilus 30s ribosomal subunit in complex with de-6-msa-pactamycin
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
99
structure length
99
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a Bioactive Pactamycin Analog Bound to the 30S Ribosomal Subunit.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S Ribosomal RNA
total genus 22
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4khpQ00
5GQOA 4LF5Q 2F4VL 5GROA 1MIUA 2E2HH 4A3BG 1HZBA 4DV5L 2I0QA 1YJNA 3S17H 2R93G 4R1JA 4OWXB 4JG2A 2GVBA 4JI0Q 2NZOA 3L2PA 2CWPA 2B63H 2B63G 1BBUA 4L5SA 4GLAC 2UUCL 2NVTH 1E1OA 4LFAL 1VQDA 1T9HA 3U50C 3JAMc 4K0KQ 2UXDQ 2VS1A 2YU9H 3NENA 3BU2A 1YITA 3KLWA 1IXRA 1EWIA 3BZCA 2QA4A 2VQFQ 5LMNL 3M4PA 4A3LH 2Q2TA 3GDEA 3KOJA 4B3TQ 5K36G 2R7ZH 1G51A 4PMWA 3G6EA 3CMEA 5M3FG 3J81c 4DNIA 1VQJA 3MEFA 4MNOA 1XMQL 1N33Q 3TS2A 4X64Q 3KDFB 4TVAB 4AQYL 4EX5A 3E0EA 3CPFA 5LMUQ 4DV6Q 1VQAA 4JC0A 1QUQA 3GTKH 4YWLA 1IBLQ 4A3GH 2K5HA 3S2DH 1JMCA 2R7FA 3I56A 1XMOQ 1JJGA 1U5KA 2XTIA 4UP9A 4R4TA 4JI5L 3CCSA 1OXXK 3J81j 4P75A 2K4KA 2N78A 3F8TA 1TWFH 1I94Q 2E5LQ 2BH2A 4HIDA 2DUDA 5BR8Q 3OTOL 2OWOA 5IP9G 5IP9H 4A3KG 5IYDG 3OYYA 4NXNQ 3TREA 3JAMi 2AHOB 4XIGS 5IWAQ 2BA0A 3E9HA 1G6PA 4LF8Q 1CKNA 4C3IH 4R4IA 3CCUA 1NY4A 1VQOA 1SR3A 1I3QH 1J5EQ 4B3RL 1N32Q 3A0JA 4BBSG 1VQNA 3FP9A 3CCRA 5DLQE 4JV5L 2WB1G 1HR0L 3BJUA 4DR6Q 4DR3Q 1J6QA 4JBJA 3PCOB 1S40A 3S2HH 2MFIA 3CCJA 1LYLA 3UDXA 1FL0A 4DR2L 1Y1WH 5C4JH 3F1ZA 3S15H 2IX0A 3PIPA 1PH8A 4JV5Q 3KJPA 4LF6L 4GOPA 2WAQE 3K80C 3G48A 4P74A 1QVCA 3IRBA 5C0XI 4QQBX 1CKOA 2KCTA 2ID0A 4APVA 2ZJQA 1VQFA 2QGQA 1YHBA 1CSQA 2NVQH 2VZAA 3TS0A 1XTDA 4A3KH 2MO0A 4KHZA 1Q8KA 5M5YH 1N33L 3CMAA 1C7YA 3RLFA 5FJ8H 4P72A 1OXSC 4PZ6A 1YVCA 1PH4A 4OO1I 2Z0SA 4B3SL 4IO9A 1PH7A 2UU9L 4GKJL 1YBYA 3AFQA 3LGJA 3F2BA 4JBKA 5JJKA 4PZ8A 4EQ5A 1MKHA 1C0AA 1JE5A 4GLVB 4AYBE 4POFA 5M3FH 3HOVG 4JI2Q 4BY1H 5ELNA 2E5LL 2OTJA 2PI2E 3D0FA 2EXDA 2N3SA 2JQOA 1K83H 4XTCS 2K5VA 3FKIH 2UU9Q 1CSPA 2YTYA 4HJ8A 4B3SQ 5IYBG 1HJPA 1TWHH 2N49A 3RZDH 3TRZA 2AWOA 4Y52H 1EIFA 1A8VA 3UE0A 3T1YL 1NJIC 4B3TL 4OX9Q 1IL2A 2LXKA 1TWCH 2B3GA 1NBWA 4IPGA 3E9IA 1VQEA 3KJOA 1M90C 1HNZL 4JI6Q 2R7ZG 1E3PA 3CPWA 1BBWA 4DV2Q 3ULLA 3M7NA 3J7A5 2RF4A 1EUJA 1HNXL 3GTOH 4YHHL 4LF9L 3H0GH 1CKNB 4HJ9A 1K73C 3U4ZA 2Z6KC 1HNZQ 4IJHA 4DUZL 3KYHC 1QZGA 3T1HQ 2AMCB 4A3EG 3I4OA 2EIFA 3W5OA 4HIOA 5J3BA 3HOYG 2WAQG 4HJ7A 3S1MH 2JEAI 1AH9A 1WJJA 3EBEA 3S1RH 4OONA 4QL5A 1IBMQ 1ASYA 1Q7YC 1E7ZA 1X3EA 2H5XA 1XPOA 1KIXA 4LUOA 2RHSB 2JA6H 4B3RQ 1K8GA 3KDFA 5JJLA 5H1SE 4DUZQ 3RLNA 5AJ3L 2K14A 3ULPA 4A3LG 5FJ8G 4QGUA 2ZM6Q 3M85A 4LF9Q 3J80i 5GADC 4DR5Q 3S24A 1IBLL 2VUMG 5C4XH 2DGYA 3NELA 2IT1A 4IJLA 3CW2C 5GAHC 4A3FH 1PH5A 3WWVA 3RN5A 4A3DH 1HZ9A 4GKKL 3K81C 4RMFA 3KF8B 4X62L 4AQYQ 4X64L 1FVIA 2K52A 4ALPA 5FLXc 1PV4A 3GD7A 1AE3A 3L7ZC 4DV5Q 4GNXC 3H3VH 2NVYH 2ZJPA 2JA7G 3CCQA 4A3MH 2JK8A 2NN6I 4JI5Q 2UUCQ 3FHWA 1VQ5A 1N34Q 3U58A 1EYGA 4NXMQ 5IYCG 4OWWB 1KXLA 3STBD 1L0WA 3OTOQ 4YWMA 1XNRL 3FKIG 3F2DA 1NMFA 2YTVA 4JI8L 4DV2L 1AE2A 4YCUA 1HNWQ 3UDIA 2PNHA 2R6GA 3A5ZB 3D31A 3EIVA 2VQFL 1DGSA 4JI3Q 3RZOH 3M9BA 5C3EG 1Q86C 4DR4L 1YHQA 4BXXG 4IOCA 2PMZE 4QY7A 4IPDA 1EFWA 2KENA 3UE1A 1FGUA 1QVFA 4R4QA 1N36Q 2UUAL 1PVOA 3I4NG 4IFDG 4X6AH 2L15A 4A3JH 2NVXH 4LFBL 1VQ4A 4DV3L 4A3CG 5LMNW 2Y0SG 3K7AH 1XPUA 1E22A 2OQKA 4YWKA 2VQEQ 1MJCA 1JJCB 2HIVA 2E2JH 4JI4L 3ER0A 1L1OB 1YIJA 3KFUA 3PSIA 1I50H 2LXJA 1B8AA 3PO2H 2PQAA 4DAMA 1SROA 4DV4Q 1UEBA 4IPHA 4L5RC 2RHQB 3NEMA 2ZTEA 4LFBQ 2YTXA 3UDFA 4JI6L 4DV7L 3K8AA 1A63A 3GTQH 1K8AC 3GTGH 1BKBA 3PUVA 1NTGA 1XJVA 3G71A 2Q2HA 1KL9A 1B7YB 2VNUD 3RLOA 5HGQA 2UXBL 4DV4L 1EQRA 3L0OA 3I2ZA 1P8LA 5IE8A 3HOUH 1LTLA 3ICEA 4BY7H 1C9OA 3J80c 3AEVA 4IOAA 2A1AA 3PO3G 1Y1VG 1FJGL 4A93H 1YJ9A 1S72A 1XNRQ 4JI4Q 4OO1G 5IY0A 3CCVA 2GN5A 4BA1I 3G4SA 4NXML 2QEXA 3HKSA 3PGZA 1KQSA 2CCZA 3GTMH 3PUZA 4HJAA 1K0RA 1YNXA 2K5NA 3CAMA 4DUYL 3AQQA 1VQGA 2KHIA 4JI7Q 2HQLA 2WB1E 4X65L 1FJGQ 3PO3H 4O2DA 4BY7G 4PZ7A 1OXUA 2MNAA 1XMOL 1KC8C 4BY1G 3I7FA 3PIOA 4JBWA 4R4CA 4A3IG 1M1KC 1KRSA 4J15A 5M3MH 3H15A 2EQSA 2WFWA 3I4MH 4AIMA 3S14H 4DUYQ 2ATWA 1X3FA 4X66Q 4A3GG 4YY3L 1UE7A 1X3GA 1VQ7A 1VQ6A 3HOWH 2VY3A 3CXCA 1L2FA 4DR1L 1PYBA 2C35B 4LWCA 3HOWG 4GN3B 1XNQQ 4OXPA 3Q8DA 4WJ4A 1BVSA 4B3MQ 4DAYB 1K9MC 4JI1Q 2Q2UA 1GM5A 4DPGA 1RL2A 4A75A 1N34L 5C44H 5C44G 1HNWL 1OXVA 4A3JG 1WFQA 1U0LA 4KI0A 5FLMG 3I4NH 3CQZH 1N8RC 1S3OA 3TQYA 2ASBA 5GAGC 1HZCA 4MZ9A 4YCWA 3CC7A 3DM3A 1Y14B 2D62A 4QJFA 4DV0Q 2R92G 4BXXH 2ZTDA 2FXQA 4JI3L 3RN2A 1E1TA 2A19A 2I5MX 4UP7A 5C0XJ 4JYAQ 1VCIA 1UE1A 4LF7Q 4LFCL 2VQEL 2MQHA 3K7UC 3KF6A 1R9TH 1HZAA 3TEHB 1VQHA 4GKKQ 4DV0L 3GTPH 3HOXH 5IT9c 3GTLH 4YHHQ 4PG3A 1KD1C 5EAYA 2YV5A 1CUKA 2Q2IA 1NE3A 1WCMG 1SRUA 2CFMA 3A74A 3J7ZC 3CCEA 1VS0A 2AWNA 2UUBL 3HOZH 2RCNA 2IHEA 1WI5A 1IBKL 3K0XA 1SLJA 1YHAA 4GOPB 2JA5G 2KHJA 1P16A 1GVPA 4Y7NH 2AKWB 2NZHA 4JI2L 1MJEA 3AFPA 2E2IH 2JA5H 2GVAA 4DR4Q 4JYAL 1X65A 4BBRH 1O7IA 2VL6A 1B70B 2K50A 1IBKQ 3HOUG 1PH6A 3MXNB 3W1GA 2ALYB 4JI8Q 1TWAH 4C3JH 1X55A 2CKZB 2KBNA 1YJWA 1Q82C 1PH3A 4KHPQ 1I6HH 4DR5L 1QUQB 1WCMH 1GD7A 1OTCA 3S1NH 1W3SA 1NMGA 1CKMA 1UWVA 5JEAJ 5GAEC 2OTLA 3M4OH 1JB7A 2UUAQ 2E8GA 4JI1L 1V9PA 3SGIA 2IY5B 4LF8L 3I55A 1X9NA 2YYZA 4LW1A 4IFDI 3HKZG 4GKJQ 5E7NA 1IYJB 1Z9FA 2KCMA 1W2BA 2JA8H 1PYSB 5JEAG 3CC2A 2JE6I 2K75A 1KAWA 2N8NA 1SN8A 5ELOA 4L5TA 4GNXB 4A4IA 4A3FG 5IYBH 4A76A 1SFOH 4BA2I 4DR7L 3W1BA 3PF4A 1YI2A 4BBRG 1IBML 4AYBG 3CD6A 5FLMH 2JA6G 5IP7G 1VQPA 5C3EH 1PA6A 2JEBI 3GO5A 3CCMA 3HOXG 1HR0W 2OQ0A 4LF4L 1I5FA 2ZTCA 4AH6A 4JCVE 3RNUA 3GTJH 1QZHA 1YZ6A 4NPSA 4A3EH 3CC4A 1UE5A 1VQ8A 4DR7Q 5BR8L 4K0KL 1PH1A 5IYCH 2UXDL 1HNXQ 1HH2P 4H02A 1EOVA 4TQUS 1A62A 3PUXA 2LSSA 2V1CC 1N9WA 3ERSX 4OWTB 4GLXA 2HIXA 1PH2A 2IX1A 2R92H 1ASZA 2WP8J 1J5EL 1XMQQ 2A8VA 1D8LA 3PUWA 1K3RA 1Q12A 4HJ5A 2Y0SE 5LMUL 1KRTA 5M5XH 3PV0A 1Q1BA 1LUZA 2Z6KA 4DV6L 1JT8A 2HT1A 2BH8A 4IPCA 1XNQL 4DV7Q 1EIYB 4YCVA 3H0GG 1L1OA 4YY3Q 4R4OA 2F4VQ 2D0OA 1PFSA 2PQAB 1I94L 3S1QH 3STBC 1SMXA 2ZM6L 1E24A 4DR1Q 4A3BH 2BA1A 4DV1Q 1G291 1Y1VH 2UUBQ 1VQBA 3CP0A 4NXNL 3PO2G 3J81i 4A93G 1VQMA 4BBSH 2I5HA 1VQCA 1GKHA 2NN6G 4LFAQ 3A5UA 4C3HH 1QVGA 2JJQA 3KF6B 1YEZA 1PHJA 1N36L 3HOVH 3HOYH 3S16H 2B29A 3CCLA 3HKZE 2D0PA 4UP8A 5HY6A 3F2CA 3NBHB 4POGA 4LF4Q 3DLLA 2JA7H 4LUVA 1X56A 4JOIC 1UE6A 4UPAA 4HIMA 4IFDJ 4X65Q 3PF5A 3T1HL 2HHHQ 4HIKA 1GO3E 1WYDA 1WOCA 4A3DG 4LNQA 4DR6L 2F3IA 5IWAL 4A3IH 4MTNA 1XPRA 3ULJA 1A0IA 2XGTA 1N32L 4X66L 4C2MH 1IZ6A 4DV1L 4DR2Q 5C4XG 4LFCQ 4GN5A 2OCEA 2UXCL 3B6YA 3PUYA 3BZKA 3UDGA 4A3CH 5AJ3Q 4QIWE 1Y1WG 4LF6Q 3H3VI 4P71A 4DR3L 1X54A 5C0XG 3JC66 4GN4B 1H95A 1V43A 2UXBQ 3T1YQ 4OX9L 1Q81C 4B3ML 1PH9A 2JA8G 3M3YH 1KHIA 4JI7L 1L1OC 4WJ3M 2I5LX 4GOPC 1D7QA 2VW9A 2UXCQ 5M5WH 4RG1A 4DK6C 4FDBA 4GS3A 4ME3A 2R7DA 3VDYA 2MO1A 2CWAA 2ZJRA 1TXYA 1Q1EA 1TWGH 4L5QA 3RR5A 4UY8C 4A3MG 5LMNQ 3CF5A 4LF7L 5IYDH 1VQLA 1LM0A 4KLKA 4O0AA 2HHHL 2ES2A 1HR0Q 5JJIA 4JBMA 1VQ9A 1VQIA 2PI2A 4JOIA 4LUZA 1EQQA 3HFZB 1JJ2A 4GNXA 2VUMH 3AYHB 2R93H 1Z47A 3U4VA 4LF5L 3HOZG 1V1QA 2JA9A 1RIPA 4DKAC 3M4QA 1VQKA 4JI0L 1Q46A 3EN2A 4P73A 3ZJYC 4DV3Q 3OW2A 3I4MG 1SE8A 4DK3C 5M3MG 2IHFA 4NB3A 2F52A 2CQOA 1X6OA 4X62Q 5IP7H 4KHPL 1OXTA
chains in the Genus database with same CATH superfamily
3MTSA 1I6HB 2F4VL 4NP5A 4A3BG 2ICEC 3HKZB 4DV5L 4K14A 1PXUA 5C4JB 3L2PA 4L5SA 1HTPA 3HRZC 2DNEA 1SSOA 1T9HA 3W3AA 3U50C 2VS1A 2N55A 3BU2A 4X3TA 3WOEA 1IXRA 2VQFQ 3GDEA 3SDZA 3GTLB 5K36G 4PMWA 4DAVA 4DNIA 1VQJA 4MNOA 1XMQL 1N33Q 3IKJA 3TS2A 4X64Q 4TVAB 2IX3A 1K0SA 2HD3A 1QUQA 3GTKH 1ZEQX 3S2DH 1J9OA 2R7FA 1AW7A 3OW7A 3I56A 1JJGA 4JI5L 4H7BA 1IL8A 2R3ZA 3BDOA 1TWFH 2E5LQ 2L5TA 2RSNA 1SXTA 1KNEA 1I4RA 2L11A 2N88A 3NTKA 4NXNQ 4HSVA 4RHSA 4HCEA 1QE6A 4HR7B 4P2CB 1SYCA 1ZXTA 1CTMA 2AHOB 1YNJD 5EKKA 3TREA 1G6PA 1CKNA 5G3LF 4C3IH 1VQOA 1PYWD 3CCUA 5CORA 1N32Q 2A68C 1LV9A 3NXWA 1ET6A 5DLQE 4JV5L 3BJUA 2Z9HA 3DWQA 1PRTF 4R9WA 4UHVA 4JBJA 3S2HH 3CCJA 2OT2A 3UDXA 1EY5A 1K8MA 4LK1C 1HA6A 5C4JH 3S15H 2PZTA 3QIAA 4JV5Q 4LF6L 4GOPA 4KJOA 5C0XI 4QQBX 1C4QA 1B1ZA 3M4OB 5DNFA 4XDXA 1Q8KA 1N33L 2F0SA 3HZXA 5M5XB 1C7YA 3HOUB 4P72A 4BY7B 2F0GA 4IO9A 4GKJL 3AFQA 4JBKA 3F2BA 4PZ8A 4EQ5A 1JE5A 4POFA 3BYTB 2WV6D 1H9MA 2PI2E 2B2UA 4CDDC 3D0FA 1AP0A 1S5CD 1Y8OB 2N3SA 1W6JA 2JQOA 3DUZA 5C6AA 5IT9L 4B3SQ 2BE5D 4A3DB 1HJPA 2N49A 5K36H 1LTGD 1DOMA 1A8VA 4U68A 3T1YL 1NJIC 3VR6A 4B3TL 2QF7A 1TWCH 2B3GA 2R7ZG 4JI6Q 3CPWA 4DV2Q 3ULLA 3M7NA 3J7A5 2FMCA 1EUJA 1PFBA 1QJOA 3W2DA 3J81E 2JA8B 1HNZQ 2Z6KC 3KYHC 3I4OA 1JICA 3W5OA 2WAQG 4HJ7A 4QB4A 5CMDA 3S1RH 4QL5A 3FRPB 1Q7YC 1XPOA 2RHSB 4XYOA 1JOKA 2K14A 4HTHA 5IOCA 4CJ2C 1IBLL 1E0BA 5HURA 3NELA 4A3FH 5GAHC 3RN5A 3K81C 3FMCA 5IGCA 4PQXA 3U9SA 3GD7A 1ENCA 3H3VH 1GXDC 1SDFA 2C9OA 4ULLA 4ZYSA 2JA6B 1HHVA 4A3MH 1NCVA 4JI5Q 4IUNA 4QMGA 3U58A 5IYCG 4OWWB 1BR9A 2DNCA 2AQ3B 3BVGA 4FXKC 4DV2L 2F0TA 3UDIA 1E2WA 4KN7C 1SJED 2VQFL 2RKSA 4ID6A 3K6OA 2V4DA 5C3EG 2FMMA 1YHQA 2K01A 4MTKA 2PMZE 1EFWA 3UE1A 1HPCA 4PMCA 1GUOA 4A3JH 1VQ4A 5LMNW 1RJTA 2HIVA 1L1OB 1YIJA 3EJIA 1T5EA 4LAAA 3E0JA 2VB2X 4L5RC 4A3DH 2LY7A 4IPHA 1UEBA 1JC7A 1KDAA 3MXUA 3UDFA 3K8AA 3GTQH 2A74C 3H3VC 3AB9A 3I72A 2NN6H 1XJVA 4IQZA 2Q2HA 5IGFA 1KLUD 3I2ZA 4CDFC 5IE8A 3HOUH 5AFWA 4KHPL 4ZUJA 1Y1VG 1S72A 