5IGDA

Crystal structure of staphylococcal nuclease variant delta+phs t62h/i92e at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFHKKMVENAKKIEVEFDKGQRTDKYGRGLAYEYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS T62H/I92E at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5igdA00
3D6CA 5IOCA 4I65A 2F0NA 3NHHA 3QOLA 4HMJA 4OL7A 4B9XA 2RBMA 4H7BA 4DFAA 3MVVA 1KABA 5CR3A 1EY6A 4DU9A 5EKKA 2F0KA 1EYCA 1EZ8A 1JOKA 4K2KA 2HQEA 2ENBA 4K5WA 3NQTA 3EVQA 1F2ZA 3QB3A 1EY9A 5I6YA 1SYEA 3MZ5A 4N9TA 4EQPA 1ENCA 3D4WA 1NUCA 3TP7A 2F0QA 4B9WA 2F0MA 1II3A 1SNDA 4KY7A 1KDBA 2OEOA 4R8NA 2F0OA 5CV4A 4KTAA 1JOQA 4IALA 4YIJA 4PNYA 5K5PA 5IGEA 4K5VA 5HURA 1TR5A 2EYPA 2F0WA 1NSNS 1JORA 1KAAA 1STYA 5CV6A 4EVOA 3P1HA 1STBA 3SK5A 2F0FA 1A3TA 1SYDA 3DHQA 4HMIA 4LAAA 3V2TA 1EY8A 4KJOA 4EQNA 2PZTA 4K6DA 1EZ6A 4IZ8A 5KYIA 3C1FA 2OXPA 2SNSA 1EY0A 4K5XA 4PMBA 5CC4A 3SK8A 3OMCA 4ME5A 1EY4A 1F2MA 1STGA 3D8GA 4WORA 5JOBA 5C5LA 2F0JA 1EY5A 2EYJA 2F0PA 4KHVA 4KY6A 1STHA 5DEHA 5E1FA 5J22A 5DAUA 5EKLA 2PW5A 3SR1A 5I9PA 5C5MA 2RDFA 4EQOA 4ZUJA 1SNQA 1ENAA 3BDCA 2KQ3A 3U9OA 5IGGA 5C4ZA 2EY1A 1SNMA 2F0HA 4K8IA 3NXWA 2PW7A 3SK4A 4QB4A 5J1ZA 3HZXA 1EQVA 1TT2A 3ITPA 2F0UA 2O4XA 3SXHA 4KV6A 4K8JA 4J6HA 2F0GA 2KHSA 4KY5A 5NUCA 4F7XA 5J39A 4HTHA 4NP5A 2F3WA 1SYFA 2EY5A 1SYCA 5CV7A 1AEXA 2F0LA 3EROA 2PQEA 3P75A 5CV8A 4DF7A 2EYHA 2QDBA 2EY6A 1SNOA 3R3OA 3BDLA 5CV9A 5E3FA 3SK6A 3DMUA 1KDCA 3T16A 3TP5A 2EYOA 5HGTA 5F2DA 3QOJA 4QMGA 4RKBA 4E6IA 2F0TA 2RKSA 3MXPA 4DGZA 3NUCA 2EYMA 4K14A 1EY7A 4G57A 4NMZA 2EYLA 5IGCA 5IGFA 4KJNA 2M00A 4K2LA 1F2YA 4KD4A 5IIFA 5KGUA 3NP8A 5IODA 5KIXA 5KYLA 2F0EA 2SNMA 3NK9A 4IUNA 3HEJA 5EGTA 5KEEA 4NDXA 3S9WA 4TRDA 1IHZA 3TP6A 5C3WA 2WACA 4MIUA 1SNCA 5ISRA 1EYDA 2F0VA 2PYKA 3T13A 5CGKA 4PMCA 2PZWA 1STNA 3SHLA 5JAVA 1SYGA 1SYBA 5M9OA 3PMFA 1U9RA 2F3VA 1EYAA 2F0DA 3OWFA 5IGDA 1RKNA 2F0IA 3RUZA 5C6AA 5I6WA 1KDAA 4ID6A 2EY2A 2EXZA 3ERQA 5CV5A 4J1MA 4N9PA 2SOBA 2EYFA 5C4HA 5I9OA 1A3UA 3EJIA 4ZQ3A 3TMEA 5IGBA 2OF1A 3VA5A 5KRUA 2LKVA 3E5SA 3OMGA 4ZUIA 2F0SA 3MEHA 4QF4A 5C3XA 1TQOA 1A3VA 2NUCA 3OSOA 4WRDA 2PZUA 3LX0A 3MHBA 3C1EA 4RKLA 1STAA 1SNPA 3TP8A 3D4DA 4S3SA 4ODGA 4KD3A 4NKLA 4F8MA 1A2UA 1JOOA 3H6MA 1A2TA
chains in the Genus database with same CATH superfamily
4IUQA 3D6CA 5IOCA 1HFNA 3J81j 1JJ2A 1S5FD 4HAEA 4UP7A 3F2UA 4GKKQ 2I5MX 1NBWA 1HXYD 5FLXL 1EY6A 4QCLA 3U4ZA 3MEFA 2V1CC 4K5WA 2G9HD 3OPOA 3QB3A 2E5LQ 5C0XG 2R92G 2CFMA 3GTGB 5CV4A 2B63B 3D3RA 3K7AB 5A2QE 4DR3L 1ENFA 3FPPA 2C5CA 4OHJA 3DHQA 1IW7D 4IPGA 2E2JH 4EQNA 2JYOA 2PZTA 1OXXK 2F3IA 4KK7A 3KLSX 3C2PA 1YJNA 4JPBW 5C0XJ 4BBRG 2NTSA 3ERSX 4RHRA 2EDGA 2K50A 1YHBA 4PV1C 2OWOA 4DV5L 4L5RC 3HOXB 5C5MA 4GZYC 3S2DH 2WB1G 2DN8A 2KQ3A 2L12A 1K0SA 3X3NA 4C3IG 1AZQA 1NCVA 4GLVB 4A3KB 5K36G 3U50C 4BY7G 1MGSA 2ASBA 3AU7A 1SFOH 2DJFC 2R7DA 4IQZA 4DN4M 5M5WH 4DUYL 1QNKA 3J81c 3P75A 4HIMA 1J6QA 3G6JB 4RKBA 3MXPA 5BR8L 2OTLA 5IGCA 1E22A 4CDFC 2LMCB 4C56C 1FVIA 4P71A 3S24A 4G7HC 2PO4A 3S9WA 2YTVA 2WINB 2CKZB 2I07B 4X64Q 2F0VA 5FOBB 3DEPA 1V43A 4O0AA 1PRTB 3SDZA 1EYAA 2CW0D 4A3BB 4OIJA 1UWVA 3RUZA 5I6WA 4DXGA 4I7AA 2VW9A 3Q6SA 3HOUB 5LMUQ 5BN3A 5C4XB 4C3JH 4R4QA 3AMUA 1IL8A 3I56A 1IBKQ 1LABA 2TSSA 1JT8A 2LSSA 4ILWA 2VUMB 3PQIA 3VYTA 3RMHA 3Q23A 3TP8A 1NNXA 3S17H 3RLOA 2XVSA 3STBC 1UE1A 2WAQE 1H9KA 2F4VQ 1PTOH 2JK8A 4DU9A 4X6AH 4G7ZC 1FR3A 1XXGA 2VQFQ 3J81L 3OTOQ 3ICEA 2L11A 3J80E 3AFQA 3CU7A 4DR6L 2JA5B 1LO5D 5ELEA 1VQPA 3NEMA 4IALA 1GUOA 4JOIA 1PH4A 2QEXA 4DV1L 2B2YC 4CJ2C 1FNWA 3HOWH 1YJWA 3AB9A 1J5EQ 1E0BA 4IPHA 5IWAQ 2RDHA 1QCBD 2WKCA 5IYBG 4MN3A 4PZ6A 1EQQA 1B3AA 3KLSA 3CQZH 5CC4A 3K59A 4IJHA 3S1QB 1RTOA 2KHJA 2EIFA 3CMEA 1YZ6A 4N8FA 5E1FA 3J7ZC 1Y1VG 3BZCA 3QO2A 2QKIC 2WB1E 3H15A 2E2IH 4DAVA 1EQVA 1E2VA 4IOCA 3PUVA 3A54A 4KY5A 1PYBA 2IJ0A 3KYHC 5EPLA 2IY5B 4M8AA 2K5WA 4MTKA 1TU2B 4Y7NH 1SYCA 2KA7A 2HT1A 3S14B 4B3RQ 5IT9c 1S5CD 4UY8C 1S5DD 4GKJL 3TEHB 1D2BA 5CV9A 5CBEE 4L6TB 1I4RA 1TWCH 4RHSA 5IGFA 5LHY1 1S5ED 1PYWD 2K03A 2R7ZB 3TBIB 3CCUA 1L1OB 2MO1A 1HR0Q 1HUNA 4LF8Q 1SLJA 2K5DA 1DOLA 5CGKA 1IXRA 1MIUA 1RIPA 4HJ7A 1XJVA 3GTQB 4DAMA 1VQBA 3CCRA 2ES2A 3PMFA 2K33A 3F2DA 1G91A 1XNQL 4GNXC 2K05A 4UAIA 2E2HH 3CAMA 4MTNA 1B9NA 5C0XH 3CCLA 2R92H 1GUSA 2D0OA 4C3HB 2EJFC 3PUYA 3CXCA 1Y1WG 2GVBA 4JI1L 4FO2A 1IBKL 1X3FA 3H94A 4QIWE 1Q82C 3M85A 1R4QB 3A8KE 3ND9A 3GTMH 1K3BC 4RMFA 1AE3A 4OXPA 1EIYB 4NXMQ 3IL8A 2F4VL 2CVRA 1UE5A 4XT1B 4HMJA 3QOLA 4EX5A 3T51B 4BBRH 5CMDA 1BR9A 4A3IB 1P8LA 3HOZG 1IBMQ 2B2UA 1L0YB 3CD6A 4QIWB 2BH2A 1M8AA 4V0BA 3CC2A 3MXGA 1NTGA 3NQTA 5IT9L 3OTOL 3K57A 4LF5L 5CBAE 1KLGD 2F0QA 4C3IH 4X65L 2DUDA 3CCEA 1E3PA 1AFPA 1FGBD 4A3DG 2B29A 3M4PA 5K36H 4X62Q 1STEA 3T53B 4BY7H 1J9OA 1CKMA 1PRTF 1SYDA 4L5SA 3HGBA 2SEBD 4R4IA 4DK6C 3N52A 3C1FA 3DUZA 2M9VA 3S1MB 4HIKA 1CKNB 3ULPA 1JCKB 2H1EA 2A68C 1CM9A 1NMFA 2KCCA 4IN3A 1E1TA 1ENAA 1SNQA 1I6HB 2EY1A 1FJGQ 1DONA 4K8IA 3NXWA 2DNEA 3PUWA 1TT2A 3PGZA 4A76A 2CCZA 1EEID 1H9RA 5JVG3 4DV4Q 3RNUA 4K8JA 4JCVE 2NVXH 5J39A 1ICWA 5JEAG 4B3RL 1CHQD 3TRZA 4QJFA 5FO9B 1K83H 2EYHA 2VXWA 1D1KA 3BDLA 3KF8B 5JJLA 5F2DA 3FRPB 2C9OA 3KF6A 3GTLH 2B8GA 2D62A 5GROA 1EIGA 2R6GA 3DWAA 4DKAC 5GADC 1PFMA 1BCPC 3GV3A 3L2PA 4LF8L 4B08A 1G8ZD 4YWMA 2JXMB 5FLMG 3OHXC 1KRSA 3J7A5 2NVQB 1D1IA 4QGUA 2Y0SB 4JBKA 1E2WA 4XIGS 1I4PA 4BA2I 4FF3A 4A3GB 1DCZA 4A3EB 2AQ3B 4ID6A 2A69C 2ZT9C 4F88A 3PV0A 5HGQA 3TMEA 1K9MC 1TVXA 1VMCA 2Z4HA 4ZKCB 1Q90A 2JN4A 5C3XA 2QA4A 1ZYRC 1TQOA 1N34L 2RCFA 1AP0A 5IYBH 3C1EA 3HKZG 3H6MA 3M4QA 4I65A 4H0LC 1F9PA 5DM73 4ZLTF 1SE3A 2B2YA 4C2MB 4JV5Q 4K2KA 2ENBA 1VQ5A 1Q81C 1HJPA 3BVMA 1B8AA 1EY9A 3CCQA 1Y1VH 1B2TA 3GTJH 4DV0Q 2Z6KC 2RHSB 4CJ1B 1GM5A 2L15A 5KNCA 2YTXA 5C3EB 4X62L 2JEBI 3NE5B 1BQQT 2NVTB 3R93A 2QDLA 4DK1A 3P1HA 4NB3A 1A3TA 1GUGA 4LF9Q 1B7YB 1VF7A 1PRTD 4BBSH 4LUVA 1C0AA 2SNSA 1YNNC 3SK8A 2VY3A 3D8GA 3MXUA 5M3MB 1CHPD 2EYJA 2R3ZA 1N32Q 1S3OA 1HA6A 1AE2A 4A3MG 1PH3A 1I4QA 3M4OH 1HNZL 3A55A 1N8RC 1VQLA 4KMUC 4YHHQ 1S4ZA 2Z6BA 1JR0D 4DV4L 4BXXG 4J6HA 1P16A 1TWGB 3L7ZC 4K6LA 3VYRA 1D5ZC 4GN3B 1XNRQ 1SE8A 1LTGD 2NTTA 1Y1WH 1GKHA 2B2TC 4BA1I 3GP7A 5ELOA 1H95A 2M00A 5IIFA 4GNXA 1WCMH 4B3MQ 2SNMA 2MP1A 2AMCB 5EPKA 2WACA 1K3RA 3FMCA 1Q3LA 1HZBA 3KF6B 1MD2D 3MWYW 3TN2A 2EPBA 3K0YA 1U0LA 3I7FA 3H0GG 2JA7G 5C6AA 2JA6G 3NWSA 5IGBA 3KJOA 1EWCA 4A3DH 1HRJA 1BO0A 3EFXD 2AUKA 4LFAQ 2SDFA 1DYQA 3KJPA 1WTWA 3PF5A 4NPSA 1WTQA 4DR2L 1HTPA 2IWHA 4OL7A 2VL6A 1HNXL 4LF4Q 2J0TD 3UE0A 2IL8A 2ICEC 1PYSB 4DV0L 4EQPA 3RZOB 3MXNA 1VDZA 3BJUA 5CV6A 4KKSA 4LF9L 5JEAH 5IP9G 1PMRA 5FO8B 4FF2A 1EOVA 3I4OA 4IFDJ 1HNWL 3RD4A 1EY4A 3BZKA 4JBMA 5C4JB 1LTRD 1PDQA 4AIMA 1NR2A 4JI5L 4HJ8A 1GD7A 2QGQA 3S16H 4EGVA 1SNMA 4C3JG 1U4MA 4DAYA 3TS2A 4FXDA 5FLMH 4DR3Q 4ME3A 1DJRD 3ZJYC 3ITPA 3SXHA 3I70A 1K0RA 4ZK9B 1ASZA 1O7ZA 3GTOB 5J3BA 1CSQA 2NN6I 1CA5A 4JI0L 1NMGA 3PUXA 4UHVA 3BVGA 1H9MA 4R9WA 1TKWB 4YCWA 1PH1A 3ER0A 2F0TA 2RKSA 4DV5Q 1RL2A 3T1HQ 4IPCA 2PMZE 3HOXG 2K4KA 4DR7Q 1MKHA 2VZAA 4PMCA 4LK1C 1K8GA 1A6XA 5TSSA 2F0IA 4MNOA 3BG3A 1B53A 4KN7C 2P5ZX 3X3MA 1SROA 4EQ5A 5BR8Q 1QOHA 1F9RA 2LKVA 3K80C 1WVLA 5EKIA 5JJIA 3BVZA 1X9NA 2BCOA 4CKEA 1UEAB 4CDEC 2A74C 5E4WC 1SNPA 2Z6KA 3M3YH 1TWFH 1J8IA 5D65A 5GAGC 2F0KA 1WFQA 1JOKA 1TS3A 4A3MH 3G4SA 1M4VA 1YNJC 5I6YA 4A3CG 3S2DB 1U4RA 2NBFA 2CH4W 1K8AC 1TY0A 3IRBA 4R8NA 1TR5A 3CPWA 1H9JA 2JQOA 1SFOB 4GOPC 2E8GA 2N8NA 1YHQA 2VUMG 4K6DA 1OTCA 1SRUA 4JI8Q 1OXTA 4YWKA 2HCIA 4OWTB 4B3SL 1LT5D 1STHA 5LL6S 2J4XA 2JEAI 4AYBB 5J22A 1WTPA 1IL2A 4BWGB 3K7UC 1PZJD 4DR6Q 5IGGA 1TWHH 2MFIA 2HHHL 2UU9Q 1PFSA 3SK4A 3IFTA 4A93B 1E2ZA 1OXVA 4DV1Q 3F2BA 1HTLD 5NUCA 2K14A 1IW7C 4R4TA 4DK3C 4TSSA 2B2VA 1MBYA 3H0GH 2F3WA 1KIXA 2JA7H 2MUYA 4DAYB 3I4NG 2QDBA 4O1NA 2JA6H 1YNXA 3I8ZA 3T16A 3RLFA 5C44G 1PH7A 3T1HL 1EY7A 1ET6A 1M1KC 5EJWA 2DGYA 3J81i 4KJNA 1SXTA 1DZ1A 4A3JH 3HEJA 3JAME 4QL5A 4DR7L 2NVYB 3M7NA 1EWIA 4NW2A 2ID0A 4P2CB 3T13A 2UXBQ 4DV2Q 3QIAA 4B3TL 1XTCD 1GHJA 1SYGA 1PTOB 2AKWB 1XPRA 3NPPA 1GXDC 4JI4L 3D31A 5ELCA 3DM3A 3VDYA 2RDGA 1X55A 4JVZA 4RGMA 2QCPX 4GKJQ 3ERQA 2K5VA 4LFBL 2I0QA 1DXMA 5I2YA 3K5NA 1SMYC 4HJ5A 2EZVA 4HSPA 4PQXA 5IP9H 2TMPA 3A7LA 3MHBA 5IYCG 4U673 4RCOA 4S3SA 5T1GA 1ASYA 3GTPH 4DNIA 1L0WA 2CW0C 1U4PA 3TREA 4AQYL 2Z9HA 3FKIB 1Q7YC 1XNQQ 5BN5A 2A1AA 2HIXA 5M3FB 2NB0A 5GAHC 1NUCA 4KY7A 1QE6A 2Q2UA 2L1BA 4JI1Q 1PV4A 3E6ZX 1EFID 1BF4A 2BA0A 1EFWA 4A3LH 1CZGA 2YYZA 2UUBQ 1FNUA 1LT6D 2R93B 1XX8A 1QJOA 5M5YB 4K5XA 4JI8L 