4K5XA

Crystal structure of staphylococcal nuclease variant v23m/l36f at cryogenic temperature
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
135
structure length
132
Chain Sequence
LHKEPATLIKAIDGDTMKLMYKGQPMTFRFLLVDTPETKHPVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Pressure effects on proteins
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 37
structure length 132
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2013-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4k5xA00
3QOLA 5CR3A 1EY8A 3QOJA 5M9OA 1SYGA 2ENBA 4E6IA 2F0QA 3NXWA 4EQOA 5KIXA 2PZUA 2EY2A 4ODGA 2PZTA 1ENCA 3MEHA 4IUNA 3NP8A 4K5WA 3NHHA 2F0DA 3NQTA 5CV8A 1IHZA 1A2UA 1KABA 1SNDA 3C1FA 3U9OA 2F0JA 3SHLA 3SK5A 4K2LA 1JOQA 3DMUA 1KDCA 2OF1A 4LAAA 2F0HA 3D6CA 3OSOA 5CC4A 3EVQA 4DF7A 5C4ZA 3TP8A 5IOCA 4K5XA 1EQVA 2F3WA 2EY1A 5CV9A 4KY7A 2PW7A 3DHQA 3H6MA 1II3A 2PW5A 3HZXA 3QB3A 2SNMA 4PNYA 5E1FA 4EQPA 3EJIA 5C5LA 2EYOA 2F0SA 2PQEA 5J1ZA 3SR1A 4EQNA 1EY0A 1EY6A 4WORA 1ENAA 3MZ5A 3TMEA 1STYA 4B9XA 4DGZA 5IGEA 4J6HA 1RKNA 2RDFA 4R8NA 4ZUIA 3D4DA 2F0KA 3TP7A 3P1HA 4N9PA 4PMCA 4ME5A 2EYHA 3E5SA 5ISRA 1NUCA 2PZWA 1SYFA 1A3VA 1NSNS 1STNA 2M00A 1A3UA 4KV6A 4QMGA 5C4HA 5I9PA 5IGFA 4RKBA 1U9RA 2PYKA 1EY7A 4H7BA 4HTHA 5C5MA 4F7XA 4WRDA 2EYLA 1STBA 3ITPA 4DFAA 5IGDA 3D4WA 2F0LA 3BDLA 5JOBA 5CV7A 4EVOA 2EY6A 4KD4A 1A2TA 5CGKA 1SYCA 2EYPA 3R3OA 4G57A 2LKVA 5IGGA 5CV6A 4IALA 4B9WA 1SYDA 4F8MA 4KY5A 5C6AA 5I9OA 3OMCA 1KDBA 1SNMA 3T16A 1AEXA 3SXHA 3TP6A 3LX0A 5DAUA 2F0OA 2EXZA 4ZUJA 2EYFA 2NUCA 4RKLA 4HMIA 2HQEA 4NP5A 5HURA 1STGA 2F0TA 4OL7A 1SYBA 1TT2A 5IGBA 2KHSA 2EYMA 4QF4A 5IIFA 3MHBA 1F2MA 5C3XA 3C1EA 3MXPA 5KYLA 5CV5A 5K5PA 2O4XA 5CV4A 5I6WA 5KGUA 3OMGA 2RKSA 4KD3A 4DU9A 1EY9A 1SNCA 3SK6A 1EY4A 1KAAA 5EKKA 1SNOA 2F0PA 4K2KA 1EYCA 5IODA 2F0WA 4NMZA 1A3TA 1SYEA 3BDCA 5I6YA 4KHVA 4K5VA 5KYIA 1EZ8A 2F0MA 4HMJA 2WACA 3NUCA 4I65A 4KJOA 4PMBA 3S9WA 4K8IA 4ZQ3A 3TP5A 4S3SA 3D8GA 4K14A 1JORA 2KQ3A 4KY6A 2F0VA 5DEHA 4KJNA 1EY5A 1KDAA 2F0FA 2F0IA 1STAA 2F3VA 3PMFA 4IZ8A 4KTAA 5EKLA 4J1MA 5HGTA 1TR5A 2F0UA 5J39A 4YIJA 5EGTA 1EYDA 2EYJA 3SK8A 1F2YA 3V2TA 4N9TA 5KRUA 1EZ6A 1JOOA 1STHA 3MVVA 5J22A 1F2ZA 4ID6A 4MIUA 2SOBA 4NDXA 5E3FA 3VA5A 3EROA 3P75A 4TRDA 2SNSA 3OWFA 4QB4A 3HEJA 2OXPA 3NK9A 5JAVA 1SNQA 2QDBA 2OEOA 3ERQA 5C3WA 2EY5A 2F0NA 3SK4A 5KEEA 5NUCA 1EYAA 3RUZA 5F2DA 3T13A 2F0EA 5IGCA 2RBMA 4NKLA 1TQOA 4K8JA 2F0GA 1SNPA 1JOKA 4K6DA
chains in the Genus database with same CATH superfamily
4C1NK 1TWGB 4LK1C 2OTLA 1GUTA 5I2YA 4DR7Q 5FLXc 1EIFA 5BN4A 1EL0A 1GM5A 1K73C 2KEEA 2JA5H 4JBKA 4XQQA 1JC7A 5IE8A 2FFKB 1Q7YC 1NMGA 4NXMQ 1KNEA 1HRJA 4TQUS 4KLKA 3ER0A 1VQHA 4GLAC 5C3XA 2VZAA 1RJTA 4PV1C 2R7ZB 2BCOA 1SE3A 2VB3X 4J6HA 4R8NA 1Q81C 2LSSA 1XNRQ 3K59A 2EYHA 3QIAA 1VQKA 2ASBA 4R4IA 1X6OA 4RMFA 1HNWQ 5I2XA 1HR0Q 4WRDA 2G9HD 4LFCQ 3GTOB 4KD4A 3CW2C 2XIWA 2NVQB 1IBML 1HTPA 5ELBA 5IGGA 1QB5D 4B9WA 1BDOA 2B2TC 3OMCA 4YHHL 1AE3A 1F9RA 4A3KH 2A8VA 1VQOA 1SYBA 3K7AH 1KRSA 3ULJA 3L3OC 4LF7Q 3A8JE 4IFDG 5KGUA 4WJ3M 2RKSA 4KD3A 2B2VC 3I4MH 5EKKA 4JI5Q 1FGUA 2MNAA 1E2VA 1BQQT 1U4RA 4K2KA 1SDFA 1SYEA 2N55A 3O13A 3HOVH 1LT6D 1J5EL 4IUUA 4S3SA 1LACA 2F0VA 2F0IA 3QR8A 5E4WC 5IYCG 4YIJA 2JA6G 2EYJA 4C3HH 2V1CC 4CJ2C 1RIPA 3NTHA 1D2BA 1GUGA 3KDFA 2UU9Q 1U0LA 3S2HB 3ERQA 1PH4A 5C3WA 2O5IC 5M3FH 2RCNA 5IGCA 2RBMA 3KF8B 2F0GA 1V43A 2RF4A 1JJGA 2JK8A 3QOJA 2NZ1D 2VW9A 1SYGA 4JOIA 4EQOA 2IHFA 2BH2A 1N8RC 3H94A 1FL0A 5CV8A 3GTKH 1BBXC 1XTCD 5LMNQ 3JAME 3OW2A 1O78A 3F8TA 3DMUA 1R9TB 1KC8C 5CC4A 4X66L 4OX9Q 1L2FA 2B3GA 3LGJA 4X64Q 3PO3G 1G8ZD 1PRTB 2OQ0A 2PQEA 4DAPA 2ZM6L 4RG1A 4A3FH 3MZ5A 2K14A 2KOLA 4R8IA 2CKZB 2PQAA 3PQIA 3U50C 3P1HA 1RODA 4Q0FA 2JN4A 5EKIA 5TSSA 1STNA 2AQ2B 4X65L 3MFYA 1O7ZA 1XMQL 5D65A 4H7BA 4WFN3 3GTJH 1XPRA 3J80E 5FJ8G 3BDLA 2F3IA 1VQNA 5IP7H 2OTJA 4JYAQ 1E2ZA 5I9OA 1BCPC 4B3RQ 3UE1A 1JT8A 1A6XA 3CCMA 1R4PB 2X6GA 1QVGA 1DONA 1IBKQ 3NTKA 5C4JH 2CH4A 4UDUC 3MXPA 4YCVA 1XWEA 3F2BA 4V190 3BYTB 4C3IG 5C0XJ 1I94L 2DJGC 3UDFA 2E74C 4DV3L 3X3NA 5AFWA 1AFPA 2ZTCA 2AKWB 2UUCQ 4HSVA 2JE6I 5M5XH 4X62L 1M8AA 4K5VA 2B2YA 4HMJA 3S9WA 5ELFA 1KLGD 2L5TA 2F3VA 2NYZD 3P7JA 3PO3B 3FMCA 2JQOA 1UAPA 5M5WB 1EYDA 3PUZA 5KRUA 1CKNA 2L12A 1F2ZA 2D0OA 2JA7B 4QJFA 2EOTA 5NUCA 3S15H 1EU4A 4JI7L 2F0EA 3PV0A 2FMMA 1SRUA 1VDZA 4KMUC 4JVZA 3AFQA 1BCPF 2CW0D 3ERSX 1JR0D 4Z9CB 2D9UA 1H9JA 1IYUA 3GTQB 5BN5A 3GTLH 2UUAQ 4FF2A 1HTLD 1BBWA 3NP8A 1JJ2A 3NHHA 4RWSC 4BS9A 2FHTA 1VQDA 4JI0Q 1XMOQ 3M3YB 1TS3A 3CHBD 3IL8A 4DF7A 1EQTA 2CCZA 5IOCA 1CA6A 1FVIA 3PUYA 1OO9B 3TEHB 2QDLA 1I4GA 3OOCA 2JA8B 2K33A 2R3ZA 1TWCH 5M3MH 3TMEA 4NPSA 1N36Q 4O1NA 4FYDA 3L9AX 2A6EC 1Y1VG 3QJYA 1O80A 1E7ZA 1SYFA 1TKWB 3PIP3 4L5SA 1AZPA 2IL8A 2B63G 3S14B 4DNIA 1PV4A 2Q8RE 5JJZA 2XRSD 3FRPB 1O7IA 1STBA 4K6LA 1BF4A 3S1RB 3VYRA 3CF5A 2G5DA 2P5ZX 1V1PA 2LKVA 2J0TD 2CQAA 3HOXH 4KY5A 4KHPQ 2VQFQ 3KJOA 3T16A 3S1MH 1I6HH 4B3MQ 2KHSA 3Q8DA 1PH6A 5AJ3L 1WTVA 5LMUQ 4J15A 1BXTA 5IY0A 4A3DG 5IYDH 1NR4A 5K5PA 5CV4A 5M5YH 2BE5D 1QUQA 3S1NB 1D6EC 3BG3A 2R7DA 2AQ1B 3J81E 4A3CG 5A35A 1X3EA 1HUNA 3S1QH 1VQJA 3DM1A 1O7LA 1Q1EA 4DR5L 4A3EG 2VL6A 4ZQ3A 4APVA 3PO2G 2N88A 2KQ3A 5DEHA 1SROA 2JYOA 5T1GA 1QCBD 4CDDC 3R2IA 3AMUA 4ZKBB 1YHQA 1KXLA 1KLUD 4DV6L 4CDCC 1JOOA 1L1OB 4P2CB 3S2DB 1Y1VB 1T5XD 3EROA 1HR0W 4QB4A 1LT4D 2JA5G 1VQ7A 2B63B 4DV7Q 3HKZB 5HY6A 4LFBL 2YTXA 1M4VA 4LFAQ 2E2IB 1WCMH 3TDQA 3V96A 3S17H 4FO2A 4CKEA 5IT9L 3NXWA 3D0FA 1KHIA 2AQ3B 4NW2A 4EX5A 1PTOH 1U4MA 1EOVA 1LUZA 1O7YA 1VQ5A 2OWOA 2K01A 1UE6A 4A3DB 1HA6A 1BR9A 3ZJYC 4DKAC 5ELCA 1SFOH 1II3A 1J9OA 1I4RA 5C5LA 3RLOA 1OXTA 1EY0A 1FJGQ 1ICFB 5BR8Q 2EJMA 4DGZA 2MGSA 2B29A 4DXGA 3BZDB 3PO2B 1QVCA 1WYDA 3R2TA 3G48A 1VF7A 1EEID 1JB3A 1A3VA 1ZKOA 1A3UA 5I9PA 4LNQA 1JWUD 4RKBA 1G2SA 4C1NI 5DNFA 5FLMH 2K50A 4R4QA 3J7AV 1BVSA 2IX1A 3K8AA 4EVOA 1EOTA 5CV7A 3T1YQ 4GN5A 4OWWB 3GTMH 1NJIC 3C2PA 4YWLA 2PPBC 1SYDA 2JA5B 1ESFA 3CQZH 2ZJQA 4BBRH 5JVH3 4KHZA 3KJPA 4ZUJA 3Q6SA 3I4NH 2K32A 2E2JH 1STGA 2F0TA 1TT2A 1PRTD 3S16H 1QG7A 5FOBB 4DAYB 1LT3D 5LMNW 2KBNA 5FO8B 5JPNC 4FXDA 2B2WA 4XYQA 1N33L 2UXBL 1SNOA 1STEA 5IODA 2F0WA 4JI6L 3AB9A 4F88A 4JI4L 4MHEA 4H44C 3HOWH 3NUCA 4LWCA 3QG1A 2D5DA 4K8IA 1NCVA 2KCNA 1PFMA 4KJNA 1OTCA 2F0FA 2ICEC 5GAHC 2KHJA 3SK8A 4R4TA 3W5OA 2NTTA 4UP8A 1E1OA 4HJAA 3K7AB 1TWHH 1CFMA 1TY0A 2WKDA 1VQFA 2LXKA 4TKOB 3HFZB 4DV2Q 3RLFA 2NB0A 2B2UC 4U673 4OEMB 1ENCA 3MEHA 3HOVB 1I6VC 2F1MA 5C3EG 4G4KA 4A93G 3TSSA 1U4PA 1CQFA 1H9MA 2ZT9C 3DEPA 2BDOA 3G7LA 3JAML 5HGQA 2RDHA 3TP8A 3Q24A 1JE4A 4LF9L 3DLLA 3ND9A 3VYTA 1V9PA 3I91A 3A7LA 4WORA 2EIFA 2Z6BA 3VR3A 4FF4A 2L4NA 4LF6L 3VA7A 4DR6Q 3T56B 1TY2A 3JAMi 1ZYRC 2VXWA 1X65A 5C0XH 3CCRA 1E0BA 1GUSA 3A7AB 4ME3A 4GNXB 1GUWA 3F2UA 4RH6A 3GTKB 2C35B 3J80L 1VQCA 4IALA 1HH2P 1Q86C 1ML0D 2R92G 2WB1E 3W1BA 2ZXOA 2XRQD 2EXZA 3E0JA 1RF2D 4OL7A 3CMEA 3A54A 1NAPA 1S5CD 4QF4A 1Y1WH 5T1IA 4JBJA 1YHBA 5K36H 3GTGB 5IYBH 1LABA 4BY7H 4IFDI 2TMPA 4DU9A 2GN5A 2K28A 5C3EB 5H1SE 1A62A 4NMZA 4YY3Q 1RTOA 1D7QA 2WKCA 4DUZQ 1F9QA 3GTJB 1WOCA 4HSPA 2KCTA 3PUWA 2YTYA 4J1MA 4A3IH 2EVBA 2OT2A 2F52A 1IW7C 5GQOA 3A5ZB 2C9OA 3DM3A 2VUMH 1VQBA 1S4ZA 3H0GH 4R4CA 4DK6C 3VYSA 3OWFA 5EPJA 3NK9A 2QDBA 4XT3B 2L15A 5F2DA 4A3LG 2EJGC 4UHVA 2R7ZG 1HFGA 3SE0A 1N9WA 5CBEE 2HHHL 2B2TA 5CR3A 1V8QA 2IWHA 2FINB 1K8OA 1I4QA 2IHEA 4RCOA 2HCIA 5M5XB 2R92B 4B3SL 2RVLA 3CCUA 5IWAQ 2QCPX 4GOPA 1BKBA 3IRBA 4RA8A 2MP1A 2NTSA 1D1KA 1MKHA 1VMCA 2AWOA 2WIIB 1LTTD 4IPGA 2DUDA 5ELOA 5D3IB 4L5RC 3Q0AA 5J1ZA 5E7NA 3SR1A 3ULPA 3U4ZA 2JP1A 2DGYA 4QGUA 3AFPA 3S15B 4G7HC 3I2ZA 3NE5B 3MFGA 4JI2L 2FXQA 1RD9D 4DR3L 1NSNS 3CAMA 5C44H 2VNUD 5EAYA 2K5QA 2QEJC 3GTLB 1GHKA 5IYDG 1B2TA 5JEAH 1X55A 3VDYA 4IPDA 2I46A 4I7ZC 1HNXL 2EYPA 4ABNA 1LT5D 1IBMQ 3SXHA 3PIO3 4GN4B 2F0OA 5I4DA 1K0SA 2QEXA 2CH4W 3PUXA 1HQMC 1KNAA 4HMIA 3GTPB 3TZDA 3VR4A 4YHHQ 3H15A 1AE2A 2D0PA 5IIFA 3OIQA 3J81j 1LTGD 1LTBD 1E3PA 5CV5A 2O4XA 3NSWA 2WV6D 1C8CA 1TWCB 5M3MB 4C56C 2VS1A 2MPMA 1SNCA 1HNZL 3NEMA 1AP0A 3HKZE 3CC4A 1EYCA 1CSQA 2I5LX 4TSSA 3J81L 4KHVA 3HKSA 1H9RA 4G7ZC 1H9SA 1BNZA 4ALPA 5L37A 4QUCA 4CJ0B 1WCMG 4MZ9A 1IXRA 3RLNA 4ZK9B 1K83B 3HOXB 4NXML 5J22A 2ZTEA 3J81i 5KNDA 1E1TA 2KECA 3S1MB 1ILQA 3N52A 1I6HB 4DNRB 2EE1A 4GKKL 3RUZA 4GKJQ 3EQLC 3KK7A 2YYZA 1NY4A 3U4VA 4DUYQ 5EBCA 2A5HA 5M5YB 1B50A 1EY8A 1GUNA 2UXDQ 2R61A 3E9HA 3J7A5 4ZRZA 4PZ8A 2PZUA 3DXJC 1PRTC 3MEFA 2XWJB 3A56A 4LFCL 4EGVA 4M1UB 3DUZA 3A5UA 4Y7NB 4BXXH 5E4XA 3G6EA 2BH8A 