1IKMA

Nmr study of monomeric human interleukin-8 (30 structures)
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
69
structure length
68
Chain Sequence
ELRCQCIKTYSKPFHPKFIKERVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN INTERLEUKIN-8 (MONOMERIC)
publication title 1H NMR solution structure of an active monomeric interleukin-8.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine (chemotactic)
total genus 10
structure length 68
sequence length 69
ec nomenclature
pdb deposition date 1995-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ikmA00
1NR4A 1F9SA 3DM1A 4IUQA 4U68A 5EQ0A 1J8IA 2RVLA 2XIWA 1DOMA 1Q3LA 3MTSA 4RA8A 5CBAE 1AZQA 2JP1A 1M8AA 3FPUB 4MHEA 1B2TA 1RJTA 1AZPA 5EKIA 2B2VA 2RA4A 1IKLA 2RSOA 1HA6A 3IFDA 2B2UA 2DY7A 2FHTA 2MGSA 3G7LA 3GV6A 2B2VC 5T1GA 5CBEE 3DEPA 1ZXTA 2HDLA 5EJWA 1ESRA 1QE6A 1QG7A 1G6ZA 2HUGA 1HHVA 1PFNA 1U4LA 1MI2A 4O42A 1X3QA 2IL8A 1WTOA 1WTRA 1GUWA 2M2LA 1XX8A 2FMMA 3F2UA 1BNZA 1RTNA 2K1BA 5AFWA 2FJ2A 1ILQA 1EL0A 1B3AA 1XYIA 2FINB 2B2TA 4LMQD 5E4XA 1WD0A 1CA6A 2KUMA 2L12A 3QO2A 1IL8A 4X3UA 1WTPA 1DONA 1PLFA 2B2TC 1MSGA 2FFKB 3I91A 5COYA 1SDFA 2N55A 1VMCA 2R3ZA 3KBXA 1HFNA 1DOLA 1SSOA 4CJ0B 1RHPA 3D6WA 3I90A 2KEDA 2HCCA 1J9OA 1VMPA 4MN3A 4QUFA 5D14A 1RTOA 1U4RA 1HUNA 1U4PA 2MP1A 3SVMA 2KECA 3LWEA 4XT1B 4DN4M 3TN2A 2B2YA 2H1EA 2J7ZA 4ZLTF 2B2UC 2NYZD 2SDFA 1JE4A 2K01A 1WTVA 1F9QA 4UAIA 2B2YC 4X3KA 1KNEA 3I3CA 4HAEA 2K04A 4CJ2C 1HUMA 4CJ1B 4X3TA 3KUPA 1MSHA 4OIKA 5T1IA 5EPLA 2EOTA 4RAUC 1MGSA 2NWGA 2L9HA 5CORA 2B2WA 3TZDA 2N88A 2X69A 1ICWA 2X6GA 3GV3A 2K05A 3IL8A 2B2WC 4IUVA 2KVMA 1IKMA 4IUPA 1WVLA 3N52A 4HSVA 1C8CA 1JICA 1NR2A 1E0BA 1O7YA 4ZAIA 2D9UA 1B50A 3HP3A 1EQTA 2JYOA 3UI2A 1PDQA 3ONAB 1X32A 2KOLA 5EPKA 1TVXA 1X3PA 2DY8A 4R9WA 1F2LA 1O80A 2L11A 4XDXA 2CVRA 3R93A 4IUUA 1NCVA 2HCIA 1EIGA 1F9PA 1A15A 3H91A 3DEOA 1QNKA 3I8ZA 4HCSA 1O7ZA 1WD1A 2HDMA 1EOTA 5JJZA 1HRJA 1U4MA 4NW2A 2BDNA 1SAPA 4RWSC 2MJ8A 1WTWA 5E4WC 1WTQA 1AP0A 1S4ZA 3MWYW 2RSNA 1HFGA 4QUCA 1BF4A 4X3SA 4R8IA 2L1BA 1PFBA 1RODA 4HEDA 2NZ1D 3P7JA 2MPMA 1CM9A 5D65A 1G2TA 1B4OA 2Q8TA 1DZ1A 4IURA 4XT3B 1EIHA 1BO0A 5DNFA 1DOKA 2K03A 3Q6SA 2EPBA 2VXWA 1ILPA 3FDTA 1BBXC 2Q8RE 4ZKCB 2X6LA 1PFMA 2L4NA 5EPJA 5CMDA 2KEEA 1WTXA 4ZKBB 1NAPA 2K28A 4OIJA 1G2SA 1G91A 1ML0D 4ZK9B 1CA5A 1LV9A 1F9RA 4IUTA 2EE1A 1KNAA 1B53A
chains in the Genus database with same CATH superfamily
5C5LA 1ASZA 3HKSA 1J8IA 2SNMA 3K59A 3ICEA 2WP8J 3WOEA 1K8AC 4RKLA 4B9WA 3PO3H 5KNCA 3GV6A 2HQLA 1L0XB 2RKSA 3F2CA 4EVOA 2E2JH 1LT4D 4NXML 1B70B 1TIID 4LFBQ 1D1IA 1X3QA 2AWNA 5IT9L 1S5CD 3OOCA 1PH6A 3FMCA 1EWCA 2IY5B 1I6HH 1VDZA 4JI1L 1MSGA 5FO9B 2K75A 2R92B 1STYA 1UNSA 4LJZC 2JA7G 3GTMH 1KABA 3ULJA 4ME3A 5IT9c 4P75A 2JA7B 2NVXH 5C6AA 5EBCA 4KK7A 4BXXG 2KECA 3BS1A 2V1CC 4Y7NH 2A6HC 1BDOA 1ASYA 2UXDQ 1XMQL 4KY6A 3Q22A 2B39A 4L6TB 4RGMA 5C3WA 3I4MG 5GADC 1SBBB 1Z9FA 5IP7G 3SK8A 3I4MB 2L9HA 3U9SA 1TY2A 2PNHA 3M4OB 2K5HA 1GM5A 1EQVA 3BVZA 1K8OA 1LACA 2EY1A 1IBML 1P16A 1E1OA 3UI2A 1I94L 3KF6A 1STHA 2K52A 2EDGA 5HURA 1SYCA 4JI2L 3K5MA 3DEOA 1U5KA 4C3IB 3OWFA 1A6XA 2BDNA 4IALA 1OO9B 4RGTA 4CHTB 1Q86C 4B3SQ 3SHLA 1EY4A 4X3SA 1HQMC 4R8IA 4ZRZA 1RODA 3KLRA 5D65A 3NENA 1D2BA 4MNOA 1TS2A 3M7GA 1E2WA 3TBIB 1N9WA 4JI8L 1LTID 4LF9L 4X66L 4ZK9B 1CUKA 2EY5A 4IJHA 4OHJA 2O5JC 2JJQA 2F0QA 2OEOA 3ER0A 1H95A 1EQRA 1X3FA 1JWMD 1M4VA 3MTSA 1A62A 3R3OA 5LL6X 4DV4Q 1AZQA 2JA7H 1QVCA 1RL2A 1YEZA 1T5XD 3K0XA 4BXXH 1AE3A 1RKNA 3TQYA 4YY3Q 1S5BD 3S2HB 2HDLA 1C48A 4R4CA 4HJ5A 1PFNA 2UU9Q 2IPKD 4L5SA 1D6EC 1RDPD 3PV0A 3I4MH 2C5CA 2K1BA 5IP7H 3R2IA 1KDBA 1JE5A 4FO2A 2F0KA 5JPMC 1GXDC 1TWAB 4J6HA 3D6WA 4JI7Q 1CKNA 2EQSA 1NBWA 3G6EA 1V1PB 3LWEA 2B2YA 2H1EA 3VDYA 5IE8A 1EY6A 2K14A 4WRDA 2F0WA 2EXZA 4J15A 5IGFA 1PYBA 4X3TA 2DJFC 1BVSA 1QILA 4X65Q 2CQOA 3K80C 3PUXA 1AFPA 1VCIA 4BBSG 3BG3A 3KLWA 4JCVE 3S1QB 4JK1C 4BBSB 3FRPB 1Y69U 4AYBG 1MHWC 2KCMA 1S72A 2JA5G 4GKJQ 3PF5A 4LF6L 4AYBB 4PG3A 1YNJD 1GJXA 2AQ3B 1OXTA 2DY8A 3S2DB 2JA5B 1BOSA 4L5RC 1BCPF 3PF4A 3S16B 3E6ZX 3HOXG 4YIJA 2SEBD 3I72A 3SK6A 4DFAA 3T1HQ 4H7BA 3HOXB 2CW0C 1B9MA 2F0JA 1SE2A 4LF4Q 3S2HH 2VS1A 4BWGB 1G2TA 4OO1G 3SE0A 1YBYA 4DR2L 2MNAA 3RD4A 4G4KA 1ILPA 3NELA 4OEMB 2K50A 2UUAL 3NHHA 4H44C 3WOFA 1WTXA 1TS5A 5C5MA 4C3HG 3BVGA 4AYBE 2EXDA 1B53A 3SDZA 4C3HB 2VQEL 1VQMA 2RQXA 2O4XA 3FVQA 4N9TA 2CWAA 1TWAH 3IKJA 2RVLA 3PUZA 2XIWA 3VA7A 1A63A 4C56C 1MKHA 2GA4B 3FPUB 4GN3B 4YCVA 3QWNA 4LFAQ 2A6HD 4UHVA 2DY7A 2ZM6Q 3A5UA 3PUVA 3IFTA 4DR4L 3NQIA 4KTAA 1QE6A 4FF4A 1E2VA 3J81j 1Z6HA 1P8LA 2IX0A 2K5DA 1SLJA 5K5PA 2JA8B 3F2UA 1XX8A 5JJIA 5AFWA 2RHQB 3EVQA 1F77A 1F2ZA 2F4VQ 3P75A 1KRSA 4EQOA 4BBSH 1DONA 3OW7A 5G3LF 1VQKA 1T9HA 3ULLA 2MUYA 3V96A 2JA5H 4UP8A 1VQ9A 1N34L 3S16H 4ZLTF 3OYYA 5I9PA 1PTOF 5IY0A 1PVOA 3PCOB 2A68C 2K04A 4CJ2C 3C3LA 1O78A 3ERQA 3K5LA 3HOXH 1MSHA 4JOIC 2EOTA 3STBD 5I9OA 2JA9A 2XWBB 2X6GA 4IFDJ 5J22A 2MHVA 1Z47A 4G57A 1RIPA 2LSSA 4OO1H 1NR2A 4ZAIA 1UAPA 4LFBL 4JBKA 1XTDA 5C4JB 3NEMA 3D4DA 3JC66 3NTKA 1X3PA 4R9WA 1EY0A 1O80A 4PMWA 1PV4A 4C3HH 3AMUA 1V8QA 2PZTA 3L2PA 1BXTA 4X6AH 3J80E 3JAML 2F0GA 1PFBA 1LTRD 5IYDG 3NTHA 1S40A 1PMRA 2CCZA 1D1KA 1E2ZA 2AQ1B 1A0IA 5FK9C 3GQBA 2HHHQ 4FVMA 1C9OA 4JBJA 4EQ5A 4HMJA 1AEXA 3AFQA 4IN3A 4DK3C 3JAMc 2K5WA 3CU7A 4TQUS 1F9RA 1XXGA 1L1OA 1YNND 3DM1A 1SYFA 3TP7A 4LK1C 1PZJD 1IYUA 2EYJA 5CBAE 1R9TB 1QWYA 2KQ3A 3J7ZC 2B2VC 4A3LG 3D4RA 1ESRA 2HUGA 1HHVA 4AQYQ 4B3SL 4B08A 4G7ZC 4GS3A 1KQSA 4IFDI 3NXWA 3QOLA 2HIXA 2A1AA 4DAPA 1VS0A 5E4XA 2Q8IB 1SNDA 5KRUA 2FFKB 3VYSA 5C4JH 4MZ9A 3J81i 2PZUA 1TWGB 3A5ZB 1DYQA 1SNQA 1HNZQ 2NUCA 2GN5A 2KHJA 4ABNA 1VQEA 1QB5D 5GQOA 2PQAA 4KJOA 4JC0A 4DXFA 1HPCA 1KDCA 4KJNA 4QIWE 3CCQA 4OWTB 3KBGA 2F3VA 4CJ1B 4GOPA 1ESFA 4DV4L 1QNUA 2ZTCA 4A3DG 5E7NA 4A3BG 2K32A 3F1ZA 1SEBD 5IYDH 1TT2A 4A3DB 4YY3L 1PH7A 4QQBX 4A3BB 1GOZA 2B2WC 2KVMA 5C0XG 4ZYSA 2QDBA 2UU9L 2J0TD 2I5MX 1LUZA 2RHSB 1YVCA 1UEAB 1KAAA 1RCVD 3TP6A 1JJ2A 4DR6Q 5L37A 1JB3A 4K2KA 5I2XA 2QF7A 1KRTA 4ME5A 3U9OA 5IYBG 2PCFB 5A35A 2OXPA 1QCBD 4HJ9A 2DN8A 3T51B 4JI7L 4IPHA 3MXGA 1PH1A 5IT9E 5JEAG 3BZKA 2NVYH 2P5ZX 3CCLA 1OXVA 4OGQC 3T53B 2K03A 4A3LH 1NE3A 3CCVA 1W6KA 1BBXC 1LTGD 4X65L 1SE3A 4KN4C 3UDXA 2IW3A 4OONA 4KI0A 4XQNA 1ML0D 2LFNA 4O2DA 4HIKA 3I2ZA 4IPCA 5ELNA 1TWGH 4FXKC 1PH3A 3BU2A 2MFIA 5DLQE 1SMXA 4GKJL 3W3AA 1GUTA 3HOYG 4H13C 3MZ5A 4DK1A 1K8MA 5FO7B 1I50H 3E3XA 2DUDA 1HA6A 2RA4A 5CBEE 1KXLA 4CKBA 3GDEA 1GUSA 3DEPA 2RDHA 4BBRG 3W2DA 3T1HL 3MAQA 4GKKQ 4BBRB 3L7ZC 1H9JA 4LF4L 2FJ2A 5I2YA 4A3BH 5D3DA 1G6PA 4LMQD 3GTKB 4A3CG 4C1NK 2L12A 3CCSA 2F0OA 3QIAA 5LHY1 3GD7A 5C0XH 3J7A5 1VMCA 4OWWB 3MXNA 1SJED 3H15A 1Q81C 4QUFA 1D5MC 2JE6I 3K7UC 2WKCA 2Z6BA 2CQAA 3AB9A 1VQBA 1G291 1S5DD 3EBEA 4HAEA 3CXCA 1TKWB 5IYBH 3J80L 3A8JE 3KLSA 1C0AA 1IXRA 1JC7A 4APVA 4C2MB 1VQ8A 1XJVA 2KBNA 1SNCA 4LFAL 5CORA 1Q90A 2EYPA 2G9DA 2NWGA 5ELBA 2ZM6L 2WACA 1LTTD 1T5EA 2F4IA 2WAQG 5EGTA 5IYCG 4LUVA 2WB1G 3HOVG 1GUOA 4HJAA 2HIVA 2WAQB 2FMCA 2BH2A 4PV1C 3HOVB 1QUQA 1LTSD 2K5QA 2ATWA 4I65A 5EPKA 4BA2I 1CT1D 1LO5D 1K9MC 4QY7A 4WFN3 2F4VL 4JI5Q 2L11A 1CSQA 2Z4HA 2CVRA 1A15A 3NTIA 3HEJA 3S15B 1SAPA 1WTWA 5I4DA 3HOYH 2EJGC 1E1TA 3KF8A 1FGUA 2A6EC 5C44G 1EIHA 1BO0A 1DOKA 3JAMi 5BN4A 5KYLA 4BBRH 3U4ZA 3NBHA 5C44B 3OMGA 1HNWQ 1JJGA 3BYYB 2WB1E 2Z6KC 1VF5C 3CC7A 2VL6A 3PUYA 1VF7A 3BZDB 3GTKH 5CR3A 3CHBD 4IUTA 2EZVA 2O2LD 3G48A 4A3CH 3M4YA 5EKKA 4UP9A 1SNOA 1VQFA 4LWCA 4POGA 2VB2X 1JR0D 4TVAB 1DCZA 4C2MH 3ND9A 1O7LA 3CRKC 1WTOA 2DGYA 3K7AB 4XQJA 1FNVA 2FMMA 1UWVA 5GAHC 3BDLA 1XYIA 5GAEC 2B2TA 1IL8A 2HHHL 5IYCH 4X62Q 3HOVH 3MVVA 1X55A 3I90A 2ENBA 1V1QA 4PZ8A 4CKCA 1RTOA 2D2CC 2E74C 4JI4Q 2IT1A 2J7ZA 2YYZA 5CV7A 1XNRQ 1CI3M 1HUMA 3K81C 3RLOA 5CV4A 3URYA 2OTLA 2R92G 2JXMB 2H4OA 1B1ZA 2K05A 3RMHA 1E7ZA 5DM73 4B3RQ 3N52A 2JEAI 1KIXA 4IPDA 1E0BA 4AQYL 5C44H 3CMAA 1H9SB 4YWLA 2A74C 2LMCB 1ONLA 1JCKB 1C7YA 2F0LA 2NTSA 3AEVA 2SNSA 4DA2A 3DWQA 3CC2A 2JSOA 5ELCA 2NVQB 2RDGA 4HCSA 3V05A 1HCZA 1HNZL 1STGA 1U4MA 4A3IB 2PW7A 2OQ0A 4ZCKA 2PI2E 1SYGA 4CDDC 4ALPA 3AYHB 3T4AC 1O7IA 3F8TA 1L0WA 2D62A 3OPOA 3HKZG 5FJ8G 3CCEA 2WINB 3HKZB 3GTOB 1LTAD 3LNNA 4GLXA 3KJPA 4ZKCB 1EYGA 3K7AH 2UXBQ 4P74A 4C3IG 1PH8A 4DV5Q 1PXUA 1CZWA 1LT5D 4HSPA 1L1OB 4A93G 3RNUA 4DUZQ 1BCPD 2LXJA 4OXPA 2UUBQ 4A93B 4A3KG 3H6MA 3MXPA 4K5VA 1B2TA 1AZPA 4DR6L 1L0YB 4JYAQ 4A3KB 3TSSA 5HGQA 1QVFA 4H0LC 5C3XA 1VQJA 1J5EQ 2AUJD 4EX5A 1KDAA 4K5WA 2B8GA 1N36Q 1K83B 