4K5XA

Crystal structure of staphylococcal nuclease variant v23m/l36f at cryogenic temperature
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
135
structure length
132
Chain Sequence
LHKEPATLIKAIDGDTMKLMYKGQPMTFRFLLVDTPETKHPVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Pressure effects on proteins
rcsb
source organism Staphylococcus aureus
total genus 37
structure length 132
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2013-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4k5xA00
2F0SA 5HURA 1A3UA 1SYGA 4MIUA 5C3XA 5CV9A 4NP5A 4E6IA 4WRDA 1STGA 1EY9A 5CV7A 5J1ZA 2OEOA 2F0EA 5I6YA 1SYBA 3OMGA 1STBA 3D4DA 2F0IA 4ID6A 1F2ZA 4PMBA 2EYLA 1II3A 3NUCA 4HMJA 5CR3A 2PZUA 3C1FA 5CV4A 4IUNA 4EQOA 5K5PA 5CC4A 5KGUA 4N9PA 1F2YA 1SYDA 2SNSA 5IGDA 5IODA 3T16A 4DU9A 3QB3A 4WORA 3NP8A 3D8GA 4DFAA 1STYA 4K5XA 1EY5A 2F0WA 3DMUA 4QB4A 2F0KA 3BDCA 4NMZA 2M00A 5EKLA 4EQPA 1EQVA 1F2MA 1A2TA 5IGFA 4ME5A 1SNOA 2EYOA 2PZWA 4K5WA 5I9OA 1STAA 1AEXA 3ITPA 1EY8A 4KJNA 2RBMA 4F8MA 3NK9A 4KHVA 4ODGA 4HMIA 3SXHA 5CGKA 1JOKA 3HEJA 1NUCA 2F3WA 4G57A 3RUZA 2F0HA 2F0OA 3DHQA 1JOQA 1RKNA 5I6WA 1STHA 2PZTA 3R3OA 5JOBA 2LKVA 4K5VA 3TP6A 3TP8A 3OSOA 3MXPA 2F0VA 4HTHA 1A3VA 2PQEA 5J39A 3P75A 3SK4A 5NUCA 2F0NA 2O4XA 4YIJA 3SHLA 4LAAA 4KV6A 1A3TA 4ZUIA 5IGCA 5KYLA 2F0LA 1SNMA 2F3VA 2OF1A 3HZXA 1EY0A 4K6DA 5EKKA 5C5LA 3BDLA 5C5MA 2SOBA 4B9WA 5IGGA 5IIFA 2F0JA 3V2TA 5C4ZA 2F0UA 1U9RA 2EY2A 4KTAA 4R8NA 4S3SA 3H6MA 5KIXA 3SK6A 2EYPA 4K14A 1EYDA 1SNCA 2EYFA 3C1EA 4KY5A 4KJOA 4KY6A 5CV8A 3TMEA 3TP5A 2F0DA 4J6HA 5E1FA 4OL7A 1KDAA 3SR1A 2F0TA 5HGTA 1EY4A 3P1HA 2OXPA 5I9PA 4ZQ3A 1TQOA 2KHSA 2ENBA 5F2DA 3T13A 2F0QA 1STNA 1SYFA 4K8IA 5C3WA 3NHHA 5CV6A 5C4HA 1ENCA 4J1MA 1KDCA 4KY7A 1EYCA 5DAUA 5KRUA 1KABA 3D6CA 4H7BA 4DF7A 5C6AA 4PMCA 3OWFA 1KDBA 3MHBA 4QF4A 5KYIA 1SNPA 3PMFA 4ZUJA 4NDXA 2EY1A 4NKLA 3SK8A 3QOJA 4KD3A 3U9OA 3EVQA 2PW7A 5E3FA 4RKLA 1JOOA 1IHZA 4IZ8A 5IGBA 1ENAA 4QMGA 2RDFA 2EYHA 1EZ8A 1TT2A 4I65A 4PNYA 4EVOA 4K8JA 3MVVA 4B9XA 2EYMA 2F0MA 2EXZA 3OMCA 4RKBA 1EYAA 3NQTA 3QOLA 5IOCA 1TR5A 2RKSA 3EJIA 2EYJA 3MEHA 4IALA 2WACA 3S9WA 3LX0A 5JAVA 3NXWA 1A2UA 4TRDA 1NSNS 4KD4A 2F0GA 2F0PA 4DGZA 3SK5A 5EGTA 1JORA 3EROA 5IGEA 1KAAA 2HQEA 1SYCA 2F0FA 2EY5A 2EY6A 5CV5A 3E5SA 3TP7A 4F7XA 5KEEA 5ISRA 4EQNA 2PYKA 1SYEA 4N9TA 3ERQA 3D4WA 1SNQA 2NUCA 1SNDA 3MZ5A 5J22A 5M9OA 4K2LA 4K2KA 3VA5A 1EY6A 2PW5A 2QDBA 1EZ6A 2KQ3A 1EY7A 5DEHA 2SNMA
chains in the Genus database with same CATH superfamily
4DUZL 3D3RA 1V1PA 2NN6G 1D8LA 3K7AB 1KQSA 1SYBA 3OMGA 1VQHA 2WB1G 1KIXA 3OHXC 1VCIA 3OYYA 3R2IA 4JYAL 3ND9A 1SROA 2EJGC 1M8AA 3D8GA 3NBHA 2DJGC 1MBYA 3I3CA 4NMZA 2AQ3B 1MJCA 2MO1A 3JAMc 3I4NH 3PO2B 3HOUG 3S16H 4DUZQ 1D2BA 5IP7H 4JI0Q 1EOVA 3TBIB 4ODGA 4LFCL 5M3FH 1ESFA 1MSHA 1VQNA 1QJOA 4LF6L 1J6QA 4FF2A 4C3IH 4JYAQ 2Q8TA 1VQKA 2IHEA 2KEEA 2FMCA 1F9RA 3G4SA 2F0JA 3BU2A 4R8NA 3A8IE 1C4QA 2XRSD 2JK8A 3BS1A 4DR5L 4JCVE 3J81j 2F0DA 4A4IA 3F8TA 4ZQ3A 2DJFC 2E2JB 3A54A 2KA7A 4GKKQ 1G51A 4LFCQ 1Y1VH 4LUVA 3EQLC 3K81C 4LF6Q 1HA5A 4RGNA 4NB3A 1TWCH 2IHFA 4KN4C 2JP1A 5C0XI 1Z7TA 2WB1B 3DM1A 1G6ZA 2WAQE 3UI2A 4HIMA 5C4XG 3K7AH 1EFID 4EVOA 4JC0A 2OT2A 5ELDA 1VF5C 2ZXPA 3IRBA 5G3LF 2Q2TA 3S17H 2WACA 4DK1A 4DR5Q 4A3IG 3CHBD 2B2TA 1A2UA 1TS2A 3KBXA 5EQ0A 2AWOA 4DV2L 1NTGA 4A3MG 1LACA 1LUZA 1XTCD 5CV5A 3HOUB 4OO1G 3VA7A 5M9OA 1CK1A 2JA7H 3A0JA 4RFBA 3N52A 3H94A 3URYA 1K0RA 1EQTA 4E6IA 1I4HA 1Y8PB 3E0EA 3GQBA 3HOYG 1QILA 3X3MA 1Q7YC 2D0OA 1SJED 5IYCH 5ELNA 4IUNA 1ZXTA 2Z0SA 3CCMA 1HTLD 1X55A 3A8KE 4ZCKA 5IODA 4U673 3BJUA 1SN8A 4DV2Q 3HOWH 3MXGA 1MI2A 2G9HD 3HP3A 4MTKA 1QVFA 1F2MA 1CKNA 1WCMG 1QB5D 3CCSA 1A0IA 2BDOA 4A3DG 1BCPF 2B2WA 2ZJQA 4LF4L 2O5JC 2I07B 3TP6A 4JI1L 2MHVA 3OSOA 2NN6H 3S2DB 3M3YH 1U4LA 2DUDA 1B9MA 4A76A 3BVZA 4GNXC 2HQLA 4G7HC 4XIGS 5BR8L 4L5SA 2VW9A 5ELEA 5IIFA 3M85A 4A3IB 2N49A 4R4CA 1PFSA 1LTTD 2FXQA 2X69A 1UEAB 2X6GA 4C1NK 1ZEQX 4BBRH 2NZOA 1U4PA 4A3MB 2OCEA 2EYFA 4LNQA 1PDQA 3HKZE 4RG1A 5I9PA 1EY4A 3IL8A 3K6OA 5HY6A 1YJNA 5M3MH 4AYBE 4PZ7A 2E75C 5ELBA 4LF4Q 3HOUH 4ABNA 4JI8L 4LUZA 1CKOA 3M4QA 3GP7A 1JWMD 1PH7A 1XNRL 2KHJA 4HIOA 3H0GG 3TDQA 5BR8Q 3CC2A 3W2DA 4HR7B 3R2TA 5EKIA 3A56A 2F0MA 2EXZA 1TR5A 4ILWA 1T5XD 1K83B 1TKWB 4MZ9A 2F0PA 4UPAA 3MC0B 1BQQT 2Q8RE 1SYEA 3OW7A 2R7FA 3NBIA 2E2DC 3D0FA 4JI8Q 1HA6A 4K2KA 3VA5A 1S72A 4A3DB 2Z8LA 4DV4L 3SEBA 1NMGA 4KY6A 4DA2A 1XNRQ 2MFIA 3TSSA 2B3GA 1GUOA 3L3OC 4F88A 1KHIA 2F52A 1LABA 1VQCA 4I7ZC 4A3FB 4R1JA 2XVSA 3QG1A 4ID6A 4UDUC 3CCRA 3D31A 3S2HB 3C1FA 5C4XH 3ERSX 1VQPA 2L1BA 3W1BA 3K0XA 1H9SB 2K03A 3QB3A 2BE5D 1X3GA 2ZTEA 4R4TA 4DFAA 4C2MB 1TWGB 4A3IH 2B63G 1GD7A 1CFMA 2R61A 1VQAA 1EIYB 2B2UA 4DV4Q 5IGFA 4A3MH 3T4AC 1ASYA 2YU9H 4OX9L 4RCOA 4PQXA 3LGJA 4A93G 1HNXL 4R4QA 1NUCA 3UDXA 1ML0D 3NSWA 4DR1L 1Y1WG 1L1OA 2GA4B 4IPHA 3S1NB 3HOYH 1PTOB 3PIOA 2H5XA 1WOCA 1KRSA 2B2VA 1PMRA 2WIIB 1BNZA 3GTOH 3Q8DA 5C5LA 1EY0A 2A5HA 4OGQC 2K4KA 1X3FA 1VQ4A 2X6LA 2BA0A 2F4VL 1LTRD 1K83H 1MJEA 4OX9Q 1EIHA 1EWCA 1YHQA 3NHHA 1JWSD 1WCMH 1D6EC 1BKBA 1HFGA 1Q12A 3F2DA 1PXUA 1T5EA 1JB3A 1BF4A 1B9NA 3MWYW 4XXEA 1IKMA 3OW2A 1IHZA 5T1IA 4YCUA 4YHHQ 3BDOA 4DUYL 1L0WA 3AQQA 2QKIC 1EYAA 1K8AC 4CDDC 4PZ6A 3G7LA 3J80E 1KL9A 2F4VQ 4P74A 4FF3A 3M9BA 4WFN3 1QZHA 1EYGA 3RZOB 2N55A 3KJOA 5BN3A 1SJHD 3CKIB 2WV6D 2YTVA 1QNUA 1EU4A 3BYYB 3E9IA 3U58A 1WJJA 1FGBD 5T1GA 4A93B 1P16A 4IJLA 1F77A 4NXML 1EEID 5C3XA 1Y1WB 5KNBA 1LT3D 3I72A 5J1ZA 1S5DD 4DUYQ 2F0EA 5L37A 3Q22A 3NEMA 3S1RB 1YNJD 2EYLA 4HMJA 3H0GH 2PZUA 4CJ0B 1U4RA 3CD6A 4N9PA 2XN9C 1NAPA 2ICEC 1Q3LA 3KF8B 3MFYA 1ILPA 4YWLA 3PSIA 1LTSD 1DJRD 2F0WA 4QB4A 4POFA 5CBAE 4FF4A 3RLFA 2K5QA 2NVYH 4YWKA 2AQ2B 3ULJA 4NXMQ 1NE3A 1JQYD 3IAYA 5HGQA 3WWVA 4RHSA 1YJ9A 1MIUA 5FO8B 4RMFA 1BUVT 4A3EG 1LTBD 2PI2A 2WKCA 3DHQA 1N32L 2NZHA 1GXDC 3R3OA 4K5VA 2F3IA 1B50A 1Q8KA 2NYZD 4L5QA 1CSQA 4H13C 3NTKA 4V0BA 5M5XB 2L15A 1FNVA 2VQEL 1SNMA 1HCZA 1VMPA 4CKCA 2V1CC 4KJOA 1PH1A 4BY1H 2B63H 3H3VI 4JI3L 3GTPB 4X6AH 3K5OA 2JA8H 4QJFA 3M4OB 4OHJA 2QF7A 5FLXE 4LMQD 2VL6A 1N32Q 1KDCA 2PMZE 4DF7A 3PGZA 2XNAC 1A8VA 1TVXA 2VQEQ 1KD1C 2XGTA 3ONAB 1RTOA 4P71A 4PZ8A 1TWFB 4OELB 1EZ8A 1I3QB 4BY7B 1NMFA 3S1RH 3PUYA 3L7ZC 1DGSA 4NW2A 3UE0A 1HZAA 1VS0A 4BXXG 4JI3Q 4X65L 3J81L 4J8QA 1HRJA 1KAAA 3ULLA 4F7XA 2LY7A 4DV6L 2AMCB 2OTLA 2QA4A 2NUCA 3C46A 1S4ZA 4XTCS 4A3EB 4GLXA 1YNXA 2AUJD 2DNCA 3T53B 3L0OA 2JE6I 1Y14B 1HXYD 3S1QH 3WOFA 1II3A 3VR5A 3C3LA 3V96A 4J15A 1QVGA 5JJIA 1SYDA 5M5WB 3VR6A 4BBSG 4X65Q 1RJTA 2RDGA 5CBEE 1SAPA 2VQFL 1MD2D 1N33L 3RLNA 4DV6Q 2Z1CA 1J5EL 3GDEA 4DR6Q 5M3FG 5EKLA 4WJ3M 2NVTB 1YEZA 1F9QA 2K05A 4QY7A 1O80A 4F8MA 2F0HA 5CMDA 1HNZL 3TP8A 1P8LA 1XXGA 4DK6C 1CQVA 2M9VA 1A3TA 3A8JE 4JOIC 5IGCA 1DOKA 5BN5A 2OF1A 3G6EA 4DAYB 2E2IB 2VQFQ 1TWFH 1DYQA 2EE1A 1HJPA 4R9WA 1N33Q 1EL0A 2BCOA 3GTMB 2BH8A 4R8IA 1J5EQ 1Y1VG 3KDFB 3LWEA 2CW0D 4DAPA 3T1HL 2HD3A 4FXDA 2I46A 3C1EA 3VYTA 1TU2B 3TMEA 4J6HA 5HGTA 3P1HA 3UDIA 4LF7L 2B2YA 2KHSA 2KECA 4FF1A 2F0QA 1SLJA 1HNZQ 5JJLA 2QCPX 3HKSA 4A3EH 1SNPA 2EVBA 3T1YL 1XNQL 1Q46A 1HFNA 4X62L 1LTID 2B2TC 4JK1C 2BE5C 4IPCA 4K8JA 2B8GA 2UU9L 4RKBA 3GV6A 3I4NB 4DR4L 3NQTA 3B6YA 2N8NA 3T1HQ 1H9SA 1KLUD 4JI7L 3E3XA 3S16B 4KI0A 1AFPA 5JJKA 4TRDA 2HCIA 2JA7G 4LF7Q 5M3FB 2HQEA 2O2LD 2F0FA 1SNQA 3G71A 4JPBW 1WVLA 1Z9FA 4FNFA 4IUVA 1KAWA 4DKAC 4C3IB 1YJWA 3F2BA 4POGA 4QGUA 2DY7A 5DEHA 5CC4A 4YWMA 1IBML 4NP5A 2YTXA 4WRDA 1BXTA 4X62Q 1N36L 4IN3A 3D4RA 2D9UA 2CQAA 3MEFA 1Z6HA 3QJYA 3J81i 2UUCQ 2UU9Q 3HOWG 3S14H 4DR4Q 3I8ZA 3CXCA 1E2WA 5A2QE 1Q86C 4XDXA 4EQOA 4JI7Q 5CV4A 4ZKBB 1NCVA 2GVBA 1Y1VB 3KBGA 5FLMH 2TSSA 1Y8NB 1TY2A 5E4XA 4BXXH 5CORA 1TWCB 2B2WC 2CQOA 4IPGA 1D5XC 2LXKA 2EYOA 3FKIH 5C44G 4LK1C 2Y0SE 4X3UA 1IBMQ 1R4QB 4YCVA 1N36Q 4HJ7A 5IT9E 3S17B 1B44D 3PO3H 2YV5A 3Q0AA 2Q2UA 1WD1A 4O0AA 4BBRG 3NELA 1BVSA 1QNKA 4U68A 2RVLA 1QUQB 1SE3A 4DK0A 4KTAA 4BBSH 5M3MG 2JA7B 2AHOB 2A68D 1TWHH 4KY5A 4G7OC 1IZ6A 2OXPA 4A75A 3W3AA 2K5VA 4RGMA 1CTMA 4RGOS 5C4HA 1DONA 1IL8A 3NTIA 3KLWA 1B2TA 3V05A 1YNJC 3FDTA 2VZAA 1MGSA 4DK3C 5AFWA 3HOWB 2PW7A 4CDEC 1GJXA 1Q1BA 1AH9A 3H3VC 2WKDA 4X3SA 1G91A 4JOIA 2JN4A 4LW1A 3IFDA 3QOLA 5KNDA 2WP8J 3KF8A 5IYBH 1LM0A 1VQLA 2F4IA 1BBWA 1STEA 3TP7A 1HQRD 5C44B 2CWPA 3CF5A 4B3SL 4WJ4A 1S3OA 3M3YB 4OO1I 4A3KH 2Y0SG 1C48A 5IY0A 1EY7A 4B3RL 1PYWD 4ALPA 4QIWE 3VR2A 3MXNB 1PRTC 3PQIA 4BBRB 1EOTA 3KJPA 1VQMA 1UE6A 5KNCA 4MN3A 2Z6KA 2B2UC 3PUWA 5D3DA 5M3MB 5C4JH 1EQQA 2K14A 1VQ7A 1NR2A 3K5LA 4B3SQ 4JI5L 