5CC4A

Crystal structure of staphylococcal nuclease variant delta+phs t62e/v66e at cryogenic temperature
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFEKKMEENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS T62E/V66E at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 33
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5cc4A00
3MZ5A 4F7XA 2PZUA 3SK5A 3SK6A 1STAA 2F0DA 3ITPA 4NKLA 3T16A 1EY9A 2KQ3A 1A3VA 1SNDA 1SNCA 2F0MA 1STBA 1ENAA 3OSOA 2HQEA 1F2ZA 4HMJA 4HMIA 2PZTA 3EJIA 4KY5A 1KDCA 1STYA 5CV6A 2QDBA 4K6DA 3SHLA 4S3SA 1KDAA 1EY8A 2SNMA 1TR5A 3QOLA 3NXWA 2ENBA 3P75A 4J6HA 5KGUA 4RKBA 5EKLA 4IZ8A 4K8JA 4QF4A 5CV4A 1NSNS 5IGDA 2KHSA 2F0IA 4WORA 3NP8A 1STHA 3DMUA 4KY7A 3P1HA 3TP7A 1KABA 4K14A 3TP5A 5KIXA 5C5MA 1A3TA 4PNYA 1JOOA 4KV6A 2F0PA 1KAAA 2LKVA 3SK8A 4HTHA 4DGZA 3NUCA 3NK9A 4EQPA 4TRDA 2F0WA 5J39A 5C6AA 1SYGA 1SNMA 1JOQA 3QB3A 5J22A 4LAAA 4ZQ3A 1II3A 2F0EA 4K8IA 3D6CA 3H6MA 1TQOA 2F0GA 1STNA 1SNOA 5IOCA 1SYDA 5NUCA 4PMCA 1A2TA 2F0JA 4R8NA 4KJNA 4K5WA 1U9RA 5CV8A 4DU9A 5C4HA 1KDBA 1F2YA 4QMGA 3TP6A 3OMGA 4ODGA 2OF1A 3C1EA 4K5XA 5EKKA 3MEHA 5KYIA 5CR3A 3EVQA 3TP8A 5K5PA 3NQTA 3D4WA 4KY6A 4OL7A 2EY2A 2F0VA 3HEJA 5DEHA 5IGFA 4YIJA 4KHVA 1SNPA 4B9WA 2PZWA 3R3OA 3D8GA 5KRUA 5IGCA 4K2KA 4EVOA 5IODA 4DF7A 5ISRA 4ME5A 1JORA 5C4ZA 5CV7A 4EQOA 4ZUJA 4H7BA 4J1MA 2EYFA 1TT2A 3MHBA 4B9XA 2F0NA 4KJOA 5I6YA 5I9OA 1A2UA 3QOJA 1EY5A 1EZ6A 1EY7A 3D4DA 4NMZA 3SR1A 4E6IA 5C3WA 2EYLA 4ZUIA 2PW5A 2EY5A 5CGKA 5IGBA 5IIFA 3MVVA 1SNQA 4N9PA 4K2LA 2F0TA 2SOBA 4DFAA 1JOKA 1NUCA 1AEXA 2F0LA 2OXPA 3SK4A 2OEOA 1RKNA 5M9OA 1EY4A 2EYJA 4RKLA 2NUCA 3V2TA 1EY0A 1EY6A 3DHQA 2PYKA 2EYOA 1SYFA 4IALA 3LX0A 3VA5A 4F8MA 1EYAA 1SYBA 5IGGA 5KEEA 2O4XA 2SNSA 4QB4A 2RKSA 5F2DA 3BDCA 4K5VA 1IHZA 5C3XA 5CC4A 1F2MA 2EY1A 4ID6A 5KYLA 4IUNA 5DAUA 3OMCA 4KD4A 3T13A 3U9OA 5I9PA 5J1ZA 4KTAA 5JOBA 1ENCA 2EYMA 4NP5A 4WRDA 2EXZA 2WACA 4I65A 1EQVA 2F0HA 3PMFA 4NDXA 4KD3A 4EQNA 4N9TA 2F0OA 1SYCA 2EYHA 1A3UA 1STGA 3BDLA 3ERQA 3MXPA 2RDFA 3NHHA 4PMBA 3RUZA 2F0KA 2EY6A 3EROA 5I6WA 2PW7A 5HURA 3C1FA 5CV9A 3TMEA 5E3FA 1EZ8A 3OWFA 5C5LA 5E1FA 2EYPA 2F0QA 2M00A 3S9WA 2F0UA 2RBMA 4G57A 4MIUA 5EGTA 2F3VA 1EYDA 5JAVA 5HGTA 2F3WA 3HZXA 3SXHA 1EYCA 2F0SA 3E5SA 5IGEA 2F0FA 5CV5A 1SYEA 2PQEA
chains in the Genus database with same CATH superfamily
2NZ1D 2E8GA 1ICWA 2X6LA 2VUMH 3FP9A 1JJ2A 3VDYA 1K8AC 2XRSD 4GN3B 1YZ6A 2B2UA 1R4QB 1O80A 3EJIA 5CV6A 4FYDA 2F1MA 2SNMA 4A3KG 1SEBD 4GN4B 3H0GB 5FOBB 2BH2A 1TS4A 5C5MA 4H44C 3TZDA 4JBKA 3BZDB 4IPCA 1HNZL 1CT1D 4FF4A 1F2LA 4CGYB 2KA7A 3Q8DA 3FPPA 3TREA 1QUQA 4ULLA 3HOWB 4G7OC 1F9SA 2Q2HA 2K01A 4IOCA 2JA5H 4DV7L 3M4QA 1LT6D 1EIGA 2K03A 4IURA 2VY3A 1SNPA 2NB0A 2A6HD 2ICEC 1Q46A 1A8VA 2BOSA 2PI2E 3QWNA 4HSVA 4JI4Q 2PQAB 1ESFA 3MA2B 1TWGH 4G7HC 2AUJD 2JP1A 4K2LA 2ZJQA 4C1NK 4IUVA 1M90C 4BY7G 3CC7A 5IWAL 3IFDA 3HG9A 2Q8IB 3ER0A 1PA6A 5IGGA 2O4XA 1CTMA 4A3EB 3UI2A 1BR9A 2D62A 2F4VL 1WJJA 1SE8A 3U9OA 1HQMC 2JXMB 1JB7A 3L0OA 1VQ9A 4RH6A 1SN8A 1GUOA 2R3ZA 1Y69U 4PMBA 1Z47A 3EROA 1B53A 1D5ZC 5FJ8G 3TMEA 5M3MH 1PV4A 5C3EB 1WTXA 5E1FA 2EYPA 2JSOA 1WI5A 3A5ZB 4FP5D 4HJ9A 3I4NB 2A74C 4L8JA 2NVTH 1VQMA 4F7XA 4GLVB 3NE5B 4JI5Q 3J80E 1STBA 3CCLA 3LWEA 4BBRB 1X9NA 3NTKA 5IT9L 3KF6A 4RHRA 4K0KQ 2N8NA 2SDFA 2RSOA 5EKLA 4GKJQ 4JG2A 1GKHA 5CV4A 3M3YB 4WJ4A 2KHSA 2DN8A 2MP1A 1PH9A 3CKIB 1DCZA 5JEAH 1JOOA 4A3MH 1PTOD 3CQZB 1CM9A 1CKNA 1SNMA 1I6HB 4PG3A 2EJMA 2HHHQ 1X65A 1SNOA 1I50H 2HIVA 1CHPD 2XGTA 4K5WA 3HOUH 1PFSA 3FKIB 4QMGA 2UXCQ 3AFQA 2L55A 5FLXE 4PV1C 1L1OC 1C48A 1EEID 2KEDA 1XPOA 2WFWA 1H9SB 2IJ0A 3M4PA 4C3JB 1NBWA 2IHEA 1B3QA 1EY5A 1PH2A 3SR1A 2L4NA 3E9IA 2B63G 2FJ2A 3HOVB 1A0IA 1SNQA 3HKZB 1IYUA 1EWCA 3SGIA 1L1OB 2MPMA 1ET6A 1F9QA 2O5JC 1X3FA 2KVMA 1TVXA 2IT1A 4AQYQ 2K5HA 4A3IG 2A69C 1O7LA 4A3FB 3CCRA 2DNEA 1EEFD 4JI4L 1V1PB 4X64Q 5CC4A 3Q6SA 4LFBQ 2YYZA 1NY4A 4DR7Q 4OO1I 5T1GA 3TQYA 5ELFA 4A3LG 2PQAA 1YEZA 3ONAB 1CFMA 5I6WA 1TWCH 4FDBA 1C4QA 1FGUA 5JJZA 2K7VA 1XNQQ 1YNXA 1SAPA 1EYDA 3A54A 2F3VA 1SBBB 5EGTA 2JEAI 4LUVA 5IOCA 2MHVA 3J80c 2EIFA 3K59A 1HFNA 4C2MB 4IN3A 4BY7H 4F87A 2R7ZG 2MO1A 5G3LD 4A3JG 4CHTB 3PGZA 3PO3B 4G7ZC 5HGQA 3QR8A 2YU9B 4K8JA 4LF4L 1WCMG 1BO0A 1A63A 5AJ3L 5CORA 1PDQA 1AFPA 1I3QB 3SK8A 4IFDJ 3GTJB 2VW9A 1MKHA 1II3A 2F0GA 5FJ8H 1JT8A 1LO5D 4BY1G 5FLXc 2IPKD 5D3DA 1A2TA 1RF2D 3CU7A 4HIMA 1OXVA 3F8TA 1SE3A 3C1EA 4FO2A 5JJIA 3R8BA 3IKJA 1AE2A 3EVQA 3NPPA 3MWYW 4OL7A 3S24A 4KHVA 4JVZA 3F2UA 2FMMA 2Y0SG 4ZLTF 5C4JB 2JA8G 4LF6L 4NXMQ 1WYDA 4KKUA 5FK9C 2B2WC 4NMZA 4E6IA 1TXYA 2L5TA 1F9PA 1VS0A 2R93H 2AQ1B 2UXCL 3NENA 1CI3M 2PNRC 3SK4A 3CRKC 2EYJA 4DK0A 1W6KA 1E1TA 2EXDA 3RLNA 2ZJRA 1EY0A 2D2CC 4XIGS 4B3SQ 4OX9L 1XNRQ 3HKSA 1DOKA 2B2TA 4QB4A 5IE8A 3H3VC 1AZPA 3U9SA 4GLXA 1LLRD 3VYTA 4DV1Q 2WIIB 2KHJA 5T1IA 1RDPD 1RTOA 2F3IA 5L37A 1VF5C 3S1QH 1JE4A 3ICEA 4UY8C 2ZTEA 1STGA 1S40A 2F0KA 1CZWA 5C0XG 2PW7A 1K83B 2MO0A 1QZHA 2EPBA 4DV2L 2HQLA 3PV0A 3T4AC 1N33L 1BUVT 2WP8J 4JI8Q 2WB1B 2K5NA 2B63H 5CV5A 2EQSA 3X3MA 4DR7L 3MZ5A 3SK5A 4NB3A 3RNUA 1SMYD 1F77A 1PTOB 1SNCA 1WFQA 3MEFA 3KLRA 1HTLD 1V1PA 4HMJA 5IYCG 1KQSA 2PZTA 2QKIC 1ZYRC 2GA4B 2DJGC 2KENA 4R4IA 2JA5B 4A3IH 4GLAC 5EPJA 3AU7A 3H3VI 4QF4A 5DNFA 2NN6G 1S4ZA 2AMCB 5BN3A 4YHHQ 2L0CA 3IL8A 4P2CB 3BG3A 2I5MX 4B3ML 4O2DA 4C3IG 2ES2A 4DR5L 1JICA 4GS3A 4P71A 4DGZA 1TWGB 1YHAA 2R6GA 4EQPA 3OPOA 4A3GG 4A3LH 3AB9A 3I91A 3PIP3 1QJOA 1GVPA 4LFAQ 1EOTA 4UPAA 4R9WA 4ABNA 4A3DG 1CHQD 1W2BA 1AW7A 4DU9A 5K36G 4DR4L 3H09A 3URYA 4AH6A 2CWPA 2F52A 3MEHA 5C44G 5EPLA 4XXEA 4BA2I 4MN3A 4GNXB 1OXUA 3STBC 2CKZB 3K5MA 4EGVA 2OT2A 1XPUA 1UUPA 4IJHA 4JOIA 2R7ZH 1PZID 4HJ7A 3A56A 4A3JH 2AKWB 2QILA 1FVIA 3IFTA 5I9OA 4V0BA 1TS2A 3WOFA 3SVMA 4LF5L 5LHY1 1LV9A 1IBKQ 2F0TA 5M3MB 2K5VA 1AEXA 3I4MG 3UDXA 1EQQA 4DR3L 4LNQA 3CAMA 1N36L 4U673 4KHPL 1XMQQ 3OWEB 3CXCA 1XTCD 3EA6A 3K0XA 1HA5A 5CYUA 3J7A5 4NXML 5JJKA 1I4RA 2LS01 4HCSA 3S14H 4A3BG 1OTCA 3F2CA 2VQFL 4ME3A 4YWMA 2B2UC 3Q0AA 1C8CA 2GVBA 1HNXQ 1CK1A 3Q22A 1WOCA 1PTOF 2EYHA 3BU2A 1D1KA 2VUMG 4DUYQ 5HURA 4LJZC 2VL6A 2B2VA 2R61A 5C5LA 2JA8H 5IYBH 4A3MB 2UUBQ 2JEBI 3E5SA 4DV1L 3RZDH 3PF4A 1KL9A 1TWHH 1C9OA 2XN9C 3ULJA 1I50B 3WWVA 1ILQA 3HOUB 4HMIA 4JI7Q 3DUZA 4TQUS 2I5LX 3U58A 3BVZA 3HRZC 4JI6L 4X3TA 4FVMA 4CDDC 2FFKB 3P75A 1ENFA 4R8IA 3CCSA 2N55A 2DJFC 5FKAC 2XWBB 1VQGA 1MI2A 1RCVD 1SFOH 1GOZA 2KOLA 4XT3B 3J7AF 1KIXA 2L1BA 1K8GA 2D0OA 4H02A 4ZKCB 4A3KB 3BJUA 3L3OC 3RMHA 3D4RA 2BDOA 3VR5A 3JAME 4POGA 4TKOB 3PUYA 4X3UA 5C0XH 2VNUD 1HNZQ 3KYHC 4DAMA 1WTWA 4R8NA 3AQQA 4IOAA 1Y1VG 3M7NA 3M7GA 1CA6A 1GJXA 4AIMA 4ZK9B 2MJ8A 3NQTA 1CQFA 1AH9A 3L7ZC 3HKZE 4IPHA 1DYQA 3AFPA 4DV7Q 4N8X1 5KRUA 1VQHA 3PUVA 3I3CA 2N3SA 2OWOA 3KJOA 3A8JE 1EYGA 2PW5A 5M5WB 1FL0A 4MZ9A 1TWCB 3GP7A 1JE5A 5FO8B 4KKSA 1JR0D 1WTRA 4BA1I 4C3IH 3RR5A 5JPMC 3KJPA 5G3LF 5IWAQ 1NNXA 1WTOA 4YCWA 3T1HQ 1VDZA 4BY7B 1CKMA 4GNXA 4A3DH 5GQOA 4ID6A 5K36H 4DNTB 3J7YW 1NJIC 5DM73 3QIAA 2F4VQ 5C44H 2YTVA 1K9MC 4C56C 2YV5A 2IWHA 2CW0C 1SYCA 1SSOA 1CZGA 4LF9L 3MXGA 1U4PA 2F0QA 4NPSA 1K8MA 2CWAA 4GOPB 2M2LA 3GTPH 2XSCA 1PHJA 2J0TD 2PQEA 1GUSA 1J5EL 3I2ZA 2JE6I 2TSSA 3H91A 1VQOA 4QJFA 4JYAL 5M3FG 2ZT9C 2F0MA 1LACA 3LGJA 4ILWA 2QA4A 4RWSC 2A6EC 1LTRD 4JC0A 5I4DA 2RA4A 4DNIA 1EY8A 3FVQA 3P20A 2J7ZA 3PO2G 1I4GA 4XTCS 2RDGA 3FRPB 2UUBL 4KY7A 4A3BH 3TP5A 4K14A 4AYBG 3JAMc 2E2JH 2B8GA 3NUCA 2JA6G 2UXDQ 3PIPA 3KBXA 4UHVA 2XRQD 2IX1A 4JI7L 2K52A 2D9UA 4K8IA 5LMNL 2MUYA 3MAQA 4G4KA 2I46A 2IY5B 2C5CA 2UU9L 1N8RC 2C9OA 2WAQE 1XMOL 1KRSA 2UXBQ 1F2YA 4CKBA 4DV0L 1D8LA 1RJTA 1KAWA 1AN8A 5EPKA 4KY6A 5GAGC 3ZYYX 1A15A 5JEAJ 3D8GA 3KBGA 3QJYA 3S2DH 4K2KA 2EJFC 5CV7A 1A2UA 3S1QB 1QVCA 1EQTA 3D4DA 4ZUIA 5IIFA 2M9VA 4KLKA 3RZOH 1FYCA 2KBNA 1EL0A 1QNUA 4A4IA 2CCZA 1LTTD 2KCCA 2B63B 1VQ8A 3F2BA 4XT1B 2NZOA 2OQKA 1IHZA 2NBFA 1I94Q 2IX3A 3S2HH 4RG1A 1HFGA 4CDEC 4DR1Q 1D1IA 1VQ7A 4WJ3M 1Y1VH 4A3IB 4PZ7A 5KNDA 3HOYG 2K05A 2G5DA 3GTKH 2WB1E 3F1ZA 4M8AA 4O1NA 4IJLA 4QIWE 3T1YQ 5E4XA 2ASBA 3HGBA 4JBMA 4B3RQ 1LABA 2CFMA 4A93G 3T1HL 1HPCA 2QGQA 3S1NH 5D65A 1YNJC 1BF4A 3S9WA 3I90A 4IQZA 3G4SA 1VQEA 2E2DC 4DKAC 5LMUL 2KECA 1KLUD 3D0FA 2B2YA 3I4OA 1Q7YC 3M4YA 1Q1BA 1Z7TA 3E6ZX 1Q90A 4EQ5A 5DLQE 2HD3A 4DXGA 1JWSD 4R4QA 1ENAA 3OSOA 2N78A 2HIXA 1X3EA 1ZXTA 4P75A 3NXWA 4LW1A 1YNND 5IGDA 1S5ED 1IKLA 2IX0A 1J6QA 2R7ZB 4A3JB 2NVQH 4IFDI 5KIXA 4LF4Q 4FNFA 3HOZG 1A3TA 1QILA 1WTQA 1UE7A 2IW3A 3NK9A 5AJ3Q 3BYYB 4TRDA 1Y1WH 3GTQB 3NBHB 1JOQA 