3R3OA

Crystal structure of staphylococcal nuclease variant delta+phs t62a at cryogenic temperature and with high redundancy
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
129
structure length
129
Chain Sequence
b'LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFAKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Cavities determine the pressure unfolding of proteins.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 33
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2011-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3r3oA00
3BDCA 3QOLA 3SK6A 4ZQ3A 4TRDA 4QB4A 3TP6A 4EVOA 1JORA 1SYEA 3NK9A 3PMFA 3SK4A 4IALA 3ITPA 1KDBA 4KY5A 5IOCA 4ZUIA 2NUCA 1SNOA 3SK8A 4DF7A 2M00A 2EXZA 3BDLA 5F2DA 2F0HA 3NXWA 2EY5A 1ENAA 3HZXA 5JAVA 1TT2A 4WRDA 2RBMA 1A2UA 4PMCA 2F0PA 4KHVA 3D6CA 4KY6A 1EQVA 4ME5A 5DAUA 5IGBA 5IODA 2F0DA 1EY7A 5NUCA 1KDAA 1F2MA 3NQTA 4NKLA 4NDXA 3MVVA 5CV9A 2F0VA 5E3FA 1EY9A 5EKKA 5JOBA 1KDCA 4F8MA 4EQPA 1SNDA 2KHSA 4IUNA 1SYDA 4KD3A 4KJNA 2F0FA 5IGGA 3NHHA 4EQNA 1EY8A 4HMJA 2EYFA 1IHZA 3T16A 5I6WA 1EY6A 1EY5A 4OL7A 2PW5A 4MIUA 2EY6A 2OF1A 3EVQA 4QMGA 5J1ZA 4I65A 1A3VA 1SNMA 4K2LA 1JOKA 1KABA 4RKLA 4N9PA 1SNQA 1SNCA 2OXPA 5IGEA 2F0EA 1EZ8A 2O4XA 3MEHA 1SNPA 3EROA 4ID6A 3U9OA 4DGZA 5CR3A 5CGKA 5IIFA 1NUCA 4K14A 2F3WA 2EYHA 1ENCA 3OSOA 3QB3A 2OEOA 2WACA 2PZUA 2F0GA 4G57A 5CC4A 1EY4A 1STGA 1RKNA 5EKLA 2F3VA 2EYOA 4K5XA 4KD4A 5E1FA 3H6MA 3TP5A 3EJIA 5CV4A 5C3XA 5HGTA 4K5VA 1F2ZA 4HTHA 4B9XA 2F0JA 3E5SA 3D8GA 1A2TA 1EYAA 3MZ5A 3TMEA 4YIJA 4KY7A 5KGUA 2RDFA 1SYBA 1TR5A 1STHA 3MXPA 5CV8A 2F0SA 5J39A 5CV7A 4KV6A 4NMZA 5KEEA 5KYIA 5K5PA 2PZWA 3HEJA 4J1MA 1STAA 2F0IA 4NP5A 2SNMA 3D4WA 3T13A 2SNSA 1SYFA 4KTAA 4DFAA 3NUCA 2F0QA 3OMGA 3D4DA 4J6HA 4R8NA 3V2TA 4F7XA 2QDBA 2ENBA 2F0KA 4RKBA 5DEHA 5C5MA 3SXHA 3VA5A 5I6YA 3P1HA 4K8JA 2F0OA 4PNYA 5EGTA 3LX0A 1F2YA 5HURA 1U9RA 1TQOA 3P75A 3ERQA 5IGDA 2F0TA 3MHBA 4KJOA 4K5WA 5I9PA 2EYJA 4ODGA 3TP7A 3NP8A 2PZTA 4DU9A 1JOQA 3OWFA 3DMUA 3QOJA 4H7BA 3C1EA 3DHQA 2F0WA 4LAAA 5C4HA 1A3UA 1STNA 2EYMA 2PW7A 2KQ3A 4K2KA 5C3WA 2RKSA 5I9OA 1SYCA 2EYLA 2LKVA 5M9OA 2EY2A 4S3SA 4WORA 2PYKA 4K6DA 2PQEA 1EYCA 5CV6A 5KIXA 5ISRA 5J22A 2EY1A 2F0MA 3SK5A 1KAAA 2F0NA 4EQOA 3R3OA 1EZ6A 1EYDA 4PMBA 1JOOA 1A3TA 1SYGA 5C4ZA 5KRUA 2EYPA 1AEXA 5C5LA 4B9WA 3C1FA 1STBA 3SR1A 4E6IA 3OMCA 2F0LA 4K8IA 5CV5A 4QF4A 3RUZA 2HQEA 1STYA 3TP8A 3S9WA 4HMIA 4ZUJA 5IGFA 5IGCA 2SOBA 1EY0A 1II3A 1NSNS 5C6AA 5KYLA 4IZ8A 3SHLA 2F0UA 4N9TA
chains in the Genus database with same CATH superfamily
1NMFA 3OW7A 5M5YB 1Y8NB 4IALA 2YTVA 4X3UA 1BO0A 5LMUQ 1HXYD 1LTID 5E4XA 1IL8A 3VYSA 3NXWA 1BQQT 4KLKA 2CHBD 4X62L 1X3PA 5LMNW 2HIXA 1UEAB 3CMAA 1X56A 1GUOA 1VQPA 2ZM6Q 4C3JB 4JI0L 1MKHA 1BOSA 4L5RC 4EQNA 1EY8A 3NSWA 4JK1C 1MJCA 3KJPA 3RZOB 4IFDG 4MIUA 4LF5Q 2JYOA 1W3SA 1DD2A 3A56A 4IUPA 2IWHA 3CD6A 2NVYB 4JI1Q 2MUYA 1D8LA 3TSSA 4DK1A 3EROA 3S14B 1VQJA 2B2TC 2LXJA 2EYHA 1QNKA 1EFID 4G57A 3BYTB 3FKIG 3VR5A 2F3VA 2RCFA 5JVG3 2YYZA 1MIUA 3CQZH 4A3EH 2Q2UA 3WWVA 1X55A 2B2VA 1B2TA 5BR8L 2B29A 4IUTA 2RDFA 3NPPA 1I50B 1F2LA 4R9WA 3QIAA 2UUCL 1EU4A 4Y7NB 3R2IA 4DV2L 3AB9A 5K5PA 5C44H 1HNZL 5IY0A 4P74A 3T1YL 5IT9c 4PZ7A 4R8NA 1VF5C 2P5ZX 4J6HA 5C0XG 3GD7A 1BBXC 4OONA 4C3HG 1Z47A 1N34Q 3BS1A 3GP7A 4UPAA 1F9QA 4GNXB 2Y0SE 4CBVA 2I07B 2Y0SG 1H9SA 3RLOA 1CFMA 5C3WA 2WINB 3I4MH 4LF4Q 1XTDA 2EVBA 4JW0A 1EYDA 1WVLA 2KVMA 3DUZA 3S2DB 3CCJA 1I4QA 1TIID 1C48A 4HIDA 3OMCA 4HMIA 5FO8B 1SAPA 3RZDH 3M4QA 2IJ0A 2K14A 3W2DA 4GZYC 1YHQA 4PZ8A 1X54A 2ES2A 4L6TB 5H1SE 4RGMA 1PV4A 4RH6A 2K01A 3GTKH 1TWHB 1VDZA 2L15A 1J6QA 1JC7A 3VA7A 1G2TA 2K5QA 2YTYA 1K3RA 2I5LX 2R61A 3F2CA 3VYUA 2Q2HA 4K0KQ 4LWCA 2RBMA 1MBYA 3ICEA 1HHVA 2XN9C 1X32A 3D3RA 1ILPA 4FVMA 4YWMA 4P71A 1IBKL 1MD2D 2UUAQ 4LW1A 2UUBQ 1PH3A 3RR5A 1IBML 2ICEC 2RVLA 3IKJA 5ELCA 1YHAA 2DNEA 3VDYA 1N32L 1K8OA 2KCTA 4I65A 4RKLA 3BJUA 5A2QE 1YBYA 4HJ5A 1SNQA 4F88A 3RLFA 2B2UA 2K28A 2ZJPA 2X69A 4PV1C 4XQNA 3N6RA 3GTQH 2OEOA 3AMUA 2A6HC 1WJJA 3JAMc 1J5EQ 5DNFA 3OPOA 3OYYA 5LMNL 5HGTA 3U9SA 4ZLTF 4DV6L 3HOYG 4AH6A 1A2TA 2XWJB 1WTQA 1PRTB 3GO5A 2XGTA 3BU2A 1Q1BA 3WOEA 4XDXA 5ELDA 3L9AX 2OQ0A 5KYIA 1PZID 1Z7TA 2CH4A 1PYSB 3J80c 3HKZE 2SNMA 3GTPH 2WIIB 1SMYD 5C5MA 4A75A 1NCVA 4OX9Q 4RHRA 2NVTB 2H4OA 3ERQA 1VS0A 3Q6SA 4Q5VA 3S24A 4K5WA 2EYJA 3TP7A 1W6KA 2LXKA 1H95A 3S17B 3K8AA 3A74A 3I90A 3K0XA 3S16H 1HNWQ 1D6EC 2HQLA 2PNRC 4CHTB 3HOZB 3MXNB 5FLXE 2YV5A 1VQBA 1JICA 1EQRA 3EQLC 4K6DA 3NE5B 2F0NA 3H3VC 3HOXG 1EZ6A 1OO9B 5IWAQ 4A3BH 3DM1A 1CK1A 3GTJB 1Y1WB 5IGFA 5FOBB 1HNXQ 5KYLA 4MTKA 2CW0C 3R93A 4DXFA 4B3MQ 1WCMB 1M4VA 1JORA 3PMFA 3PIO3 3I4NG 3PO3H 1PTOH 1F9SA 4YCWA 5IOCA 4DR2Q 2NUCA 2M00A 4QJFA 2MO0A 2Z4HA 1B3AA 4DV7L 4UHVA 2ZM6L 2IX0A 1T9HA 1I6HH 1Y1VH 3PUZA 1K0RA 1T5XD 4C56C 4ZK9B 2B39A 3K5MA 3OW2A 4JI1L 2D62A 1WTPA 1LTLA 2VB3X 4M8AA 4P73A 5EKKA 4DR3Q 1SYDA 1IBLQ 1PTOC 5C44G 3T16A 2B2WC 1QVCA 1S5BD 3KDFA 3HP3A 1A3VA 1U5KA 4FF1A 3ER0A 3CCMA 4R4TA 3NTIA 5K36H 4DUZQ 2HHHQ 4BWGB 1P8LA 1LTGD 1MHWC 1B7YB 1S4ZA 1YNXA 1HTPA 3OSOA 4HJ7A 4BY7B 3I55A 2JEAI 4CKCA 1TS3A 3UDXA 4OIKA 1UAPA 1I6VC 2B63H 1F2ZA 2MPMA 1PXUA 3I4MG 3D8GA 1GXDC 1STHA 2K50A 1VQCA 2TSSA 4HSVA 3CRLC 4DR6Q 1N34L 3E0JA 4J1MA 1HUNA 2Y0SB 3D4RA 1SYFA 1KRTA 3FRPB 5I6YA 5HURA 1RIPA 4PNYA 4A3KH 4HR7B 3M4OB 2JSOA 4IJHA 1F9PA 2M9VA 4JI8Q 4DAVA 1PFBA 4JOIC 2L0CA 1R4PB 2MP1A 4DU9A 3TN2A 3J7AV 1G51A 3QWNA 2RKSA 2D0PA 2K4KA 3K7AB 3TZDA 4POGA 4GNXA 1V1OA 1SLJA 4UDUC 4DR4Q 4B3RL 1JOOA 1TWCB 1FD7D 2E75C 1OXSC 4QF4A 3TP8A 2F1MA 5AJ3Q 2Z8LA 2EJFC 1EWCA 3R8BA 1RD9D 3GV6A 3S1MB 3L7ZC 2Z6KC 2F0SA 3KF6A 4R4QA 4A3JB 3QOLA 4K0KL 1OXUA 2NZOA 2L12A 3UE1A 3ND9A 4JBWA 5L37A 3HZXA 3MFYA 4FF2A 1IKLA 1X65A 1M8AA 1GUNA 3E6ZX 2UUAL 2R7DA 3CCQA 1K8GA 1AP0A 2UUBL 5IT9E 4A3CH 1E7ZA 3LGJA 4M1UB 2M2LA 2KECA 3F2BA 3KLSA 1WFQA 2KHJA 2Q8TA 4WJ4A 2MGSA 5JOBA 1KDCA 5C4HA 3PIP3 5EQ0A 3I2ZA 2HCIA 1BVSA 5C4XB 2NVXB 1SNMA 1JOKA 3MXUA 1HZAA 4IN3A 4N9PA 4H44C 5IP7H 2CWAA 3VYRA 3G48A 2O4XA 4N8FA 1J5EL 2HDMA 5G3LF 5CR3A 2J4XA 4DK3C 2MFIA 3QB3A 1VQ7A 3A54A 1CKOA 3S1QB 2JA8B 2FHTA 1CZWA 4HSPA 4BXXH 1J8IA 3MA2B 4K5XA 3TP5A 2A68D 1EOTA 3ULJA 3HKZB 4C1NI 1WTRA 1SXTA 2ZTCA 1NNXA 2EDGA 3TMEA 4LK1C 2GA4B 4DAMA 2ZJQA 1Q1EA 1E2VA 4OX9L 4DK0A 1E24A 5A2QL 1YNJD 1C4QA 3OTOL 1OXVA 3C3LA 2R3ZA 3HEJA 1BDOA 5EBCA 3D4WA 3HOVH 2G9HD 1K9MC 2WB1E 3D4DA 4WFN3 5JPNC 1KLUD 1VMPA 3M3YH 1N33L 2YTXA 4K8JA 4RG1A 3CHBD 4RCNA 4KHPL 5IGDA 4HIKA 4XYOA 1AFPA 3CCLA 2BDNA 1S5ED 1D1IA 3OOCA 5IWAL 3C1EA 4K2KA 4LF8L 4A3FG 3F1ZA 5KIXA 3T1HQ 3P7JA 1PTOF 1EYCA 1I4RA 3H0GB 2F0MA 5GAHC 1HNXL 1SJED 3DWAA 4IFDH 2A8VA 4TQUS 4B3ML 2EYPA 1AEXA 5IP9H 3RUZA 4XXEA 4YWLA 4XTCS 3GTLH 2VL6A 5IGCA 4ABNA 1ASYA 2R92H 3UI2A 2RDHA 3JAME 1SMYC 1E22A 1O78A 1LLRD 3W1GA 4A3EB 3NK9A 4LUOA 1TWFH 4GKKL 3ITPA 5BN4A 3S1NH 4A3MB 1UE6A 2EXZA 3BDLA 3PO2H 4B3SQ 1ENAA 3A8IE 5C44B 1XXGA 4GLAC 1A2UA 3J80E 5A35A 4DR3L 2GN5A 2CFMA 2B63G 5DAUA 1VQNA 1AE3A 3A8KE 3CC2A 1LTTD 3QO2A 3KK7A 5C0XH 1EY9A 1YJNA 3PUVA 4DUZL 2HHHL 2G5DA 4C3HH 4H0LC 1YJ9A 3CC7A 3NELA 4HJAA 1V43A 3L3OC 2Q8IB 4DV4Q 1JR0D 1X3EA 1EQTA 4CDDC 4OELB 2A6HD 4JG2A 1JJGA 5IGEA 1Q3LA 5CGKA 3I4MB 4YCVA 1HR0Q 4IOCA 1YIJA 1VQAA 4K14A 2HT1A 5JVH3 1VQMA 4DAYB 1LTBD 4PQXA 3URYA 5M5XH 2ALYB 1JE4A 2EJMA 1M90C 5JJKA 5E1FA 2Z0SA 1HFNA 2Z1CA 5FK9C 2Q2IA 1Z9FA 2OT2A 1CKMA 1U4PA 4YY3Q 4X3TA 4LFBQ 4NMZA 1LM0A 4DKAC 2QA4A 5M3FH 3UDGA 3GTKB 2H1EA 4JI8L 1DOKA 2JA6H 1ZEQX 1NR4A 4Y52H 3P75A 3ERSX 4JC0A 3J7AF 3K5NA 2K6AA 4L8JA 5D14A 2B8GA 4AYBE 3ONAB 1FNWA 1KQSA 2PZTA 1FYCA 3LWUA 3OWFA 4DR4L 2HIVA 1ILQA 1A3UA 2PW7A 4C2MH 4CDEC 2PNHA 4ALPA 2NN6H 5T1IA 4AQYQ 3C2PA 2EYLA 5AJ3L 4WORA 1K83H 1VQDA 2EOTA 2IHEA 1IKMA 2ATWA 1N36Q 4LMQD 3HOWH 3GTQB 4OO1H 3NENA 2KCMA 5I4DA 3F2UA 3CKIB 4DV1Q 3EN2A 3KBGA 4X66L 4IUVA 2BH8A 3S15B 2N88A 4DNRB 4EVOA 2R93B 4XQJA 1Y8OB 2JA7B 2JA9A 1VQGA 4V190 4DXGA 3MWYW 1TU2B 4FP5D 4OIJA 4LNQA 2K5VA 1PH8A 2QDLA 5NUCA 3M85A 2E2HH 2F0VA 2D9UA 1FR3A 4EQPA 1KD1C 2AWOA 4A3IH 4HN7A 5FLMH 3HOVG 1SSOA 1PH7A 5ELNA 3ULPA 3S16B 1KL9A 3U9OA 4A93H 1XPUA 5IYDG 4KHZA 3JAMi 2WACA 5IT9L 2PZUA 4A3BB 1DONA 3PCOB 3H3VI 3G7LA 3ND8A 3M7NA 1DM0B 3VR4A 3HOXH 1DJRD 3H6MA 4DV7Q 4K5VA 1P16A 2KENA 4DAPA 3NBHB 2WB1B 1VQHA 3M7GA 3J80i 5KNBA 2K03A 1HZBA 4GOPB 1HZCA 1PTOB 2Z9HA 2VW9A 3PO3B 5IP9G 1BKBA 2PI2A 2F0IA 1LV9A 2FMCA 2SNSA 2F0QA 3I4NH 4A4IA 2R92G 1WTVA 1BCPD 4CDFC 1WD1A 1B9NA 1Y1VB 5I2YA 1SR3A 1UE1A 2B8FA 1X9NA 2PQAA 3T1HL 4IFDJ 4CDCC 1FGUA 3K81C 