5CC4A

Crystal structure of staphylococcal nuclease variant delta+phs t62e/v66e at cryogenic temperature
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFEKKMEENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS T62E/V66E at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 33
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5cc4A00
5KGUA 1KAAA 2EY6A 1EZ8A 2F0VA 1SNDA 4I65A 4KTAA 4EVOA 1JOQA 4DGZA 4R8NA 4HTHA 2EY2A 2EY5A 5I6YA 5IIFA 3S9WA 1EQVA 5NUCA 4K2KA 2RDFA 2F0MA 2F0LA 3SR1A 2EYMA 1A3UA 1SNMA 1EY0A 4K2LA 3SK8A 5CV9A 3RUZA 4KY7A 5ISRA 5CV6A 5C3XA 1AEXA 3DHQA 1STYA 1SNQA 3ERQA 4DU9A 4IALA 3TP6A 4YIJA 3E5SA 5DEHA 1EY4A 3TP5A 3SK5A 2F0HA 1II3A 1STNA 2F0KA 2F0WA 2KQ3A 2OXPA 2O4XA 4ME5A 2PW5A 4KY6A 4KJOA 3H6MA 4MIUA 3ITPA 4K5VA 4WORA 1KDCA 3VA5A 4KD3A 1KDAA 5I6WA 1SYBA 3EJIA 3NXWA 1EY6A 4E6IA 5EKKA 2ENBA 5EKLA 3NQTA 3QOLA 4H7BA 4NMZA 1F2ZA 1JOKA 3D4WA 1A2TA 2F3VA 2EYJA 4IZ8A 4LAAA 4F8MA 2QDBA 2EY1A 2F0PA 3QOJA 5M9OA 5E3FA 3MVVA 2F0GA 5HGTA 2KHSA 4EQOA 2NUCA 3R3OA 3SHLA 1EZ6A 1ENAA 3NHHA 5I9OA 3OSOA 1NSNS 1NUCA 5IGEA 4ID6A 3SK4A 2F0DA 5KEEA 1TT2A 2F0SA 2F0IA 3QB3A 5IGCA 5C5MA 3HZXA 3TP8A 4QB4A 5C3WA 3BDCA 5IGDA 4PMCA 5J22A 1STGA 5J1ZA 4QMGA 4HMJA 4B9XA 5IGGA 5IGFA 1SNPA 3OMCA 3SK6A 5IODA 2LKVA 3P75A 3MXPA 5HURA 5EGTA 4IUNA 4ZUJA 1SYGA 4ZUIA 4RKLA 3EROA 3T16A 3NK9A 2F0UA 5K5PA 5JAVA 5C6AA 3MHBA 4J6HA 4G57A 5I9PA 1EYDA 2PW7A 2RKSA 3NP8A 4KD4A 1F2YA 3MEHA 3MZ5A 1TQOA 1EY8A 2OEOA 2F0QA 2RBMA 2PQEA 3EVQA 1TR5A 4K8JA 4KY5A 4RKBA 3TMEA 3U9OA 3V2TA 1A2UA 1RKNA 3OWFA 4ODGA 3T13A 1EYCA 3BDLA 5C4HA 5CGKA 5KYIA 1SYCA 5E1FA 5F2DA 4WRDA 4DFAA 2WACA 2F0EA 3C1FA 2F0JA 2PZTA 1KDBA 1SNOA 2F0OA 5C5LA 3D4DA 2SNSA 4N9TA 5KYLA 5KRUA 5DAUA 4ZQ3A 4KHVA 4B9WA 3NUCA 2EYHA 1EY9A 5IGBA 1ENCA 5CV8A 4K8IA 4K5WA 2HQEA 4K6DA 4KJNA 5CR3A 4NDXA 4EQPA 4QF4A 1STBA 1STHA 5CC4A 5KIXA 5CV4A 5J39A 2M00A 4PMBA 2PYKA 3TP7A 3D8GA 4EQNA 5IOCA 1JOOA 1A3VA 2EYPA 1EY7A 5CV5A 1SYFA 1EY5A 4F7XA 1IHZA 3HEJA 4DF7A 5C4ZA 2EYFA 4S3SA 2EXZA 4TRDA 2F0TA 1KABA 3OMGA 4NKLA 1JORA 3C1EA 1EYAA 1F2MA 4K14A 1SYDA 1U9RA 1SNCA 2F0NA 2SNMA 5JOBA 2SOBA 4HMIA 2F3WA 4PNYA 1STAA 2EYOA 1SYEA 4N9PA 3LX0A 3PMFA 4J1MA 4K5XA 2EYLA 1A3TA 4KV6A 2OF1A 3D6CA 4OL7A 2PZUA 5CV7A 2F0FA 3DMUA 2PZWA 3SXHA 4NP5A 3P1HA
chains in the Genus database with same CATH superfamily
1HXYD 1JR0D 4ZAIA 4DGZA 4XQNA 1GKHA 3RD4A 2F52A 4DK1A 1PH6A 1FGBD 2WB1G 1XMQL 1CKMA 4BXXG 2VZAA 1KLGD 1EWIA 1F2LA 3A7LA 1STYA 1Q90A 1KTKA 4QCLA 3TEHB 1W6KA 3TP6A 3HOZH 4MNOA 1JWSD 2K5VA 1NE3A 3HKZB 4LMQD 5IT9L 5FLXc 3NXWA 4TQUS 5FK9C 4LFCQ 1Q1BA 1CZWA 1X56A 3PUWA 4A93G 4HCSA 2QDBA 1L1OB 1WTPA 4EQOA 4C3JH 1Q7YC 3LNNA 3PO3B 4ZYSA 4OIJA 2X6GA 2YTXA 4QGUA 4CKCA 2LY7A 1WJJA 2Q2TA 1XMOL 1OXXK 2A6ED 1QB5D 2NVQB 4DAYA 1B1ZA 2YV5A 3F2BA 5D65A 2Z8LA 4HJAA 2N8NA 4O0AA 1WTVA 3SK6A 3J81j 3M4OB 1CHQD 3PGZA 2K75A 5EPKA 1B7YB 2ES2A 1TQOA 4N8FA 1NAPA 1TWFB 5L37A 2EE1A 2SEBD 4WRDA 1IYVA 3I4NG 5JJKA 1KDBA 3HOZB 2DY8A 3KLWA 3KDFB 1V1PA 5C5LA 3HOWH 2RDHA 1TWCH 2VQFQ 1Y14B 2QCPX 3TBIB 2XRQD 4B9WA 1X6OA 2PQAB 4OWWB 4QL5A 2I5MX 2D5DA 4KI0A 1TWAH 4PMBA 4X62L 1PFSA 4H02A 4HJ8A 4DR7L 1UUPA 3OHXC 3LWEA 5J3BA 2F0TA 1CKNA 1EFWA 3D3RA 2BCOA 1PYWD 3PO3G 2F3WA 2JA6B 2ICIA 2MP1A 1AE3A 1F9SA 3J80i 2OF1A 5EBCA 3STBC 2R3ZA 2OTJA 3GTMH 2JE6I 1LTGD 2F4VL 1JOQA 3MXGA 2DJFC 5BR8Q 2A68C 4GOPB 4A3DB 4MN3A 2BH8A 1HR0W 2RDFA 4V0BA 3PUXA 1DCZA 2PCFB 5CV9A 2NVTH 3EFXD 3GV3A 1EIFA 5C4XB 4IJLA 4C3HB 4WJ4A 4LFAQ 1PV4A 4L5RC 2EJGC 4CJ2C 5HY6A 3SK5A 1II3A 1O7YA 3UE1A 3CCEA 4CBVA 1GUNA 4OWTB 2B63B 1ZXTA 2K1BA 1EY6A 2JA8G 3E3XA 5EKLA 3HRZC 1VDZA 1YJWA 4BY1B 1ZYRC 3ND9A 2UXDQ 2VY3A 3VR4A 3NBIA 4FNFA 2R92B 3DM1A 1CTMA 2M9VA 1NMFA 2FFKB 4OXPA 1JC7A 1Z7TA 2V1CC 2L11A 2R93H 4BBSH 2F0IA 3Q24A 5IGCA 3C3LA 5DNFA 3NWSA 3MXPA 3OW7A 4FXDA 2E2IB 3MHBA 2IT1A 2F3IA 4A3JH 4LF5L 5EKIA 1HNWL 4L5TA 1TR5A 3U9OA 4DV6Q 1A2UA 1YZ6A 1X9NA 1EYCA 4FXGC 1B9NA 2ZJRA 2L12A 3FVQA 3KOJA 1ESFA 4ILWA 4A4IA 2BE5C 4FF4A 1WTQA 1YBYA 4DV4L 1PTOF 2CWAA 5M3FB 3U58A 1LTRD 1BCPD 3NWTA 4P74A 2TSSA 2ZJPA 3NUCA 2B2UA 2I07B 1GUOA 4K5WA 2NZ1D 4JI5L 3H3VH 4DUYQ 5LMNW 1K8AC 1LT5D 2WINB 1S5DD 3R93A 2D0PA 4HAEA 3H0GB 1G2SA 1VQJA 4X3TA 2ZJQA 3S2DB 3LX0A 3PMFA 2K6AA 3HOVG 1A3TA 3S14H 3BYTB 3E9IA 5FJ8H 5CBEE 2DN8A 3UI2A 2VW9A 2JXMB 1IZ6A 4BY1H 1ZYRD 2KCMA 2RQXA 3SR1A 3RN2A 3SK8A 2NVXB 3HS0C 4KKTA 1EFID 1SNQA 3DM3A 2K04A 5IP9H 2AWNA 4C3HH 2LMCB 1M4VA 1Y1WB 3PO2B 4KY6A 4MIUA 3TZUA 5DLQE 5KNDA 1RJTA 4HJ5A 3GP7A 4C3IH 2G9DA 2A1AA 2F3VA 2R92G 1WTXA 4A3LH 5HGTA 3I3CA 1YEZA 5A35A 2F4VQ 4ZK9B 1WCMB 3S1NH 1H95A 1E3PA 4ID6A 3F2DA 1IL2A 1K28A 1M90C 3MFGA 4FO2A 1U4RA 1JWMD 5C3WA 1VQ7A 4HMJA 2E74C 3F2CA 3H91A 3HOUG 2UUBQ 1O7IA 3HOXB 3STBD 5C6AA 2WIIB 2K5QA 3A5UA 2MFIA 4KK7A 1S5CD 4QIWB 4YHHQ 2PQEA 1B8AA 2NVYH 2JYOA 1C9OA 2UXDL 2K5WA 3HOYH 1ET9A 4PG3A 2KCNA 3FPPA 2B29A 1I4RA 2Y0SB 3NBHA 5IGBA 1QNKA 1IL8A 3S1MH 3I7FA 2VQFL 1OTCA 1B44D 1PZID 1GXDC 1SROA 1K8MA 1U0LA 3KLRA 2NVYB 4BWGB 1DM0B 2EJFC 4JI2L 4A3EH 5M5WH 3HOWB 4DV6L 2XWBB 1N36L 2RF4A 4A3CG 1DJRD 2VXWA 4IFDH 4KV6A 4OHJA 2HHHL 3S15H 1PZKD 2PZWA 3I72A 4YCUA 5FOBB 3MXUA 3F1ZA 3MXNB 4I65A 4A3KB 4R8NA 4JI0Q 5I6YA 2ZXOA 5IWAL 5IYBG 2A69C 3K5MA 5IYCG 2B8GA 1EY0A 4J15A 3HKZE 2UU9L 3UDIA 1E0BA 5ISRA 1CK1A 1TWGB 1WCMH 2JJQA 1CA6A 5JEAH 5KNBA 4A3IG 4YIJA 3CRLC 4JOIC 1FYCA 1DOKA 4BA2I 3AEVA 1D5XC 2AQ2B 4R4OA 3GTMB 1JE4A 1WCMG 4NXMQ 1NR4A 3M3YH 4RCOA 3S1MB 2E2HH 4H7BA 1TY0A 1SE4A 3G7LA 3SVMA 3W2DA 1KNEA 4A93B 1KAWA 2H5XA 1STEA 2BOSA 3KF6B 3OSOA 5IGEA 3FPUB 3I90A 4IFDG 2F4IA 3U50C 4GOPA 4YCVA 1IYUA 3KK7A 4OEMB 3T4AC 4IUNA 3U4VA 1PRTC 3I2ZA 2X6LA 2UXBQ 1HZ9A 1B70B 1S5ED 2B2VC 4JI7Q 1RKNA 4MTKA 2FMMA 1UE5A 4IUQA 2QDLA 3BZKA 4DR4Q 2R7ZB 3KF8A 4K6LA 1VF5C 3CQZH 2F0EA 2Y0SG 1BOSA 4Z9CB 4WJWA 1RCVD 3U9SA 2AQ1B 3CXCA 3S2HH 1QILA 5C3EB 3QIAA 4XYOA 4KHVA 1IBKL 3A0JA 2EYHA 3KBGA 1N8RC 4OX9L 1VQIA 2R6GA 5CR3A 1Q1EA 5A2QL 5FO7B 5FLXL 1Q12A 1A3VA 3S16B 1EL0A 1HUMA 1VQBA 4R4QA 2VB2X 2F03A 3X3NA 4IUVA 4TRDA 1KABA 1XMOQ 4JV5L 3TREA 4Y7NB 5M3FG 2GVBA 4HMIA 4LF7Q 3I8ZA 2JA7G 1D6EC 5JOBA 1LT3D 3NPPA 4I7ZC 4A75A 5AJ3L 4RFBA 1HZCA 1N34Q 1QVFA 2Z0SA 3FHWA 2A6EC 2JA9A 4TVAB 3TQYA 1E7ZA 3D6WA 3HP3A 1B2TA 4OO1H 4QY7A 1D5MC 2B3GA 3J81c 3Q6SA 3OTOL 2JK8A 3SDZA 2IX1A 3I55A 3WWVA 1HNXL 4C3HG 1X3QA 2B2YC 3BDOA 2E5LL 2JN4A 1XYIA 4JI8Q 2HIVA 3FDTA 1XTCD 2B2TC 5FLMH 3QOLA 1PFBA 4LAAA 4BY1G 4DR7Q 2NUCA 1U4MA 2IY5B 3S24A 2HDMA 1K3BC 2C35B 1KRSA 4NXML 2B63G 2RHSB 3ZYYX 5IWAQ 2IHEA 3ER0A 3HOVH 5BN4A 2IWHA 4HIMA 4JI3Q 4QB4A 1BNZA 4PMCA 3KJOA 5IGGA 4B3ML 4DUZL 1RDPD 4EGVA 3CCSA 4N8X1 1HH2P 1PRTD 4KHPL 4IFDI 4GLVB 1DGSA 1RF2D 2YTYA 4DU9A 4JI8L 2A68D 3T13A 5M5YH 2VQEQ 4DV3Q 4JC0A 1V1QA 4DR1Q 1CKOA 1VCIA 4AYBE 5JEAJ 2CKZB 1LYLA 4HJ9A 1SSOA 2PZTA 4GNXA 3K7AB 1C8CA 3O13A 4M1UB 1E24A 3I4NB 4X65Q 4OGQC 3BU2A 5KRUA 1HRJA 4X6AH 1H9KA 1EY9A 1ENCA 1WTHA 4XT1B 4NDXA 1F9QA 1EQQA 3MA2B 1DYQA 4GS3A 3GTOB 1AZQA 1YNND 4DV7L 4A3JG 1K8OA 2EYPA 3A8IE 4GZYC 2XTIA 1Z47A 3ZJYC 3CC7A 4C56C 1Y69U 2H1EA 1SNCA 1E1OA 3GTGH 3NTIA 2DNCA 3T1HQ 4CJ1B 5I2YA 1ICWA 3B6YA 3GV6A 3E0EA 5C4JH 2O5IC 4PV1C 2PO4A 4B08A 4PZ6A 3CCJA 4RWSC 3P1HA 1R4QB 1EZ8A 2HD3A 3NEMA 4K0KL 2EY5A 2AKWB 2C5CA 4QQBX 1EWHA 1WFQA 1QUQA 1UEBA 1TWGH 1LO5D 1SLJA 5C0XI 1N34L 3PV0A 3CAMA 1SAPA 3HKSA 3I4MB 1PXUA 2PW5A 4DR2L 3S17B 1UNSA 2RSNA 1N32Q 2WB1E 2EZVA 4A3BG 5DM73 1BF4A 1LM0A 4LK1C 3EN2A 3P20A 3CMEA 3SHLA 4POFA 3CP0A 2R7FA 1TS3A 2F1MA 1HQMC 2F0SA 3V96A 3MEFA 1QOHA 3IL8A 1HZBA 3HZXA 3I70A 2JA5H 1C4QA 1CM9A 3CPFA 1VQHA 1YHBA 1QVCA 5IODA 1S40A 1G6PA 1PH3A 4DNIA 4B3MQ 1I6HB 4G57A 2XVSA 4B3SQ 3QWNA 4JBWA 3TMEA 1K8GA 1HR0Q 3V2TA 2TMPA 4DA2A 4L5QA 1KC8C 4A3FG 5E4WC 4BBSB 1SJHD 3C1FA 1VQLA 2NVQH 2CQAA 5C3EH 2O2LD 3I4NH 4ZQ3A 5C4XG 2JA8H 3EA6A 1U4PA 4A3FH 1O80A 1XPUA 3M9BA 2UUAQ 1EEFD 3M7NA 3FRPB 2PI2E 3J7AF 2DNEA 4F7XA 3Q8DA 2EXZA 2N88A 1XWEA 4JOIA 1EIGA 2QGQA 1J9OA 3LWUA 2HIXA 2X69A 2Z4IA 2IX0A 4J1MA 2F0FA 2KHIA 1GUWA 4HCEA 3I91A 1M8AA 2WV6D 4KTAA 4B3RQ 5JPNC 4C3JG 5LMNQ 4K2KA 2F0LA 1EQRA 5D3DA 1SNMA 1PH8A 1H9RA 4NPSA 1Y8PB 4KY7A 4QJFA 4FF1A 4PQXA 4YWKA 4PZ8A 2Q8IB 3HOZG 1KXLA 4GNXC 2Z6BA 2F0WA 5M3MH 2FMCA 1H9MA 1MGSA 3W1GA 4KJOA 4CDDC 5CMDA 3EJIA 2XIWA 4RGOS 4BXXH 1N32L 4P75A 3GO5A 4XXEA 1LT6D 3HOWG 1LTSD 5E3FA 3KDFA 2F0GA 2QILA 3K7UC 2PMZB 1EZ6A 5JVH3 3NHHA 4UP8A 4JCVE 3MXNA 1NSNS 2F0DA 3H3VC 3FKIG 3GTJB 3BJUA 1KD1C 2BE5D 1ESRA 2JQOA 2OT2A 5GAGC 1DOLA 3FKIB 3HOUB 1STGA 3E0JA 1SDFA 3CMAA 