1IKMA

Nmr study of monomeric human interleukin-8 (30 structures)
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
69
structure length
68
Chain Sequence
ELRCQCIKTYSKPFHPKFIKERVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytokine (chemotactic)
molecule keywords HUMAN INTERLEUKIN-8 (MONOMERIC)
publication title 1H NMR solution structure of an active monomeric interleukin-8.
pubmed doi rcsb
source organism Homo sapiens
total genus 10
structure length 68
sequence length 69
ec nomenclature
pdb deposition date 1995-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ikmA00
2K01A 1F9SA 2K04A 2EE1A 1F9RA 1QE6A 1U4RA 3TN2A 4MN3A 5E4WC 3TZDA 2FHTA 1CA5A 1CM9A 1RODA 1SAPA 3FDTA 2MJ8A 3R93A 1MI2A 5DNFA 2L1BA 1HFNA 4MHEA 1WTQA 1O80A 2HCIA 1Q3LA 1J9OA 1WVLA 1PFNA 1HA6A 1G2SA 3I90A 1WTOA 2B2VC 4X3TA 1NR4A 2X6GA 5E4XA 1C8CA 1G2TA 1XX8A 5COYA 1IKLA 5EKIA 2J7ZA 2XIWA 1U4LA 5EQ0A 4IURA 1IL8A 3DEPA 4IUPA 1WTWA 1KNAA 2B2VA 2K1BA 1B4OA 2R3ZA 3I91A 4IUQA 1CA6A 1HHVA 3MWYW 1RJTA 2KEEA 2NWGA 1ICWA 2D9UA 1A15A 3HP3A 1PFMA 4QUCA 4R9WA 5EPLA 5EPKA 5CMDA 1WD0A 1AP0A 1WTVA 1EQTA 4XT3B 1JICA 2KOLA 2L9HA 3IL8A 1KNEA 2IL8A 2RSNA 2MPMA 2X6LA 3MTSA 4QUFA 4IUVA 1WTPA 2JP1A 2B2WC 3DM1A 3KUPA 4IUUA 4XDXA 1DOKA 1ESRA 4CJ0B 3IFDA 5EPJA 1HUMA 1WD1A 1VMPA 2N88A 2Q8RE 2RA4A 5D14A 4ZLTF 1BF4A 2EPBA 2B2WA 1MSHA 4NW2A 5EJWA 3UI2A 2KECA 1PLFA 1HFGA 2K03A 3FPUB 1MGSA 2DY7A 3LWEA 1AZPA 1EIGA 2KVMA 4XT1B 1B53A 4CJ1B 3SVMA 1EL0A 3N52A 1ILQA 1B3AA 1BO0A 1F9PA 2B2YC 1NAPA 2HCCA 2N55A 1LV9A 1PDQA 2K05A 3F2UA 4X3KA 1WTXA 4X3UA 4RWSC 1RHPA 1U4MA 2L4NA 2SDFA 2B2YA 1SDFA 2B2TC 5T1IA 1X3QA 4ZKBB 2M2LA 2VXWA 1DOLA 3G7LA 5JJZA 3ONAB 1JE4A 1B2TA 5D65A 1HUNA 4OIKA 5CBEE 2RSOA 1X32A 3GV6A 2B2TA 1B50A 2NYZD 2FFKB 1DONA 1QNKA 1EOTA 2L12A 4HAEA 5CORA 2EOTA 4R8IA 3P7JA 2HDMA 2H1EA 1O7YA 1QG7A 1MSGA 1NR2A 1WTRA 2MP1A 4ZKCB 5CBAE 1DOMA 2L11A 1ML0D 3KBXA 1RTNA 5AFWA 3QO2A 4ZK9B 1PFBA 1O7ZA 2B2UC 3DEOA 4LMQD 3H91A 1ZXTA 4HSVA 1XYIA 2FMMA 4HCSA 3Q6SA 3I8ZA 1E0BA 1F9QA 4CJ2C 4RA8A 2HDLA 1J8IA 1EIHA 4IUTA 2B2UA 1HRJA 1X3PA 2MGSA 2NZ1D 1TVXA 4RAUC 2FINB 2KUMA 4ZAIA 2HUGA 1S4ZA 2DY8A 2FJ2A 4U68A 5T1GA 4X3SA 1AZQA 1DZ1A 2BDNA 3D6WA 1U4PA 4HEDA 1BBXC 1IKMA 4DN4M 1NCVA 2KEDA 1M8AA 4UAIA 2X69A 1F2LA 1G91A 3I3CA 2K28A 1ILPA 2RVLA 4O42A 2CVRA 2JYOA 1G6ZA 1SSOA 3GV3A 1RTOA 1VMCA 4OIJA 2Q8TA 1BNZA 1GUWA
chains in the Genus database with same CATH superfamily
3E9IA 4E6IA 4QGUA 3PUVA 5LMNW 3FDTA 1RODA 1SAPA 3AMUA 4DV7Q 4L63B 3IKJA 5BN5A 4IALA 2R92H 1PFNA 3A8KE 2C5CA 1AN8A 3AYHB 3J81c 4BBSH 2OEOA 4NP5A 5FJ8G 2IW3A 3GTLB 1K3BC 2DGYA 1WTWA 3G6EA 1JE5A 1YJWA 3GTPB 4R1JA 2JSOA 4CHTB 1E22A 1CKMA 2IWHA 3FHWA 2EY5A 4QJFA 4RFBA 4M1UB 1WTPA 2N3SA 4XDXA 2CFMA 2OWOA 3L3OC 3E0EA 1SR3A 1ZKOA 2RA4A 1ASYA 2EPBA 4JYAQ 1A62A 2LXJA 4BBRB 2E76C 1MJEA 3VYTA 4DU9A 1TT2A 2EXDA 1QVFA 1BO0A 3CRLC 1N36L 1LTGD 1PDQA 2NVTH 4PMCA 2K5HA 2EY2A 1ONLA 1TKWB 1D5MC 3H3VH 3OIQA 3GTOH 5KYLA 2Z1CA 1EQVA 4LF9L 3OMGA 2F0HA 1NTGA 1Z9FA 3I4MG 1HA5A 5DM73 4WFN3 4A3JG 5C4XH 2H5XA 3CCQA 5EKKA 4N9TA 3U9OA 4ZKCB 3EVQA 1N33Q 1PH5A 1EYDA 4EGVA 1PYSB 2FMMA 4L8JA 3HOWB 4JBMA 1K9MC 4DF7A 2QILA 1PTOB 1OXVA 2EJFC 4KD3A 3JAMc 4IUNA 4KK7A 1IBLQ 1TQOA 3W5OA 1VF7A 4TSSA 4WJ4A 2B3GA 1I5FA 2E2JH 3CCEA 4K2KA 4WJ3M 3RMHA 1XWEA 3R2IA 5LHY1 1MJCA 2QDBA 4B3SL 1B70B 1D7QA 3L9AX 4GKJL 1GHJA 1S5ED 1PZJD 4JPBW 5F2DA 5C0XI 2JEBI 3CU7A 3X3NA 1D1KA 4AQYQ 2PW5A 4CDDC 5EKIA 4LFCL 4IURA 2PO4A 3DEPA 1RDPD 1CA6A 2YU9B 5IY0A 2F1MA 1LTAD 1H9MA 3HGBA 4KHVA 3BDOA 2KHJA 4QUCA 4YWMA 1E24A 3NXWA 4DV0L 1N9WA 4H7BA 1EYCA 1D6EC 3TSSA 1YITA 5CV6A 3KLWA 2F3WA 3PF4A 1A2UA 1UEAB 2OT2A 1FVIA 2VQEQ 1XPRA 3PO3H 1BOSA 1WTHA 4M8AA 1VQOA 2F0FA 4PNYA 2F03A 2UXDL 2NVXB 2ENBA 4G4KA 3UI2A 1HFGA 2K03A 5C4XG 1ILQA 1N32L 2VB3X 3C3LA 1JWSD 4HN7A 2IHFA 1BXTA 3GTKB 4C3IB 2Z4HA 1HTPA 3GQBA 2PQAB 2CQOA 4LUZA 4FF4A 4MTKA 3EA6A 3P20A 1EY4A 2MNAA 1RKNA 4ZUJA 4A3MB 1JJCB 2OQ0A 3M4YA 1VQ9A 4CKEA 1QJOA 1I6HH 3GTQB 2JA6H 3PUYA 3MZ5A 1O7LA 4HAEA 4XQQA 4NXNQ 4A3IH 1II3A 1QILA 1D8LA 2RCNA 3TP8A 4KTAA 5AFWA 1WCMH 3NBIA 4JI7L 4BWGB 1DJRD 2YV5A 4RMFA 4QY7A 1A6XA 2XSCA 1U9RA 2R6GA 1KL9A 3EJIA 2EYFA 4G7HC 1UAPA 3S16H 2MO1A 4WRDA 5E7NA 2RDHA 2HUGA 2UUCQ 4A3DH 2F4VL 3RR5A 1TU2B 2A5HA 2WB1G 3EIVA 3FKIB 5K36H 1I4HA 2B63H 1JORA 4N8FA 4DR4Q 2Q8TA 1TWFH 3ER0A 4UP8A 4DV6Q 3H0GB 3M9BA 4DK6C 1D5ZC 1EFID 2FHTA 5IGGA 2YTXA 1M1KC 4LF5L 5BN4A 4OX9Q 5C4JH 1FGBD 3PO3G 1C9OA 1XMOL 1AW7A 4ME5A 2J7ZA 3U58A 4JOIA 4GOPC 2JE6I 4LFBQ 1KDCA 4X62Q 3A56A 4DR5L 2Q8IB 3UE1A 3M85A 4P2CB 4LFAL 2IHEA 1JICA 3M4PA 1KTKA 2MPMA 1HR0W 2BA1A 5LMNL 1I50H 3S14H 3K5NA 3S1RH 3U4VA 1VMPA 4UDUC 1HZAA 2RF4A 2E5LQ 4Y52H 2JA8H 1PRTD 5FLMH 2A68D 1ET6A 2ZTEA 1Q46A 2JA6G 1D5XC 1EL0A 3QWNA 4A3IG 4PMWA 3HKZB 1WCMG 4A3KB 1QCBD 4QB4A 2A68C 1JC7A 4TRDA 1EEFD 1UE7A 2B2TC 3J81L 1KXLA 4BXXG 1YJNA 4ZKBB 3W2DA 1T5EA 2K5WA 3D31A 2HHHL 3T51B 1Q7YC 3WWVA 1HZCA 1Y8PB 4A3FB 2L12A 2IX1A 3S1MH 3D0FA 4AIMA 5K36G 1MSGA 3J7AV 4C1NK 5EBCA 2B63G 5D3IB 1F77A 2NVQH 4LF7Q 1PFBA 5GAHC 1BCPD 4UPAA 5I6WA 2PZUA 1X65A 2WB1E 3IRBA 4A3GH 1SROA 3EFXD 3SGIA 2EVBA 1J5EQ 4EQ5A 1X3PA 4KD4A 2D5DA 4QF4A 2GA4B 4YY3L 4Y7NH 4ZCKA 3OW7A 3MHBA 3K7UC 5JPMC 5JJLA 2RVLA 1VS0A 5LMUL 3KDFB 4A4IA 1UE5A 3TS0A 3WOEA 1EYAA 2AMCB 3TN2A 4BY7B 4HCEA 5IYBH 4UHVA 1M90C 1GOZA 4IJLA 5IGCA 3A0JA 1S40A 1GVPA 3J80i 2XNAC 3GTJB 1WJJA 1OXUA 1EU4A 2G9HD 4JI2L 1IKLA 2JA8G 3L2PA 5FLMG 5EQ0A 3T13A 1IL8A 5EKLA 1SNDA 4FXKC 1KNAA 2XTIA 3NPPA 3OYYA 4R9WA 4IO9A 4O0AA 4R4TA 2PMZB 3HS0C 2K5DA 3I4NB 1PVOA 2NZHA 4JV5L 2I5LX 1KNEA 2RSNA 3HOUH 1B9MA 3JAML 4ABNA 2VW9A 3CAMA 3R8BA 4OWWB 1MHWC 3VYRA 2MHVA 5IGBA 5J39A 2CW0D 3VR2A 3T16A 3E9HA 1GUGA 4IFDH 4GN3B 2K6AA 1PH2A 1B3AA 3ND9A 2HCCA 2ZM6Q 2K05A 1WTXA 4A93H 3MXGA 3J81j 3A8JE 4A3EG 4A3GG 3NWTA 3TEHB 1X3QA 4NKLA 2E2HH 1FJGL 1JMCA 3H94A 4IPCA 4KN7C 4JI0L 5CBEE 1B50A 1X32A 4LF4L 2BCOA 4P75A 4DK3C 2K4KA 4DUZL 4WORA 4BA2I 3V05A 3P7JA 4A3LH 2XRQD 1LT5D 1TWAB 1EWHA 1LT3D 2PQAA 4C2MH 2K14A 1PH6A 1ZXTA 2IY5B 4I7ZC 1Y14B 2EDGA 5GADC 1J8IA 5IYBG 2FXQA 1KAWA 1Z7TA 4CGYB 1LT6D 4DN4M 4PMBA 3B6YA 3HZXA 4K5VA 2FJ2A 2E2IB 1I3QB 2F0WA 1CHQD 3BYYB 3D6WA 4X66Q 3RNUA 4DAPA 4PZ7A 4KI0A 1KC8C 3I4LA 2HIVA 3M3YH 4DUYL 3T1YQ 3J7YW 1BDOA 2K75A 4GLXA 2ZJQA 3CCVA 1CA5A 1HCZA 4S3SA 4DK1A 3HOUG 4X64L 3E5SA 3FRPB 4QL5A 3MXNB 4HIMA 3VYUA 4KHPL 3GP7A 3K58A 1PH8A 1Y1WB 1GUNA 5E4XA 3ULLA 1NSNS 1MKHA 2ZT9C 3UDIA 3CCUA 3KJPA 2UU9Q 4BBRH 3I91A 4LF6Q 3S1NH 1IW7C 4IFDG 2KEEA 1MBYA 2K52A 4G7ZC 3HP3A 1XNRQ 1YNXA 5CMDA 4QMGA 4DR6Q 3QOJA 1GO3E 4RHRA 2PNRC 1X3GA 4A93G 2NVYH 4HSPA 2PZTA 5GAEC 3M4OH 1K73C 2F0VA 4I7AA 4DV4L 2A6EC 3U9SA 1SNQA 2DJFC 3DM3A 3J81E 2N78A 2VUMH 5CV9A 1RIPA 2HQEA 1B8AA 4A3LG 1P8LA 4DV5L 4B9WA 4B3TQ 1D2BA 3VR6A 4B3MQ 2F0OA 4NXML 2WAQG 2Q2IA 1HR0L 2TMPA 1JWUD 4TVAB 1XMQL 4C3JH 3S1QB 4IN3A 1I4PA 3AFQA 1TY2A 2JA5B 3S15B 3H09A 5D65A 1LM0A 2SNMA 4O1NA 3SDZA 4DXFA 1QOHA 1XXGA 2IX3A 4LNQA 3NK9A 3OIPA 3TREA 2G5DA 3KK7A 5BR8Q 2UXBL 4XXEA 1KQSA 1SJHD 4C1NI 3TZUA 2A74C 2EZVA 3CCJA 1C0AA 2GVBA 5C6AA 2KBNA 3QG1A 4KLKA 5T1GA 1S4ZA 1AZQA 1V1PA 4JI5L 2XWBB 4HEDA 2F0UA 2K28A 4RKLA 5ELBA 4L5RC 3SK6A 5K5PA 4MZ9A 1G6ZA 3DWAA 4BBRG 1NUCA 2L55A 3SE0A 1PYWD 1TS2A 3BZDB 2YU9H 1HNZQ 3MA2B 2ICIA 4P73A 3KYHC 4EQNA 3KF8A 4DNTB 1GXDC 1KDAA 3RLOA 4HJ8A 4KKSA 4DV1L 4CKCA 1TWGH 1BR9A 4A76A 1STEA 3HOVB 3A54A 1QUQB 4FXGC 2RHQB 1VQPA 3KF6B 4FO2A 2GN5A 3JAME 3BVGA 3KDFA 3D4WA 1U4LA 1JOOA 1SYDA 3VYSA 3T1HQ 2NVXH 4IFDJ 2R3ZA 2VUMG 4CDEC 1VQMA 4FF1A 2QKIC 5JEAH 1F2ZA 1EQRA 2KOLA 5M5WB 2OTLA 2X6LA 4C3IH 3A7LA 3J7AF 3PUWA 2BH8A 4IUUA 4C3JG 1EY8A 1F2YA 4QQBX 5EPJA 2TSSA 1EOVA 4NPSA 4DR1L 1S5CD 1W6JA 5AJ3L 1EY9A 4DR3L 1EIHA 2ZXRA 2WAQE 1L2FA 3HFZB 1EIGA 3A74A 1B53A 3N52A 5ELFA 1F9PA 4KMUC 2LY7A 2D0OA 3K5LA 2MQHA 4JW0A 5C0XH 4K6DA 1B3QA 2JJQA 1FD7D 5M3FB 4FXDA 2A1AA 5FO8B 2NN6I 4QIWE 1N36Q 1NR2A 1X6OA 1AE2A 3I55A 2M9VA 3KBXA 1RTNA 5IE8A 5M3MB 3DEOA 2F0GA 4PZ6A 4JI1L 3H91A 3URYA 4AYBG 4FF2A 1MD2D 4OHJA 2R93H 1SN8A 4RA8A 1HNWL 4LF9Q 4F8MA 1B7YB 2B2UA 1PH3A 4AH6A 4ODGA 2SEBD 4KJNA 5C44B 1SYCA 3ICEA 1VQHA 2E2DC 1PFSA 5C3EH 3EQLC 3IFTA 4JYAL 3PO2H 3RN2A 1SYGA 4IOAA 4K2LA 1Y1VB 3S2HB 1F9SA 2JA7B 3DWPA 1TWCB 1YBYA 2ZTCA 3TP6A 5JEAG 4XYOA 2AUJD 1PMRA 3L7ZC 4DGZA 1WFQA 2IT1A 1O80A 2HCIA 3G4SA 1HA6A 1SNMA 3A5ZB 4K14A 4JOIC 5FLXc 2R92G 4H13C 4GNXC 2R7FA 2XVSA 4JI3L 4HIDA 2PI2A 4BBSG 4C56C 2K1BA 4OL7A 2A73B 1ICWA 1BKBA 1N33L 2P5ZX 3OPOA 