3R3OA

Crystal structure of staphylococcal nuclease variant delta+phs t62a at cryogenic temperature and with high redundancy
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFAKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cavities determine the pressure unfolding of proteins.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 33
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2011-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3r3oA00
2ENBA 3R3OA 1SNOA 1EYDA 4K6DA 5CR3A 3ITPA 4QB4A 4DF7A 2EYOA 4H7BA 3DHQA 1II3A 4K5WA 3D4WA 1KAAA 2SNMA 3H6MA 2F0SA 3EROA 4HTHA 4PNYA 4F8MA 5C3WA 4K8JA 2PZTA 2F0VA 3PMFA 2HQEA 2EY1A 5EGTA 4ZUIA 4K5XA 3BDCA 5IIFA 4DFAA 5HURA 1JORA 5NUCA 3BDLA 5CV5A 3NXWA 3MVVA 4B9WA 2LKVA 1KDCA 5IGFA 3NP8A 3QB3A 3RUZA 3DMUA 5CV6A 3MXPA 2F3VA 2PZUA 5KEEA 1JOQA 1STNA 3T16A 4K8IA 1A2UA 3P1HA 1STGA 2F0DA 4WRDA 5DEHA 2F0QA 5I6WA 1A2TA 4KV6A 3C1EA 5JAVA 1SNMA 1EY0A 1EY9A 3E5SA 4HMIA 4KTAA 3VA5A 1EY7A 2F0OA 1JOKA 3MHBA 4MIUA 5M9OA 4R8NA 5IODA 3OMCA 5K5PA 5I6YA 3C1FA 3NK9A 1A3VA 4NMZA 5E1FA 1TR5A 1EY4A 2F0JA 3ERQA 5IOCA 4RKBA 2F0KA 3OSOA 1F2MA 2F0NA 5C5MA 1SYDA 2RBMA 5IGCA 4KJOA 2F0PA 4QF4A 4F7XA 3TP7A 2F0EA 4EQNA 1KABA 5IGBA 4N9TA 4B9XA 2SOBA 2F0WA 4IALA 3SR1A 3LX0A 4K14A 5C6AA 4J6HA 5CV9A 5CGKA 5KYIA 1STBA 2RKSA 5DAUA 3MZ5A 3QOLA 4YIJA 4J1MA 1ENAA 4KD4A 1EY5A 1EYCA 1SNQA 3OMGA 2WACA 1RKNA 1JOOA 4K2LA 5J22A 5J39A 1SYGA 4S3SA 3HZXA 5IGEA 1EYAA 4KY7A 1EY8A 1A3TA 2OF1A 4ID6A 2F0TA 2EXZA 3MEHA 4TRDA 1AEXA 4NDXA 4KD3A 4KJNA 4NKLA 4DU9A 1TT2A 2OEOA 5I9PA 2F0FA 5KRUA 2PW5A 2PZWA 4K2KA 1NSNS 2F0LA 2PQEA 4IUNA 5C4HA 5CC4A 2EY2A 3D4DA 2O4XA 3NUCA 4PMBA 5C5LA 1F2YA 5CV7A 1STHA 5EKLA 5EKKA 4WORA 4E6IA 4KY5A 3EJIA 3NHHA 1ENCA 2F0HA 1EZ8A 4K5VA 5CV4A 5E3FA 4ZQ3A 3SHLA 3TMEA 5C4ZA 3P75A 2PW7A 2EYFA 2SNSA 4PMCA 3V2TA 1SYFA 2KHSA 1EY6A 1IHZA 1TQOA 5KGUA 2QDBA 4EVOA 2M00A 2PYKA 2EY5A 3D8GA 1F2ZA 4N9PA 4ZUJA 3SK4A 1SYEA 4DGZA 4EQPA 5C3XA 3SXHA 2EYLA 5IGGA 2EYHA 5KYLA 4LAAA 2NUCA 3D6CA 4RKLA 2EY6A 5IGDA 1NUCA 1EZ6A 2KQ3A 1SNCA 1SYCA 3QOJA 5F2DA 5ISRA 3TP6A 1STYA 3NQTA 3OWFA 3U9OA 4ME5A 3EVQA 1SNDA 5HGTA 4OL7A 4IZ8A 3T13A 1STAA 4I65A 4NP5A 3SK5A 2F0IA 5JOBA 4G57A 2F0GA 3S9WA 2EYMA 1U9RA 1SYBA 5J1ZA 2F3WA 5I9OA 2EYJA 2EYPA 4ODGA 1KDAA 1KDBA 2F0UA 2RDFA 5CV8A 2F0MA 4QMGA 3SK6A 4EQOA 5KIXA 4KY6A 4HMJA 3SK8A 4KHVA 2OXPA 3HEJA 1A3UA 3TP8A 3TP5A 1SNPA 1EQVA
chains in the Genus database with same CATH superfamily
1V9PA 3R3OA 1O80A 1WD1A 4RA8A 3VYTA 4IO9A 3H6MA 4B3TQ 3VR6A 2A8VA 2L1BA 1ICFB 4ZLTF 1F9QA 1QOHA 2CHBD 1BBUA 3ND8A 3J7YW 2LKVA 5J3BA 4LF8Q 3MAQA 1Y8PB 3MXPA 2PZUA 1X3PA 3PV0A 5KEEA 5LHY1 4O42A 4FDBA 1ZYRD 5FO9B 1CM9A 1H9MA 5CORA 4LW1A 5LL6S 4OIKA 3GD7A 2ICEC 1A2TA 1PFBA 3K81C 1EY7A 4H02A 4G7ZC 2O2LD 1E1OA 4UPAA 3EBEA 4ZAIA 3C1FA 1A3VA 1ESFA 3CQZH 1VQNA 3ERQA 2YTVA 1EIYB 3MXGA 5D3IB 3S14H 1UE7A 4BXXH 1XNRL 3PCOB 2I5HA 3PUXA 1U4MA 1JWMD 1NNXA 2RKSA 3HOZB 1T5XD 2KCMA 1JC7A 3DM3A 1Q1BA 2N55A 2QKIC 1O7ZA 1S40A 4R9WA 2UXCL 3D3RA 3D4RA 3A55A 1DOLA 4KJNA 2K5DA 5KRUA 3J81j 1Y8NB 4TSSA 4K2KA 1MBYA 3TDQA 1WCMG 4DV1L 4OO1G 2RA4A 2D0PA 3FKIG 5GAHC 2G5DA 3H0GB 3TMEA 4A3GG 1T5EA 3TQYA 1HNXQ 3J80E 2L9HA 1PYWD 1NR2A 1SRUA 1F2ZA 1LACA 1I4HA 1I4GA 3S1QH 2EYLA 3CMAA 2EY6A 1TWCB 1Y1VG 2E2DC 2OT2A 3GO5A 2H5XA 1YITA 1YJWA 3BDOA 2C35B 4A3DG 1IXRA 1STAA 1ESRA 3RLFA 2FJ2A 3OIPA 4RGTA 1CTMA 2HCCA 2F3WA 1HUMA 3H3VC 2R61A 3A7AB 4ZYSA 1U4LA 4JOIA 1GUGA 3CQZB 1YHBA 3A8JE 1EQVA 1GUOA 2AMCB 1RTNA 4YY3L 4XIGS 2QGQA 1U5KA 1EQTA 2AWNA 2SNMA 2NZ1D 1LM0A 2PZTA 4OONA 1Q82C 3BDCA 4OGQC 1SAPA 1KLGD 1BCPD 1H9SA 2R6GA 1SLJA 4CJ0B 4JPBW 1N33L 2EXDA 5FKAC 3TZDA 1QZHA 4ALPA 2ZXPA 2R7ZB 1HNZL 5T1GA 1XXGA 4MIUA 1A62A 2D5DA 1JQYD 2UUCL 1HCZA 3I4NB 3CU7A 1E2WA 1E1TA 1EY4A 3I91A 5IOCA 5IT9L 2MHVA 5M3FH 2KCNA 4QF4A 2F0PA 4R4QA 3TP7A 4DNIA 2CW0D 4A3DB 2SOBA 1C48A 1TWCH 4PV1C 1DCZA 2UXDQ 1B53A 2EVBA 2K50A 4POFA 1Z47A 4X3TA 4BY1G 1KLUD 1YNND 4ID6A 4GKJQ 3T1YQ 2IX1A 2CQOA 4XQJA 4POGA 2ZTCA 3SDZA 2OEOA 2Z6BA 1PH3A 3GTMB 3H0GG 4A3GB 4IUNA 4IQZA 5FO8B 1QWYA 3KLRA 3U4ZA 2O4XA 5C5LA 3HOWG 1HR0Q 3S2DH 4LF7Q 4F87A 2B2YA 3EJIA 1VQ9A 3V2TA 3KDFB 3L9AX 1HHVA 3PO3B 3AEVA 3S1RB 2UUBQ 3CF5A 1BQQT 1WVLA 3I4NH 3NSWA 3ZJYC 2R7ZG 3NQTA 3U9OA 1I4RA 3EVQA 2L55A 3Q24A 4HJAA 2R7DA 1FJGL 1SYBA 1XTDA 2WIIB 5IP9G 3QIAA 2ID0A 4DV7Q 5IT9E 4BBSH 1G6PA 4DUZQ 1SNPA 1I94Q 1FYCA 3GTKB 4A3JH 1HR0L 4HJ9A 4JI1L 1BCPC 2X6GA 4ZCKA 2EY1A 3JAMc 4B3MQ 4JYAQ 5E4XA 1VQ7A 4YCVA 2L15A 1F2LA 3A5UA 4IFDI 1SROA 4AYBB 1B3AA 3DMUA 4GKJL 2V1CC 3RD4A 4DV7L 3MFYA 2HDLA 4HIDA 2OQKA 4IFDJ 1IBMQ 1B3QA 3C1EA 4RMFA 1J8IA 4N8FA 5K5PA 3PF4A 1UAPA 3CCEA 1I6HH 5DNFA 2EQSA 1AW7A 4MTKA 5M3FB 2N8NA 1KAWA 4FXGC 2MNAA 1P8LA 4DV6L 3S16H 4B9XA 5C6AA 4C2MH 4A3FB 1M90C 4X3UA 1HH2P 3ZYYX 4QUFA 4MHEA 4A3FH 4OX9L 4DA2A 5EBDA 4DUYQ 3ER0A 1B9MA 1B1ZA 3J81c 4KD3A 3K80C 1OXSC 1UWVA 2JA7H 1WTOA 3QR8A 4JI7Q 4KHPL 2TMPA 3LGJA 4DV5Q 2PMZE 3Q8DA 3GDEA 5C4HA 1D7QA 3M3YH 3PO2G 2RCNA 4UP7A 3U9SA 3MTSA 3S1QB 4DR2Q 1GKHA 4DV0L 1TVXA 1ENCA 1ASYA 4HCSA 1DZ1A 1SMYC 3STBC 4WJ4A 1Z7TA 2JJQA 5KNBA 3KF8B 2F3IA 1TQOA 1PH7A 4XXEA 4A4IA 1JJGA 1L1OA 2B2TA 3A0JA 3SK4A 3URYA 2K5HA 2OQ0A 4DAMA 1A0IA 3FRPB 3GTOB 1BCPF 2JK8A 3OWEB 1K3RA 4IZ8A 1JJCB 2NB0A 4I65A 5FLXc 5JJLA 1TKWB 2RHSB 3JAML 4AQYQ 2E8GA 1L2FA 1Y1WH 4V190 2N49A 4RCOA 5JJIA 3HOZH 3HOXH 1TS2A 4GKKQ 3AB9A 1MD2D 3MXUA 5AJ3L 1UE1A 3H15A 4BBRH 3HOUG 1Y14B 3VYRA 3KJOA 1SSOA 1VQBA 3D4WA 2IPKD 4DV2Q 5KNDA 2Z6KA 1TXYA 1LABA 3BDLA 2XGTA 4HJ7A 1E7ZA 1GXDC 4O1NA 4DNTB 1KDCA 4DR4L 2F1MA 3I72A 1K83H 2CH4A 2JA9A 4OO1H 4HCEA 2Q2UA 1TS4A 1STNA 1XX8A 3E3XA 4QJFA 1S5DD 1K8MA 2J4XA 5I6WA 2LMCB 3CCUA 2N3SA 5M9OA 1HQRD 4LJZC 1CQFA 1HTLD 4OWWB 4R1JA 5E1FA 2PQAB 2ZXRA 3I3CA 1UEAB 4LK1C 2ES2A 3S14B 1H9KA 1LT4D 2F0NA 2FMCA 3U4VA 5IP9H 4F7XA 2ASBA 1KABA 5IGBA 2DNEA 2KENA 5CGKA 1OXXK 1Q81C 5DAUA 1UE6A 5C0XG 4KN4C 4C1NK 1SNQA 3R8BA 1JOOA 4IFDG 2K5QA 4MN3A 2A6HC 4HN7A 3VR4A 1RJTA 4C2MB 4LF8L 3T51B 2XRSD 2L11A 1CA6A 3QO2A 4FVMA 4ULLA 4GLAC 3U50C 2K5VA 4JYAL 3CW2C 4C3HB 4LF4Q 1TWHB 1L1OC 2B2TC 1PH1A 2R93H 1OXVA 1YZ6A 3GQBA 5CV7A 5FO7B 3S15B 1C0AA 3DEPA 4KY5A 4X3SA 4DUZL 1XMQQ 5E3FA 3HOYH 1ILPA 3P75A 1OTCA 2EYFA 1PFMA 4A3EB 1CA5A 1GHJA 1GM5A 4XTCS 1IZ6A 2EY5A 3FPUB 1SXTA 2D0OA 1BF4A 4DXGA 2XRQD 2WKCA 1BVSA 4FF3A 2HUGA 4RKLA 5IGDA 2E2HH 2J0TD 3PUVA 1RIPA 2L4NA 4JW0A 4PMWA 4NXML 5C44H 4Y7NH 1S4ZA 3C46A 4DV3Q 4K0KQ 2JEBI 4JI6L 2EYMA 2O5IC 4G7OC 3F8TA 1YEZA 2EYJA 2SEBD 4ODGA 3T56B 2JSOA 2ZJQA 2UXBQ 3HFZB 5JVH3 3CCSA 4LUVA 4FO2A 1AE2A 3IAYA 4LF7L 4GS3A 4K6DA 3ITPA 4IUTA 5M5XB 4HJ5A 2EE1A 1PZID 4X3KA 3HOYG 5IIFA 5LMNL 3D31A 3NBIA 2ZM6Q 4IPCA 3GTLB 4IPGA 4TQUS 3M4OH 4IOAA 3BS1A 4A3CH 1H9JA 1I3QH 4X64L 3BU2A 2VUMG 1L0XB 1PFSA 1STGA 1NE3A 2I5MX 2UU9Q 4QUCA 3OIQA 1FJGQ 1VQ4A 4JI6Q 4A3GH 1EY0A 4HMIA 1H95A 2IT1A 5IYDH 1VQPA 4L5TA 1Q8KA 4P71A 1EFWA 1PVOA 1CKMA 1TWGH 3NELA 4C1NI 3OSOA 1XYIA 1VMPA 1PMRA 2RBMA 2NVXB 1LUZA 2NZOA 4DR3L 1MHWC 3FVQA 4I7ZC 3VYUA 2JA6B 1IW7C 3GTQH 1RKNA 4DR4Q 1SYGA 5JJKA 1CQVA 1EEID 2BDNA 1EY8A 1N36Q 3W1GA 3I90A 3J7AV 3RLOA 1N32Q 4NDXA 5EAYA 1E2VA 1S5BD 5E4WC 3K59A 4A3IH 1LTBD 1NSNS 4BY7H 4X66Q 4A3FG 1EU4A 2OWOA 2K32A 2PI2A 4GKKL 4CDEC 1BBWA 1FD7D 2F52A 4PMCA 5KGUA 1LO5D 1EY6A 3TS0A 1E3PA 2B2WA 5IGGA 1SE3A 3R2TA 3S15H 2DUDA 1XPOA 1OO9B 3MWYW 3BYTB 4ME5A 2Q8IB 1SNDA 4RGMA 1VQKA 1EOVA 5M3MB 4C56C 1LTLA 3L7ZC 3J81E 2B2YC 2EYPA 3RZDH 4EQOA 1A6XA 4NW2A 4KMUC 5DM73 1SN8A 3SK8A 2RCFA 3T1HL 1QG7A 3HEJA 1R4QB 4FF4A 2ENBA 1KXLA 1CKOA 2NBFA 5CR3A 4X66L 3H94A 4GOPC 1K0SA 3G4SA 2K1BA 4F8MA 3PIO3 2JA6G 1I5FA 5EGTA 1D6EC 2HD3A 4X65Q 1ASZA 5GAEC 4IUQA 4ZKBB 1HFGA 3PIP3 1WD0A 4BY1H 1AZQA 4J8QA 4GN4B 3X3MA 1I94L 3P1HA 2HHHQ 2AQ2B 5DEHA 3DM1A 4XT1B 1IKLA 3L2PA 4LF6L 3RZOB 2L12A 3HOWH 4CHTB 2PPBC 1L1OB 3C2PA 4A3BH 5GQOA 5M3MH 2IWHA 1SYDA 1X3GA 4KJOA 3S2HB 5EPJA 3HOVG 4N9TA 3CKIB 3I73A 2FMMA 5EPKA 5CV9A 3AMUA 4Y52H 1X3EA 4GOPB 1EL0A 1HA6A 1X65A 3RN2A 1PA6A 4OWTB 3GTKH 3NTKA 3M85A 1K8GA 1IKMA 4S3SA 2A6EC 5I4DA 4R4IA 3K58A 4JI0Q 3CCRA 1F9RA 3J7ZC 3KLSA 1O78A 4KKUA 2FFKB 3PF5A 4BS9A 5LMNQ 1GHKA 4A93G 4FXKC 4YWLA 1GOZA 1PH8A 4DR1Q 3KDFA 2JA5G 2OCEA 4JBMA 3AQQA 4OHJA 2KHIA 3S1RH 2XIWA 3SE0A 3GTQB 4JK1C 2ZJPA 1TS5A 2NN6H 2K7VA 4JBJA 4ZRZA 1V43A 3PSIA 2VW9A 4LMQD 2K5WA 1SFOH 4L8JA 1Y1VH 1R9TH 2PMZB 1KNEA 5CV8A 3H3VI 1BR9A 1CFMA 4KY6A 3K7AH 4M8AA 1ZEQX 1A3UA 3A7LA 2OTLA 1XNQQ 4LF9L 1SBBB 3BZKA 2RDGA 2H4OA 3R2IA 4P2CB 5H1SE 3DHQA 4DR1L 1KAAA 3Q0AA 2LS01 