2MO0A 3P75A 5EGTA 4A3FB 4DUYL 2B2YA 4F87A 3DEOA 3NK9A 4DR5L 3A7AB 4KN4C 1TKWB 4X62Q 2MGSA 2QEJC 1BCPF 1F2YA 3CCUA 2UXCQ 2RBMA 1MIUA 1AZPA 3EVQA 4JVZA 1OXSC 4IUUA 1X3FA 4OONA 3RN5A 2E76C 1TS4A 5ELBA 3PUVA 4OIKA 3RZDB 1LT4D 5FKAC 3ND8A 3RNUA 1GHKA 2A74C 5KYLA 1V43A 2K32A 1XJVA 4DR1L 3S17H 1HNZQ 2K05A 4QUFA 2J0TD 1X54A 4LF6L 2KVMA 1STHA 4LF4L 4EQ5A 4DR6Q 5T1IA 3S16H 1TWHB 2KCCA 4A3BB 1I3QH 3TRZA 1SBBB 2FINB 1XNRL 1QUQB 3CC4A 2SNMA 1RHPA 1YJ9A 4XQQA 2RVLA 1PRTF 4G7OC 1UE7A 2Z6KA 5C0XG 3J81E 2B63H 2O5JC 1VQAA 1HFNA 1KHIA 5CBAE 3AU7A 2LXJA 3G71A 1D2BA 4JI7L 2EYMA 5CV6A 2RDGA 3R2TA 3D0FA 3ERQA 2OWOA 1BBWA 4GKJL 3SEBA 2N78A 3TP5A 2IPKD 3KUPA 3OW2A 1STNA 2F0KA 4CJ0B 2D2CC 1CSPA 4L6TB 5M3MB 4KD3A 2J4XA 1SRUA 4NMZA 3MWYW 1MI2A 4R4TA 1DZ1A 4L8JA 1BO0A 1VF7A 2PQAA 2Q8TA 4IPHA 1D5ZC 3PSIA 1WTOA 1PH5A 2AQ3B 3QR8A 3ONAB 2JA5B 1GM5A 3BDCA 4NW2A 1CI3M 4BA1I 4Y52H 3HOXG 3BVMA 1LLRD 3K8AA 2UUBL 5IYDH 5IYDG 1CKNB 1JICA 2NN6I 2B2WC 3EROA 4R9WA 3G6JB 4DN4M 1TVXA 1J6QA 1EYDA 5K5PA 5ELCA 3N52A 5COYA 1EY8A 4RKBA 3J80L 4R1JA 2K50A 5GAHC 5KYIA 1R9TH 4HIDA 2HHHQ 4A3GB 5F2DA 5G3LF 1PYSB 3T1YQ 1U5KA 2F0JA 3JAML 3RZDH 3Q23A 1NCVA 4DK0A 1O7ZA 3IKJA 1FVIA 1S72A 5CV8A 4LF9L 2L0CA 4AIMA 5IP7H 3NSWA 5IP9G 1EY5A 4LF8Q 2DGYA 2IL8A 2KEDA 1RTOA 1FR3A 4DR6L 4IPGA 4DR4L 3C1EA 3VA7A 4DV3L 1RODA 3GTPH 1N33L 3CCMA 3S1RB 2SOBA 1YJNA 4JYAQ 2WKCA 1I5FA 3FKIH 3VYSA 4H0LC 4X66Q 4DAYB 4H13C 1D1IA 1L2FA 5ELDA 5FJ8G 1HHVA 1GD7A 2EY6A 2F0VA 2NN6H 2DJGC 3WDNA 1VQDA 3T51B 1TXYA 1QG7A 1SMYD 5EAYA 4BBRH 4MZ9A 4FVMA 1I4HA 4DR3Q 2LSSA 4K2LA 1HR0L 2CVRA 1S4ZA 1O78A 2ICEC 3JAMi 1EOVA 4GKJQ 2KQ3A 2B2UC 3T56B 1WYDA 3H94A 4K5VA 5JEAG 3K5LA 3SE0A 1G51A 2CCZA 1XPRA 5EKKA 3HKZG 3SGIA 4DAPA 1VQKA 1UEAB 3TSSA 4PMWA 1TS2A 5IYCH 5IYBH 1Z9FA 3JC66 1WOCA 1Y1VH 4JI1L 2I0QA 2NZHA 1ENAA 1B9MA 2L9HA 5E4XA 3G4SA 4FXKC 1I4PA 2R93B 2NTSA 2K28A 4RCNA 3A54A 5GQOA 4OX9Q 1HFGA 5IGDA 2PNRC 5EPLA 1DD2A 3FMCA 4QMGA 4A3EG 5BN5A 1JJCB 3NTKA 3TN2A 1SFOH 4ZUIA 1VQGA 4CDEC 1I94L 2Z4HA 2R7DA 4J6HA 2MQHA 3MZ5A 3FP9A 1A63A 4LF7L 3D4RA 4ODGA 1A62A 1BBUA 2RHQB 1Q46A 1JQYD 5C4XH 2WACA 1BCPB 4DV1L 4XYQA 1SNOA 1PHJA 4JI1Q 1QVGA 5ELOA 5H1SE 2ZXRA 1TWCB 4KLKA 2PI2A 3F2UA 4B3TQ 1J8IA 3CU7A 5CC4A 5LMUQ 2E2JH 2FXQA 3RR5A 5M3MG 4BBRB 5IOCA 3EQLC 1Y1VB 4UP7A 3DEPA 4YY3Q 4DV5Q 1MSHA 2CW0C 4DKAC 2UU9Q 2LS01 2Z1CA 5K36G 1N9WA 1UE1A 2EYFA 4S3SA 2QKIC 1XX8A 2QF7A 1TWFH 4LF6Q 3CD6A 3ICEA 1K0SA 1DONA 3IAYA 4YWLA 1C7YA 3EIVA 1N33Q 4AH6A 4ULLA 3MAQA 3VR3A 3GDEA 5I2XA 4X64L 5KGUA 4KHZA 1A6XA 1CSQA 2HT1A 1B3QA 2EVBA 1EQVA 5NUCA 4JYAL 2R92H 4A3LG 3PO3H 4FF2A 1CT1D 1IBLQ 1YNNC 4B3TL 4A3BH 1CHPD 1P8LA 1TWHH 4HN7A 1B53A 1CFMA 1R9TB 5K36H 1BXTA 1SE8A 3BZCA 3QO2A 1E2WA 2QW7A 2ZTDA 5FO8B 4YY3L 4DV5L 4CGYB 2MHVA 1GOZA 1I6VC 2PNHA 2K5NA 1VQ8A 2K4KA 4E6IA 5KNCA 1NY4A 5A2QE 5IT9E 4C3IB 2NYZD 1MJEA 1C48A 4LW1A 2L5TA 1V8QA 1IXRA 5JJIA 5BN3A 1PVOA 3PF4A 2JEAI 4I7AA 3I73A 4XDXA 3ERSX 2K52A 1IBKQ 1R4PB 3VYRA 3TDQA 4P72A 5C5MA 4FF3A 2L55A 3DXJC 3UE0A 3CCQA 1XNQQ 4MTNA 2KJXA 4DR2Q 2LKVA 3R2IA 2A69D 4O1NA 2XSCA 1PH7A 1SFOB 1VQNA 1K83H 2KECA 4FDBA 1KNAA 3NP8A 5I9PA 3H09A 1LABA 2OEOA 3NENA 3PF5A 5CGKA 5J39A 3S1NB 1I3QB 4RG1A 2IW3A 5JJZA 3URYA 2RA4A 4OWXB 4JI4L 1EOTA 1PH9A 4IFDJ 2K33A 2L15A 2SNSA 3RZOB 4QIWE 4RA8A 1PTOH 3IFTA 3BVZA 2GN5A 4HIKA 4K6DA 3DLLA 2MJ8A 4DV1Q 2XN9C 2N55A 3AFPA 3AMUA 1Z6HA 4P73A 4M8AA 1H9SA 1W6JA 2ATWA 1SYFA 3OTOQ 4DK3C 2UXCL 4DNTB 2NVXH 2AUJD 1M1KC 2EOTA 1JORA 1UE6A 2G9HD 3KLSX 2K7VA 1CZGA 1SMYC 1IW7C 2IHFA 3H0GH 3IRBA 4N9PA 1QJOA 4FP5D 2WAQB 3Q22A 2ASBA 2PZUA 4BBSG 4DV0Q 2NN6G 1RIPA 4C2MB 1PRTB 3NQIA 5JVG3 1ML0D 3K5OA 1KIXA 1MD2D 2I5LX 4HTHA 5G3LD 4GN5A 1GHJA 1E1TA 2M2LA 4A3MH 2F0MA 4RAUC 3QJYA 5FLMG 3OWEB 3RUZA 4JBKA 1IBMQ 5JJLA 3AQQA 1EYGA 1T5XD 3EBEA 4WFN3 1GVPA 3S1RH 1AW7A 2JA7B 3V05A 3BZDB 3PO2G 3GTJH 3U4ZA 2A6HD 4CDCC 3K0YA 1HJPA 4LFBQ 3KBXA 2XGTA 4A76A 4QUCA 2ZTEA 4GKKL 2E2JB 2OCEA 1YNJD 5M5XH 2CHBD 4IZ8A 1EU4A 3OIPA 1LTTD 4LWCA 4RGNA 1FL0A 3N6RA 1YHAA 1XMQQ 3GTKH 1SN8A 2R7ZH 3I4MG 4J8QA 1IBLL 2JA7H 4LFAL 3H15A 4JI6Q 4V190 2VUMG 3PIPA 5HURA 3ULJA 1NR2A 2NWGA 2CW0D 2EQSA 4LNQA 3L7ZC 4DV7Q 3CCRA 3MEHA 3UDFA 3CHBD 1TIID 4WJ3M 3ULLA 1PH2A 5C44H 4DFAA 1JB3A 3M4PA 1EIYB 4YHHL 4XQJA 3CC2A 1PA6A 4JBJA 2K5HA 2HCIA 2HQLA 4KJNA 2HQEA 1LACA 3J7ZC 1HUNA 1CQVA 1AFPA 2ZTCA 4GN3B 3KF8B 4P71A 1MJCA 2RSOA 2YU9H 1UAPA 2IX3A 5LMUL 1EYAA 4K14A 3HOVB 2DY7A 1ASYA 3GTGB 2EYOA 1Y1WH 4UHVA 2G5DA 3J81L 3BYYB 2VS1A 2I5HA 4KKUA 4NP5A 4R4CA 5ELNA 1KAAA 1SNDA 4AQYL 1I4XA 3RLOA 4RGMA 4O2DA 5IIFA 1TS5A 1EUJA 1NMGA 1PLFA 4LF4Q 4JI5Q 1BVSA 1MSGA 4G4KA 4A93H 1NTGA 4IURA 3A55A 5GAEC 5EBDA 2NVTB 3L9AX 1S5BD 4GOPC 5AFWA 4ALPA 1D1KA 1Y8OB 1CQFA 2JSOA 2D9UA 1IBML 1J5EQ 5DEHA 3RZOH 1L1OA 3L0OA 1VQEA 4JW0A 2CH4W 2PMZE 5CORA 3H6MA 3TS0A 3RMHA 3CCVA 2KEEA 5JPMC 1X3GA 4A3KH 4BBRG 4F8MA 1V1PB 4AYBB 2ALYB 4HSPA 4DNRB 2JEBI 3WOEA 3R3OA 5I9OA 4DR3L 1G8ZD 1VQMA 3GTKB 5KEEA 4BS9A 3PIOA 3QB3A 3K58A 1DXMA 1Y1WG 4A3CH 2JA6G 3S14B 1RTNA 1VQFA 2B39A 2CFMA 3OMCA 1VQ5A 2WFWA 1GUTA 3M4OH 2AMCB 4X64Q 1YI2A 2OQKA 2V4DA 2VL6A 5JAVA 5IP7G 4R8IA 1QZHA 2WP8J 4LFBL 2AUKA 1WTRA 2PW7A 4KD4A 1V9PA 4JBMA 2NB0A 2OTLA 5EPJA 1SJED 4GKKQ 1HA6A 4POGA 1SEBD 4CKBA 3J7YW 1T9HA 1VQ4A 1H9SB 4KHPQ 2KUMA 3KYHC 4BY7B 1HNZL 5DAUA 4DK6C 5C44G 4XTCS 4B3RL 3DUZA 4JI2Q 5M5XB 4JV5Q 4XT3B 1WI5A 1HQRD 3TP7A 1P16A 1I94Q 1E2VA 3OIQA 4A3IB 1YNXA 2FHTA 5C4ZA 4YCWA 2EIFA 4IPCA 5M5YB 4X3UA 3OMGA 4ABNA 3CPWA 1T5EA 2B2VA 1ICFB 1SYDA 1U9RA 1OO9B 3CQZB 4IPDA 3TZDA 1STAA 2I46A 3CKIB 3I4MH 1JJGA 1Q8IA 1W2BA 2AHOB 1SE3A 4LFCL 1H9JA 1RD9D 2E2HB 3W1BA 3T1HL 4A3DH 2Q2HA 3RLNA 3JAMc 3A8KE 4LF8L 2JP1A 1PYBA 3J80E 5GROA 1FNWA 3DHQA 1CUKA 3J80c 1OXTA 3S2HB 3G48A 1BCPC 3M4QA 3PO2H 1ENFA 1WTWA 2E2DC 3VR5A 3ITPA 2XNAC 4WORA 1KLUD 4IUTA 3DWPA 1EU3A 2ENBA 2DUDA 2KENA 1F2ZA 1K73C 5C3EG 1C0AA 3HGBA 3MVVA 2ZM6L 4IUPA 1ONLA 4IJHA 1X32A 5C0XH 3SK4A 2H4OA 1K9MC 4JK1C 2KOLA 1XXGA 4A3EB 1GUSA 5LL6X 1IYJB 1ASZA 4KMUC 4DXFA 1Q82C 2KA7A 2FJ2A 1VS0A 1VQPA 1VQ9A 3HOUH 1UWVA 1SNPA 3W5OA 4IQZA 3KF6A 1J5EL 4RKLA 2RCNA 1ILPA 5IY0A 3M85A 4PZ7A 1PDQA 2RKSA 5EJWA 3BG3A 5T1GA 1JE5A 2E8GA 2YTVA 1LTLA 2A19A 5ELFA 3T1YL 3I4OA 3GD7A 1XNRQ 4ZCKA 4UY8C 1G6ZA 4Y7NH 2A8VA 4IN3A 5GADC 2EJMA 2KHJA 2K03A 2WB1B 3KLSA 4IO9A 3A8JE 4EQPA 1Y8NB 1BDOA 2C9OA 2LXKA 1I6HH 4L5SA 4EQNA 3D8GA 2YYZA 1OXVA 1DOMA 2ZT9C 2MNAA 3K6OA 4ZKCB 2KCTA 1F77A 3CF5A 1PH1A 4NKLA 1G2TA 1SXTA 2NZOA 1TY2A 3AFQA 3PUZA 2F0NA 1WD0A 1MHWC 1L0XB 1ZKOA 4PNYA 4ZKBB 4K5XA 2RCFA 2EYLA 4HIOA 2R93G 1OXUA 3SXHA 1HPCA 1XPOA 3PIO3 1PFNA 1VQOA 4FYDA 4XIGS 2EY2A 3H0GG 2BH2A 2VB3X 1Q3LA 1A3UA 2BA0A 3K81C 2YU9B 1D8LA 1E22A 1AEXA 1ILQA 1Q86C 2QA4A 1IKLA 1HTPA 2P5ZX 3AYHB 4C1NI 1Q8KA 5LMNL 1S3OA 3E5SA 4U68A 1PFMA 1PMRA 1X55A 2F0HA 2OXPA 2N3SA 2Y0SE 1A8VA 1K3RA 2ID0A 4LUOA 3VA5A 4A3GG 5I6WA 3CRKC 4IOAA 1N36Q 5LHY1 2WAQG 3D4WA 1A2TA 4ZRZA 2EYJA 3QOJA 1A15A 1AP0A 5IT9c 3K5NA 2KHSA 1EIHA 3MFYA 3CW2C 1ET6A 4ME3A 1NUCA 1CA5A 2SDFA 4GN4B 4Q5VA 1TT2A 4DUZQ 2MPMA 2HUGA 4NB3A 4NXNQ 3I56A 3NE5B 3C46A 5C4JB 4OELB 3WOFA 4B9XA 2D0OA 4RHSA 5IGFA 4DV0L 3VYUA 1JWUD 4KKSA 1SYGA 2E5LQ 2F0UA 4G7ZC 1NJIC 3GTOH 5IE8A 1YITA 4DV2Q 3PIP3 1L0WA 1AN8A 1X3EA 2EPBA 3PUYA 4K8JA 4DAMA 5E7NA 2F0QA 1O7LA 2K01A 3BVGA 4KY5A 4X3SA 3A5ZB 4CDFC 3K59A 2PPBC 3BDLA 1KRTA 2BDOA 2BA1A 4RH6A 1YIJA 3D31A 3I4LA 1VMPA 1SMXA 2UUAL 2F0OA 1NNXA 3R8BA 3JAME 3H3VI 4N9TA 1LV9A 5CYUA 4X66L 4GNXB 1U4LA 4UAIA 1XNQL 1I4GA 3K80C 1B3AA 1D7QA 4NXNL 4RHRA 1STBA 1JMCA 2M00A 2PYKA 1YNJC 3ULPA 2A5HA 1X3PA 2UXBL 4CKEA 4OO1G 3J7AV 2A6HC 3K57A 4DV2L 2E75C 1QCBD 4TSSA 4A3DG 2K14A 2JA5G 2GVAA 1AE2A 3D6CA 5CV7A 3HFZB 2XRSD 1K0RA 1YVCA 2CWPA 2GA4B 2A73B 2Q2IA 4EVOA 1EWCA 1FNUA 1L1OC 1Y1VG 1KQSA 2E2IH 1JJ2A 3MC0B 2MO1A 3LGJA 4C3JB 4JI0L 1F9PA 4LF5Q 1HNWQ 4O42A 3NELA 4A3GH 5TSSA 3MTSA 3G6EA 1JT8A 2Z9HA 5FO9B 2Q2UA 1RL2A 1F9RA 4IALA 4LUZA 4G7HC 1EY4A 1NBWA 1TU2B 3S1QB 3W3AA 3GTLB 2O4XA 1FNVA 2K5DA 3X3MA 4C2MH 1PTOB 1KDCA 1AH9A 1KDAA 1PZJD 3L2PA 3UDGA 1FGUA 1X65A 3FEWX 3NQTA 1QE6A 4GLXA 1G91A 2F0PA 1VQ6A 1QZGA 3A56A 2WKDA 4UPAA 3HG9A 4DXGA 1QWYA 3GTQB 1FJGL 3PQIA 2XWJB 4DR5Q 3TP8A 4MHEA 2B2WA 5J22A 3OPOA 3KFUA 5J1ZA 4U673 1WD1A 2JA8B 5C0XJ 4ZUJA 2VUMB 5ELEA 3T16A 1W3SA 4ZLTF 1V1OA 3NTHA 2B8FA 5LL6S 4KN7C 4IOCA 3OWFA 4JI4Q 5C4HA 4OO1I 4JG2A 1Q81C 5E1FA 1BQQT 1A0IA 2ZXPA 3K7AH 4L63B 2CQOA 3D4DA 5DM63 1IKMA 2CH4A 4AYBG 4A3KG 4BY7H 1B50A 1QNUA 4JI6L 1GUGA 2AWOA 1FJGQ 1G291 4QF4A 2R61A 5KIXA 1TWAB 1JOOA 5CV5A 1LTAD 2WAQE 3J81i 4A3IH 3VYTA 1IHZA 1XTDA 4B3SL 4APVA 4LJZC 4GLAC 4Q0FA 4TKOB 4F88A 5I4DA 1F2MA 3RLFA 2UUCQ 5HGQA 5EQ0A 1SYEA 3S1QH 4OL7A 4X65L 3DMUA 3BS1A 1VQCA 1MKHA 1EEID 4HJ7A 1GJXA 1B4OA 4JPBW 1LTBD 3PCOB 3S9WA 4A3MB 1LTID 3K0XA 3P7JA 4X3KA 3OYYA 4UP9A 1HCZA 5C3XA 2B2TA 2KBNA 4YWMA 1HA5A 2Z6KC 3QG1A 2L1BA 3GTPB 3NBHB 5C44B 1YHQA 3E6ZX 1BBXC 4DV4Q 1L0YB 4HR7B 4ME5A 1BKBA 3VDYA 3S2DH 3GTLH 3F8TA 1WVLA 1MBYA 1HNXQ 1SYBA 1ZEQX 1GO3E 4H44C 1KL9A 2QEXA 2OQ0A 4EX5A 1JOKA 1PTOD 1JCKB 4A3JB 2HDLA 3IFDA 3J7A5 2EY1A 3VR6A 5M9OA 3DWAA 3VR2A 3HOYG 5AJ3Q 4LUVA 1SE2A 2Q8RE 2NBFA 1JB7A 2MUYA 4UDUC 4HSVA 4K0KQ 2L4NA 3DWQA 5M5WB 3UDXA 4DAVA 4P2CB 1BR9A 1I4QA 1I50H 5M3FH 3M7GA 2BDNA 1EQTA 2EXDA 3TS2A 1BUVT 2VUMH 3HOXH 3KJPA 3T53B 3CCLA 1HTLD 1K83B 1PTOC 2D62A 2R7ZG 2ZM6Q 5D3IB 1SYCA 1VMCA 3Q0AA 1IW7D 2VQEL 3HOYB 4BY7G 1PH4A 3AB9A 4AQYQ 2N49A 4C3IG 4LF9Q 3L3OC 4RGTA 2IJ0A 3C2PA 1FD7D 1SR3A 4C1NK 3GQBA 4JI3L 4K8IA 3M3YB 5CV4A 1S5FD 4CHTB 1EY7A 3OOCA 5FLXE 2NTTA 2HCCA 4HEDA 2EDGA 1E2ZA 3HEJA 4DF7A 4DPGA 5D14A 4RMFA 2VNUD 3A74A 3M4YA 3GTQH 2LFNA 1LUZA 2JA6H 4A3MG 1HZAA 4R4IA 3S15B 3E9HA 2UUCL 1I50B 5BR8L 2J7ZA
