5IGDA

Crystal structure of staphylococcal nuclease variant delta+phs t62h/i92e at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFHKKMVENAKKIEVEFDKGQRTDKYGRGLAYEYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS T62H/I92E at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5igdA00
1TT2A 3NK9A 3S9WA 2F0QA 2OXPA 4ZQ3A 5NUCA 5C4HA 2PZTA 3ERQA 3SXHA 1EZ6A 3EJIA 2KQ3A 4R8NA 1SNPA 1U9RA 1SNCA 2M00A 1SYEA 1KDBA 1STHA 2EYLA 1NSNS 1EZ8A 4N9PA 4NP5A 4ZUJA 5J1ZA 5I6WA 4RKBA 1STNA 5KGUA 3T13A 1SNMA 1KDAA 5EGTA 4WRDA 5CV8A 2OEOA 1ENCA 4I65A 3V2TA 5CC4A 5IGGA 1JOQA 2F0HA 1RKNA 4S3SA 2F0NA 4OL7A 2PYKA 2EY2A 4TRDA 4LAAA 1EYCA 1II3A 1NUCA 1STBA 2EXZA 2F0FA 4ME5A 2F3VA 4NKLA 5C3WA 2SNSA 5J39A 5I9PA 4RKLA 5C5LA 2F0JA 4DF7A 4K5XA 3U9OA 4F8MA 4KJOA 4EQOA 5K5PA 2F3WA 5KRUA 4KY5A 5CV7A 3SK8A 3BDLA 5CGKA 2F0MA 5IGFA 2EYJA 2NUCA 4QB4A 2F0WA 4IUNA 3RUZA 3T16A 1STYA 3D4DA 4PMBA 5KEEA 2PZWA 4HMIA 4K2KA 2EY5A 2F0OA 2SNMA 4KD3A 5CR3A 2EYPA 3P1HA 2EY6A 2PZUA 2WACA 5CV4A 5M9OA 5IODA 3R3OA 4IZ8A 5C3XA 1KDCA 4K5VA 3MVVA 1F2ZA 2LKVA 1A2TA 5CV6A 1EY9A 5EKKA 2F0DA 4K14A 5C5MA 4J6HA 5JAVA 4K2LA 3E5SA 4NDXA 3BDCA 4NMZA 1EYAA 1SYFA 1SYCA 2KHSA 5J22A 1A3TA 3QB3A 5KYIA 5IGBA 5EKLA 3TMEA 1A3UA 2RDFA 4KTAA 4B9XA 2F0LA 5IGCA 3D4WA 4YIJA 1JOOA 3TP5A 3TP8A 1EYDA 2F0PA 1IHZA 4WORA 5HURA 1SYDA 3H6MA 4DFAA 3MEHA 4KY6A 3SK6A 5IIFA 2F0UA 2PW5A 2RKSA 1EY7A 3DHQA 3HEJA 4K5WA 4KJNA 2F0IA 1SNDA 2HQEA 4B9WA 2EYFA 4QMGA 5I9OA 3QOJA 4HMJA 5E3FA 1JORA 1TQOA 3OMGA 3OMCA 3NQTA 3D6CA 4G57A 4HTHA 4KV6A 1SNQA 1KAAA 5KIXA 3TP7A 5KYLA 4ID6A 5F2DA 5C4ZA 3P75A 1SYBA 2ENBA 3MZ5A 5I6YA 4KHVA 4K8JA 4K6DA 4EQPA 1EQVA 3MHBA 4QF4A 3SK4A 1EY8A 2F0EA 2SOBA 3EROA 5CV9A 4J1MA 4H7BA 1ENAA 1AEXA 3EVQA 1KABA 5DEHA 3SK5A 3C1FA 2EYMA 3D8GA 1F2YA 2F0VA 5IOCA 3QOLA 3NP8A 4PMCA 1TR5A 3MXPA 2QDBA 2F0KA 4F7XA 2PQEA 3NHHA 4PNYA 3ITPA 5IGEA 4DU9A 4IALA 1EY4A 5HGTA 4EQNA 2EY1A 5C6AA 3DMUA 4ODGA 1STGA 2F0SA 3C1EA 4KY7A 5CV5A 2O4XA 4DGZA 1F2MA 3NUCA 3HZXA 1A2UA 3SR1A 5IGDA 3SHLA 2F0TA 2OF1A 4MIUA 5JOBA 3TP6A 4ZUIA 4KD4A 4EVOA 5DAUA 5ISRA 2F0GA 1EY5A 1SNOA 1SYGA 2RBMA 3LX0A 3PMFA 5E1FA 3VA5A 2EYHA 1EY6A 2EYOA 4N9TA 3NXWA 1EY0A 3OWFA 4K8IA 1A3VA 4E6IA 2PW7A 3OSOA 1STAA 1JOKA
chains in the Genus database with same CATH superfamily
4A3DB 5T1IA 3RLOA 1VQPA 2LY7A 4JC0A 2EJMA 2UU9L 3T1YQ 2CCZA 1LT4D 1HQRD 1LT3D 2EYLA 4QUCA 4ZUJA 4FF2A 1TWHH 1K3RA 2BE5D 4KMUC 3TQYA 1S4ZA 4LF9Q 3K59A 1ESFA 5LMNL 1SAPA 4XT1B 1CQFA 1SMXA 2AQ2B 3EA6A 3RN5A 1C48A 4ILWA 4DAVA 2KCCA 2YV5A 3HOWB 3I4NB 5KNDA 1NAPA 2CH4A 2IJ0A 1QOHA 4A3FH 1VQ6A 3I4NG 3AEVA 1SSOA 3SEBA 4NB3A 3Q6SA 4FF4A 5CV4A 4LF4Q 4K5VA 2CHBD 4LK1C 3DM3A 2Z8LA 1QILA 5BR8Q 4KKSA 1N32L 5LL6X 3D4RA 3K5OA 1E1TA 2K05A 1A3UA 1OXUA 4IFDH 3PIP3 1GJXA 4B9XA 1VQBA 4A3JB 2I0QA 4DV5Q 3K0XA 3CCQA 3BYTB 3I4MB 1MBYA 4HSVA 1GVPA 1SEBD 4KY6A 1MGSA 4GLAC 2XTIA 4XYOA 1GUGA 1K3BC 4YWKA 1PH4A 1E22A 1XNQL 4QF4A 3HKSA 4JI3L 2KA7A 4BBSB 1PTOD 4BBSG 3NWTA 5LMUL 4O42A 3UDFA 4FVMA 3MXPA 4A3IG 3J7A5 4X3TA 1HA5A 5FO9B 1YBYA 3RD4A 1QNUA 2JN4A 3DLLA 2F3IA 3F8TA 1JT8A 2NZ1D 2K52A 3I4LA 3HOXH 1UE1A 2KJXA 3PO2H 2PNHA 4JI2Q 2ALYB 1XYIA 2KEEA 1DONA 3P7JA 3T53B 4RHRA 2D62A 3QB3A 1PLFA 3UDXA 1VQCA 3VR4A 4X64L 4LFBQ 1D5ZC 1CM9A 3KDFA 4HJ9A 2RHSB 3OPOA 4P74A 1EZ8A 2Q8RE 4JCVE 3M4PA 2D9UA 3I8ZA 3IFDA 4I7ZC 1LYLA 1YVCA 1WTHA 1SFOB 5EGTA 4OO1H 1FD7D 1K0RA 3CCEA 3RNUA 4H44C 4JW0A 4GNXA 4BBRH 3FP9A 1G91A 1WYDA 4NKLA 3KFUA 2PO4A 2B2VA 1VQ5A 1KXLA 4FDBA 1EFWA 3CC7A 3IKJA 2VXWA 4BA2I 4GOPA 1TWGB 3LWUA 2F0WA 4IUNA 3VDYA 2HHHQ 3SVMA 1XPUA 3RR5A 1H9JA 1Y1WB 4A75A 2PZUA 3E9IA 3HKZE 1PXUA 1C4QA 2D2CC 4JI6L 1BUVT 1IW7D 1TWFB 4PZ6A 2K03A 4B3RL 1ILPA 3BZKA 5C44H 3MTSA 1HTLD 2WB1G 1IYJB 3LWEA 3KDFB 1AFPA 4C2MB 3EBEA 2HUGA 1TS2A 3NELA 5EJWA 1EYDA 1S3OA 4JI1L 1AN8A 3MEFA 5T1GA 1E2VA 4DV3L 1PH6A 1V9PA 3RN2A 3A8KE 5LHY1 3UE0A 1PH5A 3GTLH 2JP1A 5AJ3L 1YI2A 2O2LD 2Z4IA 1VQNA 1WD1A 2F0EA 1PYWD 1N33L 1DOKA 2R7ZH 2J0TD 4H7BA 1PH7A 1MKHA 3HGBA 3MAQA 4LW1A 3U9SA 4BY7H 3A5ZB 3UDGA 4JV5Q 1TWCB 3BZCA 4GOPB 3NHHA 1PHJA 1LT6D 2MO1A 2I5LX 3VYUA 1Y8PB 1B9MA 1STGA 3PUWA 5JJKA 2WAQB 2K5QA 1YJ9A 3SHLA 1S5FD 2L0CA 3CQZH 1QVFA 3FKIB 4BXXG 1EQTA 5M3FH 1EFID 1EY6A 2EYOA 1TXYA 2DNCA 2UXBL 3NXWA 2OQKA 5NUCA 4GS3A 2BDNA 2K5WA 1PYSB 4CDDC 1QG7A 2EOTA 2Q2IA 3PCOB 2B63G 1EU3A 4IUVA 1NSNS 4UHVA 1WTWA 2VUMH 1NR4A 3T13A 2I07B 2A69C 5IE8A 3J80c 4JI0Q 3I56A 1W2BA 3R93A 4ZLTF 4LAAA 4DV4Q 1II3A 1MIUA 2K5DA 3I72A 2EPBA 4DR7L 2IPKD 1EQQA 2A5HA 2F0JA 4DF7A 4G4KA 1ICWA 1I5FA 3TN2A 1YNJD 1S5ED 2PCFB 3BYYB 3KLRA 5CV7A 2HIXA 1SN8A 1E3PA 1STEA 1X3FA 2RDHA 3BDLA 2UU9Q 1WOCA 5JJIA 3RZDB 1IKMA 4KK7A 5CMDA 2JA5H 5IP7G 3KYHC 3MVVA 1ET9A 1I4GA 2I5MX 5FK9C 3CKIB 4LWCA 5C5MA 2QDLA 2FXQA 4F88A 3K7AB 3M4OH 2B2VC 5LMNQ 5GQOA 4Q0FA 3DWQA 4KLKA 4DR5Q 3BVZA 3BDOA 2RDFA 3C46A 1VQDA 1SJED 2KCNA 4MN3A 1EWIA 2BH2A 3UE1A 4Y7NB 1YEZA 4K5WA 1W6JA 1SNDA 1TU2B 3NSWA 4G57A 3ULJA 2Z6BA 1SNQA 3S1QH 4M1UB 1DXMA 4XTCS 2XGTA 4HAEA 2K04A 4P75A 2ATWA 1VQOA 3LNNA 3PF5A 1SJHD 1XMOQ 4R8IA 3WWVA 3PO3G 2B2TC 2H1EA 4A3MH 1H9RA 3OWEB 4C3HH 2E2JH 3PUVA 2WKDA 1JWMD 4A3GH 1H9SA 2IHEA 2K75A 2Q8TA 3JC66 1VQHA 5ELBA 1KLUD 3OTOL 1BBWA 3S2HB 2M9VA 4WFN3 4DUYL 5K36H 4JBMA 2FMCA 4NXNL 4WJ4A 3OW7A 3A74A 4IUQA 3PIPA 4A93B 2PZTA 3LGJA 1EZ6A 4DR6Q 4R8NA 3T1YL 4MTNA 3F2UA 1XJVA 1GD7A 1SMYC 4CKEA 5I6WA 2ZM6Q 4ULLA 4P71A 2A1AA 1B9NA 4LF9L 1S5CD 3AB9A 2DGYA 4S3SA 4TRDA 2F0NA 4C3JB 5IWAQ 3J7YW 3K8AA 2CW0D 3GV6A 2K50A 3I4OA 3CCJA 5EKIA 4FXGC 4F8MA 2DJGC 2NVXH 4Q5VA 1YITA 3S1NB 1G6PA 3NPPA 4X6AH 1GUWA 3M4YA 5M5YB 2E75C 4HMIA 2JA6H 1F2LA 1E0BA 1X9NA 3TS0A 4BY1B 3W2DA 1BBUA 1A2TA 3NWSA 1PFNA 5BN5A 5JAVA 1BQQT 3N6RA 4GN4B 4BBRB 4QUFA 2DUDA 1SYCA 3M9BA 1PTOB 1A3TA 4XYQA 3FEWX 1U4RA 4DV5L 1JOOA 1WCMB 1B50A 1DCZA 1BNZA 4QMGA 1X55A 3QOJA 4HMJA 5E3FA 3F1ZA 3NENA 1I4HA 2R7DA 4OWWB 1R9TH 1BCPC 4CKCA 3L3OC 2NVTH 1PH3A 3MZ5A 4UPAA 1FGBD 3RZOB 2L5TA 3TREA 2PQAA 4K0KQ 4V190 3WOFA 3D8GA 1C9OA 1XTDA 3CRLC 4KKTA 1LTGD 4JOIA 2F0KA 3OIPA 5C44B 3O13A 3QO2A 4XDXA 1HZBA 1MJEA 1EY4A 4JI1Q 1BXTA 3NBHA 5LMNW 3HOYG 1UE6A 1PRTB 4B08A 4F87A 1VQ8A 2TSSA 5C3EG 4FO2A 4NXMQ 4DV1L 3CC4A 1QWYA 5JOBA 1I3QB 3S2DH 4JI2L 1G291 2XVSA 1AH9A 1K9MC 2RDGA 4A4IA 5ELCA 4IJLA 5GAEC 3DM1A 5FLMG 2YU9H 1CA5A 4UY8C 3S9WA 4EX5A 1Q12A 3SXHA 3Q23A 3MWYW 4O2DA 4DV0L 1JICA 1MHWC 2M00A 4BY7B 2Y0SE 1TVXA 1K83B 1EIHA 1GO3E 2ZTCA 1UE5A 1B44D 1IL8A 1GHJA 1IZ6A 1O7ZA 3L2PA 1HZCA 1CT1D 1X3EA 2CKZB 4KKUA 4IPHA 2K1BA 3K0YA 4OL7A 3V05A 3VR2A 4JI4Q 3CPFA 1H9KA 2ZTDA 1G51A 1MI2A 4CDCC 1L0YB 1ENFA 1L1OC 1F9PA 3U9OA 2WINB 1GOZA 2GA4B 1ZYRC 1KTKA 3CXCA 1F9QA 3NBHB 2EE1A 1GM5A 1ASYA 1EIGA 1TS3A 4DAPA 4CKBA 3D6WA 5H1SE 2ZTEA 4XQNA 4IZ8A 1WD0A 1VMCA 2AMCB 4K2LA 4RCNA 2A8VA 3J7AV 2Z6KC 1MJCA 1O7LA 1SYFA 1EOVA 1VQJA 4RH6A 1WTVA 4YWMA 1GHKA 5KYIA 2ASBA 1NJIC 4DR7Q 3MXNB 1D5XC 2JA8H 5GAHC 5CBEE 4LUOA 4R4TA 4ME3A 1NTGA 3NTIA 4TVAB 3SK6A 2HQEA 2K4KA 3UI2A 4DPGA 1NBWA 1N9WA 3CMEA 1TQOA 2GN5A 2PNRC 5KYLA 3ND8A 4FXDA 5F2DA 1HR0Q 1EQVA 4RFBA 1M1KC 3GTQB 4FYDA 5CGKA 4DR2L 5IOCA 2PMZB 3NBIA 2CWPA 5GADC 4DAYA 3M4OB 4P73A 1TKWB 4DK6C 2N55A 2NTSA 3E0JA 3NTKA 1PH2A 1D7QA 1YNXA 2EY1A 2ICIA 2KENA 1SXTA 3GTOH 1VQIA 2DY7A 1YHQA 1A2UA 1IYVA 4BA1I 1JC7A 1ET6A 1VQEA 2K5NA 3PV0A 1B2TA 1ESRA 3GP7A 3A0JA 2KHIA 4JOIC 3S1QB 1A3VA 3GTPH 5EPKA 1RDPD 3W1BA 5DM73 2OXPA 3TEHB 2G9HD 2KHJA 3EN2A 3KF8A 1UEAB 3HOVB 4RKBA 3STBD 3HOVG 1BDOA 1VS0A 3IFTA 2A6HD 2X6LA 3SE0A 4G7HC 1JB7A 5CV8A 2A74C 3GQBA 3QG1A 1YIJA 1LACA 4DR1Q 2B63H 1MSGA 4DV4L 1DD2A 2HQLA 4DR3L 1QJOA 4DAYB 4DUYQ 4H13C 5GAGC 4NXNQ 5I9PA 3HFZB 3H0GH 4EQOA 4PZ8A 4A3DG 4IPCA 3H94A 3SK8A 4XQQA 2EYJA 4CJ2C 1ZEQX 5C4JH 1RL2A 1VDZA 2EYPA 5IYCG 1CZWA 2JK8A 2DJFC 2JA7H 4ZYSA 2L4NA 2KCTA 3DEOA 2CVRA 5FOBB 1LUZA 1I6VC 1XXGA 4WJWA 4DR5L 5EKLA 1YJNA 1ICFB 1V1QA 3KK7A 1O80A 3KF8B 3HOWG 1IHZA 2WV6D 5M3MH 4DFAA 2EQSA 2F0UA 2NVXB 3DHQA 1PTOF 5K5PA 5I9OA 1VQGA 1RIPA 5IT9L 4AQYQ 3HOUH 1ZKOA 3E6ZX 3TP7A 5M5WB 1KAWA 4ID6A 4JVZA 1A63A 4CBVA 5KGUA 1WTPA 2IW3A 4K8JA 4AH6A 3EROA 4IUPA 1UUPA 2WB1E 2VZAA 1XMOL 3AFQA 3QOLA 4YCVA 4A3CH 1F9SA 4PMCA 1HTPA 1TY2A 3KJPA 5IT9E 5IGEA 5C0XI 3KBGA 1IYUA 1QCBD 4A3LH 4A3JG 4CDFC 4A3KB 1YHAA 3H3VI 1HZAA 2IL8A 4A3KG 3I4MG 4AIMA 4A3BB 2R61A 5A35A 4A3BG 4Z9CB 4IFDJ 2F0GA 4OIKA 1SYGA 1TY0A 3PMFA 2N3SA 3A54A 3QR8A 2E2DC 3OWFA 4K8IA 1R9TB 1O7YA 2A68D 4DA2A 1K8OA 2FFKB 4DR6L 2E2IH 1BF4A 2LFNA 3PQIA 3Q8DA 4C3IB 3C2PA 3OW2A 3KF6A 2ZM6L 1HR0W 4C3IG 