5M3MG 5ELFA 3PO2G 4BBRH 1ML0D 1GJXA 2F0WA 1UE7A 3MTSA 2B2VC 2LS01 4X6AH 3FVQA 3ULLA 5M9OA 2A68C 1RODA 2IPKD 1HH2P 4IPHA 1STYA 1YNJC 1E1TA 1VQLA 5FO7B 2SOBA 2E5LL 3I56A 2BH2A 2E2JH 4B3SL 5COYA 3N52A 3TP6A 2FMMA 4KY5A 1NMGA 1BCPB 2L5TA 5F2DA 5C0XJ 3EBEA 5CMDA 4DV3Q 1SE3A 3PF4A 2Q2TA 2EXDA 3J7A5 4A3GB 1DCZA 1QJOA 4KHVA 4ME5A 4KY6A 5IGBA 2LY7A 4RGTA 1H9JA 4A3KB 4DV4L 1HUMA 2VS1A 1RJTA 5CV9A 1QUQB 1CI3M 3JAML 4B3RQ 2KHSA 5M3FG 1HR0L 1E2WA 4KKUA 1KIXA 1JCKB 1ESRA 3EVQA 2AQ2B 5DM63 2HCCA 2JA6G 3V05A 2OXPA 4OXPA 4WJWA 1SNPA 3QJYA 1LABA 1S5DD 2KA7A 1I94Q 3F2DA 2R7ZG 2JA5G 1LACA 3EFXD 4R4CA 1ENCA 2VUMH 3U58A 1RCVD 4FNFA 3S2HH 1A0IA 4YY3L 4LFBL 1RKNA 3HGBA 1PYBA 2NN6G 5GAGC 5E4WC 2F0JA 4KKTA 5FO9B 3FEWX 4YIJA 1I4HA 2BCOA 3I4OA 1JWSD 3GTGH 5JEAH 4DAYA 4KV6A 4ZCKA 1Z6HA 4OO1G 4GN3B 3OIQA 4IUUA 3HOWG 4JV5L 1IYUA 4AYBB 1VQEA 1V8QA 4F7XA 4IOAA 3SXHA 2ENBA 1CSQA 5EAYA 2C9OA 3B6YA 4L63B 5LHY1 1VQ4A 1PFMA 1XPRA 1WTWA 5DM73 2EJGC 4AQYL 3IAYA 4R1JA 1GO3E 4MNOA 2L1BA 4AIMA 4BBSB 4GLXA 2D5DA 4X3SA 1N36L 2PPBC 1HCZA 4OHJA 3VR6A 2R7FA 4DV1L 2EY1A 2K1BA 1UNSA 2N78A 2VQFQ 1K0SA 5KRUA 2PCFB 2EQSA 3J7YW 1N8RC 4BY1B 5GAEC 3SR1A 1DOLA 2NBFA 2F0LA 1MSHA 4FDBA 5TSSA 4A3IG 3OTOQ 5FLMG 4CKBA 4IPCA 4QQBX 4QL5A 1D1KA 3UE0A 3SHLA 1N33Q 1L0YB 5GROA 3J81j 4A93G 4KHPQ 1SBBB 4X65Q 4FXDA 3PGZA 1LYLA 1B44D 1EIYB 2WAQG 4TVAB 2WV6D 3KUPA 4DR7Q 2OTJA 2XSCA 4LF8Q 1X3FA 2F0DA 3DEPA 1EYGA 1Q82C 3MC0B 5M5WH 3TBIB 2IT1A 5IGGA 1B50A 1H9MA 4G4KA 3TDQA 1EY5A 2PW5A 2DY7A 1LT3D 1PFNA 1YEZA 2MQHA 4K2LA 2KHIA 3I70A 2JP1A 3GTMH 1A62A 1S72A 4HEDA 3E9IA 1GHJA 1KNEA 1SEBD 4GKKQ 1L0XB 4A3FH 4NPSA 3IFDA 4C3IH 1XX8A 4LF7Q 5CC4A 1GUWA 1KRSA 4BBRG 2DN8A 4KD4A 2SDFA 4BA1I 5C3XA 4A3LH 3RZOH 2R92B 2KUMA 1LO5D 2O5JC 4GOPC 2JXMB 1C9OA 5BN3A 3MXPA 4CJ1B 2X6LA 3FKIB 1BNZA 3ZJYC 3D0FA 3T13A 3GTOB 3V2TA 3AFQA 2F0KA 1TWAB 3NBHA 4IFDI 4OWWB 1QG7A 4DV5Q 3I7FA 1F2YA 1TQOA 3DM3A 2E2IB 2JJQA 5I9PA 2B2WA 2OWOA 1I50H 3T56B 4Y7NH 4C3HB 3T4AC 4X3KA 1YJWA 3RD4A 1SFOB 1O7IA 1JB7A 1PH9A 5KNDA 3HOUH 3UDFA 1Y14B 5C4ZA 3Q8DA 2NVQH 1GHKA 4JCVE 4LFAL 1X3QA 1F9RA 1KLGD 3TZUA 5M5XB 2NYZD 1NTGA 4DV3L 3VR2A 2WKCA 5C0XI 2KEEA 1BCPC 4ZQ3A 4LJZC 1SYEA 3UDIA 2F4VQ 3KLRA 2YU9B 2VUMG 1WI5A 2ZXPA 1JQYD 3K59A 4O2DA 1QVGA 4OGQC 3K0YA 1L1OB 4LF9Q 1PA6A 4HIMA 2EZVA 1F2MA 1YHBA 4B08A 5EPKA 3D31A 3M4YA 3ZYYX 5JEAG 1NY4A 2A1AA 2QF7A 1I94L 4HMJA 1GVPA 2SEBD 3CAMA 1EY6A 2NZ1D 3A7LA 1S5FD 2ZTDA 4GS3A 3GDEA 1WD0A 1DOMA 2BDOA 2FINB 2K5HA 2CKZB 4C2MB 4UP9A 4X66Q 1TY2A 4DGZA 5JJLA 1G91A 4MZ9A 1BBWA 3NEMA 3G6JB 2KCCA 1DGSA 3PSIA 1STGA 1ICFB 2E2DC 3EJIA 1PYWD 5CV4A 4HTHA 4BS9A 3VYTA 3C46A 4ZKBB 1RHPA 3EIVA 1VQIA 1PH2A 1L2FA 5CV8A 4DN4M 2LFNA 4DFAA 3HOYB 3G6EA 4R4OA 3H91A 4OO1I 1V1QA 4P2CB 2VB2X 1WTHA 3K58A 1JE5A 2C35B 2KJXA 4ODGA 2A69D 1VQ6A 1FNVA 2J7ZA 4IPGA 2VQFL 1PH5A 1SE2A 2KQ3A 4RHSA 5I2XA 2LKVA 3K57A 2Z4IA 1U0LA 4DK6C 2NVTH 3NTHA 1SJHD 1A3TA 2LMCB 2RHQB 5C5LA 4PMWA 1PHJA 2FFKB 2X6GA 2IHFA 2QW7A 2OQKA 4X65L 1S40A 1EQQA 5IYDH 3S17H 3DEOA 2F0UA 3HOXB 4N9TA 3SE0A 1C8CA 3HOZH 3SK6A 2QGQA 3H15A 2UXCQ 1G2SA 3LWEA 4QIWE 1KDBA 3RLNA 4DR7L 4XT3B 2FJ2A 3GV3A 2B2YA 4C3IG 1YVCA 1O7LA 3DWQA 3CPWA 1Y1WH 3S1RH 3I4NB 3D6CA 1PH6A 4A3LG 1XMQQ 2CH4W 1PVOA 1KDAA 4NKLA 1B4OA 3MXNA 2DJGC 4KJNA 1K8AC 1X6OA 1IHZA 3CQZB 3K5LA 5LL6S 1VQ9A 1O80A 2N55A 4JYAQ 5FLXL 4HJ8A 4LF7L 2QILA 2AQ1B 1CUKA 1SNCA 2E5LQ 4Z9CB 1EZ8A 3PV0A 5M3MH 2L55A 4RMFA 4FYDA 5IYBH 2O2LD 4LF6L 4C1NK 1EEID 2AQ3B 3K7UC 5GQOA 1SN8A 2EYOA 1HRJA 1EUJA 4H02A 3Q23A 3CCUA 1EL0A 2GVAA 2XVSA 3HOUG 1JJCB 4DV5L 2AMCB 3TREA 3AYHB 1MSGA 4ILWA 1BCPF 2CQOA 2C5CA 1Q7YC 2NWGA 3DLLA 1JMCA 3OMGA 4FF3A 4BY7H 5HGQA 3KJOA 4CJ2C 2VQEQ 1Q86C 4CGYB 2K32A 4BA2I 1U9RA 1Q12A 2RHSB 1HQMC 2RF4A 2N3SA 3D6WA 4CKEA 4YHHQ 2D2CC 1HPCA 4JI3Q 3OIPA 3RZDB 3EA6A 2XWBB 4DV0Q 5C4JH 4H7BA 2G9DA 4NXNQ 1IYJB 5IYCH 4NB3A 2PO4A 1A63A 2IL8A 5ISRA 3SEBA 3I72A 3W3AA 3Q22A 1HA6A 4XQQA 2E76C 1D2BA 1YZ6A 4B9WA 4L5TA 4E6IA 5D3IB 1J9OA 2F4VL 3T51B 4UY8C 4JV5Q 1CM9A 2R7ZH 1EY0A 2JA5H 1AZQA 3WDNA 4IZ8A 4QB4A 1G8ZD 3T53B 2CCZA 4LF9L 4UP8A 2K5NA 3K7AH 4G7OC 3A55A 1FNUA 1T5EA 1UUPA 1L1OC 2Q8RE 1TWCH 1VQOA 2UXDQ 1TT2A 4L5SA 1XWEA 1TS4A 4PMCA 4K6LA 1VQ5A 4A3DH 4POFA 5J3BA 4CJ0B 5JJZA 1XMOQ 1L0WA 3S1MH 1IW7D 1EY7A 3HFZB 4A3JH 2ZTEA 3NHHA 1KC8C 4HIOA 1SDFA 2VXWA 2OF1A 1KTKA 4IQZA 3I4LA 2ASBA 2E74C 2TMPA 3MEHA 2I46A 2A5HA 1EU3A 2QEXA 2MJ8A 4JI6Q 4WJ3M 3GTPB 3SDZA 2EPBA 1GUGA 1I4GA 3I3CA 2GVBA 1D5ZC 2QKIC 4HAEA 4V0BA 2O5IC 1STEA 1B53A 3JC66 5C4XH 3Q0AA 3OWEB 4GN5A 1A15A 1X3GA 5J39A 3CXCA 1LUZA 2BE5D 4G7ZC 2NTTA 4A76A 1G6PA 3J81c 1LTRD 1UWVA 3AU7A 4GN4B 3FHWA 3S1QH 2JA8H 3F8TA 5DEHA 3VA5A 1MI2A 2JE6I 1AZPA 3LX0A 1FL0A 3HOZG 4RWSC 1JT8A 3A8JE 4IUQA 3DWPA 5M5WB 4HCEA 1BR9A 1EFWA 2MNAA 2AHOB 2EYMA 4QGUA 1Y1WG 3RN2A 4YWKA 2V1CC 1R9TH 3GTMB 3X3MA 3TS0A 1WCMG 4DPGA 3KDFB 2Z6BA 2FXQA 2AKWB 1I6HB 4QIWB 2UXCL 4A3FB 4C3IB 1RDPD 3AQQA 1QZGA 1UE5A 4P75A 3SK4A 4EQ5A 2XRQD 3H0GH 2H5XA 5IYBG 1XMQL 1SNOA 1IL2A 2VNUD 1H9RA 1IXRA 3BZDB 2F0HA 2EY5A 2A69C 2B2TA 1G291 3KYHC 1Q90A 1GUTA 4MTNA 3OHXC 5T1GA 4JBMA 5IODA 1WOCA 3HG9A 2EE1A 3NBIA 4JYAL 2JK8A 2PMZE 1TS5A 1ZYRD 4DR1Q 2B63B 4A3MH 1U4LA 2EY6A 2F4IA 4BY7G 1CHQD 4LFAQ 2VY3A 4XT1B 2I0QA 4NW2A 1VQFA 4ZYSA 4LUVA 3A0JA 3KFUA 4DR5Q 4JBKA 3HOUB 2ZJRA 4FF4A 3BYYB 3KOJA 1TXYA 4IPDA 2NVQB 1S5CD 1GUSA 3MEFA 5IYCG 1VQKA 3O13A 2KEDA 1SYBA 1TR5A 4JI2Q 2VQEL 4ZRZA 2A6ED 5KEEA 4I7ZC 3KF6B 3STBD 1A6XA 1STAA 4YHHL 1QE6A 1I3QH 1KHIA 1YNND 3NUCA 3A5UA 4JI3L 1O7YA 4RKBA 3J80L 1WTXA 1EWHA 4DV0L 4IO9A 4NXNL 2NB0A 4O42A 4GKJQ 1Q8KA 1FVIA 1KAWA 2RSOA 1TY0A 1NBWA 1BXTA 2XNAC 1STNA 4LUZA 4NXMQ 1CQVA 4A3DG 2BOSA 2PQEA 3K5OA 4PG3A 2JQOA 5J22A 1PRTD 4O1NA 4DA2A 4EQOA 2B2UC 4A3JG 2N8NA 1K28A 3MXGA 5CV5A 1B1ZA 1QZHA 5EKIA 5ELEA 1E2ZA 1EIHA 5C6AA 4TKOB 2UXDL 3BDCA 4P72A 5DLQE 1TWGH 4JI4Q 3I91A 4OWXB 5D65A 4ZUIA 1XMOL 1NAPA 4TSSA 2UXBQ 5C3EH 1QNUA 2DJFC 2V4DA 4JVZA 2RDGA 1CZGA 3CCRA 5C4XG 4H13C 3A7AB 3IL8A 1TKWB 3P20A 2ZXOA 3NQTA 3S15H 4XIGS 2L4NA 2R93H 1W2BA 4KD3A 1CA5A 1AE2A 2WP8J 4ULLA 5I6WA 2JA7H 3KF8B 4JI6L 2PI2E 2AUJD 3CRKC 2JA8G 2ID0A 1KXLA 4Q0FA 1GKHA 2WAQE 5ELOA 3W5OA 3CMEA 3HKZG 3CW2C 3LNNA 3MFGA 3V96A 5CBEE 3H3VH 3HOVB 4JI7Q 2RSNA 1SE4A 4ME3A 3M3YB 3TS2A 5EKLA 3FMCA 2R6GA 5EJWA 1Q8IA 3Q24A 1PMRA 3L2PA 5M5YH 2BA1A 1CKNB 1PH1A 3FPUB 1KNAA 1VQ8A 1VF7A 1RTOA 1IW7C 1PDQA 5CV7A 4UAIA 2AUKA 1EIGA 4NP5A 3BG3A 3U4ZA 1HTLD 1JWUD 3H94A 1SMXA 3J7ZC 3X3NA 3S1RB 1XNRQ 4MHEA 1SE8A 2I5HA 2NZHA 1CA6A 5LMUL 4C3JH 1BUVT 2D0OA 4KJOA 4MN3A 1WTOA 1YI2A 3H0GG 1D5XC 1UEBA 1XNQQ 3GTLB 1FJGQ 4F87A 4KI0A 1OXTA 1PLFA 2JN4A 4QUCA 1SROA 2NVYH 3CC4A 4LF6Q 4JPBW 1JB3A 3PUWA 2EY2A 4EX5A 1TWFB 3S14H 1F77A 3S1NB 3NWTA 3SK5A 1NE3A 3R3OA 1LT5D 3CP0A 5M3MB 4PMBA 3PO2B 4A3EG 4KN4C 1STBA 3I8ZA 3RN5A 4LF5L 2BE5C 1W6JA 1V1PB 4A3MG 2KBNA 2A19A 2OCEA 4GOPA 2DUDA 4O0AA 1G6ZA 4TRDA 4FXGC 2A73B 3HS0C 2I5MX 3SK8A 4DF7A 3K6OA 3IRBA 1ENFA 2PMZB 3BZKA 2F52A 3WOFA 1QVFA 4KN7C 3J81E 4B3TQ 4RFBA 1EQVA 4DR1L 4GLVB 3MVVA 1ET6A 4QY7A 1ONLA 1D5MC 4F8MA 2RQXA 1EWIA 1SNDA 2DNCA 3G71A 2UU9Q 2EYFA 2E8GA 3CPFA 4DR5L 3BVMA 5C4JB 5J1ZA 1FGBD 1Q81C 4A3GH 3M9BA 1MJEA 3S2DH 5M3FB 1B3QA 1E3PA 4GNXC 1CTMA 4DUYQ 2F0GA 1ESFA 4JOIA 1LT6D 2JA6B 4JI2L 4JI5Q 2CWPA 4LFCQ 2IX3A 4LF4L 1JOQA 3M4PA 1AN8A 4B9XA 5D3DA 2R7ZB 4RAUC 2JA5B 5AFWA 4KK7A 1TWHH 3NTKA 4R8IA 3G4SA 4X64Q 1TVXA 2DGYA 1CT1D 4GKJL 1QUQA 1ZYRC 1K83B 1IZ6A 1QB5D 3P1HA 2F0OA 5EGTA 5GADC 5JEAJ 4A3DB 4NXML 1VCIA 2Z6KA 3HOWB 1B9MA 3FDTA 4OWTB 4HJ9A 1HQRD 1ASZA 3BVZA 5C3EG 3L0OA 2MO1A 4S3SA 2PYKA 2NN6I 4IURA 1GM5A 1I4PA 4R4IA 1U4MA 1BF4A 1LTAD 3QR8A 5E7NA 2ZT9C 4KMUC 3MAQA 4JI4L 1QWYA 4I7AA 4EGVA 2R93G 4K8IA 1GOZA 1XTCD 2A6EC 3STBC 1NR2A 3NQIA 2JA7G 4ZUJA 4BBSH 1NSNS 4RCOA 1YNNC 2RA4A 2L11A 2B3GA 5EPJA 1B8AA 2UXBL 2E2HB 1LTSD 2DY8A 4QUFA 3R2TA 1K73C 3PUXA 5FJ8H 4A3IB 3BZCA 1GD7A 3VR3A 4BY1H 1VMCA 1XYIA 4WRDA 1ET9A 5IE8A 4A93B 2CVRA 1D7QA 5EPLA 4NDXA 1EOVA 4X62Q 1PRTC 3AEVA 1N9WA 2WAQB 4IUNA 2IW3A 5ELBA 4A3BG 4JI7L 4QMGA 1EEFD 2PQAB 1RL2A 3PIOA 1XJVA 2IY5B 2F0EA 3CU7A 1M1KC 4JI0Q 2K5WA 2JEBI 2B2YC 2K75A 3GTJH 5BN5A 1NUCA 1R9TB 4C3JG 1QILA 2WB1G 1BBUA 1HNWL 4XYQA 3KLSX 3KF8A 5EBDA 3KLWA 3PO3G 1WCMH 3E0EA 3E5SA 3MZ5A 1EYAA 1K3BC 2XIWA 2KCNA 4KY7A 5KGUA 1I4XA 3J81i 1Q46A 1Y1VG 4BBRB 1XNRL 4PZ6A 3PUYA 3DXJC 3TQYA 1H9SB 4KTAA 5CYUA 1A8VA 5BR8Q 1HJPA 1K8MA 1U4RA 2QDBA 1XNQL 1CKNA 1FJGL 4J8QA 2UUCQ 2IX1A 2F03A 1CSPA 4DV2Q 1LT4D 3CF5A 2F0TA 2WKDA 4DR2L 1HNZQ 1C0AA 3T1YQ 1SRUA 4L5QA 