chains in the Genus database with same CATH topology
1HXYD 1JR0D 4ZAIA 4DGZA 4XQNA 3RD4A 4DK1A 1FGBD 1F2LA 1KLGD 3A7LA 1STYA 1Q90A 1KTKA 4QCLA 1W6KA 3TP6A 1JWSD 3HKZB 4LMQD 5IT9L 3NXWA 4TQUS 5FK9C 1Q1BA 1CZWA 3PUWA 4HCSA 2QDBA 1WTPA 4EQOA 3LNNA 3PO3B 4ZYSA 4OIJA 2X6GA 4CKCA 2LY7A 1OXXK 2A6ED 1QB5D 2NVQB 4DAYA 1B1ZA 5D65A 2Z8LA 1WTVA 3SK6A 3M4OB 1CHQD 5EPKA 1TQOA 1NAPA 1TWFB 2EE1A 2SEBD 4WRDA 1IYVA 1KDBA 3HOZB 2DY8A 5C5LA 1V1PA 2RDHA 2QCPX 3TBIB 2XRQD 4B9WA 2D5DA 4KI0A 4PMBA 1UUPA 3OHXC 3LWEA 2F0TA 3D3RA 2BCOA 1PYWD 2F3WA 2JA6B 2ICIA 2MP1A 1F9SA 2OF1A 5EBCA 2R3ZA 2JE6I 1LTGD 1JOQA 3MXGA 2A68C 4A3DB 4MN3A 2RDFA 4V0BA 3PUXA 1DCZA 2PCFB 5CV9A 3EFXD 3GV3A 5C4XB 4C3HB 2EJGC 4CJ2C 3SK5A 1II3A 1O7YA 4CBVA 1GUNA 2B63B 1ZXTA 2K1BA 1EY6A 5EKLA 3HRZC 1VDZA 4BY1B 1ZYRC 3ND9A 3VR4A 3NBIA 4FNFA 2R92B 3DM1A 1CTMA 2M9VA 2FFKB 1JC7A 1Z7TA 2L11A 2F0IA 3Q24A 5IGCA 3C3LA 5DNFA 3NWSA 3MXPA 3OW7A 4FXDA 2E2IB 3MHBA 2IT1A 5EKIA 1TR5A 3U9OA 1A2UA 1EYCA 4FXGC 1B9NA 2L12A 3FVQA 1ESFA 4ILWA 2BE5C 4FF4A 1WTQA 1PTOF 5M3FB 1LTRD 1BCPD 3NWTA 2TSSA 3NUCA 2B2UA 2I07B 1GUOA 4K5WA 2NZ1D 1LT5D 2WINB 1S5DD 3R93A 4HAEA 3H0GB 1G2SA 4X3TA 3S2DB 3LX0A 3PMFA 2K6AA 1A3TA 3BYTB 5CBEE 2DN8A 3UI2A 2JXMB 1ZYRD 2RQXA 3SR1A 3SK8A 2NVXB 3HS0C 4KKTA 1EFID 1SNQA 2K04A 2AWNA 2LMCB 1M4VA 1Y1WB 3PO2B 4KY6A 4MIUA 3TZUA 5KNDA 1RJTA 3GP7A 2G9DA 2F3VA 1WTXA 5HGTA 3I3CA 5A35A 4ZK9B 1WCMB 4ID6A 3MFGA 4FO2A 1U4RA 1JWMD 5C3WA 4HMJA 2E74C 3H91A 3HOXB 5C6AA 2WIIB 2K5QA 4KK7A 1S5CD 4QIWB 2PQEA 2JYOA 2K5WA 1ET9A 2KCNA 3FPPA 1I4RA 2Y0SB 3NBHA 5IGBA 1QNKA 1IL8A 1B44D 1PZID 1GXDC 1K8MA 3KLRA 2NVYB 4BWGB 1DM0B 2EJFC 3HOWB 2XWBB 1DJRD 2VXWA 4IFDH 4KV6A 4OHJA 1PZKD 2PZWA 3I72A 5FOBB 3MXUA 4I65A 4A3KB 4R8NA 5I6YA 2ZXOA 2A69C 3K5MA 2B8GA 1EY0A 5ISRA 1E0BA 1CK1A 1TWGB 1CA6A 5JEAH 5KNBA 4YIJA 3CRLC 1FYCA 1DOKA 4BA2I 1D5XC 2AQ2B 3GTMB 1JE4A 1NR4A 4RCOA 3S1MB 4H7BA 1TY0A 1SE4A 3G7LA 3SVMA 3W2DA 1KNEA 4A93B 1STEA 2BOSA 3OSOA 5IGEA 3FPUB 3I90A 4IFDG 2F4IA 1IYUA 3KK7A 3T4AC 4IUNA 1PRTC 2X6LA 1S5ED 2B2VC 1RKNA 2FMMA 4IUQA 2R7ZB 3KF8A 4K6LA 1VF5C 2F0EA 1BOSA 4Z9CB 4WJWA 1RCVD 3U9SA 2AQ1B 1QILA 5C3EB 3QIAA 4XYOA 4KHVA 2EYHA 3KBGA 2R6GA 5CR3A 1Q1EA 5A2QL 5FO7B 5FLXL 1Q12A 1A3VA 3S16B 1EL0A 1HUMA 2VB2X 2F03A 3X3NA 4IUVA 4TRDA 1KABA 4Y7NB 4HMIA 3I8ZA 1D6EC 5JOBA 1LT3D 3NPPA 4I7ZC 4RFBA 2A6EC 3D6WA 3HP3A 1B2TA 4OO1H 1D5MC 3Q6SA 3SDZA 2IX1A 4C3HG 1X3QA 2B2YC 3BDOA 1XYIA 3FDTA 1XTCD 2B2TC 3QOLA 1PFBA 4LAAA 2NUCA 1U4MA 2HDMA 3ZYYX 5BN4A 2IWHA 4QB4A 1BNZA 4PMCA 5IGGA 1RDPD 4EGVA 1PRTD 4IFDI 1RF2D 4DU9A 2A68D 3T13A 1VCIA 5JEAJ 1SSOA 2PZTA 3K7AB 1C8CA 3O13A 4M1UB 3I4NB 4OGQC 1HRJA 5KRUA 1H9KA 1EY9A 1ENCA 4XT1B 4NDXA 1F9QA 3MA2B 1DYQA 3GTOB 1AZQA 1YNND 1K8OA 2EYPA 3A8IE 4GZYC 1Z47A 4C56C 1Y69U 2H1EA 1SNCA 3NTIA 2DNCA 4CJ1B 5I2YA 1ICWA 3GV6A 2O5IC 4PV1C 2PO4A 4B08A 4RWSC 3P1HA 1R4QB 1EZ8A 2EY5A 2C5CA 1EWHA 1LO5D 5C0XI 3PV0A 1SAPA 3I4MB 1PXUA 2PW5A 3S17B 1UNSA 2RSNA 2EZVA 5DM73 1BF4A 4LK1C 3P20A 3SHLA 1TS3A 2F1MA 1HQMC 2F0SA 3V96A 1QOHA 3IL8A 3HZXA 3I70A 1C4QA 1CM9A 5IODA 1I6HB 4G57A 2XVSA 3QWNA 4JBWA 3TMEA 3V2TA 2TMPA 4DA2A 5E4WC 4BBSB 1SJHD 3C1FA 2CQAA 2O2LD 4ZQ3A 3EA6A 1U4PA 1O80A 1EEFD 3M7NA 3FRPB 3J7AF 2DNEA 4F7XA 2EXZA 2N88A 1XWEA 1EIGA 1J9OA 3LWUA 2X69A 2Z4IA 2IX0A 4J1MA 2F0FA 1GUWA 4HCEA 3I91A 1M8AA 2WV6D 4KTAA 5JPNC 4C3JG 4K2KA 2F0LA 5D3DA 1SNMA 1H9RA 1Y8PB 4KY7A 4FF1A 4PQXA 2Q8IB 2F0WA 2FMCA 1H9MA 1MGSA 4KJOA 5CMDA 3EJIA 2XIWA 4RGOS 3GO5A 4XXEA 1LT6D 1LTSD 5E3FA 2F0GA 2QILA 2PMZB 1EZ6A 5JVH3 3NHHA 3MXNA 1NSNS 2F0DA 3H3VC 3GTJB 2BE5D 1ESRA 2OT2A 1DOLA 3FKIB 3HOUB 1STGA 3E0JA 1SDFA 3P75A 5EGTA 4A3FB 2B2YA 4F87A 3DEOA 3NK9A 3A7AB 4KN4C 1TKWB 2MGSA 2QEJC 1BCPF 1F2YA 2RBMA 1AZPA 3EVQA 1OXSC 4IUUA 2E76C 1TS4A 5ELBA 3PUVA 4OIKA 3RZDB 1LT4D 5FKAC 3ND8A 1GHKA 2A74C 5KYLA 1V43A 2K32A 2K05A 4QUFA 2J0TD 2KVMA 1STHA 5T1IA 1TWHB 2KCCA 4A3BB 1SBBB 2FINB 2SNMA 1RHPA 4XQQA 2RVLA 1PRTF 4G7OC 5C0XG 3J81E 2O5JC 1HFNA 5CBAE 3AU7A 1D2BA 2EYMA 5CV6A 2RDGA 3R2TA 3ERQA 3SEBA 3TP5A 2IPKD 3KUPA 1STNA 2F0KA 4CJ0B 2D2CC 4L6TB 5M3MB 4KD3A 2J4XA 3MWYW 4NMZA 1MI2A 1DZ1A 4L8JA 1BO0A 1VF7A 2Q8TA 1D5ZC 1WTOA 2AQ3B 3ONAB 2JA5B 3BDCA 4NW2A 1CI3M 4BA1I 3BVMA 1LLRD 1JICA 2NN6I 2B2WC 3EROA 4R9WA 3G6JB 4DN4M 1TVXA 1EYDA 5K5PA 5ELCA 3N52A 5COYA 1EY8A 4RKBA 3J80L 5KYIA 4A3GB 5F2DA 5G3LF 2F0JA 3JAML 3Q23A 1NCVA 4DK0A 1O7ZA 3IKJA 5CV8A 2L0CA 3NSWA 1EY5A 2IL8A 2KEDA 1RTOA 1FR3A 3C1EA 3VA7A 1RODA 3S1RB 2SOBA 2WKCA 3VYSA 4H0LC 4H13C 1D1IA 5ELDA 1HHVA 2EY6A 2F0VA 2NN6H 3WDNA 3T51B 1QG7A 1SMYD 4FVMA 1I4HA 4K2LA 2CVRA 1S4ZA 1O78A 2ICEC 2KQ3A 2B2UC 3T56B 3H94A 4K5VA 3K5LA 5JEAG 3SE0A 5EKKA 4DAPA 1UEAB 3TSSA 4PMWA 1TS2A 1ENAA 1B9MA 2L9HA 5E4XA 4FXKC 1I4PA 2R93B 2NTSA 2K28A 4RCNA 3A54A 1HFGA 5IGDA 2PNRC 5EPLA 1DD2A 3FMCA 4QMGA 5BN5A 3NTKA 3TN2A 4ZUIA 2Z4HA 4J6HA 3MZ5A 3D4RA 4ODGA 1JQYD 2WACA 1BCPB 4XYQA 1SNOA 2ZXRA 1TWCB 3F2UA 1J8IA 3CU7A 5CC4A 4BBRB 5IOCA 3EQLC 1Y1VB 3DEPA 1MSHA 2CW0C 2LS01 2Z1CA 5K36G 2EYFA 4S3SA 2QKIC 1XX8A 2QF7A 1DONA 3IAYA 4ULLA 3MAQA 3VR3A 5I2XA 5KGUA 4KHZA 1A6XA 2EVBA 1EQVA 5NUCA 4FF2A 1CT1D 1YNNC 1CHPD 4HN7A 1B53A 1CFMA 1R9TB 5K36H 1BXTA 3QO2A 1E2WA 5FO8B 4CGYB 2MHVA 1GOZA 1I6VC 4E6IA 5KNCA 5A2QE 5IT9E 4C3IB 2NYZD 1C48A 2L5TA 1V8QA 5BN3A 2JEAI 3I73A 4XDXA 1R4PB 3VYRA 3TDQA 5C5MA 4FF3A 2L55A 3DXJC 2KJXA 2LKVA 3R2IA 2A69D 4O1NA 2XSCA 1SFOB 2KECA 5I9PA 1KNAA 3NP8A 3H09A 1LABA 2OEOA 5CGKA 5J39A 3S1NB 1I3QB 2IW3A 5JJZA 3URYA 2RA4A 1EOTA 4IFDJ 2K33A 2SNSA 3RZOB 4RA8A 1PTOH 3IFTA 3BVZA 4K6DA 2MJ8A 2XN9C 2N55A 3AMUA 1Z6HA 4M8AA 1H9SA 1W6JA 1SYFA 4DNTB 2AUJD 2EOTA 1JORA 2G9HD 3KLSX 2K7VA 1CZGA 1SMYC 1IW7C 4N9PA 1QJOA 4FP5D 2WAQB 3Q22A 2PZUA 2NN6G 4C2MB 1PRTB 3NQIA 5JVG3 1ML0D 3K5OA 1MD2D 4HTHA 5G3LD 1GHJA 2M2LA 2F0MA 4RAUC 3QJYA 3OWEB 3RUZA 1T5XD 4WFN3 1AW7A 2JA7B 3V05A 3BZDB 2A6HD 3K0YA 3KBXA 4QUCA 2E2JB 1YNJD 2CHBD 4IZ8A 1EU4A 3OIPA 1LTTD 4RGNA 3N6RA 4J8QA 4V190 5HURA 1NR2A 2NWGA 2CW0D 3L7ZC 3MEHA 3CHBD 1TIID 4DFAA 1JB3A 4XQJA 2HCIA 4KJNA 2HQEA 1LACA 1HUNA 1CQVA 1AFPA 2RSOA 1UAPA 2IX3A 1EYAA 4K14A 3HOVB 2DY7A 3GTGB 2EYOA 3J81L 3BYYB 4KKUA 4NP5A 1KAAA 1SNDA 1I4XA 4RGMA 5IIFA 1TS5A 1PLFA 1MSGA 4G4KA 4IURA 3A55A 5EBDA 2NVTB 3L9AX 1S5BD 5AFWA 1D1KA 1Y8OB 1CQFA 2JSOA 2D9UA 5DEHA 5CORA 3H6MA 3RMHA 2KEEA 5JPMC 4F8MA 1V1PB 4AYBB 4HSPA 4DNRB 2JEBI 3WOEA 3R3OA 5I9OA 1G8ZD 3GTKB 5KEEA 4BS9A 3QB3A 3K58A 1DXMA 3S14B 1RTNA 2B39A 3OMCA 1GUTA 2V4DA 5JAVA 4R8IA 2WP8J 2AUKA 1WTRA 2PW7A 4KD4A 2NB0A 5EPJA 1SJED 1HA6A 1SEBD 4CKBA 3J7YW 1H9SB 2KUMA 4BY7B 5DAUA 4XTCS 3DUZA 5M5XB 4XT3B 1HQRD 3TP7A 1E2VA 3OIQA 4A3IB 2FHTA 5C4ZA 5M5YB 4X3UA 3OMGA 4ABNA 1T5EA 2B2VA 1SYDA 1U9RA 1OO9B 3CQZB 3TZDA 1STAA 2I46A 3CKIB 1Q8IA 1SE3A 1H9JA 1RD9D 2E2HB 3A8KE 2JP1A 3J80E 1FNWA 3DHQA 1OXTA 3S2HB 1BCPC 1ENFA 1WTWA 2E2DC 3VR5A 3ITPA 2XNAC 4WORA 1KLUD 4IUTA 3DWPA 1EU3A 2ENBA 1F2ZA 3HGBA 3MVVA 4IUPA 1ONLA 1X32A 5C0XH 3SK4A 2H4OA 4JK1C 2KOLA 1XXGA 4A3EB 1GUSA 5LL6X 4KMUC 4DXFA 2KA7A 2FJ2A 1SNPA 4IQZA 4RKLA 1ILPA 3M85A 1PDQA 2RKSA 5EJWA 3BG3A 5T1GA 5ELFA 3GD7A 1G6ZA 4IN3A 2EJMA 2K03A 2WB1B 3KLSA 3A8JE 4EQPA 1Y8NB 1BDOA 2C9OA 4EQNA 3D8GA 2YYZA 1OXVA 1DOMA 2ZT9C 3K6OA 4ZKCB 1F77A 4NKLA 1G2TA 1SXTA 1TY2A 3PUZA 2F0NA 1WD0A 1L0XB 1ZKOA 4PNYA 4ZKBB 4K5XA 2EYLA 1OXUA 