5IGDA

Crystal structure of staphylococcal nuclease variant delta+phs t62h/i92e at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFHKKMVENAKKIEVEFDKGQRTDKYGRGLAYEYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS T62H/I92E at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5igdA00
1F2ZA 3QOLA 5M9OA 2NUCA 3T16A 2SOBA 2QDBA 3TP7A 2F0NA 5C3WA 3SR1A 3DHQA 4B9WA 5CGKA 5HURA 4DFAA 1EY6A 4NMZA 3TP8A 5C4HA 5HGTA 5C4ZA 5IIFA 4ZUIA 3MEHA 1A2TA 1SNPA 1STHA 2F0HA 2EYPA 2PZUA 2SNMA 2PW5A 4PNYA 4EQNA 1ENAA 4HTHA 3MVVA 1EYAA 5KIXA 3BDCA 3V2TA 5I9OA 1SYEA 1TR5A 2F0KA 4N9TA 2OXPA 1EY4A 5C6AA 2RKSA 2F0JA 1STAA 1EYCA 2OF1A 1STNA 4HMIA 5IGEA 1EY8A 4RKBA 5C3XA 3VA5A 5ISRA 5CV7A 1SYGA 2EYOA 4PMBA 4ZQ3A 3E5SA 4HMJA 3OMCA 2F3WA 4OL7A 4K6DA 5EKKA 1SYDA 2PZWA 3HEJA 5E1FA 3RUZA 1A2UA 4KD3A 3C1EA 4E6IA 3OSOA 5KYLA 1F2MA 2EYMA 1KDAA 3T13A 3P75A 3OMGA 5J22A 1EY7A 1ENCA 4K5WA 2F0OA 4KY5A 1KDCA 1NSNS 3TP6A 2F0MA 2F0EA 4TRDA 3D6CA 3EROA 4KY6A 5IOCA 3R3OA 5J39A 4K2KA 2RBMA 1EY9A 4WRDA 3U9OA 1STYA 4DF7A 1SYFA 5I9PA 5KRUA 3QOJA 2F0WA 3C1FA 4KD4A 4EVOA 1KDBA 2KQ3A 4S3SA 4K5VA 3SK8A 3MZ5A 5IODA 3ITPA 4ME5A 4RKLA 4KJNA 1STGA 5IGCA 4EQPA 3D4DA 3BDLA 5CV8A 1U9RA 3NQTA 1EQVA 3TMEA 2M00A 4K2LA 2F0UA 1NUCA 4KHVA 2OEOA 4NDXA 1A3UA 2F0LA 5C5MA 3ERQA 1SNQA 4QF4A 3SHLA 1STBA 1JOKA 2EYLA 3P1HA 3PMFA 3NK9A 1A3TA 1JOOA 4R8NA 3SK5A 2EYHA 5I6YA 2O4XA 5JAVA 4I65A 3EJIA 4QB4A 1II3A 1SNMA 3MHBA 5EGTA 4K8JA 5E3FA 4B9XA 1SNOA 4DGZA 2EY2A 4KJOA 1RKNA 3SXHA 4H7BA 3NUCA 5CC4A 5K5PA 5CR3A 1KAAA 2EY6A 2WACA 1SNCA 2EXZA 2PZTA 3SK6A 5J1ZA 4EQOA 3OWFA 2PQEA 4F8MA 1F2YA 2F0SA 3QB3A 4DU9A 2EYFA 2F0DA 3MXPA 2F3VA 5NUCA 1TT2A 2F0FA 5KYIA 3D8GA 3S9WA 4LAAA 2F0GA 1EYDA 5IGDA 3LX0A 1EZ8A 2F0QA 5IGFA 2ENBA 4KV6A 3SK4A 1EZ6A 2RDFA 3NHHA 1SNDA 2HQEA 4YIJA 2F0VA 1A3VA 2EY1A 2EYJA 2SNSA 5KGUA 4IUNA 3H6MA 5CV5A 4ODGA 4PMCA 5I6WA 5KEEA 4K8IA 5JOBA 3NXWA 2LKVA 3DMUA 3D4WA 4IZ8A 4G57A 4KTAA 1IHZA 1KABA 2F0IA 3HZXA 2EY5A 4IALA 4MIUA 1EY0A 5DEHA 4ZUJA 3NP8A 4K14A 1EY5A 4KY7A 1TQOA 5CV9A 5IGGA 1SYBA 4NKLA 4F7XA 1JORA 5C5LA 4NP5A 2PYKA 4ID6A 1SYCA 4J1MA 5EKLA 4N9PA 4WORA 2F0TA 4K5XA 2F0PA 3EVQA 2KHSA 5DAUA 5F2DA 2PW7A 4QMGA 3TP5A 5CV6A 4J6HA 5IGBA 5CV4A 1JOQA 1AEXA
chains in the Genus database with same CATH superfamily
1F2ZA 2QILA 5M9OA 4A75A 2GVAA 1K83H 2SDFA 3DHQA 5HURA 3RZDB 4JI7Q 4BA2I 3IFDA 4QIWB 2YTYA 2F0HA 2JK8A 2EDGA 1D6EC 5IP7H 4GKKL 1IW7C 5DNFA 3W3AA 3I4OA 2ZXRA 3L3OC 2B2UA 4BY1H 2Z9HA 4H0LC 1NNXA 3DLLA 5COYA 1Z6HA 2EYOA 3E5SA 3EFXD 3CMEA 3DEOA 1WYDA 3SGIA 3HP3A 3I2ZA 2PI2A 3K5LA 4DR6Q 2B2TA 2JXMB 1TS3A 4JOIC 2L12A 1JWMD 1MKHA 4IFDI 2LS01 1SAPA 2E8GA 1M8AA 1Q81C 1MI2A 5JPMC 2UXCL 1GM5A 3VYSA 4DF7A 1BCPC 3I4NH 4O2DA 4GN4B 5CBAE 1HFNA 3M4PA 3BS1A 1CSQA 2J4XA 2ZJQA 2EXDA 4JI4L 5ELEA 3CC2A 1YBYA 2YU9H 1S4ZA 2F0LA 4DR7Q 2I5MX 4DKAC 4DV5Q 1Q1BA 3P1HA 1A8VA 4DUZL 4X62L 1Y1WB 5C0XG 3F2UA 1FJGL 2R92G 3QB3A 1L0WA 1XYIA 4BY7H 1GUWA 5IP9H 1TT2A 1HNXL 2OQ0A 3J7ZC 2NVTH 1EZ8A 5BR8Q 4HN7A 3J7AV 4MN3A 1HA5A 3JAMc 5FK9C 4X3SA 1ILQA 2Z4IA 3MEFA 1CSPA 4JBWA 1TWGH 1IYUA 2KA7A 2F52A 4HCSA 5GQOA 3D4WA 2LMCB 4MTNA 1O7LA 3E0JA 1EY0A 1U4LA 1PH4A 4HCEA 1SYBA 2XGTA 1CTMA 2A6ED 5EKLA 1PH5A 3QWNA 1PH2A 2UUBQ 1QE6A 2LSSA 2ZJPA 3PUVA 4LF4L 2R6GA 1BCPB 1SRUA 3QOLA 4ZLTF 4QIWE 2G9DA 4DV0L 1YHBA 5D14A 3RZOB 3J7A5 1KLGD 1JJ2A 4DV0Q 1PXUA 1EEID 4A3CH 3VDYA 4IUVA 1BUVT 5CMDA 2OXPA 2FINB 4IURA 2F4VL 4N8FA 2QW7A 1D7QA 3M4OH 3K0XA 2BA1A 1E1OA 3CQZB 5IYDH 1PTOH 4TVAB 2IW3A 2ATWA 1K0SA 2AHOB 1ET6A 3P75A 4K5WA 2XN9C 1Q8IA 2F0EA 2AKWB 4UY8C 5IOCA 1EY9A 3Q22A 1SSOA 4BY7B 3KYHC 1KL9A 3T1YQ 1JWUD 2N8NA 4U68A 4L8JA 2JA5B 3M3YB 5AJ3Q 1V1PA 1J5EL 4RA8A 4EQPA 4RGOS 2V1CC 4DR2L 2NVTB 3QO2A 3L7ZC 2OEOA 1E2ZA 1WVLA 2PO4A 2EIFA 1JCKB 1D2BA 2K75A 1YHAA 4L5RC 2O4XA 5JAVA 4GOPB 2UUBL 2EY2A 4KJOA 5A35A 2L4NA 4EQ5A 1YZ6A 3BYYB 2EXZA 2HUGA 3M4QA 1UE1A 4A93B 3MXUA 5ELNA 1VQFA 3HOXG 4OX9Q 4LAAA 4BBSH 1MJEA 2RCFA 3J81i 2UU9Q 1QILA 2F1MA 4O42A 1DGSA 1WTWA 3NHHA 3OOCA 3PIPA 4QQBX 3PF4A 5C4XB 1SNDA 3HKSA 3OIPA 1X3QA 3TZDA 2A8VA 5LMUQ 4UHVA 4ZK9B 3GTKB 1GVPA 4B3SQ 3S16B 1H9MA 1DOLA 1JB7A 4A3GB 1X3PA 5LMUL 2CCZA 4DR6L 4OO1H 1OXXK 3WOFA 3J7AF 3K6OA 1GXDC 1L1OB 2EY5A 4MIUA 3CF5A 4OO1G 4LF4Q 4FXDA 3SEBA 1SFOB 2ZXOA 5CV9A 1SXTA 1TXYA 1HQMC 2KOLA 2B63G 3R2IA 3VR4A 4TKOB 2BH2A 2DJGC 2JA5H 2Z6BA 2CW0D 3FEWX 1VQGA 3T53B 2F0NA 1YITA 4NMZA 2RDHA 4BA1I 1SMXA 2A68C 2WB1E 2GN5A 2MFIA 2QEXA 3SE0A 1A15A 1ENAA 1N36Q 1WD0A 3HGBA 2AMCB 1EY4A 3BVZA 2JJQA 1C48A 1XJVA 1IYJB 2F0JA 2HCIA 2LXJA 3HRZC 4HMIA 4WFN3 1HRJA 4ABNA 1EIHA 1PFNA 3HOZH 3OMCA 1K3BC 4K6DA 2DY7A 1K8GA 1ENFA 5M5YB 1LM0A 4DV2Q 4HIMA 3GTQB 4JI5L 1Q90A 5IT9E 1LTID 1PZKD 1HNZQ 1QVGA 3X3MA 1F2MA 3T4AC 4C3JG 4YHHL 1BBWA 1YEZA 1AFPA 4UP7A 3U50C 3IL8A 1XMOL 3UI2A 5M5XB 2WIIB 2E2IH 2OCEA 2H4OA 5I9PA 2BE5C 3GTOH 1CUKA 1K9MC 3CP0A 3MZ5A 2OQKA 4KJNA 1HH2P 1STGA 1WFQA 4XT1B 2D62A 2K03A 3OIQA 1NUCA 3QG1A 1KIXA 3GTLH 4DV4L 2R92H 1FYCA 1JOKA 1ONLA 3U4ZA 1ICWA 1SNOA 5CC4A 5K5PA 5C0XJ 1B1ZA 4UDUC 3CPWA 4DR3L 4L63B 2R93B 5NUCA 1AE3A 2X69A 4A3EG 4DUZQ 3JAML 1BXTA 2F0QA 1CA5A 1CKNB 4A93G 2F4VQ 3T1HL 5A2QL 4F87A 4OIKA 2A19A 1S5BD 4DUYQ 2NZHA 2QF7A 4JVZA 3EA6A 3S2HB 4J15A 2AUJD 5K36G 3G6EA 4OWWB 4JI5Q 1HPCA 2NN6G 4K14A 3CC7A 3HKZE 4KY7A 2A1AA 4X66Q 4KN7C 1J6QA 2UUCL 4H13C 5EAYA 2HT1A 4K5XA 2EJFC 2KHSA 3W5OA 2QA4A 3TP5A 2K50A 2TSSA 2OWOA 1NMGA 4LFCQ 1N36L 2B2WA 4BY7G 2Q2IA 1OXTA 1AZPA 2E2JB 4FF4A 4JI3Q 3W1BA 2AWOA 3VYUA 1A2TA 1SNPA 1OXSC 1BOSA 2BOSA 1YJWA 4HTHA 3UDFA 3I90A 4B3TL 2I0QA 1SYEA 3H15A 1HFGA 3I4LA 1QZGA 1XTDA 4GKKQ 4EX5A 1EU4A 1UEAB 1C4QA 3H91A 3M3YH 5FOBB 2F3WA 3A54A 3UE1A 1FR3A 2JA5G 1H9SB 3NBHA 2PI2E 4KK7A 2KHJA 1VMPA 4RGMA 2MQHA 1B3AA 3GV6A 1UE5A 5LMNQ 1PFMA 2SEBD 2ZTDA 3NTKA 4KY5A 4IOAA 4LF7L 4OWTB 1STYA 3KDFA 5G3LF 1CKNA 4POFA 4EVOA 4JOIA 5ELBA 5IODA 3E0EA 1ICFB 3H94A 3PSIA 4C1NK 3C46A 2OTLA 2K5WA 3D4DA 2A74C 4JV5Q 1N34L 3OTOQ 4KHVA 2N78A 1CM9A 1K8MA 2ZXPA 1A3TA 1I4GA 4K8JA 2QCPX 4A3KB 5I4DA 4H7BA 4GNXB 3NE5B 2WACA 1UNSA 2VS1A 1PH8A 1E7ZA 3BVMA 4M8AA 5C3EH 1YIJA 4DUYL 4A3JH 1YNND 2CHBD 5IE8A 1KD1C 1PRTB 2K05A 2KVMA 1DCZA 1Z7TA 2B39A 1K8OA 4XYOA 3KLSA 3PF5A 1EFID 2HQEA 2K28A 3KBXA 3Q0AA 1TS2A 4X3TA 4ODGA 2B3GA 2D0OA 1R9TB 1E2VA 1IBML 3RNUA 3D0FA 2XWBB 3KF8A 2V4DA 2L55A 1IHZA 1E1TA 1PLFA 1Y8NB 4DV2L 1KQSA 3GQBA 5CORA 4QGUA 4UAIA 1JORA 4ID6A 4R4QA 5C44B 3ICEA 3HOZG 4R8IA 4YCUA 2CVRA 3HKZB 1VQNA 5T1GA 4OGQC 4H44C 1LTSD 3GP7A 4A3GH 1Q1EA 2K5NA 2Y0SB 4BWGB 2BH8A 4NB3A 1D1IA 5C4ZA 1M4VA 4H02A 4YWKA 4G7HC 4OELB 3ND8A 4IJHA 2ZTEA 3WOEA 4LF5Q 1G6ZA 1S5DD 5M3FH 1PZID 2OF1A 1VQCA 4L6TB 2L11A 3S15B 4ZQ3A 4YY3L 4IJLA 4OHJA 1VQAA 1RD9D 4BBRG 4NXNQ 2GA4B 3C1EA 4E6IA 2OTJA 5EKIA 3KK7A 4R1JA 2WFWA 2FXQA 2Z4HA 3I8ZA 1OXVA 5I2YA 3EN2A 3TEHB 1PRTC 2EE1A 3MTSA 5J39A 3FPUB 4X65Q 4A3MB 2Z8LA 5KRUA 4CKEA 1VCIA 1SE4A 2K33A 4DV6Q 2RQXA 3SK8A 2N49A 3ITPA 3X3NA 1WCMG 4C3HH 3K57A 2M00A 2D9UA 2F0UA 1VQOA 4LF6Q 1A3UA 1EUJA 1SNQA 2UXBQ 3CCQA 1SJHD 1XXGA 5FKAC 2JA7B 3HOYH 2WP8J 3H09A 1HJPA 5JEAJ 3GTPB 3FP9A 1EL0A 2PZTA 4DNIA 1OXUA 1DOKA 5LL6X 4K6LA 1BR9A 4RG1A 1X3GA 4KHPQ 4YHHQ 4RGTA 2GVBA 2HIVA 2JA7G 1KXLA 2RDFA 4A3IH 3M7GA 2NVYB 4B08A 1F77A 2OT2A 1V1QA 1VQ6A 4HJ8A 1GUGA 3DWAA 3PUWA 3J81j 4ZYSA 2NN6H 1ML0D 2IY5B 2E75C 1CHQD 3NPPA 3A7LA 5LL6S 4KKUA 3K59A 2NZ1D 2I5LX 5KNDA 2YU9B 4QL5A 3E6ZX 2YTXA 1CZWA 2ZM6Q 1F9SA 1PDQA 1ZEQX 3ULPA 2F0TA 1FGUA 3IRBA 4A76A 1MSHA 1GUSA 5CV6A 1VQPA 1MIUA 3R8BA 4DR3Q 1HA6A 2R92B 2HDLA 4M1UB 1LTBD 1UE6A 1WI5A 1YHQA 4BBRB 1GOZA 2A73B 3GDEA 1PH9A 1B4OA 4ZUIA 2KENA 2EYPA 3CD6A 1EWIA 4XDXA 3GTOB 1TR5A 4DV5L 3K81C 1NR2A 1B70B 1TWCB 4P2CB 2X6GA 4GOPA 3I4MG 1IKMA 5LHY1 3ZJYC 2VZAA 3H0GH 3HKZG 2PPBC 4B3MQ 3HOZB 2UUCQ 1UUPA 5FLXc 3U9OA 3UDIA 2ICEC 1U4PA 3FVQA 4IN3A 4JI1L 2O5JC 1XMOQ 4C1NI 1FL0A 5LMNL 1R9TH 5IT9L 5JJKA 4LUOA 3R93A 2B2VA 3NQTA 1XPUA 3AEVA 3VR3A 4FDBA 3QJYA 3J80c 1NCVA 4R4TA 1YVCA 1X55A 1VS0A 4JW0A 2WKCA 1HNWL 5M3MB 1AW7A 3DM1A 3RN2A 2XRQD 1I4HA 4HIOA 2BCOA 3HOVH 4RAUC 2R3ZA 1ZXTA 3S9WA 2MPMA 1A0IA 3UE0A 1DD2A 2JSOA 1FNWA 2IX3A 1SMYC 4CDFC 1KC8C 4DR4L 1VQHA 4X6AH 4Y7NB 1TWGB 2NYZD 1YNJD 4YY3Q 4OO1I 3J80i 3JC66 2E5LQ 4G57A 2DGYA 4JI0L 1M1KC 5GAGC 1UWVA 1TQOA 3G71A 5C5LA 4XQJA 1SYCA 1I50B 4R9WA 5FO9B 3MXNB 1HR0Q 1CHPD 2IPKD 1SDFA 2F0PA 4IQZA 3I4NG 1Q82C 5CV4A 1DZ1A 4OONA 4LFAL 5JJLA 1GD7A 1ZYRD 1HZCA 2QDBA 5FJ8H 3SR1A 2K04A 2DNCA 5FO7B 3RLOA 1ET9A 2CH4W 2B2WC 3IAYA 1G291 4FO2A 1ASYA 3C2PA 