1IKMA

Nmr study of monomeric human interleukin-8 (30 structures)
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
69
structure length
68
Chain Sequence
ELRCQCIKTYSKPFHPKFIKERVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN INTERLEUKIN-8 (MONOMERIC)
publication title 1H NMR solution structure of an active monomeric interleukin-8.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine (chemotactic)
total genus 10
structure length 68
sequence length 69
ec nomenclature
pdb deposition date 1995-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ikmA00
1EL0A 4HSVA 1B3AA 1X3PA 2HCCA 1ESRA 2HDMA 4QUCA 1EIHA 1CM9A 1HHVA 3F2UA 3DM1A 3FPUB 2BDNA 4LMQD 1AP0A 1S4ZA 1DOLA 1WD0A 3I91A 1B50A 2FHTA 3UI2A 2L9HA 1WTXA 1G6ZA 2B2YA 1WTVA 1MI2A 2B2UC 1IKMA 1EIGA 4NW2A 4X3KA 1F9QA 4OIJA 5D14A 4QUFA 2MGSA 4U68A 1BBXC 4ZAIA 1G91A 1A15A 2MP1A 3FDTA 2FFKB 1ML0D 2B2YC 4HAEA 3R93A 1U4MA 1NAPA 2KVMA 1QG7A 3N52A 3MWYW 3P7JA 5EJWA 4XT3B 4ZKBB 3MTSA 5COYA 1PFNA 2CVRA 3I3CA 4RAUC 5T1IA 1O7YA 2NWGA 5CBEE 1KNAA 1ILPA 1HFNA 2KECA 5EPLA 1WVLA 1KNEA 1WTRA 1O80A 1SAPA 4CJ1B 1SSOA 1IKLA 1MSGA 1RJTA 2JP1A 2N88A 2NZ1D 4IUVA 2VXWA 4HCSA 4X3UA 5D65A 1WTPA 2KUMA 5EPKA 2HUGA 5DNFA 1JE4A 2K04A 1DOKA 1F9RA 1U4LA 1HUNA 1RHPA 2K03A 2XIWA 1VMPA 4RA8A 1F9SA 1C8CA 2FINB 1M8AA 1NCVA 4ZKCB 2D9UA 1DZ1A 1RTOA 4IUPA 3DEOA 3GV3A 5EKIA 4R8IA 2L4NA 2RA4A 3LWEA 3TN2A 4XT1B 2L11A 5E4XA 1E0BA 2IL8A 2J7ZA 2RSOA 1F9PA 1PFMA 2R3ZA 4ZLTF 1IL8A 5AFWA 1MGSA 1HFGA 1NR2A 1ICWA 2DY7A 5T1GA 1J9OA 1HUMA 2K1BA 2B2TA 2KEEA 1BO0A 3H91A 1TVXA 4CJ2C 2X69A 1XYIA 1BF4A 1PLFA 4X3SA 1AZQA 1QNKA 1HRJA 1QE6A 2B2TC 4IUUA 5EQ0A 3KUPA 1CA6A 3KBXA 1WD1A 1DONA 1WTWA 1G2TA 1VMCA 1O7ZA 1SDFA 1Q3LA 1DOMA 1B2TA 1PFBA 2L1BA 2K05A 2Q8RE 2HDLA 2RSNA 5EPJA 1WTOA 3DEPA 4ZK9B 4CJ0B 3Q6SA 1U4RA 5JJZA 2NYZD 1XX8A 4MN3A 4RWSC 1G2SA 1NR4A 2SDFA 2X6LA 3D6WA 4R9WA 1HA6A 1ILQA 1EOTA 1U4PA 1X32A 2B2UA 4X3TA 2EOTA 5E4WC 1CA5A 1RTNA 2B2VA 3IFDA 4DN4M 3IL8A 4MHEA 3I8ZA 3QO2A 2KEDA 2KOLA 2FJ2A 4IURA 1WTQA 1AZPA 2EPBA 2HCIA 1J8IA 3TZDA 2B2VC 2DY8A 2M2LA 2N55A 1LV9A 3SVMA 5CBAE 1MSHA 4IUQA 2JYOA 3G7LA 4IUTA 1BNZA 3HP3A 5CMDA 1GUWA 2MPMA 2L12A 2EE1A 2B2WA 2RVLA 4HEDA 1X3QA 3ONAB 2Q8TA 2K28A 4O42A 2X6GA 2MJ8A 1B53A 1PDQA 4XDXA 5CORA 3I90A 3GV6A 1F2LA 4UAIA 4OIKA 2FMMA 1ZXTA 1RODA 2H1EA 2K01A 1EQTA 2B2WC 1B4OA 1JICA
chains in the Genus database with same CATH superfamily
1EU4A 1EL0A 5M9OA 5FKAC 5C3WA 4A4IA 4LUVA 2UUAL 3W1GA 2UXCQ 1SEBD 1PTOD 1TS5A 3KYHC 1C0AA 2JA5H 1I4XA 3X3NA 4JI3L 1DYQA 3I4LA 4KMUC 4GS3A 1YIJA 1UE7A 2UXBL 4JI7L 2CWPA 4CDFC 1EY0A 1T9HA 1WVLA 3GTGB 2BA0A 1LUZA 2HQEA 4YIJA 1IKLA 1GM5A 4LFBQ 1SYFA 5D65A 4HTHA 5DNFA 3PO3H 1DCZA 1WFQA 4TRDA 4G7HC 2WINB 3MEHA 3AYHB 2OT2A 4RA8A 4UP8A 3IKJA 2NVTB 2RHSB 4A3FH 5C0XH 3VYUA 2JA7B 1SYBA 1DZ1A 1I6VC 4LF8Q 1VF7A 3TBIB 2RA4A 5M5WH 3LWEA 1K9MC 2E74C 4JV5L 3EQLC 1PFMA 2R7ZH 3M4OH 4LK1C 2F0LA 2I5LX 1E7ZA 4CDCC 5IGCA 2D5DA 1BF4A 1GUTA 2F52A 2R93G 4QMGA 3K58A 4IUUA 4LAAA 4DV2L 4U673 5JPNC 4B9WA 4LF6Q 1Q3LA 1IBLQ 4TQUS 4DR2L 1FL0A 3CMEA 1W2BA 1Z9FA 4A3BG 1VQ5A 3CPFA 1PRTF 5ELBA 1NMGA 1Y8NB 1ZYRC 1I4PA 2XSCA 3OMCA 4KHPQ 3U9OA 3E3XA 3RZDH 1JR0D 4CGYB 1SNOA 1HQMC 2B29A 2KEDA 4O2DA 1AZPA 4LFCQ 5KNDA 2F4VL 1TWCB 3TQYA 1Y1WG 1BNZA 3NTIA 1IYVA 1IYJB 2RVLA 1XPUA 5CV7A 5LMUL 4ID6A 4PMCA 3M7NA 1HXYD 1YNJD 3OIQA 4A3GB 4ILWA 2NBFA 1K8GA 2F0IA 1GUSA 3VDYA 5IT9E 4DU9A 1VF5C 1SJED 3D0FA 3D31A 3CCLA 1CSPA 4RCOA 3CCQA 1WTVA 4YCWA 1DXMA 2ATWA 3CW2C 4NB3A 3BVMA 1LTGD 1YHBA 4ZAIA 4A3JB 1HNWL 2RBMA 3DWQA 4PZ6A 3JAMi 1TWFB 3N52A 3P7JA 3JAME 2R93B 5EBDA 4GOPA 1MJEA 3S14B 4K2LA 1ILPA 4DR3L 1SE4A 2F0MA 1SFOH 4A3MH 2CH4A 3AQQA 5EBCA 1HZBA 4LF5L 1PH7A 3PIPA 2PZWA 1JQYD 2Z4IA 2JXMB 4J8QA 1HPCA 3E6ZX 3E0EA 1YNND 3RNUA 4IO9A 1TY2A 2IWHA 4DNTB 5NUCA 3H0GG 1M8AA 3J7AF 1D5XC 1ZEQX 1ESFA 4QQBX 3SGIA 1XMOQ 1Y1WB 3QIAA 2F0HA 4UP7A 2LSSA 5E4XA 2K5NA 4DR6L 1AH9A 5JEAH 1D1KA 5K36G 1V1OA 3C2PA 1HUMA 1VQ9A 1PH2A 1FYCA 3KLSA 3S2DH 2M9VA 2O4XA 2V4DA 1LTBD 3A8IE 1PH9A 3MXNB 4N8X1 1W3SA 3G4SA 1QVCA 2HDLA 5EAYA 2TMPA 1D7QA 2VNUD 2NN6I 5FLMH 4FDBA 5M5XB 3RZOB 4R9WA 3VR2A 3CKIB 3GTKB 4KTAA 1PH3A 3EA6A 4B08A 1U9RA 1B8AA 4A3BH 4DV4Q 4GKKQ 1W6KA 2L12A 4Z9CB 3SDZA 3ZJYC 4GNXB 2RF4A 4CKCA 3M4QA 3W5OA 1K0SA 3WDNA 3HKZG 3HOVH 5M3FG 2UXDL 4YCVA 3NBHA 2LMCB 1A3UA 2EY1A 3H0GB 1Y1WH 5JPMC 3FKIG 2SNSA 3IFTA 2BDNA 1I94Q 2F3WA 3S17B 4EGVA 4PNYA 5C3EG 4G7ZC 1VQKA 2LFNA 2K5HA 2JEAI 2A74C 2WP8J 2D0OA 3QR8A 5IP9G 2HQLA 4WJWA 4WFN3 2KVMA 5ELOA 1DD2A 3EROA 1YEZA 1HNXL 2AMCB 2DNCA 2B8GA 2WKCA 1N34Q 4RKBA 1HFNA 1W6JA 1KQSA 1O80A 5JVH3 1IXRA 2VQFL 2KUMA 3KBGA 5KYIA 1F9RA 5DAUA 1EIFA 3DWAA 4IPHA 3H09A 3HOWH 2YTVA 1B1ZA 4DV1L 1IBML 3LX0A 1NCVA 4P72A 4JI2Q 2NN6H 3J80c 2K6AA 3L0OA 4KI0A 4QL5A 4JYAQ 2IL8A 3UE0A 2R3ZA 3SHLA 1MGSA 3HKZB 3J81i 2E2JB 5M3FB 2DY7A 1UUPA 4DXFA 2K1BA 4DR7L 4AH6A 4BY7H 1KABA 2ICEC 1EOVA 2HHHQ 5CV4A 3TZUA 2KHJA 5C3EB 2IT1A 5K36H 2EDGA 2Z6BA 1PTOB 4GLXA 4OWWB 4POFA 2O5IC 2A68C 4FVMA 4EQ5A 3PUZA 4DV0Q 5CV9A 1EOTA 1KLUD 2EOTA 1J5EL 1Q86C 1E22A 4KV6A 5C4JB 3RD4A 4WJ3M 4GZYC 4BBSH 4R4QA 2DY8A 1M4VA 3V05A 3C46A 2DGYA 3BG3A 1I6HH 2E5LL 5GADC 1SR3A 3J81c 2FXQA 1B53A 1PDQA 3MXNA 4X64Q 3RLNA 2BCOA 3MZ5A 3KJPA 3F2BA 3A74A 1IW7C 4A3IG 1OTCA 1CHQD 1PH5A 3RR5A 3MC0B 4FNFA 4C3JG 1ET9A 1Z6HA 3EVQA 3CRKC 1CKNB 2R7DA 2FHTA 1IKMA 2E2JH 5J39A 5IYDG 4BA1I 2MFIA 4PMBA 2PNHA 3T1YQ 2E2HH 3CRLC 3LWUA 2F0GA 5IODA 4GNXA 3FKIH 1XNRQ 3VR4A 3WOEA 4DUZL 4C1NI 2P5ZX 4KD4A 4DK3C 1HZCA 5CBEE 1KNAA 2L5TA 1GKHA 5KNBA 3CCEA 1NMFA 1SRUA 3AU7A 1LT4D 3GTLH 4KN7C 3NWTA 4HCSA 4HIOA 1TR5A 2K04A 4LF4L 3K5NA 4JBJA 1U4LA 2B63H 3HGBA 1QWYA 2ID0A 3OIPA 1H9SB 1JORA 3VR5A 3VR6A 1K8MA 3J81j 3L2PA 4RH6A 4LF9Q 1BUVT 4LFAL 4IPCA 2L11A 1E0BA 2J7ZA 1UE6A 4NXMQ 2VUMH 1RKNA 4DV6L 1QZGA 2K5VA 4B3SQ 4OX9Q 4KY5A 2OQKA 1WI5A 1XNQL 4CJ2C 1PV4A 3I4NH 2OTLA 5BR8Q 2HD3A 3ERQA 4C3JB 1TWHH 5EQ0A 4I7AA 1CA6A 4P71A 1G2TA 2SNMA 5IP7H 4PMWA 4ZCKA 1UNSA 2R7FA 3KLWA 1KDBA 4B3TQ 5C3XA 5HGTA 1HA6A 5IGGA 2NZHA 2AHOB 2BH8A 4KJNA 1YHQA 3IFDA 1UEBA 2ZM6L 3ND8A 1PYBA 4IZ8A 2UXCL 2HCIA 1FJGL 4A75A 3NK9A 1I4RA 3QG1A 4H13C 4AYBG 2K4KA 1KC8C 2PPBC 2KJXA 3S2HH 1R9TB 3U9SA 1A63A 2F0WA 3NQTA 3S9WA 4DGZA 4A3KB 5DEHA 3S16H 1PTOC 2HCCA 4IQZA 4JBMA 1QNUA 1OXXK 1TWAH 4M1UB 2Y0SE 4I7ZC 4CKBA 4R4TA 2K75A 3D4WA 2L9HA 3H94A 2XRQD 3HG9A 4LFBL 4NW2A 2PMZE 1F9QA 3ZYYX 3K6OA 4U68A 1QZHA 1JJGA 4A3IH 1SJHD 3MFYA 2F3VA 5K5PA 3MWYW 4DF7A 2OF1A 3C1EA 4ZKBB 2JA5G 2OXPA 2WB1E 1KAAA 1MD2D 2ZJRA 2PI2A 2QF7A 3I4OA 3S15H 1CKNA 1DM0B 2Z9HA 3G71A 4P75A 1BCPF 4NPSA 1XXGA 2EXZA 2UU9Q 1LYLA 3FPPA 2F0PA 3KFUA 4TVAB 3PIOA 1NTGA 2O5JC 2G9HD 3NTKA 3F2DA 1GO3E 3PO3G 5EKLA 1RTOA 4AYBB 5GAEC 1VQ8A 4R8IA 1LABA 1R4QB 4R4OA 5C0XG 4A3DH 2B3GA 4KHPL 3DHQA 2G5DA 4LFCL 5I9PA 2C35B 3NP8A 1LACA 3T4AC 2Q2UA 2WB1G 4JVZA 1H9SA 1DONA 1FGUA 5FO9B 4UY8C 1LTID 1B2TA 1H9RA 3F2CA 1KAWA 3W3AA 1SNCA 5JOBA 1HNZQ 4RWSC 1SNMA 1HQRD 3D6WA 1HHVA 5E4WC 4JOIA 2KCMA 2JA5B 1EWHA 4MHEA 2Z4HA 1TQOA 2UUBQ 3T13A 3TSSA 4JI1Q 1PA6A 2JYOA 1SNPA 2MPMA 4HEDA 2V1CC 1G291 1YNJC 4UDUC 1F2LA 1WJJA 3VYSA 2JA6H 2H1EA 5DM73 5C0XI 1EUJA 1U0LA 2A19A 4K5XA 4BWGB 1UWVA 1PRTD 3PO3B 2XWBB 2Y0SB 3PV0A 5FLXL 4BS9A 4HIDA 1DOLA 1ENCA 1EWIA 1PXUA 1U5KA 1SXTA 4KHVA 3DXJC 2CQOA 2B2UC 2XNAC 4OELB 4JI6Q 4G7OC 2PW7A 4CHTB 4A3FB 4S3SA 1I4GA 3G6JB 4HAEA 1SMYD 3A56A 3NQIA 3S1RH 1D5ZC 1RIPA 5T1IA 2QCPX 3CPWA 2IW3A 2WB1B 4JI0Q 2R7ZB 2ICIA 3J7A5 5EPLA 1XMOL 3GTMH 5ISRA 4P2CB 3H3VI 1YNNC 1TKWB 4OHJA 1HTLD 5IGEA 3GD7A 2ZJPA 1NBWA 4QCLA 4G57A 2K03A 3U50C 4A3MG 1HZAA 2PYKA 4FO2A 1VQCA 3M3YH 4K5VA 4WORA 3GP7A 3BDOA 4H44C 4GKJQ 2N8NA 3DM3A 3RZDB 1MHWC 1LTLA 3MVVA 4Y7NH 1ASYA 1OXTA 3GDEA 3SK8A 3J7YW 1PLFA 1LT3D 1OXUA 3QOJA 2NTSA 3T16A 4OWXB 3NXWA 1N33Q 3JC66 5KRUA 5JEAG 2N49A 4DV4L 2GN5A 5GAHC 2L1BA 3E0JA 2OWOA 2Z1CA 2A8VA 4EQOA 1X3EA 1XPRA 4A3LH 2NYZD 3DUZA 1ILQA 1U4PA 3CD6A 1I4HA 4YY3L 2XVSA 2A5HA 4N9PA 4DR4Q 3K5OA 1VQPA 2EYJA 4DFAA 1I94L 2N55A 4YHHQ 1B44D 3K0YA 5FLMG 1XJVA 4IN3A 4ALPA 1K3BC 3R3OA 1GXDC 1T5XD 2PQAB 1PZID 1SFOB 1L0YB 4A3MB 4HMJA 3NBHB 5CC4A 2Z0SA 2HDMA 4IOCA 3H3VH 1Q1BA 1N34L 3EBEA 4LMQD 2VQEQ 2K52A 1YJNA 3ULPA 3BYTB 3HOVG 2K50A 2PNRC 4QUFA 4OIJA 4DV5Q 3GTOH 1L0XB 3FDTA 1Q8KA 2OCEA 5C44H 1EFWA 2DN8A 4RGTA 2CHBD 4J6HA 2EYHA 2A1AA 4JI2L 2EJGC 4R8NA 2KECA 2IX3A 3DWPA 1NY4A 5C4ZA 2UUCQ 1PHJA 3HOYH 3OWEB 2JA8G 1QUQA 4DAYB 4JI5L 5A2QE 3S2DB 2E2DC 3H6MA 5ELEA 1AN8A 1SBBB 4P74A 