3R3OA

Crystal structure of staphylococcal nuclease variant delta+phs t62a at cryogenic temperature and with high redundancy
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFAKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Cavities determine the pressure unfolding of proteins.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 33
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2011-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3r3oA00
4EQOA 2SNSA 5CV4A 4DF7A 1KDBA 3VA5A 3QOLA 1A2TA 1SNOA 5HURA 1STYA 3MHBA 3P1HA 1ENAA 4TRDA 4I65A 5CV8A 3SK5A 5ISRA 1ENCA 4HTHA 4KV6A 5IOCA 1JOQA 2F0KA 2F0TA 5C3XA 5EKKA 4KY6A 2EYLA 1STAA 2F0VA 2F0LA 2HQEA 4ME5A 4QMGA 5E3FA 2M00A 1SNCA 4ODGA 5CR3A 5K5PA 4NMZA 5M9OA 4KY7A 1KABA 1SNDA 4K2KA 1A2UA 5I9PA 2EYPA 1AEXA 3EVQA 3NK9A 4N9TA 4YIJA 3SK4A 2LKVA 4RKBA 3TP5A 5IGFA 5J39A 1KAAA 3OWFA 1EY7A 2F0DA 4ZUIA 2RDFA 5J22A 1KDAA 3D4DA 4G57A 2RKSA 3NXWA 4K5XA 5CV9A 4ZQ3A 5HGTA 2F0QA 2PZUA 4ZUJA 4DU9A 5C6AA 3NP8A 4K14A 3NQTA 5I6WA 3DMUA 5KIXA 2EYHA 3C1FA 3T16A 3TMEA 4KD4A 3E5SA 2PW5A 4PMBA 1F2YA 4KHVA 1U9RA 5KRUA 1EZ8A 1EYCA 1TT2A 5C5LA 3BDLA 1EQVA 1A3VA 1STNA 2F0JA 2WACA 5IGGA 4OL7A 2F0GA 2F0SA 3EJIA 3HZXA 4K8IA 3SHLA 5C4ZA 4PNYA 5JOBA 2F0EA 2EY5A 1SNPA 3NUCA 1NSNS 5F2DA 5CV6A 4K8JA 4KD3A 5J1ZA 3SXHA 5IGEA 2O4XA 1SYBA 4EQPA 5KEEA 1SYEA 4QF4A 3TP8A 1IHZA 2EY6A 3D8GA 3MEHA 4B9XA 2F0WA 3U9OA 5KGUA 4H7BA 3SK8A 5CC4A 1NUCA 4F7XA 1F2ZA 1STBA 2EYJA 5DAUA 4ID6A 4DGZA 1EY6A 1SNQA 3ITPA 5KYIA 1STGA 2F3WA 2OF1A 5I6YA 3D4WA 4KTAA 3LX0A 3MZ5A 3T13A 4DFAA 2OXPA 3SR1A 4PMCA 4NKLA 2EYMA 2EY2A 4LAAA 1EY9A 4K2LA 4KY5A 3S9WA 4EVOA 4R8NA 5KYLA 2SOBA 2EXZA 3C1EA 4IALA 5I9OA 5IGCA 3SK6A 5CV7A 3RUZA 3DHQA 4HMJA 4J1MA 4KJOA 2ENBA 1TQOA 1SNMA 1SYFA 2EYOA 3NHHA 5CV5A 2F0MA 4QB4A 4B9WA 1EY4A 5IIFA 4IZ8A 2F0FA 4K5VA 4J6HA 4WRDA 5DEHA 4IUNA 5E1FA 1EY0A 5CGKA 2EY1A 4HMIA 4EQNA 2OEOA 3PMFA 4S3SA 2NUCA 4K5WA 5IGDA 2PW7A 1EYAA 3HEJA 2SNMA 2F0NA 1SYDA 3OMGA 3P75A 3QOJA 5EKLA 3OSOA 2F3VA 1EZ6A 2KHSA 3OMCA 4NDXA 3TP6A 1RKNA 1EYDA 5IGBA 1JOKA 1A3TA 4NP5A 1SYCA 2F0IA 2PZTA 4K6DA 1TR5A 2PYKA 5JAVA 1STHA 1JOOA 3V2TA 5C4HA 1JORA 3BDCA 2PQEA 5EGTA 4MIUA 3MXPA 3TP7A 1F2MA 5IODA 1II3A 1SYGA 3EROA 2KQ3A 5C5MA 2F0UA 2QDBA 1EY5A 2F0OA 1A3UA 4N9PA 2RBMA 4E6IA 2F0HA 2EYFA 3QB3A 3H6MA 5C3WA 4WORA 1EY8A 2PZWA 3ERQA 3MVVA 2F0PA 1KDCA 5NUCA 4F8MA 3D6CA 4RKLA 3R3OA 4KJNA
chains in the Genus database with same CATH superfamily
1W6JA 3AFPA 3VA5A 2DY7A 5C44H 1ENAA 4AH6A 5C0XI 3SK5A 4N8FA 1WCMB 1WTXA 5JJZA 2C9OA 2F0VA 1TWFB 1DZ1A 1O78A 1VQHA 2PI2A 1B9NA 5ELDA 2WB1G 3BG3A 3KDFB 3CCJA 4EGVA 1FYCA 4U673 3L7ZC 1CI3M 2GVBA 3STBD 1EIFA 1HR0W 4ZQ3A 1IYVA 1RF2D 4R8IA 4HJ8A 1LO5D 3CKIB 1CFMA 3I4MH 4A93H 3J7AV 4L63B 1SEBD 4NXNL 4A3LH 3TS2A 1D5XC 3S1QH 5ELCA 1I6HB 2JA9A 4A3KB 4TVAB 1LT3D 1SJHD 1Y1VH 4OONA 2I07B 1B3AA 4B08A 4DV3L 1Z47A 1STBA 4IFDJ 4X62L 3PUWA 2UXCQ 2NB0A 1TWAH 4JYAL 1TWGB 4A3DH 1D6EC 1N33L 3T1HQ 2BDOA 5C4XH 4R8NA 3BYYB 2MUYA 3H91A 4DAYB 2VB2X 4NB3A 4HMJA 2ENBA 1P16A 1SNMA 1SYFA 2L11A 2B2UC 1BBWA 4LF9Q 2B8GA 1HJPA 1Z7TA 5C3EG 4HMIA 2JN4A 2NVYH 2BA0A 4Q0FA 3UDGA 3GTOB 1NNXA 1YI2A 1P8LA 3RZDH 1KL9A 2F0NA 3TP6A 1TS3A 5A2QL 2LXJA 4DAPA 4JI3Q 2PO4A 1TXYA 4CGYB 1G6PA 2KHIA 1D2BA 4CKBA 1BBUA 1Q82C 2NVTB 5JJKA 3CXCA 1C7YA 4R9WA 1G291 3CPWA 1PTOD 1BOSA 3MXPA 4C3HB 4A3GB 1PFNA 3K59A 4KKSA 1MD2D 2BE5D 1PH1A 4OO1I 1VQGA 4R4OA 1QVCA 2MP1A 3D6CA 1XNRL 1NR4A 1A2TA 3TDQA 3P1HA 1BKBA 2WAQG 2RQXA 3PO3H 1ILPA 5DM63 1GUTA 1LV9A 3KK7A 4DV7L 2Z1CA 2A68D 3F2BA 4XIGS 3S2DH 2WFWA 3GTJB 5K36H 3W1GA 3A54A 1YVCA 3HOYG 1LT4D 2O5IC 2CKZB 4R4QA 1EQQA 3GTLB 5D3IB 2EYHA 1XPRA 4KHPQ 3ND9A 1F2YA 5FO9B 1VQ4A 5HGQA 3HOXB 4FF4A 3A7LA 3A7AB 1G6ZA 3RLOA 4YCUA 5C4ZA 4A3IG 4KK7A 2ZM6Q 4BBRB 3NTHA 3F2CA 1IL8A 3CCMA 3GTMB 2QKIC 4KD3A 4DAVA 4RGOS 4DV0Q 1V9PA 2BOSA 1GUWA 1V1PB 1VQCA 3K80C 3F1ZA 3MEHA 4IOCA 3Q23A 4UHVA 1JE4A 3R2TA 1Z6HA 3CC4A 3H0GB 3QIAA 3VR5A 2PNHA 2QDLA 3I7FA 1PYWD 4EVOA 1X54A 1SMYC 1VCIA 3K0YA 5BR8L 2NZHA 4A3DB 1V1QA 1R9TB 2K04A 4IO9A 2AUJD 5C0XG 1X55A 4AYBB 5C4XB 3HOZB 4B9WA 2DJGC 1PV4A 2Z4HA 3OIQA 4IUNA 5J3BA 2CW0C 5H1SE 3S15H 2OEOA 1CKMA 4JCVE 3S24A 3U58A 3QOJA 4A3CG 2L55A 5GAEC 2J0TD 2KJXA 4DV4Q 2Z0SA 4GN5A 4LUOA 2L0CA 4MIUA 1HA5A 1XMQL 3HFZB 4G4KA 4JBJA 4YWLA 2RBMA 3KLWA 4JBKA 1BQQT 3H6MA 1T5EA 2PZWA 5EJWA 3HOVG 4APVA 4DNRB 2UXDQ 4C3IH 1HNXQ 4J15A 1ASZA 5CV4A 4GKKL 3QOLA 1EQTA 3MXUA 2K7VA 1YNNC 4A3BH 3DWAA 3RMHA 5EQ0A 2F0LA 1JCKB 4ODGA 5K5PA 1HZBA 4YCWA 1LT6D 1IBLQ 1MGSA 3RR5A 5JPMC 2BDNA 1YIJA 1XNQL 3PO3B 1W6KA 2CQAA 2F0DA 5GADC 2RDFA 3SDZA 5FK9C 2B2UA 4DAYA 4JI7Q 4BY7B 3S1RH 3S2DB 4EQ5A 1YJNA 4X3TA 1KRSA 1FNUA 2WV6D 4UAIA 4DV6L 1HA6A 4LF4L 1VQ5A 1GVPA 1CM9A 2PW5A 4A75A 1A15A 2R92H 1O80A 2F4VQ 3PGZA 4XYOA 1GO3E 3PUYA 3HG9A 1XTCD 3U9SA 2F0JA 3GO5A 3HZXA 4ULLA 4Z9CB 3M85A 3D3RA 4AIMA 1LTLA 3J81j 4DR3L 4LF5L 3L0OA 4JBWA 1IBKL 2R6GA 2O4XA 4QF4A 2PMZB 2N8NA 1JWMD 1FJGL 1O7YA 1CHPD 2R3ZA 2XGTA 3HOWG 1I50H 3DWPA 1EY6A 3E3XA 2E74C 1NTGA 3I3CA 3QO2A 5M5XH 3PIO3 4OO1G 2B8FA 4R4CA 2A6HC 1QCBD 3S9WA 4DR5Q 3Q8DA 1CT1D 2NWGA 5ELBA 2A5HA 4DR6L 1DGSA 3RUZA 4POGA 1SXTA 5IP7H 2H1EA 2IW3A 4A3FH 4RGTA 3J7YW 2CVRA 2TMPA 2EOTA 2B63G 1WJJA 5LMNW 2JE6I 1BCPD 3OSOA 1BDOA 2YU9H 1K8GA 1Q12A 4K0KL 1QUQB 5ELOA 4LF8L 2V1CC 2R7ZB 5JJIA 2NN6I 1GUGA 4ZK9B 2B2WC 2J7ZA 4BY1H 3I70A 3VR3A 2RDGA 3QB3A 1IBML 2ZJQA 4HSVA 1S5FD 1KRTA 5HY6A 5FOBB 2FMCA 2L1BA 2ZTDA 5IYCG 3T51B 1X6OA 1KDBA 1SNOA 2JA7H 1PA6A 3CW2C 1IW7C 4JPBW 5JVH3 1FNVA 2CHBD 4C3IB 2KCTA 1I3QH 4A76A 1V1PA 2M00A 4A3BB 1F9QA 4PZ6A 3D31A 3L2PA 1UE5A 1XWEA 4GN3B 3MXGA 3TZDA 4DPGA 3HOUH 2MQHA 3SVMA 4CDDC 1EEFD 4DV5L 4P2CB 4DN4M 4JI2Q 2YTXA 4FO2A 1XMOL 2QW7A 1EZ8A 3NWTA 1CKNB 1C0AA 1BBXC 1KNAA 3UE0A 1E3PA 1STNA 2MNAA 2A8VA 1WOCA 2IHFA 2DUDA 3NUCA 3RD4A 4RG1A 2QGQA 2PMZE 1I94L 4OHJA 4HIKA 5M3MH 1HZ9A 4H44C 3A56A 1NUCA 4B3SL 2XWJB 1SNQA 4RA8A 5EPJA 2D62A 3C3LA 4X66Q 1GUOA 3OTOL 2SOBA 4KI0A 3NWSA 3I72A 3LWUA 4B3TL 1XJVA 3CMEA 1EUJA 2JYOA 1WTOA 1HR0L 3ONAB 5CV5A 3J80E 1VQBA 1W2BA 1UNSA 2WINB 1HCZA 2L12A 1VF5C 3AFQA 1N36Q 3PV0A 2VUMB 4A3FB 4BBSH 2OQ0A 4DK3C 4DR4L 2Z8LA 1OXVA 3MXNA 4BS9A 4H0LC 3UDIA 2H4OA 3S2HB 3EROA 2Q2HA 2JQOA 2EVBA 5EBCA 4KN4C 4X64L 1ET6A 2KOLA 2CWPA 3T53B 2E2JH 3IAYA 2D0PA 4KJNA 4MNOA 4DF7A 3K5MA 4MTNA 2VY3A 4XXEA 2VNUD 3PUXA 1DOMA 4UP8A 1TS2A 4O0AA 5ISRA 3PIP3 1PFSA 3OYYA 2F1MA 5M3FB 2YYZA 2EYLA 3J81E 2JA7B 5GQOA 5FJ8G 5LL6X 3ICEA 1GHJA 1SN8A 1FGUA 3I8ZA 1K28A 3GV3A 1JE5A 4CBVA 2EE1A 1X56A 4IFDI 4MN3A 1WTQA 1WCMH 2WKCA 2R7FA 4DUYQ 1JICA 4GN4B 3ZYYX 1TWFH 3HOUB 3T16A 1ET9A 2UUCL 4KHZA 1IZ6A 2FHTA 5GAHC 3CCRA 5C5LA 1N32Q 1EQRA 2L15A 4DR2L 5EAYA 4GLVB 3NBHB 1K8MA 5CV6A 2B2WA 1RTNA 3QG1A 3RLFA 1AFPA 5EPLA 4JI8Q 1A0IA 3FKIH 5KGUA 1HNZQ 1G2SA 2TSSA 4JW0A 1OXSC 2KHJA 2NN6G 2CCZA 3GTGH 3VDYA 1B44D 1I6HH 1UE6A 2ZTEA 2RSNA 3VR2A 3D4WA 4OXPA 5I6YA 2FFKB 3SR1A 5LMUQ 4B3RQ 4NKLA 3EN2A 3PSIA 2I5LX 4LAAA 3IRBA 1RODA 5GAGC 2MO1A 1SE3A 2DGYA 1TIID 3NTIA 4P73A 1XYIA 4QCLA 1RCVD 3KLSA 4YWMA 5DEHA 5IWAQ 5C44G 1K8OA 2PI2E 2K5VA 1JQYD 3OHXC 1TWGH 1XX8A 1VQ8A 4XYQA 2F3IA 2KECA 2UU9Q 1SYCA 3K7UC 1Q7YC 4XQJA 2C35B 3M4PA 3V2TA 2N55A 1EIYB 5AJ3Q 4K6LA 1OO9B 1F2MA 1IKMA 1CK1A 1J5EQ 4GLAC 4JI6L 2HHHQ 2F0PA 3I4MG 4A93G 3BU2A 1I4RA 1CKNA 1CA5A 4JI4L 3SEBA 4A3MB 1I4QA 2NVTH 1JJ2A 5I2YA 1ENFA 2E2JB 4HTHA 4KV6A 1LABA 4C3HH 1VQ9A 5EKKA 2B2VC 1SFOB 3N6RA 4OIKA 4LF7Q 5JEAH 4OWTB 2HQLA 3KYHC 4KY7A 1IL2A 4A3EB 1U5KA 2HUGA 3ULJA 3TP5A 1S72A 1V43A 1LTBD 4RWSC 2QILA 1YNJD 4ZAIA 1PH6A 1J6QA 4IUQA 2Q2UA 1LUZA 1AE2A 5CV9A 5C6AA 1WI5A 4NXMQ 4GS3A 1X65A 1ML0D 2Y0SG 1PTOF 1BNZA 2M9VA 5GROA 2A1AA 1H9RA 2AQ3B 4PMBA 4GKJQ 3RZOH 1F9RA 4WJ4A 2N3SA 1SMXA 1A62A 1UWVA 1TT2A 4LFBQ 2XRQD 1K83H 4O2DA 2A69D 3GTJH 4DXGA 2F0EA 3D6WA 5T1GA 3CHBD 1NSNS 2SDFA 3Q6SA 4CHTB 5IYDG 3GTLH 4OELB 3STBC 2EY6A 1BR9A 2AWOA 2F03A 1U4MA 2OT2A 3LNNA 3UDXA 1NR2A 2GA4B 2JA8G 4P75A 4ID6A 4FF1A 2R93H 2UXCL 3HOXH 1AW7A 3UE1A 4RGMA 3FKIB 4PMCA 3GTGB 3A8IE 3CCEA 3T1HL 5FLXE 4BBRH 5KYLA 3GTMH 1RHPA 4ZKBB 4IOAA 4QJFA 1HUMA 1O7LA 2F0MA 4YWKA 1PLFA 1MIUA 4K5VA 4LF9L 5E1FA 3H0GH 2R61A 1VDZA 3FRPB 3GD7A 2D5DA 3U4ZA 1AZPA 5EBDA 3E0JA 4GOPB 1B1ZA 1TR5A 2PYKA 4PMWA 3CC7A 1R9TH 4PG3A 4C3JB 3I4LA 3TSSA 4IFDG 3KF6B 3HOZH 1IKLA 3C46A 5EKIA 2D0OA 4GOPC 2AWNA 1KIXA 2EYFA 4HIOA 1EY8A 1Q81C 1VQ6A 1QOHA 2DNCA 3F2DA 5CR3A 2MGSA 5E4WC 4Q5VA 4NXNQ 3PCOB 2ATWA 3AMUA 3NBHA 1PTOB 1B7YB 3K57A 4DR1Q 1NE3A 2HQEA 5IIFA 4MHEA 3Q0AA 