4BY1G 3A7LA 2KENA 3RUZA 4K6DA 5LL6S 1OXXK 4BY1B 4U673 2R92H 2N78A 2AUKA 4RCNA 5LMNQ 3OIQA 3I91A 3UDIA 1X9NA 4CJ0B 2EYLA 1U4PA 3JAME 1EZ8A 3SVMA 4LF7Q 1IHZA 2NVQH 2NYZD 3S14B 4QJFA 3I3CA 1PRTB 3EIVA 1EY9A 2YTYA 3KUPA 4NXNQ 3BZCA 3M4OH 1UE5A 2A6ED 3K0YA 3J80i 1EFWA 1SR3A 1Y8PB 3CC4A 3H3VH 3GTOH 5FJ8H 3AQQA 3S1NB 4GKKL 5BN5A 3HP3A 3H3VC 1HNXQ 4RCOA 2Z6KA 1KAWA 5G3LD 4C3IH 2LXKA 2HCIA 1WD1A 1JWSD 3I8ZA 3GTPB 3N6RA 1PTOD 4YHHQ 1BF4A 2Y0SG 3ZJYC 4A3KH 4DR3Q 2Q2HA 2Y0SB 4DV6Q 4DAYA 1AN8A 1DZ1A 4XT3B 3FP9A 3FDTA 1K83H 2N8NA 3S1MB 1IL2A 1EYAA 1PFMA 2JK8A 1LTBD 2XWJB 1VQ5A 4BY1H 2NN6I 5ELEA 1CQFA 1X3EA 4DPGA 4IQZA 1XWEA 2KCTA 5EQ0A 3E0JA 4RH6A 4GNXB 4B3MQ 4NDXA 2KA7A 4A3FG 1RD9D 4Z9CB 4KLKA 2QEXA 1B44D 4JI5L 4A3FB 4OX9Q 1F2YA 3EQLC 4JI6Q 3S14H 2BE5C 1VQLA 2ZTDA 2E76C 4AIMA 4PZ6A 1ZXTA 1EIYB 3C46A 4Q0FA 1PRTC 1MI2A 3C1FA 5KIXA 5C4HA 3V2TA 1EL0A 1WD0A 3CP0A 4WORA 3S1NH 1IYVA 3U4VA 2IJ0A 1FGBD 1HNWL 2XN9C 2KEDA 1TWHB 3PQIA 5M5YB 2MP1A 1X56A 4IOAA 5EAYA 3OMCA 4DXGA 5KGUA 1JMCA 4DU9A 4K6LA 4R8NA 3GTPH 2CH4A 3LGJA 1W6JA 4X3KA 2JA8G 1ZYRC 2MO0A 4X64Q 2KCNA 3ITPA 1NMGA 3OIPA 4HMIA 3S1QH 2B29A 3PO2B 1EY8A 1N32Q 1IYJB 5JPNC 1B50A 3S2DH 1QUQB 1TVXA 5C4XG 5FO8B 1I5FA 3M4PA 5DM63 3HG9A 4DV7Q 4WJ4A 1ENAA 4KY5A 5C4XB 4P73A 1HR0Q 1SRUA 4X62L 3FPPA 1EOTA 3CQZB 1LLRD 1E24A 4O1NA 5C4ZA 4RG1A 1KD1C 4DF7A 4GNXC 4JI4L 3AFPA 2OQKA 3HOWG 1SYBA 1YJNA 2XGTA 5EBDA 1JT8A 1I4QA 3HOWB 4IOCA 1VQOA 3HS0C 1XNRL 1PYSB 3Q6SA 4BY7G 3A8KE 5J3BA 1Q8IA 1E3PA 3EJIA 1SMYC 4AH6A 4BY7B 1HTPA 3NBHB 2AWOA 3TP8A 1LV9A 5JOBA 4LUOA 4A4IA 3NP8A 4B3RL 2L15A 1NR4A 5EKLA 1VQIA 1TR5A 1TWHH 1NJIC 1Q3LA 1PFSA 4RGOS 3M3YB 1M8AA 4KKSA 1RJTA 1SJHD 3DMUA 3PGZA 1KLGD 3DXJC 3U58A 3OSOA 4R1JA 2QGQA 2JA8H 4TRDA 1B7YB 4H02A 4V190 2KHIA 1HZBA 4QF4A 5IGGA 1TWCB 4DV1Q 2L5TA 3UE1A 1B3AA 4LFCQ 2M00A 3MC0B 3DUZA 4DR7Q 1UE1A 4LW1A 4CGYB 2D5DA 1GKHA 1ET6A 2AKWB 4FXGC 4A3JG 3MEHA 2WV6D 5COYA 1N33Q 2WIIB 1DOLA 2UXBL 3H0GG 4A3MG 4PZ7A 4A3JB 2F0NA 1J9OA 1EEFD 1VMPA 4K8IA 4UPAA 1QVGA 1HUNA 4DV5L 1VQGA 4HJ8A 3H0GB 5C4XH 4A3MB 4B9XA 4XT1B 2C9OA 2OWOA 4FP5D 3CQZH 4DUZL 3HOZG 1YNXA 1X6OA 3I7FA 2BDOA 2UUBL 5ELFA 3HOZB 1PA6A 3TP5A 1H9KA 4QL5A 4JYAL 1EWHA 3PIOA 3HOWH 1J5EL 2VY3A 1I4PA 1U0LA 1D5ZC 3NUCA 3TS2A 1XTCD 1YJWA 4IFDG 1N36L 4BY7H 3VR3A 3CPFA 2F03A 2I5LX 2JQOA 2F0HA 2E2DC 2A69C 2B8FA 5LMNL 1AH9A 3O13A 1DGSA 2N49A 3CW2C 1NY4A 1STEA 2HT1A 3VR4A 1KC8C 2CW0D 2MJ8A 3M3YH 3MWYW 4QUCA 2ZXRA 5DAUA 1AW7A 2E2IB 1II3A 2BE5D 4LF7L 4DAMA 2R61A 4HEDA 2F3IA 2NZ1D 3P7JA 4RKBA 2I07B 5E3FA 2EPBA 2OF1A 3EN2A 4RMFA 1MD2D 4NXNL 1FVIA 5CMDA 3KF6B 4A3GB 1HZCA 1TWCH 1CA5A 1TWFB 2WKDA 2Z4IA 1F9SA 2BOSA 1HA5A 2K33A 1R9TH 1HNXL 3ERSX 1PH4A 4A3JH 4K14A 4DR5Q 1BBUA 1I6VC 1BCPB 3H0GH 4MHEA 5JVG3 5EKIA 2F0PA 1V1PA 1IKLA 4RGNA 3IFDA 1ZYRD 3ND8A 3F2DA 1EIFA 3HOZH 3R2TA 2IX3A 4YHHL 1U4LA 2PZWA 1W2BA 3CD6A 2M2LA 4DR3L 2BA1A 1BKBA 4DV6L 1ILQA 2FINB 4JW0A 4E6IA 1IW7C 3MEFA 5LMUQ 3FHWA 1QOHA 2R3ZA 3I56A 1OTCA 4IFDH 1PZKD 4MN3A 4HJ7A 3RZOB 2C35B 2A68D 2IHEA 1WTVA 3NWSA 4B3ML 1YHBA 5BR8Q 1HJPA 4R4IA 4BA1I 4KN7C 1M90C 4JOIA 1XMOQ 2E5LQ 2E2IH 4A3DH 4OX9L 2VQFQ 4HIMA 2RCNA 4ID6A 4JI6L 4DKAC 1FR3A 1SE4A 1X54A 2R6GA 2X69A 4S3SA 3F2BA 2UUCQ 3B6YA 4LAAA 1STBA 1TY0A 2R93G 1SMYD 2PQEA 4IUNA 2R93B 3CCUA 4L5TA 1CKNB 1X32A 2JEBI 1Y14B 2RDFA 5M5WB 4HR7B 3M7NA 4YCUA 4XTCS 5CGKA 4DK6C 5M5XB 1VQDA 4RHSA 1AE2A 5IGEA 5KYIA 4DV2Q 3FKIG 5E4WC 4NB3A 2XNAC 3GTLB 1GO3E 1HFGA 3A55A 4L5QA 3E0EA 4NMZA 4JI0Q 1PTOB 4J1MA 3E9HA 5JEAH 3FKIB 1PRTF 2MPMA 3GTJB 1DJRD 5IGCA 5DNFA 2QA4A 4X64L 2JA6G 2VXWA 3VYUA 3TDQA 1NSNS 2Q8RE 3DWAA 4K5XA 5EPJA 2JA6B 2NBFA 1DM0B 2F3WA 2D0PA 1G91A 3TS0A 5DEHA 1N32L 1D8LA 1TS4A 4LF8Q 4ILWA 3KDFA 5IOCA 2NZHA 1Q12A 1WI5A 5JJLA 4GLVB 4DV7L 1FJGQ 2B2VA 1HR0L 4DK0A 2MGSA 4L8JA 4K0KQ 3MHBA 4GN5A 4Y52H 5IIFA 4F7XA 1K73C 3NPPA 1G6ZA 2Q2UA 2ICIA 2WAQE 2EYMA 3J7AF 2IL8A 1WTRA 4O0AA 3NBIA 1XPUA 5M3FG 3A74A 4LNQA 1X3GA 3QO2A 5M3FB 1WTPA 4FYDA 1S5FD 2ES2A 4QMGA 3C1EA 3QJYA 4JG2A 5A2QL 2HCCA 1ET9A 4GZYC 1SFOB 2A69D 5M5WH 4JI3Q 3GTMB 1Q1EA 3T16A 4CDFC 2B2UC 2NVXB 1JE4A 2K01A 2B2YC 2CWPA 3RR5A 1K3BC 5E1FA 1Y1WG 3GTQB 1CSPA 4N8FA 1ZKOA 3EA6A 3GTLH 4QB4A 1A3VA 3L3OC 4RFBA 1Y1WB 1Q82C 3FKIH 2O5IC 1EU4A 2EJMA 4YCWA 5CV9A 3GTJH 2TSSA 1MGSA 3HGBA 2JN4A 5KNBA 2B2WA 1JJCB 1ICWA 4CDCC 1JB7A 3IL8A 1IKMA 4IUVA 1VQ4A 2G5DA 1TXYA 2EJFC 1JORA 4BS9A 2JA6H 4KV6A 1OXUA 4GLAC 4C1NI 5FLXc 4R4QA 5LMNW 4DV1L 5HY6A 3UDGA 4LFCL 4RHRA 1W3SA 4EQPA 4DR7L 4XDXA 1LT6D 1Q7YC 4IUUA 1NCVA 3S15H 1YNJC 1F9PA 4V0BA 1N33L 5JJZA 1U9RA 4NW2A 4OELB 4G7OC 3DLLA 1AP0A 3VYRA 3C2PA 2Z9HA 3T13A 1STAA 4PMCA 3KLSX 2VUMG 3UE0A 1YI2A 3EFXD 3MA2B 2VUMB 1CK1A 3CCMA 2X6LA 3W5OA 3QOJA 3D31A 4HCEA 5AJ3Q 1IZ6A 5H1SE 3RLFA 1LABA 1IW7D 2NB0A 4KMUC 3KJOA 4A3IG 3NSWA 4MTNA 5M3FH 5M3MG 3D4WA 1HXYD 2I46A 4FF3A 5M3MB 2EY2A 3SGIA 1SFOH 5IGBA 1YIJA 3LWUA 3A8IE 1FD7D 3OTOQ 2RSOA 3G7LA 5T1GA 1CHQD 3GTQH 1BUVT 2BH8A 4KD4A 3H3VI 1Y1WH 1H9MA 2K6AA 3DHQA 4HIDA 1GD7A 1I4HA 3VR5A 3ZYYX 4DV3Q 1XPRA 5KNDA 3NWTA 1L2FA 4X3UA 1TU2B 1HQRD 4R4OA 1FYCA 2N55A 1SDFA 1SYDA 3I4NG 4F88A 2E8GA 4ZQ3A 1RHPA 2LY7A 2ICEC 3I4NB 5IODA 4CKEA 3S1RB 1DD2A 4UAIA 3CAMA 3HKZE 4DR5L 1D5XC 4A76A 4OIKA 5EPLA 1WCMG 4HN7A 5TSSA 1WCMB 4M1UB 1XNQQ 3CCJA 2VUMH 1CHPD 3Q8DA 3STBC 1O7YA 1YJ9A 2D9UA 1EQTA 2JYOA 5JAVA 4B3TQ 1Y8NB 4ZUJA 4PNYA 4FDBA 2J4XA 2KOLA 2PQAB 4QCLA 3PIO3 2ZJPA 5LMUL 3ULPA 4JBMA 4A3IH 4I7ZC 1FL0A 3M4QA 1IBLQ 4UDUC 2H5XA 5M3MH 4GOPB 2F0VA 1EY7A 1IBKQ 1K3RA 4NKLA 3CPWA 2RSNA 4K2LA 1PHJA 2L1BA 1YITA 4G7HC 3KOJA 5D3IB 4DUYQ 5FKAC 2Q8TA 1ICFB 5BR8L 3MXUA 2EIFA 2UXCQ 5GROA 4HTHA 1XMOL 3SEBA 2E5LL 2VQFL 1NAPA 4FF1A 1TS3A 5HGTA 2QW7A 2UUCL 3J81L 1SNPA 2QILA 1DXMA 2EE1A 2WFWA 1KNAA 4U68A 1CTMA 3DM3A 1L1OC 1JOOA 4A93H 2F0UA 1VQCA 1YNNC 3I4NH 4RA8A 4CDEC 2CKZB 2V4DA 1HR0W 3D6CA 4DNRB 4LUZA 3NK9A 3Q24A 4IPGA 3S1RH 3J81c 2HD3A 1SROA 2B2UA 2FHTA 3BJUA 3A56A 1FNUA 4DV2L 4DNIA 2QDLA 2YTXA 4XYOA 4JI0L 4UY8C 3CRLC 1YZ6A 2ZT9C 3P1HA 1GUWA 1V43A 2F0MA 1XPOA 5CV8A 2KCCA 1WCMH 1YHQA 4PMBA 2A73B 4NP5A 2KJXA 5M9OA 4XQQA 1Q46A 3OWEB 2VNUD 1Q1BA 1UEBA 2NN6G 3M85A 3TMEA 1EEID 1E22A 3I4OA 4TKOB 2XRQD 4DN4M 3OHXC 4KHPQ 2Y0SE 1STNA 3NQTA 4LF8L 2TMPA 1PYWD 4QGUA 3I55A 5CV5A 4OO1I 2PMZB 4GOPC 2L55A 5T1IA 4POFA 1FJGL 3WWVA 3PIP3 1R4PB 1GVPA 2N88A 3RN2A 3BDOA 4K0KL 1CKOA 1GHJA 3Q0AA 3BDCA 1CKMA 1B3QA 4HSVA 1PH2A 2Q2TA 3MXNB 1PDQA 5IWAQ 3TREA 4F87A 1BR9A 1JWUD 4JBWA 1KHIA 1VQAA 4JV5Q 4KKUA 2ID0A 2GVAA 2LS01 1MJCA 4DR1Q 1HRJA 2N3SA 3SK4A 4EGVA 4N9PA 3VR6A 4JI3L 1S4ZA 1X65A 1Q8KA 2QCPX 3PO2G 2CFMA 2PMZE 1A2TA 3VA5A 1V1OA 2FXQA 5ELDA 5JVH3 1GHKA 1SNMA 2EVBA 1V9PA 3S1MH 1B4OA 4UP7A 4ULLA 1EYCA 3BYTB 3J7YW 3K57A 1ENCA 1MIUA 2F52A 4LF5Q 1EQQA 3K58A 1KLUD 4KHZA 3D0FA 4Q5VA 4IUQA 1NTGA 3MFYA 2QEJC 3X3NA 4IO9A 1OXSC 4YWKA 2F0EA 2YU9B 3S24A 3KDFB 1BBWA 1DOMA 4A3FH 2L0CA 1UUPA 1K8GA 2NN6H 2JP1A 3I4LA 3PMFA 3KF8B 2OCEA 3A0JA 1J6QA 4DV0Q 3G71A 2EYFA 3H09A 2A8VA 1G51A 2PI2A 2DNCA 1JOKA 3RZDB 4P2CB 1SN8A 4DGZA 5K36G 3CF5A 2OTJA 2AMCB 5FOBB 1JQYD 3E9IA 3Q23A 1YHAA 2A5HA 2F0IA 1PLFA 2EYOA 1PH5A 1MJEA 3KFUA 5M5YH 2DNEA 1H9SA 3TZUA 4P71A 2RCFA 1EUJA 5AJ3L 4OL7A 1U4RA 1K0RA 4CBVA 4DNTB 3TN2A 2SDFA 5C3EG 2G9HD 1QZHA 1D7QA 1KNEA 1SE8A 3T1YQ 4PQXA 5C3EB 4FXDA 1SXTA 3VYTA 3PO2H 3OTOL 5C0XJ 4RAUC 3IRBA 2ZXOA 1S5ED 2B3GA 3HOUG 3GV3A 3HZXA 2Z0SA 5CC4A 5BN3A 2ZJQA 2F0FA 2NZOA 1C8CA 1JICA 2UXDL 3HOUB 4A3EG 1SYEA 1EWIA 3LX0A 4J8QA 2E75C 3RLNA 2LKVA 4A3EB 4DV3L 3G6JB 1EIGA 1HH2P 2YU9H 1BQQT 2HDMA 2IX1A 5JEAJ 3D3RA 4RWSC 4NXMQ 1WOCA 3I73A 3CKIB 4NPSA 4QIWB 2YV5A 5IP9G 1RF2D 3WDNA 3U50C 1Y8OB 5FLMG 4IURA 2NVYB 4JI1Q 2XTIA 3RZDH 2EYHA 2L4NA 2MO1A 1EOVA 1HZ9A 4C3JG 5A2QE 4I7AA 1GUNA 3HRZC 4C3JB 5K36H 1XNQL 3W1GA 1KL9A 3CMEA 1WFQA 2M9VA 1PH9A 4B3TL 1XMQQ 3S9WA 1H9RA 4KHVA 1C4QA 5FLXE 2R7FA 2ALYB 3UDFA 2R7ZG 3EROA 3VR2A 2VB3X 1IBLL 3IAYA 1CQVA 2F0SA 1I50B 1PRTD 4A3GG 5J39A 1CZGA 5KEEA 2PO4A 2R7ZB 5CV6A 5C3EH 3AU7A 2YTVA 1IBKL 1QG7A 2KHSA 1WTHA 5I6WA 1HZAA 1A3TA 2Z8LA 2Z1CA 5C0XI 4O42A 5NUCA 2K7VA 1IBMQ 1VQNA 1I94Q 1Z7TA 1BNZA 1RTNA 1LTLA 4DUYL 5ISRA 2PPBC 3KYHC 1S3OA 2UXCL 2KUMA 3R8BA 4KKTA 1WJJA 2B2TC 3SR1A 4JI2Q 3HOUH 4M8AA 3KBXA 3CCRA 1HFNA 1A3UA 1I4RA 4JVZA 1HTLD 2A19A 4A3EH 4A3MH 3GTGB 3E5SA 1Y1VG 3L0OA 2CH4W 2VW9A 1GUGA 1Y1VB 2NVTB 1K0SA 1EYDA 3S17B 4WJ3M 3A7AB 4ZUIA 1UE7A 5ELOA 2F1MA 4JI8Q 4GN4B 1NMFA 4LF9Q 4X66Q 4HIOA 2GVBA 2XVSA 4R4TA 4FF2A 5IP9H 3DWPA 3MFGA 1WVLA 3OW2A 