2EDGA

Solution structure of the gcv_h domain from mouse glycine
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
130
structure length
130
Chain Sequence
GSSGSSGRKFTEKHEWITTEEGIGTVGISNFAQEALGDVVYCSLPEVGTKLKKQEEFGALESVKAASELYSPLSGEVTEVNEALAENPGLVNKSCYEDGWLIKMTLSDPSELDELMSEEAYEKYVKSIEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycine cleavage system H protein
publication title Solution structure of the GCV_H domain from mouse glycine
rcsb
source organism Mus musculus
molecule tags Biosynthetic protein
total genus 16
structure length 130
sequence length 130
ec nomenclature
pdb deposition date 2007-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01597 GCV_H Glycine cleavage H-protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2edgA00
2AWOA 3ND9A 5BN3A 2NN6G 4DNRB 5BN5A 3BDOA 2YYZA 3WDNA 1CI3M 1Q1BA 4DK0A 1OXTA 1IYUA 1T5EA 1V8QA 2DNCA 3I73A 3T51B 2O5IC 4GZYC 1K8MA 2A68C 1LACA 2A6EC 3M4YA 4JBWA 2LMCB 1BDOA 4KKTA 1LABA 1IW7D 2BDOA 3BG3A 3MXUA 3CRLC 2D5DA 3QJYA 3W3AA 3D31A 4OO1H 1GHKA 1H9SB 4KI0A 1HQMC 4KN4C 3VR3A 3PUVA 3I72A 3FMCA 3VA7A 4IFDG 4DK1A 3KLRA 4DNTB 1ZKOA 2KCCA 2A68D 1GHJA 2L5TA 2DN8A 2A6ED 2B8GA 2IT1A 3GD7A 3N6RA 1PMRA 4KKUA 4KKSA 4KMUC 3OW7A 3IFTA 2PNRC 3VR6A 1FYCA 1QJOA 5BN4A 3L7ZC 3LNNA 2ZT9C 2PCFB 2KA7A 1B9NA 3HGBA 3OPOA 3ND8A 1H9JA 2JXMB 1TKWB 4L8JA 3A7LA 1DD2A 2Q8IB 5KNBA 4IQZA 3T56B 4H0LC 4I7ZC 2D2CC 1V43A 2EVBA 2NN6H 3OOCA 3RLFA 1B9MA 2EJFC 1ZYRC 1E2WA 1DCZA 2BA0A 3QIAA 2JEBI 3TZUA 1H9RA 3P20A 3VR4A 3FPPA 5KNCA 4OGQC 1GUOA 2D62A 4JK1C 5K36G 1HPCA 4BA1I 4BA2I 1DXMA 1E2VA 2JEAI 3SDZA 2V4DA 1Q12A 3IKJA 2EJGC 3PUWA 4TQUS 1OXXK 4TKOB 5C0XG 4IFDH 1ONLA 1GJXA 2QF7A 1OXVA 2AUKA 5A35A 1OXUA 3CRKC 2E74C 4KN7C 1Q1EA 1Y69U 2BA1A 2K7VA 2A6HC 3A7AB 3AB9A 1CFMA 3H94A 3PUXA 5JEAG 3VR2A 2K33A 2JE6I 2EJMA 4HR7B 2PPBC 1VCIA 3MFYA 1TU2B 4G7HC 3M85A 1IYVA 1H9SA 3T53B 1H9KA 3GQBA 1Z6HA 3DXJC 2A6HD 1GUNA 2K32A 3LWUA 3A8KE 2BE5C 