3PIP3 2XIWA 1LT5D 4FF2A 1STEA 4JG2A 4WRDA 1D2BA 2LY7A 5JVG3 3AFQA 2HHHL 3M4OB 2YTXA 1VDZA 1XTDA 3M4YA 3HOWG 3TN2A 4FF4A 1AE2A 2WAQG 2XN9C 1BKBA 5AFWA 4DV0L 5T1GA 4GOPC 1ASZA 4LF7Q 4A3BB 2NN6G 1PH6A 5IE8A 2ZT9C 4A3EH 1H9KA 4A3CH 3IRBA 3HOVB 1ZKOA 4MNOA 1UEAB 2ZTEA 1I3QH 1LTSD 4DV7Q 4BY7G 1X54A 3K7AB 5G3LD 3LGJA 3EJIA 3NTHA 1YNXA 4X3TA 5FOBB 3HKZE 1EU3A 4J15A 3OHXC 4JPBW 4XTCS 5I6YA 3A0JA 1WCMH 1PYSB 2EPBA 3BZDB 4UP9A 1IHZA 2A6HD 5C0XJ 1LO5D 2ZJQA 4IUTA 4AQYQ 3CU7A 2KA7A 4KHZA 4BY1B 3ONAB 3V2TA 1LLRD 4KN4C 4APVA 4BBSG 4CDDC 4GN5A 1XNRL 4XIGS 3A8KE 3V96A 1ESRA 1B3QA 1EIHA 4OO1H 1AP0A 3K81C 3SEBA 4HN7A 3D6CA 1H9MA 2R61A 3RN2A 4QF4A 3K7UC 3UI2A 1XMQQ 4JI3Q 3HOWB 4DUYQ 1WTXA 2B2YA 1YHAA 1X3GA 3MXGA 1K28A 4X3KA 2WAQB 4DR1Q 1Z47A 4JI7Q 2ZTCA 2MGSA 3HZXA 2EYMA 2NVXH 3VYRA 1TU2B 2B2YC 2PQAA 4O1NA 2Q8IB 3Q22A 2IX1A 1GJXA 1RDPD 1PFNA 3I3CA 4RAUC 1VQ4A 2AKWB 2K14A 1JC7A 2EYPA 2F0VA 3CHBD 4MTKA 3S1MH 3K7AH 2JJQA 2PI2E 4BY7B 2F0UA 1HH2P 1UE1A 3EN2A 1WTPA 1EYGA 3M4PA 1B70B 2AUKA 3J80i 4OX9L 4HCEA 1JWSD 1CK1A 2PQEA 3J80E 5BR8L 1F77A 2JA8H 1C8CA 1VQEA 3MFGA 3BVZA 4JV5Q 2I46A 1PZKD 4KY7A 3CCJA 2B63G 3VR3A 4DAYA 1I4QA 4BBSB 1C9OA 4FXGC 4BBRH 1J9OA 4NDXA 4X66Q 4TSSA 1NNXA 4YWKA 5IYBH 3H91A 1I6HB 1E3PA 2QDBA 4X3SA 4GN4B 1PRTB 1TXYA 3KUPA 4DR2Q 4CBVA 2VUMG 4N8FA 2IX0A 1IYUA 4FYDA 2K5QA 5E3FA 3M7GA 3TS0A 3I4NG 2F0OA 2BOSA 1TS2A 5BN5A 5IT9L 4KKUA 3QB3A 1G2SA 3A55A 2IHFA 2O2LD 1XTCD 5IP7G 3I2ZA 2F4VQ 4XQJA 4IURA 4ZYSA 1WTQA 1WYDA 3J81E 2VB2X 5A35A 2E2HB 1J8IA 4QIWB 1KL9A 3BZCA 5LMUQ 1MSHA 4DK0A 3FKIB 3JAML 1K73C 2RCNA 2J0TD 1SYGA 1QCBD 4XDXA 3D4DA 3GV6A 1CTMA 4B3ML 2CFMA 1YJWA 1PFSA 5JEAJ 1HA5A 5AJ3L 3F8TA 2AQ3B 3GTLB 1B3AA 3LNNA 3K80C 1EIYB 4RFBA 1WOCA 5FJ8H 2BE5D 2WKDA 2ZXOA 3A7LA 2Q2TA 4JI4Q 1WD0A 4EVOA 4RHSA 1O7IA 1HNWQ 2B63B 4DKAC 1GHJA 1ENFA 4PV1C 1BBXC 1LM0A 3NWSA 2UU9L 3CC2A 4C1NK 2D2CC 1IBKL 5C5MA 2F4IA 1K83H 2QGQA 1Y1VG 1KRTA 2VUMB 4DV3L 1NJIC 1X9NA 2JEBI 1G8ZD 3I4MG 3J7ZC 4BXXH 3I4NB 1KTKA 5BN4A 3ULJA 1N36Q 1NE3A 1TWHB 4L5QA 1RHPA 1JE5A 1JOQA 1VMPA 4DAMA 2HT1A 4PZ7A 5IGBA 1SYDA 5IWAL 1EYDA 4DR6Q 2JA9A 3I7FA 3DEOA 3DMUA 4GNXC 5CR3A 1QOHA 1HNZL 4C3HH 1ICWA 3U4ZA 4X6AH 3ND9A 2EXDA 2ZXPA 4ZUIA 1BCPD 3TRZA 3S2HB 3VA5A 1FNUA 2ALYB 2EY6A 3NBIA 3B6YA 4XXEA 1VQ6A 3ICEA 1Y8PB 4JI1L 4A3DG 1VMCA 1O7ZA 1V1QA 1S5FD 3S16B 3I70A 4LNQA 3HOUG 4AYBE 1WTOA 1TWAB 1BDOA 4CJ0B 1GUNA 4POGA 4QY7A 1CA5A 1YI2A 4I65A 2F0EA 1CSQA 3SK5A 3HOXH 1M90C 3QO2A 2GVAA 2C9OA 4Q0FA 3S24A 3K59A 4A3IB 5LMNQ 1EYCA 4KK7A 3PUXA 2ASBA 3G7LA 1G51A 4AIMA 2AQ2B 3RN5A 3T1HL 4L63B 2JK8A 1KIXA 1AFPA 2F1MA 4O42A 1VQMA 1EQQA 2AUJD 5EGTA 1PRTC 4UAIA 5IOCA 3RUZA 5TSSA 3GTJH 3GQBA 3S1QH 4GLAC 1VQBA 3S15B 2F0KA 1JB7A 1VS0A 4JC0A 2IY5B 3BZKA 3CCVA 2KCNA 4JI0L 1AE3A 1R4PB 4IALA 2QEJC 4UPAA 1S4ZA 4A93G 3NENA 2JA6G 4IFDH 1SMYC 2DUDA 4F8MA 2FFKB 4L8JA 1STNA 3MEFA 5I9OA 1HNXQ 3HOZG 2Z6KA 1DJRD 3NEMA 1CT1D 1NAPA 1QG7A 2CW0D 3A54A 2L0CA 5J1ZA 2JSOA 1GVPA 1K3RA 3OTOQ 2EY5A 4A3DB 3ULLA 2E75C 4C3IG 4YWMA 3R2IA 1Q90A 3C3LA 4HIMA 4DV1Q 4CDEC 5DM63 1TWGH 1I5FA 3VA7A 1Y1VH 1I50H 2E8GA 3P75A 2EYLA 3BDCA 4NMZA 1F9SA 3CCSA 1N33L 4KKTA 4QJFA 2MNAA 2K32A 3I4MH 5FLXc 3PIO3 4K14A 3CCRA 2HIVA 1EY7A 1VQIA 2YV5A 4XT1B 4EQNA 2YU9H 5M3MH 4LF8L 2NTTA 2A68D 2B2TA 5HY6A 1X3FA 4HR7B 3R2TA 4IJHA 3FEWX 1AZQA 4DR4L 2BH2A 1Q1EA 2B2TC 4GLVB 3I56A 1VQNA 4YHHL 2PZTA 5C4XG 4ULLA 4XQQA 2JA6B 2LXJA 2BDOA 3IAYA 2NVYH 3A5UA 3C1FA 4ME3A 4CKEA 3DEPA 4ZK9B 1SE8A 4LF6L 3Q6SA 1IBLL 1II3A 1PZJD 2D0PA 4DN4M 4X65Q 3EIVA 2VL6A 2E5LQ 2VQEL 1VQAA 3TZDA 3G6EA 3FP9A 3HOUH 1F2YA 4A3LG 1D1IA 4C3IB 2XTIA 2A69D 1S5BD 1H9JA 4KD3A 2Q8TA 3CC7A 1X3QA 3S1RB 2X6GA 4HJ8A 2B8FA 2MJ8A 5CORA 3I90A 1F2MA 2FMMA 3HKSA 2K33A 2N3SA 1IZ6A 2ES2A 3GTMB 1JICA 4ZUJA 4K6LA 1K0RA 1MIUA 2UUCL 1KHIA 3FVQA 1S5ED 2CH4W 2BA1A 1Q81C 4IPDA 2PW5A 3WWVA 1MI2A 3M3YB 4JOIC 4X62Q 4BY1G 1VQHA 2MP1A 1N32Q 3STBD 1Q8IA 1LTRD 1U4MA 1L1OB 4XT3B 4A93H 3MTSA 1HR0Q 2CVRA 3K0XA 2QEXA 1OXVA 2VY3A 1C48A 4Y7NB 4ME5A 1S5CD 4F7XA 3Q23A 4DA2A 5C44G 2E2IH 4OONA 2NZ1D 1QUQB 3J7AV 3Q24A 1A2UA 1V1PB 3AFPA 3HOZH 5FO8B 2HUGA 4DK6C 2DJFC 4P73A 1YZ6A 3PUYA 1JT8A 4HJ7A 3TDQA 4WJ4A 1JWUD 3QJYA 4OEMB 3HOYG 1FVIA 3PF4A 3HFZB 4HSPA 4C3IH 1RF2D 3G48A 4ZKCB 3GTPH 1O78A 3GV3A 5EKIA 1SE2A 3SXHA 4KKSA 2F0SA 4DV7L 1CHPD 5HURA 1F9PA 2KQ3A 3H15A 4ZLTF 1XNQQ 2F3IA 5IYCH 2PCFB 3GTQB 4YWLA 1EWCA 1X6OA 4Y52H 3OPOA 3U4VA 2JA7G 2NZOA 1S40A 2CCZA 3WOFA 3BDLA 2NVQH 3CCUA 1EFID 1HZ9A 1S5DD 3KJOA 1NSNS 2Q8RE 5EPJA 3P20A 4A3EG 3TP6A 2I5MX 3BU2A 2ZM6Q 4MN3A 4L5RC 1NR4A 2MQHA 2XWJB 1X56A 4A3CG 1E24A 3FMCA 1BBUA 1FJGQ 1TIID 2A6HC 1MJCA 1BVSA 5C4XH 4GN3B 3I8ZA 3GTOB 3Q0AA 4FXDA 1XMQL 3KLRA 5C44B 3A8JE 1QVGA 5GROA 4DUYL 1E2VA 3HP3A 4DR1L 2EE1A 4DAPA 3PGZA 1JMCA 2K28A 1VCIA 1TS4A 5M5YH 4GKKL 1WCMG 2RHQB 2K01A 1EQTA 1JJ2A 3HOYB 1B4OA 3CXCA 1NUCA 4B3RQ 1X65A 4HSVA 1X3PA 1UAPA 1FR3A 1CM9A 3FPUB 3DM1A 1HTPA 1EEID 4NP5A 2RKSA 1B50A 4JI8Q 3K57A 4HMIA 1G6ZA 2XGTA 1EQRA 2R92H 4L5SA 4K0KQ 4C2MH 1EZ6A 3GTQH 4XYOA 1EYAA 3TS2A 4OO1G 3CQZH 4A3GG 3R93A 3RLFA 3KOJA 3X3MA 1BCPB 4HIKA 1O7YA 3CP0A 4K8IA 1KNEA 4MZ9A 4BY1H 3S1NH 4H0LC 1MBYA 4Q5VA 1P16A 1SSOA 4A3JG 2EZVA 3NSWA 4X3UA 4A3EB 5I2YA 1TS3A 1V9PA 4H7BA 4X66L 3BVGA 4K8JA 3TP8A 2WAQE 2IHEA 2D62A 4O0AA 1I3QB 3ER0A 1EY9A 2NUCA 1L1OA 2OQ0A 4DXGA 3M9BA 3PUVA 1CQFA 1OXSC 1S3OA 1YBYA 4YCUA 1L1OC 1J6QA 2RSOA 1A2TA 1JWMD 5D3IB 1WCMB 1V1PA 3GTGH 2K5DA 4JYAL 1XWEA 4MIUA 1EZ8A 1BO0A 4OO1I 4NXNQ 2LKVA 4JK1C 4J1MA 3A5ZB 3ERSX 1SROA 3RLOA 1WD1A 2F0NA 4BBRG 1SDFA 2YTYA 5IYBG 3PCOB 2NVTH 3DLLA 1QJOA 3CCMA 2JA7H 4DR5Q 1CQVA 2Q2HA 1XX8A 5LMNW 2X6LA 1E2ZA 5J22A 1QILA 1GUOA 2Z8LA 1A6XA 2RDFA 1PTOF 1CZGA 1UE5A 4LW1A 1SNDA 2OTJA 2A6ED 2NVXB 3NPPA 4JI4L 4LJZC 1KDCA 1BQQT 3SVMA 1STAA 3UDGA 3D4RA 1Z7TA 3D8GA 2IPKD 4PG3A 4OIKA 2JQOA 1JB3A 2BE5C 2EY2A 3OYYA 3S1MB 1TY0A 4X64L 5CV5A 5I2XA 3PMFA 3PF5A 1EY4A 1FNVA 1SNQA 3H3VC 3F2UA 4H02A 4RCNA 1TT2A 2MUYA 4KJOA 1B9MA 3R8BA 1Y69U 2KHIA 5KGUA 4QIWE 5D14A 1A8VA 2WIIB 3SK6A 1V43A 1N36L 2JA8B 5IT9c 1BOSA 5FJ8G 5LHY1 1TWCH 1B9NA 2EYFA 3T1YL 4DNRB 4ZQ3A 5JJIA 4PZ8A 2NWGA 3E5SA 3K5LA 3PO2G 2UUAQ 4BBRB 1WTRA 3CF5A 3JAMc 3SK4A 1MSGA 2CWAA 2JE6I 4A3GH 1P8LA 5EPKA 1JE4A 1Q7YC 2L15A 1HUNA 1CFMA 2NB0A 3UDXA 2UXBQ 5ELCA 3AB9A 1YVCA 2WFWA 3I73A 2H5XA 4DK1A 4BXXG 4A3JH 1PMRA 4KLKA 3MHBA 4ABNA 5JJKA 2YYZA 2QKIC 1TWFH 2L4NA 2ZXRA 4L6TB 2R93H 2OEOA 4LF9L 2CKZB 1BCPC 3MXUA 3S14H 1E1OA 1FNWA 2RDGA 1HFGA 1NR2A 1N9WA 2EJMA 1BR9A 3TP5A 4TKOB 4QGUA 1GOZA 4NXML 3FRPB 1XYIA 1QNKA 2QW7A 4L5TA 4B3SL 2DNEA 5LMNL 4C3HG 3PQIA 2ENBA 4HJ9A 1L0WA 5IGFA 5GAGC 2KCCA 4YY3Q 2SDFA 4B3TL 3PUWA 3KF6B 3KLSX 1KDAA 3Q8DA 1STHA 3IL8A 1STYA 2F0DA 2FMCA 4UHVA 3PO2B 2KOLA 4N9TA 1ZYRD 4MTNA 4DV2Q 1CUKA 2AWOA 1OO9B 2QDLA 1A3VA 1VQGA 1YITA 1K83B 3HOXG 1EY5A 1C4QA 4DNIA 5CV6A 1EY6A 5A2QL 1D8LA 2AQ1B 3OTOL 5E1FA 1T5EA 5I6WA 1BBWA 3N6RA 2Q2IA 1D6EC 5M5XH 3RZOH 3I91A 1Q46A 3OSOA 1SLJA 2KBNA 3GTKH 1EIGA 1HR0W 1HCZA 2CW0C 4RGMA 2RCFA 2XRSD 1G91A 1A15A 1RD9D 4JCVE 1ML0D 1KRSA 1F2ZA 1RL2A 5KYLA 5G3LF 3OMGA 4IFDG 5C5LA 3K5MA 5JJLA 4ZRZA 4C3HB 4JI5Q 1Q12A 1H95A 1SAPA 4IUVA 2EJFC 2F0QA 1AEXA 5DLQE 3H0GH 2GA4B 1HJPA 3FHWA 1CKOA 3D3RA 5L37A 3F1ZA 1EEFD 3S17H 2EQSA 3PO2H 4RGNA 4EQPA 2FINB 4XYQA 5D3DA 4DR3Q 1VQDA 2QILA 2TSSA 1S72A 3I55A 4LF5Q 4DPGA 5KEEA 3HOXB 1LTAD 3RMHA 3L3OC 1XPOA 3OW7A 1KLGD 2N78A 1L2FA 1FD7D 4OXPA 1AW7A 2KEEA 3AEVA 2I5HA 3TP7A 2A73B 1V8QA 4X65L 1QE6A 2KENA 5M3MG 5ELNA 4IFDI 4RGOS 1GD7A 3UE1A 3GTJB 1CI3M 3S1QB 1PFBA 2K05A 1JOKA 4E6IA 2RSNA 4ODGA 1U4RA 3QWNA 3BYYB 4LUZA 1A0IA 3UDFA 1JOOA 1A62A 1D5MC 1STBA 1X32A 3L9AX 4PQXA 2F03A 3KF8B 2A69C 1ONLA 1LTTD 1WTHA 3MA2B 1RCVD 1BXTA 5M3FH 4JBKA 1VQLA 2CQAA 4C56C 5CBAE 4IUQA 1Y8OB 2H4OA 1VQOA 3URYA 5C4HA 4X62L 2UUBL 3TMEA 1N32L 4RKLA 5C3EH 1ZXTA 3NHHA 4NKLA 2F0FA 5FO7B 2L55A 4JW0A 1PTOH 1HR0L 2EVBA 1PYWD 3CC4A 3VYTA 2EYOA 5IP9H 3KF6A 2I07B 2J4XA 1CZWA 3MAQA 2VS1A 1TWGB 1QVFA 2ZTDA 4OGQC 3J80L 4RG1A 1Y1VB 3KDFB 1I50B 3STBC 3W2DA 5C4JH 4A3KG 1E1TA 3I4MB 1MKHA 5ELDA 4IJLA 1GHKA 4JI6L 2UXDQ 3T51B 3NUCA 5EJWA 3T56B 2MO0A 5COYA 4IOAA 5HGQA 3ITPA 3HS0C 2YU9B 1ENAA 5M3MB 2KCTA 5EKKA 5KNCA 2HIXA 3A7AB 2JP1A 3SR1A 2N88A 3KK7A 2VXWA 5ELFA 4K5WA 4V0BA 3BS1A 5CGKA 1DOKA 1VQJA 2SOBA 1FGBD 1SE3A 4FXKC 5FLXE 3I72A 1SYEA 2NVYB 5I4DA 4JBWA 2MHVA 4KY6A 4IUPA 4A76A 3OW2A 1SYCA 3K8AA 4F87A 2VB3X 4GKJL 2Z6KC 5C6AA 1C7YA 3QOLA 2VQFQ 3J81L 2LXKA 1IL8A 1SN8A 3HOUB 5IY0A 