4GOPA 1DM0B 1WCMB 1BQQT 3G48A 4YY3L 1K28A 4HCEA 3BYTB 3CCMA 2QDLA 1EWHA 1HCZA 1KDBA 4JI0L 2RQXA 3TP6A 1VCIA 2K1BA 2OF1A 4WJWA 1MSGA 3I56A 2R93G 1ONLA 1QVGA 2F0VA 5JVG3 4BY1B 2O5IC 2B2TC 5M3FH 4DV6L 3S14B 1LT3D 2UXDL 3F2DA 1KRTA 3U50C 1NAPA 1G2TA 5C4ZA 4J8QA 1PH1A 3T53B 3PO2H 3ULLA 4LF6Q 2UXBL 2EY5A 5BN5A 1M1KC 4R4OA 2F4IA 2Y0SB 2JA8B 2OEOA 3S1MH 1PH6A 5I6YA 1EY6A 1ZKOA 3KLSX 4HR7B 2JA6H 2LFNA 1SYBA 3CC4A 5EKIA 3RZDB 2PMZB 1K3RA 3DXJC 3KLSA 1P16A 4OX9Q 1RL2A 4XQJA 3EFXD 1HR0Q 2RF4A 5JOBA 4Q5VA 2K28A 3FHWA 3K57A 1MIUA 3PUXA 2MFIA 1YJ9A 2P5ZX 4LFCQ 1IW7D 3A7AB 2VS1A 3BZKA 3M9BA 5E3FA 1DZ1A 5HY6A 1N34Q 1I4XA 1I94L 4DV2Q 2ATWA 1N33Q 4DR1L 4ZCKA 1QOHA 2YTYA 1BNZA 3VA7A 3T1YL 4B3TL 4B3RL 4K6DA 4HJAA 3EBEA 2KJXA 1IXRA 3DWPA 3QOLA 3PIO3 1GUWA 3S1RB 3CCUA 3NTIA 2F0IA 4H13C 1STHA 1B70B 4KI0A 3HOYH 4JCVE 4DK6C 1K0RA 1R9TH 2DUDA 2NYZD 4PZ8A 4B3MQ 4LAAA 2J4XA 4DR5Q 1STEA 2H5XA 2LXKA 2VB3X 4X3SA 4A93H 4IUQA 1BBWA 2R92G 3BZCA 4C3IB 3GD7A 2AUKA 2A6HC 1U9RA 3HP3A 4RGOS 4KKTA 1PVOA 3GTOH 4V190 4A3GB 3GTMH 4OELB 1LTGD 3K0YA 2L12A 1EU4A 1PMRA 5CMDA 4DR4Q 3TP8A 4JPBW 4A3DB 3HEJA 5M5YB 3MFYA 1I4PA 2JN4A 3P7JA 1H9JA 3S15H 2EJGC 5CBEE 1G2SA 4M1UB 3M85A 3C3LA 4JV5Q 1WTHA 1SJHD 4OXPA 5C44B 1GUGA 4DA2A 2NN6I 3NWSA 4ZYSA 5C3WA 3NBHA 1S5DD 1TWFH 4LF5Q 3CRLC 2XNAC 3HOZH 1VQBA 3OW2A 4RKLA 3J80L 3HOXG 2B2VC 3JC66 3CW2C 3VA5A 1FJGL 4DR3Q 4QGUA 1HZBA 1B4OA 2RKSA 5F2DA 3I4MB 1N36Q 2RHSB 5J3BA 4KHPQ 1Y8PB 1HRJA 5LMNW 5IYBG 5DAUA 4U68A 3T13A 4IPGA 2EXZA 4I65A 1EQVA 2F0HA 5A2QL 1W3SA 2VQFQ 4B9XA 3I8ZA 2K32A 2F03A 2EY6A 4A3BB 3J7ZC 2JQOA 1L0YB 2L9HA 1HUNA 2E2JB 2F0UA 3PQIA 2OQ0A 5HGTA 1Z9FA 4GZYC 1PRTD 2VUMB 1HR0L 2PZUA 3W1GA 1K8OA 3G7LA 1MBYA 4NXNL 1VQIA 1VQJA 2VQEQ 1U0LA 2HQEA 1BCPD 1PFNA 1Y14B 4LFCL 2QDBA 2FHTA 3R93A 2NVYH 3SHLA 1G291 1PTOC 2RCNA 1E7ZA 1QG7A 2K6AA 1LTID 4BBSG 1EFWA 3GDEA 4TVAB 1I6VC 1N34L 4JI6Q 4OO1G 4OWWB 4DR6L 3J81L 4DUZQ 4RMFA 4NW2A 2Q8RE 1JCKB 2NZHA 3ERSX 4J15A 2IHFA 2JJQA 5GAEC 3QB3A 1HJPA 3E0EA 1NR4A 3W5OA 3H6MA 2SEBD 3RZOB 5COYA 3CMEA 1WVLA 1BXTA 5KYLA 1PYWD 1D5XC 2MNAA 4LWCA 4OEMB 1NMGA 1A6XA 4Q0FA 1EUJA 3K5LA 3CCJA 4I7ZC 2E5LL 5AFWA 3D4WA 2RHQB 3S2HB 3CD6A 3OTOQ 1V8QA 1Y1VB 4GNXC 1E2ZA 1SLJA 2F0NA 5H1SE 4DXFA 3GTKB 3QOJA 5C0XJ 2AQ3B 3MVVA 4QCLA 1PLFA 3A8KE 3D31A 4HSPA 5EAYA 4A3CG 2F0LA 5E4WC 3QG1A 1VQFA 4C3HG 1RHPA 3LX0A 3NWTA 4POFA 1S5BD 4JV5L 1E24A 3K6OA 3OIPA 2K5DA 4HAEA 1L0WA 3A5UA 4CBVA 4RHSA 2R92H 2JA7G 3K7UC 1G91A 3PUWA 4WRDA 3PMFA 4YCUA 1YVCA 4ALPA 2E75C 1A3UA 3KFUA 4DPGA 2NVQB 3BDOA 4CJ0B 4XDXA 4DN4M 1QWYA 1K3BC 1S3OA 2D5DA 2R7DA 2Z0SA 4QUCA 5FO7B 2WKDA 4LF9Q 1FNUA 2NVTB 4G57A 1L0XB 1WTPA 2G9DA 4X62L 4K6LA 3PCOB 2L11A 4DNRB 5M5XH 2Q2TA 1H9KA 2F0DA 4N8FA 2PCFB 1DOLA 2Z4HA 1T9HA 4RAUC 1J5EQ 1E22A 4L63B 5ELNA 4JYAQ 3HOXH 3NELA 2WAQG 3SE0A 4Y52H 4S3SA 3PIOA 1OXTA 2CQAA 1N32L 1NCVA 4RKBA 3O13A 2XWJB 5M3FB 1ML0D 4WORA 1L2FA 1MD2D 1B8AA 3P1HA 1K0SA 1DOMA 2UUAQ 4KV6A 3PO2B 1ILPA 5J39A 2VQEL 3K8AA 1TQOA 3BVMA 3CQZH 1HNWL 1I6HH 3TDQA 3K5NA 5NUCA 4AYBB 2VZAA 3A0JA 5CV8A 5LMNQ 2JA6B 4JI3L 2UU9Q 5EKKA 1AZQA 1XMOQ 4DUZL 1PFMA 3L2PA 5CR3A 3E0JA 3FKIH 1HXYD 4HIKA 4DAYB 4DV0Q 3RN2A 4IUUA 5C4XG 3EIVA 1IBML 5ELEA 1MSHA 4DR2L 2PZWA 2MGSA 2Y0SE 4PQXA 5TSSA 4EQOA 4H7BA 3MC0B 2EYFA 4J1MA 4L5TA 4O42A 1U4MA 4ZRZA 4C3JH 4DK3C 3HFZB 2EYLA 2BCOA 1GUNA 2UUCL 4BBSH 4DFAA 4OO1H 4YWKA 1BKBA 2OXPA 3HOVH 4UP7A 4IUPA 3GV6A 1B1ZA 2ZM6L 2HUGA 3ND8A 3TS2A 1R4PB 4F8MA 2EYOA 3OTOL 2PI2A 1EIFA 1BBUA 2K14A 3ZJYC 2WV6D 4R4TA 2B2YC 3GTLH 1PH8A 1F2MA 3NSWA 2ICIA 2NTSA 1W6JA 4KD4A 1Z6HA 2RVLA 1PRTB 1O7YA 4NP5A 1WD1A 1JQYD 3CC2A 3UE1A 2KCTA 2OTJA 3NHHA 1LM0A 1TWAH 3ERQA 3MFGA 1J8IA 1BCPB 1V43A 1IKMA 1HA6A 1YITA 1G6PA 2R7FA 2B8FA 1H9RA 3HOYB 1UAPA 1SMYC 4XQNA 3OIQA 4OWXB 1O78A 1YBYA 3OHXC 2F3WA 5EJWA 2HCCA 1EYCA 1GXDC 3MTSA 4FXGC 1ICFB 3OYYA 3SK6A 2Z1CA 5LMUQ 4A93B 2KQ3A 4A3CH 4GOPC 4X65L 1V1OA 1YHQA 4C2MH 4DV3L 4RGMA 5LL6S 1STYA 4A75A 3GTOB 1MHWC 4C3HH 3GTMB 1D2BA 4UDUC 1G6ZA 1Y1WG 1KDAA 2VXWA 4GN5A 5ELOA 3EN2A 2FINB 3CCEA 3M4OH 1Y8NB 3TZUA 1BBXC 2OCEA 1M4VA 3RLFA 3S15B 1IYVA 2JA7H 4OWTB 4PMWA 3E3XA 1HQRD 1VMCA 4JI2L 1GM5A 3TN2A 3T56B 2B3GA 1QVFA 2Q2UA 1X3QA 1TKWB 2XVSA 1SYGA 5J22A 3TEHB 4DV4L 3VR4A 1TWFB 4LMQD 3PF5A 2Z9HA 4RA8A 5EBCA 3RLOA 3R2IA 3HOZB 3A8IE 3J81j 4YY3Q 3K7AH 3K5OA 4HN7A 4KN4C 5BN4A 2UUAL 4JI0Q 1T5EA 5IGFA 3B6YA 2EY2A 1HR0W 5DEHA 1PH4A 2EE1A 4R1JA 1B44D 5IT9E 3MXNA 4ME5A 4ZUJA 1TU2B 4DV6Q 2R93B 1XTDA 5C4JH 1KXLA 1RTNA 2FXQA 2QEJC 3G71A 1UE1A 1PRTF 1GHKA 1KNEA 3A55A 2E2IH 4OHJA 4IALA 4CDCC 2PYKA 1SYFA 1BCPF 5KEEA 2SNSA 4RGNA 1UWVA 2KUMA 2QCPX 4L5QA 4DAYA 2H1EA 1WD0A 2QW7A 2XTIA 5IYDG 2NVYB 2CH4A 4KTAA 2A69D 2EYMA 4KD3A 2DY8A 2ZTCA 3BDLA 5C4XH 1D6EC 4Y7NH 4L5RC 3JAML 2A8VA 1SE2A 2Z6KA 4F88A 2HDMA 4DV5Q 1T5XD 2RBMA 1K83H 1SROA 3H3VH 5I2XA 3L9AX 4LF8L 2F0FA 2E74C 3I4LA 2CQOA 1A3VA 1GD7A 4KY5A 3U4VA 1PTOH 1UNSA 2EOTA 2IL8A 1TY0A 3VYRA 4J6HA 4YWLA 4B3TQ 1VQNA 3UE0A 4JBWA 1DD2A 1C7YA 3E9HA 2CVRA 2Z8LA 4WFN3 1VQKA 1EIYB 1RIPA 1ET9A 3N6RA 5BR8L 2ID0A 2E2HH 4LF7L 3RN5A 1CA5A 1X56A 4X66L 2F0EA 5E7NA 4DK1A 1AP0A 3FPUB 1UEBA 2B39A 1SJED 2NVXH 1IL2A 2F0JA 2VB2X 2WKCA 3OMGA 5ELDA 1XX8A 2A5HA 5IT9c 3PSIA 4YIJA 2R92B 4IPDA 4APVA 5IODA 4QQBX 4KJOA 3CPFA 2V4DA 5EBDA 3SDZA 3A7LA 2EVBA 4JBJA 4HJ8A 4BXXG 1B50A 5IGBA 1B2TA 1JOKA 1NUCA 1SR3A 1PZKD 3TBIB 1FGBD 4GKKQ 4QY7A 5M5XB 1LTBD 1P8LA 3ND9A 3BDCA 3HS0C 1FJGQ 5C3XA 2B29A 4IUNA 3HOXB 1CKOA 3FEWX 2A68D 3DEPA 1EFID 1E3PA 1VQLA 1DGSA 4N9TA 1E2WA 1JJCB 4RCNA 2RDFA 1U4RA 3DEOA 2ZXPA 2EDGA 3C1FA 3NQIA 3H15A 1Q82C 1KD1C 1Q8IA 1CQVA 1XYIA 3S17H 5JAVA 5A2QE 1TWHB 2C35B 5IGEA 4FXKC 1HZAA 3RD4A 1STAA 1YHBA 4UP8A 2QF7A 1YJWA 1UE6A 3H0GG 3NTHA 2KCMA 3W3AA 3K81C 1BDOA 1VQDA 1X54A 2WINB 4NXNQ 3BVGA 4DV5L 5KGUA 4O0AA 3LWUA 4H0LC 1NSNS 3VR3A 1SFOB 2QEXA 1HZ9A 3TP7A 3CCVA 1ZYRD 3S16H 4AYBE 2O2LD 5IYDH 1NMFA 4PNYA 4DR6Q 2LKVA 3GV3A 2H4OA 3HOWG 4ZAIA 1OO9B 2F0WA 1IZ6A 4BBSB 1G8ZD 1Y8OB 2RSNA 2LY7A 4A3KH 3AMUA 1B9MA 2N88A 3J81E 1STNA 2KCNA 1B3AA 1H9MA 4CKCA 1EWIA 4JI1Q 1KC8C 2V1CC 3UDGA 2X6GA 3D6WA 4CJ2C 5IP7G 2ZTDA 2LXJA 3T51B 2PPBC 3GTLB 1YJNA 3K58A 3J80i 2E5LQ 4EVOA 4JOIC 5C0XI 3MHBA 1ESRA 3IRBA 5LL6X 3STBD 2BH8A 1TWAB 2ZXOA 1SRUA 1HZCA 2Q8TA 4OONA 4IFDG 2DGYA 4P74A 4A3EG 5M5WH 1DJRD 3FMCA 5M9OA 2G9HD 4QUFA 3DHQA 4A76A 3AYHB 1ASZA 3GO5A 2K33A 1X3PA 3GTGH 3KF8B 4C3HB 4DAVA 1BOSA 5C3EG 1ENCA 2MQHA 1QE6A 1O7ZA 1J9OA 4NDXA 2A73B 4EQNA 4I7AA 1PH3A 3M4OB 3MXPA 4XYQA 3NBIA 3I4NG 2RDHA 4XYOA 2YTXA 3V96A 2JA7B 4GKKL 5CV9A 2Z4IA 3QO2A 5DM63 3GTPB 1EU3A 5CBAE 5KNCA 1Q8KA 4BBRG 4KK7A 3SXHA 1RODA 5JPNC 4BXXH 4JI5L 4JW0A 2Q2IA 3Q24A 3J81i 1VMPA 3V05A 1EIHA 1I4HA 1YNNC 4X62Q 3H94A 4K0KL 1JC7A 3K7AB 4MTNA 1KDCA 1ZEQX 4GKJL 2ALYB 1NR2A 4FXDA 1LT5D 4IZ8A 1LUZA 1GUTA 2BE5D 3KDFB 1IYJB 3DMUA 1N32Q 1FNWA 2WAQB 1GO3E 4P73A 1BVSA 4HTHA 5FLXL 3FKIG 4XQQA 5JVH3 2HHHL 5C6AA 1TS5A 3DWQA 3J81c 3VYSA 1X55A 4CDFC 1PYBA 4MNOA 2E2IB 1V1QA 1HNWQ 1ASYA 1HTPA 4C3JG 1B9NA 5KYIA 1NTGA 5I2YA 1E0BA 5D14A 2A68C 4JI3Q 3S2DB 1U5KA 3UDIA 4RFBA 4FF2A 1XXGA 3HOVG 1PH7A 4B9WA 3HKZG 1YIJA 5GAHC 4MHEA 3H0GH 3GQBA 2NWGA 1X3GA 1JORA 3OOCA 1IBMQ 4DR2Q 1TT2A 1XWEA 1H9SA 1KNAA 1EZ6A 1EY7A 1PYSB 5C4XB 3VYUA 4Y7NB 1CUKA 5FLMG 4LUOA 4A3FG 2K5QA 4MTKA 2SOBA 1CSQA 4JI1L 1MJEA 4AQYL 1UEAB 1FD7D 4CJ1B 2UUCQ 4RCOA 2A1AA 2NUCA 1L1OA 1O7IA 3HOWH 3EQLC 1S72A 1EYAA 2KEEA 4X64L 1JWMD 2ZM6Q 3UDFA 4LFBL 4K5VA 5IY0A 4QIWB 4LK1C 1IW7C 1LTLA 2DNCA 5D3IB 2HT1A 5JJLA 5IP7H 3I72A 4ZKBB 3S1NB 2AWNA 2ZJPA 1C0AA 3C46A 1XNQL 4L6TB 1HUMA 3KLWA 1RD9D 2E2HB 1I4QA 2K50A 1AE3A 1G51A 1MGSA 2CW0D 4RGTA 1E1OA 2F0SA 3PO3G 3Q23A 1SYEA 4K5XA 4IFDH 3ITPA 4NKLA 4A3EH 1EY9A 3CMAA 2NVXB 1X32A 5IP9G 1QCBD 1JMCA 3K80C 1DONA 2CHBD 2FMCA 3KF8A 4X65Q 1HH2P 4OIKA 4B08A 1VQPA 1EQRA 4DV3Q 1Q12A 1SXTA 2I07B 1TY2A 2OTLA 3C2PA 4CKEA 1N9WA 2AQ2B 3NP8A 1PH5A 2I0QA 4KMUC 2A6ED 1Y1WB 1GHJA 2LMCB 5C3EH 2HCIA 2F0PA 1DXMA 4JI2Q 1IBLQ 2N49A 3I4NH 2E76C 4ZQ3A 4Z9CB 3D6CA 3GTQH 3AEVA 2EZVA 1WCMH 4BWGB 1KHIA 1NE3A 1E2VA 4DV4Q 2XIWA 3WOEA 2I5HA 4BBRH 1WTVA 1M8AA 4JK1C 3WDNA 2A19A 1A62A 3MXNB 3CP0A 4EX5A 3DLLA 3M3YH 3R3OA 3KOJA 1K73C 5IGCA 3KDFA 4BY1H 4DF7A 2JYOA 4FF3A 1SE4A 3MXUA 4C1NI 1X6OA 2AHOB 1TS3A 3LNNA 1OXXK 4KN7C 5FO9B 1VF7A 4X3KA 4IO9A 5GADC 5CGKA 5EQ0A 4HJ5A 4N9PA 3S1MB 3CHBD 3PUZA 3G6JB 4B3SL 3S17B 1RKNA 3DWAA 4FF1A 1XNRL 4UP9A 3TSSA 2Z6KC 3V2TA 3DM1A 3I7FA 3CPWA 1XPRA 3OW7A 3VR6A 2EY1A 4X6AH 3U4ZA 5I9PA 3OMCA 2BE5C 2B2WA 5J1ZA 1D5MC 1LTAD 1JB3A 2PMZE 5GROA 1JWUD 2PNHA 2WB1G 1PRTC 4YCVA 3RUZA 3TS0A 3W2DA 1IL8A 3W1BA 2ZXRA 3S16B 1Q1EA 3I73A 3OWFA 4JI8L 3A74A 4HEDA 3TRZA 1BCPC 2BA1A 4MIUA 3X3NA 1B7YB 3BS1A 3HZXA 1Q3LA 2JA5G 1LT4D 1Q86C 5FLMH 1S5FD 1S5CD 4A3FH 3T16A 1CSPA 2L15A 4LF8Q 1YNJD 1QUQB 1SNDA 3KK7A 1I5FA 2AWOA 1F2ZA 4P72A 3KUPA 1HHVA 3SEBA 4YHHL 1TR5A 4L5SA 2ENBA 4KHZA 1F9RA 2Z6BA 1D7QA 1UE5A 1QZGA 1H95A 5ELBA 4HIOA 3IAYA 3S1RH 1JJGA 1KABA 4R4CA 1R9TB 5IYCH 1EOVA 1LYLA 1KAAA 1KTKA 3CF5A 4LFAL 2GVAA 2K5WA 4HIDA 3G6EA 1PFBA 1PXUA 5BR8Q 4LF7Q 5ELCA 1LTSD 2NN6H 2GN5A 2KHIA 1SYDA 5A35A 4X66Q 3NEMA 4PMCA 5C4HA 1MJCA 4KJNA 1VQ4A 3ULPA 3I70A 4PZ6A 4OGQC 4ODGA 4DAPA 3PO3H 2JA9A 5K5PA 2YU9H 1KLGD 4A3GH 1U4LA 1PZJD 5IP9H 3I55A 3GTGB 2X69A 5M3MG 1IBLL 5M5YH 5ISRA 3FDTA 1FR3A 3D3RA 3DM3A 2K75A 1IBKL 1I3QH 2BDNA 2K4KA 3GTJH 2TMPA 4UAIA 2LSSA 1EY4A 1XMQL 1VQAA 2BA0A 3N52A 4BS9A 1SMXA 3CCQA 3JAMi 1QNKA 3VR2A 4TSSA 1TIID 2JK8A 3I4MH 3KF6B 1HNXL 2K04A 2NTTA 1VQ6A 5JEAG 2HDLA 2D0PA 4A3MG 4DUYL 2WACA 4LUZA 3R2TA 1SDFA 2F0OA 1V9PA 4IUTA 1FNVA 1OXSC 2DY7A 1XJVA 1QB5D 1EZ8A 1VQCA 1VQ5A 2CH4W 2M00A 1Q81C 5KNBA 3HOUG 4QL5A 1CKNB 2PO4A 4OIJA 2RCFA 1YI2A 3J7AV