3PV0A 3EQLC 4KHZA 1Y8PB 1Y8NB 1HTPA 1H9MA 3NE5B 5K36H 3I4LA 3VR5A 1O7LA 3PUZA 4PV1C 3U9SA 2DNEA 1Y8OB 4OO1G 4XIGS 3PUYA 2EDGA 4XTCS 1YNNC 1G291 5C0XH 4G7OC 1GUGA 3QG1A 1Z7TA 1HCZA 1VF5C 4RCNA 2O5JC 1CTMA 1E2ZA 2BE5D 2E76C 1Q90A 2A69C 3M7NA 4H44C 3A8JE 3SE0A 1YNJC 4H13C 4G7ZC 1K8OA 2CW0C 5KNDA 2R6GA 5JEAH 2B8FA 2NN6I 2F1MA 1O78A 4LK1C 3A8IE 3D4RA 1VDZA 2E75C 1SMYC 1GUTA 1EWHA 4LJZC 1FR3A 1IW7C 1I6VC 2A69D 1A6XA 1OXSC 1GUSA 2AUJD 1VF7A
chains in the Genus database with same CATH superfamily
1BR9A 5DLQE 4AIMA 2ZTDA 1KDAA 2DNCA 1EY7A 5HGTA 3HOYB 4A3MG 4OIJA 4YCUA 5C6AA 3A55A 1WTPA 1TWAB 4LF7L 1L1OB 1EY4A 3RZOB 1X54A 4OX9Q 4HJ9A 2NVTH 2AWNA 3OWEB 3I3CA 3F2UA 3MAQA 3S1NB 1GM5A 1SNPA 2MQHA 5M3MH 1IL2A 2HQLA 4CDFC 3GD7A 3J7ZC 3K5MA 4C2MH 1I5FA 2WB1B 5ELDA 5C4ZA 5IGEA 2XRSD 2RCNA 5EGTA 4H02A 5C4XG 1JB7A 1I50H 4R1JA 3GTKH 1G8ZD 3C1EA 1DOMA 1RTOA 2QGQA 4IUUA 2VQEL 1IHZA 3TP8A 3CW2C 3X3MA 4JI6Q 1KAWA 4Y7NH 3KJPA 3A54A 2UUAQ 2N78A 4QGUA 3VA5A 3T13A 1D7QA 2JJQA 1E2VA 3QOLA 2ZM6L 2F0LA 1OXXK 2L11A 1EQVA 3P7JA 3VDYA 1IBKQ 2H1EA 3PO3B 4IFDH 3OMCA 1RHPA 3Q24A 4IPDA 4RGNA 1EOVA 1U4PA 2FMMA 4KN7C 1CKOA 1E22A 4CKEA 1DM0B 1SYFA 4LF8Q 2E2HB 2F0OA 2PPBC 1VCIA 5C44B 3TP5A 1ASZA 4RCOA 4JI0Q 3T53B 2F52A 1EY6A 2KEDA 4PZ6A 1R4QB 1WD0A 1AE3A 3DXJC 5IOCA 4OO1I 2LFNA 4MHEA 2BE5C 1LV9A 1T9HA 4C3IB 2NZHA 2NVQB 4PMBA 3K5NA 3S15H 4LF6L 3SK5A 1PTOC 4YWMA 2EDGA 1YNNC 4K0KQ 4DFAA 3QWNA 1RTNA 3P1HA 1CA5A 2Z0SA 1SNOA 4O0AA 2B2VA 4B3TL 3KJOA 5IGDA 5JJZA 1PH8A 2F0KA 1UE7A 3S14B 2F0FA 1FJGQ 2XIWA 2VQFQ 5JEAJ 3MTSA 2R7ZB 1X3GA 5IYBH 5EPKA 3PMFA 1SROA 3DM1A 1HNZL 1IKLA 5EJWA 4LUZA 5D3IB 2VL6A 3HOUB 4JV5L 1EQQA 3QB3A 1JJCB 3TREA 2RKSA 1IW7D 3D4DA 4A3JH 3ERSX 4DR4Q 1WTHA 2G9HD 4U673 2NVYB 1KL9A 5CV4A 4KN4C 3PUVA 4R4IA 2B2VC 3RLNA 1O7YA 3WOEA 1CUKA 3V05A 2F3WA 2YTVA 3AYHB 3CCRA 4M8AA 1LUZA 3PIP3 2UXDQ 3DWPA 1KNEA 2ZT9C 4A3IG 4OHJA 1XNQQ 1E1OA 1HZBA 1BCPF 3GTPH 1KABA 3NEMA 3RLFA 1PDQA 2K14A 