4JI8Q 2WAQE 1EL0A 3A56A 3E3XA 3CCRA 2EZVA 4DV1Q 5IGGA 5IWAL 2OQ0A 3S1RH 3C3LA 4QIWE 1JCKB 2L9HA 3CCVA 5KRUA 4KY5A 2E2HH 1W6KA 2YU9B 1BBXC 1J9OA 5IGFA 4DV0Q 1Y1VH 4OWXB 1STYA 1EIYB 1VQLA 5KEEA 2PI2E 1I4RA 2MJ8A 1PRTD 3ICEA 2OTLA 5IODA 4XT3B 3I73A 1E2ZA 3S17B 3FPPA 4DV6L 1LTTD 3E5SA 2NZOA 4HN7A 4X65Q 4B3SQ 3D3RA 3K5NA 5I2XA 2C5CA 1B1ZA 3MFGA 3D4WA 3TP8A 3KF6B 5A2QL 5IP9G 3MEHA 1Z6HA 3GTGB 2MGSA 4B3TQ 3KLSX 1Y1WG 1B3QA 1SYBA 1HA6A 3SK4A 4K0KL 2UUCQ 5TSSA 5FO7B 3MFYA 5A2QE 4CJ1B 3GTJH 2K7VA 4R4OA 1TR5A 5FJ8G 3AU7A 4JBJA 2B8GA 3GTKH 1FNUA 1M90C 5EPLA 1NE3A 4IN3A 4RMFA 2JA8B 2AHOB 5C0XG 2O5JC 2B2TA 1CKMA 2MPMA 3J81i 4JI5Q 1E24A 4NXML 2SEBD 3FMCA 4KHZA 4C56C 3FPUB 3TP6A 4GNXB 1M4VA 2EYHA 1X3PA 3VYRA 3URYA 2XIWA 2R92H 1V8QA 3HOYH 4DR2Q 3J80i 1XPOA 5C3EH 3EFXD 4RA8A 1Z47A 3HG9A 1SNPA 3S15H 1SNCA 1NR2A 1WJJA 5JEAG 2XWBB 1B7YB 1WTRA 1Q1EA 4IFDI 5JJLA 4DK0A 5FLMH 2B2WC 3D31A 4MHEA 4N8X1 2WAQG 3ZJYC 2IX1A 3GTOB 4TKOB 3U4ZA 2F1MA 4JI4L 1FGUA 1OXSC 1OTCA 3FKIG 5I2YA 3T51B 1A15A 3OHXC 2B3GA 2SNSA 3CW2C 3GV3A 4RCOA 4YCWA 5C5LA 1DOLA 4UP7A 1X6OA 3VA7A 4DV7Q 3TZDA 4QB4A 3M85A 1GUTA 4K2KA 3MA2B 1HQMC 1FJGQ 1SE3A 2UXCL 2NVQH 1HCZA 2AQ3B 4G7ZC 2K5HA 4IPDA 1EWHA 2LXJA 1DZ1A 4GZYC 2R6GA 4DR3Q 2MUYA 4RGMA 1CSPA 1P8LA 2N78A 1F77A 3CAMA 1B4OA 2F0PA 2K5VA 2NN6H 1GXDC 1K8GA 2BDOA 3S14H 2JA9A 4RGOS 2F0IA 4M8AA 1LTBD 1C8CA 1XWEA 5I6YA 1HR0L 1Q90A 1RODA 1HXYD 1TWHB 4K6DA 4RWSC 1ONLA 3EVQA 4DXFA 4OX9Q 3SK5A 2Q2UA 1F2YA 2QCPX 4KN7C 2JA7B 1JJCB 2QDBA 1UAPA 2FJ2A 3OYYA 1VF7A 3KLSA 1J8IA 3CD6A 2YTXA 5EPJA 3HKZB 2F0SA 1F2MA 1PH9A 5M3MB 1PA6A 1QZHA 3J7AF 4A3FB 4KD4A 3E9HA 3DUZA 2ZT9C 4A3FG 2RBMA 1Q86C 3G71A 1A62A 3HOUB 4RGNA 2EJGC 1PH1A 5JPNC 3OIQA 1CA6A 4OIJA 2R93H 2JSOA 1STNA 4C1NK 2B2YC 4IFDG 3K7UC 1GUSA 4DAMA 4DR1L 5L37A 2KCMA 3HOZH 1BCPB 1WFQA 2JEAI 2F0FA 5KNBA 5ELDA 5C4XH 4A3EH 2B39A 4A76A 4P72A 4RKLA 1LO5D 2P5ZX 4X3UA 1AZQA 2F3WA 3X3NA 1DM0B 2FINB 1FVIA 1LLRD 3S16H 1WTXA 4A93G 4OHJA 1L1OA 5DLQE 1PYBA 1JWUD 1S5BD 2X69A 2VY3A 2R7FA 2D0PA 3R3OA 2BH8A 1RF2D 5CV6A 3K5MA 1M8AA 3BDCA 3ND9A 3SGIA 1Q7YC 4QCLA 3HOXB 2GVBA 4C3JG 2FMMA 3PO2B 3CC2A 2OTJA 1NCVA 3PO2G 2L1BA 5IYCH 3S1RB 2Z6KA 2F0LA 1DJRD 2AWNA 5DNFA 1YNNC 2PW5A 4QL5A 2A6ED 3TZUA 4B9WA 1H9SB 3A55A 4AQYL 4L5SA 1A0IA 4HTHA 2K01A 4YY3L 3Q0AA 2PPBC 5EBDA 1HPCA 3SDZA 4BY1G 3FHWA 4EQPA 1YHBA 3VYSA 2B29A 4GKKQ 5CV9A 4DV6Q 3KOJA 2RHQB 3BJUA 1SE4A 3C1FA 3I4NH 4OO1G 2R3ZA 4BBRG 4BWGB 2ZJPA 2HCIA 3I2ZA 3BS1A 1L1OB 3ITPA 2A6HC 4DNIA 4X3SA 4KY7A 1WCMG 2O4XA 3DEPA 5IYDG 3V96A 1K73C 2QGQA 3VR5A 4RG1A 1QVGA 5IT9c 1EY0A 4MZ9A 2RVLA 3GTJB 1XMQQ 2BE5C 5C44G 1R4PB 5J1ZA 4JI8L 3I3CA 1PV4A 4DUZL 1AZPA 3GTKB 2F4VQ 5JJZA 3CHBD 4BBSH 1K0SA 1I50H 1NMGA 4O1NA 1HZ9A 1PZID 4A3IH 1JOQA 5ELFA 1UNSA 3T56B 1HNZQ 2I46A 1EYCA 3GD7A 5KNCA 1S40A 3GTLB 4MTKA 2BCOA 1T5EA 4K5XA 2R7ZB 5COYA 3KBXA 4KHPL 2NTTA 3VYTA 2HT1A 4YHHL 4BY7G 3S15B 3K80C 3J81L 2YTVA 2CQOA 3U50C 2VW9A 2VB3X 4NDXA 2PQAB 1HFGA 2AUJD 3JAMi 4X65L 3CQZB 4QJFA 4B3SL 3DWAA 1BR9A 2JXMB 1ASZA 3S24A 5M3FB 5IGCA 3J80L 3J81E 2JYOA 4HIOA 1SYDA 4NPSA 3X3MA 1PVOA 3BU2A 1VQFA 5D3DA 1B8AA 2EVBA 3W1GA 4B3TL 1LTLA 3OMGA 4ZRZA 2IHFA 2XRSD 1XX8A 2A68C 2VUMB 3P75A 2UXCQ 4XQJA 1PTOC 1FNVA 3MHBA 2UUCL 1PFSA 3CCSA 4FF1A 1J5EL 1EY8A 1KLGD 3J80E 1KRTA 2DN8A 3NTHA 1TWGH 1VQKA 2J7ZA 2E8GA 4LF8Q 4TQUS 1IBKQ 1FL0A 1Y1WH 5HY6A 4PNYA 4X3KA 1K28A 1VMPA 1Q8IA 2VB2X 4LUZA 1CHPD 4LMQD 1CFMA 4JI5L 3R2TA 3SR1A 3VR3A 4ABNA 3M4QA 2MFIA 5M5XH 4MNOA 2O5IC 1EY5A 4OEMB 1SNOA 4IUUA 2JA5B 5C0XH 1OXVA 1BVSA 4C1NI 3RLFA 1MSHA 3RLNA 2MQHA 2SDFA 3ERQA 1DYQA 4OWTB 3A8JE 1FR3A 4JG2A 4NP5A 4FF3A 1N36Q 1HNXL 2V4DA 2M2LA 4J15A 1SMYD 1IBLQ 3NQIA 2OEOA 1Q8KA 1HUMA 5FLXL 3S1MH 1VF5C 4LFAL 2EY2A 5JEAH 1EOTA 4ME5A 4TSSA 4DV2Q 3QJYA 4ZKBB 1B53A 1SLJA 5AFWA 1BKBA 2Q2HA 1GKHA 4DV7L 2F0MA 3RUZA 4BXXH 1IBMQ 1QNKA 2PZWA 5FLXE 1QVCA 1IW7C 5CR3A 1FJGL 2N49A 4A3MB 1G2TA 5J3BA 4X66L 1Z7TA 4DKAC 3E0EA 4C3HB 4J8QA 4K14A 2E2JB 1GUOA 4C3HG 4LF6Q 4A3GB 2QKIC 4NMZA 1EYAA 5J22A 5IGBA 4ZAIA 1T5XD 3TDQA 2KBNA 4O0AA 2J4XA 2QILA 2Y0SB 3TP5A 2ID0A 1KQSA 5HURA 2ZXRA 5K36G 2DNEA 3DXJC 2D0OA 3H6MA 3HP3A 1I4PA 1CQVA 1JQYD 2RQXA 2JJQA 5EBCA 4AYBB 2QW7A 2C9OA 3TRZA 4AYBG 1CUKA 3H09A 3ULPA 1I94L 4KHVA 4OELB 1SRUA 1BCPD 4OX9L 5ELOA 4DK3C 4CHTB 4N8FA 1AE3A 3RZDH 1C7YA 1C0AA 4JBKA 5IP7H 1LV9A 2PQEA 1IKLA 4IALA 4PG3A 2X6GA 5HGTA 4P2CB 3PIO3 3ONAB 5CV5A 4IOCA 2FHTA 4XIGS 1Y8NB 3K7AH 2NVYH 1B3AA 4MIUA 5FKAC 4EVOA 3CRKC 4LF5Q 4HCEA 2IT1A 4YY3Q 1JE4A 2LMCB 2JA6B 1V1OA 5LL6S 3W5OA 1NMFA 1R4QB 2JA6G 1STAA 2F52A 1TS5A 2MO0A 2VQFQ 4ZQ3A 4PQXA 4Y7NH 1G8ZD 1N34L 1KIXA 1D8LA 1V1PA 1U9RA 4HEDA 2GVAA 3M3YH 4G7OC 1LTRD 1EEID 1JWSD 1QB5D 4R4IA 1E7ZA 4I65A 2WKCA 4UAIA 5CC4A 2F0HA 5E4WC 1JMCA 3PO3H 2B2WA 5G3LF 2ZXPA 1NUCA 2NB0A 4GKJL 1PZJD 2B2UC 1YNJC 4H0LC 1HRJA 1PRTF 2NVTB 1TWAH 2CQAA 3I7FA 3G6JB 3CCLA 4JBWA 1PFBA 4R4CA 4LF7Q 1WVLA 3T16A 2KOLA 4PMBA 2RF4A 1ZYRD 1KNEA 5CYUA 4DUZQ 4L5QA 3S2HH 2IY5B 2E5LQ 1FYCA 2EDGA 4A93H 4J6HA 3PUZA 1EU4A 1I50B 2N8NA 4EGVA 2KHSA 2Q8IB 4A3IB 3IRBA 4JI7L 3S2DB 2BA0A 3CP0A 1V1PB 2VNUD 2ES2A 1D2BA 4YIJA 3T1HL 4IUTA 2L12A 2XNAC 5G3LD 2A19A 4KJNA 4C3JH 4KHPQ 4YHHQ 4HR7B 3H15A 4JYAQ 5KIXA 1Q81C 2QF7A 2UXDQ 2L11A 4KI0A 5IYBG 4GKKL 1CKOA 3S1NH 4J1MA 4R1JA 4ALPA 2EYMA 2ICEC 4HJ8A 1XNRQ 5M5YH 3I70A 3B6YA 1U4LA 4BY1H 4EQNA 2L15A 4ODGA 1RJTA 4QY7A 5BN4A 3AMUA 2OF1A 1W3SA 2UUBQ 1PTOH 1A8VA 4B3ML 1QE6A 1XTCD 2F4IA 1J5EQ 3J81j 3OSOA 3EIVA 1WCMH 5IYDH 3JAML 4U68A 1D1IA 1HH2P 3GTMH 1LABA 2BOSA 4GLVB 2L55A 1XMQL 1KDBA 2Z0SA 1CHQD 5I4DA 1EUJA 2DY8A 2V1CC 3RZOH 2JA8G 2AKWB 2F4VL 1VQ4A 5CBAE 4U673 2E74C 2MP1A 1HNWQ 2B2YA 2CW0C 3V2TA 3JAME 5JVG3 4LFCQ 2EIFA 1HNZL 2WB1B 2QEJC 2EXZA 1U4PA 2IWHA 5M5XB 5C3WA 5BN3A 1OO9B 1VQAA 1NY4A 1EEFD 2A6EC 3A8IE 3BVMA 1X3GA 2NUCA 1I3QH 2QEXA 2PI2A 3U4VA 4OXPA 5FO8B 2UUAQ 1SE2A 2JQOA 4QQBX 3NEMA 1HNXQ 2WACA 3I91A 1Q82C 1I6HH 2QA4A 2KUMA 1RTOA 3J7ZC 1UEBA 3I55A 4LFAQ 1Z9FA 3F2BA 1TIID 4YCUA 3S1MB 2HDMA 1CK1A 3PUXA 4KTAA 4HIKA 1K83H 3Q24A 2AQ1B 3GTPB 4DNTB 2BA1A 3EQLC 1EY7A 3NE5B 4NW2A 3OMCA 4DR4L 3NQTA 3L0OA 5C4ZA 2ENBA 4X66Q 2LS01 2K28A 4QIWB 1AEXA 4JK1C 3J81c 2F0VA 2CWAA 3K81C 4LF8L 3NP8A 2LXKA 1IBKL 2B63B 1G6ZA 3DWPA 5D65A 4F7XA 1ZXTA 5ELEA 3UDIA 1H9MA 1KC8C 4IOAA 5HGQA 1LTAD 4DN4M 3H0GB 1BO0A 1EWCA 3HZXA 2C35B 3H0GG 2F0TA 1LT5D 3ERSX 5C4JB 3TS2A 5ISRA 1U4MA 2F03A 1I94Q 5D3IB 1PZKD 2VQEQ 4N9TA 4BS9A 4OO1I 1LTID 1HHVA 1TT2A 5C4HA 1A6XA 1DOMA 2JA7G 3H3VC 2KQ3A 1IL2A 3K5LA 1K8AC 3CPWA 2YTYA 4FXKC 4GNXC 1N36L 1D1KA 2Z9HA 3F2DA 3M7NA 1SNMA 4LJZC 1IBLL 2KECA 3HKZG 3GTQH 3GDEA 5M3MG 4X62L 1QUQA 2H5XA 3BZDB 1DGSA 1GUNA 2NVYB 4L63B 4DXGA 4DV2L 3AQQA 1UWVA 3HOUG 4GOPC 2EXDA 3ER0A 4CDEC 4JPBW 1P16A 1N34Q 1SBBB 1X3QA 1YZ6A 3PIOA 3I90A 1S5DD 3D4DA 4DNRB 4HJ5A 1IBML 1V43A 2SNMA 4A3CG 2K14A 1TS4A 3TSSA 5M9OA 3M3YB 3FDTA 4A3LG 1JJ2A 1NNXA 4LF6L 1AP0A 4POGA 1X65A 3BVGA 1N32Q 3WOEA 4GKJQ 4IJHA 3MC0B 3HOVH 3PO3B 1B70B 5FLXc 5IY0A 3QIAA 2ZJQA 3L9AX 2B8FA 2A73B 1TWAB 1IXRA 1AW7A 2E2IB 2AWOA 2EYFA 1JORA 2HDLA 3CCMA 1SROA 1SE8A 1QUQB 1KAAA 4UP9A 3S17H 5EQ0A 1AE2A 4A3DH 1YJWA 3G48A 1XNQQ 1Y8OB 3TBIB 2SOBA 2IX3A 2ZJRA 4JI3Q 4WJ3M 3R2IA 3HOXG 5LMUQ 1Q3LA 4JI7Q 3CMAA 2G5DA 1S72A 4FP5D 2IX0A 4HIDA 3T1HQ 4YWLA 3FRPB 4ZK9B 3ULLA 2CH4W 3FVQA 2CFMA 2NZHA 4I7AA 2E2HB 1I4QA 2OT2A 3K6OA 1Y1VB 4ZUIA 4LF5L 4GN3B 2YYZA 1L0WA 1Y1VG 4V0BA 2OWOA 3R8BA 3VA5A 2D5DA 3HOWH 1Y69U 2E76C 3ZYYX 2PW7A 1N8RC 4PV1C 2XSCA 2VQFL 1CSQA 3NK9A 4RGTA 4RAUC 3AFPA 4H02A 4X64Q 3STBC 3PUYA 5DM63 1QZGA 2OCEA 5M5WH 4RHSA 1WI5A 4LF4L 4WRDA 2Q2TA 2NN6I 1KD1C 3G6EA 5BR8L 2PYKA 4B3MQ 1STBA 2H4OA 3T4AC 4A3JH 1HJPA 2F3VA 3N52A 5EAYA 4ZKCB 4A3KH 1KNAA 3I4MH 4XXEA 2PMZE 1VQMA 4POFA 1D5MC 4A3BH 4LF7L 1MD2D 3IAYA 3GTMB 2EY5A 4KD3A 2XWJB 2RA4A 1JE5A 1K8MA 5C3XA 1KDCA 2E5LL 4LNQA 2HCCA 4JI6Q 5JPMC 2TMPA 2NBFA 1O7IA 2LKVA 5EKKA 2A69D 2KVMA 4IURA 1F9RA 4B3RQ 4IO9A 3PGZA 1CZGA 4C3IH 3RMHA 3MXGA 3TMEA 2HD3A 4R4QA 1UE7A 5E4XA 4LUVA 2K32A 4ZCKA 1RTNA 2R92B 1SR3A 1JR0D 1HUNA 3HOYB 2R7ZG 1PH8A 2R92G 4K6LA 5C3EB 4OONA 5IIFA 3CF5A 2RKSA 4DV3Q 3VR6A 2VL6A 2RSOA 1Q46A 4JYAL 5GROA 2UXDL 2JEBI 5AJ3Q 4CJ0B 1WTQA 1BOSA 3A5UA 4HJ7A 1N33Q 1I6HB 3KJOA 1X56A 1EQRA 1KABA 1Q1BA 5DEHA 4EQ5A 1XNRL 4OGQC 4LFBL 3MXNA 1JJGA 5ELNA 1D6EC 3A7AB 1Y14B 3MXUA 4DU9A 3K57A 1SFOH 5M3FG 1U5KA 1L2FA 1SDFA 5IYBH 1KHIA 4R9WA 5C6AA 3DMUA 4DGZA 3D0FA 1O78A 3KLWA 5IGDA 4HIMA 1ML0D 4UDUC 1ILQA 2UUBL 4DR4Q 3PF4A 4AYBE 5DAUA 3IL8A 2G9DA 3CCUA 4PZ7A 2VUMG 5IP9H 1PDQA 2UXBQ 1JOKA 2NVQB 1KL9A 2F0QA 1L0XB 3HRZC 2Z4HA 3EJIA 4HCSA 1OXXK 3GTGH 3U58A 1XPRA 3AYHB 1RHPA 1SYEA 3OOCA 1STHA 2HHHL 2RCFA 4N9PA 1PFMA 2RSNA 1TWFH 2JE6I 1KDAA 3HS0C 4GLXA 2NWGA 4HSPA 4UP8A 1HNWL 1ENCA 2KEDA 4LFCL 1WTOA 1CKNA 3F2CA 3S14B 5FJ8H 2NN6G 1VCIA 4L6TB 4FNFA 1RKNA 2LSSA 4IPGA 1EIFA 4C2MH 3L7ZC 3QWNA 5E7NA 1VQ9A 3W3AA 3G7LA 5J39A 2JA5G 2EJFC 1E1OA 1LM0A 3K58A 3H3VH 4KJOA 2WFWA 2B2UA 2MNAA 1VQ7A 1PRTC 3JAMc 2UUAL 3GO5A 2F0OA 5C0XJ 3P1HA 1RD9D 2EY6A 3WDNA 4QGUA 1PMRA 2HIVA 2WP8J 1F2ZA 1EY9A 4L5RC 2F0DA 4X62Q 4PMWA 1TWCH 2VS1A 4KN4C 2XRQD 3A7LA 2NYZD 3CU7A 1JB3A 4JV5L 3PSIA 3G4SA 4WORA 2K33A 1T9HA 1H95A 1BCPF 3P20A 3BG3A 1EYGA 1HFNA 3FKIH 3HEJA 1FNWA 5JEAJ 4KV6A 2R93B 2MHVA 3D6CA 2N88A 1CKNB 1YNND 4L5TA 3Q22A 2RCNA 2R93G 4A3MG 3M7GA 4CGYB 4IQZA 2AUKA 4Y52H 1ENAA 1U0LA 2WIIB 5JVH3 4A3GG 1G2SA 1J6QA 1X32A 4L8JA 3HOZB 1LTSD 3KUPA 2I5HA 3HOZG 1CI3M 1KRSA 1X54A 2Z1CA 5CORA 5D14A 4DK1A 4HJAA 1RCVD 2ZXOA 4APVA 4A3EB 5C4XB 1OXTA 5C4XG 2Y0SG 1CTMA 4A3EG 2XN9C 3C1EA 3NUCA 3S16B 3H91A 4GN5A 4JI0L 1E2WA 2K6AA 5E1FA 2VQEL 3OTOQ 1I4XA 3LX0A 4E6IA