3HRZC 1IL2A 2X69A 2LS01 1HRJA 5FK9C 1IBMQ 2R6GA 3EFXD 2PZUA 3KBXA 1WTWA 5F2DA 2QA4A 5IYCG 2K7VA 5JAVA 1EQVA 1Y14B 3CAMA 3U58A 3TREA 1M1KC 4LWCA 5LL6S 3TEHB 5JJZA 4DR7Q 4B3RL 1RTNA 2B2VA 4IUNA 1VQFA 3PSIA 3O13A 5J3BA 3GO5A 2VZAA 1KXLA 2B2VC 2M2LA 4JI8L 4BA2I 5IGDA 4OWTB 2C5CA 5CMDA 2PO4A 4K0KL 4A93B 4B3MQ 1GUWA 5AJ3Q 4C3JH 2DJGC 2RQXA 4HJ5A 1RODA 2E2IB 1ET6A 5IYDH 2SEBD 1J5EQ 4QUCA 3HOZB 4QB4A 4FF3A 3KF8A 1CKMA 5KIXA 5H1SE 2MO1A 1IW7D 4DAVA 2GVBA 4V190 1YJ9A 1A3TA 1IBKQ 1EY8A 3GTPB 4DV5L 4LUOA 2Y0SG 4DV3Q 5CYUA 4K6DA 1R9TH 2JN4A 2R92G 2I0QA 3NE5B 4M8AA 1G6PA 2AWNA 3E9IA 3M85A 1O7LA 4A3KH 4A3FG 4CJ1B 4XQNA 1RJTA 3W1BA 4G4KA 3KDFA 4RHRA 5BN3A 5LL6X 1PVOA 1JCKB 2K5WA 4R1JA 2NVQB 4NXNL 5IWAQ 5CV8A 2R7ZG 4DUZQ 2D9UA 1QB5D 4B9XA 4EX5A 2M00A 4K2KA 1KD1C 4FP5D 5C4XB 2VW9A 4DR5L 4IFDJ 1LT6D 4R4CA 1E2WA 4LF4Q 1PH8A 1TVXA 4R4IA 5GQOA 2F0JA 3MXPA 5E7NA 4FF1A 4LF7L 3UDIA 1JJCB 5M5YB 3SE0A 1ICFB 4RMFA 2RDHA 3T53B 1DOMA 5IIFA 4LFAQ 2B39A 4OL7A 3BJUA 2KHSA 2EIFA 2F0TA 2WACA 1GUGA 3L7ZC 4HJAA 2WV6D 3P1HA 4IPGA 2A6EC 4DV6Q 2B2UA 1PH1A 1PH4A 1K8AC 3AMUA 1STGA 2G9DA 2R92B 3NELA 3CMAA 1X55A 4C2MB 2FJ2A 1VQ7A 1DGSA 4F88A 3HEJA 1N8RC 3T1HQ 3OWFA 2PMZB 1LV9A 3CQZB 1Q82C 1B7YB 2E76C 2B2WA 5M5WB 2IJ0A 1SMXA 3E9HA 4AQYL 1K8OA 3OOCA 2B2WC 4GOPB 3S1NB
chains in the Genus database with same CATH topology
1EU4A 1EL0A 5M9OA 5FKAC 5C3WA 1SEBD 1PTOD 1TS5A 1I4XA 3X3NA 1DYQA 3I4LA 4KMUC 1EY0A 1WVLA 3GTGB 2BA0A 2HQEA 4YIJA 1IKLA 1SYFA 5D65A 4HTHA 5DNFA 1DCZA 4TRDA 4G7HC 2WINB 3MEHA 2OT2A 4RA8A 3IKJA 2NVTB 5C0XH 3VYUA 2JA7B 1SYBA 1DZ1A 1I6VC 1VF7A 3TBIB 2RA4A 3LWEA 2E74C 3EQLC 1PFMA 4LK1C 2F0LA 5IGCA 2D5DA 1BF4A 1GUTA 4QMGA 3K58A 4IUUA 4LAAA 4U673 5JPNC 4B9WA 1Q3LA 4TQUS 1PRTF 5ELBA 1Y8NB 1ZYRC 1I4PA 2XSCA 3OMCA 3U9OA 1JR0D 4CGYB 1SNOA 1HQMC 2KEDA 1AZPA 5KNDA 1TWCB 1BNZA 1IYVA 3NTIA 2RVLA 5CV7A 4ID6A 4PMCA 3M7NA 1HXYD 1YNJD 3OIQA 4A3GB 4ILWA 2NBFA 2F0IA 1GUSA 5IT9E 4DU9A 1VF5C 1SJED 3D31A 4RCOA 1WTVA 1DXMA 3BVMA 1LTGD 4ZAIA 4A3JB 2RBMA 3DWQA 1TWFB 3N52A 3P7JA 3JAME 2R93B 5EBDA 3S14B 4K2LA 1ILPA 1SE4A 2F0MA 5EBCA 2PZWA 1JQYD 2Z4IA 2JXMB 4J8QA 1HPCA 3E6ZX 1YNND 1TY2A 2IWHA 4DNTB 5NUCA 1M8AA 3J7AF 1D5XC 1ZEQX 1ESFA 1Y1WB 3QIAA 2F0HA 5E4XA 5JEAH 1D1KA 5K36G 1V1OA 3C2PA 1HUMA 1FYCA 3KLSA 2M9VA 2O4XA 2V4DA 1LTBD 3A8IE 2HDLA 2TMPA 2VNUD 2NN6I 5M5XB 3RZOB 4R9WA 3VR2A 3CKIB 3GTKB 4KTAA 3EA6A 4B08A 1U9RA 1W6KA 2L12A 3SDZA 4CKCA 3WDNA 3NBHA 2LMCB 1A3UA 2EY1A 3H0GB 5JPMC 2SNSA 3IFTA 2BDNA 2F3WA 3S17B 4EGVA 4PNYA 4G7ZC 2LFNA 2JEAI 2A74C 2WP8J 4WJWA 4WFN3 2KVMA 1DD2A 3EROA 2DNCA 2B8GA 2WKCA 1HFNA 4RKBA 1W6JA 1O80A 5JVH3 2KUMA 3KBGA 5KYIA 1F9RA 5DAUA 3DWAA 3H09A 1B1ZA 3LX0A 1NCVA 2NN6H 2K6AA 4KI0A 2IL8A 2R3ZA 3SHLA 1MGSA 3HKZB 2E2JB 5M3FB 2DY7A 1UUPA 4DXFA 2K1BA 1KABA 2ICEC 5CV4A 3TZUA 5C3EB 2IT1A 5K36H 2EDGA 1PTOB 2O5IC 2A68C 4FVMA 3PUZA 5CV9A 1EOTA 1KLUD 2EOTA 4KV6A 5C4JB 3RD4A 4GZYC 2DY8A 1M4VA 3V05A 3C46A 3BG3A 3MXNA 1B53A 1PDQA 2BCOA 3MZ5A 1IW7C 1CHQD 3MC0B 4C3JG 4FNFA 1ET9A 1Z6HA 3CRKC 3EVQA 2FHTA 1IKMA 5J39A 4BA1I 4PMBA 3CRLC 3LWUA 2F0GA 5IODA 3VR4A 3WOEA 4C1NI 4KD4A 5CBEE 1KNAA 2L5TA 5KNBA 3AU7A 1LT4D 4KN7C 3NWTA 4HCSA 1TR5A 2K04A 3K5NA 1U4LA 3HGBA 1QWYA 2ID0A 3OIPA 1H9SB 1JORA 3VR5A 3VR6A 1K8MA 4RH6A 1BUVT 2L11A 1E0BA 2J7ZA 1RKNA 4KY5A 4CJ2C 3ERQA 4C3JB 5EQ0A 1CA6A 1G2TA 2SNMA 4PMWA 1UNSA 1KDBA 5C3XA 5HGTA 1HA6A 5IGGA 4KJNA 3IFDA 3ND8A 4IZ8A 2HCIA 3NK9A 1I4RA 3QG1A 4H13C 2PPBC 2KJXA 1R9TB 3U9SA 2F0WA 3NQTA 3S9WA 4DGZA 4A3KB 5DEHA 1PTOC 2HCCA 4IQZA 1QNUA 1OXXK 4M1UB 4I7ZC 4CKBA 3D4WA 2L9HA 3H94A 2XRQD 3HG9A 4NW2A 1F9QA 3ZYYX 3K6OA 4U68A 1SJHD 3MFYA 2F3VA 5K5PA 3MWYW 4DF7A 2OF1A 3C1EA 4ZKBB 2OXPA 1KAAA 1MD2D 2QF7A 1DM0B 1BCPF 1XXGA 2EXZA 3FPPA 2F0PA 2O5JC 2G9HD 3NTKA 5EKLA 1RTOA 4AYBB 4R8IA 1LABA 1R4QB 5C0XG 3DHQA 5I9PA 3NP8A 1LACA 3T4AC 1DONA 1H9SA 5FO9B 1LTID 1B2TA 1H9RA 3W3AA 1SNCA 5JOBA 4RWSC 1SNMA 1HQRD 3D6WA 1HHVA 5E4WC 2JA5B 1EWHA 4MHEA 2Z4HA 1TQOA 3T13A 3TSSA 2JYOA 1SNPA 2MPMA 4HEDA 1G291 1YNJC 4UDUC 1F2LA 3VYSA 2H1EA 5DM73 5C0XI 4K5XA 4BWGB 1PRTD 3PO3B 2XWBB 2Y0SB 3PV0A 5FLXL 4BS9A 1DOLA 1ENCA 1PXUA 1SXTA 4KHVA 3DXJC 2B2UC 2XNAC 4G7OC 2PW7A 4CHTB 4A3FB 4S3SA 1I4GA 3G6JB 4HAEA 1SMYD 3A56A 3NQIA 1D5ZC 5T1IA 2QCPX 2IW3A 2WB1B 2R7ZB 2ICIA 5EPLA 5ISRA 4P2CB 1YNNC 1TKWB 4OHJA 1HTLD 5IGEA 3GD7A 4QCLA 4G57A 2K03A 2PYKA 4FO2A 4K5VA 4WORA 3GP7A 3BDOA 4H44C 3RZDB 3MVVA 1OXTA 3SK8A 3J7YW 1PLFA 1LT3D 1OXUA 3QOJA 2NTSA 3T16A 3NXWA 5KRUA 5JEAG 2L1BA 3E0JA 2Z1CA 4EQOA 2NYZD 3DUZA 1ILQA 1U4PA 1I4HA 2XVSA 2A5HA 4N9PA 3K5OA 2EYJA 4DFAA 2N55A 1B44D 3K0YA 4IN3A 3R3OA 1GXDC 1T5XD 1PZID 1SFOB 1L0YB 4A3MB 4HMJA 5CC4A 2HDMA 1Q1BA 4LMQD 3BYTB 2PNRC 4QUFA 4OIJA 1L0XB 3FDTA 2DN8A 4RGTA 2CHBD 4J6HA 2EYHA 2EJGC 4R8NA 2KECA 2IX3A 3DWPA 5C4ZA 3OWEB 5A2QE 3S2DB 2E2DC 3H6MA 5ELEA 1AN8A 1SBBB 3PIP3 2XIWA 1LT5D 4FF2A 1STEA 4WRDA 1D2BA 2LY7A 5JVG3 3M4OB 1VDZA 3M4YA 3TN2A 4FF4A 2XN9C 5AFWA 5T1GA 4A3BB 2NN6G 2ZT9C 1H9KA 3HOVB 1ZKOA 1UEAB 1LTSD 3K7AB 5G3LD 3EJIA 3NTHA 4X3TA 5FOBB 1EU3A 5I6YA 3OHXC 4XTCS 2EPBA 3BZDB 1IHZA 2A6HD 5C0XJ 1LO5D 4IUTA 3CU7A 2KA7A 4KHZA 4BY1B 3ONAB 3V2TA 1LLRD 4KN4C 4XIGS 3A8KE 3V96A 1ESRA 1EIHA 4OO1H 1AP0A 3SEBA 4HN7A 2R61A 1H9MA 3D6CA 4QF4A 3UI2A 3HOWB 1WTXA 2B2YA 3MXGA 4X3KA 2WAQB 1Z47A 2MGSA 3HZXA 2EYMA 3VYRA 1TU2B 2B2YC 4O1NA 2Q8IB 3Q22A 2IX1A 1GJXA 1RDPD 1PFNA 3I3CA 4RAUC 1JC7A 2EYPA 2F0VA 3CHBD 4BY7B 2F0UA 1WTPA 2AUKA 4HCEA 1JWSD 1CK1A 2PQEA 3J80E 1F77A 1C8CA 3MFGA 3BVZA 2I46A 1PZKD 4KY7A 3VR3A 4DAYA 1I4QA 4BBSB 4FXGC 1J9OA 4NDXA 4TSSA 3H91A 1I6HB 2QDBA 4X3SA 1PRTB 3KUPA 4CBVA 2IX0A 1IYUA 4FYDA 2K5QA 5E3FA 3M7GA 2F0OA 2BOSA 1TS2A 5BN5A 5IT9L 4KKUA 3QB3A 1G2SA 3A55A 2O2LD 1XTCD 4XQJA 4IURA 4ZYSA 1WTQA 3J81E 2VB2X 5A35A 2E2HB 1J8IA 4QIWB 1MSHA 4DK0A 3FKIB 3JAML 2J0TD 1SYGA 1QCBD 4XDXA 3D4DA 3GV6A 1CTMA 5JEAJ 1HA5A 2AQ3B 3GTLB 1B3AA 3LNNA 4RFBA 2BE5D 2WKDA 2ZXOA 3A7LA 1WD0A 4EVOA 4RHSA 2B63B 1GHJA 1ENFA 4PV1C 1BBXC 3NWSA 4C1NK 2D2CC 5C5MA 2F4IA 2VUMB 2JEBI 1G8ZD 3I4NB 1KTKA 5BN4A 1TWHB 1RHPA 1JOQA 1VMPA 5IGBA 1SYDA 1EYDA 3DEOA 3DMUA 5CR3A 1QOHA 1ICWA 3ND9A 2ZXPA 4ZUIA 1BCPD 3S2HB 3VA5A 1FNUA 2EY6A 3NBIA 4XXEA 1Y8PB 1VMCA 1O7ZA 1S5FD 3S16B 3I70A 1WTOA 1TWAB 1BDOA 4CJ0B 1GUNA 1CA5A 4I65A 2F0EA 3SK5A 3QO2A 2C9OA 4Q0FA 3K59A 4A3IB 1EYCA 4KK7A 3PUXA 3G7LA 2AQ2B 4L63B 1AFPA 2F1MA 4O42A 2AUJD 5EGTA 1PRTC 4UAIA 5IOCA 3RUZA 5TSSA 3GQBA 3S15B 2F0KA 2KCNA 1R4PB 4IALA 2QEJC 1S4ZA 4IFDH 1SMYC 4F8MA 2FFKB 4L8JA 1STNA 5I9OA 1DJRD 1NAPA 1CT1D 1QG7A 2CW0D 3A54A 2L0CA 5J1ZA 2JSOA 2EY5A 4A3DB 2E75C 4C3IG 3R2IA 1Q90A 3C3LA 5DM63 3VA7A 3P75A 2EYLA 3BDCA 4NMZA 1F9SA 4KKTA 2K32A 3PIO3 4K14A 1EY7A 4XT1B 4EQNA 2NTTA 2A68D 2B2TA 4HR7B 3R2TA 3FEWX 1AZQA 1Q1EA 2B2TC 2PZTA 4ULLA 4XQQA 2JA6B 2BDOA 3IAYA 3C1FA 4CKEA 3DEPA 4ZK9B 3Q6SA 1II3A 1PZJD 4DN4M 3TZDA 1F2YA 1D1IA 4C3IB 2A69D 1S5BD 1H9JA 4KD3A 2Q8TA 3S1RB 1X3QA 2X6GA 2B8FA 2MJ8A 5CORA 3I90A 1F2MA 2FMMA 2K33A 3GTMB 1JICA 4ZUJA 4K6LA 3FVQA 1S5ED 2BA1A 2PW5A 1MI2A 3M3YB 2MP1A 1Q8IA 1LTRD 1U4MA 4XT3B 3MTSA 2CVRA 1OXVA 1C48A 4Y7NB 4ME5A 1S5CD 4F7XA 3Q23A 4DA2A 2NZ1D 3J7AV 3Q24A 1A2UA 1V1PB 5FO8B 2HUGA 3PUYA 3TDQA 1JWUD 3QJYA 4HSPA 1RF2D 4ZKCB 1O78A 3GV3A 5EKIA 1SE2A 3SXHA 4KKSA 2F0SA 1CHPD 5HURA 1F9PA 2KQ3A 4ZLTF 2PCFB 3GTQB 1EWCA 3OPOA 3WOFA 3BDLA 1EFID 1S5DD 1NSNS 2Q8RE 5EPJA 3P20A 3TP6A 4MN3A 1NR4A 2XWJB 3FMCA 1TIID 2A6HC 3I8ZA 3GTOB 3Q0AA 4FXDA 3KLRA 5C44B 3A8JE 1E2VA 3HP3A 2EE1A 4DAPA 2K28A 1VCIA 1TS4A 2K01A 1EQTA 3HOYB 1B4OA 1NUCA 4HSVA 1X3PA 1UAPA 1FR3A 1CM9A 3FPUB 3DM1A 1HTPA 1EEID 4NP5A 2RKSA 1B50A 3K57A 4HMIA 1G6ZA 1EZ6A 4XYOA 1EYAA 4OO1G 3R93A 3RLFA 3X3MA 1BCPB 1O7YA 4K8IA 1KNEA 4H0LC 1MBYA 4Q5VA 1SSOA 2EZVA 3NSWA 4X3UA 4A3EB 5I2YA 1TS3A 4H7BA 3BVGA 4K8JA 3TP8A 2D62A 1I3QB 3OOCA 1EY9A 2NUCA 4DXGA 3PUVA 1CQFA 1OXSC 2RSOA 1A2TA 1JWMD 5D3IB 1WCMB 1V1PA 2K5DA 1XWEA 4MIUA 1EZ8A 1BO0A 4OO1I 2LKVA 4JK1C 4J1MA 1WD1A 2F0NA 1SDFA 1QJOA 1CQVA 1XX8A 2X6LA 1E2ZA 5J22A 1QILA 1GUOA 2Z8LA 1A6XA 2RDFA 1PTOF 1CZGA 1SNDA 2A6ED 2NVXB 3NPPA 4LJZC 1KDCA 1BQQT 3SVMA 1STAA 3D4RA 1Z7TA 3D8GA 2IPKD 4OIKA 1JB3A 2BE5C 2EY2A 3S1MB 1TY0A 5CV5A 5I2XA 3PMFA 1EY4A 1FNVA 1SNQA 3H3VC 3F2UA 4RCNA 1TT2A 2MUYA 4KJOA 1B9MA 3R8BA 1Y69U 5KGUA 5D14A 2WIIB 3SK6A 1V43A 2JA8B 1BOSA 5LHY1 1B9NA 2EYFA 4DNRB 4ZQ3A 2NWGA 3E5SA 3K5LA 4BBRB 1WTRA 3SK4A 1MSGA 2JE6I 5EPKA 1JE4A 1HUNA 1CFMA 2NB0A 5ELCA 3AB9A 3I73A 4DK1A 1PMRA 3MHBA 4ABNA 2YYZA 2QKIC 2L4NA 