3HOYB 1F2MA 5FK9C 4Z9CB 4BY1G 3M7GA 4A3IG 1PZKD 3CCJA 1CKOA 1C4QA 2PNHA 3CCMA 3EIVA 4LF5Q 3HOXH 2WAQB 3RN2A 3U9OA 2UU9L 3D4RA 1RDPD 1V1QA 4X65Q 1YITA 3KBGA 4CGYB 5J1ZA 3HZXA 3E9HA 3N6RA 2VQEQ 2HUGA 1RF2D 3FPUB 4NP5A 1KHIA 1C9OA 1CTMA 3NSWA 2E2HB 3K8AA 3FEWX 4CKCA 2ZTDA 2PQEA 3OOCA 3W1GA 5JPNC 4HEDA 3DMUA 1KDCA 2XWJB 2AHOB 2XN9C 5HGTA 5DM63 4XXEA 2IX1A 1KQSA 1CSPA 4NMZA 1KC8C 5GAEC 5DNFA 4RFBA 1S40A 3OW7A 1ILPA 2Z4IA 4DUZL 2AQ1B 1WTHA 5E7NA 3TP6A 4RG1A 2UXBL 4DV2L 2PYKA 1FL0A 4BBRB 1VQ7A 1N33L 3V96A 4LW1A 2A6HD 2JE6I 3CCVA 4X3TA 2F0DA 1W3SA 2KUMA 4LJZC 1X54A 2VS1A 4A3CH 2WB1B 4BBSG 1AW7A 1IBLL 1VQDA 5C0XI 4C3IB 1LT4D 3HOUH 1JMCA 2FINB 1I50H 2MJ8A 2WIIB 3K5OA 5C4XH 4BY7B 2Q8RE 3MFGA 1JE4A 3S2HB 1HH2P 1RD9D 2VUMH 4A4IA 2OQKA 2VB3X 1MJCA 1A2UA 2AUJD 2O2LD 3K5LA 3E3XA 2MNAA 2C35B 4OWXB 1TS2A 2G5DA 4GOPA 3I73A 1JWMD 3GQBA 3TP7A 1LTID 3URYA 1NJIC 1VS0A 3A0JA 3LWEA 2JA5H 4YIJA 4PNYA 1I5FA 2NWGA 5HURA 1GUWA 1WCMG 1N34Q 3BU2A 1X32A 3DM1A 2NVXB 4EVOA 1PTOF 2PNRC 3V2TA 1O7IA 2UUBL 1A63A 1EZ6A 1K83B 4IZ8A 1UAPA 3I4NH 1MHWC 5AJ3L 3G48A 4PMBA 1LTSD 5I2XA 1WD0A 5C44H 3S1QH 4IOAA 5FKAC 3TSSA 3GTLB 4CDDC 5I9PA 4ZUJA 2QF7A 3PO3G 3NENA 4FXKC 1W6KA 3QG1A 1VQNA 1WJJA 1PA6A 3K58A 4RGNA 3S1NB 3EQLC 2VQEL 4LUZA 2IX3A 3CRKC 2F0GA 5C3EG 1OXSC 2H5XA 2UXCL 4JG2A 3S1RH 2RSNA 1BDOA 2CQOA 1XMQQ 4JYAQ 4L8JA 2K52A 3ZYYX 3MAQA 3GTKB 4DR5Q 3TP5A 5L37A 3KUPA 2EYOA 1B1ZA 2D5DA 2MO0A 2YU9B 1HA5A 1ILQA 4DXFA 2ZJPA 5EGTA 5FLXE 5IYCH 3CCSA 1HNZQ 3DWQA 2R7ZH 3WOEA 3NTKA 1V1PA 3SHLA 4N8X1 2JA9A 2KHIA 2F3VA 2GA4B 1B44D 2A68D 1Y1VB 3GTJB 3H3VC 2EY2A 1KD1C 1SR3A 1WTOA 2CWAA 5I9OA 2KVMA 2N78A 3H91A 4RA8A 4C3HH 2HDLA 1GUTA 1F2LA 1KLUD 1WTVA 3PO2B 4IUTA 5IP7G 2PZUA 5EAYA 1O78A 2RSOA 1HPCA 1L2FA 4BY1H 1KABA 1T5EA 4A3IH 4P74A 2K5NA 2ZTCA 2L55A 3M4OB 1F9QA 4JBWA 4YWLA 2N3SA 1ZXTA 2K28A 4IUUA 1D6EC 2OEOA 4XT3B 2F0OA 1BCPD 1TXYA 2EYPA 1DOKA 5CYUA 1NSNS 2N49A 1BBXC 1OXUA 5JJKA 3RR5A 5LL6X 3KOJA 1PTOD 4DR2Q 4XQQA 1JE5A 5KYIA 1HNXQ 1Y1WB 2RCNA 3KLWA 4WORA 2M2LA 1LTAD 1EY5A 2F0PA 3BZDB 3JC66 1Q46A 3Q0AA 2HCCA 2EJGC 1QWYA 1U5KA 2DY8A 3AFPA 4A3FG 4FYDA 3HOZB 3U9SA 2B3GA 1XWEA 4F7XA 4KV6A 1KRTA 1PRTC 1SYFA 3OWEB 2F0LA 5A2QL 1XMQL 4JYAL 1HNWQ 4DR5L 2EY6A 1ONLA 3W1BA 4DV6L 2K04A 5E3FA 3J7AF 2MHVA 1CT1D 4A3DB 3QOJA 4QMGA 4LFCL 1VQ8A 3C3LA 2DNCA 4NXNL 3LGJA 4G57A 2EYLA 1PFBA 1TIID 3TZUA 4JI5Q 5KIXA 4JI7L 3NK9A 4DR4L 3VR4A 3E0JA 4NDXA 4A75A 2QW7A 4MIUA 1R9TB 5E4XA 2I46A 1CFMA 4DPGA 2HDMA 1MSHA 3J80i 3OWFA 1YNND 2Q2IA 3CKIB 4JI0Q 1WOCA 1JJCB 4N9PA 4XYOA 1KAWA 2XIWA 4ZQ3A 2K6AA 2V4DA 3TDQA 1SN8A 4G7OC 3I4MB 2NUCA 3CW2C 4WRDA 3J80c 3CHBD 1S72A 3LX0A 2EXDA 3IAYA 3PF4A 2UUCL 4O2DA 1YHAA 3GO5A 3NELA 2JA8G 1VQ4A 1XMOL 4PZ8A 1D5XC 3A8IE 2KCTA 2HQEA 4DV7Q 1FYCA 3VR5A 2MPMA 3PO3H 4CKBA 2KECA 2XTIA 2RQXA 2L4NA 2JJQA 3PCOB 5IGEA 5BN4A 5C3EH 4A3JG 2D0PA 1TS4A 1HFGA 1KL9A 2DY7A 4J8QA 4LAAA 3SK5A 4OX9L 3HKZE 5H1SE 1A8VA 1LTBD 5ELBA 3UI2A 3OMCA 5D3IB 3P20A 1AZPA 5M3MH 1QUQA 2XRQD 1VQMA 4IFDG 1G6PA 1Q8KA 3HOVB 3KDFA 3U4VA 4L5TA 1E24A 1H9SA 2GVAA 1BXTA 1L1OC 1B9MA 5EPJA 3J80L 1NE3A 2RF4A 4HJAA 2B39A 3F2CA 1Q1EA 3Q24A 5CV7A 5LMNQ 2ZJRA 1TS5A 4DF7A 3BS1A 3PIOA 5M5XH 1SNOA 5ELFA 2NYZD 4OELB 3OIQA 3Q8DA 1YIJA 3V05A 4GS3A 2FJ2A 4B3SQ 3A5UA 1SE2A 2BE5C 3UDXA 3NP8A 1BBWA 5IP7H 1JC7A 1G291 2F52A 4AYBG 2HHHQ 1VQJA 3KBXA 1IHZA 1LM0A 1Z47A 1VQOA 2LY7A 5IT9E 3AYHB 4PG3A 2LXJA 1TWFB 3NTIA 2B63G 1VCIA 4A93G 1U9RA 4TKOB 4A3LG 1PH5A 4BS9A 5CV5A 2L0CA 1VQ6A 2HD3A 1UE6A 1A3UA 1PZID 4P72A 3WOFA 3E5SA 1HQRD 1HCZA 2O5IC 4YCVA 2F0SA 2RVLA 2I5LX 3W5OA 4KKUA 1CK1A 3DXJC 4KD3A 2O5JC 2YV5A 4B3TQ 2A6EC 2CHBD 4GNXB 4A3KG 3GV6A 1A62A 1JB3A 3NTHA 1E7ZA 2K01A 2KCNA 2PMZB 5CR3A 4JI4Q 1EYCA 2R61A 4YY3L 1WI5A 4DV7L 2ZXPA 3CC7A 3EVQA 4XTCS 3VYUA 3K5MA 1EQTA 3DLLA 5FO7B 1C7YA 2F0MA 1II3A 1SNDA 3VR2A 5IYDG 4LFBQ 3WDNA 3E9IA 4A3FH 1VQGA 4CDCC 1CI3M 1ICFB 3MA2B 4DR1L 2E2JB 4XQJA 3RZDH 4KHPQ 1QB5D 2A8VA 4ULLA 2JA6B 3CMAA 1QVGA 3MTSA 4RAUC 4ME5A 1Q12A 4AQYQ 2ZXOA 4KHVA 1I6VC 4R4CA 1X56A 4LUOA 4A3BG 3FKIG 3D0FA 4RGTA 2RDFA 1FGUA 1QNUA 1IYUA 1TWAH 3BDCA 3W3AA 4RWSC 4IUPA 5M3FG 3HOUG 5KNDA 5C4XG 4JI2L 1K8MA 1QUQB 4X3SA 4QUFA 1I4HA 3KDFB 5M5WB 1G2SA 3UDGA 4HTHA 1PFNA 4HCSA 5LMNL 3GTOH 3MXNB 1AEXA 1H9SB 1T5XD 2X69A 5COYA 4U68A 2R93G 3SK6A 1YNJD 3EBEA 2Q2TA 4E6IA 4DGZA 3S15H 1KNAA 1Z6HA 1F2YA 3FVQA 1R4PB 1X3GA 2ZXRA 5KEEA 2FMCA 5T1IA 1O7YA 1QVCA 5ISRA 2JA5G 1PXUA 2B2TA 3GTPB 4JI3Q 2PZWA 3ONAB 1JJGA 1X3EA 2JA8H 4KN4C 1SJHD 1LUZA 1SYBA 2Q2HA 1ML0D 1T9HA 1GUNA 1RKNA 2GN5A 1YI2A 3VA7A 3DEOA 4IFDI 2K7VA 2NZOA 1KDAA 5ELNA 1JWSD 4C3JB 4FVMA 2WFWA 1Y69U 4LMQD 1WYDA 1CZWA 3UDIA 2BH8A 3FP9A 3Q22A 1BCPB 1UUPA 1Q1BA 2B2UC 4DUZQ 3S17B 3I3CA 5I4DA 3I55A 4RKLA 2RHQB 4ODGA 1EIHA 1A2TA 1Y8OB 2F0NA 1N33Q 2UXDL 4H7BA 1PH2A 1GVPA 3R2TA 4TVAB 3A5ZB 1UE7A 2KJXA 3T1YL 1LTLA 1EZ8A 4UP9A 4IFDH 3QWNA 4KLKA 4FNFA 3H3VI 1IBLQ 1ENCA 1NY4A 4FP5D 2A5HA 4B9WA 1FD7D 4KI0A 2X6GA 1HUMA 2D2CC 4ABNA 4QUCA 4HSVA 5K5PA 2L5TA 2Z8LA 3G7LA 3HOWB 2IW3A 1I3QH 3J7YW 3L3OC 1STYA 2XRSD 1WD1A 3A8JE 1K8OA 2R7ZG 4KHPL 3CQZB 4TQUS 2OXPA 3RLNA 2VNUD 1L1OA 1X6OA 3NQIA 1RODA 5JOBA 4CHTB 5DEHA 4DV3Q 3H3VH 1RHPA 1F9SA 1SDFA 2XNAC 1SMYD 3G6EA 5A35A 3KFUA 4QY7A 4LF6Q 4PMWA 2E2IB 2WV6D 2WKDA 3MC0B 3GTGH 4C3HG 2B63H 3BYYB 1VQ9A 3K7AH 2LXKA 4GN5A 1EEFD 4OEMB 4LF7L 4A93H 4Y7NB 1N36Q 3ULLA 4WJ4A 5FJ8G 3NWTA 5DLQE 3SE0A 2CQAA 1EOTA 5AJ3Q 2HQLA 1ESRA 1EL0A 1TWCB 1FNVA 3LWUA 4JI6L 2Q8TA 1I50B 3IKJA 2BA1A 2IX0A 4K2LA 3E0EA 4KKTA 1EWHA 3F1ZA 4APVA 3BDOA 3A74A 5CORA 1AN8A 2NVYH 1IZ6A 4JI3L 3D6WA 3STBD 4A3KH 3B6YA 4GKKL 4I7ZC 4V190 2MQHA 2IT1A 2UXCQ 5IGDA 2HIVA 2R92B 4FXGC 5G3LF 2E5LL 1I4GA 2EXZA 1B70B 1VQHA 1PH9A 5IYDH 4J1MA 2EYFA 3TQYA 4JBJA 4JK1C 2OF1A 3OMGA 3MEHA 1CKNA 2AWOA 2MGSA 2QILA 4H13C 3GTMB 4CBVA 3I4NB 3HKSA 1ZKOA 1JOOA 2A6HC 1N9WA 1EIFA 2RBMA 4DFAA 1VQIA 5C44B 2K5HA 3MVVA 2K1BA 5LMNW 5EKKA 1XPOA 3CPFA 4IJLA 4UPAA 4A3BH 4RH6A 1PLFA 3FKIH 1F2ZA 1NAPA 4Y52H 4N9TA 4ZYSA 1Y8NB 5M3FH 2E74C 5ELDA 3KF8A 4HR7B 2D9UA 2BDNA 3OW2A 1STBA 4UDUC 2F0FA 3S1RB 3C46A 3PO2G 4MZ9A 1EY8A 2XGTA 3FHWA 4KJOA 1LTTD 2KEDA 2R93H 5M5YH 1JQYD 4Q5VA 3HOYH 4KY6A 1NR4A 4DV3L 2Y0SG 3PIPA 2PW5A 4POFA 1MSGA 1YEZA 1I94Q 4LF6L 4A3GG 1BCPF 1B50A 4A3EG 3AQQA 5C4ZA 4X64L 2B2WC 3WWVA 4QB4A 2UUAQ 2ZJQA 2B8FA 2PQAA 3VYSA 2O4XA 1AH9A 2K75A 1LYLA 1N36L 1CA6A 2QEJC 2PPBC 3KLRA 3PIO3 2OT2A 5EBDA 4OIKA 5LMUL 1KTKA 2EYMA 2FHTA 1D5MC 3EA6A 4GN4B 3GD7A 2Z0SA 3H09A 4POGA 4L5QA 1IKLA 4Q0FA 4OONA 4P75A 5D3DA 1GO3E 4DA2A 4BY1B 1KXLA 4OO1G 2KOLA 3HG9A 3QJYA 2VQFL 1PH8A 4C1NI 3CP0A 4ZCKA 3S14H 1HZAA 1ET9A 4DV6Q 3HRZC 2SOBA 5G3LD 4LFCQ 1TY2A 1BOSA 4NXNQ 4ZUIA 2H4OA 5M3MG 4OWWB 4IPDA 4CJ0B 4JI7Q 1A3VA 2E2DC 3K6OA 3RN5A 4DR4Q 1GJXA 1SJED 1J5EL 3S2HH 5IWAL 4F8MA 4NKLA 3NHHA 1CQFA 4B9XA 3GTQH 1A0IA 2EOTA 4X3KA 3FDTA 1RJTA 2OCEA 1QZGA 1SEBD 1MJEA 4HJ9A 3R8BA 1JOQA 4K0KQ 4X66Q 3GDEA 2IPKD 2Z1CA 2PI2A 1KAAA 2DJGC 4DNTB 1BKBA 3I4MG 5FJ8H 4BBSB 2UUCQ 1JB7A 1GOZA 4X3UA 1G51A 1XMOQ 4FF4A 2N88A 3JAMi 1F77A 3U58A 2I5HA 1HHVA 1PHJA 4FF1A 2Y0SE 3CRLC 4IUVA 1I94L 2F03A 1G2TA 1XYIA 1V1OA 1HR0L 5JEAJ 2PW7A 2UUAL 3K0XA 1QZHA 1IYVA 1YBYA 4DNRB 4GOPB 2F0UA 2PCFB 4OGQC 3S1NH 3JAMc 3O13A 4OX9Q 1PTOC 2AWNA 2EY5A 3EROA 5CV8A 3R3OA 1PH6A 3VR6A 2PQAB 3S1MH 3GTKH 2EJMA 2A69D 4PZ7A 3I2ZA 5D14A 3BYTB 1WCMB 1S5BD 4H02A 2YU9H 1ZYRD 3HOVG 1I6HH 1RTNA 5JPMC 4DK0A 4NXML 3ND8A 2Q8IB 2LFNA 1STNA 1Q8IA 1IBML 2ICIA 2IHFA 4XQNA 2E75C 3LNNA 1PVOA 1VQCA 2NN6G 3PO3B 3PUZA 4RCNA 1ZEQX 2F1MA 3I91A 4JW0A 3TS0A 3VA5A 3M4YA 2JP1A 2G9DA 2KEEA 4DAPA 1HZ9A 1DOMA 4KHZA 4RGOS 4ALPA 2FMMA 3PO2H 2X6LA 1DGSA 3A56A 3D4DA 3J81E 1YJ9A 2LS01 2KCMA 2NZ1D 3HFZB 4AH6A 1EU3A 1QVFA 1O80A 1HZCA 2NZHA 3JAML 1IKMA 2NVQH 1UEBA 4HN7A 1XPUA 4A3GH 1SYEA 1SAPA 3MZ5A 1MI2A 3NBHA 4A3EH 1V1PB 2VB2X 4ZKBB 1RCVD 1FJGL 1O7LA 4K0KL 4KTAA 4X66L 2PI2E 1D7QA 2ALYB 1X3PA 1JORA 3T56B 4OO1I 2A19A 1KNEA 2E76C 1U4LA 4LWCA 2FFKB 3IFDA 3I72A 3P7JA 2B2WA 2K5QA 5M5XB 1Z7TA 1EY0A 1CUKA 2KENA 5AFWA 1WTRA 1STGA 5C5LA 4YY3Q 1VQKA 4C2MH 1I4XA 4HIOA 1W2BA 4WJ3M 1GHKA 3OIPA 2F4IA 5DAUA 5EKLA 3SR1A 4ZRZA 1Q86C 3S16B 3L0OA 3G71A 4HCEA 1G6ZA 1EYGA 2B2VC 2ZM6Q 1M90C 2FXQA 1QILA 4WJWA 4OO1H 3HOZH 3UE1A 4DR1Q 3R2IA 2KHSA 2J7ZA 1K73C 2A73B 3SEBA 1B3QA 3HP3A 2NVTH 2BDOA 4G4KA 5IY0A 4M1UB 4FDBA 1C48A 3F8TA 2RA4A 3EN2A 3NUCA 5KYLA 5JJZA 1VQEA 2OQ0A 1A15A 5IODA 3HKZB 4P73A 3AEVA 4TRDA 4O42A 4UP8A 1LACA 5C3WA 4R4OA 1SNCA 1EYDA 1DD2A 1DM0B 1VQAA 4GLXA 1R9TH 4JI2Q 5M9OA 4R8IA 4C1NK 1V9PA 4JV5L 1TWGH 3PSIA 1BVSA 1LV9A 1VMPA 4LNQA 3J7AV 2KBNA 2EQSA 1SSOA 5C4HA 3MFYA 4A3FB 5KRUA 4QF4A 3OSOA 4HIDA 1HR0W 2ATWA 3I4MH 3RZDB 3L9AX 4H44C 1STAA 4F87A 3M3YB 2CWPA 2YTYA 3SVMA 4A3MB 1B4OA 1Y8PB 1N32L 4MHEA 2AQ2B 1TWAB 1BUVT 2BE5D 3VR3A 1BBUA 3D4WA 2BOSA 1IYJB 1KDBA 4XDXA 4YHHL 4K5VA 2F0WA 3NBIA 1VF5C 4QQBX 1L0XB 3ULJA 5HY6A 1QG7A 4HMIA 3NBHB 2L9HA 1XNRL 2UXDQ 2XSCA 1W6JA 2WP8J 3PIP3 3T1YQ 2F0JA 4JOIC 3QR8A 3S15B 5EQ0A 3SGIA 1Z9FA 4R1JA 4WFN3 1WTXA 2EE1A 1LT3D 4EQOA 1TWHB 4B3ML 2ZM6L 3HOVH 5GQOA 3K81C 1K28A 3RZOH 3TZDA 2F0HA 2JA8B 1EUJA 3H0GB 5EBCA 3HOWG 3OYYA 2JA7B 5FLXc 2A6ED 1D8LA 3A7AB 4J15A 3W2DA 2NN6H 2CH4A 1EQRA 1E1OA 3KK7A 1UNSA 4DUYQ 2OTJA 4YCUA 1JWUD 3I90A 1V8QA 2N55A 5IE8A 4K14A 1EU4A 4A3JB 5C4JH 4KD4A 5KGUA 1HQMC 3CC4A 2F0EA 5JVH3 3M9BA 4LFAL 4IUNA 3CF5A 4JC0A 1CQVA 3T4AC 1C8CA 4GLAC 1X3QA 5JAVA 4LF7Q 4LF4L 1OO9B 2ZTEA 1JICA 4ZAIA 2JSOA 1Y14B 4IURA 1XTDA 1YVCA 3DWPA 1SE4A 3HS0C 2K32A 2XWBB 3UDFA 2R7FA 1ESFA 4JI6Q 3EJIA 1X65A 1SBBB 3I4LA 1BNZA 3HOYG 4IO9A 1I3QB 1VQFA 4BXXH 4L63B 1LLRD 4XYQA 4AYBE 2EVBA 2IHEA 2WAQG 5KNBA 1SMXA
