1IKMA

Nmr study of monomeric human interleukin-8 (30 structures)
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
69
structure length
68
Chain Sequence
ELRCQCIKTYSKPFHPKFIKERVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 1H NMR solution structure of an active monomeric interleukin-8.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine (chemotactic)
molecule keywords HUMAN INTERLEUKIN-8 (MONOMERIC)
total genus 10
structure length 68
sequence length 69
ec nomenclature
pdb deposition date 1995-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ikmA00
5EPKA 1G91A 2K04A 3Q6SA 1HA6A 1HRJA 3KBXA 2HCCA 2K03A 1DOKA 3IL8A 1CA5A 3SVMA 2MP1A 3DEPA 3G7LA 4XDXA 4RA8A 2FINB 1J8IA 1B53A 1QG7A 4X3KA 4XT1B 1O7YA 2B2VA 3DEOA 4XT3B 4R8IA 2NZ1D 4NW2A 3MWYW 1F9RA 2KEDA 4O42A 5D14A 2Q8TA 3QO2A 2N55A 1EOTA 1IL8A 1ZXTA 1ILPA 2EPBA 1HFNA 1KNEA 1F9SA 1U4RA 4MN3A 4ZKCB 1XYIA 5E4XA 1PFMA 2K05A 5EQ0A 2KOLA 1WVLA 3R93A 1G2TA 1AZPA 1X32A 5EKIA 2KUMA 2B2YA 2HDMA 1ICWA 2KECA 3UI2A 2EE1A 1QNKA 1PDQA 1BNZA 1WTOA 5JJZA 2EOTA 5D65A 1MI2A 1B2TA 1U4MA 5E4WC 2FMMA 5T1GA 3HP3A 1WTXA 2B2UA 4QUCA 2NYZD 2R3ZA 2K01A 2RSOA 3F2UA 3FPUB 4X3SA 2Q8RE 1RTOA 1Q3LA 1NR2A 1HFGA 2J7ZA 5EPJA 2K1BA 2L11A 1QE6A 2IL8A 1ML0D 2HCIA 5CBEE 4U68A 1U4LA 2RVLA 1PFNA 1KNAA 2FJ2A 4IURA 1PLFA 4IUUA 1AZQA 3D6WA 4IUPA 1X3QA 4HEDA 4DN4M 1WTRA 1O7ZA 4LMQD 3ONAB 4X3UA 1EQTA 1MGSA 2K28A 1ILQA 1J9OA 4UAIA 3I3CA 5COYA 5EPLA 1DONA 1WD1A 1A15A 2HDLA 3I8ZA 4X3TA 5DNFA 1PFBA 1RODA 2X6LA 1F2LA 1U4PA 2MGSA 1WTVA 1AP0A 2FFKB 5CMDA 3IFDA 4HSVA 2VXWA 3FDTA 3P7JA 1RHPA 2RA4A 1NR4A 4CJ2C 1DOMA 4ZKBB 1WD0A 3TN2A 3DM1A 1HUMA 1LV9A 1EIGA 5AFWA 1E0BA 4ZK9B 3KUPA 1MSHA 2FHTA 2KVMA 1B50A 1HUNA 1DZ1A 1C8CA 2L9HA 4RWSC 4CJ0B 4CJ1B 1G2SA 2X69A 1JE4A 1EL0A 2HUGA 2B2WC 1NCVA 2NWGA 2B2UC 3I91A 1JICA 2MJ8A 2B2YC 4IUTA 1WTQA 2KEEA 1IKLA 1B3AA 2JP1A 2MPMA 4IUVA 1XX8A 1TVXA 3I90A 1BBXC 1VMCA 2H1EA 4ZAIA 1MSGA 1S4ZA 3LWEA 4ZLTF 3N52A 1SAPA 3GV3A 3H91A 5EJWA 1WTWA 1WTPA 2L1BA 2BDNA 1F9PA 4IUQA 1EIHA 2L4NA 4HCSA 5CBAE 1CA6A 4OIKA 1ESRA 2CVRA 2DY7A 2XIWA 4R9WA 3TZDA 3GV6A 5T1IA 1SSOA 1G6ZA 2M2LA 1SDFA 4QUFA 1M8AA 1RTNA 2DY8A 2B2VC 1NAPA 1F9QA 2JYOA 2SDFA 3MTSA 4OIJA 1O80A 4MHEA 2B2TC 2N88A 2X6GA 4RAUC 5CORA 1RJTA 2B2TA 1X3PA 2B2WA 2L12A 1B4OA 2D9UA 2RSNA 1HHVA 1BO0A 4HAEA 1GUWA 1IKMA 1BF4A 1VMPA 1CM9A 1DOLA
chains in the Genus database with same CATH superfamily
1JOKA 5AJ3L 4QIWB 5EGTA 5M3FH 1CA5A 1DD2A 3BVGA 4XT1B 2L55A 4C3IH 4L6TB 4S3SA 1WCMG 1FL0A 1LM0A 5E4XA 2BH2A 2MNAA 3C2PA 2HDMA 3MXNA 1PH2A 4GKKL 2F03A 2PCFB 2KECA 3UI2A 3KF6A 1TWAH 3M4YA 4BBSG 2E2IH 1V9PA 1XTCD 2KCNA 1VCIA 4DFAA 3VR6A 1NBWA 3OW2A 3HOXB 5EPJA 3PO3H 1EOVA 4LF6Q 4DXFA 3D6CA 1IBKQ 2XWBB 2A8VA 4IPGA 4JOIA 2EJGC 5JVH3 2O5JC 2HQLA 1K8MA 4LMQD 4DR6Q 5EPLA 4ULLA 4JVZA 4JI5L 2ZTEA 2ICEC 1SLJA 1PH8A 4OO1H 4AQYL 4GN5A 4Q5VA 3FVQA 2F0LA 1L2FA 2VXWA 1TY0A 5CYUA 3U4VA 4OONA 1N9WA 4XQQA 3RN5A 5C4XB 2Y0SE 1VQ8A 1HUMA 1XTDA 5KYIA 4OHJA 4ZK9B 4YWMA 1C8CA 5M5XB 3H3VC 4OX9Q 1CQFA 1PYWD 1AE2A 2RKSA 4KKTA 4RGOS 2MJ8A 2Z6KA 2HD3A 3NWTA 2F1MA 4BY7G 2LMCB 2OF1A 4EVOA 3NQTA 4A3BH 1TR5A 1VQNA 3LWEA 2NB0A 3U50C 3VA7A 2UU9Q 3GP7A 5C6AA 3WDNA 1N32L 3KBGA 1Q81C 1PZID 5IYDH 4POFA 4ZQ3A 2AWNA 1Q90A 1BKBA 2UUAL 1Q82C 2RCFA 4RAUC 2B2TC 4GZYC 3KLSA 3S1NB 1ET9A 4A93B 3EQLC 3I4LA 3PUXA 4LFAQ 3KDFA 2N49A 5JEAH 4DR5Q 4Y52H 5M3MB 1DOLA 1D5XC 1HA6A 3A0JA 4F7XA 3PF4A 1OXXK 4HMJA 4OL7A 3NPPA 4RHSA 2ZXRA 2JJQA 5M5WB 1J8IA 3KDFB 3KLWA 3I2ZA 1O7YA 4A3EH 5HY6A 4KD4A 1STYA 4DUYQ 1JQYD 1MIUA 5ELOA 4MN3A 1XYIA 2AQ1B 2B39A 4KLKA 4I65A 5KGUA 5EKIA 4DGZA 2UUBQ 2LFNA 4KKSA 4GKJQ 4ID6A 1PFSA 1DM0B 4FF3A 5M9OA 4A3MG 1KLGD 2EY5A 1NMGA 2PO4A 3OOCA 2Q8RE 5J3BA 2IHEA 1F2YA 3BZKA 4KV6A 2R7FA 4KKUA 2RVLA 1TT2A 3KLRA 2B63H 1RDPD 3S24A 1X3EA 1VS0A 3STBC 4DKAC 1W2BA 2CFMA 1VQOA 4C3HG 2QW7A 2K5DA 1SNDA 3UDIA 1STAA 3K7AH 3KJPA 5FLMG 1B9MA 4NMZA 1YNJD 4N9PA 2WV6D 4DV7L 3MVVA 3QB3A 1FJGQ 1SFOB 1V1QA 1PA6A 1WD0A 5AFWA 3S1QB 1KABA 4LF7L 4A3LH 3RZOB 2JA6G 2EVBA 3DMUA 3TZUA 1G51A 1G2SA 2F0VA 1A6XA 1QVFA 2HUGA 3I91A 2B2UC 4C1NI 3I4MB 5KNCA 3A74A 4DAYA 2A6EC 2R7ZB 2A6HD 3RLFA 4ODGA 3UDXA 3S14B 2N8NA 4CBVA 3Q22A 2JEAI 1WTHA 4HJ8A 1YHBA 3NTIA 4PG3A 5IGCA 5IP9G 3T1YL 1G6ZA 4R9WA 2Q8IB 2EY1A 1EFID 2A68D 4ZRZA 4QUFA 1B7YB 2NVXH 4G57A 3HOUH 1VQMA 4JBMA 2IX1A 1VQCA 1X3PA 2ZM6L 2DNEA 3V05A 2IX0A 3IFTA 1SE4A 4UP8A 5CV8A 3SEBA 5G3LF 4GLAC 3AMUA 5C4XG 4LUOA 2F0TA 2JA7B 1TWGB 1VQFA 3FKIG 4YCWA 1J5EL 2AQ2B 1IL2A 1XPUA 3G7LA 5J22A 4JI4Q 2F0QA 4UDUC 3KF8B 3HZXA 4LF8L 1RD9D 2ASBA 3DEOA 3GQBA 2WAQE 4WFN3 3GTKB 3EN2A 3AB9A 2B8FA 4A3IH 2DGYA 3I4MG 3PIO3 1DJRD 1EUJA 3HOVB 3E3XA 4RFBA 3A55A 5C4JH 3K7UC 3K0YA 2K50A 4FO2A 4EQOA 1HR0W 3IAYA 3B6YA 5C0XJ 1B1ZA 4AYBE 1EY8A 3BVZA 3I70A 3E6ZX 3F2UA 4N9TA 2EY6A 4LK1C 4KJOA 3T51B 5LMNL 1EEID 1QE6A 3GTQH 4HTHA 1RL2A 2HCIA 1PFNA 4IUUA 1HNXL 3Q23A 1RIPA 3H09A 3WWVA 4A3MH 4B3SQ 3ONAB 2PQAB 5J1ZA 3CMEA 1G91A 1PTOD 3PUZA 1BVSA 4GNXB 1BCPF 4GN3B 1PVOA 3SHLA 1F2LA 4GKJL 4LF5L 1QJOA 3U58A 5ELEA 1LABA 2VQFL 2KBNA 4YY3Q 2XVSA 2WB1G 4A3JG 3T56B 4E6IA 1NE3A 2UUCL 2KVMA 3URYA 1O78A 4CJ1B 4KY5A 1EZ8A 1HA5A 2JSOA 2WAQB 3TP7A 4DR6L 5IYCG 2RDGA 4XIGS 4K6DA 3OWFA 1FGUA 4TVAB 4LF9Q 1TS4A 4ZYSA 3VR5A 1VQAA 2E5LQ 5LMNQ 4A3FH 3V96A 2DY7A 3CKIB 3NBHB 1RTNA 4N8FA 2B2VC 1GHKA 1K8AC 1CI3M 1EY4A 1PH1A 2G5DA 1PV4A 5K5PA 4DUZL 1LTLA 3W5OA 1SRUA 2D9UA 1A3TA 2CQOA 3F1ZA 1C48A 2GN5A 1TWAB 4ZUJA 5A35A 4OGQC 3RR5A 3M85A 2GVAA 1DCZA 4L63B 2EYMA 4DV6Q 1SROA 4NW2A 1X9NA 3MWYW 1UE1A 1PH4A 4IFDG 3AFPA 2R93G 1U9RA 1J5EQ 1FVIA 1CSPA 4LF4Q 5IY0A 3S1RB 1WVLA 4BY1G 4FF4A 2LSSA 4DR4L 1SNMA 1JMCA 3HOUB 1STBA 4IALA 3GTKH 1JORA 3NP8A 1CUKA 3J7YW 1KDBA 2V4DA 1HNWL 3CAMA 2J7ZA 4KK7A 4IFDJ 4C3JH 3PO3G 2DJFC 2JA7H 1N36L 1XPRA 1MJEA 1D1KA 3DXJC 5DEHA 1YZ6A 5IWAL 4DV3L 1M90C 3HOYB 3G48A 4EQNA 3RZOH 3MXGA 1V1PA 4PV1C 4A3DB 4PZ6A 4B3RQ 4YHHQ 5IGEA 4QCLA 3ND9A 5CMDA 1CKMA 1Y8NB 4A3JH 3OSOA 5IODA 3CCRA 4WJ3M 4ME5A 2IX3A 4J1MA 2J0TD 4B3TL 4B3MQ 1EIGA 2WACA 2L15A 1MSHA 2L9HA 2MFIA 5I2YA 4DV4L 1XXGA 3E5SA 1VQHA 1CZWA 5HGTA 2JP1A 3CCLA 3M7NA 3S2HB 1TVXA 1VMCA 3SXHA 5LL6S 1RCVD 1SYDA 1WYDA 2D5DA 2XIWA 4KHPQ 4R8NA 1EQVA 2PW7A 3L9AX 4R4CA 3CMAA 2QGQA 1L0WA 2AUKA 1Z47A 4DV1Q 4GNXA 1JWMD 1S5ED 4RG1A 2OT2A 2K6AA 1K8OA 3T1YQ 5IYBG 4IUNA 3CHBD 3SGIA 2WP8J 1CM9A 3FHWA 1UE5A 1GOZA 3CC7A 5EPKA 2K04A 5E3FA 2M00A 5IGDA 3HRZC 3T53B 1Q1EA 1YI2A 4JI3Q 5C4HA 1NY4A 3PSIA 1MD2D 3P20A 1SJED 2Z0SA 1B53A 5JPMC 2KCMA 4DAVA 4MNOA 4K2LA 3UE0A 1NMFA 3RZDH 3S9WA 1EOTA 1PRTF 3M3YB 2KQ3A 3NEMA 4J6HA 1QILA 1GUOA 4XTCS 3R93A 5LMUL 1G2TA 3GTGH 1BQQT 4A93H 5C4XH 1B9NA 3LNNA 4WRDA 4JK1C 4BY1B 2D0PA 2JEBI 5KEEA 1SYFA 2EYFA 4QMGA 1KHIA 2AWOA 3HOUG 3H0GG 2XSCA 5NUCA 2IHFA 2K1BA 4DV2Q 3J7AV 2IL8A 4U68A 3STBD 1CSQA 1I3QH 2BA0A 1WTRA 4NXNQ 1FD7D 1LTRD 3J81L 2F0MA 2HDLA 5DNFA 3A8KE 4X66Q 1UNSA 1Z9FA 1X65A 5C44H 1PRTB 2ZJPA 1E24A 1I6VC 2PYKA 5DAUA 2EXZA 1PYBA 2I5HA 5FO7B 5FLMH 1NCVA 1SNOA 4IOAA 1OTCA 2F3IA 4RGMA 1EWIA 1RKNA 1S4ZA 3NSWA 3MA2B 5ELBA 4JCVE 1WTWA 1PH7A 4UPAA 2F0WA 3K6OA 2BE5D 1ESRA 1UEAB 4CGYB 5T1IA 1Y1VB 5FJ8H 4WJWA 3EJIA 2JYOA 1H9MA 1F2ZA 2N88A 2NUCA 1QUQB 1STHA 1SNPA 1E22A 1I4PA 1UUPA 2MQHA 2NVQH 4DAYB 3M9BA 1EY9A 4HAEA 1L1OC 2VNUD 1CKNB 4C3JG 3DHQA 1X6OA 4A3DH 5AJ3Q 4DR7L 1GUTA 3IL8A 3HOVG 3V2TA 2Q2IA 3M4PA 5K36G 2K14A 1LT5D 5IP7H 4GLXA 2N3SA 2ALYB 3SK8A 4YWKA 3S17H 3LWUA 3RN2A 1H9SA 4BY1H 2K05A 3Q8DA 4JBKA 4LWCA 2ZJRA 1X56A 2K7VA 1ICWA 1PTOH 4GOPB 4IFDH 4X64L 3J80L 1BUVT 4C3IB 3RD4A 5GROA 5TSSA 1ENFA 4A76A 3I4NB 5EKLA 1Q3LA 2NVYB 1WJJA 4JI8Q 3BVMA 1ML0D 5L37A 1U4LA 1SMYC 2FJ2A 4P73A 2E2HB 4HIMA 4AH6A 3D4DA 5IP7G 1O7ZA 2C9OA 2AQ3B 3HOXG 4IPHA 1BCPC 3K5OA 4LFBL 3KF6B 1I4GA 4JG2A 1QUQA 1H9JA 1Q86C 4G7OC 3PUVA 4J8QA 1EY6A 1C9OA 3OHXC 4DV0Q 3TQYA 3FPPA 1KRSA 4TSSA 4EQPA 2RA4A 3MHBA 4DV5L 4IPDA 2K5HA 5CV7A 3UDFA 1KD1C 5H1SE 3K8AA 4QQBX 1UWVA 4JYAL 4UP7A 1IXRA 2X69A 4JPBW 3P75A 4DR1L 1XX8A 1TQOA 1PTOC 4R4IA 5IT9E 3OIQA 2K4KA 3UE1A 2FMCA 3HOVH 2UXCQ 1N33L 4DV5Q 4AQYQ 1UAPA 4IJHA 4K0KL 1CA6A 4OIKA 4C56C 4YHHL 1SR3A 2A73B 3T13A 4JI7L 1TY2A 2LS01 1V43A 4QL5A 1W6KA 2AUJD 2NTTA 1YHAA 2F0HA 1A0IA 2RSNA 2XRSD 4BS9A 2HHHQ 2Z4IA 4OWWB 2MO0A 2CHBD 1V1PB 1LLRD 1N33Q 3K5NA 2R93B 4C2MB 5C4JB 1HZBA 4B3RL 4A75A 4R4QA 4KY7A 1BDOA 1SE8A 4OO1I 1QG7A 3PMFA 2F0GA 2I07B 3H0GH 2NN6H 2VUMG 3GDEA 1CHQD 1EYDA 3J80i 3T16A 4DK6C 1X32A 4K5VA 2VL6A 4A3IG 3I4MH 4B08A 5E7NA 3O13A 