3SXHA 1HPCA 3PIO3 1PFNA 4FYDA 4XIGS 2EY2A 2VB3X 1Q3LA 1A3UA 2BA0A 2YU9B 1AEXA 1ILQA 1IKLA 1HTPA 4C1NI 3E5SA 4U68A 1PFMA 1PMRA 2F0HA 2OXPA 2ID0A 3VA5A 5I6WA 3CRKC 5LHY1 3D4WA 1A2TA 4ZRZA 2EYJA 3QOJA 1A15A 1AP0A 3K5NA 2KHSA 1EIHA 3MFYA 1ET6A 1NUCA 1CA5A 2SDFA 4Q5VA 1TT2A 2MPMA 2HUGA 3NE5B 3C46A 5C4JB 3WOFA 4B9XA 5IGFA 4RHSA 3VYUA 1JWUD 4KKSA 1SYGA 2F0UA 4G7ZC 3PIP3 1AN8A 2EPBA 3PUYA 4K8JA 2F0QA 1O7LA 2K01A 3BVGA 4KY5A 4X3SA 3K59A 2PPBC 3BDLA 2BDOA 2BA1A 4RH6A 3D31A 3I4LA 1VMPA 2F0OA 3R8BA 3JAME 4N9TA 1LV9A 5CYUA 1U4LA 4UAIA 1I4GA 1B3AA 4RHRA 1STBA 2M00A 2PYKA 1YNJC 2A5HA 1X3PA 4CKEA 4OO1G 3J7AV 2A6HC 3K57A 2E75C 1QCBD 4TSSA 3D6CA 5CV7A 2XRSD 2GA4B 2A73B 4EVOA 1EWCA 1FNUA 3MC0B 4C3JB 1F9PA 4O42A 5TSSA 3MTSA 5FO9B 1F9RA 4IALA 4G7HC 1EY4A 1TU2B 3S1QB 3W3AA 3GTLB 2O4XA 1FNVA 2K5DA 3X3MA 1PTOB 1KDCA 1KDAA 1PZJD 3FEWX 3NQTA 1QE6A 1G91A 2F0PA 3A56A 2WKDA 3HG9A 4DXGA 1QWYA 3GTQB 2XWJB 3TP8A 4MHEA 2B2WA 5J22A 3OPOA 5J1ZA 4U673 1WD1A 2JA8B 5C0XJ 4ZUJA 2VUMB 5ELEA 3T16A 4ZLTF 1V1OA 3NTHA 2B8FA 5LL6S 4KN7C 3OWFA 5C4HA 4OO1I 5E1FA 1BQQT 2ZXPA 4L63B 3D4DA 5DM63 1IKMA 1B50A 1QNUA 1GUGA 2AWOA 1G291 4QF4A 2R61A 5KIXA 1TWAB 1JOOA 5CV5A 1LTAD 3VYTA 1IHZA 4LJZC 4TKOB 4Q0FA 4F88A 5I4DA 1F2MA 3RLFA 5EQ0A 1SYEA 4OL7A 3DMUA 3BS1A 1EEID 1GJXA 1B4OA 1LTBD 3S9WA 4A3MB 1LTID 3P7JA 4X3KA 1HCZA 5C3XA 2B2TA 1HA5A 3GTPB 3QG1A 2L1BA 5C44B 3E6ZX 1BBXC 1L0YB 4HR7B 4ME5A 1WVLA 1MBYA 1SYBA 1ZEQX 4H44C 1JOKA 1PTOD 1JCKB 4A3JB 2HDLA 3IFDA 2EY1A 3VR6A 5M9OA 3DWAA 3VR2A 1SE2A 2Q8RE 2NBFA 2MUYA 4UDUC 4HSVA 2L4NA 3DWQA 5M5WB 4DAVA 4P2CB 1BR9A 1I4QA 3M7GA 2BDNA 1EQTA 1BUVT 3T53B 1HTLD 1K83B 1PTOC 2D62A 5D3IB 1SYCA 1VMCA 3Q0AA 1IW7D 3HOYB 3AB9A 4C3IG 3L3OC 4RGTA 2IJ0A 3C2PA 1FD7D 4C1NK 3GQBA 4K8IA 3M3YB 5CV4A 1S5FD 4CHTB 1EY7A 3OOCA 5FLXE 2NTTA 2HCCA 2EDGA 4HEDA 1E2ZA 3HEJA 4DF7A 5D14A 2VNUD 3M4YA 2LFNA 3S15B 1I50B 2J7ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KGU A;  1KAA A;  2EY6 A;  1EZ8 A;  2F0V A;  1SND A;  4I65 A;  4KTA A;  4EVO A;  1JOQ A;  4DGZ A;  4R8N A;  4HTH A;  2EY2 A;  2EY5 A;  5I6Y A;  5IIF A;  3S9W A;  1EQV A;  5NUC A;  4K2K A;  2RDF A;  2F0M A;  2F0L A;  3SR1 A;  2EYM A;  1A3U A;  1SNM A;  1EY0 A;  4K2L A;  3SK8 A;  5CV9 A;  3RUZ A;  4KY7 A;  5ISR A;  5CV6 A;  5C3X A;  1AEX A;  3DHQ A;  1STY A;  1SNQ A;  3ERQ A;  4DU9 A;  4IAL A;  3TP6 A;  4YIJ A;  3E5S A;  5DEH A;  1EY4 A;  3TP5 A;  3SK5 A;  2F0H A;  1II3 A;  1STN A;  2F0K A;  2F0W A;  2KQ3 A;  2OXP A;  2O4X A;  4ME5 A;  2PW5 A;  4KY6 A;  4KJO A;  3H6M A;  4MIU A;  3ITP A;  4K5V A;  4WOR A;  1KDC A;  3VA5 A;  4KD3 A;  1KDA A;  5I6W A;  1SYB A;  3EJI A;  3NXW A;  1EY6 A;  4E6I A;  5EKK A;  2ENB A;  5EKL A;  3NQT A;  3QOL A;  4H7B A;  4NMZ A;  1F2Z A;  1JOK A;  3D4W A;  1A2T A;  2F3V A;  2EYJ A;  4IZ8 A;  4LAA A;  4F8M A;  2QDB A;  2EY1 A;  2F0P A;  3QOJ A;  5M9O A;  5E3F A;  3MVV A;  2F0G A;  5HGT A;  2KHS A;  4EQO A;  2NUC A;  3R3O A;  3SHL A;  1EZ6 A;  1ENA A;  3NHH A;  5I9O A;  3OSO A;  1NSN S;  1NUC A;  5IGE A;  4ID6 A;  3SK4 A;  2F0D A;  5KEE A;  1TT2 A;  2F0S A;  2F0I A;  3QB3 A;  5IGC A;  5C5M A;  3HZX A;  3TP8 A;  4QB4 A;  5C3W A;  3BDC A;  5IGD A;  4PMC A;  5J22 A;  1STG A;  5J1Z A;  4QMG A;  4HMJ A;  4B9X A;  5IGG A;  5IGF A;  1SNP A;  3OMC A;  3SK6 A;  5IOD A;  2LKV A;  3P75 A;  3MXP A;  5HUR A;  5EGT A;  4IUN A;  4ZUJ A;  1SYG A;  4ZUI A;  4RKL A;  3ERO A;  3T16 A;  3NK9 A;  2F0U A;  5K5P A;  5JAV A;  5C6A A;  3MHB A;  4J6H A;  4G57 A;  5I9P A;  1EYD A;  2PW7 A;  2RKS A;  3NP8 A;  4KD4 A;  1F2Y A;  3MEH A;  3MZ5 A;  1TQO A;  1EY8 A;  2OEO A;  2F0Q A;  2RBM A;  2PQE A;  3EVQ A;  1TR5 A;  4K8J A;  4KY5 A;  4RKB A;  3TME A;  3U9O A;  3V2T A;  1A2U A;  1RKN A;  3OWF A;  4ODG A;  3T13 A;  1EYC A;  3BDL A;  5C4H A;  5CGK A;  5KYI A;  1SYC A;  5E1F A;  5F2D A;  4WRD A;  4DFA A;  2WAC A;  2F0E A;  3C1F A;  2F0J A;  2PZT A;  1KDB A;  1SNO A;  2F0O A;  5C5L A;  3D4D A;  2SNS A;  4N9T A;  5KYL A;  5KRU A;  5DAU A;  4ZQ3 A;  4KHV A;  4B9W A;  3NUC A;  2EYH A;  1EY9 A;  5IGB A;  1ENC A;  5CV8 A;  4K8I A;  4K5W A;  2HQE A;  4K6D A;  4KJN A;  5CR3 A;  4NDX A;  4EQP A;  4QF4 A;  1STB A;  1STH A;  5CC4 A;  5KIX A;  5CV4 A;  5J39 A;  2M00 A;  4PMB A;  2PYK A;  3TP7 A;  3D8G A;  4EQN A;  5IOC A;  1JOO A;  1A3V A;  2EYP A;  1EY7 A;  5CV5 A;  1SYF A;  1EY5 A;  4F7X A;  1IHZ A;  3HEJ A;  4DF7 A;  5C4Z A;  2EYF A;  4S3S A;  2EXZ A;  4TRD A;  2F0T A;  1KAB A;  3OMG A;  4NKL A;  1JOR A;  3C1E A;  1EYA A;  1F2M A;  4K14 A;  1SYD A;  1U9R A;  1SNC A;  2F0N A;  2SNM A;  5JOB A;  2SOB A;  4HMI A;  2F3W A;  4PNY A;  1STA A;  2EYO A;  1SYE A;  4N9P A;  3LX0 A;  3PMF A;  4J1M A;  4K5X A;  2EYL A;  1A3T A;  4KV6 A;  2OF1 A;  3D6C A;  4OL7 A;  2PZU A;  5CV7 A;  2F0F A;  3DMU A;  2PZW A;  3SXH A;  4NP5 A;  3P1H A; 
#chains in the Genus database with same CATH topology
 1HXY D;  1JR0 D;  4ZAI A;  4DGZ A;  4XQN A;  1GKH A;  3RD4 A;  2F52 A;  4DK1 A;  1PH6 A;  1FGB D;  2WB1 G;  1XMQ L;  1CKM A;  4BXX G;  2VZA A;  1KLG D;  1EWI A;  1F2L A;  3A7L A;  1STY A;  1Q90 A;  1KTK A;  4QCL A;  3TEH B;  1W6K A;  3TP6 A;  3HOZ H;  4MNO A;  1JWS D;  2K5V A;  1NE3 A;  3HKZ B;  4LMQ D;  5IT9 L;  5FLX c;  3NXW A;  4TQU S;  5FK9 C;  4LFC Q;  1Q1B A;  1CZW A;  1X56 A;  3PUW A;  4A93 G;  4HCS A;  2QDB A;  1L1O B;  1WTP A;  4EQO A;  4C3J H;  1Q7Y C;  3LNN A;  3PO3 B;  4ZYS A;  4OIJ A;  2X6G A;  2YTX A;  4QGU A;  4CKC A;  2LY7 A;  1WJJ A;  2Q2T A;  1XMO L;  1OXX K;  2A6E D;  1QB5 D;  2NVQ B;  4DAY A;  1B1Z A;  2YV5 A;  3F2B A;  5D65 A;  2Z8L A;  4HJA A;  2N8N A;  4O0A A;  1WTV A;  3SK6 A;  3J81 j;  3M4O B;  1CHQ D;  3PGZ A;  2K75 A;  5EPK A;  1B7Y B;  2ES2 A;  1TQO A;  4N8F A;  1NAP A;  1TWF B;  5L37 A;  2EE1 A;  2SEB D;  4WRD A;  1IYV A;  3I4N G;  5JJK A;  1KDB A;  3HOZ B;  2DY8 A;  3KLW A;  3KDF B;  1V1P A;  5C5L A;  3HOW H;  2RDH A;  1TWC H;  2VQF Q;  1Y14 B;  2QCP X;  3TBI B;  2XRQ D;  4B9W A;  1X6O A;  2PQA B;  4OWW B;  4QL5 A;  2I5M X;  2D5D A;  4KI0 A;  1TWA H;  4PMB A;  4X62 L;  1PFS A;  4H02 A;  4HJ8 A;  4DR7 L;  1UUP A;  3OHX C;  3LWE A;  5J3B A;  2F0T A;  1CKN A;  1EFW A;  3D3R A;  2BCO A;  1PYW D;  3PO3 G;  2F3W A;  2JA6 B;  2ICI A;  2MP1 A;  1AE3 A;  1F9S A;  3J80 i;  2OF1 A;  5EBC A;  3STB C;  2R3Z A;  2OTJ A;  3GTM H;  2JE6 I;  1LTG D;  2F4V L;  1JOQ A;  3MXG A;  2DJF C;  5BR8 Q;  2A68 C;  4GOP B;  4A3D B;  4MN3 A;  2BH8 A;  1HR0 W;  2RDF A;  4V0B A;  3PUX A;  1DCZ A;  2PCF B;  5CV9 A;  2NVT H;  3EFX D;  3GV3 A;  1EIF A;  5C4X B;  4IJL A;  4C3H B;  4WJ4 A;  4LFA Q;  1PV4 A;  4L5R C;  2EJG C;  4CJ2 C;  5HY6 A;  3SK5 A;  1II3 A;  1O7Y A;  3UE1 A;  3CCE A;  4CBV A;  1GUN A;  4OWT B;  2B63 B;  1ZXT A;  2K1B A;  1EY6 A;  2JA8 G;  3E3X A;  5EKL A;  3HRZ C;  1VDZ A;  1YJW A;  4BY1 B;  1ZYR C;  3ND9 A;  2UXD Q;  2VY3 A;  3VR4 A;  3NBI A;  4FNF A;  2R92 B;  3DM1 A;  1CTM A;  2M9V A;  1NMF A;  2FFK B;  4OXP A;  1JC7 A;  1Z7T A;  2V1C C;  2L11 A;  2R93 H;  4BBS H;  2F0I A;  3Q24 A;  5IGC A;  3C3L A;  5DNF A;  3NWS A;  3MXP A;  3OW7 A;  4FXD A;  2E2I B;  3MHB A;  2IT1 A;  2F3I A;  4A3J H;  4LF5 L;  5EKI A;  1HNW L;  4L5T A;  1TR5 A;  3U9O A;  4DV6 Q;  1A2U A;  1YZ6 A;  1X9N A;  1EYC A;  4FXG C;  1B9N A;  2ZJR A;  2L12 A;  3FVQ A;  3KOJ A;  1ESF A;  4ILW A;  4A4I A;  2BE5 C;  4FF4 A;  1WTQ A;  1YBY A;  4DV4 L;  1PTO F;  2CWA A;  5M3F B;  3U58 A;  1LTR D;  1BCP D;  3NWT A;  4P74 A;  2TSS A;  2ZJP A;  3NUC A;  2B2U A;  2I07 B;  1GUO A;  4K5W A;  2NZ1 D;  4JI5 L;  3H3V H;  4DUY Q;  5LMN W;  1K8A C;  1LT5 D;  2WIN B;  1S5D D;  3R93 A;  2D0P A;  4HAE A;  3H0G B;  1G2S A;  1VQJ A;  4X3T A;  2ZJQ A;  3S2D B;  3LX0 A;  3PMF A;  2K6A A;  3HOV G;  1A3T A;  3S14 H;  3BYT B;  3E9I A;  5FJ8 H;  5CBE E;  2DN8 A;  3UI2 A;  2VW9 A;  2JXM B;  1IZ6 A;  4BY1 H;  1ZYR D;  2KCM A;  2RQX A;  3SR1 A;  3RN2 A;  3SK8 A;  2NVX B;  3HS0 C;  4KKT A;  1EFI D;  1SNQ A;  3DM3 A;  2K04 A;  5IP9 H;  2AWN A;  4C3H H;  2LMC B;  1M4V A;  1Y1W B;  3PO2 B;  4KY6 A;  4MIU A;  3TZU A;  5DLQ E;  5KND A;  1RJT A;  4HJ5 A;  3GP7 A;  4C3I H;  2G9D A;  2A1A A;  2F3V A;  2R92 G;  1WTX A;  4A3L H;  5HGT A;  3I3C A;  1YEZ A;  5A35 A;  2F4V Q;  4ZK9 B;  1WCM B;  3S1N H;  1H95 A;  1E3P A;  4ID6 A;  3F2D A;  1IL2 A;  1K28 A;  1M90 C;  3MFG A;  4FO2 A;  1U4R A;  1JWM D;  5C3W A;  1VQ7 A;  4HMJ A;  2E74 C;  3F2C A;  3H91 A;  3HOU G;  2UUB Q;  1O7I A;  3HOX B;  3STB D;  5C6A