5CC4A

Crystal structure of staphylococcal nuclease variant delta+phs t62e/v66e at cryogenic temperature
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFEKKMEENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS T62E/V66E at cryogenic temperature
rcsb
source organism Staphylococcus aureus
total genus 33
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5cc4A00
3V2TA 2EY6A 5J1ZA 5EKKA 1KDCA 3C1EA 3D6CA 4ODGA 1STAA 3SXHA 3TMEA 1JOQA 2EY1A 5EGTA 5CC4A 2F0LA 2O4XA 4K6DA 3SR1A 5J39A 2F0FA 2F0EA 3OWFA 2F0HA 5E1FA 3QOJA 2PW5A 3HEJA 2F0PA 4HTHA 1SYGA 3DMUA 4HMIA 5DEHA 4K5XA 5I6WA 2KHSA 4KY6A 4KHVA 2F3VA 4KJOA 4KY5A 2M00A 2PYKA 5F2DA 4F7XA 1SYCA 5CV8A 4EQPA 2F0KA 1SYFA 4DGZA 4EQNA 4F8MA 4PMCA 3LX0A 2PQEA 5HURA 3ITPA 2PZWA 4EQOA 3S9WA 3MZ5A 3SK6A 5KYLA 2EXZA 3VA5A 4QF4A 1EY9A 4KD3A 3MVVA 4RKBA 4TRDA 5NUCA 1SYBA 4N9TA 4ME5A 4PNYA 2EYHA 3TP8A 1ENCA 2F0QA 5E3FA 1STBA 1IHZA 2PZTA 1EYCA 1STNA 3TP5A 4EVOA 5CGKA 2F0NA 4IUNA 2EYPA 2F0UA 5C5LA 3C1FA 2EYMA 3OSOA 5CV5A 3R3OA 1KAAA 4OL7A 2F0WA 4KV6A 2F0VA 1F2MA 1RKNA 4K14A 1EZ6A 3H6MA 4DU9A 1EY0A 5IOCA 3PMFA 1EY7A 5KYIA 1EY5A 1EY6A 5C4HA 4G57A 5C6AA 5K5PA 4K2KA 4B9XA 5KEEA 2RBMA 4S3SA 5I9OA 2F0MA 2EYJA 2F0TA 2PZUA 3D4DA 3DHQA 3RUZA 2PW7A 4IALA 4H7BA 5HGTA 5IGGA 1TT2A 2ENBA 3QOLA 4KTAA 4NKLA 1F2YA 2OEOA 4QB4A 1JORA 2F0OA 1STGA 5KIXA 2F3WA 5IGEA 5CV9A 5IGBA 1STYA 3NXWA 4NMZA 3NQTA 1NUCA 3NP8A 2SNSA 2F0IA 3NHHA 5C3WA 5ISRA 1JOKA 1SNMA 3BDCA 4KD4A 3MEHA 5CR3A 4ID6A 1SNQA 4ZUIA 4WRDA 5CV4A 5I9PA 5I6YA 4K5WA 1SNPA 3SK4A 2F0DA 3SK5A 3D8GA 3P75A 1A3VA 1STHA 3P1HA 4E6IA 1II3A 1EYAA 1SYEA 2QDBA 1EQVA 2SOBA 3EJIA 4I65A 1A3UA 3OMCA 1SYDA 1F2ZA 3MXPA 4KY7A 2SNMA 1EYDA 2F0JA 2EYFA 3NUCA 4MIUA 1ENAA 2F0GA 3D4WA 3QB3A 1SNDA 4ZQ3A 3SHLA 1KDBA 5IGDA 4NP5A 5KRUA 2RDFA 1EY8A 2F0SA 4J1MA 5JAVA 1SNCA 1EY4A 4K5VA 4K8IA 1KABA 3U9OA 1TR5A 2WACA 5IIFA 3TP6A 2EYOA 1JOOA 4QMGA 3SK8A 4KJNA 4WORA 4J6HA 2EYLA 4N9PA 4R8NA 4HMJA 1EZ8A 1AEXA 4DF7A 2KQ3A 1TQOA 3ERQA 2EY5A 4LAAA 4YIJA 5IGFA 2EY2A 4NDXA 5M9OA 5CV7A 5EKLA 1SNOA 3T13A 4DFAA 1NSNS 1A2UA 4K8JA 4B9WA 4IZ8A 1A3TA 5JOBA 5C5MA 2OF1A 2LKVA 5C3XA 2RKSA 1KDAA 3T16A 1A2TA 3EROA 5KGUA 2HQEA 4RKLA 5IODA 2NUCA 3HZXA 3NK9A 1U9RA 4ZUJA 4PMBA 3TP7A 5IGCA 5J22A 5CV6A 2OXPA 3OMGA 4K2LA 5DAUA 3EVQA 3BDLA 5C4ZA 3E5SA 3MHBA
chains in the Genus database with same CATH superfamily
5HGQA 4LJZC 4DPGA 1KDCA 3GTMH 3HGBA 3K81C 2KOLA 1T9HA 1W6JA 4IURA 4V0BA 5EGTA 3VA7A 3J80L 2F0HA 5E1FA 4R4OA 3VR2A 4YY3L 1T5XD 3MFYA 5LHY1 4KHVA 1D1KA 2N55A 4JBWA 1STEA 4LF6Q 2EVBA 1LABA 4QY7A 1Q8KA 4AH6A 1TU2B 3I4OA 3KF8A 4ZAIA 2D5DA 1PYWD 3M4OH 3JAMi 2F0QA 2V4DA 4X65Q 3E0EA 1VQPA 2O2LD 1QVFA 4RCNA 1WCMG 4A3JB 1HNZQ 1BCPD 3P20A 2JA6H 1NY4A 1VQEA 2E74C 3OHXC 3MXUA 3M7NA 3DHQA 5IE8A 2PI2A 1SRUA 3HOXB 4MTNA 3PIO3 1PRTC 1TS5A 3FVQA 4OWWB 5FLXc 4DUYL 5IWAL 3BS1A 1ASZA 2L0CA 1HQRD 3GTJB 3W2DA 1G6PA 1XJVA 1SMXA 1I4GA 3MEHA 1EIYB 4JPBW 4HIOA 4P2CB 1G291 4JI8Q 1QNUA 1TWAB 4X62L 3I2ZA 2F0DA 1PH3A 4YHHL 3CMEA 4KY7A 2R3ZA 1IBML 5CBAE 5IGDA 1C4QA 1LLRD 3GP7A 3PV0A 3NSWA 2BE5C 4A3BH 3PF4A 4J15A 5JAVA 1TY0A 1QILA 1IXRA 2YTVA 1ILQA 1Y1WG 4KK7A 1PDQA 3AMUA 2KEEA 2JK8A 5ELDA 3UDGA 3F8TA 5M5WH 2N78A 3ZYYX 4A3EH 1JT8A 1YEZA 3OPOA 1LUZA 1TWGH 2K33A 1NSNS 2K5NA 4B9WA 3PO3H 1PXUA 3GTGH 4IPGA 1DONA 1UE1A 1B44D 2HQLA 3K0YA 3K80C 4Y7NB 3BJUA 3I56A 1TWCH 3U50C 3KF6B 1U5KA 3VR3A 1ICWA 2MO1A 4FF3A 1N33Q 2OTJA 1PRTB 2JA9A 3J81i 1HHVA 4A3FB 3S1NH 1KNAA 1HNXL 2BCOA 1VQIA 4OXPA 5M5YB 2Z4IA 3GV3A 3H0GH 1MKHA 4LFBL 4DNRB 4POFA 1D5ZC 1XPUA 4N9TA 4LNQA 5J3BA 3T56B 5CGKA 3DM1A 3UDXA 3D31A 5GAHC 2DN8A 3W1BA 1X56A 3A5ZB 1FYCA 3RN5A 4C3IG 3I7FA 2XIWA 1ENFA 4Z9CB 1SE4A 4BY1B 2K1BA 5C44H 3M9BA 3I8ZA 1PH1A 2JP1A 4KTAA 2RDHA 3S14H 2EQSA 5LMUL 5IGEA 1QWYA 2KJXA 3BG3A 4KHZA 1VDZA 3UI2A 1STYA 2AQ1B 4P71A 4GZYC 4C3JG 3MXNA 3PIOA 5KNDA 4IFDI 1QG7A 1Z9FA 5C4XH 2K50A 5I6YA 5M3FB 1FL0A 1HZCA 2R7FA 1K3BC 1VQDA 1WFQA 3KFUA 1A3VA 3A56A 5M3MB 1CSQA 1A3UA 4DR5L 2EZVA 5FO9B 2F0JA 3JAME 1C7YA 3RD4A 1VQBA 1BNZA 1IZ6A 4NP5A 1F2LA 1GO3E 1AH9A 1EY8A 2HIVA 2KCCA 3AFPA 1XPOA 4P72A 4R4TA 3U9OA 2R92B 1HCZA 1MSHA 1PTOF 2A74C 1X6OA 1HPCA 4JW0A 3SK8A 4OGQC 3R93A 2VXWA 5FK9C 1K8AC 5LL6S 4POGA 5FJ8H 4A93B 3J7YW 3D6WA 3E3XA 5EKLA 5IP9G 4A3LH 1F9PA 4IZ8A 4KN7C 5JOBA 3OTOQ 2EPBA 1EWCA 2QCPX 1S5FD 1VMPA 4WJ3M 5KGUA 3WDNA 5CORA 4DV6Q 4F88A 3NTIA 4PMBA 4HEDA 1VQ7A 2F52A 2VZAA 2VS1A 2ZXRA 2AUJD 3GDEA 1DOLA 5ISRA 4JI4L 1K0SA 5LMNQ 2DNEA 1VQCA 1STAA 4XDXA 1CI3M 1JB7A 5DM73 1EQTA 4K6DA 2NTTA 3NENA 2E2JH 2B2WC 4Y52H 3O13A 3I4MB 4HTHA 1SYGA 4HMIA 5DEHA 3K57A 2EJGC 4DGZA 1IKMA 3Q24A 3FKIB 4KHPL 2PZWA 2XN9C 3SK6A 2RSOA 2QEJC 3OIQA 1ICFB 1VQ6A 4ME5A 1SE3A 5JEAG 3SVMA 3Q22A 3R3OA 4LF6L 4OL7A 1V1QA 3KUPA 2JJQA 4DV0Q 2F03A 1RL2A 2Z6BA 3FPUB 1N32L 1TS4A 4X65L 4IALA 1OXXK 5H1SE 4NKLA 1HA6A 3I4NG 1HNZL 1LO5D 1Z7TA 2F3WA 5A2QE 5IGBA 4DR4Q 1HFNA 1YNXA 3NP8A 2IHEA 3STBD 4KD4A 4ZUIA 1TWHB 3S17B 4CKCA 5D3IB 5C3EG 1F9RA 1KHIA 4BBRG 2VUMH 4IFDG 2LFNA 4A3IG 4IPDA 4LF7L 2NBFA 4A75A 2RVLA 1L1OA 1J6QA 2QGQA 2F0GA 1R9TH 1UUPA 4DAMA 1LT5D 2Z6KA 2IY5B 1Q1EA 4A3MG 4QMGA 4JI8L 1EQRA 4DNIA 2NN6I 1LT4D 3S16H 5CV7A 2XNAC 4HCEA 1BOSA 1QE6A 1EEFD 1XMOL 2WP8J 1EWIA 1LTAD 1WVLA 4F87A 3X3MA 4RAUC 4DV4Q 4YWLA 2EIFA 3PO2H 4OX9Q 3AEVA 1PH5A 4CDEC 5FLXE 1HNWQ 2DJGC 3CMAA 4IUUA 2Z1CA 5EKKA 3Q6SA 1PH2A 1JOQA 1TWFB 1VQ8A 2PPBC 1WJJA 3D3RA 5BN3A 4P73A 2K52A 4HN7A 2YTXA 2JA5G 1VQ4A 1CKNB 1N33L 4C3HH 5CV8A 1RTOA 3WOFA 2K01A 4GKKQ 4BXXH 1ML0D 1ET6A 2QILA 2B63H 3ITPA 4BWGB 2JYOA 1CQFA 1VF7A 3BU2A 3S1RH 5T1GA 4RKBA 4PZ8A 5C4JB 2PQAA 3HOWG 3OW7A 4KKUA 3TP5A 1YJNA 5IYDG 3CW2C 4H02A 2DJFC 2EYPA 1QB5D 1ASYA 2GVAA 3KDFA 2G9HD 4X3TA 2C9OA 1EY6A 5A2QL 1O80A 4K2KA 1RJTA 4GN5A 4L63B 3J7A5 1JWUD 2A68C 1AZPA 3H3VC 4G7ZC 3EA6A 2YTYA 2B8GA 3K0XA 3C46A 3FDTA 2LXJA 5CV9A 3W5OA 3K8AA 1NUCA 2A8VA 4BY7H 1UWVA 1XNRQ 4Q5VA 1I4QA 1MJCA 4FXKC 4YWMA 5IT9c 1V1PA 3F2DA 4DAYB 1XXGA 4WFN3 4JI0Q 4DV3Q 4BA2I 4GLAC 3IFDA 1M8AA 4XT1B 1PYBA 4HJ5A 4A3KH 1ZYRC 4V190 2UXDQ 2ZM6Q 4X62Q 1SSOA 2R7DA 3GO5A 1JICA 2Y0SB 2EYOA 4FF4A 1JOOA 3S15B 1I6HH 2B2YC 1AEXA 2C5CA 5IGFA 2K5WA 3NBIA 1HZ9A 5IP7H 5D3DA 2R7ZG 1BKBA 1A2TA 2XRSD 4L6TB 1YBYA 3HOZH 1U9RA 2VY3A 4G7OC 5CV6A 2BDOA 2X6GA 2AMCB 2VQFL 2E2IH 4BS9A 5J1ZA 1I3QB 3GTQB 1OXTA 1VQKA 3G6JB 1KD1C 1JQYD 4DV6L 3K6OA 3PCOB 4IJHA 4A3DB 5LMNL 3CCSA 1KTKA 2JA8H 4EQOA 1QNKA 5DNFA 1KIXA 3IAYA 3MVVA 4TRDA 2ATWA 3CQZH 2ASBA 1D2BA 1EU4A 2VQEQ 1SXTA 1I50B 3BZCA 3BZKA 2I5HA 2LS01 3K7UC 1WTRA 2P5ZX 1F2MA 5IOCA 1UAPA 1K9MC 3RLNA 1HUNA 5G3LF 3GTLH 1SE8A 4OWTB 5IYCH 5I2XA 2E5LQ 4JOIA 5C0XJ 1ZXTA 2DNCA 3DWAA 2L1BA 2Z8LA 4KLKA 2XTIA 1T5EA 2I0QA 2OEOA 2XWBB 1BCPC 4DA2A 4HIKA 2CVRA 1G8ZD 1B3QA 2GVBA 1RDPD 2D0PA 3IKJA 1BQQT 4DV0L 3S2DH 1Q3LA 4FP5D 2NVTH 1BVSA 5CV4A 3T1YQ 3NBHB 4B08A 4QQBX 3P75A 5K5PA 4LF5Q 2X69A 4A3GH 4DR4L 4B3RQ 3HOVB 1SYDA 5COYA 4OO1I 4H44C 2LMCB 4L5QA 1Z47A 3QB3A 1B8AA 4A3JG 1EY4A 5IIFA 1PZJD 3J7ZC 2KUMA 4FNFA 4OWXB 1N9WA 2R93H 2RCNA 2KQ3A 3ERQA 2EY5A 1NE3A 2NVXB 2B2VC 1EUJA 5DLQE 1WTVA 4B3SQ 1O7YA 3HOXG 2UUBQ 3RZDH 1NBWA 2HUGA 1AN8A 1G2SA 5JPNC 3G71A 1C9OA 2K14A 5BR8Q 5IYBG 2AWOA 1E1TA 1WI5A 4ME3A 1H9JA 1CZGA 2EY6A 1FR3A 2XGTA 4BY7B 1LYLA 1BCPB 1CUKA 1GD7A 3TMEA 3S2HH 2ZTDA 1XWEA 2F0EA 4DV4L 4YCVA 2JXMB 3KLRA 3DMUA 3VR5A 1SJED 1IBLQ 3NTKA 4JI4Q 4OX9L 5F2DA 3I3CA 4PQXA 1HNWL 1D5MC 3MXGA 3PIP3 2WKDA 2BOSA 3RNUA 1EY9A 4KD3A 2JQOA 1DZ1A 4M8AA 4KHPQ 1SEBD 2F0NA 3G48A 1NJIC 4GKKL 2TMPA 3OSOA 1Q90A 2Z0SA 1PYSB 1FNVA 1IW7C 1LTSD 1B50A 1PFMA 1FGUA 2I07B 1GM5A 3GV6A 1S4ZA 1H9RA 1Y1VH 1VQFA 1JWSD 2F0TA 3KYHC 4A3FG 1WD0A 1D5XC 2RHQB 3QOLA 3RR5A 4CBVA 1E7ZA 2RHSB 3HRZC 1YHQA 1X9NA 4HIMA 1E1OA 1N32Q 3NQTA 3CRKC 3QR8A 1H9SB 4WRDA 1L0YB 3GTPB 1Y1WH 2UXBQ 3K5MA 1Q81C 3P1HA 2KHJA 4RMFA 1EYAA 1SYEA 3TP7A 2HHHQ 2DY7A 3DM3A 3SDZA 1N34Q 3VYUA 4DKAC 2HD3A 1XNRL 3QIAA 4OO1G 4K8IA 1KABA 4LF7Q 1G2TA 3T53B 1AW7A 3KK7A 3NQIA 4OHJA 4WORA 4JI0L 1B53A 4DV3L 4ZRZA 3VYTA 2UUCQ 1DD2A 4BY1G 3GTLB 1RIPA 1A3TA 1SFOB 4C2MH 1OXVA 2NVQB 2B2TC 2EE1A 4RHRA 2ZM6L 4BBSB 5GAEC 3CD6A 2RKSA 2UXDL 2FXQA 1KDAA 4RFBA 4JI5L 4LF8Q 2Q2UA 3D0FA 2C35B 5FOBB 1K8OA 1XMOQ 3ER0A 3MWYW 4RGTA 5KNBA 2KA7A 3TS2A 2I46A 1QUQA 1LTRD 1DM0B 5M3FG 1M4VA 3TDQA 2NZHA 5EKIA 2QEXA 5M3MG 3CCUA 2IT1A 4KKSA 5IT9E 4DR6Q 2EDGA 2M00A 2PYKA 2NWGA 4UPAA 4R9WA 4F8MA 4PMCA 3A8KE 2VB3X 2R92G 4XQQA 3PGZA 1Q12A 1I6VC 1WTPA 3N52A 4XTCS 3CCQA 3A0JA 4A93G 2KHIA 4C3IH 3CF5A 1EOVA 1STBA 3TSSA 3PIPA 