chains in the Genus database with same CATH topology
4A3DB 5T1IA 2LY7A 2EJMA 1LT4D 1HQRD 1LT3D 2EYLA 4QUCA 4ZUJA 4FF2A 2BE5D 4KMUC 1S4ZA 3K59A 1ESFA 1SAPA 4XT1B 1CQFA 2AQ2B 3EA6A 1C48A 4ILWA 4DAVA 2KCCA 3HOWB 3I4NB 5KNDA 1NAPA 2IJ0A 1QOHA 1SSOA 3SEBA 3Q6SA 4FF4A 5CV4A 4K5VA 2CHBD 4LK1C 2Z8LA 1QILA 4KKSA 5LL6X 3D4RA 3K5OA 2K05A 1A3UA 1OXUA 4IFDH 3PIP3 1GJXA 4B9XA 4A3JB 3BYTB 3I4MB 1MBYA 4HSVA 1SEBD 4KY6A 1MGSA 4XYOA 1GUGA 4QF4A 2KA7A 4BBSB 1PTOD 3NWTA 4O42A 4FVMA 3MXPA 4X3TA 1HA5A 5FO9B 3RD4A 1QNUA 2NZ1D 3I4LA 2KJXA 1XYIA 2KEEA 1DONA 3P7JA 3T53B 4RHRA 2D62A 3QB3A 1PLFA 3VR4A 1D5ZC 1CM9A 3OPOA 1EZ8A 2Q8RE 2D9UA 3I8ZA 3IFDA 4I7ZC 1SFOB 5EGTA 4OO1H 1FD7D 4H44C 1G91A 4NKLA 2PO4A 2B2VA 3IKJA 2VXWA 4BA2I 1TWGB 3LWUA 2F0WA 4IUNA 3SVMA 1H9JA 1Y1WB 2PZUA 1PXUA 1C4QA 2D2CC 1BUVT 1IW7D 1TWFB 2K03A 1ILPA 3MTSA 1HTLD 3LWEA 1AFPA 4C2MB 2HUGA 1TS2A 5EJWA 1EYDA 1AN8A 5T1GA 1E2VA 3A8KE 5LHY1 2JP1A 2O2LD 2Z4IA 1WD1A 2F0EA 1PYWD 1DOKA 2J0TD 4H7BA 3HGBA 3MAQA 3U9SA 1TWCB 3NHHA 1LT6D 3VYUA 1Y8PB 1B9MA 1STGA 3PUWA 2WAQB 2K5QA 3SHLA 1S5FD 2L0CA 3FKIB 1EQTA 1EFID 1EY6A 2EYOA 2DNCA 3NXWA 5NUCA 2BDNA 2K5WA 1QG7A 2EOTA 1EU3A 4IUVA 1NSNS 1WTWA 1NR4A 3T13A 2I07B 2A69C 3R93A 4ZLTF 4LAAA 1II3A 3I72A 2K5DA 2EPBA 2IPKD 2A5HA 2F0JA 4DF7A 1ICWA 4G4KA 3TN2A 1YNJD 1S5ED 2PCFB 3BYYB 3KLRA 5CV7A 3BDLA 1STEA 2RDHA 3RZDB 1IKMA 4KK7A 5CMDA 3MVVA 1ET9A 1I4GA 5FK9C 3CKIB 5C5MA 4F88A 3K7AB 2B2VC 4Q0FA 3DWQA 3BVZA 3BDOA 2RDFA 3C46A 1SJED 2KCNA 4MN3A 4Y7NB 4K5WA 1W6JA 1SNDA 1TU2B 3NSWA 4G57A 1SNQA 4M1UB 1DXMA 4XTCS 4HAEA 2K04A 3LNNA 1SJHD 4R8IA 2B2TC 2H1EA 1H9RA 3OWEB 3PUVA 2WKDA 1JWMD 1H9SA 2Q8TA 5ELBA 1KLUD 3S2HB 2M9VA 4WFN3 5K36H 2FMCA 3OW7A 4IUQA 4A93B 2PZTA 1EZ6A 4R8NA 3F2UA 1SMYC 4CKEA 5I6WA 4ULLA 1B9NA 1S5CD 3AB9A 4S3SA 4TRDA 2F0NA 4C3JB 3J7YW 2CW0D 3GV6A 5EKIA 4FXGC 4F8MA 4Q5VA 3S1NB 3NPPA 1GUWA 3M4YA 5M5YB 2E75C 4HMIA 1F2LA 1E0BA 4BY1B 3W2DA 1A2TA 3NWSA 1PFNA 5BN5A 5JAVA 1BQQT 3N6RA 4BBRB 4QUFA 1SYCA 1PTOB 1A3TA 4XYQA 3FEWX 1U4RA 1JOOA 1WCMB 1B50A 1DCZA 1BNZA 4QMGA 3QOJA 4HMJA 5E3FA 1I4HA 1BCPC 4CKCA 3L3OC 3MZ5A 1FGBD 3RZOB 2L5TA 4V190 3WOFA 3D8GA 3CRLC 4KKTA 1LTGD 2F0KA 3OIPA 5C44B 3O13A 3QO2A 4XDXA 1EY4A 1BXTA 3NBHA 1PRTB 4B08A 4F87A 2TSSA 4FO2A 1QWYA 5JOBA 1I3QB 1G291 2XVSA 2RDGA 5ELCA 3DM1A 1CA5A 3S9WA 1Q12A 3SXHA 3Q23A 3MWYW 1JICA 2M00A 4BY7B 1TVXA 1K83B 1EIHA 1B44D 1IL8A 1GHJA 1O7ZA 1CT1D 4KKUA 3V05A 4OL7A 2K1BA 3K0YA 3VR2A 1H9KA 1MI2A 1L0YB 1ENFA 1F9PA 3U9OA 2WINB 1GOZA 2GA4B 1ZYRC 1KTKA 1F9QA 2EE1A 1EIGA 1TS3A 4DAPA 4CKBA 3D6WA 4XQNA 4IZ8A 1WD0A 1VMCA 4K2LA 4RCNA 3J7AV 1O7LA 1SYFA 1WTVA 4RH6A 1GHKA 5KYIA 1D5XC 5CBEE 3NTIA 3SK6A 2HQEA 3UI2A 1TQOA 2PNRC 5KYLA 3ND8A 4FXDA 5F2DA 1EQVA 4RFBA 3GTQB 4FYDA 5CGKA 5IOCA 2PMZB 3NBIA 4DAYA 3M4OB 1TKWB 2N55A 2NTSA 3E0JA 3NTKA 2EY1A 2ICIA 1SXTA 2DY7A 1A2UA 1IYVA 4BA1I 1JC7A 1ET6A 3PV0A 1B2TA 1ESRA 3GP7A 3S1QB 1A3VA 5EPKA 1RDPD 5DM73 2OXPA 2G9HD 3KF8A 1UEAB 3HOVB 4RKBA 1BDOA 3IFTA 2A6HD 2X6LA 3SE0A 4G7HC 5CV8A 2A74C 3GQBA 3QG1A 1LACA 1MSGA 1DD2A 1QJOA 4H13C 5I9PA 4EQOA 3H94A 3SK8A 4XQQA 2EYJA 4CJ2C 1ZEQX 1VDZA 2EYPA 1CZWA 4ZYSA 2L4NA 3DEOA 2CVRA 5FOBB 1I6VC 1XXGA 4WJWA 5EKLA 3KK7A 1O80A 1IHZA 2WV6D 4DFAA 2F0UA 2NVXB 3DHQA 1PTOF 5K5PA 5I9OA 5IT9L 1ZKOA 3E6ZX 3TP7A 5M5WB 4ID6A 4CBVA 5KGUA 1WTPA 2IW3A 4K8JA 3EROA 4IUPA 1UUPA 3QOLA 1F9SA 4PMCA 1HTPA 1TY2A 5IT9E 5IGEA 5C0XI 3KBGA 1IYUA 1QCBD 4A3KB 2IL8A 4A3BB 2R61A 5A35A 4Z9CB 4IFDJ 2F0GA 4OIKA 1SYGA 1TY0A 3PMFA 3A54A 2E2DC 3OWFA 4K8IA 1R9TB 1O7YA 2A68D 4DA2A 1K8OA 2FFKB 1BF4A 2LFNA 4C3IB 3C2PA 4C3IG 1EL0A 3A56A 2EZVA 5IGGA 3C3LA 1JCKB 2L9HA 5KRUA 4KY5A 1W6KA 2YU9B 1BBXC 1J9OA 5IGFA 1STYA 5KEEA 1I4RA 2MJ8A 1PRTD 5IODA 4XT3B 3I73A 1E2ZA 3S17B 3FPPA 1LTTD 3E5SA 4HN7A 3D3RA 3K5NA 5I2XA 2C5CA 1B1ZA 3MFGA 3D4WA 3TP8A 5A2QL 3MEHA 1Z6HA 3GTGB 2MGSA 3KLSX 1SYBA 1HA6A 3SK4A 5TSSA 5FO7B 3MFYA 5A2QE 4CJ1B 2K7VA 1TR5A 3AU7A 2B8GA 1FNUA 5EPLA 4IN3A 2JA8B 5C0XG 2O5JC 2B2TA 2MPMA 2SEBD 3FMCA 4KHZA 4C56C 3FPUB 3TP6A 1M4VA 2EYHA 1X3PA 3VYRA 3URYA 2XIWA 1V8QA 3EFXD 4RA8A 1Z47A 3HG9A 1SNPA 1SNCA 1NR2A 5JEAG 2XWBB 1WTRA 1Q1EA 4IFDI 4DK0A 2B2WC 3D31A 4MHEA 2IX1A 3GTOB 4TKOB 2F1MA 1OXSC 5I2YA 3T51B 1A15A 3OHXC 2SNSA 3GV3A 4RCOA 5C5LA 1DOLA 3VA7A 3TZDA 4QB4A 3M85A 1GUTA 4K2KA 3MA2B 1HQMC 1SE3A 1HCZA 2AQ3B 4G7ZC 1EWHA 1DZ1A 4GZYC 2R6GA 2MUYA 4RGMA 1F77A 1B4OA 2F0PA 2NN6H 1GXDC 2BDOA 4RGOS 2F0IA 4M8AA 1LTBD 1C8CA 1XWEA 5I6YA 1Q90A 1RODA 1HXYD 1TWHB 4K6DA 4RWSC 1ONLA 3EVQA 4DXFA 3SK5A 1F2YA 2QCPX 4KN7C 2JA7B 2QDBA 1UAPA 2FJ2A 1VF7A 3KLSA 1J8IA 5EPJA 3HKZB 2F0SA 1F2MA 5M3MB 3J7AF 4A3FB 4KD4A 3DUZA 2ZT9C 2RBMA 3HOUB 4RGNA 2EJGC 5JPNC 3OIQA 1CA6A 4OIJA 2JSOA 1STNA 4C1NK 2B2YC 4IFDG 1GUSA 1BCPB 2JEAI 2F0FA 5KNBA 5ELDA 2B39A 4RKLA 1LO5D 4X3UA 1AZQA 2F3WA 3X3NA 1DM0B 2FINB 1LLRD 1WTXA 4OHJA 1JWUD 1S5BD 2X69A 3R3OA 1RF2D 5CV6A 3K5MA 1M8AA 3BDCA 3ND9A 4QCLA 3HOXB 4C3JG 2FMMA 3PO2B 1NCVA 2L1BA 3S1RB 2F0LA 1DJRD 2AWNA 5DNFA 1YNNC 2PW5A 2A6ED 3TZUA 4B9WA 1H9SB 3A55A 4HTHA 2K01A 3Q0AA 2PPBC 5EBDA 1HPCA 3SDZA 4EQPA 3VYSA 5CV9A 4OO1G 3C1FA 1SE4A 2R3ZA 4BWGB 2HCIA 3BS1A 3ITPA 2A6HC 4X3SA 4KY7A 2O4XA 3DEPA 3V96A 3VR5A 1EY0A 2RVLA 3GTJB 2BE5C 1R4PB 5J1ZA 3I3CA 1AZPA 3GTKB 5JJZA 3CHBD 4O1NA 1PZID 1JOQA 5ELFA 1UNSA 3T56B 2I46A 1EYCA 3GD7A 5KNCA 3GTLB 2BCOA 1T5EA 4K5XA 2R7ZB 5COYA 3KBXA 2NTTA 3VYTA 3S15B 3J81L 2VB3X 4NDXA 1HFGA 2AUJD 3CQZB 3DWAA 1BR9A 2JXMB 5M3FB 5IGCA 3J80L 3J81E 2JYOA 1SYDA 3X3MA 5D3DA 2EVBA 3OMGA 4ZRZA 2XRSD 1XX8A 2A68C 2VUMB 3P75A 4XQJA 1PTOC 1FNVA 3MHBA 4FF1A 1EY8A 1KLGD 3J80E 2DN8A 3NTHA 2J7ZA 4TQUS 4PNYA 4X3KA 1VMPA 1Q8IA 2VB2X 1CHPD 4LMQD 1CFMA 3R2TA 3SR1A 3VR3A 4ABNA 2O5IC 1EY5A 1SNOA 4IUUA 2JA5B 5C0XH 1OXVA 4C1NI 3RLFA 1MSHA 2SDFA 3ERQA 1DYQA 3A8JE 1FR3A 4NP5A 4FF3A 2V4DA 2M2LA 1SMYD 3NQIA 2OEOA 1HUMA 5FLXL 1VF5C 2EY2A 5JEAH 1EOTA 4ME5A 4TSSA 3QJYA 4ZKBB 1B53A 5AFWA 2F0MA 3RUZA 1QNKA 2PZWA 5FLXE 1IW7C 5CR3A 4A3MB 1G2TA 1Z7TA 4C3HB 4J8QA 4K14A 2E2JB 1GUOA 4C3HG 4A3GB 2QKIC 4NMZA 1EYAA 5J22A 5IGBA 4ZAIA 1T5XD 3TDQA 2J4XA 2QILA 2Y0SB 3TP5A 2ID0A 5HURA 2ZXRA 5K36G 2DNEA 3DXJC 3H6MA 3HP3A 1I4PA 1CQVA 1JQYD 2RQXA 5EBCA 4AYBB 2C9OA 3H09A 4KHVA 1BCPD 4CHTB 1LV9A 2PQEA 1IKLA 4IALA 5HGTA 2X6GA 4P2CB 3PIO3 3ONAB 5CV5A 2FHTA 4XIGS 1Y8NB 1B3AA 4MIUA 5FKAC 4EVOA 3CRKC 4HCEA 2IT1A 1JE4A 2LMCB 2JA6B 1V1OA 5LL6S 1R4QB 1STAA 1TS5A 4ZQ3A 4PQXA 1G8ZD 1V1PA 1U9RA 4HEDA 4G7OC 1LTRD 1EEID 1JWSD 1QB5D 4I65A 2WKCA 4UAIA 5CC4A 2F0HA 5E4WC 2B2WA 5G3LF 2ZXPA 1NUCA 2NB0A 1PZJD 2B2UC 1YNJC 4H0LC 1HRJA 1PRTF 2NVTB 2CQAA 3G6JB 4JBWA 1PFBA 1WVLA 3T16A 2KOLA 4PMBA 1ZYRD 1KNEA 5CYUA 1FYCA 2EDGA 4J6HA 3PUZA 1EU4A 1I50B 4EGVA 2KHSA 2Q8IB 4A3IB 3S2DB 2BA0A 1V1PB 2VNUD 1D2BA 4YIJA 4IUTA 2L12A 2XNAC 5G3LD 4KJNA 4HR7B 5KIXA 2QF7A 2L11A 4KI0A 4J1MA 2EYMA 2ICEC 3I70A 1U4LA 4EQNA 4ODGA 1RJTA 5BN4A 3AMUA 2OF1A 1PTOH 1QE6A 1XTCD 2F4IA 3OSOA 3JAML 4U68A 1D1IA 1LABA 2BOSA 2L55A 1KDBA 1CHQD 5I4DA 2DY8A 5CBAE 4U673 2E74C 2MP1A 2B2YA 2CW0C 3V2TA 3JAME 5JVG3 2WB1B 2QEJC 2EXZA 1U4PA 2IWHA 5M5XB 5C3WA 5BN3A 1OO9B 1EEFD 2A6EC 3A8IE 3BVMA 2NUCA 5FO8B 1SE2A 2WACA 3I91A 2KUMA 1RTOA 1TIID 3S1MB 2HDMA 1CK1A 3PUXA 4KTAA 3Q24A 2AQ1B 3GTPB 4DNTB 2BA1A 3EQLC 1EY7A 3NE5B 4NW2A 3OMCA 3NQTA 5C4ZA 2ENBA 2LS01 2K28A 4QIWB 1AEXA 4JK1C 2F0VA 3NP8A 2B63B 1G6ZA 3DWPA 