1LYLA 5FLMH 2I5HA 5GAGC 3PIPA 1I3QB 2MQHA 2RF4A 3ONAB 4YWMA 3GP7A 4OWXB 4C3JH 3K6OA 3M9BA 1NNXA 3KK7A 3K5NA 3H91A 1QNKA 1O7ZA 3P20A 2IWHA 4GNXA 2AHOB 1EFID 1PZID 1FNWA 1LT3D 3NE5B 4KHPL 1CM9A 3HOYB 4P72A 4XYQA 4L63B 2F0DA 2R7ZH 3QG1A 2B63G 4A3GH 4IJLA 2K5VA 3TRZA 5IGDA 4TSSA 2PYKA 2SOBA 1JOQA 2B63B 1TWFH 4OIJA 2K28A 1G2SA 3PUWA 1QZGA 2Q2IA 2AQ2B 5CYUA 3QB3A 1LM0A 1I4XA 3GTGH 1VQHA 5IWAL 1NUCA 4A75A 1BCPC 1ZEQX 4JV5L 4ODGA 1Y1VH 4DAYB 4DR1L 2NVTH 2D0OA 2IHFA 3S17H 5EJWA 3I70A 1B8AA 3GO5A 2E2HB 4DAVA 4F8MA 5J1ZA 2CHBD 3T56B 1CFMA 1TQOA 3A54A 4FNFA 4LF6Q 2I0QA 1EZ6A 1N8RC 3G4SA 1CA6A 4K8JA 5F2DA 3SXHA 2K4KA 1I3QH 2ASBA 1I4GA 1QJOA 3J7AV 1SSOA 3X3MA 1F2MA 2HQEA 1EU3A 3RZOH 3PSIA 2WB1B 3J80c 4LF5L 5D14A 2RBMA 3PO3G 2PNRC 4MTKA 2F0TA 1G8ZD 1WYDA 2XRSD 3PO3B 1F9QA 2EY6A 1VQ7A 2BA0A 4DR2Q 2DJGC 4XIGS 3BVMA 2E2JB 2UUAQ 3FEWX 4KD3A 5JJKA 1ENFA 4DV0L 1VQPA 3RN5A 3TZDA 1EY5A 3L9AX 3J81E 2BCOA 1I6HB 4IUPA 1B9NA 2R93H 2VQEQ 2NTTA 2B63H 1VQ6A 1A8VA 3K5OA 4XXEA 1MBYA 1F2LA 2ZTEA 4MIUA 1UE6A 5M5XH 3R93A 4JPBW 3TEHB 4DR4Q 4N8X1 1K28A 1KTKA 2ZJRA 3K8AA 4Y7NB 5FLXL 1PTOH 2QKIC 3SK5A 1M1KC 1WTQA 2R7DA 3W1BA 2VZAA 2ZXPA 1A2UA 1PTOC 2K5NA 3HFZB 4IZ8A 3D8GA 3H94A 3T1YL 2E2HH 5I6YA 3QR8A 4EQNA 2KEEA 4ZKBB 4KY7A 4WJWA 1R4QB 2PW5A 2OT2A 1N34Q 2XSCA
chains in the Genus database with same CATH topology
5C5LA 1J8IA 2SNMA 3K59A 2WP8J 3WOEA 4RKLA 4B9WA 5KNCA 3GV6A 1L0XB 2RKSA 4EVOA 1LT4D 1TIID 1D1IA 1X3QA 2AWNA 5IT9L 1S5CD 3OOCA 3FMCA 1EWCA 1VDZA 1MSGA 5FO9B 2R92B 1STYA 1UNSA 4LJZC 1KABA 2JA7B 5C6AA 5EBCA 4KK7A 2KECA 3BS1A 2A6HC 1BDOA 4KY6A 3Q22A 2B39A 4L6TB 4RGMA 5C3WA 1SBBB 3SK8A 3I4MB 2L9HA 3U9SA 1TY2A 3M4OB 1EQVA 3BVZA 1K8OA 1LACA 2EY1A 3UI2A 1STHA 2EDGA 5HURA 1SYCA 3K5MA 3DEOA 4C3IB 3OWFA 1A6XA 2BDNA 4IALA 1OO9B 4RGTA 4CHTB 3SHLA 1EY4A 4X3SA 1HQMC 4R8IA 4ZRZA 1RODA 3KLRA 5D65A 1D2BA 1TS2A 3M7GA 1E2WA 3TBIB 1LTID 4ZK9B 2EY5A 4OHJA 2O5JC 2F0QA 2OEOA 1JWMD 1M4VA 3MTSA 5LL6X 3R3OA 1AZQA 1T5XD 1RKNA 1S5BD 3S2HB 2HDLA 1C48A 1PFNA 2IPKD 1D6EC 1RDPD 3PV0A 2C5CA 2K1BA 3R2IA 1KDBA 4FO2A 2F0KA 5JPMC 1GXDC 1TWAB 4J6HA 3D6WA 1V1PB 3LWEA 2B2YA 2H1EA 1EY6A 4WRDA 2F0WA 2EXZA 5IGFA 4X3TA 1QILA 3PUXA 1AFPA 1VCIA 3BG3A 3S1QB 4JK1C 4BBSB 3FRPB 1Y69U 4AYBB 1YNJD 1GJXA 2AQ3B 1OXTA 2DY8A 3S2DB 2JA5B 1BOSA 1BCPF 3S16B 3E6ZX 4YIJA 2SEBD 3I72A 3SK6A 4DFAA 4H7BA 3HOXB 2CW0C 1B9MA 2F0JA 1SE2A 4BWGB 1G2TA 4OO1G 3SE0A 3RD4A 4G4KA 1ILPA 3NHHA 4H44C 3WOFA 1WTXA 1TS5A 5C5MA 4C3HG 3BVGA 1B53A 3SDZA 4C3HB 2RQXA 2O4XA 3FVQA 4N9TA 3IKJA 2RVLA 3PUZA 2XIWA 3VA7A 4C56C 2GA4B 3FPUB 3QWNA 2A6HD 2DY7A 3PUVA 3IFTA 3NQIA 4KTAA 1QE6A 4FF4A 1E2VA 1Z6HA 2K5DA 2IX0A 5K5PA 2JA8B 3F2UA 1XX8A 5AFWA 3EVQA 1F77A 1F2ZA 3P75A 4EQOA 1DONA 3OW7A 5G3LF 2MUYA 3V96A 4ZLTF 5I9PA 1PTOF 2A68C 2K04A 4CJ2C 3C3LA 1O78A 3ERQA 3K5LA 1MSHA 2EOTA 5I9OA 2XWBB 2X6GA 4IFDJ 5J22A 2MHVA 1Z47A 4G57A 4OO1H 1NR2A 4ZAIA 1UAPA 5C4JB 3D4DA 3NTKA 1X3PA 4R9WA 1EY0A 1O80A 4PMWA 3AMUA 1V8QA 2PZTA 1BXTA 3J80E 3JAML 2F0GA 1PFBA 1LTRD 3NTHA 1PMRA 1D1KA 1E2ZA 2AQ1B 5FK9C 3GQBA 4FVMA 4HMJA 1AEXA 4IN3A 2K5WA 3CU7A 4TQUS 1F9RA 1XXGA 1YNND 3DM1A 1SYFA 3TP7A 4LK1C 1PZJD 1IYUA 2EYJA 5CBAE 1R9TB 1QWYA 2KQ3A 2B2VC 3D4RA 1ESRA 2HUGA 1HHVA 4B08A 4G7ZC 4IFDI 3NXWA 3QOLA 4DAPA 5E4XA 2Q8IB 1SNDA 5KRUA 2FFKB 3VYSA 2PZUA 1TWGB 1DYQA 1SNQA 2NUCA 4ABNA 1QB5D 4KJOA 4DXFA 1HPCA 1KDCA 4KJNA 3KBGA 2F3VA 4CJ1B 1ESFA 1QNUA 2K32A 1SEBD 1TT2A 4A3DB 4A3BB 1GOZA 2B2WC 2KVMA 5C0XG 4ZYSA 2QDBA 2J0TD 1UEAB 1KAAA 1RCVD 3TP6A 1JB3A 4K2KA 5I2XA 2QF7A 4ME5A 3U9OA 2PCFB 5A35A 2OXPA 1QCBD 2DN8A 3T51B 3MXGA 5IT9E 5JEAG 1OXVA 4OGQC 3T53B 2K03A 1BBXC 1W6KA 1LTGD 1SE3A 4KN4C 2IW3A 4KI0A 4XQNA 1ML0D 2LFNA 4FXKC 3W3AA 1GUTA 4H13C 3MZ5A 4DK1A 1K8MA 5FO7B 1HA6A 2RA4A 5CBEE 4CKBA 1GUSA 3DEPA 2RDHA 3W2DA 3MAQA 4BBRB 3L7ZC 1H9JA 2FJ2A 5I2YA 5D3DA 4LMQD 3GTKB 4C1NK 2L12A 2F0OA 3QIAA 5LHY1 3GD7A 5C0XH 1VMCA 3MXNA 1SJED 4QUFA 1D5MC 2JE6I 2WKCA 2CQAA 3AB9A 1G291 1S5DD 4HAEA 1TKWB 3J80L 3A8JE 3KLSA 1JC7A 4C2MB 1SNCA 5CORA 1Q90A 2EYPA 2G9DA 2NWGA 5ELBA 2WACA 1LTTD 1T5EA 2F4IA 5EGTA 1GUOA 2WAQB 2FMCA 4PV1C 3HOVB 1LTSD 2K5QA 4I65A 5EPKA 4BA2I 1CT1D 1LO5D 4WFN3 2L11A 2Z4HA 2CVRA 1A15A 3NTIA 3HEJA 3S15B 1SAPA 1WTWA 5I4DA 2EJGC 3KF8A 2A6EC 1EIHA 1BO0A 1DOKA 5BN4A 5KYLA 3NBHA 5C44B 3OMGA 3BYYB 1VF5C 3PUYA 1VF7A 3BZDB 5CR3A 3CHBD 4IUTA 2EZVA 2O2LD 3M4YA 5EKKA 1SNOA 2VB2X 1JR0D 1DCZA 3ND9A 1O7LA 3CRKC 1WTOA 3K7AB 4XQJA 1FNVA 2FMMA 3BDLA 1XYIA 2B2TA 1IL8A 3MVVA 3I90A 2ENBA 4CKCA 1RTOA 2D2CC 2E74C 2IT1A 2J7ZA 2YYZA 5CV7A 1CI3M 1HUMA 5CV4A 3URYA 2JXMB 2H4OA 1B1ZA 2K05A 3RMHA 5DM73 3N52A 2JEAI 1E0BA 1H9SB 2A74C 2LMCB 1ONLA 1JCKB 2F0LA 2NTSA 2SNSA 4DA2A 3DWQA 2JSOA 5ELCA 2NVQB 2RDGA 4HCSA 3V05A 1HCZA 1STGA 1U4MA 4A3IB 2PW7A 1SYGA 3T4AC 2D62A 3OPOA 2WINB 3HKZB 3GTOB 1LTAD 3LNNA 4ZKCB 4C3IG 1PXUA 1CZWA 1LT5D 4HSPA 1BCPD 4A93B 3H6MA 3MXPA 4K5VA 1B2TA 1AZPA 1L0YB 4A3KB 3TSSA 5C3XA 4H0LC 2AUJD 1KDAA 4K5WA 2B8GA 1K83B 3A7LA 3RUZA 4K6DA 5LL6S 1OXXK 4BY1B 4U673 2AUKA 4RCNA 3OIQA 3I91A 4CJ0B 2EYLA 1U4PA 3JAME 1EZ8A 3SVMA 1IHZA 2NYZD 3S14B 3I3CA 1PRTB 1EY9A 3KUPA 2A6ED 3K0YA 1Y8PB 3S1NB 5BN5A 3HP3A 3H3VC 4RCOA 5G3LD 2HCIA 1WD1A 1JWSD 3I8ZA 3GTPB 3N6RA 1PTOD 1BF4A 2Y0SB 4DAYA 1AN8A 1DZ1A 4XT3B 3S1MB 3FDTA 1EYAA 1PFMA 1LTBD 2XWJB 2NN6I 5ELEA 1CQFA 4IQZA 1XWEA 5EQ0A 3E0JA 4RH6A 4NDXA 2KA7A 1RD9D 4Z9CB 1B44D 4A3FB 1F2YA 3EQLC 2BE5C 2E76C 1ZXTA 3C46A 4Q0FA 1PRTC 1MI2A 3C1FA 5KIXA 5C4HA 3V2TA 1EL0A 1WD0A 4WORA 1IYVA 2IJ0A 1FGBD 2XN9C 2KEDA 1TWHB 5M5YB 2MP1A 3OMCA 4DXGA 5KGUA 4DU9A 4K6LA 4R8NA 1W6JA 4X3KA 1ZYRC 2KCNA 3ITPA 3OIPA 4HMIA 3PO2B 1EY8A 5JPNC 1B50A 1TVXA 5FO8B 5DM63 3HG9A 1ENAA 4KY5A 5C4XB 3FPPA 1EOTA 3CQZB 1LLRD 4O1NA 5C4ZA 4DF7A 1SYBA 5EBDA 1I4QA 3HOWB 3HS0C 3Q6SA 3A8KE 1Q8IA 3EJIA 1SMYC 4BY7B 1HTPA 2AWOA 3TP8A 1LV9A 5JOBA 3NP8A 5EKLA 1NR4A 1TR5A 1Q3LA 4RGOS 3M3YB 1M8AA 4KKSA 1RJTA 1SJHD 3DMUA 1KLGD 3DXJC 3OSOA 4TRDA 4V190 4QF4A 5IGGA 1TWCB 2L5TA 1B3AA 2M00A 3MC0B 3DUZA 4CGYB 2D5DA 4FXGC 1ET6A 3MEHA 2WV6D 5COYA 2WIIB 1DOLA 4A3JB 2F0NA 1J9OA 1EEFD 1VMPA 4K8IA 1HUNA 3H0GB 4A3MB 4B9XA 4XT1B 2C9OA 4FP5D 2BDOA 5ELFA 3HOZB 3TP5A 1H9KA 1EWHA 1I4PA 1D5ZC 3NUCA 1XTCD 4IFDG 3VR3A 2F03A 2F0HA 2E2DC 2A69C 2B8FA 3O13A 1STEA 3VR4A 2CW0D 2MJ8A 3MWYW 4QUCA 2ZXRA 5DAUA 1AW7A 2E2IB 1II3A 2BE5D 2R61A 4HEDA 2NZ1D 3P7JA 4RKBA 2I07B 5E3FA 2EPBA 2OF1A 1MD2D 5CMDA 4A3GB 1CA5A 1TWFB 2WKDA 2Z4IA 1F9SA 2BOSA 1HA5A 2K33A 4K14A 1I6VC 1BCPB 4MHEA 5JVG3 5EKIA 2F0PA 1V1PA 1IKLA 4RGNA 3IFDA 1ZYRD 3ND8A 3R2TA 2IX3A 1U4LA 2PZWA 2M2LA 2BA1A 1ILQA 2FINB 4E6IA 1IW7C 1QOHA 2R3ZA 4IFDH 1PZKD 4MN3A 3RZOB 2A68D 1WTVA 3NWSA 4BA1I 4KN7C 4ID6A 1FR3A 1SE4A 2R6GA 2X69A 4S3SA 4LAAA 1STBA 1TY0A 1SMYD 2PQEA 4IUNA 2R93B 1X32A 2JEBI 2RDFA 5M5WB 4HR7B 3M7NA 4XTCS 5CGKA 5M5XB 4RHSA 5IGEA 5KYIA 5E4WC 2XNAC 3GTLB 1HFGA 3A55A 4NMZA 1PTOB 4J1MA 5JEAH 3FKIB 1PRTF 2MPMA 3GTJB 1DJRD 5IGCA 5DNFA 2VXWA 3VYUA 3TDQA 1NSNS 2Q8RE 3DWAA 4K5XA 5EPJA 2JA6B 2NBFA 1DM0B 2F3WA 1G91A 5DEHA 1TS4A 4ILWA 5IOCA 1Q12A 2B2VA 4DK0A 2MGSA 4L8JA 3MHBA 5IIFA 4F7XA 3NPPA 1G6ZA 2ICIA 2EYMA 3J7AF 2IL8A 1WTRA 3NBIA 3QO2A 5M3FB 1WTPA 4FYDA 1S5FD 4QMGA 3C1EA 3QJYA 5A2QL 2HCCA 1ET9A 4GZYC 1SFOB 2A69D 3GTMB 1Q1EA 3T16A 2B2UC 2NVXB 1JE4A 2K01A 2B2YC 5E1FA 3GTQB 1ZKOA 3EA6A 4QB4A 1A3VA 3L3OC 4RFBA 1Y1WB 2O5IC 1EU4A 2EJMA 5CV9A 2TSSA 1MGSA 3HGBA 5KNBA 2B2WA 1ICWA 3IL8A 1IKMA 4IUVA 2EJFC 1JORA 4BS9A 4KV6A 1OXUA 4C1NI 4RHRA 4EQPA 4XDXA 1LT6D 4IUUA 1NCVA 1YNJC 1F9PA 4V0BA 5JJZA 1U9RA 4NW2A 4G7OC 1AP0A 3VYRA 3C2PA 3T13A 1STAA 4PMCA 3KLSX 3EFXD 3MA2B 2VUMB 1CK1A 2X6LA 3QOJA 3D31A 4HCEA 3RLFA 1LABA 1IW7D 2NB0A 4KMUC 3NSWA 3D4WA 1HXYD 2I46A 4FF3A 5M3MB 2EY2A 5IGBA 3LWUA 3A8IE 1FD7D 2RSOA 3G7LA 5T1GA 1CHQD 1BUVT 4KD4A 1H9MA 2K6AA 3DHQA 1I4HA 3VR5A 3ZYYX 5KNDA 3NWTA 4X3UA 1TU2B 1HQRD 1FYCA 2N55A 1SDFA 1SYDA 4F88A 4ZQ3A 1RHPA 2LY7A 2ICEC 3I4NB 5IODA 4CKEA 3S1RB 1DD2A 4UAIA 1D5XC 4OIKA 5EPLA 4HN7A 5TSSA 1WCMB 4M1UB 1CHPD 1O7YA 2D9UA 1EQTA 2JYOA 5JAVA 1Y8NB 4ZUJA 4PNYA 2J4XA 2KOLA 4QCLA 3PIO3 4I7ZC 4UDUC 2F0VA 1EY7A 4NKLA 2RSNA 4K2LA 2L1BA 4G7HC 5D3IB 5FKAC 2Q8TA 3MXUA 4HTHA 3SEBA 1NAPA 4FF1A 1TS3A 5HGTA 3J81L 1SNPA 2QILA 1DXMA 2EE1A 1KNAA 4U68A 1CTMA 1JOOA 2F0UA 1YNNC 4RA8A 2V4DA 3D6CA 4DNRB 3NK9A 3Q24A 2B2UA 2FHTA 3A56A 1FNUA 4XYOA 3CRLC 1GUWA 2ZT9C 3P1HA 1V43A 2F0MA 5CV8A 2KCCA 4PMBA 2A73B 4NP5A 2KJXA 5M9OA 4XQQA 3OWEB 2VNUD 1Q1BA 2NN6G 3M85A 3TMEA 1EEID 4TKOB 2XRQD 4DN4M 