2KOLA 3MHBA 3BDOA 1H9KA 5K36G 4YCUA 3QOJA 2NTSA 4LAAA 3FKIH 2E2JB 1DYQA 1AH9A 5I9OA 1ICWA 3GTOH 1RF2D 5CV6A 1AW7A 3BVGA 1TWAH 1I5FA 2XRSD 5CORA 1IBLL 4APVA 1Y69U 1IYVA 4KKSA 3C1FA 3KBXA 4G7HC 2RCNA 4IJLA 2E2IH 4RGNA 5JJIA 1ZXTA 2HQEA 5CBAE 2CQAA 3S9WA 2N49A 1DZ1A 3IFTA 1II3A 4RGOS 1XPOA 4A3GG 1JWMD 2K52A 1SFOH 3A5ZB 1PZJD 3CCEA 4B3TL 5KNCA 3QG1A 3E3XA 1ZKOA 4A3KG 1PH4A 4U673 1V1PA 3PQIA 3TEHB 1V9PA 3W1BA 1WYDA 2ICIA 5FKAC 5JAVA 1HFGA 1YITA 1I3QB 2F0PA 3M4OH 2L9HA 2UU9L 2AWNA 4DNTB 2VUMB 3PF5A 2ZXRA 4DR6L 3S2HB 5E3FA 3E9HA 4QCLA 3TRZA 2F0FA 5FLXc 2K04A 3HRZC 1R4QB 4OL7A 2YU9H 3CCSA 1B70B 4DUYL 4J15A 3HKSA 2EIFA 2K5DA 3U50C 1KABA 1IBKQ 3H09A 2BA0A 3GQBA 2HD3A 1PFSA 4JI5L 3GTGB 4ID6A 4LFCL 2OTLA 4ZKCB 1IBMQ 5IIFA 3J81L 2F3WA 1N32Q 5G3LD 2F3IA 2K05A 1EY4A 3SGIA 2HDLA 1EIFA 1QCBD 4FXKC 4AYBG 4X64L 2WFWA 1S3OA 4OEMB 1TWGB 3PIPA 1L1OA 3FPPA 4FO2A 2LSSA 5LMNQ 1OTCA 5HY6A 4A3CG 2PZWA 2QEJC 4DV6Q 1TS2A 2HUGA 4UP7A 2CW0D 4BBSG 5C3EB 1HR0W 5JPMC 1E1OA 1E0BA 3NWSA 4U68A 5FJ8G 3NP8A 3RNUA 4N8X1 5IP7G 1MGSA 2VZAA 3CCVA 3DMUA 4BY1G 3U4VA 3DHQA 3I73A 2NVXH 1JJ2A 1CHPD 1CQFA 2MHVA 4RA8A 1PRTF 3SVMA 1SYCA 2XTIA 3HOYH 2J0TD 3FP9A 1DXMA 3RMHA 1Y8PB 4BXXG 1KAAA 1HA5A 2QCPX 1NJIC 1HZ9A 1SYGA 2A74C 1QOHA 3K80C 1PTOD 5LL6X 1O7ZA 1OXXK 2K33A 1PZKD 1RTNA 4HCSA 3AFPA 1C7YA 4JBJA 4DNIA 2K7VA 4ZAIA
chains in the Genus database with same CATH topology
5M5YB 3OW7A 1Y8NB 4IALA 4X3UA 1BO0A 1HXYD 1LTID 5E4XA 1IL8A 3VYSA 3NXWA 1BQQT 2CHBD 1X3PA 1UEAB 1GUOA 4C3JB 1BOSA 4EQNA 1EY8A 3NSWA 4JK1C 3RZOB 4IFDG 4MIUA 2JYOA 1DD2A 3A56A 4IUPA 2IWHA 2NVYB 2MUYA 3TSSA 4DK1A 3EROA 3S14B 2B2TC 2EYHA 1QNKA 1EFID 4G57A 3BYTB 3VR5A 2F3VA 5JVG3 2YYZA 2B2VA 1B2TA 4IUTA 2RDFA 3NPPA 1I50B 1F2LA 4R9WA 3QIAA 1EU4A 4Y7NB 3R2IA 3AB9A 5K5PA 4R8NA 1VF5C 4J6HA 5C0XG 3GD7A 1BBXC 4C3HG 1Z47A 3BS1A 3GP7A 1F9QA 4CBVA 2I07B 1H9SA 1CFMA 5C3WA 2WINB 2EVBA 1EYDA 1WVLA 2KVMA 3DUZA 3S2DB 1I4QA 1TIID 1C48A 3OMCA 4HMIA 5FO8B 1SAPA 2IJ0A 3W2DA 4GZYC 4L6TB 4RGMA 4RH6A 2K01A 1TWHB 1VDZA 1JC7A 3VA7A 1G2TA 2K5QA 2R61A 3VYUA 2RBMA 1MBYA 1HHVA 2XN9C 1X32A 3D3RA 1ILPA 4FVMA 1MD2D 2ICEC 2RVLA 3IKJA 5ELCA 2DNEA 1K8OA 4I65A 4RKLA 5A2QE 1SNQA 4F88A 3RLFA 2B2UA 2K28A 2X69A 4PV1C 4XQNA 3N6RA 2OEOA 3AMUA 2A6HC 5DNFA 3OPOA 5HGTA 3U9SA 4ZLTF 1A2TA 2XWJB 1WTQA 1PRTB 3GO5A 1Q1BA 3WOEA 4XDXA 5ELDA 3L9AX 5KYIA 1PZID 1Z7TA 2SNMA 2WIIB 1SMYD 5C5MA 1NCVA 2NVTB 4RHRA 2H4OA 3ERQA 3Q6SA 4Q5VA 4K5WA 2EYJA 3TP7A 1W6KA 3S17B 3I90A 1D6EC 2PNRC 4CHTB 3HOZB 5FLXE 1JICA 3EQLC 4K6DA 3NE5B 2F0NA 3H3VC 1EZ6A 1OO9B 3DM1A 1CK1A 3GTJB 1Y1WB 5IGFA 5FOBB 5KYLA 2CW0C 3R93A 4DXFA 1WCMB 1M4VA 1JORA 3PMFA 3PIO3 1PTOH 1F9SA 5IOCA 2NUCA 2M00A 2Z4HA 1B3AA 2IX0A 3PUZA 1T5XD 4C56C 4ZK9B 2B39A 3K5MA 2D62A 1WTPA 2VB3X 4M8AA 5EKKA 1SYDA 1PTOC 3T16A 2B2WC 1S5BD 3HP3A 1A3VA 4FF1A 3NTIA 5K36H 4BWGB 1LTGD 1S4ZA 1HTPA 3OSOA 4BY7B 2JEAI 4CKCA 1TS3A 4OIKA 1UAPA 1I6VC 1F2ZA 2MPMA 1PXUA 3D8GA 1GXDC 1STHA 2TSSA 4HSVA 3CRLC 3E0JA 4J1MA 1HUNA 2Y0SB 3D4RA 1SYFA 3FRPB 5I6YA 5HURA 4PNYA 4HR7B 3M4OB 2JSOA 1F9PA 2M9VA 4DAVA 1PFBA 2L0CA 1R4PB 2MP1A 4DU9A 3TN2A 3J7AV 3QWNA 2RKSA 3K7AB 3TZDA 1V1OA 4UDUC 1JOOA 1TWCB 1FD7D 2E75C 1OXSC 4QF4A 3TP8A 2F1MA 2Z8LA 2EJFC 1EWCA 3R8BA 1RD9D 3GV6A 3S1MB 3L7ZC 2F0SA 4A3JB 3QOLA 1OXUA 2L12A 3ND9A 4JBWA 3HZXA 3MFYA 4FF2A 1IKLA 1M8AA 1GUNA 3E6ZX 1AP0A 5IT9E 4M1UB 2M2LA 2KECA 3KLSA 2Q8TA 2MGSA 5JOBA 1KDCA 5C4HA 3PIP3 5EQ0A 2HCIA 5C4XB 2NVXB 1SNMA 1JOKA 3MXUA 4IN3A 4N9PA 4H44C 3VYRA 2O4XA 2HDMA 5G3LF 5CR3A 2J4XA 3QB3A 3A54A 3S1QB 2JA8B 2FHTA 1CZWA 4HSPA 1J8IA 3MA2B 4K5XA 3TP5A 2A68D 1EOTA 3HKZB 4C1NI 1WTRA 1SXTA 2EDGA 3TMEA 4LK1C 2GA4B 1Q1EA 1E2VA 4DK0A 5A2QL 1YNJD 1C4QA 1OXVA 3C3LA 2R3ZA 3HEJA 1BDOA 5EBCA 3D4WA 2G9HD 3D4DA 4WFN3 5JPNC 1KLUD 1VMPA 4K8JA 4RCNA 3CHBD 5IGDA 4XYOA 1AFPA 2BDNA 1S5ED 1D1IA 3OOCA 3C1EA 4K2KA 5KIXA 3P7JA 1PTOF 1EYCA 1I4RA 3H0GB 2F0MA 1SJED 3DWAA 4IFDH 4TQUS 2EYPA 1AEXA 3RUZA 4XXEA 4XTCS 5IGCA 4ABNA 3UI2A 2RDHA 3JAME 1SMYC 1O78A 1LLRD 4A3EB 3NK9A 3ITPA 5BN4A 4A3MB 2EXZA 3BDLA 1ENAA 3A8IE 5C44B 1XXGA 1A2UA 3J80E 5A35A 5DAUA 3A8KE 1LTTD 3QO2A 3KK7A 5C0XH 1EY9A 3PUVA 4H0LC 1V43A 3L3OC 2Q8IB 1JR0D 1EQTA 2A6HD 5IGEA 1Q3LA 5CGKA 3I4MB 4K14A 5JVH3 1LTBD 4PQXA 3URYA 1JE4A 2EJMA 5E1FA 1HFNA 2Z1CA 5FK9C 2OT2A 1U4PA 4X3TA 4NMZA 3GTKB 2H1EA 1DOKA 1ZEQX 1NR4A 3P75A 3J7AF 3K5NA 2K6AA 4L8JA 5D14A 2B8GA 3ONAB 1FNWA 2PZTA 1FYCA 3LWUA 3OWFA 1ILQA 1A3UA 2PW7A 2NN6H 5T1IA 3C2PA 2EYLA 4WORA 2EOTA 1IKMA 4OO1H 4LMQD 3GTQB 5I4DA 3F2UA 3CKIB 3KBGA 4IUVA 3S15B 2N88A 4DNRB 4EVOA 2R93B 4XQJA 1Y8OB 2JA7B 4V190 4DXGA 3MWYW 1TU2B 4FP5D 4OIJA 5NUCA 3M85A 2F0VA 2D9UA 1FR3A 4EQPA 2AWOA 4HN7A 1SSOA 3S16B 3U9OA 4KHZA 2WACA 5IT9L 2PZUA 4A3BB 1DONA 3G7LA 3ND8A 3M7NA 1DM0B 3VR4A 1DJRD 3H6MA 4K5VA 4DAPA 2WB1B 3M7GA 5KNBA 2K03A 3PO3B 1PTOB 2F0IA 1LV9A 2FMCA 2SNSA 2F0QA 1WTVA 1BCPD 1WD1A 1B9NA 1Y1VB 5I2YA 2B8FA 4IFDJ 5ELFA 1ML0D 1GJXA 2F0WA 3MTSA 2B2VC 2LS01 3FVQA 5M9OA 2A68C 1RODA 2IPKD 1STYA 1YNJC 5FO7B 2SOBA 5COYA 3N52A 3TP6A 2FMMA 4KY5A 1BCPB 2L5TA 5F2DA 5C0XJ 5CMDA 1SE3A 4A3GB 1DCZA 1QJOA 4KHVA 4ME5A 4KY6A 5IGBA 2LY7A 4RGTA 1H9JA 4A3KB 1HUMA 1RJTA 5CV9A 1CI3M 3JAML 2KHSA 1E2WA 4KKUA 1JCKB 1ESRA 3EVQA 2AQ2B 5DM63 2HCCA 3V05A 2OXPA 4WJWA 1SNPA 1LABA 1S5DD 2KA7A 3QJYA 1LACA 3EFXD 1ENCA 1RCVD 4FNFA 1RKNA 3HGBA 2NN6G 5E4WC 2F0JA 4KKTA 5FO9B 3FEWX 4YIJA 1I4HA 2BCOA 1JWSD 5JEAH 4DAYA 4KV6A 1Z6HA 4OO1G 3OIQA 4IUUA 1IYUA 4AYBB 1V8QA 4F7XA 3SXHA 2ENBA 2C9OA 5LHY1 4L63B 1PFMA 1WTWA 5DM73 2EJGC 3IAYA 2L1BA 4BBSB 2D5DA 4X3SA 2PPBC 1HCZA 4OHJA 3VR6A 2EY1A 2K1BA 1UNSA 5KRUA 2PCFB 3J7YW 4BY1B 3SR1A 1DOLA 2NBFA 2F0LA 1MSHA 5TSSA 4CKBA 1D1KA 3SHLA 1L0YB 1SBBB 4FXDA 1B44D 2WV6D 3KUPA 2XSCA 2F0DA 3DEPA 3MC0B 3TBIB 2IT1A 5IGGA 1B50A 1H9MA 4G4KA 3TDQA 1EY5A 2PW5A 2DY7A 1LT3D 1PFNA 4K2LA 3I70A 2JP1A 4HEDA 1GHJA 1KNEA 1SEBD 1L0XB 3IFDA 1XX8A 1GUWA 5CC4A 2DN8A 4KD4A 2SDFA 4BA1I 5C3XA 2R92B 2KUMA 1LO5D 2O5JC 2JXMB 5BN3A 3MXPA 4CJ1B 2X6LA 3FKIB 1BNZA 3T13A 3GTOB 3V2TA 2F0KA 1TWAB 3NBHA 4IFDI 1QG7A 1F2YA 1TQOA 2E2IB 5I9PA 2B2WA 3T56B 4C3HB 3T4AC 4X3KA 3RD4A 1SFOB 5KNDA 5C4ZA 1GHKA 1X3QA 1F9RA 1KLGD 3TZUA 5M5XB 2NYZD 3VR2A 2WKCA 5C0XI 2KEEA 1BCPC 4ZQ3A 4LJZC 1SYEA 3KLRA 2YU9B 2ZXPA 1JQYD 3K59A 4OGQC 3K0YA 2EZVA 1F2MA 4B08A 5EPKA 3D31A 3M4YA 3ZYYX 5JEAG 2QF7A 4HMJA 2SEBD 1EY6A 2NZ1D 3A7LA 1S5FD 1WD0A 1DOMA 2BDOA 2FINB 4C2MB 1TY2A 4DGZA 1G91A 3G6JB 2KCCA 1STGA 2E2DC 3EJIA 1PYWD 5CV4A 4HTHA 4BS9A 3VYTA 3C46A 4ZKBB 1RHPA 5CV8A 4DN4M 2LFNA 4DFAA 3HOYB 3H91A 4OO1I 4P2CB 2VB2X 3K58A 2KJXA 4ODGA 2A69D 1FNVA 2J7ZA 1SE2A 2KQ3A 4RHSA 5I2XA 2LKVA 3K57A 2Z4IA 3NTHA 1SJHD 1A3TA 2LMCB 4PMWA 5C5LA 2FFKB 2X6GA 3DEOA 2F0UA 3HOXB 4N9TA 3SE0A 1C8CA 3SK6A 1G2SA 3LWEA 1KDBA 4XT3B 2FJ2A 3GV3A 2B2YA 4C3IG 1O7LA 3DWQA 3I4NB 3D6CA 1KDAA 4NKLA 1B4OA 3MXNA 4KJNA 1IHZA 3CQZB 3K5LA 5LL6S 1O80A 2N55A 5FLXL 2QILA 2AQ1B 1SNCA 4Z9CB 1EZ8A 3PV0A 2L55A 4FYDA 2O2LD 4C1NK 1EEID 2AQ3B 2EYOA 1HRJA 3Q23A 1EL0A 2XVSA 1MSGA 4ILWA 1BCPF 2C5CA 2NWGA 4FF3A 3OMGA 4CJ2C 4CGYB 2K32A 4BA2I 1U9RA 1Q12A 1HQMC 4CKEA 3D6WA 2D2CC 1HPCA 3OIPA 3RZDB 3EA6A 2XWBB 4H7BA 2G9DA 2PO4A 2IL8A 5ISRA 3SEBA 3I72A 3W3AA 3Q22A 1HA6A 4XQQA 2E76C 1D2BA 4B9WA 4E6IA 5D3IB 1J9OA 3T51B 1CM9A 1EY0A 1AZQA 3WDNA 4IZ8A 4QB4A 1G8ZD 3T53B 4G7OC 3A55A 1FNUA 1T5EA 1UUPA 2Q8RE 1TT2A 1XWEA 1TS4A 4PMCA 4K6LA 4CJ0B 5JJZA 1IW7D 1EY7A 3NHHA 1SDFA 2VXWA 2OF1A 1KTKA 4IQZA 3I4LA 2E74C 2TMPA 3MEHA 2I46A 2A5HA 1EU3A 2MJ8A 3GTPB 3SDZA 2EPBA 1GUGA 1I4GA 3I3CA 1D5ZC 2QKIC 4HAEA 4V0BA 2O5IC 1STEA 1B53A 3Q0AA 3OWEB 1A15A 5J39A 2BE5D 4G7ZC 2NTTA 1LTRD 3AU7A 5DEHA 3VA5A 1MI2A 2JE6I 1AZPA 3LX0A 4RWSC 3A8JE 4IUQA 3DWPA 5M5WB 4HCEA 1BR9A 2EYMA 3GTMB 3X3MA 1I6HB 4QIWB 4A3FB 4C3IB 1RDPD 3SK4A 2XRQD 1SNOA 2VNUD 1H9RA 3BZDB 2F0HA 2EY5A 2A69C 2B2TA 1G291 1Q90A 1GUTA 3OHXC 5T1GA 5IODA 3HG9A 2EE1A 3NBIA 1TS5A 1ZYRD 2B63B 1U4LA 2EY6A 2F4IA 1CHQD 4XT1B 4NW2A 4ZYSA 3HOUB 4FF4A 3BYYB 2NVQB 1S5CD 1GUSA 3O13A 2KEDA 1SYBA 1TR5A 4ZRZA 2A6ED 5KEEA 4I7ZC 1A6XA 1STAA 1QE6A 1YNND 3NUCA 1O7YA 4RKBA 3J80L 1WTXA 1EWHA 2NB0A 4O42A 2RSOA 1TY0A 1BXTA 2XNAC 1STNA 1CQVA 2BOSA 2PQEA 3K5OA 5J22A 1PRTD 4O1NA 4DA2A 4EQOA 2B2UC 3MXGA 5CV5A 1B1ZA 5EKIA 5ELEA 1E2ZA 1EIHA 5C6AA 4TKOB 3BDCA 3I91A 5D65A 4ZUIA 1NAPA 4TSSA 1QNUA 2V4DA 2RDGA 1CZGA 4H13C 3A7AB 3IL8A 1TKWB 3P20A 2ZXOA 3NQTA 4XIGS 2L4NA 4KD3A 1CA5A 2WP8J 4ULLA 5I6WA 2AUJD 3CRKC 2ID0A 4Q0FA 3LNNA 3MFGA 3V96A 5CBEE 3HOVB 2RSNA 1SE4A 3M3YB 5EKLA 3FMCA 2R6GA 5EJWA 1Q8IA 