5IGDA

Crystal structure of staphylococcal nuclease variant delta+phs t62h/i92e at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFHKKMVENAKKIEVEFDKGQRTDKYGRGLAYEYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS T62H/I92E at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5igdA00
5C4ZA 2F0VA 2KQ3A 3OSOA 4K5XA 4DF7A 3RUZA 3QB3A 4ZUJA 3PMFA 1EY9A 3P1HA 4J1MA 3ERQA 3TP6A 4K2KA 4IALA 4KD3A 4KY6A 2F3WA 3MEHA 5E1FA 4EQOA 4RKBA 4IUNA 3MXPA 4WRDA 1JOKA 2LKVA 2NUCA 4KY5A 5CGKA 1JOQA 1SNQA 2EY5A 2F0GA 1TR5A 1STYA 2F0TA 1STNA 2F0WA 2EY2A 2F3VA 1KDCA 2HQEA 2PYKA 4KJNA 5CR3A 1F2YA 5JOBA 3TP8A 3EROA 5C5MA 4EQPA 3NHHA 4K6DA 3NQTA 1STHA 3OWFA 1EY6A 2F0IA 3LX0A 3SK4A 3EVQA 5HGTA 5K5PA 5M9OA 5DAUA 2PZUA 5C3XA 4NKLA 3NP8A 3SK5A 3SR1A 1A2TA 5C3WA 1SNDA 1KAAA 3C1EA 4S3SA 5EGTA 1STGA 3TP7A 2OXPA 3D4WA 4HMIA 3MVVA 4DGZA 5IGBA 3S9WA 2F0KA 3V2TA 4B9WA 3SK8A 3OMCA 1SYEA 4KV6A 1KDAA 5KYLA 5I6WA 1TQOA 1AEXA 4F8MA 5C4HA 5CC4A 3D6CA 1SNOA 5NUCA 5ISRA 4MIUA 4PNYA 5IGCA 5F2DA 5KGUA 2EYPA 5E3FA 3TP5A 5IOCA 4HMJA 1EZ8A 4K2LA 1IHZA 4ME5A 4DFAA 4PMBA 5CV9A 1EYDA 1TT2A 1SNCA 2O4XA 5I6YA 5IGGA 4NP5A 3VA5A 2RBMA 4H7BA 5C6AA 3U9OA 2M00A 1A2UA 5CV8A 2F0FA 4HTHA 1EZ6A 2ENBA 2KHSA 1EY5A 4IZ8A 3SHLA 3DMUA 2EY6A 3EJIA 3T16A 2PW7A 5DEHA 2SNMA 3H6MA 3MZ5A 2F0LA 4LAAA 4ID6A 2WACA 1EY0A 1EY8A 4YIJA 1II3A 1STBA 4NMZA 4TRDA 4N9PA 2QDBA 5EKKA 4F7XA 4K8JA 4K8IA 1KABA 2EYOA 2F0EA 3NK9A 2RDFA 4DU9A 1F2ZA 5IGFA 1SNMA 4QB4A 5JAVA 2SNSA 2PZTA 3E5SA 1NUCA 4B9XA 2PW5A 4QF4A 5CV4A 1ENCA 1JOOA 1EY4A 1F2MA 3BDCA 3D8GA 3QOLA 2PZWA 4WORA 5KRUA 4K5WA 1U9RA 4KD4A 1STAA 4K14A 1NSNS 4K5VA 2F0PA 3SK6A 1KDBA 3OMGA 2F0MA 3ITPA 4E6IA 2F0HA 4G57A 1EYCA 2EYHA 1EQVA 1SYBA 3R3OA 4KJOA 5CV7A 4ZUIA 1ENAA 1A3VA 5HURA 3TMEA 3D4DA 4J6HA 4ZQ3A 5J39A 3P75A 2SOBA 3C1FA 4R8NA 2EY1A 3HZXA 5I9PA 1SYDA 2F0NA 5C5LA 5KYIA 4RKLA 2F0OA 5IGDA 1EY7A 1SYCA 2PQEA 5I9OA 4ODGA 2EYJA 5CV6A 4KTAA 3SXHA 5IODA 2EXZA 2F0JA 1SNPA 3HEJA 4NDXA 2F0QA 4N9TA 4QMGA 3T13A 5KEEA 5IGEA 3BDLA 5KIXA 4I65A 4KY7A 1EYAA 2RKSA 2OEOA 3NUCA 4KHVA 2EYMA 5CV5A 5J1ZA 3QOJA 4EVOA 2F0SA 1RKNA 2EYFA 4OL7A 3NXWA 1SYGA 4PMCA 2F0UA 5EKLA 4EQNA 5J22A 1SYFA 2F0DA 2OF1A 3DHQA 5IIFA 1JORA 3MHBA 1A3UA 2EYLA 1A3TA
chains in the Genus database with same CATH superfamily
5IWAL 4DR5L 4JYAQ 1WCMB 3RUZA 3M4OH 2B2WC 1N8RC 2D2CC 2EQSA 3P1HA 2RA4A 1WD1A 3BVZA 1MBYA 4RKBA 2NVTB 5CGKA 4YWLA 5FOBB 2BH8A 1F2YA 5FLXL 4L5SA 5BR8L 1ZEQX 1PLFA 1VF5C 5FO7B 4N8X1 1PVOA 4NW2A 3D31A 3NP8A 1KLUD 1JWMD 2SEBD 1B70B 3Q8DA 4ZYSA 3HOYB 2PPBC 1NMFA 2F0KA 3OWEB 3H15A 1FD7D 2R93B 2L4NA 4DAPA 2UXCL 4TQUS 3H0GH 3HOZH 4XXEA 1Y8PB 4A3GG 3PSIA 3WOEA 3RD4A 1SFOH 2ICIA 4KHPQ 3NBIA 4PMBA 4ZKCB 4L8JA 1NCVA 2Z4HA 3VA5A 3HKZB 3K5OA 3R2TA 5K36G 1KQSA 1K73C 3KLWA 3I4MB 3PUZA 2B8GA 4TRDA 1VQBA 3C2PA 5AFWA 3WWVA 2JJQA 2NVYB 3PF5A 1KL9A 5E4XA 2A69D 3E5SA 4FNFA 2PW5A 1BDOA 2L1BA 1QCBD 4GZYC 4KN7C 5C0XI 4KD4A 2R92H 4C3IB 4K5VA 2MUYA 1NR2A 3OMGA 4X3TA 4JI8Q 2M2LA 3R2IA 2IY5B 4G7HC 1BKBA 1ENAA 1VQGA 1LTGD 1ICWA 3BG3A 3CU7A 4N8FA 3K5LA 3BU2A 4ALPA 4R8NA 1N33L 3SGIA 4GOPB 3B6YA 1TWCH 3PUXA 4UP8A 2PQEA 3C46A 2JK8A 4GN3B 4N9TA 2PQAA 2K04A 3A56A 2EYMA 3URYA 4LUZA 1SYFA 4OHJA 4HJ7A 1QJOA 4GLVB 3OSOA 1D5XC 4K5XA 3KBXA 1I50B 4JI0Q 2HDLA 2ALYB 2IHEA 4DUYL 3F2UA 4HIKA 1LTLA 1K0RA 1Q82C 3VR6A 3HOYG 5C3EG 5DLQE 2ASBA 5M3FG 1RODA 2EY5A 4KJNA 1TR5A 4K5WA 1Y69U 2XRSD 5C4JH 2NTTA 4JI2Q 3UE1A 2R7ZB 2HQLA 1X56A 3I72A 1I94Q 1VQHA 4WJ4A 3VR5A 2RCFA 3CCLA 1CKNB 5IGBA 1CQFA 3A55A 2KUMA 4B9WA 1TQOA 4A93G 4OO1G 2WINB 2VB3X 3A7LA 1N36Q 1DM0B 1B8AA 4MTKA 4BY7H 4A3IH 1WTWA 1H9KA 3GDEA 3AYHB 1PDQA 3M4QA 3PV0A 4IOCA 1JMCA 2A5HA 2O5JC 1VQPA 1ZXTA 4AYBG 1X65A 2YTXA 2KBNA 3KJOA 1Q7YC 2SNMA 3MAQA 4A3BB 5G3LD 1HTPA 1B53A 4FVMA 1U4MA 5LHY1 1M1KC 4LF6L 2UXDQ 5FO8B 1QVGA 4DR4L 4C2MB 2F0EA 4IPHA 3MC0B 1DZ1A 4RAUC 3SDZA 1IBML 2D5DA 4LUOA 4DR1Q 1FJGL 2EPBA 4RFBA 1JQYD 1XTCD 4HAEA 3CD6A 2PZWA 4WORA 3R93A 3S1MH 1D1KA 2B29A 3A5UA 4HSPA 4IN3A 1BBXC 4OO1I 3Q24A 4UY8C 1DJRD 1RF2D 2AWOA 4E6IA 2VNUD 1Q8IA 3H3VC 1Z9FA 4LW1A 5LMUL 1TWHH 1SYBA 2E2HH 1VQ8A 2B2UA 4UP7A 3OW2A 1HXYD 2XIWA 4B08A 3S1QB 2O2LD 3PO2G 3FKIH 1BCPD 5KYIA 4JI3L 2E2JH 1FGBD 5EQ0A 2ZJPA 5M3MB 2H4OA 3O13A 1VQMA 3T1HQ 4O1NA 2B2VC 1I3QB 1EL0A 2WP8J 5CORA 1Q81C 1PH1A 4JK1C 1PH5A 4V0BA 1DCZA 4XT1B 5ELBA 4CBVA 1WTHA 1FGUA 4JI1L 3CXCA 4ILWA 4C56C 1HR0Q 4V190 1DXMA 3S2DB 1STYA 2F0TA 1STNA 4Z9CB 5G3LF 4A3GH 4DV2Q 1LTID 1JWUD 1H9SA 1Y1VB 2HQEA 3MXUA 1HFNA 5M5YB 1LABA 1I50H 1NAPA 3D6WA 3J7ZC 2D9UA 2NYZD 3QG1A 1STHA 3E3XA 2AWNA 4NB3A 4CJ1B 2K5VA 4XT3B 1MD2D 2VQEL 1KAAA 2TMPA 1STGA 4A3DB 1J5EL 2AQ2B 3PO3H 1CA6A 4Q5VA 2Z6BA 5C4HA 4XIGS 1BQQT 4F87A 3E6ZX 5CC4A 1IBLQ 2A74C 4PNYA 1I3QH 4R9WA 5FJ8G 3K0YA 1PMRA 1EZ8A 2IX0A 2B2VA 3H94A 1SJED 1K8MA 2EJMA 4GKKQ 1CK1A 4FXGC 5GROA 2K5NA 2PI2A 3HRZC 1XX8A 4CKEA 5EPKA 4HSVA 3UE0A 3AMUA 1YBYA 3N6RA 4F7XA 5EPJA 4DK1A 2I5HA 3MEFA 4FF4A 2IT1A 3Q23A 5IGFA 1AH9A 3HKZG 1CI3M 4HN7A 2JA9A 4FP5D 1XNRQ 1SN8A 3D8GA 4DUZQ 5C0XH 3I3CA 4FYDA 1F9RA 1HNXQ 3J81j 1NSNS 3A7AB 3FEWX 5A2QE 3CF5A 2F1MA 3E0EA 3FHWA 1TIID 4DXFA 1IKLA 4M8AA 3J7AF 1H9RA 1LT5D 4QUFA 3IKJA 3PUYA 2YTVA 1Q1BA 1HR0L 4PV1C 5I9PA 1CM9A 1MHWC 4DK0A 3NELA 2F4VL 4RG1A 3J80c 3ZJYC 3HOZB 5CV6A 4LFAQ 2JA6G 1A6XA 4OWXB 1XTDA 3G7LA 4BA2I 5KIXA 1QG7A 3MXNA 3K57A 1IW7C 3M3YB 1JORA 2RDGA 2R7ZG 1A3UA 2PMZB 4P73A 2L0CA 2L5TA 3STBD 1RDPD 2D0PA 1GKHA 4B3TQ 4PZ8A 4A3KB 1KD1C 2IHFA 3DEOA 5C0XJ 4DV3Q 1Y1WB 1XMOL 4MN3A 2ZJQA 4A3DH 4A93B 5C5MA 3NHHA 2YU9B 2BA0A 3EIVA 1EY6A 1SLJA 3EVQA 5DAUA 2K4KA 4RGOS 3HOWG 2OTJA 3GTPB 1B44D 1PTOF 1YITA 2BDNA 5D3DA 4DV5Q 3TREA 2UU9L 4GKJQ 2KOLA 2HT1A 2IX1A 2JSOA 4R4OA 1G6PA 3W2DA 1VMCA 5EKIA 5I2XA 1SXTA 1QVFA 3G4SA 4DXGA 2KENA 3JAML 2RBMA 4RH6A 3U9OA 2M00A 4JI4Q 2JA8G 2KHSA 4JV5L 1D2BA 1DYQA 4R4IA 2N78A 4IJLA 3GTPH 4AQYQ 3MZ5A 4DV4L 1F77A 1TS5A 2WACA 2VQFQ 2KEEA 1TY2A 3KDFA 2JYOA 1V1QA 4A3FH 3CQZH 3L2PA 2QGQA 1CQVA 1PH3A 2NZ1D 4IO9A 2GA4B 2VW9A 2LXJA 1BR9A 1IL2A 5J3BA 3A8IE 4X66Q 1O7YA 3NTHA 1V1OA 1HNZQ 4HR7B 3T4AC 2E76C 4LWCA 3MXGA 2BOSA 2JA8B 1EYCA 2WB1E 3CQZB 3BYTB 3S1RH 1A3VA 3P7JA 1OXTA 4OONA 1UEAB 4H44C 4ZQ3A 4NXNQ 2Q2UA 1PH6A 1L0XB 4XYQA 1WI5A 4C2MH 1N9WA 1EOVA 1X6OA 2I46A 5IP7H 1J6QA 1RJTA 2ZTCA 2ZM6Q 1PTOD 3OTOL 3ULJA 5IT9E 4C3IG 4JYAL 2HUGA 3T53B 3HKZE 1SDFA 5C4ZA 4LJZC 4KMUC 1X55A 4GOPA 4BS9A 1K83H 1AZQA 4MTNA 2Z8LA 4IALA 1I6VC 3L7ZC 4RWSC 4QJFA 4XQJA 2CH4W 1L2FA 5HGTA 5JPMC 3GTMB 3HOWH 1B2TA 1EU4A 3M3YH 4DV4Q 2NVTH 3C1EA 2VL6A 4R8IA 3J81i 3HOUG 4JI1Q 1VQLA 1WCMH 3D6CA 2VB2X 2XN9C 4JOIA 2R7FA 4MIUA 5ELFA 3S15H 4PMWA 5KGUA 3QWNA 2VUMB 4X66L 1PYSB 4FXDA 1YNJD 4H7BA 3I4OA 4LF8Q 3K59A 3HFZB 5E7NA 2P5ZX 2WAQE 4DAMA 2CQOA 4LF4L 2X69A 3CHBD 4H0LC 1PTOC 2EOTA 4AYBE 1C48A 2QF7A 2ES2A 1KABA 3VA7A 2ZXOA 1F2ZA 5JAVA 1SSOA 1R9TB 2JA6H 5CMDA 5IYDH 1VQFA 3CCRA 1YZ6A 2IPKD 2LMCB 2AUJD 4X65Q 3A0JA 3AFPA 2HHHQ 4F88A 2B2TC 2XRQD 4DV7Q 1PFNA 2A6HC 1GUSA 3M7NA 4HIOA 2B2UC 2UXBQ 1DONA 5IP7G 3G6JB 2F0NA 5IGDA 2QKIC 2Q8TA 4C3JH 3OOCA 4A3KG 2GN5A 4QY7A 3ND9A 2JEBI 2UUBL 4WJWA 4KHVA 5CV5A 3VYRA 4OL7A 2FINB 5J22A 1PXUA 3MHBA 3PUVA 5CV4A 4UDUC 3TDQA 3BZKA 1LO5D 2X6LA 3GTJH 4B3SQ 5C4XG 2AMCB 4I7ZC 3PMFA 2CWPA 4M1UB 3UDGA 3MXPA 3TS2A 1Q3LA 4JBMA 4JI7L 5JOBA 4A3IG 1EQQA 4YHHQ 2PZUA 5C4XH 1TWFB 2CKZB 1SNDA 2QCPX 2NZHA 5JJIA 2EXDA 4HMIA 4JI8L 1PH7A 1KDAA 5A35A 1I4XA 2RF4A 4LF6Q 1GUGA 3GD7A 2CW0C 4A3KH 1SE2A 2E2JB 1PTOH 2A68C 5IOCA 4X65L 1LT6D 1TXYA 5CV9A 1E2VA 2LY7A 3BVMA 4FF2A 1S5DD 1SNCA 5IGGA 5BR8Q 1NBWA 1QB5D 2BE5D 2ENBA 1EY5A 4BBRH 2Y0SE 4ZCKA 2MQHA 4OEMB 1U0LA 3LGJA 1MGSA 2B2WA 2ZXRA 5EKKA 2OQKA 3KUPA 2V4DA 2X6GA 3HOXB 1V1PA 4IURA 4JI0L 1IW7D 2RDFA 4QB4A 3G48A 4FF3A 1XNQL 1JB3A 5C4JB 1EY4A 2D62A 1E1OA 2I07B 1U9RA 2QA4A 3QO2A 3NBHB 3K58A 1LT3D 2AQ1B 5FKAC 4JVZA 2DNCA 1S3OA 1IBKL 2AKWB 4DR7Q 1UE5A 3PO2B 4FF1A 2VQFL 1ZKOA 2Q8IB 4QGUA 3S2HH 3L3OC 3C1FA 2EY1A 1SYDA 3I4LA 4ZLTF 4XQNA 4X3KA 4CDDC 4JOIC 1EY7A 1D5ZC 5D3IB 2NB0A 3VYTA 5JEAG 4LF9Q 4DK3C 2E74C 1QVCA 1LTSD 4KK7A 1JB7A 1PZID 2MFIA 2KHIA 2A73B 4TSSA 3I4MG 5EKLA 2OQ0A 2CW0D 5IIFA 1PTOB 4JI5L 5CR3A 3S1RB 3UDIA 1PFBA 3FVQA 1WTRA 3CW2C 1HZ9A 1J9OA 4L63B 2K5DA 4KY6A 3CCVA 4BWGB 3RN2A 2WFWA 4B3RL 2K5WA 1HA6A 1OXVA 1AZPA 4DNRB 1KXLA 1IBMQ 4HJAA 4A3CG 1YI2A 3NQTA 3J80i 1BOSA 1LUZA 4XDXA 1B9NA 3X3NA 3TP7A 4DGZA 4KV6A 4DAYA 1K8AC 2L15A 5ELCA 2MNAA 4WJ3M 5IP9G 1E1TA 5BN3A 4DUYQ 2DY7A 3GV3A 4CGYB 1GUTA 2B63B 3RZOB 1EU3A 3EFXD 4IPDA 