5IGDA

Crystal structure of staphylococcal nuclease variant delta+phs t62h/i92e at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
b'LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFHKKMVENAKKIEVEFDKGQRTDKYGRGLAYEYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
molecule tags Hydrolase
source organism Staphylococcus aureus
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS T62H/I92E at cryogenic temperature
rcsb
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5igdA00
4K5WA 2F0NA 4NMZA 2F0VA 2F3VA 2O4XA 2LKVA 1STNA 2EYLA 4EQPA 4ZUIA 2SNMA 2EYJA 4K5VA 4K8IA 4K5XA 5J39A 1A3UA 5EGTA 1JOKA 5CGKA 4OL7A 2EY5A 2EXZA 5E3FA 3U9OA 5C3XA 5CV8A 4K14A 3D8GA 4ODGA 1F2YA 3SK5A 4HMJA 2EYHA 3EJIA 3LX0A 3TP6A 4NP5A 5IIFA 3OWFA 5JAVA 3OMCA 2F0PA 4KY5A 2EYOA 1F2MA 1SNMA 3MHBA 1TR5A 2PZWA 2F0TA 4KY7A 5CV7A 5J1ZA 5NUCA 2F3WA 3MEHA 4TRDA 1NUCA 5CV4A 1EYCA 1STHA 3QB3A 4K6DA 2NUCA 5C3WA 1IHZA 2F0HA 1A3VA 1II3A 3QOLA 3TP7A 4DF7A 2OF1A 1A2UA 4IALA 5KYIA 1EY6A 2EYFA 3OSOA 4EQNA 5IGDA 1A3TA 1STGA 1SNCA 4N9TA 2PYKA 3H6MA 4ID6A 4KJOA 2EY1A 2RKSA 4E6IA 1SNQA 2EYMA 5KEEA 2M00A 3DHQA 1EYDA 3PMFA 4NDXA 4WRDA 5C5LA 3TP5A 4B9WA 3QOJA 4K8JA 5CR3A 5IOCA 5I6YA 5IGBA 4IUNA 4HTHA 5I9PA 5HURA 3HZXA 2F0GA 3SR1A 4F8MA 2KQ3A 5I6WA 5IGFA 4DGZA 3MXPA 1RKNA 3NQTA 2QDBA 4G57A 5CV6A 3T13A 2F0SA 1EY0A 1SYCA 4J1MA 3SXHA 3C1EA 4PNYA 3BDCA 4WORA 5M9OA 3D6CA 5KRUA 2ENBA 4B9XA 3D4DA 5EKKA 1EY4A 5C4HA 1JOQA 3P1HA 4PMCA 2PW5A 3OMGA 5EKLA 5IODA 2SOBA 2WACA 4IZ8A 1A2TA 1STAA 4KD4A 2HQEA 1SNDA 5KIXA 5K5PA 1SYEA 4K2KA 5F2DA 3R3OA 1JORA 5KYLA 1EZ8A 2F0FA 2KHSA 2PZTA 2PZUA 1KDCA 3RUZA 3C1FA 3ERQA 2F0IA 4HMIA 1SNPA 1U9RA 3SHLA 2PW7A 2RBMA 3SK4A 3SK6A 3T16A 3VA5A 4KD3A 4I65A 5CV5A 2F0JA 3NP8A 1EZ6A 3DMUA 4ZUJA 3NXWA 5IGEA 1STBA 3SK8A 2F0KA 3D4WA 4DFAA 1STYA 2F0QA 4QB4A 2EYPA 4MIUA 4F7XA 5IGGA 3TP8A 4EVOA 5C5MA 1AEXA 1SNOA 3MVVA 4R8NA 3S9WA 3HEJA 4ZQ3A 2OXPA 4KV6A 4KTAA 4EQOA 5KGUA 1KAAA 4KJNA 5JOBA 3V2TA 5I9OA 5ISRA 3NUCA 4NKLA 2SNSA 5C4ZA 1KDBA 1SYGA 1EQVA 1ENCA 2F0OA 1EY5A 3NHHA 2F0WA 1JOOA 3ITPA 4LAAA 4H7BA 1EY9A 2EY2A 1ENAA 4K2LA 4KHVA 5E1FA 2OEOA 4N9PA 5DEHA 3EVQA 2PQEA 4KY6A 2RDFA 1SYBA 4ME5A 4QMGA 5IGCA 1TQOA 1TT2A 5C6AA 1F2ZA 2EY6A 3MZ5A 4RKBA 3TMEA 5J22A 3E5SA 1EY8A 1EYAA 1NSNS 2F0UA 1SYDA 3NK9A 4J6HA 4PMBA 4QF4A 2F0LA 4S3SA 5CV9A 5DAUA 1KABA 2F0DA 1KDAA 1EY7A 3EROA 2F0MA 4DU9A 5CC4A 5HGTA 4YIJA 3P75A 3BDLA 2F0EA 1SYFA 4RKLA
chains in the Genus database with same CATH superfamily
1PFMA 2NB0A 1LT5D 3A8KE 1EFID 4IOCA 1D5XC 4JI4Q 1STNA 5FK9C 4OO1G 4EQPA 4DXGA 3HS0C 5C0XG 4YHHL 4RA8A 3CCVA 5EJWA 1RJTA 1B44D 5DNFA 4B3MQ 4AIMA 2E74C 1HNWL 4FF2A 1ZYRC 5NUCA 3OYYA 1STHA 4UAIA 1I6HB 4QUFA 1MJEA 1QZHA 1BOSA 3X3NA 3PIO3 3GTKB 1BNZA 1TY0A 3P7JA 2E2JB 4JI5L 1EWHA 4Q5VA 3GTLH 1FNUA 3HOZG 2TMPA 4A3KB 1SNQA 3M4QA 2WB1E 3UDIA 3I70A 3RZDB 4O1NA 5T1IA 5IOCA 3I4NB 1VQBA 1STEA 4DK6C 4DR6Q 2F0GA 5ELCA 5D3IB 4YWMA 2KQ3A 4DNIA 3MAQA 2JA5G 3W3AA 3F2UA 1HR0L 4MZ9A 4NB3A 3BDCA 3MXUA 2VUMG 2GN5A 1YBYA 3UDGA 3K8AA 2PW5A 5IODA 1A2TA 5HY6A 3KDFB 1SYEA 3A7LA 4YWLA 1EZ8A 2A6ED 2PZUA 4A3BB 3RN5A 1LACA 3GP7A 2HCIA 3HOWG 3NSWA 1HUNA 3UE1A 1XMOQ 1U4MA 4L5SA 1HQMC 2WKDA 2Z4IA 2RVLA 5K36G 1DOMA 3KK7A 4DV6Q 1J9OA 1WTOA 1STYA 4TQUS 3CPFA 2VL6A 4EVOA 5C5MA 2X6LA 3MA2B 3KF8A 4AYBE 1CKNB 1N36L 1DJRD 2Z9HA 4RGMA 3NUCA 3MFYA 1MKHA 1E22A 1GJXA 4K2LA 1E2VA 3HG9A 3BZCA 3W1GA 5C44G 4KHPQ 3PO3B 3TEHB 1Y69U 2WAQE 4GKJL 1HJPA 4A3FG 2Q2HA 2DUDA 4JI2Q 1XMQL 2V4DA 3NK9A 4QY7A 2EOTA 3D31A 4L5QA 1XPRA 3S1MB 4PNYA 1VQ9A 1SYFA 3D4DA 2K03A 4P74A 2K04A 2L55A 1Q1BA 4ZUIA 1JT8A 3ZJYC 4P2CB 1TS2A 2XWBB 3PUZA 1X6OA 1YHBA 4OL7A 2AUJD 4DV5L 1Q82C 5JAVA 1HRJA 1SNMA 3NELA 1W6JA 4C2MB 4A93G 2Z4HA 4TRDA 1LTID 3A74A 2UXDL 4DF7A 2CQAA 2CH4A 4FF4A 4GOPA 2UUBQ 1GUNA 1B50A 1CZGA 3Q6SA 4ZAIA 2JA6H 2EYFA 2CFMA 1SE4A 2WAQG 2KA7A 4N9TA 3TDQA 2PYKA 2G9HD 1T5XD 1I5FA 2WB1G 4DV5Q 4B3RQ 4QCLA 1YITA 1C4QA 4K8JA 3HOYG 2X69A 3FEWX 4M8AA 1VQDA 3KBGA 3QJYA 1VQFA 2H4OA 4A75A 1H95A 4BXXH 1JE4A 1S5DD 1JMCA 2JA6G 2LY7A 1EEFD 1F77A 2WV6D 1FJGL 1NR2A 2B39A 3R93A 4QIWE 4HIDA 2DN8A 1TY2A 5JEAG 5F2DA 1B8AA 1QOHA 4HMIA 3D0FA 1K8GA 5FO9B 2BE5C 5D65A 3I72A 3PO2B 1VDZA 1Z9FA 4JYAL 4OONA 2E75C 1G2SA 4QB4A 2EYPA 1BXTA 1ZYRD 3DXJC 2QCPX 2LXJA 4OWTB 5D14A 5BN5A 1OTCA 4X3UA 3Q0AA 3DEOA 2OXPA 1LT3D 2KCTA 1XJVA 4AYBB 3CRLC 4APVA 1SE8A 1CFMA 1RTOA 3CMAA 2F0WA 1I6VC 3H0GG 3A56A 4GN4B 4TKOB 4YWKA 3EVQA 3RZOB 2K14A 4OO1I 1A6XA 2Z1CA 3LNNA 2R7DA 4A3DH 2F0UA 2IL8A 3VR4A 4X6AH 1WTPA 1QVCA 3KF6B 3BDLA 4UPAA 2PQAB 1PA6A 2LKVA 3T4AC 3Q8DA 3CCUA 1VQIA 5IP7H 1DOLA 3CKIB 4B3ML 1LTAD 4ODGA 1NMGA 5H1SE 3EJIA 2AKWB 1JB7A 1PZID 3BZDB 3EA6A 2UUCQ 3I4MG 3J81j 4L5TA 1AN8A 4KY7A 2MHVA 4IN3A 3E6ZX 4GNXC 1L2FA 2UXCQ 1QILA 1IHZA 1CHPD 2R61A 2Y0SG 1Y1WB 3I4MH 3TP7A 3G6EA 2A74C 5ELOA 1U4LA 4AQYL 1F2LA 5L37A 3K7AB 2JP1A 2QILA 1Y14B 1A3TA 3GTOH 4UY8C 2K1BA 4LF4L 4XTCS 1M1KC 4CKBA 4OWXB 1U4PA 3FKIB 3K5NA 3ONAB 4JI6L 4B08A 1PRTB 4YHHQ 1DONA 4PQXA 2B2TC 3H09A 2LXKA 4DV1L 2K5VA 2E2IH 1BKBA 4DGZA 2UUAL 3CCMA 4MTNA 2NVXH 2VW9A 1SFOB 1EY4A 1KRSA 4XDXA 4C1NI 1OXXK 3HKZE 1SEBD 1SROA 2A68C 5IE8A 2KCMA 4C3IG 2KHSA 4IPCA 3KLSX 1CKMA 1SDFA 3AQQA 1E24A 3GO5A 2UU9Q 1FL0A 2AHOB 1HXYD 2HCCA 2OT2A 2EVBA 2AQ3B 2ZM6L 4KD3A 4XYOA 3HOVH 4IUPA 2Z8LA 5M3MG 3NP8A 3IKJA 5G3LD 2UUCL 1QB5D 1IL2A 4OO1H 2FFKB 3D4WA 5M5WB 1EU4A 5IYCH 4QJFA 2K33A 1PYSB 1WFQA 2R93B 4JBMA 2PI2A 1EIGA 1BBWA 3SEBA 4A3GH 4FO2A 4GOPC 3NE5B 4ZQ3A 2WFWA 4KV6A 4JI1L 1I3QH 2HDMA 3MTSA 3U4VA 1KQSA 1I94L 1JE5A 4Y52H 2OEOA 5EQ0A 3S1NH 3UDXA 1MSHA 1VQOA 2I0QA 1LUZA 4IUVA 2EY6A 1YVCA 1PV4A 3F2BA 3MFGA 1D1KA 2HD3A 4IQZA 3KF6A 5DEHA 1MIUA 4DV3Q 4ZK9B 2KECA 4K5WA 3U9SA 5IWAQ 5GAGC 4GLXA 4LUVA 1YNNC 2NBFA 2R92H 2K5WA 3NTHA 1YHAA 3URYA 4DAYB 2IJ0A 1HTPA 3CPWA 1SLJA 5A2QL 1KC8C 2BH2A 5C44H 1J8IA 3PO2H 3GTKH 1UWVA 3S2HH 1E0BA 4OWWB 4BA2I 1JWMD 4IPDA 3NWTA 3MEHA 1N33Q 4JI8Q 1NUCA 2KHJA 4KI0A 2KVMA 4AQYQ 4LF9Q 1CSPA 2B8FA 2JXMB 1AFPA 2VY3A 4LF5L 4FNFA 2C5CA 2ZT9C 2PMZE 3OSOA 4C3HH 1FD7D 2N49A 4DR6L 2EYMA 1YNXA 4XT1B 1EWCA 2LFNA 2G5DA 4YCUA 1AZPA 3PO3G 3RD4A 3MXGA 1YI2A 3S2DB 1K8OA 1YNJD 3J81i 2WAQB 5CV6A 2A73B 2RQXA 2JN4A 1ESFA 2FMMA 1QNUA 5EKKA 2J4XA 4M1UB 1V43A 2L5TA 4DR5Q 5IT9c 1GKHA 5M5XH 3PGZA 3RUZA 2O5JC 1UE5A 2HT1A 3IFTA 4DR3Q 4ABNA 4LFCQ 1D5MC 2RBMA 1O78A 5BN3A 1PH3A 1XPUA 1RIPA 4JI7Q 2F0JA 3NXWA 2F03A 5IGEA 2RSNA 3U50C 2MO0A 2JA7G 1LTBD 3QWNA 4POFA 2K32A 5LMNW 2D2CC 4KTAA 2JEBI 3SGIA 1M8AA 5M3MB 3I4OA 5ISRA 1EQVA 3BDOA 1EQQA 5CORA 3SVMA 1Q46A 1UE7A 1FR3A 2RDFA 1PFNA 2Q8TA 2JA7H 2FINB 3FPUB 3QG1A 2JA6B 1NSNS 4PMBA 2UU9L 1SMYD 3CRKC 4PG3A 2CCZA 5C4XG 2F0DA 5A2QE 5K5PA 4DV0L 5E3FA 2DNCA 1C7YA 1LLRD 1IBML 1Q1EA 2F3VA 2PO4A 1WOCA 1HCZA 2SNMA 1V1PB 1G6PA 2EIFA 4GOPB 1R4QB 5CGKA 4RGOS 3K58A 2OQ0A 3GDEA 3D8GA 4P73A 5EPJA 1B2TA 3PSIA 3WWVA 4J8QA 3NBHA 4FF1A 3KF8B 5C4XH 1QUQB 3CC7A 4A3DG 1D5ZC 4CHTB 5M3FG 1Y8PB 1A3VA 1FNVA 3QOLA 1JICA 5M5YB 4BBRG 4JCVE 3S1NB 5IGDA 3M7GA 4BY7H 1WTWA 3NENA 2MGSA 2RKSA 4DV1Q 1NAPA 4R4IA 5FLXE 3I4MB 3S15H 3NTIA 1G6ZA 4LF6L 5M3FH 3A5ZB 1ET6A 2ZTEA 2JQOA 2RHSB 1HZ9A 2EXDA 3PUXA 2KENA 2UXBL 1TS5A 1G291 4JOIA 1JOQA 3OMGA 5EKLA 3J7ZC 2SOBA 3I8ZA 3JC66 4K2KA 1X3GA 3HKSA 5IP9G 4JI3Q 2J7ZA 1RHPA 3DM1A 1IBMQ 3K59A 3SHLA 3S17B 1VQ6A 1SSOA 4LF7L 4JK1C 2KUMA 1YJWA 2R93H 5IP9H 2D9UA 3CCSA 3M85A 3NEMA 5EAYA 4DV4L 2DY7A 1CA5A 1AEXA 2R92B 4R8NA 3LWUA 2KCNA 3E9IA 4P72A 1G8ZD 2OWOA 1JQYD 1VQMA 4HSVA 2R7FA 2A1AA 4HJ9A 1I6HH 2QEJC 2NTTA 4LFCL 4NXNL 2XIWA 5C44B 3RLFA 4LFAL 1YJNA 3X3MA 3J7YW 3G4SA 3C46A 3HFZB 1V1PA 3K0XA 3T1HL 2PQEA 1TQOA 1IBLQ 4BBRB 1EYGA 3WOEA 2RDHA 3PF4A 5CV9A 1W2BA 1ILPA 3FMCA 5IYDG 1C8CA 1IYVA 1Y1VB 3HOUB 3I55A 1DOKA 5BR8L 2EQSA 3R8BA 4C3IB 2EYJA 4RH6A 1EIYB 4LJZC 1X9NA 3J7AF 1C48A 3LX0A 2A19A 4QGUA 2WP8J 1C9OA 2GVAA 1H9SA 1MI2A 1AP0A 1EYCA 1YIJA 4KK7A 4XQNA 3DEPA 1II3A 1VMPA 1WD1A 1BCPB 4H0LC 1V9PA 4LMQD 1Q8IA 4BY7B 3J80L 2H1EA 2L12A 2A69C 3BVZA 2E2HB 4MN3A 3OWEB 1PH8A 2E76C 2JA8G 1FGUA 3RN2A 3GTPH 3S1QH 3SE0A 1ASYA 2E2DC 1TWGH 3K6OA 1S4ZA 4FP5D 1KIXA 2Z6BA 4A76A 3K5OA 3OIQA 1VQ8A 1YHQA 1D8LA 2BA1A 2ENBA 3MXNA 3BVGA 1X55A 5EBCA 3OTOL 2F1MA 1X3FA 5KIXA 5LMNQ 1I94Q 1Q8KA 2PZTA 1WTQA 1SJED 1ZXTA 1ZKOA 3I2ZA 1O7ZA 1VQCA 1DD2A 1VQJA 3SK6A 3A0JA 1NE3A 2HIVA 1YJ9A 2XSCA 2Y0SE 1NMFA 2XRQD 2ICIA 3DWQA 3DMUA 1ILQA 4KKTA 4BY1G 1B3AA 2ZTDA 2RF4A 4F7XA 3BU2A 1Q7YC 1JWUD 3S1RH 4KKSA 1VQHA 3HEJA 3VR2A 5C3EB 1KRTA 5AJ3Q 3NWSA 3HP3A 1YEZA 2RCNA 3UI2A 