chains in the Genus database with same CATH topology
4IUQA 3D6CA 5IOCA 1HFNA 1S5FD 4HAEA 3F2UA 1HXYD 5FLXL 1EY6A 4QCLA 4K5WA 2G9HD 3OPOA 3QB3A 5C0XG 3GTGB 5CV4A 2B63B 3D3RA 3K7AB 5A2QE 1ENFA 3FPPA 2C5CA 4OHJA 3DHQA 1IW7D 4EQNA 2JYOA 2PZTA 1OXXK 4KK7A 3KLSX 3C2PA 5C0XJ 2NTSA 4RHRA 2EDGA 4PV1C 3HOXB 5C5MA 4GZYC 2DN8A 2KQ3A 2L12A 3X3NA 4C3IG 1AZQA 1NCVA 4A3KB 5K36G 1MGSA 3AU7A 4IQZA 4DN4M 1QNKA 3P75A 3G6JB 4RKBA 3MXPA 5IGCA 2LMCB 4C56C 4G7HC 2PO4A 3S9WA 2WINB 2I07B 2F0VA 5FOBB 3DEPA 1V43A 1PRTB 3SDZA 1EYAA 2CW0D 4A3BB 4OIJA 3RUZA 5I6WA 4DXGA 3Q6SA 3HOUB 5BN3A 5C4XB 3AMUA 1IL8A 1LABA 2TSSA 4ILWA 2VUMB 3VYTA 3Q23A 3RMHA 3TP8A 2XVSA 1H9KA 1PTOH 4DU9A 4G7ZC 1FR3A 1XXGA 3J81L 2L11A 3J80E 3CU7A 2JA5B 1LO5D 5ELEA 4IALA 1GUOA 2B2YC 4CJ2C 1FNWA 3AB9A 1E0BA 2RDHA 1QCBD 2WKCA 4MN3A 1B3AA 3KLSA 5CC4A 3K59A 3S1QB 1RTOA 5E1FA 3QO2A 2QKIC 4DAVA 1EQVA 1E2VA 3PUVA 3A54A 4KY5A 2IJ0A 5EPLA 4M8AA 2K5WA 1TU2B 1SYCA 2KA7A 3S14B 1S5CD 1S5DD 1D2BA 5CV9A 5CBEE 4L6TB 1I4RA 4RHSA 5IGFA 5LHY1 1S5ED 1PYWD 2K03A 2R7ZB 3TBIB 1HUNA 2K5DA 1DOLA 5CGKA 3GTQB 3PMFA 2K33A 1G91A 2K05A 4UAIA 1B9NA 5C0XH 1GUSA 4C3HB 2EJFC 3PUYA 4FO2A 3H94A 3M85A 1R4QB 3A8KE 3ND9A 3IL8A 2CVRA 4XT1B 4HMJA 3QOLA 3T51B 5CMDA 1BR9A 4A3IB 2B2UA 1L0YB 4QIWB 1M8AA 4V0BA 3MXGA 3NQTA 5IT9L 3K57A 5CBAE 1KLGD 2F0QA 1AFPA 1FGBD 5K36H 1STEA 3T53B 1J9OA 1PRTF 1SYDA 3HGBA 2SEBD 3N52A 3C1FA 3DUZA 2M9VA 3S1MB 1JCKB 2H1EA 2A68C 1CM9A 2KCCA 4IN3A 1SNQA 1ENAA 1I6HB 2EY1A 1DONA 4K8IA 3NXWA 2DNEA 3PUWA 1TT2A 1EEID 1H9RA 5JVG3 4K8JA 5J39A 1ICWA 5JEAG 1CHQD 5FO9B 2EYHA 2VXWA 1D1KA 3BDLA 5F2DA 3FRPB 2C9OA 2B8GA 2D62A 1EIGA 2R6GA 3DWAA 1PFMA 1BCPC 3GV3A 4B08A 1G8ZD 2JXMB 3OHXC 2NVQB 1D1IA 2Y0SB 1E2WA 4XIGS 1I4PA 4BA2I 4FF3A 4A3GB 1DCZA 4A3EB 2AQ3B 4ID6A 2A69C 2ZT9C 4F88A 3PV0A 3TMEA 1TVXA 1VMCA 2Z4HA 4ZKCB 1Q90A 5C3XA 1ZYRC 1TQOA 1AP0A 3C1EA 3H6MA 4I65A 4H0LC 1F9PA 5DM73 4ZLTF 1SE3A 2B2YA 4C2MB 4K2KA 2ENBA 3BVMA 1EY9A 1B2TA 4CJ1B 5KNCA 5C3EB 2JEBI 3NE5B 1BQQT 2NVTB 3R93A 4DK1A 3P1HA 1A3TA 1GUGA 1VF7A 1PRTD 2SNSA 1YNNC 3SK8A 3D8GA 3MXUA 5M3MB 1CHPD 2EYJA 2R3ZA 1HA6A 1I4QA 3A55A 4KMUC 1S4ZA 1JR0D 4J6HA 1TWGB 3L7ZC 4K6LA 3VYRA 1D5ZC 1LTGD 2NTTA 2B2TC 4BA1I 3GP7A 2M00A 5IIFA 2SNMA 2MP1A 5EPKA 2WACA 3FMCA 1Q3LA 1MD2D 3MWYW 3TN2A 2EPBA 3K0YA 5C6AA 3NWSA 5IGBA 1EWCA 1HRJA 1BO0A 3EFXD 2AUKA 2SDFA 1DYQA 1WTWA 1HTPA 2IWHA 4OL7A 2J0TD 2IL8A 2ICEC 4EQPA 3RZOB 3MXNA 1VDZA 5CV6A 4KKSA 5JEAH 1PMRA 5FO8B 4FF2A 4IFDJ 3RD4A 1EY4A 5C4JB 1LTRD 1PDQA 1NR2A 4EGVA 1SNMA 4C3JG 1U4MA 4DAYA 4FXDA 1DJRD 3ITPA 3SXHA 3I70A 4ZK9B 1O7ZA 3GTOB 2NN6I 1CA5A 3PUXA 3BVGA 1H9MA 4R9WA 1TKWB 2F0TA 2RKSA 4PMCA 4LK1C 1A6XA 5TSSA 2F0IA 3BG3A 1B53A 4KN7C 3X3MA 1QOHA 1F9RA 2LKVA 1WVLA 5EKIA 3BVZA 2BCOA 4CKEA 1UEAB 2A74C 5E4WC 1SNPA 1J8IA 5D65A 2F0KA 1JOKA 1TS3A 1M4VA 1YNJC 5I6YA 3S2DB 1U4RA 2NBFA 1TY0A 4R8NA 1TR5A 1H9JA 1SFOB 4K6DA 1OXTA 2HCIA 1LT5D 1STHA 5LL6S 2J4XA 2JEAI 4AYBB 5J22A 1WTPA 4BWGB 1PZJD 5IGGA 3SK4A 3IFTA 4A93B 1E2ZA 1OXVA 1HTLD 5NUCA 1IW7C 4TSSA 2B2VA 1MBYA 2F3WA 2MUYA 2QDBA 4O1NA 3I8ZA 3T16A 3RLFA 1EY7A 1ET6A 5EJWA 4KJNA 1SXTA 1DZ1A 3HEJA 3JAME 2NVYB 3M7NA 4NW2A 2ID0A 4P2CB 3T13A 3QIAA 1XTCD 1GHJA 1SYGA 1PTOB 3NPPA 1GXDC 3D31A 5ELCA 2RDGA 4RGMA 2QCPX 3ERQA 5I2YA 1DXMA 3K5NA 1SMYC 2EZVA 4HSPA 4PQXA 2TMPA 3A7LA 3MHBA 4U673 4RCOA 4S3SA 5T1GA 2CW0C 1U4PA 3FKIB 5BN5A 5M3FB 2NB0A 1NUCA 4KY7A 1QE6A 2L1BA 3E6ZX 1EFID 1BF4A 2BA0A 1CZGA 2YYZA 1FNUA 1LT6D 2R93B 1XX8A 1QJOA 5M5YB 4K5XA 3HOYB 1F2MA 5FK9C 4Z9CB 3M7GA 1PZKD 1C4QA 2WAQB 3U9OA 3D4RA 1RDPD 3KBGA 4CGYB 5J1ZA 3HZXA 3N6RA 2HUGA 1RF2D 3FPUB 4NP5A 2E2HB 3NSWA 1CTMA 3FEWX 4CKCA 3OOCA 2PQEA 5JPNC 4HEDA 3DMUA 1KDCA 2XWJB 2XN9C 5HGTA 5DM63 4XXEA 2IX1A 4NMZA 5DNFA 4RFBA 3OW7A 1ILPA 2Z4IA 2AQ1B 3TP6A 2PYKA 4BBRB 3V96A 2A6HD 2JE6I 4X3TA 2F0DA 2KUMA 4LJZC 2WB1B 1AW7A 5C0XI 4C3IB 1LT4D 2FINB 2MJ8A 2WIIB 3K5OA 4BY7B 2Q8RE 3MFGA 1JE4A 3S2HB 1RD9D 2VB3X 1A2UA 2AUJD 2O2LD 3K5LA 1TS2A 3I73A 1JWMD 3GQBA 3TP7A 1LTID 3URYA 3LWEA 4YIJA 4PNYA 2NWGA 5HURA 1GUWA 1X32A 3DM1A 2NVXB 4EVOA 1PTOF 2PNRC 3V2TA 1EZ6A 1K83B 4IZ8A 1UAPA 4PMBA 1LTSD 5I2XA 1WD0A 5FKAC 3TSSA 3GTLB 5I9PA 4ZUJA 2QF7A 4FXKC 1W6KA 3QG1A 3K58A 4RGNA 3S1NB 3EQLC 2IX3A 3CRKC 2F0GA 1OXSC 2RSNA 1BDOA 4L8JA 3MAQA 3ZYYX 3GTKB 3TP5A 3KUPA 2EYOA 1B1ZA 2D5DA 2YU9B 1HA5A 1ILQA 4DXFA 5EGTA 5FLXE 3DWQA 3WOEA 3NTKA 1V1PA 3SHLA 2F3VA 2GA4B 1B44D 2A68D 1Y1VB 3GTJB 3H3VC 2EY2A 1WTOA 5I9OA 2KVMA 3H91A 4RA8A 2HDLA 1GUTA 1F2LA 1KLUD 1WTVA 3PO2B 4IUTA 2PZUA 1O78A 2RSOA 1HPCA 1KABA 1T5EA 2L55A 3M4OB 1F9QA 4JBWA 1ZXTA 2K28A 4IUUA 1D6EC 2OEOA 4XT3B 2F0OA 1BCPD 2EYPA 1DOKA 5CYUA 1NSNS 1BBXC 1OXUA 5LL6X 1PTOD 4XQQA 5KYIA 1Y1WB 4WORA 2M2LA 1LTAD 1EY5A 2F0PA 3BZDB 3Q0AA 2HCCA 2EJGC 1QWYA 2DY8A 4FYDA 3HOZB 3U9SA 1XWEA 4F7XA 4KV6A 1PRTC 1SYFA 3OWEB 2F0LA 5A2QL 2EY6A 1ONLA 2K04A 5E3FA 3J7AF 2MHVA 1CT1D 4A3DB 3QOJA 4QMGA 3C3LA 2DNCA 4G57A 2EYLA 1PFBA 1TIID 3TZUA 5KIXA 3NK9A 3VR4A 3E0JA 4NDXA 4MIUA 1R9TB 5E4XA 2I46A 1CFMA 2HDMA 1MSHA 3OWFA 1YNND 3CKIB 4N9PA 4XYOA 2XIWA 4ZQ3A 2K6AA 2V4DA 3TDQA 4G7OC 3I4MB 2NUCA 4WRDA 3CHBD 3LX0A 3IAYA 3GO5A 1D5XC 3A8IE 2HQEA 1FYCA 3VR5A 2MPMA 4CKBA 2KECA 2RQXA 2L4NA 5IGEA 5BN4A 1TS4A 1HFGA 2DY7A 4J8QA 4LAAA 3SK5A 1LTBD 5ELBA 3UI2A 3OMCA 5D3IB 3P20A 1AZPA 2XRQD 4IFDG 3HOVB 1H9SA 1BXTA 1B9MA 5EPJA 3J80L 2B39A 1Q1EA 3Q24A 5CV7A 1TS5A 4DF7A 3BS1A 1SNOA 5ELFA 2NYZD 3OIQA 3V05A 2FJ2A 1SE2A 2BE5C 3NP8A 1JC7A 1G291 3KBXA 1IHZA 1Z47A 2LY7A 5IT9E 1TWFB 3NTIA 1VCIA 1U9RA 4TKOB 4BS9A 5CV5A 2L0CA 1A3UA 1PZID 3WOFA 3E5SA 1HQRD 1HCZA 2O5IC 2F0SA 2RVLA 4KKUA 1CK1A 3DXJC 4KD3A 2O5JC 2A6EC 2CHBD 3GV6A 1JB3A 2K01A 3NTHA 2KCNA 2PMZB 5CR3A 1EYCA 2R61A 2ZXPA 3EVQA 4XTCS 3VYUA 3K5MA 1EQTA 5FO7B 2F0MA 1II3A 1SNDA 3VR2A 3WDNA 1CI3M 3MA2B 2E2JB 4XQJA 1QB5D 4ULLA 2JA6B 3MTSA 4RAUC 4ME5A 1Q12A 2ZXOA 4KHVA 1I6VC 4RGTA 2RDFA 1QNUA 1IYUA 3BDCA 3W3AA 4RWSC 4IUPA 5KNDA 1K8MA 4X3SA 4QUFA 1I4HA 5M5WB 1G2SA 4HTHA 1PFNA 4HCSA 1AEXA 1H9SB 1T5XD 2X69A 5COYA 4U68A 3SK6A 1YNJD 4E6IA 4DGZA 1KNAA 1Z6HA 1F2YA 3FVQA 1R4PB 2ZXRA 5KEEA 2FMCA 5T1IA 1O7YA 5ISRA 1PXUA 2B2TA 3GTPB 2PZWA 3ONAB 4KN4C 1SJHD 1SYBA 1ML0D 1GUNA 1RKNA 3VA7A 3DEOA 4IFDI 2K7VA 1KDAA 1JWSD 4C3JB 4FVMA 1Y69U 4LMQD 1CZWA 3Q22A 1BCPB 1UUPA 1Q1BA 2B2UC 3S17B 3I3CA 5I4DA 4RKLA 4ODGA 1EIHA 1A2TA 1Y8OB 2F0NA 4H7BA 3R2TA 2KJXA 1EZ8A 4IFDH 3QWNA 4FNFA 1ENCA 4FP5D 2A5HA 4B9WA 1FD7D 4KI0A 2X6GA 1HUMA 2D2CC 4ABNA 4QUCA 4HSVA 5K5PA 2L5TA 2Z8LA 3G7LA 3HOWB 2IW3A 3J7YW 3L3OC 1STYA 2XRSD 1WD1A 3A8JE 1K8OA 3CQZB 4TQUS 2OXPA 2VNUD 3NQIA 5JOBA 1RODA 4CHTB 5DEHA 1RHPA 1F9SA 1SDFA 2XNAC 1SMYD 5A35A 4PMWA 2E2IB 2WV6D 2WKDA 3MC0B 4C3HG 3BYYB 1EEFD 4Y7NB 3NWTA 3SE0A 2CQAA 1EOTA 1ESRA 1EL0A 1TWCB 1FNVA 3LWUA 2Q8TA 1I50B 3IKJA 2BA1A 2IX0A 4K2LA 4KKTA 1EWHA 3BDOA 5CORA 1AN8A 3D6WA 4I7ZC 4V190 2IT1A 5IGDA 2R92B 4FXGC 5G3LF 1I4GA 2EXZA 4J1MA 2EYFA 4JK1C 2OF1A 3OMGA 3MEHA 2AWOA 2MGSA 2QILA 4H13C 3GTMB 4CBVA 3I4NB 1ZKOA 1JOOA 2A6HC 2RBMA 4DFAA 5C44B 3MVVA 2K1BA 5EKKA 4RH6A 1PLFA 1F2ZA 1NAPA 4N9TA 4ZYSA 1Y8NB 2E74C 5ELDA 3KF8A 4HR7B 2D9UA 2BDNA 1STBA 4UDUC 2F0FA 3S1RB 3C46A 1EY8A 4KJOA 1LTTD 2KEDA 1JQYD 4Q5VA 4KY6A 1NR4A 2PW5A 1MSGA 1BCPF 1B50A 5C4ZA 2B2WC 4QB4A 2B8FA 3VYSA 2O4XA 1CA6A 2QEJC 2PPBC 3KLRA 3PIO3 2OT2A 5EBDA 4OIKA 1KTKA 2EYMA 2FHTA 1D5MC 3EA6A 