A;  2WII B;  2K5Q A;  3A5U A;  2MFI A;  4KK7 A;  1S5C D;  4QIW B;  4YHH Q;  2PQE A;  1B8A A;  2NVY H;  2JYO A;  1C9O A;  2UXD L;  2K5W A;  3HOY H;  1ET9 A;  4PG3 A;  2KCN A;  3FPP A;  2B29 A;  1I4R A;  2Y0S B;  3NBH A;  5IGB A;  1QNK A;  1IL8 A;  3S1M H;  3I7F A;  2VQF L;  1OTC A;  1B44 D;  1PZI D;  1GXD C;  1SRO A;  1K8M A;  1U0L A;  3KLR A;  2NVY B;  4BWG B;  1DM0 B;  2EJF C;  4JI2 L;  4A3E H;  5M5W H;  3HOW B;  4DV6 L;  2XWB B;  1N36 L;  2RF4 A;  4A3C G;  1DJR D;  2VXW A;  4IFD H;  4KV6 A;  4OHJ A;  2HHH L;  3S15 H;  1PZK D;  2PZW A;  3I72 A;  4YCU A;  5FOB B;  3MXU A;  3F1Z A;  3MXN B;  4I65 A;  4A3K B;  4R8N A;  4JI0 Q;  5I6Y A;  2ZXO A;  5IWA L;  5IYB G;  2A69 C;  3K5M A;  5IYC G;  2B8G A;  1EY0 A;  4J15 A;  3HKZ E;  2UU9 L;  3UDI A;  1E0B A;  5ISR A;  1CK1 A;  1TWG B;  1WCM H;  2JJQ A;  1CA6 A;  5JEA H;  5KNB A;  4A3I G;  4YIJ A;  3CRL C;  4JOI C;  1FYC A;  1DOK A;  4BA2 I;  3AEV A;  1D5X C;  2AQ2 B;  4R4O A;  3GTM B;  1JE4 A;  1WCM G;  4NXM Q;  1NR4 A;  3M3Y H;  4RCO A;  3S1M B;  2E2H H;  4H7B A;  1TY0 A;  1SE4 A;  3G7L A;  3SVM A;  3W2D A;  1KNE A;  4A93 B;  1KAW A;  2H5X A;  1STE A;  2BOS A;  3KF6 B;  3OSO A;  5IGE A;  3FPU B;  3I90 A;  4IFD G;  2F4I A;  3U50 C;  4GOP A;  4YCV A;  1IYU A;  3KK7 A;  4OEM B;  3T4A C;  4IUN A;  3U4V A;  1PRT C;  3I2Z A;  2X6L A;  2UXB Q;  1HZ9 A;  1B70 B;  1S5E D;  2B2V C;  4JI7 Q;  1RKN A;  4MTK A;  2FMM A;  1UE5 A;  4IUQ A;  2QDL A;  3BZK A;  4DR4 Q;  2R7Z B;  3KF8 A;  4K6L A;  1VF5 C;  3CQZ H;  2F0E A;  2Y0S G;  1BOS A;  4Z9C B;  4WJW A;  1RCV D;  3U9S A;  2AQ1 B;  3CXC A;  3S2H H;  1QIL A;  5C3E B;  3QIA A;  4XYO A;  4KHV A;  1IBK L;  3A0J A;  2EYH A;  3KBG A;  1N8R C;  4OX9 L;  1VQI A;  2R6G A;  5CR3 A;  1Q1E A;  5A2Q L;  5FO7 B;  5FLX L;  1Q12 A;  1A3V A;  3S16 B;  1EL0 A;  1HUM A;  1VQB A;  4R4Q A;  2VB2 X;  2F03 A;  3X3N A;  4IUV A;  4TRD A;  1KAB A;  1XMO Q;  4JV5 L;  3TRE A;  4Y7N B;  5M3F G;  2GVB A;  4HMI A;  4LF7 Q;  3I8Z A;  2JA7 G;  1D6E C;  5JOB A;  1LT3 D;  3NPP A;  4I7Z C;  4A75 A;  5AJ3 L;  4RFB A;  1HZC A;  1N34 Q;  1QVF A;  2Z0S A;  3FHW A;  2A6E C;  2JA9 A;  4TVA B;  3TQY A;  1E7Z A;  3D6W A;  3HP3 A;  1B2T A;  4OO1 H;  4QY7 A;  1D5M C;  2B3G A;  3J81 c;  3Q6S A;  3OTO L;  2JK8 A;  3SDZ A;  2IX1 A;  3I55 A;  3WWV A;  1HNX L;  4C3H G;  1X3Q A;  2B2Y C;  3BDO A;  2E5L L;  2JN4 A;  1XYI A;  4JI8 Q;  2HIV A;  3FDT A;  1XTC D;  2B2T C;  5FLM H;  3QOL A;  1PFB A;  4LAA A;  4BY1 G;  4DR7 Q;  2NUC A;  1U4M A;  2IY5 B;  3S24 A;  2HDM A;  1K3B C;  2C35 B;  1KRS A;  4NXM L;  2B63 G;  2RHS B;  3ZYY X;  5IWA Q;  2IHE A;  3ER0 A;  3HOV H;  5BN4 A;  2IWH A;  4HIM A;  4JI3 Q;  4QB4 A;  1BNZ A;  4PMC A;  3KJO A;  5IGG A;  4B3M L;  4DUZ L;  1RDP D;  4EGV A;  3CCS A;  4N8X 1;  1HH2 P;  1PRT D;  4KHP L;  4IFD I;  4GLV B;  1DGS A;  1RF2 D;  2YTY A;  4DU9 A;  4JI8 L;  2A68 D;  3T13 A;  5M5Y H;  2VQE Q;  4DV3 Q;  4JC0 A;  1V1Q A;  4DR1 Q;  1CKO A;  1VCI A;  4AYB E;  5JEA J;  2CKZ B;  1LYL A;  4HJ9 A;  1SSO A;  2PZT A;  4GNX A;  3K7A B;  1C8C A;  3O13 A;  4M1U B;  1E24 A;  3I4N B;  4X65 Q;  4OGQ C;  3BU2 A;  5KRU A;  1HRJ A;  4X6A H;  1H9K A;  1EY9 A;  1ENC A;  1WTH A;  4XT1 B;  4NDX A;  1F9Q A;  1EQQ A;  3MA2 B;  1DYQ A;  4GS3 A;  3GTO B;  1AZQ A;  1YNN D;  4DV7 L;  4A3J G;  1K8O A;  2EYP A;  3A8I E;  4GZY C;  2XTI A;  1Z47 A;  3ZJY C;  3CC7 A;  4C56 C;  1Y69 U;  2H1E A;  1SNC A;  1E1O A;  3GTG H;  3NTI A;  2DNC A;  3T1H Q;  4CJ1 B;  5I2Y A;  1ICW A;  3B6Y A;  3GV6 A;  3E0E A;  5C4J H;  2O5I C;  4PV1 C;  2PO4 A;  4B08 A;  4PZ6 A;  3CCJ A;  4RWS C;  3P1H A;  1R4Q B;  1EZ8 A;  2HD3 A;  3NEM A;  4K0K L;  2EY5 A;  2AKW B;  2C5C A;  4QQB X;  1EWH A;  1WFQ A;  1QUQ A;  1UEB A;  1TWG H;  1LO5 D;  1SLJ A;  5C0X I;  1N34 L;  3PV0 A;  3CAM A;  1SAP A;  3HKS A;  3I4M B;  1PXU A;  2PW5 A;  4DR2 L;  3S17 B;  1UNS A;  2RSN A;  1N32 Q;  2WB1 E;  2EZV A;  4A3B G;  5DM7 3;  1BF4 A;  1LM0 A;  4LK1 C;  3EN2 A;  3P20 A;  3CME A;  3SHL A;  4POF A;  3CP0 A;  2R7F A;  1TS3 A;  2F1M A;  1HQM C;  2F0S A;  3V96 A;  3MEF A;  1QOH A;  3IL8 A;  1HZB A;  3HZX A;  3I70 A;  2JA5 H;  1C4Q A;  1CM9 A;  3CPF A;  1VQH A;  1YHB A;  1QVC A;  5IOD A;  1S40 A;  1G6P A;  1PH3 A;  4DNI A;  4B3M Q;  1I6H B;  4G57 A;  2XVS A;  4B3S Q;  3QWN A;  4JBW A;  3TME A;  1K8G A;  1HR0 Q;  3V2T A;  2TMP A;  4DA2 A;  4L5Q A;  1KC8 C;  4A3F G;  5E4W C;  4BBS B;  1SJH D;  3C1F A;  1VQL A;  2NVQ H;  2CQA A;  5C3E H;  2O2L D;  3I4N H;  4ZQ3 A;  5C4X G;  2JA8 H;  3EA6 A;  1U4P A;  4A3F H;  1O80 A;  1XPU A;  3M9B A;  2UUA Q;  1EEF D;  3M7N A;  3FRP B;  2PI2 E;  3J7A F;  2DNE A;  4F7X A;  3Q8D A;  2EXZ A;  2N88 A;  1XWE A;  4JOI A;  1EIG A;  2QGQ A;  1J9O A;  3LWU A;  2HIX A;  2X69 A;  2Z4I A;  2IX0 A;  4J1M A;  2F0F A;  2KHI A;  1GUW A;  4HCE A;  3I91 A;  1M8A A;  2WV6 D;  4KTA A;  4B3R Q;  5JPN C;  4C3J G;  5LMN Q;  4K2K A;  2F0L A;  1EQR A;  5D3D A;  1SNM A;  1PH8 A;  1H9R A;  4NPS A;  1Y8P B;  4KY7 A;  4QJF A;  4FF1 A;  4PQX A;  4YWK A;  4PZ8 A;  2Q8I B;  3HOZ G;  1KXL A;  4GNX C;  2Z6B A;  2F0W A;  5M3M H;  2FMC A;  1H9M A;  1MGS A;  3W1G A;  4KJO A;  4CDD C;  5CMD A;  3EJI A;  2XIW A;  4RGO S;  4BXX H;  1N32 L;  4P75 A;  3GO5 A;  4XXE A;  1LT6 D;  3HOW G;  1LTS D;  5E3F A;  3KDF A;  2F0G A;  2QIL A;  3K7U C;  2PMZ B;  1EZ6 A;  5JVH 3;  3NHH A;  4UP8 A;  4JCV E;  3MXN A;  1NSN S;  2F0D A;  3H3V C;  3FKI G;  3GTJ B;  3BJU A;  1KD1 C;  2BE5 D;  1ESR A;  2JQO A;  2OT2 A;  5GAG C;  1DOL A;  3FKI B;  3HOU B;  1STG A;  3E0J A;  1SDF A;  3CMA A;  2MO0 A;  3P75 A;  5EGT A;  4A3F B;  4DUY L;  2B2Y A;  4F87 A;  3DEO A;  3NK9 A;  4DR5 L;  3A7A B;  4KN4 C;  1TKW B;  4X62 Q;  2MGS A;  2QEJ C;  1BCP F;  1F2Y A;  3CCU A;  2UXC Q;  2RBM A;  1MIU A;  1AZP A;  3EVQ A;  4JVZ A;  1OXS C;  4IUU A;  1X3F A;  4OON A;  3RN5 A;  2E76 C;  1TS4 A;  5ELB A;  3PUV A;  4OIK A;  3RZD B;  1LT4 D;  5FKA C;  3ND8 A;  3RNU A;  1GHK A;  2A74 C;  5KYL A;  1V43 A;  2K32 A;  1XJV A;  4DR1 L;  3S17 H;  1HNZ Q;  2K05 A;  4QUF A;  2J0T D;  1X54 A;  4LF6 L;  2KVM A;  1STH A;  4LF4 L;  4EQ5 A;  4DR6 Q;  5T1I A;  3S16 H;  1TWH B;  2KCC A;  4A3B B;  1I3Q H;  3TRZ A;  1SBB B;  2FIN B;  1XNR L;  1QUQ B;  3CC4 A;  2SNM A;  1RHP A;  1YJ9 A;  4XQQ A;  2RVL A;  1PRT F;  4G7O C;  1UE7 A;  2Z6K A;  5C0X G;  3J81 E;  2B63 H;  2O5J C;  1VQA A;  1HFN A;  1KHI A;  5CBA E;  3AU7 A;  2LXJ A;  3G71 A;  1D2B A;  4JI7 L;  2EYM A;  5CV6 A;  2RDG A;  3R2T A;  3D0F A;  3ERQ A;  2OWO A;  1BBW A;  4GKJ L;  3SEB A;  2N78 A;  3TP5 A;  2IPK D;  3KUP A;  3OW2 A;  1STN A;  2F0K A;  4CJ0 B;  2D2C C;  1CSP A;  4L6T B;  5M3M B;  4KD3 A;  2J4X A;  1SRU A;  4NMZ A;  3MWY W;  1MI2 A;  4R4T A;  1DZ1 A;  4L8J A;  1BO0 A;  1VF7 A;  2PQA A;  2Q8T A;  4IPH A;  1D5Z C;  3PSI A;  1WTO A;  1PH5 A;  2AQ3 B;  3QR8 A;  3ONA B;  2JA5 B;  1GM5 A;  3BDC A;  4NW2 A;  1CI3 M;  4BA1 I;  4Y52 H;  3HOX G;  3BVM A;  1LLR D;  3K8A A;  2UUB L;  5IYD H;  5IYD G;  1CKN B;  1JIC A;  2NN6 I;  2B2W C;  3ERO A;  4R9W A;  3G6J B;  4DN4 M;  1TVX A;  1J6Q A;  1EYD A;  5K5P A;  5ELC A;  3N52 A;  5COY A;  1EY8 A;  4RKB A;  3J80 L;  4R1J A;  2K50 A;  5GAH C;  5KYI A;  1R9T H;  4HID A;  2HHH Q;  4A3G B;  5F2D A;  5G3L F;  1PYS B;  3T1Y Q;  1U5K A;  2F0J A;  3JAM L;  3RZD H;  3Q23 A;  1NCV A;  4DK0 A;  1O7Z A;  3IKJ A;  1FVI A;  1S72 A;  5CV8 A;  4LF9 L;  2L0C A;  4AIM A;  5IP7 H;  3NSW A;  5IP9 G;  1EY5 A;  4LF8 Q;  2DGY A;  2IL8 A;  2KED A;  1RTO A;  1FR3 A;  4DR6 L;  4IPG A;  4DR4 L;  3C1E A;  3VA7 A;  4DV3 L;  1ROD A;  3GTP H;  1N33 L;  3CCM A;  3S1R B;  2SOB A;  1YJN A;  4JYA Q;  2WKC A;  1I5F A;  3FKI H;  3VYS A;  4H0L C;  4X66 Q;  4DAY B;  4H13 C;  1D1I A;  1L2F A;  5ELD A;  5FJ8 G;  1HHV A;  1GD7 A;  2EY6 A;  2F0V A;  2NN6 H;  2DJG C;  3WDN A;  1VQD A;  3T51 B;  1TXY A;  1QG7 A;  1SMY D;  5EAY A;  4BBR H;  4MZ9 A;  4FVM A;  1I4H A;  4DR3 Q;  2LSS A;  4K2L A;  1HR0 L;  2CVR A;  1S4Z A;  1O78 A;  2ICE C;  3JAM i;  1EOV A;  4GKJ Q;  2KQ3 A;  2B2U C;  3T56 B;  1WYD A;  3H94 A;  4K5V A;  5JEA G;  3K5L A;  3SE0 A;  1G51 A;  2CCZ A;  1XPR A;  5EKK A;  3HKZ G;  3SGI A;  4DAP A;  1VQK A;  1UEA B;  3TSS A;  4PMW A;  1TS2 A;  5IYC H;  5IYB H;  1Z9F A;  3JC6 6;  1WOC A;  1Y1V H;  4JI1 L;  2I0Q A;  2NZH A;  1ENA A;  1B9M A;  2L9H A;  5E4X A;  3G4S A;  4FXK C;  1I4P A;  2R93 B;  2NTS A;  2K28 A;  4RCN A;  3A54 A;  5GQO A;  4OX9 Q;  1HFG