4IFDI 4KHPL 3GQBA 1ENAA 1GUWA 3I4NG 1PRTF 2ID0A 3MZ5A 2MNAA 2Q2TA 2JA9A 1IYUA 3M4OH 1EYAA 1KDAA 4KHZA 2F0EA 3F2CA 2R7ZG 4A3EB 1TU2B 1BCPF 2C9OA 2NZ1D 2Q8RE 4DV6L 4CJ1B 3CC4A 3FKIG 1DZ1A 3E3XA 3DWPA 3VDYA 1CK1A 2QKIC 1R4PB 4A3KH 4B3SQ 2B2UC 4HMJA 1QNKA 1LV9A 2Y0SB 5J1ZA 4C2MH 1Y1WG 2F3WA 4LF8L 5CV4A 2MUYA 1UE1A 3CCJA 4B3TQ 5EPLA 1ONLA 2VQFL 3CAMA 1B4OA 1XNRL 2GA4B 1NBWA 2CQOA 1K8AC 2CH4W 2B2VC 1HFNA 4R4TA 2O2LD 3CCRA 5IY0A 1EOVA 1TWCH 4R4CA 3L7ZC 3PIPA 4FF3A 3KLRA 1F9RA 1SE2A 3TN2A 4Z9CB 3C1EA 2HHHQ 3Q22A 1HNZL 3JAMc 4I7AA 3STBC 3PUVA 1SNDA 3ICEA 1X3EA 2F0FA 3C1FA 3GTMH 4KMUC 4X62L 1A63A 3ZYYX 1X54A 2FJ2A 4CDDC 5IYCG 2R7ZB 2ZJQA 1QVGA 2PNRC 3M7NA 1RTNA 3VR6A 2VQFQ 1B70B 1GUSA 3JAME 3PV0A 3MVVA 5CMDA 1O7LA 1I4QA 4JYAQ 4O42A 5GROA 4Y7NB 1U0LA 5FJ8G 2XTIA 4MHEA 1JCKB 5I9OA 4X65L 4OX9Q 1RDPD 3VYRA 4IO9A 4YCWA 2VB3X 1ENCA 2WB1B 4DNTB 1JOOA 4X3SA 3J80E 1QWYA 1GXDC 2B2WC 4HJAA 4ALPA 1VQ4A 2ES2A 3J80i 3EIVA 5IGCA 5IP7G 3MXNB 5GAEC 4J15A 4JBJA 3T51B 4DAMA 1EY8A 5DAUA 4IURA 3T13A 1UEAB 2R92G 1AE2A 2F0MA 5ELEA 2YU9B 3M3YB 4RKLA 4XQQA 4H13C 1AW7A 4RGTA 5EKIA 1PH1A 1D1IA 2B2YA 1VCIA 4K8IA 1A3UA 4A3IB 3R2TA 2F52A 4X64L 5CV8A 4U673 3QO2A 4XXEA 5AJ3L 4LF8Q 1LABA 2EJFC 2CVRA 3GTJB 1AH9A 4GLAC 5ELFA 2KCCA 2YU9H 3M3YH 3I73A 3HOXH 3FP9A 4NW2A 1TWHB 2CW0C 3S16H 3J7A5 1WTHA 2NZOA 1SJHD 5I2YA 5KNDA 4B3TL 1F9SA 1PZJD 3KLSA 2MQHA 2NN6H 1MJCA 1OXUA 4AYBG 1S5CD 4DR7Q 3U4ZA 5I6YA 1RCVD 2EDGA 1IKMA 4A3MG 4OIKA 2ZJRA 4DUZL 2B8GA 3SR1A 2YV5A 1OXTA 4B3SL 3MXPA 2Q8IB 1VQAA 1WI5A 1K83H 1TWHH 5JJZA 1J5EQ 3CMEA 3F1ZA 1WTVA 3L9AX 3F8TA 5TSSA 1CQVA 5JPMC 3PQIA 4A3GG 1GHKA 4LF4Q 1U9RA 3NTKA 4CJ2C 3CCLA 3TS0A 1X3PA 1EIFA 4FYDA 4ZUJA 5A35A 5JVG3 1STBA 1WCMH 1HNWQ 3M4PA 5JPNC 1I4HA 3CCQA 2A69D 4HR7B 5T1GA 3S9WA 4JV5L 2CW0D 4JI0Q 2D0OA 1ET9A 4JI4L 2K5DA 2Z0SA 2SNSA 2LS01 4HIOA 1SFOH 1PTOH 4IFDJ 1KL9A 2N78A 5LMUQ 1BCPD 2JA8H 5FLXc 2XRSD 1I50B 3SDZA 3ERSX 1M4VA 1K9MC 2N55A 1BBXC 4C3JB 4X65Q 4YIJA 4JI7L 1HA5A 1PRTD 2F0NA 1E7ZA 2LSSA 5IYBH 2O4XA 1KD1C 1S72A 3AEVA 1EUJA 4F87A 2ASBA 4HJ5A 1IXRA 3TRZA 3H94A 2WIIB 3TP6A 2EYHA 4CDEC 1H9SB 3OWFA 3OMCA 5FLMG 4KY5A 1I3QB 2F0TA 2K5NA 1BBUA 1TS3A 5C3WA 3FHWA 1UNSA 2AUKA 2OTJA 4A3DB 4CDCC 2KBNA 5C4JH 2AMCB 3H0GH 3T56B 2R3ZA 1N33L 1XNQL 3GV3A 1HHVA 3I4LA 1VQNA 4DK3C 3L0OA 3BYYB 4BY1H 2M00A 2KJXA 2MO1A 2R6GA 2R7ZH 4IFDH 2EE1A 2K05A 3S1RB 5I2XA 2QEXA 1X65A 2QDBA 3NQTA 1Q81C 2SEBD 2HQLA 2PNHA 2NYZD 4YY3L 2VB2X 1R9TH 4DUYL 3W5OA 4A93B 1Q3LA 3BG3A 1PTOF 4IZ8A 4FXKC 1PHJA 1E1OA 4A3MB 1XNRQ 4IOAA 5E4XA 1HUMA 1KLUD 4JOIC 3SK4A 1TWCB 2Q2IA 4L63B 2UUBL 4DR1L 2D5DA 4DV3L 1CTMA 2PPBC 3KOJA 2K50A 1K0SA 3OIPA 2HIXA 3ND9A 1CI3M 4X64Q 1QG7A 4BS9A 1TS4A 4RAUC 2BA0A 4JI5Q 2UXBQ 4PMCA 4O0AA 1AE3A 1PTOD 1UAPA 4XIGS 3M9BA 4JI3L 3HOXB 2PCFB 1Y8OB 4GN3B 3HOZB 4DR2L 5GQOA 1B1ZA 2ZXRA 3W1BA 4DNRB 1PMRA 3TQYA 2JA5B 3ND8A 3OTOQ 1WD0A 4BBRH 1XYIA 1E3PA 3D3RA 1SAPA 1Q90A 1IKLA 2F0PA 4H02A 4R4QA 3NBHB 3MHBA 2DJFC 1Y1VH 2DJGC 1TWFH 1CM9A 4RGNA 3I56A 2NUCA 1GVPA 2F0HA 3EFXD 3E9HA 1FYCA 3CP0A 2JA7B 2UXCL 4O2DA 4A3FB 5KNCA 1P8LA 3AU7A 2K75A 4A3IH 1DGSA 1QJOA 4R4OA 1LT4D 2A8VA 1V1QA 1XNQQ 4HTHA 4A3LH 1N9WA 1ENFA 5JEAJ 3J81L 5C0XJ 4JI1Q 1O7YA 4WJ3M 3SXHA 5LHY1 5KRUA 2VS1A 3D4RA 5C4HA 3CU7A 1MBYA 5K36H 5JVH3 2HQEA 2NVQB 1RL2A 1PVOA 4RWSC 4LW1A 1KDCA 2F0IA 1PYBA 1PH2A 1HH2P 3STBD 4CKEA 4FXDA 3V05A 4OGQC 2E2HH 3A55A 1ASZA 2F0KA 4DFAA 2OQKA 5IWAL 4RMFA 3Q23A 3OPOA 1N32Q 5M3FB 1L0XB 1V1OA 1I4XA 5LMUL 4BBSG 1CA6A 1RD9D 5IT9L 4NPSA 4A3GB 5JOBA 4ILWA 3T1YL 1H9RA 1FGBD 1YNJC 1TXYA 2YTYA 4N9PA 3KJOA 2RHQB 1N8RC 1TT2A 4GNXA 1TIID 1I4PA 1WCMG 2JSOA 3J81c 4QF4A 3KJPA 2B2VA 2D0PA 4A3EG 4LF7Q 5CC4A 2ZJPA 3DUZA 2DY8A 2L1BA 2K5QA 1D6EC 1UEBA 3A5UA 2F0VA 2PQAA 3HKZB 4DV0Q 1KAWA 4HCSA 1I50H 3RZDH 4KN7C 4K5XA 3O13A 4LF5Q 5LL6X 3BYTB 2ALYB 3FRPB 4C1NK 2HHHL 4IUTA 5FOBB 2EY5A 3U9OA 4PZ6A 5CBAE 1F2YA 3AB9A 3CF5A 4GNXB 3IFDA 1HA6A 2ICEC 1XPOA 4X66Q 2EYOA 1HQRD 3CC2A 2L4NA 4A3EH 3J81E 4BXXG 5E7NA 1A8VA 3QB3A 4K6DA 4UHVA 1KXLA 2EJGC 1TWAH 3CCEA 1LTSD 2YYZA 3HOWH 1D7QA 1EQRA 1W6KA 4BWGB 2KHIA 4IALA 3WOFA 3KBXA 3FPPA 3DLLA 3K5LA 3H6MA 1BCPC 2DNEA 2E5LQ 2QGQA 3TP5A 1J6QA 1GD7A 1NJIC 5HURA 3D6WA 4F8MA 1PDQA 4C3JG 1Q86C 2I46A 2NVTB 2H5XA 1A15A 3H3VH 4JV5Q 1JJGA 3QIAA 1K83B 2E5LL 3JAML 1CKOA 3A8JE 3C3LA 2K5HA 2VXWA 2CHBD 3P1HA 4RCOA 1KHIA 2LMCB 3H15A 4A3CH 2IY5B 3QR8A 1E2ZA 1H9KA 3I4NH 3CW2C 1HNXQ 5D3DA 4IPGA 5ELNA 4PV1C 3M4YA 1BR9A 4A4IA 4EX5A 2VQEL 2F4VL 4C56C 1H9JA 4POGA 1BQQT 1PTOB 1SE3A 4Q0FA 1CHQD 3I90A 3HRZC 3KUPA 3HOWB 4LFBL 4A3KG 2K28A 4OXPA 4PZ7A 4EQOA 1KAAA 2NZHA 1JWSD 5C4ZA 1HTLD 1F9PA 1KDBA 1NR4A 2F0OA 4KKUA 3NHHA 4DAPA 1N36Q 3ITPA 2G9DA 3E0JA 1UUPA 4KY6A 1NY4A 1S5FD 1VQ7A 5C4JB 1KNEA 5LL6S 4RKBA 3VYTA 1QCBD 4RG1A 4TSSA 2AWNA 4EQ5A 2NWGA 2E2IB 4DV7Q 1KABA 3MWYW 3CHBD 5E4WC 2BDNA 3PIP3 4LNQA 1NCVA 1JOKA 2N88A 2L15A 1RODA 3U58A 5C3XA 1N34Q 3SK5A 2XWJB 1X56A 2IWHA 2K7VA 4NP5A 3OW2A 4MTKA 2FXQA 1WVLA 5CV7A 5JJKA 4HSPA 1Y1WH 2OTLA 4DUYQ 1XXGA 4YY3Q 1IZ6A 1F9QA 4ZCKA 1U5KA 2OF1A 5G3LF 1HR0W 3ULLA 5KYIA 3M4OB 2CKZB 1STGA 1T9HA 1VQGA 4ID6A 4V0BA 4E6IA 2B63H 2P5ZX 3DHQA 3PMFA 4WRDA 4NDXA 1U4RA 3PUYA 3RLNA 2N8NA 4JC0A 2I5HA 2MJ8A 2QW7A 1W3SA 4IUQA 3HZXA 2F4IA 4LF9L 1PYWD 5CYUA 3N52A 2N3SA 2NN6I 4CDFC 3LWEA 2TSSA 1EY0A 1A0IA 3KDFA 4N8X1 3ER0A 3AYHB 4UP7A 2VUMH 4PZ8A 3VA7A 2B63G 5J3BA 2WACA 1O80A 4HAEA 1TKWB 3GTQH 4DR7L 1IYJB 3PUWA 3UE0A 3GTMB 3PIOA 3BZKA 1EQTA 2PW7A 3RNUA 2QDLA 1N34L 3RR5A 4ZKBB 3OHXC 2ZXPA 4JI6Q 2F0QA 2K01A 3GTLB 4MIUA 5IGGA 4NXNQ 4OIJA 4A3JG 1DYQA 3G48A 2MFIA 4R8IA 3GTQB 3V96A 1VF7A 1BF4A 1NTGA 2PI2E 1JJCB 4LUZA 4NKLA 2HUGA 2M9VA 1QVFA 4K6LA 4HJ8A 2RSOA 1VQKA 2B63B 3PO2G 2CWAA 3S16B 1S40A 2ZTCA 4IPHA 4OHJA 4QMGA 1L1OC 5FO8B 3TMEA 1HNXL 4A3FH 1G2TA 4S3SA 2F0LA 3OW7A 1EY7A 2ZM6Q 1J5EL 1JB3A 1L0YB 4A3BH 1V8QA 4IUUA 1IBKQ 4NXMQ 2EYLA 2NN6G 4WJ4A 1GUTA 3TZUA 4K5VA 3L2PA 2IX1A 1B7YB 2I07B 3H0GB 1S5ED 2UXDQ 5M9OA 2NVTH 4AH6A 3A54A 1F2MA 1PFSA 1I4RA 2UUAQ 3S2DH 3HKZG 4XQJA 2XVSA 4MNOA 2A68D 4P75A 1HFGA 2B2UA 5IYDH 4GZYC 3CXCA 3BJUA 1BO0A 1PZKD 4ZYSA 3CQZB 3PF5A 1Z47A 2EZVA 4G7OC 1BVSA 4KJOA 2EY1A 3EQLC 3CD6A 2HDLA 2O5IC 3K7UC 5CR3A 4U68A 1EU3A 1ZEQX 1PLFA 1TVXA 4JPBW 1I4GA 2KEDA 3NPPA 3EN2A 5C3EH 3S1MH 5I6WA 5IGFA 1RKNA 2VUMB 5FLXL 3TZDA 5AFWA 3AFPA 3D6CA 1E1TA 3KYHC 2AWOA 1BDOA 3K7AH 4X62Q 2B3GA 4FXGC 5M3MH 3R3OA 1JORA 3R2IA 4JI2L 3ERQA 1OO9B 1TWFB 3RLOA 2AQ2B 3G7LA 5BR8Q 3VA5A 2IT1A 3MEFA 2VQEQ 5C0XI 4TVAB 2F4VQ 1PTOC 1GUOA 4GKKQ 1S5BD 1R9TB 4G4KA 1CUKA 1LM0A 1H9MA 1B9MA 1GO3E 5IYBG 1WYDA 1MSGA 3T1YQ 1SNOA 4R1JA 4R9WA 2EJMA 1E2WA 1K3RA 2XN9C 1P16A 2GVBA 4DN4M 1CQFA 1QZGA 1GUGA 5KGUA 4DR1Q 3V2TA 3TBIB 2NTSA 3L3OC 1EY5A 4OX9L 3RZOH 1PRTC 1SYBA 2IX0A 4ME5A 2K4KA 5ELBA 5FO7B 2MPMA 1Y8NB 3E5SA 4A3CG 3A7AB 3C2PA 4ULLA 1ESRA 3K81C 2RA4A 4QIWB 2QA4A 3GD7A 4GS3A 4LFAQ 5HGQA 4JI0L 1JC7A 5IT9E 5DM73 1HR0Q 4L6TB 4DV7L 1ICWA 1X32A 1K0RA 2QF7A 1XMQQ 3FVQA 2EXZA 1IBKL 4KLKA 2WINB 5IIFA 4DV4Q 1Z6HA 4HN7A 1FVIA 1RF2D 3AMUA 4KN4C 1B53A 4H44C 3S1QB 3P20A 4RCNA 2R93G 1WTRA 3TS2A 5ELDA 3S14H 5KNBA 4DK1A 2L0CA 4DK0A 4GLVB 4ME3A 4QQBX 4UP9A 1PH9A 3PO3H 4EQNA 4BA1I 1LT6D 4CKCA 3OOCA 2NVYH 5JJIA 1FJGQ 1IBLL 1MHWC 1Q12A 5KEEA 2Q2UA 3T1HQ 4RFBA 3QOJA 2IW3A 2L9HA 2IPKD 1K73C 5I9PA 1G91A 4Y7NH 1A62A 2RDGA 1VMCA 1SYCA 4B3RL 4WFN3 4WORA 2F3IA 4ZKCB 1MGSA 3PCOB 4L5RC 3HOVB 1D2BA 3GV6A 1N32L 1JJ2A 1EL0A 1OXSC 1IW7D 3T16A 1EEID 1Z7TA 4RHSA 1EZ6A 3H3VI 4X66L 4ZRZA 1SBBB 2IHFA 2Z6KC 4BBSH 1S3OA 1LTTD 2X6GA 5CBEE 4HIMA 2FHTA 2VZAA 1L1OB 2Z6KA 3HOUH 4K0KL 3H3VC 4CGYB 1G51A 3GTJH 3VYSA 5FKAC 4N8FA 4V190 4HJ7A 3ULPA 5I4DA 4GKJQ 2DGYA 1SMXA 4A3JB 1EFWA 4I7ZC 2NVXB 4DXFA 5C6AA 1F2ZA 4BY7G 2FMCA 5J22A 3K5MA 1LYLA 1SYDA 1XMOL 4XYQA 5LMNL 1OXVA 1TWGB 3I3CA 2YTVA 3F2DA 1VF5C 4DAVA 1SMYC 4NMZA 4XT3B 1JR0D 4FDBA 3S2HB 1FNWA 1XX8A 4OEMB 3NQIA 1DCZA 1LTRD 4DUZQ 4HIKA 1M90C 4A3JH 4K14A 3VR5A 4B9XA 2D62A 2I5LX 2JK8A 4IJLA 1LO5D 2WKCA 2IHEA 1DM0B 2PZWA 3G6JB 3J7AV 1Y1VG 2MP1A 1C0AA 2VNUD 3KLWA 4QUCA 2JE6I 4DAYA 2JJQA 1A2UA 2BCOA 1EY6A 2V1CC 1VS0A 1HNZQ 3BS1A 3WDNA 2K6AA 2L11A 1K8MA 3A8IE 1BUVT 1EYDA 1PH6A 3W2DA 4B9WA 4LWCA 2A5HA 4A3BG 1UE6A 5IGBA 4IUNA 5COYA 2YTXA 4JBWA 3IRBA 1EWIA 4JVZA 1WTXA 1B3QA 4DA2A 5M5XB 2F0SA 4J1MA 5GAHC 4DV2L 4JG2A 1T5EA 4IFDG 2M2LA 4JW0A 2JA8B 1K3BC 1DXMA 1HPCA 3G71A 3DWAA 5C0XH 4C3HG 5BN4A 5EPKA 1SNPA 2XNAC 3HGBA 1CZWA 2J0TD 4DR3L 1HZAA 1PXUA 4JI8L 5CV5A 4G7ZC 2C35B 3IAYA 3BVMA 3SK8A 2NVYB 3JAMi 4LF6Q 1QE6A 