3Q24A 1PMRA 2BA1A 3FPUB 1KNAA 1VF7A 1RTOA 1IW7C 1PDQA 5CV7A 4UAIA 2AUKA 1EIGA 4NP5A 3BG3A 1HTLD 1JWUD 3H94A 3S1RB 3X3NA 4MHEA 1CA6A 1BUVT 4KJOA 4MN3A 1WTOA 1D5XC 3GTLB 4F87A 4KI0A 1OXTA 1PLFA 4QUCA 1JB3A 3PUWA 2EY2A 1TWFB 1F77A 3S1NB 3NWTA 3SK5A 3R3OA 1LT5D 5M3MB 4PMBA 3PO2B 4KN4C 1STBA 3I8ZA 2BE5C 1W6JA 1V1PB 1G6ZA 4TRDA 4FXGC 2A73B 3HS0C 3SK8A 4DF7A 3K6OA 1ENFA 2PMZB 3WOFA 4KN7C 3J81E 4RFBA 1EQVA 3MVVA 1ET6A 1ONLA 1D5MC 4F8MA 2RQXA 1SNDA 2DNCA 2EYFA 3BVMA 5C4JB 5J1ZA 1FGBD 5M3FB 1CTMA 2F0GA 1ESFA 1LT6D 2JA6B 2IX3A 1JOQA 1AN8A 4B9XA 5D3DA 2R7ZB 4RAUC 2JA5B 5AFWA 4KK7A 3NTKA 4R8IA 1TVXA 1CT1D 1ZYRC 1K83B 1QB5D 3P1HA 2F0OA 5EGTA 5JEAJ 4A3DB 1VCIA 3HOWB 1B9MA 3FDTA 1HQRD 3BVZA 4S3SA 2PYKA 2NN6I 4IURA 1I4PA 1U4MA 1BF4A 1LTAD 2ZT9C 4KMUC 3MAQA 1QWYA 4EGVA 4K8IA 1GOZA 1XTCD 2A6EC 1NR2A 3NQIA 4ZUJA 1NSNS 4RCOA 1YNNC 2RA4A 2L11A 5EPJA 2E2HB 4QUFA 1LTSD 2DY8A 3R2TA 3PUXA 4A3IB 3VR3A 1VMCA 1XYIA 4WRDA 1ET9A 4A93B 2CVRA 5EPLA 4NDXA 1PRTC 2WAQB 4IUNA 2IW3A 5ELBA 4QMGA 1EEFD 2F0EA 3CU7A 2K5WA 2JEBI 2B2YC 5BN5A 1NUCA 1R9TB 4C3JG 1QILA 4XYQA 3KLSX 3KF8A 5EBDA 3E5SA 3MZ5A 1EYAA 2XIWA 2KCNA 4KY7A 5KGUA 1I4XA 4BBRB 3PUYA 3DXJC 1H9SB 4KTAA 5CYUA 1K8MA 1U4RA 2QDBA 2IX1A 4J8QA 2F03A 1LT4D 2F0TA 2WKDA 2KOLA 3MHBA 3BDOA 1H9KA 5K36G 3QOJA 2NTSA 4LAAA 2E2JB 1DYQA 5I9OA 1ICWA 1RF2D 5CV6A 1AW7A 3BVGA 5CORA 2XRSD 1Y69U 1IYVA 4KKSA 3C1FA 3KBXA 4G7HC 4RGNA 1ZXTA 2HQEA 5CBAE 2CQAA 3S9WA 1DZ1A 3IFTA 1II3A 4RGOS 1JWMD 1PZJD 5KNCA 3QG1A 1ZKOA 4U673 1V1PA 2ICIA 5FKAC 5JAVA 1HFGA 1I3QB 2F0PA 2L9HA 2AWNA 4DNTB 2VUMB 2ZXRA 3S2HB 5E3FA 4QCLA 2F0FA 2K04A 3HRZC 1R4QB 4OL7A 2K5DA 1KABA 3H09A 2BA0A 3GQBA 3GTGB 4ID6A 4ZKCB 5IIFA 3J81L 2F3WA 5G3LD 2K05A 1EY4A 2HDLA 1QCBD 4FXKC 1TWGB 3FPPA 4FO2A 2PZWA 2QEJC 1TS2A 2HUGA 2CW0D 5C3EB 5JPMC 1E0BA 3NWSA 4U68A 3NP8A 1MGSA 3DMUA 3DHQA 3I73A 1CHPD 1CQFA 2MHVA 4RA8A 1PRTF 3SVMA 1SYCA 2J0TD 1DXMA 3RMHA 1Y8PB 1KAAA 1HA5A 2QCPX 2A74C 1SYGA 1QOHA 1PTOD 5LL6X 1O7ZA 1OXXK 2K33A 1PZKD 1RTNA 4HCSA 2K7VA 4ZAIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BDC A;  3QOL A;  3SK6 A;  4ZQ3 A;  4TRD A;  4QB4 A;  3TP6 A;  4EVO A;  1JOR A;  1SYE A;  3NK9 A;  3PMF A;  3SK4 A;  4IAL A;  3ITP A;  1KDB A;  4KY5 A;  5IOC A;  4ZUI A;  2NUC A;  1SNO A;  3SK8 A;  4DF7 A;  2M00 A;  2EXZ A;  3BDL A;  5F2D A;  2F0H A;  3NXW A;  2EY5 A;  1ENA A;  3HZX A;  5JAV A;  1TT2 A;  4WRD A;  2RBM A;  1A2U A;  4PMC A;  2F0P A;  4KHV A;  3D6C A;  4KY6 A;  1EQV A;  4ME5 A;  5DAU A;  5IGB A;  5IOD A;  2F0D A;  1EY7 A;  5NUC A;  1KDA A;  1F2M A;  3NQT A;  4NKL A;  4NDX A;  3MVV A;  5CV9 A;  2F0V A;  5E3F A;  1EY9 A;  5EKK A;  5JOB A;  1KDC A;  4F8M A;  4EQP A;  1SND A;  2KHS A;  4IUN A;  1SYD A;  4KD3 A;  4KJN A;  2F0F A;  5IGG A;  3NHH A;  4EQN A;  1EY8 A;  4HMJ A;  2EYF A;  1IHZ A;  3T16 A;  5I6W A;  1EY6 A;  1EY5 A;  4OL7 A;  2PW5 A;  4MIU A;  2EY6 A;  2OF1 A;  3EVQ A;  4QMG A;  5J1Z A;  4I65 A;  1A3V A;  1SNM A;  4K2L A;  1JOK A;  1KAB A;  4RKL A;  4N9P A;  1SNQ A;  1SNC A;  2OXP A;  5IGE A;  2F0E A;  1EZ8 A;  2O4X A;  3MEH A;  1SNP A;  3ERO A;  4ID6 A;  3U9O A;  4DGZ A;  5CR3 A;  5CGK A;  5IIF A;  1NUC A;  4K14 A;  2F3W A;  2EYH A;  1ENC A;  3OSO A;  3QB3 A;  2OEO A;  2WAC A;  2PZU A;  2F0G A;  4G57 A;  5CC4 A;  1EY4 A;  1STG A;  1RKN A;  5EKL A;  2F3V A;  2EYO A;  4K5X A;  4KD4 A;  5E1F A;  3H6M A;  3TP5 A;  3EJI A;  5CV4 A;  5C3X A;  5HGT A;  4K5V A;  1F2Z A;  4HTH A;  4B9X A;  2F0J A;  3E5S A;  3D8G A;  1A2T A;  1EYA A;  3MZ5 A;  3TME A;  4YIJ A;  4KY7 A;  5KGU A;  2RDF A;  1SYB A;  1TR5 A;  1STH A;  3MXP A;  5CV8 A;  2F0S A;  5J39 A;  5CV7 A;  4KV6 A;  4NMZ A;  5KEE A;  5KYI A;  5K5P A;  2PZW A;  3HEJ A;  4J1M A;  1STA A;  2F0I A;  4NP5 A;  2SNM A;  3D4W A;  3T13 A;  2SNS A;  1SYF A;  4KTA A;  4DFA A;  3NUC A;  2F0Q A;  3OMG A;  3D4D A;  4J6H A;  4R8N A;  3V2T A;  4F7X A;  2QDB A;  2ENB A;  2F0K A;  4RKB A;  5DEH A;  5C5M A;  3SXH A;  3VA5 A;  5I6Y A;  3P1H A;  4K8J A;  2F0O A;  4PNY A;  5EGT A;  3LX0 A;  1F2Y A;  5HUR A;  1U9R A;  1TQO A;  3P75 A;  3ERQ A;  5IGD A;  2F0T A;  3MHB A;  4KJO A;  4K5W A;  5I9P A;  2EYJ A;  4ODG A;  3TP7 A;  3NP8 A;  2PZT A;  4DU9 A;  1JOQ A;  3OWF A;  3DMU A;  3QOJ A;  4H7B A;  3C1E A;  3DHQ A;  2F0W A;  4LAA A;  5C4H A;  1A3U A;  1STN A;  2EYM A;  2PW7 A;  2KQ3 A;  4K2K A;  5C3W A;  2RKS A;  5I9O A;  1SYC A;  2EYL A;  2LKV A;  5M9O A;  2EY2 A;  4S3S A;  4WOR A;  2PYK A;  4K6D A;  2PQE A;  1EYC A;  5CV6 A;  5KIX A;  5ISR A;  5J22 A;  2EY1 A;  2F0M A;  3SK5 A;  1KAA A;  2F0N A;  4EQO A;  3R3O A;  1EZ6 A;  1EYD A;  4PMB A;  1JOO A;  1A3T A;  1SYG A;  5C4Z A;  5KRU A;  2EYP A;  1AEX A;  5C5L A;  4B9W A;  3C1F A;  1STB A;  3SR1 A;  4E6I A;  3OMC A;  2F0L A;  4K8I A;  5CV5 A;  4QF4 A;  3RUZ A;  2HQE A;  1STY A;  3TP8 A;  3S9W A;  4HMI A;  4ZUJ A;  5IGF A;  5IGC A;  2SOB A;  1EY0 A;  1II3 A;  1NSN S;  5C6A A;  5KYL A;  4IZ8 A;  3SHL A;  2F0U A;  4N9T A; 
#chains in the Genus database with same CATH topology
 1NMF A;  3OW7 A;  5M5Y B;  1Y8N B;  4IAL A;  2YTV A;  4X3U A;  1BO0 A;  5LMU Q;  1HXY D;  1LTI D;  5E4X A;  1IL8 A;  3VYS A;  3NXW A;  1BQQ T;  4KLK A;  2CHB D;  4X62 L;  1X3P A;  5LMN W;  2HIX A;  1UEA B;  3CMA A;  1X56 A;  1GUO A;  1VQP A;  2ZM6 Q;  4C3J B;  4JI0 L;  1MKH A;  1BOS A;  4L5R C;  4EQN A;  1EY8 A;  3NSW A;  4JK1 C;  1MJC A;  3KJP A;  3RZO B;  4IFD G;  4MIU A;  4LF5 Q;  2JYO A;  1W3S A;  1DD2 A;  3A56 A;  4IUP A;  2IWH A;  3CD6 A;  2NVY B;  4JI1 Q;  2MUY A;  1D8L A;  3TSS A;  4DK1 A;  3ERO A;  3S14 B;  1VQJ A;  2B2T C;  2LXJ A;  2EYH A;  1QNK A;  1EFI D;  4G57 A;  3BYT B;  3FKI G;  3VR5 A;  2F3V A;  2RCF A;  5JVG 3;  2YYZ A;  1MIU A;  3CQZ H;  4A3E H;  2Q2U A;  3WWV A;  1X55 A;  2B2V A;  1B2T A;  5BR8 L;  2B29 A;  4IUT A;  2RDF A;  3NPP A;  1I50 B;  1F2L A;  4R9W A;  3QIA A;  2UUC L;  1EU4 A;  4Y7N B;  3R2I A;  4DV2 L;  3AB9 A;  5K5P A;  5C44 H;  1HNZ L;  5IY0 A;  4P74 A;  3T1Y L;  5IT9 c;  4PZ7 A;  4R8N A;  1VF5 C;  2P5Z X;  4J6H A;  5C0X G;  3GD7 A;  1BBX C;  4OON A;  4C3H G;  1Z47 A;  1N34 Q;  3BS1 A;  3GP7 A;  4UPA A;  1F9Q A;  4GNX B;  2Y0S E;  4CBV A;  2I07 B;  2Y0S G;  1H9S A;  3RLO A;  1CFM A;  5C3W A;  2WIN B;  3I4M H;  4LF4 Q;  1XTD A;  2EVB A;  4JW0 A;  1EYD A;  1WVL A;  2KVM A;  3DUZ A;  3S2D B;  3CCJ A;  1I4Q A;  1TII D;  1C48 A;  4HID A;  3OMC A;  4HMI A;  5FO8 B;  1SAP A;  3RZD H;  3M4Q A;  2IJ0 A;  2K14 A;  3W2D A;  4GZY C;  1YHQ A;  4PZ8 A;  1X54 A;  2ES2 A;  4L6T B;  5H1S E;  4RGM A;  1PV4 A;  4RH6 A;  2K01 A;  3GTK H;  1TWH B;  1VDZ A;  2L15 A;  1J6Q A;  1JC7 A;  3VA7 A;  1G2T A;  2K5Q A;  2YTY A;  1K3R A;  2I5L X;  2R61 A;  3F2C A;  3VYU A;  2Q2H A;  4K0K Q;  4LWC A;  2RBM A;  1MBY A;  3ICE A;  1HHV A;  2XN9 C;  1X32 A;  3D3R A;  1ILP A;  4FVM A;  4YWM A;  4P71 A;  1IBK L;  1MD2 D;  2UUA Q;  4LW1 A;  2UUB Q;  1PH3 A;  3RR5 A;  1IBM L;  2ICE C;  2RVL A;  3IKJ A;  5ELC A;  1YHA A;  2DNE A;  3VDY A;  1N32 L;  1K8O A;  2KCT A;  4I65 A;  4RKL A;  3BJU A;  5A2Q E;  1YBY A;  4HJ5 A;  1SNQ A;  4F88 A;  3RLF A;  2B2U A;  2K28 A;  2ZJP A;  2X69 A;  4PV1 C;  4XQN A;  3N6R A;  3GTQ H;  2OEO A;  3AMU A;  2A6H C;  1WJJ A;  3JAM c;  1J5E Q;  5DNF A;  3OPO A;  3OYY A;  5LMN L;  5HGT A;  3U9S A;  4ZLT F;  4DV6 L;  3HOY G;  4AH6 A;  1A2T A;  2XWJ B;  1WTQ A;  1PRT B;  3GO5 A;  2XGT A;  3BU2 A;  1Q1B A;  3WOE A;  4XDX A;  5ELD A;  3L9A X;  2OQ0 A;  5KYI A;  1PZI D;  1Z7T A;  2CH4 A;  1PYS B;  3J80 c;  3HKZ E;  2SNM A;  3GTP H;  2WII B;  1SMY D;  5C5M A;  4A75 A;  1NCV A;  4OX9 Q;  4RHR A;  2NVT B;  2H4O A;  3ERQ A;  1VS0 A;  3Q6S A;  4Q5V A;  3S24 A;  4K5W A;  2EYJ A;  3TP7 A;  1W6K A;  2LXK A;  1H95 A;  3S17 B;  3K8A A;  3A74 A;  3I90 A;  3K0X A;  3S16 H;  1HNW Q;  1D6E C;  2HQL A;  2PNR C;  4CHT B;  3HOZ B;  3MXN B;  5FLX E;  2YV5 A;  1VQB A;  1JIC A;  1EQR A;  3EQL C;  4K6D A;  3NE5 B;  2F0N A;  3H3V C;  3HOX G;  1EZ6 A;  1OO9 B;  5IWA Q;  4A3B H;  3DM1 A;  1CK1 A;  3GTJ B;  1Y1W B;  5IGF A;  5FOB B;  1HNX Q;  5KYL A;  4MTK A;  2CW0 C;  3R93 A;  4DXF A;  4B3M Q;  1WCM B;  1M4V A;  1JOR A;  3PMF A;  3PIO 3;  3I4N G;  3PO3 H;  1PTO H;  1F9S A;  4YCW A;  5IOC A;  4DR2 Q;  2NUC A;  2M00 A;  4QJF A;  2MO0 A;  2Z4H A;  1B3A A;  4DV7 L;  4UHV A;  2ZM6 L;  2IX0 A;  1T9H A;  1I6H H;  1Y1V H;  3PUZ A;  1K0R A;  1T5X D;  4C56 C;  4ZK9 B;  2B39 A;  3K5M A;  3OW2 A;  4JI1 L;  2D62 A;  1WTP A;  1LTL A;  2VB3 X;  4M8A A;  4P73 