2ZXRA 4L6TB 2OEOA 1BCPC 3MXUA 1FNWA 2RDGA 1HFGA 1NR2A 2EJMA 1BR9A 3TP5A 4TKOB 1GOZA 3FRPB 1XYIA 1QNKA 2DNEA 4C3HG 2ENBA 5IGFA 2KCCA 2SDFA 3PUWA 3KLSX 1KDAA 1STHA 3IL8A 1STYA 2F0DA 2FMCA 3PO2B 2KOLA 4N9TA 1ZYRD 2AWOA 1OO9B 1A3VA 1K83B 1EY5A 1C4QA 5CV6A 1EY6A 5A2QL 2AQ1B 5E1FA 1T5EA 5I6WA 3N6RA 1D6EC 3I91A 3OSOA 1EIGA 1HCZA 2CW0C 4RGMA 2XRSD 1G91A 1A15A 1RD9D 1ML0D 1F2ZA 5KYLA 5G3LF 3OMGA 4IFDG 5C5LA 3K5MA 4ZRZA 4C3HB 1Q12A 1SAPA 4IUVA 2EJFC 2F0QA 1AEXA 2GA4B 3D3RA 1EEFD 4RGNA 4EQPA 2FINB 4XYQA 5D3DA 2QILA 2TSSA 5KEEA 3HOXB 1LTAD 3RMHA 3L3OC 3OW7A 1KLGD 1FD7D 1AW7A 2KEEA 3TP7A 2A73B 1V8QA 1QE6A 4IFDI 4RGOS 3GTJB 1CI3M 3S1QB 1PFBA 2K05A 1JOKA 4E6IA 2RSNA 4ODGA 1U4RA 3QWNA 3BYYB 1JOOA 1X32A 1D5MC 1STBA 4PQXA 3L9AX 2F03A 2A69C 1ONLA 1LTTD 3MA2B 1RCVD 1BXTA 2CQAA 4C56C 5CBAE 4IUQA 1Y8OB 2H4OA 3URYA 5C4HA 3TMEA 4RKLA 1ZXTA 3NHHA 4NKLA 2F0FA 5FO7B 2L55A 1PTOH 2EVBA 1PYWD 3VYTA 2EYOA 2I07B 2J4XA 1CZWA 3MAQA 1TWGB 4OGQC 3J80L 3W2DA 1Y1VB 1I50B 3I4MB 5ELDA 1GHKA 3T51B 3NUCA 5EJWA 3T56B 5COYA 3ITPA 3HS0C 2YU9B 1ENAA 5M3MB 5EKKA 5KNCA 3A7AB 2JP1A 3SR1A 2N88A 3KK7A 2VXWA 5ELFA 4K5WA 4V0BA 3BS1A 5CGKA 1DOKA 2SOBA 1FGBD 1SE3A 4FXKC 5FLXE 3I72A 1SYEA 2NVYB 5I4DA 4JBWA 2MHVA 4KY6A 4IUPA 1SYCA 4F87A 2VB3X 5C6AA 3QOLA 3J81L 1IL8A 3HOUB 3HRZC 2X69A 2LS01 1HRJA 5FK9C 2R6GA 3EFXD 2PZUA 3KBXA 1WTWA 5F2DA 2K7VA 5JAVA 1EQVA 5LL6S 5JJZA 1RTNA 2B2VA 4IUNA 3O13A 3GO5A 2B2VC 2M2LA 4BA2I 5IGDA 2C5CA 5CMDA 2PO4A 1GUWA 4A93B 2RQXA 1RODA 2E2IB 1ET6A 2SEBD 4QUCA 3HOZB 4QB4A 4FF3A 3KF8A 5KIXA 1IW7D 4DAVA 4V190 1A3TA 1EY8A 3GTPB 5CYUA 4K6DA 3NE5B 4M8AA 2AWNA 3M85A 1O7LA 4CJ1B 4XQNA 1RJTA 4G4KA 4RHRA 5BN3A 5LL6X 1JCKB 2K5WA 2NVQB 5CV8A 2D9UA 1QB5D 4B9XA 2M00A 4K2KA 4FP5D 5C4XB 4IFDJ 1LT6D 1E2WA 1TVXA 2F0JA 3MXPA 4FF1A 5M5YB 3SE0A 2RDHA 3T53B 1DOMA 5IIFA 2B39A 4OL7A 2KHSA 2F0TA 2WACA 1GUGA 3L7ZC 2WV6D 3P1HA 2A6EC 2B2UA 3AMUA 1STGA 2G9DA 2R92B 4C2MB 2FJ2A 4F88A 3HEJA 3OWFA 2PMZB 1LV9A 3CQZB 2E76C 2B2WA 5M5WB 2IJ0A 1K8OA 4Z9CB 2B2WC 3S1NB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EL0 A;  4HSV A;  1B3A A;  1X3P A;  2HCC A;  1ESR A;  2HDM A;  4QUC A;  1EIH A;  1CM9 A;  1HHV A;  3F2U A;  3DM1 A;  3FPU B;  2BDN A;  4LMQ D;  1AP0 A;  1S4Z A;  1DOL A;  1WD0 A;  3I91 A;  1B50 A;  2FHT A;  3UI2 A;  2L9H A;  1WTX A;  1G6Z A;  2B2Y A;  1WTV A;  1MI2 A;  2B2U C;  1IKM A;  1EIG A;  4NW2 A;  4X3K A;  1F9Q A;  4OIJ A;  5D14 A;  4QUF A;  2MGS A;  4U68 A;  1BBX C;  4ZAI A;  1G91 A;  1A15 A;  2MP1 A;  3FDT A;  2FFK B;  1ML0 D;  2B2Y C;  4HAE A;  3R93 A;  1U4M A;  1NAP A;  2KVM A;  1QG7 A;  3N52 A;  3MWY W;  3P7J A;  5EJW A;  4XT3 B;  4ZKB B;  3MTS A;  5COY A;  1PFN A;  2CVR A;  3I3C A;  4RAU C;  5T1I A;  1O7Y A;  2NWG A;  5CBE E;  1KNA A;  1ILP A;  1HFN A;  2KEC A;  5EPL A;  1WVL A;  1KNE A;  1WTR A;  1O80 A;  1SAP A;  4CJ1 B;  1SSO A;  1IKL A;  1MSG A;  1RJT A;  2JP1 A;  2N88 A;  2NZ1 D;  4IUV A;  2VXW A;  4HCS A;  4X3U A;  5D65 A;  1WTP A;  2KUM A;  5EPK A;  2HUG A;  5DNF A;  1JE4 A;  2K04 A;  1DOK A;  1F9R A;  1U4L A;  1HUN A;  1RHP A;  2K03 A;  2XIW A;  1VMP A;  4RA8 A;  1F9S A;  1C8C A;  2FIN B;  1M8A A;  1NCV A;  4ZKC B;  2D9U A;  1DZ1 A;  1RTO A;  4IUP A;  3DEO A;  3GV3 A;  5EKI A;  4R8I A;  2L4N A;  2RA4 A;  3LWE A;  3TN2 A;  4XT1 B;  2L11 A;  5E4X A;  1E0B A;  2IL8 A;  2J7Z A;  2RSO A;  1F9P A;  1PFM A;  2R3Z A;  4ZLT F;  1IL8 A;  5AFW A;  1MGS A;  1HFG A;  1NR2 A;  1ICW A;  2DY7 A;  5T1G A;  1J9O A;  1HUM A;  2K1B A;  2B2T A;  2KEE A;  1BO0 A;  3H91 A;  1TVX A;  4CJ2 C;  2X69 A;  1XYI A;  1BF4 A;  1PLF A;  4X3S A;  1AZQ A;  1QNK A;  1HRJ A;  1QE6 A;  2B2T C;  4IUU A;  5EQ0 A;  3KUP A;  1CA6 A;  3KBX A;  1WD1 A;  1DON A;  1WTW A;  1G2T A;  1VMC A;  1O7Z A;  1SDF A;  1Q3L A;  1DOM A;  1B2T A;  1PFB A;  2L1B A;  2K05 A;  2Q8R E;  2HDL A;  2RSN A;  5EPJ A;  1WTO A;  3DEP A;  4ZK9 B;  4CJ0 B;  3Q6S A;  1U4R A;  5JJZ A;  2NYZ D;  1XX8 A;  4MN3 A;  4RWS C;  1G2S A;  1NR4 A;  2SDF A;  2X6L A;  3D6W A;  4R9W A;  1HA6 A;  1ILQ A;  1EOT A;  1U4P A;  1X32 A;  2B2U A;  4X3T A;  2EOT A;  5E4W C;  1CA5 A;  1RTN A;  2B2V A;  3IFD A;  4DN4 M;  3IL8 A;  4MHE A;  3I8Z A;  3QO2 A;  2KED A;  2KOL A;  2FJ2 A;  4IUR A;  1WTQ A;  1AZP A;  2EPB A;  2HCI A;  1J8I A;  3TZD A;  2B2V C;  2DY8 A;  2M2L A;  2N55 A;  1LV9 A;  3SVM A;  5CBA E;  1MSH A;  4IUQ A;  2JYO A;  3G7L A;  4IUT A;  1BNZ A;  3HP3 A;  5CMD A;  1GUW A;  2MPM A;  2L12 A;  2EE1 A;  2B2W A;  2RVL A;  4HED A;  1X3Q A;  3ONA B;  2Q8T A;  2K28 A;  4O42 A;  2X6G A;  2MJ8 A;  1B53 A;  1PDQ A;  4XDX A;  5COR A;  3I90 A;  3GV6 A;  1F2L A;  4UAI A;  4OIK A;  2FMM A;  1ZXT A;  1ROD A;  2H1E A;  2K01 A;  1EQT A;  2B2W C;  1B4O A;  1JIC A; 
#chains in the Genus database with same CATH topology
 1EU4 A;  1EL0 A;  5M9O A;  5FKA C;  5C3W A;  4A4I A;  4LUV A;  2UUA L;  3W1G A;  2UXC Q;  1SEB D;  1PTO D;  1TS5 A;  3KYH C;  1C0A A;  2JA5 H;  1I4X A;  3X3N A;  4JI3 L;  1DYQ A;  3I4L A;  4KMU C;  4GS3 A;  1YIJ A;  1UE7 A;  2UXB L;  4JI7 L;  2CWP A;  4CDF C;  1EY0 A;  1T9H A;  1WVL A;  3GTG B;  2BA0 A;  1LUZ A;  2HQE A;  4YIJ A;  1IKL A;  1GM5 A;  4LFB Q;  1SYF A;  5D65 A;  4HTH A;  5DNF A;  3PO3 H;  1DCZ A;  1WFQ A;  4TRD A;  4G7H C;  2WIN B;  3MEH A;  3AYH B;  2OT2 A;  4RA8 A;  4UP8 A;  3IKJ A;  2NVT B;  2RHS B;  4A3F H;  5C0X H;  3VYU A;  2JA7 B;  1SYB A;  1DZ1 A;  1I6V C;  4LF8 Q;  1VF7 A;  3TBI B;  2RA4 A;  5M5W H;  3LWE A;  1K9M C;  2E74 C;  4JV5 L;  3EQL C;  1PFM A;  2R7Z H;  3M4O H;  4LK1 C;  2F0L A;  2I5L X;  1E7Z A;  4CDC C;  5IGC A;  2D5D A;  1BF4 A;  1GUT A;  2F52 A;  2R93 G;  4QMG A;  3K58 A;  4IUU A;  4LAA A;  4DV2 L;  4U67 3;  5JPN C;  4B9W A;  4LF6 Q;  1Q3L A;  1IBL Q;  4TQU S;  4DR2 L;  1FL0 A;  3CME A;  1W2B A;  1Z9F A;  4A3B G;  1VQ5 A;  3CPF A;  1PRT F;  5ELB A;  1NMG A;  1Y8N B;  1ZYR C;  1I4P A;  2XSC A;  3OMC A;  4KHP Q;  3U9O A;  3E3X A;  3RZD H;  1JR0 D;  4CGY B;  1SNO A;  1HQM C;  2B29 A;  2KED A;  4O2D A;  1AZP A;  4LFC Q;  5KND A;  2F4V L;  1TWC B;  3TQY A;  1Y1W G;  1BNZ A;  3NTI A;  1IYV A;  1IYJ B;  2RVL A;  1XPU A;  5CV7 A;  5LMU L;  4ID6 A;  4PMC A;  3M7N A;  1HXY D;  1YNJ D;  3OIQ A;  4A3G B;  4ILW A;  2NBF A;  1K8G A;  2F0I A;  1GUS A;  3VDY A;  5IT9 E;  4DU9 A;  1VF5 C;  1SJE D;  3D0F A;  3D31 A;  3CCL A;  1CSP A;  4RCO A;  3CCQ A;  1WTV A;  4YCW A;  1DXM A;  2ATW A;  3CW2 C;  4NB3 A;  3BVM A;  1LTG D;  1YHB A;  4ZAI A;  4A3J B;  1HNW L;  2RBM A;  3DWQ A;  4PZ6 A;  3JAM i;  1TWF B;  3N52 A;  3P7J A;  3JAM E;  2R93 B;  5EBD A;  4GOP A;  1MJE A;  3S14 B;  4K2L A;  1ILP A;  4DR3 L;  1SE4 A;  2F0M A;  1SFO H;  4A3M H;  2CH4 A;  3AQQ A;  5EBC A;  1HZB A;  4LF5 L;  1PH7 A;  3PIP A;  2PZW A;  1JQY D;  2Z4I A;  2JXM B;  4J8Q A;  1HPC A;  3E6Z X;  3E0E A;  1YNN D;  3RNU A;  4IO9 A;  1TY2 A;  2IWH A;  4DNT B;  5NUC A;  3H0G G;  1M8A A;  3J7A F;  1D5X C;  1ZEQ X;  1ESF A;  4QQB X;  3SGI A;  1XMO Q;  1Y1W B;  3QIA A;  2F0H A;  4UP7 A;  2LSS A;  5E4X A;  2K5N A;  4DR6 L;  1AH9 A;  5JEA H;  1D1K A;  5K36 G;  1V1O A;  3C2P A;  1HUM A;  1VQ9 A;  1PH2 A;  1FYC A;  3KLS A;  3S2D H;  2M9V A;  2O4X A;  2V4D A;  1LTB D;  3A8I E;  1PH9 A;  3MXN B;  4N8X 1;  1W3S A;  3G4S A;  1QVC A;  2HDL A;  5EAY A;  2TMP A;  1D7Q A;  2VNU D;  2NN6 I;  5FLM H;  4FDB A;  5M5X B;  3RZO B;  4R9W A;  3VR2 A;  3CKI B;  3GTK B;  4KTA A;  1PH3 A;  3EA6 A;  4B08 A;  1U9R A;  1B8A A;  4A3B H;  4DV4 Q;  4GKK Q;  1W6K A;  2L12 A;  4Z9C B;  3SDZ A;  3ZJY C;  4GNX B;  2RF4 A;  4CKC A;  3M4Q A;  3W5O A;  1K0S A;  3WDN A;  3HKZ G;  3HOV H;  5M3F G;  2UXD L;  4YCV A;  3NBH A;  2LMC B;  1A3U A;  2EY1 A;  3H0G B;  1Y1W H;  5JPM C;  3FKI G;  2SNS A;  3IFT A;  2BDN A;  1I94 Q;  2F3W A;  3S17 B;  4EGV A;  4PNY A;  5C3E G;  4G7Z C;  1VQK A;  2LFN A;  2K5H A;  2JEA I;  2A74 C;  2WP8 J;  2D0O A;  3QR8 A;  5IP9 G;  2HQL A;  4WJW A;  4WFN 3;  2KVM A;  5ELO A;  1DD2 A;  3ERO A;  1YEZ A;  1HNX L;  2AMC B;  2DNC A;  2B8G A;  2WKC A;  1N34 Q;  4RKB A;  1HFN A;  1W6J A;  1KQS A;  1O80 A;  5JVH 3;  1IXR A;  2VQF L;  2KUM A;  3KBG A;  5KYI A;  1F9R A;  5DAU A;  1EIF A;  3DWA A;  4IPH A;  3H09 A;  3HOW H;  2YTV A;  1B1Z A;  4DV1 L;  1IBM L;  3LX0 A;  1NCV A;  4P72 A;  4JI2 Q;  2NN6 H;  3J80 c;  2K6A A;  3L0O A;  4KI0 A;  4QL5 A;  4JYA Q;  2IL8 A;  3UE0 A;  2R3Z A;  3SHL A;  1MGS A;  3HKZ B;  3J81 i;  2E2J B;  5M3F B;  2DY7 A;  1UUP A;  4DXF A;  