1FVIA 1XJVA 1RD9D 1L0YB 2GN5A 4LF8L 1D7QA 4CDCC 1FYCA 1L1OC 4B3RQ 4IFDH 4KHVA 3H15A 3NPPA 3U4ZA 1D5ZC 1MSGA 1O7ZA 2B2VC 4C3JG 1L2FA 1TXYA 1YVCA 2EIFA 3CRKC 1XX8A 1SFOH 1PTOD 3MXPA 4HTHA 4NXNL 5C0XG 4L5TA 5NUCA 2QEJC 1O7YA 2JXMB 3L9AX 4C3HG 1W6KA 4UY8C 2AQ1B 1JJ2A 3CPWA 1VQIA 5C4ZA 3TREA 4HCSA 4JI5Q 3VR3A 3EIVA 2K5DA 3CC4A 2EYPA 5IYDG 1WTHA 4LF8Q 1EYDA 2N3SA 3IKJA 2PPBC 2C35B 3I4MG 4A3JH 3OIPA 2NTTA 5I2XA 3GTQH 2EJMA 5C44H 1Q81C 3CQZH 1EUJA 2FMMA 2BOSA 5C4XB 1OXXK 1GUTA 5KRUA 2A73B 5C6AA 1WTOA 4L6TB 4NXNQ 2WAQG 2MQHA 3PMFA 4KKUA 3UDFA 2OTJA 1FNUA 1AP0A 1SE8A 4O1NA 5IGBA 4I65A 1JB7A 2EYMA 2QW7A 4GN3B 1I4RA 2CH4A 3JAME 3M4PA 2YU9B 3S9WA 1SEBD 2F0GA 5IGEA 3NE5B 3I4LA 4JG2A 2IX0A 4UP8A 2I5MX 2PYKA 4JI1Q 2N88A 3D4WA 5ELFA 2Q2HA 3HOYB 1G6PA 4HSPA 2VXWA 4FXKC 3GTOB 1A3UA 3J81c 2N78A 3PUXA 3AEVA 4HIKA 3ER0A 4C3HB 2ZTDA 1DD2A 2NZ1D 1C0AA 2CW0C 2XSCA 3T16A 4DAYA 3HOZG 4EQ5A 2OWOA 3CMAA 4OWTB 5GQOA 4IQZA 4X3KA 1WCMB 4OEMB 2F1MA 3KDFA 3RR5A 4A3CH 5EPKA 1GOZA 1S5FD 3I4MB 1ZYRC 4ME5A 5LL6X 1D1IA 1JOKA 2WAQB 5JVG3 2F0OA 1IW7C 3H91A 1STHA 2R92H 3W5OA 2UXDL 3LNNA 2VUMH 4ZK9B 4TKOB 2F0VA 1A3VA 5ELOA 2DY8A 3P75A 1I5FA 2CWAA 1PV4A 1EEFD 4BY1G 2MUYA 3HZXA 2JA8G 4QUCA 2J7ZA 3HKZG 2PNHA 3TP5A 5E1FA 3SR1A 4AYBG 1KDAA 2OQ0A 2A6HD 5JPNC 1E24A 1HHVA 2FHTA 3PIP3 5C3WA 2ZXOA 1GVPA 1W6JA 1EYCA 3H0GB 2UXDQ 4H7BA 5LMNL 1V1QA 4HJ5A 4C3JH 1CSPA 4RKLA 1H9MA 3FVQA 1K8GA 5C0XH 2JEAI 3MVVA 2FFKB 2NVYB 1EFWA 3OTOL 1UEBA 1B8AA 4C3HH 3LX0A 4IUUA 5ELCA 1HNXQ 1BOSA 1BBUA 1SYCA 5IYDH 4DR1Q 4DV5L 4BWGB 4X64L 2NVQH 1ZKOA 1I6VC 2H1EA 1D1KA 1RF2D 2ZT9C 3I4MH 1EIFA 4DXFA 1WD0A 2K01A 5DM73 5JEAH 1K3BC 1UE1A 1LO5D 4YCWA 1CKMA 3Q23A 3RN2A 1O7LA 3NQIA 2F0IA 3OTOQ 1SMYC 4PMBA 4UP7A 4BS9A 4BY1B 2B63B 2QEXA 2L12A 1LTGD 1SXTA 2A68C 4OIJA 2MGSA 1W3SA 4XQQA 2JA8B 3HKZB 2K50A 2R93H 1F2LA 1QUQA 2HT1A 2CH4W 2NTSA 2NWGA 4DV5Q 1GKHA 5IWAL 4X64Q 1EY5A 1PYSB 4AYBB 1HUNA 1TS5A 4ZRZA 2XWJB 1NNXA 4GOPB 3I4OA 3J7YW 1VQOA 4KJNA 1PH6A 4JVZA 3S15H 1JT8A 2B8FA 3GTJH 3SDZA 1PYBA 2PZTA 1VQGA 2J0TD 1A6XA 2UXBL 3MA2B 4FXGC 1VQFA 2D2CC 3CW2C 1M4VA 4XQJA 5M5YH 2F3VA 1TY0A 1IKLA 1WTPA 5IWAQ 1PFMA 4O42A 3HOZH 2B2YC 1B7YB 5GROA 2ASBA 1WTVA 1TWAH 1PH2A 4A3BH 2JSOA 1TQOA 3DUZA 3GTLB 3S1QB 3CCUA 4KY7A 1XTDA 1PH3A 2PQAB 3H09A 1CI3M 3OWFA 2UXBQ 5KYIA 1PRTD 3MXNA 2A74C 4IZ8A 2I5LX 1ICWA 1RDPD 3MAQA 4H44C 1O78A 2RKSA 3UE1A 5AJ3L 3PIO3 4IALA 4IUQA 1RTNA 2E8GA 4ULLA 3S24A 1FJGL 5GAHC 1E3PA 2E2HH 4DV1L 1I4QA 3EROA 3CCLA 3VYRA 2EY6A 1Q82C 4LF9L 1I6HH 3ERQA 1WTWA 4HN7A 1VQ9A 4K2LA 2QDBA 1PTOC 4CHTB 5HURA 5DM63 2K6AA 1HZBA 5D14A 1HR0L 1JJCB 1ILQA 1S5BD 1OXUA 3A5ZB 3M7NA 4LFBL 1E0BA 5FLMG 1K73C 3D4DA 2ZXRA 1R4PB 4JBKA 2R7ZH 5AJ3Q 1RODA 2UUAL 4H0LC 2VNUD 1TS4A 3CP0A 4IPDA 2SEBD 5IGDA 3J80L 1GO3E 3FKIG 4DV1Q 2J4XA 1I4GA 1RHPA 4AIMA 3NP8A 3SE0A 4GLAC 1CQFA 4RCNA 4PV1C 4LF9Q 4K5XA 1LT5D 2F0KA 4GKJL 3I91A 3TN2A 3I70A 4RH6A 4CJ2C 2IX1A 3T51B 5E4WC 1VF7A 3PO3G 2OQKA 4JBJA 2Z4IA 4LF5L 2RBMA 1CZGA 1HR0Q 1BCPB 3NK9A 4GN5A 4HMIA 3GTLH 2F3WA 3L2PA 1OTCA 4LFBQ 1RKNA 5FJ8G 1DM0B 4KLKA 4CKBA 1K8OA 5D65A 2UUAQ 5JJZA 3CMEA 3Q6SA 1CA5A 1VQEA 1K0SA 4LAAA 1V1OA 1UE7A 3KLRA 1UUPA 3R8BA 4HJ8A 1JC7A 2F0UA 4MNOA 1FL0A 2H4OA 3CRLC 3NENA 4HEDA 1FNWA 1S5ED 4K14A 5KIXA 3UDGA 5FO7B 2KCTA 1QZGA 4ZKCB 4OL7A 4LF5Q 1GUSA 1AZPA 5F2DA 3S14B 1STNA 1U5KA 3Q24A 3GTKH 2K52A 2HUGA 1BO0A 1GHKA 1U0LA 2JJQA 1G2TA 5IYBG 4JI2L 1SDFA 2KHIA 4DR7L 1CHQD 3TS0A 2EYJA 3FKIB 1R9TH 3CCEA 4FDBA 1X3QA 2K75A 2HCCA 3DWAA 5IP9G 5C3EG 4KD4A 4A3KG 1PHJA 1M90C 1XWEA 4APVA 3SK5A 4CGYB 1TS3A 3X3NA 5BN4A 1ZYRD 5E7NA 4KKSA 4BA2I 3PO3B 4N9TA 1VQ6A 1JICA 3DEOA 3OOCA 4FYDA 5FLXL 2VB2X 1C7YA 3HOXG 3CCJA 1EZ6A 2SNMA 4DV7L 4MIUA 1IW7D 4Q0FA 1GHJA 4JI2Q 2C5CA 2Z6KC 4BBSB 2PI2E 1STBA 4DR7Q 2G9DA 1TWHB 1VQBA 4RAUC 3TEHB 3DM3A 1F2ZA 5CGKA 2CCZA 3NUCA 3HGBA 4DV3L 3DWPA 2K1BA 5J3BA 2JA5G 4V190 2WB1E 2KCMA 1D5MC 1E1TA 4Y7NH 2MJ8A 2Z4HA 2A6ED 2A6HC 3K5NA 1STYA 4EX5A 1LYLA 2IT1A 4IFDG 1QWYA 1EQVA 2V4DA 2Q8IB 4DV0L 3K57A 2PMZB 3T1YQ 4X3TA 1XNQQ 1STAA 1IYUA 4DV7Q 2ALYB 3ITPA 3FMCA 3HOVH 1SSOA 1V9PA 4ME3A 2NN6I 4RWSC 3K59A 3J80i 3QO2A 3K80C 4AQYL 3E6ZX 5I6WA 5LHY1 4B3ML 5I2YA 5EJWA 4OONA 4DV3Q 3KK7A 3FP9A 5EAYA 4RHRA 3SK4A 2F0NA 4G4KA 3SHLA 3BDLA 2JEBI 4JBWA 2HDLA 4A3JG 1U4MA 1X3EA 4PMWA 4A3KB 4S3SA 3M4YA 1G8ZD 4DV0Q 3HG9A 1LV9A 1NY4A 4UP9A 3AYHB 5FO9B 1OXTA 3HOXB 1WTRA 2EQSA 3H3VH 1T9HA 4AQYQ 4B3MQ 1YNND 2NBFA 3D6CA 2ID0A 3KLSA 1IL2A 3SVMA 3STBD 1WI5A 1QCBD 1S5CD 5C4JB 1VQ5A 1X32A 5FJ8H 2K32A 5DNFA 1XMQL 1JR0D 4JI0L 1SMYD 3AB9A 1JMCA 2JA5B 2LS01 3T56B 3VYUA 3WDNA 3CC7A 3TRZA 1SR3A 1ONLA 3F2CA 2XRQD 1B3AA 4GNXB 1M1KC 5FKAC 4Q5VA 3G48A 2EY5A 3E5SA 1PVOA 2D0PA 1EQRA 2HIVA 1Q90A 1SFOB 1F9PA 4FP5D 4HJ9A 3TZUA 4CJ1B 2R6GA 4GOPA 1WFQA 1EY6A 1HZCA 5K36H 3DWQA 1STGA 1XMQQ 4XYOA 4GKKL 3RZDH 4LWCA 4CDFC 3EA6A 4P75A 1JORA 4A3CG 3E0JA 1ET6A 1SMXA 4IFDJ 4ZAIA 1X9NA 1F2YA 3I90A 4A3JB 5JPMC 1XYIA 3GTQB 3CQZB 4A3GG 2LFNA 3MXUA 5C3EH 5IP9H 2IY5B 2A19A 4M8AA 2F03A 3I56A 2KEDA 2R92G 1QE6A 1IBLL 2VUMG 1RIPA 4KHPL 3ZYYX 1ET9A 3K58A 5FK9C 4DNIA 3ZJYC 3HOXH 3RUZA 1EWHA 3WOEA 1JOQA 2PQAA 4R4IA 4UAIA 1Q1EA 1JE5A 3GTGH 2PQEA 4L5RC 5A2QL 3DLLA 4QQBX 3N6RA 4Y52H 1LT4D 4ZYSA 2C9OA 4B9WA 2SOBA 3BVGA 4LJZC 3OPOA 2JA5H 1RCVD 3J7AF 5CV8A 1X6OA 2KCNA 1XPRA 1IBLQ 3J7ZC 5LMUL 2RF4A 1UAPA 4KHPQ 2YYZA 4XQNA 2PCFB 1A63A 3A74A 1K28A 2TMPA 2ENBA 4NPSA 3VDYA 4OXPA 3S1MB 5IT9L 3KFUA 4IOCA 5D3IB 2RDHA 4DXGA 3MHBA 2QDLA 2EY1A 2B39A 3SK8A 3PO2H 3QOJA 2ZJRA 4IOAA 3EVQA 4GS3A 1E7ZA 3GV3A 2JA9A 2CVRA 1B70B 4B9XA 3AFQA 2JQOA 2XWBB 1GUWA 2IL8A 2ZTCA 4A3GB 3TS2A 1BDOA 5EBDA 2K28A 1X54A 4MHEA 5LMUQ 2A69C 4MTNA 1NSNS 3QWNA 1YI2A 2VB3X 4DGZA 2Y0SB 3PF5A 4OIKA 5JEAG 2R92B 5KEEA 2VUMB 1V8QA 3KYHC 1GUGA 2B29A 2R7DA 4HAEA 3PIPA 2BH2A 1HNWL 2F0SA 2YTYA 1JE4A 2RHQB 5CV9A 4I7AA 1ESRA 3HFZB 5LMNW 2CHBD 4ZLTF 1O7IA 1EY9A 4IUTA 2E2JH 5I6YA 2R93G 3AU7A 1OO9B 1KRTA 1E2ZA 1B3QA 5CYUA 4RA8A 2RSNA 1I4XA 1VQ8A 4A3FG 1E1OA 1VMCA 3K5MA 1HNWQ 4JBMA 4C3JB 2PZWA 5I9OA 3J80c 4HJAA 3F2UA 1X56A 4DR2L 1EY8A 3MTSA 3P7JA 2EZVA 2R3ZA 4G57A 1ICFB 2KVMA 3S1MH 4BA1I 2RA4A 2AKWB 2UUBL 1B1ZA 1HPCA 1KNEA 2O4XA 4YIJA 1I50B 2RSOA 3KLSX 2PNRC 2NVQB 4L8JA 3F1ZA 4A3BG 3V2TA 1PZID 1U9RA 3RD4A 3TZDA 4A3GH 1YBYA 3FHWA 4Z9CB 5C0XJ 4DR2Q 1UWVA 4O2DA 4QIWB 2ICIA 4B3TL 2WFWA 2UUBQ 2A1AA 2M2LA 4QF4A 1HH2P 1J8IA 2R93B 2QGQA 3R93A 1PRTF 2KBNA 3I2ZA 4HCEA 5COYA 4PNYA 4F87A 2IW3A 1KNAA 5G3LD 2DN8A 2A6EC 4P72A 5JEAJ 4IURA 5JAVA 4OWWB 2CKZB 2K5HA 2MO0A 2JA6G 3S2DH 3S15B 1PZKD 3GTJB 5EGTA 1K8MA 1N9WA 3VR4A 5GAGC 2HDMA 1CUKA 4TQUS 3PV0A 4B3TQ 2EDGA 1SNDA 4DAVA 4QCLA 2R7ZG 3KOJA 1Y69U 5M5YB 1SYGA 4N8X1 2K04A 4OO1H 5CV7A 2OEOA 3HOZB 3E9HA 1QVCA 3A7LA 3IFTA 2NB0A 5FLXc 4JW0A 5FOBB 2SDFA 1LTLA 1NR4A 1YZ6A 5CR3A 5KGUA 1TWAB 3JAML 5K5PA 1I4PA 3K0YA 4A3BB 2O5IC 2E74C 2HIXA 3KF6B 1I50H 3BG3A 2FJ2A 3I73A 1EWIA 4YHHL 2AUKA 3DMUA 1RL2A 3BDCA 5LMNQ 1CA6A 4EQPA 1NBWA 2ZM6L 3CPFA 4A3LG 1VQDA 2K7VA 1YNNC 4K5WA 4XT1B 3STBC 2Z9HA 1PH4A 3W1GA 1BCPD 3RNUA 4LFAL 1IXRA 4IUPA 1V1PB 1HR0W 1PH9A 2WINB 1QOHA 4A3DH 2E2HB 4JI4L 1MHWC 3OWEB 4IO9A 1X65A 1DXMA 4KV6A 4ZUIA 1KXLA 2NVXB 1LLRD 5EKKA 4K6DA 1AN8A 1V43A 1I6HB 3OIQA 3FPPA 1LT6D 2JA6B 3NBHB 1DOMA 3FRPB 4GNXA 4A3FH 1PFNA 2K33A 2ZM6Q 1S40A 1SNCA 3S2HH 3PUVA 4CBVA 3J81E 3VYSA 1ASZA 1SE2A 2P5ZX 2F0TA 1JWUD 1OXSC 4LFAQ 3T13A 1AW7A 4RGTA 2R7ZB 1SYFA 1Z47A 5EBCA 4C2MH 1TWGH 4KMUC 1PFBA 2EPBA 1CHPD 2D5DA 1HQMC 4JI4Q 3U9OA 5E3FA 2RQXA 3A7AB 1GUNA 4AH6A 3KUPA 1ENAA 3AFPA 4H02A 4QMGA 3PCOB 1SRUA 3TQYA 3OMCA 3RN5A 3JC66 1FGUA 2L4NA 3NXWA 2DNEA 3S1NH 4DPGA 1PTOH 3U9SA 4EGVA 4BY7G 4GN4B 1GM5A 3PF4A 2EOTA 1YHBA 2FINB 4DAMA 2IJ0A 1DZ1A 1A15A 5J22A 5IE8A 4DR3L 2LXJA 4C56C 2MPMA 3HS0C 5JVH3 5LL6S 1KC8C 4TVAB 4M1UB 1CT1D 1B53A 4XT3B 1I94L 1B4OA 2GVAA 4DU9A 4TSSA 4KHZA 2JYOA 2NVXH 4FVMA 2LSSA 5GAEC 3GTKB 1XPOA 3HOVG 1Q8IA 2JA6H 2KCCA 3K7UC 2ES2A 1BBXC 1A2TA 4QUFA 1SNOA 4DR3Q 3RZOH 2L0CA 4IJHA 3G6JB 3JAMi 3SXHA 3DXJC 3BZKA 5JOBA 2LKVA 1R9TB 1H9KA 2DGYA 4P73A 1FJGQ 4A93H 2ATWA 1I94Q 4UHVA 5KYLA 3C2PA 1HZ9A 1W2BA 2XTIA 1Y1WH 1FR3A 2RCFA 5C5MA 3RMHA 3O13A 3P20A 1IYVA 4PG3A 2A69D 1IBKL 1XMOL 1C8CA 4DNRB 2KOLA 4HSVA 2L5TA 4YY3L 1CKNB 4GZYC 1N8RC 2L11A 4A3LH 4K0KL 1HUMA 4K8IA 5EPLA 3U4VA 5TSSA 3BVMA 1ENCA 5DAUA 3ULPA 4WJWA 3ICEA 1KABA 4G7ZC 1E2VA 4DR6L 3A5UA 3GD7A 3RLOA 2I5HA 3QIAA 4KKTA 2K5NA 4ZUJA 4NDXA 4Y7NB 4LUOA 3J7A5 1PZJD 2Z6BA 1JJGA 3EBEA 2EYHA 1TT2A 1A62A 3U50C 3BYTB 4GKJQ 5IT9c 3NWTA 1VQJA 2K5WA 