3OHXC 3NQTA 1STNA 2TMPA 1PYWD 5CV5A 4OO1I 2PMZB 2L55A 5T1IA 3PIP3 1R4PB 2N88A 3BDOA 1GHJA 3Q0AA 3BDCA 4HSVA 1PDQA 4F87A 1BR9A 1JWUD 4JBWA 4KKUA 2ID0A 2LS01 1HRJA 4EGVA 3SK4A 4N9PA 3VR6A 1S4ZA 2QCPX 1A2TA 3VA5A 1V1OA 5ELDA 1GHKA 5JVH3 1SNMA 2EVBA 1B4OA 4ULLA 1EYCA 3BYTB 3J7YW 3K57A 1ENCA 3K58A 1KLUD 4KHZA 4Q5VA 4IUQA 3MFYA 2QEJC 3X3NA 1OXSC 2F0EA 2YU9B 1DOMA 2L0CA 1UUPA 2NN6H 2JP1A 3I4LA 3PMFA 2EYFA 3H09A 2DNCA 1JOKA 3RZDB 4P2CB 4DGZA 5K36G 5FOBB 1JQYD 3Q23A 2A5HA 2F0IA 1PLFA 2EYOA 2DNEA 1H9SA 3TZUA 4OL7A 1U4RA 4CBVA 4DNTB 3TN2A 2SDFA 2G9HD 1KNEA 4PQXA 5C3EB 4FXDA 1SXTA 3VYTA 5C0XJ 4RAUC 2ZXOA 1S5ED 3GV3A 3HZXA 5CC4A 5BN3A 2F0FA 1C8CA 1JICA 3HOUB 1SYEA 3LX0A 4J8QA 2E75C 4A3EB 2LKVA 3G6JB 1EIGA 1BQQT 2HDMA 2IX1A 5JEAJ 3D3RA 4RWSC 3I73A 3CKIB 4QIWB 1RF2D 3WDNA 1Y8OB 4IURA 2NVYB 2EYHA 2L4NA 4C3JG 5A2QE 1GUNA 3HRZC 4C3JB 5K36H 2M9VA 3S9WA 1H9RA 4KHVA 1C4QA 5FLXE 3EROA 3VR2A 2VB3X 3IAYA 1CQVA 2F0SA 1I50B 1PRTD 5J39A 1CZGA 5KEEA 2PO4A 2R7ZB 5CV6A 3AU7A 1QG7A 2KHSA 5I6WA 1A3TA 2Z8LA 2Z1CA 5C0XI 4O42A 5NUCA 2K7VA 1Z7TA 1BNZA 1RTNA 5ISRA 2PPBC 2KUMA 3R8BA 4KKTA 2B2TC 3SR1A 4M8AA 3KBXA 1HFNA 1A3UA 1I4RA 3GTGB 1HTLD 3E5SA 1GUGA 1Y1VB 2NVTB 1EYDA 3S17B 3A7AB 4ZUIA 2F1MA 2XVSA 4FF2A 3DWPA 3MFGA 1WVLA 1I3QB 3ONAB 3GP7A 3K6OA 3KK7A 3K5NA 3H91A 1QNKA 1O7ZA 3P20A 2IWHA 1EFID 1PZID 1FNWA 1LT3D 3NE5B 1CM9A 3HOYB 4XYQA 4L63B 2F0DA 3QG1A 1JOQA 5IGDA 4TSSA 2PYKA 2SOBA 2B63B 4OIJA 2K28A 1G2SA 3PUWA 2AQ2B 5CYUA 3QB3A 1I4XA 1NUCA 1BCPC 1ZEQX 4ODGA 5EJWA 3I70A 3GO5A 2E2HB 4DAVA 4F8MA 5J1ZA 2CHBD 3T56B 1CFMA 1TQOA 3A54A 4FNFA 1EZ6A 1CA6A 4K8JA 5F2DA 3SXHA 3J7AV 1I4GA 1QJOA 3X3MA 1SSOA 1F2MA 2HQEA 1EU3A 2WB1B 5D14A 2RBMA 2PNRC 2F0TA 1G8ZD 2XRSD 3PO3B 1F9QA 2EY6A 2BA0A 4XIGS 3BVMA 2E2JB 3FEWX 4KD3A 1ENFA 3TZDA 1EY5A 3L9AX 3J81E 2BCOA 1I6HB 4IUPA 1B9NA 2NTTA 3K5OA 4XXEA 1MBYA 1F2LA 4MIUA 3R93A 1KTKA 4Y7NB 5FLXL 1PTOH 2QKIC 3SK5A 1WTQA 2ZXPA 1A2UA 1PTOC 4IZ8A 3D8GA 3H94A 5I6YA 4EQNA 2KEEA 4ZKBB 4KY7A 4WJWA 1R4QB 2PW5A 2OT2A 2XSCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NR4 A;  1F9S A;  3DM1 A;  4IUQ A;  4U68 A;  5EQ0 A;  1J8I A;  2RVL A;  2XIW A;  1DOM A;  1Q3L A;  3MTS A;  4RA8 A;  5CBA E;  1AZQ A;  2JP1 A;  1M8A A;  3FPU B;  4MHE A;  1B2T A;  1RJT A;  1AZP A;  5EKI A;  2B2V A;  2RA4 A;  1IKL A;  2RSO A;  1HA6 A;  3IFD A;  2B2U A;  2DY7 A;  2FHT A;  2MGS A;  3G7L A;  3GV6 A;  2B2V C;  5T1G A;  5CBE E;  3DEP A;  1ZXT A;  2HDL A;  5EJW A;  1ESR A;  1QE6 A;  1QG7 A;  1G6Z A;  2HUG A;  1HHV A;  1PFN A;  1U4L A;  1MI2 A;  4O42 A;  1X3Q A;  2IL8 A;  1WTO A;  1WTR A;  1GUW A;  2M2L A;  1XX8 A;  2FMM A;  3F2U A;  1BNZ A;  1RTN A;  2K1B A;  5AFW A;  2FJ2 A;  1ILQ A;  1EL0 A;  1B3A A;  1XYI A;  2FIN B;  2B2T A;  4LMQ D;  5E4X A;  1WD0 A;  1CA6 A;  2KUM A;  2L12 A;  3QO2 A;  1IL8 A;  4X3U A;  1WTP A;  1DON A;  1PLF A;  2B2T C;  1MSG A;  2FFK B;  3I91 A;  5COY A;  1SDF A;  2N55 A;  1VMC A;  2R3Z A;  3KBX A;  1HFN A;  1DOL A;  1SSO A;  4CJ0 B;  1RHP A;  3D6W A;  3I90 A;  2KED A;  2HCC A;  1J9O A;  1VMP A;  4MN3 A;  4QUF A;  5D14 A;  1RTO A;  1U4R A;  1HUN A;  1U4P A;  2MP1 A;  3SVM A;  2KEC A;  3LWE A;  4XT1 B;  4DN4 M;  3TN2 A;  2B2Y A;  2H1E A;  2J7Z A;  4ZLT F;  2B2U C;  2NYZ D;  2SDF A;  1JE4 A;  2K01 A;  1WTV A;  1F9Q A;  4UAI A;  2B2Y C;  4X3K A;  1KNE A;  3I3C A;  4HAE A;  2K04 A;  4CJ2 C;  1HUM A;  4CJ1 B;  4X3T A;  3KUP A;  1MSH A;  4OIK A;  5T1I A;  5EPL A;  2EOT A;  4RAU C;  1MGS A;  2NWG A;  2L9H A;  5COR A;  2B2W A;  3TZD A;  2N88 A;  2X69 A;  1ICW A;  2X6G A;  3GV3 A;  2K05 A;  3IL8 A;  2B2W C;  4IUV A;  2KVM A;  1IKM A;  4IUP A;  1WVL A;  3N52 A;  4HSV A;  1C8C A;  1JIC A;  1NR2 A;  1E0B A;  1O7Y A;  4ZAI A;  2D9U A;  1B50 A;  3HP3 A;  1EQT A;  2JYO A;  3UI2 A;  1PDQ A;  3ONA B;  1X32 A;  2KOL A;  5EPK A;  1TVX A;  1X3P A;  2DY8 A;  4R9W A;  1F2L A;  1O80 A;  2L11 A;  4XDX A;  2CVR A;  3R93 A;  4IUU A;  1NCV A;  2HCI A;  1EIG A;  1F9P A;  1A15 A;  3H91 A;  3DEO A;  1QNK A;  3I8Z A;  4HCS A;  1O7Z A;  1WD1 A;  2HDM A;  1EOT A;  5JJZ A;  1HRJ A;  1U4M A;  4NW2 A;  2BDN A;  1SAP A;  4RWS C;  2MJ8 A;  1WTW A;  5E4W C;  1WTQ A;  1AP0 A;  1S4Z A;  3MWY W;  2RSN A;  1HFG A;  4QUC A;  1BF4 A;  4X3S A;  4R8I A;  2L1B A;  1PFB A;  1ROD A;  4HED A;  2NZ1 D;  3P7J A;  2MPM A;  1CM9 A;  5D65 A;  1G2T A;  1B4O A;  2Q8T A;  1DZ1 A;  4IUR A;  4XT3 B;  1EIH A;  1BO0 A;  5DNF A;  1DOK A;  2K03 A;  3Q6S A;  2EPB A;  2VXW A;  1ILP A;  3FDT A;  1BBX C;  2Q8R E;  4ZKC B;  2X6L A;  1PFM A;  2L4N A;  5EPJ A;  5CMD A;  2KEE A;  1WTX A;  4ZKB B;  1NAP A;  2K28 A;  4OIJ A;  1G2S A;  1G91 A;  1ML0 D;  4ZK9 B;  1CA5 A;  1LV9 A;  1F9R A;  4IUT A;  2EE1 A;  1KNA A;  1B53 A; 
#chains in the Genus database with same CATH topology
 5C5L A;  1ASZ A;  3HKS A;  1J8I A;  2SNM A;  3K59 A;  3ICE A;  2WP8 J;  3WOE A;  1K8A C;  4RKL A;  4B9W A;  3PO3 H;  5KNC A;  3GV6 A;  2HQL A;  1L0X B;  2RKS A;  3F2C A;  4EVO A;  2E2J H;  1LT4 D;  4NXM L;  1B70 B;  1TII D;  4LFB Q;  1D1I A;  1X3Q A;  2AWN A;  5IT9 L;  1S5C D;  3OOC A;  1PH6 A;  3FMC A;  1EWC A;  2IY5 B;  1I6H H;  1VDZ A;  4JI1 L;  1MSG A;  5FO9 B;  2K75 A;  2R92 B;  1STY A;  1UNS A;  4LJZ C;  2JA7 G;  3GTM H;  1KAB A;  3ULJ A;  4ME3 A;  5IT9 c;  4P75 A;  2JA7 B;  2NVX H;  5C6A A;  5EBC A;  4KK7 A;  4BXX G;  2KEC A;  3BS1 A;  2V1C C;  4Y7N H;  2A6H C;  1BDO A;  1ASY A;  2UXD Q;  1XMQ L;  4KY6 A;  3Q22 A;  2B39 A;  4L6T B;  4RGM A;  5C3W A;  3I4M G;  5GAD C;  1SBB B;  1Z9F A;  5IP7 G;  3SK8 A;  3I4M B;  2L9H A;  3U9S A;  1TY2 A;  2PNH A;  3M4O B;  2K5H A;  1GM5 A;  1EQV A;  3BVZ A;  1K8O A;  1LAC A;  2EY1 A;  1IBM L;  1P16 A;  1E1O A;  3UI2 A;  1I94 L;  3KF6 A;  1STH A;  2K52 A;  2EDG A;  5HUR A;  1SYC A;  4JI2 L;  3K5M A;  3DEO A;  1U5K A;  4C3I B;  3OWF A;  1A6X A;  2BDN A;  4IAL A;  1OO9 B;  4RGT A;  4CHT B;  1Q86 C;  4B3S Q;  3SHL A;  1EY4 A;  4X3S A;  1HQM C;  4R8I A;  4ZRZ A;  1ROD A;  3KLR A;  5D65 A;  3NEN A;  1D2B A;  4MNO A;  1TS2 A;  3M7G A;  1E2W A;  3TBI B;  1N9W A;  4JI8 L;  1LTI D;  4LF9 L;  4X66 L;  4ZK9 B;  1CUK A;  2EY5 A;  4IJH A;  4OHJ A;  2O5J C;  2JJQ A;  2F0Q A;  2OEO A;  3ER0 A;  1H95 A;  1EQR A;  1X3F A;  1JWM D;  1M4V A;  3MTS A;  1A62 A;  3R3O A;  5LL6 X;  4DV4 Q;  1AZQ A;  2JA7 H;  1QVC A;  1RL2 A;  1YEZ A;  1T5X D;  3K0X A;  4BXX H;  1AE3 A;  1RKN A;  3TQY A;  4YY3 Q;  1S5B D;  3S2H B;  2HDL A;  1C48 A;  4R4C A;  4HJ5 A;  1PFN A;  2UU9 Q;  2IPK D;  4L5S A;  1D6E C;  1RDP D;  3PV0 A;  3I4M H;  2C5C A;  2K1B A;  5IP7 H;  3R2I A;  1KDB A;  1JE5 A;  4FO2 A;  2F0K A;  5JPM C;  1GXD C;  1TWA B;  4J6H A;  3D6W A;  4JI7 Q;  1CKN A;  2EQS A;  1NBW A;  3G6E A;  1V1P B;  3LWE A;  2B2Y A;  2H1E A;  3VDY A;  5IE8 A;  1EY6 A;  2K14 A;  4WRD A;  2F0W A;  2EXZ A;  4J15 A;  5IGF A;  1PYB A;  4X3T A;  2DJF C;  1BVS A;  1QIL A;  4X65 Q;  2CQO A;  3K80 C;  3PUX A;  1AFP A;  1VCI A;  4BBS G;  3BG3 A;  3KLW A;  4JCV E;  3S1Q B;  4JK1 C;  4BBS B;  3FRP B;  1Y69 U;  4AYB G;  1MHW C;  2KCM A;  1S72 A;  2JA5 G;  4GKJ Q;  3PF5 A;  4LF6 L;  4AYB B;  4PG3 A;  1YNJ D;  1GJX A;  2AQ3 B;  1OXT A;  2DY8 A;  3S2D B;  2JA5 B;  1BOS A;  4L5R C;  1BCP F;  3PF4 A;  3S16 B;  3E6Z X;  3HOX G;  4YIJ A;  2SEB D;  3I72 A;  3SK6 A;  4DFA A;  3T1H Q;  4H7B A;  3HOX B;  2CW0 C;  1B9M A;  2F0J A;  1SE2 A;  4LF4 Q;  3S2H H;  2VS1 A;  4BWG B;  1G2T A;  4OO1 G;  3SE0 A;  1YBY A;  4DR2 L;  2MNA A;  3RD4 A;  4G4K A;  1ILP A;  3NEL A;  4OEM B;  2K50 A;  2UUA L;  3NHH A;  4H44 C;  3WOF A;  1WTX A;  1TS5 A;  5C5M A;  4C3H G;  3BVG A;  4AYB E;  2EXD A;  1B53 A;  3SDZ A;  4C3H B;  2VQE L;  1VQM A;  2RQX A;  2O4X A;  3FVQ A;  4N9T A;  2CWA A;  1TWA H;  3IKJ A;  2RVL A;  3PUZ A;  2XIW A;  3VA7 A;  1A63 A;  4C56 C;  1MKH A;  2GA4 B;  3FPU B;  4GN3 B;  4YCV A;  3QWN A;  4LFA Q;  2A6H D;  4UHV A;  2DY7 A;  2ZM6 Q;  3A5U A;  3PUV A;  3IFT A;  4DR4 L;  3NQI A;  4KTA A;  1QE6 A;  4FF4 A;  1E2V A;  3J81 j;  1Z6H A;  1P8L A;  2IX0 A;  2K5D A;  1SLJ A;  5K5P A;  2JA8 B;  3F2U A;  1XX8 A;  5JJI A;  5AFW A;  2RHQ B;  3EVQ A;  1F77 A;  1F2Z A;  2F4V Q;  3P75 A;  1KRS A;  4EQO A;  4BBS H;  1DON A;  3OW7 A;  5G3L F;  1VQK A;  1T9H A;  3ULL A;  2MUY A;  3V96 A;  2JA5 H;  4UP8 A;  1VQ9 A;  1N34 L;  3S16 H;  4ZLT F;  3OYY A;  5I9P A;  1PTO F;  5IY0 A;  1PVO A;  3PCO B;  2A68 C;  2K04 A;  4CJ2 C;  3C3L A;  1O78 A;  3ERQ A;  3K5L A;  3HOX H;  