3R3OA

Crystal structure of staphylococcal nuclease variant delta+phs t62a at cryogenic temperature and with high redundancy
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFAKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Cavities determine the pressure unfolding of proteins.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 33
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2011-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3r3oA00
4K6DA 5CV7A 2F0MA 3D8GA 1SNOA 5IOCA 3NUCA 2WACA 2M00A 3E5SA 4N9PA 1JOKA 3OMGA 1STYA 5I9OA 2F0DA 4KJOA 2F3VA 2PW5A 3MHBA 4NP5A 2F0VA 5CC4A 3TP6A 1RKNA 5I6YA 2PZTA 2PYKA 1SNDA 4J6HA 3H6MA 4RKLA 1EYAA 2HQEA 4ZUJA 1STGA 2KQ3A 1SYGA 3C1EA 5EKLA 1IHZA 4IUNA 4K2LA 1F2MA 4R8NA 2F0FA 5E3FA 1ENAA 2F0LA 2EY2A 4KY6A 2EYHA 4KY7A 4LAAA 4NKLA 5C5LA 5HGTA 1EY8A 5J22A 5IGDA 3TP7A 5CR3A 1STNA 1KABA 2F0IA 2PZUA 5CV6A 5CGKA 2SOBA 5CV4A 1SYBA 3EJIA 1EY7A 1SYDA 3SK4A 4EQOA 2KHSA 4YIJA 1KDCA 4F7XA 5KEEA 5IGBA 2EXZA 4K5WA 4OL7A 3EROA 3DMUA 3PMFA 2F3WA 4NMZA 5C4HA 2EYLA 3ITPA 5KYIA 3TP8A 3LX0A 5K5PA 5CV9A 3RUZA 3NK9A 3SK5A 4I65A 2QDBA 4KY5A 2OEOA 2PZWA 1EZ8A 2F0HA 4B9XA 5J39A 1II3A 2F0UA 4QF4A 3HEJA 1STHA 2EYFA 5CV5A 1SNPA 1TT2A 2F0NA 5JAVA 2EYPA 1F2ZA 3SK6A 4KHVA 2RDFA 1EY9A 5C4ZA 2EYOA 3BDCA 2F0EA 3U9OA 2F0QA 2F0TA 4ID6A 5CV8A 5E1FA 4TRDA 2F0WA 5C5MA 4K2KA 4HTHA 4PMBA 1AEXA 4HMJA 5C6AA 1A3VA 1EY6A 2EY1A 1EY5A 3QOLA 4B9WA 3S9WA 1JORA 1EYCA 1JOQA 1SNMA 2F0OA 1STBA 3SK8A 5ISRA 1EZ6A 1F2YA 4PNYA 2OXPA 5EGTA 5KGUA 2OF1A 4KV6A 1SYFA 1ENCA 5EKKA 3SXHA 4DU9A 1A3TA 2SNMA 3D4WA 3QOJA 4DF7A 3MEHA 4K14A 1NUCA 4EQNA 4H7BA 1SYCA 4K5VA 3HZXA 4K8JA 3T13A 4J1MA 3VA5A 4QMGA 5J1ZA 5DEHA 1KDAA 4K5XA 3TMEA 5HURA 1EQVA 4IALA 4KD4A 4ZUIA 5I6WA 2EYMA 1A2UA 4S3SA 3T16A 1STAA 3NQTA 5NUCA 4KTAA 3R3OA 1SYEA 4N9TA 2SNSA 4EVOA 2RKSA 3C1FA 3NHHA 3TP5A 5IGCA 1U9RA 3OWFA 1SNCA 3QB3A 4QB4A 4KJNA 4NDXA 5IGEA 4DFAA 2EYJA 3SR1A 1SNQA 2F0KA 3DHQA 3OMCA 4WRDA 4EQPA 1NSNS 2ENBA 3V2TA 1EY4A 4IZ8A 3BDLA 5I9PA 3P1HA 4RKBA 5KYLA 4PMCA 4KD3A 3D6CA 1JOOA 5IGGA 2O4XA 2PW7A 5KRUA 1KAAA 3NXWA 3NP8A 5JOBA 2RBMA 5IGFA 1A2TA 3OSOA 3EVQA 4HMIA 4K8IA 2EY5A 4ODGA 2F0JA 5M9OA 3SHLA 2LKVA 3MXPA 1KDBA 4ZQ3A 5IODA 4ME5A 1TR5A 1TQOA 3MZ5A 1EY0A 3P75A 5DAUA 5C3WA 1A3UA 4WORA 4E6IA 2NUCA 4MIUA 3D4DA 4G57A 2F0SA 3MVVA 4DGZA 5F2DA 5IIFA 5C3XA 2F0GA 2F0PA 4F8MA 1EYDA 3ERQA 2EY6A 5KIXA 2PQEA
chains in the Genus database with same CATH superfamily
3KK7A 2UUAL 1SNOA 2ZJQA 1LT4D 1PLFA 4JI1L 1GJXA 1STYA 1DOLA 5IWAL 1N34Q 3A8KE 3GTJH 5I6YA 1ET6A 2KCMA 3T1YL 5COYA 2N55A 3V05A 4PZ6A 4DNIA 1N33Q 2Z4HA 4R1JA 1YHAA 2VXWA 3D31A 3FKIG 3K81C 3KF8B 2QEXA 3S1NH 1PHJA 1O7YA 3OTOQ 2AUKA 4O42A 1R9TH 4HEDA 3DUZA 1N36L 3E9HA 1EOVA 1PTOD 1BDOA 3K58A 2E2JH 5L37A 3SK5A 4GKKL 4X62Q 1DD2A 1WOCA 5CV5A 4DV7Q 5E7NA 5M5YB 1JJCB 1B8AA 2VQEL 3HKSA 2O5JC 3FKIH 4ILWA 4RGNA 2OCEA 2UUCQ 5C5MA 2RSOA 5A2QE 1EY6A 2RVLA 4R4OA 4BA2I 4KK7A 3ULLA 3HGBA 5KNBA 3GQBA 4DR7Q 1JCKB 5EKKA 2OT2A 4B3TQ 4ZLTF 5J1ZA 2E74C 2C9OA 1JICA 1U4LA 1H9RA 2KEEA 2VQFL 4JI0Q 2SNSA 3K57A 3S2HB 2LFNA 5DM63 2A5HA 1TWGB 5D3DA 2IX1A 1ZYRC 3RR5A 5ELDA 4DV0L 1DCZA 2RDHA 4KMUC 3MXGA 3BZDB 1BCPD 3DEOA 4RKBA 1NR4A 2Y0SG 1VQ8A 3PGZA 1JE4A 2VS1A 1HR0W 3WOEA 3M9BA 4JBWA 4WJ3M 3EVQA 1VF5C 4LF7Q 1BBXC 1HNXQ 1K9MC 5DLQE 3RZOH 2F0SA 2DY7A 3NBIA 3ULJA 1C4QA 1TWFH 3HOXG 3CCRA 5CV7A 3V96A 3D8GA 1PRTB 2SDFA 1KAWA 2ZTCA 3CD6A 3GTKH 3KBXA 4Y7NH 4PMWA 1UUPA 5I9OA 1XMQL 4LF8L 3AEVA 4MZ9A 2DJGC 2BH8A 3I4NB 3TRZA 4J6HA 5LMNW 3IL8A 1EOTA 4JI5L 5AJ3L 2ZXOA 2Q8RE 1HUMA 2L9HA 3VR3A 4B3RQ 3H15A 4K2LA 1ENAA 1TY0A 2EY2A 4KY6A 4LAAA 3TEHB 4DNTB 4BY1B 3T1HQ 3TP7A 4B3SQ 2JA6B 2GN5A 2HUGA 1K8GA 2NTTA 3PUZA 3T56B 1GD7A 4NMZA 1Y1VG 1HNWQ 5I4DA 3E3XA 4QUFA 2Y0SE 2L55A 4FP5D 5JAVA 1EFWA 3KJPA 3HOYG 2HIXA 2CQAA 4NPSA 1BBUA 3ULPA 4XIGS 3TDQA 4XXEA 1HPCA 1J9OA 2ZJRA 2UU9L 1A3VA 3S9WA 3QOLA 1GVPA 2DUDA 4ZRZA 4QUCA 4DR2L 3DWAA 2YTXA 3MXNB 4OO1I 2CW0C 5FKAC 4AH6A 1NUCA 1EQQA 4LFBQ 1H9MA 4YWMA 3TS2A 3G4SA 5HY6A 3GTPB 2DN8A 1EL0A 4KD4A 1HZBA 2WKCA 3URYA 4ZK9B 4YHHL 1JMCA 3HOYH 2AWNA 4NXML 3PIO3 4KHZA 1LLRD 4DFAA 2F0KA 2VY3A 4UP7A 2F52A 3CMAA 3M7GA 3H0GB 3H94A 1NSNS 1S5CD 4KN4C 3V2TA 4GLAC 2VUMB 3K5LA 3I72A 3EIVA 2JK8A 1I94L 3OYYA 1J5EL 3S2HH 3K5NA 2RCNA 1CKOA 3PIOA 4LF6Q 4RHSA 1TWGH 2CCZA 3Q23A 3MXPA 2KCNA 4DV3L 1Q81C 1TS5A 4DR6L 5F2DA 2YU9B 2NZHA 1GUSA 1CK1A 5G3LF 2G9DA 1ET9A 1Q1BA 2KJXA 4RH6A 3U4VA 1PH4A 4BY1G 2JA6G 3G6EA 3HKZB 1XNQL 3ERSX 4ZYSA 5CC4A 1Q86C 1LT5D 2BA0A 1X54A 4C3JB 2OWOA 2B2WC 2K28A 5ELFA 2BE5D 1L1OA 3PUWA 1C48A 3MXUA 1IHZA 2KEDA 1I4RA 5GADC 3T4AC 1G2TA 2MNAA 2JSOA 4KI0A 4JBKA 4CBVA 3BS1A 1XTDA 2C5CA 1BQQT 1EWHA 3GP7A 1VQKA 2FFKB 3A5ZB 2UUAQ 3RUZA 2Q2HA 4CGYB 1II3A 4BY1H 1SE2A 2JA6H 4DR3L 4R9WA 1K83B 2EE1A 1NR2A 2C35B 4LF5L 5J3BA 2RCFA 2NZ1D 1BOSA 1NTGA 2PI2A 1VQNA 1CKNA 1DM0B 3PF5A 2XVSA 4APVA 2D0OA 1EUJA 1QILA 1X3GA 4V190 3LGJA 1JORA 2K75A 4LUZA 1EIGA 3CCEA 3JAML 4P2CB 1N36Q 1OXXK 2Z6KC 5JVH3 2EVBA 4F87A 1YZ6A 1VQ4A 2G5DA 1MKHA 2WV6D 3IKJA 2PCFB 5DEHA 5ELEA 2VUMG 5GAGC 4IALA 4S3SA 1E0BA 2UXBL 1F2LA 1IL8A 3M7NA 3X3NA 4KN7C 3IFTA 4IFDJ 2HD3A 2OQ0A 5HGQA 1RDPD 3GTPH 3A7AB 2D0PA 3S24A 3NBHB 5H1SE 3C2PA 2BDNA 2XWBB 1WCMG 1BO0A 3OWEB 1S3OA 1VQ6A 1GO3E 2WB1B 4BBRG 1I50B 2PW7A 3PV0A 5JOBA 1HA6A 3E0JA 4CJ0B 4HMIA 2LKVA 4GN3B 2L1BA 2HT1A 3H0GH 4HIOA 3MZ5A 2VUMH 3G6JB 1CT1D 2A6HD 5DNFA 5EQ0A 2MUYA 4DGZA 4JVZA 1WTXA 1MGSA 2F0GA 1TY2A 1PH9A 5KIXA 1W2BA 2Q2TA 1XPOA 1D2BA 2NVYB 1DJRD 2XNAC 2AQ1B 4DPGA 1N33L 1KRSA 1UNSA 4RKLA 1K3RA 4DV5Q 4OWXB 3SEBA 4BBRH 1MJEA 3OIPA 4YY3Q 2RF4A 4C3HB 4DR1Q 5ELBA 5J22A 2NZOA 1VQCA 3OTOL 1JB7A 4IN3A 2PZUA 2OQKA 4TQUS 5T1IA 4XDXA 1O7LA 3QJYA 1SYDA 4OXPA 1IKMA 1FD7D 5IGBA 2J7ZA 4BBSB 4X62L 4GNXC 1Q1EA 1CHPD 4GLVB 2E2IB 2IX3A 3TS0A 1M1KC 1PXUA 1LO5D 4DV7L 2B63B 1FGUA 2EYPA 1SDFA 1C8CA 5JVG3 3I4OA 2LXKA 2F0EA 4DV2Q 4GOPA 2UUCL 1F9QA 5E1FA 4LF4Q 4K6LA 1K83H 2CVRA 1RL2A 1QUQB 2IY5B 2E2HB 1X3EA 3PQIA 1VQMA 1V8QA 5A35A 4DR5Q 1A3TA 3LWEA 1PMRA 4A3DB 4XTCS 5BN3A 2L12A 3G71A 1VQ5A 4A3BB 1SJED 2WB1G 5EKIA 2PQAB 1EU3A 1WFQA 2K6AA 1ENFA 3W1BA 4KTAA 4JI0L 3X3MA 3PIP3 3MA2B 4QJFA 1IYJB 3TP5A 1TWHB 1Q7YC 3A55A 1BBWA 3AB9A 2FXQA 2BH2A 3NEMA 1PFBA 5KYLA 1CFMA 4DR2Q 4OGQC 2F4VQ 3KUPA 3PIPA 2K50A 1JC7A 3I2ZA 1RD9D 4LF7L 2EY5A 3DEPA 2NVTB 1HNXL 1TR5A 4R8IA 4E6IA 2WIIB 2MPMA 2ZXPA 5C0XI 2ASBA 1RTOA 4YHHQ 2F0PA 1I50H 2IW3A 3RD4A 4NXMQ 4FF3A 3QIAA 4PZ7A 4HIMA 2DY8A 4C3HG 2WACA 2QILA 5EPLA 1ILQA 1Q82C 1E1OA 3TP6A 2JJQA 2ICEC 2PYKA 4HJAA 3C3LA 1JT8A 1J5EQ 1YNND 4B3RL 1HTLD 1SYGA 4BBSG 1Q8IA 2AMCB 5M3MG 2WB1E 1D5ZC 1O78A 2NVYH 4YCUA 3VDYA 3FRPB 4U673 3T1HL 1U5KA 2B63G 2MHVA 4TSSA 3TSSA 4RHRA 2G9HD 2ZJPA 1ASZA 1WYDA 2JA9A 3EQLC 2F3WA 3NTKA 4LWCA 1L1OC 2EOTA 1LTGD 2QDBA 4C3HH 3TREA 5J39A 2B2YA 1PFSA 1FNUA 2HQLA 1XNQQ 1LTLA 1F2ZA 5C4ZA 3M85A 2L5TA 4BBSH 1AE3A 3HFZB 1S4ZA 2E2IH 3K0XA 4L5SA 2B63H 2SEBD 1RODA 2NB0A 4A3BG 1SSOA 2HCCA 4X65Q 4G7HC 2OXPA 1QVGA 3LWUA 1G51A 1HRJA 2SNMA 2E5LQ 1X9NA 1U0LA 4HN7A 3ZYYX 1P8LA 5C0XJ 4H7BA 1NJIC 1UE7A 1KDAA 4RGOS 4CJ1B 2EYMA 1NMFA 1A2UA 3T16A 1I5FA 2RA4A 3NQTA 5JJIA 1NE3A 3RZDB 1PTOC 2LS01 4A3JB 1D6EC 2AQ2B 4A3DH 2Z0SA 4L8JA 4NDXA 1U4PA 3SVMA 3J81L 3Q22A 4A3BH 1JWMD 3D6CA 2AQ3B 2O4XA 4IO9A 1BR9A 1TWHH 2HCIA 3FDTA 4DUZL 4ODGA 1KDBA 3CRKC 3S17B 4MNOA 3NSWA 1M90C 4LK1C 1ZXTA 1NMGA 4LJZC 1YVCA 4X3UA 1D1IA 3L0OA 2FINB 2ZM6Q 1JOKA 1A15A 2F0DA 1WTHA 1AP0A 1RKNA 2RHQB 3I91A 2PZTA 1QG7A 3N52A 2E2DC 3C1EA 1MSGA 1SFOB 3KLWA 3MFGA 2CQOA 4YWLA 4KHPQ 2B2WA 2A8VA 2LMCB 4DXFA 2K01A 2H5XA 3J81c 3BDOA 3PMFA 1C9OA 3I3CA 1GXDC 2B2UA 2F0HA 3PUVA 2X6GA 1BUVT 2NVQB 1UAPA 3AYHB 2DJFC 3MEFA 2ZXRA 1HJPA 2B2TA 4C56C 1LTTD 3CC2A 1NNXA 2QA4A 2QF7A 4PMBA 3R93A 1NCVA 3J7YW 2EY1A 4YCWA 5A2QL 4N8FA 1PH8A 1WTVA 2OF1A 1LV9A 5FJ8G 4A3JG 4AQYQ 5IP7G 4A3FB 4DU9A 3KLRA 3MEHA 5GAEC 1GHKA 3U58A 1FL0A 2I5HA 1Z7TA 3GO5A 4GOPC 4IUQA 2B29A 4PZ8A 2XRQD 4JI3Q 4JC0A 4DAVA 2KUMA 2Z6KA 1QE6A 1IBKQ 3AMUA 4FVMA 4L6TB 1RIPA 3I70A 4EQ5A 1U9RA 1XX8A 4ZCKA 1V1PA 1SNQA 2N88A 1Q3LA 4DV1Q 1GUGA 2ENBA 2ID0A 3W2DA 3CF5A 5JJKA 1X6OA 5I9PA 3IFDA 1FNWA 4GLXA 3K5MA 5IGGA 5FJ8H 4A3JH 5IP7H 1X32A 1SJHD 1PRTD 3GTOB 1TXYA 3KF6B 3K6OA 1AN8A 5FK9C 1E7ZA 4K8IA 1PH1A 1IL2A 2MGSA 4PQXA 4HAEA 1AW7A 5LHY1 1GKHA 2NUCA 2D5DA 5BR8L 1QOHA 3F2BA 1K73C 3ERQA 1GUNA 4H0LC 1MHWC 2IX0A 3WWVA 1YIJA 1HTPA 4ABNA 1E22A 3MHBA 3NELA 2PMZB 3WDNA 2YTVA 4F88A 3S17H 4DAYA 1PFNA 1A6XA 3BU2A 1X55A 1W6JA 4FNFA 4LMQD 3DM3A 