2ENBA 5C44G 1CKOA 4XXEA 4DV4Q 3H3VH 3JAMi 3HP3A 1P8LA 2R3ZA 3MXPA 2K01A 2JA5H 3FKIH 1GVPA 4JC0A 1HJPA 1A2UA 1IHZA 4A3CH 3SK4A 2SEBD 1PH5A 2L11A 4CDDC 4I7AA 2OQKA 2F0PA 4R4TA 3HOZG 1HPCA 3J80c 2DN8A 4N8X1 3I72A 2Z4HA 1Y1VH 4WJ4A 1TXYA 2K28A 4IFDI 1J9OA 2BDOA 1AEXA 4NKLA 2CW0C 3JAMc 4FXGC 4CDCC 5ELDA 2KCCA 3E9HA 1XNQQ 4L8JA 3HOZH 4QIWE 2VUMB 4CJ2C 3CCUA 1HNZQ 2E2JH 3GTMH 2MHVA 3F8TA 4A3CG 1E7ZA 4UHVA 1ASZA 1SE3A 1HTLD 2D2CC 1YITA 2R61A 3MXUA 3JAML 1Y69U 3CU7A 3A56A 3K7AB 2B2WC 5C44B 3K81C 4NXNL 1IKLA 3TREA 3G6JB 1IZ6A 5C5MA 1K9MC 1QWYA 1VQ4A 4H44C 1JCKB 3N52A 1SAPA 3GV3A 4LAAA 3CC4A 3TMEA 5JEAJ 4HCSA 4DAPA 2IJ0A 4WORA 1ZKOA 4LUZA 3ERQA 1EY0A 2R7ZG 1JOOA 3D3RA 1AP0A 3HEJA 5CV9A 5CORA 4KN7C 1F77A 1GUGA 4JOIC 5BR8L 2VS1A 4BBRH 1VQIA 2D0OA 4G7HC 1LT4D 4XYQA 3W1GA 1E2ZA 2IWHA 1A62A 1VQBA 1PMRA 3C1EA 2EYHA 2NN6I 4POGA 4XYOA 5IOCA 1G6PA 1TWHH 3GTJB 3HFZB 1LYLA 4R8IA 1XMQQ 1F9RA 2UUBL 2JA7G 3U9OA 3BG3A 2EPBA 3CF5A 1IBKL 1I3QB 1ENAA 4LF9L 4K2KA 1B44D 2EXDA 1ICFB 1H95A 1PDQA 2AMCB 5BN5A 2SOBA 1K28A 3IRBA 4YIJA 1MI2A 1B2TA 3NXWA 4J15A 1K73C 3AU7A 3NENA 2EZVA 2KHIA 4O1NA 2NYZD 1CTMA 2PQEA 3FPUB 2Q2HA 1V1OA 2JN4A 4DAMA 1Y1WG 4JI1L 2R93H 5CBEE 3OTOQ 3AYHB 1QCBD 1FNVA 3G71A 1QVGA 4IUPA 4X66L 1CFMA 3AQQA 2AHOB 3W2DA 4RCOA 1CKNA 2V1CC 1MJCA 3VYRA 1ILQA 3HKZG 1KRTA 3J7ZC 2YTXA 4H02A 3QJYA 5E1FA 3MFYA 1RODA 3CCVA 1BR9A 2JA9A 3KOJA 1SXTA 1S5CD 3PIOA 3J81j 3JC66 1XWEA 3KF8A 5M3MG 1GHJA 4A3BG 3MAQA 3PO2H 1IYUA 1CHPD 4BY7H 1VQKA 4G4KA 4JI8L 3H6MA 3CD6A 2E2IB 1GXDC 4RWSC 1JOQA 1TU2B 2PZWA 4DR2Q 5JJLA 5KNDA 1LTBD 1ENCA 2F52A 2F0OA 2CQAA 2VY3A 4LF7Q 2K75A 3I90A 4ZAIA 4APVA 1Y1WH 4B3ML 4M8AA 5I6WA 2QEXA 1HZ9A 2SNMA 3I4NH 2BE5C 3FMCA 5JAVA 4JI6L 3R8BA 3PQIA 1MKHA 1O7LA 4MHEA 3OMGA 3BYTB 2XTIA 1EWCA 4RMFA 1B4OA 4X65Q 1UE6A 2UXDQ 3MZ5A 1GUWA 2A6ED 1HRJA 3CQZB 3UDGA 1W3SA 2K03A 5IGGA 2ZM6Q 2NVYH 5C5LA 4X3KA 3MXNB 2B2VA 4UP9A 1I94L 3KYHC 2Q8TA 2E2DC 2EJMA 3QO2A 4QB4A 2RCNA 3R2IA 4PZ8A 3L0OA 2Y0SG 5EQ0A 1PXUA 1Q8KA 1STEA 3D31A 1Q8IA 1K83B 3D4RA 1VQ7A 1A2TA 1STNA 3PV0A 4A4IA 5GAGC 3CPWA 3S2DH 3A5ZB 2PZUA 2C5CA 4JI6Q 1HQMC 4KMUC 5M3FG 1HFGA 3CP0A 4NXML 4H7BA 5DM73 3TS2A 1FR3A 3ULLA 3CCJA 2PNRC 4KHZA 2PPBC 2RDFA 3H3VI 4KD3A 2RBMA 4DN4M 1ZEQX 3WOEA 1KXLA 3HKSA 3J81i 1WI5A 3I3CA 4V190 3EFXD 1WTVA 1KDAA 2UUCQ 1DGSA 1EU3A 4RGTA 3BS1A 2Y0SB 5C0XI 3HOWH 1FNUA 1YNXA 1Q12A 4FP5D 5ELNA 4DR3L 1EL0A 2N78A 5IP9H 2B2YC 4BBSB 2KEEA 1Y8PB 1HZAA 2JA8B 2A6HC 2JA8H 1BCPD 2O2LD 1Y1WB 2G9HD 1GJXA 1WFQA 3F2CA 4GOPA 2L1BA 2BDNA 1F9PA 5JVG3 4IUQA 5I9OA 2O5IC 1LT3D 3GO5A 5BN4A 3S1NH 5FK9C 1I5FA 1KC8C 1TS2A 3NHHA 4OIJA 5A2QE 1E1OA 1Q7YC 3CRKC 4DR3Q 4JI0Q 2B3GA 1RJTA 3PO2B 2B2TA 1PZKD 2E75C 3W1BA 2AKWB 1K8GA 2E5LL 1BBUA 1D2BA 1BF4A 1LT6D 1S3OA 4CHTB 1RF2D 2ZJQA 3K58A 3GTPB 1SYCA 3EBEA 2MP1A 4C3HB 1NSNS 3NQIA 4C3HH 2Z8LA 1CZGA 2FINB 3PUWA 1I6HB 4A3FB 3QG1A 1L0XB 1K3BC 1ASYA 3ZYYX 5ELFA 1VQDA 2B63G 4A3IB 4JBJA 1F9SA 4X62L 2JA6H 1J6QA 2CKZB 1JWUD 2KOLA 3HKZE 1HR0Q 4ZUIA 4LFAL 4YCVA 4HSPA 1K83H 2SNSA 2F0NA 3W3AA 2XNAC 3J81c 5GAEC 3TSSA 3RZDB 3E0EA 1D8LA 3VYTA 1N34L 3NE5B 2RF4A 2F0UA 4GKKQ 4X3SA 1QOHA 1YJWA 1HNXQ 1KTKA 3ZJYC 1R4PB 2IY5B 3TP6A 2EDGA 4F8MA 1OO9B 2MUYA 3BZCA 1EQQA 2G9DA 1KNAA 2F4IA 5HGQA 4XQJA 4A3EG 2DNCA 4C1NK 2VW9A 1R4QB 5GADC 2KCTA 2RDHA 5C3EG 1WD1A 1A15A 2BH8A 2LKVA 4TQUS 3M4OB 2OTJA 4H0LC 4TKOB 3QR8A 2B29A 2EYOA 3VA5A 5JEAG 4DV3Q 3FDTA 3L7ZC 1EIFA 1NUCA 1RHPA 4HJ5A 1EY5A 3SK6A 1E0BA 5FO9B 2JXMB 1HUNA 2CCZA 1X54A 5CR3A 3CPFA 4HJ7A 4DR2L 5IYDG 4ABNA 1OXTA 2EQSA 1STGA 1FYCA 5M3FB 4IUVA 4P71A 3A5UA 1R9TB 1HZCA 2P5ZX 2XN9C 5LMNW 3E9IA 3H94A 1WTPA 5CBAE 4RGNA 4K8JA 2NBFA 4K5XA 3PUYA 2KA7A 4MIUA 5GAHC 1F9QA 3SR1A 5I2XA 1SMXA 5D3DA 4CKCA 1SN8A 5F2DA 4KHPL 1BO0A 1SYBA 5IT9L 2RQXA 2D62A 3TP5A 1JJ2A 3PO2G 1SFOH 3PCOB 2UXBQ 2HIVA 1XMOL 3SE0A 3GTOB 2NVXB 2F3WA 2I0QA 4RA8A 2XWJB 2JA6B 3VYSA 2KEDA 4O42A 2A5HA 4R1JA 5I4DA 4A3FG 1HFNA 1KNEA 4P72A 4OWXB 3QOJA 2PZTA 4DV7Q 2OTLA 4X65L 2UXDL 1AN8A 3OIPA 1L1OB 1QNUA 3G6EA 1NTGA 2F3VA 4IZ8A 5C3EH 2WAQG 4JBWA 5FJ8G 1I50H 2R92H 4BA1I 2BOSA 5IWAQ 2UUAQ 3K5MA 2QCPX 2UXCL 3EIVA 4EGVA 3HOYG 2CWPA 5FLXc 1WCMH 1A8VA 2F4VL 1SYEA 3EVQA 1M4VA 1X3QA 4HEDA 3OYYA 5EBCA 4DPGA 4DK0A 3F2DA 1PH6A 1DONA 1EYCA 4A3BB 5C4ZA 4X3TA 2B63B 2DJGC 2OCEA 4BBSH 1PRTD 2JE6I 1LTGD 4HSVA 5G3LD 3P7JA 4HMIA 4ZKBB 3DM1A 2A69D 3PF5A 1H9RA 5IE8A 2OWOA 1AW7A 3L3OC 1OXSC 4DV6L 1PTOF 4AYBG 2KHJA 5FO8B 2EYLA 5M5YB 1TWCH 2DUDA 2ZT9C 1JT8A 2WINB 5EJWA 5CGKA 4DV0L 2C35B 1EIHA 4A3EB 2CVRA 2Z6KC 3GV6A 3VR2A 4LFBQ 4K6LA 2YV5A 1M8AA 1NJIC 1TS3A 5JOBA 5C3EB 4JI0L 1OXVA 1YJ9A 1D5ZC 2LXKA 3L2PA 5M5XH 1LTAD 1Z7TA 2VB3X 3K80C 1LUZA 1YVCA 4YWLA 1TWHB 5C0XG 3GTJH 1WCMB 3S2DB 2JQOA 2YTYA 3I73A 4LFCQ 4DNTB 3KFUA 3T1HL 1I4HA 2NVTB 4LUVA 1IBLL 5LHY1 2H5XA 2EYPA 2XGTA 2NZ1D 1XNRL 1VF7A 4BWGB 3ERSX 1S5BD 5C3WA 1ZXTA 4DR7Q 1TWFB 3P1HA 3DWAA 2RHSB 2KUMA 3DLLA 2F0FA 1S40A 3HGBA 4OWTB 4IO9A 4ALPA 1QNKA 1WTOA 1LTID 4MZ9A 3CW2C 4IPCA 5BN3A 3T1HQ 1E2VA 1KAWA 5E4WC 2MO1A 5T1GA 4QUCA 1YNJC 3MEFA 3D8GA 2NZHA 2RSOA 3U4ZA 3HS0C 1FNWA 4F87A 3QOLA 1BBWA 2QF7A 3GTLH 3D4WA 4IQZA 3S17B 3FKIB 2NN6G 2VUMH 1AZQA 1E3PA 2LXJA 1JB7A 4PMCA 4GLVB 3MEHA 4HR7B 3HOZB 2PMZE 2F0JA 2X6LA 5GQOA 1CK1A 1EIYB 1V8QA 2Z9HA 4JV5Q 2OXPA 3E0JA 3IFDA 2NVQB 2I5LX 3VR4A 2NZOA 2ZTDA 1L1OA 3BDOA 5EKKA 5DM63 4BY7B 3ULJA 3KUPA 4QY7A 4A3KH 4EX5A 4JI2Q 1KAAA 4DNRB 3OW7A 3Q0AA 1TIID 4DNIA 2L5TA 3CCMA 1VQ5A 3J81E 3S15H 3VR3A 1AE3A 4FVMA 5FLXE 5IGBA 4M1UB 4ZLTF 2OQ0A 3M3YH 2CWAA 4AYBB 2EY2A 2YU9B 2L4NA 1EFWA 1I4XA 2Q2UA 1VQPA 5CC4A 3ULPA 4A3GG 2LY7A 4G7ZC 1K0RA 3MTSA 4JI2L 1ZYRD 2R92G 1JB3A 4KN4C 1SEBD 1GM5A 1JC7A 3CCEA 2L0CA 3CC2A 1VQGA 1JR0D 4CDEC 3S1MH 5KRUA 4GOPC 4JV5L 2EYJA 5M5WH 3RLOA 4YCUA 1F2MA 4XT3B 4HIDA 4DUZQ 1EZ6A 1KL9A 2A19A 5D14A 1L0YB 3T4AC 4L5SA 4LJZC 4PQXA 1IL8A 1ILPA 5M3MH 1DXMA 1KLUD 4A3MB 1PFMA 2K52A 4PZ7A 3S2HH 2HHHL 4CDFC 2ZTCA 4OEMB 2ZXPA 1GO3E 3HOWB 1VQ9A 4A3GB 3NELA 4A3KB 4BXXG 4JI3L 2J4XA 2FMMA 5FKAC 2B2UA 2CH4W 2R6GA 2R92B 4OX9L 1WOCA 1Y8OB 4DR4Q 1S72A 3FP9A 4Z9CB 2QDLA 3GTPH 1E1TA 1A3VA 1QZHA 1PLFA 4NDXA 1IBMQ 2VQFQ 3D6WA 4OO1G 1D7QA 1QB5D 3TRZA 4DR1Q 3PO3B 4LF5Q 2Q2TA 1EY7A 1W6JA 5COYA 4HIKA 3K57A 1T5XD 3G4SA 1EEFD 3ER0A 5J39A 3ITPA 3DM3A 2QILA 1U4PA 1X3FA 1D1IA 1H9SB 5DLQE 3OTOL 1GD7A 1YHQA 4KI0A 3S16H 1OXUA 4A3DG 3CXCA 2A74C 2PQAA 4O2DA 4X62Q 3TN2A 2VQEQ 3J7A5 4CKEA 4HN7A 1K0SA 4NP5A 1DZ1A 1BOSA 1PZJD 3TDQA 1M1KC 1JE4A 4AIMA 3DWPA 4A3KG 2YU9H 3TBIB 2MPMA 1CQVA 4KY6A 2TSSA 1FGBD 3CCQA 1BBXC 5ISRA 1MSGA 3A7LA 2K5QA 2WB1E 3AEVA 1SE2A 3TS0A 3K0XA 1PRTC 1T9HA 2CH4A 2WFWA 3M4QA 1SSOA 3X3MA 1C7YA 4C3IG 5BR8Q 1VQ6A 2A69C 2X6GA 2R7ZH 4NPSA 1X55A 3GD7A 4MTNA 3VYUA 2B2WA 1C4QA 1SNCA 4JI4L 2PNHA 5JPNC 2VQEL 4KJNA 1A3UA 1JJGA 2K5VA 1CT1D 3DUZA 2UU9L 3NBHA 5CV5A 1E2WA 2F0KA 3S1QH 5KNBA 2B8GA 3DEPA 4XDXA 3FEWX 4EQ5A 3NBIA 4ME3A 1HXYD 3J80E 3LX0A 2K32A 1K3RA 2FXQA 1U4RA 1HTPA 1AZPA 1XNRQ 1KQSA 2QA4A 1PH9A 1BNZA 2EE1A 1YEZA 5ELCA 4GNXC 5JJZA 4K14A 1N8RC 1D6EC 3H15A 2PI2A 2K33A 1B3QA 4JI7Q 3I7FA 3PGZA 1NR2A 3R3OA 1LTSD 2QKIC 4DR5L 3U9SA 5I6YA 5JJKA 3CQZH 1AH9A 2I5MX 3D0FA 4B9XA 4HCEA 5I9PA 4IURA 3S16B 4DK3C 3IKJA 4B9WA 4MTKA 3S1MB 2NVTH 1TWCB 4ZCKA 1EQTA 3OWEB 2ID0A 2WB1B 2E76C 1BXTA 3TP8A 3A8IE 4FNFA 1Q46A 3N6RA 1IBML 4L5QA 4Q0FA 4IJLA 4K8IA 1II3A 1NR4A 3AFQA 1DOMA 3HOWG 2WKCA 5A2QL 1IYVA 5KIXA 2KJXA 1XPOA 3F2BA 3EA6A 3KLSX 4U673 3FRPB 3BYYB 5FLXL 3C3LA 4PNYA 1YIJA 3A8JE 4HJAA 1U0LA 1GUSA 1JJCB 1LACA 4GN4B 2E2HH 2I46A 1ESFA 3TZDA 1A63A 2SDFA 1NAPA 1X3GA 4FXKC 5FOBB 4B3SL 4FDBA 1S5DD 4ILWA 1XMQL 1QVCA 1MBYA 4JW0A 4Y7NH 1N32Q 3LGJA 2L12A 2JK8A 1HHVA 5LMUQ 1FJGL 3NTHA 1SBBB 3HOYH 1PTOB 3C1FA 3HG9A 4PMWA 3Q6SA 3KBXA 2KENA 1DOKA 4IOCA 2IPKD 1VQEA 2CW0D 5C3XA 3PIP3 3HKZB 1I4RA 1T5EA 3A54A 4PMBA 1G291 3RLNA 2VZAA 3DWQA 4UY8C 3S14H 3MC0B 1YJNA 4FF1A 4QGUA 4BBRB 1VQLA 3Q24A 4LF4L 1I50B 3GTMB 2E2JB 4BXXH 1YBYA 3NUCA 1N34Q 1HQRD 3I4OA 1Q1BA 3HOXH 2GVBA 1PH3A 1U4MA 2YYZA 3NWSA 2H4OA 4O0AA 3VDYA 5EBDA 2R7DA 2UXBL 1VF5C 4B3TQ 3S15B 2E74C 4C3JB 4HJ9A 1SYGA 3K5LA 3I4NG 1Y14B 1SJHD 3M4OH 1SMYD 2QEJC 2YTVA 1YNNC 3JAME 1HH2P 1B70B 2ES2A 2JA5B 1JWSD 4JI5Q 1PFBA 4LFCL 4X64Q 2PI2E 2HT1A 1EYGA 3J7AF 2MGSA 2K5WA 1EU4A 2WKDA 2FFKB 3S1RH 3BDLA 2NTSA 4DF7A 2A68C 3PIPA 1HNWQ 4CKBA 1LV9A 3BDCA 1B50A 4KTAA 1YNND 1TS5A 4CJ0B 2BCOA 5K36H 1WTQA 4IUTA 1PHJA 1B3AA 1BCPB 4RKBA 5LL6X 3K59A 1R9TH 4OELB 5D3IB 3H91A 4DU9A 1O7IA 4DK1A 4HIOA 4NB3A 