4K5XA

Crystal structure of staphylococcal nuclease variant v23m/l36f at cryogenic temperature
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
135
structure length
132
Chain Sequence
LHKEPATLIKAIDGDTMKLMYKGQPMTFRFLLVDTPETKHPVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Pressure effects on proteins
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 37
structure length 132
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2013-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4k5xA00
4PMCA 5F2DA 3SHLA 1TR5A 3BDCA 3ITPA 2QDBA 2PZUA 3EVQA 3RUZA 5C5MA 1STGA 3MHBA 3NQTA 5EKLA 2F0EA 3MXPA 4KJOA 4KJNA 2F0IA 3HZXA 1JORA 2F0TA 2F0OA 2PQEA 3SR1A 1A2UA 4DF7A 1A3TA 4HMIA 5C4HA 2F0QA 2EYMA 4KD3A 1A2TA 1JOOA 3U9OA 4KY5A 1F2MA 4NMZA 5C3WA 5JAVA 2F0SA 3EROA 3QOJA 4IUNA 1SYBA 3NXWA 5KYLA 2EY6A 3V2TA 5K5PA 5HURA 1SYDA 2EYOA 3D4WA 5IOCA 1STNA 5ISRA 4KY7A 4E6IA 2F3WA 3D4DA 5KRUA 2F0KA 1STAA 4J1MA 4QMGA 1EQVA 1KDBA 1KDCA 1SYCA 2KQ3A 1AEXA 1EY7A 1EY9A 4K2LA 5C3XA 4KV6A 2EYFA 4KY6A 4NKLA 1JOKA 4DGZA 5IGBA 1SYFA 4K8JA 3HEJA 3D6CA 4NP5A 3MEHA 3PMFA 5CV5A 4G57A 5JOBA 4EQOA 5C6AA 3VA5A 5CC4A 5M9OA 5J22A 2RKSA 5NUCA 1JOQA 1SNDA 5CV4A 3SK8A 4F8MA 3NHHA 3QB3A 3MVVA 4H7BA 4K5VA 4K5XA 5C5LA 1F2ZA 3C1FA 3TP7A 4WRDA 4EVOA 3NK9A 5E3FA 1EY0A 2OEOA 5I6WA 1NSNS 4DFAA 2NUCA 4MIUA 1EYAA 5DEHA 1STYA 1A3VA 3S9WA 1SNCA 5IGGA 4ODGA 4K8IA 5IGFA 1ENAA 1KDAA 2EY5A 2OF1A 3SK6A 2WACA 1SNOA 4PMBA 2F0NA 1EYCA 1KABA 4F7XA 3NP8A 3E5SA 5IGCA 3EJIA 4R8NA 5IIFA 2F0JA 1EY6A 2PW7A 2PZTA 4N9PA 2F0FA 5CV7A 5J39A 1SNMA 3TP6A 4KHVA 4ZQ3A 1STBA 2PZWA 2EYJA 1F2YA 2EYPA 3BDLA 1EZ8A 1EYDA 3DMUA 3SXHA 5IGEA 2M00A 5CV6A 2F0PA 4B9XA 4KD4A 2PW5A 2SNSA 1TT2A 1IHZA 4K5WA 3OSOA 1U9RA 2ENBA 3LX0A 4K2KA 3TP8A 3D8GA 5CGKA 5I6YA 5IODA 5KYIA 3OWFA 4IALA 2PYKA 3QOLA 4ID6A 2F0LA 4HTHA 1SYGA 3OMGA 3SK5A 1II3A 1ENCA 2F0VA 2EY2A 4N9TA 4TRDA 2O4XA 3MZ5A 5EKKA 1STHA 3DHQA 4KTAA 2F0GA 4YIJA 3T13A 3SK4A 2EXZA 5DAUA 3OMCA 4I65A 2F0UA 4K6DA 3P1HA 2SNMA 1RKNA 1SYEA 2EY1A 2EYLA 2RBMA 4J6HA 4S3SA 4RKBA 2F0MA 3TMEA 2F0DA 5C4ZA 1EY4A 4EQNA 1TQOA 1EZ6A 2HQEA 3R3OA 4IZ8A 4QB4A 2EYHA 5IGDA 5EGTA 2F3VA 5I9OA 3T16A 4HMJA 3P75A 5KGUA 1SNQA 1EY5A 2RDFA 2LKVA 2SOBA 3NUCA 4ME5A 4OL7A 4RKLA 5CV9A 5HGTA 3TP5A 1A3UA 4NDXA 5CV8A 4B9WA 1NUCA 5CR3A 2F0HA 2F0WA 3C1EA 4QF4A 1KAAA 4K14A 2OXPA 4PNYA 3H6MA 4ZUIA 4DU9A 4LAAA 1SNPA 4EQPA 4WORA 5J1ZA 5KEEA 3ERQA 5E1FA 5KIXA 2KHSA 5I9PA 4ZUJA 1EY8A
chains in the Genus database with same CATH superfamily
2WKCA 1PH2A 1ESRA 1NR4A 2MO0A 1PFMA 3ITPA 1WVLA 2L0CA 2OWOA 3F2DA 2JA8H 4LF6L 2CQOA 2HHHL 2MPMA 4A3EG 5GAHC 2OT2A 4HMIA 4QIWE 3E3XA 1C8CA 2IX0A 2Y0SE 3RZOB 3AYHB 1SR3A 5C4JB 1CHQD 1YNXA 5M5WH 4BWGB 4HEDA 4UP8A 3F1ZA 1HQRD 1EQRA 1KDBA 1AEXA 4OO1I 2OQKA 3A7AB 4NP5A 2HCIA 2L12A 1LTAD 1FD7D 4IUTA 1BOSA 2K52A 2WINB 3W3AA 1F2LA 1GKHA 3U9SA 1F2ZA 5E3FA 4MIUA 2C35B 1VQ6A 4QGUA 4HJ5A 1G8ZD 3UDFA 1LYLA 1RCVD 1VQDA 3R8BA 3I4NH 1QUQA 3K80C 4UP9A 3J7A5 2EPBA 2L11A 3K81C 2L9HA 2PW7A 2RCFA 1EFWA 2XTIA 3PCOB 1MHWC 3KF8B 1G51A 4KLKA 1W2BA 5BR8Q 4NXNQ 2MQHA 4JOIA 1YEZA 1S4ZA 3QR8A 2IL8A 1Q3LA 1BNZA 1L0XB 4AYBG 1LT5D 3DM3A 2ZTDA 4OONA 5IP7G 2O2LD 5EKKA 2EY2A 3OWEB 2D0PA 1N36L 1N8RC 1HTPA 4MZ9A 4RHRA 4I7ZC 3T51B 3KF8A 4I65A 4LWCA 3A8KE 3VYRA 4RKBA 4B3SL 2NBFA 4LFAL 2QEXA 3VYUA 1IKLA 4BY7G 1AN8A 2Q2HA 1VF5C 1P16A 4A3GH 2SOBA 4HN7A 4M1UB 3H15A 4Z9CB 2VQFQ 1DJRD 4FF3A 2K5QA 3PIPA 4FF4A 4QJFA 2RF4A 1M90C 3H6MA 4R1JA 2Z9HA 4XT3B 2UXCQ 2F52A 5F2DA 3Q23A 4A93H 1KNEA 2KVMA 2KHJA 1STGA 2Q2UA 1BXTA 3G4SA 5EKLA 1SAPA 4X3SA 1G291 3HZXA 1HA5A 1JORA 3KK7A 1L1OB 3CQZB 1GM5A 3U4VA 3F2UA 1YI2A 1VQNA 4IUNA 2VY3A 4KHPQ 2NB0A 4JI8L 5KYLA 1Y1VB 2EY6A 5TSSA 1H9JA 3OTOL 1SYDA 4B08A 4OX9L 4LF8Q 2NVTB 5KRUA 3FDTA 2GN5A 3BJUA 3PSIA 1TWFB 1SFOH 4NKLA 2LMCB 4A93B 3GO5A 3I8ZA 5FJ8H 4UY8C 4GKJL 1D1IA 1PZID 2BA0A 2DN8A 3MFGA 4CJ2C 3S14B 4LJZC 3J80i 2JE6I 1TVXA 2R92H 1NBWA 2WIIB 5FLMG 2AHOB 1HCZA 1MSHA 5D3DA 4EVOA 3HKZB 1KTKA 2B2TC 3ERSX 1IZ6A 3S9WA 1VCIA 3HG9A 2HT1A 2B63H 4G7OC 4DV6Q 5C4XG 1SNOA 5IY0A 5JJZA 1TWFH 1SFOB 3KF6A 2RVLA 4HJ9A 3JC66 2MFIA 3HKSA 3S14H 3Q22A 1M4VA 2WAQE 3K7AH 5IODA 3RR5A 2B2YA 1EOTA 2MNAA 4L5SA 4OIJA 1BCPD 2KBNA 5C44B 3SK5A 2BCOA 4F87A 4KN7C 4RMFA 2B63B 1ZXTA 4ULLA 1IKMA 3NTHA 4NB3A 4POGA 4X62Q 3G48A 1EZ6A 4LFBQ 2JA7G 1OXUA 2ATWA 2HD3A 5ELNA 3ND8A 1C48A 1SEBD 1VQ8A 4L63B 3DWAA 5HGTA 3FP9A 4HIOA 5EJWA 1LV9A 5IWAL 1PTOF 4CDCC 1N32Q 3MXGA 2OXPA 4TKOB 4WORA 5GAEC 3VYSA 2QA4A 1DYQA 3KOJA 1D8LA 1SE3A 5I2YA 4P72A 4JI2L 3MHBA 1SDFA 2DJFC 1SMYC 1BQQT 1K83B 1NJIC 1VQJA 3IFDA 5L37A 1F2MA 3I4MB 2D5DA 3PQIA 4MHEA 3S15B 1LLRD 1CUKA 1NY4A 1RHPA 1W6JA 4KY7A 5M5YB 1TY0A 3V96A 3NELA 4E6IA 5DM73 4GNXC 3S2DB 1WFQA 1YIJA 3ZYYX 4RCOA 1E7ZA 1PZJD 1UE1A 3C2PA 4DR4Q 2Q2IA 1DOLA 1HQMC 1GVPA 2NYZD 1YHQA 1VQPA 2UXDQ 4DAPA 1FYCA 4K5XA 4K5VA 1WD1A 1W3SA 1EIFA 2G9HD 4JI6L 2F1MA 3LWUA 4GLXA 2R93B 3I4MH 3HOZH 3J80L 3ULLA 1SNCA 1XMOQ 4OIKA 1YITA 3CPWA 1KDAA 4LF7L 4O2DA 2BH2A 1HJPA 2PI2E 4ZK9B 2F0NA 4AQYQ 2WFWA 4ME3A 1CA5A 2MP1A 3LGJA 2E5LQ 4YWMA 4BY1G 1T5EA 3A7LA 3DMUA 1AE2A 4KD4A 5A2QL 2WAQG 1U9RA 1QZGA 1V8QA 2OTJA 1ENFA 2IHEA 2VNUD 5E7NA 1LO5D 3IKJA 1ENCA 3GTOB 2O4XA 1E1OA 4P74A 2F0GA 1E3PA 2F0UA 3HP3A 5JEAG 2EQSA 4DR3Q 1RKNA 1L2FA 1B9MA 1IYJB 1EFID 4CKEA 1HHVA 3R3OA 1UEAB 4Y7NH 4GKJQ 2EYHA 5IGDA 4IUVA 5I9OA 2E2JB 1O78A 4WJ4A 3T1HL 5LMUQ 2PCFB 3CKIB 3GP7A 5LMUL 5CV8A 1EEFD 1TIID 4KHPL 4V0BA 5ELBA 5I9PA 3GTMB 1TY2A 3SHLA 3K5OA 5IYCG 5JJKA 3Q8DA 5LHY1 3L7ZC 4DV2Q 1PTOC 1QG7A 1KHIA 2HQLA 5BN5A 1T5XD 2EVBA 2KUMA 4CKBA 2JYOA 4Y7NB 5C4HA 1EU3A 2D0OA 4KD3A 4BBSH 1A2TA 2WP8J 1Q1EA 2XIWA 2EJFC 4G7HC 3HGBA 2KA7A 3V2TA 2CHBD 3D4DA 1X3PA 4DR2L 3SE0A 2GVBA 3TS0A 4A3KG 2R7ZH 3RLFA 3NBHB 3PF5A 4B3MQ 3IRBA 2WB1E 5JOBA 2VXWA 1CFMA 4A3KB 4LF4Q 4XIGS 5KNBA 4BBSB 1EYAA 1PRTF 4GOPC 1IBKL 2MHVA 3I90A 3S24A 4LK1C 4DUZQ 2L4NA 4YCWA 4QIWB 1A0IA 3KBXA 4JI5Q 3PO2G 2VUMB 3DLLA 2AWOA 1F2YA 1Z9FA 2UUAQ 2IX1A 2SDFA 2JA8G 3WOFA 1EIHA 4KKUA 4NXML 5FLXc 1AW7A 2AWNA 4V190 3T56B 4JYAQ 1H9MA 3OMGA 3BS1A 1WTHA 4TRDA 1F9QA 3J80E 1MBYA 3DHQA 5EBDA 3KJPA 5EQ0A 1ZKOA 1RD9D 5AJ3Q 4L8JA 2I0QA 2DGYA 4JPBW 5JPNC 1K8AC 1YZ6A 1EOVA 1C9OA 5KGUA 2VUMH 4RKLA 3STBD 1QE6A 4NDXA 3TP5A 1Y8PB 4A3IB 5FJ8G 4PNYA 2F4IA 1U4MA 5KEEA 3VR4A 3PIP3 1PH9A 1H9SB 4RG1A 5T1IA 1BBUA 1LM0A 4IUPA 3P20A 4DUZL 1ET9A 4X64L 4R8IA 1D7QA 1JJGA 3A5ZB 1Y1VG 5CORA 3K0YA 2A8VA 2OTLA 3E0JA 5ISRA 1CKNA 1PFSA 1U5KA 4QCLA 3HOWH 1STAA 2PPBC 2KQ3A 1HZBA 1HZ9A 1ICFB 1S72A 1D1KA 2K32A 3GV6A 1SYFA 4RHSA 4DR2Q 1PH6A 4LF8L 2KCMA 4R4QA 5C6AA 1WTRA 5CC4A 4OWTB 3I55A 4KI0A 4F8MA 2CWAA 2XWJB 4P73A 2B2WA 5C0XI 2K7VA 1NE3A 3M9BA 5DLQE 3MFYA 5I6WA 1KQSA 4LFCQ 2VW9A 1I3QB 3CCJA 4AH6A 4HIMA 3PGZA 2RSNA 1X55A 2ZM6L 1FGBD 2FMCA 4DR7Q 1V1QA 1JICA 1XWEA 1YNNC 1E2WA 3NPPA 1EQTA 1FNWA 2WACA 2K50A 2A6HC 1J8IA 2E8GA 2K75A 1IW7C 3VYTA 3TP6A 2K28A 1AZQA 2EYJA 3HOWG 1QNUA 5FK9C 4EQ5A 2M00A 4LUZA 4DV1Q 2E2DC 2VQEQ 1N33L 4PZ8A 3LX0A 5EPLA 2H1EA 2VL6A 4C1NK 1I3QH 2JA7B 2DUDA 4KTAA 1B2TA 1G2SA 4DNRB 2AQ1B 2Z1CA 4A3FB 2R93G 4DNTB 1BUVT 3TZUA 3H3VC 3K7UC 1XTCD 4JI0Q 4H44C 2F4VQ 2QILA 1FR3A 1Y8OB 4ME5A 5IT9E 1A3UA 3VDYA 1NUCA 3KDFA 2F0WA 2RQXA 2CW0C 1FL0A 1A15A 2B2UA 4JI4L 3X3NA 4A3GG 2L15A 2BE5C 1EIGA 3GQBA 1HR0W 5IYBG 1D2BA 4LF7Q 4K6LA 4DV3Q 1LT3D 2G5DA 2YV5A 1QJOA 1DONA 4KJOA 5IYCH 4A3FH 1YHBA 3I72A 3GV3A 4DF7A 1PYBA 1IW7D 3T1YQ 2MJ8A 3VR3A 3U9OA 1PTOD 3QOJA 4C3HB 1CQFA 2RDHA 1SBBB 1Q12A 5K5PA 3BZDB 1EWHA 1YHAA 2XSCA 3I73A 4I7AA 2JEAI 2E74C 3TSSA 3CCVA 3S1MH 1YJ9A 1KDCA 1Y1WG 1RIPA 1C4QA 1YNJD 1RODA 1SE8A 3D6CA 4HR7B 5FO9B 4L5RC 4G57A 2EOTA 3MXNA 2RKSA 2EIFA 5CV4A 4IN3A 4R9WA 4A75A 3QG1A 3R2TA 5JJIA 3L9AX 3C1FA 2A19A 1NSNS 3H94A 3CW2C 1C0AA 1EYGA 3MXUA 3E0EA 4ZKCB 2HHHQ 1S5CD 3J7AV 4APVA 4ZCKA 4JI2Q 4BBRB 3L0OA 2EY5A 1K8OA 3RNUA 2UUAL 2PQAB 1KABA 3E5SA 4RCNA 4R8NA 5C44G 2LFNA 3R2IA 5CV7A 1Y69U 3I4LA 5CMDA 1T9HA 1STBA 4BA2I 2EYPA 2VB3X 1B70B 1D5MC 4XYOA 1TS3A 1UNSA 1B4OA 1VQBA 1LTID 1G2TA 4K2KA 1CQVA 2FMMA 3OIQA 4FVMA 2P5ZX 4LFBL 1K8MA 4HCEA 3J7YW 1TWCB 1CHPD 4YIJA 4X66L 1PH5A 4N8X1 1M1KC 2EXZA 3C46A 2BA1A 1HNZL 3DWPA 4XYQA 2PMZB 4R4TA 1O80A 1OXTA 4OHJA 2F0MA 4BBRH 4KMUC 4GLAC 2HQEA 1EU4A 1VMCA 2JA5H 2ZT9C 3MC0B 2N78A 3TZDA 1HNXQ 4JI7Q 2NVXB 4QY7A 1NNXA 4OL7A 2FFKB 3JAMi 1R9TH 5I6YA 1PRTD 1Z47A 1N34L 3URYA 3J81L 4IFDI 3GTQH 1J5EQ 3RZDH 5E4XA 3M7GA 1SNPA 1X3GA 2IJ0A 4ZRZA 5HGQA 2IY5B 1PXUA 3UE1A 4FNFA 3HOZG 1TWCH 1NAPA 3J81i 2ASBA 1LT4D 1S3OA 