5E3FA 4AQYQ 3VYUA 2O5JC 1FNWA 1PTOC 5I9PA 3W5OA 1Q3LA 1BO0A 4RKBA 1DJRD 1OXUA 5ELEA 1S3OA 4JI1Q 1SLJA 3V05A 3NTKA 3D4RA 1X9NA 2BE5C 4K5XA 5FKAC 1MI2A 5LMNL 1YHQA 4DV1Q 4L6TB 4X62Q 3HKZB 5I6WA 5KIXA 4JYAQ 1HNWQ 4X6AH 1GKHA 3IFDA 1CZGA 3H15A 3CD6A 2MJ8A 3FDTA 2FXQA 2BH2A 3AQQA 1TY0A 1S5DD 3RZOB 1I5FA 2ZM6L 1Y1WB 1PYSB 4MZ9A 1K83B 4BY7H 4TKOB 3H3VI 4DV0L 1IHZA 1NBWA 3I91A 3KJPA 2IY5B 1EEID 2I46A 4BXXH 4Y7NH 1U4LA 4XT3B 1BXTA 3PQIA 1GXDC 4KTAA 4ZYSA 3CP0A 2E75C 2R93B 2EXZA 3C1EA 4IALA 2B2VA 4GNXB 3CCLA 1S4ZA 1B3QA 2Z6BA 4HJAA 3E6ZX 4OIJA 1TQOA 4DXFA 2RHQB 5G3LD 1Q8IA 2XRSD 4X3KA 3VYRA 2F0FA 2OCEA 4GNXC 4HSPA 3U4VA 1KQSA 1X3EA 3NEMA 4K5WA 5BN4A 4FXGC 3K5LA 2KEDA 2V4DA 3CRKC 3SGIA 1V8QA 2EQSA 1HUNA 4JI0Q 4XT1B 2PZTA 4PZ7A 1QNKA 5JAVA 4DV4L 3G48A 1WD1A 1JORA 4CDCC 3S1NB 4E6IA 2F0HA 4DA2A 4R4IA 3ERQA 1H9SA 2K4KA 5I2XA 1KDCA 2JA6B 2UXDL 5DNFA 4RHRA 1NMFA 2VQFL 2R92G 3NENA 1I4HA 1C9OA 2K5NA 2KCCA 4I65A 1CHQD 3V96A 1S40A 3FPUB 2R7ZH 2F0KA 5C3XA 2WP8J 2JEAI 4R1JA 3PO2B 1ICWA 4DAMA 1L0XB 1QZHA 4B3ML 5JJLA 3EA6A 4WJ3M 1A2UA 5KNBA 3S16H 1IBLL 1IYUA 1QG7A 1EWHA 1DONA 2NZ1D 2CW0D 2CFMA 1H9MA 2Z4IA 1BCPF 1E2VA 2K5QA 4OEMB 2JEBI 2K1BA 2VB3X 3HKZE 4LMQD 1PH4A 4K14A 1KLUD 2WB1B 1X3GA 2E2HB 3FP9A 1N8RC 1E24A 2AKWB 2F4VL 3FMCA 3BDLA 4A4IA 5IP7G 5CORA 2CH4A 1SE4A 3GV6A 4K8IA 3EJIA 2K05A 1H95A 1SNPA 1OXTA 4K8JA 4GOPA 4A3IH 5KEEA 4ZKCB 1MHWC 3MXNB 3KF6A 4LUVA 1QVFA 2AMCB 3G6EA 5E4XA 4DV2L 1XTDA 3ZJYC 2VZAA 4BY1G 1S5CD 1KXLA 4KY5A 2JA5G 4I7ZC 4QIWB 1XMQQ 2LS01 4Y7NB 2E8GA 3DHQA 4F87A 5IT9E 1PVOA 2ZXPA 2L5TA 1VF7A 2LSSA 4IZ8A 1QVGA 4CDEC 1L1OB 3OPOA 5CGKA 5C0XH 2UUBL 1L2FA 2AHOB 1KHIA 3A55A 2E5LL 2K5HA 1LTAD 2DNEA 3HEJA 5EKLA 1K8AC 2F3VA 1L1OC 2B2YC 4RCOA 1VQNA 5IGBA 1U4RA 3OWEB 3BVZA 1B53A 1STHA 2JK8A 1Q46A 3BDCA 1Q1EA 5C3EB 1PXUA 2LY7A 3TP7A 5LHY1 1SYGA 4DUZQ 2MHVA 1EY5A 2F0OA 2GVAA 4N9PA 1FL0A 2MPMA 1QNUA 2KVMA 2IL8A 1H9JA 1WFQA 2BA1A 3D0FA 3W1BA 4OX9Q 3RN2A 1BCPB 2VUMH 3S1MH 2I5MX 4FP5D 3ULLA 1Y8NB 1BUVT 4IURA 5CBAE 2RVLA 5HURA 4DV6Q 3WDNA 1BCPC 4O1NA 1YHBA 4V0BA 3S2HH 1JWUD 3J80c 1XPOA 3I4NG 4HIDA 1J8IA 2UXBQ 1BVSA 2XSCA 3H94A 4M1UB 5M3MG 1L0WA 3PIOA 2OTJA 2WAQB 1B8AA 1EU3A 1QILA 4ZUIA 1PH8A 3G7LA 2KEEA 4L5SA 1U4PA 3S16B 3RN5A 1I4XA 2PZUA 4ZUJA 3T1YQ 2WB1E 4A3JG 2B29A 4GNXA 5M3FH 3I73A 3BZDB 1EU4A 2HD3A 1C48A 4UPAA 4UY8C 3JAME 3E5SA 2BH8A 5KRUA 3NSWA 3HOYB 5IGGA 3SHLA 5JOBA 4KLKA 1VS0A 4GLXA 3NBIA 3CCUA 4CJ2C 1V1OA 1B50A 3DEOA 3TN2A 4BBSG 1RJTA 3AEVA 3S17B 4ZLTF 5CC4A 3J81c 1VQ7A 1H9KA 2KBNA 1YZ6A 4A3IB 1KLGD 2HCIA 1PYBA 2ZTCA 4ALPA 3LX0A 3MZ5A 4QIWE 5IY0A 4X66L 1KD1C 1HTLD 1VQDA 3KJOA 1M1KC 1CA6A 1E1OA 4OO1H 5CV7A 3PF4A 1F77A 2VL6A 2M2LA 3FVQA 2ICIA 1HH2P 1IBMQ 1EY4A 1Y8PB 1OXXK 3BJUA 3MFGA 1UE1A 1EOVA 1PZKD 4CDFC 4CJ0B 3RNUA 2EY1A 4RH6A 4EQNA 2YTVA 4S3SA 3K0XA 1EYAA 2QCPX 4JVZA 2MFIA 1SYDA 5A35A 4IQZA 5IYBH 2KHSA 2YV5A 3ULPA 2O2LD 2EXDA 1S5BD 4LF6L 2VQEQ 2B63H 3TZUA 3GTPB 1EFID 3I55A 5IODA 3KBGA 2XN9C 1WCMG 3NQIA 4C1NK 1PH9A 5FO7B 2E2DC 2RCNA 4HAEA 4QL5A 4YHHL 2SNSA 1ZXTA 3R2IA 4YCVA 1YHAA 1ONLA 4IUUA 3Q22A 2KCMA 1XMOQ 1FD7D 3S1MB 1IXRA 3M4YA 5IOCA 3HOVB 3BVGA 4OWXB 3A5ZB 1HHVA 3DXJC 1AEXA 5IGFA 2WAQE 5IP9G 2LKVA 2EJFC 1HTPA 1SJED 1CUKA 3OIPA 1I94Q 2B2TA 4A3MH 2Q2TA 1E2ZA 4A3KG 3BZCA 4X65L 4DUYL 1SFOH 1G2TA 1RL2A 1D8LA 4A3EH 4LFCL 1U9RA 4L8JA 1HFNA 2X6LA 3QJYA 3MFYA 1L1OA 2B2YA 1N32L 2IWHA 1LTID 1JJGA 4CJ1B 1GHKA 5A2QE 1HR0Q 1PH7A 3EIVA 1AP0A 1Q90A 4NPSA 2A73B 3K5OA 1DOKA 1EFWA 3GTQB 3W3AA 2K28A 4V190 1STGA 4JV5L 3HGBA 5LMUL 4B3RL 4HJ7A 1SRUA 3DEPA 5ELFA 4BA2I 1G51A 3PIPA 5D3DA 3HOWB 4X64Q 1WTPA 2XVSA 4P71A 4QB4A 1F9SA 4ME3A 4R4TA 3WOEA 5FO8B 5M5YH 2BCOA 2EIFA 2L9HA 3DM1A 5JEAJ 5IWAL 1EY0A 3TS0A 1G91A 1IYJB 3KF8B 4C3HG 5CYUA 5IGDA 4A3GG 3K7AH 1I4GA 1E2WA 3K5NA 1SSOA 3BZKA 1EYDA 1KTKA 2F0IA 2UU9L 3VA7A 4IPDA 1OTCA 1Q8KA 3LGJA 4QGUA 2VS1A 2B63B 3CQZH 1J5EL 3BVMA 4PQXA 2OTLA 2P5ZX 4YY3L 2HHHL 3DM3A 4JI5Q 3I4NB 2XTIA 3K8AA 3ER0A 1WTVA 1GUNA 5FLXc 1PH3A 1EIGA 4C3JH 5FLMH 2UUCQ 2HDMA 1ZYRD 3U50C 1ENCA 4I7AA 2F0TA 1T9HA 1XXGA 2DN8A 4ME5A 4DR2Q 2UUAQ 1PRTD 4NMZA 2EYPA 3SK4A 5J39A 1UEAB 2ZJPA 1G8ZD 1SR3A 4POFA 1RD9D 1CSPA 2LMCB 3HOXG 4DR7Q 1B4OA 4JOIC 4G7OC 4A3LG 1PTOH 4HCSA 2CQOA 1TKWB 4MTKA 4BBRG 3G4SA 2NVQB 2DY8A 1RDPD 2K50A 3ND8A 3I56A 1A3VA 1TVXA 3F2UA 1Y1VG 3H0GG 4C56C 2RSOA 1N34Q 4N8X1 1O7ZA 5IGEA 4IPGA 1SYBA 4EQPA 4L5RC 3K6OA 1Q1BA 1PMRA 2NVXB 3D8GA 1C8CA 3SK8A 4A3DG 1KC8C 2EYJA 1X3FA 1D5MC 4AYBG 5C4XG 2NTTA 3HOZG 2ES2A 4J8QA 3TRZA 1H9SB 2EY2A 2KENA 2A6ED 2QA4A 3MTSA 1Y1WH 1SAPA 4OGQC 1VMPA 4KN7C 3J80i 3PF5A 2L4NA 2IJ0A 2A69C 1FR3A 2G5DA 4HCEA 1E1TA 2CH4W 3BDOA 3CCQA 3J7AF 3CCVA 4WRDA 3HKSA 2RA4A 4JI4Q 2K6AA 1ILQA 1K0RA 5M5YB 3CCSA 1K0SA 2SNMA 1DD2A 1A3TA 3K7AB 1HFGA 1JOOA 5C4HA 4U68A 2PQEA 5JPNC 2E2IH 5DM73 1SBBB 4ZRZA 3M3YB 2RF4A 1WVLA 4DK1A 3DLLA 2K01A 2K52A 4RCNA 4LFAQ 2N88A 3CQZB 4RFBA 2B39A 2NTSA 3GTKH 4TRDA 3PO3G 3J81i 4JI3L 4FYDA 1CZWA 1STEA 2XWBB 3J80L 3S1NH 4UP9A 1STAA 4HJ5A 4DR1L 1VQOA 5G3LF 2IPKD 4AQYL 1AE3A 4BY7G 4K2KA 3NE5B 3TEHB 3CU7A 1HXYD 3K58A 2JA6H 5K36G 5T1IA 3E9IA 3MA2B 3VR6A 4L5QA 2WIIB 1KAAA 2PQAB 1EY7A 4JI1L 1EWIA 1Y69U 4BXXG 2CWAA 4JC0A 2B3GA 1SE8A 3FHWA 3QWNA 4LJZC 3L3OC 4DV1L 3PO2H 3CC2A 4FNFA 3SE0A 1VQJA 4HR7B 3C1FA 1HNWL 1F2LA 4KHVA 2H5XA 3A8KE 1LTGD 1EWCA 4RHSA 3KF8A 3AU7A 4RMFA 1AZQA 1NY4A 3I4OA 4FXKC 5M5WH 1PH5A 3TBIB 4QQBX 2JSOA 1VQKA 4FVMA 4FXDA 4H02A 4DV3Q 2E2HH 3J81L 2F4IA 3M4OB 5IYDH 4DGZA 1RTOA 3ITPA 2MO0A 3X3NA 3BYTB 4DFAA 3T13A 2OXPA 2JA8H 1N33Q 4KHPL 2Z6KC 3E9HA 4K2LA 4O42A 4BA1I 3C2PA 2K32A 3A74A 4G7HC 1YNXA 1VQIA 2N49A 2HCCA 3HRZC 1DYQA 2A68C 3PUVA 4RGNA 1TS4A 5EPKA 2R7ZG 4PV1C 2FJ2A 1A6XA 4EX5A 1A8VA 1BF4A 3OMGA 4JOIA 1VQPA 2GN5A 4JI0L 2IHEA 5C44B 2IX0A 1VQAA 1J9OA 1DCZA 5EGTA 5KNCA 1II3A 2JJQA 3CMAA 4M8AA 4IFDH 1A3UA 1WTHA 4C3IG 1D1KA 3Q24A 1EIHA 4ILWA 5NUCA 5LMNQ 1WTRA 2A74C 4A3BG 2E2IB 1XNRQ 4DKAC 2NZOA 1MSHA 4IUVA 4KKUA 2Q2IA 3NELA 5C3EH 1JOQA 1LTSD 5IT9c 3I4MB 4A93B 2C5CA 3GTKB 5BN5A 3KOJA 3S1QB 1KABA 1SNDA 1X3PA 2ASBA 2JXMB 1MKHA 4FF2A 4DV7Q 4YIJA 4TQUS 1F9PA 4IPCA 1TWHH 2VXWA 3CAMA 1LTTD 5J22A 2ZT9C 4DNTB 1MJEA 1SE2A 2J4XA 2RKSA 3HP3A 5AFWA 1JB7A 1C4QA 1Y1VB 3CPFA 5IE8A 1HNXL 2AQ1B 3NQTA 1D5ZC 3G71A 1TU2B 4IPHA 1K3RA 3X3MA 2G9HD 1KNEA 5C0XJ 1SMYD 1EQVA 3T4AC 1TWAB 2WACA 1VQEA 4JG2A 1A63A 2EDGA 3DWQA 4Y52H 1UAPA 3KUPA 4NW2A 2EY5A 1QJOA 1MSGA 2Y0SB 2X6GA 3SXHA 4HN7A 1LLRD 3ERSX 1CTMA 3QR8A 2F0WA 5M5WB 4H7BA 3KDFA 4F7XA 4JI7L 1JMCA 2QEXA 1WD0A 2NVYB 1HRJA 3GP7A 3HOYH 3DUZA 2KA7A 2N78A 2AQ2B 4ZCKA 3RZDB 1EY9A 3F8TA 2HIXA 4CKEA 5BR8Q 3TQYA 5I9OA 2ALYB 3SK6A 5IGCA 1PFBA 3TREA 4CKCA 2JA8B 3L9AX 2EJMA 2WKDA 2VUMG 4A3FG 3NHHA 2K75A 3S17H 5DLQE 3GDEA 3KFUA 2K03A 3JAMc 2VQFQ 4C2MH 2DJFC 1B2TA 1YITA 3O13A 1EYGA 1YNND 3CF5A 2Z9HA 1EZ6A 4NDXA 2VW9A 2PQAA 1MJCA 1JOKA 4LWCA 4B3MQ 2A19A 4QUCA 1ICFB 4DR5L 2KQ3A 5LL6S 4DUZL 1XPUA 2B2TC 4H13C 4IJLA 5C3WA 5M3FG 2JA7G 4OX9L 1I4PA 2LFNA 4XTCS 4GKKQ 2LXKA 5FLXL 1ESRA 2Q8RE 3GTPH 1QB5D 1UEBA 5E7NA 2HDLA 5M9OA 1E22A 4LW1A 4A3CH 2Z6KA 2UXBL 4N9TA 1I6VC 1XNQQ 3HOUG 3OWFA 2Q8TA 1JT8A 1HQRD 1U0LA 3M7NA 3FEWX 1NMGA 4XQQA 1TWHB 1WTWA 1K3BC 3E0EA 1JC7A 3T1YL 4DV2Q 3HOVH 4HIMA 3OOCA 4UDUC 3TMEA 4LF4Q 3URYA 3K81C 4KD4A 1D1IA 2A6HD 4XDXA 5C4JH 4FF3A 1QZGA 1Z9FA 3NPPA 4AYBE 3EFXD 2Y0SE 1CQVA 2AUKA 4PNYA 4DR3Q 4LF5Q 2KCNA 3B6YA 1IBKQ 3KBXA 2K33A 4DK6C 2UUBQ 2IX3A 1SYEA 3N52A 3TP8A 5IYBG 2E5LQ 1T5XD 4B9XA 1FJGQ 3U9OA 4LUZA 1F2ZA 1ASYA 3S15B 2OF1A 1VQFA 4JI2L 3IFTA 2ID0A 1B70B 4JK1C 4DR6Q 1R4QB 2JA5H 1TWCH 1L0YB 4WFN3 2EYOA 5BN3A 1EOTA 3A8JE 3R93A 4F88A 4RAUC 4XQNA 1VMCA 3GTQH 1CQFA 3PMFA 1YJWA 2NUCA 3LWEA 2Q8IB 1YBYA 1YJ9A 4HEDA 1IW7D 4IJHA 1CSQA 4KKTA 3OMCA 2IX1A 1RKNA 4C2MB 4K0KQ 4NP5A 4K6DA 1ZKOA 2VQEL 3HOWH 4LF8Q 1LT5D 3M4QA 1PZID 2OWOA 1W3SA 1PDQA 4A3MG 5ELNA 4WJWA 1YEZA 3S14H 3UI2A 4WORA 1D7QA 1LM0A 1JB3A 2I5HA 1CKOA 1ZEQX 3VR4A 3R3OA 1S5ED 4LNQA 4P72A 3EQLC 4A3EG 1M90C 2FMMA 1LTRD 1SDFA 1N36L 3MAQA 1B9MA 1AN8A 3S1RB 1RIPA 3I2ZA 2JP1A 1DOLA 3UDFA 2R92B 1JR0D 3WOFA 3EVQA 3NK9A 3H3VH 2I0QA 3I4NH 4IUTA 1K9MC 3PUZA 1KDAA 3D4DA 4G57A 5D14A 5TSSA 1NJIC 5HGTA 2HT1A 1UE7A 2RHSB 2NBFA 3T56B 4DV5Q 1X3QA 1HZAA 3DMUA 4ABNA 2D9UA 3MC0B 4A3JH 4DK0A 5IYCH 5I4DA 1I50B 1VQMA 1EYCA 1FVIA 1M8AA 2K5DA 1NAPA 5M5XB 1DM0B 5CMDA 2F0SA 1JWSD 5C4JB 3FKIG 5F2DA 1E0BA 2OQKA 5J1ZA 2YTYA 1GD7A 3AB9A 2ZXOA 4B3SQ 2NVQH 5KYIA 1NCVA 1PRTF 4LF6Q 1O7IA 2IT1A 2EYMA 3OTOQ 1Y14B 3A5UA 3P20A 1FGBD 1GOZA 2EZVA 