3GD7A 3H09A 1IKLA 4Q0FA 5D3DA 4DA2A 4BY1B 4OO1G 2KOLA 3HG9A 3QJYA 4C1NI 1ET9A 3HRZC 2SOBA 5G3LD 1TY2A 1BOSA 4ZUIA 2H4OA 4CJ0B 1A3VA 2E2DC 3K6OA 1GJXA 1SJED 4F8MA 4NKLA 3NHHA 1CQFA 4B9XA 2EOTA 4X3KA 3FDTA 1RJTA 1SEBD 3R8BA 1JOQA 2IPKD 2Z1CA 1KAAA 4DNTB 4BBSB 1GOZA 4X3UA 4FF4A 2N88A 1F77A 1HHVA 4FF1A 3CRLC 4IUVA 2F03A 1G2TA 1XYIA 1V1OA 5JEAJ 2PW7A 1IYVA 4DNRB 2F0UA 2PCFB 4OGQC 3O13A 1PTOC 2AWNA 2EY5A 3EROA 5CV8A 3R3OA 3VR6A 2EJMA 2A69D 5D14A 3BYTB 1WCMB 1S5BD 1ZYRD 1RTNA 5JPMC 4DK0A 3ND8A 2Q8IB 2LFNA 1STNA 1Q8IA 2ICIA 4XQNA 2E75C 3LNNA 2NN6G 3PO3B 3PUZA 4RCNA 1ZEQX 2F1MA 3I91A 3VA5A 2JP1A 2G9DA 3M4YA 2KEEA 4DAPA 1DOMA 4KHZA 4RGOS 2FMMA 2X6LA 3A56A 3D4DA 3J81E 2LS01 2NZ1D 1EU3A 1O80A 3JAML 1IKMA 4HN7A 1SYEA 1SAPA 3MZ5A 1MI2A 3NBHA 1V1PB 2VB2X 4ZKBB 1RCVD 1O7LA 4KTAA 1JORA 1X3PA 3T56B 4OO1I 1KNEA 2E76C 1U4LA 2FFKB 3IFDA 3I72A 3P7JA 2B2WA 2K5QA 5M5XB 1Z7TA 1EY0A 5AFWA 1WTRA 1STGA 5C5LA 1I4XA 1GHKA 3OIPA 2F4IA 5DAUA 5EKLA 3SR1A 4ZRZA 3S16B 4HCEA 1G6ZA 2B2VC 1QILA 4WJWA 4OO1H 3R2IA 2KHSA 2J7ZA 2A73B 3SEBA 3HP3A 2BDOA 4G4KA 4M1UB 1C48A 2RA4A 3NUCA 5KYLA 5JJZA 1A15A 5IODA 3HKZB 4TRDA 4O42A 1LACA 5C3WA 1SNCA 1EYDA 1DD2A 1DM0B 5M9OA 4R8IA 4C1NK 1LV9A 1VMPA 3J7AV 1SSOA 5C4HA 3MFYA 4A3FB 5KRUA 4QF4A 3OSOA 3RZDB 3L9AX 4H44C 1STAA 4F87A 3M3YB 3SVMA 4A3MB 1B4OA 1Y8PB 4MHEA 2AQ2B 1TWAB 1BUVT 2BE5D 3VR3A 3D4WA 2BOSA 1KDBA 4XDXA 4K5VA 2F0WA 3NBIA 1VF5C 1L0XB 1QG7A 4HMIA 2L9HA 2XSCA 1W6JA 2WP8J 3PIP3 2F0JA 3S15B 5EQ0A 1WTXA 4WFN3 2EE1A 1LT3D 4EQOA 1TWHB 3TZDA 2F0HA 2JA8B 3H0GB 5EBCA 2JA7B 2A6ED 3A7AB 3W2DA 2NN6H 3KK7A 1UNSA 1JWUD 3I90A 1V8QA 2N55A 4K14A 1EU4A 4A3JB 4KD4A 5KGUA 1HQMC 2F0EA 5JVH3 4IUNA 1CQVA 3T4AC 1C8CA 1X3QA 5JAVA 1OO9B 4ZAIA 1JICA 2JSOA 4IURA 3DWPA 1SE4A 3HS0C 2K32A 2XWBB 1ESFA 3EJIA 3I4LA 1SBBB 1BNZA 1I3QB 4L63B 1LLRD 4XYQA 2EVBA 5KNBA 1WTQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D6C A;  5IOC A;  4I65 A;  2F0N A;  3NHH A;  3QOL A;  4HMJ A;  4OL7 A;  4B9X A;  2RBM A;  4H7B A;  4DFA A;  3MVV A;  1KAB A;  5CR3 A;  1EY6 A;  4DU9 A;  5EKK A;  2F0K A;  1EYC A;  1EZ8 A;  1JOK A;  4K2K A;  2HQE A;  2ENB A;  4K5W A;  3NQT A;  3EVQ A;  1F2Z A;  3QB3 A;  1EY9 A;  5I6Y A;  1SYE A;  3MZ5 A;  4N9T A;  4EQP A;  1ENC A;  3D4W A;  1NUC A;  3TP7 A;  2F0Q A;  4B9W A;  2F0M A;  1II3 A;  1SND A;  4KY7 A;  1KDB A;  2OEO A;  4R8N A;  2F0O A;  5CV4 A;  4KTA A;  1JOQ A;  4IAL A;  4YIJ A;  4PNY A;  5K5P A;  5IGE A;  4K5V A;  5HUR A;  1TR5 A;  2EYP A;  2F0W A;  1NSN S;  1JOR A;  1KAA A;  1STY A;  5CV6 A;  4EVO A;  3P1H A;  1STB A;  3SK5 A;  2F0F A;  1A3T A;  1SYD A;  3DHQ A;  4HMI A;  4LAA A;  3V2T A;  1EY8 A;  4KJO A;  4EQN A;  2PZT A;  4K6D A;  1EZ6 A;  4IZ8 A;  5KYI A;  3C1F A;  2OXP A;  2SNS A;  1EY0 A;  4K5X A;  4PMB A;  5CC4 A;  3SK8 A;  3OMC A;  4ME5 A;  1EY4 A;  1F2M A;  1STG A;  3D8G A;  4WOR A;  5JOB A;  5C5L A;  2F0J A;  1EY5 A;  2EYJ A;  2F0P A;  4KHV A;  4KY6 A;  1STH A;  5DEH A;  5E1F A;  5J22 A;  5DAU A;  5EKL A;  2PW5 A;  3SR1 A;  5I9P A;  5C5M A;  2RDF A;  4EQO A;  4ZUJ A;  1SNQ A;  1ENA A;  3BDC A;  2KQ3 A;  3U9O A;  5IGG A;  5C4Z A;  2EY1 A;  1SNM A;  2F0H A;  4K8I A;  3NXW A;  2PW7 A;  3SK4 A;  4QB4 A;  5J1Z A;  3HZX A;  1EQV A;  1TT2 A;  3ITP A;  2F0U A;  2O4X A;  3SXH A;  4KV6 A;  4K8J A;  4J6H A;  2F0G A;  2KHS A;  4KY5 A;  5NUC A;  4F7X A;  5J39 A;  4HTH A;  4NP5 A;  2F3W A;  1SYF A;  2EY5 A;  1SYC A;  5CV7 A;  1AEX A;  2F0L A;  3ERO A;  2PQE A;  3P75 A;  5CV8 A;  4DF7 A;  2EYH A;  2QDB A;  2EY6 A;  1SNO A;  3R3O A;  3BDL A;  5CV9 A;  5E3F A;  3SK6 A;  3DMU A;  1KDC A;  3T16 A;  3TP5 A;  2EYO A;  5HGT A;  5F2D A;  3QOJ A;  4QMG A;  4RKB A;  4E6I A;  2F0T A;  2RKS A;  3MXP A;  4DGZ A;  3NUC A;  2EYM A;  4K14 A;  1EY7 A;  4G57 A;  4NMZ A;  2EYL A;  5IGC A;  5IGF A;  4KJN A;  2M00 A;  4K2L A;  1F2Y A;  4KD4 A;  5IIF A;  5KGU A;  3NP8 A;  5IOD A;  5KIX A;  5KYL A;  2F0E A;  2SNM A;  3NK9 A;  4IUN A;  3HEJ A;  5EGT A;  5KEE A;  4NDX A;  3S9W A;  4TRD A;  1IHZ A;  3TP6 A;  5C3W A;  2WAC A;  4MIU A;  1SNC A;  5ISR A;  1EYD A;  2F0V A;  2PYK A;  3T13 A;  5CGK A;  4PMC A;  2PZW A;  1STN A;  3SHL A;  5JAV A;  1SYG A;  1SYB A;  5M9O A;  3PMF A;  1U9R A;  2F3V A;  1EYA A;  2F0D A;  3OWF A;  5IGD A;  1RKN A;  2F0I A;  3RUZ A;  5C6A A;  5I6W A;  1KDA A;  4ID6 A;  2EY2 A;  2EXZ A;  3ERQ A;  5CV5 A;  4J1M A;  4N9P A;  2SOB A;  2EYF A;  5C4H A;  5I9O A;  1A3U A;  3EJI A;  4ZQ3 A;  3TME A;  5IGB A;  2OF1 A;  3VA5 A;  5KRU A;  2LKV A;  3E5S A;  3OMG A;  4ZUI A;  2F0S A;  3MEH A;  4QF4 A;  5C3X A;  1TQO A;  1A3V A;  2NUC A;  3OSO A;  4WRD A;  2PZU A;  3LX0 A;  3MHB A;  3C1E A;  4RKL A;  1STA A;  1SNP A;  3TP8 A;  3D4D A;  4S3S A;  4ODG A;  4KD3 A;  4NKL A;  4F8M A;  1A2U A;  1JOO A;  3H6M A;  1A2T A; 
#chains in the Genus database with same CATH topology
 4IUQ A;  3D6C A;  5IOC A;  1HFN A;  3J81 j;  1JJ2 A;  1S5F D;  4HAE A;  4UP7 A;  3F2U A;  4GKK Q;  2I5M X;  1NBW A;  1HXY D;  5FLX L;  1EY6 A;  4QCL A;  3U4Z A;  3MEF A;  2V1C C;  4K5W A;  2G9H D;  3OPO A;  3QB3 A;  2E5L Q;  5C0X G;  2R92 G;  2CFM A;  3GTG B;  5CV4 A;  2B63 B;  3D3R A;  3K7A B;  5A2Q E;  4DR3 L;  1ENF A;  3FPP A;  2C5C A;  4OHJ A;  3DHQ A;  1IW7 D;  4IPG A;  2E2J H;  4EQN A;  2JYO A;  2PZT A;  1OXX K;  2F3I A;  4KK7 A;  3KLS X;  3C2P A;  1YJN A;  4JPB W;  5C0X J;  4BBR G;  2NTS A;  3ERS X;  4RHR A;  2EDG A;  2K50 A;  1YHB A;  4PV1 C;  2OWO A;  4DV5 L;  4L5R C;  3HOX B;  5C5M A;  4GZY C;  3S2D H;  2WB1 G;  2DN8 A;  2KQ3 A;  2L12 A;  1K0S A;  3X3N A;  4C3I G;  1AZQ A;  1NCV A;  4GLV B;  4A3K B;  5K36 G;  3U50 C;  4BY7 G;  1MGS A;  2ASB A;  3AU7 A;  1SFO H;  2DJF C;  2R7D A;  4IQZ A;  4DN4 M;  5M5W H;  4DUY L;  1QNK A;  3J81 c;  3P75 A;  4HIM A;  1J6Q A;  3G6J B;  4RKB A;  3MXP A;  5BR8 L;  2OTL A;  5IGC A;  1E22 A;  4CDF C;  2LMC B;  4C56 C;  1FVI A;  4P71 A;  3S24 A;  4G7H C;  2PO4 A;  3S9W A;  2YTV A;  2WIN B;  2CKZ B;  2I07 B;  4X64 Q;  2F0V A;  5FOB B;  3DEP A;  1V43 A;  4O0A A;  1PRT B;  3SDZ A;  1EYA A;  2CW0 D;  4A3B B;  4OIJ A;  1UWV A;  3RUZ A;  5I6W A;  4DXG A;  4I7A A;  2VW9 A;  3Q6S A;  3HOU B;  5LMU Q;  5BN3 A;  5C4X B;  4C3J H;  4R4Q A;  3AMU A;  1IL8 A;  3I56 A;  1IBK Q;  1LAB A;  2TSS A;  1JT8 A;  2LSS A;  4ILW A;  2VUM B;  3PQI A;  3VYT A;  3RMH A;  3Q23 A;  3TP8 A;  1NNX A;  3S17 H;  3RLO A;  2XVS A;  3STB C;  1UE1 A;  2WAQ E;  1H9K A;  2F4V Q;  1PTO H;  2JK8 A;  4DU9 A;  4X6A H;  4G7Z C;  1FR3 A;  1XXG A;  2VQF Q;  3J81 L;  3OTO Q;  3ICE A;  2L11 A;  3J80 E;  3AFQ A;  3CU7 A;  4DR6 L;  2JA5 B;  1LO5 D;  5ELE A;  1VQP A;  3NEM A;  4IAL A;  1GUO A;  4JOI A;  1PH4 A;  2QEX A;  4DV1 L;  2B2Y C;  4CJ2 C;  1FNW A;  3HOW H;  1YJW A;  3AB9 A;  1J5E Q;  1E0B A;  4IPH A;  5IWA Q;  2RDH A;  1QCB D;  2WKC A;  5IYB G;  4MN3 A;  4PZ6 A;  1EQQ A;  1B3A A;  3KLS A;  3CQZ H;  5CC4 A;  3K59 A;  4IJH A;  3S1Q B;  1RTO A;  2KHJ A;  2EIF A;  3CME A;  1YZ6 A;  4N8F A;  5E1F A;  3J7Z C;  1Y1V G;  3BZC A;  3QO2 A;  2QKI C;  2WB1 E;  3H15 A;  2E2I H;  4DAV A;  1EQV A;  1E2V A;  4IOC A;  3PUV A;  3A54 A;  4KY5 A;  1PYB A;  2IJ0 A;  3KYH C;  5EPL A;  2IY5 B;  4M8A A;  2K5W A;  4MTK A;  1TU2 B;  4Y7N H;  1SYC A;  2KA7 A;  2HT1 A;  3S14 B;  4B3R Q;  5IT9 c;  1S5C D;  4UY8 C;  1S5D D;  4GKJ L;  3TEH B;  1D2B A;  5CV9 A;  5CBE E;  4L6T B;  1I4R A;  1TWC H;  4RHS A;  5IGF A;  5LHY 1;  1S5E D;  1PYW D;  2K03 A;  2R7Z B;  3TBI B;  3CCU A;  1L1O B;  2MO1 A;  1HR0 Q;  1HUN A;  4LF8 Q;  1SLJ A;  2K5D A;  1DOL A;  5CGK A;  1IXR A;  1MIU A;  1RIP A;  4HJ7 A;  1XJV A;  3GTQ B;  4DAM A;  1VQB A;  3CCR A;  2ES2 A;  3PMF A;  2K33 A;  3F2D A;  1G91 A;  1XNQ L;  4GNX C;  2K05 A;  4UAI A;  2E2H H;  3CAM A;  4MTN A;  1B9N A;  5C0X H;  3CCL A;  2R92 H;  1GUS A;  2D0O A;  4C3H B;  2EJF C;  3PUY A;  3CXC A;  1Y1W G;  2GVB A;  4JI1 L;  4FO2 A;  1IBK L;  1X3F A;  3H94 A;  4QIW E;  1Q82 C;  3M85 A;  1R4Q B;  3A8K E;  3ND9 A;  3GTM H;  1K3B C;  4RMF A;  1AE3 A;  4OXP A;  1EIY B;  4NXM Q;  3IL8 A;  2F4V L;  2CVR A;  1UE5 A;  4XT1 B;  4HMJ A;  3QOL A;  4EX5 A;  3T51 B;  4BBR H;  5CMD A;  1BR9 A;  4A3I B;  1P8L A;  3HOZ G;  1IBM Q;  2B2U A;  1L0Y B;  3CD6 A;  4QIW B;  2BH2 A;  1M8A A;  4V0B A;  3CC2 A;  3MXG A;  1NTG A;  3NQT A;  5IT9 L;  3OTO L;  3K57 A;  4LF5 L;  5CBA E;  1KLG D;  2F0Q A;  4C3I H;  4X65 L;  2DUD A;  3CCE A;  1E3P A;  1AFP A;  1FGB D;  4A3D G;  2B29 A;  3M4P A;  5K36 