4HSPA 4HSVA 3NQTA 1PTOB 2Z6KA 1PRTB 3PO3G 2NN6H 2OCEA 3I56A 1CKMA 3SR1A 3V05A 2F0QA 4GZYC 1SMXA 2F0SA 4WJ3M 4XXEA 3D4RA 3CXCA 1RL2A 2EYOA 4CDEC 1STNA 2IWHA 2G9DA 2F3WA 2EZVA 3RZDB 1EY7A 4DV6L 1QVCA 1F77A 1KAWA 1NTGA 3D3RA 4JI0L 2KHIA 1PH7A 2MO1A 3I3CA 1GXDC 1UAPA 4DK3C 2ID0A 2AQ2B 4JOIC 1CSQA 1PTOH 2A69D 3VR5A 3PIOA 3BYTB 3CCQA 1UE7A 1YVCA 3TP7A 2UXBQ 1BBXC 2NUCA 2X6LA 1STYA 2Z0SA 4JYAL 1TWGH 4K8IA 5M3FG 2Z4IA 2JA6G 4X65Q 3M3YH 2AKWB 2VQEL 2KOLA 1TWAH 3TDQA 1EYCA 2JA8B 1VQMA 2PZTA 5J39A 1A63A 2RHQB 5GADC 2QDLA 3HOUG 2X6GA 5C4JH 1LACA 3G71A 2ENBA 4EGVA 1PH3A 1XNRQ 1ILPA 3GTLB 1B9NA 4R4OA 2WB1B 4BY1H 3NBIA 3T13A 1TWHB 5DAUA 4GS3A 3RD4A 1CK1A 1GHKA 5C4ZA 3M3YB 2K5WA 2K5DA 1TQOA 3QJYA 4LNQA 4A3IG 4JV5Q 4H02A 3CP0A 1QB5D 1V9PA 2PMZE 4JC0A 2CFMA 3H0GB 3NUCA 2Z6BA 5CV9A 1DD2A 4B9WA 2E2IB 2YTYA 4BBRG 2B2UC 1O7LA 5FO7B 1HRJA 2E76C 4GN5A 3DEOA 3ERQA 5CGKA 2AUJD 4DUYL 2UUCQ 5LMNL 1S5ED 5IP9G 4BY1B 1GJXA 3EVQA 4GNXB 1A62A 2C9OA 4KJNA 2IHFA 1HUNA 1PDQA 2NZHA 2I5HA 2PQEA 2N3SA 3N52A 3A5UA 3M85A 1JOOA 1CI3M 2NVYH 1Q1BA 2HIXA 2JQOA 1K3BC 1TKWB 3IFTA 3H0GH 3TQYA 3PUXA 4X3UA 5CBAE 3GTGH 2E2IH 3H3VI 2B3GA 1HTLD 2EDGA 2PO4A 3JAME 3CRLC 2O5IC 1ET6A 4A3BG 4Q5VA 2JSOA 2BDOA 1RTOA 1QNKA 4IPHA 3H09A 3PMFA 1ONLA 3D6WA 2JJQA 4JBWA 1JQYD 4A3GB 2KCCA 1IBMQ 3BZCA 4DK0A 4CKCA 3BVZA 1Q8IA 4WRDA 4U68A 1BCPC 1MGSA 4P75A 2K04A 1VQ5A 2NVYB 1D5XC 1CZWA 5IGGA 5A35A 1DXMA 2B2WC 4O0AA 4DV1L 3KLWA 2OF1A 2CVRA 2BE5D 2KEEA 1I4HA 3SEBA 4ILWA 1R4QB 4KKTA 4JI5L 3CQZH 1JB7A 4DR6L 1B3AA 1PFNA 5IGEA 2JP1A 2LS01 2CH4W 4K5WA 3K58A 1Y1VH 4FYDA 2CCZA 2XRQD 3QOLA 1WTQA 2B8FA 2QF7A 1BBWA 2NVTH 3HRZC 3PUYA 1I4XA 2KEDA 1SYEA 2EY1A 4S3SA 3GTKH 1G6PA 2XWBB 1PRTC 1CSPA 4EQNA 5FO8B 4JI3Q 5D3IB 1ML0D 4FF1A 4IZ8A 1IBLQ 1CT1D 3NSWA 4HIKA 1N34Q 1HXYD 3O13A 3K8AA 5J3BA 4JI7L 4QF4A 4C1NI 3HFZB 3M4OB 1SXTA 2EXDA 3EN2A 1JJCB 1E1TA 2R61A 3AFQA 4FXKC 1X9NA 1NMGA 4DV2L 4YWKA 2EYMA 4B3TL 1PFBA 3J7AF 3PO3H 3EROA 2D62A 3AFPA 1Q8KA 3RMHA 5C44H 4POFA 3CCUA 1ESFA 4QQBX 1B7YB 1ZEQX 1JC7A 2F0KA 1SYCA 2NTSA 4JK1C 4HJ8A 2Z6KC 4Y52H 3H0GG 5IGBA 2YU9H 2DY8A 4EQOA 4OEMB 1H9KA 2B2VA 3CC7A 3NEMA 2HCCA 4H7BA 4LF9Q 1JWSD 1WI5A 1RJTA 3K0XA 1BCPB 3NK9A 3CCSA 3T1YL 4BA1I 4UHVA 1PMRA 3M4PA 3PO3B 1PVOA 3A8JE 1VF7A 5D14A 5I4DA 1VQ7A 2A74C 3A8IE 1ENAA 4NXMQ 4DXGA 3FHWA 3SK6A 4PMBA 3KF6B 3WOEA 2E75C 2UUCL 1K83H 1I6HB 2M2LA 1EY6A 4JI1Q 1JWUD 3DXJC 3TRZA 3A74A 1H9RA 2QGQA 3J80c 1EZ8A 1EYDA 3A54A 2AQ3B 1SLJA 1WTOA 3WDNA 1HUMA 3VA7A 1TT2A 3PO2H 4A3FG 3M7NA 3ICEA 2PNHA 4PG3A 4IALA 2RDGA 2YTXA 3BU2A 3S2DH 2TSSA 4J8QA 5C0XJ 3K5LA 1VS0A 2QW7A 3MZ5A 3QIAA 2E2HB 2QCPX 2CKZB 2XGTA 4JI6Q 1E0BA 3TMEA 4A3JH 4LF9L 4IO9A 4QB4A 2ICIA 5EGTA 4XTCS 1N9WA 5GROA 4ALPA 1NCVA 2YYZA 4FF2A 3RN5A 2PNRC 5ELFA 2R93H 3HOZB 3K5MA 3PO2B 1YJWA 4ZUIA 4LAAA 1S5FD 4RGOS 5J1ZA 3OTOQ 5CBEE 1AP0A 2VB2X 2DNEA 4IOAA 3I4MG 4X65L 2BOSA 2E2HH 4B3TQ 1XJVA 2F0EA 3HOXG 2WB1G 5IP9H 1B53A 3MA2B 1A2UA 5T1GA 2MUYA 2QKIC 3HOVH 2RHSB 4DN4M 1VQCA 4FP5D 2JN4A 1DZ1A 1I6VC 2A69C 2A68C 1WTWA 4J1MA 4C3IH 3HOUH 5C5MA 3UDIA 2K4KA 5LL6X 3BVMA 1EY9A 4UAIA 1XYIA 3VR6A 3VR2A 1CKNB 5H1SE 4R4IA 2I46A 4B3RL 1X3EA 4OGQC 1GHJA 4K8JA 3MEHA 5IE8A 4OO1H 2E2JH 1SNDA 5BN3A 5M3MB 3L2PA 4RAUC 3Q24A 4DV0Q 4DR5Q 5LMNW 1KIXA 3HOYH 1I50B 3ER0A 5JEAJ 2UU9L 2OEOA 4OXPA 3NBHA 5DEHA 4DV7L 1BDOA 3A55A 3CRKC 1XMQL 1D6EC 5EKIA 4ODGA 1L0WA 4XT1B 2V1CC 3CCRA 1RDPD 3EQLC 5FKAC 1WTPA 1HR0Q 3HOUB 1SMYD 4F7XA 1VQ4A 2K1BA 4P2CB 5IIFA 1QUQB 3K57A 2K6AA 1SNMA 1E22A 2QEJC 1TU2B 5M3MH 4A4IA 1GUGA 4R4CA 1IHZA 3Q6SA 3RZOH 3D8GA 4QUCA 1I50H 2BH8A 1KLUD 5M5WB 4GN3B 4X64Q 2J7ZA 2K5VA 1STHA 5ELOA 1PV4A 1IYVA 1VDZA 2A68D 3CCEA 2N55A 3J81j 2M9VA 2RBMA 1K8GA 2X69A 1UE5A 4DV0L 4DR5L 2A5HA 3L3OC 4A3KH 3T4AC 2F3VA 2GVAA 3W2DA 1J5EL 3T16A 4O42A 4AIMA 3PIO3 4B3RQ 2RDFA 4OELB 1G6ZA 1R4PB 3AU7A 1EWIA 3C1EA 1WTVA 1F9PA 1MI2A 2LSSA 1OO9B 2J4XA 4BY7B 1SROA 4JI8Q 4X3KA 1BR9A 2R6GA 2XNAC 1EL0A 1TR5A 3GTPB 5K36G 5G3LD 3I4NB 2CW0D 3RUZA 1KRSA 4HCSA 1M8AA 3HS0C 2KENA 3W5OA 5LL6S 4PZ7A 1A8VA 1VQHA 5FOBB 2IT1A 5C3WA 2ICEC 3GDEA 3TREA 3K59A 3W1BA 4LF4L 1QVGA 3GD7A 1J6QA 3EA6A 4BY7H 2NZ1D 4A3CG 3S1NB 3D0FA 4DGZA 4MN3A 2RA4A 3GTPH 5COYA 1Y1WH 1BVSA 4L6TB 4BXXG 2Y0SG 4C3IG 1JT8A 5KNCA 2I5LX 2PI2A 4A3IH 1WCMB 3LWEA 1J9OA 3CC4A 2VUMG 2B2TA 2DJGC 2Z8LA 4CJ0B 2EE1A 2AMCB 1PHJA 2JEBI 4DV5Q 1HPCA 3S1NH 2F0JA 3CMAA 1E24A 1ASZA 1WTXA 1FJGL 3SXHA 1Y1WB 2PW5A 4YY3L 5C4XB 3OSOA 1MD2D 2F4VL 4L5TA 3PUWA 4MTNA 1EIYB 1EUJA 3E9HA 4H13C 4LF5L 4A3EB 1UWVA 1JR0D 1WCMH 3KLSA 3CF5A 4QL5A 1BKBA 2F03A 3P1HA 1B8AA 1IBML 2D9UA 4HJAA 4A3LH 1DGSA 2ZJRA 4TSSA 3P75A 3BYYB 1LTTD 2R92B 4GOPA 1FJGQ 3F2CA 2IPKD 1VQOA 5C4XH 4ZLTF 1AE3A 1U4PA 1MJCA 3R93A 2KHSA 3N6RA 3TEHB 4DK1A 5KNDA 4DV5L 3EIVA 4A3EH 1Q82C 1OXXK 1VQKA 2A6HD 2QDBA 2KCTA 2J0TD 4XQNA 4JBKA 3MXPA 3EBEA 1UEBA 4OWXB 3F2BA 3NWTA 3FRPB 1HNWQ 3RLNA 1A3TA 4CDDC 4DV4Q 4LFCL 3HOXH 5LMNQ 2FINB 3NXWA 5A2QE 3K7AB 2EJMA 3OW7A 3X3MA 4CDFC 2MGSA 4JBJA 4GOPB 1E2ZA 3M4YA 3I7FA 4MNOA 4ZKBB 2JA9A 1O7YA 1I5FA 5C3XA 4KV6A 2WV6D 1YBYA 4U673 1JOKA 4WJWA 3CMEA 1DOKA 1I4QA 3PUVA 1XMOL 3S1QB 4DR7L 1OXVA 3NE5B 5CV5A 4RGTA 5M5XB 2K33A 3SK8A 5GQOA 3NHHA 4FDBA 4A3BH 3NENA 2HDMA 2JK8A 4MTKA 1IL2A 4L5QA 1HNZQ 1PH8A 1V1PB 2UXDL 3HOXB 3I2ZA 2FHTA 1B3QA 3MWYW 1QWYA 1VQEA 1XNRL 1VQFA 2F3IA 1VQGA 5C0XG 2FJ2A 3CCLA 4DR1L 1KNAA 1GO3E 4JI1L 5M3FH 4N9PA 4G4KA 2F0FA 4M8AA 3S1QH 1LUZA 1JB3A 2UUBL 4GKKQ 2SEBD 5IP7H 5CV6A 2F0PA 3CU7A 2SNSA 5CYUA 5EPKA 4DNIA 5M5XH 3S16B 1PLFA 4X3TA 3TP8A 4A3BB 3S15H 4IQZA 1GUSA 2PYKA 3UI2A 3CCMA 1Z7TA 4HTHA 1SYGA 4KN4C 3S1MB 5M5YH 1ASYA 3SK4A 1BF4A 1ZYRD 3MEFA 3SGIA 1A6XA 4ZAIA 1PYSB 4LUOA 3BDOA 2IW3A 3TBIB 1ZYRC 4HMJA 2Q8TA 2ZTEA 5M3FB 2XVSA 3PF4A 2ES2A 3I91A 1XPOA 1P8LA 4PQXA 5CR3A 5C0XH 1LT6D 1SJHD 3S16H 1SJED 4DU9A 4EQPA 3ULPA 1YNND 5E1FA 4DR1Q 4X62L 4IUQA 1PH1A 4PMCA 5AJ3L 1XPUA 2N49A 3P7JA 4ABNA 3G6JB 1B1ZA 1D5ZC 1F9SA 4A3DG 1BO0A 1MKHA 2F0TA 2KECA 3OYYA 4GNXA 1DOMA 1ILQA 1JWMD 3UDXA 1Q7YC 4KY5A 1HFNA 4C2MB 1X32A 3FPPA 1TXYA 5AFWA 3FPUB 3D4WA 2LXKA 1JE4A 2Q2TA 1Z6HA 3GTOH 1NMFA 2H4OA 3S17H 3KFUA 4XQJA 5E4WC 1XXGA 2R7FA 4JG2A 3HEJA 4JW0A 5FLMH 1YJNA 4OX9Q 3EFXD 3BG3A 4A3CH 1FVIA 1K3RA 5IT9L 1R9TB 5GAGC 1KC8C 1LTBD 2B63G 3H91A 3IL8A 3GTQB 4DAVA 3B6YA 1A3VA 3A56A 4C2MH 4Q0FA 2B8GA 5IYDG 3KLSX 3G7LA 1O7ZA 4PV1C 3GTMH 3E6ZX 2R7DA 1JE5A 4RWSC 1XTDA 3I4OA 1BCPF 1LABA 1H95A 3S17B 4BBSG 4DKAC 4A3MB 3KLRA 1HH2P 1CM9A 3FMCA 3ONAB 2HDLA 4IPDA 1K73C 3STBC 1S40A 2C5CA 2L5TA 2B2YC 5JVG3 1HNWL 3OWFA 2LXJA 3HOVG 2F0VA 1L0YB 5IGCA 2Z4HA 2HUGA 2XN9C 1MJEA 4LW1A 2CQAA 4IJLA 2B29A 2D2CC 2R7ZB 2FXQA 2F0DA 4AYBB 3G6EA 4JVZA 3T53B 1AZPA 5EAYA 5EBCA 3I70A 1K0RA 4A3MH 4NW2A 2VQFL 2LKVA 2XRSD 4A3JG 3WWVA 4P71A 1QVFA 2F0HA 1TS4A 3QO2A 3I4NG 1HZAA 1TWGB 1KD1C 1CA6A 3HKZG 4DR3L 3NTIA 3BDCA 1TWAB 1PH4A 3AQQA 1X3QA 4DAYA 2ZJQA 2JA6H 1AFPA 4H0LC 2K01A 4YY3Q 1C7YA 4KKSA 3RLOA 5JAVA 4NMZA 1SE4A 3UDGA 4DUYQ 3GTLH 3J7ZC 4JI4Q 4JCVE 3KUPA 5IOCA 4CJ1B 1X3FA 2A73B 1TWHH 4RFBA 4AYBE 4DK6C 2O5JC 3CC2A 2Q8RE 1SN8A 5BN4A 1E2VA 1MSGA 2R92G 2K14A 1JCKB 1Q46A 2OQ0A 1PYWD 1S5BD 4IFDG 5ELEA 2V4DA 1X65A 2EJGC 3KBGA 5J22A 3OIPA 1I4PA 4X6AH 5NUCA 4KK7A 2NVQH 2WKDA 4IFDJ 4EX5A 1NR2A 2JA6B 2A6EC 1SE2A 2DNCA 3AEVA 2RSOA 4IPCA 3KJOA 2LY7A 4X66Q 2N8NA 4A3LG 1KXLA 4IJHA 4O1NA 1S5DD 4HJ7A 2TMPA 4GLVB 3AB9A 2ZTCA 4F88A 5IGFA 2VS1A 1CTMA 4GKKL 2UUBQ 3J81c 4G7ZC 5K36H 5IYDH 5EPJA 1N32L 5IWAQ 1WJJA 2NVQB 1EWCA 1KLGD 1I94Q 1TS5A 5KYIA 5ELCA 4BS9A 3GTGB 3OPOA 2ZM6Q 4ID6A 5JEAH 2F0LA 1IBLL 3K5NA 4LF6Q 2CH4A 2NWGA 2K5NA 3HOWB 2UXBL 2SNMA 2EYLA 1L1OA 5G3LF 4RH6A 2R3ZA 3OHXC 4PZ6A 1K28A 4N8FA 3ND9A 3W1GA 1GUWA 5DM63 1XNQL 1I4RA 1UE6A 3LNNA 1KL9A 4NPSA 5I2XA 1OTCA 4UP7A 4RGMA 3U58A 3PUZA 4A3MG 1EY8A 1QCBD 3FKIG 3HKZE 1FGUA 1O7IA 1OXSC 1HR0L 3MAQA 2L55A 3AMUA 2PZUA 5FLXE 3CD6A 2I5MX 4C3JG 2ZJPA 3FKIB 4UPAA 3S1RB 1L1OC 1V1OA 2F0OA 4RA8A 1LTLA 2PQAA 4IURA 1HFGA 1PZKD 1Q81C 3H3VH 4C3JB 4A3DH 3CPFA 1WYDA 3QWNA 3K6OA 2R7ZG 1VQAA 2A6ED 5HURA 2WAQB 1EQVA 1CZGA 1V1PA 4K2LA 2JA7H 1XNQQ 3GTKB 2EYFA 2ZXPA 4KY6A 3T1HQ 1WCMG 3C3LA 1XMQQ 3A0JA 1JOQA 3PV0A 3VA5A 4DV7Q 3JAMc 2H5XA 1EEID 3QB3A 3MVVA 1FNVA 1LTSD 2CWPA 2GA4B 3FKIH 1PA6A 3S1RH 4YCVA 4IFDH 1EY0A 1GD7A 4C3JH 3M4OH 3J81E 4A3DB 1X6OA 4YHHL 2A1AA 1EQQA 3HOYG 1CKOA 1X56A 3DEPA 1AH9A 1IYUA 1DM0B 3M4QA 1I94L 5ELDA 2VZAA 5IT9c 1N33Q 4C56C 4QUFA 4DA2A 4J15A 3EJIA 1GUOA 2ZXRA 2L1BA 2IX3A 2KCNA 3IAYA 1Y8NB 1XX8A 4ZQ3A 3BDLA 3DUZA 4AQYL 1VQ9A 1STEA 2B2VC 