1AE2A 1SBBB 3EJIA 1XMOQ 1IBKQ 1KTKA 1PH8A 3BZCA 5H1SE 1C9OA 4N8FA 3EN2A 3HOVB 4YY3Q 1HTPA 5M5XH 4DN4M 2ZJPA 1TIID 2D62A 4GOPC 5K36G 3I4NG 2EXDA 3I55A 1NJIC 2KUMA 1YITA 1MKHA 4K0KQ 1PH5A 5IP7G 2A8VA 3NWSA 3MZ5A 4HIDA 2E5LL 1G291 2PW5A 3FPUB 2IPKD 1CZWA 2PO4A 2I0QA 1AZQA 3GTPH 1VDZA 3QR8A 2UXCL 4C3IG 4JV5L 1XPUA 2QILA 4CKEA 2BDNA 4FO2A 3M4OH 3NTHA 2LMCB 2Q2IA 3J7AV 2SNSA 2AWNA 3GO5A 4WORA 3CCQA 2HHHL 3DEPA 1I3QH 3CAMA 3K8AA 2KENA 2M00A 2E76C 4BY7H 4IFDI 1H9RA 3CU7A 2E5LQ 1PLFA 2IX3A 3HRZC 2XIWA 1AEXA 3EFXD 5GADC 1WTXA 1Y8OB 3D6WA 3HEJA 2VY3A 2UXCQ 1K9MC 4JV5Q 4XYQA 1YHAA 1IYJB 1FD7D 2L9HA 1WTQA 5J39A 5A35A 2CFMA 4JI6L 1KLGD 5EPJA 3AMUA 1BR9A 1F9SA 3PUZA 2MNAA 2F0LA 3MFGA 4DNTB 1PRTB 1SE4A 4K6LA 1JCKB 5IGGA 2HHHQ 3M7GA 2EY2A 2UUCL 5DLQE 3H6MA 1YIJA 3SK6A 4QL5A 1QG7A 4B08A 2MP1A 3LWUA 1X3PA 2RHSB 5M5WH 4C1NI 3RZDB 3BZDB 1EU3A 3PO2G 5I4DA 1L0XB 2L55A 3I7FA 5CV6A 4J1MA 1AE3A 4R4OA 4X66L 1OXVA 1CM9A 1PTOF 3A55A 4PMCA 1L1OB 1N34L 1KDBA 4JI6Q 4NKLA 2NVTH 4KD3A 3ND8A 2BA1A 4KK7A 1JOOA 5IYCG 1UNSA 1UE5A 5C3EB 2KJXA 2RDFA 1H95A 5IOCA 2VS1A 3CCVA 3MEHA 3KF6A 2IWHA 2G5DA 4P2CB 1H9JA 3FEWX 1K3RA 4GLVB 1G2SA 2RCNA 1DOLA 4OWXB 1ENFA 2EJFC 1J9OA 1EIGA 1DCZA 1LTAD 1BCPC 4KN7C 3SGIA 5ISRA 4EQNA 2E2IH 1E22A 4L63B 1WYDA 1PA6A 3GTMH 4X66Q 3GTGB 1N34Q 2KQ3A
chains in the Genus database with same CATH topology
3D3RA 1V1PA 2NN6G 3K7AB 1SYBA 3OMGA 3OHXC 1VCIA 3R2IA 3ND9A 2EJGC 1M8AA 3D8GA 3NBHA 1MBYA 3I3CA 4NMZA 2AQ3B 3PO2B 1D2BA 3TBIB 4ODGA 1ESFA 1MSHA 1QJOA 4FF2A 2Q8TA 2KEEA 2FMCA 1F9RA 2F0JA 4R8NA 3A8IE 1C4QA 2XRSD 3BS1A 2F0DA 4ZQ3A 2E2JB 3A54A 2KA7A 3EQLC 1HA5A 4RGNA 4KN4C 2JP1A 5C0XI 1Z7TA 2WB1B 3DM1A 1G6ZA 3UI2A 1EFID 4EVOA 2OT2A 5ELDA 1VF5C 2ZXPA 5G3LF 2WACA 4DK1A 3CHBD 2B2TA 1A2UA 1TS2A 3KBXA 5EQ0A 2AWOA 1LACA 1XTCD 5CV5A 3HOUB 4OO1G 3VA7A 5M9OA 1CK1A 4RFBA 3N52A 3H94A 3URYA 1EQTA 4E6IA 1I4HA 1Y8PB 3GQBA 1QILA 3X3MA 1SJED 4IUNA 1ZXTA 1HTLD 3A8KE 5IODA 4U673 3MXGA 1MI2A 2G9HD 3HP3A 1F2MA 1QB5D 2BDOA 1BCPF 2B2WA 2O5JC 2I07B 3TP6A 2MHVA 3OSOA 2NN6H 3S2DB 1U4LA 1B9MA 3BVZA 4G7HC 4XIGS 5ELEA 5IIFA 3M85A 4A3IB 1LTTD 2X69A 1UEAB 2X6GA 4C1NK 1ZEQX 1U4PA 4A3MB 2EYFA 1PDQA 5I9PA 1EY4A 3IL8A 3K6OA 2E75C 5ELBA 4ABNA 3GP7A 1JWMD 3TDQA 3W2DA 4HR7B 3R2TA 5EKIA 3A56A 2F0MA 2EXZA 1TR5A 4ILWA 1T5XD 1K83B 1TKWB 2F0PA 3MC0B 1BQQT 2Q8RE 1SYEA 3OW7A 3NBIA 2E2DC 1HA6A 4K2KA 3VA5A 4A3DB 2Z8LA 3SEBA 4KY6A 4DA2A 3TSSA 1GUOA 3L3OC 4F88A 1LABA 4I7ZC 4A3FB 2XVSA 3QG1A 4ID6A 4UDUC 3S2HB 3D31A 3C1FA 2L1BA 1H9SB 2K03A 3QB3A 2BE5D 4DFAA 4C2MB 1TWGB 1CFMA 2R61A 2B2UA 5IGFA 3T4AC 4RCOA 4PQXA 1NUCA 1ML0D 3NSWA 2GA4B 3S1NB 1PTOB 2B2VA 1PMRA 2WIIB 1BNZA 5C5LA 1EY0A 2A5HA 4OGQC 2X6LA 2BA0A 1LTRD 1EIHA 1EWCA 3NHHA 1JWSD 1D6EC 1HFGA 1Q12A 1PXUA 1T5EA 1JB3A 1BF4A 1B9NA 3MWYW 4XXEA 1IKMA 1IHZA 5T1IA 3BDOA 2QKIC 1EYAA 3G7LA 3J80E 4FF3A 3RZOB 4WFN3 2N55A 5BN3A 1SJHD 3CKIB 2WV6D 1QNUA 1EU4A 3BYYB 1FGBD 5T1GA 4A93B 1F77A 1EEID 5C3XA 1Y1WB 5KNBA 1LT3D 3I72A 5J1ZA 1S5DD 2F0EA 3Q22A 3S1RB 1YNJD 2EYLA 4HMJA 2PZUA 4CJ0B 1U4RA 4N9PA 2XN9C 1NAPA 2ICEC 1Q3LA 3MFYA 1ILPA 1LTSD 1DJRD 2F0WA 4QB4A 5CBAE 4FF4A 3RLFA 2K5QA 2AQ2B 1JQYD 3IAYA 4RHSA 5FO8B 1BUVT 1LTBD 2WKCA 3DHQA 1GXDC 3R3OA 4K5VA 1B50A 2NYZD 4H13C 3NTKA 4V0BA 5M5XB 1FNVA 1SNMA 1HCZA 1VMPA 4CKCA 4KJOA 3GTPB 3K5OA 3M4OB 4OHJA 2QF7A 5FLXE 4LMQD 1KDCA 4DF7A 2XNAC 1TVXA 3ONAB 1RTOA 1TWFB 1EZ8A 1I3QB 4BY7B 3PUYA 3L7ZC 4NW2A 3J81L 4J8QA 1HRJA 1KAAA 4F7XA 2LY7A 2NUCA 3C46A 1S4ZA 4XTCS 4A3EB 2AUJD 2DNCA 3T53B 2JE6I 1HXYD 3WOFA 1II3A 3VR5A 3C3LA 3V96A 1SYDA 5M5WB 3VR6A 1RJTA 2RDGA 5CBEE 1SAPA 1MD2D 2Z1CA 5EKLA 2NVTB 1F9QA 2K05A 1O80A 4F8MA 2F0HA 5CMDA 3TP8A 1XXGA 1CQVA 2M9VA 1A3TA 3A8JE 5IGCA 1DOKA 5BN5A 2OF1A 2E2IB 1DYQA 2EE1A 4R9WA 1EL0A 2BCOA 3GTMB 4R8IA 3LWEA 2CW0D 4DAPA 4FXDA 2I46A 3C1EA 3VYTA 1TU2B 3TMEA 4J6HA 5HGTA 3P1HA 2B2YA 2KHSA 2KECA 4FF1A 2F0QA 2QCPX 1SNPA 2EVBA 1HFNA 1LTID 2B2TC 4JK1C 2BE5C 4K8JA 2B8GA 4RKBA 3GV6A 3I4NB 3NQTA 1H9SA 1KLUD 3S16B 4KI0A 1AFPA 4TRDA 2HCIA 5M3FB 2HQEA 2O2LD 2F0FA 1SNQA 1WVLA 4FNFA 4IUVA 4C3IB 2DY7A 5DEHA 5CC4A 4NP5A 4WRDA 1BXTA 4IN3A 3D4RA 2D9UA 2CQAA 3QJYA 1Z6HA 3I8ZA 1E2WA 5A2QE 4XDXA 4EQOA 5CV4A 4ZKBB 1NCVA 1Y1VB 3KBGA 2TSSA 1Y8NB 1TY2A 5E4XA 5CORA 1TWCB 2B2WC 1D5XC 2EYOA 4LK1C 4X3UA 1R4QB 5IT9E 3S17B 1B44D 3Q0AA 1WD1A 1QNKA 4U68A 2RVLA 1SE3A 4DK0A 4KTAA 2JA7B 2A68D 4KY5A 4G7OC 2OXPA 3W3AA 4RGMA 1CTMA 4RGOS 5C4HA 1DONA 1IL8A 3NTIA 1B2TA 3V05A 1YNJC 3FDTA 1MGSA 5AFWA 3HOWB 2PW7A 1GJXA 1Q1BA 3H3VC 2WKDA 4X3SA 1G91A 3IFDA 3QOLA 5KNDA 2WP8J 3KF8A 2F4IA 1STEA 3TP7A 1HQRD 5C44B 3M3YB 4OO1I 1C48A 1EY7A 1PYWD 3VR2A 1PRTC 4BBRB 1EOTA 5KNCA 4MN3A 2B2UC 3PUWA 5D3DA 5M3MB 1NR2A 3K5LA 1RD9D 1L0YB 1FYCA 4IFDH 4KHVA 3NPPA 1D5ZC 1MSGA 1O7ZA 2B2VC 4C3JG 3CRKC 1XX8A 1PTOD 3MXPA 4HTHA 5C0XG 5NUCA 2QEJC 1O7YA 2JXMB 3L9AX 4C3HG 1W6KA 2AQ1B 5C4ZA 4HCSA 3VR3A 2K5DA 2EYPA 1EYDA 3IKJA 2PPBC 3OIPA 2NTTA 5I2XA 2EJMA 2FMMA 2BOSA 5C4XB 1OXXK 1GUTA 5KRUA 2A73B 5C6AA 1WTOA 4L6TB 3PMFA 4KKUA 1FNUA 1AP0A 4O1NA 5IGBA 4I65A 2EYMA 1I4RA 3JAME 2YU9B 3S9WA 1SEBD 2F0GA 5IGEA 3NE5B 3I4LA 2IX0A 2PYKA 2N88A 3D4WA 5ELFA 3HOYB 4HSPA 2VXWA 4FXKC 3GTOB 1A3UA 3PUXA 4C3HB 1DD2A 2NZ1D 2CW0C 2XSCA 3T16A 4DAYA 4IQZA 4X3KA 1WCMB 2F1MA 5EPKA 1GOZA 1S5FD 3I4MB 1ZYRC 4ME5A 5LL6X 1D1IA 1JOKA 2WAQB 5JVG3 2F0OA 1IW7C 3H91A 1STHA 3LNNA 4ZK9B 4TKOB 2F0VA 1A3VA 2DY8A 3P75A 1EEFD 2MUYA 3HZXA 4QUCA 2J7ZA 3TP5A 5E1FA 3SR1A 1KDAA 2A6HD 5JPNC 1HHVA 2FHTA 3PIP3 5C3WA 2ZXOA 1W6JA 1EYCA 3H0GB 4H7BA 4RKLA 1H9MA 3FVQA 5C0XH 2JEAI 3MVVA 2FFKB 2NVYB 3LX0A 5ELCA 4IUUA 1BOSA 1SYCA 4BWGB 1ZKOA 1I6VC 2H1EA 1D1KA 1RF2D 2ZT9C 4DXFA 1WD0A 2K01A 5DM73 5JEAH 1LO5D 3Q23A 1O7LA 3NQIA 2F0IA 1SMYC 4PMBA 4BS9A 4BY1B 2B63B 2L12A 1LTGD 1SXTA 2A68C 4OIJA 2MGSA 4XQQA 2JA8B 3HKZB 1F2LA 2NTSA 2NWGA 1EY5A 4AYBB 1HUNA 1TS5A 4ZRZA 2XWJB 3J7YW 4KJNA 2B8FA 3SDZA 2PZTA 2J0TD 1A6XA 3MA2B 4FXGC 2D2CC 1M4VA 4XQJA 2F3VA 1TY0A 1IKLA 1WTPA 1PFMA 4O42A 2B2YC 1WTVA 2JSOA 1TQOA 3DUZA 3GTLB 3S1QB 4KY7A 3H09A 1CI3M 3OWFA 5KYIA 1PRTD 3MXNA 2A74C 4IZ8A 1ICWA 1RDPD 3MAQA 4H44C 1O78A 2RKSA 3PIO3 4IALA 4IUQA 1RTNA 4ULLA 1I4QA 3EROA 3VYRA 2EY6A 3ERQA 1WTWA 4HN7A 4K2LA 2QDBA 1PTOC 4CHTB 5HURA 5DM63 2K6AA 5D14A 1ILQA 1S5BD 1OXUA 3M7NA 1E0BA 3D4DA 2ZXRA 1R4PB 1RODA 4H0LC 2VNUD 1TS4A 3J80L 2SEBD 5IGDA 2J4XA 1I4GA 1RHPA 3NP8A 3SE0A 1CQFA 4RCNA 4PV1C 4K5XA 1LT5D 2F0KA 3I91A 3TN2A 3I70A 4RH6A 4CJ2C 2IX1A 3T51B 5E4WC 1VF7A 2Z4IA 2RBMA 1CZGA 1BCPB 3NK9A 4HMIA 2F3WA 1RKNA 1DM0B 4CKBA 1K8OA 5D65A 5JJZA 3Q6SA 1CA5A 4LAAA 1V1OA 3KLRA 1UUPA 3R8BA 1JC7A 2F0UA 2H4OA 3CRLC 4HEDA 1FNWA 1S5ED 4K14A 5KIXA 5FO7B 4ZKCB 4OL7A 1GUSA 1AZPA 5F2DA 3S14B 1STNA 3Q24A 2HUGA 1BO0A 1GHKA 1G2TA 1SDFA 1CHQD 2EYJA 3FKIB 1X3QA 2HCCA 3DWAA 4KD4A 1XWEA 3SK5A 4CGYB 1TS3A 3X3NA 5BN4A 1ZYRD 4KKSA 4BA2I 3PO3B 4N9TA 1JICA 3DEOA 3OOCA 4FYDA 5FLXL 2VB2X 1EZ6A 2SNMA 4MIUA 1IW7D 4Q0FA 1GHJA 2C5CA 4BBSB 1STBA 2G9DA 1TWHB 4RAUC 1F2ZA 5CGKA 3NUCA 3HGBA 3DWPA 2K1BA 4V190 1D5MC 2MJ8A 2Z4HA 2A6ED 2A6HC 3K5NA 1STYA 2IT1A 4IFDG 1QWYA 1EQVA 2V4DA 2Q8IB 3K57A 2PMZB 4X3TA 1STAA 1IYUA 3ITPA 3FMCA 1SSOA 2NN6I 4RWSC 3K59A 3QO2A 3E6ZX 5I6WA 5LHY1 5I2YA 5EJWA 3KK7A 4RHRA 3SK4A 2F0NA 4G4KA 3SHLA 3BDLA 2JEBI 4JBWA 2HDLA 1U4MA 4PMWA 4A3KB 4S3SA 3M4YA 1G8ZD 3HG9A 1LV9A 5FO9B 1OXTA 3HOXB 1WTRA 1YNND 2NBFA 3D6CA 2ID0A 3KLSA 3SVMA 1QCBD 1S5CD 5C4JB 1X32A 2K32A 5DNFA 1JR0D 1SMYD 3AB9A 2JA5B 2LS01 3T56B 3VYUA 3WDNA 1ONLA 2XRQD 1B3AA 5FKAC 4Q5VA 2EY5A 3E5SA 1Q90A 1SFOB 1F9PA 4FP5D 3TZUA 4CJ1B 2R6GA 1EY6A 5K36H 3DWQA 1STGA 4XYOA 3EA6A 1JORA 3E0JA 1ET6A 4IFDJ 4ZAIA 1F2YA 3I90A 4A3JB 5JPMC 1XYIA 3GTQB 3CQZB 2LFNA 3MXUA 4M8AA 2F03A 2KEDA 1QE6A 3ZYYX 1ET9A 3K58A 5FK9C 3RUZA 1EWHA 3WOEA 1JOQA 4UAIA 1Q1EA 2PQEA 5A2QL 3N6RA 1LT4D 4ZYSA 2C9OA 4B9WA 2SOBA 3BVGA 4LJZC 3OPOA 1RCVD 3J7AF 5CV8A 2KCNA 1UAPA 2YYZA 4XQNA 2PCFB 2TMPA 2ENBA 3S1MB 5IT9L 5D3IB 2RDHA 4DXGA 3MHBA 2EY1A 2B39A 3SK8A 3QOJA 3EVQA 3GV3A 2CVRA 4B9XA 2XWBB 1GUWA 2IL8A 4A3GB 1BDOA 5EBDA 2K28A 4MHEA 2A69C 1NSNS 3QWNA 2VB3X 4DGZA 2Y0SB 4OIKA 5JEAG 2R92B 5KEEA 2VUMB 1V8QA 1GUGA 4HAEA 2F0SA 1JE4A 5CV9A 1ESRA 2CHBD 4ZLTF 1EY9A 4IUTA 5I6YA 3AU7A 1OO9B 1E2ZA 5CYUA 4RA8A 2RSNA 1I4XA 1VMCA 3K5MA 4C3JB 2PZWA 5I9OA 3F2UA 1EY8A 3MTSA 3P7JA 2EZVA 2R3ZA 4G57A 2KVMA 4BA1I 2RA4A 1B1ZA 1HPCA 1KNEA 2O4XA 4YIJA 1I50B 2RSOA 3KLSX 2PNRC 2NVQB 4L8JA 3V2TA 1PZID 1U9RA 3RD4A 3TZDA 4Z9CB 5C0XJ 4QIWB 2ICIA 2M2LA 4QF4A 1J8IA 2R93B 3R93A 1PRTF 4HCEA 5COYA 4PNYA 4F87A 