A;  5EKK A;  4DR3 Q;  1SYD A;  1IBL Q;  1PTO C;  5C44 G;  3T16 A;  2B2W C;  1QVC A;  1S5B D;  3KDF A;  3HP3 A;  1A3V A;  1U5K A;  4FF1 A;  3ER0 A;  3CCM A;  4R4T A;  3NTI A;  5K36 H;  4DUZ Q;  2HHH Q;  4BWG B;  1P8L A;  1LTG D;  1MHW C;  1B7Y B;  1S4Z A;  1YNX A;  1HTP A;  3OSO A;  4HJ7 A;  4BY7 B;  3I55 A;  2JEA I;  4CKC A;  1TS3 A;  3UDX A;  4OIK A;  1UAP A;  1I6V C;  2B63 H;  1F2Z A;  2MPM A;  1PXU A;  3I4M G;  3D8G A;  1GXD C;  1STH A;  2K50 A;  1VQC A;  2TSS A;  4HSV A;  3CRL C;  4DR6 Q;  1N34 L;  3E0J A;  4J1M A;  1HUN A;  2Y0S B;  3D4R A;  1SYF A;  1KRT A;  3FRP B;  5I6Y A;  5HUR A;  1RIP A;  4PNY A;  4A3K H;  4HR7 B;  3M4O B;  2JSO A;  4IJH A;  1F9P A;  2M9V A;  4JI8 Q;  4DAV A;  1PFB A;  4JOI C;  2L0C A;  1R4P B;  2MP1 A;  4DU9 A;  3TN2 A;  3J7A V;  1G51 A;  3QWN A;  2RKS A;  2D0P A;  2K4K A;  3K7A B;  3TZD A;  4POG A;  4GNX A;  1V1O A;  1SLJ A;  4UDU C;  4DR4 Q;  4B3R L;  1JOO A;  1TWC B;  1FD7 D;  2E75 C;  1OXS C;  4QF4 A;  3TP8 A;  2F1M A;  5AJ3 Q;  2Z8L A;  2EJF C;  1EWC A;  3R8B A;  1RD9 D;  3GV6 A;  3S1M B;  3L7Z C;  2Z6K C;  2F0S A;  3KF6 A;  4R4Q A;  4A3J B;  3QOL A;  4K0K L;  1OXU A;  2NZO A;  2L12 A;  3UE1 A;  3ND9 A;  4JBW A;  5L37 A;  3HZX A;  3MFY A;  4FF2 A;  1IKL A;  1X65 A;  1M8A A;  1GUN A;  3E6Z X;  2UUA L;  2R7D A;  3CCQ A;  1K8G A;  1AP0 A;  2UUB L;  5IT9 E;  4A3C H;  1E7Z A;  3LGJ A;  4M1U B;  2M2L A;  2KEC A;  3F2B A;  3KLS A;  1WFQ A;  2KHJ A;  2Q8T A;  4WJ4 A;  2MGS A;  5JOB A;  1KDC A;  5C4H A;  3PIP 3;  5EQ0 A;  3I2Z A;  2HCI A;  1BVS A;  5C4X B;  2NVX B;  1SNM A;  1JOK A;  3MXU A;  1HZA A;  4IN3 A;  4N9P A;  4H44 C;  5IP7 H;  2CWA A;  3VYR A;  3G48 A;  2O4X A;  4N8F A;  1J5E L;  2HDM A;  5G3L F;  5CR3 A;  2J4X A;  4DK3 C;  2MFI A;  3QB3 A;  1VQ7 A;  3A54 A;  1CKO A;  3S1Q B;  2JA8 B;  2FHT A;  1CZW A;  4HSP A;  4BXX H;  1J8I A;  3MA2 B;  4K5X A;  3TP5 A;  2A68 D;  1EOT A;  3ULJ A;  3HKZ B;  4C1N I;  1WTR A;  1SXT A;  2ZTC A;  1NNX A;  2EDG A;  3TME A;  4LK1 C;  2GA4 B;  4DAM A;  2ZJQ A;  1Q1E A;  1E2V A;  4OX9 L;  4DK0 A;  1E24 A;  5A2Q L;  1YNJ D;  1C4Q A;  3OTO L;  1OXV A;  3C3L A;  2R3Z A;  3HEJ A;  1BDO A;  5EBC A;  3D4W A;  3HOV H;  2G9H D;  1K9M C;  2WB1 E;  3D4D A;  4WFN 3;  5JPN C;  1KLU D;  1VMP A;  3M3Y H;  1N33 L;  2YTX A;  4K8J A;  4RG1 A;  3CHB D;  4RCN A;  4KHP L;  5IGD A;  4HIK A;  4XYO A;  1AFP A;  3CCL A;  2BDN A;  1S5E D;  1D1I A;  3OOC A;  5IWA L;  3C1E A;  4K2K A;  4LF8 L;  4A3F G;  3F1Z A;  5KIX A;  3T1H Q;  3P7J A;  1PTO F;  1EYC A;  1I4R A;  3H0G B;  2F0M A;  5GAH C;  1HNX L;  1SJE D;  3DWA A;  4IFD H;  2A8V A;  4TQU S;  4B3M L;  2EYP A;  1AEX A;  5IP9 H;  3RUZ A;  4XXE A;  4YWL A;  4XTC S;  3GTL H;  2VL6 A;  5IGC A;  4ABN A;  1ASY A;  2R92 H;  3UI2 A;  2RDH A;  3JAM E;  1SMY C;  1E22 A;  1O78 A;  1LLR D;  3W1G A;  4A3E B;  3NK9 A;  4LUO A;  1TWF H;  4GKK L;  3ITP A;  5BN4 A;  3S1N H;  4A3M B;  1UE6 A;  2EXZ A;  3BDL A;  3PO2 H;  4B3S Q;  1ENA A;  3A8I E;  5C44 B;  1XXG A;  4GLA C;  1A2U A;  3J80 E;  5A35 A;  4DR3 L;  2GN5 A;  2CFM A;  2B63 G;  5DAU A;  1VQN A;  1AE3 A;  3A8K E;  3CC2 A;  1LTT D;  3QO2 A;  3KK7 A;  5C0X H;  1EY9 A;  1YJN A;  3PUV A;  4DUZ L;  2HHH L;  2G5D A;  4C3H H;  4H0L C;  1YJ9 A;  3CC7 A;  3NEL A;  4HJA A;  1V43 A;  3L3O C;  2Q8I B;  4DV4 Q;  1JR0 D;  1X3E A;  1EQT A;  4CDD C;  4OEL B;  2A6H D;  4JG2 A;  1JJG A;  5IGE A;  1Q3L A;  5CGK A;  3I4M B;  4YCV A;  1HR0 Q;  4IOC A;  1YIJ A;  1VQA A;  4K14 A;  2HT1 A;  5JVH 3;  1VQM A;  4DAY B;  1LTB D;  4PQX A;  3URY A;  5M5X H;  2ALY B;  1JE4 A;  2EJM A;  1M90 C;  5JJK A;  5E1F A;  2Z0S A;  1HFN A;  2Z1C A;  5FK9 C;  2Q2I A;  1Z9F A;  2OT2 A;  1CKM A;  1U4P A;  4YY3 Q;  4X3T A;  4LFB Q;  4NMZ A;  1LM0 A;  4DKA C;  2QA4 A;  5M3F H;  3UDG A;  3GTK B;  2H1E A;  4JI8 L;  1DOK A;  2JA6 H;  1ZEQ X;  1NR4 A;  4Y52 H;  3P75 A;  3ERS X;  4JC0 A;  3J7A F;  3K5N A;  2K6A A;  4L8J A;  5D14 A;  2B8G A;  4AYB E;  3ONA B;  1FNW A;  1KQS A;  2PZT A;  1FYC A;  3LWU A;  3OWF A;  4DR4 L;  2HIV A;  1ILQ A;  1A3U A;  2PW7 A;  4C2M H;  4CDE C;  2PNH A;  4ALP A;  2NN6 H;  5T1I A;  4AQY Q;  3C2P A;  2EYL A;  5AJ3 L;  4WOR A;  1K83 H;  1VQD A;  2EOT A;  2IHE A;  1IKM A;  2ATW A;  1N36 Q;  4LMQ D;  3HOW H;  3GTQ B;  4OO1 H;  3NEN A;  2KCM A;  5I4D A;  3F2U A;  3CKI B;  4DV1 Q;  3EN2 A;  3KBG A;  4X66 L;  4IUV A;  2BH8 A;  3S15 B;  2N88 A;  4DNR B;  4EVO A;  2R93 B;  4XQJ A;  1Y8O B;  2JA7 B;  2JA9 A;  1VQG A;  4V19 0;  4DXG A;  3MWY W;  1TU2 B;  4FP5 D;  4OIJ A;  4LNQ A;  2K5V A;  1PH8 A;  2QDL A;  5NUC A;  3M85 A;  2E2H H;  2F0V A;  2D9U A;  1FR3 A;  4EQP A;  1KD1 C;  2AWO A;  4A3I H;  4HN7 A;  5FLM H;  3HOV G;  1SSO A;  1PH7 A;  5ELN A;  3ULP A;  3S16 B;  1KL9 A;  3U9O A;  4A93 H;  1XPU A;  5IYD G;  4KHZ A;  3JAM i;  2WAC A;  5IT9 L;  2PZU A;  4A3B B;  1DON A;  3PCO B;  3H3V I;  3G7L A;  3ND8 A;  3M7N A;  1DM0 B;  3VR4 A;  3HOX H;  1DJR D;  3H6M A;  4DV7 Q;  4K5V A;  1P16 A;  2KEN A;  4DAP A;  3NBH B;  2WB1 B;  1VQH A;  3M7G A;  3J80 i;  5KNB A;  2K03 A;  1HZB A;  4GOP B;  1HZC A;  1PTO B;  2Z9H A;  2VW9 A;  3PO3 B;  5IP9 G;  1BKB A;  2PI2 A;  2F0I A;  1LV9 A;  2FMC A;  2SNS A;  2F0Q A;  3I4N H;  4A4I A;  2R92 G;  1WTV A;  1BCP D;  4CDF C;  1WD1 A;  1B9N A;  1Y1V B;  5I2Y A;  1SR3 A;  1UE1 A;  2B8F A;  1X9N A;  2PQA A;  3T1H L;  4IFD J;  4CDC C;  1FGU A;  3K81 C;  5M3M G;  5ELF A;  3PO2 G;  4BBR H;  1ML0 D;  1GJX A;  2F0W A;  1UE7 A;  3MTS A;  2B2V C;  2LS0 1;  4X6A H;  3FVQ A;  3ULL A;  5M9O A;  2A68 C;  1ROD A;  2IPK D;  1HH2 P;  4IPH A;  1STY A;  1YNJ C;  1E1T A;  1VQL A;  5FO7 B;  2SOB A;  2E5L L;  3I56 A;  2BH2 A;  2E2J H;  4B3S L;  5COY A;  3N52 A;  3TP6 A;  2FMM A;  4KY5 A;  1NMG A;  1BCP B;  2L5T A;  5F2D A;  5C0X J;  3EBE A;  5CMD A;  4DV3 Q;  1SE3 A;  3PF4 A;  2Q2T A;  2EXD A;  3J7A 5;  4A3G B;  1DCZ A;  1QJO A;  4KHV A;  4ME5 A;  4KY6 A;  5IGB A;  2LY7 A;  4RGT A;  1H9J A;  4A3K B;  4DV4 L;  1HUM A;  2VS1 A;  1RJT A;  5CV9 A;  1QUQ B;  1CI3 M;  3JAM L;  4B3R Q;  2KHS A;  5M3F G;  1HR0 L;  1E2W A;  4KKU A;  1KIX A;  1JCK B;  1ESR A;  3EVQ A;  2AQ2 B;  5DM6 3;  2HCC A;  2JA6 G;  3V05 A;  2OXP A;  4OXP A;  4WJW A;  1SNP A;  3QJY A;  1LAB A;  1S5D D;  2KA7 A;  1I94 Q;  3F2D A;  2R7Z G;  2JA5 G;  1LAC A;  3EFX D;  4R4C A;  1ENC A;  2VUM H;  3U58 A;  1RCV D;  4FNF A;  3S2H H;  1A0I A;  4YY3 L;  4LFB L;  1RKN A;  3HGB A;  1PYB A;  2NN6 G;  5GAG C;  5E4W C;  2F0J A;  4KKT A;  5FO9 B;  3FEW X;  4YIJ A;  1I4H A;  2BCO A;  3I4O A;  1JWS D;  3GTG H;  5JEA H;  4DAY A;  4KV6 A;  4ZCK A;  1Z6H A;  4OO1 G;  4GN3 B;  3OIQ A;  4IUU A;  3HOW G;  4JV5 L;  1IYU A;  4AYB B;  1VQE A;  1V8Q A;  4F7X A;  4IOA A;  3SXH A;  2ENB A;  1CSQ A;  5EAY A;  2C9O A;  3B6Y A;  4L63 B;  5LHY 1;  1VQ4 A;  1PFM A;  1XPR A;  1WTW A;  5DM7 3;  2EJG C;  4AQY L;  3IAY A;  4R1J A;  1GO3 E;  4MNO A;  2L1B A;  4AIM A;  4BBS B;  4GLX A;  2D5D A;  4X3S A;  1N36 L;  2PPB C;  1HCZ A;  4OHJ A;  3VR6 A;  2R7F A;  4DV1 L;  2EY1 A;  2K1B A;  1UNS A;  2N78 A;  2VQF Q;  1K0S A;  5KRU A;  2PCF B;  2EQS A;  3J7Y W;  1N8R C;  4BY1 B;  5GAE C;  3SR1 A;  1DOL A;  2NBF A;  2F0L A;  1MSH A;  4FDB A;  5TSS A;  4A3I G;  3OTO Q;  5FLM G;  4CKB A;  4IPC A;  4QQB X;  4QL5 A;  1D1K A;  3UE0 A;  3SHL A;  1N33 Q;  1L0Y B;  5GRO A;  3J81 j;  4A93 G;  4KHP Q;  1SBB B;  4X65 Q;  4FXD A;  3PGZ A;  1LYL A;  1B44 D;  1EIY B;  2WAQ G;  4TVA B;  2WV6 D;  3KUP A;  4DR7 Q;  2OTJ A;  2XSC A;  4LF8 Q;  1X3F A;  2F0D A;  3DEP A;  1EYG A;  1Q82 C;  3MC0 B;  5M5W H;  3TBI B;  2IT1 A;  5IGG A;  1B50 A;  1H9M A;  4G4K A;  3TDQ A;  1EY5 A;  2PW5 A;  2DY7 A;  1LT3 D;  1PFN A;  1YEZ A;  2MQH A;  4K2L A;  2KHI A;  3I70 A;  2JP1 A;  3GTM H;  1A62 A;  1S72 A;  4HED A;  3E9I A;  1GHJ A;  1KNE A;  1SEB D;  4GKK Q;  1L0X B;  4A3F H;  4NPS A;  3IFD A;  4C3I H;  1XX8 A;  4LF7 Q;  5CC4 A;  1GUW A;  1KRS A;  4BBR G;  2DN8 A;  4KD4 A;  2SDF A;  4BA1 I;  5C3X A;  4A3L H;  3RZO H;  2R92 B;  2KUM A;  1LO5 D;  2O5J C;  4GOP C;  2JXM B;  1C9O A;  5BN3 A;  3MXP A;  4CJ1 B;  2X6L A;  3FKI B;  1BNZ A;  3ZJY C;  3D0F A;  3T13 A;  3GTO B;  3V2T A;  3AFQ A;  2F0K A;  1TWA B;  3NBH A;  4IFD I;  4OWW B;  1QG7 A;  4DV5 Q;  3I7F A;  1F2Y A;  1TQO A;  3DM3 A;  2E2I B;  2JJQ A;  5I9P A;  2B2W A;  2OWO A;  1I50 H;  3T56 B;  4Y7N H;  4C3H B;  3T4A C;  4X3K A;  1YJW A;  3RD4 A;  1SFO B;  1O7I A;  1JB7 A;  1PH9 A;  5KND A;  3HOU H;  3UDF A;  