5IGDA

Crystal structure of staphylococcal nuclease variant delta+phs t62h/i92e at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFHKKMVENAKKIEVEFDKGQRTDKYGRGLAYEYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS T62H/I92E at cryogenic temperature
rcsb
source organism Staphylococcus aureus
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5igdA00
2QDBA 1JOQA 1EY7A 3DMUA 4PNYA 3SK8A 5CV4A 2OXPA 3NP8A 3SXHA 3TMEA 3PMFA 4G57A 1A3TA 2LKVA 4J6HA 2RKSA 5KYIA 5CV9A 2PZTA 5J1ZA 4F7XA 1JOKA 2F0TA 4PMBA 3R3OA 3SR1A 3T13A 2O4XA 1RKNA 4F8MA 4NMZA 1IHZA 2F0PA 2ENBA 3EJIA 3C1EA 3QB3A 3NQTA 1STNA 2EYPA 2PW7A 1ENCA 4J1MA 5KGUA 2F0VA 2F0GA 5KRUA 5IGGA 2F0LA 2RBMA 1SYDA 1SNDA 2F0HA 3P1HA 1A3UA 4NP5A 4HTHA 4K2LA 4KY6A 3DHQA 5C3WA 3ITPA 3H6MA 5E1FA 5M9OA 3BDLA 1EY6A 1SNMA 1EY8A 4K5XA 4KJNA 5C6AA 3P75A 1SYGA 1F2ZA 2PZUA 4ZQ3A 3NHHA 1SNOA 2EYLA 4HMIA 3TP8A 3BDCA 4IUNA 5CR3A 4K14A 4LAAA 5EKLA 5KIXA 2NUCA 2EY5A 1STYA 1KDCA 2RDFA 3D4WA 4K8JA 1EQVA 5C3XA 3C1FA 1EZ8A 2EY6A 2F0NA 4K2KA 3SHLA 4DU9A 5I9OA 2OF1A 4KY7A 5CV5A 5NUCA 2F0UA 3TP5A 1TR5A 4KY5A 5CC4A 4IZ8A 5E3FA 2PYKA 3NUCA 3MVVA 4K8IA 1KDBA 5CV7A 4KHVA 4DF7A 1SNCA 2KHSA 4KD3A 4S3SA 4EQOA 1F2MA 3MZ5A 2F0WA 3D8GA 4K5VA 4RKLA 3QOLA 1STHA 1EYDA 4N9TA 5IOCA 1KAAA 1TQOA 4MIUA 4ZUJA 3TP6A 3T16A 4B9WA 2F0MA 5JOBA 4K5WA 2F0KA 4QB4A 4WRDA 1U9RA 4KTAA 3SK6A 1EZ6A 2F0JA 2EYOA 5IGEA 2PQEA 1KDAA 5JAVA 2EYHA 1SNPA 5IIFA 2SNMA 5EKKA 1EY4A 2EY1A 5IGBA 1STAA 4QF4A 5C5LA 5EGTA 4ME5A 3OMCA 3RUZA 5IODA 3MEHA 3MXPA 4TRDA 2EYJA 3SK5A 3SK4A 5KYLA 4QMGA 1AEXA 4DFAA 1EY0A 1STGA 2F0OA 4KJOA 3TP7A 5HURA 4KD4A 2OEOA 3EVQA 4ODGA 1TT2A 4RKBA 2F0SA 4YIJA 5IGDA 3VA5A 5ISRA 1SYBA 5C4ZA 1NUCA 1STBA 1SYCA 4K6DA 3S9WA 3LX0A 1NSNS 3MHBA 4HMJA 2F0FA 3D6CA 3EROA 1A2UA 3OWFA 4I65A 4PMCA 5C5MA 5K5PA 3ERQA 5I6YA 1JORA 2KQ3A 4IALA 4EQNA 5DAUA 2F0EA 2HQEA 2M00A 1KABA 2EYMA 3U9OA 3V2TA 4ZUIA 2SNSA 3NXWA 2SOBA 5CV8A 4B9XA 5I9PA 5HGTA 5J22A 5CV6A 1SYFA 3HEJA 4NDXA 4EVOA 3QOJA 1EY5A 5IGFA 2F3WA 2EY2A 3HZXA 4DGZA 5F2DA 2EYFA 4OL7A 5I6WA 1EYAA 2F0DA 2WACA 3D4DA 1ENAA 2F3VA 3OSOA 4ID6A 5J39A 4R8NA 2F0QA 2EXZA 1F2YA 3NK9A 1EY9A 3OMGA 2F0IA 1SNQA 5C4HA 2PZWA 1EYCA 2PW5A 1A3VA 4WORA 4N9PA 4NKLA 4E6IA 4EQPA 5CGKA 5KEEA 4KV6A 1II3A 5DEHA 1SYEA 4H7BA 1A2TA 5IGCA 1JOOA 3E5SA
chains in the Genus database with same CATH superfamily
1EY7A 4C3HB 3F1ZA 3FRPB 1MD2D 5CV4A 3PIPA 3L3OC 3RZOH 3PMFA 1IYVA 1BCPC 4X3TA 4F7XA 1AZPA 4ZLTF 2KCCA 3NQTA 1Z47A 1IBML 3BZKA 5C3EB 1ENCA 5EQ0A 4A3JH 5IP9H 2KVMA 4NP5A 4ZCKA 1L1OC 2AWNA 3I4NG 2QA4A 5EAYA 1NR4A 3HOXH 1GO3E 2VUMG 4TSSA 1I6HH 1K0RA 1CKMA 4KN4C 3DEOA 1X3FA 2UUAQ 5IT9L 3SHLA 3S16H 2R92H 1QNUA 4LF9L 2X69A 4P71A 5I4DA 1ENFA 4QQBX 2D0PA 3DM3A 2DY8A 2HIXA 5CBEE 2JA5B 4A3GB 1P8LA 1E22A 1LT6D 1H9RA 5IOCA 4FP5D 4GNXA 4A3EH 1JJCB 1W3SA 4MIUA 2ZJRA 1IKMA 4WFN3 1W2BA 2O5IC 1NR2A 1SMYC 2VQEL 4WRDA 5GAEC 2F0JA 1M90C 1QE6A 1TY2A 3HS0C 3CU7A 4DNRB 1MBYA 1MI2A 4FXGC 2I46A 3F2BA 2H1EA 4RHRA 2PI2E 3CCVA 3PF5A 4C3IG 1FR3A 1WFQA 2V4DA 1FGUA 4C3HH 1BKBA 5DM73 3S1NB 5A2QE 2GVAA 5KNDA 1IKLA 5LL6S 3NBHB 1VQ8A 1BOSA 2A6HD 2F0EA 4F87A 1QWYA 5C3EH 4LFCL 5C4JH 5HGTA 3K5LA 3HEJA 4EVOA 2B63G 4ZAIA 2Z6KA 3NE5B 3S1RB 3BVGA 4B3TL 1RTNA 3K80C 1YJNA 2BDOA 3D4DA 4X66Q 1OXTA 4A3DG 1TIID 4R4QA 1SNQA 3KLSA 5DNFA 1ZYRD 3R8BA 4WORA 2ZM6L 1LTAD 4XIGS 5M5XB 4YCVA 4A75A 1DJRD 4BXXH 1SYEA 5HY6A 4ZKCB 5C3XA 3OIQA 5D65A 4DR7Q 4BBSB 2PCFB 4IQZA 4U68A 2NB0A 2J7ZA 5LL6X 1O7IA 2JA5H 2K50A 1UNSA 2EYPA 4A3GH 4BY7B 3KBXA 4DV1Q 2UXBQ 3G48A 4A3IB 1Y1WG 5FLXL 2VXWA 1KRSA 2KBNA 3G71A 5E1FA 1DOMA 2B29A 5DLQE 2WAQE 4IPHA 3VYRA 4DR6L 1DONA 4DR4L 4GN5A 4HMIA 4JI7L 1EOTA 1YI2A 4RGMA 1RL2A 2N49A 2UUCL 1SE8A 4YCWA 3TDQA 3EQLC 4BA2I 3ERSX 5CV5A 5NUCA 2EJGC 2JXMB 3CAMA 2R7ZG 1O7ZA 3NBHA 3PO2G 4OWTB 4DAVA 1G8ZD 2A19A 1XX8A 4HAEA 3S1NH 2KHSA 3S2HB 2F4VL 2Q2UA 4K5VA 4GLVB 2K5VA 3STBD 1CTMA 3GDEA 1SRUA 3T16A 3GTKB 4JI0Q 1V1QA 2JEBI 4GS3A 2MP1A 2B2UA 3A7LA 3SK6A 1PH3A 3I91A 4LMQD 5K36H 2KUMA 5JAVA 3S1RH 3GTPB 3CMAA 3E9HA 1JWUD 3A0JA 3NBIA 2DGYA 4WJ3M 2XGTA 1H9KA 2IHFA 1EIGA 3MXPA 4ABNA 5M5WH 3JAML 5EPKA 3D0FA 4OIJA 1B1ZA 4ODGA 5M5XH 2F0SA 4OX9Q 5FO9B 4DAYB 3VR2A 4BBSH 4X6AH 3I4MG 1NY4A 4RGNA 4RAUC 1HNWQ 1PTOD 1VQ4A 3ERQA 2DUDA 2E5LQ 3ZJYC 4BY7H 2SOBA 4B9XA 5I9PA 4A3IH 2AHOB 3SEBA 1NJIC 1OXXK 2HDMA 1K73C 4LF5L 4C1NK 2A8VA 2EY2A 2MHVA 4X64Q 4R4OA 4JI8Q 2AWOA 4A3CH 1X3EA 1GUSA 1B53A 2N78A 3HOVG 3F8TA 5CGKA 1N8RC 3HOZB 2XSCA 2B2YC 2OQKA 1PYWD 3K81C 5LMUQ 1XPUA 2EVBA 1BO0A 3E6ZX 2P5ZX 4JI2L 1Y69U 1L1OB 1Y1VH 2OQ0A 2HHHL 3KJOA 3UDFA 2Q8IB 1JJ2A 2MUYA 4DR1L 4H13C 4A3MB 1HNXQ 3S2HH 3LWEA 1S40A 2K28A 1DOLA 4IJLA 1ML0D 4BY1G 4P75A 4K2LA 3KUPA 3GTKH 5M5YB 2A69D 3BDLA 4XQNA 1X54A 5LMNW 1YHAA 3NHHA 1YBYA 4QY7A 1VQPA 3VA7A 2YTYA 5IYDG 4CDCC 2EY5A 3HFZB 1EOVA 4K2KA 4KKTA 2OCEA 1WOCA 2WB1G 4KY5A 3J81E 1O78A 1TU2B 1XJVA 1B44D 3QWNA 3AFQA 2IPKD 4OIKA 2F0WA 4JBJA 4LUVA 1KAAA 1IBMQ 3C2PA 5BN4A 3P20A 1DGSA 1U5KA 2B8GA 3CCMA 2SDFA 3CCJA 4KTAA 3VYSA 1S5ED 3A56A 1VQJA 4DUZL 5EKKA 5IP7G 3CPWA 1HFGA 4QUCA 3A54A 2RDGA 1ILQA 1STGA 2B2TC 2J0TD 3HOZH 5ISRA 4UP7A 4IFDH 5JJLA 3TSSA 5BN5A 4IO9A 5IYCH 4LF9Q 2E2HB 2Z1CA 4CJ1B 2HDLA 2MPMA 4HMJA 2B3GA 3OWFA 1Z9FA 4JOIA 3GD7A 1VQOA 2VB3X 4A3MH 1OTCA 1H9JA 2ZJQA 4IFDJ 4QIWE 1IL8A 1W6KA 2VQEQ 3I4LA 4AYBG 1X9NA 2OWOA 3CD6A 1EY5A 4JCVE 1QB5D 5M5YH 1Q46A 2VB2X 1CI3M 4BWGB 4DXGA 4KK7A 4ULLA 3J7YW 1X3PA 3PV0A 4EQ5A 1DXMA 4E6IA 2F3IA 4HJ5A 1K8OA 1VDZA 2PQAA 1NCVA 1CUKA 1DM0B 3PUWA 3J7ZC 1XXGA 4CGYB 2RCFA 2L9HA 4JI5Q 3PSIA 1VQLA 4YWMA 5IE8A 1HZAA 5TSSA 3T13A 5EBCA 2PNHA 4J1MA 1C8CA 1J9OA 2BH2A 2F0LA 2RBMA 1MSGA 4IPGA 4LFCQ 2A6HC 1DZ1A 3QR8A 1ILPA 4K5XA 2PZUA 4GNXC 4B3TQ 4XQQA 2UXCL 1NE3A 5CBAE 1HZCA 3UI2A 3KF8A 3MA2B 4IN3A 2G5DA 2K6AA 1CT1D 4JI4L 1IBLL 2UUBL 2PPBC 2R93G 2F1MA 2ZM6Q 2ID0A 1I94L 3HGBA 2DN8A 1HNZL 4R1JA 2OF1A 1ZYRC 2PO4A 4L63B 1NAPA 1JQYD 4K8IA 4JC0A 1KDBA 4DF7A 1P16A 1YITA 3R93A 3D8GA 1HFNA 5EPLA 3S1MB 3S17B 1QJOA 2F0MA 2JA6H 1N36L 1I4PA 3UDIA 2X6GA 2C9OA 2IWHA 1EZ6A 1WD1A 1MKHA 3A7AB 1WTPA 4DR6Q 1ICWA 4JI7Q 5EGTA 4ME5A 2UUCQ 1WYDA 1VQ6A 2ICEC 4OELB 1Z7TA 1AEXA 4DFAA 3HOYB 3TP7A 3EVQA 1HUNA 1TT2A 3CXCA 1CK1A 3DWPA 3IFTA 4K6DA 1HPCA 2YYZA 3HP3A 2WKCA 3MHBA 3J80E 1E1TA 2F4VQ 3J7AF 2BCOA 1PH5A 3KLWA 1STEA 3FEWX 3W1GA 1X3GA 1K0SA 2Q8TA 2NN6G 5IYBH 5COYA 2F3WA 3CRKC 4BBRB 4LF7L 5F2DA 4DK3C 4ID6A 1E2VA 5HGQA 2EXZA 3NTIA 2GN5A 1CQVA 5IY0A 1NTGA 3VR5A 3C46A 1LTRD 2UU9L 5IGCA 3QB3A 3E5SA 5H1SE 2ZTDA 2VUMB 1CSQA 2EPBA 4JI6L 1E0BA 1O80A 4X3UA 2M2LA 3L7ZC 1K8MA 2IL8A 4JG2A 4DV3L 3IRBA 1TS5A 2PI2A 3PGZA 3CMEA 1PTOC 2K32A 3GTLB 3S1MH 4GOPA 2J4XA 3S17H 2K5HA 3EFXD 1EQRA 1LT3D 4CBVA 3KOJA 4LF5Q 1I5FA 1CZWA 1LLRD 4OHJA 1EY6A 1EY8A 3H0GH 1I50B 2R3ZA 4JBWA 1LO5D 1GUNA 5EKLA 2XRQD 4L6TB 2JA7B 1U4MA 4K8JA 2Q2IA 1WCMG 2C35B 1BF4A 1S5FD 2PYKA 4JI2Q 4TVAB 2HHHQ 4P72A 1SNCA 4KD3A 4S3SA 4DR1Q 1VQ5A 3OW2A 1K28A 1VS0A 3ULLA 3MFYA 3QOLA 4XXEA 1JICA 4ZKBB 1F9SA 1LM0A 3BVMA 3CPFA 4KN7C 4X65L 1ZKOA 1JCKB 2X6LA 3BJUA 4C1NI 2EYOA 4LJZC 5IGEA 1AP0A 1TS4A 3S24A 3GTQB 1GXDC 4BBRH 2A69C 1A15A 1EY4A 2CHBD 2Z4IA 2NWGA 3RUZA 2ES2A 4TRDA 4RG1A 2YTXA 4QMGA 2CKZB 3I4NH 1RCVD 1T5XD 1UEBA 1FJGL 2JA8G 3VA5A 3DEPA 4RWSC 2B2VA 2VUMH 3SVMA 3PCOB 4DR5L 1S5DD 1E2WA 4RA8A 3CC4A 3OWEB 4I65A 1Q81C 3QG1A 1LV9A 4YWKA 1K83H 3V2TA 1ESFA 1I6HB 5CV8A 1J5EL 3H3VI 2R6GA 3GTLH 4IUVA 1GOZA 1TWCB 4HIOA 3CCSA 1FGBD 1I50H 1SE3A 2E8GA 1Y1WB 4DUZQ 2R92B 4JBMA 4K6LA 4UAIA 1BUVT 5JEAG 4EQPA 1PV4A 2QW7A 3E3XA 4MNOA 1IYUA 3TS2A 1YNND 2JK8A 4FO2A 1RODA 4KHPL 1JMCA 3DMUA 3GTOB 2EZVA 4A3EB 1QVCA 1FL0A 1AE2A 2ENBA 4GNXB 3BZDB 1NBWA 2K75A 1OXSC 3DUZA 2R7ZB 4I7ZC 1HTLD 4KMUC 3PO2B 1D6EC 4IOCA 1WTOA 1CA6A 2NN6I 1BDOA 4B3ML 3ITPA 1IBKL 3AMUA 3WDNA 2K14A 3L9AX 1G51A 1BBWA 3OPOA 3J81c 3GTQH 1I6VC 3BDCA 2CQOA 4HIMA 3CCEA 4U673 2KENA 2I5HA 1EQVA 2E75C 4DU9A 1SEBD 5AFWA 2GA4B 4XQJA 1YEZA 4X3SA 1VQ9A 4Y52H 5C4JB 1HUMA 4M1UB 4OWXB 4N9TA 1G6ZA 1VQEA 1PTOF 3TN2A 4M8AA 4XDXA 1WVLA 4JOIC 4DK6C 1XYIA 1KDAA 2WAQG 1TWCH 2UXCQ 1JB3A 3MEFA 4JI4Q 1Y1WH 4FF4A 1IBLQ 2UUBQ 2IY5B 4ZYSA 1R9TB 1X56A 4OXPA 1I94Q 5HURA 4L5RC 4O42A 4RKBA 1HNZQ 2OTJA 1FNUA 1TWHB 1LTTD 3GTOH 3W5OA 2K5WA 1T9HA 1A2UA 4A3FG 5K5PA 2NYZD 2AMCB 1DOKA 2D2CC 3G6JB 1MIUA 1RHPA 4X62L 2JQOA 3NXWA 2R7ZH 1N36Q 3PO2H 1C0AA 4CDFC 1RD9D 1R4PB 5I6WA 2F0DA 1X55A 3J7AV 2XWJB 1QILA 1DYQA 4R8NA 1N33L 2JSOA 4BY1B 5KEEA 1D5ZC 1UUPA 4XTCS 1DD2A 1PTOB 3SK8A 4G7HC 2OXPA 3SXHA 5I2YA 5D3DA 