2KJXA 4LUVA 4FXGC 4C3HH 1ICWA 4K0KL 3JAML 1IBKQ 5M3MG 1MIUA 1DCZA 1XPRA 4UDUC 3OMCA 1GUTA 1W6KA 4J6HA 1WD0A 1Q90A 3E9IA 2YU9B 1G91A 2K03A 1EY4A 2ZXOA 1N36Q 2UXCL 4IUUA 5JJLA 4OWWB 4WFN3 1HA6A 4DAYB 1RTNA 4DR4L 2I07B 4K0KQ 1EY5A 1KRTA 3U4ZA 3Q0AA 3BZKA 3NWSA 1Y14B 2HIVA 4A93G 5JVH3 4JV5L 1QZHA 5DNFA 3FEWX 5KIXA 3DWQA 4LFAQ 4B3SQ 4PMWA 4CBVA 3TN2A 4DV4L 4XDXA 3RN2A 3SDZA 2AUKA 1I6HH 3F8TA 3SVMA 4A76A 3KYHC 2F0IA 4XQQA 1GOZA 4ZYSA 4YHHQ 1LTGD 1TS2A 4KHZA 2NTTA 4DV3L 5D65A 2YTVA 4LMQD 1V43A 1SRUA 2NN6I 3NQIA 4IPGA 1SYBA 4NXNL 5BR8L 1JJ2A 3ULJA 1SSOA 2RCNA 3UE0A 3S2HB 2K5HA 4QMGA 3NTKA 2JA5G 3MXNB 3MTSA 4A3JB 2Q8IB 4FO2A 5FLXL 4DXFA 5M9OA 2JA5B 3TS2A 5C5LA 2NVXH 1QILA 4IOCA 1IXRA 4BXXH 2NZOA 4DFAA 4LF5Q 1VQIA 1B44D 4HIDA 1JMCA 3OW2A 4YCUA 1B50A 5C3EG 3GTJH 2NN6G 3S2HH 1U0LA 3OOCA 1YNJC 1GUNA 3NP8A 1K0SA 4CGYB 2E5LL 4RGNA 4FXDA 5C3EB 4KHVA 2PZWA 3DM1A 3HOVB 4B9XA 1RF2D 1LTRD 2DY7A 1HNXL 3KDFB 1U4LA 4TVAB 1X54A 1VQLA 1Q86C 4DAMA 1II3A 2Y0SB 4C3IB 1I4GA 4N9TA 4TQUS 5HY6A 5JPMC 4CHTB 1F9RA 3CHBD 1K9MC 2UU9Q 4K6DA 4C3HG 3GTJB 1HZCA 3CAMA 1WOCA 1U4RA 1H9SA 4HAEA 2B39A 2JXMB 4B3ML 1UUPA 3HOYB 1SNQA 2K05A 3BVGA 4GN4B 5C3EH 1QOHA 2BDNA 1VMPA 4OO1G 4DPGA 3ZJYC 2ALYB 4JBMA 3FVQA 3U50C 1KAAA 3D31A 4K14A 5IYBH 4DR6Q 2N88A 4YWLA 4JI3L 1IL8A 1FNUA 4ZUJA
chains in the Genus database with same CATH topology
2WKCA 1ESRA 1NR4A 1PFMA 3ITPA 1WVLA 2L0CA 2MPMA 2OT2A 4HMIA 1C8CA 2IX0A 3RZOB 5C4JB 1CHQD 4BWGB 4HEDA 1HQRD 1KDBA 1AEXA 4OO1I 3A7AB 4NP5A 2HCIA 2L12A 1LTAD 1FD7D 4IUTA 1BOSA 2WINB 3W3AA 1F2LA 3U9SA 1F2ZA 5E3FA 4MIUA 1G8ZD 1RCVD 3R8BA 2EPBA 2L11A 2L9HA 2PW7A 1S4ZA 2IL8A 1Q3LA 1BNZA 1L0XB 1LT5D 2O2LD 5EKKA 2EY2A 3OWEB 1HTPA 4RHRA 4I7ZC 3T51B 3KF8A 4I65A 3A8KE 3VYRA 4RKBA 2NBFA 3VYUA 1IKLA 1AN8A 1VF5C 2SOBA 4HN7A 4M1UB 4Z9CB 1DJRD 4FF3A 2K5QA 4FF4A 3H6MA 4XT3B 5F2DA 3Q23A 1KNEA 2KVMA 1STGA 1BXTA 5EKLA 1SAPA 4X3SA 1G291 3HZXA 1HA5A 1JORA 3KK7A 3CQZB 3F2UA 4IUNA 2NB0A 5KYLA 1Y1VB 2EY6A 5TSSA 1H9JA 1SYDA 4B08A 2NVTB 5KRUA 3FDTA 1TWFB 4NKLA 2LMCB 4A93B 3GO5A 3I8ZA 1D1IA 1PZID 2BA0A 2DN8A 3MFGA 4CJ2C 3S14B 4LJZC 2JE6I 1TVXA 2WIIB 1HCZA 1MSHA 5D3DA 4EVOA 1KTKA 3HKZB 2B2TC 3S9WA 1VCIA 3HG9A 4G7OC 1SNOA 5JJZA 1SFOB 2RVLA 3Q22A 1M4VA 5IODA 2B2YA 1EOTA 4OIJA 1BCPD 5C44B 3SK5A 2BCOA 4F87A 4KN7C 2B63B 1ZXTA 4ULLA 1IKMA 3NTHA 1EZ6A 1OXUA 3ND8A 1C48A 1SEBD 4L63B 3DWAA 5HGTA 5EJWA 1LV9A 1PTOF 3MXGA 2OXPA 4TKOB 4WORA 3VYSA 1DYQA 1SE3A 5I2YA 3MHBA 1SDFA 1SMYC 1BQQT 1K83B 3IFDA 1F2MA 3I4MB 2D5DA 4MHEA 3S15B 1LLRD 1RHPA 4KY7A 1W6JA 5M5YB 1TY0A 3V96A 4E6IA 5DM73 3S2DB 3ZYYX 4RCOA 1PZJD 3C2PA 1DOLA 1HQMC 2NYZD 4DAPA 1FYCA 4K5VA 4K5XA 1WD1A 2G9HD 2F1MA 3LWUA 2R93B 3J80L 1SNCA 4OIKA 1KDAA 4ZK9B 2F0NA 1CA5A 2MP1A 1T5EA 3A7LA 3DMUA 4KD4A 5A2QL 1U9RA 1V8QA 1ENFA 2VNUD 1LO5D 3IKJA 1ENCA 3GTOB 2O4XA 2F0GA 2F0UA 3HP3A 5JEAG 1RKNA 1B9MA 1EFID 4CKEA 1HHVA 3R3OA 1UEAB 2EYHA 5IGDA 4IUVA 5I9OA 2E2JB 1O78A 2PCFB 3CKIB 3GP7A 5CV8A 1EEFD 1TIID 4V0BA 5I9PA 5ELBA 3GTMB 1TY2A 3SHLA 3K5OA 5LHY1 3L7ZC 1PTOC 1QG7A 5BN5A 1T5XD 2EVBA 2KUMA 4CKBA 2JYOA 4Y7NB 5C4HA 1EU3A 4KD3A 1A2TA 2WP8J 1Q1EA 2XIWA 2EJFC 4G7HC 3HGBA 2KA7A 3V2TA 2CHBD 3D4DA 1X3PA 3SE0A 3RLFA 5JOBA 2VXWA 1CFMA 4A3KB 4XIGS 5KNBA 4BBSB 1EYAA 1PRTF 2MHVA 3I90A 4LK1C 2L4NA 4QIWB 3KBXA 2VUMB 2AWOA 1F2YA 2IX1A 2SDFA 3WOFA 1EIHA 4KKUA 1AW7A 4V190 2AWNA 3T56B 1H9MA 3OMGA 3BS1A 4TRDA 1F9QA 3J80E 1MBYA 3DHQA 5EBDA 5EQ0A 1ZKOA 1RD9D 4L8JA 5JPNC 5KGUA 4RKLA 1QE6A 4NDXA 3TP5A 1Y8PB 4A3IB 4PNYA 2F4IA 1U4MA 5KEEA 3VR4A 3PIP3 1H9SB 5T1IA 4IUPA 3P20A 1ET9A 4R8IA 5CORA 3K0YA 3E0JA 5ISRA 4QCLA 1STAA 2PPBC 2KQ3A 1D1KA 2K32A 3GV6A 1SYFA 4RHSA 5C6AA 1WTRA 5CC4A 4KI0A 4F8MA 2XWJB 2B2WA 5C0XI 2K7VA 3MFYA 5I6WA 1I3QB 2RSNA 1FGBD 2FMCA 1JICA 1XWEA 1YNNC 1E2WA 3NPPA 1EQTA 1FNWA 2WACA 2A6HC 1J8IA 1IW7C 3VYTA 3TP6A 2K28A 1AZQA 2EYJA 1QNUA 5FK9C 2M00A 2E2DC 3LX0A 5EPLA 2H1EA 4C1NK 2JA7B 4KTAA 1B2TA 1G2SA 4DNRB 2AQ1B 2Z1CA 4A3FB 4DNTB 1BUVT 3TZUA 3H3VC 1XTCD 4H44C 2QILA 1FR3A 1Y8OB 4ME5A 5IT9E 1A3UA 1NUCA 2F0WA 2RQXA 2CW0C 1A15A 2B2UA 3X3NA 2BE5C 1EIGA 3GQBA 1D2BA 4K6LA 1LT3D 1QJOA 1DONA 4KJOA 3I72A 3GV3A 4DF7A 1IW7D 2MJ8A 3VR3A 3U9OA 1PTOD 3QOJA 4C3HB 1CQFA 2RDHA 1SBBB 1Q12A 5K5PA 3BZDB 1EWHA 3I73A 2XSCA 2JEAI 2E74C 3TSSA 1KDCA 1C4QA 1YNJD 1RODA 3D6CA 4HR7B 5FO9B 4G57A 2EOTA 3MXNA 2RKSA 5CV4A 4IN3A 4R9WA 3QG1A 3R2TA 3L9AX 3C1FA 1NSNS 3H94A 3MXUA 4ZKCB 1S5CD 3J7AV 4BBRB 2EY5A 1K8OA 1KABA 3E5SA 4RCNA 4R8NA 2LFNA 3R2IA 5CV7A 1Y69U 3I4LA 5CMDA 4BA2I 1STBA 2EYPA 2VB3X 1D5MC 4XYOA 1TS3A 1UNSA 1B4OA 1LTID 1G2TA 4K2KA 1CQVA 2FMMA 3OIQA 4FVMA 1K8MA 4HCEA 3J7YW 1TWCB 1CHPD 4YIJA 3C46A 2EXZA 2BA1A 3DWPA 4XYQA 2PMZB 1O80A 1OXTA 4OHJA 2F0MA 4KMUC 2HQEA 1EU4A 1VMCA 2ZT9C 3MC0B 3TZDA 2NVXB 4OL7A 2FFKB 5I6YA 1PRTD 1Z47A 3URYA 3J81L 4IFDI 5E4XA 3M7GA 1SNPA 2IJ0A 4ZRZA 1PXUA 4FNFA 1NAPA 1LT4D 4HSPA 4HSVA 3NQTA 1PTOB 1PRTB 2NN6H 3SR1A 3V05A 2F0QA 4GZYC 2F0SA 4XXEA 3D4RA 2EYOA 1STNA 2IWHA 2G9DA 2F3WA 2EZVA 3RZDB 1EY7A 1F77A 3D3RA 3I3CA 1GXDC 1UAPA 2ID0A 2AQ2B 1PTOH 2A69D 3VR5A 3BYTB 3TP7A 1BBXC 2NUCA 2X6LA 1STYA 4K8IA 2Z4IA 2KOLA 3TDQA 1EYCA 2JA8B 2PZTA 5J39A 2X6GA 1LACA 2ENBA 4EGVA 1ILPA 3GTLB 1B9NA 2WB1B 3NBIA 3T13A 1TWHB 5DAUA 3RD4A 1CK1A 1GHKA 5C4ZA 3M3YB 2K5WA 2K5DA 1TQOA 3QJYA 1QB5D 3H0GB 3NUCA 5CV9A 1DD2A 4B9WA 2E2IB 2B2UC 1O7LA 5FO7B 1HRJA 2E76C 3DEOA 3ERQA 5CGKA 2AUJD 1S5ED 4BY1B 1GJXA 3EVQA 2C9OA 4KJNA 1HUNA 1PDQA 2PQEA 3N52A 3M85A 1JOOA 1CI3M 1Q1BA 1TKWB 3IFTA 3PUXA 4X3UA 5CBAE 1HTLD 2EDGA 2PO4A 3JAME 3CRLC 2O5IC 1ET6A 4Q5VA 2JSOA 2BDOA 1RTOA 1QNKA 3H09A 3PMFA 1ONLA 3D6WA 4JBWA 1JQYD 4A3GB 2KCCA 4DK0A 4CKCA 3BVZA 1Q8IA 4WRDA 4U68A 1BCPC 1MGSA 2K04A 2NVYB 1D5XC 1CZWA 5IGGA 5A35A 1DXMA 2B2WC 2OF1A 2CVRA 2BE5D 2KEEA 1I4HA 3SEBA 4ILWA 1R4QB 4KKTA 1B3AA 1PFNA 5IGEA 2JP1A 2LS01 4K5WA 3K58A 4FYDA 2XRQD 3QOLA 1WTQA 2B8FA 2QF7A 3HRZC 3PUYA 1I4XA 2KEDA 1SYEA 2EY1A 4S3SA 2XWBB 1PRTC 4EQNA 5FO8B 4FF1A 5D3IB 1ML0D 4IZ8A 1CT1D 3NSWA 1HXYD 3O13A 4QF4A 4C1NI 3M4OB 1SXTA 2R61A 4FXKC 2EYMA 1PFBA 3J7AF 3EROA 2D62A 3RMHA 1ESFA 1ZEQX 1JC7A 2F0KA 1SYCA 2NTSA 4JK1C 5IGBA 2DY8A 4EQOA 1H9KA 2B2VA 2HCCA 4H7BA 1JWSD 1RJTA 1BCPB 3NK9A 4BA1I 3PO3B 1PMRA 3A8JE 1VF7A 5D14A 5I4DA 2A74C 3A8IE 1ENAA 4DXGA 3SK6A 4PMBA 3WOEA 2E75C 1I6HB 2M2LA 1EY6A 1JWUD 3DXJC 1H9RA 1EZ8A 1EYDA 3A54A 2AQ3B 1WTOA 3WDNA 1HUMA 3VA7A 1TT2A 3M7NA 4IALA 2RDGA 2TSSA 4J8QA 5C0XJ 3K5LA 3MZ5A 3QIAA 2E2HB 2QCPX 1E0BA 3TMEA 4QB4A 2ICIA 5EGTA 4XTCS 1NCVA 2YYZA 4FF2A 2PNRC 5ELFA 3HOZB 3K5MA 3PO2B 4ZUIA 4LAAA 1S5FD 4RGOS 5J1ZA 5CBEE 1AP0A 2VB2X 2DNEA 2BOSA 2F0EA 1B53A 3MA2B 1A2UA 5T1GA 2MUYA 2QKIC 4DN4M 4FP5D 1DZ1A 1I6VC 2A69C 2A68C 1WTWA 4J1MA 5C5MA 5LL6X 3BVMA 1EY9A 4UAIA 1XYIA 3VR6A 3VR2A 2I46A 4OGQC 1GHJA 4K8JA 3MEHA 4OO1H 1SNDA 5BN3A 5M3MB 4RAUC 3Q24A 1I50B 5JEAJ 2OEOA 3NBHA 5DEHA 1BDOA 3A55A 3CRKC 1D6EC 5EKIA 4ODGA 4XT1B 1RDPD 3EQLC 5FKAC 1WTPA 3HOUB 1SMYD 4F7XA 2K1BA 4P2CB 5IIFA 3K57A 2K6AA 1SNMA 2QEJC 1TU2B 1GUGA 1IHZA 3Q6SA 3D8GA 4QUCA 1KLUD 5M5WB 2J7ZA 1STHA 1IYVA 1VDZA 2A68D 2N55A 2M9VA 2RBMA 2X69A 2A5HA 3L3OC 3T4AC 2F3VA 3W2DA 3T16A 4O42A 3PIO3 2RDFA 1G6ZA 1R4PB 3AU7A 3C1EA 1WTVA 1F9PA 1MI2A 1OO9B 2J4XA 4BY7B 4X3KA 1BR9A 2R6GA 2XNAC 1EL0A 1TR5A 3GTPB 5K36G 5G3LD 3I4NB 2CW0D 3RUZA 4HCSA 1M8AA 3HS0C 5LL6S 5FOBB 2IT1A 5C3WA 2ICEC 3K59A 3GD7A 3EA6A 2NZ1D 3S1NB 4DGZA 4MN3A 2RA4A 5COYA 4L6TB 4C3IG 5KNCA 1WCMB 3LWEA 1J9OA 2B2TA 2Z8LA 4CJ0B 2EE1A 2JEBI 1HPCA 2F0JA 1WTXA 3SXHA 1Y1WB 2PW5A 5C4XB 3OSOA 1MD2D 3PUWA 4H13C 4A3EB 1JR0D 3KLSA 2F03A 3P1HA 2D9UA 4TSSA 3P75A 3BYYB 1LTTD 2R92B 2IPKD 4ZLTF 1U4PA 3R93A 2KHSA 3N6RA 4DK1A 5KNDA 1OXXK 2A6HD 2QDBA 2J0TD 4XQNA 3MXPA 3NWTA 3FRPB 1A3TA 2FINB 3NXWA 5A2QE 3K7AB 2EJMA 3OW7A 3X3MA 2MGSA 1E2ZA 3M4YA 4ZKBB 1O7YA 5C3XA 4KV6A 2WV6D 4U673 1JOKA 4WJWA 3S1QB 1DOKA 1I4QA 3PUVA 1OXVA 3NE5B 5CV5A 4RGTA 5M5XB 2K33A 3SK8A 3NHHA 2HDMA 1V1PB 3HOXB 2FHTA 3MWYW 1QWYA 5C0XG 2FJ2A 1KNAA 4N9PA 4G4KA 2F0FA 4M8AA 1JB3A 2SEBD 5CV6A 2F0PA 3CU7A 2SNSA 5CYUA 5EPKA 3S16B 4A3BB 1PLFA 4X3TA 3TP8A 4IQZA 1GUSA 2PYKA 3UI2A 1Z7TA 4HTHA 1SYGA 4KN4C 3S1MB 3SK4A 1BF4A 1ZYRD 1A6XA 4ZAIA 3BDOA 2IW3A 3TBIB 1ZYRC 4HMJA 2Q8TA 5M3FB 2XVSA 3I91A 4PQXA 5CR3A 5C0XH 1LT6D 1SJHD 1SJED 4DU9A 4EQPA 1YNND 5E1FA 4IUQA 4PMCA 3P7JA 4ABNA 3G6JB 1B1ZA 1D5ZC 1F9SA 1BO0A 2F0TA 2KECA 1DOMA 1ILQA 1JWMD 4KY5A 1HFNA 4C2MB 1X32A 3FPPA 5AFWA 3FPUB 3D4WA 1JE4A 1Z6HA 2H4OA 4XQJA 5E4WC 1XXGA 3HEJA 3EFXD 3BG3A 5IT9L 1R9TB 1LTBD 3H91A 3IL8A 3GTQB 4DAVA 