A;  5IGD A;  2PNR C;  5EPL A;  1DD2 A;  3FMC A;  4QMG A;  4A3E G;  5BN5 A;  1JJC B;  3NTK A;  3TN2 A;  1SFO H;  4ZUI A;  1VQG A;  4CDE C;  1I94 L;  2Z4H A;  2R7D A;  4J6H A;  2MQH A;  3MZ5 A;  3FP9 A;  1A63 A;  4LF7 L;  3D4R A;  4ODG A;  1A62 A;  1BBU A;  2RHQ B;  1Q46 A;  1JQY D;  5C4X H;  2WAC A;  1BCP B;  4DV1 L;  4XYQ A;  1SNO A;  1PHJ A;  4JI1 Q;  1QVG A;  5ELO A;  5H1S E;  2ZXR A;  1TWC B;  4KLK A;  2PI2 A;  3F2U A;  4B3T Q;  1J8I A;  3CU7 A;  5CC4 A;  5LMU Q;  2E2J H;  2FXQ A;  3RR5 A;  5M3M G;  4BBR B;  5IOC A;  3EQL C;  1Y1V B;  4UP7 A;  3DEP A;  4YY3 Q;  4DV5 Q;  1MSH A;  2CW0 C;  4DKA C;  2UU9 Q;  2LS0 1;  2Z1C A;  5K36 G;  1N9W A;  1UE1 A;  2EYF A;  4S3S A;  2QKI C;  1XX8 A;  2QF7 A;  1TWF H;  4LF6 Q;  3CD6 A;  3ICE A;  1K0S A;  1DON A;  3IAY A;  4YWL A;  1C7Y A;  3EIV A;  1N33 Q;  4AH6 A;  4ULL A;  3MAQ A;  3VR3 A;  3GDE A;  5I2X A;  4X64 L;  5KGU A;  4KHZ A;  1A6X A;  1CSQ A;  2HT1 A;  1B3Q A;  2EVB A;  1EQV A;  5NUC A;  4JYA L;  2R92 H;  4A3L G;  3PO3 H;  4FF2 A;  1CT1 D;  1IBL Q;  1YNN C;  4B3T L;  4A3B H;  1CHP D;  1P8L A;  1TWH H;  4HN7 A;  1B53 A;  1CFM A;  1R9T B;  5K36 H;  1BXT A;  1SE8 A;  3BZC A;  3QO2 A;  1E2W A;  2QW7 A;  2ZTD A;  5FO8 B;  4YY3 L;  4DV5 L;  4CGY B;  2MHV A;  1GOZ A;  1I6V C;  2PNH A;  2K5N A;  1VQ8 A;  2K4K A;  4E6I A;  5KNC A;  1NY4 A;  5A2Q E;  5IT9 E;  4C3I B;  2NYZ D;  1MJE A;  1C48 A;  4LW1 A;  2L5T A;  1V8Q A;  1IXR A;  5JJI A;  5BN3 A;  1PVO A;  3PF4 A;  2JEA I;  4I7A A;  3I73 A;  4XDX A;  3ERS X;  2K52 A;  1IBK Q;  1R4P B;  3VYR A;  3TDQ A;  4P72 A;  5C5M A;  4FF3 A;  2L55 A;  3DXJ C;  3UE0 A;  3CCQ A;  1XNQ Q;  4MTN A;  2KJX A;  4DR2 Q;  2LKV A;  3R2I A;  2A69 D;  4O1N A;  2XSC A;  1PH7 A;  1SFO B;  1VQN A;  1K83 H;  2KEC A;  4FDB A;  1KNA A;  3NP8 A;  5I9P A;  3H09 A;  1LAB A;  2OEO A;  3NEN A;  3PF5 A;  5CGK A;  5J39 A;  3S1N B;  1I3Q B;  4RG1 A;  2IW3 A;  5JJZ A;  3URY A;  2RA4 A;  4OWX B;  4JI4 L;  1EOT A;  1PH9 A;  4IFD J;  2K33 A;  2L15 A;  2SNS A;  3RZO B;  4QIW E;  4RA8 A;  1PTO H;  3IFT A;  3BVZ A;  2GN5 A;  4HIK A;  4K6D A;  3DLL A;  2MJ8 A;  4DV1 Q;  2XN9 C;  2N55 A;  3AFP A;  3AMU A;  1Z6H A;  4P73 A;  4M8A A;  1H9S A;  1W6J A;  2ATW A;  1SYF A;  3OTO Q;  4DK3 C;  2UXC L;  4DNT B;  2NVX H;  2AUJ D;  1M1K C;  2EOT A;  1JOR A;  1UE6 A;  2G9H D;  3KLS X;  2K7V A;  1CZG A;  1SMY C;  1IW7 C;  2IHF A;  3H0G H;  3IRB A;  4N9P A;  1QJO A;  4FP5 D;  2WAQ B;  3Q22 A;  2ASB A;  2PZU A;  4BBS G;  4DV0 Q;  2NN6 G;  1RIP A;  4C2M B;  1PRT B;  3NQI A;  5JVG 3;  1ML0 D;  3K5O A;  1KIX A;  1MD2 D;  2I5L X;  4HTH A;  5G3L D;  4GN5 A;  1GHJ A;  1E1T A;  2M2L A;  4A3M H;  2F0M A;  4RAU C;  3QJY A;  5FLM G;  3OWE B;  3RUZ A;  4JBK A;  1IBM Q;  5JJL A;  3AQQ A;  1EYG A;  1T5X D;  3EBE A;  4WFN 3;  1GVP A;  3S1R H;  1AW7 A;  2JA7 B;  3V05 A;  3BZD B;  3PO2 G;  3GTJ H;  3U4Z A;  2A6H D;  4CDC C;  3K0Y A;  1HJP A;  4LFB Q;  3KBX A;  2XGT A;  4A76 A;  4QUC A;  2ZTE A;  4GKK L;  2E2J B;  2OCE A;  1YNJ D;  5M5X H;  2CHB D;  4IZ8 A;  1EU4 A;  3OIP A;  1LTT D;  4LWC A;  4RGN A;  1FL0 A;  3N6R A;  1YHA A;  1XMQ Q;  3GTK H;  1SN8 A;  2R7Z H;  3I4M G;  4J8Q A;  1IBL L;  2JA7 H;  4LFA L;  3H15 A;  4JI6 Q;  4V19 0;  2VUM G;  3PIP A;  5HUR A;  3ULJ A;  1NR2 A;  2NWG A;  2CW0 D;  2EQS A;  4LNQ A;  3L7Z C;  4DV7 Q;  3CCR A;  3MEH A;  3UDF A;  3CHB D;  1TII D;  4WJ3 M;  3ULL A;  1PH2 A;  5C44 H;  4DFA A;  1JB3 A;  3M4P A;  1EIY B;  4YHH L;  4XQJ A;  3CC2 A;  1PA6 A;  4JBJ A;  2K5H A;  2HCI A;  2HQL A;  4KJN A;  2HQE A;  1LAC A;  3J7Z C;  1HUN A;  1CQV A;  1AFP A;  2ZTC A;  4GN3 B;  3KF8 B;  4P71 A;  1MJC A;  2RSO A;  2YU9 H;  1UAP A;  2IX3 A;  5LMU L;  1EYA A;  4K14 A;  3HOV B;  2DY7 A;  1ASY A;  3GTG B;  2EYO A;  1Y1W H;  4UHV A;  2G5D A;  3J81 L;  3BYY B;  2VS1 A;  2I5H A;  4KKU A;  4NP5 A;  4R4C A;  5ELN A;  1KAA A;  1SND A;  4AQY L;  1I4X A;  3RLO A;  4RGM A;  4O2D A;  5IIF A;  1TS5 A;  1EUJ A;  1NMG A;  1PLF A;  4LF4 Q;  4JI5 Q;  1BVS A;  1MSG A;  4G4K A;  4A93 H;  1NTG A;  4IUR A;  3A55 A;  5GAE C;  5EBD A;  2NVT B;  3L9A X;  1S5B D;  4GOP C;  5AFW A;  4ALP A;  1D1K A;  1Y8O B;  1CQF A;  2JSO A;  2D9U A;  1IBM L;  1J5E Q;  5DEH A;  3RZO H;  1L1O A;  3L0O A;  1VQE A;  4JW0 A;  2CH4 W;  2PMZ E;  5COR A;  3H6M A;  3TS0 A;  3RMH A;  3CCV A;  2KEE A;  5JPM C;  1X3G A;  4A3K H;  4BBR G;  4F8M A;  1V1P B;  4AYB B;  2ALY B;  4HSP A;  4DNR B;  2JEB I;  3WOE A;  3R3O A;  5I9O A;  4DR3 L;  1G8Z D;  1VQM A;  3GTK B;  5KEE A;  4BS9 A;  3PIO A;  3QB3 A;  3K58 A;  1DXM A;  1Y1W G;  4A3C H;  2JA6 G;  3S14 B;  1RTN A;  1VQF A;  2B39 A;  2CFM A;  3OMC A;  1VQ5 A;  2WFW A;  1GUT A;  3M4O H;  2AMC B;  4X64 Q;  1YI2 A;  2OQK A;  2V4D A;  2VL6 A;  5JAV A;  5IP7 G;  4R8I A;  1QZH A;  2WP8 J;  4LFB L;  2AUK A;  1WTR A;  2PW7 A;  4KD4 A;  1V9P A;  4JBM A;  2NB0 A;  2OTL A;  5EPJ A;  1SJE D;  4GKK Q;  1HA6 A;  4POG A;  1SEB D;  4CKB A;  3J7Y W;  1T9H A;  1VQ4 A;  1H9S B;  4KHP Q;  2KUM A;  3KYH C;  4BY7 B;  1HNZ L;  5DAU A;  4DK6 C;  5C44 G;  4XTC S;  4B3R L;  3DUZ A;  4JI2 Q;  5M5X B;  4JV5 Q;  4XT3 B;  1WI5 A;  1HQR D;  3TP7 A;  1P16 A;  1I94 Q;  1E2V A;  3OIQ A;  4A3I B;  1YNX A;  2FHT A;  5C4Z A;  4YCW A;  2EIF A;  4IPC A;  5M5Y B;  4X3U A;  3OMG A;  4ABN A;  3CPW A;  1T5E A;  2B2V A;  1ICF B;  1SYD A;  1U9R A;  1OO9 B;  3CQZ B;  4IPD A;  3TZD A;  1STA A;  2I46 A;  3CKI B;  3I4M H;  1JJG A;  1Q8I A;  1W2B A;  2AHO B;  1SE3 A;  4LFC L;  1H9J A;  1RD9 D;  2E2H B;  3W1B A;  3T1H L;  4A3D H;  2Q2H A;  3RLN A;  3JAM c;  3A8K E;  4LF8 L;  2JP1 A;  1PYB A;  3J80 E;  5GRO A;  1FNW A;  3DHQ A;  1CUK A;  3J80 c;  1OXT A;  3S2H B;  3G48 A;  1BCP C;  3M4Q A;  3PO2 H;  1ENF A;  1WTW A;  2E2D C;  3VR5 A;  3ITP A;  2XNA C;  4WOR A;  1KLU D;  4IUT A;  3DWP A;  1EU3 A;  2ENB A;  2DUD A;  2KEN A;  1F2Z A;  1K73 C;  5C3E G;  1C0A A;  3HGB A;  3MVV A;  2ZM6 L;  4IUP A;  1ONL A;  4IJH A;  1X32 A;  5C0X H;  3SK4 A;  2H4O A;  1K9M C;  4JK1 C;  2KOL A;  1XXG A;  4A3E B;  1GUS A;  5LL6 X;  1IYJ B;  1ASZ A;  4KMU C;  4DXF A;  1Q82 C;  2KA7 A;  2FJ2 A;  1VS0 A;  1VQP A;  1VQ9 A;  3HOU H;  1UWV A;  1SNP A;  3W5O A;  4IQZ A;  3KF6 A;  1J5E L;  4RKL A;  2RCN A;  1ILP A;  5IY0 A;  3M85 A;  4PZ7 A;  1PDQ A;  2RKS A;  5EJW A;  3BG3 A;  5T1G A;  1JE5 A;  2E8G A;  2YTV A;  1LTL A;  2A19 A;  5ELF A;  3T1Y L;  3I4O A;  3GD7 A;  1XNR Q;  4ZCK A;  4UY8 C;  1G6Z A;  4Y7N H;  2A8V A;  4IN3 A;  5GAD C;  2EJM A;  2KHJ A;  2K03 A;  2WB1 B;  3KLS A;  4IO9 A;  3A8J E;  4EQP A;  1Y8N B;  1BDO A;  2C9O A;  2LXK A;  1I6H H;  4L5S A;  4EQN A;  3D8G A;  2YYZ A;  1OXV A;  1DOM A;  2ZT9 C;  2MNA A;  3K6O A;  4ZKC B;  2KCT A;  1F77 A;  3CF5 A;  1PH1 A;  4NKL A;  1G2T A;  1SXT A;  2NZO A;  1TY2 A;  3AFQ A;  3PUZ A;  2F0N A;  1WD0 A;  1MHW C;  1L0X B;  1ZKO A;  4PNY A;  4ZKB B;  4K5X A;  2RCF A;  2EYL A;  4HIO A;  2R93 G;  1OXU A;  3SXH A;  1HPC A;  1XPO A;  3PIO 3;  1PFN A;  1VQO A;  4FYD A;  4XIG S;  2EY2 A;  3H0G G;  2BH2 A;  2VB3 X;  1Q3L A;  1A3U A;  2BA0 A;  3K81 C;  2YU9 B;  1D8L A;  1E22 A;  1AEX A;  1ILQ A;  1Q86 C;  2QA4 A;  1IKL A;  1HTP A;  2P5Z X;  3AYH B;  4C1N I;  1Q8K A;  5LMN L;  1S3O A;  3E5S A;  4U68 A;  1PFM A;  1PMR A;  1X55 A;  2F0H A;  2OXP A;  2N3S A;  2Y0S E;  1A8V A;  1K3R A;  2ID0 A;  4LUO A;  3VA5 A;  4A3G G;  5I6W A;  3CRK C;  4IOA A;  1N36 Q;  5LHY 1;  2WAQ G;  3D4W A;  1A2T A;  4ZRZ A;  2EYJ A;  3QOJ A;  1A15 A;  1AP0 A;  5IT9 c;  3K5N A;  2KHS A;  1EIH A;  3MFY A;  3CW2 C;  1ET6 A;  4ME3 A;  1NUC A;  1CA5 A;  2SDF A;  4GN4 B;  4Q5V A;  1TT2 A;  4DUZ Q;  2MPM A;  2HUG A;  4NB3 A;  4NXN Q;  3I56 A;  3NE5 B;  3C46 A;  5C4J B;  4OEL B;  3WOF A;  4B9X A;  2D0O A;  4RHS A;  5IGF A;  4DV0 L;  3VYU A;  1JWU D;  4KKS A;  1SYG A;  2E5L Q;  2F0U A;  4G7Z C;  1NJI C;  3GTO H;  5IE8 A;  1YIT A;  4DV2 Q;  3PIP 3;  1L0W A;  1AN8 A;  1X3E A;  2EPB A;  3PUY A;  4K8J A;  4DAM A;  5E7N A;  2F0Q A;  1O7L A;  2K01 A;  3BVG A;  4KY5 A;  4X3S A;  3A5Z B;  4CDF C;  3K59 A;  2PPB C;  3BDL A;  1KRT A;  2BDO A;  2BA1 A;  4RH6 A;  1YIJ A;  3D31 A;  3I4L A;  1VMP A;  1SMX A;  2UUA L;  2F0O A;  1NNX A;  3R8B A;  3JAM E;  3H3V I;  4N9T A;  1LV9 A;  5CYU A;  4X66 L;  4GNX B;  1U4L A;  4UAI A;  1XNQ L;  1I4G A;  3K80 C;  1B3A A;  1D7Q A;  4NXN L;  4RHR A;  1STB A;  1JMC A;  2M00 A;  2PYK A;  1YNJ C;  3ULP A;  2A5H A;  1X3P A;  2UXB L;  4CKE A;  4OO1 G;  