3H0GB 4ZAIA 5I9OA 1BO0A 2EZVA 4V190 2FMMA 4DAYB 5IGEA 5C3XA 5IP9G 1IBMQ 4HMJA 1VF7A 4JG2A 1XWEA 4HJ7A 1CQFA 2CW0C 2FHTA 3DM3A 4AQYQ 1WTPA 4GLXA 1NSNS 4KY6A 4J8QA 5JEAG 2RBMA 4A3JB 2JP1A 2MO1A 4C3HG 4KD4A 5H1SE 3STBC 3CCVA 4HEDA 3N52A 1JICA 3MC0B 2G9HD 4DK6C 4BY1B 4FXGC 4RKLA 4GOPC 1NMFA 1NTGA 1LT4D 4NDXA 1O7IA 3NWSA 2VQFQ 4KHZA 5EPJA 3SHLA 1XNRL 3S14B 2JEBI 1X65A 3K7UC 4X3KA 5EGTA 5M3MH 5GAEC 3BJUA 1UE7A 1JR0D 4DXFA 1K8AC 1IBKL 2AQ1B 4AYBG 3HOYB 3KOJA 2AUKA 1N9WA 4R4OA 2F0GA 5IWAL 2NVXB 1I3QB 4NXMQ 1O7YA 5D3IB 4GKJL 3CAMA 4U673 2RHSB 1VQKA 2XVSA 2ID0A 3CCSA 4YCVA 1X3FA 3STBD 4NPSA 1QWYA 5CV5A 4A3DG 4DV7Q 4CBVA 2LY7A 4C56C 3OW7A 4JBMA 1LTLA 2NN6I 1BF4A 1TY2A 1QCBD 2F0IA 3K7AB 5C5MA 5IGBA 1L1OC 3NP8A 4XTCS 3K58A 2UXBL 4F7XA 4X3UA 3CXCA 5IYCG 3NQIA 1Q12A 3RZOH 1V9PA 4C3JB 1AE2A 3KDFB 2D2CC 5I6WA 5C3WA 2VUMH 3Q8DA 2DNEA 1I4PA 3D31A 3A0JA 4BBSB 1NR4A 2PW5A 1D5XC 4P72A 4HIKA 4A93H 1ZYRC 1GUTA 2NVXH 3TBIB 4RKBA 1BCPF 1WD1A 5K36H 1DXMA 2PZWA 5E1FA 2H5XA 4FF3A 3LNNA 4LW1A 1TKWB 1QVCA 1L2FA 4IUQA 3BYTB 3NELA 2A6EC 2IL8A 3TP6A 2B63B 3G4SA 1YNJC 4K2KA 2JA8B 1WTOA 1TIID 3RD4A 1Q86C 3L2PA 1VQMA 2AQ3B 1C8CA 2R7ZG 2RHQB 1SMYD 4DNTB 1BBXC 4ME5A 1EQRA 1TVXA 4RHRA 4B3TQ 3KF8B 2IX0A 1PMRA 4JI1Q 1GJXA 3ERQA 1STBA 2EYLA 3M85A 2UUAL 5E3FA 4B9XA 1RKNA 1KLUD 4LF6L 1MD2D 4LFAQ 4F8MA 1EWCA 3KFUA 2B2UC 2TMPA 4KMUC 1LT6D 1U0LA 5IGDA 1Y14B 2VY3A 4UP9A 3VYTA 2EVBA 3RLNA 4RWSC 2MUYA 5GROA 2F0VA 1A3VA 1ILPA 1HHVA 4A3MG 4IUNA 3VYRA 3BU2A 3AU7A 4DK1A 5FLMH 2WINB 3CCJA 5EQ0A 5M5XH 2LKVA 1M90C 1K28A 4AIMA 1JE5A 4IALA 2A5HA 3J81L 4JBJA 1BCPD 5IYBH 3NENA 1RF2D 5IGGA 1RTNA 3A8IE 4A3CG 2JQOA 4LFBL 4A3LH 3SVMA 3EVQA 3G7LA 4ALPA 3T51B 4EGVA 3G48A 1H9KA 1AEXA 2WB1G 5CYUA 2NUCA 2SOBA 3FPPA 3KLRA 4PG3A 1Z47A 1EIGA 1EY6A 3HOWB 1I3QH 3P7JA 3BDOA 1F9PA 3W1GA 1IW7D 5EPKA 1KRSA 3ERSX 1U5KA 3E9HA 2LFNA 4G7ZC 1Y1WH 1B3QA 1Q46A 1FNUA 4YCWA 2BA0A 5T1IA 1A2UA 1AN8A 4YWMA 1VQLA 4DA2A 3HG9A 3AB9A 1QZHA 1L0XB 3OMGA 4P73A 5IWAQ 1GUNA 4GKJQ 4P71A 1C9OA 4WRDA 2QDLA 3QOJA 1HXYD 2JA8G 2DY8A 4K5VA 1F2LA 1LYLA 5C4XH 4B3ML 2B2YA 1X56A 4DV3Q 1I6HH 4BS9A 3GTGB 1Q8KA 3L9AX 4DV6L 1SLJA 4HJ9A 4X64Q 5FJ8G 2VQEL 2EYHA 3L0OA 4QB4A 3H3VC 4A3KH 3J81c 4AYBE 4EQOA 4MHEA 5ELDA 4BXXH 4MNOA 1CZGA 1OO9B 1B2TA 2NTTA 1IL8A 1BKBA 4GS3A 2F0FA 1G2TA 2L1BA 5KYIA 1Y1WG 1E0BA 3TZUA 1X3EA 1LUZA 4ZKCB 3SK4A 1DONA 1EZ6A 1EEFD 1TWAB 1XMQQ 2RF4A 3KUPA 5TSSA 1MJCA 4K8IA 1PRTD 1H9SA 5JEAH 4IUUA 1Q3LA 2Q8RE 1YNXA 2E2IB 2K6AA 4A4IA 2QEJC 2E2HH 1HQRD 4NKLA 3PO3G 3I3CA 1CA6A 1LT3D 4LUZA 4WORA 3HOWG 3S1NH 5EPLA 1E24A 5M5WH 5BN3A 1QOHA 1B50A 4GNXC 4C3JH 1TY0A 5GADC 3WWVA 2CWPA 2MNAA 2NZOA 1G8ZD 2E2JH 1AH9A 2NVYH 4A3IG 3PIOA 3C3LA 2F0KA 3HOVB 5M5YH 3FRPB 4DAVA 1VQ9A 1FJGQ 4IUTA 2K5HA 3I72A 1NAPA 1PTOB 1V1OA 1TWAH 2K52A 3OSOA 5J22A 1WOCA 3MXGA 1PHJA 2DJFC 1FGBD 4ZKBB 1J8IA 1HNZL 4DV3L 2UXDL 3K5NA 2A6HC 3GD7A 2KBNA 1PV4A 3UDGA 4DK0A 2KQ3A 2ZT9C 1S5ED 1FNVA 1JJCB 1F9QA 3BDLA 3VR5A 4A3EH 1U9RA 3TMEA 2JE6I 4K2LA 1YNNC 4XIGS 2C5CA 3G6JB 5D65A 5JVH3 4QF4A 1VQ7A 5I6YA 2E2DC 5BN5A 5JJIA 2Z6KA 4AH6A 4JI6L 3ND9A 3SXHA 2C35B 3S16H 2EY6A 1S5CD 2NBFA 1XMQL 4IPDA 4WJ3M 1F2YA 3F8TA 4JC0A 4BBSG 5E4WC 1RJTA 3D8GA 3MFYA 2UUAQ 4PMWA 5I2XA 4KKSA 3NTHA 4APVA 1WTRA 5C3EB 2EY1A 2VB3X 4Y7NH 4PQXA 5LMNW 4N8X1 2N88A 5KEEA 3V05A 4CDEC 1PFBA 2HIXA 1E2WA 3Q6SA 4RH6A 3M7NA 4KTAA 1GKHA 4C3IH 3VR6A 1KABA 3D3RA 3HZXA 4IFDH 1Y1VB 2HHHQ 4A3DH 4UPAA 2CKZB 2EQSA 4HJ5A 1UEBA 4JK1C 4J1MA 1LTRD 3S1NB 1GUOA 4LF8L 5F2DA 3TDQA 4KI0A 1HUNA 2VL6A 3ULLA 1JOQA 1V1PB 3OWEB 2B2TC 3T16A 1HR0L 2FMCA 2I5HA 4LFBQ 2Z6KC 2SNMA 2IWHA 1VDZA 1WCMH 5KNBA 3HOYG 4WJ4A 1PTOD 3K0YA 3BDCA 3PO3H 4DR1Q 3NWTA 4N9TA 4MTKA 1K83B 2KHIA 1IKLA 5M3MG 1Y8PB 3CPFA 1EY8A 1AP0A 3VA5A 3F1ZA 1LV9A 4IO9A 3BG3A 2IT1A 4PMBA 2MHVA 2EJGC 5EJWA 1EIFA 3DXJC 5L37A 5DM73 1YJNA 2XNAC 3F2CA 5KYLA 2N55A 2NVQB 1AZQA 1A63A 4DR4Q 1KDCA 1X54A 4O1NA 2K5QA 3B6YA 3MAQA 5GAHC 3I91A 5EBDA 2YV5A 3S1QH 4LJZC 3K8AA 5M5WB 4DR2Q 3E3XA 1DOMA 4RGNA 1D5MC 1QUQB 1RIPA 5IGCA 1I6HB 4QUCA 4LMQD 3N6RA 3BZCA 3CU7A 4QUFA 3U58A 2KJXA 3MHBA 4BY1G 3FKIG 3M4YA 5J1ZA 5M3FB 1DM0B 4ZRZA 2EYFA 4RCOA 2F3VA 1PFSA 1S40A 3LX0A 2I46A 5IGFA 1TU2B 1JJGA 3S17B 4YIJA 1E22A 4DR1L 2BE5D 1I94Q 1IBLQ 3TS2A 1Y1VG 3H6MA 4LF7Q 2K7VA 2EOTA 3MFGA 3GO5A 3I4MH 1B9NA 5JOBA 3NXWA 2JA8H 2K14A 3DMUA 4IZ8A 1B44D 1RODA 1XNQQ 1CQVA 2BDNA 4ZUJA 4X64L 2KCNA 1H9JA 5C3EG 4HAEA 1N34Q 3A74A 1D1KA 3H0GG 4C2MB 3GTGH 4N9PA 2VUMB 2I07B 5DAUA 3Q24A 2PW7A 1WJJA 4J6HA 1GHKA 1QNUA 5M3FG 5C4JH 3FKIB 4BXXG 4KN4C 5IIFA 2Q8IB 2A68D 1W6KA 4DR5L 3FMCA 4A3LG 2A69D 4IUPA 3V2TA 3H3VI 1XPOA 1CK1A 1RTOA 2CH4A 2H1EA 3RR5A 3CCUA 1STNA 5D3DA 1MGSA 4YWLA 2WAQG 1IBKQ 1SYGA 2ES2A 1BDOA 3ZYYX 5EKKA 4CDCC 4FNFA 3RUZA 3T1YL 1W6JA 1S3OA 1WCMB 1Y69U 3D6CA 4DXGA 3TS0A 4POGA 3R2TA 3CCEA 4UP8A 1O80A 2NWGA 2VB2X 1SEBD 2E76C 2QGQA 1HZAA 4QY7A 1FD7D 2RSNA 4NW2A 3GV3A 4Q0FA 2R61A 2JA7H 1PH3A 3CCMA 4X66L 4R4CA 2E74C 1MBYA 2M2LA 3DUZA 2RVLA 3RMHA 3NEMA 3A5UA 2XRSD 1S72A 3NUCA 1O78A 5CR3A 2BDOA 2VXWA 2F3IA 1ASZA 3T1HQ 2CQAA 1TWHH 2ASBA 1HTLD 2Q8TA 1HNWQ 5G3LD 2RSOA 2Z0SA 4DAYA 3PO3B 5JVG3 3FKIH 1QJOA 1KRTA 1SE3A 3PUZA 2UXCQ 1PYBA 4CJ1B 4WJWA 3I4MB 1E3PA 1TS4A 5C44G 3S15H 1GO3E 3KLWA 3KJPA 4C2MH 4AQYL 3TQYA 1VQIA 4JI4Q 3JAMi 4DR7L 2B63H 1JWSD 3A5ZB 3E9IA 1NJIC 2D5DA 3S14H 4L5SA 2R93H 3PO2H 2HD3A 1Y1VH 2PCFB 3AFPA 2HHHL 2IX1A 3CCRA 2WAQE 5E7NA 5CGKA 1IXRA 3PO2B 4DPGA 1H95A 4GN3B 3CRLC 4FP5D 2PZUA 2IHEA 2J7ZA 3T56B 1T5XD 3IKJA 1NE3A 4V0BA 1IL2A 1WTHA 4JBKA 1NBWA 5C6AA 3I56A 4GNXA 4A3KG 1EOTA 1JT8A 1BNZA 3DWPA 2Z1CA 2JA9A 2MO0A 3CMAA 1JB3A 1PTOF 4OL7A 1D5ZC 3Q23A 1SYDA 3HOUG 1I50H 4Q5VA 1PH1A 4KD3A 2R7ZH 1XPRA 3KBGA 3NTIA 1PVOA 2KEEA 1R4PB 2HCCA 2EYMA 1C7YA 2K32A 3M9BA 2KECA 4FF1A 2F0OA 1SE8A 5E4XA 2F0MA 1HZBA 2B2VC 3EROA 1P16A 1HUMA 3R3OA 4F88A 3I55A 2ZM6L 4DV7L 3K7AH 3I70A 4IFDG 4DN4M 4OXPA 1T9HA 2ZTCA 1CKMA 2VW9A 1W3SA 3F2DA 5ELFA 1V8QA 1VQ4A 3VR2A 2UXDQ 2L9HA 3OHXC 3IFTA 4G4KA 4JI2L 2RA4A 1GHJA 3LWEA 3HOVG 2F4IA 3DEPA 1QVFA 4A3IB 3TRZA 4R8NA 3GTQH 3AQQA 3J81E 2AWNA 3BVGA 2XSCA 4I65A 1H9RA 1PYWD 3GTJB 3RZDH 3P20A 1KAAA 2Y0SE 3BZDB 4A3FB 1TS5A 3CQZH 1YJ9A 1O7ZA 4RHSA 1BBUA 3M4OB 2L0CA 2L5TA 2ALYB 3MXPA 1QB5D 2O2LD 2XWJB 4RFBA 3GTJH 1BQQT 4PV1C 3A56A 5A2QE 2Q2TA 1IZ6A 1SFOH 3TN2A 1HTPA 1TWFH 2D0PA 2SNSA 4C3IB 1W2BA 2FFKB 3LGJA 1SE2A 2MGSA 4I7AA 1RL2A 2RCNA 4DAMA 1K0RA 1RDPD 1YI2A 2PQAA 4JYAQ 1I94L 3OPOA 1EY5A 1ESFA 4XYQA 2PYKA 3J7YW 4JYAL 1XTCD 2YYZA 3K5MA 3HOUH 5C0XH 1VQJA 4GZYC 4G7OC 4DNRB 5IP7G 2Y0SG 3S2DH 1EQQA 1X9NA 3GTKH 4LK1C 2KEDA 3GTLB 2JA6B 4B9WA 3ER0A 3V96A 3HOUB 5C4HA 3A55A 2KUMA 2DN8A 4CKCA 3MEHA 1STHA 3A8KE 4LF8Q 4PNYA 1TWHB 2R93G 3FHWA 1EYAA 2A69C 2CQOA 1QG7A 3AYHB 4B3RL 3KLSX 2FJ2A 1F9RA 2JA6H 3PQIA 2P5ZX 2RKSA 1EYCA 5J3BA 5HY6A 4B3SL 1G91A 2K5DA 4XT3B 3S2HH 3PO2G 1X6OA 1CT1D 1PYSB 3FDTA 3RLFA 1D8LA 1G51A 1LT5D 1TWFB 3PUYA 1JMCA 3U4VA 3CW2C 5ELCA 1LTTD 2E5LL 4PZ7A 3T13A 1Q7YC 4DV1L 1A6XA 1MHWC 1N8RC 4IPHA 4FF2A 4PZ6A 3URYA 1RHPA 1PA6A 3JAME 2Q2UA 2XTIA 2F0WA 3S1RH 3MXNA 5FO8B 1HR0W 1KAWA 4L5TA 4S3SA 1B9MA 4DAPA 4BBRH 4FYDA 3UDXA 1KTKA 5AFWA 3PUXA 3H3VH 4GLAC 4OEMB 5CV8A 4OWXB 3S2DB 1STEA 4XQNA 1N32L 2MP1A 1PRTF 2PQAB 4X62Q 3PMFA 4HSPA 1L0YB 3SK5A 1JOOA 2IHFA 2QKIC 1II3A 3EBEA 1I5FA 3A8JE 1JC7A 4DGZA 1EIYB 4FVMA 2VQFL 1S5FD 4KHPL 1XNRQ 4OX9L 3SK6A 2WB1B 1PH7A 2F0DA 1LACA 4OIJA 3CCLA 4XQQA 3NBHB 4Y52H 1LO5D 3VA7A 4O0AA 1KNEA 2IJ0A 1B8AA 1IYVA 5IYCH 5CBEE 5KGUA 4B3RQ 1B53A 1DJRD 4JCVE 3CC4A 3HOWH 1BVSA 2M9VA 1VMCA 4CJ2C 3I73A 2K5VA 1I4RA 1FVIA 4ME3A 5DEHA 3GTPH 2E2HB 3S24A 1KNAA 3PV0A 5EBCA 4CJ0B 3CRKC 4DV1Q 4GN5A 1R4QB 1XX8A 3ONAB 2F03A 4C3HB 1CI3M 2NTSA 4A3BG 1VF5C 4AYBB 5IT9c 4A3JG 3TP7A 4HIDA 3GTMH 3S17H 4A3BH 4JI2Q 1JQYD 3TP8A 1G2SA 4A3EB 4XXEA 1OTCA 1RCVD 4MZ9A 3HOXB 1WTQA 2WAQB 2B8GA 4EQNA 3PGZA 4IFDJ 1QUQA 3MVVA 4LNQA 4A3BB 3GTMB 4LF9L 1PTOC 1UAPA 2Q2HA 5IYBG 3DWQA 1STAA 2C9OA 4JI6Q 5CV7A 3NBIA 1TWCH 3PCOB 1L1OA 4ILWA 2R7ZB 2PNRC 2PMZE 5C44H 1ESRA 1LTGD 2CWAA 5JJZA 1HCZA 1KDAA 3TSSA 2AQ2B 1ENCA 2VUMG 2WV6D 3OW2A 1Z9FA 4KLKA 5C0XI 5AJ3L 3NSWA 3PIP3 1CFMA 2KCMA 2K4KA 3C1FA 1PH6A 1KDBA 4LWCA 4HJAA 5DLQE 2O5IC 1EFWA 4JI3L 1VQ5A 1QNKA 2NVQH 2VNUD 1EU3A 1EQVA 5DM63 4K0KL 3AFQA 2EJMA 1MSGA 3NK9A 1C0AA 5FLMG 3HOXH 3EJIA 1EWHA 1SNMA 1K3RA 4RCNA 1VQ8A 3CKIB 4DU9A 1WTXA 3OYYA 3KF6A 2ENBA 4KV6A 4TQUS 4P74A 5ELOA 3S1RB 1U4MA 4CGYB 5IYDG 1J9OA 1VQBA 2R7FA 3RN5A 1VQEA 2MJ8A 3S1MB 1SBBB 2A6HD 3OTOL 4A3DB 3LWUA 4JV5L 2G5DA 1KHIA 1XNQL 4IOCA 1G6PA 3PIO3 3SDZA 4IPGA 4QMGA 1ZKOA 4TSSA 3S1MH 1SROA 2B8FA 3U9SA 1V43A 1I6VC 4DFAA 1I4XA 2PNHA 5HGTA 1J5EQ 1EOVA 3I7FA 1P8LA 5BR8L 2JA6G 2WKDA 1HNXQ 4R4IA 4K0KQ 4RMFA 3QIAA 2B2YC 3K5OA 2JYOA 5C4JB 3D6WA 4FXKC 4JI8Q 2XIWA 4ULLA 5ISRA 1VQDA 1Y8OB 5JPNC 4A3GG 4JPBW 3HEJA 3F2BA 1LABA 4JI8L 3EQLC 5BN4A 4QJFA 3MA2B 3BZKA 3K80C 1LTAD 2PMZB 5C4XG 1SN8A 1EY7A 2UU9L 2K1BA 4TRDA 3D4RA 1N33L 3KF6B 4LUVA 3HS0C 3J80E 1SYFA 4PZ8A 4C3IG 1IBLL 3W2DA 1T5EA 1U4RA 3J80L 4P75A 5HGQA 2HDMA 4GLVB 2HQLA 3MWYW 3ULJA 4CDDC 1NY4A 2N3SA 4JI7L 3AMUA 4DV4Q 1I4QA 5KNCA 4I7ZC 4ZCKA 4HR7B 4A3FG 1A62A 2J0TD 1CKOA 2RDGA 4LF5L 1SR3A 5KIXA 4A3FH 5FLXE 2KCCA 2DUDA 5FLXL 1SNCA 1EQTA 1N32Q 3OWFA 2PQEA 2KCTA 4QCLA 2F0SA 4NXML 4KKTA 2LXKA 4DR5Q 3I4NB 4NXNL 4L5QA 3KJOA 1K73C 2JEAI 2EPBA 1PZJD 1EYDA 2CFMA 3QR8A 3EIVA 3WDNA 1WTVA 2EYJA 4LF9Q 4JI0Q 2X6LA 4X65L 5IY0A 2K01A 1LLRD 4PMCA 4A3MH 3S1QB 2YTVA 3O13A 3TREA 1X32A 3A7AB 4IPCA 2R7DA 4LFCL 1EYGA 2L15A 1SJED 1JE4A 4CKBA 4NP5A 2NB0A 3HFZB 1HZ9A 1N33Q 2ZJRA 2B29A 4DK3C 2VQEQ 2ICIA 4CHTB 1DYQA 3CHBD 4Z9CB 1B7YB 4HSVA 2JN4A