3WWVA 2YU9B 4B3TQ 2RCFA 4KJOA 2NVXH 3OW7A 3M7GA 4J6HA 1UUPA 3I90A 4YHHQ 4BY1B 4C3JG 5FLMG 2JA5B 2K14A 1TWCB 3J7A5 2K5WA 3IL8A 4JI8L 4QY7A 1PZJD 1HNZL 4G7ZC 3R8BA 4DR4Q 4OWWB 1JJCB 1WYDA 3JC66 4PZ8A 3MEFA 4HJ9A 2EJGC 1GM5A 1MBYA 1I3QB 5C5MA 2F0UA 2QDBA 3A0JA 1QE6A 4DNIA 4L5TA 4JI5L 4X3UA 4F8MA 4OL7A 1M4VA 4RKLA 4X65Q 2ZJRA 4EQOA 3S14B 4TSSA 1TS5A 3CRLC 1STYA 2ZXRA 3MHBA 4GZYC 3G6JB 5CV8A 5JEAG 4UP7A 5IT9L 4LFCQ 4KY6A 1K73C 3MWYW 4QMGA 2F52A 1SNCA 2UUAL 3M3YH 2QF7A 1PFMA 3HKZG 5CBEE 5AJ3L 2HIVA 2NYZD 1PHJA 3H09A 1R4PB 3FPPA 5D65A 1QUQA 1HPCA 5IP9H 3HS0C 1Y8OB 4JBMA 3NXWA 2D2CC 1VQLA 4DR7L 2F0QA 4DU9A 1KAWA 3NP8A 2E76C 3JAMi 5M3MB 3OW2A 5L37A 4JV5Q 1Y1WG 4A3KH 3H3VC 1PRTB 1ZYRC 1LACA 3IKJA 1Q86C 1N9WA 4LF7L 1PRTC 4A3JB 2F0GA 2SEBD 1TY2A 1X32A 4LK1C 1N34L 3KLRA 3EBEA 5FJ8H 1GJXA 2R93G 2X69A 2RDHA 2QEJC 5DAUA 1GUSA 2XIWA 2F3WA 4NXML 2FINB 1QWYA 4X3SA 2ICEC 4GKJL 2PNRC 4BBSB 1AH9A 1HZCA 4LFBL 1ESFA 3M9BA 4J1MA 3GTOH 1PH2A 4YY3Q 2EPBA 2XNAC 4FDBA 3M4OH 4IN3A 1YNJC 3J7ZC 3JAML 5JVG3 4QUFA 5COYA 1EL0A 1SROA 2PW7A 3KLSX 1DXMA 3RLNA 4BWGB 4C1NI 1HQMC 1LYLA 3P75A 5KNDA 3P7JA 3BS1A 4A3GH 4P74A 2R7DA 4KMUC 2JA6G 2NN6H 3AYHB 2G9DA 3W2DA 2A6EC 3VYTA 4IUPA 3VYSA 4JI6Q 2KUMA 2PCFB 3PO2G 3MVVA 1E7ZA 2PPBC 4LFAL 3GQBA
chains in the Genus database with same CATH topology
1W6JA 3VA5A 2DY7A 1ENAA 5C0XI 3SK5A 1WCMB 1WTXA 5JJZA 2C9OA 2F0VA 1TWFB 1DZ1A 1O78A 1B9NA 5ELDA 3BG3A 4EGVA 1FYCA 4U673 3L7ZC 1CI3M 4ZQ3A 1IYVA 1RF2D 4R8IA 1LO5D 3CKIB 1CFMA 3J7AV 4L63B 1SEBD 1D5XC 5ELCA 1I6HB 4A3KB 1LT3D 1SJHD 2I07B 1B3AA 4B08A 1Z47A 1STBA 4IFDJ 3PUWA 2NB0A 1TWGB 1D6EC 2BDOA 4R8NA 3BYYB 2MUYA 3H91A 2VB2X 4HMJA 2ENBA 1SNMA 1SYFA 2L11A 2B2UC 2B8GA 1Z7TA 4HMIA 4Q0FA 3GTOB 2BA0A 2F0NA 3TP6A 1TS3A 5A2QL 4DAPA 2PO4A 4CGYB 1D2BA 4CKBA 2NVTB 4R9WA 1G291 1PTOD 1BOSA 3MXPA 4C3HB 4A3GB 1PFNA 3K59A 4KKSA 1MD2D 2BE5D 4OO1I 2MP1A 3D6CA 1NR4A 1A2TA 3TDQA 3P1HA 2RQXA 1ILPA 5DM63 1GUTA 1LV9A 3KK7A 2Z1CA 2A68D 4XIGS 3GTJB 5K36H 3A54A 1LT4D 2O5IC 3GTLB 5D3IB 2EYHA 3ND9A 1F2YA 5FO9B 3HOXB 4FF4A 3A7LA 3A7AB 1G6ZA 5C4ZA 4KK7A 4BBRB 3NTHA 3GTMB 1IL8A 2QKIC 4KD3A 4DAVA 4RGOS 1GUWA 2BOSA 1V1PB 3MEHA 3Q23A 1JE4A 3R2TA 1Z6HA 3H0GB 3QIAA 3VR5A 1PYWD 4EVOA 1SMYC 1VCIA 3K0YA 4A3DB 1R9TB 2K04A 2AUJD 5C0XG 4AYBB 5C4XB 3HOZB 4B9WA 2Z4HA 3OIQA 4IUNA 2CW0C 2OEOA 3QOJA 2L55A 2J0TD 2KJXA 2L0CA 4MIUA 1HA5A 4G4KA 2RBMA 1BQQT 3H6MA 1T5EA 2PZWA 5EJWA 4DNRB 5CV4A 3QOLA 1EQTA 3MXUA 2K7VA 1YNNC 3DWAA 3RMHA 5EQ0A 2F0LA 1JCKB 4ODGA 5K5PA 1LT6D 1MGSA 5JPMC 2BDNA 3PO3B 1W6KA 2CQAA 2F0DA 2RDFA 3SDZA 5FK9C 2B2UA 4DAYA 4BY7B 3S2DB 4X3TA 1FNUA 2WV6D 4UAIA 1HA6A 1CM9A 2PW5A 1A15A 1O80A 4XYOA 3PUYA 3HG9A 1XTCD 3U9SA 2F0JA 3GO5A 3HZXA 4ULLA 4Z9CB 3M85A 3D3RA 4JBWA 2R6GA 2O4XA 4QF4A 2PMZB 1JWMD 1O7YA 1CHPD 2R3ZA 3DWPA 1EY6A 2E74C 3PIO3 3I3CA 3QO2A 4OO1G 2B8FA 2A6HC 1QCBD 3S9WA 1CT1D 2NWGA 5ELBA 2A5HA 3RUZA 1SXTA 2H1EA 2IW3A 4RGTA 3J7YW 2CVRA 2TMPA 2EOTA 2JE6I 1BCPD 3OSOA 1BDOA 1Q12A 2R7ZB 2NN6I 1GUGA 4ZK9B 2B2WC 2J7ZA 3I70A 3VR3A 2RDGA 3QB3A 4HSVA 1S5FD 5FOBB 2FMCA 2L1BA 3T51B 1KDBA 1SNOA 1IW7C 5JVH3 1FNVA 2CHBD 4C3IB 1V1PA 2M00A 4A3BB 1F9QA 3D31A 1XWEA 3MXGA 3TZDA 3SVMA 1EEFD 4P2CB 4DN4M 4FO2A 1EZ8A 3NWTA 1BBXC 1KNAA 1STNA 3NUCA 3RD4A 4OHJA 4H44C 3A56A 1NUCA 2XWJB 1SNQA 4RA8A 5EPJA 2D62A 3C3LA 1GUOA 2SOBA 4KI0A 3NWSA 3I72A 3LWUA 2JYOA 1WTOA 3ONAB 5CV5A 3J80E 1UNSA 2WINB 1HCZA 2L12A 1VF5C 3PV0A 2VUMB 4A3FB 2Z8LA 1OXVA 3MXNA 4BS9A 4H0LC 2H4OA 3S2HB 3EROA 2EVBA 5EBCA 4KN4C 1ET6A 2KOLA 3T53B 3IAYA 4KJNA 4DF7A 3K5MA 4XXEA 2VNUD 3PUXA 1DOMA 1TS2A 5ISRA 3PIP3 2F1MA 5M3FB 2YYZA 2EYLA 3J81E 2JA7B 5LL6X 1GHJA 3I8ZA 3GV3A 4CBVA 2EE1A 4IFDI 4MN3A 1WTQA 2WKCA 1JICA 3ZYYX 3HOUB 3T16A 1ET9A 4KHZA 2FHTA 5C5LA 1K8MA 5CV6A 2B2WA 1RTNA 3QG1A 3RLFA 1AFPA 5EPLA 5KGUA 1G2SA 2TSSA 1OXSC 2NN6G 1B44D 2RSNA 3VR2A 3D4WA 5I6YA 2FFKB 3SR1A 4NKLA 4LAAA 1RODA 1SE3A 1TIID 3NTIA 1XYIA 4QCLA 1RCVD 3KLSA 5DEHA 1K8OA 1JQYD 3OHXC 1XX8A 4XYQA 2KECA 1SYCA 4XQJA 3V2TA 2N55A 4K6LA 1OO9B 1F2MA 1IKMA 1CK1A 2F0PA 1I4RA 1CA5A 3SEBA 4A3MB 1I4QA 5I2YA 1ENFA 2E2JB 4HTHA 4KV6A 1LABA 5EKKA 2B2VC 1SFOB 3N6RA 4OIKA 5JEAH 4KY7A 4A3EB 2HUGA 3TP5A 1V43A 1LTBD 4RWSC 2QILA 1YNJD 4ZAIA 4IUQA 5CV9A 5C6AA 1ML0D 1PTOF 1BNZA 2M9VA 1H9RA 2AQ3B 4PMBA 1F9RA 1TT2A 2XRQD 2A69D 4DXGA 2F0EA 3D6WA 5T1GA 3CHBD 1NSNS 2SDFA 3Q6SA 4CHTB 2EY6A 1BR9A 2AWOA 2F03A 1U4MA 2OT2A 3LNNA 1NR2A 2GA4B 4ID6A 4FF1A 1AW7A 4RGMA 3FKIB 4PMCA 3GTGB 3A8IE 5FLXE 5KYLA 1RHPA 4ZKBB 1HUMA 1O7LA 2F0MA 1PLFA 4K5VA 5E1FA 2R61A 1VDZA 3FRPB 3GD7A 2D5DA 1AZPA 5EBDA 3E0JA 1B1ZA 1TR5A 2PYKA 4PMWA 4C3JB 3I4LA 3TSSA 4IFDG 1IKLA 3C46A 5EKIA 2AWNA 2EYFA 1EY8A 1QOHA 2DNCA 5CR3A 2MGSA 5E4WC 4Q5VA 3AMUA 3NBHA 1PTOB 3K57A 2HQEA 5IIFA 4MHEA 3Q0AA 5E3FA 3VYUA 2O5JC 1FNWA 1PTOC 5I9PA 1Q3LA 1BO0A 4RKBA 1DJRD 1OXUA 5ELEA 3V05A 3NTKA 3D4RA 2BE5C 4K5XA 5FKAC 1MI2A 4L6TB 3HKZB 5I6WA 5KIXA 3IFDA 1CZGA 2MJ8A 3FDTA 1TY0A 1S5DD 3RZOB 1Y1WB 1K83B 4TKOB 1IHZA 3I91A 1EEID 2I46A 1U4LA 4XT3B 1BXTA 1GXDC 4KTAA 4ZYSA 2E75C 2R93B 2EXZA 3C1EA 4IALA 2B2VA 1S4ZA 3E6ZX 4OIJA 1TQOA 4DXFA 5G3LD 1Q8IA 2XRSD 4X3KA 3VYRA 2F0FA 4HSPA 4K5WA 5BN4A 4FXGC 3K5LA 2KEDA 2V4DA 3CRKC 1HUNA 1V8QA 4XT1B 2PZTA 1QNKA 5JAVA 1WD1A 1JORA 3S1NB 4E6IA 2F0HA 4DA2A 3ERQA 1H9SA 5I2XA 1KDCA 2JA6B 5DNFA 4RHRA 1I4HA 2KCCA 4I65A 1CHQD 3V96A 3FPUB 2F0KA 5C3XA 2WP8J 2JEAI 3PO2B 1ICWA 1L0XB 3EA6A 1A2UA 5KNBA 1IYUA 1QG7A 1EWHA 1DONA 2NZ1D 2CW0D 1H9MA 2Z4IA 1BCPF 1E2VA 2K5QA 2JEBI 2K1BA 2VB3X 4LMQD 4K14A 1KLUD 2WB1B 2E2HB 3FMCA 3BDLA 5CORA 1SE4A 3GV6A 4K8IA 3EJIA 2K05A 1SNPA 1OXTA 4K8JA 5KEEA 4ZKCB 5E4XA 1S5CD 4KY5A 4I7ZC 4QIWB 2LS01 4Y7NB 3DHQA 4F87A 5IT9E 2ZXPA 2L5TA 1VF7A 4IZ8A 3OPOA 5CGKA 5C0XH 3A55A 1LTAD 2DNEA 3HEJA 5EKLA 2F3VA 2B2YC 4RCOA 5IGBA 1U4RA 3OWEB 3BVZA 1B53A 1STHA 3BDCA 1Q1EA 5C3EB 1PXUA 2LY7A 3TP7A 5LHY1 1SYGA 2MHVA 1EY5A 2F0OA 4N9PA 2MPMA 1QNUA 2KVMA 2IL8A 1H9JA 2BA1A 1BCPB 4FP5D 1Y8NB 1BUVT 4IURA 5CBAE 2RVLA 5HURA 3WDNA 1BCPC 4O1NA 4V0BA 1JWUD 1J8IA 2XSCA 3H94A 4M1UB 2WAQB 1EU3A 1QILA 4ZUIA 3G7LA 2KEEA 1U4PA 3S16B 1I4XA 2PZUA 4ZUJA 3I73A 3BZDB 1EU4A 1C48A 3JAME 3E5SA 5KRUA 3NSWA 3HOYB 5IGGA 3SHLA 5JOBA 3NBIA 4CJ2C 1V1OA 1B50A 3DEOA 3TN2A 1RJTA 3S17B 4ZLTF 5CC4A 1H9KA 4A3IB 1KLGD 2HCIA 3LX0A 3MZ5A 1HTLD 1CA6A 4OO1H 5CV7A 1F77A 3FVQA 2M2LA 2ICIA 1EY4A 1Y8PB 1OXXK 3MFGA 4CJ0B 1PZKD 2EY1A 4RH6A 4EQNA 4S3SA 1EYAA 2QCPX 1SYDA 5A35A 4IQZA 2KHSA 2O2LD 1S5BD 3TZUA 3GTPB 1EFID 5IODA 3KBGA 2XN9C 3NQIA 4C1NK 5FO7B 2E2DC 4HAEA 2SNSA 1ZXTA 3R2IA 1ONLA 4IUUA 3Q22A 1FD7D 3S1MB 3M4YA 5IOCA 3HOVB 3BVGA 1HHVA 3DXJC 1AEXA 5IGFA 2LKVA 2EJFC 1HTPA 1SJED 3OIPA 2B2TA 1E2ZA 1G2TA 1U9RA 4L8JA 1HFNA 2X6LA 3QJYA 3MFYA 2B2YA 2IWHA 1LTID 4CJ1B 1GHKA 5A2QE 1AP0A 1Q90A 2A73B 3K5OA 1DOKA 3GTQB 3W3AA 2K28A 4V190 1STGA 3HGBA 3DEPA 5ELFA 4BA2I 5D3DA 3HOWB 1WTPA 2XVSA 4QB4A 1F9SA 3WOEA 5FO8B 2BCOA 2L9HA 3DM1A 5JEAJ 1EY0A 1G91A 4C3HG 5CYUA 5IGDA 1I4GA 1E2WA 3K5NA 1SSOA 1EYDA 1KTKA 2F0IA 3VA7A 2B63B 3BVMA 4PQXA 3I4NB 1WTVA 1GUNA 1EIGA 2HDMA 1ZYRD 1ENCA 2F0TA 1XXGA 2DN8A 4ME5A 1PRTD 4NMZA 2EYPA 3SK4A 5J39A 1UEAB 1G8ZD 1RD9D 2LMCB 1B4OA 4G7OC 1PTOH 4HCSA 1TKWB 2NVQB 2DY8A 1RDPD 3ND8A 1A3VA 1TVXA 3F2UA 4C56C 2RSOA 1O7ZA 5IGEA 1SYBA 4EQPA 3K6OA 1Q1BA 1PMRA 2NVXB 3D8GA 1C8CA 3SK8A 2EYJA 1D5MC 2NTTA 4J8QA 1H9SB 2EY2A 2A6ED 3MTSA 1SAPA 4OGQC 1VMPA 4KN7C 2L4NA 2IJ0A 2A69C 1FR3A 4HCEA 3BDOA 3J7AF 4WRDA 2RA4A 2K6AA 1ILQA 5M5YB 2SNMA 1DD2A 1A3TA 3K7AB 1HFGA 1JOOA 5C4HA 4U68A 2PQEA 5JPNC 5DM73 1SBBB 4ZRZA 3M3YB 1WVLA 4DK1A 2K01A 4RCNA 2N88A 3CQZB 4RFBA 2B39A 2NTSA 4TRDA 4FYDA 1CZWA 1STEA 2XWBB 3J80L 1STAA 5G3LF 2IPKD 4K2KA 3NE5B 3CU7A 1HXYD 3K58A 5K36G 5T1IA 3MA2B 3VR6A 2WIIB 1KAAA 1EY7A 1Y69U 3QWNA 4LJZC 3L3OC 4FNFA 3SE0A 4HR7B 3C1FA 1F2LA 4KHVA 3A8KE 1LTGD 1EWCA 4RHSA 3KF8A 3AU7A 1AZQA 4FXKC 3TBIB 2JSOA 4FVMA 4FXDA 3J81L 2F4IA 3M4OB 4DGZA 1RTOA 3ITPA 3X3NA 3BYTB 4DFAA 3T13A 2OXPA 4K2LA 4O42A 4BA1I 3C2PA 2K32A 4G7HC 2HCCA 3HRZC 1DYQA 2A68C 3PUVA 4RGNA 1TS4A 5EPKA 1A6XA 4PV1C 2FJ2A 1BF4A 3OMGA 5C44B 2IX0A 1J9OA 1DCZA 5EGTA 5KNCA 1II3A 4M8AA 4IFDH 1A3UA 4C3IG 1D1KA 3Q24A 1EIHA 4ILWA 5NUCA 1WTRA 2A74C 2E2IB 1MSHA 4IUVA 4KKUA 1JOQA 1LTSD 3I4MB 4A93B 2C5CA 3GTKB 5BN5A 3S1QB 1KABA 1SNDA 1X3PA 2JXMB 4FF2A 4YIJA 4TQUS 1F9PA 2VXWA 1LTTD 5J22A 2ZT9C 4DNTB 1SE2A 2J4XA 2RKSA 3HP3A 5AFWA 1C4QA 1Y1VB 2AQ1B 3NQTA 1D5ZC 1TU2B 3X3MA 2G9HD 1KNEA 5C0XJ 1SMYD 1EQVA 3T4AC 1TWAB 2WACA 2EDGA 3DWQA 1UAPA 3KUPA 4NW2A 2EY5A 1QJOA 1MSGA 