1K3RA 1NBWA 4B3SQ 5C0XG 3BVZA 4JBWA 3MXNA 4GKJQ 4A3KH 1U0LA 1UE6A 2ID0A 1X3FA 2I07B 1X9NA 4L5TA 4KJOA 4Q5VA 3RZDH 3K7AB 3A55A 4ILWA 5G3LF 2V1CC 5LL6X 2DUDA 4LK1C 2F0QA 1AZPA 1VQ7A 3RZOB 1S5DD 3K8AA 4XQJA 4CJ1B 1NAPA 4DV0Q 1LLRD 1YHAA 4DPGA 2WINB 4PQXA 1A2TA 3CQZB 1W3SA 5EBDA 1K0RA 2WIIB 5JVG3 3S2DB 1EZ6A 4EQOA 2R93G 2WKDA 1QWYA 3NWSA 5ISRA 1TWHB 1GUOA 1DOLA 3K5MA 2UXDQ 3CCSA 5ELCA 3HG9A 3I70A 3NHHA 3CCRA 2NYZD 3S9WA 4AYBE 5M5XB 5C3EG 2OF1A 2EOTA 1N32Q 4LUVA 3PO2G 1E7ZA 2H1EA 2F52A 1HQMC 3EN2A 1EUJA 3BDLA 1RCVD 1STAA 2EYJA 4HSVA 1SRUA 2LKVA 5M5YH 3F8TA 3Q6SA 2EY6A 3HEJA 2Z0SA 3NTHA 4OGQC 3MXPA 3LX0A 2DNCA 3IAYA 4A3JB 2NZ1D 3NP8A 3TZDA 4H44C 2EYMA 3DHQA 4U68A 5J1ZA 2JXMB 4DFAA 5JAVA 2I5MX 1M8AA 4LJZC 4DXGA 3O13A 2AUKA 4BY1H 2VQFQ 1SE8A 3H15A 3GV3A 3OTOL 1YHQA 2Q2UA 1G8ZD 4JI7Q 1I4GA 4H0LC 4JI6L 4L5SA 4DV2L 4K5WA 4K6LA 5JEAJ 3HKZG 2QCPX 3KLSA 3CC2A 3I4NH 1ENAA 1VDZA 2BE5D 4A3KG 1W2BA 5DLQE 1C7YA 1EWIA 2R7ZH 2F4VQ 1WTOA 1C8CA 4B3RL 2CH4W 1PRTB 2NB0A 1K8MA 3E0JA 1LTRD 1QVGA 1DD2A 4NDXA 2Y0SG 3L0OA 2L15A 2BE5C 1HHVA 1YNJC 2JQOA 1CHPD 1VQ4A 4K0KL 3K81C 3PF5A 3S17H 4B08A 5C0XJ 4DAYA 1KIXA 4MIUA 4LF5Q 1QUQA 4QUFA 1EIFA 1VQNA 5H1SE 1FR3A 1HH2P 1VQAA 3KF6A 4PZ8A 2JK8A 4IJHA 1L1OB 1XMOQ 4DK0A 4ZRZA 2B2WA 1R9TH 3FVQA 1H9SB 4JCVE 1DZ1A 3C1EA 2NVTB 1UNSA 2LSSA 3Q23A 2G9DA 4DR5Q 2BA0A 2NUCA 5HURA 4LFAQ 3GTOB 3OSOA 1HZBA 5I9PA 1BCPB 1TWAH 4IZ8A 5LMNQ 2KHSA 1YVCA 4FP5D 1SE2A 5IT9L 1KD1C 2OQKA 3UE0A 5IGEA 1JE4A 1GD7A 4J15A 3D4RA 4KV6A 5C4XB 1TXYA 1FNUA 5IOCA 1LTLA 1I3QH 3KLRA 1N34L 3CMAA 4BY1G 1ML0D 2HQLA 1W6KA 1X54A 1STNA 4HCSA 3OHXC 2OXPA 1SYEA 1GKHA 2O2LD 2HHHQ 2MGSA 2QDLA 3HRZC 2DY8A 3I72A 1EY6A 2R7ZG 5KEEA 3RUZA 4C3HB 2E5LL 1NNXA 4A3DG 2B8FA 1ICFB 4GLVB 1V9PA 2SNSA 2X69A 2F0KA 5KYIA 1Y1WH 2E2JB 4JC0A 2F4IA 2JYOA 4ME3A 1JB3A 1FL0A 1IYVA 2Z6KA 3SXHA 3ULJA 1Q1EA 1IL2A 2K7VA 2CH4A 2Y0SE 4JBKA 5FOBB 4YY3Q 2KCTA 2L1BA 1LTBD 2K50A 2WB1B 5IODA 1J9OA 3TQYA 2K33A 1RD9D 1LO5D 4X3TA 3CD6A 5FK9C 3CCMA 5LMUQ 4LAAA 2XIWA 2B2VA 3I2ZA 2F0NA 5M9OA 3M4QA 2NBFA 1XPUA 3PO3B 3D4DA 1EY0A 3QOLA 5I2YA 3V2TA 3K0YA 2Q8RE 4YWKA 1EFWA 2ZXOA 5IP9H 4J6HA 1AEXA 3S15H 2KA7A 1ESFA 1PHJA 1KHIA 3VR4A 2N49A 3HOXH 1SE3A 1IZ6A 3CP0A 3AFPA 5TSSA 1N8RC 4RWSC 5KRUA 1JQYD 2B29A 2K5QA 1I6HB 2F0LA 3K6OA 2JA6B 3SR1A 4OIKA 3HOYH 4A3BH 4A3IB 2KENA 2FFKB 1A3UA 1WCMB 1CUKA 5KGUA 4DR2L 3PMFA 1NJIC 5I4DA 3ZYYX 2DN8A 5C5MA 1IYUA 5KNBA 5FO9B 2JEAI 3S16B 1E0BA 1FJGQ 1I94L 4YHHL 5EGTA 2QA4A 4JI0Q 2J4XA 3HOVH 4LF4Q 4X3SA 3NSWA 2SOBA 3TDQA 4OONA 4POFA 2I46A 4DUZQ 1Y69U 3LGJA 1EQQA 1BBXC 2O5JC 2B63B 2KEDA 1E1TA 5ELDA 1EIYB 1AFPA 4O42A 4MTNA 2UUBL 3HOZH 1HQRD 1SXTA 4J8QA 2UXCL 4PV1C 1K8OA 5JPNC 5C4JB 2EXZA 3N6RA 3CMEA 3BZCA 2PCFB 1UUPA 3J81i 1IBML 1K83B 2I0QA 5IP7H 3Q0AA 3I90A 1NR4A 1FGUA 3KOJA 4OEMB 5G3LD 5IP9G 2PW7A 3EROA 2HD3A 1VCIA 4DUYQ 1A3VA 1DCZA 3DXJC 3GTLH 3HOXG 2JN4A 1WD0A 3U4ZA 4GKKL 1I50B 4R4IA 3S14B 3GTPH 4X64Q 3IL8A 1GUWA 3S1RB 2IJ0A 1BVSA 1XTDA 1PTOF 3FPPA 4CJ0B 3Q24A 1IW7D 2JA8B 2N88A 2Q2TA 4FNFA 3KFUA 1JOKA 3ND8A 5ELOA 3HOYG 1JCKB 4A3BG 4RKBA 5IT9E 4L5QA 2F0EA 3SK5A 5JOBA 2PQEA 3E3XA 1YI2A 2MO0A 3FEWX 1AH9A 2A6ED 5I6YA 4IPGA 1DXMA 4YIJA 5M3MH 2L4NA 3DMUA 5BN3A 1L1OA 4DV4Q 3G7LA 3UDGA 1PZID 1H9SA 1LTSD 1VQLA 1LYLA 2WV6D 2RSOA 2VB2X 4APVA 4JI4L 3GTMB 1HXYD 4TKOB 1QNKA 2YTVA 4FDBA 4XIGS 2NVQB 4I65A 2NTSA 4DV5Q 1YIJA 3WOFA 1C4QA 3HOZG 4A3EB 4ZK9B 1Q81C 4NXMQ 2B2UC 4F7XA 4A3GB 4EX5A 1HR0Q 1XMQQ 1XYIA 2JA7H 2ZJRA 2CWAA 1V43A 3JAMi 4HIOA 4DV3Q 3HOWH 2E8GA 1TVXA 4ZAIA 1GUTA 1TS4A 1PTOH 1S72A 1S3OA 2LMCB 2B39A 4CDFC 2LXKA 1CZGA 5CV8A 5DEHA 2OCEA 1VQEA 1ILPA 4DR7L 3BYTB 4HMIA 1RTOA 2UXBQ 2NZOA 2CQAA 3P1HA 2A6HC 5I2XA 1VQKA 4R4CA 2VL6A 4RGTA 2EE1A 2UUAL 3GTGB 1JOQA 4LUOA 1PA6A 2KJXA 1IXRA 2NN6H 1VQJA 1HNXL 1G6PA 1MI2A 1CKNB 1I4XA 4JI5Q 2A69D 4BA1I 4OXPA 2QW7A 1FNVA 5FJ8H 3BJUA 2X6GA 1SMYC 3K7AH 2ZJPA 4UY8C 4V0BA 1STGA 2K5VA 1YEZA 3J80c 4G57A 5IWAL 3RD4A 4R4QA 1RJTA 2NWGA 4OO1I 4DKAC 2A69C 3HOUB 1Q90A 3GO5A 4RHSA 4DV1Q 2ZTDA 1STBA 1NE3A 3I73A 5M3MG 3DUZA 5NUCA 3DM1A 1DOKA 4RCOA 4HR7B 2K32A 1IBKL 3S2DH 1LACA 4HTHA 2AHOB 4HMJA 4LF8L 2D62A 3PIPA 2L5TA 2KECA 1PLFA 2EYOA 1MGSA 3MEHA 5M5XH 4JG2A 1XJVA 4X65L 4A93B 2DJGC 1LABA 3F2UA 2WFWA 1RHPA 1U5KA 4JI8L 2EJGC 4Q0FA 1QB5D 2SDFA 2E2HB 4J1MA 3GTKH 1JR0D 1YJ9A 2XWJB 3CC4A 4DR1Q 3PIO3 3CKIB 1PH1A 5AJ3Q 1C48A 1K28A 3HOWG 2D2CC 3ITPA 4A3JH 5EAYA 1A3TA 4DR3Q 2LS01 1Q86C 4A3MH 3GD7A 1UEBA 2Q2HA 1LT4D 5GAGC 1XNQL 2HDMA 4R4OA 4C2MB 2A8VA 3MXUA 3GTQH 3K0XA 2WAQB 5JVH3 4GNXB 1BCPF 1O7ZA 3PGZA 5JJIA 1R4QB 3J7ZC 5C3WA 1XPOA 2VNUD 2NN6G 4G7OC 3AU7A 1LTTD 5CYUA 1I6VC 4DV7L 2A19A 3KLSX 3OW2A 1U4PA 3OMCA 1EY5A 1F2LA 3M3YB 2CVRA 2KCMA 2ZXPA 2RDGA 1AP0A 3FKIH 4QIWB 4JI1Q 4KKUA 1KAAA 1HNWQ 1DGSA 1NMFA 1QE6A 2IX0A 3H0GH 1X3EA 1CQVA 4JVZA 2AWNA 3TBIB 4ZYSA 2ASBA 3UDFA 1LTID 4HJ7A 4RG1A 5IYDH 1SBBB 3S1NB 4MNOA 4IUPA 3P75A 1CZWA 1S5BD 4XQNA 1E1OA 4JBJA 3MAQA 3LNNA 1PFMA 3ZJYC 1L0YB 2NVYB 5IGDA 4GLAC 2L9HA 4FYDA 1Z47A 3M4OB 1CSPA 4U673 3CCLA 1V1QA 4IUVA 2F3VA 5HGTA 2B2WC 1QZGA 4PG3A 2PYKA 4C3IG 1ENFA 1WD1A 3CHBD 4P72A 4JI3Q 1JWMD 4KN4C 1A0IA 3OWFA 2VUMB 2VS1A 5EJWA 4A3MG 1CKOA 3SHLA 4DNRB 3D3RA 4O2DA 1HPCA 1UWVA 2GVAA 1LV9A 4POGA 4C3JB 1ZEQX 1Q82C 1B44D 2B2YA 1SDFA 2C9OA 1ASZA 2PPBC 4JK1C 5D3DA 5C4ZA 3MVVA 2I5HA 4A3CH 3CF5A 1SFOB 1K8GA 1KABA 1NY4A 3W1BA 1H9RA 4OWXB 1EU3A 2Z9HA 1BBWA 4LFCQ 2K5NA 4C3HH 3AEVA 3CPFA 1IBLL 3CRKC 1O7YA 3ERSX 5CBAE 4A3FH 1VQ6A 2NTTA 1DOMA 5CR3A 2AWOA 3FKIG 5IYCH 3NBHB 3MC0B 2E75C 2QEJC 4CJ2C 1AE3A 3BDCA 4IUTA 2F0MA 3H0GG 1JB7A 1T9HA 2HT1A 3F2CA 3X3MA 1A8VA 1G291 4RH6A 4XYQA 2BDNA 3NQIA 4RGNA 1NCVA 1VQDA 2B8GA 2ALYB 5IYDG 4ZQ3A 2Z6KC 4AQYL 1WI5A 4AYBB 1SSOA 1VMCA 4EVOA 2K01A 4YCVA 1CTMA 1TWGB 3K57A 4MN3A 3CC7A 2ATWA 4GOPB 1LUZA 3R93A 1PTOD 1SYBA 3I4MB 4BY7H 4MHEA 3PIOA 2VQEL 2B2VC 2AKWB 5GROA 3F2DA 4RGOS 1XX8A 1VQ5A 3H3VI 3BU2A 2IPKD 1KDBA 3OTOQ 1S5FD 3ERQA 3T53B 3GTJH 3NEMA 5HGQA 5KIXA 4JI6Q 4DV2Q 1PTOC 2Z6BA 1WYDA 1VQCA 2E74C 5EPKA 1Z6HA 2F0DA 3K59A 1CKNA 2IL8A 2M00A 3MTSA 1E2ZA 3KUPA 2R92B 3KBGA 1YNJD 3UDXA 3IFDA 1HUMA 1YNND 4DAVA 4B3RQ 5D14A 5A2QL 4BBSB 4A3CG 4KY6A 1XTCD 4K0KQ 4XT1B 1M4VA 1K8AC 2F0SA 1R4PB 4C3HG 3Q22A 2VQFL 4NXNL 1H95A 1VQIA 2N55A 3WDNA 3MFGA 2OTJA 4A3FG 1YNNC 2VY3A 4X3KA 2WP8J 2H4OA 1OXSC 4X3UA 5IYCG 1SNPA 4KY7A 4R8NA 4BXXH 3NELA 1YZ6A 3VR5A 1TS5A 4GN5A 1E2WA 1B9NA 2F0JA 5T1IA 4FF3A 3J80L 5DM63 2O4XA 3GV6A 1PYBA 2UUCL 1MIUA 3R3OA 3RLFA 3I4OA 1EOTA 4LW1A 4DAMA 1STYA 3QIAA 2BDOA 4ZUIA 1CI3M 2WKCA 3C2PA 4DR4L 2R93B 1Q8IA 1Q1BA 4DV6L 3NE5B 1ZYRD 2Z4IA 4P74A 1OXTA 1D1IA 2RKSA 1ENCA 4N8X1 5FKAC 1PH7A 5C3EB 4RGMA 2HIXA 1VQGA 5JJKA 3MFYA 4BS9A 4BY7G 3SK4A 4OX9L 2N8NA 3PO2B 1K83H 3QB3A 4X6AH 1IKMA 1N34Q 1WOCA 2E2IH 3SK8A 1G91A 1ZYRC 3NENA 3D6CA 4GNXA 3PQIA 3TP5A 1TS3A 2BH2A 2KCNA 2K04A 4LFBL 1F9RA 4X62L 5E4WC 5CV7A 1EEID 2PZWA 2ES2A 3I4NG 1HFNA 1WTQA 1Q3LA 3BVMA 1TY0A 3E6ZX 1G2TA 1G51A 3NUCA 1DYQA 3HKZE 2EY1A 1E2VA 4IUQA 3MWYW 1L0WA 4YCUA 2D9UA 1A15A 1CSQA 2RDFA 3RN5A 2EIFA 1QVCA 1WTVA 1PRTC 4XT3B 2D0PA 4K8IA 2F0TA 3VR3A 1RL2A 2JP1A 3RZDB 1JJGA 1ESRA 2Y0SB 2XN9C 1BF4A 4KHZA 3NQTA 5E3FA 1CQFA 2RBMA 4K8JA 1V1PB 2MFIA 3LWEA 2AQ3B 3GTMH 1DM0B 5A35A 4GS3A 3SVMA 1EZ8A 1OO9B 4DNIA 2RCFA 1YHBA 1CFMA 1L1OC 3A5UA 1ET9A 1U4MA 4CDCC 4A3EH 4LF7L 3OWEB 3I56A 3KF8B 3BZKA 4Z9CB 2VXWA 4F88A 1B2TA 5ELNA 4F87A 3G71A 1J5EL 3H3VC 3S1QH 2QEXA 1HUNA 5CGKA 1BCPC 4JI2Q 4ALPA 4KY5A 2JA5H 1WTRA 1QG7A 4IPDA 1J6QA 1PH4A 5M5YB 4IPHA 1JJ2A 4DA2A 4LMQD 3ULPA 1EWCA 4JV5Q 2QGQA 1PZKD 3K80C 3GTGH 4IOCA 1Q12A 4H02A 2HDLA 5FLXL 3PCOB 4HJAA 4ULLA 3VA5A 1SYFA 2KUMA 1SE4A 4BY1B 1NMGA 3F2BA 4DR2Q 3W1GA 3OOCA 2LFNA 3NTKA 2PMZE 3NBHA 1Y1WG 3QJYA 2XRSD 3BS1A 1BNZA 2CCZA 3C1FA 4OELB 2R7DA 1FYCA 3SEBA 5KNCA 1PH9A 4LWCA 1HZ9A 1SNOA 2EYHA 1U4RA 2YTYA 1X55A 2EYPA 2MUYA 1I94Q 4YHHQ 1JT8A 2R7ZB 3VDYA 1TIID 2AQ2B 3U50C 3K5OA 4A3DB 5J22A 3F1ZA 1WVLA 1K0SA 2KQ3A 4KKTA 2FMCA 4NMZA 3PIP3 3M7NA 5E1FA 2UUBQ 4HJ5A 4GZYC 1O78A 1PV4A 3S17B 5J3BA 1B4OA 1I4QA 1TWFB 2UXCQ 1SLJA 5A2QE 2VZAA 1KRSA 4GOPA 1SNCA 2ZM6L 2CW0C 2XGTA 1IBMQ 1SEBD 3TRZA 2RQXA 5M5WH 1R9TB 5IIFA 2AQ1B 4GN4B 3PUZA 2RHSB 4NW2A 1MSHA 1KLGD 3S24A 4FVMA 1GUSA 2V4DA 2JA5G 2KVMA 1PXUA 3T4AC 5CC4A 4B9XA 4GKKQ 3PUXA 3J80E 4L6TB 2EJMA 5ELEA 4A75A 1GM5A 1HTLD 1A63A 3AQQA 3I7FA 4WJWA 4OWTB 5GQOA 2PNHA 4N9PA 4KHPQ 2M2LA 3TMEA 3TP7A 4OO1H 2QF7A 1SMXA 1L0XB 5M3FH 4TQUS 1E3PA 2B2TA 4X66L 2PI2E 5CORA 5KNDA 