chains in the Genus database with same CATH topology
1F2ZA 2QILA 5M9OA 5HURA 2SDFA 3DHQA 3RZDB 4BA2I 3IFDA 4QIWB 2F0HA 2EDGA 1D6EC 1IW7C 5DNFA 3W3AA 3L3OC 2ZXRA 2B2UA 4H0LC 5COYA 1Z6HA 2EYOA 3E5SA 3EFXD 3DEOA 3HP3A 3K5LA 2B2TA 2JXMB 1TS3A 2L12A 1JWMD 4IFDI 2LS01 1SAPA 1M8AA 1MI2A 5JPMC 3VYSA 4DF7A 1BCPC 5CBAE 1HFNA 3BS1A 2J4XA 5ELEA 1S4ZA 2F0LA 1Q1BA 3P1HA 1Y1WB 5C0XG 3F2UA 3QB3A 1XYIA 1GUWA 1TT2A 1EZ8A 4HN7A 3J7AV 4MN3A 1HA5A 5FK9C 4X3SA 1ILQA 2Z4IA 4JBWA 1IYUA 2KA7A 4HCSA 3D4WA 2LMCB 1O7LA 3E0JA 1EY0A 1U4LA 4HCEA 1SYBA 1CTMA 2A6ED 5EKLA 3QWNA 1QE6A 3PUVA 2R6GA 1BCPB 3QOLA 4ZLTF 2G9DA 5D14A 3RZOB 1KLGD 1PXUA 1EEID 4IUVA 1BUVT 5CMDA 2OXPA 2FINB 4IURA 2BA1A 3CQZB 1PTOH 2IW3A 1ET6A 3P75A 4K5WA 2XN9C 1Q8IA 2F0EA 5IOCA 1EY9A 3Q22A 1SSOA 4BY7B 1JWUD 4U68A 4L8JA 2JA5B 3M3YB 1V1PA 4RA8A 4EQPA 4RGOS 2NVTB 3QO2A 3L7ZC 2OEOA 1WVLA 1E2ZA 2PO4A 1JCKB 1D2BA 2O4XA 5JAVA 2EY2A 4KJOA 5A35A 2L4NA 3BYYB 2EXZA 2HUGA 4A93B 3MXUA 4LAAA 1QILA 2F1MA 4O42A 1WTWA 3NHHA 3OOCA 5C4XB 1SNDA 3OIPA 1X3QA 3TZDA 4ZK9B 3GTKB 3S16B 1H9MA 1DOLA 4A3GB 1X3PA 4OO1H 1OXXK 3WOFA 3J7AF 3K6OA 1GXDC 2EY5A 4MIUA 4OO1G 4FXDA 3SEBA 1SFOB 2ZXOA 5CV9A 1SXTA 1HQMC 2KOLA 3R2IA 3VR4A 4TKOB 2CW0D 3FEWX 3T53B 2F0NA 4NMZA 2RDHA 4BA1I 2A68C 3SE0A 1A15A 1ENAA 1WD0A 3HGBA 3BVZA 1EY4A 1C48A 2F0JA 2HCIA 3HRZC 4HMIA 4WFN3 1HRJA 4ABNA 1EIHA 1PFNA 3OMCA 4K6DA 2DY7A 1ENFA 5M5YB 3GTQB 1Q90A 5IT9E 1LTID 1PZKD 3X3MA 1F2MA 3T4AC 4C3JG 1AFPA 3IL8A 3UI2A 5M5XB 2WIIB 2H4OA 5I9PA 2BE5C 3MZ5A 4KJNA 1STGA 4XT1B 2D62A 2K03A 3OIQA 1NUCA 3QG1A 1FYCA 1JOKA 1ONLA 1ICWA 1SNOA 5CC4A 5K5PA 5C0XJ 1B1ZA 4UDUC 4L63B 2R93B 5NUCA 2X69A 3JAML 1BXTA 2F0QA 1CA5A 5A2QL 4F87A 4OIKA 1S5BD 2QF7A 3EA6A 3S2HB 2AUJD 5K36G 1HPCA 2NN6G 4K14A 4KY7A 4KN7C 4H13C 4K5XA 2EJFC 2KHSA 3TP5A 2TSSA 2B2WA 1OXTA 1AZPA 2E2JB 4FF4A 2AWOA 3VYUA 1A2TA 1SNPA 1OXSC 1BOSA 2BOSA 4HTHA 3I90A 1SYEA 1HFGA 3I4LA 1EU4A 1UEAB 1C4QA 3H91A 5FOBB 2F3WA 3A54A 1FR3A 1H9SB 3NBHA 4KK7A 1VMPA 4RGMA 1B3AA 3GV6A 1PFMA 2SEBD 3NTKA 4KY5A 1STYA 5G3LF 4EVOA 5ELBA 5IODA 3H94A 4C1NK 3C46A 2K5WA 3D4DA 2A74C 4KHVA 1CM9A 1K8MA 2ZXPA 1A3TA 1I4GA 4K8JA 2QCPX 4A3KB 5I4DA 4H7BA 3NE5B 2WACA 1UNSA 3BVMA 4M8AA 1YNND 2CHBD 1PRTB 2K05A 2KVMA 1DCZA 1Z7TA 2B39A 1K8OA 4XYOA 3KLSA 1EFID 2HQEA 2K28A 3KBXA 3Q0AA 1TS2A 4X3TA 4ODGA 1R9TB 1E2VA 2XWBB 3KF8A 2V4DA 2L55A 1IHZA 1PLFA 1Y8NB 3GQBA 5CORA 4UAIA 1JORA 4ID6A 5C44B 4R8IA 2CVRA 3HKZB 5T1GA 4OGQC 4H44C 1LTSD 3GP7A 1Q1EA 2Y0SB 4BWGB 1D1IA 5C4ZA 1M4VA 4G7HC 3ND8A 3WOEA 1G6ZA 1S5DD 1PZID 2OF1A 4L6TB 2L11A 3S15B 4ZQ3A 4OHJA 1RD9D 2GA4B 3C1EA 4E6IA 5EKIA 3KK7A 2Z4HA 3I8ZA 1OXVA 5I2YA 1PRTC 2EE1A 3MTSA 5J39A 3FPUB 4A3MB 2Z8LA 5KRUA 4CKEA 1VCIA 1SE4A 2K33A 2RQXA 3SK8A 3ITPA 3X3NA 3K57A 2M00A 2D9UA 2F0UA 1A3UA 1SNQA 1SJHD 1XXGA 5FKAC 2JA7B 2WP8J 3H09A 5JEAJ 3GTPB 1EL0A 2PZTA 1OXUA 1DOKA 5LL6X 4K6LA 1BR9A 4RGTA 2RDFA 3M7GA 2NVYB 4B08A 1F77A 2OT2A 1GUGA 3DWAA 3PUWA 4ZYSA 2NN6H 1ML0D 2E75C 1CHQD 3NPPA 3A7LA 5LL6S 4KKUA 3K59A 2NZ1D 5KNDA 2YU9B 3E6ZX 1CZWA 1F9SA 1PDQA 1ZEQX 2F0TA 1MSHA 1GUSA 5CV6A 3R8BA 1HA6A 2R92B 2HDLA 4M1UB 1LTBD 4BBRB 1GOZA 2A73B 1B4OA 4ZUIA 2EYPA 4XDXA 3GTOB 1TR5A 1NR2A 1TWCB 4P2CB 2X6GA 1IKMA 5LHY1 2PPBC 3HOZB 1UUPA 3U9OA 2ICEC 1U4PA 3FVQA 4IN3A 2O5JC 4C1NI 5IT9L 3R93A 2B2VA 3NQTA 3VR3A 3QJYA 1NCVA 2WKCA 5M3MB 1AW7A 3DM1A 2XRQD 1I4HA 2BCOA 4RAUC 2R3ZA 1ZXTA 3S9WA 2MPMA 1DD2A 2JSOA 1FNWA 2IX3A 1SMYC 4Y7NB 1TWGB 2NYZD 1YNJD 4OO1I 4G57A 1TQOA 5C5LA 4XQJA 1SYCA 1I50B 4R9WA 5FO9B 1CHPD 2IPKD 1SDFA 2F0PA 4IQZA 5CV4A 1DZ1A 1ZYRD 2QDBA 3SR1A 2K04A 2DNCA 5FO7B 1ET9A 2B2WC 3IAYA 1G291 4FO2A 3C2PA 3H0GB 4ZAIA 5I9OA 1BO0A 2EZVA 4V190 2FMMA 5IGEA 5C3XA 4HMJA 1VF7A 1XWEA 1CQFA 2CW0C 2FHTA 1WTPA 1NSNS 4KY6A 4J8QA 5JEAG 2RBMA 4A3JB 2JP1A 4C3HG 4KD4A 4HEDA 3N52A 1JICA 3MC0B 2G9HD 4BY1B 4FXGC 4RKLA 1LT4D 4NDXA 3NWSA 4KHZA 5EPJA 3SHLA 3S14B 2JEBI 4X3KA 5EGTA 1JR0D 4DXFA 2AQ1B 3HOYB 2AUKA 2F0GA 2NVXB 1I3QB 1O7YA 5D3IB 4U673 2XVSA 2ID0A 1QWYA 5CV5A 4CBVA 2LY7A 4C56C 3OW7A 2NN6I 1BF4A 1TY2A 1QCBD 5IGBA 2F0IA 3K7AB 5C5MA 3NP8A 4XTCS 3K58A 4F7XA 4X3UA 3NQIA 1Q12A 4C3JB 2D2CC 5I6WA 5C3WA 2DNEA 1I4PA 3D31A 4BBSB 1NR4A 2PW5A 1D5XC 1ZYRC 1GUTA 3TBIB 4RKBA 1BCPF 1WD1A 5K36H 1DXMA 2PZWA 5E1FA 4FF3A 3LNNA 1TKWB 4IUQA 3BYTB 2A6EC 2IL8A 3TP6A 2B63B 1YNJC 4K2KA 2JA8B 1WTOA 1TIID 3RD4A 2AQ3B 1C8CA 1BBXC 1SMYD 4DNTB 4ME5A 1TVXA 4RHRA 2IX0A 1PMRA 1GJXA 3ERQA 1STBA 2EYLA 3M85A 5E3FA 4B9XA 1RKNA 1KLUD 1MD2D 4F8MA 1EWCA 2B2UC 2TMPA 4KMUC 1LT6D 5IGDA 3VYTA 2EVBA 4RWSC 2MUYA 2F0VA 1A3VA 1ILPA 1HHVA 4IUNA 3VYRA 3AU7A 4DK1A 2WINB 5EQ0A 2LKVA 4IALA 2A5HA 3J81L 1BCPD 1RF2D 5IGGA 1RTNA 3A8IE 3SVMA 3EVQA 3G7LA 3T51B 4EGVA 1H9KA 1AEXA 5CYUA 2NUCA 2SOBA 3FPPA 3KLRA 1Z47A 1EIGA 1EY6A 3HOWB 3P7JA 3BDOA 1F9PA 1IW7D 5EPKA 2LFNA 4G7ZC 1FNUA 2BA0A 5T1IA 1A2UA 1AN8A 4DA2A 3HG9A 3AB9A 1L0XB 3OMGA 1GUNA 4WRDA 3QOJA 1HXYD 2DY8A 4K5VA 1F2LA 2B2YA 4BS9A 3GTGB 3L9AX 2EYHA 3H3VC 4QB4A 4EQOA 4MHEA 5ELDA 1CZGA 1OO9B 1B2TA 2NTTA 1IL8A 2F0FA 1G2TA 2L1BA 5KYIA 1E0BA 3TZUA 4ZKCB 3SK4A 1DONA 1EZ6A 1EEFD 1TWAB 3KUPA 5TSSA 4K8IA 1H9SA 1PRTD 5JEAH 4IUUA 1Q3LA 2Q8RE 2E2IB 2K6AA 2QEJC 1HQRD 4NKLA 3I3CA 1CA6A 1LT3D 4WORA 5EPLA 5BN3A 1QOHA 1B50A 1TY0A 1G8ZD 3C3LA 2F0KA 3HOVB 3FRPB 4DAVA 4IUTA 3I72A 1NAPA 1PTOB 1V1OA 3OSOA 5J22A 3MXGA 1FGBD 4ZKBB 1J8IA 3K5NA 2A6HC 3GD7A 4DK0A 2KQ3A 2ZT9C 1S5ED 1FNVA 1F9QA 3BDLA 3VR5A 1U9RA 3TMEA 2JE6I 4K2LA 1YNNC 4XIGS 2C5CA 3G6JB 5JVH3 5D65A 4QF4A 5I6YA 2E2DC 5BN5A 3ND9A 3SXHA 2EY6A 1S5CD 2NBFA 1F2YA 5E4WC 1RJTA 3D8GA 3MFYA 4PMWA 5I2XA 4KKSA 3NTHA 1WTRA 5C3EB 2EY1A 2VB3X 4PQXA 2N88A 5KEEA 3V05A 1PFBA 1E2WA 3Q6SA 4RH6A 3M7NA 4KTAA 3VR6A 1KABA 3D3RA 3HZXA 4IFDH 1Y1VB 4JK1C 4J1MA 1LTRD 3S1NB 1GUOA 5F2DA 3TDQA 4KI0A 1HUNA 1JOQA 1V1PB 3OWEB 2B2TC 3T16A 2FMCA 2SNMA 2IWHA 1VDZA 5KNBA 1PTOD 3K0YA 3BDCA 3NWTA 4N9TA 1K83B 1IKLA 1Y8PB 1EY8A 1AP0A 3VA5A 1LV9A 3BG3A 2IT1A 4PMBA 2MHVA 2EJGC 5EJWA 3DXJC 5DM73 2XNAC 5KYLA 2N55A 2NVQB 1AZQA 1KDCA 4O1NA 2K5QA 3MAQA 3I91A 5EBDA 4LJZC 5M5WB 1DOMA 4RGNA 1D5MC 5IGCA 1I6HB 4QUCA 4LMQD 3N6RA 3CU7A 4QUFA 2KJXA 3MHBA 3M4YA 5J1ZA 5M3FB 1DM0B 4ZRZA 2EYFA 4RCOA 2F3VA 3LX0A 2I46A 5IGFA 1TU2B 3S17B 4YIJA 2BE5D 3H6MA 2K7VA 2EOTA 3MFGA 3GO5A 1B9NA 5JOBA 3NXWA 3DMUA 4IZ8A 1B44D 1RODA 1CQVA 2BDNA 4ZUJA 2KCNA 1H9JA 4HAEA 1D1KA 4C2MB 4N9PA 2VUMB 2I07B 5DAUA 3Q24A 2PW7A 4J6HA 1GHKA 1QNUA 3FKIB 4KN4C 5IIFA 2Q8IB 2A68D 1W6KA 3FMCA 2A69D 4IUPA 3V2TA 1CK1A 1RTOA 2H1EA 1STNA 5D3DA 1MGSA 1SYGA 1BDOA 3ZYYX 5EKKA 4FNFA 3RUZA 1W6JA 1WCMB 1Y69U 3D6CA 4DXGA 3R2TA 1O80A 2NWGA 2VB2X 1SEBD 2E76C 1FD7D 2RSNA 3GV3A 4NW2A 4Q0FA 2R61A 2E74C 1MBYA 2M2LA 3DUZA 2RVLA 3RMHA 2XRSD 3NUCA 1O78A 5CR3A 2BDOA 2VXWA 2CQAA 1HTLD 2Q8TA 5G3LD 2RSOA 4DAYA 3PO3B 5JVG3 1QJOA 1SE3A 3PUZA 4CJ1B 4WJWA 3I4MB 1TS4A 1JWSD 2D5DA 2PCFB 2IX1A 5CGKA 3PO2B 3CRLC 4FP5D 2PZUA 2J7ZA 3T56B 1T5XD 3IKJA 4V0BA 5C6AA 1EOTA 1BNZA 3DWPA 2Z1CA 1JB3A 1PTOF 4OL7A 1D5ZC 3Q23A 1SYDA 4Q5VA 4KD3A 3KBGA 3NTIA 2KEEA 1R4PB 2HCCA 2EYMA 2K32A 2KECA 4FF1A 2F0OA 5E4XA 2F0MA 2B2VC 3EROA 3R3OA 1HUMA 4F88A 3I70A 4IFDG 4DN4M 5ELFA 1V8QA 3VR2A 2L9HA 3OHXC 3IFTA 4G4KA 2RA4A 1GHJA 3LWEA 2F4IA 3DEPA 4A3IB 4R8NA 3J81E 2AWNA 3BVGA 2XSCA 4I65A 1H9RA 1PYWD 3GTJB 3P20A 1KAAA 3BZDB 4A3FB 1TS5A 1O7ZA 4RHSA 3M4OB 2L0CA 2L5TA 3MXPA 1QB5D 