1Y14 B;  5C4Z A;  3Q8D A;  2NVQ H;  1GHK A;  4JCV E;  4LFA L;  1X3Q A;  1F9R A;  1KLG D;  3TZU A;  5M5X B;  2NYZ D;  1NTG A;  4DV3 L;  3VR2 A;  2WKC A;  5C0X I;  2KEE A;  1BCP C;  4ZQ3 A;  4LJZ C;  1SYE A;  3UDI A;  2F4V Q;  3KLR A;  2YU9 B;  2VUM G;  1WI5 A;  2ZXP A;  1JQY D;  3K59 A;  4O2D A;  1QVG A;  4OGQ C;  3K0Y A;  1L1O B;  4LF9 Q;  1PA6 A;  4HIM A;  2EZV A;  1F2M A;  1YHB A;  4B08 A;  5EPK A;  3D31 A;  3M4Y A;  3ZYY X;  5JEA G;  1NY4 A;  2A1A A;  2QF7 A;  1I94 L;  4HMJ A;  1GVP A;  2SEB D;  3CAM A;  1EY6 A;  2NZ1 D;  3A7L A;  1S5F D;  2ZTD A;  4GS3 A;  3GDE A;  1WD0 A;  1DOM A;  2BDO A;  2FIN B;  2K5H A;  2CKZ B;  4C2M B;  4UP9 A;  4X66 Q;  1TY2 A;  4DGZ A;  5JJL A;  1G91 A;  4MZ9 A;  1BBW A;  3NEM A;  3G6J B;  2KCC A;  1DGS A;  3PSI A;  1STG A;  1ICF B;  2E2D C;  3EJI A;  1PYW D;  5CV4 A;  4HTH A;  4BS9 A;  3VYT A;  3C46 A;  4ZKB B;  1RHP A;  3EIV A;  1VQI A;  1PH2 A;  1L2F A;  5CV8 A;  4DN4 M;  2LFN A;  4DFA A;  3HOY B;  3G6E A;  4R4O A;  3H91 A;  4OO1 I;  1V1Q A;  4P2C B;  2VB2 X;  1WTH A;  3K58 A;  1JE5 A;  2C35 B;  2KJX A;  4ODG A;  2A69 D;  1VQ6 A;  1FNV A;  2J7Z A;  4IPG A;  2VQF L;  1PH5 A;  1SE2 A;  2KQ3 A;  4RHS A;  5I2X A;  2LKV A;  3K57 A;  2Z4I A;  1U0L A;  4DK6 C;  2NVT H;  3NTH A;  1SJH D;  1A3T A;  2LMC B;  2RHQ B;  5C5L A;  4PMW A;  1PHJ A;  2FFK B;  2X6G A;  2IHF A;  2QW7 A;  2OQK A;  4X65 L;  1S40 A;  1EQQ A;  5IYD H;  3S17 H;  3DEO A;  2F0U A;  3HOX B;  4N9T A;  3SE0 A;  1C8C A;  3HOZ H;  3SK6 A;  2QGQ A;  3H15 A;  2UXC Q;  1G2S A;  3LWE A;  4QIW E;  1KDB A;  3RLN A;  4DR7 L;  4XT3 B;  2FJ2 A;  3GV3 A;  2B2Y A;  4C3I G;  1YVC A;  1O7L A;  3DWQ A;  3CPW A;  1Y1W H;  3S1R H;  3I4N B;  3D6C A;  1PH6 A;  4A3L G;  1XMQ Q;  2CH4 W;  1PVO A;  1KDA A;  4NKL A;  1B4O A;  3MXN A;  2DJG C;  4KJN A;  1K8A C;  1X6O A;  1IHZ A;  3CQZ B;  3K5L A;  5LL6 S;  1VQ9 A;  1O80 A;  2N55 A;  4JYA Q;  5FLX L;  4HJ8 A;  4LF7 L;  2QIL A;  2AQ1 B;  1CUK A;  1SNC A;  2E5L Q;  4Z9C B;  1EZ8 A;  3PV0 A;  5M3M H;  2L55 A;  4RMF A;  4FYD A;  5IYB H;  2O2L D;  4LF6 L;  4C1N K;  1EEI D;  2AQ3 B;  3K7U C;  5GQO A;  1SN8 A;  2EYO A;  1HRJ A;  1EUJ A;  4H02 A;  3Q23 A;  3CCU A;  1EL0 A;  2GVA A;  2XVS A;  3HOU G;  1JJC B;  4DV5 L;  2AMC B;  3TRE A;  3AYH B;  1MSG A;  4ILW A;  1BCP F;  2CQO A;  2C5C A;  1Q7Y C;  2NWG A;  3DLL A;  1JMC A;  3OMG A;  4FF3 A;  4BY7 H;  5HGQ A;  3KJO A;  4CJ2 C;  2VQE Q;  1Q86 C;  4CGY B;  2K32 A;  4BA2 I;  1U9R A;  1Q12 A;  2RHS B;  1HQM C;  2RF4 A;  2N3S A;  3D6W A;  4CKE A;  4YHH Q;  2D2C C;  1HPC A;  4JI3 Q;  3OIP A;  3RZD B;  3EA6 A;  2XWB B;  4DV0 Q;  5C4J H;  4H7B A;  2G9D A;  4NXN Q;  1IYJ B;  5IYC H;  4NB3 A;  2PO4 A;  1A63 A;  2IL8 A;  5ISR A;  3SEB A;  3I72 A;  3W3A A;  3Q22 A;  1HA6 A;  4XQQ A;  2E76 C;  1D2B A;  1YZ6 A;  4B9W A;  4L5T A;  4E6I A;  5D3I B;  1J9O A;  2F4V L;  3T51 B;  4UY8 C;  4JV5 Q;  1CM9 A;  2R7Z H;  1EY0 A;  2JA5 H;  1AZQ A;  3WDN A;  4IZ8 A;  4QB4 A;  1G8Z D;  3T53 B;  2CCZ A;  4LF9 L;  4UP8 A;  2K5N A;  3K7A H;  4G7O C;  3A55 A;  1FNU A;  1T5E A;  1UUP A;  1L1O C;  2Q8R E;  1TWC H;  1VQO A;  2UXD Q;  1TT2 A;  4L5S A;  1XWE A;  1TS4 A;  4PMC A;  4K6L A;  1VQ5 A;  4A3D H;  4POF A;  5J3B A;  4CJ0 B;  5JJZ A;  1XMO Q;  1L0W A;  3S1M H;  1IW7 D;  1EY7 A;  3HFZ B;  4A3J H;  2ZTE A;  3NHH A;  1KC8 C;  4HIO A;  1SDF A;  2VXW A;  2OF1 A;  1KTK A;  4IQZ A;  3I4L A;  2ASB A;  2E74 C;  2TMP A;  3MEH A;  2I46 A;  2A5H A;  1EU3 A;  2QEX A;  2MJ8 A;  4JI6 Q;  4WJ3 M;  3GTP B;  3SDZ A;  2EPB A;  1GUG A;  1I4G A;  3I3C A;  2GVB A;  1D5Z C;  2QKI C;  4HAE A;  4V0B A;  2O5I C;  1STE A;  1B53 A;  3JC6 6;  5C4X H;  3Q0A A;  3OWE B;  4GN5 A;  1A15 A;  1X3G A;  5J39 A;  3CXC A;  1LUZ A;  2BE5 D;  4G7Z C;  2NTT A;  4A76 A;  1G6P A;  3J81 c;  1LTR D;  1UWV A;  3AU7 A;  4GN4 B;  3FHW A;  3S1Q H;  2JA8 H;  3F8T A;  5DEH A;  3VA5 A;  1MI2 A;  2JE6 I;  1AZP A;  3LX0 A;  1FL0 A;  3HOZ G;  4RWS C;  1JT8 A;  3A8J E;  4IUQ A;  3DWP A;  5M5W B;  4HCE A;  1BR9 A;  1EFW A;  2MNA A;  2AHO B;  2EYM A;  4QGU A;  1Y1W G;  3RN2 A;  4YWK A;  2V1C C;  1R9T H;  3GTM B;  3X3M A;  3TS0 A;  1WCM G;  4DPG A;  3KDF B;  2Z6B A;  2FXQ A;  2AKW B;  1I6H B;  4QIW B;  2UXC L;  4A3F B;  4C3I B;  1RDP D;  3AQQ A;  1QZG A;  1UE5 A;  4P75 A;  3SK4 A;  4EQ5 A;  2XRQ D;  3H0G H;  2H5X A;  5IYB G;  1XMQ L;  1SNO A;  1IL2 A;  2VNU D;  1H9R A;  1IXR A;  3BZD B;  2F0H A;  2EY5 A;  2A69 C;  2B2T A;  1G29 1;  3KYH C;  1Q90 A;  1GUT A;  4MTN A;  3OHX C;  5T1G A;  4JBM A;  5IOD A;  1WOC A;  3HG9 A;  2EE1 A;  3NBI A;  4JYA L;  2JK8 A;  2PMZ E;  1TS5 A;  1ZYR D;  4DR1 Q;  2B63 B;  4A3M H;  1U4L A;  2EY6 A;  2F4I A;  4BY7 G;  1CHQ D;  4LFA Q;  2VY3 A;  4XT1 B;  2I0Q A;  4NW2 A;  1VQF A;  4ZYS A;  4LUV A;  3A0J A;  3KFU A;  4DR5 Q;  4JBK A;  3HOU B;  2ZJR A;  4FF4 A;  3BYY B;  3KOJ A;  1TXY A;  4IPD A;  2NVQ B;  1S5C D;  1GUS A;  3MEF A;  5IYC G;  1VQK A;  3O13 A;  2KED A;  1SYB A;  1TR5 A;  4JI2 Q;  2VQE L;  4ZRZ A;  2A6E D;  5KEE A;  4I7Z C;  3KF6 B;  3STB D;  1A6X A;  1STA A;  4YHH L;  1QE6 A;  1I3Q H;  1KHI A;  1YNN D;  3NUC A;  3A5U A;  4JI3 L;  1O7Y A;  4RKB A;  3J80 L;  1WTX A;  1EWH A;  4DV0 L;  4IO9 A;  4NXN L;  2NB0 A;  4O42 A;  4GKJ Q;  1Q8K A;  1FVI A;  1KAW A;  2RSO A;  1TY0 A;  1NBW A;  1BXT A;  2XNA C;  1STN A;  4LUZ A;  4NXM Q;  1CQV A;  4A3D G;  2BOS A;  2PQE A;  3K5O A;  4PG3 A;  2JQO A;  5J22 A;  1PRT D;  4O1N A;  4DA2 A;  4EQO A;  2B2U C;  4A3J G;  2N8N A;  1K28 A;  3MXG A;  5CV5 A;  1B1Z A;  1QZH A;  5EKI A;  5ELE A;  1E2Z A;  1EIH A;  5C6A A;  4TKO B;  2UXD L;  3BDC A;  4P72 A;  5DLQ E;  1TWG H;  4JI4 Q;  3I91 A;  4OWX B;  5D65 A;  4ZUI A;  1XMO L;  1NAP A;  4TSS A;  2UXB Q;  5C3E H;  1QNU A;  2DJF C;  2V4D A;  4JVZ A;  2RDG A;  1CZG A;  3CCR A;  5C4X G;  4H13 C;  3A7A B;  3IL8 A;  1TKW B;  3P20 A;  2ZXO A;  3NQT A;  3S15 H;  4XIG S;  2L4N A;  2R93 H;  1W2B A;  4KD3 A;  1CA5 A;  1AE2 A;  2WP8 J;  4ULL A;  5I6W A;  2JA7 H;  3KF8 B;  4JI6 L;  2PI2 E;  2AUJ D;  3CRK C;  2JA8 G;  2ID0 A;  1KXL A;  4Q0F A;  1GKH A;  2WAQ E;  5ELO A;  3W5O A;  3CME A;  3HKZ G;  3CW2 C;  3LNN A;  3MFG A;  3V96 A;  5CBE E;  3H3V H;  3HOV B;  4JI7 Q;  2RSN A;  1SE4 A;  4ME3 A;  3M3Y B;  3TS2 A;  5EKL A;  3FMC A;  2R6G A;  5EJW A;  1Q8I A;  3Q24 A;  1PMR A;  3L2P A;  5M5Y H;  2BA1 A;  1CKN B;  1PH1 A;  3FPU B;  1KNA A;  1VQ8 A;  1VF7 A;  1RTO A;  1IW7 C;  1PDQ A;  5CV7 A;  4UAI A;  2AUK A;  1EIG A;  4NP5 A;  3BG3 A;  3U4Z A;  1HTL D;  1JWU D;  3H94 A;  1SMX A;  3J7Z C;  3X3N A;  3S1R B;  1XNR Q;  4MHE A;  1SE8 A;  2I5H A;  2NZH A;  1CA6 A;  5LMU L;  4C3J H;  1BUV T;  2D0O A;  4KJO A;  4MN3 A;  1WTO A;  1YI2 A;  3H0G G;  1D5X C;  1UEB A;  1XNQ Q;  3GTL B;  1FJG Q;  4F87 A;  4KI0 A;  1OXT A;  1PLF A;  2JN4 A;  4QUC A;  1SRO A;  2NVY H;  3CC4 A;  4LF6 Q;  4JPB W;  1JB3 A;  3PUW A;  2EY2 A;  4EX5 A;  1TWF B;  3S14 H;  1F77 A;  3S1N B;  3NWT A;  3SK5 A;  1NE3 A;  3R3O A;  1LT5 D;  3CP0 A;  5M3M B;  4PMB A;  3PO2 B;  4A3E G;  4KN4 C;  1STB A;  3I8Z A;  3RN5 A;  4LF5 L;  2BE5 C;  1W6J A;  1V1P B;  4A3M G;  2KBN A;  2A19 A;  2OCE A;  4GOP A;  2DUD A;  4O0A A;  1G6Z A;  4TRD A;  4FXG C;  2A73 B;  3HS0 C;  2I5M X;  3SK8 A;  4DF7 A;  3K6O A;  3IRB A;  1ENF A;  2PMZ B;  3BZK A;  2F52 A;  3WOF A;  1QVF A;  4KN7 C;  3J81 E;  4B3T Q;  4RFB A;  1EQV A;  4DR1 L;  4GLV B;  3MVV A;  1ET6 A;  4QY7 A;  1ONL A;  1D5M C;  4F8M A;  2RQX A;  1EWI A;  1SND A;  2DNC A;  3G71 A;  2UU9 Q;  2EYF A;  2E8G A;  3CPF A;  4DR5 L;  3BVM A;  5C4J B;  5J1Z A;  1FGB D;  1Q81 C;  4A3G H;  3M9B A;  1MJE A;  3S2D H;  5M3F B;  1B3Q A;  1E3P A;  4GNX C;  1CTM A;  4DUY Q;  2F0G A;  1ESF A;  4JOI A;  1LT6 D;  2JA6 B;  4JI2 L;  4JI5 Q;  2CWP A;  4LFC Q;  2IX3 A;  4LF4 L;  1JOQ A;  3M4P A;  1AN8 A;  4B9X A;  5D3D A;  2R7Z B;  4RAU C;  2JA5 B;  5AFW A;  4KK7 A;  1TWH H;  3NTK A;  4R8I A;  3G4S A;  4X64 Q;  1TVX A;  2DGY A;  1CT1 D;  4GKJ L;  1QUQ A;  1ZYR C;  1K83 B;  1IZ6 A;  1QB5 D;  3P1H A;  2F0O A;  5EGT A;  5GAD C;  5JEA J;  4A3D B;  4NXM L;  1VCI A;  2Z6K A;  3HOW B;  1B9M A;  3FDT A;  4OWT B;  4HJ9 A;  1HQR D;  1ASZ A;  3BVZ A;  5C3E G;  3L0O A;  2MO1 A;  4S3S A;  2PYK A;  2NN6 I;  4IUR A;  1GM5 A;  1I4P A;  4R4I A;  1U4M A;  1BF4 A;  1LTA D;  3QR8 A;  5E7N A;  2ZT9 C;  4KMU C;  3MAQ A;  4JI4 L;  1QWY A;  4I7A A;  4EGV A;  2R93 G;  4K8I A;  1GOZ A;  1XTC D;  2A6E C;  3STB C;  1NR2 A;  3NQI A;  