2HQEA 1HQMC 3T4AC 1S5FD 4AIMA 3WOEA 4JI0L 2Q8RE 1IBLQ 2WFWA 2DGYA 2B8GA 5AFWA 1Y8OB 3I4OA 1BBXC 3GTMH 2LXKA 3T16A 1DJRD 2LXJA 2MQHA 4JI8Q 2BA0A 3MA2B 2VS1A 1SEBD 4GZYC 2KUMA 1HNWL 1TWHH 3KF6B 1LTRD 1HFNA 2PI2E 1BCPB 1NTGA 3FHWA 2VUMH 1SE2A 3AYHB 2BDOA 3NTIA 3HG9A 2A6ED 1U0LA 5FLXL 3LX0A 1VQGA 2AWOA 2MP1A 3GTOH 2KCCA 1V1PB 4C3JB 1N33Q 2WACA 5BR8Q 5IGEA 2F0TA 1QNUA 5JEAG 4DR7L 2ICIA 4R4OA 4A3EG 3HOXG 2F0FA 2EIFA 4DV5L 2NN6I 1EIHA 5HY6A 1ICWA 1LV9A 1LT3D 3E0JA 2NVYH 3K5LA 2YU9B 1KNAA 1ZKOA 5EKLA 5EKKA 4QIWE 1FNWA 2BE5D 3GTPB 3ULJA 4O2DA 1IL8A 4L6TB 4ILWA 1LTSD 3FP9A 3KJPA 1TY0A 5IWAQ 1VQ5A 2RSNA 2QDBA 1HJPA 1D5MC 4N9PA 3JC66 1SYEA 2VXWA 3SXHA 5I2XA 4JBWA 3D6CA 4R8IA 3OYYA 3KLWA 2YTYA 5KNCA 3NBHA 1XNRQ 5ELFA 2KECA 4XYOA 2KCTA 4EGVA 4DAPA 3L0OA 1DM0B 2A5HA 5D3DA 1E22A 1JWUD 1DD2A 1I3QB 2F0MA 1L0YB 2JN4A 4HMJA 1VQOA 3MEFA 1EUJA 3HOXB 3M4YA 3E9IA 3TP8A 4P73A 3K5MA 4A76A 1IHZA 4A3DH 1Y1VB 1R9TB 1VQ6A 1FNUA 1FNVA 3GTGH 2M9VA 2F0SA 4M1UB 4BBRG 3PMFA 2ZM6L 4JI2L 4K5XA 4A3JG 1DXMA 2KHJA 4KHPQ 2JA5H 4P75A 3JAME 4DPGA 1TWAH 3NXWA 4CJ1B 1N8RC 3KK7A 4LF5L 2Z4IA 3Q22A 2E2IH 5DM63 1YVCA 1IBKQ 3AU7A 3FEWX 2L5TA 3G6EA 2JXMB 5M5YB 5JVG3 5CBAE 4HR7B 4H44C 2EOTA 1I6VC 2F0QA 2JEAI 3VA5A 3M7NA 1K8OA 4KTAA 2QW7A 4R8NA 1DOMA 1I4XA 2RHQB 5EBCA 3RMHA 3ICEA 1UE5A 2F4VL 1RDPD 3AFQA 1D2BA 1ET6A 2F0KA 3JAMi 4AYBG 1W6KA 5C5MA 5IGCA 1EU3A 4YCUA 1HA5A 2F0WA 4PZ8A 5JJZA 2E2JH 3Q23A 3S1NB 4P74A 1HTPA 2SDFA 2WAQG 3DWAA 1EQRA 5EJWA 1NMGA 4JBKA 5J39A 3M9BA 1IBML 3CP0A 4B3SQ 5E7NA 3EIVA 1EYAA 5CMDA 4DV1Q 1M8AA 1BO0A 1RTOA 1WI5A 1J9OA 5EPLA 1AEXA 3GP7A 4RHSA 3DUZA 2KVMA 2PNHA 2EJFC 2KEEA 4LUZA 2PZWA 1FGUA 4Q5VA 2B2UC 1KD1C 3V96A 3GTLH 2Z9HA 1F2YA 1Y1WG 5TSSA 1XNQL 5ELOA 5HURA 4OIJA 1B70B 3SHLA 5C3EH 3UDIA 3BVZA 1EYGA 5G3LF 1Q8IA 2K28A 2EJGC 5JPNC 4RFBA 3UE1A 2EZVA 5FLMH 2G9DA 3CPWA 3J7A5 3A8IE 2A1AA 5FLMG 4NXMQ 2A74C 3TP6A 4WFN3 4CGYB 5HGTA 4KK7A 4J15A 4YWMA 1PRTC 5JOBA 3IFTA 1PTOH 2RDFA 2WP8J 2ZTEA 4QMGA 3R93A 2E5LL 1O7LA 4OELB 1EIFA 2AUJD 4YHHQ 1FL0A 2R92G 1JB3A 1SNOA 1JMCA 3K6OA 3K5NA 5IYCG 2EYOA 2K4KA 4A3KB 1B4OA 1DGSA 4PNYA 1A8VA 1VQEA 2KJXA 5CV5A 2K6AA 2HIVA 3GTJH 3A8KE 4KHZA 3HOUH 2O5JC 3TREA 1J6QA 3NP8A 2X6LA 1LTID 2FHTA 1Q12A 3O13A 4JI5L 2F3VA 1Y1WB 5C4XB 2E75C 3SGIA 3UDXA 4C3HG 5FLXE 2E74C 3T1HQ 5ELCA 1QJOA 1WJJA 2EPBA 1LT6D 2VZAA 1K3BC 2MUYA 3RR5A 1SE8A 4JCVE 1QE6A 1EIGA 1QNKA 1N34Q 1GUTA 5C0XJ 1Q3LA 5K36G 2WAQE 4NMZA 2F4VQ 3IRBA 3A74A 5IYDG 1KTKA 2J7ZA 2B63B 2NVQH 2CWPA 4A3KH 1LLRD 4LWCA 3PO2H 2F0EA 4GN5A 1M4VA 1HNZQ 3V05A 4YIJA 4IUPA 4J1MA 4WJWA 1OXUA 1EYCA 3F2BA 5C4JB 1KHIA 1O7IA 1Q86C 2AUKA 2NVXH 2MPMA 3I55A 2EXZA 4QGUA 3S1MB 3BG3A 4RG1A 5M5YH 1WTVA 2F03A 3RZOH 3PGZA 1GVPA 4GN3B 1BXTA 3RNUA 2NWGA 1CSPA 1W2BA 1K28A 4HSPA 1PV4A 3CC7A 2WINB 2Y0SB 4EVOA 4QQBX 4ZUJA 3ONAB 4IPHA 3HKZG 2A6HD 4PZ6A 2A68C 5LL6X 1JICA 3F1ZA 3PUZA 4NXNL 1WTRA 2F0IA 3X3NA 3P7JA 5IE8A 1U9RA 2HIXA 3OTOL 4IUUA 2K52A 1KDAA 4RGOS 2F0UA 4BY7B 2VQFL 3KUPA 1YBYA 3TP5A 3N52A 2VY3A 1K73C 3K7UC 1NJIC 2MO0A 3WOFA 2I07B 4CKBA 4QB4A 4GNXB 1QVCA 1B8AA 1MJEA 1XPRA 2HQLA 3S1MH 1HXYD 1AN8A 3KBXA 3QJYA 4IN3A 5C44B 2JA6H 1N32L 2K03A 2DN8A 3M3YB 4BA2I 5AJ3Q 5LMUQ 3GV6A 4N8X1 2RSOA 3F2CA 5CV6A 4IURA 1P16A 3IFDA 1QCBD 1A2UA 4KI0A 3N6RA 3KF8A 3H0GH 3I8ZA 1JOKA 3NEMA 3LNNA 3MFGA 2DY8A 1PZJD 2EDGA 4RKBA 3UI2A 1NBWA 3G6JB 5ELNA 3PIPA 1VQFA 4XQNA 3OPOA 5T1IA 4PQXA 3QOLA 1JWSD 4IOCA 4X62Q 1A15A 3WDNA 2E76C 4DR2L 3FPPA 1JR0D 3HZXA 5JPMC 1YNXA 5IYCH 1ET9A 1V1OA 5HGQA 1H9RA 1PLFA 2I5LX 1Z9FA 4DV4L 3NPPA 4B3ML 1S3OA 1YHAA 2F0LA 1KC8C 1PTOF 1WCMB 2BCOA 2F0HA 1AFPA 1DONA 3CRKC 1S5CD 3CPFA 2DJGC 2KA7A 5EKIA 2A68D 1JB7A 1E2ZA 3J81L 2IY5B 1IW7D 4DGZA 2XWBB 1GUWA 5C4JH 1VS0A 2E2HB 4UAIA 1R4PB 4LAAA 1WTQA 5K36H 2CQAA 1EZ6A 3BVGA 5A35A 1U4PA 4ZKCB 2Z8LA 1PXUA 3OWFA 1WTXA 3OW2A 2DNCA 1C9OA 3T13A 4DAYB 2CVRA 1SJHD 1WTWA 4KLKA 2UUBL 1HRJA 1PH9A 2R93B 3I4MG 5FK9C 4LFBL 2VL6A 1PH4A 2OXPA 2R3ZA 2VQEQ 2UUAQ 1II3A 5D65A 2I46A 4DK3C 3K0XA 4FF1A 4DFAA 4LNQA 2VQEL 2UUAL 3T1YL 1X6OA 4B9WA 1QVGA 4DV4Q 2ATWA 2E2JB 2AQ1B 5IT9c 4X62L 3G7LA 3HOYB 1D5ZC 1G291 2K14A 3BJUA 4WRDA 2ZT9C 1J5EQ 3EQLC 4DNRB 4EX5A 2C9OA 3GTGB 1VQCA 1JJ2A 4QCLA 2ZJRA 1DYQA 2CW0C 4A93H 3HKSA 1X3FA 4C3HH 1FR3A 4B3RQ 4OO1I 3J7AF 2A69C 1E24A 1WCMH 3HOVB 1B44D 1MJCA 3M7GA 2OTJA 5KYIA 4GLXA 1PH5A 4CDDC 1RCVD 3MXNA 1UEBA 3QG1A 1LTTD 3VR5A 1TWAB 4KD4A 2HHHL 1LTGD 3FKIH 1QUQB 2NN6G 4KKSA 2NZHA 2RDHA 2DY7A 3C3LA 3I2ZA 4H0LC 2DJFC 5CYUA 4BA1I 4DR5Q 3HOZG 1B9NA 4K5VA 1EZ8A 1ENFA 3AFPA 4DKAC 2FINB 5IYBG 4AQYL 2LFNA 3A54A 4IJHA 2D2CC 4Z9CB 5ELDA 2XVSA 2WB1E 2EYHA 5L37A 3D0FA 2ALYB 3MXNB 4MNOA 2RVLA 2KQ3A 1D8LA 1PZKD 1BNZA 1VQJA 1C8CA 1FGBD 1Z6HA 3RN5A 5C4XG 4JI3L 1TWFH 3M4PA 1VQAA 1EWHA 4CDFC 5KIXA 1CKNA 1PTOD 3CXCA 3NQIA 1D5XC 2B2UA 2B8FA 2XNAC 2JA7B 2BA1A 4IUVA 3BZDB 3CCLA 4DF7A 4LFAQ 4H7BA 1QZGA 1MIUA 1O7YA 3J80c 3EROA 1G6ZA 4K8JA 4A3BB 3LWUA 4ZUIA 2IJ0A 4DK0A 1JORA 5NUCA 4LFAL 3BZCA 3EA6A 4R4CA 5M3FG 3TS2A 4JI1Q 2JA8B 5BR8L 2MJ8A 5IP7H 2P5ZX 2WB1B 3OTOQ 3W1BA 3S17H 2BH2A 4JI3Q 5JEAH 1SNMA 1X9NA 1V8QA 1RODA 1G8ZD 1PRTB 3OMCA 2JA7G 2AHOB 2A69D 2G9HD 4K6LA 1JT8A 4CKCA 3K7AB 3P20A 2FXQA 5C3EG 3UDFA 1VQMA 3G48A 4NB3A 5C0XI 4QIWB 3OOCA 3I4MH 1XTCD 4CDCC 5M5XH 4C3IG 4JOIC 1HNXL 1D1KA 2LY7A 1STBA 3MZ5A 4L63B 1EQQA 2B63G 4A3CG 2UU9L 1EY5A 3H91A 4HIOA 4B08A 5M5WH 1CSQA 3VR2A 1A3TA 3TSSA 4DR5L 3H09A 2Q2IA 1H9SB 3GTPH 4YWKA 5GROA 1SR3A 2PW5A 3CC2A 3UDGA 1UUPA 2WAQB 3GTJB 3D4DA 4IPDA 3H3VH 2VNUD 3NBHB 1I50B 4ME3A 3VR3A 4HAEA 3PO2B 1TU2B 4U673 4WORA 2R7ZH 2QILA 5GAGC 4DN4M 4RH6A 2Z6KC 1CZWA 2SNSA 1YI2A 4B3SL 1SYFA 4R4TA 4HSVA 4I7AA 1HPCA 1ZXTA 2B39A 1K9MC 3PUYA 5A2QE 1IYUA 1VF7A 4G4KA 4A3MH 1VQDA 2NUCA 1SNCA 1SYCA 5LMNW 2Q2TA 3PO3G 4BBSG 5F2DA 3PO3H 1PTOC 4AYBE 1AP0A 2JA8G 3S2HH 1J5EL 4QY7A 3WWVA 4A3LG 1SJED 1TS3A 4Y7NB 1YJNA 3KFUA 1VDZA 2N88A 3CCJA 1LYLA 2D9UA 5A2QL 4A3JB 3L3OC 3K57A 3I56A 2IHFA 2B29A 1IBKL 4RCNA 2QCPX 4PZ7A 1X55A 2V4DA 5C3WA 5LMUL 4FXDA 1VF5C 4O0AA 2F0VA 4LF4L 2RQXA 1EWCA 1AZPA 1ILQA 2HT1A 3PIOA 1CKNB 3PQIA 3S24A 3RUZA 1HZAA 3E0EA 5C0XH 4AH6A 2L0CA 4L5SA 1K8AC 4LFBQ 3HP3A 3S17B 4PG3A 4UHVA 1CHQD 1XMOL 4KV6A 4DK1A 5JAVA 3E5SA 1G2TA 2Q2HA 1EWIA 3Q6SA 5IODA 1GD7A 1HZBA 5BN5A 1BKBA 1B7YB 2F0JA 1PH6A 4HJ8A 2Q8TA 1U4RA 4FYDA 4APVA 1Q90A 1MSGA 3CD6A 4FNFA 4LF6Q 1TY2A 2Z4HA 4XT3B 3F2UA 2Z0SA 2Z1CA 3MEHA 1QUQA 2BOSA 4NKLA 2K5NA 5I2YA 1BOSA 2E2IB 2N78A 2WV6D 3D6WA 1ONLA 3CHBD 4XQQA 4JI7L 1D1IA 1S5ED 2JA5B 1NAPA 3NUCA 3HOWB 2NTSA 5M3MG 4E6IA 5IP7G 3NHHA 4DK6C 2HCIA 1N36L 4DUYL 1G2SA 4JG2A 4KKTA 4EQPA 1KRSA 4BBRB 3HKZB 4BY1B 4YCWA 2KEDA 1VCIA 2QDLA 2C5CA 4RAUC 1PH2A 1HUNA 1STYA 2X69A 2YV5A 3NE5B 1VQLA 4NXNQ 5IYBH 3FKIB 2IX3A 1Q7YC 1E0BA 3KF6A 2MGSA 5I9OA 4L5RC 2CCZA 3KLSX 3SK6A 4KHVA 4CBVA 1V1QA 5IWAL 2QEXA 2M2LA 3EN2A 3CCQA 4A3IB 4X64Q 2AKWB 2A19A 3F2DA 4G7HC 5GADC 1KIXA 3MC0B 4HTHA 3HOVH 3IKJA 2A73B 1X3QA 3CCMA 4DV2L 1NR4A 3MVVA 2UXCQ 5IGFA 3QB3A 1PRTD 3RLNA 4DAYA 4WJ3M 1SMXA 1SFOB 2H1EA 3VYSA 4DR3Q 4KN7C 3HKZE 4CJ2C 3HGBA 3W5OA 2E5LQ 1QILA 1BDOA 1C4QA 1K83B 2PCFB 3NK9A 5DLQE 3FMCA 3RZDB 4BY7G 4B3RL 3M4QA 1JCKB 3K8AA 1JE4A 4CKEA 3A5ZB 1PHJA 2PO4A 1STEA 3TZUA 1MSHA 1N34L 3BVMA 1L0WA 4J6HA 1VMCA 1MKHA 4JI4L 4IJLA 3S1NH 1ENAA 1ZYRC 2GN5A 4A3KG 4JI5Q 4K2LA 2NVQB 5CBEE 5FJ8G 4XYQA 1SDFA 3DWQA 5FJ8H 3T53B 3QWNA 4C3JH 1BUVT 3I7FA 4PMBA 4MZ9A 3DXJC 3NENA 2AQ3B 2K75A 4UDUC 2PW7A 2UXBL 2LSSA 4UY8C 1CT1D 2JQOA 4LFCQ 3CAMA 3GV3A 3CMEA 4JVZA 4DV6Q 4GOPA 2M00A 1JE5A 2PYKA 1PYBA 2XN9C 2BE5C 3I4NG 2IX0A 2R92H 3QOJA 2GA4B 4UP8A 4BXXG 4NP5A 4EQ5A 1PFNA 3DLLA 4RHRA 3I4MB 1XMOQ 3CCVA 4ABNA 5J1ZA 2NYZD 3VA7A 1OXTA 5IY0A 4RWSC 3E6ZX 3NWSA 3BYYB 1IBLL 3I4LA 2GVBA 3S16B 2B2WC 1CZGA 5COYA 4LF5Q 2XSCA 2PQAA 1YNJC 1AH9A 3PUWA 5BN3A 2QA4A 4A3LH 1WOCA 4JV5Q 4C3IB 3S2DB 4A3MB 4LF9Q 5JEAJ 2R7FA 2B2VA 2B3GA 4OEMB 5C3EB 3G71A 4K8IA 2B2VC 4A3EH 1C7YA 2F0DA 2VQFQ 2UXDL 2Y0SE 1IYJB 1X56A 2VB3X 5EQ0A 4DV3L 2YU9H 4K0KL 2JP1A 2TSSA 4HEDA 2R92B 2YYZA 2NVTB 3K5OA 1I50H 3KYHC 4TKOB 2KBNA 1B2TA 3VDYA 3TRZA 1CUKA 4DR6Q 4FF2A 1S72A 2UUCQ 1SE4A 1TWFB 2WKDA 1K0RA 2K01A 1RD9D 2JA8H 4IALA 1EFID 3I70A 1HR0W 1G51A 3CC4A 4BBSB 3FDTA 3ND9A 1CHPD 1G91A 4NPSA 4X6AH 1QB5D 3CRLC 4TRDA 4X65L 4JI2Q 3U58A 5I9PA 3HRZC 1GO3E 1YHQA 1CI3M 2PQEA 2IHEA 1GUNA 3W2DA 1PYSB 2IL8A 1WTPA 1Y69U 1STHA 1AE3A 1IL2A 2K04A 4YY3Q 1HZCA 5CV4A 5BN4A 4OWXB 3OHXC 1I4QA 2XTIA 2KHSA 3ERSX 4FP5D 1VQIA 2HDMA 5C44G 1KL9A 1TWGB 3J80i 2JE6I 1PDQA 1YNNC 3W3AA 