2O2LD 2XWJB 4RFBA 1BQQT 4PV1C 3A56A 5A2QE 3TN2A 1HTPA 2SNSA 4C3IB 2FFKB 1SE2A 2MGSA 1RDPD 3OPOA 1EY5A 1ESFA 4XYQA 2PYKA 3J7YW 1XTCD 2YYZA 3K5MA 5C0XH 4GZYC 4G7OC 4DNRB 4LK1C 2KEDA 3GTLB 2JA6B 4B9WA 3V96A 3HOUB 5C4HA 3A55A 2KUMA 2DN8A 4CKCA 3MEHA 1STHA 3A8KE 4PNYA 1TWHB 1EYAA 2A69C 1QG7A 3KLSX 2FJ2A 1F9RA 2RKSA 1EYCA 1G91A 2K5DA 4XT3B 1CT1D 3FDTA 3RLFA 1LT5D 1TWFB 3PUYA 5ELCA 1LTTD 3T13A 1A6XA 4FF2A 3URYA 1RHPA 3JAME 2F0WA 3MXNA 5FO8B 4S3SA 1B9MA 4DAPA 4FYDA 1KTKA 5AFWA 3PUXA 5CV8A 3S2DB 1STEA 4XQNA 2MP1A 1PRTF 3PMFA 4HSPA 1L0YB 3SK5A 1JOOA 2QKIC 1II3A 3A8JE 1JC7A 4DGZA 4FVMA 1S5FD 3SK6A 2WB1B 2F0DA 1LACA 4OIJA 4XQQA 1LO5D 3VA7A 1KNEA 2IJ0A 1IYVA 5CBEE 5KGUA 1B53A 1DJRD 2M9VA 1VMCA 4CJ2C 3I73A 1I4RA 5DEHA 2E2HB 1KNAA 3PV0A 5EBCA 4CJ0B 3CRKC 1R4QB 1XX8A 3ONAB 2F03A 4C3HB 1CI3M 2NTSA 1VF5C 4AYBB 3TP7A 1JQYD 3TP8A 1G2SA 4A3EB 4XXEA 1RCVD 3HOXB 1WTQA 2WAQB 2B8GA 4EQNA 4IFDJ 3MVVA 4A3BB 3GTMB 1PTOC 1UAPA 3DWQA 1STAA 2C9OA 5CV7A 3NBIA 4ILWA 2R7ZB 2PNRC 1ESRA 1LTGD 5JJZA 1HCZA 1KDAA 3TSSA 2AQ2B 1ENCA 2WV6D 5C0XI 3PIP3 3NSWA 1CFMA 3C1FA 1KDBA 2O5IC 1QNKA 2VNUD 1EU3A 1EQVA 5DM63 2EJMA 1MSGA 3NK9A 3EJIA 1EWHA 1SNMA 4RCNA 3CKIB 4DU9A 1WTXA 2ENBA 4KV6A 4TQUS 3S1RB 1U4MA 4CGYB 1J9OA 2MJ8A 3S1MB 1SBBB 2A6HD 4A3DB 3LWUA 3PIO3 3SDZA 4QMGA 1ZKOA 4TSSA 2B8FA 3U9SA 1V43A 1I6VC 4DFAA 1I4XA 5HGTA 2WKDA 3QIAA 2B2YC 3K5OA 2JYOA 5C4JB 3D6WA 4FXKC 2XIWA 4ULLA 5ISRA 1Y8OB 5JPNC 3HEJA 1LABA 3EQLC 5BN4A 3MA2B 1LTAD 2PMZB 1EY7A 2K1BA 4TRDA 3D4RA 3HS0C 3J80E 1SYFA 4C3IG 3W2DA 1T5EA 1U4RA 3J80L 2HDMA 3AMUA 3MWYW 1I4QA 5KNCA 4I7ZC 4HR7B 2J0TD 2RDGA 5KIXA 5FLXE 2KCCA 5FLXL 1SNCA 1EQTA 3OWFA 2PQEA 4QCLA 2F0SA 4KKTA 3I4NB 2JEAI 2EPBA 1PZJD 1EYDA 3WDNA 1WTVA 2EYJA 2X6LA 2K01A 1LLRD 4PMCA 3S1QB 3O13A 1X32A 3A7AB 1SJED 1JE4A 4CKBA 4NP5A 2NB0A 2ICIA 4CHTB 1DYQA 3CHBD 4Z9CB 4HSVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F2Z A;  3QOL A;  5M9O A;  2NUC A;  3T16 A;  2SOB A;  2QDB A;  3TP7 A;  2F0N A;  5C3W A;  3SR1 A;  3DHQ A;  4B9W A;  5CGK A;  5HUR A;  4DFA A;  1EY6 A;  4NMZ A;  3TP8 A;  5C4H A;  5HGT A;  5C4Z A;  5IIF A;  4ZUI A;  3MEH A;  1A2T A;  1SNP A;  1STH A;  2F0H A;  2EYP A;  2PZU A;  2SNM A;  2PW5 A;  4PNY A;  4EQN A;  1ENA A;  4HTH A;  3MVV A;  1EYA A;  5KIX A;  3BDC A;  3V2T A;  5I9O A;  1SYE A;  1TR5 A;  2F0K A;  4N9T A;  2OXP A;  1EY4 A;  5C6A A;  2RKS A;  2F0J A;  1STA A;  1EYC A;  2OF1 A;  1STN A;  4HMI A;  5IGE A;  1EY8 A;  4RKB A;  5C3X A;  3VA5 A;  5ISR A;  5CV7 A;  1SYG A;  2EYO A;  4PMB A;  4ZQ3 A;  3E5S A;  4HMJ A;  3OMC A;  2F3W A;  4OL7 A;  4K6D A;  5EKK A;  1SYD A;  2PZW A;  3HEJ A;  5E1F A;  3RUZ A;  1A2U A;  4KD3 A;  3C1E A;  4E6I A;  3OSO A;  5KYL A;  1F2M A;  2EYM A;  1KDA A;  3T13 A;  3P75 A;  3OMG A;  5J22 A;  1EY7 A;  1ENC A;  4K5W A;  2F0O A;  4KY5 A;  1KDC A;  1NSN S;  3TP6 A;  2F0M A;  2F0E A;  4TRD A;  3D6C A;  3ERO A;  4KY6 A;  5IOC A;  3R3O A;  5J39 A;  4K2K A;  2RBM A;  1EY9 A;  4WRD A;  3U9O A;  1STY A;  4DF7 A;  1SYF A;  5I9P A;  5KRU A;  3QOJ A;  2F0W A;  3C1F A;  4KD4 A;  4EVO A;  1KDB A;  2KQ3 A;  4S3S A;  4K5V A;  3SK8 A;  3MZ5 A;  5IOD A;  3ITP A;  4ME5 A;  4RKL A;  4KJN A;  1STG A;  5IGC A;  4EQP A;  3D4D A;  3BDL A;  5CV8 A;  1U9R A;  3NQT A;  1EQV A;  3TME A;  2M00 A;  4K2L A;  2F0U A;  1NUC A;  4KHV A;  2OEO A;  4NDX A;  1A3U A;  2F0L A;  5C5M A;  3ERQ A;  1SNQ A;  4QF4 A;  3SHL A;  1STB A;  1JOK A;  2EYL A;  3P1H A;  3PMF A;  3NK9 A;  1A3T A;  1JOO A;  4R8N A;  3SK5 A;  2EYH A;  5I6Y A;  2O4X A;  5JAV A;  4I65 A;  3EJI A;  4QB4 A;  1II3 A;  1SNM A;  3MHB A;  5EGT A;  4K8J A;  5E3F A;  4B9X A;  1SNO A;  4DGZ A;  2EY2 A;  4KJO A;  1RKN A;  3SXH A;  4H7B A;  3NUC A;  5CC4 A;  5K5P A;  5CR3 A;  1KAA A;  2EY6 A;  2WAC A;  1SNC A;  2EXZ A;  2PZT A;  3SK6 A;  5J1Z A;  4EQO A;  3OWF A;  2PQE A;  4F8M A;  1F2Y A;  2F0S A;  3QB3 A;  4DU9 A;  2EYF A;  2F0D A;  3MXP A;  2F3V A;  5NUC A;  1TT2 A;  2F0F A;  5KYI A;  3D8G A;  3S9W A;  4LAA A;  2F0G A;  1EYD A;  5IGD A;  3LX0 A;  1EZ8 A;  2F0Q A;  5IGF A;  2ENB A;  4KV6 A;  3SK4 A;  1EZ6 A;  2RDF A;  3NHH A;  1SND A;  2HQE A;  4YIJ A;  2F0V A;  1A3V A;  2EY1 A;  2EYJ A;  2SNS A;  5KGU A;  4IUN A;  3H6M A;  5CV5 A;  4ODG A;  4PMC A;  5I6W A;  5KEE A;  4K8I A;  5JOB A;  3NXW A;  2LKV A;  3DMU A;  3D4W A;  4IZ8 A;  4G57 A;  4KTA A;  1IHZ A;  1KAB A;  2F0I A;  3HZX A;  2EY5 A;  4IAL A;  4MIU A;  1EY0 A;  5DEH A;  4ZUJ A;  3NP8 A;  4K14 A;  1EY5 A;  4KY7 A;  1TQO A;  5CV9 A;  5IGG A;  1SYB A;  4NKL A;  4F7X A;  1JOR A;  5C5L A;  4NP5 A;  2PYK A;  4ID6 A;  1SYC A;  4J1M A;  5EKL A;  4N9P A;  4WOR A;  2F0T A;  4K5X A;  2F0P A;  3EVQ A;  2KHS A;  5DAU A;  5F2D A;  2PW7 A;  4QMG A;  3TP5 A;  5CV6 A;  4J6H A;  5IGB A;  5CV4 A;  1JOQ A;  1AEX A; 
#chains in the Genus database with same CATH topology
 1F2Z A;  2QIL A;  5M9O A;  4A75 A;  2GVA A;  1K83 H;  2SDF A;  3DHQ A;  5HUR A;  3RZD B;  4JI7 Q;  4BA2 I;  3IFD A;  4QIW B;  2YTY A;  2F0H A;  2JK8 A;  2EDG A;  1D6E C;  5IP7 H;  4GKK L;  1IW7 C;  5DNF A;  3W3A A;  3I4O A;  2ZXR A;  3L3O C;  2B2U A;  4BY1 H;  2Z9H A;  4H0L C;  1NNX A;  3DLL A;  5COY A;  1Z6H A;  2EYO A;  3E5S A;  3EFX D;  3CME A;  3DEO A;  1WYD A;  3SGI A;  3HP3 A;  3I2Z A;  2PI2 A;  3K5L A;  4DR6 Q;  2B2T A;  2JXM B;  1TS3 A;  4JOI C;  2L12 A;  1JWM D;  1MKH A;  4IFD I;  2LS0 1;  1SAP A;  2E8G A;  1M8A A;  1Q81 C;  1MI2 A;  5JPM C;  2UXC L;  1GM5 A;  3VYS A;  4DF7 A;  1BCP C;  3I4N H;  4O2D A;  4GN4 B;  5CBA E;  1HFN A;  3M4P A;  3BS1 A;  1CSQ A;  2J4X A;  2ZJQ A;  2EXD A;  4JI4 L;  5ELE A;  3CC2 A;  1YBY A;  2YU9 H;  1S4Z A;  2F0L A;  4DR7 Q;  2I5M X;  4DKA C;  4DV5 Q;  1Q1B A;  3P1H A;  1A8V A;  4DUZ L;  4X62 L;  1Y1W B;  5C0X G;  3F2U A;  1FJG L;  2R92 G;  3QB3 A;  1L0W A;  1XYI A;  4BY7 H;  1GUW A;  5IP9 H;  1TT2 A;  1HNX L;  2OQ0 A;  3J7Z C;  2NVT H;  1EZ8 A;  5BR8 Q;  4HN7 A;  3J7A V;  4MN3 A;  1HA5 A;  3JAM c;  5FK9 C;  4X3S A;  1ILQ A;  2Z4I A;  3MEF A;  1CSP A;  4JBW A;  1TWG H;  1IYU A;  2KA7 A;  2F52 A;  4HCS A;  5GQO A;  3D4W A;  2LMC B;  4MTN A;  1O7L A;  3E0J A;  1EY0 A;  1U4L A;  1PH4 A;  4HCE A;  1SYB A;  2XGT A;  1CTM A;  2A6E D;  5EKL A;  1PH5 A;  3QWN A;  1PH2 A;  2UUB Q;  1QE6 A;  2LSS A;  2ZJP A;  3PUV A;  4LF4 L;  2R6G A;  1BCP B;  1SRU A;  3QOL A;  4ZLT F;  4QIW E;  2G9D A;  4DV0 L;  1YHB A;  5D14 A;  3RZO B;  3J7A 5;  1KLG D;  1JJ2 A;  4DV0 Q;  1PXU A;  1EEI D;  4A3C H;  3VDY A;  4IUV A;  1BUV T;  5CMD A;  2OXP A;  2FIN B;  4IUR A;  2F4V L;  4N8F A;  2QW7 A;  1D7Q A;  3M4O H;  3K0X A;  2BA1 A;  1E1O A;  3CQZ B;  5IYD H;  1PTO H;  4TVA B;  2IW3 A;  2ATW A;  1K0S A;  2AHO B;  1ET6 A;  3P75 A;  4K5W A;  2XN9 C;  1Q8I A;  2F0E A;  2AKW B;  4UY8 C;  5IOC A;  1EY9 A;  3Q22 A;  1SSO A;  4BY7 B;  3KYH C;  1KL9 A;  3T1Y Q;  1JWU D;  2N8N A;  4U68 A;  4L8J A;  2JA5 B;  3M3Y B;  5AJ3 Q;  1V1P A;  1J5E L;  4RA8 A;  4EQP A;  4RGO S;  2V1C C;  4DR2 L;  2NVT B;  3QO2 A;  3L7Z C;  2OEO A;  1E2Z A;  1WVL A;  2PO4 A;  2EIF A;  1JCK B;  1D2B A;  2K75 A;  1YHA A;  4L5R C;  2O4X A;  5JAV A;  4GOP B;  2UUB L;  2EY2 A;  4KJO A;  5A35 A;  2L4N A;  4EQ5 A;  1YZ6 A;  3BYY B;  2EXZ A;  2HUG A;  3M4Q A;  1UE1 A;  4A93 B;  3MXU A;  5ELN A;  1VQF A;  3HOX G;  4OX9 Q;  4LAA A;  4BBS H;  1MJE A;  2RCF A;  3J81 i;  2UU9 Q;  1QIL A;  2F1M A;  4O42 A;  1DGS A;  1WTW A;  3NHH A;  3OOC A;  3PIP A;  4QQB X;  3PF4 A;  5C4X B;  1SND A;  3HKS A;  3OIP A;  1X3Q A;  3TZD A;  2A8V A;  5LMU Q;  4UHV A;  4ZK9 B;  3GTK B;  1GVP A;  4B3S Q;  3S16 B;  1H9M A;  1DOL A;  1JB7 A;  4A3G B;  1X3P A;  5LMU L;  2CCZ A;  4DR6 L;  4OO1 H;  1OXX K;  3WOF A;  3J7A F;  3K6O A;  1GXD C;  1L1O B;  2EY5 A;  4MIU A;  3CF5 A;  4OO1 G;  4LF4 Q;  4FXD A;  3SEB A;  1SFO B;  2ZXO A;  5CV9 A;  1SXT A;  1TXY A;  1HQM C;  2KOL A;  2B63 G;  3R2I A;  3VR4 A;  4TKO B;  2BH2 A;  2DJG C;  2JA5 H;  2Z6B A;  2CW0 D;  3FEW X;  1VQG A;  3T53 B;  2F0N A;  1YIT A;  4NMZ A;  2RDH A;  4BA1 I;  1SMX A;  2A68 C;  2WB1 E;  2GN5 A;  2MFI A;  2QEX A;  3SE0 A;  1A15 A;  1ENA A;  1N36 Q;  1WD0 A;  3HGB A;  2AMC B;  1EY4 A;  3BVZ A;  2JJQ A;  1C48 A;  1XJV A;  1IYJ B;  2F0J A;  2HCI A;  2LXJ A;  3HRZ C;  4HMI A;  4WFN 3;  1HRJ A;  4ABN A;  1EIH A;  1PFN A;  3HOZ H;  3OMC A;  1K3B C;  4K6D A;  2DY7 A;  1K8G A;  1ENF A;  5M5Y B;  1LM0 A;  4DV2 Q;  4HIM A;  3GTQ B;  4JI5 L;  1Q90 A;  5IT9 E;  1LTI D;  1PZK D;  1HNZ Q;  1QVG A;  3X3M A;  1F2M A;  3T4A C;  4C3J G;  4YHH L;  1BBW A;  1YEZ A;  1AFP A;  4UP7 A;  3U50 C;  3IL8 A;  1XMO L;  3UI2 A;  5M5X B;  2WII B;  2E2I H;  2OCE A;  2H4O A;  5I9P A;  2BE5 C;  3GTO H;  1CUK A;  1K9M C;  3CP0 A;  3MZ5 A;  2OQK A;  4KJN A;  1HH2 P;  1STG A;  1WFQ A;  4XT1 B;  2D62 A;  2K03 A;  3OIQ A;  1NUC A;  3QG1 A;  1KIX A;  3GTL H;  4DV4 L;  2R92 H;  1FYC A;  1JOK A;  1ONL A;  3U4Z A;  1ICW A;  1SNO A;  5CC4 A;  5K5P A;  5C0X J;  1B1Z A;  4UDU C;  3CPW A;  4DR3 L;  4L63 B;  2R93 B;  5NUC A;  1AE3 A;  2X69 A;  4A3E G;  4DUZ Q;  3JAM L;  1BXT A;  2F0Q A;  1CA5 A;  1CKN B;  4A93 G;  2F4V Q;  3T1H L;  5A2Q L;  4F87 A;  4OIK A;  2A19 A;  1S5B D;  4DUY Q;  2NZH A;  2QF7 A;  4JVZ A;  3EA6 A;  3S2H B;  4J15 A;  2AUJ D;  5K36 G;  3G6E A;  4OWW B;  4JI5 Q;  1HPC A;  2NN6 G;  4K14 A;  3CC7 A;  3HKZ E;  4KY7 A;  2A1A A;  4X66 Q;  4KN7 C;  1J6Q A;  2UUC L;  4H13 C;  5EAY A;  2HT1 A;  4K5X A;  2EJF C;  2KHS A;  3W5O A;  2QA4 A;  3TP5 A;  2K50 A;  2TSS A;  2OWO A;  1NMG A;  4LFC Q;  1N36 L;  2B2W A;  4BY7 G;  2Q2I A;  1OXT A;  1AZP A;  2E2J B;  4FF4 A;  4JI3 Q;  3W1B A;  2AWO A;  3VYU A;  1A2T A;  1SNP A;  1OXS C;  1BOS A;  2BOS A;  1YJW A;  4HTH A;  3UDF A;  3I90 A;  4B3T L;  2I0Q A;  1SYE A;  3H15 A;  1HFG A;  3I4L A;  1QZG A;  1XTD A;  4GKK Q;  4EX5 A;  1EU4 A;  1UEA B;  1C4Q A;  3H91 A;  3M3Y H;  5FOB B;  2F3W A;  3A54 A;  3UE1 A;  1FR3 A;  2JA5 G;  1H9S B;  3NBH A;  2PI2 E;  4KK7 A;  2KHJ A;  1VMP A;  4RGM A;  2MQH A;  1B3A A;  3GV6 A;  1UE5 A;  5LMN Q;  1PFM A;  2SEB D;  2ZTD A;  3NTK A;  4KY5 A;  4IOA A;  4LF7 L;  4OWT B;  1STY A;  3KDF A;  5G3L F;  1CKN A;  4POF A;  4EVO A;  4JOI A;  5ELB A;  5IOD A;  3E0E A;  1ICF B;  3H94 A;  3PSI A;  4C1N K;  3C46 A;  2OTL A;  2K5W A;  3D4D A;  2A74 C;  4JV5 Q;  1N34 L;  3OTO Q;  4KHV A;  2N78 A;  1CM9 A;  1K8M A;  2ZXP A;  1A3T A;  1I4G A;  4K8J A;  2QCP X;  4A3K B;  5I4D A;  4H7B A;  4GNX B;  3NE5 B;  2WAC A;  1UNS A;  2VS1 A;  1PH8 A;  1E7Z A;  3BVM A;  4M8A A;  5C3E H;  1YIJ A;  4DUY L;  4A3J H;  1YNN D;  2CHB D;  5IE8 A;  1KD1 C;  1PRT B;  2K05 A;  2KVM A;  1DCZ A;  1Z7T A;  2B39 A;  1K8O A;  4XYO A;  3KLS A;  3PF5 A;  1EFI D;  2HQE A;  2K28 A;  3KBX A;  3Q0A A;  1TS2 A;  4X3T A;  4ODG A;  2B3G A;  2D0O A;  1R9T B;  1E2V A;  1IBM L;  3RNU A;  3D0F A;  2XWB B;  3KF8 A;  2V4D A;  2L55 A;  1IHZ A;  1E1T A;  1PLF A;  1Y8N B;  4DV2 L;  1KQS A;  3GQB A;  5COR A;  4QGU A;  4UAI A;  1JOR A;  4ID6 A;  4R4Q A;  5C44 B;  3ICE A;  3HOZ G;  4R8I A;  4YCU A;  2CVR A;  3HKZ B;  1VQN A;  5T1G A;  4OGQ C;  4H44 C;  1LTS D;  3GP7 A;  4A3G H;  1Q1E A;  2K5N A;  2Y0S B;  4BWG B;  2BH8 A;  4NB3 A;  1D1I A;  5C4Z A;  1M4V A;  4H02 A;  4YWK A;  4G7H C;  4OEL B;  3ND8 A;  4IJH A;  2ZTE A;  3WOE A;  4LF5 Q;  1G6Z A;  1S5D D;  5M3F H;  1PZI D;  2OF1 A;  1VQC A;  4L6T B;  2L11 A;  3S15 B;  4ZQ3 A;  4YY3 L;  4IJL A;  4OHJ A;  1VQA A;  1RD9 D;  4BBR G;  4NXN Q;  2GA4 B;  3C1E A;  4E6I A;  2OTJ A;  5EKI A;  3KK7 A;  4R1J A;  2WFW A;  2FXQ A;  2Z4H A;  3I8Z A;  1OXV A;  5I2Y A;  3EN2 A;  3TEH B;  1PRT C;  2EE1 A;  3MTS A;  5J39 A;  3FPU B;  4X65 Q;  4A3M B;  2Z8L A;  5KRU A;  4CKE A;  1VCI A;  1SE4 A;  2K33 A;  4DV6 Q;  2RQX A;  3SK8 A;  2N49 A;  3ITP A;  3X3N A;  1WCM G;  4C3H H;  3K57 A;  2M00 A;  2D9U A;  2F0U A;  1VQO A;  4LF6 Q;  1A3U A;  1EUJ A;  1SNQ A;  2UXB Q;  3CCQ A;  1SJH D;  1XXG A;  5FKA C;  2JA7 B;  3HOY H;  2WP8 J;  3H09 A;  1HJP A;  5JEA J;  3GTP B;  3FP9 A;  1EL0 A;  2PZT A;  4DNI A;  1OXU A;  1DOK A;  5LL6 X;  4K6L A;  1BR9 A;  4RG1 A;  1X3G A;  4KHP Q;  4YHH Q;  4RGT A;  2GVB A;  2HIV A;  2JA7 G;  1KXL A;  2RDF A;  4A3I H;  3M7G A;  2NVY B;  4B08 A;  1F77 A;  2OT2 A;  1V1Q A;  1VQ6 A;  4HJ8 A;  1GUG A;  3DWA A;  3PUW A;  3J81 j;  4ZYS A;  2NN6 H;  1ML0 D;  2IY5 B;  2E75 C;  1CHQ D;  3NPP A;  3A7L A;  5LL6 S;  4KKU A;  3K59 A;  2NZ1 D;  2I5L X;  5KND A;  2YU9 B;  4QL5 A;  3E6Z X;  2YTX A;  1CZW A;  2ZM6 Q;  1F9S A;  1PDQ A;  1ZEQ X;  3ULP A;  2F0T A;  1FGU A;  3IRB A;  4A76 A;  1MSH A;  1GUS A;  5CV6 A;  1VQP A;  1MIU A;  3R8B A;  4DR3 Q;  1HA6 A;  2R92 B;  2HDL A;  4M1U B;  1LTB D;  1UE6 A;  1WI5 A;  1YHQ A;  4BBR B;  1GOZ A;  2A73 B;  3GDE A;  1PH9 A;  1B4O A;  4ZUI A;  2KEN A;  2EYP A;  3CD6 A;  1EWI A;  4XDX A;  3GTO B;  1TR5 A;  4DV5 L;  3K81 C;  1NR2 A;  1B70 B;  1TWC B;  4P2C B;  2X6G A;  4GOP A;  3I4M G;  1IKM A;  5LHY 1;  3ZJY C;  2VZA A;  3H0G H;  3HKZ G;  2PPB C;  4B3M Q;  3HOZ B;  2UUC Q;  1UUP A;  5FLX c;  3U9O A;  3UDI A;  2ICE C;  1U4P A;  3FVQ A;  4IN3 A;  4JI1 L;  2O5J C;  1XMO Q;  4C1N I;  1FL0 A;  5LMN L;  1R9T H;  5IT9 L;  5JJK A;  4LUO A;  3R93 A;  2B2V A;  3NQT A;  1XPU A;  3AEV A;  3VR3 A;  4FDB A;  3QJY A;  3J80 c;  1NCV A;  4R4T A;  1YVC A;  1X55 A;  1VS0 A;  4JW0 A;  2WKC A;  1HNW L;  5M3M B;  1AW7 A;  3DM1 A;  3RN2 A;  2XRQ D;  1I4H A;  4HIO A;  2BCO A;  3HOV H;  4RAU C;  2R3Z A;  1ZXT A;  3S9W A;  2MPM A;  1A0I A;  3UE0 A;  1DD2 A;  2JSO A;  1FNW A;  2IX3 A;  1SMY C;  4CDF C;  1KC8 C;  4DR4 L;  1VQH A;  4X6A H;  4Y7N B;  1TWG B;  2NYZ D;  1YNJ D;  4YY3 Q;  4OO1 I;  3J80 i;  3JC6 6;  2E5L Q;  4G57 A;  2DGY A;  4JI0 L;  1M1K C;  5GAG C;  1UWV A;  1TQO A;  3G71 A;  5C5L A;  4XQJ A;  1SYC A;  1I50 B;  4R9W A;  5FO9 B;  3MXN B;  1HR0 Q;  1CHP D;  2IPK D;  1SDF A;  2F0P A;  4IQZ A;  3I4N G;  1Q82 C;  5CV4 A;  1DZ1 A;  4OON A;  4LFA L;  5JJL A;  1GD7 A;  1ZYR D;  1HZC A;  2QDB A;  5FJ8 H;  3SR1 A;  2K04 A;  2DNC A;  5FO7 B;  3RLO A;  1ET9 A;  2CH4 W;  2B2W C;  3IAY A;  1G29 1;  4FO2 A;  1ASY A;  3C2P A;  3H0G B;  4ZAI A;  5I9O A;  1BO0 A;  2EZV A;  4V19 0;  2FMM A;  4DAY B;  5IGE A;  5C3X A;  5IP9 G;  1IBM Q;  4HMJ A;  1VF7 A;  4JG2 A;  1XWE A;  4HJ7 A;  1CQF A;  2CW0 C;  2FHT A;  3DM3 A;  4AQY Q;  1WTP A;  4GLX A;  1NSN S;  4KY6 A;  4J8Q A;  5JEA G;  2RBM A;  4A3J B;  2JP1 A;  2MO1 A;  4C3H G;  4KD4 A;  5H1S E;  3STB C;  3CCV A;  4HED A;  3N52 A;  1JIC A;  3MC0 B;  2G9H D;  4DK6 C;  4BY1 B;  4FXG C;  4RKL A;  4GOP C;  1NMF A;  1NTG A;  1LT4 D;  4NDX A;  1O7I A;  3NWS A;  2VQF Q;  4KHZ A;  5EPJ A;  3SHL A;  1XNR L;  3S14 B;  2JEB I;  1X65 A;  3K7U C;  4X3K A;  5EGT A;  5M3M H;  5GAE C;  3BJU A;  1UE7 A;  1JR0 D;  4DXF A;  1K8A C;  1IBK L;  2AQ1 B;  4AYB G;  3HOY B;  3KOJ A;  2AUK A;  1N9W A;  4R4O A;  2F0G A;  5IWA L;  2NVX B;  1I3Q B;  4NXM Q;  1O7Y A;  5D3I B;  4GKJ L;  3CAM A;  4U67 3;  2RHS B;  1VQK A;  2XVS A;  2ID0 A;  3CCS A;  4YCV A;  1X3F A;  3STB D;  4NPS A;  1QWY A;  5CV5 A;  4A3D G;  4DV7 Q;  4CBV A;  2LY7 A;  4C56 C;  3OW7 A;  4JBM A;  1LTL A;  2NN6 I;  1BF4 A;  1TY2 A;  1QCB D;  2F0I A;  3K7A B;  5C5M A;  5IGB A;  1L1O C;  3NP8 A;  4XTC S;  3K58 A;  2UXB L;  4F7X A;  4X3U A;  3CXC A;  5IYC G;  3NQI A;  1Q12 A;  3RZO H;  1V9P A;  4C3J B;  1AE2 A;  3KDF B;  2D2C C;  5I6W A;  5C3W A;  2VUM H;  3Q8D A;  2DNE A;  1I4P A;  3D31 A;  3A0J A;  4BBS B;  1NR4 A;  2PW5 A;  1D5X C;  4P72 A;  4HIK A;  4A93 H;  1ZYR C;  1GUT A;  2NVX H;  3TBI B;  4RKB A;  1BCP F;  1WD1 A;  5K36 H;  1DXM A;  2PZW A;  5E1F A;  2H5X A;  4FF3 A;  3LNN A;  4LW1 A;  1TKW B;  1QVC A;  1L2F A;  4IUQ A;  3BYT B;  3NEL A;  2A6E C;  2IL8 A;  3TP6 A;  2B63 B;  3G4S A;  1YNJ C;  4K2K A;  2JA8 B;  1WTO A;  1TII D;  3RD4 A;  1Q86 C;  3L2P A;  1VQM A;  2AQ3 B;  1C8C A;  2R7Z G;  2RHQ B;  1SMY D;  4DNT B;  1BBX C;  4ME5 A;  1EQR A;  1TVX A;  4RHR A;  4B3T Q;  3KF8 B;  2IX0 A;  1PMR A;  4JI1 Q;  1GJX A;  3ERQ A;  1STB A;  2EYL A;  3M85 A;  2UUA L;  5E3F A;  4B9X A;  1RKN A;  1KLU D;  4LF6 L;  1MD2 D;  4LFA Q;  4F8M A;  1EWC A;  3KFU A;  2B2U C;  2TMP A;  4KMU C;  1LT6 D;  1U0L A;  5IGD A;  1Y14 B;  2VY3 A;  4UP9 A;  3VYT A;  2EVB A;  3RLN A;  4RWS C;  2MUY A;  5GRO A;  2F0V A;  1A3V A;  1ILP A;  1HHV A;  4A3M G;  4IUN A;  3VYR A;  3BU2 A;  3AU7 A;  4DK1 A;  5FLM H;  2WIN B;  3CCJ A;  5EQ0 A;  5M5X H;  2LKV A;  1M90 C;  1K28 A;  4AIM A;  1JE5 A;  4IAL A;  2A5H A;  3J81 L;  4JBJ A;  1BCP D;  5IYB H;  3NEN A;  1RF2 D;  5IGG A;  1RTN A;  3A8I E;  4A3C G;  2JQO A;  4LFB L;  4A3L H;  3SVM A;  3EVQ A;  3G7L A;  4ALP A;  3T51 B;  4EGV A;  3G48 A;  1H9K A;  1AEX A;  2WB1 G;  5CYU A;  2NUC A;  2SOB A;  3FPP A;  3KLR A;  4PG3 A;  1Z47 A;  1EIG A;  1EY6 A;  3HOW B;  1I3Q H;  3P7J A;  3BDO A;  1F9P A;  3W1G A;  1IW7 D;  5EPK A;  1KRS A;  3ERS X;  1U5K A;  3E9H A;  2LFN A;  4G7Z C;  