5D65A 4F7XA 1ZXTA 5ELEA 1H9MA 1LTAD 4DN4M 3H0GB 1BO0A 1EWCA 3HZXA 2F0TA 1LT5D 5C4JB 5ISRA 1U4MA 2F03A 5D3IB 1PZKD 4N9TA 4BS9A 4OO1I 1LTID 1HHVA 1TT2A 5C4HA 1A6XA 1DOMA 3H3VC 2KQ3A 3K5LA 4FXKC 1D1KA 3M7NA 1SNMA 4LJZC 2KECA 3BZDB 1GUNA 2NVYB 4L63B 4DXGA 1SBBB 1X3QA 3I90A 1S5DD 3D4DA 4DNRB 1V43A 2SNMA 1TS4A 3TSSA 5M9OA 3M3YB 3FDTA 1AP0A 3BVGA 3WOEA 3MC0B 3PO3B 3QIAA 3L9AX 2B8FA 2A73B 1TWAB 1AW7A 2E2IB 2AWOA 2EYFA 1JORA 2HDLA 1KAAA 5EQ0A 1Y8OB 3TBIB 2SOBA 2IX3A 3R2IA 1Q3LA 4FP5D 2IX0A 3FRPB 4ZK9B 3FVQA 2E2HB 1I4QA 2OT2A 3K6OA 1Y1VB 4ZUIA 2YYZA 4V0BA 3R8BA 3VA5A 2D5DA 1Y69U 2E76C 3ZYYX 2PW7A 4PV1C 2XSCA 4RGTA 3NK9A 4RAUC 3PUYA 5DM63 4RHSA 4WRDA 2NN6I 2PYKA 1STBA 2H4OA 3T4AC 2F3VA 3N52A 4ZKCB 1KNAA 4XXEA 1D5MC 1MD2D 3IAYA 3GTMB 2EY5A 4KD3A 2XWJB 2RA4A 1K8MA 5C3XA 1KDCA 2HCCA 5JPMC 2TMPA 2NBFA 2LKVA 5EKKA 2A69D 2KVMA 4IURA 1F9RA 1CZGA 3RMHA 3MXGA 3TMEA 5E4XA 2K32A 1RTNA 2R92B 1HUNA 1JR0D 3HOYB 4K6LA 5C3EB 5IIFA 2RKSA 3VR6A 2RSOA 2JEBI 4CJ0B 1WTQA 1BOSA 1I6HB 5DEHA 1KABA 1Q1BA 4OGQC 3MXNA 1D6EC 3A7AB 3MXUA 4DU9A 3K57A 1SDFA 4R9WA 5C6AA 3DMUA 4DGZA 1O78A 5IGDA 1ML0D 4UDUC 1ILQA 5DAUA 3IL8A 2G9DA 1PDQA 1JOKA 2NVQB 2F0QA 1L0XB 3HRZC 2Z4HA 3EJIA 4HCSA 1OXXK 1RHPA 1SYEA 1STHA 3OOCA 4N9PA 1PFMA 2RSNA 2JE6I 1KDAA 3HS0C 2NWGA 4HSPA 1ENCA 2KEDA 1WTOA 3S14B 2NN6G 1VCIA 4L6TB 4FNFA 1RKNA 3L7ZC 3QWNA 3W3AA 3G7LA 5J39A 2EJFC 3K58A 4KJOA 2B2UA 1PRTC 3GO5A 2F0OA 5C0XJ 3P1HA 1RD9D 2EY6A 3WDNA 1PMRA 2WP8J 1F2ZA 1EY9A 2F0DA 4PMWA 4KN4C 2XRQD 3A7LA 2NYZD 3CU7A 1JB3A 4WORA 2K33A 1BCPF 3P20A 3BG3A 1HFNA 3HEJA 1FNWA 5JEAJ 4KV6A 2R93B 2MHVA 3D6CA 2N88A 3Q22A 1YNND 3M7GA 4CGYB 4IQZA 2AUKA 1ENAA 2WIIB 5JVH3 1G2SA 1X32A 4L8JA 3HOZB 1LTSD 3KUPA 1CI3M 2Z1CA 5CORA 5D14A 5C4XB 4DK1A 1RCVD 2ZXOA 4A3EB 1OXTA 1CTMA 2XN9C 3C1EA 3NUCA 3S16B 3H91A 1E2WA 2K6AA 5E1FA 1I4XA 3LX0A 4E6IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TT2 A;  3NK9 A;  3S9W A;  2F0Q A;  2OXP A;  4ZQ3 A;  5NUC A;  5C4H A;  2PZT A;  3ERQ A;  3SXH A;  1EZ6 A;  3EJI A;  2KQ3 A;  4R8N A;  1SNP A;  1U9R A;  1SNC A;  2M00 A;  1SYE A;  1KDB A;  1STH A;  2EYL A;  1NSN S;  1EZ8 A;  4N9P A;  4NP5 A;  4ZUJ A;  5J1Z A;  5I6W A;  4RKB A;  1STN A;  5KGU A;  3T13 A;  1SNM A;  1KDA A;  5EGT A;  4WRD A;  5CV8 A;  2OEO A;  1ENC A;  4I65 A;  3V2T A;  5CC4 A;  5IGG A;  1JOQ A;  2F0H A;  1RKN A;  4S3S A;  2F0N A;  4OL7 A;  2PYK A;  2EY2 A;  4TRD A;  4LAA A;  1EYC A;  1II3 A;  1NUC A;  1STB A;  2EXZ A;  2F0F A;  4ME5 A;  2F3V A;  4NKL A;  5C3W A;  2SNS A;  5J39 A;  5I9P A;  4RKL A;  5C5L A;  2F0J A;  4DF7 A;  4K5X A;  3U9O A;  4F8M A;  4KJO A;  4EQO A;  5K5P A;  2F3W A;  5KRU A;  4KY5 A;  5CV7 A;  3SK8 A;  3BDL A;  5CGK A;  2F0M A;  5IGF A;  2EYJ A;  2NUC A;  4QB4 A;  2F0W A;  4IUN A;  3RUZ A;  3T16 A;  1STY A;  3D4D A;  4PMB A;  5KEE A;  2PZW A;  4HMI A;  4K2K A;  2EY5 A;  2F0O A;  2SNM A;  4KD3 A;  5CR3 A;  2EYP A;  3P1H A;  2EY6 A;  2PZU A;  2WAC A;  5CV4 A;  5M9O A;  5IOD A;  3R3O A;  4IZ8 A;  5C3X A;  1KDC A;  4K5V A;  3MVV A;  1F2Z A;  2LKV A;  1A2T A;  5CV6 A;  1EY9 A;  5EKK A;  2F0D A;  4K14 A;  5C5M A;  4J6H A;  5JAV A;  4K2L A;  3E5S A;  4NDX A;  3BDC A;  4NMZ A;  1EYA A;  1SYF A;  1SYC A;  2KHS A;  5J22 A;  1A3T A;  3QB3 A;  5KYI A;  5IGB A;  5EKL A;  3TME A;  1A3U A;  2RDF A;  4KTA A;  4B9X A;  2F0L A;  5IGC A;  3D4W A;  4YIJ A;  1JOO A;  3TP5 A;  3TP8 A;  1EYD A;  2F0P A;  1IHZ A;  4WOR A;  5HUR A;  1SYD A;  3H6M A;  4DFA A;  3MEH A;  4KY6 A;  3SK6 A;  5IIF A;  2F0U A;  2PW5 A;  2RKS A;  1EY7 A;  3DHQ A;  3HEJ A;  4K5W A;  4KJN A;  2F0I A;  1SND A;  2HQE A;  4B9W A;  2EYF A;  4QMG A;  5I9O A;  3QOJ A;  4HMJ A;  5E3F A;  1JOR A;  1TQO A;  3OMG A;  3OMC A;  3NQT A;  3D6C A;  4G57 A;  4HTH A;  4KV6 A;  1SNQ A;  1KAA A;  5KIX A;  3TP7 A;  5KYL A;  4ID6 A;  5F2D A;  5C4Z A;  3P75 A;  1SYB A;  2ENB A;  3MZ5 A;  5I6Y A;  4KHV A;  4K8J A;  4K6D A;  4EQP A;  1EQV A;  3MHB A;  4QF4 A;  3SK4 A;  1EY8 A;  2F0E A;  2SOB A;  3ERO A;  5CV9 A;  4J1M A;  4H7B A;  1ENA A;  1AEX A;  3EVQ A;  1KAB A;  5DEH A;  3SK5 A;  3C1F A;  2EYM A;  3D8G A;  1F2Y A;  2F0V A;  5IOC A;  3QOL A;  3NP8 A;  4PMC A;  1TR5 A;  3MXP A;  2QDB A;  2F0K A;  4F7X A;  2PQE A;  3NHH A;  4PNY A;  3ITP A;  5IGE A;  4DU9 A;  4IAL A;  1EY4 A;  5HGT A;  4EQN A;  2EY1 A;  5C6A A;  3DMU A;  4ODG A;  1STG A;  2F0S A;  3C1E A;  4KY7 A;  5CV5 A;  2O4X A;  4DGZ A;  1F2M A;  3NUC A;  3HZX A;  1A2U A;  3SR1 A;  5IGD A;  3SHL A;  2F0T A;  2OF1 A;  4MIU A;  5JOB A;  3TP6 A;  4ZUI A;  4KD4 A;  4EVO A;  5DAU A;  5ISR A;  2F0G A;  1EY5 A;  1SNO A;  1SYG A;  2RBM A;  3LX0 A;  3PMF A;  5E1F A;  3VA5 A;  2EYH A;  1EY6 A;  2EYO A;  4N9T A;  3NXW A;  1EY0 A;  3OWF A;  4K8I A;  1A3V A;  4E6I A;  2PW7 A;  3OSO A;  1STA A;  1JOK A; 
#chains in the Genus database with same CATH topology
 4A3D B;  5T1I A;  3RLO A;  1VQP A;  2LY7 A;  4JC0 A;  2EJM A;  2UU9 L;  3T1Y Q;  2CCZ A;  1LT4 D;  1HQR D;  1LT3 D;  2EYL A;  4QUC A;  4ZUJ A;  4FF2 A;  1TWH H;  1K3R A;  2BE5 D;  4KMU C;  3TQY A;  1S4Z A;  4LF9 Q;  3K59 A;  1ESF A;  5LMN L;  1SAP A;  4XT1 B;  1CQF A;  1SMX A;  2AQ2 B;  3EA6 A;  3RN5 A;  1C48 A;  4ILW A;  4DAV A;  2KCC A;  2YV5 A;  3HOW B;  3I4N B;  5KND A;  1NAP A;  2CH4 A;  2IJ0 A;  1QOH A;  4A3F H;  1VQ6 A;  3I4N G;  3AEV A;  1SSO A;  3SEB A;  4NB3 A;  3Q6S A;  4FF4 A;  5CV4 A;  4LF4 Q;  4K5V A;  2CHB D;  4LK1 C;  3DM3 A;  2Z8L A;  1QIL A;  5BR8 Q;  4KKS A;  1N32 L;  5LL6 X;  3D4R A;  3K5O A;  1E1T A;  2K05 A;  1A3U A;  1OXU A;  4IFD H;  3PIP 3;  1GJX A;  4B9X A;  1VQB A;  4A3J B;  2I0Q A;  4DV5 Q;  3K0X A;  3CCQ A;  3BYT B;  3I4M B;  1MBY A;  4HSV A;  1GVP A;  1SEB D;  4KY6 A;  1MGS A;  4GLA C;  2XTI A;  4XYO A;  1GUG A;  1K3B C;  4YWK A;  1PH4 A;  1E22 A;  1XNQ L;  4QF4 A;  3HKS A;  4JI3 L;  2KA7 A;  4BBS B;  1PTO D;  4BBS G;  3NWT A;  5LMU L;  4O42 A;  3UDF A;  4FVM A;  3MXP A;  4A3I G;  3J7A 5;  4X3T A;  1HA5 A;  5FO9 B;  1YBY A;  3RD4 A;  1QNU A;  2JN4 A;  3DLL A;  2F3I A;  3F8T A;  1JT8 A;  2NZ1 D;  2K52 A;  3I4L A;  3HOX H;  1UE1 A;  2KJX A;  3PO2 H;  2PNH A;  4JI2 Q;  2ALY B;  1XYI A;  2KEE A;  1DON A;  3P7J A;  3T53 B;  4RHR A;  2D62 A;  3QB3 A;  1PLF A;  3UDX A;  1VQC A;  3VR4 A;  4X64 L;  4LFB Q;  1D5Z C;  1CM9 A;  3KDF A;  4HJ9 A;  2RHS B;  3OPO A;  4P74 A;  1EZ8 A;  2Q8R E;  4JCV E;  3M4P A;  2D9U A;  3I8Z A;  3IFD A;  4I7Z C;  1LYL A;  1YVC A;  1WTH A;  1SFO B;  5EGT A;  4OO1 H;  1FD7 D;  1K0R A;  3CCE A;  3RNU A;  4H44 C;  4JW0 A;  4GNX A;  4BBR H;  3FP9 A;  1G91 A;  1WYD A;  4NKL A;  3KFU A;  2PO4 A;  2B2V A;  1VQ5 A;  1KXL A;  4FDB A;  1EFW A;  3CC7 A;  3IKJ A;  2VXW A;  4BA2 I;  4GOP A;  1TWG B;  3LWU A;  2F0W A;  4IUN A;  3VDY A;  2HHH Q;  3SVM A;  1XPU A;  3RR5 A;  1H9J A;  1Y1W B;  4A75 A;  2PZU A;  3E9I A;  3HKZ E;  1PXU A;  1C4Q A;  2D2C C;  4JI6 L;  1BUV T;  1IW7 D;  1TWF B;  4PZ6 A;  2K03 A;  4B3R L;  1ILP A;  3BZK A;  5C44 H;  3MTS A;  1HTL D;  2WB1 G;  1IYJ B;  3LWE A;  3KDF B;  1AFP A;  4C2M B;  3EBE A;  2HUG A;  1TS2 A;  3NEL A;  5EJW A;  1EYD A;  1S3O A;  4JI1 L;  1AN8 A;  3MEF A;  5T1G A;  1E2V A;  4DV3 L;  1PH6 A;  1V9P A;  3RN2 A;  3A8K E;  5LHY 1;  3UE0 A;  1PH5 A;  3GTL H;  2JP1 A;  5AJ3 L;  1YI2 A;  2O2L D;  2Z4I A;  1VQN A;  1WD1 A;  2F0E A;  1PYW D;  1N33 L;  1DOK A;  2R7Z H;  2J0T D;  4H7B A;  1PH7 A;  1MKH A;  3HGB A;  3MAQ A;  4LW1 A;  3U9S A;  4BY7 H;  3A5Z B;  3UDG A;  4JV5 Q;  1TWC B;  3BZC A;  4GOP B;  3NHH A;  1PHJ A;  1LT6 D;  2MO1 A;  2I5L X;  3VYU A;  1Y8P B;  1B9M A;  1STG A;  3PUW A;  5JJK A;  2WAQ B;  2K5Q A;  1YJ9 A;  3SHL A;  1S5F D;  2L0C A;  3CQZ H;  1QVF A;  3FKI B;  4BXX G;  1EQT A;  5M3F H;  1EFI D;  1EY6 A;  2EYO A;  1TXY A;  2DNC A;  2UXB L;  3NXW A;  2OQK A;  5NUC A;  4GS3 A;  2BDN A;  2K5W A;  1PYS B;  4CDD C;  1QG7 A;  2EOT A;  2Q2I A;  3PCO B;  2B63 G;  1EU3 A;  4IUV A;  1NSN S;  4UHV A;  1WTW A;  2VUM H;  1NR4 A;  3T13 A;  2I07 B;  2A69 C;  5IE8 A;  3J80 c;  4JI0 Q;  3I56 A;  1W2B A;  3R93 A;  4ZLT F;  4LAA A;  4DV4 Q;  1II3 A;  1MIU A;  2K5D A;  3I72 A;  2EPB A;  4DR7 L;  2IPK D;  1EQQ A;  2A5H A;  2F0J A;  4DF7 A;  4G4K A;  1ICW A;  1I5F A;  3TN2 A;  1YNJ D;  1S5E D;  2PCF B;  3BYY B;  3KLR A;  5CV7 A;  2HIX A;  1SN8 A;  1E3P A;  1STE A;  1X3F A;  2RDH A;  3BDL A;  2UU9 Q;  1WOC A;  5JJI A;  3RZD B;  1IKM A;  4KK7 A;  5CMD A;  2JA5 H;  5IP7 G;  3KYH C;  3MVV A;  1ET9 A;  1I4G