chains in the Genus database with same CATH topology
2NZ1D 1ICWA 2X6LA 2XRSD 2B2UA 1R4QB 1O80A 3EJIA 5CV6A 4FYDA 2F1MA 2SNMA 1SEBD 3H0GB 5FOBB 1TS4A 5C5MA 4H44C 3TZDA 3BZDB 1CT1D 4FF4A 1F2LA 4CGYB 2KA7A 3FPPA 4ULLA 3HOWB 4G7OC 1F9SA 2K01A 1LT6D 1EIGA 2K03A 4IURA 1SNPA 2NB0A 2A6HD 2ICEC 2BOSA 3QWNA 4HSVA 1ESFA 3MA2B 4G7HC 2AUJD 2JP1A 4K2LA 4C1NK 4IUVA 3IFDA 3HG9A 2Q8IB 5IGGA 2O4XA 1CTMA 4A3EB 3UI2A 1BR9A 2D62A 3U9OA 1HQMC 2JXMB 4RH6A 1GUOA 2R3ZA 1Y69U 4PMBA 1Z47A 3EROA 1B53A 1D5ZC 3TMEA 5C3EB 1WTXA 5E1FA 2EYPA 2JSOA 4FP5D 3I4NB 2A74C 4L8JA 4F7XA 3NE5B 3J80E 1STBA 3LWEA 4BBRB 3NTKA 5IT9L 4RHRA 2SDFA 2RSOA 5EKLA 5CV4A 3M3YB 2KHSA 2DN8A 2MP1A 3CKIB 1DCZA 5JEAH 1JOOA 1PTOD 3CQZB 1CM9A 1SNMA 1I6HB 2EJMA 1SNOA 1CHPD 4K5WA 3FKIB 4QMGA 5FLXE 2L55A 4PV1C 1C48A 1EEID 2KEDA 1H9SB 2IJ0A 4C3JB 1EY5A 3SR1A 2L4NA 2FJ2A 3HOVB 1SNQA 3HKZB 1IYUA 1EWCA 2MPMA 1ET6A 1F9QA 2O5JC 2KVMA 1TVXA 2IT1A 2A69C 1O7LA 4A3FB 2DNEA 1EEFD 1V1PB 5CC4A 3Q6SA 2YYZA 4OO1I 5T1GA 5ELFA 3ONAB 1CFMA 5I6WA 1C4QA 5JJZA 2K7VA 5EGTA 1SAPA 1EYDA 3A54A 2F3VA 1SBBB 2JEAI 5IOCA 2MHVA 1HFNA 3K59A 4C2MB 4IN3A 4F87A 5G3LD 4CHTB 3PO3B 4G7ZC 2YU9B 4K8JA 1BO0A 5CORA 1PDQA 1AFPA 1I3QB 3SK8A 4IFDJ 3GTJB 1II3A 2F0GA 1LO5D 2IPKD 5D3DA 1A2TA 1RF2D 3CU7A 1OXVA 1SE3A 3C1EA 4FO2A 3R8BA 3IKJA 3EVQA 3NPPA 3MWYW 4OL7A 4KHVA 3F2UA 2FMMA 4ZLTF 5C4JB 4KKUA 5FK9C 2B2WC 4NMZA 4E6IA 2L5TA 1F9PA 2AQ1B 1CI3M 2PNRC 3SK4A 3CRKC 2EYJA 4DK0A 1W6KA 1EY0A 2D2CC 4XIGS 1DOKA 2B2TA 4QB4A 3H3VC 1AZPA 3U9SA 1LLRD 3VYTA 2WIIB 5T1IA 1RDPD 1RTOA 1VF5C 1JE4A 1STGA 2F0KA 1CZWA 5C0XG 2PW7A 1K83B 2EPBA 3PV0A 3T4AC 1BUVT 2WP8J 2WB1B 5CV5A 3X3MA 3MZ5A 3SK5A 1SMYD 1F77A 1PTOB 1SNCA 3KLRA 1HTLD 1V1PA 4HMJA 2PZTA 2QKIC 1ZYRC 2GA4B 2JA5B 5EPJA 3AU7A 4QF4A 5DNFA 2NN6G 1S4ZA 5BN3A 2L0CA 3IL8A 4P2CB 3BG3A 4C3IG 1JICA 4DGZA 1TWGB 4EQPA 2R6GA 3OPOA 3AB9A 3I91A 3PIP3 1QJOA 1EOTA 4R9WA 4ABNA 1CHQD 1AW7A 4DU9A 5K36G 3H09A 3URYA 4BA2I 3MEHA 5EPLA 4XXEA 4MN3A 1OXUA 3K5MA 4EGVA 2OT2A 1UUPA 1PZID 3A56A 2QILA 3IFTA 5I9OA 4V0BA 1TS2A 3WOFA 3SVMA 5LHY1 1LV9A 2F0TA 5M3MB 1AEXA 4U673 3OWEB 1XTCD 3EA6A 5CYUA 1HA5A 1I4RA 2LS01 4HCSA 2B2UC 3Q0AA 1C8CA 1CK1A 3Q22A 1PTOF 2EYHA 1D1KA 5HURA 4LJZC 2B2VA 2R61A 5C5LA 4A3MB 2JEBI 3E5SA 2XN9C 1I50B 1ILQA 3HOUB 4HMIA 3DUZA 4TQUS 3BVZA 3HRZC 4X3TA 4FVMA 2FFKB 3P75A 1ENFA 4R8IA 2N55A 5FKAC 2XWBB 1MI2A 1RCVD 1GOZA 2KOLA 4XT3B 3J7AF 2L1BA 4ZKCB 4A3KB 3L3OC 3RMHA 3D4RA 2BDOA 3VR5A 3JAME 4TKOB 3PUYA 4X3UA 5C0XH 2VNUD 1WTWA 4R8NA 3M7NA 3M7GA 1CA6A 1GJXA 4ZK9B 2MJ8A 3NQTA 1CQFA 3L7ZC 1DYQA 5KRUA 3PUVA 3I3CA 3A8JE 2PW5A 5M5WB 1TWCB 3GP7A 5FO8B 4KKSA 1JR0D 1WTRA 4BA1I 5JPMC 5G3LF 1WTOA 1VDZA 4BY7B 4ID6A 5K36H 4DNTB 3J7YW 5DM73 3QIAA 4C56C 2IWHA 2CW0C 1SYCA 1SSOA 1CZGA 3MXGA 1U4PA 2F0QA 1K8MA 2M2LA 2XSCA 2J0TD 2PQEA 1GUSA 2JE6I 2TSSA 3H91A 2ZT9C 2F0MA 1LACA 4ILWA 4RWSC 2A6EC 1LTRD 5I4DA 2RA4A 1EY8A 3FVQA 3P20A 2J7ZA 1I4GA 4XTCS 2RDGA 3FRPB 4KY7A 3TP5A 4K14A 2B8GA 3NUCA 3KBXA 2XRQD 2IX1A 2D9UA 4K8IA 2MUYA 3MAQA 4G4KA 2I46A 2C5CA 2C9OA 1F2YA 4CKBA 1RJTA 1AN8A 5EPKA 4KY6A 3ZYYX 1A15A 5JEAJ 3D8GA 3KBGA 3QJYA 4K2KA 2EJFC 5CV7A 1A2UA 3S1QB 1EQTA 3D4DA 4ZUIA 5IIFA 2M9VA 1FYCA 1EL0A 1QNUA 1LTTD 2KCCA 2B63B 4XT1B 1IHZA 2NBFA 2IX3A 1HFGA 1D1IA 4A3IB 5KNDA 2K05A 4M8AA 4O1NA 5E4XA 3HGBA 1LABA 1HPCA 5D65A 1YNJC 1BF4A 3S9WA 3I90A 4IQZA 2E2DC 1KLUD 2KECA 2B2YA 3M4YA 1Q1BA 1Z7TA 3E6ZX 1Q90A 4DXGA 1JWSD 1ENAA 3OSOA 1ZXTA 3NXWA 1YNND 5IGDA 1S5ED 1IKLA 2IX0A 2R7ZB 4A3JB 4IFDI 5KIXA 4FNFA 1A3TA 1QILA 1WTQA 2IW3A 3NK9A 3BYYB 4TRDA 3GTQB 1JOQA 1DM0B 1WCMB 1BQQT 4HCEA 3BYTB 1EWHA 1HCZA 1KDBA 2RQXA 3TP6A 1VCIA 2K1BA 2OF1A 4WJWA 1MSGA 1ONLA 2F0VA 5JVG3 4BY1B 2O5IC 2B2TC 3S14B 1LT3D 1NAPA 1G2TA 5C4ZA 4J8QA 3T53B 2EY5A 5BN5A 2F4IA 2Y0SB 2JA8B 2OEOA 5I6YA 1EY6A 1ZKOA 3KLSX 4HR7B 2LFNA 1SYBA 5EKIA 3RZDB 2PMZB 3DXJC 3KLSA 4XQJA 3EFXD 5JOBA 4Q5VA 2K28A 3K57A 3PUXA 1IW7D 3A7AB 5E3FA 1DZ1A 1I4XA 1QOHA 1BNZA 3VA7A 4K6DA 2KJXA 3DWPA 3QOLA 3PIO3 1GUWA 3S1RB 3NTIA 2F0IA 4H13C 1STHA 4KI0A 2NYZD 4LAAA 2J4XA 1STEA 2VB3X 4X3SA 4IUQA 4C3IB 3GD7A 2AUKA 2A6HC 1U9RA 3HP3A 4RGOS 4KKTA 4V190 4A3GB 5CMDA 1LTGD 2L12A 1EU4A 1PMRA 3K0YA 3TP8A 4A3DB 3HEJA 5M5YB 3MFYA 1I4PA 3P7JA 1H9JA 2EJGC 5CBEE 1G2SA 4M1UB 3M85A 3C3LA 1SJHD 5C44B 1GUGA 4DA2A 2NN6I 3NWSA 4ZYSA 5C3WA 3NBHA 1S5DD 3CRLC 2XNAC 4RKLA 3J80L 2B2VC 3VA5A 1B4OA 2RKSA 5F2DA 3I4MB 1Y8PB 1HRJA 5DAUA 4U68A 3T13A 2EXZA 4I65A 1EQVA 2F0HA 5A2QL 4B9XA 3I8ZA 2K32A 2F03A 2EY6A 4A3BB 1L0YB 2L9HA 1HUNA 2E2JB 2F0UA 5HGTA 4GZYC 1PRTD 2VUMB 2PZUA 1K8OA 3G7LA 1MBYA 2HQEA 1BCPD 1PFNA 2QDBA 2FHTA 3R93A 3SHLA 1G291 1PTOC 1QG7A 2K6AA 1LTID 1I6VC 4OO1G 3J81L 4NW2A 2Q8RE 1JCKB 3QB3A 1NR4A 3H6MA 2SEBD 3RZOB 5COYA 1WVLA 1BXTA 5KYLA 1PYWD 1D5XC 1A6XA 4Q0FA 3K5LA 4I7ZC 5AFWA 3D4WA 3S2HB 1V8QA 1Y1VB 1E2ZA 2F0NA 3GTKB 4DXFA 3QOJA 5C0XJ 2AQ3B 3MVVA 4QCLA 1PLFA 3A8KE 3D31A 4HSPA 2F0LA 5E4WC 3QG1A 4C3HG 1RHPA 3LX0A 3NWTA 1S5BD 3K6OA 3OIPA 2K5DA 4HAEA 4CBVA 4RHSA 1G91A 3PUWA 4WRDA 3PMFA 2E75C 1A3UA 2NVQB 3BDOA 4CJ0B 4XDXA 4DN4M 1QWYA 4QUCA 5FO7B 2D5DA 2WKDA 1FNUA 2NVTB 4G57A 1L0XB 1WTPA 2G9DA 4K6LA 2L11A 4DNRB 1H9KA 2F0DA 2PCFB 1DOLA 2Z4HA 4RAUC 4L63B 3SE0A 4S3SA 1OXTA 2CQAA 1NCVA 4RKBA 3O13A 2XWJB 5M3FB 1ML0D 4WORA 1MD2D 3P1HA 1DOMA 4KV6A 3PO2B 1ILPA 5J39A 1TQOA 3BVMA 3TDQA 3K5NA 5NUCA 4AYBB 5CV8A 2JA6B 5EKKA 1AZQA 1PFMA 5CR3A 3E0JA 1HXYD 4IUUA 5ELEA 1MSHA 2PZWA 2MGSA 4PQXA 5TSSA 4EQOA 4H7BA 3MC0B 2EYFA 4J1MA 4O42A 1U4MA 4ZRZA 2EYLA 2BCOA 1GUNA 4DFAA 4OO1H 2OXPA 4IUPA 3GV6A 1B1ZA 2HUGA 3ND8A 1R4PB 4F8MA 2EYOA 2WV6D 2B2YC 1F2MA 3NSWA 2ICIA 2NTSA 1W6JA 4KD4A 1Z6HA 2RVLA 1PRTB 1O7YA 4NP5A 1WD1A 1JQYD 3NHHA 1J8IA 3ERQA 3MFGA 1BCPB 1V43A 1IKMA 1HA6A 2B8FA 1H9RA 3HOYB 1UAPA 1SMYC 4XQNA 3OIQA 1O78A 3OHXC 5EJWA 2F3WA 2HCCA 1EYCA 1GXDC 3MTSA 4FXGC 3SK6A 2Z1CA 4A93B 2KQ3A 1V1OA 4RGMA 5LL6S 1STYA 3GTOB 1D2BA 3GTMB 4UDUC 1G6ZA 1KDAA 2VXWA 2FINB 1Y8NB 3TZUA 1BBXC 3RLFA 1M4VA 3S15B 1IYVA 4PMWA 1HQRD 1VMCA 3TN2A 3T56B 1X3QA 1TKWB 2XVSA 1SYGA 5J22A 3VR4A 1TWFB 4LMQD 4RA8A 5EBCA 3R2IA 3HOZB 3A8IE 3K5OA 4HN7A 4KN4C 5BN4A 1T5EA 5IGFA 2EY2A 5DEHA 2EE1A 1B44D 5IT9E 3MXNA 4ME5A 4ZUJA 1TU2B 2R93B 1RTNA 2QEJC 1GHKA 1PRTF 1KNEA 3A55A 4OHJA 4IALA 2PYKA 1SYFA 1BCPF 5KEEA 2SNSA 4RGNA 2KUMA 2QCPX 4DAYA 2H1EA 1WD0A 2NVYB 4KTAA 2A69D 2EYMA 4KD3A 2DY8A 3BDLA 1D6EC 3JAML 1SE2A 4F88A 2HDMA 1T5XD 2RBMA 5I2XA 3L9AX 2F0FA 2E74C 3I4LA 1A3VA 4KY5A 1PTOH 1UNSA 2EOTA 2IL8A 1TY0A 3VYRA 4J6HA 4JBWA 1DD2A 2CVRA 2Z8LA 4WFN3 1ET9A 3N6RA 2ID0A 1CA5A 2F0EA 4DK1A 1AP0A 3FPUB 2B39A 1SJED 2F0JA 2VB2X 2WKCA 3OMGA 5ELDA 1XX8A 2A5HA 4YIJA 2R92B 5IODA 4KJOA 2V4DA 5EBDA 3SDZA 3A7LA 2EVBA 1B50A 5IGBA 1B2TA 1JOKA 1NUCA 1PZKD 3TBIB 1FGBD 5M5XB 1LTBD 3ND9A 3BDCA 3HS0C 5C3XA 4IUNA 3HOXB 3FEWX 2A68D 3DEPA 1EFID 4N9TA 1E2WA 4RCNA 2RDFA 1U4RA 3DEOA 2ZXPA 2EDGA 3C1FA 3NQIA 1Q8IA 1CQVA 1XYIA 5JAVA 5A2QE 1TWHB 5IGEA 4FXKC 3RD4A 1STAA 2QF7A 3NTHA 3W3AA 1BDOA 2WINB 3BVGA 5KGUA 3LWUA 4H0LC 1NSNS 3VR3A 1SFOB 3TP7A 1ZYRD 2O2LD 4PNYA 2LKVA 3GV3A 2H4OA 4ZAIA 1OO9B 2F0WA 4BBSB 1G8ZD 1Y8OB 2RSNA 2LY7A 3AMUA 1B9MA 2N88A 3J81E 1STNA 2KCNA 1B3AA 1H9MA 4CKCA 2X6GA 3D6WA 4CJ2C 3T51B 2PPBC 3GTLB 3K58A 4EVOA 5C0XI 3MHBA 1ESRA 5LL6X 1TWAB 2ZXOA 2Q8TA 4IFDG 1DJRD 3FMCA 5M9OA 2G9HD 4QUFA 3DHQA 