3VR5A 4DV5L 2KQ3A 1V1OA 4JBMA 4YY3L 1EIHA 4BA1I 4DR1L 2QDLA 5E3FA 1UE6A 1PTOB 2K52A 3CMEA 4KLKA 5CGKA 2I07B 1L2FA 1SBBB 3GDEA 5TSSA 1HH2P 2KECA 1B4OA 1Y8PB 2IPKD 1SXTA 4K5WA 2R7DA 1SFOH 3TZDA 3NK9A 1D5MC 1MSHA 1CHQD 2KBNA 2MO0A 4IOCA 1SRUA 1S5DD 2F1MA 5GAHC 4Z9CB 3ONAB 1X3PA 1WJJA 4OHJA 4DK3C 2JP1A 4GNXA 4A3FG 4DV2L 2EYOA 4BS9A 3TN2A 1O7ZA 3Q0AA 4LF4L 4IUTA 4TRDA 3CCUA 1Y1WB 1XYIA 2B2YC 4HCEA 2Z1CA 1JOQA 2F0OA 3BG3A 1TWAB 5IYDG 2BE5C 4DR5L 4X3SA 1C7YA 1YI2A 4A3IB 3NWTA 2OTJA 2QW7A 3HZXA 4K8JA 2NVXB 3VA5A 2EJGC 3MFYA 3JC66 1X65A 1HFGA 2GVBA 1GHJA 4A3FH 1BCPB 4N9TA 1WTOA 1LYLA 4FXDA 5IGEA 1FNVA 4WRDA 5M5YH 4IUPA 3CW2C 1WI5A 1GUOA 2F4VL 5IYDH 5JJZA 1Y8NB 2IJ0A 2NN6G 5GQOA 3NXWA 2K5QA 1LT6D 4JV5Q 3OSOA 5M9OA 4QGUA 2KCTA 2JEBI 1EY0A 4DAPA 4DR4Q 1EFID 1S5BD 3GV3A 3L3OC 5IIFA 3D6WA 3Q6SA 3GTOH 1STEA 3NUCA 1EWCA 4I7ZC 1HNZQ 1IYUA 1RHPA 2VB2X 4XT1B 5EPJA 2Q8TA 3H3VH 1VQHA 3N6RA 1CA5A 4DV6L 2M9VA 3BYTB 2NN6H 4IUNA 4DUZQ 4H13C 1VQ9A 1VDZA 4AIMA 1JQYD 1BKBA 5IYCG 3I4NG 3CPWA 1BF4A 1KABA 5CV4A 3KDFB 4EQOA 3KF8A 1KDCA 3GTGB 1MI2A 2IL8A 2N3SA 3S14B 1D1KA 5K5PA 2L11A 1SMXA 4KY5A 1Y1WG 4B9XA 3O13A 3UDXA 3UDGA 2A6HC 5IP9G 3FVQA 2ICIA 4KHVA 3SK6A 1HA5A 2A68D 1V1QA 2PMZE 4OELB 5T1GA 2XTIA 4R4IA 2F0QA 4J8QA 4HSVA 2CKZB 2B2UC 3GTQB 5IYCH 3I4NH 1G2SA 4X65L 1WTQA 2K5NA 1EZ6A 3S16B 4OIKA 4KV6A 2KA7A 2E5LL 2CH4W 4POGA 4Q0FA 4FXKC 1TS3A 1YEZA 2B2TC 1Y1WH 4J1MA 1PTOF 2A73B 3MTSA 1J8IA 3ND8A 1H9SA 3Q24A 5I6WA 4ZUIA 5IP9H 1TWAH 5NUCA 5AFWA 4GN5A 3A7LA 3GV6A 1H9KA 3KJOA 1U4MA 1XPUA 2ATWA 1KLUD 4MTNA 4QB4A 2NVXH 2EPBA 1BNZA 3KOJA 2NN6I 1KHIA 2E8GA 1HFNA 2GVAA 4R4CA 1FR3A 1PH5A 4FF4A 4HR7B 1Y69U 1TVXA 2RQXA 4IJLA 3M4QA 3U50C 3BZCA 4AYBB 1VQOA 3H0GG 4IURA 1V43A 2K03A 2K1BA 4ME3A 2BA1A 4MIUA 1GUTA 3VYSA 1EYDA 1JJ2A 2UXCL 2ZM6L 1QNUA 2KOLA 3UDFA 4DK0A 1B2TA 1UEAB 2AWOA 4X6AH 1GM5A 1RJTA 1OXUA 1O80A 2MJ8A 4IPDA 4CDCC 1B9NA 1BCPF 3HOUB 2BDOA 3HKZG 1HR0L 5C5LA 4KHPL 1YJNA 1B1ZA 4JI6Q 3CKIB 4C3JG 4LNQA 3CQZB 2JA5B 1F77A 4FF1A 5BR8Q 3C46A 3BJUA 5CYUA 5KYIA 2A69D 2ZT9C 4CDEC 5CV9A 4TKOB 4IPHA 1WD0A 3HP3A 1F9SA 2PNHA 3KLSA 1VQPA 2X6LA 4O2DA 2QEJC 5M5WB 2RDFA 1IBLQ 2YU9H 2Z4IA 3HOZB 5LMNL 3GTGH 3S14H 1ESRA 1CTMA 1WTRA 4LFAL 4CJ2C 1VMCA 4C3JH 5E4WC 2M2LA 2O2LD 4AQYL 1LABA 1YNNC 4V0BA 4C1NK 4KKTA 2JN4A 3A74A 4FO2A 4XYQA 2XWJB 5E4XA 2QKIC 3PF4A 4Q5VA 1CA6A 4QMGA 4JI3L 2ES2A 3DXJC 2JA8B 3HKZE 2A6EC 1A0IA 3S16H 3NTHA 1STAA 4POFA 1IBKL 1JE5A 1KIXA 4A93B 4EVOA 4AYBG 5IGCA 5FO9B 3OWFA 3OOCA 2E76C 4DV1L 4LF9Q 3SR1A 4C1NI 4C3IB 1NY4A 3PO2B 4L5RC 1EQRA 5KNDA 3K7UC 1KNEA 3EBEA 4JK1C 4OEMB 1IXRA 1KD1C 3S1MB 1AZPA 1KC8C 3CCSA 4WJWA 1Z9FA 4ME5A 2WAQB 5C3WA 1P16A 2EQSA 1S5FD 3R2IA 1EIYB 3K7AB 3MVVA 5C4JB 2JXMB 3HOUG 3R8BA 3F2DA 1ESFA 1HXYD 3E5SA 2JQOA 1M8AA 2D62A 3QR8A 4BY7B 1I3QB 2X69A 1Q46A 2NWGA 1SNDA 3VR4A 2LSSA 1DZ1A 2HQEA 5C4XB 3VYRA 5FO8B 5EKLA 2YTYA 1CQFA 2F0FA 2F0LA 1EEID 3BVMA 5IGDA 5JEAH 4AYBE 1JWUD 2F3IA 1WTWA 3HOZG 3M4OB 4WFN3 3GD7A 4F7XA 1J6QA 4H44C 1YNJD 2H1EA 3RN5A 3HOUH 5ELCA 1XMOQ 2PZWA 1D8LA 2HDMA 4IPGA 1STHA 5FLXE 4RFBA 2F0NA 4DV6Q 1G91A 2Z9HA 3KLSX 2B3GA 2YYZA 1X3FA 2K5WA 4PV1C 3I56A 1F9PA 1GOZA 4HMJA 5C6AA 4OWTB 1RCVD 3U4ZA 4HJ9A 3I73A 2JA8G 1FYCA 3S1QB 2A6ED 5ISRA 1VF7A 1QZGA 3HOZH 1VQGA 4P72A 4XQQA 4A93G 2E75C 1CI3M 3D4WA 1IW7D 3QOJA 3SE0A 3I7FA 4QCLA 5FLXc 1HUNA 4C2MB 3FPPA 2WP8J 4C3IG 2XRSD 4ZKCB 1I6VC 1A8VA 5IT9E 4RGTA 1BXTA 3GTJB 1DONA 5LMUQ 4JI7Q 3PSIA 4A3DG 3ZJYC 2J4XA 4RCOA 1B44D 2PNRC 4K0KQ 3J80i 2JA8H 1JR0D 3I4LA 3J7AV 1E3PA 4A93H 2Q2IA 4LUVA 4CHTB 5KRUA 4JV5L 2IT1A 4Y52H 3NBHA 2L15A 5IGFA 4A3EB 3RLNA 3RN2A 1XJVA 2F0JA 4C3IH 3OPOA 4DR4L 4BY7G 2HHHL 5DAUA 1A3UA 2B2VA 2E2HH 2RHSB 1B9MA 2MP1A 5C4XG 3NENA 2PQEA 4GKJQ 1QCBD 1HNZL 2ALYB 4GNXB 3S1MH 1SLJA 3D0FA 3DWPA 4FF2A 4A76A 3HS0C 3K7AH 1HCZA 4IQZA 1STGA 3T51B 5C4JH 4P74A 3J80E 2K04A 2IHEA 2MFIA 2R93B 2WFWA 5HGTA 3ND9A 4NB3A 2F0IA 2FJ2A 4BY7H 5M3FB 3TQYA 4ULLA 3HOVB 4JI8Q 4YIJA 4JW0A 1VQLA 5KEEA 2MO1A 5C4XH 1PRTC 3DMUA 4NXNQ 2FMCA 3ITPA 2UXCQ 3LX0A 4IUUA 2NVTH 2EYFA 1D5XC 2Z8LA 3D4RA 5IY0A 1QVCA 2AUJD 1B50A 1G6ZA 3I55A 2R3ZA 1R4PB 1W6KA 5FOBB 2A1AA 1OTCA 1HR0Q 3GTMB 3CPFA 5KNCA 3J7A5 2F0TA 1DOKA 4DV4Q 4RMFA 2K4KA 4HTHA 1PH3A 2UXDL 1CSPA 1VQAA 3CCMA 2BCOA 5EGTA 5EPKA 4JYAQ 4OONA 4DA2A 2B8GA 4FDBA 1SYCA 3T13A 1QUQA 1TWCB 4K5XA 4Y7NB 3S1QH 1L0WA 3E9IA 1PZID 3K0YA 1DOMA 5G3LD 5LMNQ 2BOSA 1SYEA 1ZEQX 3D3RA 1PA6A 2A74C 3C1FA 1PZKD 4C2MH 4LFAQ 3QB3A 5M5XB 2Z6BA 2EJFC 3TBIB 3HOWB 2N8NA 2EYJA 2PQAA 4UAIA 4MTKA 1QJOA 1EY4A 4UY8C 1QWYA 2QCPX 2VL6A 3CU7A 1RTNA 1S40A 2UUBQ 4PMCA 1VQ7A 2JEAI 1UWVA 5ELNA 3EA6A 3HOXB 2LY7A 4IJHA 4ALPA 4L63B 4WORA 4HSPA 3D4DA 5I2XA 4PG3A 4F8MA 3A8JE 1TKWB 2R93G 2O5IC 4A3EH 1L1OB 5ELOA 1SEBD 4A3KB 4NP5A 4DKAC 5M3FG 2F0VA 4RWSC 3HOVG 3RZDH 4FXGC 3H6MA 4CDDC 4CKEA 3K80C 3OW2A 1CKMA 5CMDA 1N32Q 1PYSB 1SR3A 1Y1VB 4JI6L 4X66Q 4O1NA 1A63A 3BVGA 2EZVA 5CR3A 5BN5A 5CV6A 1H9JA 1SMYD 1LTBD 2CWAA 2R7ZB 1IYVA 3NWSA 4UPAA 3EROA 5C4HA 4DUYQ 2R92B 1H9SB 3PUXA 3I4MB 3HOYB 3J7AF 2R93H 1CKNB 2RSNA 2OEOA 4BXXG 4OO1G 3OIQA 1K28A 3GTLB 2I0QA 4ZAIA 5M3FH 1IBLL 1E24A 3HOVH 3UDIA 1SE3A 1LTSD 4OX9Q 1EY9A 2R7FA 4X3TA 4A3EG 4DK1A 3A5UA 1KLGD 1X3QA 3U9OA 4EGVA 4LFCL 3STBD 2I5MX 4GS3A 5D3IB 4PNYA 1EU4A 2TSSA 4A3LG 3GTMH 3CCLA 3HOWG 1N8RC 1XNRL 4BXXH 4OO1H 3TMEA 4KKUA 1F9RA 2AHOB 1TIID 1H95A 1EEFD 3R3OA 4P73A 3IRBA 1HZCA 1S72A 4LF9L 1VQEA 2NVQH 1TWCH 4QQBX 3AU7A 5CORA 1PDQA 1NBWA 3S2DB 2A68C 2NBFA 1JOOA 3ER0A 3MAQA 4IFDG 3EFXD 3NE5B 3NTIA 4A3LH 1B53A 3L9AX 5M5XH 3HOWH 1D7QA 2K32A 2HIVA 1OXVA 4RGMA 4A3KG 3A54A 1XWEA 3EN2A 3VR6A 4XT3B 3S1RB 4HIDA 1VCIA 2V4DA 1SE4A 5JPMC 1ONLA 1XTCD 2F0MA 3DWQA 3F2CA 3HOXH 4UP9A 4JI4L 4A3GB 2F3VA 1K8AC 2MQHA 3QWNA 2R7ZG 3BYYB 1JJGA 2B2VC 1YJWA 2R92G 4DAMA 3I4MG 3CCJA 5D65A 4IFDH 1F2MA 4NKLA 1MD2D 4KY7A 4A3KH 1EY8A 1STNA 2HHHQ 1QZHA 1EY7A 3SK4A 1YJ9A 5I2YA 1ICFB 4L5QA 4UHVA 1DGSA 4HCSA 3FHWA 1CQVA 2DGYA 4JI2Q 3TP8A 3FPUB 1XMOL 1Y1VH 4JG2A 1EZ8A 4X64Q 4GOPB 3HEJA 1ZYRD 1SNPA 1TT2A 4JOIA 2R7ZH 1I4HA 2R92H 3VYTA 1PH7A 3I4MH 2VZAA 1C0AA 3CC7A 1E1TA 4XYOA 2F0WA 3BZKA 4K2KA 2KCCA 2AKWB 3GTLH 1Z6HA 3RNUA 1E2WA 1DXMA 3Q8DA 1F2YA 3FMCA 2JA7B 5KGUA 3VR2A 3SXHA 1XXGA 4JPBW 1PTOH 4ZKBB 4R4QA 2K5DA 3G7LA 3J81j 5HURA 2IWHA 3VYUA 2PI2E 2K33A 5LMUL 3IAYA 1HZ9A 3MC0B 4JI7L 1WCMB 3WOFA 1PYBA 2A69C 2J0TD 4MHEA 4A3IG 4A3MB 3AQQA 2WINB 1KL9A 1MIUA 1K0RA 4BBRB 3G48A 1HHVA 2UXDQ 4G4KA 4K0KL 4EQPA 1G6PA 1FJGL 3M3YB 1ICWA 1DYQA 3BDLA 1I4XA 4IFDI 1HQMC 3P1HA 1B3QA 1HQRD 2Q2UA 2NYZD 3H09A 4B3MQ 1KXLA 1CZWA 4J15A 4A3GG 3S2DH 1YNXA 1OXSC 5EBDA 1K8OA 4G57A 3KF6A 3H3VI 2QGQA 4GKJL 4A3IH 3K5OA 1OO9B 1W3SA 2PPBC 2M00A 2I46A 2EJMA 4N8X1 4JI1Q 3A56A 4RG1A 3S1RH 3CRLC 5IWAQ 1I4PA 3K8AA 1EYAA 4ZUJA 3T1YQ 2V1CC 1KNAA 1LT3D 3M4YA 2CW0D 4R8NA 3UE0A 1LACA 2NTSA 3JAMi 4A3GH 1PRTF 4JI8L 1LM0A 1MJCA 2K5HA 4QIWB 4NXNL 3I90A 4HIKA 4RAUC 3AFQA 5EBCA 3W1GA 1MBYA 2RDGA 4I65A 4GKKQ 3FEWX 4QL5A 2L0CA 2D2CC 1IBML 2B39A 1QB5D 2XN9C 2JA7G 1SN8A 4OWWB 3BDCA 2VQEQ 4DV4L 3RMHA 5CV8A 3VA7A 1WVLA 3PCOB 4CDFC 1CUKA 1EY5A 4B9WA 1PV4A 1SNMA 3SK8A 3JAME 1CZGA 5C3EB 1TU2B 4JYAL 1PH2A 4A3MG 3QG1A 3UE1A 2L4NA 2N49A 3KFUA 3PUYA 1HZAA 1L0YB 3KYHC 1EWIA 1IKLA 4RA8A 1UE5A 1LUZA 1WD1A 1KTKA 1Q90A 1TS4A 1LTAD 3A0JA 2JA7H 1VMPA 1KQSA 1YNJC 3LNNA 2KVMA 1KRTA 2VQFQ 1AZQA 5K36G 3MWYW 4LFCQ 5C0XG 2K05A 4XQJA 3JAMc 3OMCA 2XIWA 4DNRB 1N34L 1I4GA 1G8ZD 4DV0Q 2UUBL 1WCMH 1E2ZA 1VS0A 4WJ4A 4YWKA 4A3MH 1SAPA 1KAAA 1T5XD 1XNRQ 3GTQH 2ZTDA 1X56A 5FO7B 3SHLA 3CC4A 3MXNA 4MN3A 5IODA 2CFMA 3M3YH 1B70B 4HJ8A 5C3XA 2EDGA 3DM1A 4LUOA 1IW7C 1CM9A 3E0EA 4K6DA 4O0AA 2EIFA 3CCVA 2DNCA 1EYGA 5K36H 4N9PA 5C0XH 3OMGA 4QY7A 4GN4B 4U68A 5M3MB 1XMQQ 4LF8Q 3OHXC 3PO3B 1T9HA 3HG9A 3P20A 5DM73 4JI5Q 5AJ3Q 1Q8KA 1RF2D 1T5EA 3HRZC 5FLMG 1N32L 5JEAG 2K5VA 4X66L 3TZUA 4KKSA 4A4IA 1K3BC 3EJIA 1AH9A 3RLOA 5GROA 5C44B 2KHSA 4L5TA 3F1ZA 4DUYL 3P7JA 2EXZA 4DR7L 4OL7A 3ICEA 3M4PA 2JYOA 4JI4Q 3T53B 4CKCA 4B3TL 4M1UB 5IYBG 3KDFA 2JA5G 1E2VA 3NPPA 5FLXL 3CCQA 3FP9A 5C3EG 4OX9L 1I6HB 1N9WA 4DN4M 4FYDA 3AFPA 1UE1A 2B8FA 4X3KA 4HJ7A 3UI2A 2I5LX 3S15B 5CBAE 5FLMH 4RCNA 2R61A 3OW7A 1AEXA 1OXTA 2UU9Q 1YITA 1EYCA 4JOIC 1K0SA 3F8TA 1WTPA 1SYFA 2F4IA 3KBGA 2EXDA 1LTID 3W5OA 4DF7A 3U9SA 2Q8IB 4QIWE 4EQNA 1PZJD 4R4TA 5IYBH 3CQZH 2JA5H 2TMPA 1PH6A 1ZKOA 1V1PB 1B7YB 1ILPA 1S5ED 1VQIA 2VB3X 5C3EH 2F03A 4IOAA 5IT9L 2CWPA 1Y8OB 1PVOA 1R4QB 4H02A 5IE8A 4YCVA 1SNCA 1CSQA 4NW2A 1JB3A 1XPRA 4M8AA 1Q12A 5M5WH 3L7ZC 