A;  2I5M X;  5FK9 C;  3CKI B;  4LWC A;  5C5M A;  2QDL A;  2FXQ A;  4F88 A;  3K7A B;  3M4O H;  2B2V C;  5LMN Q;  5GQO A;  4Q0F A;  3DWQ A;  4KLK A;  4DR5 Q;  3BVZ A;  3BDO A;  2RDF A;  3C46 A;  1VQD A;  1SJE D;  2KCN A;  4MN3 A;  1EWI A;  2BH2 A;  3UE1 A;  4Y7N B;  1YEZ A;  4K5W A;  1W6J A;  1SND A;  1TU2 B;  3NSW A;  4G57 A;  3ULJ A;  2Z6B A;  1SNQ A;  3S1Q H;  4M1U B;  1DXM A;  4XTC S;  2XGT A;  4HAE A;  2K04 A;  4P75 A;  2ATW A;  1VQO A;  3LNN A;  3PF5 A;  1SJH D;  1XMO Q;  4R8I A;  3WWV A;  3PO3 G;  2B2T C;  2H1E A;  4A3M H;  1H9R A;  3OWE B;  4C3H H;  2E2J H;  3PUV A;  2WKD A;  1JWM D;  4A3G H;  1H9S A;  2IHE A;  2K75 A;  2Q8T A;  3JC6 6;  1VQH A;  5ELB A;  1KLU D;  3OTO L;  1BBW A;  3S2H B;  2M9V A;  4WFN 3;  4DUY L;  5K36 H;  4JBM A;  2FMC A;  4NXN L;  4WJ4 A;  3OW7 A;  3A74 A;  4IUQ A;  3PIP A;  4A93 B;  2PZT A;  3LGJ A;  1EZ6 A;  4DR6 Q;  4R8N A;  3T1Y L;  4MTN A;  3F2U A;  1XJV A;  1GD7 A;  1SMY C;  4CKE A;  5I6W A;  2ZM6 Q;  4ULL A;  4P71 A;  2A1A A;  1B9N A;  4LF9 L;  1S5C D;  3AB9 A;  2DGY A;  4S3S A;  4TRD A;  2F0N A;  4C3J B;  5IWA Q;  3J7Y W;  3K8A A;  2CW0 D;  3GV6 A;  2K50 A;  3I4O A;  3CCJ A;  5EKI A;  4FXG C;  4F8M A;  2DJG C;  2NVX H;  4Q5V A;  1YIT A;  3S1N B;  1G6P A;  3NPP A;  4X6A H;  1GUW A;  3M4Y A;  5M5Y B;  2E75 C;  4HMI A;  2JA6 H;  1F2L A;  1E0B A;  1X9N A;  3TS0 A;  4BY1 B;  3W2D A;  1BBU A;  1A2T A;  3NWS A;  1PFN A;  5BN5 A;  5JAV A;  1BQQ T;  3N6R A;  4GN4 B;  4BBR B;  4QUF A;  2DUD A;  1SYC A;  3M9B A;  1PTO B;  1A3T A;  4XYQ A;  3FEW X;  1U4R A;  4DV5 L;  1JOO A;  1WCM B;  1B50 A;  1DCZ A;  1BNZ A;  4QMG A;  1X55 A;  3QOJ A;  4HMJ A;  5E3F A;  3F1Z A;  3NEN A;  1I4H A;  2R7D A;  4OWW B;  1R9T H;  1BCP C;  4CKC A;  3L3O C;  2NVT H;  1PH3 A;  3MZ5 A;  4UPA A;  1FGB D;  3RZO B;  2L5T A;  3TRE A;  2PQA A;  4K0K Q;  4V19 0;  3WOF A;  3D8G A;  1C9O A;  1XTD A;  3CRL C;  4KKT A;  1LTG D;  4JOI A;  2F0K A;  3OIP A;  5C44 B;  3O13 A;  3QO2 A;  4XDX A;  1HZB A;  1MJE A;  1EY4 A;  4JI1 Q;  1BXT A;  3NBH A;  5LMN W;  3HOY G;  1UE6 A;  1PRT B;  4B08 A;  4F87 A;  1VQ8 A;  2TSS A;  5C3E G;  4FO2 A;  4NXM Q;  4DV1 L;  3CC4 A;  1QWY A;  5JOB A;  1I3Q B;  3S2D H;  4JI2 L;  1G29 1;  2XVS A;  1AH9 A;  1K9M C;  2RDG A;  4A4I A;  5ELC A;  4IJL A;  5GAE C;  3DM1 A;  5FLM G;  2YU9 H;  1CA5 A;  4UY8 C;  3S9W A;  4EX5 A;  1Q12 A;  3SXH A;  3Q23 A;  3MWY W;  4O2D A;  4DV0 L;  1JIC A;  1MHW C;  2M00 A;  4BY7 B;  2Y0S E;  1TVX A;  1K83 B;  1EIH A;  1GO3 E;  2ZTC A;  1UE5 A;  1B44 D;  1IL8 A;  1GHJ A;  1IZ6 A;  1O7Z A;  3L2P A;  1HZC A;  1CT1 D;  1X3E A;  2CKZ B;  4KKU A;  4IPH A;  2K1B A;  3K0Y A;  4OL7 A;  3V05 A;  3VR2 A;  4JI4 Q;  3CPF A;  1H9K A;  2ZTD A;  1G51 A;  1MI2 A;  4CDC C;  1L0Y B;  1ENF A;  1L1O C;  1F9P A;  3U9O A;  2WIN B;  1GOZ A;  2GA4 B;  1ZYR C;  1KTK A;  3CXC A;  1F9Q A;  3NBH B;  2EE1 A;  1GM5 A;  1ASY A;  1EIG A;  1TS3 A;  4DAP A;  4CKB A;  3D6W A;  5H1S E;  2ZTE A;  4XQN A;  4IZ8 A;  1WD0 A;  1VMC A;  2AMC B;  4K2L A;  4RCN A;  2A8V A;  3J7A V;  2Z6K C;  1MJC A;  1O7L A;  1SYF A;  1EOV A;  1VQJ A;  4RH6 A;  1WTV A;  4YWM A;  1GHK A;  5KYI A;  2ASB A;  1NJI C;  4DR7 Q;  3MXN B;  1D5X C;  2JA8 H;  5GAH C;  5CBE E;  4LUO A;  4R4T A;  4ME3 A;  1NTG A;  3NTI A;  4TVA B;  3SK6 A;  2HQE A;  2K4K A;  3UI2 A;  4DPG A;  1NBW A;  1N9W A;  3CME A;  1TQO A;  2GN5 A;  2PNR C;  5KYL A;  3ND8 A;  4FXD A;  5F2D A;  1HR0 Q;  1EQV A;  4RFB A;  1M1K C;  3GTQ B;  4FYD A;  5CGK A;  4DR2 L;  5IOC A;  2PMZ B;  3NBI A;  2CWP A;  5GAD C;  4DAY A;  3M4O B;  4P73 A;  1TKW B;  4DK6 C;  2N55 A;  2NTS A;  3E0J A;  3NTK A;  1PH2 A;  1D7Q A;  1YNX A;  2EY1 A;  2ICI A;  2KEN A;  1SXT A;  3GTO H;  1VQI A;  2DY7 A;  1YHQ A;  1A2U A;  1IYV A;  4BA1 I;  1JC7 A;  1ET6 A;  1VQE A;  2K5N A;  3PV0 A;  1B2T A;  1ESR A;  3GP7 A;  3A0J A;  2KHI A;  4JOI C;  3S1Q B;  1A3V A;  3GTP H;  5EPK A;  1RDP D;  3W1B A;  5DM7 3;  2OXP A;  3TEH B;  2G9H D;  2KHJ A;  3EN2 A;  3KF8 A;  1UEA B;  3HOV B;  4RKB A;  3STB D;  3HOV G;  1BDO A;  1VS0 A;  3IFT A;  2A6H D;  2X6L A;  3SE0 A;  4G7H C;  1JB7 A;  5CV8 A;  2A74 C;  3GQB A;  3QG1 A;  1YIJ A;  1LAC A;  4DR1 Q;  2B63 H;  1MSG A;  4DV4 L;  1DD2 A;  2HQL A;  4DR3 L;  1QJO A;  4DAY B;  4DUY Q;  4H13 C;  5GAG C;  4NXN Q;  5I9P A;  3HFZ B;  3H0G H;  4EQO A;  4PZ8 A;  4A3D G;  4IPC A;  3H94 A;  3SK8 A;  4XQQ A;  2EYJ A;  4CJ2 C;  1ZEQ X;  5C4J H;  1RL2 A;  1VDZ A;  2EYP A;  5IYC G;  1CZW A;  2JK8 A;  2DJF C;  2JA7 H;  4ZYS A;  2L4N A;  2KCT A;  3DEO A;  2CVR A;  5FOB B;  1LUZ A;  1I6V C;  1XXG A;  4WJW A;  4DR5 L;  5EKL A;  1YJN A;  1ICF B;  1V1Q A;  3KK7 A;  1O80 A;  3KF8 B;  3HOW G;  1IHZ A;  2WV6 D;  5M3M H;  4DFA A;  2EQS A;  2F0U A;  2NVX B;  3DHQ A;  1PTO F;  5K5P A;  5I9O A;  1VQG A;  1RIP A;  5IT9 L;  4AQY Q;  3HOU H;  1ZKO A;  3E6Z X;  3TP7 A;  5M5W B;  1KAW A;  4ID6 A;  4JVZ A;  1A63 A;  4CBV A;  5KGU A;  1WTP A;  2IW3 A;  4K8J A;  4AH6 A;  3ERO A;  4IUP A;  1UUP A;  2WB1 E;  2VZA A;  1XMO L;  3AFQ A;  3QOL A;  4YCV A;  4A3C H;  1F9S A;  4PMC A;  1HTP A;  1TY2 A;  3KJP A;  5IT9 E;  5IGE A;  5C0X I;  3KBG A;  1IYU A;  1QCB D;  4A3L H;  4A3J G;  4CDF C;  4A3K B;  1YHA A;  3H3V I;  1HZA A;  2IL8 A;  4A3K G;  3I4M G;  4AIM A;  4A3B B;  2R61 A;  5A35 A;  4A3B G;  4Z9C B;  4IFD J;  2F0G A;  4OIK A;  1SYG A;  1TY0 A;  3PMF A;  2N3S A;  3A54 A;  3QR8 A;  2E2D C;  3OWF A;  4K8I A;  1R9T B;  1O7Y A;  2A68 D;  4DA2 A;  1K8O A;  2FFK B;  4DR6 L;  2E2I H;  1BF4 A;  2LFN A;  3PQI A;  3Q8D A;  4C3I B;  3C2P A;  3OW2 A;  3KF6 A;  2ZM6 L;  1HR0 W;  4C3I G;  4JI8 Q;  2WAQ E;  1EL0 A;  3A56 A;  3E3X A;  3CCR A;  2EZV A;  4DV1 Q;  5IGG A;  5IWA L;  2OQ0 A;  3S1R H;  3C3L A;  4QIW E;  1JCK B;  2L9H A;  3CCV A;  5KRU A;  4KY5 A;  2E2H H;  1W6K A;  2YU9 B;  1BBX C;  1J9O A;  5IGF A;  4DV0 Q;  1Y1V H;  4OWX B;  1STY A;  1EIY B;  1VQL A;  5KEE A;  2PI2 E;  1I4R A;  2MJ8 A;  1PRT D;  3ICE A;  2OTL A;  5IOD A;  4XT3 B;  3I73 A;  1E2Z A;  3S17 B;  3FPP A;  4DV6 L;  1LTT D;  3E5S A;  2NZO A;  4HN7 A;  4X65 Q;  4B3S Q;  3D3R A;  3K5N A;  5I2X A;  2C5C A;  1B1Z A;  3MFG A;  3D4W A;  3TP8 A;  3KF6 B;  5A2Q L;  5IP9 G;  3MEH A;  1Z6H A;  3GTG B;  2MGS A;  4B3T Q;  3KLS X;  1Y1W G;  1B3Q A;  1SYB A;  1HA6 A;  3SK4 A;  4K0K L;  2UUC Q;  5TSS A;  5FO7 B;  3MFY A;  5A2Q E;  4CJ1 B;  3GTJ H;  2K7V A;  4R4O A;  1TR5 A;  5FJ8 G;  3AU7 A;  4JBJ A;  2B8G A;  3GTK H;  1FNU A;  1M90 C;  5EPL A;  1NE3 A;  4IN3 A;  4RMF A;  2JA8 B;  2AHO B;  5C0X G;  2O5J C;  2B2T A;  1CKM A;  2MPM A;  3J81 i;  4JI5 Q;  1E24 A;  4NXM L;  2SEB D;  3FMC A;  4KHZ A;  4C56 C;  3FPU B;  3TP6 A;  4GNX B;  1M4V A;  2EYH A;  1X3P A;  3VYR A;  3URY A;  2XIW A;  2R92 H;  1V8Q A;  3HOY H;  4DR2 Q;  3J80 i;  1XPO A;  5C3E H;  3EFX D;  4RA8 A;  1Z47 A;  3HG9 A;  1SNP A;  3S15 H;  1SNC A;  1NR2 A;  1WJJ A;  5JEA G;  2XWB B;  1B7Y B;  1WTR A;  1Q1E A;  4IFD I;  5JJL A;  4DK0 A;  5FLM H;  2B2W C;  3D31 A;  4MHE A;  4N8X 1;  2WAQ G;  3ZJY C;  2IX1 A;  3GTO B;  4TKO B;  3U4Z A;  2F1M A;  4JI4 L;  1FGU A;  1OXS C;  1OTC A;  3FKI G;  5I2Y A;  3T51 B;  1A15 A;  3OHX C;  2B3G A;  2SNS A;  3CW2 C;  3GV3 A;  4RCO A;  4YCW A;  5C5L A;  1DOL A;  4UP7 A;  1X6O A;  3VA7 A;  4DV7 Q;  3TZD A;  4QB4 A;  3M85 A;  1GUT A;  4K2K A;  3MA2 B;  1HQM C;  1FJG Q;  1SE3 A;  2UXC L;  2NVQ H;  1HCZ A;  2AQ3 B;  4G7Z C;  2K5H A;  4IPD A;  1EWH A;  2LXJ A;  1DZ1 A;  4GZY C;  2R6G A;  4DR3 Q;  2MUY A;  4RGM A;  1CSP A;  1P8L A;  2N78 A;  1F77 A;  3CAM A;  1B4O A;  2F0P A;  2K5V A;  2NN6 H;  1GXD C;  1K8G A;  2BDO A;  3S14 H;  2JA9 A;  4RGO S;  2F0I A;  4M8A A;  1LTB D;  1C8C A;  1XWE A;  5I6Y A;  1HR0 L;  1Q90 A;  1ROD A;  1HXY D;  1TWH B;  4K6D A;  4RWS C;  1ONL A;  3EVQ A;  4DXF A;  4OX9 Q;  3SK5 A;  2Q2U A;  1F2Y A;  2QCP X;  4KN7 C;  2JA7 B;  1JJC B;  2QDB A;  1UAP A;  2FJ2 A;  3OYY A;  1VF7 A;  3KLS A;  1J8I A;  3CD6 A;  2YTX A;  5EPJ A;  3HKZ B;  2F0S A;  1F2M A;  1PH9 A;  5M3M B;  1PA6 A;  1QZH A;  3J7A F;  4A3F B;  4KD4 A;  3E9H A;  3DUZ A;  2ZT9 C;  4A3F G;  2RBM A;  1Q86 C;  3G71 A;  1A62 A;  3HOU B;  4RGN A;  2EJG C;  1PH1 A;  5JPN C;  3OIQ A;  1CA6 A;  4OIJ A;  2R93 H;  2JSO A;  1STN A;  4C1N K;  2B2Y C;  4IFD G;  3K7U C;  1GUS A;  4DAM A;  4DR1 L;  5L37 A;  2KCM A;  3HOZ H;  1BCP B;  1WFQ A;  2JEA I;  2F0F A;  5KNB A;  5ELD A;  5C4X H;  4A3E H;  2B39 A;  4A76 A;  