1B44D 2ZTCA 4HCEA 1Y1WH 4RA8A 4J8QA 4KJOA 4DXFA 4OGQC 3B6YA 2Y0SE 3D8GA 4LW1A 1HPCA 1QUQB 3DHQA 3GV6A 2EJGC 5F2DA 2FXQA 4KHPQ 1FVIA 1OXUA 1QVCA 3R2TA 4AYBB 4GOPB 1E7ZA 2D0PA 2MP1A 3IFDA 3W2DA 1YBYA 3J7YW 3BJUA 2RBMA 3T1YL 1AW7A 3P75A 4HN7A 4DV1Q 4A93G 4BY1G 3U9SA 5C4HA 4YHHQ 2HT1A 3BYTB 1PRTD 2CHBD 4X66L 5M3FB 3DEOA 1C48A 4WJ3M 5E4XA 4JBMA 4A3EG 1EIHA 5KNDA 2R6GA 5JEAH 4DV6Q 2JA7G 1VMCA 3KF8B 3HOZG 3RNUA 4LJZC 2RSNA 4P72A 4QB4A 1RDPD 4EQOA 4Q5VA 1OXSC 3IL8A 1JE5A 4DKAC 4K8IA 3EBEA 4LFBL 1YNJD 2H5XA 2NN6G 3BU2A 5C3EH 3T51B 3CQZB 3I73A 4CJ1B 1SMYD 2R92G 3S2DB 4L6TB 3BG3A 3D4WA 4BWGB 1GHKA 4DR3Q 2KQ3A 3FP9A 3VYSA 4HAEA 4DUZQ 2QCPX 4UAIA 1I3QB 2F0PA 1YITA 2HHHL 4DUYQ 5KEEA 4A3BB 2AHOB 2JA5H 4X6AH 2DN8A 4JI7L 2VUMH 3ULLA 2ES2A 1QJOA 1LTLA 2ZXOA 5IT9E 4DV2Q 5KYIA 1F9SA 1SYDA 2M00A 5AJ3L 1HUNA 2CW0D 1YJ9A 1NTGA 1EIGA 2VZAA 1TY0A 5EKIA 4FXGC 2JA6B 2SDFA 2YU9H 2K52A 3TQYA 1P8LA 4MTKA 4O1NA 2BCOA 2XWJB 4DV7Q 1EQRA 4A3DH 3FPPA 4ILWA 1NE3A 1KC8C 3VYRA 3H0GH 4JI4L 1CHPD 1TWHH 5I9OA 2NTTA 1V1PB 3CCLA 2V4DA 4TQUS 1VQPA 2LY7A 1GJXA 1PTOH 4ID6A 1MD2D 3G48A 1PYWD 2TSSA 5JPNC 4X65L 3Q22A 2L0CA 4GLXA 1N36L 2K05A 5A35A 3K7AH 3F2CA 5COYA 1LT4D 1U4MA 2E74C 1O80A 5DNFA 5EQ0A 1KD1C 3T1HL 2K7VA 1TWCB 5M5XB 2PW7A 1NUCA 3I4MB 3J80c 4I65A 3U4ZA 3K58A 1H9SA 3SK6A 2IHFA 4QUCA 3SGIA 2F0QA 3E0JA 2F3IA 3DWAA 1BXTA 3I90A 1ZYRD 4DR7L 3T4AC 2E5LQ 5G3LF 4BBRB 1SR3A 4IOAA 3QO2A 3CPWA 1EUJA 5FLXE 4R9WA 1FNVA 2MFIA 4ME3A 2A69C 5BR8Q 4R8NA 5IYCH 1F2LA 4YCWA 4NW2A 4DR5L 4JBKA 3S16B 4QIWB 1QZGA 4DN4M 3GTOB 2MO0A 1D5ZC 5I9PA 1VDZA 2ASBA 3A5UA 1I6VC 2OQKA 4EGVA 3S9WA 1SE4A 1T5EA 1IYUA 1EEID 2DGYA 3BDLA 4JBWA 5J3BA 1VQLA 3CCSA 1LABA 1Q8KA 4G4KA 4OO1H 1N32Q 4BY7H 1DONA 2UU9Q 4TVAB 4BXXH 1F77A 1XTDA 3KLRA 4ZUJA 4A3KG 1NY4A 1LTBD 2L5TA 1HA6A 2Z1CA 3OW7A 5E3FA 1NR2A 3K81C 1FYCA 4R4OA 2K5VA 3I4NH 1STAA 2XWBB 1PFMA 3KLSA 5KNBA 2SNMA 2OT2A 2A74C 1X32A 3ONAB 3OOCA 4RKLA 3GDEA 4DV0L 3GV3A 1SE2A 1EEFD 