1H95A 4X3UA 4DK1A 2WV6D 1AZQA 1EIGA 4RH6A 4DNTB 3HOUB 5ELEA 4TQUS 4ZK9B 4JCVE 4C3JH 1PHJA 1QCBD 4UAIA 1WTHA 3HOYB 1CZWA 2VQEL 3C3LA 1IW7D 4OONA 3I4MG 3SEBA 4UDUC 1HR0Q 3AQQA 1K83H 2QF7A 2E5LL 3FKIG 1HJPA 1BF4A 1E22A 2WB1E 4L8JA 4JI6Q 4XYQA 3BVMA 2PO4A 1B9MA 2WB1B 1PH7A 3A55A 4MIUA 5J39A 2N3SA 4H0LC 1AE2A 3M85A 1KDBA 4GOPC 3STBC 4PMWA 2RDFA 3GTMB 4O0AA 2UUAQ 3T1YL 3I91A 1GVPA 5LMNW 4KJNA 4LF5L 3RLOA 4B3RL 4DFAA 2K6AA 1A2UA 2KCMA 1Q1BA 3PUWA 4WJWA 1KNEA 1Y1VB 3T16A 4DAVA 1BBUA 2TSSA 1R4QB 1RTNA 5IGCA 2PMZE 4L5RC 2OXPA 5ELNA 4O42A 3M4OB 2K04A 3AFQA 1XTCD 4JI1Q 2A6EC 3WWVA 4B3SL 2PMZB 1RCVD 1AP0A 2NVYH 2UUBL 2IWHA 3CCJA 3SR1A 4DAPA 2F0FA 2PW5A 2JA6B 4NW2A 1S3OA 3ICEA 2PCFB 4LFAL 2VQFQ 1PTOH 4GNXC 5BR8L 4KJOA 1XYIA 1TS3A 2Q2TA 2DY8A 3LX0A 4MTKA 5JEAH 2YU9H 4R4IA 2IL8A 3CCLA 3S9WA 4DR7Q 1E2ZA 1FNUA 2EXZA 2HDMA 3VA5A 3S24A 4GOPB 3FHWA 1EOTA 4CDDC 1Q8IA 1R4PB 1IBLL 1Y8PB 4RCOA 2LSSA 2MNAA 5CV5A 3H3VI 4RGMA 1HQMC 3I4NH 1SJHD 5ELBA 1VQLA 4G57A 3UDIA 2NYZD 3EBEA 3J80c 2E2HH 5I9OA 1KAWA 4A3BB 1VCIA 1TT2A 3DEPA 3C2PA 1FNWA 1E2VA 4BBRH 5KIXA 4IFDH 1HTLD 4U673 2B39A 1O7IA 4A3IH 3UE0A 1TXYA 2AUKA 5M5WB 4A3EB 1X55A 1TWGB 4GN3B 3PO3B 3GTGB 4ZYSA 4ZCKA 3T4AC 1JJ2A 4CDFC 4GNXB 2A73B 4A3MH 1STHA 1II3A 4I65A 1D1IA 1TWCB 1F2ZA 3J81E 5FJ8G 1GUGA 4QCLA 3S1NB 4DK0A 4XYOA 4GS3A 4EQ5A 2UXBL 4IUVA 2RCFA 4DF7A 1VQ5A 1X3FA 4YIJA 1DCZA 2HHHL 1GHKA 3M3YH 3MA2B 5GQOA 2KEDA 3JAML 1PH9A 3ZJYC 1N34L 3H0GB 4IQZA 4J8QA 3TN2A 4CJ2C 4RGOS 3BZDB 1ZKOA 3HZXA 2AHOB 3NK9A 4DV7L 1BO0A 5J22A 1K28A 4HCSA 2JA5H 1QOHA 2UUCL 3MTSA 3C1EA 4GN4B 5EAYA 4QGUA 3K5OA 5I4DA 3E0JA 4LF8L 3TEHB 3E6ZX 2A6ED 2JEAI 3QWNA 1NR2A 3HOWH 2K5QA 2WINB 5C44B 5IYDH 1C0AA 1BBXC 4A4IA 3DUZA 2Y0SG 3MAQA 3S14B 1IYJB 3DWQA 2KECA 1YHBA 4RHSA 5AFWA 1Q46A 1UNSA 1M90C 3L0OA 5FKAC 2G9DA 1KC8C 4DR6L 3FRPB 1ENCA 1A62A 2CKZB 4QJFA 5E3FA 1EFID 1ESFA 2L11A 1VS0A 5C4XB 4X3KA 4DU9A 1EZ6A 1F9SA 1PZID 1BUVT 2CW0D 1JC7A 1EY7A 1EY5A 3PF5A 2H5XA 1XX8A 4JK1C 2EYJA 2PZUA 3D4DA 5HGTA 1G6ZA 5IGGA 1JJGA 2CH4A 2WAQE 4AYBB 3J80i 1HFGA 1FJGQ 3GTKH 2XSCA 2JEBI 2A1AA 3BVGA 2WAQB 1EYGA 2QW7A 4A3DG 1MD2D 2SNSA 1PTOB 1AE3A 1F77A 2B2UC 1O78A 3KF8B 3J81L 3CPWA 2VW9A 4PZ6A 5JJLA 4X6AH 4HJ7A 3KF6A 1L0WA 3SK4A 1BR9A 3A74A 2IX1A 4U68A 3D8GA 1FD7D 4ILWA 2SOBA 1ILPA 1HR0L 2OQKA 2EYFA 1Y69U 5ELCA 2K4KA 5EPLA 4IO9A 2NN6H 1HH2P 1SN8A 4CDCC 1TR5A 1H9KA 3EIVA 4XT3B 4X3SA 4O2DA 2E2JB 2OWOA 1D7QA 4JI6L 2MFIA 2EY2A 5FLMH 1BDOA 3CRLC 2AQ2B 1YVCA 2Q2HA 4DK3C 1B7YB 1LM0A 3MEFA 1EFWA 1SBBB 2XWJB 5BN5A 1Q7YC 2UUAL 2NZ1D 3F2BA 2HQEA 1B70B 4LF9L 4JI2L 1IL8A 3NEMA 1D8LA 1CA6A 4LFCQ 3KLWA 4DV1Q 1EQQA 3HKZB 2BH2A 2Y0SE 1K8MA 1S5CD 1J9OA 5C0XI 2VL6A 4IN3A 4JI5Q 3SXHA 3J7AV 1SROA 1QVGA 3S1QH 4QL5A 4CGYB 5GADC 3HOVG 1S5BD 1JE4A 4KN4C 3M7GA 2Q8RE 5FLXL 1PTOD 4JV5L 3I72A 2F0KA 2ZJQA 4JI1L 1B9NA 2L55A 2UU9Q 3HG9A 2B29A 2NB0A 3MZ5A 1GUSA 3ERSX 5I2YA 4DK6C 4ULLA 2B8FA 4GLXA 1LV9A 3M3YB 1EYCA 1GXDC 1V1OA 4IUNA 1VF5C 2VUMB 1KAAA 1YJ9A 4KV6A 4KMUC 4DR7L 2QKIC 1RKNA 1IYUA 1CT1D 1LACA 5KYIA 2ZJRA 5JJIA 5C4HA 1SDFA 4FYDA 2RBMA 1R9TB 4BY7G 2F0MA 3SE0A 3RUZA 3DEOA 4JI3Q 1LTBD 1F9QA 1PZKD 1JORA 4QB4A 3I90A 3L9AX 2BDNA 2CH4W 3VR6A 3S16B 3E9HA 2CHBD 1VQNA 5C3WA 1BXTA 4MHEA 3OWEB 1I4RA 4ID6A 1SNQA 1PLFA 2O5JC 1J8IA 1RHPA 3NELA 2AWNA 1CFMA 4DV5Q 2HDLA 1S72A 3PO2B 3Q0AA 3OMCA 4ZQ3A 1Q82C 4C1NK 3OW2A 1KLUD 1GUNA 1G91A 3HOXH 3URYA 4X66Q 3F2CA 1Y14B 1UEBA 1B2TA 3I4LA 2PNHA 4RGNA 4YCUA 3GTJH 4JC0A 5IYBH 3RN2A 4C3HB 2ID0A 3UE1A 3CCRA 1WTWA 3MXNB 1VQMA 4RA8A 2J7ZA 2B63B 1TWAH 2GA4B 4CHTB 4A3CG 1NMFA 3S1RB 3L2PA 3QJYA 4CJ1B 4IOCA 3CAMA 4HIDA 3TQYA 3E5SA 1KLGD 3ULJA 1HTPA 3D6CA 4TKOB 4IUPA 4JYAQ 1WD1A 2O4XA 3PUZA 5C0XG 4AQYQ 2ZJPA 4IJLA 4XIGS 4PZ7A 4HR7B 1D6EC 2BH8A 5I6WA 3VYRA 2F3VA 3V96A 1SYCA 1X32A 1EIFA 3K59A 1X54A 4LUOA 2YYZA 1N8RC 3S1MH 3OYYA 1GKHA 4ZLTF 1PRTF 4LFAQ 2JSOA 4Y7NH 1I5FA 5D65A 2OTLA 3T1HQ 1I4HA 1JWMD 5JPMC 1KXLA 2B2WA 1IHZA 3T51B 3I55A 2JA7G 4A3FH 4BBSG 1DJRD 3TZUA 3AU7A 2F0UA 5C5LA 2LY7A 2EYMA 3CC7A 3HP3A 2HCCA 1NR4A 1VQAA 1EY0A 1G51A 2R6GA 1TS2A 5M5YH 1QJOA 5EJWA 1MIUA 4DR3Q 4A3KB 1WCMH 4H7BA 4XXEA 2ENBA 1PH6A 3RZOH 2R61A 4IUTA 1STGA 1L1OC 2BA1A 1I6HB 3LWEA 3MC0B 4OELB 3NHHA 1SNMA 2Z6KC 1IBKQ 3ULPA 3CKIB 4NXML 4OO1H 2JA7B 2A6HC 3KOJA 1E0BA 1FJGL 3HOZB 5HY6A 4ZKCB 1YHAA 5M5XH 3ULLA 1OO9B 4BY1H 5ELOA 2E2IB 3M4YA 4DUZQ 2J4XA 1SNCA 4LUVA 3HOUG 2WACA 2KCTA 3L7ZC 1CKNA 1P8LA 3QG1A 2I5LX 1CHPD 1KL9A 4JI7Q 2FFKB 3HOYG 4IOAA 5K36G 2MO0A 2MUYA 2N8NA 2XRQD 3R2TA 3AB9A 3OOCA 5C3XA 5M3FH 2JA8B 3EROA 5FO7B 2WFWA 5TSSA 5M3MH 1PFBA 3F1ZA 1P16A 3CQZB 3BDLA 2EXDA 4J6HA 1EWHA 4B3TQ 1CQVA 1L1OB 2FINB 2R92H 4DV7Q 2F4IA 1KRTA 2RSNA 3G7LA 2WB1G 5IY0A 4LFCL 4DV1L 4X64Q 4A93H 1J5EQ 2D0OA 3CCVA 4EQNA 1KQSA 1O7ZA 2DUDA 2WKCA 2IX3A 4MZ9A 3N6RA 1DOKA 3RLFA 1XTDA 3VYSA 3S2DB 1HR0W 5GROA 2CFMA 1A6XA 4P75A 4DAYA 1Y1VG 3V05A 2HT1A 2NVTB 1EL0A 3C1FA 1DOMA 2UU9L 5JJZA 2F0WA 4K14A 3I4MH 3IRBA 1YZ6A 1EEID 3PMFA 4A3GB 4HJAA 5C6AA 2EOTA 5KEEA 2L9HA 4S3SA 2K7VA 1LT6D 4DXGA 1E2WA 4DV2Q 3FKIH 2B3GA 1NNXA 1JMCA 2RDGA 1YNJC 3CCEA 1M1KC 2KBNA 2B2UA 1TIID 2K03A 2JA6G 2R93B 1GOZA 4NMZA 1RODA 2A69D 4NXNQ 3Q8DA 4IPCA 1XNQQ 2PQAB 4QUFA 1A15A 5I9PA 4JI3L 1H9MA 3RZDB 1HZBA 4WJ4A 1JJCB 2L15A 2J0TD 3S1MB 1YNND 5EPJA 2NZOA 1I94Q 4FO2A 4IUQA 2QDBA 5KYLA 3I73A 1K0RA 5NUCA 3NUCA 1XMQQ 3KDFB 1GUTA 2A6HD 1WTOA 4K5VA 3S2HB 5G3LD 1MJEA 2SEBD 1QZGA 4GKJQ 1SR3A 1EZ8A 4DV5L 4XQNA 3KJOA 4K8JA 4DR2Q 5CYUA 4A3BG 1TWHH 3S17H 2OF1A 1WCMB 5EBDA 1X3QA 4L5SA 3RZOB 4X66L 4NB3A 2O5IC 1PFNA 4MNOA 4RKLA 2CCZA 1SLJA 4A3EG 1EU3A 1V1PB 5IP9H 2B2YA 1PFSA 1YIJA 3PO3G 3EVQA 4UP7A 3V2TA 1SAPA 1GJXA 2A5HA 4LF9Q 4JI2Q 4C1NI 2QA4A 3CPFA 2ZT9C 1CA5A 3OWFA 2OQ0A 4N8X1 3WOEA 4K5XA 3NE5B 2UXCQ 3FEWX 5M5XB 2X6LA 1W3SA 2CQAA 4EQPA 3CC4A 4KI0A 3SGIA 2Q8TA 1RF2D 3BVZA 4JYAL 3VR4A 4AQYL 4O1NA 4JOIC 1UE5A 1VQGA 3CCMA 4JV5Q 4KKTA 5IT9L 2EYHA 2GN5A 3NBHA 3EQLC 3PSIA 2KCNA 4EGVA 3H0GG 1STNA 3GD7A 2OT2A 1YI2A 1TWFH 1PRTD 5JJKA 3A7AB 3EFXD 4TSSA 2CWPA 5DM63 1Y1WB 4ALPA 4LK1C 3H6MA 4JVZA 2IHFA 3T1HL 4H13C 1L2FA 3JC66 2K28A 2M2LA 5AJ3Q 1CM9A 2PW7A 1IL2A 2CWAA 1KRSA 1HUMA 1AFPA 4LW1A 2CW0C 5C4JH 2M9VA 2ZTCA 2ZXOA 2MPMA 1TKWB 1OXUA 5C44G 1CTMA 2BE5D 3BDCA 2BA0A 4C2MB 5CR3A 4DR3L 1YNJD 3BYYB 3TREA 1CHQD 1I4XA 1N36Q 1HXYD 5JEAJ 2E8GA 3MXPA 2F3IA 1U4MA 3J7AF 4OIKA 4HJ9A 5E4WC 5C4XG 1IBKL 5C3EH 1WOCA 4JBMA 2MJ8A 1DGSA 5D14A 1B3AA 1LTID 4HMJA 1I4PA 3RMHA 2ZXPA 5M9OA 2SDFA 3L3OC 2N49A 1YJWA 1MI2A 3ND8A 5EQ0A 3K5NA 4DUZL 1S5DD 4AYBG 2LKVA 3K7AH 2FMCA 1CKMA 1QZHA 2A19A 1L0XB 2NUCA 2WAQG 4ZUJA 4A3LG 3E9IA 4C3IB 5DAUA 3A5UA 4JI7L 4RWSC 4IFDJ 5C4ZA 3MHBA 2F1MA 5CMDA 3U9SA 2B2VA 4LF4Q 4L5TA 2EY1A 1OTCA 4UY8C 1PMRA 1HZAA 4QUCA 1YITA 3S15H 4IPHA 2E76C 2Z4HA 2F0PA 2WIIB 3CXCA 1WTQA 2N88A 4KY6A 4KY5A 4C3JB 4OIJA 2FMMA 1SYFA 4B3TL 2KVMA 4ZKBB 1O7LA 2IW3A 2AQ3B 2K75A 3TBIB 4FXGC 1MBYA 2L12A 4QF4A 1H9SA 1DYQA 1SYBA 1K83B 1V43A 2CQOA 3LGJA 4X64L 3H3VH 2PZTA 1PTOC 3H15A 3KLSX 2PNRC 1I3QH 1J5EL 1NTGA 3GTQH 4JG2A 1C8CA 1W2BA 1SE2A 1PH4A 3A8IE 4B3MQ 3HKZG 2F4VQ 3PUXA 3W1GA 3HFZB 4N8FA 3Q23A 4A3DH 1VQJA 3IFTA 1PH8A 4ABNA 2D2CC 2F0OA 1V9PA 3H09A 3G6EA 2EJFC 4DR1Q 3NXWA 3CHBD 1PVOA 3NWSA 2F0IA 3U58A 4HSPA 1I50H 3DXJC 1WTXA 4FF2A 5FO8B 1SMYC 3U4VA 4DV2L 3FP9A 3M4PA 3PQIA 1SNPA 2FJ2A 4JBKA 2HCIA 3SK5A 2MP1A 1HRJA 1GUWA 3GTOH 4BA1I 3EJIA 4AYBE 1EYDA 1SNDA 4NXMQ 4NXNL 1Z6HA 1XNQL 2NVYB 1IYVA 1V8QA 2VUMG 4UHVA 2KENA 1LTGD 5A35A 4N9PA 4R8NA 1I94L 4K0KQ 3NPPA 1TQOA 4LAAA 1MSGA 4NDXA 1LTLA 3P7JA 3T13A 4AIMA 1ONLA 1XMQL 3CP0A 1FGBD 5JVH3 1A0IA 1K3RA 4MN3A 5LL6X 3GQBA 1TY2A 2YU9B 4R4CA 3PUYA 3KLSA 5T1IA 2H4OA 5IODA 4YY3Q 4GKJL 3BDOA 3HOVH 3J81j 2PI2E 2R7ZH 1MGSA 4DR2L 3OIPA 4P74A 4G4KA 4FF1A 4R8IA 2AKWB 3I4NB 2B2TA 1S40A 3PO2G 3R8BA 2NVXH 5BN4A 1OXSC 4F7XA 1ESRA 1U4PA 2E2HB 1TVXA 2L4NA 3NWTA 2VB2X 4YCWA 1S5ED 3HKZE 1ET9A 5C3EB 4BBRB 5GAGC 4A3IB 1BCPF 1PV4A 2IX0A 4PNYA 4G7HC 1E24A 1B1ZA 4C3HG 2UXCL 3FPPA 4BXXG 3DWPA 3QO2A 2B63G 4APVA 4M1UB 1QUQB 4CKBA 4DUYQ 2D9UA 5IWAQ 2F0VA 2FHTA 3K7AB 4A3MB 1GHJA 4GLVB 2ZTEA 3U4ZA 2ES2A 1UEAB 1VQ9A 4UP9A 2RA4A 1A8VA 1Q86C 1VMCA 4LMQD 4R4QA 1JE5A 1JCKB 4YHHQ 4I7ZC 2OCEA 1IBMQ 2K5DA 2HIXA 3VDYA 3R2IA 1XPRA 1K8GA 1X65A 1BBWA 1JOKA 1VQOA 1NMGA 5AJ3L 2NN6G 2H1EA 4TVAB 4K5WA 3LNNA 3H91A 2XVSA 1MHWC 1DXMA 1W6KA 4NPSA 2JA5B 4R1JA 3D4WA 5FLMG 3SHLA 1SMYD 4CJ0B 4I7AA 3OTOL 2ICIA 2ALYB 3TZDA 2G5DA 3KBGA 3EN2A 4A3CH 4RG1A 4FXDA 1N36L 3A54A 4EX5A 2Q8IB 4OEMB 2RQXA 1K73C 2K32A 4HSVA 4K6LA 1JR0D 1X3EA 4A3KG 3HOWB 2JE6I 3K5LA 5C5MA 3CC2A 1Y8NB 3TS0A 4A3JH 4PV1C 1RD9D 2I5MX 4GOPA 1HNXQ 3GTPH 3W3AA 3ND9A 5C0XH 4JBJA 2QDLA 2DGYA 1PA6A 3FMCA 3D4RA 3M4QA 4K2LA 1HA5A 2L5TA 3CU7A 1CK1A 5IP7G 4CKEA 3UDFA 1UE7A 4LUZA 4LFBQ 1A63A 1QVCA 2RF4A 4ODGA 1UE6A 4C56C 5CC4A 4DXFA 2F0LA 2NTSA 1CSPA 2EJMA 3HOZG 3QOJA 3HEJA 3I70A 4A76A 3GTOB 2KHSA 3B6YA 1B4OA 1SFOH 2MQHA 2NVQH 2PQEA 2JA7H 2Z9HA 3J80E 5HURA 4BBSH 4LF4L 3JAMc 3A8JE 3GTKB 2IPKD 1IKLA 3TP8A 3G4SA 2A68D 3KJPA 4EVOA 1EIHA 3H94A 4GNXA 3IL8A 3NTHA 2JA8G 5KNCA 5LMUQ 1NCVA 1Y8OB 3A7LA 1CKOA 5E4XA 5EBCA 1E3PA 4UP8A 2JN4A 4B9XA 1U4LA 1C48A 2MHVA 3HS0C 3DLLA 2R7ZB 2K5VA 1F2YA 3BYTB 4XQJA 3PUVA 1JB3A 1ZEQX 2YV5A 4DR5Q 4B3ML 2ICEC 2F4VL 5IYCG 4DN4M 5L37A 5JVG3 5CBEE 1ZYRD 4YWKA 2VNUD 3HOUH 1LTTD 5EPKA 1FVIA 4E6IA 2K5HA 5ELFA 3TP6A 4Q0FA 1EQVA 1X3GA 2K05A 3LWUA 4DR1L 4HAEA 2A69C 2SNMA 4LWCA 1ENAA 3K58A 5KRUA 3HOYH 5K36H 2F0SA 2D62A 4FDBA 4J1MA 3TRZA 5E7NA 3MFGA 1X3PA 1NAPA 2LXKA 4PG3A 2E2DC 1YNNC 2EYLA 3S1QB 4HJ8A 4A3GG 4FVMA 1GUOA 3X3NA 3F2UA 2E75C 4QIWE 1U0LA 1SNOA 3KBXA 1WYDA 2V1CC 1LT3D 3AYHB 4QIWB 1VQHA 2MGSA 2R93G 3J81c 3ONAB 3HKSA 4K0KL 1U4RA 2Q2IA 2IJ0A 3OMGA