1A0IA 1MJEA 2A68D 2F0TA 3PO3G 1WTHA 4Y7NB 1PFMA 3SDZA 4A3LG 2B2WA 3M4OB 1YHBA 5FJ8G 2WB1B 3PF4A 2PW7A 5KGUA 3MAQA 4FDBA 3I90A 3CP0A 3D3RA 3NWTA 1YHQA 2VZAA 1A63A 3H6MA 5M5WB 1PH8A 4LF7Q 5I2XA 4PQXA 4DV2L 3W1BA 3X3NA 4P2CB 1E7ZA 4RHSA 1TWFB 5C0XG 2FXQA 1JE4A 2K05A 1RDPD 4CKEA 4JV5L 5ELEA 1JT8A 3C1FA 1R9TH 3BYYB 1HR0L 2Q2HA 3M7NA 1N32L 2IW3A 4JI6Q 1EIFA 1TWHH 2FHTA 3MVVA 3W2DA 3OW7A 2VQFL 4KHVA 2NVTB 2VL6A 3DWQA 3I70A 1W6JA 2Y0SB 4DV3Q 3CCLA 1JC7A 1UWVA 3IL8A 4IUQA 3DXJC 1UEAB 2VS1A 1K9MC 3LNNA 4XT1B 2N3SA 1T5EA 4HEDA 1C7YA 2EYHA 1SLJA 3TRZA 4DAMA 2CW0D 1B3AA 4AYBB 1MSHA 1Y1VB 3J80c 4BY1H 1D1IA 1CHQD 1H95A 1PFBA 4G7OC 4B3SL 1PTOH 3BZCA 4IUUA 2H5XA 1LTSD 2AQ1B 3EROA 5IYDH 1KNEA 2K5QA 1EU3A 4GZYC 4IUPA 2MO1A 2YU9B 3HOUG 4Y7NH 2K4KA 4CKCA 3M4OH 3U9OA 4X65Q 2WKDA 4OO1I 1PLFA 4FXKC 4AIMA 4DV7L 3RLNA 1GUWA 2EYFA 4OL7A 2ZTEA 4H44C 3I2ZA 1LT4D 4NXNL 5KNCA 4GOPC 3OMGA 2MO0A 3IAYA 3HKZE 2PW5A 2K03A 2BH8A 1TWFH 1A62A 4C3HG 3HKSA 3CHBD 1FJGQ 2QDBA 2MNAA 2L5TA 3TMEA 4GKJL 2KCMA 1M8AA 5IP7H 4WJ4A 4DR5Q 1PH9A 2JN4A 4EGVA 5C3EG 3S1QB 5ELNA 2KJXA 2NVTH 3J81i 5FOBB 4ZRZA 2KEDA 3GTGH 5JPMC 3T4AC 3FKIB 4A93G 4PZ8A 1LTBD 4HJAA 2F0HA 1J5EQ 1PRTD 2FMMA 3DHQA 5C3WA 4HJ9A 4DNIA 3NSWA 2I07B 1F2ZA 2KCTA 3BG3A 4YY3L 1SNOA 1O7YA 1YIJA 1K8AC 5CR3A 1VMPA 4NXML 1X65A 1O7LA 1SE2A 3RLFA 5I9OA 1G291 1TS3A 1I4XA 4KY7A 1EIYB 1TR5A 1VQ7A 1HHVA 4IZ8A 2PMZE 5L37A 2G9HD 1YNNC 3NUCA 3I56A 4A3GG 4B3RQ 1AW7A 1GHJA 3M85A 1RTOA 5JVG3 1I4GA 4UPAA 2YU9H 2B2VC 3MXUA 1EFWA 1Y8OB 3UDXA 4DV5L 2D0OA 5JVH3 3RLOA 1Y8NB 4JYAL 4B3MQ 1G2SA 1HQMC 1IBKQ 2B39A 2JP1A 2PQEA 2NZOA 3FPUB 3KLSX 1EEID 5C0XI 1PDQA 2PQAB 3MFGA 3SK4A 2RVLA 1K8GA 1I4HA 1LABA 2N55A 4DAPA 2OEOA 3ULPA 1HA5A 4UHVA 2LMCB 4ILWA 1CKNA 5FKAC 4BA1I 4FF2A 2NVXB 2A5HA 2CWAA 4CDEC 1HJPA 4JI1L 3S1QH 2NVYB 1YNXA 2A73B 2M00A 4N8FA 3A8JE 3FKIH 3VR6A 1U4LA 5K36G 1CA5A 2RCNA 4DV4L 3WOFA 5AJ3L 1PYSB 5IGFA 2HQLA 1UAPA 4DGZA 3KF8B 3NELA 1F2YA 3KJPA 4IJHA 3UE0A 5G3LD 3H3VH 3DLLA 2AQ2B 4PZ6A 1A2TA 2QILA 3BU2A 4B08A 1XPOA 1SFOB 4LFBL 5KYIA 4CKBA 4LF8L 2JA6B 2PNRC 3SR1A 4BY7G 2KHJA 1XMQL 1IHZA 1WCMB 4ME3A 1C9OA 1M1KC 1VQKA 4TQUS 4PV1C 2F0VA 2DNEA 4MZ9A 2E74C 1TY0A 4A3KG 3KFUA 1HTPA 1SAPA 2D5DA 1S5CD 1B70B 1PFSA 3I73A 1EWHA 1L2FA 1N33Q 5FO7B 2NUCA 2RDFA 1GVPA 1IXRA 3B6YA 3FHWA 3NPPA 1HRJA 3PQIA 4DK0A 3K7AB 5CMDA 2QF7A 1BCPD 2TMPA 3BDOA 2NVXH 1BQQT 4GN4B 2NVYH 2R7DA 3PUXA 3J80i 5M3FG 5A2QL 5FLMG 2IX3A 1EIHA 4EX5A 3T51B 1V9PA 4O2DA 2ATWA 1V1OA 1JR0D 4DV2Q 3L0OA 2VY3A 2HCCA 1KIXA 4NW2A 3FMCA 1GHKA 4JV5Q 1SBBB 4XT3B 1HR0Q 3H09A 4R4CA 5C4ZA 1N32Q 4FNFA 3S9WA 1SFOH 2VQFQ 4DV0L 1JWSD 3PUZA 2EQSA 3F2CA 4POGA 2WV6D 1JORA 3H0GB 3PIP3 1WCMH 5DAUA 4GOPB 5BN3A 5JJIA 4DR4Q 1Q82C 4L5SA 1VCIA 3GP7A 4NPSA 4RFBA 1WJJA 2B2WC 3ND9A 1QUQA 3S2DB 4OONA 3K59A 4A3BB 2NZ1D 4JI3L 3RR5A 1J8IA 4NKLA 1V1PA 4R4TA 1WTWA 2K5DA 4RCOA 4B3SQ 2Y0SE 4AQYL 1DCZA 2WINB 3K7AH 3GO5A 4F8MA 4ALPA 2F0PA 3STBC 3HOWG 5D3IB 2JA8H 2AUJD 4DKAC 3RNUA 2Z0SA 1CKOA 1B9NA 3W3AA 5CORA 3CKIB 3UE1A 2ZTCA 4DV7Q 4A76A 2KEEA 3ICEA 3A5UA 3I4NB 5BR8L 5C4XG 1A6XA 4GLAC 3TP8A 4DV6L 2QCPX 3UDGA 4NXNQ 4K14A 2RDHA 3D4WA 4RMFA 2K52A 2XN9C 4C3JG 2K04A 3TP5A 5FLXE 1E2ZA 1K83B 4GKJQ 1KRTA 2HCIA 2ASBA 4Z9CB 4EQOA 4FVMA 2CQAA 4RKLA 1XTCD 1GJXA 1SXTA 1NMGA 4ZUJA 2KA7A 1VQDA 1D8LA 2F0KA 4UP8A 5C44G 4DV1L 5DM63 4A3FB 1WD0A 1D2BA 2KOLA 3U9SA 4O0AA 4YY3Q 1STAA 2JYOA 3S2DH 2HUGA 3H94A 4NXMQ 4A3BH 2LY7A 1FNWA 4YIJA 3RN2A 1TWGB 1GUOA 1Q7YC 1I4QA 1KLGD 1NUCA 4C3IB 3ULJA 4PZ7A 3SGIA 3EBEA 3M4QA 1L0WA 3KF6B 4Q0FA 1VQIA 4IALA 3A5ZB 3Q22A 2IX1A 1X6OA 4LUZA 4P73A 4DV5Q 1RIPA 4KI0A 4NDXA 4JYAQ 3JAME 1MHWC 1B4OA 3HZXA 4JW0A 1Q1EA 2B63B 1V43A 1CZGA 4HJ7A 1C48A 1H9SA 2QEXA 3RN5A 3K57A 3TEHB 3TBIB 4A3DB 2QEJC 4KKUA 1II3A 2D9UA 3K5OA 5DEHA 1BVSA 4H7BA 1IW7D 3I7FA 1B8AA 4DR2L 1PZKD 5M3MG 2H4OA 2K7VA 5CV9A 2EOTA 4LNQA 2XRSD 4PMBA 5ELBA 1QVFA 2EE1A 4JI1Q 3J81L 1F9QA 3AYHB 1KC8C 3K6OA 1VQFA 3G7LA 3AB9A 4DV4Q 1J6QA 5AJ3Q 5M9OA 4KJNA 3A8KE 2ZT9C 4L5TA 4A3FH 2L15A 4IFDI 5KIXA 1Y14B 3IFDA 5ELDA 3TS0A 3C3LA 1N9WA 5CC4A 1E24A 1Q3LA 3PUVA 1TWGH 5E3FA 4LFBQ 1ESRA 3KF6A 4C3IH 4LF4L 3D4RA 4LF8Q 4UY8C 2OTLA 1ET9A 1EEFD 1XMQQ 2EIFA 1S4ZA 5LHY1 4K5WA 2QKIC 2E2IB 3PO3H 1VQAA 4JK1C 3TZUA 3HOUB 4NB3A 1SNPA 2B63H 4APVA 5FJ8H 3Q23A 3FDTA 1XTDA 1HA6A 3HOYG 1K3BC 5IODA 1TVXA 4DK1A 4A3DH 1Z6HA 3DWAA 3H3VC 1SYCA 1ET6A 3E0EA 1OO9B 4MHEA 3G6EA 2LS01 4IPCA 5C0XH 2A1AA 1XNQL 3I4MB 3GV3A 4OO1G 4PG3A 5LMNL 2SNSA 1Y8PB 1LT5D 4DR3L 4BBRG 1SYFA 2NVQB 1KHIA 1UE1A 3CCUA 5C0XJ 3AEVA 4HCEA 1PRTF 3OSOA 4A93B 1EY9A 4QIWB 3U4VA 1QZHA 1OXUA 2E2DC 1EYCA 1UE6A 5C4HA 3NEMA 3HOVB 1HCZA 1IYJB 2L12A 2IJ0A 4QJFA 2IX0A 1C4QA 3K8AA 2QDLA 1TS2A 2RF4A 5EBDA 2XWBB 4G57A 1A3TA 1KTKA 4V190 1VMCA 4DV0Q 3R3OA 1KQSA 1PFNA 2OT2A 5A35A 1WTRA 4IUTA 2C5CA 1PH7A 5J3BA 2KCNA 1SNDA 3P1HA 1G91A 4KY6A 4K0KL 3CF5A 2Z6BA 2E2IH 2FFKB 4ZQ3A 4GKKL 2EYLA 3HOUH 2WFWA 2L4NA 2JA7G 4LAAA 2XNAC 3HKZG 4JI3Q 4DNTB 3VYTA 1PH4A 2Q8RE 1EZ8A 2EY6A 2F0NA 3X3MA 3CQZB 4GLXA 1EU4A 2N88A 1D5XC 3OTOL 2BE5D 2KHIA 4LF6L 1JB7A 4AQYQ 1SROA 3I3CA 4RGTA 1PHJA 5IT9c 1PRTB 4JI5L 3I4MH 1RF2D 4YHHL 4B9WA 1VQMA 3MXNB 1FYCA 3J80L 4C56C 1XMOL 4WJWA 4RCNA 3J81j 3CC2A 3I72A 2NVQH 5BR8Q 1S72A 4RH6A 1SJHD 3BVZA 5IGBA 4DV6Q 2UU9Q 2CWPA 2FJ2A 4A93H 3VYUA 4FXDA 2JJQA 1R4QB 3I4OA 5KYLA 1EY0A 2F0OA 3BYTB 2A74C 3HOVH 5IGDA 5IP9G 4A3JG 3T1HL 3GTGB 5GADC 4R9WA 5G3LF 3TZDA 3M4PA 2A6ED 3CRLC 3AU7A 4QUFA 1Q86C 3AFPA 2AKWB 3HOXG 4PMCA 1LTLA 5I6YA 4OWWB 1VQNA 1PVOA 3MWYW 4UDUC 1Q12A 2ALYB 2JEAI 2R92G 1NNXA 1EYAA 2K5NA 1WTVA 4LFAL 4DXFA 1Q8IA 4LK1C 2PZWA 2DJFC 4A3KB 1A3VA 4N9PA 4CHTB 4N8X1 2RHSB 3K0XA 3FP9A 3NTKA 4A3EG 3PIOA 1BBXC 3CQZH 1LTGD 3NP8A 1JOQA 4POFA 3LWUA 1JOKA 3A55A 1VQHA 2F52A 3C1EA 1STNA 1KL9A 3MXNA 1B2TA 4H02A 1BCPF 3N52A 1V8QA 4HTHA 4AH6A 1Q90A 1OXVA 4IOAA 1ASZA 1SNMA 3AQQA 1E1OA 2Z4HA 5KNBA 1EUJA 5FLXc 5M3FB 1VQBA 1VF5C 1AFPA 1STYA 1KDCA 3Q6SA 3U50C 3KLRA 2R93B 1HQRD 1LYLA 3WWVA 2UXDL 2DY7A 2Z9HA 4I7AA 4DR2Q 1CKNB 3F2DA 1IW7C 3D31A 2GVBA 1H9MA 1SSOA 1B7YB 2BA0A 3ER0A 1CSPA 2CCZA 3M3YB 3MXGA 2D62A 2XIWA 2G9DA 2K33A 4BXXG 3Q24A 3T1YL 2AUKA 4G7ZC 2RA4A 1PXUA 3EA6A 2SNMA 5GAHC 1HZBA 4MTNA 2EY1A 2L11A 4LWCA 5C5LA 4KHPQ 5IWAL 5GROA 1F77A 1PH6A 2JA5G 3K0YA 4G4KA 4KJOA 4A3KH 3T53B 4KD4A 2DNCA 2XTIA 1BCPB 3M9BA 3MC0B 3Q8DA 2SEBD 3V05A 3LX0A 1NSNS 3CC7A 4LF4Q 1ZEQX 1PH1A 1LACA 2ZXPA 3QIAA 3JAMc 1IL2A 3D6WA 5C5MA 1XNRL 1KLUD 4OEMB 2R7FA 2EJMA 3L2PA 1F9RA 2YTVA 4HSPA 3EN2A 3HOWB 1WTXA 1QOHA 4P74A 4FYDA 2EDGA 2RHQB 1AE3A 2F4IA 1YJ9A 2XVSA 5M3FH 2KECA 4KV6A 5FLMH 2FINB 3GTPH 5C4XB 2R93H 3QJYA 2LKVA 4DAYA 2M9VA 4A4IA 5JPNC 2O4XA 1RKNA 4YWLA 4NMZA 2LXKA 1F2LA 3A74A 3EJIA 4JBKA 3OIPA 4C3JB 1XNQQ 2HD3A 2TSSA 5KRUA 2JA9A 5LMNQ 3M3YH 4F88A 4DUYL 3NQIA 4DR3Q 4H0LC 1QNKA 3OOCA 1TWAB 2IT1A 3P75A 3CCRA 4YCUA 1FD7D 4TKOB 4CDDC 4BBSG 4CJ0B 1YNJD 5C44B 1XPRA 2Z8LA 2IHEA 3U58A 4HJ8A 5GQOA 4JPBW 3KYHC 1B50A 1A8VA 2F0UA 5FK9C 3K7UC 2RQXA 2MGSA 4R4IA 4A3IG 2Y0SG 1SJED 1L1OA 2RSOA 4X62Q 2LSSA 2ZJPA 1QCBD 1F2MA 4A3CG 1FVIA 1MGSA 1EQQA 5EKIA 2K1BA 1PYBA 2I5LX 2L1BA 1N34L 2LFNA 1U9RA 3H15A 4K0KQ 1CFMA 4LUOA 5T1IA 1IZ6A 1QUQB 4GKKQ 5IIFA 1CQFA 4PMWA 1D5MC 2NN6H 1PMRA 3HOWH 1Y1VG 4QF4A 4UP9A 2WP8J 3J7A5 1V1PB 3OMCA 4KLKA 1EL0A 1F9PA 4QL5A 5EPJA 1KAWA 2Q2TA 3NTHA 1SYBA 3OTOQ 4R8IA 5C4XH 4IPDA 2JA8B 4LF6Q 1GD7A 2A68C 3GQBA 1GUTA 3NENA 1HR0W 2BE5C 1GKHA 4GN3B 4HIDA 2KQ3A 5ELOA 1M4VA 4C3JH 1QG7A 1YVCA 5D14A 5M3MB 1LTID 4YHHQ 5IT9E 4ZUIA 1XMOQ 3QOJA 2MFIA 3TREA 1WTQA 1TWAH 1Q1BA 1HH2P 3URYA 1ENAA 2F3VA 4O1NA 1U4RA 3NK9A 2F0IA 4ZK9B 3F2UA 2UUAL 3K58A 5C44H 1VQCA 2AQ3B 2N8NA 1CM9A 1JOOA 2BDNA 3R2TA 2WB1E 3T1HQ 4PNYA 1D1KA 2RKSA 5J1ZA 1ONLA 3WOEA 2MQHA 3VR4A 3GTJB 3FKIG 2A6EC 4HN7A 3M4YA 1SMYD 4OGQC 2E2HH 3GTMB 2E2JB 1JWMD 2HIVA 1K3RA 1BBUA 1SYDA 1AN8A 5E7NA 1PH2A 3HOZG 1CHPD 3RZDB 2CVRA 2V1CC 4IFDG 1BNZA 1SYGA 5IYCG 1NMFA 5EJWA 2CW0C 1LUZA 1U0LA 2B8FA 4LFAQ 1EYGA 2I0QA 1SMXA 1WI5A 5T1GA 1VQGA 3KBGA 1XWEA 4A3MG 2O2LD 1G6PA 2NBFA 2EXDA 1EFID 1RJTA 2Z6KC 3JC66 2NZHA 3S14B 2BOSA 1B9MA 3ONAB 3MZ5A 4HIKA 1STHA 1TXYA 1I3QB 1TQOA 2QGQA 5JOBA 5M3MH 2CH4A 4AYBE 3A8IE 1JJGA 1VF7A 2DJGC 2E76C 3ZYYX 4CJ2C 3E0JA 2VW9A 1I4RA 1H9SB 1X3QA 4V0BA 1MJCA 4X66L 3HG9A 2WAQB 3ND8A 4MN3A 3JAMi 3DM1A 1UE7A 1AH9A 2EJFC 1YZ6A 2UXDQ 4Q5VA 4L5QA 5JEAH 1STBA 4DR7L 3S15B 3EIVA 2I5MX 3V96A 3K5NA 2YV5A 3GTJH 2UXBL 4EQNA 3KDFB 3M7GA 1HZ9A 3FPPA 3GTMH 2E2JH 1PRTC 5JEAJ 5J22A 1KD1C 4X3KA 4KHZA 3T1YQ 3RZDH 2FMCA 2WACA 5J39A 4LW1A 1TKWB 2F0QA 5IWAQ 1SDFA 4JVZA 1D7QA 4J15A 3K5MA 2VNUD 3CW2C 3TP6A 1KXLA 3T56B 2K01A 1JE5A 1PZID 2B2UC 3O13A 2JA6G 4J6HA 3HKZB 2PZTA 1PA6A 2L0CA 3HOYH 1GM5A 4XYQA 5JJZA 3S14H 1XNRQ 3E9IA 3PO3B 2ZXOA 5JJKA 1Q8KA 2F0GA 5IGGA 4JI0L 1I3QH 1A3UA 2F03A 1S5BD 1KNAA 2B2YA 1X32A 1HXYD 5C6AA 5CYUA 3R2IA 4C2MB 3PUYA 4IURA 4OO1H 4IUNA 3VR3A 1BXTA 3Q0AA 1YJWA 3VDYA 2NTTA 1L0YB 3BS1A 3G4SA 1EQTA 4HCSA 4OX9L 4J8QA 3RZOB 1L0XB 4DPGA 1E3PA 1S3OA 5E4WC 1SN8A 5CV7A 5IYBG 1SR3A 3FVQA 1QZGA 1SE4A 3KDFA 1HNWL 3S15H 3I55A 3P7JA 2ICIA 2R61A 4A3JB 2E5LL 4FF3A 1EYDA 4KKSA 2PMZB 4HSVA 3PIO3 4DUYQ 4QB4A 1QVGA 2O5JC 1BR9A 1ICFB 2RSNA 5ELCA 3KK7A 3CCQA 1ASYA 3QO2A 3IKJA 3HOXB 2ZXRA 4X64L 4JI8L 4BS9A 5GAGC 3MTSA 1AZQA 4DA2A 2HT1A 2NTSA 3MEHA 2EYJA 3SK5A 3S16B 2WIIB 3U4ZA 1YNJC 2LXJA 5LMUL 4DN4M 1EWCA 3RMHA 4QCLA 2CH4W 4XYOA 1G2TA 3OYYA 4L8JA 2JA7H 2F0FA 5E4XA 3D6CA 2CFMA 3HRZC 3TQYA 3H0GG 1ZXTA 1HNXL 2MJ8A 4MTKA 2HQEA 1KABA 2EYMA 4B3RL 3SE0A 3I8ZA 4A3LH 5CV6A 2L55A 1B3QA 1N34Q 1UE5A 5ELFA 1U4PA 3N6RA 1FNVA 2B2TA 5FO8B 4A3BG 2BA1A 4HR7B 3OHXC 4C2MH 3GV6A 1GUGA 2JE6I 1EWIA 3NWSA 4RGOS 3H91A 4FF1A 3RD4A 4QGUA 3LGJA 1PZJD