1B3AA 1NAPA 2JE6I 1YHQA 4DK6C 1I94Q 2R6GA 1U4RA 4HJ5A 3PO2G 4ZQ3A 3PO3G 4GZYC 4B3SL 4A75A 3P75A 1TQOA 5JPNC 1PFMA 1QVFA 4DV3Q 2ZTEA 1IZ6A 2FHTA 2DNEA 3K59A 4DR6Q 3J7ZC 2EY6A 5D14A 4DAYB 1HNWL 5IOCA 2WAQG 3S1NB 4KJOA 2PW5A 1FJGQ 2H4OA 2K14A 3B6YA 5C44G 1BVSA 3CP0A 1R9TB 3CXCA 2KHIA 2XSCA 1G291 2E2JB 2LXJA 2GA4B 3J80L 2OTLA 5IT9c 4G7OC 2EYHA 3H3VC 5M3MH 2XGTA 1V9PA 1AFPA 3PO2H 3PO3H 5EAYA 1QNKA 2VNUD 5JJLA 2SOBA 1SYBA 4A3CG 1TS2A 4IPCA 3RLFA 4JI2L 3L2PA 2EYLA 3FKIB 5CBEE 2HDLA 4LFBL 4X64L 1Y14B 3SGIA 1UEBA 4TVAB 2F0UA 4QF4A 2VW9A 4DR3Q 1FVIA 2FMMA 3H91A 5C44H 4P75A 1VQDA 4LF5Q 1I4QA 3QO2A 1ASYA 4EX5A 3J81i 5EJWA 4P71A 1YBYA 2KHJA 1JWSD 4ID6A 4JBJA 1FGBD 1LTRD 3NQIA 1I3QH 3E6ZX 3W3AA 1STBA 4A3CH 1I6HH 2WAQE 3SDZA 1ENCA 1A62A 4K14A 4BWGB 3S15H 4LF6L 5LL6S 4G7ZC 2CH4A 2N78A 4K5VA 4I7AA 1IBMQ 2PO4A 3F2UA 1SMYC 4XQNA 1ML0D 1EQVA 1K8MA 3M4OH 3J80c 3CHBD 1VQJA 4B08A 1M4VA 2UXBQ 2K7VA 1PYWD 1YHBA 1EIFA 2P5ZX 2RKSA 3CAMA 2A19A 3NHHA 1Z47A 1SE8A 2D9UA 3I8ZA 4KJNA 5JEAJ 4CKBA 1AE2A 3DHQA 3J81E 2CHBD 2IHFA 3A8IE 4IZ8A 1EQTA 3DLLA 3RZOB 5BN4A 4KD3A 4B3ML 2YV5A 5LL6X 1TWFB 3NP8A 2RBMA 4IUVA 4UP8A 1A2TA 1SROA 3STBC 3GTKB 1L0XB 1GUWA 4DXGA 4OIJA 4UDUC 3BVZA 2WKDA 4LW1A 1VQFA 1BCPC 4JCVE 2KENA 1O7IA 2Y0SB 3R2TA 1VQBA
chains in the Genus database with same CATH topology
3KK7A 1SNOA 1LT4D 1PLFA 1GJXA 1STYA 1DOLA 3A8KE 5I6YA 1ET6A 5COYA 2N55A 3V05A 2Z4HA 2VXWA 3D31A 1O7YA 2AUKA 4O42A 4HEDA 3DUZA 1PTOD 1BDOA 3K58A 3SK5A 1DD2A 5CV5A 5M5YB 2O5JC 4ILWA 4RGNA 5C5MA 2RSOA 5A2QE 1EY6A 2RVLA 4BA2I 4KK7A 3HGBA 5KNBA 3GQBA 1JCKB 5EKKA 2OT2A 4ZLTF 5J1ZA 2E74C 2C9OA 1JICA 1U4LA 1H9RA 2KEEA 2SNSA 3K57A 3S2HB 2LFNA 5DM63 2A5HA 1TWGB 5D3DA 2IX1A 1ZYRC 5ELDA 1DCZA 2RDHA 4KMUC 3MXGA 3BZDB 1BCPD 3DEOA 4RKBA 1NR4A 1JE4A 3WOEA 4JBWA 3EVQA 1VF5C 1BBXC 2F0SA 2DY7A 3NBIA 1C4QA 5CV7A 3V96A 2SDFA 1PRTB 3D8GA 3KBXA 4PMWA 1UUPA 5I9OA 3I4NB 4J6HA 3IL8A 1EOTA 2ZXOA 2Q8RE 1HUMA 2L9HA 3VR3A 4K2LA 1ENAA 1TY0A 2EY2A 4KY6A 4LAAA 4DNTB 4BY1B 3TP7A 2JA6B 2HUGA 2NTTA 3PUZA 3T56B 4NMZA 5I4DA 4QUFA 2L55A 4FP5D 5JAVA 2CQAA 4XIGS 3TDQA 4XXEA 1HPCA 1J9OA 1A3VA 3S9WA 3QOLA 4ZRZA 4QUCA 3DWAA 4OO1I 2CW0C 5FKAC 1NUCA 1H9MA 3GTPB 2DN8A 1EL0A 4KD4A 2WKCA 3URYA 4ZK9B 2AWNA 3PIO3 4KHZA 1LLRD 4DFAA 2F0KA 3M7GA 3H94A 3H0GB 1NSNS 1S5CD 4KN4C 3V2TA 2VUMB 3K5LA 3I72A 3K5NA 4RHSA 3Q23A 3MXPA 2KCNA 1TS5A 5F2DA 2YU9B 1GUSA 1CK1A 5G3LF 2G9DA 1ET9A 1Q1BA 2KJXA 4RH6A 3HKZB 4ZYSA 5CC4A 1LT5D 2BA0A 4C3JB 2B2WC 2K28A 5ELFA 2BE5D 1C48A 3PUWA 3MXUA 1IHZA 2KEDA 1I4RA 3T4AC 1G2TA 2JSOA 4KI0A 4CBVA 3BS1A 2C5CA 1BQQT 1EWHA 3GP7A 2FFKB 3RUZA 4CGYB 1II3A 1SE2A 4R9WA 1K83B 2EE1A 1NR2A 2NZ1D 1BOSA 1DM0B 2XVSA 1QILA 4V190 1JORA 1EIGA 3JAML 4P2CB 1OXXK 5JVH3 2EVBA 4F87A 2WV6D 3IKJA 2PCFB 5DEHA 5ELEA 4IALA 4S3SA 1E0BA 1F2LA 1IL8A 3M7NA 3X3NA 4KN7C 3IFTA 4IFDJ 1RDPD 3A7AB 3C2PA 2BDNA 2XWBB 1BO0A 3OWEB 2WB1B 1I50B 2PW7A 3PV0A 5JOBA 1HA6A 3E0JA 4CJ0B 4HMIA 2LKVA 2L1BA 3MZ5A 3G6JB 1CT1D 2A6HD 5DNFA 5EQ0A 2MUYA 4DGZA 1WTXA 1MGSA 2F0GA 1TY2A 5KIXA 1D2BA 2NVYB 1DJRD 2XNAC 2AQ1B 1UNSA 4RKLA 3SEBA 3OIPA 4C3HB 5ELBA 5J22A 5T1IA 2PZUA 4IN3A 4TQUS 4XDXA 1O7LA 3QJYA 1SYDA 1IKMA 1FD7D 5IGBA 2J7ZA 4BBSB 1Q1EA 1CHPD 2E2IB 2IX3A 1PXUA 1LO5D 2B63B 2EYPA 1SDFA 1C8CA 5JVG3 2F0EA 1F9QA 5E1FA 4K6LA 2CVRA 2E2HB 1V8QA 5A35A 1A3TA 3LWEA 1PMRA 4A3DB 4XTCS 5BN3A 2L12A 4A3BB 1SJED 5EKIA 1EU3A 2K6AA 1ENFA 4KTAA 3X3MA 3PIP3 3MA2B 3TP5A 1TWHB 3A55A 3AB9A 1PFBA 5KYLA 1CFMA 4OGQC 3KUPA 1JC7A 1RD9D 2EY5A 3DEPA 2NVTB 1TR5A 4R8IA 4E6IA 2WIIB 2MPMA 2ZXPA 5C0XI 1RTOA 2F0PA 2IW3A 4FF3A 3RD4A 3QIAA 2DY8A 4C3HG 2WACA 2QILA 5EPLA 1ILQA 3TP6A 2ICEC 2PYKA 3C3LA 1YNND 1HTLD 1SYGA 1Q8IA 1D5ZC 1O78A 3FRPB 4U673 2MHVA 4TSSA 3TSSA 4RHRA 2G9HD 3EQLC 2F3WA 3NTKA 2EOTA 1LTGD 2QDBA 5J39A 2B2YA 1FNUA 1F2ZA 5C4ZA 3M85A 2L5TA 1S4ZA 2SEBD 1RODA 2NB0A 1SSOA 2HCCA 4G7HC 2OXPA 3LWUA 1HRJA 2SNMA 4HN7A 3ZYYX 5C0XJ 4H7BA 1KDAA 4RGOS 4CJ1B 2EYMA 1A2UA 3T16A 2RA4A 3NQTA 3RZDB 1PTOC 2LS01 4A3JB 1D6EC 2AQ2B 4L8JA 4NDXA 1U4PA 3SVMA 3J81L 3Q22A 1JWMD 3D6CA 2AQ3B 2O4XA 1BR9A 3FDTA 2HCIA 4ODGA 1KDBA 3CRKC 3S17B 3NSWA 4LK1C 1ZXTA 4LJZC 4X3UA 1D1IA 2FINB 1JOKA 1A15A 2F0DA 1AP0A 1RKNA 3I91A 2PZTA 1QG7A 3N52A 2E2DC 3C1EA 1MSGA 1SFOB 3MFGA 2B2WA 2LMCB 4DXFA 2K01A 3BDOA 3PMFA 3I3CA 1GXDC 2B2UA 2F0HA 3PUVA 2X6GA 1BUVT 2NVQB 1UAPA 2ZXRA 2B2TA 4C56C 1LTTD 2QF7A 4PMBA 3R93A 1NCVA 3J7YW 2EY1A 5A2QL 1WTVA 2OF1A 1LV9A 4A3FB 4DU9A 3KLRA 3MEHA 1GHKA 3GO5A 1Z7TA 4IUQA 2XRQD 4DAVA 2KUMA 1QE6A 3AMUA 4FVMA 4L6TB 3I70A 1U9RA 1XX8A 1V1PA 1SNQA 2N88A 1Q3LA 1GUGA 2ENBA 2ID0A 3W2DA 5I9PA 3IFDA 1FNWA 3K5MA 5IGGA 1X32A 1SJHD 1PRTD 3GTOB 3K6OA 1AN8A 5FK9C 4K8IA 2MGSA 4PQXA 4HAEA 1AW7A 5LHY1 2NUCA 2D5DA 1QOHA 3ERQA 1GUNA 4H0LC 2IX0A 1HTPA 4ABNA 3MHBA 2PMZB 3WDNA 4F88A 4DAYA 1PFNA 1A6XA 4FNFA 4LMQD 1W6JA 3VR5A 2KQ3A 1V1OA 1EIHA 4BA1I 5E3FA 1PTOB 5CGKA 2I07B 1SBBB 5TSSA 2KECA 1B4OA 1Y8PB 2IPKD 1SXTA 4K5WA 3TZDA 3NK9A 1D5MC 1MSHA 1CHQD 1S5DD 2F1MA 4Z9CB 3ONAB 1X3PA 4OHJA 2JP1A 2EYOA 4BS9A 3TN2A 1O7ZA 3Q0AA 4IUTA 4TRDA 1Y1WB 1XYIA 2B2YC 4HCEA 2Z1CA 1JOQA 2F0OA 3BG3A 1TWAB 2BE5C 4X3SA 4A3IB 3NWTA 3HZXA 4K8JA 2NVXB 3VA5A 2EJGC 3MFYA 1HFGA 1GHJA 1BCPB 4N9TA 1WTOA 4FXDA 5IGEA 1FNVA 4WRDA 4IUPA 1GUOA 5JJZA 1Y8NB 2IJ0A 2NN6G 3NXWA 2K5QA 1LT6D 3OSOA 5M9OA 2JEBI 1EY0A 4DAPA 1EFID 1S5BD 3GV3A 3L3OC 5IIFA 3D6WA 3Q6SA 1STEA 3NUCA 1EWCA 4I7ZC 1IYUA 1RHPA 2VB2X 4XT1B 5EPJA 2Q8TA 3N6RA 1CA5A 2M9VA 3BYTB 2NN6H 4IUNA 4H13C 1VDZA 1JQYD 1BF4A 1KABA 5CV4A 4EQOA 3KF8A 1KDCA 3GTGB 1MI2A 2IL8A 3S14B 1D1KA 5K5PA 2L11A 4KY5A 4B9XA 3O13A 2A6HC 3FVQA 2ICIA 4KHVA 3SK6A 1HA5A 2A68D 5T1GA 2F0QA 4J8QA 4HSVA 2B2UC 3GTQB 1G2SA 1WTQA 1EZ6A 3S16B 4OIKA 4KV6A 2KA7A 4Q0FA 4FXKC 1TS3A 2B2TC 4J1MA 1PTOF 2A73B 3MTSA 1J8IA 3ND8A 1H9SA 3Q24A 5I6WA 4ZUIA 5NUCA 5AFWA 3A7LA 3GV6A 1H9KA 1U4MA 1KLUD 4QB4A 2EPBA 1BNZA 2NN6I 1HFNA 1FR3A 4FF4A 4HR7B 1Y69U 1TVXA 2RQXA 4AYBB 4IURA 1V43A 2K03A 2K1BA 2BA1A 4MIUA 1GUTA 3VYSA 1EYDA 1QNUA 2KOLA 4DK0A 1B2TA 1UEAB 2AWOA 1RJTA 1OXUA 1O80A 2MJ8A 1B9NA 1BCPF 3HOUB 2BDOA 5C5LA 1B1ZA 3CKIB 4C3JG 3CQZB 2JA5B 1F77A 4FF1A 3C46A 5CYUA 5KYIA 2A69D 2ZT9C 5CV9A 4TKOB 1WD0A 3HP3A 1F9SA 3KLSA 2X6LA 2QEJC 5M5WB 2RDFA 2Z4IA 3HOZB 1ESRA 1CTMA 1WTRA 4CJ2C 1VMCA 5E4WC 2M2LA 2O2LD 1LABA 1YNNC 4V0BA 4C1NK 4KKTA 4FO2A 4XYQA 2XWJB 5E4XA 2QKIC 4Q5VA 1CA6A 4QMGA 3DXJC 2JA8B 2A6EC 3NTHA 1STAA 4A93B 4EVOA 5IGCA 5FO9B 3OWFA 3OOCA 2E76C 3SR1A 4C1NI 4C3IB 3PO2B 5KNDA 1KNEA 4JK1C 3S1MB 1AZPA 4WJWA 4ME5A 5C3WA 2WAQB 1S5FD 3R2IA 3K7AB 3MVVA 5C4JB 2JXMB 3R8BA 1ESFA 1HXYD 3E5SA 1M8AA 2D62A 4BY7B 1I3QB 2X69A 2NWGA 1SNDA 3VR4A 1DZ1A 2HQEA 5C4XB 3VYRA 5FO8B 5EKLA 1CQFA 2F0FA 2F0LA 1EEID 3BVMA 5IGDA 5JEAH 1JWUD 1WTWA 3M4OB 4WFN3 3GD7A 4F7XA 4H44C 1YNJD 2H1EA 5ELCA 2PZWA 2HDMA 5FLXE 1STHA 4RFBA 2F0NA 1G91A 3KLSX 2YYZA 2K5WA 4PV1C 1F9PA 1GOZA 4HMJA 5C6AA 1RCVD 3I73A 1FYCA 3S1QB 2A6ED 5ISRA 1VF7A 4XQQA 2E75C 1CI3M 3D4WA 1IW7D 3QOJA 3SE0A 4QCLA 1HUNA 4C2MB 3FPPA 2WP8J 4C3IG 2XRSD 4ZKCB 1I6VC 5IT9E 4RGTA 1BXTA 3GTJB 1DONA 2J4XA 4RCOA 1B44D 2PNRC 1JR0D 3I4LA 3J7AV 4CHTB 5KRUA 2IT1A 3NBHA 5IGFA 4A3EB 2F0JA 3OPOA 5DAUA 1A3UA 2B2VA 1B9MA 2MP1A 2PQEA 1QCBD 3DWPA 4FF2A 3HS0C 1HCZA 4IQZA 1STGA 3T51B 3J80E 2K04A 2R93B 5HGTA 3ND9A 2F0IA 2FJ2A 5M3FB 4ULLA 3HOVB 4YIJA 5KEEA 1PRTC 3DMUA 2FMCA 3ITPA 3LX0A 4IUUA 2EYFA 1D5XC 2Z8LA 3D4RA 2AUJD 1B50A 1G6ZA 2R3ZA 1R4PB 1W6KA 5FOBB 3GTMB 5KNCA 2F0TA 1DOKA 4HTHA 2BCOA 5EGTA 5EPKA 4DA2A 2B8GA 1SYCA 3T13A 1TWCB 4K5XA 4Y7NB 3K0YA 1PZID 1DOMA 5G3LD 2BOSA 1SYEA 1ZEQX 3D3RA 2A74C 3C1FA 1PZKD 3QB3A 5M5XB 3HOWB 2EJFC 3TBIB 2EYJA 4UAIA 1QJOA 1EY4A 1QWYA 2QCPX 3CU7A 1RTNA 4PMCA 2JEAI 3EA6A 3HOXB 2LY7A 4WORA 4L63B 4HSPA 3D4DA 5I2XA 4F8MA 3A8JE 1TKWB 2O5IC 1SEBD 4A3KB 4NP5A 2F0VA 4RWSC 4FXGC 3H6MA 4CKEA 5CMDA 1Y1VB 4O1NA 3BVGA 2EZVA 5CR3A 5BN5A 5CV6A 1H9JA 1SMYD 1LTBD 2R7ZB 1IYVA 3NWSA 3EROA 5C4HA 2R92B 1H9SB 3PUXA 3I4MB 3HOYB 3J7AF 2RSNA 2OEOA 4OO1G 3OIQA 3GTLB 4ZAIA 1SE3A 1LTSD 1EY9A 4X3TA 4DK1A 1KLGD 1X3QA 3U9OA 4EGVA 5D3IB 4PNYA 1EU4A 2TSSA 4OO1H 3TMEA 4KKUA 1F9RA 1TIID 1EEFD 3R3OA 3AU7A 5CORA 1PDQA 3S2DB 2A68C 2NBFA 1JOOA 3MAQA 4IFDG 3EFXD 3NE5B 3NTIA 1B53A 3L9AX 2K32A 4RGMA 1OXVA 3A54A 1XWEA 3VR6A 4XT3B 3S1RB 1VCIA 2V4DA 1SE4A 5JPMC 1ONLA 1XTCD 2F0MA 3DWQA 4A3GB 2F3VA 3QWNA 3BYYB 2B2VC 5D65A 4IFDH 1F2MA 4NKLA 1MD2D 4KY7A 1EY8A 1STNA 1EY7A 3SK4A 5I2YA 4HCSA 1CQVA 3TP8A 3FPUB 1EZ8A 3HEJA 1ZYRD 1SNPA 1TT2A 1I4HA 3VYTA 4XYOA 2F0WA 4K2KA 2KCCA 1Z6HA 1E2WA 1DXMA 1F2YA 3FMCA 2JA7B 5KGUA 3VR2A 3SXHA 1XXGA 1PTOH 4ZKBB 2K5DA 3G7LA 5HURA 2IWHA 3VYUA 2K33A 3IAYA 3MC0B 1WCMB 3WOFA 4MHEA 2A69C 2J0TD 4A3MB 2WINB 4BBRB 1HHVA 4G4KA 4EQPA 3M3YB 1ICWA 1DYQA 3BDLA 1I4XA 4IFDI 1HQMC 3P1HA 1HQRD 2NYZD 3H09A 1CZWA 1OXSC 5EBDA 1K8OA 4G57A 3K5OA 1OO9B 2PPBC 2M00A 2I46A 2EJMA 3A56A 3CRLC 1I4PA 1EYAA 4ZUJA 1KNAA 1LT3D 3M4YA 2CW0D 4R8NA 1LACA 2NTSA 1PRTF 4QIWB 3I90A 4RAUC 5EBCA 1MBYA 2RDGA 4I65A 3FEWX 2L0CA 2D2CC 2B39A 1QB5D 2XN9C 3BDCA 3RMHA 5CV8A 3VA7A 1WVLA 1EY5A 4B9WA 1SNMA 3SK8A 3JAME 1CZGA 5C3EB 1TU2B 3QG1A 2L4NA 3PUYA 1L0YB 1IKLA 4RA8A 1WD1A 1KTKA 1Q90A 1TS4A 1LTAD 1VMPA 1YNJC 3LNNA 2KVMA 1AZQA 5K36G 3MWYW 5C0XG 2K05A 4XQJA 3OMCA 2XIWA 4DNRB 1I4GA 1G8ZD 1E2ZA 1SAPA 1KAAA 1T5XD 5FO7B 3SHLA 3MXNA 4MN3A 5IODA 5C3XA 2EDGA 3DM1A 1IW7C 1CM9A 4K6DA 2DNCA 5K36H 4N9PA 5C0XH 3OMGA 5M3MB 4U68A 3OHXC 3PO3B 3HG9A 3P20A 5DM73 1RF2D 1T5EA 3HRZC 5JEAG 3TZUA 4KKSA 3EJIA 5C44B 2KHSA 2EXZA 3P7JA 4OL7A 2JYOA 3T53B 4CKCA 4M1UB 1E2VA 3NPPA 5FLXL 1I6HB 4DN4M 4FYDA 2B8FA 4X3KA 3UI2A 3S15B 5CBAE 4RCNA 2R61A 3OW7A 1AEXA 1OXTA 1EYCA 1WTPA 1SYFA 2F4IA 3KBGA 1LTID 4DF7A 3U9SA 2Q8IB 4EQNA 1PZJD 2TMPA 1ZKOA 1V1PB 1ILPA 1S5ED 2VB3X 2F03A 5IT9L 1Y8OB 1R4QB 1SNCA 4NW2A 1JB3A 4M8AA 1Q12A 3L7ZC 1B3AA 1NAPA 2JE6I 2R6GA 1U4RA 4ZQ3A 4GZYC 3P75A 1TQOA 5JPNC 1PFMA 2FHTA 2DNEA 3K59A 2EY6A 5D14A 5IOCA 3S1NB 4KJOA 2PW5A 2H4OA 1R9TB 2XSCA 1G291 2E2JB 2GA4B 3J80L 4G7OC 2EYHA 3H3VC 1AFPA 1QNKA 2VNUD 2SOBA 1SYBA 1TS2A 3RLFA 2EYLA 3FKIB 5CBEE 2HDLA 2F0UA 4QF4A 2FMMA 3H91A 1I4QA 3QO2A 5EJWA 4ID6A 1JWSD 1FGBD 1LTRD 3NQIA 3E6ZX 3W3AA 1STBA 3SDZA 1ENCA 4K14A 4BWGB 5LL6S 4G7ZC 4K5VA 2PO4A 3F2UA 1SMYC 4XQNA 1ML0D 1EQVA 1K8MA 3CHBD 4B08A 1M4VA 2K7VA 1PYWD 2RKSA 3NHHA 1Z47A 2D9UA 3I8ZA 4KJNA 5JEAJ 4CKBA 3J81E 3DHQA 2CHBD 3A8IE 4IZ8A 1EQTA 3RZOB 5BN4A 4KD3A 5LL6X 1TWFB 3NP8A 2RBMA 4IUVA 1A2TA 3GTKB 1L0XB 1GUWA 4DXGA 4OIJA 4UDUC 3BVZA 2WKDA 1BCPC 2Y0SB 3R2TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K6D A;  5CV7 A;  2F0M A;  3D8G A;  1SNO A;  5IOC A;  3NUC A;  2WAC A;  2M00 A;  3E5S A;  4N9P A;  1JOK A;  3OMG A;  1STY A;  5I9O A;  2F0D A;  4KJO A;  2F3V A;  2PW5 A;  3MHB A;  4NP5 A;  2F0V A;  5CC4 A;  3TP6 A;  1RKN A;  5I6Y A;  2PZT A;  2PYK A;  1SND A;  4J6H A;  3H6M A;  4RKL A;  1EYA A;  2HQE A;  4ZUJ A;  1STG A;  2KQ3 A;  1SYG A;  3C1E A;  5EKL A;  1IHZ A;  4IUN A;  4K2L A;  1F2M A;  4R8N A;  2F0F A;  5E3F A;  1ENA A;  2F0L A;  2EY2 A;  4KY6 A;  2EYH A;  4KY7 A;  4LAA A;  4NKL A;  5C5L A;  5HGT A;  1EY8 A;  5J22 A;  5IGD A;  3TP7 A;  5CR3 A;  1STN A;  1KAB A;  2F0I A;  2PZU A;  5CV6 A;  5CGK A;  2SOB A;  5CV4 A;  1SYB A;  3EJI A;  1EY7 A;  1SYD A;  3SK4 A;  4EQO A;  2KHS A;  4YIJ A;  1KDC A;  4F7X A;  5KEE A;  5IGB A;  2EXZ A;  4K5W A;  4OL7 A;  3ERO A;  3DMU A;  3PMF A;  2F3W A;  4NMZ A;  5C4H A;  2EYL A;  3ITP A;  5KYI A;  3TP8 A;  3LX0 A;  5K5P A;  5CV9 A;  3RUZ A;  3NK9 A;  3SK5 A;  4I65 A;  2QDB A;  4KY5 A;  2OEO A;  2PZW A;  1EZ8 A;  2F0H A;  4B9X A;  5J39 A;  1II3 A;  2F0U A;  4QF4 A;  3HEJ A;  1STH A;  2EYF A;  5CV5 A;  1SNP A;  1TT2 A;  2F0N A;  5JAV A;  2EYP A;  1F2Z A;  3SK6 A;  4KHV A;  2RDF A;  1EY9 A;  5C4Z A;  2EYO A;  3BDC A;  2F0E A;  3U9O A;  2F0Q A;  2F0T A;  4ID6 A;  5CV8 A;  5E1F A;  4TRD A;  2F0W A;  5C5M A;  4K2K A;  4HTH A;  4PMB A;  1AEX A;  4HMJ A;  5C6A A;  1A3V A;  1EY6 A;  2EY1 A;  1EY5 A;  3QOL A;  4B9W A;  3S9W A;  1JOR A;  1EYC A;  1JOQ A;  1SNM A;  2F0O A;  1STB A;  3SK8 A;  5ISR A;  1EZ6 A;  1F2Y A;  4PNY A;  2OXP A;  5EGT A;  5KGU A;  2OF1 A;  4KV6 A;  1SYF A;  1ENC A;  5EKK A;  3SXH A;  4DU9 A;  1A3T A;  2SNM A;  3D4W A;  3QOJ A;  4DF7 A;  3MEH A;  4K14 A;  1NUC A;  4EQN A;  4H7B A;  1SYC A;  4K5V A;  3HZX A;  4K8J A;  3T13 A;  4J1M A;  3VA5 A;  4QMG A;  5J1Z A;  5DEH A;  1KDA A;  4K5X A;  3TME A;  5HUR A;  1EQV A;  4IAL A;  4KD4 A;  4ZUI A;  5I6W A;  2EYM A;  1A2U A;  4S3S A;  3T16 A;  1STA A;  3NQT A;  5NUC A;  4KTA A;  3R3O A;  1SYE A;  4N9T A;  2SNS A;  4EVO A;  2RKS A;  3C1F A;  3NHH A;  3TP5 A;  5IGC A;  1U9R A;  3OWF A;  1SNC A;  3QB3 A;  4QB4 A;  4KJN A;  4NDX A;  5IGE A;  4DFA A;  2EYJ A;  3SR1 A;  1SNQ A;  2F0K A;  3DHQ A;  3OMC A;  4WRD A;  4EQP A;  1NSN S;  2ENB A;  3V2T A;  1EY4 A;  4IZ8 A;  3BDL A;  5I9P A;  3P1H A;  4RKB A;  5KYL A;  4PMC A;  4KD3 A;  3D6C A;  1JOO A;  5IGG A;  2O4X A;  2PW7 A;  5KRU A;  1KAA A;  3NXW A;  3NP8 A;  5JOB A;  2RBM A;  5IGF A;  1A2T A;  3OSO A;  3EVQ A;  4HMI A;  4K8I A;  2EY5 A;  4ODG A;  2F0J A;  5M9O A;  3SHL A;  2LKV A;  3MXP A;  1KDB A;  4ZQ3 A;  5IOD A;  4ME5 A;  1TR5 A;  1TQO A;  3MZ5 A;  1EY0 A;  3P75 A;  5DAU A;  5C3W A;  1A3U A;  4WOR A;  4E6I A;  2NUC A;  4MIU A;  3D4D A;  4G57 A;  2F0S A;  3MVV A;  4DGZ A;  5F2D A;  5IIF A;  5C3X A;  2F0G A;  2F0P A;  4F8M A;  1EYD A;  3ERQ A;  2EY6 A;  5KIX A;  2PQE A; 
#chains in the Genus database with same CATH topology
 3KK7 A;  2UUA L;  1SNO A;  2ZJQ A;  1LT4 D;  1PLF A;  4JI1 L;  1GJX A;  1STY A;  1DOL A;  5IWA L;  1N34 Q;  3A8K E;  3GTJ H;  5I6Y A;  1ET6 A;  2KCM A;  3T1Y L;  5COY A;  2N55 A;  3V05 A;  4PZ6 A;  4DNI A;  1N33 Q;  2Z4H A;  4R1J A;  1YHA A;  2VXW A;  3D31 A;  3FKI G;  3K81 C;  3KF8 B;  2QEX A;  3S1N H;  1PHJ A;  1O7Y A;  3OTO Q;  2AUK A;  4O42 A;  1R9T H;  4HED A;  3DUZ A;  1N36 L;  3E9H A;  1EOV A;  1PTO D;  1BDO A;  3K58 A;  2E2J H;  5L37 A;  3SK5 A;  4GKK L;  4X62 Q;  1DD2 A;  1WOC A;  5CV5 A;  4DV7 Q;  5E7N A;  5M5Y B;  1JJC B;  1B8A A;  2VQE L;  3HKS A;  2O5J C;  3FKI H;  4ILW A;  4RGN A;  2OCE A;  2UUC Q;  5C5M A;  2RSO A;  5A2Q E;  1EY6 A;  2RVL A;  4R4O A;  4BA2 I;  4KK7 A;  3ULL A;  3HGB A;  5KNB A;  3GQB A;  4DR7 Q;  1JCK B;  5EKK A;  2OT2 A;  4B3T Q;  4ZLT F;  5J1Z A;  2E74 C;  2C9O A;  1JIC A;  1U4L A;  1H9R A;  2KEE A;  2VQF L;  4JI0 Q;  2SNS A;  3K57 A;  3S2H B;  2LFN A;  5DM6 3;  2A5H A;  1TWG B;  5D3D A;  2IX1 A;  1ZYR C;  3RR5 A;  5ELD A;  4DV0 L;  1DCZ A;  2RDH A;  4KMU C;  3MXG A;  3BZD B;  1BCP D;  3DEO A;  4RKB A;  1NR4 A;  2Y0S G;  1VQ8 A;  3PGZ A;  1JE4 A;  2VS1 A;  1HR0 W;  3WOE A;  3M9B A;  4JBW A;  4WJ3 M;  3EVQ A;  1VF5 C;  4LF7 Q;  1BBX C;  1HNX Q;  1K9M C;  5DLQ E;  3RZO H;  2F0S A;  2DY7 A;  3NBI A;  3ULJ A;  1C4Q A;  1TWF H;  3HOX G;  3CCR A;  5CV7 A;  3V96 A;  3D8G A;  1PRT B;  2SDF A;  1KAW A;  2ZTC A;  3CD6 A;  3GTK H;  3KBX A;  4Y7N H;  4PMW A;  1UUP A;  5I9O A;  1XMQ L;  4LF8 L;  3AEV A;  4MZ9 A;  2DJG C;  2BH8 A;  3I4N B;  3TRZ A;  4J6H A;  5LMN W;  3IL8 A;  1EOT A;  4JI5 L;  5AJ3 L;  2ZXO A;  2Q8R E;  1HUM A;  2L9H A;  3VR3 A;  4B3R Q;  3H15 A;  4K2L A;  1ENA A;  1TY0 A;  2EY2 A;  4KY6 A;  4LAA A;  3TEH B;  4DNT B;  4BY1 B;  3T1H Q;  3TP7 A;  4B3S Q;  2JA6 B;  2GN5 A;  2HUG A;  1K8G A;  2NTT A;  3PUZ A;  3T56 B;  1GD7 A;  4NMZ A;  1Y1V G;  1HNW Q;  5I4D A;  3E3X A;  4QUF A;  2Y0S E;  2L55 A;  4FP5 D;  5JAV A;  1EFW A;  3KJP A;  3HOY G;  2HIX A;  2CQA A;  4NPS A;  1BBU A;  3ULP A;  4XIG S;  3TDQ A;  4XXE A;  1HPC A;  1J9O A;  2ZJR A;  2UU9 L;  1A3V A;  3S9W A;  3QOL A;  1GVP A;  2DUD A;  4ZRZ A;  4QUC A;  4DR2 L;  3DWA A;  2YTX A;  3MXN B;  4OO1 I;  2CW0 C;  5FKA C;  4AH6 A;  1NUC A;  1EQQ A;  4LFB Q;  1H9M A;  4YWM A;  3TS2 A;  3G4S A;  5HY6 A;  3GTP B;  2DN8 A;  1EL0 A;  4KD4 A;  1HZB A;  2WKC A;  3URY A;  4ZK9 B;  4YHH L;  1JMC A;  3HOY H;  2AWN A;  4NXM L;  3PIO 3;  4KHZ A;  1LLR D;  4DFA A;  2F0K A;  2VY3 A;  4UP7 A;  2F52 A;  3CMA A;  3M7G A;  3H0G B;  3H94 A;  1NSN S;  1S5C D;  4KN4 C;  3V2T A;  4GLA C;  2VUM B;  3K5L A;  3I72 A;  3EIV A;  2JK8 A;  1I94 L;  3OYY A;  1J5E L;  3S2H H;  3K5N A;  2RCN A;  1CKO A;  3PIO A;  4LF6 Q;  4RHS A;  1TWG H;  2CCZ A;  3Q23 A;  3MXP A;  2KCN A;  4DV3 L;  1Q81 C;  1TS5 A;  4DR6 L;  5F2D A;  2YU9 B;  2NZH A;  1GUS A;  1CK1 A;  5G3L F;  2G9D A;  1ET9 A;  1Q1B A;  2KJX A;  4RH6 A;  3U4V A;  1PH4 A;  4BY1 G;  2JA6 G;  3G6E A;  3HKZ B;  1XNQ L;  3ERS X;  4ZYS A;  5CC4 A;  1Q86 C;  1LT5 D;  2BA0 A;  1X54 A;  4C3J B;  2OWO A;  2B2W C;  2K28 A;  5ELF A;  2BE5 D;  1L1O A;  3PUW A;  1C48 A;  3MXU A;  1IHZ A;  2KED A;  1I4R A;  5GAD C;  3T4A C;  1G2T A;  2MNA A;  2JSO A;  4KI0 A;  4JBK A;  4CBV A;  3BS1 A;  1XTD A;  2C5C A;  1BQQ T;  1EWH A;  3GP7 A;  1VQK A;  2FFK B;  3A5Z B;  2UUA Q;  3RUZ A;  2Q2H A;  4CGY B;  1II3 A;  4BY1 H;  1SE2 A;  2JA6 H;  4DR3 L;  4R9W A;  1K83 B;  2EE1 A;  1NR2 A;  2C35 B;  4LF5 L;  