5E3FA 1Q90A 4DFAA 1BBWA 3K8AA 1GXDC 2K32A 2AQ3B 3IL8A 1HNWQ 5CV8A 4HTHA 3G6EA 2K1BA 1BCPC 1PRTD 3UDFA 2CQAA 1EWHA 1CZWA 1STBA 4R4CA 4LUVA 3HOVB 1BUVT 5D65A 5FK9C 2JQOA 3M4PA 4DR2L 1YIJA 5M3FB 5CYUA 1VQOA 2C9OA 2Y0SB 1DGSA 2SNSA 1LT4D 1E0BA 2F4VQ 4QF4A 1PH2A 3H3VI 3BDCA 3QOLA 3RMHA 1X32A 2F0PA 2FJ2A 3SK6A 1IXRA 5EPLA 3BZCA 1MIUA 4DK6C 3VR3A 1CHPD 4DNTB 3M7GA 1EQRA 4ZUIA 5HURA 3TMEA 4J6HA 1EFWA 4UHVA 4HJ9A 1ESFA 2UUAL 2ZT9C 1B50A 3HZXA 1TU2B 1VQ5A 1BO0A 1GHJA 3JC66 4DV3L 3GTKH 4KTAA 2B8FA 5T1GA 1CA5A 1FJGQ 4AH6A 1HH2P 1W6KA 4OGQC 5IGEA 4I65A 1XJVA 5ELNA 4EGVA 4IJHA 2JA7G 3S24A 1SYGA 1XPRA 2RHQB 2I5MX 3I8ZA 1EEID 1H95A 3I2ZA 5M5WH 5K36H 1X9NA 1AP0A 3F2CA 2MPMA 4YY3L 4GKJL 5JJLA 1BCPF 1YEZA 2A19A 3J81E 1YVCA 3CRKC 4JBKA 5COYA 4EQOA 4A3JB 4A3DG 2LKVA 3KLRA 4CDCC 4BBSG 2KVMA 4IUUA 3KFUA 3ICEA 4PZ6A 1VQ4A 3EROA 1PH8A 4A3LG 1XNRL 5C44H 4MHEA 4DUZL 2F0IA 1TWHB 4X62Q 3T56B 4DV0L 4R4QA 1SJHD 4A3EG 1QZGA 4B3SL 2K5HA 2QEJC 1AFPA 2N3SA 3V2TA 3SK8A 4C1NI 4DV6L 3GTLH 1QUQA 4BY7G 4BY1H 5NUCA 1SRUA 2JE6I 3I73A 4YWMA 1U4LA 3GTOH 4XTCS 4OIKA 3K80C 3VYSA 1TWAH 3T1HL 1EYDA 3L9AX 2O4XA 1VCIA 2YV5A 3VR4A 2N55A 1PZJD 3CCJA 4PZ7A 4LK1C 2EY6A 1KRTA 2YTYA 2QEXA 5EBCA 1VF7A 2DY8A 2JA5H 2GVBA 3AQQA 4LF5Q 1EY8A 3G71A 4BY1G 1IYJB 3IRBA 2UUAQ 1SMXA 2Q2IA 1HRJA 4K8JA 4K8IA 4NXNL 5FO9B 3VR2A 3I4NH 2KCCA 1EIYB 3TQYA 5FLMG 1W3SA 2FXQA 4G7ZC 4GN5A 4A3GB 4IOAA 5IY0A 1B4OA 1VQ6A 4P2CB 1ENFA 1TWFH 2VZAA 1J5EQ 4KKUA 2A8VA 4U68A 3I56A 3S1NB 1G91A 3NTIA 1WTOA 2F03A 3NSWA 1FNVA 3V05A 2ATWA 4J15A 4R4TA 1G6ZA 1LYLA 1Y1VH 3CCUA 4ODGA 4QIWE 5FJ8H 1SNPA 3I4MH 1HQMC 2K14A 1Z6HA 2B2TA 2OEOA 5J1ZA 3QOJA 1HNXL 1L0YB 4RHSA 4PMCA 4DV1Q 4POGA 2F0DA 2RDHA 2ID0A 2R92G 1UUPA 1A3TA 3HGBA 2K6AA 4EX5A 3DWPA 3U4ZA 3PIO3 1F2LA 4IFDJ 3QB3A 1LTRD 1KLGD 4J1MA 2J0TD 1H9JA 3SVMA 2WKDA 3N52A 3TP6A 1MKHA 1YNNC 5E4WC 3UI2A 3OW7A 4IUNA 1VS0A 4LF9L 1BVSA 5IYCG 2NVQH 1QILA 2EY2A 4IUVA 2GVAA 4DN4M 5ELDA 1Q1EA 3R8BA 4APVA 3DUZA 4Q0FA 4JI5Q 1D5MC 1C4QA 3ER0A 4IQZA 5A2QL 3TZUA 3ND8A 3HG9A 1Q12A 1UE6A 1SNOA 5ISRA 2EDGA 1KTKA 1ONLA 1HZCA 3GTGB 1HFGA 1SE3A 1A15A 1XMOQ 4ME5A 4P74A 2AHOB 1NTGA 3S1NH 2JA7B 4JBWA 3KLSX 4LFCQ 1SROA 4J8QA 3I90A 5C0XG 1SE8A 4GKKL 2NZOA 4ABNA 4OWTB 4B3TL 4LAAA 1O7LA 1WTQA 1Z7TA 1UNSA 4NMZA 5IP9H 2WB1B 1EOTA 3M4YA 4GS3A 4DR3L 2IX3A 3HOUB 4IUTA 2H1EA 4H02A 5GADC 2VUMH 1ENCA 4GNXA 2DJGC 2XTIA 2V1CC 2QILA 3PQIA 3BJUA 4HCSA 3IFTA 3KF8B 3MXNB 5DM73 3HOWB 1YHBA 2K01A 5IYBH 3FRPB 3VYUA 2R93G 3I91A 1L1OC 1S5FD 4AQYL 1X54A 4DR2Q 5M3MG 3CPWA 3S17B 2NVYH 4JC0A 2RSOA 3ZYYX 5JJZA 3I4NG 3PIOA 2WAQG 2EE1A 3TRZA 1NMGA 1HR0W 1JCKB 3Q22A 2G5DA 2A6EC 4RGNA 1ILPA 5C4XB 3GTQH 3AU7A 1AW7A 4L5TA 1B9MA 4EVOA 1HNZL 1YJNA 2Q8RE 4LF8L 2VY3A 1CSQA 1YNJC 1OO9B 2F0VA 2L12A 1MJCA 1DOMA 1DD2A 4CKCA 1HUNA 3KDFB 2F3WA 2E5LL 1ZYRD 1BBUA 3PUWA 1HA5A 3HOYH 2K75A 1VQDA 1PZKD 4QIWB 1L1OA 3NEMA 4A4IA 1JT8A 2IW3A 2A69C 4OXPA 1Y8NB 3TBIB 1N32Q 5AJ3L 1A0IA 3BVGA 5C44G 4A76A 2N8NA 1KC8C 1NY4A 3I55A 3FKIG 3CCEA 4JI6L 3EBEA 1PFMA 4GNXC 1AEXA 4F8MA 4X64L 3H3VH 4DR6L 1W6JA 2F52A 4AIMA 4IFDI 1EIGA 2B2YC 5F2DA 1JJCB 1XNQQ 4QCLA 4HMJA 4BA1I 3K7AB 4NXMQ 3BS1A 4A3MB 4P72A 5ELOA 5EAYA 2I0QA 1RL2A 4HIDA 3PCOB 3CP0A 1EUJA 1EZ6A 4XYOA 1B7YB 1SEBD 2PW7A 3S2DH 4IUQA 2DJFC 4K6LA 4OELB 3CRLC 4DV6Q 2OWOA 4N9PA 3A54A 1WTPA 3W3AA 3HOUH 3E9IA 4DU9A 2PCFB 4B9XA 2BDOA 4C3HH 1O7ZA 1SFOB 1G51A 1ET9A 2DN8A 4G57A 3U9SA 2BH2A 3CPFA 3R3OA 5KNDA 5T1IA 2O5IC 3S15B 1TKWB 5GAEC 2IJ0A 3NTKA 3HOXG 2YU9H 4A3BH 4DAVA 3GTLB 2B63H 3RZOH 3S14B 1C0AA 4MNOA 4KN4C 2EYJA 4C1NK 4B3RQ 2F0JA 2KEDA 3WOFA 1V43A 2F0QA 4P71A 4QMGA 3HP3A 3GO5A 3CAMA 1BF4A 1BCPB 3Q0AA 3NUCA 2JXMB 2FMCA 2EYFA 2PNRC 4DR5Q 2R3ZA 3F2DA 1B3QA 3AFQA 3SEBA 3J7AV 1JE5A 4B3ML 3K81C 1R4QB 1VQEA 3AB9A 3DWAA 4X64Q 4PQXA 1B1ZA 4DR6Q 4A3EH 3ERQA 5E1FA 4CDEC 1FR3A 2OCEA 1XPUA 2KHJA 1JOQA 1PRTB 3PO3B 5JEAJ 3H91A 2J7ZA 1VQAA 5IT9c 2C5CA 4K6DA 1XYIA 1LV9A 2EJGC 5EJWA 3SK4A 1L1OB 2LS01 1A2TA 4A3IB 4S3SA 5EGTA 3D4WA 4DR7L 1WTVA 1G2TA 5KYLA 3SE0A 1X3GA 1XPOA 4JPBW 3F8TA 3GTMH 2EYPA 1IHZA 1I5FA 3M9BA 4O0AA 2JA8H 1H9SB 2JP1A 1CKMA 1SR3A 1K8GA 4NPSA 1T5XD 4LNQA 2Y0SG 1EYGA 1EY0A 1XMQQ 4IUPA 5LMNL 3MTSA 2E2IB 1UAPA 2M9VA 3PIPA 4DAYB 3EQLC 4JI7Q 4RGTA 4C3HB 1NUCA 3QIAA 1QE6A 2L9HA 2F3IA 1N34Q 3J80E 1F2MA 1NJIC 1RTNA 1CFMA 4OX9L 3CMEA 2Q2HA 1SMYD 1Z47A 2F0MA 1S72A 3I7FA 1A8VA 2PI2E 3MA2B 4P75A 3HOZG 4RMFA 2MO0A 3W1BA 4A3MH 1EEFD 1U4PA 1OXXK 2KECA 5C5LA 3RNUA 2UXCQ 4UAIA 2WKCA 1VQKA 3JAMc 3ERSX 3SXHA 1JJGA 2LSSA 5CBEE 4KHPL 1D8LA 3BDLA 2RKSA 2RQXA 4UPAA 3FPPA 3HS0C 2UUBQ 4EQNA 2OF1A 1IBKQ 2PNHA 2XVSA 1GUOA 2IWHA 5JJKA 3I4NB 2RVLA 1LACA 2B2YA 4DNIA 1ESRA 3T1YQ 3OHXC 4IPCA 1CHQD 2ZJRA 3I70A 3MEHA 1IL8A 2VS1A 3OYYA 1VMPA 2NUCA 2XWBB 1RHPA 2FFKB 1E2WA 3DXJC 1GUNA 1GD7A 4JBJA 4A3CH 3S1QH 1RCVD 5BN5A 4POFA 1I94L 1XXGA 3F1ZA 4X62L 1MI2A 1QZHA 1I4RA 1LTBD 2A68D 3GTJB 1S5BD 3IFDA 1TY0A 1A63A 3GQBA 3KBGA 2NWGA 3SK5A 1WYDA 2WIIB 1QNUA 4YHHL 3H09A 1GOZA 1NR4A 3MFYA 3MVVA 4A3FG 1PFSA 4JG2A 5HY6A 2EIFA 2R93H 3J81L 1MJEA 5IGCA 5IT9L 1N34L 3DM3A 4OO1H 1K0SA 4A3JG 2KA7A 4K2LA 3PGZA 4L5RC 4OX9Q 5C44B 4NP5A 3LWEA 1YNND 2F0FA 3GP7A 1TS3A 5LL6S 4CJ0B 5LL6X 4LF5L 2RCNA 1PH9A 3H6MA 3CC7A 2ZXPA 4Y52H 4UP9A 3AEVA 1X3QA 1I4QA 1PRTC 2K33A 3PO3G 5M3FH 1FNWA 1G2SA 4CHTB 2AUKA 4ME3A 3DWQA 1DOKA 2L55A 1J8IA 3FP9A 1VQCA 4K14A 4JI2L 3DEPA 1ZYRC 2HCIA 4FO2A 1KNEA 3S16B 1HHVA 2TSSA 1M8AA 3KOJA 3TEHB 1HUMA 3NWTA 4RCOA 4L5QA 3T1YL 2R6GA 4RKLA 1P8LA 1N36L 1GJXA 1GO3E 1O7IA 3HEJA 4KI0A 1G8ZD 5FLXE 5KNCA 1HNWL 3EA6A 3STBC 4LF7Q 3KF8A 2JA7H 5L37A 3ONAB 4DV1L 4OWWB 3RZDB 1HJPA 1VQ7A 4BXXH 4BBSB 2F0SA 1RKNA 1X3FA 3P75A 2JN4A 1LTTD 2I5LX 4Y7NB 2A6ED 1T9HA 1QUQB 5M5XB 4ZUJA 4YCUA 2K52A 1S5ED 2UXDL 4GLAC 4WRDA 1JOKA 4A3JH 2EJFC 4IPGA 3TN2A 1WCMG 5M3MH 1JE4A 3F2BA 1VQIA 1HZAA 5JPNC 4EQPA 1TWCB 2YYZA 1QWYA 1RIPA 1E22A 5GQOA 4LFBL 5IYBG 1Q46A 2VQEQ 3GTQB 1ASZA 2J4XA 4NKLA 3SR1A 5C3WA 1I4PA 1NE3A 2B39A 1PRTF 2MHVA 2E2HB 5C3EB 1N33Q 1SYEA 3CC2A 2KCMA 2VUMG 1BXTA 4YY3Q 1D7QA 4RGMA 1VDZA 1FVIA 1GM5A 1TS4A 1O78A 4AYBB 2DUDA 4X3UA 3E9HA 1S5CD 1TT2A 4C3JG 1U5KA 2ICEC 5I6YA 5M5YH 4K0KL 1A2UA 1JICA 5M9OA 3HKSA 1A62A 1K8OA 4DV0Q 3CCMA 4ID6A 1L0WA 4YIJA 2K05A 2XSCA 1F9QA 1AE2A 3NENA 1JR0D 2FHTA 5IE8A 3RLNA 1WTXA 1B3AA 3S17H 3K5NA 2PZTA 5EBDA 1HTLD 2PQAB 4A3BG 3VDYA 1V9PA 4DV2L 2PMZE 1PYWD 2QW7A 1KDBA 2PO4A 5ELEA 2EZVA 1EIHA 4BXXG 3CCQA 1XMQL 1P16A 2DGYA 1KRSA 4U673 2C35B 2WAQB 2SOBA 3PF4A 1CT1D 2WB1G 4TVAB 1C7YA 4O2DA 1IKMA 4YWKA 2Z6KA 3NQIA 5I9OA 4A3LH 2E5LQ 4L6TB 2K03A 5IYCH 4HJ8A 1W2BA 1G291 1JC7A 2LXKA 3BDOA 5I2YA 5FLXc 3NXWA 4CKBA 1H9MA 5DNFA 5H1SE 3M4OB 4QQBX 5IODA 1F9SA 4BBRG 5HGQA 1LTAD 2KCTA 1IBLL 3C3LA 1Y1VG 1D1IA 1M4VA 4K2KA 2CVRA 2SDFA 4ZRZA 2F0GA 1UE1A 2E8GA 1EFID 2F0WA 2PYKA 1WVLA 2F4IA 3GV6A 2NVXH 4YCVA 1N32L 4ZK9B 3LX0A 2MGSA 1CSPA 1KHIA 1KIXA 3FPUB 3J7A5 4DPGA 4FDBA 3S9WA 1JJ2A 5BN4A 3J7YW 4BBRB 3MWYW 4KKSA 2CCZA 4NXML 1RD9D 3D0FA 3S14H 1I6HH 4HEDA 3RLFA 1TWGH 2K5QA 3GTGH 1IYUA 1SAPA 3TZDA 2R7ZH 4A3FB 5C6AA 3HOVG 1YNXA 2LFNA 2E2DC 3DMUA 5DEHA 4HJ5A 2IL8A 2B3GA 2F0LA 2HIXA 1ASYA 1II3A 1MSGA 4LMQD 4ULLA 3H0GG 1PYBA 2Z1CA 1D6EC 2D0OA 1T5EA 1KNAA 1PA6A 3KJPA 1DOLA 1QOHA 3QR8A 3RN5A 1JOOA 2K28A 3DLLA 2B63G 2NVQB 5KRUA 3HOXH 2QDLA 4DR1L 3HOVH 2NN6I 4KHZA 2KCNA 2Z4IA 3A8KE 2H5XA 2HD3A 3ITPA 4QL5A 4WFN3 1SMYC 1TS2A 4KJOA 5CV7A 4Y7NH 2CFMA 1EIFA 3D4DA 3J81c 3P20A 2HCCA 5J39A 4DR4Q 1YHQA 3H0GB 1STEA 4JI6Q 4A3MG 1YHAA 4C3JB 2FMMA 2EXZA 4C3HG 4LFCL 3T13A 4X6AH 1R4PB 4EQ5A 1M90C 4RHRA 1EYAA 3S1MB 3LNNA 1MSHA 3K7AH 3NBHA 1TWGB 4B3MQ 5LMUQ 1I6HB 4XQQA 4NDXA 2EYLA 4HIMA 1HPCA 2KQ3A 3DM1A 1CKNA 2EVBA 2HDMA 4R1JA 4DF7A 4DR3Q 5D14A 5JVG3 1GUWA 1EY9A 2DNEA 4OIJA 2NBFA 5JVH3 1NNXA 4KD3A 3X3MA 2MP1A 1SNQA 3KK7A 2F3VA 2NN6H 1I4HA 2R61A 5M5WB 4LF7L 1K3RA 3CC4A 3E0JA 3CMAA 5JEAH 3OWFA 1EWIA 1V8QA 4CJ2C 5C3XA 1FYCA 1HCZA 3KYHC 4KLKA 2OXPA 3GTKB 3KF6A 3S16H 1CUKA 3OMCA 1IYVA 1OTCA 1XWEA 3JAMi 2ZTEA 1K9MC 1IZ6A 1TWAB 1VQ9A 1HZBA 2XGTA 3FKIB 4JW0A 4TKOB 3T51B 1CZGA 2E2IH 1SBBB 3RR5A 2CHBD 1CTMA 4LFBQ 3S2HB 2RSNA 3NE5B 4MZ9A 3OTOQ 4BY1B 5CBAE 1ILQA 1UEBA 4IZ8A 4LF4Q 3W1GA 4A75A 2BA1A 2K50A 2G9HD 3ULPA 1ICFB 2CWAA 1Y8OB 1K83B 1OXUA 3K7UC 5KNBA 1E7ZA 2NN6G 3M85A 2EYOA 3NK9A 3FMCA 3LWUA 2RHSB 4KKTA 1SNMA 3JAME 3PO2H 2L11A 2VXWA 3CKIB 3NWSA 3TSSA 3V96A 3K6OA 4K0KQ 5AJ3Q 5TSSA 4ZKBB 2F0HA 1TVXA 1C8CA 2UXBL 1CKOA 4O42A 3EN2A 4CDFC 1VQNA 3MFGA 1E3PA 1C9OA 1WFQA 1PH4A 2R7DA 1UE7A 2NTSA 3BYYB 3A5ZB 4BY7B 4G7OC 4PG3A 2Z0SA 3U50C 2N88A 2MJ8A 1E2ZA 1Y14B 4C3IH 5KEEA 4JI4L 4KY7A 3ULLA 3FDTA 1LLRD 1F9PA 3OPOA 2BCOA 2F0UA 1LM0A 4I7AA 1Q86C 1HQRD 3WDNA 4A93H 4RCNA 1YJWA 1X3EA 1O80A 3IAYA 1YJ9A 2K7VA 4IFDH 2OT2A 3PIP3 3U58A 1E24A 4GLXA 4KY5A 3TS0A 4RA8A 4LFAL 2UUCL 1AN8A 2G9DA 1KDCA 3TP8A 4X3SA 3RLOA 1K3BC 1S40A 1GHKA 2XWJB 1Y1WG 1EWCA 2A6HD 5K5PA 2HHHL 3W5OA 1WJJA 2Z9HA 2NVXB 4DA2A 2R92B 5IWAQ 4QUCA 5I6WA 1RTOA 5C3EH 1KAWA 1S4ZA 3A74A 4DV5L 1VQJA 2BE5C 2ZM6L 3UDXA 4GOPC 3QJYA 5I4DA 3BZDB 3TP5A 4BBSH 4ZAIA 4YCWA 3CCSA 5GAHC 1PV4A 5IYDG 3NPPA 4DV7L 1JWSD 4JCVE 2ZTDA 3SHLA 3T16A 3OIQA 3EJIA 1BNZA 1EQTA 1X3PA 1QNKA 2JEAI 1Q8KA 2MO1A 3U4VA 4JV5Q 4H13C 2UU9Q 4G4KA 1WOCA 2QDBA 3OIPA 5M5XH 5DM63 5LMNW 3J80L 1OXSC 2CH4A 3D3RA 1R9TH 2JA6B 4JI3Q 1U4RA 3RZDH 1Y1WH 2KJXA 1STAA 1SE4A 2JA5B 4GN4B 3K5MA 2EYHA 1EQVA 3L0OA 2OTLA 1UWVA 2Z6KC 1V1PB 5GAGC 4IFDG 4DKAC 1ET6A 3KF6B 2WV6D 2XNAC 1FNUA 2F0OA 2HIVA 3D4RA 2UUCQ 4HCEA 4GNXB 1I4GA 1SYCA 1ML0D 5FLMH 2Q2TA 2A1AA 3K0XA 3KLSA 4FXKC 2E75C 3Q6SA 1WD0A 1PHJA 3A8JE 4A3EB 2N49A 1K28A 3GTOB 2JA5G 3DHQA 1GVPA 5LMNQ 1FL0A 1AE3A