chains in the Genus database with same CATH topology
1EY7A 4C3HB 3FRPB 1MD2D 5CV4A 3L3OC 3PMFA 1IYVA 1BCPC 4X3TA 4F7XA 1AZPA 4ZLTF 2KCCA 3NQTA 1Z47A 5C3EB 1ENCA 5EQ0A 2KVMA 4NP5A 2AWNA 1NR4A 4TSSA 4KN4C 3DEOA 5IT9L 3SHLA 1QNUA 2X69A 5I4DA 1ENFA 2DY8A 5CBEE 2JA5B 4A3GB 1LT6D 1H9RA 5IOCA 4FP5D 4MIUA 1IKMA 4WFN3 2O5IC 1NR2A 1SMYC 4WRDA 2F0JA 1QE6A 1TY2A 3HS0C 3CU7A 4DNRB 1MBYA 1MI2A 4FXGC 2I46A 2H1EA 4RHRA 4C3IG 1FR3A 2V4DA 5DM73 3S1NB 5A2QE 5KNDA 1IKLA 5LL6S 1BOSA 2A6HD 2F0EA 4F87A 1QWYA 5HGTA 3K5LA 3HEJA 4EVOA 4ZAIA 3NE5B 3S1RB 3BVGA 1RTNA 2BDOA 3D4DA 1OXTA 1TIID 1SNQA 3KLSA 5DNFA 1ZYRD 3R8BA 4WORA 1LTAD 4XIGS 5M5XB 1DJRD 1SYEA 4ZKCB 5C3XA 3OIQA 5D65A 4BBSB 2PCFB 4IQZA 4U68A 2NB0A 2J7ZA 5LL6X 1UNSA 2EYPA 4BY7B 3KBXA 4A3IB 5FLXL 2VXWA 5E1FA 1DOMA 3VYRA 1DONA 4HMIA 1EOTA 4RGMA 3TDQA 3EQLC 4BA2I 5CV5A 5NUCA 2EJGC 2JXMB 1O7ZA 3NBHA 4DAVA 1G8ZD 3S2HB 1XX8A 4HAEA 2KHSA 4K5VA 1CTMA 3T16A 3GTKB 2JEBI 2MP1A 2B2UA 3A7LA 3SK6A 3I91A 4LMQD 5K36H 2KUMA 5JAVA 3GTPB 1JWUD 3NBIA 1H9KA 3MXPA 1EIGA 4ABNA 3JAML 5EPKA 4OIJA 1B1ZA 4ODGA 2F0SA 5FO9B 3VR2A 4RGNA 4RAUC 1PTOD 3ERQA 2SOBA 4B9XA 5I9PA 3SEBA 1OXXK 2HDMA 4C1NK 2EY2A 2MHVA 2AWOA 1GUSA 1B53A 5CGKA 3HOZB 2XSCA 2B2YC 1PYWD 2EVBA 1BO0A 3E6ZX 1Y69U 2Q8IB 2MUYA 4H13C 4A3MB 3LWEA 2K28A 1DOLA 1ML0D 4K2LA 3KUPA 5M5YB 2A69D 3BDLA 4XQNA 3NHHA 3VA7A 2EY5A 4K2KA 4KKTA 4KY5A 3J81E 1O78A 1TU2B 1B44D 3QWNA 2IPKD 4OIKA 2F0WA 1KAAA 3C2PA 5BN4A 3P20A 2B8GA 2SDFA 4KTAA 3VYSA 1S5ED 3A56A 5EKKA 1HFGA 4QUCA 3A54A 2RDGA 1ILQA 1STGA 2B2TC 2J0TD 5ISRA 4IFDH 3TSSA 5BN5A 2E2HB 2Z1CA 4CJ1B 2HDLA 2MPMA 4HMJA 3OWFA 3GD7A 2VB3X 1H9JA 4IFDJ 1IL8A 1W6KA 3I4LA 1EY5A 1QB5D 2VB2X 4BWGB 1CI3M 4DXGA 4KK7A 4ULLA 3J7YW 1X3PA 3PV0A 1DXMA 4E6IA 1K8OA 1VDZA 1NCVA 1DM0B 3PUWA 1XXGA 4CGYB 2L9HA 3T13A 5TSSA 5EBCA 4J1MA 1C8CA 1J9OA 2F0LA 2RBMA 1MSGA 2A6HC 1DZ1A 1ILPA 4K5XA 2PZUA 4XQQA 5CBAE 3UI2A 3KF8A 3MA2B 4IN3A 2K6AA 1CT1D 2PPBC 2F1MA 2ID0A 3HGBA 2DN8A 2OF1A 1ZYRC 2PO4A 4L63B 1NAPA 1JQYD 4K8IA 1KDBA 4DF7A 3R93A 3D8GA 1HFNA 5EPLA 3S1MB 3S17B 1QJOA 2F0MA 1I4PA 2X6GA 2C9OA 2IWHA 1EZ6A 1WD1A 3A7AB 1WTPA 1ICWA 5EGTA 4ME5A 2ICEC 1Z7TA 4DFAA 1AEXA 3HOYB 3TP7A 3EVQA 1HUNA 1TT2A 1CK1A 3DWPA 3IFTA 4K6DA 1HPCA 2YYZA 3HP3A 2WKCA 3MHBA 3J80E 3J7AF 2BCOA 1STEA 3FEWX 2Q8TA 2NN6G 5COYA 2F3WA 3CRKC 4BBRB 5F2DA 4ID6A 1E2VA 2EXZA 3NTIA 1CQVA 3VR5A 3C46A 1LTRD 5IGCA 3QB3A 3E5SA 2VUMB 2EPBA 1E0BA 1O80A 4X3UA 2M2LA 3L7ZC 1K8MA 2IL8A 1TS5A 1PTOC 2K32A 3GTLB 2J4XA 3EFXD 4CBVA 1LT3D 1CZWA 1LLRD 4OHJA 1EY6A 1EY8A 1I50B 2R3ZA 4JBWA 1LO5D 1GUNA 5EKLA 2XRQD 4L6TB 2JA7B 1U4MA 4K8JA 1BF4A 1S5FD 2PYKA 1SNCA 4KD3A 4S3SA 3MFYA 3QOLA 4XXEA 1JICA 4ZKBB 1F9SA 3BVMA 4KN7C 1ZKOA 1JCKB 2X6LA 4C1NI 1AP0A 2EYOA 4LJZC 5IGEA 1TS4A 3GTQB 1GXDC 2A69C 1A15A 1EY4A 2CHBD 2Z4IA 2NWGA 3RUZA 4TRDA 4QMGA 1RCVD 1T5XD 3VA5A 3DEPA 4RWSC 2B2VA 3SVMA 1S5DD 1E2WA 4RA8A 3OWEB 4I65A 3QG1A 1LV9A 3V2TA 1ESFA 1I6HB 5CV8A 2R6GA 4IUVA 1GOZA 1TWCB 1FGBD 1SE3A 1Y1WB 2R92B 4K6LA 4UAIA 1BUVT 5JEAG 4EQPA 1IYUA 1YNND 4FO2A 1RODA 3DMUA 3GTOB 2EZVA 4A3EB 2ENBA 3BZDB 1OXSC 3DUZA 2R7ZB 4I7ZC 1HTLD 4KMUC 3PO2B 1D6EC 1WTOA 1CA6A 2NN6I 1BDOA 3ITPA 3AMUA 3WDNA 3L9AX 3OPOA 1I6VC 3BDCA 4U673 1EQVA 2E75C 4DU9A 1SEBD 5AFWA 2GA4B 4XQJA 4X3SA 5C4JB 1HUMA 4M1UB 4N9TA 1G6ZA 1PTOF 3TN2A 4M8AA 4XDXA 1WVLA 1XYIA 1KDAA 1JB3A 4FF4A 4ZYSA 1R9TB 5HURA 4O42A 4RKBA 1FNUA 1TWHB 1LTTD 2K5WA 1A2UA 5K5PA 2NYZD 1DOKA 2D2CC 3G6JB 1RHPA 3NXWA 1RD9D 1R4PB 5I6WA 2F0DA 3J7AV 2XWJB 1QILA 1DYQA 4R8NA 2JSOA 4BY1B 5KEEA 1D5ZC 1UUPA 4XTCS 1DD2A 1PTOB 3SK8A 4G7HC 2OXPA 3SXHA 5I2YA 5D3DA 2A68D 2F0TA 4Y7NB 1PFMA 3SDZA 2B2WA 3M4OB 2WB1B 2PW7A 5KGUA 3MAQA 3I90A 3D3RA 3NWTA 3H6MA 5M5WB 5I2XA 4PQXA 3X3NA 4P2CB 4RHSA 1TWFB 5C0XG 1JE4A 2K05A 1RDPD 4CKEA 5ELEA 3C1FA 3BYYB 3M7NA 2IW3A 3MVVA 2FHTA 3W2DA 3OW7A 4KHVA 2NVTB 3DWQA 3I70A 1W6JA 2Y0SB 1JC7A 3IL8A 4IUQA 3DXJC 1UEAB 3LNNA 4XT1B 1T5EA 4HEDA 2EYHA 2CW0D 1B3AA 4AYBB 1MSHA 1Y1VB 1D1IA 1CHQD 1PFBA 4G7OC 1PTOH 4IUUA 1LTSD 2AQ1B 3EROA 1KNEA 2K5QA 1EU3A 4GZYC 4IUPA 2YU9B 4CKCA 3U9OA 2WKDA 4OO1I 1PLFA 4FXKC 1GUWA 2EYFA 4OL7A 4H44C 1LT4D 5KNCA 3OMGA 3IAYA 2PW5A 2K03A 4C3HG 3CHBD 2QDBA 2L5TA 3TMEA 1M8AA 4EGVA 3S1QB 2KJXA 5FOBB 4ZRZA 2KEDA 5JPMC 3T4AC 3FKIB 1LTBD 2F0HA 1PRTD 2FMMA 3DHQA 5C3WA 3NSWA 2I07B 1F2ZA 3BG3A 1SNOA 1O7YA 5CR3A 1VMPA 1O7LA 1SE2A 3RLFA 5I9OA 4KY7A 1G291 1TS3A 1I4XA 1TR5A 1HHVA 4IZ8A 2G9HD 1YNNC 3NUCA 1AW7A 1GHJA 3M85A 1RTOA 5JVG3 1I4GA 2B2VC 3MXUA 1Y8OB 5JVH3 1Y8NB 1G2SA 1HQMC 2B39A 2JP1A 2PQEA 3FPUB 3KLSX 1EEID 5C0XI 1PDQA 3MFGA 3SK4A 2RVLA 1I4HA 1LABA 2N55A 4DAPA 2OEOA 1HA5A 2LMCB 4ILWA 5FKAC 4BA1I 4FF2A 2NVXB 2A5HA 2NVYB 2M00A 2A73B 3A8JE 3VR6A 5K36G 1U4LA 1CA5A 3WOFA 5IGFA 4DGZA 1UAPA 1F2YA 5G3LD 2AQ2B 1A2TA 2QILA 4B08A 1SFOB 5KYIA 4CKBA 2JA6B 2PNRC 3SR1A 1IHZA 1WCMB 4TQUS 4PV1C 2F0VA 2DNEA 2E74C 1TY0A 1HTPA 1SAPA 2D5DA 1S5CD 3I73A 1EWHA 5FO7B 2NUCA 2RDFA 3NPPA 1HRJA 4DK0A 3K7AB 5CMDA 2QF7A 1BCPD 2TMPA 3BDOA 1BQQT 3PUXA 5A2QL 2IX3A 1EIHA 3T51B 1V1OA 1JR0D 2HCCA 4NW2A 3FMCA 1GHKA 1SBBB 4XT3B 3H09A 5C4ZA 4FNFA 3S9WA 1JWSD 3PUZA 2WV6D 1JORA 3H0GB 3PIP3 5DAUA 5BN3A 1VCIA 3GP7A 4RFBA 2B2WC 3ND9A 3S2DB 3K59A 4A3BB 1J8IA 2NZ1D 4NKLA 1V1PA 1WTWA 2K5DA 4RCOA 1DCZA 2WINB 3GO5A 4F8MA 2F0PA 5D3IB 2AUJD 1B9NA 3W3AA 5CORA 3CKIB 2KEEA 3I4NB 1A6XA 3TP8A 2QCPX 4K14A 2RDHA 3D4WA 2XN9C 4C3JG 2K04A 3TP5A 5FLXE 1E2ZA 1K83B 2HCIA 4Z9CB 4EQOA 4FVMA 2CQAA 4RKLA 1XTCD 1GJXA 1SXTA 4ZUJA 2KA7A 2F0KA 5DM63 4A3FB 1WD0A 1D2BA 2KOLA 3U9SA 1STAA 2JYOA 2HUGA 3H94A 2LY7A 1FNWA 4YIJA 1TWGB 1GUOA 1I4QA 1KLGD 1NUCA 4C3IB 4Q0FA 4IALA 3Q22A 2IX1A 4KI0A 4NDXA 3JAME 1B4OA 3HZXA 1Q1EA 2B63B 1V43A 1CZGA 1C48A 1H9SA 3K57A 3TBIB 4A3DB 2QEJC 4KKUA 1II3A 2D9UA 3K5OA 5DEHA 4H7BA 1IW7D 1PZKD 2H4OA 2K7VA 5CV9A 2EOTA 2XRSD 4PMBA 5ELBA 2EE1A 3J81L 1F9QA 3K6OA 3G7LA 3AB9A 5M9OA 4KJNA 3A8KE 2ZT9C 4IFDI 5KIXA 3IFDA 5ELDA 3C3LA 5CC4A 1Q3LA 3PUVA 5E3FA 1ESRA 3D4RA 1ET9A 1EEFD 1S4ZA 5LHY1 4K5WA 2QKIC 2E2IB 4JK1C 3TZUA 3HOUB 1SNPA 3Q23A 3FDTA 1HA6A 5IODA 1TVXA 4DK1A 1Z6HA 3DWAA 3H3VC 1SYCA 1ET6A 1OO9B 4MHEA 2LS01 5C0XH 3I4MB 3GV3A 4OO1G 2SNSA 1Y8PB 1LT5D 1SYFA 2NVQB 5C0XJ 4HCEA 1PRTF 3OSOA 4A93B 1EY9A 4QIWB 1OXUA 2E2DC 1EYCA 5C4HA 3HOVB 1HCZA 2L12A 2IJ0A 2IX0A 1C4QA 1TS2A 5EBDA 2XWBB 4G57A 1A3TA 1KTKA 4V190 1VMCA 3R3OA 1PFNA 2OT2A 5A35A 1WTRA 4IUTA 2C5CA 2KCNA 1SNDA 3P1HA 1G91A 4KY6A 2FFKB 4ZQ3A 2EYLA 2L4NA 4LAAA 2XNAC 4DNTB 3VYTA 2Q8RE 1EZ8A 2EY6A 2F0NA 3X3MA 3CQZB 1EU4A 2N88A 1D5XC 2BE5D 3I3CA 4RGTA 1PRTB 1RF2D 4B9WA 1FYCA 3J80L 4C56C 4WJWA 4RCNA 3I72A 4RH6A 1SJHD 3BVZA 5IGBA 2FJ2A 3VYUA 4FXDA 1R4QB 5KYLA 1EY0A 2F0OA 3BYTB 2A74C 5IGDA 3GTGB 4R9WA 5G3LF 3TZDA 2A6ED 3CRLC 3AU7A 4QUFA 4PMCA 5I6YA 3MWYW 4UDUC 1Q12A 2JEAI 1EYAA 1WTVA 4DXFA 1Q8IA 4LK1C 2PZWA 4A3KB 1A3VA 4N9PA 4CHTB 3NTKA 1BBXC 1LTGD 3NP8A 1JOQA 3LWUA 1JOKA 3A55A 3C1EA 1STNA 3MXNA 1B2TA 1BCPF 3N52A 1V8QA 4HTHA 1Q90A 1OXVA 1SNMA 2Z4HA 5KNBA 5M3FB 1VF5C 1AFPA 1STYA 1KDCA 3Q6SA 3KLRA 2R93B 1HQRD 2DY7A 1IW7C 3D31A 1H9MA 1SSOA 2BA0A 3M3YB 3MXGA 2D62A 2XIWA 2G9DA 2K33A 3Q24A 2AUKA 4G7ZC 2RA4A 1PXUA 3EA6A 2SNMA 2EY1A 2L11A 5C5LA 1F77A 3K0YA 4G4KA 4KJOA 3T53B 4KD4A 2DNCA 1BCPB 3MC0B 2SEBD 3V05A 3LX0A 1NSNS 1ZEQX 1LACA 2ZXPA 3QIAA 3D6WA 5C5MA 1KLUD 