4ABNA 3P20A 1SFOB 3CMEA 2B2WA 3QOJA 2WV6D 1PHJA 3ITPA 2B3GA 1DXMA 2KVMA 2Q8RE 1O7ZA 4LF4Q 1VQ6A 1HNWL 2F3VA 1KLUD 3SK8A 5CBAE 1ONLA 2R93B 1UUPA 4XQJA 1Q7YC 4IPGA 1WVLA 2R7FA 5D3DA 2OQ0A 4OL7A 1K83B 4HTHA 2Q2IA 2BA1A 3AB9A 5IP7H 4C3JB 1HZAA 4X3SA 4XT1B 5I2XA 2F4VQ 3FHWA 2N49A 3MEFA 1K9MC 1HNXQ 3SHLA 3VYUA 4FXDA 5FK9C 1H9KA 2PNHA 1NMGA 2JA8H 3MXNA 5FLMG 2A6HD 1WTRA 3A8KE 4JI1Q 4LF5Q 1BCPC 4R4TA 3VR5A 1KRTA 3EFXD 2DNEA 1Y8OB 5GAHC 3I70A 3MZ5A 4NP5A 2CCZA 1AP0A 2QA4A 1E24A 2QILA 1PRTB 3ULJA 3J81E 5IODA 4B3MQ 2B29A 3A8JE 1EQTA 1WCMG 5CBEE 1P16A 2ZXPA 1F9QA 1YHQA 1W6KA 2PQEA 5ELBA 1EWHA 1SMXA 1JWUD 1PH7A 3ND9A 5FOBB 3HOWG 4GNXB 4N8FA 3HKZB 3W1BA 2A68C 1K3RA 2YTYA 4P71A 5HGQA 5FJ8G 1B70B 3CRLC 4A3MB 2R3ZA 1D2BA 1HR0L 4C1NI 4KI0A 2E2IH 3H3VI 1O7IA 3VR3A 4EX5A 2KHIA 3BS1A 1PH2A 2KHSA 3JAMi 1MBYA 3K57A 4QF4A 4E6IA 1QVGA 3L7ZC 1G51A 3HGBA 2JXMB 1FD7D 5C4XB 2EY1A 1STBA 4QMGA 2EY6A 2K6AA 1PH9A 2UXBL 4ZLTF 2EJFC 3S1RH 1ESRA 1L1OA 1DCZA 3NENA 5LMNL 5IGCA 2N3SA 1N34Q 2EXZA 2L1BA 3TBIB 2CWPA 1Q82C 1B4OA 2RF4A 3S1QB 1PFBA 4BA1I 3K80C 3C46A 3DMUA 1TVXA 1TY2A 5C0XG 5EKLA 1WTOA 3K59A 3MXGA 1NR4A 3A5ZB 4A3LH 1QE6A 1IKMA 3S1MB 1ASYA 1LO5D 2JYOA 1OTCA 3H94A 2JP1A 3A7AB 1CFMA 4IN3A 5CV5A 3K5LA 1KDBA 1QNUA 4CJ0B 5GADC 1TS4A 5T1GA 4K6DA 2CFMA 4QJFA 3M4PA 4XXEA 3NK9A 1GUNA 3LWUA 1ET9A 1VQEA 1Q8IA 2Z6KA 2H4OA 2NTSA 2NWGA 1L0WA 1EWIA 3R3OA 3H6MA 2K28A 4C3HG 2N88A 3GTQB 4G7OC 2WB1E 4X3UA 1Y1VH 5IT9L 2BE5D 1TR5A 2WAQG 1YJWA 1UNSA 4PQXA 1PTOD 1YNND 5K5PA 1PH3A 3DM3A 2Q8TA 3PIOA 5ELNA 3BVMA 4KD3A 2BDNA 5M5WH 2EIFA 2OWOA 2AMCB 1B3QA 4HSPA 1QNKA 1EY8A 3WDNA 2UUBQ 2LS01 4Q0FA 4DV4Q 1U4LA 4LF9Q 1BDOA 3DUZA 1A3TA 4NXNL 1SLJA 4JI3Q 5M9OA 1V9PA 4A3FH 1HQMC 4O2DA 4DR6L 2GN5A 1VQ7A 3FMCA 2UUCQ 4AH6A 1PFSA 1X3EA 1W6JA 2EYFA 5BN4A 3OW2A 4LMQD 4B3RQ 3HKZG 1TKWB 4A3IB 1UE5A 4I7AA 5CV6A 2BOSA 2B63H 4LFCQ 1BF4A 1K73C 3CKIB 1G6PA 4M1UB 4DR2L 4JI5Q 5FLXL 2JQOA 1XPOA 3PO2H 5ELOA 4IUVA 2ENBA 