2B2TA 1B9NA 3S17H 4EGVA 3VR3A 1VQEA 3I7FA 3E0EA 1HZBA 1AZQA 4LK1C 2OCEA 4A93H 3HOZH 4BY1B 4A3MH 4H7BA 3K57A 4DV2Q 4DR2Q 4KHVA 3GTOB 1SN8A 4C3HB 4DPGA 4F88A 4LFBQ 2JA5H 4RHRA 4J6HA 5EBDA 5C3EG 1O7IA 1LTLA 3EROA 4K0KQ 3P75A 2E8GA 2B29A 4DR4L 5JJLA 1K28A 3H91A 3LGJA 3S15B 1VQPA 2IX3A 3N6RA 5J39A 2JEAI 2XGTA 5M5WH 2RCFA 5EGTA 2A6HD 3J80c 3AFQA 1PH7A 5M5YH 3GTGB 3HOYB 4HEDA 1YNND 1TR5A 3TSSA 1IL8A 1ML0D 4ZLTF 5JEAH 1IW7C 3Q24A 1EIHA 2BDOA 4G7HC 3I91A 1WJJA 4UP8A 2AQ1B 3IL8A 3KFUA 3HOUG 1X3QA 3B6YA 1SRUA 4QL5A 4PMWA 1SNCA 4X3TA 3VYUA 2E2JH 5C5LA 5FJ8H 3S24A 1TWAB 3S14B 3K80C 1LTGD 1HZCA 1PFBA 2I5MX 4A3IG 2SDFA 1XTCD 2ZXOA 4C3JH 1ICFB 4NXML 1KNAA 1YZ6A 2BOSA 3EBEA 4G57A 4A3LG 1WCMB 4JBKA 1MD2D 4YCVA 1L0WA 3K0YA 4LUOA 1KLGD 1VQLA 1STAA 1CSQA 4KD4A 3TREA 4WJWA 3T53B 1L1OA 4GKKL 5KYLA 2A6HC 2EPBA 2B2WA 5FLMH 1XWEA 1SXTA 4DR4Q 1CT1D 4DKAC 1CKNA 3GTPB 4BBSB 1VQ5A 4I65A 5GADC 3FKIH 4L8JA 3UDFA 2BE5D 3FDTA 3MC0B 3CQZH 3NBIA 4CBVA 1SR3A 2A6EC 4OELB 2ATWA 2K52A 3TP8A 4GN5A 1KTKA 2KEEA 3DM3A 3RMHA 3HOXG 4HCEA 2PMZB 2JYOA 4KJNA 2KOLA 1NNXA 4FVMA 2B2YC 1GM5A 2NVQH 5DM63 1SYGA 4LAAA 1PH4A 1XTDA 2CWPA 1EY9A 1QUQA 2EY2A 5E1FA 3GTGH 3HOYH 4IJHA 5DLQE 3ULJA 4CJ0B 4UDUC 4C3IH 1GHJA 1PH5A 4P71A 4DR5L 4DU9A 5HGTA 2BH8A 4X3KA 3HOVG 1GOZA 1EOTA 5C4XB
chains in the Genus database with same CATH topology
1PFMA 2NB0A 1LT5D 3A8KE 1EFID 1D5XC 1STNA 5FK9C 4OO1G 4EQPA 4DXGA 3HS0C 5C0XG 4RA8A 5EJWA 1RJTA 1B44D 5DNFA 2E74C 4FF2A 1ZYRC 5NUCA 1STHA 4UAIA 1I6HB 4QUFA 1BOSA 3X3NA 3PIO3 3GTKB 1BNZA 1TY0A 3P7JA 2E2JB 1EWHA 4Q5VA 1FNUA 2TMPA 4A3KB 1SNQA 3I70A 3RZDB 4O1NA 5T1IA 5IOCA 3I4NB 1STEA 2F0GA 5ELCA 5D3IB 2KQ3A 3MAQA 3W3AA 3F2UA 3BDCA 3MXUA 2PW5A 5IODA 1A2TA 1SYEA 3A7LA 1EZ8A 2A6ED 2PZUA 4A3BB 1LACA 3GP7A 2HCIA 3NSWA 1HUNA 1U4MA 1HQMC 2WKDA 2Z4IA 2RVLA 5K36G 1DOMA 3KK7A 1WTOA 1J9OA 1STYA 4TQUS 4EVOA 5C5MA 2X6LA 3MA2B 3KF8A 1DJRD 4RGMA 3NUCA 3MFYA 1GJXA 4K2LA 1E2VA 3HG9A 3PO3B 1Y69U 2V4DA 3NK9A 2EOTA 3D31A 3S1MB 4PNYA 1SYFA 3D4DA 2K03A 2K04A 2L55A 1Q1BA 4ZUIA 4P2CB 1TS2A 2XWBB 3PUZA 4OL7A 2AUJD 5JAVA 1HRJA 1SNMA 1W6JA 4C2MB 2Z4HA 4TRDA 1LTID 4DF7A 2CQAA 4FF4A 1GUNA 1B50A 1CZGA 3Q6SA 4ZAIA 2EYFA 1SE4A 2KA7A 4N9TA 3TDQA 2PYKA 2G9HD 1T5XD 4QCLA 1C4QA 4K8JA 2X69A 3FEWX 4M8AA 3KBGA 3QJYA 2H4OA 1JE4A 1S5DD 2LY7A 1EEFD 1F77A 2WV6D 1NR2A 2B39A 3R93A 2DN8A 1TY2A 5JEAG 5F2DA 1QOHA 4HMIA 5FO9B 2BE5C 5D65A 3I72A 3PO2B 1VDZA 2E75C 1G2SA 4QB4A 2EYPA 1BXTA 1ZYRD 3DXJC 2QCPX 5D14A 5BN5A 4X3UA 3Q0AA 3DEOA 2OXPA 1LT3D 4AYBB 3CRLC 1CFMA 1RTOA 2F0WA 1I6VC 3A56A 4TKOB 3EVQA 3RZOB 4OO1I 1A6XA 2Z1CA 3LNNA 2F0UA 2IL8A 3VR4A 1WTPA 3BDLA 2LKVA 3T4AC 1DOLA 3CKIB 1LTAD 4ODGA 3EJIA 1PZID 3BZDB 3EA6A 1AN8A 4KY7A 2MHVA 4IN3A 3E6ZX 1QILA 1IHZA 1CHPD 2R61A 1Y1WB 3TP7A 2A74C 1U4LA 1F2LA 3K7AB 2JP1A 2QILA 1A3TA 2K1BA 4XTCS 4CKBA 1U4PA 3FKIB 3K5NA 3ONAB 4B08A 1PRTB 1DONA 4PQXA 2B2TC 3H09A 4DGZA 1SFOB 1EY4A 4XDXA 4C1NI 1OXXK 1SEBD 2A68C 4C3IG 2KHSA 3KLSX 1SDFA 3GO5A 1HXYD 2HCCA 2OT2A 2EVBA 2AQ3B 4KD3A 4XYOA 4IUPA 2Z8LA 3NP8A 3IKJA 5G3LD 1QB5D 4OO1H 2FFKB 3D4WA 5M5WB 1EU4A 2K33A 2R93B 1EIGA 3SEBA 4FO2A 3NE5B 4ZQ3A 4KV6A 2HDMA 3MTSA 2OEOA 5EQ0A 1MSHA 4IUVA 2EY6A 3MFGA 1D1KA 4IQZA 5DEHA 4ZK9B 2KECA 4K5WA 3U9SA 1YNNC 2NBFA 2K5WA 3NTHA 3URYA 2IJ0A 1HTPA 5A2QL 1J8IA 1E0BA 4BA2I 1JWMD 3NWTA 3MEHA 1NUCA 4KI0A 2KVMA 2B8FA 2JXMB 1AFPA 4FNFA 2C5CA 2ZT9C 3OSOA 1FD7D 2EYMA 4XT1B 1EWCA 2LFNA 1AZPA 3RD4A 3MXGA 3S2DB 1K8OA 1YNJD 2WAQB 5CV6A 2A73B 2RQXA 1ESFA 2FMMA 1QNUA 5EKKA 2J4XA 4M1UB 1V43A 2L5TA 3RUZA 2O5JC 3IFTA 4ABNA 1D5MC 2RBMA 1O78A 5BN3A 2F0JA 2F03A 3NXWA 5IGEA 2RSNA 1LTBD 3QWNA 2K32A 2D2CC 4KTAA 2JEBI 1M8AA 5M3MB 5ISRA 1EQVA 3BDOA 5CORA 3SVMA 1FR3A 2RDFA 1PFNA 2Q8TA 2FINB 3FPUB 3QG1A 2JA6B 1NSNS 4PMBA 1SMYD 3CRKC 2F0DA 5A2QE 5K5PA 5E3FA 2DNCA 1LLRD 1Q1EA 2F3VA 2PO4A 1HCZA 2SNMA 1V1PB 1R4QB 5CGKA 4RGOS 3K58A 3D8GA 5EPJA 1B2TA 4J8QA 3NBHA 4FF1A 1D5ZC 4CHTB 1Y8PB 1A3VA 1FNVA 3QOLA 1JICA 5M5YB 3S1NB 5IGDA 3M7GA 1WTWA 2MGSA 2RKSA 1NAPA 5FLXE 3I4MB 3NTIA 1G6ZA 1ET6A 3PUXA 1TS5A 1G291 1JOQA 3OMGA 5EKLA 2SOBA 3I8ZA 4K2KA 2J7ZA 1RHPA 3DM1A 3K59A 3SHLA 3S17B 1SSOA 4JK1C 2KUMA 2D9UA 3M85A 2DY7A 1CA5A 1AEXA 2R92B 4R8NA 3LWUA 2KCNA 1G8ZD 1JQYD 4HSVA 2QEJC 2NTTA 2XIWA 5C44B 3RLFA 3X3MA 3J7YW 3C46A 1V1PA 2PQEA 1TQOA 4BBRB 3WOEA 2RDHA 5CV9A 1ILPA 3FMCA 1C8CA 1IYVA 1Y1VB 3HOUB 1DOKA 3R8BA 4C3IB 2EYJA 4RH6A 4LJZC 3J7AF 1C48A 3LX0A 2WP8J 1H9SA 1MI2A 1AP0A 1EYCA 4KK7A 4XQNA 3DEPA 1II3A 1VMPA 1WD1A 1BCPB 4H0LC 4LMQD 1Q8IA 4BY7B 3J80L 2H1EA 2L12A 2A69C 3BVZA 2E2HB 4MN3A 3OWEB 2E76C 3SE0A 2E2DC 3K6OA 1S4ZA 4FP5D 3K5OA 3OIQA 2BA1A 2ENBA 3MXNA 3BVGA 5EBCA 2F1MA 5KIXA 2PZTA 1WTQA 1SJED 1ZXTA 1ZKOA 1O7ZA 1DD2A 3SK6A 2XSCA 2XRQD 3DWQA 2ICIA 3DMUA 1ILQA 4KKTA 1B3AA 4F7XA 1JWUD 4KKSA 3HEJA 3VR2A 5C3EB 3NWSA 3HP3A 3UI2A 4IFDI 3GQBA 1ENAA 1GUWA 1PRTF 2ID0A 3MZ5A 1IYUA 1EYAA 1KDAA 4KHZA 2F0EA 4A3EB 1TU2B 1BCPF 2C9OA 2NZ1D 2Q8RE 4CJ1B 1DZ1A 3DWPA 1CK1A 2QKIC 1R4PB 2B2UC 4HMJA 1QNKA 1LV9A 2Y0SB 5J1ZA 2F3WA 5CV4A 2MUYA 5EPLA 1ONLA 1B4OA 2GA4B 2B2VC 1HFNA 2O2LD 3L7ZC 4FF3A 3KLRA 1F9RA 1SE2A 3TN2A 4Z9CB 3C1EA 3Q22A 3PUVA 1SNDA 2F0FA 3C1FA 4KMUC 3ZYYX 2FJ2A 2R7ZB 2PNRC 3M7NA 1RTNA 3VR6A 1GUSA 3JAME 3PV0A 3MVVA 5CMDA 1O7LA 1I4QA 4O42A 4Y7NB 4MHEA 1JCKB 5I9OA 1RDPD 3VYRA 4DNTB 2VB3X 1ENCA 2WB1B 1JOOA 4X3SA 3J80E 1QWYA 1GXDC 2B2WC 5IGCA 3T51B 1EY8A 5DAUA 4IURA 3T13A 1UEAB 2F0MA 5ELEA 2YU9B 3M3YB 4RKLA 4XQQA 4H13C 1AW7A 4RGTA 5EKIA 1D1IA 2B2YA 1VCIA 4K8IA 1A3UA 4A3IB 3R2TA 5CV8A 4U673 3QO2A 4XXEA 1LABA 2EJFC 2CVRA 3GTJB 5ELFA 2KCCA 3I73A 4NW2A 1TWHB 2CW0C 1SJHD 5I2YA 5KNDA 1F9SA 1PZJD 3KLSA 2NN6H 1OXUA 1S5CD 5I6YA 1RCVD 2EDGA 1IKMA 4OIKA 2B8GA 3SR1A 1OXTA 3MXPA 2Q8IB 5JJZA 1WTVA 3L9AX 5TSSA 1CQVA 5JPMC 1GHKA 1U9RA 3NTKA 4CJ2C 1X3PA 4FYDA 4ZUJA 5A35A 5JVG3 1STBA 5JPNC 1I4HA 2A69D 4HR7B 5T1GA 3S9WA 2CW0D 1ET9A 2K5DA 2SNSA 2LS01 1PTOH 4IFDJ 1BCPD 2XRSD 1I50B 3SDZA 1M4VA 2N55A 1BBXC 4C3JB 4YIJA 1HA5A 1PRTD 2F0NA 2O4XA 4F87A 3H94A 2WIIB 3TP6A 2EYHA 1H9SB 3OWFA 3OMCA 4KY5A 1I3QB 2F0TA 1TS3A 5C3WA 1UNSA 2AUKA 4A3DB 3T56B 2R3ZA 3GV3A 1HHVA 3I4LA 3BYYB 2M00A 2KJXA 2R6GA 4IFDH 2EE1A 2K05A 3S1RB 5I2XA 3NQTA 2QDBA 2SEBD 2NYZD 2VB2X 4A93B 1Q3LA 3BG3A 1PTOF 4IZ8A 4FXKC 4A3MB 5E4XA 1HUMA 1KLUD 3SK4A 1TWCB 4L63B 2D5DA 2PPBC 1CTMA 3OIPA 3ND9A 1CI3M 1QG7A 4BS9A 1TS4A 4RAUC 2BA0A 4PMCA 1PTOD 1UAPA 4XIGS 3HOXB 2PCFB 1Y8OB 3HOZB 1B1ZA 2ZXRA 4DNRB 1PMRA 2JA5B 3ND8A 1WD0A 1XYIA 3D3RA 1SAPA 1Q90A 1IKLA 2F0PA 3MHBA 1CM9A 4RGNA 2NUCA 2F0HA 3EFXD 1FYCA 2JA7B 4A3FB 5KNCA 3AU7A 1QJOA 1LT4D 4HTHA 1ENFA 5JEAJ 3J81L 5C0XJ 1O7YA 3SXHA 5LHY1 5KRUA 3D4RA 5C4HA 3CU7A 1MBYA 5K36H 5JVH3 2HQEA 2NVQB 4RWSC 1KDCA 2F0IA 4CKEA 4FXDA 3V05A 4OGQC 3A55A 2F0KA 4DFAA 3Q23A 3OPOA 5M3FB 1L0XB 1V1OA 1I4XA 1CA6A 1RD9D 5IT9L 4A3GB 5JOBA 4ILWA 1H9RA 1FGBD 1YNJC 4N9PA 1TT2A 1TIID 1I4PA 2JSOA 4QF4A 2B2VA 5CC4A 3DUZA 2DY8A 2L1BA 2K5QA 1D6EC 2F0VA 3HKZB 4HCSA 4KN7C 4K5XA 3O13A 5LL6X 3BYTB 3FRPB 4C1NK 4IUTA 5FOBB 2EY5A 3U9OA 5CBAE 1F2YA 3AB9A 3IFDA 1HA6A 2ICEC 2EYOA 1HQRD 2L4NA 3J81E 3QB3A 4K6DA 2EJGC 1LTSD 2YYZA 1W6KA 4BWGB 4IALA 3WOFA 3KBXA 3FPPA 3K5LA 3H6MA 1BCPC 2DNEA 3TP5A 5HURA 3D6WA 4F8MA 1PDQA 4C3JG 2I46A 2NVTB 1A15A 3QIAA 1K83B 3JAML 3A8JE 3C3LA 2VXWA 2CHBD 3P1HA 4RCOA 2LMCB 1E2ZA 1H9KA 5D3DA 4PV1C 3M4YA 1BR9A 4C56C 1H9JA 1BQQT 1PTOB 1SE3A 4Q0FA 1CHQD 3I90A 3HRZC 3KUPA 3HOWB 2K28A 4EQOA 1KAAA 1JWSD 5C4ZA 1HTLD 1F9PA 1KDBA 1NR4A 2F0OA 4KKUA 3NHHA 4DAPA 3ITPA 2G9DA 3E0JA 1UUPA 4KY6A 1S5FD 5C4JB 1KNEA 5LL6S 4RKBA 3VYTA 1QCBD 4TSSA 2AWNA 2NWGA 2E2IB 1KABA 3MWYW 3CHBD 5E4WC 2BDNA 3PIP3 1NCVA 1JOKA 2N88A 1RODA 5C3XA 3SK5A 2XWJB 2IWHA 2K7VA 4NP5A 1WVLA 5CV7A 4HSPA 1XXGA 1F9QA 5G3LF 2OF1A 5KYIA 3M4OB 1STGA 4ID6A 4V0BA 4E6IA 3DHQA 3PMFA 4WRDA 4NDXA 1U4RA 3PUYA 2MJ8A 4IUQA 3HZXA 2F4IA 1PYWD 5CYUA 3N52A 2NN6I 3LWEA 2TSSA 1EY0A 3VA7A 2WACA 1O80A 4HAEA 1TKWB 3PUWA 3GTMB 1EQTA 2PW7A 4ZKBB 3OHXC 2ZXPA 2F0QA 2K01A 3GTLB 4MIUA 5IGGA 4OIJA 1DYQA 4R8IA 3GTQB 3V96A 1VF7A 1BF4A 4NKLA 2HUGA 2M9VA 4K6LA 2RSOA 2B63B 3S16B 4OHJA 4QMGA 5FO8B 3TMEA 1G2TA 4S3SA 2F0LA 3OW7A 1EY7A 1JB3A 1L0YB 1V8QA 4IUUA 2EYLA 2NN6G 1GUTA 3TZUA 4K5VA 2IX1A 2I07B 3H0GB 1S5ED 5M9OA 3A54A 1F2MA 1I4RA 4XQJA 2XVSA 2A68D 1HFGA 2B2UA 4GZYC 1BO0A 1PZKD 4ZYSA 3CQZB 1Z47A 2EZVA 4G7OC 4KJOA 2EY1A 3EQLC 2HDLA 2O5IC 5CR3A 4U68A 1EU3A 1ZEQX 1PLFA 1TVXA 1I4GA 2KEDA 3NPPA 5I6WA 5IGFA 1RKNA 2VUMB 5FLXL 3TZDA 5AFWA 3D6CA 2AWOA 1BDOA 4FXGC 3R3OA 1JORA 3R2IA 