chains in the Genus database with same CATH topology
1WCMB 3RUZA 2B2WC 2D2CC 3P1HA 2RA4A 1WD1A 3BVZA 1MBYA 4RKBA 2NVTB 5CGKA 5FOBB 1F2YA 5FLXL 1ZEQX 1PLFA 1VF5C 5FO7B 4NW2A 3D31A 3NP8A 1KLUD 1JWMD 2SEBD 4ZYSA 3HOYB 2PPBC 2F0KA 3OWEB 1FD7D 2R93B 2L4NA 4DAPA 4TQUS 4XXEA 1Y8PB 3WOEA 3RD4A 2ICIA 3NBIA 4PMBA 4ZKCB 4L8JA 1NCVA 2Z4HA 3VA5A 3HKZB 3K5OA 3R2TA 5K36G 3I4MB 3PUZA 2B8GA 4TRDA 3C2PA 5AFWA 2NVYB 5E4XA 2A69D 3E5SA 4FNFA 2PW5A 1BDOA 2L1BA 1QCBD 4GZYC 4KN7C 5C0XI 4KD4A 4C3IB 4K5VA 2MUYA 1NR2A 3OMGA 4X3TA 2M2LA 3R2IA 4G7HC 3CU7A 1ENAA 3BG3A 1LTGD 1ICWA 3K5LA 4R8NA 3PUXA 2PQEA 3C46A 4N9TA 2K04A 3A56A 2EYMA 3URYA 1SYFA 4OHJA 1QJOA 3OSOA 1D5XC 4K5XA 3KBXA 1I50B 2HDLA 3F2UA 3VR6A 1RODA 2EY5A 1Y69U 1TR5A 4KJNA 4K5WA 2XRSD 2NTTA 2R7ZB 3I72A 3VR5A 5IGBA 1CQFA 3A55A 2KUMA 4B9WA 1TQOA 4OO1G 2WINB 2VB3X 3A7LA 1DM0B 1WTWA 1H9KA 1PDQA 3PV0A 2A5HA 2O5JC 1ZXTA 2SNMA 3MAQA 4A3BB 5G3LD 1HTPA 1B53A 4FVMA 1U4MA 5LHY1 5FO8B 4C2MB 2F0EA 3MC0B 1DZ1A 4RAUC 3SDZA 2D5DA 2EPBA 4RFBA 1JQYD 1XTCD 4HAEA 2PZWA 4WORA 3R93A 1D1KA 4HSPA 4IN3A 1BBXC 4OO1I 3Q24A 1DJRD 1RF2D 2AWOA 4E6IA 2VNUD 1Q8IA 3H3VC 1SYBA 2B2UA 1HXYD 2XIWA 4B08A 3S1QB 2O2LD 1BCPD 5KYIA 1FGBD 5EQ0A 5M3MB 2H4OA 3O13A 4O1NA 2B2VC 1I3QB 1EL0A 2WP8J 5CORA 4JK1C 4V0BA 1DCZA 4XT1B 5ELBA 4CBVA 4ILWA 4C56C 4V190 1DXMA 3S2DB 1STYA 5G3LF 4Z9CB 1STNA 2F0TA 1LTID 1JWUD 1H9SA 1Y1VB 2HQEA 3MXUA 1HFNA 5M5YB 1LABA 3D6WA 1NAPA 2D9UA 2NYZD 3QG1A 1STHA 2AWNA 4CJ1B 4XT3B 1MD2D 1KAAA 2TMPA 1STGA 4A3DB 2AQ2B 1CA6A 4Q5VA 5C4HA 4XIGS 1BQQT 4F87A 3E6ZX 5CC4A 2A74C 4PNYA 4R9WA 3K0YA 1PMRA 1EZ8A 2IX0A 2B2VA 3H94A 1SJED 1K8MA 2EJMA 1CK1A 4FXGC 3HRZC 1XX8A 4CKEA 5EPKA 4HSVA 3AMUA 3N6RA 4F7XA 5EPJA 4DK1A 4FF4A 2IT1A 3Q23A 5IGFA 1CI3M 4HN7A 4FP5D 3D8GA 5C0XH 3I3CA 4FYDA 1F9RA 1NSNS 3A7AB 3FEWX 5A2QE 2F1MA 1TIID 4DXFA 1IKLA 4M8AA 3J7AF 1H9RA 1LT5D 4QUFA 3IKJA 3PUYA 1Q1BA 4PV1C 5I9PA 1CM9A 4DK0A 3HOZB 5CV6A 1A6XA 3G7LA 4BA2I 5KIXA 1QG7A 3MXNA 3K57A 1IW7C 3M3YB 1JORA 2RDGA 1A3UA 2PMZB 2L0CA 2L5TA 1RDPD 4A3KB 3DEOA 5C0XJ 1Y1WB 4MN3A 4A93B 5C5MA 3NHHA 2YU9B 2BA0A 1EY6A 3EVQA 5DAUA 4RGOS 3GTPB 1B44D 1PTOF 2BDNA 5D3DA 2KOLA 2IX1A 2JSOA 3W2DA 1VMCA 5EKIA 5I2XA 1SXTA 4DXGA 3JAML 2RBMA 4RH6A 3U9OA 2M00A 2KHSA 1D2BA 1DYQA 3MZ5A 1F77A 1TS5A 2WACA 2KEEA 1TY2A 2JYOA 1CQVA 2NZ1D 2GA4B 1BR9A 3A8IE 1O7YA 3NTHA 1V1OA 4HR7B 3T4AC 2E76C 3MXGA 2BOSA 2JA8B 1EYCA 3CQZB 3BYTB 1A3VA 3P7JA 1OXTA 1UEAB 4H44C 4ZQ3A 1L0XB 4XYQA 2I46A 1RJTA 1PTOD 5IT9E 4C3IG 2HUGA 3T53B 1SDFA 5C4ZA 4LJZC 4KMUC 4BS9A 1AZQA 2Z8LA 4IALA 1I6VC 3L7ZC 4RWSC 4XQJA 5HGTA 5JPMC 3GTMB 1B2TA 1EU4A 3C1EA 4R8IA 3D6CA 2VB2X 2XN9C 4MIUA 5ELFA 4PMWA 5KGUA 3QWNA 2VUMB 4FXDA 1YNJD 4H7BA 3K59A 2X69A 3CHBD 4H0LC 1PTOC 2EOTA 1C48A 2QF7A 1KABA 3VA7A 2ZXOA 1F2ZA 5JAVA 1SSOA 1R9TB 5CMDA 2IPKD 2LMCB 2AUJD 4F88A 2B2TC 2XRQD 1PFNA 2A6HC 1GUSA 3M7NA 2B2UC 1DONA 3G6JB 2F0NA 5IGDA 2QKIC 2Q8TA 3OOCA 3ND9A 2JEBI 4WJWA 4KHVA 5CV5A 3VYRA 4OL7A 2FINB 5J22A 1PXUA 3MHBA 3PUVA 5CV4A 4UDUC 3TDQA 1LO5D 2X6LA 4I7ZC 3PMFA 4M1UB 3MXPA 1Q3LA 5JOBA 2PZUA 1TWFB 1SNDA 2QCPX 4HMIA 1KDAA 5A35A 1I4XA 1GUGA 3GD7A 2CW0C 1SE2A 2E2JB 1PTOH 2A68C 5IOCA 1LT6D 5CV9A 1E2VA 2LY7A 3BVMA 4FF2A 1S5DD 1SNCA 5IGGA 1QB5D 2BE5D 2ENBA 1EY5A 1MGSA 2B2WA 2ZXRA 5EKKA 3KUPA 2V4DA 2X6GA 3HOXB 1V1PA 4IURA 1IW7D 2RDFA 4QB4A 4FF3A 1JB3A 5C4JB 1EY4A 2D62A 2I07B 1U9RA 3QO2A 3K58A 1LT3D 2AQ1B 5FKAC 2DNCA 3PO2B 4FF1A 1ZKOA 2Q8IB 3L3OC 3C1FA 2EY1A 1SYDA 3I4LA 4ZLTF 4XQNA 4X3KA 1EY7A 1D5ZC 5D3IB 2NB0A 3VYTA 5JEAG 2E74C 4KK7A 1LTSD 1PZID 2A73B 4TSSA 5EKLA 2CW0D 5IIFA 1PTOB 5CR3A 3S1RB 1PFBA 3FVQA 1WTRA 1J9OA 4L63B 2K5DA 4KY6A 4BWGB 2K5WA 1HA6A 1OXVA 1AZPA 4DNRB 3NQTA 1BOSA 4XDXA 1B9NA 3X3NA 3TP7A 4DGZA 4KV6A 4DAYA 5ELCA 5BN3A 2DY7A 3GV3A 4CGYB 1GUTA 2B63B 3RZOB 1EU3A 3EFXD 5E3FA 1Q90A 4DFAA 1GXDC 2K32A 2AQ3B 3IL8A 5CV8A 4HTHA 2K1BA 1BCPC 1PRTD 2CQAA 1EWHA 1CZWA 1STBA 3HOVB 1BUVT 5D65A 5FK9C 5M3FB 5CYUA 2C9OA 2Y0SB 2SNSA 1LT4D 1E0BA 4QF4A 3BDCA 3QOLA 3RMHA 1X32A 2F0PA 2FJ2A 3SK6A 5EPLA 4DNTB 3VR3A 1CHPD 3M7GA 4ZUIA 5HURA 3TMEA 4J6HA 1ESFA 2ZT9C 1B50A 3HZXA 1TU2B 1BO0A 1GHJA 4KTAA 2B8FA 5T1GA 1CA5A 5IGEA 1W6KA 4OGQC 4I65A 4EGVA 1SYGA 3I8ZA 1EEID 5K36H 1AP0A 2MPMA 1BCPF 3J81E 3CRKC 5COYA 4EQOA 4A3JB 2LKVA 3KLRA 2KVMA 4IUUA 3EROA 4MHEA 2F0IA 1TWHB 3T56B 1SJHD 2QEJC 1AFPA 3V2TA 3SK8A 4C1NI 5NUCA 2JE6I 3I73A 1U4LA 4XTCS 4OIKA 3VYSA 1EYDA 3L9AX 2O4XA 1VCIA 3VR4A 2N55A 1PZJD 4LK1C 2EY6A 5EBCA 1VF7A 2DY8A 1EY8A 1HRJA 4K8JA 4K8IA 5FO9B 3VR2A 2KCCA 4G7ZC 4A3GB 1B4OA 4P2CB 1ENFA 4KKUA 4U68A 3S1NB 1G91A 3NTIA 1WTOA 2F03A 3NSWA 1FNVA 3V05A 1G6ZA 4ODGA 1SNPA 1HQMC 1Z6HA 2B2TA 2OEOA 5J1ZA 3QOJA 1L0YB 4RHSA 4PMCA 2F0DA 2RDHA 2ID0A 1UUPA 3HGBA 1A3TA 2K6AA 3DWPA 3PIO3 1F2LA 4IFDJ 3QB3A 1LTRD 1KLGD 4J1MA 2J0TD 1H9JA 3SVMA 2WKDA 3N52A 3TP6A 3UI2A 1YNNC 5E4WC 3OW7A 4IUNA 1QILA 2EY2A 4IUVA 4DN4M 5ELDA 1Q1EA 3R8BA 3DUZA 4Q0FA 1D5MC 1C4QA 4IQZA 5A2QL 3TZUA 3ND8A 3HG9A 1Q12A 1SNOA 5ISRA 2EDGA 1KTKA 1ONLA 3GTGB 1HFGA 1SE3A 1A15A 4ME5A 2JA7B 4JBWA 3KLSX 4J8QA 3I90A 5C0XG 4ABNA 4LAAA 1O7LA 1WTQA 1Z7TA 1UNSA 4NMZA 2WB1B 1EOTA 3M4YA 2IX3A 3HOUB 4IUTA 2H1EA 1ENCA 2QILA 4HCSA 3IFTA 5DM73 3HOWB 2K01A 3FRPB 3VYUA 3I91A 1S5FD 3S17B 2RSOA 3ZYYX 5JJZA 2EE1A 1JCKB 3Q22A 2A6EC 4RGNA 1ILPA 5C4XB 3AU7A 1AW7A 1B9MA 4EVOA 2Q8RE 1YNJC 1OO9B 2F0VA 2L12A 1DOMA 1DD2A 4CKCA 1HUNA 2F3WA 1ZYRD 3PUWA 1HA5A 1PZKD 4QIWB 2IW3A 2A69C 1Y8NB 3TBIB 3BVGA 1PFMA 1AEXA 4F8MA 1W6JA 4IFDI 1EIGA 2B2YC 5F2DA 4QCLA 4HMJA 4BA1I 3K7AB 3BS1A 4A3MB 1EZ6A 4XYOA 1SEBD 2PW7A 4IUQA 4K6LA 3CRLC 4N9PA 3A54A 1WTPA 3W3AA 4DU9A 2PCFB 4B9XA 2BDOA 1O7ZA 1SFOB 1ET9A 2DN8A 4G57A 3U9SA 3R3OA 5KNDA 5T1IA 2O5IC 3S15B 1TKWB 2IJ0A 3NTKA 4DAVA 3GTLB 3S14B 4KN4C 2EYJA 4C1NK 2F0JA 2KEDA 3WOFA 1V43A 2F0QA 4QMGA 3HP3A 3GO5A 1BF4A 1BCPB 3Q0AA 3NUCA 2JXMB 2FMCA 2EYFA 2PNRC 2R3ZA 3SEBA 3J7AV 1R4QB 3AB9A 3DWAA 4PQXA 1B1ZA 3ERQA 5E1FA 1FR3A 1JOQA 1PRTB 3PO3B 5JEAJ 3H91A 2J7ZA 2C5CA 4K6DA 1XYIA 1LV9A 2EJGC 5EJWA 3SK4A 2LS01 1A2TA 4A3IB 4S3SA 5EGTA 3D4WA 1WTVA 1G2TA 5KYLA 3SE0A 2EYPA 1IHZA 1H9SB 2JP1A 1T5XD 1EY0A 4IUPA 3MTSA 2E2IB 1UAPA 2M9VA 3EQLC 4RGTA 4C3HB 1NUCA 3QIAA 1QE6A 2L9HA 3J80E 1F2MA 1RTNA 1CFMA 1SMYD 1Z47A 2F0MA 3MA2B 1EEFD 1U4PA 1OXXK 2KECA 5C5LA 4UAIA 2WKCA 3SXHA 5CBEE 3BDLA 2RKSA 2RQXA 3FPPA 3HS0C 4EQNA 2OF1A 2XVSA 2IWHA 1GUOA 3I4NB 2RVLA 1LACA 2B2YA 1ESRA 3OHXC 1CHQD 3I70A 3MEHA 1IL8A 1VMPA 2NUCA 2XWBB 1RHPA 2FFKB 1E2WA 3DXJC 1GUNA 1RCVD 5BN5A 1XXGA 1MI2A 1I4RA 1LTBD 2A68D 3GTJB 1S5BD 1TY0A 3IFDA 3GQBA 3KBGA 2NWGA 3SK5A 2WIIB 1QNUA 3H09A 1GOZA 1NR4A 3MFYA 3MVVA 3J81L 5IGCA 5IT9L 4OO1H 2KA7A 4K2LA 5C44B 4NP5A 3LWEA 1YNND 2F0FA 3GP7A 1TS3A 5LL6S 4CJ0B 5LL6X 3H6MA 2ZXPA 1X3QA 1I4QA 1PRTC 2K33A 1FNWA 1G2SA 4CHTB 2AUKA 3DWQA 1DOKA 2L55A 1J8IA 4K14A 3DEPA 1ZYRC 2HCIA 4FO2A 1KNEA 3S16B 1HHVA 2TSSA 1M8AA 1HUMA 3NWTA 4RCOA 2R6GA 4RKLA 1GJXA 3HEJA 4KI0A 1G8ZD 5FLXE 5KNCA 3EA6A 3KF8A 3ONAB 3RZDB 4BBSB 2F0SA 1RKNA 3P75A 1LTTD 4Y7NB 2A6ED 5M5XB 4ZUJA 1S5ED 4WRDA 1JOKA 2EJFC 3TN2A 1JE4A 5JPNC 4EQPA 1TWCB 2YYZA 1QWYA 3GTQB 2J4XA 4NKLA 3SR1A 5C3WA 1I4PA 2B39A 1PRTF 2MHVA 2E2HB 5C3EB 1SYEA 1BXTA 4RGMA 1VDZA 1TS4A 1O78A 4AYBB 4X3UA 1S5CD 1TT2A 4C3JG 2ICEC 5I6YA 1A2UA 1JICA 5M9OA 1K8OA 4ID6A 4YIJA 2K05A 2XSCA 1F9QA 1JR0D 2FHTA 1WTXA 1B3AA 3K5NA 2PZTA 