5FO8B 3DEPA 4BBSG 2I5LX 3IAYA 3OTOL 3HOVG 1S5FD 2HIVA 2RCFA 1OXVA 1UE1A 3MFGA 4HIDA 2XSCA 4JI8L 4NXML 3MC0B 4YWLA 4DR1Q 1Z47A 5LMUL 2MPMA 4NB3A 4NKLA 3CCVA 3TS2A 1FNWA 3HOXG 1EY0A 1CZGA 1BOSA 1QUQA 1L2FA 4IO9A 3FKIH 2LXJA 2X69A 1WTXA 1HTLD 4A93B 4BY1B 4ME5A 4JYAQ 1C4QA 2WINB 4RHRA 4GOPA 1VF5C 5IWAQ 1C8CA 5M3MG 1JOOA 3CPFA 2Z4HA 1BQQT 5IGGA 2Z4IA 3SE0A 5FO9B 1TWGB 3H09A 5CMDA 4A3GB 2KJXA 4DK3C 1A3VA 4A3EB 4IUPA 1D8LA 2WKCA 2JA7B 2IL8A 1STEA 3HOZB 3M4OH 1M4VA 1LTRD 3S2HH 4X64Q 1VQGA 2IWHA 4N9TA 4DK6C 2YYZA 4C1NK 1Q1BA 2L15A 1BO0A 1V1OA 4GZYC 2A6EC 1IYVA 2E8GA 4RHSA 2D5DA 2R92B 1PZID 3TMEA 1HR0W 4YWKA 4GOPC 3I72A 4IFDG 3UI2A 4AYBE 2I5MX 3TRZA 3RD4A 4KMUC 2UXCQ 3KF8A 1E3PA 2F0DA 4WJWA 4RGMA 1W2BA 2PZTA 5CV7A 3AMUA 1IBLL 4AQYQ 2Q2UA 1MSGA 3QR8A 5CGKA 4YCVA 1IBMQ 4GN3B 2KUMA 4CJ2C 2EPBA 4I7ZC 2VS1A 1U9RA 2EYMA 3E3XA 3CCEA 1WJJA 5ELCA 4EQPA 3HOYH 1TWAH 1HA5A 2RQXA 1H9RA 1X9NA 4DR3L 1Q46A 5CYUA 2CH4A 3O13A 1WD1A 4BA2I 3T16A 3J81L 4DAMA 4P73A 2HQEA 1S5DD 2PQAA 4MIUA 2EY2A 4LF7Q 3H3VH 3CRKC 1ENCA 4HIMA 2F0MA 1GOZA 1UEBA 1X3FA 5IP9H 1JB3A 3A56A 1XMOL 4HR7B 5I2YA 3M85A 1EOTA 2J4XA 4XDXA 1EFWA 5IYBG 4V190 1AE2A 3HZXA 3CC7A 4IJHA 1AEXA 4OONA 1F9RA 1V1PA 2MO1A 1HTPA 1XNRL 3E9HA 3U9OA 4A3JG 3PO3H 4KTAA 2VQEQ 1W3SA 1RKNA 1HCZA 1NMFA 3S17B 2E76C 4KY5A 1J5EL 2F0UA 1S72A 2E2HH 3W1GA 2JSOA 1K8OA 2ZM6Q 4EVOA 5C44H 2F1MA 2EYOA 3A8IE 2A69D 1XYIA 1SNDA 1VF7A 2K32A 5GAEC 2GVAA 4C3IH 3BDOA 3TP6A 1Y1WG 2NVQH 4A3CG 5C5MA 1J8IA 2E5LL 1OXTA 1N33L 1NCVA 3NTIA 1ICWA 4PZ7A 4HIOA 4K6LA 1B2TA 1CQFA 1ZEQX 2EOTA 2WKDA 2OTLA 4A3GG 3NBIA 2FMCA 1TQOA 3K8AA 4MTNA 3S14H 2K5HA 1Y14B 3R93A 2KENA 3N6RA 2KECA 4PMWA 1Z9FA 4A3KB 4LF6Q 3LNNA 2HCCA 1I94L 2R7ZH 3KF6B 1U4RA 3ND8A 3KBGA 1N8RC 1JJ2A 5C5LA 1PZKD 3RZDB 3CU7A 4B3TQ 4HIKA 2XRQD 1PH4A 1II3A 3HOUH 1JC7A 2D2CC 2PMZB 4GLAC 4KD4A 4JOIA 5J1ZA 2NVXB 3QIAA 4DNIA 2MJ8A 1VQ8A 2NVYH 4H7BA 5EKKA 5TSSA 5KRUA 1CQVA 1HNZQ 3L0OA 2DJGC 1KNAA 2LSSA 