1WI5A 4RAUC 5FLMG 5C4XH 2SNMA 3U58A 1YJNA 3U9SA 5IGEA 4HJ5A 2E5LL 1TU2B 4B9XA 4LF7L 4ZUIA 2EJFC 2ZM6Q 4OO1H 2KCCA 4BBRG 5CMDA 3L2PA 1XYIA 2KJXA 3OIPA 2WAQE 3I4NG 1J6QA 2RHQB 3E5SA 4JI5L 2NVXH 4L5QA 1WTHA 1WCMB 2HT1A 3S17B 4ZCKA 1EY7A 5C5MA 3ITPA 5IGDA 1XNQQ 4X65Q 3NBHB 2F0LA 4DAMA 1XMQQ 4FF3A 1PTOB 5DLQE 1C4QA 5LHY1 5IT9c 1DOMA 3S24A 2WB1G 1K3BC 1BBUA 3VR5A 4XQNA 3GQBA 3I56A 4X3UA 1PRTF 4HCSA 1I50H 1PH5A 2UU9L 2JA7G 1DJRD 4DXFA 1A15A 2F4VL 3M9BA 1EY9A 4A3MH 2G9DA 4HIKA 1F9PA 4UP7A 3EIVA 4DV3Q 2F0MA 3TP5A 1WTPA 2A6HC 1TXYA 1CZGA 4X3TA 4DA2A 1KDAA 4KTAA 2AUKA 3H3VH 1YJWA 2F0UA 3GTMB 1HCZA 2I07B 4XTCS 1WTOA 3CQZB 2PI2E 4OX9L 4BBRB 4NDXA 2CWAA 4TRDA 3I4NB 2E2JB 2IPKD 4X64L 3I70A 3CCLA 2OEOA 2JEAI 1DOKA 3S16B 2CWPA 3EN2A 1X32A 2JA8G 2K52A 1OXXK 2PO4A 2OCEA 1F2LA 2EQSA 1IBLQ 2NWGA 4R1JA 2RSOA 3FKIH 3J7AF 3I3CA 4P72A 2WB1B 3A55A 2A1AA 4JPBW 1C0AA 1SE8A 3HOWB 1ZYRD 1PDQA 2Q2IA 3U9OA 1X3QA 5IP9G 1PH2A 2JEBI 5C0XG 1LTAD 3HOUG 4B3RL 3K5NA 4ZAIA 1EQVA 3H6MA 2PW7A 3HOYH 4EQ5A 1LM0A 4DV1Q 1PYBA 3BVGA 4A3JG 2K5DA 3CPWA 4JCVE 4BBSH 4O0AA 2B39A 2E2HH 1VQPA 1MJCA 2UUCL 4OGQC 2ZTDA 4F7XA 2HCCA 3D4WA 1XJVA 5JOBA 1FD7D 4BY7G 4TVAB 2DN8A 1DZ1A 3IFTA 1QZGA 1ILPA 4NXNQ 1CHPD 3CRKC 4P71A 2HQEA 3URYA 2NN6H 2N78A 3GP7A 1B9NA 3MAQA 1S72A 3E9IA 3KDFB 3NTIA 3HOZH 1IW7D 4JV5L 4LMQD 1CQVA 4A3IG 3JAMc 3WDNA 3HKZG 1L1OC 3KF6A 1E24A 1ASYA 3IKJA 4GN3B 3NQIA 2KENA 3HOUB 4K14A 4DR5Q 1L0YB 4C3JG 1PYSB 3ULLA 4XQJA 1UNSA 3GTOH 3RD4A 1TR5A 2CVRA 4JI1L 1XMOL 2UUBL 4A3JB 5EGTA 2A19A 3OHXC 4N9TA 3Q23A 1IZ6A 4DV6Q 1EWCA 3J80c 4B3TQ 3UE0A 1Y1WB 2WFWA 5JEAJ 2IX0A 2H5XA 1VQ4A 3K58A 3QO2A 4K8JA 2RCFA 1SNPA 1N36L 1QE6A 4K6DA 2PQAB 1LTSD 4YCUA 4BY7B 2GVBA 2RA4A 1ENFA 1N34L 1CKMA 3AQQA 1JB7A 1PXUA 2F0QA 2Q8IB 1LO5D 3D6WA 2EY2A 2KEDA 2QKIC 2RQXA 3CD6A 4QCLA 1PZID 3D4RA 2JSOA 4LF5L 1P16A 2RDGA 3P20A 2MJ8A 4LAAA 2QF7A 3D6CA 4CKBA 4A3IB 3HRZC 5JJIA 1G6ZA 4CHTB 2VUMB 1Q82C 3GDEA 5JVG3 3EJIA 4RGOS 2BOSA 4YWMA 3S2HH 5FO7B 1E22A 4JI8L 2WAQG 1J8IA 4BY1H 4C3JB 2BA1A 1JJCB 4OONA 3LWUA 1D5ZC 2R6GA 5C4HA 1A0IA 2PYKA 4JG2A 4AH6A 3OTOQ 4IUQA 1K28A 4HR7B 3A74A 4CJ1B 4H13C 1MHWC 2EXDA 4CDEC 1WTQA 4RFBA 1AEXA 2B2UA 3T1HL 1EIGA 1CKNB 3W3AA 1TWFH 4QUFA 5HURA 5GADC 4DV4L 1VQAA 4A3KG 1LV9A 4OWTB 3UDGA 3CRLC 3CKIB 1DXMA 1JCKB 1Z7TA 2L11A 1DGSA 2DJFC 2Z6KC 3KFUA 5COYA 3T4AC 1N33Q 3NPPA 1EZ8A 3I4MG 4DV0L 4BA2I 2LY7A 5IYCH 3BDOA 4JI6Q 4IPHA 3G4SA 1Y8PB 1SAPA 2JA6H 2NZHA 3T51B 1PTOD 3KUPA 3OWEB 4GS3A 3HOVG 3MXNA 4MTKA 3I73A 4FVMA 1QWYA 1IKMA 1UWVA 2XGTA 2FMCA 1HJPA 4X3SA 1STHA 2ALYB 4UP9A 1Z6HA 4LF4Q 3GV3A 2WAQB 4C3HG 1I5FA 1DOLA 1PH7A 2KA7A 2AWNA 1E2WA 2MO1A 1EYAA 4WJ4A 1Q12A 1FJGL 5BR8L 1X56A 3BDCA 5I6YA 2CQOA 3CCQA 3I4OA 2I0QA 5M3FG 4DR2L 1H95A 3PCOB 2J4XA 5KNBA 1NMFA 1NBWA 3VYUA 3N6RA 1SMYD 4DV5Q 4LF8Q 1AW7A 3T1YL 1FNVA 3C1FA 1FYCA 4K2LA 1EWIA 1V1PB 4IUPA 3M4QA 4A3KB 1K8MA 3J81c 2EZVA 4DNTB 4DK1A 2ICIA 1TS4A 4N8FA 4RGNA 3NENA 4KY7A 4POFA 4PNYA 2RSNA 4GNXC 3J7YW 1U4LA 3CXCA 3IAYA 1WTRA 4AYBE 2WINB 4LF9Q 2VQEL 2K6AA 5DM63 1STYA 1M90C 3I4MB 3D4DA 1QUQB 1SJHD 1W2BA 4A3FG 3TREA 5ISRA 2Q2TA 3DEOA 5FJ8H 2M00A 2DY7A 4HTHA 2L0CA 4DFAA 1S5BD 2XTIA 1A2TA 1TWAH 3RZOH 4C3HB 4C2MH 1TVXA 1KDBA 2K5HA 1W6KA 1SNMA 2A6HD 3K0XA 3LX0A 4RHRA 5IP7G 2AHOB 4JI3Q 3FPPA 2LXJA 2EYMA 4C3IH 2K5NA 1B53A 2IX3A 5M3FB 2K1BA 3M4YA 5FLXE 1VQMA 4F87A 2E76C 4L63B 4HJ7A 4HIOA 1EIHA 1VMPA 4AQYQ 1WTXA 2MHVA 1HZCA 2F0PA 3T53B 3G6JB 1UEAB 2L55A 3R93A 1A3TA 2O5JC 2DNCA 1JMCA 2NVXB 4A76A 1YITA 1NR2A 5FO9B 4DR1Q 1PFBA 1PH9A 1GOZA 1S5ED 1A63A 4KKUA 1ICWA 3FKIG 1TIID 2DY8A 4GZYC 1Z47A 4A3FB 3FP9A 4IOAA 3TQYA 1WVLA 1SE4A 1P8LA 3D31A 1K9MC 1SEBD 4O2DA 1TQOA 1JE5A 4CGYB 1N32Q 3S1NH 3HOYG 4K0KQ 1CI3M 1D8LA 2Q2HA 2IY5B 1SXTA 4RCNA 2ZXRA 5ELNA 4GLXA 2Z1CA 1JWMD 1PMRA 4P73A 5EBDA 1SNDA 1S3OA 3SHLA 4KI0A 4B3SQ 2OF1A 2HIVA 1B9MA 1VQ8A 3OSOA 2M2LA 1KD1C 2IW3A 2KVMA 5C4JB 2I5MX 1D1IA 3HZXA 4EQPA 3S2DH 1Y1VH 1HFNA 2Z4IA 5CORA 1WFQA 1HXYD 3KF8A 1GD7A 5LL6S 4L5TA 2B63H 1T5EA 3MWYW 4ME5A 5M3MG 1C9OA 3KLWA 5JJLA 2ZJRA 3RN2A 4QMGA 5EQ0A 3PF4A 3HOZG 3K57A 4DR3Q 3FPUB 3VR6A 2EYLA 3FDTA 3FKIB 2UXCL 1GXDC 2B2VA 4V0BA 1CUKA 5JJKA 4DAVA 3K0YA 4RGMA 3CPFA 1A8VA 3OYYA 5GAGC 2NVYH 2SDFA 1HNXQ 3OPOA 4RKLA 1BOSA 4A3DH 3HOXG 4KKTA 3HOYB 3C1EA 4A3CH 3PF5A 3UDIA 1GUOA 4A3EH 3A0JA 2CHBD 4BBSB 4JBMA 3K6OA 1ET6A 3KOJA 2E2HB 2I5HA 4DR4L 4Q5VA 4CKCA 3BZCA 4HAEA 2VB2X 4BWGB 5IWAL 5GAEC 2XWBB 4ZLTF 1XX8A 4ZKCB 3AEVA 1GKHA 4ID6A 3VA5A 2SOBA 1K0RA 1CKOA 1PH3A 2OXPA 3FHWA 1SNQA 4IUVA 2EY5A 2PNRC 4KN7C 3HOZB 4GKKQ 4OIKA 1NE3A 3SDZA 1Z9FA 3B6YA 4DR7L 1VF5C 4PMWA 2F03A 1J5EQ 4QY7A 1EFWA 3ICEA 2PZTA 3C3LA 4IUNA 4IFDJ 2ATWA 1I3QH 4R4OA 1A2UA 3SK5A 4BY1G 4L8JA 1QOHA 4IUTA 2K04A 1T9HA 3ND8A 2A74C 1HQRD 5C4ZA 5C0XI 4CBVA 4KN4C 1DM0B 2PW5A 1SJED 2XSCA 4AYBG 2BA0A 2EYOA 2KHIA 4H02A 1XNRL 2K5VA 1PTOC 1LYLA 1VQ9A 5A2QE 1YNJC 3S1QB 1PZJD 1MSGA 2C5CA 4N9PA 2E5LQ 1HNWL 1UE5A 2NZOA 1HR0L 4GOPC 2J7ZA 3NWTA 2MFIA 4KV6A 5IGFA 2Q2UA 4IJHA 3EBEA 3K5MA 1PFSA 1GVPA 3NELA 2EY6A 1RDPD 4JW0A 4CDFC 2ZJPA 4X66Q 4AIMA 3TS2A 3VR2A 1Q3LA 3LWEA 1HZAA 4FDBA 2EDGA 3RN5A 1I4PA 1BO0A 5FKAC 3MHBA 1MBYA 1YNNC 3CCSA 2OQKA 1SMYC 3PIPA 3F2CA 5KNCA 3SVMA 1YJ9A 2NVTH 2H4OA 4GKJL 4HJ9A 4DUYL 3MXGA 1SLJA 4GLVB 1PFNA 2F4VQ 1LTLA 3BU2A 4BY1B 2AMCB 2PMZB 1X3FA 4A3GH 5KYIA 2UXDL 1FR3A 4QIWE 2V4DA 4A4IA 1G91A 2D2CC 4HCEA 5ELEA 1ASZA 1AN8A 1PTOF 1W3SA 1CM9A 3DWQA 1CTMA 2XVSA 3BS1A 3HOWG 5HGTA 4GOPB 3FEWX 4AYBB 1DD2A 1L0XB 1SFOB 2R7FA 3K5OA 3CC2A 3M7GA 3TS0A 1SSOA 1TWFB 3HEJA 3NBIA 1TS5A 2CFMA 2Z9HA 1EWHA 1I94Q 4MNOA 4NKLA 3STBC 1JOKA 2H1EA 3GTGH 2N3SA 1B44D 4X62Q 1QZHA 3F2DA 4PG3A 4PZ7A 4E6IA 3GV6A 4A3BH 1XTDA 5C3EH 4A93H 5LMNL 2JJQA 3NQTA 3AYHB 4FNFA 5FK9C 2XNAC 1XNQL 1M1KC 2JA6B 3M4OH 1FNWA 2PCFB 2R93H 4H0LC 2F0HA 3RR5A 1L1OA 4UPAA 1B8AA 2YU9H 4HN7A 2F0SA 1CSPA 2NBFA 1MSHA 4FF1A 3EA6A 1K8GA 4JI7Q 1ENAA 3TBIB 1XPOA 2Z8LA 3QWNA 2RDFA 4LW1A 1RHPA 3MTSA 1UEBA 4PMCA 1R4QB 4QL5A 2PZWA 1X3PA 4XIGS 2A73B 1H9SB 2E8GA 3A8KE 4MN3A 2R92H 4JYAL 5CGKA 1VQLA 4BA1I 1UUPA 3PUVA 1EU3A 1IBKL 3E3XA 3RZDH 4JOIC 2EYFA 2HUGA 1EYGA 4ULLA 2B8GA 1WD0A 1KTKA 1TWHB 1F9SA 1KQSA 1F2MA 4P74A 1JQYD 4J8QA 1V1OA 5FLXL 4FP5D 1Y1WG 3OMGA 1TWGH 3K80C 4JV5Q 5K36G 1KAAA 4HIMA 1BCPB 2IJ0A 1CZWA 1EQRA 3CCEA 3RMHA 5IYBG 1IBLL 3SEBA 1VCIA 4I65A 4KJOA 1FGBD 3SGIA 1W6JA 4A75A 3D8GA 1AH9A 2KCMA 4XDXA 1STAA 4IZ8A 5G3LD 3MA2B 1TWAB 5J39A 3RZOB 2L9HA 1CA5A 4C2MB 2ZXPA 5GROA 3M85A 1SMXA 4I7AA 4KK7A 4JI1Q 3HG9A 1ET9A 2A69C 3DWAA 4L6TB 3R8BA 2UUBQ 4A3LH 5AJ3Q 4DAYA 2Y0SE 1I4XA 2A68C 2R7ZH 2VUMG 5JAVA 4DV1L 3GTPH 4C3IB 3T13A 3H0GG 4XXEA 1MGSA 4IPCA 1U5KA 3TP7A 1YEZA 3QOLA 2UUAL 1G6PA 2Z0SA 2LS01 3I72A 5J3BA 2TSSA 1JICA 2MUYA 5KIXA 4JI0L 1N34Q 4K5WA 4PQXA 3I4LA 1Q46A 1CHQD 1SE2A 2NVQH 1B1ZA 1IHZA 1KABA 4O42A 1AZQA 4OO1I 5LL6X 1VQIA 2HDMA 4LF5Q 1PH8A 3LNNA 1XPUA 1QNKA 2QA4A 4FXGC 2Z6KA 2JA9A 3L0OA 4PZ6A 4POGA 1SR3A 4NXNL 1L0WA 3NWSA 1K83H 2B2YC 2X6LA 3I7FA 3KLRA 4OHJA 3ZYYX 4EQNA 1EFID 2IT1A 5D3DA 1DYQA 1NNXA 1KAWA 3KYHC 4LFBQ 4YWKA 2F0KA 3CU7A 1MIUA 1Y8NB 4IN3A 1NUCA 1EIYB 3EFXD 4JI8Q 1U9RA 2ES2A 2YTVA 5C44G 1YZ6A 2LMCB 2HIXA 4DN4M 4KHPL 1SYCA 2VQFL 3R3OA 1PVOA 5CV6A 1OXVA 1RTNA 2QW7A 2PI2A 3FVQA 4F8MA 5CBAE 5JEAG 1HHVA 4WJWA 1QILA 4B3ML 2KUMA 3H0GB 2JXMB 4Y7NH 1ZEQX 2NUCA 5LMUL 3BVZA 1MI2A 4U68A 4UAIA 3T1HQ 1C7YA 2GVAA 1TS2A 4B3TL 4IO9A 3H3VI 1SN8A 1X3GA 4DV4Q 5I6WA 1B70B 1G51A 3CC7A 3SK6A 1WTWA 1G2TA 2L1BA 4OXPA 4GNXA 1PZKD 3W1GA 3TN2A 1BUVT 4OELB 4FXKC 1R9TH 4DV0Q 1EY5A 1HZ9A 4IFDH 3V2TA 2NVYB 5EPLA 3BYYB 3GD7A 5E3FA 2QILA 1Q8IA 4DV7L 2FJ2A 1Q90A 5KEEA 1CK1A 3SK4A 4LUOA 3UDXA 4LFAL 2AUJD 2N8NA 1S40A 3E0EA 1B3QA 4HEDA 1RL2A 2QGQA 5C44B 2UXBQ 1X9NA 1WJJA 4JI4Q 1K8AC 3TRZA 2ENBA 4A3EB 4ODGA 1VQGA 2HD3A 1YVCA 1ZXTA 1YNJD 1JWSD 1H9KA 3HP3A 4DR2Q 4M8AA 3ONAB 1DCZA 1Y14B 4IQZA 1WD1A 3OTOL 1XXGA 1EQQA 1ONLA 1KL9A 3DWPA 1YI2A 3EVQA 1Q1BA 2EPBA 3WWVA 4K5XA 4DK3C 1LTRD 2F3WA 1YBYA 2MO0A 4ZYSA 1C48A 5E1FA 3M7NA 4BXXG 3X3MA 1IKLA 1EY6A 2ID0A 4RHSA 5C4XG 4LJZC 4QIWB 1RKNA 2VQEQ 2N49A 2GA4B 1I4HA 4RGTA 1YNND 5A2QL 1IYJB 3KF6B 2NN6I 4XT1B 1YNXA 4OO1G 1B4OA 5CYUA 3K5LA 4JBWA 1UE7A 2PMZE 4JK1C 5D14A 1HUMA 1G291 3PO3H 5DM73 1I3QB 5M5WH 4OWXB 3HS0C 3TP6A 4G7OC 4A3GG 3KBXA 5DAUA 1GO3E 2JA7H 2LFNA 5BN3A 1MD2D 4LF4L 4R9WA 1ESRA 4XYOA 4LF6Q 4YCWA 5KYLA 1UE1A 2WP8J 1IL8A 4LUZA 3C46A 3H09A 3JC66 3GTQH 2K05A 2K5WA 1IYVA 1X54A 2E75C 3WOFA 2XN9C 4A3MG 4PMBA 3STBD 4P75A 5EJWA 1JORA 3CCJA 5ELDA 1HA5A 3BJUA 3PIOA 