1A3VA 3A56A 4Q0FA 2B8GA 3KLSX 3G7LA 1O7ZA 4PV1C 3E6ZX 4RWSC 1BCPF 1LABA 3S17B 4A3MB 3KLRA 1CM9A 3FMCA 3ONAB 2HDLA 2C5CA 2L5TA 2B2YC 5JVG3 3OWFA 2F0VA 1L0YB 5IGCA 2Z4HA 2HUGA 2XN9C 2CQAA 2D2CC 2R7ZB 2F0DA 4AYBB 3T53B 1AZPA 5EBCA 3I70A 4NW2A 2LKVA 2XRSD 2F0HA 1TS4A 3QO2A 1TWGB 1CA6A 3NTIA 3BDCA 1TWAB 1X3QA 4DAYA 1AFPA 4H0LC 2K01A 4KKSA 5JAVA 4NMZA 1SE4A 3KUPA 5IOCA 4CJ1B 2A73B 2O5JC 4RFBA 2Q8RE 5BN4A 1E2VA 1MSGA 1JCKB 1PYWD 1S5BD 4IFDG 5ELEA 2V4DA 2EJGC 3KBGA 5J22A 3OIPA 1I4PA 5NUCA 4KK7A 2WKDA 4IFDJ 1NR2A 2JA6B 2A6EC 1SE2A 2DNCA 2RSOA 2LY7A 4O1NA 1S5DD 2TMPA 3AB9A 4F88A 5IGFA 1CTMA 4G7ZC 5K36H 5EPJA 2NVQB 1EWCA 1KLGD 1TS5A 5KYIA 5ELCA 4BS9A 3GTGB 3OPOA 4ID6A 5JEAH 2F0LA 3K5NA 2NWGA 3HOWB 2SNMA 2EYLA 5G3LF 4RH6A 2R3ZA 3OHXC 3ND9A 1GUWA 5DM63 1I4RA 3LNNA 5I2XA 4RGMA 3PUZA 1EY8A 1QCBD 1OXSC 3MAQA 2L55A 3AMUA 2PZUA 5FLXE 4C3JG 3FKIB 3S1RB 1V1OA 2F0OA 4RA8A 4IURA 1HFGA 1PZKD 4C3JB 3QWNA 3K6OA 2A6ED 5HURA 2WAQB 1EQVA 1V1PA 1CZGA 4K2LA 3GTKB 2EYFA 2ZXPA 4KY6A 3C3LA 1JOQA 3PV0A 3VA5A 1EEID 3QB3A 3MVVA 1FNVA 1LTSD 2GA4B 4IFDH 1EY0A 3J81E 4A3DB 3DEPA 1IYUA 1DM0B 5ELDA 4C56C 4QUFA 4DA2A 3EJIA 1GUOA 2ZXRA 2L1BA 2IX3A 2KCNA 3IAYA 1Y8NB 1XX8A 4ZQ3A 3BDLA 3DUZA 1STEA 2B2VC 2KJXA 4FXGC 1ICWA 3JAML 1DCZA 4UDUC 3OMCA 1GUTA 1W6KA 4J6HA 1WD0A 1Q90A 2YU9B 1G91A 2K03A 1EY4A 2ZXOA 4IUUA 4WFN3 1HA6A 1RTNA 2I07B 1EY5A 3Q0AA 3NWSA 5JVH3 5DNFA 3FEWX 5KIXA 3DWQA 4PMWA 4CBVA 3TN2A 4XDXA 3SDZA 2AUKA 3SVMA 2F0IA 4XQQA 1GOZA 4ZYSA 1LTGD 1TS2A 4KHZA 2NTTA 5D65A 4LMQD 1V43A 2NN6I 3NQIA 1SYBA 1SSOA 3S2HB 4QMGA 3NTKA 4A3JB 3MTSA 2Q8IB 4FO2A 5FLXL 4DXFA 5M9OA 2JA5B 5C5LA 1QILA 4DFAA 1B44D 1B50A 2NN6G 3OOCA 1YNJC 1GUNA 3NP8A 4CGYB 4FXDA 4RGNA 5C3EB 4KHVA 2PZWA 3DM1A 3HOVB 4B9XA 1RF2D 1LTRD 2DY7A 1U4LA 4C3IB 1II3A 2Y0SB 1I4GA 4N9TA 4TQUS 5JPMC 4CHTB 1F9RA 3CHBD 4K6DA 4C3HG 3GTJB 1U4RA 1H9SA 4HAEA 2B39A 2JXMB 3HOYB 1UUPA 1SNQA 2K05A 3BVGA 1QOHA 2BDNA 1VMPA 4OO1G 3FVQA 1KAAA 3D31A 4K14A 2N88A 1IL8A 1FNUA 4ZUJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PMC A;  5F2D A;  3SHL A;  1TR5 A;  3BDC A;  3ITP A;  2QDB A;  2PZU A;  3EVQ A;  3RUZ A;  5C5M A;  1STG A;  3MHB A;  3NQT A;  5EKL A;  2F0E A;  3MXP A;  4KJO A;  4KJN A;  2F0I A;  3HZX A;  1JOR A;  2F0T A;  2F0O A;  2PQE A;  3SR1 A;  1A2U A;  4DF7 A;  1A3T A;  4HMI A;  5C4H A;  2F0Q A;  2EYM A;  4KD3 A;  1A2T A;  1JOO A;  3U9O A;  4KY5 A;  1F2M A;  4NMZ A;  5C3W A;  5JAV A;  2F0S A;  3ERO A;  3QOJ A;  4IUN A;  1SYB A;  3NXW A;  5KYL A;  2EY6 A;  3V2T A;  5K5P A;  5HUR A;  1SYD A;  2EYO A;  3D4W A;  5IOC A;  1STN A;  5ISR A;  4KY7 A;  4E6I A;  2F3W A;  3D4D A;  5KRU A;  2F0K A;  1STA A;  4J1M A;  4QMG A;  1EQV A;  1KDB A;  1KDC A;  1SYC A;  2KQ3 A;  1AEX A;  1EY7 A;  1EY9 A;  4K2L A;  5C3X A;  4KV6 A;  2EYF A;  4KY6 A;  4NKL A;  1JOK A;  4DGZ A;  5IGB A;  1SYF A;  4K8J A;  3HEJ A;  3D6C A;  4NP5 A;  3MEH A;  3PMF A;  5CV5 A;  4G57 A;  5JOB A;  4EQO A;  5C6A A;  3VA5 A;  5CC4 A;  5M9O A;  5J22 A;  2RKS A;  5NUC A;  1JOQ A;  1SND A;  5CV4 A;  3SK8 A;  4F8M A;  3NHH A;  3QB3 A;  3MVV A;  4H7B A;  4K5V A;  4K5X A;  5C5L A;  1F2Z A;  3C1F A;  3TP7 A;  4WRD A;  4EVO A;  3NK9 A;  5E3F A;  1EY0 A;  2OEO A;  5I6W A;  1NSN S;  4DFA A;  2NUC A;  4MIU A;  1EYA A;  5DEH A;  1STY A;  1A3V A;  3S9W A;  1SNC A;  5IGG A;  4ODG A;  4K8I A;  5IGF A;  1ENA A;  1KDA A;  2EY5 A;  2OF1 A;  3SK6 A;  2WAC A;  1SNO A;  4PMB A;  2F0N A;  1EYC A;  1KAB A;  4F7X A;  3NP8 A;  3E5S A;  5IGC A;  3EJI A;  4R8N A;  5IIF A;  2F0J A;  1EY6 A;  2PW7 A;  2PZT A;  4N9P A;  2F0F A;  5CV7 A;  5J39 A;  1SNM A;  3TP6 A;  4KHV A;  4ZQ3 A;  1STB A;  2PZW A;  2EYJ A;  1F2Y A;  2EYP A;  3BDL A;  1EZ8 A;  1EYD A;  3DMU A;  3SXH A;  5IGE A;  2M00 A;  5CV6 A;  2F0P A;  4B9X A;  4KD4 A;  2PW5 A;  2SNS A;  1TT2 A;  1IHZ A;  4K5W A;  3OSO A;  1U9R A;  2ENB A;  3LX0 A;  4K2K A;  3TP8 A;  3D8G A;  5CGK A;  5I6Y A;  5IOD A;  5KYI A;  3OWF A;  4IAL A;  2PYK A;  3QOL A;  4ID6 A;  2F0L A;  4HTH A;  1SYG A;  3OMG A;  3SK5 A;  1II3 A;  1ENC A;  2F0V A;  2EY2 A;  4N9T A;  4TRD A;  2O4X A;  3MZ5 A;  5EKK A;  1STH A;  3DHQ A;  4KTA A;  2F0G A;  4YIJ A;  3T13 A;  3SK4 A;  2EXZ A;  5DAU A;  3OMC A;  4I65 A;  2F0U A;  4K6D A;  3P1H A;  2SNM A;  1RKN A;  1SYE A;  2EY1 A;  2EYL A;  2RBM A;  4J6H A;  4S3S A;  4RKB A;  2F0M A;  3TME A;  2F0D A;  5C4Z A;  1EY4 A;  4EQN A;  1TQO A;  1EZ6 A;  2HQE A;  3R3O A;  4IZ8 A;  4QB4 A;  2EYH A;  5IGD A;  5EGT A;  2F3V A;  5I9O A;  3T16 A;  4HMJ A;  3P75 A;  5KGU A;  1SNQ A;  1EY5 A;  2RDF A;  2LKV A;  2SOB A;  3NUC A;  4ME5 A;  4OL7 A;  4RKL A;  5CV9 A;  5HGT A;  3TP5 A;  1A3U A;  4NDX A;  5CV8 A;  4B9W A;  1NUC A;  5CR3 A;  2F0H A;  2F0W A;  3C1E A;  4QF4 A;  1KAA A;  4K14 A;  2OXP A;  4PNY A;  3H6M A;  4ZUI A;  4DU9 A;  4LAA A;  1SNP A;  4EQP A;  4WOR A;  5J1Z A;  5KEE A;  3ERQ A;  5E1F A;  5KIX A;  2KHS A;  5I9P A;  4ZUJ A;  1EY8 A; 
#chains in the Genus database with same CATH topology
 2WKC A;  1PH2 A;  1ESR A;  1NR4 A;  2MO0 A;  1PFM A;  3ITP A;  1WVL A;  2L0C A;  2OWO A;  3F2D A;  2JA8 H;  4LF6 L;  2CQO A;  2HHH L;  2MPM A;  4A3E G;  5GAH C;  2OT2 A;  4HMI A;  4QIW E;  3E3X A;  1C8C A;  2IX0 A;  2Y0S E;  3RZO B;  3AYH B;  1SR3 A;  5C4J B;  1CHQ D;  1YNX A;  5M5W H;  4BWG B;  4HED A;  4UP8 A;  3F1Z A;  1HQR D;  1EQR A;  1KDB A;  1AEX A;  4OO1 I;  2OQK A;  3A7A B;  4NP5 A;  2HCI A;  2L12 A;  1LTA D;  1FD7 D;  4IUT A;  1BOS A;  2K52 A;  2WIN B;  3W3A A;  1F2L A;  1GKH A;  3U9S A;  1F2Z A;  5E3F A;  4MIU A;  2C35 B;  1VQ6 A;  4QGU A;  4HJ5 A;  1G8Z D;  3UDF A;  1LYL A;  1RCV D;  1VQD A;  3R8B A;  3I4N H;  1QUQ A;  3K80 C;  4UP9 A;  3J7A 5;  2EPB A;  2L11 A;  3K81 C;  2L9H A;  2PW7 A;  2RCF A;  1EFW A;  2XTI A;  3PCO B;  1MHW C;  3KF8 B;  1G51 A;  4KLK A;  1W2B A;  5BR8 Q;  4NXN Q;  2MQH A;  4JOI A;  1YEZ A;  1S4Z A;  3QR8 A;  2IL8 A;  1Q3L A;  1BNZ A;  1L0X B;  4AYB G;  1LT5 D;  3DM3 A;  2ZTD A;  4OON A;  5IP7 G;  2O2L D;  5EKK A;  2EY2 A;  3OWE B;  2D0P A;  1N36 L;  1N8R C;  1HTP A;  4MZ9 A;  4RHR A;  4I7Z C;  3T51 B;  3KF8 A;  4I65 A;  4LWC A;  3A8K E;  3VYR A;  4RKB A;  4B3S L;  2NBF A;  4LFA L;  2QEX A;  3VYU A;  1IKL A;  4BY7 G;  1AN8 A;  2Q2H A;  1VF5 C;  1P16 A;  4A3G H;  2SOB A;  4HN7 A;  4M1U B;  3H15 A;  4Z9C B;  2VQF Q;  1DJR D;  4FF3 A;  2K5Q A;  3PIP A;  4FF4 A;  4QJF A;  2RF4 A;  1M90 C;  3H6M A;  4R1J A;  2Z9H A;  4XT3 B;  2UXC Q;  2F52 A;  5F2D A;  3Q23 A;  4A93 H;  1KNE A;  2KVM A;  2KHJ A;  1STG A;  2Q2U A;  1BXT A;  3G4S A;  5EKL A;  1SAP A;  4X3S A;  1G29 1;  3HZX A;  1HA5 A;  1JOR A;  3KK7 A;  1L1O B;  3CQZ B;  1GM5 A;  3U4V A;  3F2U A;  1YI2 A;  1VQN A;  4IUN A;  2VY3 A;  4KHP Q;  2NB0 A;  4JI8 L;  5KYL A;  1Y1V B;  2EY6 A;  5TSS A;  1H9J A;  3OTO L;  1SYD A;  4B08 A;  4OX9 L;  4LF8 Q;  2NVT B;  5KRU A;  3FDT A;  2GN5 A;  3BJU A;  3PSI A;  1TWF B;  1SFO H;  4NKL A;  2LMC B;  4A93 B;  3GO5 A;  3I8Z A;  5FJ8 H;  4UY8 C;  4GKJ L;  1D1I A;  1PZI D;  2BA0 A;  2DN8 A;  3MFG A;  4CJ2 C;  3S14 B;  4LJZ C;  3J80 i;  2JE6 I;  1TVX A;  2R92 H;  1NBW A;  2WII B;  5FLM G;  2AHO B;  1HCZ A;  1MSH A;  5D3D A;  4EVO A;  3HKZ B;  1KTK A;  2B2T C;  3ERS X;  1IZ6 A;  3S9W A;  1VCI A;  3HG9 A;  2HT1 A;  2B63 H;  4G7O C;  4DV6 Q;  5C4X G;  1SNO A;  5IY0 A;  5JJZ A;  1TWF H;  1SFO B;  3KF6 A;  2RVL A;  4HJ9 A;  3JC6 6;  2MFI A;  3HKS A;  3S14 H;  3Q22 A;  1M4V A;  2WAQ E;  3K7A H;  5IOD A;  3RR5 A;  2B2Y A;  1EOT A;  2MNA A;  4L5S A;  4OIJ A;  1BCP D;  2KBN A;  5C44 B;  3SK5 A;  2BCO A;  4F87 A;  4KN7 C;  4RMF A;  2B63 B;  1ZXT A;  4ULL A;  1IKM A;  3NTH A;  4NB3 A;  4POG A;  4X62 Q;  3G48 A;  1EZ6 A;  4LFB Q;  2JA7 G;  1OXU A;  2ATW A;  2HD3 A;  5ELN A;  3ND8 A;  1C48 A;  1SEB D;  1VQ8 A;  4L63 B;  3DWA A;  5HGT A;  3FP9 A;  4HIO A;  5EJW A;  1LV9 A;  5IWA L;  1PTO F;  4CDC C;  1N32 Q;  3MXG A;  2OXP A;  4TKO B;  4WOR A;  5GAE C;  3VYS A;  2QA4 A;  1DYQ A;  3KOJ A;  1D8L A;  1SE3 A;  5I2Y A;  4P72 A;  4JI2 L;  3MHB A;  1SDF A;  2DJF C;  1SMY C;  1BQQ T;  1K83 B;  1NJI C;  1VQJ A;  3IFD A;  5L37 A;  1F2M A;  3I4M B;  2D5D A;  3PQI A;  4MHE A;  3S15 B;  1LLR D;  1CUK A;  1NY4 A;  1RHP A;  1W6J A;  4KY7 A;  5M5Y B;  1TY0 A;  3V96 A;  3NEL A;  4E6I A;  5DM7 3;  4GNX C;  3S2D B;  1WFQ A;  1YIJ A;  3ZYY X;  4RCO A;  1E7Z A;  1PZJ D;  1UE1 A;  3C2P A;  4DR4 Q;  2Q2I A;  1DOL A;  1HQM C;  1GVP A;  2NYZ D;  1YHQ A;  1VQP A;  2UXD Q;  4DAP A;  1FYC