1B50A 4A3IG 1X54A 3B6YA 3TBIB 3J81i 4U68A 1PRTF 4TVAB 3OW7A 3TEHB 3SK5A 1UNSA 3DEOA 2F0GA 4G57A 4HIKA 4OXPA 1DOKA 3SEBA 1W3SA 1WTHA 1IYVA 1YIJA 1VQ8A 1YNJD 2NTTA 4JI8L 2CH4W 1T9HA 4RGNA 2ZTDA 4LUOA 1EYDA 4DXFA 1Q1EA 3E9HA 2JYOA 2WB1G 4DV0Q 4K5WA 5ELBA 1RF2D 4C3JG 1XWEA 4JC0A 1V1PA 2F4IA 1F77A 3KOJA 2EJMA 4JV5L 4MTNA 1TIID 2Y0SG 1HZ9A 3TN2A 2B63H 1KRTA 3UE0A 1A63A 2I0QA 4B3TL 1F9SA 3DWPA 4DR7Q 2D62A 4V0BA 1JOQA 4A3BG 2NVYB 2BH8A 3HOUB 2K05A 1I4PA 4Q0FA 1EY9A 1GUSA 2NVTH 4XDXA 3M4OB 3MHBA 1WYDA 2CFMA 2F0OA 1Q46A 4ZK9B 5I6YA 1W6JA 3IL8A 1TR5A 2XWJB 5D14A 3SVMA 2QF7A 4DR6L 2CWAA 1X32A 1GJXA 1CK1A 3ULLA 4GNXC 3NWTA 1WFQA 4A3MG 1F2MA 1FVIA 1XJVA 4EQNA 2KOLA 3SR1A 4K14A 1F9PA 1MI2A 1N9WA 4C3IH 4A75A 4F88A 2MFIA 3NTHA 2RF4A 5J22A 3OMGA 3J80L 2ZXOA 4KY7A 2OF1A 1XPUA 3A56A 1RHPA 1QVFA 1PTOB 2K33A 1NCVA 1RL2A 4DU9A 4GLVB 1TT2A 4QL5A 2GVAA 4GNXA 1LT5D 5C4XH 2QEJC 1I6HB 5CC4A 5M5WB 2R93G 2VUMB 2EY2A 3EFXD 4UP9A 1NY4A 1EOTA 1EEFD 1MGSA 4L5QA 4YHHL 3ULPA 1KQSA 3KBGA 4OX9Q 4ZQ3A 5C4ZA 2IW3A 1NMFA 5ELEA 1YJ9A 4JI4Q 2YTXA 1LTAD 3D8GA 3K0YA 4BWGB 5C3XA 5KYLA 1NUCA 5G3LD 1M1KC 3HS0C 5ISRA 1VQHA 4IFDH 4H13C 4OL7A 1ML0D 4DAVA 4P72A 1HNWQ 2MO1A 3S9WA 2PNRC 3LWEA 4A93B 5FOBB 1KDBA 2CKZB 2VB2X 1SMYD 3STBD 4HIMA 1XMQL 4LFCL
chains in the Genus database with same CATH topology
3R3OA 1O80A 1WD1A 4RA8A 3VYTA 3H6MA 3VR6A 2L1BA 4ZLTF 1F9QA 1QOHA 2CHBD 3ND8A 3J7YW 2LKVA 3MAQA 1Y8PB 3MXPA 2PZUA 1X3PA 3PV0A 5KEEA 5LHY1 4O42A 5FO9B 1ZYRD 1CM9A 1H9MA 5CORA 5LL6S 4OIKA 3GD7A 2ICEC 1A2TA 1PFBA 1EY7A 4G7ZC 2O2LD 4ZAIA 3C1FA 1A3VA 1ESFA 3ERQA 3MXGA 5D3IB 3PUXA 1U4MA 1JWMD 2RKSA 3HOZB 1T5XD 1JC7A 1Q1BA 2N55A 2QKIC 1O7ZA 4R9WA 3D3RA 3D4RA 3A55A 1DOLA 4KJNA 2K5DA 5KRUA 1Y8NB 4TSSA 4K2KA 1MBYA 3TDQA 4OO1G 2RA4A 3H0GB 3TMEA 1T5EA 3J80E 2L9HA 1PYWD 1NR2A 1F2ZA 1LACA 1I4HA 1I4GA 2EYLA 2EY6A 1TWCB 2E2DC 2OT2A 3GO5A 3BDOA 1STAA 1ESRA 3RLFA 2FJ2A 3OIPA 4RGTA 1CTMA 2HCCA 2F3WA 1HUMA 3H3VC 2R61A 3A7AB 4ZYSA 1U4LA 1GUGA 3CQZB 3A8JE 1EQVA 1GUOA 1RTNA 4XIGS 1EQTA 2AWNA 2SNMA 2NZ1D 2PZTA 3BDCA 4OGQC 1SAPA 1KLGD 1BCPD 1H9SA 2R6GA 4CJ0B 5FKAC 3TZDA 2ZXPA 2R7ZB 5T1GA 1XXGA 4MIUA 2D5DA 1JQYD 1HCZA 3I4NB 3CU7A 1E2WA 1EY4A 3I91A 5IOCA 5IT9L 2MHVA 2KCNA 4QF4A 2F0PA 3TP7A 2CW0D 4A3DB 2SOBA 1C48A 4PV1C 1DCZA 1B53A 2EVBA 1Z47A 4X3TA 1KLUD 1YNND 4ID6A 2IX1A 4XQJA 3SDZA 2OEOA 3GTMB 4A3GB 4IUNA 4IQZA 5FO8B 1QWYA 3KLRA 2O4XA 5C5LA 4F87A 2B2YA 3EJIA 3V2TA 3L9AX 1HHVA 3PO3B 3S1RB 1BQQT 1WVLA 3NSWA 3NQTA 3U9OA 1I4RA 3EVQA 2L55A 3Q24A 1SYBA 2WIIB 3QIAA 2ID0A 5IT9E 1SNPA 3GTKB 1FYCA 1BCPC 2X6GA 2EY1A 5E4XA 1F2LA 4IFDI 4AYBB 1B3AA 3DMUA 3RD4A 3MFYA 2HDLA 4IFDJ 3C1EA 1J8IA 5K5PA 1UAPA 5DNFA 1AW7A 5M3FB 4FXGC 4B9XA 5C6AA 4A3FB 4X3UA 3ZYYX 4QUFA 4MHEA 4DA2A 5EBDA 1B9MA 1B1ZA 4KD3A 1OXSC 1WTOA 2TMPA 5C4HA 3U9SA 3MTSA 3S1QB 1TVXA 1ENCA 4HCSA 1DZ1A 1SMYC 1Z7TA 5KNBA 1TQOA 4XXEA 2B2TA 3SK4A 3URYA 3FRPB 3GTOB 1BCPF 3OWEB 4IZ8A 2NB0A 4I65A 1TKWB 3JAML 4V190 4RCOA 1TS2A 3AB9A 1MD2D 3MXUA 3VYRA 1SSOA 3D4WA 2IPKD 5KNDA 1LABA 3BDLA 1GXDC 4O1NA 4DNTB 1KDCA 2F1MA 3I72A 4OO1H 4HCEA 1TS4A 1STNA 1XX8A 1S5DD 1K8MA 2J4XA 5I6WA 2LMCB 5M9OA 1HQRD 4LJZC 1CQFA 1HTLD 5E1FA 2ZXRA 3I3CA 1UEAB 4LK1C 3S14B 1H9KA 1LT4D 2F0NA 2FMCA 4F7XA 1KABA 5IGBA 2DNEA 5CGKA 1OXXK 5DAUA 5C0XG 4KN4C 4C1NK 1SNQA 3R8BA 1JOOA 4IFDG 2K5QA 4MN3A 2A6HC 4HN7A 3VR4A 1RJTA 4C2MB 3T51B 2XRSD 1CA6A 2L11A 3QO2A 4FVMA 4ULLA 4C3HB 1TWHB 2B2TC 1OXVA 5CV7A 3GQBA 5FO7B 3S15B 3DEPA 4KY5A 4X3SA 5E3FA 1ILPA 3P75A 2EYFA 1PFMA 4A3EB 1CA5A 1GHJA 4XTCS 2EY5A 3FPUB 1SXTA 1BF4A 4DXGA 2XRQD 2WKCA 4FF3A 2HUGA 4RKLA 5IGDA 2J0TD 3PUVA 2L4NA 4PMWA 1S4ZA 3C46A 2JEBI 4G7OC 2EYMA 2O5IC 2EYJA 2SEBD 4ODGA 3T56B 2JSOA 5JVH3 4FO2A 3IAYA 4K6DA 3ITPA 4IUTA 5M5XB 2EE1A 1PZID 4X3KA 5IIFA 3D31A 3NBIA 3GTLB 4TQUS 3BS1A 1H9JA 1L0XB 1STGA 4QUCA 3OIQA 1EY0A 4HMIA 2IT1A 4C1NI 3OSOA 1XYIA 1VMPA 1PMRA 2RBMA 2NVXB 3FVQA 4I7ZC 3VYUA 2JA6B 1IW7C 1RKNA 1SYGA 1CQVA 1EEID 2BDNA 1EY8A 3I90A 3J7AV 4NDXA 1E2VA 1S5BD 5E4WC 3K59A 1LTBD 1NSNS 1EU4A 2K32A 1FD7D 4PMCA 5KGUA 1LO5D 1EY6A 2B2WA 5IGGA 1SE3A 3R2TA 1OO9B 3MWYW 3BYTB 4ME5A 2Q8IB 1SNDA 4RGMA 5M3MB 4C56C 3J81E 3L7ZC 2B2YC 2EYPA 4EQOA 1A6XA 4NW2A 4KMUC 5DM73 3SK8A 1QG7A 3HEJA 1R4QB 4FF4A 2ENBA 2NBFA 5CR3A 3H94A 2K1BA 4F8MA 3PIO3 5EGTA 1D6EC 4IUQA 4ZKBB 1HFGA 3PIP3 1WD0A 1AZQA 4J8QA 3X3MA 3P1HA 2AQ2B 5DEHA 3DM1A 4XT1B 1IKLA 3RZOB 2L12A 4CHTB 2PPBC 3C2PA 2IWHA 1SYDA 4KJOA 3S2HB 5EPJA 4N9TA 3CKIB 3I73A 2FMMA 5EPKA 5CV9A 3AMUA 1EL0A 1HA6A 3NTKA 3M85A 1IKMA 4S3SA 2A6EC 5I4DA 3K58A 1F9RA 3KLSA 1O78A 4KKUA 2FFKB 4BS9A 1GHKA 4FXKC 1GOZA 4OHJA 2XIWA 3SE0A 3GTQB 4JK1C 1TS5A 2NN6H 2K7VA 4ZRZA 1V43A 4LMQD 2K5WA 4L8JA 2PMZB 1KNEA 5CV8A 1BR9A 1CFMA 4KY6A 4M8AA 1ZEQX 1A3UA 3A7LA 1SBBB 2RDGA 2H4OA 3R2IA 4P2CB 3DHQA 1KAAA 3Q0AA 2LS01 2HQEA 1HQMC 3T4AC 1S5FD 3WOEA 2Q8RE 2B8GA 5AFWA 1Y8OB 1BBXC 3T16A 1DJRD 2BA0A 3MA2B 1SEBD 4GZYC 2KUMA 1LTRD 1HFNA 1BCPB 1SE2A 2BDOA 3NTIA 3HG9A 2A6ED 5FLXL 3LX0A 2AWOA 2MP1A 2KCCA 1V1PB 4C3JB 2WACA 5IGEA 2F0TA 1QNUA 5JEAG 2ICIA 2F0FA 2NN6I 1EIHA 1ICWA 1LV9A 1LT3D 3E0JA 3K5LA 2YU9B 1KNAA 1ZKOA 5EKLA 5EKKA 1FNWA 2BE5D 3GTPB 1IL8A 4L6TB 1LTSD 4ILWA 1TY0A 2RSNA 2QDBA 1D5MC 4N9PA 1SYEA 2VXWA 3SXHA 5I2XA 4JBWA 3D6CA 4R8IA 5KNCA 3NBHA 5ELFA 2KECA 4XYOA 4EGVA 4DAPA 1DM0B 2A5HA 5D3DA 1JWUD 1DD2A 1I3QB 2F0MA 1L0YB 4HMJA 3HOXB 3M4YA 3TP8A 3K5MA 1IHZA 1Y1VB 1R9TB 1FNUA 1FNVA 2M9VA 2F0SA 4M1UB 3PMFA 4K5XA 1DXMA 3JAME 3NXWA 4CJ1B 3KK7A 2Z4IA 3Q22A 5DM63 3AU7A 3FEWX 2L5TA 2JXMB 5M5YB 5JVG3 5CBAE 4HR7B 2JEAI 2EOTA 1I6VC 2F0QA 4H44C 3VA5A 3M7NA 1K8OA 4KTAA 4R8NA 1DOMA 1I4XA 5EBCA 3RMHA 1RDPD 1D2BA 1ET6A 2F0KA 1W6KA 5C5MA 5IGCA 1EU3A 1HA5A 2F0WA 5JJZA 3Q23A 3S1NB 1HTPA 2SDFA 3DWAA 5EJWA 5J39A 1EYAA 5CMDA 1M8AA 1BO0A 1RTOA 1J9OA 5EPLA 1AEXA 4RHSA 3GP7A 3DUZA 2KVMA 2EJFC 2KEEA 2PZWA 4Q5VA 2B2UC 3V96A 1F2YA 5TSSA 5HURA 4OIJA 3SHLA 3BVZA 5G3LF 1Q8IA 2K28A 2EJGC 5JPNC 4RFBA 2EZVA 2G9DA 3A8IE 2A74C 3TP6A 4WFN3 4CGYB 5HGTA 4KK7A 1PRTC 5JOBA 3IFTA 1PTOH 2RDFA 2WP8J 4QMGA 3R93A 1O7LA 2AUJD 1JB3A 1SNOA 3K6OA 3K5NA 2EYOA 4A3KB 1B4OA 4PNYA 2KJXA 5CV5A 2K6AA 3A8KE 4KHZA 2O5JC 3NP8A 2X6LA 1LTID 2FHTA 1Q12A 3O13A 2F3VA 1Y1WB 5C4XB 2E75C 4C3HG 5FLXE 2E74C 5ELCA 1QJOA 2EPBA 1LT6D 2MUYA 1QE6A 1EIGA 1QNKA 1GUTA 5C0XJ 1Q3LA 5K36G 4NMZA 1KTKA 2J7ZA 2B63B 1LLRD 2F0EA 1M4VA 3V05A 4YIJA 4IUPA 4J1MA 4WJWA 1OXUA 1EYCA 5C4JB 2AUKA 2MPMA 2EXZA 3S1MB 3BG3A 1WTVA 2F03A 1BXTA 2NWGA 4HSPA 2WINB 2Y0SB 4EVOA 4ZUJA 3ONAB 2A6HD 2A68C 5LL6X 1JICA 3PUZA 1WTRA 2F0IA 3X3NA 3P7JA 1U9RA 4IUUA 1KDAA 4RGOS 2F0UA 4BY7B 3KUPA 3TP5A 3N52A 3WOFA 4CKBA 2I07B 4QB4A 1HXYD 1AN8A 3KBXA 3QJYA 4IN3A 5C44B 2K03A 2DN8A 3M3YB 4BA2I 3GV6A 2RSOA 5CV6A 4IURA 3IFDA 1QCBD 1A2UA 4KI0A 3N6RA 3KF8A 3I8ZA 1JOKA 3LNNA 3MFGA 2DY8A 1PZJD 2EDGA 4RKBA 3UI2A 3G6JB 4XQNA 3OPOA 5T1IA 4PQXA 3QOLA 1JWSD 1A15A 3WDNA 2E76C 3FPPA 1JR0D 3HZXA 5JPMC 1ET9A 1V1OA 1H9RA 1PLFA 3NPPA 2F0LA 1PTOF 1WCMB 2BCOA 2F0HA 1AFPA 1DONA 3CRKC 1S5CD 2KA7A 5EKIA 2A68D 1E2ZA 3J81L 1IW7D 4DGZA 2XWBB 1GUWA 2E2HB 4UAIA 1R4PB 4LAAA 1WTQA 5K36H 2CQAA 1EZ6A 3BVGA 5A35A 1U4PA 4ZKCB 2Z8LA 1PXUA 3OWFA 1WTXA 2DNCA 3T13A 2CVRA 1SJHD 1WTWA 1HRJA 2R93B 5FK9C 2OXPA 2R3ZA 1II3A 5D65A 2I46A 4FF1A 4DFAA 4B9WA 2E2JB 2AQ1B 3G7LA 3HOYB 1D5ZC 1G291 4WRDA 2ZT9C 3EQLC 4DNRB 2C9OA 3GTGB 4QCLA 1DYQA 2CW0C 1FR3A 4OO1I 3J7AF 2A69C 3HOVB 1B44D 3M7GA 5KYIA 1RCVD 3MXNA 3QG1A 3VR5A 1LTTD 1TWAB 4KD4A 1LTGD 2NN6G 4KKSA 2RDHA 2DY7A 3C3LA 4H0LC 5CYUA 4BA1I 1B9NA 4K5VA 1EZ8A 1ENFA 2FINB 2LFNA 3A54A 2D2CC 4Z9CB 5ELDA 2XVSA 2EYHA 2RVLA 2KQ3A 1PZKD 1BNZA 1C8CA 1FGBD 1Z6HA 1EWHA 5KIXA 1PTOD 2XNAC 1D5XC 2B2UA 2B8FA 3NQIA 2JA7B 2BA1A 4IUVA 3BZDB 4DF7A 4H7BA 1O7YA 3EROA 1G6ZA 4K8JA 4A3BB 3LWUA 4ZUIA 2IJ0A 4DK0A 1JORA 5NUCA 3EA6A 2JA8B 2MJ8A 2WB1B 5JEAH 1SNMA 1V8QA 1RODA 1G8ZD 1PRTB 3OMCA 2A69D 2G9HD 4K6LA 4CKCA 3K7AB 3P20A 5C0XI 4QIWB 3OOCA 1XTCD 4C3IG 1D1KA 2LY7A 1STBA 3MZ5A 4L63B 1EY5A 3H91A 4B08A 3VR2A 1A3TA 3TSSA 3H09A 1H9SB 2PW5A 1UUPA 2WAQB 3GTJB 3D4DA 2VNUD 1I50B 3VR3A 4HAEA 3PO2B 4U673 1TU2B 4WORA 2QILA 4DN4M 4RH6A 1CZWA 2SNSA 1SYFA 4HSVA 1HPCA 1ZXTA 2B39A 3PUYA 5A2QE 1IYUA 1VF7A 4G4KA 2NUCA 1SNCA 1SYCA 5F2DA 1PTOC 1AP0A 1SJED 1TS3A 4Y7NB 1VDZA 2N88A 2D9UA 4A3JB 5A2QL 3L3OC 3K57A 4RCNA 2QCPX 2V4DA 5C3WA 4FXDA 1VF5C 2F0VA 2RQXA 1EWCA 1AZPA 1ILQA 3RUZA 5C0XH 2L0CA 3HP3A 3S17B 1CHQD 4KV6A 4DK1A 5JAVA 3E5SA 1G2TA 3Q6SA 5IODA 5BN5A 2F0JA 2Q8TA 1U4RA 4FYDA 1Q90A 1MSGA 4FNFA 1TY2A 2Z4HA 4XT3B 