2EDGA

Solution structure of the gcv_h domain from mouse glycine
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
130
structure length
130
Chain Sequence
GSSGSSGRKFTEKHEWITTEEGIGTVGISNFAQEALGDVVYCSLPEVGTKLKKQEEFGALESVKAASELYSPLSGEVTEVNEALAENPGLVNKSCYEDGWLIKMTLSDPSELDELMSEEAYEKYVKSIEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the GCV_H domain from mouse glycine
rcsb
source organism Mus musculus
molecule tags Biosynthetic protein
molecule keywords Glycine cleavage system H protein
total genus 16
structure length 130
sequence length 130
ec nomenclature
pdb deposition date 2007-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01597 GCV_H Glycine cleavage H-protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2edgA00
3CRKC 3HGBA 2A69D 4KKTA 3M7NA 2AWOA 3T51B 2EJGC 4JBWA 2B8FA 3A7AB 3L7ZC 1GJXA 4IFDG 1TU2B 4KHZA 5JEAH 4IFDH 1HPCA 3QJYA 1Y8NB 1FYCA 2O5JC 4G7OC 3I73A 1GHJA 1ZYRC 2KA7A 2R6GA 3DXJC 5K36H 1T5EA 5K36G 1Y69U 3MXUA 5BN5A 1K8OA 2PNRC 5C0XH 3PUWA 4RCNA 5C0XG 3CRLC 4PV1C 1E2ZA 4KMUC 3IFTA 2A6HC 2A68D 4DK1A 2Q8IB 1V8QA 3D4RA 4KN4C 3BG3A 2E74C 4I7ZC 3KLRA 3U9SA 4BA1I 2KCCA 2JXMB 2BA0A 1VCIA 2BE5D 1IYUA 1DCZA 2BDOA 3I72A 3VR4A 1H9KA 1VF7A 3A8JE 2A6ED 1IYVA 1H9RA 4BA2I 3T56B 1YNNC 1GUTA 2PCFB 4OGQC 2K7VA 4OO1G 2JE6I 1Y8PB 4XIGS 4H44C 2BA1A 5KNDA 2EJFC 3OOCA 5KNBA 1GUOA 2K32A 2NN6I 4JK1C 1H9MA 4LJZC 4IQZA 3VR6A 1HCZA 2AUJD 2CW0C 3MFYA 2L5TA 1BDOA 5A35A 1ZKOA 2DNEA 3PV0A 4KN7C 1Q90A 3T53B 3D31A 2LMCB 3TZUA 1EWHA 1VDZA 2EVBA 3QIAA 1OXUA 2K33A 2B8GA 1B9NA 1HTPA 3LNNA 4KKUA 1SMYC 2A69C 1H9SB 3EQLC 2QF7A 1IW7C 1Z7TA 1H9JA 1IW7D 1Q12A 5BN3A 1OXXK 4GZYC 1DXMA 1OXTA 1Z6HA 3AB9A 3I4LA 2AUKA 2D62A 2NN6G 2V4DA 4TKOB 3OPOA 3SDZA 1PMRA 1YNJC 1G291 4L8JA 3VR3A 3N6RA 2E76C 3P20A 3PUZA 2F1MA 1FR3A 1CI3M 1B9MA 3H94A 4KKSA 2JEBI 1HQMC 1Q1EA 1CFMA 1OXSC 1O7LA 1I6VC 3WDNA 4G7HC 3PUVA 3A8IE 3ND8A 1A6XA 3IKJA 3GQBA 5JEAG 2EJMA 4LK1C 2A68C 2A6HD 2JEAI 3QG1A 1H9SA 1TKWB 1QJOA 1GUNA 1GUGA 3ND9A 3SE0A 3PUXA 1E2WA 3RLFA 4G7ZC 2A6EC 3FPPA 3M4YA 4H0LC 4HR7B 1E2VA 1V43A 1ONLA 2E75C 2D5DA 2O5IC 1OXVA 2IT1A 4KI0A 5BN4A 2D2CC 2YYZA 3GD7A 1DD2A 4H13C 1GUSA 2PPBC 1O78A 3OW7A 3VR2A 3LWUA 3W3AA 4DNTB 3BDOA 1CTMA 3NE5B 4TQUS 2EDGA 4DNRB 4DK0A 5KNCA 3A7LA 3A8KE 1Y8OB 3M85A 2ZT9C 1K8MA 1Q1BA 2NN6H 4OO1H 1GHKA 1LABA 2DNCA 3PUYA 3VA7A 4XTCS 3VR5A 2DN8A 2BE5C 1LACA 3FMCA 1VF5C
chains in the Genus database with same CATH superfamily
4O2DA 5CGKA 2K14A 2Z6BA 3URYA 4B3TL 3L7ZC 1RDPD 2EE1A 4YY3Q 1GJXA 4E6IA 4K6DA 1HPCA 4KK7A 1AZQA 1PTOC 1KDCA 2JA6H 5JAVA 5JVG3 1YZ6A 2OQKA 5BN5A 4A3BB 4IFDJ 3AU7A 1LM0A 3STBC 4I7ZC 2K04A 2QDBA 2KCCA 3C1EA 3E0JA 2KOLA 2BE5D 1YJWA 3NQIA 2BDOA 3Q8DA 1I94L 4A3LG 2E2JH 1JE4A 3CC2A 2WACA 5IYCG 2WP8J 4DR7L 5IP9H 3CQZB 3K80C 1HZCA 1UE6A 3U4VA 3MXPA 4K0KQ 3NTIA 5A35A 1ZKOA 2M00A 1SR3A 1XPRA 3S1RB 3AFPA 3QIAA 1F9RA 4DXGA 1OXUA 2K33A 2JA6G 5CMDA 1PZID 1IW7C 4APVA 2HQLA 3F2UA 2K52A 3S1QB 1LUZA 3GDEA 5M5XH 4LF7Q 1BF4A 1CHQD 1EZ8A 3CCQA 2JEBI 4IUQA 1J9OA 1VQ7A 2LXKA 5M3MG 1ILPA 1PH4A 3A8IE 1WI5A 4BY1B 3I70A 4RGTA 1KRSA 1UE5A 4C3HH 5ELNA 1HNZQ 2Y0SG 2B2TA 4X62L 4DUYL 2EY5A 1S40A 1E2VA 3K0YA 2JA5G 1EQVA 3HOWH 3BJUA 1B8AA 2QEJC 3A55A 4R4TA 2H4OA 3CU7A 3Q23A 3H3VI 2L15A 2NZHA 4GKJQ 1IKMA 3UDFA 2F0VA 1CZGA 4A3MB 2N3SA 5J39A 2UUBQ 3RN5A 1PFBA 1WTVA 3E9HA 2E5LL 1DJRD 3IAYA 1HA5A 4NDXA 2JA5B 1PRTB 2DY7A 2DN8A 1I94Q 3BDLA 4FNFA 4Q0FA 4DV2L 1KAWA 2C9OA 1EY5A 1KHIA 3S17B 4BY1G 3NWTA 3U50C 2IWHA 2ZM6Q 3HOYH 1X3QA 4XXEA 4AYBE 1Q86C 1B4OA 2F0LA 4KY6A 1KDAA 4DAMA 4AQYL 4KMUC 3IFTA 3NHHA 5EKLA 1J6QA 2N49A 1V8QA 1SYBA 2MQHA 5HURA 2ICIA 5DNFA 2Q8TA 1SE8A 4ABNA 2A5HA 1PXUA 1QOHA 1YJNA 1EY6A 2EYFA 4A3LH 5J22A 4C3JH 2J4XA 2MPMA 3HOYB 4NB3A 2JE6I 1Y8PB 3S2DB 3KBGA 1IYJB 1QNUA 2WKCA 2XGTA 4DA2A 1GD7A 4IJHA 3VA5A 2UUCQ 2QEXA 4DV3L 1FD7D 1SJED 1U9RA 3TEHB 3VDYA 2QKIC 4KD4A 3GTQH 5EAYA 3G6JB 1PH5A 3I8ZA 4ZQ3A 1SMYC 2FMMA 3K6OA 5IT9L 1Z7TA 3I4MH 1FVIA 1YI2A 2WAQB 4XQNA 2RVLA 3ONAB 4GKJL 4LFBL 3SK4A 1HNXL 2C35B 3P7JA 4B3ML 1QILA 1I6VC 1QE6A 3GQBA 4IO9A 1PFMA 3DLLA 4C3HG 2YTVA 4K8IA 5EQ0A 3I4MB 3MXNA 4KY5A 3VYTA 1PVOA 1X56A 4F7XA 4ULLA 3JAMc 3GTGB 5EGTA 2N55A 1UEAB 3U9OA 2F0HA 4DGZA 1HTLD 3U4ZA 1PTOH 3T13A 2L9HA 3NTHA 4AYBB 3I4MG 4DAYB 1O7IA 2MNAA 2VZAA 2B2VC 2B63H 1Q1BA 2N88A 3L2PA 1IZ6A 2B39A 3BDCA 1ASYA 1FJGL 2K1BA 4XYQA 1K0RA 3MEFA 2EYJA 5IWAL 4JI3Q 3PO2B 1ML0D 3M7NA 1B2TA 1QZGA 1VQ6A 4DR5Q 2Y0SE 4Y52H 3FVQA 3J80E 1JJCB 3QR8A 2CHBD 1D5MC 4B9XA 4OWWB 5FJ8G 3D6CA 1M4VA 3TDQA 3SVMA 4JI0L 1BBUA 1HH2P 4K2LA 4DV3Q 2A8VA 2B63B 1SNOA 5ELEA 2R7FA 3GTLB 3RLOA 4A3MH 3KDFB 3QOLA 5C4ZA 4P2CB 2NVXH 3Q6SA 1F2YA 4V0BA 1ICFB 1Y1VB 1HNZL 3D4RA 4JI5L 4DPGA 2BOSA 1TY2A 4A3FB 4DKAC 1HZBA 3NSWA 3A74A 2VB3X 1H9KA 1XTCD 3SR1A 3HZXA 1RODA 4OGQC 2F0MA 3HP3A 3H0GH 4JBJA 1W2BA 1UE7A 1IXRA 2EJFC 4ZKBB 2NN6I 4JK1C 4DV5Q 2NB0A 2RA4A 4AIMA 4P72A 3WOEA 1EEFD 4F8MA 3CCVA 3OHXC 4YCUA 2RHSB 2Q2IA 5M3FB 2K28A 1IW7D 3V2TA 4JV5Q 2UXCL 1BBXC 1HUNA 1I3QB 1EL0A 4KHVA 5CV6A 1AZPA 4Q5VA 1MSHA 4B3TQ 4BBSB 4DK3C 2OCEA 3VR3A 1KQSA 3N6RA 3P20A 2E76C 1FL0A 4HJ5A 1FR3A 1LT6D 4LF8L 4R1JA 1S5DD 4RCOA 2A74C 3A56A 1EQRA 4JCVE 5LMNQ 1TKWB 2LXJA 4F88A 3W2DA 4EQNA 1X55A 3FRPB 2CWAA 3JAME 3C1FA 5FOBB 2WAQE 3J81L 3ZYYX 2F0PA 1SNPA 2PMZE 1VQPA 1L1OC 2C5CA 3FP9A 1NR4A 1PH3A 3PF5A 4GKKQ 3TQYA 5CYUA 3DMUA 3S1MB 3Q22A 1STGA 4KY7A 3A8KE 1Y8OB 4OO1H 1K8MA 3HFZB 5I9OA 2KVMA 5KRUA 1AH9A 1CKNB 2EY1A 2WV6D 2ZJQA 4M8AA 2RCNA 5FK9C 4LF9Q 1XMQL 1DM0B 1HNXQ 3N52A 2ATWA 1EY8A 4UHVA 4GOPB 1HR0L 4B3MQ 4GOPA 1M1KC 4R8NA 5I6WA 4QF4A 4RHRA 3KUPA 4RCNA 4DN4M 4DR1L 4LUZA 1X3FA 1B44D 2Q8IB 2ZXPA 4LAAA 2VQFL 2JA8G 4A3GH 2SNSA 4X62Q 4ZKCB 3OIPA 4NPSA 1GOZA 1EZ6A 1TWCB 2BA1A 3RZOH 1ENCA 3OOCA 4LJZC 1H9MA 5C44H 5C44G 2I07B 1RL2A 2AKWB 3J81E 2LY7A 4LFAQ 2F0DA 2UXDQ 1Y1VH 1L0YB 4MTKA 3E9IA 1HZAA 5E1FA 4A3FH 3BVGA 1OXTA 3AB9A 1S72A 2HIVA 2KECA 4JI0Q 1EOTA 1TWCH 2XRSD 2JA7H 2IL8A 1G291 3NENA 2PI2E 1TQOA 4IZ8A 1B50A 1Y1WG 3WDNA 1KDBA 1A6XA 5CV7A 1PLFA 2A6HD 3QG1A 2KHSA 1EYAA 4OXPA 3DM3A 1F2ZA 1WTHA 1ET9A 2N8NA 5FO7B 1PRTF 4QB4A 5CR3A 1D6EC 3TREA 1YHBA 5M3FH 2JA7B 1ONLA 1STYA 2D5DA 2PQAA 3Q0AA 2R92B 1STAA 2F0OA 2PO4A 3OWEB 1QVCA 2IPKD 3ER0A 3LWUA 1NUCA 1Y1VG 1TS2A 5GROA 1PV4A 1PA6A 1I4HA 4GLAC 2B63G 4OL7A 4A93B 2IX0A 2LS01 3PGZA 1TS3A 4Z9CB 1NCVA 2AWOA 2R92H 3E6ZX 4FF1A 2ZJPA 3TBIB 5JEAH 2FHTA 2RBMA 2ZTDA 3GTPB 2AHOB 1K8OA 4J15A 3PUWA 2L0CA 3J80L 1KD1C 1WTXA 1ZXTA 1XMOQ 2UUBL 3HOUB 2G9HD 4JVZA 2DUDA 2AMCB 2JK8A 3U9SA 3DWPA 2JQOA 2K03A 4GN3B 1JMCA 1PRTD 5AFWA 1BNZA 2B2UA 1G8ZD 1VF7A 1VQIA 2RCFA 1JQYD 5M5WB 1GUTA 4OO1G 1YEZA 2K4KA 3GTPH 2M2LA 4QUFA 2L55A 4ILWA 2K32A 4IQZA 4A3EB 4DR2L 1PYBA 2K05A 2PMZB 3EA6A 1VQ8A 5JPMC 1N34Q 1K8AC 2G9DA 5ISRA 4X3SA 2NVTH 2F3WA 4CJ2C 1I4PA 3K0XA 4DV6L 1DXMA 5NUCA 1GKHA 2D62A 1I6HH 2B3GA 4FXDA 2HT1A 1WJJA 4U673 4A3EH 3RZOB 3CCLA 2EY2A 1JR0D 5JEAG 2EJMA 5IYBH 4LK1C 2XWBB 5LHY1 1QJOA 1GUNA 4H02A 4X65Q 1C7YA 3CF5A 2YV5A 2CH4W 3M4YA 4H0LC 2MO1A 4NXNL 4Y7NH 5A2QE 1DD2A 4M1UB 2F0UA 1ICWA 1LT3D 3BDOA 1DOMA 4LFAL 2HDMA 4K5XA 1L2FA 3KJPA 4A75A 1JORA 2DNCA 3PUYA 3HG9A 4JI2L 4I65A 4Y7NB 1F77A 1Z9FA 2UXCQ 3RZDH 3GV6A 2R93H 4OWXB 4DR6Q 3J7AF 3MXUA 3W1GA 2Z6KA 3HOXH 4LWCA 5D3IB 4A3MG 2K5QA 1IBLQ 3S1NH 3CPFA 3D0FA 1PRTC 2B2WA 2LFNA 4MZ9A 3KFUA 3CHBD 1PH1A 4DU9A 3RZDB 2PCFB 3I2ZA 4PNYA 2XTIA 1V9PA 3NBIA 4CKBA 1NNXA 3S2HH 4IFDI 4FXKC 1LTSD 1VQ5A 3CXCA 1CA5A 2K6AA 3PV0A 1Q90A 3ERQA 2UUAQ 3UI2A 3TZUA 2EYPA 4DUYQ 1LT5D 2LKVA 3D8GA 1WD1A 4YIJA 3UDGA 4A3JG 1QCBD 3SDZA 4POFA 2IHFA 1YNJD 4L8JA 4N9PA 3S2HB 3IFDA 4KKSA 1KABA 2L12A 1HQMC 5C3XA 1EY7A 4R4IA 3SGIA 3CCEA 4G7HC 1N32Q 2NTTA 1G6ZA 3KLSA 2EQSA 5IGBA 1SYFA 2CCZA 3MVVA 1C9OA 4JI2Q 5FKAC 3F2DA 1QZHA 4B3SQ 4N8FA 5JJIA 1UUPA 1B7YB 1SE2A 1I4XA 3PUXA 2ES2A 4C3IG 1G2TA 1TT2A 5GQOA 3OTOQ 1A8VA 1EQQA 1CKNA 4RMFA 1HUMA 4JV5L 1U4RA 3ZJYC 1FGUA 3BZDB 5L37A 1I6HB 4EX5A 4IALA 3TS2A 4GN5A 3M4OB 4B9WA 4C2MH 4A3BG 1IBKL 2Z9HA 2OEOA 2NUCA 4DR3L 1N36L 3QOJA 1LABA 1MI2A 1UAPA 4A3KH 1VQ4A 3DWQA 1EYGA 5KIXA 3PIP3 3NEMA 1KXLA 1PH2A 1D7QA 4C1NI 5IY0A 2NVQH 2EJGC 3MWYW 5HGTA 5TSSA 1BO0A 2O5JC 1I50B 4J1MA 1VQBA 1ZYRC 3M4OH 1VQNA 1BUVT 4LMQD 4RGOS 3KJOA 3MTSA 3SEBA 3MZ5A 3G7LA 2JA9A 4A3KB 1E2ZA 2HUGA 1WVLA 2A6HC 2EYHA 1L0XB 2DY8A 4LFCL 3WWVA 2IHEA 4TSSA 4A4IA 1XNQQ 2E2JB 4QJFA 3RUZA 3AYHB 1ENAA 1D1KA 3TP7A 3OYYA 2PQEA 3E0EA 4R4CA 4C56C 3H6MA 5LMUL 2DJFC 1MJEA 