4OO1G 3NP8A 1F9QA 3CCVA 5E3FA 4DGZA 2GN5A 3G4SA 4DAPA 4NXML 3HKSA 3PGZA 4IN3A 3GTMH 2K5NA 3TZDA 2WB1E 4DF7A 4XXEA 3S15B 2MNAA 1GJXA 1KC8C 4I65A 1FGBD 2Q8TA 2ZXRA 5M3MH 2ATWA 3I73A 4A3FB 1X3FA 1TIID 2SNSA 2IPKD 4XYQA 3CXCA 3HOWG 4GN3B 1R4PB 3S1QB 1SYDA 4WJ4A 2B39A 2MHVA 3T16A 2M9VA 1N34L 5C44G 1WTVA 4X3SA 1WFQA 5EPJA 4IFDH 4KI0A 3C2PA 3BS1A 1S3OA 2A73B 3TQYA 2OXPA 5M9OA 1HZCA 2EY5A 4MZ9A 4QJFA 4CJ1B 2ZTDA 4U673 2IWHA 3KBGA 3S2DB 1CA5A 1M8AA 2NWGA 4LFCL 5FO8B 3Q22A 1Z7TA 3MC0B 4YIJA 4C3IG 3NUCA 3TEHB 4KD3A 1PTOD 2B2YC 5IT9c 1CFMA 4PG3A 1KD1C 5ELCA 5EAYA 2J7ZA 3DMUA 2EJGC 2J0TD 4B08A 2UUBL 3A74A 4NMZA 1HTLD 1S5BD 4C3JG 2KHJA 1NSNS 2AKWB 5M3MB 3S14B 4DR4Q 2JA5H 2GVAA 4RGNA 5JVH3 3W1GA 2ALYB 1JOOA 2KBNA 1F9SA 3Q23A 1OTCA 1STHA 1I4QA 3S1NH 1NMGA 1UWVA 1RHPA 1GHJA 1WCMB 4RAUC 2IY5B 3OPOA 1G2TA 2YYZA 2PPBC 4V190 1IYJB 1Z9FA 3SE0A 2X6GA 1W2BA 4NDXA 1PYSB 1RD9D 2B2WA 2JE6I 1S4ZA 4A3FG 3LWEA 2JXMB 2M00A 3PF4A 4BBRG 4HAEA 2KHSA 4AYBG 2QDBA 3T13A 1EZ8A 3A8JE 1FD7D 2EY2A 4CGYB 2BOSA 1VQPA 1PA6A 3G6JB 1FYCA 4LF4L 3RNUA 2ZTCA 5CV9A 4JCVE 5BN5A 3GTJH 3OWFA 1RODA 4K0KL 2UXDL 1HH2P 3M3YB 2MUYA 1EOVA 1CQVA 1KABA 1STNA 2G9HD 4OWTB 2LSSA 5FLXL 1G6ZA 3OIQA 4JPBW 1ASZA 1F2YA 4E6IA 2A8VA 3PUWA 5ELFA 5M5XH 1LUZA 1HUNA 2A6ED 1XNQL 1EY7A 1KAAA 4YCVA 2QW7A 1LLRD 2HQEA 5KRUA 1CI3M 2D0OA 2PQAB 4XQJA 4DV1Q 4XQNA 1LT5D 3PO2G 3J81i 1O7YA 4BBSH 1F9RA 4C3HH 1QVGA 3KF6B 1EEID 4NKLA 4RH6A 1GUNA 5DM73 1N36L 2EYLA 2B29A 3HKZE 1H9SA 5HY6A 3NBHB 1CHPD 2VXWA 4R8IA 2XWJB 4LUVA 4ZKCB 4UPAA 4HIMA 3PF5A 2HHHQ 3I91A 3CRLC 1W6KA 2F3IA 3D4RA 4A3IH 4B9WA 1B4OA 4OIKA 3ULJA 1WD1A 4DXFA 1ILPA 2XGTA 3FEWX 1STBA 3B6YA 4LF6Q 4DR3L 5C0XG 1H95A 3BZDB 1V43A 1SMYD 5T1GA 2SNMA 1PH9A 1I4GA 1L1OC 5COYA 1PTOH 4KJNA 4GS3A 2MO1A 4F88A 1Q1EA 2F0IA 4L5QA 1O7ZA 2PNRC 5IYDH 3JAME 1KTKA 1EU3A 2RDGA 2KUMA 5M3FB 2HHHL 3A8KE 1HR0Q 2PI2A 1QOHA 1SJHD 3HFZB 2EOTA 1JJ2A 1DCZA 2B2TC 3MAQA 2VUMH 2R93H 1B44D 1WVLA 4LF5L 1RIPA 4EQOA 2F0LA 3EN2A 4P73A 3WDNA 5ISRA 1LT4D 4C3HG 5M3MG 1NUCA 5KYLA 1X6OA 4X62Q 5IP7H 1OXTA 4QY7A 2QILA 2NVYB 5I9OA 5GQOA 4LF5Q 2B2VC 2E2HH 5EBDA 1HZBA 1EY9A 4JG2A 4KD4A 2E2IB 2CWPA 3S2HB 1E1OA 1EQTA 5CV7A 4LFAL 3K5LA 3WOFA 3JAMc 4K0KQ 2PYKA 2UXDQ 3HOZB 3DM1A 4Z9CB 2NYZD 3KLWA 1I3QB 2QA4A 4WFN3 4A3LH 5D65A 2HCCA 3HOXB 3G6EA 4C1NK 3MEFA 1ML0D 3DXJC 2DY8A 1EY0A 1JB3A 1F2ZA 4CKBA 3CPFA 5LMUQ 3FPUB 2IW3A 1A6XA 4A3GH 2K5HA 2EXZA 1CZGA 1JWUD 4K5XA 1TKWB 1JMCA 2XTIA 4G4KA 3GTKB 1BCPF 2QCPX 3MFGA 4HIDA 2OWOA 5IP9G 3TMEA 2CHBD 1PZID 3I70A 3M7GA 4XIGS 5IWAQ 3E9HA 3LWUA 1RTOA 2EY6A 5L37A 3TP6A 3CCRA 2WB1G 1Z6HA 2XIWA 3MA2B 1S40A 2NBFA 4DU9A 3K59A 1L0YB 2R61A 3P75A 1PH8A 3J80E 2MP1A 3IRBA 4ZK9B 1CKOA 2WAQB 3GV3A 3U9OA 1YHBA 1CSQA 5ELBA 4L6TB 2H4OA 2BDOA 3OOCA 3CMAA 1V1PA 3RLFA 3X3MA 2Z0SA 5D3IB 1HQRD 1QWYA 1LABA 3LGJA 4TRDA 5JJKA 1MKHA 5JVG3 1GHKA 5ELNA 2OTJA 3V2TA 5CR3A 2K5VA 1LACA 2Z8LA 4IUQA 5TSSA 5IYBG 3TRZA 1EY6A 1IL2A 3UE0A 1G2SA 4IPGA 1HNZL 2LS01 1ESFA 2ZT9C 4ZKBB 2CQAA 3NBIA 1PTOB 4B9XA 3JAML 1EZ6A 3GV6A 3GTOH 1LTRD 4YHHL 1DM0B 3U4ZA 4F7XA 1E2VA 3KLSX 1GOZA 4IJHA 1QZGA 2EIFA 4X3KA 4HIOA 5J3BA 2FHTA 5I9PA 2JEAI 1WJJA 3EBEA 2NVQB 4OONA 1IW7D 2F0VA 2H5XA 4B3RQ 3K57A 5JJLA 4DUZQ 2EYPA 3ULPA 3AMUA 1RTNA 4DR5Q 5C3XA 2DGYA 3OMCA 3HOVB 2BDNA 1Y69U 1YNND 4C3HB 2NUCA 3KF8B 2K04A 2K52A 5KNCA 3L7ZC 2ENBA 4DV5Q 3R2IA 2ZJPA 1JR0D 3LX0A 1RCVD 3FHWA 1A3UA 2B2VA 1KXLA 3STBD 1TS3A 4H13C 3H09A 3F2DA 5JAVA 1I6VC 1F2LA 4FF2A 2DY7A 2VUMB 3D31A 3A5ZB 1Q86C 1ICWA 2B2YA 4IPDA 4FXDA 5D14A 2PCFB 1UEAB 4DAYA 3SK4A 2UUAL 1B53A 3QO2A 4LFBL 4WRDA 2Y0SG 2OQKA 2VQEQ 4RGTA 5LHY1 3ER0A 3KFUA 1DZ1A 3PSIA 3RMHA 1UUPA 2DJFC 5LL6X 2YTXA 5KEEA 2JN4A 1D6EC 5CBEE 3NQTA 1K8AC 4FVMA 1TT2A 1WTQA 1HXYD 3G71A 4IUPA 3VYSA 3RLOA 1EY4A 3L0OA 2F0MA 3CHBD 5EKLA 1P8LA 1LTLA 2A1AA 3PO3G 1FJGL 2WB1B 4I7ZC 2F3WA 2F0NA 4X3UA 1YNJC 2CCZA 1DJRD 3ERQA 4HJAA 2FJ2A 2HQLA 4QUCA 4O2DA 3RD4A 4BY7G 1X32A 2EYOA 4BY1G 3TP7A 4JBWA 1KRSA 2SEBD 3H15A 1AZPA 4AIMA 1BCPC 3H94A 4X66Q 4A3GG 4TKOB 1UE7A 2E2DC 1Q8IA 3IL8A 1VQ7A 1EYAA 2C35B 4LWCA 2Z4IA 5IGDA 1VMCA 3Q8DA 1Q90A 1MI2A 1B3AA 2E2JB 1IHZA 4LMQD 2Q2UA 4JI1Q 5IGEA 4A75A 1SE2A 3D6CA 5M5WB 2A6HC 1OXVA 1HFNA 2RBMA 4EQNA 5FLMG 2CVRA 3CQZH 4RKBA 3MEHA 4R8NA 1D1KA 5GAGC 5BN3A 3RN2A 5C5LA 3V96A 2PW5A 1WTPA 1D1IA 5C0XJ 5EPLA 1K3BC 1UE1A 5C44B 4LF7Q 3L9AX 1U9RA 3K7UC 1HZAA 4L8JA 4DV0L 4GKKQ 4YHHQ 3A55A 1CUKA 1SEBD 1NE3A 2CFMA 1SRUA 4IFDI 1VS0A 1IBKL 1HFGA 1K83B 4GOPB 4FP5D 1KNAA 1P16A 4Y7NH 3I4MB 2KQ3A 4BY1B 4LJZC 3AFPA 4IUUA 1BQQT 1X65A 1WTHA 2VL6A 3S17B 3HOUG 4JI8Q 1TWAH 3MXNA 4C3JH 1X55A 4JK1C 3D6WA 1LTBD 1JWMD 1CKMA 5GAEC 1S5DD 1JB7A 2UUAQ 2E8GA 1QNUA 2XSCA 2WKDA 3SGIA 3VA5A 5A2QL 3I55A 1X9NA 1CM9A 5KNDA 1BOSA 2IJ0A 2R93B 4DNRB 4O42A 2KCMA 5KIXA 1HQMC 3CC2A 1B9MA 1SN8A 2VB3X 4A4IA 1SNOA 3A54A 1EY8A 4RCOA 4N9PA 3VA7A 2EJFC 2A6HD 4G7OC 2F4IA 5C3EH 1AEXA 3GO5A 3CCMA 1HR0W 1EQVA 1R9TB 4AH6A 1A3VA 4ZAIA 4NPSA 4A3EH 3CC4A 4DR7Q 5BR8L 5IYCH 1HNXQ 4H02A 4TQUS 3I8ZA 3PUXA 2V1CC 3KBXA 2IX1A 2HUGA 4KV6A 1J5EL 3GQBA 1K3RA 1Q12A 4DV6L 2HT1A 2BH8A 4IPCA 4EQPA 1MSGA 2XN9C 3R8BA 2K03A 2Z4HA 2F4VQ 2PZWA 1U4RA 1I94L 1PFSA 3S1QH 2D5DA 1SAPA 1SMXA 4DXGA 4DR1Q 2BA1A 3BG3A 1IYUA 4KMUC 1G291 4A93G 1VQBA 3CP0A 4BBRB 1VQCA 2F0JA 5G3LD 4LFAQ 3A5UA 2KECA 1BCPD 3HOYH 3CCLA 3NBHA 2D0PA 1ZKOA 4UP8A 3NQIA 3SXHA 4POGA 4LF4Q 1A2TA 4K2LA 4JOIC 3K5MA 2L12A 4HIKA 1WYDA 2RDFA 4DR6L 4A3DG 4MTNA 1XPRA 3CU7A 1A0IA 3AU7A 1CK1A 1N32L 4DR2Q 4DV1L 2RA4A 2UXCL 2DN8A 3PUYA 3UDGA 4A3CH 2RCFA 5AJ3Q 1Y1WG 2BCOA 2KEDA 4RGOS 2RDHA 4DA2A 1MGSA 4OELB 2JA8G 1KLGD 1KHIA 2F0PA 3M3YH 3C46A 2TMPA 4DK6C 1H9KA 1EWCA 3KUPA 4FDBA 4XT1B 3D4DA 1TWGH 1SNDA 3KLRA 2K5DA 4A3MG 5LMNQ 3OMGA 1VQLA 1AFPA 4H44C 3KK7A 4O0AA 3Q24A 5CV4A 5JJIA 4G7HC 1QILA 4JOIA 4LUZA 1EQQA 2JP1A 4CDEC 4FYDA 1SNMA 3U4VA 1V1QA 3TN2A 1U4MA 4DKAC 3M4QA 3GTMB 1S5ED 2CH4A 4L63B 2K6AA 3QR8A 3I4MG 4DK3C 2XRSD 4NB3A 4QCLA 2F52A 2K7VA 5GROA 1MIUA 3URYA 3MXPA 4OWXB 2RSOA 1B3QA 4PMBA 4JI0Q 2NZOA 2B63H 1BBUA 2UUCL 1NR2A 1HRJA 3EROA 1VQDA 1YNNC 4BBSB 2JYOA 5CV8A 3BDLA 1BF4A 2YU9H 3NENA 1YITA 5LMNL 1EWIA 3BZCA 1CZWA 1DOKA 1C8CA 3M4PA 2WIIB 4S3SA 5NUCA 3KOJA 4B3TQ 2R7ZH 1G51A 3CMEA 5M3FG 2L0CA 4ODGA 3J81c 1S5FD 3TSSA 1QG7A 1EOTA 3S1RB 1LTAD 3DEOA 4AQYL 4EX5A 1VQAA 1FNUA 4JC0A 1IBLQ 5J39A 2LMCB 2F1MA 4UP9A 1ZYRD 4KY6A 4A3GB 1OXXK 3J81j 4P75A 4FF4A 4V0BA 2AUJD 5IP9H 4A3KG 3H6MA 3L3OC 5IYDG 3OYYA 2B2WC 5IIFA 1ET9A 2B2TA 1TS5A 3JAMi 4A3IB 1O80A 1LTSD 1I3QH 1SR3A 1EIHA 3VYTA 1HR0L 3QG1A 4DR6Q 1F77A 3NTHA 3A56A 2NVTB 1GUWA 3PCOB 5I6YA 1FL0A 4DR2L 1I4PA 3F1ZA 2E76C 2WAQE 1BCPB 3K80C 4ZCKA 4FXGC 1HA5A 2GA4B 1C48A 2H1EA 2KCTA 3F2UA 1VQFA 2QGQA 4RFBA 3TS0A 4A3KH 4KHZA 1D2BA 3D8GA 5M5YH 2P5ZX 3PQIA 1XWEA 4OHJA 2I46A 1PZKD 1OXSC 1PH4A 4OO1I 4B3SL 1PH7A 3OWEB 5IODA 1C0AA 4AYBE 5M3FH 3HOVG 1H9SB 5CC4A 2KCCA 2EXDA 4O1NA 2I07B 2KEEA 1CSPA 2YTYA 1F9PA 3ZYYX 2K5QA 3MFYA 5I2YA 4KK7A 3N6RA 1FNWA 4IURA 3KJOA 3E9IA 1VQEA 3GP7A 3IFDA 5C5MA 2EPBA 4HN7A 4KY5A 1HNXL 4LF9L 3H0GH 1CKNB 5EPKA 1ENAA 1LO5D 5IGBA 3RZOB 4RA8A 1X3PA 3PMFA 3HOYG 5M5YB 4A3KB 1IBMQ 2HDMA 1ASYA 1E7ZA 2Q8IB 2JA6H 4LUOA 5C4HA 1PFNA 1K8GA 2NTSA 5E1FA 1K28A 5D3DA 5FJ8G 4QGUA 3HOWB 4LF9Q 3N52A 3J80i 4KKSA 2IT1A 1PH5A 3BDCA 3WWVA 3FPPA 1SNCA 3KF8A 4GKKL 4RMFA 4AQYQ 4X62L 2HDLA 2Z1CA 4X64L 1FVIA 3G7LA 4GNXC 3R3OA 1G8ZD 2F0KA 2JA7G 2NN6I 3GTPB 1ESRA 1VQ5A 1N34Q 4NXMQ 1O7LA 1JWSD 1L0WA 4YWMA 3TZUA 2YTVA 3K58A 3M4YA 2SOBA 1HNWQ 2G5DA 2R6GA 3RZOH 1DGSA 3M9BA 5FO7B 4DR4L 3NWSA 3QOJA 5I4DA 5J22A 1QVFA 1FGUA 2PQEA 1PVOA 3I4NG 4X6AH 1JQYD 1TY0A 4A3CG 3K7AH 1UNSA 1DD2A 1E22A 4YWKA 1MJCA 4JI4L 3H91A 1TWGB 4K2KA 1Y8NB 4OEMB 4ILWA 4DV4Q 1SROA 2YU9B 2RHQB 3NEMA 2ZTEA 4PNYA 4JI6L 1A63A 1U4LA 4TSSA 3VR4A 3GTGH 1BKBA 1GUTA 3PUVA 1PRTC 1B7YB 1DYQA 5HGQA 2UXBL 4DV4L 4BY7H 1C9OA 3J80c 2EYFA 4ABNA 4A93H 1YJ9A 1IKMA 4JI4Q 4KY7A 5IY0A 3BVZA 1CT1D 1FR3A 1MHWC 3OSOA 1KQSA 4DUYL 3CAMA 3SK5A 3AQQA 1VQGA 2KHIA 1FJGQ 3PO3H 2LKVA 2MGSA 4PZ7A 1U4PA 1IYVA 3I7FA 4A3IG 4J15A 2WFWA 3A7LA 1X3GA 3HOWH 4PV1C 4A3BB 1BBXC 1A3TA 1MBYA 1XNQQ 3HG9A 4C3IB 4B3MQ 3K7AB 4DPGA 1RL2A 1TWFB 5ELDA 2L55A 3DM3A 2D62A 2R92G 1Q3LA 4BXXH 1STGA 4JI3L 2FXQA 1E1TA 2A19A 2I5MX 2F03A 4JYAQ 3TBIB 1VCIA 2CW0C 2O4XA 5CBAE 2VQEL 2MQHA 4CBVA 5DM63 1JORA 3KF6A 4HEDA 1R9TH 1VQHA 3GTPH 3GTLH 4Q5VA 2R7ZB 2YV5A 4RKLA 2ZXPA 1WCMG 3J7ZC 4IZ8A 2AWNA 3P7JA 2IHEA 1WI5A 4K6LA 1SLJA 1YHAA 2F3VA 1SFOB 3S16B 2NZHA 1MJEA 4F8MA 4BBRH 1B70B 2K50A 1OO9B 3HEJA 1IBKQ 1PH6A 3MXNB 4RGMA 4DFAA 1YJWA 1Q82C 1I6HH 4AYBB 3VYUA 4DR5L 1QUQB 4XQQA 1RF2D 1VF7A 5CGKA 1G91A 1W3SA 5JEAJ 3M4OH 4JI1L 4N9TA 2Z6BA 3C1EA 4LF8L 4GZYC 1TWAB 4C3JB 4LW1A 1PMRA 1AN8A 2X6LA 4OL7A 3HKZG 4GKJQ 3J80L 2JA8H 2C5CA 2EDGA 2MPMA 5JEAG 4MIUA 2K75A 1KAWA 4CHTB 2N8NA 2NZ1D 4DN4M 3GTGB 3GTQB 5ELOA 2AQ1B 5IYBH 4A76A 1KDCA 4BA2I 4DR7L 3W1BA 1TS4A 1YI2A 4A3EB 3CD6A 5FLMH 1TWCB 2JA6G 2HCIA 2JEBI 3VR5A 2CH4W 3QB3A 1I5FA 3CKIB 1QZHA 1UE5A 2EVBA 2PMZB 1VQ8A 2NVXB 1EYCA 1JCKB 3SK6A 1A62A 2CW0D 5JOBA 3UI2A 1DONA 4JW0A 3NK9A 5A35A 4GLXA 3SR1A 2R92H 2FINB 4IUVA 4OIJA 5EBCA 1D8LA 3E3XA 3DHQA 4HJ5A 1KRTA 5CV5A 1JT8A 4DV7Q 1EIYB 3LNNA 3H0GG 2ZM6L 1E24A 2PW7A 4NXNL 1PZJD 1GKHA 5ELEA 4FO2A 1YEZA 1PHJA 2F0HA 3HOVH 5C4XB 3F2CA 3O13A 3D3RA 1Y1VB 