1MSH A;  4JOI C;  2EOT A;  3STB D;  5I9O A;  2JA9 A;  2XWB B;  2X6G A;  4IFD J;  5J22 A;  2MHV A;  1Z47 A;  4G57 A;  1RIP A;  2LSS A;  4OO1 H;  1NR2 A;  4ZAI A;  1UAP A;  4LFB L;  4JBK A;  1XTD A;  5C4J B;  3NEM A;  3D4D A;  3JC6 6;  3NTK A;  1X3P A;  4R9W A;  1EY0 A;  1O80 A;  4PMW A;  1PV4 A;  4C3H H;  3AMU A;  1V8Q A;  2PZT A;  3L2P A;  1BXT A;  4X6A H;  3J80 E;  3JAM L;  2F0G A;  1PFB A;  1LTR D;  5IYD G;  3NTH A;  1S40 A;  1PMR A;  2CCZ A;  1D1K A;  1E2Z A;  2AQ1 B;  1A0I A;  5FK9 C;  3GQB A;  2HHH Q;  4FVM A;  1C9O A;  4JBJ A;  4EQ5 A;  4HMJ A;  1AEX A;  3AFQ A;  4IN3 A;  4DK3 C;  3JAM c;  2K5W A;  3CU7 A;  4TQU S;  1F9R A;  1XXG A;  1L1O A;  1YNN D;  3DM1 A;  1SYF A;  3TP7 A;  4LK1 C;  1PZJ D;  1IYU A;  2EYJ A;  5CBA E;  1R9T B;  1QWY A;  2KQ3 A;  3J7Z C;  2B2V C;  4A3L G;  3D4R A;  1ESR A;  2HUG A;  1HHV A;  4AQY Q;  4B3S L;  4B08 A;  4G7Z C;  4GS3 A;  1KQS A;  4IFD I;  3NXW A;  3QOL A;  2HIX A;  2A1A A;  4DAP A;  1VS0 A;  5E4X A;  2Q8I B;  1SND A;  5KRU A;  2FFK B;  3VYS A;  5C4J H;  4MZ9 A;  3J81 i;  2PZU A;  1TWG B;  3A5Z B;  1DYQ A;  1SNQ A;  1HNZ Q;  2NUC A;  2GN5 A;  2KHJ A;  4ABN A;  1VQE A;  1QB5 D;  5GQO A;  2PQA A;  4KJO A;  4JC0 A;  4DXF A;  1HPC A;  1KDC A;  4KJN A;  4QIW E;  3CCQ A;  4OWT B;  3KBG A;  2F3V A;  4CJ1 B;  4GOP A;  1ESF A;  4DV4 L;  1QNU A;  2ZTC A;  4A3D G;  5E7N A;  4A3B G;  2K32 A;  3F1Z A;  1SEB D;  5IYD H;  1TT2 A;  4A3D B;  4YY3 L;  1PH7 A;  4QQB X;  4A3B B;  1GOZ A;  2B2W C;  2KVM A;  5C0X G;  4ZYS A;  2QDB A;  2UU9 L;  2J0T D;  2I5M X;  1LUZ A;  2RHS B;  1YVC A;  1UEA B;  1KAA A;  1RCV D;  3TP6 A;  1JJ2 A;  4DR6 Q;  5L37 A;  1JB3 A;  4K2K A;  5I2X A;  2QF7 A;  1KRT A;  4ME5 A;  3U9O A;  5IYB G;  2PCF B;  5A35 A;  2OXP A;  1QCB D;  4HJ9 A;  2DN8 A;  3T51 B;  4JI7 L;  4IPH A;  3MXG A;  1PH1 A;  5IT9 E;  5JEA G;  3BZK A;  2NVY H;  2P5Z X;  3CCL A;  1OXV A;  4OGQ C;  3T53 B;  2K03 A;  4A3L H;  1NE3 A;  3CCV A;  1W6K A;  1BBX C;  1LTG D;  4X65 L;  1SE3 A;  4KN4 C;  3UDX A;  2IW3 A;  4OON A;  4KI0 A;  4XQN A;  1ML0 D;  2LFN A;  4O2D A;  4HIK A;  3I2Z A;  4IPC A;  5ELN A;  1TWG H;  4FXK C;  1PH3 A;  3BU2 A;  2MFI A;  5DLQ E;  1SMX A;  4GKJ L;  3W3A A;  1GUT A;  3HOY G;  4H13 C;  3MZ5 A;  4DK1 A;  1K8M A;  5FO7 B;  1I50 H;  3E3X A;  2DUD A;  1HA6 A;  2RA4 A;  5CBE E;  1KXL A;  4CKB A;  3GDE A;  1GUS A;  3DEP A;  2RDH A;  4BBR G;  3W2D A;  3T1H L;  3MAQ A;  4GKK Q;  4BBR B;  3L7Z C;  1H9J A;  4LF4 L;  2FJ2 A;  5I2Y A;  4A3B H;  5D3D A;  1G6P A;  4LMQ D;  3GTK B;  4A3C G;  4C1N K;  2L12 A;  3CCS A;  2F0O A;  3QIA A;  5LHY 1;  3GD7 A;  5C0X H;  3J7A 5;  1VMC A;  4OWW B;  3MXN A;  1SJE D;  3H15 A;  1Q81 C;  4QUF A;  1D5M C;  2JE6 I;  3K7U C;  2WKC A;  2Z6B A;  2CQA A;  3AB9 A;  1VQB A;  1G29 1;  1S5D D;  3EBE A;  4HAE A;  3CXC A;  1TKW B;  5IYB H;  3J80 L;  3A8J E;  3KLS A;  1C0A A;  1IXR A;  1JC7 A;  4APV A;  4C2M B;  1VQ8 A;  1XJV A;  2KBN A;  1SNC A;  4LFA L;  5COR A;  1Q90 A;  2EYP A;  2G9D A;  2NWG A;  5ELB A;  2ZM6 L;  2WAC A;  1LTT D;  1T5E A;  2F4I A;  2WAQ G;  5EGT A;  5IYC G;  4LUV A;  2WB1 G;  3HOV G;  1GUO A;  4HJA A;  2HIV A;  2WAQ B;  2FMC A;  2BH2 A;  4PV1 C;  3HOV B;  1QUQ A;  1LTS D;  2K5Q A;  2ATW A;  4I65 A;  5EPK A;  4BA2 I;  1CT1 D;  1LO5 D;  1K9M C;  4QY7 A;  4WFN 3;  2F4V L;  4JI5 Q;  2L11 A;  1CSQ A;  2Z4H A;  2CVR A;  1A15 A;  3NTI A;  3HEJ A;  3S15 B;  1SAP A;  1WTW A;  5I4D A;  3HOY H;  2EJG C;  1E1T A;  3KF8 A;  1FGU A;  2A6E C;  5C44 G;  1EIH A;  1BO0 A;  1DOK A;  3JAM i;  5BN4 A;  5KYL A;  4BBR H;  3U4Z A;  3NBH A;  5C44 B;  3OMG A;  1HNW Q;  1JJG A;  3BYY B;  2WB1 E;  2Z6K C;  1VF5 C;  3CC7 A;  2VL6 A;  3PUY A;  1VF7 A;  3BZD B;  3GTK H;  5CR3 A;  3CHB D;  4IUT A;  2EZV A;  2O2L D;  3G48 A;  4A3C H;  3M4Y A;  5EKK A;  4UP9 A;  1SNO A;  1VQF A;  4LWC A;  4POG A;  2VB2 X;  1JR0 D;  4TVA B;  1DCZ A;  4C2M H;  3ND9 A;  1O7L A;  3CRK C;  1WTO A;  2DGY A;  3K7A B;  4XQJ A;  1FNV A;  2FMM A;  1UWV A;  5GAH C;  3BDL A;  1XYI A;  5GAE C;  2B2T A;  1IL8 A;  2HHH L;  5IYC H;  4X62 Q;  3HOV H;  3MVV A;  1X55 A;  3I90 A;  2ENB A;  1V1Q A;  4PZ8 A;  4CKC A;  1RTO A;  2D2C C;  2E74 C;  4JI4 Q;  2IT1 A;  2J7Z A;  2YYZ A;  5CV7 A;  1XNR Q;  1CI3 M;  1HUM A;  3K81 C;  3RLO A;  5CV4 A;  3URY A;  2OTL A;  2R92 G;  2JXM B;  2H4O A;  1B1Z A;  2K05 A;  3RMH A;  1E7Z A;  5DM7 3;  4B3R Q;  3N52 A;  2JEA I;  1KIX A;  4IPD A;  1E0B A;  4AQY L;  5C44 H;  3CMA A;  1H9S B;  4YWL A;  2A74 C;  2LMC B;  1ONL A;  1JCK B;  1C7Y A;  2F0L A;  2NTS A;  3AEV A;  2SNS A;  4DA2 A;  3DWQ A;  3CC2 A;  2JSO A;  5ELC A;  2NVQ B;  2RDG A;  4HCS A;  3V05 A;  1HCZ A;  1HNZ L;  1STG A;  1U4M A;  4A3I B;  2PW7 A;  2OQ0 A;  4ZCK A;  2PI2 E;  1SYG A;  4CDD C;  4ALP A;  3AYH B;  3T4A C;  1O7I A;  3F8T A;  1L0W A;  2D62 A;  3OPO A;  3HKZ G;  5FJ8 G;  3CCE A;  2WIN B;  3HKZ B;  3GTO B;  1LTA D;  3LNN A;  4GLX A;  3KJP A;  4ZKC B;  1EYG A;  3K7A H;  2UXB Q;  4P74 A;  4C3I G;  1PH8 A;  4DV5 Q;  1PXU A;  1CZW A;  1LT5 D;  4HSP A;  1L1O B;  4A93 G;  3RNU A;  4DUZ Q;  1BCP D;  2LXJ A;  4OXP A;  2UUB Q;  4A93 B;  4A3K G;  3H6M A;  3MXP A;  4K5V A;  1B2T A;  1AZP A;  4DR6 L;  1L0Y B;  4JYA Q;  4A3K B;  3TSS A;  5HGQ A;  1QVF A;  4H0L C;  5C3X A;  1VQJ A;  1J5E Q;  2AUJ D;  4EX5 A;  1KDA A;  4K5W A;  2B8G A;  1N36 Q;  1K83 B;  4BY1 G;  3A7L A;  2KEN A;  3RUZ A;  4K6D A;  5LL6 S;  1OXX K;  4BY1 B;  4U67 3;  2R92 H;  2N78 A;  2AUK A;  4RCN A;  5LMN Q;  3OIQ A;  3I91 A;  3UDI A;  1X9N A;  4CJ0 B;  2EYL A;  1U4P A;  3JAM E;  1EZ8 A;  3SVM A;  4LF7 Q;  1IHZ A;  2NVQ H;  2NYZ D;  3S14 B;  4QJF A;  3I3C A;  1PRT B;  3EIV A;  1EY9 A;  2YTY A;  3KUP A;  4NXN Q;  3BZC A;  3M4O H;  1UE5 A;  2A6E D;  3K0Y A;  3J80 i;  1EFW A;  1SR3 A;  1Y8P B;  3CC4 A;  3H3V H;  3GTO H;  5FJ8 H;  3AQQ A;  3S1N B;  4GKK L;  5BN5 A;  3HP3 A;  3H3V C;  1HNX Q;  4RCO A;  2Z6K A;  1KAW A;  5G3L D;  4C3I H;  2LXK A;  2HCI A;  1WD1 A;  1JWS D;  3I8Z A;  3GTP B;  3N6R A;  1PTO D;  4YHH Q;  1BF4 A;  2Y0S G;  3ZJY C;  4A3K H;  4DR3 Q;  2Q2H A;  2Y0S B;  4DV6 Q;  4DAY A;  1AN8 A;  1DZ1 A;  4XT3 B;  3FP9 A;  3FDT A;  1K83 H;  2N8N A;  3S1M B;  1IL2 A;  1EYA A;  1PFM A;  2JK8 A;  1LTB D;  2XWJ B;  1VQ5 A;  4BY1 H;  2NN6 I;  5ELE A;  1CQF A;  1X3E A;  4DPG A;  4IQZ A;  1XWE A;  2KCT A;  5EQ0 A;  3E0J A;  4RH6 A;  4GNX B;  4B3M Q;  4NDX A;  2KA7 A;  4A3F G;  1RD9 D;  4Z9C B;  4KLK A;  2QEX A;  1B44 D;  4JI5 L;  4A3F B;  4OX9 Q;  1F2Y A;  3EQL C;  4JI6 Q;  3S14 H;  2BE5 C;  1VQL A;  2ZTD A;  2E76 C;  4AIM A;  4PZ6 A;  1ZXT A;  1EIY B;  3C46 A;  4Q0F A;  1PRT C;  1MI2 A;  3C1F A;  5KIX A;  5C4H A;  3V2T A;  1EL0 A;  1WD0 A;  3CP0 A;  4WOR A;  3S1N H;  1IYV A;  3U4V A;  2IJ0 A;  1FGB D;  1HNW L;  2XN9 C;  2KED A;  1TWH B;  3PQI A;  5M5Y B;  2MP1 A;  1X56 A;  4IOA A;  5EAY A;  3OMC A;  4DXG A;  5KGU A;  1JMC A;  4DU9 A;  4K6L A;  4R8N A;  3GTP H;  2CH4 A;  3LGJ A;  1W6J A;  4X3K A;  2JA8 G;  1ZYR C;  2MO0 A;  4X64 Q;  2KCN A;  3ITP A;  1NMG A;  3OIP A;  4HMI A;  3S1Q H;  2B29 A;  3PO2 B;  1EY8 A;  1N32 Q;  1IYJ B;  5JPN C;  1B50 A;  3S2D H;  1QUQ B;  1TVX A;  5C4X G;  5FO8 B;  1I5F A;  3M4P A;  5DM6 3;  3HG9 A;  4DV7 Q;  4WJ4 A;  1ENA A;  4KY5 A;  5C4X B;  4P73 A;  1HR0 Q;  1SRU A;  4X62 L;  3FPP A;  1EOT A;  3CQZ B;  1LLR D;  1E24 A;  4O1N A;  5C4Z A;  4RG1 A;  1KD1 C;  4DF7 A;  4GNX C;  4JI4 L;  3AFP A;  2OQK A;  3HOW G;  1SYB A;  1YJN A;  2XGT A;  5EBD A;  1JT8 A;  1I4Q A;  3HOW B;  4IOC A;  1VQO A;  3HS0 C;  1XNR L;  1PYS B;  3Q6S A;  4BY7 G;  3A8K E;  5J3B A;  1Q8I A;  1E3P A;  3EJI A;  1SMY C;  4AH6 A;  4BY7 B;  1HTP A;  3NBH B;  2AWO A;  3TP8 A;  1LV9 A;  5JOB A;  4LUO A;  4A4I A;  3NP8 A;  4B3R L;  2L15 A;  1NR4 A;  5EKL A;  1VQI A;  1TR5 A;  1TWH H;  1NJI C;  1Q3L A;  1PFS A;  4RGO S;  3M3Y B;  1M8A A;  4KKS A;  1RJT A;  1SJH D;  3DMU A;  3PGZ A;  1KLG D;  3DXJ C;  3U58 A;  3OSO A;  4R1J A;  2QGQ A;  2JA8 H;  4TRD A;  1B7Y B;  4H02 A;  4V19 0;  2KHI A;  1HZB A;  4QF4 A;  5IGG A;  1TWC B;  4DV1 Q;  2L5T A;  3UE1 A;  1B3A A;  4LFC Q;  2M00 A;  3MC0 B;  3DUZ A;  4DR7 Q;  1UE1 A;  4LW1 A;  4CGY B;  2D5D A;  1GKH A;  1ET6 A;  2AKW B;  4FXG C;  4A3J G;  3MEH A;  2WV6 D;  5COY A;  1N33 Q;  2WII B;  1DOL A;  2UXB L;  3H0G G;  4A3M G;  4PZ7 A;  4A3J B;  2F0N A;  1J9O A;  1EEF D;  1VMP A;  4K8I A;  4UPA A;  1QVG A;  1HUN A;  4DV5 L;  