5C4HA 3A7AB 1HJPA 1T5XD 1V8QA 5CV5A 3QO2A 2ICEC 2CKZB 1VF5C 3T1YL 5FO7B 4CBVA 3D8GA 2YYZA 4RAUC 2FINB 3CXCA 3G48A 1V1OA 4JI4Q 3HOVG 3T56B 1QNUA 3S1MB 5CV4A 2O5IC 5C44H 4HJ9A 4V190 4UAIA 3I3CA 1IYJB 4YCWA 5L37A 3RLNA 2UU9L 1OTCA 4LF6L 2KCCA 1KRTA 3W3AA 1XNRL 4QCLA 1Y1VH 3S2HH 4DR6L 3MEFA 1TWCH 4IFDI 1CM9A 2C35B 2Z8LA 2EQSA 2MJ8A 4Y7NB 5DNFA 2KHIA 1FNWA 3Q8DA 1P16A 1GHKA 4RCNA 3A8IE 4EQPA 1G2SA 2A6HD 3TS2A 5IP7G 3H6MA 5COYA 1SJED 1OXXK 1RF2D 1TR5A 4DR7Q 1CT1D 5IGFA 3BG3A 1VQBA 3DWQA 2UUAQ 3R2TA 5EPLA 4K5XA 1EQTA 1SMYD 2EYLA 1HNXQ 3J7A5 4B3TL 4IQZA 4B3ML 3CW2C 1EY7A 4DV3L 2WACA 4ZLTF 4OO1G 3FMCA 1CK1A 1IHZA 5M3FG 1SFOH 3KJOA 3HOXB 5IWAQ 3FPUB 4ID6A 2DY7A 3V96A 1QZHA 3QR8A 4YWLA 1STHA 2B2YC 1H9JA 2BOSA 3RZOH 1VQFA 5DAUA 5HY6A 5BR8L 1EYGA 1IBKQ 4HIKA 5LL6S 3CQZH 3EBEA 4UP7A 1BBUA 1VQ8A 4XTCS 3HOYB 4A3BB 4LF8Q 2DNEA 3ONAB 5JJZA 1BQQT 3G6JB 2F0PA 1TWHH 4P71A 1Y8OB 1PRTF 1DONA 3VA7A 3DLLA 1F2MA 5C3XA 1H9KA 4X65Q 1Y8NB 5C44G 4R8IA 1B1ZA 5FLXE 3AB9A 3PSIA 5C5LA 3CPWA 2MP1A 1GJXA 3PV0A 3GDEA 2CWPA 2L11A 4JI8Q 3NTIA 1BUVT 1HNZL 4CKBA 1O7IA 3I8ZA 4DAYB 1F9QA 1X56A 4NB3A 1Y1VG 3FP9A 2JA7G 1I4RA 1HRJA 3M7GA 2JA9A 3STBD 3C46A 1Q8KA 3HKSA 3LWUA 5IT9c 3I4MH 2J0TD 2R61A 1XNQQ 3HOZB 1KLUD 2L0CA 2CHBD 1UE1A 2F3IA 5I9OA 4UP9A 4OIJA 2F0IA 3T1HL 3JC66 3STBC
chains in the Genus database with same CATH topology
4E6IA 3PUVA 3FDTA 1RODA 1SAPA 3AMUA 4L63B 3IKJA 5BN5A 4IALA 1PFNA 3A8KE 2C5CA 1AN8A 2OEOA 4NP5A 2IW3A 3GTLB 1WTWA 3GTPB 2JSOA 4CHTB 2IWHA 2EY5A 4RFBA 4M1UB 1WTPA 4XDXA 3L3OC 1ZKOA 2RA4A 2EPBA 4BBRB 2E76C 3VYTA 4DU9A 1TT2A 1BO0A 3CRLC 1LTGD 1PDQA 4PMCA 2EY2A 1ONLA 1TKWB 1D5MC 3OIQA 5KYLA 2Z1CA 1EQVA 3OMGA 2F0HA 1HA5A 5DM73 4WFN3 5EKKA 4N9TA 3U9OA 4ZKCB 3EVQA 1EYDA 4EGVA 2FMMA 4L8JA 3HOWB 4DF7A 2QILA 1PTOB 1OXVA 2EJFC 4KD3A 4IUNA 4KK7A 1TQOA 1VF7A 4TSSA 4K2KA 3RMHA 1XWEA 3R2IA 5LHY1 2QDBA 3L9AX 1GHJA 1S5ED 1PZJD 5F2DA 5C0XI 2JEBI 3CU7A 3X3NA 1D1KA 2PW5A 5EKIA 4IURA 2PO4A 3DEPA 1RDPD 1CA6A 2YU9B 2F1MA 1LTAD 1H9MA 3HGBA 4KHVA 3BDOA 4QUCA 3NXWA 4H7BA 1EYCA 1D6EC 3TSSA 5CV6A 2F3WA 1A2UA 1UEAB 2OT2A 1BOSA 4M8AA 2F0FA 4PNYA 2F03A 2NVXB 2ENBA 4G4KA 3UI2A 1HFGA 2K03A 1ILQA 2VB3X 3C3LA 1JWSD 4HN7A 1BXTA 3GTKB 4C3IB 2Z4HA 1HTPA 3GQBA 4FF4A 3EA6A 3P20A 1EY4A 1RKNA 4ZUJA 4A3MB 3M4YA 4CKEA 1QJOA 3GTQB 3PUYA 3MZ5A 1O7LA 4HAEA 4XQQA 1II3A 1QILA 3TP8A 4KTAA 5AFWA 3NBIA 4BWGB 1DJRD 1A6XA 2XSCA 1U9RA 2R6GA 3EJIA 2EYFA 4G7HC 1UAPA 4WRDA 2RDHA 2HUGA 1TU2B 2A5HA 3FKIB 5K36H 1I4HA 1JORA 2Q8TA 3H0GB 1D5ZC 1EFID 2FHTA 5IGGA 5BN4A 1FGBD 1AW7A 4ME5A 2J7ZA 2JE6I 1KDCA 3A56A 2Q8IB 3M85A 4P2CB 1JICA 1KTKA 2MPMA 2BA1A 3K5NA 1VMPA 4UDUC 1PRTD 2A68D 1ET6A 1D5XC 1EL0A 3QWNA 4PMWA 3HKZB 4A3KB 1QCBD 4QB4A 2A68C 1JC7A 4TRDA 1EEFD 2B2TC 3J81L 4ZKBB 3W2DA 1T5EA 2K5WA 3D31A 3T51B 1Y8PB 4A3FB 2L12A 2IX1A 5K36G 1MSGA 3J7AV 4C1NK 5EBCA 5D3IB 1F77A 1PFBA 1BCPD 5I6WA 2PZUA 3EFXD 2EVBA 1X3PA 4KD4A 4QF4A 2D5DA 2GA4B 3OW7A 3MHBA 5JPMC 2RVLA 3WOEA 1EYAA 3TN2A 4BY7B 4HCEA 1GOZA 5IGCA 2XNAC 3GTJB 1OXUA 1EU4A 2G9HD 1IKLA 5EQ0A 3T13A 1IL8A 5EKLA 1SNDA 1KNAA 4FXKC 3NPPA 4R9WA 2PMZB 3HS0C 2K5DA 3I4NB 1KNEA 2RSNA 1B9MA 3JAML 4ABNA 3R8BA 3VYRA 2MHVA 5IGBA 5J39A 2CW0D 3VR2A 3T16A 1GUGA 4IFDH 2K6AA 1B3AA 3ND9A 2HCCA 2K05A 1WTXA 3MXGA 3A8JE 3NWTA 1X3QA 4NKLA 3H94A 4KN7C 5CBEE 1B50A 1X32A 2BCOA 4WORA 4BA2I 3V05A 3P7JA 2XRQD 1LT5D 1TWAB 1EWHA 1LT3D 1ZXTA 4I7ZC 2EDGA 1J8IA 1Z7TA 4CGYB 1LT6D 4DN4M 4PMBA 3HZXA 4K5VA 2FJ2A 2E2IB 1I3QB 2F0WA 1CHQD 3BYYB 3D6WA 4DAPA 4KI0A 3I4LA 3J7YW 1BDOA 1CA5A 1HCZA 4S3SA 4DK1A 3E5SA 3FRPB 3VYUA 3GP7A 3K58A 1Y1WB 1GUNA 5E4XA 1NSNS 2ZT9C 3I91A 4IFDG 1IW7C 2KEEA 1MBYA 4G7ZC 3HP3A 5CMDA 4QMGA 3QOJA 4RHRA 2PNRC 4HSPA 2PZTA 2F0VA 2A6EC 3U9SA 1SNQA 3J81E 5CV9A 2HQEA 4B9WA 1D2BA 3VR6A 2F0OA 2TMPA 1JWUD 3S1QB 4IN3A 1I4PA 1TY2A 2JA5B 3S15B 3H09A 5D65A 2SNMA 4O1NA 3SDZA 4DXFA 1QOHA 1XXGA 2IX3A 3NK9A 3OIPA 3KK7A 4XXEA 1SJHD 4C1NI 3TZUA 2A74C 2EZVA 5C6AA 3QG1A 5T1GA 1S4ZA 1AZQA 1V1PA 2XWBB 4HEDA 2F0UA 2K28A 4RKLA 5ELBA 3SK6A 5K5PA 1G6ZA 3DWAA 1NUCA 2L55A 3SE0A 1PYWD 1TS2A 3BZDB 3MA2B 2ICIA 4EQNA 3KF8A 4DNTB 1GXDC 1KDAA 4KKSA 4CKCA 1BR9A 1STEA 3HOVB 3A54A 4FXGC 4FO2A 3JAME 3BVGA 3D4WA 4IFDJ 3VYSA 1U4LA 1JOOA 1SYDA 2R3ZA 4FF1A 2QKIC 5JEAH 1F2ZA 2KOLA 5M5WB 2X6LA 3A7LA 3J7AF 3PUWA 4IUUA 4C3JG 1EY8A 1F2YA 5EPJA 2TSSA 1S5CD 1W6JA 1EY9A 1EIHA 2ZXRA 1EIGA 1B53A 3N52A 5ELFA 1F9PA 4KMUC 2LY7A 3K5LA 5C0XH 4K6DA 1FD7D 5M3FB 4FXDA 5FO8B 2NN6I 1NR2A 2M9VA 3KBXA 1RTNA 5M3MB 3DEOA 2F0GA 3H91A 3URYA 4FF2A 1MD2D 4OHJA 4RA8A 4F8MA 2B2UA 4ODGA 2SEBD 4KJNA 5C44B 1SYCA 2E2DC 3EQLC 3IFTA 1SYGA 4K2LA 1Y1VB 3S2HB 1F9SA 2JA7B 3DWPA 1TWCB 3TP6A 5JEAG 4XYOA 2AUJD 1PMRA 3L7ZC 4DGZA 2IT1A 1HA6A 1O80A 2HCIA 1SNMA 4K14A 4H13C 2XVSA 4C56C 2K1BA 4OL7A 2A73B 1ICWA 3OPOA 5C0XG 3BVZA 4JBWA 3MXNA 2ID0A 2I07B 4KJOA 4Q5VA 3K7AB 3A55A 4ILWA 5G3LF 5LL6X 4LK1C 2F0QA 1AZPA 3RZOB 1S5DD 4XQJA 4CJ1B 1NAPA 1LLRD 2WINB 4PQXA 1A2TA 3CQZB 5EBDA 2WIIB 5JVG3 3S2DB 1EZ6A 4EQOA 2WKDA 1QWYA 3NWSA 5ISRA 1TWHB 1GUOA 1DOLA 3K5MA 5ELCA 3HG9A 3I70A 3NHHA 2NYZD 3S9WA 5M5XB 2OF1A 2EOTA 2H1EA 1HQMC 3BDLA 1RCVD 1STAA 2EYJA 4HSVA 2LKVA 3Q6SA 2EY6A 3HEJA 3NTHA 4OGQC 3MXPA 3LX0A 2DNCA 3IAYA 4A3JB 2NZ1D 3NP8A 3TZDA 4H44C 2EYMA 3DHQA 4U68A 5J1ZA 2JXMB 4DFAA 5JAVA 1M8AA 4LJZC 4DXGA 3O13A 2AUKA 3GV3A 1G8ZD 1I4GA 4H0LC 4K5WA 4K6LA 5JEAJ 2QCPX 3KLSA 1ENAA 1VDZA 2BE5D 1WTOA 1C8CA 1PRTB 2NB0A 1K8MA 1LTRD 3E0JA 1DD2A 4NDXA 2BE5C 1HHVA 1YNJC 1CHPD 4B08A 5C0XJ 4DAYA 4MIUA 4QUFA 1FR3A 4DK0A 4ZRZA 2B2WA 3FVQA 1H9SB 1DZ1A 3C1EA 2NVTB 1UNSA 3Q23A 2G9DA 2BA0A 2NUCA 5HURA 3GTOB 3OSOA 5I9PA 1BCPB 4IZ8A 2KHSA 4FP5D 1SE2A 5IT9L 5IGEA 1JE4A 4KV6A 5C4XB 3D4RA 1FNUA 5IOCA 3KLRA 1ML0D 1W6KA 1STNA 4HCSA 3OHXC 2OXPA 1SYEA 2O2LD 2MGSA 3HRZC 2DY8A 3I72A 1EY6A 5KEEA 3RUZA 4C3HB 2B8FA 2SNSA 2X69A 2F0KA 5KYIA 2E2JB 2F4IA 2JYOA 1JB3A 1IYVA 3SXHA 1Q1EA 2K7VA 5FOBB 2L1BA 1LTBD 2WB1B 5IODA 1J9OA 2K33A 1RD9D 1LO5D 4X3TA 5FK9C 4LAAA 2XIWA 2B2VA 2F0NA 5M9OA 2NBFA 3PO3B 3D4DA 1EY0A 3QOLA 5I2YA 3V2TA 3K0YA 2Q8RE 2ZXOA 4J6HA 1AEXA 2KA7A 1ESFA 3VR4A 1SE3A 5TSSA 4RWSC 5KRUA 1JQYD 2K5QA 1I6HB 2F0LA 3K6OA 2JA6B 3SR1A 4OIKA 4A3IB 2FFKB 1A3UA 1WCMB 5KGUA 3PMFA 5I4DA 3ZYYX 2DN8A 5C5MA 1IYUA 5KNBA 5FO9B 2JEAI 3S16B 1E0BA 5EGTA 2J4XA 4X3SA 3NSWA 2SOBA 3TDQA 2O5JC 2I46A 1Y69U 1BBXC 2B63B 2KEDA 5ELDA 1AFPA 4O42A 1SXTA 1HQRD 4J8QA 4PV1C 1K8OA 5JPNC 5C4JB 2EXZA 3N6RA 2PCFB 1UUPA 1K83B 3Q0AA 3I90A 1NR4A 5G3LD 2PW7A 3EROA 1VCIA 1A3VA 1DCZA 3DXJC 1WD0A 1I50B 3S14B 3IL8A 3S1RB 2IJ0A 1PTOF 3FPPA 4CJ0B 3Q24A 1IW7D 2JA8B 2N88A 4FNFA 1JOKA 3ND8A 1JCKB 4RKBA 5IT9E 2F0EA 3SK5A 5JOBA 2PQEA 3FEWX 2A6ED 5I6YA 1DXMA 4YIJA 2L4NA 3DMUA 5BN3A 3G7LA 1PZID 1H9SA 1LTSD 2WV6D 2RSOA 2VB2X 3GTMB 1HXYD 4TKOB 1QNKA 4XIGS 2NVQB 4I65A 2NTSA 3WOFA 1C4QA 4A3EB 4ZK9B 4A3GB 2B2UC 4F7XA 1XYIA 1V43A 4ZAIA 1TVXA 1GUTA 1TS4A 1PTOH 2LMCB 2B39A 1CZGA 5CV8A 5DEHA 1ILPA 3BYTB 4HMIA 1RTOA 1GUWA 5I2XA 2CQAA 2A6HC 3P1HA 4RGTA 3GTGB 2EE1A 1JOQA 2KJXA 2NN6H 1MI2A 1I4XA 2A69D 4BA1I 1FNVA 2X6GA 1SMYC 4V0BA 1STGA 4G57A 3RD4A 1RJTA 2NWGA 4OO1I 2A69C 3HOUB 1Q90A 3GO5A 4RHSA 1STBA 3I73A 3DUZA 5NUCA 3DM1A 1DOKA 4RCOA 4HR7B 2K32A 1LACA 4HTHA 4HMJA 2D62A 2L5TA 2KECA 1PLFA 2EYOA 1MGSA 3MEHA 4A93B 1LABA 3F2UA 1RHPA 2EJGC 4Q0FA 1QB5D 2SDFA 2E2HB 4J1MA 1JR0D 2XWJB 3PIO3 3CKIB 1C48A 2D2CC 3ITPA 1A3TA 2LS01 3GD7A 1LT4D 2HDMA 4C2MB 3MXUA 2WAQB 5JVH3 1BCPF 1O7ZA 1R4QB 5C3WA 2VNUD 2NN6G 4G7OC 3AU7A 1LTTD 5CYUA 1I6VC 3KLSX 1U4PA 3OMCA 1EY5A 1F2LA 3M3YB 2CVRA 2ZXPA 2RDGA 1AP0A 4QIWB 4KKUA 1KAAA 1QE6A 2IX0A 1CQVA 2AWNA 3TBIB 4ZYSA 1LTID 1SBBB 3S1NB 4IUPA 3P75A 1CZWA 1S5BD 4XQNA 3MAQA 3LNNA 1PFMA 1L0YB 2NVYB 5IGDA 2L9HA 4FYDA 1Z47A 3M4OB 4U673 4IUVA 5HGTA 2F3VA 2B2WC 2PYKA 4C3IG 1ENFA 1WD1A 3CHBD 1JWMD 4KN4C 3OWFA 2VUMB 5EJWA 4DNRB 3SHLA 3D3RA 1HPCA 1LV9A 4C3JB 1ZEQX 1B44D 2B2YA 1SDFA 2C9OA 2PPBC 4JK1C 5D3DA 5C4ZA 3MVVA 1SFOB 1KABA 1H9RA 1EU3A 3CRKC 1O7YA 5CBAE 2NTTA 1DOMA 5CR3A 2AWOA 3MC0B 2E75C 2QEJC 4CJ2C 3BDCA 4IUTA 2F0MA 3X3MA 1G291 4RH6A 4XYQA 2BDNA 3NQIA 4RGNA 1NCVA 2B8GA 4ZQ3A 4AYBB 1SSOA 1VMCA 4EVOA 2K01A 1CTMA 1TWGB 3K57A 4MN3A 3R93A 1PTOD 1SYBA 3I4MB 4MHEA 2B2VC 4RGOS 1XX8A 2IPKD 1KDBA 1S5FD 3ERQA 3T53B 5KIXA 1PTOC 2E74C 5EPKA 1Z6HA 2F0DA 3K59A 2IL8A 2M00A 3MTSA 1E2ZA 3KUPA 2R92B 3KBGA 1YNJD 3IFDA 1HUMA 1YNND 4DAVA 5D14A 5A2QL 4BBSB 4KY6A 1XTCD 4XT1B 1M4VA 2F0SA 1R4PB 4C3HG 3Q22A 2N55A 3WDNA 3MFGA 1YNNC 4X3KA 2WP8J 2H4OA 