2K1B A;  4DR7 L;  4AH6 A;  4BY7 H;  1KAB A;  2ICE C;  1EOV A;  2HHH Q;  5CV4 A;  3TZU A;  2KHJ A;  5C3E B;  2IT1 A;  5K36 H;  2EDG A;  2Z6B A;  1PTO B;  4GLX A;  4OWW B;  4POF A;  2O5I C;  2A68 C;  4FVM A;  4EQ5 A;  3PUZ A;  4DV0 Q;  5CV9 A;  1EOT A;  1KLU D;  2EOT A;  1J5E L;  1Q86 C;  1E22 A;  4KV6 A;  5C4J B;  3RD4 A;  4WJ3 M;  4GZY C;  4BBS H;  4R4Q A;  2DY8 A;  1M4V A;  3V05 A;  3C46 A;  2DGY A;  3BG3 A;  1I6H H;  2E5L L;  5GAD C;  1SR3 A;  3J81 c;  2FXQ A;  1B53 A;  1PDQ A;  3MXN A;  4X64 Q;  3RLN A;  2BCO A;  3MZ5 A;  3KJP A;  3F2B A;  3A74 A;  1IW7 C;  4A3I G;  1OTC A;  1CHQ D;  1PH5 A;  3RR5 A;  3MC0 B;  4FNF A;  4C3J G;  1ET9 A;  1Z6H A;  3EVQ A;  3CRK C;  1CKN B;  2R7D A;  2FHT A;  1IKM A;  2E2J H;  5J39 A;  5IYD G;  4BA1 I;  2MFI A;  4PMB A;  2PNH A;  3T1Y Q;  2E2H H;  3CRL C;  3LWU A;  2F0G A;  5IOD A;  4GNX A;  3FKI H;  1XNR Q;  3VR4 A;  3WOE A;  4DUZ L;  4C1N I;  2P5Z X;  4KD4 A;  4DK3 C;  1HZC A;  5CBE E;  1KNA A;  2L5T A;  1GKH A;  5KNB A;  3CCE A;  1NMF A;  1SRU A;  3AU7 A;  1LT4 D;  3GTL H;  4KN7 C;  3NWT A;  4HCS A;  4HIO A;  1TR5 A;  2K04 A;  4LF4 L;  3K5N A;  4JBJ A;  1U4L A;  2B63 H;  3HGB A;  1QWY A;  2ID0 A;  3OIP A;  1H9S B;  1JOR A;  3VR5 A;  3VR6 A;  1K8M A;  3J81 j;  3L2P A;  4RH6 A;  4LF9 Q;  1BUV T;  4LFA L;  4IPC A;  2L11 A;  1E0B A;  2J7Z A;  1UE6 A;  4NXM Q;  2VUM H;  1RKN A;  4DV6 L;  1QZG A;  2K5V A;  4B3S Q;  4OX9 Q;  4KY5 A;  2OQK A;  1WI5 A;  1XNQ L;  4CJ2 C;  1PV4 A;  3I4N H;  2OTL A;  5BR8 Q;  2HD3 A;  3ERQ A;  4C3J B;  1TWH H;  5EQ0 A;  4I7A A;  1CA6 A;  4P71 A;  1G2T A;  2SNM A;  5IP7 H;  4PMW A;  4ZCK A;  1UNS A;  2R7F A;  3KLW A;  1KDB A;  4B3T Q;  5C3X A;  5HGT A;  1HA6 A;  5IGG A;  2NZH A;  2AHO B;  2BH8 A;  4KJN A;  1YHQ A;  3IFD A;  1UEB A;  2ZM6 L;  3ND8 A;  1PYB A;  4IZ8 A;  2UXC L;  2HCI A;  1FJG L;  4A75 A;  3NK9 A;  1I4R A;  3QG1 A;  4H13 C;  4AYB G;  2K4K A;  1KC8 C;  2PPB C;  2KJX A;  3S2H H;  1R9T B;  3U9S A;  1A63 A;  2F0W A;  3NQT A;  3S9W A;  4DGZ A;  4A3K B;  5DEH A;  3S16 H;  1PTO C;  2HCC A;  4IQZ A;  4JBM A;  1QNU A;  1OXX K;  1TWA H;  4M1U B;  2Y0S E;  4I7Z C;  4CKB A;  4R4T A;  2K75 A;  3D4W A;  2L9H A;  3H94 A;  2XRQ D;  3HG9 A;  4LFB L;  4NW2 A;  2PMZ E;  1F9Q A;  3ZYY X;  3K6O A;  4U68 A;  1QZH A;  1JJG A;  4A3I H;  1SJH D;  3MFY A;  2F3V A;  5K5P A;  3MWY W;  4DF7 A;  2OF1 A;  3C1E A;  4ZKB B;  2JA5 G;  2OXP A;  2WB1 E;  1KAA A;  1MD2 D;  2ZJR A;  2PI2 A;  2QF7 A;  3I4O A;  3S15 H;  1CKN A;  1DM0 B;  2Z9H A;  3G71 A;  4P75 A;  1BCP F;  4NPS A;  1XXG A;  2EXZ A;  2UU9 Q;  1LYL A;  3FPP A;  2F0P A;  3KFU A;  4TVA B;  3PIO A;  1NTG A;  2O5J C;  2G9H D;  3NTK A;  3F2D A;  1GO3 E;  3PO3 G;  5EKL A;  1RTO A;  4AYB B;  5GAE C;  1VQ8 A;  4R8I A;  1LAB A;  1R4Q B;  4R4O A;  5C0X G;  4A3D H;  2B3G A;  4KHP L;  3DHQ A;  2G5D A;  4LFC L;  5I9P A;  2C35 B;  3NP8 A;  1LAC A;  3T4A C;  2Q2U A;  2WB1 G;  4JVZ A;  1H9S A;  1DON A;  1FGU A;  5FO9 B;  4UY8 C;  1LTI D;  1B2T A;  1H9R A;  3F2C A;  1KAW A;  3W3A A;  1SNC A;  5JOB A;  1HNZ Q;  4RWS C;  1SNM A;  1HQR D;  3D6W A;  1HHV A;  5E4W C;  4JOI A;  2KCM A;  2JA5 B;  1EWH A;  4MHE A;  2Z4H A;  1TQO A;  2UUB Q;  3T13 A;  3TSS A;  4JI1 Q;  1PA6 A;  2JYO A;  1SNP A;  2MPM A;  4HED A;  2V1C C;  1G29 1;  1YNJ C;  4UDU C;  1F2L A;  1WJJ A;  3VYS A;  2JA6 H;  2H1E A;  5DM7 3;  5C0X I;  1EUJ A;  1U0L A;  2A19 A;  4K5X A;  4BWG B;  1UWV A;  1PRT D;  3PO3 B;  2XWB B;  2Y0S B;  3PV0 A;  5FLX L;  4BS9 A;  4HID A;  1DOL A;  1ENC A;  1EWI A;  1PXU A;  1U5K A;  1SXT A;  4KHV A;  3DXJ C;  2CQO A;  2B2U C;  2XNA C;  4OEL B;  4JI6 Q;  4G7O C;  2PW7 A;  4CHT B;  4A3F B;  4S3S A;  1I4G A;  3G6J B;  4HAE A;  1SMY D;  3A56 A;  3NQI A;  3S1R H;  1D5Z C;  1RIP A;  5T1I A;  2QCP X;  3CPW A;  2IW3 A;  2WB1 B;  4JI0 Q;  2R7Z B;  2ICI A;  3J7A 5;  5EPL A;  1XMO L;  3GTM H;  5ISR A;  4P2C B;  3H3V I;  1YNN C;  1TKW B;  4OHJ A;  1HTL D;  5IGE A;  3GD7 A;  2ZJP A;  1NBW A;  4QCL A;  4G57 A;  2K03 A;  3U50 C;  4A3M G;  1HZA A;  2PYK A;  4FO2 A;  1VQC A;  3M3Y H;  4K5V A;  4WOR A;  3GP7 A;  3BDO A;  4H44 C;  4GKJ Q;  2N8N A;  3DM3 A;  3RZD B;  1MHW C;  1LTL A;  3MVV A;  4Y7N H;  1ASY A;  1OXT A;  3GDE A;  3SK8 A;  3J7Y W;  1PLF A;  1LT3 D;  1OXU A;  3QOJ A;  2NTS A;  3T16 A;  4OWX B;  3NXW A;  1N33 Q;  3JC6 6;  5KRU A;  5JEA G;  2N49 A;  4DV4 L;  2GN5 A;  5GAH C;  2L1B A;  3E0J A;  2OWO A;  2Z1C A;  2A8V A;  4EQO A;  1X3E A;  1XPR A;  4A3L H;  2NYZ D;  3DUZ A;  1ILQ A;  1U4P A;  3CD6 A;  1I4H A;  4YY3 L;  2XVS A;  2A5H A;  4N9P A;  4DR4 Q;  3K5O A;  1VQP A;  2EYJ A;  4DFA A;  1I94 L;  2N55 A;  4YHH Q;  1B44 D;  3K0Y A;  5FLM G;  1XJV A;  4IN3 A;  4ALP A;  1K3B C;  3R3O A;  1GXD C;  1T5X D;  2PQA B;  1PZI D;  1SFO B;  1L0Y B;  4A3M B;  4HMJ A;  3NBH B;  5CC4 A;  2Z0S A;  2HDM A;  4IOC A;  3H3V H;  1Q1B A;  1N34 L;  3EBE A;  4LMQ D;  2VQE Q;  2K52 A;  1YJN A;  3ULP A;  3BYT B;  3HOV G;  2K50 A;  2PNR C;  4QUF A;  4OIJ A;  4DV5 Q;  3GTO H;  1L0X B;  3FDT A;  1Q8K A;  2OCE A;  5C44 H;  1EFW A;  2DN8 A;  4RGT A;  2CHB D;  4J6H A;  2EYH A;  2A1A A;  4JI2 L;  2EJG C;  4R8N A;  2KEC A;  2IX3 A;  3DWP A;  1NY4 A;  5C4Z A;  2UUC Q;  1PHJ A;  3HOY H;  3OWE B;  2JA8 G;  1QUQ A;  4DAY B;  4JI5 L;  5A2Q E;  3S2D B;  2E2D C;  3H6M A;  5ELE A;  1AN8 A;  1SBB B;  4P74 A;  3PIP 3;  2XIW A;  1LT5 D;  4FF2 A;  1STE A;  4JG2 A;  4WRD A;  1D2B A;  2LY7 A;  5JVG 3;  3AFQ A;  2HHH L;  3M4O B;  2YTX A;  1VDZ A;  1XTD A;  3M4Y A;  3HOW G;  3TN2 A;  4FF4 A;  1AE2 A;  2WAQ G;  2XN9 C;  1BKB A;  5AFW A;  4DV0 L;  5T1G A;  4GOP C;  1ASZ A;  4LF7 Q;  4A3B B;  2NN6 G;  1PH6 A;  5IE8 A;  2ZT9 C;  4A3E H;  1H9K A;  4A3C H;  3IRB A;  3HOV B;  1ZKO A;  4MNO A;  1UEA B;  2ZTE A;  1I3Q H;  1LTS D;  4DV7 Q;  4BY7 G;  1X54 A;  3K7A B;  5G3L D;  3LGJ A;  3EJI A;  3NTH A;  1YNX A;  4X3T A;  5FOB B;  3HKZ E;  1EU3 A;  4J15 A;  3OHX C;  4JPB W;  4XTC S;  5I6Y A;  3A0J A;  1WCM H;  1PYS B;  2EPB A;  3BZD B;  4UP9 A;  1IHZ A;  2A6H D;  5C0X J;  1LO5 D;  2ZJQ A;  4IUT A;  4AQY Q;  3CU7 A;  2KA7 A;  4KHZ A;  4BY1 B;  3ONA B;  3V2T A;  1LLR D;  4KN4 C;  4APV A;  4BBS G;  4CDD C;  4GN5 A;  1XNR L;  4XIG S;  3A8K E;  3V96 A;  1ESR A;  1B3Q A;  1EIH A;  4OO1 H;  1AP0 A;  3K81 C;  3SEB A;  4HN7 A;  3D6C A;  1H9M A;  2R61 A;  3RN2 A;  4QF4 A;  3K7U C;  3UI2 A;  1XMQ Q;  4JI3 Q;  3HOW B;  4DUY Q;  1WTX A;  2B2Y A;  1YHA A;  1X3G A;  3MXG A;  1K28 A;  4X3K A;  2WAQ B;  4DR1 Q;  1Z47 A;  4JI7 Q;  2ZTC A;  2MGS A;  3HZX A;  2EYM A;  2NVX H;  3VYR A;  1TU2 B;  2B2Y C;  2PQA A;  4O1N A;  2Q8I B;  3Q22 A;  2IX1 A;  1GJX A;  1RDP D;  1PFN A;  3I3C A;  4RAU C;  1VQ4 A;  2AKW B;  2K14 A;  1JC7 A;  2EYP A;  2F0V A;  3CHB D;  4MTK A;  3S1M H;  3K7A H;  2JJQ A;  2PI2 E;  4BY7 B;  2F0U A;  1HH2 P;  1UE1 A;  3EN2 A;  1WTP A;  1EYG A;  3M4P A;  1B70 B;  2AUK A;  3J80 i;  4OX9 L;  4HCE A;  1JWS D;  1CK1 A;  2PQE A;  3J80 E;  5BR8 L;  1F77 A;  2JA8 H;  1C8C A;  1VQE A;  3MFG A;  3BVZ A;  4JV5 Q;  2I46 A;  1PZK D;  4KY7 A;  3CCJ A;  2B63 G;  3VR3 A;  4DAY A;  1I4Q A;  4BBS B;  1C9O A;  4FXG C;  4BBR H;  1J9O A;  4NDX A;  4X66 Q;  4TSS A;  1NNX A;  4YWK A;  5IYB H;  3H91 A;  1I6H B;  1E3P A;  2QDB A;  4X3S A;  4GN4 B;  1PRT B;  1TXY A;  3KUP A;  4DR2 Q;  4CBV A;  2VUM G;  4N8F A;  2IX0 A;  1IYU A;  4FYD A;  2K5Q A;  5E3F A;  3M7G A;  3TS0 A;  3I4N G;  2F0O A;  2BOS A;  1TS2 A;  5BN5 A;  5IT9 L;  4KKU A;  3QB3 A;  1G2S A;  3A55 A;  2IHF A;  2O2L D;  1XTC D;  5IP7 G;  3I2Z A;  2F4V Q;  4XQJ A;  4IUR A;  4ZYS A;  1WTQ A;  1WYD A;  3J81 E;  2VB2 X;  5A35 A;  2E2H B;  1J8I A;  4QIW B;  1KL9 A;  3BZC A;  5LMU Q;  1MSH A;  4DK0 A;  3FKI B;  3JAM L;  1K73 C;  2RCN A;  2J0T D;  1SYG A;  1QCB D;  4XDX A;  3D4D A;  3GV6 A;  1CTM A;  4B3M L;  2CFM A;  1YJW A;  1PFS A;  5JEA J;  1HA5 A;  5AJ3 L;  3F8T A;  2AQ3 B;  3GTL B;  1B3A A;  3LNN A;  3K80 C;  1EIY B;  4RFB A;  1WOC A;  5FJ8 H;  2BE5 D;  2WKD A;  2ZXO A;  3A7L A;  2Q2T A;  4JI4 Q;  1WD0 A;  4EVO A;  4RHS A;  1O7I A;  1HNW Q;  2B63 B;  4DKA C;  1GHJ A;  1ENF A;  4PV1 C;  1BBX C;  1LM0 A;  3NWS A;  2UU9 L;  3CC2 A;  4C1N K;  2D2C C;  1IBK L;  5C5M A;  2F4I A;  1K83 H;  2QGQ A;  1Y1V G;  1KRT A;  2VUM B;  4DV3 L;  1NJI C;  1X9N A;  2JEB I;  1G8Z D;  3I4M G;  3J7Z C;  4BXX H;  3I4N B;  1KTK A;  5BN4 A;  3ULJ A;  1N36 Q;  1NE3 A;  1TWH B;  4L5Q A;  1RHP