3F2UA 2Z1CA 3MEHA 2BOSA 4NKLA 5I2YA 1BOSA 2E2IB 2WV6D 3D6WA 1ONLA 3CHBD 4XQQA 1D1IA 1S5ED 2JA5B 1NAPA 3NUCA 3HOWB 2NTSA 4E6IA 3NHHA 2HCIA 1G2SA 4KKTA 4EQPA 4BBRB 3HKZB 4BY1B 2KEDA 1VCIA 2C5CA 4RAUC 1HUNA 1STYA 2X69A 3NE5B 3FKIB 2IX3A 1E0BA 2MGSA 5I9OA 3KLSX 3SK6A 4KHVA 4CBVA 2M2LA 4A3IB 4G7HC 3MC0B 4HTHA 3IKJA 2A73B 1X3QA 1NR4A 3MVVA 5IGFA 3QB3A 1PRTD 4DAYA 1SFOB 2H1EA 3VYSA 4KN7C 4CJ2C 3HGBA 1QILA 1BDOA 1C4QA 1K83B 2PCFB 3NK9A 3FMCA 3RZDB 1JCKB 1JE4A 4CKEA 2PO4A 1STEA 3TZUA 1MSHA 3BVMA 4J6HA 1VMCA 1ENAA 1ZYRC 4K2LA 2NVQB 5CBEE 4XYQA 1SDFA 3DWQA 3T53B 3QWNA 1BUVT 4PMBA 3DXJC 2AQ3B 4UDUC 2PW7A 1CT1D 3GV3A 2M00A 2PYKA 2XN9C 2BE5C 2IX0A 3QOJA 2GA4B 4NP5A 1PFNA 4RHRA 3I4MB 4ABNA 5J1ZA 2NYZD 3VA7A 1OXTA 4RWSC 3E6ZX 3NWSA 3BYYB 3I4LA 3S16B 2B2WC 1CZGA 5COYA 2XSCA 1YNJC 3PUWA 5BN3A 4C3IB 3S2DB 4A3MB 5JEAJ 2B2VA 5C3EB 4K8IA 2B2VC 2F0DA 2VB3X 5EQ0A 2R92B 2JP1A 2TSSA 4HEDA 2YYZA 2NVTB 3K5OA 4TKOB 1B2TA 4FF2A 1SE4A 1TWFB 2WKDA 2K01A 1RD9D 4IALA 1EFID 3I70A 4BBSB 3FDTA 3ND9A 1CHPD 1G91A 1QB5D 3CRLC 4TRDA 5I9PA 3HRZC 1CI3M 2PQEA 3W2DA 1GUNA 2IL8A 1WTPA 1Y69U 1STHA 2K04A 5BN4A 5CV4A 3OHXC 1I4QA 2KHSA 4FP5D 2HDMA 1TWGB 2JE6I 1PDQA 1YNNC 3W3AA 1B50A 3TBIB 4U68A 1PRTF 3OW7A 3SK5A 1UNSA 3DEOA 2F0GA 4G57A 1DOKA 3SEBA 1IYVA 1YNJD 2NTTA 4RGNA 1EYDA 4DXFA 1Q1EA 2JYOA 4K5WA 5ELBA 1RF2D 4C3JG 1XWEA 1V1PA 2F4IA 1F77A 2EJMA 1TIID 3TN2A 1F9SA 3DWPA 2D62A 4V0BA 1JOQA 2NVYB 3HOUB 2K05A 1I4PA 4Q0FA 1EY9A 1GUSA 3M4OB 4XDXA 2F0OA 3MHBA 4ZK9B 5I6YA 1W6JA 3IL8A 1TR5A 2XWJB 5D14A 3SVMA 2QF7A 1X32A 1GJXA 1CK1A 3NWTA 1F2MA 4EQNA 2KOLA 3SR1A 4K14A 1F9PA 1MI2A 4F88A 3NTHA 5J22A 3OMGA 3J80L 2ZXOA 4KY7A 2OF1A 3A56A 1RHPA 1PTOB 2K33A 1NCVA 4DU9A 1TT2A 1LT5D 2QEJC 1I6HB 5CC4A 5M5WB 2VUMB 2EY2A 3EFXD 1EOTA 1EEFD 1MGSA 3KBGA 4ZQ3A 5C4ZA 2IW3A 5ELEA 4BWGB 1LTAD 3D8GA 3K0YA 5C3XA 5KYLA 1NUCA 5G3LD 3HS0C 5ISRA 4IFDH 4H13C 4OL7A 1ML0D 4DAVA 3S9WA 2PNRC 3LWEA 4A93B 5FOBB 1KDBA 2VB2X 1SMYD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ENB A;  3R3O A;  1SNO A;  1EYD A;  4K6D A;  5CR3 A;  3ITP A;  4QB4 A;  4DF7 A;  2EYO A;  4H7B A;  3DHQ A;  1II3 A;  4K5W A;  3D4W A;  1KAA A;  2SNM A;  3H6M A;  2F0S A;  3ERO A;  4HTH A;  4PNY A;  4F8M A;  5C3W A;  4K8J A;  2PZT A;  2F0V A;  3PMF A;  2HQE A;  2EY1 A;  5EGT A;  4ZUI A;  4K5X A;  3BDC A;  5IIF A;  4DFA A;  5HUR A;  1JOR A;  5NUC A;  3BDL A;  5CV5 A;  3NXW A;  3MVV A;  4B9W A;  2LKV A;  1KDC A;  5IGF A;  3NP8 A;  3QB3 A;  3RUZ A;  3DMU A;  5CV6 A;  3MXP A;  2F3V A;  2PZU A;  5KEE A;  1JOQ A;  1STN A;  3T16 A;  4K8I A;  1A2U A;  3P1H A;  1STG A;  2F0D A;  4WRD A;  5DEH A;  2F0Q A;  5I6W A;  1A2T A;  4KV6 A;  3C1E A;  5JAV A;  1SNM A;  1EY0 A;  1EY9 A;  3E5S A;  4HMI A;  4KTA A;  3VA5 A;  1EY7 A;  2F0O A;  1JOK A;  3MHB A;  4MIU A;  5M9O A;  4R8N A;  5IOD A;  3OMC A;  5K5P A;  5I6Y A;  3C1F A;  3NK9 A;  1A3V A;  4NMZ A;  5E1F A;  1TR5 A;  1EY4 A;  2F0J A;  3ERQ A;  5IOC A;  4RKB A;  2F0K A;  3OSO A;  1F2M A;  2F0N A;  5C5M A;  1SYD A;  2RBM A;  5IGC A;  4KJO A;  2F0P A;  4QF4 A;  4F7X A;  3TP7 A;  2F0E A;  4EQN A;  1KAB A;  5IGB A;  4N9T A;  4B9X A;  2SOB A;  2F0W A;  4IAL A;  3SR1 A;  3LX0 A;  4K14 A;  5C6A A;  4J6H A;  5CV9 A;  5CGK A;  5KYI A;  1STB A;  2RKS A;  5DAU A;  3MZ5 A;  3QOL A;  4YIJ A;  4J1M A;  1ENA A;  4KD4 A;  1EY5 A;  1EYC A;  1SNQ A;  3OMG A;  2WAC A;  1RKN A;  1JOO A;  4K2L A;  5J22 A;  5J39 A;  1SYG A;  4S3S A;  3HZX A;  5IGE A;  1EYA A;  4KY7 A;  1EY8 A;  1A3T A;  2OF1 A;  4ID6 A;  2F0T A;  2EXZ A;  3MEH A;  4TRD A;  1AEX A;  4NDX A;  4KD3 A;  4KJN A;  4NKL A;  4DU9 A;  1TT2 A;  2OEO A;  5I9P A;  2F0F A;  5KRU A;  2PW5 A;  2PZW A;  4K2K A;  1NSN S;  2F0L A;  2PQE A;  4IUN A;  5C4H A;  5CC4 A;  2EY2 A;  3D4D A;  2O4X A;  3NUC A;  4PMB A;  5C5L A;  1F2Y A;  5CV7 A;  1STH A;  5EKL A;  5EKK A;  4WOR A;  4E6I A;  4KY5 A;  3EJI A;  3NHH A;  1ENC A;  2F0H A;  1EZ8 A;  4K5V A;  5CV4 A;  5E3F A;  4ZQ3 A;  3SHL A;  3TME A;  5C4Z A;  3P75 A;  2PW7 A;  2EYF A;  2SNS A;  4PMC A;  3V2T A;  1SYF A;  2KHS A;  1EY6 A;  1IHZ A;  1TQO A;  5KGU A;  2QDB A;  4EVO A;  2M00 A;  2PYK A;  2EY5 A;  3D8G A;  1F2Z A;  4N9P A;  4ZUJ A;  3SK4 A;  1SYE A;  4DGZ A;  4EQP A;  5C3X A;  3SXH A;  2EYL A;  5IGG A;  2EYH A;  5KYL A;  4LAA A;  2NUC A;  3D6C A;  4RKL A;  2EY6 A;  5IGD A;  1NUC A;  1EZ6 A;  2KQ3 A;  1SNC A;  1SYC A;  3QOJ A;  5F2D A;  5ISR A;  3TP6 A;  1STY A;  3NQT A;  3OWF A;  3U9O A;  4ME5 A;  3EVQ A;  1SND A;  5HGT A;  4OL7 A;  4IZ8 A;  3T13 A;  1STA A;  4I65 A;  4NP5 A;  3SK5 A;  2F0I A;  5JOB A;  4G57 A;  2F0G A;  3S9W A;  2EYM A;  1U9R A;  1SYB A;  5J1Z A;  2F3W A;  5I9O A;  2EYJ A;  2EYP A;  4ODG A;  1KDA A;  1KDB A;  2F0U A;  2RDF A;  5CV8 A;  2F0M A;  4QMG A;  3SK6 A;  4EQO A;  5KIX A;  4KY6 A;  4HMJ A;  3SK8 A;  4KHV A;  2OXP A;  3HEJ A;  1A3U A;  3TP8 A;  3TP5 A;  1SNP A;  1EQV A; 
#chains in the Genus database with same CATH topology
 1V9P A;  3R3O A;  1O80 A;  1WD1 A;  4RA8 A;  3VYT A;  4IO9 A;  3H6M A;  4B3T Q;  3VR6 A;  2A8V A;  2L1B A;  1ICF B;  4ZLT F;  1F9Q A;  1QOH A;  2CHB D;  1BBU A;  3ND8 A;  3J7Y W;  2LKV A;  5J3B A;  4LF8 Q;  3MAQ A;  1Y8P B;  3MXP A;  2PZU A;  1X3P A;  3PV0 A;  5KEE A;  5LHY 1;  4O42 A;  4FDB A;  1ZYR D;  5FO9 B;  1CM9 A;  1H9M A;  5COR A;  4LW1 A;  5LL6 S;  4OIK A;  3GD7 A;  2ICE C;  1A2T A;  1PFB A;  3K81 C;  1EY7 A;  4H02 A;  4G7Z C;  2O2L D;  1E1O A;  4UPA A;  3EBE A;  4ZAI A;  3C1F A;  1A3V A;  1ESF A;  3CQZ H;  1VQN A;  3ERQ A;  2YTV A;  1EIY B;  3MXG A;  5D3I B;  3S14 H;  1UE7 A;  4BXX H;  1XNR L;  3PCO B;  2I5H A;  3PUX A;  1U4M A;  1JWM D;  1NNX A;  2RKS A;  3HOZ B;  1T5X D;  2KCM A;  1JC7 A;  3DM3 A;  1Q1B A;  2N55 A;  2QKI C;  1O7Z A;  1S40 A;  4R9W A;  2UXC L;  3D3R A;  3D4R A;  3A55 A;  1DOL A;  4KJN A;  2K5D A;  5KRU A;  3J81 j;  1Y8N B;  4TSS A;  4K2K A;  1MBY A;  3TDQ A;  1WCM G;  4DV1 L;  4OO1 G;  2RA4 A;  2D0P A;  3FKI G;  5GAH C;  2G5D A;  3H0G B;  3TME A;  4A3G G;  1T5E A;  3TQY A;  1HNX Q;  3J80 E;  2L9H A;  1PYW D;  1NR2 A;  1SRU A;  1F2Z A;  1LAC A;  1I4H A;  1I4G A;  3S1Q H;  2EYL A;  3CMA A;  2EY6 A;  1TWC B;  1Y1V G;  2E2D C;  2OT2 A;  3GO5 A;  2H5X A;  1YIT A;  1YJW A;  3BDO A;  2C35 B;  4A3D G;  1IXR A;  1STA A;  1ESR A;  3RLF A;  2FJ2 A;  3OIP A;  4RGT A;  1CTM A;  2HCC A;  2F3W A;  1HUM A;  3H3V C;  2R61 A;  3A7A B;  4ZYS A;  1U4L A;  4JOI A;  1GUG A;  3CQZ B;  1YHB A;  3A8J E;  1EQV A;  1GUO A;  2AMC B;  1RTN A;  4YY3 L;  4XIG S;  2QGQ A;  1U5K A;  1EQT A;  2AWN A;  2SNM A;  2NZ1 D;  1LM0 A;  2PZT A;  4OON A;  1Q82 C;  3BDC A;  4OGQ C;  1SAP A;  1KLG D;  1BCP D;  1H9S A;  2R6G A;  1SLJ A;  4CJ0 B;  4JPB W;  1N33 L;  2EXD A;  5FKA C;  3TZD A;  1QZH A;  4ALP A;  2ZXP A;  2R7Z B;  1HNZ L;  5T1G A;  1XXG A;  4MIU A;  1A62 A;  2D5D A;  1JQY D;  2UUC L;  1HCZ A;  3I4N B;  3CU7 A;  1E2W A;  1E1T A;  1EY4 A;  3I91 A;  5IOC A;  5IT9 L;  2MHV A;  5M3F H;  2KCN A;  4QF4 A;  2F0P A;  4R4Q A;  3TP7 A;  4DNI A;  2CW0 D;  4A3D B;  2SOB A;  1C48 A;  1TWC H;  4PV1 C;  1DCZ A;  2UXD Q;  1B53 A;  2EVB A;  2K50 A;  4POF A;  1Z47 A;  4X3T A;  4BY1 G;  1KLU D;  1YNN D;  4ID6 A;  4GKJ Q;  3T1Y Q;  2IX1 A;  2CQO A;  4XQJ A;  4POG A;  2ZTC A;  3SDZ A;  2OEO A;  2Z6B A;  1PH3 A;  3GTM B;  3H0G G;  4A3G B;  4IUN A;  4IQZ A;  5FO8 B;  1QWY A;  3KLR A;  3U4Z A;  2O4X A;  5C5L A;  3HOW G;  1HR0 Q;  3S2D H;  4LF7 Q;  4F87 A;  2B2Y A;  3EJI A;  1VQ9 A;  3V2T A;  3KDF B;  3L9A X;  1HHV A;  3PO3 B;  3AEV A;  3S1R B;  2UUB Q;  3CF5 A;  1BQQ T;  1WVL A;  3I4N H;  3NSW A;  3ZJY C;  2R7Z G;  3NQT A;  3U9O A;  1I4R A;  3EVQ A;  2L55 A;  3Q24 A;  4HJA A;  2R7D A;  1FJG L;  1SYB A;  1XTD A;  2WII B;  5IP9 G;  3QIA A;  2ID0 A;  4DV7 Q;  5IT9 E;  4BBS H;  1G6P A;  4DUZ Q;  1SNP A;  1I94 Q;  1FYC A;  3GTK B;  4A3J H;  1HR0 L;  4HJ9 A;  4JI1 L;  1BCP C;  2X6G A;  4ZCK A;  2EY1 A;  3JAM c;  4B3M Q;  4JYA Q;  5E4X A;  1VQ7 A;  4YCV A;  2L15 A;  1F2L A;  3A5U A;  4IFD I;  1SRO A;  4AYB B;  1B3A A;  3DMU A;  4GKJ L;  2V1C C;  3RD4 A;  4DV7 L;  3MFY A;  2HDL A;  4HID A;  2OQK A;  4IFD J;  1IBM Q;  1B3Q A;  3C1E A;  4RMF A;  1J8I A;  4N8F A;  5K5P A;  3PF4 A;  1UAP A;  3CCE A;  1I6H H;  5DNF A;  2EQS A;  1AW7 A;  4MTK A;  5M3F B;  2N8N A;  1KAW A;  4FXG C;  2MNA A;  1P8L A;  4DV6 L;  3S16 H;  4B9X A;  5C6A A;  4C2M H;  4A3F B;  1M90 C;  4X3U A;  1HH2 P;  3ZYY X;  4QUF A;  4MHE A;  4A3F H;  4OX9 L;  