chains in the Genus database with same CATH topology
4LJZC 1KDCA 3HGBA 2KOLA 4IURA 1W6JA 4V0BA 5EGTA 3VA7A 3J80L 2F0HA 5E1FA 3VR2A 1T5XD 3MFYA 5LHY1 4KHVA 1D1KA 2N55A 4JBWA 1STEA 2EVBA 1LABA 1TU2B 3KF8A 4ZAIA 2D5DA 1PYWD 2F0QA 2V4DA 2O2LD 4RCNA 4A3JB 1BCPD 3P20A 2E74C 3OHXC 3MXUA 3M7NA 3DHQA 3HOXB 3PIO3 1PRTC 1TS5A 3FVQA 3BS1A 2L0CA 1HQRD 3GTJB 3W2DA 1I4GA 3MEHA 4P2CB 1G291 1QNUA 1TWAB 2F0DA 4KY7A 2R3ZA 5CBAE 5IGDA 1C4QA 1LLRD 3GP7A 3PV0A 3NSWA 2BE5C 5JAVA 1TY0A 1QILA 1ILQA 4KK7A 1PDQA 3AMUA 2KEEA 5ELDA 3ZYYX 3OPOA 2K33A 1NSNS 4B9WA 1PXUA 1DONA 1B44D 3K0YA 4Y7NB 3VR3A 1ICWA 4FF3A 1PRTB 1HHVA 4A3FB 1KNAA 2BCOA 5M5YB 2Z4IA 3GV3A 4DNRB 1D5ZC 4N9TA 3T56B 5CGKA 3DM1A 3D31A 2DN8A 1FYCA 4C3IG 2XIWA 1ENFA 4Z9CB 1SE4A 4BY1B 2K1BA 3I8ZA 2JP1A 4KTAA 2RDHA 5IGEA 1QWYA 2KJXA 3BG3A 4KHZA 1VDZA 3UI2A 1STYA 2AQ1B 4GZYC 4C3JG 3MXNA 5KNDA 4IFDI 1QG7A 5I6YA 5M3FB 1A3VA 3A56A 5M3MB 1A3UA 2EZVA 5FO9B 2F0JA 3JAME 3RD4A 1BNZA 4NP5A 1F2LA 1EY8A 2KCCA 3U9OA 2R92B 1HCZA 1MSHA 1PTOF 2A74C 1HPCA 3SK8A 4OGQC 3R93A 2VXWA 5FK9C 5LL6S 4A93B 3J7YW 3D6WA 5EKLA 1F9PA 4IZ8A 4KN7C 5JOBA 2EPBA 1EWCA 2QCPX 1S5FD 1VMPA 5KGUA 3WDNA 5CORA 4F88A 3NTIA 4PMBA 4HEDA 2ZXRA 2AUJD 1DOLA 5ISRA 2DNEA 1STAA 4XDXA 1CI3M 5DM73 1EQTA 4K6DA 2NTTA 2B2WC 3O13A 3I4MB 4HTHA 1SYGA 4HMIA 5DEHA 3K57A 2EJGC 4DGZA 1IKMA 3Q24A 3FKIB 2PZWA 2XN9C 3SK6A 2RSOA 2QEJC 3OIQA 4ME5A 1SE3A 5JEAG 3SVMA 3Q22A 3R3OA 4OL7A 3KUPA 2F03A 3FPUB 1TS4A 4IALA 1OXXK 4NKLA 1HA6A 1LO5D 1Z7TA 2F3WA 5A2QE 5IGBA 1HFNA 3NP8A 4KD4A 4ZUIA 1TWHB 3S17B 4CKCA 5D3IB 1F9RA 4IFDG 2LFNA 2NBFA 2RVLA 2F0GA 1UUPA 1LT5D 1Q1EA 4QMGA 2NN6I 1LT4D 5CV7A 4HCEA 2XNAC 1BOSA 1QE6A 1EEFD 2WP8J 1WVLA 1LTAD 4F87A 3X3MA 4RAUC 5FLXE 4IUUA 2Z1CA 5EKKA 3Q6SA 1JOQA 1TWFB 2PPBC 3D3RA 5BN3A 4HN7A 5CV8A 1RTOA 3WOFA 2K01A 1ML0D 1ET6A 2QILA 3ITPA 4BWGB 2JYOA 1CQFA 1VF7A 5T1GA 4RKBA 5C4JB 3OW7A 4KKUA 3TP5A 2EYPA 1QB5D 2G9HD 4X3TA 2C9OA 1EY6A 5A2QL 1O80A 4K2KA 1RJTA 4L63B 1JWUD 2A68C 1AZPA 3H3VC 4G7ZC 3EA6A 2B8GA 3C46A 3FDTA 5CV9A 1NUCA 4Q5VA 1I4QA 4FXKC 1V1PA 4WFN3 1XXGA 4BA2I 3IFDA 1M8AA 4XT1B 1ZYRC 4V190 1SSOA 3GO5A 1JICA 2Y0SB 2EYOA 4FF4A 1JOOA 3S15B 2B2YC 1AEXA 2C5CA 5IGFA 2K5WA 3NBIA 5D3DA 1A2TA 2XRSD 4L6TB 1U9RA 4G7OC 5CV6A 2BDOA 2X6GA 4BS9A 5J1ZA 1I3QB 3GTQB 1OXTA 3G6JB 1JQYD 3K6OA 4A3DB 1KTKA 4EQOA 1QNKA 5DNFA 3IAYA 3MVVA 4TRDA 1D2BA 1EU4A 1SXTA 1I50B 2LS01 1WTRA 1F2MA 5IOCA 1UAPA 1HUNA 5G3LF 5I2XA 5C0XJ 1ZXTA 2DNCA 3DWAA 2L1BA 2Z8LA 1T5EA 2OEOA 2XWBB 1BCPC 4DA2A 2CVRA 1G8ZD 1RDPD 3IKJA 1BQQT 1Q3LA 4FP5D 5CV4A 4B08A 3P75A 5K5PA 2X69A 3HOVB 1SYDA 5COYA 4OO1I 4H44C 2LMCB 1Z47A 3QB3A 1EY4A 5IIFA 1PZJD 2KUMA 4FNFA 2KQ3A 3ERQA 2EY5A 2NVXB 2B2VC 1WTVA 1O7YA 2HUGA 1AN8A 1G2SA 5JPNC 2AWOA 1H9JA 1CZGA 2EY6A 1FR3A 4BY7B 1BCPB 3TMEA 1XWEA 2F0EA 2JXMB 3KLRA 3DMUA 3VR5A 1SJED 3NTKA 5F2DA 3I3CA 4PQXA 1D5MC 3MXGA 3PIP3 2WKDA 2BOSA 1EY9A 4KD3A 1DZ1A 4M8AA 1SEBD 2F0NA 2TMPA 3OSOA 1Q90A 1FNVA 1IW7C 1LTSD 1B50A 1PFMA 2I07B 3GV6A 1S4ZA 1H9RA 2F0TA 1WD0A 1JWSD 1D5XC 3QOLA 4CBVA 3HRZC 3NQTA 3CRKC 1H9SB 4WRDA 1L0YB 3GTPB 3K5MA 3P1HA 3TP7A 1EYAA 1SYEA 2DY7A 3SDZA 3VYUA 3QIAA 4OO1G 4K8IA 1KABA 1G2TA 3T53B 1AW7A 3KK7A 3NQIA 4OHJA 4WORA 1B53A 4ZRZA 3VYTA 1DD2A 3GTLB 1A3TA 1SFOB 1OXVA 2NVQB 2B2TC 2EE1A 4RHRA 4BBSB 2VNUD 2JA7B 2RKSA 1KDAA 4RFBA 5FOBB 1K8OA 3MWYW 4RGTA 5KNBA 2KA7A 2I46A 1LTRD 1DM0B 1M4VA 3TDQA 5EKIA 2IT1A 4KKSA 5IT9E 2EDGA 2M00A 2PYKA 2NWGA 4R9WA 4F8MA 4PMCA 3A8KE 2VB3X 4XQQA 1Q12A 1I6VC 1WTPA 3N52A 4XTCS 1STBA 3TSSA 4X3UA 4DK1A 2WV6D 1AZQA 1EIGA 4RH6A 4DNTB 3HOUB 5ELEA 4TQUS 4ZK9B 1QCBD 4UAIA 3HOYB 1CZWA 3C3LA 1IW7D 3SEBA 4UDUC 2QF7A 1BF4A 4L8JA 4XYQA 3BVMA 2PO4A 1B9MA 2WB1B 3A55A 4MIUA 5J39A 4H0LC 3M85A 1KDBA 4PMWA 2RDFA 3GTMB 3I91A 4KJNA 4DFAA 2K6AA 1A2UA 1Q1BA 3PUWA 4WJWA 1KNEA 1Y1VB 3T16A 4DAVA 2TSSA 1R4QB 1RTNA 5IGCA 2OXPA 3M4OB 4O42A 2K04A 1XTCD 2A6EC 1AP0A 2PMZB 1RCVD 2IWHA 3SR1A 4DAPA 2F0FA 2PW5A 2JA6B 4NW2A 2PCFB 1PTOH 4KJOA 1XYIA 1TS3A 2DY8A 3LX0A 5JEAH 2IL8A 3S9WA 1E2ZA 1FNUA 2EXZA 2HDMA 3VA5A 1EOTA 1Q8IA 1R4PB 1Y8PB 4RCOA 5CV5A 4RGMA 1HQMC 1SJHD 5ELBA 4G57A 2NYZD 5I9OA 4A3BB 1VCIA 1TT2A 3DEPA 3C2PA 1FNWA 1E2VA 5KIXA 4IFDH 1HTLD 4U673 2B39A 2AUKA 5M5WB 4A3EB 1TWGB 3PO3B 3GTGB 4ZYSA 3T4AC 2A73B 1STHA 1II3A 4I65A 1D1IA 1TWCB 1F2ZA 3J81E 1GUGA 4QCLA 3S1NB 4DK0A 4XYOA 4IUVA 4DF7A 4YIJA 1DCZA 1GHKA 3MA2B 2KEDA 3JAML 3H0GB 4IQZA 4J8QA 3TN2A 4CJ2C 4RGOS 3BZDB 1ZKOA 3HZXA 3NK9A 1BO0A 5J22A 4HCSA 1QOHA 3MTSA 3C1EA 3K5OA 5I4DA 3E0JA 3E6ZX 2A6ED 2JEAI 3QWNA 1NR2A 2K5QA 2WINB 5C44B 1BBXC 3DUZA 3MAQA 3S14B 3DWQA 2KECA 4RHSA 5AFWA 1UNSA 5FKAC 2G9DA 3FRPB 1ENCA 5E3FA 1EFID 1ESFA 2L11A 5C4XB 4X3KA 4DU9A 1EZ6A 1F9SA 1PZID 1BUVT 2CW0D 1JC7A 1EY7A 1EY5A 1XX8A 4JK1C 2EYJA 2PZUA 3D4DA 5HGTA 1G6ZA 5IGGA 4AYBB 1HFGA 2XSCA 2JEBI 3BVGA 2WAQB 1MD2D 2SNSA 1PTOB 1F77A 2B2UC 1O78A 3J81L 3SK4A 1BR9A 2IX1A 4U68A 3D8GA 1FD7D 4ILWA 2SOBA 1ILPA 2EYFA 1Y69U 5ELCA 5EPLA 2NN6H 1TR5A 1H9KA 4XT3B 4X3SA 2E2JB 2EY2A 1BDOA 3CRLC 2AQ2B 1SBBB 2XWJB 5BN5A 2NZ1D 2HQEA 1IL8A 1CA6A 3HKZB 1K8MA 1S5CD 1J9OA 5C0XI 4IN3A 3SXHA 3J7AV 4CGYB 1S5BD 1JE4A 4KN4C 3M7GA 2Q8RE 5FLXL 1PTOD 3I72A 2F0KA 1B9NA 2L55A 3HG9A 2NB0A 3MZ5A 1GUSA 5I2YA 4ULLA 2B8FA 1LV9A 3M3YB 1EYCA 1GXDC 1V1OA 4IUNA 1VF5C 2VUMB 1KAAA 4KV6A 4KMUC 2QKIC 1RKNA 1IYUA 1CT1D 1LACA 5KYIA 5C4HA 1SDFA 4FYDA 2RBMA 1R9TB 2F0MA 3SE0A 3RUZA 3DEOA 1LTBD 1F9QA 1PZKD 1JORA 4QB4A 3I90A 3L9AX 2BDNA 3VR6A 3S16B 2CHBD 5C3WA 1BXTA 4MHEA 3OWEB 1I4RA 4ID6A 1SNQA 1PLFA 2O5JC 1J8IA 1RHPA 2AWNA 1CFMA 2HDLA 3PO2B 3Q0AA 3OMCA 4ZQ3A 4C1NK 1KLUD 1GUNA 1G91A 3URYA 1B2TA 3I4LA 4RGNA 4C3HB 2ID0A 1WTWA 4RA8A 2J7ZA 2B63B 2GA4B 4CHTB 3S1RB 3QJYA 4CJ1B 3E5SA 1KLGD 1HTPA 3D6CA 4TKOB 4IUPA 1WD1A 2O4XA 3PUZA 5C0XG 4XIGS 4HR7B 1D6EC 5I6WA 3VYRA 2F3VA 3V96A 1SYCA 1X32A 3K59A 2YYZA 4ZLTF 1PRTF 2JSOA 5D65A 1I4HA 1JWMD 5JPMC 2B2WA 1IHZA 3T51B 1DJRD 3TZUA 3AU7A 2F0UA 5C5LA 2LY7A 2EYMA 3HP3A 2HCCA 1NR4A 1EY0A 2R6GA 1TS2A 1QJOA 5EJWA 4A3KB 4H7BA 4XXEA 2ENBA 2R61A 4IUTA 1STGA 2BA1A 1I6HB 3LWEA 3MC0B 3NHHA 1SNMA 4OO1H 3CKIB 2A6HC 1E0BA 3HOZB 4ZKCB 1OO9B 2E2IB 3M4YA 2J4XA 1SNCA 2WACA 3L7ZC 3QG1A 1CHPD 2FFKB 5K36G 2MUYA 2XRQD 3R2TA 3AB9A 3OOCA 5C3XA 2JA8B 3EROA 5FO7B 5TSSA 1PFBA 3CQZB 3BDLA 4J6HA 1EWHA 1CQVA 2FINB 2F4IA 2RSNA 3G7LA 4EQNA 1O7ZA 2WKCA 2IX3A 3N6RA 1DOKA 3RLFA 3VYSA 3S2DB 1A6XA 4DAYA 3V05A 2NVTB 1EL0A 3C1FA 1DOMA 5JJZA 2F0WA 4K14A 3PMFA 1EEID 4A3GB 5C6AA 2EOTA 5KEEA 2L9HA 4S3SA 2K7VA 1LT6D 4DXGA 1E2WA 2RDGA 1YNJC 2B2UA 1TIID 2K03A 2R93B 1GOZA 4NMZA 1RODA 2A69D 4QUFA 1A15A 5I9PA 1H9MA 3RZDB 3S1MB 2J0TD 1YNND 5EPJA 4FO2A 4IUQA 2QDBA 5KYLA 3I73A 5NUCA 3NUCA 1GUTA 2A6HD 1WTOA 4K5VA 3S2HB 5G3LD 2SEBD 1EZ8A 4XQNA 4K8JA 5CYUA 2OF1A 1WCMB 5EBDA 1X3QA 3RZOB 2O5IC 1PFNA 4RKLA 1EU3A 1V1PB 2B2YA 3EVQA 3V2TA 1SAPA 1GJXA 2A5HA 4C1NI 2ZT9C 1CA5A 3OWFA 3WOEA 4K5XA 3NE5B 3FEWX 5M5XB 2X6LA 2CQAA 4EQPA 4KI0A 2Q8TA 1RF2D 3BVZA 3VR4A 4O1NA 4KKTA 5IT9L 2EYHA 3NBHA 3EQLC 2KCNA 4EGVA 1STNA 3GD7A 2OT2A 1PRTD 3A7AB 3EFXD 4TSSA 5DM63 1Y1WB 4LK1C 3H6MA 4H13C 2K28A 2M2LA 1CM9A 2PW7A 1HUMA 1AFPA 2CW0C 2M9VA 2ZXOA 2MPMA 1TKWB 1OXUA 1CTMA 2BE5D 3BDCA 2BA0A 4C2MB 5CR3A 1YNJD 3BYYB 1CHQD 1I4XA 1HXYD 5JEAJ 3MXPA 1U4MA 3J7AF 4OIKA 5E4WC 2MJ8A 5D14A 1B3AA 1LTID 