3GO5A 2K33A 1X3PA 4C3HB 4DAVA 1BOSA 1ENCA 1QE6A 1O7ZA 1J9OA 4NDXA 2A73B 4EQNA 3M4OB 3MXPA 4XYQA 3NBIA 2RDHA 4XYOA 3V96A 2JA7B 5CV9A 2Z4IA 3QO2A 5DM63 3GTPB 1EU3A 5CBAE 5KNCA 4KK7A 3SXHA 1RODA 5JPNC 3Q24A 1VMPA 3V05A 1EIHA 1I4HA 1YNNC 3H94A 1JC7A 3K7AB 1KDCA 1ZEQX 1NR2A 4FXDA 1LT5D 4IZ8A 1GUTA 2BE5D 3DMUA 1FNWA 2WAQB 4HTHA 5FLXL 4XQQA 5JVH3 5C6AA 1TS5A 3DWQA 3VYSA 2E2IB 1HTPA 4C3JG 1B9NA 5KYIA 5I2YA 1E0BA 5D14A 2A68C 3S2DB 4RFBA 4FF2A 1XXGA 4B9WA 4MHEA 3GQBA 2NWGA 1JORA 3OOCA 1TT2A 1XWEA 1H9SA 1KNAA 1EZ6A 1EY7A 5C4XB 3VYUA 4Y7NB 2K5QA 2SOBA 1UEAB 1FD7D 4CJ1B 4RCOA 2NUCA 3EQLC 1EYAA 2KEEA 1JWMD 4K5VA 4QIWB 4LK1C 1IW7C 2DNCA 5D3IB 3I72A 4ZKBB 3S1NB 2AWNA 3C46A 4L6TB 1HUMA 1RD9D 2E2HB 1I4QA 1MGSA 2CW0D 4RGTA 2F0SA 3Q23A 1SYEA 4K5XA 4IFDH 3ITPA 4NKLA 1EY9A 2NVXB 1X32A 1QCBD 1DONA 2CHBD 2FMCA 3KF8A 4OIKA 4B08A 1Q12A 1SXTA 2I07B 1TY2A 3C2PA 4CKEA 2AQ2B 3NP8A 4KMUC 2A6ED 1Y1WB 1GHJA 2LMCB 2HCIA 2F0PA 1DXMA 2E76C 4ZQ3A 4Z9CB 3D6CA 2EZVA 4BWGB 1E2VA 2XIWA 3WOEA 1WTVA 1M8AA 4JK1C 3WDNA 3R3OA 5IGCA 4FF3A 4DF7A 2JYOA 1SE4A 3MXUA 4C1NI 3LNNA 1TS3A 4KN7C 1OXXK 5FO9B 1VF7A 4X3KA 5CGKA 5EQ0A 4N9PA 3S1MB 3CHBD 3PUZA 3G6JB 3S17B 1RKNA 3DWAA 4FF1A 3TSSA 3V2TA 3DM1A 3OW7A 3VR6A 2EY1A 5I9PA 3OMCA 2BE5C 2B2WA 5J1ZA 1D5MC 1LTAD 1JB3A 1JWUD 1PRTC 3RUZA 3W2DA 1IL8A 2ZXRA 3S16B 1Q1EA 3I73A 3OWFA 4HEDA 1BCPC 2BA1A 4MIUA 3X3NA 3BS1A 3HZXA 1Q3LA 1LT4D 1S5FD 1S5CD 3T16A 1YNJD 1SNDA 3KK7A 2AWOA 1F2ZA 3KUPA 1HHVA 3SEBA 1TR5A 2ENBA 4KHZA 1F9RA 5ELBA 3IAYA 1KABA 1R9TB 1KAAA 1KTKA 2K5WA 1PFBA 1PXUA 5ELCA 1LTSD 2NN6H 1SYDA 5A35A 4PMCA 5C4HA 4KJNA 3I70A 4OGQC 4ODGA 4DAPA 5K5PA 1KLGD 1U4LA 1PZJD 3GTGB 2X69A 5ISRA 3FDTA 1FR3A 3D3RA 2BDNA 2TMPA 4UAIA 1EY4A 2BA0A 3N52A 4BS9A 1QNKA 3VR2A 4TSSA 1TIID 2K04A 2NTTA 5JEAG 2HDLA 2WACA 3R2TA 1SDFA 2F0OA 4IUTA 1FNVA 1OXSC 2DY7A 1QB5D 1EZ8A 2M00A 5KNBA 2PO4A 4OIJA 3J7AV
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MZ5 A;  4F7X A;  2PZU A;  3SK5 A;  3SK6 A;  1STA A;  2F0D A;  3ITP A;  4NKL A;  3T16 A;  1EY9 A;  2KQ3 A;  1A3V A;  1SND A;  1SNC A;  2F0M A;  1STB A;  1ENA A;  3OSO A;  2HQE A;  1F2Z A;  4HMJ A;  4HMI A;  2PZT A;  3EJI A;  4KY5 A;  1KDC A;  1STY A;  5CV6 A;  2QDB A;  4K6D A;  3SHL A;  4S3S A;  1KDA A;  1EY8 A;  2SNM A;  1TR5 A;  3QOL A;  3NXW A;  2ENB A;  3P75 A;  4J6H A;  5KGU A;  4RKB A;  5EKL A;  4IZ8 A;  4K8J A;  4QF4 A;  5CV4 A;  1NSN S;  5IGD A;  2KHS A;  2F0I A;  4WOR A;  3NP8 A;  1STH A;  3DMU A;  4KY7 A;  3P1H A;  3TP7 A;  1KAB A;  4K14 A;  3TP5 A;  5KIX A;  5C5M A;  1A3T A;  4PNY A;  1JOO A;  4KV6 A;  2F0P A;  1KAA A;  2LKV A;  3SK8 A;  4HTH A;  4DGZ A;  3NUC A;  3NK9 A;  4EQP A;  4TRD A;  2F0W A;  5J39 A;  5C6A A;  1SYG A;  1SNM A;  1JOQ A;  3QB3 A;  5J22 A;  4LAA A;  4ZQ3 A;  1II3 A;  2F0E A;  4K8I A;  3D6C A;  3H6M A;  1TQO A;  2F0G A;  1STN A;  1SNO A;  5IOC A;  1SYD A;  5NUC A;  4PMC A;  1A2T A;  2F0J A;  4R8N A;  4KJN A;  4K5W A;  1U9R A;  5CV8 A;  4DU9 A;  5C4H A;  1KDB A;  1F2Y A;  4QMG A;  3TP6 A;  3OMG A;  4ODG A;  2OF1 A;  3C1E A;  4K5X A;  5EKK A;  3MEH A;  5KYI A;  5CR3 A;  3EVQ A;  3TP8 A;  5K5P A;  3NQT A;  3D4W A;  4KY6 A;  4OL7 A;  2EY2 A;  2F0V A;  3HEJ A;  5DEH A;  5IGF A;  4YIJ A;  4KHV A;  1SNP A;  4B9W A;  2PZW A;  3R3O A;  3D8G A;  5KRU A;  5IGC A;  4K2K A;  4EVO A;  5IOD A;  4DF7 A;  5ISR A;  4ME5 A;  1JOR A;  5C4Z A;  5CV7 A;  4EQO A;  4ZUJ A;  4H7B A;  4J1M A;  2EYF A;  1TT2 A;  3MHB A;  4B9X A;  2F0N A;  4KJO A;  5I6Y A;  5I9O A;  1A2U A;  3QOJ A;  1EY5 A;  1EZ6 A;  1EY7 A;  3D4D A;  4NMZ A;  3SR1 A;  4E6I A;  5C3W A;  2EYL A;  4ZUI A;  2PW5 A;  2EY5 A;  5CGK A;  5IGB A;  5IIF A;  3MVV A;  1SNQ A;  4N9P A;  4K2L A;  2F0T A;  2SOB A;  4DFA A;  1JOK A;  1NUC A;  1AEX A;  2F0L A;  2OXP A;  3SK4 A;  2OEO A;  1RKN A;  5M9O A;  1EY4 A;  2EYJ A;  4RKL A;  2NUC A;  3V2T A;  1EY0 A;  1EY6 A;  3DHQ A;  2PYK A;  2EYO A;  1SYF A;  4IAL A;  3LX0 A;  3VA5 A;  4F8M A;  1EYA A;  1SYB A;  5IGG A;  5KEE A;  2O4X A;  2SNS A;  4QB4 A;  2RKS A;  5F2D A;  3BDC A;  4K5V A;  1IHZ A;  5C3X A;  5CC4 A;  1F2M A;  2EY1 A;  4ID6 A;  5KYL A;  4IUN A;  5DAU A;  3OMC A;  4KD4 A;  3T13 A;  3U9O A;  5I9P A;  5J1Z A;  4KTA A;  5JOB A;  1ENC A;  2EYM A;  4NP5 A;  4WRD A;  2EXZ A;  2WAC A;  4I65 A;  1EQV A;  2F0H A;  3PMF A;  4NDX A;  4KD3 A;  4EQN A;  4N9T A;  2F0O A;  1SYC A;  2EYH A;  1A3U A;  1STG A;  3BDL A;  3ERQ A;  3MXP A;  2RDF A;  3NHH A;  4PMB A;  3RUZ A;  2F0K A;  2EY6 A;  3ERO A;  5I6W A;  2PW7 A;  5HUR A;  3C1F A;  5CV9 A;  3TME A;  5E3F A;  1EZ8 A;  3OWF A;  5C5L A;  5E1F A;  2EYP A;  2F0Q A;  2M00 A;  3S9W A;  2F0U A;  2RBM A;  4G57 A;  4MIU A;  5EGT A;  2F3V A;  1EYD A;  5JAV A;  5HGT A;  2F3W A;  3HZX A;  3SXH A;  1EYC A;  2F0S A;  3E5S A;  5IGE A;  2F0F A;  5CV5 A;  1SYE A;  2PQE A; 
#chains in the Genus database with same CATH topology
 2NZ1 D;  2E8G A;  1ICW A;  2X6L A;  2VUM H;  3FP9 A;  1JJ2 A;  3VDY A;  1K8A C;  2XRS D;  4GN3 B;  1YZ6 A;  2B2U A;  1R4Q B;  1O80 A;  3EJI A;  5CV6 A;  4FYD A;  2F1M A;  2SNM A;  4A3K G;  1SEB D;  4GN4 B;  3H0G B;  5FOB B;  2BH2 A;  1TS4 A;  5C5M A;  4H44 C;  3TZD A;  4JBK A;  3BZD B;  4IPC A;  1HNZ L;  1CT1 D;  4FF4 A;  1F2L A;  4CGY B;  2KA7 A;  3Q8D A;  3FPP A;  3TRE A;  1QUQ A;  4ULL A;  3HOW B;  4G7O C;  1F9S A;  2Q2H A;  2K01 A;  4IOC A;  2JA5 H;  4DV7 L;  3M4Q A;  1LT6 D;  1EIG A;  2K03 A;  4IUR A;  2VY3 A;  1SNP A;  2NB0 A;  2A6H D;  2ICE C;  1Q46 A;  1A8V A;  2BOS A;  2PI2 E;  3QWN A;  4HSV A;  4JI4 Q;  2PQA B;  1ESF A;  3MA2 B;  1TWG H;  4G7H C;  2AUJ D;  2JP1 A;  4K2L A;  2ZJQ A;  4C1N K;  4IUV A;  1M90 C;  4BY7 G;  3CC7 A;  5IWA L;  3IFD A;  3HG9 A;  2Q8I B;  3ER0 A;  1PA6 A;  5IGG A;  2O4X A;  1CTM A;  4A3E B;  3UI2 A;  1BR9 A;  2D62 A;  2F4V L;  1WJJ A;  1SE8 A;  3U9O A;  1HQM C;  2JXM B;  1JB7 A;  3L0O A;  1VQ9 A;  4RH6 A;  1SN8 A;  1GUO A;  2R3Z A;  1Y69 U;  4PMB A;  1Z47 A;  3ERO A;  1B53 A;  1D5Z C;  5FJ8 G;  3TME A;  5M3M H;  1PV4 A;  5C3E B;  1WTX A;  5E1F A;  2EYP A;  2JSO A;  1WI5 A;  3A5Z B;  4FP5 D;  4HJ9 A;  3I4N B;  2A74 C;  4L8J A;  2NVT H;  1VQM A;  4F7X A;  4GLV B;  3NE5 B;  4JI5 Q;  3J80 E;  1STB A;  3CCL A;  3LWE A;  4BBR B;  1X9N A;  3NTK A;  5IT9 L;  3KF6 A;  4RHR A;  4K0K Q;  2N8N A;  2SDF A;  2RSO A;  5EKL A;  4GKJ Q;  4JG2 A;  1GKH A;  5CV4 A;  3M3Y B;  4WJ4 A;  2KHS A;  2DN8 A;  2MP1 A;  1PH9 A;  3CKI B;  1DCZ A;  5JEA H;  1JOO A;  4A3M H;  1PTO D;  3CQZ B;  1CM9 A;  1CKN A;  1SNM A;  1I6H B;  4PG3 A;  2EJM A;  2HHH Q;  1X65 A;  1SNO A;  1I50 H;  2HIV A;  1CHP D;  2XGT A;  4K5W A;  3HOU H;  1PFS A;  3FKI B;  4QMG A;  2UXC Q;  3AFQ A;  2L55 A;  5FLX E;  4PV1 C;  1L1O C;  1C48 A;  1EEI D;  2KED A;  1XPO A;  2WFW A;  1H9S B;  2IJ0 A;  3M4P A;  4C3J B;  1NBW A;  2IHE A;  1B3Q A;  1EY5 A;  1PH2 A;  3SR1 A;  2L4N A;  3E9I A;  2B63 G;  2FJ2 A;  3HOV B;  1A0I A;  1SNQ A;  3HKZ B;  1IYU A;  1EWC A;  3SGI A;  1L1O B;  2MPM A;  1ET6 A;  1F9Q A;  2O5J C;  1X3F A;  2KVM A;  1TVX A;  2IT1 A;  4AQY Q;  2K5H A;  4A3I G;  2A69 C;  1O7L A;  4A3F B;  3CCR A;  2DNE A;  1EEF D;  4JI4 L;  1V1P B;  4X64 Q;  5CC4 A;  3Q6S A;  4LFB Q;  2YYZ A;  1NY4 A;  4DR7 Q;  4OO1 I;  5T1G A;  3TQY A;  5ELF A;  4A3L G;  2PQA A;  1YEZ A;  3ONA B;  1CFM A;  5I6W A;  1TWC H;  4FDB A;  1C4Q A;  1FGU A;  5JJZ A;  2K7V A;  1XNQ Q;  1YNX A;  1SAP A;  1EYD A;  3A54 A;  2F3V A;  1SBB B;  5EGT A;  2JEA I;  4LUV A;  5IOC A;  2MHV A;  3J80 c;  2EIF A;  3K59 A;  1HFN A;  4C2M B;  4IN3 A;  4BY7 H;  4F87 A;  2R7Z G;  2MO1 A;  5G3L D;  4A3J G;  4CHT B;  3PGZ A;  3PO3 B;  4G7Z C;  5HGQ A;  3QR8 A;  2YU9 B;  4K8J A;  4LF4 L;  1WCM G;  1BO0 A;  1A63 A;  5AJ3 L;  5COR A;  1PDQ A;  1AFP A;  1I3Q B;  3SK8 A;  4IFD J;  3GTJ B;  2VW9 A;  1MKH A;  1II3 A;  2F0G A;  5FJ8 H;  1JT8 A;  1LO5 D;  4BY1 G;  5FLX c;  2IPK D;  5D3D A;  1A2T A;  1RF2 D;  3CU7 A;  4HIM A;  1OXV A;  3F8T A;  1SE3 A;  3C1E A;  4FO2 A;  5JJI A;  3R8B A;  3IKJ A;  1AE2 A;  3EVQ A;  3NPP A;  3MWY W;  4OL7 A;  3S24 A;  4KHV A;  4JVZ A;  3F2U A;  2FMM A;  2Y0S G;  4ZLT F;  5C4J B;  2JA8 G;  4LF6 L;  4NXM Q;  1WYD A;  4KKU A;  5FK9 C;  2B2W C;  4NMZ A;  4E6I A;  1TXY A;  2L5T A;  1F9P A;  1VS0 A;  2R93 H;  2AQ1 B;  2UXC L;  3NEN A;  1CI3 M;  2PNR C;  3SK4 A;  3CRK C;  2EYJ A;  4DK0 A;  1W6K A;  1E1T A;  2EXD A;  3RLN A;  2ZJR A;  1EY0 A;  2D2C C;  4XIG S;  4B3S Q;  4OX9 L;  1XNR Q;  3HKS A;  1DOK