3ERQA 1OO9B 1TWFB 2AQ2B 3G7LA 3VA5A 2IT1A 5C0XI 1PTOC 1GUOA 1S5BD 1R9TB 4G4KA 1H9MA 1B9MA 1MSGA 1SNOA 4R9WA 2EJMA 1E2WA 2XN9C 4DN4M 1CQFA 1GUGA 5KGUA 3V2TA 3TBIB 2NTSA 3L3OC 1EY5A 1PRTC 1SYBA 2IX0A 4ME5A 5ELBA 5FO7B 2MPMA 1Y8NB 3E5SA 3A7AB 3C2PA 4ULLA 1ESRA 2RA4A 4QIWB 3GD7A 1JC7A 5IT9E 5DM73 4L6TB 1ICWA 1X32A 2QF7A 3FVQA 2EXZA 2WINB 5IIFA 1Z6HA 4HN7A 1RF2D 3AMUA 4KN4C 1B53A 4H44C 3S1QB 3P20A 4RCNA 1WTRA 5ELDA 5KNBA 4DK1A 2L0CA 4DK0A 4EQNA 4BA1I 4CKCA 1LT6D 3OOCA 1Q12A 5KEEA 4RFBA 3QOJA 2IW3A 2L9HA 2IPKD 5I9PA 1G91A 2RDGA 1VMCA 1SYCA 4WFN3 4WORA 4ZKCB 1MGSA 3HOVB 1D2BA 3GV6A 1EL0A 1OXSC 1IW7D 3T16A 1EEID 1Z7TA 4RHSA 1EZ6A 4ZRZA 1SBBB 2X6GA 1LTTD 5CBEE 2FHTA 3H3VC 4CGYB 3VYSA 5FKAC 4V190 5I4DA 4A3JB 4I7ZC 2NVXB 4DXFA 5C6AA 1F2ZA 2FMCA 5J22A 3K5MA 1SYDA 4XYQA 1OXVA 1TWGB 3I3CA 1VF5C 4DAVA 1SMYC 4NMZA 4XT3B 1JR0D 3S2HB 1FNWA 1XX8A 3NQIA 1DCZA 1LTRD 4K14A 3VR5A 4B9XA 2D62A 1LO5D 2WKCA 1DM0B 2PZWA 3G6JB 3J7AV 2MP1A 2VNUD 4QUCA 2JE6I 4DAYA 1A2UA 2BCOA 1EY6A 3BS1A 3WDNA 2K6AA 2L11A 1K8MA 3A8IE 1BUVT 1EYDA 3W2DA 4B9WA 2A5HA 5IGBA 4IUNA 5COYA 4JBWA 1WTXA 4DA2A 5M5XB 2F0SA 4J1MA 1T5EA 4IFDG 2M2LA 2JA8B 1DXMA 1HPCA 3DWAA 5C0XH 4C3HG 5BN4A 5EPKA 1SNPA 2XNAC 3HGBA 1CZWA 2J0TD 1PXUA 5CV5A 4G7ZC 3IAYA 3BVMA 3SK8A 2NVYB 1QE6A 2B2TA 1B9NA 4EGVA 3VR3A 1AZQA 4LK1C 4BY1B 4H7BA 3K57A 4KHVA 3GTOB 4C3HB 4F88A 4RHRA 4J6HA 5EBDA 3EROA 3P75A 3H91A 3S15B 2IX3A 3N6RA 5J39A 2JEAI 5EGTA 2A6HD 3GTGB 3HOYB 4HEDA 1YNND 1TR5A 3TSSA 1IL8A 1ML0D 4ZLTF 3Q24A 1IW7C 5JEAH 1EIHA 2BDOA 4G7HC 3I91A 2AQ1B 3IL8A 1X3QA 4PMWA 1SNCA 4X3TA 3VYUA 5C5LA 1TWAB 3S14B 1LTGD 1PFBA 2SDFA 1XTCD 2ZXOA 1KNAA 4G57A 2BOSA 1WCMB 1MD2D 3K0YA 1KLGD 1STAA 4KD4A 4WJWA 3T53B 5KYLA 2A6HC 2EPBA 2B2WA 1XWEA 1SXTA 1CT1D 3GTPB 4BBSB 4I65A 4L8JA 2BE5D 3FDTA 3MC0B 3NBIA 4CBVA 2A6EC 3TP8A 1KTKA 2KEEA 3RMHA 4HCEA 2PMZB 2JYOA 4KJNA 2KOLA 4FVMA 2B2YC 5DM63 1SYGA 4LAAA 1EY9A 2EY2A 5E1FA 4CJ0B 4UDUC 1GHJA 4DU9A 5HGTA 4X3KA 1GOZA 1EOTA 5C4XB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K5W A;  2F0N A;  4NMZ A;  2F0V A;  2F3V A;  2O4X A;  2LKV A;  1STN A;  2EYL A;  4EQP A;  4ZUI A;  2SNM A;  2EYJ A;  4K5V A;  4K8I A;  4K5X A;  5J39 A;  1A3U A;  5EGT A;  1JOK A;  5CGK A;  4OL7 A;  2EY5 A;  2EXZ A;  5E3F A;  3U9O A;  5C3X A;  5CV8 A;  4K14 A;  3D8G A;  4ODG A;  1F2Y A;  3SK5 A;  4HMJ A;  2EYH A;  3EJI A;  3LX0 A;  3TP6 A;  4NP5 A;  5IIF A;  3OWF A;  5JAV A;  3OMC A;  2F0P A;  4KY5 A;  2EYO A;  1F2M A;  1SNM A;  3MHB A;  1TR5 A;  2PZW A;  2F0T A;  4KY7 A;  5CV7 A;  5J1Z A;  5NUC A;  2F3W A;  3MEH A;  4TRD A;  1NUC A;  5CV4 A;  1EYC A;  1STH A;  3QB3 A;  4K6D A;  2NUC A;  5C3W A;  1IHZ A;  2F0H A;  1A3V A;  1II3 A;  3QOL A;  3TP7 A;  4DF7 A;  2OF1 A;  1A2U A;  4IAL A;  5KYI A;  1EY6 A;  2EYF A;  3OSO A;  4EQN A;  5IGD A;  1A3T A;  1STG A;  1SNC A;  4N9T A;  2PYK A;  3H6M A;  4ID6 A;  4KJO A;  2EY1 A;  2RKS A;  4E6I A;  1SNQ A;  2EYM A;  5KEE A;  2M00 A;  3DHQ A;  1EYD A;  3PMF A;  4NDX A;  4WRD A;  5C5L A;  3TP5 A;  4B9W A;  3QOJ A;  4K8J A;  5CR3 A;  5IOC A;  5I6Y A;  5IGB A;  4IUN A;  4HTH A;  5I9P A;  5HUR A;  3HZX A;  2F0G A;  3SR1 A;  4F8M A;  2KQ3 A;  5I6W A;  5IGF A;  4DGZ A;  3MXP A;  1RKN A;  3NQT A;  2QDB A;  4G57 A;  5CV6 A;  3T13 A;  2F0S A;  1EY0 A;  1SYC A;  4J1M A;  3SXH A;  3C1E A;  4PNY A;  3BDC A;  4WOR A;  5M9O A;  3D6C A;  5KRU A;  2ENB A;  4B9X A;  3D4D A;  5EKK A;  1EY4 A;  5C4H A;  1JOQ A;  3P1H A;  4PMC A;  2PW5 A;  3OMG A;  5EKL A;  5IOD A;  2SOB A;  2WAC A;  4IZ8 A;  1A2T A;  1STA A;  4KD4 A;  2HQE A;  1SND A;  5KIX A;  5K5P A;  1SYE A;  4K2K A;  5F2D A;  3R3O A;  1JOR A;  5KYL A;  1EZ8 A;  2F0F A;  2KHS A;  2PZT A;  2PZU A;  1KDC A;  3RUZ A;  3C1F A;  3ERQ A;  2F0I A;  4HMI A;  1SNP A;  1U9R A;  3SHL A;  2PW7 A;  2RBM A;  3SK4 A;  3SK6 A;  3T16 A;  3VA5 A;  4KD3 A;  4I65 A;  5CV5 A;  2F0J A;  3NP8 A;  1EZ6 A;  3DMU A;  4ZUJ A;  3NXW A;  5IGE A;  1STB A;  3SK8 A;  2F0K A;  3D4W A;  4DFA A;  1STY A;  2F0Q A;  4QB4 A;  2EYP A;  4MIU A;  4F7X A;  5IGG A;  3TP8 A;  4EVO A;  5C5M A;  1AEX A;  1SNO A;  3MVV A;  4R8N A;  3S9W A;  3HEJ A;  4ZQ3 A;  2OXP A;  4KV6 A;  4KTA A;  4EQO A;  5KGU A;  1KAA A;  4KJN A;  5JOB A;  3V2T A;  5I9O A;  5ISR A;  3NUC A;  4NKL A;  2SNS A;  5C4Z A;  1KDB A;  1SYG A;  1EQV A;  1ENC A;  2F0O A;  1EY5 A;  3NHH A;  2F0W A;  1JOO A;  3ITP A;  4LAA A;  4H7B A;  1EY9 A;  2EY2 A;  1ENA A;  4K2L A;  4KHV A;  5E1F A;  2OEO A;  4N9P A;  5DEH A;  3EVQ A;  2PQE A;  4KY6 A;  2RDF A;  1SYB A;  4ME5 A;  4QMG A;  5IGC A;  1TQO A;  1TT2 A;  5C6A A;  1F2Z A;  2EY6 A;  3MZ5 A;  4RKB A;  3TME A;  5J22 A;  3E5S A;  1EY8 A;  1EYA A;  1NSN S;  2F0U A;  1SYD A;  3NK9 A;  4J6H A;  4PMB A;  4QF4 A;  2F0L A;  4S3S A;  5CV9 A;  5DAU A;  1KAB A;  2F0D A;  1KDA A;  1EY7 A;  3ERO A;  2F0M A;  4DU9 A;  5CC4 A;  5HGT A;  4YIJ A;  3P75 A;  3BDL A;  2F0E A;  1SYF A;  4RKL A; 
#chains in the Genus database with same CATH topology
 1PFM A;  2NB0 A;  1LT5 D;  3A8K E;  1EFI D;  4IOC A;  1D5X C;  4JI4 Q;  1STN A;  5FK9 C;  4OO1 G;  4EQP A;  4DXG A;  3HS0 C;  5C0X G;  4YHH L;  4RA8 A;  3CCV A;  5EJW A;  1RJT A;  1B44 D;  5DNF A;  4B3M Q;  4AIM A;  2E74 C;  1HNW L;  4FF2 A;  1ZYR C;  5NUC A;  3OYY A;  1STH A;  4UAI A;  1I6H B;  4QUF A;  1MJE A;  1QZH A;  1BOS A;  3X3N A;  3PIO 3;  3GTK B;  1BNZ A;  1TY0 A;  3P7J A;  2E2J B;  4JI5 L;  1EWH A;  4Q5V A;  3GTL H;  1FNU A;  3HOZ G;  2TMP A;  4A3K B;  1SNQ A;  3M4Q A;  2WB1 E;  3UDI A;  3I70 A;  3RZD B;  4O1N A;  5T1I A;  5IOC A;  3I4N B;  1VQB A;  1STE A;  4DK6 C;  4DR6 Q;  2F0G A;  5ELC A;  5D3I B;  4YWM A;  2KQ3 A;  4DNI A;  3MAQ A;  2JA5 G;  3W3A A;  3F2U A;  1HR0 L;  4MZ9 A;  4NB3 A;  3BDC A;  3MXU A;  2VUM G;  2GN5 A;  1YBY A;  3UDG A;  3K8A A;  2PW5 A;  5IOD A;  1A2T A;  5HY6 A;  3KDF B;  1SYE A;  3A7L A;  4YWL A;  1EZ8 A;  2A6E D;  2PZU A;  4A3B B;  3RN5 A;  1LAC A;  3GP7 A;  2HCI A;  3HOW G;  3NSW A;  1HUN A;  3UE1 A;  1XMO Q;  1U4M A;  4L5S A;  1HQM C;  2WKD A;  2Z4I A;  2RVL A;  5K36 G;  1DOM A;  3KK7 A;  4DV6 Q;  1J9O A;  1WTO A;  1STY A;  4TQU S;  3CPF A;  2VL6 A;  4EVO A;  5C5M A;  2X6L A;  3MA2 B;  3KF8 A;  4AYB E;  1CKN B;  1N36 L;  1DJR D;  2Z9H A;  4RGM A;  3NUC A;  3MFY A;  1MKH A;  1E22 A;  1GJX A;  4K2L A;  1E2V A;  3HG9 A;  3BZC A;  3W1G A;  5C44 G;  4KHP Q;  3PO3 B;  3TEH B;  1Y69 U;  2WAQ E;  4GKJ L;  1HJP A;  4A3F G;  2Q2H A;  2DUD A;  4JI2 Q;  1XMQ L;  2V4D A;  3NK9 A;  4QY7 A;  2EOT A;  3D31 A;  4L5Q A;  1XPR A;  3S1M B;  4PNY A;  1VQ9 A;  1SYF A;  3D4D A;  2K03 A;  4P74 A;  2K04 A;  2L55 A;  1Q1B A;  4ZUI A;  1JT8 A;  3ZJY C;  4P2C B;  1TS2 A;  2XWB B;  3PUZ A;  1X6O A;  1YHB A;  4OL7 A;  2AUJ D;  4DV5 L;  1Q82 C;  5JAV A;  1HRJ A;  1SNM A;  3NEL A;  1W6J A;  4C2M B;  4A93 G;  2Z4H A;  4TRD A;  1LTI D;  3A74 A;  2UXD L;  4DF7 A;  2CQA A;  2CH4 A;  4FF4 A;  4GOP A;  2UUB Q;  1GUN A;  1B50 A;  1CZG A;  3Q6S A;  4ZAI A;  2JA6 H;  2EYF A;  2CFM A;  1SE4 A;  2WAQ G;  2KA7 A;  4N9T A;  3TDQ A;  2PYK A;  2G9H D;  1T5X D;  1I5F A;  2WB1 G;  4DV5 Q;  4B3R Q;  4QCL A;  1YIT A;  1C4Q A;  4K8J A;  3HOY G;  2X69 A;  3FEW X;  4M8A A;  1VQD A;  3KBG A;  3QJY A;  1VQF A;  2H4O A;  4A75 A;  1H95 A;  4BXX H;  1JE4 A;  1S5D D;  1JMC A;  2JA6 G;  2LY7 A;  1EEF D;  1F77 A;  2WV6 D;  1FJG L;  1NR2 A;  2B39 A;  3R93 A;  4QIW E;  4HID A;  2DN8 A;  1TY2 A;  5JEA G;  5F2D A;  1B8A A;  1QOH A;  4HMI A;  3D0F A;  1K8G A;  5FO9 B;  2BE5 C;  5D65 A;  3I72 A;  3PO2 B;  1VDZ A;  1Z9F A;  4JYA L;  4OON A;  2E75 C;  1G2S A;  4QB4 A;  2EYP A;  1BXT A;  1ZYR D;  3DXJ C;  2QCP X;  2LXJ A;  4OWT B;  5D14 A;  5BN5 A;  1OTC A;  4X3U A;  3Q0A A;  3DEO A;  2OXP A;  1LT3 D;  2KCT A;  1XJV A;  4AYB B;  3CRL C;  4APV A;  1SE8 A;  1CFM A;  1RTO A;  3CMA A;  2F0W A;  1I6V C;  3H0G G;  3A56 A;  4GN4 B;  4TKO B;  4YWK A;  3EVQ A;  3RZO B;  2K14 A;  4OO1 I;  1A6X A;  2Z1C A;  3LNN A;  2R7D A;  4A3D H;  2F0U A;  2IL8 A;  3VR4 A;  4X6A H;  1WTP A;  1QVC A;  3KF6 B;  3BDL A;  4UPA A;  2PQA B;  1PA6 A;  2LKV A;  3T4A C;  3Q8D A;  3CCU A;  1VQI A;  5IP7 H;  1DOL A;  3CKI B;  4B3M L;  1LTA D;  4ODG A;  1NMG A;  5H1S E;  3EJI A;  2AKW B;  1JB7 A;  1PZI D;  3BZD B;  3EA6 A;  2UUC Q;  3I4M G;  3J81 j;  4L5T A;  1AN8 A;  4KY7 A;  2MHV A;  4IN3 A;  3E6Z X;  4GNX C;  1L2F A;  2UXC Q;  1QIL A;  1IHZ A;  1CHP D;  2R61 A;  2Y0S G;  1Y1W B;  3I4M H;  3TP7 A;  3G6E A;  2A74 C;  5ELO A;  