5J3B A;  2RCF A;  2NZ1 D;  1BOS A;  1NTG A;  2PI2 A;  1VQN A;  1CKN A;  1DM0 B;  3PF5 A;  2XVS A;  4APV A;  2D0O A;  1EUJ A;  1QIL A;  1X3G A;  4V19 0;  3LGJ A;  1JOR A;  2K75 A;  4LUZ A;  1EIG A;  3CCE A;  3JAM L;  4P2C B;  1N36 Q;  1OXX K;  2Z6K C;  5JVH 3;  2EVB A;  4F87 A;  1YZ6 A;  1VQ4 A;  2G5D A;  1MKH A;  2WV6 D;  3IKJ A;  2PCF B;  5DEH A;  5ELE A;  2VUM G;  5GAG C;  4IAL A;  4S3S A;  1E0B A;  2UXB L;  1F2L A;  1IL8 A;  3M7N A;  3X3N A;  4KN7 C;  3IFT A;  4IFD J;  2HD3 A;  2OQ0 A;  5HGQ A;  1RDP D;  3GTP H;  3A7A B;  2D0P A;  3S24 A;  3NBH B;  5H1S E;  3C2P A;  2BDN A;  2XWB B;  1WCM G;  1BO0 A;  3OWE B;  1S3O A;  1VQ6 A;  1GO3 E;  2WB1 B;  4BBR G;  1I50 B;  2PW7 A;  3PV0 A;  5JOB A;  1HA6 A;  3E0J A;  4CJ0 B;  4HMI A;  2LKV A;  4GN3 B;  2L1B A;  2HT1 A;  3H0G H;  4HIO A;  3MZ5 A;  2VUM H;  3G6J B;  1CT1 D;  2A6H D;  5DNF A;  5EQ0 A;  2MUY A;  4DGZ A;  4JVZ A;  1WTX A;  1MGS A;  2F0G A;  1TY2 A;  1PH9 A;  5KIX A;  1W2B A;  2Q2T A;  1XPO A;  1D2B A;  2NVY B;  1DJR D;  2XNA C;  2AQ1 B;  4DPG A;  1N33 L;  1KRS A;  1UNS A;  4RKL A;  1K3R A;  4DV5 Q;  4OWX B;  3SEB A;  4BBR H;  1MJE A;  3OIP A;  4YY3 Q;  2RF4 A;  4C3H B;  4DR1 Q;  5ELB A;  5J22 A;  2NZO A;  1VQC A;  3OTO L;  1JB7 A;  4IN3 A;  2PZU A;  2OQK A;  4TQU S;  5T1I A;  4XDX A;  1O7L A;  3QJY A;  1SYD A;  4OXP A;  1IKM A;  1FD7 D;  5IGB A;  2J7Z A;  4BBS B;  4X62 L;  4GNX C;  1Q1E A;  1CHP D;  4GLV B;  2E2I B;  2IX3 A;  3TS0 A;  1M1K C;  1PXU A;  1LO5 D;  4DV7 L;  2B63 B;  1FGU A;  2EYP A;  1SDF A;  1C8C A;  5JVG 3;  3I4O A;  2LXK A;  2F0E A;  4DV2 Q;  4GOP A;  2UUC L;  1F9Q A;  5E1F A;  4LF4 Q;  4K6L A;  1K83 H;  2CVR A;  1RL2 A;  1QUQ B;  2IY5 B;  2E2H B;  1X3E A;  3PQI A;  1VQM A;  1V8Q A;  5A35 A;  4DR5 Q;  1A3T A;  3LWE A;  1PMR A;  4A3D B;  4XTC S;  5BN3 A;  2L12 A;  3G71 A;  1VQ5 A;  4A3B B;  1SJE D;  2WB1 G;  5EKI A;  2PQA B;  1EU3 A;  1WFQ A;  2K6A A;  1ENF A;  3W1B A;  4KTA A;  4JI0 L;  3X3M A;  3PIP 3;  3MA2 B;  4QJF A;  1IYJ B;  3TP5 A;  1TWH B;  1Q7Y C;  3A55 A;  1BBW A;  3AB9 A;  2FXQ A;  2BH2 A;  3NEM A;  1PFB A;  5KYL A;  1CFM A;  4DR2 Q;  4OGQ C;  2F4V Q;  3KUP A;  3PIP A;  2K50 A;  1JC7 A;  3I2Z A;  1RD9 D;  4LF7 L;  2EY5 A;  3DEP A;  2NVT B;  1HNX L;  1TR5 A;  4R8I A;  4E6I A;  2WII B;  2MPM A;  2ZXP A;  5C0X I;  2ASB A;  1RTO A;  4YHH Q;  2F0P A;  1I50 H;  2IW3 A;  3RD4 A;  4NXM Q;  4FF3 A;  3QIA A;  4PZ7 A;  4HIM A;  2DY8 A;  4C3H G;  2WAC A;  2QIL A;  5EPL A;  1ILQ A;  1Q82 C;  1E1O A;  3TP6 A;  2JJQ A;  2ICE C;  2PYK A;  4HJA A;  3C3L A;  1JT8 A;  1J5E Q;  1YNN D;  4B3R L;  1HTL D;  1SYG A;  4BBS G;  1Q8I A;  2AMC B;  5M3M G;  2WB1 E;  1D5Z C;  1O78 A;  2NVY H;  4YCU A;  3VDY A;  3FRP B;  4U67 3;  3T1H L;  1U5K A;  2B63 G;  2MHV A;  4TSS A;  3TSS A;  4RHR A;  2G9H D;  2ZJP A;  1ASZ A;  1WYD A;  2JA9 A;  3EQL C;  2F3W A;  3NTK A;  4LWC A;  1L1O C;  2EOT A;  1LTG D;  2QDB A;  4C3H H;  3TRE A;  5J39 A;  2B2Y A;  1PFS A;  1FNU A;  2HQL A;  1XNQ Q;  1LTL A;  1F2Z A;  5C4Z A;  3M85 A;  2L5T A;  4BBS H;  1AE3 A;  3HFZ B;  1S4Z A;  2E2I H;  3K0X A;  4L5S A;  2B63 H;  2SEB D;  1ROD A;  2NB0 A;  4A3B G;  1SSO A;  2HCC A;  4X65 Q;  4G7H C;  2OXP A;  1QVG A;  3LWU A;  1G51 A;  1HRJ A;  2SNM A;  2E5L Q;  1X9N A;  1U0L A;  4HN7 A;  3ZYY X;  1P8L A;  5C0X J;  4H7B A;  1NJI C;  1UE7 A;  1KDA A;  4RGO S;  4CJ1 B;  2EYM A;  1NMF A;  1A2U A;  3T16 A;  1I5F A;  2RA4 A;  3NQT A;  5JJI A;  1NE3 A;  3RZD B;  1PTO C;  2LS0 1;  4A3J B;  1D6E C;  2AQ2 B;  4A3D H;  2Z0S A;  4L8J A;  4NDX A;  1U4P A;  3SVM A;  3J81 L;  3Q22 A;  4A3B H;  1JWM D;  3D6C A;  2AQ3 B;  2O4X A;  4IO9 A;  1BR9 A;  1TWH H;  2HCI A;  3FDT A;  4DUZ L;  4ODG A;  1KDB A;  3CRK C;  3S17 B;  4MNO A;  3NSW A;  1M90 C;  4LK1 C;  1ZXT A;  1NMG A;  4LJZ C;  1YVC A;  4X3U A;  1D1I A;  3L0O A;  2FIN B;  2ZM6 Q;  1JOK A;  1A15 A;  2F0D A;  1WTH A;  1AP0 A;  1RKN A;  2RHQ B;  3I91 A;  2PZT A;  1QG7 A;  3N52 A;  2E2D C;  3C1E A;  1MSG A;  1SFO B;  3KLW A;  3MFG A;  2CQO A;  4YWL A;  4KHP Q;  2B2W A;  2A8V A;  2LMC B;  4DXF A;  2K01 A;  2H5X A;  3J81 c;  3BDO A;  3PMF A;  1C9O A;  3I3C A;  1GXD C;  2B2U A;  2F0H A;  3PUV A;  2X6G A;  1BUV T;  2NVQ B;  1UAP A;  3AYH B;  2DJF C;  3MEF A;  2ZXR A;  1HJP A;  2B2T A;  4C56 C;  1LTT D;  3CC2 A;  1NNX A;  2QA4 A;  2QF7 A;  4PMB A;  3R93 A;  1NCV A;  3J7Y W;  2EY1 A;  4YCW A;  5A2Q L;  4N8F A;  1PH8 A;  1WTV A;  2OF1 A;  1LV9 A;  5FJ8 G;  4A3J G;  4AQY Q;  5IP7 G;  4A3F B;  4DU9 A;  3KLR A;  3MEH A;  5GAE C;  1GHK A;  3U58 A;  1FL0 A;  2I5H A;  1Z7T A;  3GO5 A;  4GOP C;  4IUQ A;  2B29 A;  4PZ8 A;  2XRQ D;  4JI3 Q;  4JC0 A;  4DAV A;  2KUM A;  2Z6K A;  1QE6 A;  1IBK Q;  3AMU A;  4FVM A;  4L6T B;  1RIP A;  3I70 A;  4EQ5 A;  1U9R A;  1XX8 A;  4ZCK A;  1V1P A;  1SNQ A;  2N88 A;  1Q3L A;  4DV1 Q;  1GUG A;  2ENB A;  2ID0 A;  3W2D A;  3CF5 A;  5JJK A;  1X6O A;  5I9P A;  3IFD A;  1FNW A;  4GLX A;  3K5M A;  5IGG A;  5FJ8 H;  4A3J H;  5IP7 H;  1X32 A;  1SJH D;  1PRT D;  3GTO B;  1TXY A;  3KF6 B;  3K6O A;  1AN8 A;  5FK9 C;  1E7Z A;  4K8I A;  1PH1 A;  1IL2 A;  2MGS A;  4PQX A;  4HAE A;  1AW7 A;  5LHY 1;  1GKH A;  2NUC A;  2D5D A;  5BR8 L;  1QOH A;  3F2B A;  1K73 C;  3ERQ A;  1GUN A;  4H0L C;  1MHW C;  2IX0 A;  3WWV A;  1YIJ A;  1HTP A;  4ABN A;  1E22 A;  3MHB A;  3NEL A;  2PMZ B;  3WDN A;  2YTV A;  4F88 A;  3S17 H;  4DAY A;  1PFN A;  1A6X A;  3BU2 A;  1X55 A;  1W6J A;  4FNF A;  4LMQ D;  3DM3 A;  3VR5 A;  4DV5 L;  2KQ3 A;  1V1O A;  4JBM A;  4YY3 L;  1EIH A;  4BA1 I;  4DR1 L;  2QDL A;  5E3F A;  1UE6 A;  1PTO B;  2K52 A;  3CME A;  4KLK A;  5CGK A;  2I07 B;  1L2F A;  1SBB B;  3GDE A;  5TSS A;  1HH2 P;  2KEC A;  1B4O A;  1Y8P B;  2IPK D;  1SXT A;  4K5W A;  2R7D A;  1SFO H;  3TZD A;  3NK9 A;  1D5M C;  1MSH A;  1CHQ D;  2KBN A;  2MO0 A;  4IOC A;  1SRU A;  1S5D D;  2F1M A;  5GAH C;  4Z9C B;  3ONA B;  1X3P A;  1WJJ A;  4OHJ A;  4DK3 C;  2JP1 A;  4GNX A;  4A3F G;  4DV2 L;  2EYO A;  4BS9 A;  3TN2 A;  1O7Z A;  3Q0A A;  4LF4 L;  4IUT A;  4TRD A;  3CCU A;  1Y1W B;  1XYI A;  2B2Y C;  4HCE A;  2Z1C A;  1JOQ A;  2F0O A;  3BG3 A;  1TWA B;  5IYD G;  2BE5 C;  4DR5 L;  4X3S A;  1C7Y A;  1YI2 A;  4A3I B;  3NWT A;  2OTJ A;  2QW7 A;  3HZX A;  4K8J A;  2NVX B;  3VA5 A;  2EJG C;  3MFY A;  3JC6 6;  1X65 A;  1HFG A;  2GVB A;  1GHJ A;  4A3F H;  1BCP B;  4N9T A;  1WTO A;  1LYL A;  4FXD A;  5IGE A;  1FNV A;  4WRD A;  5M5Y H;  4IUP A;  3CW2 C;  1WI5 A;  1GUO A;  2F4V L;  5IYD H;  5JJZ A;  1Y8N B;  2IJ0 A;  2NN6 G;  5GQO A;  3NXW A;  2K5Q A;  1LT6 D;  4JV5 Q;  3OSO A;  5M9O A;  4QGU A;  2KCT A;  2JEB I;  1EY0 A;  4DAP A;  4DR4 Q;  1EFI D;  1S5B D;  3GV3 A;  3L3O C;  5IIF A;  3D6W A;  3Q6S A;  3GTO H;  1STE A;  3NUC A;  1EWC A;  4I7Z C;  1HNZ Q;  1IYU A;  1RHP A;  2VB2 X;  4XT1 B;  5EPJ A;  2Q8T A;  3H3V H;  1VQH A;  3N6R A;  1CA5 A;  4DV6 L;  2M9V A;  3BYT B;  2NN6 H;  4IUN A;  4DUZ Q;  4H13 C;  1VQ9 A;  1VDZ A;  4AIM A;  1JQY D;  1BKB A;  5IYC G;  3I4N G;  3CPW A;  1BF4 A;  1KAB A;  5CV4 A;  3KDF B;  4EQO A;  3KF8 A;  1KDC A;  3GTG B;  1MI2 A;  2IL8 A;  2N3S A;  3S14 B;  1D1K A;  5K5P A;  2L11 A;  1SMX A;  4KY5 A;  1Y1W G;  4B9X A;  3O13 A;  3UDX A;  3UDG A;  2A6H C;  5IP9 G;  3FVQ A;  2ICI A;  4KHV A;  3SK6 A;  1HA5 A;  2A68 D;  1V1Q A;  2PMZ E;  4OEL B;  5T1G A;  2XTI A;  4R4I A;  2F0Q A;  4J8Q A;  4HSV A;  2CKZ B;  2B2U C;  3GTQ B;  5IYC H;  3I4N H;  1G2S A;  4X65 L;  1WTQ A;  2K5N A;  1EZ6 A;  3S16 B;  4OIK A;  4KV6 A;  2KA7 A;  2E5L L;  2CH4 W;  4POG A;  4Q0F A;  4FXK C;  1TS3 A;  1YEZ A;  2B2T C;  1Y1W H;  4J1M A;  1PTO F;  2A73 B;  3MTS A;  1J8I A;  3ND8 A;  1H9S A;  3Q24 A;  5I6W A;  4ZUI A;  5IP9 H;  1TWA H;  5NUC A;  5AFW A;  4GN5 A;  3A7L A;  3GV6 A;  1H9K A;  3KJO A;  1U4M A;  1XPU A;  2ATW A;  1KLU D;  4MTN A;  4QB4 A;  2NVX H;  2EPB A;  1BNZ A;  3KOJ A;  2NN6 I;  1KHI A;  2E8G A;  1HFN A;  2GVA A;  4R4C A;  1FR3 A;  1PH5 A;  4FF4 A;  4HR7 B;  1Y69 U;  1TVX A;  2RQX A;  4IJL A;  3M4Q A;  3U50 C;  3BZC A;  4AYB B;  1VQO A;  3H0G G;  4IUR A;  1V43 A;  2K03 A;  2K1B A;  4ME3 A;  2BA1 A;  4MIU A;  1GUT A;  3VYS A;  1EYD A;  1JJ2 A;  2UXC L;  2ZM6 L;  1QNU A;  2KOL A;  3UDF A;  4DK0 A;  1B2T A;  1UEA B;  2AWO A;  4X6A H;  1GM5 A;  1RJT A;  1OXU A;  1O80 A;  2MJ8 A;  4IPD A;  4CDC C;  1B9N A;  1BCP F;  3HOU B;  2BDO A;  3HKZ G;  1HR0 L;  5C5L A;  4KHP L;  1YJN A;  1B1Z A;  4JI6 Q;  3CKI B;  4C3J G;  4LNQ A;  3CQZ B;  2JA5 B;  1F77 A;  4FF1 A;  5BR8 Q;  3C46 A;  3BJU A;  5CYU A;  5KYI A;  2A69 D;  2ZT9 C;  4CDE C;  5CV9 A;  4TKO B;  4IPH A;  1WD0 A;  3HP3 A;  1F9S A;  2PNH A;  3KLS A;  1VQP A;  2X6L A;  4O2D A;  2QEJ C;  5M5W B;  2RDF A;  1IBL Q;  2YU9 H;  2Z4I A;  3HOZ B;  5LMN L;  3GTG H;  3S14 H;  1ESR A;  1CTM A;  1WTR A;  4LFA L;  4CJ2 C;  1VMC A;  4C3J H;  5E4W C;  2M2L A;  2O2L D;  4AQY L;  1LAB A;  1YNN C;  4V0B A;  4C1N K;  4KKT A;  2JN4 A;  3A74 A;  4FO2 A;  4XYQ A;  2XWJ B;  5E4X A;  2QKI C;  3PF4 A;  4Q5V A;  1CA6 A;  4QMG A;  4JI3 L;  2ES2 A;  3DXJ C;  2JA8 B;  3HKZ E;  2A6E C;  1A0I A;  3S16 H;  3NTH A;  1STA A;  4POF A;  1IBK L;  1JE5 A;  1KIX A;  4A93 B;  4EVO A;  4AYB G;  5IGC A;  5FO9 B;  3OWF A;  3OOC A;  2E76 C;  4DV1 L;  4LF9 Q;  3SR1 A;  4C1N I;  4C3I B;  1NY4 A;  3PO2 B;  4L5R C;  1EQR A;  5KND A;  3K7U C;  1KNE A;  3EBE A;  4JK1 C;  4OEM B;  1IXR A;  1KD1 C;  3S1M B;  1AZP A;  1KC8 C;  3CCS A;  4WJW A;  1Z9F A;  4ME5 A;  2WAQ B;  5C3W A;  1P16 A;  2EQS A;  1S5F D;  3R2I A;  1EIY B;  3K7A B;  3MVV A;  5C4J B;  2JXM B;  3HOU G;  3R8B A;  3F2D A;  1ESF A;  1HXY D;  3E5S A;  2JQO A;  1M8A A;  2D62 A;  3QR8 A;  4BY7 B;  1I3Q B;  2X69 A;  1Q46 A;  2NWG A;  1SND A;  3VR4 A;  2LSS A;  1DZ1 A;  2HQE A;  5C4X B;  3VYR A;  5FO8 B;  5EKL A;  2YTY A;  1CQF A;  2F0F A;  2F0L A;  1EEI D;  3BVM A;  5IGD A;  5JEA H;  4AYB E;  1JWU D;  2F3I A;  1WTW A;  3HOZ G;  3M4O B;  4WFN 3;  3GD7 A;  4F7X A;  1J6Q A;  4H44 C;  1YNJ D;  2H1E A;  3RN5 A;  3HOU H;  5ELC A;  1XMO Q;  2PZW A;  1D8L A;  2HDM A;  4IPG A;  1STH A;  5FLX E;  4RFB A;  2F0N A;  4DV6 Q;  1G91 A;  2Z9H A;  3KLS X;  2B3G A;  2YYZ A;  1X3F A;  2K5W A;  4PV1 C;  3I56 A;  1F9P A;  1GOZ A;  4HMJ A;  5C6A A;  4OWT B;  1RCV D;  3U4Z A;  4HJ9 A;  3I73 A;  2JA8 G;  1FYC A;  3S1Q B;  2A6E D;  5ISR A;  1VF7 A;  1QZG A;  3HOZ H;  1VQG A;  4P72 A;  4XQQ A;  4A93 G;  2E75 C;  1CI3 M;  3D4W A;  1IW7 D;  3QOJ A;  3SE0 A;  3I7F A;  4QCL A;  5FLX c;  1HUN A;  4C2M B;  3FPP A;  2WP8 J;  4C3I G;  2XRS D;  4ZKC B;  1I6V C;  1A8V A;  5IT9 E;  4RGT A;  1BXT A;  3GTJ B;  1DON A;  5LMU Q;  4JI7 Q;  3PSI A;  4A3D G;  3ZJY C;  2J4X A;  4RCO A;  1B44 D;  2PNR C;  4K0K Q;  3J80 i;  2JA8 H;  1JR0 D;  3I4L A;  3J7A V;  1E3P A;  4A93 H;  2Q2I A;  4LUV A;  4CHT B;  5KRU A;  4JV5 L;  2IT1 A;  4Y52 H;  3NBH A;  2L15 A;  5IGF A;  4A3E B;  3RLN A;  3RN2 A;  1XJV A;  2F0J A;  4C3I H;  3OPO A;  4DR4 L;  4BY7 G;  2HHH L;  5DAU A;  1A3U A;  2B2V A;  2E2H H;  2RHS B;  1B9M A;  2MP1 A;  5C4X G;  3NEN A;  2PQE A;  4GKJ Q;  1QCB D;  1HNZ L;  2ALY B;  4GNX B;  3S1M H;  1SLJ A;  3D0F A;  3DWP A;  4FF2 A;  4A76 A;  3HS0 C;  3K7A H;  1HCZ A;  4IQZ A;  1STG A;  3T51 B;  5C4J H;  4P74 A;  3J80 E;  2K04 A;  2IHE A;  2MFI A;  2R93 B;  2WFW A;  5HGT A;  3ND9 A;  4NB3 A;  2F0I A;  2FJ2 A;  4BY7 H;  5M3F B;  3TQY A;  4ULL A;  3HOV B;  4JI8 Q;  4YIJ A;  4JW0 A;  1VQL A;  5KEE A;  2MO1 A;  5C4X H;  1PRT C;  3DMU A;  4NXN Q;  2FMC A;  3ITP A;  2UXC Q;  3LX0 A;  4IUU A;  2NVT H;  2EYF A;  1D5X C;  2Z8L A;  3D4R A;  5IY0 A;  1QVC A;  2AUJ D;  1B50 A;  1G6Z A;  3I55 A;  2R3Z A;  1R4P B;  1W6K A;  5FOB B;  2A1A A;  1OTC A;  1HR0 Q;  3GTM B;  3CPF A;  5KNC A;  3J7A 5;  2F0T A;  1DOK A;  4DV4 Q;  4RMF A;  2K4K A;  4HTH A;  1PH3 A;  2UXD L;  1CSP A;  1VQA A;  3CCM A;  2BCO A;  5EGT A;  5EPK A;  4JYA Q;  4OON A;  4DA2 A;  2B8G A;  4FDB A;  1SYC A;  3T13 A;  1QUQ A;  1TWC B;  4K5X A;  4Y7N B;  3S1Q H;  1L0W A;  3E9I A;  1PZI D;  3K0Y A;  1DOM A;  5G3L D;  5LMN Q;  2BOS A;  1SYE A;  1ZEQ X;  3D3R A;  1PA6 A;  2A74 C;  3C1F A;  1PZK D;  4C2M H;  4LFA Q;  3QB3 A;  5M5X B;  2Z6B A;  2EJF C;  3TBI B;  3HOW B;  2N8N A;  2EYJ A;  2PQA A;  4UAI A;  4MTK A;  1QJO A;  1EY4 A;  4UY8 C;  1QWY A;  2QCP X;  2VL6 A;  3CU7 A;  1RTN A;  1S40 A;  2UUB Q;  4PMC A;  1VQ7 A;  2JEA I;  1UWV A;  5ELN A;  3EA6 A;  3HOX B;  2LY7 A;  4IJH A;  4ALP A;  4L63 B;  4WOR A;  4HSP A;  3D4D A;  5I2X A;  4PG3 A;  4F8M A;  3A8J E;  1TKW B;  2R93 G;  2O5I C;  4A3E H;  1L1O B;  5ELO A;  1SEB D;  4A3K B;  4NP5 A;  4DKA C;  5M3F G;  2F0V A;  4RWS C;  3HOV G;  3RZD H;  4FXG C;  3H6M A;  4CDD C;  4CKE A;  3K80 C;  3OW2 A;  1CKM A;  5CMD A;  1N32 Q;  1PYS B;  1SR3 A;  1Y1V B;  4JI6 L;  4X66 Q;  4O1N A;  1A63 A;  3BVG A;  2EZV A;  5CR3 A;  5BN5 A;  5CV6 A;  1H9J A;  1SMY D;  1LTB D;  2CWA A;  2R7Z B;  1IYV A;  3NWS A;  4UPA A;  3ERO A;  5C4H A;  4DUY Q;  2R92 B;  1H9S B;  3PUX A;  3I4M B;  3HOY B;  3J7A F;  2R93 H;  1CKN B;  2RSN A;  2OEO A;  4BXX G;  4OO1 G;  3OIQ A;  1K28 A;  3GTL B;  2I0Q A;  4ZAI A;  5M3F H;  1IBL L;  1E24 A;  3HOV H;  3UDI A;  1SE3 A;  1LTS D;  4OX9 Q;  1EY9 A;  2R7F A;  4X3T A;  4A3E G;  4DK1 A;  3A5U A;  1KLG D;  1X3Q A;  3U9O A;  4EGV A;  4LFC L;  3STB D;  2I5M X;  4GS3 A;  5D3I B;  4PNY A;  1EU4 A;  2TSS A;  4A3L G;  3GTM H;  3CCL A;  3HOW G;  1N8R C;  1XNR L;  4BXX H;  4OO1 H;  3TME A;  4KKU A;  1F9R A;  2AHO B;  1TII D;  1H95 A;  1EEF D;  3R3O A;  4P73 A;  3IRB A;  1HZC A;  1S72 A;  4LF9 L;  1VQE A;  2NVQ H;  1TWC H;  4QQB X;  3AU7 A;  5COR A;  1PDQ A;  1NBW A;  3S2D B;  2A68 C;  2NBF A;  1JOO A;  3ER0 A;  3MAQ A;  4IFD G;  3EFX D;  3NE5 B;  3NTI A;  4A3L H;  1B53 A;  3L9A X;  5M5X H;  3HOW H;  1D7Q A;  2K32 A;  2HIV A;  1OXV A;  4RGM A;  4A3K G;  3A54 A;  1XWE A;  3EN2 A;  3VR6 A;  4XT3 B;  3S1R B;  4HID A;  1VCI A;  2V4D A;  1SE4 A;  5JPM C;  1ONL A;  1XTC D;  2F0M A;  3DWQ A;  3F2C A;  3HOX H;  4UP9 A;  4JI4 L;  4A3G B;  2F3V A;  1K8A C;  2MQH A;  3QWN A;  2R7Z G;  3BYY B;  1JJG A;  2B2V C;  1YJW A;  2R92 G;  4DAM A;  3I4M G;  3CCJ A;  5D65 A;  4IFD H;  1F2M A;  4NKL A;  1MD2 D;  4KY7 A;  4A3K H;  1EY8 A;  1STN A;  2HHH Q;  1QZH A;  1EY7 A;  3SK4 A;  1YJ9 A;  5I2Y A;  1ICF B;  4L5Q A;  4UHV A;  1DGS A;  4HCS A;  3FHW A;  1CQV A;  2DGY A;  4JI2 Q;  3TP8 A;  3FPU B;  1XMO L;  1Y1V H;  4JG2 A;  1EZ8 A;  4X64 Q;  4GOP B;  3HEJ A;  1ZYR D;  1SNP A;  1TT2 A;  4JOI A;  2R7Z H;  1I4H A;  2R92 H;  3VYT A;  1PH7 A;  3I4M H;  2VZA A;  1C0A A;  3CC7 A;  1E1T A;  4XYO A;  2F0W A;  3BZK A;  4K2K A;  2KCC A;  2AKW B;  3GTL H;  1Z6H A;  3RNU A;  1E2W A;  1DXM A;  3Q8D A;  1F2Y A;  3FMC A;  2JA7 B;  5KGU A;  3VR2 A;  3SXH A;  1XXG A;  4JPB W;  1PTO H;  4ZKB B;  4R4Q A;  2K5D A;  3G7L A;  3J81 j;  5HUR A;  2IWH A;  3VYU A;  2PI2 E;  2K33 A;  5LMU L;  3IAY A;  1HZ9 A;  3MC0 B;  4JI7 L;  1WCM B;  3WOF A;  1PYB A;  2A69 C;  2J0T D;  4MHE A;  4A3I G;  4A3M B;  3AQQ A;  2WIN B;  1KL9 A;  1MIU A;  1K0R A;  4BBR B;  3G48 A;  1HHV A;  2UXD Q;  4G4K A;  4K0K L;  4EQP A;  1G6P A;  1FJG L;  3M3Y B;  1ICW A;  1DYQ A;  3BDL A;  1I4X A;  4IFD I;  1HQM C;  3P1H A;  1B3Q A;  1HQR D;  2Q2U A;  2NYZ D;  3H09 A;  4B3M Q;  1KXL A;  1CZW A;  4J15 A;  4A3G G;  3S2D H;  1YNX A;  1OXS C;  5EBD A;  1K8O A;  4G57 A;  3KF6 A;  3H3V I;  2QGQ A;  4GKJ L;  4A3I H;  3K5O A;  1OO9 B;  1W3S A;  2PPB C;  2M00 A;  2I46 A;  2EJM A;  4N8X 1;  4JI1 Q;  3A56 A;  4RG1 A;  3S1R H;  3CRL C;  5IWA Q;  1I4P A;  3K8A A;  1EYA A;  4ZUJ A;  3T1Y Q;  2V1C C;  1KNA A;  1LT3 D;  3M4Y A;  2CW0 D;  4R8N A;  3UE0 A;  1LAC A;  2NTS A;  3JAM i;  4A3G H;  1PRT F;  4JI8 L;  1LM0 A;  1MJC A;  2K5H A;  4QIW B;  4NXN L;  3I90 A;  4HIK A;  4RAU C;  3AFQ A;  5EBC A;  3W1G A;  1MBY A;  2RDG A;  4I65 A;  4GKK Q;  3FEW X;  4QL5 A;  2L0C A;  2D2C C;  1IBM L;  2B39 A;  1QB5 D;  2XN9 C;  2JA7 G;  1SN8 A;  4OWW B;  3BDC A;  2VQE Q;  4DV4 L;  3RMH A;  5CV8 A;  3VA7 A;  1WVL A;  3PCO B;  4CDF C;  1CUK A;  1EY5 A;  4B9W A;  1PV4 A;  1SNM A;  3SK8 A;  3JAM E;  1CZG A;  5C3E B;  1TU2 B;  4JYA L;  1PH2 A;  4A3M G;  3QG1 A;  3UE1 A;  2L4N A;  2N49 A;  3KFU A;  3PUY A;  1HZA A;  1L0Y B;  3KYH C;  1EWI A;  1IKL A;  4RA8 A;  1UE5 A;  1LUZ A;  1WD1 A;  1KTK A;  1Q90 A;  1TS4 A;  1LTA D;  3A0J A;  2JA7 H;  1VMP A;  1KQS A;  1YNJ C;  3LNN A;  2KVM A;  1KRT A;  2VQF Q;  1AZQ A;  5K36 G;  3MWY W;  4LFC Q;  5C0X G;  2K05 A;  4XQJ A;  3JAM c;  3OMC A;  2XIW A;  4DNR B;  1N34 L;  1I4G A;  1G8Z D;  4DV0 Q;  2UUB L;  1WCM H;  1E2Z A;  1VS0 A;  4WJ4 A;  4YWK A;  4A3M H;  1SAP A;  1KAA A;  1T5X D;  1XNR Q;  3GTQ H;  2ZTD A;  1X56 A;  5FO7 B;  3SHL A;  3CC4 A;  3MXN A;  4MN3 A;  5IOD A;  2CFM A;  3M3Y H;  1B70 B;  4HJ8 A;  5C3X A;  2EDG A;  3DM1 A;  4LUO A;  1IW7 C;  1CM9 A;  3E0E A;  4K6D A;  4O0A A;  2EIF A;  3CCV A;  2DNC A;  1EYG A;  