2Y0SB 2X6GA 3SXHA 4HN7A 1LLRD 1CTMA 2F0WA 5M5WB 4H7BA 4F7XA 1WD0A 2NVYB 1HRJA 3GP7A 3DUZA 2KA7A 2AQ2B 3RZDB 1EY9A 4CKEA 5IGCA 5I9OA 3SK6A 1PFBA 4CKCA 2JA8B 3L9AX 2EJMA 2WKDA 3NHHA 2K03A 1B2TA 3O13A 1YNND 1EZ6A 4NDXA 1JOKA 4QUCA 2KQ3A 5LL6S 2B2TC 4H13C 5C3WA 1I4PA 2LFNA 4XTCS 5FLXL 1ESRA 2Q8RE 1QB5D 2HDLA 5M9OA 4N9TA 1I6VC 3OWFA 2Q8TA 1HQRD 3M7NA 3FEWX 4XQQA 1TWHB 1WTWA 1JC7A 3OOCA 4UDUC 3TMEA 3URYA 4KD4A 1D1IA 2A6HD 4XDXA 4FF3A 3NPPA 3EFXD 1CQVA 2AUKA 4PNYA 2KCNA 3KBXA 2K33A 2IX3A 1SYEA 3N52A 3TP8A 1T5XD 4B9XA 3U9OA 1F2ZA 3S15B 2OF1A 3IFTA 2ID0A 4JK1C 1R4QB 1L0YB 4WFN3 5BN3A 2EYOA 1EOTA 3A8JE 3R93A 4F88A 4RAUC 4XQNA 1VMCA 1CQFA 3PMFA 2NUCA 3LWEA 2Q8IB 4HEDA 1IW7D 4KKTA 3OMCA 2IX1A 1RKNA 4C2MB 4NP5A 4K6DA 1ZKOA 1LT5D 1PZID 1PDQA 4WJWA 3UI2A 4WORA 1JB3A 1ZEQX 3VR4A 3R3OA 1S5ED 3EQLC 2FMMA 1LTRD 1SDFA 3MAQA 1B9MA 1AN8A 3S1RB 2JP1A 1DOLA 2R92B 1JR0D 3WOFA 3EVQA 3NK9A 4IUTA 3PUZA 1KDAA 3D4DA 4G57A 5D14A 5TSSA 5HGTA 3T56B 2NBFA 1X3QA 3DMUA 4ABNA 2D9UA 3MC0B 4DK0A 5I4DA 1I50B 1EYCA 1M8AA 2K5DA 1NAPA 5M5XB 1DM0B 5CMDA 2F0SA 1JWSD 5C4JB 5F2DA 1E0BA 5J1ZA 3AB9A 2ZXOA 5KYIA 1NCVA 1PRTF 2IT1A 2EYMA 3P20A 1FGBD 1GOZA 2EZVA 2YU9B 4KJOA 3OW7A 3M7GA 4J6HA 1UUPA 3I90A 4BY1B 4C3JG 2JA5B 1TWCB 2K5WA 3IL8A 1PZJD 4G7ZC 3R8BA 2EJGC 1MBYA 1I3QB 5C5MA 2F0UA 2QDBA 1QE6A 4X3UA 4F8MA 4OL7A 1M4VA 4RKLA 4EQOA 3S14B 4TSSA 1TS5A 3CRLC 1STYA 2ZXRA 3MHBA 4GZYC 3G6JB 5CV8A 5JEAG 5IT9L 4KY6A 3MWYW 4QMGA 1SNCA 2QF7A 1PFMA 5CBEE 2NYZD 3H09A 1R4PB 3FPPA 5D65A 1HPCA 3HS0C 1Y8OB 3NXWA 2D2CC 2F0QA 4DU9A 3NP8A 2E76C 5M3MB 3H3VC 1PRTB 1ZYRC 1LACA 3IKJA 1PRTC 4A3JB 2F0GA 2SEBD 1TY2A 1X32A 4LK1C 3KLRA 1GJXA 2X69A 2RDHA 2QEJC 5DAUA 1GUSA 2XIWA 2F3WA 2FINB 1QWYA 4X3SA 2ICEC 2PNRC 4BBSB 1ESFA 4J1MA 2EPBA 2XNAC 4IN3A 1YNJC 3JAML 5JVG3 4QUFA 5COYA 1EL0A 2PW7A 3KLSX 1DXMA 4C1NI 4BWGB 1HQMC 3P75A 5KNDA 3P7JA 3BS1A 4KMUC 2NN6H 2G9DA 3W2DA 2A6EC 3VYTA 4IUPA 3VYSA 2KUMA 2PCFB 3MVVA 2PPBC 3GQBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EQO A;  2SNS A;  5CV4 A;  4DF7 A;  1KDB A;  3VA5 A;  3QOL A;  1A2T A;  1SNO A;  5HUR A;  1STY A;  3MHB A;  3P1H A;  1ENA A;  4TRD A;  4I65 A;  5CV8 A;  3SK5 A;  5ISR A;  1ENC A;  4HTH A;  4KV6 A;  5IOC A;  1JOQ A;  2F0K A;  2F0T A;  5C3X A;  5EKK A;  4KY6 A;  2EYL A;  1STA A;  2F0V A;  2F0L A;  2HQE A;  4ME5 A;  4QMG A;  5E3F A;  2M00 A;  1SNC A;  4ODG A;  5CR3 A;  5K5P A;  4NMZ A;  5M9O A;  4KY7 A;  1KAB A;  1SND A;  4K2K A;  1A2U A;  5I9P A;  2EYP A;  1AEX A;  3EVQ A;  3NK9 A;  4N9T A;  4YIJ A;  3SK4 A;  2LKV A;  4RKB A;  3TP5 A;  5IGF A;  5J39 A;  1KAA A;  3OWF A;  1EY7 A;  2F0D A;  4ZUI A;  2RDF A;  5J22 A;  1KDA A;  3D4D A;  4G57 A;  2RKS A;  3NXW A;  4K5X A;  5CV9 A;  4ZQ3 A;  5HGT A;  2F0Q A;  2PZU A;  4ZUJ A;  4DU9 A;  5C6A A;  3NP8 A;  4K14 A;  3NQT A;  5I6W A;  3DMU A;  5KIX A;  2EYH A;  3C1F A;  3T16 A;  3TME A;  4KD4 A;  3E5S A;  2PW5 A;  4PMB A;  1F2Y A;  4KHV A;  1U9R A;  5KRU A;  1EZ8 A;  1EYC A;  1TT2 A;  5C5L A;  3BDL A;  1EQV A;  1A3V A;  1STN A;  2F0J A;  2WAC A;  5IGG A;  4OL7 A;  2F0G A;  2F0S A;  3EJI A;  3HZX A;  4K8I A;  3SHL A;  5C4Z A;  4PNY A;  5JOB A;  2F0E A;  2EY5 A;  1SNP A;  3NUC A;  1NSN S;  5F2D A;  5CV6 A;  4K8J A;  4KD3 A;  5J1Z A;  3SXH A;  5IGE A;  2O4X A;  1SYB A;  4EQP A;  5KEE A;  1SYE A;  4QF4 A;  3TP8 A;  1IHZ A;  2EY6 A;  3D8G A;  3MEH A;  4B9X A;  2F0W A;  3U9O A;  5KGU A;  4H7B A;  3SK8 A;  5CC4 A;  1NUC A;  4F7X A;  1F2Z A;  1STB A;  2EYJ A;  5DAU A;  4ID6 A;  4DGZ A;  1EY6 A;  1SNQ A;  3ITP A;  5KYI A;  1STG A;  2F3W A;  2OF1 A;  5I6Y A;  3D4W A;  4KTA A;  3LX0 A;  3MZ5 A;  3T13 A;  4DFA A;  2OXP A;  3SR1 A;  4PMC A;  4NKL A;  2EYM A;  2EY2 A;  4LAA A;  1EY9 A;  4K2L A;  4KY5 A;  3S9W A;  4EVO A;  4R8N A;  5KYL A;  2SOB A;  2EXZ A;  3C1E A;  4IAL A;  5I9O A;  5IGC A;  3SK6 A;  5CV7 A;  3RUZ A;  3DHQ A;  4HMJ A;  4J1M A;  4KJO A;  2ENB A;  1TQO A;  1SNM A;  1SYF A;  2EYO A;  3NHH A;  5CV5 A;  2F0M A;  4QB4 A;  4B9W A;  1EY4 A;  5IIF A;  4IZ8 A;  2F0F A;  4K5V A;  4J6H A;  4WRD A;  5DEH A;  4IUN A;  5E1F A;  1EY0 A;  5CGK A;  2EY1 A;  4HMI A;  4EQN A;  2OEO A;  3PMF A;  4S3S A;  2NUC A;  4K5W A;  5IGD A;  2PW7 A;  1EYA A;  3HEJ A;  2SNM A;  2F0N A;  1SYD A;  3OMG A;  3P75 A;  3QOJ A;  5EKL A;  3OSO A;  2F3V A;  1EZ6 A;  2KHS A;  3OMC A;  4NDX A;  3TP6 A;  1RKN A;  1EYD A;  5IGB A;  1JOK A;  1A3T A;  4NP5 A;  1SYC A;  2F0I A;  2PZT A;  4K6D A;  1TR5 A;  2PYK A;  5JAV A;  1STH A;  1JOO A;  3V2T A;  5C4H A;  1JOR A;  3BDC A;  2PQE A;  5EGT A;  4MIU A;  3MXP A;  3TP7 A;  1F2M A;  5IOD A;  1II3 A;  1SYG A;  3ERO A;  2KQ3 A;  5C5M A;  2F0U A;  2QDB A;  1EY5 A;  2F0O A;  1A3U A;  4N9P A;  2RBM A;  4E6I A;  2F0H A;  2EYF A;  3QB3 A;  3H6M A;  5C3W A;  4WOR A;  1EY8 A;  2PZW A;  3ERQ A;  3MVV A;  2F0P A;  1KDC A;  5NUC A;  4F8M A;  3D6C A;  4RKL A;  3R3O A;  4KJN A; 
#chains in the Genus database with same CATH topology
 1W6J A;  3AFP A;  3VA5 A;  2DY7 A;  5C44 H;  1ENA A;  4AH6 A;  5C0X I;  3SK5 A;  4N8F A;  1WCM B;  1WTX A;  5JJZ A;  2C9O A;  2F0V A;  1TWF B;  1DZ1 A;  1O78 A;  1VQH A;  2PI2 A;  1B9N A;  5ELD A;  2WB1 G;  3BG3 A;  3KDF B;  3CCJ A;  4EGV A;  1FYC A;  4U67 3;  3L7Z C;  1CI3 M;  2GVB A;  3STB D;  1EIF A;  1HR0 W;  4ZQ3 A;  1IYV A;  1RF2 D;  4R8I A;  4HJ8 A;  1LO5 D;  3CKI B;  1CFM A;  3I4M H;  4A93 H;  3J7A V;  4L63 B;  1SEB D;  4NXN L;  4A3L H;  3TS2 A;  1D5X C;  3S1Q H;  5ELC A;  1I6H B;  2JA9 A;  4A3K B;  4TVA B;  1LT3 D;  1SJH D;  1Y1V H;  4OON A;  2I07 B;  1B3A A;  4B08 A;  4DV3 L;  1Z47 A;  1STB A;  4IFD J;  4X62 L;  3PUW A;  2UXC Q;  2NB0 A;  1TWA H;  4JYA L;  1TWG B;  4A3D H;  1D6E C;  1N33 L;  3T1H Q;  2BDO A;  5C4X H;  4R8N A;  3BYY B;  2MUY A;  3H91 A;  4DAY B;  2VB2 X;  4NB3 A;  4HMJ A;  2ENB A;  1P16 A;  1SNM A;  1SYF A;  2L11 A;  2B2U C;  1BBW A;  4LF9 Q;  2B8G A;  1HJP A;  1Z7T A;  5C3E G;  4HMI A;  2JN4 A;  2NVY H;  2BA0 A;  4Q0F A;  3UDG A;  3GTO B;  1NNX A;  1YI2 A;  1P8L A;  3RZD H;  1KL9 A;  2F0N A;  3TP6 A;  1TS3 A;  5A2Q L;  2LXJ A;  4DAP A;  4JI3 Q;  2PO4 A;  1TXY A;  4CGY B;  1G6P A;  2KHI A;  1D2B A;  4CKB A;  1BBU A;  1Q82 C;  2NVT B;  5JJK A;  3CXC A;  1C7Y A;  4R9W A;  1G29 1;  3CPW A;  1PTO D;  1BOS A;  3MXP A;  4C3H B;  4A3G B;  1PFN A;  3K59 A;  4KKS A;  1MD2 D;  2BE5 D;  1PH1 A;  4OO1 I;  1VQG A;  4R4O A;  1QVC A;  2MP1 A;  3D6C A;  1XNR L;  1NR4 A;  1A2T A;  3TDQ A;  3P1H A;  1BKB A;  2WAQ G;  2RQX A;  3PO3 H;  1ILP A;  5DM6 3;  1GUT A;  1LV9 A;  3KK7 A;  4DV7 L;  2Z1C A;  2A68 D;  3F2B A;  4XIG S;  3S2D H;  2WFW A;  3GTJ B;  5K36 H;  3W1G A;  3A54 A;  1YVC A;  3HOY G;  1LT4 D;  2O5I C;  2CKZ B;  4R4Q A;  1EQQ A;  3GTL B;  5D3I B;  2EYH A;  1XPR A;  4KHP Q;  3ND9 A;  1F2Y A;  5FO9 B;  1VQ4 A;  5HGQ A;  3HOX B;  4FF4 A;  3A7L A;  3A7A B;  1G6Z A;  3RLO A;  4YCU A;  5C4Z A;  4A3I G;  4KK7 A;  2ZM6 Q;  4BBR B;  3NTH A;  3F2C A;  1IL8 A;  3CCM A;  3GTM B;  2QKI C;  4KD3 A;  4DAV A;  4RGO S;  4DV0 Q;  1V9P A;  2BOS A;  1GUW A;  1V1P B;  1VQC A;  3K80 C;  3F1Z A;  3MEH A;  4IOC A;  3Q23 A;  4UHV A;  1JE4 A;  3R2T A;  1Z6H A;  3CC4 A;  3H0G B;  3QIA A;  3VR5 A;  2PNH A;  2QDL A;  3I7F A;  1PYW D;  4EVO A;  1X54 A;  1SMY C;  1VCI A;  3K0Y A;  5BR8 L;  2NZH A;  4A3D B;  1V1Q A;  1R9T B;  2K04 A;  4IO9 A;  2AUJ D;  5C0X G;  1X55 A;  4AYB B;  5C4X B;  3HOZ B;  4B9W A;  2DJG C;  1PV4 A;  2Z4H A;  3OIQ A;  4IUN A;  5J3B A;  2CW0 C;  5H1S E;  3S15 H;  2OEO A;  1CKM A;  4JCV E;  3S24 A;  3U58 A;  3QOJ A;  4A3C G;  2L55 A;  5GAE C;  2J0T D;  2KJX A;  4DV4 Q;  2Z0S A;  4GN5 A;  4LUO A;  2L0C A;  4MIU A;  1HA5 A;  1XMQ L;  3HFZ B;  4G4K A;  4JBJ A;  4YWL A;  2RBM A;  3KLW A;  4JBK A;  1BQQ T;  3H6M A;  1T5E A;  2PZW A;  5EJW A;  3HOV G;  4APV A;  4DNR B;  2UXD Q;  4C3I H;  1HNX Q;  4J15 A;  1ASZ A;  5CV4 A;  4GKK L;  3QOL A;  1EQT A;  3MXU A;  2K7V A;  1YNN C;  4A3B H;  3DWA A;  3RMH A;  5EQ0 A;  2F0L A;  1JCK B;  4ODG A;  5K5P A;  1HZB A;  4YCW A;  1LT6 D;  1IBL Q;  1MGS A;  3RR5 A;  5JPM C;  2BDN A;  1YIJ A;  1XNQ L;  3PO3 B;  1W6K A;  2CQA A;  2F0D A;  5GAD C;  2RDF A;  3SDZ A;  5FK9 C;  2B2U A;  4DAY A;  4JI7 Q;  4BY7 B;  3S1R H;  3S2D B;  4EQ5 A;  1YJN A;  4X3T A;  1KRS A;  1FNU A;  2WV6 D;  4UAI A;  4DV6 L;  1HA6 A;  4LF4 L;  1VQ5 A;  1GVP A;  1CM9 A;  2PW5 A;  4A75 A;  1A15 A;  2R92 H;  1O80 A;  2F4V Q;  3PGZ A;  4XYO A;  1GO3 E;  3PUY A;  3HG9 A;  1XTC D;  