4P72 A;  4RKL A;  1LO5 D;  2P5Z X;  4X3U A;  1AZQ A;  2F3W A;  3X3N A;  1DM0 B;  2FIN B;  1FVI A;  1LLR D;  3S16 H;  1WTX A;  4A93 G;  4OHJ A;  1L1O A;  5DLQ E;  1PYB A;  1JWU D;  1S5B D;  2X69 A;  2VY3 A;  2R7F A;  2D0P A;  3R3O A;  2BH8 A;  1RF2 D;  5CV6 A;  3K5M A;  1M8A A;  3BDC A;  3ND9 A;  3SGI A;  1Q7Y C;  4QCL A;  3HOX B;  2GVB A;  4C3J G;  2FMM A;  3PO2 B;  3CC2 A;  2OTJ A;  1NCV A;  3PO2 G;  2L1B A;  5IYC H;  3S1R B;  2Z6K A;  2F0L A;  1DJR D;  2AWN A;  5DNF A;  1YNN C;  2PW5 A;  4QL5 A;  2A6E D;  3TZU A;  4B9W A;  1H9S B;  3A55 A;  4AQY L;  4L5S A;  1A0I A;  4HTH A;  2K01 A;  4YY3 L;  3Q0A A;  2PPB C;  5EBD A;  1HPC A;  3SDZ A;  4BY1 G;  3FHW A;  4EQP A;  1YHB A;  3VYS A;  2B29 A;  4GKK Q;  5CV9 A;  4DV6 Q;  3KOJ A;  2RHQ B;  3BJU A;  1SE4 A;  3C1F A;  3I4N H;  4OO1 G;  2R3Z A;  4BBR G;  4BWG B;  2ZJP A;  2HCI A;  3I2Z A;  3BS1 A;  1L1O B;  3ITP A;  2A6H C;  4DNI A;  4X3S A;  4KY7 A;  1WCM G;  2O4X A;  3DEP A;  5IYD G;  3V96 A;  1K73 C;  2QGQ A;  3VR5 A;  4RG1 A;  1QVG A;  5IT9 c;  1EY0 A;  4MZ9 A;  2RVL A;  3GTJ B;  1XMQ Q;  2BE5 C;  5C44 G;  1R4P B;  5J1Z A;  4JI8 L;  3I3C A;  1PV4 A;  4DUZ L;  1AZP A;  3GTK B;  2F4V Q;  5JJZ A;  3CHB D;  4BBS H;  1K0S A;  1I50 H;  1NMG A;  4O1N A;  1HZ9 A;  1PZI D;  4A3I H;  1JOQ A;  5ELF A;  1UNS A;  3T56 B;  1HNZ Q;  2I46 A;  1EYC A;  3GD7 A;  5KNC A;  1S40 A;  3GTL B;  4MTK A;  2BCO A;  1T5E A;  4K5X A;  2R7Z B;  5COY A;  3KBX A;  4KHP L;  2NTT A;  3VYT A;  2HT1 A;  4YHH L;  4BY7 G;  3S15 B;  3K80 C;  3J81 L;  2YTV A;  2CQO A;  3U50 C;  2VW9 A;  2VB3 X;  4NDX A;  2PQA B;  1HFG A;  2AUJ D;  3JAM i;  4X65 L;  3CQZ B;  4QJF A;  4B3S L;  3DWA A;  1BR9 A;  2JXM B;  1ASZ A;  3S24 A;  5M3F B;  5IGC A;  3J80 L;  3J81 E;  2JYO A;  4HIO A;  1SYD A;  4NPS A;  3X3M A;  1PVO A;  3BU2 A;  1VQF A;  5D3D A;  1B8A A;  2EVB A;  3W1G A;  4B3T L;  1LTL A;  3OMG A;  4ZRZ A;  2IHF A;  2XRS D;  1XX8 A;  2A68 C;  2VUM B;  3P75 A;  2UXC Q;  4XQJ A;  1PTO C;  1FNV A;  3MHB A;  2UUC L;  1PFS A;  3CCS A;  4FF1 A;  1J5E L;  1EY8 A;  1KLG D;  3J80 E;  1KRT A;  2DN8 A;  3NTH A;  1TWG H;  1VQK A;  2J7Z A;  2E8G A;  4LF8 Q;  4TQU S;  1IBK Q;  1FL0 A;  1Y1W H;  5HY6 A;  4PNY A;  4X3K A;  1K28 A;  1VMP A;  1Q8I A;  2VB2 X;  4LUZ A;  1CHP D;  4LMQ D;  1CFM A;  4JI5 L;  3R2T A;  3SR1 A;  3VR3 A;  4ABN A;  3M4Q A;  2MFI A;  5M5X H;  4MNO A;  2O5I C;  1EY5 A;  4OEM B;  1SNO A;  4IUU A;  2JA5 B;  5C0X H;  1OXV A;  1BVS A;  4C1N I;  3RLF A;  1MSH A;  3RLN A;  2MQH A;  2SDF A;  3ERQ A;  1DYQ A;  4OWT B;  3A8J E;  1FR3 A;  4JG2 A;  4NP5 A;  4FF3 A;  1N36 Q;  1HNX L;  2V4D A;  2M2L A;  4J15 A;  1SMY D;  1IBL Q;  3NQI A;  2OEO A;  1Q8K A;  1HUM A;  5FLX L;  3S1M H;  1VF5 C;  4LFA L;  2EY2 A;  5JEA H;  1EOT A;  4ME5 A;  4TSS A;  4DV2 Q;  3QJY A;  4ZKB B;  1B53 A;  1SLJ A;  5AFW A;  1BKB A;  2Q2H A;  1GKH A;  4DV7 L;  2F0M A;  3RUZ A;  4BXX H;  1IBM Q;  1QNK A;  2PZW A;  5FLX E;  1QVC A;  1IW7 C;  5CR3 A;  1FJG L;  2N49 A;  4A3M B;  1G2T A;  5J3B A;  4X66 L;  1Z7T A;  4DKA C;  3E0E A;  4C3H B;  4J8Q A;  4K14 A;  2E2J B;  1GUO A;  4C3H G;  4LF6 Q;  4A3G B;  2QKI C;  4NMZ A;  1EYA A;  5J22 A;  5IGB A;  4ZAI A;  1T5X D;  3TDQ A;  2KBN A;  4O0A A;  2J4X A;  2QIL A;  2Y0S B;  3TP5 A;  2ID0 A;  1KQS A;  5HUR A;  2ZXR A;  5K36 G;  2DNE A;  3DXJ C;  2D0O A;  3H6M A;  3HP3 A;  1I4P A;  1CQV A;  1JQY D;  2RQX A;  2JJQ A;  5EBC A;  4AYB B;  2QW7 A;  2C9O A;  3TRZ A;  4AYB G;  1CUK A;  3H09 A;  3ULP A;  1I94 L;  4KHV A;  4OEL B;  1SRU A;  1BCP D;  4OX9 L;  5ELO A;  4DK3 C;  4CHT B;  4N8F A;  1AE3 A;  3RZD H;  1C7Y A;  1C0A A;  4JBK A;  5IP7 H;  1LV9 A;  2PQE A;  1IKL A;  4IAL A;  4PG3 A;  2X6G A;  5HGT A;  4P2C B;  3PIO 3;  3ONA B;  5CV5 A;  4IOC A;  2FHT A;  4XIG S;  1Y8N B;  3K7A H;  2NVY H;  1B3A A;  4MIU A;  5FKA C;  4EVO A;  3CRK C;  4LF5 Q;  4HCE A;  2IT1 A;  4YY3 Q;  1JE4 A;  2LMC B;  2JA6 B;  1V1O A;  5LL6 S;  3W5O A;  1NMF A;  1R4Q B;  2JA6 G;  1STA A;  2F52 A;  1TS5 A;  2MO0 A;  2VQF Q;  4ZQ3 A;  4PQX A;  4Y7N H;  1G8Z D;  1N34 L;  1KIX A;  1D8L A;  1V1P A;  1U9R A;  4HED A;  2GVA A;  3M3Y H;  4G7O C;  1LTR D;  1EEI D;  1JWS D;  1QB5 D;  4R4I A;  1E7Z A;  4I65 A;  2WKC A;  4UAI A;  5CC4 A;  2F0H A;  5E4W C;  1JMC A;  3PO3 H;  2B2W A;  5G3L F;  2ZXP A;  1NUC A;  2NB0 A;  4GKJ L;  1PZJ D;  2B2U C;  1YNJ C;  4H0L C;  1HRJ A;  1PRT F;  2NVT B;  1TWA H;  2CQA A;  3I7F A;  3G6J B;  3CCL A;  4JBW A;  1PFB A;  4R4C A;  4LF7 Q;  1WVL A;  3T16 A;  2KOL A;  4PMB A;  2RF4 A;  1ZYR D;  1KNE A;  5CYU A;  4DUZ Q;  4L5Q A;  3S2H H;  2IY5 B;  2E5L Q;  1FYC A;  2EDG A;  4A93 H;  4J6H A;  3PUZ A;  1EU4 A;  1I50 B;  2N8N A;  4EGV A;  2KHS A;  2Q8I B;  4A3I B;  3IRB A;  4JI7 L;  3S2D B;  2BA0 A;  3CP0 A;  1V1P B;  2VNU D;  2ES2 A;  1D2B A;  4YIJ A;  3T1H L;  4IUT A;  2L12 A;  2XNA C;  5G3L D;  2A19 A;  4KJN A;  4C3J H;  4KHP Q;  4YHH Q;  4HR7 B;  3H15 A;  4JYA Q;  5KIX A;  1Q81 C;  2QF7 A;  2UXD Q;  2L11 A;  4KI0 A;  5IYB G;  4GKK L;  1CKO A;  3S1N H;  4J1M A;  4R1J A;  4ALP A;  2EYM A;  2ICE C;  4HJ8 A;  1XNR Q;  5M5Y H;  3I70 A;  3B6Y A;  1U4L A;  4BY1 H;  4EQN A;  2L15 A;  4ODG A;  1RJT A;  4QY7 A;  5BN4 A;  3AMU A;  2OF1 A;  1W3S A;  2UUB Q;  1PTO H;  1A8V A;  4B3M L;  1QE6 A;  1XTC D;  2F4I A;  1J5E Q;  3J81 j;  3OSO A;  3EIV A;  1WCM H;  5IYD H;  3JAM L;  4U68 A;  1D1I A;  1HH2 P;  3GTM H;  1LAB A;  2BOS A;  4GLV B;  2L55 A;  1XMQ L;  1KDB A;  2Z0S A;  1CHQ D;  5I4D A;  1EUJ A;  2DY8 A;  2V1C C;  3RZO H;  2JA8 G;  2AKW B;  2F4V L;  1VQ4 A;  5CBA E;  4U67 3;  2E74 C;  2MP1 A;  1HNW Q;  2B2Y A;  2CW0 C;  3V2T A;  3JAM E;  5JVG 3;  4LFC Q;  2EIF A;  1HNZ L;  2WB1 B;  2QEJ C;  2EXZ A;  1U4P A;  2IWH A;  5M5X B;  5C3W A;  5BN3 A;  1OO9 B;  1VQA A;  1NY4 A;  1EEF D;  2A6E C;  3A8I E;  3BVM A;  1X3G A;  2NUC A;  1I3Q H;  2QEX A;  2PI2 A;  3U4V A;  4OXP A;  5FO8 B;  2UUA Q;  1SE2 A;  2JQO A;  4QQB X;  3NEM A;  1HNX Q;  2WAC A;  3I91 A;  1Q82 C;  1I6H H;  2QA4 A;  2KUM A;  1RTO A;  3J7Z C;  1UEB A;  3I55 A;  4LFA Q;  1Z9F A;  3F2B A;  1TII D;  4YCU A;  3S1M B;  2HDM A;  1CK1 A;  3PUX A;  4KTA A;  4HIK A;  1K83 H;  3Q24 A;  2AQ1 B;  3GTP B;  4DNT B;  2BA1 A;  3EQL C;  1EY7 A;  3NE5 B;  4NW2 A;  3OMC A;  4DR4 L;  3NQT A;  3L0O A;  5C4Z A;  2ENB A;  4X66 Q;  2LS0 1;  2K28 A;  4QIW B;  1AEX A;  4JK1 C;  3J81 c;  2F0V A;  2CWA A;  3K81 C;  4LF8 L;  3NP8 A;  2LXK A;  1IBK L;  2B63 B;  1G6Z A;  3DWP A;  5D65 A;  4F7X A;  1ZXT A;  5ELE A;  3UDI A;  1H9M A;  1KC8 C;  4IOA A;  5HGQ A;  1LTA D;  4DN4 M;  3H0G B;  1BO0 A;  1EWC A;  3HZX A;  2C35 B;  3H0G G;  2F0T A;  1LT5 D;  3ERS X;  5C4J B;  3TS2 A;  5ISR A;  1U4M A;  2F03 A;  1I94 Q;  5D3I B;  1PZK D;  2VQE Q;  4N9T A;  4BS9 A;  4OO1 I;  1LTI D;  1HHV A;  1TT2 A;  5C4H A;  1A6X A;  1DOM A;  2JA7 G;  3H3V C;  2KQ3 A;  1IL2 A;  3K5L A;  1K8A C;  3CPW A;  2YTY A;  4FXK C;  4GNX C;  1N36 L;  1D1K A;  2Z9H A;  3F2D A;  3M7N A;  1SNM A;  4LJZ C;  1IBL L;  2KEC A;  3HKZ G;  3GTQ H;  3GDE A;  5M3M G;  4X62 L;  1QUQ A;  2H5X A;  3BZD B;  1DGS A;  1GUN A;  2NVY B;  4L63 B;  4DXG A;  4DV2 L;  3AQQ A;  1UWV A;  3HOU G;  4GOP C;  2EXD A;  3ER0 A;  4CDE C;  4JPB W;  1P16 A;  1N34 Q;  1SBB B;  1X3Q A;  1YZ6 A;  3PIO A;  3I90 A;  1S5D D;  3D4D A;  4DNR B;  4HJ5 A;  1IBM L;  1V43 A;  2SNM A;  4A3C G;  2K14 A;  1TS4 A;  3TSS A;  5M9O A;  3M3Y B;  3FDT A;  4A3L G;  1JJ2 A;  1NNX A;  4LF6 L;  1AP0 A;  4POG A;  1X65 A;  3BVG A;  1N32 Q;  3WOE A;  4GKJ Q;  4IJH A;  3MC0 B;  3HOV H;  3PO3 B;  1B70 B;  5FLX c;  5IY0 A;  3QIA A;  2ZJQ A;  3L9A X;  2B8F A;  2A73 B;  1TWA B;  1IXR A;  1AW7 A;  2E2I B;  2AWO A;  2EYF A;  1JOR A;  2HDL A;  3CCM A;  1SRO A;  1SE8 A;  1QUQ B;  1KAA A;  4UP9 A;  3S17 H;  5EQ0 A;  1AE2 A;  4A3D H;  1YJW A;  3G48 A;  1XNQ Q;  1Y8O B;  3TBI B;  2SOB A;  2IX3 A;  2ZJR A;  4JI3 Q;  4WJ3 M;  3R2I A;  3HOX G;  5LMU Q;  1Q3L A;  4JI7 Q;  3CMA A;  2G5D A;  1S72 A;  4FP5 D;  2IX0 A;  4HID A;  3T1H Q;  4YWL A;  3FRP B;  4ZK9 B;  3ULL A;  2CH4 W;  3FVQ A;  2CFM A;  2NZH A;  4I7A A;  2E2H B;  1I4Q A;  2OT2 A;  3K6O A;  1Y1V B;  4ZUI A;  4LF5 L;  4GN3 B;  2YYZ A;  1L0W A;  1Y1V G;  4V0B A;  2OWO A;  3R8B A;  3VA5 A;  2D5D A;  3HOW H;  1Y69 U;  2E76 C;  3ZYY X;  2PW7 A;  1N8R C;  4PV1 C;  2XSC A;  2VQF L;  1CSQ A;  3NK9 A;  4RGT A;  4RAU C;  3AFP A;  4H02 A;  4X64 Q;  3STB C;  3PUY A;  5DM6 