1VQG A;  4HJ8 A;  3H0G B;  5C4X H;  4A3M B;  4B9X A;  4XT1 B;  2C9O A;  2OWO A;  4FP5 D;  3CQZ H;  4DUZ L;  3HOZ G;  1YNX A;  1X6O A;  3I7F A;  2BDO A;  2UUB L;  5ELF A;  3HOZ B;  1PA6 A;  3TP5 A;  1H9K A;  4QL5 A;  4JYA L;  1EWH A;  3PIO A;  3HOW H;  1J5E L;  2VY3 A;  1I4P A;  1U0L A;  1D5Z C;  3NUC A;  3TS2 A;  1XTC D;  1YJW A;  4IFD G;  1N36 L;  4BY7 H;  3VR3 A;  3CPF A;  2F03 A;  2I5L X;  2JQO A;  2F0H A;  2E2D C;  2A69 C;  2B8F A;  5LMN L;  1AH9 A;  3O13 A;  1DGS A;  2N49 A;  3CW2 C;  1NY4 A;  1STE A;  2HT1 A;  3VR4 A;  1KC8 C;  2CW0 D;  2MJ8 A;  3M3Y H;  3MWY W;  4QUC A;  2ZXR A;  5DAU A;  1AW7 A;  2E2I B;  1II3 A;  2BE5 D;  4LF7 L;  4DAM A;  2R61 A;  4HED A;  2F3I A;  2NZ1 D;  3P7J A;  4RKB A;  2I07 B;  5E3F A;  2EPB A;  2OF1 A;  3EN2 A;  4RMF A;  1MD2 D;  4NXN L;  1FVI A;  5CMD A;  3KF6 B;  4A3G B;  1HZC A;  1TWC H;  1CA5 A;  1TWF B;  2WKD A;  2Z4I A;  1F9S A;  2BOS A;  1HA5 A;  2K33 A;  1R9T H;  1HNX L;  3ERS X;  1PH4 A;  4A3J H;  4K14 A;  4DR5 Q;  1BBU A;  1I6V C;  1BCP B;  3H0G H;  4MHE A;  5JVG 3;  5EKI A;  2F0P A;  1V1P A;  1IKL A;  4RGN A;  3IFD A;  1ZYR D;  3ND8 A;  3F2D A;  1EIF A;  3HOZ H;  3R2T A;  2IX3 A;  4YHH L;  1U4L A;  2PZW A;  1W2B A;  3CD6 A;  2M2L A;  4DR3 L;  2BA1 A;  1BKB A;  4DV6 L;  1ILQ A;  2FIN B;  4JW0 A;  4E6I A;  1IW7 C;  3MEF A;  5LMU Q;  3FHW A;  1QOH A;  2R3Z A;  3I56 A;  1OTC A;  4IFD H;  1PZK D;  4MN3 A;  4HJ7 A;  3RZO B;  2C35 B;  2A68 D;  2IHE A;  1WTV A;  3NWS A;  4B3M L;  1YHB A;  5BR8 Q;  1HJP A;  4R4I A;  4BA1 I;  4KN7 C;  1M90 C;  4JOI A;  1XMO Q;  2E5L Q;  2E2I H;  4A3D H;  4OX9 L;  2VQF Q;  4HIM A;  2RCN A;  4ID6 A;  4JI6 L;  4DKA C;  1FR3 A;  1SE4 A;  1X54 A;  2R6G A;  2X69 A;  4S3S A;  3F2B A;  2UUC Q;  3B6Y A;  4LAA A;  1STB A;  1TY0 A;  2R93 G;  1SMY D;  2PQE A;  4IUN A;  2R93 B;  3CCU A;  4L5T A;  1CKN B;  1X32 A;  2JEB I;  1Y14 B;  2RDF A;  5M5W B;  4HR7 B;  3M7N A;  4YCU A;  4XTC S;  5CGK A;  4DK6 C;  5M5X B;  1VQD A;  4RHS A;  1AE2 A;  5IGE A;  5KYI A;  4DV2 Q;  3FKI G;  5E4W C;  4NB3 A;  2XNA C;  3GTL B;  1GO3 E;  1HFG A;  3A55 A;  4L5Q A;  3E0E A;  4NMZ A;  4JI0 Q;  1PTO B;  4J1M A;  3E9H A;  5JEA H;  3FKI B;  1PRT F;  2MPM A;  3GTJ B;  1DJR D;  5IGC A;  5DNF A;  2QA4 A;  4X64 L;  2JA6 G;  2VXW A;  3VYU A;  3TDQ A;  1NSN S;  2Q8R E;  3DWA A;  4K5X A;  5EPJ A;  2JA6 B;  2NBF A;  1DM0 B;  2F3W A;  2D0P A;  1G91 A;  3TS0 A;  5DEH A;  1N32 L;  1D8L A;  1TS4 A;  4LF8 Q;  4ILW A;  3KDF A;  5IOC A;  2NZH A;  1Q12 A;  1WI5 A;  5JJL A;  4GLV B;  4DV7 L;  1FJG Q;  2B2V A;  1HR0 L;  4DK0 A;  2MGS A;  4L8J A;  4K0K Q;  3MHB A;  4GN5 A;  4Y52 H;  5IIF A;  4F7X A;  1K73 C;  3NPP A;  1G6Z A;  2Q2U A;  2ICI A;  2WAQ E;  2EYM A;  3J7A F;  2IL8 A;  1WTR A;  4O0A A;  3NBI A;  1XPU A;  5M3F G;  3A74 A;  4LNQ A;  1X3G A;  3QO2 A;  5M3F B;  1WTP A;  4FYD A;  1S5F D;  2ES2 A;  4QMG A;  3C1E A;  3QJY A;  4JG2 A;  5A2Q L;  2HCC A;  1ET9 A;  4GZY C;  1SFO B;  2A69 D;  5M5W H;  4JI3 Q;  3GTM B;  1Q1E A;  3T16 A;  4CDF C;  2B2U C;  2NVX B;  1JE4 A;  2K01 A;  2B2Y C;  2CWP A;  3RR5 A;  1K3B C;  5E1F A;  1Y1W G;  3GTQ B;  1CSP A;  4N8F A;  1ZKO A;  3EA6 A;  3GTL H;  4QB4 A;  1A3V A;  3L3O C;  4RFB A;  1Y1W B;  1Q82 C;  3FKI H;  2O5I C;  1EU4 A;  2EJM A;  4YCW A;  5CV9 A;  3GTJ H;  2TSS A;  1MGS A;  3HGB A;  2JN4 A;  5KNB A;  2B2W A;  1JJC B;  1ICW A;  4CDC C;  1JB7 A;  3IL8 A;  1IKM A;  4IUV A;  1VQ4 A;  2G5D A;  1TXY A;  2EJF C;  1JOR A;  4BS9 A;  2JA6 H;  4KV6 A;  1OXU A;  4GLA C;  4C1N I;  5FLX c;  4R4Q A;  5LMN W;  4DV1 L;  5HY6 A;  3UDG A;  4LFC L;  4RHR A;  1W3S A;  4EQP A;  4DR7 L;  4XDX A;  1LT6 D;  1Q7Y C;  4IUU A;  1NCV A;  3S15 H;  1YNJ C;  1F9P A;  4V0B A;  1N33 L;  5JJZ A;  1U9R A;  4NW2 A;  4OEL B;  4G7O C;  3DLL A;  1AP0 A;  3VYR A;  3C2P A;  2Z9H A;  3T13 A;  1STA A;  4PMC A;  3KLS X;  2VUM G;  3UE0 A;  1YI2 A;  3EFX D;  3MA2 B;  2VUM B;  1CK1 A;  3CCM A;  2X6L A;  3W5O A;  3QOJ A;  3D31 A;  4HCE A;  5AJ3 Q;  1IZ6 A;  5H1S E;  3RLF A;  1LAB A;  1IW7 D;  2NB0 A;  4KMU C;  3KJO A;  4A3I G;  3NSW A;  4MTN A;  5M3F H;  5M3M G;  3D4W A;  1HXY D;  2I46 A;  4FF3 A;  5M3M B;  2EY2 A;  3SGI A;  1SFO H;  5IGB A;  1YIJ A;  3LWU A;  3A8I E;  1FD7 D;  3OTO Q;  2RSO A;  3G7L A;  5T1G A;  1CHQ D;  3GTQ H;  1BUV T;  2BH8 A;  4KD4 A;  3H3V I;  1Y1W H;  1H9M A;  2K6A A;  3DHQ A;  4HID A;  1GD7 A;  1I4H A;  3VR5 A;  3ZYY X;  4DV3 Q;  1XPR A;  5KND A;  3NWT A;  1L2F A;  4X3U A;  1TU2 B;  1HQR D;  4R4O A;  1FYC A;  2N55 A;  1SDF A;  1SYD A;  3I4N G;  4F88 A;  2E8G A;  4ZQ3 A;  1RHP A;  2LY7 A;  2ICE C;  3I4N B;  5IOD A;  4CKE A;  3S1R B;  1DD2 A;  4UAI A;  3CAM A;  3HKZ E;  4DR5 L;  1D5X C;  4A76 A;  4OIK A;  5EPL A;  1WCM G;  4HN7 A;  5TSS A;  1WCM B;  4M1U B;  1XNQ Q;  3CCJ A;  2VUM H;  1CHP D;  3Q8D A;  3STB C;  1O7Y A;  1YJ9 A;  2D9U A;  1EQT A;  2JYO A;  5JAV A;  4B3T Q;  1Y8N B;  4ZUJ A;  4PNY A;  4FDB A;  2J4X A;  2KOL A;  2PQA B;  4QCL A;  3PIO 3;  2ZJP A;  5LMU L;  3ULP A;  4JBM A;  4A3I H;  4I7Z C;  1FL0 A;  3M4Q A;  1IBL Q;  4UDU C;  2H5X A;  5M3M H;  4GOP B;  2F0V A;  1EY7 A;  1IBK Q;  1K3R A;  4NKL A;  3CPW A;  2RSN A;  4K2L A;  1PHJ A;  2L1B A;  1YIT A;  4G7H C;  3KOJ A;  5D3I B;  4DUY Q;  5FKA C;  2Q8T A;  1ICF B;  5BR8 L;  3MXU A;  2EIF A;  2UXC Q;  5GRO A;  4HTH A;  1XMO L;  3SEB A;  2E5L L;  2VQF L;  1NAP A;  4FF1 A;  1TS3 A;  5HGT A;  2QW7 A;  2UUC L;  3J81 L;  1SNP A;  2QIL A;  1DXM A;  2EE1 A;  2WFW A;  1KNA A;  4U68 A;  1CTM A;  3DM3 A;  1L1O C;  1JOO A;  4A93 H;  2F0U A;  1VQC A;  1YNN C;  3I4N H;  4RA8 A;  4CDE C;  2CKZ B;  2V4D A;  1HR0 W;  3D6C A;  4DNR B;  4LUZ A;  3NK9 A;  3Q24 A;  4IPG A;  3S1R H;  3J81 c;  2HD3 A;  1SRO A;  2B2U A;  2FHT A;  3BJU A;  3A56 A;  1FNU A;  4DV2 L;  4DNI A;  2QDL A;  2YTX A;  4XYO A;  4JI0 L;  4UY8 C;  3CRL C;  1YZ6 A;  2ZT9 C;  3P1H A;  1GUW A;  1V43 A;  2F0M A;  1XPO A;  5CV8 A;  2KCC A;  1WCM H;  1YHQ A;  4PMB A;  2A73 B;  4NP5 A;  2KJX A;  5M9O A;  4XQQ A;  1Q46 A;  3OWE B;  2VNU D;  1Q1B A;  1UEB A;  2NN6 G;  3M85 A;  3TME A;  1EEI D;  1E22 A;  3I4O A;  4TKO B;  2XRQ D;  4DN4 M;  3OHX C;  4KHP Q;  2Y0S E;  1STN A;  3NQT A;  4LF8 L;  2TMP A;  1PYW D;  4QGU A;  3I55 A;  5CV5 A;  4OO1 I;  2PMZ B;  4GOP C;  2L55 A;  5T1I A;  4POF A;  1FJG L;  3WWV A;  3PIP 3;  1R4P B;  1GVP A;  2N88 A;  3RN2 A;  3BDO A;  4K0K L;  1CKO A;  1GHJ A;  3Q0A A;  3BDC A;  1CKM A;  1B3Q A;  4HSV A;  1PH2 A;  2Q2T A;  3MXN B;  1PDQ A;  5IWA Q;  3TRE A;  4F87 A;  1BR9 A;  1JWU D;  4JBW A;  1KHI A;  1VQA A;  4JV5 Q;  4KKU A;  2ID0 A;  2GVA A;  2LS0 1;  1MJC A;  4DR1 Q;  1HRJ A;  2N3S A;  3SK4 A;  4EGV A;  4N9P A;  3VR6 A;  4JI3 L;  1S4Z A;  1X65 A;  1Q8K A;  2QCP X;  3PO2 G;  2CFM A;  2PMZ E;  1A2T A;  3VA5 A;  1V1O A;  2FXQ A;  5ELD A;  5JVH 3;  1GHK A;  1SNM A;  2EVB A;  1V9P A;  3S1M H;  1B4O A;  4UP7 A;  4ULL A;  1EYC A;  3BYT B;  3J7Y W;  3K57 A;  1ENC A;  1MIU A;  2F52 A;  4LF5 Q;  1EQQ A;  3K58 A;  1KLU D;  4KHZ A;  3D0F A;  4Q5V A;  4IUQ A;  1NTG A;  3MFY A;  2QEJ C;  3X3N A;  4IO9 A;  1OXS C;  4YWK A;  2F0E A;  2YU9 B;  3S24 A;  3KDF B;  1BBW A;  1DOM A;  4A3F H;  2L0C A;  1UUP A;  1K8G A;  2NN6 H;  2JP1 A;  3I4L A;  3PMF A;  3KF8 B;  2OCE A;  3A0J A;  1J6Q A;  4DV0 Q;  3G71 A;  2EYF A;  3H09 A;  2A8V A;  1G51 A;  2PI2 A;  2DNC A;  1JOK A;  3RZD B;  4P2C B;  1SN8 A;  4DGZ A;  5K36 G;  3CF5 A;  2OTJ A;  2AMC B;  5FOB B;  1JQY D;  3E9I A;  3Q23 A;  1YHA A;  2A5H A;  2F0I A;  1PLF A;  2EYO A;  1PH5 A;  1MJE A;  3KFU A;  5M5Y H;  2DNE A;  1H9S A;  3TZU A;  4P71 A;  2RCF A;  1EUJ A;  5AJ3 L;  4OL7 A;  1U4R A;  1K0R A;  4CBV A;  4DNT B;  3TN2 A;  2SDF A;  5C3E G;  2G9H D;  1QZH A;  1D7Q A;  1KNE A;  1SE8 A;  3T1Y Q;  4PQX A;  5C3E B;  4FXD A;  1SXT A;  3VYT A;  3PO2 H;  3OTO L;  5C0X J;  4RAU C;  3IRB A;  2ZXO A;  1S5E D;  2B3G A;  3HOU G;  3GV3 A;  3HZX A;  2Z0S A;  5CC4 A;  5BN3 A;  2ZJQ A;  2F0F A;  2NZO A;  1C8C A;  1JIC A;  2UXD L;  3HOU B;  4A3E G;  1SYE A;  1EWI A;  3LX0 A;  4J8Q A;  2E75 C;  3RLN A;  2LKV A;  4A3E B;  4DV3 L;  3G6J B;  1EIG A;  1HH2 P;  2YU9 H;  1BQQ T;  2HDM A;  2IX1 A;  5JEA J;  3D3R A;  4RWS C;  4NXM Q;  1WOC A;  3I73 A;  3CKI B;  4NPS A;  4QIW B;  2YV5 A;  5IP9 G;  1RF2 D;  3WDN A;  3U50 C;  1Y8O B;  5FLM G;  4IUR A;  2NVY B;  4JI1 Q;  2XTI A;  3RZD H;  2EYH A;  2L4N A;  2MO1 A;  1EOV A;  1HZ9 A;  4C3J