1OXSC 4X3UA 1SNPA 4KY7A 4R8NA 3VR5A 1TS5A 1E2WA 1B9NA 2F0JA 5T1IA 4FF3A 3J80L 5DM63 2O4XA 3GV6A 3R3OA 3RLFA 1EOTA 1STYA 3QIAA 2BDOA 4ZUIA 1CI3M 2WKCA 3C2PA 2R93B 1Q8IA 1Q1BA 3NE5B 1ZYRD 2Z4IA 1OXTA 1D1IA 2RKSA 1ENCA 5FKAC 5C3EB 4RGMA 3MFYA 4BS9A 3SK4A 3PO2B 3QB3A 1IKMA 3SK8A 1G91A 1ZYRC 3D6CA 3TP5A 1TS3A 2KCNA 2K04A 1F9RA 5E4WC 5CV7A 1EEID 2PZWA 1HFNA 1WTQA 1Q3LA 3BVMA 1TY0A 3E6ZX 1G2TA 3NUCA 1DYQA 2EY1A 1E2VA 4IUQA 3MWYW 2D9UA 1A15A 2RDFA 1WTVA 1PRTC 4XT3B 4K8IA 2F0TA 3VR3A 2JP1A 3RZDB 1ESRA 2Y0SB 2XN9C 1BF4A 4KHZA 3NQTA 5E3FA 1CQFA 2RBMA 4K8JA 1V1PB 3LWEA 2AQ3B 1DM0B 5A35A 3SVMA 1EZ8A 1OO9B 1CFMA 1ET9A 1U4MA 3OWEB 4Z9CB 2VXWA 4F88A 1B2TA 4F87A 3H3VC 1HUNA 5CGKA 1BCPC 4KY5A 1WTRA 1QG7A 5M5YB 4DA2A 4LMQD 1EWCA 1PZKD 1Q12A 2HDLA 5FLXL 4ULLA 3VA5A 1SYFA 2KUMA 1SE4A 4BY1B 3OOCA 2LFNA 3NTKA 3NBHA 3QJYA 2XRSD 3BS1A 1BNZA 3C1FA 1FYCA 3SEBA 5KNCA 1SNOA 2EYHA 1U4RA 2EYPA 2MUYA 2R7ZB 1TIID 2AQ2B 3K5OA 4A3DB 5J22A 1WVLA 2KQ3A 4KKTA 2FMCA 4NMZA 3PIP3 3M7NA 5E1FA 4GZYC 1O78A 3S17B 1B4OA 1I4QA 1TWFB 5A2QE 1SNCA 2CW0C 1SEBD 2RQXA 1R9TB 5IIFA 2AQ1B 3PUZA 4NW2A 1MSHA 1KLGD 4FVMA 1GUSA 2V4DA 2KVMA 1PXUA 3T4AC 5CC4A 4B9XA 3PUXA 3J80E 4L6TB 2EJMA 5ELEA 1HTLD 4WJWA 4N9PA 2M2LA 3TMEA 3TP7A 4OO1H 2QF7A 1L0XB 4TQUS 2B2TA 5CORA 5KNDA 5C4HA 3A7AB 1T5XD 1V8QA 5CV5A 3QO2A 2ICEC 1VF5C 5FO7B 4CBVA 3D8GA 2YYZA 4RAUC 2FINB 1V1OA 3T56B 1QNUA 3S1MB 5CV4A 2O5IC 4V190 4UAIA 3I3CA 2KCCA 3W3AA 4QCLA 4IFDI 1CM9A 2Z8LA 2MJ8A 4Y7NB 5DNFA 1FNWA 1GHKA 4RCNA 3A8IE 4EQPA 1G2SA 2A6HD 3H6MA 5COYA 1SJED 1OXXK 1RF2D 1TR5A 1CT1D 5IGFA 3BG3A 3DWQA 3R2TA 5EPLA 4K5XA 1EQTA 1SMYD 2EYLA 4IQZA 1EY7A 2WACA 4ZLTF 4OO1G 3FMCA 1CK1A 1IHZA 3HOXB 3FPUB 4ID6A 2DY7A 3V96A 1STHA 2B2YC 1H9JA 2BOSA 5DAUA 5LL6S 4XTCS 3HOYB 4A3BB 2DNEA 3ONAB 5JJZA 1BQQT 3G6JB 2F0PA 1Y8OB 1PRTF 1DONA 3VA7A 1F2MA 5C3XA 1H9KA 4R8IA 1Y8NB 1B1ZA 5FLXE 3AB9A 5C5LA 2MP1A 1GJXA 3PV0A 2L11A 3NTIA 1BUVT 4CKBA 3I8ZA 1F9QA 1I4RA 1HRJA 3M7GA 3C46A 3LWUA 2J0TD 2R61A 3HOZB 1KLUD 2L0CA 2CHBD 5I9OA 4OIJA 2F0IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K01 A;  1F9S A;  2K04 A;  2EE1 A;  1F9R A;  1QE6 A;  1U4R A;  3TN2 A;  4MN3 A;  5E4W C;  3TZD A;  2FHT A;  1CA5 A;  1CM9 A;  1ROD A;  1SAP A;  3FDT A;  2MJ8 A;  3R93 A;  1MI2 A;  5DNF A;  2L1B A;  1HFN A;  4MHE A;  1WTQ A;  1O80 A;  2HCI A;  1Q3L A;  1J9O A;  1WVL A;  1PFN A;  1HA6 A;  1G2S A;  3I90 A;  1WTO A;  2B2V C;  4X3T A;  1NR4 A;  2X6G A;  5E4X A;  1C8C A;  1G2T A;  1XX8 A;  5COY A;  1IKL A;  5EKI A;  2J7Z A;  2XIW A;  1U4L A;  5EQ0 A;  4IUR A;  1IL8 A;  3DEP A;  4IUP A;  1WTW A;  1KNA A;  2B2V A;  2K1B A;  1B4O A;  2R3Z A;  3I91 A;  4IUQ A;  1CA6 A;  1HHV A;  3MWY W;  1RJT A;  2KEE A;  2NWG A;  1ICW A;  2D9U A;  1A15 A;  3HP3 A;  1PFM A;  4QUC A;  4R9W A;  5EPL A;  5EPK A;  5CMD A;  1WD0 A;  1AP0 A;  1WTV A;  1EQT A;  4XT3 B;  1JIC A;  2KOL A;  2L9H A;  3IL8 A;  1KNE A;  2IL8 A;  2RSN A;  2MPM A;  2X6L A;  3MTS A;  4QUF A;  4IUV A;  1WTP A;  2JP1 A;  2B2W C;  3DM1 A;  3KUP A;  4IUU A;  4XDX A;  1DOK A;  1ESR A;  4CJ0 B;  3IFD A;  5EPJ A;  1HUM A;  1WD1 A;  1VMP A;  2N88 A;  2Q8R E;  2RA4 A;  5D14 A;  4ZLT F;  1BF4 A;  2EPB A;  2B2W A;  1MSH A;  4NW2 A;  5EJW A;  3UI2 A;  2KEC A;  1PLF A;  1HFG A;  2K03 A;  3FPU B;  1MGS A;  2DY7 A;  3LWE A;  1AZP A;  1EIG A;  2KVM A;  4XT1 B;  1B53 A;  4CJ1 B;  3SVM A;  1EL0 A;  3N52 A;  1ILQ A;  1B3A A;  1BO0 A;  1F9P A;  2B2Y C;  1NAP A;  2HCC A;  2N55 A;  1LV9 A;  1PDQ A;  2K05 A;  3F2U A;  4X3K A;  1WTX A;  4X3U A;  4RWS C;  1RHP A;  1U4M A;  2L4N A;  2SDF A;  2B2Y A;  1SDF A;  2B2T C;  5T1I A;  1X3Q A;  4ZKB B;  2M2L A;  2VXW A;  1DOL A;  3G7L A;  5JJZ A;  3ONA B;  1JE4 A;  1B2T A;  5D65 A;  1HUN A;  4OIK A;  5CBE E;  2RSO A;  1X32 A;  3GV6 A;  2B2T A;  1B50 A;  2NYZ D;  2FFK B;  1DON A;  1QNK A;  1EOT A;  2L12 A;  4HAE A;  5COR A;  2EOT A;  4R8I A;  3P7J A;  2HDM A;  2H1E A;  1O7Y A;  1QG7 A;  1MSG A;  1NR2 A;  1WTR A;  2MP1 A;  4ZKC B;  5CBA E;  1DOM A;  2L11 A;  1ML0 D;  3KBX A;  1RTN A;  5AFW A;  3QO2 A;  4ZK9 B;  1PFB A;  1O7Z A;  2B2U C;  3DEO A;  4LMQ D;  3H91 A;  1ZXT A;  4HSV A;  1XYI A;  2FMM A;  4HCS A;  3Q6S A;  3I8Z A;  1E0B A;  1F9Q A;  4CJ2 C;  4RA8 A;  2HDL A;  1J8I A;  1EIH A;  4IUT A;  2B2U A;  1HRJ A;  1X3P A;  2MGS A;  2NZ1 D;  1TVX A;  4RAU C;  2FIN B;  2KUM A;  4ZAI A;  2HUG A;  1S4Z A;  2DY8 A;  2FJ2 A;  4U68 A;  5T1G A;  4X3S A;  1AZQ A;  1DZ1 A;  2BDN A;  3D6W A;  1U4P A;  4HED A;  1BBX C;  1IKM A;  4DN4 M;  1NCV A;  2KED A;  1M8A A;  4UAI A;  2X69 A;  1F2L A;  1G91 A;  3I3C A;  2K28 A;  1ILP A;  2RVL A;  4O42 A;  2CVR A;  2JYO A;  1G6Z A;  1SSO A;  3GV3 A;  1RTO A;  1VMC A;  4OIJ A;  2Q8T A;  1BNZ A;  1GUW A; 
#chains in the Genus database with same CATH topology
 3E9I A;  4E6I A;  4QGU A;  3PUV A;  5LMN W;  3FDT A;  1ROD A;  1SAP A;  3AMU A;  4DV7 Q;  4L63 B;  3IKJ A;  5BN5 A;  4IAL A;  2R92 H;  1PFN A;  3A8K E;  2C5C A;  1AN8 A;  3AYH B;  3J81 c;  4BBS H;  2OEO A;  4NP5 A;  5FJ8 G;  2IW3 A;  3GTL B;  1K3B C;  2DGY A;  1WTW A;  3G6E A;  1JE5 A;  1YJW A;  3GTP B;  4R1J A;  2JSO A;  4CHT B;  1E22 A;  1CKM A;  2IWH A;  3FHW A;  2EY5 A;  4QJF A;  4RFB A;  4M1U B;  1WTP A;  2N3S A;  4XDX A;  2CFM A;  2OWO A;  3L3O C;  3E0E A;  1SR3 A;  1ZKO A;  2RA4 A;  1ASY A;  2EPB A;  4JYA Q;  1A62 A;  2LXJ A;  4BBR B;  2E76 C;  1MJE A;  3VYT A;  4DU9 A;  1TT2 A;  2EXD A;  1QVF A;  1BO0 A;  3CRL C;  1N36 L;  1LTG D;  1PDQ A;  2NVT H;  4PMC A;  2K5H A;  2EY2 A;  1ONL A;  1TKW B;  1D5M C;  3H3V H;  3OIQ A;  3GTO H;  5KYL A;  2Z1C A;  1EQV A;  4LF9 L;  3OMG A;  2F0H A;  1NTG A;  1Z9F A;  3I4M G;  1HA5 A;  5DM7 3;  4WFN 3;  4A3J G;  5C4X H;  2H5X A;  3CCQ A;  5EKK A;  4N9T A;  3U9O A;  4ZKC B;  3EVQ A;  1N33 Q;  1PH5 A;  1EYD A;  4EGV A;  1PYS B;  2FMM A;  4L8J A;  3HOW B;  4JBM A;  1K9M C;  4DF7 A;  2QIL A;  1PTO B;  1OXV A;  2EJF C;  4KD3 A;  3JAM c;  4IUN A;  4KK7 A;  1IBL Q;  1TQO A;  3W5O A;  1VF7 A;  4TSS A;  4WJ4 A;  2B3G A;  1I5F A;  2E2J H;  3CCE A;  4K2K A;  4WJ3 M;  3RMH A;  1XWE A;  3R2I A;  5LHY 1;  1MJC A;  2QDB A;  4B3S L;  1B70 B;  1D7Q A;  3L9A X;  4GKJ L;  1GHJ A;  1S5E D;  1PZJ D;  4JPB W;  5F2D A;  5C0X I;  2JEB I;  3CU7 A;  3X3N A;  1D1K A;  4AQY Q;  2PW5 A;  4CDD C;  5EKI A;  4LFC L;  4IUR A;  2PO4 A;  3DEP A;  1RDP D;  1CA6 A;  2YU9 B;  5IY0 A;  2F1M A;  1LTA D;  1H9M A;  3HGB A;  4KHV A;  3BDO A;  2KHJ A;  4QUC A;  4YWM A;  1E24 A;  3NXW A;  4DV0 L;  1N9W A;  4H7B A;  1EYC A;  1D6E C;  3TSS A;  1YIT A;  5CV6 A;  3KLW A;  2F3W A;  3PF4 A;  1A2U A;  1UEA B;  2OT2 A;  1FVI A;  2VQE Q;  1XPR A;  3PO3 H;  1BOS A;  1WTH A;  4M8A A;  1VQO A;  2F0F A;  4PNY A;  2F03 A;  2UXD L;  2NVX B;  2ENB A;  4G4K A;  3UI2 A;  1HFG A;  2K03 A;  5C4X G;  1ILQ A;  1N32 L;  2VB3 X;  3C3L A;  1JWS D;  4HN7 A;  2IHF A;  1BXT A;  3GTK B;  4C3I B;  2Z4H A;  1HTP A;  3GQB A;  2PQA B;  2CQO A;  4LUZ A;  4FF4 A;  4MTK A;  3EA6 A;  3P20 A;  1EY4 A;  2MNA A;  1RKN A;  4ZUJ A;  4A3M B;  1JJC B;  2OQ0 A;  3M4Y A;  1VQ9 A;  4CKE A;  1QJO A;  1I6H H;  3GTQ B;  2JA6 H;  3PUY A;  3MZ5 A;  1O7L A;  4HAE A;  4XQQ A;  4NXN Q;  4A3I H;  1II3 A;  1QIL A;  1D8L A;  2RCN A;  3TP8 A;  4KTA A;  5AFW A;  1WCM H;  3NBI A;  4JI7 L;  4BWG B;  1DJR D;  2YV5 A;  4RMF A;  4QY7 A;  1A6X A;  2XSC A;  1U9R A;  2R6G A;  1KL9 A;  3EJI A;  2EYF A;  4G7H C;  1UAP A;  3S16 H;  2MO1 A;  4WRD A;  5E7N A;  2RDH A;  2HUG A;  2UUC Q;  4A3D H;  2F4V L;  3RR5 A;  1TU2 B;  2A5H A;  2WB1 G;  3EIV A;  3FKI B;  5K36 H;  1I4H A;  2B63 H;  1JOR A;  4N8F A;  4DR4 Q;  2Q8T A;  1TWF H;  3ER0 A;  4UP8 A;  4DV6 Q;  3H0G B;  3M9B A;  4DK6 C;  1D5Z C;  1EFI D;  2FHT A;  5IGG A;  2YTX A;  1M1K C;  4LF5 L;  5BN4 A;  4OX9 Q;  5C4J H;  1FGB D;  3PO3 G;  1C9O A;  1XMO L;  1AW7 A;  4ME5 A;  2J7Z A;  3U58 A;  4JOI A;  4GOP C;  2JE6 I;  4LFB Q;  1KDC A;  4X62 Q;  3A56 A;  4DR5 L;  2Q8I B;  3UE1 A;  3M85 A;  4P2C B;  4LFA L;  2IHE A;  1JIC A;  3M4P A;  1KTK A;  2MPM A;  1HR0 W;  2BA1 A;  5LMN L;  1I50 H;  3S14 H;  3K5N A;  3S1R H;  3U4V A;  1VMP A;  4UDU C;  1HZA A;  2RF4 A;  2E5L Q;  4Y52 H;  2JA8 H;  1PRT D;  5FLM H;  2A68 D;  1ET6 A;  2ZTE A;  1Q46 A;  2JA6 G;  1D5X C;  1EL0 A;  3QWN A;  4A3I G;  4PMW A;  3HKZ B;  1WCM G;  4A3K B;  1QCB D;  4QB4 A;  2A68 C;  1JC7 A;  4TRD A;  1EEF D;  1UE7 A;  2B2T C;  3J81 L;  1KXL A;  4BXX G;  1YJN A;  4ZKB B;  