4HMJA 1I4PA 3RMHA 2ZXPA 5M9OA 2SDFA 3L3OC 1MI2A 3ND8A 5EQ0A 3K5NA 1S5DD 2LKVA 2FMCA 1L0XB 2NUCA 4ZUJA 4C3IB 5DAUA 4RWSC 4IFDJ 5C4ZA 3MHBA 2F1MA 5CMDA 3U9SA 2B2VA 2EY1A 1PMRA 4QUCA 2E76C 2Z4HA 2F0PA 2WIIB 1WTQA 2N88A 4KY6A 4KY5A 4C3JB 4OIJA 2FMMA 1SYFA 2KVMA 4ZKBB 1O7LA 2IW3A 2AQ3B 3TBIB 4FXGC 1MBYA 2L12A 4QF4A 1H9SA 1DYQA 1SYBA 1K83B 1V43A 2PZTA 1PTOC 3KLSX 2PNRC 1C8CA 1SE2A 3A8IE 3PUXA 3Q23A 3IFTA 4ABNA 2D2CC 2F0OA 3H09A 2EJFC 3NXWA 3CHBD 3NWSA 2F0IA 4HSPA 1WTXA 3DXJC 4FF2A 5FO8B 1SMYC 1SNPA 2FJ2A 2HCIA 3SK5A 2MP1A 1HRJA 1GUWA 4BA1I 3EJIA 1EYDA 1SNDA 1Z6HA 2NVYB 1IYVA 1V8QA 1LTGD 5A35A 4N9PA 4R8NA 3NPPA 1TQOA 4LAAA 1MSGA 4NDXA 3P7JA 3T13A 1ONLA 1FGBD 5JVH3 4MN3A 5LL6X 3GQBA 1TY2A 2YU9B 3PUYA 3KLSA 5T1IA 2H4OA 5IODA 3BDOA 1MGSA 3OIPA 4G4KA 4FF1A 4R8IA 3I4NB 2B2TA 3R8BA 5BN4A 1OXSC 4F7XA 1ESRA 1U4PA 2E2HB 1TVXA 2L4NA 3NWTA 2VB2X 1S5ED 1ET9A 5C3EB 4BBRB 4A3IB 1BCPF 2IX0A 4PNYA 4G7HC 1B1ZA 4C3HG 3FPPA 3DWPA 3QO2A 4M1UB 4CKBA 2D9UA 2F0VA 2FHTA 3K7AB 4A3MB 1GHJA 1UEAB 2RA4A 1VMCA 4LMQD 1JCKB 4I7ZC 2K5DA 3R2IA 1JOKA 2NN6G 2H1EA 4K5WA 3LNNA 3H91A 2XVSA 1W6KA 1DXMA 2JA5B 3D4WA 3SHLA 1SMYD 4CJ0B 2ICIA 3TZDA 3KBGA 4FXDA 3A54A 2Q8IB 2RQXA 2K32A 4HSVA 4K6LA 1JR0D 3HOWB 2JE6I 3K5LA 5C5MA 1Y8NB 4PV1C 1RD9D 3W3AA 3ND9A 5C0XH 3FMCA 3D4RA 4K2LA 1HA5A 2L5TA 3CU7A 1CK1A 4CKEA 4ODGA 4C56C 5CC4A 4DXFA 2F0LA 2NTSA 2EJMA 3QOJA 3HEJA 3I70A 3GTOB 2KHSA 1B4OA 2PQEA 3J80E 5HURA 3A8JE 3GTKB 2IPKD 1IKLA 3TP8A 2A68D 4EVOA 1EIHA 3H94A 3IL8A 3NTHA 5KNCA 1NCVA 1Y8OB 3A7LA 5E4XA 5EBCA 4B9XA 1U4LA 1C48A 2MHVA 3HS0C 2R7ZB 1F2YA 3BYTB 4XQJA 3PUVA 1JB3A 1ZEQX 2ICEC 4DN4M 5JVG3 5CBEE 1ZYRD 1LTTD 5EPKA 4E6IA 5ELFA 3TP6A 4Q0FA 1EQVA 2K05A 3LWUA 4HAEA 2A69C 2SNMA 1ENAA 3K58A 5KRUA 5K36H 2F0SA 2D62A 4J1MA 3MFGA 1X3PA 1NAPA 2E2DC 1YNNC 2EYLA 3S1QB 4FVMA 1GUOA 3X3NA 3F2UA 2E75C 1SNOA 3KBXA 1LT3D 4QIWB 2MGSA 3ONAB 1U4RA 2IJ0A 3OMGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V2T A;  2EY6 A;  5J1Z A;  5EKK A;  1KDC A;  3C1E A;  3D6C A;  4ODG A;  1STA A;  3SXH A;  3TME A;  1JOQ A;  2EY1 A;  5EGT A;  5CC4 A;  2F0L A;  2O4X A;  4K6D A;  3SR1 A;  5J39 A;  2F0F A;  2F0E A;  3OWF A;  2F0H A;  5E1F A;  3QOJ A;  2PW5 A;  3HEJ A;  2F0P A;  4HTH A;  1SYG A;  3DMU A;  4HMI A;  5DEH A;  4K5X A;  5I6W A;  2KHS A;  4KY6 A;  4KHV A;  2F3V A;  4KJO A;  4KY5 A;  2M00 A;  2PYK A;  5F2D A;  4F7X A;  1SYC A;  5CV8 A;  4EQP A;  2F0K A;  1SYF A;  4DGZ A;  4EQN A;  4F8M A;  4PMC A;  3LX0 A;  2PQE A;  5HUR A;  3ITP A;  2PZW A;  4EQO A;  3S9W A;  3MZ5 A;  3SK6 A;  5KYL A;  2EXZ A;  3VA5 A;  4QF4 A;  1EY9 A;  4KD3 A;  3MVV A;  4RKB A;  4TRD A;  5NUC A;  1SYB A;  4N9T A;  4ME5 A;  4PNY A;  2EYH A;  3TP8 A;  1ENC A;  2F0Q A;  5E3F A;  1STB A;  1IHZ A;  2PZT A;  1EYC A;  1STN A;  3TP5 A;  4EVO A;  5CGK A;  2F0N A;  4IUN A;  2EYP A;  2F0U A;  5C5L A;  3C1F A;  2EYM A;  3OSO A;  5CV5 A;  3R3O A;  1KAA A;  4OL7 A;  2F0W A;  4KV6 A;  2F0V A;  1F2M A;  1RKN A;  4K14 A;  1EZ6 A;  3H6M A;  4DU9 A;  1EY0 A;  5IOC A;  3PMF A;  1EY7 A;  5KYI A;  1EY5 A;  1EY6 A;  5C4H A;  4G57 A;  5C6A A;  5K5P A;  4K2K A;  4B9X A;  5KEE A;  2RBM A;  4S3S A;  5I9O A;  2F0M A;  2EYJ A;  2F0T A;  2PZU A;  3D4D A;  3DHQ A;  3RUZ A;  2PW7 A;  4IAL A;  4H7B A;  5HGT A;  5IGG A;  1TT2 A;  2ENB A;  3QOL A;  4KTA A;  4NKL A;  1F2Y A;  2OEO A;  4QB4 A;  1JOR A;  2F0O A;  1STG A;  5KIX A;  2F3W A;  5IGE A;  5CV9 A;  5IGB A;  1STY A;  3NXW A;  4NMZ A;  3NQT A;  1NUC A;  3NP8 A;  2SNS A;  2F0I A;  3NHH A;  5C3W A;  5ISR A;  1JOK A;  1SNM A;  3BDC A;  4KD4 A;  3MEH A;  5CR3 A;  4ID6 A;  1SNQ A;  4ZUI A;  4WRD A;  5CV4 A;  5I9P A;  5I6Y A;  4K5W A;  1SNP A;  3SK4 A;  2F0D A;  3SK5 A;  3D8G A;  3P75 A;  1A3V A;  1STH A;  3P1H A;  4E6I A;  1II3 A;  1EYA A;  1SYE A;  2QDB A;  1EQV A;  2SOB A;  3EJI A;  4I65 A;  1A3U A;  3OMC A;  1SYD A;  1F2Z A;  3MXP A;  4KY7 A;  2SNM A;  1EYD A;  2F0J A;  2EYF A;  3NUC A;  4MIU A;  1ENA A;  2F0G A;  3D4W A;  3QB3 A;  1SND A;  4ZQ3 A;  3SHL A;  1KDB A;  5IGD A;  4NP5 A;  5KRU A;  2RDF A;  1EY8 A;  2F0S A;  4J1M A;  5JAV A;  1SNC A;  1EY4 A;  4K5V A;  4K8I A;  1KAB A;  3U9O A;  1TR5 A;  2WAC A;  5IIF A;  3TP6 A;  2EYO A;  1JOO A;  4QMG A;  3SK8 A;  4KJN A;  4WOR A;  4J6H A;  2EYL A;  4N9P A;  4R8N A;  4HMJ A;  1EZ8 A;  1AEX A;  4DF7 A;  2KQ3 A;  1TQO A;  3ERQ A;  2EY5 A;  4LAA A;  4YIJ A;  5IGF A;  2EY2 A;  4NDX A;  5M9O A;  5CV7 A;  5EKL A;  1SNO A;  3T13 A;  4DFA A;  1NSN S;  1A2U A;  4K8J A;  4B9W A;  4IZ8 A;  1A3T A;  5JOB A;  5C5M A;  2OF1 A;  2LKV A;  5C3X A;  2RKS A;  1KDA A;  3T16 A;  1A2T A;  3ERO A;  5KGU A;  2HQE A;  4RKL A;  5IOD A;  2NUC A;  3HZX A;  3NK9 A;  1U9R A;  4ZUJ A;  4PMB A;  3TP7 A;  5IGC A;  5J22 A;  5CV6 A;  2OXP A;  3OMG A;  4K2L A;  5DAU A;  3EVQ A;  3BDL A;  5C4Z A;  3E5S A;  3MHB A; 
#chains in the Genus database with same CATH topology
 5HGQ A;  4LJZ C;  4DPG A;  1KDC A;  3GTM H;  3HGB A;  3K81 C;  2KOL A;  1T9H A;  1W6J A;  4IUR A;  4V0B A;  5EGT A;  3VA7 A;  3J80 L;  2F0H A;  5E1F A;  4R4O A;  3VR2 A;  4YY3 L;  1T5X D;  3MFY A;  5LHY 1;  4KHV A;  1D1K A;  2N55 A;  4JBW A;  1STE A;  4LF6 Q;  2EVB A;  1LAB A;  4QY7 A;  1Q8K A;  4AH6 A;  1TU2 B;  3I4O A;  3KF8 A;  4ZAI A;  2D5D A;  1PYW D;  3M4O H;  3JAM i;  2F0Q A;  2V4D A;  4X65 Q;  3E0E A;  1VQP A;  2O2L D;  1QVF A;  4RCN A;  1WCM G;  4A3J B;  1HNZ Q;  1BCP D;  3P20 A;  2JA6 H;  1NY4 A;  1VQE A;  2E74 C;  3OHX C;  3MXU A;  3M7N A;  3DHQ A;  5IE8 A;  2PI2 A;  1SRU A;  3HOX B;  4MTN A;  3PIO 3;  1PRT C;  1TS5 A;  3FVQ A;  4OWW B;  5FLX c;  4DUY L;  5IWA L;  3BS1 A;  1ASZ A;  2L0C A;  1HQR D;  3GTJ B;  3W2D A;  1G6P A;  1XJV A;  1SMX A;  1I4G A;  3MEH A;  1EIY B;  4JPB W;  4HIO A;  4P2C B;  1G29 1;  4JI8 Q;  1QNU A;  1TWA B;  4X62 L;  3I2Z A;  2F0D A;  1PH3 A;  4YHH L;  3CME A;  4KY7 A;  2R3Z A;  1IBM L;  5CBA E;  5IGD A;  1C4Q A;  1LLR D;  3GP7 A;  3PV0 A;  3NSW A;  2BE5 C;  4A3B H;  3PF4 A;  4J15 A;  5JAV A;  1TY0 A;  1QIL A;  1IXR A;  2YTV A;  1ILQ A;  1Y1W G;  4KK7 A;  1PDQ A;  3AMU A;  2KEE A;  2JK8 A;  5ELD A;  3UDG A;  3F8T A;  5M5W H;  2N78 A;  3ZYY X;  4A3E H;  1JT8 A;  1YEZ A;  3OPO A;  1LUZ A;  1TWG H;  2K33 A;  1NSN S;  2K5N A;  4B9W A;  3PO3 H;  1PXU A;  3GTG H;  4IPG A;  1DON A;  1UE1 A;  1B44 D;  2HQL A;  3K0Y A;  3K80 C;  4Y7N B;  3BJU A;  3I56 A;  1TWC H;  3U50 C;  3KF6 B;  1U5K A;  3VR3 A;  1ICW A;  2MO1 A;  4FF3 A;  1N33 Q;  2OTJ A;  1PRT B;  2JA9 A;  3J81 i;  1HHV A;  4A3F B;  3S1N H;  1KNA A;  1HNX L;  2BCO A;  1VQI A;  4OXP A;  5M5Y B;  2Z4I A;  3GV3 A;  3H0G H;  1MKH A;  4LFB L;  4DNR B;  4POF A;  1D5Z C;  1XPU A;  4N9T A;  4LNQ A;  5J3B A;  3T56 B;  5CGK A;  3DM1 A;  3UDX A;  3D31 A;  5GAH C;  2DN8 A;  3W1B A;  1X56 A;  3A5Z B;  1FYC A;  3RN5 A;  4C3I G;  3I7F A;  2XIW A;  1ENF A;  4Z9C B;  1SE4 A;  4BY1 B;  2K1B A;  5C44 H;  3M9B A;  3I8Z A;  1PH1 A;  2JP1 A;  4KTA A;  2RDH A;  3S14 H;  2EQS A;  5LMU L;  5IGE A;  1QWY A;  2KJX A;  3BG3 A;  4KHZ A;  1VDZ A;  3UI2 A;  1STY A;  2AQ1 B;  4P71 A;  4GZY C;  4C3J G;  3MXN A;  3PIO A;  5KND A;  4IFD I;  1QG7 A;  1Z9F A;  5C4X H;  2K50 A;  5I6Y A;  5M3F B;  1FL0 A;  1HZC A;  2R7F A;  1K3B C;  1VQD A;  1WFQ A;  3KFU A;  1A3V A;  3A56 A;  5M3M B;  1CSQ A;  1A3U A;  4DR5 L;  2EZV A;  5FO9 B;  2F0J A;  3JAM E;  1C7Y A;  3RD4 A;  1VQB A;  1BNZ A;  1IZ6 A;  4NP5 A;  1F2L A;  1GO3 E;  1AH9 A;  1EY8 A;  2HIV A;  2KCC A;  3AFP A;  1XPO A;  4P72 A;  4R4T A;  3U9O A;  2R92 B;  1HCZ A;  1MSH A;  1PTO F;  2A74 C;  1X6O A;  1HPC A;  4JW0 A;  3SK8 A;  4OGQ C;  3R93 A;  2VXW A;  5FK9 C;  1K8A C;  5LL6 S;  4POG A;  5FJ8 H;  4A93 B;  3J7Y W;  3D6W A;  3E3X A;  5EKL A;  5IP9 G;  4A3L H;  1F9P A;  4IZ8 A;  4KN7 C;  5JOB A;  3OTO Q;  2EPB A;  1EWC A;  2QCP X;  1S5F D;  1VMP A;  4WJ3 M;  5KGU A;  3WDN A;  5COR A;  4DV6 Q;  4F88 A;  3NTI A;  4PMB A;  4HED A;  1VQ7 A;  2F52 A;  2VZA A;  2VS1 A;  2ZXR A;  2AUJ D;  3GDE A;  1DOL A;  5ISR A;  4JI4 L;  1K0S A;  5LMN Q;  2DNE A;  1VQC A;  1STA A;  4XDX A;  1CI3 M;  1JB7 A;  5DM7 3;  1EQT A;  4K6D A;  2NTT A;  3NEN A;  2E2J H;  2B2W C;  4Y52 H;  3O13 A;  3I4M B;  4HTH A;  1SYG A;  4HMI A;  5DEH A;  3K57 A;  2EJG C;  4DGZ A;  1IKM A;  3Q24 A;  3FKI B;  4KHP L;  2PZW A;  2XN9 C;  3SK6 A;  2RSO A;  2QEJ C;  3OIQ A;  1ICF B;  1VQ6 A;  4ME5 A;  1SE3 A;  5JEA G;  3SVM A;  3Q22 A;  3R3O A;  4LF6 L;  4OL7 A;  1V1Q A;  3KUP A;  