G;  5A2Q E;  4I7A A;  1GUN A;  3HRZ C;  4C3J B;  5K36 H;  1XNQ L;  3W1G A;  1KL9 A;  3CME A;  1WFQ A;  2M9V A;  1PH9 A;  4B3T L;  1XMQ Q;  3S9W A;  1H9R A;  4KHV A;  1C4Q A;  5FLX E;  2R7F A;  2ALY B;  3UDF A;  2R7Z G;  3ERO A;  3VR2 A;  2VB3 X;  1IBL L;  3IAY A;  1CQV A;  2F0S A;  1I50 B;  1PRT D;  4A3G G;  5J39 A;  1CZG A;  5KEE A;  2PO4 A;  2R7Z B;  5CV6 A;  5C3E H;  3AU7 A;  2YTV A;  1IBK L;  1QG7 A;  2KHS A;  1WTH A;  5I6W A;  1HZA A;  1A3T A;  2Z8L A;  2Z1C A;  5C0X I;  4O42 A;  5NUC A;  2K7V A;  1IBM Q;  1VQN A;  1I94 Q;  1Z7T A;  1BNZ A;  1RTN A;  1LTL A;  4DUY L;  5ISR A;  2PPB C;  3KYH C;  1S3O A;  2UXC L;  2KUM A;  3R8B A;  4KKT A;  1WJJ A;  2B2T C;  3SR1 A;  4JI2 Q;  3HOU H;  4M8A A;  3KBX A;  3CCR A;  1HFN A;  1A3U A;  1I4R A;  4JVZ A;  1HTL D;  2A19 A;  4A3E H;  4A3M H;  3GTG B;  3E5S A;  1Y1V G;  3L0O A;  2CH4 W;  2VW9 A;  1GUG A;  1Y1V B;  2NVT B;  1K0S A;  1EYD A;  3S17 B;  4WJ3 M;  3A7A B;  4ZUI A;  1UE7 A;  5ELO A;  2F1M A;  4JI8 Q;  4GN4 B;  1NMF A;  4LF9 Q;  4X66 Q;  4HIO A;  2GVB A;  2XVS A;  4R4T A;  4FF2 A;  5IP9 H;  3DWP A;  3MFG A;  1WVL A;  3OW2 A;  1LYL A;  5FLM H;  2I5H A;  5GAG C;  3PIP A;  1I3Q B;  2MQH A;  2RF4 A;  3ONA B;  4YWM A;  3GP7 A;  4OWX B;  4C3J H;  3K6O A;  3M9B A;  1NNX A;  3KK7 A;  3K5N A;  3H91 A;  1QNK A;  1O7Z A;  3P20 A;  2IWH A;  4GNX A;  2AHO B;  1EFI D;  1PZI D;  1FNW A;  1LT3 D;  3NE5 B;  4KHP L;  1CM9 A;  3HOY B;  4P72 A;  4XYQ A;  4L63 B;  2F0D A;  2R7Z H;  3QG1 A;  2B63 G;  4A3G H;  4IJL A;  2K5V A;  3TRZ A;  5IGD A;  4TSS A;  2PYK A;  2SOB A;  1JOQ A;  2B63 B;  1TWF H;  4OIJ A;  2K28 A;  1G2S A;  3PUW A;  1QZG A;  2Q2I A;  2AQ2 B;  5CYU A;  3QB3 A;  1LM0 A;  1I4X A;  3GTG H;  1VQH A;  5IWA L;  1NUC A;  4A75 A;  1BCP C;  1ZEQ X;  4JV5 L;  4ODG A;  1Y1V H;  4DAY B;  4DR1 L;  2NVT H;  2D0O A;  2IHF A;  3S17 H;  5EJW A;  3I70 A;  1B8A A;  3GO5 A;  2E2H B;  4DAV A;  4F8M A;  5J1Z A;  2CHB D;  3T56 B;  1CFM A;  1TQO A;  3A54 A;  4FNF A;  4LF6 Q;  2I0Q A;  1EZ6 A;  1N8R C;  3G4S A;  1CA6 A;  4K8J A;  5F2D A;  3SXH A;  2K4K A;  1I3Q H;  2ASB A;  1I4G A;  1QJO A;  3J7A V;  1SSO A;  3X3M A;  1F2M A;  2HQE A;  1EU3 A;  3RZO H;  3PSI A;  2WB1 B;  3J80 c;  4LF5 L;  5D14 A;  2RBM A;  3PO3 G;  2PNR C;  4MTK A;  2F0T A;  1G8Z D;  1WYD A;  2XRS D;  3PO3 B;  1F9Q A;  2EY6 A;  1VQ7 A;  2BA0 A;  4DR2 Q;  2DJG C;  4XIG S;  3BVM A;  2E2J B;  2UUA Q;  3FEW X;  4KD3 A;  5JJK A;  1ENF A;  4DV0 L;  1VQP A;  3RN5 A;  3TZD A;  1EY5 A;  3L9A X;  3J81 E;  2BCO A;  1I6H B;  4IUP A;  1B9N A;  2R93 H;  2VQE Q;  2NTT A;  2B63 H;  1VQ6 A;  1A8V A;  3K5O A;  4XXE A;  1MBY A;  1F2L A;  2ZTE A;  4MIU A;  1UE6 A;  5M5X H;  3R93 A;  4JPB W;  3TEH B;  4DR4 Q;  4N8X 1;  1K28 A;  1KTK A;  2ZJR A;  3K8A A;  4Y7N B;  5FLX L;  1PTO H;  2QKI C;  3SK5 A;  1M1K C;  1WTQ A;  2R7D A;  3W1B A;  2VZA A;  2ZXP A;  1A2U A;  1PTO C;  2K5N A;  3HFZ B;  4IZ8 A;  3D8G A;  3H94 A;  3T1Y L;  2E2H H;  5I6Y A;  3QR8 A;  4EQN A;  2KEE A;  4ZKB B;  4KY7 A;  4WJW A;  1R4Q B;  2PW5 A;  2OT2 A;  1N34 Q;  2XSC A; 
#chains in the Genus database with same CATH homology
 5C5L A;  1J8I A;  2SNM A;  3K59 A;  2WP8 J;  3WOE A;  4RKL A;  4B9W A;  5KNC A;  3GV6 A;  1L0X B;  2RKS A;  4EVO A;  1LT4 D;  1TII D;  1D1I A;  1X3Q A;  2AWN A;  5IT9 L;  1S5C D;  3OOC A;  3FMC A;  1EWC A;  1VDZ A;  1MSG A;  5FO9 B;  2R92 B;  1STY A;  1UNS A;  4LJZ C;  1KAB A;  2JA7 B;  5C6A A;  5EBC A;  4KK7 A;  2KEC A;  3BS1 A;  2A6H C;  1BDO A;  4KY6 A;  3Q22 A;  2B39 A;  4L6T B;  4RGM A;  5C3W A;  1SBB B;  3SK8 A;  3I4M B;  2L9H A;  3U9S A;  1TY2 A;  3M4O B;  1EQV A;  3BVZ A;  1K8O A;  1LAC A;  2EY1 A;  3UI2 A;  1STH A;  2EDG A;  5HUR A;  1SYC A;  3K5M A;  3DEO A;  4C3I B;  3OWF A;  1A6X A;  2BDN A;  4IAL A;  1OO9 B;  4RGT A;  4CHT B;  3SHL A;  1EY4 A;  4X3S A;  1HQM C;  4R8I A;  4ZRZ A;  1ROD A;  3KLR A;  5D65 A;  1D2B A;  1TS2 A;  3M7G A;  1E2W A;  3TBI B;  1LTI D;  4ZK9 B;  2EY5 A;  4OHJ A;  2O5J C;  2F0Q A;  2OEO A;  1JWM D;  1M4V A;  3MTS A;  5LL6 X;  3R3O A;  1AZQ A;  1T5X D;  1RKN A;  1S5B D;  3S2H B;  2HDL A;  1C48 A;  1PFN A;  2IPK D;  1D6E C;  1RDP D;  3PV0 A;  2C5C A;  2K1B A;  3R2I A;  1KDB A;  4FO2 A;  2F0K A;  5JPM C;  1GXD C;  1TWA B;  4J6H A;  3D6W A;  1V1P B;  3LWE A;  2B2Y A;  2H1E A;  1EY6 A;  4WRD A;  2F0W A;  2EXZ A;  5IGF A;  4X3T A;  1QIL A;  3PUX A;  1AFP A;  1VCI A;  3BG3 A;  3S1Q B;  4JK1 C;  4BBS B;  3FRP B;  1Y69 U;  4AYB B;  1YNJ D;  1GJX A;  2AQ3 B;  1OXT A;  2DY8 A;  3S2D B;  2JA5 B;  1BOS A;  1BCP F;  3S16 B;  3E6Z X;  4YIJ A;  2SEB D;  3I72 A;  3SK6 A;  4DFA A;  4H7B A;  3HOX B;  2CW0 C;  1B9M A;  2F0J A;  1SE2 A;  4BWG B;  1G2T A;  4OO1 G;  3SE0 A;  3RD4 A;  4G4K A;  1ILP A;  3NHH A;  4H44 C;  3WOF A;  1WTX A;  1TS5 A;  5C5M A;  4C3H G;  3BVG A;  1B53 A;  3SDZ A;  4C3H B;  2RQX A;  2O4X A;  3FVQ A;  4N9T A;  3IKJ A;  2RVL A;  3PUZ A;  2XIW A;  3VA7 A;  4C56 C;  2GA4 B;  3FPU B;  3QWN A;  2A6H D;  2DY7 A;  3PUV A;  3IFT A;  3NQI A;  4KTA A;  1QE6 A;  4FF4 A;  1E2V A;  1Z6H A;  2K5D A;  2IX0 A;  5K5P A;  2JA8 B;  3F2U A;  1XX8 A;  5AFW A;  3EVQ A;  1F77 A;  1F2Z A;  3P75 A;  4EQO A;  1DON A;  3OW7 A;  5G3L F;  2MUY A;  3V96 A;  4ZLT F;  5I9P A;  1PTO F;  2A68 C;  2K04 A;  4CJ2 C;  3C3L A;  1O78 A;  3ERQ A;  3K5L A;  1MSH A;  2EOT A;  5I9O A;  2XWB B;  2X6G A;  4IFD J;  5J22 A;  2MHV A;  1Z47 A;  4G57 A;  4OO1 H;  1NR2 A;  4ZAI A;  1UAP A;  5C4J B;  3D4D A;  3NTK A;  1X3P A;  4R9W A;  1EY0 A;  1O80 A;  4PMW A;  3AMU A;  1V8Q A;  2PZT A;  1BXT A;  3J80 E;  3JAM L;  2F0G A;  1PFB A;  1LTR D;  3NTH A;  1PMR A;  1D1K A;  1E2Z A;  2AQ1 B;  5FK9 C;  3GQB A;  4FVM A;  4HMJ A;  1AEX A;  4IN3 A;  2K5W A;  3CU7 A;  4TQU S;  1F9R A;  1XXG A;  1YNN D;  3DM1 A;  1SYF A;  3TP7 A;  4LK1 C;  1PZJ D;  1IYU A;  2EYJ A;  5CBA E;  1R9T B;  1QWY A;  2KQ3 A;  2B2V C;  3D4R A;  1ESR A;  2HUG A;  1HHV A;  4B08 A;  4G7Z C;  4IFD I;  3NXW A;  3QOL A;  4DAP A;  5E4X A;  2Q8I B;  1SND A;  5KRU A;  2FFK B;  3VYS A;  2PZU A;  1TWG B;  1DYQ A;  1SNQ A;  2NUC A;  4ABN A;  1QB5 D;  4KJO A;  4DXF A;  1HPC A;  1KDC A;  4KJN A;  3KBG A;  2F3V A;  4CJ1 B;  1ESF A;  1QNU A;  2K32 A;  1SEB D;  1TT2 A;  4A3D B;  4A3B B;  1GOZ A;  2B2W C;  2KVM A;  5C0X G;  4ZYS A;  2QDB A;  2J0T D;  1UEA B;  1KAA A;  1RCV D;  3TP6 A;  1JB3 A;  4K2K A;  5I2X A;  2QF7 A;  4ME5 A;  3U9O A;  2PCF B;  5A35 A;  2OXP A;  1QCB D;  2DN8 A;  3T51 B;  3MXG A;  5IT9 E;  5JEA G;  1OXV A;  4OGQ C;  3T53 B;  2K03 A;  1BBX C;  1W6K A;  1LTG D;  1SE3 A;  4KN4 C;  2IW3 A;  4KI0 A;  4XQN A;  1ML0 D;  2LFN A;  4FXK C;  3W3A A;  1GUT A;  4H13 C;  3MZ5 A;  4DK1 A;  1K8M A;  5FO7 B;  1HA6 A;  2RA4 A;  5CBE E;  4CKB A;  1GUS A;  3DEP A;  2RDH A;  3W2D A;  3MAQ A;  4BBR B;  3L7Z C;  1H9J A;  2FJ2 A;  5I2Y A;  5D3D A;  4LMQ D;  3GTK B;  4C1N K;  2L12 A;  2F0O A;  3QIA A;  5LHY 1;  3GD7 A;  5C0X H;  1VMC A;  3MXN A;  1SJE D;  4QUF A;  1D5M C;  2JE6 I;  2WKC A;  2CQA A;  3AB9 A;  1G29 1;  1S5D D;  4HAE A;  1TKW B;  3J80 L;  3A8J E;  3KLS A;  1JC7 A;  4C2M B;  1SNC A;  5COR A;  1Q90 A;  2EYP A;  2G9D A;  2NWG A;  5ELB A;  2WAC A;  1LTT D;  1T5E A;  2F4I A;  5EGT A;  1GUO A;  2WAQ B;  2FMC A;  4PV1 C;  3HOV B;  1LTS D;  2K5Q A;  4I65 A;  5EPK A;  4BA2 I;  1CT1 D;  1LO5 D;  4WFN 3;  2L11 A;  2Z4H A;  2CVR A;  1A15 A;  3NTI A;  3HEJ A;  3S15 B;  1SAP A;  1WTW A;  5I4D A;  2EJG C;  3KF8 A;  2A6E C;  1EIH A;  1BO0 A;  1DOK A;  5BN4 A;  5KYL A;  3NBH A;  5C44 B;  3OMG A;  3BYY B;  1VF5 C;  3PUY A;  1VF7 A;  3BZD B;  5CR3 A;  3CHB D;  4IUT A;  2EZV A;  2O2L D;  3M4Y A;  5EKK A;  1SNO A;  2VB2 X;  1JR0 D;  1DCZ A;  3ND9 A;  1O7L A;  3CRK C;  1WTO A;  3K7A B;  4XQJ A;  1FNV A;  2FMM A;  3BDL A;  1XYI A;  2B2T A;  1IL8 A;  3MVV A;  3I90 A;  2ENB A;  4CKC A;  1RTO A;  2D2C C;  2E74 C;  2IT1 A;  2J7Z A;  2YYZ A;  5CV7 A;  1CI3 M;  1HUM A;  5CV4 A;  3URY A;  2JXM B;  2H4O A;  1B1Z A;  2K05 A;  3RMH A;  5DM7 3;  3N52 A;  2JEA I;  1E0B A;  1H9S B;  2A74 C;  2LMC B;  1ONL A;  1JCK B;  2F0L A;  2NTS A;  2SNS A;  4DA2 A;  3DWQ A;  2JSO A;  5ELC A;  2NVQ B;  2RDG A;  4HCS A;  3V05 A;  1HCZ A;  1STG A;  1U4M A;  4A3I B;  2PW7 A;  1SYG A;  3T4A C;  2D62 A;  3OPO A;  2WIN B;  3HKZ B;  3GTO B;  1LTA D;  3LNN A;  4ZKC B;  4C3I G;  1PXU A;  1CZW A;  1LT5 D;  4HSP A;  1BCP D;  4A93 B;  3H6M A;  3MXP A;  4K5V