1EYCA 1UWVA 1RIPA 2F0EA 4IJLA 2R93B 2WB1E 3CPWA 4C3IH 2VY3A 2L5TA 2WINB 1O80A 4ID6A 2E8GA 1EIYB 5AJ3Q 4B3SL 4UAIA 5JVH3 3GO5A 1CUKA 1SLJA 1W3SA 2R93G 3S1NB 2HHHQ 4EGVA 1H9SB 2HQEA 4BXXG 2NZOA 2I0QA 4DAPA 2K5VA 1KAAA 2GVAA 1A63A 1P16A 4FF2A 4MIUA 1SMXA 1PH9A 1YNJC 5H1SE 1P8LA 4A3EG 3EJIA 1U0LA 2OF1A 3HOZB 1X54A 3O13A 1EOVA 4ZRZA 3M3YH 1Y1WH 2AQ3B 3ND8A 4OELB 1NMGA 4YHHL 1YNXA 3AMUA 1QWYA 2OXPA 1FJGQ 1E3PA 3GTJB 1A2TA 3PIO3 1JOOA 2PI2A 4DR5L 1WTPA 3UDIA 1SFOB 1KLUD 1E0BA 4RA8A 3SE0A 3W5OA 2CWPA 4HIKA 2K75A 1TIID 4HR7B 4RH6A 4CJ1B 4NW2A 2F0SA 4JBKA 3I7FA 1LYLA 3GD7A 4BS9A 5BN4A 3GTMH 3BVMA 4C1NK 5D3DA 3ULJA 1CZWA 2HCIA 4DAYA 3KOJA 3MC0B 3HRZC 2NWGA 4R4QA 1RTOA 2ZT9C 2NN6H 4LFCQ 3NPPA 3RR5A 5C3EG 5A2QL 3QWNA 2EY6A 3I4NH 4QL5A 4JI4L 2BE5C 2K50A 1VQKA 3GTKH 1JB3A 4ZYSA 4OHJA 4PQXA 5I9PA 3ITPA 4DV4L 3T1YQ 4LF7L 4B3RL 1L1OA 1TR5A 2K5WA 3R3OA 1Q82C 5BR8Q 1RF2D 2PNRC 4P73A 5M9OA 3CRLC 5C0XG 2ID0A 3CCJA 2JA7G 4DK1A 2I5LX 1C8CA 5IIFA 1JWUD 2BA0A 2Z4HA 3FEWX 3VR4A 2CVRA 2QA4A 4X64Q 3S2DH 1YITA 4UDUC 4LF5Q 1ESFA 2RSNA 1BCPF 2V1CC 5JPNC 4GLXA 2RDGA 5M5YB 3HOVB 1I50H 5CBAE 1IBKQ 1DZ1A 2CW0D 3JAML 3OIQA 1S4ZA 2BDNA 3T16A 5LMNL 4KN7C 2Q8RE 4LF4Q 2LMCB 4YWKA 2UXBQ 1EWHA 2YTYA 3D4DA 4WFN3 1HTPA 1SYCA 1X3EA 4PMWA 1CQFA 1MBYA 1LTID 1Y14B 2AUKA 2NN6G 3OPOA 3HOVH 1PMRA 4JYAQ 4A3DB 3JC66 1DGSA 3C3LA 5EPKA 1GM5A 2KCNA 2NTSA 3ULLA 4BY7G 4KTAA 2R7DA 1I5FA 2MHVA 2PW7A 4BY7B 1CA6A 1NTGA 1B3AA 2PZUA 4JI1L 2D0OA 4PMCA 1Q3LA 1KRTA 3RLFA 5C4XB 2AQ1B 5JJLA 2Y0SB 2RSOA 2O2LD 4KI0A 2VS1A 2E2DC 4K8JA 5ELBA 4DNTB 1HZ9A 5ELDA 3EVQA 2ZTEA 3RLNA 3Q24A 1NJIC 3HOVG 3BS1A 2HHHL 2X6GA 5IP9G 1VQLA 3PO2H 5C4XH 4JI7Q 4FO2A 4X64L 3CRKC 2CFMA 4KKTA 1YIJA 1BVSA 4NXML 2QDLA 1OTCA 2E2IB 1EUJA 1TVXA 2EIFA 4LNQA 4IPCA 3P1HA 3GTMB 4DFAA 1WCMG 2E2HB 1LTTD 4A3FG 4BBRH 5FO9B 3CKIB 3K5MA 4JPBW 1BCPC 1PH8A 3VYSA 1BXTA 1BR9A 3BG3A 3MFGA 2IY5B 1SE4A 4YWMA 3KYHC 3HOWB 2I5MX 3H0GB 4C3JG 4IUVA 2B29A 3J80c 1IL2A 3K5NA 5FLXE 1Z47A 1VQMA 4QIWB 1SJHD 1QB5D 1BDOA 2SNMA 1HFGA 2MP1A 4G4KA 2JA5H 4O0AA 1SNDA 1UE1A 3R93A 1S5FD 1B9NA 1BQQT 2MO0A 5IE8A 4P74A 4HIOA 3KF6B 1N33Q 3NQTA 4DV4Q 4MTNA 4BBSH 1LTGD 3E5SA 2F0QA 1PHJA 1YVCA 2Z8LA 4R4OA 1H95A 2QCPX 1KL9A 5M5YH 1HA6A 1YBYA 2RDFA 1VQGA 5KEEA 1BCPD 2FFKB 4I7AA 2A68C 3CCMA 4MN3A 2F0TA 4N9TA 2KHJA 2MUYA 2ALYB 5E7NA 1Q8KA 4LUVA 2NYZD 4XT3B 5HY6A 5DAUA 1TWGB 1XNQL 2PQAB 1NBWA 2EXDA 3EBEA 1SNCA 1D5XC 2RHQB 1XYIA 3OW2A 4FXGC 3OWFA 3S1MH 5IGGA 2MJ8A 3S15H 1VS0A 4EQOA 4A93G 3CQZH 4JOIC 1CT1D 1K9MC 3GTQB 1JCKB 5AJ3L 4A3IH 3PO2G 3CD6A 4O42A 5G3LF 3VR5A 4DR4Q 4X6AH 1TWGH 3A8JE 3FKIH 4N8X1 4FVMA 4HJ9A 4RWSC 2R92G 4JYAL 2B8FA 3T4AC 1GO3E 3V05A 1EIGA 4DR7Q 3NXWA 2H1EA 2D0PA 3HOYG 1GHJA 3S15B 3HKZB 5M5XB 2KA7A 3CC4A 5K36H 4L5QA 2VL6A 5C6AA 2PYKA 1AEXA 4LF8Q 2DJGC 1PYSB 1K83B 4PV1C 2Z0SA 1V1QA 5JJZA 4A3IB 2DGYA 4J6HA 4IPHA 3BVZA 4IUPA 2EPBA 2TSSA 1MJCA 3J80i 4BWGB 2E74C 3D3RA 4CDDC 3FPUB 1N33L 3G4SA 2B2VA 1T9HA 3HKZE 5E3FA 1NSNS 1VCIA 4C3HB 2VQEL 4GOPC 2NBFA 2K7VA 1DOLA 1SYEA 4OONA 3AEVA 1X3GA 5KNBA 5C5MA 1GUOA 1I4GA 3KLWA 5EKIA 1PFNA 2CW0C 2ENBA 4YCVA 3MFYA 2E2HH 1JWMD 3H15A 3OMGA 1D8LA 2B2TC 3L0OA 3T1HL 2EVBA 1HFNA 4X65L 1PDQA 3STBD 2QILA 2RDHA 4XYOA 4JI4Q 3K59A 1Q12A 4IURA 4EVOA 1S5ED 4QGUA 4A3JH 4CDEC 1TY0A 4RGNA 1AW7A 5EKKA 4XT1B 1XMQQ 4LUOA 3S17H 4K14A 2WB1B 3DUZA 1WTQA 1K0SA 4QY7A 1ENFA 5BR8L 1S5CD 3AQQA 4IOCA 5T1IA 1X6OA 1G6PA 4K2KA 1SN8A 1WTOA 1TWAB 5M3MB 3NBHA 3QO2A 4A3JB 3EFXD 1V43A 3TP6A 2YYZA 3RN2A 1II3A 1VQAA 1MD2D 3A54A 4QUCA 3VR2A 5D14A 4K0KL 1AN8A 1TS5A 5T1GA 5KNCA 1IBLL 4A93H 2B2WC 1LTBD 1SRUA 2XNAC 1VQJA 5C3WA 2Q2HA 2KEDA 2UXBL 5C4XG 1LACA 1Q46A 3DM1A 4MNOA 3I90A 4IFDG 1K28A 4KHZA 4ME3A 1Y8NB 1MHWC 5FLMG 3E3XA 2F0WA 4KHPQ 2TMPA 2Q2TA 1F2LA 1B3QA 3H09A 4KN4C 1SE3A 5EPLA 4BA1I 1WD0A 4JBMA 1JC7A 1GUWA 4JW0A 1SNMA 3TZDA 3RD4A 3I72A 4A3GG 2KENA 3SK6A 4X3UA 3TS0A 5DM73 1J5EL 4JI6L 2ICEC 1EWCA 1PTOF 1PFSA 4KV6A 4OO1I 2F0NA 1LO5D 3UE0A 1HR0Q 4CDFC 2N78A 4DUZQ 1K3RA 3K5OA 2OT2A 2RQXA 4P75A 1E22A 4UP7A 5IT9E 1DYQA 4L6TB 3HEJA 3HKSA 3CMAA 1Q7YC 3EQLC 4DV2Q 3HKZG 3NP8A 1STHA 3G6EA 1HHVA 1B1ZA 1TXYA 1PZJD 1RJTA 1MKHA 2VQFQ 1KNAA 2IX1A 4DV1Q 3A0JA 4P71A 2KEEA 2F1MA 4FP5D 1U5KA 4QCLA 4A76A 1G51A 1HJPA 4HMIA 1N36Q 5COYA 3PIPA 1D2BA 1JE5A 4BY1H 1G91A 4JI3L 3K7UC 5IWAQ 2F0KA 3KBXA 5C4JB 4L5TA 3S9WA 1CKMA 3ND9A 3OSOA 2F0GA 4BBRG 5LL6X 1FNVA 1STBA 2B2YA 2O5IC 1FGBD 3J7YW 4RG1A 4H13C 1GXDC 2R7ZG 2I5HA 3W3AA 2WIIB 4WORA 3EIVA 4UP8A 5D65A 4B08A 1JB7A 4IPDA 4DK0A 3KLSX 2CQAA 5IODA 3A7LA 1D1IA 1HR0W 2CQOA 5IGEA 4OX9Q 1GHKA 1A3UA 3VA7A 3CCRA 4CKEA 4IOAA 3FMCA 3MEHA 1TWAH 4XQJA 5M3MH 3A7AB 2EYOA 4OEMB 2NZ1D 1TU2B 3DHQA 3P75A 1I3QH 1FYCA 2F3VA 5IGCA 2HIXA 2X69A 3HOUG 3DXJC 4OIJA 1VQHA 1T5EA 5DM63 2F3IA 1QUQA 3F2BA 2JJQA 5DEHA 1STEA 2A68D 2KCMA 5CV9A 3KLRA 1STNA 2WFWA 5CV8A 2R7ZB 1XPOA 3PCOB 4NMZA 1IYUA 3I3CA 1YNND 5IYBG 3BZCA 2WAQG 4YY3L 3D4WA 1EFID 3H0GG 4JI8L 2PW5A 4C3JB 4H44C 1WFQA 1RCVD 5F2DA 3K58A 1DONA 1SXTA 1W6JA 1EY0A 1CQVA 2DNEA 1A0IA 5HGQA 3IL8A 2A73B 3D31A 2R7ZH 1XMOL 1L1OB 2B8GA 2B2UC 3B6YA 1U4LA 3EN2A 2A69C 4CHTB 2NVYH 2QF7A 1NY4A 1MIUA 1WCMB 4UY8C 3KF6A 2P5ZX 1Z6HA 1E7ZA 3DEPA 4A3KG 1EU3A 2VUMB 4GKKL 1A2UA 2SDFA 4QMGA 1CI3M 1DOKA 4FDBA 1OXSC 4IPGA 1RTNA 2ZXRA 3IKJA 3UE1A 1Q8IA 2J0TD 3S14B 1JOQA 1YHQA 3L3OC 1CSPA 3H3VC 1WCMH 3BZKA 2OTJA 1GUGA 5FLMH 2F52A 2HCCA 1E2WA 4HJ7A 2VB2X 1FNUA 2XWJB 5LMNW 4LF6L 4A3GB 2VUMH 3G71A 3GTGH 5GAEC 4CBVA 3X3MA 1O78A 4U68A 1T5XD 2F4IA 2QGQA 4C2MB 1CTMA 4DNRB 1PTOB 4DV0Q 1BCPB 5C44B 3S14H 2PZTA 1EY9A 4OWTB 3H91A 1CK1A 1S5BD 1XJVA 1WOCA 3I4NG 3OMCA 3F2CA 3FKIG 2KUMA 2A69D 5C4JH 2I46A 1KIXA 1F9PA 1WYDA 4JI8Q 4A3DG 3CP0A 5EBDA 1CM9A 1SSOA 5EPJA 1BKBA 3I73A 1AE2A 1S3OA 4X3TA 5LL6S 4KJOA 1XXGA 5KGUA 1Y69U 4XDXA 4R9WA 3J81i 2A1AA 1VQDA 3PO3B 3X3NA 2UU9Q 3NELA 3M9BA 2UXDL 2LSSA 1XTDA 3LX0A 2E5LQ 2CH4A 3GTLH 1B53A 2NVXB 4F87A 1X9NA 4XQQA 2JXMB 4DR4L 5ELOA 3CW2C 3CCSA 1E1TA 3W1BA 4WRDA 3OTOL 2R3ZA 1AFPA 3NK9A 2X6LA 4DV7L 4IN3A 3PO3G 3PO3H 3D6WA 1JOKA 2F0JA 1F2MA 1NMFA 3G48A 3K7AB 3SK8A 5JEAJ 3K5LA 2FJ2A 1U4PA 2Z1CA 1HNWQ 1HXYD 1EFWA 3RNUA 1QVFA 3S16H 1N8RC 2AQ2B 2EYMA 4KKUA 4X66Q 4HCSA 4AH6A 2PZWA 5EBCA 4BXXH 1H9JA 4K5VA 3SHLA 3I4LA 3NTKA 2ZTCA 5IGFA 2V4DA 4TRDA 2WKDA 2VW9A 5IP7H 1L0WA 1SYDA 4GLVB 1YHAA 4A3CG 3M3YB 2MFIA 4DV0L 1K3BC 3BU2A 1Q1EA 1CFMA 1IBMQ 4HN7A 4DR1Q 3PUVA 2FINB 2YTXA 5C3EB 3GTJH 1M90C 3I55A 4JOIA 1JICA 1SFOH 4WJ4A 4GNXA 2XIWA 3HOUH 1R4QB 3FHWA 3T1HQ 4NXMQ 2H5XA 3J7ZC 3TMEA 2PNHA 4G7ZC 2BH2A 4ZK9B 2IW3A 3RMHA 2NVYB 5M3FG 2M9VA 1OXVA 1J8IA 1RKNA 3A5UA 4HAEA 4IUNA 5M5WH 1V1PB 4S3SA 2Q2UA 4CJ0B 1U4MA 4LFBQ 4TVAB 1JJGA 2UU9L 1LT4D 4DF7A 1E24A 4HIMA 1SDFA 1KLGD 4DAVA 1KNEA 3GTKB 5CORA 3CC7A 4EQPA 1VMCA 3HGBA 2KBNA 1XPUA 4RAUC 3M4QA 4ZCKA 4GN4B 1HQRD 3QJYA 3CAMA 4G7OC 4DV1L 1CKOA 3F8TA 2R6GA 3S24A 2KCTA 3TN2A 3M7GA 5IOCA 3TRZA 5C0XH 3U58A 1N34L 3MA2B 1LTLA 4FF4A 4MHEA 1SBBB 4X66L 3DEOA 1X3PA 2F0FA 1XX8A 3GP7A 1W6KA 2A6ED 2SOBA 1VMPA 1H9RA 4PZ7A 3ICEA 3T56B 4HCEA 1YNNC 1CHPD 1O7YA 2BCOA 3FDTA 3K57A 2FXQA 3C2PA 2JP1A 1IBML 1PH7A 3PSIA 3R8BA 3VR6A 4CKCA 3HS0C 1SNQA 4PG3A 1G2SA 5KYIA 4R8IA 1FNWA 1LTAD 4ODGA 3I91A 2XVSA 2GA4B 4QQBX 1PH6A 2KJXA 1A62A 2ZXOA 1NE3A 3KF8A 2NVQB 1JJ2A 1I4RA 4YWLA 5BN3A 1M8AA 2ASBA 5K5PA 4TKOB 1TWFB 1J5EQ 4JI6Q 3J7AV 2B2YC 3PUZA 3PF4A 1PTOD 2RKSA 1B9MA 3H94A 2K5NA 3J7A5 4BY7H 3T1YL 2IX3A 2CKZB 4HJ8A 4UPAA 4B3RQ 3F1ZA 3K81C 4RFBA 1EEID 1LLRD 3K7AH 4DUZL 3HOXB 5IYCH 1C48A 3BYTB 2D9UA 1KTKA 2ZJRA 1RD9D 1D5ZC 4O1NA 2FMCA 3S16B 1OO9B 3J81j 1TWFH 2E75C 3HOWG 2IT1A 5EJWA 2D2CC 1KC8C 4HEDA 1ZEQX 2XRQD 2G5DA 4RKLA 4L63B 4LF5L 4DR6L 3VYRA 3NUCA 4C3IB 1ZYRD 3M4PA 5ELCA 1JWSD 5CV5A 4X3KA 1GVPA 2XSCA 1CSQA 5I4DA 1EU4A 5C0XJ 5C3EH 2KHIA 5CBEE 2R61A 2BH8A 2AWNA 2VQEQ 5FLXc 1C0AA 5CV4A 1QNKA 3J81c 1VQFA 1SEBD 3T51B 3PIOA 2E2IH 1EIHA 4JBWA 1R9TH 1K8GA 4RKBA 1ILQA 3HOZH 3BYYB 3LWEA 3MHBA 2OQ0A 2VXWA 5J1ZA 1Y1WB 2UUCL 4NP5A 4GS3A 5K36G 2HDLA 2UUAL 3TP8A 4OX9L 4RHSA 1A3VA 1O7ZA 1MGSA 1R9TB 4NXNQ 2JA8H 1IYVA 5GAHC 1JT8A 1C4QA 3PMFA 4LF9L 2L1BA 4XIGS 4HMJA 3MXGA 1V1OA 4CDCC 2L4NA 5C4HA 5IT9c 3VYUA 1HCZA 2AUJD 2EYLA 4K6LA 2EOTA 5I6YA 3I4NB 3T53B 1IKLA 1SROA 1XNRQ 3LNNA 2JA8B 5FLXL 2EXZA 4JG2A 2NVTB 5IYDG 5IYDH 1X32A 3A5ZB 4DXFA 1VQEA 2ZM6L 1F9QA 4G57A 5ELFA 5E4XA 4EQ5A 3ULPA 4A3CH 1IL8A 4DNIA 3CCUA 4GNXB 4DR3Q 1O7LA 4AQYQ 5JOBA 4L5RC 3GTOH 1TWHB 4LW1A 4PZ8A 1SAPA 2RF4A 