2JJQ A;  4DV0 Q;  2F03 A;  1RL2 A;  2Z6B A;  3FPU B;  1N32 L;  1TS4 A;  4X65 L;  4IAL A;  1OXX K;  5H1S E;  4NKL A;  1HA6 A;  3I4N G;  1HNZ L;  1LO5 D;  1Z7T A;  2F3W A;  5A2Q E;  5IGB A;  4DR4 Q;  1HFN A;  1YNX A;  3NP8 A;  2IHE A;  3STB D;  4KD4 A;  4ZUI A;  1TWH B;  3S17 B;  4CKC A;  5D3I B;  5C3E G;  1F9R A;  1KHI A;  4BBR G;  2VUM H;  4IFD G;  2LFN A;  4A3I G;  4IPD A;  4LF7 L;  2NBF A;  4A75 A;  2RVL A;  1L1O A;  1J6Q A;  2QGQ A;  2F0G A;  1R9T H;  1UUP A;  4DAM A;  1LT5 D;  2Z6K A;  2IY5 B;  1Q1E A;  4A3M G;  4QMG A;  4JI8 L;  1EQR A;  4DNI A;  2NN6 I;  1LT4 D;  3S16 H;  5CV7 A;  2XNA C;  4HCE A;  1BOS A;  1QE6 A;  1EEF D;  1XMO L;  2WP8 J;  1EWI A;  1LTA D;  1WVL A;  4F87 A;  3X3M A;  4RAU C;  4DV4 Q;  4YWL A;  2EIF A;  3PO2 H;  4OX9 Q;  3AEV A;  1PH5 A;  4CDE C;  5FLX E;  1HNW Q;  2DJG C;  3CMA A;  4IUU A;  2Z1C A;  5EKK A;  3Q6S A;  1PH2 A;  1JOQ A;  1TWF B;  1VQ8 A;  2PPB C;  1WJJ A;  3D3R A;  5BN3 A;  4P73 A;  2K52 A;  4HN7 A;  2YTX A;  2JA5 G;  1VQ4 A;  1CKN B;  1N33 L;  4C3H H;  5CV8 A;  1RTO A;  3WOF A;  2K01 A;  4GKK Q;  4BXX H;  1ML0 D;  1ET6 A;  2QIL A;  2B63 H;  3ITP A;  4BWG B;  2JYO A;  1CQF A;  1VF7 A;  3BU2 A;  3S1R H;  5T1G A;  4RKB A;  4PZ8 A;  5C4J B;  2PQA A;  3HOW G;  3OW7 A;  4KKU A;  3TP5 A;  1YJN A;  5IYD G;  3CW2 C;  4H02 A;  2DJF C;  2EYP A;  1QB5 D;  1ASY A;  2GVA A;  3KDF A;  2G9H D;  4X3T A;  2C9O A;  1EY6 A;  5A2Q L;  1O80 A;  4K2K A;  1RJT A;  4GN5 A;  4L63 B;  3J7A 5;  1JWU D;  2A68 C;  1AZP A;  3H3V C;  4G7Z C;  3EA6 A;  2YTY A;  2B8G A;  3K0X A;  3C46 A;  3FDT A;  2LXJ A;  5CV9 A;  3W5O A;  3K8A A;  1NUC A;  2A8V A;  4BY7 H;  1UWV A;  1XNR Q;  4Q5V A;  1I4Q A;  1MJC A;  4FXK C;  4YWM A;  5IT9 c;  1V1P A;  3F2D A;  4DAY B;  1XXG A;  4WFN 3;  4JI0 Q;  4DV3 Q;  4BA2 I;  4GLA C;  3IFD A;  1M8A A;  4XT1 B;  1PYB A;  4HJ5 A;  4A3K H;  1ZYR C;  4V19 0;  2UXD Q;  2ZM6 Q;  4X62 Q;  1SSO A;  2R7D A;  3GO5 A;  1JIC A;  2Y0S B;  2EYO A;  4FF4 A;  1JOO A;  3S15 B;  1I6H H;  2B2Y C;  1AEX A;  2C5C A;  5IGF A;  2K5W A;  3NBI A;  1HZ9 A;  5IP7 H;  5D3D A;  2R7Z G;  1BKB A;  1A2T A;  2XRS D;  4L6T B;  1YBY A;  3HOZ H;  1U9R A;  2VY3 A;  4G7O C;  5CV6 A;  2BDO A;  2X6G A;  2AMC B;  2VQF L;  2E2I H;  4BS9 A;  5J1Z A;  1I3Q B;  3GTQ B;  1OXT A;  1VQK A;  3G6J B;  1KD1 C;  1JQY D;  4DV6 L;  3K6O A;  3PCO B;  4IJH A;  4A3D B;  5LMN L;  3CCS A;  1KTK A;  2JA8 H;  4EQO A;  1QNK A;  5DNF A;  1KIX A;  3IAY A;  3MVV A;  4TRD A;  2ATW A;  3CQZ H;  2ASB A;  1D2B A;  1EU4 A;  2VQE Q;  1SXT A;  1I50 B;  3BZC A;  3BZK A;  2I5H A;  2LS0 1;  3K7U C;  1WTR A;  2P5Z X;  1F2M A;  5IOC A;  1UAP A;  1K9M C;  3RLN A;  1HUN A;  5G3L F;  3GTL H;  1SE8 A;  4OWT B;  5IYC H;  5I2X A;  2E5L Q;  4JOI A;  5C0X J;  1ZXT A;  2DNC A;  3DWA A;  2L1B A;  2Z8L A;  4KLK A;  2XTI A;  1T5E A;  2I0Q A;  2OEO A;  2XWB B;  1BCP C;  4DA2 A;  4HIK A;  2CVR A;  1G8Z D;  1B3Q A;  2GVB A;  1RDP D;  2D0P A;  3IKJ A;  1BQQ T;  4DV0 L;  3S2D H;  1Q3L A;  4FP5 D;  2NVT H;  1BVS A;  5CV4 A;  3T1Y Q;  3NBH B;  4B08 A;  4QQB X;  3P75 A;  5K5P A;  4LF5 Q;  2X69 A;  4A3G H;  4DR4 L;  4B3R Q;  3HOV B;  1SYD A;  5COY A;  4OO1 I;  4H44 C;  2LMC B;  4L5Q A;  1Z47 A;  3QB3 A;  1B8A A;  4A3J G;  1EY4 A;  5IIF A;  1PZJ D;  3J7Z C;  2KUM A;  4FNF A;  4OWX B;  1N9W A;  2R93 H;  2RCN A;  2KQ3 A;  3ERQ A;  2EY5 A;  1NE3 A;  2NVX B;  2B2V C;  1EUJ A;  5DLQ E;  1WTV A;  4B3S Q;  1O7Y A;  3HOX G;  2UUB Q;  3RZD H;  1NBW A;  2HUG A;  1AN8 A;  1G2S A;  5JPN C;  3G71 A;  1C9O A;  2K14 A;  5BR8 Q;  5IYB G;  2AWO A;  1E1T A;  1WI5 A;  4ME3 A;  1H9J A;  1CZG A;  2EY6 A;  1FR3 A;  2XGT A;  4BY7 B;  1LYL A;  1BCP B;  1CUK A;  1GD7 A;  3TME A;  3S2H H;  2ZTD A;  1XWE A;  2F0E A;  4DV4 L;  4YCV A;  2JXM B;  3KLR A;  3DMU A;  3VR5 A;  1SJE D;  1IBL Q;  3NTK A;  4JI4 Q;  4OX9 L;  5F2D A;  3I3C A;  4PQX A;  1HNW L;  1D5M C;  3MXG A;  3PIP 3;  2WKD A;  2BOS A;  3RNU A;  1EY9 A;  4KD3 A;  2JQO A;  1DZ1 A;  4M8A A;  4KHP Q;  1SEB D;  2F0N A;  3G48 A;  1NJI C;  4GKK L;  2TMP A;  3OSO A;  1Q90 A;  2Z0S A;  1PYS B;  1FNV A;  1IW7 C;  1LTS D;  1B50 A;  1PFM A;  1FGU A;  2I07 B;  1GM5 A;  3GV6 A;  1S4Z A;  1H9R A;  1Y1V H;  1VQF A;  1JWS D;  2F0T A;  3KYH C;  4A3F G;  1WD0 A;  1D5X C;  2RHQ B;  3QOL A;  3RR5 A;  4CBV A;  1E7Z A;  2RHS B;  3HRZ C;  1YHQ A;  1X9N A;  4HIM A;  1E1O A;  1N32 Q;  3NQT A;  3CRK C;  3QR8 A;  1H9S B;  4WRD A;  1L0Y B;  3GTP B;  1Y1W H;  2UXB Q;  3K5M A;  1Q81 C;  3P1H A;  2KHJ A;  4RMF A;  1EYA A;  1SYE A;  3TP7 A;  2HHH Q;  2DY7 A;  3DM3 A;  3SDZ A;  1N34 Q;  3VYU A;  4DKA C;  2HD3 A;  1XNR L;  3QIA A;  4OO1 G;  4K8I A;  1KAB A;  4LF7 Q;  1G2T A;  3T53 B;  1AW7 A;  3KK7 A;  3NQI A;  4OHJ A;  4WOR A;  4JI0 L;  1B53 A;  4DV3 L;  4ZRZ A;  3VYT A;  2UUC Q;  1DD2 A;  4BY1 G;  3GTL B;  1RIP A;  1A3T A;  1SFO B;  4C2M H;  1OXV A;  2NVQ B;  2B2T C;  2EE1 A;  4RHR A;  2ZM6 L;  4BBS B;  5GAE C;  3CD6 A;  2RKS A;  2UXD L;  2FXQ A;  1KDA A;  4RFB A;  4JI5 L;  4LF8 Q;  2Q2U A;  3D0F A;  2C35 B;  5FOB B;  1K8O A;  1XMO Q;  3ER0 A;  3MWY W;  4RGT A;  5KNB A;  2KA7 A;  3TS2 A;  2I46 A;  1QUQ A;  1LTR D;  1DM0 B;  5M3F G;  1M4V A;  3TDQ A;  2NZH A;  5EKI A;  2QEX A;  5M3M G;  3CCU A;  2IT1 A;  4KKS A;  5IT9 E;  4DR6 Q;  2EDG A;  2M00 A;  2PYK A;  2NWG A;  4UPA A;  4R9W A;  4F8M A;  4PMC A;  3A8K E;  2VB3 X;  2R92 G;  4XQQ A;  3PGZ A;  1Q12 A;  1I6V C;  1WTP A;  3N52 A;  4XTC S;  3CCQ A;  3A0J A;  4A93 G;  2KHI A;  4C3I H;  3CF5 A;  1EOV A;  1STB A;  3TSS A;  3PIP A;  1H95 A;  4X3U A;  4DK1 A;  2WV6 D;  1AZQ A;  1EIG A;  4RH6 A;  4DNT B;  3HOU B;  5ELE A;  4TQU S;  4ZK9 B;  4JCV E;  4C3J H;  1PHJ A;  1QCB D;  4UAI A;  1WTH A;  3HOY B;  1CZW A;  2VQE L;  3C3L A;  1IW7 D;  4OON A;  3I4M G;  3SEB A;  4UDU C;  1HR0 Q;  3AQQ A;  1K83 H;  2QF7 A;  2E5L L;  3FKI G;  1HJP A;  1BF4 A;  1E22 A;  2WB1 E;  4L8J A;  4JI6 Q;  4XYQ A;  3BVM A;  2PO4 A;  1B9M A;  2WB1 B;  1PH7 A;  3A55 A;  4MIU A;  5J39 A;  2N3S A;  4H0L C;  1AE2 A;  3M85 A;  1KDB A;  4GOP C;  3STB C;  4PMW A;  2RDF A;  3GTM B;  4O0A A;  2UUA Q;  3T1Y L;  3I91 A;  1GVP A;  5LMN W;  4KJN A;  4LF5 L;  3RLO A;  4B3R L;  4DFA A;  2K6A A;  1A2U A;  2KCM A;  1Q1B A;  3PUW A;  4WJW A;  1KNE A;  1Y1V B;  3T16 A;  4DAV A;  1BBU A;  2TSS A;  1R4Q B;  1RTN A;  5IGC A;  2PMZ E;  4L5R C;  2OXP A;  5ELN A;  4O42 A;  3M4O B;  2K04 A;  3AFQ A;  1XTC D;  4JI1 Q;  2A6E C;  3WWV A;  4B3S L;  2PMZ B;  1RCV D;  1AP0 A;  2NVY H;  2UUB L;  2IWH A;  3CCJ A;  3SR1 A;  4DAP A;  2F0F A;  2PW5 A;  2JA6 B;  4NW2 A;  1S3O A;  3ICE A;  2PCF B;  4LFA L;  2VQF Q;  1PTO H;  4GNX C;  5BR8 L;  4KJO A;  1XYI A;  1TS3 A;  2Q2T A;  2DY8 A;  3LX0 A;  4MTK A;  5JEA H;  2YU9 H;  4R4I A;  2IL8 A;  3CCL A;  3S9W A;  4DR7 Q;  1E2Z A;  1FNU A;  2EXZ A;  2HDM A;  3VA5 A;  3S24 A;  4GOP B;  3FHW A;  1EOT A;  4CDD C;  1Q8I A;  1R4P B;  1IBL L;  1Y8P B;  4RCO A;  2LSS A;  2MNA A;  5CV5 A;  3H3V I;  4RGM A;  1HQM C;  3I4N H;  1SJH D;  5ELB A;  1VQL A;  4G57 A;  3UDI A;  2NYZ D;  3EBE A;  3J80 c;  2E2H H;  5I9O A;  1KAW A;  4A3B B;  1VCI A;  1TT2 A;  3DEP A;  3C2P A;  1FNW A;  1E2V A;  4BBR H;  5KIX A;  4IFD H;  1HTL D;  4U67 3;  2B39 A;  1O7I A;  4A3I H;  3UE0 A;  1TXY A;  2AUK A;  5M5W B;  4A3E B;  1X55 A;  1TWG B;  4GN3 B;  3PO3 B;  3GTG B;  4ZYS A;  4ZCK A;  3T4A C;  1JJ2 A;  4CDF C;  4GNX B;  2A73 B;  4A3M H;  1STH A;  1II3 A;  4I65 A;  1D1I A;  1TWC B;  1F2Z A;  3J81 E;  5FJ8 G;  1GUG A;  4QCL A;  3S1N B;  4DK0 A;  4XYO A;  4GS3 A;  4EQ5 A;  2UXB L;  4IUV A;  2RCF A;  4DF7 A;  1VQ5 A;  1X3F A;  4YIJ A;  1DCZ A;  2HHH L;  1GHK A;  3M3Y H;  3MA2 B;  5GQO A;  2KED A;  3JAM L;  1PH9 A;  3ZJY C;  1N34 L;  3H0G B;  4IQZ A;  4J8Q A;  3TN2 A;  4CJ2 C;  4RGO S;  3BZD B;  1ZKO A;  3HZX A;  2AHO B;  3NK9 A;  4DV7 L;  1BO0 A;  5J22 A;  1K28 A;  4HCS A;  2JA5 H;  1QOH A;  2UUC L;  3MTS A;  3C1E A;  4GN4 B;  5EAY A;  4QGU A;  3K5O A;  5I4D A;  3E0J A;  4LF8 L;  3TEH B;  3E6Z X;  2A6E D;  2JEA I;  3QWN A;  1NR2 A;  3HOW H;  2K5Q A;  2WIN B;  5C44 B;  5IYD H;  1C0A A;  1BBX C;  4A4I A;  3DUZ A;  2Y0S G;  3MAQ A;  3S14 B;  1IYJ B;  3DWQ A;  2KEC A;  1YHB A;  4RHS A;  5AFW A;  1Q46 A;  1UNS A;  1M90 C;  3L0O A;  5FKA C;  2G9D A;  1KC8 C;  4DR6 L;  3FRP B;  1ENC A;  1A62 A;  2CKZ B;  4QJF A;  5E3F A;  1EFI D;  1ESF A;  2L11 A;  1VS0 A;  5C4X B;  4X3K A;  4DU9 A;  1EZ6 A;  1F9S