3U9S A;  2F0J A;  3GO5 A;  3HZX A;  4ULL A;  4Z9C B;  3M85 A;  3D3R A;  4AIM A;  1LTL A;  3J81 j;  4DR3 L;  4LF5 L;  3L0O A;  4JBW A;  1IBK L;  2R6G A;  2O4X A;  4QF4 A;  2PMZ B;  2N8N A;  1JWM D;  1FJG L;  1O7Y A;  1CHP D;  2R3Z A;  2XGT A;  3HOW G;  1I50 H;  3DWP A;  1EY6 A;  3E3X A;  2E74 C;  1NTG A;  3I3C A;  3QO2 A;  5M5X H;  3PIO 3;  4OO1 G;  2B8F A;  4R4C A;  2A6H C;  1QCB D;  3S9W A;  4DR5 Q;  3Q8D A;  1CT1 D;  2NWG A;  5ELB A;  2A5H A;  4DR6 L;  1DGS A;  3RUZ A;  4POG A;  1SXT A;  5IP7 H;  2H1E A;  2IW3 A;  4A3F H;  4RGT A;  3J7Y W;  2CVR A;  2TMP A;  2EOT A;  2B63 G;  1WJJ A;  5LMN W;  2JE6 I;  1BCP D;  3OSO A;  1BDO A;  2YU9 H;  1K8G A;  1Q12 A;  4K0K L;  1QUQ B;  5ELO A;  4LF8 L;  2V1C C;  2R7Z B;  5JJI A;  2NN6 I;  1GUG A;  4ZK9 B;  2B2W C;  2J7Z A;  4BY1 H;  3I70 A;  3VR3 A;  2RDG A;  3QB3 A;  1IBM L;  2ZJQ A;  4HSV A;  1S5F D;  1KRT A;  5HY6 A;  5FOB B;  2FMC A;  2L1B A;  2ZTD A;  5IYC G;  3T51 B;  1X6O A;  1KDB A;  1SNO A;  2JA7 H;  1PA6 A;  3CW2 C;  1IW7 C;  4JPB W;  5JVH 3;  1FNV A;  2CHB D;  4C3I B;  2KCT A;  1I3Q H;  4A76 A;  1V1P A;  2M00 A;  4A3B B;  1F9Q A;  4PZ6 A;  3D31 A;  3L2P A;  1UE5 A;  1XWE A;  4GN3 B;  3MXG A;  3TZD A;  4DPG A;  3HOU H;  2MQH A;  3SVM A;  4CDD C;  1EEF D;  4DV5 L;  4P2C B;  4DN4 M;  4JI2 Q;  2YTX A;  4FO2 A;  1XMO L;  2QW7 A;  1EZ8 A;  3NWT A;  1CKN B;  1C0A A;  1BBX C;  1KNA A;  3UE0 A;  1E3P A;  1STN A;  2MNA A;  2A8V A;  1WOC A;  2IHF A;  2DUD A;  3NUC A;  3RD4 A;  4RG1 A;  2QGQ A;  2PMZ E;  1I94 L;  4OHJ A;  4HIK A;  5M3M H;  1HZ9 A;  4H44 C;  3A56 A;  1NUC A;  4B3S L;  2XWJ B;  1SNQ A;  4RA8 A;  5EPJ A;  2D62 A;  3C3L A;  4X66 Q;  1GUO A;  3OTO L;  2SOB A;  4KI0 A;  3NWS A;  3I72 A;  3LWU A;  4B3T L;  1XJV A;  3CME A;  1EUJ A;  2JYO A;  1WTO A;  1HR0 L;  3ONA B;  5CV5 A;  3J80 E;  1VQB A;  1W2B A;  1UNS A;  2WIN B;  1HCZ A;  2L12 A;  1VF5 C;  3AFQ A;  1N36 Q;  3PV0 A;  2VUM B;  4A3F B;  4BBS H;  2OQ0 A;  4DK3 C;  4DR4 L;  2Z8L A;  1OXV A;  3MXN A;  4BS9 A;  4H0L C;  3UDI A;  2H4O A;  3S2H B;  3ERO A;  2Q2H A;  2JQO A;  2EVB A;  5EBC A;  4KN4 C;  4X64 L;  1ET6 A;  2KOL A;  2CWP A;  3T53 B;  2E2J H;  3IAY A;  2D0P A;  4KJN A;  4MNO A;  4DF7 A;  3K5M A;  4MTN A;  2VY3 A;  4XXE A;  2VNU D;  3PUX A;  1DOM A;  4UP8 A;  1TS2 A;  4O0A A;  5ISR A;  3PIP 3;  1PFS A;  3OYY A;  2F1M A;  5M3F B;  2YYZ A;  2EYL A;  3J81 E;  2JA7 B;  5GQO A;  5FJ8 G;  5LL6 X;  3ICE A;  1GHJ A;  1SN8 A;  1FGU A;  3I8Z A;  1K28 A;  3GV3 A;  1JE5 A;  4CBV A;  2EE1 A;  1X56 A;  4IFD I;  4MN3 A;  1WTQ A;  1WCM H;  2WKC A;  2R7F A;  4DUY Q;  1JIC A;  4GN4 B;  3ZYY X;  1TWF H;  3HOU B;  3T16 A;  1ET9 A;  2UUC L;  4KHZ A;  1IZ6 A;  2FHT A;  5GAH C;  3CCR A;  5C5L A;  1N32 Q;  1EQR A;  2L15 A;  4DR2 L;  5EAY A;  4GLV B;  3NBH B;  1K8M A;  5CV6 A;  2B2W A;  1RTN A;  3QG1 A;  3RLF A;  1AFP A;  5EPL A;  4JI8 Q;  1A0I A;  3FKI H;  5KGU A;  1HNZ Q;  1G2S A;  2TSS A;  4JW0 A;  1OXS C;  2KHJ A;  2NN6 G;  2CCZ A;  3GTG H;  3VDY A;  1B44 D;  1I6H H;  1UE6 A;  2ZTE A;  2RSN A;  3VR2 A;  3D4W A;  4OXP A;  5I6Y A;  2FFK B;  3SR1 A;  5LMU Q;  4B3R Q;  4NKL A;  3EN2 A;  3PSI A;  2I5L X;  4LAA A;  3IRB A;  1ROD A;  5GAG C;  2MO1 A;  1SE3 A;  2DGY A;  1TII D;  3NTI A;  4P73 A;  1XYI A;  4QCL A;  1RCV D;  3KLS A;  4YWM A;  5DEH A;  5IWA Q;  5C44 G;  1K8O A;  2PI2 E;  2K5V A;  1JQY D;  3OHX C;  1TWG H;  1XX8 A;  1VQ8 A;  4XYQ A;  2F3I A;  2KEC A;  2UU9 Q;  1SYC A;  3K7U C;  1Q7Y C;  4XQJ A;  2C35 B;  3M4P A;  3V2T A;  2N55 A;  1EIY B;  5AJ3 Q;  4K6L A;  1OO9 B;  1F2M A;  1IKM A;  1CK1 A;  1J5E Q;  4GLA C;  4JI6 L;  2HHH Q;  2F0P A;  3I4M G;  4A93 G;  3BU2 A;  1I4R A;  1CKN A;  1CA5 A;  4JI4 L;  3SEB A;  4A3M B;  1I4Q A;  2NVT H;  1JJ2 A;  5I2Y A;  1ENF A;  2E2J B;  4HTH A;  4KV6 A;  1LAB A;  4C3H H;  1VQ9 A;  5EKK A;  2B2V C;  1SFO B;  3N6R A;  4OIK A;  4LF7 Q;  5JEA H;  4OWT B;  2HQL A;  3KYH C;  4KY7 A;  1IL2 A;  4A3E B;  1U5K A;  2HUG A;  3ULJ A;  3TP5 A;  1S72 A;  1V43 A;  1LTB D;  4RWS C;  2QIL A;  1YNJ D;  4ZAI A;  1PH6 A;  1J6Q A;  4IUQ A;  2Q2U A;  1LUZ A;  1AE2 A;  5CV9 A;  5C6A A;  1WI5 A;  4NXM Q;  4GS3 A;  1X65 A;  1ML0 D;  2Y0S G;  1PTO F;  1BNZ A;  2M9V A;  5GRO A;  2A1A A;  1H9R A;  2AQ3 B;  4PMB A;  4GKJ Q;  3RZO H;  1F9R A;  4WJ4 A;  2N3S A;  1SMX A;  1A62 A;  1UWV A;  1TT2 A;  4LFB Q;  2XRQ D;  1K83 H;  4O2D A;  2A69 D;  3GTJ H;  4DXG A;  2F0E A;  3D6W A;  5T1G A;  3CHB D;  1NSN S;  2SDF A;  3Q6S A;  4CHT B;  5IYD G;  3GTL H;  4OEL B;  3STB C;  2EY6 A;  1BR9 A;  2AWO A;  2F03 A;  1U4M A;  2OT2 A;  3LNN A;  3UDX A;  1NR2 A;  2GA4 B;  2JA8 G;  4P75 A;  4ID6 A;  4FF1 A;  2R93 H;  2UXC L;  3HOX H;  1AW7 A;  3UE1 A;  4RGM A;  3FKI B;  4PMC A;  3GTG B;  3A8I E;  3CCE A;  3T1H L;  5FLX E;  4BBR H;  5KYL A;  3GTM H;  1RHP A;  4ZKB B;  4IOA A;  4QJF A;  1HUM A;  1O7L A;  2F0M A;  4YWK A;  1PLF A;  1MIU A;  4K5V A;  4LF9 L;  5E1F A;  3H0G H;  2R61 A;  1VDZ A;  3FRP B;  3GD7 A;  2D5D A;  3U4Z A;  1AZP A;  5EBD A;  3E0J A;  4GOP B;  1B1Z A;  1TR5 A;  2PYK A;  4PMW A;  3CC7 A;  1R9T H;  4PG3 A;  4C3J B;  3I4L A;  3TSS A;  4IFD G;  3KF6 B;  3HOZ H;  1IKL A;  3C46 A;  5EKI A;  2D0O A;  4GOP C;  2AWN A;  1KIX A;  2EYF A;  4HIO A;  1EY8 A;  1Q81 C;  1VQ6 A;  1QOH A;  2DNC A;  3F2D A;  5CR3 A;  2MGS A;  5E4W C;  4Q5V A;  4NXN Q;  3PCO B;  2ATW A;  3AMU A;  3NBH A;  1PTO B;  1B7Y B;  3K57 A;  4DR1 Q;  1NE3 A;  2HQE A;  5IIF A;  4MHE A;  3Q0A A;  5E3F A;  4AQY Q;  3VYU A;  2O5J C;  1FNW A;  1PTO C;  5I9P A;  3W5O A;  1Q3L A;  1BO0 A;  4RKB A;  1DJR D;  1OXU A;  5ELE A;  1S3O A;  4JI1 Q;  1SLJ A;  3V05 A;  3NTK A;  3D4R A;  1X9N A;  2BE5 C;  4K5X A;  5FKA C;  1MI2 A;  5LMN L;  1YHQ A;  4DV1 Q;  4L6T B;  4X62 Q;  3HKZ B;  5I6W A;  5KIX A;  4JYA Q;  1HNW Q;  4X6A H;  1GKH A;  3IFD A;  1CZG A;  3H15 A;  3CD6 A;  2MJ8 A;  3FDT A;  2FXQ A;  2BH2 A;  3AQQ A;  1TY0 A;  1S5D D;  3RZO B;  1I5F A;  2ZM6 L;  1Y1W B;  1PYS B;  4MZ9 A;  1K83 B;  4BY7 H;  4TKO B;  3H3V I;  4DV0 L;  1IHZ A;  1NBW A;  3I91 A;  3KJP A;  2IY5 B;  1EEI D;  2I46 A;  4BXX H;  4Y7N H;  1U4L A;  4XT3 B;  1BXT A;  3PQI A;  1GXD C;  4KTA A;  4ZYS A;  3CP0 A;  2E75 C;  2R93 B;  2EXZ A;  3C1E A;  4IAL A;  2B2V A;  4GNX B;  3CCL A;  1S4Z A;  1B3Q A;  2Z6B A;  4HJA A;  3E6Z X;  4OIJ A;  1TQO A;  4DXF A;  2RHQ B;  5G3L D;  1Q8I A;  2XRS D;  4X3K A;  3VYR A;  2F0F A;  2OCE A;  4GNX C;  4HSP A;  3U4V A;  1KQS A;  1X3E A;  3NEM A;  4K5W A;  5BN4 A;  4FXG C;  3K5L A;  2KED A;  2V4D A;  3CRK C;  3SGI A;  1V8Q A;  2EQS A;  1HUN A;  4JI0 Q;  4XT1 B;  2PZT A;  4PZ7 A;  1QNK A;  5JAV A;  4DV4 L;  3G48 A;  1WD1 A;  1JOR A;  4CDC C;  3S1N B;  4E6I A;  2F0H A;  4DA2 A;  4R4I A;  3ERQ A;  1H9S A;  2K4K A;  5I2X A;  1KDC A;  2JA6 B;  2UXD L;  5DNF A;  4RHR A;  1NMF A;  2VQF L;  2R92 G;  3NEN A;  1I4H A;  1C9O A;  2K5N A;  2KCC A;  4I65 A;  1CHQ D;  3V96 A;  1S40 A;  3FPU B;  2R7Z H;  2F0K A;  5C3X A;  2WP8 J;  2JEA I;  4R1J A;  3PO2 B;  1ICW A;  4DAM A;  1L0X B;  1QZH A;  4B3M L;  5JJL A;  3EA6 A;  4WJ3 M;  1A2U A;  5KNB A;  3S16 H;  1IBL L;  1IYU A;  1QG7 A;  1EWH A;  1DON A;  2NZ1 D;  2CW0 D;  2CFM A;  1H9M A;  2Z4I A;  1BCP F;  1E2V A;  2K5Q A;  4OEM B;  2JEB I;  2K1B A;  2VB3 X;  3HKZ E;  4LMQ D;  1PH4 A;  4K14 A;  1KLU D;  2WB1 B;  1X3G A;  2E2H B;  3FP9 A;  1N8R C;  1E24 A;  2AKW B;  2F4V L;  3FMC A;  3BDL A;  4A4I A;  5IP7 G;  5COR A;  2CH4 A;  1SE4 A;  3GV6 A;  4K8I A;  3EJI A;  2K05 A;  1H95 A;  1SNP A;  1OXT A;  4K8J A;  4GOP A;  4A3I H;  5KEE A;  4ZKC B;  1MHW C;  3MXN B;  3KF6 A;  4LUV A;  1QVF A;  2AMC B;  3G6E A;  5E4X A;  4DV2 L;  1XTD A;  3ZJY C;  2VZA A;  4BY1 G;  1S5C D;  1KXL A;  4KY5 A;  2JA5 G;  4I7Z C;  4QIW B;  1XMQ Q;  2LS0 1;  4Y7N B;  2E8G A;  3DHQ A;  4F87 A;  5IT9 E;  1PVO A;  2ZXP A;  2L5T A;  1VF7 A;  2LSS A;  4IZ8 A;  1QVG A;  4CDE C;  1L1O B;  3OPO A;  5CGK A;  5C0X H;  2UUB L;  1L2F A;  2AHO B;  1KHI A;  3A55 A;  2E5L L;  2K5H A;  1LTA D;  2DNE A;  3HEJ A;  5EKL A;  1K8A C;  2F3V A;  1L1O C;  2B2Y C;  4RCO A;  1VQN A;  5IGB A;  1U4R A;  3OWE B;  3BVZ A;  1B53 A;  1STH A;  2JK8 A;  1Q46 A;  3BDC A;  1Q1E A;  5C3E B;  1PXU A;  2LY7 A;  3TP7 A;  5LHY 1;  1SYG A;  4DUZ Q;  2MHV A;  1EY5 A;  2F0O A;  2GVA A;  4N9P A;  1FL0 A;  2MPM A;  1QNU A;  2KVM A;  2IL8 A;  1H9J A;  1WFQ A;  2BA1 A;  3D0F A;  3W1B A;  4OX9 Q;  3RN2 A;  1BCP B;  2VUM H;  3S1M H;  2I5M X;  