3DLLA 2JA7H 1X56A 1SNQA 3QWNA 3R2TA 3T1HL 5IWAL 1ENFA 5HGTA 4X66L 2NB0A 4M8AA 3S1MB 2E75C 3BZKA 4QUFA 1X54A 3JC66 4GN4B 1LTID 2UXBQ 4OX9L 1I4XA 5JPNC 2BE5C 1BUVT 2QKIC 4OO1H 1B9NA 1SBBB 4JI7L 2I5LX 3KLSA 1D7QA 1SE4A 2F0EA 2F0DA 1BO0A 3VYRA 5JPMC 5M5WH 3Q6SA 4WORA 3VDYA 1TQOA 2CWAA 4KTAA 2ZJRA 1TXYA 3RR5A 4UY8C 3DWPA 1NNXA 2JSOA 3CF5A 5F2DA 2OEOA 1CHQD 1LM0A 5KGUA 2ES2A 3D4WA 4CKCA 5KNBA 4JBMA 5C3WA 2L9HA 1TR5A 1VQIA 1MSHA 4FF3A 3AYHB 2O2LD 1Z47A 1LT3D 3HOZG 3OHXC 2JA9A 4C2MB 3ZJYC 4DV3Q 2K1BA 2CQOA 2K28A 3MXGA 3EQLC 4RCNA 2WINB 2EYMA 2I0QA 1YJNA 3S17H 3T56B 2R93G 4R1JA 4C1NI 2DJGC 2GVBA 2B63G 3QJYA 1AZQA 4GLAC 1O78A 2NVTH 3V05A 4FF1A 3SHLA 2EJMA 5J1ZA 1EWHA 2Q2TA 2Y0SB 3FVQA 5CYUA 3EFXD 4K8JA 3KDFB 3E0EA 4DV6Q 1PRTB 4ZLTF 1SYEA 4YWLA 2WKCA 1RDPD 4EVOA 1MD2D 1XMOQ 1U5KA 1GUGA 4R4TA 3T53B 3CCSA 2K4KA 2N78A 3F8TA 5T1IA 1I94Q 1LT6D 2BH2A 3I4LA 2DUDA 2F0QA 5BR8Q 3OTOL 1EFID 2BA0A 4LF8Q 2A5HA 4R4IA 1NY4A 3RZDB 3PIO3 2QDLA 3NWTA 1J5EQ 4N8FA 3A0JA 4B3RL 4BBSG 1VQNA 3FP9A 4ME5A 5FO9B 1ILQA 2FFKB 4IALA 4CJ0B 1F2MA 4DR3Q 1J6QA 1JE4A 2MFIA 3HP3A 1FNVA 1LYLA 4H0LC 2B63B 2J4XA 1Y1WH 4FNFA 4ZQ3A 2IX0A 5FK9C 3PIPA 3KJPA 1BDOA 4P74A 3G48A 1QVCA 1EL0A 3C3LA 4J8QA 1D5XC 2KCNA 4APVA 2ID0A 1BNZA 2ZJQA 3K5NA 3HGBA 1SYFA 4J6HA 2NVQH 2VZAA 1XTDA 2MO0A 1D5MC 3NHHA 3Q0AA 2SDFA 5FJ8H 3S9WA 4PZ6A 1YVCA 1EU4A 1NAPA 1NR4A 3TP5A 4DK1A 2UU9L 4JVZA 1YBYA 4GLVB 3GTOB 2F0OA 5EJWA 2EZVA 4JI2Q 4BY1H 2E5LL 4Y7NB 1IW7C 1K83H 3ONAB 4XTCS 1H9JA 3C1FA 3FKIH 2UU9Q 2K32A 2A68D 5I6WA 4HJ8A 1GUSA 1TWHH 3RZDH 1LTTD 2AWOA 4Y52H 1EIFA 1TVXA 2AQ2B 2B8FA 3EVQA 4K6DA 3MHBA 3ITPA 5C3EB 4OX9Q 4A3LG 1NBWA 2LXKA 3QOLA 4Q0FA 3TDQA 1SMYC 1VMPA 3FKIB 1M90C 1E3PA 4CKEA 1BBWA 4KN4C 1VDZA 5FLXE 3NE5B 2RF4A 3BVMA 4HJ9A 1K73C 1SYGA 3RUZA 2OF1A 2F0UA 4DUZL 1PTOC 3MWYW 1XXGA 3T1HQ 2AMCB 4A3EG 1T5XD 2G9DA 2D9UA 3I4NB 4NW2A 3ND9A 4ZRZA 3S1MH 2MJ8A 1AH9A 2E74C 3MVVA 5IT9E 4K8IA 1X3EA 2EE1A 1KIXA 3KDFA 3J7YW 5H1SE 3RLNA 5AJ3L 3IAYA 2ZM6Q 3M85A 1STEA 5GADC 2O5IC 3HOYB 3S24A 2A69C 2VUMG 5C4XH 4IJLA 1I4HA 3CW2C 1HZ9A 2AUKA 4QIWB 5E4XA 1V1PB 4ALPA 1PV4A 1TY2A 5FLXc 1UAPA 1AE3A 2A6EC 2XVSA 2NVYH 3CCQA 2EYHA 2JK8A 2UUCQ 1ICFB 5FOBB 1EYGA 2QEJC 3A7AB 1K8OA 3OTOQ 1V1OA 1XNRL 3FKIG 1NMFA 4JI8L 1AE2A 4YCUA 2PNHA 2O5JC 3EIVA 4JI3Q 4BXXG 4IOCA 2TSSA 2XNAC 3DWAA 2KENA 4G57A 4HSPA 4R4QA 1N36Q 4OGQC 4IFDG 2L15A 5DAUA 5I2XA 2NVXH 3IFTA 4DV3L 1XPUA 1JJCB 3DEPA 2E2JH 4MN3A 1HUMA 1TWHB 1I50H 4UDUC 2LXJA 3SVMA 1B8AA 3PO2H 2PQAA 4DAMA 1QCBD 5JJZA 1QB5D 3NPPA 4LFBQ 1IKLA 4DV7L 1TU2B 1NTGA 3BYYB 1KL9A 2KJXA 2VNUD 1EQRA 3J7AF 5DEHA 3ICEA 4IOAA 3AEVA 1XNRQ 3A8IE 3J81L 3T51B 4BA1I 3TP8A 2EYJA 2QEXA 2X69A 3R93A 2A69D 2LFNA 5E4WC 1WTRA 3PUZA 4JI7Q 1K0RA 1YNXA 1R4QB 4X65L 1OXUA 1XMOL 2JA7B 1Y1WB 2PO4A 3PIOA 4R4CA 1M1KC 2EQSA 3I4MH 4HMJA 3S14H 4DUYQ 4BS9A 4XT3B 5IGGA 4YY3L 1VQ6A 2VY3A 1L2FA 4DR1L 1PYBA 4J1MA 1PFMA 4OXPA 1DOLA 1I50B 3PIP3 1BVSA 1M4VA 4N8X1 4DAYB 5KYIA 1K9MC 1GM5A 3OIPA 5A2QE 5C44H 1HNWL 4A3JG 1U0LA 3I4NH 4DNTB 1N8RC 4I7AA 2ZXOA 2ASBA 4YCWA 5JEAH 4IUTA 3CC7A 3T4AC 4DV0Q 1PRTD 1Y14B 4UP7A 3CQZB 5EQ0A 3I90A 1STAA 1VF5C 1L0XB 1JOQA 2NTTA 2F0WA 4EGVA 3HOXH 1HCZA 1J8IA 2B8GA 2Q2IA 5C4ZA 3CCEA 3HOZH 2RCNA 3K0XA 2JA5G 1RKNA 2EY1A 1GVPA 4WJWA 4JI2L 1ZYRC 4HCSA 2E2IH 2K33A 4JYAL 1O7IA 3NSWA 2E2HB 1SYBA 2CKZB 4KKTA 1PH3A 4KHPQ 4RWSC 2L4NA 1WTXA 1WCMH 1DXMA 1GD7A 2F0FA 5BN4A 3E6ZX 2OTLA 5CV6A 4KHVA 1V9PA 2KVMA 3HS0C 3FDTA 1ONLA 2XRQD 1E2ZA 3E5SA 1PLFA 5E7NA 1X3QA 3K5OA 4QF4A 3VR3A 1H9RA 5LL6S 4L5TA 1XX8A 2ICIA 4GNXB 2L1BA 2PZUA 1SFOH 1SE3A 1KDBA 1IBML 3PO2B 5IP7G 3VR2A 3HOXG 4ZUIA 2OQ0A 4K5VA 1YZ6A 2KA7A 3EA6A 1EYDA 4A3JB 1PH1A 4MHEA 4BWGB 1N9WA 3ERSX 1PH2A 1A15A 2HIXA 3X3NA 2WP8J 1XMQQ 1PDQA 2Y0SE 5LMUL 3PV0A 1Q1BA 2Z6KA 3P1HA 3S1NB 2K5WA 1L1OA 1QNKA 4YY3Q 4R4OA 2D2CC 1XYIA 3STBC 4A3BH 1Y1VH 1WTWA 2UUBQ 4M1UB 1VQMA 2I5HA 3K0YA 2JA5B 2NN6G 2JJQA 1CA6A 3S16H 5C0XH 1Y8PB 1WD0A 4RHRA 4IFDJ 1UE6A 2B2UC 2IL8A 1EEFD 4X65Q 3PO3B 1II3A 1A2UA 1GO3E 1WOCA 4LNQA 1TS2A 1PTOF 3SK8A 4HMIA 1IZ6A 1CQFA 4C2MH 5C4XG 4LFCQ 4GN5A 2OCEA 4F87A 4A93B 3I3CA 4QIWE 3H3VI 4P71A 4K5WA 1D5ZC 2R92B 3T1YQ 3MZ5A 1Q81C 4B3ML 3H0GB 2XWBB 4CDCC 4WJ3M 1V8QA 3CRKC 4GOPC 2VW9A 4KKUA 2UXCQ 2Q8RE 2M2LA 2WACA 4RG1A 1XTCD 1STYA 1SNPA 4ME3A 2R7DA 1EIGA 3GTJB 4DK0A 4G7ZC 3J7AV 1WTOA 5K5PA 4C56C 4LF7L 1B2TA 3ND8A 4KLKA 2RVLA 1BXTA 1VQ9A 4GNXA 2KOLA 5EGTA 3NTIA 1B50A 2K05A 3SEBA 5FKAC 1VQKA 4JI0L 1Q46A 4UAIA 3OW2A 1SE8A 2IHFA 2RQXA 3P20A 4A3MB 5EKIA
chains in the Genus database with same CATH topology
5GQOA 4LF5Q 2F4VL 5GROA 1MIUA 2E2HH 4A3BG 1HZBA 4DV5L 2I0QA 1YJNA 3S17H 2R93G 4R1JA 4OWXB 4JG2A 2GVBA 4JI0Q 2NZOA 3L2PA 2CWPA 2B63H 2B63G 1BBUA 4L5SA 4GLAC 2UUCL 2NVTH 1E1OA 4LFAL 1VQDA 1T9HA 3U50C 3JAMc 4K0KQ 2UXDQ 2VS1A 2YU9H 3NENA 3BU2A 1YITA 3KLWA 1IXRA 1EWIA 3BZCA 2QA4A 2VQFQ 5LMNL 3M4PA 4A3LH 2Q2TA 3GDEA 3KOJA 4B3TQ 5K36G 2R7ZH 1G51A 4PMWA 3G6EA 3CMEA 5M3FG 3J81c 4DNIA 1VQJA 3MEFA 4MNOA 1XMQL 1N33Q 3TS2A 4X64Q 3KDFB 4TVAB 4AQYL 4EX5A 3E0EA 3CPFA 5LMUQ 4DV6Q 1VQAA 4JC0A 1QUQA 3GTKH 4YWLA 1IBLQ 4A3GH 2K5HA 3S2DH 1JMCA 2R7FA 3I56A 1XMOQ 1JJGA 1U5KA 2XTIA 4UP9A 4R4TA 4JI5L 3CCSA 1OXXK 3J81j 4P75A 2K4KA 2N78A 3F8TA 1TWFH 1I94Q 2E5LQ 2BH2A 4HIDA 2DUDA 5BR8Q 3OTOL 2OWOA 5IP9G 5IP9H 4A3KG 5IYDG 3OYYA 4NXNQ 3TREA 3JAMi 2AHOB 4XIGS 5IWAQ 2BA0A 3E9HA 1G6PA 4LF8Q 1CKNA 4C3IH 4R4IA 3CCUA 1NY4A 1VQOA 1SR3A 1I3QH 1J5EQ 4B3RL 1N32Q 3A0JA 4BBSG 1VQNA 3FP9A 3CCRA 5DLQE 4JV5L 2WB1G 1HR0L 3BJUA 4DR6Q 4DR3Q 1J6QA 4JBJA 3PCOB 1S40A 3S2HH 2MFIA 3CCJA 1LYLA 3UDXA 1FL0A 4DR2L 1Y1WH 5C4JH 3F1ZA 3S15H 2IX0A 3PIPA 1PH8A 4JV5Q 3KJPA 4LF6L 4GOPA 2WAQE 3K80C 3G48A 4P74A 1QVCA 3IRBA 5C0XI 4QQBX 1CKOA 2KCTA 2ID0A 4APVA 2ZJQA 1VQFA 2QGQA 1YHBA 1CSQA 2NVQH 2VZAA 3TS0A 1XTDA 4A3KH 2MO0A 4KHZA 1Q8KA 5M5YH 1N33L 3CMAA 1C7YA 3RLFA 5FJ8H 4P72A 1OXSC 4PZ6A 1YVCA 1PH4A 4OO1I 2Z0SA 4B3SL 4IO9A 1PH7A 2UU9L 4GKJL 1YBYA 3AFQA 3LGJA 3F2BA 4JBKA 5JJKA 4PZ8A 4EQ5A 1MKHA 1C0AA 1JE5A 4GLVB 4AYBE 4POFA 5M3FH 3HOVG 4JI2Q 4BY1H 5ELNA 2E5LL 2OTJA 2PI2E 3D0FA 2EXDA 2N3SA 2JQOA 1K83H 4XTCS 2K5VA 3FKIH 2UU9Q 1CSPA 2YTYA 4HJ8A 4B3SQ 5IYBG 1HJPA 1TWHH 2N49A 3RZDH 3TRZA 2AWOA 4Y52H 1EIFA 1A8VA 3UE0A 3T1YL 1NJIC 4B3TL 4OX9Q 1IL2A 2LXKA 1TWCH 2B3GA 1NBWA 4IPGA 3E9IA 1VQEA 3KJOA 1M90C 1HNZL 4JI6Q 2R7ZG 1E3PA 3CPWA 1BBWA 4DV2Q 3ULLA 3M7NA 3J7A5 2RF4A 1EUJA 1HNXL 3GTOH 4YHHL 4LF9L 3H0GH 1CKNB 4HJ9A 1K73C 3U4ZA 2Z6KC 1HNZQ 4IJHA 4DUZL 3KYHC 1QZGA 3T1HQ 2AMCB 4A3EG 3I4OA 2EIFA 3W5OA 4HIOA 5J3BA 3HOYG 2WAQG 4HJ7A 3S1MH 2JEAI 1AH9A 1WJJA 3EBEA 3S1RH 4OONA 4QL5A 1IBMQ 1ASYA 1Q7YC 1E7ZA 1X3EA 2H5XA 1XPOA 1KIXA 4LUOA 2RHSB 2JA6H 4B3RQ 1K8GA 3KDFA 5JJLA 5H1SE 4DUZQ 3RLNA 5AJ3L 2K14A 3ULPA 4A3LG 5FJ8G 4QGUA 2ZM6Q 3M85A 4LF9Q 3J80i 5GADC 4DR5Q 3S24A 1IBLL 2VUMG 5C4XH 2DGYA 3NELA 2IT1A 4IJLA 3CW2C 5GAHC 4A3FH 1PH5A 3WWVA 3RN5A 4A3DH 1HZ9A 4GKKL 3K81C 4RMFA 3KF8B 4X62L 4AQYQ 4X64L 1FVIA 2K52A 4ALPA 5FLXc 1PV4A 3GD7A 1AE3A 3L7ZC 4DV5Q 4GNXC 3H3VH 2NVYH 2ZJPA 2JA7G 3CCQA 4A3MH 2JK8A 2NN6I 4JI5Q 2UUCQ 3FHWA 1VQ5A 1N34Q 3U58A 1EYGA 4NXMQ 5IYCG 4OWWB 1KXLA 3STBD 1L0WA 3OTOQ 4YWMA 1XNRL 3FKIG 3F2DA 1NMFA 2YTVA 4JI8L 4DV2L 1AE2A 4YCUA 1HNWQ 3UDIA 2PNHA 2R6GA 3A5ZB 3D31A 3EIVA 2VQFL 1DGSA 4JI3Q 3RZOH 3M9BA 5C3EG 1Q86C 4DR4L 1YHQA 4BXXG 4IOCA 2PMZE 4QY7A 4IPDA 1EFWA 2KENA 3UE1A 1FGUA 1QVFA 4R4QA 1N36Q 2UUAL 1PVOA 3I4NG 4IFDG 4X6AH 2L15A 4A3JH 2NVXH 4LFBL 1VQ4A 4DV3L 4A3CG 5LMNW 2Y0SG 3K7AH 1XPUA 1E22A 2OQKA 4YWKA 2VQEQ 1MJCA 1JJCB 2HIVA 2E2JH 4JI4L 3ER0A 1L1OB 1YIJA 3KFUA 3PSIA 1I50H 2LXJA 1B8AA 3PO2H 2PQAA 4DAMA 1SROA 4DV4Q 1UEBA 4IPHA 4L5RC 2RHQB 3NEMA 2ZTEA 4LFBQ 2YTXA 3UDFA 4JI6L 4DV7L 3K8AA 1A63A 3GTQH 1K8AC 3GTGH 1BKBA 3PUVA 1NTGA 1XJVA 3G71A 2Q2HA 1KL9A 1B7YB 2VNUD 3RLOA 5HGQA 2UXBL 4DV4L 1EQRA 3L0OA 3I2ZA 1P8LA 5IE8A 3HOUH 1LTLA 3ICEA 4BY7H 1C9OA 3J80c 3AEVA 4IOAA 2A1AA 3PO3G 1Y1VG 1FJGL 4A93H 1YJ9A 1S72A 1XNRQ 4JI4Q 4OO1G 5IY0A 3CCVA 2GN5A 4BA1I 3G4SA 4NXML 2QEXA 3HKSA 3PGZA 1KQSA 2CCZA 3GTMH 3PUZA 4HJAA 1K0RA 1YNXA 2K5NA 3CAMA 4DUYL 3AQQA 1VQGA 2KHIA 4JI7Q 2HQLA 2WB1E 4X65L 1FJGQ 3PO3H 4O2DA 4BY7G 4PZ7A 1OXUA 2MNAA 1XMOL 1KC8C 4BY1G 3I7FA 3PIOA 4JBWA 4R4CA 4A3IG 1M1KC 1KRSA 4J15A 5M3MH 3H15A 2EQSA 2WFWA 3I4MH 4AIMA 3S14H 4DUYQ 2ATWA 1X3FA 4X66Q 4A3GG 4YY3L 1UE7A 1X3GA 1VQ7A 1VQ6A 3HOWH 2VY3A 3CXCA 1L2FA 4DR1L 1PYBA 2C35B 4LWCA 3HOWG 4GN3B 1XNQQ 4OXPA 3Q8DA 4WJ4A 1BVSA 4B3MQ 4DAYB 1K9MC 4JI1Q 2Q2UA 1GM5A 4DPGA 1RL2A 4A75A 1N34L 5C44H 5C44G 1HNWL 1OXVA 4A3JG 1WFQA 1U0LA 4KI0A 5FLMG 3I4NH 3CQZH 1N8RC 1S3OA 3TQYA 2ASBA 5GAGC 1HZCA 4MZ9A 4YCWA 3CC7A 3DM3A 1Y14B 2D62A 4QJFA 4DV0Q 2R92G 4BXXH 2ZTDA 2FXQA 4JI3L 3RN2A 1E1TA 2A19A 2I5MX 4UP7A 5C0XJ 4JYAQ 1VCIA 1UE1A 4LF7Q 4LFCL 2VQEL 2MQHA 3K7UC 3KF6A 1R9TH 1HZAA 3TEHB 1VQHA 4GKKQ 4DV0L 3GTPH 3HOXH 5IT9c 3GTLH 4YHHQ 4PG3A 1KD1C 5EAYA 2YV5A 1CUKA 2Q2IA 1NE3A 1WCMG 1SRUA 2CFMA 3A74A 3J7ZC 3CCEA 1VS0A 2AWNA 2UUBL 3HOZH 2RCNA 2IHEA 1WI5A 1IBKL 3K0XA 1SLJA 1YHAA 4GOPB 2JA5G 2KHJA 1P16A 1GVPA 4Y7NH 2AKWB 2NZHA 4JI2L 1MJEA 3AFPA 2E2IH 2JA5H 2GVAA 4DR4Q 4JYAL 1X65A 4BBRH 1O7IA 2VL6A 1B70B 2K50A 1IBKQ 3HOUG 1PH6A 3MXNB 3W1GA 2ALYB 4JI8Q 1TWAH 4C3JH 1X55A 2CKZB 2KBNA 1YJWA 1Q82C 1PH3A 4KHPQ 1I6HH 4DR5L 1QUQB 1WCMH 1GD7A 1OTCA 3S1NH 1W3SA 