3W2D A;  1T5E A;  2K5W A;  3D31 A;  2HHH L;  3T51 B;  1Q7Y C;  3WWV A;  1HZC A;  1Y8P B;  4A3F B;  2L12 A;  2IX1 A;  3S1M H;  3D0F A;  4AIM A;  5K36 G;  1MSG A;  3J7A V;  4C1N K;  5EBC A;  2B63 G;  5D3I B;  1F77 A;  2NVQ H;  4LF7 Q;  1PFB A;  5GAH C;  1BCP D;  4UPA A;  5I6W A;  2PZU A;  1X65 A;  2WB1 E;  3IRB A;  4A3G H;  1SRO A;  3EFX D;  3SGI A;  2EVB A;  1J5E Q;  4EQ5 A;  1X3P A;  4KD4 A;  2D5D A;  4QF4 A;  2GA4 B;  4YY3 L;  4Y7N H;  4ZCK A;  3OW7 A;  3MHB A;  3K7U C;  5JPM C;  5JJL A;  2RVL A;  1VS0 A;  5LMU L;  3KDF B;  4A4I A;  1UE5 A;  3TS0 A;  3WOE A;  1EYA A;  2AMC B;  3TN2 A;  4BY7 B;  4HCE A;  5IYB H;  4UHV A;  1M90 C;  1GOZ A;  4IJL A;  5IGC A;  3A0J A;  1S40 A;  1GVP A;  3J80 i;  2XNA C;  3GTJ B;  1WJJ A;  1OXU A;  1EU4 A;  2G9H D;  4JI2 L;  1IKL A;  2JA8 G;  3L2P A;  5FLM G;  5EQ0 A;  3T13 A;  1IL8 A;  5EKL A;  1SND A;  4FXK C;  1KNA A;  2XTI A;  3NPP A;  3OYY A;  4R9W A;  4IO9 A;  4O0A A;  4R4T A;  2PMZ B;  3HS0 C;  2K5D A;  3I4N B;  1PVO A;  2NZH A;  4JV5 L;  2I5L X;  1KNE A;  2RSN A;  3HOU H;  1B9M A;  3JAM L;  4ABN A;  2VW9 A;  3CAM A;  3R8B A;  4OWW B;  1MHW C;  3VYR A;  2MHV A;  5IGB A;  5J39 A;  2CW0 D;  3VR2 A;  3T16 A;  3E9H A;  1GUG A;  4IFD H;  4GN3 B;  2K6A A;  1PH2 A;  1B3A A;  3ND9 A;  2HCC A;  2ZM6 Q;  2K05 A;  1WTX A;  4A93 H;  3MXG A;  3J81 j;  3A8J E;  4A3E G;  4A3G G;  3NWT A;  3TEH B;  1X3Q A;  4NKL A;  2E2H H;  1FJG L;  1JMC A;  3H94 A;  4IPC A;  4KN7 C;  4JI0 L;  5CBE E;  1B50 A;  1X32 A;  4LF4 L;  2BCO A;  4P75 A;  4DK3 C;  2K4K A;  4DUZ L;  4WOR A;  4BA2 I;  3V05 A;  3P7J A;  4A3L H;  2XRQ D;  1LT5 D;  1TWA B;  1EWH A;  1LT3 D;  2PQA A;  4C2M H;  2K14 A;  1PH6 A;  1ZXT A;  2IY5 B;  4I7Z C;  1Y14 B;  2EDG A;  5GAD C;  1J8I A;  5IYB G;  2FXQ A;  1KAW A;  1Z7T A;  4CGY B;  1LT6 D;  4DN4 M;  4PMB A;  3B6Y A;  3HZX A;  4K5V A;  2FJ2 A;  2E2I B;  1I3Q B;  2F0W A;  1CHQ D;  3BYY B;  3D6W A;  4X66 Q;  3RNU A;  4DAP A;  4PZ7 A;  4KI0 A;  1KC8 C;  3I4L A;  2HIV A;  3M3Y H;  4DUY L;  3T1Y Q;  3J7Y W;  1BDO A;  2K75 A;  4GLX A;  2ZJQ A;  3CCV A;  1CA5 A;  1HCZ A;  4S3S A;  4DK1 A;  3HOU G;  4X64 L;  3E5S A;  3FRP B;  4QL5 A;  3MXN B;  4HIM A;  3VYU A;  4KHP L;  3GP7 A;  3K58 A;  1PH8 A;  1Y1W B;  1GUN A;  5E4X A;  3ULL A;  1NSN S;  1MKH A;  2ZT9 C;  3UDI A;  3CCU A;  3KJP A;  2UU9 Q;  4BBR H;  3I91 A;  4LF6 Q;  3S1N H;  1IW7 C;  4IFD G;  2KEE A;  1MBY A;  2K52 A;  4G7Z C;  3HP3 A;  1XNR Q;  1YNX A;  5CMD A;  4QMG A;  4DR6 Q;  3QOJ A;  1GO3 E;  4RHR A;  2PNR C;  1X3G A;  4A93 G;  2NVY H;  4HSP A;  2PZT A;  5GAE C;  3M4O H;  1K73 C;  2F0V A;  4I7A A;  4DV4 L;  2A6E C;  3U9S A;  1SNQ A;  2DJF C;  3DM3 A;  3J81 E;  2N78 A;  2VUM H;  5CV9 A;  1RIP A;  2HQE A;  1B8A A;  4A3L G;  1P8L A;  4DV5 L;  4B9W A;  4B3T Q;  1D2B A;  3VR6 A;  4B3M Q;  2F0O A;  4NXM L;  2WAQ G;  2Q2I A;  1HR0 L;  2TMP A;  1JWU D;  4TVA B;  1XMQ L;  4C3J H;  3S1Q B;  4IN3 A;  1I4P A;  3AFQ A;  1TY2 A;  2JA5 B;  3S15 B;  3H09 A;  5D65 A;  1LM0 A;  2SNM A;  4O1N A;  3SDZ A;  4DXF A;  1QOH A;  1XXG A;  2IX3 A;  4LNQ A;  3NK9 A;  3OIP A;  3TRE A;  2G5D A;  3KK7 A;  5BR8 Q;  2UXB L;  4XXE A;  1KQS A;  1SJH D;  4C1N I;  3TZU A;  2A74 C;  2EZV A;  3CCJ A;  1C0A A;  2GVB A;  5C6A A;  2KBN A;  3QG1 A;  4KLK A;  5T1G A;  1S4Z A;  1AZQ A;  1V1P A;  4JI5 L;  2XWB B;  4HED A;  2F0U A;  2K28 A;  4RKL A;  5ELB A;  4L5R C;  3SK6 A;  5K5P A;  4MZ9 A;  1G6Z A;  3DWA A;  4BBR G;  1NUC A;  2L55 A;  3SE0 A;  1PYW D;  1TS2 A;  3BZD B;  2YU9 H;  1HNZ Q;  3MA2 B;  2ICI A;  4P73 A;  3KYH C;  4EQN A;  3KF8 A;  4DNT B;  1GXD C;  1KDA A;  3RLO A;  4HJ8 A;  4KKS A;  4DV1 L;  4CKC A;  1TWG H;  1BR9 A;  4A76 A;  1STE A;  3HOV B;  3A54 A;  1QUQ B;  4FXG C;  2RHQ B;  1VQP A;  3KF6 B;  4FO2 A;  2GN5 A;  3JAM E;  3BVG A;  3KDF A;  3D4W A;  1U4L A;  1JOO A;  1SYD A;  3VYS A;  3T1H Q;  2NVX H;  4IFD J;  2R3Z A;  2VUM G;  4CDE C;  1VQM A;  4FF1 A;  2QKI C;  5JEA H;  1F2Z A;  1EQR A;  2KOL A;  5M5W B;  2OTL A;  2X6L A;  4C3I H;  3A7L A;  3J7A F;  3PUW A;  2BH8 A;  4IUU A;  4C3J G;  1EY8 A;  1F2Y A;  4QQB X;  5EPJ A;  2TSS A;  1EOV A;  4NPS A;  4DR1 L;  1S5C D;  1W6J A;  5AJ3 L;  1EY9 A;  4DR3 L;  1EIH A;  2ZXR A;  2WAQ E;  1L2F A;  3HFZ B;  1EIG A;  3A74 A;  1B53 A;  3N52 A;  5ELF A;  1F9P A;  4KMU C;  2LY7 A;  2D0O A;  3K5L A;  2MQH A;  4JW0 A;  5C0X H;  4K6D A;  1B3Q A;  2JJQ A;  1FD7 D;  5M3F B;  4FXD A;  2A1A A;  5FO8 B;  2NN6 I;  4QIW E;  1N36 Q;  1NR2 A;  1X6O A;  1AE2 A;  3I55 A;  2M9V A;  3KBX A;  1RTN A;  5IE8 A;  5M3M B;  3DEO A;  2F0G A;  4PZ6 A;  4JI1 L;  3H91 A;  3URY A;  4AYB G;  4FF2 A;  1MD2 D;  4OHJ A;  2R93 H;  1SN8 A;  4RA8 A;  1HNW L;  4LF9 Q;  4F8M A;  1B7Y B;  2B2U A;  1PH3 A;  4AH6 A;  4ODG A;  2SEB D;  4KJN A;  5C44 B;  1SYC A;  3ICE A;  1VQH A;  2E2D C;  1PFS A;  5C3E H;  3EQL C;  3IFT A;  4JYA L;  3PO2 H;  3RN2 A;  1SYG A;  4IOA A;  4K2L A;  1Y1V B;  3S2H B;  1F9S A;  2JA7 B;  3DWP A;  1TWC B;  1YBY A;  2ZTC A;  3TP6 A;  5JEA G;  4XYO A;  2AUJ D;  1PMR A;  3L7Z C;  4DGZ A;  1WFQ A;  2IT1 A;  1O80 A;  2HCI A;  3G4S A;  1HA6 A;  1SNM A;  3A5Z B;  4K14 A;  4JOI C;  5FLX c;  2R92 G;  4H13 C;  4GNX C;  2R7F A;  2XVS A;  4JI3 L;  4HID A;  2PI2 A;  4BBS G;  4C56 C;  2K1B A;  4OL7 A;  2A73 B;  1ICW A;  1BKB A;  1N33 L;  2P5Z X;  3OPO A;  1K3R A;  1NBW A;  4B3S Q;  5C0X G;  3BVZ A;  4JBW A;  3MXN A;  4GKJ Q;  4A3K H;  1U0L A;  1UE6 A;  2ID0 A;  1X3F A;  2I07 B;  1X9N A;  4L5T A;  4KJO A;  4Q5V A;  3RZD H;  3K7A B;  3A55 A;  4ILW A;  5G3L F;  2V1C C;  5LL6 X;  2DUD A;  4LK1 C;  2F0Q A;  1AZP A;  1VQ7 A;  3RZO B;  1S5D D;  3K8A A;  4XQJ A;  4CJ1 B;  1NAP A;  4DV0 Q;  1LLR D;  1YHA A;  4DPG A;  2WIN B;  4PQX A;  1A2T A;  3CQZ B;  1W3S A;  5EBD A;  1K0R A;  2WII B;  5JVG 3;  3S2D B;  1EZ6 A;  4EQO A;  2R93 G;  2WKD A;  1QWY A;  3NWS A;  5ISR A;  1TWH B;  1GUO A;  1DOL A;  3K5M A;  2UXD Q;  3CCS A;  5ELC A;  3HG9 A;  3I70 A;  3NHH A;  3CCR A;  2NYZ D;  3S9W A;  4AYB E;  5M5X B;  5C3E G;  2OF1 A;  2EOT A;  1N32 Q;  4LUV A;  3PO2 G;  1E7Z A;  2H1E A;  2F52 A;  1HQM C;  3EN2 A;  1EUJ A;  3BDL A;  1RCV D;  1STA A;  2EYJ A;  4HSV A;  1SRU A;  2LKV A;  5M5Y H;  3F8T A;  3Q6S A;  2EY6 A;  3HEJ A;  2Z0S A;  3NTH A;  4OGQ C;  3MXP A;  3LX0 A;  2DNC A;  3IAY A;  4A3J B;  2NZ1 D;  3NP8 A;  3TZD A;  4H44 C;  2EYM A;  3DHQ A;  4U68 A;  5J1Z A;  2JXM B;  4DFA A;  5JAV A;  2I5M X;  1M8A A;  4LJZ C;  4DXG A;  3O13 A;  2AUK A;  4BY1 H;  2VQF Q;  1SE8 A;  3H15 A;  3GV3 A;  3OTO L;  1YHQ A;  2Q2U A;  1G8Z D;  4JI7 Q;  1I4G A;  4H0L C;  4JI6 L;  4L5S A;  4DV2 L;  4K5W A;  4K6L A;  5JEA J;  3HKZ G;  2QCP X;  3KLS A;  3CC2 A;  3I4N H;  1ENA A;  1VDZ A;  2BE5 D;  4A3K G;  1W2B A;  5DLQ E;  1C7Y A;  1EWI A;  2R7Z H;  2F4V Q;  1WTO A;  1C8C A;  4B3R L;  2CH4 W;  1PRT B;  2NB0 A;  1K8M A;  3E0J A;  1LTR D;  1QVG A;  1DD2 A;  4NDX A;  2Y0S G;  3L0O A;  2L15 A;  2BE5 C;  1HHV A;  1YNJ C;  2JQO A;  1CHP D;  1VQ4 A;  4K0K L;  3K81 C;  3PF5 A;  3S17 H;  4B08 A;  5C0X J;  4DAY A;  1KIX A;  4MIU A;  4LF5 Q;  1QUQ A;  4QUF A;  1EIF A;  1VQN A;  5H1S E;  1FR3 A;  1HH2 P;  1VQA A;  3KF6 A;  4PZ8 A;  2JK8 A;  4IJH A;  1L1O B;  1XMO Q;  4DK0 A;  4ZRZ A;  2B2W A;  1R9T H;  3FVQ A;  1H9S B;  4JCV E;  1DZ1 A;  3C1E A;  2NVT B;  1UNS A;  2LSS A;  3Q23 A;  2G9D A;  4DR5 Q;  2BA0 A;  2NUC A;  5HUR A;  4LFA Q;  3GTO B;  3OSO A;  1HZB A;  5I9P A;  1BCP B;  1TWA H;  4IZ8 A;  5LMN Q;  2KHS A;  1YVC A;  4FP5 D;  1SE2 A;  5IT9 L;  1KD1 C;  2OQK A;  3UE0 A;  5IGE A;  1JE4 A;  1GD7 A;  4J15 A;  3D4R A;  4KV6 A;  5C4X B;  1TXY A;  1FNU A;  5IOC A;  1LTL A;  1I3Q H;  3KLR A;  1N34 L;  3CMA A;  4BY1 G;  1ML0 D;  2HQL A;  1W6K A;  1X54 A;  1STN A;  4HCS A;  3OHX C;  2OXP A;  1SYE A;  1GKH A;  2O2L D;  2HHH Q;  2MGS A;  2QDL A;  3HRZ C;  2DY8 A;  3I72 A;  1EY6 A;  2R7Z G;  5KEE A;  3RUZ A;  4C3H B;  2E5L L;  1NNX A;  4A3D G;  2B8F A;  1ICF B;  4GLV B;  1V9P A;  2SNS A;  2X69 A;  2F0K A;  5KYI A;  1Y1W H;  2E2J B;  4JC0 A;  2F4I A;  2JYO A;  4ME3 A;  1JB3 A;  1FL0 A;  1IYV A;  2Z6K A;  3SXH A;  3ULJ A;  1Q1E A;  1IL2 A;  2K7V A;  2CH4 A;  2Y0S E;  4JBK A;  5FOB B;  4YY3 Q;  2KCT A;  2L1B A;  1LTB D;  2K50 A;  2WB1 B;  5IOD A;  1J9O A;  3TQY A;  2K33 A;  1RD9 D;  1LO5 D;  4X3T A;  3CD6 A;  5FK9 C;  3CCM A;  5LMU Q;  4LAA A;  2XIW A;  2B2V A;  3I2Z A;  2F0N A;  5M9O A;  3M4Q A;  2NBF A;  1XPU A;  3PO3 B;  3D4D A;  1EY0 A;  3QOL A;  5I2Y A;  3V2T A;  3K0Y A;  2Q8R E;  4YWK A;  1EFW A;  2ZXO A;  5IP9 H;  4J6H A;  1AEX A;  3S15 H;  2KA7 A;  1ESF A;  1PHJ A;  1KHI A;  3VR4 A;  2N49 A;  3HOX H;  1SE3 A;  1IZ6 A;  3CP0 A;  3AFP A;  5TSS A;  1N8R C;  4RWS C;  5KRU A;  1JQY D;  2B29 A;  2K5Q A;  1I6H B;  2F0L A;  3K6O A;  2JA6 B;  3SR1 A;  4OIK A;  3HOY H;  4A3B H;  4A3I B;  2KEN A;  2FFK B;  1A3U A;  1WCM B;  1CUK A;  5KGU A;  4DR2 L;  3PMF A;  1NJI C;  5I4D A;  3ZYY X;  2DN8 A;  5C5M A;  1IYU A;  5KNB A;  5FO9 B;  2JEA I;  3S16 B;  1E0B A;  1FJG Q;  1I94 L;  4YHH L;  5EGT A;  2QA4 A;  4JI0 Q;  2J4X A;  3HOV H;  4LF4 Q;  4X3S A;  3NSW A;  2SOB A;  3TDQ A;  4OON A;  4POF A;  2I46 A;  4DUZ Q;  1Y69 U;  3LGJ A;  1EQQ A;  1BBX C;  2O5J C;  2B63 B;  2KED A;  1E1T A;  5ELD A;  1EIY B;  1AFP A;  4O42 A;  4MTN A;  2UUB L;  3HOZ H;  1HQR D;  1SXT A;  4J8Q A;  2UXC L;  4PV1 C;  1K8O A;  5JPN C;  5C4J B;  2EXZ A;  3N6R A;  3CME A;  3BZC A;  2PCF B;  1UUP A;  3J81 i;  1IBM L;  1K83 B;  2I0Q A;  5IP7 H;  3Q0A A;  3I90 A;  1NR4 A;  1FGU A;  3KOJ A;  4OEM B;  5G3L D;  5IP9 G;  2PW7 A;  3ERO A;  2HD3 A;  1VCI A;  4DUY Q;  1A3V A;  1DCZ A;  3DXJ C;  3GTL H;  3HOX G;  2JN4 A;  1WD0 A;  3U4Z A;  4GKK L;  1I50 B;  4R4I A;  3S14 B;  3GTP H;  4X64 Q;  3IL8 A;  1GUW A;  3S1R B;  2IJ0 A;  1BVS A;  1XTD A;  1PTO F;  3FPP A;  4CJ0 B;  3Q24 A;  1IW7 D;  2JA8 B;  2N88 A;  2Q2T A;  4FNF A;  3KFU A;  1JOK A;  3ND8 A;  5ELO A;  3HOY G;  1JCK B;  4A3B G;  4RKB A;  5IT9 E;  4L5Q A;  2F0E A;  3SK5 A;  5JOB A;  2PQE A;  3E3X A;  1YI2 A;  2MO0 A;  3FEW X;  1AH9 A;  2A6E D;  5I6Y A;  4IPG A;  1DXM A;  4YIJ A;  5M3M H;  2L4N A;  3DMU A;  5BN3 A;  1L1O A;  4DV4 Q;  3G7L A;  3UDG A;  1PZI D;  1H9S A;  1LTS D;  1VQL A;  1LYL A;  2WV6 D;  2RSO A;  2VB2 X;  4APV A;  4JI4 L;  3GTM B;  1HXY D;  4TKO B;  1QNK A;  2YTV A;  4FDB A;  4XIG S;  2NVQ B;  4I65 A;  2NTS A;  4DV5 Q;  1YIJ A;  3WOF A;  1C4Q A;  3HOZ G;  4A3E B;  4ZK9 B;  1Q81 C;  4NXM Q;  2B2U C;  4F7X A;  4A3G B;  4EX5 A;  1HR0 Q;  1XMQ Q;  1XYI A;  2JA7 H;  2ZJR A;  2CWA A;  1V43 A;  3JAM i;  4HIO A;  4DV3 Q;  3HOW H;  2E8G A;  1TVX A;  4ZAI A;  1GUT A;  1TS4 A;  1PTO H;  1S72 A;  1S3O A;  2LMC B;  2B39 A;  4CDF C;  2LXK A;  1CZG A;  5CV8 A;  5DEH A;  2OCE A;  1VQE A;  1ILP A;  4DR7 L;  3BYT B;  4HMI A;  1RTO A;  2UXB Q;  2NZO A;  2CQA A;  3P1H A;  2A6H C;  5I2X A;  1VQK A;  4R4C A;  2VL6 A;  4RGT A;  2EE1 A;  2UUA L;  3GTG B;  1JOQ A;  4LUO A;  1PA6 A;  2KJX A;  1IXR A;  2NN6 H;  1VQJ A;  1HNX L;  1G6P A;  1MI2 A;  1CKN B;  1I4X A;  4JI5 Q;  2A69 D;  4BA1 I;  4OXP A;  2QW7 A;  1FNV A;  5FJ8 H;  3BJU A;  2X6G A;  1SMY C;  3K7A H;  2ZJP A;  4UY8 C;  4V0B A;  1STG A;  2K5V A;  1YEZ A;  3J80 c;  4G57 A;  5IWA L;  3RD4 A;  4R4Q A;  1RJT A;  2NWG A;  4OO1 I;  4DKA C;  2A69 C;  3HOU B;  1Q90 A;  3GO5 A;  4RHS A;  4DV1 Q;  2ZTD A;  1STB A;  1NE3 A;  3I73 A;  5M3M G;  3DUZ A;  5NUC A;  3DM1 A;  1DOK A;  4RCO A;  4HR7 B;  2K32 A;  1IBK L;  3S2D H;  1LAC A;  4HTH A;  2AHO B;  4HMJ A;  4LF8 L;  2D62 A;  3PIP A;  2L5T A;  2KEC A;  1PLF A;  2EYO A;  1MGS A;  3MEH A;  5M5X H;  4JG2 A;  1XJV A;  4X65 L;  4A93 B;  2DJG C;  1LAB A;  3F2U A;  2WFW A;  1RHP A;  1U5K A;  4JI8 L;  2EJG C;  4Q0F A;  1QB5 D;  2SDF A;  2E2H B;  4J1M A;  3GTK H;  1JR0 D;  1YJ9 A;  2XWJ B;  3CC4 A;  4DR1 Q;  3PIO 3;  3CKI B;  1PH1 A;  5AJ3 Q;  1C48 A;  1K28 A;  3HOW G;  2D2C C;  3ITP A;  4A3J H;  5EAY A;  1A3T A;  4DR3 Q;  2LS0 1;  1Q86 C;  4A3M H;  3GD7 A;  1UEB A;  2Q2H A;  1LT4 D;  5GAG C;  1XNQ L;  2HDM A;  4R4O A;  4C2M B;  2A8V A;  3MXU A;  3GTQ H;  3K0X A;  2WAQ B;  5JVH 3;  4GNX B;  1BCP F;  1O7Z A;  3PGZ A;  5JJI A;  1R4Q B;  3J7Z C;  5C3W A;  1XPO A;  2VNU D;  2NN6 G;  4G7O C;  3AU7 A;  1LTT D;  5CYU A;  1I6V C;  4DV7 L;  2A19 A;  3KLS X;  3OW2 A;  1U4P A;  3OMC A;  1EY5 A;  1F2L A;  3M3Y B;  2CVR A;  2KCM A;  2ZXP A;  2RDG A;  1AP0 A;  3FKI H;  4QIW B;  4JI1 Q;  4KKU A;  1KAA A;  1HNW Q;  1DGS A;  1NMF A;  1QE6 A;  2IX0 A;  3H0G H;  1X3E A;  1CQV A;  4JVZ A;  2AWN A;  3TBI B;  4ZYS A;  2ASB A;  3UDF A;  1LTI D;  4HJ7 A;  4RG1 A;  5IYD H;  1SBB B;  3S1N B;  4MNO A;  4IUP A;  3P75 A;  1CZW A;  1S5B D;  4XQN A;  1E1O A;  4JBJ A;  3MAQ A;  3LNN A;  1PFM A;  3ZJY C;  1L0Y B;  2NVY B;  5IGD A;  4GLA C;  2L9H A;  4FYD A;  1Z47 A;  3M4O B;  1CSP A;  4U67 3;  3CCL A;  1V1Q A;  4IUV A;  2F3V A;  5HGT A;  2B2W C;  1QZG A;  4PG3 A;  2PYK A;  4C3I G;  1ENF A;  1WD1 A;  3CHB D;  4P72 A;  4JI3 Q;  1JWM D;  4KN4 C;  1A0I A;  3OWF A;  2VUM B;  2VS1 A;  5EJW A;  4A3M G;  1CKO A;  3SHL A;  4DNR B;  3D3R A;  4O2D A;  1HPC A;  1UWV A;  2GVA A;  1LV9 A;  4POG A;  4C3J B;  1ZEQ X;  1Q82 C;  1B44 D;  2B2Y A;  1SDF A;  2C9O A;  1ASZ A;  2PPB C;  4JK1 C;  5D3D A;  5C4Z A;  3MVV A;  2I5H A;  4A3C H;  3CF5 A;  1SFO B;  1K8G A;  1KAB A;  1NY4 A;  3W1B A;  1H9R A;  4OWX B;  1EU3 A;  2Z9H A;  1BBW A;  4LFC Q;  2K5N A;  4C3H H;  3AEV A;  3CPF A;  1IBL L;  3CRK C;  1O7Y A;  3ERS X;  5CBA E;  4A3F H;  1VQ6 A;  2NTT A;  1DOM A;  5CR3 A;  2AWO A;  3FKI G;  5IYC H;  3NBH B;  3MC0 B;  2E75 C;  2QEJ C;  4CJ2 C;  1AE3 A;  3BDC A;  4IUT A;  2F0M A;  3H0G G;  1JB7 A;  1T9H A;  2HT1 A;  3F2C A;  3X3M A;  1A8V A;  1G29 1;  4RH6 A;  4XYQ A;  2BDN A;  3NQI A;  4RGN A;  1NCV A;  1VQD A;  2B8G A;  2ALY B;  5IYD G;  4ZQ3 A;  2Z6K C;  4AQY L;  1WI5 A;  4AYB B;  1SSO A;  1VMC A;  4EVO A;  2K01 A;  4YCV A;  1CTM A;  1TWG B;  3K57 A;  4MN3 A;  3CC7 A;  2ATW A;  4GOP B;  1LUZ A;  3R93 A;  1PTO D;  1SYB A;  3I4M B;  4BY7 H;  4MHE A;  3PIO A;  2VQE L;  2B2V C;  2AKW B;  5GRO A;  3F2D A;  4RGO S;  1XX8 A;  1VQ5 A;  3H3V I;  3BU2 A;  2IPK D;  1KDB A;  3OTO Q;  1S5F D;  3ERQ A;  3T53 B;  3GTJ H;  3NEM A;  5HGQ A;  5KIX A;  4JI6 Q;  4DV2 Q;  1PTO C;  2Z6B A;  1WYD A;  1VQC A;  2E74 C;  5EPK A;  1Z6H A;  2F0D A;  3K59 A;  1CKN A;  2IL8 A;  2M00 A;  3MTS A;  1E2Z A;  3KUP A;  2R92 B;  3KBG A;  1YNJ D;  3UDX A;  3IFD A;  1HUM A;  1YNN D;  4DAV A;  4B3R Q;  5D14 A;  5A2Q L;  4BBS B;  4A3C G;  4KY6 A;  1XTC D;  4K0K Q;  4XT1 B;  1M4V A;  1K8A C;  2F0S A;  1R4P B;  4C3H G;  3Q22 A;  2VQF L;  4NXN L;  1H95 A;  1VQI A;  2N55 A;  3WDN A;  3MFG A;  2OTJ A;  4A3F G;  1YNN C;  2VY3 A;  4X3K A;  2WP8 J;  2H4O A;  1OXS C;  4X3U A;  5IYC G;  1SNP A;  4KY7 A;  4R8N A;  4BXX H;  3NEL A;  1YZ6 A;  3VR5 A;  1TS5 A;  4GN5 A;  1E2W A;  1B9N A;  2F0J A;  5T1I A;  4FF3 A;  3J80 L;  5DM6 3;  2O4X A;  3GV6 A;  1PYB A;  2UUC L;  1MIU A;  3R3O A;  3RLF A;  3I4O A;  1EOT A;  4LW1 A;  4DAM A;  1STY A;  3QIA A;  2BDO A;  4ZUI A;  1CI3 M;  2WKC A;  3C2P A;  4DR4 L;  2R93 B;  1Q8I A;  1Q1B A;  4DV6 L;  3NE5 B;  1ZYR D;  2Z4I A;  4P74 A;  1OXT A;  1D1I A;  2RKS A;  1ENC A;  4N8X 1;  5FKA C;  1PH7 A;  5C3E B;  4RGM A;  2HIX A;  1VQG A;  5JJK A;  3MFY A;  4BS9 A;  4BY7 G;  3SK4 A;  4OX9 L;  2N8N A;  3PO2 B;  1K83 H;  3QB3 A;  4X6A H;  1IKM A;  1N34 Q;  1WOC A;  2E2I H;  3SK8 A;  1G91 A;  1ZYR C;  3NEN A;  3D6C A;  4GNX A;  3PQI A;  3TP5 A;  1TS3 A;  2BH2 A;  2KCN A;  2K04 A;  4LFB L;  1F9R A;  4X62 L;  5E4W C;  5CV7 A;  1EEI D;  2PZW A;  2ES2 A;  3I4N G;  1HFN A;  1WTQ A;  1Q3L A;  3BVM A;  1TY0 A;  3E6Z X;  1G2T A;  1G51 A;  3NUC A;  1DYQ A;  3HKZ E;  2EY1 A;  1E2V A;  4IUQ A;  3MWY W;  1L0W A;  4YCU A;  2D9U A;  1A15 A;  1CSQ A;  2RDF A;  3RN5 A;  2EIF A;  1QVC A;  1WTV A;  1PRT C;  4XT3 B;  2D0P A;  4K8I A;  2F0T A;  3VR3 A;  1RL2 A;  2JP1 A;  3RZD B;  1JJG A;  1ESR A;  2Y0S B;  2XN9 C;  1BF4 A;  4KHZ A;  3NQT A;  5E3F A;  1CQF A;  2RBM A;  4K8J A;  1V1P B;  2MFI A;  3LWE A;  2AQ3 B;  3GTM H;  1DM0 B;  5A35 A;  4GS3 A;  3SVM A;  1EZ8 A;  1OO9 B;  4DNI A;  2RCF A;  1YHB A;  1CFM A;  1L1O C;  3A5U A;  1ET9 A;  1U4M A;  4CDC C;  4A3E H;  4LF7 L;  3OWE B;  3I56 A;  3KF8 B;  3BZK A;  4Z9C B;  2VXW A;  4F88 A;  1B2T A;  5ELN A;  4F87 A;  3G71 A;  1J5E L;  3H3V C;  3S1Q H;  2QEX A;  1HUN A;  5CGK A;  1BCP C;  4JI2 Q;  4ALP A;  4KY5 A;  2JA5 H;  1WTR A;  1QG7 A;  4IPD A;  1J6Q A;  1PH4 A;  5M5Y B;  4IPH A;  1JJ2 A;  4DA2 A;  4LMQ D;  3ULP A;  1EWC A;  4JV5 Q;  2QGQ A;  1PZK D;  3K80 C;  3GTG H;  4IOC A;  1Q12 A;  4H02 A;  2HDL A;  5FLX L;  3PCO B;  4HJA A;  4ULL A;  3VA5 A;  1SYF A;  2KUM A;  1SE4 A;  4BY1 B;  1NMG A;  3F2B A;  4DR2 Q;  3W1G A;  3OOC A;  2LFN A;  3NTK A;  2PMZ E;  3NBH A;  