1Y1W H;  1B3Q A;  1Q46 A;  1FNU A;  4YCW A;  2BA0 A;  5T1I A;  1A2U A;  1AN8 A;  4YWM A;  1VQL A;  4DA2 A;  3HG9 A;  3AB9 A;  1QZH A;  1L0X B;  3OMG A;  4P73 A;  5IWA Q;  1GUN A;  4GKJ Q;  4P71 A;  1C9O A;  4WRD A;  2QDL A;  3QOJ A;  1HXY D;  2JA8 G;  2DY8 A;  4K5V A;  1F2L A;  1LYL A;  5C4X H;  4B3M L;  2B2Y A;  1X56 A;  4DV3 Q;  1I6H H;  4BS9 A;  3GTG B;  1Q8K A;  3L9A X;  4DV6 L;  1SLJ A;  4HJ9 A;  4X64 Q;  5FJ8 G;  2VQE L;  2EYH A;  3L0O A;  4QB4 A;  3H3V C;  4A3K H;  3J81 c;  4AYB E;  4EQO A;  4MHE A;  5ELD A;  4BXX H;  4MNO A;  1CZG A;  1OO9 B;  1B2T A;  2NTT A;  1IL8 A;  1BKB A;  4GS3 A;  2F0F A;  1G2T A;  2L1B A;  5KYI A;  1Y1W G;  1E0B A;  3TZU A;  1X3E A;  1LUZ A;  4ZKC B;  3SK4 A;  1DON A;  1EZ6 A;  1EEF D;  1TWA B;  1XMQ Q;  2RF4 A;  3KUP A;  5TSS A;  1MJC A;  4K8I A;  1PRT D;  1H9S A;  5JEA H;  4IUU A;  1Q3L A;  2Q8R E;  1YNX A;  2E2I B;  2K6A A;  4A4I A;  2QEJ C;  2E2H H;  1HQR D;  4NKL A;  3PO3 G;  3I3C A;  1CA6 A;  1LT3 D;  4LUZ A;  4WOR A;  3HOW G;  3S1N H;  5EPL A;  1E24 A;  5M5W H;  5BN3 A;  1QOH A;  1B50 A;  4GNX C;  4C3J H;  1TY0 A;  5GAD C;  3WWV A;  2CWP A;  2MNA A;  2NZO A;  1G8Z D;  2E2J H;  1AH9 A;  2NVY H;  4A3I G;  3PIO A;  3C3L A;  2F0K A;  3HOV B;  5M5Y H;  3FRP B;  4DAV A;  1VQ9 A;  1FJG Q;  4IUT A;  2K5H A;  3I72 A;  1NAP A;  1PTO B;  1V1O A;  1TWA H;  2K52 A;  3OSO A;  5J22 A;  1WOC A;  3MXG A;  1PHJ A;  2DJF C;  1FGB D;  4ZKB B;  1J8I A;  1HNZ L;  4DV3 L;  2UXD L;  3K5N A;  2A6H C;  3GD7 A;  2KBN A;  1PV4 A;  3UDG A;  4DK0 A;  2KQ3 A;  2ZT9 C;  1S5E D;  1FNV A;  1JJC B;  1F9Q A;  3BDL A;  3VR5 A;  4A3E H;  1U9R A;  3TME A;  2JE6 I;  4K2L A;  1YNN C;  4XIG S;  2C5C A;  3G6J B;  5D65 A;  5JVH 3;  4QF4 A;  1VQ7 A;  5I6Y A;  2E2D C;  5BN5 A;  5JJI A;  2Z6K A;  4AH6 A;  4JI6 L;  3ND9 A;  3SXH A;  2C35 B;  3S16 H;  2EY6 A;  1S5C D;  2NBF A;  1XMQ L;  4IPD A;  4WJ3 M;  1F2Y A;  3F8T A;  4JC0 A;  4BBS G;  5E4W C;  1RJT A;  3D8G A;  3MFY A;  2UUA Q;  4PMW A;  5I2X A;  4KKS A;  3NTH A;  4APV A;  1WTR A;  5C3E B;  2EY1 A;  2VB3 X;  4Y7N H;  4PQX A;  5LMN W;  4N8X 1;  2N88 A;  5KEE A;  3V05 A;  4CDE C;  1PFB A;  2HIX A;  1E2W A;  3Q6S A;  4RH6 A;  3M7N A;  4KTA A;  1GKH A;  4C3I H;  3VR6 A;  1KAB A;  3D3R A;  3HZX A;  4IFD H;  1Y1V B;  2HHH Q;  4A3D H;  4UPA A;  2CKZ B;  2EQS A;  4HJ5 A;  1UEB A;  4JK1 C;  4J1M A;  1LTR D;  3S1N B;  1GUO A;  4LF8 L;  5F2D A;  3TDQ A;  4KI0 A;  1HUN A;  2VL6 A;  3ULL A;  1JOQ A;  1V1P B;  3OWE B;  2B2T C;  3T16 A;  1HR0 L;  2FMC A;  2I5H A;  4LFB Q;  2Z6K C;  2SNM A;  2IWH A;  1VDZ A;  1WCM H;  5KNB A;  3HOY G;  4WJ4 A;  1PTO D;  3K0Y A;  3BDC A;  3PO3 H;  4DR1 Q;  3NWT A;  4N9T A;  4MTK A;  1K83 B;  2KHI A;  1IKL A;  5M3M G;  1Y8P B;  3CPF A;  1EY8 A;  1AP0 A;  3VA5 A;  3F1Z A;  1LV9 A;  4IO9 A;  3BG3 A;  2IT1 A;  4PMB A;  2MHV A;  2EJG C;  5EJW A;  1EIF A;  3DXJ C;  5L37 A;  5DM7 3;  1YJN A;  2XNA C;  3F2C A;  5KYL A;  2N55 A;  2NVQ B;  1AZQ A;  1A63 A;  4DR4 Q;  1KDC A;  1X54 A;  4O1N A;  2K5Q A;  3B6Y A;  3MAQ A;  5GAH C;  3I91 A;  5EBD A;  2YV5 A;  3S1Q H;  4LJZ C;  3K8A A;  5M5W B;  4DR2 Q;  3E3X A;  1DOM A;  4RGN A;  1D5M C;  1QUQ B;  1RIP A;  5IGC A;  1I6H B;  4QUC A;  4LMQ D;  3N6R A;  3BZC A;  3CU7 A;  4QUF A;  3U58 A;  2KJX A;  3MHB A;  4BY1 G;  3FKI G;  3M4Y A;  5J1Z A;  5M3F B;  1DM0 B;  4ZRZ A;  2EYF A;  4RCO A;  2F3V A;  1PFS A;  1S40 A;  3LX0 A;  2I46 A;  5IGF A;  1TU2 B;  1JJG A;  3S17 B;  4YIJ A;  1E22 A;  4DR1 L;  2BE5 D;  1I94 Q;  1IBL Q;  3TS2 A;  1Y1V G;  3H6M A;  4LF7 Q;  2K7V A;  2EOT A;  3MFG A;  3GO5 A;  3I4M H;  1B9N A;  5JOB A;  3NXW A;  2JA8 H;  2K14 A;  3DMU A;  4IZ8 A;  1B44 D;  1ROD A;  1XNQ Q;  1CQV A;  2BDN A;  4ZUJ A;  4X64 L;  2KCN A;  1H9J A;  5C3E G;  4HAE A;  1N34 Q;  3A74 A;  1D1K A;  3H0G G;  4C2M B;  3GTG H;  4N9P A;  2VUM B;  2I07 B;  5DAU A;  3Q24 A;  2PW7 A;  1WJJ A;  4J6H A;  1GHK A;  1QNU A;  5M3F G;  5C4J H;  3FKI B;  4BXX G;  4KN4 C;  5IIF A;  2Q8I B;  2A68 D;  1W6K A;  4DR5 L;  3FMC A;  4A3L G;  2A69 D;  4IUP A;  3V2T A;  3H3V I;  1XPO A;  1CK1 A;  1RTO A;  2CH4 A;  2H1E A;  3RR5 A;  3CCU A;  1STN A;  5D3D A;  1MGS A;  4YWL A;  2WAQ G;  1IBK Q;  1SYG A;  2ES2 A;  1BDO A;  3ZYY X;  5EKK A;  4CDC C;  4FNF A;  3RUZ A;  3T1Y L;  1W6J A;  1S3O A;  1WCM B;  1Y69 U;  3D6C A;  4DXG A;  3TS0 A;  4POG A;  3R2T A;  3CCE A;  4UP8 A;  1O80 A;  2NWG A;  2VB2 X;  1SEB D;  2E76 C;  2QGQ A;  1HZA A;  4QY7 A;  1FD7 D;  2RSN A;  4NW2 A;  3GV3 A;  4Q0F A;  2R61 A;  2JA7 H;  1PH3 A;  3CCM A;  4X66 L;  4R4C A;  2E74 C;  1MBY A;  2M2L A;  3DUZ A;  2RVL A;  3RMH A;  3NEM A;  3A5U A;  2XRS D;  1S72 A;  3NUC A;  1O78 A;  5CR3 A;  2BDO A;  2VXW A;  2F3I A;  1ASZ A;  3T1H Q;  2CQA A;  1TWH H;  2ASB A;  1HTL D;  2Q8T A;  1HNW Q;  5G3L D;  2RSO A;  2Z0S A;  4DAY A;  3PO3 B;  5JVG 3;  3FKI H;  1QJO A;  1KRT A;  1SE3 A;  3PUZ A;  2UXC Q;  1PYB A;  4CJ1 B;  4WJW A;  3I4M B;  1E3P A;  1TS4 A;  5C44 G;  3S15 H;  1GO3 E;  3KLW A;  3KJP A;  4C2M H;  4AQY L;  3TQY A;  1VQI A;  4JI4 Q;  3JAM i;  4DR7 L;  2B63 H;  1JWS D;  3A5Z B;  3E9I A;  1NJI C;  2D5D A;  3S14 H;  4L5S A;  2R93 H;  3PO2 H;  2HD3 A;  1Y1V H;  2PCF B;  3AFP A;  2HHH L;  2IX1 A;  3CCR A;  2WAQ E;  5E7N A;  5CGK A;  1IXR A;  3PO2 B;  4DPG A;  1H95 A;  4GN3 B;  3CRL C;  4FP5 D;  2PZU A;  2IHE A;  2J7Z A;  3T56 B;  1T5X D;  3IKJ A;  1NE3 A;  4V0B A;  1IL2 A;  1WTH A;  4JBK A;  1NBW A;  5C6A A;  3I56 A;  4GNX A;  4A3K G;  1EOT A;  1JT8 A;  1BNZ A;  3DWP A;  2Z1C A;  2JA9 A;  2MO0 A;  3CMA A;  1JB3 A;  1PTO F;  4OL7 A;  1D5Z C;  3Q23 A;  1SYD A;  3HOU G;  1I50 H;  4Q5V A;  1PH1 A;  4KD3 A;  2R7Z H;  1XPR A;  3KBG A;  3NTI A;  1PVO A;  2KEE A;  1R4P B;  2HCC A;  2EYM A;  1C7Y A;  2K32 A;  3M9B A;  2KEC A;  4FF1 A;  2F0O A;  1SE8 A;  5E4X A;  2F0M A;  1HZB A;  2B2V C;  3ERO A;  1P16 A;  1HUM A;  3R3O A;  4F88 A;  3I55 A;  2ZM6 L;  4DV7 L;  3K7A H;  3I70 A;  4IFD G;  4DN4 M;  4OXP A;  1T9H A;  2ZTC A;  1CKM A;  2VW9 A;  1W3S A;  3F2D A;  5ELF A;  1V8Q A;  1VQ4 A;  3VR2 A;  2UXD Q;  2L9H A;  3OHX C;  3IFT A;  4G4K A;  4JI2 L;  2RA4 A;  1GHJ A;  3LWE A;  3HOV G;  2F4I A;  3DEP A;  1QVF A;  4A3I B;  3TRZ A;  4R8N A;  3GTQ H;  3AQQ A;  3J81 E;  2AWN A;  3BVG A;  2XSC A;  4I65 A;  1H9R A;  1PYW D;  3GTJ B;  3RZD H;  3P20 A;  1KAA A;  2Y0S E;  3BZD B;  4A3F B;  1TS5 A;  3CQZ H;  1YJ9 A;  1O7Z A;  4RHS A;  1BBU A;  3M4O B;  2L0C A;  2L5T A;  2ALY B;  3MXP A;  1QB5 D;  2O2L D;  2XWJ B;  4RFB A;  3GTJ H;  1BQQ T;  4PV1 C;  3A56 A;  5A2Q E;  2Q2T A;  1IZ6 A;  1SFO H;  3TN2 A;  1HTP A;  1TWF H;  2D0P A;  2SNS A;  4C3I B;  1W2B A;  2FFK B;  3LGJ A;  1SE2 A;  2MGS A;  4I7A A;  1RL2 A;  2RCN A;  4DAM A;  1K0R A;  1RDP D;  1YI2 A;  2PQA A;  4JYA Q;  1I94 L;  3OPO A;  1EY5 A;  1ESF A;  4XYQ A;  2PYK A;  3J7Y W;  4JYA L;  1XTC D;  2YYZ A;  3K5M A;  3HOU H;  5C0X H;  1VQJ A;  4GZY C;  4G7O C;  4DNR B;  5IP7 G;  2Y0S G;  3S2D H;  1EQQ A;  1X9N A;  3GTK H;  4LK1 C;  2KED A;  3GTL B;  2JA6 B;  4B9W A;  3ER0 A;  3V96 A;  3HOU B;  5C4H A;  3A55 A;  2KUM A;  2DN8 A;  4CKC A;  3MEH A;  1STH A;  3A8K E;  4LF8 Q;  4PNY A;  1TWH B;  2R93 G;  3FHW A;  1EYA A;  2A69 C;  2CQO A;  1QG7 A;  3AYH B;  4B3R L;  3KLS X;  2FJ2 A;  1F9R A;  2JA6 H;  3PQI A;  2P5Z X;  2RKS A;  1EYC A;  5J3B A;  5HY6 A;  4B3S L;  1G91 A;  2K5D A;  4XT3 B;  3S2H H;  3PO2 G;  1X6O A;  1CT1 D;  1PYS B;  3FDT A;  3RLF A;  1D8L A;  1G51 A;  1LT5 D;  1TWF B;  3PUY A;  1JMC A;  3U4V A;  3CW2 C;  5ELC A;  1LTT D;  2E5L L;  4PZ7 A;  3T13 A;  1Q7Y C;  4DV1 L;  1A6X A;  1MHW C;  1N8R C;  4IPH A;  4FF2 A;  4PZ6 A;  3URY A;  1RHP A;  1PA6 A;  3JAM E;  2Q2U A;  2XTI A;  2F0W A;  3S1R H;  3MXN A;  5FO8 B;  1HR0 W;  1KAW A;  4L5T A;  4S3S A;  1B9M A;  4DAP A;  4BBR H;  4FYD A;  3UDX A;  1KTK A;  5AFW A;  3PUX A;  3H3V H;  4GLA C;  4OEM B;  5CV8 A;  4OWX B;  3S2D B;  1STE A;  4XQN A;  1N32 L;  2MP1 A;  1PRT F;  2PQA B;  4X62 Q;  3PMF A;  4HSP A;  1L0Y B;  3SK5 A;  1JOO A;  2IHF A;  2QKI C;  1II3 A;  3EBE A;  1I5F A;  3A8J E;  1JC7 A;  4DGZ A;  1EIY B;  4FVM A;  2VQF L;  1S5F D;  4KHP L;  1XNR Q;  4OX9 L;  3SK6 A;  2WB1 B;  1PH7 A;  2F0D A;  1LAC A;  4OIJ A;  3CCL A;  4XQQ A;  3NBH B;  4Y52 H;  1LO5 D;  3VA7 A;  4O0A A;  1KNE A;  2IJ0 A;  1B8A A;  1IYV A;  5IYC H;  5CBE E;  5KGU A;  4B3R Q;  1B53 A;  1DJR D;  4JCV E;  3CC4 A;  3HOW H;  1BVS A;  2M9V