A;  1PZI D;  1BUV T;  2CW0 D;  1JC7 A;  1EY7 A;  1EY5 A;  3PF5 A;  2H5X A;  1XX8 A;  4JK1 C;  2EYJ A;  2PZU A;  3D4D A;  5HGT A;  1G6Z A;  5IGG A;  1JJG A;  2CH4 A;  2WAQ E;  4AYB B;  3J80 i;  1HFG A;  1FJG Q;  3GTK H;  2XSC A;  2JEB I;  2A1A A;  3BVG A;  2WAQ B;  1EYG A;  2QW7 A;  4A3D G;  1MD2 D;  2SNS A;  1PTO B;  1AE3 A;  1F77 A;  2B2U C;  1O78 A;  3KF8 B;  3J81 L;  3CPW A;  2VW9 A;  4PZ6 A;  5JJL A;  4X6A H;  4HJ7 A;  3KF6 A;  1L0W A;  3SK4 A;  1BR9 A;  3A74 A;  2IX1 A;  4U68 A;  3D8G A;  1FD7 D;  4ILW A;  2SOB A;  1ILP A;  1HR0 L;  2OQK A;  2EYF A;  1Y69 U;  5ELC A;  2K4K A;  5EPL A;  4IO9 A;  2NN6 H;  1HH2 P;  1SN8 A;  4CDC C;  1TR5 A;  1H9K A;  3EIV A;  4XT3 B;  4X3S A;  4O2D A;  2E2J B;  2OWO A;  1D7Q A;  4JI6 L;  2MFI A;  2EY2 A;  5FLM H;  1BDO A;  3CRL C;  2AQ2 B;  1YVC A;  2Q2H A;  4DK3 C;  1B7Y B;  1LM0 A;  3MEF A;  1EFW A;  1SBB B;  2XWJ B;  5BN5 A;  1Q7Y C;  2UUA L;  2NZ1 D;  3F2B A;  2HQE A;  1B70 B;  4LF9 L;  4JI2 L;  1IL8 A;  3NEM A;  1D8L A;  1CA6 A;  4LFC Q;  3KLW A;  4DV1 Q;  1EQQ A;  3HKZ B;  2BH2 A;  2Y0S E;  1K8M A;  1S5C D;  1J9O A;  5C0X I;  2VL6 A;  4IN3 A;  4JI5 Q;  3SXH A;  3J7A V;  1SRO A;  1QVG A;  3S1Q H;  4QL5 A;  4CGY B;  5GAD C;  3HOV G;  1S5B D;  1JE4 A;  4KN4 C;  3M7G A;  2Q8R E;  5FLX L;  1PTO D;  4JV5 L;  3I72 A;  2F0K A;  2ZJQ A;  4JI1 L;  1B9N A;  2L55 A;  2UU9 Q;  3HG9 A;  2B29 A;  2NB0 A;  3MZ5 A;  1GUS A;  3ERS X;  5I2Y A;  4DK6 C;  4ULL A;  2B8F A;  4GLX A;  1LV9 A;  3M3Y B;  1EYC A;  1GXD C;  1V1O A;  4IUN A;  1VF5 C;  2VUM B;  1KAA A;  1YJ9 A;  4KV6 A;  4KMU C;  4DR7 L;  2QKI C;  1RKN A;  1IYU A;  1CT1 D;  1LAC A;  5KYI A;  2ZJR A;  5JJI A;  5C4H A;  1SDF A;  4FYD A;  2RBM A;  1R9T B;  4BY7 G;  2F0M A;  3SE0 A;  3RUZ A;  3DEO A;  4JI3 Q;  1LTB D;  1F9Q A;  1PZK D;  1JOR A;  4QB4 A;  3I90 A;  3L9A X;  2BDN A;  2CH4 W;  3VR6 A;  3S16 B;  3E9H A;  2CHB D;  1VQN A;  5C3W A;  1BXT A;  4MHE A;  3OWE B;  1I4R A;  4ID6 A;  1SNQ A;  1PLF A;  2O5J C;  1J8I A;  1RHP A;  3NEL A;  2AWN A;  1CFM A;  4DV5 Q;  2HDL A;  1S72 A;  3PO2 B;  3Q0A A;  3OMC A;  4ZQ3 A;  1Q82 C;  4C1N K;  3OW2 A;  1KLU D;  1GUN A;  1G91 A;  3HOX H;  3URY A;  4X66 Q;  3F2C A;  1Y14 B;  1UEB A;  1B2T A;  3I4L A;  2PNH A;  4RGN A;  4YCU A;  3GTJ H;  4JC0 A;  5IYB H;  3RN2 A;  4C3H B;  2ID0 A;  3UE1 A;  3CCR A;  1WTW A;  3MXN B;  1VQM A;  4RA8 A;  2J7Z A;  2B63 B;  1TWA H;  2GA4 B;  4CHT B;  4A3C G;  1NMF A;  3S1R B;  3L2P A;  3QJY A;  4CJ1 B;  4IOC A;  3CAM A;  4HID A;  3TQY A;  3E5S A;  1KLG D;  3ULJ A;  1HTP A;  3D6C A;  4TKO B;  4IUP A;  4JYA Q;  1WD1 A;  2O4X A;  3PUZ A;  5C0X G;  4AQY Q;  2ZJP A;  4IJL A;  4XIG S;  4PZ7 A;  4HR7 B;  1D6E C;  2BH8 A;  5I6W A;  3VYR A;  2F3V A;  3V96 A;  1SYC A;  1X32 A;  1EIF A;  3K59 A;  1X54 A;  4LUO A;  2YYZ A;  1N8R C;  3S1M H;  3OYY A;  1GKH A;  4ZLT F;  1PRT F;  4LFA Q;  2JSO A;  4Y7N H;  1I5F A;  5D65 A;  2OTL A;  3T1H Q;  1I4H A;  1JWM D;  5JPM C;  1KXL A;  2B2W A;  1IHZ A;  3T51 B;  3I55 A;  2JA7 G;  4A3F H;  4BBS G;  1DJR D;  3TZU A;  3AU7 A;  2F0U A;  5C5L A;  2LY7 A;  2EYM A;  3CC7 A;  3HP3 A;  2HCC A;  1NR4 A;  1VQA A;  1EY0 A;  1G51 A;  2R6G A;  1TS2 A;  5M5Y H;  1QJO A;  5EJW A;  1MIU A;  4DR3 Q;  4A3K B;  1WCM H;  4H7B A;  4XXE A;  2ENB A;  1PH6 A;  3RZO H;  2R61 A;  4IUT A;  1STG A;  1L1O C;  2BA1 A;  1I6H B;  3LWE A;  3MC0 B;  4OEL B;  3NHH A;  1SNM A;  2Z6K C;  1IBK Q;  3ULP A;  3CKI B;  4NXM L;  4OO1 H;  2JA7 B;  2A6H C;  3KOJ A;  1E0B A;  1FJG L;  3HOZ B;  5HY6 A;  4ZKC B;  1YHA A;  5M5X H;  3ULL A;  1OO9 B;  4BY1 H;  5ELO A;  2E2I B;  3M4Y A;  4DUZ Q;  2J4X A;  1SNC A;  4LUV A;  3HOU G;  2WAC A;  2KCT A;  3L7Z C;  1CKN A;  1P8L A;  3QG1 A;  2I5L X;  1CHP D;  1KL9 A;  4JI7 Q;  2FFK B;  3HOY G;  4IOA A;  5K36 G;  2MO0 A;  2MUY A;  2N8N A;  2XRQ D;  3R2T A;  3AB9 A;  3OOC A;  5C3X A;  5M3F H;  2JA8 B;  3ERO A;  5FO7 B;  2WFW A;  5TSS A;  5M3M H;  1PFB A;  3F1Z A;  1P16 A;  3CQZ B;  3BDL A;  2EXD A;  4J6H A;  1EWH A;  4B3T Q;  1CQV A;  1L1O B;  2FIN B;  2R92 H;  4DV7 Q;  2F4I A;  1KRT A;  2RSN A;  3G7L A;  2WB1 G;  5IY0 A;  4LFC L;  4DV1 L;  4X64 Q;  4A93 H;  1J5E Q;  2D0O A;  3CCV A;  4EQN A;  1KQS A;  1O7Z A;  2DUD A;  2WKC A;  2IX3 A;  4MZ9 A;  3N6R A;  1DOK A;  3RLF A;  1XTD A;  3VYS A;  3S2D B;  1HR0 W;  5GRO A;  2CFM A;  1A6X A;  4P75 A;  4DAY A;  1Y1V G;  3V05 A;  2HT1 A;  2NVT B;  1EL0 A;  3C1F A;  1DOM A;  2UU9 L;  5JJZ A;  2F0W A;  4K14 A;  3I4M H;  3IRB A;  1YZ6 A;  1EEI D;  3PMF A;  4A3G B;  4HJA A;  5C6A A;  2EOT A;  5KEE A;  2L9H A;  4S3S A;  2K7V A;  1LT6 D;  4DXG A;  1E2W A;  4DV2 Q;  3FKI H;  2B3G A;  1NNX A;  1JMC A;  2RDG A;  1YNJ C;  3CCE A;  1M1K C;  2KBN A;  2B2U A;  1TII D;  2K03 A;  2JA6 G;  2R93 B;  1GOZ A;  4NMZ A;  1ROD A;  2A69 D;  4NXN Q;  3Q8D A;  4IPC A;  1XNQ Q;  2PQA B;  4QUF A;  1A15 A;  5I9P A;  4JI3 L;  1H9M A;  3RZD B;  1HZB A;  4WJ4 A;  1JJC B;  2L15 A;  2J0T D;  3S1M B;  1YNN D;  5EPJ A;  2NZO A;  1I94 Q;  4FO2 A;  4IUQ A;  2QDB A;  5KYL A;  3I73 A;  1K0R A;  5NUC A;  3NUC A;  1XMQ Q;  3KDF B;  1GUT A;  2A6H D;  1WTO A;  4K5V A;  3S2H B;  5G3L D;  1MJE A;  2SEB D;  1QZG A;  4GKJ Q;  1SR3 A;  1EZ8 A;  4DV5 L;  4XQN A;  3KJO A;  4K8J A;  4DR2 Q;  5CYU A;  4A3B G;  1TWH H;  3S17 H;  2OF1 A;  1WCM B;  5EBD A;  1X3Q A;  4L5S A;  3RZO B;  4X66 L;  4NB3 A;  2O5I C;  1PFN A;  4MNO A;  4RKL A;  2CCZ A;  1SLJ A;  4A3E G;  1EU3 A;  1V1P B;  5IP9 H;  2B2Y A;  1PFS A;  1YIJ A;  3PO3 G;  3EVQ A;  4UP7 A;  3V2T A;  1SAP A;  1GJX A;  2A5H A;  4LF9 Q;  4JI2 Q;  4C1N I;  2QA4 A;  3CPF A;  2ZT9 C;  1CA5 A;  3OWF A;  2OQ0 A;  4N8X 1;  3WOE A;  4K5X A;  3NE5 B;  2UXC Q;  3FEW X;  5M5X B;  2X6L A;  1W3S A;  2CQA A;  4EQP A;  3CC4 A;  4KI0 A;  3SGI A;  2Q8T A;  1RF2 D;  3BVZ A;  4JYA L;  3VR4 A;  4AQY L;  4O1N A;  4JOI C;  1UE5 A;  1VQG A;  3CCM A;  4JV5 Q;  4KKT A;  5IT9 L;  2EYH A;  2GN5 A;  3NBH A;  3EQL C;  3PSI A;  2KCN A;  4EGV A;  3H0G G;  1STN A;  3GD7 A;  2OT2 A;  1YI2 A;  1TWF H;  1PRT D;  5JJK A;  3A7A B;  3EFX D;  4TSS A;  2CWP A;  5DM6 3;  1Y1W B;  4ALP A;  4LK1 C;  3H6M A;  4JVZ A;  2IHF A;  3T1H L;  4H13 C;  1L2F A;  3JC6 6;  2K28 A;  2M2L A;  5AJ3 Q;  1CM9 A;  2PW7 A;  1IL2 A;  2CWA A;  1KRS A;  1HUM A;  1AFP A;  4LW1 A;  2CW0 C;  5C4J H;  2M9V A;  2ZTC A;  2ZXO A;  2MPM A;  1TKW B;  1OXU A;  5C44 G;  1CTM A;  2BE5 D;  3BDC A;  2BA0 A;  4C2M B;  5CR3 A;  4DR3 L;  1YNJ D;  3BYY B;  3TRE A;  1CHQ D;  1I4X A;  1N36 Q;  1HXY D;  5JEA J;  2E8G A;  3MXP A;  2F3I A;  1U4M A;  3J7A F;  4OIK A;  4HJ9 A;  5E4W C;  5C4X G;  1IBK L;  5C3E H;  1WOC A;  4JBM A;  2MJ8 A;  1DGS A;  5D14 A;  1B3A A;  1LTI D;  4HMJ A;  1I4P A;  3RMH A;  2ZXP A;  5M9O A;  2SDF A;  3L3O C;  2N49 A;  1YJW A;  1MI2 A;  3ND8 A;  5EQ0 A;  3K5N A;  4DUZ L;  1S5D D;  4AYB G;  2LKV A;  3K7A H;  2FMC A;  1CKM A;  1QZH A;  2A19 A;  1L0X B;  2NUC A;  2WAQ G;  4ZUJ A;  4A3L G;  3E9I A;  4C3I B;  5DAU A;  3A5U A;  4JI7 L;  4RWS C;  4IFD J;  5C4Z A;  3MHB A;  2F1M A;  5CMD A;  3U9S A;  2B2V A;  4LF4 Q;  4L5T A;  2EY1 A;  1OTC A;  4UY8 C;  1PMR A;  1HZA A;  4QUC A;  1YIT A;  3S15 H;  4IPH A;  2E76 C;  2Z4H A;  2F0P A;  2WII B;  3CXC A;  1WTQ A;  2N88 A;  4KY6 A;  4KY5 A;  4C3J B;  4OIJ A;  2FMM A;  1SYF A;  4B3T L;  2KVM A;  4ZKB B;  1O7L A;  2IW3 A;  2AQ3 B;  2K75 A;  3TBI B;  4FXG C;  1MBY A;  2L12 A;  4QF4 A;  1H9S A;  1DYQ A;  1SYB A;  1K83 B;  1V43 A;  2CQO A;  3LGJ A;  4X64 L;  3H3V H;  2PZT A;  1PTO C;  3H15 A;  3KLS X;  2PNR C;  1I3Q H;  1J5E L;  1NTG A;  3GTQ H;  4JG2 A;  1C8C A;  1W2B A;  1SE2 A;  1PH4 A;  3A8I E;  4B3M Q;  3HKZ G;  2F4V Q;  3PUX A;  3W1G A;  3HFZ B;  4N8F A;  3Q23 A;  4A3D H;  1VQJ A;  3IFT A;  1PH8 A;  4ABN A;  2D2C C;  2F0O A;  1V9P A;  3H09 A;  3G6E A;  2EJF C;  4DR1 Q;  3NXW A;  3CHB D;  1PVO A;  3NWS A;  2F0I A;  3U58 A;  4HSP A;  1I50 H;  3DXJ C;  1WTX A;  4FF2 A;  5FO8 B;  1SMY C;  3U4V A;  4DV2 L;  3FP9 A;  3M4P A;  3PQI A;  1SNP A;  2FJ2 A;  4JBK A;  2HCI A;  3SK5 A;  2MP1 A;  1HRJ A;  1GUW A;  3GTO H;  4BA1 I;  3EJI A;  4AYB E;  1EYD A;  1SND A;  4NXM Q;  4NXN L;  1Z6H A;  1XNQ L;  2NVY B;  1IYV A;  1V8Q A;  2VUM G;  4UHV A;  2KEN A;  1LTG D;  5A35 A;  4N9P A;  4R8N A;  1I94 L;  4K0K Q;  3NPP A;  1TQO A;  4LAA A;  1MSG A;  4NDX A;  1LTL A;  3P7J A;  3T13 A;  4AIM A;  1ONL A;  1XMQ L;  3CP0 A;  1FGB D;  5JVH 3;  1A0I A;  1K3R A;  4MN3 