3J7A V;  2A6H C;  3K57 A;  4DV2 L;  2E75 C;  1QCB D;  4TSS A;  4A3D G;  2K14 A;  2JA5 G;  2GVA A;  1AE2 A;  3D6C A;  5CV7 A;  3HFZ B;  2XRS D;  1K0R A;  1YVC A;  2CWP A;  2GA4 B;  2A73 B;  2Q2I A;  4EVO A;  1EWC A;  1FNU A;  1L1O C;  1Y1V G;  1KQS A;  2E2I H;  1JJ2 A;  3MC0 B;  2MO1 A;  3LGJ A;  4C3J B;  4JI0 L;  1F9P A;  4LF5 Q;  1HNW Q;  4O42 A;  3NEL A;  4A3G H;  5TSS A;  3MTS A;  3G6E A;  1JT8 A;  2Z9H A;  5FO9 B;  2Q2U A;  1RL2 A;  1F9R A;  4IAL A;  4LUZ A;  4G7H C;  1EY4 A;  1NBW A;  1TU2 B;  3S1Q B;  3W3A A;  3GTL B;  2O4X A;  1FNV A;  2K5D A;  3X3M A;  4C2M H;  1PTO B;  1KDC A;  1AH9 A;  1KDA A;  1PZJ D;  3L2P A;  3UDG A;  1FGU A;  1X65 A;  3FEW X;  3NQT A;  1QE6 A;  4GLX A;  1G91 A;  2F0P A;  1VQ6 A;  1QZG A;  3A56 A;  2WKD A;  4UPA A;  3HG9 A;  4DXG A;  1QWY A;  3GTQ B;  1FJG L;  3PQI A;  2XWJ B;  4DR5 Q;  3TP8 A;  4MHE A;  2B2W A;  5J22 A;  3OPO A;  3KFU A;  5J1Z A;  4U67 3;  1WD1 A;  2JA8 B;  5C0X J;  4ZUJ A;  2VUM B;  5ELE A;  3T16 A;  1W3S A;  4ZLT F;  1V1O A;  3NTH A;  2B8F A;  5LL6 S;  4KN7 C;  4IOC A;  3OWF A;  4JI4 Q;  5C4H A;  4OO1 I;  4JG2 A;  1Q81 C;  5E1F A;  1BQQ T;  1A0I A;  2ZXP A;  3K7A H;  4L63 B;  2CQO A;  3D4D A;  5DM6 3;  1IKM A;  2CH4 A;  4AYB G;  4A3K G;  4BY7 H;  1B50 A;  1QNU A;  4JI6 L;  1GUG A;  2AWO A;  1FJG Q;  1G29 1;  4QF4 A;  2R61 A;  5KIX A;  1TWA B;  1JOO A;  5CV5 A;  1LTA D;  2WAQ E;  3J81 i;  4A3I H;  3VYT A;  1IHZ A;  1XTD A;  4B3S L;  4APV A;  4LJZ C;  4GLA C;  4Q0F A;  4TKO B;  4F88 A;  5I4D A;  1F2M A;  3RLF A;  2UUC Q;  5HGQ A;  5EQ0 A;  1SYE A;  3S1Q H;  4OL7 A;  4X65 L;  3DMU A;  3BS1 A;  1VQC A;  1MKH A;  1EEI D;  4HJ7 A;  1GJX A;  1B4O A;  4JPB W;  1LTB D;  3PCO B;  3S9W A;  4A3M B;  1LTI D;  3K0X A;  3P7J A;  4X3K A;  3OYY A;  4UP9 A;  1HCZ A;  5C3X A;  2B2T A;  2KBN A;  4YWM A;  1HA5 A;  2Z6K C;  3QG1 A;  2L1B A;  3GTP B;  3NBH B;  5C44 B;  1YHQ A;  3E6Z X;  1BBX C;  4DV4 Q;  1L0Y B;  4HR7 B;  4ME5 A;  1BKB A;  3VDY A;  3S2D H;  3GTL H;  3F8T A;  1WVL A;  1MBY A;  1HNX Q;  1SYB A;  1ZEQ X;  1GO3 E;  4H44 C;  1KL9 A;  2QEX A;  2OQ0 A;  4EX5 A;  1JOK A;  1PTO D;  1JCK B;  4A3J B;  2HDL A;  3IFD A;  3J7A 5;  2EY1 A;  3VR6 A;  5M9O A;  3DWA A;  3VR2 A;  3HOY G;  5AJ3 Q;  4LUV A;  1SE2 A;  2Q8R E;  2NBF A;  1JB7 A;  2MUY A;  4UDU C;  4HSV A;  4K0K Q;  2L4N A;  3DWQ A;  5M5W B;  3UDX A;  4DAV A;  4P2C B;  1BR9 A;  1I4Q A;  1I50 H;  5M3F H;  3M7G A;  2BDN A;  1EQT A;  2EXD A;  3TS2 A;  1BUV T;  2VUM H;  3HOX H;  3KJP A;  3T53 B;  3CCL A;  1HTL D;  1K83 B;  1PTO C;  2D62 A;  2R7Z G;  2ZM6 Q;  5D3I B;  1SYC A;  1VMC A;  3Q0A A;  1IW7 D;  2VQE L;  3HOY B;  4BY7 G;  1PH4 A;  3AB9 A;  4AQY Q;  2N49 A;  4C3I G;  4LF9 Q;  3L3O C;  4RGT A;  2IJ0 A;  3C2P A;  1FD7 D;  1SR3 A;  4C1N K;  3GQB A;  4JI3 L;  4K8I A;  3M3Y B;  5CV4 A;  1S5F D;  4CHT B;  1EY7 A;  3OOC A;  5FLX E;  2NTT A;  2HCC A;  4HED A;  2EDG A;  1E2Z A;  3HEJ A;  4DF7 A;  4DPG A;  5D14 A;  4RMF A;  2VNU D;  3A74 A;  3M4Y A;  3GTQ H;  2LFN A;  1LUZ A;  2JA6 H;  4A3M G;  1HZA A;  4R4I A;  3S15 B;  3E9H A;  2UUC L;  1I50 B;  5BR8 L;  2J7Z A; 
#chains in the Genus database with same CATH homology
 1HXY D;  1JR0 D;  4ZAI A;  4DGZ A;  4XQN A;  3RD4 A;  4DK1 A;  1FGB D;  1F2L A;  1KLG D;  3A7L A;  1STY A;  1Q90 A;  1KTK A;  4QCL A;  1W6K A;  3TP6 A;  1JWS D;  3HKZ B;  4LMQ D;  5IT9 L;  3NXW A;  4TQU S;  5FK9 C;  1Q1B A;  1CZW A;  3PUW A;  4HCS A;  2QDB A;  1WTP A;  4EQO A;  3LNN A;  3PO3 B;  4ZYS A;  4OIJ A;  2X6G A;  4CKC A;  2LY7 A;  1OXX K;  2A6E D;  1QB5 D;  2NVQ B;  4DAY A;  1B1Z A;  5D65 A;  2Z8L A;  1WTV A;  3SK6 A;  3M4O B;  1CHQ D;  5EPK A;  1TQO A;  1NAP A;  1TWF B;  2EE1 A;  2SEB D;  4WRD A;  1IYV A;  1KDB A;  3HOZ B;  2DY8 A;  5C5L A;  1V1P A;  2RDH A;  2QCP X;  3TBI B;  2XRQ D;  4B9W A;  2D5D A;  4KI0 A;  4PMB A;  1UUP A;  3OHX C;  3LWE A;  2F0T A;  3D3R A;  2BCO A;  1PYW D;  2F3W A;  2JA6 B;  2ICI A;  2MP1 A;  1F9S A;  2OF1 A;  5EBC A;  2R3Z A;  2JE6 I;  1LTG D;  1JOQ A;  3MXG A;  2A68 C;  4A3D B;  4MN3 A;  2RDF A;  4V0B A;  3PUX A;  1DCZ A;  2PCF B;  5CV9 A;  3EFX D;  3GV3 A;  5C4X B;  4C3H B;  2EJG C;  4CJ2 C;  3SK5 A;  1II3 A;  1O7Y A;  4CBV A;  1GUN A;  2B63 B;  1ZXT A;  2K1B A;  1EY6 A;  5EKL A;  3HRZ C;  1VDZ A;  4BY1 B;  1ZYR C;  3ND9 A;  3VR4 A;  3NBI A;  4FNF A;  2R92 B;  3DM1 A;  1CTM A;  2M9V A;  2FFK B;  1JC7 A;  1Z7T A;  2L11 A;  2F0I A;  3Q24 A;  5IGC A;  3C3L A;  5DNF A;  3NWS A;  3MXP A;  3OW7 A;  4FXD A;  2E2I B;  3MHB A;  2IT1 A;  5EKI A;  1TR5 A;  3U9O A;  1A2U A;  1EYC A;  4FXG C;  1B9N A;  2L12 A;  3FVQ A;  1ESF A;  4ILW A;  2BE5 C;  4FF4 A;  1WTQ A;  1PTO F;  5M3F B;  1LTR D;  1BCP D;  3NWT A;  2TSS A;  3NUC A;  2B2U A;  2I07 B;  1GUO A;  4K5W A;  2NZ1 D;  1LT5 D;  2WIN B;  1S5D D;  3R93 A;  4HAE A;  3H0G B;  1G2S A;  4X3T A;  3S2D B;  3LX0 A;  3PMF A;  2K6A A;  1A3T A;  3BYT B;  5CBE E;  2DN8 A;  3UI2 A;  2JXM B;  1ZYR D;  2RQX A;  3SR1 A;  3SK8 A;  2NVX B;  3HS0 C;  4KKT A;  1EFI D;  1SNQ A;  2K04 A;  2AWN A;  2LMC B;  1M4V A;  1Y1W B;  3PO2 B;  4KY6 A;  4MIU A;  3TZU A;  5KND A;  1RJT A;  3GP7 A;  2G9D A;  2F3V A;  1WTX A;  5HGT A;  3I3C A;  5A35 A;  4ZK9 B;  1WCM B;  4ID6 A;  3MFG A;  4FO2 A;  1U4R A;  1JWM D;  5C3W A;  4HMJ A;  2E74 C;  3H91 A;  3HOX B;  5C6A A;  2WII B;  2K5Q A;  4KK7 A;  1S5C D;  4QIW B;  2PQE A;  2JYO A;  2K5W A;  1ET9 A;  2KCN A;  3FPP A;  1I4R A;  2Y0S B;  3NBH A;  5IGB A;  1QNK A;  1IL8 A;  1B44 D;  1PZI D;  1GXD C;  1K8M A;  3KLR A;  2NVY B;  4BWG B;  1DM0 B;  2EJF C;  3HOW B;  2XWB B;  1DJR D;  2VXW A;  4IFD H;  4KV6 A;  4OHJ A;  1PZK D;  2PZW A;  3I72 A;  5FOB B;  3MXU A;  4I65 A;  4A3K B;  4R8N A;  5I6Y A;  2ZXO A;  2A69 C;  3K5M A;  2B8G A;  1EY0 A;  5ISR A;  1E0B A;  1CK1 A;  1TWG B;  1CA6 A;  5JEA H;  5KNB A;  4YIJ A;  3CRL C;  1FYC A;  1DOK A;  4BA2 I;  1D5X C;  2AQ2 B;  3GTM B;  1JE4 A;  1NR4 A;  4RCO A;  3S1M B;  4H7B A;  1TY0 A;  1SE4 A;  3G7L A;  3SVM A;  3W2D A;  1KNE A;  4A93 B;  1STE A;  2BOS A;  3OSO A;  5IGE A;  3FPU B;  3I90 A;  4IFD G;  2F4I A;  1IYU A;  3KK7 A;  3T4A C;  4IUN A;  1PRT C;  2X6L A;  1S5E D;  2B2V C;  1RKN A;  2FMM A;  4IUQ A;  2R7Z B;  3KF8 A;  4K6L A;  1VF5 C;  2F0E A;  1BOS A;  4Z9C B;  4WJW A;  1RCV D;  3U9S A;  2AQ1 B;  1QIL A;  5C3E B;  3QIA A;  4XYO A;  4KHV A;  2EYH A;  3KBG A;  2R6G A;  5CR3 A;  1Q1E A;  5A2Q L;  5FO7 B;  5FLX L;  1Q12 A;  1A3V A;  3S16 B;  1EL0 A;  1HUM A;  2VB2 X;  2F03 A;  3X3N A;  4IUV A;  4TRD A;  1KAB A;  4Y7N B;  4HMI A;  3I8Z A;  1D6E C;  5JOB A;  1LT3 D;  3NPP A;  4I7Z C;  4RFB A;  2A6E C;  3D6W A;  3HP3 A;  1B2T A;  4OO1 H;  1D5M C;  3Q6S A;  3SDZ A;  2IX1 A;  4C3H G;  1X3Q A;  2B2Y C;  3BDO A;  1XYI A;  3FDT A;  1XTC D;  2B2T C;  3QOL A;  1PFB A;  4LAA A;  2NUC A;  1U4M A;  2HDM A;  3ZYY X;  5BN4 A;  2IWH A;  4QB4 A;  1BNZ A;  4PMC A;  5IGG A;  1RDP D;  4EGV A;  1PRT D;  4IFD I;  1RF2 D;  4DU9 A;  2A68 D;  3T13 A;  1VCI A;  5JEA J;  1SSO A;  2PZT A;  3K7A B;  1C8C A;  3O13 A;  4M1U B;  3I4N B;  4OGQ C;  1HRJ A;  5KRU A;  1H9K A;  1EY9 A;  1ENC A;  4XT1 B;  4NDX A;  1F9Q A;  3MA2 B;  1DYQ A;  3GTO B;  1AZQ A;  1YNN D;  1K8O A;  2EYP A;  3A8I E;  4GZY C;  1Z47 A;  4C56 C;  1Y69 U;  2H1E A;  1SNC A;  3NTI A;  2DNC A;  4CJ1 B;  5I2Y A;  1ICW A;  3GV6 A;  2O5I C;  4PV1 C;  2PO4 A;  4B08 A;  4RWS C;  3P1H A;  1R4Q B;  1EZ8 A;  2EY5 A;  2C5C A;  1EWH A;  1LO5 D;  5C0X I;  3PV0 A;  1SAP A;  3I4M B;  1PXU A;  2PW5 A;  3S17 B;  1UNS A;  2RSN A;  2EZV A;  5DM7 3;  1BF4 A;  4LK1 C;  3P20 A;  3SHL A;  1TS3 A;  2F1M A;  1HQM C;  2F0S A;  3V96 A;  1QOH A;  3IL8 A;  3HZX A;  3I70 A;  1C4Q A;  1CM9 A;  5IOD A;  1I6H B;  4G57 A;  2XVS A;  3QWN A;  4JBW A;  3TME A;  3V2T A;  2TMP A;  4DA2 A;  5E4W C;  4BBS B;  1SJH D;  3C1F A;  2CQA A;  2O2L D;  4ZQ3 A;  3EA6 A;  1U4P A;  1O80 A;  1EEF D;  3M7N A;  3FRP B;  3J7A F;  2DNE A;  4F7X A;  2EXZ A;  2N88 A;  1XWE A;  1EIG A;  1J9O A;  3LWU A;  2X69 A;  2Z4I A;  2IX0 A;  4J1M A;  2F0F A;  1GUW A;  4HCE A;  3I91 A;  1M8A A;  2WV6 D;  4KTA A;  5JPN C;  4C3J G;  4K2K A;  2F0L A;  5D3D A;  1SNM A;  1H9R A;  1Y8P B;  4KY7 A;  4FF1 A;  4PQX A;  2Q8I B;  2F0W A;  2FMC A;  1H9M A;  1MGS A;  4KJO A;  5CMD A;  3EJI A;  2XIW A;  4RGO S;  3GO5 A;  4XXE A;  1LT6 D;  1LTS D;  5E3F A;  2F0G A;  2QIL A;  2PMZ B;  1EZ6 A;  5JVH 3;  3NHH A;  3MXN A;  1NSN S;  2F0D A;  