A;  4K5X A;  4K5V A;  1WD1 A;  1W3S A;  1EIF A;  2G9H D;  4JI6 L;  2F1M A;  3LWU A;  4GLX A;  2R93 B;  3I4M H;  3HOZ H;  3J80 L;  3ULL A;  1SNC A;  1XMO Q;  4OIK A;  1YIT A;  3CPW A;  1KDA A;  4LF7 L;  4O2D A;  2BH2 A;  1HJP A;  2PI2 E;  4ZK9 B;  2F0N A;  4AQY Q;  2WFW A;  4ME3 A;  1CA5 A;  2MP1 A;  3LGJ A;  2E5L Q;  4YWM A;  4BY1 G;  1T5E A;  3A7L A;  3DMU A;  1AE2 A;  4KD4 A;  5A2Q L;  2WAQ G;  1U9R A;  1QZG A;  1V8Q A;  2OTJ A;  1ENF A;  2IHE A;  2VNU D;  5E7N A;  1LO5 D;  3IKJ A;  1ENC A;  3GTO B;  2O4X A;  1E1O A;  4P74 A;  2F0G A;  1E3P A;  2F0U A;  3HP3 A;  5JEA G;  2EQS A;  4DR3 Q;  1RKN A;  1L2F A;  1B9M A;  1IYJ B;  1EFI D;  4CKE A;  1HHV A;  3R3O A;  1UEA B;  4Y7N H;  4GKJ Q;  2EYH A;  5IGD A;  4IUV A;  5I9O A;  2E2J B;  1O78 A;  4WJ4 A;  3T1H L;  5LMU Q;  2PCF B;  3CKI B;  3GP7 A;  5LMU L;  5CV8 A;  1EEF D;  1TII D;  4KHP L;  4V0B A;  5ELB A;  5I9P A;  3GTM B;  1TY2 A;  3SHL A;  3K5O A;  5IYC G;  5JJK A;  3Q8D A;  5LHY 1;  3L7Z C;  4DV2 Q;  1PTO C;  1QG7 A;  1KHI A;  2HQL A;  5BN5 A;  1T5X D;  2EVB A;  2KUM A;  4CKB A;  2JYO A;  4Y7N B;  5C4H A;  1EU3 A;  2D0O A;  4KD3 A;  4BBS H;  1A2T A;  2WP8 J;  1Q1E A;  2XIW A;  2EJF C;  4G7H C;  3HGB A;  2KA7 A;  3V2T A;  2CHB D;  3D4D A;  1X3P A;  4DR2 L;  3SE0 A;  2GVB A;  3TS0 A;  4A3K G;  2R7Z H;  3RLF A;  3NBH B;  3PF5 A;  4B3M Q;  3IRB A;  2WB1 E;  5JOB A;  2VXW A;  1CFM A;  4A3K B;  4LF4 Q;  4XIG S;  5KNB A;  4BBS B;  1EYA A;  1PRT F;  4GOP C;  1IBK L;  2MHV A;  3I90 A;  3S24 A;  4LK1 C;  4DUZ Q;  2L4N A;  4YCW A;  4QIW B;  1A0I A;  3KBX A;  4JI5 Q;  3PO2 G;  2VUM B;  3DLL A;  2AWO A;  1F2Y A;  1Z9F A;  2UUA Q;  2IX1 A;  2SDF A;  2JA8 G;  3WOF A;  1EIH A;  4KKU A;  4NXM L;  5FLX c;  1AW7 A;  2AWN A;  4V19 0;  3T56 B;  4JYA Q;  1H9M A;  3OMG A;  3BS1 A;  1WTH A;  4TRD A;  1F9Q A;  3J80 E;  1MBY A;  3DHQ A;  5EBD A;  3KJP A;  5EQ0 A;  1ZKO A;  1RD9 D;  5AJ3 Q;  4L8J A;  2I0Q A;  2DGY A;  4JPB W;  5JPN C;  1K8A C;  1YZ6 A;  1EOV A;  1C9O A;  5KGU A;  2VUM H;  4RKL A;  3STB D;  1QE6 A;  4NDX A;  3TP5 A;  1Y8P B;  4A3I B;  5FJ8 G;  4PNY A;  2F4I A;  1U4M A;  5KEE A;  3VR4 A;  3PIP 3;  1PH9 A;  1H9S B;  4RG1 A;  5T1I A;  1BBU A;  1LM0 A;  4IUP A;  3P20 A;  4DUZ L;  1ET9 A;  4X64 L;  4R8I A;  1D7Q A;  1JJG A;  3A5Z B;  1Y1V G;  5COR A;  3K0Y A;  2A8V A;  2OTL A;  3E0J A;  5ISR A;  1CKN A;  1PFS A;  1U5K A;  4QCL A;  3HOW H;  1STA A;  2PPB C;  2KQ3 A;  1HZB A;  1HZ9 A;  1ICF B;  1S72 A;  1D1K A;  2K32 A;  3GV6 A;  1SYF A;  4RHS A;  4DR2 Q;  1PH6 A;  4LF8 L;  2KCM A;  4R4Q A;  5C6A A;  1WTR A;  5CC4 A;  4OWT B;  3I55 A;  4KI0 A;  4F8M A;  2CWA A;  2XWJ B;  4P73 A;  2B2W A;  5C0X I;  2K7V A;  1NE3 A;  3M9B A;  5DLQ E;  3MFY A;  5I6W A;  1KQS A;  4LFC Q;  2VW9 A;  1I3Q B;  3CCJ A;  4AH6 A;  4HIM A;  3PGZ A;  2RSN A;  1X55 A;  2ZM6 L;  1FGB D;  2FMC A;  4DR7 Q;  1V1Q A;  1JIC A;  1XWE A;  1YNN C;  1E2W A;  3NPP A;  1EQT A;  1FNW A;  2WAC A;  2K50 A;  2A6H C;  1J8I A;  2E8G A;  2K75 A;  1IW7 C;  3VYT A;  3TP6 A;  2K28 A;  1AZQ A;  2EYJ A;  3HOW G;  1QNU A;  5FK9 C;  4EQ5 A;  2M00 A;  4LUZ A;  4DV1 Q;  2E2D C;  2VQE Q;  1N33 L;  4PZ8 A;  3LX0 A;  5EPL A;  2H1E A;  2VL6 A;  4C1N K;  1I3Q H;  2JA7 B;  2DUD A;  4KTA A;  1B2T A;  1G2S A;  4DNR B;  2AQ1 B;  2Z1C A;  4A3F B;  2R93 G;  4DNT B;  1BUV T;  3TZU A;  3H3V C;  3K7U C;  1XTC D;  4JI0 Q;  4H44 C;  2F4V Q;  2QIL A;  1FR3 A;  1Y8O B;  4ME5 A;  5IT9 E;  1A3U A;  3VDY A;  1NUC A;  3KDF A;  2F0W A;  2RQX A;  2CW0 C;  1FL0 A;  1A15 A;  2B2U A;  4JI4 L;  3X3N A;  4A3G G;  2L15 A;  2BE5 C;  1EIG A;  3GQB A;  1HR0 W;  5IYB G;  1D2B A;  4LF7 Q;  4K6L A;  4DV3 Q;  1LT3 D;  2G5D A;  2YV5 A;  1QJO A;  1DON A;  4KJO A;  5IYC H;  4A3F H;  1YHB A;  3I72 A;  3GV3 A;  4DF7 A;  1PYB A;  1IW7 D;  3T1Y Q;  2MJ8 A;  3VR3 A;  3U9O A;  1PTO D;  3QOJ A;  4C3H B;  1CQF A;  2RDH A;  1SBB B;  1Q12 A;  5K5P A;  3BZD B;  1EWH A;  1YHA A;  2XSC A;  3I73 A;  4I7A A;  2JEA I;  2E74 C;  3TSS A;  3CCV A;  3S1M H;  1YJ9 A;  1KDC A;  1Y1W G;  1RIP A;  1C4Q A;  1YNJ D;  1ROD A;  1SE8 A;  3D6C A;  4HR7 B;  5FO9 B;  4L5R C;  4G57 A;  2EOT A;  3MXN A;  2RKS A;  2EIF A;  5CV4 A;  4IN3 A;  4R9W A;  4A75 A;  3QG1 A;  3R2T A;  5JJI A;  3L9A X;  3C1F A;  2A19 A;  1NSN S;  3H94 A;  3CW2 C;  1C0A A;  1EYG A;  3MXU A;  3E0E A;  4ZKC B;  2HHH Q;  1S5C D;  3J7A V;  4APV A;  4ZCK A;  4JI2 Q;  4BBR B;  3L0O A;  2EY5 A;  1K8O A;  3RNU A;  2UUA L;  2PQA B;  1KAB A;  3E5S A;  4RCN A;  4R8N A;  5C44 G;  2LFN A;  3R2I A;  5CV7 A;  1Y69 U;  3I4L A;  5CMD A;  1T9H A;  1STB A;  4BA2 I;  2EYP A;  2VB3 X;  1B70 B;  1D5M C;  4XYO A;  1TS3 A;  1UNS A;  1B4O A;  1VQB A;  1LTI D;  1G2T A;  4K2K A;  1CQV A;  2FMM A;  3OIQ A;  4FVM A;  2P5Z X;  4LFB L;  1K8M A;  4HCE A;  3J7Y W;  1TWC B;  1CHP D;  4YIJ A;  4X66 L;  1PH5 A;  4N8X 1;  1M1K C;  2EXZ A;  3C46 A;  2BA1 A;  1HNZ L;  3DWP A;  4XYQ A;  2PMZ B;  4R4T A;  1O80 A;  1OXT A;  4OHJ A;  2F0M A;  4BBR H;  4KMU C;  4GLA C;  2HQE A;  1EU4 A;  1VMC A;  2JA5 H;  2ZT9 C;  3MC0 B;  2N78 A;  3TZD A;  1HNX Q;  4JI7 Q;  2NVX B;  4QY7 A;  1NNX A;  4OL7 A;  2FFK B;  3JAM i;  1R9T H;  5I6Y A;  1PRT D;  1Z47 A;  1N34 L;  3URY A;  3J81 L;  4IFD I;  3GTQ H;  1J5E Q;  3RZD H;  5E4X A;  3M7G A;  1SNP A;  1X3G A;  2IJ0 A;  4ZRZ A;  5HGQ A;  2IY5 B;  1PXU A;  3UE1 A;  4FNF A;  3HOZ G;  1TWC H;  1NAP A;  3J81 i;  2ASB A;  1LT4 D;  1S3O A;  4HSP A;  4HSV A;  3NQT A;  1PTO B;  2Z6K A;  1PRT B;  3PO3 G;  2NN6 H;  2OCE A;  3I56 A;  1CKM A;  3SR1 A;  3V05 A;  2F0Q A;  4GZY C;  1SMX A;  2F0S A;  4WJ3 M;  4XXE A;  3D4R A;  3CXC A;  1RL2 A;  2EYO A;  4CDE C;  1STN A;  2IWH A;  2G9D A;  2F3W A;  2EZV A;  3RZD B;  1EY7 A;  4DV6 L;  1QVC A;  1F77 A;  1KAW A;  1NTG A;  3D3R A;  4JI0 L;  2KHI A;  1PH7 A;  2MO1 A;  3I3C A;  1GXD C;  1UAP A;  4DK3 C;  2ID0 A;  2AQ2 B;  4JOI C;  1CSQ A;  1PTO H;  2A69 D;  3VR5 A;  3PIO A;  3BYT B;  3CCQ A;  1UE7 A;  1YVC A;  3TP7 A;  2UXB Q;  1BBX C;  2NUC A;  2X6L A;  1STY A;  2Z0S A;  4JYA L;  1TWG H;  4K8I A;  5M3F G;  2Z4I A;  2JA6 G;  4X65 Q;  3M3Y H;  2AKW B;  2VQE L;  2KOL A;  1TWA H;  3TDQ A;  1EYC A;  2JA8 B;  1VQM A;  2PZT A;  5J39 A;  1A63 A;  2RHQ B;  5GAD C;  2QDL A;  3HOU G;  2X6G A;  5C4J H;  1LAC A;  3G71 A;  2ENB A;  4EGV A;  1PH3 A;  1XNR Q;  1ILP A;  3GTL B;  1B9N A;  4R4O A;  2WB1 B;  4BY1 H;  3NBI A;  3T13 A;  1TWH B;  5DAU A;  4GS3 A;  3RD4 A;  1CK1 A;  1GHK A;  5C4Z A;  3M3Y B;  2K5W A;  2K5D A;  1TQO A;  3QJY A;  4LNQ A;  4A3I G;  4JV5 Q;  4H02 A;  3CP0 A;  1QB5 D;  1V9P A;  2PMZ E;  4JC0 A;  2CFM A;  3H0G B;  3NUC A;  2Z6B A;  5CV9 A;  1DD2 A;  4B9W A;  2E2I B;  2YTY A;  4BBR G;  2B2U C;  1O7L A;  5FO7 B;  1HRJ A;  2E76 C;  4GN5 A;  3DEO A;  3ERQ A;  5CGK A;  2AUJ D;  4DUY L;  2UUC Q;  5LMN L;  1S5E D;  5IP9 G;  4BY1 B;  1GJX A;  3EVQ A;  4GNX B;  1A62 A;  2C9O A;  4KJN A;  2IHF A;  1HUN A;  1PDQ A;  2NZH A;  2I5H A;  2PQE A;  2N3S A;  3N52 A;  3A5U A;  3M85 A;  1JOO A;  1CI3 M;  2NVY H;  1Q1B A;  2HIX A;  2JQO A;  1K3B C;  1TKW B;  3IFT A;  3H0G H;  3TQY A;  3PUX A;  4X3U A;  5CBA E;  3GTG H;  2E2I H;  3H3V I;  2B3G A;  1HTL D;  2EDG A;  2PO4 A;  3JAM E;  3CRL C;  2O5I C;  1ET6 A;  4A3B G;  4Q5V A;  2JSO A;  2BDO A;  1RTO A;  1QNK A;  4IPH A;  3H09 A;  3PMF A;  1ONL A;  3D6W A;  2JJQ A;  4JBW A;  1JQY D;  4A3G B;  2KCC A;  1IBM Q;  3BZC A;  4DK0 A;  4CKC A;  3BVZ A;  1Q8I A;  4WRD A;  4U68 A;  1BCP C;  1MGS A;  4P75 A;  2K04 A;  1VQ5 A;  2NVY B;  1D5X C;  1CZW A;  5IGG A;  5A35 A;  1DXM A;  2B2W C;  4O0A A;  4DV1 L;  3KLW A;  2OF1 A;  2CVR A;  2BE5 D;  2KEE A;  1I4H A;  3SEB A;  4ILW A;  1R4Q B;  4KKT A;  4JI5 L;  3CQZ H;  1JB7 A;  4DR6 L;  1B3A A;  1PFN A;  5IGE A;  2JP1 A;  2LS0 1;  2CH4 W;  4K5W A;  3K58 A;  1Y1V H;  4FYD A;  2CCZ A;  2XRQ D;  3QOL A;  1WTQ A;  2B8F A;  2QF7 A;  1BBW A;  2NVT H;  3HRZ C;  3PUY A;  1I4X A;  2KED A;  1SYE A;  2EY1 A;  4S3S A;  3GTK H;  1G6P A;  2XWB B;  1PRT C;  1CSP A;  4EQN A;  5FO8 B;  4JI3 Q;  5D3I B;  1ML0 D;  4FF1 A;  4IZ8 A;  1IBL Q;  1CT1 D;  3NSW A;  4HIK A;  1N34 Q;  1HXY D;  3O13 A;  3K8A A;  5J3B A;  4JI7 L;  4QF4 A;  4C1N I;  3HFZ B;  3M4O B;  1SXT A;  2EXD A;  3EN2 A;  1JJC B;  1E1T A;  2R61 A;  3AFQ A;  4FXK C;  1X9N A;  1NMG A;  4DV2 L;  4YWK A;  2EYM A;  4B3T L;  1PFB A;  3J7A F;  3PO3 H;  3ERO A;  2D62 A;  3AFP A;  1Q8K A;  3RMH A;  5C44 H;  4POF A;  3CCU A;  1ESF A;  