A;  2B2T A;  4QB4 A;  5IE8 A;  3H3V C;  1AZP A;  3U9S A;  4GLX A;  1LLR D;  3VYT A;  4DV1 Q;  2WII B;  2KHJ A;  5T1I A;  1RDP D;  1RTO A;  2F3I A;  5L37 A;  1VF5 C;  3S1Q H;  1JE4 A;  3ICE A;  4UY8 C;  2ZTE A;  1STG A;  1S40 A;  2F0K A;  1CZW A;  5C0X G;  2PW7 A;  1K83 B;  2MO0 A;  1QZH A;  2EPB A;  4DV2 L;  2HQL A;  3PV0 A;  3T4A C;  1N33 L;  1BUV T;  2WP8 J;  4JI8 Q;  2WB1 B;  2K5N A;  2B63 H;  5CV5 A;  2EQS A;  3X3M A;  4DR7 L;  3MZ5 A;  3SK5 A;  4NB3 A;  3RNU A;  1SMY D;  1F77 A;  1PTO B;  1SNC A;  1WFQ A;  3MEF A;  3KLR A;  1HTL D;  1V1P A;  4HMJ A;  5IYC G;  1KQS A;  2PZT A;  2QKI C;  1ZYR C;  2GA4 B;  2DJG C;  2KEN A;  4R4I A;  2JA5 B;  4A3I H;  4GLA C;  5EPJ A;  3AU7 A;  3H3V I;  4QF4 A;  5DNF A;  2NN6 G;  1S4Z A;  2AMC B;  5BN3 A;  4YHH Q;  2L0C A;  3IL8 A;  4P2C B;  3BG3 A;  2I5M X;  4B3M L;  4O2D A;  4C3I G;  2ES2 A;  4DR5 L;  1JIC A;  4GS3 A;  4P71 A;  4DGZ A;  1TWG B;  1YHA A;  2R6G A;  4EQP A;  3OPO A;  4A3G G;  4A3L H;  3AB9 A;  3I91 A;  3PIP 3;  1QJO A;  1GVP A;  4LFA Q;  1EOT A;  4UPA A;  4R9W A;  4ABN A;  4A3D G;  1CHQ D;  1W2B A;  1AW7 A;  4DU9 A;  5K36 G;  4DR4 L;  3H09 A;  3URY A;  4AH6 A;  2CWP A;  2F52 A;  3MEH A;  5C44 G;  5EPL A;  4XXE A;  4BA2 I;  4MN3 A;  4GNX B;  1OXU A;  3STB C;  2CKZ B;  3K5M A;  4EGV A;  2OT2 A;  1XPU A;  1UUP A;  4IJH A;  4JOI A;  2R7Z H;  1PZI D;  4HJ7 A;  3A56 A;  4A3J H;  2AKW B;  2QIL A;  1FVI A;  3IFT A;  5I9O A;  4V0B A;  1TS2 A;  3WOF A;  3SVM A;  4LF5 L;  5LHY 1;  1LV9 A;  1IBK Q;  2F0T A;  5M3M B;  2K5V A;  1AEX A;  3I4M G;  3UDX A;  1EQQ A;  4DR3 L;  4LNQ A;  3CAM A;  1N36 L;  4U67 3;  4KHP L;  1XMQ Q;  3OWE B;  3CXC A;  1XTC D;  3EA6 A;  3K0X A;  1HA5 A;  5CYU A;  3J7A 5;  4NXM L;  5JJK A;  1I4R A;  2LS0 1;  4HCS A;  3S14 H;  4A3B G;  1OTC A;  3F2C A;  2VQF L;  4ME3 A;  4YWM A;  2B2U C;  3Q0A A;  1C8C A;  2GVB A;  1HNX Q;  1CK1 A;  3Q22 A;  1WOC A;  1PTO F;  2EYH A;  3BU2 A;  1D1K A;  2VUM G;  4DUY Q;  5HUR A;  4LJZ C;  2VL6 A;  2B2V A;  2R61 A;  5C5L A;  2JA8 H;  5IYB H;  4A3M B;  2UUB Q;  2JEB I;  3E5S A;  4DV1 L;  3RZD H;  3PF4 A;  1KL9 A;  1TWH H;  1C9O A;  2XN9 C;  3ULJ A;  1I50 B;  3WWV A;  1ILQ A;  3HOU B;  4HMI A;  4JI7 Q;  3DUZ A;  4TQU S;  2I5L X;  3U58 A;  3BVZ A;  3HRZ C;  4JI6 L;  4X3T A;  4FVM A;  4CDD C;  2FFK B;  3P75 A;  1ENF A;  4R8I A;  3CCS A;  2N55 A;  2DJF C;  5FKA C;  2XWB B;  1VQG A;  1MI2 A;  1RCV D;  1SFO H;  1GOZ A;  2KOL A;  4XT3 B;  3J7A F;  1KIX A;  2L1B A;  1K8G A;  2D0O A;  4H02 A;  4ZKC B;  4A3K B;  3BJU A;  3L3O C;  3RMH A;  3D4R A;  2BDO A;  3VR5 A;  3JAM E;  4POG A;  4TKO B;  3PUY A;  4X3U A;  5C0X H;  2VNU D;  1HNZ Q;  3KYH C;  4DAM A;  1WTW A;  4R8N A;  3AQQ A;  4IOA A;  1Y1V G;  3M7N A;  3M7G A;  1CA6 A;  1GJX A;  4AIM A;  4ZK9 B;  2MJ8 A;  3NQT A;  1CQF A;  1AH9 A;  3L7Z C;  3HKZ E;  4IPH A;  1DYQ A;  3AFP A;  4DV7 Q;  4N8X 1;  5KRU A;  1VQH A;  3PUV A;  3I3C A;  2N3S A;  2OWO A;  3KJO A;  3A8J E;  1EYG A;  2PW5 A;  5M5W B;  1FL0 A;  4MZ9 A;  1TWC B;  3GP7 A;  1JE5 A;  5FO8 B;  4KKS A;  1JR0 D;  1WTR A;  4BA1 I;  4C3I H;  3RR5 A;  5JPM C;  3KJP A;  5G3L F;  5IWA Q;  1NNX A;  1WTO A;  4YCW A;  3T1H Q;  1VDZ A;  4BY7 B;  1CKM A;  4GNX A;  4A3D H;  5GQO A;  4ID6 A;  5K36 H;  4DNT B;  3J7Y W;  1NJI C;  5DM7 3;  3QIA A;  2F4V Q;  5C44 H;  2YTV A;  1K9M C;  4C56 C;  2YV5 A;  2IWH A;  2CW0 C;  1SYC A;  1SSO A;  1CZG A;  4LF9 L;  3MXG A;  1U4P A;  2F0Q A;  4NPS A;  1K8M A;  2CWA A;  4GOP B;  2M2L A;  3GTP H;  2XSC A;  1PHJ A;  2J0T D;  2PQE A;  1GUS A;  1J5E L;  3I2Z A;  2JE6 I;  2TSS A;  3H91 A;  1VQO A;  4QJF A;  4JYA L;  5M3F G;  2ZT9 C;  2F0M A;  1LAC A;  3LGJ A;  4ILW A;  2QA4 A;  4RWS C;  2A6E C;  1LTR D;  4JC0 A;  5I4D A;  2RA4 A;  4DNI A;  1EY8 A;  3FVQ A;  3P20 A;  2J7Z A;  3PO2 G;  1I4G A;  4XTC S;  2RDG A;  3FRP B;  2UUB L;  4KY7 A;  4A3B H;  3TP5 A;  4K14 A;  4AYB G;  3JAM c;  2E2J H;  2B8G A;  3NUC A;  2JA6 G;  2UXD Q;  3PIP A;  3KBX A;  4UHV A;  2XRQ D;  2IX1 A;  4JI7 L;  2K52 A;  2D9U A;  4K8I A;  5LMN L;  2MUY A;  3MAQ A;  4G4K A;  2I46 A;  2IY5 B;  2C5C A;  2UU9 L;  1N8R C;  2C9O A;  2WAQ E;  1XMO L;  1KRS A;  2UXB Q;  1F2Y A;  4CKB A;  4DV0 L;  1D8L A;  1RJT A;  1KAW A;  1AN8 A;  5EPK A;  4KY6 A;  5GAG C;  3ZYY X;  1A15 A;  5JEA J;  3D8G A;  3KBG A;  3QJY A;  3S2D H;  4K2K A;  2EJF C;  5CV7 A;  1A2U A;  3S1Q B;  1QVC A;  1EQT A;  3D4D A;  4ZUI A;  5IIF A;  2M9V A;  4KLK A;  3RZO H;  1FYC A;  2KBN A;  1EL0 A;  1QNU A;  4A4I A;  2CCZ A;  1LTT D;  2KCC A;  2B63 B;  1VQ8 A;  3F2B A;  4XT1 B;  2NZO A;  2OQK A;  1IHZ A;  2NBF A;  1I94 Q;  2IX3 A;  3S2H H;  4RG1 A;  1HFG A;  4CDE C;  4DR1 Q;  1D1I A;  1VQ7 A;  4WJ3 M;  1Y1V H;  4A3I B;  4PZ7 A;  5KND A;  3HOY G;  2K05 A;  2G5D A;  3GTK H;  2WB1 E;  3F1Z A;  4M8A A;  4O1N A;  4IJL A;  4QIW E;  3T1Y Q;  5E4X A;  2ASB A;  3HGB A;  4JBM A;  4B3R Q;  1LAB A;  2CFM A;  4A93 G;  3T1H L;  1HPC A;  2QGQ A;  3S1N H;  5D65 A;  1YNJ C;  1BF4 A;  3S9W A;  3I90 A;  4IQZ A;  3G4S A;  1VQE A;  2E2D C;  4DKA C;  5LMU L;  2KEC A;  1KLU D;  3D0F A;  2B2Y A;  3I4O A;  1Q7Y C;  3M4Y A;  1Q1B A;  1Z7T A;  3E6Z X;  1Q90 A;  4EQ5 A;  5DLQ E;  2HD3 A;  4DXG A;  1JWS D;  4R4Q A;  1ENA A;  3OSO A;  2N78 A;  2HIX A;  1X3E A;  1ZXT A;  4P75 A;  3NXW A;  4LW1 A;  1YNN D;  5IGD A;  1S5E D;  1IKL A;  2IX0 A;  1J6Q A;  2R7Z B;  4A3J B;  2NVQ H;  4IFD I;  5KIX A;  4LF4 Q;  4FNF A;  3HOZ G;  1A3T A;  1QIL A;  1WTQ A;  1UE7 A;  2IW3 A;  3NK9 A;  5AJ3 Q;  3BYY B;  4TRD A;  1Y1W H;  3GTQ B;  3NBH B;  1JOQ A;  4GOP A;  1DM0 B;  1WCM B;  1BQQ T;  3G48 A;  4YY3 L;  1K28 A;  4HCE A;  3BYT B;  3CCM A;  2QDL A;  1EWH A;  1HCZ A;  1KDB A;  4JI0 L;  2RQX A;  3TP6 A;  1VCI A;  2K1B A;  2OF1 A;  4WJW A;  1MSG A;  3I56 A;  2R93 G;  1ONL A;  1QVG A;  2F0V A;  5JVG 3;  4BY1 B;  2O5I C;  2B2T C;  5M3F H;  4DV6 L;  3S14 B;  1LT3 D;  2UXD L;  3F2D A;  1KRT A;  3U50 C;  1NAP A;  1G2T A;  5C4Z A;  4J8Q A;  1PH1 A;  3T53 B;  3PO2 H;  3ULL A;  4LF6 Q;  2UXB L;  2EY5 A;  5BN5 A;  1M1K C;  4R4O A;  2F4I A;  2Y0S B;  2JA8 B;  2OEO A;  3S1M H;  1PH6 A;  5I6Y A;  1EY6 A;  1ZKO A;  3KLS X;  4HR7 B;  2JA6 H;  2LFN A;  1SYB A;  3CC4 A;  5EKI A;  3RZD B;  2PMZ B;  1K3R A;  3DXJ C;  3KLS A;  1P16 A;  4OX9 Q;  1RL2 A;  4XQJ A;  3EFX D;  1HR0 Q;  2RF4 A;  5JOB A;  4Q5V A;  2K28 A;  3FHW A;  3K57 A;  1MIU A;  3PUX A;  2MFI A;  1YJ9 A;  2P5Z X;  4LFC Q;  1IW7 D;  3A7A B;  2VS1 A;  3BZK A;  3M9B A;  5E3F A;  1DZ1 A;  5HY6 A;  1N34 Q;  1I4X A;  1I94 L;  4DV2 Q;  2ATW A;  1N33 Q;  4DR1 L;  4ZCK A;  1QOH A;  2YTY A;  1BNZ A;  3VA7 A;  3T1Y L;  4B3T L;  4B3R L;  4K6D A;  4HJA A;  3EBE A;  2KJX A;  1IXR A;  3DWP A;  3QOL A;  3PIO 3;  1GUW A;  3S1R B;  3CCU A;  3NTI A;  2F0I A;  4H13 C;  1STH A;  1B70 B;  4KI0 A;  3HOY H;  4JCV E;  4DK6 C;  1K0R A;  1R9T H;  2DUD A;  2NYZ D;  4PZ8 A;  4B3M Q;  4LAA A;  2J4X A;  4DR5 Q;  1STE A;  2H5X A;  2LXK A;  2VB3 X;  4X3S A;  4A93 H;  4IUQ A;  1BBW A;  2R92 G;  3BZC A;  4C3I B;  3GD7 A;  2AUK A;  2A6H C;  1U9R A;  3HP3 A;  4RGO S;  4KKT A;  1PVO A;  3GTO H;  4V19 0;  4A3G B;  3GTM H;  4OEL B;  1LTG D;  3K0Y A;  2L12 A;  1EU4 A;  1PMR A;  5CMD A;  4DR4 Q;  3TP8 A;  4JPB W;  4A3D B;  3HEJ A;  5M5Y B;  3MFY A;  1I4P A;  2JN4 A;  3P7J A;  1H9J A;  3S15 H;  2EJG C;  5CBE E;  1G2S A;  4M1U B;  3M85 A;  3C3L A;  4JV5 Q;  1WTH A;  1SJH D;  4OXP A;  5C44 B;  1GUG A;  4DA2 A;  2NN6 I;  3NWS A;  4ZYS A;  5C3W A;  3NBH A;  1S5D D;  1TWF H;  4LF5 Q;  3CRL C;  2XNA C;  3HOZ H;  1VQB A;  3OW2 A;  4RKL A;  3J80 L;  3HOX G;  2B2V C;  3JC6 6;  3CW2 C;  3VA5 A;  1FJG L;  4DR3 Q;  4QGU A;  1HZB A;  1B4O A;  2RKS A;  5F2D A;  3I4M B;  1N36 Q;  2RHS B;  5J3B A;  4KHP Q;  1Y8P B;  1HRJ A;  5LMN W;  5IYB G;  5DAU A;  4U68 A;  3T13 A;  4IPG A;  2EXZ A;  4I65 A;  1EQV A;  2F0H A;  5A2Q L;  1W3S A;  2VQF Q;  4B9X A;  3I8Z A;  2K32 A;  2F03 A;  2EY6 A;  4A3B B;  3J7Z C;  2JQO A;  1L0Y B;  2L9H A;  1HUN A;  2E2J B;  2F0U A;  3PQI A;  2OQ0 A;  5HGT A;  1Z9F A;  4GZY C;  1PRT D;  2VUM B;  1HR0 L;  2PZU A;  3W1G A;  1K8O A;  3G7L A;  1MBY A;  4NXN L;  1VQI A;  1VQJ A;  2VQE Q;  1U0L A;  2HQE A;  1BCP D;  1PFN A;  1Y14 B;  4LFC L;  2QDB A;  2FHT A;  3R93 A;  2NVY H;  3SHL A;  1G29 1;  1PTO C;  2RCN A;  1E7Z A;  1QG7 A;  2K6A A;  1LTI D;  4BBS G;  1EFW A;  3GDE A;  4TVA B;  1I6V C;  1N34 L;  4JI6 Q;  4OO1 G;  4OWW B;  4DR6 