5K36 H;  4N9P A;  5C0X H;  3OMG A;  4QY7 A;  4GN4 B;  4U68 A;  5M3M B;  1XMQ Q;  4LF8 Q;  3OHX C;  3PO3 B;  1T9H A;  3HG9 A;  3P20 A;  5DM7 3;  4JI5 Q;  5AJ3 Q;  1Q8K A;  1RF2 D;  1T5E A;  3HRZ C;  5FLM G;  1N32 L;  5JEA G;  2K5V A;  4X66 L;  3TZU A;  4KKS A;  4A4I A;  1K3B C;  3EJI A;  1AH9 A;  3RLO A;  5GRO A;  5C44 B;  2KHS A;  4L5T A;  3F1Z A;  4DUY L;  3P7J A;  2EXZ A;  4DR7 L;  4OL7 A;  3ICE A;  3M4P A;  2JYO A;  4JI4 Q;  3T53 B;  4CKC A;  4B3T L;  4M1U B;  5IYB G;  3KDF A;  2JA5 G;  1E2V A;  3NPP A;  5FLX L;  3CCQ A;  3FP9 A;  5C3E G;  4OX9 L;  1I6H B;  1N9W A;  4DN4 M;  4FYD A;  3AFP A;  1UE1 A;  2B8F A;  4X3K A;  4HJ7 A;  3UI2 A;  2I5L X;  3S15 B;  5CBA E;  5FLM H;  4RCN A;  2R61 A;  3OW7 A;  1AEX A;  1OXT A;  2UU9 Q;  1YIT A;  1EYC A;  4JOI C;  1K0S A;  3F8T A;  1WTP A;  1SYF A;  2F4I A;  3KBG A;  2EXD A;  1LTI D;  3W5O A;  4DF7 A;  3U9S A;  2Q8I B;  4QIW E;  4EQN A;  1PZJ D;  4R4T A;  5IYB H;  3CQZ H;  2JA5 H;  2TMP A;  1PH6 A;  1ZKO A;  1V1P B;  1B7Y B;  1ILP A;  1S5E D;  1VQI A;  2VB3 X;  5C3E H;  2F03 A;  4IOA A;  5IT9 L;  2CWP A;  1Y8O B;  1PVO A;  1R4Q B;  4H02 A;  5IE8 A;  4YCV A;  1SNC A;  1CSQ A;  4NW2 A;  1JB3 A;  1XPR A;  4M8A A;  1Q12 A;  5M5W H;  3L7Z C;  1B3A A;  1NAP A;  2JE6 I;  1YHQ A;  4DK6 C;  1I94 Q;  2R6G A;  1U4R A;  4HJ5 A;  3PO2 G;  4ZQ3 A;  3PO3 G;  4GZY C;  4B3S L;  4A75 A;  3P75 A;  1TQO A;  5JPN C;  1PFM A;  1QVF A;  4DV3 Q;  2ZTE A;  1IZ6 A;  2FHT A;  2DNE A;  3K59 A;  4DR6 Q;  3J7Z C;  2EY6 A;  5D14 A;  4DAY B;  1HNW L;  5IOC A;  2WAQ G;  3S1N B;  4KJO A;  2PW5 A;  1FJG Q;  2H4O A;  2K14 A;  3B6Y A;  5C44 G;  1BVS A;  3CP0 A;  1R9T B;  3CXC A;  2KHI A;  2XSC A;  1G29 1;  2E2J B;  2LXJ A;  2GA4 B;  3J80 L;  2OTL A;  5IT9 c;  4G7O C;  2EYH A;  3H3V C;  5M3M H;  2XGT A;  1V9P A;  1AFP A;  3PO2 H;  3PO3 H;  5EAY A;  1QNK A;  2VNU D;  5JJL A;  2SOB A;  1SYB A;  4A3C G;  1TS2 A;  4IPC A;  3RLF A;  4JI2 L;  3L2P A;  2EYL A;  3FKI B;  5CBE E;  2HDL A;  4LFB L;  4X64 L;  1Y14 B;  3SGI A;  1UEB A;  4TVA B;  2F0U A;  4QF4 A;  2VW9 A;  4DR3 Q;  1FVI A;  2FMM A;  3H91 A;  5C44 H;  4P75 A;  1VQD A;  4LF5 Q;  1I4Q A;  3QO2 A;  1ASY A;  4EX5 A;  3J81 i;  5EJW A;  4P71 A;  1YBY A;  2KHJ A;  1JWS D;  4ID6 A;  4JBJ A;  1FGB D;  1LTR D;  3NQI A;  1I3Q H;  3E6Z X;  3W3A A;  1STB A;  4A3C H;  1I6H H;  2WAQ E;  3SDZ A;  1ENC A;  1A62 A;  4K14 A;  4BWG B;  3S15 H;  4LF6 L;  5LL6 S;  4G7Z C;  2CH4 A;  2N78 A;  4K5V A;  4I7A A;  1IBM Q;  2PO4 A;  3F2U A;  1SMY C;  4XQN A;  1ML0 D;  1EQV A;  1K8M A;  3M4O H;  3J80 c;  3CHB D;  1VQJ A;  4B08 A;  1M4V A;  2UXB Q;  2K7V A;  1PYW D;  1YHB A;  1EIF A;  2P5Z X;  2RKS A;  3CAM A;  2A19 A;  3NHH A;  1Z47 A;  1SE8 A;  2D9U A;  3I8Z A;  4KJN A;  5JEA J;  4CKB A;  1AE2 A;  3DHQ A;  3J81 E;  2CHB D;  2IHF A;  3A8I E;  4IZ8 A;  1EQT A;  3DLL A;  3RZO B;  5BN4 A;  4KD3 A;  4B3M L;  2YV5 A;  5LL6 X;  1TWF B;  3NP8 A;  2RBM A;  4IUV A;  4UP8 A;  1A2T A;  1SRO A;  3STB C;  3GTK B;  1L0X B;  1GUW A;  4DXG A;  4OIJ A;  4UDU C;  3BVZ A;  2WKD A;  4LW1 A;  1VQF A;  1BCP C;  4JCV E;  2KEN A;  1O7I A;  2Y0S B;  3R2T A;  1VQB A; 
#chains in the Genus database with same CATH homology
 3KK7 A;  1SNO A;  1LT4 D;  1PLF A;  1GJX A;  1STY A;  1DOL A;  3A8K E;  5I6Y A;  1ET6 A;  5COY A;  2N55 A;  3V05 A;  2Z4H A;  2VXW A;  3D31 A;  1O7Y A;  2AUK A;  4O42 A;  4HED A;  3DUZ A;  1PTO D;  1BDO A;  3K58 A;  3SK5 A;  1DD2 A;  5CV5 A;  5M5Y B;  2O5J C;  4ILW A;  4RGN A;  5C5M A;  2RSO A;  5A2Q E;  1EY6 A;  2RVL A;  4BA2 I;  4KK7 A;  3HGB A;  5KNB A;  3GQB A;  1JCK B;  5EKK A;  2OT2 A;  4ZLT F;  5J1Z A;  2E74 C;  2C9O A;  1JIC A;  1U4L A;  1H9R A;  2KEE A;  2SNS A;  3K57 A;  3S2H B;  2LFN A;  5DM6 3;  2A5H A;  1TWG B;  5D3D A;  2IX1 A;  1ZYR C;  5ELD A;  1DCZ A;  2RDH A;  4KMU C;  3MXG A;  3BZD B;  1BCP D;  3DEO A;  4RKB A;  1NR4 A;  1JE4 A;  3WOE A;  4JBW A;  3EVQ A;  1VF5 C;  1BBX C;  2F0S A;  2DY7 A;  3NBI A;  1C4Q A;  5CV7 A;  3V96 A;  2SDF A;  1PRT B;  3D8G A;  3KBX A;  4PMW A;  1UUP A;  5I9O A;  3I4N B;  4J6H A;  3IL8 A;  1EOT A;  2ZXO A;  2Q8R E;  1HUM A;  2L9H A;  3VR3 A;  4K2L A;  1ENA A;  1TY0 A;  2EY2 A;  4KY6 A;  4LAA A;  4DNT B;  4BY1 B;  3TP7 A;  2JA6 B;  2HUG A;  2NTT A;  3PUZ A;  3T56 B;  4NMZ A;  5I4D A;  4QUF A;  2L55 A;  4FP5 D;  5JAV A;  2CQA A;  4XIG S;  3TDQ A;  4XXE A;  1HPC A;  1J9O A;  1A3V A;  3S9W A;  3QOL A;  4ZRZ A;  4QUC A;  3DWA A;  4OO1 I;  2CW0 C;  5FKA C;  1NUC A;  1H9M A;  3GTP B;  2DN8 A;  1EL0 A;  4KD4 A;  2WKC A;  3URY A;  4ZK9 B;  2AWN A;  3PIO 3;  4KHZ A;  1LLR D;  4DFA A;  2F0K A;  3M7G A;  3H94 A;  3H0G B;  1NSN S;  1S5C D;  4KN4 C;  3V2T A;  2VUM B;  3K5L A;  3I72 A;  3K5N A;  4RHS A;  3Q23 A;  3MXP A;  2KCN A;  1TS5 A;  5F2D A;  2YU9 B;  1GUS A;  1CK1 A;  5G3L F;  2G9D A;  1ET9 A;  1Q1B A;  2KJX A;  4RH6 A;  3HKZ B;  4ZYS A;  5CC4 A;  1LT5 D;  2BA0 A;  4C3J B;  2B2W C;  2K28 A;  5ELF A;  2BE5 D;  1C48 A;  3PUW A;  3MXU A;  1IHZ A;  2KED A;  1I4R A;  3T4A C;  1G2T A;  2JSO A;  4KI0 A;  4CBV A;  3BS1 A;  2C5C A;  1BQQ T;  1EWH A;  3GP7 A;  2FFK B;  3RUZ A;  4CGY B;  1II3 A;  1SE2 A;  4R9W A;  1K83 B;  2EE1 A;  1NR2 A;  2NZ1 D;  1BOS A;  1DM0 B;  2XVS A;  1QIL A;  4V19 0;  1JOR A;  1EIG A;  3JAM L;  4P2C B;  1OXX K;  5JVH 3;  2EVB A;  4F87 A;  2WV6 D;  3IKJ A;  2PCF B;  5DEH A;  5ELE A;  4IAL A;  4S3S A;  1E0B A;  1F2L A;  1IL8 A;  3M7N A;  3X3N A;  4KN7 C;  3IFT A;  4IFD J;  1RDP D;  3A7A B;  3C2P A;  2BDN A;  2XWB B;  1BO0 A;  3OWE B;  2WB1 B;  1I50 B;  2PW7 A;  3PV0 A;  5JOB A;  1HA6 A;  3E0J A;  4CJ0 B;  4HMI A;  2LKV A;  2L1B A;  3MZ5 A;  3G6J B;  1CT1 D;  2A6H D;  5DNF A;  5EQ0 A;  2MUY A;  4DGZ A;  1WTX A;  1MGS A;  2F0G A;  1TY2 A;  5KIX A;  1D2B A;  2NVY B;  1DJR D;  2XNA C;  2AQ1 B;  1UNS A;  4RKL A;  3SEB A;  3OIP A;  4C3H B;  5ELB A;  5J22 A;  5T1I A;  2PZU A;  4IN3 A;  4TQU S;  4XDX A;  1O7L A;  3QJY A;  1SYD A;  1IKM A;  1FD7 D;  5IGB A;  2J7Z A;  4BBS B;  1Q1E A;  1CHP D;  2E2I B;  2IX3 A;  1PXU A;  1LO5 D;  2B63 B;  2EYP A;  1SDF A;  1C8C A;  5JVG 3;  2F0E A;  1F9Q A;  5E1F A;  4K6L A;  2CVR A;  2E2H B;  1V8Q A;  5A35 A;  1A3T A;  3LWE A;  1PMR A;  4A3D B;  4XTC S;  5BN3 A;  2L12 A;  4A3B B;  1SJE D;  5EKI A;  1EU3 A;  2K6A A;  1ENF A;  4KTA A;  3X3M A;  3PIP 3;  3MA2 B;  3TP5 A;  1TWH B;  3A55 A;  3AB9 A;  1PFB A;  5KYL A;  1CFM A;  4OGQ C;  3KUP A;  1JC7 A;  1RD9 D;  2EY5 A;  3DEP A;  2NVT B;  1TR5 A;  4R8I A;  4E6I A;  2WII B;  2MPM A;  2ZXP A;  5C0X I;  1RTO A;  2F0P A;  2IW3 A;  4FF3 A;  3RD4 A;  3QIA A;  2DY8 A;  4C3H G;  2WAC A;  2QIL A;  5EPL A;  1ILQ A;  3TP6 A;  2ICE C;  2PYK A;  3C3L A;  1YNN D;  1HTL D;  1SYG A;  1Q8I A;  1D5Z C;  1O78 A;  3FRP B;  4U67 3;  2MHV A;  4TSS A;  3TSS A;  4RHR A;  2G9H D;  3EQL C;  2F3W A;  3NTK A;  2EOT A;  1LTG D;  2QDB A;  5J39 A;  2B2Y A;  1FNU A;  1F2Z A;  5C4Z A;  3M85 A;  2L5T A;  1S4Z A;  2SEB D;  1ROD A;  2NB0 A;  1SSO A;  2HCC A;  4G7H C;  2OXP A;  3LWU A;  1HRJ A;  2SNM A;  4HN7 A;  3ZYY X;  5C0X J;  4H7B A;  1KDA A;  4RGO S;  4CJ1 B;  2EYM A;  1A2U A;  3T16 A;  2RA4 A;  3NQT A;  3RZD B;  1PTO C;  2LS0 1;  4A3J B;  1D6E C;  2AQ2 B;  4L8J A;  4NDX A;  1U4P A;  3SVM A;  3J81 L;  3Q22 A;  1JWM D;  3D6C A;  2AQ3 B;  2O4X A;  1BR9 A;  3FDT A;  2HCI A;  4ODG A;  1KDB A;  3CRK C;  3S17 B;  3NSW A;  4LK1 C;  1ZXT A;  4LJZ C;  4X3U A;  1D1I A;  2FIN B;  1JOK A;  1A15 A;  2F0D A;  1AP0 A;  1RKN A;  3I91 A;  2PZT A;  1QG7 A;  3N52 A;  2E2D C;  3C1E A;  1MSG A;  1SFO B;  3MFG A;  2B2W A;  2LMC B;  4DXF A;  2K01 A;  3BDO A;  3PMF A;  3I3C A;  1GXD C;  2B2U A;  2F0H A;  3PUV A;  2X6G A;  1BUV T;  2NVQ B;  1UAP A;  2ZXR A;  2B2T A;  4C56 C;  1LTT D;  2QF7 A;  4PMB A;  3R93 A;  1NCV A;  3J7Y W;  2EY1 A;  5A2Q L;  1WTV A;  2OF1 A;  1LV9 A;  4A3F B;  4DU9 A;  3KLR A;  3MEH A;  1GHK A;  3GO5 A;  1Z7T A;  4IUQ A;  2XRQ D;  4DAV A;  2KUM A;  1QE6 A;  3AMU A;  4FVM A;  4L6T B;  3I70 A;  1U9R A;  1XX8 A;  1V1P A;  1SNQ A;  2N88 A;  1Q3L A;  1GUG A;  2ENB A;  2ID0 A;  3W2D A;  5I9P A;  3IFD A;  1FNW A;  3K5M A;  5IGG A;  1X32 A;  1SJH D;  1PRT D;  3GTO B;  3K6O A;  1AN8 A;  5FK9 C;  4K8I A;  2MGS A;  4PQX A;  4HAE A;  1AW7 A;  5LHY 1;  2NUC A;  2D5D A;  1QOH A;  3ERQ A;  1GUN A;  4H0L C;  2IX0 A;  1HTP A;  4ABN A;  3MHB A;  2PMZ B;  3WDN A;  4F88 A;  4DAY A;  1PFN A;  1A6X A;  4FNF A;  4LMQ D;  1W6J A;  3VR5 