3;  1QZG A;  2OCE A;  5M5W H;  4RHS A;  1WI5 A;  4LF4 L;  4WRD A;  2Q2T A;  2NN6 I;  1KD1 C;  3G6E A;  5BR8 L;  2PYK A;  4B3M Q;  1STB A;  2H4O A;  3T4A C;  4A3J H;  1HJP A;  2F3V A;  3N52 A;  5EAY A;  4ZKC B;  4A3K H;  1KNA A;  3I4M H;  4XXE A;  2PMZ E;  1VQM A;  4POF A;  1D5M C;  4A3B H;  4LF7 L;  1MD2 D;  3IAY A;  3GTM B;  2EY5 A;  4KD3 A;  2XWJ B;  2RA4 A;  1JE5 A;  1K8M A;  5C3X A;  1KDC A;  2E5L L;  4LNQ A;  2HCC A;  4JI6 Q;  5JPM C;  2TMP A;  2NBF A;  1O7I A;  2LKV A;  5EKK A;  2A69 D;  2KVM A;  4IUR A;  1F9R A;  4B3R Q;  4IO9 A;  3PGZ A;  1CZG A;  4C3I H;  3RMH A;  3MXG A;  3TME A;  2HD3 A;  4R4Q A;  1UE7 A;  5E4X A;  4LUV A;  2K32 A;  4ZCK A;  1RTN A;  2R92 B;  1SR3 A;  1JR0 D;  1HUN A;  3HOY B;  2R7Z G;  1PH8 A;  2R92 G;  4K6L A;  5C3E B;  4OON A;  5IIF A;  3CF5 A;  2RKS A;  4DV3 Q;  3VR6 A;  2VL6 A;  2RSO A;  1Q46 A;  4JYA L;  5GRO A;  2UXD L;  2JEB I;  5AJ3 Q;  4CJ0 B;  1WTQ A;  1BOS A;  3A5U A;  4HJ7 A;  1N33 Q;  1I6H B;  3KJO A;  1X56 A;  1EQR A;  1KAB A;  1Q1B A;  5DEH A;  4EQ5 A;  1XNR L;  4OGQ C;  4LFB L;  3MXN A;  1JJG A;  5ELN A;  1D6E C;  3A7A B;  1Y14 B;  3MXU A;  4DU9 A;  3K57 A;  1SFO H;  5M3F G;  1U5K A;  1L2F A;  1SDF A;  5IYB H;  1KHI A;  4R9W A;  5C6A A;  3DMU A;  4DGZ A;  3D0F A;  1O78 A;  3KLW A;  5IGD A;  4HIM A;  1ML0 D;  4UDU C;  1ILQ A;  2UUB L;  4DR4 Q;  3PF4 A;  4AYB E;  5DAU A;  3IL8 A;  2G9D A;  3CCU A;  4PZ7 A;  2VUM G;  5IP9 H;  1PDQ A;  2UXB Q;  1JOK A;  2NVQ B;  1KL9 A;  2F0Q A;  1L0X B;  3HRZ C;  2Z4H A;  3EJI A;  4HCS A;  1OXX K;  3GTG H;  3U58 A;  1XPR A;  3AYH B;  1RHP A;  1SYE A;  3OOC A;  1STH A;  2HHH L;  2RCF A;  4N9P A;  1PFM A;  2RSN A;  1TWF H;  2JE6 I;  1KDA A;  3HS0 C;  4GLX A;  2NWG A;  4HSP A;  4UP8 A;  1HNW L;  1ENC A;  2KED A;  4LFC L;  1WTO A;  1CKN A;  3F2C A;  3S14 B;  5FJ8 H;  2NN6 G;  1VCI A;  4L6T B;  4FNF A;  1RKN A;  2LSS A;  4IPG A;  1EIF A;  4C2M H;  3L7Z C;  3QWN A;  5E7N A;  1VQ9 A;  3W3A A;  3G7L A;  5J39 A;  2JA5 G;  2EJF C;  1E1O A;  1LM0 A;  3K58 A;  3H3V H;  4KJO A;  2WFW A;  2B2U A;  2MNA A;  1VQ7 A;  1PRT C;  3JAM c;  2UUA L;  3GO5 A;  2F0O A;  5C0X J;  3P1H A;  1RD9 D;  2EY6 A;  3WDN A;  4QGU A;  1PMR A;  2HIV A;  2WP8 J;  1F2Z A;  1EY9 A;  4L5R C;  2F0D A;  4X62 Q;  4PMW A;  1TWC H;  2VS1 A;  4KN4 C;  2XRQ D;  3A7L A;  2NYZ D;  3CU7 A;  1JB3 A;  4JV5 L;  3PSI A;  3G4S A;  4WOR A;  2K33 A;  1T9H A;  1H95 A;  1BCP F;  3P20 A;  3BG3 A;  1EYG A;  1HFN A;  3FKI H;  3HEJ A;  1FNW A;  5JEA J;  4KV6 A;  2R93 B;  2MHV A;  3D6C A;  2N88 A;  1CKN B;  1YNN D;  4L5T A;  3Q22 A;  2RCN A;  2R93 G;  4A3M G;  3M7G A;  4CGY B;  4IQZ A;  2AUK A;  4Y52 H;  1ENA A;  1U0L A;  2WII B;  5JVH 3;  4A3G G;  1G2S A;  1J6Q A;  1X32 A;  4L8J A;  3HOZ B;  1LTS D;  3KUP A;  2I5H A;  3HOZ G;  1CI3 M;  1KRS A;  1X54 A;  2Z1C A;  5COR A;  5D14 A;  4DK1 A;  4HJA A;  1RCV D;  2ZXO A;  4APV A;  4A3E B;  5C4X B;  1OXT A;  5C4X G;  2Y0S G;  1CTM A;  4A3E G;  2XN9 C;  3C1E A;  3NUC A;  3S16 B;  3H91 A;  4GN5 A;  4JI0 L;  1E2W A;  2K6A A;  5E1F A;  2VQE L;  3OTO Q;  1I4X A;  3LX0 A;  4E6I A; 
#chains in the Genus database with same CATH homology
 4A3D B;  5T1I A;  2LY7 A;  2EJM A;  1LT4 D;  1HQR D;  1LT3 D;  2EYL A;  4QUC A;  4ZUJ A;  4FF2 A;  2BE5 D;  4KMU C;  1S4Z A;  3K59 A;  1ESF A;  1SAP A;  4XT1 B;  1CQF A;  2AQ2 B;  3EA6 A;  1C48 A;  4ILW A;  4DAV A;  2KCC A;  3HOW B;  3I4N B;  5KND A;  1NAP A;  2IJ0 A;  1QOH A;  1SSO A;  3SEB A;  3Q6S A;  4FF4 A;  5CV4 A;  4K5V A;  2CHB D;  4LK1 C;  2Z8L A;  1QIL A;  4KKS A;  5LL6 X;  3D4R A;  3K5O A;  2K05 A;  1A3U A;  1OXU A;  4IFD H;  3PIP 3;  1GJX A;  4B9X A;  4A3J B;  3BYT B;  3I4M B;  1MBY A;  4HSV A;  1SEB D;  4KY6 A;  1MGS A;  4XYO A;  1GUG A;  4QF4 A;  2KA7 A;  4BBS B;  1PTO D;  3NWT A;  4O42 A;  4FVM A;  3MXP A;  4X3T A;  1HA5 A;  5FO9 B;  3RD4 A;  1QNU A;  2NZ1 D;  3I4L A;  2KJX A;  1XYI A;  2KEE A;  1DON A;  3P7J A;  3T53 B;  4RHR A;  2D62 A;  3QB3 A;  1PLF A;  3VR4 A;  1D5Z C;  1CM9 A;  3OPO A;  1EZ8 A;  2Q8R E;  2D9U A;  3I8Z A;  3IFD A;  4I7Z C;  1SFO B;  5EGT A;  4OO1 H;  1FD7 D;  4H44 C;  1G91 A;  4NKL A;  2PO4 A;  2B2V A;  3IKJ A;  2VXW A;  4BA2 I;  1TWG B;  3LWU A;  2F0W A;  4IUN A;  3SVM A;  1H9J A;  1Y1W B;  2PZU A;  1PXU A;  1C4Q A;  2D2C C;  1BUV T;  1IW7 D;  1TWF B;  2K03 A;  1ILP A;  3MTS A;  1HTL D;  3LWE A;  1AFP A;  4C2M B;  2HUG A;  1TS2 A;  5EJW A;  1EYD A;  1AN8 A;  5T1G A;  1E2V A;  3A8K E;  5LHY 1;  2JP1 A;  2O2L D;  2Z4I A;  1WD1 A;  2F0E A;  1PYW D;  1DOK A;  2J0T D;  4H7B A;  3HGB A;  3MAQ A;  3U9S A;  1TWC B;  3NHH A;  1LT6 D;  3VYU A;  1Y8P B;  1B9M A;  1STG A;  3PUW A;  2WAQ B;  2K5Q A;  3SHL A;  1S5F D;  2L0C A;  3FKI B;  1EQT A;  1EFI D;  1EY6 A;  2EYO A;  2DNC A;  3NXW A;  5NUC A;  2BDN A;  2K5W A;  1QG7 A;  2EOT A;  1EU3 A;  4IUV A;  1NSN S;  1WTW A;  1NR4 A;  3T13 A;  2I07 B;  2A69 C;  3R93 A;  4ZLT F;  4LAA A;  1II3 A;  3I72 A;  2K5D A;  2EPB A;  2IPK D;  2A5H A;  2F0J A;  4DF7 A;  1ICW A;  4G4K A;  3TN2 A;  1YNJ D;  1S5E D;  2PCF B;  3BYY B;  3KLR A;  5CV7 A;  3BDL A;  1STE A;  2RDH A;  3RZD B;  1IKM A;  4KK7 A;  5CMD A;  3MVV A;  1ET9 A;  1I4G A;  5FK9 C;  3CKI B;  5C5M A;  4F88 A;  3K7A B;  2B2V C;  4Q0F A;  3DWQ A;  3BVZ A;  3BDO A;  2RDF A;  3C46 A;  1SJE D;  2KCN A;  4MN3 A;  4Y7N B;  4K5W A;  1W6J A;  1SND A;  1TU2 B;  3NSW A;  4G57 A;  1SNQ A;  4M1U B;  1DXM A;  4XTC S;  4HAE A;  2K04 A;  3LNN A;  1SJH D;  4R8I A;  2B2T C;  2H1E A;  1H9R A;  3OWE B;  3PUV A;  2WKD A;  1JWM D;  1H9S A;  2Q8T A;  5ELB A;  1KLU D;  3S2H B;  2M9V A;  4WFN 3;  5K36 H;  2FMC A;  3OW7 A;  4IUQ A;  4A93 B;  2PZT A;  1EZ6 A;  4R8N A;  3F2U A;  1SMY C;  4CKE A;  5I6W A;  4ULL A;  1B9N A;  1S5C D;  3AB9 A;  4S3S A;  4TRD A;  2F0N A;  4C3J B;  3J7Y W;  2CW0 D;  3GV6 A;  5EKI A;  4FXG C;  4F8M A;  4Q5V A;  3S1N B;  3NPP A;  1GUW A;  3M4Y A;  5M5Y B;  2E75 C;  4HMI A;  1F2L A;  1E0B A;  4BY1 B;  3W2D A;  1A2T A;  3NWS A;  1PFN A;  5BN5 A;  5JAV A;  1BQQ T;  3N6R A;  4BBR B;  4QUF A;  1SYC A;  1PTO B;  1A3T A;  4XYQ A;  3FEW X;  1U4R A;  1JOO A;  1WCM B;  1B50 A;  1DCZ A;  1BNZ A;  4QMG A;  3QOJ A;  4HMJ A;  5E3F A;  1I4H A;  1BCP C;  4CKC A;  3L3O C;  3MZ5 A;  1FGB D;  3RZO B;  2L5T A;  4V19 0;  3WOF A;  3D8G A;  3CRL C;  4KKT A;  1LTG D;  2F0K A;  3OIP A;  5C44 B;  3O13 A;  3QO2 A;  4XDX A;  1EY4 A;  1BXT A;  3NBH A;  1PRT B;  4B08 A;  4F87 A;  2TSS A;  4FO2 A;  1QWY A;  5JOB A;  1I3Q B;  1G29 1;  2XVS A;  2RDG A;  5ELC A;  3DM1 A;  1CA5 A;  3S9W A;  1Q12 A;  3SXH A;  3Q23 A;  3MWY W;  1JIC A;  2M00 A;  4BY7 B;  1TVX A;  1K83 B;  1EIH A;  1B44 D;  1IL8 A;  1GHJ A;  1O7Z A;  1CT1 D;  4KKU A;  3V05 A;  4OL7 A;  2K1B A;  3K0Y A;  3VR2 A;  1H9K A;  1MI2 A;  1L0Y B;  1ENF A;  1F9P A;  3U9O A;  2WIN B;  1GOZ A;  2GA4 B;  1ZYR C;  1KTK A;  1F9Q A;  2EE1 A;  1EIG A;  1TS3 A;  4DAP A;  4CKB A;  3D6W A;  4XQN A;  4IZ8 A;  1WD0 A;  1VMC A;  4K2L A;  4RCN A;  3J7A V;  1O7L A;  1SYF A;  1WTV A;  4RH6 A;  1GHK A;  5KYI A;  1D5X C;  5CBE E;  3NTI A;  3SK6 A;  2HQE A;  3UI2 A;  1TQO A;  2PNR C;  5KYL A;  3ND8 A;  4FXD A;  5F2D A;  1EQV A;  4RFB A;  3GTQ B;  4FYD A;  5CGK A;  5IOC A;  2PMZ B;  3NBI A;  4DAY A;  3M4O B;  1TKW B;  2N55 A;  2NTS A;  3E0J A;  3NTK A;  2EY1 A;  2ICI A;  1SXT A;  2DY7 A;  1A2U A;  1IYV A;  4BA1 I;  1JC7 A;  1ET6 A;  3PV0 A;  1B2T A;  1ESR A;  3GP7 A;  3S1Q B;  1A3V A;  5EPK A;  1RDP D;  5DM7 3;  2OXP A;  2G9H D;  3KF8 A;  1UEA B;  3HOV B;  4RKB A;  1BDO A;  3IFT A;  2A6H D;  2X6L A;  3SE0 A;  4G7H C;  5CV8 A;  2A74 C;  3GQB A;  3QG1 A;  1LAC A;  1MSG A;  1DD2 A;  1QJO A;  4H13 C;  5I9P A;  4EQO A;  3H94 A;  3SK8 A;  4XQQ A;  2EYJ A;  4CJ2 C;  1ZEQ X;  1VDZ A;  2EYP A;  1CZW A;  4ZYS A;  2L4N A;  3DEO A;  2CVR A;  5FOB B;  1I6V C;  1XXG A;  4WJW A;  5EKL A;  3KK7 A;  1O80 A;  1IHZ A;  2WV6 D;  4DFA A;  2F0U A;  2NVX B;  3DHQ A;  1PTO F;  5K5P A;  5I9O A;  5IT9 L;  1ZKO A;  3E6Z X;  3TP7 A;  5M5W B;  4ID6 A;  4CBV A;  5KGU A;  1WTP A;  2IW3 A;  4K8J A;  3ERO A;  4IUP A;  1UUP A;  3QOL A;  1F9S A;  4PMC A;  1HTP A;  1TY2 A;  5IT9 E;  5IGE A;  5C0X I;  3KBG A;  1IYU A;  1QCB D;  4A3K B;  2IL8 A;  4A3B B;  2R61 A;  5A35 A;  4Z9C B;  4IFD J;  2F0G A;  4OIK A;  1SYG A;  1TY0 A;  3PMF A;  3A54 A;  2E2D C;  3OWF A;  4K8I A;  1R9T B;  1O7Y A;  2A68 D;  4DA2 A;  1K8O A;  2FFK B;  1BF4 A;  2LFN A;  