1I4QA 4RH6A 1GKHA 3A7AB 2M2LA 2DY8A 1ZYRC 5IYCH 5EAYA 1IBLQ 3SDZA 1I94Q 4QF4A 1TWFH 2PMZB 2OEOA 4RKLA 2M9VA 4F88A 4FYDA 1H9KA 4L5TA 3OMCA 4YY3L 2RHQB 3BU2A 3TEHB 4A3GH 1U5KA 2KHSA 4DV2L 2HIXA 3RMHA 2HCCA 4DUYL 4P75A 5HURA 3SVMA 3GTGB 1ONLA 1P16A 3QWNA 3KJOA 1UEBA 3R2TA 2E8GA 4FF2A 1SNQA 4P74A 2F0DA 2F0SA 2WIIB 2ZXOA 5IT9c 2N55A 2A1AA 1HR0L 1IYJB 2IW3A 4L5RC 1VQJA 2F4VQ 4ZKCB 1B8AA 1VDZA 4K0KQ 5CV6A 4Y7NB 4FXDA 2B2YA 2TMPA 2O4XA 4K5WA 2ATWA 3WOFA 3ICEA 3H0GB 3OPOA 3RNUA 2EOTA 1D5MC 3QIAA 5D65A 4BBRG 4DA2A 1KIXA 4I7ZC 1EQRA 5M5YH 1C0AA 4V0BA 4LF8Q 3NTKA 2F0EA 1WTXA 1LO5D 5CV4A 1RTOA 3I55A 1MHWC 1XMOQ 1IW7D 1KDCA 4R4OA 4C2MH 1JE5A 1TWGH 3GTOH 5IIFA 1I6HH 1UE7A 3CCSA 5JJIA 2QDBA 4X3UA 1MGSA 4UAIA 4DV1L 2Z6BA 2XRQD 3I8ZA 1LTTD 2PW5A 3SK5A 4H13C 5C0XH 4JYAQ 4DXGA 3BZDB 2IT1A 4A93G 2VB2X 2HQEA 2EJFC 2GA4B 1IW7C 2ICIA 2K5NA 3KK7A 1S5FD 4OXPA 4JI1Q 3GTQB 3C46A 2FHTA 2JA8G 4RHRA 3ND8A 4GS3A 3CRLC 4X6AH 2NWGA 3I56A 1TKWB 1JICA 1NNXA 2EIFA 4XQNA 3M7GA 1Y1VG 1HNZL 4A3JB 2H1EA 4LNQA 3NK9A 1EYAA 1QZGA 3BJUA 1XNQL 1G8ZD 1AFPA 4NXMQ 1N36Q 5KYLA 5IYBH 3X3NA 5IGFA 2F0IA 4TRDA 1SDFA 1DYQA 1Z6HA 2JA5G 1O80A 2Z1CA 4IN3A 3EROA 3RUZA 1HCZA 2BA1A 4KHVA 4QJFA 1GUNA 3GTLB 1EWHA 4LF6L 4A3LG 3MFGA 1ET6A 1PYSB 1XJVA 4BA2I 4P2CB 1IKMA 1VMPA 4RCNA 4LW1A
chains in the Genus database with same CATH topology
1JOKA 4QIWB 5EGTA 1CA5A 1DD2A 3BVGA 4XT1B 2L55A 4L6TB 4S3SA 5E4XA 3C2PA 2HDMA 3MXNA 2F03A 2PCFB 2KECA 3UI2A 3M4YA 1XTCD 2KCNA 1VCIA 4DFAA 3VR6A 3HOXB 5EPJA 4DXFA 3D6CA 2XWBB 2EJGC 5JVH3 2O5JC 4LMQD 1K8MA 5EPLA 4ULLA 2ICEC 4OO1H 4Q5VA 3FVQA 2F0LA 2VXWA 1TY0A 5CYUA 5C4XB 4XQQA 1HUMA 5KYIA 4OHJA 4ZK9B 1C8CA 5M5XB 3H3VC 1CQFA 1PYWD 2RKSA 4KKTA 4RGOS 2MJ8A 3NWTA 2F1MA 2LMCB 2OF1A 4EVOA 3NQTA 1TR5A 3LWEA 2NB0A 3VA7A 3GP7A 5C6AA 3WDNA 3KBGA 1PZID 4ZQ3A 2AWNA 1Q90A 4RAUC 2B2TC 4GZYC 3KLSA 3S1NB 1ET9A 4A93B 3EQLC 3I4LA 3PUXA 5JEAH 5M3MB 1DOLA 1D5XC 1HA6A 4F7XA 1OXXK 4HMJA 4OL7A 3NPPA 4RHSA 2ZXRA 5M5WB 1J8IA 1O7YA 4KD4A 1STYA 1JQYD 4MN3A 1XYIA 2AQ1B 2B39A 4I65A 5KGUA 5EKIA 4DGZA 2LFNA 4KKSA 4ID6A 1DM0B 4FF3A 5M9OA 1KLGD 2EY5A 2PO4A 3OOCA 2Q8RE 1F2YA 4KV6A 4KKUA 2RVLA 1TT2A 3KLRA 1RDPD 4C3HG 2K5DA 1SNDA 1STAA 1B9MA 4NMZA 1YNJD 4N9PA 2WV6D 3MVVA 3QB3A 1SFOB 1WD0A 5AFWA 3S1QB 1KABA 3RZOB 2EVBA 3DMUA 3TZUA 1G2SA 2F0VA 1A6XA 2HUGA 3I91A 2B2UC 4C1NI 3I4MB 5KNCA 4DAYA 2A6EC 2R7ZB 2A6HD 3RLFA 4ODGA 3S14B 4CBVA 3Q22A 2JEAI 3NTIA 5IGCA 1G6ZA 4R9WA 2Q8IB 2EY1A 1EFID 2A68D 4ZRZA 4QUFA 4G57A 2IX1A 1X3PA 2DNEA 3V05A 2IX0A 3IFTA 1SE4A 5CV8A 3SEBA 5G3LF 3AMUA 2F0TA 2JA7B 1TWGB 2AQ2B 3G7LA 5J22A 2F0QA 4UDUC 3HZXA 1RD9D 3DEOA 3GQBA 4WFN3 3GTKB 3AB9A 2B8FA 3PIO3 1DJRD 3HOVB 4RFBA 3A55A 3K0YA 4FO2A 4EQOA 3IAYA 5C0XJ 1B1ZA 1EY8A 3BVZA 3I70A 3E6ZX 3F2UA 4N9TA 2EY6A 4LK1C 4KJOA 3T51B 1EEID 1QE6A 4HTHA 2HCIA 1PFNA 4IUUA 3Q23A 3H09A 3ONAB 5J1ZA 1G91A 1PTOD 3PUZA 1BCPF 3SHLA 1F2LA 1QJOA 5ELEA 1LABA 2XVSA 3T56B 4E6IA 2KVMA 3URYA 1O78A 4CJ1B 4KY5A 1EZ8A 1HA5A 2JSOA 2WAQB 3TP7A 2RDGA 4XIGS 4K6DA 3OWFA 1TS4A 4ZYSA 3VR5A 3V96A 2DY7A 3CKIB 1RTNA 2B2VC 1GHKA 1CI3M 1EY4A 5K5PA 2D9UA 1A3TA 1C48A 1TWAB 4ZUJA 5A35A 4OGQC 3M85A 1DCZA 4L63B 2EYMA 4NW2A 3MWYW 4IFDG 1U9RA 3S1RB 1WVLA 4FF4A 1SNMA 3HOUB 1STBA 4IALA 1JORA 3NP8A 3J7YW 1KDBA 2V4DA 4KK7A 2J7ZA 4IFDJ 1D1KA 3DXJC 5DEHA 3HOYB 4EQNA 3MXGA 1V1PA 4PV1C 4A3DB 5IGEA 4QCLA 3ND9A 5CMDA 1Y8NB 3OSOA 5IODA 4ME5A 2IX3A 4J1MA 2J0TD 1EIGA 2WACA 1MSHA 2L9HA 5I2YA 1XXGA 3E5SA 1CZWA 5HGTA 2JP1A 3M7NA 3S2HB 1TVXA 1VMCA 3SXHA 5LL6S 1RCVD 1SYDA 2D5DA 2XIWA 4R8NA 1EQVA 2PW7A 3L9AX 2AUKA 1Z47A 1JWMD 1S5ED 2OT2A 2K6AA 1K8OA 4IUNA 3CHBD 2WP8J 1CM9A 1GOZA 5EPKA 2K04A 5E3FA 2M00A 5IGDA 3HRZC 3T53B 1Q1EA 5C4HA 1MD2D 3P20A 1SJED 1B53A 5JPMC 4DAVA 4K2LA 3S9WA 1EOTA 1PRTF 3M3YB 2KQ3A 4J6HA 1QILA 1GUOA 4XTCS 3R93A 1G2TA 1BQQT 1B9NA 3LNNA 4WRDA 4JK1C 4BY1B 2JEBI 5KEEA 1SYFA 2EYFA 4QMGA 2AWOA 5NUCA 2XSCA 2K1BA 3J7AV 2IL8A 4U68A 2BA0A 1WTRA 1FD7D 1LTRD 3J81L 2F0MA 2HDLA 5DNFA 3A8KE 1UNSA 1PRTB 1I6VC 2PYKA 5DAUA 2EXZA 5FO7B 1NCVA 1SNOA 4RGMA 1RKNA 1S4ZA 3NSWA 3MA2B 5ELBA 1WTWA 2F0WA 3K6OA 2BE5D 1ESRA 1UEAB 4CGYB 5T1IA 1Y1VB 4WJWA 3EJIA 2JYOA 1H9MA 1F2ZA 2N88A 2NUCA 1STHA 1SNPA 1I4PA 1UUPA 1EY9A 4HAEA 2VNUD 4C3JG 3DHQA 1GUTA 3IL8A 3V2TA 5K36G 1LT5D 3SK8A 3LWUA 1H9SA 2K05A 2K7VA 1ICWA 1PTOH 4IFDH 3J80L 1BUVT 4C3IB 3RD4A 5TSSA 1ENFA 3I4NB 5EKLA 1Q3LA 2NVYB 3BVMA 1ML0D 1U4LA 1SMYC 2FJ2A 2E2HB 3D4DA 1O7ZA 2C9OA 2AQ3B 1BCPC 3K5OA 1I4GA 1H9JA 4G7OC 3PUVA 4J8QA 1EY6A 3OHXC 3FPPA 4TSSA 4EQPA 2RA4A 3MHBA 5CV7A 2X69A 3P75A 1XX8A 1TQOA 1PTOC 5IT9E 3OIQA 2FMCA 1UAPA 1CA6A 4OIKA 4C56C 2A73B 3T13A 1TY2A 2LS01 1V43A 1W6KA 2AUJD 2NTTA 2F0HA 2RSNA 2XRSD 4BS9A 2Z4IA 2CHBD 1V1PB 1LLRD 3K5NA 2R93B 4C2MB 5C4JB 4KY7A 1BDOA 4OO1I 1QG7A 3PMFA 2F0GA 2I07B 2NN6H 1CHQD 1EYDA 3T16A 1X32A 4K5VA 4B08A 3O13A 2ENBA 4XXEA 3HP3A 2R3ZA 3MXPA 2K01A 1A2UA 1IHZA 3SK4A 2SEBD 2L11A 2F0PA 1HPCA 2DN8A 3I72A 2Z4HA 2K28A 4IFDI 1J9OA 2BDOA 1AEXA 4NKLA 2CW0C 4FXGC 5ELDA 2KCCA 4L8JA 2VUMB 4CJ2C 2MHVA 1SE3A 1HTLD 2D2CC 2R61A 3JAML 3MXUA 1Y69U 3CU7A 3A56A 3K7AB 2B2WC 5C44B 1IKLA 3G6JB 5C5MA 1QWYA 4H44C 1JCKB 3N52A 1SAPA 3GV3A 4LAAA 3TMEA 5JEAJ 4HCSA 4DAPA 2IJ0A 4WORA 1ZKOA 3ERQA 1EY0A 1JOOA 3D3RA 1AP0A 3HEJA 5CV9A 5CORA 4KN7C 1F77A 1GUGA 4G7HC 1LT4D 4XYQA 1E2ZA 2IWHA 1PMRA 3C1EA 2EYHA 2NN6I 4XYOA 5IOCA 3GTJB 4R8IA 1F9RA 3U9OA 3BG3A 2EPBA 1I3QB 1ENAA 4K2KA 1B44D 1PDQA 5BN5A 2SOBA 4YIJA 1MI2A 1B2TA 3NXWA 3AU7A 2EZVA 4O1NA 2NYZD 1CTMA 2PQEA 3FPUB 1V1OA 5CBEE 1QCBD 1FNVA 4IUPA 1CFMA 3W2DA 4RCOA 3VYRA 1ILQA 3QJYA 5E1FA 3MFYA 1RODA 1BR9A 1SXTA 1S5CD 1XWEA 3KF8A 1GHJA 3MAQA 1IYUA 1CHPD 4G4KA 2E2IB 3H6MA 1GXDC 4RWSC 1JOQA 1TU2B 2PZWA 5KNDA 1LTBD 1ENCA 2F0OA 2CQAA 3I90A 4ZAIA 4M8AA 5I6WA 2SNMA 2BE5C 3FMCA 5JAVA 3R8BA 1O7LA 4MHEA 3OMGA 3BYTB 1EWCA 1B4OA 3MZ5A 1GUWA 2A6ED 1HRJA 3CQZB 2K03A 5IGGA 5C5LA 4X3KA 2B2VA 2Q8TA 2E2DC 2EJMA 3QO2A 4QB4A 3R2IA 5EQ0A 1PXUA 1STEA 3D31A 1Q8IA 1K83B 3D4RA 1A2TA 1STNA 3PV0A 2PZUA 2C5CA 1HQMC 4KMUC 1HFGA 4H7BA 5DM73 1FR3A 2PNRC 4KHZA 2PPBC 2RDFA 4KD3A 2RBMA 4DN4M 1ZEQX 3WOEA 3I3CA 4V190 3EFXD 1WTVA 1KDAA 1EU3A 4RGTA 3BS1A 2Y0SB 5C0XI 1FNUA 1Q12A 4FP5D 1EL0A 2B2YC 4BBSB 2KEEA 1Y8PB 2JA8B 2A6HC 1BCPD 2O2LD 1Y1WB 2G9HD 1GJXA 2L1BA 2BDNA 1F9PA 5JVG3 4IUQA 5I9OA 2O5IC 1LT3D 3GO5A 5BN4A 5FK9C 1TS2A 3NHHA 4OIJA 5A2QE 3CRKC 1RJTA 3PO2B 2B2TA 1PZKD 2E75C 1D2BA 1BF4A 1LT6D 4CHTB 1RF2D 3K58A 3GTPB 1SYCA 2MP1A 4C3HB 1NSNS 3NQIA 2Z8LA 1CZGA 2FINB 3PUWA 1I6HB 4A3FB 3QG1A 1L0XB 3ZYYX 5ELFA 4A3IB 1F9SA 1JWUD 2KOLA 4ZUIA 4HSPA 2SNSA 2F0NA 3W3AA 2XNAC 3TSSA 3RZDB 3VYTA 3NE5B 2F0UA 4X3SA 1QOHA 1KTKA 1R4PB 3TP6A 2EDGA 4F8MA 1OO9B 2MUYA 2G9DA 1KNAA 2F4IA 4XQJA 2DNCA 4C1NK 1R4QB 2RDHA 1WD1A 1A15A 2LKVA 4TQUS 3M4OB 4H0LC 4TKOB 2EYOA 3VA5A 5JEAG 3FDTA 3L7ZC 1RHPA 1NUCA 1EY5A 3SK6A 1E0BA 5FO9B 2JXMB 1HUNA 5CR3A 4ABNA 1OXTA 1STGA 1FYCA 5M3FB 4IUVA 1R9TB 2XN9C 3H94A 1WTPA 5CBAE 4RGNA 4K8JA 2NBFA 4K5XA 3PUYA 2KA7A 4MIUA 1F9QA 3SR1A 5I2XA 5D3DA 4CKCA 5F2DA 1BO0A 1SYBA 5IT9L 2RQXA 2D62A 3TP5A 3SE0A 3GTOB 2NVXB 2F3WA 4RA8A 2XWJB 2JA6B 3VYSA 2KEDA 4O42A 2A5HA 5I4DA 1HFNA 1KNEA 3QOJA 2PZTA 1AN8A 3OIPA 1QNUA 2F3VA 4IZ8A 4JBWA 4BA1I 2BOSA 3K5MA 2QCPX 4EGVA 1SYEA 3EVQA 1M4VA 1X3QA 4HEDA 5EBCA 4DK0A 1DONA 1EYCA 4A3BB 5C4ZA 4X3TA 2B63B 1PRTD 2JE6I 1LTGD 4HSVA 5G3LD 3P7JA 4HMIA 4ZKBB 3DM1A 2A69D 1H9RA 1AW7A 3L3OC 1OXSC 1PTOF 5FO8B 2EYLA 5M5YB 2ZT9C 2WINB 5EJWA 5CGKA 1EIHA 4A3EB 2CVRA 3GV6A 3VR2A 4K6LA 1M8AA 1TS3A 5JOBA 5C3EB 1OXVA 1D5ZC 1LTAD 1Z7TA 2VB3X 1TWHB 5C0XG 1WCMB 3S2DB 3I73A 4DNTB 1I4HA 2NVTB 5LHY1 2EYPA 2NZ1D 1VF7A 4BWGB 1S5BD 5C3WA 1ZXTA 1TWFB 3P1HA 3DWAA 2KUMA 2F0FA 3HGBA 1QNKA 1WTOA 1LTID 5BN3A 1E2VA 5E4WC 5T1GA 4QUCA 1YNJC 3D8GA 2RSOA 3HS0C 1FNWA 4F87A 3QOLA 2QF7A 3D4WA 4IQZA 3S17B 3FKIB 2NN6G 1AZQA 4PMCA 3MEHA 4HR7B 3HOZB 2F0JA 2X6LA 1CK1A 1V8QA 2OXPA 3E0JA 3IFDA 2NVQB 3VR4A 3BDOA 5DM63 5EKKA 4BY7B 3KUPA 1KAAA 4DNRB 3OW7A 3Q0AA 1TIID 2L5TA 3J81E 3VR3A 4FVMA 5FLXE 5IGBA 4M1UB 4ZLTF 4AYBB 2EY2A 2YU9B 2L4NA 1I4XA 5CC4A 2LY7A 4G7ZC 3MTSA 1ZYRD 1JB3A 4KN4C 1SEBD 1JC7A 2L0CA 1JR0D 5KRUA 2EYJA 1F2MA 4XT3B 1EZ6A 5D14A 1L0YB 3T4AC 4LJZC 4PQXA 1IL8A 1ILPA 1DXMA 1KLUD 4A3MB 1PFMA 2ZXPA 3HOWB 4A3GB 4A3KB 2J4XA 2FMMA 5FKAC 2B2UA 2R6GA 2R92B 1Y8OB 4Z9CB 1A3VA 1PLFA 4NDXA 3D6WA 4OO1G 1QB5D 3PO3B 1EY7A 1W6JA 5COYA 3K57A 1T5XD 1EEFD 5J39A 3ITPA 2QILA 1U4PA 1D1IA 1H9SB 4KI0A 1OXUA 2A74C 3TN2A 4CKEA 4HN7A 4NP5A 