A;  1VMC A;  4CJ2 C;  3I73 A;  2K5V A;  1I4R A;  1FVI A;  4ME3 A;  5DEH A;  3GTP H;  2E2H B;  3S24 A;  1KNA A;  3PV0 A;  5EBC A;  4CJ0 B;  3CRK C;  4DV1 Q;  4GN5 A;  1R4Q B;  1XX8 A;  3ONA B;  2F03 A;  4C3H B;  1CI3 M;  2NTS A;  4A3B G;  1VF5 C;  4AYB B;  5IT9 c;  4A3J G;  3TP7 A;  4HID A;  3GTM H;  3S17 H;  4A3B H;  4JI2 Q;  1JQY D;  3TP8 A;  1G2S A;  4A3E B;  4XXE A;  1OTC A;  1RCV D;  4MZ9 A;  3HOX B;  1WTQ A;  2WAQ B;  2B8G A;  4EQN A;  3PGZ A;  4IFD J;  1QUQ A;  3MVV A;  4LNQ A;  4A3B B;  3GTM B;  4LF9 L;  1PTO C;  1UAP A;  2Q2H A;  5IYB G;  3DWQ A;  1STA A;  2C9O A;  4JI6 Q;  5CV7 A;  3NBI A;  1TWC H;  3PCO B;  1L1O A;  4ILW A;  2R7Z B;  2PNR C;  2PMZ E;  5C44 H;  1ESR A;  1LTG D;  2CWA A;  5JJZ A;  1HCZ A;  1KDA A;  3TSS A;  2AQ2 B;  1ENC A;  2VUM G;  2WV6 D;  3OW2 A;  1Z9F A;  4KLK A;  5C0X I;  5AJ3 L;  3NSW A;  3PIP 3;  1CFM A;  2KCM A;  2K4K A;  3C1F A;  1PH6 A;  1KDB A;  4LWC A;  4HJA A;  5DLQ E;  2O5I C;  1EFW A;  4JI3 L;  1VQ5 A;  1QNK A;  2NVQ H;  2VNU D;  1EU3 A;  1EQV A;  5DM6 3;  4K0K L;  3AFQ A;  2EJM A;  1MSG A;  3NK9 A;  1C0A A;  5FLM G;  3HOX H;  3EJI A;  1EWH A;  1SNM A;  1K3R A;  4RCN A;  1VQ8 A;  3CKI B;  4DU9 A;  1WTX A;  3OYY A;  3KF6 A;  2ENB A;  4KV6 A;  4TQU S;  4P74 A;  5ELO A;  3S1R B;  1U4M A;  4CGY B;  5IYD G;  1J9O A;  1VQB A;  2R7F A;  3RN5 A;  1VQE A;  2MJ8 A;  3S1M B;  1SBB B;  2A6H D;  3OTO L;  4A3D B;  3LWU A;  4JV5 L;  2G5D A;  1KHI A;  1XNQ L;  4IOC A;  1G6P A;  3PIO 3;  3SDZ A;  4IPG A;  4QMG A;  1ZKO A;  4TSS A;  3S1M H;  1SRO A;  2B8F A;  3U9S A;  1V43 A;  1I6V C;  4DFA A;  1I4X A;  2PNH A;  5HGT A;  1J5E Q;  1EOV A;  3I7F A;  1P8L A;  5BR8 L;  2JA6 G;  2WKD A;  1HNX Q;  4R4I A;  4K0K Q;  4RMF A;  3QIA A;  2B2Y C;  3K5O A;  2JYO A;  5C4J B;  3D6W A;  4FXK C;  4JI8 Q;  2XIW A;  4ULL A;  5ISR A;  1VQD A;  1Y8O B;  5JPN C;  4A3G G;  4JPB W;  3HEJ A;  3F2B A;  1LAB A;  4JI8 L;  3EQL C;  5BN4 A;  4QJF A;  3MA2 B;  3BZK A;  3K80 C;  1LTA D;  2PMZ B;  5C4X G;  1SN8 A;  1EY7 A;  2UU9 L;  2K1B A;  4TRD A;  3D4R A;  1N33 L;  3KF6 B;  4LUV A;  3HS0 C;  3J80 E;  1SYF A;  4PZ8 A;  4C3I G;  1IBL L;  3W2D A;  1T5E A;  1U4R A;  3J80 L;  4P75 A;  5HGQ A;  2HDM A;  4GLV B;  2HQL A;  3MWY W;  3ULJ A;  4CDD C;  1NY4 A;  2N3S A;  4JI7 L;  3AMU A;  4DV4 Q;  1I4Q A;  5KNC A;  4I7Z C;  4ZCK A;  4HR7 B;  4A3F G;  1A62 A;  2J0T D;  1CKO A;  2RDG A;  4LF5 L;  1SR3 A;  5KIX A;  4A3F H;  5FLX E;  2KCC A;  2DUD A;  5FLX L;  1SNC A;  1EQT A;  1N32 Q;  3OWF A;  2PQE A;  2KCT A;  4QCL A;  2F0S A;  4NXM L;  4KKT A;  2LXK A;  4DR5 Q;  3I4N B;  4NXN L;  4L5Q A;  3KJO A;  1K73 C;  2JEA I;  2EPB A;  1PZJ D;  1EYD A;  2CFM A;  3QR8 A;  3EIV A;  3WDN A;  1WTV A;  2EYJ A;  4LF9 Q;  4JI0 Q;  2X6L A;  4X65 L;  5IY0 A;  2K01 A;  1LLR D;  4PMC A;  4A3M H;  3S1Q B;  2YTV A;  3O13 A;  3TRE A;  1X32 A;  3A7A B;  4IPC A;  2R7D A;  4LFC L;  1EYG A;  2L15 A;  1SJE D;  1JE4 A;  4CKB A;  4NP5 A;  2NB0 A;  3HFZ B;  1HZ9 A;  1N33 Q;  2ZJR A;  2B29 A;  4DK3 C;  2VQE Q;  2ICI A;  4CHT B;  1DYQ A;  3CHB D;  4Z9C B;  1B7Y B;  4HSV A;  2JN4 A; 
#chains in the Genus database with same CATH homology
 1F2Z A;  2QIL A;  5M9O A;  5HUR A;  2SDF A;  3DHQ A;  3RZD B;  4BA2 I;  3IFD A;  4QIW B;  2F0H A;  2EDG A;  1D6E C;  1IW7 C;  5DNF A;  3W3A A;  3L3O C;  2ZXR A;  2B2U A;  4H0L C;  5COY A;  1Z6H A;  2EYO A;  3E5S A;  3EFX D;  3DEO A;  3HP3 A;  3K5L A;  2B2T A;  2JXM B;  1TS3 A;  2L12 A;  1JWM D;  4IFD I;  2LS0 1;  1SAP A;  1M8A A;  1MI2 A;  5JPM C;  3VYS A;  4DF7 A;  1BCP C;  5CBA E;  1HFN A;  3BS1 A;  2J4X A;  5ELE A;  1S4Z A;  2F0L A;  1Q1B A;  3P1H A;  1Y1W B;  5C0X G;  3F2U A;  3QB3 A;  1XYI A;  1GUW A;  1TT2 A;  1EZ8 A;  4HN7 A;  3J7A V;  4MN3 A;  1HA5 A;  5FK9 C;  4X3S A;  1ILQ A;  2Z4I A;  4JBW A;  1IYU A;  2KA7 A;  4HCS A;  3D4W A;  2LMC B;  1O7L A;  3E0J A;  1EY0 A;  1U4L A;  4HCE A;  1SYB A;  1CTM A;  2A6E D;  5EKL A;  3QWN A;  1QE6 A;  3PUV A;  2R6G A;  1BCP B;  3QOL A;  4ZLT F;  2G9D A;  5D14 A;  3RZO B;  1KLG D;  1PXU A;  1EEI D;  4IUV A;  1BUV T;  5CMD A;  2OXP A;  2FIN B;  4IUR A;  2BA1 A;  3CQZ B;  1PTO H;  2IW3 A;  1ET6 A;  3P75 A;  4K5W A;  2XN9 C;  1Q8I A;  2F0E A;  5IOC A;  1EY9 A;  3Q22 A;  1SSO A;  4BY7 B;  1JWU D;  4U68 A;  4L8J A;  2JA5 B;  3M3Y B;  1V1P A;  4RA8 A;  4EQP A;  4RGO S;  2NVT B;  3QO2 A;  3L7Z C;  2OEO A;  1WVL A;  1E2Z A;  2PO4 A;  1JCK B;  1D2B A;  2O4X A;  5JAV A;  2EY2 A;  4KJO A;  5A35 A;  2L4N A;  3BYY B;  2EXZ A;  2HUG A;  4A93 B;  3MXU A;  4LAA A;  1QIL A;  2F1M A;  4O42 A;  1WTW A;  3NHH A;  3OOC A;  5C4X B;  1SND A;  3OIP A;  1X3Q A;  3TZD A;  4ZK9 B;  3GTK B;  3S16 B;  1H9M A;  1DOL A;  4A3G B;  1X3P A;  4OO1 H;  1OXX K;  3WOF A;  3J7A F;  3K6O A;  1GXD C;  2EY5 A;  4MIU A;  4OO1 G;  4FXD A;  3SEB A;  1SFO B;  2ZXO A;  5CV9 A;  1SXT A;  1HQM C;  2KOL A;  3R2I A;  3VR4 A;  4TKO B;  2CW0 D;  3FEW X;  3T53 B;  2F0N A;  4NMZ A;  2RDH A;  4BA1 I;  2A68 C;  3SE0 A;  1A15 A;  1ENA A;  1WD0 A;  3HGB A;  3BVZ A;  1EY4 A;  1C48 A;  2F0J A;  2HCI A;  3HRZ C;  4HMI A;  4WFN 3;  1HRJ A;  4ABN A;  1EIH A;  1PFN A;  3OMC A;  4K6D A;  2DY7 A;  1ENF A;  5M5Y B;  3GTQ B;  1Q90 A;  5IT9 E;  1LTI D;  1PZK D;  3X3M A;  1F2M A;  3T4A C;  4C3J G;  1AFP A;  3IL8 A;  3UI2 A;  5M5X B;  2WII B;  2H4O A;  5I9P A;  2BE5 C;  3MZ5 A;  4KJN A;  1STG A;  4XT1 B;  2D62 A;  2K03 A;  3OIQ A;  1NUC A;  3QG1 A;  1FYC A;  1JOK A;  1ONL A;  1ICW A;  1SNO A;  5CC4 A;  5K5P A;  5C0X J;  1B1Z A;  4UDU C;  4L63 B;  2R93 B;  5NUC A;  2X69 A;  3JAM L;  1BXT A;  2F0Q A;  1CA5 A;  5A2Q L;  4F87 A;  4OIK A;  1S5B D;  2QF7 A;  3EA6 A;  3S2H B;  2AUJ D;  5K36 G;  1HPC A;  2NN6 G;  4K14 A;  4KY7 A;  4KN7 C;  4H13 C;  4K5X A;  2EJF C;  2KHS A;  3TP5 A;  2TSS A;  2B2W A;  1OXT A;  1AZP A;  2E2J B;  4FF4 A;  2AWO A;  3VYU A;  1A2T A;  1SNP A;  1OXS C;  1BOS A;  2BOS A;  4HTH A;  3I90 A;  1SYE A;  1HFG A;  3I4L A;  1EU4 A;  1UEA B;  1C4Q A;  3H91 A;  5FOB B;  2F3W A;  3A54 A;  1FR3 A;  1H9S B;  3NBH A;  4KK7 A;  1VMP A;  4RGM A;  1B3A A;  3GV6 A;  1PFM A;  2SEB D;  3NTK A;  4KY5 A;  1STY A;  5G3L F;  4EVO A;  5ELB A;  5IOD A;  3H94 A;  4C1N K;  3C46 A;  2K5W A;  3D4D A;  2A74 C;  4KHV A;  1CM9 A;  1K8M A;  2ZXP A;  1A3T A;  1I4G A;  4K8J A;  2QCP X;  4A3K B;  5I4D A;  4H7B A;  3NE5 B;  2WAC A;  1UNS A;  3BVM A;  4M8A A;  1YNN D;  2CHB D;  1PRT B;  2K05 A;  2KVM A;  1DCZ A;  1Z7T A;  2B39 A;  1K8O A;  4XYO A;  3KLS A;  1EFI D;  2HQE A;  2K28 A;  3KBX A;  3Q0A A;  1TS2 A;  4X3T A;  4ODG A;  1R9T B;  1E2V A;  2XWB B;  3KF8 A;  2V4D A;  2L55 A;  1IHZ A;  1PLF A;  1Y8N B;  3GQB A;  5COR A;  4UAI A;  1JOR A;  4ID6 A;  5C44 B;  4R8I A;  2CVR A;  3HKZ B;  5T1G A;  4OGQ C;  4H44 C;  1LTS D;  3GP7 A;  1Q1E A;  2Y0S B;  4BWG B;  1D1I A;  5C4Z A;  1M4V A;  4G7H C;  3ND8 A;  3WOE A;  1G6Z A;  1S5D D;  1PZI D;  2OF1 A;  4L6T B;  2L11 A;  3S15 B;  4ZQ3 A;  4OHJ A;  1RD9 D;  2GA4 B;  3C1E A;  4E6I A;  5EKI A;  3KK7 A;  2Z4H A;  3I8Z A;  1OXV A;  5I2Y A;  1PRT C;  2EE1 A;  3MTS A;  5J39 A;  3FPU B;  4A3M B;  2Z8L A;  5KRU A;  4CKE A;  1VCI A;  1SE4 A;  2K33 A;  2RQX A;  3SK8 A;  3ITP A;  3X3N A;  3K57 A;  2M00 A;  2D9U A;  2F0U A;  1A3U A;  1SNQ A;  1SJH D;  1XXG A;  5FKA C;  2JA7 B;  2WP8 J;  3H09 A;  5JEA J;  3GTP B;  1EL0 A;  2PZT A;  1OXU A;  1DOK A;  5LL6 X;  4K6L A;  1BR9 A;  4RGT A;  2RDF A;  3M7G A;  2NVY B;  4B08 A;  1F77 A;  2OT2 A;  1GUG A;  3DWA A;  3PUW A;  4ZYS A;  2NN6 H;  1ML0 D;  2E75 C;  1CHQ D;  3NPP A;  3A7L A;  5LL6 S;  4KKU A;  3K59 A;  2NZ1 D;  5KND A;  2YU9 B;  3E6Z X;  1CZW A;  1F9S A;  1PDQ A;  1ZEQ X;  2F0T A;  1MSH A;  1GUS A;  5CV6 A;  3R8B A;  1HA6 A;  2R92 B;  2HDL A;  4M1U B;  1LTB D;  4BBR B;  1GOZ A;  2A73 B;  1B4O A;  4ZUI A;  2EYP A;  4XDX A;  3GTO B;  1TR5 A;  1NR2 A;  1TWC B;  4P2C B;  2X6G A;  1IKM A;  5LHY 1;  2PPB C;  3HOZ B;  1UUP A;  3U9O A;  2ICE C;  1U4P A;  3FVQ A;  4IN3 A;  2O5J C;  4C1N I;  5IT9 L;  3R93 A;  2B2V A;  3NQT A;  3VR3 A;  3QJY A;  1NCV A;  2WKC A;  5M3M B;  1AW7 A;  3DM1 A;  2XRQ D;  1I4H A;  2BCO A;  4RAU C;  2R3Z A;  1ZXT A;  3S9W A;  2MPM A;  1DD2 A;  2JSO A;  1FNW A;  2IX3 A;  1SMY C;  4Y7N B;  1TWG B;  2NYZ D;  1YNJ D;  4OO1 I;  4G57 A;  1TQO A;  5C5L A;  4XQJ A;  1SYC A;  1I50 B;  4R9W A;  5FO9 B;  1CHP D;  2IPK D;  1SDF A;  2F0P A;  4IQZ A;  5CV4 A;  1DZ1 A;  1ZYR D;  2QDB A;  