4DA2 A;  5EBD A;  4DUY Q;  3ER0 A;  1B9M A;  1B1Z A;  3J81 c;  4KD3 A;  3K80 C;  1OXS C;  1UWV A;  2JA7 H;  1WTO A;  3QR8 A;  4JI7 Q;  4KHP L;  2TMP A;  3LGJ A;  4DV5 Q;  2PMZ E;  3Q8D A;  3GDE A;  5C4H A;  1D7Q A;  3M3Y H;  3PO2 G;  2RCN A;  4UP7 A;  3U9S A;  3MTS A;  3S1Q B;  4DR2 Q;  1GKH A;  4DV0 L;  1TVX A;  1ENC A;  1ASY A;  4HCS A;  1DZ1 A;  1SMY C;  3STB C;  4WJ4 A;  1Z7T A;  2JJQ A;  5KNB A;  3KF8 B;  2F3I A;  1TQO A;  1PH7 A;  4XXE A;  4A4I A;  1JJG A;  1L1O A;  2B2T A;  3A0J A;  3SK4 A;  3URY A;  2K5H A;  2OQ0 A;  4DAM A;  1A0I A;  3FRP B;  3GTO B;  1BCP F;  2JK8 A;  3OWE B;  1K3R A;  4IZ8 A;  1JJC B;  2NB0 A;  4I65 A;  5FLX c;  5JJL A;  1TKW B;  2RHS B;  3JAM L;  4AQY Q;  2E8G A;  1L2F A;  1Y1W H;  4V19 0;  2N49 A;  4RCO A;  5JJI A;  3HOZ H;  3HOX H;  1TS2 A;  4GKK Q;  3AB9 A;  1MD2 D;  3MXU A;  5AJ3 L;  1UE1 A;  3H15 A;  4BBR H;  3HOU G;  1Y14 B;  3VYR A;  3KJO A;  1SSO A;  1VQB A;  3D4W A;  2IPK D;  4DV2 Q;  5KND A;  2Z6K A;  1TXY A;  1LAB A;  3BDL A;  2XGT A;  4HJ7 A;  1E7Z A;  1GXD C;  4O1N A;  4DNT B;  1KDC A;  4DR4 L;  2F1M A;  3I72 A;  1K83 H;  2CH4 A;  2JA9 A;  4OO1 H;  4HCE A;  2Q2U A;  1TS4 A;  1STN A;  1XX8 A;  3E3X A;  4QJF A;  1S5D D;  1K8M A;  2J4X A;  5I6W A;  2LMC B;  3CCU A;  2N3S A;  5M9O A;  1HQR D;  4LJZ C;  1CQF A;  1HTL D;  4OWW B;  4R1J A;  5E1F A;  2PQA B;  2ZXR A;  3I3C A;  1UEA B;  4LK1 C;  2ES2 A;  3S14 B;  1H9K A;  1LT4 D;  2F0N A;  2FMC A;  3U4V A;  5IP9 H;  4F7X A;  2ASB A;  1KAB A;  5IGB A;  2DNE A;  2KEN A;  5CGK A;  1OXX K;  1Q81 C;  5DAU A;  1UE6 A;  5C0X G;  4KN4 C;  4C1N K;  1SNQ A;  3R8B A;  1JOO A;  4IFD G;  2K5Q A;  4MN3 A;  2A6H C;  4HN7 A;  3VR4 A;  1RJT A;  4C2M B;  4LF8 L;  3T51 B;  2XRS D;  2L11 A;  1CA6 A;  3QO2 A;  4FVM A;  4ULL A;  4GLA C;  3U50 C;  2K5V A;  4JYA L;  3CW2 C;  4C3H B;  4LF4 Q;  1TWH B;  1L1O C;  2B2T C;  1PH1 A;  2R93 H;  1OXV A;  1YZ6 A;  3GQB A;  5CV7 A;  5FO7 B;  3S15 B;  1C0A A;  3DEP A;  4KY5 A;  4X3S A;  4DUZ L;  1XMQ Q;  5E3F A;  3HOY H;  1ILP A;  3P75 A;  1OTC A;  2EYF A;  1PFM A;  4A3E B;  1CA5 A;  1GHJ A;  1GM5 A;  4XTC S;  1IZ6 A;  2EY5 A;  3FPU B;  1SXT A;  2D0O A;  1BF4 A;  4DXG A;  2XRQ D;  2WKC A;  1BVS A;  4FF3 A;  2HUG A;  4RKL A;  5IGD A;  2E2H H;  2J0T D;  3PUV A;  1RIP A;  2L4N A;  4JW0 A;  4PMW A;  4NXM L;  5C44 H;  4Y7N H;  1S4Z A;  3C46 A;  4DV3 Q;  4K0K Q;  2JEB I;  4JI6 L;  2EYM A;  2O5I C;  4G7O C;  3F8T A;  1YEZ A;  2EYJ A;  2SEB D;  4ODG A;  3T56 B;  2JSO A;  2ZJQ A;  2UXB Q;  3HFZ B;  5JVH 3;  3CCS A;  4LUV A;  4FO2 A;  1AE2 A;  3IAY A;  4LF7 L;  4GS3 A;  4K6D A;  3ITP A;  4IUT A;  5M5X B;  4HJ5 A;  2EE1 A;  1PZI D;  4X3K A;  3HOY G;  5IIF A;  5LMN L;  3D31 A;  3NBI A;  2ZM6 Q;  4IPC A;  3GTL B;  4IPG A;  4TQU S;  3M4O H;  4IOA A;  3BS1 A;  4A3C H;  1H9J A;  1I3Q H;  4X64 L;  3BU2 A;  2VUM G;  1L0X B;  1PFS A;  1STG A;  1NE3 A;  2I5M X;  2UU9 Q;  4QUC A;  3OIQ A;  1FJG Q;  1VQ4 A;  4JI6 Q;  4A3G H;  1EY0 A;  4HMI A;  1H95 A;  2IT1 A;  5IYD H;  1VQP A;  4L5T A;  1Q8K A;  4P71 A;  1EFW A;  1PVO A;  1CKM A;  1TWG H;  3NEL A;  4C1N I;  3OSO A;  1XYI A;  1VMP A;  1PMR A;  2RBM A;  2NVX B;  1LUZ A;  2NZO A;  4DR3 L;  1MHW C;  3FVQ A;  4I7Z C;  3VYU A;  2JA6 B;  1IW7 C;  3GTQ H;  1RKN A;  4DR4 Q;  1SYG A;  5JJK A;  1CQV A;  1EEI D;  2BDN A;  1EY8 A;  1N36 Q;  3W1G A;  3I90 A;  3J7A V;  3RLO A;  1N32 Q;  4NDX A;  5EAY A;  1E2V A;  1S5B D;  5E4W C;  3K59 A;  4A3I H;  1LTB D;  1NSN S;  4BY7 H;  4X66 Q;  4A3F G;  1EU4 A;  2OWO A;  2K32 A;  2PI2 A;  4GKK L;  4CDE C;  1BBW A;  1FD7 D;  2F52 A;  4PMC A;  5KGU A;  1LO5 D;  1EY6 A;  3TS0 A;  1E3P A;  2B2W A;  5IGG A;  1SE3 A;  3R2T A;  3S15 H;  2DUD A;  1XPO A;  1OO9 B;  3MWY W;  3BYT B;  4ME5 A;  2Q8I B;  1SND A;  4RGM A;  1VQK A;  1EOV A;  5M3M B;  4C56 C;  1LTL A;  3L7Z C;  3J81 E;  2B2Y C;  2EYP A;  3RZD H;  4EQO A;  1A6X A;  4NW2 A;  4KMU C;  5DM7 3;  1SN8 A;  3SK8 A;  2RCF A;  3T1H L;  1QG7 A;  3HEJ A;  1R4Q B;  4FF4 A;  2ENB A;  1KXL A;  1CKO A;  2NBF A;  5CR3 A;  4X66 L;  3H94 A;  4GOP C;  1K0S A;  3G4S A;  2K1B A;  4F8M A;  3PIO 3;  2JA6 G;  1I5F A;  5EGT A;  1D6E C;  2HD3 A;  4X65 Q;  1ASZ A;  5GAE C;  4IUQ A;  4ZKB B;  1HFG A;  3PIP 3;  1WD0 A;  4BY1 H;  1AZQ A;  4J8Q A;  4GN4 B;  3X3M A;  1I94 L;  3P1H A;  2HHH Q;  2AQ2 B;  5DEH A;  3DM1 A;  4XT1 B;  1IKL A;  3L2P A;  4LF6 L;  3RZO B;  2L12 A;  3HOW H;  4CHT B;  2PPB C;  1L1O B;  3C2P A;  4A3B H;  5GQO A;  5M3M H;  2IWH A;  1SYD A;  1X3G A;  4KJO A;  3S2H B;  5EPJ A;  3HOV G;  4N9T A;  3CKI B;  3I73 A;  2FMM A;  5EPK A;  5CV9 A;  3AMU A;  4Y52 H;  1X3E A;  4GOP B;  1EL0 A;  1HA6 A;  1X65 A;  3RN2 A;  1PA6 A;  4OWT B;  3GTK H;  3NTK A;  3M85 A;  1K8G A;  1IKM A;  4S3S A;  2A6E C;  5I4D A;  4R4I A;  3K58 A;  4JI0 Q;  3CCR A;  1F9R A;  3J7Z C;  3KLS A;  1O78 A;  4KKU A;  2FFK B;  3PF5 A;  4BS9 A;  5LMN Q;  1GHK A;  4A93 G;  4FXK C;  4YWL A;  1GOZ A;  1PH8 A;  4DR1 Q;  3KDF A;  2JA5 G;  2OCE A;  4JBM A;  3AQQ A;  4OHJ A;  2KHI A;  3S1R H;  2XIW A;  3SE0 A;  3GTQ B;  4JK1 C;  2ZJP A;  1TS5 A;  2NN6 H;  2K7V A;  4JBJ A;  4ZRZ A;  1V43 A;  3PSI A;  2VW9 A;  4LMQ D;  2K5W A;  1SFO H;  4L8J A;  1Y1V H;  1R9T H;  2PMZ B;  1KNE A;  5CV8 A;  3H3V I;  1BR9 A;  1CFM A;  4KY6 A;  3K7A H;  4M8A A;  1ZEQ X;  1A3U A;  3A7L A;  2OTL A;  1XNQ Q;  4LF9 L;  1SBB B;  3BZK A;  2RDG A;  2H4O A;  3R2I A;  4P2C B;  5H1S E;  3DHQ A;  4DR1 L;  1KAA A;  3Q0A A;  2LS0 1;  2HQE A;  1HQM C;  3T4A C;  1S5F D;  4AIM A;  3WOE A;  4JI0 L;  2Q8R E;  1IBL Q;  2WFW A;  2DGY A;  2B8G A;  5AFW A;  1Y8O B;  3I4O A;  1BBX C;  3GTM H;  2LXK A;  3T16 A;  1DJR D;  2LXJ A;  2MQH A;  4JI8 Q;  2BA0 A;  3MA2 B;  2VS1 A;  1SEB D;  4GZY C;  2KUM A;  1HNW L;  1TWH H;  3KF6 B;  1LTR D;  1HFN A;  2PI2 E;  1BCP B;  1NTG A;  3FHW A;  2VUM H;  1SE2 A;  3AYH B;  2BDO A;  3NTI A;  3HG9 A;  2A6E D;  1U0L A;  5FLX L;  3LX0 A;  1VQG A;  2AWO A;  2MP1 A;  3GTO H;  2KCC A;  1V1P B;  4C3J B;  1N33 Q;  2WAC A;  5BR8 Q;  5IGE A;  2F0T A;  1QNU A;  5JEA G;  4DR7 L;  2ICI A;  4R4O A;  4A3E G;  3HOX G;  2F0F A;  2EIF A;  4DV5 L;  2NN6 I;  1EIH A;  5HY6 A;  1ICW A;  1LV9 A;  1LT3 D;  3E0J A;  2NVY H;  3K5L A;  2YU9 B;  1KNA A;  1ZKO A;  5EKL A;  5EKK A;  4QIW E;  1FNW A;  2BE5 D;  3GTP B;  3ULJ A;  4O2D A;  1IL8 A;  4L6T B;  4ILW A;  1LTS D;  3FP9 A;  3KJP A;  1TY0 A;  5IWA Q;  1VQ5 A;  2RSN A;  2QDB A;  1HJP A;  1D5M C;  4N9P A;  3JC6 6;  1SYE A;  2VXW A;  3SXH A;  5I2X A;  4JBW A;  3D6C A;  4R8I A;  3OYY A;  3KLW A;  2YTY A;  5KNC A;  3NBH A;  1XNR Q;  5ELF A;  2KEC A;  4XYO A;  2KCT A;  4EGV A;  4DAP A;  3L0O A;  1DM0 B;  2A5H A;  5D3D A;  1E22 A;  1JWU D;  1DD2 A;  1I3Q B;  2F0M A;  1L0Y B;  2JN4 A;  4HMJ A;  1VQO A;  3MEF A;  1EUJ A;  3HOX B;  3M4Y A;  3E9I A;  3TP8 A;  4P73 A;  3K5M A;  4A76 A;  1IHZ A;  4A3D H;  1Y1V B;  1R9T B;  1VQ6 A;  1FNU A;  1FNV A;  3GTG H;  2M9V A;  2F0S A;  4M1U B;  4BBR G;  3PMF A;  2ZM6 L;  4JI2 L;  4K5X A;  4A3J G;  1DXM A;  2KHJ A;  4KHP Q;  2JA5 H;  4P75 A;  3JAM E;  4DPG A;  1TWA H;  3NXW A;  4CJ1 B;  1N8R C;  3KK7 A;  4LF5 L;  2Z4I A;  3Q22 A;  2E2I H;  5DM6 3;  1YVC A;  1IBK Q;  3AU7 A;  3FEW X;  2L5T A;  3G6E A;  2JXM B;  5M5Y B;  5JVG 3;  5CBA E;  4HR7 B;  4H44 C;  2EOT A;  1I6V C;  2F0Q A;  2JEA I;  3VA5 A;  3M7N A;  1K8O A;  4KTA A;  2QW7 A;  4R8N A;  1DOM A;  1I4X A;  2RHQ B;  5EBC A;  3RMH A;  3ICE A;  1UE5 A;  2F4V L;  1RDP D;  3AFQ A;  1D2B A;  1ET6 A;  2F0K A;  3JAM i;  4AYB G;  1W6K A;  5C5M A;  5IGC A;  1EU3 A;  4YCU A;  1HA5 A;  2F0W A;  4PZ8 A;  5JJZ A;  2E2J H;  3Q23 A;  3S1N B;  4P74 A;  1HTP A;  2SDF A;  2WAQ G;  3DWA A;  1EQR A;  5EJW A;  1NMG A;  4JBK A;  5J39 A;  3M9B A;  1IBM L;  3CP0 A;  4B3S Q;  5E7N A;  3EIV A;  1EYA A;  5CMD A;  4DV1 Q;  1M8A A;  1BO0 A;  1RTO A;  1WI5 A;  1J9O A;  5EPL A;  1AEX A;  3GP7 A;  4RHS A;  3DUZ A;  2KVM A;  2PNH A;  2EJF C;  2KEE A;  4LUZ A;  2PZW A;  1FGU A;  4Q5V A;  2B2U C;  1KD1 C;  3V96 A;  3GTL H;  2Z9H A;  1F2Y A;  1Y1W G;  5TSS A;  1XNQ L;  5ELO A;  5HUR A;  4OIJ A;  1B70 B;  3SHL A;  5C3E H;  3UDI A;  3BVZ A;  1EYG A;  5G3L F;  1Q8I A;  2K28 A;  2EJG C;  5JPN C;  4RFB A;  3UE1 A;  2EZV A;  5FLM H;  2G9D A;  3CPW A;  3J7A 5;  3A8I E;  2A1A A;  5FLM G;  4NXM Q;  2A74 C;  3TP6 A;  4WFN 3;  4CGY B;  5HGT A;  4KK7 A;  4J15 A;  4YWM A;  1PRT C;  5JOB A;  3IFT A;  1PTO H;  2RDF A;  2WP8 J;  2ZTE A;  