2JA7 G;  4ZUJ A;  4BBS H;  1NSN S;  4RCO A;  1YNN C;  2RA4 A;  2L11 A;  2B3G A;  5EPJ A;  1B8A A;  2UXB L;  2E2H B;  1LTS D;  2DY8 A;  4QUF A;  3R2T A;  1K73 C;  3PUX A;  5FJ8 H;  4A3I B;  3BZC A;  1GD7 A;  3VR3 A;  4BY1 H;  1VMC A;  1XYI A;  4WRD A;  1ET9 A;  5IE8 A;  4A93 B;  2CVR A;  1D7Q A;  5EPL A;  4NDX A;  1EOV A;  4X62 Q;  1PRT C;  3AEV A;  1N9W A;  2WAQ B;  4IUN A;  2IW3 A;  5ELB A;  4A3B G;  4JI7 L;  4QMG A;  1EEF D;  2PQA B;  1RL2 A;  3PIO A;  1XJV A;  2IY5 B;  2F0E A;  3CU7 A;  1M1K C;  4JI0 Q;  2K5W A;  2JEB I;  2B2Y C;  2K75 A;  3GTJ H;  5BN5 A;  1NUC A;  1R9T B;  4C3J G;  1QIL A;  2WB1 G;  1BBU A;  1HNW L;  4XYQ A;  3KLS X;  3KF8 A;  5EBD A;  3KLW A;  3PO3 G;  1WCM H;  3E0E A;  3E5S A;  3MZ5 A;  1EYA A;  1K3B C;  2XIW A;  2KCN A;  4KY7 A;  5KGU A;  1I4X A;  3J81 i;  1Q46 A;  1Y1V G;  4BBR B;  1XNR L;  4PZ6 A;  3PUY A;  3DXJ C;  3TQY A;  1H9S B;  4KTA A;  5CYU A;  1A8V A;  5BR8 Q;  1HJP A;  1K8M A;  1U4R A;  2QDB A;  1XNQ L;  1CKN A;  1FJG L;  4J8Q A;  2UUC Q;  2IX1 A;  2F03 A;  1CSP A;  4DV2 Q;  1LT4 D;  3CF5 A;  2F0T A;  2WKD A;  4DR2 L;  1HNZ Q;  1C0A A;  3T1Y Q;  1SRU A;  4L5Q A;  2KOL A;  3MHB A;  3BDO A;  1H9K A;  5K36 G;  4YCU A;  3QOJ A;  2NTS A;  4LAA A;  3FKI H;  2E2J B;  1DYQ A;  1AH9 A;  5I9O A;  1ICW A;  3GTO H;  1RF2 D;  5CV6 A;  1AW7 A;  3BVG A;  1TWA H;  1I5F A;  2XRS D;  5COR A;  1IBL L;  4APV A;  1Y69 U;  1IYV A;  4KKS A;  3C1F A;  3KBX A;  4G7H C;  2RCN A;  4IJL A;  2E2I H;  4RGN A;  5JJI A;  1ZXT A;  2HQE A;  5CBA E;  2CQA A;  3S9W A;  2N49 A;  1DZ1 A;  3IFT A;  1II3 A;  4RGO S;  1XPO A;  4A3G G;  1JWM D;  2K52 A;  1SFO H;  3A5Z B;  1PZJ D;  3CCE A;  4B3T L;  5KNC A;  3QG1 A;  3E3X A;  1ZKO A;  4A3K G;  1PH4 A;  4U67 3;  1V1P A;  3PQI A;  3TEH B;  1V9P A;  3W1B A;  1WYD A;  2ICI A;  5FKA C;  5JAV A;  1HFG A;  1YIT A;  1I3Q B;  2F0P A;  3M4O H;  2L9H A;  2UU9 L;  2AWN A;  4DNT B;  2VUM B;  3PF5 A;  2ZXR A;  4DR6 L;  3S2H B;  5E3F A;  3E9H A;  4QCL A;  3TRZ A;  2F0F A;  5FLX c;  2K04 A;  3HRZ C;  1R4Q B;  4OL7 A;  2YU9 H;  3CCS A;  1B70 B;  4DUY L;  4J15 A;  3HKS A;  2EIF A;  2K5D A;  3U50 C;  1KAB A;  1IBK Q;  3H09 A;  2BA0 A;  3GQB A;  2HD3 A;  1PFS A;  4JI5 L;  3GTG B;  4ID6 A;  4LFC L;  2OTL A;  4ZKC B;  1IBM Q;  5IIF A;  3J81 L;  2F3W A;  1N32 Q;  5G3L D;  2F3I A;  2K05 A;  1EY4 A;  3SGI A;  2HDL A;  1EIF A;  1QCB D;  4FXK C;  4AYB G;  4X64 L;  2WFW A;  1S3O A;  4OEM B;  1TWG B;  3PIP A;  1L1O A;  3FPP A;  4FO2 A;  2LSS A;  5LMN Q;  1OTC A;  5HY6 A;  4A3C G;  2PZW A;  2QEJ C;  4DV6 Q;  1TS2 A;  2HUG A;  4UP7 A;  2CW0 D;  4BBS G;  5C3E B;  1HR0 W;  5JPM C;  1E1O A;  1E0B A;  3NWS A;  4U68 A;  5FJ8 G;  3NP8 A;  3RNU A;  4N8X 1;  5IP7 G;  1MGS A;  2VZA A;  3CCV A;  3DMU A;  4BY1 G;  3U4V A;  3DHQ A;  3I73 A;  2NVX H;  1JJ2 A;  1CHP D;  1CQF A;  2MHV A;  4RA8 A;  1PRT F;  3SVM A;  1SYC A;  2XTI A;  3HOY H;  2J0T D;  3FP9 A;  1DXM A;  3RMH A;  1Y8P B;  4BXX G;  1KAA A;  1HA5 A;  2QCP X;  1NJI C;  1HZ9 A;  1SYG A;  2A74 C;  1QOH A;  3K80 C;  1PTO D;  5LL6 X;  1O7Z A;  1OXX K;  2K33 A;  1PZK D;  1RTN A;  4HCS A;  3AFP A;  1C7Y A;  4JBJ A;  4DNI A;  2K7V A;  4ZAI A; 
#chains in the Genus database with same CATH homology
 5M5Y B;  3OW7 A;  1Y8N B;  4IAL A;  4X3U A;  1BO0 A;  1HXY D;  1LTI D;  5E4X A;  1IL8 A;  3VYS A;  3NXW A;  1BQQ T;  2CHB D;  1X3P A;  1UEA B;  1GUO A;  4C3J B;  1BOS A;  4EQN A;  1EY8 A;  3NSW A;  4JK1 C;  3RZO B;  4IFD G;  4MIU A;  2JYO A;  1DD2 A;  3A56 A;  4IUP A;  2IWH A;  2NVY B;  2MUY A;  3TSS A;  4DK1 A;  3ERO A;  3S14 B;  2B2T C;  2EYH A;  1QNK A;  1EFI D;  4G57 A;  3BYT B;  3VR5 A;  2F3V A;  5JVG 3;  2YYZ A;  2B2V A;  1B2T A;  4IUT A;  2RDF A;  3NPP A;  1I50 B;  1F2L A;  4R9W A;  3QIA A;  1EU4 A;  4Y7N B;  3R2I A;  3AB9 A;  5K5P A;  4R8N A;  1VF5 C;  4J6H A;  5C0X G;  3GD7 A;  1BBX C;  4C3H G;  1Z47 A;  3BS1 A;  3GP7 A;  1F9Q A;  4CBV A;  2I07 B;  1H9S A;  1CFM A;  5C3W A;  2WIN B;  2EVB A;  1EYD A;  1WVL A;  2KVM A;  3DUZ A;  3S2D B;  1I4Q A;  1TII D;  1C48 A;  3OMC A;  4HMI A;  5FO8 B;  1SAP A;  2IJ0 A;  3W2D A;  4GZY C;  4L6T B;  4RGM A;  4RH6 A;  2K01 A;  1TWH B;  1VDZ A;  1JC7 A;  3VA7 A;  1G2T A;  2K5Q A;  2R61 A;  3VYU A;  2RBM A;  1MBY A;  1HHV A;  2XN9 C;  1X32 A;  3D3R A;  1ILP A;  4FVM A;  1MD2 D;  2ICE C;  2RVL A;  3IKJ A;  5ELC A;  2DNE A;  1K8O A;  4I65 A;  4RKL A;  5A2Q E;  1SNQ A;  4F88 A;  3RLF A;  2B2U A;  2K28 A;  2X69 A;  4PV1 C;  4XQN A;  3N6R A;  2OEO A;  3AMU A;  2A6H C;  5DNF A;  3OPO A;  5HGT A;  3U9S A;  4ZLT F;  1A2T A;  2XWJ B;  1WTQ A;  1PRT B;  3GO5 A;  1Q1B A;  3WOE A;  4XDX A;  5ELD A;  3L9A X;  5KYI A;  1PZI D;  1Z7T A;  2SNM A;  2WII B;  1SMY D;  5C5M A;  1NCV A;  2NVT B;  4RHR A;  2H4O A;  3ERQ A;  3Q6S A;  4Q5V A;  4K5W A;  2EYJ A;  3TP7 A;  1W6K A;  3S17 B;  3I90 A;  1D6E C;  2PNR C;  4CHT B;  3HOZ B;  5FLX E;  1JIC A;  3EQL C;  4K6D A;  3NE5 B;  2F0N A;  3H3V C;  1EZ6 A;  1OO9 B;  3DM1 A;  1CK1 A;  3GTJ B;  1Y1W B;  5IGF A;  5FOB B;  5KYL A;  2CW0 C;  3R93 A;  4DXF A;  1WCM B;  1M4V A;  1JOR A;  3PMF A;  3PIO 3;  1PTO H;  1F9S A;  5IOC A;  2NUC A;  2M00 A;  2Z4H A;  1B3A A;  2IX0 A;  3PUZ A;  1T5X D;  4C56 C;  4ZK9 B;  2B39 A;  3K5M A;  2D62 A;  1WTP A;  2VB3 X;  4M8A A;  5EKK A;  1SYD A;  1PTO C;  3T16 A;  2B2W C;  1S5B D;  3HP3 A;  1A3V A;  4FF1 A;  3NTI A;  5K36 H;  4BWG B;  1LTG D;  1S4Z A;  1HTP A;  3OSO A;  4BY7 B;  2JEA I;  4CKC A;  1TS3 A;  4OIK A;  1UAP A;  1I6V C;  1F2Z A;  2MPM A;  1PXU A;  3D8G A;  1GXD C;  1STH A;  2TSS A;  4HSV A;  3CRL C;  3E0J A;  4J1M A;  1HUN A;  2Y0S B;  3D4R A;  1SYF A;  3FRP B;  5I6Y A;  5HUR A;  4PNY A;  4HR7 B;  3M4O B;  2JSO A;  1F9P A;  2M9V A;  4DAV A;  1PFB A;  2L0C A;  1R4P B;  2MP1 A;  4DU9 A;  3TN2 A;  3J7A V;  3QWN A;  2RKS A;  3K7A B;  3TZD A;  1V1O A;  4UDU C;  1JOO A;  1TWC B;  1FD7 D;  2E75 C;  1OXS C;  4QF4 A;  3TP8 A;  2F1M A;  2Z8L A;  2EJF C;  1EWC A;  3R8B A;  1RD9 D;  3GV6 A;  3S1M B;  3L7Z C;  2F0S A;  4A3J B;  3QOL A;  1OXU A;  2L12 A;  3ND9 A;  4JBW A;  3HZX A;  3MFY A;  4FF2 A;  1IKL A;  1M8A A;  1GUN A;  3E6Z X;  1AP0 A;  5IT9 E;  4M1U B;  2M2L A;  2KEC A;  3KLS A;  2Q8T A;  2MGS A;  5JOB A;  1KDC A;  5C4H A;  3PIP 3;  5EQ0 A;  2HCI A;  5C4X B;  2NVX B;  1SNM A;  1JOK A;  3MXU A;  4IN3 A;  4N9P A;  4H44 C;  3VYR A;  2O4X A;  2HDM A;  5G3L F;  5CR3 A;  2J4X A;  3QB3 A;  3A54 A;  3S1Q B;  2JA8 B;  2FHT A;  1CZW A;  4HSP A;  1J8I A;  3MA2 B;  4K5X A;  3TP5 A;  2A68 D;  1EOT A;  3HKZ B;  4C1N I;  1WTR A;  1SXT A;  2EDG A;  3TME A;  4LK1 C;  2GA4 B;  1Q1E A;  1E2V A;  4DK0 A;  5A2Q L;  1YNJ D;  1C4Q A;  1OXV A;  3C3L A;  2R3Z A;  3HEJ A;  1BDO A;  5EBC A;  3D4W A;  2G9H D;  3D4D A;  4WFN 3;  5JPN C;  1KLU D;  1VMP A;  4K8J A;  4RCN A;  3CHB D;  5IGD A;  4XYO A;  1AFP A;  2BDN A;  1S5E D;  1D1I A;  3OOC A;  3C1E A;  4K2K A;  5KIX A;  3P7J A;  1PTO F;  1EYC A;  1I4R A;  3H0G B;  2F0M A;  1SJE D;  3DWA A;  4IFD H;  4TQU S;  2EYP A;  1AEX A;  3RUZ A;  4XXE A;  4XTC S;  5IGC A;  4ABN A;  3UI2 A;  2RDH A;  3JAM E;  1SMY C;  1O78 A;  1LLR D;  4A3E B;  3NK9 A;  3ITP A;  5BN4 A;  4A3M B;  2EXZ A;  3BDL A;  1ENA A;  3A8I E;  5C44 B;  1XXG A;  1A2U A;  3J80 E;  5A35 A;  5DAU A;  3A8K E;  1LTT D;  3QO2 A;  3KK7 A;  5C0X H;  1EY9 A;  3PUV A;  4H0L C;  1V43 A;  3L3O C;  2Q8I B;  1JR0 D;  1EQT A;  2A6H D;  5IGE A;  1Q3L A;  5CGK A;  3I4M B;  4K14 A;  5JVH 3;  1LTB D;  4PQX A;  3URY A;  1JE4 A;  2EJM A;  5E1F A;  1HFN A;  2Z1C A;  5FK9 C;  2OT2 A;  1U4P A;  4X3T A;  4NMZ A;  3GTK B;  2H1E A;  1DOK A;  1ZEQ X;  1NR4 A;  3P75 A;  3J7A F;  3K5N A;  2K6A A;  4L8J A;  5D14 A;  2B8G A;  3ONA B;  1FNW A;  2PZT A;  1FYC A;  3LWU A;  3OWF A;  1ILQ A;  1A3U A;  2PW7 A;  2NN6 H;  5T1I A;  3C2P A;  2EYL A;  4WOR A;  2EOT A;  1IKM A;  4OO1 H;  4LMQ D;  3GTQ B;  5I4D A;  3F2U A;  3CKI B;  3KBG A;  4IUV A;  3S15 B;  2N88 A;  4DNR B;  4EVO A;  2R93 B;  4XQJ A;  1Y8O B;  2JA7 B;  4V19 0;  4DXG A;  3MWY W;  1TU2 B;  4FP5 D;  4OIJ A;  5NUC A;  3M85 A;  2F0V A;  2D9U A;  1FR3 A;  4EQP A;  2AWO A;  4HN7 A;  1SSO A;  3S16 B;  3U9O A;  4KHZ A;  2WAC A;  5IT9 L;  2PZU A;  4A3B B;  1DON A;  3G7L A;  3ND8 A;  3M7N A;  1DM0 B;  3VR4 A;  1DJR D;  3H6M A;  4K5V A;  4DAP A;  2WB1 B;  3M7G A;  5KNB A;  2K03 A;  3PO3 B;  1PTO B;  2F0I A;  1LV9 A;  2FMC A;  2SNS A;  2F0Q A;  1WTV A;  1BCP D;  1WD1 A;  1B9N A;  1Y1V B;  5I2Y A;  2B8F