4FP5 D;  3ULL A;  1Y8N B;  1BUV T;  4IUR A;  5CBA E;  2RVL A;  5HUR A;  4DV6 Q;  3WDN A;  1BCP C;  4O1N A;  1YHB A;  4V0B A;  3S2H H;  1JWU D;  3J80 c;  1XPO A;  3I4N G;  4HID A;  1J8I A;  2UXB Q;  1BVS A;  2XSC A;  3H94 A;  4M1U B;  5M3M G;  1L0W A;  3PIO A;  2OTJ A;  2WAQ B;  1B8A A;  1EU3 A;  1QIL A;  4ZUI A;  1PH8 A;  3G7L A;  2KEE A;  4L5S A;  1U4P A;  3S16 B;  3RN5 A;  1I4X A;  2PZU A;  4ZUJ A;  3T1Y Q;  2WB1 E;  4A3J G;  2B29 A;  4GNX A;  5M3F H;  3I73 A;  3BZD B;  1EU4 A;  2HD3 A;  1C48 A;  4UPA A;  4UY8 C;  3JAM E;  3E5S A;  2BH8 A;  5KRU A;  3NSW A;  3HOY B;  5IGG A;  3SHL A;  5JOB A;  4KLK A;  1VS0 A;  4GLX A;  3NBI A;  3CCU A;  4CJ2 C;  1V1O A;  1B50 A;  3DEO A;  3TN2 A;  4BBS G;  1RJT A;  3AEV A;  3S17 B;  4ZLT F;  5CC4 A;  3J81 c;  1VQ7 A;  1H9K A;  2KBN A;  1YZ6 A;  4A3I B;  1KLG D;  2HCI A;  1PYB A;  2ZTC A;  4ALP A;  3LX0 A;  3MZ5 A;  4QIW E;  5IY0 A;  4X66 L;  1KD1 C;  1HTL D;  1VQD A;  3KJO A;  1M1K C;  1CA6 A;  1E1O A;  4OO1 H;  5CV7 A;  3PF4 A;  1F77 A;  2VL6 A;  2M2L A;  3FVQ A;  2ICI A;  1HH2 P;  1IBM Q;  1EY4 A;  1Y8P B;  1OXX K;  3BJU A;  3MFG A;  1UE1 A;  1EOV A;  1PZK D;  4CDF C;  4CJ0 B;  3RNU A;  2EY1 A;  4RH6 A;  4EQN A;  2YTV A;  4S3S A;  3K0X A;  1EYA A;  2QCP X;  4JVZ A;  2MFI A;  1SYD A;  5A35 A;  4IQZ A;  5IYB H;  2KHS A;  2YV5 A;  3ULP A;  2O2L D;  2EXD A;  1S5B D;  4LF6 L;  2VQE Q;  2B63 H;  3TZU A;  3GTP B;  1EFI D;  3I55 A;  5IOD A;  3KBG A;  2XN9 C;  1WCM G;  3NQI A;  4C1N K;  1PH9 A;  5FO7 B;  2E2D C;  2RCN A;  4HAE A;  4QL5 A;  4YHH L;  2SNS A;  1ZXT A;  3R2I A;  4YCV A;  1YHA A;  1ONL A;  4IUU A;  3Q22 A;  2KCM A;  1XMO Q;  1FD7 D;  3S1M B;  1IXR A;  3M4Y A;  5IOC A;  3HOV B;  3BVG A;  4OWX B;  3A5Z B;  1HHV A;  3DXJ C;  1AEX A;  5IGF A;  2WAQ E;  5IP9 G;  2LKV A;  2EJF C;  1HTP A;  1SJE D;  1CUK A;  3OIP A;  1I94 Q;  2B2T A;  4A3M H;  2Q2T A;  1E2Z A;  4A3K G;  3BZC A;  4X65 L;  4DUY L;  1SFO H;  1G2T A;  1RL2 A;  1D8L A;  4A3E H;  4LFC L;  1U9R A;  4L8J A;  1HFN A;  2X6L A;  3QJY A;  3MFY A;  1L1O A;  2B2Y A;  1N32 L;  2IWH A;  1LTI D;  1JJG A;  4CJ1 B;  1GHK A;  5A2Q E;  1HR0 Q;  1PH7 A;  3EIV A;  1AP0 A;  1Q90 A;  4NPS A;  2A73 B;  3K5O A;  1DOK A;  1EFW A;  3GTQ B;  3W3A A;  2K28 A;  4V19 0;  1STG A;  4JV5 L;  3HGB A;  5LMU L;  4B3R L;  4HJ7 A;  1SRU A;  3DEP A;  5ELF A;  4BA2 I;  1G51 A;  3PIP A;  5D3D A;  3HOW B;  4X64 Q;  1WTP A;  2XVS A;  4P71 A;  4QB4 A;  1F9S A;  4ME3 A;  4R4T A;  3WOE A;  5FO8 B;  5M5Y H;  2BCO A;  2EIF A;  2L9H A;  3DM1 A;  5JEA J;  5IWA L;  1EY0 A;  3TS0 A;  1G91 A;  1IYJ B;  3KF8 B;  4C3H G;  5CYU A;  5IGD A;  4A3G G;  3K7A H;  1I4G A;  1E2W A;  3K5N A;  1SSO A;  3BZK A;  1EYD A;  1KTK A;  2F0I A;  2UU9 L;  3VA7 A;  4IPD A;  1OTC A;  1Q8K A;  3LGJ A;  4QGU A;  2VS1 A;  2B63 B;  3CQZ H;  1J5E L;  3BVM A;  4PQX A;  2OTL A;  2P5Z X;  4YY3 L;  2HHH L;  3DM3 A;  4JI5 Q;  3I4N B;  2XTI A;  3K8A A;  3ER0 A;  1WTV A;  1GUN A;  5FLX c;  1PH3 A;  1EIG A;  4C3J H;  5FLM H;  2UUC Q;  2HDM A;  1ZYR D;  3U50 C;  1ENC A;  4I7A A;  2F0T A;  1T9H A;  1XXG A;  2DN8 A;  4ME5 A;  4DR2 Q;  2UUA Q;  1PRT D;  4NMZ A;  2EYP A;  3SK4 A;  5J39 A;  1UEA B;  2ZJP A;  1G8Z D;  1SR3 A;  4POF A;  1RD9 D;  1CSP A;  2LMC B;  3HOX G;  4DR7 Q;  1B4O A;  4JOI C;  4G7O C;  4A3L G;  1PTO H;  4HCS A;  2CQO A;  1TKW B;  4MTK A;  4BBR G;  3G4S A;  2NVQ B;  2DY8 A;  1RDP D;  2K50 A;  3ND8 A;  3I56 A;  1A3V A;  1TVX A;  3F2U A;  1Y1V G;  3H0G G;  4C56 C;  2RSO A;  1N34 Q;  4N8X 1;  1O7Z A;  5IGE A;  4IPG A;  1SYB A;  4EQP A;  4L5R C;  3K6O A;  1Q1B A;  1PMR A;  2NVX B;  3D8G A;  1C8C A;  3SK8 A;  4A3D G;  1KC8 C;  2EYJ A;  1X3F A;  1D5M C;  4AYB G;  5C4X G;  2NTT A;  3HOZ G;  2ES2 A;  4J8Q A;  3TRZ A;  1H9S B;  2EY2 A;  2KEN A;  2A6E D;  2QA4 A;  3MTS A;  1Y1W H;  1SAP A;  4OGQ C;  1VMP A;  4KN7 C;  3J80 i;  3PF5 A;  2L4N A;  2IJ0 A;  2A69 C;  1FR3 A;  2G5D A;  4HCE A;  1E1T A;  2CH4 W;  3BDO A;  3CCQ A;  3J7A F;  3CCV A;  4WRD A;  3HKS A;  2RA4 A;  4JI4 Q;  2K6A A;  1ILQ A;  1K0R A;  5M5Y B;  3CCS A;  1K0S A;  2SNM A;  1DD2 A;  1A3T A;  3K7A B;  1HFG A;  1JOO A;  5C4H A;  4U68 A;  2PQE A;  5JPN C;  2E2I H;  5DM7 3;  1SBB B;  4ZRZ A;  3M3Y B;  2RF4 A;  1WVL A;  4DK1 A;  3DLL A;  2K01 A;  2K52 A;  4RCN A;  4LFA Q;  2N88 A;  3CQZ B;  4RFB A;  2B39 A;  2NTS A;  3GTK H;  4TRD A;  3PO3 G;  3J81 i;  4JI3 L;  4FYD A;  1CZW A;  1STE A;  2XWB B;  3J80 L;  3S1N H;  4UP9 A;  1STA A;  4HJ5 A;  4DR1 L;  1VQO A;  5G3L F;  2IPK D;  4AQY L;  1AE3 A;  4BY7 G;  4K2K A;  3NE5 B;  3TEH B;  3CU7 A;  1HXY D;  3K58 A;  2JA6 H;  5K36 G;  5T1I A;  3E9I A;  3MA2 B;  3VR6 A;  4L5Q A;  2WII B;  1KAA A;  2PQA B;  1EY7 A;  4JI1 L;  1EWI A;  1Y69 U;  4BXX G;  2CWA A;  4JC0 A;  2B3G A;  1SE8 A;  3FHW A;  3QWN A;  4LJZ C;  3L3O C;  4DV1 L;  3PO2 H;  3CC2 A;  4FNF A;  3SE0 A;  1VQJ A;  4HR7 B;  3C1F A;  1HNW L;  1F2L A;  4KHV A;  2H5X A;  3A8K E;  1LTG D;  1EWC A;  4RHS A;  3KF8 A;  3AU7 A;  4RMF A;  1AZQ A;  1NY4 A;  3I4O A;  4FXK C;  5M5W H;  1PH5 A;  3TBI B;  4QQB X;  2JSO A;  1VQK A;  4FVM A;  4FXD A;  4H02 A;  4DV3 Q;  2E2H H;  3J81 L;  2F4I A;  3M4O B;  5IYD H;  4DGZ A;  1RTO A;  3ITP A;  2MO0 A;  3X3N A;  3BYT B;  4DFA A;  3T13 A;  2OXP A;  2JA8 H;  1N33 Q;  4KHP L;  2Z6K C;  3E9H A;  4K2L A;  4O42 A;  4BA1 I;  3C2P A;  2K32 A;  3A74 A;  4G7H C;  1YNX A;  1VQI A;  2N49 A;  2HCC A;  3HRZ C;  1DYQ A;  2A68 C;  3PUV A;  4RGN A;  1TS4 A;  5EPK A;  2R7Z G;  4PV1 C;  2FJ2 A;  1A6X A;  4EX5 A;  1A8V A;  1BF4 A;  3OMG A;  4JOI A;  1VQP A;  2GN5 A;  4JI0 L;  2IHE A;  5C44 B;  2IX0 A;  1VQA A;  1J9O A;  1DCZ A;  5EGT A;  5KNC A;  1II3 A;  2JJQ A;  3CMA A;  4M8A A;  4IFD H;  1A3U A;  1WTH A;  4C3I G;  1D1K A;  3Q24 A;  1EIH A;  4ILW A;  5NUC A;  5LMN Q;  1WTR A;  2A74 C;  4A3B G;  2E2I B;  1XNR Q;  4DKA C;  2NZO A;  1MSH A;  4IUV A;  4KKU A;  2Q2I A;  3NEL A;  5C3E H;  1JOQ A;  1LTS D;  5IT9 c;  3I4M B;  4A93 B;  2C5C A;  3GTK B;  5BN5 A;  3KOJ A;  3S1Q B;  1KAB A;  1SND A;  1X3P A;  2ASB A;  2JXM B;  1MKH A;  4FF2 A;  4DV7 Q;  4YIJ A;  4TQU S;  1F9P A;  4IPC A;  1TWH H;  2VXW A;  3CAM A;  1LTT D;  5J22 A;  2ZT9 C;  4DNT B;  1MJE A;  1SE2 A;  2J4X A;  2RKS A;  3HP3 A;  5AFW A;  1JB7 A;  1C4Q A;  1Y1V B;  3CPF A;  5IE8 A;  1HNX L;  2AQ1 B;  3NQT A;  1D5Z C;  3G71 A;  1TU2 B;  4IPH A;  1K3R A;  3X3M A;  2G9H D;  1KNE A;  5C0X J;  1SMY D;  1EQV A;  3T4A C;  1TWA B;  2WAC A;  1VQE A;  4JG2 A;  1A63 A;  2EDG A;  3DWQ A;  4Y52 H;  1UAP A;  3KUP A;  4NW2 A;  2EY5 A;  1QJO A;  1MSG A;  2Y0S B;  2X6G A;  3SXH A;  4HN7 A;  1LLR D;  3ERS X;  1CTM A;  3QR8 A;  2F0W A;  5M5W B;  4H7B A;  3KDF A;  4F7X A;  4JI7 L;  1JMC A;  2QEX A;  1WD0 A;  2NVY B;  1HRJ A;  3GP7 A;  3HOY H;  3DUZ A;  2KA7 A;  2N78 A;  2AQ2 B;  4ZCK A;  3RZD B;  1EY9 A;  3F8T A;  2HIX A;  4CKE A;  5BR8 Q;  3TQY A;  5I9O A;  2ALY B;  3SK6 A;  5IGC A;  1PFB A;  3TRE A;  4CKC A;  2JA8 B;  3L9A X;  2EJM A;  2WKD A;  2VUM G;  4A3F G;  3NHH A;  2K75 A;  3S17 H;  5DLQ E;  3GDE A;  3KFU A;  2K03 A;  3JAM c;  2VQF Q;  4C2M H;  2DJF C;  1B2T A;  1YIT A;  3O13 A;  1EYG A;  1YNN D;  3CF5 A;  2Z9H A;  1EZ6 A;  4NDX A;  2VW9 A;  2PQA A;  1MJC A;  1JOK A;  4LWC A;  4B3M Q;  2A19 A;  4QUC A;  1ICF B;  4DR5 L;  2KQ3 A;  5LL6 S;  4DUZ L;  1XPU A;  2B2T C;  4H13 C;  4IJL A;  5C3W A;  5M3F G;  2JA7 G;  4OX9 L;  1I4P A;  2LFN A;  4XTC S;  4GKK Q;  2LXK A;  5FLX L;  1ESR A;  2Q8R E;  3GTP H;  1QB5 D;  1UEB A;  5E7N A;  2HDL A;  5M9O A;  1E22 A;  4LW1 A;  4A3C H;  2Z6K A;  2UXB L;  4N9T A;  1I6V C;  1XNQ Q;  3HOU G;  3OWF A;  2Q8T A;  1JT8 A;  1HQR D;  1U0L A;  3M7N A;  3FEW X;  1NMG A;  4XQQ A;  1TWH B;  1WTW A;  1K3B C;  3E0E A;  1JC7 A;  3T1Y L;  4DV2 Q;  3HOV H;  4HIM A;  3OOC A;  4UDU C;  3TME A;  4LF4 Q;  3URY A;  3K81 C;  4KD4 A;  1D1I A;  2A6H D;  4XDX A;  5C4J H;  4FF3 A;  1QZG A;  1Z9F A;  3NPP A;  4AYB E;  3EFX D;  2Y0S E;  1CQV A;  2AUK A;  4PNY A;  4DR3 Q;  4LF5 Q;  2KCN A;  3B6Y A;  1IBK Q;  3KBX A;  2K33 A;  4DK6 C;  2UUB Q;  2IX3 A;  1SYE A;  3N52 A;  3TP8 A;  5IYB G;  2E5L Q;  1T5X D;  4B9X A;  1FJG Q;  3U9O A;  4LUZ A;  1F2Z A;  1ASY A;  3S15 B;  2OF1 A;  1VQF A;  4JI2 L;  3IFT A;  2ID0 A;  1B70 B;  4JK1 C;  4DR6 Q;  1R4Q B;  2JA5 H;  1TWC H;  1L0Y B;  4WFN 3;  2EYO A;  5BN3 A;  1EOT A;  3A8J E;  3R93 A;  4F88 A;  4RAU C;  4XQN A;  1VMC A;  3GTQ H;  1CQF A;  3PMF A;  1YJW A;  