2EJMA 1F9RA 4HSPA 3HOWB 1WTXA 1QOHA 4FYDA 2EDGA 2F4IA 2XVSA 2KECA 4KV6A 2FINB 5C4XB 3QJYA 2LKVA 4DAYA 2M9VA 5JPNC 2O4XA 1RKNA 4NMZA 1F2LA 3EJIA 3OIPA 4C3JB 2TSSA 5KRUA 4F88A 3NQIA 4H0LC 1QNKA 3OOCA 1TWAB 2IT1A 3P75A 1FD7D 4TKOB 4CJ0B 1YNJD 5C44B 2Z8LA 1B50A 5FK9C 2F0UA 2RQXA 2MGSA 1SJED 2RSOA 1QCBD 1F2MA 1MGSA 5EKIA 2K1BA 2L1BA 2LFNA 1U9RA 1CFMA 5T1IA 5IIFA 1CQFA 4PMWA 1D5MC 2NN6H 1PMRA 4QF4A 2WP8J 1V1PB 3OMCA 1EL0A 1F9PA 5EPJA 3NTHA 1SYBA 4R8IA 2JA8B 2A68C 3GQBA 1GUTA 2BE5C 2KQ3A 1M4VA 1QG7A 5IT9E 5D14A 5M3MB 1LTID 4ZUIA 3QOJA 1WTQA 1Q1BA 3URYA 1ENAA 2F3VA 4O1NA 1U4RA 3NK9A 2F0IA 4ZK9B 3F2UA 3K58A 2AQ3B 1CM9A 1JOOA 2BDNA 3R2TA 4PNYA 1D1KA 2RKSA 5J1ZA 1ONLA 3WOEA 3VR4A 3GTJB 2A6EC 4HN7A 3M4YA 1SMYD 4OGQC 3GTMB 2E2JB 1JWMD 1SYDA 1AN8A 1CHPD 3RZDB 2CVRA 4IFDG 1BNZA 1SYGA 5EJWA 2CW0C 2B8FA 5T1GA 3KBGA 1XWEA 2O2LD 2NBFA 1EFID 1RJTA 3S14B 2BOSA 1B9MA 3ONAB 3MZ5A 1STHA 1I3QB 1TQOA 5JOBA 3A8IE 1VF7A 2E76C 3ZYYX 4CJ2C 3E0JA 1I4RA 1H9SB 1X3QA 4V0BA 3HG9A 2WAQB 3ND8A 4MN3A 3DM1A 2EJFC 4Q5VA 5JEAH 1STBA 3S15B 3V96A 3K5NA 4EQNA 3M7GA 3FPPA 1PRTC 5JEAJ 5J22A 4X3KA 4KHZA 2FMCA 2WACA 5J39A 1TKWB 2F0QA 1SDFA 3K5MA 2VNUD 3TP6A 3T56B 2K01A 1PZID 2B2UC 3O13A 4J6HA 3HKZB 2PZTA 2L0CA 4XYQA 5JJZA 3PO3B 2ZXOA 2F0GA 5IGGA 1A3UA 2F03A 1S5BD 1KNAA 2B2YA 1X32A 1HXYD 5C6AA 5CYUA 3R2IA 4C2MB 4IURA 3PUYA 4OO1H 4IUNA 3VR3A 1BXTA 3Q0AA 2NTTA 1L0YB 3BS1A 1EQTA 4HCSA 4J8QA 3RZOB 1L0XB 5E4WC 5CV7A 3FVQA 1SE4A 3P7JA 2ICIA 2R61A 4A3JB 4FF3A 1EYDA 4KKSA 2PMZB 4HSVA 3PIO3 4QB4A 2O5JC 1BR9A 2RSNA 5ELCA 3HOXB 3KK7A 3QO2A 3IKJA 2ZXRA 4BS9A 3MTSA 1AZQA 4DA2A 2NTSA 3MEHA 2EYJA 3SK5A 3S16B 2WIIB 1YNJC 4DN4M 1EWCA 3RMHA 4QCLA 4XYOA 1G2TA 4L8JA 2F0FA 5E4XA 3D6CA 3HRZC 1ZXTA 2MJ8A 2HQEA 1KABA 2EYMA 3SE0A 3I8ZA 5CV6A 2L55A 5ELFA 1U4PA 3N6RA 1FNVA 2B2TA 5FO8B 2BA1A 4HR7B 3OHXC 3GV6A 1GUGA 2JE6I 3NWSA 4RGOS 3H91A 4FF1A 3RD4A 1PZJD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QDB A;  1JOQ A;  1EY7 A;  3DMU A;  4PNY A;  3SK8 A;  5CV4 A;  2OXP A;  3NP8 A;  3SXH A;  3TME A;  3PMF A;  4G57 A;  1A3T A;  2LKV A;  4J6H A;  2RKS A;  5KYI A;  5CV9 A;  2PZT A;  5J1Z A;  4F7X A;  1JOK A;  2F0T A;  4PMB A;  3R3O A;  3SR1 A;  3T13 A;  2O4X A;  1RKN A;  4F8M A;  4NMZ A;  1IHZ A;  2F0P A;  2ENB A;  3EJI A;  3C1E A;  3QB3 A;  3NQT A;  1STN A;  2EYP A;  2PW7 A;  1ENC A;  4J1M A;  5KGU A;  2F0V A;  2F0G A;  5KRU A;  5IGG A;  2F0L A;  2RBM A;  1SYD A;  1SND A;  2F0H A;  3P1H A;  1A3U A;  4NP5 A;  4HTH A;  4K2L A;  4KY6 A;  3DHQ A;  5C3W A;  3ITP A;  3H6M A;  5E1F A;  5M9O A;  3BDL A;  1EY6 A;  1SNM A;  1EY8 A;  4K5X A;  4KJN A;  5C6A A;  3P75 A;  1SYG A;  1F2Z A;  2PZU A;  4ZQ3 A;  3NHH A;  1SNO A;  2EYL A;  4HMI A;  3TP8 A;  3BDC A;  4IUN A;  5CR3 A;  4K14 A;  4LAA A;  5EKL A;  5KIX A;  2NUC A;  2EY5 A;  1STY A;  1KDC A;  2RDF A;  3D4W A;  4K8J A;  1EQV A;  5C3X A;  3C1F A;  1EZ8 A;  2EY6 A;  2F0N A;  4K2K A;  3SHL A;  4DU9 A;  5I9O A;  2OF1 A;  4KY7 A;  5CV5 A;  5NUC A;  2F0U A;  3TP5 A;  1TR5 A;  4KY5 A;  5CC4 A;  4IZ8 A;  5E3F A;  2PYK A;  3NUC A;  3MVV A;  4K8I A;  1KDB A;  5CV7 A;  4KHV A;  4DF7 A;  1SNC A;  2KHS A;  4KD3 A;  4S3S A;  4EQO A;  1F2M A;  3MZ5 A;  2F0W A;  3D8G A;  4K5V A;  4RKL A;  3QOL A;  1STH A;  1EYD A;  4N9T A;  5IOC A;  1KAA A;  1TQO A;  4MIU A;  4ZUJ A;  3TP6 A;  3T16 A;  4B9W A;  2F0M A;  5JOB A;  4K5W A;  2F0K A;  4QB4 A;  4WRD A;  1U9R A;  4KTA A;  3SK6 A;  1EZ6 A;  2F0J A;  2EYO A;  5IGE A;  2PQE A;  1KDA A;  5JAV A;  2EYH A;  1SNP A;  5IIF A;  2SNM A;  5EKK A;  1EY4 A;  2EY1 A;  5IGB A;  1STA A;  4QF4 A;  5C5L A;  5EGT A;  4ME5 A;  3OMC A;  3RUZ A;  5IOD A;  3MEH A;  3MXP A;  4TRD A;  2EYJ A;  3SK5 A;  3SK4 A;  5KYL A;  4QMG A;  1AEX A;  4DFA A;  1EY0 A;  1STG A;  2F0O A;  4KJO A;  3TP7 A;  5HUR A;  4KD4 A;  2OEO A;  3EVQ A;  4ODG A;  1TT2 A;  4RKB A;  2F0S A;  4YIJ A;  5IGD A;  3VA5 A;  5ISR A;  1SYB A;  5C4Z A;  1NUC A;  1STB A;  1SYC A;  4K6D A;  3S9W A;  3LX0 A;  1NSN S;  3MHB A;  4HMJ A;  2F0F A;  3D6C A;  3ERO A;  1A2U A;  3OWF A;  4I65 A;  4PMC A;  5C5M A;  5K5P A;  3ERQ A;  5I6Y A;  1JOR A;  2KQ3 A;  4IAL A;  4EQN A;  5DAU A;  2F0E A;  2HQE A;  2M00 A;  1KAB A;  2EYM A;  3U9O A;  3V2T A;  4ZUI A;  2SNS A;  3NXW A;  2SOB A;  5CV8 A;  4B9X A;  5I9P A;  5HGT A;  5J22 A;  5CV6 A;  1SYF A;  3HEJ A;  4NDX A;  4EVO A;  3QOJ A;  1EY5 A;  5IGF A;  2F3W A;  2EY2 A;  3HZX A;  4DGZ A;  5F2D A;  2EYF A;  4OL7 A;  5I6W A;  1EYA A;  2F0D A;  2WAC A;  3D4D A;  1ENA A;  2F3V A;  3OSO A;  4ID6 A;  5J39 A;  4R8N A;  2F0Q A;  2EXZ A;  1F2Y A;  3NK9 A;  1EY9 A;  3OMG A;  2F0I A;  1SNQ A;  5C4H A;  2PZW A;  1EYC A;  2PW5 A;  1A3V A;  4WOR A;  4N9P A;  4NKL A;  4E6I A;  4EQP A;  5CGK A;  5KEE A;  4KV6 A;  1II3 A;  5DEH A;  1SYE A;  4H7B A;  1A2T A;  5IGC A;  1JOO A;  3E5S A; 
#chains in the Genus database with same CATH topology
 1EY7 A;  4C3H B;  3F1Z A;  3FRP B;  1MD2 D;  5CV4 A;  3PIP A;  3L3O C;  3RZO H;  3PMF A;  1IYV A;  1BCP C;  4X3T A;  4F7X A;  1AZP A;  4ZLT F;  2KCC A;  3NQT A;  1Z47 A;  1IBM L;  3BZK A;  5C3E B;  1ENC A;  5EQ0 A;  4A3J H;  5IP9 H;  2KVM A;  4NP5 A;  4ZCK A;  1L1O C;  2AWN A;  3I4N G;  2QA4 A;  5EAY A;  1NR4 A;  3HOX H;  1GO3 E;  2VUM G;  4TSS A;  1I6H H;  1K0R A;  1CKM A;  4KN4 C;  3DEO A;  1X3F A;  2UUA Q;  5IT9 L;  3SHL A;  3S16 H;  2R92 H;  1QNU A;  4LF9 L;  2X69 A;  4P71 A;  5I4D A;  1ENF A;  4QQB X;  2D0P A;  3DM3 A;  2DY8 A;  2HIX A;  5CBE E;  2JA5 B;  4A3G B;  1P8L A;  1E22 A;  1LT6 D;  1H9R A;  5IOC A;  4FP5 D;  4GNX A;  4A3E H;  1JJC B;  1W3S A;  4MIU A;  2ZJR A;  1IKM A;  4WFN 3;  1W2B A;  2O5I C;  1NR2 A;  1SMY C;  2VQE L;  4WRD A;  5GAE C;  2F0J A;  1M90 C;  1QE6 A;  1TY2 A;  3HS0 C;  3CU7 A;  4DNR B;  1MBY A;  1MI2 A;  4FXG C;  2I46 A;  3F2B A;  2H1E A;  4RHR A;  2PI2 E;  3CCV A;  3PF5 A;  4C3I G;  1FR3 A;  1WFQ A;  2V4D A;  1FGU A;  4C3H H;  1BKB A;  5DM7 3;  3S1N B;  5A2Q E;  2GVA A;  5KND A;  1IKL A;  5LL6 S;  3NBH B;  1VQ8 A;  1BOS A;  2A6H D;  2F0E A;  4F87 A;  1QWY A;  5C3E H;  4LFC L;  5C4J H;  5HGT A;  3K5L A;  3HEJ A;  4EVO A;  2B63 G;  4ZAI A;  2Z6K A;  3NE5 B;  3S1R B;  3BVG A;  4B3T L;  1RTN A;  3K80 C;  1YJN A;  2BDO A;  3D4D A;  4X66 Q;  1OXT A;  4A3D G;  1TII D;  4R4Q A;  1SNQ A;  3KLS A;  5DNF A;  1ZYR D;  3R8B A;  4WOR A;  2ZM6 L;  1LTA D;  4XIG S;  5M5X B;  4YCV A;  4A75 A;  1DJR D;  4BXX H;  1SYE A;  5HY6 A;  4ZKC B;  5C3X A;  3OIQ A;  5D65 A;  4DR7 Q;  4BBS B;  2PCF B;  4IQZ A;  4U68 A;  2NB0 A;  2J7Z A;  5LL6 X;  1O7I A;  2JA5 H;  2K50 A;  1UNS A;  2EYP A;  4A3G H;  4BY7 B;  3KBX A;  4DV1 Q;  2UXB Q;  3G48 A;  4A3I B;  1Y1W G;  5FLX L;  2VXW A;  1KRS A;  2KBN A;  3G71 A;  5E1F A;  1DOM A;  2B29 A;  5DLQ E;  2WAQ E;  4IPH A;  3VYR A;  4DR6 L;  1DON A;  4DR4 L;  4GN5 A;  4HMI A;  4JI7 L;  1EOT A;  1YI2 A;  4RGM A;  1RL2 A;  2N49 A;  2UUC L;  1SE8 A;  4YCW A;  3TDQ A;  3EQL C;  4BA2 I;  3ERS X;  5CV5 A;  5NUC A;  2EJG C;  2JXM B;  3CAM A;  2R7Z G;  1O7Z A;  3NBH A;  3PO2 G;  4OWT B;  4DAV A;  1G8Z D;  2A19 A;  1XX8 A;  4HAE A;  3S1N H;  2KHS A;  3S2H B;  2F4V L;  2Q2U A;  4K5V A;  4GLV B;  2K5V A;  3STB D;  1CTM A;  3GDE A;  1SRU A;  3T16 A;  3GTK B;  4JI0 Q;  1V1Q A;  2JEB I;  4GS3 A;  2MP1 A;  2B2U A;  3A7L A;  3SK6 A;  1PH3 A;  3I91 A;  4LMQ D;  5K36 H;  2KUM A;  5JAV A;  3S1R H;  3GTP B;  3CMA A;  3E9H A;  1JWU D;  3A0J A;  3NBI A;  2DGY A;  4WJ3 M;  2XGT A;  1H9K A;  2IHF A;  1EIG A;  3MXP A;  4ABN A;  5M5W H;  3JAM L;  5EPK A;  3D0F A;  4OIJ A;  1B1Z A;  4ODG A;  5M5X H;  2F0S A;  4OX9 Q;  5FO9 B;  4DAY B;  3VR2 A;  4BBS H;  4X6A H;  3I4M G;  1NY4 A;  4RGN A;  4RAU C;  1HNW Q;  1PTO D;  1VQ4 A;  3ERQ A;  2DUD A;  2E5L Q;  3ZJY C;  4BY7 H;  2SOB A;  4B9X A;  5I9P A;  4A3I H;  2AHO B;  3SEB A;  1NJI C;  1OXX K;  2HDM A;  1K73 C;  4LF5 L;  4C1N K;  2A8V A;  2EY2 A;  2MHV A;  4X64 Q;  4R4O A;  4JI8 Q;  2AWO A;  4A3C H;  1X3E A;  1GUS A;  1B53 A;  2N78 A;  3HOV G;  3F8T A;  5CGK A;  1N8R C;  3HOZ B;  2XSC A;  2B2Y C;  2OQK A;  1PYW D;  3K81 C;  5LMU Q;  1XPU A;  2EVB A;  1BO0 A;  3E6Z X;  2P5Z X;  4JI2 L;  1Y69 U;  1L1O B;  1Y1V H;  2OQ0 A;  2HHH L;  3KJO A;  3UDF A;  2Q8I B;  1JJ2 A;  2MUY A;  4DR1 L;  4H13 C;  4A3M B;  1HNX Q;  3S2H H;  3LWE A;  1S40 A;  2K28 A;  1DOL A;  4IJL A;  1ML0 D;  4BY1 G;  4P75 A;  4K2L A;  3KUP A;  3GTK H;  5M5Y B;  2A69 D;  3BDL A;  4XQN A;  1X54 A;  5LMN W;  1YHA