2K01A 1QVGA 1K73C 4ME5A 3UDXA 4LF4L 3V96A 2SEBD 2GN5A 3SK5A 1EQTA 1LTRD 4V190 3FPPA 2VNUD 4J8QA 3R2IA 2VUMG 3CMEA 1F9SA 2JA6B 2F03A 4YCWA 2YU9H 1IHZA 4POGA 1NAPA 3NE5B 4PMBA 2EDGA 4DK6C 2F4VL 1E1OA 4KHPL 4DV7Q 4A3BH 1AE3A 2WB1G 2OTLA 1N9WA 2O4XA 4ZUJA 4JI5Q 4DR2Q 1MSGA 4K5WA 1VQOA 3FKIB 1VQCA 4IUTA 4XTCS 5KYLA 4FYDA 5GAGC 3I56A 3AFQA 4QIWE 1PYWD 4JI1Q 4KLKA 1SMYD 4L5SA 3NBHB 2JSOA 4A3DH 5LMUQ 4IFDH 3SXHA 2YU9B 4DV6Q 3K8AA 1QUQB 4LF6Q 5DLQE 2QW7A 3KF8B 4DV5L 1PZKD 5I2XA 1N32L 1K83H 3HOXG 1LV9A 3S1RH 1WTRA 3KDFA 3R2TA 4KD3A 4BBSG 4HSVA 1XWEA 1XNRL 1B70B 5GADC 1A15A 3EROA 4IUUA 3C46A 3H3VH 2Z6KC 4HJAA 1UNSA 3I4OA 4ZAIA 1DCZA 2IJ0A 2JN4A 4JI7L 3S1QH 3LGJA 1AP0A 2Z4IA 4ZUIA 4BA2I 1R4PB 4OIKA 5CC4A 1ET6A 1RHPA 4FF3A 4A3IG 3DWAA 1BBWA 5KNDA 4WJ3M 1I4QA 4YHHQ 3PQIA 1Q81C 1EWIA 2GVBA 3JAMi 4H7BA 3GV3A 5FJ8H 1VDZA 3HOZG 3TSSA 4WJWA 2L11A 5E4WC 5J3BA 1QG7A 1EYDA 2XN9C 2A19A 1TS4A 5JJKA 1YJ9A 1OXXK 4PZ6A 5C0XI 2MGSA 3TP5A 2K5HA 4GZYC 3MAQA 2OWOA 3NWSA 3QB3A 5IP7G 1A3TA 4UP9A 3MXNB 5G3LD 2EZVA 2F4VQ 3KK7A 4BBRB 1EIFA 5I2YA 4GNXC 3ERSX 2K5DA 4HTHA 1X65A 2J7ZA 2JEAI 1H9SA 5IGDA 1HNWL 2JYOA 2HD3A 4NKLA 2A6EC 4CGYB 1UEBA 4JC0A 1BOSA 1EY4A 3IRBA 1GUSA 2PPBC 5FO8B 3OW7A 1NR2A 4AYBG 1HRJA 4TQUS 1ASZA 4ZLTF 3L9AX 1VQ9A 5C5LA 1ESRA 3M85A 2KQ3A 1V1PA 3GTOB 1TWHH 1WTWA 4RGMA 4ALPA 4HSPA 4HIDA 4KJNA 3WOFA 1SYGA 2F0IA 1VF5C
chains in the Genus database with same CATH topology
5CGKA 3URYA 1GJXA 3L7ZC 1RDPD 2EE1A 4E6IA 4K6DA 1HPCA 4KK7A 1AZQA 1PTOC 1KDCA 5JAVA 5JVG3 5BN5A 4A3BB 4IFDJ 3AU7A 4I7ZC 2K04A 2QDBA 2KCCA 3C1EA 3E0JA 2KOLA 2BE5D 3NQIA 2BDOA 1JE4A 2WACA 2WP8J 3CQZB 3MXPA 3NTIA 5A35A 1ZKOA 2M00A 3S1RB 3QIAA 1F9RA 4DXGA 1OXUA 2K33A 5CMDA 1PZID 1IW7C 3F2UA 3S1QB 1BF4A 1CHQD 1EZ8A 2JEBI 4IUQA 1J9OA 1ILPA 3A8IE 4BY1B 3I70A 4RGTA 2B2TA 2EY5A 1E2VA 3K0YA 1EQVA 2QEJC 3A55A 2H4OA 3CU7A 3Q23A 1IKMA 2F0VA 1CZGA 4A3MB 5J39A 1WTVA 1PFBA 3IAYA 1DJRD 1HA5A 4NDXA 2JA5B 1PRTB 2DY7A 2DN8A 3BDLA 4FNFA 4Q0FA 2C9OA 1EY5A 3S17B 3NWTA 2IWHA 1X3QA 4XXEA 1B4OA 2F0LA 4KY6A 1KDAA 4KMUC 3IFTA 3NHHA 5EKLA 1V8QA 1SYBA 5HURA 2ICIA 5DNFA 2Q8TA 4ABNA 2A5HA 1PXUA 1QOHA 1EY6A 2EYFA 5J22A 2J4XA 3HOYB 2MPMA 2JE6I 1Y8PB 3S2DB 3KBGA 1QNUA 2WKCA 4DA2A 3VA5A 1FD7D 1SJED 1U9RA 2QKIC 4KD4A 3G6JB 3I8ZA 4ZQ3A 1SMYC 2FMMA 3K6OA 5IT9L 1Z7TA 2WAQB 4XQNA 2RVLA 3ONAB 3SK4A 3P7JA 1QILA 1I6VC 1QE6A 3GQBA 1PFMA 4C3HG 3I4MB 4K8IA 5EQ0A 3MXNA 4KY5A 3VYTA 4F7XA 4ULLA 3GTGB 5EGTA 2N55A 1UEAB 3U9OA 2F0HA 4DGZA 1HTLD 1PTOH 3T13A 2L9HA 3NTHA 4AYBB 2B2VC 1Q1BA 2N88A 2B39A 3BDCA 2K1BA 4XYQA 2EYJA 3PO2B 1ML0D 3M7NA 1B2TA 3FVQA 3J80E 2CHBD 1D5MC 4B9XA 3D6CA 1M4VA 3TDQA 3SVMA 4K2LA 2B63B 1SNOA 5ELEA 3GTLB 5C4ZA 3QOLA 4P2CB 3Q6SA 1F2YA 4V0BA 1Y1VB 3D4RA 2BOSA 1TY2A 4A3FB 3NSWA 2VB3X 1H9KA 1XTCD 3SR1A 3HZXA 1RODA 4OGQC 2F0MA 3HP3A 2EJFC 4ZKBB 2NN6I 4JK1C 2NB0A 2RA4A 3WOEA 1EEFD 4F8MA 3OHXC 5M3FB 2K28A 1IW7D 3V2TA 1BBXC 1HUNA 1I3QB 1EL0A 4KHVA 5CV6A 1AZPA 4Q5VA 1MSHA 4BBSB 3VR3A 3N6RA 2E76C 3P20A 1FR3A 1LT6D 1S5DD 4RCOA 2A74C 3A56A 1TKWB 4F88A 3W2DA 4EQNA 3FRPB 3JAME 3C1FA 5FOBB 3J81L 3ZYYX 2F0PA 1SNPA 2C5CA 1NR4A 5CYUA 3DMUA 3S1MB 3Q22A 1STGA 4KY7A 3A8KE 1Y8OB 4OO1H 1K8MA 5I9OA 2KVMA 5KRUA 2EY1A 2WV6D 4M8AA 5FK9C 1DM0B 3N52A 1EY8A 4R8NA 5I6WA 4QF4A 4RHRA 3KUPA 4RCNA 4DN4M 1B44D 2Q8IB 2ZXPA 4LAAA 2SNSA 4ZKCB 3OIPA 1GOZA 1EZ6A 1TWCB 2BA1A 1ENCA 3OOCA 4LJZC 1H9MA 2I07B 3J81E 2LY7A 2F0DA 1L0YB 5E1FA 3BVGA 1OXTA 3AB9A 2KECA 1EOTA 2XRSD 2IL8A 1G291 1TQOA 4IZ8A 1B50A 3WDNA 1KDBA 1A6XA 5CV7A 1PLFA 2A6HD 3QG1A 2KHSA 1EYAA 1F2ZA 1ET9A 5FO7B 1PRTF 4QB4A 5CR3A 1D6EC 2JA7B 1ONLA 1STYA 2D5DA 3Q0AA 2R92B 1STAA 2F0OA 2PO4A 3OWEB 2IPKD 3LWUA 1NUCA 1TS2A 1I4HA 4OL7A 4A93B 2IX0A 2LS01 1TS3A 4Z9CB 1NCVA 2AWOA 3E6ZX 4FF1A 3TBIB 5JEAH 2FHTA 2RBMA 3GTPB 1K8OA 3PUWA 2L0CA 3J80L 1WTXA 1ZXTA 3HOUB 2G9HD 3U9SA 3DWPA 2K03A 1PRTD 5AFWA 1BNZA 2B2UA 1G8ZD 1VF7A 5M5WB 1JQYD 1GUTA 4OO1G 2M2LA 4QUFA 2L55A 4ILWA 2K32A 4IQZA 4A3EB 2K05A 2PMZB 3EA6A 5JPMC 2G9DA 5ISRA 4X3SA 2F3WA 4CJ2C 1I4PA 1DXMA 5NUCA 2D62A 4FXDA 4U673 3RZOB 2EY2A 1JR0D 5JEAG 2EJMA 4LK1C 2XWBB 5LHY1 1QJOA 1GUNA 3M4YA 4H0LC 5A2QE 1DD2A 4M1UB 2F0UA 1ICWA 1LT3D 3BDOA 1DOMA 2HDMA 4K5XA 1JORA 2DNCA 3PUYA 3HG9A 4I65A 4Y7NB 1F77A 3GV6A 3J7AF 3MXUA 5D3IB 2K5QA 1PRTC 2B2WA 2LFNA 3CHBD 4DU9A 3RZDB 2PCFB 4PNYA 3NBIA 4CKBA 4IFDI 4FXKC 1LTSD 1CA5A 2K6AA 3PV0A 1Q90A 3ERQA 3UI2A 3TZUA 2EYPA 1LT5D 2LKVA 3D8GA 1WD1A 4YIJA 1QCBD 3SDZA 1YNJD 4L8JA 4N9PA 3S2HB 3IFDA 4KKSA 1KABA 2L12A 1HQMC 5C3XA 1EY7A 4G7HC 2NTTA 1G6ZA 3KLSA 5IGBA 1SYFA 3MVVA 5FKAC 1UUPA 1SE2A 1I4XA 3PUXA 4C3IG 1G2TA 1TT2A 1HUMA 1U4RA 3BZDB 1I6HB 4IALA 3M4OB 4B9WA 2OEOA 2NUCA 3QOJA 1LABA 1MI2A 1UAPA 3DWQA 5KIXA 3PIP3 4C1NI 2EJGC 3MWYW 5HGTA 5TSSA 1BO0A 2O5JC 1I50B 4J1MA 1ZYRC 1BUVT 4LMQD 4RGOS 3MTSA 3SEBA 3MZ5A 3G7LA 4A3KB 1E2ZA 2HUGA 1WVLA 2A6HC 2EYHA 1L0XB 2DY8A 4TSSA 2E2JB 3RUZA 3TP7A 1ENAA 1D1KA 2PQEA 4C56C 3H6MA 1EYCA 2F0EA 2R93B 2L5TA 2WINB 1O80A 4ID6A 4UAIA 5JVH3 3GO5A 3S1NB 4EGVA 1H9SB 2HQEA 4DAPA 1KAAA 4FF2A 4MIUA 1YNJC 3EJIA 2OF1A 3HOZB 3O13A 4ZRZA 2AQ3B 3ND8A 3AMUA 1QWYA 2OXPA 3GTJB 3PIO3 1A2TA 1JOOA 1WTPA 1SFOB 1KLUD 1E0BA 4RA8A 3SE0A 1TIID 4HR7B 4RH6A 4CJ1B 4NW2A 2F0SA 5BN4A 3GD7A 4BS9A 3BVMA 4C1NK 5D3DA 1CZWA 2HCIA 4DAYA 3MC0B 3HRZC 2NWGA 1RTOA 2ZT9C 2NN6H 3NPPA 5A2QL 3QWNA 2EY6A 2BE5C 1JB3A 4ZYSA 4OHJA 4PQXA 5I9PA 3ITPA 1TR5A 2K5WA 3R3OA 1RF2D 2PNRC 5C0XG 5M9OA 3CRLC 2ID0A 4DK1A 1C8CA 5IIFA 1JWUD 2BA0A 2Z4HA 3FEWX 3VR4A 2CVRA 4UDUC 1ESFA 2RSNA 1BCPF 5JPNC 2RDGA 5M5YB 3HOVB 5CBAE 1DZ1A 2CW0D 3JAML 3OIQA 1S4ZA 2BDNA 3T16A 4KN7C 2Q8RE 2LMCB 1EWHA 4WFN3 3D4DA 1HTPA 1SYCA 4PMWA 1CQFA 1MBYA 1LTID 2AUKA 2NN6G 3OPOA 1PMRA 4A3DB 3C3LA 5EPKA 2KCNA 2NTSA 4KTAA 2MHVA 2PW7A 4BY7B 1CA6A 1B3AA 2PZUA 4PMCA 1Q3LA 3RLFA 5C4XB 2AQ1B 2Y0SB 2RSOA 2O2LD 4KI0A 2E2DC 4K8JA 5ELBA 4DNTB 5ELDA 3EVQA 3Q24A 3BS1A 2X6GA 4FO2A 3CRKC 4KKTA 2E2IB 1TVXA 3P1HA 3GTMB 4DFAA 2E2HB 1LTTD 5FO9B 3CKIB 3K5MA 1BCPC 3VYSA 1BXTA 1BR9A 3BG3A 3MFGA 1SE4A 3HOWB 3H0GB 4C3JG 4IUVA 3K5NA 5FLXE 1Z47A 4QIWB 1SJHD 1QB5D 1BDOA 2SNMA 1HFGA 2MP1A 4G4KA 1SNDA 3R93A 1S5FD 1B9NA 1BQQT 3NQTA 1LTGD 3E5SA 2F0QA 2Z8LA 2QCPX 1HA6A 2RDFA 5KEEA 1BCPD 2FFKB 2A68C 4MN3A 2F0TA 4N9TA 2MUYA 2NYZD 4XT3B 5DAUA 1TWGB 1SNCA 1D5XC 1XYIA 4FXGC 3OWFA 5IGGA 2MJ8A 4EQOA 1CT1D 3GTQB 1JCKB 4O42A 5G3LF 3VR5A 3A8JE 4FVMA 4RWSC 2B8FA 3T4AC 3V05A 1EIGA 3NXWA 2H1EA 1GHJA 3S15B 3HKZB 5M5XB 2KA7A 5K36H 5C6AA 2PYKA 1AEXA 1K83B 4PV1C 5JJZA 4A3IB 4J6HA 3BVZA 4IUPA 2EPBA 2TSSA 4BWGB 2E74C 3D3RA 3FPUB 2B2VA 5E3FA 1NSNS 1VCIA 4C3HB 2NBFA 2K7VA 1DOLA 1SYEA 5KNBA 5C5MA 1GUOA 1I4GA 5EKIA 1PFNA 2CW0C 2ENBA 3MFYA 1JWMD 3OMGA 2B2TC 2EVBA 1HFNA 1PDQA 2QILA 2RDHA 4XYOA 3K59A 1Q12A 4IURA 4EVOA 1S5ED 1TY0A 4RGNA 1AW7A 5EKKA 4XT1B 4K14A 2WB1B 3DUZA 1WTQA 1ENFA 1S5CD 5T1IA 4K2KA 1WTOA 1TWAB 5M3MB 3NBHA 3QO2A 4A3JB 3EFXD 1V43A 3TP6A 2YYZA 1II3A 1MD2D 3A54A 4QUCA 3VR2A 5D14A 1AN8A 1TS5A 5T1GA 5KNCA 2B2WC 1LTBD 2XNAC 5C3WA 2KEDA 1LACA 3DM1A 3I90A 4IFDG 4KHZA 1Y8NB 2F0WA 2TMPA 1F2LA 3H09A 4KN4C 1SE3A 5EPLA 4BA1I 1WD0A 1JC7A 1GUWA 1SNMA 3TZDA 3RD4A 3I72A 3SK6A 4X3UA 5DM73 2ICEC 1EWCA 1PTOF 4KV6A 4OO1I 2F0NA 1LO5D 3K5OA 2OT2A 2RQXA 5IT9E 1DYQA 4L6TB 3HEJA 3EQLC 1HHVA 3NP8A 1STHA 1B1ZA 1PZJD 1RJTA 1KNAA 2IX1A 2KEEA 2F1MA 4FP5D 4QCLA 4HMIA 5COYA 1D2BA 1G91A 2F0KA 3KBXA 5C4JB 3S9WA 3ND9A 3OSOA 2F0GA 5LL6X 1FNVA 1STBA 2B2YA 2O5IC 1FGBD 3J7YW 4H13C 1GXDC 3W3AA 2WIIB 4WORA 5D65A 4B08A 4DK0A 3KLSX 5IODA 2CQAA 3A7LA 1D1IA 5IGEA 1GHKA 1A3UA 3VA7A 4CKEA 3FMCA 3MEHA 4XQJA 3A7AB 2EYOA 2NZ1D 1TU2B 3DHQA 3P75A 1FYCA 2F3VA 5IGCA 2X69A 3DXJC 4OIJA 1T5EA 5DM63 5DEHA 1STEA 2A68D 5CV9A 3KLRA 1STNA 5CV8A 2R7ZB 4NMZA 1IYUA 3I3CA 1YNND 3D4WA 1EFID 4C3JB 2PW5A 4H44C 1RCVD 3K58A 5F2DA 1DONA 1SXTA 1W6JA 1EY0A 1CQVA 2DNEA 3IL8A 2A73B 3D31A 2B8GA 2B2UC 1U4LA 2A69C 4CHTB 2QF7A 1WCMB 1Z6HA 3DEPA 1EU3A 2VUMB 1A2UA 2SDFA 4QMGA 1CI3M 1DOKA 1OXSC 1RTNA 2ZXRA 3IKJA 1Q8IA 2J0TD 3S14B 1JOQA 3L3OC 3H3VC 1GUGA 2HCCA 1E2WA 2VB2X 1FNUA 2XWJB 4A3GB 4CBVA 3X3MA 1O78A 4U68A 1T5XD 2F4IA 4C2MB 1CTMA 4DNRB 1PTOB 1BCPB 5C44B 2PZTA 1EY9A 3H91A 1CK1A 1S5BD 3OMCA 2KUMA 2A69D 2I46A 1F9PA 5EBDA 1CM9A 1SSOA 5EPJA 3I73A 4X3TA 5LL6S 4KJOA 1XXGA 5KGUA 1Y69U 4XDXA 4R9WA 3PO3B 3X3NA 3LX0A 1B53A 2NVXB 4F87A 4XQQA 2JXMB 4WRDA 2R3ZA 1AFPA 3NK9A 2X6LA 4IN3A 3D6WA 1JOKA 2F0JA 1F2MA 3K7AB 5JEAJ 3SK8A 3K5LA 2FJ2A 1U4PA 2Z1CA 1HXYD 2AQ2B 