H;  4X62 Q;  1STE A;  3T53 B;  4BY7 H;  1J9O A;  1CKM A;  1PRT F;  1SYD A;  4L5S A;  3HGB A;  2SEB D;  4R4I A;  4DK6 C;  3N52 A;  3C1F A;  3DUZ A;  2M9V A;  3S1M B;  4HIK A;  1CKN B;  3ULP A;  1JCK B;  2H1E A;  2A68 C;  1CM9 A;  1NMF A;  2KCC A;  4IN3 A;  1E1T A;  1ENA A;  1SNQ A;  1I6H B;  2EY1 A;  1FJG Q;  1DON A;  4K8I A;  3NXW A;  2DNE A;  3PUW A;  1TT2 A;  3PGZ A;  4A76 A;  2CCZ A;  1EEI D;  1H9R A;  5JVG 3;  4DV4 Q;  3RNU A;  4K8J A;  4JCV E;  2NVX H;  5J39 A;  1ICW A;  5JEA G;  4B3R L;  1CHQ D;  3TRZ A;  4QJF A;  5FO9 B;  1K83 H;  2EYH A;  2VXW A;  1D1K A;  3BDL A;  3KF8 B;  5JJL A;  5F2D A;  3FRP B;  2C9O A;  3KF6 A;  3GTL H;  2B8G A;  2D62 A;  5GRO A;  1EIG A;  2R6G A;  3DWA A;  4DKA C;  5GAD C;  1PFM A;  1BCP C;  3GV3 A;  3L2P A;  4LF8 L;  4B08 A;  1G8Z D;  4YWM A;  2JXM B;  5FLM G;  3OHX C;  1KRS A;  3J7A 5;  2NVQ B;  1D1I A;  4QGU A;  2Y0S B;  4JBK A;  1E2W A;  4XIG S;  1I4P A;  4BA2 I;  4FF3 A;  4A3G B;  1DCZ A;  4A3E B;  2AQ3 B;  4ID6 A;  2A69 C;  2ZT9 C;  4F88 A;  3PV0 A;  5HGQ A;  3TME A;  1K9M C;  1TVX A;  1VMC A;  2Z4H A;  4ZKC B;  1Q90 A;  2JN4 A;  5C3X A;  2QA4 A;  1ZYR C;  1TQO A;  1N34 L;  2RCF A;  1AP0 A;  5IYB H;  3C1E A;  3HKZ G;  3H6M A;  3M4Q A;  4I65 A;  4H0L C;  1F9P A;  5DM7 3;  4ZLT F;  1SE3 A;  2B2Y A;  4C2M B;  4JV5 Q;  4K2K A;  2ENB A;  1VQ5 A;  1Q81 C;  1HJP A;  3BVM A;  1B8A A;  1EY9 A;  3CCQ A;  1Y1V H;  1B2T A;  3GTJ H;  4DV0 Q;  2Z6K C;  2RHS B;  4CJ1 B;  1GM5 A;  2L15 A;  5KNC A;  2YTX A;  5C3E B;  4X62 L;  2JEB I;  3NE5 B;  1BQQ T;  2NVT B;  3R93 A;  2QDL A;  4DK1 A;  3P1H A;  4NB3 A;  1A3T A;  1GUG A;  4LF9 Q;  1B7Y B;  1VF7 A;  1PRT D;  4BBS H;  4LUV A;  1C0A A;  2SNS A;  1YNN C;  3SK8 A;  2VY3 A;  3D8G A;  3MXU A;  5M3M B;  1CHP D;  2EYJ A;  2R3Z A;  1N32 Q;  1S3O A;  1HA6 A;  1AE2 A;  4A3M G;  1PH3 A;  1I4Q A;  3M4O H;  1HNZ L;  3A55 A;  1N8R C;  1VQL A;  4KMU C;  4YHH Q;  1S4Z A;  2Z6B A;  1JR0 D;  4DV4 L;  4BXX G;  4J6H A;  1P16 A;  1TWG B;  3L7Z C;  4K6L A;  3VYR A;  1D5Z C;  4GN3 B;  1XNR Q;  1SE8 A;  1LTG D;  2NTT A;  1Y1W H;  1GKH A;  2B2T C;  4BA1 I;  3GP7 A;  5ELO A;  1H95 A;  2M00 A;  5IIF A;  4GNX A;  1WCM H;  4B3M Q;  2SNM A;  2MP1 A;  2AMC B;  5EPK A;  2WAC A;  1K3R A;  3FMC A;  1Q3L A;  1HZB A;  3KF6 B;  1MD2 D;  3MWY W;  3TN2 A;  2EPB A;  3K0Y A;  1U0L A;  3I7F A;  3H0G G;  2JA7 G;  5C6A A;  2JA6 G;  3NWS A;  5IGB A;  3KJO A;  1EWC A;  4A3D H;  1HRJ A;  1BO0 A;  3EFX D;  2AUK A;  4LFA Q;  2SDF A;  1DYQ A;  3KJP A;  1WTW A;  3PF5 A;  4NPS A;  1WTQ A;  4DR2 L;  1HTP A;  2IWH A;  4OL7 A;  2VL6 A;  1HNX L;  4LF4 Q;  2J0T D;  3UE0 A;  2IL8 A;  2ICE C;  1PYS B;  4DV0 L;  4EQP A;  3RZO B;  3MXN A;  1VDZ A;  3BJU A;  5CV6 A;  4KKS A;  4LF9 L;  5JEA H;  5IP9 G;  1PMR A;  5FO8 B;  4FF2 A;  1EOV A;  3I4O A;  4IFD J;  1HNW L;  3RD4 A;  1EY4 A;  3BZK A;  4JBM A;  5C4J B;  1LTR D;  1PDQ A;  4AIM A;  1NR2 A;  4JI5 L;  4HJ8 A;  1GD7 A;  2QGQ A;  3S16 H;  4EGV A;  1SNM A;  4C3J G;  1U4M A;  4DAY A;  3TS2 A;  4FXD A;  5FLM H;  4DR3 Q;  4ME3 A;  1DJR D;  3ZJY C;  3ITP A;  3SXH A;  3I70 A;  1K0R A;  4ZK9 B;  1ASZ A;  1O7Z A;  3GTO B;  5J3B A;  1CSQ A;  2NN6 I;  1CA5 A;  4JI0 L;  1NMG A;  3PUX A;  4UHV A;  3BVG A;  1H9M A;  4R9W A;  1TKW B;  4YCW A;  1PH1 A;  3ER0 A;  2F0T A;  2RKS A;  4DV5 Q;  1RL2 A;  3T1H Q;  4IPC A;  2PMZ E;  3HOX G;  2K4K A;  4DR7 Q;  1MKH A;  2VZA A;  4PMC A;  4LK1 C;  1K8G A;  1A6X A;  5TSS A;  2F0I A;  4MNO A;  3BG3 A;  1B53 A;  4KN7 C;  2P5Z X;  3X3M A;  1SRO A;  4EQ5 A;  5BR8 Q;  1QOH A;  1F9R A;  2LKV A;  3K80 C;  1WVL A;  5EKI A;  5JJI A;  3BVZ A;  1X9N A;  2BCO A;  4CKE A;  1UEA B;  4CDE C;  2A74 C;  5E4W C;  1SNP A;  2Z6K A;  3M3Y H;  1TWF H;  1J8I A;  5D65 A;  5GAG C;  2F0K A;  1WFQ A;  1JOK A;  1TS3 A;  4A3M H;  3G4S A;  1M4V A;  1YNJ C;  5I6Y A;  4A3C G;  3S2D B;  1U4R A;  2NBF A;  2CH4 W;  1K8A C;  1TY0 A;  3IRB A;  4R8N A;  1TR5 A;  3CPW A;  1H9J A;  2JQO A;  1SFO B;  4GOP C;  2E8G A;  2N8N A;  1YHQ A;  2VUM G;  4K6D A;  1OTC A;  1SRU A;  4JI8 Q;  1OXT A;  4YWK A;  2HCI A;  4OWT B;  4B3S L;  1LT5 D;  1STH A;  5LL6 S;  2J4X A;  2JEA I;  4AYB B;  5J22 A;  1WTP A;  1IL2 A;  4BWG B;  3K7U C;  1PZJ D;  4DR6 Q;  5IGG A;  1TWH H;  2MFI A;  2HHH L;  2UU9 Q;  1PFS A;  3SK4 A;  3IFT A;  4A93 B;  1E2Z A;  1OXV A;  4DV1 Q;  3F2B A;  1HTL D;  5NUC A;  2K14 A;  1IW7 C;  4R4T A;  4DK3 C;  4TSS A;  2B2V A;  1MBY A;  3H0G H;  2F3W A;  1KIX A;  2JA7 H;  2MUY A;  4DAY B;  3I4N G;  2QDB A;  4O1N A;  2JA6 H;  1YNX A;  3I8Z A;  3T16 A;  3RLF A;  5C44 G;  1PH7 A;  3T1H L;  1EY7 A;  1ET6 A;  1M1K C;  5EJW A;  2DGY A;  3J81 i;  4KJN A;  1SXT A;  1DZ1 A;  4A3J H;  3HEJ A;  3JAM E;  4QL5 A;  4DR7 L;  2NVY B;  3M7N A;  1EWI A;  4NW2 A;  2ID0 A;  4P2C B;  3T13 A;  2UXB Q;  4DV2 Q;  3QIA A;  4B3T L;  1XTC D;  1GHJ A;  1SYG A;  1PTO B;  2AKW B;  1XPR A;  3NPP A;  1GXD C;  4JI4 L;  3D31 A;  5ELC A;  3DM3 A;  3VDY A;  2RDG A;  1X55 A;  4JVZ A;  4RGM A;  2QCP X;  4GKJ Q;  3ERQ A;  2K5V A;  4LFB L;  2I0Q A;  1DXM A;  5I2Y A;  3K5N A;  1SMY C;  4HJ5 A;  2EZV A;  4HSP A;  4PQX A;  5IP9 H;  2TMP A;  3A7L A;  3MHB A;  5IYC G;  4U67 3;  4RCO A;  4S3S A;  5T1G A;  1ASY A;  3GTP H;  4DNI A;  1L0W A;  2CW0 C;  1U4P A;  3TRE A;  4AQY L;  2Z9H A;  3FKI B;  1Q7Y C;  1XNQ Q;  5BN5 A;  2A1A A;  2HIX A;  5M3F B;  2NB0 A;  5GAH C;  1NUC A;  4KY7 A;  1QE6 A;  2Q2U A;  2L1B A;  4JI1 Q;  1PV4 A;  3E6Z X;  1EFI D;  1BF4 A;  2BA0 A;  1EFW A;  4A3L H;  1CZG A;  2YYZ A;  2UUB Q;  1FNU A;  1LT6 D;  2R93 B;  1XX8 A;  1QJO A;  5M5Y B;  4K5X A;  4JI8 L;  3HOY B;  1F2M A;  5FK9 C;  4Z9C B;  4BY1 G;  3M7G A;  4A3I G;  1PZK D;  3CCJ A;  1CKO A;  1C4Q A;  2PNH A;  3CCM A;  3EIV A;  4LF5 Q;  3HOX H;  2WAQ B;  3RN2 A;  3U9O A;  2UU9 L;  3D4R A;  1RDP D;  1V1Q A;  4X65 Q;  1YIT A;  3KBG A;  4CGY B;  5J1Z A;  3HZX A;  3E9H A;  3N6R A;  2VQE Q;  2HUG A;  1RF2 D;  3FPU B;  4NP5 A;  1KHI A;  1C9O A;  1CTM A;  3NSW A;  2E2H B;  3K8A A;  3FEW X;  4CKC A;  2ZTD A;  2PQE A;  3OOC A;  3W1G A;  5JPN C;  4HED A;  3DMU A;  1KDC A;  2XWJ B;  2AHO B;  2XN9 C;  5HGT A;  5DM6 3;  4XXE A;  2IX1 A;  1KQS A;  1CSP A;  4NMZ A;  1KC8 C;  5GAE C;  5DNF A;  4RFB A;  1S40 A;  3OW7 A;  1ILP A;  2Z4I A;  4DUZ L;  2AQ1 B;  1WTH A;  5E7N A;  3TP6 A;  4RG1 A;  2UXB L;  4DV2 L;  2PYK A;  1FL0 A;  4BBR B;  1VQ7 A;  1N33 L;  3V96 A;  4LW1 A;  2A6H D;  2JE6 I;  3CCV A;  4X3T A;  2F0D A;  1W3S A;  2KUM A;  4LJZ C;  1X54 A;  2VS1 A;  4A3C H;  2WB1 B;  4BBS G;  1AW7 A;  1IBL L;  1VQD A;  5C0X I;  4C3I B;  1LT4 D;  3HOU H;  1JMC A;  2FIN B;  1I50 H;  2MJ8 A;  2WII B;  3K5O A;  5C4X H;  4BY7 B;  2Q8R E;  3MFG A;  1JE4 A;  3S2H B;  1HH2 P;  1RD9 D;  2VUM H;  4A4I A;  2OQK A;  2VB3 X;  1MJC A;  1A2U A;  2AUJ D;  2O2L D;  3K5L A;  3E3X A;  2MNA A;  2C35 B;  4OWX B;  1TS2 A;  2G5D A;  4GOP A;  3I73 A;  1JWM D;  3GQB A;  3TP7 A;  1LTI D;  3URY A;  1NJI C;  1VS0 A;  3A0J A;  3LWE A;  2JA5 H;  4YIJ A;  4PNY A;  1I5F A;  2NWG A;  5HUR A;  1GUW A;  1WCM G;  1N34 Q;  3BU2 A;  1X32 A;  3DM1 A;  2NVX B;  4EVO A;  1PTO F;  2PNR C;  3V2T A;  1O7I A;  2UUB L;  1A63 A;  1EZ6 A;  1K83 B;  4IZ8 A;  1UAP A;  3I4N H;  1MHW C;  5AJ3 L;  3G48 A;  4PMB A;  1LTS D;  5I2X A;  1WD0 A;  5C44 H;  3S1Q H;  4IOA A;  5FKA C;  3TSS A;  3GTL B;  4CDD C;  5I9P A;  4ZUJ A;  2QF7 A;  3PO3 G;  3NEN A;  4FXK C;  1W6K A;  3QG1 A;  1VQN A;  1WJJ A;  1PA6 A;  3K58 A;  4RGN A;  3S1N B;  3EQL C;  2VQE L;  4LUZ A;  2IX3 A;  3CRK C;  2F0G A;  5C3E G;  1OXS C;  2H5X A;  2UXC L;  4JG2 A;  3S1R H;  2RSN A;  1BDO A;  2CQO A;  1XMQ Q;  4JYA Q;  4L8J A;  2K52 A;  3ZYY X;  3MAQ A;  3GTK B;  4DR5 Q;  3TP5 A;  5L37 A;  3KUP A;  2EYO A;  1B1Z A;  2D5D A;  2MO0 A;  2YU9 B;  1HA5 A;  1ILQ A;  4DXF A;  2ZJP A;  5EGT A;  5FLX E;  5IYC H;  3CCS A;  1HNZ Q;  3DWQ A;  2R7Z H;  3WOE A;  3NTK A;  1V1P A;  3SHL A;  4N8X 1;  2JA9 A;  2KHI A;  2F3V A;  2GA4 B;  1B44 D;  2A68 D;  1Y1V B;  3GTJ B;  3H3V C;  2EY2 A;  1KD1 C;  1SR3 A;  1WTO A;  2CWA A;  5I9O A;  2KVM A;  2N78 A;  3H91 A;  4RA8 A;  4C3H H;  2HDL A;  1GUT A;  1F2L A;  1KLU D;  1WTV A;  3PO2 B;  4IUT A;  5IP7 G;  2PZU A;  5EAY A;  1O78 A;  2RSO A;  1HPC A;  1L2F A;  4BY1 H;  1KAB A;  1T5E A;  4A3I H;  4P74 A;  2K5N A;  2ZTC A;  2L55 A;  3M4O B;  1F9Q A;  4JBW A;  4YWL A;  2N3S A;  1ZXT A;  2K28 A;  4IUU A;  1D6E C;  2OEO A;  4XT3 B;  