A;  1JE5 A;  1JOQ A;  1VMP A;  4DAM A;  2HT1 A;  4PZ7 A;  5IGB A;  1SYD A;  5IWA L;  1EYD A;  4DR6 Q;  2JA9 A;  3I7F A;  3DEO A;  3DMU A;  4GNX C;  5CR3 A;  1QOH A;  1HNZ L;  4C3H H;  1ICW A;  3U4Z A;  4X6A H;  3ND9 A;  2EXD A;  2ZXP A;  4ZUI A;  1BCP D;  3TRZ A;  3S2H B;  3VA5 A;  1FNU A;  2ALY B;  2EY6 A;  3NBI A;  3B6Y A;  4XXE A;  1VQ6 A;  3ICE A;  1Y8P B;  4JI1 L;  4A3D G;  1VMC A;  1O7Z A;  1V1Q A;  1S5F D;  3S16 B;  3I70 A;  4LNQ A;  3HOU G;  4AYB E;  1WTO A;  1TWA B;  1BDO A;  4CJ0 B;  1GUN A;  4POG A;  4QY7 A;  1CA5 A;  1YI2 A;  4I65 A;  2F0E A;  1CSQ A;  3SK5 A;  3HOX H;  1M90 C;  3QO2 A;  2GVA A;  2C9O A;  4Q0F A;  3S24 A;  3K59 A;  4A3I B;  5LMN Q;  1EYC A;  4KK7 A;  3PUX A;  2ASB A;  3G7L A;  1G51 A;  4AIM A;  2AQ2 B;  3RN5 A;  3T1H L;  4L63 B;  2JK8 A;  1KIX A;  1AFP A;  2F1M A;  4O42 A;  1VQM A;  1EQQ A;  2AUJ D;  5EGT A;  1PRT C;  4UAI A;  5IOC A;  3RUZ A;  5TSS A;  3GTJ H;  3GQB A;  3S1Q H;  4GLA C;  1VQB A;  3S15 B;  2F0K A;  1JB7 A;  1VS0 A;  4JC0 A;  2IY5 B;  3BZK A;  3CCV A;  2KCN A;  4JI0 L;  1AE3 A;  1R4P B;  4IAL A;  2QEJ C;  4UPA A;  1S4Z A;  4A93 G;  3NEN A;  2JA6 G;  4IFD H;  1SMY C;  2DUD A;  4F8M A;  2FFK B;  4L8J A;  1STN A;  3MEF A;  5I9O A;  1HNX Q;  3HOZ G;  2Z6K A;  1DJR D;  3NEM A;  1CT1 D;  1NAP A;  1QG7 A;  2CW0 D;  3A54 A;  2L0C A;  5J1Z A;  2JSO A;  1GVP A;  1K3R A;  3OTO Q;  2EY5 A;  4A3D B;  3ULL A;  2E75 C;  4C3I G;  4YWM A;  3R2I A;  1Q90 A;  3C3L A;  4HIM A;  4DV1 Q;  4CDE C;  5DM6 3;  1TWG H;  1I5F A;  3VA7 A;  1Y1V H;  1I50 H;  2E8G A;  3P75 A;  2EYL A;  3BDC A;  4NMZ A;  1F9S A;  3CCS A;  1N33 L;  4KKT A;  4QJF A;  2MNA A;  2K32 A;  3I4M H;  5FLX c;  3PIO 3;  4K14 A;  3CCR A;  2HIV A;  1EY7 A;  1VQI A;  2YV5 A;  4XT1 B;  4EQN A;  2YU9 H;  5M3M H;  4LF8 L;  2NTT A;  2A68 D;  2B2T A;  5HY6 A;  1X3F A;  4HR7 B;  3R2T A;  4IJH A;  3FEW X;  1AZQ A;  4DR4 L;  2BH2 A;  1Q1E A;  2B2T C;  4GLV B;  3I56 A;  1VQN A;  4YHH L;  2PZT A;  5C4X G;  4ULL A;  4XQQ A;  2JA6 B;  2LXJ A;  2BDO A;  3IAY A;  2NVY H;  3A5U A;  3C1F A;  4ME3 A;  4CKE A;  3DEP A;  4ZK9 B;  1SE8 A;  4LF6 L;  3Q6S A;  1IBL L;  1II3 A;  1PZJ D;  2D0P A;  4DN4 M;  4X65 Q;  3EIV A;  2VL6 A;  2E5L Q;  2VQE L;  1VQA A;  3TZD A;  3G6E A;  3FP9 A;  3HOU H;  1F2Y A;  4A3L G;  1D1I A;  4C3I B;  2XTI A;  2A69 D;  1S5B D;  1H9J A;  4KD3 A;  2Q8T A;  3CC7 A;  1X3Q A;  3S1R B;  2X6G A;  4HJ8 A;  2B8F A;  2MJ8 A;  5COR A;  3I90 A;  1F2M A;  2FMM A;  3HKS A;  2K33 A;  2N3S A;  1IZ6 A;  2ES2 A;  3GTM B;  1JIC A;  4ZUJ A;  4K6L A;  1K0R A;  1MIU A;  2UUC L;  1KHI A;  3FVQ A;  1S5E D;  2CH4 W;  2BA1 A;  1Q81 C;  4IPD A;  2PW5 A;  3WWV A;  1MI2 A;  3M3Y B;  4JOI C;  4X62 Q;  4BY1 G;  1VQH A;  2MP1 A;  1N32 Q;  3STB D;  1Q8I A;  1LTR D;  1U4M A;  1L1O B;  4XT3 B;  4A93 H;  3MTS A;  1HR0 Q;  2CVR A;  3K0X A;  2QEX A;  1OXV A;  2VY3 A;  1C48 A;  4Y7N B;  4ME5 A;  1S5C D;  4F7X A;  3Q23 A;  4DA2 A;  5C44 G;  2E2I H;  4OON A;  2NZ1 D;  1QUQ B;  3J7A V;  3Q24 A;  1A2U A;  1V1P B;  3AFP A;  3HOZ H;  5FO8 B;  2HUG A;  4DK6 C;  2DJF C;  4P73 A;  1YZ6 A;  3PUY A;  1JT8 A;  4HJ7 A;  3TDQ A;  4WJ4 A;  1JWU D;  3QJY A;  4OEM B;  3HOY G;  1FVI A;  3PF4 A;  3HFZ B;  4HSP A;  4C3I H;  1RF2 D;  3G48 A;  4ZKC B;  3GTP H;  1O78 A;  3GV3 A;  5EKI A;  1SE2 A;  3SXH A;  4KKS A;  2F0S A;  4DV7 L;  1CHP D;  5HUR A;  1F9P A;  2KQ3 A;  3H15 A;  4ZLT F;  1XNQ Q;  2F3I A;  5IYC H;  2PCF B;  3GTQ B;  4YWL A;  1EWC A;  1X6O A;  4Y52 H;  3OPO A;  3U4V A;  2JA7 G;  2NZO A;  1S40 A;  2CCZ A;  3WOF A;  3BDL A;  2NVQ H;  3CCU A;  1EFI D;  1HZ9 A;  1S5D D;  3KJO A;  1NSN S;  2Q8R E;  5EPJ A;  3P20 A;  4A3E G;  3TP6 A;  2I5M X;  3BU2 A;  2ZM6 Q;  4MN3 A;  4L5R C;  1NR4 A;  2MQH A;  2XWJ B;  1X56 A;  4A3C G;  1E24 A;  3FMC A;  1BBU A;  1FJG Q;  1TII D;  2A6H C;  1MJC A;  1BVS A;  5C4X H;  4GN3 B;  3I8Z A;  3GTO B;  3Q0A A;  4FXD A;  1XMQ L;  3KLR A;  5C44 B;  3A8J E;  1QVG A;  5GRO A;  4DUY L;  1E2V A;  3HP3 A;  4DR1 L;  2EE1 A;  4DAP A;  3PGZ A;  1JMC A;  2K28 A;  1VCI A;  1TS4 A;  5M5Y H;  4GKK L;  1WCM G;  2RHQ B;  2K01 A;  1EQT A;  1JJ2 A;  3HOY B;  1B4O A;  3CXC A;  1NUC A;  4B3R Q;  1X65 A;  4HSV A;  1X3P A;  1UAP A;  1FR3 A;  1CM9 A;  3FPU B;  3DM1 A;  1HTP A;  1EEI D;  4NP5 A;  2RKS A;  1B50 A;  4JI8 Q;  3K57 A;  4HMI A;  1G6Z A;  2XGT A;  1EQR A;  2R92 H;  4L5S A;  4K0K Q;  4C2M H;  1EZ6 A;  3GTQ H;  4XYO A;  1EYA A;  3TS2 A;  4OO1 G;  3CQZ H;  4A3G G;  3R93 A;  3RLF A;  3KOJ A;  3X3M A;  1BCP B;  4HIK A;  1O7Y A;  3CP0 A;  4K8I A;  1KNE A;  4MZ9 A;  4BY1 H;  3S1N H;  4H0L C;  1MBY A;  4Q5V A;  1P16 A;  1SSO A;  4A3J G;  2EZV A;  3NSW A;  4X3U A;  4A3E B;  5I2Y A;  1TS3 A;  1V9P A;  4H7B A;  4X66 L;  3BVG A;  4K8J A;  3TP8 A;  2WAQ E;  2IHE A;  2D62 A;  4O0A A;  1I3Q B;  3ER0 A;  1EY9 A;  2NUC A;  1L1O A;  2OQ0 A;  4DXG A;  3M9B A;  3PUV A;  1CQF A;  1OXS C;  1S3O A;  1YBY A;  4YCU A;  1L1O C;  1J6Q A;  2RSO A;  1A2T A;  1JWM D;  5D3I B;  1WCM B;  1V1P A;  3GTG H;  2K5D A;  4JYA L;  1XWE A;  4MIU A;  1EZ8 A;  1BO0 A;  4OO1 I;  4NXN Q;  2LKV A;  4JK1 C;  4J1M A;  3A5Z B;  3ERS X;  1SRO A;  3RLO A;  1WD1 A;  2F0N A;  4BBR G;  1SDF A;  2YTY A;  5IYB G;  3PCO B;  2NVT H;  3DLL A;  1QJO A;  3CCM A;  2JA7 H;  4DR5 Q;  1CQV A;  2Q2H A;  1XX8 A;  5LMN W;  2X6L A;  1E2Z A;  5J22 A;  1QIL A;  1GUO A;  2Z8L A;  1A6X A;  2RDF A;  1PTO F;  1CZG A;  1UE5 A;  4LW1 A;  1SND A;  2OTJ A;  2A6E D;  2NVX B;  3NPP A;  4JI4 L;  4LJZ C;  1KDC A;  1BQQ T;  3SVM A;  1STA A;  3UDG A;  3D4R A;  1Z7T A;  3D8G A;  2IPK D;  4PG3 A;  4OIK A;  2JQO A;  1JB3 A;  2BE5 C;  2EY2 A;  3OYY A;  3S1M B;  1TY0 A;  4X64 L;  5CV5 A;  5I2X A;  3PMF A;  3PF5 A;  1EY4 A;  1FNV A;  1SNQ A;  3H3V C;  3F2U A;  4H02 A;  4RCN A;  1TT2 A;  2MUY A;  4KJO A;  1B9M A;  3R8B A;  1Y69 U;  2KHI A;  5KGU A;  4QIW E;  5D14 A;  1A8V A;  2WII B;  3SK6 A;  1V43 A;  1N36 L;  2JA8 B;  5IT9 c;  1BOS A;  5FJ8 G;  5LHY 1;  1TWC H;  1B9N A;  2EYF A;  3T1Y L;  4DNR B;  4ZQ3 A;  5JJI A;  4PZ8 A;  2NWG A;  3E5S A;  3K5L A;  3PO2 G;  2UUA Q;  4BBR B;  1WTR A;  3CF5 A;  3JAM c;  3SK4 A;  1MSG A;  2CWA A;  2JE6 I;  4A3G H;  1P8L A;  5EPK A;  1JE4 A;  1Q7Y C;  2L15 A;  1HUN A;  1CFM A;  2NB0 A;  3UDX A;  2UXB Q;  5ELC A;  3AB9 A;  1YVC A;  2WFW A;  3I73 A;  2H5X A;  4DK1 A;  4BXX G;  4A3J H;  1PMR A;  4KLK A;  3MHB A;  4ABN A;  5JJK A;  2YYZ A;  2QKI C;  1TWF H;  2L4N A;  2ZXR A;  4L6T B;  2R93 H;  2OEO A;  4LF9 L;  2CKZ B;  1BCP C;  3MXU A;  3S14 H;  1E1O A;  1FNW A;  2RDG A;  1HFG A;  1NR2 A;  1N9W A;  2EJM A;  1BR9 A;  3TP5 A;  4TKO B;  4QGU A;  1GOZ A;  4NXM L;  3FRP B;  1XYI A;  1QNK A;  2QW7 A;  4L5T A;  4B3S L;  2DNE A;  5LMN L;  4C3H G;  3PQI A;  2ENB A;  4HJ9 A;  1L0W A;  5IGF A;  5GAG C;  2KCC A;  4YY3 Q;  2SDF A;  4B3T L;  3PUW A;  3KF6 B;  3KLS X;  1KDA A;  3Q8D A;  1STH A;  3IL8 A;  1STY A;  2F0D A;  2FMC A;  4UHV A;  3PO2 B;  2KOL A;  4N9T A;  1ZYR D;  4MTN A;  4DV2 Q;  1CUK A;  2AWO A;  1OO9 B;  2QDL A;  1A3V A;  1VQG A;  1YIT A;  1K83 B;  3HOX G;  1EY5 A;  1C4Q A;  4DNI A;  5CV6 A;  1EY6 A;  5A2Q L;  1D8L A;  2AQ1 B;  3OTO L;  5E1F A;  1T5E A;  5I6W A;  1BBW A;  3N6R A;  2Q2I A;  1D6E C;  5M5X H;  3RZO H;  3I91 A;  1Q46 A;  3OSO A;  1SLJ A;  2KBN A;  3GTK H;  1EIG A;  1HR0 W;  1HCZ A;  2CW0 C;  4RGM A;  2RCF A;  2XRS D;  1G91 A;  1A15 A;  1RD9 D;  4JCV E;  1ML0 D;  1KRS A;  1F2Z A;  1RL2 A;  5KYL A;  5G3L F;  3OMG A;  4IFD G;  5C5L A;  3K5M A;  5JJL A;  4ZRZ A;  4C3H B;  4JI5 Q;  1Q12 A;  1H95 A;  1SAP A;  4IUV A;  2EJF C;  2F0Q A;  1AEX A;  5DLQ E;  3H0G H;  2GA4 B;  1HJP A;  3FHW A;  1CKO A;  3D3R A;  5L37 A;  3F1Z A;  1EEF D;  3S17 H;  2EQS A;  3PO2 H;  4RGN A;  4EQP A;  2FIN B;  4XYQ A;  5D3D A;  4DR3 Q;  1VQD A;  2QIL A;  2TSS A;  1S72 A;  3I55 A;  4LF5 Q;  4DPG A;  5KEE A;  3HOX B;  1LTA D;  3RMH A;  3L3O C;  1XPO A;  3OW7 A;  1KLG D;  2N78 A;  1L2F A;  1FD7 D;  4OXP A;  1AW7 A;  2KEE A;  3AEV A;  2I5H A;  3TP7 A;  2A73 B;  1V8Q A;  4X65 L;  1QE6 A;  2KEN A;  5M3M G;  5ELN A;  4IFD I;  4RGO S;  1GD7 A;  3UE1 A;  3GTJ B;  1CI3 M;  3S1Q B;  1PFB A;  2K05 A;  1JOK A;  4E6I A;  2RSN A;  4ODG A;  1U4R A;  3QWN A;  3BYY B;  4LUZ A;  1A0I A;  3UDF A;  1JOO A;  1A62 A;  1D5M C;  1STB A;  1X32 A;  3L9A X;  4PQX A;  2F03 A;  3KF8 B;  2A69 C;  1ONL A;  1LTT D;  1WTH A;  3MA2 B;  1RCV D;  1BXT