4C3I B;  3C2P A;  4C3I G;  1EL0 A;  3A56 A;  2EZV A;  5IGG A;  3C3L A;  1JCK B;  2L9H A;  5KRU A;  4KY5 A;  1W6K A;  2YU9 B;  1BBX C;  1J9O A;  5IGF A;  1STY A;  5KEE A;  1I4R A;  2MJ8 A;  1PRT D;  5IOD A;  4XT3 B;  3I73 A;  1E2Z A;  3S17 B;  3FPP A;  1LTT D;  3E5S A;  4HN7 A;  3D3R A;  3K5N A;  5I2X A;  2C5C A;  1B1Z A;  3MFG A;  3D4W A;  3TP8 A;  5A2Q L;  3MEH A;  1Z6H A;  3GTG B;  2MGS A;  3KLS X;  1SYB A;  1HA6 A;  3SK4 A;  5TSS A;  5FO7 B;  3MFY A;  5A2Q E;  4CJ1 B;  2K7V A;  1TR5 A;  3AU7 A;  2B8G A;  1FNU A;  5EPL A;  4IN3 A;  2JA8 B;  5C0X G;  2O5J C;  2B2T A;  2MPM A;  2SEB D;  3FMC A;  4KHZ A;  4C56 C;  3FPU B;  3TP6 A;  1M4V A;  2EYH A;  1X3P A;  3VYR A;  3URY A;  2XIW A;  1V8Q A;  3EFX D;  4RA8 A;  1Z47 A;  3HG9 A;  1SNP A;  1SNC A;  1NR2 A;  5JEA G;  2XWB B;  1WTR A;  1Q1E A;  4IFD I;  4DK0 A;  2B2W C;  3D31 A;  4MHE A;  2IX1 A;  3GTO B;  4TKO B;  2F1M A;  1OXS C;  5I2Y A;  3T51 B;  1A15 A;  3OHX C;  2SNS A;  3GV3 A;  4RCO A;  5C5L A;  1DOL A;  3VA7 A;  3TZD A;  4QB4 A;  3M85 A;  1GUT A;  4K2K A;  3MA2 B;  1HQM C;  1SE3 A;  1HCZ A;  2AQ3 B;  4G7Z C;  1EWH A;  1DZ1 A;  4GZY C;  2R6G A;  2MUY A;  4RGM A;  1F77 A;  1B4O A;  2F0P A;  2NN6 H;  1GXD C;  2BDO A;  4RGO S;  2F0I A;  4M8A A;  1LTB D;  1C8C A;  1XWE A;  5I6Y A;  1Q90 A;  1ROD A;  1HXY D;  1TWH B;  4K6D A;  4RWS C;  1ONL A;  3EVQ A;  4DXF A;  3SK5 A;  1F2Y A;  2QCP X;  4KN7 C;  2JA7 B;  2QDB A;  1UAP A;  2FJ2 A;  1VF7 A;  3KLS A;  1J8I A;  5EPJ A;  3HKZ B;  2F0S A;  1F2M A;  5M3M B;  3J7A F;  4A3F B;  4KD4 A;  3DUZ A;  2ZT9 C;  2RBM A;  3HOU B;  4RGN A;  2EJG C;  5JPN C;  3OIQ A;  1CA6 A;  4OIJ A;  2JSO A;  1STN A;  4C1N K;  2B2Y C;  4IFD G;  1GUS A;  1BCP B;  2JEA I;  2F0F A;  5KNB A;  5ELD A;  2B39 A;  4RKL A;  1LO5 D;  4X3U A;  1AZQ A;  2F3W A;  3X3N A;  1DM0 B;  2FIN B;  1LLR D;  1WTX A;  4OHJ A;  1JWU D;  1S5B D;  2X69 A;  3R3O A;  1RF2 D;  5CV6 A;  3K5M A;  1M8A A;  3BDC A;  3ND9 A;  4QCL A;  3HOX B;  4C3J G;  2FMM A;  3PO2 B;  1NCV A;  2L1B A;  3S1R B;  2F0L A;  1DJR D;  2AWN A;  5DNF A;  1YNN C;  2PW5 A;  2A6E D;  3TZU A;  4B9W A;  1H9S B;  3A55 A;  4HTH A;  2K01 A;  3Q0A A;  2PPB C;  5EBD A;  1HPC A;  3SDZ A;  4EQP A;  3VYS A;  5CV9 A;  4OO1 G;  3C1F A;  1SE4 A;  2R3Z A;  4BWG B;  2HCI A;  3BS1 A;  3ITP A;  2A6H C;  4X3S A;  4KY7 A;  2O4X A;  3DEP A;  3V96 A;  3VR5 A;  1EY0 A;  2RVL A;  3GTJ B;  2BE5 C;  1R4P B;  5J1Z A;  3I3C A;  1AZP A;  3GTK B;  5JJZ A;  3CHB D;  4O1N A;  1PZI D;  1JOQ A;  5ELF A;  1UNS A;  3T56 B;  2I46 A;  1EYC A;  3GD7 A;  5KNC A;  3GTL B;  2BCO A;  1T5E A;  4K5X A;  2R7Z B;  5COY A;  3KBX A;  2NTT A;  3VYT A;  3S15 B;  3J81 L;  2VB3 X;  4NDX A;  1HFG A;  2AUJ D;  3CQZ B;  3DWA A;  1BR9 A;  2JXM B;  5M3F B;  5IGC A;  3J80 L;  3J81 E;  2JYO A;  1SYD A;  3X3M A;  5D3D A;  2EVB A;  3OMG A;  4ZRZ A;  2XRS D;  1XX8 A;  2A68 C;  2VUM B;  3P75 A;  4XQJ A;  1PTO C;  1FNV A;  3MHB A;  4FF1 A;  1EY8 A;  1KLG D;  3J80 E;  2DN8 A;  3NTH A;  2J7Z A;  4TQU S;  4PNY A;  4X3K A;  1VMP A;  1Q8I A;  2VB2 X;  1CHP D;  4LMQ D;  1CFM A;  3R2T A;  3SR1 A;  3VR3 A;  4ABN A;  2O5I C;  1EY5 A;  1SNO A;  4IUU A;  2JA5 B;  5C0X H;  1OXV A;  4C1N I;  3RLF A;  1MSH A;  2SDF A;  3ERQ A;  1DYQ A;  3A8J E;  1FR3 A;  4NP5 A;  4FF3 A;  2V4D A;  2M2L A;  1SMY D;  3NQI A;  2OEO A;  1HUM A;  5FLX L;  1VF5 C;  2EY2 A;  5JEA H;  1EOT A;  4ME5 A;  4TSS A;  3QJY A;  4ZKB B;  1B53 A;  5AFW A;  2F0M A;  3RUZ A;  1QNK A;  2PZW A;  5FLX E;  1IW7 C;  5CR3 A;  4A3M B;  1G2T A;  1Z7T A;  4C3H B;  4J8Q A;  4K14 A;  2E2J B;  1GUO A;  4C3H G;  4A3G B;  2QKI C;  4NMZ A;  1EYA A;  5J22 A;  5IGB A;  4ZAI A;  1T5X D;  3TDQ A;  2J4X A;  2QIL A;  2Y0S B;  3TP5 A;  2ID0 A;  5HUR A;  2ZXR A;  5K36 G;  2DNE A;  3DXJ C;  3H6M A;  3HP3 A;  1I4P A;  1CQV A;  1JQY D;  2RQX A;  5EBC A;  4AYB B;  2C9O A;  3H09 A;  4KHV A;  1BCP D;  4CHT B;  1LV9 A;  2PQE A;  1IKL A;  4IAL A;  5HGT A;  2X6G A;  4P2C B;  3PIO 3;  3ONA B;  5CV5 A;  2FHT A;  4XIG S;  1Y8N B;  1B3A A;  4MIU A;  5FKA C;  4EVO A;  3CRK C;  4HCE A;  2IT1 A;  1JE4 A;  2LMC B;  2JA6 B;  1V1O A;  5LL6 S;  1R4Q B;  1STA A;  1TS5 A;  4ZQ3 A;  4PQX A;  1G8Z D;  1V1P A;  1U9R A;  4HED A;  4G7O C;  1LTR D;  1EEI D;  1JWS D;  1QB5 D;  4I65 A;  2WKC A;  4UAI A;  5CC4 A;  2F0H A;  5E4W C;  2B2W A;  5G3L F;  2ZXP A;  1NUC A;  2NB0 A;  1PZJ D;  2B2U C;  1YNJ C;  4H0L C;  1HRJ A;  1PRT F;  2NVT B;  2CQA A;  3G6J B;  4JBW A;  1PFB A;  1WVL A;  3T16 A;  2KOL A;  4PMB A;  1ZYR D;  1KNE A;  5CYU A;  1FYC A;  2EDG A;  4J6H A;  3PUZ A;  1EU4 A;  1I50 B;  4EGV A;  2KHS A;  2Q8I B;  4A3I B;  3S2D B;  2BA0 A;  1V1P B;  2VNU D;  1D2B A;  4YIJ A;  4IUT A;  2L12 A;  2XNA C;  5G3L D;  4KJN A;  4HR7 B;  5KIX A;  2QF7 A;  2L11 A;  4KI0 A;  4J1M A;  2EYM A;  2ICE C;  3I70 A;  1U4L A;  4EQN A;  4ODG A;  1RJT A;  5BN4 A;  3AMU A;  2OF1 A;  1PTO H;  1QE6 A;  1XTC D;  2F4I A;  3OSO A;  3JAM L;  4U68 A;  1D1I A;  1LAB A;  2BOS A;  2L55 A;  1KDB A;  1CHQ D;  5I4D A;  2DY8 A;  5CBA E;  4U67 3;  2E74 C;  2MP1 A;  2B2Y A;  2CW0 C;  3V2T A;  3JAM E;  5JVG 3;  2WB1 B;  2QEJ C;  2EXZ A;  1U4P A;  2IWH A;  5M5X B;  5C3W A;  5BN3 A;  1OO9 B;  1EEF D;  2A6E C;  3A8I E;  3BVM A;  2NUC A;  5FO8 B;  1SE2 A;  2WAC A;  3I91 A;  2KUM A;  1RTO A;  1TII D;  3S1M B;  2HDM A;  1CK1 A;  3PUX A;  4KTA A;  3Q24 A;  2AQ1 B;  3GTP B;  4DNT B;  2BA1 A;  3EQL C;  1EY7 A;  3NE5 B;  4NW2 A;  3OMC A;  3NQT A;  5C4Z A;  2ENB A;  2LS0 1;  2K28 A;  4QIW B;  1AEX A;  4JK1 C;  2F0V A;  3NP8 A;  2B63 B;  1G6Z A;  3DWP A;  5D65 A;  4F7X A;  1ZXT A;  5ELE A;  1H9M A;  1LTA D;  4DN4 M;  3H0G B;  1BO0 A;  1EWC A;  3HZX A;  2F0T A;  1LT5 D;  5C4J B;  5ISR A;  1U4M A;  2F03 A;  5D3I B;  1PZK D;  4N9T A;  4BS9 A;  4OO1 I;  1LTI D;  1HHV A;  1TT2 A;  5C4H A;  1A6X A;  1DOM A;  3H3V C;  2KQ3 A;  3K5L A;  4FXK C;  1D1K A;  3M7N A;  1SNM A;  4LJZ C;  2KEC A;  3BZD B;  1GUN A;  2NVY B;  4L63 B;  4DXG A;  1SBB B;  1X3Q A;  3I90 A;  1S5D D;  3D4D A;  4DNR B;  1V43 A;  2SNM A;  1TS4 A;  3TSS A;  5M9O A;  3M3Y B;  3FDT A;  1AP0 A;  3BVG A;  3WOE A;  3MC0 B;  3PO3 B;  3QIA A;  3L9A X;  2B8F A;  2A73 B;  1TWA B;  1AW7 A;  2E2I B;  2AWO A;  2EYF A;  1JOR A;  2HDL A;  1KAA A;  5EQ0 A;  1Y8O B;  3TBI B;  2SOB A;  2IX3 A;  3R2I A;  1Q3L A;  4FP5 D;  2IX0 A;  3FRP B;  4ZK9 B;  3FVQ A;  2E2H B;  1I4Q A;  2OT2 A;  3K6O A;  1Y1V B;  4ZUI A;  2YYZ A;  4V0B A;  3R8B A;  3VA5 A;  2D5D A;  1Y69 U;  2E76 C;  3ZYY X;  2PW7 A;  4PV1 C;  2XSC A;  4RGT A;  3NK9 A;  4RAU C;  3PUY A;  5DM6 3;  4RHS A;  4WRD A;  2NN6 I;  2PYK A;  1STB A;  2H4O A;  3T4A C;  2F3V A;  3N52 A;  4ZKC B;  1KNA A;  4XXE A;  1D5M C;  1MD2 D;  3IAY A;  3GTM B;  2EY5 A;  4KD3 A;  2XWJ B;  2RA4 A;  1K8M A;  5C3X A;  1KDC A;  2HCC A;  5JPM C;  2TMP A;  2NBF A;  2LKV A;  5EKK A;  2A69 D;  2KVM A;  4IUR A;  1F9R A;  1CZG A;  3RMH A;  3MXG A;  3TME A;  5E4X A;  2K32 A;  1RTN A;  2R92 B;  1HUN A;  1JR0 D;  3HOY B;  4K6L A;  5C3E B;  5IIF A;  2RKS A;  3VR6 A;  2RSO A;  2JEB I;  4CJ0 B;  1WTQ A;  1BOS A;  1I6H B;  5DEH A;  1KAB A;  1Q1B A;  4OGQ C;  3MXN A;  1D6E C;  3A7A B;  3MXU A;  4DU9 A;  3K57 A;  1SDF A;  4R9W A;  5C6A A;  3DMU A;  4DGZ A;  1O78 A;  5IGD A;  1ML0 D;  4UDU C;  1ILQ A;  5DAU A;  3IL8 A;  2G9D A;  1PDQ A;  1JOK A;  2NVQ B;  2F0Q A;  1L0X B;  3HRZ C;  2Z4H A;  3EJI A;  4HCS A;  1OXX K;  1RHP A;  1SYE A;  1STH A;  3OOC A;  4N9P A;  1PFM A;  2RSN A;  2JE6 I;  1KDA A;  3HS0 C;  2NWG A;  4HSP A;  1ENC A;  2KED A;  1WTO A;  3S14 B;  2NN6 G;  1VCI A;  4L6T B;  4FNF A;  1RKN A;  3L7Z C;  3QWN A;  3W3A A;  3G7L A;  5J39 A;  2EJF C;  3K58 A;  4KJO A;  2B2U A;  1PRT C;  3GO5 A;  2F0O A;  5C0X J;  3P1H A;  1RD9 D;  2EY6 A;  3WDN A;  1PMR A;  2WP8 J;  1F2Z A;  1EY9 A;  2F0D A;  4PMW A;  4KN4 C;  2XRQ D;  3A7L A;  2NYZ D;  3CU7 A;  1JB3 A;  4WOR A;  2K33 A;  1BCP F;  3P20 A;  3BG3 A;  1HFN A;  3HEJ A;  1FNW A;  5JEA J;  4KV6 A;  2R93 B;  2MHV A;  3D6C A;  2N88 A;  3Q22 A;  1YNN D;  3M7G A;  4CGY B;  4IQZ A;  2AUK A;  1ENA A;  2WII B;  5JVH 3;  1G2S A;  1X32 A;  4L8J A;  3HOZ B;  1LTS D;  3KUP A;  1CI3 M;  2Z1C A;  5COR A;  5D14 A;  5C4X B;  4DK1 A;  1RCV D;  2ZXO A;  4A3E B;  1OXT A;  1CTM A;  2XN9 C;  3C1E A;  3NUC A;  3S16 B;  3H91 A;  1E2W A;  2K6A A;  5E1F A;  1I4X A;  3LX0 A;  4E6I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...