2F0O A;  1BCP D;  1TXY A;  2EYP A;  1DOK A;  5CYU A;  1NSN S;  2N49 A;  1BBX C;  1OXU A;  5JJK A;  3RR5 A;  5LL6 X;  3KOJ A;  1PTO D;  4DR2 Q;  4XQQ A;  1JE5 A;  5KYI A;  1HNX Q;  1Y1W B;  2RCN A;  3KLW A;  4WOR A;  2M2L A;  1LTA D;  1EY5 A;  2F0P A;  3BZD B;  3JC6 6;  1Q46 A;  3Q0A A;  2HCC A;  2EJG C;  1QWY A;  1U5K A;  2DY8 A;  3AFP A;  4A3F G;  4FYD A;  3HOZ B;  3U9S A;  2B3G A;  1XWE A;  4F7X A;  4KV6 A;  1KRT A;  1PRT C;  1SYF A;  3OWE B;  2F0L A;  5A2Q L;  1XMQ L;  4JYA L;  1HNW Q;  4DR5 L;  2EY6 A;  1ONL A;  3W1B A;  4DV6 L;  2K04 A;  5E3F A;  3J7A F;  2MHV A;  1CT1 D;  4A3D B;  3QOJ A;  4QMG A;  4LFC L;  1VQ8 A;  3C3L A;  2DNC A;  4NXN L;  3LGJ A;  4G57 A;  2EYL A;  1PFB A;  1TII D;  3TZU A;  4JI5 Q;  5KIX A;  4JI7 L;  3NK9 A;  4DR4 L;  3VR4 A;  3E0J A;  4NDX A;  4A75 A;  2QW7 A;  4MIU A;  1R9T B;  5E4X A;  2I46 A;  1CFM A;  4DPG A;  2HDM A;  1MSH A;  3J80 i;  3OWF A;  1YNN D;  2Q2I A;  3CKI B;  4JI0 Q;  1WOC A;  1JJC B;  4N9P A;  4XYO A;  1KAW A;  2XIW A;  4ZQ3 A;  2K6A A;  2V4D A;  3TDQ A;  1SN8 A;  4G7O C;  3I4M B;  2NUC A;  3CW2 C;  4WRD A;  3J80 c;  3CHB D;  1S72 A;  3LX0 A;  2EXD A;  3IAY A;  3PF4 A;  2UUC L;  4O2D A;  1YHA A;  3GO5 A;  3NEL A;  2JA8 G;  1VQ4 A;  1XMO L;  4PZ8 A;  1D5X C;  3A8I E;  2KCT A;  2HQE A;  4DV7 Q;  1FYC A;  3VR5 A;  2MPM A;  3PO3 H;  4CKB A;  2KEC A;  2XTI A;  2RQX A;  2L4N A;  2JJQ A;  3PCO B;  5IGE A;  5BN4 A;  5C3E H;  4A3J G;  2D0P A;  1TS4 A;  1HFG A;  1KL9 A;  2DY7 A;  4J8Q A;  4LAA A;  3SK5 A;  4OX9 L;  3HKZ E;  5H1S E;  1A8V A;  1LTB D;  5ELB A;  3UI2 A;  3OMC A;  5D3I B;  3P20 A;  1AZP A;  5M3M H;  1QUQ A;  2XRQ D;  1VQM A;  4IFD G;  1G6P A;  1Q8K A;  3HOV B;  3KDF A;  3U4V A;  4L5T A;  1E24 A;  1H9S A;  2GVA A;  1BXT A;  1L1O C;  1B9M A;  5EPJ A;  3J80 L;  1NE3 A;  2RF4 A;  4HJA A;  2B39 A;  3F2C A;  1Q1E A;  3Q24 A;  5CV7 A;  5LMN Q;  2ZJR A;  1TS5 A;  4DF7 A;  3BS1 A;  3PIO A;  5M5X H;  1SNO A;  5ELF A;  2NYZ D;  4OEL B;  3OIQ A;  3Q8D A;  1YIJ A;  3V05 A;  4GS3 A;  2FJ2 A;  4B3S Q;  3A5U A;  1SE2 A;  2BE5 C;  3UDX A;  3NP8 A;  1BBW A;  5IP7 H;  1JC7 A;  1G29 1;  2F52 A;  4AYB G;  2HHH Q;  1VQJ A;  3KBX A;  1IHZ A;  1LM0 A;  1Z47 A;  1VQO A;  2LY7 A;  5IT9 E;  3AYH B;  4PG3 A;  2LXJ A;  1TWF B;  3NTI A;  2B63 G;  1VCI A;  4A93 G;  1U9R A;  4TKO B;  4A3L G;  1PH5 A;  4BS9 A;  5CV5 A;  2L0C A;  1VQ6 A;  2HD3 A;  1UE6 A;  1A3U A;  1PZI D;  4P72 A;  3WOF A;  3E5S A;  1HQR D;  1HCZ A;  2O5I C;  4YCV A;  2F0S A;  2RVL A;  2I5L X;  3W5O A;  4KKU A;  1CK1 A;  3DXJ C;  4KD3 A;  2O5J C;  2YV5 A;  4B3T Q;  2A6E C;  2CHB D;  4GNX B;  4A3K G;  3GV6 A;  1A62 A;  1JB3 A;  3NTH A;  1E7Z A;  2K01 A;  2KCN A;  2PMZ B;  5CR3 A;  4JI4 Q;  1EYC A;  2R61 A;  4YY3 L;  1WI5 A;  4DV7 L;  2ZXP A;  3CC7 A;  3EVQ A;  4XTC S;  3VYU A;  3K5M A;  1EQT A;  3DLL A;  5FO7 B;  1C7Y A;  2F0M A;  1II3 A;  1SND A;  3VR2 A;  5IYD G;  4LFB Q;  3WDN A;  3E9I A;  4A3F H;  1VQG A;  4CDC C;  1CI3 M;  1ICF B;  3MA2 B;  4DR1 L;  2E2J B;  4XQJ A;  3RZD H;  4KHP Q;  1QB5 D;  2A8V A;  4ULL A;  2JA6 B;  3CMA A;  1QVG A;  3MTS A;  4RAU C;  4ME5 A;  1Q12 A;  4AQY Q;  2ZXO A;  4KHV A;  1I6V C;  4R4C A;  1X56 A;  4LUO A;  4A3B G;  3FKI G;  3D0F A;  4RGT A;  2RDF A;  1FGU A;  1QNU A;  1IYU A;  1TWA H;  3BDC A;  3W3A A;  4RWS C;  4IUP A;  5M3F G;  3HOU G;  5KND A;  5C4X G;  4JI2 L;  1K8M A;  1QUQ B;  4X3S A;  4QUF A;  1I4H A;  3KDF B;  5M5W B;  1G2S A;  3UDG A;  4HTH A;  1PFN A;  4HCS A;  5LMN L;  3GTO H;  3MXN B;  1AEX A;  1H9S B;  1T5X D;  2X69 A;  5COY A;  4U68 A;  2R93 G;  3SK6 A;  1YNJ D;  3EBE A;  2Q2T A;  4E6I A;  4DGZ A;  3S15 H;  1KNA A;  1Z6H A;  1F2Y A;  3FVQ A;  1R4P B;  1X3G A;  2ZXR A;  5KEE A;  2FMC A;  5T1I A;  1O7Y A;  1QVC A;  5ISR A;  2JA5 G;  1PXU A;  2B2T A;  3GTP B;  4JI3 Q;  2PZW A;  3ONA B;  1JJG A;  1X3E A;  2JA8 H;  4KN4 C;  1SJH D;  1LUZ A;  1SYB A;  2Q2H A;  1ML0 D;  1T9H A;  1GUN A;  1RKN A;  2GN5 A;  1YI2 A;  3VA7 A;  3DEO A;  4IFD I;  2K7V A;  2NZO A;  1KDA A;  5ELN A;  1JWS D;  4C3J B;  4FVM A;  2WFW A;  1Y69 U;  4LMQ D;  1WYD A;  1CZW A;  3UDI A;  2BH8 A;  3FP9 A;  3Q22 A;  1BCP B;  1UUP A;  1Q1B A;  2B2U C;  4DUZ Q;  3S17 B;  3I3C A;  5I4D A;  3I55 A;  4RKL A;  2RHQ B;  4ODG A;  1EIH A;  1A2T A;  1Y8O B;  2F0N A;  1N33 Q;  2UXD L;  4H7B A;  1PH2 A;  1GVP A;  3R2T A;  4TVA B;  3A5Z B;  1UE7 A;  2KJX A;  3T1Y L;  1LTL A;  1EZ8 A;  4UP9 A;  4IFD H;  3QWN A;  4KLK A;  4FNF A;  3H3V I;  1IBL Q;  1ENC A;  1NY4 A;  4FP5 D;  2A5H A;  4B9W A;  1FD7 D;  4KI0 A;  2X6G A;  1HUM A;  2D2C C;  4ABN A;  4QUC A;  4HSV A;  5K5P A;  2L5T A;  2Z8L A;  3G7L A;  3HOW B;  2IW3 A;  1I3Q H;  3J7Y W;  3L3O C;  1STY A;  2XRS D;  1WD1 A;  3A8J E;  1K8O A;  2R7Z G;  4KHP L;  3CQZ B;  4TQU S;  2OXP A;  3RLN A;  2VNU D;  1L1O A;  1X6O A;  3NQI A;  1ROD A;  5JOB A;  4CHT B;  5DEH A;  4DV3 Q;  3H3V H;  1RHP A;  1F9S A;  1SDF A;  2XNA C;  1SMY D;  3G6E A;  5A35 A;  3KFU A;  4QY7 A;  4LF6 Q;  4PMW A;  2E2I B;  2WV6 D;  2WKD A;  3MC0 B;  3GTG H;  4C3H G;  2B63 H;  3BYY B;  1VQ9 A;  3K7A H;  2LXK A;  4GN5 A;  1EEF D;  4OEM B;  4LF7 L;  4A93 H;  4Y7N B;  1N36 Q;  3ULL A;  4WJ4 A;  5FJ8 G;  3NWT A;  5DLQ E;  3SE0 A;  2CQA A;  1EOT A;  5AJ3 Q;  2HQL A;  1ESR A;  1EL0 A;  1TWC B;  1FNV A;  3LWU A;  4JI6 L;  2Q8T A;  1I50 B;  3IKJ A;  2BA1 A;  2IX0 A;  4K2L A;  3E0E A;  4KKT A;  1EWH A;  3F1Z A;  4APV A;  3BDO A;  3A74 A;  5COR A;  1AN8 A;  2NVY H;  1IZ6 A;  4JI3 L;  3D6W A;  3STB D;  4A3K H;  3B6Y A;  4GKK L;  4I7Z C;  4V19 0;  2MQH A;  2IT1 A;  2UXC Q;  5IGD A;  2HIV A;  2R92 B;  4FXG C;  5G3L F;  2E5L L;  1I4G A;  2EXZ A;  1B70 B;  1VQH A;  1PH9 A;  5IYD H;  4J1M A;  2EYF A;  3TQY A;  4JBJ A;  4JK1 C;  2OF1 A;  3OMG A;  3MEH A;  1CKN A;  2AWO A;  2MGS A;  2QIL A;  4H13 C;  3GTM B;  4CBV A;  3I4N B;  3HKS A;  1ZKO A;  1JOO A;  2A6H C;  1N9W A;  1EIF A;  2RBM A;  4DFA A;  1VQI A;  5C44 B;  2K5H A;  3MVV A;  2K1B A;  5LMN W;  5EKK A;  1XPO A;  3CPF A;  4IJL A;  4UPA A;  4A3B H;  4RH6 A;  1PLF A;  3FKI H;  1F2Z A;  1NAP A;  4Y52 H;  4N9T A;  4ZYS A;  1Y8N B;  5M3F H;  2E74 C;  5ELD A;  3KF8 A;  4HR7 B;  2D9U A;  2BDN A;  3OW2 A;  1STB A;  4UDU C;  2F0F A;  3S1R B;  3C46 A;  3PO2 G;  4MZ9 A;  1EY8 A;  2XGT A;  3FHW A;  4KJO A;  1LTT D;  2KED A;  2R93 H;  5M5Y H;  1JQY D;  4Q5V A;  3HOY H;  4KY6 A;  1NR4 A;  4DV3 L;  2Y0S G;  3PIP A;  2PW5 A;  4POF A;  1MSG A;  1YEZ A;  1I94 Q;  4LF6 L;  4A3G G;  1BCP F;  1B50 A;  4A3E G;  3AQQ A;  5C4Z A;  4X64 L;  2B2W C;  3WWV A;  4QB4 A;  2UUA Q;  2ZJQ A;  2B8F A;  2PQA A;  3VYS A;  2O4X A;  1AH9 A;  2K75 A;  1LYL A;  1N36 L;  1CA6 A;  2QEJ C;  2PPB C;  3KLR A;  3PIO 3;  2OT2 A;  5EBD A;  4OIK A;  5LMU L;  1KTK A;  2EYM A;  2FHT A;  1D5M C;  3EA6 A;  4GN4 B;  3GD7 A;  2Z0S A;  3H09 A;  4POG A;  4L5Q A;  1IKL A;  4Q0F A;  4OON A;  4P75 A;  5D3D A;  1GO3 E;  4DA2 A;  4BY1 B;  1KXL A;  4OO1 G;  2KOL A;  3HG9 A;  3QJY A;  2VQF L;  1PH8 A;  4C1N I;  3CP0 A;  4ZCK A;  3S14 H;  1HZA A;  1ET9 A;  4DV6 Q;  3HRZ C;  2SOB A;  5G3L D;  4LFC Q;  1TY2 A;  1BOS A;  4NXN Q;  4ZUI A;  2H4O A;  5M3M G;  4OWW B;  4IPD A;  4CJ0 B;  4JI7 Q;  1A3V A;  2E2D C;  3K6O A;  3RN5 A;  4DR4 Q;  1GJX A;  1SJE D;  1J5E L;  3S2H H;  5IWA L;  4F8M A;  4NKL A;  3NHH A;  1CQF A;  4B9X A;  3GTQ H;  1A0I A;  2EOT A;  4X3K A;  3FDT A;  1RJT A;  2OCE A;  1QZG A;  1SEB D;  1MJE A;  4HJ9 A;  3R8B A;  1JOQ A;  4K0K Q;  4X66 Q;  3GDE A;  2IPK D;  2Z1C A;  2PI2 A;  1KAA A;  2DJG C;  4DNT B;  1BKB A;  3I4M G;  5FJ8 H;  4BBS B;  2UUC Q;  1JB7 A;  1GOZ A;  4X3U A;  1G51 A;  1XMO Q;  4FF4 A;  2N88 A;  3JAM i;  1F77 A;  3U58 A;  2I5H A;  1HHV A;  1PHJ A;  4FF1 A;  2Y0S E;  3CRL C;  4IUV A;  1I94 L;  2F03 A;  1G2T A;  1XYI A;  1V1O A;  1HR0 L;  5JEA J;  2PW7 A;  2UUA L;  3K0X A;  1QZH A;  1IYV A;  1YBY A;  4DNR B;  4GOP B;  2F0U A;  2PCF B;  4OGQ C;  3S1N H;  3JAM c;  3O13 A;  4OX9 Q;  1PTO C;  2AWN A;  2EY5 A;  3ERO A;  5CV8 A;  3R3O A;  1PH6 A;  3VR6 A;  2PQA B;  3S1M H;  3GTK H;  2EJM A;  2A69 D;  4PZ7 A;  3I2Z A;  5D14 A;  3BYT B;  1WCM B;  1S5B D;  4H02 A;  2YU9 H;  1ZYR D;  3HOV G;  1I6H H;  1RTN A;  5JPM C;  4DK0 A;  4NXM L;  3ND8 A;  2Q8I B;  2LFN A;  1STN A;  1Q8I A;  1IBM L;  2ICI A;  2IHF A;  4XQN A;  2E75 C;  3LNN A;  1PVO A;  1VQC A;  2NN6 G;  3PO3 B;  3PUZ A;  4RCN A;  1ZEQ X;  2F1M A;  3I91 A;  4JW0 A;  3TS0 