4JV5Q 4PNYA 5I6WA 1EIYB 4QIWE 2K5NA 2K1BA 3NQIA 3TZDA 2NZOA 1S4ZA 4NPSA 1Y69U 5JEAG 2CWAA 4R4CA 4IUNA 2EJMA 4PZ8A 4WORA 1Q3LA 4GKKL 4JOIC 3PIO3 1KTKA 1DJRD 2EYLA 3Q0AA 3AEVA 5C3EG 3ERQA 4GKJL 5DM73 1CKNA 3K5OA 3L9AX 5K36H 2F0HA 1VQCA 4PG3A 1X6OA 3UE0A 5FKAC 3TN2A 5DEHA 3PUYA 2HUGA 2ZJQA 1RIPA 1R9TB 2JA5G 4CBVA 1STGA 1QB5D 2VNUD 2VUMG 4H13C 2A73B 1RJTA 2OCEA 3AFQA 4FXKC 1K0RA 1WCMB 3HRZC 3GTJB 2PI2A 3D4RA 3LWEA 2F0EA 1KDCA 2HDMA 1I4QA 2AWOA 4DNRB 3KDFB 3KLWA 2XN9C 4X62L 2O5IC 2ZJRA 1YI2A 4A3DG 3HOWB 3J80E 2IY5B 1G6ZA 3CCQA 1EFID 1LTGD 5DM63 2BDOA 3H0GG 1BVSA 3AQQA 1MIUA 5M3FH 1OO9B 3WOFA 2C35B 3UDIA 4JBJA 3DWQA 3T1YQ 3SK4A 3D6CA 2KCCA 3WWVA 2A68D 4B3SL 1TIID 3EA6A 1PMRA 5J22A 2PNRC 1IZ6A 2EXDA 1CZWA 2PCFB 4X66Q 1HXYD 2PI2E 2B2TA 3KUPA 1DD2A 4N9PA 4GNXA 5IGBA 4MZ9A 5JJLA 3CQZH 3H15A 3AFPA 2NUCA 2BA0A 3S2DH 4FVMA 3N52A 5KNCA 1M90C 3HS0C 1WTVA 1R4PB 1I3QH 4XQQA 4L5TA 4LFBQ 4ZRZA 4A3BH 1ENFA 1SYBA 4UP9A 1CK1A 4K2LA 1YIJA 5KIXA 1BNZA 2WP8J 4FP5D 3Q23A 2NBFA 3CHBD 3BZKA 2J7ZA 4JG2A 5ISRA 4CDDC 5IYCG 3FVQA 4ZAIA 2B2TC 3PUXA 4IUQA 2HHHQ 3GTMB 4GNXC 2JA6H 1VQHA 3D6WA 1J9OA 1B1ZA 4XQNA 4JI7Q 3HKZE 5C4JB 4L5SA 4OEMB 5CV8A 1HZCA 1AZPA 4NDXA 4P74A 2K03A 1SRUA 1UWVA 3HG9A 4RFBA 4B9WA 4OO1G 3E9IA 1HRJA 4BY7G 3OWFA 1SNMA 4ZKBB 4CDCC 2X6LA 4BXXG 3PSIA 4C3HB 1XPUA 3TS0A 2O5JC 5A2QL 4LNQA 4JI2L 4JI4Q 1TWCH 1XTCD 5M5XH 4RGTA 1CSPA 2PZWA 2WAQB 4G7ZC 3I4MH 2CW0C 1XJVA 4JW0A 1I6HB 4NMZA 4V0BA 3NELA 3C1FA 3I4NG 3JC66 2WIIB 4K5WA 1FR3A 2B2WC 1CSQA 4X65Q 1N36Q 3X3NA 4PV1C 2K5DA 2R61A 3T1HQ 1TWFB 1I4RA 4BBRH 1SYEA 1Q86C 1K8MA 1K3BC 4F8MA 3OYYA 1T5XD 3LX0A 2AQ2B 1V1QA 5NUCA 1H9SB 3IRBA 4DV5L 1XMQL 3K0XA 3VA7A 4DR7Q 4UDUC 3GTLH 3UDFA 3S16H 3GTOH 4YY3L 3VR6A 4POFA 1MI2A 4P2CB 3EN2A 5IP7G 1IXRA 4UHVA 2L12A 1C0AA 4KK7A 4HCSA 1EZ8A 3M3YB 2KBNA 5G3LD 4B08A 1PV4A 2Q2TA 4OWWB 3OSOA 1ZYRC 1E2WA 2C5CA 4FYDA 4DR5Q 2JA8G 3W5OA 4OXPA 3VR4A 5EAYA 2N55A 4J15A 2K01A 2D62A 2O2LD 5IGFA 3TP7A 