A;  1B2T A;  1AZP A;  1L0Y B;  4A3K B;  3TSS A;  5C3X A;  4H0L C;  2AUJ D;  1KDA A;  4K5W A;  2B8G A;  1K83 B;  3A7L A;  3RUZ A;  4K6D A;  5LL6 S;  1OXX K;  4BY1 B;  4U67 3;  2AUK A;  4RCN A;  3OIQ A;  3I91 A;  4CJ0 B;  2EYL A;  1U4P A;  3JAM E;  1EZ8 A;  3SVM A;  1IHZ A;  2NYZ D;  3S14 B;  3I3C A;  1PRT B;  1EY9 A;  3KUP A;  2A6E D;  3K0Y A;  1Y8P B;  3S1N B;  5BN5 A;  3HP3 A;  3H3V C;  4RCO A;  5G3L D;  2HCI A;  1WD1 A;  1JWS D;  3I8Z A;  3GTP B;  3N6R A;  1PTO D;  1BF4 A;  2Y0S B;  4DAY A;  1AN8 A;  1DZ1 A;  4XT3 B;  3S1M B;  3FDT A;  1EYA A;  1PFM A;  1LTB D;  2XWJ B;  2NN6 I;  5ELE A;  1CQF A;  4IQZ A;  1XWE A;  5EQ0 A;  3E0J A;  4RH6 A;  4NDX A;  2KA7 A;  1RD9 D;  4Z9C B;  1B44 D;  4A3F B;  1F2Y A;  3EQL C;  2BE5 C;  2E76 C;  1ZXT A;  3C46 A;  4Q0F A;  1PRT C;  1MI2 A;  3C1F A;  5KIX A;  5C4H A;  3V2T A;  1EL0 A;  1WD0 A;  4WOR A;  1IYV A;  2IJ0 A;  1FGB D;  2XN9 C;  2KED A;  1TWH B;  5M5Y B;  2MP1 A;  3OMC A;  4DXG A;  5KGU A;  4DU9 A;  4K6L A;  4R8N A;  1W6J A;  4X3K A;  1ZYR C;  2KCN A;  3ITP A;  3OIP A;  4HMI A;  3PO2 B;  1EY8 A;  5JPN C;  1B50 A;  1TVX A;  5FO8 B;  5DM6 3;  3HG9 A;  1ENA A;  4KY5 A;  5C4X B;  3FPP A;  1EOT A;  3CQZ B;  1LLR D;  4O1N A;  5C4Z A;  4DF7 A;  1SYB A;  5EBD A;  1I4Q A;  3HOW B;  3HS0 C;  3Q6S A;  3A8K E;  1Q8I A;  3EJI A;  1SMY C;  4BY7 B;  1HTP A;  2AWO A;  3TP8 A;  1LV9 A;  5JOB A;  3NP8 A;  5EKL A;  1NR4 A;  1TR5 A;  1Q3L A;  4RGO S;  3M3Y B;  1M8A A;  4KKS A;  1RJT A;  1SJH D;  3DMU A;  1KLG D;  3DXJ C;  3OSO A;  4TRD A;  4V19 0;  4QF4 A;  5IGG A;  1TWC B;  2L5T A;  1B3A A;  2M00 A;  3MC0 B;  3DUZ A;  4CGY B;  2D5D A;  4FXG C;  1ET6 A;  3MEH A;  2WV6 D;  5COY A;  2WII B;  1DOL A;  4A3J B;  2F0N A;  1J9O A;  1EEF D;  1VMP A;  4K8I A;  1HUN A;  3H0G B;  4A3M B;  4B9X A;  4XT1 B;  2C9O A;  4FP5 D;  2BDO A;  5ELF A;  3HOZ B;  3TP5 A;  1H9K A;  1EWH A;  1I4P A;  1D5Z C;  3NUC A;  1XTC D;  4IFD G;  3VR3 A;  2F03 A;  2F0H A;  2E2D C;  2A69 C;  2B8F A;  3O13 A;  1STE A;  3VR4 A;  2CW0 D;  2MJ8 A;  3MWY W;  4QUC A;  2ZXR A;  5DAU A;  1AW7 A;  2E2I B;  1II3 A;  2BE5 D;  2R61 A;  4HED A;  2NZ1 D;  3P7J A;  4RKB A;  2I07 B;  5E3F A;  2EPB A;  2OF1 A;  1MD2 D;  5CMD A;  4A3G B;  1CA5 A;  1TWF B;  2WKD A;  2Z4I A;  1F9S A;  2BOS A;  1HA5 A;  2K33 A;  4K14 A;  1I6V C;  1BCP B;  4MHE A;  5JVG 3;  5EKI A;  2F0P A;  1V1P A;  1IKL A;  4RGN A;  3IFD A;  1ZYR D;  3ND8 A;  3R2T A;  2IX3 A;  1U4L A;  2PZW A;  2M2L A;  2BA1 A;  1ILQ A;  2FIN B;  4E6I A;  1IW7 C;  1QOH A;  2R3Z A;  4IFD H;  1PZK D;  4MN3 A;  3RZO B;  2A68 D;  1WTV A;  3NWS A;  4BA1 I;  4KN7 C;  4ID6 A;  1FR3 A;  1SE4 A;  2R6G A;  2X69 A;  4S3S A;  4LAA A;  1STB A;  1TY0 A;  1SMY D;  2PQE A;  4IUN A;  2R93 B;  1X32 A;  2JEB I;  2RDF A;  5M5W B;  4HR7 B;  3M7N A;  4XTC S;  5CGK A;  5M5X B;  4RHS A;  5IGE A;  5KYI A;  5E4W C;  2XNA C;  3GTL B;  1HFG A;  3A55 A;  4NMZ A;  1PTO B;  4J1M A;  5JEA H;  3FKI B;  1PRT F;  2MPM A;  3GTJ B;  1DJR D;  5IGC A;  5DNF A;  2VXW A;  3VYU A;  3TDQ A;  1NSN S;  2Q8R E;  3DWA A;  4K5X A;  5EPJ A;  2JA6 B;  2NBF A;  1DM0 B;  2F3W A;  1G91 A;  5DEH A;  1TS4 A;  4ILW A;  5IOC A;  1Q12 A;  2B2V A;  4DK0 A;  2MGS A;  4L8J A;  3MHB A;  5IIF A;  4F7X A;  3NPP A;  1G6Z A;  2ICI A;  2EYM A;  3J7A F;  2IL8 A;  1WTR A;  3NBI A;  3QO2 A;  5M3F B;  1WTP A;  4FYD A;  1S5F D;  4QMG A;  3C1E A;  3QJY A;  5A2Q L;  2HCC A;  1ET9 A;  4GZY C;  1SFO B;  2A69 D;  3GTM B;  1Q1E A;  3T16 A;  2B2U C;  2NVX B;  1JE4 A;  2K01 A;  2B2Y C;  5E1F A;  3GTQ B;  1ZKO A;  3EA6 A;  4QB4 A;  1A3V A;  3L3O C;  4RFB A;  1Y1W B;  2O5I C;  1EU4 A;  2EJM A;  5CV9 A;  2TSS A;  1MGS A;  3HGB A;  5KNB A;  2B2W A;  1ICW A;  3IL8 A;  1IKM A;  4IUV A;  2EJF C;  1JOR A;  4BS9 A;  4KV6 A;  1OXU A;  4C1N I;  4RHR A;  4EQP A;  4XDX A;  1LT6 D;  4IUU A;  1NCV A;  1YNJ C;  1F9P A;  4V0B A;  5JJZ A;  1U9R A;  4NW2 A;  4G7O C;  1AP0 A;  3VYR A;  3C2P A;  3T13 A;  1STA A;  4PMC A;  3KLS X;  3EFX D;  3MA2 B;  2VUM B;  1CK1 A;  2X6L A;  3QOJ A;  3D31 A;  4HCE A;  3RLF A;  1LAB A;  1IW7 D;  2NB0 A;  4KMU C;  3NSW A;  3D4W A;  1HXY D;  2I46 A;  4FF3 A;  5M3M B;  2EY2 A;  5IGB A;  3LWU A;  3A8I E;  1FD7 D;  2RSO A;  3G7L A;  5T1G A;  1CHQ D;  1BUV T;  4KD4 A;  1H9M A;  2K6A A;  3DHQ A;  1I4H A;  3VR5 A;  3ZYY X;  5KND A;  3NWT A;  4X3U A;  1TU2 B;  1HQR D;  1FYC A;  2N55 A;  1SDF A;  1SYD A;  4F88 A;  4ZQ3 A;  1RHP A;  2LY7 A;  2ICE C;  3I4N B;  5IOD A;  4CKE A;  3S1R B;  1DD2 A;  4UAI A;  1D5X C;  4OIK A;  5EPL A;  4HN7 A;  5TSS A;  1WCM B;  4M1U B;  1CHP D;  1O7Y A;  2D9U A;  1EQT A;  2JYO A;  5JAV A;  1Y8N B;  4ZUJ A;  4PNY A;  2J4X A;  2KOL A;  4QCL A;  3PIO 3;  4I7Z C;  4UDU C;  2F0V A;  1EY7 A;  4NKL A;  2RSN A;  4K2L A;  2L1B A;  4G7H C;  5D3I B;  5FKA C;  2Q8T A;  3MXU A;  4HTH A;  3SEB A;  1NAP A;  4FF1 A;  1TS3 A;  5HGT A;  3J81 L;  1SNP A;  2QIL A;  1DXM A;  2EE1 A;  1KNA A;  4U68 A;  1CTM A;  1JOO A;  2F0U A;  1YNN C;  4RA8 A;  2V4D A;  3D6C A;  4DNR B;  3NK9 A;  3Q24 A;  2B2U A;  2FHT A;  3A56 A;  1FNU A;  4XYO A;  3CRL C;  1GUW A;  2ZT9 C;  3P1H A;  1V43 A;  2F0M A;  5CV8 A;  2KCC A;  4PMB A;  2A73 B;  4NP5 A;  2KJX A;  5M9O A;  4XQQ A;  3OWE B;  2VNU D;  1Q1B A;  2NN6 G;  3M85 A;  3TME A;  1EEI D;  4TKO B;  2XRQ D;  4DN4 M;  3OHX C;  3NQT A;  1STN A;  2TMP A;  1PYW D;  5CV5 A;  4OO1 I;  2PMZ B;  2L55 A;  5T1I A;  3PIP 3;  1R4P B;  2N88 A;  3BDO A;  1GHJ A;  3Q0A A;  3BDC A;  4HSV A;  1PDQ A;  4F87 A;  1BR9 A;  1JWU D;  4JBW A;  4KKU A;  2ID0 A;  2LS0 1;  1HRJ A;  4EGV A;  3SK4 A;  4N9P A;  3VR6 A;  1S4Z A;  2QCP X;  1A2T A;  3VA5 A;  1V1O A;  5ELD A;  1GHK A;  5JVH 3;  1SNM A;  2EVB A;  1B4O A;  4ULL A;  1EYC A;  3BYT B;  3J7Y W;  3K57 A;  1ENC A;  3K58 A;  1KLU D;  4KHZ A;  4Q5V A;  4IUQ A;  3MFY A;  2QEJ C;  3X3N A;  1OXS C;  2F0E A;  2YU9 B;  1DOM A;  2L0C A;  1UUP A;  2NN6 H;  2JP1 A;  3I4L A;  3PMF A;  2EYF A;  3H09 A;  2DNC A;  1JOK A;  3RZD B;  4P2C B;  4DGZ A;  5K36 G;  5FOB B;  1JQY D;  3Q23 A;  2A5H A;  2F0I A;  1PLF A;  2EYO A;  2DNE A;  1H9S A;  3TZU A;  4OL7 A;  1U4R A;  4CBV A;  4DNT B;  3TN2 A;  2SDF A;  2G9H D;  1KNE A;  4PQX A;  5C3E B;  4FXD A;  1SXT A;  3VYT A;  5C0X J;  4RAU C;  2ZXO A;  1S5E D;  3GV3 A;  3HZX A;  5CC4 A;  5BN3 A;  2F0F A;  1C8C A;  1JIC A;  3HOU B;  1SYE A;  3LX0 A;  4J8Q A;  2E75 C;  4A3E B;  2LKV A;  3G6J B;  1EIG A;  1BQQ T;  2HDM A;  2IX1 A;  5JEA J;  3D3R A;  4RWS C;  3I73 A;  3CKI B;  4QIW B;  1RF2 D;  3WDN A;  1Y8O B;  4IUR A;  2NVY B;  2EYH A;  2L4N A;  4C3J G;  5A2Q E;  1GUN A;  3HRZ C;  4C3J B;  5K36 H;  2M9V A;  3S9W A;  1H9R A;  4KHV A;  1C4Q A;  5FLX E;  3ERO A;  3VR2 A;  2VB3 X;  3IAY A;  1CQV A;  2F0S A;  1I50 B;  1PRT D;  5J39 A;  1CZG A;  5KEE A;  2PO4 A;  2R7Z B;  5CV6 A;  3AU7 A;  1QG7 A;  2KHS A;  5I6W A;  1A3T A;  2Z8L A;  2Z1C A;  5C0X I;  4O42 A;  5NUC A;  2K7V A;  1Z7T A;  1BNZ A;  1RTN A;  5ISR A;  2PPB C;  2KUM A;  3R8B A;  4KKT A;  2B2T C;  3SR1 A;  4M8A A;  3KBX A;  1HFN A;  1A3U A;  1I4R A;  3GTG B;  1HTL D;  3E5S A;  1GUG A;  1Y1V B;  2NVT B;  1EYD A;  3S17 B;  3A7A B;  4ZUI A;  2F1M A;  2XVS A;  4FF2 A;  3DWP A;  3MFG A;  1WVL A;  1I3Q B;  3ONA B;  3GP7 A;  3K6O A;  3KK7 A;  3K5N A;  3H91 A;  1QNK A;  1O7Z A;  3P20 A;  2IWH A;  1EFI D;  1PZI D;  1FNW A;  1LT3 D;  3NE5 B;  1CM9 A;  3HOY B;  4XYQ A;  4L63 B;  2F0D A;  3QG1 A;  1JOQ A;  5IGD A;  4TSS A;  2PYK A;  2SOB A;  2B63 B;  4OIJ A;  2K28 A;  1G2S A;  3PUW A;  2AQ2 B;  5CYU A;  3QB3 A;  1I4X A;  1NUC A;  1BCP C;  1ZEQ X;  4ODG A;  5EJW A;  3I70 A;  3GO5 A;  2E2H B;  4DAV A;  4F8M A;  5J1Z A;  2CHB D;  3T56 B;  1CFM A;  1TQO A;  3A54 A;  4FNF A;  1EZ6 A;  1CA6 A;  4K8J A;  5F2D A;  3SXH A;  3J7A V;  1I4G A;  1QJO A;  3X3M A;  1SSO A;  1F2M A;  2HQE A;  1EU3 A;  2WB1 B;  5D14 A;  2RBM A;  2PNR C;  2F0T A;  1G8Z D;  2XRS D;  3PO3 B;  1F9Q A;  2EY6 A;  2BA0 A;  4XIG S;  3BVM A;  2E2J B;  3FEW X;  4KD3 A;  1ENF A;  3TZD A;  1EY5 A;  3L9A X;  3J81 E;  2BCO A;  1I6H B;  4IUP A;  1B9N A;  2NTT A;  3K5O A;  4XXE A;  1MBY A;  1F2L A;  4MIU A;  3R93 A;  1KTK A;  4Y7N B;  5FLX L;  1PTO H;  2QKI C;  3SK5 A;  1WTQ A;  2ZXP A;  1A2U A;  1PTO C;  4IZ8 A;  3D8G A;  3H94 A;  5I6Y A;  4EQN A;  2KEE A;  4ZKB B;  4KY7 A;  4WJW A;  1R4Q B;  2PW5 A;  2OT2 A;  2XSC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...