1Y1W G;  3QJY A;  2XRS D;  3BS1 A;  1BNZ A;  2CCZ A;  3C1F A;  4OEL B;  2R7D A;  1FYC A;  3SEB A;  5KNC A;  1PH9 A;  4LWC A;  1HZ9 A;  1SNO A;  2EYH A;  1U4R A;  2YTY A;  1X55 A;  2EYP A;  2MUY A;  1I94 Q;  4YHH Q;  1JT8 A;  2R7Z B;  3VDY A;  1TII D;  2AQ2 B;  3U50 C;  3K5O A;  4A3D B;  5J22 A;  3F1Z A;  1WVL A;  1K0S A;  2KQ3 A;  4KKT A;  2FMC A;  4NMZ A;  3PIP 3;  3M7N A;  5E1F A;  2UUB Q;  4HJ5 A;  4GZY C;  1O78 A;  1PV4 A;  3S17 B;  5J3B A;  1B4O A;  1I4Q A;  1TWF B;  2UXC Q;  1SLJ A;  5A2Q E;  2VZA A;  1KRS A;  4GOP A;  1SNC A;  2ZM6 L;  2CW0 C;  2XGT A;  1IBM Q;  1SEB D;  3TRZ A;  2RQX A;  5M5W H;  1R9T B;  5IIF A;  2AQ1 B;  4GN4 B;  3PUZ A;  2RHS B;  4NW2 A;  1MSH A;  1KLG D;  3S24 A;  4FVM A;  1GUS A;  2V4D A;  2JA5 G;  2KVM A;  1PXU A;  3T4A C;  5CC4 A;  4B9X A;  4GKK Q;  3PUX A;  3J80 E;  4L6T B;  2EJM A;  5ELE A;  4A75 A;  1GM5 A;  1HTL D;  1A63 A;  3AQQ A;  3I7F A;  4WJW A;  4OWT B;  5GQO A;  2PNH A;  4N9P A;  4KHP Q;  2M2L A;  3TME A;  3TP7 A;  4OO1 H;  2QF7 A;  1SMX A;  1L0X B;  5M3F H;  4TQU S;  1E3P A;  2B2T A;  4X66 L;  2PI2 E;  5COR A;  5KND A;  5C4H A;  3A7A B;  1HJP A;  1T5X D;  1V8Q A;  5CV5 A;  3QO2 A;  2ICE C;  2CKZ B;  1VF5 C;  3T1Y L;  5FO7 B;  4CBV A;  3D8G A;  2YYZ A;  4RAU C;  2FIN B;  3CXC A;  3G48 A;  1V1O A;  4JI4 Q;  3HOV G;  3T56 B;  1QNU A;  3S1M B;  5CV4 A;  2O5I C;  5C44 H;  4HJ9 A;  4V19 0;  4UAI A;  3I3C A;  1IYJ B;  4YCW A;  5L37 A;  3RLN A;  2UU9 L;  1OTC A;  4LF6 L;  2KCC A;  1KRT A;  3W3A A;  1XNR L;  4QCL A;  1Y1V H;  3S2H H;  4DR6 L;  3MEF A;  1TWC H;  4IFD I;  1CM9 A;  2C35 B;  2Z8L A;  2EQS A;  2MJ8 A;  4Y7N B;  5DNF A;  2KHI A;  1FNW A;  3Q8D A;  1P16 A;  1GHK A;  4RCN A;  3A8I E;  4EQP A;  1G2S A;  2A6H D;  3TS2 A;  5IP7 G;  3H6M A;  5COY A;  1SJE D;  1OXX K;  1RF2 D;  1TR5 A;  4DR7 Q;  1CT1 D;  5IGF A;  3BG3 A;  1VQB A;  3DWQ A;  2UUA Q;  3R2T A;  5EPL A;  4K5X A;  1EQT A;  1SMY D;  2EYL A;  1HNX Q;  3J7A 5;  4B3T L;  4IQZ A;  4B3M L;  3CW2 C;  1EY7 A;  4DV3 L;  2WAC A;  4ZLT F;  4OO1 G;  3FMC A;  1CK1 A;  1IHZ A;  5M3F G;  1SFO H;  3KJO A;  3HOX B;  5IWA Q;  3FPU B;  4ID6 A;  2DY7 A;  3V96 A;  1QZH A;  3QR8 A;  4YWL A;  1STH A;  2B2Y C;  1H9J A;  2BOS A;  3RZO H;  1VQF A;  5DAU A;  5HY6 A;  5BR8 L;  1EYG A;  1IBK Q;  4HIK A;  5LL6 S;  3CQZ H;  3EBE A;  4UP7 A;  1BBU A;  1VQ8 A;  4XTC S;  3HOY B;  4A3B B;  4LF8 Q;  2DNE A;  3ONA B;  5JJZ A;  1BQQ T;  3G6J B;  2F0P A;  1TWH H;  4P71 A;  1Y8O B;  1PRT F;  1DON A;  3VA7 A;  3DLL A;  1F2M A;  5C3X A;  1H9K A;  4X65 Q;  1Y8N B;  5C44 G;  4R8I A;  1B1Z A;  5FLX E;  3AB9 A;  3PSI A;  5C5L A;  3CPW A;  2MP1 A;  1GJX A;  3PV0 A;  3GDE A;  2CWP A;  2L11 A;  4JI8 Q;  3NTI A;  1BUV T;  1HNZ L;  4CKB A;  1O7I A;  3I8Z A;  4DAY B;  1F9Q A;  1X56 A;  4NB3 A;  1Y1V G;  3FP9 A;  2JA7 G;  1I4R A;  1HRJ A;  3M7G A;  2JA9 A;  3STB D;  3C46 A;  1Q8K A;  3HKS A;  3LWU A;  5IT9 c;  3I4M H;  2J0T D;  2R61 A;  1XNQ Q;  3HOZ B;  1KLU D;  2L0C A;  2CHB D;  1UE1 A;  2F3I A;  5I9O A;  4UP9 A;  4OIJ A;  2F0I A;  3T1H L;  3JC6 6;  3STB C; 
#chains in the Genus database with same CATH homology
 4E6I A;  3PUV A;  3FDT A;  1ROD A;  1SAP A;  3AMU A;  4L63 B;  3IKJ A;  5BN5 A;  4IAL A;  1PFN A;  3A8K E;  2C5C A;  1AN8 A;  2OEO A;  4NP5 A;  2IW3 A;  3GTL B;  1WTW A;  3GTP B;  2JSO A;  4CHT B;  2IWH A;  2EY5 A;  4RFB A;  4M1U B;  1WTP A;  4XDX A;  3L3O C;  1ZKO A;  2RA4 A;  2EPB A;  4BBR B;  2E76 C;  3VYT A;  4DU9 A;  1TT2 A;  1BO0 A;  3CRL C;  1LTG D;  1PDQ A;  4PMC A;  2EY2 A;  1ONL A;  1TKW B;  1D5M C;  3OIQ A;  5KYL A;  2Z1C A;  1EQV A;  3OMG A;  2F0H A;  1HA5 A;  5DM7 3;  4WFN 3;  5EKK A;  4N9T A;  3U9O A;  4ZKC B;  3EVQ A;  1EYD A;  4EGV A;  2FMM A;  4L8J A;  3HOW B;  4DF7 A;  2QIL A;  1PTO B;  1OXV A;  2EJF C;  4KD3 A;  4IUN A;  4KK7 A;  1TQO A;  1VF7 A;  4TSS A;  4K2K A;  3RMH A;  1XWE A;  3R2I A;  5LHY 1;  2QDB A;  3L9A X;  1GHJ A;  1S5E D;  1PZJ D;  5F2D A;  5C0X I;  2JEB I;  3CU7 A;  3X3N A;  1D1K A;  2PW5 A;  5EKI A;  4IUR A;  2PO4 A;  3DEP A;  1RDP D;  1CA6 A;  2YU9 B;  2F1M A;  1LTA D;  1H9M A;  3HGB A;  4KHV A;  3BDO A;  4QUC A;  3NXW A;  4H7B A;  1EYC A;  1D6E C;  3TSS A;  5CV6 A;  2F3W A;  1A2U A;  1UEA B;  2OT2 A;  1BOS A;  4M8A A;  2F0F A;  4PNY A;  2F03 A;  2NVX B;  2ENB A;  4G4K A;  3UI2 A;  1HFG A;  2K03 A;  1ILQ A;  2VB3 X;  3C3L A;  1JWS D;  4HN7 A;  1BXT A;  3GTK B;  4C3I B;  2Z4H A;  1HTP A;  3GQB A;  4FF4 A;  3EA6 A;  3P20 A;  1EY4 A;  1RKN A;  4ZUJ A;  4A3M B;  3M4Y A;  4CKE A;  1QJO A;  3GTQ B;  3PUY A;  3MZ5 A;  1O7L A;  4HAE A;  4XQQ A;  1II3 A;  1QIL A;  3TP8 A;  4KTA A;  5AFW A;  3NBI A;  4BWG B;  1DJR D;  1A6X A;  2XSC A;  1U9R A;  2R6G A;  3EJI A;  2EYF A;  4G7H C;  1UAP A;  4WRD A;  2RDH A;  2HUG A;  1TU2 B;  2A5H A;  3FKI B;  5K36 H;  1I4H A;  1JOR A;  2Q8T A;  3H0G B;  1D5Z C;  1EFI D;  2FHT A;  5IGG A;  5BN4 A;  1FGB D;  1AW7 A;  4ME5 A;  2J7Z A;  2JE6 I;  1KDC A;  3A56 A;  2Q8I B;  3M85 A;  4P2C B;  1JIC A;  1KTK A;  2MPM A;  2BA1 A;  3K5N A;  1VMP A;  4UDU C;  1PRT D;  2A68 D;  1ET6 A;  1D5X C;  1EL0 A;  3QWN A;  4PMW A;  3HKZ B;  4A3K B;  1QCB D;  4QB4 A;  2A68 C;  1JC7 A;  4TRD A;  1EEF D;  2B2T C;  3J81 L;  4ZKB B;  3W2D A;  1T5E A;  2K5W A;  3D31 A;  3T51 B;  1Y8P B;  4A3F B;  2L12 A;  2IX1 A;  5K36 G;  1MSG A;  3J7A V;  4C1N K;  5EBC A;  5D3I B;  1F77 A;  1PFB A;  1BCP D;  5I6W A;  2PZU A;  3EFX D;  2EVB A;  1X3P A;  4KD4 A;  4QF4 A;  2D5D A;  2GA4 B;  3OW7 A;  3MHB A;  5JPM C;  2RVL A;  3WOE A;  1EYA A;  3TN2 A;  4BY7 B;  4HCE A;  1GOZ A;  5IGC A;  2XNA C;  3GTJ B;  1OXU A;  1EU4 A;  2G9H D;  1IKL A;  5EQ0 A;  3T13 A;  1IL8 A;  5EKL A;  1SND A;  1KNA A;  4FXK C;  3NPP A;  4R9W A;  2PMZ B;  3HS0 C;  2K5D A;  3I4N B;  1KNE A;  2RSN A;  1B9M A;  3JAM L;  4ABN A;  3R8B A;  3VYR A;  2MHV A;  5IGB A;  5J39 A;  2CW0 D;  3VR2 A;  3T16 A;  1GUG A;  4IFD H;  2K6A A;  1B3A A;  3ND9 A;  2HCC A;  2K05 A;  1WTX A;  3MXG A;  3A8J E;  3NWT A;  1X3Q A;  4NKL A;  3H94 A;  4KN7 C;  5CBE E;  1B50 A;  1X32 A;  2BCO A;  4WOR A;  4BA2 I;  3V05 A;  3P7J A;  2XRQ D;  1LT5 D;  1TWA B;  1EWH A;  1LT3 D;  1ZXT A;  4I7Z C;  2EDG A;  1J8I A;  1Z7T A;  4CGY B;  1LT6 D;  4DN4 M;  4PMB A;  3HZX A;  4K5V A;  2FJ2 A;  2E2I B;  1I3Q B;  2F0W A;  1CHQ D;  3BYY B;  3D6W A;  4DAP A;  4KI0 A;  3I4L A;  3J7Y W;  1BDO A;  1CA5 A;  1HCZ A;  4S3S A;  4DK1 A;  3E5S A;  3FRP B;  3VYU A;  3GP7 A;  3K58 A;  1Y1W B;  1GUN A;  5E4X A;  1NSN S;  2ZT9 C;  3I91 A;  4IFD G;  1IW7 C;  2KEE A;  1MBY A;  4G7Z C;  3HP3 A;  5CMD A;  4QMG A;  3QOJ A;  4RHR A;  2PNR C;  4HSP A;  2PZT A;  2F0V A;  2A6E C;  3U9S A;  1SNQ A;  3J81 E;  5CV9 A;  2HQE A;  4B9W A;  1D2B A;  3VR6 A;  2F0O A;  2TMP A;  1JWU D;  3S1Q B;  4IN3 A;  1I4P A;  1TY2 A;  2JA5 B;  3S15 B;  3H09 A;  5D65 A;  2SNM A;  4O1N A;  3SDZ A;  4DXF A;  1QOH A;  1XXG A;  2IX3 A;  3NK9 A;  3OIP A;  3KK7 A;  4XXE A;  1SJH D;  4C1N I;  3TZU A;  2A74 C;  2EZV A;  5C6A A;  3QG1 A;  5T1G A;  1S4Z A;  1AZQ A;  1V1P A;  2XWB B;  4HED A;  2F0U A;  2K28 A;  4RKL A;  5ELB A;  3SK6 A;  5K5P A;  1G6Z A;  3DWA A;  1NUC A;  2L55 A;  3SE0 A;  1PYW D;  1TS2 A;  3BZD B;  3MA2 B;  2ICI A;  4EQN A;  3KF8 A;  4DNT B;  1GXD C;  1KDA A;  4KKS A;  4CKC A;  1BR9 A;  1STE A;  3HOV B;  3A54 A;  4FXG C;  4FO2 A;  3JAM E;  3BVG A;  3D4W A;  4IFD J;  3VYS A;  1U4L A;  1JOO A;  1SYD A;  2R3Z A;  4FF1 A;  2QKI C;  5JEA H;  1F2Z A;  2KOL A;  5M5W B;  2X6L A;  3A7L A;  3J7A F;  3PUW A;  4IUU A;  4C3J G;  1EY8 A;  1F2Y A;  5EPJ A;  2TSS A;  1S5C D;  1W6J A;  1EY9 A;  1EIH A;  2ZXR A;  1EIG A;  1B53 A;  3N52 A;  5ELF A;  1F9P A;  4KMU C;  2LY7 A;  3K5L A;  5C0X H;  4K6D A;  1FD7 D;  5M3F B;  4FXD A;  5FO8 B;  2NN6 I;  1NR2 A;  2M9V A;  3KBX A;  1RTN A;  5M3M B;  3DEO A;  2F0G A;  3H91 A;  3URY A;  4FF2 A;  1MD2 D;  4OHJ A;  4RA8 A;  4F8M A;  2B2U A;  4ODG A;  2SEB D;  4KJN A;  5C44 B;  1SYC A;  2E2D C;  3EQL C;  3IFT A;  1SYG A;  4K2L A;  1Y1V B;  3S2H B;  1F9S A;  2JA7 B;  3DWP A;  1TWC B;  3TP6 A;  5JEA G;  4XYO A;  2AUJ D;  1PMR A;  3L7Z C;  4DGZ A;  2IT1 A;  1HA6 A;  1O80 A;  2HCI A;  1SNM A;  4K14 A;  4H13 C;  2XVS A;  4C56 C;  2K1B A;  4OL7 A;  2A73 B;  1ICW A;  3OPO A;  5C0X G;  3BVZ A;  4JBW A;  3MXN A;  2ID0 A;  2I07 B;  4KJO A;  4Q5V A;  3K7A B;  3A55 A;  4ILW A;  5G3L F;  5LL6 X;  4LK1 C;  2F0Q A;  1AZP A;  