4QMG A;  3R93 A;  2E5L L;  1O7L A;  4OEL B;  1EIF A;  2AUJ D;  4YHH Q;  1FL0 A;  2R92 G;  1JB3 A;  1SNO A;  1JMC A;  3K6O A;  3K5N A;  5IYC G;  2EYO A;  2K4K A;  4A3K B;  1B4O A;  1DGS A;  4PNY A;  1A8V A;  1VQE A;  2KJX A;  5CV5 A;  2K6A A;  2HIV A;  3GTJ H;  3A8K E;  4KHZ A;  3HOU H;  2O5J C;  3TRE A;  1J6Q A;  3NP8 A;  2X6L A;  1LTI D;  2FHT A;  1Q12 A;  3O13 A;  4JI5 L;  2F3V A;  1Y1W B;  5C4X B;  2E75 C;  3SGI A;  3UDX A;  4C3H G;  5FLX E;  2E74 C;  3T1H Q;  5ELC A;  1QJO A;  1WJJ A;  2EPB A;  1LT6 D;  2VZA A;  1K3B C;  2MUY A;  3RR5 A;  1SE8 A;  4JCV E;  1QE6 A;  1EIG A;  1QNK A;  1N34 Q;  1GUT A;  5C0X J;  1Q3L A;  5K36 G;  2WAQ E;  4NMZ A;  2F4V Q;  3IRB A;  3A74 A;  5IYD G;  1KTK A;  2J7Z A;  2B63 B;  2NVQ H;  2CWP A;  4A3K H;  1LLR D;  4LWC A;  3PO2 H;  2F0E A;  4GN5 A;  1M4V A;  1HNZ Q;  3V05 A;  4YIJ A;  4IUP A;  4J1M A;  4WJW A;  1OXU A;  1EYC A;  3F2B A;  5C4J B;  1KHI A;  1O7I A;  1Q86 C;  2AUK A;  2NVX H;  2MPM A;  3I55 A;  2EXZ A;  4QGU A;  3S1M B;  3BG3 A;  4RG1 A;  5M5Y H;  1WTV A;  2F03 A;  3RZO H;  3PGZ A;  1GVP A;  4GN3 B;  1BXT A;  3RNU A;  2NWG A;  1CSP A;  1W2B A;  1K28 A;  4HSP A;  1PV4 A;  3CC7 A;  2WIN B;  2Y0S B;  4EVO A;  4QQB X;  4ZUJ A;  3ONA B;  4IPH A;  3HKZ G;  2A6H D;  4PZ6 A;  2A68 C;  5LL6 X;  1JIC A;  3F1Z A;  3PUZ A;  4NXN L;  1WTR A;  2F0I A;  3X3N A;  3P7J A;  5IE8 A;  1U9R A;  2HIX A;  3OTO L;  4IUU A;  2K52 A;  1KDA A;  4RGO S;  2F0U A;  4BY7 B;  2VQF L;  3KUP A;  1YBY A;  3TP5 A;  3N52 A;  2VY3 A;  1K73 C;  3K7U C;  1NJI C;  2MO0 A;  3WOF A;  2I07 B;  4CKB A;  4QB4 A;  4GNX B;  1QVC A;  1B8A A;  1MJE A;  1XPR A;  2HQL A;  3S1M H;  1HXY D;  1AN8 A;  3KBX A;  3QJY A;  4IN3 A;  5C44 B;  2JA6 H;  1N32 L;  2K03 A;  2DN8 A;  3M3Y B;  4BA2 I;  5AJ3 Q;  5LMU Q;  3GV6 A;  4N8X 1;  2RSO A;  3F2C A;  5CV6 A;  4IUR A;  1P16 A;  3IFD A;  1QCB D;  1A2U A;  4KI0 A;  3N6R A;  3KF8 A;  3H0G H;  3I8Z A;  1JOK A;  3NEM A;  3LNN A;  3MFG A;  2DY8 A;  1PZJ D;  2EDG A;  4RKB A;  3UI2 A;  1NBW A;  3G6J B;  5ELN A;  3PIP A;  1VQF A;  4XQN A;  3OPO A;  5T1I A;  4PQX A;  3QOL A;  1JWS D;  4IOC A;  4X62 Q;  1A15 A;  3WDN A;  2E76 C;  4DR2 L;  3FPP A;  1JR0 D;  3HZX A;  5JPM C;  1YNX A;  5IYC H;  1ET9 A;  1V1O A;  5HGQ A;  1H9R A;  1PLF A;  2I5L X;  1Z9F A;  4DV4 L;  3NPP A;  4B3M L;  1S3O A;  1YHA A;  2F0L A;  1KC8 C;  1PTO F;  1WCM B;  2BCO A;  2F0H A;  1AFP A;  1DON A;  3CRK C;  1S5C D;  3CPF A;  2DJG C;  2KA7 A;  5EKI A;  2A68 D;  1JB7 A;  1E2Z A;  3J81 L;  2IY5 B;  1IW7 D;  4DGZ A;  2XWB B;  1GUW A;  5C4J H;  1VS0 A;  2E2H B;  4UAI A;  1R4P B;  4LAA A;  1WTQ A;  5K36 H;  2CQA A;  1EZ6 A;  3BVG A;  5A35 A;  1U4P A;  4ZKC B;  2Z8L A;  1PXU A;  3OWF A;  1WTX A;  3OW2 A;  2DNC A;  1C9O A;  3T13 A;  4DAY B;  2CVR A;  1SJH D;  1WTW A;  4KLK A;  2UUB L;  1HRJ A;  1PH9 A;  2R93 B;  3I4M G;  5FK9 C;  4LFB L;  2VL6 A;  1PH4 A;  2OXP A;  2R3Z A;  2VQE Q;  2UUA Q;  1II3 A;  5D65 A;  2I46 A;  4DK3 C;  3K0X A;  4FF1 A;  4DFA A;  4LNQ A;  2VQE L;  2UUA L;  3T1Y L;  1X6O A;  4B9W A;  1QVG A;  4DV4 Q;  2ATW A;  2E2J B;  2AQ1 B;  5IT9 c;  4X62 L;  3G7L A;  3HOY B;  1D5Z C;  1G29 1;  2K14 A;  3BJU A;  4WRD A;  2ZT9 C;  1J5E Q;  3EQL C;  4DNR B;  4EX5 A;  2C9O A;  3GTG B;  1VQC A;  1JJ2 A;  4QCL A;  2ZJR A;  1DYQ A;  2CW0 C;  4A93 H;  3HKS A;  1X3F A;  4C3H H;  1FR3 A;  4B3R Q;  4OO1 I;  3J7A F;  2A69 C;  1E24 A;  1WCM H;  3HOV B;  1B44 D;  1MJC A;  3M7G A;  2OTJ A;  5KYI A;  4GLX A;  1PH5 A;  4CDD C;  1RCV D;  3MXN A;  1UEB A;  3QG1 A;  1LTT D;  3VR5 A;  1TWA B;  4KD4 A;  2HHH L;  1LTG D;  3FKI H;  1QUQ B;  2NN6 G;  4KKS A;  2NZH A;  2RDH A;  2DY7 A;  3C3L A;  3I2Z A;  4H0L C;  2DJF C;  5CYU A;  4BA1 I;  4DR5 Q;  3HOZ G;  1B9N A;  4K5V A;  1EZ8 A;  1ENF A;  3AFP A;  4DKA C;  2FIN B;  5IYB G;  4AQY L;  2LFN A;  3A54 A;  4IJH A;  2D2C C;  4Z9C B;  5ELD A;  2XVS A;  2WB1 E;  2EYH A;  5L37 A;  3D0F A;  2ALY B;  3MXN B;  4MNO A;  2RVL A;  2KQ3 A;  1D8L A;  1PZK D;  1BNZ A;  1VQJ A;  1C8C A;  1FGB D;  1Z6H A;  3RN5 A;  5C4X G;  4JI3 L;  1TWF H;  3M4P A;  1VQA A;  1EWH A;  4CDF C;  5KIX A;  1CKN A;  1PTO D;  3CXC A;  3NQI A;  1D5X C;  2B2U A;  2B8F A;  2XNA C;  2JA7 B;  2BA1 A;  4IUV A;  3BZD B;  3CCL A;  4DF7 A;  4LFA Q;  4H7B A;  1QZG A;  1MIU A;  1O7Y A;  3J80 c;  3ERO A;  1G6Z A;  4K8J A;  4A3B B;  3LWU A;  4ZUI A;  2IJ0 A;  4DK0 A;  1JOR A;  5NUC A;  4LFA L;  3BZC A;  3EA6 A;  4R4C A;  5M3F G;  3TS2 A;  4JI1 Q;  2JA8 B;  5BR8 L;  2MJ8 A;  5IP7 H;  2P5Z X;  2WB1 B;  3OTO Q;  3W1B A;  3S17 H;  2BH2 A;  4JI3 Q;  5JEA H;  1SNM A;  1X9N A;  1V8Q A;  1ROD A;  1G8Z D;  1PRT B;  3OMC A;  2JA7 G;  2AHO B;  2A69 D;  2G9H D;  4K6L A;  1JT8 A;  4CKC A;  3K7A B;  3P20 A;  2FXQ A;  5C3E G;  3UDF A;  1VQM A;  3G48 A;  4NB3 A;  5C0X I;  4QIW B;  3OOC A;  3I4M H;  1XTC D;  4CDC C;  5M5X H;  4C3I G;  4JOI C;  1HNX L;  1D1K A;  2LY7 A;  1STB A;  3MZ5 A;  4L63 B;  1EQQ A;  2B63 G;  4A3C G;  2UU9 L;  1EY5 A;  3H91 A;  4HIO A;  4B08 A;  5M5W H;  1CSQ A;  3VR2 A;  1A3T A;  3TSS A;  4DR5 L;  3H09 A;  2Q2I A;  1H9S B;  3GTP H;  4YWK A;  5GRO A;  1SR3 A;  2PW5 A;  3CC2 A;  3UDG A;  1UUP A;  2WAQ B;  3GTJ B;  3D4D A;  4IPD A;  3H3V H;  2VNU D;  3NBH B;  1I50 B;  4ME3 A;  3VR3 A;  4HAE A;  3PO2 B;  1TU2 B;  4U67 3;  4WOR A;  2R7Z H;  2QIL A;  5GAG C;  4DN4 M;  4RH6 A;  2Z6K C;  1CZW A;  2SNS A;  1YI2 A;  4B3S L;  1SYF A;  4R4T A;  4HSV A;  4I7A A;  1HPC A;  1ZXT A;  2B39 A;  1K9M C;  3PUY A;  5A2Q E;  1IYU A;  1VF7 A;  4G4K A;  4A3M H;  1VQD A;  2NUC A;  1SNC A;  1SYC A;  5LMN W;  2Q2T A;  3PO3 G;  4BBS G;  5F2D A;  3PO3 H;  1PTO C;  4AYB E;  1AP0 A;  2JA8 G;  3S2H H;  1J5E L;  4QY7 A;  3WWV A;  4A3L G;  1SJE D;  1TS3 A;  4Y7N B;  1YJN A;  3KFU A;  1VDZ A;  2N88 A;  3CCJ A;  1LYL A;  2D9U A;  5A2Q L;  4A3J B;  3L3O C;  3K57 A;  3I56 A;  2IHF A;  2B29 A;  1IBK L;  4RCN A;  2QCP X;  4PZ7 A;  1X55 A;  2V4D A;  5C3W A;  5LMU L;  4FXD A;  1VF5 C;  4O0A A;  2F0V A;  4LF4 L;  2RQX A;  1EWC A;  1AZP A;  1ILQ A;  2HT1 A;  3PIO A;  1CKN B;  3PQI A;  3S24 A;  3RUZ A;  1HZA A;  3E0E A;  5C0X H;  4AH6 A;  2L0C A;  4L5S A;  1K8A C;  4LFB Q;  3HP3 A;  3S17 B;  4PG3 A;  4UHV A;  1CHQ D;  1XMO L;  4KV6 A;  4DK1 A;  5JAV A;  3E5S A;  1G2T A;  2Q2H A;  1EWI A;  3Q6S A;  5IOD A;  1GD7 A;  1HZB A;  5BN5 A;  1BKB A;  1B7Y B;  2F0J A;  1PH6 A;  4HJ8 A;  2Q8T A;  1U4R A;  4FYD A;  4APV A;  1Q90 A;  1MSG A;  3CD6 A;  4FNF A;  4LF6 Q;  1TY2 A;  2Z4H A;  4XT3 B;  3F2U A;  2Z0S A;  2Z1C A;  3MEH A;  1QUQ A;  2BOS A;  4NKL A;  2K5N A;  5I2Y A;  1BOS A;  2E2I B;  2N78 A;  2WV6 D;  3D6W A;  1ONL A;  3CHB D;  4XQQ A;  4JI7 L;  1D1I A;  1S5E D;  2JA5 B;  1NAP A;  3NUC A;  3HOW B;  2NTS A;  5M3M G;  4E6I A;  5IP7 G;  3NHH A;  4DK6 C;  2HCI A;  1N36 L;  4DUY L;  1G2S A;  4JG2 A;  4KKT A;  4EQP A;  1KRS A;  4BBR B;  3HKZ B;  4BY1 B;  4YCW A;  2KED A;  1VCI A;  2QDL A;  2C5C A;  4RAU C;  1PH2 A;  1HUN A;  1STY A;  2X69 A;  2YV5 A;  3NE5 B;  1VQL A;  4NXN Q;  5IYB H;  3FKI B;  2IX3 A;  1Q7Y C;  1E0B A;  3KF6 A;  2MGS A;  5I9O A;  4L5R C;  2CCZ A;  3KLS X;  3SK6 A;  4KHV A;  4CBV A;  1V1Q A;  5IWA L;  2QEX A;  2M2L A;  3EN2 A;  3CCQ A;  4A3I B;  4X64 Q;  2AKW B;  2A19 A;  3F2D A;  4G7H C;  5GAD C;  1KIX A;  3MC0 B;  4HTH A;  3HOV H;  3IKJ A;  2A73 B;  1X3Q A;  3CCM A;  4DV2 L;  1NR4 A;  3MVV A;  2UXC Q;  5IGF A;  3QB3 A;  1PRT D;  3RLN A;  4DAY A;  4WJ3 M;  1SMX A;  1SFO B;  2H1E A;  3VYS A;  4DR3 Q;  4KN7 C;  3HKZ E;  4CJ2 C;  3HGB A;  3W5O A;  2E5L Q;  1QIL A;  1BDO A;  1C4Q A;  1K83 B;  2PCF B;  3NK9 A;  5DLQ E;  3FMC A;  3RZD B;  4BY7 G;  4B3R L;  3M4Q A;  1JCK B;  3K8A A;  1JE4 A;  4CKE A;  3A5Z B;  1PHJ A;  2PO4 A;  1STE A;  3TZU A;  1MSH A;  1N34 L;  3BVM A;  1L0W A;  4J6H A;  1VMC A;  1MKH A;  4JI4 L;  4IJL A;  3S1N H;  1ENA A;  1ZYR C;  2GN5 A;  4A3K G;  4JI5 Q;  4K2L A;  2NVQ B;  5CBE E;  5FJ8 G;  4XYQ A;  1SDF A;  3DWQ A;  5FJ8 H;  3T53 B;  3QWN A;  4C3J H;  1BUV T;  3I7F A;  4PMB A;  4MZ9 A;  3DXJ C;  3NEN A;  2AQ3 B;  2K75 A;  4UDU C;  2PW7 A;  2UXB L;  2LSS A;  4UY8 C;  1CT1 D;  2JQO A;  4LFC Q;  3CAM A;  3GV3 A;  3CME A;  4JVZ A;  4DV6 Q;  4GOP A;  2M00 A;  1JE5 A;  2PYK A;  1PYB A;  2XN9 C;  2BE5 C;  3I4N G;  2IX0 A;  2R92 H;  3QOJ A;  2GA4 B;  4UP8 A;  4BXX G;  4NP5 A;  4EQ5 A;  1PFN A;  3DLL A;  4RHR A;  3I4M B;  1XMO Q;  3CCV A;  4ABN A;  5J1Z A;  2NYZ D;  3VA7 A;  