3M3YH 3CCVA 3PMFA 4DV5L 2K75A 3H91A 4LF8L 1PA6A 3BZKA 5C4XB 4A3BG 4UY8C 3MVVA 2HQLA 1SBBB 3P75A 2JA8H 2Y0SG 4OIJA 1RCVD 2E2DC 2F0NA 4DV2L 2M9VA 3RNUA 3PSIA 2R93G 4X6AH 3I8ZA 4Y52H 4MIUA 3H3VC 2NVTB 1BCPD 1GHJA 2X69A 5M9OA 3I90A 3S14H 1D5MC 2BDNA 3L7ZC 3E6ZX 3KBGA 3S1RH 2F0DA 3I55A 4A3GB 5IP9H 3IFDA 1GJXA 1EEFD 3HOUH 1LLRD 2F0JA 5JPMC 1JOQA 3D3RA 3MXUA 2B2WC 2RHSB 1KDCA 1B7YB 1HPCA 4NB3A 3K7UC 1PHJA 4A3JH 1EUJA 1LTID 1HZBA 2EY1A 5CV9A 3DHQA 1I50B 1OXSC 3QB3A 4JI3L 3CMAA 2CW0C 1VS0A 4DR6L 4IJLA 4JC0A 4A3MB 2HHHQ 4HJ8A 1QNUA 3F1ZA 1K3RA 2VY3A 4ILWA 4AQYL 3K81C 2D62A 5EPKA 3J80i 2K4KA 1QJOA 3W2DA 3KLSX 3UI2A 4BBSG 3PGZA 4A3BB 1S5DD 4B08A 1D5XC 4A93B 3GO5A 4QQBX 3J7ZC 2YV5A 4DK0A 2UXCQ 2Y0SB 4G57A 4DR1L 3MXNB 1PLFA 3TZUA 3V05A 5C6AA 3M4OB 1KRTA 2R93B 2B8FA 1FNUA 4NP5A 1B3AA 5IGBA 3A8IE 4X3KA 4HIDA 1KIXA 2K03A 2YU9B 3BVMA 1VQ6A 2NN6G 2A69D 1IL2A 1MJEA 1VQEA 3KLSA 2Z4HA 2E2IH 1CT1D 3AU7A 4JI2Q 3WOEA 4YY3L 1Q8KA 2A68D 1EY4A 4DPGA 1V1QA 4LUVA 1N32L 3OW7A 2Q8TA 4C3JH 4K0KL 4DUZL 2MQHA 2WACA 3NBHA 2PNHA 4DR4Q 4KY6A 1PH1A 2F4IA 5EKLA 5G3LF 2A6ED 1Y69U 2HDLA 2SEBD 1F77A 3Q22A 1F2YA 3MC0B 4KKSA 3G71A 1EZ6A 3HGBA 3CP0A 2BE5C 4MTNA 2DNEA 3RZDB 1OXUA 2O2LD 2SNSA 1NTGA 4N8X1 1YIJA 1Y8OB 4IOCA 1QVFA 3M4PA 1S5FD 1YHAA 3PO2H 4IURA 2K7VA 1HNZQ 1PYWD 5IT9E
chains in the Genus database with same CATH topology
4C1NK 1TWGB 4LK1C 1GUTA 5I2YA 5BN4A 1EL0A 2KEEA 4XQQA 1JC7A 2FFKB 1KNEA 1HRJA 4TQUS 5C3XA 1RJTA 4PV1C 2R7ZB 2BCOA 1SE3A 2VB3X 4J6HA 4R8NA 3K59A 2EYHA 3QIAA 5I2XA 4WRDA 2G9HD 3GTOB 4KD4A 2XIWA 2NVQB 1HTPA 5ELBA 5IGGA 1QB5D 4B9WA 1BDOA 2B2TC 3OMCA 1F9RA 1SYBA 3L3OC 3A8JE 4IFDG 5KGUA 2RKSA 4KD3A 2B2VC 5EKKA 1E2VA 1BQQT 1U4RA 4K2KA 1SDFA 1SYEA 2N55A 3O13A 1LT6D 4IUUA 4S3SA 1LACA 2F0VA 2F0IA 5E4WC 4YIJA 2EYJA 4CJ2C 3NTHA 1D2BA 1GUGA 3S2HB 3ERQA 5C3WA 2O5IC 5IGCA 2RBMA 2F0GA 1V43A 3QOJA 2NZ1D 1SYGA 4EQOA 3H94A 5CV8A 1BBXC 1XTCD 3JAME 1O78A 1R9TB 3DMUA 5CC4A 1G8ZD 1PRTB 2PQEA 4DAPA 3MZ5A 2KOLA 4R8IA 3P1HA 1RODA 4Q0FA 5EKIA 5TSSA 1STNA 2AQ2B 3MFYA 1O7ZA 5D65A 4H7BA 4WFN3 3J80E 3BDLA 1E2ZA 5I9OA 1BCPC 1A6XA 1R4PB 2X6GA 1DONA 3NTKA 4UDUC 3MXPA 1XWEA 4V190 3BYTB 4C3IG 5C0XJ 2E74C 3X3NA 5AFWA 1AFPA 4HSVA 2JE6I 1M8AA 4K5VA 2B2YA 4HMJA 3S9WA 5ELFA 1KLGD 2L5TA 2F3VA 2NYZD 3P7JA 3PO3B 3FMCA 1UAPA 5M5WB 1EYDA 3PUZA 5KRUA 2L12A 1F2ZA 2JA7B 2EOTA 5NUCA 1EU4A 2F0EA 3PV0A 2FMMA 4KMUC 1VDZA 1BCPF 2CW0D 1JR0D 4Z9CB 2D9UA 1H9JA 1IYUA 3GTQB 5BN5A 4FF2A 1HTLD 3NP8A 3NHHA 4RWSC 4BS9A 2FHTA 3M3YB 1TS3A 3CHBD 3IL8A 4DF7A 1EQTA 5IOCA 1CA6A 3PUYA 1OO9B 1I4GA 3OOCA 2JA8B 2K33A 2R3ZA 3TMEA 4O1NA 4FYDA 3L9AX 2A6EC 3QJYA 1O80A 1TKWB 1SYFA 3PIP3 1AZPA 2IL8A 3S14B 2Q8RE 5JJZA 2XRSD 3FRPB 1STBA 4K6LA 1BF4A 3S1RB 3VYRA 1V1PA 2LKVA 2J0TD 2CQAA 4KY5A 3T16A 2KHSA 1WTVA 1BXTA 1NR4A 5K5PA 5CV4A 3S1NB 2BE5D 1D6EC 3BG3A 2AQ1B 3J81E 5A35A 1HUNA 3DM1A 1O7LA 1Q1EA 4ZQ3A 2N88A 2KQ3A 5DEHA 2JYOA 5T1GA 1QCBD 3R2IA 3AMUA 4ZKBB 1KLUD 1JOOA 4P2CB 3S2DB 1Y1VB 1T5XD 3EROA 4QB4A 1LT4D 2B63B 3HKZB 1M4VA 2E2IB 3TDQA 3V96A 4FO2A 4CKEA 5IT9L 3NXWA 2AQ3B 4NW2A 1PTOH 1U4MA 1O7YA 2K01A 4A3DB 1HA6A 1BR9A 5ELCA 1II3A 1J9OA 1I4RA 5C5LA 1OXTA 1EY0A 2EJMA 4DGZA 2MGSA 4DXGA 3BZDB 3PO2B 3R2TA 1VF7A 1EEID 1JB3A 1A3VA 1ZKOA 1A3UA 5I9PA 1JWUD 4RKBA 1G2SA 4C1NI 5DNFA 3J7AV 2IX1A 4EVOA 1EOTA 5CV7A 3C2PA 2PPBC 1SYDA 2JA5B 1ESFA 5JVH3 4KHZA 4ZUJA 3Q6SA 2K32A 1STGA 2F0TA 1TT2A 1PRTD 1QG7A 5FOBB 1LT3D 5FO8B 5JPNC 4FXDA 2B2WA 4XYQA 1SNOA 1STEA 5IODA 2F0WA 3AB9A 4F88A 4MHEA 4H44C 3NUCA 3QG1A 2D5DA 4K8IA 1NCVA 2KCNA 1PFMA 4KJNA 2F0FA 2ICEC 3SK8A 2NTTA 3K7AB 1CFMA 1TY0A 2WKDA 4TKOB 3RLFA 2NB0A 2B2UC 4U673 1ENCA 3MEHA 3HOVB 1I6VC 2F1MA 4G4KA 3TSSA 1U4PA 1CQFA 1H9MA 2ZT9C 3DEPA 2BDOA 3G7LA 3JAML 2RDHA 3TP8A 3Q24A 1JE4A 3ND9A 3VYTA 3I91A 3A7LA 4WORA 3VR3A 4FF4A 2L4NA 3VA7A 3T56B 1TY2A 1ZYRC 2VXWA 5C0XH 1E0BA 1GUSA 3A7AB 1GUWA 3F2UA 4RH6A 3GTKB 3J80L 4IALA 1ML0D 2ZXOA 2XRQD 2EXZA 3E0JA 1RF2D 4OL7A 3A54A 1NAPA 1S5CD 4QF4A 5T1IA 5K36H 3GTGB 1LABA 4IFDI 2TMPA 4DU9A 2K28A 5C3EB 4NMZA 1RTOA 2WKCA 1F9QA 3GTJB 4HSPA 3PUWA 4J1MA 2EVBA 2OT2A 1IW7C 2C9OA 1S4ZA 3VYSA 3OWFA 5EPJA 3NK9A 2QDBA 4XT3B 5F2DA 2EJGC 1HFGA 3SE0A 5CBEE 2B2TA 5CR3A 1V8QA 2IWHA 2FINB 1K8OA 1I4QA 4RCOA 2HCIA 5M5XB 2R92B 2RVLA 2QCPX 4RA8A 2MP1A 2NTSA 1D1KA 1VMCA 2AWOA 2WIIB 1LTTD 5D3IB 3Q0AA 5J1ZA 3SR1A 2JP1A 3S15B 4G7HC 3NE5B 3MFGA 1RD9D 2VNUD 1NSNS 2K5QA 2QEJC 3GTLB 1GHKA 1B2TA 5JEAH 2I46A 4I7ZC 2EYPA 4ABNA 1LT5D 3SXHA 3PIO3 2F0OA 5I4DA 3PUXA 1HQMC 1KNAA 4HMIA 3GTPB 3TZDA 3VR4A 5IIFA 3OIQA 1LTGD 1LTBD 5CV5A 2O4XA 3NSWA 2WV6D 1C8CA 1TWCB 5M3MB 4C56C 2MPMA 1SNCA 1AP0A 1EYCA 4TSSA 3J81L 4KHVA 1H9RA 4G7ZC 1H9SA 1BNZA 4QUCA 4CJ0B 4ZK9B 1K83B 3HOXB 5J22A 5KNDA 2KECA 3S1MB 1ILQA 3N52A 1I6HB 4DNRB 2EE1A 3RUZA 3EQLC 3KK7A 2YYZA 5EBCA 2A5HA 5M5YB 1B50A 1EY8A 1GUNA 2R61A 4ZRZA 2PZUA 3DXJC 1PRTC 2XWJB 3A56A 4EGVA 4M1UB 3DUZA 4Y7NB 5E4XA 4RAUC 2SNMA 3U9SA 5IGEA 1TU2B 4B9XA 4ZUIA 2EJFC 4OO1H 2KCCA 5CMDA 1XYIA 2KJXA 3OIPA 3E5SA 1WCMB 3S17B 1EY7A 5C5MA 3ITPA 5IGDA 2F0LA 4FF3A 1PTOB 1C4QA 5LHY1 1DOMA 3VR5A 4XQNA 3GQBA 4X3UA 1PRTF 4HCSA 1DJRD 4DXFA 1A15A 1EY9A 2G9DA 1F9PA 2F0MA 3TP5A 1WTPA 2A6HC 1CZGA 4X3TA 4DA2A 1KDAA 4KTAA 2AUKA 2F0UA 3GTMB 1HCZA 2I07B 4XTCS 1WTOA 3CQZB 4BBRB 4NDXA 3I4NB 4TRDA 2E2JB 2IPKD 3I70A 3S16B 2OEOA 2JEAI 1DOKA 1X32A 1OXXK 2PO4A 1F2LA 2NWGA 2RSOA 3J7AF 3I3CA 2WB1B 3A55A 3HOWB 1ZYRD 1PDQA 3U9OA 1X3QA 2JEBI 5C0XG 1LTAD 3K5NA 4ZAIA 1EQVA 2PW7A 3H6MA 3BVGA 2K5DA 2B39A 4OGQC 4F7XA 2HCCA 3D4WA 5JOBA 1FD7D 2DN8A 1DZ1A 3IFTA 1ILPA 1CHPD 3CRKC 2HQEA 3URYA 2NN6H 3GP7A 1B9NA 3MAQA 3NTIA 1IW7D 4LMQD 1CQVA 3WDNA 3IKJA 3NQIA 3HOUB 4K14A 1L0YB 4C3JG 4XQJA 1UNSA 3RD4A 1TR5A 2CVRA 4A3JB 5EGTA 3OHXC 4N9TA 3Q23A 1EWCA 1Y1WB 5JEAJ 2IX0A 3K58A 3QO2A 4K8JA 1SNPA 1QE6A 4K6DA 1LTSD 4BY7B 2RA4A 1ENFA 1PXUA 2F0QA 2Q8IB 1LO5D 3D6WA 2EY2A 2KEDA 2QKIC 2RQXA 4QCLA 1PZID 3D4RA 2JSOA 2RDGA 3P20A 2MJ8A 4LAAA 2QF7A 3D6CA 4CKBA 4A3IB 3HRZC 1G6ZA 4CHTB 2VUMB 5JVG3 3EJIA 4RGOS 2BOSA 5FO7B 1J8IA 4C3JB 2BA1A 3LWUA 1D5ZC 2R6GA 5C4HA 2PYKA 4IUQA 4HR7B 4CJ1B 4H13C 1WTQA 4RFBA 1AEXA 2B2UA 1EIGA 3W3AA 5HURA 4QUFA 1LV9A 3CRLC 3CKIB 1DXMA 1JCKB 1Z7TA 2L11A 5COYA 3T4AC 3NPPA 1EZ8A 4BA2I 2LY7A 3BDOA 1Y8PB 1SAPA 3T51B 1PTOD 3KUPA 3OWEB 3MXNA 3I73A 4FVMA 1QWYA 1IKMA 2FMCA 4X3SA 1STHA 1Z6HA 3GV3A 2WAQB 4C3HG 1DOLA 2KA7A 2AWNA 1E2WA 1EYAA 1Q12A 3BDCA 5I6YA 5KNBA 2J4XA 3VYUA 3N6RA 1SMYD 1AW7A 1FNVA 3C1FA 1FYCA 4K2LA 1V1PB 4IUPA 4A3KB 1K8MA 2EZVA 4DNTB 4DK1A 2ICIA 1TS4A 4RGNA 4KY7A 4PNYA 2RSNA 3J7YW 1U4LA 3IAYA 1WTRA 2WINB 2K6AA 5DM63 1STYA 3I4MB 3D4DA 1SJHD 5ISRA 3DEOA 2M00A 2DY7A 4HTHA 2L0CA 4DFAA 1S5BD 1A2TA 4C3HB 1TVXA 1KDBA 1W6KA 1SNMA 2A6HD 4RHRA 3LX0A 3FPPA 2EYMA 1B53A 2IX3A 5M3FB 2K1BA 3M4YA 5FLXE 4F87A 2E76C 4L63B 1EIHA 1VMPA 1WTXA 2MHVA 2F0PA 3T53B 3G6JB 1UEAB 2L55A 3R93A 1A3TA 2O5JC 2DNCA 2NVXB 1NR2A 5FO9B 1PFBA 1GOZA 1S5ED 4KKUA 1ICWA 1TIID 2DY8A 4GZYC 1Z47A 4A3FB 1WVLA 1SE4A 3D31A 1SEBD 1TQOA 4CGYB 1CI3M 1SXTA 4RCNA 2ZXRA 2Z1CA 1JWMD 1PMRA 5EBDA 1SNDA 3SHLA 4KI0A 2OF1A 1B9MA 3OSOA 2M2LA 2IW3A 2KVMA 5C4JB 1D1IA 3HZXA 4EQPA 1HFNA 2Z4IA 5CORA 1HXYD 3KF8A 5LL6S 1T5EA 3MWYW 4ME5A 4QMGA 5EQ0A 3K57A 3FPUB 3VR6A 2EYLA 3FDTA 3FKIB 1GXDC 2B2VA 4V0BA 4DAVA 3K0YA 4RGMA 2SDFA 3OPOA 4RKLA 1BOSA 4KKTA 3HOYB 3C1EA 1GUOA 2CHBD 4BBSB 3K6OA 1ET6A 2E2HB 4Q5VA 4CKCA 4HAEA 2VB2X 4BWGB 2XWBB 4ZLTF 1XX8A 4ZKCB 4ID6A 3VA5A 2SOBA 2OXPA 1SNQA 4IUVA 2EY5A 2PNRC 4KN7C 3HOZB 4OIKA 3SDZA 1VF5C 4PMWA 2F03A 2PZTA 3C3LA 4IUNA 4IFDJ 1A2UA 3SK5A 4L8JA 1QOHA 4IUTA 2K04A 3ND8A 2A74C 1HQRD 5C4ZA 5C0XI 4CBVA 4KN4C 1DM0B 2PW5A 1SJED 2XSCA 2BA0A 2EYOA 1PTOC 5A2QE 1YNJC 3S1QB 1PZJD 1MSGA 2C5CA 4N9PA 2J7ZA 3NWTA 4KV6A 5IGFA 3K5MA 2EY6A 1RDPD 3VR2A 1Q3LA 3LWEA 2EDGA 1I4PA 1BO0A 5FKAC 3MHBA 1MBYA 1YNNC 1SMYC 5KNCA 3SVMA 2H4OA 3MXGA 1PFNA 4BY1B 2PMZB 5KYIA 1FR3A 2V4DA 1G91A 2D2CC 4HCEA 5ELEA 1AN8A 1PTOF 1CM9A 3DWQA 1CTMA 2XVSA 3BS1A 5HGTA 3FEWX 4AYBB 1DD2A 1L0XB 1SFOB 3K5OA 3M7GA 1SSOA 1TWFB 3HEJA 3NBIA 1TS5A 1EWHA 4NKLA 1JOKA 2H1EA 1B44D 4E6IA 3GV6A 3NQTA 4FNFA 5FK9C 2XNAC 2JA6B 1FNWA 2PCFB 4H0LC 2F0HA 4HN7A 2F0SA 2NBFA 4FF1A 1MSHA 3EA6A 1ENAA 3TBIB 2Z8LA 3QWNA 2RDFA 1RHPA 3MTSA 4PMCA 1R4QB 2PZWA 1X3PA 4XIGS 2A73B 1H9SB 3A8KE 4MN3A 5CGKA 4BA1I 1UUPA 3PUVA 1EU3A 2EYFA 2HUGA 4ULLA 2B8GA 1WD0A 1KTKA 1TWHB 1F9SA 1F2MA 1JQYD 4J8QA 1V1OA 5FLXL 4FP5D 3OMGA 5K36G 1KAAA 1BCPB 2IJ0A 1CZWA 3RMHA 3SEBA 1VCIA 4I65A 4KJOA 1FGBD 1W6JA 3D8GA 4XDXA 1STAA 4IZ8A 5G3LD 