2F0IA 3VYTA 2XTIA 4DU9A 1BBUA 4DV3L 2E2JB 3PUWA 5LHY1 1NBWA 5H1SE 1PXUA 4BBSB 4F7XA 1B7YB 5J39A 2AUKA 2RDFA 3JAMc 3HOVB 1VQIA 3R2IA 1Q1EA 4GLVB 4LFCL 1DZ1A 4KY7A 1YVCA 3CC2A 3SEBA 5IYDH 2QEXA 3ULPA 1SFOH 3GTGB 2OTJA 1Z6HA 4OX9L 5GROA 3F2BA 3PGZA 4QL5A 1A2TA 1B3AA 3HOXB 3NWTA 3PV0A 4TSSA 2ICEC 3HP3A 4WFN3 2VB2X 4JC0A 1BBXC 2R93H 1RL2A 2ID0A 4DV0Q 1GD7A 1Z7TA 4K14A 1K83H 4RWSC 4L5RC 2NVTB 4EQNA 4RGOS 4C3JH 5M3MB 2MGSA 4FF3A 1M1KC 1C9OA 2NN6I 4C2MB 1HNWQ 3BYYB 1L1OC 1VQ9A 4JI6L 2FINB 1GUTA 2UUAL 4CHTB 4G57A 3EROA 1SNQA 1I50B 4LUVA 1PYBA 3GTKB 1PH1A 2VB3X 1ENAA 1CI3M 4WJ4A 1A0IA 1SE8A 1JICA 1IBKL 2P5ZX 4Z9CB 4CGYB 3H3VC 4IURA 3D31A 1QVFA 4Y7NB 3NQTA 1A3UA 4ZCKA 1X3PA 1MGSA 4LF8L 4RG1A 1M8AA 2F0JA 4TRDA 1PLFA 2A6ED 2NB0A 1EWCA 4JI0L 4A3LG 3UE1A 2F0NA 2KCMA 4IFDJ 5ELFA 2I07B 1EU3A 3HFZB 1SYCA 1DOLA 1CHQD 1NSNS 1KRSA 3PF5A 4IUTA 3G71A 2Z6KC 1VQMA 1I4PA 4FF2A 1B9MA 5E4WC 3CD6A 5I6YA 1EYAA 4O42A 3AU7A 4K0KL 3G7LA 4A3MH 3RLOA 2Z8LA 1B53A 3UDXA 1FJGL 3SVMA 4XT3B 2JEAI 5C3XA 2WACA 2VQFL 1AZQA 1VQJA 3GP7A 3S15B 3OMGA 2QF7A 3FRPB 1Y1VG 1SJHD 5E7NA 3RR5A 1EIFA 2GA4B 4CKCA 1AFPA 5JAVA 1HR0Q 4UY8C 1WFQA 3NWSA 5C4XH 3HKSA 5EPLA 3CCUA 2KCTA 1IL8A 1X65A 2B2YA 1GXDC 2K5QA 1S3OA 1TU2B 4DR4L 3UDGA 2G5DA 3J80L 3F8TA 2E2DC 3MVVA 3KOJA 2QDLA 1N9WA 1D5MC 4ZKCB 3S1QH 1SE3A 5KGUA 1ILQA 1I4HA 2L55A 2EYHA 2UXBQ 3BDCA 2Z6BA 3NBHB 3SXHA 4XIGS 1VMPA 2UXDL 1EL0A 4A3FG 5LMNQ 2AQ3B 4IZ8A 1JWSD 4A3JB 1XNQL 3S1MH 4ODGA 2B2UA 1KAAA 1LTSD 1Q90A 4HJ8A 1MHWC 1SN8A 2B8FA 1GKHA 1ET6A 4KLKA 2EYJA 2B2YC 4LK1C 2KCNA 5JPMC 3STBC 3E6ZX 1SSOA 4DXGA 1F2ZA 1E1TA 5M5YH 4A76A 2B63G 1U0LA 3NUCA 2ZTEA 3NP8A 1PH6A 3GTPB 4DK0A 2IHEA 4KHPL 3KK7A 1Y1WB 2LMCB 1XXGA 3Q8DA 2HDLA 4KKTA 3GTQH 3QJYA 4DAYB 4DAPA 5HURA 1YJNA 1STNA 3PO2G 1TT2A 3CF5A 2B2UC 1AN8A 2B8GA 4GN5A 4KKSA 4DPGA 1PRTF 1NAPA 1YNXA 1B9NA 3OPOA 1H9JA 4L8JA 2F0VA 3A7LA 1YHAA 4IQZA 4KJNA 4DV1L 4HJAA 4H0LC 2EVBA 4YHHL 1SYGA 2PZUA 1PZJD 2F4IA 