A;  3NHH A;  1YBY A;  4QY7 A;  1VQP A;  3VA7 A;  2YTY A;  5IYD G;  4CDC C;  2EY5 A;  3HFZ B;  1EOV A;  4K2K A;  4KKT A;  2OCE A;  1WOC A;  2WB1 G;  4KY5 A;  3J81 E;  1O78 A;  1TU2 B;  1XJV A;  1B44 D;  3QWN A;  3AFQ A;  2IPK D;  4OIK A;  2F0W A;  4JBJ A;  4LUV A;  1KAA A;  1IBM Q;  3C2P A;  5BN4 A;  3P20 A;  1DGS A;  1U5K A;  2B8G A;  3CCM A;  2SDF A;  3CCJ A;  4KTA A;  3VYS A;  1S5E D;  3A56 A;  1VQJ A;  4DUZ L;  5EKK A;  5IP7 G;  3CPW A;  1HFG A;  4QUC A;  3A54 A;  2RDG A;  1ILQ A;  1STG A;  2B2T C;  2J0T D;  3HOZ H;  5ISR A;  4UP7 A;  4IFD H;  5JJL A;  3TSS A;  5BN5 A;  4IO9 A;  5IYC H;  4LF9 Q;  2E2H B;  2Z1C A;  4CJ1 B;  2HDL A;  2MPM A;  4HMJ A;  2B3G A;  3OWF A;  1Z9F A;  4JOI A;  3GD7 A;  1VQO A;  2VB3 X;  4A3M H;  1OTC A;  1H9J A;  2ZJQ A;  4IFD J;  4QIW E;  1IL8 A;  1W6K A;  2VQE Q;  3I4L A;  4AYB G;  1X9N A;  2OWO A;  3CD6 A;  1EY5 A;  4JCV E;  1QB5 D;  5M5Y H;  1Q46 A;  2VB2 X;  1CI3 M;  4BWG B;  4DXG A;  4KK7 A;  4ULL A;  3J7Y W;  1X3P A;  3PV0 A;  4EQ5 A;  1DXM A;  4E6I A;  2F3I A;  4HJ5 A;  1K8O A;  1VDZ A;  2PQA A;  1NCV A;  1CUK A;  1DM0 B;  3PUW A;  3J7Z C;  1XXG A;  4CGY B;  2RCF A;  2L9H A;  4JI5 Q;  3PSI A;  1VQL A;  4YWM A;  5IE8 A;  1HZA A;  5TSS A;  3T13 A;  5EBC A;  2PNH A;  4J1M A;  1C8C A;  1J9O A;  2BH2 A;  2F0L A;  2RBM A;  1MSG A;  4IPG A;  4LFC Q;  2A6H C;  1DZ1 A;  3QR8 A;  1ILP A;  4K5X A;  2PZU A;  4GNX C;  4B3T Q;  4XQQ A;  2UXC L;  1NE3 A;  5CBA E;  1HZC A;  3UI2 A;  3KF8 A;  3MA2 B;  4IN3 A;  2G5D A;  2K6A A;  1CT1 D;  4JI4 L;  1IBL L;  2UUB L;  2PPB C;  2R93 G;  2F1M A;  2ZM6 Q;  2ID0 A;  1I94 L;  3HGB A;  2DN8 A;  1HNZ L;  4R1J A;  2OF1 A;  1ZYR C;  2PO4 A;  4L63 B;  1NAP A;  1JQY D;  4K8I A;  4JC0 A;  1KDB A;  4DF7 A;  1P16 A;  1YIT A;  3R93 A;  3D8G A;  1HFN A;  5EPL A;  3S1M B;  3S17 B;  1QJO A;  2F0M A;  2JA6 H;  1N36 L;  1I4P A;  3UDI A;  2X6G A;  2C9O A;  2IWH A;  1EZ6 A;  1WD1 A;  1MKH A;  3A7A B;  1WTP A;  4DR6 Q;  1ICW A;  4JI7 Q;  5EGT A;  4ME5 A;  2UUC Q;  1WYD A;  1VQ6 A;  2ICE C;  4OEL B;  1Z7T A;  1AEX A;  4DFA A;  3HOY B;  3TP7 A;  3EVQ A;  1HUN A;  1TT2 A;  3CXC A;  1CK1 A;  3DWP A;  3IFT A;  4K6D A;  1HPC A;  2YYZ A;  3HP3 A;  2WKC A;  3MHB A;  3J80 E;  1E1T A;  2F4V Q;  3J7A F;  2BCO A;  1PH5 A;  3KLW A;  1STE A;  3FEW X;  3W1G A;  1X3G A;  1K0S A;  2Q8T A;  2NN6 G;  5IYB H;  5COY A;  2F3W A;  3CRK C;  4BBR B;  4LF7 L;  5F2D A;  4DK3 C;  4ID6 A;  1E2V A;  5HGQ A;  2EXZ A;  3NTI A;  2GN5 A;  1CQV A;  5IY0 A;  1NTG A;  3VR5 A;  3C46 A;  1LTR D;  2UU9 L;  5IGC A;  3QB3 A;  3E5S A;  5H1S E;  2ZTD A;  2VUM B;  1CSQ A;  2EPB A;  4JI6 L;  1E0B A;  1O80 A;  4X3U A;  2M2L A;  3L7Z C;  1K8M A;  2IL8 A;  4JG2 A;  4DV3 L;  3IRB A;  1TS5 A;  2PI2 A;  3PGZ A;  3CME A;  1PTO C;  2K32 A;  3GTL B;  3S1M H;  4GOP A;  2J4X A;  3S17 H;  2K5H A;  3EFX D;  1EQR A;  1LT3 D;  4CBV A;  3KOJ A;  4LF5 Q;  1I5F A;  1CZW A;  1LLR D;  4OHJ A;  1EY6 A;  1EY8 A;  3H0G H;  1I50 B;  2R3Z A;  4JBW A;  1LO5 D;  1GUN A;  5EKL A;  2XRQ D;  4L6T B;  2JA7 B;  1U4M A;  4K8J A;  2Q2I A;  1WCM G;  2C35 B;  1BF4 A;  1S5F D;  2PYK A;  4JI2 Q;  4TVA B;  2HHH Q;  4P72 A;  1SNC A;  4KD3 A;  4S3S A;  4DR1 Q;  1VQ5 A;  3OW2 A;  1K28 A;  1VS0 A;  3ULL A;  3MFY A;  3QOL A;  4XXE A;  1JIC A;  4ZKB B;  1F9S A;  1LM0 A;  3BVM A;  3CPF A;  4KN7 C;  4X65 L;  1ZKO A;  1JCK B;  2X6L A;  3BJU A;  4C1N I;  2EYO A;  4LJZ C;  5IGE A;  1AP0 A;  1TS4 A;  3S24 A;  3GTQ B;  1GXD C;  4BBR H;  2A69 C;  1A15 A;  1EY4 A;  2CHB D;  2Z4I A;  2NWG A;  3RUZ A;  2ES2 A;  4TRD A;  4RG1 A;  2YTX A;  4QMG A;  2CKZ B;  3I4N H;  1RCV D;  1T5X D;  1UEB A;  1FJG L;  2JA8 G;  3VA5 A;  3DEP A;  4RWS C;  2B2V A;  2VUM H;  3SVM A;  3PCO B;  4DR5 L;  1S5D D;  1E2W A;  4RA8 A;  3CC4 A;  3OWE B;  4I65 A;  1Q81 C;  3QG1 A;  1LV9 A;  4YWK A;  1K83 H;  3V2T A;  1ESF A;  1I6H B;  5CV8 A;  1J5E L;  3H3V I;  2R6G A;  3GTL H;  4IUV A;  1GOZ A;  1TWC B;  4HIO A;  3CCS A;  1FGB D;  1I50 H;  1SE3 A;  2E8G A;  1Y1W B;  4DUZ Q;  2R92 B;  4JBM A;  4K6L A;  4UAI A;  1BUV T;  5JEA G;  4EQP A;  1PV4 A;  2QW7 A;  3E3X A;  4MNO A;  1IYU A;  3TS2 A;  1YNN D;  2JK8 A;  4FO2 A;  1ROD A;  4KHP L;  1JMC A;  3DMU A;  3GTO B;  2EZV A;  4A3E B;  1QVC A;  1FL0 A;  1AE2 A;  2ENB A;  4GNX B;  3BZD B;  1NBW A;  2K75 A;  1OXS C;  3DUZ A;  2R7Z B;  4I7Z C;  1HTL D;  4KMU C;  3PO2 B;  1D6E C;  4IOC A;  1WTO A;  1CA6 A;  2NN6 I;  1BDO A;  4B3M L;  3ITP A;  1IBK L;  3AMU A;  3WDN A;  2K14 A;  3L9A X;  1G51 A;  1BBW A;  3OPO A;  3J81 c;  3GTQ H;  1I6V C;  3BDC A;  2CQO A;  4HIM A;  3CCE A;  4U67 3;  2KEN A;  2I5H A;  1EQV A;  2E75 C;  4DU9 A;  1SEB D;  5AFW A;  2GA4 B;  4XQJ A;  1YEZ A;  4X3S A;  1VQ9 A;  4Y52 H;  5C4J B;  1HUM A;  4M1U B;  4OWX B;  4N9T A;  1G6Z A;  1VQE A;  1PTO F;  3TN2 A;  4M8A A;  4XDX A;  1WVL A;  4JOI C;  4DK6 C;  1XYI A;  1KDA A;  2WAQ G;  1TWC H;  2UXC Q;  1JB3 A;  3MEF A;  4JI4 Q;  1Y1W H;  4FF4 A;  1IBL Q;  2UUB Q;  2IY5 B;  4ZYS A;  1R9T B;  1X56 A;  4OXP A;  1I94 Q;  5HUR A;  4L5R C;  4O42 A;  4RKB A;  1HNZ Q;  2OTJ A;  1FNU A;  1TWH B;  1LTT D;  3GTO H;  3W5O A;  2K5W A;  1T9H A;  1A2U A;  4A3F G;  5K5P A;  2NYZ D;  2AMC B;  1DOK A;  2D2C C;  3G6J B;  1MIU A;  1RHP A;  4X62 L;  2JQO A;  3NXW A;  2R7Z H;  1N36 Q;  3PO2 H;  1C0A A;  4CDF C;  1RD9 D;  1R4P B;  5I6W A;  2F0D A;  1X55 A;  3J7A V;  2XWJ B;  1QIL A;  1DYQ A;  4R8N A;  1N33 L;  2JSO A;  4BY1 B;  5KEE A;  1D5Z C;  1UUP A;  4XTC S;  1DD2 A;  1PTO B;  3SK8 A;  4G7H C;  2OXP A;  3SXH A;  5I2Y A;  5D3D A;  1A0I A;  1MJE A;  2A68 D;  2F0T A;  3PO3 G;  1WTH A;  4Y7N B;  1PFM A;  3SDZ A;  4A3L G;  2B2W A;  3M4O B;  1YHB A;  5FJ8 G;  2WB1 B;  3PF4 A;  2PW7 A;  5KGU A;  3MAQ A;  4FDB A;  3I90 A;  3CP0 A;  3D3R A;  3NWT A;  1YHQ A;  2VZA A;  1A63 A;  3H6M A;  5M5W B;  1PH8 A;  4LF7 Q;  5I2X A;  4PQX A;  4DV2 L;  3W1B A;  3X3N A;  4P2C B;  1E7Z A;  4RHS A;  1TWF B;  5C0X G;  2FXQ A;  1JE4 A;  2K05 A;  1RDP D;  4CKE A;  4JV5 L;  5ELE A;  1JT8 A;  3C1F A;  1R9T H;  3BYY B;  1HR0 L;  2Q2H A;  3M7N A;  1N32 L;  2IW3 A;  4JI6 Q;  1EIF A;  1TWH H;  2FHT A;  3MVV A;  3W2D A;  3OW7 A;  2VQF L;  4KHV A;  2NVT B;  2VL6 A;  3DWQ A;  3I70 A;  1W6J A;  2Y0S B;  4DV3 Q;  3CCL A;  1JC7 A;  1UWV A;  3IL8 A;  4IUQ A;  3DXJ C;  1UEA B;  2VS1 A;  1K9M C;  3LNN A;  4XT1 B;  2N3S A;  1T5E A;  4HED A;  1C7Y A;  2EYH A;  1SLJ A;  3TRZ A;  4DAM A;  2CW0 D;  1B3A A;  4AYB B;  1MSH A;  1Y1V B;  3J80 c;  4BY1 H;  1D1I A;  1CHQ D;  1H95 A;  1PFB A;  4G7O C;  4B3S L;  1PTO H;  3BZC A;  4IUU A;  2H5X A;  1LTS D;  2AQ1 B;  3ERO A;  5IYD H;  1KNE A;  2K5Q A;  1EU3 A;  4GZY C;  4IUP A;  2MO1 A;  2YU9 B;  3HOU G;  4Y7N H;  2K4K A;  4CKC A;  3M4O H;  3U9O A;  4X65 Q;  2WKD A;  4OO1 I;  1PLF A;  4FXK C;  4AIM A;  4DV7 L;  3RLN A;  1GUW A;  2EYF A;  4OL7 A;  2ZTE A;  4H44 C;  3I2Z A;  1LT4 D;  4NXN L;  5KNC A;  4GOP C;  3OMG A;  2MO0 A;  3IAY A;  3HKZ E;  2PW5 A;  2K03 A;  2BH8 A;  1TWF H;  1A62 A;  4C3H G;  3HKS A;  3CHB D;  1FJG Q;  2QDB A;  2MNA A;  2L5T A;  3TME A;  4GKJ L;  2KCM A;  1M8A A;  5IP7 H;  4WJ4 A;  4DR5 Q;  1PH9 A;  2JN4 A;  4EGV A;  5C3E G;  3S1Q B;  5ELN A;  2KJX A;  2NVT H;  3J81 i;  5FOB B;  4ZRZ A;  2KED A;  3GTG H;  5JPM C;  3T4A C;  3FKI B;  4A93 G;  4PZ8 A;  1LTB D;  4HJA A;  2F0H A;  1J5E Q;  1PRT D;  2FMM A;  3DHQ A;  5C3W A;  4HJ9 A;  4DNI A;  3NSW A;  2I07 B;  1F2Z A;  2KCT A;  3BG3 A;  4YY3 L;  1SNO A;  1O7Y A;  1YIJ A;  1K8A C;  5CR3 A;  1VMP A;  4NXM L;  1X65 A;  1O7L A;  1SE2 A;  3RLF A;  5I9O A;  1G29 1;  1TS3 A;  1I4X A;  4KY7 A;  1EIY B;  1TR5 A;  1VQ7 A;  1HHV A;  4IZ8 A;  2PMZ E;  5L37 A;  2G9H D;  1YNN C;  3NUC A;  3I56 A;  4A3G G;  4B3R Q;  1AW7 A;  1GHJ A;  3M85 A;  1RTO A;  5JVG 3;  1I4G A;  4UPA A;  2YU9 H;  2B2V C;  3MXU A;  1EFW A;  1Y8O B;  3UDX A;  4DV5 L;  2D0O A;  5JVH 3;  3RLO A;  1Y8N B;  4JYA L;  4B3M Q;  1G2S A;  1HQM C;  1IBK Q;  2B39 A;  2JP1 A;  2PQE A;  2NZO A;  3FPU B;  3KLS X;  1EEI D;  5C0X I;  1PDQ A;  2PQA B;  3MFG A;  3SK4 A;  2RVL A;  1K8G A;  1I4H A;  1LAB A;  2N55 A;  4DAP A;  2OEO A;  3ULP A;  1HA5 A;  4UHV A;  2LMC B;  4ILW A;  1CKN A;  5FKA C;  4BA1 I;  4FF2 A;  2NVX B;  2A5H A;  2CWA A;  4CDE C;  1HJP A;  4JI1 L;  3S1Q H;  2NVY B;  1YNX A;  2A73 B;  2M00 A;  4N8F A;  3A8J E;  3FKI H;  3VR6 A;  1U4L A;  5K36 G;  1CA5 A;  2RCN A;  4DV4 L;  3WOF A;  5AJ3 L;  1PYS B;  5IGF