2IW3A 1KNAA 5G3LD 2DN8A 2A6EC 5JEAJ 4IURA 5JAVA 3S15B 1PZKD 3GTJB 5EGTA 1K8MA 3VR4A 2HDMA 4TQUS 3PV0A 2EDGA 1SNDA 4DAVA 4QCLA 1Y69U 5M5YB 1SYGA 2K04A 4OO1H 5CV7A 2OEOA 3HOZB 3A7LA 3IFTA 2NB0A 5FOBB 2SDFA 1NR4A 5CR3A 5KGUA 1TWAB 3JAML 5K5PA 1I4PA 3K0YA 4A3BB 2O5IC 2E74C 3BG3A 2FJ2A 3I73A 2AUKA 3DMUA 3BDCA 1CA6A 4EQPA 2K7VA 1YNNC 4K5WA 4XT1B 1BCPD 4IUPA 1V1PB 2WINB 1QOHA 2E2HB 3OWEB 1DXMA 4KV6A 4ZUIA 2NVXB 1LLRD 5EKKA 4K6DA 1AN8A 1V43A 1I6HB 3OIQA 3FPPA 1LT6D 2JA6B 1DOMA 3FRPB 1PFNA 2K33A 1SNCA 3PUVA 4CBVA 3J81E 3VYSA 1SE2A 2F0TA 1JWUD 1OXSC 3T13A 1AW7A 4RGTA 2R7ZB 1SYFA 1Z47A 5EBCA 4KMUC 1PFBA 2EPBA 1CHPD 2D5DA 1HQMC 3U9OA 5E3FA 2RQXA 3A7AB 1GUNA 3KUPA 1ENAA 4QMGA 3OMCA 2L4NA 3NXWA 2DNEA 1PTOH 3U9SA 4EGVA 2EOTA 2FINB 2IJ0A 1DZ1A 1A15A 5J22A 4C56C 2MPMA 3HS0C 5JVH3 5LL6S 4M1UB 1CT1D 1B53A 4XT3B 1B4OA 4DU9A 4TSSA 4KHZA 2JYOA 4FVMA 3GTKB 1Q8IA 2KCCA 1BBXC 1A2TA 4QUFA 1SNOA 2L0CA 3G6JB 3SXHA 3DXJC 5JOBA 2LKVA 1R9TB 1H9KA 5KYLA 3C2PA 1FR3A 5C5MA 3RMHA 3O13A 3P20A 1IYVA 2A69D 1C8CA 4DNRB 2KOLA 4HSVA 2L5TA 4GZYC 2L11A 1HUMA 4K8IA 5EPLA 5TSSA 3BVMA 1ENCA 5DAUA 4WJWA 1KABA 4G7ZC 1E2VA 3GD7A 3QIAA 4KKTA 4ZUJA 4Y7NB 4NDXA 1PZJD 2EYHA 1TT2A 3BYTB 2K5WA 3NWTA 1SBBB 3EJIA 1KTKA 3HOVB 1HTPA 4DN4M 5K36G 1TIID 2D62A 2KUMA 3NWSA 3MZ5A 1G291 2PW5A 3FPUB 2IPKD 1CZWA 2PO4A 1AZQA 1VDZA 4C3IG 2QILA 4CKEA 2BDNA 4FO2A 3NTHA 2LMCB 3J7AV 2SNSA 2AWNA 3GO5A 4WORA 3DEPA 2M00A 2E76C 4IFDI 1H9RA 3CU7A 1PLFA 2IX3A 3HRZC 2XIWA 1AEXA 3EFXD 1WTXA 1Y8OB 3D6WA 3HEJA 4XYQA 1FD7D 2L9HA 1WTQA 5J39A 5A35A 1KLGD 5EPJA 3AMUA 1BR9A 1F9SA 3PUZA 2F0LA 3MFGA 4DNTB 1PRTB 1SE4A 4K6LA 1JCKB 5IGGA 3M7GA 2EY2A 3H6MA 3SK6A 1QG7A 4B08A 2MP1A 3LWUA 1X3PA 4C1NI 3RZDB 3BZDB 1EU3A 5I4DA 1L0XB 2L55A 5CV6A 4J1MA 1OXVA 1CM9A 1PTOF 3A55A 4PMCA 1KDBA 4NKLA 4KD3A 3ND8A 2BA1A 4KK7A 1JOOA 1UNSA 5C3EB 2KJXA 2RDFA 5IOCA 3MEHA 2IWHA 4P2CB 1H9JA 3FEWX 1G2SA 1DOLA 1ENFA 2EJFC 1J9OA 1EIGA 1DCZA 1LTAD 1BCPC 4KN7C 5ISRA 4EQNA 4L63B 3GTGB 2KQ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F0S A;  5HUR A;  1A3U A;  1SYG A;  4MIU A;  5C3X A;  5CV9 A;  4NP5 A;  4E6I A;  4WRD A;  1STG A;  1EY9 A;  5CV7 A;  5J1Z A;  2OEO A;  2F0E A;  5I6Y A;  1SYB A;  3OMG A;  1STB A;  3D4D A;  2F0I A;  4ID6 A;  1F2Z A;  4PMB A;  2EYL A;  1II3 A;  3NUC A;  4HMJ A;  5CR3 A;  2PZU A;  3C1F A;  5CV4 A;  4IUN A;  4EQO A;  5K5P A;  5CC4 A;  5KGU A;  4N9P A;  1F2Y A;  1SYD A;  2SNS A;  5IGD A;  5IOD A;  3T16 A;  4DU9 A;  3QB3 A;  4WOR A;  3NP8 A;  3D8G A;  4DFA A;  1STY A;  4K5X A;  1EY5 A;  2F0W A;  3DMU A;  4QB4 A;  2F0K A;  3BDC A;  4NMZ A;  2M00 A;  5EKL A;  4EQP A;  1EQV A;  1F2M A;  1A2T A;  5IGF A;  4ME5 A;  1SNO A;  2EYO A;  2PZW A;  4K5W A;  5I9O A;  1STA A;  1AEX A;  3ITP A;  1EY8 A;  4KJN A;  2RBM A;  4F8M A;  3NK9 A;  4KHV A;  4ODG A;  4HMI A;  3SXH A;  5CGK A;  1JOK A;  3HEJ A;  1NUC A;  2F3W A;  4G57 A;  3RUZ A;  2F0H A;  2F0O A;  3DHQ A;  1JOQ A;  1RKN A;  5I6W A;  1STH A;  2PZT A;  3R3O A;  5JOB A;  2LKV A;  4K5V A;  3TP6 A;  3TP8 A;  3OSO A;  3MXP A;  2F0V A;  4HTH A;  1A3V A;  2PQE A;  5J39 A;  3P75 A;  3SK4 A;  5NUC A;  2F0N A;  2O4X A;  4YIJ A;  3SHL A;  4LAA A;  4KV6 A;  1A3T A;  4ZUI A;  5IGC A;  5KYL A;  2F0L A;  1SNM A;  2F3V A;  2OF1 A;  3HZX A;  1EY0 A;  4K6D A;  5EKK A;  5C5L A;  3BDL A;  5C5M A;  2SOB A;  4B9W A;  5IGG A;  5IIF A;  2F0J A;  3V2T A;  5C4Z A;  2F0U A;  1U9R A;  2EY2 A;  4KTA A;  4R8N A;  4S3S A;  3H6M A;  5KIX A;  3SK6 A;  2EYP A;  4K14 A;  1EYD A;  1SNC A;  2EYF A;  3C1E A;  4KY5 A;  4KJO A;  4KY6 A;  5CV8 A;  3TME A;  3TP5 A;  2F0D A;  4J6H A;  5E1F A;  4OL7 A;  1KDA A;  3SR1 A;  2F0T A;  5HGT A;  1EY4 A;  3P1H A;  2OXP A;  5I9P A;  4ZQ3 A;  1TQO A;  2KHS A;  2ENB A;  5F2D A;  3T13 A;  2F0Q A;  1STN A;  1SYF A;  4K8I A;  5C3W A;  3NHH A;  5CV6 A;  5C4H A;  1ENC A;  4J1M A;  1KDC A;  4KY7 A;  1EYC A;  5DAU A;  5KRU A;  1KAB A;  3D6C A;  4H7B A;  4DF7 A;  5C6A A;  4PMC A;  3OWF A;  1KDB A;  3MHB A;  4QF4 A;  5KYI A;  1SNP A;  3PMF A;  4ZUJ A;  4NDX A;  2EY1 A;  4NKL A;  3SK8 A;  3QOJ A;  4KD3 A;  3U9O A;  3EVQ A;  2PW7 A;  5E3F A;  4RKL A;  1JOO A;  1IHZ A;  4IZ8 A;  5IGB A;  1ENA A;  4QMG A;  2RDF A;  2EYH A;  1EZ8 A;  1TT2 A;  4I65 A;  4PNY A;  4EVO A;  4K8J A;  3MVV A;  4B9X A;  2EYM A;  2F0M A;  2EXZ A;  3OMC A;  4RKB A;  1EYA A;  3NQT A;  3QOL A;  5IOC A;  1TR5 A;  2RKS A;  3EJI A;  2EYJ A;  3MEH A;  4IAL A;  2WAC A;  3S9W A;  3LX0 A;  5JAV A;  3NXW A;  1A2U A;  4TRD A;  1NSN S;  4KD4 A;  2F0G A;  2F0P A;  4DGZ A;  3SK5 A;  5EGT A;  1JOR A;  3ERO A;  5IGE A;  1KAA A;  2HQE A;  1SYC A;  2F0F A;  2EY5 A;  2EY6 A;  5CV5 A;  3E5S A;  3TP7 A;  4F7X A;  5KEE A;  5ISR A;  4EQN A;  2PYK A;  1SYE A;  4N9T A;  3ERQ A;  3D4W A;  1SNQ A;  2NUC A;  1SND A;  3MZ5 A;  5J22 A;  5M9O A;  4K2L A;  4K2K A;  3VA5 A;  1EY6 A;  2PW5 A;  2QDB A;  1EZ6 A;  2KQ3 A;  1EY7 A;  5DEH A;  2SNM A; 
#chains in the Genus database with same CATH topology
 4DUZ L;  3D3R A;  1V1P A;  2NN6 G;  1D8L A;  3K7A B;  1KQS A;  1SYB A;  3OMG A;  1VQH A;  2WB1 G;  1KIX A;  3OHX C;  1VCI A;  3OYY A;  3R2I A;  4JYA L;  3ND9 A;  1SRO A;  2EJG C;  1M8A A;  3D8G A;  3NBH A;  2DJG C;  1MBY A;  3I3C A;  4NMZ A;  2AQ3 B;  1MJC A;  2MO1 A;  3JAM c;  3I4N H;  3PO2 B;  3HOU G;  3S16 H;  4DUZ Q;  1D2B A;  5IP7 H;  4JI0 Q;  1EOV A;  3TBI B;  4ODG A;  4LFC L;  5M3F H;  1ESF A;  1MSH A;  1VQN A;  1QJO A;  4LF6 L;  1J6Q A;  4FF2 A;  4C3I H;  4JYA Q;  2Q8T A;  1VQK A;  2IHE A;  2KEE A;  2FMC A;  1F9R A;  3G4S A;  2F0J A;  3BU2 A;  4R8N A;  3A8I E;  1C4Q A;  2XRS D;  2JK8 A;  3BS1 A;  4DR5 L;  4JCV E;  3J81 j;  2F0D A;  4A4I A;  3F8T A;  4ZQ3 A;  2DJF C;  2E2J B;  3A54 A;  2KA7 A;  4GKK Q;  1G51 A;  4LFC Q;  1Y1V H;  4LUV A;  3EQL C;  3K81 C;  4LF6 Q;  1HA5 A;  4RGN A;  4NB3 A;  1TWC H;  2IHF A;  4KN4 C;  2JP1 A;  5C0X I;  1Z7T A;  2WB1 B;  3DM1 A;  1G6Z A;  2WAQ E;  3UI2 A;  4HIM A;  5C4X G;  3K7A H;  1EFI D;  4EVO A;  4JC0 A;  2OT2 A;  5ELD A;  1VF5 C;  2ZXP A;  3IRB A;  5G3L F;  2Q2T A;  3S17 H;  2WAC A;  4DK1 A;  4DR5 Q;  4A3I G;  3CHB D;  2B2T A;  1A2U A;  1TS2 A;  3KBX A;  5EQ0 A;  2AWO A;  4DV2 L;  1NTG A;  4A3M G;  1LAC A;  1LUZ A;  1XTC D;  5CV5 A;  3HOU B;  4OO1 G;  3VA7 A;  5M9O A;  1CK1 A;  2JA7 H;  3A0J A;  4RFB A;  3N52 A;  3H94 A;  3URY A;  1K0R A;  1EQT A;  4E6I A;  1I4H A;  1Y8P B;  3E0E A;  3GQB A;  3HOY G;  1QIL A;  3X3M A;  1Q7Y C;  2D0O A;  1SJE D;  5IYC H;  5ELN A;  4IUN A;  1ZXT A;  2Z0S A;  3CCM A;  1HTL D;  1X55 A;  3A8K E;  4ZCK A;  5IOD A;  4U67 3;  3BJU A;  1SN8 A;  4DV2 Q;  3HOW H;  3MXG A;  1MI2 A;  2G9H D;  3HP3 A;  4MTK A;  1QVF A;  1F2M A;  1CKN A;  1WCM G;  1QB5 D;  3CCS A;  1A0I A;  2BDO A;  4A3D G;  1BCP F;  2B2W A;  2ZJQ A;  4LF4 L;  2O5J C;  2I07 B;  3TP6 A;  4JI1 L;  2MHV A;  3OSO A;  2NN6 H;  3S2D B;  3M3Y H;  1U4L A;  2DUD A;  1B9M A;  4A76 A;  3BVZ A;  4GNX C;  2HQL A;  4G7H C;  4XIG S;  5BR8 L;  4L5S A;  2VW9 A;  5ELE A;  5IIF A;  3M85 A;  4A3I B;  2N49 A;  4R4C A;  1PFS A;  1LTT D;  2FXQ A;  2X69 A;  1UEA B;  2X6G A;  4C1N K;  1ZEQ X;  4BBR H;  2NZO A;  1U4P A;  4A3M B;  2OCE A;  2EYF A;  4LNQ A;  1PDQ A;  3HKZ E;  4RG1 A;  5I9P A;  1EY4 A;  3IL8 A;  3K6O A;  5HY6 A;  1YJN A;  5M3M H;  4AYB E;  4PZ7 A;  2E75 C;  5ELB A;  4LF4 Q;  3HOU H;  4ABN A;  4JI8 L;  4LUZ A;  1CKO A;  3M4Q A;  3GP7 A;  1JWM D;  1PH7 A;  1XNR L;  2KHJ A;  4HIO A;  3H0G G;  3TDQ A;  5BR8 Q;  3CC2 A;  3W2D A;  4HR7 B;  3R2T A;  5EKI A;  3A56 A;  2F0M A;  2EXZ A;  1TR5 A;  4ILW A;  1T5X D;  1K83 B;  1TKW B;  4MZ9 A;  2F0P A;  4UPA A;  3MC0 B;  1BQQ T;  2Q8R E;  1SYE A;  3OW7 A;  2R7F A;  3NBI A;  2E2D C;  3D0F A;  4JI8 Q;  1HA6 A;  4K2K A;  3VA5 A;  1S72 A;  4A3D B;  2Z8L A;  4DV4 L;  3SEB A;  1NMG A;  4KY6 A;  4DA2 A;  1XNR Q;  2MFI A;  3TSS A;  2B3G A;  1GUO A;  3L3O C;  4F88 A;  1KHI A;  2F52 A;  1LAB A;  1VQC A;  4I7Z C;  4A3F B;  4R1J A;  2XVS A;  3QG1 A;  4ID6 A;  4UDU C;  3CCR A;  3D31 A;  3S2H B;  3C1F A;  5C4X H;  3ERS X;  1VQP A;  2L1B A;  3W1B A;  3K0X A;  1H9S B;  2K03 A;  3QB3 A;  2BE5 D;  1X3G A;  2ZTE A;  4R4T A;  4DFA A;  4C2M B;  1TWG B;  4A3I H;  2B63 G;  1GD7 A;  1CFM A;  2R61 A;  1VQA A;  1EIY B;  2B2U A;  4DV4 Q;  5IGF A;  4A3M H;  3T4A C;  1ASY A;  2YU9 H;  4OX9 L;  4RCO A;  4PQX A;  3LGJ A;  4A93 G;  1HNX L;  4R4Q A;  1NUC A;  3UDX A;  1ML0 D;  3NSW A;  4DR1 L;  1Y1W G;  1L1O A;  2GA4 B;  4IPH A;  3S1N