1NMGA 1CKMA 1UWVA 5JEAJ 5GAEC 2OTLA 3M4OH 1JB7A 2UUAQ 2E8GA 4JI1L 1V9PA 3SGIA 2IY5B 4LF8L 3I55A 1X9NA 2YYZA 4LW1A 4IFDI 3HKZG 4GKJQ 5E7NA 1IYJB 1Z9FA 2KCMA 1W2BA 2JA8H 1PYSB 5JEAG 3CC2A 2JE6I 2K75A 1KAWA 2N8NA 1SN8A 5ELOA 4L5TA 4GNXB 4A4IA 4A3FG 5IYBH 4A76A 1SFOH 4BA2I 4DR7L 3W1BA 3PF4A 1YI2A 4BBRG 1IBML 4AYBG 3CD6A 5FLMH 2JA6G 5IP7G 1VQPA 5C3EH 1PA6A 2JEBI 3GO5A 3CCMA 3HOXG 1HR0W 2OQ0A 4LF4L 1I5FA 2ZTCA 4AH6A 4JCVE 3RNUA 3GTJH 1QZHA 1YZ6A 4NPSA 4A3EH 3CC4A 1UE5A 1VQ8A 4DR7Q 5BR8L 4K0KL 1PH1A 5IYCH 2UXDL 1HNXQ 1HH2P 4H02A 1EOVA 4TQUS 1A62A 3PUXA 2LSSA 2V1CC 1N9WA 3ERSX 4OWTB 4GLXA 2HIXA 1PH2A 2IX1A 2R92H 1ASZA 2WP8J 1J5EL 1XMQQ 2A8VA 1D8LA 3PUWA 1K3RA 1Q12A 4HJ5A 2Y0SE 5LMUL 1KRTA 5M5XH 3PV0A 1Q1BA 1LUZA 2Z6KA 4DV6L 1JT8A 2HT1A 2BH8A 4IPCA 1XNQL 4DV7Q 1EIYB 4YCVA 3H0GG 1L1OA 4YY3Q 4R4OA 2F4VQ 2D0OA 1PFSA 2PQAB 1I94L 3S1QH 3STBC 1SMXA 2ZM6L 1E24A 4DR1Q 4A3BH 2BA1A 4DV1Q 1G291 1Y1VH 2UUBQ 1VQBA 3CP0A 4NXNL 3PO2G 3J81i 4A93G 1VQMA 4BBSH 2I5HA 1VQCA 1GKHA 2NN6G 4LFAQ 3A5UA 4C3HH 1QVGA 2JJQA 3KF6B 1YEZA 1PHJA 1N36L 3HOVH 3HOYH 3S16H 2B29A 3CCLA 3HKZE 2D0PA 4UP8A 5HY6A 3F2CA 3NBHB 4POGA 4LF4Q 3DLLA 2JA7H 4LUVA 1X56A 4JOIC 1UE6A 4UPAA 4HIMA 4IFDJ 4X65Q 3PF5A 3T1HL 2HHHQ 4HIKA 1GO3E 1WYDA 1WOCA 4A3DG 4LNQA 4DR6L 2F3IA 5IWAL 4A3IH 4MTNA 1XPRA 3ULJA 1A0IA 2XGTA 1N32L 4X66L 4C2MH 1IZ6A 4DV1L 4DR2Q 5C4XG 4LFCQ 4GN5A 2OCEA 2UXCL 3B6YA 3PUYA 3BZKA 3UDGA 4A3CH 5AJ3Q 4QIWE 1Y1WG 4LF6Q 3H3VI 4P71A 4DR3L 1X54A 5C0XG 3JC66 4GN4B 1H95A 1V43A 2UXBQ 3T1YQ 4OX9L 1Q81C 4B3ML 1PH9A 2JA8G 3M3YH 1KHIA 4JI7L 1L1OC 4WJ3M 2I5LX 4GOPC 1D7QA 2VW9A 2UXCQ 5M5WH 4RG1A 4DK6C 4FDBA 4GS3A 4ME3A 2R7DA 3VDYA 2MO1A 2CWAA 2ZJRA 1TXYA 1Q1EA 1TWGH 4L5QA 3RR5A 4UY8C 4A3MG 5LMNQ 3CF5A 4LF7L 5IYDH 1VQLA 1LM0A 4KLKA 4O0AA 2HHHL 2ES2A 1HR0Q 5JJIA 4JBMA 1VQ9A 1VQIA 2PI2A 4JOIA 4LUZA 1EQQA 3HFZB 1JJ2A 4GNXA 2VUMH 3AYHB 2R93H 1Z47A 3U4VA 4LF5L 3HOZG 1V1QA 2JA9A 1RIPA 4DKAC 3M4QA 1VQKA 4JI0L 1Q46A 3EN2A 4P73A 3ZJYC 4DV3Q 3OW2A 3I4MG 1SE8A 4DK3C 5M3MG 2IHFA 4NB3A 2F52A 2CQOA 1X6OA 4X62Q 5IP7H 4KHPL 1OXTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GQO A;  4LF5 Q;  2F4V L;  5GRO A;  1MIU A;  2E2H H;  4A3B G;  1HZB A;  4DV5 L;  2I0Q A;  1YJN A;  3S17 H;  2R93 G;  4R1J A;  4OWX B;  4JG2 A;  2GVB A;  4JI0 Q;  2NZO A;  3L2P A;  2CWP A;  2B63 H;  2B63 G;  1BBU A;  4L5S A;  4GLA C;  2UUC L;  2NVT H;  1E1O A;  4LFA L;  1VQD A;  1T9H A;  3U50 C;  3JAM c;  4K0K Q;  2UXD Q;  2VS1 A;  2YU9 H;  3NEN A;  3BU2 A;  1YIT A;  3KLW A;  1IXR A;  1EWI A;  3BZC A;  2QA4 A;  2VQF Q;  5LMN L;  3M4P A;  4A3L H;  2Q2T A;  3GDE A;  3KOJ A;  4B3T Q;  5K36 G;  2R7Z H;  1G51 A;  4PMW A;  3G6E A;  3CME A;  5M3F G;  3J81 c;  4DNI A;  1VQJ A;  3MEF A;  4MNO A;  1XMQ L;  1N33 Q;  3TS2 A;  4X64 Q;  3KDF B;  4TVA B;  4AQY L;  4EX5 A;  3E0E A;  3CPF A;  5LMU Q;  4DV6 Q;  1VQA A;  4JC0 A;  1QUQ A;  3GTK H;  4YWL A;  1IBL Q;  4A3G H;  2K5H A;  3S2D H;  1JMC A;  2R7F A;  3I56 A;  1XMO Q;  1JJG A;  1U5K A;  2XTI A;  4UP9 A;  4R4T A;  4JI5 L;  3CCS A;  1OXX K;  3J81 j;  4P75 A;  2K4K A;  2N78 A;  3F8T A;  1TWF H;  1I94 Q;  2E5L Q;  2BH2 A;  4HID A;  2DUD A;  5BR8 Q;  3OTO L;  2OWO A;  5IP9 G;  5IP9 H;  4A3K G;  5IYD G;  3OYY A;  4NXN Q;  3TRE A;  3JAM i;  2AHO B;  4XIG S;  5IWA Q;  2BA0 A;  3E9H A;  1G6P A;  4LF8 Q;  1CKN A;  4C3I H;  4R4I A;  3CCU A;  1NY4 A;  1VQO A;  1SR3 A;  1I3Q H;  1J5E Q;  4B3R L;  1N32 Q;  3A0J A;  4BBS G;  1VQN A;  3FP9 A;  3CCR A;  5DLQ E;  4JV5 L;  2WB1 G;  1HR0 L;  3BJU A;  4DR6 Q;  4DR3 Q;  1J6Q A;  4JBJ A;  3PCO B;  1S40 A;  3S2H H;  2MFI A;  3CCJ A;  1LYL A;  3UDX A;  1FL0 A;  4DR2 L;  1Y1W H;  5C4J H;  3F1Z A;  3S15 H;  2IX0 A;  3PIP A;  1PH8 A;  4JV5 Q;  3KJP A;  4LF6 L;  4GOP A;  2WAQ E;  3K80 C;  3G48 A;  4P74 A;  1QVC A;  3IRB A;  5C0X I;  4QQB X;  1CKO A;  2KCT A;  2ID0 A;  4APV A;  2ZJQ A;  1VQF A;  2QGQ A;  1YHB A;  1CSQ A;  2NVQ H;  2VZA A;  3TS0 A;  1XTD A;  4A3K H;  2MO0 A;  4KHZ A;  1Q8K A;  5M5Y H;  1N33 L;  3CMA A;  1C7Y A;  3RLF A;  5FJ8 H;  4P72 A;  1OXS C;  4PZ6 A;  1YVC A;  1PH4 A;  4OO1 I;  2Z0S A;  4B3S L;  4IO9 A;  1PH7 A;  2UU9 L;  4GKJ L;  1YBY A;  3AFQ A;  3LGJ A;  3F2B A;  4JBK A;  5JJK A;  4PZ8 A;  4EQ5 A;  1MKH A;  1C0A A;  1JE5 A;  4GLV B;  4AYB E;  4POF A;  5M3F H;  3HOV G;  4JI2 Q;  4BY1 H;  5ELN A;  2E5L L;  2OTJ A;  2PI2 E;  3D0F A;  2EXD A;  2N3S A;  2JQO A;  1K83 H;  4XTC S;  2K5V A;  3FKI H;  2UU9 Q;  1CSP A;  2YTY A;  4HJ8 A;  4B3S Q;  5IYB G;  1HJP A;  1TWH H;  2N49 A;  3RZD H;  3TRZ A;  2AWO A;  4Y52 H;  1EIF A;  1A8V A;  3UE0 A;  3T1Y L;  1NJI C;  4B3T L;  4OX9 Q;  1IL2 A;  2LXK A;  1TWC H;  2B3G A;  1NBW A;  4IPG A;  3E9I A;  1VQE A;  3KJO A;  1M90 C;  1HNZ L;  4JI6 Q;  2R7Z G;  1E3P A;  3CPW A;  1BBW A;  4DV2 Q;  3ULL A;  3M7N A;  3J7A 5;  2RF4 A;  1EUJ A;  1HNX L;  3GTO H;  4YHH L;  4LF9 L;  3H0G H;  1CKN B;  4HJ9 A;  1K73 C;  3U4Z A;  2Z6K C;  1HNZ Q;  4IJH A;  4DUZ L;  3KYH C;  1QZG A;  3T1H Q;  2AMC B;  4A3E G;  3I4O A;  2EIF A;  3W5O A;  4HIO A;  5J3B A;  3HOY G;  2WAQ G;  4HJ7 A;  3S1M H;  2JEA I;  1AH9 A;  1WJJ A;  3EBE A;  3S1R H;  4OON A;  4QL5 A;  1IBM Q;  1ASY A;  1Q7Y C;  1E7Z A;  1X3E A;  2H5X A;  1XPO A;  1KIX A;  4LUO A;  2RHS B;  2JA6 H;  4B3R Q;  1K8G A;  3KDF A;  5JJL A;  5H1S E;  4DUZ Q;  3RLN A;  5AJ3 L;  2K14 A;  3ULP A;  4A3L G;  5FJ8 G;  4QGU A;  2ZM6 Q;  3M85 A;  4LF9 Q;  3J80 i;  5GAD C;  4DR5 Q;  3S24 A;  1IBL L;  2VUM G;  5C4X H;  2DGY A;  3NEL A;  2IT1 A;  4IJL A;  3CW2 C;  5GAH C;  4A3F H;  1PH5 A;  3WWV A;  3RN5 A;  4A3D H;  1HZ9 A;  4GKK L;  3K81 C;  4RMF A;  3KF8 B;  4X62 L;  4AQY Q;  4X64 L;  1FVI A;  2K52 A;  4ALP A;  5FLX c;  1PV4 A;  3GD7 A;  1AE3 A;  3L7Z C;  4DV5 Q;  4GNX C;  3H3V H;  2NVY H;  2ZJP A;  2JA7 G;  3CCQ A;  4A3M H;  2JK8 A;  2NN6 I;  4JI5 Q;  2UUC Q;  3FHW A;  1VQ5 A;  1N34 Q;  3U58 A;  1EYG A;  4NXM Q;  5IYC G;  4OWW B;  1KXL A;  3STB D;  1L0W A;  3OTO Q;  4YWM A;  1XNR L;  3FKI G;  3F2D A;  1NMF A;  2YTV A;  4JI8 L;  4DV2 L;  1AE2 A;  4YCU A;  1HNW Q;  3UDI A;  2PNH A;  2R6G A;  3A5Z B;  3D31 A;  3EIV A;  2VQF L;  1DGS A;  4JI3 Q;  3RZO H;  3M9B A;  5C3E G;  1Q86 C;  4DR4 L;  1YHQ A;  4BXX G;  4IOC A;  2PMZ E;  4QY7 A;  4IPD A;  1EFW A;  2KEN A;  3UE1 A;  1FGU A;  1QVF A;  4R4Q A;  1N36 Q;  2UUA L;  1PVO A;  3I4N G;  4IFD G;  4X6A H;  2L15 A;  4A3J H;  2NVX H;  4LFB L;  1VQ4 A;  4DV3 L;  4A3C G;  5LMN W;  2Y0S G;  3K7A H;  1XPU A;  1E22 A;  2OQK A;  4YWK A;  2VQE Q;  1MJC A;  1JJC B;  2HIV A;  2E2J H;  4JI4 L;  3ER0 A;  1L1O B;  1YIJ A;  3KFU A;  3PSI A;  1I50 H;  2LXJ A;  1B8A A;  3PO2 H;  2PQA A;  4DAM A;  1SRO A;  4DV4 Q;  1UEB A;  4IPH A;  4L5R C;  2RHQ B;  3NEM A;  2ZTE A;  4LFB Q;  2YTX A;  3UDF A;  4JI6 L;  4DV7 L;  3K8A A;  1A63 A;  3GTQ H;  1K8A C;  3GTG H;  1BKB A;  3PUV A;  1NTG A;  1XJV A;  3G71 A;  2Q2H A;  1KL9 A;  1B7Y B;  2VNU D;  3RLO A;  5HGQ A;  2UXB L;  4DV4 L;  1EQR A;  3L0O A;  3I2Z A;  1P8L A;  5IE8 A;  3HOU H;  1LTL A;  3ICE A;  4BY7 H;  1C9O A;  3J80 c;  3AEV A;  4IOA A;  2A1A A;  3PO3 G;  1Y1V G;  1FJG L;  4A93 H;  1YJ9 A;  1S72 A;  1XNR Q;  4JI4 Q;  4OO1 G;  5IY0 A;  3CCV A;  2GN5 A;  4BA1 I;  3G4S A;  4NXM L;  2QEX A;  3HKS A;  3PGZ A;  1KQS A;  2CCZ A;  3GTM H;  3PUZ A;  4HJA A;  1K0R A;  1YNX A;  2K5N A;  3CAM A;  4DUY L;  3AQQ A;  1VQG A;  2KHI A;  4JI7 Q;  2HQL A;  2WB1 E;  4X65 L;  1FJG Q;  3PO3 H;  4O2D A;  4BY7 G;  4PZ7 A;  1OXU A;  2MNA A;  1XMO L;  1KC8 C;  4BY1 G;  3I7F A;  3PIO A;  4JBW A;  4R4C A;  4A3I G;  1M1K C;  1KRS A;  4J15 A;  5M3M H;  3H15 A;  2EQS A;  2WFW A;  3I4M H;  4AIM A;  3S14 H;  4DUY Q;  2ATW A;  1X3F A;  4X66 Q;  4A3G G;  4YY3 L;  1UE7 A;  1X3G A;  1VQ7 A;  1VQ6 A;  3HOW H;  2VY3 A;  3CXC A;  1L2F A;  4DR1 L;  1PYB A;  2C35 B;  4LWC A;  3HOW G;  4GN3 B;  1XNQ Q;  4OXP A;  3Q8D A;  4WJ4 A;  1BVS A;  4B3M Q;  4DAY B;  1K9M C;  4JI1 Q;  2Q2U A;  1GM5 A;  4DPG A;  1RL2 A;  4A75 A;  1N34 L;  5C44 H;  5C44 G;  1HNW L;  1OXV A;  4A3J G;  1WFQ A;  1U0L A;  4KI0 A;  5FLM G;  3I4N H;  3CQZ H;  1N8R C;  1S3O A;  3TQY A;  2ASB A;  5GAG C;  1HZC A;  4MZ9 A;  4YCW A;  3CC7 A;  3DM3 A;  1Y14 B;  2D62 A;  4QJF A;  4DV0 Q;  2R92 G;  4BXX H;  2ZTD A;  2FXQ A;  4JI3 L;  3RN2 A;  1E1T A;  2A19 A;  2I5M X;  4UP7 A;  5C0X J;  4JYA Q;  1VCI A;  1UE1 A;  4LF7 Q;  4LFC L;  2VQE L;  2MQH A;  3K7U C;  3KF6 A;  1R9T H;  1HZA A;  3TEH B;  1VQH A;  4GKK Q;  4DV0 L;  3GTP H;  3HOX H;  5IT9 c;  3GTL H;  4YHH Q;  4PG3 A;  1KD1 C;  5EAY A;  2YV5 A;  1CUK A;  2Q2I A;  1NE3 A;  1WCM G;  1SRU A;  2CFM A;  3A74 A;  3J7Z C;  3CCE A;  1VS0 A;  2AWN A;  2UUB L;  3HOZ H;  2RCN A;  2IHE A;  1WI5 A;  1IBK L;  3K0X A;  1SLJ A;  1YHA A;  4GOP B;  2JA5 G;  2KHJ A;  1P16 A;  1GVP A;  4Y7N H;  2AKW B;  2NZH A;  4JI2 L;  1MJE A;  3AFP A;  2E2I H;  2JA5 H;  2GVA A;  4DR4 Q;  4JYA L;  1X65 A;  4BBR H;  1O7I A;  2VL6 A;  1B70 B;  2K50 A;  1IBK Q;  3HOU G;  1PH6 A;  3MXN B;  3W1G A;  2ALY B;  4JI8 Q;  1TWA H;  4C3J H;  1X55 A;  2CKZ B;  2KBN A;  1YJW A;  1Q82 C;  1PH3 A;  4KHP Q;  1I6H H;  4DR5 L;  1QUQ B;  1WCM H;  1GD7 A;  1OTC A;  3S1N H;  1W3S A;  1NMG A;  1CKM A;  1UWV A;  5JEA J;  5GAE C;  2OTL A;  3M4O H;  