1U4L A;  4AQY L;  1F2L A;  5L37 A;  3K7A B;  2JP1 A;  2QIL A;  1Y14 B;  1A3T A;  3GTO H;  4UY8 C;  2K1B A;  4LF4 L;  4XTC S;  1M1K C;  4CKB A;  4OWX B;  1U4P A;  3FKI B;  3K5N A;  3ONA B;  4JI6 L;  4B08 A;  1PRT B;  4YHH Q;  1DON A;  4PQX A;  2B2T C;  3H09 A;  2LXK A;  4DV1 L;  2K5V A;  2E2I H;  1BKB A;  4DGZ A;  2UUA L;  3CCM A;  4MTN A;  2NVX H;  2VW9 A;  1SFO B;  1EY4 A;  1KRS A;  4XDX A;  4C1N I;  1OXX K;  3HKZ E;  1SEB D;  1SRO A;  2A68 C;  5IE8 A;  2KCM A;  4C3I G;  2KHS A;  4IPC A;  3KLS X;  1CKM A;  1SDF A;  3AQQ A;  1E24 A;  3GO5 A;  2UU9 Q;  1FL0 A;  2AHO B;  1HXY D;  2HCC A;  2OT2 A;  2EVB A;  2AQ3 B;  2ZM6 L;  4KD3 A;  4XYO A;  3HOV H;  4IUP A;  2Z8L A;  5M3M G;  3NP8 A;  3IKJ A;  5G3L D;  2UUC L;  1QB5 D;  1IL2 A;  4OO1 H;  2FFK B;  3D4W A;  5M5W B;  1EU4 A;  5IYC H;  4QJF A;  2K33 A;  1PYS B;  1WFQ A;  2R93 B;  4JBM A;  2PI2 A;  1EIG A;  1BBW A;  3SEB A;  4A3G H;  4FO2 A;  4GOP C;  3NE5 B;  4ZQ3 A;  2WFW A;  4KV6 A;  4JI1 L;  1I3Q H;  2HDM A;  3MTS A;  3U4V A;  1KQS A;  1I94 L;  1JE5 A;  4Y52 H;  2OEO A;  5EQ0 A;  3S1N H;  3UDX A;  1MSH A;  1VQO A;  2I0Q A;  1LUZ A;  4IUV A;  2EY6 A;  1YVC A;  1PV4 A;  3F2B A;  3MFG A;  1D1K A;  2HD3 A;  4IQZ A;  3KF6 A;  5DEH A;  1MIU A;  4DV3 Q;  4ZK9 B;  2KEC A;  4K5W A;  3U9S A;  5IWA Q;  5GAG C;  4GLX A;  4LUV A;  1YNN C;  2NBF A;  2R92 H;  2K5W A;  3NTH A;  1YHA A;  3URY A;  4DAY B;  2IJ0 A;  1HTP A;  3CPW A;  1SLJ A;  5A2Q L;  1KC8 C;  2BH2 A;  5C44 H;  1J8I A;  3PO2 H;  3GTK H;  1UWV A;  3S2H H;  1E0B A;  4OWW B;  4BA2 I;  1JWM D;  4IPD A;  3NWT A;  3MEH A;  1N33 Q;  4JI8 Q;  1NUC A;  2KHJ A;  4KI0 A;  2KVM A;  4AQY Q;  4LF9 Q;  1CSP A;  2B8F A;  2JXM B;  1AFP A;  2VY3 A;  4LF5 L;  4FNF A;  2C5C A;  2ZT9 C;  2PMZ E;  3OSO A;  4C3H H;  1FD7 D;  2N49 A;  4DR6 L;  2EYM A;  1YNX A;  4XT1 B;  1EWC A;  2LFN A;  2G5D A;  4YCU A;  1AZP A;  3PO3 G;  3RD4 A;  3MXG A;  1YI2 A;  3S2D B;  1K8O A;  1YNJ D;  3J81 i;  2WAQ B;  5CV6 A;  2A73 B;  2RQX A;  2JN4 A;  1ESF A;  2FMM A;  1QNU A;  5EKK A;  2J4X A;  4M1U B;  1V43 A;  2L5T A;  4DR5 Q;  5IT9 c;  1GKH A;  5M5X H;  3PGZ A;  3RUZ A;  2O5J C;  1UE5 A;  2HT1 A;  3IFT A;  4DR3 Q;  4ABN A;  4LFC Q;  1D5M C;  2RBM A;  1O78 A;  5BN3 A;  1PH3 A;  1XPU A;  1RIP A;  4JI7 Q;  2F0J A;  3NXW A;  2F03 A;  5IGE A;  2RSN A;  3U50 C;  2MO0 A;  2JA7 G;  1LTB D;  3QWN A;  4POF A;  2K32 A;  5LMN W;  2D2C C;  4KTA A;  2JEB I;  3SGI A;  1M8A A;  5M3M B;  3I4O A;  5ISR A;  1EQV A;  3BDO A;  1EQQ A;  5COR A;  3SVM A;  1Q46 A;  1UE7 A;  1FR3 A;  2RDF A;  1PFN A;  2Q8T A;  2JA7 H;  2FIN B;  3FPU B;  3QG1 A;  2JA6 B;  1NSN S;  4PMB A;  2UU9 L;  1SMY D;  3CRK C;  4PG3 A;  2CCZ A;  5C4X G;  2F0D A;  5A2Q E;  5K5P A;  4DV0 L;  5E3F A;  2DNC A;  1C7Y A;  1LLR D;  1IBM L;  1Q1E A;  2F3V A;  2PO4 A;  1WOC A;  1HCZ A;  2SNM A;  1V1P B;  1G6P A;  2EIF A;  4GOP B;  1R4Q B;  5CGK A;  4RGO S;  3K58 A;  2OQ0 A;  3GDE A;  3D8G A;  4P73 A;  5EPJ A;  1B2T A;  3PSI A;  3WWV A;  4J8Q A;  3NBH A;  4FF1 A;  3KF8 B;  5C4X H;  1QUQ B;  3CC7 A;  4A3D G;  1D5Z C;  4CHT B;  5M3F G;  1Y8P B;  1A3V A;  1FNV A;  3QOL A;  1JIC A;  5M5Y B;  4BBR G;  4JCV E;  3S1N B;  5IGD A;  3M7G A;  4BY7 H;  1WTW A;  3NEN A;  2MGS A;  2RKS A;  4DV1 Q;  1NAP A;  4R4I A;  5FLX E;  3I4M B;  3S15 H;  3NTI A;  1G6Z A;  4LF6 L;  5M3F H;  3A5Z B;  1ET6 A;  2ZTE A;  2JQO A;  2RHS B;  1HZ9 A;  2EXD A;  3PUX A;  2KEN A;  2UXB L;  1TS5 A;  1G29 1;  4JOI A;  1JOQ A;  3OMG A;  5EKL A;  3J7Z C;  2SOB A;  3I8Z A;  3JC6 6;  4K2K A;  1X3G A;  3HKS A;  5IP9 G;  4JI3 Q;  2J7Z A;  1RHP A;  3DM1 A;  1IBM Q;  3K59 A;  3SHL A;  3S17 B;  1VQ6 A;  1SSO A;  4LF7 L;  4JK1 C;  2KUM A;  1YJW A;  2R93 H;  5IP9 H;  2D9U A;  3CCS A;  3M85 A;  3NEM A;  5EAY A;  4DV4 L;  2DY7 A;  1CA5 A;  1AEX A;  2R92 B;  4R8N A;  3LWU A;  2KCN A;  3E9I A;  4P72 A;  1G8Z D;  2OWO A;  1JQY D;  1VQM A;  4HSV A;  2R7F A;  2A1A A;  4HJ9 A;  1I6H H;  2QEJ C;  2NTT A;  4LFC L;  4NXN L;  2XIW A;  5C44 B;  3RLF A;  4LFA L;  1YJN A;  3X3M A;  3J7Y W;  3G4S A;  3C46 A;  3HFZ B;  1V1P A;  3K0X A;  3T1H L;  2PQE A;  1TQO A;  1IBL Q;  4BBR B;  1EYG A;  3WOE A;  2RDH A;  3PF4 A;  5CV9 A;  1W2B A;  1ILP A;  3FMC A;  5IYD G;  1C8C A;  1IYV A;  1Y1V B;  3HOU B;  3I55 A;  1DOK A;  5BR8 L;  2EQS A;  3R8B A;  4C3I B;  2EYJ A;  4RH6 A;  1EIY B;  4LJZ C;  1X9N A;  3J7A F;  1C48 A;  3LX0 A;  2A19 A;  4QGU A;  2WP8 J;  1C9O A;  2GVA A;  1H9S A;  1MI2 A;  1AP0 A;  1EYC A;  1YIJ A;  4KK7 A;  4XQN A;  3DEP A;  1II3 A;  1VMP A;  1WD1 A;  1BCP B;  4H0L C;  1V9P A;  4LMQ D;  1Q8I A;  4BY7 B;  3J80 L;  2H1E A;  2L12 A;  2A69 C;  3BVZ A;  2E2H B;  4MN3 A;  3OWE B;  1PH8 A;  2E76 C;  2JA8 G;  1FGU A;  3RN2 A;  3GTP H;  3S1Q H;  3SE0 A;  1ASY A;  2E2D C;  1TWG H;  3K6O A;  1S4Z A;  4FP5 D;  1KIX A;  2Z6B A;  4A76 A;  3K5O A;  3OIQ A;  1VQ8 A;  1YHQ A;  1D8L A;  2BA1 A;  2ENB A;  3MXN A;  3BVG A;  1X55 A;  5EBC A;  3OTO L;  2F1M A;  1X3F A;  5KIX A;  5LMN Q;  1I94 Q;  1Q8K A;  2PZT A;  1WTQ A;  1SJE D;  1ZXT A;  1ZKO A;  3I2Z A;  1O7Z A;  1VQC A;  1DD2 A;  1VQJ A;  3SK6 A;  3A0J A;  1NE3 A;  2HIV A;  1YJ9 A;  2XSC A;  2Y0S E;  1NMF A;  2XRQ D;  2ICI A;  3DWQ A;  3DMU A;  1ILQ A;  4KKT A;  4BY1 G;  1B3A A;  2ZTD A;  2RF4 A;  4F7X A;  3BU2 A;  1Q7Y C;  1JWU D;  3S1R H;  4KKS A;  1VQH A;  3HEJ A;  3VR2 A;  5C3E B;  1KRT A;  5AJ3 Q;  3NWS A;  3HP3 A;  1YEZ A;  2RCN A;  3UI2 A;  4IFD I;  4KHP L;  3GQB A;  1ENA A;  1GUW A;  3I4N G;  1PRT F;  2ID0 A;  3MZ5 A;  2MNA A;  2Q2T A;  2JA9 A;  1IYU A;  3M4O H;  1EYA A;  1KDA A;  4KHZ A;  2F0E A;  3F2C A;  2R7Z G;  4A3E B;  1TU2 B;  1BCP F;  2C9O A;  2NZ1 D;  2Q8R E;  4DV6 L;  4CJ1 B;  3CC4 A;  3FKI G;  1DZ1 A;  3E3X A;  3DWP A;  3VDY A;  1CK1 A;  2QKI C;  1R4P B;  4A3K H;  4B3S Q;  2B2U C;  4HMJ A;  1QNK A;  1LV9 A;  2Y0S B;  5J1Z A;  4C2M H;  1Y1W G;  2F3W A;  4LF8 L;  5CV4 A;  2MUY A;  1UE1 A;  3CCJ A;  4B3T Q;  5EPL A;  1ONL A;  2VQF L;  3CAM A;  1B4O A;  1XNR L;  2GA4 B;  1NBW A;  2CQO A;  1K8A C;  2CH4 W;  2B2V C;  1HFN A;  4R4T A;  2O2L D;  3CCR A;  5IY0 A;  1EOV A;  1TWC H;  4R4C A;  3L7Z C;  3PIP A;  4FF3 A;  3KLR A;  1F9R A;  1SE2 A;  3TN2 A;  4Z9C B;  3C1E A;  2HHH Q;  3Q22 A;  1HNZ L;  3JAM c;  4I7A A;  3STB C;  3PUV A;  1SND A;  3ICE A;  1X3E A;  2F0F A;  3C1F A;  3GTM H;  4KMU C;  4X62 L;  1A63 A;  3ZYY X;  1X54 A;  2FJ2 A;  4CDD C;  5IYC G;  2R7Z B;  2ZJQ A;  1QVG A;  2PNR C;  3M7N A;  1RTN A;  3VR6 A;  2VQF Q;  1B70 B;  1GUS A;  3JAM E;  3PV0 A;  3MVV A;  5CMD A;  1O7L A;  1I4Q A;  4JYA Q;  4O42 A;  5GRO A;  4Y7N B;  1U0L A;  5FJ8 G;  2XTI A;  4MHE A;  1JCK B;  5I9O A;  4X65 L;  4OX9 Q;  1RDP D;  3VYR A;  4IO9 A;  4YCW A;  2VB3 X;  1ENC A;  2WB1 B;  4DNT B;  1JOO A;  4X3S A;  3J80 E;  1QWY A;  1GXD C;  2B2W C;  4HJA A;  4ALP A;  1VQ4 A;  2ES2 A;  3J80 i;  3EIV A;  5IGC A;  5IP7 G;  3MXN B;  5GAE C;  4J15 A;  4JBJ A;  3T51 B;  4DAM A;  1EY8 A;  5DAU A;  4IUR A;  3T13 A;  1UEA B;  2R92 G;  1AE2 A;  2F0M A;  5ELE A;  2YU9 B;  3M3Y B;  4RKL A;  4XQQ A;  4H13 C;  1AW7 A;  4RGT A;  5EKI A;  1PH1 A;  1D1I A;  2B2Y A;  1VCI A;  4K8I A;  1A3U A;  4A3I B;  3R2T A;  2F52 A;  4X64 L;  5CV8 A;  4U67 3;  3QO2 A;  4XXE A;  5AJ3 L;  4LF8 Q;  1LAB A;  2EJF C;  2CVR A;  3GTJ B;  1AH9 A;  4GLA C;  5ELF A;  2KCC A;  2YU9 H;  3M3Y H;  3I73 A;  3HOX H;  3FP9 A;  4NW2 A;  1TWH B;  2CW0 C;  3S16 H;  3J7A 5;  1WTH A;  2NZO A;  1SJH D;  5I2Y A;  5KND A;  4B3T L;  1F9S A;  1PZJ D;  3KLS A;  2MQH A;  2NN6 H;  1MJC A;  1OXU A;  4AYB G;  1S5C D;  4DR7 Q;  3U4Z A;  5I6Y A;  1RCV D;  2EDG A;  1IKM A;  4A3M G;  4OIK A;  2ZJR A;  4DUZ L;  2B8G A;  3SR1 A;  2YV5 A;  1OXT A;  4B3S L;  3MXP A;  2Q8I B;  1VQA A;  1WI5 A;  1K83 H;  1TWH H;  5JJZ A;  1J5E Q;  3CME A;  3F1Z A;  1WTV A;  3L9A X;  3F8T A;  5TSS A;  1CQV A;  5JPM C;  3PQI A;  4A3G G;  1GHK A;  4LF4 Q;  1U9R A;  3NTK A;  4CJ2 C;  3CCL A;  3TS0 A;  1X3P A;  1EIF A;  4FYD A;  4ZUJ A;  5A35 A;  5JVG 3;  1STB A;  1WCM H;  1HNW Q;  3M4P A;  5JPN C;  1I4H A;  3CCQ A;  2A69 D;  4HR7 B;  5T1G A;  3S9W A;  4JV5 L;  2CW0 D;  4JI0 Q;  2D0O A;  1ET9 A;  4JI4 L;  2K5D A;  2Z0S A;  2SNS A;  2LS0 1;  4HIO A;  1SFO H;  1PTO H;  4IFD J;  1KL9 A;  2N78 A;  5LMU Q;  1BCP D;  2JA8 H;  5FLX c;  2XRS D;  1I50 B;  3SDZ A;  3ERS X;  1M4V A;  1K9M C;  2N55 A;  1BBX C;  4C3J B;  4X65 Q;  4YIJ A;  4JI7 L;  1HA5 A;  1PRT D;  2F0N A;  1E7Z