3MA2B 1TWAB 5J39A 3RZOB 2L9HA 1CA5A 4C2MB 2ZXPA 3M85A 4KK7A 3HG9A 1ET9A 2A69C 3DWAA 4L6TB 3R8BA 4DAYA 1I4XA 2A68C 5JAVA 4C3IB 3T13A 4XXEA 1MGSA 3TP7A 3QOLA 2LS01 3I72A 2TSSA 1JICA 2MUYA 5KIXA 4K5WA 4PQXA 3I4LA 1CHQD 1SE2A 1B1ZA 1IHZA 1KABA 4O42A 1AZQA 4OO1I 5LL6X 2HDMA 3LNNA 1QNKA 4FXGC 3NWSA 2X6LA 2B2YC 3KLRA 4OHJA 3ZYYX 4EQNA 1EFID 2IT1A 5D3DA 1DYQA 2F0KA 3CU7A 4IN3A 1Y8NB 1NUCA 3EFXD 1U9RA 2LMCB 4DN4M 1SYCA 3R3OA 5CV6A 1OXVA 1RTNA 3FVQA 4F8MA 5JEAG 5CBAE 1HHVA 4WJWA 1QILA 2KUMA 3H0GB 2JXMB 1ZEQX 2NUCA 3BVZA 1MI2A 4U68A 4UAIA 1TS2A 5I6WA 3SK6A 1WTWA 1G2TA 2L1BA 1PZKD 3TN2A 1BUVT 4FXKC 1EY5A 4IFDH 3V2TA 2NVYB 5EPLA 3BYYB 3GD7A 5E3FA 2QILA 1Q8IA 2FJ2A 1Q90A 5KEEA 1CK1A 3SK4A 2AUJD 4HEDA 5C44B 2ENBA 4A3EB 4ODGA 3HP3A 1YNJD 1ZXTA 1JWSD 1H9KA 4M8AA 3ONAB 1DCZA 4IQZA 1WD1A 1XXGA 1ONLA 3DWPA 3EVQA 1Q1BA 2EPBA 4K5XA 1LTRD 2F3WA 4ZYSA 1C48A 5E1FA 3M7NA 3X3MA 1IKLA 1EY6A 2ID0A 4RHSA 4LJZC 4QIWB 1RKNA 2GA4B 1I4HA 4RGTA 1YNND 5A2QL 2NN6I 4XT1B 4OO1G 1B4OA 5CYUA 3K5LA 4JBWA 4JK1C 5D14A 1HUMA 1G291 5DM73 1I3QB 3HS0C 3TP6A 4G7OC 3KBXA 5DAUA 2LFNA 5BN3A 1MD2D 4R9WA 1ESRA 4XYOA 5KYLA 2WP8J 1IL8A 3C46A 3H09A 2K05A 2K5WA 1IYVA 2E75C 3WOFA 2XN9C 4PMBA 5EJWA 1JORA 5ELDA 1HA5A 3PMFA 3H91A 5C4XB 3MVVA 1SBBB 3P75A 4OIJA 1RCVD 2E2DC 2F0NA 2M9VA 3I8ZA 4MIUA 3H3VC 2NVTB 1BCPD 1GHJA 2X69A 5M9OA 3I90A 1D5MC 2BDNA 3L7ZC 3E6ZX 3KBGA 2F0DA 4A3GB 3IFDA 1GJXA 1EEFD 1LLRD 2F0JA 5JPMC 1JOQA 3D3RA 3MXUA 2B2WC 1KDCA 1HPCA 1LTID 2EY1A 5CV9A 3DHQA 1I50B 1OXSC 3QB3A 2CW0C 4A3MB 1QNUA 4ILWA 2D62A 5EPKA 3W2DA 1QJOA 3KLSX 3UI2A 4A3BB 1S5DD 4B08A 1D5XC 4A93B 3GO5A 4DK0A 2Y0SB 4G57A 1PLFA 3TZUA 3V05A 5C6AA 3M4OB 2R93B 2B8FA 1FNUA 4NP5A 5IGBA 1B3AA 3A8IE 4X3KA 2YU9B 2K03A 3BVMA 2NN6G 2A69D 3KLSA 2Z4HA 1CT1D 3AU7A 3WOEA 2A68D 1EY4A 3OW7A 2Q8TA 2WACA 3NBHA 4KY6A 2F4IA 5EKLA 5G3LF 2A6ED 1Y69U 2HDLA 2SEBD 1F77A 3Q22A 1F2YA 3MC0B 4KKSA 1EZ6A 3HGBA 2BE5C 2DNEA 3RZDB 1OXUA 2O2LD 2SNSA 1Y8OB 1S5FD 4IURA 2K7VA 1PYWD 5IT9E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QOL A;  5CR3 A;  1EY8 A;  3QOJ A;  5M9O A;  1SYG A;  2ENB A;  4E6I A;  2F0Q A;  3NXW A;  4EQO A;  5KIX A;  2PZU A;  2EY2 A;  4ODG A;  2PZT A;  1ENC A;  3MEH A;  4IUN A;  3NP8 A;  4K5W A;  3NHH A;  2F0D A;  3NQT A;  5CV8 A;  1IHZ A;  1A2U A;  1KAB A;  1SND A;  3C1F A;  3U9O A;  2F0J A;  3SHL A;  3SK5 A;  4K2L A;  1JOQ A;  3DMU A;  1KDC A;  2OF1 A;  4LAA A;  2F0H A;  3D6C A;  3OSO A;  5CC4 A;  3EVQ A;  4DF7 A;  5C4Z A;  3TP8 A;  5IOC A;  4K5X A;  1EQV A;  2F3W A;  2EY1 A;  5CV9 A;  4KY7 A;  2PW7 A;  3DHQ A;  3H6M A;  1II3 A;  2PW5 A;  3HZX A;  3QB3 A;  2SNM A;  4PNY A;  5E1F A;  4EQP A;  3EJI A;  5C5L A;  2EYO A;  2F0S A;  2PQE A;  5J1Z A;  3SR1 A;  4EQN A;  1EY0 A;  1EY6 A;  4WOR A;  1ENA A;  3MZ5 A;  3TME A;  1STY A;  4B9X A;  4DGZ A;  5IGE A;  4J6H A;  1RKN A;  2RDF A;  4R8N A;  4ZUI A;  3D4D A;  2F0K A;  3TP7 A;  3P1H A;  4N9P A;  4PMC A;  4ME5 A;  2EYH A;  3E5S A;  5ISR A;  1NUC A;  2PZW A;  1SYF A;  1A3V A;  1NSN S;  1STN A;  2M00 A;  1A3U A;  4KV6 A;  4QMG A;  5C4H A;  5I9P A;  5IGF A;  4RKB A;  1U9R A;  2PYK A;  1EY7 A;  4H7B A;  4HTH A;  5C5M A;  4F7X A;  4WRD A;  2EYL A;  1STB A;  3ITP A;  4DFA A;  5IGD A;  3D4W A;  2F0L A;  3BDL A;  5JOB A;  5CV7 A;  4EVO A;  2EY6 A;  4KD4 A;  1A2T A;  5CGK A;  1SYC A;  2EYP A;  3R3O A;  4G57 A;  2LKV A;  5IGG A;  5CV6 A;  4IAL A;  4B9W A;  1SYD A;  4F8M A;  4KY5 A;  5C6A A;  5I9O A;  3OMC A;  1KDB A;  1SNM A;  3T16 A;  1AEX A;  3SXH A;  3TP6 A;  3LX0 A;  5DAU A;  2F0O A;  2EXZ A;  4ZUJ A;  2EYF A;  2NUC A;  4RKL A;  4HMI A;  2HQE A;  4NP5 A;  5HUR A;  1STG A;  2F0T A;  4OL7 A;  1SYB A;  1TT2 A;  5IGB A;  2KHS A;  2EYM A;  4QF4 A;  5IIF A;  3MHB A;  1F2M A;  5C3X A;  3C1E A;  3MXP A;  5KYL A;  5CV5 A;  5K5P A;  2O4X A;  5CV4 A;  5I6W A;  5KGU A;  3OMG A;  2RKS A;  4KD3 A;  4DU9 A;  1EY9 A;  1SNC A;  3SK6 A;  1EY4 A;  1KAA A;  5EKK A;  1SNO A;  2F0P A;  4K2K A;  1EYC A;  5IOD A;  2F0W A;  4NMZ A;  1A3T A;  1SYE A;  3BDC A;  5I6Y A;  4KHV A;  4K5V A;  5KYI A;  1EZ8 A;  2F0M A;  4HMJ A;  2WAC A;  3NUC A;  4I65 A;  4KJO A;  4PMB A;  3S9W A;  4K8I A;  4ZQ3 A;  3TP5 A;  4S3S A;  3D8G A;  4K14 A;  1JOR A;  2KQ3 A;  4KY6 A;  2F0V A;  5DEH A;  4KJN A;  1EY5 A;  1KDA A;  2F0F A;  2F0I A;  1STA A;  2F3V A;  3PMF A;  4IZ8 A;  4KTA A;  5EKL A;  4J1M A;  5HGT A;  1TR5 A;  2F0U A;  5J39 A;  4YIJ A;  5EGT A;  1EYD A;  2EYJ A;  3SK8 A;  1F2Y A;  3V2T A;  4N9T A;  5KRU A;  1EZ6 A;  1JOO A;  1STH A;  3MVV A;  5J22 A;  1F2Z A;  4ID6 A;  4MIU A;  2SOB A;  4NDX A;  5E3F A;  3VA5 A;  3ERO A;  3P75 A;  4TRD A;  2SNS A;  3OWF A;  4QB4 A;  3HEJ A;  2OXP A;  3NK9 A;  5JAV A;  1SNQ A;  2QDB A;  2OEO A;  3ERQ A;  5C3W A;  2EY5 A;  2F0N A;  3SK4 A;  5KEE A;  5NUC A;  1EYA A;  3RUZ A;  5F2D A;  3T13 A;  2F0E A;  5IGC A;  2RBM A;  4NKL A;  1TQO A;  4K8J A;  2F0G A;  1SNP A;  1JOK A;  4K6D A; 
#chains in the Genus database with same CATH topology
 4C1N K;  1TWG B;  4LK1 C;  2OTL A;  1GUT A;  5I2Y A;  4DR7 Q;  5FLX c;  1EIF A;  5BN4 A;  1EL0 A;  1GM5 A;  1K73 C;  2KEE A;  2JA5 H;  4JBK A;  4XQQ A;  1JC7 A;  5IE8 A;  2FFK B;  1Q7Y C;  1NMG A;  4NXM Q;  1KNE A;  1HRJ A;  4TQU S;  4KLK A;  3ER0 A;  1VQH A;  4GLA C;  5C3X A;  2VZA A;  1RJT A;  4PV1 C;  2R7Z B;  2BCO A;  1SE3 A;  2VB3 X;  4J6H A;  4R8N A;  1Q81 C;  2LSS A;  1XNR Q;  3K59 A;  2EYH A;  3QIA A;  1VQK A;  2ASB A;  4R4I A;  1X6O A;  4RMF A;  1HNW Q;  5I2X A;  1HR0 Q;  4WRD A;  2G9H D;  4LFC Q;  3GTO B;  4KD4 A;  3CW2 C;  2XIW A;  2NVQ B;  1IBM L;  1HTP A;  5ELB A;  5IGG A;  1QB5 D;  4B9W A;  1BDO A;  2B2T C;  3OMC A;  4YHH L;  1AE3 A;  1F9R A;  4A3K H;  2A8V A;  1VQO A;  1SYB A;  3K7A H;  1KRS A;  3ULJ A;  3L3O C;  4LF7 Q;  3A8J E;  4IFD G;  5KGU A;  4WJ3 M;  2RKS A;  4KD3 A;  2B2V C;  3I4M H;  5EKK A;  4JI5 Q;  1FGU A;  2MNA A;  1E2V A;  1BQQ T;  1U4R A;  4K2K A;  1SDF A;  1SYE A;  2N55 A;  3O13 A;  3HOV H;  1LT6 D;  1J5E L;  4IUU A;  4S3S A;  1LAC A;  2F0V A;  2F0I A;  3QR8 A;  5E4W C;  5IYC G;  4YIJ A;  2JA6 G;  2EYJ A;  4C3H H;  2V1C C;  4CJ2 C;  1RIP A;  3NTH A;  1D2B A;  1GUG A;  3KDF A;  2UU9 Q;  1U0L A;  3S2H B;  3ERQ A;  1PH4 A;  5C3W A;  2O5I C;  5M3F H;  2RCN A;  5IGC A;  2RBM A;  3KF8 B;  2F0G A;  1V43 A;  2RF4 A;  1JJG A;  2JK8 A;  3QOJ A;  2NZ1 D;  2VW9 A;  1SYG A;  4JOI A;  4EQO A;  2IHF A;  2BH2 A;  1N8R C;  3H94 A;  1FL0 A;  5CV8 A;  3GTK H;  1BBX C;  1XTC D;  5LMN Q;  3JAM E;  3OW2 A;  1O78 A;  3F8T A;  3DMU A;  1R9T B;  1KC8 C;  5CC4 A;  4X66 L;  4OX9 Q;  1L2F A;  2B3G A;  3LGJ A;  4X64 Q;  3PO3 G;  1G8Z D;  1PRT B;  2OQ0 A;  2PQE A;  4DAP A;  2ZM6 L;  4RG1 A;  4A3F H;  3MZ5 A;  2K14 A;  2KOL A;  4R8I A;  2CKZ B;  2PQA A;  3PQI A;  3U50 C;  3P1H A;  1ROD A;  4Q0F A;  2JN4 A;  5EKI A;  5TSS A;  1STN A;  2AQ2 B;  4X65 L;  3MFY A;  1O7Z A;  1XMQ L;  5D65 A;  4H7B A;  4WFN 3;  3GTJ H;  1XPR A;  3J80 E;  5FJ8 G;  3BDL A;  2F3I A;  1VQN A;  5IP7 H;  2OTJ A;  4JYA Q;  1E2Z A;  5I9O A;  1BCP C;  4B3R Q;  3UE1 A;  1JT8 A;  1A6X A;  3CCM A;  1R4P B;  2X6G A;  1QVG A;  1DON A;  1IBK Q;  3NTK A;  5C4J H;  2CH4 A;  4UDU C;  3MXP A;  4YCV A;  1XWE A;  3F2B A;  4V19 0;  3BYT B;  4C3I G;  5C0X J;  1I94 L;  2DJG C;  3UDF A;  2E74 C;  4DV3 L;  3X3N A;  5AFW A;  1AFP A;  2ZTC A;  2AKW B;  2UUC Q;  4HSV A;  2JE6 I;  5M5X H;  4X62 L;  1M8A A;  4K5V A;  2B2Y A;  4HMJ A;  3S9W A;  5ELF A;  1KLG D;  2L5T A;  2F3V A;  2NYZ D;  3P7J A;  3PO3 B;  3FMC A;  2JQO A;  1UAP A;  5M5W B;  1EYD A;  3PUZ A;  5KRU A;  1CKN A;  2L12 A;  1F2Z A;  2D0O A;  2JA7 B;  4QJF A;  2EOT A;  5NUC A;  3S15 H;  1EU4 A;  4JI7 L;  2F0E A;  3PV0 A;  2FMM A;  1SRU A;  1VDZ A;  4KMU C;  4JVZ A;  3AFQ A;  1BCP F;  2CW0 D;  3ERS X;  1JR0 D;  4Z9C B;  2D9U A;  1H9J A;  1IYU A;  3GTQ B;  5BN5 A;  3GTL H;  2UUA Q;  4FF2 A;  1HTL D;  1BBW A;  3NP8 A;  1JJ2 A;  3NHH A;  4RWS C;  4BS9 A;  2FHT A;  1VQD A;  4JI0 Q;  1XMO Q;  3M3Y B;  1TS3 A;  3CHB D;  3IL8 A;  4DF7 A;  1EQT A;  2CCZ A;  5IOC A;  1CA6 A;  1FVI A;  3PUY A;  1OO9 B;  3TEH B;  2QDL A;  1I4G A;  3OOC A;  2JA8 B;  2K33 A;  2R3Z A;  1TWC H;  5M3M H;  3TME A;  4NPS A;  1N36 Q;  4O1N A;  4FYD A;  3L9A X;  2A6E C;  1Y1V G;  3QJY A;  1O80 A;  1E7Z A;  1SYF A;  1TKW B;  3PIP 3;  4L5S A;  1AZP A;  2IL8 A;  2B63 G;  3S14 B;  4DNI A;  1PV4 A;  2Q8R E;  5JJZ A;  2XRS D;  3FRP B;  1O7I A;  1STB A;  4K6L A;  1BF4 A;  3S1R B;  3VYR A;  3CF5 