A;  2HQL A;  1UAP A;  4DGZ A;  3KF8 B;  3NEL A;  1F2Y A;  3KJP A;  4IJH A;  3UE0 A;  5G3L D;  3H3V H;  3DLL A;  2AQ2 B;  4PZ6 A;  1A2T A;  2QIL A;  3BU2 A;  4B08 A;  1XPO A;  1SFO B;  4LFB L;  5KYI A;  4CKB A;  4LF8 L;  2JA6 B;  2PNR C;  3SR1 A;  4BY7 G;  2KHJ A;  1XMQ L;  1IHZ A;  1WCM B;  4ME3 A;  1C9O A;  1M1K C;  1VQK A;  4TQU S;  4PV1 C;  2F0V A;  2DNE A;  4MZ9 A;  2E74 C;  1TY0 A;  4A3K G;  3KFU A;  1HTP A;  1SAP A;  2D5D A;  1S5C D;  1B70 B;  1PFS A;  3I73 A;  1EWH A;  1L2F A;  1N33 Q;  5FO7 B;  2NUC A;  2RDF A;  1GVP A;  1IXR A;  3B6Y A;  3FHW A;  3NPP A;  1HRJ A;  3PQI A;  4DK0 A;  3K7A B;  5CMD A;  2QF7 A;  1BCP D;  2TMP A;  3BDO A;  2NVX H;  1BQQ T;  4GN4 B;  2NVY H;  2R7D A;  3PUX A;  3J80 i;  5M3F G;  5A2Q L;  5FLM G;  2IX3 A;  1EIH A;  4EX5 A;  3T51 B;  1V9P A;  4O2D A;  2ATW A;  1V1O A;  1JR0 D;  4DV2 Q;  3L0O A;  2VY3 A;  2HCC A;  1KIX A;  4NW2 A;  3FMC A;  1GHK A;  4JV5 Q;  1SBB B;  4XT3 B;  1HR0 Q;  3H09 A;  4R4C A;  5C4Z A;  1N32 Q;  4FNF A;  3S9W A;  1SFO H;  2VQF Q;  4DV0 L;  1JWS D;  3PUZ A;  2EQS A;  3F2C A;  4POG A;  2WV6 D;  1JOR A;  3H0G B;  3PIP 3;  1WCM H;  5DAU A;  4GOP B;  5BN3 A;  5JJI A;  4DR4 Q;  1Q82 C;  4L5S A;  1VCI A;  3GP7 A;  4NPS A;  4RFB A;  1WJJ A;  2B2W C;  3ND9 A;  1QUQ A;  3S2D B;  4OON A;  3K59 A;  4A3B B;  2NZ1 D;  4JI3 L;  3RR5 A;  1J8I A;  4NKL A;  1V1P A;  4R4T A;  1WTW A;  2K5D A;  4RCO A;  4B3S Q;  2Y0S E;  4AQY L;  1DCZ A;  2WIN B;  3K7A H;  3GO5 A;  4F8M A;  4ALP A;  2F0P A;  3STB C;  3HOW G;  5D3I B;  2JA8 H;  2AUJ D;  4DKA C;  3RNU A;  2Z0S A;  1CKO A;  1B9N A;  3W3A A;  5COR A;  3CKI B;  3UE1 A;  2ZTC A;  4DV7 Q;  4A76 A;  2KEE A;  3ICE A;  3A5U A;  3I4N B;  5BR8 L;  5C4X G;  1A6X A;  4GLA C;  3TP8 A;  4DV6 L;  2QCP X;  3UDG A;  4NXN Q;  4K14 A;  2RDH A;  3D4W A;  4RMF A;  2K52 A;  2XN9 C;  4C3J G;  2K04 A;  3TP5 A;  5FLX E;  1E2Z A;  1K83 B;  4GKJ Q;  1KRT A;  2HCI A;  2ASB A;  4Z9C B;  4EQO A;  4FVM A;  2CQA A;  4RKL A;  1XTC D;  1GJX A;  1SXT A;  1NMG A;  4ZUJ A;  2KA7 A;  1VQD A;  1D8L A;  2F0K A;  4UP8 A;  5C44 G;  4DV1 L;  5DM6 3;  4A3F B;  1WD0 A;  1D2B A;  2KOL A;  3U9S A;  4O0A A;  4YY3 Q;  1STA A;  2JYO A;  3S2D H;  2HUG A;  3H94 A;  4NXM Q;  4A3B H;  2LY7 A;  1FNW A;  4YIJ A;  3RN2 A;  1TWG B;  1GUO A;  1Q7Y C;  1I4Q A;  1KLG D;  1NUC A;  4C3I B;  3ULJ A;  4PZ7 A;  3SGI A;  3EBE A;  3M4Q A;  1L0W A;  3KF6 B;  4Q0F A;  1VQI A;  4IAL A;  3A5Z B;  3Q22 A;  2IX1 A;  1X6O A;  4LUZ A;  4P73 A;  4DV5 Q;  1RIP A;  4KI0 A;  4NDX A;  4JYA Q;  3JAM E;  1MHW C;  1B4O A;  3HZX A;  4JW0 A;  1Q1E A;  2B63 B;  1V43 A;  1CZG A;  4HJ7 A;  1C48 A;  1H9S A;  2QEX A;  3RN5 A;  3K57 A;  3TEH B;  3TBI B;  4A3D B;  2QEJ C;  4KKU A;  1II3 A;  2D9U A;  3K5O A;  5DEH A;  1BVS A;  4H7B A;  1IW7 D;  3I7F A;  1B8A A;  4DR2 L;  1PZK D;  5M3M G;  2H4O A;  2K7V A;  5CV9 A;  2EOT A;  4LNQ A;  2XRS D;  4PMB A;  5ELB A;  1QVF A;  2EE1 A;  4JI1 Q;  3J81 L;  1F9Q A;  3AYH B;  1KC8 C;  3K6O A;  1VQF A;  3G7L A;  3AB9 A;  4DV4 Q;  1J6Q A;  5AJ3 Q;  5M9O A;  4KJN A;  3A8K E;  2ZT9 C;  4L5T A;  4A3F H;  2L15 A;  4IFD I;  5KIX A;  1Y14 B;  3IFD A;  5ELD A;  3TS0 A;  3C3L A;  1N9W A;  5CC4 A;  1E24 A;  1Q3L A;  3PUV A;  1TWG H;  5E3F A;  4LFB Q;  1ESR A;  3KF6 A;  4C3I H;  4LF4 L;  3D4R A;  4LF8 Q;  4UY8 C;  2OTL A;  1ET9 A;  1EEF D;  1XMQ Q;  2EIF A;  1S4Z A;  5LHY 1;  4K5W A;  2QKI C;  2E2I B;  3PO3 H;  1VQA A;  4JK1 C;  3TZU A;  3HOU B;  4NB3 A;  1SNP A;  2B63 H;  4APV A;  5FJ8 H;  3Q23 A;  3FDT A;  1XTD A;  1HA6 A;  3HOY G;  1K3B C;  5IOD A;  1TVX A;  4DK1 A;  4A3D H;  1Z6H A;  3DWA A;  3H3V C;  1SYC A;  1ET6 A;  3E0E A;  1OO9 B;  4MHE A;  3G6E A;  2LS0 1;  4IPC A;  5C0X H;  2A1A A;  1XNQ L;  3I4M B;  3GV3 A;  4OO1 G;  4PG3 A;  5LMN L;  2SNS A;  1Y8P B;  1LT5 D;  4DR3 L;  4BBR G;  1SYF A;  2NVQ B;  1KHI A;  1UE1 A;  3CCU A;  5C0X J;  3AEV A;  4HCE A;  1PRT F;  3OSO A;  4A93 B;  1EY9 A;  4QIW B;  3U4V A;  1QZH A;  1OXU A;  2E2D C;  1EYC A;  1UE6 A;  5C4H A;  3NEM A;  3HOV B;  1HCZ A;  1IYJ B;  2L12 A;  2IJ0 A;  4QJF A;  2IX0 A;  1C4Q A;  3K8A A;  2QDL A;  1TS2 A;  2RF4 A;  5EBD A;  2XWB B;  4G57 A;  1A3T A;  1KTK A;  4V19 0;  1VMC A;  4DV0 Q;  3R3O A;  1KQS A;  1PFN A;  2OT2 A;  5A35 A;  1WTR A;  4IUT A;  2C5C A;  1PH7 A;  5J3B A;  2KCN A;  1SND A;  3P1H A;  1G91 A;  4KY6 A;  4K0K L;  3CF5 A;  2Z6B A;  2E2I H;  2FFK B;  4ZQ3 A;  4GKK L;  2EYL A;  3HOU H;  2WFW A;  2L4N A;  2JA7 G;  4LAA A;  2XNA C;  3HKZ G;  4JI3 Q;  4DNT B;  3VYT A;  1PH4 A;  2Q8R E;  1EZ8 A;  2EY6 A;  2F0N A;  3X3M A;  3CQZ B;  4GLX A;  1EU4 A;  2N88 A;  1D5X C;  3OTO L;  2BE5 D;  2KHI A;  4LF6 L;  1JB7 A;  4AQY Q;  1SRO A;  3I3C A;  4RGT A;  1PHJ A;  5IT9 c;  1PRT B;  4JI5 L;  3I4M H;  1RF2 D;  4YHH L;  4B9W A;  1VQM A;  3MXN B;  1FYC A;  3J80 L;  4C56 C;  1XMO L;  4WJW A;  4RCN A;  3J81 j;  3CC2 A;  3I72 A;  2NVQ H;  5BR8 Q;  1S72 A;  4RH6 A;  1SJH D;  3BVZ A;  5IGB A;  4DV6 Q;  2UU9 Q;  2CWP A;  2FJ2 A;  4A93 H;  3VYU A;  4FXD A;  2JJQ A;  1R4Q B;  3I4O A;  5KYL A;  1EY0 A;  2F0O A;  3BYT B;  2A74 C;  3HOV H;  5IGD A;  5IP9 G;  4A3J G;  3T1H L;  3GTG B;  5GAD C;  4R9W A;  5G3L F;  3TZD A;  3M4P A;  2A6E D;  3CRL C;  3AU7 A;  4QUF A;  1Q86 C;  3AFP A;  2AKW B;  3HOX G;  4PMC A;  1LTL A;  5I6Y A;  4OWW B;  1VQN A;  1PVO A;  3MWY W;  4UDU C;  1Q12 A;  2ALY B;  2JEA I;  2R92 G;  1NNX A;  1EYA A;  2K5N A;  1WTV A;  4LFA L;  4DXF A;  1Q8I A;  4LK1 C;  2PZW A;  2DJF C;  4A3K B;  1A3V A;  4N9P A;  4CHT B;  4N8X 1;  2RHS B;  3K0X A;  3FP9 A;  3NTK A;  4A3E G;  3PIO A;  1BBX C;  3CQZ H;  1LTG D;  3NP8 A;  1JOQ A;  4POF A;  3LWU A;  1JOK A;  3A55 A;  1VQH A;  2F52 A;  3C1E A;  1STN A;  1KL9 A;  3MXN A;  1B2T A;  4H02 A;  1BCP F;  3N52 A;  1V8Q A;  4HTH A;  4AH6 A;  1Q90 A;  1OXV A;  4IOA A;  1ASZ A;  1SNM A;  3AQQ A;  1E1O A;  2Z4H A;  5KNB A;  1EUJ A;  5FLX c;  5M3F B;  1VQB A;  1VF5 C;  1AFP A;  1STY A;  1KDC A;  3Q6S A;  3U50 C;  3KLR A;  2R93 B;  1HQR D;  1LYL A;  3WWV A;  2UXD L;  2DY7 A;  2Z9H A;  4I7A A;  4DR2 Q;  1CKN B;  3F2D A;  1IW7 C;  3D31 A;  2GVB A;  1H9M A;  1SSO A;  1B7Y B;  2BA0 A;  3ER0 A;  1CSP A;  2CCZ A;  3M3Y B;  3MXG A;  2D62 A;  2XIW A;  2G9D A;  2K33 A;  4BXX G;  3Q24 A;  3T1Y L;  2AUK A;  4G7Z C;  2RA4 A;  1PXU A;  3EA6 A;  2SNM A;  5GAH C;  1HZB A;  4MTN A;  2EY1 A;  2L11 A;  4LWC A;  5C5L A;  4KHP Q;  5IWA L;  5GRO A;  1F77 A;  1PH6 A;  2JA5 G;  3K0Y A;  4G4K A;  4KJO A;  4A3K H;  3T53 B;  4KD4 A;  2DNC A;  2XTI A;  1BCP B;  3M9B A;  3MC0 B;  3Q8D A;  2SEB D;  3V05 A;  3LX0 A;  1NSN S;  3CC7 A;  4LF4 Q;  1ZEQ X;  1PH1 A;  1LAC A;  2ZXP A;  3QIA A;  3JAM c;  1IL2 A;  3D6W A;  5C5M A;  1XNR L;  1KLU D;  4OEM B;  2R7F A;  2EJM A;  3L2P A;  1F9R A;  2YTV A;  4HSP A;  3EN2 A;  3HOW B;  1WTX A;  1QOH A;  4P74 A;  4FYD A;  2EDG A;  2RHQ B;  1AE3 A;  2F4I A;  1YJ9 A;  2XVS A;  5M3F H;  2KEC A;  4KV6 A;  5FLM H;  2FIN B;  3GTP H;  5C4X B;  2R93 H;  3QJY A;  2LKV A;  4DAY A;  2M9V A;  4A4I A;  5JPN C;  2O4X A;  1RKN A;  4YWL A;  4NMZ A;  2LXK A;  1F2L A;  3A74 A;  3EJI A;  4JBK A;  3OIP A;  4C3J B;  1XNQ Q;  2HD3 A;  2TSS A;  5KRU A;  2JA9 A;  5LMN Q;  3M3Y H;  4F88 A;  4DUY L;  3NQI A;  4DR3 Q;  4H0L C;  1QNK A;  3OOC A;  1TWA B;  2IT1 A;  3P75 A;  3CCR A;  4YCU A;  1FD7 D;  4TKO B;  4CDD C;  4BBS G;  4CJ0 B;  1YNJ D;  5C44 B;  1XPR A;  2Z8L A;  2IHE A;  3U58 A;  4HJ8 A;  5GQO A;  4JPB W;  3KYH C;  1B50 A;  1A8V A;  2F0U A;  5FK9 C;  3K7U C;  2RQX A;  2MGS A;  4R4I A;  4A3I G;  2Y0S G;  1SJE D;  1L1O A;  2RSO A;  4X62 Q;  2LSS A;  2ZJP A;  1QCB D;  1F2M A;  4A3C G;  1FVI A;  1MGS A;  1EQQ A;  5EKI A;  2K1B A;  1PYB A;  2I5L X;  2L1B A;  1N34 L;  2LFN A;  1U9R A;  3H15 A;  4K0K Q;  1CFM A;  4LUO A;  5T1I A;  1IZ6 A;  1QUQ B;  4GKK Q;  5IIF A;  1CQF A;  4PMW A;  1D5M C;  2NN6 H;  1PMR A;  3HOW H;  1Y1V G;  4QF4 A;  4UP9 A;  2WP8 J;  3J7A 5;  1V1P B;  3OMC A;  4KLK A;  1EL0 A;  1F9P A;  4QL5 A;  5EPJ A;  1KAW A;  2Q2T A;  3NTH A;  1SYB A;  3OTO Q;  4R8I A;  5C4X H;  4IPD A;  2JA8 B;  4LF6 Q;  1GD7 A;  2A68 C;  3GQB A;  1GUT A;  3NEN A;  1HR0 W;  2BE5 C;  1GKH A;  4GN3 B;  4HID A;  2KQ3 A;  5ELO A;  1M4V A;  4C3J H;  1QG7 A;  1YVC A;  5D14 A;  5M3M B;  1LTI D;  4YHH Q;  5IT9 E;  4ZUI A;  1XMO Q;  3QOJ A;  2MFI A;  3TRE A;  1WTQ A;  1TWA H;  1Q1B A;  1HH2 P;  3URY A;  1ENA A;  2F3V A;  4O1N A;  1U4R A;  