A;  2LSS A;  5IYB H;  2O4X A;  1KD1 C;  1S72 A;  3AEV A;  1EUJ A;  4F87 A;  2ASB A;  4HJ5 A;  1IXR A;  3TRZ A;  3H94 A;  2WII B;  3TP6 A;  2EYH A;  4CDE C;  1H9S B;  3OWF A;  3OMC A;  5FLM G;  4KY5 A;  1I3Q B;  2F0T A;  2K5N A;  1BBU A;  1TS3 A;  5C3W A;  3FHW A;  1UNS A;  2AUK A;  2OTJ A;  4A3D B;  4CDC C;  2KBN A;  5C4J H;  2AMC B;  3H0G H;  3T56 B;  2R3Z A;  1N33 L;  1XNQ L;  3GV3 A;  1HHV A;  3I4L A;  1VQN A;  4DK3 C;  3L0O A;  3BYY B;  4BY1 H;  2M00 A;  2KJX A;  2MO1 A;  2R6G A;  2R7Z H;  4IFD H;  2EE1 A;  2K05 A;  3S1R B;  5I2X A;  2QEX A;  1X65 A;  2QDB A;  3NQT A;  1Q81 C;  2SEB D;  2HQL A;  2PNH A;  2NYZ D;  4YY3 L;  2VB2 X;  1R9T H;  4DUY L;  3W5O A;  4A93 B;  1Q3L A;  3BG3 A;  1PTO F;  4IZ8 A;  4FXK C;  1PHJ A;  1E1O A;  4A3M B;  1XNR Q;  4IOA A;  5E4X A;  1HUM A;  1KLU D;  4JOI C;  3SK4 A;  1TWC B;  2Q2I A;  4L63 B;  2UUB L;  4DR1 L;  2D5D A;  4DV3 L;  1CTM A;  2PPB C;  3KOJ A;  2K50 A;  1K0S A;  3OIP A;  2HIX A;  3ND9 A;  1CI3 M;  4X64 Q;  1QG7 A;  4BS9 A;  1TS4 A;  4RAU C;  2BA0 A;  4JI5 Q;  2UXB Q;  4PMC A;  4O0A A;  1AE3 A;  1PTO D;  1UAP A;  4XIG S;  3M9B A;  4JI3 L;  3HOX B;  2PCF B;  1Y8O B;  4GN3 B;  3HOZ B;  4DR2 L;  5GQO A;  1B1Z A;  2ZXR A;  3W1B A;  4DNR B;  1PMR A;  3TQY A;  2JA5 B;  3ND8 A;  3OTO Q;  1WD0 A;  4BBR H;  1XYI A;  1E3P A;  3D3R A;  1SAP A;  1Q90 A;  1IKL A;  2F0P A;  4H02 A;  4R4Q A;  3NBH B;  3MHB A;  2DJF C;  1Y1V H;  2DJG C;  1TWF H;  1CM9 A;  4RGN A;  3I56 A;  2NUC A;  1GVP A;  2F0H A;  3EFX D;  3E9H A;  1FYC A;  3CP0 A;  2JA7 B;  2UXC L;  4O2D A;  4A3F B;  5KNC A;  1P8L A;  3AU7 A;  2K75 A;  4A3I H;  1DGS A;  1QJO A;  4R4O A;  1LT4 D;  2A8V A;  1V1Q A;  1XNQ Q;  4HTH A;  4A3L H;  1N9W A;  1ENF A;  5JEA J;  3J81 L;  5C0X J;  4JI1 Q;  1O7Y A;  4WJ3 M;  3SXH A;  5LHY 1;  5KRU A;  2VS1 A;  3D4R A;  5C4H A;  3CU7 A;  1MBY A;  5K36 H;  5JVH 3;  2HQE A;  2NVQ B;  1RL2 A;  1PVO A;  4RWS C;  4LW1 A;  1KDC A;  2F0I A;  1PYB A;  1PH2 A;  1HH2 P;  3STB D;  4CKE A;  4FXD A;  3V05 A;  4OGQ C;  2E2H H;  3A55 A;  1ASZ A;  2F0K A;  4DFA A;  2OQK A;  5IWA L;  4RMF A;  3Q23 A;  3OPO A;  1N32 Q;  5M3F B;  1L0X B;  1V1O A;  1I4X A;  5LMU L;  4BBS G;  1CA6 A;  1RD9 D;  5IT9 L;  4NPS A;  4A3G B;  5JOB A;  4ILW A;  3T1Y L;  1H9R A;  1FGB D;  1YNJ C;  1TXY A;  2YTY A;  4N9P A;  3KJO A;  2RHQ B;  1N8R C;  1TT2 A;  4GNX A;  1TII D;  1I4P A;  1WCM G;  2JSO A;  3J81 c;  4QF4 A;  3KJP A;  2B2V A;  2D0P A;  4A3E G;  4LF7 Q;  5CC4 A;  2ZJP A;  3DUZ A;  2DY8 A;  2L1B A;  2K5Q A;  1D6E C;  1UEB A;  3A5U A;  2F0V A;  2PQA A;  3HKZ B;  4DV0 Q;  1KAW A;  4HCS A;  1I50 H;  3RZD H;  4KN7 C;  4K5X A;  3O13 A;  4LF5 Q;  5LL6 X;  3BYT B;  2ALY B;  3FRP B;  4C1N K;  2HHH L;  4IUT A;  5FOB B;  2EY5 A;  3U9O A;  4PZ6 A;  5CBA E;  1F2Y A;  3AB9 A;  3CF5 A;  4GNX B;  3IFD A;  1HA6 A;  2ICE C;  1XPO A;  4X66 Q;  2EYO A;  1HQR D;  3CC2 A;  2L4N A;  4A3E H;  3J81 E;  4BXX G;  5E7N A;  1A8V A;  3QB3 A;  4K6D A;  4UHV A;  1KXL A;  2EJG C;  1TWA H;  3CCE A;  1LTS D;  2YYZ A;  3HOW H;  1D7Q A;  1EQR A;  1W6K A;  4BWG B;  2KHI A;  4IAL A;  3WOF A;  3KBX A;  3FPP A;  3DLL A;  3K5L A;  3H6M A;  1BCP C;  2DNE A;  2E5L Q;  2QGQ A;  3TP5 A;  1J6Q A;  1GD7 A;  1NJI C;  5HUR A;  3D6W A;  4F8M A;  1PDQ A;  4C3J G;  1Q86 C;  2I46 A;  2NVT B;  2H5X A;  1A15 A;  3H3V H;  4JV5 Q;  1JJG A;  3QIA A;  1K83 B;  2E5L L;  3JAM L;  1CKO A;  3A8J E;  3C3L A;  2K5H A;  2VXW A;  2CHB D;  3P1H A;  4RCO A;  1KHI A;  2LMC B;  3H15 A;  4A3C H;  2IY5 B;  3QR8 A;  1E2Z A;  1H9K A;  3I4N H;  3CW2 C;  1HNX Q;  5D3D A;  4IPG A;  5ELN A;  4PV1 C;  3M4Y A;  1BR9 A;  4A4I A;  4EX5 A;  2VQE L;  2F4V L;  4C56 C;  1H9J A;  4POG A;  1BQQ T;  1PTO B;  1SE3 A;  4Q0F A;  1CHQ D;  3I90 A;  3HRZ C;  3KUP A;  3HOW B;  4LFB L;  4A3K G;  2K28 A;  4OXP A;  4PZ7 A;  4EQO A;  1KAA A;  2NZH A;  1JWS D;  5C4Z A;  1HTL D;  1F9P A;  1KDB A;  1NR4 A;  2F0O A;  4KKU A;  3NHH A;  4DAP A;  1N36 Q;  3ITP A;  2G9D A;  3E0J A;  1UUP A;  4KY6 A;  1NY4 A;  1S5F D;  1VQ7 A;  5C4J B;  1KNE A;  5LL6 S;  4RKB A;  3VYT A;  1QCB D;  4RG1 A;  4TSS A;  2AWN A;  4EQ5 A;  2NWG A;  2E2I B;  4DV7 Q;  1KAB A;  3MWY W;  3CHB D;  5E4W C;  2BDN A;  3PIP 3;  4LNQ A;  1NCV A;  1JOK A;  2N88 A;  2L15 A;  1ROD A;  3U58 A;  5C3X A;  1N34 Q;  3SK5 A;  2XWJ B;  1X56 A;  2IWH A;  2K7V A;  4NP5 A;  3OW2 A;  4MTK A;  2FXQ A;  1WVL A;  5CV7 A;  5JJK A;  4HSP A;  1Y1W H;  2OTL A;  4DUY Q;  1XXG A;  4YY3 Q;  1IZ6 A;  1F9Q A;  4ZCK A;  1U5K A;  2OF1 A;  5G3L F;  1HR0 W;  3ULL A;  5KYI A;  3M4O B;  2CKZ B;  1STG A;  1T9H A;  1VQG A;  4ID6 A;  4V0B A;  4E6I A;  2B63 H;  2P5Z X;  3DHQ A;  3PMF A;  4WRD A;  4NDX A;  1U4R A;  3PUY A;  3RLN A;  2N8N A;  4JC0 A;  2I5H A;  2MJ8 A;  2QW7 A;  1W3S A;  4IUQ A;  3HZX A;  2F4I A;  4LF9 L;  1PYW D;  5CYU A;  3N52 A;  2N3S A;  2NN6 I;  4CDF C;  3LWE A;  2TSS A;  1EY0 A;  1A0I A;  3KDF A;  4N8X 1;  3ER0 A;  3AYH B;  4UP7 A;  2VUM H;  4PZ8 A;  3VA7 A;  2B63 G;  5J3B A;  2WAC A;  1O80 A;  4HAE A;  1TKW B;  3GTQ H;  4DR7 L;  1IYJ B;  3PUW A;  3UE0 A;  3GTM B;  3PIO A;  3BZK A;  1EQT A;  2PW7 A;  3RNU A;  2QDL A;  1N34 L;  3RR5 A;  4ZKB B;  3OHX C;  2ZXP A;  4JI6 Q;  2F0Q A;  2K01 A;  3GTL B;  4MIU A;  5IGG A;  4NXN Q;  4OIJ A;  4A3J G;  1DYQ A;  3G48 A;  2MFI A;  4R8I A;  3GTQ B;  3V96 A;  1VF7 A;  1BF4 A;  1NTG A;  2PI2 E;  1JJC B;  4LUZ A;  4NKL A;  2HUG A;  2M9V A;  1QVF A;  4K6L A;  4HJ8 A;  2RSO A;  1VQK A;  2B63 B;  3PO2 G;  2CWA A;  3S16 B;  1S40 A;  2ZTC A;  4IPH A;  4OHJ A;  4QMG A;  1L1O C;  5FO8 B;  3TME A;  1HNX L;  4A3F H;  1G2T A;  4S3S A;  2F0L A;  3OW7 A;  1EY7 A;  2ZM6 Q;  1J5E L;  1JB3 A;  1L0Y B;  4A3B H;  1V8Q A;  4IUU A;  1IBK Q;  4NXM Q;  2EYL A;  2NN6 G;  4WJ4 A;  1GUT A;  3TZU A;  4K5V A;  3L2P A;  2IX1 A;  1B7Y B;  2I07 B;  3H0G B;  1S5E D;  2UXD Q;  5M9O A;  2NVT H;  4AH6 A;  3A54 A;  1F2M A;  1PFS A;  1I4R A;  2UUA Q;  3S2D H;  3HKZ G;  4XQJ A;  2XVS A;  4MNO A;  2A68 D;  4P75 A;  1HFG A;  2B2U A;  5IYD H;  4GZY C;  3CXC A;  3BJU A;  1BO0 A;  1PZK D;  4ZYS A;  3CQZ B;  3PF5 A;  1Z47 A;  2EZV A;  4G7O C;  1BVS A;  4KJO A;  2EY1 A;  3EQL C;  3CD6 A;  2HDL A;  2O5I C;  3K7U C;  5CR3 A;  4U68 A;  1EU3 A;  1ZEQ X;  1PLF A;  1TVX A;  4JPB W;  1I4G A;  2KED A;  3NPP A;  3EN2 A;  5C3E H;  3S1M H;  5I6W A;  5IGF A;  1RKN A;  2VUM B;  5FLX L;  3TZD A;  5AFW A;  3AFP A;  3D6C A;  1E1T A;  3KYH C;  2AWO A;  1BDO A;  3K7A H;  4X62 Q;  2B3G A;  4FXG C;  5M3M H;  3R3O A;  1JOR A;  3R2I A;  4JI2 L;  3ERQ A;  1OO9 B;  1TWF B;  3RLO A;  2AQ2 B;  3G7L A;  5BR8 Q;  3VA5 A;  2IT1 A;  3MEF A;  2VQE Q;  5C0X I;  4TVA B;  2F4V Q;  1PTO C;  1GUO A;  4GKK Q;  1S5B D;  1R9T B;  4G4K A;  1CUK A;  1LM0 A;  1H9M A;  1B9M A;  1GO3 E;  5IYB G;  1WYD A;  1MSG A;  3T1Y Q;  1SNO A;  4R1J A;  4R9W A;  2EJM A;  1E2W A;  1K3R A;  2XN9 C;  1P16 A;  2GVB A;  4DN4 M;  1CQF A;  1QZG A;  1GUG A;  5KGU A;  4DR1 Q;  3V2T A;  3TBI B;  2NTS A;  3L3O C;  1EY5 A;  4OX9 L;  3RZO H;  1PRT C;  1SYB A;  2IX0 A;  4ME5 A;  2K4K A;  5ELB A;  5FO7 B;  2MPM A;  1Y8N B;  3E5S A;  4A3C G;  3A7A B;  3C2P A;  4ULL A;  1ESR A;  3K81 C;  2RA4 A;  4QIW B;  2QA4 A;  3GD7 A;  4GS3 A;  4LFA Q;  5HGQ A;  4JI0 L;  1JC7 A;  5IT9 E;  5DM7 3;  1HR0 Q;  4L6T B;  4DV7 L;  1ICW A;  1X32 A;  1K0R A;  2QF7 A;  1XMQ Q;  3FVQ A;  2EXZ A;  1IBK L;  4KLK A;  2WIN B;  5IIF A;  4DV4 Q;  1Z6H A;  4HN7 A;  1FVI A;  1RF2 D;  3AMU A;  4KN4 C;  1B53 A;  4H44 C;  3S1Q B;  3P20 A;  4RCN A;  2R93 G;  1WTR A;  3TS2 A;  5ELD A;  3S14 H;  5KNB A;  4DK1 A;  2L0C A;  4DK0 A;  4GLV B;  4ME3 A;  4QQB X;  4UP9 A;  1PH9 A;  3PO3 H;  4EQN A;  4BA1 I;  1LT6 D;  4CKC A;  3OOC A;  2NVY H;  5JJI A;  1FJG Q;  1IBL L;  1MHW C;  1Q12 A;  5KEE A;  2Q2U A;  3T1H Q;  4RFB A;  3QOJ A;  2IW3 A;  2L9H A;  2IPK D;  1K73 C;  5I9P A;  1G91 A;  4Y7N H;  1A62 A;  2RDG A;  1VMC A;  1SYC A;  4B3R L;  4WFN 3;  4WOR A;  2F3I A;  4ZKC B;  1MGS A;  3PCO B;  4L5R C;  3HOV B;  1D2B A;  3GV6 A;  1N32 L;  1JJ2 A;  1EL0 A;  1OXS C;  1IW7 D;  3T16 A;  1EEI D;  1Z7T A;  4RHS A;  1EZ6 A;  3H3V I;  4X66 L;  4ZRZ A;  1SBB B;  2IHF A;  2Z6K C;  4BBS H;  1S3O A;  1LTT D;  2X6G A;  5CBE E;  4HIM A;  2FHT A;  2VZA A;  1L1O B;  2Z6K A;  3HOU H;  4K0K L;  3H3V C;  4CGY B;  1G51 A;  3GTJ H;  3VYS A;  5FKA C;  4N8F A;  4V19 0;  4HJ7 A;  3ULP A;  5I4D A;  4GKJ Q;  2DGY A;  1SMX A;  4A3J B;  1EFW A;  4I7Z C;  