1DZ1A 1BOSA 1PZJD 3TDQA 1JE4A 3DWPA 3TBIB 2MPMA 1CQVA 4KY6A 2TSSA 1FGBD 1BBXC 5ISRA 1MSGA 3A7LA 2K5QA 1SE2A 1PRTC 1SSOA 3X3MA 4C3IG 2A69C 2X6GA 3GD7A 3VYUA 2B2WA 1C4QA 1SNCA 5JPNC 4KJNA 1A3UA 1CT1D 3DUZA 3NBHA 5CV5A 1E2WA 2F0KA 5KNBA 2B8GA 3DEPA 4XDXA 3FEWX 3NBIA 1HXYD 3J80E 3LX0A 2K32A 1U4RA 1HTPA 1AZPA 1BNZA 2EE1A 5ELCA 5JJZA 4K14A 1D6EC 2K33A 1NR2A 3R3OA 1LTSD 2QKIC 3U9SA 5I6YA 4B9XA 4HCEA 5I9PA 4IURA 3S16B 3IKJA 4B9WA 3S1MB 1TWCB 1EQTA 3OWEB 2ID0A 2WB1B 2E76C 1BXTA 3TP8A 3A8IE 4FNFA 3N6RA 4Q0FA 4K8IA 1II3A 1NR4A 1DOMA 2WKCA 5A2QL 1IYVA 5KIXA 2KJXA 3EA6A 3KLSX 4U673 3FRPB 3BYYB 5FLXL 3C3LA 4PNYA 3A8JE 1GUSA 1LACA 2I46A 1ESFA 3TZDA 2SDFA 1NAPA 4FXKC 5FOBB 1S5DD 4ILWA 1MBYA 2L12A 1HHVA 3NTHA 1SBBB 1PTOB 3C1FA 3HG9A 4PMWA 3Q6SA 3KBXA 1DOKA 2IPKD 2CW0D 5C3XA 3PIP3 3HKZB 1I4RA 1T5EA 3A54A 4PMBA 1G291 3DWQA 3MC0B 4FF1A 4BBRB 3Q24A 1I50B 3GTMB 2E2JB 3NUCA 1HQRD 1Q1BA 1U4MA 2YYZA 3NWSA 2H4OA 5EBDA 1VF5C 3S15B 2E74C 4C3JB 1SYGA 3K5LA 1SJHD 1SMYD 2QEJC 1YNNC 3JAME 2JA5B 1JWSD 1PFBA 3J7AF 2MGSA 2K5WA 1EU4A 2WKDA 2FFKB 3BDLA 2NTSA 4DF7A 2A68C 4CKBA 1LV9A 3BDCA 1B50A 4KTAA 1YNND 4CJ0B 1TS5A 2BCOA 5K36H 1WTQA 4IUTA 1B3AA 1BCPB 4RKBA 5LL6X 3K59A 5D3IB 3H91A 4DU9A 4DK1A 1I4QA 4RH6A 3A7AB 2M2LA 2DY8A 1ZYRC 3SDZA 4QF4A 2PMZB 4F88A 2OEOA 4RKLA 2M9VA 4FYDA 1H9KA 3OMCA 2KHSA 3RMHA 2HCCA 5HURA 3SVMA 3GTGB 1ONLA 3QWNA 3R2TA 4FF2A 1SNQA 2F0DA 2F0SA 2WIIB 2ZXOA 2N55A 2IW3A 4ZKCB 1VDZA 5CV6A 4Y7NB 4FXDA 2B2YA 2TMPA 2O4XA 4K5WA 3WOFA 3H0GB 3OPOA 2EOTA 1D5MC 3QIAA 5D65A 4DA2A 4I7ZC 4V0BA 3NTKA 2F0EA 1WTXA 1LO5D 5CV4A 1RTOA 1IW7D 1KDCA 5IIFA 2QDBA 4X3UA 1MGSA 4UAIA 2XRQD 3I8ZA 1LTTD 2PW5A 3SK5A 4H13C 5C0XH 4DXGA 3BZDB 2IT1A 2VB2X 2HQEA 2EJFC 2GA4B 1IW7C 2ICIA 3KK7A 1S5FD 3GTQB 3C46A 2FHTA 4RHRA 3ND8A 3CRLC 2NWGA 1TKWB 1JICA 4XQNA 3M7GA 4A3JB 2H1EA 3NK9A 1EYAA 1AFPA 1G8ZD 5KYLA 3X3NA 5IGFA 2F0IA 4TRDA 1SDFA 1DYQA 1Z6HA 1O80A 2Z1CA 3EROA 3RUZA 4IN3A 1HCZA 2BA1A 4KHVA 1GUNA 3GTLB 1EWHA 3MFGA 1ET6A 4BA2I 4P2CB 1IKMA 1VMPA 4RCNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EPK A;  1G91 A;  2K04 A;  3Q6S A;  1HA6 A;  1HRJ A;  3KBX A;  2HCC A;  2K03 A;  1DOK A;  3IL8 A;  1CA5 A;  3SVM A;  2MP1 A;  3DEP A;  3G7L A;  4XDX A;  4RA8 A;  2FIN B;  1J8I A;  1B53 A;  1QG7 A;  4X3K A;  4XT1 B;  1O7Y A;  2B2V A;  3DEO A;  4XT3 B;  4R8I A;  2NZ1 D;  4NW2 A;  3MWY W;  1F9R A;  2KED A;  4O42 A;  5D14 A;  2Q8T A;  3QO2 A;  2N55 A;  1EOT A;  1IL8 A;  1ZXT A;  1ILP A;  2EPB A;  1HFN A;  1KNE A;  1F9S A;  1U4R A;  4MN3 A;  4ZKC B;  1XYI A;  5E4X A;  1PFM A;  2K05 A;  5EQ0 A;  2KOL A;  1WVL A;  3R93 A;  1G2T A;  1AZP A;  1X32 A;  5EKI A;  2KUM A;  2B2Y A;  2HDM A;  1ICW A;  2KEC A;  3UI2 A;  2EE1 A;  1QNK A;  1PDQ A;  1BNZ A;  1WTO A;  5JJZ A;  2EOT A;  5D65 A;  1MI2 A;  1B2T A;  1U4M A;  5E4W C;  2FMM A;  5T1G A;  3HP3 A;  1WTX A;  2B2U A;  4QUC A;  2NYZ D;  2R3Z A;  2K01 A;  2RSO A;  3F2U A;  3FPU B;  4X3S A;  2Q8R E;  1RTO A;  1Q3L A;  1NR2 A;  1HFG A;  2J7Z A;  5EPJ A;  2K1B A;  2L11 A;  1QE6 A;  2IL8 A;  1ML0 D;  2HCI A;  5CBE E;  4U68 A;  1U4L A;  2RVL A;  1PFN A;  1KNA A;  2FJ2 A;  4IUR A;  1PLF A;  4IUU A;  1AZQ A;  3D6W A;  4IUP A;  1X3Q A;  4HED A;  4DN4 M;  1WTR A;  1O7Z A;  4LMQ D;  3ONA B;  4X3U A;  1EQT A;  1MGS A;  2K28 A;  1ILQ A;  1J9O A;  4UAI A;  3I3C A;  5COY A;  5EPL A;  1DON A;  1WD1 A;  1A15 A;  2HDL A;  3I8Z A;  4X3T A;  5DNF A;  1PFB A;  1ROD A;  2X6L A;  1F2L A;  1U4P A;  2MGS A;  1WTV A;  1AP0 A;  2FFK B;  5CMD A;  3IFD A;  4HSV A;  2VXW A;  3FDT A;  3P7J A;  1RHP A;  2RA4 A;  1NR4 A;  4CJ2 C;  1DOM A;  4ZKB B;  1WD0 A;  3TN2 A;  3DM1 A;  1HUM A;  1LV9 A;  1EIG A;  5AFW A;  1E0B A;  4ZK9 B;  3KUP A;  1MSH A;  2FHT A;  2KVM A;  1B50 A;  1HUN A;  1DZ1 A;  1C8C A;  2L9H A;  4RWS C;  4CJ0 B;  4CJ1 B;  1G2S A;  2X69 A;  1JE4 A;  1EL0 A;  2HUG A;  2B2W C;  1NCV A;  2NWG A;  2B2U C;  3I91 A;  1JIC A;  2MJ8 A;  2B2Y C;  4IUT A;  1WTQ A;  2KEE A;  1IKL A;  1B3A A;  2JP1 A;  2MPM A;  4IUV A;  1XX8 A;  1TVX A;  3I90 A;  1BBX C;  1VMC A;  2H1E A;  4ZAI A;  1MSG A;  1S4Z A;  3LWE A;  4ZLT F;  3N52 A;  1SAP A;  3GV3 A;  3H91 A;  5EJW A;  1WTW A;  1WTP A;  2L1B A;  2BDN A;  1F9P A;  4IUQ A;  1EIH A;  2L4N A;  4HCS A;  5CBA E;  1CA6 A;  4OIK A;  1ESR A;  2CVR A;  2DY7 A;  2XIW A;  4R9W A;  3TZD A;  3GV6 A;  5T1I A;  1SSO A;  1G6Z A;  2M2L A;  1SDF A;  4QUF A;  1M8A A;  1RTN A;  2DY8 A;  2B2V C;  1NAP A;  1F9Q A;  2JYO A;  2SDF A;  3MTS A;  4OIJ A;  1O80 A;  4MHE A;  2B2T C;  2N88 A;  2X6G A;  4RAU C;  5COR A;  1RJT A;  2B2T A;  1X3P A;  2B2W A;  2L12 A;  1B4O A;  2D9U A;  2RSN A;  1HHV A;  1BO0 A;  4HAE A;  1GUW A;  1IKM A;  1BF4 A;  1VMP A;  1CM9 A;  1DOL A; 
#chains in the Genus database with same CATH topology
 1JOK A;  5AJ3 L;  4QIW B;  5EGT A;  5M3F H;  1CA5 A;  1DD2 A;  3BVG A;  4XT1 B;  2L55 A;  4C3I H;  4L6T B;  4S3S A;  1WCM G;  1FL0 A;  1LM0 A;  5E4X A;  2BH2 A;  2MNA A;  3C2P A;  2HDM A;  3MXN A;  1PH2 A;  4GKK L;  2F03 A;  2PCF B;  2KEC A;  3UI2 A;  3KF6 A;  1TWA H;  3M4Y A;  4BBS G;  2E2I H;  1V9P A;  1XTC D;  2KCN A;  1VCI A;  4DFA A;  3VR6 A;  1NBW A;  3OW2 A;  3HOX B;  5EPJ A;  3PO3 H;  1EOV A;  4LF6 Q;  4DXF A;  3D6C A;  1IBK Q;  2XWB B;  2A8V A;  4IPG A;  4JOI A;  2EJG C;  5JVH 3;  2O5J C;  2HQL A;  1K8M A;  4LMQ D;  4DR6 Q;  5EPL A;  4ULL A;  4JVZ A;  4JI5 L;  2ZTE A;  2ICE C;  1SLJ A;  1PH8 A;  4OO1 H;  4AQY L;  4GN5 A;  4Q5V A;  3FVQ A;  2F0L A;  1L2F A;  2VXW A;  1TY0 A;  5CYU A;  3U4V A;  4OON A;  1N9W A;  4XQQ A;  3RN5 A;  5C4X B;  2Y0S E;  1VQ8 A;  1HUM A;  1XTD A;  5KYI A;  4OHJ A;  4ZK9 B;  4YWM A;  1C8C A;  5M5X B;  3H3V C;  4OX9 Q;  1CQF A;  1PYW D;  1AE2 A;  2RKS A;  4KKT A;  4RGO S;  2MJ8 A;  2Z6K A;  2HD3 A;  3NWT A;  2F1M A;  4BY7 G;  2LMC B;  2OF1 A;  4EVO A;  3NQT A;  4A3B H;  1TR5 A;  1VQN A;  3LWE A;  2NB0 A;  3U50 C;  3VA7 A;  2UU9 Q;  3GP7 A;  5C6A A;  3WDN A;  1N32 L;  3KBG A;  1Q81 C;  1PZI D;  5IYD H;  4POF A;  4ZQ3 A;  2AWN A;  1Q90 A;  1BKB A;  2UUA L;  1Q82 C;  2RCF A;  4RAU C;  2B2T C;  4GZY C;  3KLS A;  3S1N B;  1ET9 A;  4A93 B;  3EQL C;  3I4L A;  3PUX A;  4LFA Q;  3KDF A;  2N49 A;  5JEA H;  4DR5 Q;  4Y52 H;  5M3M B;  1DOL A;  1D5X C;  1HA6 A;  3A0J A;  4F7X A;  3PF4 A;  1OXX K;  4HMJ A;  4OL7 A;  3NPP A;  4RHS A;  2ZXR A;  2JJQ A;  5M5W B;  1J8I A;  3KDF B;  3KLW A;  3I2Z A;  1O7Y A;  4A3E H;  5HY6 A;  4KD4 A;  1STY A;  4DUY Q;  1JQY D;  1MIU A;  5ELO A;  4MN3 A;  1XYI A;  2AQ1 B;  2B39 A;  4KLK A;  4I65 A;  5KGU A;  5EKI A;  4DGZ A;  2UUB Q;  2LFN A;  4KKS A;  4GKJ Q;  4ID6 A;  1PFS A;  1DM0 B;  4FF3 A;  5M9O A;  4A3M G;  1KLG D;  2EY5 A;  1NMG A;  2PO4 A;  3OOC A;  2Q8R E;  5J3B A;  2IHE A;  1F2Y A;  3BZK A;  4KV6 A;  2R7F A;  4KKU A;  2RVL A;  1TT2 A;  3KLR A;  2B63 H;  1RDP D;  3S24 A;  1X3E A;  1VS0 A;  3STB C;  4DKA C;  1W2B A;  2CFM A;  1VQO A;  4C3H G;  2QW7 A;  2K5D A;  1SND A;  3UDI A;  1STA A;  3K7A H;  3KJP A;  5FLM G;  1B9M A;  4NMZ A;  1YNJ D;  4N9P A;  2WV6 D;  4DV7 L;  3MVV A;  3QB3 A;  1FJG Q;  1SFO B;  1V1Q A;  1PA6 A;  1WD0 A;  5AFW A;  3S1Q B;  1KAB A;  4LF7 L;  4A3L H;  3RZO B;  2JA6 G;  2EVB A;  3DMU A;  3TZU A;  1G51 A;  1G2S A;  2F0V A;  1A6X A;  1QVF A;  2HUG A;  3I91 A;  2B2U C;  4C1N I;  3I4M B;  5KNC A;  3A74 A;  4DAY A;  2A6E C;  2R7Z B;  2A6H D;  3RLF A;  4ODG A;  3UDX A;  3S14 B;  2N8N A;  4CBV A;  3Q22 A;  2JEA I;  1WTH A;  4HJ8 A;  1YHB A;  3NTI A;  4PG3 A;  5IGC A;  5IP9 G;  3T1Y L;  1G6Z A;  4R9W A;  2Q8I B;  2EY1 A;  1EFI D;  2A68 D;  4ZRZ A;  4QUF A;  1B7Y B;  2NVX H;  4G57 A;  3HOU H;  1VQM A;  4JBM A;  2IX1 A;  1VQC A;  1X3P A;  2ZM6 L;  2DNE A;  3V05 A;  2IX0 A;  3IFT A;  1SE4 A;  4UP8 A;  5CV8 A;  3SEB A;  5G3L F;  4GLA C;  3AMU A;  5C4X G;  4LUO A;  2F0T A;  2JA7 B;  1TWG B;  1VQF A;  3FKI G;  4YCW A;  1J5E L;  2AQ2 B;  1IL2 A;  1XPU A;  3G7L A;  5J22 A;  4JI4 Q;  2F0Q A;  4UDU C;  3KF8 B;  3HZX A;  4LF8 L;  1RD9 D;  2ASB A;  3DEO A;  3GQB A;  2WAQ E;  4WFN 3;  3GTK B;  3EN2 A;  3AB9 A;  2B8F A;  4A3I H;  2DGY A;  3I4M G;  3PIO 3;  1DJR D;  1EUJ A;  3HOV B;  3E3X A;  4RFB A;  3A55 A;  5C4J H;  3K7U C;  3K0Y A;  2K50 A;  4FO2 A;  4EQO A;  1HR0 W;  3IAY A;  3B6Y A;  5C0X J;  1B1Z A;  4AYB E;  1EY8 A;  3BVZ A;  3I70 A;  3E6Z X;  3F2U A;  4N9T A;  2EY6 A;  4LK1 C;  4KJO A;  3T51 B;  5LMN L;  1EEI D;  1QE6 A;  3GTQ H;  4HTH A;  1RL2 