B;  3HOY H;  1PTO B;  3PIO A;  2H5X A;  1WOC A;  1KRS A;  2B2V A;  1PMR A;  2WII B;  1BNZ A;  3GTO H;  3Q8D A;  5C5L A;  1EY0 A;  2A5H A;  4OGQ C;  2K4K A;  1X3F A;  1VQ4 A;  2X6L A;  2BA0 A;  2F4V L;  1LTR D;  1K83 H;  1MJE A;  4OX9 Q;  1EIH A;  1EWC A;  1YHQ A;  3NHH A;  1JWS D;  1WCM H;  1D6E C;  1BKB A;  1HFG A;  1Q12 A;  3F2D A;  1PXU A;  1T5E A;  1JB3 A;  1BF4 A;  1B9N A;  3MWY W;  4XXE A;  1IKM A;  3OW2 A;  1IHZ A;  5T1I A;  4YCU A;  4YHH Q;  3BDO A;  4DUY L;  1L0W A;  3AQQ A;  2QKI C;  1EYA A;  1K8A C;  4CDD C;  4PZ6 A;  3G7L A;  3J80 E;  1KL9 A;  2F4V Q;  4P74 A;  4FF3 A;  3M9B A;  4WFN 3;  1QZH A;  1EYG A;  3RZO B;  2N55 A;  3KJO A;  5BN3 A;  1SJH D;  3CKI B;  2WV6 D;  2YTV A;  1QNU A;  1EU4 A;  3BYY B;  3E9I A;  3U58 A;  1WJJ A;  1FGB D;  5T1G A;  4A93 B;  1P16 A;  4IJL A;  1F77 A;  4NXM L;  1EEI D;  5C3X A;  1Y1W B;  5KNB A;  1LT3 D;  3I72 A;  5J1Z A;  1S5D D;  4DUY Q;  2F0E A;  5L37 A;  3Q22 A;  3NEM A;  3S1R B;  1YNJ D;  2EYL A;  4HMJ A;  3H0G H;  2PZU A;  4CJ0 B;  1U4R A;  3CD6 A;  4N9P A;  2XN9 C;  1NAP A;  2ICE C;  1Q3L A;  3KF8 B;  3MFY A;  1ILP A;  4YWL A;  3PSI A;  1LTS D;  1DJR D;  2F0W A;  4QB4 A;  4POF A;  5CBA E;  4FF4 A;  3RLF A;  2K5Q A;  2NVY H;  4YWK A;  2AQ2 B;  3ULJ A;  4NXM Q;  1NE3 A;  1JQY D;  3IAY A;  5HGQ A;  3WWV A;  4RHS A;  1YJ9 A;  1MIU A;  5FO8 B;  4RMF A;  1BUV T;  4A3E G;  1LTB D;  2PI2 A;  2WKC A;  3DHQ A;  1N32 L;  2NZH A;  1GXD C;  3R3O A;  4K5V A;  2F3I A;  1B50 A;  1Q8K A;  2NYZ D;  4L5Q A;  1CSQ A;  4H13 C;  3NTK A;  4V0B A;  5M5X B;  2L15 A;  1FNV A;  2VQE L;  1SNM A;  1HCZ A;  1VMP A;  4CKC A;  2V1C C;  4KJO A;  1PH1 A;  4BY1 H;  2B63 H;  3H3V I;  4JI3 L;  3GTP B;  4X6A H;  3K5O A;  2JA8 H;  4QJF A;  3M4O B;  4OHJ A;  2QF7 A;  5FLX E;  4LMQ D;  2VL6 A;  1N32 Q;  1KDC A;  2PMZ E;  4DF7 A;  3PGZ A;  2XNA C;  1A8V A;  1TVX A;  2VQE Q;  1KD1 C;  2XGT A;  3ONA B;  1RTO A;  4P71 A;  4PZ8 A;  1TWF B;  4OEL B;  1EZ8 A;  1I3Q B;  4BY7 B;  1NMF A;  3S1R H;  3PUY A;  3L7Z C;  1DGS A;  4NW2 A;  3UE0 A;  1HZA A;  1VS0 A;  4BXX G;  4JI3 Q;  4X65 L;  3J81 L;  4J8Q A;  1HRJ A;  1KAA A;  3ULL A;  4F7X A;  2LY7 A;  4DV6 L;  2AMC B;  2OTL A;  2QA4 A;  2NUC A;  3C46 A;  1S4Z A;  4XTC S;  4A3E B;  4GLX A;  1YNX A;  2AUJ D;  2DNC A;  3T53 B;  3L0O A;  2JE6 I;  1Y14 B;  1HXY D;  3S1Q H;  3WOF A;  1II3 A;  3VR5 A;  3C3L A;  3V96 A;  4J15 A;  1QVG A;  5JJI A;  1SYD A;  5M5W B;  3VR6 A;  4BBS G;  4X65 Q;  1RJT A;  2RDG A;  5CBE E;  1SAP A;  2VQF L;  1MD2 D;  1N33 L;  3RLN A;  4DV6 Q;  2Z1C A;  1J5E L;  3GDE A;  4DR6 Q;  5M3F G;  5EKL A;  4WJ3 M;  2NVT B;  1YEZ A;  1F9Q A;  2K05 A;  4QY7 A;  1O80 A;  4F8M A;  2F0H A;  5CMD A;  1HNZ L;  3TP8 A;  1P8L A;  1XXG A;  4DK6 C;  1CQV A;  2M9V A;  1A3T A;  3A8J E;  4JOI C;  5IGC A;  1DOK A;  5BN5 A;  2OF1 A;  3G6E A;  4DAY B;  2E2I B;  2VQF Q;  1TWF H;  1DYQ A;  2EE1 A;  1HJP A;  4R9W A;  1N33 Q;  1EL0 A;  2BCO A;  3GTM B;  2BH8 A;  4R8I A;  1J5E Q;  1Y1V G;  3KDF B;  3LWE A;  2CW0 D;  4DAP A;  3T1H L;  2HD3 A;  4FXD A;  2I46 A;  3C1E A;  3VYT A;  1TU2 B;  3TME A;  4J6H A;  5HGT A;  3P1H A;  3UDI A;  4LF7 L;  2B2Y A;  2KHS A;  2KEC A;  4FF1 A;  2F0Q A;  1SLJ A;  1HNZ Q;  5JJL A;  2QCP X;  3HKS A;  4A3E H;  1SNP A;  2EVB A;  3T1Y L;  1XNQ L;  1Q46 A;  1HFN A;  4X62 L;  1LTI D;  2B2T C;  4JK1 C;  2BE5 C;  4IPC A;  4K8J A;  2B8G A;  2UU9 L;  4RKB A;  3GV6 A;  3I4N B;  4DR4 L;  3NQT A;  3B6Y A;  2N8N A;  3T1H Q;  1H9S A;  1KLU D;  4JI7 L;  3E3X A;  3S16 B;  4KI0 A;  1AFP A;  5JJK A;  4TRD A;  2HCI A;  2JA7 G;  4LF7 Q;  5M3F B;  2HQE A;  2O2L D;  2F0F A;  1SNQ A;  3G71 A;  4JPB W;  1WVL A;  1Z9F A;  4FNF A;  4IUV A;  1KAW A;  4DKA C;  4C3I B;  1YJW A;  3F2B A;  4POG A;  4QGU A;  2DY7 A;  5DEH A;  5CC4 A;  4YWM A;  1IBM L;  4NP5 A;  2YTX A;  4WRD A;  1BXT A;  4X62 Q;  1N36 L;  4IN3 A;  3D4R A;  2D9U A;  2CQA A;  3MEF A;  1Z6H A;  3QJY A;  3J81 i;  2UUC Q;  2UU9 Q;  3HOW G;  3S14 H;  4DR4 Q;  3I8Z A;  3CXC A;  1E2W A;  5A2Q E;  1Q86 C;  4XDX A;  4EQO A;  4JI7 Q;  5CV4 A;  4ZKB B;  1NCV A;  2GVB A;  1Y1V B;  3KBG A;  5FLM H;  2TSS A;  1Y8N B;  1TY2 A;  5E4X A;  4BXX H;  5COR A;  1TWC B;  2B2W C;  2CQO A;  4IPG A;  1D5X C;  2LXK A;  2EYO A;  3FKI H;  5C44 G;  4LK1 C;  2Y0S E;  4X3U A;  1IBM Q;  1R4Q B;  4YCV A;  1N36 Q;  4HJ7 A;  5IT9 E;  3S17 B;  1B44 D;  3PO3 H;  2YV5 A;  3Q0A A;  2Q2U A;  1WD1 A;  4O0A A;  4BBR G;  3NEL A;  1BVS A;  1QNK A;  4U68 A;  2RVL A;  1QUQ B;  1SE3 A;  4DK0 A;  4KTA A;  4BBS H;  5M3M G;  2JA7 B;  2AHO B;  2A68 D;  1TWH H;  4KY5 A;  4G7O C;  1IZ6 A;  2OXP A;  4A75 A;  3W3A A;  2K5V A;  4RGM A;  1CTM A;  4RGO S;  5C4H A;  1DON A;  1IL8 A;  3NTI A;  3KLW A;  1B2T A;  3V05 A;  1YNJ C;  3FDT A;  2VZA A;  1MGS A;  4DK3 C;  5AFW A;  3HOW B;  2PW7 A;  4CDE C;  1GJX A;  1Q1B A;  1AH9 A;  3H3V C;  2WKD A;  4X3S A;  1G91 A;  4JOI A;  2JN4 A;  4LW1 A;  3IFD A;  3QOL A;  5KND A;  2WP8 J;  3KF8 A;  5IYB H;  1LM0 A;  1VQL A;  2F4I A;  1BBW A;  1STE A;  3TP7 A;  1HQR D;  5C44 B;  2CWP A;  3CF5 A;  4B3S L;  4WJ4 A;  1S3O A;  3M3Y B;  4OO1 I;  4A3K H;  2Y0S G;  1C48 A;  5IY0 A;  1EY7 A;  4B3R L;  1PYW D;  4ALP A;  4QIW E;  3VR2 A;  3MXN B;  1PRT C;  3PQI A;  4BBR B;  1EOT A;  3KJP A;  1VQM A;  1UE6 A;  5KNC A;  4MN3 A;  2Z6K A;  2B2U C;  3PUW A;  5D3D A;  5M3M B;  5C4J H;  1EQQ A;  2K14 A;  1VQ7 A;  1NR2 A;  3K5L A;  4B3S Q;  4JI5 L;  1FVI A;  1XJV A;  1RD9 D;  1L0Y B;  2GN5 A;  4LF8 L;  1D7Q A;  4CDC C;  1FYC A;  1L1O C;  4B3R Q;  4IFD H;  4KHV A;  3H15 A;  3NPP A;  3U4Z A;  1D5Z C;  1MSG A;  1O7Z A;  2B2V C;  4C3J G;  1L2F A;  1TXY A;  1YVC A;  2EIF A;  3CRK C;  1XX8 A;  1SFO H;  1PTO D;  3MXP A;  4HTH A;  4NXN L;  5C0X G;  4L5T A;  5NUC A;  2QEJ C;  1O7Y A;  2JXM B;  3L9A X;  4C3H G;  1W6K A;  4UY8 C;  2AQ1 B;  1JJ2 A;  3CPW A;  1VQI A;  5C4Z A;  3TRE A;  4HCS A;  4JI5 Q;  3VR3 A;  3EIV A;  2K5D A;  3CC4 A;  2EYP A;  5IYD G;  1WTH A;  4LF8 Q;  1EYD A;  2N3S A;  3IKJ A;  2PPB C;  2C35 B;  3I4M G;  4A3J H;  3OIP A;  2NTT A;  5I2X A;  3GTQ H;  2EJM A;  5C44 H;  1Q81 C;  3CQZ H;  1EUJ A;  2FMM A;  2BOS A;  5C4X B;  1OXX K;  1GUT A;  5KRU A;  2A73 B;  5C6A A;  1WTO A;  4L6T B;  4NXN Q;  2WAQ G;  2MQH A;  3PMF A;  4KKU A;  3UDF A;  2OTJ A;  1FNU A;  1AP0 A;  1SE8 A;  4O1N A;  5IGB A;  4I65 A;  1JB7 A;  2EYM A;  2QW7 A;  4GN3 B;  1I4R A;  2CH4 A;  3JAM E;  3M4P A;  2YU9 B;  3S9W A;  1SEB D;  2F0G A;  5IGE A;  3NE5 B;  3I4L A;  4JG2 A;  2IX0 A;  4UP8 A;  2I5M X;  2PYK A;  4JI1 Q;  2N88 A;  3D4W A;  5ELF A;  2Q2H A;  3HOY B;  1G6P A;  4HSP A;  2VXW A;  4FXK C;  3GTO B;  1A3U A;  3J81 c;  2N78 A;  3PUX A;  3AEV A;  4HIK A;  3ER0 A;  4C3H B;  2ZTD A;  1DD2 A;  2NZ1 D;  1C0A A;  2CW0 C;  2XSC A;  3T16 A;  4DAY A;  3HOZ G;  4EQ5 A;  2OWO A;  3CMA A;  4OWT B;  5GQO A;  4IQZ A;  4X3K A;  1WCM B;  4OEM B;  2F1M A;  3KDF A;  3RR5 A;  4A3C H;  5EPK A;  1GOZ A;  1S5F D;  3I4M B;  1ZYR C;  4ME5 A;  5LL6 X;  1D1I A;  1JOK A;  2WAQ B;  5JVG 3;  2F0O A;  1IW7 C;  3H91 A;  1STH A;  2R92 H;  3W5O A;  2UXD L;  3LNN A;  2VUM H;  4ZK9 B;  4TKO B;  2F0V A;  1A3V A;  5ELO A;  2DY8 A;  3P75 A;  1I5F A;  2CWA A;  1PV4 A;  1EEF D;  4BY1 G;  2MUY A;  3HZX A;  2JA8 G;  4QUC A;  2J7Z A;  3HKZ G;  2PNH A;  3TP5 A;  5E1F A;  3SR1 A;  4AYB G;  1KDA A;  2OQ0 A;  2A6H D;  5JPN C;  1E24 A;  1HHV A;  2FHT A;  3PIP 3;  5C3W A;  2ZXO A;  1GVP A;  1W6J A;  1EYC A;  3H0G B;  2UXD Q;  4H7B A;  5LMN L;  1V1Q A;  4HJ5 A;  4C3J H;  1CSP A;  4RKL A;  1H9M A;  3FVQ A;  1K8G A;  5C0X H;  2JEA I;  3MVV A;  2FFK B;  2NVY B;  1EFW A;  3OTO L;  1UEB A;  1B8A A;  4C3H H;  3LX0 A;  4IUU A;  5ELC A;  1HNX Q;  1BOS A;  1BBU A;  1SYC A;  5IYD H;  4DR1 Q;  4DV5 L;  4BWG B;  4X64 L;  2NVQ H;  1ZKO A;  1I6V C;  2H1E A;  1D1K A;  1RF2 D;  2ZT9 C;  3I4M H;  1EIF A;  4DXF A;  1WD0 A;  2K01 A;  5DM7 3;  5JEA H;  1K3B C;  1UE1 A;  1LO5 D;  4YCW A;  1CKM A;  3Q23 A;  3RN2 A;  1O7L A;  3NQI A;  2F0I A;  3OTO Q;  1SMY C;  4PMB A;  4UP7 A;  4BS9 A;  4BY1 B;  2B63 B;  2QEX A;  2L12 A;  1LTG D;  1SXT A;  2A68 C;  4OIJ A;  2MGS A;  1W3S A;  4XQQ A;  2JA8 B;  3HKZ B;  2K50 A;  2R93 H;  1F2L A;  1QUQ A;  2HT1 A;  2CH4 W;  2NTS A;  2NWG A;  4DV5 Q;  1GKH A;  5IWA L;  4X64 Q;  1EY5 A;  1PYS B;  4AYB B;  1HUN A;  1TS5 A;  4ZRZ A;  2XWJ B;  1NNX A;  4GOP B;  3I4O A;  3J7Y W;  1VQO A;  4KJN A;  1PH6 A;  4JVZ A;  3S15 H;  1JT8 A;  2B8F A;  