2NUC A;  3LWE A;  2Q8I B;  1YBY A;  1YJ9 A;  4HED A;  1IW7 D;  4IJH A;  1CSQ A;  4KKT A;  3OMC A;  2IX1 A;  1RKN A;  4C2M B;  4K0K Q;  4NP5 A;  4K6D A;  1ZKO A;  2VQE L;  3HOW H;  4LF8 Q;  1LT5 D;  3M4Q A;  1PZI D;  2OWO A;  1W3S A;  1PDQ A;  4A3M G;  5ELN A;  4WJW A;  1YEZ A;  3S14 H;  3UI2 A;  4WOR A;  1D7Q A;  1LM0 A;  1JB3 A;  2I5H A;  1CKO A;  1ZEQ X;  3VR4 A;  3R3O A;  1S5E D;  4LNQ A;  4P72 A;  3EQL C;  4A3E G;  1M90 C;  2FMM A;  1LTR D;  1SDF A;  1N36 L;  3MAQ A;  1B9M A;  1AN8 A;  3S1R B;  1RIP A;  3I2Z A;  2JP1 A;  1DOL A;  3UDF A;  2R92 B;  1JR0 D;  3WOF A;  3EVQ A;  3NK9 A;  3H3V H;  2I0Q A;  3I4N H;  4IUT A;  1K9M C;  3PUZ A;  1KDA A;  3D4D A;  4G57 A;  5D14 A;  5TSS A;  1NJI C;  5HGT A;  2HT1 A;  1UE7 A;  2RHS B;  2NBF A;  3T56 B;  4DV5 Q;  1X3Q A;  1HZA A;  3DMU A;  4ABN A;  2D9U A;  3MC0 B;  4A3J H;  4DK0 A;  5IYC H;  5I4D A;  1I50 B;  1VQM A;  1EYC A;  1FVI A;  1M8A A;  2K5D A;  1NAP A;  5M5X B;  1DM0 B;  5CMD A;  2F0S A;  1JWS D;  5C4J B;  3FKI G;  5F2D A;  1E0B A;  2OQK A;  5J1Z A;  2YTY A;  1GD7 A;  3AB9 A;  2ZXO A;  4B3S Q;  2NVQ H;  5KYI A;  1NCV A;  1PRT F;  4LF6 Q;  1O7I A;  2IT1 A;  2EYM A;  3OTO Q;  1Y14 B;  3A5U A;  3P20 A;  1FGB D;  1GOZ A;  2EZV A;  3WWV A;  2YU9 B;  4B3T Q;  2RCF A;  4KJO A;  2NVX H;  3OW7 A;  3M7G A;  4J6H A;  1UUP A;  3I90 A;  4YHH Q;  4BY1 B;  4C3J G;  5FLM G;  2JA5 B;  2K14 A;  1TWC B;  3J7A 5;  2K5W A;  3IL8 A;  4JI8 L;  4QY7 A;  1PZJ D;  1HNZ L;  4G7Z C;  3R8B A;  4DR4 Q;  4OWW B;  1JJC B;  1WYD A;  3JC6 6;  4PZ8 A;  3MEF A;  4HJ9 A;  2EJG C;  1GM5 A;  1MBY A;  1I3Q B;  5C5M A;  2F0U A;  2QDB A;  3A0J A;  1QE6 A;  4DNI A;  4L5T A;  4JI5 L;  4X3U A;  4F8M A;  4OL7 A;  1M4V A;  4RKL A;  4X65 Q;  2ZJR A;  4EQO A;  3S14 B;  4TSS A;  1TS5 A;  3CRL C;  1STY A;  2ZXR A;  3MHB A;  4GZY C;  3G6J B;  5CV8 A;  5JEA G;  4UP7 A;  5IT9 L;  4LFC Q;  4KY6 A;  1K73 C;  3MWY W;  4QMG A;  2F52 A;  1SNC A;  2UUA L;  3M3Y H;  2QF7 A;  1PFM A;  3HKZ G;  5CBE E;  5AJ3 L;  2HIV A;  2NYZ D;  1PHJ A;  3H09 A;  1R4P B;  3FPP A;  5D65 A;  1QUQ A;  1HPC A;  5IP9 H;  3HS0 C;  1Y8O B;  4JBM A;  3NXW A;  2D2C C;  1VQL A;  4DR7 L;  2F0Q A;  4DU9 A;  1KAW A;  3NP8 A;  2E76 C;  3JAM i;  5M3M B;  3OW2 A;  5L37 A;  4JV5 Q;  1Y1W G;  4A3K H;  3H3V C;  1PRT B;  1ZYR C;  1LAC A;  3IKJ A;  1Q86 C;  1N9W A;  4LF7 L;  1PRT C;  4A3J B;  2F0G A;  2SEB D;  1TY2 A;  1X32 A;  4LK1 C;  1N34 L;  3KLR A;  3EBE A;  5FJ8 H;  1GJX A;  2R93 G;  2X69 A;  2RDH A;  2QEJ C;  5DAU A;  1GUS A;  2XIW A;  2F3W A;  4NXM L;  2FIN B;  1QWY A;  4X3S A;  2ICE C;  4GKJ L;  2PNR C;  4BBS B;  1AH9 A;  1HZC A;  4LFB L;  1ESF A;  3M9B A;  4J1M A;  3GTO H;  1PH2 A;  4YY3 Q;  2EPB A;  2XNA C;  4FDB A;  3M4O H;  4IN3 A;  1YNJ C;  3J7Z C;  3JAM L;  5JVG 3;  4QUF A;  5COY A;  1EL0 A;  1SRO A;  2PW7 A;  3KLS X;  1DXM A;  3RLN A;  4BWG B;  4C1N I;  1HQM C;  1LYL A;  3P75 A;  5KND A;  3P7J A;  3BS1 A;  4A3G H;  4P74 A;  2R7D A;  4KMU C;  2JA6 G;  2NN6 H;  3AYH B;  2G9D A;  3W2D A;  2A6E C;  3VYT A;  4IUP A;  3VYS A;  4JI6 Q;  2KUM A;  2PCF B;  3PO2 G;  3MVV A;  1E7Z A;  2PPB C;  4LFA L;  3GQB A; 
#chains in the Genus database with same CATH homology
 1W6J A;  3VA5 A;  2DY7 A;  1ENA A;  5C0X I;  3SK5 A;  1WCM B;  1WTX A;  5JJZ A;  2C9O A;  2F0V A;  1TWF B;  1DZ1 A;  1O78 A;  1B9N A;  5ELD A;  3BG3 A;  4EGV A;  1FYC A;  4U67 3;  3L7Z C;  1CI3 M;  4ZQ3 A;  1IYV A;  1RF2 D;  4R8I A;  1LO5 D;  3CKI B;  1CFM A;  3J7A V;  4L63 B;  1SEB D;  1D5X C;  5ELC A;  1I6H B;  4A3K B;  1LT3 D;  1SJH D;  2I07 B;  1B3A A;  4B08 A;  1Z47 A;  1STB A;  4IFD J;  3PUW A;  2NB0 A;  1TWG B;  1D6E C;  2BDO A;  4R8N A;  3BYY B;  2MUY A;  3H91 A;  2VB2 X;  4HMJ A;  2ENB A;  1SNM A;  1SYF A;  2L11 A;  2B2U C;  2B8G A;  1Z7T A;  4HMI A;  4Q0F A;  3GTO B;  2BA0 A;  2F0N A;  3TP6 A;  1TS3 A;  5A2Q L;  4DAP A;  2PO4 A;  4CGY B;  1D2B A;  4CKB A;  2NVT B;  4R9W A;  1G29 1;  1PTO D;  1BOS A;  3MXP A;  4C3H B;  4A3G B;  1PFN A;  3K59 A;  4KKS A;  1MD2 D;  2BE5 D;  4OO1 I;  2MP1 A;  3D6C A;  1NR4 A;  1A2T A;  3TDQ A;  3P1H A;  2RQX A;  1ILP A;  5DM6 3;  1GUT A;  1LV9 A;  3KK7 A;  2Z1C A;  2A68 D;  4XIG S;  3GTJ B;  5K36 H;  3A54 A;  1LT4 D;  2O5I C;  3GTL B;  5D3I B;  2EYH A;  3ND9 A;  1F2Y A;  5FO9 B;  3HOX B;  4FF4 A;  3A7L A;  3A7A B;  1G6Z A;  5C4Z A;  4KK7 A;  4BBR B;  3NTH A;  3GTM B;  1IL8 A;  2QKI C;  4KD3 A;  4DAV A;  4RGO S;  1GUW A;  2BOS A;  1V1P B;  3MEH A;  3Q23 A;  1JE4 A;  3R2T A;  1Z6H A;  3H0G B;  3QIA A;  3VR5 A;  1PYW D;  4EVO A;  1SMY C;  1VCI A;  3K0Y A;  4A3D B;  1R9T B;  2K04 A;  2AUJ D;  5C0X G;  4AYB B;  5C4X B;  3HOZ B;  4B9W A;  2Z4H A;  3OIQ A;  4IUN A;  2CW0 C;  2OEO A;  3QOJ A;  2L55 A;  2J0T D;  2KJX A;  2L0C A;  4MIU A;  1HA5 A;  4G4K A;  2RBM A;  1BQQ T;  3H6M A;  1T5E A;  2PZW A;  5EJW A;  4DNR B;  5CV4 A;  3QOL A;  1EQT A;  3MXU A;  2K7V A;  1YNN C;  3DWA A;  3RMH A;  5EQ0 A;  2F0L A;  1JCK B;  4ODG A;  5K5P A;  1LT6 D;  1MGS A;  5JPM C;  2BDN A;  3PO3 B;  1W6K A;  2CQA A;  2F0D A;  2RDF A;  3SDZ A;  5FK9 C;  2B2U A;  4DAY A;  4BY7 B;  3S2D B;  4X3T A;  1FNU A;  2WV6 D;  4UAI A;  1HA6 A;  1CM9 A;  2PW5 A;  1A15 A;  1O80 A;  4XYO A;  3PUY A;  3HG9 A;  1XTC D;  3U9S A;  2F0J A;  3GO5 A;  3HZX A;  4ULL A;  4Z9C B;  3M85 A;  3D3R A;  4JBW A;  2R6G A;  2O4X A;  4QF4 A;  2PMZ B;  1JWM D;  1O7Y A;  1CHP D;  2R3Z A;  3DWP A;  1EY6 A;  2E74 C;  3PIO 3;  3I3C A;  3QO2 A;  4OO1 G;  2B8F A;  2A6H C;  1QCB D;  3S9W A;  1CT1 D;  2NWG A;  5ELB A;  2A5H A;  3RUZ A;  1SXT A;  2H1E A;  2IW3 A;  4RGT A;  3J7Y W;  2CVR A;  2TMP A;  2EOT A;  2JE6 I;  1BCP D;  3OSO A;  1BDO A;  1Q12 A;  2R7Z B;  2NN6 I;  1GUG A;  4ZK9 B;  2B2W C;  2J7Z A;  3I70 A;  3VR3 A;  2RDG A;  3QB3 A;  4HSV A;  1S5F D;  5FOB B;  2FMC A;  2L1B A;  3T51 B;  1KDB A;  1SNO A;  1IW7 C;  5JVH 3;  1FNV A;  2CHB D;  4C3I B;  1V1P A;  2M00 A;  4A3B B;  1F9Q A;  3D31 A;  1XWE A;  3MXG A;  3TZD A;  3SVM A;  1EEF D;  4P2C B;  4DN4 M;  4FO2 A;  1EZ8 A;  3NWT A;  1BBX C;  1KNA A;  1STN A;  3NUC A;  3RD4 A;  4OHJ A;  4H44 C;  3A56 A;  1NUC A;  2XWJ B;  1SNQ A;  4RA8 A;  5EPJ A;  2D62 A;  3C3L A;  1GUO A;  2SOB A;  4KI0 A;  3NWS A;  3I72 A;  3LWU A;  2JYO A;  1WTO A;  3ONA B;  5CV5 A;  3J80 E;  1UNS A;  2WIN B;  1HCZ A;  2L12 A;  1VF5 C;  3PV0 A;  2VUM B;  4A3F B;  2Z8L A;  1OXV A;  3MXN A;  4BS9 A;  4H0L C;  2H4O A;  3S2H B;  3ERO A;  2EVB A;  5EBC A;  4KN4 C;  1ET6 A;  2KOL A;  3T53 B;  3IAY A;  4KJN A;  4DF7 A;  3K5M A;  4XXE A;  2VNU D;  3PUX A;  1DOM A;  1TS2 A;  5ISR A;  3PIP 3;  2F1M A;  5M3F B;  2YYZ A;  2EYL A;  3J81 E;  2JA7 B;  5LL6 X;  1GHJ A;  3I8Z A;  3GV3 A;  4CBV A;  2EE1 A;  4IFD I;  4MN3 A;  1WTQ A;  2WKC A;  1JIC A;  3ZYY X;  3HOU B;  3T16 A;  1ET9 A;  4KHZ A;  2FHT A;  5C5L A;  1K8M A;  5CV6 A;  2B2W A;  1RTN A;  3QG1 A;  3RLF A;  1AFP A;  5EPL A;  5KGU A;  1G2S A;  2TSS A;  1OXS C;  2NN6 G;  1B44 D;  2RSN A;  3VR2 A;  3D4W A;  5I6Y A;  2FFK B;  3SR1 A;  4NKL A;  4LAA A;  1ROD A;  1SE3 A;  1TII D;  3NTI A;  1XYI A;  4QCL A;  1RCV D;  3KLS A;  5DEH A;  1K8O A;  1JQY D;  3OHX C;  1XX8 A;  4XYQ A;  2KEC A;  1SYC A;  4XQJ A;  3V2T A;  2N55 A;  4K6L A;  1OO9 B;  1F2M A;  1IKM A;  1CK1 A;  2F0P A;  1I4R A;  1CA5 A;  3SEB A;  4A3M B;  1I4Q A;  5I2Y A;  1ENF A;  2E2J B;  4HTH A;  4KV6 A;  1LAB A;  5EKK A;  2B2V C;  1SFO B;  3N6R A;  4OIK A;  5JEA H;  4KY7 A;  4A3E B;  2HUG A;  3TP5 A;  1V43 A;  1LTB D;  4RWS C;  2QIL A;  1YNJ D;  4ZAI A;  4IUQ A;  5CV9 A;  5C6A A;  1ML0 D;  1PTO F;  1BNZ A;  2M9V A;  1H9R A;  2AQ3 B;  4PMB A;  1F9R A;  1TT2 A;  2XRQ D;  2A69 D;  4DXG A;  2F0E A;  3D6W A;  5T1G A;  3CHB D;  1NSN S;  2SDF A;  3Q6S A;  4CHT B;  2EY6 A;  1BR9 A;  2AWO A;  2F03 A;  1U4M A;  2OT2 A;  3LNN A;  1NR2 A;  2GA4 B;  4ID6 A;  4FF1 A;  1AW7 A;  4RGM A;  3FKI B;  4PMC A;  3GTG B;  3A8I E;  5FLX E;  5KYL A;  1RHP A;  4ZKB B;  1HUM A;  1O7L A;  2F0M A;  1PLF A;  4K5V A;  5E1F A;  2R61 A;  1VDZ A;  3FRP B;  3GD7 A;  2D5D A;  1AZP A;  5EBD A;  3E0J A;  1B1Z A;  1TR5 A;  2PYK A;  4PMW A;  4C3J B;  3I4L A;  3TSS A;  4IFD G;  1IKL A;  3C46 A;  5EKI A;  2AWN A;  2EYF A;  1EY8 A;  1QOH A;  2DNC A;  5CR3 A;  2MGS A;  5E4W C;  4Q5V A;  3AMU A;  3NBH A;  1PTO B;  3K57 A;  2HQE A;  5IIF A;  4MHE A;  3Q0A A;  5E3F A;  3VYU A;  2O5J C;  1FNW A;  1PTO C;  5I9P A;  1Q3L A;  1BO0 A;  4RKB A;  1DJR D;  1OXU A;  5ELE