A;  2HCI A;  1PFN A;  4IUU A;  1HNX L;  3Q23 A;  1RIP A;  3H09 A;  3WWV A;  4A3M H;  4B3S Q;  3ONA B;  2PQA B;  5J1Z A;  3CME A;  1G91 A;  1PTO D;  3PUZ A;  1BVS A;  4GNX B;  1BCP F;  4GN3 B;  1PVO A;  3SHL A;  1F2L A;  4GKJ L;  4LF5 L;  1QJO A;  3U58 A;  5ELE A;  1LAB A;  2VQF L;  2KBN A;  4YY3 Q;  2XVS A;  2WB1 G;  4A3J G;  3T56 B;  4E6I A;  1NE3 A;  2UUC L;  2KVM A;  3URY A;  1O78 A;  4CJ1 B;  4KY5 A;  1EZ8 A;  1HA5 A;  2JSO A;  2WAQ B;  3TP7 A;  4DR6 L;  5IYC G;  2RDG A;  4XIG S;  4K6D A;  3OWF A;  1FGU A;  4TVA B;  4LF9 Q;  1TS4 A;  4ZYS A;  3VR5 A;  1VQA A;  2E5L Q;  5LMN Q;  4A3F H;  3V96 A;  2DY7 A;  3CKI B;  3NBH B;  1RTN A;  4N8F A;  2B2V C;  1GHK A;  1K8A C;  1CI3 M;  1EY4 A;  1PH1 A;  2G5D A;  1PV4 A;  5K5P A;  4DUZ L;  1LTL A;  3W5O A;  1SRU A;  2D9U A;  1A3T A;  2CQO A;  3F1Z A;  1C48 A;  2GN5 A;  1TWA B;  4ZUJ A;  5A35 A;  4OGQ C;  3RR5 A;  3M85 A;  2GVA A;  1DCZ A;  4L63 B;  2EYM A;  4DV6 Q;  1SRO A;  4NW2 A;  1X9N A;  3MWY W;  1UE1 A;  1PH4 A;  4IFD G;  3AFP A;  2R93 G;  1U9R A;  1J5E Q;  1FVI A;  1CSP A;  4LF4 Q;  5IY0 A;  3S1R B;  1WVL A;  4BY1 G;  4FF4 A;  2LSS A;  4DR4 L;  1SNM A;  1JMC A;  3HOU B;  1STB A;  4IAL A;  3GTK H;  1JOR A;  3NP8 A;  1CUK A;  3J7Y W;  1KDB A;  2V4D A;  1HNW L;  3CAM A;  2J7Z A;  4KK7 A;  4IFD J;  4C3J H;  3PO3 G;  2DJF C;  2JA7 H;  1N36 L;  1XPR A;  1MJE A;  1D1K A;  3DXJ C;  5DEH A;  1YZ6 A;  5IWA L;  4DV3 L;  1M90 C;  3HOY B;  3G48 A;  4EQN A;  3RZO H;  3MXG A;  1V1P A;  4PV1 C;  4A3D B;  4PZ6 A;  4B3R Q;  4YHH Q;  5IGE A;  4QCL A;  3ND9 A;  5CMD A;  1CKM A;  1Y8N B;  4A3J H;  3OSO A;  5IOD A;  3CCR A;  4WJ3 M;  4ME5 A;  2IX3 A;  4J1M A;  2J0T D;  4B3T L;  4B3M Q;  1EIG A;  2WAC A;  2L15 A;  1MSH A;  2L9H A;  2MFI A;  5I2Y A;  4DV4 L;  1XXG A;  3E5S A;  1VQH A;  1CZW A;  5HGT A;  2JP1 A;  3CCL A;  3M7N A;  3S2H B;  1TVX A;  1VMC A;  3SXH A;  5LL6 S;  1RCV D;  1SYD A;  1WYD A;  2D5D A;  2XIW A;  4KHP Q;  4R8N A;  1EQV A;  2PW7 A;  3L9A X;  4R4C A;  3CMA A;  2QGQ A;  1L0W A;  2AUK A;  1Z47 A;  4DV1 Q;  4GNX A;  1JWM D;  1S5E D;  4RG1 A;  2OT2 A;  2K6A A;  1K8O A;  3T1Y Q;  5IYB G;  4IUN A;  3CHB D;  3SGI A;  2WP8 J;  1CM9 A;  3FHW A;  1UE5 A;  1GOZ A;  3CC7 A;  5EPK A;  2K04 A;  5E3F A;  2M00 A;  5IGD A;  3HRZ C;  3T53 B;  1Q1E A;  1YI2 A;  4JI3 Q;  5C4H A;  1NY4 A;  3PSI A;  1MD2 D;  3P20 A;  1SJE D;  2Z0S A;  1B53 A;  5JPM C;  2KCM A;  4DAV A;  4MNO A;  4K2L A;  3UE0 A;  1NMF A;  3RZD H;  3S9W A;  1EOT A;  1PRT F;  3M3Y B;  2KQ3 A;  3NEM A;  4J6H A;  1QIL A;  1GUO A;  4XTC S;  3R93 A;  5LMU L;  1G2T A;  3GTG H;  1BQQ T;  4A93 H;  5C4X H;  1B9N A;  3LNN A;  4WRD A;  4JK1 C;  4BY1 B;  2D0P A;  2JEB I;  5KEE A;  1SYF A;  2EYF A;  4QMG A;  1KHI A;  2AWO A;  3HOU G;  3H0G G;  2XSC A;  5NUC A;  2IHF A;  2K1B A;  4DV2 Q;  3J7A V;  2IL8 A;  4U68 A;  3STB D;  1CSQ A;  1I3Q H;  2BA0 A;  1WTR A;  4NXN Q;  1FD7 D;  1LTR D;  3J81 L;  2F0M A;  2HDL A;  5DNF A;  3A8K E;  4X66 Q;  1UNS A;  1Z9F A;  1X65 A;  5C44 H;  1PRT B;  2ZJP A;  1E24 A;  1I6V C;  2PYK A;  5DAU A;  2EXZ A;  1PYB A;  2I5H A;  5FO7 B;  5FLM H;  1NCV A;  1SNO A;  4IOA A;  1OTC A;  2F3I A;  4RGM A;  1EWI A;  1RKN A;  1S4Z A;  3NSW A;  3MA2 B;  5ELB A;  4JCV E;  1WTW A;  1PH7 A;  4UPA A;  2F0W A;  3K6O A;  2BE5 D;  1ESR A;  1UEA B;  4CGY B;  5T1I A;  1Y1V B;  5FJ8 H;  4WJW A;  3EJI A;  2JYO A;  1H9M A;  1F2Z A;  2N88 A;  2NUC A;  1QUQ B;  1STH A;  1SNP A;  1E22 A;  1I4P A;  1UUP A;  2MQH A;  2NVQ H;  4DAY B;  3M9B A;  1EY9 A;  4HAE A;  1L1O C;  2VNU D;  1CKN B;  4C3J G;  3DHQ A;  1X6O A;  4A3D H;  5AJ3 Q;  4DR7 L;  1GUT A;  3IL8 A;  3HOV G;  3V2T A;  2Q2I A;  3M4P A;  5K36 G;  2K14 A;  1LT5 D;  5IP7 H;  4GLX A;  2N3S A;  2ALY B;  3SK8 A;  4YWK A;  3S17 H;  3LWU A;  3RN2 A;  1H9S A;  4BY1 H;  2K05 A;  3Q8D A;  4JBK A;  4LWC A;  2ZJR A;  1X56 A;  2K7V A;  1ICW A;  1PTO H;  4GOP B;  4IFD H;  4X64 L;  3J80 L;  1BUV T;  4C3I B;  3RD4 A;  5GRO A;  5TSS A;  1ENF A;  4A76 A;  3I4N B;  5EKL A;  1Q3L A;  2NVY B;  1WJJ A;  4JI8 Q;  3BVM A;  1ML0 D;  5L37 A;  1U4L A;  1SMY C;  2FJ2 A;  4P73 A;  2E2H B;  4HIM A;  4AH6 A;  3D4D A;  5IP7 G;  1O7Z A;  2C9O A;  2AQ3 B;  3HOX G;  4IPH A;  1BCP C;  3K5O A;  4LFB L;  3KF6 B;  1I4G A;  4JG2 A;  1QUQ A;  1H9J A;  1Q86 C;  4G7O C;  3PUV A;  4J8Q A;  1EY6 A;  1C9O A;  3OHX C;  4DV0 Q;  3TQY A;  3FPP A;  1KRS A;  4TSS A;  4EQP A;  2RA4 A;  3MHB A;  4DV5 L;  4IPD A;  2K5H A;  5CV7 A;  3UDF A;  1KD1 C;  5H1S E;  3K8A A;  4QQB X;  1UWV A;  4JYA L;  4UP7 A;  1IXR A;  2X69 A;  4JPB W;  3P75 A;  4DR1 L;  1XX8 A;  1TQO A;  1PTO C;  4R4I A;  5IT9 E;  3OIQ A;  2K4K A;  3UE1 A;  2FMC A;  3HOV H;  2UXC Q;  1N33 L;  4DV5 Q;  4AQY Q;  1UAP A;  4IJH A;  4K0K L;  1CA6 A;  4OIK A;  4C56 C;  4YHH L;  1SR3 A;  2A73 B;  3T13 A;  4JI7 L;  1TY2 A;  2LS0 1;  1V43 A;  4QL5 A;  1W6K A;  2AUJ D;  2NTT A;  1YHA A;  2F0H A;  1A0I A;  2RSN A;  2XRS D;  4BS9 A;  2HHH Q;  2Z4I A;  4OWW B;  2MO0 A;  2CHB D;  1V1P B;  1LLR D;  1N33 Q;  3K5N A;  2R93 B;  4C2M B;  5C4J B;  1HZB A;  4B3R L;  4A75 A;  4R4Q A;  4KY7 A;  1BDO A;  1SE8 A;  4OO1 I;  1QG7 A;  3PMF A;  2F0G A;  2I07 B;  3H0G H;  2NN6 H;  2VUM G;  3GDE A;  1CHQ D;  1EYD A;  3J80 i;  3T16 A;  4DK6 C;  1X32 A;  4K5V A;  2VL6 A;  4A3I G;  3I4M H;  4B08 A;  5E7N A;  3O13 A;  2ENB A;  5C44 G;  1CKO A;  4XXE A;  4DV4 Q;  3H3V H;  3JAM i;  3HP3 A;  1P8L A;  2R3Z A;  3MXP A;  2K01 A;  2JA5 H;  3FKI H;  1GVP A;  4JC0 A;  1HJP A;  1A2U A;  1IHZ A;  4A3C H;  3SK4 A;  2SEB D;  1PH5 A;  2L11 A;  4CDD C;  4I7A A;  2OQK A;  2F0P A;  4R4T A;  3HOZ G;  1HPC A;  3J80 c;  2DN8 A;  4N8X 1;  3I72 A;  2Z4H A;  1Y1V H;  4WJ4 A;  1TXY A;  2K28 A;  4IFD I;  1J9O A;  2BDO A;  1AEX A;  4NKL A;  2CW0 C;  3JAM c;  4FXG C;  4CDC C;  5ELD A;  2KCC A;  3E9H A;  1XNQ Q;  4L8J A;  3HOZ H;  4QIW E;  2VUM B;  4CJ2 C;  3CCU A;  1HNZ Q;  2E2J H;  3GTM H;  2MHV A;  3F8T A;  4A3C G;  1E7Z A;  4UHV A;  1ASZ A;  1SE3 A;  1HTL D;  2D2C C;  1YIT A;  2R61 A;  3MXU A;  3JAM L;  1Y69 U;  3CU7 A;  3A56 A;  3K7A B;  2B2W C;  5C44 B;  3K81 C;  4NXN L;  1IKL A;  3TRE A;  3G6J B;  1IZ6 A;  5C5M A;  1K9M C;  1QWY A;  1VQ4 A;  4H44 C;  1JCK B;  3N52 A;  1SAP A;  3GV3 A;  4LAA A;  3CC4 A;  3TME A;  5JEA J;  4HCS A;  4DAP A;  2IJ0 A;  4WOR A;  1ZKO A;  4LUZ A;  3ERQ A;  1EY0 A;  2R7Z G;  1JOO A;  3D3R A;  1AP0 A;  3HEJ A;  5CV9 A;  5COR A;  4KN7 C;  1F77 A;  1GUG A;  4JOI C;  5BR8 L;  2VS1 A;  4BBR H;  1VQI A;  2D0O A;  4G7H C;  1LT4 D;  4XYQ A;  3W1G A;  1E2Z A;  2IWH A;  1A62 A;  1VQB A;  1PMR A;  3C1E A;  2EYH A;  2NN6 I;  4POG A;  4XYO A;  5IOC A;  1G6P A;  1TWH H;  3GTJ B;  3HFZ B;  1LYL A;  4R8I A;  1XMQ Q;  1F9R A;  2UUB L;  2JA7 G;  3U9O A;  3BG3 A;  2EPB A;  3CF5 A;  1IBK L;  1I3Q B;  1ENA A;  4LF9 L;  4K2K A;  1B44 D;  2EXD A;  1ICF B;  1H95 A;  1PDQ A;  2AMC B;  5BN5 A;  2SOB A;  1K28 A;  3IRB A;  4YIJ A;  1MI2 A;  1B2T A;  3NXW A;  4J15 A;  1K73 C;  3AU7 A;  3NEN A;  2EZV A;  2KHI A;  4O1N A;  2NYZ D;  1CTM A;  2PQE A;  3FPU B;  2Q2H A;  1V1O A;  2JN4 A;  4DAM A;  1Y1W G;  4JI1 L;  2R93 H;  5CBE E;  3OTO Q;  3AYH B;  1QCB D;  1FNV A;  3G71 A;  1QVG A;  4IUP A;  4X66 L;  1CFM A;  3AQQ A;  2AHO B;  3W2D A;  4RCO A;  1CKN A;  2V1C C;  1MJC A;  3VYR A;  1ILQ A;  3HKZ G;  1KRT A;  3J7Z C;  2YTX A;  4H02 A;  3QJY A;  5E1F A;  3MFY A;  1ROD A;  3CCV A;  1BR9 A;  2JA9 A;  3KOJ A;  1SXT A;  1S5C D;  3PIO A;  3J81 j;  3JC6 6;  1XWE A;  3KF8 A;  5M3M G;  1GHJ A;  4A3B G;  3MAQ A;  3PO2 H;  1IYU A;  1CHP D;  4BY7 H;  1VQK A;  4G4K A;  4JI8 L;  3H6M A;  3CD6 A;  2E2I B;  1GXD C;  4RWS C;  1JOQ A;  1TU2 B;  2PZW A;  4DR2 Q;  5JJL A;  5KND A;  1LTB D;  1ENC A;  2F52 A;  2F0O A;  2CQA A;  2VY3 A;  4LF7 Q;  2K75 A;  3I90 A;  4ZAI A;  4APV A;  1Y1W H;  4B3M L;  4M8A A;  5I6W A;  2QEX A;  1HZ9 A;  2SNM A;  3I4N H;  2BE5 C;  3FMC A;  5JAV A;  4JI6 L;  3R8B A;  3PQI A;  1MKH A;  1O7L A;  4MHE A;  3OMG A;  3BYT B;  2XTI A;  1EWC A;  4RMF A;  1B4O A;  4X65 Q;  1UE6 A;  2UXD Q;  3MZ5 A;  1GUW A;  2A6E D;  1HRJ A;  3CQZ B;  3UDG A;  1W3S A;  2K03 A;  5IGG A;  2ZM6 Q;  2NVY H;  5C5L A;  4X3K A;  3MXN B;  2B2V A;  4UP9 A;  1I94 L;  3KYH C;  2Q8T A;  2E2D C;  2EJM A;  3QO2 A;  4QB4 A;  2RCN A;  3R2I A;  4PZ8 A;  3L0O A;  2Y0S G;  5EQ0 A;  1PXU A;  1Q8K A;  1STE A;  3D31 A;  1Q8I A;  1K83 B;  3D4R A;  1VQ7 A;  