3GTJ H;  3SDZ A;  1PYB A;  2PZT A;  1VQG A;  2J0T D;  1A6X A;  2UXB L;  3MA2 B;  4FXG C;  1VQF A;  2D2C C;  3CW2 C;  1M4V A;  4XQJ A;  5M5Y H;  2F3V A;  1TY0 A;  1IKL A;  1WTP A;  5IWA Q;  1PFM A;  4O42 A;  3HOZ H;  2B2Y C;  1B7Y B;  5GRO A;  2ASB A;  1WTV A;  1TWA H;  1PH2 A;  4A3B H;  2JSO A;  1TQO A;  3DUZ A;  3GTL B;  3S1Q B;  3CCU A;  4KY7 A;  1XTD A;  1PH3 A;  2PQA B;  3H09 A;  1CI3 M;  3OWF A;  2UXB Q;  5KYI A;  1PRT D;  3MXN A;  2A74 C;  4IZ8 A;  2I5L X;  1ICW A;  1RDP D;  3MAQ A;  4H44 C;  1O78 A;  2RKS A;  3UE1 A;  5AJ3 L;  3PIO 3;  4IAL A;  4IUQ A;  1RTN A;  2E8G A;  4ULL A;  3S24 A;  1FJG L;  5GAH C;  1E3P A;  2E2H H;  4DV1 L;  1I4Q A;  3ERO A;  3CCL A;  3VYR A;  2EY6 A;  1Q82 C;  4LF9 L;  1I6H H;  3ERQ A;  1WTW A;  4HN7 A;  1VQ9 A;  4K2L A;  2QDB A;  1PTO C;  4CHT B;  5HUR A;  5DM6 3;  2K6A A;  1HZB A;  5D14 A;  1HR0 L;  1JJC B;  1ILQ A;  1S5B D;  1OXU A;  3A5Z B;  3M7N A;  4LFB L;  1E0B A;  5FLM G;  1K73 C;  3D4D A;  2ZXR A;  1R4P B;  4JBK A;  2R7Z H;  5AJ3 Q;  1ROD A;  2UUA L;  4H0L C;  2VNU D;  1TS4 A;  3CP0 A;  4IPD A;  2SEB D;  5IGD A;  3J80 L;  1GO3 E;  3FKI G;  4DV1 Q;  2J4X A;  1I4G A;  1RHP A;  4AIM A;  3NP8 A;  3SE0 A;  4GLA C;  1CQF A;  4RCN A;  4PV1 C;  4LF9 Q;  4K5X A;  1LT5 D;  2F0K A;  4GKJ L;  3I91 A;  3TN2 A;  3I70 A;  4RH6 A;  4CJ2 C;  2IX1 A;  3T51 B;  5E4W C;  1VF7 A;  3PO3 G;  2OQK A;  4JBJ A;  2Z4I A;  4LF5 L;  2RBM A;  1CZG A;  1HR0 Q;  1BCP B;  3NK9 A;  4GN5 A;  4HMI A;  3GTL H;  2F3W A;  3L2P A;  1OTC A;  4LFB Q;  1RKN A;  5FJ8 G;  1DM0 B;  4KLK A;  4CKB A;  1K8O A;  5D65 A;  2UUA Q;  5JJZ A;  3CME A;  3Q6S A;  1CA5 A;  1VQE A;  1K0S A;  4LAA A;  1V1O A;  1UE7 A;  3KLR A;  1UUP A;  3R8B A;  4HJ8 A;  1JC7 A;  2F0U A;  4MNO A;  1FL0 A;  2H4O A;  3CRL C;  3NEN A;  4HED A;  1FNW A;  1S5E D;  4K14 A;  5KIX A;  3UDG A;  5FO7 B;  2KCT A;  1QZG A;  4ZKC B;  4OL7 A;  4LF5 Q;  1GUS A;  1AZP A;  5F2D A;  3S14 B;  1STN A;  1U5K A;  3Q24 A;  3GTK H;  2K52 A;  2HUG A;  1BO0 A;  1GHK A;  1U0L A;  2JJQ A;  1G2T A;  5IYB G;  4JI2 L;  1SDF A;  2KHI A;  4DR7 L;  1CHQ D;  3TS0 A;  2EYJ A;  3FKI B;  1R9T H;  3CCE A;  4FDB A;  1X3Q A;  2K75 A;  2HCC A;  3DWA A;  5IP9 G;  5C3E G;  4KD4 A;  4A3K G;  1PHJ A;  1M90 C;  1XWE A;  4APV A;  3SK5 A;  4CGY B;  1TS3 A;  3X3N A;  5BN4 A;  1ZYR D;  5E7N A;  4KKS A;  4BA2 I;  3PO3 B;  4N9T A;  1VQ6 A;  1JIC A;  3DEO A;  3OOC A;  4FYD A;  5FLX L;  2VB2 X;  1C7Y A;  3HOX G;  3CCJ A;  1EZ6 A;  2SNM A;  4DV7 L;  4MIU A;  1IW7 D;  4Q0F A;  1GHJ A;  4JI2 Q;  2C5C A;  2Z6K C;  4BBS B;  2PI2 E;  1STB A;  4DR7 Q;  2G9D A;  1TWH B;  1VQB A;  4RAU C;  3TEH B;  3DM3 A;  1F2Z A;  5CGK A;  2CCZ A;  3NUC A;  3HGB A;  4DV3 L;  3DWP A;  2K1B A;  5J3B A;  2JA5 G;  4V19 0;  2WB1 E;  2KCM A;  1D5M C;  1E1T A;  4Y7N H;  2MJ8 A;  2Z4H A;  2A6E D;  2A6H C;  3K5N A;  1STY A;  4EX5 A;  1LYL A;  2IT1 A;  4IFD G;  1QWY A;  1EQV A;  2V4D A;  2Q8I B;  4DV0 L;  3K57 A;  2PMZ B;  3T1Y Q;  4X3T A;  1XNQ Q;  1STA A;  1IYU A;  4DV7 Q;  2ALY B;  3ITP A;  3FMC A;  3HOV H;  1SSO A;  1V9P A;  4ME3 A;  2NN6 I;  4RWS C;  3K59 A;  3J80 i;  3QO2 A;  3K80 C;  4AQY L;  3E6Z X;  5I6W A;  5LHY 1;  4B3M L;  5I2Y A;  5EJW A;  4OON A;  4DV3 Q;  3KK7 A;  3FP9 A;  5EAY A;  4RHR A;  3SK4 A;  2F0N A;  4G4K A;  3SHL A;  3BDL A;  2JEB I;  4JBW A;  2HDL A;  4A3J G;  1U4M A;  1X3E A;  4PMW A;  4A3K B;  4S3S A;  3M4Y A;  1G8Z D;  4DV0 Q;  3HG9 A;  1LV9 A;  1NY4 A;  4UP9 A;  3AYH B;  5FO9 B;  1OXT A;  3HOX B;  1WTR A;  2EQS A;  3H3V H;  1T9H A;  4AQY Q;  4B3M Q;  1YNN D;  2NBF A;  3D6C A;  2ID0 A;  3KLS A;  1IL2 A;  3SVM A;  3STB D;  1WI5 A;  1QCB D;  1S5C D;  5C4J B;  1VQ5 A;  1X32 A;  5FJ8 H;  2K32 A;  5DNF A;  1XMQ L;  1JR0 D;  4JI0 L;  1SMY D;  3AB9 A;  1JMC A;  2JA5 B;  2LS0 1;  3T56 B;  3VYU A;  3WDN A;  3CC7 A;  3TRZ A;  1SR3 A;  1ONL A;  3F2C A;  2XRQ D;  1B3A A;  4GNX B;  1M1K C;  5FKA C;  4Q5V A;  3G48 A;  2EY5 A;  3E5S A;  1PVO A;  2D0P A;  1EQR A;  2HIV A;  1Q90 A;  1SFO B;  1F9P A;  4FP5 D;  4HJ9 A;  3TZU A;  4CJ1 B;  2R6G A;  4GOP A;  1WFQ A;  1EY6 A;  1HZC A;  5K36 H;  3DWQ A;  1STG A;  1XMQ Q;  4XYO A;  4GKK L;  3RZD H;  4LWC A;  4CDF C;  3EA6 A;  4P75 A;  1JOR A;  4A3C G;  3E0J A;  1ET6 A;  1SMX A;  4IFD J;  4ZAI A;  1X9N A;  1F2Y A;  3I90 A;  4A3J B;  5JPM C;  1XYI A;  3GTQ B;  3CQZ B;  4A3G G;  2LFN A;  3MXU A;  5C3E H;  5IP9 H;  2IY5 B;  2A19 A;  4M8A A;  2F03 A;  3I56 A;  2KED A;  2R92 G;  1QE6 A;  1IBL L;  2VUM G;  1RIP A;  4KHP L;  3ZYY X;  1ET9 A;  3K58 A;  5FK9 C;  4DNI A;  3ZJY C;  3HOX H;  3RUZ A;  1EWH A;  3WOE A;  1JOQ A;  2PQA A;  4R4I A;  4UAI A;  1Q1E A;  1JE5 A;  3GTG H;  2PQE A;  4L5R C;  5A2Q L;  3DLL A;  4QQB X;  3N6R A;  4Y52 H;  1LT4 D;  4ZYS A;  2C9O A;  4B9W A;  2SOB A;  3BVG A;  4LJZ C;  3OPO A;  2JA5 H;  1RCV D;  3J7A F;  5CV8 A;  1X6O A;  2KCN A;  1XPR A;  1IBL Q;  3J7Z C;  5LMU L;  2RF4 A;  1UAP A;  4KHP Q;  2YYZ A;  4XQN A;  2PCF B;  1A63 A;  3A74 A;  1K28 A;  2TMP A;  2ENB A;  4NPS A;  3VDY A;  4OXP A;  3S1M B;  5IT9 L;  3KFU A;  4IOC A;  5D3I B;  2RDH A;  4DXG A;  3MHB A;  2QDL A;  2EY1 A;  2B39 A;  3SK8 A;  3PO2 H;  3QOJ A;  2ZJR A;  4IOA A;  3EVQ A;  4GS3 A;  1E7Z A;  3GV3 A;  2JA9 A;  2CVR A;  1B70 B;  4B9X A;  3AFQ A;  2JQO A;  2XWB B;  1GUW A;  2IL8 A;  2ZTC A;  4A3G B;  3TS2 A;  1BDO A;  5EBD A;  2K28 A;  1X54 A;  4MHE A;  5LMU Q;  2A69 C;  4MTN A;  1NSN S;  3QWN A;  1YI2 A;  2VB3 X;  4DGZ A;  2Y0S B;  3PF5 A;  4OIK A;  5JEA G;  2R92 B;  5KEE A;  2VUM B;  1V8Q A;  3KYH C;  1GUG A;  2B29 A;  2R7D A;  4HAE A;  3PIP A;  2BH2 A;  1HNW L;  2F0S A;  2YTY A;  1JE4 A;  2RHQ B;  5CV9 A;  4I7A A;  1ESR A;  3HFZ B;  5LMN W;  2CHB D;  4ZLT F;  1O7I A;  1EY9 A;  4IUT A;  2E2J H;  5I6Y A;  2R93 G;  3AU7 A;  1OO9 B;  1KRT A;  1E2Z A;  1B3Q A;  5CYU A;  4RA8 A;  2RSN A;  1I4X A;  1VQ8 A;  4A3F G;  1E1O A;  1VMC A;  3K5M A;  1HNW Q;  4JBM A;  4C3J B;  2PZW A;  5I9O A;  3J80 c;  4HJA A;  3F2U A;  1X56 A;  4DR2 L;  1EY8 A;  3MTS A;  3P7J A;  2EZV A;  2R3Z A;  4G57 A;  1ICF B;  2KVM A;  3S1M H;  4BA1 I;  2RA4 A;  2AKW B;  2UUB L;  1B1Z A;  1HPC A;  1KNE A;  2O4X A;  4YIJ A;  1I50 B;  2RSO A;  3KLS X;  2PNR C;  2NVQ B;  4L8J A;  3F1Z A;  4A3B G;  3V2T A;  1PZI D;  1U9R A;  3RD4 A;  3TZD A;  4A3G H;  1YBY A;  3FHW A;  4Z9C B;  5C0X J;  4DR2 Q;  1UWV A;  4O2D A;  4QIW B;  2ICI A;  4B3T L;  2WFW A;  2UUB Q;  2A1A A;  2M2L A;  4QF4 A;  1HH2 P;  1J8I A;  2R93 B;  2QGQ A;  3R93 A;  1PRT F;  2KBN A;  3I2Z A;  4HCE A;  5COY A;  4PNY A;  4F87 A;  2IW3 A;  1KNA A;  5G3L D;  2DN8 A;  2A6E C;  4P72 A;  5JEA J;  4IUR A;  5JAV A;  4OWW B;  2CKZ B;  2K5H A;  2MO0 A;  2JA6 G;  3S2D H;  3S15 B;  1PZK D;  3GTJ B;  5EGT A;  1K8M A;  1N9W A;  3VR4 A;  5GAG C;  2HDM A;  1CUK A;  4TQU S;  3PV0 A;  4B3T Q;  2EDG A;  1SND A;  4DAV A;  4QCL A;  2R7Z G;  3KOJ A;  1Y69 U;  5M5Y B;  1SYG A;  4N8X 1;  2K04 A;  4OO1 H;  5CV7 A;  2OEO A;  3HOZ B;  3E9H A;  1QVC A;  3A7L A;  3IFT A;  2NB0 A;  5FLX c;  4JW0 A;  5FOB B;  2SDF A;  1LTL A;  1NR4 A;  1YZ6 A;  5CR3 A;  5KGU A;  1TWA B;  3JAM L;  5K5P A;  1I4P A;  3K0Y A;  4A3B B;  2O5I C;  2E74 C;  2HIX A;  3KF6 B;  1I50 H;  3BG3 A;  2FJ2 A;  3I73 A;  1EWI A;  4YHH L;  2AUK A;  3DMU A;  1RL2 A;  3BDC A;  5LMN Q;  1CA6 A;  4EQP A;  1NBW A;  2ZM6 L;  3CPF A;  4A3L G;  1VQD A;  2K7V A;  1YNN C;  4K5W A;  4XT1 B;  3STB C;  2Z9H A;  1PH4 A;  3W1G A;  1BCP D;  3RNU A;  4LFA L;  1IXR A;  4IUP A;  1V1P B;  1HR0 W;  1PH9 A;  2WIN B;  1QOH A;  4A3D H;  2E2H B;  4JI4 L;  1MHW C;  3OWE B;  4IO9 A;  1X65 A;  1DXM A;  4KV6 A;  4ZUI A;  1KXL A;  2NVX B;  1LLR D;  5EKK A;  4K6D A;  1AN8 A;  1V43 A;  1I6H B;  3OIQ A;  3FPP A;  1LT6 D;  2JA6 B;  3NBH B;  1DOM A;  3FRP B;  4GNX A;  4A3F H;  1PFN A;  2K33 A;  2ZM6 Q;  1S40 A;  1SNC A;  3S2H H;  3PUV A;  4CBV A;  3J81 E;  3VYS A;  1ASZ A;  1SE2 A;  2P5Z X;  2F0T A;  1JWU D;  1OXS C;  4LFA Q;  3T13 A;  1AW7 A;  4RGT A;  2R7Z B;  1SYF A;  1Z47 A;  5EBC A;  4C2M H;  1TWG H;  4KMU C;  1PFB A;  2EPB A;  1CHP D;  2D5D A;  1HQM C;  4JI4 Q;  3U9O A;  5E3F A;  2RQX A;  3A7A B;  1GUN A;  4AH6 A;  3KUP A;  1ENA A;  3AFP A;  4H02 A;  4QMG A;  3PCO B;  1SRU A;  3TQY A;  3OMC A;  3RN5 A;  3JC6 6;  1FGU A;  2L4N A;  3NXW A;  2DNE A;  3S1N H;  4DPG A;  1PTO H;  3U9S A;  4EGV A;  4BY7 G;  4GN4 B;  1GM5 A;  3PF4 A;  2EOT A;  1YHB A;  2FIN B;  4DAM A;  2IJ0 A;  1DZ1 A;  1A15 