A;  5M3F H;  4JBK A;  1VQL A;  2CQA A;  4C56 C;  5CBA E;  4IUQ A;  1Y8O B;  2H4O A;  1VQO A;  3URY A;  5C4H A;  4X62 L;  2UUB L;  3TME A;  1N32 L;  4RKL A;  5C3E H;  1ZXT A;  3NHH A;  4NKL A;  2F0F A;  5FO7 B;  2L55 A;  4JW0 A;  1PTO H;  1HR0 L;  2EVB A;  1PYW D;  3CC4 A;  3VYT A;  2EYO A;  5IP9 H;  3KF6 A;  2I07 B;  2J4X A;  1CZW A;  3MAQ A;  2VS1 A;  1TWG B;  1QVF A;  2ZTD A;  4OGQ C;  3J80 L;  4RG1 A;  1Y1V B;  3KDF B;  1I50 B;  3STB C;  3W2D A;  5C4J H;  4A3K G;  1E1T A;  3I4M B;  1MKH A;  5ELD A;  4IJL A;  1GHK A;  4JI6 L;  2UXD Q;  3T51 B;  3NUC A;  5EJW A;  3T56 B;  2MO0 A;  5COY A;  4IOA A;  5HGQ A;  3ITP A;  3HS0 C;  2YU9 B;  1ENA A;  5M3M B;  2KCT A;  5EKK A;  5KNC A;  2HIX A;  3A7A B;  2JP1 A;  3SR1 A;  2N88 A;  3KK7 A;  2VXW A;  5ELF A;  4K5W A;  4V0B A;  3BS1 A;  5CGK A;  1DOK A;  1VQJ A;  2SOB A;  1FGB D;  1SE3 A;  4FXK C;  5FLX E;  3I72 A;  1SYE A;  2NVY B;  5I4D A;  4JBW A;  2MHV A;  4KY6 A;  4IUP A;  4A76 A;  3OW2 A;  1SYC A;  3K8A A;  4F87 A;  2VB3 X;  4GKJ L;  2Z6K C;  5C6A A;  1C7Y A;  3QOL A;  2VQF Q;  3J81 L;  2LXK A;  1IL8 A;  1SN8 A;  3HOU B;  5IY0 A;  3HRZ C;  1IL2 A;  2X69 A;  2LS0 1;  1HRJ A;  5FK9 C;  1IBM Q;  2R6G A;  3EFX D;  2PZU A;  3KBX A;  1WTW A;  5F2D A;  2QA4 A;  5IYC G;  2K7V A;  5JAV A;  1EQV A;  1Y14 B;  3CAM A;  3U58 A;  3TRE A;  1M1K C;  4LWC A;  5LL6 S;  3TEH B;  5JJZ A;  4DR7 Q;  4B3R L;  1RTN A;  2B2V A;  4IUN A;  1VQF A;  3PSI A;  3O13 A;  5J3B A;  3GO5 A;  2VZA A;  1KXL A;  2B2V C;  2M2L A;  4JI8 L;  4BA2 I;  5IGD A;  4OWT B;  2C5C A;  5CMD A;  2PO4 A;  4K0K L;  4A93 B;  4B3M Q;  1GUW A;  5AJ3 Q;  4C3J H;  2DJG C;  2RQX A;  4HJ5 A;  1ROD A;  2E2I B;  1ET6 A;  5IYD H;  2SEB D;  1J5E Q;  4QUC A;  3HOZ B;  4QB4 A;  4FF3 A;  3KF8 A;  1CKM A;  5KIX A;  5H1S E;  2MO1 A;  1IW7 D;  4DAV A;  2GVB A;  4V19 0;  1YJ9 A;  1A3T A;  1IBK Q;  1EY8 A;  3GTP B;  4DV5 L;  4LUO A;  2Y0S G;  4DV3 Q;  5CYU A;  4K6D A;  1R9T H;  2JN4 A;  2R92 G;  2I0Q A;  3NE5 B;  4M8A A;  1G6P A;  2AWN A;  3E9I A;  3M85 A;  1O7L A;  4A3K H;  4A3F G;  4CJ1 B;  4XQN A;  1RJT A;  3W1B A;  4G4K A;  3KDF A;  4RHR A;  5BN3 A;  5LL6 X;  1PVO A;  1JCK B;  2K5W A;  4R1J A;  2NVQ B;  4NXN L;  5IWA Q;  5CV8 A;  2R7Z G;  4DUZ Q;  2D9U A;  1QB5 D;  4B9X A;  4EX5 A;  2M00 A;  4K2K A;  1KD1 C;  4FP5 D;  5C4X B;  2VW9 A;  4DR5 L;  4IFD J;  1LT6 D;  4R4C A;  1E2W A;  4LF4 Q;  1PH8 A;  1TVX A;  4R4I A;  5GQO A;  2F0J A;  3MXP A;  5E7N A;  4FF1 A;  4LF7 L;  3UDI A;  1JJC B;  5M5Y B;  3SE0 A;  1ICF B;  4RMF A;  2RDH A;  3T53 B;  1DOM A;  5IIF A;  4LFA Q;  2B39 A;  4OL7 A;  3BJU A;  2KHS A;  2EIF A;  2F0T A;  2WAC A;  1GUG A;  3L7Z C;  4HJA A;  2WV6 D;  3P1H A;  4IPG A;  2A6E C;  4DV6 Q;  2B2U A;  1PH1 A;  1PH4 A;  1K8A C;  3AMU A;  1STG A;  2G9D A;  2R92 B;  3NEL A;  3CMA A;  1X55 A;  4C2M B;  2FJ2 A;  1VQ7 A;  1DGS A;  4F88 A;  3HEJ A;  1N8R C;  3T1H Q;  3OWF A;  2PMZ B;  1LV9 A;  3CQZ B;  1Q82 C;  1B7Y B;  2E76 C;  2B2W A;  5M5W B;  2IJ0 A;  1SMX A;  3E9H A;  4AQY L;  1K8O A;  3OOC A;  2B2W C;  4GOP B;  3S1N B; 
#chains in the Genus database with same CATH homology
 1EU4 A;  1EL0 A;  5M9O A;  5FKA C;  5C3W A;  1SEB D;  1PTO D;  1TS5 A;  1I4X A;  3X3N A;  1DYQ A;  3I4L A;  4KMU C;  1EY0 A;  1WVL A;  3GTG B;  2BA0 A;  2HQE A;  4YIJ A;  1IKL A;  1SYF A;  5D65 A;  4HTH A;  5DNF A;  1DCZ A;  4TRD A;  4G7H C;  2WIN B;  3MEH A;  2OT2 A;  4RA8 A;  3IKJ A;  2NVT B;  5C0X H;  3VYU A;  2JA7 B;  1SYB A;  1DZ1 A;  1I6V C;  1VF7 A;  3TBI B;  2RA4 A;  3LWE A;  2E74 C;  3EQL C;  1PFM A;  4LK1 C;  2F0L A;  5IGC A;  2D5D A;  1BF4 A;  1GUT A;  4QMG A;  3K58 A;  4IUU A;  4LAA A;  4U67 3;  5JPN C;  4B9W A;  1Q3L A;  4TQU S;  1PRT F;  5ELB A;  1Y8N B;  1ZYR C;  1I4P A;  2XSC A;  3OMC A;  3U9O A;  1JR0 D;  4CGY B;  1SNO A;  1HQM C;  2KED A;  1AZP A;  5KND A;  1TWC B;  1BNZ A;  1IYV A;  3NTI A;  2RVL A;  5CV7 A;  4ID6 A;  4PMC A;  3M7N A;  1HXY D;  1YNJ D;  3OIQ A;  4A3G B;  4ILW A;  2NBF A;  2F0I A;  1GUS A;  5IT9 E;  4DU9 A;  1VF5 C;  1SJE D;  3D31 A;  4RCO A;  1WTV A;  1DXM A;  3BVM A;  1LTG D;  4ZAI A;  4A3J B;  2RBM A;  3DWQ A;  1TWF B;  3N52 A;  3P7J A;  3JAM E;  2R93 B;  5EBD A;  3S14 B;  4K2L A;  1ILP A;  1SE4 A;  2F0M A;  5EBC A;  2PZW A;  1JQY D;  2Z4I A;  2JXM B;  4J8Q A;  1HPC A;  3E6Z X;  1YNN D;  1TY2 A;  2IWH A;  4DNT B;  5NUC A;  1M8A A;  3J7A F;  1D5X C;  1ZEQ X;  1ESF A;  1Y1W B;  3QIA A;  2F0H A;  5E4X A;  5JEA H;  1D1K A;  5K36 G;  1V1O A;  3C2P A;  1HUM A;  1FYC A;  3KLS A;  2M9V A;  2O4X A;  2V4D A;  1LTB D;  3A8I E;  2HDL A;  2TMP A;  2VNU D;  2NN6 I;  5M5X B;  3RZO B;  4R9W A;  3VR2 A;  3CKI B;  3GTK B;  4KTA A;  3EA6 A;  4B08 A;  1U9R A;  1W6K A;  2L12 A;  3SDZ A;  4CKC A;  3WDN A;  3NBH A;  2LMC B;  1A3U A;  2EY1 A;  3H0G B;  5JPM C;  2SNS A;  3IFT A;  2BDN A;  2F3W A;  3S17 B;  4EGV A;  4PNY A;  4G7Z C;  2LFN A;  2JEA I;  2A74 C;  2WP8 J;  4WJW A;  4WFN 3;  2KVM A;  1DD2 A;  3ERO A;  2DNC A;  2B8G A;  2WKC A;  1HFN A;  4RKB A;  1W6J A;  1O80 A;  5JVH 3;  2KUM A;  3KBG A;  5KYI A;  1F9R A;  5DAU A;  3DWA A;  3H09 A;  1B1Z A;  3LX0 A;  1NCV A;  2NN6 H;  2K6A A;  4KI0 A;  2IL8 A;  2R3Z A;  3SHL A;  1MGS A;  3HKZ B;  2E2J B;  5M3F B;  2DY7 A;  1UUP A;  4DXF A;  2K1B A;  1KAB A;  2ICE C;  5CV4 A;  3TZU A;  5C3E B;  2IT1 A;  5K36 H;  2EDG A;  1PTO B;  2O5I C;  2A68 C;  4FVM A;  3PUZ A;  5CV9 A;  1EOT A;  1KLU D;  2EOT A;  4KV6 A;  5C4J B;  3RD4 A;  4GZY C;  2DY8 A;  1M4V A;  3V05 A;  3C46 A;  3BG3 A;  3MXN A;  1B53 A;  1PDQ A;  2BCO A;  3MZ5 A;  1IW7 C;  1CHQ D;  3MC0 B;  4C3J G;  4FNF A;  1ET9 A;  1Z6H A;  3CRK C;  3EVQ A;  2FHT A;  1IKM A;  5J39 A;  4BA1 I;  4PMB A;  3CRL C;  3LWU A;  2F0G A;  5IOD A;  3VR4 A;  3WOE A;  4C1N I;  4KD4 A;  5CBE E;  1KNA A;  2L5T A;  5KNB A;  3AU7 A;  1LT4 D;  4KN7 C;  3NWT A;  4HCS A;  1TR5 A;  2K04 A;  3K5N A;  1U4L A;  3HGB A;  1QWY A;  2ID0 A;  3OIP A;  1H9S B;  1JOR A;  3VR5 A;  3VR6 A;  1K8M A;  4RH6 A;  1BUV T;  2L11 A;  1E0B A;  2J7Z A;  1RKN A;  4KY5 A;  4CJ2 C;  3ERQ A;  4C3J B;  5EQ0 A;  1CA6 A;  1G2T A;  2SNM A;  4PMW A;  1UNS A;  1KDB A;  5C3X A;  5HGT A;  1HA6 A;  5IGG A;  4KJN A;  3IFD A;  3ND8 A;  4IZ8 A;  2HCI A;  3NK9 A;  1I4R A;  3QG1 A;  4H13 C;  2PPB C;  2KJX A;  1R9T B;  3U9S A;  2F0W A;  3NQT A;  3S9W A;  4DGZ A;  4A3K B;  5DEH A;  1PTO C;  2HCC A;  4IQZ A;  1QNU A;  1OXX K;  4M1U B;  4I7Z C;  4CKB A;  3D4W A;  2L9H A;  3H94 A;  2XRQ D;  3HG9 A;  4NW2 A;  1F9Q A;  3ZYY X;  3K6O A;  4U68 A;  1SJH D;  3MFY A;  2F3V A;  5K5P A;  3MWY W;  4DF7 A;  2OF1 A;  3C1E A;  4ZKB B;  2OXP A;  1KAA A;  1MD2 D;  2QF7 A;  1DM0 B;  1BCP F;  1XXG A;  2EXZ A;  3FPP A;  2F0P A;  2O5J C;  2G9H D;  3NTK A;  5EKL A;  1RTO A;  4AYB B;  4R8I A;  1LAB A;  1R4Q B;  5C0X G;  3DHQ A;  5I9P A;  3NP8 A;  1LAC A;  3T4A C;  1DON A;  1H9S A;  5FO9 B;  1LTI D;  1B2T A;  1H9R A;  3W3A A;  1SNC A;  5JOB A;  4RWS C;  1SNM A;  1HQR D;  3D6W A;  1HHV A;  5E4W C;  2JA5 B;  1EWH A;  4MHE A;  2Z4H A;  1TQO A;  3T13 A;  3TSS A;  2JYO A;  1SNP A;  2MPM A;  4HED A;  1G29 1;  1YNJ C;  4UDU C;  1F2L A;  3VYS A;  2H1E A;  5DM7 3;  5C0X I;  4K5X A;  4BWG B;  1PRT D;  3PO3 B;  2XWB B;  2Y0S B;  3PV0 A;  5FLX L;  4BS9 A;  1DOL A;  1ENC A;  1PXU A;  1SXT A;  4KHV A;  3DXJ C;  2B2U C;  2XNA C;  4G7O C;  2PW7 A;  4CHT B;  4A3F B;  4S3S A;  1I4G A;  3G6J B;  4HAE A;  1SMY D;  3A56 A;  3NQI A;  1D5Z C;  5T1I A;  2QCP X;  2IW3 A;  2WB1 B;  2R7Z B;  2ICI A;  5EPL A;  5ISR A;  4P2C B;  1YNN C;  1TKW B;  4OHJ A;  1HTL D;  5IGE A;  3GD7 A;  4QCL A;  4G57 A;  2K03 A;  2PYK A;  4FO2 A;  4K5V A;  4WOR A;  3GP7 A;  3BDO A;  4H44 C;  3RZD B;  3MVV A;  1OXT A;  3SK8 A;  3J7Y W;  1PLF A;  1LT3 D;  1OXU A;  3QOJ A;  2NTS A;  3T16 A;  3NXW A;  5KRU A;  5JEA G;  2L1B A;  3E0J A;  2Z1C A;  4EQO A;  2NYZ D;  3DUZ A;  1ILQ A;  1U4P A;  1I4H A;  2XVS A;  2A5H A;  4N9P A;  3K5O A;  2EYJ A;  4DFA A;  2N55 A;  1B44 D;  3K0Y A;  4IN3 A;  3R3O A;  1GXD C;  1T5X D;  1PZI D;  1SFO B;  1L0Y B;  4A3M B;  4HMJ A;  5CC4 A;  2HDM A;  1Q1B A;  4LMQ D;  3BYT B;  2PNR C;  4QUF A;  4OIJ A;  1L0X B;  3FDT A;  2DN8 A;  4RGT A;  2CHB D;  4J6H A;  2EYH A;  2EJG C;  4R8N A;  2KEC A;  2IX3 A;  3DWP A;  5C4Z A;  3OWE B;  5A2Q E;  3S2D B;  2E2D C;  3H6M A;  5ELE A;  1AN8 A;  1SBB B;  3PIP 3;  2XIW A;  1LT5 D;  4FF2 A;  1STE A;  4WRD A;  1D2B