1A2T A;  1STN A;  3PV0 A;  4A4I A;  5GAG C;  3CPW A;  3S2D H;  3A5Z B;  2PZU A;  2C5C A;  4JI6 Q;  1HQM C;  4KMU C;  5M3F G;  1HFG A;  3CP0 A;  4NXM L;  4H7B A;  5DM7 3;  3TS2 A;  1FR3 A;  3ULL A;  3CCJ A;  2PNR C;  4KHZ A;  2PPB C;  2RDF A;  3H3V I;  4KD3 A;  2RBM A;  4DN4 M;  1ZEQ X;  3WOE A;  1KXL A;  3HKS A;  3J81 i;  1WI5 A;  3I3C A;  4V19 0;  3EFX D;  1WTV A;  1KDA A;  2UUC Q;  1DGS A;  1EU3 A;  4RGT A;  3BS1 A;  2Y0S B;  5C0X I;  3HOW H;  1FNU A;  1YNX A;  1Q12 A;  4FP5 D;  5ELN A;  4DR3 L;  1EL0 A;  2N78 A;  5IP9 H;  2B2Y C;  4BBS B;  2KEE A;  1Y8P B;  1HZA A;  2JA8 B;  2A6H C;  2JA8 H;  1BCP D;  2O2L D;  1Y1W B;  2G9H D;  1GJX A;  1WFQ A;  3F2C A;  4GOP A;  2L1B A;  2BDN A;  1F9P A;  5JVG 3;  4IUQ A;  5I9O A;  2O5I C;  1LT3 D;  3GO5 A;  5BN4 A;  3S1N H;  5FK9 C;  1I5F A;  1KC8 C;  1TS2 A;  3NHH A;  4OIJ A;  5A2Q E;  1E1O A;  1Q7Y C;  3CRK C;  4DR3 Q;  4JI0 Q;  2B3G A;  1RJT A;  3PO2 B;  2B2T A;  1PZK D;  2E75 C;  3W1B A;  2AKW B;  1K8G A;  2E5L L;  1BBU A;  1D2B A;  1BF4 A;  1LT6 D;  1S3O A;  4CHT B;  1RF2 D;  2ZJQ A;  3K58 A;  3GTP B;  1SYC A;  3EBE A;  2MP1 A;  4C3H B;  1NSN S;  3NQI A;  4C3H H;  2Z8L A;  1CZG A;  2FIN B;  3PUW A;  1I6H B;  4A3F B;  3QG1 A;  1L0X B;  1K3B C;  1ASY A;  3ZYY X;  5ELF A;  1VQD A;  2B63 G;  4A3I B;  4JBJ A;  1F9S A;  4X62 L;  2JA6 H;  1J6Q A;  2CKZ B;  1JWU D;  2KOL A;  3HKZ E;  1HR0 Q;  4ZUI A;  4LFA L;  4YCV A;  4HSP A;  1K83 H;  2SNS A;  2F0N A;  3W3A A;  2XNA C;  3J81 c;  5GAE C;  3TSS A;  3RZD B;  3E0E A;  1D8L A;  3VYT A;  1N34 L;  3NE5 B;  2RF4 A;  2F0U A;  4GKK Q;  4X3S A;  1QOH A;  1YJW A;  1HNX Q;  1KTK A;  3ZJY C;  1R4P B;  2IY5 B;  3TP6 A;  2EDG A;  4F8M A;  1OO9 B;  2MUY A;  3BZC A;  1EQQ A;  2G9D A;  1KNA A;  2F4I A;  5HGQ A;  4XQJ A;  4A3E G;  2DNC A;  4C1N K;  2VW9 A;  1R4Q B;  5GAD C;  2KCT A;  2RDH A;  5C3E G;  1WD1 A;  1A15 A;  2BH8 A;  2LKV A;  4TQU S;  3M4O B;  2OTJ A;  4H0L C;  4TKO B;  3QR8 A;  2B29 A;  2EYO A;  3VA5 A;  5JEA G;  4DV3 Q;  3FDT A;  3L7Z C;  1EIF A;  1NUC A;  1RHP A;  4HJ5 A;  1EY5 A;  3SK6 A;  1E0B A;  5FO9 B;  2JXM B;  1HUN A;  2CCZ A;  1X54 A;  5CR3 A;  3CPF A;  4HJ7 A;  4DR2 L;  5IYD G;  4ABN A;  1OXT A;  2EQS A;  1STG A;  1FYC A;  5M3F B;  4IUV A;  4P71 A;  3A5U A;  1R9T B;  1HZC A;  2P5Z X;  2XN9 C;  5LMN W;  3E9I A;  3H94 A;  1WTP A;  5CBA E;  4RGN A;  4K8J A;  2NBF A;  4K5X A;  3PUY A;  2KA7 A;  4MIU A;  5GAH C;  1F9Q A;  3SR1 A;  5I2X A;  1SMX A;  5D3D A;  4CKC A;  1SN8 A;  5F2D A;  4KHP L;  1BO0 A;  1SYB A;  5IT9 L;  2RQX A;  2D62 A;  3TP5 A;  1JJ2 A;  3PO2 G;  1SFO H;  3PCO B;  2UXB Q;  2HIV A;  1XMO L;  3SE0 A;  3GTO B;  2NVX B;  2F3W A;  2I0Q A;  4RA8 A;  2XWJ B;  2JA6 B;  3VYS A;  2KED A;  4O42 A;  2A5H A;  4R1J A;  5I4D A;  4A3F G;  1HFN A;  1KNE A;  4P72 A;  4OWX B;  3QOJ A;  2PZT A;  4DV7 Q;  2OTL A;  4X65 L;  2UXD L;  1AN8 A;  3OIP A;  1L1O B;  1QNU A;  3G6E A;  1NTG A;  2F3V A;  4IZ8 A;  5C3E H;  2WAQ G;  4JBW A;  5FJ8 G;  1I50 H;  2R92 H;  4BA1 I;  2BOS A;  5IWA Q;  2UUA Q;  3K5M A;  2QCP X;  2UXC L;  3EIV A;  4EGV A;  3HOY G;  2CWP A;  5FLX c;  1WCM H;  1A8V A;  2F4V L;  1SYE A;  3EVQ A;  1M4V A;  1X3Q A;  4HED A;  3OYY A;  5EBC A;  4DPG A;  4DK0 A;  3F2D A;  1PH6 A;  1DON A;  1EYC A;  4A3B B;  5C4Z A;  4X3T A;  2B63 B;  2DJG C;  2OCE A;  4BBS H;  1PRT D;  2JE6 I;  1LTG D;  4HSV A;  5G3L D;  3P7J A;  4HMI A;  4ZKB B;  3DM1 A;  2A69 D;  3PF5 A;  1H9R A;  5IE8 A;  2OWO A;  1AW7 A;  3L3O C;  1OXS C;  4DV6 L;  1PTO F;  4AYB G;  2KHJ A;  5FO8 B;  2EYL A;  5M5Y B;  1TWC H;  2DUD A;  2ZT9 C;  1JT8 A;  2WIN B;  5EJW A;  5CGK A;  4DV0 L;  2C35 B;  1EIH A;  4A3E B;  2CVR A;  2Z6K C;  3GV6 A;  3VR2 A;  4LFB Q;  4K6L A;  2YV5 A;  1M8A A;  1NJI C;  1TS3 A;  5JOB A;  5C3E B;  4JI0 L;  1OXV A;  1YJ9 A;  1D5Z C;  2LXK A;  3L2P A;  5M5X H;  1LTA D;  1Z7T A;  2VB3 X;  3K80 C;  1LUZ A;  1YVC A;  4YWL A;  1TWH B;  5C0X G;  3GTJ H;  1WCM B;  3S2D B;  2JQO A;  2YTY A;  3I73 A;  4LFC Q;  4DNT B;  3KFU A;  3T1H L;  1I4H A;  2NVT B;  4LUV A;  1IBL L;  5LHY 1;  2H5X A;  2EYP A;  2XGT A;  2NZ1 D;  1XNR L;  1VF7 A;  4BWG B;  3ERS X;  1S5B D;  5C3W A;  1ZXT A;  4DR7 Q;  1TWF B;  3P1H A;  3DWA A;  2RHS B;  2KUM A;  3DLL A;  2F0F A;  1S40 A;  3HGB A;  4OWT B;  4IO9 A;  4ALP A;  1QNK A;  1WTO A;  1LTI D;  4MZ9 A;  3CW2 C;  4IPC A;  5BN3 A;  3T1H Q;  1E2V A;  1KAW A;  5E4W C;  2MO1 A;  5T1G A;  4QUC A;  1YNJ C;  3MEF A;  3D8G A;  2NZH A;  2RSO A;  3U4Z A;  3HS0 C;  1FNW A;  4F87 A;  3QOL A;  1BBW A;  2QF7 A;  3GTL H;  3D4W A;  4IQZ A;  3S17 B;  3FKI B;  2NN6 G;  2VUM H;  1AZQ A;  1E3P A;  2LXJ A;  1JB7 A;  4PMC A;  4GLV B;  3MEH A;  4HR7 B;  3HOZ B;  2PMZ E;  2F0J A;  2X6L A;  5GQO A;  1CK1 A;  1EIY B;  1V8Q A;  2Z9H A;  4JV5 Q;  2OXP A;  3E0J A;  3IFD A;  2NVQ B;  2I5L X;  3VR4 A;  2NZO A;  2ZTD A;  1L1O A;  3BDO A;  5EKK A;  5DM6 3;  4BY7 B;  3ULJ A;  3KUP A;  4QY7 A;  4A3K H;  4EX5 A;  4JI2 Q;  1KAA A;  4DNR B;  3OW7 A;  3Q0A A;  1TII D;  4DNI A;  2L5T A;  3CCM A;  1VQ5 A;  3J81 E;  3S15 H;  3VR3 A;  1AE3 A;  4FVM A;  5FLX E;  5IGB A;  4M1U B;  4ZLT F;  2OQ0 A;  3M3Y H;  2CWA A;  4AYB B;  2EY2 A;  2YU9 B;  2L4N A;  1EFW A;  1I4X A;  2Q2U A;  1VQP A;  5CC4 A;  3ULP A;  4A3G G;  2LY7 A;  4G7Z C;  1K0R A;  3MTS A;  4JI2 L;  1ZYR D;  2R92 G;  1JB3 A;  4KN4 C;  1SEB D;  1GM5 A;  1JC7 A;  3CCE A;  2L0C A;  3CC2 A;  1VQG A;  1JR0 D;  4CDE C;  3S1M H;  5KRU A;  4GOP C;  4JV5 L;  2EYJ A;  5M5W H;  3RLO A;  4YCU A;  1F2M A;  4XT3 B;  4HID A;  4DUZ Q;  1EZ6 A;  1KL9 A;  2A19 A;  5D14 A;  1L0Y B;  3T4A C;  4L5S A;  4LJZ C;  4PQX A;  1IL8 A;  1ILP A;  5M3M H;  1DXM A;  1KLU D;  4A3M B;  1PFM A;  2K52 A;  4PZ7 A;  3S2H H;  2HHH L;  4CDF C;  2ZTC A;  4OEM B;  2ZXP A;  1GO3 E;  3HOW B;  1VQ9 A;  4A3G B;  3NEL A;  4A3K B;  4BXX G;  4JI3 L;  2J4X A;  2FMM A;  5FKA C;  2B2U A;  2CH4 W;  2R6G A;  2R92 B;  4OX9 L;  1WOC A;  1Y8O B;  4DR4 Q;  1S72 A;  3FP9 A;  4Z9C B;  2QDL A;  3GTP H;  1E1T A;  1A3V A;  1QZH A;  1PLF A;  4NDX A;  1IBM Q;  2VQF Q;  3D6W A;  4OO1 G;  1D7Q A;  1QB5 D;  3TRZ A;  4DR1 Q;  3PO3 B;  4LF5 Q;  2Q2T A;  1EY7 A;  1W6J A;  5COY A;  4HIK A;  3K57 A;  1T5X D;  3G4S A;  1EEF D;  3ER0 A;  5J39 A;  3ITP A;  3DM3 A;  2QIL A;  1U4P A;  1X3F A;  1D1I A;  1H9S B;  5DLQ E;  3OTO L;  1GD7 A;  1YHQ A;  4KI0 A;  3S16 H;  1OXU A;  4A3D G;  3CXC A;  2A74 C;  2PQA A;  4O2D A;  4X62 Q;  3TN2 A;  2VQE Q;  3J7A 5;  4CKE A;  4HN7 A;  1K0S A;  4NP5 A;  1DZ1 A;  1BOS A;  1PZJ D;  3TDQ A;  1M1K C;  1JE4 A;  4AIM A;  3DWP A;  4A3K G;  2YU9 H;  3TBI B;  2MPM A;  1CQV A;  4KY6 A;  2TSS A;  1FGB D;  3CCQ A;  1BBX C;  5ISR A;  1MSG A;  3A7L A;  2K5Q A;  2WB1 E;  3AEV A;  1SE2 A;  3TS0 A;  3K0X A;  1PRT C;  1T9H A;  2CH4 A;  2WFW A;  3M4Q A;  1SSO A;  3X3M A;  1C7Y A;  4C3I G;  5BR8 Q;  1VQ6 A;  2A69 C;  2X6G A;  2R7Z H;  4NPS A;  1X55 A;  3GD7 A;  4MTN A;  3VYU A;  2B2W A;  1C4Q A;  1SNC A;  4JI4 L;  2PNH A;  5JPN C;  2VQE L;  4KJN A;  1A3U A;  1JJG A;  2K5V A;  1CT1 D;  3DUZ A;  2UU9 L;  3NBH A;  5CV5 A;  1E2W A;  2F0K A;  3S1Q H;  5KNB A;  2B8G A;  3DEP A;  4XDX A;  3FEW X;  4EQ5 A;  3NBI A;  4ME3 A;  1HXY D;  3J80 E;  3LX0 A;  2K32 A;  1K3R A;  2FXQ A;  1U4R A;  1HTP A;  1AZP A;  1XNR Q;  1KQS A;  2QA4 A;  1PH9 A;  1BNZ A;  2EE1 A;  1YEZ A;  5ELC A;  4GNX C;  5JJZ A;  4K14 A;  1N8R C;  1D6E C;  3H15 A;  2PI2 A;  2K33 A;  1B3Q A;  4JI7 Q;  3I7F A;  3PGZ A;  1NR2 A;  3R3O A;  1LTS D;  2QKI C;  4DR5 L;  3U9S A;  5I6Y A;  5JJK A;  3CQZ H;  1AH9 A;  2I5M X;  3D0F A;  4B9X A;  4HCE A;  5I9P A;  4IUR A;  3S16 B;  4DK3 C;  3IKJ A;  4B9W A;  4MTK A;  3S1M B;  2NVT H;  1TWC B;  4ZCK A;  1EQT A;  3OWE B;  2ID0 A;  2WB1 B;  2E76 C;  1BXT A;  3TP8 A;  3A8I E;  4FNF A;  1Q46 A;  3N6R A;  1IBM L;  4L5Q A;  4Q0F A;  4IJL A;  4K8I A;  1II3 A;  1NR4 A;  3AFQ A;  1DOM A;  3HOW G;  2WKC A;  5A2Q L;  1IYV A;  5KIX A;  2KJX A;  1XPO A;  3F2B A;  3EA6 A;  3KLS X;  4U67 3;  3FRP B;  3BYY B;  5FLX L;  3C3L A;  4PNY A;  1YIJ A;  3A8J E;  4HJA A;  1U0L A;  1GUS A;  1JJC B;  1LAC A;  4GN4 B;  2E2H H;  2I46 A;  1ESF A;  3TZD A;  1A63 A;  2SDF A;  1NAP A;  1X3G A;  4FXK C;  5FOB B;  4B3S L;  4FDB A;  1S5D D;  4ILW A;  1XMQ L;  1QVC A;  1MBY A;  4JW0 A;  4Y7N H;  1N32 Q;  3LGJ A;  2L12 A;  2JK8 A;  1HHV A;  5LMU Q;  1FJG L;  3NTH A;  1SBB B;  3HOY H;  1PTO B;  3C1F A;  