A;  5LL6 X;  3GQB A;  1TY2 A;  2YU9 B;  4R4C A;  3PUY A;  3KLS A;  5T1I A;  2H4O A;  5IOD A;  4YY3 Q;  4GKJ L;  3BDO A;  3HOV H;  3J81 j;  2PI2 E;  2R7Z H;  1MGS A;  4DR2 L;  3OIP A;  4P74 A;  4G4K A;  4FF1 A;  4R8I A;  2AKW B;  3I4N B;  2B2T A;  1S40 A;  3PO2 G;  3R8B A;  2NVX H;  5BN4 A;  1OXS C;  4F7X A;  1ESR A;  1U4P A;  2E2H B;  1TVX A;  2L4N A;  3NWT A;  2VB2 X;  4YCW A;  1S5E D;  3HKZ E;  1ET9 A;  5C3E B;  4BBR B;  5GAG C;  4A3I B;  1BCP F;  1PV4 A;  2IX0 A;  4PNY A;  4G7H C;  1E24 A;  1B1Z A;  4C3H G;  2UXC L;  3FPP A;  4BXX G;  3DWP A;  3QO2 A;  2B63 G;  4APV A;  4M1U B;  1QUQ B;  4CKB A;  4DUY Q;  2D9U A;  5IWA Q;  2F0V A;  2FHT A;  3K7A B;  4A3M B;  1GHJ A;  4GLV B;  2ZTE A;  3U4Z A;  2ES2 A;  1UEA B;  1VQ9 A;  4UP9 A;  2RA4 A;  1A8V A;  1Q86 C;  1VMC A;  4LMQ D;  4R4Q A;  1JE5 A;  1JCK B;  4YHH Q;  4I7Z C;  2OCE A;  1IBM Q;  2K5D A;  2HIX A;  3VDY A;  3R2I A;  1XPR A;  1K8G A;  1X65 A;  1BBW A;  1JOK A;  1VQO A;  1NMG A;  5AJ3 L;  2NN6 G;  2H1E A;  4TVA B;  4K5W A;  3LNN A;  3H91 A;  2XVS A;  1MHW C;  1DXM A;  1W6K A;  4NPS A;  2JA5 B;  4R1J A;  3D4W A;  5FLM G;  3SHL A;  1SMY D;  4CJ0 B;  4I7A A;  3OTO L;  2ICI A;  2ALY B;  3TZD A;  2G5D A;  3KBG A;  3EN2 A;  4A3C H;  4RG1 A;  4FXD A;  1N36 L;  3A54 A;  4EX5 A;  2Q8I B;  4OEM B;  2RQX A;  1K73 C;  2K32 A;  4HSV A;  4K6L A;  1JR0 D;  1X3E A;  4A3K G;  3HOW B;  2JE6 I;  3K5L A;  5C5M A;  3CC2 A;  1Y8N B;  3TS0 A;  4A3J H;  4PV1 C;  1RD9 D;  2I5M X;  4GOP A;  1HNX Q;  3GTP H;  3W3A A;  3ND9 A;  5C0X H;  4JBJ A;  2QDL A;  2DGY A;  1PA6 A;  3FMC A;  3D4R A;  3M4Q A;  4K2L A;  1HA5 A;  2L5T A;  3CU7 A;  1CK1 A;  5IP7 G;  4CKE A;  3UDF A;  1UE7 A;  4LUZ A;  4LFB Q;  1A63 A;  1QVC A;  2RF4 A;  4ODG A;  1UE6 A;  4C56 C;  5CC4 A;  4DXF A;  2F0L A;  2NTS A;  1CSP A;  2EJM A;  3HOZ G;  3QOJ A;  3HEJ A;  3I70 A;  4A76 A;  3GTO B;  2KHS A;  3B6Y A;  1B4O A;  1SFO H;  2MQH A;  2NVQ H;  2PQE A;  2JA7 H;  2Z9H A;  3J80 E;  5HUR A;  4BBS H;  4LF4 L;  3JAM c;  3A8J E;  3GTK B;  2IPK D;  1IKL A;  3TP8 A;  3G4S A;  2A68 D;  3KJP A;  4EVO A;  1EIH A;  3H94 A;  4GNX A;  3IL8 A;  3NTH A;  2JA8 G;  5KNC A;  5LMU Q;  1NCV A;  1Y8O B;  3A7L A;  1CKO A;  5E4X A;  5EBC A;  1E3P A;  4UP8 A;  2JN4 A;  4B9X A;  1U4L A;  1C48 A;  2MHV A;  3HS0 C;  3DLL A;  2R7Z B;  2K5V A;  1F2Y A;  3BYT B;  4XQJ A;  3PUV A;  1JB3 A;  1ZEQ X;  2YV5 A;  4DR5 Q;  4B3M L;  2ICE C;  2F4V L;  5IYC G;  4DN4 M;  5L37 A;  5JVG 3;  5CBE E;  1ZYR D;  4YWK A;  2VNU D;  3HOU H;  1LTT D;  5EPK A;  1FVI A;  4E6I A;  2K5H A;  5ELF A;  3TP6 A;  4Q0F A;  1EQV A;  1X3G A;  2K05 A;  3LWU A;  4DR1 L;  4HAE A;  2A69 C;  2SNM A;  4LWC A;  1ENA A;  3K58 A;  5KRU A;  3HOY H;  5K36 H;  2F0S A;  2D62 A;  4FDB A;  4J1M A;  3TRZ A;  5E7N A;  3MFG A;  1X3P A;  1NAP A;  2LXK A;  4PG3 A;  2E2D C;  1YNN C;  2EYL A;  3S1Q B;  4HJ8 A;  4A3G G;  4FVM A;  1GUO A;  3X3N A;  3F2U A;  2E75 C;  4QIW E;  1U0L A;  1SNO A;  3KBX A;  1WYD A;  2V1C C;  1LT3 D;  3AYH B;  4QIW B;  1VQH A;  2MGS A;  2R93 G;  3J81 c;  3ONA B;  3HKS A;  4K0K L;  1U4R A;  2Q2I A;  2IJ0 A;  3OMG A; 
#chains in the Genus database with same CATH homology
 4LJZ C;  1KDC A;  3HGB A;  2KOL A;  4IUR A;  1W6J A;  4V0B A;  5EGT A;  3VA7 A;  3J80 L;  2F0H A;  5E1F A;  3VR2 A;  1T5X D;  3MFY A;  5LHY 1;  4KHV A;  1D1K A;  2N55 A;  4JBW A;  1STE A;  2EVB A;  1LAB A;  1TU2 B;  3KF8 A;  4ZAI A;  2D5D A;  1PYW D;  2F0Q A;  2V4D A;  2O2L D;  4RCN A;  4A3J B;  1BCP D;  3P20 A;  2E74 C;  3OHX C;  3MXU A;  3M7N A;  3DHQ A;  3HOX B;  3PIO 3;  1PRT C;  1TS5 A;  3FVQ A;  3BS1 A;  2L0C A;  1HQR D;  3GTJ B;  3W2D A;  1I4G A;  3MEH A;  4P2C B;  1G29 1;  1QNU A;  1TWA B;  2F0D A;  4KY7 A;  2R3Z A;  5CBA E;  5IGD A;  1C4Q A;  1LLR D;  3GP7 A;  3PV0 A;  3NSW A;  2BE5 C;  5JAV A;  1TY0 A;  1QIL A;  1ILQ A;  4KK7 A;  1PDQ A;  3AMU A;  2KEE A;  5ELD A;  3ZYY X;  3OPO A;  2K33 A;  1NSN S;  4B9W A;  1PXU A;  1DON A;  1B44 D;  3K0Y A;  4Y7N B;  3VR3 A;  1ICW A;  4FF3 A;  1PRT B;  1HHV A;  4A3F B;  1KNA A;  2BCO A;  5M5Y B;  2Z4I A;  3GV3 A;  4DNR B;  1D5Z C;  4N9T A;  3T56 B;  5CGK A;  3DM1 A;  3D31 A;  2DN8 A;  1FYC A;  4C3I G;  2XIW A;  1ENF A;  4Z9C B;  1SE4 A;  4BY1 B;  2K1B A;  3I8Z A;  2JP1 A;  4KTA A;  2RDH A;  5IGE A;  1QWY A;  2KJX A;  3BG3 A;  4KHZ A;  1VDZ A;  3UI2 A;  1STY A;  2AQ1 B;  4GZY C;  4C3J G;  3MXN A;  5KND A;  4IFD I;  1QG7 A;  5I6Y A;  5M3F B;  1A3V A;  3A56 A;  5M3M B;  1A3U A;  2EZV A;  5FO9 B;  2F0J A;  3JAM E;  3RD4 A;  1BNZ A;  4NP5 A;  1F2L A;  1EY8 A;  2KCC A;  3U9O A;  2R92 B;  1HCZ A;  1MSH A;  1PTO F;  2A74 C;  1HPC A;  3SK8 A;  4OGQ C;  3R93 A;  2VXW A;  5FK9 C;  5LL6 S;  4A93 B;  3J7Y W;  3D6W A;  5EKL A;  1F9P A;  4IZ8 A;  4KN7 C;  5JOB A;  2EPB A;  1EWC A;  2QCP X;  1S5F D;  1VMP A;  5KGU A;  3WDN A;  5COR A;  4F88 A;  3NTI A;  4PMB A;  4HED A;  2ZXR A;  2AUJ D;  1DOL A;  5ISR A;  2DNE A;  1STA A;  4XDX A;  1CI3 M;  5DM7 3;  1EQT A;  4K6D A;  2NTT A;  2B2W C;  3O13 A;  3I4M B;  4HTH A;  1SYG A;  4HMI A;  5DEH A;  3K57 A;  2EJG C;  4DGZ A;  1IKM A;  3Q24 A;  3FKI B;  2PZW A;  2XN9 C;  3SK6 A;  2RSO A;  2QEJ C;  3OIQ A;  4ME5 A;  1SE3 A;  5JEA G;  3SVM A;  3Q22 A;  3R3O A;  4OL7 A;  3KUP A;  2F03 A;  3FPU B;  1TS4 A;  4IAL A;  1OXX K;  4NKL A;  1HA6 A;  1LO5 D;  1Z7T A;  2F3W A;  5A2Q E;  5IGB A;  1HFN A;  3NP8 A;  4KD4 A;  4ZUI A;  1TWH B;  3S17 B;  4CKC A;  5D3I B;  1F9R A;  4IFD G;  2LFN A;  2NBF A;  2RVL A;  2F0G A;  1UUP A;  1LT5 D;  1Q1E A;  4QMG A;  2NN6 I;  1LT4 D;  5CV7 A;  4HCE A;  2XNA C;  1BOS A;  1QE6 A;  1EEF D;  2WP8 J;  1WVL A;  1LTA D;  4F87 A;  3X3M A;  4RAU C;  5FLX E;  4IUU A;  2Z1C A;  5EKK A;  3Q6S A;  1JOQ A;  1TWF B;  2PPB C;  3D3R A;  5BN3 A;  4HN7 A;  5CV8 A;  1RTO A;  3WOF A;  2K01 A;  1ML0 D;  1ET6 A;  2QIL A;  3ITP A;  4BWG B;  2JYO A;  1CQF A;  1VF7 A;  5T1G A;  4RKB A;  5C4J B;  3OW7 A;  4KKU A;  3TP5 A;  2EYP A;  1QB5 D;  2G9H D;  4X3T A;  2C9O A;  1EY6 A;  5A2Q L;  1O80 A;  4K2K A;  1RJT A;  4L63 B;  1JWU D;  2A68 C;  1AZP A;  3H3V C;  4G7Z C;  3EA6 A;  2B8G A;  3C46 A;  3FDT A;  5CV9 A;  1NUC A;  4Q5V A;  1I4Q A;  4FXK C;  1V1P A;  4WFN 3;  1XXG A;  4BA2 I;  3IFD A;  1M8A A;  4XT1 B;  1ZYR C;  4V19 0;  1SSO A;  3GO5 A;  1JIC A;  2Y0S B;  2EYO A;  4FF4 A;  1JOO A;  3S15 B;  2B2Y C;  1AEX A;  2C5C A;  5IGF A;  2K5W A;  3NBI A;  5D3D A;  1A2T A;  2XRS D;  4L6T B;  1U9R A;  4G7O C;  5CV6 A;  2BDO A;  2X6G A;  4BS9 A;  5J1Z A;  1I3Q B;  3GTQ B;  1OXT A;  3G6J B;  1JQY D;  3K6O A;  4A3D B;  1KTK A;  4EQO A;  1QNK A;  5DNF A;  3IAY A;  3MVV A;  4TRD A;  1D2B A;  1EU4 A;  1SXT A;  1I50 B;  2LS0 1;  1WTR A;  1F2M A;  5IOC A;  1UAP A;  1HUN A;  5G3L F;  5I2X A;  5C0X J;  1ZXT A;  2DNC A;  3DWA A;  2L1B A;  2Z8L A;  1T5E A;  2OEO A;  2XWB B;  1BCP C;  4DA2 A;  2CVR A;  1G8Z D;  1RDP D;  3IKJ A;  1BQQ T;  1Q3L A;  4FP5 D;  5CV4 A;  4B08 A;  3P75 A;  5K5P A;  2X69 A;  3HOV B;  1SYD A;  5COY A;  4OO1 I;  4H44 C;  2LMC B;  1Z47 A;  3QB3 A;  1EY4 A;  5IIF A;  1PZJ D;  2KUM A;  4FNF A;  2KQ3 A;  3ERQ A;  2EY5 A;  2NVX B;  2B2V C;  1WTV A;  1O7Y A;  2HUG A;  1AN8 A;  1G2S A;  5JPN C;  2AWO A;  1H9J A;  1CZG A;  2EY6 A;  1FR3 A;  4BY7 B;  1BCP B;  3TME A;  1XWE A;  2F0E A;  2JXM B;  3KLR A;  3DMU A;  3VR5 A;  1SJE D;  3NTK A;  5F2D A;  3I3C A;  4PQX A;  1D5M C;  3MXG A;  3PIP 3;  2WKD A;  2BOS A;  1EY9 A;  4KD3 A;  1DZ1 A;  4M8A A;  1SEB D;  2F0N A;  2TMP A;  3OSO A;  1Q90 A;  1FNV A;  1IW7 C;  1LTS D;  1B50 A;  1PFM A;  2I07 B;  3GV6 A;  1S4Z A;  1H9R A;  2F0T A;  1WD0 A;  1JWS D;  1D5X C;  3QOL A;  4CBV A;  3HRZ C;  3NQT A;  3CRK C;  1H9S B;  4WRD A;  1L0Y B;  3GTP B;  3K5M A;  3P1H A;  3TP7 A;  1EYA A;  1SYE A;  2DY7 A;  3SDZ A;  3VYU A;  3QIA A;  4OO1 G;  4K8I A;  1KAB A;  1G2T A;  3T53 B;  1AW7 A;  3KK7 A;  3NQI A;  4OHJ A;  4WOR A;  1B53 A;  4ZRZ A;  3VYT A;  1DD2 A;  3GTL B;  1A3T A;  1SFO B;  1OXV A;  2NVQ B;  2B2T C;  2EE1 A;  4RHR A;  4BBS B;  2VNU D;  2JA7 B;  2RKS A;  1KDA A;  4RFB A;  5FOB B;  1K8O A;  3MWY W;  4RGT A;  5KNB A;  2KA7 A;  2I46 A;  1LTR D;  1DM0 B;  1M4V A;  3TDQ A;  5EKI A;  2IT1 A;  4KKS A;  5IT9 E;  2EDG A;  2M00 A;  2PYK A;  2NWG A;  4R9W A;  4F8M A;  4PMC A;  3A8K E;  2VB3 X;  4XQQ A;  1Q12 A;  1I6V C;  1WTP A;  3N52 A;  4XTC S;  1STB A;  3TSS A;  4X3U A;  4DK1 A;  2WV6 D;  1AZQ A;  1EIG A;  4RH6 A;  4DNT B;  