3SR1 A;  2K04 A;  2DNC A;  5FO7 B;  1ET9 A;  2B2W C;  3IAY A;  1G29 1;  4FO2 A;  3C2P A;  3H0G B;  4ZAI A;  5I9O A;  1BO0 A;  2EZV A;  4V19 0;  2FMM A;  5IGE A;  5C3X A;  4HMJ A;  1VF7 A;  1XWE A;  1CQF A;  2CW0 C;  2FHT A;  1WTP A;  1NSN S;  4KY6 A;  4J8Q A;  5JEA G;  2RBM A;  4A3J B;  2JP1 A;  4C3H G;  4KD4 A;  4HED A;  3N52 A;  1JIC A;  3MC0 B;  2G9H D;  4BY1 B;  4FXG C;  4RKL A;  1LT4 D;  4NDX A;  3NWS A;  4KHZ A;  5EPJ A;  3SHL A;  3S14 B;  2JEB I;  4X3K A;  5EGT A;  1JR0 D;  4DXF A;  2AQ1 B;  3HOY B;  2AUK A;  2F0G A;  2NVX B;  1I3Q B;  1O7Y A;  5D3I B;  4U67 3;  2XVS A;  2ID0 A;  1QWY A;  5CV5 A;  4CBV A;  2LY7 A;  4C56 C;  3OW7 A;  2NN6 I;  1BF4 A;  1TY2 A;  1QCB D;  5IGB A;  2F0I A;  3K7A B;  5C5M A;  3NP8 A;  4XTC S;  3K58 A;  4F7X A;  4X3U A;  3NQI A;  1Q12 A;  4C3J B;  2D2C C;  5I6W A;  5C3W A;  2DNE A;  1I4P A;  3D31 A;  4BBS B;  1NR4 A;  2PW5 A;  1D5X C;  1ZYR C;  1GUT A;  3TBI B;  4RKB A;  1BCP F;  1WD1 A;  5K36 H;  1DXM A;  2PZW A;  5E1F A;  4FF3 A;  3LNN A;  1TKW B;  4IUQ A;  3BYT B;  2A6E C;  2IL8 A;  3TP6 A;  2B63 B;  1YNJ C;  4K2K A;  2JA8 B;  1WTO A;  1TII D;  3RD4 A;  2AQ3 B;  1C8C A;  1BBX C;  1SMY D;  4DNT B;  4ME5 A;  1TVX A;  4RHR A;  2IX0 A;  1PMR A;  1GJX A;  3ERQ A;  1STB A;  2EYL A;  3M85 A;  5E3F A;  4B9X A;  1RKN A;  1KLU D;  1MD2 D;  4F8M A;  1EWC A;  2B2U C;  2TMP A;  4KMU C;  1LT6 D;  5IGD A;  3VYT A;  2EVB A;  4RWS C;  2MUY A;  2F0V A;  1A3V A;  1ILP A;  1HHV A;  4IUN A;  3VYR A;  3AU7 A;  4DK1 A;  2WIN B;  5EQ0 A;  2LKV A;  4IAL A;  2A5H A;  3J81 L;  1BCP D;  1RF2 D;  5IGG A;  1RTN A;  3A8I E;  3SVM A;  3EVQ A;  3G7L A;  3T51 B;  4EGV A;  1H9K A;  1AEX A;  5CYU A;  2NUC A;  2SOB A;  3FPP A;  3KLR A;  1Z47 A;  1EIG A;  1EY6 A;  3HOW B;  3P7J A;  3BDO A;  1F9P A;  1IW7 D;  5EPK A;  2LFN A;  4G7Z C;  1FNU A;  2BA0 A;  5T1I A;  1A2U A;  1AN8 A;  4DA2 A;  3HG9 A;  3AB9 A;  1L0X B;  3OMG A;  1GUN A;  4WRD A;  3QOJ A;  1HXY D;  2DY8 A;  4K5V A;  1F2L A;  2B2Y A;  4BS9 A;  3GTG B;  3L9A X;  2EYH A;  3H3V C;  4QB4 A;  4EQO A;  4MHE A;  5ELD A;  1CZG A;  1OO9 B;  1B2T A;  2NTT A;  1IL8 A;  2F0F A;  1G2T A;  2L1B A;  5KYI A;  1E0B A;  3TZU A;  4ZKC B;  3SK4 A;  1DON A;  1EZ6 A;  1EEF D;  1TWA B;  3KUP A;  5TSS A;  4K8I A;  1H9S A;  1PRT D;  5JEA H;  4IUU A;  1Q3L A;  2Q8R E;  2E2I B;  2K6A A;  2QEJ C;  1HQR D;  4NKL A;  3I3C A;  1CA6 A;  1LT3 D;  4WOR A;  5EPL A;  5BN3 A;  1QOH A;  1B50 A;  1TY0 A;  1G8Z D;  3C3L A;  2F0K A;  3HOV B;  3FRP B;  4DAV A;  4IUT A;  3I72 A;  1NAP A;  1PTO B;  1V1O A;  3OSO A;  5J22 A;  3MXG A;  1FGB D;  4ZKB B;  1J8I A;  3K5N A;  2A6H C;  3GD7 A;  4DK0 A;  2KQ3 A;  2ZT9 C;  1S5E D;  1FNV A;  1F9Q A;  3BDL A;  3VR5 A;  1U9R A;  3TME A;  2JE6 I;  4K2L A;  1YNN C;  4XIG S;  2C5C A;  3G6J B;  5JVH 3;  5D65 A;  4QF4 A;  5I6Y A;  2E2D C;  5BN5 A;  3ND9 A;  3SXH A;  2EY6 A;  1S5C D;  2NBF A;  1F2Y A;  5E4W C;  1RJT A;  3D8G A;  3MFY A;  4PMW A;  5I2X A;  4KKS A;  3NTH A;  1WTR A;  5C3E B;  2EY1 A;  2VB3 X;  4PQX A;  2N88 A;  5KEE A;  3V05 A;  1PFB A;  1E2W A;  3Q6S A;  4RH6 A;  3M7N A;  4KTA A;  3VR6 A;  1KAB A;  3D3R A;  3HZX A;  4IFD H;  1Y1V B;  4JK1 C;  4J1M A;  1LTR D;  3S1N B;  1GUO A;  5F2D A;  3TDQ A;  4KI0 A;  1HUN A;  1JOQ A;  1V1P B;  3OWE B;  2B2T C;  3T16 A;  2FMC A;  2SNM A;  2IWH A;  1VDZ A;  5KNB A;  1PTO D;  3K0Y A;  3BDC A;  3NWT A;  4N9T A;  1K83 B;  1IKL A;  1Y8P B;  1EY8 A;  1AP0 A;  3VA5 A;  1LV9 A;  3BG3 A;  2IT1 A;  4PMB A;  2MHV A;  2EJG C;  5EJW A;  3DXJ C;  5DM7 3;  2XNA C;  5KYL A;  2N55 A;  2NVQ B;  1AZQ A;  1KDC A;  4O1N A;  2K5Q A;  3MAQ A;  3I91 A;  5EBD A;  4LJZ C;  5M5W B;  1DOM A;  4RGN A;  1D5M C;  5IGC A;  1I6H B;  4QUC A;  4LMQ D;  3N6R A;  3CU7 A;  4QUF A;  2KJX A;  3MHB A;  3M4Y A;  5J1Z A;  5M3F B;  1DM0 B;  4ZRZ A;  2EYF A;  4RCO A;  2F3V A;  3LX0 A;  2I46 A;  5IGF A;  1TU2 B;  3S17 B;  4YIJ A;  2BE5 D;  3H6M A;  2K7V A;  2EOT A;  3MFG A;  3GO5 A;  1B9N A;  5JOB A;  3NXW A;  3DMU A;  4IZ8 A;  1B44 D;  1ROD A;  1CQV A;  2BDN A;  4ZUJ A;  2KCN A;  1H9J A;  4HAE A;  1D1K A;  4C2M B;  4N9P A;  2VUM B;  2I07 B;  5DAU A;  3Q24 A;  2PW7 A;  4J6H A;  1GHK A;  1QNU A;  3FKI B;  4KN4 C;  5IIF A;  2Q8I B;  2A68 D;  1W6K A;  3FMC A;  2A69 D;  4IUP A;  3V2T A;  1CK1 A;  1RTO A;  2H1E A;  1STN A;  5D3D A;  1MGS A;  1SYG A;  1BDO A;  3ZYY X;  5EKK A;  4FNF A;  3RUZ A;  1W6J A;  1WCM B;  1Y69 U;  3D6C A;  4DXG A;  3R2T A;  1O80 A;  2NWG A;  2VB2 X;  1SEB D;  2E76 C;  1FD7 D;  2RSN A;  3GV3 A;  4NW2 A;  4Q0F A;  2R61 A;  2E74 C;  1MBY A;  2M2L A;  3DUZ A;  2RVL A;  3RMH A;  2XRS D;  3NUC A;  1O78 A;  5CR3 A;  2BDO A;  2VXW A;  2CQA A;  1HTL D;  2Q8T A;  5G3L D;  2RSO A;  4DAY A;  3PO3 B;  5JVG 3;  1QJO A;  1SE3 A;  3PUZ A;  4CJ1 B;  4WJW A;  3I4M B;  1TS4 A;  1JWS D;  2D5D A;  2PCF B;  2IX1 A;  5CGK A;  3PO2 B;  3CRL C;  4FP5 D;  2PZU A;  2J7Z A;  3T56 B;  1T5X D;  3IKJ A;  4V0B A;  5C6A A;  1EOT A;  1BNZ A;  3DWP A;  2Z1C A;  1JB3 A;  1PTO F;  4OL7 A;  1D5Z C;  3Q23 A;  1SYD A;  4Q5V A;  4KD3 A;  3KBG A;  3NTI A;  2KEE A;  1R4P B;  2HCC A;  2EYM A;  2K32 A;  2KEC A;  4FF1 A;  2F0O A;  5E4X A;  2F0M A;  2B2V C;  3ERO A;  3R3O A;  1HUM A;  4F88 A;  3I70 A;  4IFD G;  4DN4 M;  5ELF A;  1V8Q A;  3VR2 A;  2L9H A;  3OHX C;  3IFT A;  4G4K A;  2RA4 A;  1GHJ A;  3LWE A;  2F4I A;  3DEP A;  4A3I B;  4R8N A;  3J81 E;  2AWN A;  3BVG A;  2XSC A;  4I65 A;  1H9R A;  1PYW D;  3GTJ B;  3P20 A;  1KAA A;  3BZD B;  4A3F B;  1TS5 A;  1O7Z A;  4RHS A;  3M4O B;  2L0C A;  2L5T A;  3MXP A;  1QB5 D;  2O2L D;  2XWJ B;  4RFB A;  1BQQ T;  4PV1 C;  3A56 A;  5A2Q E;  3TN2 A;  1HTP A;  2SNS A;  4C3I B;  2FFK B;  1SE2 A;  2MGS A;  1RDP D;  3OPO A;  1EY5 A;  1ESF A;  4XYQ A;  2PYK A;  3J7Y W;  1XTC D;  2YYZ A;  3K5M A;  5C0X H;  4GZY C;  4G7O C;  4DNR B;  4LK1 C;  2KED A;  3GTL B;  2JA6 B;  4B9W A;  3V96 A;  3HOU B;  5C4H A;  3A55 A;  2KUM A;  2DN8 A;  4CKC A;  3MEH A;  1STH A;  3A8K E;  4PNY A;  1TWH B;  1EYA A;  2A69 C;  1QG7 A;  3KLS X;  2FJ2 A;  1F9R A;  2RKS A;  1EYC A;  1G91 A;  2K5D A;  4XT3 B;  1CT1 D;  3FDT A;  3RLF A;  1LT5 D;  1TWF B;  3PUY A;  5ELC A;  1LTT D;  3T13 A;  1A6X A;  4FF2 A;  3URY A;  1RHP A;  3JAM E;  2F0W A;  3MXN A;  5FO8 B;  4S3S A;  1B9M A;  4DAP A;  4FYD A;  1KTK A;  5AFW A;  3PUX A;  5CV8 A;  3S2D B;  1STE A;  4XQN A;  2MP1 A;  1PRT F;  3PMF A;  4HSP A;  1L0Y B;  3SK5 A;  1JOO A;  2QKI C;  1II3 A;  3A8J E;  1JC7 A;  4DGZ A;  4FVM A;  1S5F D;  3SK6 A;  2WB1 B;  2F0D A;  1LAC A;  4OIJ A;  4XQQ A;  1LO5 D;  3VA7 A;  1KNE A;  2IJ0 A;  1IYV A;  5CBE E;  5KGU A;  1B53 A;  1DJR D;  2M9V A;  1VMC A;  4CJ2 C;  3I73 A;  1I4R A;  5DEH A;  2E2H B;  1KNA A;  3PV0 A;  5EBC A;  4CJ0 B;  3CRK C;  1R4Q B;  1XX8 A;  3ONA B;  2F03 A;  4C3H B;  1CI3 M;  2NTS A;  1VF5 C;  4AYB B;  3TP7 A;  1JQY D;  3TP8 A;  1G2S A;  4A3E B;  4XXE A;  1RCV D;  3HOX B;  1WTQ A;  2WAQ B;  2B8G A;  4EQN A;  4IFD J;  3MVV A;  4A3B B;  3GTM B;  1PTO C;  1UAP A;  3DWQ A;  1STA A;  2C9O A;  5CV7 A;  3NBI A;  4ILW A;  2R7Z B;  2PNR C;  1ESR A;  1LTG D;  5JJZ A;  1HCZ A;  1KDA A;  3TSS A;  2AQ2 B;  1ENC A;  2WV6 D;  5C0X I;  3PIP 3;  3NSW A;  1CFM A;  3C1F A;  1KDB A;  2O5I C;  1QNK A;  2VNU D;  1EU3 A;  1EQV A;  5DM6 3;  2EJM A;  1MSG A;  3NK9 A;  3EJI A;  1EWH A;  1SNM A;  4RCN A;  3CKI B;  4DU9 A;  1WTX A;  2ENB A;  4KV6 A;  4TQU S;  3S1R B;  1U4M A;  4CGY B;  1J9O A;  2MJ8 A;  3S1M B;  1SBB B;  2A6H D;  4A3D B;  3LWU A;  3PIO 3;  3SDZ A;  4QMG A;  1ZKO A;  4TSS A;  2B8F A;  3U9S A;  1V43 A;  1I6V C;  4DFA A;  1I4X A;  5HGT A;  2WKD A;  3QIA A;  2B2Y C;  3K5O A;  2JYO A;  5C4J B;  3D6W A;  4FXK C;  2XIW A;  4ULL A;  5ISR A;  1Y8O B;  5JPN C;  3HEJ A;  1LAB A;  3EQL C;  5BN4 A;  3MA2 B;  1LTA D;  2PMZ B;  1EY7 A;  2K1B A;  4TRD A;  3D4R A;  3HS0 C;  3J80 E;  1SYF A;  4C3I G;  3W2D A;  1T5E A;  1U4R A;  3J80 L;  2HDM A;  3AMU A;  3MWY W;  1I4Q A;  5KNC A;  4I7Z C;  4HR7 B;  2J0T D;  2RDG A;  5KIX A;  5FLX E;  2KCC A;  5FLX L;  1SNC A;  1EQT A;  3OWF A;  2PQE A;  4QCL A;  2F0S A;  4KKT A;  3I4N B;  2JEA I;  2EPB A;  1PZJ D;  1EYD A;  3WDN A;  1WTV A;  2EYJ A;  2X6L A;  2K01 A;  1LLR D;  4PMC A;  3S1Q B;  3O13 A;  1X32 A;  3A7A B;  1SJE D;  1JE4 A;  4CKB A;  4NP5 A;  2NB0 A;  2ICI A;  4CHT B;  1DYQ A;  3CHB D;  4Z9C B;  4HSV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...