3NK9 A;  2F0I A;  4ZK9 B;  3F2U A;  2UUA L;  3K58 A;  5C44 H;  1VQC A;  2AQ3 B;  2N8N A;  1CM9 A;  1JOO A;  2BDN A;  3R2T A;  2WB1 E;  3T1H Q;  4PNY A;  1D1K A;  2RKS A;  5J1Z A;  1ONL A;  3WOE A;  2MQH A;  3VR4 A;  3GTJ B;  3FKI G;  2A6E C;  4HN7 A;  3M4Y A;  1SMY D;  4OGQ C;  2E2H H;  3GTM B;  2E2J B;  1JWM D;  2HIV A;  1K3R A;  1BBU A;  1SYD A;  1AN8 A;  5E7N A;  1PH2 A;  3HOZ G;  1CHP D;  3RZD B;  2CVR A;  2V1C C;  4IFD G;  1BNZ A;  1SYG A;  5IYC G;  1NMF A;  5EJW A;  2CW0 C;  1LUZ A;  1U0L A;  2B8F A;  4LFA Q;  1EYG A;  2I0Q A;  1SMX A;  1WI5 A;  5T1G A;  1VQG A;  3KBG A;  1XWE A;  4A3M G;  2O2L D;  1G6P A;  2NBF A;  2EXD A;  1EFI D;  1RJT A;  2Z6K C;  3JC6 6;  2NZH A;  3S14 B;  2BOS A;  1B9M A;  3ONA B;  3MZ5 A;  4HIK A;  1STH A;  1TXY A;  1I3Q B;  1TQO A;  2QGQ A;  5JOB A;  5M3M H;  2CH4 A;  4AYB E;  3A8I E;  1JJG A;  1VF7 A;  2DJG C;  2E76 C;  3ZYY X;  4CJ2 C;  3E0J A;  2VW9 A;  1I4R A;  1H9S B;  1X3Q A;  4V0B A;  1MJC A;  4X66 L;  3HG9 A;  2WAQ B;  3ND8 A;  4MN3 A;  3JAM i;  3DM1 A;  1UE7 A;  1AH9 A;  2EJF C;  1YZ6 A;  2UXD Q;  4Q5V A;  4L5Q A;  5JEA H;  1STB A;  4DR7 L;  3S15 B;  3EIV A;  2I5M X;  3V96 A;  3K5N A;  2YV5 A;  3GTJ H;  2UXB L;  4EQN A;  3KDF B;  3M7G A;  1HZ9 A;  3FPP A;  3GTM H;  2E2J H;  1PRT C;  5JEA J;  5J22 A;  1KD1 C;  4X3K A;  4KHZ A;  3T1Y Q;  3RZD H;  2FMC A;  2WAC A;  5J39 A;  4LW1 A;  1TKW B;  2F0Q A;  5IWA Q;  1SDF A;  4JVZ A;  1D7Q A;  4J15 A;  3K5M A;  2VNU D;  3CW2 C;  3TP6 A;  1KXL A;  3T56 B;  2K01 A;  1JE5 A;  1PZI D;  2B2U C;  3O13 A;  2JA6 G;  4J6H A;  3HKZ B;  2PZT A;  1PA6 A;  2L0C A;  3HOY H;  1GM5 A;  4XYQ A;  5JJZ A;  3S14 H;  1XNR Q;  3E9I A;  3PO3 B;  2ZXO A;  5JJK A;  1Q8K A;  2F0G A;  5IGG A;  4JI0 L;  1I3Q H;  1A3U A;  2F03 A;  1S5B D;  1KNA A;  2B2Y A;  1X32 A;  1HXY D;  5C6A A;  5CYU A;  3R2I A;  4C2M B;  3PUY A;  4IUR A;  4OO1 H;  4IUN A;  3VR3 A;  1BXT A;  3Q0A A;  1YJW A;  3VDY A;  2NTT A;  1L0Y B;  3BS1 A;  3G4S A;  1EQT A;  4HCS A;  4OX9 L;  4J8Q A;  3RZO B;  1L0X B;  4DPG A;  1E3P A;  1S3O A;  5E4W C;  1SN8 A;  5CV7 A;  5IYB G;  1SR3 A;  3FVQ A;  1QZG A;  1SE4 A;  3KDF A;  1HNW L;  3S15 H;  3I55 A;  3P7J A;  2ICI A;  2R61 A;  4A3J B;  2E5L L;  4FF3 A;  1EYD A;  4KKS A;  2PMZ B;  4HSV A;  3PIO 3;  4DUY Q;  4QB4 A;  1QVG A;  2O5J C;  1BR9 A;  1ICF B;  2RSN A;  5ELC A;  3KK7 A;  3CCQ A;  1ASY A;  3QO2 A;  3IKJ A;  3HOX B;  2ZXR A;  4X64 L;  4JI8 L;  4BS9 A;  5GAG C;  3MTS A;  1AZQ A;  4DA2 A;  2HT1 A;  2NTS A;  3MEH A;  2EYJ A;  3SK5 A;  3S16 B;  2WII B;  3U4Z A;  1YNJ C;  2LXJ A;  5LMU L;  4DN4 M;  1EWC A;  3RMH A;  4QCL A;  2CH4 W;  4XYO A;  1G2T A;  3OYY A;  4L8J A;  2JA7 H;  2F0F A;  5E4X A;  3D6C A;  2CFM A;  3HRZ C;  3TQY A;  3H0G G;  1ZXT A;  1HNX L;  2MJ8 A;  4MTK A;  2HQE A;  1KAB A;  2EYM A;  4B3R L;  3SE0 A;  3I8Z A;  4A3L H;  5CV6 A;  2L55 A;  1B3Q A;  1N34 Q;  1UE5 A;  5ELF A;  1U4P A;  3N6R A;  1FNV A;  2B2T A;  5FO8 B;  4A3B G;  2BA1 A;  4HR7 B;  3OHX C;  4C2M H;  3GV6 A;  1GUG A;  2JE6 I;  1EWI A;  3NWS A;  4RGO S;  3H91 A;  4FF1 A;  3RD4 A;  4QGU A;  3LGJ A;  1PZJ D; 
#chains in the Genus database with same CATH homology
 1EY7 A;  4C3H B;  3FRP B;  1MD2 D;  5CV4 A;  3L3O C;  3PMF A;  1IYV A;  1BCP C;  4X3T A;  4F7X A;  1AZP A;  4ZLT F;  2KCC A;  3NQT A;  1Z47 A;  5C3E B;  1ENC A;  5EQ0 A;  2KVM A;  4NP5 A;  2AWN A;  1NR4 A;  4TSS A;  4KN4 C;  3DEO A;  5IT9 L;  3SHL A;  1QNU A;  2X69 A;  5I4D A;  1ENF A;  2DY8 A;  5CBE E;  2JA5 B;  4A3G B;  1LT6 D;  1H9R A;  5IOC A;  4FP5 D;  4MIU A;  1IKM A;  4WFN 3;  2O5I C;  1NR2 A;  1SMY C;  4WRD A;  2F0J A;  1QE6 A;  1TY2 A;  3HS0 C;  3CU7 A;  4DNR B;  1MBY A;  1MI2 A;  4FXG C;  2I46 A;  2H1E A;  4RHR A;  4C3I G;  1FR3 A;  2V4D A;  5DM7 3;  3S1N B;  5A2Q E;  5KND A;  1IKL A;  5LL6 S;  1BOS A;  2A6H D;  2F0E A;  4F87 A;  1QWY A;  5HGT A;  3K5L A;  3HEJ A;  4EVO A;  4ZAI A;  3NE5 B;  3S1R B;  3BVG A;  1RTN A;  2BDO A;  3D4D A;  1OXT A;  1TII D;  1SNQ A;  3KLS A;  5DNF A;  1ZYR D;  3R8B A;  4WOR A;  1LTA D;  4XIG S;  5M5X B;  1DJR D;  1SYE A;  4ZKC B;  5C3X A;  3OIQ A;  5D65 A;  4BBS B;  2PCF B;  4IQZ A;  4U68 A;  2NB0 A;  2J7Z A;  5LL6 X;  1UNS A;  2EYP A;  4BY7 B;  3KBX A;  4A3I B;  5FLX L;  2VXW A;  5E1F A;  1DOM A;  3VYR A;  1DON A;  4HMI A;  1EOT A;  4RGM A;  3TDQ A;  3EQL C;  4BA2 I;  5CV5 A;  5NUC A;  2EJG C;  2JXM B;  1O7Z A;  3NBH A;  4DAV A;  1G8Z D;  3S2H B;  1XX8 A;  4HAE A;  2KHS A;  4K5V A;  1CTM A;  3T16 A;  3GTK B;  2JEB I;  2MP1 A;  2B2U A;  3A7L A;  3SK6 A;  3I91 A;  4LMQ D;  5K36 H;  2KUM A;  5JAV A;  3GTP B;  1JWU D;  3NBI A;  1H9K A;  3MXP A;  1EIG A;  4ABN A;  3JAM L;  5EPK A;  4OIJ A;  1B1Z A;  4ODG A;  2F0S A;  5FO9 B;  3VR2 A;  4RGN A;  4RAU C;  1PTO D;  3ERQ A;  2SOB A;  4B9X A;  5I9P A;  3SEB A;  1OXX K;  2HDM A;  4C1N K;  2EY2 A;  2MHV A;  2AWO A;  1GUS A;  1B53 A;  5CGK A;  3HOZ B;  2XSC A;  2B2Y C;  1PYW D;  2EVB A;  1BO0 A;  3E6Z X;  1Y69 U;  2Q8I B;  2MUY A;  4H13 C;  4A3M B;  3LWE A;  2K28 A;  1DOL A;  1ML0 D;  4K2L A;  3KUP A;  5M5Y B;  2A69 D;  3BDL A;  4XQN A;  3NHH A;  3VA7 A;  2EY5 A;  4K2K A;  4KKT A;  4KY5 A;  3J81 E;  1O78 A;  1TU2 B;  1B44 D;  3QWN A;  2IPK D;  4OIK A;  2F0W A;  1KAA A;  3C2P A;  5BN4 A;  3P20 A;  2B8G A;  2SDF A;  4KTA A;  3VYS A;  1S5E D;  3A56 A;  5EKK A;  1HFG A;  4QUC A;  3A54 A;  2RDG A;  1ILQ A;  1STG A;  2B2T C;  2J0T D;  5ISR A;  4IFD H;  3TSS A;  5BN5 A;  2E2H B;  2Z1C A;  4CJ1 B;  2HDL A;  2MPM A;  4HMJ A;  3OWF A;  3GD7 A;  2VB3 X;  1H9J A;  4IFD J;  1IL8 A;  1W6K A;  3I4L A;  1EY5 A;  1QB5 D;  2VB2 X;  4BWG B;  1CI3 M;  4DXG A;  4KK7 A;  4ULL A;  3J7Y W;  1X3P A;  3PV0 A;  1DXM A;  4E6I A;  1K8O A;  1VDZ A;  1NCV A;  1DM0 B;  3PUW A;  1XXG A;  4CGY B;  2L9H A;  3T13 A;  5TSS A;  5EBC A;  4J1M A;  1C8C A;  1J9O A;  2F0L A;  2RBM A;  1MSG A;  2A6H C;  1DZ1 A;  1ILP A;  4K5X A;  2PZU A;  4XQQ A;  5CBA E;  3UI2 A;  3KF8 A;  3MA2 B;  4IN3 A;  2K6A A;  1CT1 D;  2PPB C;  2F1M A;  2ID0 A;  3HGB A;  2DN8 A;  2OF1 A;  1ZYR C;  2PO4 A;  4L63 B;  1NAP A;  1JQY D;  4K8I A;  1KDB A;  4DF7 A;  3R93 A;  3D8G A;  1HFN A;  5EPL A;  3S1M B;  3S17 B;  1QJO A;  2F0M A;  1I4P A;  2X6G A;  2C9O A;  2IWH A;  1EZ6 A;  1WD1 A;  3A7A B;  1WTP A;  1ICW A;  5EGT A;  4ME5 A;  2ICE C;  1Z7T A;  4DFA A;  1AEX A;  3HOY B;  3TP7 A;  3EVQ A;  1HUN A;  1TT2 A;  1CK1 A;  3DWP A;  3IFT A;  4K6D A;  1HPC A;  2YYZ A;  3HP3 A;  2WKC A;  3MHB A;  3J80 E;  3J7A F;  2BCO A;  1STE A;  3FEW X;  2Q8T A;  2NN6 G;  5COY A;  2F3W A;  3CRK C;  4BBR B;  5F2D A;  4ID6 A;  1E2V A;  2EXZ A;  3NTI A;  1CQV A;  3VR5 A;  3C46 A;  1LTR D;  5IGC A;  3QB3 A;  3E5S A;  2VUM B;  2EPB A;  1E0B A;  1O80 A;  4X3U A;  2M2L A;  3L7Z C;  1K8M A;  2IL8 A;  1TS5 A;  1PTO C;  2K32 A;  3GTL B;  2J4X A;  3EFX D;  4CBV A;  1LT3 D;  1CZW A;  1LLR D;  4OHJ A;  1EY6 A;  1EY8 A;  1I50 B;  2R3Z A;  4JBW A;  1LO5 D;  1GUN A;  5EKL A;  2XRQ D;  4L6T B;  2JA7 B;  1U4M A;  4K8J A;  1BF4 A;  1S5F D;  2PYK A;  1SNC A;  4KD3 A;  4S3S A;  3MFY A;  3QOL A;  4XXE A;  1JIC A;  4ZKB B;  1F9S A;  3BVM A;  4KN7 C;  1ZKO A;  1JCK B;  2X6L A;  4C1N I;  1AP0 A;  2EYO A;  4LJZ C;  5IGE A;  1TS4 A;  3GTQ B;  1GXD C;  2A69 C;  1A15 A;  1EY4 A;  2CHB D;  2Z4I A;  2NWG A;  3RUZ A;  4TRD A;  4QMG A;  1RCV D;  1T5X D;  3VA5 A;  3DEP A;  4RWS C;  2B2V A;  3SVM A;  1S5D D;  1E2W A;  4RA8 A;  3OWE B;  4I65 A;  3QG1 A;  1LV9 A;  3V2T A;  1ESF A;  1I6H B;  5CV8 A;  2R6G A;  4IUV A;  1GOZ A;  1TWC B;  1FGB D;  1SE3 A;  1Y1W B;  2R92 B;  4K6L A;  4UAI A;  1BUV T;  5JEA G;  4EQP A;  1IYU A;  1YNN D;  4FO2 A;  1ROD A;  3DMU A;  3GTO B;  2EZV A;  4A3E B;  2ENB A;  3BZD B;  1OXS C;  3DUZ A;  2R7Z B;  4I7Z C;  1HTL D;  4KMU C;  3PO2 B;  1D6E C;  1WTO A;  1CA6 A;  2NN6 I;  1BDO A;  3ITP A;  3AMU A;  3WDN A;  3L9A X;  3OPO A;  1I6V C;  3BDC A;  4U67 3;  1EQV A;  2E75 C;  4DU9 A;  1SEB D;  5AFW A;  2GA4 B;  4XQJ A;  4X3S A;  5C4J B;  1HUM A;  4M1U B;  4N9T A;  1G6Z A;  1PTO F;  3TN2 A;  4M8A A;  4XDX A;  1WVL A;  1XYI A;  1KDA A;  1JB3 A;  4FF4 A;  4ZYS A;  1R9T B;  5HUR A;  4O42 A;  4RKB A;  1FNU A;  1TWH B;  1LTT D;  2K5W A;  1A2U A;  5K5P A;  2NYZ D;  1DOK A;  2D2C C;  3G6J B;  1RHP A;  3NXW A;  1RD9 D;  1R4P B;  5I6W A;  2F0D A;  3J7A V;  2XWJ B;  1QIL A;  1DYQ A;  4R8N A;  2JSO A;  4BY1 B;  5KEE A;  1D5Z C;  1UUP A;  4XTC S;  1DD2 A;  1PTO