3HG9 A;  4PMW A;  3Q6S A;  3KBX A;  2KEN A;  1DOK A;  4IOC A;  2IPK D;  1VQE A;  2CW0 D;  5C3X A;  3PIP 3;  3HKZ B;  1I4R A;  1T5E A;  3A54 A;  4PMB A;  1G29 1;  3RLN A;  2VZA A;  3DWQ A;  4UY8 C;  3S14 H;  3MC0 B;  1YJN A;  4FF1 A;  4QGU A;  4BBR B;  1VQL A;  3Q24 A;  4LF4 L;  1I50 B;  3GTM B;  2E2J B;  4BXX H;  1YBY A;  3NUC A;  1N34 Q;  1HQR D;  3I4O A;  1Q1B A;  3HOX H;  2GVB A;  1PH3 A;  1U4M A;  2YYZ A;  3NWS A;  2H4O A;  4O0A A;  3VDY A;  5EBD A;  2R7D A;  2UXB L;  1VF5 C;  4B3T Q;  3S15 B;  2E74 C;  4C3J B;  4HJ9 A;  1SYG A;  3K5L A;  3I4N G;  1Y14 B;  1SJH D;  3M4O H;  1SMY D;  2QEJ C;  2YTV A;  1YNN C;  3JAM E;  1HH2 P;  1B70 B;  2ES2 A;  2JA5 B;  1JWS D;  4JI5 Q;  1PFB A;  4LFC L;  4X64 Q;  2PI2 E;  2HT1 A;  1EYG A;  3J7A F;  2MGS A;  2K5W A;  1EU4 A;  2WKD A;  2FFK B;  3S1R H;  3BDL A;  2NTS A;  4DF7 A;  2A68 C;  3PIP A;  1HNW Q;  4CKB A;  1LV9 A;  3BDC A;  1B50 A;  4KTA A;  1YNN D;  1TS5 A;  4CJ0 B;  2BCO A;  5K36 H;  1WTQ A;  4IUT A;  1PHJ A;  1B3A A;  1BCP B;  4RKB A;  5LL6 X;  3K59 A;  1R9T H;  4OEL B;  5D3I B;  3H91 A;  4DU9 A;  1O7I A;  4DK1 A;  4HIO A;  4NB3 A;  1I4Q A;  4RH6 A;  1GKH A;  3A7A B;  2M2L A;  2DY8 A;  1ZYR C;  5IYC H;  5EAY A;  1IBL Q;  3SDZ A;  1I94 Q;  4QF4 A;  1TWF H;  2PMZ B;  2OEO A;  4RKL A;  2M9V A;  4F88 A;  4FYD A;  1H9K A;  4L5T A;  3OMC A;  4YY3 L;  2RHQ B;  3BU2 A;  3TEH B;  4A3G H;  1U5K A;  2KHS A;  4DV2 L;  2HIX A;  3RMH A;  2HCC A;  4DUY L;  4P75 A;  5HUR A;  3SVM A;  3GTG B;  1ONL A;  1P16 A;  3QWN A;  3KJO A;  1UEB A;  3R2T A;  2E8G A;  4FF2 A;  1SNQ A;  4P74 A;  2F0D A;  2F0S A;  2WII B;  2ZXO A;  5IT9 c;  2N55 A;  2A1A A;  1HR0 L;  1IYJ B;  2IW3 A;  4L5R C;  1VQJ A;  2F4V Q;  4ZKC B;  1B8A A;  1VDZ A;  4K0K Q;  5CV6 A;  4Y7N B;  4FXD A;  2B2Y A;  2TMP A;  2O4X A;  4K5W A;  2ATW A;  3WOF A;  3ICE A;  3H0G B;  3OPO A;  3RNU A;  2EOT A;  1D5M C;  3QIA A;  5D65 A;  4BBR G;  4DA2 A;  1KIX A;  4I7Z C;  1EQR A;  5M5Y H;  1C0A A;  4V0B A;  4LF8 Q;  3NTK A;  2F0E A;  1WTX A;  1LO5 D;  5CV4 A;  1RTO A;  3I55 A;  1MHW C;  1XMO Q;  1IW7 D;  1KDC A;  4R4O A;  4C2M H;  1JE5 A;  1TWG H;  3GTO H;  5IIF A;  1I6H H;  1UE7 A;  3CCS A;  5JJI A;  2QDB A;  4X3U A;  1MGS A;  4UAI A;  4DV1 L;  2Z6B A;  2XRQ D;  3I8Z A;  1LTT D;  2PW5 A;  3SK5 A;  4H13 C;  5C0X H;  4JYA Q;  4DXG A;  3BZD B;  2IT1 A;  4A93 G;  2VB2 X;  2HQE A;  2EJF C;  2GA4 B;  1IW7 C;  2ICI A;  2K5N A;  3KK7 A;  1S5F D;  4OXP A;  4JI1 Q;  3GTQ B;  3C46 A;  2FHT A;  2JA8 G;  4RHR A;  3ND8 A;  4GS3 A;  3CRL C;  4X6A H;  2NWG A;  3I56 A;  1TKW B;  1JIC A;  1NNX A;  2EIF A;  4XQN A;  3M7G A;  1Y1V G;  1HNZ L;  4A3J B;  2H1E A;  4LNQ A;  3NK9 A;  1EYA A;  1QZG A;  3BJU A;  1XNQ L;  1G8Z D;  1AFP A;  4NXM Q;  1N36 Q;  5KYL A;  5IYB H;  3X3N A;  5IGF A;  2F0I A;  4TRD A;  1SDF A;  1DYQ A;  1Z6H A;  2JA5 G;  1O80 A;  2Z1C A;  4IN3 A;  3ERO A;  3RUZ A;  1HCZ A;  2BA1 A;  4KHV A;  4QJF A;  1GUN A;  3GTL B;  1EWH A;  4LF6 L;  4A3L G;  3MFG A;  1ET6 A;  1PYS B;  1XJV A;  4BA2 I;  4P2C B;  1IKM A;  1VMP A;  4RCN A;  4LW1 A; 
#chains in the Genus database with same CATH homology
 1JOK A;  4QIW B;  5EGT A;  1CA5 A;  1DD2 A;  3BVG A;  4XT1 B;  2L55 A;  4L6T B;  4S3S A;  5E4X A;  3C2P A;  2HDM A;  3MXN A;  2F03 A;  2PCF B;  2KEC A;  3UI2 A;  3M4Y A;  1XTC D;  2KCN A;  1VCI A;  4DFA A;  3VR6 A;  3HOX B;  5EPJ A;  4DXF A;  3D6C A;  2XWB B;  2EJG C;  5JVH 3;  2O5J C;  4LMQ D;  1K8M A;  5EPL A;  4ULL A;  2ICE C;  4OO1 H;  4Q5V A;  3FVQ A;  2F0L A;  2VXW A;  1TY0 A;  5CYU A;  5C4X B;  4XQQ A;  1HUM A;  5KYI A;  4OHJ A;  4ZK9 B;  1C8C A;  5M5X B;  3H3V C;  1CQF A;  1PYW D;  2RKS A;  4KKT A;  4RGO S;  2MJ8 A;  3NWT A;  2F1M A;  2LMC B;  2OF1 A;  4EVO A;  3NQT A;  1TR5 A;  3LWE A;  2NB0 A;  3VA7 A;  3GP7 A;  5C6A A;  3WDN A;  3KBG A;  1PZI D;  4ZQ3 A;  2AWN A;  1Q90 A;  4RAU C;  2B2T C;  4GZY C;  3KLS A;  3S1N B;  1ET9 A;  4A93 B;  3EQL C;  3I4L A;  3PUX A;  5JEA H;  5M3M B;  1DOL A;  1D5X C;  1HA6 A;  4F7X A;  1OXX K;  4HMJ A;  4OL7 A;  3NPP A;  4RHS A;  2ZXR A;  5M5W B;  1J8I A;  1O7Y A;  4KD4 A;  1STY A;  1JQY D;  4MN3 A;  1XYI A;  2AQ1 B;  2B39 A;  4I65 A;  5KGU A;  5EKI A;  4DGZ A;  2LFN A;  4KKS A;  4ID6 A;  1DM0 B;  4FF3 A;  5M9O A;  1KLG D;  2EY5 A;  2PO4 A;  3OOC A;  2Q8R E;  1F2Y A;  4KV6 A;  4KKU A;  2RVL A;  1TT2 A;  3KLR A;  1RDP D;  4C3H G;  2K5D A;  1SND A;  1STA A;  1B9M A;  4NMZ A;  1YNJ D;  4N9P A;  2WV6 D;  3MVV A;  3QB3 A;  1SFO B;  1WD0 A;  5AFW A;  3S1Q B;  1KAB A;  3RZO B;  2EVB A;  3DMU A;  3TZU A;  1G2S A;  2F0V A;  1A6X A;  2HUG A;  3I91 A;  2B2U C;  4C1N I;  3I4M B;  5KNC A;  4DAY A;  2A6E C;  2R7Z B;  2A6H D;  3RLF A;  4ODG A;  3S14 B;  4CBV A;  3Q22 A;  2JEA I;  3NTI A;  5IGC A;  1G6Z A;  4R9W A;  2Q8I B;  2EY1 A;  1EFI D;  2A68 D;  4ZRZ A;  4QUF A;  4G57 A;  2IX1 A;  1X3P A;  2DNE A;  3V05 A;  2IX0 A;  3IFT A;  1SE4 A;  5CV8 A;  3SEB A;  5G3L F;  3AMU A;  2F0T A;  2JA7 B;  1TWG B;  2AQ2 B;  3G7L A;  5J22 A;  2F0Q A;  4UDU C;  3HZX A;  1RD9 D;  3DEO A;  3GQB A;  4WFN 3;  3GTK B;  3AB9 A;  2B8F A;  3PIO 3;  1DJR D;  3HOV B;  4RFB A;  3A55 A;  3K0Y A;  4FO2 A;  4EQO A;  3IAY A;  5C0X J;  1B1Z A;  1EY8 A;  3BVZ A;  3I70 A;  3E6Z X;  3F2U A;  4N9T A;  2EY6 A;  4LK1 C;  4KJO A;  3T51 B;  1EEI D;  1QE6 A;  4HTH A;  2HCI A;  1PFN A;  4IUU A;  3Q23 A;  3H09 A;  3ONA B;  5J1Z A;  1G91 A;  1PTO D;  3PUZ A;  1BCP F;  3SHL A;  1F2L A;  1QJO A;  5ELE A;  1LAB A;  2XVS A;  3T56 B;  4E6I A;  2KVM A;  3URY A;  1O78 A;  4CJ1 B;  4KY5 A;  1EZ8 A;  1HA5 A;  2JSO A;  2WAQ B;  3TP7 A;  2RDG A;  4XIG S;  4K6D A;  3OWF A;  1TS4 A;  4ZYS A;  3VR5 A;  3V96 A;  2DY7 A;  3CKI B;  1RTN A;  2B2V C;  1GHK A;  1CI3 M;  1EY4 A;  5K5P A;  2D9U A;  1A3T A;  1C48 A;  1TWA B;  4ZUJ A;  5A35 A;  4OGQ C;  3M85 A;  1DCZ A;  4L63 B;  2EYM A;  4NW2 A;  3MWY W;  4IFD G;  1U9R A;  3S1R B;  1WVL A;  4FF4 A;  1SNM A;  3HOU B;  1STB A;  4IAL A;  1JOR A;  3NP8 A;  3J7Y W;  1KDB A;  2V4D A;  4KK7 A;  2J7Z A;  4IFD J;  1D1K A;  3DXJ C;  5DEH A;  3HOY B;  4EQN A;  3MXG A;  1V1P A;  4PV1 C;  4A3D B;  5IGE A;  4QCL A;  3ND9 A;  5CMD A;  1Y8N B;  3OSO A;  5IOD A;  4ME5 A;  2IX3 A;  4J1M A;  2J0T D;  1EIG A;  2WAC A;  1MSH A;  2L9H A;  5I2Y A;  1XXG A;  3E5S A;  1CZW A;  5HGT A;  2JP1 A;  3M7N A;  3S2H B;  1TVX A;  1VMC A;  3SXH A;  5LL6 S;  1RCV D;  1SYD A;  2D5D A;  2XIW A;  4R8N A;  1EQV A;  2PW7 A;  3L9A X;  2AUK A;  1Z47 A;  1JWM D;  1S5E D;  2OT2 A;  2K6A A;  1K8O A;  4IUN A;  3CHB D;  2WP8 J;  1CM9 A;  1GOZ A;  5EPK A;  2K04 A;  5E3F A;  2M00 A;  5IGD A;  3HRZ C;  3T53 B;  1Q1E A;  5C4H A;  1MD2 D;  3P20 A;  1SJE D;  1B53 A;  5JPM C;  4DAV A;  4K2L A;  3S9W A;  1EOT A;  1PRT F;  3M3Y B;  2KQ3 A;  4J6H A;  1QIL A;  1GUO A;  4XTC S;  3R93 A;  1G2T A;  1BQQ T;  1B9N A;  3LNN A;  4WRD A;  4JK1 C;  4BY1 B;  2JEB I;  5KEE A;  1SYF A;  2EYF A;  4QMG A;  2AWO A;  5NUC A;  2XSC A;  2K1B A;  3J7A V;  2IL8 A;  4U68 A;  2BA0 A;  1WTR A;  1FD7 D;  1LTR D;  3J81 L;  2F0M A;  2HDL A;  5DNF A;  3A8K E;  1UNS A;  1PRT B;  1I6V C;  2PYK A;  5DAU A;  2EXZ A;  5FO7 B;  1NCV A;  1SNO A;  4RGM A;  1RKN A;  1S4Z A;  3NSW A;  3MA2 B;  5ELB A;  1WTW A;  2F0W A;  3K6O A;  2BE5 D;  1ESR A;  1UEA B;  4CGY B;  5T1I A;  1Y1V B;  4WJW A;  3EJI A;  2JYO A;  1H9M A;  1F2Z A;  2N88 A;  2NUC A;  1STH A;  1SNP A;  1I4P A;  1UUP A;  1EY9 A;  4HAE A;  2VNU D;  4C3J G;  3DHQ A;  1GUT A;  3IL8 A;  3V2T A;  5K36 G;  1LT5 D;  3SK8 A;  3LWU A;  1H9S A;  2K05 A;  2K7V A;  1ICW A;  1PTO H;  4IFD H;  3J80 L;  1BUV T;  4C3I B;  3RD4 A;  5TSS A;  1ENF A;  3I4N B;  5EKL A;  1Q3L A;  2NVY B;  3BVM A;  1ML0 D;  1U4L A;  1SMY C;  2FJ2 A;  2E2H B;  3D4D A;  1O7Z A;  2C9O A;  2AQ3 B;  1BCP C;  3K5O A;  1I4G A;  1H9J A;  4G7O C;  3PUV A;  4J8Q A;  1EY6 A;  3OHX C;  3FPP A;  4TSS A;  4EQP A;  2RA4 A;  3MHB A;  5CV7 A;  2X69 A;  3P75 A;  1XX8 A;  1TQO A;  1PTO C;  5IT9 E;  3OIQ A;  2FMC A;  1UAP A;  1CA6 A;  4OIK A;  4C56 C;  2A73 B;  3T13 A;  1TY2 A;  2LS0 1;  1V43 A;  1W6K A;  2AUJ D;  2NTT A;  2F0H A;  2RSN A;  2XRS D;  4BS9 A;  2Z4I A;  2CHB D;  1V1P B;  1LLR D;  3K5N A;  2R93 B;  4C2M B;  5C4J B;  4KY7 A;  1BDO A;  4OO1 I;  1QG7 A;  3PMF A;  2F0G A;  2I07 B;  2NN6 H;  1CHQ D;  1EYD A;  3T16 A;  1X32 A;  4K5V A;  4B08 A;  3O13 A;  2ENB A;  4XXE A;  3HP3 A;  2R3Z A;  3MXP A;  2K01 A;  1A2U