2EYMA 4KKUA 4HCSA 2PZWA 5EBCA 1H9JA 4K5VA 3SHLA 3I4LA 3NTKA 5IGFA 2V4DA 4TRDA 2WKDA 1SYDA 3M3YB 1Q1EA 1CFMA 4HN7A 3PUVA 2FINB 5C3EB 1JICA 2XIWA 1R4QB 3TMEA 4G7ZC 4ZK9B 2IW3A 3RMHA 2NVYB 2M9VA 1OXVA 1J8IA 1RKNA 4HAEA 4IUNA 1V1PB 4S3SA 4CJ0B 1U4MA 1LT4D 4DF7A 1SDFA 1KLGD 4DAVA 1KNEA 3GTKB 5CORA 4EQPA 1VMCA 3HGBA 4RAUC 1HQRD 3QJYA 4G7OC 2R6GA 3TN2A 3M7GA 5IOCA 5C0XH 3MA2B 4FF4A 4MHEA 1SBBB 3DEOA 1X3PA 2F0FA 1XX8A 3GP7A 1W6KA 2A6ED 2SOBA 1VMPA 1H9RA 3T56B 4HCEA 1YNNC 1CHPD 1O7YA 2BCOA 3FDTA 3K57A 3C2PA 2JP1A 3R8BA 3VR6A 4CKCA 3HS0C 1SNQA 1G2SA 5KYIA 4R8IA 1FNWA 1LTAD 4ODGA 3I91A 2XVSA 2GA4B 2KJXA 2ZXOA 3KF8A 2NVQB 1I4RA 5BN3A 1M8AA 5K5PA 4TKOB 1TWFB 3J7AV 2B2YC 3PUZA 1PTOD 2RKSA 1B9MA 3H94A 2IX3A 4RFBA 1EEID 1LLRD 3HOXB 1C48A 3BYTB 2D9UA 1KTKA 1RD9D 1D5ZC 4O1NA 2FMCA 3S16B 1OO9B 2E75C 2IT1A 5EJWA 2D2CC 4HEDA 1ZEQX 4RKLA 2XRQD 4L63B 3VYRA 3NUCA 4C3IB 1ZYRD 5ELCA 1JWSD 5CV5A 4X3KA 2XSCA 5I4DA 1EU4A 5C0XJ 5CBEE 2R61A 2AWNA 5CV4A 1QNKA 3T51B 1SEBD 1EIHA 4JBWA 4RKBA 1ILQA 3BYYB 3LWEA 3MHBA 2VXWA 5J1ZA 1Y1WB 4NP5A 5K36G 2HDLA 3TP8A 4RHSA 1A3VA 1O7ZA 1MGSA 1R9TB 1IYVA 1C4QA 3PMFA 2L1BA 4XIGS 4HMJA 3MXGA 1V1OA 2L4NA 5C4HA 3VYUA 1HCZA 2AUJD 2EYLA 4K6LA 2EOTA 5I6YA 3I4NB 3T53B 1IKLA 3LNNA 2JA8B 5FLXL 2EXZA 2NVTB 1X32A 4DXFA 1F9QA 4G57A 5ELFA 5E4XA 1IL8A 1O7LA 5JOBA 1TWHB 1SAPA 2K01A 4ME5A 3V96A 2SEBD 3SK5A 1EQTA 1LTRD 4V190 3FPPA 2VNUD 4J8QA 3R2IA 1F9SA 2JA6B 2F03A 1IHZA 1NAPA 3NE5B 4PMBA 2EDGA 2O4XA 4ZUJA 1MSGA 4K5WA 3FKIB 4IUTA 4XTCS 5KYLA 4FYDA 1PYWD 1SMYD 2JSOA 4IFDH 3SXHA 2YU9B 1PZKD 5I2XA 1LV9A 1WTRA 3R2TA 4KD3A 4HSVA 1XWEA 1A15A 3EROA 4IUUA 3C46A 1UNSA 4ZAIA 1DCZA 2IJ0A 1AP0A 2Z4IA 4ZUIA 4BA2I 1R4PB 4OIKA 5CC4A 1ET6A 1RHPA 4FF3A 3DWAA 5KNDA 1I4QA 4H7BA 3GV3A 1VDZA 3TSSA 4WJWA 2L11A 5E4WC 1QG7A 1EYDA 2XN9C 1TS4A 1OXXK 5C0XI 2MGSA 3TP5A 4GZYC 3MAQA 3NWSA 3QB3A 1A3TA 5G3LD 2EZVA 3KK7A 4BBRB 5I2YA 2K5DA 4HTHA 2J7ZA 2JEAI 1H9SA 5IGDA 2JYOA 4NKLA 2A6EC 4CGYB 1BOSA 1EY4A 1GUSA 2PPBC 5FO8B 3OW7A 1NR2A 1HRJA 4TQUS 4ZLTF 3L9AX 5C5LA 1ESRA 3M85A 2KQ3A 1V1PA 3GTOB 1WTWA 4RGMA 4HSPA 4KJNA 3WOFA 1SYGA 2F0IA 1VF5C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CRK C;  3HGB A;  2A69 D;  4KKT A;  3M7N A;  2AWO A;  3T51 B;  2EJG C;  4JBW A;  2B8F A;  3A7A B;  3L7Z C;  1GJX A;  4IFD G;  1TU2 B;  4KHZ A;  5JEA H;  4IFD H;  1HPC A;  3QJY A;  1Y8N B;  1FYC A;  2O5J C;  4G7O C;  3I73 A;  1GHJ A;  1ZYR C;  2KA7 A;  2R6G A;  3DXJ C;  5K36 H;  1T5E A;  5K36 G;  1Y69 U;  3MXU A;  5BN5 A;  1K8O A;  2PNR C;  5C0X H;  3PUW A;  4RCN A;  5C0X G;  3CRL C;  4PV1 C;  1E2Z A;  4KMU C;  3IFT A;  2A6H C;  2A68 D;  4DK1 A;  2Q8I B;  1V8Q A;  3D4R A;  4KN4 C;  3BG3 A;  2E74 C;  4I7Z C;  3KLR A;  3U9S A;  4BA1 I;  2KCC A;  2JXM B;  2BA0 A;  1VCI A;  2BE5 D;  1IYU A;  1DCZ A;  2BDO A;  3I72 A;  3VR4 A;  1H9K A;  1VF7 A;  3A8J E;  2A6E D;  1IYV A;  1H9R A;  4BA2 I;  3T56 B;  1YNN C;  1GUT A;  2PCF B;  4OGQ C;  2K7V A;  4OO1 G;  2JE6 I;  1Y8P B;  4XIG S;  4H44 C;  2BA1 A;  5KND A;  2EJF C;  3OOC A;  5KNB A;  1GUO A;  2K32 A;  2NN6 I;  4JK1 C;  1H9M A;  4LJZ C;  4IQZ A;  3VR6 A;  1HCZ A;  2AUJ D;  2CW0 C;  3MFY A;  2L5T A;  1BDO A;  5A35 A;  1ZKO A;  2DNE A;  3PV0 A;  4KN7 C;  1Q90 A;  3T53 B;  3D31 A;  2LMC B;  3TZU A;  1EWH A;  1VDZ A;  2EVB A;  3QIA A;  1OXU A;  2K33 A;  2B8G A;  1B9N A;  1HTP A;  3LNN A;  4KKU A;  1SMY C;  2A69 C;  1H9S B;  3EQL C;  2QF7 A;  1IW7 C;  1Z7T A;  1H9J A;  1IW7 D;  1Q12 A;  5BN3 A;  1OXX K;  4GZY C;  1DXM A;  1OXT A;  1Z6H A;  3AB9 A;  3I4L A;  2AUK A;  2D62 A;  2NN6 G;  2V4D A;  4TKO B;  3OPO A;  3SDZ A;  1PMR A;  1YNJ C;  1G29 1;  4L8J A;  3VR3 A;  3N6R A;  2E76 C;  3P20 A;  3PUZ A;  2F1M A;  1FR3 A;  1CI3 M;  1B9M A;  3H94 A;  4KKS A;  2JEB I;  1HQM C;  1Q1E A;  1CFM A;  1OXS C;  1O7L A;  1I6V C;  3WDN A;  4G7H C;  3PUV A;  3A8I E;  3ND8 A;  1A6X A;  3IKJ A;  3GQB A;  5JEA G;  2EJM A;  4LK1 C;  2A68 C;  2A6H D;  2JEA I;  3QG1 A;  1H9S A;  1TKW B;  1QJO A;  1GUN A;  1GUG A;  3ND9 A;  3SE0 A;  3PUX A;  1E2W A;  3RLF A;  4G7Z C;  2A6E C;  3FPP A;  3M4Y A;  4H0L C;  4HR7 B;  1E2V A;  1V43 A;  1ONL A;  2E75 C;  2D5D A;  2O5I C;  1OXV A;  2IT1 A;  4KI0 A;  5BN4 A;  2D2C C;  2YYZ A;  3GD7 A;  1DD2 A;  4H13 C;  1GUS A;  2PPB C;  1O78 A;  3OW7 A;  3VR2 A;  3LWU A;  3W3A A;  4DNT B;  3BDO A;  1CTM A;  3NE5 B;  4TQU S;  2EDG A;  4DNR B;  4DK0 A;  5KNC A;  3A7L A;  3A8K E;  1Y8O B;  3M85 A;  2ZT9 C;  1K8M A;  1Q1B A;  2NN6 H;  4OO1 H;  1GHK A;  1LAB A;  2DNC A;  3PUY A;  3VA7 A;  4XTC S;  3VR5 A;  2DN8 A;  2BE5 C;  1LAC A;  3FMC A;  1VF5 C; 
#chains in the Genus database with same CATH topology
 4O2D A;  5CGK A;  2K14 A;  2Z6B A;  3URY A;  4B3T L;  3L7Z C;  1RDP D;  2EE1 A;  4YY3 Q;  1GJX A;  4E6I A;  4K6D A;  1HPC A;  4KK7 A;  1AZQ A;  1PTO C;  1KDC A;  2JA6 H;  5JAV A;  5JVG 3;  1YZ6 A;  2OQK A;  5BN5 A;  4A3B B;  4IFD J;  3AU7 A;  1LM0 A;  3STB C;  4I7Z C;  2K04 A;  2QDB A;  2KCC A;  3C1E A;  3E0J A;  2KOL A;  2BE5 D;  1YJW A;  3NQI A;  2BDO A;  3Q8D A;  1I94 L;  4A3L G;  2E2J H;  1JE4 A;  3CC2 A;  2WAC A;  5IYC G;  2WP8 J;  4DR7 L;  5IP9 H;  3CQZ B;  3K80 C;  1HZC A;  1UE6 A;  3U4V A;  3MXP A;  4K0K Q;  3NTI A;  5A35 A;  1ZKO A;  2M00 A;  1SR3 A;  1XPR A;  3S1R B;  3AFP A;  3QIA A;  1F9R A;  4DXG A;  1OXU A;  2K33 A;  2JA6 G;  5CMD A;  1PZI D;  1IW7 C;  4APV A;  2HQL A;  3F2U A;  2K52 A;  3S1Q B;  1LUZ A;  3GDE A;  5M5X H;  4LF7 Q;  1BF4 A;  1CHQ D;  1EZ8 A;  3CCQ A;  2JEB I;  4IUQ A;  1J9O A;  1VQ7 A;  2LXK A;  5M3M G;  1ILP A;  1PH4 A;  3A8I E;  1WI5 A;  4BY1 B;  3I70 A;  4RGT A;  1KRS A;  1UE5 A;  4C3H H;  5ELN A;  1HNZ Q;  2Y0S G;  2B2T A;  4X62 L;  4DUY L;  2EY5 A;  1S40 A;  1E2V A;  3K0Y A;  2JA5 G;  1EQV A;  3HOW H;  3BJU A;  1B8A A;  2QEJ C;  3A55 A;  4R4T A;  2H4O A;  3CU7 A;  3Q23 A;  3H3V I;  2L15 A;  2NZH A;  4GKJ Q;  1IKM A;  3UDF A;  2F0V A;  1CZG A;  4A3M B;  2N3S A;  5J39 A;  2UUB Q;  3RN5 A;  1PFB A;  1WTV A;  3E9H A;  2E5L L;  1DJR D;  3IAY A;  1HA5 A;  4NDX A;  2JA5 B;  1PRT B;  2DY7 A;  2DN8 A;  1I94 Q;  3BDL A;  4FNF A;  4Q0F A;  4DV2 L;  1KAW A;  2C9O A;  1EY5 A;  1KHI A;  3S17 B;  4BY1 G;  3NWT A;  3U50 C;  2IWH A;  2ZM6 Q;  3HOY H;  1X3Q A;  4XXE A;  4AYB E;  1Q86 C;  1B4O A;  2F0L A;  4KY6 A;  1KDA A;  4DAM A;  4AQY L;  4KMU C;  3IFT A;  3NHH A;  5EKL A;  1J6Q A;  2N49 A;  1V8Q A;  1SYB A;  2MQH A;  5HUR A;  2ICI A;  5DNF A;  2Q8T A;  1SE8 A;  4ABN A;  2A5H A;  1PXU A;  1QOH A;  1YJN A;  1EY6 A;  2EYF A;  4A3L H;  5J22 A;  4C3J H;  2J4X A;  2MPM A;  3HOY B;  4NB3 A;  2JE6 I;  1Y8P B;  3S2D B;  3KBG A;  1IYJ B;  1QNU A;  2WKC A;  2XGT A;  4DA2 A;  1GD7 A;  4IJH A;  3VA5 A;  2UUC Q;  2QEX A;  4DV3 L;  1FD7 D;  1SJE D;  1U9R A;  3TEH B;  3VDY A;  2QKI C;  4KD4 A;  3GTQ H;  5EAY A;  3G6J B;  1PH5 A;  3I8Z A;  4ZQ3 A;  1SMY C;  2FMM A;  3K6O A;  5IT9 L;  1Z7T A;  3I4M H;  1FVI A;  1YI2 A;  2WAQ B;  4XQN A;  2RVL A;  3ONA B;  4GKJ L;  4LFB L;  3SK4 A;  1HNX L;  2C35 B;  3P7J A;  4B3M L;  1QIL A;  1I6V C;  1QE6 A;  3GQB A;  4IO9 A;  1PFM A;  3DLL A;  4C3H G;  2YTV A;  4K8I A;  5EQ0 A;  3I4M B;  3MXN A;  4KY5 A;  3VYT A;  1PVO A;  1X56 A;  4F7X A;  4ULL A;  3JAM c;  3GTG B;  5EGT A;  2N55 A;  1UEA B;  3U9O A;  2F0H A;  4DGZ A;  1HTL D;  3U4Z A;  1PTO H;  3T13 A;  2L9H A;  3NTH A;  4AYB B;  3I4M G;  4DAY B;  1O7I A;  2MNA A;  2VZA A;  2B2V C;  2B63 H;  1Q1B A;  2N88 A;  3L2P A;  1IZ6 A;  2B39 A;  3BDC A;  1ASY A;  1FJG L;  2K1B A;  4XYQ A;  1K0R A;  3MEF A;  2EYJ A;  5IWA L;  4JI3 Q;  3PO2 B;  1ML0 D;  3M7N A;  1B2T A;  1QZG A;  1VQ6 A;  4DR5 Q;  2Y0S E;  4Y52 H;  3FVQ A;  3J80 E;  1JJC B;  3QR8 A;  2CHB D;  1D5M C;  4B9X A;  4OWW B;  5FJ8 G;  3D6C A;  1M4V A;  3TDQ A;  3SVM A;  4JI0 L;  1BBU A;  1HH2 P;  4K2L A;  4DV3 Q;  2A8V A;  2B63 B;  1SNO A;  5ELE A;  2R7F A;  3GTL B;  3RLO A;  4A3M H;  3KDF B;  3QOL A;  5C4Z A;  4P2C B;  2NVX H;  3Q6S A;  1F2Y A;  4V0B A;  1ICF B;  1Y1V B;  1HNZ L;  3D4R A;  4JI5 L;  4DPG A;  2BOS A;  1TY2 A;  4A3F B;  4DKA C;  1HZB A;  3NSW A;  3A74 A;  2VB3 X;  1H9K A;  1XTC D;  3SR1 A;  3HZX A;  1ROD A;  4OGQ C;  2F0M A;  3HP3 A;  3H0G H;  4JBJ A;  1W2B A;  1UE7 A;  1IXR A;  2EJF C;  4ZKB B;  2NN6 I;  4JK1 C;  4DV5 Q;  2NB0 A;  2RA4 A;  4AIM A;  4P72 A;  3WOE A;  1EEF D;  4F8M A;  3CCV A;  3OHX C;  4YCU A;  2RHS B;  2Q2I A;  5M3F B;  2K28 