A;  5J22 A;  5IE8 A;  4DR3 L;  2LXJ A;  4C56 C;  2MPM A;  3HS0 C;  5JVH 3;  5LL6 S;  1KC8 C;  4TVA B;  4M1U B;  1CT1 D;  1B53 A;  4XT3 B;  1I94 L;  1B4O A;  2GVA A;  4DU9 A;  4TSS A;  4KHZ A;  2JYO A;  2NVX H;  4FVM A;  2LSS A;  5GAE C;  3GTK B;  1XPO A;  3HOV G;  1Q8I A;  2JA6 H;  2KCC A;  3K7U C;  2ES2 A;  1BBX C;  1A2T A;  4QUF A;  1SNO A;  4DR3 Q;  3RZO H;  2L0C A;  4IJH A;  3G6J B;  3JAM i;  3SXH A;  3DXJ C;  3BZK A;  5JOB A;  2LKV A;  1R9T B;  1H9K A;  2DGY A;  4P73 A;  1FJG Q;  4A93 H;  2ATW A;  1I94 Q;  4UHV A;  5KYL A;  3C2P A;  1HZ9 A;  1W2B A;  2XTI A;  1Y1W H;  1FR3 A;  2RCF A;  5C5M A;  3RMH A;  3O13 A;  3P20 A;  1IYV A;  4PG3 A;  2A69 D;  1IBK L;  1XMO L;  1C8C A;  4DNR B;  2KOL A;  4HSV A;  2L5T A;  4YY3 L;  1CKN B;  4GZY C;  1N8R C;  2L11 A;  4A3L H;  4K0K L;  1HUM A;  4K8I A;  5EPL A;  3U4V A;  5TSS A;  3BVM A;  1ENC A;  5DAU A;  3ULP A;  4WJW A;  3ICE A;  1KAB A;  4G7Z C;  1E2V A;  4DR6 L;  3A5U A;  3GD7 A;  3RLO A;  2I5H A;  3QIA A;  4KKT A;  2K5N A;  4ZUJ A;  4NDX A;  4Y7N B;  4LUO A;  3J7A 5;  1PZJ D;  2Z6B A;  1JJG A;  3EBE A;  2EYH A;  1TT2 A;  1A62 A;  3U50 C;  3BYT B;  4GKJ Q;  5IT9 c;  3NWT A;  1VQJ A;  2K5W A;  1AE2 A;  1SBB B;  3EJI A;  1XMO Q;  1IBK Q;  1KTK A;  1PH8 A;  3BZC A;  5H1S E;  1C9O A;  4N8F A;  3EN2 A;  3HOV B;  4YY3 Q;  1HTP A;  5M5X H;  4DN4 M;  2ZJP A;  1TII D;  2D62 A;  4GOP C;  5K36 G;  3I4N G;  2EXD A;  3I55 A;  1NJI C;  2KUM A;  1YIT A;  1MKH A;  4K0K Q;  1PH5 A;  5IP7 G;  2A8V A;  3NWS A;  3MZ5 A;  4HID A;  2E5L L;  1G29 1;  2PW5 A;  3FPU B;  2IPK D;  1CZW A;  2PO4 A;  2I0Q A;  1AZQ A;  3GTP H;  1VDZ A;  3QR8 A;  2UXC L;  4C3I G;  4JV5 L;  1XPU A;  2QIL A;  4CKE A;  2BDN A;  4FO2 A;  3M4O H;  3NTH A;  2LMC B;  2Q2I A;  3J7A V;  2SNS A;  2AWN A;  3GO5 A;  4WOR A;  3CCQ A;  2HHH L;  3DEP A;  1I3Q H;  3CAM A;  3K8A A;  2KEN A;  2M00 A;  2E76 C;  4BY7 H;  4IFD I;  1H9R A;  3CU7 A;  2E5L Q;  1PLF A;  2IX3 A;  3HRZ C;  2XIW A;  1AEX A;  3EFX D;  5GAD C;  1WTX A;  1Y8O B;  3D6W A;  3HEJ A;  2VY3 A;  2UXC Q;  1K9M C;  4JV5 Q;  4XYQ A;  1YHA A;  1IYJ B;  1FD7 D;  2L9H A;  1WTQ A;  5J39 A;  5A35 A;  2CFM A;  4JI6 L;  1KLG D;  5EPJ A;  3AMU A;  1BR9 A;  1F9S A;  3PUZ A;  2MNA A;  2F0L A;  3MFG A;  4DNT B;  1PRT B;  1SE4 A;  4K6L A;  1JCK B;  5IGG A;  2HHH Q;  3M7G A;  2EY2 A;  2UUC L;  5DLQ E;  3H6M A;  1YIJ A;  3SK6 A;  4QL5 A;  1QG7 A;  4B08 A;  2MP1 A;  3LWU A;  1X3P A;  2RHS B;  5M5W H;  4C1N I;  3RZD B;  3BZD B;  1EU3 A;  3PO2 G;  5I4D A;  1L0X B;  2L55 A;  3I7F A;  5CV6 A;  4J1M A;  1AE3 A;  4R4O A;  4X66 L;  1OXV A;  1CM9 A;  1PTO F;  3A55 A;  4PMC A;  1L1O B;  1N34 L;  1KDB A;  4JI6 Q;  4NKL A;  2NVT H;  4KD3 A;  3ND8 A;  2BA1 A;  4KK7 A;  1JOO A;  5IYC G;  1UNS A;  1UE5 A;  5C3E B;  2KJX A;  2RDF A;  1H95 A;  5IOC A;  2VS1 A;  3CCV A;  3MEH A;  3KF6 A;  2IWH A;  2G5D A;  4P2C B;  1H9J A;  3FEW X;  1K3R A;  4GLV B;  1G2S A;  2RCN A;  1DOL A;  4OWX B;  1ENF A;  2EJF C;  1J9O A;  1EIG A;  1DCZ A;  1LTA D;  1BCP C;  4KN7 C;  3SGI A;  5ISR A;  4EQN A;  2E2I H;  1E22 A;  4L63 B;  1WYD A;  1PA6 A;  3GTM H;  4X66 Q;  3GTG B;  1N34 Q;  2KQ3 A; 
#chains in the Genus database with same CATH homology
 3D3R A;  1V1P A;  2NN6 G;  3K7A B;  1SYB A;  3OMG A;  3OHX C;  1VCI A;  3R2I A;  3ND9 A;  2EJG C;  1M8A A;  3D8G A;  3NBH A;  1MBY A;  3I3C A;  4NMZ A;  2AQ3 B;  3PO2 B;  1D2B A;  3TBI B;  4ODG A;  1ESF A;  1MSH A;  1QJO A;  4FF2 A;  2Q8T A;  2KEE A;  2FMC A;  1F9R A;  2F0J A;  4R8N A;  3A8I E;  1C4Q A;  2XRS D;  3BS1 A;  2F0D A;  4ZQ3 A;  2E2J B;  3A54 A;  2KA7 A;  3EQL C;  1HA5 A;  4RGN A;  4KN4 C;  2JP1 A;  5C0X I;  1Z7T A;  2WB1 B;  3DM1 A;  1G6Z A;  3UI2 A;  1EFI D;  4EVO A;  2OT2 A;  5ELD A;  1VF5 C;  2ZXP A;  5G3L F;  2WAC A;  4DK1 A;  3CHB D;  2B2T A;  1A2U A;  1TS2 A;  3KBX A;  5EQ0 A;  2AWO A;  1LAC A;  1XTC D;  5CV5 A;  3HOU B;  4OO1 G;  3VA7 A;  5M9O A;  1CK1 A;  4RFB A;  3N52 A;  3H94 A;  3URY A;  1EQT A;  4E6I A;  1I4H A;  1Y8P B;  3GQB A;  1QIL A;  3X3M A;  1SJE D;  4IUN A;  1ZXT A;  1HTL D;  3A8K E;  5IOD A;  4U67 3;  3MXG A;  1MI2 A;  2G9H D;  3HP3 A;  1F2M A;  1QB5 D;  2BDO A;  1BCP F;  2B2W A;  2O5J C;  2I07 B;  3TP6 A;  2MHV A;  3OSO A;  2NN6 H;  3S2D B;  1U4L A;  1B9M A;  3BVZ A;  4G7H C;  4XIG S;  5ELE A;  5IIF A;  3M85 A;  4A3I B;  1LTT D;  2X69 A;  1UEA B;  2X6G A;  4C1N K;  1ZEQ X;  1U4P A;  4A3M B;  2EYF A;  1PDQ A;  5I9P A;  1EY4 A;  3IL8 A;  3K6O A;  2E75 C;  5ELB A;  4ABN A;  3GP7 A;  1JWM D;  3TDQ A;  3W2D A;  4HR7 B;  3R2T A;  5EKI A;  3A56 A;  2F0M A;  2EXZ A;  1TR5 A;  4ILW A;  1T5X D;  1K83 B;  1TKW B;  2F0P A;  3MC0 B;  1BQQ T;  2Q8R E;  1SYE A;  3OW7 A;  3NBI A;  2E2D C;  1HA6 A;  4K2K A;  3VA5 A;  4A3D B;  2Z8L A;  3SEB A;  4KY6 A;  4DA2 A;  3TSS A;  1GUO A;  3L3O C;  4F88 A;  1LAB A;  4I7Z C;  4A3F B;  2XVS A;  3QG1 A;  4ID6 A;  4UDU C;  3S2H B;  3D31 A;  3C1F A;  2L1B A;  1H9S B;  2K03 A;  3QB3 A;  2BE5 D;  4DFA A;  4C2M B;  1TWG B;  1CFM A;  2R61 A;  2B2U A;  5IGF A;  3T4A C;  4RCO A;  4PQX A;  1NUC A;  1ML0 D;  3NSW A;  2GA4 B;  3S1N B;  1PTO B;  2B2V A;  1PMR A;  2WII B;  1BNZ A;  5C5L A;  1EY0 A;  2A5H A;  4OGQ C;  2X6L A;  2BA0 A;  1LTR D;  1EIH A;  1EWC A;  3NHH A;  1JWS D;  1D6E C;  1HFG A;  1Q12 A;  1PXU A;  1T5E A;  1JB3 A;  1BF4 A;  1B9N A;  3MWY W;  4XXE A;  1IKM A;  1IHZ A;  5T1I A;  3BDO A;  2QKI C;  1EYA A;  3G7L A;  3J80 E;  4FF3 A;  3RZO B;  4WFN 3;  2N55 A;  5BN3 A;  1SJH D;  3CKI B;  2WV6 D;  1QNU A;  1EU4 A;  3BYY B;  1FGB D;  5T1G A;  4A93 B;  1F77 A;  1EEI D;  5C3X A;  1Y1W B;  5KNB A;  1LT3 D;  3I72 A;  5J1Z A;  1S5D D;  2F0E A;  3Q22 A;  3S1R B;  1YNJ D;  2EYL A;  4HMJ A;  2PZU A;  4CJ0 B;  1U4R A;  4N9P A;  2XN9 C;  1NAP A;  2ICE C;  1Q3L A;  3MFY A;  1ILP A;  1LTS D;  1DJR D;  2F0W A;  4QB4 A;  5CBA E;  4FF4 A;  3RLF A;  2K5Q A;  2AQ2 B;  1JQY D;  3IAY A;  4RHS A;  5FO8 B;  1BUV T;  1LTB D;  2WKC A;  3DHQ A;  1GXD C;  3R3O A;  4K5V A;  1B50 A;  2NYZ D;  4H13 C;  3NTK A;  4V0B A;  5M5X B;  1FNV A;  1SNM A;  1HCZ A;  1VMP A;  4CKC A;  4KJO A;  3GTP B;  3K5O A;  3M4O B;  4OHJ A;  2QF7 A;  5FLX E;  4LMQ D;  1KDC A;  4DF7 A;  2XNA C;  1TVX A;  3ONA B;  1RTO A;  1TWF B;  1EZ8 A;  1I3Q B;  4BY7 B;  3PUY A;  3L7Z C;  4NW2 A;  3J81 L;  4J8Q A;  1HRJ A;  1KAA A;  4F7X A;  2LY7 A;  2NUC A;  3C46 A;  1S4Z A;  4XTC S;  4A3E B;  2AUJ D;  2DNC A;  3T53 B;  2JE6 I;  1HXY D;  3WOF A;  1II3 A;  3VR5 A;  3C3L A;  3V96 A;  1SYD A;  5M5W B;  3VR6 A;  1RJT A;  2RDG A;  5CBE E;  1SAP A;  1MD2 D;  2Z1C A;  5EKL A;  2NVT B;  1F9Q A;  2K05 A;  1O80 A;  4F8M A;  2F0H A;  5CMD A;  3TP8 A;  1XXG A;  1CQV A;  2M9V A;  1A3T A;  3A8J E;  5IGC A;  1DOK A;  5BN5 A;  2OF1 A;  2E2I B;  1DYQ A;  2EE1 A;  4R9W A;  1EL0 A;  2BCO A;  3GTM B;  4R8I A;  3LWE A;  2CW0 D;  4DAP A;  4FXD A;  2I46 A;  3C1E A;  3VYT A;  1TU2 B;  3TME A;  4J6H A;  5HGT A;  3P1H A;  2B2Y A;  2KHS A;  2KEC A;  4FF1 A;  2F0Q A;  2QCP X;  1SNP A;  2EVB A;  1HFN A;  1LTI D;  2B2T C;  4JK1 C;  2BE5 C;  4K8J A;  2B8G A;  4RKB A;  3GV6 A;  3I4N B;  3NQT A;  1H9S A;  1KLU D;  3S16 B;  4KI0 A;  1AFP A;  4TRD A;  2HCI A;  5M3F B;  2HQE A;  2O2L D;  2F0F A;  1SNQ A;  1WVL A;  4FNF A;  4IUV A;  4C3I B;  2DY7 A;  5DEH A;  5CC4 A;  4NP5 A;  4WRD A;  1BXT A;  4IN3 A;  3D4R A;  2D9U A;  2CQA A;  3QJY A;  1Z6H A;  3I8Z A;  1E2W A;  5A2Q E;  4XDX A;  4EQO A;  5CV4 A;  4ZKB B;  1NCV A;  1Y1V B;  3KBG A;  2TSS A;  1Y8N B;  1TY2 A;  5E4X A;  5COR A;  1TWC B;  2B2W C;  1D5X C;  2EYO A;  4LK1 C;  4X3U A;  1R4Q B;  5IT9 E;  3S17 B;  1B44 D;  3Q0A A;  1WD1 A;  1QNK A;  4U68 A;  2RVL A;  1SE3 A;  4DK0 A;  4KTA A;  2JA7 B;  2A68 D;  4KY5 A;  4G7O C;  2OXP A;  3W3A A;  4RGM A;  1CTM A;  4RGO S;  5C4H A;  1DON A;  1IL8 A;  3NTI A;  1B2T A;  3V05 A;  1YNJ C;  3FDT A;  1MGS A;  5AFW A;  3HOW B;  2PW7 A;  1GJX A;  1Q1B A;  3H3V C;  2WKD A;  4X3S A;  1G91 A;  3IFD A;  3QOL A;  5KND A;  2WP8 J;  3KF8 A;  2F4I A;  1STE A;  3TP7 A;  1HQR D;  5C44 B;  3M3Y B;  4OO1 I;  1C48 A;  1EY7 A;  1PYW D;  3VR2 A;  1PRT C;  4BBR B;  1EOT A;  5KNC A;  4MN3 A;  2B2U C;  3PUW A;  5D3D A;  5M3M B;  1NR2 A;  3K5L A;  1RD9 D;  1L0Y B;  1FYC A;  4IFD H;  4KHV A;  3NPP A;  1D5Z C;  1MSG A;  1O7Z A;  2B2V C;  4C3J G;  3CRK C;  1XX8 A;  1PTO D;  3MXP A;  4HTH A;  5C0X G;  5NUC A;  2QEJ C;  1O7Y A;  2JXM B;  3L9A X;  4C3H G;  1W6K A;  2AQ1 B;  5C4Z A;  