A;  1IHZ A;  3SK4 A;  2SEB D;  2L11 A;  2F0P A;  1HPC A;  2DN8 A;  3I72 A;  2Z4H A;  2K28 A;  4IFD I;  1J9O A;  2BDO A;  1AEX A;  4NKL A;  2CW0 C;  4FXG C;  5ELD A;  2KCC A;  4L8J A;  2VUM B;  4CJ2 C;  2MHV A;  1SE3 A;  1HTL D;  2D2C C;  2R61 A;  3JAM L;  3MXU A;  1Y69 U;  3CU7 A;  3A56 A;  3K7A B;  2B2W C;  5C44 B;  1IKL A;  3G6J B;  5C5M A;  1QWY A;  4H44 C;  1JCK B;  3N52 A;  1SAP A;  3GV3 A;  4LAA A;  3TME A;  5JEA J;  4HCS A;  4DAP A;  2IJ0 A;  4WOR A;  1ZKO A;  3ERQ A;  1EY0 A;  1JOO A;  3D3R A;  1AP0 A;  3HEJ A;  5CV9 A;  5COR A;  4KN7 C;  1F77 A;  1GUG A;  4G7H C;  1LT4 D;  4XYQ A;  1E2Z A;  2IWH A;  1PMR A;  3C1E A;  2EYH A;  2NN6 I;  4XYO A;  5IOC A;  3GTJ B;  4R8I A;  1F9R A;  3U9O A;  3BG3 A;  2EPB A;  1I3Q B;  1ENA A;  4K2K A;  1B44 D;  1PDQ A;  5BN5 A;  2SOB A;  4YIJ A;  1MI2 A;  1B2T A;  3NXW A;  3AU7 A;  2EZV A;  4O1N A;  2NYZ D;  1CTM A;  2PQE A;  3FPU B;  1V1O A;  5CBE E;  1QCB D;  1FNV A;  4IUP A;  1CFM A;  3W2D A;  4RCO A;  3VYR A;  1ILQ A;  3QJY A;  5E1F A;  3MFY A;  1ROD A;  1BR9 A;  1SXT A;  1S5C D;  1XWE A;  3KF8 A;  1GHJ A;  3MAQ A;  1IYU A;  1CHP D;  4G4K A;  2E2I B;  3H6M A;  1GXD C;  4RWS C;  1JOQ A;  1TU2 B;  2PZW A;  5KND A;  1LTB D;  1ENC A;  2F0O A;  2CQA A;  3I90 A;  4ZAI A;  4M8A A;  5I6W A;  2SNM A;  2BE5 C;  3FMC A;  5JAV A;  3R8B A;  1O7L A;  4MHE A;  3OMG A;  3BYT B;  1EWC A;  1B4O A;  3MZ5 A;  1GUW A;  2A6E D;  1HRJ A;  3CQZ B;  2K03 A;  5IGG A;  5C5L A;  4X3K A;  2B2V A;  2Q8T A;  2E2D C;  2EJM A;  3QO2 A;  4QB4 A;  3R2I A;  5EQ0 A;  1PXU A;  1STE A;  3D31 A;  1Q8I A;  1K83 B;  3D4R A;  1A2T A;  1STN A;  3PV0 A;  2PZU A;  2C5C A;  1HQM C;  4KMU C;  1HFG A;  4H7B A;  5DM7 3;  1FR3 A;  2PNR C;  4KHZ A;  2PPB C;  2RDF A;  4KD3 A;  2RBM A;  4DN4 M;  1ZEQ X;  3WOE A;  3I3C A;  4V19 0;  3EFX D;  1WTV A;  1KDA A;  1EU3 A;  4RGT A;  3BS1 A;  2Y0S B;  5C0X I;  1FNU A;  1Q12 A;  4FP5 D;  1EL0 A;  2B2Y C;  4BBS B;  2KEE A;  1Y8P B;  2JA8 B;  2A6H C;  1BCP D;  2O2L D;  1Y1W B;  2G9H D;  1GJX A;  2L1B A;  2BDN A;  1F9P A;  5JVG 3;  4IUQ A;  5I9O A;  2O5I C;  1LT3 D;  3GO5 A;  5BN4 A;  5FK9 C;  1TS2 A;  3NHH A;  4OIJ A;  5A2Q E;  3CRK C;  1RJT A;  3PO2 B;  2B2T A;  1PZK D;  2E75 C;  1D2B A;  1BF4 A;  1LT6 D;  4CHT B;  1RF2 D;  3K58 A;  3GTP B;  1SYC A;  2MP1 A;  4C3H B;  1NSN S;  3NQI A;  2Z8L A;  1CZG A;  2FIN B;  3PUW A;  1I6H B;  4A3F B;  3QG1 A;  1L0X B;  3ZYY X;  5ELF A;  4A3I B;  1F9S A;  1JWU D;  2KOL A;  4ZUI A;  4HSP A;  2SNS A;  2F0N A;  3W3A A;  2XNA C;  3TSS A;  3RZD B;  3VYT A;  3NE5 B;  2F0U A;  4X3S A;  1QOH A;  1KTK A;  1R4P B;  3TP6 A;  2EDG A;  4F8M A;  1OO9 B;  2MUY A;  2G9D A;  1KNA A;  2F4I A;  4XQJ A;  2DNC A;  4C1N K;  1R4Q B;  2RDH A;  1WD1 A;  1A15 A;  2LKV A;  4TQU S;  3M4O B;  4H0L C;  4TKO B;  2EYO A;  3VA5 A;  5JEA G;  3FDT A;  3L7Z C;  1RHP A;  1NUC A;  1EY5 A;  3SK6 A;  1E0B A;  5FO9 B;  2JXM B;  1HUN A;  5CR3 A;  4ABN A;  1OXT A;  1STG A;  1FYC A;  5M3F B;  4IUV A;  1R9T B;  2XN9 C;  3H94 A;  1WTP A;  5CBA E;  4RGN A;  4K8J A;  2NBF A;  4K5X A;  3PUY A;  2KA7 A;  4MIU A;  1F9Q A;  3SR1 A;  5I2X A;  5D3D A;  4CKC A;  5F2D A;  1BO0 A;  1SYB A;  5IT9 L;  2RQX A;  2D62 A;  3TP5 A;  3SE0 A;  3GTO B;  2NVX B;  2F3W A;  4RA8 A;  2XWJ B;  2JA6 B;  3VYS A;  2KED A;  4O42 A;  2A5H A;  5I4D A;  1HFN A;  1KNE A;  3QOJ A;  2PZT A;  1AN8 A;  3OIP A;  1QNU A;  2F3V A;  4IZ8 A;  4JBW A;  4BA1 I;  2BOS A;  3K5M A;  2QCP X;  4EGV A;  1SYE A;  3EVQ A;  1M4V A;  1X3Q A;  4HED A;  5EBC A;  4DK0 A;  1DON A;  1EYC A;  4A3B B;  5C4Z A;  4X3T A;  2B63 B;  1PRT D;  2JE6 I;  1LTG D;  4HSV A;  5G3L D;  3P7J A;  4HMI A;  4ZKB B;  3DM1 A;  2A69 D;  1H9R A;  1AW7 A;  3L3O C;  1OXS C;  1PTO F;  5FO8 B;  2EYL A;  5M5Y B;  2ZT9 C;  2WIN B;  5EJW A;  5CGK A;  1EIH A;  4A3E B;  2CVR A;  3GV6 A;  3VR2 A;  4K6L A;  1M8A A;  1TS3 A;  5JOB A;  5C3E B;  1OXV A;  1D5Z C;  1LTA D;  1Z7T A;  2VB3 X;  1TWH B;  5C0X G;  1WCM B;  3S2D B;  3I73 A;  4DNT B;  1I4H A;  2NVT B;  5LHY 1;  2EYP A;  2NZ1 D;  1VF7 A;  4BWG B;  1S5B D;  5C3W A;  1ZXT A;  1TWF B;  3P1H A;  3DWA A;  2KUM A;  2F0F A;  3HGB A;  1QNK A;  1WTO A;  1LTI D;  5BN3 A;  1E2V A;  5E4W C;  5T1G A;  4QUC A;  1YNJ C;  3D8G A;  2RSO A;  3HS0 C;  1FNW A;  4F87 A;  3QOL A;  2QF7 A;  3D4W A;  4IQZ A;  3S17 B;  3FKI B;  2NN6 G;  1AZQ A;  4PMC A;  3MEH A;  4HR7 B;  3HOZ B;  2F0J A;  2X6L A;  1CK1 A;  1V8Q A;  2OXP A;  3E0J A;  3IFD A;  2NVQ B;  3VR4 A;  3BDO A;  5DM6 3;  5EKK A;  4BY7 B;  3KUP A;  1KAA A;  4DNR B;  3OW7 A;  3Q0A A;  1TII D;  2L5T A;  3J81 E;  3VR3 A;  4FVM A;  5FLX E;  5IGB A;  4M1U B;  4ZLT F;  4AYB B;  2EY2 A;  2YU9 B;  2L4N A;  1I4X A;  5CC4 A;  2LY7 A;  4G7Z C;  3MTS A;  1ZYR D;  1JB3 A;  4KN4 C;  1SEB D;  1JC7 A;  2L0C A;  1JR0 D;  5KRU A;  2EYJ A;  1F2M A;  4XT3 B;  1EZ6 A;  5D14 A;  1L0Y B;  3T4A C;  4LJZ C;  4PQX A;  1IL8 A;  1ILP A;  1DXM A;  1KLU D;  4A3M B;  1PFM A;  2ZXP A;  3HOW B;  4A3G B;  4A3K B;  2J4X A;  2FMM A;  5FKA C;  2B2U A;  2R6G A;  2R92 B;  1Y8O B;  4Z9C B;  1A3V A;  1PLF A;  4NDX A;  3D6W A;  4OO1 G;  1QB5 D;  3PO3 B;  1EY7 A;  1W6J A;  5COY A;  3K57 A;  1T5X D;  1EEF D;  5J39 A;  3ITP A;  2QIL A;  1U4P A;  1D1I A;  1H9S B;  4KI0 A;  1OXU A;  2A74 C;  3TN2 A;  4CKE A;  4HN7 A;  4NP5 A;  1DZ1 A;  1BOS A;  1PZJ D;  3TDQ A;  1JE4 A;  3DWP A;  3TBI B;  2MPM A;  1CQV A;  4KY6 A;  2TSS A;  1FGB D;  1BBX C;  5ISR A;  1MSG A;  3A7L A;  2K5Q A;  1SE2 A;  1PRT C;  1SSO A;  3X3M A;  4C3I G;  2A69 C;  2X6G A;  3GD7 A;  3VYU A;  2B2W A;  1C4Q A;  1SNC A;  5JPN C;  4KJN A;  1A3U A;  1CT1 D;  3DUZ A;  3NBH A;  5CV5 A;  1E2W A;  2F0K A;  5KNB A;  2B8G A;  3DEP A;  4XDX A;  3FEW X;  3NBI A;  1HXY D;  3J80 E;  3LX0 A;  2K32 A;  1U4R A;  1HTP A;  1AZP A;  1BNZ A;  2EE1 A;  5ELC A;  5JJZ A;  4K14 A;  1D6E C;  2K33 A;  1NR2 A;  3R3O A;  1LTS D;  2QKI C;  3U9S A;  5I6Y A;  4B9X A;  4HCE A;  5I9P A;  4IUR A;  3S16 B;  3IKJ A;  4B9W A;  3S1M B;  1TWC B;  1EQT A;  3OWE B;  2ID0 A;  2WB1 B;  2E76 C;  1BXT A;  3TP8 A;  3A8I E;  4FNF A;  3N6R A;  4Q0F A;  4K8I A;  1II3 A;  1NR4 A;  1DOM A;  2WKC A;  5A2Q L;  1IYV A;  5KIX A;  2KJX A;  3EA6 A;  3KLS X;  4U67 3;  3FRP B;  3BYY B;  5FLX L;  3C3L A;  4PNY A;  3A8J E;  1GUS A;  1LAC A;  2I46 A;  1ESF A;  3TZD A;  2SDF A;  1NAP A;  4FXK C;  5FOB B;  1S5D D;  4ILW A;  1MBY A;  2L12 A;  1HHV A;  3NTH A;  1SBB B;  1PTO B;  3C1F A;  3HG9 A;  4PMW A;  3Q6S A;  3KBX A;  1DOK A;  2IPK D;  2CW0 D;  5C3X A;  3PIP 3;  3HKZ B;  1I4R A;  1T5E A;  3A54 A;  4PMB A;  1G29 1;  3DWQ A;  3MC0 B;  4FF1 A;  4BBR B;  3Q24 A;  1I50 B;  3GTM B;  2E2J B;  3NUC A;  1HQR D;  1Q1B A;  1U4M A;  2YYZ A;  3NWS A;  2H4O A;  5EBD A;  1VF5 C;  3S15 B;  2E74 C;  4C3J B;  1SYG A;  3K5L A;  1SJH D;  1SMY D;  2QEJ C;  1YNN C;  3JAM E;  2JA5 B;  1JWS D;  1PFB A;  3J7A F;  2MGS A;  2K5W A;  1EU4 A;  2WKD A;  2FFK B;  3BDL A;  2NTS A;  4DF7 A;  2A68 C;  4CKB A;  1LV9 A;  3BDC A;  1B50 A;  4KTA A;  1YNN D;  4CJ0 B;  1TS5 A;  2BCO A;  5K36 H;  1WTQ A;  4IUT A;  1B3A A;  1BCP B;  4RKB A;  5LL6 X;  3K59 A;  5D3I B;  3H91 A;  4DU9 A;  4DK1 A;  1I4Q A;  4RH6 A;  3A7A B;  2M2L A;  2DY8 A;  1ZYR C;  3SDZ A;  4QF4 A;  2PMZ B;  4F88 A;  2OEO A;  4RKL A;  2M9V A;  4FYD A;  1H9K A;  3OMC A;  2KHS A;  3RMH A;  2HCC A;  5HUR A;  3SVM A;  3GTG B;  1ONL A;  3QWN A;  3R2T A;  4FF2 A;  1SNQ A;  2F0D A;  2F0S A;  2WII B;  2ZXO A;  2N55 A;  2IW3 A;  4ZKC B;  1VDZ A;  5CV6 A;  4Y7N B;  4FXD A;  2B2Y A;  2TMP A;  2O4X A;  4K5W A;  3WOF A;  3H0G B;  3OPO A;  2EOT A;  1D5M C;  3QIA A;  5D65 A;  4DA2 A;  4I7Z C;  4V0B A;  3NTK A;  2F0E A;  1WTX A;  1LO5 D;  5CV4 A;  1RTO A;  1IW7 D;  1KDC A;  5IIF A;  2QDB A;  4X3U A;  1MGS A;  4UAI A;  2XRQ D;  3I8Z A;  1LTT D;  2PW5 A;  3SK5 A;  4H13 C;  5C0X H;  4DXG A;  3BZD B;  2IT1 A;  2VB2 X;  2HQE A;  2EJF C;  2GA4 B;  1IW7 C;  2ICI A;  3KK7 A;  1S5F D;  3GTQ B;  3C46 A;  2FHT A;  4RHR A;  3ND8 A;  3CRL C;  2NWG A;  1TKW B;  1JIC A;  4XQN A;  3M7G A;  4A3J B;  2H1E A;  3NK9 A;  1EYA A;  1AFP A;  1G8Z D;  5KYL A;  3X3N A;  5IGF A;  2F0I A;  4TRD A;  1SDF A;  1DYQ A;  1Z6H A;  1O80 A;  2Z1C A;  3ERO A;  3RUZ A;  4IN3 A;  1HCZ A;  2BA1 A;  4KHV A;  1GUN A;  3GTL B;  1EWH A;  3MFG A;  1ET6 A;  4BA2 I;  4P2C B;  1IKM A;  1VMP A;  4RCN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...