1JB7 A;  2UUA Q;  2E8G A;  4JI1 L;  1V9P A;  3SGI A;  2IY5 B;  4LF8 L;  3I55 A;  1X9N A;  2YYZ A;  4LW1 A;  4IFD I;  3HKZ G;  4GKJ Q;  5E7N A;  1IYJ B;  1Z9F A;  2KCM A;  1W2B A;  2JA8 H;  1PYS B;  5JEA G;  3CC2 A;  2JE6 I;  2K75 A;  1KAW A;  2N8N A;  1SN8 A;  5ELO A;  4L5T A;  4GNX B;  4A4I A;  4A3F G;  5IYB H;  4A76 A;  1SFO H;  4BA2 I;  4DR7 L;  3W1B A;  3PF4 A;  1YI2 A;  4BBR G;  1IBM L;  4AYB G;  3CD6 A;  5FLM H;  2JA6 G;  5IP7 G;  1VQP A;  5C3E H;  1PA6 A;  2JEB I;  3GO5 A;  3CCM A;  3HOX G;  1HR0 W;  2OQ0 A;  4LF4 L;  1I5F A;  2ZTC A;  4AH6 A;  4JCV E;  3RNU A;  3GTJ H;  1QZH A;  1YZ6 A;  4NPS A;  4A3E H;  3CC4 A;  1UE5 A;  1VQ8 A;  4DR7 Q;  5BR8 L;  4K0K L;  1PH1 A;  5IYC H;  2UXD L;  1HNX Q;  1HH2 P;  4H02 A;  1EOV A;  4TQU S;  1A62 A;  3PUX A;  2LSS A;  2V1C C;  1N9W A;  3ERS X;  4OWT B;  4GLX A;  2HIX A;  1PH2 A;  2IX1 A;  2R92 H;  1ASZ A;  2WP8 J;  1J5E L;  1XMQ Q;  2A8V A;  1D8L A;  3PUW A;  1K3R A;  1Q12 A;  4HJ5 A;  2Y0S E;  5LMU L;  1KRT A;  5M5X H;  3PV0 A;  1Q1B A;  1LUZ A;  2Z6K A;  4DV6 L;  1JT8 A;  2HT1 A;  2BH8 A;  4IPC A;  1XNQ L;  4DV7 Q;  1EIY B;  4YCV A;  3H0G G;  1L1O A;  4YY3 Q;  4R4O A;  2F4V Q;  2D0O A;  1PFS A;  2PQA B;  1I94 L;  3S1Q H;  3STB C;  1SMX A;  2ZM6 L;  1E24 A;  4DR1 Q;  4A3B H;  2BA1 A;  4DV1 Q;  1G29 1;  1Y1V H;  2UUB Q;  1VQB A;  3CP0 A;  4NXN L;  3PO2 G;  3J81 i;  4A93 G;  1VQM A;  4BBS H;  2I5H A;  1VQC A;  1GKH A;  2NN6 G;  4LFA Q;  3A5U A;  4C3H H;  1QVG A;  2JJQ A;  3KF6 B;  1YEZ A;  1PHJ A;  1N36 L;  3HOV H;  3HOY H;  3S16 H;  2B29 A;  3CCL A;  3HKZ E;  2D0P A;  4UP8 A;  5HY6 A;  3F2C A;  3NBH B;  4POG A;  4LF4 Q;  3DLL A;  2JA7 H;  4LUV A;  1X56 A;  4JOI C;  1UE6 A;  4UPA A;  4HIM A;  4IFD J;  4X65 Q;  3PF5 A;  3T1H L;  2HHH Q;  4HIK A;  1GO3 E;  1WYD A;  1WOC A;  4A3D G;  4LNQ A;  4DR6 L;  2F3I A;  5IWA L;  4A3I H;  4MTN A;  1XPR A;  3ULJ A;  1A0I A;  2XGT A;  1N32 L;  4X66 L;  4C2M H;  1IZ6 A;  4DV1 L;  4DR2 Q;  5C4X G;  4LFC Q;  4GN5 A;  2OCE A;  2UXC L;  3B6Y A;  3PUY A;  3BZK A;  3UDG A;  4A3C H;  5AJ3 Q;  4QIW E;  1Y1W G;  4LF6 Q;  3H3V I;  4P71 A;  4DR3 L;  1X54 A;  5C0X G;  3JC6 6;  4GN4 B;  1H95 A;  1V43 A;  2UXB Q;  3T1Y Q;  4OX9 L;  1Q81 C;  4B3M L;  1PH9 A;  2JA8 G;  3M3Y H;  1KHI A;  4JI7 L;  1L1O C;  4WJ3 M;  2I5L X;  4GOP C;  1D7Q A;  2VW9 A;  2UXC Q;  5M5W H;  4RG1 A;  4DK6 C;  4FDB A;  4GS3 A;  4ME3 A;  2R7D A;  3VDY A;  2MO1 A;  2CWA A;  2ZJR A;  1TXY A;  1Q1E A;  1TWG H;  4L5Q A;  3RR5 A;  4UY8 C;  4A3M G;  5LMN Q;  3CF5 A;  4LF7 L;  5IYD H;  1VQL A;  1LM0 A;  4KLK A;  4O0A A;  2HHH L;  2ES2 A;  1HR0 Q;  5JJI A;  4JBM A;  1VQ9 A;  1VQI A;  2PI2 A;  4JOI A;  4LUZ A;  1EQQ A;  3HFZ B;  1JJ2 A;  4GNX A;  2VUM H;  3AYH B;  2R93 H;  1Z47 A;  3U4V A;  4LF5 L;  3HOZ G;  1V1Q A;  2JA9 A;  1RIP A;  4DKA C;  3M4Q A;  1VQK A;  4JI0 L;  1Q46 A;  3EN2 A;  4P73 A;  3ZJY C;  4DV3 Q;  3OW2 A;  3I4M G;  1SE8 A;  4DK3 C;  5M3M G;  2IHF A;  4NB3 A;  2F52 A;  2CQO A;  1X6O A;  4X62 Q;  5IP7 H;  4KHP L;  1OXT A; 
#chains in the Genus database with same CATH topology
 3MTS A;  1I6H B;  2F4V L;  4NP5 A;  4A3B G;  2ICE C;  3HKZ B;  4DV5 L;  4K14 A;  1PXU A;  5C4J B;  3L2P A;  4L5S A;  1HTP A;  3HRZ C;  2DNE A;  1SSO A;  1T9H A;  3W3A A;  3U50 C;  2VS1 A;  2N55 A;  3BU2 A;  4X3T A;  3WOE A;  1IXR A;  2VQF Q;  3GDE A;  3SDZ A;  3GTL B;  5K36 G;  4PMW A;  4DAV A;  4DNI A;  1VQJ A;  4MNO A;  1XMQ L;  1N33 Q;  3IKJ A;  3TS2 A;  4X64 Q;  4TVA B;  2IX3 A;  1K0S A;  2HD3 A;  1QUQ A;  3GTK H;  1ZEQ X;  3S2D H;  1J9O A;  2R7F A;  1AW7 A;  3OW7 A;  3I56 A;  1JJG A;  4JI5 L;  4H7B A;  1IL8 A;  2R3Z A;  3BDO A;  1TWF H;  2E5L Q;  2L5T A;  2RSN A;  1SXT A;  1KNE A;  1I4R A;  2L11 A;  2N88 A;  3NTK A;  4NXN Q;  4HSV A;  4RHS A;  4HCE A;  1QE6 A;  4HR7 B;  4P2C B;  1SYC A;  1ZXT A;  1CTM A;  2AHO B;  1YNJ D;  5EKK A;  3TRE A;  1G6P A;  1CKN A;  5G3L F;  4C3I H;  1VQO A;  1PYW D;  3CCU A;  5COR A;  1N32 Q;  2A68 C;  1LV9 A;  3NXW A;  1ET6 A;  5DLQ E;  4JV5 L;  3BJU A;  2Z9H A;  3DWQ A;  1PRT F;  4R9W A;  4UHV A;  4JBJ A;  3S2H H;  3CCJ A;  2OT2 A;  3UDX A;  1EY5 A;  1K8M A;  4LK1 C;  1HA6 A;  5C4J H;  3S15 H;  2PZT A;  3QIA A;  4JV5 Q;  4LF6 L;  4GOP A;  4KJO A;  5C0X I;  4QQB X;  1C4Q A;  1B1Z A;  3M4O B;  5DNF A;  4XDX A;  1Q8K A;  1N33 L;  2F0S A;  3HZX A;  5M5X B;  1C7Y A;  3HOU B;  4P72 A;  4BY7 B;  2F0G A;  4IO9 A;  4GKJ L;  3AFQ A;  4JBK A;  3F2B A;  4PZ8 A;  4EQ5 A;  1JE5 A;  4POF A;  3BYT B;  2WV6 D;  1H9M A;  2PI2 E;  2B2U A;  4CDD C;  3D0F A;  1AP0 A;  1S5C D;  1Y8O B;  2N3S A;  1W6J A;  2JQO A;  3DUZ A;  5C6A A;  5IT9 L;  4B3S Q;  2BE5 D;  4A3D B;  1HJP A;  2N49 A;  5K36 H;  1LTG D;  1DOM A;  1A8V A;  4U68 A;  3T1Y L;  1NJI C;  3VR6 A;  4B3T L;  2QF7 A;  1TWC H;  2B3G A;  2R7Z G;  4JI6 Q;  3CPW A;  4DV2 Q;  3ULL A;  3M7N A;  3J7A 5;  2FMC A;  1EUJ A;  1PFB A;  1QJO A;  3W2D A;  3J81 E;  2JA8 B;  1HNZ Q;  2Z6K C;  3KYH C;  3I4O A;  1JIC A;  3W5O A;  2WAQ G;  4HJ7 A;  4QB4 A;  5CMD A;  3S1R H;  4QL5 A;  3FRP B;  1Q7Y C;  1XPO A;  2RHS B;  4XYO A;  1JOK A;  2K14 A;  4HTH A;  5IOC A;  4CJ2 C;  1IBL L;  1E0B A;  5HUR A;  3NEL A;  4A3F H;  5GAH C;  3RN5 A;  3K81 C;  3FMC A;  5IGC A;  4PQX A;  3U9S A;  3GD7 A;  1ENC A;  3H3V H;  1GXD C;  1SDF A;  2C9O A;  4ULL A;  4ZYS A;  2JA6 B;  1HHV A;  4A3M H;  1NCV A;  4JI5 Q;  4IUN A;  4QMG A;  3U58 A;  5IYC G;  4OWW B;  1BR9 A;  2DNC A;  2AQ3 B;  3BVG A;  4FXK C;  4DV2 L;  2F0T A;  3UDI A;  1E2W A;  4KN7 C;  1SJE D;  2VQF L;  2RKS A;  4ID6 A;  3K6O A;  2V4D A;  5C3E G;  2FMM A;  1YHQ A;  2K01 A;  4MTK A;  2PMZ E;  1EFW A;  3UE1 A;  1HPC A;  4PMC A;  1GUO A;  4A3J H;  1VQ4 A;  5LMN W;  1RJT A;  2HIV A;  1L1O B;  1YIJ A;  3EJI A;  1T5E A;  4LAA A;  3E0J A;  2VB2 X;  4L5R C;  4A3D H;  2LY7 A;  4IPH A;  1UEB A;  1JC7 A;  1KDA A;  3MXU A;  3UDF A;  3K8A A;  3GTQ H;  2A74 C;  3H3V C;  3AB9 A;  3I72 A;  2NN6 H;  1XJV A;  4IQZ A;  2Q2H A;  5IGF A;  1KLU D;  3I2Z A;  4CDF C;  5IE8 A;  3HOU H;  5AFW A;  4KHP L;  4ZUJ A;  1Y1V G;  1S72 A;  4OO1 G;  3NP8 A;  1F9Q A;  3CCV A;  5E3F A;  4DGZ A;  2GN5 A;  3G4S A;  4DAP A;  4NXM L;  3HKS A;  3PGZ A;  4IN3 A;  3GTM H;  2K5N A;  3TZD A;  2WB1 E;  4DF7 A;  4XXE A;  3S15 B;  2MNA A;  1GJX A;  1KC8 C;  4I65 A;  1FGB D;  2Q8T A;  2ZXR A;  5M3M H;  2ATW A;  3I73 A;  4A3F B;  1X3F A;  1TII D;  2SNS A;  2IPK D;  4XYQ A;  3CXC A;  3HOW G;  4GN3 B;  1R4P B;  3S1Q B;  1SYD A;  4WJ4 A;  2B39 A;  2MHV A;  3T16 A;  2M9V A;  1N34 L;  5C44 G;  1WTV A;  4X3S A;  1WFQ A;  5EPJ A;  4IFD H;  4KI0 A;  3C2P A;  3BS1 A;  1S3O A;  2A73 B;  3TQY A;  2OXP A;  5M9O A;  1HZC A;  2EY5 A;  4MZ9 A;  4QJF A;  4CJ1 B;  2ZTD A;  4U67 3;  2IWH A;  3KBG A;  3S2D B;  1CA5 A;  1M8A A;  2NWG A;  4LFC L;  5FO8 B;  3Q22 A;  1Z7T A;  3MC0 B;  4YIJ A;  4C3I G;  3NUC A;  3TEH B;  4KD3 A;  1PTO D;  2B2Y C;  5IT9 c;  1CFM A;  4PG3 A;  1KD1 C;  5ELC A;  5EAY A;  2J7Z A;  3DMU A;  2EJG C;  2J0T D;  4B08 A;  2UUB L;  3A74 A;  4NMZ A;  1HTL D;  1S5B D;  4C3J G;  2KHJ A;  1NSN S;  2AKW B;  5M3M B;  3S14 B;  4DR4 Q;  2JA5 H;  2GVA A;  4RGN A;  5JVH 3;  3W1G A;  2ALY B;  1JOO A;  2KBN A;  1F9S A;  3Q23 A;  1OTC A;  1STH A;  1I4Q A;  3S1N H;  1NMG A;  1UWV A;  1RHP A;  1GHJ A;  1WCM B;  4RAU C;  2IY5 B;  3OPO A;  1G2T A;  2YYZ A;  2PPB C;  4V19 0;  1IYJ B;  1Z9F A;  3SE0 A;  2X6G A;  1W2B A;  4NDX A;  1PYS B;  1RD9 D;  2B2W A;  2JE6 I;  1S4Z A;  4A3F G;  3LWE A;  2JXM B;  2M00 A;  3PF4 A;  4BBR G;  4HAE A;  2KHS A;  4AYB G;  2QDB A;  3T13 A;  1EZ8 A;  3A8J E;  1FD7 D;  2EY2 A;  4CGY B;  2BOS A;  1VQP A;  1PA6 A;  3G6J B;  1FYC A;  4LF4 L;  3RNU A;  2ZTC A;  5CV9 A;  4JCV E;  5BN5 A;  3GTJ H;  3OWF A;  1ROD A;  4K0K L;  2UXD L;  1HH2 P;  3M3Y B;  2MUY A;  1EOV A;  1CQV A;  1KAB A;  1STN A;  2G9H D;  4OWT B;  2LSS A;  5FLX L;  1G6Z A;  3OIQ A;  4JPB W;  1ASZ A;  1F2Y A;  4E6I A;  2A8V A;  3PUW A;  5ELF A;  5M5X H;  1LUZ A;  1HUN A;  2A6E D;  1XNQ L;  1EY7 A;  1KAA A;  4YCV A;  2QW7 A;  1LLR D;  2HQE A;  5KRU A;  1CI3 M;  2D0O A;  2PQA B;  4XQJ A;  4DV1 Q;  4XQN A;  1LT5 D;  3PO2 G;  3J81 i;  1O7Y A;  4BBS H;  1F9R A;  4C3H H;  1QVG A;  3KF6 B;  1EEI D;  4NKL A;  4RH6 A;  1GUN A;  5DM7 3;  1N36 L;  2EYL A;  2B29 A;  3HKZ E;  1H9S A;  5HY6 A;  3NBH B;  1CHP D;  2VXW A;  4R8I A;  2XWJ B;  4LUV A;  4ZKC B;  4UPA A;  4HIM A;  3PF5 A;  2HHH Q;  3I91 A;  3CRL C;  1W6K A;  2F3I A;  3D4R A;  4A3I H;  4B9W A;  1B4O A;  4OIK A;  3ULJ A;  1WD1 A;  4DXF A;  1ILP A;  2XGT A;  3FEW X;  1STB A;  3B6Y A;  4LF6 Q;  4DR3 L;  5C0X G;  1H95 A;  3BZD B;  1V43 A;  1SMY D;  5T1G A;  2SNM A;  1PH9 A;  1I4G A;  1L1O C;  5COY A;  1PTO H;  4KJN A;  4GS3 A;  2MO1 A;  4F88 A;  1Q1E A;  2F0I A;  4L5Q A;  1O7Z A;  2PNR C;  5IYD H;  3JAM E;  1KTK A;  1EU3 A;  2RDG A;  2KUM A;  5M3F B;  2HHH L;  3A8K E;  1HR0 Q;  2PI2 A;  1QOH A;  1SJH D;  3HFZ B;  2EOT A;  1JJ2 A;  1DCZ A;  2B2T C;  3MAQ A;  2VUM H;  2R93 H;  1B44 D;  1WVL A;  4LF5 L;  1RIP A;  4EQO A;  2F0L A;  3EN2 A;  4P73 A;  3WDN A;  5ISR A;  1LT4 D;  4C3H G;  5M3M G;  1NUC A;  5KYL A;  1X6O A;  4X62 Q;  5IP7 H;  1OXT A;  4QY7 A;  2QIL A;  2NVY B;  5I9O A;  5GQO A;  4LF5 Q;  