A;  2LY7 A;  5JVG 3;  3M4O B;  1VDZ A;  3M4Y A;  3TN2 A;  4FF4 A;  2XN9 C;  5AFW A;  5T1G A;  4A3B B;  2NN6 G;  2ZT9 C;  1H9K A;  3HOV B;  1ZKO A;  1UEA B;  1LTS D;  3K7A B;  5G3L D;  3EJI A;  3NTH A;  4X3T A;  5FOB B;  1EU3 A;  5I6Y A;  3OHX C;  4XTC S;  2EPB A;  3BZD B;  1IHZ A;  2A6H D;  5C0X J;  1LO5 D;  4IUT A;  3CU7 A;  2KA7 A;  4KHZ A;  4BY1 B;  3ONA B;  3V2T A;  1LLR D;  4KN4 C;  4XIG S;  3A8K E;  3V96 A;  1ESR A;  1EIH A;  4OO1 H;  1AP0 A;  3SEB A;  4HN7 A;  2R61 A;  1H9M A;  3D6C A;  4QF4 A;  3UI2 A;  3HOW B;  1WTX A;  2B2Y A;  3MXG A;  4X3K A;  2WAQ B;  1Z47 A;  2MGS A;  3HZX A;  2EYM A;  3VYR A;  1TU2 B;  2B2Y C;  4O1N A;  2Q8I B;  3Q22 A;  2IX1 A;  1GJX A;  1RDP D;  1PFN A;  3I3C A;  4RAU C;  1JC7 A;  2EYP A;  2F0V A;  3CHB D;  4BY7 B;  2F0U A;  1WTP A;  2AUK A;  4HCE A;  1JWS D;  1CK1 A;  2PQE A;  3J80 E;  1F77 A;  1C8C A;  3MFG A;  3BVZ A;  2I46 A;  1PZK D;  4KY7 A;  3VR3 A;  4DAY A;  1I4Q A;  4BBS B;  4FXG C;  1J9O A;  4NDX A;  4TSS A;  3H91 A;  1I6H B;  2QDB A;  4X3S A;  1PRT B;  3KUP A;  4CBV A;  2IX0 A;  1IYU A;  4FYD A;  2K5Q A;  5E3F A;  3M7G A;  2F0O A;  2BOS A;  1TS2 A;  5BN5 A;  5IT9 L;  4KKU A;  3QB3 A;  1G2S A;  3A55 A;  2O2L D;  1XTC D;  4XQJ A;  4IUR A;  4ZYS A;  1WTQ A;  3J81 E;  2VB2 X;  5A35 A;  2E2H B;  1J8I A;  4QIW B;  1MSH A;  4DK0 A;  3FKI B;  3JAM L;  2J0T D;  1SYG A;  1QCB D;  4XDX A;  3D4D A;  3GV6 A;  1CTM A;  5JEA J;  1HA5 A;  2AQ3 B;  3GTL B;  1B3A A;  3LNN A;  4RFB A;  2BE5 D;  2WKD A;  2ZXO A;  3A7L A;  1WD0 A;  4EVO A;  4RHS A;  2B63 B;  1GHJ A;  1ENF A;  4PV1 C;  1BBX C;  3NWS A;  4C1N K;  2D2C C;  5C5M A;  2F4I A;  2VUM B;  2JEB I;  1G8Z D;  3I4N B;  1KTK A;  5BN4 A;  1TWH B;  1RHP A;  1JOQ A;  1VMP A;  5IGB A;  1SYD A;  1EYD A;  3DEO A;  3DMU A;  5CR3 A;  1QOH A;  1ICW A;  3ND9 A;  2ZXP A;  4ZUI A;  1BCP D;  3S2H B;  3VA5 A;  1FNU A;  2EY6 A;  3NBI A;  4XXE A;  1Y8P B;  1VMC A;  1O7Z A;  1S5F D;  3S16 B;  3I70 A;  1WTO A;  1TWA B;  1BDO A;  4CJ0 B;  1GUN A;  1CA5 A;  4I65 A;  2F0E A;  3SK5 A;  3QO2 A;  2C9O A;  4Q0F A;  3K59 A;  4A3I B;  1EYC A;  4KK7 A;  3PUX A;  3G7L A;  2AQ2 B;  4L63 B;  1AFP A;  2F1M A;  4O42 A;  2AUJ D;  5EGT A;  1PRT C;  4UAI A;  5IOC A;  3RUZ A;  5TSS A;  3GQB A;  3S15 B;  2F0K A;  2KCN A;  1R4P B;  4IAL A;  2QEJ C;  1S4Z A;  4IFD H;  1SMY C;  4F8M A;  2FFK B;  4L8J A;  1STN A;  5I9O A;  1DJR D;  1NAP A;  1CT1 D;  1QG7 A;  2CW0 D;  3A54 A;  2L0C A;  5J1Z A;  2JSO A;  2EY5 A;  4A3D B;  2E75 C;  4C3I G;  3R2I A;  1Q90 A;  3C3L A;  5DM6 3;  3VA7 A;  3P75 A;  2EYL A;  3BDC A;  4NMZ A;  1F9S A;  4KKT A;  2K32 A;  3PIO 3;  4K14 A;  1EY7 A;  4XT1 B;  4EQN A;  2NTT A;  2A68 D;  2B2T A;  4HR7 B;  3R2T A;  3FEW X;  1AZQ A;  1Q1E A;  2B2T C;  2PZT A;  4ULL A;  4XQQ A;  2JA6 B;  2BDO A;  3IAY A;  3C1F A;  4CKE A;  3DEP A;  4ZK9 B;  3Q6S A;  1II3 A;  1PZJ D;  4DN4 M;  3TZD A;  1F2Y A;  1D1I A;  4C3I B;  2A69 D;  1S5B D;  1H9J A;  4KD3 A;  2Q8T A;  3S1R B;  1X3Q A;  2X6G A;  2B8F A;  2MJ8 A;  5COR A;  3I90 A;  1F2M A;  2FMM A;  2K33 A;  3GTM B;  1JIC A;  4ZUJ A;  4K6L A;  3FVQ A;  1S5E D;  2BA1 A;  2PW5 A;  1MI2 A;  3M3Y B;  2MP1 A;  1Q8I A;  1LTR D;  1U4M A;  4XT3 B;  3MTS A;  2CVR A;  1OXV A;  1C48 A;  4Y7N B;  4ME5 A;  1S5C D;  4F7X A;  3Q23 A;  4DA2 A;  2NZ1 D;  3J7A V;  3Q24 A;  1A2U A;  1V1P B;  5FO8 B;  2HUG A;  3PUY A;  3TDQ A;  1JWU D;  3QJY A;  4HSP A;  1RF2 D;  4ZKC B;  1O78 A;  3GV3 A;  5EKI A;  1SE2 A;  3SXH A;  4KKS A;  2F0S A;  1CHP D;  5HUR A;  1F9P A;  2KQ3 A;  4ZLT F;  2PCF B;  3GTQ B;  1EWC A;  3OPO A;  3WOF A;  3BDL A;  1EFI D;  1S5D D;  1NSN S;  2Q8R E;  5EPJ A;  3P20 A;  3TP6 A;  4MN3 A;  1NR4 A;  2XWJ B;  3FMC A;  1TII D;  2A6H C;  3I8Z A;  3GTO B;  3Q0A A;  4FXD A;  3KLR A;  5C44 B;  3A8J E;  1E2V A;  3HP3 A;  2EE1 A;  4DAP A;  2K28 A;  1VCI A;  1TS4 A;  2K01 A;  1EQT A;  3HOY B;  1B4O A;  1NUC A;  4HSV A;  1X3P A;  1UAP A;  1FR3 A;  1CM9 A;  3FPU B;  3DM1 A;  1HTP A;  1EEI D;  4NP5 A;  2RKS A;  1B50 A;  3K57 A;  4HMI A;  1G6Z A;  1EZ6 A;  4XYO A;  1EYA A;  4OO1 G;  3R93 A;  3RLF A;  3X3M A;  1BCP B;  1O7Y A;  4K8I A;  1KNE A;  4H0L C;  1MBY A;  4Q5V A;  1SSO A;  2EZV A;  3NSW A;  4X3U A;  4A3E B;  5I2Y A;  1TS3 A;  4H7B A;  3BVG A;  4K8J A;  3TP8 A;  2D62 A;  1I3Q B;  3OOC A;  1EY9 A;  2NUC A;  4DXG A;  3PUV A;  1CQF A;  1OXS C;  2RSO A;  1A2T A;  1JWM D;  5D3I B;  1WCM B;  1V1P A;  2K5D A;  1XWE A;  4MIU A;  1EZ8 A;  1BO0 A;  4OO1 I;  2LKV A;  4JK1 C;  4J1M A;  1WD1 A;  2F0N A;  1SDF A;  1QJO A;  1CQV A;  1XX8 A;  2X6L A;  1E2Z A;  5J22 A;  1QIL A;  1GUO A;  2Z8L A;  1A6X A;  2RDF A;  1PTO F;  1CZG A;  1SND A;  2A6E D;  2NVX B;  3NPP A;  4LJZ C;  1KDC A;  1BQQ T;  3SVM A;  1STA A;  3D4R A;  1Z7T A;  3D8G A;  2IPK D;  4OIK A;  1JB3 A;  2BE5 C;  2EY2 A;  3S1M B;  1TY0 A;  5CV5 A;  5I2X A;  3PMF A;  1EY4 A;  1FNV A;  1SNQ A;  3H3V C;  3F2U A;  4RCN A;  1TT2 A;  2MUY A;  4KJO A;  1B9M A;  3R8B A;  1Y69 U;  5KGU A;  5D14 A;  2WII B;  3SK6 A;  1V43 A;  2JA8 B;  1BOS A;  5LHY 1;  1B9N A;  2EYF A;  4DNR B;  4ZQ3 A;  2NWG A;  3E5S A;  3K5L A;  4BBR B;  1WTR A;  3SK4 A;  1MSG A;  2JE6 I;  5EPK A;  1JE4 A;  1HUN A;  1CFM A;  2NB0 A;  5ELC A;  3AB9 A;  3I73 A;  4DK1 A;  1PMR A;  3MHB A;  4ABN A;  2YYZ A;  2QKI C;  2L4N A;  2ZXR A;  4L6T B;  2OEO A;  1BCP C;  3MXU A;  1FNW A;  2RDG A;  1HFG A;  1NR2 A;  2EJM A;  1BR9 A;  3TP5 A;  4TKO B;  1GOZ A;  3FRP B;  1XYI A;  1QNK A;  2DNE A;  4C3H G;  2ENB A;  5IGF A;  2KCC A;  2SDF A;  3PUW A;  3KLS X;  1KDA A;  1STH A;  3IL8 A;  1STY A;  2F0D A;  2FMC A;  3PO2 B;  2KOL A;  4N9T A;  1ZYR D;  2AWO A;  1OO9 B;  1A3V A;  1K83 B;  1EY5 A;  1C4Q A;  5CV6 A;  1EY6 A;  5A2Q L;  2AQ1 B;  5E1F A;  1T5E A;  5I6W A;  3N6R A;  1D6E C;  3I91 A;  3OSO A;  1EIG A;  1HCZ A;  2CW0 C;  4RGM A;  2XRS D;  1G91 A;  1A15 A;  1RD9 D;  1ML0 D;  1F2Z A;  5KYL A;  5G3L F;  3OMG A;  4IFD G;  5C5L A;  3K5M A;  4ZRZ A;  4C3H B;  1Q12 A;  1SAP A;  4IUV A;  2EJF C;  2F0Q A;  1AEX A;  2GA4 B;  3D3R A;  1EEF D;  4RGN A;  4EQP A;  2FIN B;  4XYQ A;  5D3D A;  2QIL A;  2TSS A;  5KEE A;  3HOX B;  1LTA D;  3RMH A;  3L3O C;  3OW7 A;  1KLG D;  1FD7 D;  1AW7 A;  2KEE A;  3TP7 A;  2A73 B;  1V8Q A;  1QE6 A;  4IFD I;  4RGO S;  3GTJ B;  1CI3 M;  3S1Q B;  1PFB A;  2K05 A;  1JOK A;  4E6I A;  2RSN A;  4ODG A;  1U4R A;  3QWN A;  3BYY B;  1JOO A;  1X32 A;  1D5M C;  1STB A;  4PQX A;  3L9A X;  2F03 A;  2A69 C;  1ONL A;  1LTT D;  3MA2 B;  1RCV D;  1BXT A;  2CQA A;  4C56 C;  5CBA E;  4IUQ A;  1Y8O B;  2H4O A;  3URY A;  5C4H A;  3TME A;  4RKL A;  1ZXT A;  3NHH A;  4NKL A;  2F0F A;  5FO7 B;  2L55 A;  1PTO H;  2EVB A;  1PYW D;  3VYT A;  2EYO A;  2I07 B;  2J4X A;  1CZW A;  3MAQ A;  1TWG B;  4OGQ C;  3J80 L;  3W2D A;  1Y1V B;  1I50 B;  3I4M B;  5ELD A;  1GHK A;  3T51 B;  3NUC A;  5EJW A;  3T56 B;  5COY A;  3ITP A;  3HS0 C;  2YU9 B;  1ENA A;  5M3M B;  5EKK A;  5KNC A;  3A7A B;  2JP1 A;  3SR1 A;  2N88 A;  3KK7 A;  2VXW A;  5ELF A;  4K5W A;  4V0B A;  3BS1 A;  5CGK A;  1DOK A;  2SOB A;  1FGB D;  1SE3 A;  4FXK C;  5FLX E;  3I72 A;  1SYE A;  2NVY B;  5I4D A;  4JBW A;  2MHV A;  4KY6 A;  4IUP A;  1SYC A;  4F87 A;  2VB3 X;  5C6A A;  3QOL A;  3J81 L;  1IL8 A;  3HOU B;  3HRZ C;  2X69 A;  2LS0 1;  1HRJ A;  5FK9 C;  2R6G A;  3EFX D;  2PZU A;  3KBX A;  1WTW A;  5F2D A;  2K7V A;  5JAV A;  1EQV A;  5LL6 S;  5JJZ A;  1RTN A;  2B2V A;  4IUN A;  3O13 A;  3GO5 A;  2B2V C;  2M2L A;  4BA2 I;  5IGD A;  2C5C A;  5CMD A;  2PO4 A;  1GUW A;  4A93 B;  2RQX A;  1ROD A;  2E2I B;  1ET6 A;  2SEB D;  4QUC A;  3HOZ B;  4QB4 A;  4FF3 A;  3KF8 A;  5KIX A;  1IW7 D;  4DAV A;  4V19 0;  1A3T A;  1EY8 A;  3GTP B;  5CYU A;  4K6D A;  3NE5 B;  4M8A A;  2AWN A;  3M85 A;  1O7L A;  4CJ1 B;  4XQN A;  1RJT A;  4G4K A;  4RHR A;  5BN3 A;  5LL6 X;  1JCK B;  2K5W A;  2NVQ B;  5CV8 A;  2D9U A;  1QB5 D;  4B9X A;  2M00 A;  4K2K A;  4FP5 D;  5C4X B;  4IFD J;  1LT6 D;  1E2W A;  1TVX A;  2F0J A;  3MXP A;  4FF1 A;  5M5Y B;  3SE0 A;  2RDH A;  3T53 B;  1DOM A;  5IIF A;  2B39 A;  4OL7 A;  2KHS A;  2F0T A;  2WAC A;  1GUG A;  3L7Z C;  2WV6 D;  3P1H A;  2A6E C;  2B2U A;  3AMU A;  1STG A;  2G9D A;  2R92 B;  4C2M B;  2FJ2 A;  4F88 A;  3HEJ A;  3OWF A;  2PMZ B;  1LV9 A;  3CQZ B;  2E76 C;  2B2W A;  5M5W B;  2IJ0 A;  1K8O A;  4Z9C B;  2B2W C;  3S1N B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...