A;  1IW7 D;  3V2T A;  4JV5 Q;  2UXC L;  1BBX C;  1HUN A;  1I3Q B;  1EL0 A;  4KHV A;  5CV6 A;  1AZP A;  4Q5V A;  1MSH A;  4B3T Q;  4BBS B;  4DK3 C;  2OCE A;  3VR3 A;  1KQS A;  3N6R A;  3P20 A;  2E76 C;  1FL0 A;  4HJ5 A;  1FR3 A;  1LT6 D;  4LF8 L;  4R1J A;  1S5D D;  4RCO A;  2A74 C;  3A56 A;  1EQR A;  4JCV E;  5LMN Q;  1TKW B;  2LXJ A;  4F88 A;  3W2D A;  4EQN A;  1X55 A;  3FRP B;  2CWA A;  3JAM E;  3C1F A;  5FOB B;  2WAQ E;  3J81 L;  3ZYY X;  2F0P A;  1SNP A;  2PMZ E;  1VQP A;  1L1O C;  2C5C A;  3FP9 A;  1NR4 A;  1PH3 A;  3PF5 A;  4GKK Q;  3TQY A;  5CYU A;  3DMU A;  3S1M B;  3Q22 A;  1STG A;  4KY7 A;  3A8K E;  1Y8O B;  4OO1 H;  1K8M A;  3HFZ B;  5I9O A;  2KVM A;  5KRU A;  1AH9 A;  1CKN B;  2EY1 A;  2WV6 D;  2ZJQ A;  4M8A A;  2RCN A;  5FK9 C;  4LF9 Q;  1XMQ L;  1DM0 B;  1HNX Q;  3N52 A;  2ATW A;  1EY8 A;  4UHV A;  4GOP B;  1HR0 L;  4B3M Q;  4GOP A;  1M1K C;  4R8N A;  5I6W A;  4QF4 A;  4RHR A;  3KUP A;  4RCN A;  4DN4 M;  4DR1 L;  4LUZ A;  1X3F A;  1B44 D;  2Q8I B;  2ZXP A;  4LAA A;  2VQF L;  2JA8 G;  4A3G H;  2SNS A;  4X62 Q;  4ZKC B;  3OIP A;  4NPS A;  1GOZ A;  1EZ6 A;  1TWC B;  2BA1 A;  3RZO H;  1ENC A;  3OOC A;  4LJZ C;  1H9M A;  5C44 H;  5C44 G;  2I07 B;  1RL2 A;  2AKW B;  3J81 E;  2LY7 A;  4LFA Q;  2F0D A;  2UXD Q;  1Y1V H;  1L0Y B;  4MTK A;  3E9I A;  1HZA A;  5E1F A;  4A3F H;  3BVG A;  1OXT A;  3AB9 A;  1S72 A;  2HIV A;  2KEC A;  4JI0 Q;  1EOT A;  1TWC H;  2XRS D;  2JA7 H;  2IL8 A;  1G29 1;  3NEN A;  2PI2 E;  1TQO A;  4IZ8 A;  1B50 A;  1Y1W G;  3WDN A;  1KDB A;  1A6X A;  5CV7 A;  1PLF A;  2A6H D;  3QG1 A;  2KHS A;  1EYA A;  4OXP A;  3DM3 A;  1F2Z A;  1WTH A;  1ET9 A;  2N8N A;  5FO7 B;  1PRT F;  4QB4 A;  5CR3 A;  1D6E C;  3TRE A;  1YHB A;  5M3F H;  2JA7 B;  1ONL A;  1STY A;  2D5D A;  2PQA A;  3Q0A A;  2R92 B;  1STA A;  2F0O A;  2PO4 A;  3OWE B;  1QVC A;  2IPK D;  3ER0 A;  3LWU A;  1NUC A;  1Y1V G;  1TS2 A;  5GRO A;  1PV4 A;  1PA6 A;  1I4H A;  4GLA C;  2B63 G;  4OL7 A;  4A93 B;  2IX0 A;  2LS0 1;  3PGZ A;  1TS3 A;  4Z9C B;  1NCV A;  2AWO A;  2R92 H;  3E6Z X;  4FF1 A;  2ZJP A;  3TBI B;  5JEA H;  2FHT A;  2RBM A;  2ZTD A;  3GTP B;  2AHO B;  1K8O A;  4J15 A;  3PUW A;  2L0C A;  3J80 L;  1KD1 C;  1WTX A;  1ZXT A;  1XMO Q;  2UUB L;  3HOU B;  2G9H D;  4JVZ A;  2DUD A;  2AMC B;  2JK8 A;  3U9S A;  3DWP A;  2JQO A;  2K03 A;  4GN3 B;  1JMC A;  1PRT D;  5AFW A;  1BNZ A;  2B2U A;  1G8Z D;  1VF7 A;  1VQI A;  2RCF A;  1JQY D;  5M5W B;  1GUT A;  4OO1 G;  1YEZ A;  2K4K A;  3GTP H;  2M2L A;  4QUF A;  2L55 A;  4ILW A;  2K32 A;  4IQZ A;  4A3E B;  4DR2 L;  1PYB A;  2K05 A;  2PMZ B;  3EA6 A;  1VQ8 A;  5JPM C;  1N34 Q;  1K8A C;  2G9D A;  5ISR A;  4X3S A;  2NVT H;  2F3W A;  4CJ2 C;  1I4P A;  3K0X A;  4DV6 L;  1DXM A;  5NUC A;  1GKH A;  2D62 A;  1I6H H;  2B3G A;  4FXD A;  2HT1 A;  1WJJ A;  4U67 3;  4A3E H;  3RZO B;  3CCL A;  2EY2 A;  1JR0 D;  5JEA G;  2EJM A;  5IYB H;  4LK1 C;  2XWB B;  5LHY 1;  1QJO A;  1GUN A;  4H02 A;  4X65 Q;  1C7Y A;  3CF5 A;  2YV5 A;  2CH4 W;  3M4Y A;  4H0L C;  2MO1 A;  4NXN L;  4Y7N H;  5A2Q E;  1DD2 A;  4M1U B;  2F0U A;  1ICW A;  1LT3 D;  3BDO A;  1DOM A;  4LFA L;  2HDM A;  4K5X A;  1L2F A;  3KJP A;  4A75 A;  1JOR A;  2DNC A;  3PUY A;  3HG9 A;  4JI2 L;  4I65 A;  4Y7N B;  1F77 A;  1Z9F A;  2UXC Q;  3RZD H;  3GV6 A;  2R93 H;  4OWX B;  4DR6 Q;  3J7A F;  3MXU A;  3W1G A;  2Z6K A;  3HOX H;  4LWC A;  5D3I B;  4A3M G;  2K5Q A;  1IBL Q;  3S1N H;  3CPF A;  3D0F A;  1PRT C;  2B2W A;  2LFN A;  4MZ9 A;  3KFU A;  3CHB D;  1PH1 A;  4DU9 A;  3RZD B;  2PCF B;  3I2Z A;  4PNY A;  2XTI A;  1V9P A;  3NBI A;  4CKB A;  1NNX A;  3S2H H;  4IFD I;  4FXK C;  1LTS D;  1VQ5 A;  3CXC A;  1CA5 A;  2K6A A;  3PV0 A;  1Q90 A;  3ERQ A;  2UUA Q;  3UI2 A;  3TZU A;  2EYP A;  4DUY Q;  1LT5 D;  2LKV A;  3D8G A;  1WD1 A;  4YIJ A;  3UDG A;  4A3J G;  1QCB D;  3SDZ A;  4POF A;  2IHF A;  1YNJ D;  4L8J A;  4N9P A;  3S2H B;  3IFD A;  4KKS A;  1KAB A;  2L12 A;  1HQM C;  5C3X A;  1EY7 A;  4R4I A;  3SGI A;  3CCE A;  4G7H C;  1N32 Q;  2NTT A;  1G6Z A;  3KLS A;  2EQS A;  5IGB A;  1SYF A;  2CCZ A;  3MVV A;  1C9O A;  4JI2 Q;  5FKA C;  3F2D A;  1QZH A;  4B3S Q;  4N8F A;  5JJI A;  1UUP A;  1B7Y B;  1SE2 A;  1I4X A;  3PUX A;  2ES2 A;  4C3I G;  1G2T A;  1TT2 A;  5GQO A;  3OTO Q;  1A8V A;  1EQQ A;  1CKN A;  4RMF A;  1HUM A;  4JV5 L;  1U4R A;  3ZJY C;  1FGU A;  3BZD B;  5L37 A;  1I6H B;  4EX5 A;  4IAL A;  3TS2 A;  4GN5 A;  3M4O B;  4B9W A;  4C2M H;  4A3B G;  1IBK L;  2Z9H A;  2OEO A;  2NUC A;  4DR3 L;  1N36 L;  3QOJ A;  1LAB A;  1MI2 A;  1UAP A;  4A3K H;  1VQ4 A;  3DWQ A;  1EYG A;  5KIX A;  3PIP 3;  3NEM A;  1KXL A;  1PH2 A;  1D7Q A;  4C1N I;  5IY0 A;  2NVQ H;  2EJG C;  3MWY W;  5HGT A;  5TSS A;  1BO0 A;  2O5J C;  1I50 B;  4J1M A;  1VQB A;  1ZYR C;  3M4O H;  1VQN A;  1BUV T;  4LMQ D;  4RGO S;  3KJO A;  3MTS A;  3SEB A;  3MZ5 A;  3G7L A;  2JA9 A;  4A3K B;  1E2Z A;  2HUG A;  1WVL A;  2A6H C;  2EYH A;  1L0X B;  2DY8 A;  4LFC L;  3WWV A;  2IHE A;  4TSS A;  4A4I A;  1XNQ Q;  2E2J B;  4QJF A;  3RUZ A;  3AYH B;  1ENA A;  1D1K A;  3TP7 A;  3OYY A;  2PQE A;  3E0E A;  4R4C A;  4C56 C;  3H6M A;  5LMU L;  2DJF C;  1MJE A;  1EYC A;  1UWV A;  1RIP A;  2F0E A;  4IJL A;  2R93 B;  2WB1 E;  3CPW A;  4C3I H;  2VY3 A;  2L5T A;  2WIN B;  1O80 A;  4ID6 A;  2E8G A;  1EIY B;  5AJ3 Q;  4B3S L;  4UAI A;  5JVH 3;  3GO5 A;  1CUK A;  1SLJ A;  1W3S A;  2R93 G;  3S1N B;  2HHH Q;  4EGV A;  1H9S B;  2HQE A;  4BXX G;  2NZO A;  2I0Q A;  4DAP A;  2K5V A;  1KAA A;  2GVA A;  1A63 A;  1P16 A;  4FF2 A;  4MIU A;  1SMX A;  1PH9 A;  1YNJ C;  5H1S E;  1P8L A;  4A3E G;  3EJI A;  1U0L A;  2OF1 A;  3HOZ B;  1X54 A;  3O13 A;  1EOV A;  4ZRZ A;  3M3Y H;  1Y1W H;  2AQ3 B;  3ND8 A;  4OEL B;  1NMG A;  4YHH L;  1YNX A;  3AMU A;  1QWY A;  2OXP A;  1FJG Q;  1E3P A;  3GTJ B;  1A2T A;  3PIO 3;  1JOO A;  2PI2 A;  4DR5 L;  1WTP A;  3UDI A;  1SFO B;  1KLU D;  1E0B A;  4RA8 A;  3SE0 A;  3W5O A;  2CWP A;  4HIK A;  2K75 A;  1TII D;  4HR7 B;  4RH6 A;  4CJ1 B;  4NW2 A;  2F0S A;  4JBK A;  3I7F A;  1LYL A;  3GD7 A;  4BS9 A;  5BN4 A;  3GTM H;  3BVM A;  4C1N K;  5D3D A;  3ULJ A;  1CZW A;  2HCI A;  4DAY A;  3KOJ A;  3MC0 B;  3HRZ C;  2NWG A;  4R4Q A;  1RTO A;  2ZT9 C;  2NN6 H;  4LFC Q;  3NPP A;  3RR5 A;  5C3E G;  5A2Q L;  3QWN A;  2EY6 A;  3I4N H;  4QL5 A;  4JI4 L;  2BE5 C;  2K50 A;  1VQK A;  3GTK H;  1JB3 A;  4ZYS A;  4OHJ A;  4PQX A;  5I9P A;  3ITP A;  4DV4 L;  3T1Y Q;  4LF7 L;  4B3R L;  1L1O A;  1TR5 A;  2K5W A;  3R3O A;  1Q82 C;  5BR8 Q;  1RF2 D;  2PNR C;  4P73 A;  5M9O A;  3CRL C;  5C0X G;  2ID0 A;  3CCJ A;  2JA7 G;  4DK1 A;  2I5L X;  1C8C A;  5IIF A;  1JWU D;  2BA0 A;  2Z4H A;  3FEW X;  3VR4 A;  2CVR A;  2QA4 A;  4X64 Q;  3S2D H;  1YIT A;  4UDU C;  4LF5 Q;  1ESF A;  2RSN A;  1BCP F;  2V1C C;  5JPN C;  4GLX A;  2RDG A;  5M5Y B;  3HOV B;  1I50 H;  5CBA E;  1IBK Q;  1DZ1 A;  2CW0 D;  3JAM L;  3OIQ A;  1S4Z A;  2BDN A;  3T16 A;  5LMN L;  4KN7 C;  2Q8R E;  4LF4 Q;  2LMC B;  4YWK A;  2UXB Q;  1EWH A;  2YTY A;  3D4D A;  4WFN 3;  1HTP A;  1SYC A;  1X3E A;  4PMW A;  1CQF A;  1MBY A;  1LTI D;  1Y14 B;  2AUK A;  2NN6 G;  3OPO A;  3HOV H;  1PMR A;  4JYA Q;  4A3D B;  3JC6 6;  1DGS A;  3C3L A;  5EPK A;  1GM5 A;  2KCN A;  2NTS A;  3ULL A;  4BY7 G;  4KTA A;  2R7D A;  1I5F A;  2MHV A;  2PW7 A;  4BY7 B;  1CA6 A;  1NTG A;  1B3A A;  2PZU A;  4JI1 L;  2D0O A;  4PMC A;  1Q3L A;  1KRT A;  3RLF A;  5C4X B;  2AQ1 B;  5JJL A;  2Y0S B;  2RSO A;  2O2L D;  4KI0 A;  2VS1 A;  2E2D C;  4K8J A;  5ELB A;  4DNT B;  1HZ9 A;  5ELD A;  3EVQ A;  2ZTE A;  3RLN A;  3Q24 A;  1NJI C;  3HOV G;  3BS1 A;  2HHH L;  2X6G A;  5IP9 G;  1VQL A;  3PO2 H;  5C4X H;  4JI7 Q;  4FO2 A;  4X64 L;  3CRK C;  2CFM A;  4KKT A;  1YIJ A;  1BVS A;  4NXM L;  2QDL A;  1OTC A;  2E2I B;  1EUJ A;  1TVX A;  2EIF A;  4LNQ A;  4IPC A;  3P1H A;  3GTM B;  4DFA A;  1WCM G;  2E2H B;  1LTT D;  4A3F G;  4BBR H;  5FO9 B;  3CKI B;  3K5M A;  4JPB W;  1BCP C;  1PH8 A;  3VYS A;  1BXT A;  1BR9 A;  3BG3 A;  3MFG A;  2IY5 B;  1SE4 A;  4YWM A;  3KYH C;  3HOW B;  2I5M X;  3H0G B;  4C3J G;  4IUV A;  2B29 A;  3J80 c;  1IL2 A;  3K5N A;  5FLX E;  1Z47 A;  1VQM A;  4QIW B;  1SJH D;  1QB5 D;  1BDO A;  2SNM A;  1HFG A;  2MP1 A;  4G4K A;  2JA5 H;  4O0A A;  1SND A;  1UE1 A;  3R93 A;  1S5F D;  1B9N A;  1BQQ T;  2MO0 A;  5IE8 A;  4P74 A;  4HIO A;  3KF6 B;  1N33 Q;  3NQT A;  4DV4 Q;  4MTN