2B2V C;  2E2H H;  5EBD A;  1HZB A;  1EY9 A;  4JG2 A;  4KD4 A;  2E2I B;  2CWP A;  3S2H B;  1E1O A;  1EQT A;  5CV7 A;  4LFA L;  3K5L A;  3WOF A;  3JAM c;  4K0K Q;  2PYK A;  2UXD Q;  3HOZ B;  3DM1 A;  4Z9C B;  2NYZ D;  3KLW A;  1I3Q B;  2QA4 A;  4WFN 3;  4A3L H;  5D65 A;  2HCC A;  3HOX B;  3G6E A;  4C1N K;  3MEF A;  1ML0 D;  3DXJ C;  2DY8 A;  1EY0 A;  1JB3 A;  1F2Z A;  4CKB A;  3CPF A;  5LMU Q;  3FPU B;  2IW3 A;  1A6X A;  4A3G H;  2K5H A;  2EXZ A;  1CZG A;  1JWU D;  4K5X A;  1TKW B;  1JMC A;  2XTI A;  4G4K A;  3GTK B;  1BCP F;  2QCP X;  3MFG A;  4HID A;  2OWO A;  5IP9 G;  3TME A;  2CHB D;  1PZI D;  3I70 A;  3M7G A;  4XIG S;  5IWA Q;  3E9H A;  3LWU A;  1RTO A;  2EY6 A;  5L37 A;  3TP6 A;  3CCR A;  2WB1 G;  1Z6H A;  2XIW A;  3MA2 B;  1S40 A;  2NBF A;  4DU9 A;  3K59 A;  1L0Y B;  2R61 A;  3P75 A;  1PH8 A;  3J80 E;  2MP1 A;  3IRB A;  4ZK9 B;  1CKO A;  2WAQ B;  3GV3 A;  3U9O A;  1YHB A;  1CSQ A;  5ELB A;  4L6T B;  2H4O A;  2BDO A;  3OOC A;  3CMA A;  1V1P A;  3RLF A;  3X3M A;  2Z0S A;  5D3I B;  1HQR D;  1QWY A;  1LAB A;  3LGJ A;  4TRD A;  5JJK A;  1MKH A;  5JVG 3;  1GHK A;  5ELN A;  2OTJ A;  3V2T A;  5CR3 A;  2K5V A;  1LAC A;  2Z8L A;  4IUQ A;  5TSS A;  5IYB G;  3TRZ A;  1EY6 A;  1IL2 A;  3UE0 A;  1G2S A;  4IPG A;  1HNZ L;  2LS0 1;  1ESF A;  2ZT9 C;  4ZKB B;  2CQA A;  3NBI A;  1PTO B;  4B9X A;  3JAM L;  1EZ6 A;  3GV6 A;  3GTO H;  1LTR D;  4YHH L;  1DM0 B;  3U4Z A;  4F7X A;  1E2V A;  3KLS X;  1GOZ A;  4IJH A;  1QZG A;  2EIF A;  4X3K A;  4HIO A;  5J3B A;  2FHT A;  5I9P A;  2JEA I;  1WJJ A;  3EBE A;  2NVQ B;  4OON A;  1IW7 D;  2F0V A;  2H5X A;  4B3R Q;  3K57 A;  5JJL A;  4DUZ Q;  2EYP A;  3ULP A;  3AMU A;  1RTN A;  4DR5 Q;  5C3X A;  2DGY A;  3OMC A;  3HOV B;  2BDN A;  1Y69 U;  1YNN D;  4C3H B;  2NUC A;  3KF8 B;  2K04 A;  2K52 A;  5KNC A;  3L7Z C;  2ENB A;  4DV5 Q;  3R2I A;  2ZJP A;  1JR0 D;  3LX0 A;  1RCV D;  3FHW A;  1A3U A;  2B2V A;  1KXL A;  3STB D;  1TS3 A;  4H13 C;  3H09 A;  3F2D A;  5JAV A;  1I6V C;  1F2L A;  4FF2 A;  2DY7 A;  2VUM B;  3D31 A;  3A5Z B;  1Q86 C;  1ICW A;  2B2Y A;  4IPD A;  4FXD A;  5D14 A;  2PCF B;  1UEA B;  4DAY A;  3SK4 A;  2UUA L;  1B53 A;  3QO2 A;  4LFB L;  4WRD A;  2Y0S G;  2OQK A;  2VQE Q;  4RGT A;  5LHY 1;  3ER0 A;  3KFU A;  1DZ1 A;  3PSI A;  3RMH A;  1UUP A;  2DJF C;  5LL6 X;  2YTX A;  5KEE A;  2JN4 A;  1D6E C;  5CBE E;  3NQT A;  1K8A C;  4FVM A;  1TT2 A;  1WTQ A;  1HXY D;  3G71 A;  4IUP A;  3VYS A;  3RLO A;  1EY4 A;  3L0O A;  2F0M A;  3CHB D;  5EKL A;  1P8L A;  1LTL A;  2A1A A;  3PO3 G;  1FJG L;  2WB1 B;  4I7Z C;  2F3W A;  2F0N A;  4X3U A;  1YNJ C;  2CCZ A;  1DJR D;  3ERQ A;  4HJA A;  2FJ2 A;  2HQL A;  4QUC A;  4O2D A;  3RD4 A;  4BY7 G;  1X32 A;  2EYO A;  4BY1 G;  3TP7 A;  4JBW A;  1KRS A;  2SEB D;  3H15 A;  1AZP A;  4AIM A;  1BCP C;  3H94 A;  4X66 Q;  4A3G G;  4TKO B;  1UE7 A;  2E2D C;  1Q8I A;  3IL8 A;  1VQ7 A;  1EYA A;  2C35 B;  4LWC A;  2Z4I A;  5IGD A;  1VMC A;  3Q8D A;  1Q90 A;  1MI2 A;  1B3A A;  2E2J B;  1IHZ A;  4LMQ D;  2Q2U A;  4JI1 Q;  5IGE A;  4A75 A;  1SE2 A;  3D6C A;  5M5W B;  2A6H C;  1OXV A;  1HFN A;  2RBM A;  4EQN A;  5FLM G;  2CVR A;  3CQZ H;  4RKB A;  3MEH A;  4R8N A;  1D1K A;  5GAG C;  5BN3 A;  3RN2 A;  5C5L A;  3V96 A;  2PW5 A;  1WTP A;  1D1I A;  5C0X J;  5EPL A;  1K3B C;  1UE1 A;  5C44 B;  4LF7 Q;  3L9A X;  1U9R A;  3K7U C;  1HZA A;  4L8J A;  4DV0 L;  4GKK Q;  4YHH Q;  3A55 A;  1CUK A;  1SEB D;  1NE3 A;  2CFM A;  1SRU A;  4IFD I;  1VS0 A;  1IBK L;  1HFG A;  1K83 B;  4GOP B;  4FP5 D;  1KNA A;  1P16 A;  4Y7N H;  3I4M B;  2KQ3 A;  4BY1 B;  4LJZ C;  3AFP A;  4IUU A;  1BQQ T;  1X65 A;  1WTH A;  2VL6 A;  3S17 B;  3HOU G;  4JI8 Q;  1TWA H;  3MXN A;  4C3J H;  1X55 A;  4JK1 C;  3D6W A;  1LTB D;  1JWM D;  1CKM A;  5GAE C;  1S5D D;  1JB7 A;  2UUA Q;  2E8G A;  1QNU A;  2XSC A;  2WKD A;  3SGI A;  3VA5 A;  5A2Q L;  3I55 A;  1X9N A;  1CM9 A;  5KND A;  1BOS A;  2IJ0 A;  2R93 B;  4DNR B;  4O42 A;  2KCM A;  5KIX A;  1HQM C;  3CC2 A;  1B9M A;  1SN8 A;  2VB3 X;  4A4I A;  1SNO A;  3A54 A;  1EY8 A;  4RCO A;  4N9P A;  3VA7 A;  2EJF C;  2A6H D;  4G7O C;  2F4I A;  5C3E H;  1AEX A;  3GO5 A;  3CCM A;  1HR0 W;  1EQV A;  1R9T B;  4AH6 A;  1A3V A;  4ZAI A;  4NPS A;  4A3E H;  3CC4 A;  4DR7 Q;  5BR8 L;  5IYC H;  1HNX Q;  4H02 A;  4TQU S;  3I8Z A;  3PUX A;  2V1C C;  3KBX A;  2IX1 A;  2HUG A;  4KV6 A;  1J5E L;  3GQB A;  1K3R A;  1Q12 A;  4DV6 L;  2HT1 A;  2BH8 A;  4IPC A;  4EQP A;  1MSG A;  2XN9 C;  3R8B A;  2K03 A;  2Z4H A;  2F4V Q;  2PZW A;  1U4R A;  1I94 L;  1PFS A;  3S1Q H;  2D5D A;  1SAP A;  1SMX A;  4DXG A;  4DR1 Q;  2BA1 A;  3BG3 A;  1IYU A;  4KMU C;  1G29 1;  4A93 G;  1VQB A;  3CP0 A;  4BBR B;  1VQC A;  2F0J A;  5G3L D;  4LFA Q;  3A5U A;  2KEC A;  1BCP D;  3HOY H;  3CCL A;  3NBH A;  2D0P A;  1ZKO A;  4UP8 A;  3NQI A;  3SXH A;  4POG A;  4LF4 Q;  1A2T A;  4K2L A;  4JOI C;  3K5M A;  2L12 A;  4HIK A;  1WYD A;  2RDF A;  4DR6 L;  4A3D G;  4MTN A;  1XPR A;  3CU7 A;  1A0I A;  3AU7 A;  1CK1 A;  1N32 L;  4DR2 Q;  4DV1 L;  2RA4 A;  2UXC L;  2DN8 A;  3PUY A;  3UDG A;  4A3C H;  2RCF A;  5AJ3 Q;  1Y1W G;  2BCO A;  2KED A;  4RGO S;  2RDH A;  4DA2 A;  1MGS A;  4OEL B;  2JA8 G;  1KLG D;  1KHI A;  2F0P A;  3M3Y H;  3C46 A;  2TMP A;  4DK6 C;  1H9K A;  1EWC A;  3KUP A;  4FDB A;  4XT1 B;  3D4D A;  1TWG H;  1SND A;  3KLR A;  2K5D A;  4A3M G;  5LMN Q;  3OMG A;  1VQL A;  1AFP A;  4H44 C;  3KK7 A;  4O0A A;  3Q24 A;  5CV4 A;  5JJI A;  4G7H C;  1QIL A;  4JOI A;  4LUZ A;  1EQQ A;  2JP1 A;  4CDE C;  4FYD A;  1SNM A;  3U4V A;  1V1Q A;  3TN2 A;  1U4M A;  4DKA C;  3M4Q A;  3GTM B;  1S5E D;  2CH4 A;  4L63 B;  2K6A A;  3QR8 A;  3I4M G;  4DK3 C;  2XRS D;  4NB3 A;  4QCL A;  2F52 A;  2K7V A;  5GRO A;  1MIU A;  3URY A;  3MXP A;  4OWX B;  2RSO A;  1B3Q A;  4PMB A;  4JI0 Q;  2NZO A;  2B63 H;  1BBU A;  2UUC L;  1NR2 A;  1HRJ A;  3ERO A;  1VQD A;  1YNN C;  4BBS B;  2JYO A;  5CV8 A;  3BDL A;  1BF4 A;  2YU9 H;  3NEN A;  1YIT A;  5LMN L;  1EWI A;  3BZC A;  1CZW A;  1DOK A;  1C8C A;  3M4P A;  2WII B;  4S3S A;  5NUC A;  3KOJ A;  4B3T Q;  2R7Z H;  1G51 A;  3CME A;  5M3F G;  2L0C A;  4ODG A;  3J81 c;  1S5F D;  3TSS A;  1QG7 A;  1EOT A;  3S1R B;  1LTA D;  3DEO A;  4AQY L;  4EX5 A;  1VQA A;  1FNU A;  4JC0 A;  1IBL Q;  5J39 A;  2LMC B;  2F1M A;  4UP9 A;  1ZYR D;  4KY6 A;  4A3G B;  1OXX K;  3J81 j;  4P75 A;  4FF4 A;  4V0B A;  2AUJ D;  5IP9 H;  4A3K G;  3H6M A;  3L3O C;  5IYD G;  3OYY A;  2B2W C;  5IIF A;  1ET9 A;  2B2T A;  1TS5 A;  3JAM i;  4A3I B;  1O80 A;  1LTS D;  1I3Q H;  1SR3 A;  1EIH A;  3VYT A;  1HR0 L;  3QG1 A;  4DR6 Q;  1F77 A;  3NTH A;  3A56 A;  2NVT B;  1GUW A;  3PCO B;  5I6Y A;  1FL0 A;  4DR2 L;  1I4P A;  3F1Z A;  2E76 C;  2WAQ E;  1BCP B;  3K80 C;  4ZCK A;  4FXG C;  1HA5 A;  2GA4 B;  1C48 A;  2H1E A;  2KCT A;  3F2U A;  1VQF A;  2QGQ A;  4RFB A;  3TS0 A;  4A3K H;  4KHZ A;  1D2B A;  3D8G A;  5M5Y H;  2P5Z X;  3PQI A;  1XWE A;  4OHJ A;  2I46 A;  1PZK D;  1OXS C;  1PH4 A;  4OO1 I;  4B3S L;  1PH7 A;  3OWE B;  5IOD A;  1C0A A;  4AYB E;  5M3F H;  3HOV G;  1H9S B;  5CC4 A;  2KCC A;  2EXD A;  4O1N A;  2I07 B;  2KEE A;  1CSP A;  2YTY A;  1F9P A;  3ZYY X;  2K5Q A;  3MFY A;  5I2Y A;  4KK7 A;  3N6R A;  1FNW A;  4IUR A;  3KJO A;  3E9I A;  1VQE A;  3GP7 A;  3IFD A;  5C5M A;  2EPB A;  4HN7 A;  4KY5 A;  1HNX L;  4LF9 L;  3H0G H;  1CKN B;  5EPK A;  1ENA A;  1LO5 D;  5IGB A;  3RZO B;  4RA8 A;  1X3P A;  3PMF A;  3HOY G;  5M5Y B;  4A3K B;  1IBM Q;  2HDM A;  1ASY A;  1E7Z A;  2Q8I B;  2JA6 H;  4LUO A;  5C4H A;  1PFN A;  1K8G A;  2NTS A;  5E1F A;  1K28 A;  5D3D A;  5FJ8 G;  4QGU A;  3HOW B;  4LF9 Q;  3N52 A;  3J80 i;  4KKS A;  2IT1 A;  1PH5 A;  3BDC A;  3WWV A;  3FPP A;  1SNC A;  3KF8 A;  4GKK L;  4RMF A;  4AQY Q;  4X62 L;  2HDL A;  2Z1C A;  4X64 L;  1FVI A;  3G7L A;  4GNX C;  3R3O A;  1G8Z D;  2F0K A;  2JA7 G;  2NN6 I;  3GTP B;  1ESR A;  1VQ5 A;  1N34 Q;  4NXM Q;  1O7L A;  1JWS D;  1L0W A;  4YWM A;  3TZU A;  2YTV A;  3K58 A;  3M4Y A;  2SOB A;  1HNW Q;  2G5D A;  2R6G A;  3RZO H;  1DGS A;  3M9B A;  5FO7 B;  4DR4 L;  3NWS A;  3QOJ A;  5I4D A;  5J22 A;  1QVF A;  1FGU A;  2PQE A;  1PVO A;  3I4N G;  4X6A H;  1JQY D;  1TY0 A;  4A3C G;  3K7A H;  1UNS A;  1DD2 A;  1E22 A;  4YWK A;  1MJC A;  4JI4 L;  3H91 A;  1TWG B;  4K2K A;  1Y8N B;  4OEM B;  4ILW A;  4DV4 Q;  1SRO A;  2YU9 B;  2RHQ B;  3NEM A;  2ZTE A;  4PNY A;  4JI6 L;  1A63 A;  1U4L A;  4TSS A;  3VR4 A;  3GTG H;  1BKB A;  1GUT A;  3PUV A;  1PRT C;  1B7Y B;  1DYQ A;  5HGQ A;  2UXB L;  4DV4 L;  4BY7 H;  1C9O A;  3J80 c;  2EYF A;  4ABN A;  4A93 H;  1YJ9 A;  1IKM A;  4JI4 Q;  4KY7 A;  5IY0 A;  3BVZ A;  1CT1 D;  1FR3 A;  1MHW C;  3OSO A;  1KQS A;  4DUY L;  3CAM A;  3SK5 A;  3AQQ A;  1VQG A;  2KHI A;  1FJG Q;  3PO3 H;  2LKV A;  2MGS A;  4PZ7 A;  1U4P A;  1IYV A;  3I7F A;  4A3I G;  4J15 A;  2WFW A;  3A7L A;  1X3G A;  3HOW H;  4PV1 C;  4A3B B;  1BBX C;  1A3T A;  1MBY A;  1XNQ Q;  3HG9 A;  4C3I B;  4B3M Q;  3K7A B;  4DPG A;  1RL2 A;  1TWF B;  5ELD A;  2L55 A;  3DM3 A;  2D62 A;  2R92 G;  1Q3L A;  4BXX H;  1STG A;  4JI3 L;  2FXQ A;  1E1T A;  2A19 A;  2I5M X;  2F03 A;  4JYA Q;  3TBI B;  1VCI A;  2CW0 C;  2O4X A;  5CBA E;  2VQE L;  2MQH A;  4CBV A;  5DM6 3;  1JOR A;  