5EBDA 1HTLD 1PYWD 1KDBA 2PO4A 5ELEA 2EZVA 1EIHA 4U673 2WAQB 2SOBA 1CT1D 1IKMA 3NQIA 5I9OA 4L6TB 2K03A 1G291 1JC7A 3BDOA 5I2YA 3NXWA 4CKBA 1H9MA 5DNFA 3M4OB 5IODA 1F9SA 1LTAD 3C3LA 1D1IA 1M4VA 4K2KA 2CVRA 2SDFA 4ZRZA 2F0GA 1EFID 2F0WA 2PYKA 1WVLA 2F4IA 3GV6A 4ZK9B 3LX0A 2MGSA 3FPUB 3S9WA 5BN4A 3J7YW 4BBRB 3MWYW 4KKSA 1RD9D 4HEDA 3RLFA 2K5QA 1IYUA 1SAPA 3TZDA 4A3FB 5C6AA 2LFNA 2E2DC 3DMUA 5DEHA 2IL8A 2F0LA 1II3A 1MSGA 4LMQD 4ULLA 2Z1CA 1D6EC 1T5EA 1KNAA 1DOLA 1QOHA 1JOOA 2K28A 2NVQB 5KRUA 2NN6I 4KHZA 2KCNA 2Z4IA 3A8KE 3ITPA 4WFN3 1SMYC 1TS2A 4KJOA 5CV7A 3D4DA 3P20A 2HCCA 5J39A 3H0GB 1STEA 4C3JB 2FMMA 2EXZA 4C3HG 3T13A 1R4PB 4RHRA 1EYAA 3S1MB 3LNNA 1MSHA 3NBHA 1TWGB 1I6HB 4XQQA 4NDXA 2EYLA 1HPCA 2KQ3A 3DM1A 2EVBA 2HDMA 4DF7A 5D14A 5JVG3 1GUWA 1EY9A 2DNEA 4OIJA 2NBFA 5JVH3 4KD3A 3X3MA 2MP1A 1SNQA 2F3VA 2NN6H 3KK7A 1I4HA 2R61A 5M5WB 3E0JA 5JEAH 3OWFA 1V8QA 4CJ2C 5C3XA 1FYCA 1HCZA 2OXPA 3GTKB 3OMCA 1IYVA 1XWEA 1TWAB 3FKIB 4TKOB 3T51B 1CZGA 1SBBB 2CHBD 1CTMA 3S2HB 2RSNA 3NE5B 4BY1B 5CBAE 1ILQA 4IZ8A 2BA1A 2G9HD 1Y8OB 1K83B 1OXUA 5KNBA 2NN6G 3M85A 2EYOA 3NK9A 3FMCA 3LWUA 4KKTA 1SNMA 3JAME 2L11A 2VXWA 3CKIB 3NWSA 3TSSA 3V96A 3K6OA 5TSSA 4ZKBB 2F0HA 1TVXA 1C8CA 4O42A 3MFGA 2NTSA 3BYYB 4BY7B 4G7OC 2N88A 2MJ8A 1E2ZA 5KEEA 4KY7A 3FDTA 1LLRD 1F9PA 3OPOA 2BCOA 2F0UA 1HQRD 3WDNA 4RCNA 1O80A 3IAYA 2K7VA 4IFDH 2OT2A 3PIP3 4KY5A 4RA8A 1AN8A 2G9DA 1KDCA 3TP8A 4X3SA 1GHKA 2XWJB 1EWCA 2A6HD 5K5PA 2NVXB 4DA2A 2R92B 4QUCA 5I6WA 1RTOA 1S4ZA 2BE5C 3QJYA 5I4DA 3BZDB 3TP5A 4ZAIA 3NPPA 1JWSD 3SHLA 3T16A 3OIQA 3EJIA 1BNZA 1EQTA 1X3PA 1QNKA 2JEAI 4H13C 4G4KA 2QDBA 3OIPA 5DM63 3J80L 1OXSC 3D3RA 2JA6B 1U4RA 2KJXA 1STAA 1SE4A 2JA5B 3K5MA 2EYHA 1EQVA 1V1PB 4IFDG 1ET6A 2WV6D 2XNAC 1FNUA 2F0OA 3D4RA 4HCEA 1I4GA 1SYCA 1ML0D 3KLSA 4FXKC 2E75C 3Q6SA 1WD0A 3A8JE 4A3EB 3GTOB 3DHQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C4Z A;  2F0V A;  2KQ3 A;  3OSO A;  4K5X A;  4DF7 A;  3RUZ A;  3QB3 A;  4ZUJ A;  3PMF A;  1EY9 A;  3P1H A;  4J1M A;  3ERQ A;  3TP6 A;  4K2K A;  4IAL A;  4KD3 A;  4KY6 A;  2F3W A;  3MEH A;  5E1F A;  4EQO A;  4RKB A;  4IUN A;  3MXP A;  4WRD A;  1JOK A;  2LKV A;  2NUC A;  4KY5 A;  5CGK A;  1JOQ A;  1SNQ A;  2EY5 A;  2F0G A;  1TR5 A;  1STY A;  2F0T A;  1STN A;  2F0W A;  2EY2 A;  2F3V A;  1KDC A;  2HQE A;  2PYK A;  4KJN A;  5CR3 A;  1F2Y A;  5JOB A;  3TP8 A;  3ERO A;  5C5M A;  4EQP A;  3NHH A;  4K6D A;  3NQT A;  1STH A;  3OWF A;  1EY6 A;  2F0I A;  3LX0 A;  3SK4 A;  3EVQ A;  5HGT A;  5K5P A;  5M9O A;  5DAU A;  2PZU A;  5C3X A;  4NKL A;  3NP8 A;  3SK5 A;  3SR1 A;  1A2T A;  5C3W A;  1SND A;  1KAA A;  3C1E A;  4S3S A;  5EGT A;  1STG A;  3TP7 A;  2OXP A;  3D4W A;  4HMI A;  3MVV A;  4DGZ A;  5IGB A;  3S9W A;  2F0K A;  3V2T A;  4B9W A;  3SK8 A;  3OMC A;  1SYE A;  4KV6 A;  1KDA A;  5KYL A;  5I6W A;  1TQO A;  1AEX A;  4F8M A;  5C4H A;  5CC4 A;  3D6C A;  1SNO A;  5NUC A;  5ISR A;  4MIU A;  4PNY A;  5IGC A;  5F2D A;  5KGU A;  2EYP A;  5E3F A;  3TP5 A;  5IOC A;  4HMJ A;  1EZ8 A;  4K2L A;  1IHZ A;  4ME5 A;  4DFA A;  4PMB A;  5CV9 A;  1EYD A;  1TT2 A;  1SNC A;  2O4X A;  5I6Y A;  5IGG A;  4NP5 A;  3VA5 A;  2RBM A;  4H7B A;  5C6A A;  3U9O A;  2M00 A;  1A2U A;  5CV8 A;  2F0F A;  4HTH A;  1EZ6 A;  2ENB A;  2KHS A;  1EY5 A;  4IZ8 A;  3SHL A;  3DMU A;  2EY6 A;  3EJI A;  3T16 A;  2PW7 A;  5DEH A;  2SNM A;  3H6M A;  3MZ5 A;  2F0L A;  4LAA A;  4ID6 A;  2WAC A;  1EY0 A;  1EY8 A;  4YIJ A;  1II3 A;  1STB A;  4NMZ A;  4TRD A;  4N9P A;  2QDB A;  5EKK A;  4F7X A;  4K8J A;  4K8I A;  1KAB A;  2EYO A;  2F0E A;  3NK9 A;  2RDF A;  4DU9 A;  1F2Z A;  5IGF A;  1SNM A;  4QB4 A;  5JAV A;  2SNS A;  2PZT A;  3E5S A;  1NUC A;  4B9X A;  2PW5 A;  4QF4 A;  5CV4 A;  1ENC A;  1JOO A;  1EY4 A;  1F2M A;  3BDC A;  3D8G A;  3QOL A;  2PZW A;  4WOR A;  5KRU A;  4K5W A;  1U9R A;  4KD4 A;  1STA A;  4K14 A;  1NSN S;  4K5V A;  2F0P A;  3SK6 A;  1KDB A;  3OMG A;  2F0M A;  3ITP A;  4E6I A;  2F0H A;  4G57 A;  1EYC A;  2EYH A;  1EQV A;  1SYB A;  3R3O A;  4KJO A;  5CV7 A;  4ZUI A;  1ENA A;  1A3V A;  5HUR A;  3TME A;  3D4D A;  4J6H A;  4ZQ3 A;  5J39 A;  3P75 A;  2SOB A;  3C1F A;  4R8N A;  2EY1 A;  3HZX A;  5I9P A;  1SYD A;  2F0N A;  5C5L A;  5KYI A;  4RKL A;  2F0O A;  5IGD A;  1EY7 A;  1SYC A;  2PQE A;  5I9O A;  4ODG A;  2EYJ A;  5CV6 A;  4KTA A;  3SXH A;  5IOD A;  2EXZ A;  2F0J A;  1SNP A;  3HEJ A;  4NDX A;  2F0Q A;  4N9T A;  4QMG A;  3T13 A;  5KEE A;  5IGE A;  3BDL A;  5KIX A;  4I65 A;  4KY7 A;  1EYA A;  2RKS A;  2OEO A;  3NUC A;  4KHV A;  2EYM A;  5CV5 A;  5J1Z A;  3QOJ A;  4EVO A;  2F0S A;  1RKN A;  2EYF A;  4OL7 A;  3NXW A;  1SYG A;  4PMC A;  2F0U A;  5EKL A;  4EQN A;  5J22 A;  1SYF A;  2F0D A;  2OF1 A;  3DHQ A;  5IIF A;  1JOR A;  3MHB A;  1A3U A;  2EYL A;  1A3T A; 
#chains in the Genus database with same CATH topology
 5IWA L;  4DR5 L;  4JYA Q;  1WCM B;  3RUZ A;  3M4O H;  2B2W C;  1N8R C;  2D2C C;  2EQS A;  3P1H A;  2RA4 A;  1WD1 A;  3BVZ A;  1MBY A;  4RKB A;  2NVT B;  5CGK A;  4YWL A;  5FOB B;  2BH8 A;  1F2Y A;  5FLX L;  4L5S A;  5BR8 L;  1ZEQ X;  1PLF A;  1VF5 C;  5FO7 B;  4N8X 1;  1PVO A;  4NW2 A;  3D31 A;  3NP8 A;  1KLU D;  1JWM D;  2SEB D;  1B70 B;  3Q8D A;  4ZYS A;  3HOY B;  2PPB C;  1NMF A;  2F0K A;  3OWE B;  3H15 A;  1FD7 D;  2R93 B;  2L4N A;  4DAP A;  2UXC L;  4TQU S;  3H0G H;  3HOZ H;  4XXE A;  1Y8P B;  4A3G G;  3PSI A;  3WOE A;  3RD4 A;  1SFO H;  2ICI A;  4KHP Q;  3NBI A;  4PMB A;  4ZKC B;  4L8J A;  1NCV A;  2Z4H A;  3VA5 A;  3HKZ B;  3K5O A;  3R2T A;  5K36 G;  1KQS A;  1K73 C;  3KLW A;  3I4M B;  3PUZ A;  2B8G A;  4TRD A;  1VQB A;  3C2P A;  5AFW A;  3WWV A;  2JJQ A;  2NVY B;  3PF5 A;  1KL9 A;  5E4X A;  2A69 D;  3E5S A;  4FNF A;  2PW5 A;  1BDO A;  2L1B A;  1QCB D;  4GZY C;  4KN7 C;  5C0X I;  4KD4 A;  2R92 H;  4C3I B;  4K5V A;  2MUY A;  1NR2 A;  3OMG A;  4X3T A;  4JI8 Q;  2M2L A;  3R2I A;  2IY5 B;  4G7H C;  1BKB A;  1ENA A;  1VQG A;  1LTG D;  1ICW A;  3BG3 A;  3CU7 A;  4N8F A;  3K5L A;  3BU2 A;  4ALP A;  4R8N A;  1N33 L;  3SGI A;  4GOP B;  3B6Y A;  1TWC H;  3PUX A;  4UP8 A;  2PQE A;  3C46 A;  2JK8 A;  4GN3 B;  4N9T A;  2PQA A;  2K04 A;  3A56 A;  2EYM A;  3URY A;  4LUZ A;  1SYF A;  4OHJ A;  4HJ7 A;  1QJO A;  4GLV B;  3OSO A;  1D5X C;  4K5X A;  3KBX A;  1I50 B;  4JI0 Q;  2HDL A;  2ALY B;  2IHE A;  4DUY L;  3F2U A;  4HIK A;  1LTL A;  1K0R A;  1Q82 C;  3VR6 A;  3HOY G;  5C3E G;  5DLQ E;  2ASB A;  5M3F G;  1ROD A;  2EY5 A;  4KJN A;  1TR5 A;  4K5W A;  1Y69 U;  2XRS D;  5C4J H;  2NTT A;  4JI2 Q;  3UE1 A;  2R7Z B;  2HQL A;  1X56 A;  3I72 A;  1I94 Q;  1VQH A;  4WJ4 A;  3VR5 A;  2RCF A;  3CCL A;  1CKN B;  5IGB A;  1CQF A;  3A55 A;  2KUM A;  4B9W A;  1TQO A;  4A93 G;  4OO1 G;  2WIN B;  2VB3 X;  3A7L A;  1N36 Q;  1DM0 B;  1B8A A;  4MTK A;  4BY7 H;  4A3I H;  1WTW A;  1H9K A;  3GDE A;  3AYH B;  1PDQ A;  3M4Q A;  3PV0 A;  4IOC A;  1JMC A;  2A5H A;  2O5J C;  1VQP A;  1ZXT A;  4AYB G;  1X65 A;  2YTX A;  2KBN A;  3KJO A;  1Q7Y C;  2SNM A;  3MAQ A;  4A3B B;  5G3L D;  1HTP A;  1B53 A;  4FVM A;  1U4M A;  5LHY 1;  1M1K C;  4LF6 L;  2UXD Q;  5FO8 B;  1QVG A;  4DR4 L;  4C2M B;  2F0E A;  4IPH A;  3MC0 B;  1DZ1 A;  4RAU C;  3SDZ A;  1IBM L;  2D5D A;  4LUO A;  4DR1 Q;  1FJG L;  2EPB A;  4RFB A;  1JQY D;  1XTC D;  4HAE A;  3CD6 A;  2PZW A;  4WOR A;  3R93 A;  3S1M H;  1D1K A;  2B29 A;  3A5U A;  4HSP A;  4IN3 A;  1BBX C;  4OO1 I;  3Q24 A;  4UY8 C;  1DJR D;  1RF2 D;  2AWO A;  4E6I A;  2VNU D;  1Q8I A;  3H3V C;  1Z9F A;  4LW1 A;  5LMU L;  1TWH H;  1SYB A;  2E2H H;  1VQ8 A;  2B2U A;  4UP7 A;  3OW2 A;  1HXY D;  2XIW A;  4B08 A;  3S1Q B;  2O2L D;  3PO2 G;  3FKI H;  1BCP D;  5KYI A;  4JI3 L;  2E2J H;  1FGB D;  5EQ0 A;  2ZJP A;  5M3M B;  2H4O A;  3O13 A;  1VQM A;  3T1H Q;  4O1N A;  2B2V C;  1I3Q B;  1EL0 A;  2WP8 J;  5COR A;  1Q81 C;  1PH1 A;  4JK1 C;  1PH5 A;  4V0B A;  1DCZ A;  4XT1 B;  5ELB A;  4CBV A;  1WTH A;  1FGU A;  4JI1 L;  3CXC A;  4ILW A;  4C56 C;  1HR0 Q;  4V19 0;  1DXM A;  3S2D B;  1STY A;  2F0T A;  1STN A;  4Z9C B;  5G3L F;  4A3G H;  4DV2 Q;  1LTI D;  1JWU D;  1H9S A;  1Y1V B;  2HQE A;  3MXU A;  1HFN A;  5M5Y B;  1LAB A;  1I50 H;  1NAP A;  3D6W A;  3J7Z C;  2D9U A;  2NYZ D;  3QG1 A;  1STH A;  3E3X A;  2AWN A;  4NB3 A;  4CJ1 B;  2K5V A;  4XT3 B;  1MD2 D;  2VQE L;  1KAA A;  2TMP A;  1STG A;  4A3D B;  1J5E L;  2AQ2 B;  3PO3 H;  1CA6 A;  4Q5V A;  2Z6B A;  5C4H A;  4XIG S;  1BQQ T;  4F87 A;  3E6Z