A;  4IFD J;  5ELF A;  1ML0 D;  1GJX A;  2F0W A;  3MTS A;  2B2V C;  2LS0 1;  3FVQ A;  5M9O A;  2A68 C;  1ROD A;  2IPK D;  1STY A;  1YNJ C;  5FO7 B;  2SOB A;  5COY A;  3N52 A;  3TP6 A;  2FMM A;  4KY5 A;  1BCP B;  2L5T A;  5F2D A;  5C0X J;  5CMD A;  1SE3 A;  4A3G B;  1DCZ A;  1QJO A;  4KHV A;  4ME5 A;  4KY6 A;  5IGB A;  2LY7 A;  4RGT A;  1H9J A;  4A3K B;  1HUM A;  1RJT A;  5CV9 A;  1CI3 M;  3JAM L;  2KHS A;  1E2W A;  4KKU A;  1JCK B;  1ESR A;  3EVQ A;  2AQ2 B;  5DM6 3;  2HCC A;  3V05 A;  2OXP A;  4WJW A;  1SNP A;  1LAB A;  1S5D D;  2KA7 A;  3QJY A;  1LAC A;  3EFX D;  1ENC A;  1RCV D;  4FNF A;  1RKN A;  3HGB A;  2NN6 G;  5E4W C;  2F0J A;  4KKT A;  5FO9 B;  3FEW X;  4YIJ A;  1I4H A;  2BCO A;  1JWS D;  5JEA H;  4DAY A;  4KV6 A;  1Z6H A;  4OO1 G;  3OIQ A;  4IUU A;  1IYU A;  4AYB B;  1V8Q A;  4F7X A;  3SXH A;  2ENB A;  2C9O A;  5LHY 1;  4L63 B;  1PFM A;  1WTW A;  5DM7 3;  2EJG C;  3IAY A;  2L1B A;  4BBS B;  2D5D A;  4X3S A;  2PPB C;  1HCZ A;  4OHJ A;  3VR6 A;  2EY1 A;  2K1B A;  1UNS A;  5KRU A;  2PCF B;  3J7Y W;  4BY1 B;  3SR1 A;  1DOL A;  2NBF A;  2F0L A;  1MSH A;  5TSS A;  4CKB A;  1D1K A;  3SHL A;  1L0Y B;  1SBB B;  4FXD A;  1B44 D;  2WV6 D;  3KUP A;  2XSC A;  2F0D A;  3DEP A;  3MC0 B;  3TBI B;  2IT1 A;  5IGG A;  1B50 A;  1H9M A;  4G4K A;  3TDQ A;  1EY5 A;  2PW5 A;  2DY7 A;  1LT3 D;  1PFN A;  4K2L A;  3I70 A;  2JP1 A;  4HED A;  1GHJ A;  1KNE A;  1SEB D;  1L0X B;  3IFD A;  1XX8 A;  1GUW A;  5CC4 A;  2DN8 A;  4KD4 A;  2SDF A;  4BA1 I;  5C3X A;  2R92 B;  2KUM A;  1LO5 D;  2O5J C;  2JXM B;  5BN3 A;  3MXP A;  4CJ1 B;  2X6L A;  3FKI B;  1BNZ A;  3T13 A;  3GTO B;  3V2T A;  2F0K A;  1TWA B;  3NBH A;  4IFD I;  1QG7 A;  1F2Y A;  1TQO A;  2E2I B;  5I9P A;  2B2W A;  3T56 B;  4C3H B;  3T4A C;  4X3K A;  3RD4 A;  1SFO B;  5KND A;  5C4Z A;  1GHK A;  1X3Q A;  1F9R A;  1KLG D;  3TZU A;  5M5X B;  2NYZ D;  3VR2 A;  2WKC A;  5C0X I;  2KEE A;  1BCP C;  4ZQ3 A;  4LJZ C;  1SYE A;  3KLR A;  2YU9 B;  2ZXP A;  1JQY D;  3K59 A;  4OGQ C;  3K0Y A;  2EZV A;  1F2M A;  4B08 A;  5EPK A;  3D31 A;  3M4Y A;  3ZYY X;  5JEA G;  2QF7 A;  4HMJ A;  2SEB D;  1EY6 A;  2NZ1 D;  3A7L A;  1S5F D;  1WD0 A;  1DOM A;  2BDO A;  2FIN B;  4C2M B;  1TY2 A;  4DGZ A;  1G91 A;  3G6J B;  2KCC A;  1STG A;  2E2D C;  3EJI A;  1PYW D;  5CV4 A;  4HTH A;  4BS9 A;  3VYT A;  3C46 A;  4ZKB B;  1RHP A;  5CV8 A;  4DN4 M;  2LFN A;  4DFA A;  3HOY B;  3H91 A;  4OO1 I;  4P2C B;  2VB2 X;  3K58 A;  2KJX A;  4ODG A;  2A69 D;  1FNV A;  2J7Z A;  1SE2 A;  2KQ3 A;  4RHS A;  5I2X A;  2LKV A;  3K57 A;  2Z4I A;  3NTH A;  1SJH D;  1A3T A;  2LMC B;  4PMW A;  5C5L A;  2FFK B;  2X6G A;  3DEO A;  2F0U A;  3HOX B;  4N9T A;  3SE0 A;  1C8C A;  3SK6 A;  1G2S A;  3LWE A;  1KDB A;  4XT3 B;  2FJ2 A;  3GV3 A;  2B2Y A;  4C3I G;  1O7L A;  3DWQ A;  3I4N B;  3D6C A;  1KDA A;  4NKL A;  1B4O A;  3MXN A;  4KJN A;  1IHZ A;  3CQZ B;  3K5L A;  5LL6 S;  1O80 A;  2N55 A;  5FLX L;  2QIL A;  2AQ1 B;  1SNC A;  4Z9C B;  1EZ8 A;  3PV0 A;  2L55 A;  4FYD A;  2O2L D;  4C1N K;  1EEI D;  2AQ3 B;  2EYO A;  1HRJ A;  3Q23 A;  1EL0 A;  2XVS A;  1MSG A;  4ILW A;  1BCP F;  2C5C A;  2NWG A;  4FF3 A;  3OMG A;  4CJ2 C;  4CGY B;  2K32 A;  4BA2 I;  1U9R A;  1Q12 A;  1HQM C;  4CKE A;  3D6W A;  2D2C C;  1HPC A;  3OIP A;  3RZD B;  3EA6 A;  2XWB B;  4H7B A;  2G9D A;  2PO4 A;  2IL8 A;  5ISR A;  3SEB A;  3I72 A;  3W3A A;  3Q22 A;  1HA6 A;  4XQQ A;  2E76 C;  1D2B A;  4B9W A;  4E6I A;  5D3I B;  1J9O A;  3T51 B;  1CM9 A;  1EY0 A;  1AZQ A;  3WDN A;  4IZ8 A;  4QB4 A;  1G8Z D;  3T53 B;  4G7O C;  3A55 A;  1FNU A;  1T5E A;  1UUP A;  2Q8R E;  1TT2 A;  1XWE A;  1TS4 A;  4PMC A;  4K6L A;  4CJ0 B;  5JJZ A;  1IW7 D;  1EY7 A;  3NHH A;  1SDF A;  2VXW A;  2OF1 A;  1KTK A;  4IQZ A;  3I4L A;  2E74 C;  2TMP A;  3MEH A;  2I46 A;  2A5H A;  1EU3 A;  2MJ8 A;  3GTP B;  3SDZ A;  2EPB A;  1GUG A;  1I4G A;  3I3C A;  1D5Z C;  2QKI C;  4HAE A;  4V0B A;  2O5I C;  1STE A;  1B53 A;  3Q0A A;  3OWE B;  1A15 A;  5J39 A;  2BE5 D;  4G7Z C;  2NTT A;  1LTR D;  3AU7 A;  5DEH A;  3VA5 A;  1MI2 A;  2JE6 I;  1AZP A;  3LX0 A;  4RWS C;  3A8J E;  4IUQ A;  3DWP A;  5M5W B;  4HCE A;  1BR9 A;  2EYM A;  3GTM B;  3X3M A;  1I6H B;  4QIW B;  4A3F B;  4C3I B;  1RDP D;  3SK4 A;  2XRQ D;  1SNO A;  2VNU D;  1H9R A;  3BZD B;  2F0H A;  2EY5 A;  2A69 C;  2B2T A;  1G29 1;  1Q90 A;  1GUT A;  3OHX C;  5T1G A;  5IOD A;  3HG9 A;  2EE1 A;  3NBI A;  1TS5 A;  1ZYR D;  2B63 B;  1U4L A;  2EY6 A;  2F4I A;  1CHQ D;  4XT1 B;  4NW2 A;  4ZYS A;  3HOU B;  4FF4 A;  3BYY B;  2NVQ B;  1S5C D;  1GUS A;  3O13 A;  2KED A;  1SYB A;  1TR5 A;  4ZRZ A;  2A6E D;  5KEE A;  4I7Z C;  1A6X A;  1STA A;  1QE6 A;  1YNN D;  3NUC A;  1O7Y A;  4RKB A;  3J80 L;  1WTX A;  1EWH A;  2NB0 A;  4O42 A;  2RSO A;  1TY0 A;  1BXT A;  2XNA C;  1STN A;  1CQV A;  2BOS A;  2PQE A;  3K5O A;  5J22 A;  1PRT D;  4O1N A;  4DA2 A;  4EQO A;  2B2U C;  3MXG A;  5CV5 A;  1B1Z A;  5EKI A;  5ELE A;  1E2Z A;  1EIH A;  5C6A A;  4TKO B;  3BDC A;  3I91 A;  5D65 A;  4ZUI A;  1NAP A;  4TSS A;  1QNU A;  2V4D A;  2RDG A;  1CZG A;  4H13 C;  3A7A B;  3IL8 A;  1TKW B;  3P20 A;  2ZXO A;  3NQT A;  4XIG S;  2L4N A;  4KD3 A;  1CA5 A;  2WP8 J;  4ULL A;  5I6W A;  2AUJ D;  3CRK C;  2ID0 A;  4Q0F A;  3LNN A;  3MFG A;  3V96 A;  5CBE E;  3HOV B;  2RSN A;  1SE4 A;  3M3Y B;  5EKL A;  3FMC A;  2R6G A;  5EJW A;  1Q8I A;  3Q24 A;  1PMR A;  2BA1 A;  3FPU B;  1KNA A;  1VF7 A;  1RTO A;  1IW7 C;  1PDQ A;  5CV7 A;  4UAI A;  2AUK A;  1EIG A;  4NP5 A;  3BG3 A;  1HTL D;  1JWU D;  3H94 A;  3S1R B;  3X3N A;  4MHE A;  1CA6 A;  1BUV T;  4KJO A;  4MN3 A;  1WTO A;  1D5X C;  3GTL B;  4F87 A;  4KI0 A;  1OXT A;  1PLF A;  4QUC A;  1JB3 A;  3PUW A;  2EY2 A;  1TWF B;  1F77 A;  3S1N B;  3NWT A;  3SK5 A;  3R3O A;  1LT5 D;  5M3M B;  4PMB A;  3PO2 B;  4KN4 C;  1STB A;  3I8Z A;  2BE5 C;  1W6J A;  1V1P B;  1G6Z A;  4TRD A;  4FXG C;  2A73 B;  3HS0 C;  3SK8 A;  4DF7 A;  3K6O A;  1ENF A;  2PMZ B;  3WOF A;  4KN7 C;  3J81 E;  4RFB A;  1EQV A;  3MVV A;  1ET6 A;  1ONL A;  1D5M C;  4F8M A;  2RQX A;  1SND A;  2DNC A;  2EYF A;  3BVM A;  5C4J B;  5J1Z A;  1FGB D;  5M3F B;  1CTM A;  2F0G A;  1ESF A;  1LT6 D;  2JA6 B;  2IX3 A;  1JOQ A;  1AN8 A;  4B9X A;  5D3D A;  2R7Z B;  4RAU C;  2JA5 B;  5AFW A;  4KK7 A;  3NTK A;  4R8I A;  1TVX A;  1CT1 D;  1ZYR C;  1K83 B;  1QB5 D;  3P1H A;  2F0O A;  5EGT A;  5JEA J;  4A3D B;  1VCI A;  3HOW B;  1B9M A;  3FDT A;  1HQR D;  3BVZ A;  4S3S A;  2PYK A;  2NN6 I;  4IUR A;  1I4P A;  1U4M A;  1BF4 A;  1LTA D;  2ZT9 C;  4KMU C;  3MAQ A;  1QWY A;  4EGV A;  4K8I A;  1GOZ A;  1XTC D;  2A6E C;  1NR2 A;  3NQI A;  4ZUJ A;  1NSN S;  4RCO A;  1YNN C;  2RA4 A;  2L11 A;  5EPJ A;  2E2H B;  4QUF A;  1LTS D;  2DY8 A;  3R2T A;  3PUX A;  4A3I B;  3VR3 A;  1VMC A;  1XYI A;  4WRD A;  1ET9 A;  4A93 B;  2CVR A;  5EPL A;  4NDX A;  1PRT C;  2WAQ B;  4IUN A;  2IW3 A;  5ELB A;  4QMG A;  1EEF D;  2F0E A;  3CU7 A;  2K5W A;  2JEB I;  2B2Y C;  5BN5 A;  1NUC A;  1R9T B;  4C3J G;  1QIL A;  4XYQ A;  3KLS X;  3KF8 A;  5EBD A;  3E5S A;  3MZ5 A;  1EYA A;  2XIW A;  2KCN A;  4KY7 A;  5KGU A;  1I4X A;  4BBR B;  3PUY A;  3DXJ C;  1H9S B;  4KTA A;  5CYU A;  1K8M A;  1U4R A;  2QDB A;  2IX1 A;  4J8Q A;  2F03 A;  1LT4 D;  2F0T A;  2WKD A;  2KOL A;  3MHB A;  3BDO A;  1H9K A;  5K36 G;  3QOJ A;  2NTS A;  4LAA A;  2E2J B;  1DYQ A;  5I9O A;  1ICW A;  1RF2 D;  5CV6 A;  1AW7 A;  3BVG A;  5COR A;  2XRS D;  1Y69 U;  1IYV A;  4KKS A;  3C1F A;  3KBX A;  4G7H C;  4RGN A;  1ZXT A;  2HQE A;  5CBA E;  2CQA A;  3S9W A;  1DZ1 A;  3IFT A;  1II3 A;  4RGO S;  1JWM D;  1PZJ D;  5KNC A;  3QG1 A;  1ZKO A;  4U67 3;  1V1P A;  2ICI A;  5FKA C;  5JAV A;  1HFG A;  1I3Q B;  2F0P A;  2L9H A;  2AWN A;  4DNT B;  2VUM B;  2ZXR A;  3S2H B;  5E3F A;  4QCL A;  2F0F A;  2K04 A;  3HRZ C;  1R4Q B;  4OL7 A;  2K5D A;  1KAB A;  3H09 A;  2BA0 A;  3GQB A;  3GTG B;  4ID6 A;  4ZKC B;  5IIF A;  3J81 L;  2F3W A;  5G3L D;  2K05 A;  1EY4 A;  2HDL A;  1QCB D;  4FXK C;  1TWG B;  3FPP A;  4FO2 A;  2PZW A;  2QEJ C;  1TS2 A;  2HUG A;  2CW0 D;  5C3E B;  5JPM C;  1E0B A;  3NWS A;  4U68 A;  3NP8 A;  1MGS A;  3DMU A;  3DHQ A;  3I73 A;  1CHP D;  1CQF A;  2MHV A;  4RA8 A;  1PRT F;  3SVM A;  1SYC A;  2J0T D;  1DXM A;  3RMH A;  1Y8P B;  1KAA A;  1HA5 A;  2QCP X;  2A74 C;  1SYG A;  1QOH A;  1PTO D;  5LL6 X;  1O7Z A;  1OXX K;  2K33 A;  1PZK D;  1RTN A;  4HCS A;  2K7V A;  4ZAI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...