B;  3SK8 A;  4G7H C;  2OXP A;  3SXH A;  5I2Y A;  5D3D A;  2A68 D;  2F0T A;  4Y7N B;  1PFM A;  3SDZ A;  2B2W A;  3M4O B;  2WB1 B;  2PW7 A;  5KGU A;  3MAQ A;  3I90 A;  3D3R A;  3NWT A;  3H6M A;  5M5W B;  5I2X A;  4PQX A;  3X3N A;  4P2C B;  4RHS A;  1TWF B;  5C0X G;  1JE4 A;  2K05 A;  1RDP D;  4CKE A;  5ELE A;  3C1F A;  3BYY B;  3M7N A;  2IW3 A;  3MVV A;  2FHT A;  3W2D A;  3OW7 A;  4KHV A;  2NVT B;  3DWQ A;  3I70 A;  1W6J A;  2Y0S B;  1JC7 A;  3IL8 A;  4IUQ A;  3DXJ C;  1UEA B;  3LNN A;  4XT1 B;  1T5E A;  4HED A;  2EYH A;  2CW0 D;  1B3A A;  4AYB B;  1MSH A;  1Y1V B;  1D1I A;  1CHQ D;  1PFB A;  4G7O C;  1PTO H;  4IUU A;  1LTS D;  2AQ1 B;  3ERO A;  1KNE A;  2K5Q A;  1EU3 A;  4GZY C;  4IUP A;  2YU9 B;  4CKC A;  3U9O A;  2WKD A;  4OO1 I;  1PLF A;  4FXK C;  1GUW A;  2EYF A;  4OL7 A;  4H44 C;  1LT4 D;  5KNC A;  3OMG A;  3IAY A;  2PW5 A;  2K03 A;  4C3H G;  3CHB D;  2QDB A;  2L5T A;  3TME A;  1M8A A;  4EGV A;  3S1Q B;  2KJX A;  5FOB B;  4ZRZ A;  2KED A;  5JPM C;  3T4A C;  3FKI B;  1LTB D;  2F0H A;  1PRT D;  2FMM A;  3DHQ A;  5C3W A;  3NSW A;  2I07 B;  1F2Z A;  3BG3 A;  1SNO A;  1O7Y A;  5CR3 A;  1VMP A;  1O7L A;  1SE2 A;  3RLF A;  5I9O A;  4KY7 A;  1G29 1;  1TS3 A;  1I4X A;  1TR5 A;  1HHV A;  4IZ8 A;  2G9H D;  1YNN C;  3NUC A;  1AW7 A;  1GHJ A;  3M85 A;  1RTO A;  5JVG 3;  1I4G A;  2B2V C;  3MXU A;  1Y8O B;  5JVH 3;  1Y8N B;  1G2S A;  1HQM C;  2B39 A;  2JP1 A;  2PQE A;  3FPU B;  3KLS X;  1EEI D;  5C0X I;  1PDQ A;  3MFG A;  3SK4 A;  2RVL A;  1I4H A;  1LAB A;  2N55 A;  4DAP A;  2OEO A;  1HA5 A;  2LMC B;  4ILW A;  5FKA C;  4BA1 I;  4FF2 A;  2NVX B;  2A5H A;  2NVY B;  2M00 A;  2A73 B;  3A8J E;  3VR6 A;  5K36 G;  1U4L A;  1CA5 A;  3WOF A;  5IGF A;  4DGZ A;  1UAP A;  1F2Y A;  5G3L D;  2AQ2 B;  1A2T A;  2QIL A;  4B08 A;  1SFO B;  5KYI A;  4CKB A;  2JA6 B;  2PNR C;  3SR1 A;  1IHZ A;  1WCM B;  4TQU S;  4PV1 C;  2F0V A;  2DNE A;  2E74 C;  1TY0 A;  1HTP A;  1SAP A;  2D5D A;  1S5C D;  3I73 A;  1EWH A;  5FO7 B;  2NUC A;  2RDF A;  3NPP A;  1HRJ A;  4DK0 A;  3K7A B;  5CMD A;  2QF7 A;  1BCP D;  2TMP A;  3BDO A;  1BQQ T;  3PUX A;  5A2Q L;  2IX3 A;  1EIH A;  3T51 B;  1V1O A;  1JR0 D;  2HCC A;  4NW2 A;  3FMC A;  1GHK A;  1SBB B;  4XT3 B;  3H09 A;  5C4Z A;  4FNF A;  3S9W A;  1JWS D;  3PUZ A;  2WV6 D;  1JOR A;  3H0G B;  3PIP 3;  5DAU A;  5BN3 A;  1VCI A;  3GP7 A;  4RFB A;  2B2W C;  3ND9 A;  3S2D B;  3K59 A;  4A3B B;  1J8I A;  2NZ1 D;  4NKL A;  1V1P A;  1WTW A;  2K5D A;  4RCO A;  1DCZ A;  2WIN B;  3GO5 A;  4F8M A;  2F0P A;  5D3I B;  2AUJ D;  1B9N A;  3W3A A;  5COR A;  3CKI B;  2KEE A;  3I4N B;  1A6X A;  3TP8 A;  2QCP X;  4K14 A;  2RDH A;  3D4W A;  2XN9 C;  4C3J G;  2K04 A;  3TP5 A;  5FLX E;  1E2Z A;  1K83 B;  2HCI A;  4Z9C B;  4EQO A;  4FVM A;  2CQA A;  4RKL A;  1XTC D;  1GJX A;  1SXT A;  4ZUJ A;  2KA7 A;  2F0K A;  5DM6 3;  4A3F B;  1WD0 A;  1D2B A;  2KOL A;  3U9S A;  1STA A;  2JYO A;  2HUG A;  3H94 A;  2LY7 A;  1FNW A;  4YIJ A;  1TWG B;  1GUO A;  1I4Q A;  1KLG D;  1NUC A;  4C3I B;  4Q0F A;  4IAL A;  3Q22 A;  2IX1 A;  4KI0 A;  4NDX A;  3JAM E;  1B4O A;  3HZX A;  1Q1E A;  2B63 B;  1V43 A;  1CZG A;  1C48 A;  1H9S A;  3K57 A;  3TBI B;  4A3D B;  2QEJ C;  4KKU A;  1II3 A;  2D9U A;  3K5O A;  5DEH A;  4H7B A;  1IW7 D;  1PZK D;  2H4O A;  2K7V A;  5CV9 A;  2EOT A;  2XRS D;  4PMB A;  5ELB A;  2EE1 A;  3J81 L;  1F9Q A;  3K6O A;  3G7L A;  3AB9 A;  5M9O A;  4KJN A;  3A8K E;  2ZT9 C;  4IFD I;  5KIX A;  3IFD A;  5ELD A;  3C3L A;  5CC4 A;  1Q3L A;  3PUV A;  5E3F A;  1ESR A;  3D4R A;  1ET9 A;  1EEF D;  1S4Z A;  5LHY 1;  4K5W A;  2QKI C;  2E2I B;  4JK1 C;  3TZU A;  3HOU B;  1SNP A;  3Q23 A;  3FDT A;  1HA6 A;  5IOD A;  1TVX A;  4DK1 A;  1Z6H A;  3DWA A;  3H3V C;  1SYC A;  1ET6 A;  1OO9 B;  4MHE A;  2LS0 1;  5C0X H;  3I4M B;  3GV3 A;  4OO1 G;  2SNS A;  1Y8P B;  1LT5 D;  1SYF A;  2NVQ B;  5C0X J;  4HCE A;  1PRT F;  3OSO A;  4A93 B;  1EY9 A;  4QIW B;  1OXU A;  2E2D C;  1EYC A;  5C4H A;  3HOV B;  1HCZ A;  2L12 A;  2IJ0 A;  2IX0 A;  1C4Q A;  1TS2 A;  5EBD A;  2XWB B;  4G57 A;  1A3T A;  1KTK A;  4V19 0;  1VMC A;  3R3O A;  1PFN A;  2OT2 A;  5A35 A;  1WTR A;  4IUT A;  2C5C A;  2KCN A;  1SND A;  3P1H A;  1G91 A;  4KY6 A;  2FFK B;  4ZQ3 A;  2EYL A;  2L4N A;  4LAA A;  2XNA C;  4DNT B;  3VYT A;  2Q8R E;  1EZ8 A;  2EY6 A;  2F0N A;  3X3M A;  3CQZ B;  1EU4 A;  2N88 A;  1D5X C;  2BE5 D;  3I3C A;  4RGT A;  1PRT B;  1RF2 D;  4B9W A;  1FYC A;  3J80 L;  4C56 C;  4WJW A;  4RCN A;  3I72 A;  4RH6 A;  1SJH D;  3BVZ A;  5IGB A;  2FJ2 A;  3VYU A;  4FXD A;  1R4Q B;  5KYL A;  1EY0 A;  2F0O A;  3BYT B;  2A74 C;  5IGD A;  3GTG B;  4R9W A;  5G3L F;  3TZD A;  2A6E D;  3CRL C;  3AU7 A;  4QUF A;  4PMC A;  5I6Y A;  3MWY W;  4UDU C;  1Q12 A;  2JEA I;  1EYA A;  1WTV A;  4DXF A;  1Q8I A;  4LK1 C;  2PZW A;  4A3K B;  1A3V A;  4N9P A;  4CHT B;  3NTK A;  1BBX C;  1LTG D;  3NP8 A;  1JOQ A;  3LWU A;  1JOK A;  3A55 A;  3C1E A;  1STN A;  3MXN A;  1B2T A;  1BCP F;  3N52 A;  1V8Q A;  4HTH A;  1Q90 A;  1OXV A;  1SNM A;  2Z4H A;  5KNB A;  5M3F B;  1VF5 C;  1AFP A;  1STY A;  1KDC A;  3Q6S A;  3KLR A;  2R93 B;  1HQR D;  2DY7 A;  1IW7 C;  3D31 A;  1H9M A;  1SSO A;  2BA0 A;  3M3Y B;  3MXG A;  2D62 A;  2XIW A;  2G9D A;  2K33 A;  3Q24 A;  2AUK A;  4G7Z C;  2RA4 A;  1PXU A;  3EA6 A;  2SNM A;  2EY1 A;  2L11 A;  5C5L A;  1F77 A;  3K0Y A;  4G4K A;  4KJO A;  3T53 B;  4KD4 A;  2DNC A;  1BCP B;  3MC0 B;  2SEB D;  3V05 A;  3LX0 A;  1NSN S;  1ZEQ X;  1LAC A;  2ZXP A;  3QIA A;  3D6W A;  5C5M A;  1KLU D;  2EJM A;  1F9R A;  4HSP A;  3HOW B;  1WTX A;  1QOH A;  4FYD A;  2EDG A;  2F4I A;  2XVS A;  2KEC A;  4KV6 A;  2FIN B;  5C4X B;  3QJY A;  2LKV A;  4DAY A;  2M9V A;  5JPN C;  2O4X A;  1RKN A;  4NMZ A;  1F2L A;  3EJI A;  3OIP A;  4C3J B;  2TSS A;  5KRU A;  4F88 A;  3NQI A;  4H0L C;  1QNK A;  3OOC A;  1TWA B;  2IT1 A;  3P75 A;  1FD7 D;  4TKO B;  4CJ0 B;  1YNJ D;  5C44 B;  2Z8L A;  1B50 A;  5FK9 C;  2F0U A;  2RQX A;  2MGS A;  1SJE D;  2RSO A;  1QCB D;  1F2M A;  1MGS A;  5EKI A;  2K1B A;  2L1B A;  2LFN A;  1U9R A;  1CFM A;  5T1I A;  5IIF A;  1CQF A;  4PMW A;  1D5M C;  2NN6 H;  1PMR A;  4QF4 A;  2WP8 J;  1V1P B;  3OMC A;  1EL0 A;  1F9P A;  5EPJ A;  3NTH A;  1SYB A;  4R8I A;  2JA8 B;  2A68 C;  3GQB A;  1GUT A;  2BE5 C;  2KQ3 A;  1M4V A;  1QG7 A;  5IT9 E;  5D14 A;  5M3M B;  1LTI D;  4ZUI A;  3QOJ A;  1WTQ A;  1Q1B A;  3URY A;  1ENA A;  2F3V A;  4O1N A;  1U4R A;  3NK9 A;  2F0I A;  4ZK9 B;  3F2U A;  3K58 A;  2AQ3 B;  1CM9 A;  1JOO A;  2BDN A;  3R2T A;  4PNY A;  1D1K A;  2RKS A;  5J1Z A;  1ONL A;  3WOE A;  3VR4 A;  3GTJ B;  2A6E C;  4HN7 A;  3M4Y A;  1SMY D;  4OGQ C;  3GTM B;  2E2J B;  1JWM D;  1SYD A;  1AN8 A;  1CHP D;  3RZD B;  2CVR A;  4IFD G;  1BNZ A;  1SYG A;  5EJW A;  2CW0 C;  2B8F A;  5T1G A;  3KBG A;  1XWE A;  2O2L D;  2NBF A;  1EFI D;  1RJT A;  3S14 B;  2BOS A;  1B9M A;  3ONA B;  3MZ5 A;  1STH A;  1I3Q B;  1TQO A;  5JOB A;  3A8I E;  1VF7 A;  2E76 C;  3ZYY X;  4CJ2 C;  3E0J A;  1I4R A;  1H9S B;  1X3Q A;  4V0B A;  3HG9 A;  2WAQ B;  3ND8 A;  4MN3 A;  3DM1 A;  2EJF C;  4Q5V A;  5JEA H;  1STB A;  3S15 B;  3V96 A;  3K5N A;  4EQN A;  3M7G A;  3FPP A;  1PRT C;  5JEA J;  5J22 A;  4X3K A;  4KHZ A;  2FMC A;  2WAC A;  5J39 A;  1TKW B;  2F0Q A;  1SDF A;  3K5M A;  2VNU D;  3TP6 A;  3T56 B;  2K01 A;  1PZI D;  2B2U C;  3O13 A;  4J6H A;  3HKZ B;  2PZT A;  2L0C A;  4XYQ A;  5JJZ A;  3PO3 B;  2ZXO A;  2F0G A;  5IGG A;  1A3U A;  2F03 A;  1S5B D;  1KNA A;  2B2Y A;  1X32 A;  1HXY D;  5C6A A;  5CYU A;  3R2I A;  4C2M B;  4IUR A;  3PUY A;  4OO1 H;  4IUN A;  3VR3 A;  1BXT A;  3Q0A A;  2NTT A;  1L0Y B;  3BS1 A;  1EQT A;  4HCS A;  4J8Q A;  3RZO B;  1L0X B;  5E4W C;  5CV7 A;  3FVQ A;  1SE4 A;  3P7J A;  2ICI A;  2R61 A;  4A3J B;  4FF3 A;  1EYD A;  4KKS A;  2PMZ B;  4HSV A;  3PIO 3;  4QB4 A;  2O5J C;  1BR9 A;  2RSN A;  5ELC A;  3HOX B;  3KK7 A;  3QO2 A;  3IKJ A;  2ZXR A;  4BS9 A;  3MTS A;  1AZQ A;  4DA2 A;  2NTS A;  3MEH A;  2EYJ A;  3SK5 A;  3S16 B;  2WII B;  1YNJ C;  4DN4 M;  1EWC A;  3RMH A;  4QCL A;  4XYO A;  1G2T A;  4L8J A;  2F0F A;  5E4X A;  3D6C A;  3HRZ C;  1ZXT A;  2MJ8 A;  2HQE A;  1KAB A;  2EYM A;  3SE0 A;  3I8Z A;  5CV6 A;  2L55 A;  5ELF A;  1U4P A;  3N6R A;  1FNV A;  2B2T A;  5FO8 B;  2BA1 A;  4HR7 B;  3OHX C;  3GV6 A;  1GUG A;  2JE6 I;  3NWS A;  4RGO S;  3H91 A;  4FF1 A;  3RD4 A;  1PZJ D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...