A;  3VA5 A;  3M4Y A;  2JP1 A;  2G9D A;  2KEE A;  4DAP A;  1HZ9 A;  1DOM A;  4KHZ A;  4RGO S;  4ALP A;  2FMM A;  3PO2 H;  2X6L A;  1DGS A;  3A56 A;  3D4D A;  3J81 E;  1YJ9 A;  2LS0 1;  2KCM A;  2NZ1 D;  3HFZ B;  4AH6 A;  1EU3 A;  1QVF A;  1O80 A;  1HZC A;  2NZH A;  3JAM L;  1IKM A;  2NVQ H;  1UEB A;  4HN7 A;  1XPU A;  4A3G H;  1SYE A;  1SAP A;  3MZ5 A;  1MI2 A;  3NBH A;  4A3E H;  1V1P B;  2VB2 X;  4ZKB B;  1RCV D;  1FJG L;  1O7L A;  4K0K L;  4KTA A;  4X66 L;  2PI2 E;  1D7Q A;  2ALY B;  1X3P A;  1JOR A;  3T56 B;  4OO1 I;  2A19 A;  1KNE A;  2E76 C;  1U4L A;  4LWC A;  2FFK B;  3IFD A;  3I72 A;  3P7J A;  2B2W A;  2K5Q A;  5M5X B;  1Z7T A;  1EY0 A;  1CUK A;  2KEN A;  5AFW A;  1WTR A;  1STG A;  5C5L A;  4YY3 Q;  1VQK A;  4C2M H;  1I4X A;  4HIO A;  1W2B A;  4WJ3 M;  1GHK A;  3OIP A;  2F4I A;  5DAU A;  5EKL A;  3SR1 A;  4ZRZ A;  1Q86 C;  3S16 B;  3L0O A;  3G71 A;  4HCE A;  1G6Z A;  1EYG A;  2B2V C;  2ZM6 Q;  1M90 C;  2FXQ A;  1QIL A;  4WJW A;  4OO1 H;  3HOZ H;  3UE1 A;  4DR1 Q;  3R2I A;  2KHS A;  2J7Z A;  1K73 C;  2A73 B;  3SEB A;  1B3Q A;  3HP3 A;  2NVT H;  2BDO A;  4G4K A;  5IY0 A;  4M1U B;  4FDB A;  1C48 A;  3F8T A;  2RA4 A;  3EN2 A;  3NUC A;  5KYL A;  5JJZ A;  1VQE A;  2OQ0 A;  1A15 A;  5IOD A;  3HKZ B;  4P73 A;  3AEV A;  4TRD A;  4O42 A;  4UP8 A;  1LAC A;  5C3W A;  4R4O A;  1SNC A;  1EYD A;  1DD2 A;  1DM0 B;  1VQA A;  4GLX A;  1R9T H;  4JI2 Q;  5M9O A;  4R8I A;  4C1N K;  1V9P A;  4JV5 L;  1TWG H;  3PSI A;  1BVS A;  1LV9 A;  1VMP A;  4LNQ A;  3J7A V;  2KBN A;  2EQS A;  1SSO A;  5C4H A;  3MFY A;  4A3F B;  5KRU A;  4QF4 A;  3OSO A;  4HID A;  1HR0 W;  2ATW A;  3I4M H;  3RZD B;  3L9A X;  4H44 C;  1STA A;  4F87 A;  3M3Y B;  2CWP A;  2YTY A;  3SVM A;  4A3M B;  1B4O A;  1Y8P B;  1N32 L;  4MHE A;  2AQ2 B;  1TWA B;  1BUV T;  2BE5 D;  3VR3 A;  1BBU A;  3D4W A;  2BOS A;  1IYJ B;  1KDB A;  4XDX A;  4YHH L;  4K5V A;  2F0W A;  3NBI A;  1VF5 C;  4QQB X;  1L0X B;  3ULJ A;  5HY6 A;  1QG7 A;  4HMI A;  3NBH B;  2L9H A;  1XNR L;  2UXD Q;  2XSC A;  1W6J A;  2WP8 J;  3PIP 3;  3T1Y Q;  2F0J A;  4JOI C;  3QR8 A;  3S15 B;  5EQ0 A;  3SGI A;  1Z9F A;  4R1J A;  4WFN 3;  1WTX A;  2EE1 A;  1LT3 D;  4EQO A;  1TWH B;  4B3M L;  2ZM6 L;  3HOV H;  5GQO A;  3K81 C;  1K28 A;  3RZO H;  3TZD A;  2F0H A;  2JA8 B;  1EUJ A;  3H0G B;  5EBC A;  3HOW G;  3OYY A;  2JA7 B;  5FLX c;  2A6E D;  1D8L A;  3A7A B;  4J15 A;  3W2D A;  2NN6 H;  2CH4 A;  1EQR A;  1E1O A;  3KK7 A;  1UNS A;  4DUY Q;  2OTJ A;  4YCU A;  1JWU D;  3I90 A;  1V8Q A;  2N55 A;  5IE8 A;  4K14 A;  1EU4 A;  4A3J B;  5C4J H;  4KD4 A;  5KGU A;  1HQM C;  3CC4 A;  2F0E A;  5JVH 3;  3M9B A;  4LFA L;  4IUN A;  3CF5 A;  4JC0 A;  1CQV A;  3T4A C;  1C8C A;  4GLA C;  1X3Q A;  5JAV A;  4LF7 Q;  4LF4 L;  1OO9 B;  2ZTE A;  1JIC A;  4ZAI A;  2JSO A;  1Y14 B;  4IUR A;  1XTD A;  1YVC A;  3DWP A;  1SE4 A;  3HS0 C;  2K32 A;  2XWB B;  3UDF A;  2R7F A;  1ESF A;  4JI6 Q;  3EJI A;  1X65 A;  1SBB B;  3I4L A;  1BNZ A;  3HOY G;  4IO9 A;  1I3Q B;  1VQF A;  4BXX H;  4L63 B;  1LLR D;  4XYQ A;  4AYB E;  2EVB A;  2IHE A;  2WAQ G;  5KNB A;  1SMX A; 
#chains in the Genus database with same CATH homology
 4IUQ A;  3D6C A;  5IOC A;  1HFN A;  1S5F D;  4HAE A;  3F2U A;  1HXY D;  5FLX L;  1EY6 A;  4QCL A;  4K5W A;  2G9H D;  3OPO A;  3QB3 A;  5C0X G;  3GTG B;  5CV4 A;  2B63 B;  3D3R A;  3K7A B;  5A2Q E;  1ENF A;  3FPP A;  2C5C A;  4OHJ A;  3DHQ A;  1IW7 D;  4EQN A;  2JYO A;  2PZT A;  1OXX K;  4KK7 A;  3KLS X;  3C2P A;  5C0X J;  2NTS A;  4RHR A;  2EDG A;  4PV1 C;  3HOX B;  5C5M A;  4GZY C;  2DN8 A;  2KQ3 A;  2L12 A;  3X3N A;  4C3I G;  1AZQ A;  1NCV A;  4A3K B;  5K36 G;  1MGS A;  3AU7 A;  4IQZ A;  4DN4 M;  1QNK A;  3P75 A;  3G6J B;  4RKB A;  3MXP A;  5IGC A;  2LMC B;  4C56 C;  4G7H C;  2PO4 A;  3S9W A;  2WIN B;  2I07 B;  2F0V A;  5FOB B;  3DEP A;  1V43 A;  1PRT B;  3SDZ A;  1EYA A;  2CW0 D;  4A3B B;  4OIJ A;  3RUZ A;  5I6W A;  4DXG A;  3Q6S A;  3HOU B;  5BN3 A;  5C4X B;  3AMU A;  1IL8 A;  1LAB A;  2TSS A;  4ILW A;  2VUM B;  3VYT A;  3Q23 A;  3RMH A;  3TP8 A;  2XVS A;  1H9K A;  1PTO H;  4DU9 A;  4G7Z C;  1FR3 A;  1XXG A;  3J81 L;  2L11 A;  3J80 E;  3CU7 A;  2JA5 B;  1LO5 D;  5ELE A;  4IAL A;  1GUO A;  2B2Y C;  4CJ2 C;  1FNW A;  3AB9 A;  1E0B A;  2RDH A;  1QCB D;  2WKC A;  4MN3 A;  1B3A A;  3KLS A;  5CC4 A;  3K59 A;  3S1Q B;  1RTO A;  5E1F A;  3QO2 A;  2QKI C;  4DAV A;  1EQV A;  1E2V A;  3PUV A;  3A54 A;  4KY5 A;  2IJ0 A;  5EPL A;  4M8A A;  2K5W A;  1TU2 B;  1SYC A;  2KA7 A;  3S14 B;  1S5C D;  1S5D D;  1D2B A;  5CV9 A;  5CBE E;  4L6T B;  1I4R A;  4RHS A;  5IGF A;  5LHY 1;  1S5E D;  1PYW D;  2K03 A;  2R7Z B;  3TBI B;  1HUN A;  2K5D A;  1DOL A;  5CGK A;  3GTQ B;  3PMF A;  2K33 A;  1G91 A;  2K05 A;  4UAI A;  1B9N A;  5C0X H;  1GUS A;  4C3H B;  2EJF C;  3PUY A;  4FO2 A;  3H94 A;  3M85 A;  1R4Q B;  3A8K E;  3ND9 A;  3IL8 A;  2CVR A;  4XT1 B;  4HMJ A;  3QOL A;  3T51 B;  5CMD A;  1BR9 A;  4A3I B;  2B2U A;  1L0Y B;  4QIW B;  1M8A A;  4V0B A;  3MXG A;  3NQT A;  5IT9 L;  3K57 A;  5CBA E;  1KLG D;  2F0Q A;  1AFP A;  1FGB D;  5K36 H;  1STE A;  3T53 B;  1J9O A;  1PRT F;  1SYD A;  3HGB A;  2SEB D;  3N52 A;  3C1F A;  3DUZ A;  2M9V A;  3S1M B;  1JCK B;  2H1E A;  2A68 C;  1CM9 A;  2KCC A;  4IN3 A;  1SNQ A;  1ENA A;  1I6H B;  2EY1 A;  1DON A;  4K8I A;  3NXW A;  2DNE A;  3PUW A;  1TT2 A;  1EEI D;  1H9R A;  5JVG 3;  4K8J A;  5J39 A;  1ICW A;  5JEA G;  1CHQ D;  5FO9 B;  2EYH A;  2VXW A;  1D1K A;  3BDL A;  5F2D A;  3FRP B;  2C9O A;  2B8G A;  2D62 A;  1EIG A;  2R6G A;  3DWA A;  1PFM A;  1BCP C;  3GV3 A;  4B08 A;  1G8Z D;  2JXM B;  3OHX C;  2NVQ B;  1D1I A;  2Y0S B;  1E2W A;  4XIG S;  1I4P A;  4BA2 I;  4FF3 A;  4A3G B;  1DCZ A;  4A3E B;  2AQ3 B;  4ID6 A;  2A69 C;  2ZT9 C;  4F88 A;  3PV0 A;  3TME A;  1TVX A;  1VMC A;  2Z4H A;  4ZKC B;  1Q90 A;  5C3X A;  1ZYR C;  1TQO A;  1AP0 A;  3C1E A;  3H6M A;  4I65 A;  4H0L C;  1F9P A;  5DM7 3;  4ZLT F;  1SE3 A;  2B2Y A;  4C2M B;  4K2K A;  2ENB A;  3BVM A;  1EY9 A;  1B2T A;  4CJ1 B;  5KNC A;  5C3E B;  2JEB I;  3NE5 B;  1BQQ T;  2NVT B;  3R93 A;  4DK1 A;  3P1H A;  1A3T A;  1GUG A;  1VF7 A;  1PRT D;  2SNS A;  1YNN C;  3SK8 A;  3D8G A;  3MXU A;  5M3M B;  1CHP D;  2EYJ A;  2R3Z A;  1HA6 A;  1I4Q A;  3A55 A;  4KMU C;  1S4Z A;  1JR0 D;  4J6H A;  1TWG B;  3L7Z C;  4K6L A;  3VYR A;  1D5Z C;  1LTG D;  2NTT A;  2B2T C;  4BA1 I;  3GP7 A;  2M00 A;  5IIF A;  2SNM A;  2MP1 A;  5EPK A;  2WAC A;  3FMC A;  1Q3L A;  1MD2 D;  3MWY W;  3TN2 A;  2EPB A;  3K0Y A;  5C6A A;  3NWS A;  5IGB A;  1EWC A;  1HRJ A;  1BO0 A;  3EFX D;  2AUK A;  2SDF A;  1DYQ A;  1WTW A;  1HTP A;  2IWH A;  4OL7 A;  2J0T D;  2IL8 A;  2ICE C;  4EQP A;  3RZO B;  3MXN A;  1VDZ A;  5CV6 A;  4KKS A;  5JEA H;  1PMR A;  5FO8 B;  4FF2 A;  4IFD J;  3RD4 A;  1EY4 A;  5C4J B;  1LTR D;  1PDQ A;  1NR2 A;  4EGV A;  1SNM A;  4C3J G;  1U4M A;  4DAY A;  4FXD A;  1DJR D;  3ITP A;  3SXH A;  3I70 A;  4ZK9 B;  1O7Z A;  3GTO B;  2NN6 I;  1CA5 A;  3PUX A;  3BVG A;  1H9M A;  4R9W A;  1TKW B;  2F0T A;  2RKS A;  4PMC A;  4LK1 C;  1A6X A;  5TSS A;  2F0I A;  3BG3 A;  1B53 A;  4KN7 C;  3X3M A;  1QOH A;  1F9R A;  2LKV A;  1WVL A;  5EKI A;  3BVZ A;  2BCO A;  4CKE A;  1UEA B;  2A74 C;  5E4W C;  1SNP A;  1J8I A;  5D65 A;  2F0K A;  1JOK A;  1TS3 A;  1M4V A;  1YNJ C;  5I6Y A;  3S2D B;  1U4R A;  2NBF A;  1TY0 A;  4R8N A;  1TR5 A;  1H9J A;  1SFO B;  4K6D A;  1OXT A;  2HCI A;  1LT5 D;  1STH A;  5LL6 S;  2J4X A;  2JEA I;  4AYB B;  5J22 A;  1WTP A;  4BWG B;  1PZJ D;  5IGG A;  3SK4 A;  3IFT A;  4A93 B;  1E2Z A;  1OXV A;  1HTL D;  5NUC A;  1IW7 C;  4TSS A;  2B2V A;  1MBY A;  2F3W A;  2MUY A;  2QDB A;  4O1N A;  3I8Z A;  3T16 A;  3RLF A;  1EY7 A;  1ET6 A;  5EJW A;  4KJN A;  1SXT A;  1DZ1 A;  3HEJ A;  3JAM E;  2NVY B;  3M7N A;  4NW2 A;  2ID0 A;  4P2C B;  3T13 A;  3QIA A;  1XTC D;  1GHJ A;  1SYG A;  1PTO B;  3NPP A;  1GXD C;  3D31 A;  5ELC A;  2RDG A;  4RGM A;  2QCP X;  3ERQ A;  5I2Y A;  1DXM A;  3K5N A;  1SMY C;  2EZV A;  4HSP A;  4PQX A;  2TMP A;  3A7L A;  3MHB A;  4U67 3;  4RCO A;  4S3S A;  5T1G A;  2CW0 C;  1U4P A;  3FKI B;  5BN5 A;  5M3F B;  2NB0 A;  1NUC A;  4KY7 A;  1QE6 A;  2L1B A;  3E6Z X;  1EFI D;  1BF4 A;  2BA0 A;  1CZG A;  2YYZ A;  1FNU A;  1LT6 D;  2R93 B;  1XX8 A;  1QJO A;  5M5Y B;  4K5X A;  3HOY B;  1F2M A;  5FK9 C;  4Z9C B;  3M7G A;  1PZK D;  1C4Q A;  2WAQ B;  3U9O A;  3D4R A;  1RDP D;  3KBG A;  