3RZO B;  1S5D D;  4XQJ A;  4CJ1 B;  1NAP A;  1LLR D;  2WIN B;  4PQX A;  1A2T A;  3CQZ B;  5EBD A;  2WII B;  5JVG 3;  3S2D B;  1EZ6 A;  4EQO A;  2WKD A;  1QWY A;  3NWS A;  5ISR A;  1TWH B;  1GUO A;  1DOL A;  3K5M A;  5ELC A;  3HG9 A;  3I70 A;  3NHH A;  2NYZ D;  3S9W A;  5M5X B;  2OF1 A;  2EOT A;  2H1E A;  1HQM C;  3BDL A;  1RCV D;  1STA A;  2EYJ A;  4HSV A;  2LKV A;  3Q6S A;  2EY6 A;  3HEJ A;  3NTH A;  4OGQ C;  3MXP A;  3LX0 A;  2DNC A;  3IAY A;  4A3J B;  2NZ1 D;  3NP8 A;  3TZD A;  4H44 C;  2EYM A;  3DHQ A;  4U68 A;  5J1Z A;  2JXM B;  4DFA A;  5JAV A;  1M8A A;  4LJZ C;  4DXG A;  3O13 A;  2AUK A;  3GV3 A;  1G8Z D;  1I4G A;  4H0L C;  4K5W A;  4K6L A;  5JEA J;  2QCP X;  3KLS A;  1ENA A;  1VDZ A;  2BE5 D;  1WTO A;  1C8C A;  1PRT B;  2NB0 A;  1K8M A;  1LTR D;  3E0J A;  1DD2 A;  4NDX A;  2BE5 C;  1HHV A;  1YNJ C;  1CHP D;  4B08 A;  5C0X J;  4DAY A;  4MIU A;  4QUF A;  1FR3 A;  4DK0 A;  4ZRZ A;  2B2W A;  3FVQ A;  1H9S B;  1DZ1 A;  3C1E A;  2NVT B;  1UNS A;  3Q23 A;  2G9D A;  2BA0 A;  2NUC A;  5HUR A;  3GTO B;  3OSO A;  5I9P A;  1BCP B;  4IZ8 A;  2KHS A;  4FP5 D;  1SE2 A;  5IT9 L;  5IGE A;  1JE4 A;  4KV6 A;  5C4X B;  3D4R A;  1FNU A;  5IOC A;  3KLR A;  1ML0 D;  1W6K A;  1STN A;  4HCS A;  3OHX C;  2OXP A;  1SYE A;  2O2L D;  2MGS A;  3HRZ C;  2DY8 A;  3I72 A;  1EY6 A;  5KEE A;  3RUZ A;  4C3H B;  2B8F A;  2SNS A;  2X69 A;  2F0K A;  5KYI A;  2E2J B;  2F4I A;  2JYO A;  1JB3 A;  1IYV A;  3SXH A;  1Q1E A;  2K7V A;  5FOB B;  2L1B A;  1LTB D;  2WB1 B;  5IOD A;  1J9O A;  2K33 A;  1RD9 D;  1LO5 D;  4X3T A;  5FK9 C;  4LAA A;  2XIW A;  2B2V A;  2F0N A;  5M9O A;  2NBF A;  3PO3 B;  3D4D A;  1EY0 A;  3QOL A;  5I2Y A;  3V2T A;  3K0Y A;  2Q8R E;  2ZXO A;  4J6H A;  1AEX A;  2KA7 A;  1ESF A;  3VR4 A;  1SE3 A;  5TSS A;  4RWS C;  5KRU A;  1JQY D;  2K5Q A;  1I6H B;  2F0L A;  3K6O A;  2JA6 B;  3SR1 A;  4OIK A;  4A3I B;  2FFK B;  1A3U A;  1WCM B;  5KGU A;  3PMF A;  5I4D A;  3ZYY X;  2DN8 A;  5C5M A;  1IYU A;  5KNB A;  5FO9 B;  2JEA I;  3S16 B;  1E0B A;  5EGT A;  2J4X A;  4X3S A;  3NSW A;  2SOB A;  3TDQ A;  2O5J C;  2I46 A;  1Y69 U;  1BBX C;  2B63 B;  2KED A;  5ELD A;  1AFP A;  4O42 A;  1SXT A;  1HQR D;  4J8Q A;  4PV1 C;  1K8O A;  5JPN C;  5C4J B;  2EXZ A;  3N6R A;  2PCF B;  1UUP A;  1K83 B;  3Q0A A;  3I90 A;  1NR4 A;  5G3L D;  2PW7 A;  3ERO A;  1VCI A;  1A3V A;  1DCZ A;  3DXJ C;  1WD0 A;  1I50 B;  3S14 B;  3IL8 A;  3S1R B;  2IJ0 A;  1PTO F;  3FPP A;  4CJ0 B;  3Q24 A;  1IW7 D;  2JA8 B;  2N88 A;  4FNF A;  1JOK A;  3ND8 A;  1JCK B;  4RKB A;  5IT9 E;  2F0E A;  3SK5 A;  5JOB A;  2PQE A;  3FEW X;  2A6E D;  5I6Y A;  1DXM A;  4YIJ A;  2L4N A;  3DMU A;  5BN3 A;  3G7L A;  1PZI D;  1H9S A;  1LTS D;  2WV6 D;  2RSO A;  2VB2 X;  3GTM B;  1HXY D;  4TKO B;  1QNK A;  4XIG S;  2NVQ B;  4I65 A;  2NTS A;  3WOF A;  1C4Q A;  4A3E B;  4ZK9 B;  4A3G B;  2B2U C;  4F7X A;  1XYI A;  1V43 A;  4ZAI A;  1TVX A;  1GUT A;  1TS4 A;  1PTO H;  2LMC B;  2B39 A;  1CZG A;  5CV8 A;  5DEH A;  1ILP A;  3BYT B;  4HMI A;  1RTO A;  1GUW A;  5I2X A;  2CQA A;  2A6H C;  3P1H A;  4RGT A;  3GTG B;  2EE1 A;  1JOQ A;  2KJX A;  2NN6 H;  1MI2 A;  1I4X A;  2A69 D;  4BA1 I;  1FNV A;  2X6G A;  1SMY C;  4V0B A;  1STG A;  4G57 A;  3RD4 A;  1RJT A;  2NWG A;  4OO1 I;  2A69 C;  3HOU B;  1Q90 A;  3GO5 A;  4RHS A;  1STB A;  3I73 A;  3DUZ A;  5NUC A;  3DM1 A;  1DOK A;  4RCO A;  4HR7 B;  2K32 A;  1LAC A;  4HTH A;  4HMJ A;  2D62 A;  2L5T A;  2KEC A;  1PLF A;  2EYO A;  1MGS A;  3MEH A;  4A93 B;  1LAB A;  3F2U A;  1RHP A;  2EJG C;  4Q0F A;  1QB5 D;  2SDF A;  2E2H B;  4J1M A;  1JR0 D;  2XWJ B;  3PIO 3;  3CKI B;  1C48 A;  2D2C C;  3ITP A;  1A3T A;  2LS0 1;  3GD7 A;  1LT4 D;  2HDM A;  4C2M B;  3MXU A;  2WAQ B;  5JVH 3;  1BCP F;  1O7Z A;  1R4Q B;  5C3W A;  2VNU D;  2NN6 G;  4G7O C;  3AU7 A;  1LTT D;  5CYU A;  1I6V C;  3KLS X;  1U4P A;  3OMC A;  1EY5 A;  1F2L A;  3M3Y B;  2CVR A;  2ZXP A;  2RDG A;  1AP0 A;  4QIW B;  4KKU A;  1KAA A;  1QE6 A;  2IX0 A;  1CQV A;  2AWN A;  3TBI B;  4ZYS A;  1LTI D;  1SBB B;  3S1N B;  4IUP A;  3P75 A;  1CZW A;  1S5B D;  4XQN A;  3MAQ A;  3LNN A;  1PFM A;  1L0Y B;  2NVY B;  5IGD A;  2L9H A;  4FYD A;  1Z47 A;  3M4O B;  4U67 3;  4IUV A;  5HGT A;  2F3V A;  2B2W C;  2PYK A;  4C3I G;  1ENF A;  1WD1 A;  3CHB D;  1JWM D;  4KN4 C;  3OWF A;  2VUM B;  5EJW A;  4DNR B;  3SHL A;  3D3R A;  1HPC A;  1LV9 A;  4C3J B;  1ZEQ X;  1B44 D;  2B2Y A;  1SDF A;  2C9O A;  2PPB C;  4JK1 C;  5D3D A;  5C4Z A;  3MVV A;  1SFO B;  1KAB A;  1H9R A;  1EU3 A;  3CRK C;  1O7Y A;  5CBA E;  2NTT A;  1DOM A;  5CR3 A;  2AWO A;  3MC0 B;  2E75 C;  2QEJ C;  4CJ2 C;  3BDC A;  4IUT A;  2F0M A;  3X3M A;  1G29 1;  4RH6 A;  4XYQ A;  2BDN A;  3NQI A;  4RGN A;  1NCV A;  2B8G A;  4ZQ3 A;  4AYB B;  1SSO A;  1VMC A;  4EVO A;  2K01 A;  1CTM A;  1TWG B;  3K57 A;  4MN3 A;  3R93 A;  1PTO D;  1SYB A;  3I4M B;  4MHE A;  2B2V C;  4RGO S;  1XX8 A;  2IPK D;  1KDB A;  1S5F D;  3ERQ A;  3T53 B;  5KIX A;  1PTO C;  2E74 C;  5EPK A;  1Z6H A;  2F0D A;  3K59 A;  2IL8 A;  2M00 A;  3MTS A;  1E2Z A;  3KUP A;  2R92 B;  3KBG A;  1YNJ D;  3IFD A;  1HUM A;  1YNN D;  4DAV A;  5D14 A;  5A2Q L;  4BBS B;  4KY6 A;  1XTC D;  4XT1 B;  1M4V A;  2F0S A;  1R4P B;  4C3H G;  3Q22 A;  2N55 A;  3WDN A;  3MFG A;  1YNN C;  4X3K A;  2WP8 J;  2H4O A;  1OXS C;  4X3U A;  1SNP A;  4KY7 A;  4R8N A;  3VR5 A;  1TS5 A;  1E2W A;  1B9N A;  2F0J A;  5T1I A;  4FF3 A;  3J80 L;  5DM6 3;  2O4X A;  3GV6 A;  3R3O A;  3RLF A;  1EOT A;  1STY A;  3QIA A;  2BDO A;  4ZUI A;  1CI3 M;  2WKC A;  3C2P A;  2R93 B;  1Q8I A;  1Q1B A;  3NE5 B;  1ZYR D;  2Z4I A;  1OXT A;  1D1I A;  2RKS A;  1ENC A;  5FKA C;  5C3E B;  4RGM A;  3MFY A;  4BS9 A;  3SK4 A;  3PO2 B;  3QB3 A;  1IKM A;  3SK8 A;  1G91 A;  1ZYR C;  3D6C A;  3TP5 A;  1TS3 A;  2KCN A;  2K04 A;  1F9R A;  5E4W C;  5CV7 A;  1EEI D;  2PZW A;  1HFN A;  1WTQ A;  1Q3L A;  3BVM A;  1TY0 A;  3E6Z X;  1G2T A;  3NUC A;  1DYQ A;  2EY1 A;  1E2V A;  4IUQ A;  3MWY W;  2D9U A;  1A15 A;  2RDF A;  1WTV A;  1PRT C;  4XT3 B;  4K8I A;  2F0T A;  3VR3 A;  2JP1 A;  3RZD B;  1ESR A;  2Y0S B;  2XN9 C;  1BF4 A;  4KHZ A;  3NQT A;  5E3F A;  1CQF A;  2RBM A;  4K8J A;  1V1P B;  3LWE A;  2AQ3 B;  1DM0 B;  5A35 A;  3SVM A;  1EZ8 A;  1OO9 B;  1CFM A;  1ET9 A;  1U4M A;  3OWE B;  4Z9C B;  2VXW A;  4F88 A;  1B2T A;  4F87 A;  3H3V C;  1HUN A;  5CGK A;  1BCP C;  4KY5 A;  1WTR A;  1QG7 A;  5M5Y B;  4DA2 A;  4LMQ D;  1EWC A;  1PZK D;  1Q12 A;  2HDL A;  5FLX L;  4ULL A;  3VA5 A;  1SYF A;  2KUM A;  1SE4 A;  4BY1 B;  3OOC A;  2LFN A;  3NTK A;  3NBH A;  3QJY A;  2XRS D;  3BS1 A;  1BNZ A;  3C1F A;  1FYC A;  3SEB A;  5KNC A;  1SNO A;  2EYH A;  1U4R A;  2EYP A;  2MUY A;  2R7Z B;  1TII D;  2AQ2 B;  3K5O A;  4A3D B;  5J22 A;  1WVL A;  2KQ3 A;  4KKT A;  2FMC A;  4NMZ A;  3PIP 3;  3M7N A;  5E1F A;  4GZY C;  1O78 A;  3S17 B;  1B4O A;  1I4Q A;  1TWF B;  5A2Q E;  1SNC A;  2CW0 C;  1SEB D;  2RQX A;  1R9T B;  5IIF A;  2AQ1 B;  3PUZ A;  4NW2 A;  1MSH A;  1KLG D;  4FVM A;  1GUS A;  2V4D A;  2KVM A;  1PXU A;  3T4A C;  5CC4 A;  4B9X A;  3PUX A;  3J80 E;  4L6T B;  2EJM A;  5ELE A;  1HTL D;  4WJW A;  4N9P A;  2M2L A;  3TME A;  3TP7 A;  4OO1 H;  2QF7 A;  1L0X B;  4TQU S;  2B2T A;  5COR A;  5KND A;  5C4H A;  3A7A B;  1T5X D;  1V8Q A;  5CV5 A;  3QO2 A;  2ICE C;  1VF5 C;  5FO7 B;  4CBV A;  3D8G A;  2YYZ A;  4RAU C;  2FIN B;  1V1O A;  3T56 B;  1QNU A;  3S1M B;  5CV4 A;  2O5I C;  4V19 0;  4UAI A;  3I3C A;  2KCC A;  3W3A A;  4QCL A;  4IFD I;  1CM9 A;  2Z8L A;  2MJ8 A;  4Y7N B;  5DNF A;  1FNW A;  1GHK A;  4RCN A;  3A8I E;  4EQP A;  1G2S A;  2A6H D;  3H6M A;  5COY A;  1SJE D;  1OXX K;  1RF2 D;  1TR5 A;  1CT1 D;  5IGF A;  3BG3 A;  3DWQ A;  3R2T A;  5EPL A;  4K5X A;  1EQT A;  1SMY D;  2EYL A;  4IQZ A;  1EY7 A;  2WAC A;  4ZLT F;  4OO1 G;  3FMC A;  1CK1 A;  1IHZ A;  3HOX B;  3FPU B;  4ID6 A;  2DY7 A;  3V96 A;  1STH A;  2B2Y C;  1H9J A;  2BOS A;  5DAU A;  5LL6 S;  4XTC S;  3HOY B;  4A3B B;  2DNE A;  3ONA B;  5JJZ A;  1BQQ T;  3G6J B;  2F0P A;  1Y8O B;  1PRT F;  1DON A;  3VA7 A;  1F2M A;  5C3X A;  1H9K A;  4R8I A;  1Y8N B;  1B1Z A;  5FLX E;  3AB9 A;  5C5L A;  2MP1 A;  1GJX A;  3PV0 A;  2L11 A;  3NTI A;  1BUV T;  4CKB A;  3I8Z A;  1F9Q A;  1I4R A;  1HRJ A;  3M7G A;  3C46 A;  3LWU A;  2J0T D;  2R61 A;  3HOZ B;  1KLU D;  2L0C A;  2CHB D;  5I9O A;  4OIJ A;  2F0I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...