4QQB X;  1B7Y B;  1ZEQ X;  1JC7 A;  2F0K A;  1SYC A;  2NTS A;  4JK1 C;  4HJ8 A;  2Z6K C;  4Y52 H;  3H0G G;  5IGB A;  2YU9 H;  2DY8 A;  4EQO A;  4OEM B;  1H9K A;  2B2V A;  3CC7 A;  3NEM A;  2HCC A;  4H7B A;  4LF9 Q;  1JWS D;  1WI5 A;  1RJT A;  3K0X A;  1BCP B;  3NK9 A;  3CCS A;  3T1Y L;  4BA1 I;  4UHV A;  1PMR A;  3M4P A;  3PO3 B;  1PVO A;  3A8J E;  1VF7 A;  5D14 A;  5I4D A;  1VQ7 A;  2A74 C;  3A8I E;  1ENA A;  4NXM Q;  4DXG A;  3FHW A;  3SK6 A;  4PMB A;  3KF6 B;  3WOE A;  2E75 C;  2UUC L;  1K83 H;  1I6H B;  2M2L A;  1EY6 A;  4JI1 Q;  1JWU D;  3DXJ C;  3TRZ A;  3A74 A;  1H9R A;  2QGQ A;  3J80 c;  1EZ8 A;  1EYD A;  3A54 A;  2AQ3 B;  1SLJ A;  1WTO A;  3WDN A;  1HUM A;  3VA7 A;  1TT2 A;  3PO2 H;  4A3F G;  3M7N A;  3ICE A;  2PNH A;  4PG3 A;  4IAL A;  2RDG A;  2YTX A;  3BU2 A;  3S2D H;  2TSS A;  4J8Q A;  5C0X J;  3K5L A;  1VS0 A;  2QW7 A;  3MZ5 A;  3QIA A;  2E2H B;  2QCP X;  2CKZ B;  2XGT A;  4JI6 Q;  1E0B A;  3TME A;  4A3J H;  4LF9 L;  4IO9 A;  4QB4 A;  2ICI A;  5EGT A;  4XTC S;  1N9W A;  5GRO A;  4ALP A;  1NCV A;  2YYZ A;  4FF2 A;  3RN5 A;  2PNR C;  5ELF A;  2R93 H;  3HOZ B;  3K5M A;  3PO2 B;  1YJW A;  4ZUI A;  4LAA A;  1S5F D;  4RGO S;  5J1Z A;  3OTO Q;  5CBE E;  1AP0 A;  2VB2 X;  2DNE A;  4IOA A;  3I4M G;  4X65 L;  2BOS A;  2E2H H;  4B3T Q;  1XJV A;  2F0E A;  3HOX G;  2WB1 G;  5IP9 H;  1B53 A;  3MA2 B;  1A2U A;  5T1G A;  2MUY A;  2QKI C;  3HOV H;  2RHS B;  4DN4 M;  1VQC A;  4FP5 D;  2JN4 A;  1DZ1 A;  1I6V C;  2A69 C;  2A68 C;  1WTW A;  4J1M A;  4C3I H;  3HOU H;  5C5M A;  3UDI A;  2K4K A;  5LL6 X;  3BVM A;  1EY9 A;  4UAI A;  1XYI A;  3VR6 A;  3VR2 A;  1CKN B;  5H1S E;  4R4I A;  2I46 A;  4B3R L;  1X3E A;  4OGQ C;  1GHJ A;  4K8J A;  3MEH A;  5IE8 A;  4OO1 H;  2E2J H;  1SND A;  5BN3 A;  5M3M B;  3L2P A;  4RAU C;  3Q24 A;  4DV0 Q;  4DR5 Q;  5LMN W;  1KIX A;  3HOY H;  1I50 B;  3ER0 A;  5JEA J;  2UU9 L;  2OEO A;  4OXP A;  3NBH A;  5DEH A;  4DV7 L;  1BDO A;  3A55 A;  3CRK C;  1XMQ L;  1D6E C;  5EKI A;  4ODG A;  1L0W A;  4XT1 B;  2V1C C;  3CCR A;  1RDP D;  3EQL C;  5FKA C;  1WTP A;  1HR0 Q;  3HOU B;  1SMY D;  4F7X A;  1VQ4 A;  2K1B A;  4P2C B;  5IIF A;  1QUQ B;  3K57 A;  2K6A A;  1SNM A;  1E22 A;  2QEJ C;  1TU2 B;  5M3M H;  4A4I A;  1GUG A;  4R4C A;  1IHZ A;  3Q6S A;  3RZO H;  3D8G A;  4QUC A;  1I50 H;  2BH8 A;  1KLU D;  5M5W B;  4GN3 B;  4X64 Q;  2J7Z A;  2K5V A;  1STH A;  5ELO A;  1PV4 A;  1IYV A;  1VDZ A;  2A68 D;  3CCE A;  2N55 A;  3J81 j;  2M9V A;  2RBM A;  1K8G A;  2X69 A;  1UE5 A;  4DV0 L;  4DR5 L;  2A5H A;  3L3O C;  4A3K H;  3T4A C;  2F3V A;  2GVA A;  3W2D A;  1J5E L;  3T16 A;  4O42 A;  4AIM A;  3PIO 3;  4B3R Q;  2RDF A;  4OEL B;  1G6Z A;  1R4P B;  3AU7 A;  1EWI A;  3C1E A;  1WTV A;  1F9P A;  1MI2 A;  2LSS A;  1OO9 B;  2J4X A;  4BY7 B;  1SRO A;  4JI8 Q;  4X3K A;  1BR9 A;  2R6G A;  2XNA C;  1EL0 A;  1TR5 A;  3GTP B;  5K36 G;  5G3L D;  3I4N B;  2CW0 D;  3RUZ A;  1KRS A;  4HCS A;  1M8A A;  3HS0 C;  2KEN A;  3W5O A;  5LL6 S;  4PZ7 A;  1A8V A;  1VQH A;  5FOB B;  2IT1 A;  5C3W A;  2ICE C;  3GDE A;  3TRE A;  3K59 A;  3W1B A;  4LF4 L;  1QVG A;  3GD7 A;  1J6Q A;  3EA6 A;  4BY7 H;  2NZ1 D;  4A3C G;  3S1N B;  3D0F A;  4DGZ A;  4MN3 A;  2RA4 A;  3GTP H;  5COY A;  1Y1W H;  1BVS A;  4L6T B;  4BXX G;  2Y0S G;  4C3I G;  1JT8 A;  5KNC A;  2I5L X;  2PI2 A;  4A3I H;  1WCM B;  3LWE A;  1J9O A;  3CC4 A;  2VUM G;  2B2T A;  2DJG C;  2Z8L A;  4CJ0 B;  2EE1 A;  2AMC B;  1PHJ A;  2JEB I;  4DV5 Q;  1HPC A;  3S1N H;  2F0J A;  3CMA A;  1E24 A;  1ASZ A;  1WTX A;  1FJG L;  3SXH A;  1Y1W B;  2PW5 A;  4YY3 L;  5C4X B;  3OSO A;  1MD2 D;  2F4V L;  4L5T A;  3PUW A;  4MTN A;  1EIY B;  1EUJ A;  3E9H A;  4H13 C;  4LF5 L;  4A3E B;  1UWV A;  1JR0 D;  1WCM H;  3KLS A;  3CF5 A;  4QL5 A;  1BKB A;  2F03 A;  3P1H A;  1B8A A;  1IBM L;  2D9U A;  4HJA A;  4A3L H;  1DGS A;  2ZJR A;  4TSS A;  3P75 A;  3BYY B;  1LTT D;  2R92 B;  4GOP A;  1FJG Q;  3F2C A;  2IPK D;  1VQO A;  5C4X H;  4ZLT F;  1AE3 A;  1U4P A;  1MJC A;  3R93 A;  2KHS A;  3N6R A;  3TEH B;  4DK1 A;  5KND A;  4DV5 L;  3EIV A;  4A3E H;  1Q82 C;  1OXX K;  1VQK A;  2A6H D;  2QDB A;  2KCT A;  2J0T D;  4XQN A;  4JBK A;  3MXP A;  3EBE A;  1UEB A;  4OWX B;  3F2B A;  3NWT A;  3FRP B;  1HNW Q;  3RLN A;  1A3T A;  4CDD C;  4DV4 Q;  4LFC L;  3HOX H;  5LMN Q;  2FIN B;  3NXW A;  5A2Q E;  3K7A B;  2EJM A;  3OW7 A;  3X3M A;  4CDF C;  2MGS A;  4JBJ A;  4GOP B;  1E2Z A;  3M4Y A;  3I7F A;  4MNO A;  4ZKB B;  2JA9 A;  1O7Y A;  1I5F A;  5C3X A;  4KV6 A;  2WV6 D;  1YBY A;  4U67 3;  1JOK A;  4WJW A;  3CME A;  1DOK A;  1I4Q A;  3PUV A;  1XMO L;  3S1Q B;  4DR7 L;  1OXV A;  3NE5 B;  5CV5 A;  4RGT A;  5M5X B;  2K33 A;  3SK8 A;  5GQO A;  3NHH A;  4FDB A;  4A3B H;  3NEN A;  2HDM A;  2JK8 A;  4MTK A;  1IL2 A;  4L5Q A;  1HNZ Q;  1PH8 A;  1V1P B;  2UXD L;  3HOX B;  3I2Z A;  2FHT A;  1B3Q A;  3MWY W;  1QWY A;  1VQE A;  1XNR L;  1VQF A;  2F3I A;  1VQG A;  5C0X G;  2FJ2 A;  3CCL A;  4DR1 L;  1KNA A;  1GO3 E;  4JI1 L;  5M3F H;  4N9P A;  4G4K A;  2F0F A;  4M8A A;  3S1Q H;  1LUZ A;  1JB3 A;  2UUB L;  4GKK Q;  2SEB D;  5IP7 H;  5CV6 A;  2F0P A;  3CU7 A;  2SNS A;  5CYU A;  5EPK A;  4DNI A;  5M5X H;  3S16 B;  1PLF A;  4X3T A;  3TP8 A;  4A3B B;  3S15 H;  4IQZ A;  1GUS A;  2PYK A;  3UI2 A;  3CCM A;  1Z7T A;  4HTH A;  1SYG A;  4KN4 C;  3S1M B;  5M5Y H;  1ASY A;  3SK4 A;  1BF4 A;  1ZYR D;  3MEF A;  3SGI A;  1A6X A;  4ZAI A;  1PYS B;  4LUO A;  3BDO A;  2IW3 A;  3TBI B;  1ZYR C;  4HMJ A;  2Q8T A;  2ZTE A;  5M3F B;  2XVS A;  3PF4 A;  2ES2 A;  3I91 A;  1XPO A;  1P8L A;  4PQX A;  5CR3 A;  5C0X H;  1LT6 D;  1SJH D;  3S16 H;  1SJE D;  4DU9 A;  4EQP A;  3ULP A;  1YNN D;  5E1F A;  4DR1 Q;  4X62 L;  4IUQ A;  1PH1 A;  4PMC A;  5AJ3 L;  1XPU A;  2N49 A;  3P7J A;  4ABN A;  3G6J B;  1B1Z A;  1D5Z C;  1F9S A;  4A3D G;  1BO0 A;  1MKH A;  2F0T A;  2KEC A;  3OYY A;  4GNX A;  1DOM A;  1ILQ A;  1JWM D;  3UDX A;  1Q7Y C;  4KY5 A;  1HFN A;  4C2M B;  1X32 A;  3FPP A;  1TXY A;  5AFW A;  3FPU B;  3D4W A;  2LXK A;  1JE4 A;  2Q2T A;  1Z6H A;  3GTO H;  1NMF A;  2H4O A;  3S17 H;  3KFU A;  4XQJ A;  5E4W C;  1XXG A;  2R7F A;  4JG2 A;  3HEJ A;  4JW0 A;  5FLM H;  1YJN A;  4OX9 Q;  3EFX D;  3BG3 A;  4A3C H;  1FVI A;  1K3R A;  5IT9 L;  1R9T B;  5GAG C;  1KC8 C;  1LTB D;  2B63 G;  3H91 A;  3IL8 A;  3GTQ B;  4DAV A;  3B6Y A;  1A3V A;  3A56 A;  4C2M H;  4Q0F A;  2B8G A;  5IYD G;  3KLS X;  3G7L A;  1O7Z A;  4PV1 C;  3GTM H;  3E6Z X;  2R7D A;  1JE5 A;  4RWS C;  1XTD A;  3I4O A;  1BCP F;  1LAB A;  1H95 A;  3S17 B;  4BBS G;  4DKA C;  4A3M B;  3KLR A;  1HH2 P;  1CM9 A;  3FMC A;  3ONA B;  2HDL A;  4IPD A;  1K73 C;  3STB C;  1S40 A;  2C5C A;  2L5T A;  2B2Y C;  5JVG 3;  1HNW L;  3OWF A;  2LXJ A;  3HOV G;  2F0V A;  1L0Y B;  5IGC A;  2Z4H A;  2HUG A;  2XN9 C;  1MJE A;  4LW1 A;  2CQA A;  4IJL A;  2B29 A;  2D2C C;  2R7Z B;  2FXQ A;  2F0D A;  4AYB B;  3G6E A;  4JVZ A;  3T53 B;  1AZP A;  5EAY A;  5EBC A;  3I70 A;  1K0R A;  4A3M H;  4NW2 A;  2VQF L;  2LKV A;  2XRS D;  4A3J G;  3WWV A;  4P71 A;  1QVF A;  2F0H A;  1TS4 A;  3QO2 A;  3I4N G;  1HZA A;  1TWG B;  1KD1 C;  1CA6 A;  3HKZ G;  4DR3 L;  3NTI A;  3BDC A;  1TWA B;  1PH4 A;  3AQQ A;  1X3Q A;  4DAY A;  2ZJQ A;  2JA6 H;  1AFP A;  4H0L C;  2K01 A;  4YY3 Q;  1C7Y A;  4KKS A;  3RLO A;  5JAV A;  4NMZ A;  1SE4 A;  3UDG A;  4DUY Q;  3GTL H;  3J7Z C;  4JI4 Q;  4JCV E;  3KUP A;  5IOC A;  4CJ1 B;  1X3F A;  2A73 B;  1TWH H;  4RFB A;  4AYB E;  4DK6 C;  2O5J C;  3CC2 A;  2Q8R E;  1SN8 A;  5BN4 A;  1E2V A;  1MSG A;  2R92 G;  2K14 A;  1JCK B;  1Q46 A;  2OQ0 A;  1PYW D;  1S5B D;  4IFD G;  5ELE A;  2V4D A;  1X65 A;  2EJG C;  3KBG A;  5J22 A;  3OIP A;  1I4P A;  4X6A H;  5NUC A;  4KK7 A;  2NVQ H;  2WKD A;  4IFD J;  4EX5 A;  1NR2 A;  2JA6 B;  2A6E C;  1SE2 A;  2DNC A;  3AEV A;  2RSO A;  4IPC A;  3KJO A;  2LY7 A;  4X66 Q;  2N8N A;  4A3L G;  1KXL A;  4IJH A;  4O1N A;  1S5D D;  4HJ7 A;  2TMP A;  4GLV B;  3AB9 A;  2ZTC A;  4F88 A;  5IGF A;  2VS1 A;  1CTM A;  4GKK L;  2UUB Q;  3J81 c;  4G7Z C;  5K36 H;  5IYD H;  5EPJ A;  1N32 L;  5IWA Q;  1WJJ A;  2NVQ B;  1EWC A;  1KLG D;  1I94 Q;  1TS5 A;  5KYI A;  5ELC A;  4BS9 A;  3GTG B;  3OPO A;  2ZM6 Q;  4ID6 A;  5JEA H;  2F0L A;  1IBL L;  3K5N A;  4LF6 Q;  2CH4 A;  2NWG A;  2K5N A;  3HOW B;  2UXB L;  2SNM A;  2EYL A;  1L1O A;  5G3L F;  4RH6 A;  2R3Z A;  3OHX C;  4PZ6 A;  1K28 A;  4N8F A;  3ND9 A;  3W1G A;  1GUW A;  5DM6 3;  1XNQ L;  1I4R A;  1UE6 