3H3V C;  3GTJ B;  2BE5 D;  1ESR A;  2OT2 A;  1DOL A;  3FKI B;  3HOU B;  1STG A;  3E0J A;  1SDF A;  3P75 A;  5EGT A;  4A3F B;  2B2Y A;  4F87 A;  3DEO A;  3NK9 A;  3A7A B;  4KN4 C;  1TKW B;  2MGS A;  2QEJ C;  1BCP F;  1F2Y A;  2RBM A;  1AZP A;  3EVQ A;  1OXS C;  4IUU A;  2E76 C;  1TS4 A;  5ELB A;  3PUV A;  4OIK A;  3RZD B;  1LT4 D;  5FKA C;  3ND8 A;  1GHK A;  2A74 C;  5KYL A;  1V43 A;  2K32 A;  2K05 A;  4QUF A;  2J0T D;  2KVM A;  1STH A;  5T1I A;  1TWH B;  2KCC A;  4A3B B;  1SBB B;  2FIN B;  2SNM A;  1RHP A;  4XQQ A;  2RVL A;  1PRT F;  4G7O C;  5C0X G;  3J81 E;  2O5J C;  1HFN A;  5CBA E;  3AU7 A;  1D2B A;  2EYM A;  5CV6 A;  2RDG A;  3R2T A;  3ERQ A;  3SEB A;  3TP5 A;  2IPK D;  3KUP A;  1STN A;  2F0K A;  4CJ0 B;  2D2C C;  4L6T B;  5M3M B;  4KD3 A;  2J4X A;  3MWY W;  4NMZ A;  1MI2 A;  1DZ1 A;  4L8J A;  1BO0 A;  1VF7 A;  2Q8T A;  1D5Z C;  1WTO A;  2AQ3 B;  3ONA B;  2JA5 B;  3BDC A;  4NW2 A;  1CI3 M;  4BA1 I;  3BVM A;  1LLR D;  1JIC A;  2NN6 I;  2B2W C;  3ERO A;  4R9W A;  3G6J B;  4DN4 M;  1TVX A;  1EYD A;  5K5P A;  5ELC A;  3N52 A;  5COY A;  1EY8 A;  4RKB A;  3J80 L;  5KYI A;  4A3G B;  5F2D A;  5G3L F;  2F0J A;  3JAM L;  3Q23 A;  1NCV A;  4DK0 A;  1O7Z A;  3IKJ A;  5CV8 A;  2L0C A;  3NSW A;  1EY5 A;  2IL8 A;  2KED A;  1RTO A;  1FR3 A;  3C1E A;  3VA7 A;  1ROD A;  3S1R B;  2SOB A;  2WKC A;  3VYS A;  4H0L C;  4H13 C;  1D1I A;  5ELD A;  1HHV A;  2EY6 A;  2F0V A;  2NN6 H;  3WDN A;  3T51 B;  1QG7 A;  1SMY D;  4FVM A;  1I4H A;  4K2L A;  2CVR A;  1S4Z A;  1O78 A;  2ICE C;  2KQ3 A;  2B2U C;  3T56 B;  3H94 A;  4K5V A;  3K5L A;  5JEA G;  3SE0 A;  5EKK A;  4DAP A;  1UEA B;  3TSS A;  4PMW A;  1TS2 A;  1ENA A;  1B9M A;  2L9H A;  5E4X A;  4FXK C;  1I4P A;  2R93 B;  2NTS A;  2K28 A;  4RCN A;  3A54 A;  1HFG A;  5IGD A;  2PNR C;  5EPL A;  1DD2 A;  3FMC A;  4QMG A;  5BN5 A;  3NTK A;  3TN2 A;  4ZUI A;  2Z4H A;  4J6H A;  3MZ5 A;  3D4R A;  4ODG A;  1JQY D;  2WAC A;  1BCP B;  4XYQ A;  1SNO A;  2ZXR A;  1TWC B;  3F2U A;  1J8I A;  3CU7 A;  5CC4 A;  4BBR B;  5IOC A;  3EQL C;  1Y1V B;  3DEP A;  1MSH A;  2CW0 C;  2LS0 1;  2Z1C A;  5K36 G;  2EYF A;  4S3S A;  2QKI C;  1XX8 A;  2QF7 A;  1DON A;  3IAY A;  4ULL A;  3MAQ A;  3VR3 A;  5I2X A;  5KGU A;  4KHZ A;  1A6X A;  2EVB A;  1EQV A;  5NUC A;  4FF2 A;  1CT1 D;  1YNN C;  1CHP D;  4HN7 A;  1B53 A;  1CFM A;  1R9T B;  5K36 H;  1BXT A;  3QO2 A;  1E2W A;  5FO8 B;  4CGY B;  2MHV A;  1GOZ A;  1I6V C;  4E6I A;  5KNC A;  5A2Q E;  5IT9 E;  4C3I B;  2NYZ D;  1C48 A;  2L5T A;  1V8Q A;  5BN3 A;  2JEA I;  3I73 A;  4XDX A;  1R4P B;  3VYR A;  3TDQ A;  5C5M A;  4FF3 A;  2L55 A;  3DXJ C;  2KJX A;  2LKV A;  3R2I A;  2A69 D;  4O1N A;  2XSC A;  1SFO B;  2KEC A;  5I9P A;  1KNA A;  3NP8 A;  3H09 A;  1LAB A;  2OEO A;  5CGK A;  5J39 A;  3S1N B;  1I3Q B;  2IW3 A;  5JJZ A;  3URY A;  2RA4 A;  1EOT A;  4IFD J;  2K33 A;  2SNS A;  3RZO B;  4RA8 A;  1PTO H;  3IFT A;  3BVZ A;  4K6D A;  2MJ8 A;  2XN9 C;  2N55 A;  3AMU A;  1Z6H A;  4M8A A;  1H9S A;  1W6J A;  1SYF A;  4DNT B;  2AUJ D;  2EOT A;  1JOR A;  2G9H D;  3KLS X;  2K7V A;  1CZG A;  1SMY C;  1IW7 C;  4N9P A;  1QJO A;  4FP5 D;  2WAQ B;  3Q22 A;  2PZU A;  2NN6 G;  4C2M B;  1PRT B;  3NQI A;  5JVG 3;  1ML0 D;  3K5O A;  1MD2 D;  4HTH A;  5G3L D;  1GHJ A;  2M2L A;  2F0M A;  4RAU C;  3QJY A;  3OWE B;  3RUZ A;  1T5X D;  4WFN 3;  1AW7 A;  2JA7 B;  3V05 A;  3BZD B;  2A6H D;  3K0Y A;  3KBX A;  4QUC A;  2E2J B;  1YNJ D;  2CHB D;  4IZ8 A;  1EU4 A;  3OIP A;  1LTT D;  4RGN A;  3N6R A;  4J8Q A;  4V19 0;  5HUR A;  1NR2 A;  2NWG A;  2CW0 D;  3L7Z C;  3MEH A;  3CHB D;  1TII D;  4DFA A;  1JB3 A;  4XQJ A;  2HCI A;  4KJN A;  2HQE A;  1LAC A;  1HUN A;  1CQV A;  1AFP A;  2RSO A;  1UAP A;  2IX3 A;  1EYA A;  4K14 A;  3HOV B;  2DY7 A;  3GTG B;  2EYO A;  3J81 L;  3BYY B;  4KKU A;  4NP5 A;  1KAA A;  1SND A;  1I4X A;  4RGM A;  5IIF A;  1TS5 A;  1PLF A;  1MSG A;  4G4K A;  4IUR A;  3A55 A;  5EBD A;  2NVT B;  3L9A X;  1S5B D;  5AFW A;  1D1K A;  1Y8O B;  1CQF A;  2JSO A;  2D9U A;  5DEH A;  5COR A;  3H6M A;  3RMH A;  2KEE A;  5JPM C;  4F8M A;  1V1P B;  4AYB B;  4HSP A;  4DNR B;  2JEB I;  3WOE A;  3R3O A;  5I9O A;  1G8Z D;  3GTK B;  5KEE A;  4BS9 A;  3QB3 A;  3K58 A;  1DXM A;  3S14 B;  1RTN A;  2B39 A;  3OMC A;  1GUT A;  2V4D A;  5JAV A;  4R8I A;  2WP8 J;  2AUK A;  1WTR A;  2PW7 A;  4KD4 A;  2NB0 A;  5EPJ A;  1SJE D;  1HA6 A;  1SEB D;  4CKB A;  3J7Y W;  1H9S B;  2KUM A;  4BY7 B;  5DAU A;  4XTC S;  3DUZ A;  5M5X B;  4XT3 B;  1HQR D;  3TP7 A;  1E2V A;  3OIQ A;  4A3I B;  2FHT A;  5C4Z A;  5M5Y B;  4X3U A;  3OMG A;  4ABN A;  1T5E A;  2B2V A;  1SYD A;  1U9R A;  1OO9 B;  3CQZ B;  3TZD A;  1STA A;  2I46 A;  3CKI B;  1Q8I A;  1SE3 A;  1H9J A;  1RD9 D;  2E2H B;  3A8K E;  2JP1 A;  3J80 E;  1FNW A;  3DHQ A;  1OXT A;  3S2H B;  1BCP C;  1ENF A;  1WTW A;  2E2D C;  3VR5 A;  3ITP A;  2XNA C;  4WOR A;  1KLU D;  4IUT A;  3DWP A;  1EU3 A;  2ENB A;  1F2Z A;  3HGB A;  3MVV A;  4IUP A;  1ONL A;  1X32 A;  5C0X H;  3SK4 A;  2H4O A;  4JK1 C;  2KOL A;  1XXG A;  4A3E B;  1GUS A;  5LL6 X;  4KMU C;  4DXF A;  2KA7 A;  2FJ2 A;  1SNP A;  4IQZ A;  4RKL A;  1ILP A;  3M85 A;  1PDQ A;  2RKS A;  5EJW A;  3BG3 A;  5T1G A;  5ELF A;  3GD7 A;  1G6Z A;  4IN3 A;  2EJM A;  2K03 A;  2WB1 B;  3KLS A;  3A8J E;  4EQP A;  1Y8N B;  1BDO A;  2C9O A;  4EQN A;  3D8G A;  2YYZ A;  1OXV A;  1DOM A;  2ZT9 C;  3K6O A;  4ZKC B;  1F77 A;  4NKL A;  1G2T A;  1SXT A;  1TY2 A;  3PUZ A;  2F0N A;  1WD0 A;  1L0X B;  1ZKO A;  4PNY A;  4ZKB B;  4K5X A;  2EYL A;  1OXU A;  3SXH A;  1HPC A;  3PIO 3;  1PFN A;  4FYD A;  4XIG S;  2EY2 A;  2VB3 X;  1Q3L A;  1A3U A;  2BA0 A;  2YU9 B;  1AEX A;  1ILQ A;  1IKL A;  1HTP A;  4C1N I;  3E5S A;  4U68 A;  1PFM A;  1PMR A;  2F0H A;  2OXP A;  2ID0 A;  3VA5 A;  5I6W A;  3CRK C;  5LHY 1;  3D4W A;  1A2T A;  4ZRZ A;  2EYJ A;  3QOJ A;  1A15 A;  1AP0 A;  3K5N A;  2KHS A;  1EIH A;  3MFY A;  1ET6 A;  1NUC A;  1CA5 A;  2SDF A;  4Q5V A;  1TT2 A;  2MPM A;  2HUG A;  3NE5 B;  3C46 A;  5C4J B;  3WOF A;  4B9X A;  5IGF A;  4RHS A;  3VYU A;  1JWU D;  4KKS A;  1SYG A;  2F0U A;  4G7Z C;  3PIP 3;  1AN8 A;  2EPB A;  3PUY A;  4K8J A;  2F0Q A;  1O7L A;  2K01 A;  3BVG A;  4KY5 A;  4X3S A;  3K59 A;  2PPB C;  3BDL A;  2BDO A;  2BA1 A;  4RH6 A;  3D31 A;  3I4L A;  1VMP A;  2F0O A;  3R8B A;  3JAM E;  4N9T A;  1LV9 A;  5CYU A;  1U4L A;  4UAI A;  1I4G A;  1B3A A;  4RHR A;  1STB A;  2M00 A;  2PYK A;  1YNJ C;  2A5H A;  1X3P A;  4CKE A;  4OO1 G;  3J7A V;  2A6H C;  3K57 A;  2E75 C;  1QCB D;  4TSS A;  3D6C A;  5CV7 A;  2XRS D;  2GA4 B;  2A73 B;  4EVO A;  1EWC A;  1FNU A;  3MC0 B;  4C3J B;  1F9P A;  4O42 A;  5TSS A;  3MTS A;  5FO9 B;  1F9R A;  4IAL A;  4G7H C;  1EY4 A;  1TU2 B;  3S1Q B;  3W3A A;  3GTL B;  2O4X A;  1FNV A;  2K5D A;  3X3M A;  1PTO B;  1KDC A;  1KDA A;  1PZJ D;  3FEW X;  3NQT A;  1QE6 A;  1G91 A;  2F0P A;  3A56 A;  2WKD A;  3HG9 A;  4DXG A;  1QWY A;  3GTQ B;  2XWJ B;  3TP8 A;  4MHE A;  2B2W A;  5J22 A;  3OPO A;  5J1Z A;  4U67 3;  1WD1 A;  2JA8 B;  5C0X J;  4ZUJ A;  2VUM B;  5ELE A;  3T16 A;  4ZLT F;  1V1O A;  3NTH A;  2B8F A;  5LL6 S;  4KN7 C;  3OWF A;  5C4H A;  4OO1 I;  5E1F A;  1BQQ T;  2ZXP A;  4L63 B;  3D4D A;  5DM6 3;  1IKM A;  1B50 A;  1QNU A;  1GUG A;  2AWO A;  1G29 1;  4QF4 A;  2R61 A;  5KIX A;  1TWA B;  1JOO A;  5CV5 A;  1LTA D;  3VYT A;  1IHZ A;  4LJZ C;  4TKO B;  4Q0F A;  4F88 A;  5I4D A;  1F2M A;  3RLF A;  5EQ0 A;  1SYE A;  4OL7 A;  3DMU A;  3BS1 A;  1EEI D;  1GJX A;  1B4O A;  1LTB D;  3S9W A;  4A3M B;  1LTI D;  3P7J A;  4X3K A;  1HCZ A;  5C3X A;  2B2T A;  1HA5 A;  3GTP B;  3QG1 A;  2L1B A;  5C44 B;  3E6Z X;  1BBX C;  1L0Y B;  4HR7 B;  4ME5 A;  1WVL A;  1MBY A;  1SYB A;  1ZEQ X;  4H44 C;  1JOK A;  1PTO D;  1JCK B;  4A3J B;  2HDL A;  3IFD A;  2EY1 A;  3VR6 A;  5M9O A;  3DWA A;  3VR2 A;  1SE2 A;  2Q8R E;  2NBF A;  2MUY A;  4UDU C;  4HSV A;  2L4N A;  3DWQ A;  5M5W B;  4DAV A;  4P2C B;  1BR9 A;  1I4Q A;  3M7G A;  2BDN A;  1EQT A;  1BUV T;  3T53 B;  1HTL D;  1K83 B;  1PTO C;  2D62 A;  5D3I B;  1SYC A;  1VMC A;  3Q0A A;  1IW7 D;  3HOY B;  3AB9 A;  4C3I G;  3L3O C;  4RGT A;  2IJ0 A;  3C2P A;  1FD7 D;  4C1N K;  3GQB A;  4K8I A;  3M3Y B;  5CV4 A;  1S5F D;  4CHT B;  1EY7 A;  3OOC A;  5FLX E;  2NTT A;  2HCC A;  2EDG A;  4HED A;  1E2Z A;  3HEJ A;  4DF7 A;  5D14 A;  2VNU D;  3M4Y A;  2LFN A;  3S15 B;  1I50 B;  2J7Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...