2NVX B;  4DXF A;  5C6A A;  1F2Z A;  4BY7 G;  2FMC A;  5J22 A;  3K5M A;  1LYL A;  1SYD A;  1XMO L;  4XYQ A;  5LMN L;  1OXV A;  1TWG B;  3I3C A;  2YTV A;  3F2D A;  1VF5 C;  4DAV A;  1SMY C;  4NMZ A;  4XT3 B;  1JR0 D;  4FDB A;  3S2H B;  1FNW A;  1XX8 A;  4OEM B;  3NQI A;  1DCZ A;  1LTR D;  4DUZ Q;  4HIK A;  1M90 C;  4A3J H;  4K14 A;  3VR5 A;  4B9X A;  2D62 A;  2I5L X;  2JK8 A;  4IJL A;  1LO5 D;  2WKC A;  2IHE A;  1DM0 B;  2PZW A;  3G6J B;  3J7A V;  1Y1V G;  2MP1 A;  1C0A A;  2VNU D;  3KLW A;  4QUC A;  2JE6 I;  4DAY A;  2JJQ A;  1A2U A;  2BCO A;  1EY6 A;  2V1C C;  1VS0 A;  1HNZ Q;  3BS1 A;  3WDN A;  2K6A A;  2L11 A;  1K8M A;  3A8I E;  1BUV T;  1EYD A;  1PH6 A;  3W2D A;  4B9W A;  4LWC A;  2A5H A;  4A3B G;  1UE6 A;  5IGB A;  4IUN A;  5COY A;  2YTX A;  4JBW A;  3IRB A;  1EWI A;  4JVZ A;  1WTX A;  1B3Q A;  4DA2 A;  5M5X B;  2F0S A;  4J1M A;  5GAH C;  4DV2 L;  4JG2 A;  1T5E A;  4IFD G;  2M2L A;  4JW0 A;  2JA8 B;  1K3B C;  1DXM A;  1HPC A;  3G71 A;  3DWA A;  5C0X H;  4C3H G;  5BN4 A;  5EPK A;  1SNP A;  2XNA C;  3HGB A;  1CZW A;  2J0T D;  4DR3 L;  1HZA A;  1PXU A;  4JI8 L;  5CV5 A;  4G7Z C;  2C35 B;  3IAY A;  3BVM A;  3SK8 A;  2NVY B;  3JAM i;  4LF6 Q;  1QE6 A;  2B2T A;  1B9N A;  3S17 H;  4EGV A;  3VR3 A;  1VQE A;  3I7F A;  3E0E A;  1HZB A;  1AZQ A;  4LK1 C;  2OCE A;  4A93 H;  3HOZ H;  4BY1 B;  4A3M H;  4H7B A;  3K57 A;  4DV2 Q;  4DR2 Q;  4KHV A;  3GTO B;  1SN8 A;  4C3H B;  4DPG A;  4F88 A;  4LFB Q;  2JA5 H;  4RHR A;  4J6H A;  5EBD A;  5C3E G;  1O7I A;  1LTL A;  3ERO A;  4K0K Q;  3P75 A;  2E8G A;  2B29 A;  4DR4 L;  5JJL A;  1K28 A;  3H91 A;  3LGJ A;  3S15 B;  1VQP A;  2IX3 A;  3N6R A;  5J39 A;  2JEA I;  2XGT A;  5M5W H;  2RCF A;  5EGT A;  2A6H D;  3J80 c;  3AFQ A;  1PH7 A;  5M5Y H;  3GTG B;  3HOY B;  4HED A;  1YNN D;  1TR5 A;  3TSS A;  1IL8 A;  1ML0 D;  4ZLT F;  5JEA H;  1IW7 C;  3Q24 A;  1EIH A;  2BDO A;  4G7H C;  3I91 A;  1WJJ A;  4UP8 A;  2AQ1 B;  3IL8 A;  3KFU A;  3HOU G;  1X3Q A;  3B6Y A;  1SRU A;  4QL5 A;  4PMW A;  1SNC A;  4X3T A;  3VYU A;  2E2J H;  5C5L A;  5FJ8 H;  3S24 A;  1TWA B;  3S14 B;  3K80 C;  1LTG D;  1HZC A;  1PFB A;  2I5M X;  4A3I G;  2SDF A;  1XTC D;  2ZXO A;  4C3J H;  1ICF B;  4NXM L;  1KNA A;  1YZ6 A;  2BOS A;  3EBE A;  4G57 A;  4A3L G;  1WCM B;  4JBK A;  1MD2 D;  4YCV A;  1L0W A;  3K0Y A;  4LUO A;  1KLG D;  1VQL A;  1STA A;  1CSQ A;  4KD4 A;  3TRE A;  4WJW A;  3T53 B;  1L1O A;  4GKK L;  5KYL A;  2A6H C;  2EPB A;  2B2W A;  5FLM H;  1XWE A;  1SXT A;  4DR4 Q;  1CT1 D;  4DKA C;  1CKN A;  3GTP B;  4BBS B;  1VQ5 A;  4I65 A;  5GAD C;  3FKI H;  4L8J A;  3UDF A;  2BE5 D;  3FDT A;  3MC0 B;  3CQZ H;  3NBI A;  4CBV A;  1SR3 A;  2A6E C;  4OEL B;  2ATW A;  2K52 A;  3TP8 A;  4GN5 A;  1KTK A;  2KEE A;  3DM3 A;  3RMH A;  3HOX G;  4HCE A;  2PMZ B;  2JYO A;  4KJN A;  2KOL A;  1NNX A;  4FVM A;  2B2Y C;  1GM5 A;  2NVQ H;  5DM6 3;  1SYG A;  4LAA A;  1PH4 A;  1XTD A;  2CWP A;  1EY9 A;  1QUQ A;  2EY2 A;  5E1F A;  3GTG H;  3HOY H;  4IJH A;  5DLQ E;  3ULJ A;  4CJ0 B;  4UDU C;  4C3I H;  1GHJ A;  1PH5 A;  4P71 A;  4DR5 L;  4DU9 A;  5HGT A;  2BH8 A;  4X3K A;  3HOV G;  1GOZ A;  1EOT A;  5C4X B; 
#chains in the Genus database with same CATH homology
 1PFM A;  2NB0 A;  1LT5 D;  3A8K E;  1EFI D;  1D5X C;  1STN A;  5FK9 C;  4OO1 G;  4EQP A;  4DXG A;  3HS0 C;  5C0X G;  4RA8 A;  5EJW A;  1RJT A;  1B44 D;  5DNF A;  2E74 C;  4FF2 A;  1ZYR C;  5NUC A;  1STH A;  4UAI A;  1I6H B;  4QUF A;  1BOS A;  3X3N A;  3PIO 3;  3GTK B;  1BNZ A;  1TY0 A;  3P7J A;  2E2J B;  1EWH A;  4Q5V A;  1FNU A;  2TMP A;  4A3K B;  1SNQ A;  3I70 A;  3RZD B;  4O1N A;  5T1I A;  5IOC A;  3I4N B;  1STE A;  2F0G A;  5ELC A;  5D3I B;  2KQ3 A;  3MAQ A;  3W3A A;  3F2U A;  3BDC A;  3MXU A;  2PW5 A;  5IOD A;  1A2T A;  1SYE A;  3A7L A;  1EZ8 A;  2A6E D;  2PZU A;  4A3B B;  1LAC A;  3GP7 A;  2HCI A;  3NSW A;  1HUN A;  1U4M A;  1HQM C;  2WKD A;  2Z4I A;  2RVL A;  5K36 G;  1DOM A;  3KK7 A;  1WTO A;  1J9O A;  1STY A;  4TQU S;  4EVO A;  5C5M A;  2X6L A;  3MA2 B;  3KF8 A;  1DJR D;  4RGM A;  3NUC A;  3MFY A;  1GJX A;  4K2L A;  1E2V A;  3HG9 A;  3PO3 B;  1Y69 U;  2V4D A;  3NK9 A;  2EOT A;  3D31 A;  3S1M B;  4PNY A;  1SYF A;  3D4D A;  2K03 A;  2K04 A;  2L55 A;  1Q1B A;  4ZUI A;  4P2C B;  1TS2 A;  2XWB B;  3PUZ A;  4OL7 A;  2AUJ D;  5JAV A;  1HRJ A;  1SNM A;  1W6J A;  4C2M B;  2Z4H A;  4TRD A;  1LTI D;  4DF7 A;  2CQA A;  4FF4 A;  1GUN A;  1B50 A;  1CZG A;  3Q6S A;  4ZAI A;  2EYF A;  1SE4 A;  2KA7 A;  4N9T A;  3TDQ A;  2PYK A;  2G9H D;  1T5X D;  4QCL A;  1C4Q A;  4K8J A;  2X69 A;  3FEW X;  4M8A A;  3KBG A;  3QJY A;  2H4O A;  1JE4 A;  1S5D D;  2LY7 A;  1EEF D;  1F77 A;  2WV6 D;  1NR2 A;  2B39 A;  3R93 A;  2DN8 A;  1TY2 A;  5JEA G;  5F2D A;  1QOH A;  4HMI A;  5FO9 B;  2BE5 C;  5D65 A;  3I72 A;  3PO2 B;  1VDZ A;  2E75 C;  1G2S A;  4QB4 A;  2EYP A;  1BXT A;  1ZYR D;  3DXJ C;  2QCP X;  5D14 A;  5BN5 A;  4X3U A;  3Q0A A;  3DEO A;  2OXP A;  1LT3 D;  4AYB B;  3CRL C;  1CFM A;  1RTO A;  2F0W A;  1I6V C;  3A56 A;  4TKO B;  3EVQ A;  3RZO B;  4OO1 I;  1A6X A;  2Z1C A;  3LNN A;  2F0U A;  2IL8 A;  3VR4 A;  1WTP A;  3BDL A;  2LKV A;  3T4A C;  1DOL A;  3CKI B;  1LTA D;  4ODG A;  3EJI A;  1PZI D;  3BZD B;  3EA6 A;  1AN8 A;  4KY7 A;  2MHV A;  4IN3 A;  3E6Z X;  1QIL A;  1IHZ A;  1CHP D;  2R61 A;  1Y1W B;  3TP7 A;  2A74 C;  1U4L A;  1F2L A;  3K7A B;  2JP1 A;  2QIL A;  1A3T A;  2K1B A;  4XTC S;  4CKB A;  1U4P A;  3FKI B;  3K5N A;  3ONA B;  4B08 A;  1PRT B;  1DON A;  4PQX A;  2B2T C;  3H09 A;  4DGZ A;  1SFO B;  1EY4 A;  4XDX A;  4C1N I;  1OXX K;  1SEB D;  2A68 C;  4C3I G;  2KHS A;  3KLS X;  1SDF A;  3GO5 A;  1HXY D;  2HCC A;  2OT2 A;  2EVB A;  2AQ3 B;  4KD3 A;  4XYO A;  4IUP A;  2Z8L A;  3NP8 A;  3IKJ A;  5G3L D;  1QB5 D;  4OO1 H;  2FFK B;  3D4W A;  5M5W B;  1EU4 A;  2K33 A;  2R93 B;  1EIG A;  3SEB A;  4FO2 A;  3NE5 B;  4ZQ3 A;  4KV6 A;  2HDM A;  3MTS A;  2OEO A;  5EQ0 A;  1MSH A;  4IUV A;  2EY6 A;  3MFG A;  1D1K A;  4IQZ A;  5DEH A;  4ZK9 B;  2KEC A;  4K5W A;  3U9S A;  1YNN C;  2NBF A;  2K5W A;  3NTH A;  3URY A;  2IJ0 A;  1HTP A;  5A2Q L;  1J8I A;  1E0B A;  4BA2 I;  1JWM D;  3NWT A;  3MEH A;  1NUC A;  4KI0 A;  2KVM A;  2B8F A;  2JXM B;  1AFP A;  4FNF A;  2C5C A;  2ZT9 C;  3OSO A;  1FD7 D;  2EYM A;  4XT1 B;  1EWC A;  2LFN A;  1AZP A;  3RD4 A;  3MXG A;  3S2D B;  1K8O A;  1YNJ D;  2WAQ B;  5CV6 A;  2A73 B;  2RQX A;  1ESF A;  2FMM A;  1QNU A;  5EKK A;  2J4X A;  4M1U B;  1V43 A;  2L5T A;  3RUZ A;  2O5J C;  3IFT A;  4ABN A;  1D5M C;  2RBM A;  1O78 A;  5BN3 A;  2F0J A;  2F03 A;  3NXW A;  5IGE A;  2RSN A;  1LTB D;  3QWN A;  2K32 A;  2D2C C;  4KTA A;  2JEB I;  1M8A A;  5M3M B;  5ISR A;  1EQV A;  3BDO A;  5COR A;  3SVM A;  1FR3 A;  2RDF A;  1PFN A;  2Q8T A;  2FIN B;  3FPU B;  3QG1 A;  2JA6 B;  1NSN S;  4PMB A;  1SMY D;  3CRK C;  2F0D A;  5A2Q E;  5K5P A;  5E3F A;  2DNC A;  1LLR D;  1Q1E A;  2F3V A;  2PO4 A;  1HCZ A;  2SNM A;  1V1P B;  1R4Q B;  5CGK A;  4RGO S;  3K58 A;  3D8G A;  5EPJ A;  1B2T A;  4J8Q A;  3NBH A;  4FF1 A;  1D5Z C;  4CHT B;  1Y8P B;  1A3V A;  1FNV A;  3QOL A;  1JIC A;  5M5Y B;  3S1N B;  5IGD A;  3M7G A;  1WTW A;  2MGS A;  2RKS A;  1NAP A;  5FLX E;  3I4M B;  3NTI A;  1G6Z A;  1ET6 A;  3PUX A;  1TS5 A;  1G29 1;  1JOQ A;  3OMG A;  5EKL A;  2SOB A;  3I8Z A;  4K2K A;  2J7Z A;  1RHP A;  3DM1 A;  3K59 A;  3SHL A;  3S17 B;  1SSO A;  4JK1 C;  2KUM A;  2D9U A;  3M85 A;  2DY7 A;  1CA5 A;  1AEX A;  2R92 B;  4R8N A;  3LWU A;  2KCN A;  1G8Z D;  1JQY D;  4HSV A;  2QEJ C;  2NTT A;  2XIW A;  5C44 B;  3RLF A;  3X3M A;  3J7Y W;  3C46 A;  1V1P A;  2PQE A;  1TQO A;  4BBR B;  3WOE A;  2RDH A;  5CV9 A;  1ILP A;  3FMC A;  1C8C A;  1IYV A;  1Y1V B;  3HOU B;  1DOK A;  3R8B A;  4C3I B;  2EYJ A;  4RH6 A;  4LJZ C;  3J7A F;  1C48 A;  3LX0 A;  2WP8 J;  1H9S A;  1MI2 A;  1AP0 A;  1EYC A;  4KK7 A;  4XQN A;  3DEP A;  1II3 A;  1VMP A;  1WD1 A;  1BCP B;  4H0L C;  4LMQ D;  1Q8I A;  4BY7 B;  3J80 L;  2H1E A;  2L12 A;  2A69 C;  3BVZ A;  2E2H B;  4MN3 A;  3OWE B;  2E76 C;  3SE0 A;  2E2D C;  3K6O A;  1S4Z A;  4FP5 D;  3K5O A;  3OIQ A;  2BA1 A;  2ENB A;  3MXN A;  3BVG A;  5EBC A;  2F1M A;  5KIX A;  2PZT A;  1WTQ A;  1SJE D;  1ZXT A;  1ZKO A;  1O7Z A;  1DD2 A;  3SK6 A;  2XSC A;  2XRQ D;  3DWQ A;  2ICI A;  3DMU A;  1ILQ A;  4KKT A;  1B3A A;  4F7X A;  1JWU D;  4KKS A;  3HEJ A;  3VR2 A;  5C3E B;  3NWS A;  3HP3 A;  3UI2 A;  4IFD I;  3GQB A;  1ENA A;  1GUW A;  1PRT