4HCS A;  3VR3 A;  2K5D A;  2EYP A;  1EYD A;  3IKJ A;  2PPB C;  3OIP A;  2NTT A;  5I2X A;  2EJM A;  2FMM A;  2BOS A;  5C4X B;  1OXX K;  1GUT A;  5KRU A;  2A73 B;  5C6A A;  1WTO A;  4L6T B;  3PMF A;  4KKU A;  1FNU A;  1AP0 A;  4O1N A;  5IGB A;  4I65 A;  2EYM A;  1I4R A;  3JAM E;  2YU9 B;  3S9W A;  1SEB D;  2F0G A;  5IGE A;  3NE5 B;  3I4L A;  2IX0 A;  2PYK A;  2N88 A;  3D4W A;  5ELF A;  3HOY B;  4HSP A;  2VXW A;  4FXK C;  3GTO B;  1A3U A;  3PUX A;  4C3H B;  1DD2 A;  2NZ1 D;  2CW0 C;  2XSC A;  3T16 A;  4DAY A;  4IQZ A;  4X3K A;  1WCM B;  2F1M A;  5EPK A;  1GOZ A;  1S5F D;  3I4M B;  1ZYR C;  4ME5 A;  5LL6 X;  1D1I A;  1JOK A;  2WAQ B;  5JVG 3;  2F0O A;  1IW7 C;  3H91 A;  1STH A;  3LNN A;  4ZK9 B;  4TKO B;  2F0V A;  1A3V A;  2DY8 A;  3P75 A;  1EEF D;  2MUY A;  3HZX A;  4QUC A;  2J7Z A;  3TP5 A;  5E1F A;  3SR1 A;  1KDA A;  2A6H D;  5JPN C;  1HHV A;  2FHT A;  3PIP 3;  5C3W A;  2ZXO A;  1W6J A;  1EYC A;  3H0G B;  4H7B A;  4RKL A;  1H9M A;  3FVQ A;  5C0X H;  2JEA I;  3MVV A;  2FFK B;  2NVY B;  3LX0 A;  5ELC A;  4IUU A;  1BOS A;  1SYC A;  4BWG B;  1ZKO A;  1I6V C;  2H1E A;  1D1K A;  1RF2 D;  2ZT9 C;  4DXF A;  1WD0 A;  2K01 A;  5DM7 3;  5JEA H;  1LO5 D;  3Q23 A;  1O7L A;  3NQI A;  2F0I A;  1SMY C;  4PMB A;  4BS9 A;  4BY1 B;  2B63 B;  2L12 A;  1LTG D;  1SXT A;  2A68 C;  4OIJ A;  2MGS A;  4XQQ A;  2JA8 B;  3HKZ B;  1F2L A;  2NTS A;  2NWG A;  1EY5 A;  4AYB B;  1HUN A;  1TS5 A;  4ZRZ A;  2XWJ B;  3J7Y W;  4KJN A;  2B8F A;  3SDZ A;  2PZT A;  2J0T D;  1A6X A;  3MA2 B;  4FXG C;  2D2C C;  1M4V A;  4XQJ A;  2F3V A;  1TY0 A;  1IKL A;  1WTP A;  1PFM A;  4O42 A;  2B2Y C;  1WTV A;  2JSO A;  1TQO A;  3DUZ A;  3GTL B;  3S1Q B;  4KY7 A;  3H09 A;  1CI3 M;  3OWF A;  5KYI A;  1PRT D;  3MXN A;  2A74 C;  4IZ8 A;  1ICW A;  1RDP D;  3MAQ A;  4H44 C;  1O78 A;  2RKS A;  3PIO 3;  4IAL A;  4IUQ A;  1RTN A;  4ULL A;  1I4Q A;  3ERO A;  3VYR A;  2EY6 A;  3ERQ A;  1WTW A;  4HN7 A;  4K2L A;  2QDB A;  1PTO C;  4CHT B;  5HUR A;  5DM6 3;  2K6A A;  5D14 A;  1ILQ A;  1S5B D;  1OXU A;  3M7N A;  1E0B A;  3D4D A;  2ZXR A;  1R4P B;  1ROD A;  4H0L C;  2VNU D;  1TS4 A;  3J80 L;  2SEB D;  5IGD A;  2J4X A;  1I4G A;  1RHP A;  3NP8 A;  3SE0 A;  1CQF A;  4RCN A;  4PV1 C;  4K5X A;  1LT5 D;  2F0K A;  3I91 A;  3TN2 A;  3I70 A;  4RH6 A;  4CJ2 C;  2IX1 A;  3T51 B;  5E4W C;  1VF7 A;  2Z4I A;  2RBM A;  1CZG A;  1BCP B;  3NK9 A;  4HMI A;  2F3W A;  1RKN A;  1DM0 B;  4CKB A;  1K8O A;  5D65 A;  5JJZ A;  3Q6S A;  1CA5 A;  4LAA A;  1V1O A;  3KLR A;  1UUP A;  3R8B A;  1JC7 A;  2F0U A;  2H4O A;  3CRL C;  4HED A;  1FNW A;  1S5E D;  4K14 A;  5KIX A;  5FO7 B;  4ZKC B;  4OL7 A;  1GUS A;  1AZP A;  5F2D A;  3S14 B;  1STN A;  3Q24 A;  2HUG A;  1BO0 A;  1GHK A;  1G2T A;  1SDF A;  1CHQ D;  2EYJ A;  3FKI B;  1X3Q A;  2HCC A;  3DWA A;  4KD4 A;  1XWE A;  3SK5 A;  4CGY B;  1TS3 A;  3X3N A;  5BN4 A;  1ZYR D;  4KKS A;  4BA2 I;  3PO3 B;  4N9T A;  1JIC A;  3DEO A;  3OOC A;  4FYD A;  5FLX L;  2VB2 X;  1EZ6 A;  2SNM A;  4MIU A;  1IW7 D;  4Q0F A;  1GHJ A;  2C5C A;  4BBS B;  1STB A;  2G9D A;  1TWH B;  4RAU C;  1F2Z A;  5CGK A;  3NUC A;  3HGB A;  3DWP A;  2K1B A;  4V19 0;  1D5M C;  2MJ8 A;  2Z4H A;  2A6E D;  2A6H C;  3K5N A;  1STY A;  2IT1 A;  4IFD G;  1QWY A;  1EQV A;  2V4D A;  2Q8I B;  3K57 A;  2PMZ B;  4X3T A;  1STA A;  1IYU A;  3ITP A;  3FMC A;  1SSO A;  2NN6 I;  4RWS C;  3K59 A;  3QO2 A;  3E6Z X;  5I6W A;  5LHY 1;  5I2Y A;  5EJW A;  3KK7 A;  4RHR A;  3SK4 A;  2F0N A;  4G4K A;  3SHL A;  3BDL A;  2JEB I;  4JBW A;  2HDL A;  1U4M A;  4PMW A;  4A3K B;  4S3S A;  3M4Y A;  1G8Z D;  3HG9 A;  1LV9 A;  5FO9 B;  1OXT A;  3HOX B;  1WTR A;  1YNN D;  2NBF A;  3D6C A;  2ID0 A;  3KLS A;  3SVM A;  1QCB D;  1S5C D;  5C4J B;  1X32 A;  2K32 A;  5DNF A;  1JR0 D;  1SMY D;  3AB9 A;  2JA5 B;  2LS0 1;  3T56 B;  3VYU A;  3WDN A;  1ONL A;  2XRQ D;  1B3A A;  5FKA C;  4Q5V A;  2EY5 A;  3E5S A;  1Q90 A;  1SFO B;  1F9P A;  4FP5 D;  3TZU A;  4CJ1 B;  2R6G A;  1EY6 A;  5K36 H;  3DWQ A;  1STG A;  4XYO A;  3EA6 A;  1JOR A;  3E0J A;  1ET6 A;  4IFD J;  4ZAI A;  1F2Y A;  3I90 A;  4A3J B;  5JPM C;  1XYI A;  3GTQ B;  3CQZ B;  2LFN A;  3MXU A;  4M8A A;  2F03 A;  2KED A;  1QE6 A;  3ZYY X;  1ET9 A;  3K58 A;  5FK9 C;  3RUZ A;  1EWH A;  3WOE A;  1JOQ A;  4UAI A;  1Q1E A;  2PQE A;  5A2Q L;  3N6R A;  1LT4 D;  4ZYS A;  2C9O A;  4B9W A;  2SOB A;  3BVG A;  4LJZ C;  3OPO A;  1RCV D;  3J7A F;  5CV8 A;  2KCN A;  1UAP A;  2YYZ A;  4XQN A;  2PCF B;  2TMP A;  2ENB A;  3S1M B;  5IT9 L;  5D3I B;  2RDH A;  4DXG A;  3MHB A;  2EY1 A;  2B39 A;  3SK8 A;  3QOJ A;  3EVQ A;  3GV3 A;  2CVR A;  4B9X A;  2XWB B;  1GUW A;  2IL8 A;  4A3G B;  1BDO A;  5EBD A;  2K28 A;  4MHE A;  2A69 C;  1NSN S;  3QWN A;  2VB3 X;  4DGZ A;  2Y0S B;  4OIK A;  5JEA G;  2R92 B;  5KEE A;  2VUM B;  1V8Q A;  1GUG A;  4HAE A;  2F0S A;  1JE4 A;  5CV9 A;  1ESR A;  2CHB D;  4ZLT F;  1EY9 A;  4IUT A;  5I6Y A;  3AU7 A;  1OO9 B;  1E2Z A;  5CYU A;  4RA8 A;  2RSN A;  1I4X A;  1VMC A;  3K5M A;  4C3J B;  2PZW A;  5I9O A;  3F2U A;  1EY8 A;  3MTS A;  3P7J A;  2EZV A;  2R3Z A;  4G57 A;  2KVM A;  4BA1 I;  2RA4 A;  1B1Z A;  1HPC A;  1KNE A;  2O4X A;  4YIJ A;  1I50 B;  2RSO A;  3KLS X;  2PNR C;  2NVQ B;  4L8J A;  3V2T A;  1PZI D;  1U9R A;  3RD4 A;  3TZD A;  4Z9C B;  5C0X J;  4QIW B;  2ICI A;  2M2L A;  4QF4 A;  1J8I A;  2R93 B;  3R93 A;  1PRT F;  4HCE A;  5COY A;  4PNY A;  4F87 A;  2IW3 A;  1KNA A;  5G3L D;  2DN8 A;  2A6E C;  5JEA J;  4IUR A;  5JAV A;  3S15 B;  1PZK D;  3GTJ B;  5EGT A;  1K8M A;  3VR4 A;  2HDM A;  4TQU S;  3PV0 A;  2EDG A;  1SND A;  4DAV A;  4QCL A;  1Y69 U;  5M5Y B;  1SYG A;  2K04 A;  4OO1 H;  5CV7 A;  2OEO A;  3HOZ B;  3A7L A;  3IFT A;  2NB0 A;  5FOB B;  2SDF A;  1NR4 A;  5CR3 A;  5KGU A;  1TWA B;  3JAM L;  5K5P A;  1I4P A;  3K0Y A;  4A3B B;  2O5I C;  2E74 C;  3BG3 A;  2FJ2 A;  3I73 A;  2AUK A;  3DMU A;  3BDC A;  1CA6 A;  4EQP A;  2K7V A;  1YNN C;  4K5W A;  4XT1 B;  1BCP D;  4IUP A;  1V1P B;  2WIN B;  1QOH A;  2E2H B;  3OWE B;  1DXM A;  4KV6 A;  4ZUI A;  2NVX B;  1LLR D;  5EKK A;  4K6D A;  1AN8 A;  1V43 A;  1I6H B;  3OIQ A;  3FPP A;  1LT6 D;  2JA6 B;  1DOM A;  3FRP B;  1PFN A;  2K33 A;  1SNC A;  3PUV A;  4CBV A;  3J81 E;  3VYS A;  1SE2 A;  2F0T A;  1JWU D;  1OXS C;  3T13 A;  1AW7 A;  4RGT A;  2R7Z B;  1SYF A;  1Z47 A;  5EBC A;  4KMU C;  1PFB A;  2EPB A;  1CHP D;  2D5D A;  1HQM C;  3U9O A;  5E3F A;  2RQX A;  3A7A B;  1GUN A;  3KUP A;  1ENA A;  4QMG A;  3OMC A;  2L4N A;  3NXW A;  2DNE A;  1PTO H;  3U9S A;  4EGV A;  2EOT A;  2FIN B;  2IJ0 A;  1DZ1 A;  1A15 A;  5J22 A;  4C56 C;  2MPM A;  3HS0 C;  5JVH 3;  5LL6 S;  4M1U B;  1CT1 D;  1B53 A;  4XT3 B;  1B4O A;  4DU9 A;  4TSS A;  4KHZ A;  2JYO A;  4FVM A;  3GTK B;  1Q8I A;  2KCC A;  1BBX C;  1A2T A;  4QUF A;  1SNO A;  2L0C A;  3G6J B;  3SXH A;  3DXJ C;  5JOB A;  2LKV A;  1R9T B;  1H9K A;  5KYL A;  3C2P A;  1FR3 A;  5C5M A;  3RMH A;  3O13 A;  3P20 A;  1IYV A;  2A69 D;  1C8C A;  4DNR B;  2KOL A;  4HSV A;  2L5T A;  4GZY C;  2L11 A;  1HUM A;  4K8I A;  5EPL A;  5TSS A;  3BVM A;  1ENC A;  5DAU A;  4WJW A;  1KAB A;  4G7Z C;  1E2V A;  3GD7 A;  3QIA A;  4KKT A;  4ZUJ A;  4Y7N B;  4NDX A;  1PZJ D;  2EYH A;  1TT2 A;  3BYT B;  2K5W A;  3NWT A;  1SBB B;  3EJI A;  1KTK A;  3HOV B;  1HTP A;  4DN4 M;  5K36 G;  1TII D;  2D62 A;  2KUM A;  3NWS A;  3MZ5 A;  1G29 1;  2PW5 A;  3FPU B;  2IPK D;  1CZW A;  2PO4 A;  1AZQ A;  1VDZ A;  4C3I G;  2QIL A;  4CKE A;  2BDN A;  4FO2 A;  3NTH A;  2LMC B;  3J7A V;  2SNS A;  2AWN A;  3GO5 A;  4WOR A;  3DEP A;  2M00 A;  2E76 C;  4IFD I;  1H9R A;  3CU7 A;  1PLF A;  2IX3 A;  3HRZ C;  2XIW A;  1AEX A;  3EFX D;  1WTX A;  1Y8O B;  3D6W A;  3HEJ A;  4XYQ A;  1FD7 D;  2L9H A;  1WTQ A;  5J39 A;  5A35 A;  1KLG D;  5EPJ A;  3AMU A;  1BR9 A;  1F9S A;  3PUZ A;  2F0L A;  3MFG A;  4DNT B;  1PRT B;  1SE4 A;  4K6L A;  1JCK B;  5IGG A;  3M7G A;  2EY2 A;  3H6M A;  3SK6 A;  1QG7 A;  4B08 A;  2MP1 A;  3LWU A;  1X3P A;  4C1N I;  3RZD B;  3BZD B;  1EU3 A;  5I4D A;  1L0X B;  2L55 A;  5CV6 A;  4J1M A;  1OXV A;  1CM9 A;  1PTO F;  3A55 A;  4PMC A;  1KDB A;  4NKL A;  4KD3 A;  3ND8 A;  2BA1 A;  4KK7 A;  1JOO A;  1UNS A;  5C3E B;  2KJX A;  2RDF A;  5IOC A;  3MEH A;  2IWH A;  4P2C B;  1H9J A;  3FEW X;  1G2S A;  1DOL A;  1ENF A;  2EJF C;  1J9O A;  1EIG A;  1DCZ A;  1LTA D;  1BCP C;  4KN7 C;  5ISR A;  4EQN A;  4L63 B;  3GTG B;  2KQ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...