3HOU B;  5ELE A;  4TQU S;  4ZK9 B;  1QCB D;  4UAI A;  3HOY B;  1CZW A;  3C3L A;  1IW7 D;  3SEB A;  4UDU C;  2QF7 A;  1BF4 A;  4L8J A;  4XYQ A;  3BVM A;  2PO4 A;  1B9M A;  2WB1 B;  3A55 A;  4MIU A;  5J39 A;  4H0L C;  3M85 A;  1KDB A;  4PMW A;  2RDF A;  3GTM B;  3I91 A;  4KJN A;  4DFA A;  2K6A A;  1A2U A;  1Q1B A;  3PUW A;  4WJW A;  1KNE A;  1Y1V B;  3T16 A;  4DAV A;  2TSS A;  1R4Q B;  1RTN A;  5IGC A;  2OXP A;  3M4O B;  4O42 A;  2K04 A;  1XTC D;  2A6E C;  1AP0 A;  2PMZ B;  1RCV D;  2IWH A;  3SR1 A;  4DAP A;  2F0F A;  2PW5 A;  2JA6 B;  4NW2 A;  2PCF B;  1PTO H;  4KJO A;  1XYI A;  1TS3 A;  2DY8 A;  3LX0 A;  5JEA H;  2IL8 A;  3S9W A;  1E2Z A;  1FNU A;  2EXZ A;  2HDM A;  3VA5 A;  1EOT A;  1Q8I A;  1R4P B;  1Y8P B;  4RCO A;  5CV5 A;  4RGM A;  1HQM C;  1SJH D;  5ELB A;  4G57 A;  2NYZ D;  5I9O A;  4A3B B;  1VCI A;  1TT2 A;  3DEP A;  3C2P A;  1FNW A;  1E2V A;  5KIX A;  4IFD H;  1HTL D;  4U67 3;  2B39 A;  2AUK A;  5M5W B;  4A3E B;  1TWG B;  3PO3 B;  3GTG B;  4ZYS A;  3T4A C;  2A73 B;  1STH A;  1II3 A;  4I65 A;  1D1I A;  1TWC B;  1F2Z A;  3J81 E;  1GUG A;  4QCL A;  3S1N B;  4DK0 A;  4XYO A;  4IUV A;  4DF7 A;  4YIJ A;  1DCZ A;  1GHK A;  3MA2 B;  2KED A;  3JAM L;  3H0G B;  4IQZ A;  4J8Q A;  3TN2 A;  4CJ2 C;  4RGO S;  3BZD B;  1ZKO A;  3HZX A;  3NK9 A;  1BO0 A;  5J22 A;  4HCS A;  1QOH A;  3MTS A;  3C1E A;  3K5O A;  5I4D A;  3E0J A;  3E6Z X;  2A6E D;  2JEA I;  3QWN A;  1NR2 A;  2K5Q A;  2WIN B;  5C44 B;  1BBX C;  3DUZ A;  3MAQ A;  3S14 B;  3DWQ A;  2KEC A;  4RHS A;  5AFW A;  1UNS A;  5FKA C;  2G9D A;  3FRP B;  1ENC A;  5E3F A;  1EFI D;  1ESF A;  2L11 A;  5C4X B;  4X3K A;  4DU9 A;  1EZ6 A;  1F9S A;  1PZI D;  1BUV T;  2CW0 D;  1JC7 A;  1EY7 A;  1EY5 A;  1XX8 A;  4JK1 C;  2EYJ A;  2PZU A;  3D4D A;  5HGT A;  1G6Z A;  5IGG A;  4AYB B;  1HFG A;  2XSC A;  2JEB I;  3BVG A;  2WAQ B;  1MD2 D;  2SNS A;  1PTO B;  1F77 A;  2B2U C;  1O78 A;  3J81 L;  3SK4 A;  1BR9 A;  2IX1 A;  4U68 A;  3D8G A;  1FD7 D;  4ILW A;  2SOB A;  1ILP A;  2EYF A;  1Y69 U;  5ELC A;  5EPL A;  2NN6 H;  1TR5 A;  1H9K A;  4XT3 B;  4X3S A;  2E2J B;  2EY2 A;  1BDO A;  3CRL C;  2AQ2 B;  1SBB B;  2XWJ B;  5BN5 A;  2NZ1 D;  2HQE A;  1IL8 A;  1CA6 A;  3HKZ B;  1K8M A;  1S5C D;  1J9O A;  5C0X I;  4IN3 A;  3SXH A;  3J7A V;  4CGY B;  1S5B D;  1JE4 A;  4KN4 C;  3M7G A;  2Q8R E;  5FLX L;  1PTO D;  3I72 A;  2F0K A;  1B9N A;  2L55 A;  3HG9 A;  2NB0 A;  3MZ5 A;  1GUS A;  5I2Y A;  4ULL A;  2B8F A;  1LV9 A;  3M3Y B;  1EYC A;  1GXD C;  1V1O A;  4IUN A;  1VF5 C;  2VUM B;  1KAA A;  4KV6 A;  4KMU C;  2QKI C;  1RKN A;  1IYU A;  1CT1 D;  1LAC A;  5KYI A;  5C4H A;  1SDF A;  4FYD A;  2RBM A;  1R9T B;  2F0M A;  3SE0 A;  3RUZ A;  3DEO A;  1LTB D;  1F9Q A;  1PZK D;  1JOR A;  4QB4 A;  3I90 A;  3L9A X;  2BDN A;  3VR6 A;  3S16 B;  2CHB D;  5C3W A;  1BXT A;  4MHE A;  3OWE B;  1I4R A;  4ID6 A;  1SNQ A;  1PLF A;  2O5J C;  1J8I A;  1RHP A;  2AWN A;  1CFM A;  2HDL A;  3PO2 B;  3Q0A A;  3OMC A;  4ZQ3 A;  4C1N K;  1KLU D;  1GUN A;  1G91 A;  3URY A;  1B2T A;  3I4L A;  4RGN A;  4C3H B;  2ID0 A;  1WTW A;  4RA8 A;  2J7Z A;  2B63 B;  2GA4 B;  4CHT B;  3S1R B;  3QJY A;  4CJ1 B;  3E5S A;  1KLG D;  1HTP A;  3D6C A;  4TKO B;  4IUP A;  1WD1 A;  2O4X A;  3PUZ A;  5C0X G;  4XIG S;  4HR7 B;  1D6E C;  5I6W A;  3VYR A;  2F3V A;  3V96 A;  1SYC A;  1X32 A;  3K59 A;  2YYZ A;  4ZLT F;  1PRT F;  2JSO A;  5D65 A;  1I4H A;  1JWM D;  5JPM C;  2B2W A;  1IHZ A;  3T51 B;  1DJR D;  3TZU A;  3AU7 A;  2F0U A;  5C5L A;  2LY7 A;  2EYM A;  3HP3 A;  2HCC A;  1NR4 A;  1EY0 A;  2R6G A;  1TS2 A;  1QJO A;  5EJW A;  4A3K B;  4H7B A;  4XXE A;  2ENB A;  2R61 A;  4IUT A;  1STG A;  2BA1 A;  1I6H B;  3LWE A;  3MC0 B;  3NHH A;  1SNM A;  4OO1 H;  3CKI B;  2A6H C;  1E0B A;  3HOZ B;  4ZKC B;  1OO9 B;  2E2I B;  3M4Y A;  2J4X A;  1SNC A;  2WAC A;  3L7Z C;  3QG1 A;  1CHP D;  2FFK B;  5K36 G;  2MUY A;  2XRQ D;  3R2T A;  3AB9 A;  3OOC A;  5C3X A;  2JA8 B;  3ERO A;  5FO7 B;  5TSS A;  1PFB A;  3CQZ B;  3BDL A;  4J6H A;  1EWH A;  1CQV A;  2FIN B;  2F4I A;  2RSN A;  3G7L A;  4EQN A;  1O7Z A;  2WKC A;  2IX3 A;  3N6R A;  1DOK A;  3RLF A;  3VYS A;  3S2D B;  1A6X A;  4DAY A;  3V05 A;  2NVT B;  1EL0 A;  3C1F A;  1DOM A;  5JJZ A;  2F0W A;  4K14 A;  3PMF A;  1EEI D;  4A3G B;  5C6A A;  2EOT A;  5KEE A;  2L9H A;  4S3S A;  2K7V A;  1LT6 D;  4DXG A;  1E2W A;  2RDG A;  1YNJ C;  2B2U A;  1TII D;  2K03 A;  2R93 B;  1GOZ A;  4NMZ A;  1ROD A;  2A69 D;  4QUF A;  1A15 A;  5I9P A;  1H9M A;  3RZD B;  3S1M B;  2J0T D;  1YNN D;  5EPJ A;  4FO2 A;  4IUQ A;  2QDB A;  5KYL A;  3I73 A;  5NUC A;  3NUC A;  1GUT A;  2A6H D;  1WTO A;  4K5V A;  3S2H B;  5G3L D;  2SEB D;  1EZ8 A;  4XQN A;  4K8J A;  5CYU A;  2OF1 A;  1WCM B;  5EBD A;  1X3Q A;  3RZO B;  2O5I C;  1PFN A;  4RKL A;  1EU3 A;  1V1P B;  2B2Y A;  3EVQ A;  3V2T A;  1SAP A;  1GJX A;  2A5H A;  4C1N I;  2ZT9 C;  1CA5 A;  3OWF A;  3WOE A;  4K5X A;  3NE5 B;  3FEW X;  5M5X B;  2X6L A;  2CQA A;  4EQP A;  4KI0 A;  2Q8T A;  1RF2 D;  3BVZ A;  3VR4 A;  4O1N A;  4KKT A;  5IT9 L;  2EYH A;  3NBH A;  3EQL C;  2KCN A;  4EGV A;  1STN A;  3GD7 A;  2OT2 A;  1PRT D;  3A7A B;  3EFX D;  4TSS A;  5DM6 3;  1Y1W B;  4LK1 C;  3H6M A;  4H13 C;  2K28 A;  2M2L A;  1CM9 A;  2PW7 A;  1HUM A;  1AFP A;  2CW0 C;  2M9V A;  2ZXO A;  2MPM A;  1TKW B;  1OXU A;  1CTM A;  2BE5 D;  3BDC A;  2BA0 A;  4C2M B;  5CR3 A;  1YNJ D;  3BYY B;  1CHQ D;  1I4X A;  1HXY D;  5JEA J;  3MXP A;  1U4M A;  3J7A F;  4OIK A;  5E4W C;  2MJ8 A;  5D14 A;  1B3A A;  1LTI D;  4HMJ A;  1I4P A;  3RMH A;  2ZXP A;  5M9O A;  2SDF A;  3L3O C;  1MI2 A;  3ND8 A;  5EQ0 A;  3K5N A;  1S5D D;  2LKV A;  2FMC A;  1L0X B;  2NUC A;  4ZUJ A;  4C3I B;  5DAU A;  4RWS C;  4IFD J;  5C4Z A;  3MHB A;  2F1M A;  5CMD A;  3U9S A;  2B2V A;  2EY1 A;  1PMR A;  4QUC A;  2E76 C;  2Z4H A;  2F0P A;  2WII B;  1WTQ A;  2N88 A;  4KY6 A;  4KY5 A;  4C3J B;  4OIJ A;  2FMM A;  1SYF A;  2KVM A;  4ZKB B;  1O7L A;  2IW3 A;  2AQ3 B;  3TBI B;  4FXG C;  1MBY A;  2L12 A;  4QF4 A;  1H9S A;  1DYQ A;  1SYB A;  1K83 B;  1V43 A;  2PZT A;  1PTO C;  3KLS X;  2PNR C;  1C8C A;  1SE2 A;  3A8I E;  3PUX A;  3Q23 A;  3IFT A;  4ABN A;  2D2C C;  2F0O A;  3H09 A;  2EJF C;  3NXW A;  3CHB D;  3NWS A;  2F0I A;  4HSP A;  1WTX A;  3DXJ C;  4FF2 A;  5FO8 B;  1SMY C;  1SNP A;  2FJ2 A;  2HCI A;  3SK5 A;  2MP1 A;  1HRJ A;  1GUW A;  4BA1 I;  3EJI A;  1EYD A;  1SND A;  1Z6H A;  2NVY B;  1IYV A;  1V8Q A;  1LTG D;  5A35 A;  4N9P A;  4R8N A;  3NPP A;  1TQO A;  4LAA A;  1MSG A;  4NDX A;  3P7J A;  3T13 A;  1ONL A;  1FGB D;  5JVH 3;  4MN3 A;  5LL6 X;  3GQB A;  1TY2 A;  2YU9 B;  3PUY A;  3KLS A;  5T1I A;  2H4O A;  5IOD A;  3BDO A;  1MGS A;  3OIP A;  4G4K A;  4FF1 A;  4R8I A;  3I4N B;  2B2T A;  3R8B A;  5BN4 A;  1OXS C;  4F7X A;  1ESR A;  1U4P A;  2E2H B;  1TVX A;  2L4N A;  3NWT A;  2VB2 X;  1S5E D;  1ET9 A;  5C3E B;  4BBR B;  4A3I B;  1BCP F;  2IX0 A;  4PNY A;  4G7H C;  1B1Z A;  4C3H G;  3FPP A;  3DWP A;  3QO2 A;  4M1U B;  4CKB A;  2D9U A;  2F0V A;  2FHT A;  3K7A B;  4A3M B;  1GHJ A;  1UEA B;  2RA4 A;  1VMC A;  4LMQ D;  1JCK B;  4I7Z C;  2K5D A;  3R2I A;  1JOK A;  2NN6 G;  2H1E A;  4K5W A;  3LNN A;  3H91 A;  2XVS A;  1W6K A;  1DXM A;  2JA5 B;  3D4W A;  3SHL A;  1SMY D;  4CJ0 B;  2ICI A;  3TZD A;  3KBG A;  4FXD A;  3A54 A;  2Q8I B;  2RQX A;  2K32 A;  4HSV A;  4K6L A;  1JR0 D;  3HOW B;  2JE6 I;  3K5L A;  5C5M A;  1Y8N B;  4PV1 C;  1RD9 D;  3W3A A;  3ND9 A;  5C0X H;  3FMC A;  3D4R A;  4K2L A;  1HA5 A;  2L5T A;  3CU7 A;  1CK1 A;  4CKE A;  4ODG A;  4C56 C;  5CC4 A;  4DXF A;  2F0L A;  2NTS A;  2EJM A;  3QOJ A;  3HEJ A;  3I70 A;  3GTO B;  2KHS A;  1B4O A;  2PQE A;  3J80 E;  5HUR A;  3A8J E;  3GTK B;  2IPK D;  1IKL A;  3TP8 A;  2A68 D;  4EVO A;  1EIH A;  3H94 A;  3IL8 A;  3NTH A;  5KNC A;  1NCV A;  1Y8O B;  3A7L A;  5E4X A;  5EBC A;  4B9X A;  1U4L A;  1C48 A;  2MHV A;  3HS0 C;  2R7Z B;  1F2Y A;  3BYT B;  4XQJ A;  3PUV A;  1JB3 A;  1ZEQ X;  2ICE C;  4DN4 M;  5JVG 3;  5CBE E;  1ZYR D;  1LTT D;  5EPK A;  4E6I A;  5ELF A;  3TP6 A;  4Q0F A;  1EQV A;  2K05 A;  3LWU A;  4HAE A;  2A69 C;  2SNM A;  1ENA A;  3K58 A;  5KRU A;  5K36 H;  2F0S A;  2D62 A;  4J1M A;  3MFG A;  1X3P A;  1NAP A;  2E2D C;  1YNN C;  2EYL A;  3S1Q B;  4FVM A;  1GUO A;  3X3N A;  3F2U A;  2E75 C;  1SNO A;  3KBX A;  1LT3 D;  4QIW B;  2MGS A;  3ONA B;  1U4R A;  2IJ0 A;  3OMG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...