A;  2G5D A;  2P5Z X;  1V1P A;  2LKV A;  2J0T D;  2CQA A;  3HOX H;  4KY5 A;  4KHP Q;  2VQF Q;  3KJO A;  3T16 A;  3S1M H;  1I6H H;  4B3M Q;  2KHS A;  3Q8D A;  1PH6 A;  5AJ3 L;  1WTV A;  5LMU Q;  4J15 A;  1BXT A;  5IY0 A;  4A3D G;  5IYD H;  1NR4 A;  5K5P A;  5CV4 A;  5M5Y H;  2BE5 D;  1QUQ A;  3S1N B;  1D6E C;  3BG3 A;  2R7D A;  2AQ1 B;  3J81 E;  4A3C G;  5A35 A;  1X3E A;  1HUN A;  3S1Q H;  1VQJ A;  3DM1 A;  1O7L A;  1Q1E A;  4DR5 L;  4A3E G;  2VL6 A;  4ZQ3 A;  4APV A;  3PO2 G;  2N88 A;  2KQ3 A;  5DEH A;  1SRO A;  2JYO A;  5T1G A;  1QCB D;  4CDD C;  3R2I A;  3AMU A;  4ZKB B;  1YHQ A;  1KXL A;  1KLU D;  4DV6 L;  4CDC C;  1JOO A;  1L1O B;  4P2C B;  3S2D B;  1Y1V B;  1T5X D;  3ERO A;  1HR0 W;  4QB4 A;  1LT4 D;  2JA5 G;  1VQ7 A;  2B63 B;  4DV7 Q;  3HKZ B;  5HY6 A;  4LFB L;  2YTX A;  1M4V A;  4LFA Q;  2E2I B;  1WCM H;  3TDQ A;  3V96 A;  3S17 H;  4FO2 A;  4CKE A;  5IT9 L;  3NXW A;  3D0F A;  1KHI A;  2AQ3 B;  4NW2 A;  4EX5 A;  1PTO H;  1U4M A;  1EOV A;  1LUZ A;  1O7Y A;  1VQ5 A;  2OWO A;  2K01 A;  1UE6 A;  4A3D B;  1HA6 A;  1BR9 A;  3ZJY C;  4DKA C;  5ELC A;  1SFO H;  1II3 A;  1J9O A;  1I4R A;  5C5L A;  3RLO A;  1OXT A;  1EY0 A;  1FJG Q;  1ICF B;  5BR8 Q;  2EJM A;  4DGZ A;  2MGS A;  2B29 A;  4DXG A;  3BZD B;  3PO2 B;  1QVC A;  1WYD A;  3R2T A;  3G48 A;  1VF7 A;  1EEI D;  1JB3 A;  1A3V A;  1ZKO A;  1A3U A;  5I9P A;  4LNQ A;  1JWU D;  4RKB A;  1G2S A;  4C1N I;  5DNF A;  5FLM H;  2K50 A;  4R4Q A;  3J7A V;  1BVS A;  2IX1 A;  3K8A A;  4EVO A;  1EOT A;  5CV7 A;  3T1Y Q;  4GN5 A;  4OWW B;  3GTM H;  1NJI C;  3C2P A;  4YWL A;  2PPB C;  1SYD A;  2JA5 B;  1ESF A;  3CQZ H;  2ZJQ A;  4BBR H;  5JVH 3;  4KHZ A;  3KJP A;  4ZUJ A;  3Q6S A;  3I4N H;  2K32 A;  2E2J H;  1STG A;  2F0T A;  1TT2 A;  1PRT D;  3S16 H;  1QG7 A;  5FOB B;  4DAY B;  1LT3 D;  5LMN W;  2KBN A;  5FO8 B;  5JPN C;  4FXD A;  2B2W A;  4XYQ A;  1N33 L;  2UXB L;  1SNO A;  1STE A;  5IOD A;  2F0W A;  4JI6 L;  3AB9 A;  4F88 A;  4JI4 L;  4MHE A;  4H44 C;  3HOW H;  3NUC A;  4LWC A;  3QG1 A;  2D5D A;  4K8I A;  1NCV A;  2KCN A;  1PFM A;  4KJN A;  1OTC A;  2F0F A;  2ICE C;  5GAH C;  2KHJ A;  3SK8 A;  4R4T A;  3W5O A;  2NTT A;  4UP8 A;  1E1O A;  4HJA A;  3K7A B;  1TWH H;  1CFM A;  1TY0 A;  2WKD A;  1VQF A;  2LXK A;  4TKO B;  3HFZ B;  4DV2 Q;  3RLF A;  2NB0 A;  2B2U C;  4U67 3;  4OEM B;  1ENC A;  3MEH A;  3HOV B;  1I6V C;  2F1M A;  5C3E G;  4G4K A;  4A93 G;  3TSS A;  1U4P A;  1CQF A;  1H9M A;  2ZT9 C;  3DEP A;  2BDO A;  3G7L A;  3JAM L;  5HGQ A;  2RDH A;  3TP8 A;  3Q24 A;  1JE4 A;  4LF9 L;  3DLL A;  3ND9 A;  3VYT A;  1V9P A;  3I91 A;  3A7L A;  4WOR A;  2EIF A;  2Z6B A;  3VR3 A;  4FF4 A;  2L4N A;  4LF6 L;  3VA7 A;  4DR6 Q;  3T56 B;  1TY2 A;  3JAM i;  1ZYR C;  2VXW A;  1X65 A;  5C0X H;  3CCR A;  1E0B A;  1GUS A;  3A7A B;  4ME3 A;  4GNX B;  1GUW A;  3F2U A;  4RH6 A;  3GTK B;  2C35 B;  3J80 L;  1VQC A;  4IAL A;  1HH2 P;  1Q86 C;  1ML0 D;  2R92 G;  2WB1 E;  3W1B A;  2ZXO A;  2XRQ D;  2EXZ A;  3E0J A;  1RF2 D;  4OL7 A;  3CME A;  3A54 A;  1NAP A;  1S5C D;  4QF4 A;  1Y1W H;  5T1I A;  4JBJ A;  1YHB A;  5K36 H;  3GTG B;  5IYB H;  1LAB A;  4BY7 H;  4IFD I;  2TMP A;  4DU9 A;  2GN5 A;  2K28 A;  5C3E B;  5H1S E;  1A62 A;  4NMZ A;  4YY3 Q;  1RTO A;  1D7Q A;  2WKC A;  4DUZ Q;  1F9Q A;  3GTJ B;  1WOC A;  4HSP A;  2KCT A;  3PUW A;  2YTY A;  4J1M A;  4A3I H;  2EVB A;  2OT2 A;  2F52 A;  1IW7 C;  5GQO A;  3A5Z B;  2C9O A;  3DM3 A;  2VUM H;  1VQB A;  1S4Z A;  3H0G H;  4R4C A;  4DK6 C;  3VYS A;  3OWF A;  5EPJ A;  3NK9 A;  2QDB A;  4XT3 B;  2L15 A;  5F2D A;  4A3L G;  2EJG C;  4UHV A;  2R7Z G;  1HFG A;  3SE0 A;  1N9W A;  5CBE E;  2HHH L;  2B2T A;  5CR3 A;  1V8Q A;  2IWH A;  2FIN B;  1K8O A;  1I4Q A;  2IHE A;  4RCO A;  2HCI A;  5M5X B;  2R92 B;  4B3S L;  2RVL A;  3CCU A;  5IWA Q;  2QCP X;  4GOP A;  1BKB A;  3IRB A;  4RA8 A;  2MP1 A;  2NTS A;  1D1K A;  1MKH A;  1VMC A;  2AWO A;  2WII B;  1LTT D;  4IPG A;  2DUD A;  5ELO A;  5D3I B;  4L5R C;  3Q0A A;  5J1Z A;  5E7N A;  3SR1 A;  3ULP A;  3U4Z A;  2JP1 A;  2DGY A;  4QGU A;  3AFP A;  3S15 B;  4G7H C;  3I2Z A;  3NE5 B;  3MFG A;  4JI2 L;  2FXQ A;  1RD9 D;  4DR3 L;  1NSN S;  3CAM A;  5C44 H;  2VNU D;  5EAY A;  2K5Q A;  2QEJ C;  3GTL B;  1GHK A;  5IYD G;  1B2T A;  5JEA H;  1X55 A;  3VDY A;  4IPD A;  2I46 A;  4I7Z C;  1HNX L;  2EYP A;  4ABN A;  1LT5 D;  1IBM Q;  3SXH A;  3PIO 3;  4GN4 B;  2F0O A;  5I4D A;  1K0S A;  2QEX A;  2CH4 W;  3PUX A;  1HQM C;  1KNA A;  4HMI A;  3GTP B;  3TZD A;  3VR4 A;  4YHH Q;  3H15 A;  1AE2 A;  2D0P A;  5IIF A;  3OIQ A;  3J81 j;  1LTG D;  1LTB D;  1E3P A;  5CV5 A;  2O4X A;  3NSW A;  2WV6 D;  1C8C A;  1TWC B;  5M3M B;  4C56 C;  2VS1 A;  2MPM A;  1SNC A;  1HNZ L;  3NEM A;  1AP0 A;  3HKZ E;  3CC4 A;  1EYC A;  1CSQ A;  2I5L X;  4TSS A;  3J81 L;  4KHV A;  3HKS A;  1H9R A;  4G7Z C;  1H9S A;  1BNZ A;  4ALP A;  5L37 A;  4QUC A;  4CJ0 B;  1WCM G;  4MZ9 A;  1IXR A;  3RLN A;  4ZK9 B;  1K83 B;  3HOX B;  4NXM L;  5J22 A;  2ZTE A;  3J81 i;  5KND A;  1E1T A;  2KEC A;  3S1M B;  1ILQ A;  3N52 A;  1I6H B;  4DNR B;  2EE1 A;  4GKK L;  3RUZ A;  4GKJ Q;  3EQL C;  3KK7 A;  2YYZ A;  1NY4 A;  3U4V A;  4DUY Q;  5EBC A;  2A5H A;  5M5Y B;  1B50 A;  1EY8 A;  1GUN A;  2UXD Q;  2R61 A;  3E9H A;  3J7A 5;  4ZRZ A;  4PZ8 A;  2PZU A;  3DXJ C;  1PRT C;  3MEF A;  2XWJ B;  3A56 A;  4LFC L;  4EGV A;  4M1U B;  3DUZ A;  3A5U A;  4Y7N B;  4BXX H;  5E4X A;  3G6E A;  2BH8 A;  1WI5 A;  4RAU C;  5FLM G;  5C4X H;  2SNM A;  3U58 A;  1YJN A;  3U9S A;  5IGE A;  4HJ5 A;  2E5L L;  1TU2 B;  4B9X A;  4LF7 L;  4ZUI A;  2EJF C;  2ZM6 Q;  4OO1 H;  2KCC A;  4BBR G;  5CMD A;  3L2P A;  1XYI A;  2KJX A;  3OIP A;  2WAQ E;  3I4N G;  1J6Q A;  2RHQ B;  3E5S A;  4JI5 L;  2NVX H;  4L5Q A;  1WTH A;  1WCM B;  2HT1 A;  3S17 B;  4ZCK A;  1EY7 A;  5C5M A;  3ITP A;  5IGD A;  1XNQ Q;  4X65 Q;  3NBH B;  2F0L A;  4DAM A;  1XMQ Q;  4FF3 A;  1PTO B;  5DLQ E;  1C4Q A;  5LHY 1;  5IT9 c;  1DOM A;  3S24 A;  2WB1 G;  1K3B C;  1BBU A;  3VR5 A;  4XQN A;  3GQB A;  3I56 A;  4X3U A;  1PRT F;  4HCS A;  1I50 H;  1PH5 A;  2UU9 L;  2JA7 G;  1DJR D;  4DXF A;  1A15 A;  2F4V L;  3M9B A;  1EY9 A;  4A3M H;  2G9D A;  4HIK A;  1F9P A;  4UP7 A;  3EIV A;  4DV3 Q;  2F0M A;  3TP5 A;  1WTP A;  2A6H C;  1TXY A;  1CZG A;  4X3T A;  4DA2 A;  1KDA A;  4KTA A;  2AUK A;  3H3V H;  1YJW A;  2F0U A;  3GTM B;  1HCZ A;  2I07 B;  4XTC S;  1WTO A;  3CQZ B;  2PI2 E;  4OX9 L;  4BBR B;  4NDX A;  2CWA A;  4TRD A;  3I4N B;  2E2J B;  2IPK D;  4X64 L;  3I70 A;  3CCL A;  2OEO A;  2JEA I;  1DOK A;  3S16 B;  2CWP A;  3EN2 A;  1X32 A;  2JA8 G;  2K52 A;  1OXX K;  2PO4 A;  2OCE A;  1F2L A;  2EQS A;  1IBL Q;  2NWG A;  4R1J A;  2RSO A;  3FKI H;  3J7A F;  3I3C A;  4P72 A;  2WB1 B;  3A55 A;  2A1A A;  4JPB W;  1C0A A;  1SE8 A;  3HOW B;  1ZYR D;  1PDQ A;  2Q2I A;  3U9O A;  1X3Q A;  5IP9 G;  1PH2 A;  2JEB I;  5C0X G;  1LTA D;  3HOU G;  4B3R L;  3K5N A;  4ZAI A;  1EQV A;  3H6M A;  2PW7 A;  3HOY H;  4EQ5 A;  1LM0 A;  4DV1 Q;  1PYB A;  3BVG A;  4A3J G;  2K5D A;  3CPW A;  4JCV E;  4BBS H;  4O0A A;  2B39 A;  2E2H H;  1VQP A;  1MJC A;  2UUC L;  4OGQ C;  2ZTD A;  4F7X A;  2HCC A;  3D4W A;  1XJV A;  5JOB A;  1FD7 D;  4BY7 G;  4TVA B;  2DN8 A;  1DZ1 A;  3IFT A;  1QZG A;  1ILP A;  4NXN Q;  1CHP D;  3CRK C;  4P71 A;  2HQE A;  3URY A;  2NN6 H;  2N78 A;  3GP7 A;  1B9N A;  3MAQ A;  1S72 A;  3E9I A;  3KDF B;  3NTI A;  3HOZ H;  1IW7 D;  4JV5 L;  4LMQ D;  1CQV A;  4A3I G;  3JAM c;  3WDN A;  3HKZ G;  1L1O C;  3KF6 A;  1E24 A;  1ASY A;  3IKJ A;  4GN3 B;  3NQI A;  2KEN A;  3HOU B;  4K14 A;  4DR5 Q;  1L0Y B;  4C3J G;  1PYS B;  3ULL A;  4XQJ A;  1UNS A;  3GTO H;  3RD4 A;  1TR5 A;  2CVR A;  4JI1 L;  1XMO L;  2UUB L;  4A3J B;  5EGT A;  2A19 A;  3OHX C;  4N9T A;  3Q23 A;  1IZ6 A;  4DV6 Q;  1EWC A;  3J80 c;  4B3T Q;  3UE0 A;  1Y1W B;  2WFW A;  5JEA J;  2IX0 A;  2H5X A;  1VQ4 A;  3K58 A;  3QO2 A;  4K8J A;  2RCF A;  1SNP A;  1N36 L;  1QE6 A;  4K6D A;  2PQA B;  1LTS D;  4YCU A;  4BY7 B;  2GVB A;  2RA4 A;  1ENF A;  1N34 L;  1CKM A;  3AQQ A;  1JB7 A;  1PXU A;  2F0Q A;  2Q8I B;  1LO5 D;  3D6W A;  2EY2 A;  2KED A;  2QKI C;  2RQX A;  3CD6 A;  4QCL A;  1PZI D;  3D4R A;  2JSO A;  4LF5 L;  1P16 A;  2RDG A;  3P20 A;  2MJ8 A;  4LAA A;  2QF7 A;  3D6C A;  4CKB A;  4A3I B;  3HRZ C;  5JJI A;  1G6Z A;  4CHT B;  2VUM B;  1Q82 C;  3GDE A;  5JVG 3;  3EJI A;  4RGO S;  2BOS A;  4YWM A;  3S2H H;  5FO7 B;  1E22 A;  4JI8 L;  2WAQ G;  1J8I A;  