1OXT A;  5IY0 A;  4RWS C;  3E6Z X;  3NWS A;  3BYY B;  1IBL L;  3I4L A;  2GVB A;  3S16 B;  2B2W C;  1CZG A;  5COY A;  4LF5 Q;  2XSC A;  2PQA A;  1YNJ C;  1AH9 A;  3PUW A;  5BN3 A;  2QA4 A;  4A3L H;  1WOC A;  4JV5 Q;  4C3I B;  3S2D B;  4A3M B;  4LF9 Q;  5JEA J;  2R7F A;  2B2V A;  2B3G A;  4OEM B;  5C3E B;  3G71 A;  4K8I A;  2B2V C;  4A3E H;  1C7Y A;  2F0D A;  2VQF Q;  2UXD L;  2Y0S E;  1IYJ B;  1X56 A;  2VB3 X;  5EQ0 A;  4DV3 L;  2YU9 H;  4K0K L;  2JP1 A;  2TSS A;  4HED A;  2R92 B;  2YYZ A;  2NVT B;  3K5O A;  1I50 H;  3KYH C;  4TKO B;  2KBN A;  1B2T A;  3VDY A;  3TRZ A;  1CUK A;  4DR6 Q;  4FF2 A;  1S72 A;  2UUC Q;  1SE4 A;  1TWF B;  2WKD A;  1K0R A;  2K01 A;  1RD9 D;  2JA8 H;  4IAL A;  1EFI D;  3I70 A;  1HR0 W;  1G51 A;  3CC4 A;  4BBS B;  3FDT A;  3ND9 A;  1CHP D;  1G91 A;  4NPS A;  4X6A H;  1QB5 D;  3CRL C;  4TRD A;  4X65 L;  4JI2 Q;  3U58 A;  5I9P A;  3HRZ C;  1GO3 E;  1YHQ A;  1CI3 M;  2PQE A;  2IHE A;  1GUN A;  3W2D A;  1PYS B;  2IL8 A;  1WTP A;  1Y69 U;  1STH A;  1AE3 A;  1IL2 A;  2K04 A;  4YY3 Q;  1HZC A;  5CV4 A;  5BN4 A;  4OWX B;  3OHX C;  1I4Q A;  2XTI A;  2KHS A;  3ERS X;  4FP5 D;  1VQI A;  2HDM A;  5C44 G;  1KL9 A;  1TWG B;  3J80 i;  2JE6 I;  1PDQ A;  1YNN C;  3W3A A;  1B50 A;  4A3I G;  1X54 A;  3B6Y A;  3TBI B;  3J81 i;  4U68 A;  1PRT F;  4TVA B;  3OW7 A;  3TEH B;  3SK5 A;  1UNS A;  3DEO A;  2F0G A;  4G57 A;  4HIK A;  4OXP A;  1DOK A;  3SEB A;  1W3S A;  1WTH A;  1IYV A;  1YIJ A;  1VQ8 A;  1YNJ D;  2NTT A;  4JI8 L;  2CH4 W;  1T9H A;  4RGN A;  2ZTD A;  4LUO A;  1EYD A;  4DXF A;  1Q1E A;  3E9H A;  2JYO A;  2WB1 G;  4DV0 Q;  4K5W A;  5ELB A;  1RF2 D;  4C3J G;  1XWE A;  4JC0 A;  1V1P A;  2F4I A;  1F77 A;  3KOJ A;  2EJM A;  4JV5 L;  4MTN A;  1TII D;  2Y0S G;  1HZ9 A;  3TN2 A;  2B63 H;  1KRT A;  3UE0 A;  1A63 A;  2I0Q A;  4B3T L;  1F9S A;  3DWP A;  4DR7 Q;  2D62 A;  4V0B A;  1JOQ A;  4A3B G;  2NVY B;  2BH8 A;  3HOU B;  2K05 A;  1I4P A;  4Q0F A;  1EY9 A;  1GUS A;  2NVT H;  4XDX A;  3M4O B;  3MHB A;  1WYD A;  2CFM A;  2F0O A;  1Q46 A;  4ZK9 B;  5I6Y A;  1W6J A;  3IL8 A;  1TR5 A;  2XWJ B;  5D14 A;  3SVM A;  2QF7 A;  4DR6 L;  2CWA A;  1X32 A;  1GJX A;  1CK1 A;  3ULL A;  4GNX C;  3NWT A;  1WFQ A;  4A3M G;  1F2M A;  1FVI A;  1XJV A;  4EQN A;  2KOL A;  3SR1 A;  4K14 A;  1F9P A;  1MI2 A;  1N9W A;  4C3I H;  4A75 A;  4F88 A;  2MFI A;  3NTH A;  2RF4 A;  5J22 A;  3OMG A;  3J80 L;  2ZXO A;  4KY7 A;  2OF1 A;  1XPU A;  3A56 A;  1RHP A;  1QVF A;  1PTO B;  2K33 A;  1NCV A;  1RL2 A;  4DU9 A;  4GLV B;  1TT2 A;  4QL5 A;  2GVA A;  4GNX A;  1LT5 D;  5C4X H;  2QEJ C;  1I6H B;  5CC4 A;  5M5W B;  2R93 G;  2VUM B;  2EY2 A;  3EFX D;  4UP9 A;  1NY4 A;  1EOT A;  1EEF D;  1MGS A;  4L5Q A;  4YHH L;  3ULP A;  1KQS A;  3KBG A;  4OX9 Q;  4ZQ3 A;  5C4Z A;  2IW3 A;  1NMF A;  5ELE A;  1YJ9 A;  4JI4 Q;  2YTX A;  1LTA D;  3D8G A;  3K0Y A;  4BWG B;  5C3X A;  5KYL A;  1NUC A;  5G3L D;  1M1K C;  3HS0 C;  5ISR A;  1VQH A;  4IFD H;  4H13 C;  4OL7 A;  1ML0 D;  4DAV A;  4P72 A;  1HNW Q;  2MO1 A;  3S9W A;  2PNR C;  3LWE A;  4A93 B;  5FOB B;  1KDB A;  2CKZ B;  2VB2 X;  1SMY D;  3STB D;  4HIM A;  1XMQ L;  4LFC L; 
#chains in the Genus database with same CATH homology
 3R3O A;  1O80 A;  1WD1 A;  4RA8 A;  3VYT A;  3H6M A;  3VR6 A;  2L1B A;  4ZLT F;  1F9Q A;  1QOH A;  2CHB D;  3ND8 A;  3J7Y W;  2LKV A;  3MAQ A;  1Y8P B;  3MXP A;  2PZU A;  1X3P A;  3PV0 A;  5KEE A;  5LHY 1;  4O42 A;  5FO9 B;  1ZYR D;  1CM9 A;  1H9M A;  5COR A;  5LL6 S;  4OIK A;  3GD7 A;  2ICE C;  1A2T A;  1PFB A;  1EY7 A;  4G7Z C;  2O2L D;  4ZAI A;  3C1F A;  1A3V A;  1ESF A;  3ERQ A;  3MXG A;  5D3I B;  3PUX A;  1U4M A;  1JWM D;  2RKS A;  3HOZ B;  1T5X D;  1JC7 A;  1Q1B A;  2N55 A;  2QKI C;  1O7Z A;  4R9W A;  3D3R A;  3D4R A;  3A55 A;  1DOL A;  4KJN A;  2K5D A;  5KRU A;  1Y8N B;  4TSS A;  4K2K A;  1MBY A;  3TDQ A;  4OO1 G;  2RA4 A;  3H0G B;  3TME A;  1T5E A;  3J80 E;  2L9H A;  1PYW D;  1NR2 A;  1F2Z A;  1LAC A;  1I4H A;  1I4G A;  2EYL A;  2EY6 A;  1TWC B;  2E2D C;  2OT2 A;  3GO5 A;  3BDO A;  1STA A;  1ESR A;  3RLF A;  2FJ2 A;  3OIP A;  4RGT A;  1CTM A;  2HCC A;  2F3W A;  1HUM A;  3H3V C;  2R61 A;  3A7A B;  4ZYS A;  1U4L A;  1GUG A;  3CQZ B;  3A8J E;  1EQV A;  1GUO A;  1RTN A;  4XIG S;  1EQT A;  2AWN A;  2SNM A;  2NZ1 D;  2PZT A;  3BDC A;  4OGQ C;  1SAP A;  1KLG D;  1BCP D;  1H9S A;  2R6G A;  4CJ0 B;  5FKA C;  3TZD A;  2ZXP A;  2R7Z B;  5T1G A;  1XXG A;  4MIU A;  2D5D A;  1JQY D;  1HCZ A;  3I4N B;  3CU7 A;  1E2W A;  1EY4 A;  3I91 A;  5IOC A;  5IT9 L;  2MHV A;  2KCN A;  4QF4 A;  2F0P A;  3TP7 A;  2CW0 D;  4A3D B;  2SOB A;  1C48 A;  4PV1 C;  1DCZ A;  1B53 A;  2EVB A;  1Z47 A;  4X3T A;  1KLU D;  1YNN D;  4ID6 A;  2IX1 A;  4XQJ A;  3SDZ A;  2OEO A;  3GTM B;  4A3G B;  4IUN A;  4IQZ A;  5FO8 B;  1QWY A;  3KLR A;  2O4X A;  5C5L A;  4F87 A;  2B2Y A;  3EJI A;  3V2T A;  3L9A X;  1HHV A;  3PO3 B;  3S1R B;  1BQQ T;  1WVL A;  3NSW A;  3NQT A;  3U9O A;  1I4R A;  3EVQ A;  2L55 A;  3Q24 A;  1SYB A;  2WII B;  3QIA A;  2ID0 A;  5IT9 E;  1SNP A;  3GTK B;  1FYC A;  1BCP C;  2X6G A;  2EY1 A;  5E4X A;  1F2L A;  4IFD I;  4AYB B;  1B3A A;  3DMU A;  3RD4 A;  3MFY A;  2HDL A;  4IFD J;  3C1E A;  1J8I A;  5K5P A;  1UAP A;  5DNF A;  1AW7 A;  5M3F B;  4FXG C;  4B9X A;  5C6A A;  4A3F B;  4X3U A;  3ZYY X;  4QUF A;  4MHE A;  4DA2 A;  5EBD A;  1B9M A;  1B1Z A;  4KD3 A;  1OXS C;  1WTO A;  2TMP A;  5C4H A;  3U9S A;  3MTS A;  3S1Q B;  1TVX A;  1ENC A;  4HCS A;  1DZ1 A;  1SMY C;  1Z7T A;  5KNB A;  1TQO A;  4XXE A;  2B2T A;  3SK4 A;  3URY A;  3FRP B;  3GTO B;  1BCP F;  3OWE B;  4IZ8 A;  2NB0 A;  4I65 A;  1TKW B;  3JAM L;  4V19 0;  4RCO A;  1TS2 A;  3AB9 A;  1MD2 D;  3MXU A;  3VYR A;  1SSO A;  3D4W A;  2IPK D;  5KND A;  1LAB A;  3BDL A;  1GXD C;  4O1N A;  4DNT B;  1KDC A;  2F1M A;  3I72 A;  4OO1 H;  4HCE A;  1TS4 A;  1STN A;  1XX8 A;  1S5D D;  1K8M A;  2J4X A;  5I6W A;  2LMC B;  5M9O A;  1HQR D;  4LJZ C;  1CQF A;  1HTL D;  5E1F A;  2ZXR A;  3I3C A;  1UEA B;  4LK1 C;  3S14 B;  1H9K A;  1LT4 D;  2F0N A;  2FMC A;  4F7X A;  1KAB A;  5IGB A;  2DNE A;  5CGK A;  1OXX K;  5DAU A;  5C0X G;  4KN4 C;  4C1N K;  1SNQ A;  3R8B A;  1JOO A;  4IFD G;  2K5Q A;  4MN3 A;  2A6H C;  4HN7 A;  3VR4 A;  1RJT A;  4C2M B;  3T51 B;  2XRS D;  1CA6 A;  2L11 A;  3QO2 A;  4FVM A;  4ULL A;  4C3H B;  1TWH B;  2B2T C;  1OXV A;  5CV7 A;  3GQB A;  5FO7 B;  3S15 B;  3DEP A;  4KY5 A;  4X3S A;  5E3F A;  1ILP A;  3P75 A;  2EYF A;  1PFM A;  4A3E B;  1CA5 A;  1GHJ A;  4XTC S;  2EY5 A;  3FPU B;  1SXT A;  1BF4 A;  4DXG A;  2XRQ D;  2WKC A;  4FF3 A;  2HUG A;  4RKL A;  5IGD A;  2J0T D;  3PUV A;  2L4N A;  4PMW A;  1S4Z A;  3C46 A;  2JEB I;  4G7O C;  2EYM A;  2O5I C;  2EYJ A;  2SEB D;  4ODG A;  3T56 B;  2JSO A;  5JVH 3;  4FO2 A;  3IAY A;  4K6D A;  3ITP A;  4IUT A;  5M5X B;  2EE1 A;  1PZI D;  4X3K A;  5IIF A;  3D31 A;  3NBI A;  3GTL B;  4TQU S;  3BS1 A;  1H9J A;  1L0X B;  1STG A;  4QUC A;  3OIQ A;  1EY0 A;  4HMI A;  2IT1 A;  4C1N I;  3OSO A;  1XYI A;  1VMP A;  1PMR A;  2RBM A;  2NVX B;  3FVQ A;  4I7Z C;  3VYU A;  2JA6 B;  1IW7 C;  1RKN A;  1SYG A;  1CQV A;  1EEI D;  2BDN A;  1EY8 A;  3I90 A;  3J7A V;  4NDX A;  1E2V A;  1S5B D;  5E4W C;  3K59 A;  1LTB D;  1NSN S;  1EU4 A;  2K32 A;  1FD7 D;  4PMC A;  5KGU A;  1LO5 D;  1EY6 A;  2B2W A;  5IGG A;  1SE3 A;  3R2T A;  1OO9 B;  3MWY W;  3BYT B;  4ME5 A;  2Q8I B;  1SND A;  4RGM A;  5M3M B;  4C56 C;  3J81 E;  3L7Z C;  2B2Y C;  2EYP A;  4EQO A;  1A6X A;  4NW2 A;  4KMU C;  5DM7 3;  3SK8 A;  1QG7 A;  3HEJ A;  1R4Q B;  4FF4 A;  2ENB A;  2NBF A;  5CR3 A;  3H94 A;  2K1B A;  4F8M A;  3PIO 3;  5EGT A;  1D6E C;  4IUQ A;  4ZKB B;  1HFG A;  3PIP 3;  1WD0 A;  1AZQ A;  4J8Q A;  3X3M A;  3P1H A;  2AQ2 B;  5DEH A;  3DM1 A;  4XT1 B;  1IKL A;  3RZO B;  2L12 A;  4CHT B;  2PPB C;  3C2P A;  2IWH A;  1SYD A;  4KJO A;  3S2H B;  5EPJ A;  4N9T A;  3CKI B;  3I73 A;  2FMM A;  5EPK A;  5CV9 A;  3AMU A;  1EL0 A;  1HA6 A;  3NTK A;  3M85 A;  1IKM A;  4S3S A;  2A6E C;  5I4D A;  3K58 A;  1F9R A;  3KLS A;  1O78 A;  4KKU A;  2FFK B;  4BS9 A;  1GHK A;  4FXK C;  1GOZ A;  4OHJ A;  2XIW A;  3SE0 A;  3GTQ B;  4JK1 C;  1TS5 A;  2NN6 H;  2K7V A;  4ZRZ A;  1V43 A;  4LMQ D;  2K5W A;  4L8J A;  2PMZ B;  1KNE A;  5CV8 A;  1BR9 A;  1CFM A;  4KY6 A;  4M8A A;  1ZEQ X;  1A3U A;  3A7L A;  1SBB B;  2RDG A;  2H4O A;  3R2I A;  4P2C B;  3DHQ A;  1KAA A;  3Q0A A;  2LS0 1;  2HQE A;  1HQM C;  3T4A C;  1S5F D;  