X;  5CC4 A;  1IBL Q;  2A74 C;  4PNY A;  1I3Q H;  4R9W A;  5FJ8 G;  3K0Y A;  1PMR A;  1EZ8 A;  2IX0 A;  2B2V A;  3H94 A;  1SJE D;  1K8M A;  2EJM A;  4GKK Q;  1CK1 A;  4FXG C;  5GRO A;  2K5N A;  2PI2 A;  3HRZ C;  1XX8 A;  4CKE A;  5EPK A;  4HSV A;  3UE0 A;  3AMU A;  1YBY A;  3N6R A;  4F7X A;  5EPJ A;  4DK1 A;  2I5H A;  3MEF A;  4FF4 A;  2IT1 A;  3Q23 A;  5IGF A;  1AH9 A;  3HKZ G;  1CI3 M;  4HN7 A;  2JA9 A;  4FP5 D;  1XNR Q;  1SN8 A;  3D8G A;  4DUZ Q;  5C0X H;  3I3C A;  4FYD A;  1F9R A;  1HNX Q;  3J81 j;  1NSN S;  3A7A B;  3FEW X;  5A2Q E;  3CF5 A;  2F1M A;  3E0E A;  3FHW A;  1TII D;  4DXF A;  1IKL A;  4M8A A;  3J7A F;  1H9R A;  1LT5 D;  4QUF A;  3IKJ A;  3PUY A;  2YTV A;  1Q1B A;  1HR0 L;  4PV1 C;  5I9P A;  1CM9 A;  1MHW C;  4DK0 A;  3NEL A;  2F4V L;  4RG1 A;  3J80 c;  3ZJY C;  3HOZ B;  5CV6 A;  4LFA Q;  2JA6 G;  1A6X A;  4OWX B;  1XTD A;  3G7L A;  4BA2 I;  5KIX A;  1QG7 A;  3MXN A;  3K57 A;  1IW7 C;  3M3Y B;  1JOR A;  2RDG A;  2R7Z G;  1A3U A;  2PMZ B;  4P73 A;  2L0C A;  2L5T A;  3STB D;  1RDP D;  2D0P A;  1GKH A;  4B3T Q;  4PZ8 A;  4A3K B;  1KD1 C;  2IHF A;  3DEO A;  5C0X J;  4DV3 Q;  1Y1W B;  1XMO L;  4MN3 A;  2ZJQ A;  4A3D H;  4A93 B;  5C5M A;  3NHH A;  2YU9 B;  2BA0 A;  3EIV A;  1EY6 A;  1SLJ A;  3EVQ A;  5DAU A;  2K4K A;  4RGO S;  3HOW G;  2OTJ A;  3GTP B;  1B44 D;  1PTO F;  1YIT A;  2BDN A;  5D3D A;  4DV5 Q;  3TRE A;  2UU9 L;  4GKJ Q;  2KOL A;  2HT1 A;  2IX1 A;  2JSO A;  4R4O A;  1G6P A;  3W2D A;  1VMC A;  5EKI A;  5I2X A;  1SXT A;  1QVF A;  3G4S A;  4DXG A;  2KEN A;  3JAM L;  2RBM A;  4RH6 A;  3U9O A;  2M00 A;  4JI4 Q;  2JA8 G;  2KHS A;  4JV5 L;  1D2B A;  1DYQ A;  4R4I A;  2N78 A;  4IJL A;  3GTP H;  4AQY Q;  3MZ5 A;  4DV4 L;  1F77 A;  1TS5 A;  2WAC A;  2VQF Q;  2KEE A;  1TY2 A;  3KDF A;  2JYO A;  1V1Q A;  4A3F H;  3CQZ H;  3L2P A;  2QGQ A;  1CQV A;  1PH3 A;  2NZ1 D;  4IO9 A;  2GA4 B;  2VW9 A;  2LXJ A;  1BR9 A;  1IL2 A;  5J3B A;  3A8I E;  4X66 Q;  1O7Y A;  3NTH A;  1V1O A;  1HNZ Q;  4HR7 B;  3T4A C;  2E76 C;  4LWC A;  3MXG A;  2BOS A;  2JA8 B;  1EYC A;  2WB1 E;  3CQZ B;  3BYT B;  3S1R H;  1A3V A;  3P7J A;  1OXT A;  4OON A;  1UEA B;  4H44 C;  4ZQ3 A;  4NXN Q;  2Q2U A;  1PH6 A;  1L0X B;  4XYQ A;  1WI5 A;  4C2M H;  1N9W A;  1EOV A;  1X6O A;  2I46 A;  5IP7 H;  1J6Q A;  1RJT A;  2ZTC A;  2ZM6 Q;  1PTO D;  3OTO L;  3ULJ A;  5IT9 E;  4C3I G;  4JYA L;  2HUG A;  3T53 B;  3HKZ E;  1SDF A;  5C4Z A;  4LJZ C;  4KMU C;  1X55 A;  4GOP A;  4BS9 A;  1K83 H;  1AZQ A;  4MTN A;  2Z8L A;  4IAL A;  1I6V C;  3L7Z C;  4RWS C;  4QJF A;  4XQJ A;  2CH4 W;  1L2F A;  5HGT A;  5JPM C;  3GTM B;  3HOW H;  1B2T A;  1EU4 A;  3M3Y H;  4DV4 Q;  2NVT H;  3C1E A;  2VL6 A;  4R8I A;  3J81 i;  3HOU G;  4JI1 Q;  1VQL A;  1WCM H;  3D6C A;  2VB2 X;  2XN9 C;  4JOI A;  2R7F A;  4MIU A;  5ELF A;  3S15 H;  4PMW A;  5KGU A;  3QWN A;  2VUM B;  4X66 L;  1PYS B;  4FXD A;  1YNJ D;  4H7B A;  3I4O A;  4LF8 Q;  3K59 A;  3HFZ B;  5E7N A;  2P5Z X;  2WAQ E;  4DAM A;  2CQO A;  4LF4 L;  2X69 A;  3CHB D;  4H0L C;  1PTO C;  2EOT A;  4AYB E;  1C48 A;  2QF7 A;  2ES2 A;  1KAB A;  3VA7 A;  2ZXO A;  1F2Z A;  5JAV A;  1SSO A;  1R9T B;  2JA6 H;  5CMD A;  5IYD H;  1VQF A;  3CCR A;  1YZ6 A;  2IPK D;  2LMC B;  2AUJ D;  4X65 Q;  3A0J A;  3AFP A;  2HHH Q;  4F88 A;  2B2T C;  2XRQ D;  4DV7 Q;  1PFN A;  2A6H C;  1GUS A;  3M7N A;  4HIO A;  2B2U C;  2UXB Q;  1DON A;  5IP7 G;  3G6J B;  2F0N A;  5IGD A;  2QKI C;  2Q8T A;  4C3J H;  3OOC A;  4A3K G;  2GN5 A;  4QY7 A;  3ND9 A;  2JEB I;  2UUB L;  4WJW A;  4KHV A;  5CV5 A;  3VYR A;  4OL7 A;  2FIN B;  5J22 A;  1PXU A;  3MHB A;  3PUV A;  5CV4 A;  4UDU C;  3TDQ A;  3BZK A;  1LO5 D;  2X6L A;  3GTJ H;  4B3S Q;  5C4X G;  2AMC B;  4I7Z C;  3PMF A;  2CWP A;  4M1U B;  3UDG A;  3MXP A;  3TS2 A;  1Q3L A;  4JBM A;  4JI7 L;  5JOB A;  4A3I G;  1EQQ A;  4YHH Q;  2PZU A;  5C4X H;  1TWF B;  2CKZ B;  1SND A;  2QCP X;  2NZH A;  5JJI A;  2EXD A;  4HMI A;  4JI8 L;  1PH7 A;  1KDA A;  5A35 A;  1I4X A;  2RF4 A;  4LF6 Q;  1GUG A;  3GD7 A;  2CW0 C;  4A3K H;  1SE2 A;  2E2J B;  1PTO H;  2A68 C;  5IOC A;  4X65 L;  1LT6 D;  1TXY A;  5CV9 A;  1E2V A;  2LY7 A;  3BVM A;  4FF2 A;  1S5D D;  1SNC A;  5IGG A;  5BR8 Q;  1NBW A;  1QB5 D;  2BE5 D;  2ENB A;  1EY5 A;  4BBR H;  2Y0S E;  4ZCK A;  2MQH A;  4OEM B;  1U0L A;  3LGJ A;  1MGS A;  2B2W A;  2ZXR A;  5EKK A;  2OQK A;  3KUP A;  2V4D A;  2X6G A;  3HOX B;  1V1P A;  4IUR A;  4JI0 L;  1IW7 D;  2RDF A;  4QB4 A;  3G48 A;  4FF3 A;  1XNQ L;  1JB3 A;  5C4J B;  1EY4 A;  2D62 A;  1E1O A;  2I07 B;  1U9R A;  2QA4 A;  3QO2 A;  3NBH B;  3K58 A;  1LT3 D;  2AQ1 B;  5FKA C;  4JVZ A;  2DNC A;  1S3O A;  1IBK L;  2AKW B;  4DR7 Q;  1UE5 A;  3PO2 B;  4FF1 A;  2VQF L;  1ZKO A;  2Q8I B;  4QGU A;  3S2H H;  3L3O C;  3C1F A;  2EY1 A;  1SYD A;  3I4L A;  4ZLT F;  4XQN A;  4X3K A;  4CDD C;  4JOI C;  1EY7 A;  1D5Z C;  5D3I B;  2NB0 A;  3VYT A;  5JEA G;  4LF9 Q;  4DK3 C;  2E74 C;  1QVC A;  1LTS D;  4KK7 A;  1JB7 A;  1PZI D;  2MFI A;  2KHI A;  2A73 B;  4TSS A;  3I4M G;  5EKL A;  2OQ0 A;  2CW0 D;  5IIF A;  1PTO B;  4JI5 L;  5CR3 A;  3S1R B;  3UDI A;  1PFB A;  3FVQ A;  1WTR A;  3CW2 C;  1HZ9 A;  1J9O A;  4L63 B;  2K5D A;  4KY6 A;  3CCV A;  4BWG B;  3RN2 A;  2WFW A;  4B3R L;  2K5W A;  1HA6 A;  1OXV A;  1AZP A;  4DNR B;  1KXL A;  1IBM Q;  4HJA A;  4A3C G;  1YI2 A;  3NQT A;  3J80 i;  1BOS A;  1LUZ A;  4XDX A;  1B9N A;  3X3N A;  3TP7 A;  4DGZ A;  4KV6 A;  4DAY A;  1K8A C;  2L15 A;  5ELC A;  2MNA A;  4WJ3 M;  5IP9 G;  1E1T A;  5BN3 A;  4DUY Q;  2DY7 A;  3GV3 A;  4CGY B;  1GUT A;  2B63 B;  3RZO B;  1EU3 A;  3EFX D;  4IPD A;  5E3F A;  1Q90 A;  4DFA A;  1BBW A;  3K8A A;  1GXD C;  2K32 A;  2AQ3 B;  3IL8 A;  1HNW Q;  5CV8 A;  4HTH A;  3G6E A;  2K1B A;  1BCP C;  1PRT D;  3UDF A;  2CQA A;  1EWH A;  1CZW A;  1STB A;  4R4C A;  4LUV A;  3HOV B;  1BUV T;  5D65 A;  5FK9 C;  2JQO A;  3M4P A;  4DR2 L;  1YIJ A;  5M3F B;  5CYU A;  1VQO A;  2C9O A;  2Y0S B;  1DGS A;  2SNS A;  1LT4 D;  1E0B A;  2F4V Q;  4QF4 A;  1PH2 A;  3H3V I;  3BDC A;  3QOL A;  3RMH A;  1X32 A;  2F0P A;  2FJ2 A;  3SK6 A;  1IXR A;  5EPL A;  3BZC A;  1MIU A;  4DK6 C;  3VR3 A;  1CHP D;  4DNT B;  3M7G A;  1EQR A;  4ZUI A;  5HUR A;  3TME A;  4J6H A;  1EFW A;  4UHV A;  4HJ9 A;  1ESF A;  2UUA L;  2ZT9 C;  1B50 A;  3HZX A;  1TU2 B;  1VQ5 A;  1BO0 A;  1GHJ A;  3JC6 6;  4DV3 L;  3GTK H;  4KTA A;  2B8F A;  5T1G A;  1CA5 A;  1FJG Q;  4AH6 A;  1HH2 P;  1W6K A;  4OGQ C;  5IGE A;  4I65 A;  1XJV A;  5ELN A;  4EGV A;  4IJH A;  2JA7 G;  3S24 A;  1SYG A;  1XPR A;  2RHQ B;  2I5M X;  3I8Z A;  1EEI D;  1H95 A;  3I2Z A;  5M5W H;  5K36 H;  1X9N A;  1AP0 A;  3F2C A;  2MPM A;  4YY3 L;  4GKJ L;  5JJL A;  1BCP F;  1YEZ A;  2A19 A;  3J81 E;  1YVC A;  3CRK C;  4JBK A;  5COY A;  4EQO A;  4A3J B;  4A3D G;  2LKV A;  3KLR A;  4CDC C;  4BBS G;  2KVM A;  4IUU A;  3KFU A;  3ICE A;  4PZ6 A;  1VQ4 A;  3ERO A;  1PH8 A;  4A3L G;  1XNR L;  5C44 H;  4MHE A;  4DUZ L;  2F0I A;  1TWH B;  4X62 Q;  3T56 B;  4DV0 L;  4R4Q A;  1SJH D;  4A3E G;  1QZG A;  4B3S L;  2K5H A;  2QEJ C;  1AFP A;  2N3S A;  3V2T A;  3SK8 A;  4C1N I;  4DV6 L;  3GTL H;  1QUQ A;  4BY7 G;  4BY1 H;  5NUC A;  1SRU A;  2JE6 I;  3I73 A;  4YWM A;  1U4L A;  3GTO H;  4XTC S;  4OIK A;  3K80 C;  3VYS A;  1TWA H;  3T1H L;  1EYD A;  3L9A X;  2O4X A;  1VCI A;  2YV5 A;  3VR4 A;  2N55 A;  1PZJ D;  3CCJ A;  4PZ7 A;  4LK1 C;  2EY6 A;  1KRT A;  2YTY A;  2QEX A;  5EBC A;  1VF7 A;  2DY8 A;  2JA5 H;  2GVB A;  3AQQ A;  4LF5 Q;  1EY8 A;  3G71 A;  4BY1 G;  1IYJ B;  3IRB A;  2UUA Q;  1SMX A;  2Q2I A;  1HRJ A;  4K8J A;  4K8I A;  4NXN L;  5FO9 B;  3VR2 A;  3I4N H;  2KCC A;  1EIY B;  3TQY A;  5FLM G;  1W3S A;  2FXQ A;  4G7Z C;  4GN5 A;  4A3G B;  4IOA A;  5IY0 A;  1B4O A;  1VQ6 A;  4P2C B;  1ENF A;  1TWF H;  2VZA A;  1J5E Q;  4KKU A;  2A8V A;  4U68 A;  3I56 A;  3S1N B;  1G91 A;  3NTI A;  1WTO A;  2F03 A;  3NSW A;  1FNV A;  3V05 A;  2ATW A;  4J15 A;  4R4T A;  1G6Z A;  1LYL A;  1Y1V H;  3CCU A;  4ODG A;  4QIW E;  5FJ8 H;  1SNP A;  3I4M H;  1HQM C;  2K14 A;  1Z6H A;  2B2T A;  2OEO A;  5J1Z A;  3QOJ A;  1HNX L;  1L0Y B;  4RHS A;  4PMC A;  4DV1 Q;  4POG A;  2F0D A;  2RDH A;  2ID0 A;  2R92 G;  1UUP A;  1A3T A;  3HGB A;  2K6A A;  4EX5 A;  3DWP A;  3U4Z A;  3PIO 3;  1F2L A;  4IFD J;  3QB3 A;  1LTR D;  1KLG D;  4J1M A;  2J0T D;  1H9J A;  3SVM A;  2WKD A;  3N52 A;  3TP6 A;  1MKH A;  1YNN C;  5E4W C;  3UI2 A;  3OW7 A;  