A;  2KQ3 A;  1V1O A;  1EIH A;  4BA1 I;  5E3F A;  1PTO B;  5CGK A;  2I07 B;  1SBB B;  5TSS A;  2KEC A;  1B4O A;  1Y8P B;  2IPK D;  1SXT A;  4K5W A;  3TZD A;  3NK9 A;  1D5M C;  1MSH A;  1CHQ D;  1S5D D;  2F1M A;  4Z9C B;  3ONA B;  1X3P A;  4OHJ A;  2JP1 A;  2EYO A;  4BS9 A;  3TN2 A;  1O7Z A;  3Q0A A;  4IUT A;  4TRD A;  1Y1W B;  1XYI A;  2B2Y C;  4HCE A;  2Z1C A;  1JOQ A;  2F0O A;  3BG3 A;  1TWA B;  2BE5 C;  4X3S A;  4A3I B;  3NWT A;  3HZX A;  4K8J A;  2NVX B;  3VA5 A;  2EJG C;  3MFY A;  1HFG A;  1GHJ A;  1BCP B;  4N9T A;  1WTO A;  4FXD A;  5IGE A;  1FNV A;  4WRD A;  4IUP A;  1GUO A;  5JJZ A;  1Y8N B;  2IJ0 A;  2NN6 G;  3NXW A;  2K5Q A;  1LT6 D;  3OSO A;  5M9O A;  2JEB I;  1EY0 A;  4DAP A;  1EFI D;  1S5B D;  3GV3 A;  3L3O C;  5IIF A;  3D6W A;  3Q6S A;  1STE A;  3NUC A;  1EWC A;  4I7Z C;  1IYU A;  1RHP A;  2VB2 X;  4XT1 B;  5EPJ A;  2Q8T A;  3N6R A;  1CA5 A;  2M9V A;  3BYT B;  2NN6 H;  4IUN A;  4H13 C;  1VDZ A;  1JQY D;  1BF4 A;  1KAB A;  5CV4 A;  4EQO A;  3KF8 A;  1KDC A;  3GTG B;  1MI2 A;  2IL8 A;  3S14 B;  1D1K A;  5K5P A;  2L11 A;  4KY5 A;  4B9X A;  3O13 A;  2A6H C;  3FVQ A;  2ICI A;  4KHV A;  3SK6 A;  1HA5 A;  2A68 D;  5T1G A;  2F0Q A;  4J8Q A;  4HSV A;  2B2U C;  3GTQ B;  1G2S A;  1WTQ A;  1EZ6 A;  3S16 B;  4OIK A;  4KV6 A;  2KA7 A;  4Q0F A;  4FXK C;  1TS3 A;  2B2T C;  4J1M A;  1PTO F;  2A73 B;  3MTS A;  1J8I A;  3ND8 A;  1H9S A;  3Q24 A;  5I6W A;  4ZUI A;  5NUC A;  5AFW A;  3A7L A;  3GV6 A;  1H9K A;  1U4M A;  1KLU D;  4QB4 A;  2EPB A;  1BNZ A;  2NN6 I;  1HFN A;  1FR3 A;  4FF4 A;  4HR7 B;  1Y69 U;  1TVX A;  2RQX A;  4AYB B;  4IUR A;  1V43 A;  2K03 A;  2K1B A;  2BA1 A;  4MIU A;  1GUT A;  3VYS A;  1EYD A;  1QNU A;  2KOL A;  4DK0 A;  1B2T A;  1UEA B;  2AWO A;  1RJT A;  1OXU A;  1O80 A;  2MJ8 A;  1B9N A;  1BCP F;  3HOU B;  2BDO A;  5C5L A;  1B1Z A;  3CKI B;  4C3J G;  3CQZ B;  2JA5 B;  1F77 A;  4FF1 A;  3C46 A;  5CYU A;  5KYI A;  2A69 D;  2ZT9 C;  5CV9 A;  4TKO B;  1WD0 A;  3HP3 A;  1F9S A;  3KLS A;  2X6L A;  2QEJ C;  5M5W B;  2RDF A;  2Z4I A;  3HOZ B;  1ESR A;  1CTM A;  1WTR A;  4CJ2 C;  1VMC A;  5E4W C;  2M2L A;  2O2L D;  1LAB A;  1YNN C;  4V0B A;  4C1N K;  4KKT A;  4FO2 A;  4XYQ A;  2XWJ B;  5E4X A;  2QKI C;  4Q5V A;  1CA6 A;  4QMG A;  3DXJ C;  2JA8 B;  2A6E C;  3NTH A;  1STA A;  4A93 B;  4EVO A;  5IGC A;  5FO9 B;  3OWF A;  3OOC A;  2E76 C;  3SR1 A;  4C1N I;  4C3I B;  3PO2 B;  5KND A;  1KNE A;  4JK1 C;  3S1M B;  1AZP A;  4WJW A;  4ME5 A;  5C3W A;  2WAQ B;  1S5F D;  3R2I A;  3K7A B;  3MVV A;  5C4J B;  2JXM B;  3R8B A;  1ESF A;  1HXY D;  3E5S A;  1M8A A;  2D62 A;  4BY7 B;  1I3Q B;  2X69 A;  2NWG A;  1SND A;  3VR4 A;  1DZ1 A;  2HQE A;  5C4X B;  3VYR A;  5FO8 B;  5EKL A;  1CQF A;  2F0F A;  2F0L A;  1EEI D;  3BVM A;  5IGD A;  5JEA H;  1JWU D;  1WTW A;  3M4O B;  4WFN 3;  3GD7 A;  4F7X A;  4H44 C;  1YNJ D;  2H1E A;  5ELC A;  2PZW A;  2HDM A;  5FLX E;  1STH A;  4RFB A;  2F0N A;  1G91 A;  3KLS X;  2YYZ A;  2K5W A;  4PV1 C;  1F9P A;  1GOZ A;  4HMJ A;  5C6A A;  1RCV D;  3I73 A;  1FYC A;  3S1Q B;  2A6E D;  5ISR A;  1VF7 A;  4XQQ A;  2E75 C;  1CI3 M;  3D4W A;  1IW7 D;  3QOJ A;  3SE0 A;  4QCL A;  1HUN A;  4C2M B;  3FPP A;  2WP8 J;  4C3I G;  2XRS D;  4ZKC B;  1I6V C;  5IT9 E;  4RGT A;  1BXT A;  3GTJ B;  1DON A;  2J4X A;  4RCO A;  1B44 D;  2PNR C;  1JR0 D;  3I4L A;  3J7A V;  4CHT B;  5KRU A;  2IT1 A;  3NBH A;  5IGF A;  4A3E B;  2F0J A;  3OPO A;  5DAU A;  1A3U A;  2B2V A;  1B9M A;  2MP1 A;  2PQE A;  1QCB D;  3DWP A;  4FF2 A;  3HS0 C;  1HCZ A;  4IQZ A;  1STG A;  3T51 B;  3J80 E;  2K04 A;  2R93 B;  5HGT A;  3ND9 A;  2F0I A;  2FJ2 A;  5M3F B;  4ULL A;  3HOV B;  4YIJ A;  5KEE A;  1PRT C;  3DMU A;  2FMC A;  3ITP A;  3LX0 A;  4IUU A;  2EYF A;  1D5X C;  2Z8L A;  3D4R A;  2AUJ D;  1B50 A;  1G6Z A;  2R3Z A;  1R4P B;  1W6K A;  5FOB B;  3GTM B;  5KNC A;  2F0T A;  1DOK A;  4HTH A;  2BCO A;  5EGT A;  5EPK A;  4DA2 A;  2B8G A;  1SYC A;  3T13 A;  1TWC B;  4K5X A;  4Y7N B;  3K0Y A;  1PZI D;  1DOM A;  5G3L D;  2BOS A;  1SYE A;  1ZEQ X;  3D3R A;  2A74 C;  3C1F A;  1PZK D;  3QB3 A;  5M5X B;  3HOW B;  2EJF C;  3TBI B;  2EYJ A;  4UAI A;  1QJO A;  1EY4 A;  1QWY A;  2QCP X;  3CU7 A;  1RTN A;  4PMC A;  2JEA I;  3EA6 A;  3HOX B;  2LY7 A;  4WOR A;  4L63 B;  4HSP A;  3D4D A;  5I2X A;  4F8M A;  3A8J E;  1TKW B;  2O5I C;  1SEB D;  4A3K B;  4NP5 A;  2F0V A;  4RWS C;  4FXG C;  3H6M A;  4CKE A;  5CMD A;  1Y1V B;  4O1N A;  3BVG A;  2EZV A;  5CR3 A;  5BN5 A;  5CV6 A;  1H9J A;  1SMY D;  1LTB D;  2R7Z B;  1IYV A;  3NWS A;  3ERO A;  5C4H A;  2R92 B;  1H9S B;  3PUX A;  3I4M B;  3HOY B;  3J7A F;  2RSN A;  2OEO A;  4OO1 G;  3OIQ A;  3GTL B;  4ZAI A;  1SE3 A;  1LTS D;  1EY9 A;  4X3T A;  4DK1 A;  1KLG D;  1X3Q A;  3U9O A;  4EGV A;  5D3I B;  4PNY A;  1EU4 A;  2TSS A;  4OO1 H;  3TME A;  4KKU A;  1F9R A;  1TII D;  1EEF D;  3R3O A;  3AU7 A;  5COR A;  1PDQ A;  3S2D B;  2A68 C;  2NBF A;  1JOO A;  3MAQ A;  4IFD G;  3EFX D;  3NE5 B;  3NTI A;  1B53 A;  3L9A X;  2K32 A;  4RGM A;  1OXV A;  3A54 A;  1XWE A;  3VR6 A;  4XT3 B;  3S1R B;  1VCI A;  2V4D A;  1SE4 A;  5JPM C;  1ONL A;  1XTC D;  2F0M A;  3DWQ A;  4A3G B;  2F3V A;  3QWN A;  3BYY B;  2B2V C;  5D65 A;  4IFD H;  1F2M A;  4NKL A;  1MD2 D;  4KY7 A;  1EY8 A;  1STN A;  1EY7 A;  3SK4 A;  5I2Y A;  4HCS A;  1CQV A;  3TP8 A;  3FPU B;  1EZ8 A;  3HEJ A;  1ZYR D;  1SNP A;  1TT2 A;  1I4H A;  3VYT A;  4XYO A;  2F0W A;  4K2K A;  2KCC A;  1Z6H A;  1E2W A;  1DXM A;  1F2Y A;  3FMC A;  2JA7 B;  5KGU A;  3VR2 A;  3SXH A;  1XXG A;  1PTO H;  4ZKB B;  2K5D A;  3G7L A;  5HUR A;  2IWH A;  3VYU A;  2K33 A;  3IAY A;  3MC0 B;  1WCM B;  3WOF A;  4MHE A;  2A69 C;  2J0T D;  4A3M B;  2WIN B;  4BBR B;  1HHV A;  4G4K A;  4EQP A;  3M3Y B;  1ICW A;  1DYQ A;  3BDL A;  1I4X A;  4IFD I;  1HQM C;  3P1H A;  1HQR D;  2NYZ D;  3H09 A;  1CZW A;  1OXS C;  5EBD A;  1K8O A;  4G57 A;  3K5O A;  1OO9 B;  2PPB C;  2M00 A;  2I46 A;  2EJM A;  3A56 A;  3CRL C;  1I4P A;  1EYA A;  4ZUJ A;  1KNA A;  1LT3 D;  3M4Y A;  2CW0 D;  4R8N A;  1LAC A;  2NTS A;  1PRT F;  4QIW B;  3I90 A;  4RAU C;  5EBC A;  1MBY A;  2RDG A;  4I65 A;  3FEW X;  2L0C A;  2D2C C;  2B39 A;  1QB5 D;  2XN9 C;  3BDC A;  3RMH A;  5CV8 A;  3VA7 A;  1WVL A;  1EY5 A;  4B9W A;  1SNM A;  3SK8 A;  3JAM E;  1CZG A;  5C3E B;  1TU2 B;  3QG1 A;  2L4N A;  3PUY A;  1L0Y B;  1IKL A;  4RA8 A;  1WD1 A;  1KTK A;  1Q90 A;  1TS4 A;  1LTA D;  1VMP A;  1YNJ C;  3LNN A;  2KVM A;  1AZQ A;  5K36 G;  3MWY W;  5C0X G;  2K05 A;  4XQJ A;  3OMC A;  2XIW A;  4DNR B;  1I4G A;  1G8Z D;  1E2Z A;  1SAP A;  1KAA A;  1T5X D;  5FO7 B;  3SHL A;  3MXN A;  4MN3 A;  5IOD A;  5C3X A;  2EDG A;  3DM1 A;  1IW7 C;  1CM9 A;  4K6D A;  2DNC A;  5K36 H;  4N9P A;  5C0X H;  3OMG A;  5M3M B;  4U68 A;  3OHX C;  3PO3 B;  3HG9 A;  3P20 A;  5DM7 3;  1RF2 D;  1T5E A;  3HRZ C;  5JEA G;  3TZU A;  4KKS A;  3EJI A;  5C44 B;  2KHS A;  2EXZ A;  3P7J A;  4OL7 A;  2JYO A;  3T53 B;  4CKC A;  4M1U B;  1E2V A;  3NPP A;  5FLX L;  1I6H B;  4DN4 M;  4FYD A;  2B8F A;  4X3K A;  3UI2 A;  3S15 B;  5CBA E;  4RCN A;  2R61 A;  3OW7 A;  1AEX A;  1OXT A;  1EYC A;  1WTP A;  1SYF A;  2F4I A;  3KBG A;  1LTI D;  4DF7 A;  3U9S A;  2Q8I B;  4EQN A;  1PZJ D;  2TMP A;  1ZKO A;  1V1P B;  1ILP A;  1S5E D;  2VB3 X;  2F03 A;  5IT9 L;  1Y8O B;  1R4Q B;  1SNC A;  4NW2 A;  1JB3 A;  4M8A A;  1Q12 A;  3L7Z C;  1B3A A;  1NAP A;  2JE6 I;  2R6G A;  1U4R A;  4ZQ3 A;  4GZY C;  3P75 A;  1TQO A;  5JPN C;  1PFM A;  2FHT A;  2DNE A;  3K59 A;  2EY6 A;  5D14 A;  5IOC A;  3S1N B;  4KJO A;  2PW5 A;  2H4O A;  1R9T B;  2XSC A;  1G29 1;  2E2J B;  2GA4 B;  3J80 L;  4G7O C;  2EYH A;  3H3V C;  1AFP A;  1QNK A;  2VNU D;  2SOB A;  1SYB A;  1TS2 A;  3RLF A;  2EYL A;  3FKI B;  5CBE E;  2HDL A;  2F0U A;  4QF4 A;  2FMM A;  3H91 A;  1I4Q A;  3QO2 A;  5EJW A;  4ID6 A;  1JWS D;  1FGB D;  1LTR D;  3NQI A;  3E6Z X;  3W3A A;  1STB A;  3SDZ A;  1ENC A;  4K14 A;  4BWG B;  5LL6 S;  4G7Z C;  4K5V A;  2PO4 A;  3F2U A;  1SMY C;  4XQN A;  1ML0 D;  1EQV A;  1K8M A;  3CHB D;  4B08 A;  1M4V A;  2K7V A;  1PYW D;  2RKS A;  3NHH A;  1Z47 A;  2D9U A;  3I8Z A;  4KJN A;  5JEA J;  4CKB A;  3J81 E;  3DHQ A;  2CHB D;  3A8I E;  4IZ8 A;  1EQT A;  3RZO B;  5BN4 A;  4KD3 A;  5LL6 X;  1TWF B;  3NP8 A;  2RBM A;  4IUV A;  1A2T A;  3GTK B;  1L0X B;  1GUW A;  4DXG A;  4OIJ A;  4UDU C;  3BVZ A;  2WKD A;  1BCP C;  2Y0S B;  3R2T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...