3KF6 A;  4HED A;  1R9T H;  1VQH A;  3GTP H;  3GTL H;  4Q5V A;  2R7Z B;  2YV5 A;  4RKL A;  2ZXP A;  1WCM G;  3J7Z C;  4IZ8 A;  2AWN A;  3P7J A;  2IHE A;  1WI5 A;  4K6L A;  1SLJ A;  1YHA A;  2F3V A;  1SFO B;  3S16 B;  2NZH A;  1MJE A;  4F8M A;  4BBR H;  1B70 B;  2K50 A;  1OO9 B;  3HEJ A;  1IBK Q;  1PH6 A;  3MXN B;  4RGM A;  4DFA A;  1YJW A;  1Q82 C;  1I6H H;  4AYB B;  3VYU A;  4DR5 L;  1QUQ B;  4XQQ A;  1RF2 D;  1VF7 A;  5CGK A;  1G91 A;  1W3S A;  5JEA J;  3M4O H;  4JI1 L;  4N9T A;  2Z6B A;  3C1E A;  4LF8 L;  4GZY C;  1TWA B;  4C3J B;  4LW1 A;  1PMR A;  1AN8 A;  2X6L A;  4OL7 A;  3HKZ G;  4GKJ Q;  3J80 L;  2JA8 H;  2C5C A;  2EDG A;  2MPM A;  5JEA G;  4MIU A;  2K75 A;  1KAW A;  4CHT B;  2N8N A;  2NZ1 D;  4DN4 M;  3GTG B;  3GTQ B;  5ELO A;  2AQ1 B;  5IYB H;  4A76 A;  1KDC A;  4BA2 I;  4DR7 L;  3W1B A;  1TS4 A;  1YI2 A;  4A3E B;  3CD6 A;  5FLM H;  1TWC B;  2JA6 G;  2HCI A;  2JEB I;  3VR5 A;  2CH4 W;  3QB3 A;  1I5F A;  3CKI B;  1QZH A;  1UE5 A;  2EVB A;  2PMZ B;  1VQ8 A;  2NVX B;  1EYC A;  1JCK B;  3SK6 A;  1A62 A;  2CW0 D;  5JOB A;  3UI2 A;  1DON A;  4JW0 A;  3NK9 A;  5A35 A;  4GLX A;  3SR1 A;  2R92 H;  2FIN B;  4IUV A;  4OIJ A;  5EBC A;  1D8L A;  3E3X A;  3DHQ A;  4HJ5 A;  1KRT A;  5CV5 A;  1JT8 A;  4DV7 Q;  1EIY B;  3LNN A;  3H0G G;  2ZM6 L;  1E24 A;  2PW7 A;  4NXN L;  1PZJ D;  1GKH A;  5ELE A;  4FO2 A;  1YEZ A;  1PHJ A;  2F0H A;  3HOV H;  5C4X B;  3F2C A;  3O13 A;  3D3R A;  1Y1V B;  3DLL A;  2JA7 H;  1X56 A;  1SNQ A;  3QWN A;  3R2T A;  3T1H L;  5IWA L;  1ENF A;  5HGT A;  4X66 L;  2NB0 A;  4M8A A;  3S1M B;  2E75 C;  3BZK A;  4QUF A;  1X54 A;  3JC6 6;  4GN4 B;  1LTI D;  2UXB Q;  4OX9 L;  1I4X A;  5JPN C;  2BE5 C;  1BUV T;  2QKI C;  4OO1 H;  1B9N A;  1SBB B;  4JI7 L;  2I5L X;  3KLS A;  1D7Q A;  1SE4 A;  2F0E A;  2F0D A;  1BO0 A;  3VYR A;  5JPM C;  5M5W H;  3Q6S A;  4WOR A;  3VDY A;  1TQO A;  2CWA A;  4KTA A;  2ZJR A;  1TXY A;  3RR5 A;  4UY8 C;  3DWP A;  1NNX A;  2JSO A;  3CF5 A;  5F2D A;  2OEO A;  1CHQ D;  1LM0 A;  5KGU A;  2ES2 A;  3D4W A;  4CKC A;  5KNB A;  4JBM A;  5C3W A;  2L9H A;  1TR5 A;  1VQI A;  1MSH A;  4FF3 A;  3AYH B;  2O2L D;  1Z47 A;  1LT3 D;  3HOZ G;  3OHX C;  2JA9 A;  4C2M B;  3ZJY C;  4DV3 Q;  2K1B A;  2CQO A;  2K28 A;  3MXG A;  3EQL C;  4RCN A;  2WIN B;  2EYM A;  2I0Q A;  1YJN A;  3S17 H;  3T56 B;  2R93 G;  4R1J A;  4C1N I;  2DJG C;  2GVB A;  2B63 G;  3QJY A;  1AZQ A;  4GLA C;  1O78 A;  2NVT H;  3V05 A;  4FF1 A;  3SHL A;  2EJM A;  5J1Z A;  1EWH A;  2Q2T A;  2Y0S B;  3FVQ A;  5CYU A;  3EFX D;  4K8J A;  3KDF B;  3E0E A;  4DV6 Q;  1PRT B;  4ZLT F;  1SYE A;  4YWL A;  2WKC A;  1RDP D;  4EVO A;  1MD2 D;  1XMO Q;  1U5K A;  1GUG A;  4R4T A;  3T53 B;  3CCS A;  2K4K A;  2N78 A;  3F8T A;  5T1I A;  1I94 Q;  1LT6 D;  2BH2 A;  3I4L A;  2DUD A;  2F0Q A;  5BR8 Q;  3OTO L;  1EFI D;  2BA0 A;  4LF8 Q;  2A5H A;  4R4I A;  1NY4 A;  3RZD B;  3PIO 3;  2QDL A;  3NWT A;  1J5E Q;  4N8F A;  3A0J A;  4B3R L;  4BBS G;  1VQN A;  3FP9 A;  4ME5 A;  5FO9 B;  1ILQ A;  2FFK B;  4IAL A;  4CJ0 B;  1F2M A;  4DR3 Q;  1J6Q A;  1JE4 A;  2MFI A;  3HP3 A;  1FNV A;  1LYL A;  4H0L C;  2B63 B;  2J4X A;  1Y1W H;  4FNF A;  4ZQ3 A;  2IX0 A;  5FK9 C;  3PIP A;  3KJP A;  1BDO A;  4P74 A;  3G48 A;  1QVC A;  1EL0 A;  3C3L A;  4J8Q A;  1D5X C;  2KCN A;  4APV A;  2ID0 A;  1BNZ A;  2ZJQ A;  3K5N A;  3HGB A;  1SYF A;  4J6H A;  2NVQ H;  2VZA A;  1XTD A;  2MO0 A;  1D5M C;  3NHH A;  3Q0A A;  2SDF A;  5FJ8 H;  3S9W A;  4PZ6 A;  1YVC A;  1EU4 A;  1NAP A;  1NR4 A;  3TP5 A;  4DK1 A;  2UU9 L;  4JVZ A;  1YBY A;  4GLV B;  3GTO B;  2F0O A;  5EJW A;  2EZV A;  4JI2 Q;  4BY1 H;  2E5L L;  4Y7N B;  1IW7 C;  1K83 H;  3ONA B;  4XTC S;  1H9J A;  3C1F A;  3FKI H;  2UU9 Q;  2K32 A;  2A68 D;  5I6W A;  4HJ8 A;  1GUS A;  1TWH H;  3RZD H;  1LTT D;  2AWO A;  4Y52 H;  1EIF A;  1TVX A;  2AQ2 B;  2B8F A;  3EVQ A;  4K6D A;  3MHB A;  3ITP A;  5C3E B;  4OX9 Q;  4A3L G;  1NBW A;  2LXK A;  3QOL A;  4Q0F A;  3TDQ A;  1SMY C;  1VMP A;  3FKI B;  1M90 C;  1E3P A;  4CKE A;  1BBW A;  4KN4 C;  1VDZ A;  5FLX E;  3NE5 B;  2RF4 A;  3BVM A;  4HJ9 A;  1K73 C;  1SYG A;  3RUZ A;  2OF1 A;  2F0U A;  4DUZ L;  1PTO C;  3MWY W;  1XXG A;  3T1H Q;  2AMC B;  4A3E G;  1T5X D;  2G9D A;  2D9U A;  3I4N B;  4NW2 A;  3ND9 A;  4ZRZ A;  3S1M H;  2MJ8 A;  1AH9 A;  2E74 C;  3MVV A;  5IT9 E;  4K8I A;  1X3E A;  2EE1 A;  1KIX A;  3KDF A;  3J7Y W;  5H1S E;  3RLN A;  5AJ3 L;  3IAY A;  2ZM6 Q;  3M85 A;  1STE A;  5GAD C;  2O5I C;  3HOY B;  3S24 A;  2A69 C;  2VUM G;  5C4X H;  4IJL A;  1I4H A;  3CW2 C;  1HZ9 A;  2AUK A;  4QIW B;  5E4X A;  1V1P B;  4ALP A;  1PV4 A;  1TY2 A;  5FLX c;  1UAP A;  1AE3 A;  2A6E C;  2XVS A;  2NVY H;  3CCQ A;  2EYH A;  2JK8 A;  2UUC Q;  1ICF B;  5FOB B;  1EYG A;  2QEJ C;  3A7A B;  1K8O A;  3OTO Q;  1V1O A;  1XNR L;  3FKI G;  1NMF A;  4JI8 L;  1AE2 A;  4YCU A;  2PNH A;  2O5J C;  3EIV A;  4JI3 Q;  4BXX G;  4IOC A;  2TSS A;  2XNA C;  3DWA A;  2KEN A;  4G57 A;  4HSP A;  4R4Q A;  1N36 Q;  4OGQ C;  4IFD G;  2L15 A;  5DAU A;  5I2X A;  2NVX H;  3IFT A;  4DV3 L;  1XPU A;  1JJC B;  3DEP A;  2E2J H;  4MN3 A;  1HUM A;  1TWH B;  1I50 H;  4UDU C;  2LXJ A;  3SVM A;  1B8A A;  3PO2 H;  2PQA A;  4DAM A;  1QCB D;  5JJZ A;  1QB5 D;  3NPP A;  4LFB Q;  1IKL A;  4DV7 L;  1TU2 B;  1NTG A;  3BYY B;  1KL9 A;  2KJX A;  2VNU D;  1EQR A;  3J7A F;  5DEH A;  3ICE A;  4IOA A;  3AEV A;  1XNR Q;  3A8I E;  3J81 L;  3T51 B;  4BA1 I;  3TP8 A;  2EYJ A;  2QEX A;  2X69 A;  3R93 A;  2A69 D;  2LFN A;  5E4W C;  1WTR A;  3PUZ A;  4JI7 Q;  1K0R A;  1YNX A;  1R4Q B;  4X65 L;  1OXU A;  1XMO L;  2JA7 B;  1Y1W B;  2PO4 A;  3PIO A;  4R4C A;  1M1K C;  2EQS A;  3I4M H;  4HMJ A;  3S14 H;  4DUY Q;  4BS9 A;  4XT3 B;  5IGG A;  4YY3 L;  1VQ6 A;  2VY3 A;  1L2F A;  4DR1 L;  1PYB A;  4J1M A;  1PFM A;  4OXP A;  1DOL A;  1I50 B;  3PIP 3;  1BVS A;  1M4V A;  4N8X 1;  4DAY B;  5KYI A;  1K9M C;  1GM5 A;  3OIP A;  5A2Q E;  5C44 H;  1HNW L;  4A3J G;  1U0L A;  3I4N H;  4DNT B;  1N8R C;  4I7A A;  2ZXO A;  2ASB A;  4YCW A;  5JEA H;  4IUT A;  3CC7 A;  3T4A C;  4DV0 Q;  1PRT D;  1Y14 B;  4UP7 A;  3CQZ B;  5EQ0 A;  3I90 A;  1STA A;  1VF5 C;  1L0X B;  1JOQ A;  2NTT A;  2F0W A;  4EGV A;  3HOX H;  1HCZ A;  1J8I A;  2B8G A;  2Q2I A;  5C4Z A;  3CCE A;  3HOZ H;  2RCN A;  3K0X A;  2JA5 G;  1RKN A;  2EY1 A;  1GVP A;  4WJW A;  4JI2 L;  1ZYR C;  4HCS A;  2E2I H;  2K33 A;  4JYA L;  1O7I A;  3NSW A;  2E2H B;  1SYB A;  2CKZ B;  4KKT A;  1PH3 A;  4KHP Q;  4RWS C;  2L4N A;  1WTX A;  1WCM H;  1DXM A;  1GD7 A;  2F0F A;  5BN4 A;  3E6Z X;  2OTL A;  5CV6 A;  4KHV A;  1V9P A;  2KVM A;  3HS0 C;  3FDT A;  1ONL A;  2XRQ D;  1E2Z A;  3E5S A;  1PLF A;  5E7N A;  1X3Q A;  3K5O A;  4QF4 A;  3VR3 A;  1H9R A;  5LL6 S;  4L5T A;  1XX8 A;  2ICI A;  4GNX B;  2L1B A;  2PZU A;  1SFO H;  1SE3 A;  1KDB A;  1IBM L;  3PO2 B;  5IP7 G;  3VR2 A;  3HOX G;  4ZUI A;  2OQ0 A;  4K5V A;  1YZ6 A;  2KA7 A;  3EA6 A;  1EYD A;  4A3J B;  1PH1 A;  4MHE A;  4BWG B;  1N9W A;  3ERS X;  1PH2 A;  1A15 A;  2HIX A;  3X3N A;  2WP8 J;  1XMQ Q;  1PDQ A;  2Y0S E;  5LMU L;  3PV0 A;  1Q1B A;  2Z6K A;  3P1H A;  3S1N B;  2K5W A;  1L1O A;  1QNK A;  4YY3 Q;  4R4O A;  2D2C C;  1XYI A;  3STB C;  4A3B H;  1Y1V H;  1WTW A;  2UUB Q;  4M1U B;  1VQM A;  2I5H A;  3K0Y A;  2JA5 B;  2NN6 G;  2JJQ A;  1CA6 A;  3S16 H;  5C0X H;  1Y8P B;  1WD0 A;  4RHR A;  4IFD J;  1UE6 A;  2B2U C;  2IL8 A;  1EEF D;  4X65 Q;  3PO3 B;  1II3 A;  1A2U A;  1GO3 E;  1WOC A;  4LNQ A;  1TS2 A;  1PTO F;  3SK8 A;  4HMI A;  1IZ6 A;  1CQF A;  4C2M H;  5C4X G;  4LFC Q;  4GN5 A;  2OCE A;  4F87 A;  4A93 B;  3I3C A;  4QIW E;  3H3V I;  4P71 A;  4K5W A;  1D5Z C;  2R92 B;  3T1Y Q;  3MZ5 A;  1Q81 C;  4B3M L;  3H0G B;  2XWB B;  4CDC C;  4WJ3 M;  1V8Q A;  3CRK C;  4GOP C;  2VW9 A;  4KKU A;  2UXC Q;  2Q8R E;  2M2L A;  2WAC A;  4RG1 A;  1XTC D;  1STY A;  1SNP A;  4ME3 A;  2R7D A;  1EIG A;  3GTJ B;  4DK0 A;  4G7Z C;  3J7A V;  1WTO A;  5K5P A;  4C56 C;  4LF7 L;  1B2T A;  3ND8 A;  4KLK A;  2RVL A;  1BXT A;  1VQ9 A;  4GNX A;  2KOL A;  5EGT A;  3NTI A;  1B50 A;  2K05 A;  3SEB A;  5FKA C;  1VQK A;  4JI0 L;  1Q46 A;  4UAI A;  3OW2 A;  1SE8 A;  2IHF A;  2RQX A;  3P20 A;  4A3M B;  5EKI A; 
#chains in the Genus database with same CATH homology