4IUN A;  1VS0 A;  4LF9 L;  1BVS A;  5IYC G;  2NVQ H;  1QIL A;  2EY2 A;  4IUV A;  2GVA A;  4DN4 M;  5ELD A;  1Q1E A;  3R8B A;  4APV A;  3DUZ A;  4Q0F A;  4JI5 Q;  1D5M C;  1C4Q A;  3ER0 A;  4IQZ A;  5A2Q L;  3TZU A;  3ND8 A;  3HG9 A;  1Q12 A;  1UE6 A;  1SNO A;  5ISR A;  2EDG A;  1KTK A;  1ONL A;  1HZC A;  3GTG B;  1HFG A;  1SE3 A;  1A15 A;  1XMO Q;  4ME5 A;  4P74 A;  2AHO B;  1NTG A;  3S1N H;  2JA7 B;  4JBW A;  3KLS X;  4LFC Q;  1SRO A;  4J8Q A;  3I90 A;  5C0X G;  1SE8 A;  4GKK L;  2NZO A;  4ABN A;  4OWT B;  4B3T L;  4LAA A;  1O7L A;  1WTQ A;  1Z7T A;  1UNS A;  4NMZ A;  5IP9 H;  2WB1 B;  1EOT A;  3M4Y A;  4GS3 A;  4DR3 L;  2IX3 A;  3HOU B;  4IUT A;  2H1E A;  4H02 A;  5GAD C;  2VUM H;  1ENC A;  4GNX A;  2DJG C;  2XTI A;  2V1C C;  2QIL A;  3PQI A;  3BJU A;  4HCS A;  3IFT A;  3KF8 B;  3MXN B;  5DM7 3;  3HOW B;  1YHB A;  2K01 A;  5IYB H;  3FRP B;  3VYU A;  2R93 G;  3I91 A;  1L1O C;  1S5F D;  4AQY L;  1X54 A;  4DR2 Q;  5M3M G;  3CPW A;  3S17 B;  2NVY H;  4JC0 A;  2RSO A;  3ZYY X;  5JJZ A;  3I4N G;  3PIO A;  2WAQ G;  2EE1 A;  3TRZ A;  1NMG A;  1HR0 W;  1JCK B;  3Q22 A;  2G5D A;  2A6E C;  4RGN A;  1ILP A;  5C4X B;  3GTQ H;  3AU7 A;  1AW7 A;  4L5T A;  1B9M A;  4EVO A;  1HNZ L;  1YJN A;  2Q8R E;  4LF8 L;  2VY3 A;  1CSQ A;  1YNJ C;  1OO9 B;  2F0V A;  2L12 A;  1MJC A;  1DOM A;  1DD2 A;  4CKC A;  1HUN A;  3KDF B;  2F3W A;  2E5L L;  1ZYR D;  1BBU A;  3PUW A;  1HA5 A;  3HOY H;  2K75 A;  1VQD A;  1PZK D;  4QIW B;  1L1O A;  3NEM A;  4A4I A;  1JT8 A;  2IW3 A;  2A69 C;  4OXP A;  1Y8N B;  3TBI B;  1N32 Q;  5AJ3 L;  1A0I A;  3BVG A;  5C44 G;  4A76 A;  2N8N A;  1KC8 C;  1NY4 A;  3I55 A;  3FKI G;  3CCE A;  4JI6 L;  3EBE A;  1PFM A;  4GNX C;  1AEX A;  4F8M A;  4X64 L;  3H3V H;  4DR6 L;  1W6J A;  2F52 A;  4AIM A;  4IFD I;  1EIG A;  2B2Y C;  5F2D A;  1JJC B;  1XNQ Q;  4QCL A;  4HMJ A;  4BA1 I;  3K7A B;  4NXM Q;  3BS1 A;  4A3M B;  4P72 A;  5ELO A;  5EAY A;  2I0Q A;  1RL2 A;  4HID A;  3PCO B;  3CP0 A;  1EUJ A;  1EZ6 A;  4XYO A;  1B7Y B;  1SEB D;  2PW7 A;  3S2D H;  4IUQ A;  2DJF C;  4K6L A;  4OEL B;  3CRL C;  4DV6 Q;  2OWO A;  4N9P A;  3A54 A;  1WTP A;  3W3A A;  3HOU H;  3E9I A;  4DU9 A;  2PCF B;  4B9X A;  2BDO A;  4C3H H;  1O7Z A;  1SFO B;  1G51 A;  1ET9 A;  2DN8 A;  4G57 A;  3U9S A;  2BH2 A;  3CPF A;  3R3O A;  5KND A;  5T1I A;  2O5I C;  3S15 B;  1TKW B;  5GAE C;  2IJ0 A;  3NTK A;  3HOX G;  2YU9 H;  4A3B H;  4DAV A;  3GTL B;  2B63 H;  3RZO H;  3S14 B;  1C0A A;  4MNO A;  4KN4 C;  2EYJ A;  4C1N K;  4B3R Q;  2F0J A;  2KED A;  3WOF A;  1V43 A;  2F0Q A;  4P71 A;  4QMG A;  3HP3 A;  3GO5 A;  3CAM A;  1BF4 A;  1BCP B;  3Q0A A;  3NUC A;  2JXM B;  2FMC A;  2EYF A;  2PNR C;  4DR5 Q;  2R3Z A;  3F2D A;  1B3Q A;  3AFQ A;  3SEB A;  3J7A V;  1JE5 A;  4B3M L;  3K81 C;  1R4Q B;  1VQE A;  3AB9 A;  3DWA A;  4X64 Q;  4PQX A;  1B1Z A;  4DR6 Q;  4A3E H;  3ERQ A;  5E1F A;  4CDE C;  1FR3 A;  2OCE A;  1XPU A;  2KHJ A;  1JOQ A;  1PRT B;  3PO3 B;  5JEA J;  3H91 A;  2J7Z A;  1VQA A;  5IT9 c;  2C5C A;  4K6D A;  1XYI A;  1LV9 A;  2EJG C;  5EJW A;  3SK4 A;  1L1O B;  2LS0 1;  1A2T A;  4A3I B;  4S3S A;  5EGT A;  3D4W A;  4DR7 L;  1WTV A;  1G2T A;  5KYL A;  3SE0 A;  1X3G A;  1XPO A;  4JPB W;  3F8T A;  3GTM H;  2EYP A;  1IHZ A;  1I5F A;  3M9B A;  4O0A A;  2JA8 H;  1H9S B;  2JP1 A;  1CKM A;  1SR3 A;  1K8G A;  4NPS A;  1T5X D;  4LNQ A;  2Y0S G;  1EYG A;  1EY0 A;  1XMQ Q;  4IUP A;  5LMN L;  3MTS A;  2E2I B;  1UAP A;  2M9V A;  3PIP A;  4DAY B;  3EQL C;  4JI7 Q;  4RGT A;  4C3H B;  1NUC A;  3QIA A;  1QE6 A;  2L9H A;  2F3I A;  1N34 Q;  3J80 E;  1F2M A;  1NJI C;  1RTN A;  1CFM A;  4OX9 L;  3CME A;  2Q2H A;  1SMY D;  1Z47 A;  2F0M A;  1S72 A;  3I7F A;  1A8V A;  2PI2 E;  3MA2 B;  4P75 A;  3HOZ G;  4RMF A;  2MO0 A;  3W1B A;  4A3M H;  1EEF D;  1U4P A;  1OXX K;  2KEC A;  5C5L A;  3RNU A;  2UXC Q;  4UAI A;  2WKC A;  1VQK A;  3JAM c;  3ERS X;  3SXH A;  1JJG A;  2LSS A;  5CBE E;  4KHP L;  1D8L A;  3BDL A;  2RKS A;  2RQX A;  4UPA A;  3FPP A;  3HS0 C;  2UUB Q;  4EQN A;  2OF1 A;  1IBK Q;  2PNH A;  2XVS A;  1GUO A;  2IWH A;  5JJK A;  3I4N B;  2RVL A;  1LAC A;  2B2Y A;  4DNI A;  1ESR A;  3T1Y Q;  3OHX C;  4IPC A;  1CHQ D;  2ZJR A;  3I70 A;  3MEH A;  1IL8 A;  2VS1 A;  3OYY A;  1VMP A;  2NUC A;  2XWB B;  1RHP A;  2FFK B;  1E2W A;  3DXJ C;  1GUN A;  1GD7 A;  4JBJ A;  4A3C H;  3S1Q H;  1RCV D;  5BN5 A;  4POF A;  1I94 L;  1XXG A;  3F1Z A;  4X62 L;  1MI2 A;  1QZH A;  1I4R A;  1LTB D;  2A68 D;  3GTJ B;  1S5B D;  3IFD A;  1TY0 A;  1A63 A;  3GQB A;  3KBG A;  2NWG A;  3SK5 A;  1WYD A;  2WII B;  1QNU A;  4YHH L;  3H09 A;  1GOZ A;  1NR4 A;  3MFY A;  3MVV A;  4A3F G;  1PFS A;  4JG2 A;  5HY6 A;  2EIF A;  2R93 H;  3J81 L;  1MJE A;  5IGC A;  5IT9 L;  1N34 L;  3DM3 A;  4OO1 H;  1K0S A;  4A3J G;  2KA7 A;  4K2L A;  3PGZ A;  4L5R C;  4OX9 Q;  5C44 B;  4NP5 A;  3LWE A;  1YNN D;  2F0F A;  3GP7 A;  1TS3 A;  5LL6 S;  4CJ0 B;  5LL6 X;  4LF5 L;  2RCN A;  1PH9 A;  3H6M A;  3CC7 A;  2ZXP A;  4Y52 H;  4UP9 A;  3AEV A;  1X3Q A;  1I4Q A;  1PRT C;  2K33 A;  3PO3 G;  5M3F H;  1FNW A;  1G2S A;  4CHT B;  2AUK A;  4ME3 A;  3DWQ A;  1DOK A;  2L55 A;  1J8I A;  3FP9 A;  1VQC A;  4K14 A;  4JI2 L;  3DEP A;  1ZYR C;  2HCI A;  4FO2 A;  1KNE A;  3S16 B;  1HHV A;  2TSS A;  1M8A A;  3KOJ A;  3TEH B;  1HUM A;  3NWT A;  4RCO A;  4L5Q A;  3T1Y L;  2R6G A;  4RKL A;  1P8L A;  1N36 L;  1GJX A;  1GO3 E;  1O7I A;  3HEJ A;  4KI0 A;  1G8Z D;  5FLX E;  5KNC A;  1HNW L;  3EA6 A;  3STB C;  4LF7 Q;  3KF8 A;  2JA7 H;  5L37 A;  3ONA B;  4DV1 L;  4OWW B;  3RZD B;  1HJP A;  1VQ7 A;  4BXX H;  4BBS B;  2F0S A;  1RKN A;  1X3F A;  3P75 A;  2JN4 A;  1LTT D;  2I5L X;  4Y7N B;  2A6E D;  1T9H A;  1QUQ B;  5M5X B;  4ZUJ A;  4YCU A;  2K52 A;  1S5E D;  2UXD L;  4GLA C;  4WRD A;  1JOK A;  4A3J H;  2EJF C;  4IPG A;  3TN2 A;  1WCM G;  5M3M H;  1JE4 A;  3F2B A;  1VQI A;  1HZA A;  5JPN C;  4EQP A;  1TWC B;  2YYZ A;  1QWY A;  1RIP A;  1E22 A;  5GQO A;  4LFB L;  5IYB G;  1Q46 A;  2VQE Q;  3GTQ B;  1ASZ A;  2J4X A;  4NKL A;  3SR1 A;  5C3W A;  1I4P A;  1NE3 A;  2B39 A;  1PRT F;  2MHV A;  2E2H B;  5C3E B;  1N33 Q;  1SYE A;  3CC2 A;  2KCM A;  2VUM G;  1BXT A;  4YY3 Q;  1D7Q A;  4RGM A;  1VDZ A;  1FVI A;  1GM5 A;  1TS4 A;  1O78 A;  4AYB B;  2DUD A;  4X3U A;  3E9H A;  1S5C D;  1TT2 A;  4C3J G;  1U5K A;  2ICE C;  5I6Y A;  5M5Y H;  4K0K L;  1A2U A;  1JIC A;  5M9O A;  3HKS A;  1A62 A;  1K8O A;  4DV0 Q;  3CCM A;  4ID6 A;  1L0W A;  4YIJ A;  2K05 A;  2XSC A;  1F9Q A;  1AE2 A;  3NEN A;  1JR0 D;  2FHT A;  5IE8 A;  3RLN A;  1WTX A;  1B3A A;  3S17 H;  3K5N A;  2PZT A;  5EBD A;  1HTL D;  2PQA B;  4A3B G;  3VDY A;  1V9P A;  4DV2 L;  2PMZ E;  1PYW D;  2QW7 A;  1KDB A;  2PO4 A;  5ELE A;  2EZV A;  1EIH A;  4BXX G;  3CCQ A;  1XMQ L;  1P16 A;  2DGY A;  1KRS A;  4U67 3;  2C35 B;  2WAQ B;  2SOB A;  3PF4 A;  1CT1 D;  2WB1 G;  4TVA B;  1C7Y A;  4O2D A;  1IKM A;  4YWK A;  2Z6K A;  3NQI A;  5I9O A;  4A3L H;  2E5L Q;  4L6T B;  2K03 A;  5IYC H;  4HJ8 A;  1W2B A;  1G29 1;  1JC7 A;  2LXK A;  3BDO A;  5I2Y A;  5FLX c;  3NXW A;  4CKB A;  1H9M A;  5DNF A;  5H1S E;  3M4O B;  4QQB X;  5IOD A;  1F9S A;  4BBR G;  5HGQ A;  1LTA D;  2KCT A;  1IBL L;  3C3L A;  1Y1V G;  1D1I A;  1M4V A;  4K2K A;  2CVR A;  2SDF A;  4ZRZ A;  2F0G A;  1UE1 A;  2E8G A;  1EFI D;  2F0W A;  2PYK A;  1WVL A;  2F4I A;  3GV6 A;  2NVX H;  4YCV A;  1N32 L;  4ZK9 B;  3LX0 A;  2MGS A;  1CSP A;  1KHI A;  1KIX A;  3FPU B;  3J7A 5;  4DPG A;  4FDB A;  3S9W A;  1JJ2 A;  5BN4 A;  3J7Y W;  4BBR B;  3MWY W;  4KKS A;  2CCZ A;  4NXM L;  1RD9 D;  3D0F A;  3S14 H;  1I6H H;  4HED A;  3RLF A;  1TWG H;  2K5Q A;  3GTG H;  1IYU A;  1SAP A;  3TZD A;  2R7Z H;  4A3F B;  5C6A A;  3HOV G;  1YNX A;  2LFN A;  2E2D C;  3DMU A;  5DEH A;  4HJ5 A;  2IL8 A;  2B3G A;  2F0L A;  2HIX A;  1ASY A;  1II3 A;  1MSG A;  4LMQ D;  4ULL A;  3H0G G;  1PYB A;  2Z1C A;  1D6E C;  2D0O A;  1T5E A;  1KNA A;  1PA6 A;  3KJP A;  1DOL A;  1QOH A;  3QR8 A;  3RN5 A;  1JOO A;  2K28 A;  3DLL A;  2B63 G;  2NVQ B;  5KRU A;  3HOX H;  2QDL A;  4DR1 L;  3HOV H;  2NN6 I;  4KHZ A;  2KCN A;  2Z4I A;  3A8K E;  2H5X A;  2HD3 A;  3ITP A;  4QL5 A;  4WFN 3;  1SMY C;  1TS2 A;  4KJO A;  5CV7 A;  4Y7N H;  2CFM A;  1EIF A;  3D4D A;  3J81 c;  3P20 A;  2HCC A;  5J39 A;  4DR4 Q;  1YHQ A;  3H0G B;  1STE A;  4JI6 Q;  4A3M G;  1YHA A;  4C3J B;  2FMM A;  2EXZ A;  4C3H G;  4LFC L;  3T13 A;  4X6A H;  1R4P B;  4EQ5 