F;  2ID0 A;  3MZ5 A;  1IYU A;  1EYA A;  1KDA A;  4KHZ A;  2F0E A;  4A3E B;  1TU2 B;  1BCP F;  2C9O A;  2NZ1 D;  2Q8R E;  4CJ1 B;  1DZ1 A;  3DWP A;  1CK1 A;  2QKI C;  1R4P B;  2B2U C;  4HMJ A;  1QNK A;  1LV9 A;  2Y0S B;  5J1Z A;  2F3W A;  5CV4 A;  2MUY A;  5EPL A;  1ONL A;  1B4O A;  2GA4 B;  2B2V C;  1HFN A;  2O2L D;  3L7Z C;  4FF3 A;  3KLR A;  1F9R A;  1SE2 A;  3TN2 A;  4Z9C B;  3C1E A;  3Q22 A;  3PUV A;  1SND A;  2F0F A;  3C1F A;  4KMU C;  3ZYY X;  2FJ2 A;  2R7Z B;  2PNR C;  3M7N A;  1RTN A;  3VR6 A;  1GUS A;  3JAM E;  3PV0 A;  3MVV A;  5CMD A;  1O7L A;  1I4Q A;  4O42 A;  4Y7N B;  4MHE A;  1JCK B;  5I9O A;  1RDP D;  3VYR A;  4DNT B;  2VB3 X;  1ENC A;  2WB1 B;  1JOO A;  4X3S A;  3J80 E;  1QWY A;  1GXD C;  2B2W C;  5IGC A;  3T51 B;  1EY8 A;  5DAU A;  4IUR A;  3T13 A;  1UEA B;  2F0M A;  5ELE A;  2YU9 B;  3M3Y B;  4RKL A;  4XQQ A;  4H13 C;  1AW7 A;  4RGT A;  5EKI A;  1D1I A;  2B2Y A;  1VCI A;  4K8I A;  1A3U A;  4A3I B;  3R2T A;  5CV8 A;  4U67 3;  3QO2 A;  4XXE A;  1LAB A;  2EJF C;  2CVR A;  3GTJ B;  5ELF A;  2KCC A;  3I73 A;  4NW2 A;  1TWH B;  2CW0 C;  1SJH D;  5I2Y A;  5KND A;  1F9S A;  1PZJ D;  3KLS A;  2NN6 H;  1OXU A;  1S5C D;  5I6Y A;  1RCV D;  2EDG A;  1IKM A;  4OIK A;  2B8G A;  3SR1 A;  1OXT A;  3MXP A;  2Q8I B;  5JJZ A;  1WTV A;  3L9A X;  5TSS A;  1CQV A;  5JPM C;  1GHK A;  1U9R A;  3NTK A;  4CJ2 C;  1X3P A;  4FYD A;  4ZUJ A;  5A35 A;  5JVG 3;  1STB A;  5JPN C;  1I4H A;  2A69 D;  4HR7 B;  5T1G A;  3S9W A;  2CW0 D;  1ET9 A;  2K5D A;  2SNS A;  2LS0 1;  1PTO H;  4IFD J;  1BCP D;  2XRS D;  1I50 B;  3SDZ A;  1M4V A;  2N55 A;  1BBX C;  4C3J B;  4YIJ A;  1HA5 A;  1PRT D;  2F0N A;  2O4X A;  4F87 A;  3H94 A;  2WII B;  3TP6 A;  2EYH A;  1H9S B;  3OWF A;  3OMC A;  4KY5 A;  1I3Q B;  2F0T A;  1TS3 A;  5C3W A;  1UNS A;  2AUK A;  4A3D B;  3T56 B;  2R3Z A;  3GV3 A;  1HHV A;  3I4L A;  3BYY B;  2M00 A;  2KJX A;  2R6G A;  4IFD H;  2EE1 A;  2K05 A;  3S1R B;  5I2X A;  3NQT A;  2QDB A;  2SEB D;  2NYZ D;  2VB2 X;  4A93 B;  1Q3L A;  3BG3 A;  1PTO F;  4IZ8 A;  4FXK C;  4A3M B;  5E4X A;  1HUM A;  1KLU D;  3SK4 A;  1TWC B;  4L63 B;  2D5D A;  2PPB C;  1CTM A;  3OIP A;  3ND9 A;  1CI3 M;  1QG7 A;  4BS9 A;  1TS4 A;  4RAU C;  2BA0 A;  4PMC A;  1PTO D;  1UAP A;  4XIG S;  3HOX B;  2PCF B;  1Y8O B;  3HOZ B;  1B1Z A;  2ZXR A;  4DNR B;  1PMR A;  2JA5 B;  3ND8 A;  1WD0 A;  1XYI A;  3D3R A;  1SAP A;  1Q90 A;  1IKL A;  2F0P A;  3MHB A;  1CM9 A;  4RGN A;  2NUC A;  2F0H A;  3EFX D;  1FYC A;  2JA7 B;  4A3F B;  5KNC A;  3AU7 A;  1QJO A;  1LT4 D;  4HTH A;  1ENF A;  5JEA J;  3J81 L;  5C0X J;  1O7Y A;  3SXH A;  5LHY 1;  5KRU A;  3D4R A;  5C4H A;  3CU7 A;  1MBY A;  5K36 H;  5JVH 3;  2HQE A;  2NVQ B;  4RWS C;  1KDC A;  2F0I A;  4CKE A;  4FXD A;  3V05 A;  4OGQ C;  3A55 A;  2F0K A;  4DFA A;  3Q23 A;  3OPO A;  5M3F B;  1L0X B;  1V1O A;  1I4X A;  1CA6 A;  1RD9 D;  5IT9 L;  4A3G B;  5JOB A;  4ILW A;  1H9R A;  1FGB D;  1YNJ C;  4N9P A;  1TT2 A;  1TII D;  1I4P A;  2JSO A;  4QF4 A;  2B2V A;  5CC4 A;  3DUZ A;  2DY8 A;  2L1B A;  2K5Q A;  1D6E C;  2F0V A;  3HKZ B;  4HCS A;  4KN7 C;  4K5X A;  3O13 A;  5LL6 X;  3BYT B;  3FRP B;  4C1N K;  4IUT A;  5FOB B;  2EY5 A;  3U9O A;  5CBA E;  1F2Y A;  3AB9 A;  3IFD A;  1HA6 A;  2ICE C;  2EYO A;  1HQR D;  2L4N A;  3J81 E;  3QB3 A;  4K6D A;  2EJG C;  1LTS D;  2YYZ A;  1W6K A;  4BWG B;  4IAL A;  3WOF A;  3KBX A;  3FPP A;  3K5L A;  3H6M A;  1BCP C;  2DNE A;  3TP5 A;  5HUR A;  3D6W A;  4F8M A;  1PDQ A;  4C3J G;  2I46 A;  2NVT B;  1A15 A;  3QIA A;  1K83 B;  3JAM L;  3A8J E;  3C3L A;  2VXW A;  2CHB D;  3P1H A;  4RCO A;  2LMC B;  1E2Z A;  1H9K A;  5D3D A;  4PV1 C;  3M4Y A;  1BR9 A;  4C56 C;  1H9J A;  1BQQ T;  1PTO B;  1SE3 A;  4Q0F A;  1CHQ D;  3I90 A;  3HRZ C;  3KUP A;  3HOW B;  2K28 A;  4EQO A;  1KAA A;  1JWS D;  5C4Z A;  1HTL D;  1F9P A;  1KDB A;  1NR4 A;  2F0O A;  4KKU A;  3NHH A;  4DAP A;  3ITP A;  2G9D A;  3E0J A;  1UUP A;  4KY6 A;  1S5F D;  5C4J B;  1KNE A;  5LL6 S;  4RKB A;  3VYT A;  1QCB D;  4TSS A;  2AWN A;  2NWG A;  2E2I B;  1KAB A;  3MWY W;  3CHB D;  5E4W C;  2BDN A;  3PIP 3;  1NCV A;  1JOK A;  2N88 A;  1ROD A;  5C3X A;  3SK5 A;  2XWJ B;  2IWH A;  2K7V A;  4NP5 A;  1WVL A;  5CV7 A;  4HSP A;  1XXG A;  1F9Q A;  5G3L F;  2OF1 A;  5KYI A;  3M4O B;  1STG A;  4ID6 A;  4V0B A;  4E6I A;  3DHQ A;  3PMF A;  4WRD A;  4NDX A;  1U4R A;  3PUY A;  2MJ8 A;  4IUQ A;  3HZX A;  2F4I A;  1PYW D;  5CYU A;  3N52 A;  2NN6 I;  3LWE A;  2TSS A;  1EY0 A;  3VA7 A;  2WAC A;  1O80 A;  4HAE A;  1TKW B;  3PUW A;  3GTM B;  1EQT A;  2PW7 A;  4ZKB B;  3OHX C;  2ZXP A;  2F0Q A;  2K01 A;  3GTL B;  4MIU A;  5IGG A;  4OIJ A;  1DYQ A;  4R8I A;  3GTQ B;  3V96 A;  1VF7 A;  1BF4 A;  4NKL A;  2HUG A;  2M9V A;  4K6L A;  2RSO A;  2B63 B;  3S16 B;  4OHJ A;  4QMG A;  5FO8 B;  3TME A;  1G2T A;  4S3S A;  2F0L A;  3OW7 A;  1EY7 A;  1JB3 A;  1L0Y B;  1V8Q A;  4IUU A;  2EYL A;  2NN6 G;  1GUT A;  3TZU A;  4K5V A;  2IX1 A;  2I07 B;  3H0G B;  1S5E D;  5M9O A;  3A54 A;  1F2M A;  1I4R A;  4XQJ A;  2XVS A;  2A68 D;  1HFG A;  2B2U A;  4GZY C;  1BO0 A;  1PZK D;  4ZYS A;  3CQZ B;  1Z47 A;  2EZV A;  4G7O C;  4KJO A;  2EY1 A;  3EQL C;  2HDL A;  2O5I C;  5CR3 A;  4U68 A;  1EU3 A;  1ZEQ X;  1PLF A;  1TVX A;  1I4G A;  2KED A;  3NPP A;  5I6W A;  5IGF A;  1RKN A;  2VUM B;  5FLX L;  3TZD A;  5AFW A;  3D6C A;  2AWO A;  1BDO A;  4FXG C;  3R3O A;  1JOR A;  3R2I A;  3ERQ A;  1OO9 B;  1TWF B;  2AQ2 B;  3G7L A;  3VA5 A;  2IT1 A;  5C0X I;  1PTO C;  1GUO A;  1S5B D;  1R9T B;  4G4K A;  1H9M A;  1B9M A;  1MSG A;  1SNO A;  4R9W A;  2EJM A;  1E2W A;  2XN9 C;  4DN4 M;  1CQF A;  1GUG A;  5KGU A;  3V2T A;  3TBI B;  2NTS A;  3L3O C;  1EY5 A;  1PRT C;  1SYB A;  2IX0 A;  4ME5 A;  5ELB A;  5FO7 B;  2MPM A;  1Y8N B;  3E5S A;  3A7A B;  3C2P A;  4ULL A;  1ESR A;  2RA4 A;  4QIW B;  3GD7 A;  1JC7 A;  5IT9 E;  5DM7 3;  4L6T B;  1ICW A;  1X32 A;  2QF7 A;  3FVQ A;  2EXZ A;  2WIN B;  5IIF A;  1Z6H A;  4HN7 A;  1RF2 D;  3AMU A;  4KN4 C;  1B53 A;  4H44 C;  3S1Q B;  3P20 A;  4RCN A;  1WTR A;  5ELD A;  5KNB A;  4DK1 A;  2L0C A;  4DK0 A;  4EQN A;  4BA1 I;  4CKC A;  1LT6 D;  3OOC A;  1Q12 A;  5KEE A;  4RFB A;  3QOJ A;  2IW3 A;  2L9H A;  2IPK D;  5I9P A;  1G91 A;  2RDG A;  1VMC A;  1SYC A;  4WFN 3;  4WOR A;  4ZKC B;  1MGS A;  3HOV B;  1D2B A;  3GV6 A;  1EL0 A;  1OXS C;  1IW7 D;  3T16 A;  1EEI D;  1Z7T A;  4RHS A;  1EZ6 A;  4ZRZ A;  1SBB B;  2X6G A;  1LTT D;  5CBE E;  2FHT A;  3H3V C;  4CGY B;  3VYS A;  5FKA C;  4V19 0;  5I4D A;  4A3J B;  4I7Z C;  2NVX B;  4DXF A;  5C6A A;  1F2Z A;  2FMC A;  5J22 A;  3K5M A;  1SYD A;  4XYQ A;  1OXV A;  1TWG B;  3I3C A;  1VF5 C;  4DAV A;  1SMY C;  4NMZ A;  4XT3 B;  1JR0 D;  3S2H B;  1FNW A;  1XX8 A;  3NQI A;  1DCZ A;  1LTR D;  4K14 A;  3VR5 A;  4B9X A;  2D62 A;  1LO5 D;  2WKC A;  1DM0 B;  2PZW A;  3G6J B;  3J7A V;  2MP1 A;  2VNU D;  4QUC A;  2JE6 I;  4DAY A;  1A2U A;  2BCO A;  1EY6 A;  3BS1 A;  3WDN A;  2K6A A;  2L11 A;  1K8M A;  3A8I E;  1BUV T;  1EYD A;  3W2D A;  4B9W A;  2A5H A;  5IGB A;  4IUN A;  5COY A;  4JBW A;  1WTX A;  4DA2 A;  5M5X B;  2F0S A;  4J1M A;  1T5E A;  4IFD G;  2M2L A;  2JA8 B;  1DXM A;  1HPC A;  3DWA A;  5C0X H;  4C3H G;  5BN4 A;  5EPK A;  1SNP A;  2XNA C;  3HGB A;  1CZW A;  2J0T D;  1PXU A;  5CV5 A;  4G7Z C;  3IAY A;  3BVM A;  3SK8 A;  2NVY B;  1QE6 A;  2B2T A;  1B9N A;  4EGV A;  3VR3 A;  1AZQ A;  4LK1 C;  4BY1 B;  4H7B A;  3K57 A;  4KHV A;  3GTO B;  4C3H B;  4F88 A;  4RHR A;  4J6H A;  5EBD A;  3ERO A;  3P75 A;  3H91 A;  3S15 B;  2IX3 A;  3N6R A;  5J39 A;  2JEA I;  5EGT A;  2A6H D;  3GTG B;  3HOY B;  4HED A;  1YNN D;  1TR5 A;  3TSS A;  1IL8 A;  1ML0 D;  4ZLT F;  3Q24 A;  1IW7 C;  5JEA H;  1EIH A;  2BDO A;  4G7H C;  3I91 A;  2AQ1 B;  3IL8 A;  1X3Q A;  4PMW A;  1SNC A;  4X3T A;  3VYU A;  5C5L A;  1TWA B;  3S14 B;  1LTG D;  1PFB A;  2SDF A;  1XTC D;  2ZXO A;  1KNA A;  4G57 A;  2BOS A;  1WCM B;  1MD2 D;  3K0Y A;  1KLG D;  1STA A;  4KD4 A;  4WJW A;  3T53 B;  5KYL A;  2A6H C;  2EPB A;  2B2W A;  1XWE A;  1SXT A;  1CT1 D;  3GTP B;  4BBS B;  4I65 A;  4L8J A;  2BE5 D;  3FDT A;  3MC0 B;  3NBI A;  4CBV A;  2A6E C;  3TP8 A;  1KTK A;  2KEE A;  3RMH A;  4HCE A;  2PMZ B;  2JYO A;  4KJN A;  2KOL A;  4FVM A;  2B2Y C;  5DM6 3;  1SYG A;  4LAA A;  1EY9 A;  2EY2 A;  5E1F A;  4CJ0 B;  4UDU C;  1GHJ A;  4DU9 A;  5HGT A;  4X3K A;  1GOZ A;  1EOT A;  5C4X B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...