A;  4BBS H;  1LTG D;  3E5S A;  2F0Q A;  1PHJ A;  1YVC A;  2Z8L A;  4R4O A;  1H95 A;  2QCP X;  1KL9 A;  5M5Y H;  1HA6 A;  1YBY A;  2RDF A;  1VQG A;  5KEE A;  1BCP D;  2FFK B;  4I7A A;  2A68 C;  3CCM A;  4MN3 A;  2F0T A;  4N9T A;  2KHJ A;  2MUY A;  2ALY B;  5E7N A;  1Q8K A;  4LUV A;  2NYZ D;  4XT3 B;  5HY6 A;  5DAU A;  1TWG B;  1XNQ L;  2PQA B;  1NBW A;  2EXD A;  3EBE A;  1SNC A;  1D5X C;  2RHQ B;  1XYI A;  3OW2 A;  4FXG C;  3OWF A;  3S1M H;  5IGG A;  2MJ8 A;  3S15 H;  1VS0 A;  4EQO A;  4A93 G;  3CQZ H;  4JOI C;  1CT1 D;  1K9M C;  3GTQ B;  1JCK B;  5AJ3 L;  4A3I H;  3PO2 G;  3CD6 A;  4O42 A;  5G3L F;  3VR5 A;  4DR4 Q;  4X6A H;  1TWG H;  3A8J E;  3FKI H;  4N8X 1;  4FVM A;  4HJ9 A;  4RWS C;  2R92 G;  4JYA L;  2B8F A;  3T4A C;  1GO3 E;  3V05 A;  1EIG A;  4DR7 Q;  3NXW A;  2H1E A;  2D0P A;  3HOY G;  1GHJ A;  3S15 B;  3HKZ B;  5M5X B;  2KA7 A;  3CC4 A;  5K36 H;  4L5Q A;  2VL6 A;  5C6A A;  2PYK A;  1AEX A;  4LF8 Q;  2DJG C;  1PYS B;  1K83 B;  4PV1 C;  2Z0S A;  1V1Q A;  5JJZ A;  4A3I B;  2DGY A;  4J6H A;  4IPH A;  3BVZ A;  4IUP A;  2EPB A;  2TSS A;  1MJC A;  3J80 i;  4BWG B;  2E74 C;  3D3R A;  4CDD C;  3FPU B;  1N33 L;  3G4S A;  2B2V A;  1T9H A;  3HKZ E;  5E3F A;  1NSN S;  1VCI A;  4C3H B;  2VQE L;  4GOP C;  2NBF A;  2K7V A;  1DOL A;  1SYE A;  4OON A;  3AEV A;  1X3G A;  5KNB A;  5C5M A;  1GUO A;  1I4G A;  3KLW A;  5EKI A;  1PFN A;  2CW0 C;  2ENB A;  4YCV A;  3MFY A;  2E2H H;  1JWM D;  3H15 A;  3OMG A;  1D8L A;  2B2T C;  3L0O A;  3T1H L;  2EVB A;  1HFN A;  4X65 L;  1PDQ A;  3STB D;  2QIL A;  2RDH A;  4XYO A;  4JI4 Q;  3K59 A;  1Q12 A;  4IUR A;  4EVO A;  1S5E D;  4QGU A;  4A3J H;  4CDE C;  1TY0 A;  4RGN A;  1AW7 A;  5EKK A;  4XT1 B;  1XMQ Q;  4LUO A;  3S17 H;  4K14 A;  2WB1 B;  3DUZ A;  1WTQ A;  1K0S A;  4QY7 A;  1ENF A;  5BR8 L;  1S5C D;  3AQQ A;  4IOC A;  5T1I A;  1X6O A;  1G6P A;  4K2K A;  1SN8 A;  1WTO A;  1TWA B;  5M3M B;  3NBH A;  3QO2 A;  4A3J B;  3EFX D;  1V43 A;  3TP6 A;  2YYZ A;  3RN2 A;  1II3 A;  1VQA A;  1MD2 D;  3A54 A;  4QUC A;  3VR2 A;  5D14 A;  4K0K L;  1AN8 A;  1TS5 A;  5T1G A;  5KNC A;  1IBL L;  4A93 H;  2B2W C;  1LTB D;  1SRU A;  2XNA C;  1VQJ A;  5C3W A;  2Q2H A;  2KED A;  2UXB L;  5C4X G;  1LAC A;  1Q46 A;  3DM1 A;  4MNO A;  3I90 A;  4IFD G;  1K28 A;  4KHZ A;  4ME3 A;  1Y8N B;  1MHW C;  5FLM G;  3E3X A;  2F0W A;  4KHP Q;  2TMP A;  2Q2T A;  1F2L A;  1B3Q A;  3H09 A;  4KN4 C;  1SE3 A;  5EPL A;  4BA1 I;  1WD0 A;  4JBM A;  1JC7 A;  1GUW A;  4JW0 A;  1SNM A;  3TZD A;  3RD4 A;  3I72 A;  4A3G G;  2KEN A;  3SK6 A;  4X3U A;  3TS0 A;  5DM7 3;  1J5E L;  4JI6 L;  2ICE C;  1EWC A;  1PTO F;  1PFS A;  4KV6 A;  4OO1 I;  2F0N A;  1LO5 D;  3UE0 A;  1HR0 Q;  4CDF C;  2N78 A;  4DUZ Q;  1K3R A;  3K5O A;  2OT2 A;  2RQX A;  4P75 A;  1E22 A;  4UP7 A;  5IT9 E;  1DYQ A;  4L6T B;  3HEJ A;  3HKS A;  3CMA A;  1Q7Y C;  3EQL C;  4DV2 Q;  3HKZ G;  3NP8 A;  1STH A;  3G6E A;  1HHV A;  1B1Z A;  1TXY A;  1PZJ D;  1RJT A;  1MKH A;  2VQF Q;  1KNA A;  2IX1 A;  4DV1 Q;  3A0J A;  4P71 A;  2KEE A;  2F1M A;  4FP5 D;  1U5K A;  4QCL A;  4A76 A;  1G51 A;  1HJP A;  4HMI A;  1N36 Q;  5COY A;  3PIP A;  1D2B A;  1JE5 A;  4BY1 H;  1G91 A;  4JI3 L;  3K7U C;  5IWA Q;  2F0K A;  3KBX A;  5C4J B;  4L5T A;  3S9W A;  1CKM A;  3ND9 A;  3OSO A;  2F0G A;  4BBR G;  5LL6 X;  1FNV A;  1STB A;  2B2Y A;  2O5I C;  1FGB D;  3J7Y W;  4RG1 A;  4H13 C;  1GXD C;  2R7Z G;  2I5H A;  3W3A A;  2WII B;  4WOR A;  3EIV A;  4UP8 A;  5D65 A;  4B08 A;  1JB7 A;  4IPD A;  4DK0 A;  3KLS X;  2CQA A;  5IOD A;  3A7L A;  1D1I A;  1HR0 W;  2CQO A;  5IGE A;  4OX9 Q;  1GHK A;  1A3U A;  3VA7 A;  3CCR A;  4CKE A;  4IOA A;  3FMC A;  3MEH A;  1TWA H;  4XQJ A;  5M3M H;  3A7A B;  2EYO A;  4OEM B;  2NZ1 D;  1TU2 B;  3DHQ A;  3P75 A;  1I3Q H;  1FYC A;  2F3V A;  5IGC A;  2HIX A;  2X69 A;  3HOU G;  3DXJ C;  4OIJ A;  1VQH A;  1T5E A;  5DM6 3;  2F3I A;  1QUQ A;  3F2B A;  2JJQ A;  5DEH A;  1STE A;  2A68 D;  2KCM A;  5CV9 A;  3KLR A;  1STN A;  2WFW A;  5CV8 A;  2R7Z B;  1XPO A;  3PCO B;  4NMZ A;  1IYU A;  3I3C A;  1YNN D;  5IYB G;  3BZC A;  2WAQ G;  4YY3 L;  3D4W A;  1EFI D;  3H0G G;  4JI8 L;  2PW5 A;  4C3J B;  4H44 C;  1WFQ A;  1RCV D;  5F2D A;  3K58 A;  1DON A;  1SXT A;  1W6J A;  1EY0 A;  1CQV A;  2DNE A;  1A0I A;  5HGQ A;  3IL8 A;  2A73 B;  3D31 A;  2R7Z H;  1XMO L;  1L1O B;  2B8G A;  2B2U C;  3B6Y A;  1U4L A;  3EN2 A;  2A69 C;  4CHT B;  2NVY H;  2QF7 A;  1NY4 A;  1MIU A;  1WCM B;  4UY8 C;  3KF6 A;  2P5Z X;  1Z6H A;  1E7Z A;  3DEP A;  4A3K G;  1EU3 A;  2VUM B;  4GKK L;  1A2U A;  2SDF A;  4QMG A;  1CI3 M;  1DOK A;  4FDB A;  1OXS C;  4IPG A;  1RTN A;  2ZXR A;  3IKJ A;  3UE1 A;  1Q8I A;  2J0T D;  3S14 B;  1JOQ A;  1YHQ A;  3L3O C;  1CSP A;  3H3V C;  1WCM H;  3BZK A;  2OTJ A;  1GUG A;  5FLM H;  2F52 A;  2HCC A;  1E2W A;  4HJ7 A;  2VB2 X;  1FNU A;  2XWJ B;  5LMN W;  4LF6 L;  4A3G B;  2VUM H;  3G71 A;  3GTG H;  5GAE C;  4CBV A;  3X3M A;  1O78 A;  4U68 A;  1T5X D;  2F4I A;  2QGQ A;  4C2M B;  1CTM A;  4DNR B;  1PTO B;  4DV0 Q;  1BCP B;  5C44 B;  3S14 H;  2PZT A;  1EY9 A;  4OWT B;  3H91 A;  1CK1 A;  1S5B D;  1XJV A;  1WOC A;  3I4N G;  3OMC A;  3F2C A;  3FKI G;  2KUM A;  2A69 D;  5C4J H;  2I46 A;  1KIX A;  1F9P A;  1WYD A;  4JI8 Q;  4A3D G;  3CP0 A;  5EBD A;  1CM9 A;  1SSO A;  5EPJ A;  1BKB A;  3I73 A;  1AE2 A;  1S3O A;  4X3T A;  5LL6 S;  4KJO A;  1XXG A;  5KGU A;  1Y69 U;  4XDX A;  4R9W A;  3J81 i;  2A1A A;  1VQD A;  3PO3 B;  3X3N A;  2UU9 Q;  3NEL A;  3M9B A;  2UXD L;  2LSS A;  1XTD A;  3LX0 A;  2E5L Q;  2CH4 A;  3GTL H;  1B53 A;  2NVX B;  4F87 A;  1X9N A;  4XQQ A;  2JXM B;  4DR4 L;  5ELO A;  3CW2 C;  3CCS A;  1E1T A;  3W1B A;  4WRD A;  3OTO L;  2R3Z A;  1AFP A;  3NK9 A;  2X6L A;  4DV7 L;  4IN3 A;  3PO3 G;  3PO3 H;  3D6W A;  1JOK A;  2F0J A;  1F2M A;  1NMF A;  3G48 A;  3K7A B;  3SK8 A;  5JEA J;  3K5L A;  2FJ2 A;  1U4P A;  2Z1C A;  1HNW Q;  1HXY D;  1EFW A;  3RNU A;  1QVF A;  3S16 H;  1N8R C;  2AQ2 B;  2EYM A;  4KKU A;  4X66 Q;  4HCS A;  4AH6 A;  2PZW A;  5EBC A;  4BXX H;  1H9J A;  4K5V A;  3SHL A;  3I4L A;  3NTK A;  2ZTC A;  5IGF A;  2V4D A;  4TRD A;  2WKD A;  2VW9 A;  5IP7 H;  1L0W A;  1SYD A;  4GLV B;  1YHA A;  4A3C G;  3M3Y B;  2MFI A;  4DV0 L;  1K3B C;  3BU2 A;  1Q1E A;  1CFM A;  1IBM Q;  4HN7 A;  4DR1 Q;  3PUV A;  2FIN B;  2YTX A;  5C3E B;  3GTJ H;  1M90 C;  3I55 A;  4JOI A;  1JIC A;  1SFO H;  4WJ4 A;  4GNX A;  2XIW A;  3HOU H;  1R4Q B;  3FHW A;  3T1H Q;  4NXM Q;  2H5X A;  3J7Z C;  3TME A;  2PNH A;  4G7Z C;  2BH2 A;  4ZK9 B;  2IW3 A;  3RMH A;  2NVY B;  5M3F G;  2M9V A;  1OXV A;  1J8I A;  1RKN A;  3A5U A;  4HAE A;  4IUN A;  5M5W H;  1V1P B;  4S3S A;  2Q2U A;  4CJ0 B;  1U4M A;  4LFB Q;  4TVA B;  1JJG A;  2UU9 L;  1LT4 D;  4DF7 A;  1E24 A;  4HIM A;  1SDF A;  1KLG D;  4DAV A;  1KNE A;  3GTK B;  5COR A;  3CC7 A;  4EQP A;  1VMC A;  3HGB A;  2KBN A;  1XPU A;  4RAU C;  3M4Q A;  4ZCK A;  4GN4 B;  1HQR D;  3QJY A;  3CAM A;  4G7O C;  4DV1 L;  1CKO A;  3F8T A;  2R6G A;  3S24 A;  2KCT A;  3TN2 A;  3M7G A;  5IOC A;  3TRZ A;  5C0X H;  3U58 A;  1N34 L;  3MA2 B;  1LTL A;  4FF4 A;  4MHE A;  1SBB B;  4X66 L;  3DEO A;  1X3P A;  2F0F A;  1XX8 A;  3GP7 A;  1W6K A;  2A6E D;  2SOB A;  1VMP A;  1H9R A;  4PZ7 A;  3ICE A;  3T56 B;  4HCE A;  1YNN C;  1CHP D;  1O7Y A;  2BCO A;  3FDT A;  3K57 A;  2FXQ A;  3C2P A;  2JP1 A;  1IBM L;  1PH7 A;  3PSI A;  3R8B A;  3VR6 A;  4CKC A;  3HS0 C;  1SNQ A;  4PG3 A;  1G2S A;  5KYI A;  4R8I A;  1FNW A;  1LTA D;  4ODG A;  3I91 A;  2XVS A;  2GA4 B;  4QQB X;  1PH6 A;  2KJX A;  1A62 A;  2ZXO A;  1NE3 A;  3KF8 A;  2NVQ B;  1JJ2 A;  1I4R A;  4YWL A;  5BN3 A;  1M8A A;  2ASB A;  5K5P A;  4TKO B;  1TWF B;  1J5E Q;  4JI6 Q;  3J7A V;  2B2Y C;  3PUZ A;  3PF4 A;  1PTO D;  2RKS A;  1B9M A;  3H94 A;  2K5N A;  3J7A 5;  4BY7 H;  3T1Y L;  2IX3 A;  2CKZ B;  4HJ8 A;  4UPA A;  4B3R Q;  3F1Z A;  3K81 C;  4RFB A;  1EEI D;  1LLR D;  3K7A H;  4DUZ L;  3HOX B;  5IYC H;  1C48 A;  3BYT B;  2D9U A;  1KTK A;  2ZJR A;  1RD9 D;  1D5Z C;  4O1N A;  2FMC A;  3S16 B;  1OO9 B;  3J81 j;  1TWF H;  2E75 C;  3HOW G;  2IT1 A;  5EJW A;  2D2C C;  1KC8 C;  4HED A;  1ZEQ X;  2XRQ D;  2G5D A;  4RKL A;  4L63 B;  4LF5 L;  4DR6 L;  3VYR A;  3NUC A;  4C3I B;  1ZYR D;  3M4P A;  5ELC A;  1JWS D;  5CV5 A;  4X3K A;  1GVP A;  2XSC A;  1CSQ A;  5I4D A;  1EU4 A;  5C0X J;  5C3E H;  2KHI A;  5CBE E;  2R61 A;  