A;  3LNN A;  1KL9 A;  4NPS A;  5I2X A;  1OTC A;  4UP7 A;  4RGM A;  3U58 A;  3PUZ A;  4A3M G;  1EY8 A;  1QCB D;  3FKI G;  3HKZ E;  1FGU A;  1O7I A;  1OXS C;  1HR0 L;  3MAQ A;  2L55 A;  3AMU A;  2PZU A;  5FLX E;  3CD6 A;  2I5M X;  4C3J G;  2ZJP A;  3FKI B;  4UPA A;  3S1R B;  1L1O C;  1V1O A;  2F0O A;  4RA8 A;  1LTL A;  2PQA A;  4IUR A;  1HFG A;  1PZK D;  1Q81 C;  3H3V H;  4C3J B;  4A3D H;  3CPF A;  1WYD A;  3QWN A;  3K6O A;  2R7Z G;  1VQA A;  2A6E D;  5HUR A;  2WAQ B;  1EQV A;  1CZG A;  1V1P A;  4K2L A;  2JA7 H;  1XNQ Q;  3GTK B;  2EYF A;  2ZXP A;  4KY6 A;  3T1H Q;  1WCM G;  3C3L A;  1XMQ Q;  3A0J A;  1JOQ A;  3PV0 A;  3VA5 A;  4DV7 Q;  3JAM c;  2H5X A;  1EEI D;  3QB3 A;  3MVV A;  1FNV A;  1LTS D;  2CWP A;  2GA4 B;  3FKI H;  1PA6 A;  3S1R H;  4YCV A;  4IFD H;  1EY0 A;  1GD7 A;  4C3J H;  3M4O H;  3J81 E;  4A3D B;  1X6O A;  4YHH L;  2A1A A;  1EQQ A;  3HOY G;  1CKO A;  1X56 A;  3DEP A;  1AH9 A;  1IYU A;  1DM0 B;  3M4Q A;  1I94 L;  5ELD A;  2VZA A;  5IT9 c;  1N33 Q;  4C56 C;  4QUF A;  4DA2 A;  4J15 A;  3EJI A;  1GUO A;  2ZXR A;  2L1B A;  2IX3 A;  2KCN A;  3IAY A;  1Y8N B;  1XX8 A;  4ZQ3 A;  3BDL A;  3DUZ A;  4AQY L;  1VQ9 A;  1STE A;  2B2V C;  2KJX A;  4LUV A;  4FXG C;  4C3H H;  1ICW A;  4K0K L;  3JAM L;  1IBK Q;  5M3M G;  1MIU A;  1DCZ A;  1XPR A;  4UDU C;  3OMC A;  1GUT A;  1W6K A;  4J6H A;  1WD0 A;  1Q90 A;  3E9I A;  2YU9 B;  1G91 A;  2K03 A;  1EY4 A;  2ZXO A;  1N36 Q;  2UXC L;  4IUU A;  5JJL A;  4OWW B;  4WFN 3;  1HA6 A;  4DAY B;  1RTN A;  4DR4 L;  2I07 B;  4K0K Q;  1EY5 A;  1KRT A;  3U4Z A;  3Q0A A;  3BZK A;  3NWS A;  1Y14 B;  2HIV A;  4A93 G;  5JVH 3;  4JV5 L;  1QZH A;  5DNF A;  3FEW X;  5KIX A;  3DWQ A;  4LFA Q;  4B3S Q;  4PMW A;  4CBV A;  3TN2 A;  4DV4 L;  4XDX A;  3RN2 A;  3SDZ A;  2AUK A;  1I6H H;  3F8T A;  3SVM A;  4A76 A;  3KYH C;  2F0I A;  4XQQ A;  1GOZ A;  4ZYS A;  4YHH Q;  1LTG D;  1TS2 A;  4KHZ A;  2NTT A;  4DV3 L;  5D65 A;  2YTV A;  4LMQ D;  1V43 A;  1SRU A;  2NN6 I;  3NQI A;  4IPG A;  1SYB A;  4NXN L;  5BR8 L;  1JJ2 A;  3ULJ A;  1SSO A;  2RCN A;  3UE0 A;  3S2H B;  2K5H A;  4QMG A;  3NTK A;  2JA5 G;  3MXN B;  3MTS A;  4A3J B;  2Q8I B;  4FO2 A;  5FLX L;  4DXF A;  5M9O A;  2JA5 B;  3TS2 A;  5C5L A;  2NVX H;  1QIL A;  4IOC A;  1IXR A;  4BXX H;  2NZO A;  4DFA A;  4LF5 Q;  1VQI A;  1B44 D;  4HID A;  1JMC A;  3OW2 A;  4YCU A;  1B50 A;  5C3E G;  3GTJ H;  2NN6 G;  3S2H H;  1U0L A;  3OOC A;  1YNJ C;  1GUN A;  3NP8 A;  1K0S A;  4CGY B;  2E5L L;  4RGN A;  4FXD A;  5C3E B;  4KHV A;  2PZW A;  3DM1 A;  3HOV B;  4B9X A;  1RF2 D;  1LTR D;  2DY7 A;  1HNX L;  3KDF B;  1U4L A;  4TVA B;  1X54 A;  1VQL A;  1Q86 C;  4DAM A;  1II3 A;  2Y0S B;  4C3I B;  1I4G A;  4N9T A;  4TQU S;  5HY6 A;  5JPM C;  4CHT B;  1F9R A;  3CHB D;  1K9M C;  2UU9 Q;  4K6D A;  4C3H G;  3GTJ B;  1HZC A;  3CAM A;  1WOC A;  1U4R A;  1H9S A;  4HAE A;  2B39 A;  2JXM B;  4B3M L;  1UUP A;  3HOY B;  1SNQ A;  2K05 A;  3BVG A;  4GN4 B;  5C3E H;  1QOH A;  2BDN A;  1VMP A;  4OO1 G;  4DPG A;  3ZJY C;  2ALY B;  4JBM A;  3FVQ A;  3U50 C;  1KAA A;  3D31 A;  4K14 A;  5IYB H;  4DR6 Q;  2N88 A;  4YWL A;  4JI3 L;  1IL8 A;  1FNU A;  4ZUJ A; 
#chains in the Genus database with same CATH homology
 2WKC A;  1ESR A;  1NR4 A;  1PFM A;  3ITP A;  1WVL A;  2L0C A;  2MPM A;  2OT2 A;  4HMI A;  1C8C A;  2IX0 A;  3RZO B;  5C4J B;  1CHQ D;  4BWG B;  4HED A;  1HQR D;  1KDB A;  1AEX A;  4OO1 I;  3A7A B;  4NP5 A;  2HCI A;  2L12 A;  1LTA D;  1FD7 D;  4IUT A;  1BOS A;  2WIN B;  3W3A A;  1F2L A;  3U9S A;  1F2Z A;  5E3F A;  4MIU A;  1G8Z D;  1RCV D;  3R8B A;  2EPB A;  2L11 A;  2L9H A;  2PW7 A;  1S4Z A;  2IL8 A;  1Q3L A;  1BNZ A;  1L0X B;  1LT5 D;  2O2L D;  5EKK A;  2EY2 A;  3OWE B;  1HTP A;  4RHR A;  4I7Z C;  3T51 B;  3KF8 A;  4I65 A;  3A8K E;  3VYR A;  4RKB A;  2NBF A;  3VYU A;  1IKL A;  1AN8 A;  1VF5 C;  2SOB A;  4HN7 A;  4M1U B;  4Z9C B;  1DJR D;  4FF3 A;  2K5Q A;  4FF4 A;  3H6M A;  4XT3 B;  5F2D A;  3Q23 A;  1KNE A;  2KVM A;  1STG A;  1BXT A;  5EKL A;  1SAP A;  4X3S A;  1G29 1;  3HZX A;  1HA5 A;  1JOR A;  3KK7 A;  3CQZ B;  3F2U A;  4IUN A;  2NB0 A;  5KYL A;  1Y1V B;  2EY6 A;  5TSS A;  1H9J A;  1SYD A;  4B08 A;  2NVT B;  5KRU A;  3FDT A;  1TWF B;  4NKL A;  2LMC B;  4A93 B;  3GO5 A;  3I8Z A;  1D1I A;  1PZI D;  2BA0 A;  2DN8 A;  3MFG A;  4CJ2 C;  3S14 B;  4LJZ C;  2JE6 I;  1TVX A;  2WII B;  1HCZ A;  1MSH A;  5D3D A;  4EVO A;  1KTK A;  3HKZ B;  2B2T C;  3S9W A;  1VCI A;  3HG9 A;  4G7O C;  1SNO A;  5JJZ A;  1SFO B;  2RVL A;  3Q22 A;  1M4V A;  5IOD A;  2B2Y A;  1EOT A;  4OIJ A;  1BCP D;  5C44 B;  3SK5 A;  2BCO A;  4F87 A;  4KN7 C;  2B63 B;  1ZXT A;  4ULL A;  1IKM A;  3NTH A;  1EZ6 A;  1OXU A;  3ND8 A;  1C48 A;  1SEB D;  4L63 B;  3DWA A;  5HGT A;  5EJW A;  1LV9 A;  1PTO F;  3MXG A;  2OXP A;  4TKO B;  4WOR A;  3VYS A;  1DYQ A;  1SE3 A;  5I2Y A;  3MHB A;  1SDF A;  1SMY C;  1BQQ T;  1K83 B;  3IFD A;  1F2M A;  3I4M B;  2D5D A;  4MHE A;  3S15 B;  1LLR D;  1RHP A;  4KY7 A;  1W6J A;  5M5Y B;  1TY0 A;  3V96 A;  4E6I A;  5DM7 3;  3S2D B;  3ZYY X;  4RCO A;  1PZJ D;  3C2P A;  1DOL A;  1HQM C;  2NYZ D;  4DAP A;  1FYC A;  4K5V A;  4K5X A;  1WD1 A;  2G9H D;  2F1M A;  3LWU A;  2R93 B;  3J80 L;  1SNC A;  4OIK A;  1KDA A;  4ZK9 B;  2F0N A;  1CA5 A;  2MP1 A;  1T5E A;  3A7L A;  3DMU A;  4KD4 A;  5A2Q L;  1U9R A;  1V8Q A;  1ENF A;  2VNU D;  1LO5 D;  3IKJ A;  1ENC A;  3GTO B;  2O4X A;  2F0G A;  2F0U A;  3HP3 A;  5JEA G;  1RKN A;  1B9M A;  1EFI D;  4CKE A;  1HHV A;  3R3O A;  1UEA B;  2EYH A;  5IGD A;  4IUV A;  5I9O A;  2E2J B;  1O78 A;  2PCF B;  3CKI B;  3GP7 A;  5CV8 A;  1EEF D;  1TII D;  4V0B A;  5I9P A;  5ELB A;  3GTM B;  1TY2 A;  3SHL A;  3K5O A;  5LHY 1;  3L7Z C;  1PTO C;  1QG7 A;  5BN5 A;  1T5X D;  2EVB A;  2KUM A;  4CKB A;  2JYO A;  4Y7N B;  5C4H A;  1EU3 A;  4KD3 A;  1A2T A;  2WP8 J;  1Q1E A;  2XIW A;  2EJF C;  4G7H C;  3HGB A;  2KA7 A;  3V2T A;  2CHB D;  3D4D A;  1X3P A;  3SE0 A;  3RLF A;  5JOB A;  2VXW A;  1CFM A;  4A3K B;  4XIG S;  5KNB A;  4BBS B;  1EYA A;  1PRT F;  2MHV A;  3I90 A;  4LK1 C;  2L4N A;  4QIW B;  3KBX A;  2VUM B;  2AWO A;  1F2Y A;  2IX1 A;  2SDF A;  3WOF A;  1EIH A;  4KKU A;  1AW7 A;  4V19 0;  2AWN A;  3T56 B;  1H9M A;  3OMG A;  3BS1 A;  4TRD A;  1F9Q A;  3J80 E;  1MBY A;  3DHQ A;  5EBD A;  5EQ0 A;  1ZKO A;  1RD9 D;  4L8J A;  5JPN C;  5KGU A;  4RKL A;  1QE6 A;  4NDX A;  3TP5 A;  1Y8P B;  4A3I B;  4PNY A;  2F4I A;  1U4M A;  5KEE A;  3VR4 A;  3PIP 3;  1H9S B;  5T1I A;  4IUP A;  3P20 A;  1ET9 A;  4R8I A;  5COR A;  3K0Y A;  3E0J A;  5ISR A;  4QCL A;  1STA A;  2PPB C;  2KQ3 A;  1D1K A;  2K32 A;  3GV6 A;  1SYF A;  4RHS A;  5C6A A;  1WTR A;  5CC4 A;  4KI0 A;  4F8M A;  2XWJ B;  2B2W A;  5C0X I;  2K7V A;  3MFY A;  5I6W A;  1I3Q B;  2RSN A;  1FGB D;  2FMC A;  1JIC A;  1XWE A;  1YNN C;  1E2W A;  3NPP A;  1EQT A;  1FNW A;  2WAC A;  2A6H C;  1J8I A;  1IW7 C;  3VYT A;  3TP6 A;  2K28 A;  1AZQ A;  2EYJ A;  1QNU A;  5FK9 C;  2M00 A;  2E2D C;  3LX0 A;  5EPL A;  2H1E A;  4C1N K;  2JA7 B;  4KTA A;  1B2T A;  1G2S A;  4DNR B;  2AQ1 B;  2Z1C A;  4A3F B;  4DNT B;  1BUV T;  3TZU A;  3H3V C;  1XTC D;  4H44 C;  2QIL A;  1FR3 A;  1Y8O B;  4ME5 A;  5IT9 E;  1A3U A;  1NUC A;  2F0W A;  2RQX A;  2CW0 C;  1A15 A;  2B2U A;  3X3N A;  2BE5 C;  1EIG A;  3GQB A;  1D2B A;  4K6L A;  1LT3 D;  1QJO A;  1DON A;  4KJO A;  3I72 A;  3GV3 A;  4DF7 A;  1IW7 D;  2MJ8 A;  3VR3 A;  3U9O A;  1PTO D;  3QOJ A;  4C3H B;  1CQF A;  2RDH A;  1SBB B;  1Q12 A;  5K5P A;  3BZD B;  1EWH A;  3I73 A;  2XSC A;  2JEA I;  2E74 C;  3TSS A;  1KDC A;  1C4Q A;  1YNJ D;  1ROD A;  3D6C A;  4HR7 B;  5FO9 B;  4G57 A;  2EOT A;  3MXN A;  2RKS A;  5CV4 A;  4IN3 A;  4R9W A;  3QG1 A;  3R2T A;  3L9A X;  3C1F A;  1NSN S;  3H94 A;  3MXU A;  4ZKC B;  1S5C D;  3J7A V;  4BBR B;  2EY5 A;  1K8O A;  1KAB A;  3E5S A;  4RCN A;  4R8N A;  2LFN A;  3R2I A;  5CV7 A;  1Y69 U;  3I4L A;  5CMD A;  4BA2 I;  1STB A;  2EYP A;  2VB3 X;  1D5M C;  4XYO A;  1TS3 A;  1UNS A;  1B4O A;  1LTI D;  1G2T A;  4K2K A;  1CQV A;  2FMM A;  3OIQ A;  4FVM A;  1K8M A;  4HCE A;  3J7Y W;  1TWC B;  1CHP D;  4YIJ A;  3C46 A;  2EXZ A;  2BA1 A;  3DWP A;  4XYQ A;  2PMZ B;  1O80 A;  1OXT A;  4OHJ A;  2F0M A;  4KMU C;  2HQE A;  1EU4 A;  1VMC A;  2ZT9 C;  3MC0 B;  3TZD A;  2NVX B;  4OL7 A;  2FFK B;  5I6Y A;  1PRT D;  1Z47 A;  3URY A;  3J81 L;  4IFD I;  5E4X A;  3M7G A;  1SNP A;  2IJ0 A;  4ZRZ A;  1PXU A;  4FNF A;  1NAP A;  1LT4 D;  