A;  1M90 C;  4RHR A;  1EYA A;  3S1M B;  3LNN A;  1MSH A;  3K7A H;  3NBH A;  1TWG B;  4B3M Q;  5LMU Q;  1I6H B;  4XQQ A;  4NDX A;  2EYL A;  4HIM A;  1HPC A;  2KQ3 A;  3DM1 A;  1CKN A;  2EVB A;  2HDM A;  4R1J A;  4DF7 A;  4DR3 Q;  5D14 A;  5JVG 3;  1GUW A;  1EY9 A;  2DNE A;  4OIJ A;  2NBF A;  5JVH 3;  1NNX A;  4KD3 A;  3X3M A;  2MP1 A;  1SNQ A;  3KK7 A;  2F3V A;  2NN6 H;  1I4H A;  2R61 A;  5M5W B;  4LF7 L;  1K3R A;  3CC4 A;  3E0J A;  3CMA A;  5JEA H;  3OWF A;  1EWI A;  1V8Q A;  4CJ2 C;  5C3X A;  1FYC A;  1HCZ A;  3KYH C;  4KLK A;  2OXP A;  3GTK B;  3KF6 A;  3S16 H;  1CUK A;  3OMC A;  1IYV A;  1OTC A;  1XWE A;  3JAM i;  2ZTE A;  1K9M C;  1IZ6 A;  1TWA B;  1VQ9 A;  1HZB A;  2XGT A;  3FKI B;  4JW0 A;  4TKO B;  3T51 B;  1CZG A;  2E2I H;  1SBB B;  3RR5 A;  2CHB D;  1CTM A;  4LFB Q;  3S2H B;  2RSN A;  3NE5 B;  4MZ9 A;  3OTO Q;  4BY1 B;  5CBA E;  1ILQ A;  1UEB A;  4IZ8 A;  4LF4 Q;  3W1G A;  4A75 A;  2BA1 A;  2K50 A;  2G9H D;  3ULP A;  1ICF B;  2CWA A;  1Y8O B;  1K83 B;  1OXU A;  3K7U C;  5KNB A;  1E7Z A;  2NN6 G;  3M85 A;  2EYO A;  3NK9 A;  3FMC A;  3LWU A;  2RHS B;  4KKT A;  1SNM A;  3JAM E;  3PO2 H;  2L11 A;  2VXW A;  3CKI B;  3NWS A;  3TSS A;  3V96 A;  3K6O A;  4K0K Q;  5AJ3 Q;  5TSS A;  4ZKB B;  2F0H A;  1TVX A;  1C8C A;  2UXB L;  1CKO A;  4O42 A;  3EN2 A;  4CDF C;  1VQN A;  3MFG A;  1E3P A;  1C9O A;  1WFQ A;  1PH4 A;  2R7D A;  1UE7 A;  2NTS A;  3BYY B;  3A5Z B;  4BY7 B;  4G7O C;  4PG3 A;  2Z0S A;  3U50 C;  2N88 A;  2MJ8 A;  1E2Z A;  1Y14 B;  4C3I H;  5KEE A;  4JI4 L;  4KY7 A;  3ULL A;  3FDT A;  1LLR D;  1F9P A;  3OPO A;  2BCO A;  2F0U A;  1LM0 A;  4I7A A;  1Q86 C;  1HQR D;  3WDN A;  4A93 H;  4RCN A;  1YJW A;  1X3E A;  1O80 A;  3IAY A;  1YJ9 A;  2K7V A;  4IFD H;  2OT2 A;  3PIP 3;  3U58 A;  1E24 A;  4GLX A;  4KY5 A;  3TS0 A;  4RA8 A;  4LFA L;  2UUC L;  1AN8 A;  2G9D A;  1KDC A;  3TP8 A;  4X3S A;  3RLO A;  1K3B C;  1S40 A;  1GHK A;  2XWJ B;  1Y1W G;  1EWC A;  2A6H D;  5K5P A;  2HHH L;  3W5O A;  1WJJ A;  2Z9H A;  2NVX B;  4DA2 A;  2R92 B;  5IWA Q;  4QUC A;  5I6W A;  1RTO A;  5C3E H;  1KAW A;  1S4Z A;  3A74 A;  4DV5 L;  1VQJ A;  2BE5 C;  2ZM6 L;  3UDX A;  4GOP C;  3QJY A;  5I4D A;  3BZD B;  3TP5 A;  4BBS H;  4ZAI A;  4YCW A;  3CCS A;  5GAH C;  1PV4 A;  5IYD G;  3NPP A;  4DV7 L;  1JWS D;  4JCV E;  2ZTD A;  3SHL A;  3T16 A;  3OIQ A;  3EJI A;  1BNZ A;  1EQT A;  1X3P A;  1QNK A;  2JEA I;  1Q8K A;  2MO1 A;  3U4V A;  4JV5 Q;  4H13 C;  2UU9 Q;  4G4K A;  1WOC A;  2QDB A;  3OIP A;  5M5X H;  5DM6 3;  5LMN W;  3J80 L;  1OXS C;  2CH4 A;  3D3R A;  1R9T H;  2JA6 B;  4JI3 Q;  1U4R A;  3RZD H;  1Y1W H;  2KJX A;  1STA A;  1SE4 A;  2JA5 B;  4GN4 B;  3K5M A;  2EYH A;  1EQV A;  3L0O A;  2OTL A;  1UWV A;  2Z6K C;  1V1P B;  5GAG C;  4IFD G;  4DKA C;  1ET6 A;  3KF6 B;  2WV6 D;  2XNA C;  1FNU A;  2F0O A;  2HIV A;  3D4R A;  2UUC Q;  4HCE A;  4GNX B;  1I4G A;  1SYC A;  1ML0 D;  5FLM H;  2Q2T A;  2A1A A;  3K0X A;  3KLS A;  4FXK C;  2E75 C;  3Q6S A;  1WD0 A;  1PHJ A;  3A8J E;  4A3E B;  2N49 A;  1K28 A;  3GTO B;  2JA5 G;  3DHQ A;  1GVP A;  5LMN Q;  1FL0 A;  1AE3 A; 
#chains in the Genus database with same CATH homology
 1WCM B;  3RUZ A;  2B2W C;  2D2C C;  3P1H A;  2RA4 A;  1WD1 A;  3BVZ A;  1MBY A;  4RKB A;  2NVT B;  5CGK A;  5FOB B;  1F2Y A;  5FLX L;  1ZEQ X;  1PLF A;  1VF5 C;  5FO7 B;  4NW2 A;  3D31 A;  3NP8 A;  1KLU D;  1JWM D;  2SEB D;  4ZYS A;  3HOY B;  2PPB C;  2F0K A;  3OWE B;  1FD7 D;  2R93 B;  2L4N A;  4DAP A;  4TQU S;  4XXE A;  1Y8P B;  3WOE A;  3RD4 A;  2ICI A;  3NBI A;  4PMB A;  4ZKC B;  4L8J A;  1NCV A;  2Z4H A;  3VA5 A;  3HKZ B;  3K5O A;  3R2T A;  5K36 G;  3I4M B;  3PUZ A;  2B8G A;  4TRD A;  3C2P A;  5AFW A;  2NVY B;  5E4X A;  2A69 D;  3E5S A;  4FNF A;  2PW5 A;  1BDO A;  2L1B A;  1QCB D;  4GZY C;  4KN7 C;  5C0X I;  4KD4 A;  4C3I B;  4K5V A;  2MUY A;  1NR2 A;  3OMG A;  4X3T A;  2M2L A;  3R2I A;  4G7H C;  3CU7 A;  1ENA A;  3BG3 A;  1LTG D;  1ICW A;  3K5L A;  4R8N A;  3PUX A;  2PQE A;  3C46 A;  4N9T A;  2K04 A;  3A56 A;  2EYM A;  3URY A;  1SYF A;  4OHJ A;  1QJO A;  3OSO A;  1D5X C;  4K5X A;  3KBX A;  1I50 B;  2HDL A;  3F2U A;  3VR6 A;  1ROD A;  2EY5 A;  1Y69 U;  1TR5 A;  4KJN A;  4K5W A;  2XRS D;  2NTT A;  2R7Z B;  3I72 A;  3VR5 A;  5IGB A;  1CQF A;  3A55 A;  2KUM A;  4B9W A;  1TQO A;  4OO1 G;  2WIN B;  2VB3 X;  3A7L A;  1DM0 B;  1WTW A;  1H9K A;  1PDQ A;  3PV0 A;  2A5H A;  2O5J C;  1ZXT A;  2SNM A;  3MAQ A;  4A3B B;  5G3L D;  1HTP A;  1B53 A;  4FVM A;  1U4M A;  5LHY 1;  5FO8 B;  4C2M B;  2F0E A;  3MC0 B;  1DZ1 A;  4RAU C;  3SDZ A;  2D5D A;  2EPB A;  4RFB A;  1JQY D;  1XTC D;  4HAE A;  2PZW A;  4WOR A;  3R93 A;  1D1K A;  4HSP A;  4IN3 A;  1BBX C;  4OO1 I;  3Q24 A;  1DJR D;  1RF2 D;  2AWO A;  4E6I A;  2VNU D;  1Q8I A;  3H3V C;  1SYB A;  2B2U A;  1HXY D;  2XIW A;  4B08 A;  3S1Q B;  2O2L D;  1BCP D;  5KYI A;  1FGB D;  5EQ0 A;  5M3M B;  2H4O A;  3O13 A;  4O1N A;  2B2V C;  1I3Q B;  1EL0 A;  2WP8 J;  5COR A;  4JK1 C;  4V0B A;  1DCZ A;  4XT1 B;  5ELB A;  4CBV A;  4ILW A;  4C56 C;  4V19 0;  1DXM A;  3S2D B;  1STY A;  5G3L F;  4Z9C B;  1STN A;  2F0T A;  1LTI D;  1JWU D;  1H9S A;  1Y1V B;  2HQE A;  3MXU A;  1HFN A;  5M5Y B;  1LAB A;  3D6W A;  1NAP A;  2D9U A;  2NYZ D;  3QG1 A;  1STH A;  2AWN A;  4CJ1 B;  4XT3 B;  1MD2 D;  1KAA A;  2TMP A;  1STG A;  4A3D B;  2AQ2 B;  1CA6 A;  4Q5V A;  5C4H A;  4XIG S;  1BQQ T;  4F87 A;  3E6Z X;  5CC4 A;  2A74 C;  4PNY A;  4R9W A;  3K0Y A;  1PMR A;  1EZ8 A;  2IX0 A;  2B2V A;  3H94 A;  1SJE D;  1K8M A;  2EJM A;  1CK1 A;  4FXG C;  3HRZ C;  1XX8 A;  4CKE A;  5EPK A;  4HSV A;  3AMU A;  3N6R A;  4F7X A;  5EPJ A;  4DK1 A;  4FF4 A;  2IT1 A;  3Q23 A;  5IGF A;  1CI3 M;  4HN7 A;  4FP5 D;  3D8G A;  5C0X H;  3I3C A;  4FYD A;  1F9R A;  1NSN S;  3A7A B;  3FEW X;  5A2Q E;  2F1M A;  1TII D;  4DXF A;  1IKL A;  4M8A A;  3J7A F;  1H9R A;  1LT5 D;  4QUF A;  3IKJ A;  3PUY A;  1Q1B A;  4PV1 C;  5I9P A;  1CM9 A;  4DK0 A;  3HOZ B;  5CV6 A;  1A6X A;  3G7L A;  4BA2 I;  5KIX A;  1QG7 A;  3MXN A;  3K57 A;  1IW7 C;  3M3Y B;  1JOR A;  2RDG A;  1A3U A;  2PMZ B;  2L0C A;  2L5T A;  1RDP D;  4A3K B;  3DEO A;  5C0X J;  1Y1W B;  4MN3 A;  4A93 B;  5C5M A;  3NHH A;  2YU9 B;  2BA0 A;  1EY6 A;  3EVQ A;  5DAU A;  4RGO S;  3GTP B;  1B44 D;  1PTO F;  2BDN A;  5D3D A;  2KOL A;  2IX1 A;  2JSO A;  3W2D A;  1VMC A;  5EKI A;  5I2X A;  1SXT A;  4DXG A;  3JAM L;  2RBM A;  4RH6 A;  3U9O A;  2M00 A;  2KHS A;  1D2B A;  1DYQ A;  3MZ5 A;  1F77 A;  1TS5 A;  2WAC A;  2KEE A;  1TY2 A;  2JYO A;  1CQV A;  2NZ1 D;  2GA4 B;  1BR9 A;  3A8I E;  1O7Y A;  3NTH A;  1V1O A;  4HR7 B;  3T4A C;  2E76 C;  3MXG A;  2BOS A;  2JA8 B;  1EYC A;  3CQZ B;  3BYT B;  1A3V A;  3P7J A;  1OXT A;  1UEA B;  4H44 C;  4ZQ3 A;  1L0X B;  4XYQ A;  2I46 A;  1RJT A;  1PTO D;  5IT9 E;  4C3I G;  2HUG A;  3T53 B;  1SDF A;  5C4Z A;  4LJZ C;  4KMU C;  4BS9 A;  1AZQ A;  2Z8L A;  4IAL A;  1I6V C;  3L7Z C;  4RWS C;  4XQJ A;  5HGT A;  5JPM C;  3GTM B;  1B2T A;  1EU4 A;  3C1E A;  4R8I A;  3D6C A;  2VB2 X;  2XN9 C;  4MIU A;  5ELF A;  4PMW A;  5KGU A;  3QWN A;  2VUM B;  4FXD A;  1YNJ D;  4H7B A;  3K59 A;  2X69 A;  3CHB D;  4H0L C;  1PTO C;  2EOT A;  1C48 A;  2QF7 A;  1KAB A;  3VA7 A;  2ZXO A;  1F2Z A;  5JAV A;  1SSO A;  1R9T B;  5CMD A;  2IPK D;  2LMC B;  2AUJ D;  4F88 A;  2B2T C;  2XRQ D;  1PFN A;  2A6H C;  1GUS A;  3M7N A;  2B2U C;  1DON A;  3G6J B;  2F0N A;  5IGD A;  2QKI C;  2Q8T A;  3OOC A;  3ND9 A;  2JEB I;  4WJW A;  4KHV A;  5CV5 A;  3VYR A;  4OL7 A;  2FIN B;  5J22 A;  1PXU A;  3MHB A;  3PUV A;  5CV4 A;  4UDU C;  3TDQ A;  1LO5 D;  2X6L A;  4I7Z C;  3PMF A;  4M1U B;  3MXP A;  1Q3L A;  5JOB A;  2PZU A;  1TWF B;  1SND A;  2QCP X;  4HMI A;  1KDA A;  5A35 A;  1I4X A;  1GUG A;  3GD7 A;  2CW0 C;  1SE2 A;  2E2J B;  1PTO H;  2A68 C;  5IOC A;  1LT6 D;  5CV9 A;  1E2V A;  2LY7 A;  3BVM A;  4FF2 A;  1S5D D;  1SNC A;  5IGG A;  1QB5 D;  2BE5 D;  2ENB A;  1EY5 A;  1MGS A;  2B2W A;  2ZXR A;  5EKK A;  3KUP A;  2V4D A;  2X6G A;  3HOX B;  1V1P A;  4IUR A;  1IW7 D;  2RDF A;  4QB4 A;  4FF3 A;  1JB3 A;  5C4J B;  1EY4 A;  2D62 A;  2I07 B;  1U9R A;  3QO2 A;  3K58 A;  1LT3 D;  2AQ1 B;  5FKA C;  2DNC A;  3PO2 B;  4FF1 A;  1ZKO A;  2Q8I B;  3L3O C;  3C1F A;  2EY1 A;  1SYD A;  3I4L A;  4ZLT F;  4XQN A;  4X3K A;  1EY7 A;  1D5Z C;  5D3I B;  2NB0 A;  3VYT A;  5JEA G;  2E74 C;  4KK7 A;  1LTS D;  1PZI D;  2A73 B;  4TSS A;  5EKL A;  