4BY1 H;  4C3J B;  2BA1 A;  1JJC B;  4OON A;  3LWU A;  1D5Z C;  2R6G A;  5C4H A;  1A0I A;  2PYK A;  4JG2 A;  4AH6 A;  3OTO Q;  4IUQ A;  1K28 A;  4HR7 B;  3A74 A;  4CJ1 B;  4H13 C;  1MHW C;  2EXD A;  4CDE C;  1WTQ A;  4RFB A;  1AEX A;  2B2U A;  3T1H L;  1EIG A;  1CKN B;  3W3A A;  1TWF H;  4QUF A;  5HUR A;  5GAD C;  4DV4 L;  1VQA A;  4A3K G;  1LV9 A;  4OWT B;  3UDG A;  3CRL C;  3CKI B;  1DXM A;  1JCK B;  1Z7T A;  2L11 A;  1DGS A;  2DJF C;  2Z6K C;  3KFU A;  5COY A;  3T4A C;  1N33 Q;  3NPP A;  1EZ8 A;  3I4M G;  4DV0 L;  4BA2 I;  2LY7 A;  5IYC H;  3BDO A;  4JI6 Q;  4IPH A;  3G4S A;  1Y8P B;  1SAP A;  2JA6 H;  2NZH A;  3T51 B;  1PTO D;  3KUP A;  3OWE B;  4GS3 A;  3HOV G;  3MXN A;  4MTK A;  3I73 A;  4FVM A;  1QWY A;  1IKM A;  1UWV A;  2XGT A;  2FMC A;  1HJP A;  4X3S A;  1STH A;  2ALY B;  4UP9 A;  1Z6H A;  4LF4 Q;  3GV3 A;  2WAQ B;  4C3H G;  1I5F A;  1DOL A;  1PH7 A;  2KA7 A;  2AWN A;  1E2W A;  2MO1 A;  1EYA A;  4WJ4 A;  1Q12 A;  1FJG L;  5BR8 L;  1X56 A;  3BDC A;  5I6Y A;  2CQO A;  3CCQ A;  3I4O A;  2I0Q A;  5M3F G;  4DR2 L;  1H95 A;  3PCO B;  2J4X A;  5KNB A;  1NMF A;  1NBW A;  3VYU A;  3N6R A;  1SMY D;  4DV5 Q;  4LF8 Q;  1AW7 A;  3T1Y L;  1FNV A;  3C1F A;  1FYC A;  4K2L A;  1EWI A;  1V1P B;  4IUP A;  3M4Q A;  4A3K B;  1K8M A;  3J81 c;  2EZV A;  4DNT B;  4DK1 A;  2ICI A;  1TS4 A;  4N8F A;  4RGN A;  3NEN A;  4KY7 A;  4POF A;  4PNY A;  2RSN A;  4GNX C;  3J7Y W;  1U4L A;  3CXC A;  3IAY A;  1WTR A;  4AYB E;  2WIN B;  4LF9 Q;  2VQE L;  2K6A A;  5DM6 3;  1STY A;  1M90 C;  3I4M B;  3D4D A;  1QUQ B;  1SJH D;  1W2B A;  4A3F G;  3TRE A;  5ISR A;  2Q2T A;  3DEO A;  5FJ8 H;  2M00 A;  2DY7 A;  4HTH A;  2L0C A;  4DFA A;  1S5B D;  2XTI A;  1A2T A;  1TWA H;  3RZO H;  4C3H B;  4C2M H;  1TVX A;  1KDB A;  2K5H A;  1W6K A;  1SNM A;  2A6H D;  3K0X A;  3LX0 A;  4RHR A;  5IP7 G;  2AHO B;  4JI3 Q;  3FPP A;  2LXJ A;  2EYM A;  4C3I H;  2K5N A;  1B53 A;  2IX3 A;  5M3F B;  2K1B A;  3M4Y A;  5FLX E;  1VQM A;  4F87 A;  2E76 C;  4L63 B;  4HJ7 A;  4HIO A;  1EIH A;  1VMP A;  4AQY Q;  1WTX A;  2MHV A;  1HZC A;  2F0P A;  3T53 B;  3G6J B;  1UEA B;  2L55 A;  3R93 A;  1A3T A;  2O5J C;  2DNC A;  1JMC A;  2NVX B;  4A76 A;  1YIT A;  1NR2 A;  5FO9 B;  4DR1 Q;  1PFB A;  1PH9 A;  1GOZ A;  1S5E D;  1A63 A;  4KKU A;  1ICW A;  3FKI G;  1TII D;  2DY8 A;  4GZY C;  1Z47 A;  4A3F B;  3FP9 A;  4IOA A;  3TQY A;  1WVL A;  1SE4 A;  1P8L A;  3D31 A;  1K9M C;  1SEB D;  4O2D A;  1TQO A;  1JE5 A;  4CGY B;  1N32 Q;  3S1N H;  3HOY G;  4K0K Q;  1CI3 M;  1D8L A;  2Q2H A;  2IY5 B;  1SXT A;  4RCN A;  2ZXR A;  5ELN A;  4GLX A;  2Z1C A;  1JWM D;  1PMR A;  4P73 A;  5EBD A;  1SND A;  1S3O A;  3SHL A;  4KI0 A;  4B3S Q;  2OF1 A;  2HIV A;  1B9M A;  1VQ8 A;  3OSO A;  2M2L A;  1KD1 C;  2IW3 A;  2KVM A;  5C4J B;  2I5M X;  1D1I A;  3HZX A;  4EQP A;  3S2D H;  1Y1V H;  1HFN A;  2Z4I A;  5COR A;  1WFQ A;  1HXY D;  3KF8 A;  1GD7 A;  5LL6 S;  4L5T A;  2B63 H;  1T5E A;  3MWY W;  4ME5 A;  5M3M G;  1C9O A;  3KLW A;  5JJL A;  2ZJR A;  3RN2 A;  4QMG A;  5EQ0 A;  3PF4 A;  3HOZ G;  3K57 A;  4DR3 Q;  3FPU B;  3VR6 A;  2EYL A;  3FDT A;  3FKI B;  2UXC L;  1GXD C;  2B2V A;  4V0B A;  1CUK A;  5JJK A;  4DAV A;  3K0Y A;  4RGM A;  3CPF A;  1A8V A;  3OYY A;  5GAG C;  2NVY H;  2SDF A;  1HNX Q;  3OPO A;  4RKL A;  1BOS A;  4A3D H;  3HOX G;  4KKT A;  3HOY B;  3C1E A;  4A3C H;  3PF5 A;  3UDI A;  1GUO A;  4A3E H;  3A0J A;  2CHB D;  4BBS B;  4JBM A;  3K6O A;  1ET6 A;  3KOJ A;  2E2H B;  2I5H A;  4DR4 L;  4Q5V A;  4CKC A;  3BZC A;  4HAE A;  2VB2 X;  4BWG B;  5IWA L;  5GAE C;  2XWB B;  4ZLT F;  1XX8 A;  4ZKC B;  3AEV A;  1GKH A;  4ID6 A;  3VA5 A;  2SOB A;  1K0R A;  1CKO A;  1PH3 A;  2OXP A;  3FHW A;  1SNQ A;  4IUV A;  2EY5 A;  2PNR C;  4KN7 C;  3HOZ B;  4GKK Q;  4OIK A;  1NE3 A;  3SDZ A;  1Z9F A;  3B6Y A;  4DR7 L;  1VF5 C;  4PMW A;  2F03 A;  1J5E Q;  4QY7 A;  1EFW A;  3ICE A;  2PZT A;  3C3L A;  4IUN A;  4IFD J;  2ATW A;  1I3Q H;  4R4O A;  1A2U A;  3SK5 A;  4BY1 G;  4L8J A;  1QOH A;  4IUT A;  2K04 A;  1T9H A;  3ND8 A;  2A74 C;  1HQR D;  5C4Z A;  5C0X I;  4CBV A;  4KN4 C;  1DM0 B;  2PW5 A;  1SJE D;  2XSC A;  4AYB G;  2BA0 A;  2EYO A;  2KHI A;  4H02 A;  1XNR L;  2K5V A;  1PTO C;  1LYL A;  1VQ9 A;  5A2Q E;  1YNJ C;  3S1Q B;  1PZJ D;  1MSG A;  2C5C A;  4N9P A;  2E5L Q;  1HNW L;  1UE5 A;  2NZO A;  1HR0 L;  4GOP C;  2J7Z A;  3NWT A;  2MFI A;  4KV6 A;  5IGF A;  2Q2U A;  4IJH A;  3EBE A;  3K5M A;  1PFS A;  1GVP A;  3NEL A;  2EY6 A;  1RDP D;  4JW0 A;  4CDF C;  2ZJP A;  4X66 Q;  4AIM A;  3TS2 A;  3VR2 A;  1Q3L A;  3LWE A;  1HZA A;  4FDB A;  2EDG A;  3RN5 A;  1I4P A;  1BO0 A;  5FKA C;  3MHB A;  1MBY A;  1YNN C;  3CCS A;  2OQK A;  1SMY C;  3PIP A;  3F2C A;  5KNC A;  3SVM A;  1YJ9 A;  2NVT H;  2H4O A;  4GKJ L;  4HJ9 A;  4DUY L;  3MXG A;  1SLJ A;  4GLV B;  1PFN A;  2F4V Q;  1LTL A;  3BU2 A;  4BY1 B;  2AMC B;  2PMZ B;  1X3F A;  4A3G H;  5KYI A;  2UXD L;  1FR3 A;  4QIW E;  2V4D A;  4A4I A;  1G91 A;  2D2C C;  4HCE A;  5ELE A;  1ASZ A;  1AN8 A;  1PTO F;  1W3S A;  1CM9 A;  3DWQ A;  1CTM A;  2XVS A;  3BS1 A;  3HOW G;  5HGT A;  4GOP B;  3FEW X;  4AYB B;  1DD2 A;  1L0X B;  1SFO B;  2R7F A;  3K5O A;  3CC2 A;  3M7G A;  3TS0 A;  1SSO A;  1TWF B;  3HEJ A;  3NBI A;  1TS5 A;  2CFM A;  2Z9H A;  1EWH A;  1I94 Q;  4MNO A;  4NKL A;  3STB C;  1JOK A;  2H1E A;  3GTG H;  2N3S A;  1B44 D;  4X62 Q;  1QZH A;  3F2D A;  4PG3 A;  4PZ7 A;  4E6I A;  3GV6 A;  4A3B H;  1XTD A;  5C3E H;  4A93 H;  5LMN L;  2JJQ A;  3NQT A;  3AYH B;  4FNF A;  5FK9 C;  2XNA C;  1XNQ L;  1M1K C;  2JA6 B;  3M4O H;  1FNW A;  2PCF B;  2R93 H;  4H0L C;  2F0H A;  3RR5 A;  1L1O A;  4UPA A;  1B8A A;  2YU9 H;  4HN7 A;  2F0S A;  1CSP A;  2NBF A;  1MSH A;  4FF1 A;  3EA6 A;  1K8G A;  4JI7 Q;  1ENA A;  3TBI B;  1XPO A;  2Z8L A;  3QWN A;  2RDF A;  4LW1 A;  1RHP A;  3MTS A;  1UEB A;  4PMC A;  1R4Q B;  4QL5 A;  2PZW A;  1X3P A;  4XIG S;  2A73 B;  1H9S B;  2E8G A;  3A8K E;  4MN3 A;  2R92 H;  4JYA L;  5CGK A;  1VQL A;  4BA1 I;  1UUP A;  3PUV A;  1EU3 A;  1IBK L;  3E3X A;  3RZD H;  4JOI C;  2EYF A;  2HUG A;  1EYG A;  4ULL A;  2B8G A;  1WD0 A;  1KTK A;  1TWH B;  1F9S A;  1KQS A;  1F2M A;  4P74 A;  1JQY D;  4J8Q A;  1V1O A;  5FLX L;  4FP5 D;  1Y1W G;  3OMG A;  1TWG H;  3K80 C;  4JV5 Q;  5K36 G;  1KAA A;  4HIM A;  1BCP B;  2IJ0 A;  1CZW A;  1EQR A;  3CCE A;  3RMH A;  5IYB G;  1IBL L;  3SEB A;  1VCI A;  4I65 A;  4KJO A;  1FGB D;  3SGI A;  1W6J A;  4A75 A;  3D8G A;  1AH9 A;  2KCM A;  4XDX A;  1STA A;  4IZ8 A;  5G3L D;  3MA2 B;  1TWA B;  5J39 A;  3RZO B;  2L9H A;  1CA5 A;  4C2M B;  2ZXP A;  5GRO A;  3M85 A;  1SMX A;  4I7A A;  4KK7 A;  4JI1 Q;  3HG9 A;  1ET9 A;  2A69 C;  3DWA A;  4L6T B;  3R8B A;  2UUB Q;  4A3L H;  5AJ3 Q;  4DAY A;  2Y0S E;  1I4X A;  2A68 C;  2R7Z H;  2VUM G;  5JAV A;  4DV1 L;  3GTP H;  4C3I B;  3T13 A;  3H0G G;  4XXE A;  1MGS A;  4IPC A;  1U5K A;  3TP7 A;  1YEZ A;  3QOL A;  2UUA L;  1G6P A;  2Z0S A;  2LS0 1;  3I72 A;  5J3B A;  2TSS A;  1JIC A;  2MUY A;  5KIX A;  4JI0 L;  1N34 Q;  4K5W A;  4PQX A;  3I4L A;  1Q46 A;  1CHQ D;  1SE2 A;  2NVQ H;  1B1Z A;  1IHZ A;  1KAB A;  4O42 A;  1AZQ A;  4OO1 I;  5LL6 X;  1VQI A;  2HDM A;  4LF5 Q;  1PH8 A;  3LNN A;  1XPU A;  1QNK A;  2QA4 A;  4FXG C;  2Z6K A;  2JA9 A;  3L0O A;  4PZ6 A;  4POG A;  1SR3 A;  4NXN L;  1L0W A;  3NWS A;  1K83 H;  2B2Y C;  2X6L A;  3I7F A;  3KLR A;  4OHJ A;  3ZYY X;  4EQN A;  1EFI D;  2IT1 A;  5D3D A;  1DYQ A;  1NNX A;  1KAW A;  3KYH C;  4LFB Q;  4YWK A;  2F0K A;  3CU7 A;  1MIU A;  1Y8N B;  4IN3 A;  1NUC A;  1EIY B;  3EFX D;  4JI8 Q;  1U9R A;  2ES2 A;  2YTV A;  5C44 G;  1YZ6 A;  2LMC B;  2HIX A;  4DN4 M;  4KHP L;  1SYC A;  2VQF L;  3R3O A;  1PVO A;  5CV6 A;  1OXV A;  1RTN A;  2QW7 A;  2PI2 A;  3FVQ A;  4F8M A;  5CBA E;  5JEA G;  1HHV A;  4WJW A;  1QIL A;  4B3M L;  2KUM A;  3H0G B;  2JXM B;  4Y7N H;  1ZEQ X;  2NUC A;  5LMU L;  3BVZ A;  1MI2 A;  4U68 A;  4UAI A;  3T1H Q;  1C7Y A;  2GVA A;  1TS2 A;  4B3T L;  4IO9 A;  3H3V I;  1SN8 A;  1X3G A;  4DV4 Q;  5I6W A;  1B70 B;  1G51 A;  3CC7 A;  3SK6 A;  1WTW A;  1G2T A;  2L1B A;  4OXP A;  4GNX A;  1PZK D;  3W1G A;  3TN2 A;  1BUV T;  4OEL B;  4FXK C;  1R9T H;  4DV0 Q;  1EY5 A;  1HZ9 A;  4IFD H;  3V2T A;  2NVY B;  5EPL A;  3BYY B;  3GD7 A;  5E3F A;  2QIL A;  1Q8I A;  4DV7 L;  2FJ2 A;  1Q90 A;  5KEE A;  1CK1 A;  3SK4 A;  4LUO A;  3UDX A;  4LFA L;  2AUJ D;  2N8N A;  1S40 A;  3E0E A;  1B3Q A;  4HED A;  1RL2 A;  2QGQ A;  5C44 B;  2UXB Q;  1X9N A;  1WJJ A;  4JI4 Q;  1K8A C;  3TRZ A;  2ENB A;  4A3E B;  4ODG A;  1VQG A;  2HD3 A;  1YVC A;  1ZXT A;  1YNJ D;  1JWS D;  1H9K A;  3HP3 A;  4DR2 Q;  4M8A A;  3ONA B;  1DCZ A;  1Y14 B;  4IQZ A;  1WD1 A;  3OTO L;  1XXG A;  1EQQ A;  1ONL A;  1KL9 A;  3DWP A;  1YI2 A;  3EVQ A;  1Q1B A;  2EPB A;  3WWV A;  4K5X A;  4DK3 C;  1LTR D;  2F3W A;  1YBY A;  2MO0 A;  4ZYS A;  1C48 A;  5E1F A;  3M7N A;  4BXX G;  3X3M A;  1IKL A;  1EY6 A;  2ID0 A;  4RHS A;  5C4X G;  4LJZ C;  4QIW B;  1RKN A;  2VQE Q;  2N49 A;  2GA4 B;  1I4H A;  4RGT A;  1YNN D;  5A2Q L;  1IYJ B;  3KF6 B;  2NN6 I;  4XT1 B;  1YNX A;  4OO1 G;  1B4O A;  5CYU A;  3K5L A;  4JBW A;  1UE7 A;  2PMZ E;  4JK1 C;  5D14 A;  1HUM A;  1G29 1;  3PO3 H;  5DM7 3;  1I3Q B;  5M5W H;  4OWX B;  3HS0 C;  3TP6 A;  4G7O C;  4A3G G;  3KBX A;  5DAU A;  1GO3 E;  2JA7 H;  2LFN A;  5BN3 A;  1MD2 D;  4LF4 L;  4R9W A;  1ESR A;  4XYO A;  4LF6 Q;  4YCW A;  5KYL A;  1UE1 A;  2WP8 J;  1IL8 A;  4LUZ A;  3C46 A;  3H09 A;  3JC6 6;  3GTQ H;  2K05 A;  2K5W A;  1IYV A;  1X54 A;  2E75 C;  3WOF A;  2XN9 C;  4A3M G;  4PMB A;  3STB D;  4P75 A;  5EJW A;  1JOR A;  3CCJ A;  5ELD A;  1HA5 A;  3BJU A;  3PIO A;  3M3Y H;  3CCV A;  3PMF A;  4DV5 L;  2K75 A;  3H91 A;  4LF8 L;  1PA6 A;  3BZK A;  5C4X B;  4A3B G;  4UY8 C;  3MVV A;  2HQL A;  1SBB B;  3P75 A;  2JA8 H;  2Y0S G;  4OIJ A;  1RCV D;  2E2D C;  2F0N A;  4DV2 L;  2M9V A;  3RNU A;  3PSI A;  2R93 G;  4X6A H;  3I8Z A;  4Y52 H;  4MIU A;  3H3V C;  2NVT B;  1BCP D;  1GHJ A;  2X69 A;  5M9O A;  3I90 A;  3S14 H;  1D5M C;  2BDN A;  3L7Z C;  3E6Z X;  3KBG A;  3S1R H;  2F0D A;  3I55 A;  4A3G B;  5IP9 H;  3IFD A;  1GJX A;  1EEF D;  3HOU H;  1LLR D;  2F0J A;  5JPM C;  1JOQ A;  3D3R A;  3MXU A;  2B2W C;  2RHS B;  1KDC A;  1B7Y B;  1HPC A;  4NB3 A;  3K7U C;  1PHJ A;  4A3J H;  1EUJ A;  1LTI D;  1HZB A;  2EY1 A;  5CV9 A;  3DHQ A;  1I50 B;  1OXS C;  3QB3 A;  4JI3 L;  3CMA A;  2CW0 C;  1VS0 A;  4DR6 L;  4IJL A;  4JC0 A;  4A3M B;  2HHH Q;  4HJ8 A;  1QNU A;  3F1Z A;  1K3R A;  2VY3 A;  4ILW A;  4AQY L;  3K81 C;  2D62 A;  5EPK A;  3J80 i;  2K4K A;  1QJO A;  3W2D A;  3KLS X;  3UI2 A;  4BBS G;  3PGZ A;  4A3B B;  1S5D D;  4B08 A;  1D5X C;  4A93 B;  3GO5 A;  4QQB X;  3J7Z C;  2YV5 A;  4DK0 A;  2UXC Q;  2Y0S B;  4G57 A;  4DR1 L;  3MXN B;  1PLF A;  3TZU A;  3V05 A;  5C6A A;  3M4O B;  1KRT A;  2R93 B;  2B8F A;  1FNU A;  4NP5 A;  1B3A A;  5IGB A;  3A8I E;  4X3K A;  4HID A;  1KIX A;  2K03 A;  2YU9 B;  3BVM A;  1VQ6 A;  2NN6 G;  2A69 D;  1IL2 A;  1MJE A;  1VQE A;  3KLS A;  2Z4H A;  2E2I H;  1CT1 D;  3AU7 A;  4JI2 Q;  3WOE A;  4YY3 L;  1Q8K A;  2A68 D;  1EY4 A;  4DPG A;  1V1Q A;  4LUV A;  1N32 L;  3OW7 A;  2Q8T A;  4C3J H;  4K0K L;  4DUZ L;  2MQH A;  2WAC A;  3NBH A;  2PNH A;  4DR4 Q;  4KY6 A;  1PH1 A;  2F4I A;  5EKL A;  5G3L F;  2A6E D;  1Y69 U;  2HDL A;  2SEB D;  1F77 A;  3Q22 A;  1F2Y A;  3MC0 B;  4KKS A;  3G71 A;  1EZ6 A;  3HGB A;  3CP0 A;  2BE5 C;  4MTN A;  2DNE A;  3RZD B;  1OXU A;  2O2L D;  2SNS A;  1NTG A;  4N8X 1;  1YIJ A;  1Y8O B;  4IOC A;  1QVF A;  3M4P A;  1S5F D;  1YHA A;  3PO2 H;  4IUR A;  2K7V A;  1HNZ Q;  1PYW D;  5IT9 E; 
#chains in the Genus database with same CATH homology
 4C1N K;  1TWG B;  4LK1 C;  1GUT A;  5I2Y A;  5BN4 A;  1EL0 A;  2KEE A;  4XQQ A;  1JC7 A;  2FFK B;  1KNE A;  1HRJ A;  4TQU S;  5C3X A;  1RJT A;  4PV1 C;  2R7Z B;  2BCO A;  1SE3 A;  2VB3 X;  4J6H A;  4R8N A;  3K59 A;  2EYH A;  3QIA A;  5I2X A;  4WRD A;  2G9H D;  3GTO B;  4KD4 A;  2XIW A;  2NVQ B;  1HTP A;  5ELB A;  5IGG A;  1QB5 D;  4B9W A;  1BDO A;  2B2T C;  3OMC A;  1F9R A;  1SYB A;  3L3O C;  3A8J E;  4IFD G;  5KGU A;  2RKS A;  4KD3 A;  2B2V C;  5EKK A;  1E2V A;  1BQQ T;  1U4R A;  4K2K A;  1SDF A;  1SYE A;  2N55 A;  3O13 A;  1LT6 D;  4IUU A;  4S3S A;  1LAC A;  2F0V A;  2F0I A;  5E4W C;  4YIJ A;  2EYJ A;  4CJ2 C;  3NTH A;  1D2B A;  1GUG A;  3S2H B;  3ERQ A;  5C3W A;  2O5I C;  5IGC A;  2RBM A;  2F0G A;  1V43 A;  3QOJ A;  2NZ1 D;  1SYG A;  4EQO A;  3H94 A;  5CV8 A;  1BBX C;  1XTC D;  3JAM E;  1O78 A;  1R9T B;  3DMU A;  5CC4 A;  1G8Z D;  1PRT B;  2PQE A;  4DAP A;  3MZ5 A;  2KOL A;  4R8I A;  3P1H A;  1ROD A;  4Q0F A;  5EKI A;  5TSS A;  1STN A;  2AQ2 B;  3MFY A;  1O7Z A;  5D65 A;  4H7B A;  4WFN 3;  3J80 E;  3BDL A;  1E2Z A;  5I9O A;  1BCP C;  1A6X A;  1R4P B;  2X6G A;  1DON A;  3NTK A;  4UDU C;  3MXP A;  1XWE A;  4V19 0;  3BYT B;  4C3I G;  5C0X J;  2E74 C;  3X3N A;  5AFW A;  1AFP A;  4HSV A;  2JE6 I;  1M8A A;  4K5V A;  2B2Y A;  4HMJ A;  3S9W A;  5ELF A;  1KLG D;  2L5T A;  2F3V A;  2NYZ D;  3P7J A;  3PO3 B;  3FMC A;  1UAP A;  5M5W B;  1EYD A;  3PUZ A;  5KRU A;  2L12 A;  1F2Z A;  2JA7 B;  2EOT A;  5NUC A;  1EU4 A;  2F0E A;  3PV0 A;  2FMM A;  4KMU C;  1VDZ A;  1BCP F;  2CW0 D;  1JR0 D;  4Z9C B;  2D9U A;  1H9J A;  1IYU A;  3GTQ B;  5BN5 A;  4FF2 A;  1HTL D;  3NP8 A;  3NHH A;  4RWS C;  4BS9 A;  2FHT A;  3M3Y B;  1TS3 A;  3CHB D;  3IL8 A;  4DF7 A;  1EQT A;  5IOC A;  1CA6 A;  3PUY A;  1OO9 B;  1I4G A;  3OOC A;  2JA8 B;  2K33 A;  2R3Z A;  3TME A;  4O1N A;  4FYD A;  3L9A X;  2A6E C;  3QJY A;  1O80 A;  1TKW B;  1SYF A;  3PIP 3;  1AZP A;  2IL8 A;  3S14 B;  2Q8R E;  5JJZ A;  2XRS D;  3FRP B;  1STB A;  4K6L A;  1BF4 A;  3S1R B;  3VYR A;  1V1P A;  2LKV A;  2J0T D;  2CQA A;  4KY5 A;  3T16 A;  2KHS A;  1WTV A;  1BXT A;  1NR4 A;  5K5P A;  5CV4 A;  3S1N B;  2BE5 D;  1D6E C;  3BG3 A;  2AQ1 B;  3J81 E;  5A35 A;  1HUN A;  3DM1 A;  1O7L A;  1Q1E A;  4ZQ3 A;  2N88 A;  2KQ3 A;  5DEH A;  2JYO A;  5T1G A;  1QCB D;  3R2I A;  3AMU A;  4ZKB B;  1KLU D;  1JOO A;  4P2C B;  3S2D B;  1Y1V B;  1T5X D;  3ERO A;  4QB4 A;  1LT4 D;  2B63 B;  3HKZ B;  1M4V A;  2E2I B;  3TDQ A;  3V96 A;  4FO2 A;  4CKE A;  5IT9 L;  3NXW A;  2AQ3 B;  4NW2 A;  1PTO H;  1U4M A;  1O7Y A;  2K01 A;  4A3D B;  1HA6 A;  1BR9 A;  5ELC A;  1II3 A;  1J9O A;  1I4R A;  5C5L A;  1OXT A;  1EY0 A;  2EJM A;  4DGZ A;  2MGS A;  4DXG A;  3BZD B;  3PO2 B;  3R2T A;  1VF7 A;  1EEI D;  1JB3 A;  1A3V A;  1ZKO A;  1A3U A;  5I9P A;  1JWU D;  4RKB A;  1G2S A;  4C1N I;  5DNF A;  3J7A V;  2IX1 A;  4EVO A;  1EOT A;  5CV7 A;  3C2P A;  2PPB C;  1SYD A;  2JA5 B;  1ESF A;  5JVH 3;  4KHZ A;  4ZUJ A;  3Q6S A;  2K32 A;  1STG A;  2F0T A;  1TT2 A;  1PRT D;  1QG7 A;  5FOB B;  1LT3 D;  5FO8 B;  5JPN C;  4FXD A;  2B2W A;  4XYQ A;  1SNO A;  1STE A;  5IOD A;  2F0W A;  3AB9 A;  4F88 A;  4MHE A;  4H44 C;  3NUC A;  3QG1 A;  2D5D A;  4K8I A;  1NCV A;  2KCN A;  1PFM A;  4KJN A;  2F0F A;  2ICE C;  3SK8 A;  2NTT A;  3K7A B;  1CFM A;  1TY0 A;  2WKD A;  4TKO B;  3RLF A;  2NB0 A;  2B2U C;  4U67 3;  1ENC A;  3MEH A;  3HOV B;  1I6V C;  2F1M A;  4G4K A;  3TSS A;  1U4P A;  1CQF A;  1H9M A;  2ZT9 C;  3DEP A;  2BDO A;  3G7L A;  3JAM L;  2RDH A;  3TP8 A;  3Q24 A;  1JE4 A;  3ND9 A;  3VYT A;  3I91 A;  3A7L A;  4WOR A;  3VR3 A;  4FF4 A;  2L4N A;  3VA7 A;  3T56 B;  1TY2 A;  1ZYR C;  2VXW A;  5C0X H;  1E0B A;  1GUS A;  3A7A B;  1GUW A;  3F2U A;  4RH6 A;  3GTK B;  3J80 L;  4IAL A;  1ML0 D;  2ZXO A;  2XRQ D;  2EXZ A;  3E0J A;  1RF2 D;  4OL7 A;  3A54 A;  1NAP A;  1S5C D;  4QF4 A;  5T1I A;  5K36 H;  3GTG B;  1LAB A;  4IFD I;  2TMP A;  4DU9 A;  2K28 A;  5C3E B;  4NMZ A;  1RTO A;  2WKC A;  1F9Q A;  3GTJ B;  4HSP A;  3PUW A;  4J1M A;  2EVB A;  2OT2 A;  1IW7 C;  2C9O A;  1S4Z A;  3VYS A;  3OWF A;  5EPJ A;  3NK9 A;  2QDB A;  4XT3 B;  5F2D A;  2EJG C;  1HFG A;  3SE0 A;  5CBE E;  2B2T A;  5CR3 A;  1V8Q A;  2IWH A;  2FIN B;  1K8O A;  1I4Q A;  4RCO A;  2HCI A;  5M5X B;  2R92 B;  2RVL A;  2QCP X;  4RA8 A;  2MP1 A;  2NTS A;  1D1K A;  1VMC A;  2AWO A;  2WII B;  1LTT D;  5D3I B;  3Q0A A;  5J1Z A;  3SR1 A;  2JP1 A;  3S15 B;  4G7H C;  3NE5 B;  3MFG A;  1RD9 D;  2VNU D;  1NSN S;  2K5Q A;  2QEJ C;  3GTL B;  1GHK A;  1B2T A;  5JEA H;  2I46 A;  4I7Z C;  2EYP A;  4ABN A;  1LT5 D;  3SXH A;  3PIO 3;  2F0O A;  5I4D A;  3PUX A;  1HQM C;  1KNA A;  4HMI A;  3GTP B;  3TZD A;  3VR4 A;  5IIF A;  3OIQ A;  1LTG D;  1LTB D;  5CV5 A;  2O4X A;  3NSW A;  2WV6 D;  1C8C A;  1TWC B;  5M3M B;  4C56 C;  2MPM A;  1SNC A;  1AP0 A;  1EYC A;  4TSS A;  3J81 L;  4KHV A;  1H9R A;  4G7Z C;  1H9S A;  1BNZ A;  4QUC A;  4CJ0 B;  4ZK9 B;  1K83 B;  3HOX B;  5J22 A;  5KND A;  2KEC A;  3S1M B;  1ILQ A;  3N52 A;  1I6H B;  4DNR B;  2EE1 A;  3RUZ A;  3EQL C;  3KK7 A;  2YYZ A;  5EBC A;  2A5H A;  5M5Y B;  1B50 A;  1EY8 A;  1GUN A;  2R61 A;  4ZRZ A;  2PZU A;  3DXJ C;  1PRT C;  2XWJ B;  