3WOE A;  2Q8R E;  2B8G A;  5AFW A;  1Y8O B;  1BBX C;  3T16 A;  1DJR D;  2BA0 A;  3MA2 B;  1SEB D;  4GZY C;  2KUM A;  1LTR D;  1HFN A;  1BCP B;  1SE2 A;  2BDO A;  3NTI A;  3HG9 A;  2A6E D;  5FLX L;  3LX0 A;  2AWO A;  2MP1 A;  2KCC A;  1V1P B;  4C3J B;  2WAC A;  5IGE A;  2F0T A;  1QNU A;  5JEA G;  2ICI A;  2F0F A;  2NN6 I;  1EIH A;  1ICW A;  1LV9 A;  1LT3 D;  3E0J A;  3K5L A;  2YU9 B;  1KNA A;  1ZKO A;  5EKL A;  5EKK A;  1FNW A;  2BE5 D;  3GTP B;  1IL8 A;  4L6T B;  1LTS D;  4ILW A;  1TY0 A;  2RSN A;  2QDB A;  1D5M C;  4N9P A;  1SYE A;  2VXW A;  3SXH A;  5I2X A;  4JBW A;  3D6C A;  4R8I A;  5KNC A;  3NBH A;  5ELF A;  2KEC A;  4XYO A;  4EGV A;  4DAP A;  1DM0 B;  2A5H A;  5D3D A;  1JWU D;  1DD2 A;  1I3Q B;  2F0M A;  1L0Y B;  4HMJ A;  3HOX B;  3M4Y A;  3TP8 A;  3K5M A;  1IHZ A;  1Y1V B;  1R9T B;  1FNU A;  1FNV A;  2M9V A;  2F0S A;  4M1U B;  3PMF A;  4K5X A;  1DXM A;  3JAM E;  3NXW A;  4CJ1 B;  3KK7 A;  2Z4I A;  3Q22 A;  5DM6 3;  3AU7 A;  3FEW X;  2L5T A;  2JXM B;  5M5Y B;  5JVG 3;  5CBA E;  4HR7 B;  2JEA I;  2EOT A;  1I6V C;  2F0Q A;  4H44 C;  3VA5 A;  3M7N A;  1K8O A;  4KTA A;  4R8N A;  1DOM A;  1I4X A;  5EBC A;  3RMH A;  1RDP D;  1D2B A;  1ET6 A;  2F0K A;  1W6K A;  5C5M A;  5IGC A;  1EU3 A;  1HA5 A;  2F0W A;  5JJZ A;  3Q23 A;  3S1N B;  1HTP A;  2SDF A;  3DWA A;  5EJW A;  5J39 A;  1EYA A;  5CMD A;  1M8A A;  1BO0 A;  1RTO A;  1J9O A;  5EPL A;  1AEX A;  4RHS A;  3GP7 A;  3DUZ A;  2KVM A;  2EJF C;  2KEE A;  2PZW A;  4Q5V A;  2B2U C;  3V96 A;  1F2Y A;  5TSS A;  5HUR A;  4OIJ A;  3SHL A;  3BVZ A;  5G3L F;  1Q8I A;  2K28 A;  2EJG C;  5JPN C;  4RFB A;  2EZV A;  2G9D A;  3A8I E;  2A74 C;  3TP6 A;  4WFN 3;  4CGY B;  5HGT A;  4KK7 A;  1PRT C;  5JOB A;  3IFT A;  1PTO H;  2RDF A;  2WP8 J;  4QMG A;  3R93 A;  1O7L A;  2AUJ D;  1JB3 A;  1SNO A;  3K6O A;  3K5N A;  2EYO A;  4A3K B;  1B4O A;  4PNY A;  2KJX A;  5CV5 A;  2K6A A;  3A8K E;  4KHZ A;  2O5J C;  3NP8 A;  2X6L A;  1LTI D;  2FHT A;  1Q12 A;  3O13 A;  2F3V A;  1Y1W B;  5C4X B;  2E75 C;  4C3H G;  5FLX E;  2E74 C;  5ELC A;  1QJO A;  2EPB A;  1LT6 D;  2MUY A;  1QE6 A;  1EIG A;  1QNK A;  1GUT A;  5C0X J;  1Q3L A;  5K36 G;  4NMZ A;  1KTK A;  2J7Z A;  2B63 B;  1LLR D;  2F0E A;  1M4V A;  3V05 A;  4YIJ A;  4IUP A;  4J1M A;  4WJW A;  1OXU A;  1EYC A;  5C4J B;  2AUK A;  2MPM A;  2EXZ A;  3S1M B;  3BG3 A;  1WTV A;  2F03 A;  1BXT A;  2NWG A;  4HSP A;  2WIN B;  2Y0S B;  4EVO A;  4ZUJ A;  3ONA B;  2A6H D;  2A68 C;  5LL6 X;  1JIC A;  3PUZ A;  1WTR A;  2F0I A;  3X3N A;  3P7J A;  1U9R A;  4IUU A;  1KDA A;  4RGO S;  2F0U A;  4BY7 B;  3KUP A;  3TP5 A;  3N52 A;  3WOF A;  4CKB A;  2I07 B;  4QB4 A;  1HXY D;  1AN8 A;  3KBX A;  3QJY A;  4IN3 A;  5C44 B;  2K03 A;  2DN8 A;  3M3Y B;  4BA2 I;  3GV6 A;  2RSO A;  5CV6 A;  4IUR A;  3IFD A;  1QCB D;  1A2U A;  4KI0 A;  3N6R A;  3KF8 A;  3I8Z A;  1JOK A;  3LNN A;  3MFG A;  2DY8 A;  1PZJ D;  2EDG A;  4RKB A;  3UI2 A;  3G6J B;  4XQN A;  3OPO A;  5T1I A;  4PQX A;  3QOL A;  1JWS D;  1A15 A;  3WDN A;  2E76 C;  3FPP A;  1JR0 D;  3HZX A;  5JPM C;  1ET9 A;  1V1O A;  1H9R A;  1PLF A;  3NPP A;  2F0L A;  1PTO F;  1WCM B;  2BCO A;  2F0H A;  1AFP A;  1DON A;  3CRK C;  1S5C D;  2KA7 A;  5EKI A;  2A68 D;  1E2Z A;  3J81 L;  1IW7 D;  4DGZ A;  2XWB B;  1GUW A;  2E2H B;  4UAI A;  1R4P B;  4LAA A;  1WTQ A;  5K36 H;  2CQA A;  1EZ6 A;  3BVG A;  5A35 A;  1U4P A;  4ZKC B;  2Z8L A;  1PXU A;  3OWF A;  1WTX A;  2DNC A;  3T13 A;  2CVR A;  1SJH D;  1WTW A;  1HRJ A;  2R93 B;  5FK9 C;  2OXP A;  2R3Z A;  1II3 A;  5D65 A;  2I46 A;  4FF1 A;  4DFA A;  4B9W A;  2E2J B;  2AQ1 B;  3G7L A;  3HOY B;  1D5Z C;  1G29 1;  4WRD A;  2ZT9 C;  3EQL C;  4DNR B;  2C9O A;  3GTG B;  4QCL A;  1DYQ A;  2CW0 C;  1FR3 A;  4OO1 I;  3J7A F;  2A69 C;  3HOV B;  1B44 D;  3M7G A;  5KYI A;  1RCV D;  3MXN A;  3QG1 A;  3VR5 A;  1LTT D;  1TWA B;  4KD4 A;  1LTG D;  2NN6 G;  4KKS A;  2RDH A;  2DY7 A;  3C3L A;  4H0L C;  5CYU A;  4BA1 I;  1B9N A;  4K5V A;  1EZ8 A;  1ENF A;  2FIN B;  2LFN A;  3A54 A;  2D2C C;  4Z9C B;  5ELD A;  2XVS A;  2EYH A;  2RVL A;  2KQ3 A;  1PZK D;  1BNZ A;  1C8C A;  1FGB D;  1Z6H A;  1EWH A;  5KIX A;  1PTO D;  2XNA C;  1D5X C;  2B2U A;  2B8F A;  3NQI A;  2JA7 B;  2BA1 A;  4IUV A;  3BZD B;  4DF7 A;  4H7B A;  1O7Y A;  3ERO A;  1G6Z A;  4K8J A;  4A3B B;  3LWU A;  4ZUI A;  2IJ0 A;  4DK0 A;  1JOR A;  5NUC A;  3EA6 A;  2JA8 B;  2MJ8 A;  2WB1 B;  5JEA H;  1SNM A;  1V8Q A;  1ROD A;  1G8Z D;  1PRT B;  3OMC A;  2A69 D;  2G9H D;  4K6L A;  4CKC A;  3K7A B;  3P20 A;  5C0X I;  4QIW B;  3OOC A;  1XTC D;  4C3I G;  1D1K A;  2LY7 A;  1STB A;  3MZ5 A;  4L63 B;  1EY5 A;  3H91 A;  4B08 A;  3VR2 A;  1A3T A;  3TSS A;  3H09 A;  1H9S B;  2PW5 A;  1UUP A;  2WAQ B;  3GTJ B;  3D4D A;  2VNU D;  1I50 B;  3VR3 A;  4HAE A;  3PO2 B;  4U67 3;  1TU2 B;  4WOR A;  2QIL A;  4DN4 M;  4RH6 A;  1CZW A;  2SNS A;  1SYF A;  4HSV A;  1HPC A;  1ZXT A;  2B39 A;  3PUY A;  5A2Q E;  1IYU A;  1VF7 A;  4G4K A;  2NUC A;  1SNC A;  1SYC A;  5F2D A;  1PTO C;  1AP0 A;  1SJE D;  1TS3 A;  4Y7N B;  1VDZ A;  2N88 A;  2D9U A;  4A3J B;  5A2Q L;  3L3O C;  3K57 A;  4RCN A;  2QCP X;  2V4D A;  5C3W A;  4FXD A;  1VF5 C;  2F0V A;  2RQX A;  1EWC A;  1AZP A;  1ILQ A;  3RUZ A;  5C0X H;  2L0C A;  3HP3 A;  3S17 B;  1CHQ D;  4KV6 A;  4DK1 A;  5JAV A;  3E5S A;  1G2T A;  3Q6S A;  5IOD A;  5BN5 A;  2F0J A;  2Q8T A;  1U4R A;  4FYD A;  1Q90 A;  1MSG A;  4FNF A;  1TY2 A;  2Z4H A;  4XT3 B;  3F2U A;  2Z1C A;  3MEH A;  2BOS A;  4NKL A;  5I2Y A;  1BOS A;  2E2I B;  2WV6 D;  3D6W A;  1ONL A;  3CHB D;  4XQQ A;  1D1I A;  1S5E D;  2JA5 B;  1NAP A;  3NUC A;  3HOW B;  2NTS A;  4E6I A;  3NHH A;  2HCI A;  1G2S A;  4KKT A;  4EQP A;  4BBR B;  3HKZ B;  4BY1 B;  2KED A;  1VCI A;  2C5C A;  4RAU C;  1HUN A;  1STY A;  2X69 A;  3NE5 B;  3FKI B;  2IX3 A;  1E0B A;  2MGS A;  5I9O A;  3KLS X;  3SK6 A;  4KHV A;  4CBV A;  2M2L A;  4A3I B;  4G7H C;  3MC0 B;  4HTH A;  3IKJ A;  2A73 B;  1X3Q A;  1NR4 A;  3MVV A;  5IGF A;  3QB3 A;  1PRT D;  4DAY A;  1SFO B;  2H1E A;  3VYS A;  4KN7 C;  4CJ2 C;  3HGB A;  1QIL A;  1BDO A;  1C4Q A;  1K83 B;  2PCF B;  3NK9 A;  3FMC A;  3RZD B;  1JCK B;  1JE4 A;  4CKE A;  2PO4 A;  1STE A;  3TZU A;  1MSH A;  3BVM A;  4J6H A;  1VMC A;  1ENA A;  1ZYR C;  4K2L A;  2NVQ B;  5CBE E;  4XYQ A;  1SDF A;  3DWQ A;  3T53 B;  3QWN A;  1BUV T;  4PMB A;  3DXJ C;  2AQ3 B;  4UDU C;  2PW7 A;  1CT1 D;  3GV3 A;  2M00 A;  2PYK A;  2XN9 C;  2BE5 C;  2IX0 A;  3QOJ A;  2GA4 B;  4NP5 A;  1PFN A;  4RHR A;  3I4M B;  4ABN A;  5J1Z A;  2NYZ D;  3VA7 A;  1OXT A;  4RWS C;  3E6Z X;  3NWS A;  3BYY B;  3I4L A;  3S16 B;  2B2W C;  1CZG A;  5COY A;  2XSC A;  1YNJ C;  3PUW A;  5BN3 A;  4C3I B;  3S2D B;  4A3M B;  5JEA J;  2B2V A;  5C3E B;  4K8I A;  2B2V C;  2F0D A;  2VB3 X;  5EQ0 A;  2R92 B;  2JP1 A;  2TSS A;  4HED A;  2YYZ A;  2NVT B;  3K5O A;  4TKO B;  1B2T A;  4FF2 A;  1SE4 A;  1TWF B;  2WKD A;  2K01 A;  1RD9 D;  4IAL A;  1EFI D;  3I70 A;  4BBS B;  3FDT A;  3ND9 A;  1CHP D;  1G91 A;  1QB5 D;  3CRL C;  4TRD A;  5I9P A;  3HRZ C;  1CI3 M;  2PQE A;  3W2D A;  1GUN A;  2IL8 A;  1WTP A;  1Y69 U;  1STH A;  2K04 A;  5BN4 A;  5CV4 A;  3OHX C;  1I4Q A;  2KHS A;  4FP5 D;  2HDM A;  1TWG B;  2JE6 I;  1PDQ A;  1YNN C;  3W3A A;  1B50 A;  3TBI B;  4U68 A;  1PRT F;  3OW7 A;  3SK5 A;  1UNS A;  3DEO A;  2F0G A;  4G57 A;  1DOK A;  3SEB A;  1IYV A;  1YNJ D;  2NTT A;  4RGN A;  1EYD A;  4DXF A;  1Q1E A;  2JYO A;  4K5W A;  5ELB A;  1RF2 D;  4C3J G;  1XWE A;  1V1P A;  2F4I A;  1F77 A;  2EJM A;  1TII D;  3TN2 A;  1F9S A;  3DWP A;  2D62 A;  4V0B A;  1JOQ A;  2NVY B;  3HOU B;  2K05 A;  1I4P A;  4Q0F A;  1EY9 A;  1GUS A;  3M4O B;  4XDX A;  2F0O A;  3MHB A;  4ZK9 B;  5I6Y A;  1W6J A;  3IL8 A;  1TR5 A;  2XWJ B;  5D14 A;  3SVM A;  2QF7 A;  1X32 A;  1GJX A;  1CK1 A;  3NWT A;  1F2M A;  4EQN A;  2KOL A;  3SR1 A;  4K14 A;  1F9P A;  1MI2 A;  4F88 A;  3NTH A;  5J22 A;  3OMG A;  3J80 L;  2ZXO A;  4KY7 A;  2OF1 A;  3A56 A;  1RHP A;  1PTO B;  2K33 A;  1NCV A;  4DU9 A;  1TT2 A;  1LT5 D;  2QEJ C;  1I6H B;  5CC4 A;  5M5W B;  2VUM B;  2EY2 A;  3EFX D;  1EOT A;  1EEF D;  1MGS A;  3KBG A;  4ZQ3 A;  5C4Z A;  2IW3 A;  5ELE A;  4BWG B;  1LTA D;  3D8G A;  3K0Y A;  5C3X A;  5KYL A;  1NUC A;  5G3L D;  3HS0 C;  5ISR A;  4IFD H;  4H13 C;  4OL7 A;  1ML0 D;  4DAV A;  3S9W A;  2PNR C;  3LWE A;  4A93 B;  5FOB B;  1KDB A;  2VB2 X;  1SMY D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...