L;  3J81 L;  4DUZ Q;  4RMF A;  4NW2 A;  2Q8R E;  1JCK B;  2NZH A;  3ERS X;  4J15 A;  2IHF A;  2JJQ A;  5GAE C;  3QB3 A;  1HJP A;  3E0E A;  1NR4 A;  3W5O A;  3H6M A;  2SEB D;  3RZO B;  5COY A;  3CME A;  1WVL A;  1BXT A;  5KYL A;  1PYW D;  1D5X C;  2MNA A;  4LWC A;  4OEM B;  1NMG A;  1A6X A;  4Q0F A;  1EUJ A;  3K5L A;  3CCJ A;  4I7Z C;  2E5L L;  5AFW A;  3D4W A;  2RHQ B;  3S2H B;  3CD6 A;  3OTO Q;  1V8Q A;  1Y1V B;  4GNX C;  1E2Z A;  1SLJ A;  2F0N A;  5H1S E;  4DXF A;  3GTK B;  3QOJ A;  5C0X J;  2AQ3 B;  3MVV A;  4QCL A;  1PLF A;  3A8K E;  3D31 A;  4HSP A;  5EAY A;  4A3C G;  2F0L A;  5E4W C;  3QG1 A;  1VQF A;  4C3H G;  1RHP A;  3LX0 A;  3NWT A;  4POF A;  1S5B D;  4JV5 L;  1E24 A;  3K6O A;  3OIP A;  2K5D A;  4HAE A;  1L0W A;  3A5U A;  4CBV A;  4RHS A;  2R92 H;  2JA7 G;  3K7U C;  1G91 A;  3PUW A;  4WRD A;  3PMF A;  4YCU A;  1YVC A;  4ALP A;  2E75 C;  1A3U A;  3KFU A;  4DPG A;  2NVQ B;  3BDO A;  4CJ0 B;  4XDX A;  4DN4 M;  1QWY A;  1K3B C;  1S3O A;  2D5D A;  2R7D A;  2Z0S A;  4QUC A;  5FO7 B;  2WKD A;  4LF9 Q;  1FNU A;  2NVT B;  4G57 A;  1L0X B;  1WTP A;  2G9D A;  4X62 L;  4K6L A;  3PCO B;  2L11 A;  4DNR B;  5M5X H;  2Q2T A;  1H9K A;  2F0D A;  4N8F A;  2PCF B;  1DOL A;  2Z4H A;  1T9H A;  4RAU C;  1J5E Q;  1E22 A;  4L63 B;  5ELN A;  4JYA Q;  3HOX H;  3NEL A;  2WAQ G;  3SE0 A;  4Y52 H;  4S3S A;  3PIO A;  1OXT A;  2CQA A;  1N32 L;  1NCV A;  4RKB A;  3O13 A;  2XWJ B;  5M3F B;  1ML0 D;  4WOR A;  1L2F A;  1MD2 D;  1B8A A;  3P1H A;  1K0S A;  1DOM A;  2UUA Q;  4KV6 A;  3PO2 B;  1ILP A;  5J39 A;  2VQE L;  3K8A A;  1TQO A;  3BVM A;  3CQZ H;  1HNW L;  1I6H H;  3TDQ A;  3K5N A;  5NUC A;  4AYB B;  2VZA A;  3A0J A;  5CV8 A;  5LMN Q;  2JA6 B;  4JI3 L;  2UU9 Q;  5EKK A;  1AZQ A;  1XMO Q;  4DUZ L;  1PFM A;  3L2P A;  5CR3 A;  3E0J A;  3FKI H;  1HXY D;  4HIK A;  4DAY B;  4DV0 Q;  3RN2 A;  4IUU A;  5C4X G;  3EIV A;  1IBM L;  5ELE A;  1MSH A;  4DR2 L;  2PZW A;  2MGS A;  2Y0S E;  4PQX A;  5TSS A;  4EQO A;  4H7B A;  3MC0 B;  2EYF A;  4J1M A;  4L5T A;  4O42 A;  1U4M A;  4ZRZ A;  4C3J H;  4DK3 C;  3HFZ B;  2EYL A;  2BCO A;  1GUN A;  2UUC L;  4BBS H;  4DFA A;  4OO1 H;  4YWK A;  1BKB A;  2OXP A;  3HOV H;  4UP7 A;  4IUP A;  3GV6 A;  1B1Z A;  2ZM6 L;  2HUG A;  3ND8 A;  3TS2 A;  1R4P B;  4F8M A;  2EYO A;  3OTO L;  2PI2 A;  1EIF A;  1BBU A;  2K14 A;  3ZJY C;  2WV6 D;  4R4T A;  2B2Y C;  3GTL H;  1PH8 A;  1F2M A;  3NSW A;  2ICI A;  2NTS A;  1W6J A;  4KD4 A;  1Z6H A;  2RVL A;  1PRT B;  1O7Y A;  4NP5 A;  1WD1 A;  1JQY D;  3CC2 A;  3UE1 A;  2KCT A;  2OTJ A;  3NHH A;  1LM0 A;  1TWA H;  3ERQ A;  3MFG A;  1J8I A;  1BCP B;  1V43 A;  1IKM A;  1HA6 A;  1YIT A;  1G6P A;  2R7F A;  2B8F A;  1H9R A;  3HOY B;  1UAP A;  1SMY C;  4XQN A;  3OIQ A;  4OWX B;  1O78 A;  1YBY A;  3OHX C;  2F3W A;  5EJW A;  2HCC A;  1EYC A;  1GXD C;  3MTS A;  4FXG C;  1ICF B;  3OYY A;  3SK6 A;  2Z1C A;  5LMU Q;  4A93 B;  2KQ3 A;  4A3C H;  4GOP C;  4X65 L;  1V1O A;  1YHQ A;  4C2M H;  4DV3 L;  4RGM A;  5LL6 S;  1STY A;  4A75 A;  3GTO B;  1MHW C;  4C3H H;  3GTM B;  1D2B A;  4UDU C;  1G6Z A;  1Y1W G;  1KDA A;  2VXW A;  4GN5 A;  5ELO A;  3EN2 A;  2FIN B;  3CCE A;  3M4O H;  1Y8N B;  3TZU A;  1BBX C;  2OCE A;  1M4V A;  3RLF A;  3S15 B;  1IYV A;  2JA7 H;  4OWT B;  4PMW A;  3E3X A;  1HQR D;  1VMC A;  4JI2 L;  1GM5 A;  3TN2 A;  3T56 B;  2B3G A;  1QVF A;  2Q2U A;  1X3Q A;  1TKW B;  2XVS A;  1SYG A;  5J22 A;  3TEH B;  4DV4 L;  3VR4 A;  1TWF B;  4LMQ D;  3PF5 A;  2Z9H A;  4RA8 A;  5EBC A;  3RLO A;  3R2I A;  3HOZ B;  3A8I E;  3J81 j;  4YY3 Q;  3K7A H;  3K5O A;  4HN7 A;  4KN4 C;  5BN4 A;  2UUA L;  4JI0 Q;  1T5E A;  5IGF A;  3B6Y A;  2EY2 A;  1HR0 W;  5DEH A;  1PH4 A;  2EE1 A;  4R1J A;  1B44 D;  5IT9 E;  3MXN A;  4ME5 A;  4ZUJ A;  1TU2 B;  4DV6 Q;  2R93 B;  1XTD A;  5C4J H;  1KXL A;  1RTN A;  2FXQ A;  2QEJ C;  3G71 A;  1UE1 A;  1PRT F;  1GHK A;  1KNE A;  3A55 A;  2E2I H;  4OHJ A;  4IAL A;  4CDC C;  2PYK A;  1SYF A;  1BCP F;  5KEE A;  2SNS A;  4RGN A;  1UWV A;  2KUM A;  2QCP X;  4L5Q A;  4DAY A;  2H1E A;  1WD0 A;  2QW7 A;  2XTI A;  5IYD G;  2NVY B;  2CH4 A;  4KTA A;  2A69 D;  2EYM A;  4KD3 A;  2DY8 A;  2ZTC A;  3BDL A;  5C4X H;  1D6E C;  4Y7N H;  4L5R C;  3JAM L;  2A8V A;  1SE2 A;  2Z6K A;  4F88 A;  2HDM A;  4DV5 Q;  1T5X D;  2RBM A;  1K83 H;  1SRO A;  3H3V H;  5I2X A;  3L9A X;  4LF8 L;  2F0F A;  2E74 C;  3I4L A;  2CQO A;  1A3V A;  1GD7 A;  4KY5 A;  3U4V A;  1PTO H;  1UNS A;  2EOT A;  2IL8 A;  1TY0 A;  3VYR A;  4J6H A;  4YWL A;  4B3T Q;  1VQN A;  3UE0 A;  4JBW A;  1DD2 A;  1C7Y A;  3E9H A;  2CVR A;  2Z8L A;  4WFN 3;  1VQK A;  1EIY B;  1RIP A;  1ET9 A;  3N6R A;  5BR8 L;  2ID0 A;  2E2H H;  4LF7 L;  3RN5 A;  1CA5 A;  1X56 A;  4X66 L;  2F0E A;  5E7N A;  4DK1 A;  1AP0 A;  3FPU B;  1UEB A;  2B39 A;  1SJE D;  2NVX H;  1IL2 A;  2F0J A;  2VB2 X;  2WKC A;  3OMG A;  5ELD A;  1XX8 A;  2A5H A;  5IT9 c;  3PSI A;  4YIJ A;  2R92 B;  4IPD A;  4APV A;  5IOD A;  4QQB X;  4KJO A;  3CPF A;  2V4D A;  5EBD A;  3SDZ A;  3A7L A;  2EVB A;  4JBJ A;  4HJ8 A;  4BXX G;  1B50 A;  5IGB A;  1B2T A;  1JOK A;  1NUC A;  1SR3 A;  1PZK D;  3TBI B;  1FGB D;  4GKK Q;  4QY7 A;  5M5X B;  1LTB D;  1P8L A;  3ND9 A;  3BDC A;  3HS0 C;  1FJG Q;  5C3X A;  2B29 A;  4IUN A;  3HOX B;  1CKO A;  3FEW X;  2A68 D;  3DEP A;  1EFI D;  1E3P A;  1VQL A;  1DGS A;  4N9T A;  1E2W A;  1JJC B;  4RCN A;  2RDF A;  1U4R A;  3DEO A;  2ZXP A;  2EDG A;  3C1F A;  3NQI A;  3H15 A;  1Q82 C;  1KD1 C;  1Q8I A;  1CQV A;  1XYI A;  3S17 H;  5JAV A;  5A2Q E;  1TWH B;  2C35 B;  5IGE A;  4FXK C;  1HZA A;  3RD4 A;  1STA A;  1YHB A;  4UP8 A;  2QF7 A;  1YJW A;  1UE6 A;  3H0G G;  3NTH A;  2KCM A;  3W3A A;  3K81 C;  1BDO A;  1VQD A;  1X54 A;  2WIN B;  4NXN Q;  3BVG A;  4DV5 L;  5KGU A;  4O0A A;  3LWU A;  4H0L C;  1NSN S;  3VR3 A;  1SFO B;  2QEX A;  1HZ9 A;  3TP7 A;  3CCV A;  1ZYR D;  3S16 H;  4AYB E;  2O2L D;  5IYD H;  1NMF A;  4PNY A;  4DR6 Q;  2LKV A;  3GV3 A;  2H4O A;  3HOW G;  4ZAI A;  1OO9 B;  2F0W A;  1IZ6 A;  4BBS B;  1G8Z D;  1Y8O B;  2RSN A;  2LY7 A;  4A3K H;  3AMU A;  1B9M A;  2N88 A;  3J81 E;  1STN A;  2KCN A;  1B3A A;  1H9M A;  4CKC A;  1EWI A;  4JI1 Q;  1KC8 C;  2V1C C;  3UDG A;  2X6G A;  3D6W A;  4CJ2 C;  5IP7 G;  2ZTD A;  2LXJ A;  3T51 B;  2PPB C;  3GTL B;  1YJN A;  3K58 A;  3J80 i;  2E5L Q;  4EVO A;  4JOI C;  5C0X I;  3MHB A;  1ESR A;  3IRB A;  5LL6 X;  3STB D;  2BH8 A;  1TWA B;  2ZXO A;  1SRU A;  1HZC A;  2Q8T A;  4OON A;  4IFD G;  2DGY A;  4P74 A;  4A3E G;  5M5W H;  1DJR D;  3FMC A;  5M9O A;  2G9H D;  4QUF A;  3DHQ A;  4A76 A;  3AYH B;  1ASZ A;  3GO5 A;  2K33 A;  1X3P A;  3GTG H;  3KF8 B;  4C3H B;  4DAV A;  1BOS A;  5C3E G;  1ENC A;  2MQH A;  1QE6 A;  1O7Z A;  1J9O A;  4NDX A;  2A73 B;  4EQN A;  4I7A A;  1PH3 A;  3M4O B;  3MXP A;  4XYQ A;  3NBI A;  3I4N G;  2RDH A;  4XYO A;  2YTX A;  3V96 A;  2JA7 B;  4GKK L;  5CV9 A;  2Z4I A;  3QO2 A;  5DM6 3;  3GTP B;  1EU3 A;  5CBA E;  5KNC A;  1Q8K A;  4BBR G;  4KK7 A;  3SXH A;  1ROD A;  5JPN C;  4BXX H;  4JI5 L;  4JW0 A;  2Q2I A;  3Q24 A;  3J81 i;  1VMP A;  3V05 A;  1EIH A;  1I4H A;  1YNN C;  4X62 Q;  3H94 A;  4K0K L;  1JC7 A;  3K7A B;  4MTN A;  1KDC A;  1ZEQ X;  4GKJ L;  2ALY B;  1NR2 A;  4FXD A;  1LT5 D;  4IZ8 A;  1LUZ A;  1GUT A;  2BE5 D;  3KDF B;  1IYJ B;  3DMU A;  1N32 Q;  1FNW A;  2WAQ B;  1GO3 E;  4P73 A;  1BVS A;  4HTH A;  5FLX L;  3FKI G;  4XQQ A;  5JVH 3;  2HHH L;  5C6A A;  1TS5 A;  3DWQ A;  3J81 c;  3VYS A;  1X55 A;  4CDF C;  1PYB A;  4MNO A;  2E2I B;  1V1Q A;  1HNW Q;  1ASY A;  1HTP A;  4C3J G;  1B9N A;  5KYI A;  1NTG A;  5I2Y A;  1E0B A;  5D14 A;  2A68 C;  4JI3 Q;  3S2D B;  1U5K A;  3UDI A;  4RFB A;  4FF2 A;  1XXG A;  3HOV G;  1PH7 A;  4B9W A;  3HKZ G;  1YIJ A;  5GAH C;  4MHE A;  3H0G H;  3GQB A;  2NWG A;  1X3G A;  1JOR A;  3OOC A;  1IBM Q;  4DR2 Q;  1TT2 A;  1XWE A;  1H9S A;  1KNA A;  1EZ6 A;  1EY7 A;  1PYS B;  5C4X B;  3VYU A;  4Y7N B;  1CUK A;  5FLM G;  4LUO A;  4A3F G;  2K5Q A;  4MTK A;  2SOB A;  1CSQ A;  4JI1 L;  1MJE A;  4AQY L;  1UEA B;  1FD7 D;  4CJ1 B;  2UUC Q;  4RCO A;  2A1A A;  2NUC A;  1L1O A;  1O7I A;  3HOW H;  3EQL C;  1S72 A;  1EYA A;  2KEE A;  4X64 L;  1JWM D;  2ZM6 Q;  3UDF A;  4LFB L;  4K5V A;  5IY0 A;  4QIW B;  4LK1 C;  1IW7 C;  1LTL A;  2DNC A;  5D3I B;  2HT1 A;  5JJL A;  5IP7 H;  3I72 A;  4ZKB B;  3S1N B;  2AWN A;  2ZJP A;  1C0A A;  3C46 A;  1XNQ L;  4L6T B;  1HUM A;  3KLW A;  1RD9 D;  2E2H B;  