3A56 A;  4EGV A;  4M1U B;  3DUZ A;  4Y7N B;  5E4X A;  4RAU C;  2SNM A;  3U9S A;  5IGE A;  1TU2 B;  4B9X A;  4ZUI A;  2EJF C;  4OO1 H;  2KCC A;  5CMD A;  1XYI A;  2KJX A;  3OIP A;  3E5S A;  1WCM B;  3S17 B;  1EY7 A;  5C5M A;  3ITP A;  5IGD A;  2F0L A;  4FF3 A;  1PTO B;  1C4Q A;  5LHY 1;  1DOM A;  3VR5 A;  4XQN A;  3GQB A;  4X3U A;  1PRT F;  4HCS A;  1DJR D;  4DXF A;  1A15 A;  1EY9 A;  2G9D A;  1F9P A;  2F0M A;  3TP5 A;  1WTP A;  2A6H C;  1CZG A;  4X3T A;  4DA2 A;  1KDA A;  4KTA A;  2AUK A;  2F0U A;  3GTM B;  1HCZ A;  2I07 B;  4XTC S;  1WTO A;  3CQZ B;  4BBR B;  4NDX A;  3I4N B;  4TRD A;  2E2J B;  2IPK D;  3I70 A;  3S16 B;  2OEO A;  2JEA I;  1DOK A;  1X32 A;  1OXX K;  2PO4 A;  1F2L A;  2NWG A;  2RSO A;  3J7A F;  3I3C A;  2WB1 B;  3A55 A;  3HOW B;  1ZYR D;  1PDQ A;  3U9O A;  1X3Q A;  2JEB I;  5C0X G;  1LTA D;  3K5N A;  4ZAI A;  1EQV A;  2PW7 A;  3H6M A;  3BVG A;  2K5D A;  2B39 A;  4OGQ C;  4F7X A;  2HCC A;  3D4W A;  5JOB A;  1FD7 D;  2DN8 A;  1DZ1 A;  3IFT A;  1ILP A;  1CHP D;  3CRK C;  2HQE A;  3URY A;  2NN6 H;  3GP7 A;  1B9N A;  3MAQ A;  3NTI A;  1IW7 D;  4LMQ D;  1CQV A;  3WDN A;  3IKJ A;  3NQI A;  3HOU B;  4K14 A;  1L0Y B;  4C3J G;  4XQJ A;  1UNS A;  3RD4 A;  1TR5 A;  2CVR A;  4A3J B;  5EGT A;  3OHX C;  4N9T A;  3Q23 A;  1EWC A;  1Y1W B;  5JEA J;  2IX0 A;  3K58 A;  3QO2 A;  4K8J A;  1SNP A;  1QE6 A;  4K6D A;  1LTS D;  4BY7 B;  2RA4 A;  1ENF A;  1PXU A;  2F0Q A;  2Q8I B;  1LO5 D;  3D6W A;  2EY2 A;  2KED A;  2QKI C;  2RQX A;  4QCL A;  1PZI D;  3D4R A;  2JSO A;  2RDG A;  3P20 A;  2MJ8 A;  4LAA A;  2QF7 A;  3D6C A;  4CKB A;  4A3I B;  3HRZ C;  1G6Z A;  4CHT B;  2VUM B;  5JVG 3;  3EJI A;  4RGO S;  2BOS A;  5FO7 B;  1J8I A;  4C3J B;  2BA1 A;  3LWU A;  1D5Z C;  2R6G A;  5C4H A;  2PYK A;  4IUQ A;  4HR7 B;  4CJ1 B;  4H13 C;  1WTQ A;  4RFB A;  1AEX A;  2B2U A;  1EIG A;  3W3A A;  5HUR A;  4QUF A;  1LV9 A;  3CRL C;  3CKI B;  1DXM A;  1JCK B;  1Z7T A;  2L11 A;  5COY A;  3T4A C;  3NPP A;  1EZ8 A;  4BA2 I;  2LY7 A;  3BDO A;  1Y8P B;  1SAP A;  3T51 B;  1PTO D;  3KUP A;  3OWE B;  3MXN A;  3I73 A;  4FVM A;  1QWY A;  1IKM A;  2FMC A;  4X3S A;  1STH A;  1Z6H A;  3GV3 A;  2WAQ B;  4C3H G;  1DOL A;  2KA7 A;  2AWN A;  1E2W A;  1EYA A;  1Q12 A;  3BDC A;  5I6Y A;  5KNB A;  2J4X A;  3VYU A;  3N6R A;  1SMY D;  1AW7 A;  1FNV A;  3C1F A;  1FYC A;  4K2L A;  1V1P B;  4IUP A;  4A3K B;  1K8M A;  2EZV A;  4DNT B;  4DK1 A;  2ICI A;  1TS4 A;  4RGN A;  4KY7 A;  4PNY A;  2RSN A;  3J7Y W;  1U4L A;  3IAY A;  1WTR A;  2WIN B;  2K6A A;  5DM6 3;  1STY A;  3I4M B;  3D4D A;  1SJH D;  5ISR A;  3DEO A;  2M00 A;  2DY7 A;  4HTH A;  2L0C A;  4DFA A;  1S5B D;  1A2T A;  4C3H B;  1TVX A;  1KDB A;  1W6K A;  1SNM A;  2A6H D;  4RHR A;  3LX0 A;  3FPP A;  2EYM A;  1B53 A;  2IX3 A;  5M3F B;  2K1B A;  3M4Y A;  5FLX E;  4F87 A;  2E76 C;  4L63 B;  1EIH A;  1VMP A;  1WTX A;  2MHV A;  2F0P A;  3T53 B;  3G6J B;  1UEA B;  2L55 A;  3R93 A;  1A3T A;  2O5J C;  2DNC A;  2NVX B;  1NR2 A;  5FO9 B;  1PFB A;  1GOZ A;  1S5E D;  4KKU A;  1ICW A;  1TII D;  2DY8 A;  4GZY C;  1Z47 A;  4A3F B;  1WVL A;  1SE4 A;  3D31 A;  1SEB D;  1TQO A;  4CGY B;  1CI3 M;  1SXT A;  4RCN A;  2ZXR A;  2Z1C A;  1JWM D;  1PMR A;  5EBD A;  1SND A;  3SHL A;  4KI0 A;  2OF1 A;  1B9M A;  3OSO A;  2M2L A;  2IW3 A;  2KVM A;  5C4J B;  1D1I A;  3HZX A;  4EQP A;  1HFN A;  2Z4I A;  5COR A;  1HXY D;  3KF8 A;  5LL6 S;  1T5E A;  3MWY W;  4ME5 A;  4QMG A;  5EQ0 A;  3K57 A;  3FPU B;  3VR6 A;  2EYL A;  3FDT A;  3FKI B;  1GXD C;  2B2V A;  4V0B A;  4DAV A;  3K0Y A;  4RGM A;  2SDF A;  3OPO A;  4RKL A;  1BOS A;  4KKT A;  3HOY B;  3C1E A;  1GUO A;  2CHB D;  4BBS B;  3K6O A;  1ET6 A;  2E2H B;  4Q5V A;  4CKC A;  4HAE A;  2VB2 X;  4BWG B;  2XWB B;  4ZLT F;  1XX8 A;  4ZKC B;  4ID6 A;  3VA5 A;  2SOB A;  2OXP A;  1SNQ A;  4IUV A;  2EY5 A;  2PNR C;  4KN7 C;  3HOZ B;  4OIK A;  3SDZ A;  1VF5 C;  4PMW A;  2F03 A;  2PZT A;  3C3L A;  4IUN A;  4IFD J;  1A2U A;  3SK5 A;  4L8J A;  1QOH A;  4IUT A;  2K04 A;  3ND8 A;  2A74 C;  1HQR D;  5C4Z A;  5C0X I;  4CBV A;  4KN4 C;  1DM0 B;  2PW5 A;  1SJE D;  2XSC A;  2BA0 A;  2EYO A;  1PTO C;  5A2Q E;  1YNJ C;  3S1Q B;  1PZJ D;  1MSG A;  2C5C A;  4N9P A;  2J7Z A;  3NWT A;  4KV6 A;  5IGF A;  3K5M A;  2EY6 A;  1RDP D;  3VR2 A;  1Q3L A;  3LWE A;  2EDG A;  1I4P A;  1BO0 A;  5FKA C;  3MHB A;  1MBY A;  1YNN C;  1SMY C;  5KNC A;  3SVM A;  2H4O A;  3MXG A;  1PFN A;  4BY1 B;  2PMZ B;  5KYI A;  1FR3 A;  2V4D A;  1G91 A;  2D2C C;  4HCE A;  5ELE A;  1AN8 A;  1PTO F;  1CM9 A;  3DWQ A;  1CTM A;  2XVS A;  3BS1 A;  5HGT A;  3FEW X;  4AYB B;  1DD2 A;  1L0X B;  1SFO B;  3K5O A;  3M7G A;  1SSO A;  1TWF B;  3HEJ A;  3NBI A;  1TS5 A;  1EWH A;  4NKL A;  1JOK A;  2H1E A;  1B44 D;  4E6I A;  3GV6 A;  3NQT A;  4FNF A;  5FK9 C;  2XNA C;  2JA6 B;  1FNW A;  2PCF B;  4H0L C;  2F0H A;  4HN7 A;  2F0S A;  2NBF A;  4FF1 A;  1MSH A;  3EA6 A;  1ENA A;  3TBI B;  2Z8L A;  3QWN A;  2RDF A;  1RHP A;  3MTS A;  4PMC A;  1R4Q B;  2PZW A;  1X3P A;  4XIG S;  2A73 B;  1H9S B;  3A8K E;  4MN3 A;  5CGK A;  4BA1 I;  1UUP A;  3PUV A;  1EU3 A;  2EYF A;  2HUG A;  4ULL A;  2B8G A;  1WD0 A;  1KTK A;  1TWH B;  1F9S A;  1F2M A;  1JQY D;  4J8Q A;  1V1O A;  5FLX L;  4FP5 D;  3OMG A;  5K36 G;  1KAA A;  1BCP B;  2IJ0 A;  1CZW A;  3RMH A;  3SEB A;  1VCI A;  4I65 A;  4KJO A;  1FGB D;  1W6J A;  3D8G A;  4XDX A;  1STA A;  4IZ8 A;  5G3L D;  3MA2 B;  1TWA B;  5J39 A;  3RZO B;  2L9H A;  1CA5 A;  4C2M B;  2ZXP A;  3M85 A;  4KK7 A;  3HG9 A;  1ET9 A;  2A69 C;  3DWA A;  4L6T B;  3R8B A;  4DAY A;  1I4X A;  2A68 C;  5JAV A;  4C3I B;  3T13 A;  4XXE A;  1MGS A;  3TP7 A;  3QOL A;  2LS0 1;  3I72 A;  2TSS A;  1JIC A;  2MUY A;  5KIX A;  4K5W A;  4PQX A;  3I4L A;  1CHQ D;  1SE2 A;  1B1Z A;  1IHZ A;  1KAB A;  4O42 A;  1AZQ A;  4OO1 I;  5LL6 X;  2HDM A;  3LNN A;  1QNK A;  4FXG C;  3NWS A;  2X6L A;  2B2Y C;  3KLR A;  4OHJ A;  3ZYY X;  4EQN A;  1EFI D;  2IT1 A;  5D3D A;  1DYQ A;  2F0K A;  3CU7 A;  4IN3 A;  1Y8N B;  1NUC A;  3EFX D;  1U9R A;  2LMC B;  4DN4 M;  1SYC A;  3R3O A;  5CV6 A;  1OXV A;  1RTN A;  3FVQ A;  4F8M A;  5JEA G;  5CBA E;  1HHV A;  4WJW A;  1QIL A;  2KUM A;  3H0G B;  2JXM B;  1ZEQ X;  2NUC A;  3BVZ A;  1MI2 A;  4U68 A;  4UAI A;  1TS2 A;  5I6W A;  3SK6 A;  1WTW A;  1G2T A;  2L1B A;  1PZK D;  3TN2 A;  1BUV T;  4FXK C;  1EY5 A;  4IFD H;  3V2T A;  2NVY B;  5EPL A;  3BYY B;  3GD7 A;  5E3F A;  2QIL A;  1Q8I A;  2FJ2 A;  1Q90 A;  5KEE A;  1CK1 A;  3SK4 A;  2AUJ D;  4HED A;  5C44 B;  2ENB A;  4A3E B;  4ODG A;  3HP3 A;  1YNJ D;  1ZXT A;  1JWS D;  1H9K A;  4M8A A;  3ONA B;  1DCZ A;  4IQZ A;  1WD1 A;  1XXG A;  1ONL A;  3DWP A;  3EVQ A;  1Q1B A;  2EPB A;  4K5X A;  1LTR D;  2F3W A;  4ZYS A;  1C48 A;  5E1F A;  3M7N A;  3X3M A;  1IKL A;  1EY6 A;  2ID0 A;  4RHS A;  4LJZ C;  4QIW B;  1RKN A;  2GA4 B;  1I4H A;  4RGT A;  1YNN D;  5A2Q L;  2NN6 I;  4XT1 B;  4OO1 G;  1B4O A;  5CYU A;  3K5L A;  4JBW A;  4JK1 C;  5D14 A;  1HUM A;  1G29 1;  5DM7 3;  1I3Q B;  3HS0 C;  3TP6 A;  4G7O C;  3KBX A;  5DAU A;  2LFN A;  5BN3 A;  1MD2 D;  4R9W A;  1ESR A;  4XYO A;  5KYL A;  2WP8 J;  1IL8 A;  3C46 A;  3H09 A;  2K05 A;  2K5W A;  1IYV A;  2E75 C;  3WOF A;  2XN9 C;  4PMB A;  5EJW A;  1JOR A;  5ELD A;  1HA5 A;  3PMF A;  3H91 A;  5C4X B;  3MVV A;  1SBB B;  3P75 A;  4OIJ A;  1RCV D;  2E2D C;  2F0N A;  2M9V A;  3I8Z A;  4MIU A;  3H3V C;  2NVT B;  1BCP D;  1GHJ A;  2X69 A;  5M9O A;  3I90 A;  1D5M C;  2BDN A;  3L7Z C;  3E6Z X;  3KBG A;  2F0D A;  4A3G B;  3IFD A;  1GJX A;  1EEF D;  1LLR D;  2F0J A;  5JPM C;  1JOQ A;  3D3R A;  3MXU A;  2B2W C;  1KDC A;  1HPC A;  1LTI D;  2EY1 A;  5CV9 A;  3DHQ A;  1I50 B;  1OXS C;  3QB3 A;  2CW0 C;  4A3M B;  1QNU A;  4ILW A;  2D62 A;  5EPK A;  3W2D A;  1QJO A;  3KLS X;  3UI2 A;  4A3B B;  1S5D D;  4B08 A;  1D5X C;  4A93 B;  3GO5 A;  4DK0 A;  2Y0S B;  4G57 A;  1PLF A;  3TZU A;  3V05 A;  5C6A A;  3M4O B;  2R93 B;  2B8F A;  1FNU A;  4NP5 A;  5IGB A;  1B3A A;  3A8I E;  4X3K A;  2YU9 B;  2K03 A;  3BVM A;  2NN6 G;  2A69 D;  3KLS A;  2Z4H A;  1CT1 D;  3AU7 A;  3WOE A;  2A68 D;  1EY4 A;  3OW7 A;  2Q8T A;  2WAC A;  3NBH A;  4KY6 A;  2F4I A;  5EKL A;  5G3L F;  2A6E D;  1Y69 U;  2HDL A;  2SEB D;  1F77 A;  3Q22 A;  1F2Y A;  3MC0 B;  4KKS A;  1EZ6 A;  3HGB A;  2BE5 C;  2DNE A;  3RZD B;  1OXU A;  2O2L D;  2SNS A;  1Y8O B;  1S5F D;  4IUR A;  2K7V A;  1PYW D;  5IT9 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...