 5GQO A;  4LF5 Q;  2F4V L;  5GRO A;  1MIU A;  2E2H H;  4A3B G;  1HZB A;  4DV5 L;  2I0Q A;  1YJN A;  3S17 H;  2R93 G;  4R1J A;  4OWX B;  4JG2 A;  2GVB A;  4JI0 Q;  2NZO A;  3L2P A;  2CWP A;  2B63 H;  2B63 G;  1BBU A;  4L5S A;  4GLA C;  2UUC L;  2NVT H;  1E1O A;  4LFA L;  1VQD A;  1T9H A;  3U50 C;  3JAM c;  4K0K Q;  2UXD Q;  2VS1 A;  2YU9 H;  3NEN A;  3BU2 A;  1YIT A;  3KLW A;  1IXR A;  1EWI A;  3BZC A;  2QA4 A;  2VQF Q;  5LMN L;  3M4P A;  4A3L H;  2Q2T A;  3GDE A;  3KOJ A;  4B3T Q;  5K36 G;  2R7Z H;  1G51 A;  4PMW A;  3G6E A;  3CME A;  5M3F G;  3J81 c;  4DNI A;  1VQJ A;  3MEF A;  4MNO A;  1XMQ L;  1N33 Q;  3TS2 A;  4X64 Q;  3KDF B;  4TVA B;  4AQY L;  4EX5 A;  3E0E A;  3CPF A;  5LMU Q;  4DV6 Q;  1VQA A;  4JC0 A;  1QUQ A;  3GTK H;  4YWL A;  1IBL Q;  4A3G H;  2K5H A;  3S2D H;  1JMC A;  2R7F A;  3I56 A;  1XMO Q;  1JJG A;  1U5K A;  2XTI A;  4UP9 A;  4R4T A;  4JI5 L;  3CCS A;  1OXX K;  3J81 j;  4P75 A;  2K4K A;  2N78 A;  3F8T A;  1TWF H;  1I94 Q;  2E5L Q;  2BH2 A;  4HID A;  2DUD A;  5BR8 Q;  3OTO L;  2OWO A;  5IP9 G;  5IP9 H;  4A3K G;  5IYD G;  3OYY A;  4NXN Q;  3TRE A;  3JAM i;  2AHO B;  4XIG S;  5IWA Q;  2BA0 A;  3E9H A;  1G6P A;  4LF8 Q;  1CKN A;  4C3I H;  4R4I A;  3CCU A;  1NY4 A;  1VQO A;  1SR3 A;  1I3Q H;  1J5E Q;  4B3R L;  1N32 Q;  3A0J A;  4BBS G;  1VQN A;  3FP9 A;  3CCR A;  5DLQ E;  4JV5 L;  2WB1 G;  1HR0 L;  3BJU A;  4DR6 Q;  4DR3 Q;  1J6Q A;  4JBJ A;  3PCO B;  1S40 A;  3S2H H;  2MFI A;  3CCJ A;  1LYL A;  3UDX A;  1FL0 A;  4DR2 L;  1Y1W H;  5C4J H;  3F1Z A;  3S15 H;  2IX0 A;  3PIP A;  1PH8 A;  4JV5 Q;  3KJP A;  4LF6 L;  4GOP A;  2WAQ E;  3K80 C;  3G48 A;  4P74 A;  1QVC A;  3IRB A;  5C0X I;  4QQB X;  1CKO A;  2KCT A;  2ID0 A;  4APV A;  2ZJQ A;  1VQF A;  2QGQ A;  1YHB A;  1CSQ A;  2NVQ H;  2VZA A;  3TS0 A;  1XTD A;  4A3K H;  2MO0 A;  4KHZ A;  1Q8K A;  5M5Y H;  1N33 L;  3CMA A;  1C7Y A;  3RLF A;  5FJ8 H;  4P72 A;  1OXS C;  4PZ6 A;  1YVC A;  1PH4 A;  4OO1 I;  2Z0S A;  4B3S L;  4IO9 A;  1PH7 A;  2UU9 L;  4GKJ L;  1YBY A;  3AFQ A;  3LGJ A;  3F2B A;  4JBK A;  5JJK A;  4PZ8 A;  4EQ5 A;  1MKH A;  1C0A A;  1JE5 A;  4GLV B;  4AYB E;  4POF A;  5M3F H;  3HOV G;  4JI2 Q;  4BY1 H;  5ELN A;  2E5L L;  2OTJ A;  2PI2 E;  3D0F A;  2EXD A;  2N3S A;  2JQO A;  1K83 H;  4XTC S;  2K5V A;  3FKI H;  2UU9 Q;  1CSP A;  2YTY A;  4HJ8 A;  4B3S Q;  5IYB G;  1HJP A;  1TWH H;  2N49 A;  3RZD H;  3TRZ A;  2AWO A;  4Y52 H;  1EIF A;  1A8V A;  3UE0 A;  3T1Y L;  1NJI C;  4B3T L;  4OX9 Q;  1IL2 A;  2LXK A;  1TWC H;  2B3G A;  1NBW A;  4IPG A;  3E9I A;  1VQE A;  3KJO A;  1M90 C;  1HNZ L;  4JI6 Q;  2R7Z G;  1E3P A;  3CPW A;  1BBW A;  4DV2 Q;  3ULL A;  3M7N A;  3J7A 5;  2RF4 A;  1EUJ A;  1HNX L;  3GTO H;  4YHH L;  4LF9 L;  3H0G H;  1CKN B;  4HJ9 A;  1K73 C;  3U4Z A;  2Z6K C;  1HNZ Q;  4IJH A;  4DUZ L;  3KYH C;  1QZG A;  3T1H Q;  2AMC B;  4A3E G;  3I4O A;  2EIF A;  3W5O A;  4HIO A;  5J3B A;  3HOY G;  2WAQ G;  4HJ7 A;  3S1M H;  2JEA I;  1AH9 A;  1WJJ A;  3EBE A;  3S1R H;  4OON A;  4QL5 A;  1IBM Q;  1ASY A;  1Q7Y C;  1E7Z A;  1X3E A;  2H5X A;  1XPO A;  1KIX A;  4LUO A;  2RHS B;  2JA6 H;  4B3R Q;  1K8G A;  3KDF A;  5JJL A;  5H1S E;  4DUZ Q;  3RLN A;  5AJ3 L;  2K14 A;  3ULP A;  4A3L G;  5FJ8 G;  4QGU A;  2ZM6 Q;  3M85 A;  4LF9 Q;  3J80 i;  5GAD C;  4DR5 Q;  3S24 A;  1IBL L;  2VUM G;  5C4X H;  2DGY A;  3NEL A;  2IT1 A;  4IJL A;  3CW2 C;  5GAH C;  4A3F H;  1PH5 A;  3WWV A;  3RN5 A;  4A3D H;  1HZ9 A;  4GKK L;  3K81 C;  4RMF A;  3KF8 B;  4X62 L;  4AQY Q;  4X64 L;  1FVI A;  2K52 A;  4ALP A;  5FLX c;  1PV4 A;  3GD7 A;  1AE3 A;  3L7Z C;  4DV5 Q;  4GNX C;  3H3V H;  2NVY H;  2ZJP A;  2JA7 G;  3CCQ A;  4A3M H;  2JK8 A;  2NN6 I;  4JI5 Q;  2UUC Q;  3FHW A;  1VQ5 A;  1N34 Q;  3U58 A;  1EYG A;  4NXM Q;  5IYC G;  4OWW B;  1KXL A;  3STB D;  1L0W A;  3OTO Q;  4YWM A;  1XNR L;  3FKI G;  3F2D A;  1NMF A;  2YTV A;  4JI8 L;  4DV2 L;  1AE2 A;  4YCU A;  1HNW Q;  3UDI A;  2PNH A;  2R6G A;  3A5Z B;  3D31 A;  3EIV A;  2VQF L;  1DGS A;  4JI3 Q;  3RZO H;  3M9B A;  5C3E G;  1Q86 C;  4DR4 L;  1YHQ A;  4BXX G;  4IOC A;  2PMZ E;  4QY7 A;  4IPD A;  1EFW A;  2KEN A;  3UE1 A;  1FGU A;  1QVF A;  4R4Q A;  1N36 Q;  2UUA L;  1PVO A;  3I4N G;  4IFD G;  4X6A H;  2L15 A;  4A3J H;  2NVX H;  4LFB L;  1VQ4 A;  4DV3 L;  4A3C G;  5LMN W;  2Y0S G;  3K7A H;  1XPU A;  1E22 A;  2OQK A;  4YWK A;  2VQE Q;  1MJC A;  1JJC B;  2HIV A;  2E2J H;  4JI4 L;  3ER0 A;  1L1O B;  1YIJ A;  3KFU A;  3PSI A;  1I50 H;  2LXJ A;  1B8A A;  3PO2 H;  2PQA A;  4DAM A;  1SRO A;  4DV4 Q;  1UEB A;  4IPH A;  4L5R C;  2RHQ B;  3NEM A;  2ZTE A;  4LFB Q;  2YTX A;  3UDF A;  4JI6 L;  4DV7 L;  3K8A A;  1A63 A;  3GTQ H;  1K8A C;  3GTG H;  1BKB A;  3PUV A;  1NTG A;  1XJV A;  3G71 A;  2Q2H A;  1KL9 A;  1B7Y B;  2VNU D;  3RLO A;  5HGQ A;  2UXB L;  4DV4 L;  1EQR A;  3L0O A;  3I2Z A;  1P8L A;  5IE8 A;  3HOU H;  1LTL A;  3ICE A;  4BY7 H;  1C9O A;  3J80 c;  3AEV A;  4IOA A;  2A1A A;  3PO3 G;  1Y1V G;  1FJG L;  4A93 H;  1YJ9 A;  1S72 A;  1XNR Q;  4JI4 Q;  4OO1 G;  5IY0 A;  3CCV A;  2GN5 A;  4BA1 I;  3G4S A;  4NXM L;  2QEX A;  3HKS A;  3PGZ A;  1KQS A;  2CCZ A;  3GTM H;  3PUZ A;  4HJA A;  1K0R A;  1YNX A;  2K5N A;  3CAM A;  4DUY L;  3AQQ A;  1VQG A;  2KHI A;  4JI7 Q;  2HQL A;  2WB1 E;  4X65 L;  1FJG Q;  3PO3 H;  4O2D A;  4BY7 G;  4PZ7 A;  1OXU A;  2MNA A;  1XMO L;  1KC8 C;  4BY1 G;  3I7F A;  3PIO A;  4JBW A;  4R4C A;  4A3I G;  1M1K C;  1KRS A;  4J15 A;  5M3M H;  3H15 A;  2EQS A;  2WFW A;  3I4M H;  4AIM A;  3S14 H;  4DUY Q;  2ATW A;  1X3F A;  4X66 Q;  4A3G G;  4YY3 L;  1UE7 A;  1X3G A;  1VQ7 A;  1VQ6 A;  3HOW H;  2VY3 A;  3CXC A;  1L2F A;  4DR1 L;  1PYB A;  2C35 B;  4LWC A;  3HOW G;  4GN3 B;  1XNQ Q;  4OXP A;  3Q8D A;  4WJ4 A;  1BVS A;  4B3M Q;  4DAY B;  1K9M C;  4JI1 Q;  2Q2U A;  1GM5 A;  4DPG A;  1RL2 A;  4A75 A;  1N34 L;  5C44 H;  5C44 G;  1HNW L;  1OXV A;  4A3J G;  1WFQ A;  1U0L A;  4KI0 A;  5FLM G;  3I4N H;  3CQZ H;  1N8R C;  1S3O A;  3TQY A;  2ASB A;  5GAG C;  1HZC A;  4MZ9 A;  4YCW A;  3CC7 A;  3DM3 A;  1Y14 B;  2D62 A;  4QJF A;  4DV0 Q;  2R92 G;  4BXX H;  2ZTD A;  2FXQ A;  4JI3 L;  3RN2 A;  1E1T A;  2A19 A;  2I5M X;  4UP7 A;  5C0X J;  4JYA Q;  1VCI A;  1UE1 A;  4LF7 Q;  4LFC L;  2VQE L;  2MQH A;  3K7U C;  3KF6 A;  1R9T H;  1HZA A;  3TEH B;  1VQH A;  4GKK Q;  4DV0 L;  3GTP H;  3HOX H;  5IT9 c;  3GTL H;  4YHH Q;  4PG3 A;  1KD1 C;  5EAY A;  2YV5 A;  1CUK A;  2Q2I A;  1NE3 A;  1WCM G;  1SRU A;  2CFM A;  3A74 A;  3J7Z C;  3CCE A;  1VS0 A;  2AWN A;  2UUB L;  3HOZ H;  2RCN A;  2IHE A;  1WI5 A;  1IBK L;  3K0X A;  1SLJ A;  1YHA A;  4GOP B;  2JA5 G;  2KHJ A;  1P16 A;  1GVP A;  4Y7N H;  2AKW B;  2NZH A;  4JI2 L;  1MJE A;  3AFP A;  2E2I H;  2JA5 H;  2GVA A;  4DR4 Q;  4JYA L;  1X65 A;  4BBR H;  1O7I A;  2VL6 A;  1B70 B;  2K50 A;  1IBK Q;  3HOU G;  1PH6 A;  3MXN B;  3W1G A;  2ALY B;  4JI8 Q;  1TWA H;  4C3J H;  1X55 A;  2CKZ B;  2KBN A;  1YJW A;  1Q82 C;  1PH3 A;  4KHP Q;  1I6H H;  4DR5 L;  1QUQ B;  1WCM H;  1GD7 A;  1OTC A;  3S1N H;  1W3S A;  1NMG A;  1CKM A;  1UWV A;  5JEA J;  5GAE C;  2OTL A;  3M4O H;  1JB7 A;  2UUA Q;  2E8G A;  4JI1 L;  1V9P A;  3SGI A;  2IY5 B;  4LF8 L;  3I55 A;  1X9N A;  2YYZ A;  4LW1 A;  4IFD I;  3HKZ G;  4GKJ Q;  5E7N A;  1IYJ B;  1Z9F A;  2KCM A;  1W2B A;  2JA8 H;  1PYS B;  5JEA G;  3CC2 A;  2JE6 I;  2K75 A;  1KAW A;  2N8N A;  1SN8 A;  5ELO A;  4L5T A;  4GNX B;  4A4I A;  4A3F G;  5IYB H;  4A76 A;  1SFO H;  4BA2 I;  4DR7 L;  3W1B A;  3PF4 A;  1YI2 A;  4BBR G;  1IBM L;  4AYB G;  3CD6 A;  5FLM H;  2JA6 G;  5IP7 G;  1VQP A;  5C3E H;  1PA6 A;  2JEB I;  3GO5 A;  3CCM A;  3HOX G;  1HR0 W;  2OQ0 A;  4LF4 L;  1I5F A;  2ZTC A;  4AH6 A;  4JCV E;  3RNU A;  3GTJ H;  1QZH A;  1YZ6 A;  4NPS A;  4A3E H;  3CC4 A;  1UE5 A;  1VQ8 A;  4DR7 Q;  5BR8 L;  4K0K L;  1PH1 A;  5IYC H;  2UXD L;  1HNX Q;  1HH2 P;  4H02 A;  1EOV A;  4TQU S;  1A62 A;  3PUX A;  2LSS A;  2V1C C;  1N9W A;  3ERS X;  4OWT B;  4GLX A;  2HIX A;  1PH2 A;  2IX1 A;  2R92 H;  1ASZ A;  2WP8 J;  1J5E L;  1XMQ Q;  2A8V A;  1D8L A;  3PUW A;  1K3R A;  1Q12 A;  4HJ5 A;  2Y0S E;  5LMU L;  1KRT A;  5M5X H;  3PV0 A;  1Q1B A;  1LUZ A;  2Z6K A;  4DV6 L;  1JT8 A;  2HT1 A;  2BH8 A;  4IPC A;  1XNQ L;  4DV7 Q;  1EIY B;  4YCV A;  3H0G G;  1L1O A;  4YY3 Q;  4R4O A;  2F4V Q;  2D0O A;  1PFS A;  2PQA B;  1I94 L;  3S1Q H;  3STB C;  1SMX A;  2ZM6 L;  1E24 A;  4DR1 Q;  4A3B H;  2BA1 A;  4DV1 Q;  1G29 1;  1Y1V H;  2UUB Q;  1VQB A;  3CP0 A;  4NXN L;  3PO2 G;  3J81 i;  4A93 G;  1VQM A;  4BBS H;  2I5H A;  1VQC A;  1GKH A;  2NN6 G;  4LFA Q;  3A5U A;  4C3H H;  1QVG A;  2JJQ A;  3KF6 B;  1YEZ A;  1PHJ A;  1N36 L;  3HOV H;  3HOY H;  3S16 H;  2B29 A;  3CCL A;  3HKZ E;  2D0P A;  4UP8 A;  5HY6 A;  3F2C A;  3NBH B;  4POG A;  4LF4 Q;  3DLL A;  2JA7 H;  4LUV A;  1X56 A;  4JOI C;  1UE6 A;  4UPA A;  4HIM A;  4IFD J;  4X65 Q;  3PF5 A;  3T1H L;  2HHH Q;  4HIK A;  1GO3 E;  1WYD A;  1WOC A;  4A3D G;  4LNQ A;  4DR6 L;  2F3I A;  5IWA L;  4A3I H;  4MTN A;  1XPR A;  3ULJ A;  1A0I A;  2XGT A;  1N32 L;  4X66 L;  4C2M H;  1IZ6 A;  4DV1 L;  4DR2 Q;  5C4X G;  4LFC Q;  4GN5 A;  2OCE A;  2UXC L;  3B6Y A;  3PUY A;  3BZK A;  3UDG A;  4A3C H;  5AJ3 Q;  4QIW E;  1Y1W G;  4LF6 Q;  3H3V I;  4P71 A;  4DR3 L;  1X54 A;  5C0X G;  3JC6 6;  4GN4 B;  1H95 A;  1V43 A;  2UXB Q;  3T1Y Q;  4OX9 L;  1Q81 C;  4B3M L;  1PH9 A;  2JA8 G;  3M3Y H;  1KHI A;  4JI7 L;  1L1O C;  4WJ3 M;  2I5L X;  4GOP C;  1D7Q A;  2VW9 A;  2UXC Q;  5M5W H;  4RG1 A;  4DK6 C;  4FDB A;  4GS3 A;  4ME3 A;  2R7D A;  3VDY A;  2MO1 A;  2CWA A;  2ZJR A;  1TXY A;  1Q1E A;  1TWG H;  4L5Q A;  3RR5 A;  4UY8 C;  4A3M G;  5LMN Q;  3CF5 A;  4LF7 L;  5IYD H;  1VQL A;  1LM0 A;  4KLK A;  4O0A A;  2HHH L;  2ES2 A;  1HR0 Q;  5JJI A;  4JBM A;  1VQ9 A;  1VQI A;  2PI2 A;  4JOI A;  4LUZ A;  1EQQ A;  3HFZ B;  1JJ2 A;  4GNX A;  2VUM H;  3AYH B;  2R93 H;  1Z47 A;  3U4V A;  4LF5 L;  3HOZ G;  1V1Q A;  2JA9 A;  1RIP A;  4DKA C;  3M4Q A;  1VQK A;  4JI0 L;  1Q46 A;  3EN2 A;  4P73 A;  3ZJY C;  4DV3 Q;  3OW2 A;  3I4M G;  1SE8 A;  4DK3 C;  5M3M G;  2IHF A;  4NB3 A;  2F52 A;  2CQO A;  1X6O A;  4X62 Q;  5IP7 H;  4KHP L;  1OXT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...