A;  3V05 A;  3NTK A;  3D4R A;  2BE5 C;  4K5X A;  5FKA C;  1MI2 A;  4L6T B;  3HKZ B;  5I6W A;  5KIX A;  3IFD A;  1CZG A;  2MJ8 A;  3FDT A;  1TY0 A;  1S5D D;  3RZO B;  1Y1W B;  1K83 B;  4TKO B;  1IHZ A;  3I91 A;  1EEI D;  2I46 A;  1U4L A;  4XT3 B;  1BXT A;  1GXD C;  4KTA A;  4ZYS A;  2E75 C;  2R93 B;  2EXZ A;  3C1E A;  4IAL A;  2B2V A;  1S4Z A;  3E6Z X;  4OIJ A;  1TQO A;  4DXF A;  5G3L D;  1Q8I A;  2XRS D;  4X3K A;  3VYR A;  2F0F A;  4HSP A;  4K5W A;  5BN4 A;  4FXG C;  3K5L A;  2KED A;  2V4D A;  3CRK C;  1HUN A;  1V8Q A;  4XT1 B;  2PZT A;  1QNK A;  5JAV A;  1WD1 A;  1JOR A;  3S1N B;  4E6I A;  2F0H A;  4DA2 A;  3ERQ A;  1H9S A;  5I2X A;  1KDC A;  2JA6 B;  5DNF A;  4RHR A;  1I4H A;  2KCC A;  4I65 A;  1CHQ D;  3V96 A;  3FPU B;  2F0K A;  5C3X A;  2WP8 J;  2JEA I;  3PO2 B;  1ICW A;  1L0X B;  3EA6 A;  1A2U A;  5KNB A;  1IYU A;  1QG7 A;  1EWH A;  1DON A;  2NZ1 D;  2CW0 D;  1H9M A;  2Z4I A;  1BCP F;  1E2V A;  2K5Q A;  2JEB I;  2K1B A;  2VB3 X;  4LMQ D;  4K14 A;  1KLU D;  2WB1 B;  2E2H B;  3FMC A;  3BDL A;  5COR A;  1SE4 A;  3GV6 A;  4K8I A;  3EJI A;  2K05 A;  1SNP A;  1OXT A;  4K8J A;  5KEE A;  4ZKC B;  5E4X A;  1S5C D;  4KY5 A;  4I7Z C;  4QIW B;  2LS0 1;  4Y7N B;  3DHQ A;  4F87 A;  5IT9 E;  2ZXP A;  2L5T A;  1VF7 A;  4IZ8 A;  3OPO A;  5CGK A;  5C0X H;  3A55 A;  1LTA D;  2DNE A;  3HEJ A;  5EKL A;  2F3V A;  2B2Y C;  4RCO A;  5IGB A;  1U4R A;  3OWE B;  3BVZ A;  1B53 A;  1STH A;  3BDC A;  1Q1E A;  5C3E B;  1PXU A;  2LY7 A;  3TP7 A;  5LHY 1;  1SYG A;  2MHV A;  1EY5 A;  2F0O A;  4N9P A;  2MPM A;  1QNU A;  2KVM A;  2IL8 A;  1H9J A;  2BA1 A;  1BCP B;  4FP5 D;  1Y8N B;  1BUV T;  4IUR A;  5CBA E;  2RVL A;  5HUR A;  3WDN A;  1BCP C;  4O1N A;  4V0B A;  1JWU D;  1J8I A;  2XSC A;  3H94 A;  4M1U B;  2WAQ B;  1EU3 A;  1QIL A;  4ZUI A;  3G7L A;  2KEE A;  1U4P A;  3S16 B;  1I4X A;  2PZU A;  4ZUJ A;  3I73 A;  3BZD B;  1EU4 A;  1C48 A;  3JAM E;  3E5S A;  5KRU A;  3NSW A;  3HOY B;  5IGG A;  3SHL A;  5JOB A;  3NBI A;  4CJ2 C;  1V1O A;  1B50 A;  3DEO A;  3TN2 A;  1RJT A;  3S17 B;  4ZLT F;  5CC4 A;  1H9K A;  4A3I B;  1KLG D;  2HCI A;  3LX0 A;  3MZ5 A;  1HTL D;  1CA6 A;  4OO1 H;  5CV7 A;  1F77 A;  3FVQ A;  2M2L A;  2ICI A;  1EY4 A;  1Y8P B;  1OXX K;  3MFG A;  4CJ0 B;  1PZK D;  2EY1 A;  4RH6 A;  4EQN A;  4S3S A;  1EYA A;  2QCP X;  1SYD A;  5A35 A;  4IQZ A;  2KHS A;  2O2L D;  1S5B D;  3TZU A;  3GTP B;  1EFI D;  5IOD A;  3KBG A;  2XN9 C;  3NQI A;  4C1N K;  5FO7 B;  2E2D C;  4HAE A;  2SNS A;  1ZXT A;  3R2I A;  1ONL A;  4IUU A;  3Q22 A;  1FD7 D;  3S1M B;  3M4Y A;  5IOC A;  3HOV B;  3BVG A;  1HHV A;  3DXJ C;  1AEX A;  5IGF A;  2LKV A;  2EJF C;  1HTP A;  1SJE D;  3OIP A;  2B2T A;  1E2Z A;  1G2T A;  1U9R A;  4L8J A;  1HFN A;  2X6L A;  3QJY A;  3MFY A;  2B2Y A;  2IWH A;  1LTI D;  4CJ1 B;  1GHK A;  5A2Q E;  1AP0 A;  1Q90 A;  2A73 B;  3K5O A;  1DOK A;  3GTQ B;  3W3A A;  2K28 A;  4V19 0;  1STG A;  3HGB A;  3DEP A;  5ELF A;  4BA2 I;  5D3D A;  3HOW B;  1WTP A;  2XVS A;  4QB4 A;  1F9S A;  3WOE A;  5FO8 B;  2BCO A;  2L9H A;  3DM1 A;  5JEA J;  1EY0 A;  1G91 A;  4C3H G;  5CYU A;  5IGD A;  1I4G A;  1E2W A;  3K5N A;  1SSO A;  1EYD A;  1KTK A;  2F0I A;  3VA7 A;  2B63 B;  3BVM A;  4PQX A;  3I4N B;  1WTV A;  1GUN A;  1EIG A;  2HDM A;  1ZYR D;  1ENC A;  2F0T A;  1XXG A;  2DN8 A;  4ME5 A;  1PRT D;  4NMZ A;  2EYP A;  3SK4 A;  5J39 A;  1UEA B;  1G8Z D;  1RD9 D;  2LMC B;  1B4O A;  4G7O C;  1PTO H;  4HCS A;  1TKW B;  2NVQ B;  2DY8 A;  1RDP D;  3ND8 A;  1A3V A;  1TVX A;  3F2U A;  4C56 C;  2RSO A;  1O7Z A;  5IGE A;  1SYB A;  4EQP A;  3K6O A;  1Q1B A;  1PMR A;  2NVX B;  3D8G A;  1C8C A;  3SK8 A;  2EYJ A;  1D5M C;  2NTT A;  4J8Q A;  1H9S B;  2EY2 A;  2A6E D;  3MTS A;  1SAP A;  4OGQ C;  1VMP A;  4KN7 C;  2L4N A;  2IJ0 A;  2A69 C;  1FR3 A;  4HCE A;  3BDO A;  3J7A F;  4WRD A;  2RA4 A;  2K6A A;  1ILQ A;  5M5Y B;  2SNM A;  1DD2 A;  1A3T A;  3K7A B;  1HFG A;  1JOO A;  5C4H A;  4U68 A;  2PQE A;  5JPN C;  5DM7 3;  1SBB B;  4ZRZ A;  3M3Y B;  1WVL A;  4DK1 A;  2K01 A;  4RCN A;  2N88 A;  3CQZ B;  4RFB A;  2B39 A;  2NTS A;  4TRD A;  4FYD A;  1CZW A;  1STE A;  2XWB B;  3J80 L;  1STA A;  5G3L F;  2IPK D;  4K2K A;  3NE5 B;  3CU7 A;  1HXY D;  3K58 A;  5K36 G;  5T1I A;  3MA2 B;  3VR6 A;  2WII B;  1KAA A;  1EY7 A;  1Y69 U;  3QWN A;  4LJZ C;  3L3O C;  4FNF A;  3SE0 A;  4HR7 B;  3C1F A;  1F2L A;  4KHV A;  3A8K E;  1LTG D;  1EWC A;  4RHS A;  3KF8 A;  3AU7 A;  1AZQ A;  4FXK C;  3TBI B;  2JSO A;  4FVM A;  4FXD A;  3J81 L;  2F4I A;  3M4O B;  4DGZ A;  1RTO A;  3ITP A;  3X3N A;  3BYT B;  4DFA A;  3T13 A;  2OXP A;  4K2L A;  4O42 A;  4BA1 I;  3C2P A;  2K32 A;  4G7H C;  2HCC A;  3HRZ C;  1DYQ A;  2A68 C;  3PUV A;  4RGN A;  1TS4 A;  5EPK A;  1A6X A;  4PV1 C;  2FJ2 A;  1BF4 A;  3OMG A;  5C44 B;  2IX0 A;  1J9O A;  1DCZ A;  5EGT A;  5KNC A;  1II3 A;  4M8A A;  4IFD H;  1A3U A;  4C3I G;  1D1K A;  3Q24 A;  1EIH A;  4ILW A;  5NUC A;  1WTR A;  2A74 C;  2E2I B;  1MSH A;  4IUV A;  4KKU A;  1JOQ A;  1LTS D;  3I4M B;  4A93 B;  2C5C A;  3GTK B;  5BN5 A;  3S1Q B;  1KAB A;  1SND A;  1X3P A;  2JXM B;  4FF2 A;  4YIJ A;  4TQU S;  1F9P A;  2VXW A;  1LTT D;  5J22 A;  2ZT9 C;  4DNT B;  1SE2 A;  2J4X A;  2RKS A;  3HP3 A;  5AFW A;  1C4Q A;  1Y1V B;  2AQ1 B;  3NQT A;  1D5Z C;  1TU2 B;  3X3M A;  2G9H D;  1KNE A;  5C0X J;  1SMY D;  1EQV A;  3T4A C;  1TWA B;  2WAC A;  2EDG A;  3DWQ A;  1UAP A;  3KUP A;  4NW2 A;  2EY5 A;  1QJO A;  1MSG A;  2Y0S B;  2X6G A;  3SXH A;  4HN7 A;  1LLR D;  1CTM A;  2F0W A;  5M5W B;  4H7B A;  4F7X A;  1WD0 A;  2NVY B;  1HRJ A;  3GP7 A;  3DUZ A;  2KA7 A;  2AQ2 B;  3RZD B;  1EY9 A;  4CKE A;  5IGC A;  5I9O A;  3SK6 A;  1PFB A;  4CKC A;  2JA8 B;  3L9A X;  2EJM A;  2WKD A;  3NHH A;  2K03 A;  1B2T A;  3O13 A;  1YNN D;  1EZ6 A;  4NDX A;  1JOK A;  4QUC A;  2KQ3 A;  5LL6 S;  2B2T C;  4H13 C;  5C3W A;  1I4P A;  2LFN A;  4XTC S;  5FLX L;  1ESR A;  2Q8R E;  1QB5 D;  2HDL A;  5M9O A;  4N9T A;  1I6V C;  3OWF A;  2Q8T A;  1HQR D;  3M7N A;  3FEW X;  4XQQ A;  1TWH B;  1WTW A;  1JC7 A;  3OOC A;  4UDU C;  3TME A;  3URY A;  4KD4 A;  1D1I A;  2A6H D;  4XDX A;  4FF3 A;  3NPP A;  3EFX D;  1CQV A;  2AUK A;  4PNY A;  2KCN A;  3KBX A;  2K33 A;  2IX3 A;  1SYE A;  3N52 A;  3TP8 A;  1T5X D;  4B9X A;  3U9O A;  1F2Z A;  3S15 B;  2OF1 A;  3IFT A;  2ID0 A;  4JK1 C;  1R4Q B;  1L0Y B;  4WFN 3;  5BN3 A;  2EYO A;  1EOT A;  3A8J E;  3R93 A;  4F88 A;  4RAU C;  4XQN A;  1VMC A;  1CQF A;  3PMF A;  2NUC A;  3LWE A;  2Q8I B;  4HED A;  1IW7 D;  4KKT A;  3OMC A;  2IX1 A;  1RKN A;  4C2M B;  4NP5 A;  4K6D A;  1ZKO A;  1LT5 D;  1PZI D;  1PDQ A;  4WJW A;  3UI2 A;  4WOR A;  1JB3 A;  1ZEQ X;  3VR4 A;  3R3O A;  1S5E D;  3EQL C;  2FMM A;  1LTR D;  1SDF A;  3MAQ A;  1B9M A;  1AN8 A;  3S1R B;  2JP1 A;  1DOL A;  2R92 B;  1JR0 D;  3WOF A;  3EVQ A;  3NK9 A;  4IUT A;  3PUZ A;  1KDA A;  3D4D A;  4G57 A;  5D14 A;  5TSS A;  5HGT A;  3T56 B;  2NBF A;  1X3Q A;  3DMU A;  4ABN A;  2D9U A;  3MC0 B;  4DK0 A;  5I4D A;  1I50 B;  1EYC A;  1M8A A;  2K5D A;  1NAP A;  5M5X B;  1DM0 B;  5CMD A;  2F0S A;  1JWS D;  5C4J B;  5F2D A;  1E0B A;  5J1Z A;  3AB9 A;  2ZXO A;  5KYI A;  1NCV A;  1PRT F;  2IT1 A;  2EYM A;  3P20 A;  1FGB D;  1GOZ A;  2EZV A;  2YU9 B;  4KJO A;  3OW7 A;  3M7G A;  4J6H A;  1UUP A;  3I90 A;  4BY1 B;  4C3J G;  2JA5 B;  1TWC B;  2K5W A;  3IL8 A;  1PZJ D;  4G7Z C;  3R8B A;  2EJG C;  1MBY A;  1I3Q B;  5C5M A;  2F0U A;  2QDB A;  1QE6 A;  4X3U A;  4F8M A;  4OL7 A;  1M4V A;  4RKL A;  4EQO A;  3S14 B;  4TSS A;  1TS5 A;  3CRL C;  1STY A;  2ZXR A;  3MHB A;  4GZY C;  3G6J B;  5CV8 A;  5JEA G;  5IT9 L;  4KY6 A;  3MWY W;  4QMG A;  1SNC A;  2QF7 A;  1PFM A;  5CBE E;  2NYZ D;  3H09 A;  1R4P B;  3FPP A;  5D65 A;  1HPC A;  3HS0 C;  1Y8O B;  3NXW A;  2D2C C;  2F0Q A;  4DU9 A;  3NP8 A;  2E76 C;  5M3M B;  3H3V C;  1PRT B;  1ZYR C;  1LAC A;  3IKJ A;  1PRT C;  4A3J B;  2F0G A;  2SEB D;  1TY2 A;  1X32 A;  4LK1 C;  3KLR A;  1GJX A;  2X69 A;  2RDH A;  2QEJ C;  5DAU A;  1GUS A;  2XIW A;  2F3W A;  2FIN B;  1QWY A;  4X3S A;  2ICE C;  2PNR C;  4BBS B;  1ESF A;  4J1M A;  2EPB A;  2XNA C;  4IN3 A;  1YNJ C;  3JAM L;  5JVG 3;  4QUF A;  5COY A;  1EL0 A;  2PW7 A;  3KLS X;  1DXM A;  4C1N I;  4BWG B;  1HQM C;  3P75 A;  5KND A;  3P7J A;  3BS1 A;  4KMU C;  2NN6 H;  2G9D A;  3W2D A;  2A6E C;  3VYT A;  4IUP A;  3VYS A;  2KUM A;  2PCF B;  3MVV A;  2PPB C;  3GQB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...