4CGY B;  5J1Z A;  3HZX A;  3N6R A;  2HUG A;  1RF2 D;  3FPU B;  4NP5 A;  2E2H B;  3NSW A;  1CTM A;  3FEW X;  4CKC A;  3OOC A;  2PQE A;  5JPN C;  4HED A;  3DMU A;  1KDC A;  2XWJ B;  2XN9 C;  5HGT A;  5DM6 3;  4XXE A;  2IX1 A;  4NMZ A;  5DNF A;  4RFB A;  3OW7 A;  1ILP A;  2Z4I A;  2AQ1 B;  3TP6 A;  2PYK A;  4BBR B;  3V96 A;  2A6H D;  2JE6 I;  4X3T A;  2F0D A;  2KUM A;  4LJZ C;  2WB1 B;  1AW7 A;  5C0X I;  4C3I B;  1LT4 D;  2FIN B;  2MJ8 A;  2WII B;  3K5O A;  4BY7 B;  2Q8R E;  3MFG A;  1JE4 A;  3S2H B;  1RD9 D;  2VB3 X;  1A2U A;  2AUJ D;  2O2L D;  3K5L A;  1TS2 A;  3I73 A;  1JWM D;  3GQB A;  3TP7 A;  1LTI D;  3URY A;  3LWE A;  4YIJ A;  4PNY A;  2NWG A;  5HUR A;  1GUW A;  1X32 A;  3DM1 A;  2NVX B;  4EVO A;  1PTO F;  2PNR C;  3V2T A;  1EZ6 A;  1K83 B;  4IZ8 A;  1UAP A;  4PMB A;  1LTS D;  5I2X A;  1WD0 A;  5FKA C;  3TSS A;  3GTL B;  5I9P A;  4ZUJ A;  2QF7 A;  4FXK C;  1W6K A;  3QG1 A;  3K58 A;  4RGN A;  3S1N B;  3EQL C;  2IX3 A;  3CRK C;  2F0G A;  1OXS C;  2RSN A;  1BDO A;  4L8J A;  3MAQ A;  3ZYY X;  3GTK B;  3TP5 A;  3KUP A;  2EYO A;  1B1Z A;  2D5D A;  2YU9 B;  1HA5 A;  1ILQ A;  4DXF A;  5EGT A;  5FLX E;  3DWQ A;  3WOE A;  3NTK A;  1V1P A;  3SHL A;  2F3V A;  2GA4 B;  1B44 D;  2A68 D;  1Y1V B;  3GTJ B;  3H3V C;  2EY2 A;  1WTO A;  5I9O A;  2KVM A;  3H91 A;  4RA8 A;  2HDL A;  1GUT A;  1F2L A;  1KLU D;  1WTV A;  3PO2 B;  4IUT A;  2PZU A;  1O78 A;  2RSO A;  1HPC A;  1KAB A;  1T5E A;  2L55 A;  3M4O B;  1F9Q A;  4JBW A;  1ZXT A;  2K28 A;  4IUU A;  1D6E C;  2OEO A;  4XT3 B;  2F0O A;  1BCP D;  2EYP A;  1DOK A;  5CYU A;  1NSN S;  1BBX C;  1OXU A;  5LL6 X;  1PTO D;  4XQQ A;  5KYI A;  1Y1W B;  4WOR A;  2M2L A;  1LTA D;  1EY5 A;  2F0P A;  3BZD B;  3Q0A A;  2HCC A;  2EJG C;  1QWY A;  2DY8 A;  4FYD A;  3HOZ B;  3U9S A;  1XWE A;  4F7X A;  4KV6 A;  1PRT C;  1SYF A;  3OWE B;  2F0L A;  5A2Q L;  2EY6 A;  1ONL A;  2K04 A;  5E3F A;  3J7A F;  2MHV A;  1CT1 D;  4A3D B;  3QOJ A;  4QMG A;  3C3L A;  2DNC A;  4G57 A;  2EYL A;  1PFB A;  1TII D;  3TZU A;  5KIX A;  3NK9 A;  3VR4 A;  3E0J A;  4NDX A;  4MIU A;  1R9T B;  5E4X A;  2I46 A;  1CFM A;  2HDM A;  1MSH A;  3OWF A;  1YNN D;  3CKI B;  4N9P A;  4XYO A;  2XIW A;  4ZQ3 A;  2K6A A;  2V4D A;  3TDQ A;  4G7O C;  3I4M B;  2NUC A;  4WRD A;  3CHB D;  3LX0 A;  3IAY A;  3GO5 A;  1D5X C;  3A8I E;  2HQE A;  1FYC A;  3VR5 A;  2MPM A;  4CKB A;  2KEC A;  2RQX A;  2L4N A;  5IGE A;  5BN4 A;  1TS4 A;  1HFG A;  2DY7 A;  4J8Q A;  4LAA A;  3SK5 A;  1LTB D;  5ELB A;  3UI2 A;  3OMC A;  5D3I B;  3P20 A;  1AZP A;  2XRQ D;  4IFD G;  3HOV B;  1H9S A;  1BXT A;  1B9M A;  5EPJ A;  3J80 L;  2B39 A;  1Q1E A;  3Q24 A;  5CV7 A;  1TS5 A;  4DF7 A;  3BS1 A;  1SNO A;  5ELF A;  2NYZ D;  3OIQ A;  3V05 A;  2FJ2 A;  1SE2 A;  2BE5 C;  3NP8 A;  1JC7 A;  1G29 1;  3KBX A;  1IHZ A;  1Z47 A;  2LY7 A;  5IT9 E;  1TWF B;  3NTI A;  1VCI A;  1U9R A;  4TKO B;  4BS9 A;  5CV5 A;  2L0C A;  1A3U A;  1PZI D;  3WOF A;  3E5S A;  1HQR D;  1HCZ A;  2O5I C;  2F0S A;  2RVL A;  4KKU A;  1CK1 A;  3DXJ C;  4KD3 A;  2O5J C;  2A6E C;  2CHB D;  3GV6 A;  1JB3 A;  2K01 A;  3NTH A;  2KCN A;  2PMZ B;  5CR3 A;  1EYC A;  2R61 A;  2ZXP A;  3EVQ A;  4XTC S;  3VYU A;  3K5M A;  1EQT A;  5FO7 B;  2F0M A;  1II3 A;  1SND A;  3VR2 A;  3WDN A;  1CI3 M;  3MA2 B;  2E2J B;  4XQJ A;  1QB5 D;  4ULL A;  2JA6 B;  3MTS A;  4RAU C;  4ME5 A;  1Q12 A;  2ZXO A;  4KHV A;  1I6V C;  4RGT A;  2RDF A;  1QNU A;  1IYU A;  3BDC A;  3W3A A;  4RWS C;  4IUP A;  5KND A;  1K8M A;  4X3S A;  4QUF A;  1I4H A;  5M5W B;  1G2S A;  4HTH A;  1PFN A;  4HCS A;  1AEX A;  1H9S B;  1T5X D;  2X69 A;  5COY A;  4U68 A;  3SK6 A;  1YNJ D;  4E6I A;  4DGZ A;  1KNA A;  1Z6H A;  1F2Y A;  3FVQ A;  1R4P B;  2ZXR A;  5KEE A;  2FMC A;  5T1I A;  1O7Y A;  5ISR A;  1PXU A;  2B2T A;  3GTP B;  2PZW A;  3ONA B;  4KN4 C;  1SJH D;  1SYB A;  1ML0 D;  1GUN A;  1RKN A;  3VA7 A;  3DEO A;  4IFD I;  2K7V A;  1KDA A;  1JWS D;  4C3J B;  4FVM A;  1Y69 U;  4LMQ D;  1CZW A;  3Q22 A;  1BCP B;  1UUP A;  1Q1B A;  2B2U C;  3S17 B;  3I3C A;  5I4D A;  4RKL A;  4ODG A;  1EIH A;  1A2T A;  1Y8O B;  2F0N A;  4H7B A;  3R2T A;  2KJX A;  1EZ8 A;  4IFD H;  3QWN A;  4FNF A;  1ENC A;  4FP5 D;  2A5H A;  4B9W A;  1FD7 D;  4KI0 A;  2X6G A;  1HUM A;  2D2C C;  4ABN A;  4QUC A;  4HSV A;  5K5P A;  2L5T A;  2Z8L A;  3G7L A;  3HOW B;  2IW3 A;  3J7Y W;  3L3O C;  1STY A;  2XRS D;  1WD1 A;  3A8J E;  1K8O A;  3CQZ B;  4TQU S;  2OXP A;  2VNU D;  3NQI A;  5JOB A;  1ROD A;  4CHT B;  5DEH A;  1RHP A;  1F9S A;  1SDF A;  2XNA C;  1SMY D;  5A35 A;  4PMW A;  2E2I B;  2WV6 D;  2WKD A;  3MC0 B;  4C3H G;  3BYY B;  1EEF D;  4Y7N B;  3NWT A;  3SE0 A;  2CQA A;  1EOT A;  1ESR A;  1EL0 A;  1TWC B;  1FNV A;  3LWU A;  2Q8T A;  1I50 B;  3IKJ A;  2BA1 A;  2IX0 A;  4K2L A;  4KKT A;  1EWH A;  3BDO A;  5COR A;  1AN8 A;  3D6W A;  4I7Z C;  4V19 0;  2IT1 A;  5IGD A;  2R92 B;  4FXG C;  5G3L F;  1I4G A;  2EXZ A;  4J1M A;  2EYF A;  4JK1 C;  2OF1 A;  3OMG A;  3MEH A;  2AWO A;  2MGS A;  2QIL A;  4H13 C;  3GTM B;  4CBV A;  3I4N B;  1ZKO A;  1JOO A;  2A6H C;  2RBM A;  4DFA A;  5C44 B;  3MVV A;  2K1B A;  5EKK A;  4RH6 A;  1PLF A;  1F2Z A;  1NAP A;  4N9T A;  4ZYS A;  1Y8N B;  2E74 C;  5ELD A;  3KF8 A;  4HR7 B;  2D9U A;  2BDN A;  1STB A;  4UDU C;  2F0F A;  3S1R B;  3C46 A;  1EY8 A;  4KJO A;  1LTT D;  2KED A;  1JQY D;  4Q5V A;  4KY6 A;  1NR4 A;  2PW5 A;  1MSG A;  1BCP F;  1B50 A;  5C4Z A;  2B2W C;  4QB4 A;  2B8F A;  3VYS A;  2O4X A;  1CA6 A;  2QEJ C;  2PPB C;  3KLR A;  3PIO 3;  2OT2 A;  5EBD A;  4OIK A;  1KTK A;  2EYM A;  2FHT A;  1D5M C;  3EA6 A;  3GD7 A;  3H09 A;  1IKL A;  4Q0F A;  5D3D A;  4DA2 A;  4BY1 B;  4OO1 G;  2KOL A;  3HG9 A;  3QJY A;  4C1N I;  1ET9 A;  3HRZ C;  2SOB A;  5G3L D;  1TY2 A;  1BOS A;  4ZUI A;  2H4O A;  4CJ0 B;  1A3V A;  2E2D C;  3K6O A;  1GJX A;  1SJE D;  4F8M A;  4NKL A;  3NHH A;  1CQF A;  4B9X A;  2EOT A;  4X3K A;  3FDT A;  1RJT A;  1SEB D;  3R8B A;  1JOQ A;  2IPK D;  2Z1C A;  1KAA A;  4DNT B;  4BBS B;  1GOZ A;  4X3U A;  4FF4 A;  2N88 A;  1F77 A;  1HHV A;  4FF1 A;  3CRL C;  4IUV A;  2F03 A;  1G2T A;  1XYI A;  1V1O A;  5JEA J;  2PW7 A;  1IYV A;  4DNR B;  2F0U A;  2PCF B;  4OGQ C;  3O13 A;  1PTO C;  2AWN A;  2EY5 A;  3ERO A;  5CV8 A;  3R3O A;  3VR6 A;  2EJM A;  2A69 D;  5D14 A;  3BYT B;  1WCM B;  1S5B D;  1ZYR D;  1RTN A;  5JPM C;  4DK0 A;  3ND8 A;  2Q8I B;  2LFN A;  1STN A;  1Q8I A;  2ICI A;  4XQN A;  2E75 C;  3LNN A;  2NN6 G;  3PO3 B;  3PUZ A;  4RCN A;  1ZEQ X;  2F1M A;  3I91 A;  3VA5 A;  2JP1 A;  2G9D A;  3M4Y A;  2KEE A;  4DAP A;  1DOM A;  4KHZ A;  4RGO S;  2FMM A;  2X6L A;  3A56 A;  3D4D A;  3J81 E;  2LS0 1;  2NZ1 D;  1EU3 A;  1O80 A;  3JAM L;  1IKM A;  4HN7 A;  1SYE A;  1SAP A;  3MZ5 A;  1MI2 A;  3NBH A;  1V1P B;  2VB2 X;  4ZKB B;  1RCV D;  1O7L A;  4KTA A;  1JOR A;  1X3P A;  3T56 B;  4OO1 I;  1KNE A;  2E76 C;  1U4L A;  2FFK B;  3IFD A;  3I72 A;  3P7J A;  2B2W A;  2K5Q A;  5M5X B;  1Z7T A;  1EY0 A;  5AFW A;  1WTR A;  1STG A;  5C5L A;  1I4X A;  1GHK A;  3OIP A;  2F4I A;  5DAU A;  5EKL A;  3SR1 A;  4ZRZ A;  3S16 B;  4HCE A;  1G6Z A;  2B2V C;  1QIL A;  4WJW A;  4OO1 H;  3R2I A;  2KHS A;  2J7Z A;  2A73 B;  3SEB A;  3HP3 A;  2BDO A;  4G4K A;  4M1U B;  1C48 A;  2RA4 A;  3NUC A;  5KYL A;  5JJZ A;  1A15 A;  5IOD A;  3HKZ B;  4TRD A;  4O42 A;  1LAC A;  5C3W A;  1SNC A;  1EYD A;  1DD2 A;  1DM0 B;  5M9O A;  4R8I A;  4C1N K;  1LV9 A;  1VMP A;  3J7A V;  1SSO A;  5C4H A;  3MFY A;  4A3F B;  5KRU A;  4QF4 A;  3OSO A;  3RZD B;  3L9A X;  4H44 C;  1STA A;  4F87 A;  3M3Y B;  3SVM A;  4A3M B;  1B4O A;  1Y8P B;  4MHE A;  2AQ2 B;  1TWA B;  1BUV T;  2BE5 D;  3VR3 A;  3D4W A;  2BOS A;  1KDB A;  4XDX A;  4K5V A;  2F0W A;  3NBI A;  1VF5 C;  1L0X B;  1QG7 A;  4HMI A;  2L9H A;  2XSC A;  1W6J A;  2WP8 J;  3PIP 3;  2F0J A;  3S15 B;  5EQ0 A;  1WTX A;  4WFN 3;  2EE1 A;  1LT3 D;  4EQO A;  1TWH B;  3TZD A;  2F0H A;  2JA8 B;  3H0G B;  5EBC A;  2JA7 B;  2A6E D;  3A7A B;  3W2D A;  2NN6 H;  3KK7 A;  1UNS A;  1JWU D;  3I90 A;  1V8Q A;  2N55 A;  4K14 A;  1EU4 A;  4A3J B;  4KD4 A;  5KGU A;  1HQM C;  2F0E A;  5JVH 3;  4IUN A;  1CQV A;  3T4A C;  1C8C A;  1X3Q A;  5JAV A;  1OO9 B;  4ZAI A;  1JIC A;  2JSO A;  4IUR A;  3DWP A;  1SE4 A;  3HS0 C;  2K32 A;  2XWB B;  1ESF A;  3EJI A;  3I4L A;  1SBB B;  1BNZ A;  1I3Q B;  4L63 B;  1LLR D;  4XYQ A;  2EVB A;  5KNB A;  1WTQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...