2CW0 D;  5IIF A;  1PTO B;  5CR3 A;  3S1R B;  1PFB A;  3FVQ A;  1WTR A;  1J9O A;  4L63 B;  2K5D A;  4KY6 A;  4BWG B;  2K5W A;  1HA6 A;  1OXV A;  1AZP A;  4DNR B;  3NQT A;  1BOS A;  4XDX A;  1B9N A;  3X3N A;  3TP7 A;  4DGZ A;  4KV6 A;  4DAY A;  5ELC A;  5BN3 A;  2DY7 A;  3GV3 A;  4CGY B;  1GUT A;  2B63 B;  3RZO B;  1EU3 A;  3EFX D;  5E3F A;  1Q90 A;  4DFA A;  1GXD C;  2K32 A;  2AQ3 B;  3IL8 A;  5CV8 A;  4HTH A;  2K1B A;  1BCP C;  1PRT D;  2CQA A;  1EWH A;  1CZW A;  1STB A;  3HOV B;  1BUV T;  5D65 A;  5FK9 C;  5M3F B;  5CYU A;  2C9O A;  2Y0S B;  2SNS A;  1LT4 D;  1E0B A;  4QF4 A;  3BDC A;  3QOL A;  3RMH A;  1X32 A;  2F0P A;  2FJ2 A;  3SK6 A;  5EPL A;  4DNT B;  3VR3 A;  1CHP D;  3M7G A;  4ZUI A;  5HUR A;  3TME A;  4J6H A;  1ESF A;  2ZT9 C;  1B50 A;  3HZX A;  1TU2 B;  1BO0 A;  1GHJ A;  4KTA A;  2B8F A;  5T1G A;  1CA5 A;  5IGE A;  1W6K A;  4OGQ C;  4I65 A;  4EGV A;  1SYG A;  3I8Z A;  1EEI D;  5K36 H;  1AP0 A;  2MPM A;  1BCP F;  3J81 E;  3CRK C;  5COY A;  4EQO A;  4A3J B;  2LKV A;  3KLR A;  2KVM A;  4IUU A;  3ERO A;  4MHE A;  2F0I A;  1TWH B;  3T56 B;  1SJH D;  2QEJ C;  1AFP A;  3V2T A;  3SK8 A;  4C1N I;  5NUC A;  2JE6 I;  3I73 A;  1U4L A;  4XTC S;  4OIK A;  3VYS A;  1EYD A;  3L9A X;  2O4X A;  1VCI A;  3VR4 A;  2N55 A;  1PZJ D;  4LK1 C;  2EY6 A;  5EBC A;  1VF7 A;  2DY8 A;  1EY8 A;  1HRJ A;  4K8J A;  4K8I A;  5FO9 B;  3VR2 A;  2KCC A;  4G7Z C;  4A3G B;  1B4O A;  4P2C B;  1ENF A;  4KKU A;  4U68 A;  3S1N B;  1G91 A;  3NTI A;  1WTO A;  2F03 A;  3NSW A;  1FNV A;  3V05 A;  1G6Z A;  4ODG A;  1SNP A;  1HQM C;  1Z6H A;  2B2T A;  2OEO A;  5J1Z A;  3QOJ A;  1L0Y B;  4RHS A;  4PMC A;  2F0D A;  2RDH A;  2ID0 A;  1UUP A;  3HGB A;  1A3T A;  2K6A A;  3DWP A;  3PIO 3;  1F2L A;  4IFD J;  3QB3 A;  1LTR D;  1KLG D;  4J1M A;  2J0T D;  1H9J A;  3SVM A;  2WKD A;  3N52 A;  3TP6 A;  3UI2 A;  1YNN C;  5E4W C;  3OW7 A;  4IUN A;  1QIL A;  2EY2 A;  4IUV A;  4DN4 M;  5ELD A;  1Q1E A;  3R8B A;  3DUZ A;  4Q0F A;  1D5M C;  1C4Q A;  4IQZ A;  5A2Q L;  3TZU A;  3ND8 A;  3HG9 A;  1Q12 A;  1SNO A;  5ISR A;  2EDG A;  1KTK A;  1ONL A;  3GTG B;  1HFG A;  1SE3 A;  1A15 A;  4ME5 A;  2JA7 B;  4JBW A;  3KLS X;  4J8Q A;  3I90 A;  5C0X G;  4ABN A;  4LAA A;  1O7L A;  1WTQ A;  1Z7T A;  1UNS A;  4NMZ A;  2WB1 B;  1EOT A;  3M4Y A;  2IX3 A;  3HOU B;  4IUT A;  2H1E A;  1ENC A;  2QIL A;  4HCS A;  3IFT A;  5DM7 3;  3HOW B;  2K01 A;  3FRP B;  3VYU A;  3I91 A;  1S5F D;  3S17 B;  2RSO A;  3ZYY X;  5JJZ A;  2EE1 A;  1JCK B;  3Q22 A;  2A6E C;  4RGN A;  1ILP A;  5C4X B;  3AU7 A;  1AW7 A;  1B9M A;  4EVO A;  2Q8R E;  1YNJ C;  1OO9 B;  2F0V A;  2L12 A;  1DOM A;  1DD2 A;  4CKC A;  1HUN A;  2F3W A;  1ZYR D;  3PUW A;  1HA5 A;  1PZK D;  4QIW B;  2IW3 A;  2A69 C;  1Y8N B;  3TBI B;  3BVG A;  1PFM A;  1AEX A;  4F8M A;  1W6J A;  4IFD I;  1EIG A;  2B2Y C;  5F2D A;  4QCL A;  4HMJ A;  4BA1 I;  3K7A B;  3BS1 A;  4A3M B;  1EZ6 A;  4XYO A;  1SEB D;  2PW7 A;  4IUQ A;  4K6L A;  3CRL C;  4N9P A;  3A54 A;  1WTP A;  3W3A A;  4DU9 A;  2PCF B;  4B9X A;  2BDO A;  1O7Z A;  1SFO B;  1ET9 A;  2DN8 A;  4G57 A;  3U9S A;  3R3O A;  5KND A;  5T1I A;  2O5I C;  3S15 B;  1TKW B;  2IJ0 A;  3NTK A;  4DAV A;  3GTL B;  3S14 B;  4KN4 C;  2EYJ A;  4C1N K;  2F0J A;  2KED A;  3WOF A;  1V43 A;  2F0Q A;  4QMG A;  3HP3 A;  3GO5 A;  1BF4 A;  1BCP B;  3Q0A A;  3NUC A;  2JXM B;  2FMC A;  2EYF A;  2PNR C;  2R3Z A;  3SEB A;  3J7A V;  1R4Q B;  3AB9 A;  3DWA A;  4PQX A;  1B1Z A;  3ERQ A;  5E1F A;  1FR3 A;  1JOQ A;  1PRT B;  3PO3 B;  5JEA J;  3H91 A;  2J7Z A;  2C5C A;  4K6D A;  1XYI A;  1LV9 A;  2EJG C;  5EJW A;  3SK4 A;  2LS0 1;  1A2T A;  4A3I B;  4S3S A;  5EGT A;  3D4W A;  1WTV A;  1G2T A;  5KYL A;  3SE0 A;  2EYP A;  1IHZ A;  1H9S B;  2JP1 A;  1T5X D;  1EY0 A;  4IUP A;  3MTS A;  2E2I B;  1UAP A;  2M9V A;  3EQL C;  4RGT A;  4C3H B;  1NUC A;  3QIA A;  1QE6 A;  2L9H A;  3J80 E;  1F2M A;  1RTN A;  1CFM A;  1SMY D;  1Z47 A;  2F0M A;  3MA2 B;  1EEF D;  1U4P A;  1OXX K;  2KEC A;  5C5L A;  4UAI A;  2WKC A;  3SXH A;  5CBE E;  3BDL A;  2RKS A;  2RQX A;  3FPP A;  3HS0 C;  4EQN A;  2OF1 A;  2XVS A;  2IWH A;  1GUO A;  3I4N B;  2RVL A;  1LAC A;  2B2Y A;  1ESR A;  3OHX C;  1CHQ D;  3I70 A;  3MEH A;  1IL8 A;  1VMP A;  2NUC A;  2XWB B;  1RHP A;  2FFK B;  1E2W A;  3DXJ C;  1GUN A;  1RCV D;  5BN5 A;  1XXG A;  1MI2 A;  1I4R A;  1LTB D;  2A68 D;  3GTJ B;  1S5B D;  1TY0 A;  3IFD A;  3GQB A;  3KBG A;  2NWG A;  3SK5 A;  2WII B;  1QNU A;  3H09 A;  1GOZ A;  1NR4 A;  3MFY A;  3MVV A;  3J81 L;  5IGC A;  5IT9 L;  4OO1 H;  2KA7 A;  4K2L A;  5C44 B;  4NP5 A;  3LWE A;  1YNN D;  2F0F A;  3GP7 A;  1TS3 A;  5LL6 S;  4CJ0 B;  5LL6 X;  3H6M A;  2ZXP A;  1X3Q A;  1I4Q A;  1PRT C;  2K33 A;  1FNW A;  1G2S A;  4CHT B;  2AUK A;  3DWQ A;  1DOK A;  2L55 A;  1J8I A;  4K14 A;  3DEP A;  1ZYR C;  2HCI A;  4FO2 A;  1KNE A;  3S16 B;  1HHV A;  2TSS A;  1M8A A;  1HUM A;  3NWT A;  4RCO A;  2R6G A;  4RKL A;  1GJX A;  3HEJ A;  4KI0 A;  1G8Z D;  5FLX E;  5KNC A;  3EA6 A;  3KF8 A;  3ONA B;  3RZD B;  4BBS B;  2F0S A;  1RKN A;  3P75 A;  1LTT D;  4Y7N B;  2A6E D;  5M5X B;  4ZUJ A;  1S5E D;  4WRD A;  1JOK A;  2EJF C;  3TN2 A;  1JE4 A;  5JPN C;  4EQP A;  1TWC B;  2YYZ A;  1QWY A;  3GTQ B;  2J4X A;  4NKL A;  3SR1 A;  5C3W A;  1I4P A;  2B39 A;  1PRT F;  2MHV A;  2E2H B;  5C3E B;  1SYE A;  1BXT A;  4RGM A;  1VDZ A;  1TS4 A;  1O78 A;  4AYB B;  4X3U A;  1S5C D;  1TT2 A;  4C3J G;  2ICE C;  5I6Y A;  1A2U A;  1JIC A;  5M9O A;  1K8O A;  4ID6 A;  4YIJ A;  2K05 A;  2XSC A;  1F9Q A;  1JR0 D;  2FHT A;  1WTX A;  1B3A A;  3K5N A;  2PZT A;  5EBD A;  1HTL D;  1PYW D;  1KDB A;  2PO4 A;  5ELE A;  2EZV A;  1EIH A;  4U67 3;  2WAQ B;  2SOB A;  1CT1 D;  1IKM A;  3NQI A;  5I9O A;  4L6T B;  2K03 A;  1G29 1;  1JC7 A;  3BDO A;  5I2Y A;  3NXW A;  4CKB A;  1H9M A;  5DNF A;  3M4O B;  5IOD A;  1F9S A;  1LTA D;  3C3L A;  1D1I A;  1M4V A;  4K2K A;  2CVR A;  2SDF A;  4ZRZ A;  2F0G A;  1EFI D;  2F0W A;  2PYK A;  1WVL A;  2F4I A;  3GV6 A;  4ZK9 B;  3LX0 A;  2MGS A;  3FPU B;  3S9W A;  5BN4 A;  3J7Y W;  4BBR B;  3MWY W;  4KKS A;  1RD9 D;  4HED A;  3RLF A;  2K5Q A;  1IYU A;  1SAP A;  3TZD A;  4A3F B;  5C6A A;  2LFN A;  2E2D C;  3DMU A;  5DEH A;  2IL8 A;  2F0L A;  1II3 A;  1MSG A;  4LMQ D;  4ULL A;  2Z1C A;  1D6E C;  1T5E A;  1KNA A;  1DOL A;  1QOH A;  1JOO A;  2K28 A;  2NVQ B;  5KRU A;  2NN6 I;  4KHZ A;  2KCN A;  2Z4I A;  3A8K E;  3ITP A;  4WFN 3;  1SMY C;  1TS2 A;  4KJO A;  5CV7 A;  3D4D A;  3P20 A;  2HCC A;  5J39 A;  3H0G B;  1STE A;  4C3J B;  2FMM A;  2EXZ A;  4C3H G;  3T13 A;  1R4P B;  4RHR A;  1EYA A;  3S1M B;  3LNN A;  1MSH A;  3NBH A;  1TWG B;  1I6H B;  4XQQ A;  4NDX A;  2EYL A;  1HPC A;  2KQ3 A;  3DM1 A;  2EVB A;  2HDM A;  4DF7 A;  5D14 A;  5JVG 3;  1GUW A;  1EY9 A;  2DNE A;  4OIJ A;  2NBF A;  5JVH 3;  4KD3 A;  3X3M A;  2MP1 A;  1SNQ A;  2F3V A;  2NN6 H;  3KK7 A;  1I4H A;  2R61 A;  5M5W B;  3E0J A;  5JEA H;  3OWF A;  1V8Q A;  4CJ2 C;  5C3X A;  1FYC A;  1HCZ A;  2OXP A;  3GTK B;  3OMC A;  1IYV A;  1XWE A;  1TWA B;  3FKI B;  4TKO B;  3T51 B;  1CZG A;  1SBB B;  2CHB D;  1CTM A;  3S2H B;  2RSN A;  3NE5 B;  4BY1 B;  5CBA E;  1ILQ A;  4IZ8 A;  2BA1 A;  2G9H D;  1Y8O B;  1K83 B;  1OXU A;  5KNB A;  2NN6 G;  3M85 A;  2EYO A;  3NK9 A;  3FMC A;  3LWU A;  4KKT A;  1SNM A;  3JAM E;  2L11 A;  2VXW A;  3CKI B;  3NWS A;  3TSS A;  3V96 A;  3K6O A;  5TSS A;  4ZKB B;  2F0H A;  1TVX A;  1C8C A;  4O42 A;  3MFG A;  2NTS A;  3BYY B;  4BY7 B;  4G7O C;  2N88 A;  2MJ8 A;  1E2Z A;  5KEE A;  4KY7 A;  3FDT A;  1LLR D;  1F9P A;  3OPO A;  2BCO A;  2F0U A;  1HQR D;  3WDN A;  4RCN A;  1O80 A;  3IAY A;  2K7V A;  4IFD H;  2OT2 A;  3PIP 3;  4KY5 A;  4RA8 A;  1AN8 A;  2G9D A;  1KDC A;  3TP8 A;  4X3S A;  1GHK A;  2XWJ B;  1EWC A;  2A6H D;  5K5P A;  2NVX B;  4DA2 A;  2R92 B;  4QUC A;  5I6W A;  1RTO A;  1S4Z A;  2BE5 C;  3QJY A;  5I4D A;  3BZD B;  3TP5 A;  4ZAI A;  3NPP A;  1JWS D;  3SHL A;  3T16 A;  3OIQ A;  3EJI A;  1BNZ A;  1EQT A;  1X3P A;  1QNK A;  2JEA I;  4H13 C;  4G4K A;  2QDB A;  3OIP A;  5DM6 3;  3J80 L;  1OXS C;  3D3R A;  2JA6 B;  1U4R A;  2KJX A;  1STA A;  1SE4 A;  2JA5 B;  3K5M A;  2EYH A;  1EQV A;  1V1P B;  4IFD G;  1ET6 A;  2WV6 D;  2XNA C;  1FNU A;  2F0O A;  3D4R A;  4HCE A;  1I4G A;  1SYC A;  1ML0 D;  3KLS A;  4FXK C;  2E75 C;  3Q6S A;  1WD0 A;  3A8J E;  4A3E B;  3GTO B;  3DHQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...