1I4Q A;  2K50 A;  1AE3 A;  1G51 A;  1MGS A;  2CW0 D;  4RGT A;  1E1O A;  2F0S A;  3PO3 G;  3Q23 A;  1SYE A;  4K5X A;  4IFD H;  3ITP A;  4NKL A;  4A3E H;  1EY9 A;  3CMA A;  2NVX B;  1X32 A;  5IP9 G;  1QCB D;  1JMC A;  3K80 C;  1DON A;  2CHB D;  2FMC A;  3KF8 A;  4X65 Q;  1HH2 P;  4OIK A;  4B08 A;  1VQP A;  1EQR A;  4DV3 Q;  1Q12 A;  1SXT A;  2I07 B;  1TY2 A;  2OTL A;  3C2P A;  4CKE A;  1N9W A;  2AQ2 B;  3NP8 A;  1PH5 A;  2I0Q A;  4KMU C;  2A6E D;  1Y1W B;  1GHJ A;  2LMC B;  5C3E H;  2HCI A;  2F0P A;  1DXM A;  4JI2 Q;  1IBL Q;  2N49 A;  3I4N H;  2E76 C;  4ZQ3 A;  4Z9C B;  3D6C A;  3GTQ H;  3AEV A;  2EZV A;  1WCM H;  4BWG B;  1KHI A;  1NE3 A;  1E2V A;  4DV4 Q;  2XIW A;  3WOE A;  2I5H A;  4BBR H;  1WTV A;  1M8A A;  4JK1 C;  3WDN A;  2A19 A;  1A62 A;  3MXN B;  3CP0 A;  4EX5 A;  3DLL A;  3M3Y H;  3R3O A;  3KOJ A;  1K73 C;  5IGC A;  3KDF A;  4BY1 H;  4DF7 A;  2JYO A;  4FF3 A;  1SE4 A;  3MXU A;  4C1N I;  1X6O A;  2AHO B;  1TS3 A;  3LNN A;  1OXX K;  4KN7 C;  5FO9 B;  1VF7 A;  4X3K A;  4IO9 A;  5GAD C;  5CGK A;  5EQ0 A;  4HJ5 A;  4N9P A;  3S1M B;  3CHB D;  3PUZ A;  3G6J B;  4B3S L;  3S17 B;  1RKN A;  3DWA A;  4FF1 A;  1XNR L;  4UP9 A;  3TSS A;  2Z6K C;  3V2T A;  3DM1 A;  3I7F A;  3CPW A;  1XPR A;  3OW7 A;  3VR6 A;  2EY1 A;  4X6A H;  3U4Z A;  5I9P A;  3OMC A;  2BE5 C;  2B2W A;  5J1Z A;  1D5M C;  1LTA D;  1JB3 A;  2PMZ E;  5GRO A;  1JWU D;  2PNH A;  2WB1 G;  1PRT C;  4YCV A;  3RUZ A;  3TS0 A;  3W2D A;  1IL8 A;  3W1B A;  2ZXR A;  3S16 B;  1Q1E A;  3I73 A;  3OWF A;  4JI8 L;  3A74 A;  4HED A;  3TRZ A;  1BCP C;  2BA1 A;  4MIU A;  3X3N A;  1B7Y B;  3BS1 A;  3HZX A;  1Q3L A;  2JA5 G;  1LT4 D;  1Q86 C;  5FLM H;  1S5F D;  1S5C D;  4A3F H;  3T16 A;  1CSP A;  2L15 A;  4LF8 Q;  1YNJ D;  1QUQ B;  1SND A;  3KK7 A;  1I5F A;  2AWO A;  1F2Z A;  4P72 A;  3KUP A;  1HHV A;  3SEB A;  4YHH L;  1TR5 A;  4L5S A;  2ENB A;  4KHZ A;  1F9R A;  2Z6B A;  1D7Q A;  1UE5 A;  1QZG A;  1H95 A;  5ELB A;  4HIO A;  3IAY A;  3S1R H;  1JJG A;  1KAB A;  4R4C A;  1R9T B;  5IYC H;  1EOV A;  1LYL A;  1KAA A;  1KTK A;  3CF5 A;  4LFA L;  2GVA A;  2K5W A;  4HID A;  3G6E A;  1PFB A;  1PXU A;  5BR8 Q;  4LF7 Q;  5ELC A;  1LTS D;  2NN6 H;  2GN5 A;  2KHI A;  1SYD A;  5A35 A;  4X66 Q;  3NEM A;  4PMC A;  5C4H A;  1MJC A;  4KJN A;  1VQ4 A;  3ULP A;  3I70 A;  4PZ6 A;  4OGQ C;  4ODG A;  4DAP A;  3PO3 H;  2JA9 A;  5K5P A;  2YU9 H;  1KLG D;  4A3G H;  1U4L A;  1PZJ D;  5IP9 H;  3I55 A;  3GTG B;  2X69 A;  5M3M G;  1IBL L;  5M5Y H;  5ISR A;  3FDT A;  1FR3 A;  3D3R A;  3DM3 A;  2K75 A;  1IBK L;  1I3Q H;  2BDN A;  2K4K A;  3GTJ H;  2TMP A;  4UAI A;  2LSS A;  1EY4 A;  1XMQ L;  1VQA A;  2BA0 A;  3N52 A;  4BS9 A;  1SMX A;  3CCQ A;  3JAM i;  1QNK A;  3VR2 A;  4TSS A;  1TII D;  2JK8 A;  3I4M H;  3KF6 B;  1HNX L;  2K04 A;  2NTT A;  1VQ6 A;  5JEA G;  2HDL A;  2D0P A;  4A3M G;  4DUY L;  2WAC A;  4LUZ A;  3R2T A;  1SDF A;  2F0O A;  1V9P A;  4IUT A;  1FNV A;  1OXS C;  2DY7 A;  1XJV A;  1QB5 D;  1EZ8 A;  1VQC A;  1VQ5 A;  2CH4 W;  2M00 A;  1Q81 C;  5KNB A;  3HOU G;  4QL5 A;  1CKN B;  2PO4 A;  4OIJ A;  2RCF A;  1YI2 A;  3J7A V; 
#chains in the Genus database with same CATH homology
 2NZ1 D;  1ICW A;  2X6L A;  2XRS D;  2B2U A;  1R4Q B;  1O80 A;  3EJI A;  5CV6 A;  4FYD A;  2F1M A;  2SNM A;  1SEB D;  3H0G B;  5FOB B;  1TS4 A;  5C5M A;  4H44 C;  3TZD A;  3BZD B;  1CT1 D;  4FF4 A;  1F2L A;  4CGY B;  2KA7 A;  3FPP A;  4ULL A;  3HOW B;  4G7O C;  1F9S A;  2K01 A;  1LT6 D;  1EIG A;  2K03 A;  4IUR A;  1SNP A;  2NB0 A;  2A6H D;  2ICE C;  2BOS A;  3QWN A;  4HSV A;  1ESF A;  3MA2 B;  4G7H C;  2AUJ D;  2JP1 A;  4K2L A;  4C1N K;  4IUV A;  3IFD A;  3HG9 A;  2Q8I B;  5IGG A;  2O4X A;  1CTM A;  4A3E B;  3UI2 A;  1BR9 A;  2D62 A;  3U9O A;  1HQM C;  2JXM B;  4RH6 A;  1GUO A;  2R3Z A;  1Y69 U;  4PMB A;  1Z47 A;  3ERO A;  1B53 A;  1D5Z C;  3TME A;  5C3E B;  1WTX A;  5E1F A;  2EYP A;  2JSO A;  4FP5 D;  3I4N B;  2A74 C;  4L8J A;  4F7X A;  3NE5 B;  3J80 E;  1STB A;  3LWE A;  4BBR B;  3NTK A;  5IT9 L;  4RHR A;  2SDF A;  2RSO A;  5EKL A;  5CV4 A;  3M3Y B;  2KHS A;  2DN8 A;  2MP1 A;  3CKI B;  1DCZ A;  5JEA H;  1JOO A;  1PTO D;  3CQZ B;  1CM9 A;  1SNM A;  1I6H B;  2EJM A;  1SNO A;  1CHP D;  4K5W A;  3FKI B;  4QMG A;  5FLX E;  2L55 A;  4PV1 C;  1C48 A;  1EEI D;  2KED A;  1H9S B;  2IJ0 A;  4C3J B;  1EY5 A;  3SR1 A;  2L4N A;  2FJ2 A;  3HOV B;  1SNQ A;  3HKZ B;  1IYU A;  1EWC A;  2MPM A;  1ET6 A;  1F9Q A;  2O5J C;  2KVM A;  1TVX A;  2IT1 A;  2A69 C;  1O7L A;  4A3F B;  2DNE A;  1EEF D;  1V1P B;  5CC4 A;  3Q6S A;  2YYZ A;  4OO1 I;  5T1G A;  5ELF A;  3ONA B;  1CFM A;  5I6W A;  1C4Q A;  5JJZ A;  2K7V A;  5EGT A;  1SAP A;  1EYD A;  3A54 A;  2F3V A;  1SBB B;  2JEA I;  5IOC A;  2MHV A;  1HFN A;  3K59 A;  4C2M B;  4IN3 A;  4F87 A;  5G3L D;  4CHT B;  3PO3 B;  4G7Z C;  2YU9 B;  4K8J A;  1BO0 A;  5COR A;  1PDQ A;  1AFP A;  1I3Q B;  3SK8 A;  4IFD J;  3GTJ B;  1II3 A;  2F0G A;  1LO5 D;  2IPK D;  5D3D A;  1A2T A;  1RF2 D;  3CU7 A;  1OXV A;  1SE3 A;  3C1E A;  4FO2 A;  3R8B A;  3IKJ A;  3EVQ A;  3NPP A;  3MWY W;  4OL7 A;  4KHV A;  3F2U A;  2FMM A;  4ZLT F;  5C4J B;  4KKU A;  5FK9 C;  2B2W C;  4NMZ A;  4E6I A;  2L5T A;  1F9P A;  2AQ1 B;  1CI3 M;  2PNR C;  3SK4 A;  3CRK C;  2EYJ A;  4DK0 A;  1W6K A;  1EY0 A;  2D2C C;  4XIG S;  1DOK A;  2B2T A;  4QB4 A;  3H3V C;  1AZP A;  3U9S A;  1LLR D;  3VYT A;  2WII B;  5T1I A;  1RDP D;  1RTO A;  1VF5 C;  1JE4 A;  1STG A;  2F0K A;  1CZW A;  5C0X G;  2PW7 A;  1K83 B;  2EPB A;  3PV0 A;  3T4A C;  1BUV T;  2WP8 J;  2WB1 B;  5CV5 A;  3X3M A;  3MZ5 A;  3SK5 A;  1SMY D;  1F77 A;  1PTO B;  1SNC A;  3KLR A;  1HTL D;  1V1P A;  4HMJ A;  2PZT A;  2QKI C;  1ZYR C;  2GA4 B;  2JA5 B;  5EPJ A;  3AU7 A;  4QF4 A;  5DNF A;  2NN6 G;  1S4Z A;  5BN3 A;  2L0C A;  3IL8 A;  4P2C B;  3BG3 A;  4C3I G;  1JIC A;  4DGZ A;  1TWG B;  4EQP A;  2R6G A;  3OPO A;  3AB9 A;  3I91 A;  3PIP 3;  1QJO A;  1EOT A;  4R9W A;  4ABN A;  1CHQ D;  1AW7 A;  4DU9 A;  5K36 G;  3H09 A;  3URY A;  4BA2 I;  3MEH A;  5EPL A;  4XXE A;  4MN3 A;  1OXU A;  3K5M A;  4EGV A;  2OT2 A;  1UUP A;  1PZI D;  3A56 A;  2QIL A;  3IFT A;  5I9O A;  4V0B A;  1TS2 A;  3WOF A;  3SVM A;  5LHY 1;  1LV9 A;  2F0T A;  5M3M B;  1AEX A;  4U67 3;  3OWE B;  1XTC D;  3EA6 A;  5CYU A;  1HA5 A;  1I4R A;  2LS0 1;  4HCS A;  2B2U C;  3Q0A A;  1C8C A;  1CK1 A;  3Q22 A;  1PTO F;  2EYH A;  1D1K A;  5HUR A;  4LJZ C;  2B2V A;  2R61 A;  5C5L A;  4A3M B;  2JEB I;  3E5S A;  2XN9 C;  1I50 B;  1ILQ A;  3HOU B;  4HMI A;  3DUZ A;  4TQU S;  3BVZ A;  3HRZ C;  4X3T A;  4FVM A;  2FFK B;  3P75 A;  1ENF A;  4R8I A;  2N55 A;  5FKA C;  2XWB B;  1MI2 A;  1RCV D;  1GOZ A;  2KOL A;  4XT3 B;  3J7A F;  2L1B A;  4ZKC B;  4A3K B;  3L3O C;  3RMH A;  3D4R A;  2BDO A;  3VR5 A;  3JAM E;  4TKO B;  3PUY A;  4X3U A;  5C0X H;  2VNU D;  1WTW A;  4R8N A;  3M7N A;  3M7G A;  1CA6 A;  1GJX A;  4ZK9 B;  2MJ8 A;  3NQT A;  1CQF A;  3L7Z C;  1DYQ A;  5KRU A;  3PUV A;  3I3C A;  3A8J E;  2PW5 A;  5M5W B;  1TWC B;  3GP7 A;  5FO8 B;  4KKS A;  1JR0 D;  1WTR A;  4BA1 I;  5JPM C;  5G3L F;  1WTO A;  1VDZ A;  4BY7 B;  4ID6 A;  5K36 H;  4DNT B;  3J7Y W;  5DM7 3;  3QIA A;  4C56 C;  2IWH A;  2CW0 C;  1SYC A;  1SSO A;  1CZG A;  3MXG A;  1U4P A;  2F0Q A;  1K8M A;  2M2L A;  2XSC A;  2J0T D;  2PQE A;  1GUS A;  2JE6 I;  2TSS A;  3H91 A;  2ZT9 C;  2F0M A;  1LAC A;  4ILW A;  4RWS C;  2A6E C;  1LTR D;  5I4D A;  2RA4 A;  1EY8 A;  3FVQ A;  3P20 A;  2J7Z A;  1I4G A;  4XTC S;  2RDG A;  3FRP B;  4KY7 A;  3TP5 A;  4K14 A;  2B8G A;  3NUC A;  3KBX A;  2XRQ D;  2IX1 A;  2D9U A;  4K8I A;  2MUY A;  3MAQ A;  4G4K A;  2I46 A;  2C5C A;  2C9O A;  1F2Y A;  4CKB A;  1RJT A;  1AN8 A;  5EPK A;  4KY6 A;  3ZYY X;  1A15 A;  5JEA J;  3D8G A;  3KBG A;  3QJY A;  4K2K A;  2EJF C;  5CV7 A;  1A2U A;  3S1Q B;  1EQT A;  3D4D A;  4ZUI A;  5IIF A;  2M9V A;  1FYC A;  1EL0 A;  1QNU A;  1LTT D;  2KCC A;  2B63 B;  4XT1 B;  1IHZ A;  2NBF A;  2IX3 A;  1HFG A;  1D1I A;  4A3I B;  5KND A;  2K05 A;  4M8A A;  4O1N A;  5E4X A;  3HGB A;  1LAB A;  1HPC A;  5D65 A;  1YNJ C;  1BF4 A;  3S9W A;  3I90 A;  4IQZ A;  2E2D C;  1KLU D;  2KEC A;  2B2Y A;  3M4Y A;  1Q1B A;  1Z7T A;  3E6Z X;  1Q90 A;  4DXG A;  1JWS D;  1ENA A;  3OSO A;  1ZXT A;  3NXW A;  1YNN D;  5IGD A;  1S5E D;  1IKL A;  2IX0 A;  2R7Z B;  4A3J B;  4IFD I;  5KIX A;  4FNF A;  1A3T A;  1QIL A;  1WTQ A;  2IW3 A;  3NK9 A;  3BYY B;  4TRD A;  3GTQ B;  1JOQ A;  1DM0 B;  1WCM B;  1BQQ T;  4HCE A;  3BYT B;  1EWH A;  1HCZ A;  1KDB A;  2RQX A;  3TP6 A;  1VCI A;  2K1B A;  2OF1 A;  4WJW A;  1MSG A;  1ONL A;  2F0V A;  5JVG 3;  4BY1 B;  2O5I C;  2B2T C;  3S14 B;  1LT3 D;  1NAP A;  1G2T A;  5C4Z A;  4J8Q A;  3T53 B;  2EY5 A;  5BN5 A;  2F4I A;  2Y0S B;  2JA8 B;  2OEO A;  5I6Y A;  1EY6 A;  1ZKO A;  3KLS X;  4HR7 B;  2LFN A;  1SYB A;  5EKI A;  3RZD B;  2PMZ B;  3DXJ C;  3KLS A;  4XQJ A;  3EFX D;  5JOB A;  4Q5V A;  2K28 A;  3K57 A;  3PUX A;  1IW7 D;  3A7A B;  5E3F A;  1DZ1 A;  1I4X A;  1QOH A;  1BNZ A;  3VA7 A;  4K6D A;  2KJX A;  3DWP A;  3QOL A;  3PIO 3;  1GUW A;  3S1R B;  3NTI A;  2F0I A;  4H13 C;  1STH A;  4KI0 A;  2NYZ D;  4LAA A;  2J4X A;  1STE A;  2VB3 X;  4X3S A;  4IUQ A;  4C3I B;  3GD7 A;  2AUK A;  2A6H C;  1U9R A;  3HP3 A;  4RGO S;  4KKT A;  4V19 0;  4A3G B;  5CMD A;  1LTG D;  2L12 A;  1EU4 A;  1PMR A;  3K0Y A;  3TP8 A;  4A3D B;  3HEJ A;  5M5Y B;  3MFY A;  1I4P A;  3P7J A;  1H9J A;  2EJG C;  5CBE E;  1G2S A;  4M1U B;  3M85 A;  3C3L A;  1SJH D;  5C44 B;  1GUG A;  4DA2 A;  2NN6 I;  3NWS A;  4ZYS A;  5C3W A;  3NBH A;  1S5D D;  3CRL C;  2XNA C;  4RKL A;  3J80 L;  2B2V C;  3VA5 A;  1B4O A;  2RKS A;  5F2D A;  3I4M B;  1Y8P B;  1HRJ A;  5DAU A;  4U68 A;  3T13 A;  2EXZ A;  4I65 A;  1EQV A;  2F0H A;  5A2Q L;  4B9X A;  3I8Z A;  2K32 A;  2F03 A;  2EY6 A;  4A3B B;  1L0Y B;  2L9H A;  1HUN A;  2E2J B;  2F0U A;  5HGT A;  4GZY C;  1PRT D;  2VUM B;  2PZU A;  1K8O A;  3G7L A;  1MBY A;  2HQE A;  1BCP D;  1PFN A;  2QDB A;  2FHT A;  3R93 A;  3SHL A;  1G29 1;  1PTO C;  1QG7 A;  2K6A A;  1LTI D;  1I6V C;  4OO1 G;  3J81 L;  4NW2 A;  2Q8R E;  1JCK B;  3QB3 A;  1NR4 A;  3H6M A;  2SEB D;  3RZO B;  5COY A;  1WVL A;  1BXT A;  5KYL A;  1PYW D;  1D5X C;  1A6X A;  4Q0F A;  3K5L A;  4I7Z C;  5AFW A;  3D4W A;  3S2H B;  1V8Q A;  1Y1V B;  1E2Z A;  2F0N A;  3GTK B;  4DXF A;  3QOJ A;  5C0X J;  2AQ3 B;  3MVV A;  4QCL A;  1PLF A;  3A8K E;  3D31 A;  4HSP A;  2F0L A;  5E4W C;  3QG1 A;  4C3H G;  1RHP A;  3LX0 A;  3NWT A;  1S5B D;  3K6O A;  3OIP A;  2K5D A;  4HAE A;  4CBV A;  4RHS A;  1G91 A;  3PUW A;  4WRD A;  3PMF A;  2E75 C;  1A3U A;  2NVQ B;  3BDO A;  4CJ0 B;  4XDX A;  4DN4 M;  1QWY A;  4QUC A;  5FO7 B;  2D5D A;  2WKD A;  1FNU A;  2NVT B;  4G57 A;  1L0X B;  1WTP A;  2G9D A;  4K6L A;  2L11 A;  4DNR B;  1H9K A;  2F0D A;  2PCF B;  1DOL A;  2Z4H A;  4RAU C;  4L63 B;  3SE0 A;  4S3S A;  1OXT A;  2CQA A;  1NCV A;  4RKB A;  3O13 A;  2XWJ B;  5M3F B;  1ML0 D;  4WOR A;  1MD2 D;  3P1H A;  1DOM A;  4KV6 A;  3PO2 B;  1ILP A;  5J39 A;  1TQO A;  3BVM A;  3TDQ A;  3K5N A;  5NUC A;  4AYB B;  5CV8 A;  2JA6 B;  5EKK A;  1AZQ A;  1PFM A;  5CR3 A;  3E0J A;  1HXY D;  4IUU A;  5ELE A;  1MSH A;  2PZW A;  2MGS A;  4PQX A;  5TSS A;  4EQO A;  4H7B A;  3MC0 B;  2EYF A;  4J1M A;  4O42 A;  1U4M A;  4ZRZ A;  2EYL A;  2BCO A;  1GUN A;  4DFA A;  4OO1 H;  2OXP A;  4IUP A;  3GV6 A;  1B1Z A;  2HUG A;  3ND8 A;  1R4P B;  4F8M A;  2EYO A;  2WV6 D;  2B2Y C;  1F2M A;  3NSW A;  2ICI A;  2NTS A;  1W6J A;  4KD4 A;  1Z6H A;  2RVL A;  1PRT B;  1O7Y A;  4NP5 A;  1WD1 A;  1JQY D;  3NHH A;  1J8I A;  3ERQ A;  3MFG A;  1BCP B;  1V43 A;  1IKM A;  1HA6 A;  2B8F A;  1H9R A;  3HOY B;  1UAP A;  1SMY C;  4XQN A;  3OIQ A;  1O78 A;  3OHX C;  5EJW A;  2F3W A;  2HCC A;  1EYC A;  1GXD C;  3MTS A;  4FXG C;  3SK6 A;  2Z1C A;  4A93 B;  2KQ3 A;  1V1O A;  4RGM A;  5LL6 S;  1STY A;  3GTO B;  1D2B A;  3GTM B;  4UDU C;  1G6Z A;  1KDA A;  2VXW A;  2FIN B;  1Y8N B;  3TZU A;  1BBX C;  3RLF A;  1M4V A;  3S15 B;  1IYV A;  4PMW A;  1HQR D;  1VMC A;  3TN2 A;  3T56 B;  1X3Q A;  1TKW B;  2XVS A;  1SYG A;  5J22 A;  3VR4 A;  1TWF B;  4LMQ D;  4RA8 A;  5EBC A;  3R2I A;  3HOZ B;  3A8I E;  3K5O A;  4HN7 A;  4KN4 C;  5BN4 A;  1T5E A;  5IGF A;  2EY2 A;  5DEH A;  2EE1 A;  1B44 D;  5IT9 E;  3MXN A;  4ME5 A;  4ZUJ A;  1TU2 B;  2R93 B;  1RTN A;  2QEJ C;  1GHK A;  1PRT F;  1KNE A;  3A55 A;  4OHJ A;  4IAL A;  2PYK A;  1SYF A;  1BCP F;  5KEE A;  2SNS A;  4RGN A;  2KUM A;  2QCP X;  4DAY A;  2H1E A;  1WD0 A;  2NVY B;  4KTA A;  2A69 D;  2EYM A;  4KD3 A;  2DY8 A;  3BDL A;  1D6E C;  3JAM L;  1SE2 A;  4F88 A;  2HDM A;  1T5X D;  2RBM A;  5I2X A;  3L9A X;  2F0F A;  2E74 C;  3I4L A;  1A3V A;  4KY5 A;  1PTO H;  1UNS A;  2EOT A;  2IL8 A;  1TY0 A;  3VYR A;  4J6H A;  4JBW A;  1DD2 A;  2CVR A;  2Z8L A;  4WFN 3;  1ET9 A;  3N6R A;  2ID0 A;  1CA5 A;  2F0E A;  4DK1 A;  1AP0 A;  3FPU B;  2B39 A;  1SJE D;  2F0J A;  2VB2 X;  2WKC A;  3OMG A;  5ELD A;  1XX8 A;  2A5H A;  4YIJ A;  2R92 B;  5IOD A;  4KJO A;  2V4D A;  5EBD A;  3SDZ A;  3A7L A;  2EVB A;  1B50 A;  5IGB A;  1B2T A;  1JOK A;  1NUC A;  1PZK D;  3TBI B;  1FGB D;  5M5X B;  1LTB D;  3ND9 A;  3BDC A;  3HS0 C;  5C3X A;  4IUN A;  3HOX B;  3FEW X;  2A68 D;  3DEP A;  1EFI D;  4N9T A;  1E2W A;  4RCN A;  2RDF A;  1U4R A;  3DEO A;  2ZXP A;  2EDG A;  3C1F A;  3NQI A;  1Q8I A;  1CQV A;  1XYI A;  5JAV A;  5A2Q E;  1TWH B;  5IGE A;  4FXK C;  3RD4 A;  1STA A;  2QF7 A;  3NTH A;  3W3A A;  1BDO A;  2WIN B;  3BVG A;  5KGU A;  3LWU A;  4H0L C;  1NSN S;  3VR3 A;  1SFO B;  3TP7 A;  1ZYR D;  2O2L D;  4PNY A;  2LKV A;  3GV3 A;  2H4O A;  4ZAI A;  1OO9 B;  2F0W A;  4BBS B;  1G8Z D;  1Y8O B;  2RSN A;  2LY7 A;  3AMU A;  1B9M A;  2N88 A;  3J81 E;  1STN A;  2KCN A;  1B3A A;  1H9M A;  4CKC A;  2X6G A;  3D6W A;  4CJ2 C;  3T51 B;  2PPB C;  3GTL B;  3K58 A;  4EVO A;  5C0X I;  3MHB A;  1ESR A;  5LL6 X;  1TWA B;  2ZXO A;  2Q8T A;  4IFD G;  1DJR D;  3FMC A;  5M9O A;  2G9H D;  4QUF A;  3DHQ A;  3GO5 A;  2K33 A;  1X3P A;  4C3H B;  4DAV A;  1BOS A;  1ENC A;  1QE6 A;  1O7Z A;  1J9O A;  4NDX A;  2A73 B;  4EQN A;  3M4O B;  3MXP A;  4XYQ A;  3NBI A;  2RDH A;  4XYO A;  3V96 A;  2JA7 B;  5CV9 A;  2Z4I A;  3QO2 A;  5DM6 3;  3GTP B;  1EU3 A;  5CBA E;  5KNC A;  4KK7 A;  3SXH A;  1ROD A;  5JPN C;  3Q24 A;  1VMP A;  3V05 A;  1EIH A;  1I4H A;  1YNN C;  3H94 A;  1JC7 A;  3K7A B;  1KDC A;  1ZEQ X;  1NR2 A;  4FXD A;  1LT5 D;  4IZ8 A;  1GUT A;  2BE5 D;  3DMU A;  1FNW A;  2WAQ B;  4HTH A;  5FLX L;  4XQQ A;  5JVH 3;  5C6A A;  1TS5 A;  3DWQ A;  3VYS A;  2E2I B;  1HTP A;  4C3J G;  1B9N A;  5KYI A;  5I2Y A;  1E0B A;  5D14 A;  2A68 C;  3S2D B;  4RFB A;  4FF2 A;  1XXG A;  4B9W A;  4MHE A;  3GQB A;  2NWG A;  1JOR A;  3OOC A;  1TT2 A;  1XWE A;  1H9S A;  1KNA A;  1EZ6 A;  1EY7 A;  5C4X B;  3VYU A;  4Y7N B;  2K5Q A;  2SOB A;  1UEA B;  1FD7 D;  4CJ1 B;  4RCO A;  2NUC A;  3EQL C;  1EYA A;  2KEE A;  1JWM D;  4K5V A;  4QIW B;  4LK1 C;  1IW7 C;  2DNC A;  5D3I B;  3I72 A;  4ZKB B;  3S1N B;  2AWN A;  3C46 A;  4L6T B;  1HUM A;  1RD9 D;  2E2H B;  1I4Q A;  1MGS A;  2CW0 D;  4RGT A;  2F0S A;  3Q23 A;  1SYE A;  4K5X A;  4IFD H;  3ITP A;  4NKL A;  1EY9 A;  2NVX B;  1X32 A;  1QCB D;  1DON A;  2CHB D;  2FMC A;  3KF8 A;  4OIK A;  4B08 A;  1Q12 A;  1SXT A;  2I07 B;  1TY2 A;  3C2P A;  4CKE A;  2AQ2 B;  3NP8 A;  4KMU C;  2A6E D;  1Y1W B;  1GHJ A;  2LMC B;  2HCI A;  2F0P A;  1DXM A;  2E76 C;  4ZQ3 A;  4Z9C B;  3D6C A;  2EZV A;  4BWG B;  1E2V A;  2XIW A;  3WOE A;  1WTV A;  1M8A A;  4JK1 C;  3WDN A;  3R3O A;  5IGC A;  4FF3 A;  4DF7 A;  2JYO A;  1SE4 A;  3MXU A;  4C1N I;  3LNN A;  1TS3 A;  4KN7 C;  1OXX K;  5FO9 B;  1VF7 A;  4X3K A;  5CGK A;  5EQ0 A;  4N9P A;  3S1M B;  3CHB D;  3PUZ A;  3G6J B;  3S17 B;  1RKN A;  3DWA A;  4FF1 A;  3TSS A;  3V2T A;  3DM1 A;  3OW7 A;  3VR6 A;  2EY1 A;  5I9P A;  3OMC A;  2BE5 C;  2B2W A;  5J1Z A;  1D5M C;  1LTA D;  1JB3 A;  1JWU D;  1PRT C;  3RUZ A;  3W2D A;  1IL8 A;  2ZXR A;  3S16 B;  1Q1E A;  3I73 A;  3OWF A;  4HED A;  1BCP C;  2BA1 A;  4MIU A;  3X3N A;  3BS1 A;  3HZX A;  1Q3L A;  1LT4 D;  1S5F D;  1S5C D;  3T16 A;  1YNJ D;  1SND A;  3KK7 A;  2AWO A;  1F2Z A;  3KUP A;  1HHV A;  3SEB A;  1TR5 A;  2ENB A;  4KHZ A;  1F9R A;  5ELB A;  3IAY A;  1KAB A;  1R9T B;  1KAA A;  1KTK A;  2K5W A;  1PFB A;  1PXU A;  5ELC A;  1LTS D;  2NN6 H;  1SYD A;  5A35 A;  4PMC A;  5C4H A;  4KJN A;  3I70 A;  4OGQ C;  4ODG A;  4DAP A;  5K5P A;  1KLG D;  1U4L A;  1PZJ D;  3GTG B;  2X69 A;  5ISR A;  3FDT A;  1FR3 A;  3D3R A;  2BDN A;  2TMP A;  4UAI A;  1EY4 A;  2BA0 A;  3N52 A;  4BS9 A;  1QNK A;  3VR2 A;  4TSS A;  1TII D;  2K04 A;  2NTT A;  5JEA G;  2HDL A;  2WAC A;  3R2T A;  1SDF A;  2F0O A;  4IUT A;  1FNV A;  1OXS C;  2DY7 A;  1QB5 D;  1EZ8 A;  2M00 A;  5KNB A;  2PO4 A;  4OIJ A;  3J7A V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...