2BH8 A;  2AWN A;  2VQE Q;  5FLX c;  1C0A A;  5CV4 A;  1QNK A;  3J81 c;  1VQF A;  1SEB D;  3T51 B;  3PIO A;  2E2I H;  1EIH A;  4JBW A;  1R9T H;  1K8G A;  4RKB A;  1ILQ A;  3HOZ H;  3BYY B;  3LWE A;  3MHB A;  2OQ0 A;  2VXW A;  5J1Z A;  1Y1W B;  2UUC L;  4NP5 A;  4GS3 A;  5K36 G;  2HDL A;  2UUA L;  3TP8 A;  4OX9 L;  4RHS A;  1A3V A;  1O7Z A;  1MGS A;  1R9T B;  4NXN Q;  2JA8 H;  1IYV A;  5GAH C;  1JT8 A;  1C4Q A;  3PMF A;  4LF9 L;  2L1B A;  4XIG S;  4HMJ A;  3MXG A;  1V1O A;  4CDC C;  2L4N A;  5C4H A;  5IT9 c;  3VYU A;  1HCZ A;  2AUJ D;  2EYL A;  4K6L A;  2EOT A;  5I6Y A;  3I4N B;  3T53 B;  1IKL A;  1SRO A;  1XNR Q;  3LNN A;  2JA8 B;  5FLX L;  2EXZ A;  4JG2 A;  2NVT B;  5IYD G;  5IYD H;  1X32 A;  3A5Z B;  4DXF A;  1VQE A;  2ZM6 L;  1F9Q A;  4G57 A;  5ELF A;  5E4X A;  4EQ5 A;  3ULP A;  4A3C H;  1IL8 A;  4DNI A;  3CCU A;  4GNX B;  4DR3 Q;  1O7L A;  4AQY Q;  5JOB A;  4L5R C;  3GTO H;  1TWH B;  4LW1 A;  4PZ8 A;  1SAP A;  2RF4 A;  2K01 A;  1QVG A;  1K73 C;  4ME5 A;  3UDX A;  4LF4 L;  3V96 A;  2SEB D;  2GN5 A;  3SK5 A;  1EQT A;  1LTR D;  4V19 0;  3FPP A;  2VNU D;  4J8Q A;  3R2I A;  2VUM G;  3CME A;  1F9S A;  2JA6 B;  2F03 A;  4YCW A;  2YU9 H;  1IHZ A;  4POG A;  1NAP A;  3NE5 B;  4PMB A;  2EDG A;  4DK6 C;  2F4V L;  1E1O A;  4KHP L;  4DV7 Q;  4A3B H;  1AE3 A;  2WB1 G;  2OTL A;  1N9W A;  2O4X A;  4ZUJ A;  4JI5 Q;  4DR2 Q;  1MSG A;  4K5W A;  1VQO A;  3FKI B;  1VQC A;  4IUT A;  4XTC S;  5KYL A;  4FYD A;  5GAG C;  3I56 A;  3AFQ A;  4QIW E;  1PYW D;  4JI1 Q;  4KLK A;  1SMY D;  4L5S A;  3NBH B;  2JSO A;  4A3D H;  5LMU Q;  4IFD H;  3SXH A;  2YU9 B;  4DV6 Q;  3K8A A;  1QUQ B;  4LF6 Q;  5DLQ E;  2QW7 A;  3KF8 B;  4DV5 L;  1PZK D;  5I2X A;  1N32 L;  1K83 H;  3HOX G;  1LV9 A;  3S1R H;  1WTR A;  3KDF A;  3R2T A;  4KD3 A;  4BBS G;  4HSV A;  1XWE A;  1XNR L;  1B70 B;  5GAD C;  1A15 A;  3ERO A;  4IUU A;  3C46 A;  3H3V H;  2Z6K C;  4HJA A;  1UNS A;  3I4O A;  4ZAI A;  1DCZ A;  2IJ0 A;  2JN4 A;  4JI7 L;  3S1Q H;  3LGJ A;  1AP0 A;  2Z4I A;  4ZUI A;  4BA2 I;  1R4P B;  4OIK A;  5CC4 A;  1ET6 A;  1RHP A;  4FF3 A;  4A3I G;  3DWA A;  1BBW A;  5KND A;  4WJ3 M;  1I4Q A;  4YHH Q;  3PQI A;  1Q81 C;  1EWI A;  2GVB A;  3JAM i;  4H7B A;  3GV3 A;  5FJ8 H;  1VDZ A;  3HOZ G;  3TSS A;  4WJW A;  2L11 A;  5E4W C;  5J3B A;  1QG7 A;  1EYD A;  2XN9 C;  2A19 A;  1TS4 A;  5JJK A;  1YJ9 A;  1OXX K;  4PZ6 A;  5C0X I;  2MGS A;  3TP5 A;  2K5H A;  4GZY C;  3MAQ A;  2OWO A;  3NWS A;  3QB3 A;  5IP7 G;  1A3T A;  4UP9 A;  3MXN B;  5G3L D;  2EZV A;  2F4V Q;  3KK7 A;  4BBR B;  1EIF A;  5I2Y A;  4GNX C;  3ERS X;  2K5D A;  4HTH A;  1X65 A;  2J7Z A;  2JEA I;  1H9S A;  5IGD A;  1HNW L;  2JYO A;  2HD3 A;  4NKL A;  2A6E C;  4CGY B;  1UEB A;  4JC0 A;  1BOS A;  1EY4 A;  3IRB A;  1GUS A;  2PPB C;  5FO8 B;  3OW7 A;  1NR2 A;  4AYB G;  1HRJ A;  4TQU S;  1ASZ A;  4ZLT F;  3L9A X;  1VQ9 A;  5C5L A;  1ESR A;  3M85 A;  2KQ3 A;  1V1P A;  3GTO B;  1TWH H;  1WTW A;  4RGM A;  4ALP A;  4HSP A;  4HID A;  4KJN A;  3WOF A;  1SYG A;  2F0I A;  1VF5 C; 
#chains in the Genus database with same CATH homology
 5CGK A;  3URY A;  1GJX A;  3L7Z C;  1RDP D;  2EE1 A;  4E6I A;  4K6D A;  1HPC A;  4KK7 A;  1AZQ A;  1PTO C;  1KDC A;  5JAV A;  5JVG 3;  5BN5 A;  4A3B B;  4IFD J;  3AU7 A;  4I7Z C;  2K04 A;  2QDB A;  2KCC A;  3C1E A;  3E0J A;  2KOL A;  2BE5 D;  3NQI A;  2BDO A;  1JE4 A;  2WAC A;  2WP8 J;  3CQZ B;  3MXP A;  3NTI A;  5A35 A;  1ZKO A;  2M00 A;  3S1R B;  3QIA A;  1F9R A;  4DXG A;  1OXU A;  2K33 A;  5CMD A;  1PZI D;  1IW7 C;  3F2U A;  3S1Q B;  1BF4 A;  1CHQ D;  1EZ8 A;  2JEB I;  4IUQ A;  1J9O A;  1ILP A;  3A8I E;  4BY1 B;  3I70 A;  4RGT A;  2B2T A;  2EY5 A;  1E2V A;  3K0Y A;  1EQV A;  2QEJ C;  3A55 A;  2H4O A;  3CU7 A;  3Q23 A;  1IKM A;  2F0V A;  1CZG A;  4A3M B;  5J39 A;  1WTV A;  1PFB A;  3IAY A;  1DJR D;  1HA5 A;  4NDX A;  2JA5 B;  1PRT B;  2DY7 A;  2DN8 A;  3BDL A;  4FNF A;  4Q0F A;  2C9O A;  1EY5 A;  3S17 B;  3NWT A;  2IWH A;  1X3Q A;  4XXE A;  1B4O A;  2F0L A;  4KY6 A;  1KDA A;  4KMU C;  3IFT A;  3NHH A;  5EKL A;  1V8Q A;  1SYB A;  5HUR A;  2ICI A;  5DNF A;  2Q8T A;  4ABN A;  2A5H A;  1PXU A;  1QOH A;  1EY6 A;  2EYF A;  5J22 A;  2J4X A;  3HOY B;  2MPM A;  2JE6 I;  1Y8P B;  3S2D B;  3KBG A;  1QNU A;  2WKC A;  4DA2 A;  3VA5 A;  1FD7 D;  1SJE D;  1U9R A;  2QKI C;  4KD4 A;  3G6J B;  3I8Z A;  4ZQ3 A;  1SMY C;  2FMM A;  3K6O A;  5IT9 L;  1Z7T A;  2WAQ B;  4XQN A;  2RVL A;  3ONA B;  3SK4 A;  3P7J A;  1QIL A;  1I6V C;  1QE6 A;  3GQB A;  1PFM A;  4C3H G;  3I4M B;  4K8I A;  5EQ0 A;  3MXN A;  4KY5 A;  3VYT A;  4F7X A;  4ULL A;  3GTG B;  5EGT A;  2N55 A;  1UEA B;  3U9O A;  2F0H A;  4DGZ A;  1HTL D;  1PTO H;  3T13 A;  2L9H A;  3NTH A;  4AYB B;  2B2V C;  1Q1B A;  2N88 A;  2B39 A;  3BDC A;  2K1B A;  4XYQ A;  2EYJ A;  3PO2 B;  1ML0 D;  3M7N A;  1B2T A;  3FVQ A;  3J80 E;  2CHB D;  1D5M C;  4B9X A;  3D6C A;  1M4V A;  3TDQ A;  3SVM A;  4K2L A;  2B63 B;  1SNO A;  5ELE A;  3GTL B;  5C4Z A;  3QOL A;  4P2C B;  3Q6S A;  1F2Y A;  4V0B A;  1Y1V B;  3D4R A;  2BOS A;  1TY2 A;  4A3F B;  3NSW A;  2VB3 X;  1H9K A;  1XTC D;  3SR1 A;  3HZX A;  1ROD A;  4OGQ C;  2F0M A;  3HP3 A;  2EJF C;  4ZKB B;  2NN6 I;  4JK1 C;  2NB0 A;  2RA4 A;  3WOE A;  1EEF D;  4F8M A;  3OHX C;  5M3F B;  2K28 A;  1IW7 D;  3V2T A;  1BBX C;  1HUN A;  1I3Q B;  1EL0 A;  4KHV A;  5CV6 A;  1AZP A;  4Q5V A;  1MSH A;  4BBS B;  3VR3 A;  3N6R A;  2E76 C;  3P20 A;  1FR3 A;  1LT6 D;  1S5D D;  4RCO A;  2A74 C;  3A56 A;  1TKW B;  4F88 A;  3W2D A;  4EQN A;  3FRP B;  3JAM E;  3C1F A;  5FOB B;  3J81 L;  3ZYY X;  2F0P A;  1SNP A;  2C5C A;  1NR4 A;  5CYU A;  3DMU A;  3S1M B;  3Q22 A;  1STG A;  4KY7 A;  3A8K E;  1Y8O B;  4OO1 H;  1K8M A;  5I9O A;  2KVM A;  5KRU A;  2EY1 A;  2WV6 D;  4M8A A;  5FK9 C;  1DM0 B;  3N52 A;  1EY8 A;  4R8N A;  5I6W A;  4QF4 A;  4RHR A;  3KUP A;  4RCN A;  4DN4 M;  1B44 D;  2Q8I B;  2ZXP A;  4LAA A;  2SNS A;  4ZKC B;  3OIP A;  1GOZ A;  1EZ6 A;  1TWC B;  2BA1 A;  1ENC A;  3OOC A;  4LJZ C;  1H9M A;  2I07 B;  3J81 E;  2LY7 A;  2F0D A;  1L0Y B;  5E1F A;  3BVG A;  1OXT A;  3AB9 A;  2KEC A;  1EOT A;  2XRS D;  2IL8 A;  1G29 1;  1TQO A;  4IZ8 A;  1B50 A;  3WDN A;  1KDB A;  1A6X A;  5CV7 A;  1PLF A;  2A6H D;  3QG1 A;  2KHS A;  1EYA A;  1F2Z A;  1ET9 A;  5FO7 B;  1PRT F;  4QB4 A;  5CR3 A;  1D6E C;  2JA7 B;  1ONL A;  1STY A;  2D5D A;  3Q0A A;  2R92 B;  1STA A;  2F0O A;  2PO4 A;  3OWE B;  2IPK D;  3LWU A;  1NUC A;  1TS2 A;  1I4H A;  4OL7 A;  4A93 B;  2IX0 A;  2LS0 1;  1TS3 A;  4Z9C B;  1NCV A;  2AWO A;  3E6Z X;  4FF1 A;  3TBI B;  5JEA H;  2FHT A;  2RBM A;  3GTP B;  1K8O A;  3PUW A;  2L0C A;  3J80 L;  1WTX A;  1ZXT A;  3HOU B;  2G9H D;  3U9S A;  3DWP A;  2K03 A;  1PRT D;  5AFW A;  1BNZ A;  2B2U A;  1G8Z D;  1VF7 A;  5M5W B;  1JQY D;  1GUT A;  4OO1 G;  2M2L A;  4QUF A;  2L55 A;  4ILW A;  2K32 A;  4IQZ A;  4A3E B;  2K05 A;  2PMZ B;  3EA6 A;  5JPM C;  2G9D A;  5ISR A;  4X3S A;  2F3W A;  4CJ2 C;  1I4P A;  1DXM A;  5NUC A;  2D62 A;  4FXD A;  4U67 3;  3RZO B;  2EY2 A;  1JR0 D;  5JEA G;  2EJM A;  4LK1 C;  2XWB B;  5LHY 1;  1QJO A;  1GUN A;  3M4Y A;  4H0L C;  5A2Q E;  1DD2 A;  4M1U B;  2F0U A;  1ICW A;  1LT3 D;  3BDO A;  1DOM A;  2HDM A;  4K5X A;  1JOR A;  2DNC A;  3PUY A;  3HG9 A;  4I65 A;  4Y7N B;  1F77 A;  3GV6 A;  3J7A F;  3MXU A;  5D3I B;  2K5Q A;  1PRT C;  2B2W A;  2LFN A;  3CHB D;  4DU9 A;  3RZD B;  2PCF B;  4PNY A;  3NBI A;  4CKB A;  4IFD I;  4FXK C;  1LTS D;  1CA5 A;  2K6A A;  3PV0 A;  1Q90 A;  3ERQ A;  3UI2 A;  3TZU A;  2EYP A;  1LT5 D;  2LKV A;  3D8G A;  1WD1 A;  4YIJ A;  1QCB D;  3SDZ A;  1YNJ D;  4L8J A;  4N9P A;  3S2H B;  3IFD A;  4KKS A;  1KAB A;  2L12 A;  1HQM C;  5C3X A;  1EY7 A;  4G7H C;  2NTT A;  1G6Z A;  3KLS A;  5IGB A;  1SYF A;  3MVV A;  5FKA C;  1UUP A;  1SE2 A;  1I4X A;  3PUX A;  4C3I G;  1G2T A;  1TT2 A;  1HUM A;  1U4R A;  3BZD B;  1I6H B;  4IAL A;  3M4O B;  4B9W A;  2OEO A;  2NUC A;  3QOJ A;  1LAB A;  1MI2 A;  1UAP A;  3DWQ A;  5KIX A;  3PIP 3;  4C1N I;  2EJG C;  3MWY W;  5HGT A;  5TSS A;  1BO0 A;  2O5J C;  1I50 B;  4J1M A;  1ZYR C;  1BUV T;  4LMQ D;  4RGO S;  3MTS A;  3SEB A;  3MZ5 A;  3G7L A;  4A3K B;  1E2Z A;  2HUG A;  1WVL A;  2A6H C;  2EYH A;  1L0X B;  2DY8 A;  4TSS A;  2E2J B;  3RUZ A;  3TP7 A;  1ENA A;  1D1K A;  2PQE A;  4C56 C;  3H6M A;  1EYC A;  2F0E A;  2R93 B;  2L5T A;  2WIN B;  1O80 A;  4ID6 A;  