4HSP A;  4HSV A;  3NQT A;  1PTO B;  1PRT B;  2NN6 H;  3SR1 A;  3V05 A;  2F0Q A;  4GZY C;  2F0S A;  4XXE A;  3D4R A;  2EYO A;  1STN A;  2IWH A;  2G9D A;  2F3W A;  2EZV A;  3RZD B;  1EY7 A;  1F77 A;  3D3R A;  3I3C A;  1GXD C;  1UAP A;  2ID0 A;  2AQ2 B;  1PTO H;  2A69 D;  3VR5 A;  3BYT B;  3TP7 A;  1BBX C;  2NUC A;  2X6L A;  1STY A;  4K8I A;  2Z4I A;  2KOL A;  3TDQ A;  1EYC A;  2JA8 B;  2PZT A;  5J39 A;  2X6G A;  1LAC A;  2ENB A;  4EGV A;  1ILP A;  3GTL B;  1B9N A;  2WB1 B;  3NBI A;  3T13 A;  1TWH B;  5DAU A;  3RD4 A;  1CK1 A;  1GHK A;  5C4Z A;  3M3Y B;  2K5W A;  2K5D A;  1TQO A;  3QJY A;  1QB5 D;  3H0G B;  3NUC A;  5CV9 A;  1DD2 A;  4B9W A;  2E2I B;  2B2U C;  1O7L A;  5FO7 B;  1HRJ A;  2E76 C;  3DEO A;  3ERQ A;  5CGK A;  2AUJ D;  1S5E D;  4BY1 B;  1GJX A;  3EVQ A;  2C9O A;  4KJN A;  1HUN A;  1PDQ A;  2PQE A;  3N52 A;  3M85 A;  1JOO A;  1CI3 M;  1Q1B A;  1TKW B;  3IFT A;  3PUX A;  4X3U A;  5CBA E;  1HTL D;  2EDG A;  2PO4 A;  3JAM E;  3CRL C;  2O5I C;  1ET6 A;  4Q5V A;  2JSO A;  2BDO A;  1RTO A;  1QNK A;  3H09 A;  3PMF A;  1ONL A;  3D6W A;  4JBW A;  1JQY D;  4A3G B;  2KCC A;  4DK0 A;  4CKC A;  3BVZ A;  1Q8I A;  4WRD A;  4U68 A;  1BCP C;  1MGS A;  2K04 A;  2NVY B;  1D5X C;  1CZW A;  5IGG A;  5A35 A;  1DXM A;  2B2W C;  2OF1 A;  2CVR A;  2BE5 D;  2KEE A;  1I4H A;  3SEB A;  4ILW A;  1R4Q B;  4KKT A;  1B3A A;  1PFN A;  5IGE A;  2JP1 A;  2LS0 1;  4K5W A;  3K58 A;  4FYD A;  2XRQ D;  3QOL A;  1WTQ A;  2B8F A;  2QF7 A;  3HRZ C;  3PUY A;  1I4X A;  2KED A;  1SYE A;  2EY1 A;  4S3S A;  2XWB B;  1PRT C;  4EQN A;  5FO8 B;  4FF1 A;  5D3I B;  1ML0 D;  4IZ8 A;  1CT1 D;  3NSW A;  1HXY D;  3O13 A;  4QF4 A;  4C1N I;  3M4O B;  1SXT A;  2R61 A;  4FXK C;  2EYM A;  1PFB A;  3J7A F;  3ERO A;  2D62 A;  3RMH A;  1ESF A;  1ZEQ X;  1JC7 A;  2F0K A;  1SYC A;  2NTS A;  4JK1 C;  5IGB A;  2DY8 A;  4EQO A;  1H9K A;  2B2V A;  2HCC A;  4H7B A;  1JWS D;  1RJT A;  1BCP B;  3NK9 A;  4BA1 I;  3PO3 B;  1PMR A;  3A8J E;  1VF7 A;  5D14 A;  5I4D A;  2A74 C;  3A8I E;  1ENA A;  4DXG A;  3SK6 A;  4PMB A;  3WOE A;  2E75 C;  1I6H B;  2M2L A;  1EY6 A;  1JWU D;  3DXJ C;  1H9R A;  1EZ8 A;  1EYD A;  3A54 A;  2AQ3 B;  1WTO A;  3WDN A;  1HUM A;  3VA7 A;  1TT2 A;  3M7N A;  4IAL A;  2RDG A;  2TSS A;  4J8Q A;  5C0X J;  3K5L A;  3MZ5 A;  3QIA A;  2E2H B;  2QCP X;  1E0B A;  3TME A;  4QB4 A;  2ICI A;  5EGT A;  4XTC S;  1NCV A;  2YYZ A;  4FF2 A;  2PNR C;  5ELF A;  3HOZ B;  3K5M A;  3PO2 B;  4ZUI A;  4LAA A;  1S5F D;  4RGO S;  5J1Z A;  5CBE E;  1AP0 A;  2VB2 X;  2DNE A;  2BOS A;  2F0E A;  1B53 A;  3MA2 B;  1A2U A;  5T1G A;  2MUY A;  2QKI C;  4DN4 M;  4FP5 D;  1DZ1 A;  1I6V C;  2A69 C;  2A68 C;  1WTW A;  4J1M A;  5C5M A;  5LL6 X;  3BVM A;  1EY9 A;  4UAI A;  1XYI A;  3VR6 A;  3VR2 A;  2I46 A;  4OGQ C;  1GHJ A;  4K8J A;  3MEH A;  4OO1 H;  1SND A;  5BN3 A;  5M3M B;  4RAU C;  3Q24 A;  1I50 B;  5JEA J;  2OEO A;  3NBH A;  5DEH A;  1BDO A;  3A55 A;  3CRK C;  1D6E C;  5EKI A;  4ODG A;  4XT1 B;  1RDP D;  3EQL C;  5FKA C;  1WTP A;  3HOU B;  1SMY D;  4F7X A;  2K1B A;  4P2C B;  5IIF A;  3K57 A;  2K6A A;  1SNM A;  2QEJ C;  1TU2 B;  1GUG A;  1IHZ A;  3Q6S A;  3D8G A;  4QUC A;  1KLU D;  5M5W B;  2J7Z A;  1STH A;  1IYV A;  1VDZ A;  2A68 D;  2N55 A;  2M9V A;  2RBM A;  2X69 A;  2A5H A;  3L3O C;  3T4A C;  2F3V A;  3W2D A;  3T16 A;  4O42 A;  3PIO 3;  2RDF A;  1G6Z A;  1R4P B;  3AU7 A;  3C1E A;  1WTV A;  1F9P A;  1MI2 A;  1OO9 B;  2J4X A;  4BY7 B;  4X3K A;  1BR9 A;  2R6G A;  2XNA C;  1EL0 A;  1TR5 A;  3GTP B;  5K36 G;  5G3L D;  3I4N B;  2CW0 D;  3RUZ A;  4HCS A;  1M8A A;  3HS0 C;  5LL6 S;  5FOB B;  2IT1 A;  5C3W A;  2ICE C;  3K59 A;  3GD7 A;  3EA6 A;  2NZ1 D;  3S1N B;  4DGZ A;  4MN3 A;  2RA4 A;  5COY A;  4L6T B;  4C3I G;  5KNC A;  1WCM B;  3LWE A;  1J9O A;  2B2T A;  2Z8L A;  4CJ0 B;  2EE1 A;  2JEB I;  1HPC A;  2F0J A;  1WTX A;  3SXH A;  1Y1W B;  2PW5 A;  5C4X B;  3OSO A;  1MD2 D;  3PUW A;  4H13 C;  4A3E B;  1JR0 D;  3KLS A;  2F03 A;  3P1H A;  2D9U A;  4TSS A;  3P75 A;  3BYY B;  1LTT D;  2R92 B;  2IPK D;  4ZLT F;  1U4P A;  3R93 A;  2KHS A;  3N6R A;  4DK1 A;  5KND A;  1OXX K;  2A6H D;  2QDB A;  2J0T D;  4XQN A;  3MXP A;  3NWT A;  3FRP B;  1A3T A;  2FIN B;  3NXW A;  5A2Q E;  3K7A B;  2EJM A;  3OW7 A;  3X3M A;  2MGS A;  1E2Z A;  3M4Y A;  4ZKB B;  1O7Y A;  5C3X A;  4KV6 A;  2WV6 D;  4U67 3;  1JOK A;  4WJW A;  3S1Q B;  1DOK A;  1I4Q A;  3PUV A;  1OXV A;  3NE5 B;  5CV5 A;  4RGT A;  5M5X B;  2K33 A;  3SK8 A;  3NHH A;  2HDM A;  1V1P B;  3HOX B;  2FHT A;  3MWY W;  1QWY A;  5C0X G;  2FJ2 A;  1KNA A;  4N9P A;  4G4K A;  2F0F A;  4M8A A;  1JB3 A;  2SEB D;  5CV6 A;  2F0P A;  3CU7 A;  2SNS A;  5CYU A;  5EPK A;  3S16 B;  4A3B B;  1PLF A;  4X3T A;  3TP8 A;  4IQZ A;  1GUS A;  2PYK A;  3UI2 A;  1Z7T A;  4HTH A;  1SYG A;  4KN4 C;  3S1M B;  3SK4 A;  1BF4 A;  1ZYR D;  1A6X A;  4ZAI A;  3BDO A;  2IW3 A;  3TBI B;  1ZYR C;  4HMJ A;  2Q8T A;  5M3F B;  2XVS A;  3I91 A;  4PQX A;  5CR3 A;  5C0X H;  1LT6 D;  1SJH D;  1SJE D;  4DU9 A;  4EQP A;  1YNN D;  5E1F A;  4IUQ A;  4PMC A;  3P7J A;  4ABN A;  3G6J B;  1B1Z A;  1D5Z C;  1F9S A;  1BO0 A;  2F0T A;  2KEC A;  1DOM A;  1ILQ A;  1JWM D;  4KY5 A;  1HFN A;  4C2M B;  1X32 A;  3FPP A;  5AFW A;  3FPU B;  3D4W A;  1JE4 A;  1Z6H A;  2H4O A;  4XQJ A;  5E4W C;  1XXG A;  3HEJ A;  3EFX D;  3BG3 A;  5IT9 L;  1R9T B;  1LTB D;  3H91 A;  3IL8 A;  3GTQ B;  4DAV A;  1A3V A;  3A56 A;  4Q0F A;  2B8G A;  3KLS X;  3G7L A;  1O7Z A;  4PV1 C;  3E6Z X;  4RWS C;  1BCP F;  1LAB A;  3S17 B;  4A3M B;  3KLR A;  1CM9 A;  3FMC A;  3ONA B;  2HDL A;  2C5C A;  2L5T A;  2B2Y C;  5JVG 3;  3OWF A;  2F0V A;  1L0Y B;  5IGC A;  2Z4H A;  2HUG A;  2XN9 C;  2CQA A;  2D2C C;  2R7Z B;  2F0D A;  4AYB B;  3T53 B;  1AZP A;  5EBC A;  3I70 A;  4NW2 A;  2LKV A;  2XRS D;  2F0H A;  1TS4 A;  3QO2 A;  1TWG B;  1CA6 A;  3NTI A;  3BDC A;  1TWA B;  1X3Q A;  4DAY A;  1AFP A;  4H0L C;  2K01 A;  4KKS A;  5JAV A;  4NMZ A;  1SE4 A;  3KUP A;  5IOC A;  4CJ1 B;  2A73 B;  2O5J C;  4RFB A;  2Q8R E;  5BN4 A;  1E2V A;  1MSG A;  1JCK B;  1PYW D;  1S5B D;  4IFD G;  5ELE A;  2V4D A;  2EJG C;  3KBG A;  5J22 A;  3OIP A;  1I4P A;  5NUC A;  4KK7 A;  2WKD A;  4IFD J;  1NR2 A;  2JA6 B;  2A6E C;  1SE2 A;  2DNC A;  2RSO A;  2LY7 A;  4O1N A;  1S5D D;  2TMP A;  3AB9 A;  4F88 A;  5IGF A;  1CTM A;  4G7Z C;  5K36 H;  5EPJ A;  2NVQ B;  1EWC A;  1KLG D;  1TS5 A;  5KYI A;  5ELC A;  4BS9 A;  3GTG B;  3OPO A;  4ID6 A;  5JEA H;  2F0L A;  3K5N A;  2NWG A;  3HOW B;  2SNM A;  2EYL A;  5G3L F;  4RH6 A;  2R3Z A;  3OHX C;  3ND9 A;  1GUW A;  5DM6 3;  1I4R A;  3LNN A;  5I2X A;  4RGM A;  3PUZ A;  1EY8 A;  1QCB D;  1OXS C;  3MAQ A;  2L55 A;  3AMU A;  2PZU A;  5FLX E;  4C3J G;  3FKI B;  3S1R B;  1V1O A;  2F0O A;  4RA8 A;  4IUR A;  1HFG A;  1PZK D;  4C3J B;  3QWN A;  3K6O A;  2A6E D;  5HUR A;  2WAQ B;  1EQV A;  1V1P A;  1CZG A;  4K2L A;  3GTK B;  2EYF A;  2ZXP A;  4KY6 A;  3C3L A;  1JOQ A;  3PV0 A;  3VA5 A;  1EEI D;  3QB3 A;  3MVV A;  1FNV A;  1LTS D;  2GA4 B;  4IFD H;  1EY0 A;  3J81 E;  4A3D B;  3DEP A;  1IYU A;  1DM0 B;  5ELD A;  4C56 C;  4QUF A;  4DA2 A;  3EJI A;  1GUO A;  2ZXR A;  2L1B A;  2IX3 A;  2KCN A;  3IAY A;  1Y8N B;  1XX8 A;  4ZQ3 A;  3BDL A;  3DUZ A;  1STE A;  2B2V C;  2KJX A;  4FXG C;  1ICW A;  3JAM L;  1DCZ A;  4UDU C;  3OMC A;  1GUT A;  1W6K A;  4J6H A;  1WD0 A;  1Q90 A;  2YU9 B;  1G91 A;  2K03 A;  1EY4 A;  2ZXO A;  4IUU A;  4WFN 3;  1HA6 A;  1RTN A;  2I07 B;  1EY5 A;  3Q0A A;  3NWS A;  5JVH 3;  5DNF A;  3FEW X;  5KIX A;  3DWQ A;  4PMW A;  4CBV A;  3TN2 A;  4XDX A;  3SDZ A;  2AUK A;  3SVM A;  2F0I A;  4XQQ A;  1GOZ A;  4ZYS A;  1LTG D;  1TS2 A;  4KHZ A;  2NTT A;  5D65 A;  4LMQ D;  1V43 A;  2NN6 I;  3NQI A;  1SYB A;  1SSO A;  3S2H B;  4QMG A;  3NTK A;  4A3J B;  3MTS A;  2Q8I B;  4FO2 A;  5FLX L;  4DXF A;  5M9O A;  2JA5 B;  5C5L A;  1QIL A;  4DFA A;  1B44 D;  1B50 A;  2NN6 G;  3OOC A;  1YNJ C;  1GUN A;  3NP8 A;  4CGY B;  4FXD A;  4RGN A;  5C3E B;  4KHV A;  2PZW A;  3DM1 A;  3HOV B;  4B9X A;  1RF2 D;  1LTR D;  2DY7 A;  1U4L A;  4C3I B;  1II3 A;  2Y0S B;  1I4G A;  4N9T A;  4TQU S;  5JPM C;  4CHT B;  1F9R A;  3CHB D;  4K6D A;  4C3H G;  3GTJ B;  1U4R A;  1H9S A;  4HAE A;  2B39 A;  2JXM B;  3HOY B;  1UUP A;  1SNQ A;  2K05 A;  3BVG A;  1QOH A;  2BDN A;  1VMP A;  4OO1 G;  3FVQ A;  1KAA A;  3D31 A;  4K14 A;  2N88 A;  1IL8 A;  1FNU A;  4ZUJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...