4UAI A;  5JVH 3;  3GO5 A;  3S1N B;  4EGV A;  1H9S B;  2HQE A;  4DAP A;  1KAA A;  4FF2 A;  4MIU A;  1YNJ C;  3EJI A;  2OF1 A;  3HOZ B;  3O13 A;  4ZRZ A;  2AQ3 B;  3ND8 A;  3AMU A;  1QWY A;  2OXP A;  3GTJ B;  3PIO 3;  1A2T A;  1JOO A;  1WTP A;  1SFO B;  1KLU D;  1E0B A;  4RA8 A;  3SE0 A;  1TII D;  4HR7 B;  4RH6 A;  4CJ1 B;  4NW2 A;  2F0S A;  5BN4 A;  3GD7 A;  4BS9 A;  3BVM A;  4C1N K;  5D3D A;  1CZW A;  2HCI A;  4DAY A;  3MC0 B;  3HRZ C;  2NWG A;  1RTO A;  2ZT9 C;  2NN6 H;  3NPP A;  5A2Q L;  3QWN A;  2EY6 A;  2BE5 C;  1JB3 A;  4ZYS A;  4OHJ A;  4PQX A;  5I9P A;  3ITP A;  1TR5 A;  2K5W A;  3R3O A;  1RF2 D;  2PNR C;  5C0X G;  5M9O A;  3CRL C;  2ID0 A;  4DK1 A;  1C8C A;  5IIF A;  1JWU D;  2BA0 A;  2Z4H A;  3FEW X;  3VR4 A;  2CVR A;  4UDU C;  1ESF A;  2RSN A;  1BCP F;  5JPN C;  2RDG A;  5M5Y B;  3HOV B;  5CBA E;  1DZ1 A;  2CW0 D;  3JAM L;  3OIQ A;  1S4Z A;  2BDN A;  3T16 A;  4KN7 C;  2Q8R E;  2LMC B;  1EWH A;  4WFN 3;  3D4D A;  1HTP A;  1SYC A;  4PMW A;  1CQF A;  1MBY A;  1LTI D;  2AUK A;  2NN6 G;  3OPO A;  1PMR A;  4A3D B;  3C3L A;  5EPK A;  2KCN A;  2NTS A;  4KTA A;  2MHV A;  2PW7 A;  4BY7 B;  1CA6 A;  1B3A A;  2PZU A;  4PMC A;  1Q3L A;  3RLF A;  5C4X B;  2AQ1 B;  2Y0S B;  2RSO A;  2O2L D;  4KI0 A;  2E2D C;  4K8J A;  5ELB A;  4DNT B;  5ELD A;  3EVQ A;  3Q24 A;  3BS1 A;  2X6G A;  4FO2 A;  3CRK C;  4KKT A;  2E2I B;  1TVX A;  3P1H A;  3GTM B;  4DFA A;  2E2H B;  1LTT D;  5FO9 B;  3CKI B;  3K5M A;  1BCP C;  3VYS A;  1BXT A;  1BR9 A;  3BG3 A;  3MFG A;  1SE4 A;  3HOW B;  3H0G B;  4C3J G;  4IUV A;  3K5N A;  5FLX E;  1Z47 A;  4QIW B;  1SJH D;  1QB5 D;  1BDO A;  2SNM A;  1HFG A;  2MP1 A;  4G4K A;  1SND A;  3R93 A;  1S5F D;  1B9N A;  1BQQ T;  3NQT A;  1LTG D;  3E5S A;  2F0Q A;  2Z8L A;  2QCP X;  1HA6 A;  2RDF A;  5KEE A;  1BCP D;  2FFK B;  2A68 C;  4MN3 A;  2F0T A;  4N9T A;  2MUY A;  2NYZ D;  4XT3 B;  5DAU A;  1TWG B;  1SNC A;  1D5X C;  1XYI A;  4FXG C;  3OWF A;  5IGG A;  2MJ8 A;  4EQO A;  1CT1 D;  3GTQ B;  1JCK B;  4O42 A;  5G3L F;  3VR5 A;  3A8J E;  4FVM A;  4RWS C;  2B8F A;  3T4A C;  3V05 A;  1EIG A;  3NXW A;  2H1E A;  1GHJ A;  3S15 B;  3HKZ B;  5M5X B;  2KA7 A;  5K36 H;  5C6A A;  2PYK A;  1AEX A;  1K83 B;  4PV1 C;  5JJZ A;  4A3I B;  4J6H A;  3BVZ A;  4IUP A;  2EPB A;  2TSS A;  4BWG B;  2E74 C;  3D3R A;  3FPU B;  2B2V A;  5E3F A;  1NSN S;  1VCI A;  4C3H B;  2NBF A;  2K7V A;  1DOL A;  1SYE A;  5KNB A;  5C5M A;  1GUO A;  1I4G A;  5EKI A;  1PFN A;  2CW0 C;  2ENB A;  3MFY A;  1JWM D;  3OMG A;  2B2T C;  2EVB A;  1HFN A;  1PDQ A;  2QIL A;  2RDH A;  4XYO A;  3K59 A;  1Q12 A;  4IUR A;  4EVO A;  1S5E D;  1TY0 A;  4RGN A;  1AW7 A;  5EKK A;  4XT1 B;  4K14 A;  2WB1 B;  3DUZ A;  1WTQ A;  1ENF A;  1S5C D;  5T1I A;  4K2K A;  1WTO A;  1TWA B;  5M3M B;  3NBH A;  3QO2 A;  4A3J B;  3EFX D;  1V43 A;  3TP6 A;  2YYZ A;  1II3 A;  1MD2 D;  3A54 A;  4QUC A;  3VR2 A;  5D14 A;  1AN8 A;  1TS5 A;  5T1G A;  5KNC A;  2B2W C;  1LTB D;  2XNA C;  5C3W A;  2KED A;  1LAC A;  3DM1 A;  3I90 A;  4IFD G;  4KHZ A;  1Y8N B;  2F0W A;  2TMP A;  1F2L A;  3H09 A;  4KN4 C;  1SE3 A;  5EPL A;  4BA1 I;  1WD0 A;  1JC7 A;  1GUW A;  1SNM A;  3TZD A;  3RD4 A;  3I72 A;  3SK6 A;  4X3U A;  5DM7 3;  2ICE C;  1EWC A;  1PTO F;  4KV6 A;  4OO1 I;  2F0N A;  1LO5 D;  3K5O A;  2OT2 A;  2RQX A;  5IT9 E;  1DYQ A;  4L6T B;  3HEJ A;  3EQL C;  1HHV A;  3NP8 A;  1STH A;  1B1Z A;  1PZJ D;  1RJT A;  1KNA A;  2IX1 A;  2KEE A;  2F1M A;  4FP5 D;  4QCL A;  4HMI A;  5COY A;  1D2B A;  1G91 A;  2F0K A;  3KBX A;  5C4J B;  3S9W A;  3ND9 A;  3OSO A;  2F0G A;  5LL6 X;  1FNV A;  1STB A;  2B2Y A;  2O5I C;  1FGB D;  3J7Y W;  4H13 C;  1GXD C;  3W3A A;  2WII B;  4WOR A;  5D65 A;  4B08 A;  4DK0 A;  3KLS X;  5IOD A;  2CQA A;  3A7L A;  1D1I A;  5IGE A;  1GHK A;  1A3U A;  3VA7 A;  4CKE A;  3FMC A;  3MEH A;  4XQJ A;  3A7A B;  2EYO A;  2NZ1 D;  1TU2 B;  3DHQ A;  3P75 A;  1FYC A;  2F3V A;  5IGC A;  2X69 A;  3DXJ C;  4OIJ A;  1T5E A;  5DM6 3;  5DEH A;  1STE A;  2A68 D;  5CV9 A;  3KLR A;  1STN A;  5CV8 A;  2R7Z B;  4NMZ A;  1IYU A;  3I3C A;  1YNN D;  3D4W A;  1EFI D;  4C3J B;  2PW5 A;  4H44 C;  1RCV D;  3K58 A;  5F2D A;  1DON A;  1SXT A;  1W6J A;  1EY0 A;  1CQV A;  2DNE A;  3IL8 A;  2A73 B;  3D31 A;  2B8G A;  2B2U C;  1U4L A;  2A69 C;  4CHT B;  2QF7 A;  1WCM B;  1Z6H A;  3DEP A;  1EU3 A;  2VUM B;  1A2U A;  2SDF A;  4QMG A;  1CI3 M;  1DOK A;  1OXS C;  1RTN A;  2ZXR A;  3IKJ A;  1Q8I A;  2J0T D;  3S14 B;  1JOQ A;  3L3O C;  3H3V C;  1GUG A;  2HCC A;  1E2W A;  2VB2 X;  1FNU A;  2XWJ B;  4A3G B;  4CBV A;  3X3M A;  1O78 A;  4U68 A;  1T5X D;  2F4I A;  4C2M B;  1CTM A;  4DNR B;  1PTO B;  1BCP B;  5C44 B;  2PZT A;  1EY9 A;  3H91 A;  1CK1 A;  1S5B D;  3OMC A;  2KUM A;  2A69 D;  2I46 A;  1F9P A;  5EBD A;  1CM9 A;  1SSO A;  5EPJ A;  3I73 A;  4X3T A;  5LL6 S;  4KJO A;  1XXG A;  5KGU A;  1Y69 U;  4XDX A;  4R9W A;  3PO3 B;  3X3N A;  3LX0 A;  1B53 A;  2NVX B;  4F87 A;  4XQQ A;  2JXM B;  4WRD A;  2R3Z A;  1AFP A;  3NK9 A;  2X6L A;  4IN3 A;  3D6W A;  1JOK A;  2F0J A;  1F2M A;  3K7A B;  5JEA J;  3SK8 A;  3K5L A;  2FJ2 A;  1U4P A;  2Z1C A;  1HXY D;  2AQ2 B;  2EYM A;  4KKU A;  4HCS A;  2PZW A;  5EBC A;  1H9J A;  4K5V A;  3SHL A;  3I4L A;  3NTK A;  5IGF A;  2V4D A;  4TRD A;  2WKD A;  1SYD A;  3M3Y B;  1Q1E A;  1CFM A;  4HN7 A;  3PUV A;  2FIN B;  5C3E B;  1JIC A;  2XIW A;  1R4Q B;  3TME A;  4G7Z C;  4ZK9 B;  2IW3 A;  3RMH A;  2NVY B;  2M9V A;  1OXV A;  1J8I A;  1RKN A;  4HAE A;  4IUN A;  1V1P B;  4S3S A;  4CJ0 B;  1U4M A;  1LT4 D;  4DF7 A;  1SDF A;  1KLG D;  4DAV A;  1KNE A;  3GTK B;  5COR A;  4EQP A;  1VMC A;  3HGB A;  4RAU C;  1HQR D;  3QJY A;  4G7O C;  2R6G A;  3TN2 A;  3M7G A;  5IOC A;  5C0X H;  3MA2 B;  4FF4 A;  4MHE A;  1SBB B;  3DEO A;  1X3P A;  2F0F A;  1XX8 A;  3GP7 A;  1W6K A;  2A6E D;  2SOB A;  1VMP A;  1H9R A;  3T56 B;  4HCE A;  1YNN C;  1CHP D;  1O7Y A;  2BCO A;  3FDT A;  3K57 A;  3C2P A;  2JP1 A;  3R8B A;  3VR6 A;  4CKC A;  3HS0 C;  1SNQ A;  1G2S A;  5KYI A;  4R8I A;  1FNW A;  1LTA D;  4ODG A;  3I91 A;  2XVS A;  2GA4 B;  2KJX A;  2ZXO A;  3KF8 A;  2NVQ B;  1I4R A;  5BN3 A;  1M8A A;  5K5P A;  4TKO B;  1TWF B;  3J7A V;  2B2Y C;  3PUZ A;  1PTO D;  2RKS A;  1B9M A;  3H94 A;  2IX3 A;  4RFB A;  1EEI D;  1LLR D;  3HOX B;  1C48 A;  3BYT B;  2D9U A;  1KTK A;  1RD9 D;  1D5Z C;  4O1N A;  2FMC A;  3S16 B;  1OO9 B;  2E75 C;  2IT1 A;  5EJW A;  2D2C C;  4HED A;  1ZEQ X;  4RKL A;  2XRQ D;  4L63 B;  3VYR A;  3NUC A;  4C3I B;  1ZYR D;  5ELC A;  1JWS D;  5CV5 A;  4X3K A;  2XSC A;  5I4D A;  1EU4 A;  5C0X J;  5CBE E;  2R61 A;  2AWN A;  5CV4 A;  1QNK A;  3T51 B;  1SEB D;  1EIH A;  4JBW A;  4RKB A;  1ILQ A;  3BYY B;  3LWE A;  3MHB A;  2VXW A;  5J1Z A;  1Y1W B;  4NP5 A;  5K36 G;  2HDL A;  3TP8 A;  4RHS A;  1A3V A;  1O7Z A;  1MGS A;  1R9T B;  1IYV A;  1C4Q A;  3PMF A;  2L1B A;  4XIG S;  4HMJ A;  3MXG A;  1V1O A;  2L4N A;  5C4H A;  3VYU A;  1HCZ A;  2AUJ D;  2EYL A;  4K6L A;  2EOT A;  5I6Y A;  3I4N B;  3T53 B;  1IKL A;  3LNN A;  2JA8 B;  5FLX L;  2EXZ A;  2NVT B;  1X32 A;  4DXF A;  1F9Q A;  4G57 A;  5ELF A;  5E4X A;  1IL8 A;  1O7L A;  5JOB A;  1TWH B;  1SAP A;  2K01 A;  4ME5 A;  3V96 A;  2SEB D;  3SK5 A;  1EQT A;  1LTR D;  4V19 0;  3FPP A;  2VNU D;  4J8Q A;  3R2I A;  1F9S A;  2JA6 B;  2F03 A;  1IHZ A;  1NAP A;  3NE5 B;  4PMB A;  2EDG A;  2O4X A;  4ZUJ A;  1MSG A;  4K5W A;  3FKI B;  4IUT A;  4XTC S;  5KYL A;  4FYD A;  1PYW D;  1SMY D;  2JSO A;  4IFD H;  3SXH A;  2YU9 B;  1PZK D;  5I2X A;  1LV9 A;  1WTR A;  3R2T A;  4KD3 A;  4HSV A;  1XWE A;  1A15 A;  3ERO A;  4IUU A;  3C46 A;  1UNS A;  4ZAI A;  1DCZ A;  2IJ0 A;  1AP0 A;  2Z4I A;  4ZUI A;  4BA2 I;  1R4P B;  4OIK A;  5CC4 A;  1ET6 A;  1RHP A;  4FF3 A;  3DWA A;  5KND A;  1I4Q A;  4H7B A;  3GV3 A;  1VDZ A;  3TSS A;  4WJW A;  2L11 A;  5E4W C;  1QG7 A;  1EYD A;  2XN9 C;  1TS4 A;  1OXX K;  5C0X I;  2MGS A;  3TP5 A;  4GZY C;  3MAQ A;  3NWS A;  3QB3 A;  1A3T A;  5G3L D;  2EZV A;  3KK7 A;  4BBR B;  5I2Y A;  2K5D A;  4HTH A;  2J7Z A;  2JEA I;  1H9S A;  5IGD A;  2JYO A;  4NKL A;  2A6E C;  4CGY B;  1BOS A;  1EY4 A;  1GUS A;  2PPB C;  5FO8 B;  3OW7 A;  1NR2 A;  1HRJ A;  4TQU S;  4ZLT F;  3L9A X;  5C5L A;  1ESR A;  3M85 A;  2KQ3 A;  1V1P A;  3GTO B;  1WTW A;  4RGM A;  4HSP A;  4KJN A;  3WOF A;  1SYG A;  2F0I A;  1VF5 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...