1HH2P 4DGZA 4EQ5A 2JEBI 2CH4W 3FKIG 1CT1D 5LL6X 3KFUA 2YTXA 3U50C 2I0QA 4OELB 2OF1A 4IPHA 3SDZA 4OWXB 1Q12A 4DV6L 2HCIA 2SNSA 2F0SA 5A2QE 4KY6A 1K8AC 3PQIA 3KF6A 4NXNQ 5C3WA 4A3IH 1GUWA 1JCKB 1STYA 4DR6Q 3BZDB 1PYSB 4HJ5A 2ZJPA 1CA6A 2GVBA 3ICEA 3K7UC 4LFAQ 3ZYYX 1HUMA 5LMNW 3RZOH 3OIPA 1AH9A 1CM9A 2A8VA 2F0TA 4DUZL 4UP7A 4APVA 4JCVE 4IJLA 3S1NH 4DUYL 4XYOA 1LM0A 4L63B 4P75A 1PH5A 3I4LA 5C3EB 2AKWB 2DY7A 3I7FA 2DJFC 4DV2L 1D6EC 1S5BD 1GUGA 1RF2D 4DR2Q 2JA9A 2D9UA 3H91A 1CTMA 4DAVA 1K28A 1B50A 1DOKA 4H44C 4QY7A 5EBDA 2JA5B 1J6QA 2VUMB 2PMZE 4DV7L 4JVZA 4U68A 3OTOQ 1TS2A 1H95A 2VW9A 1JORA 4R4QA 4UP8A 1A6XA 3TDQA 3MHBA 1RODA 1GUSA 4JI8Q 4NXMQ 4C56C 3NPPA 3HOYG 3CC4A 5LMUQ 3J81j 1LACA 2HIXA 3M4YA 5JVG3 4BY1H 2YU9B 4UPAA 4A93H 4A3CH 4A3DB 2VY3A 3RUZA 3KYHC 3H0GB 1DGSA 4S3SA 3CMAA 3S24A 1TWHB 1UE6A 2WB1G 3NTKA 4F88A 1TWGH 4IOCA 2IT1A 4A3GH 5DAUA 1EZ6A 1XWEA 1PTOB 4A3EH 5L37A 4X3TA 3TEHB 3K7AB 1KXLA 2JA7H 5HY6A 5IP9G 3HOZH 5CORA 3KDFA 1U5KA 4HSVA 1L0YB 1V43A 2NN6H 3JAML 2M9VA 2I46A 2SEBD 1Q81C 3TSSA 3TZUA 1CKMA 1STHA 3LGJA 2R92H 4L5QA 5C0XI 1BUVT 2KOLA 5BR8L 3J7AV 3PO3G 2K5WA 3G6EA 1B8AA 4HMIA 3CAMA 4ZQ3A 2N8NA 3EJIA 3KLSX 5ELEA 5C44G 1EU4A 3PF4A 1LTTD 1FNUA 1S5CD 2RHQB 2B39A 5FO7B 4FDBA 1JJGA 3FEWX 3I4OA 1N32L 5EBCA 1F9PA 4OWTB 4F87A 2UU9L 1PVOA 4C3IG 1IBLQ 4FNFA 1ML0D 4QQBX 1ZXTA 3EQLC 4KHZA 3C2PA 1EYDA 2FFKB 4ALPA 5IT9c 2Y0SB 2C9OA 4RAUC 4ZYSA 4BY7B 4IALA 3KBXA 4ULLA 1MSHA 1LTAD 2FHTA 3ER0A 1EYCA 3L3OC 2RSOA 2ZXRA 3I8ZA 5JJIA 4JPBW 1IYJB 2R7ZG 1F2YA 2E75C 2PQAB 1IW7C 1X3QA 1WTQA 4RKBA 3I4NB 3V96A 1TXYA 1VQFA 1HJPA 3HOUG 1HFGA 4LF4L 1SNCA 1JR0D 4MN3A 2OXPA 1XMOQ 2SOBA 1VQOA 1BCPD 2XNAC 5E1FA 4A75A 3S17H 2F4VL 1A63A 4YIJA 5IE8A 3L2PA 2KEEA 4DK1A 4DNTB 1HNXL 1XNRQ 4FO2A 1MKHA 1KQSA 3J7AF 2IW3A 3MA2B 2KA7A 1WTWA 3J80i 4JI1L 4LF5L 2Q8IB 1J5EQ 1VQDA 4K2KA 1GO3E 1SJED 1EYGA 5FLXc 2F0GA 1KHIA 2BH8A 2JA8B 1QZHA 2TMPA 2EYPA 4K5XA 2IX3A 3I56A 4B3ML 5K36G 3M9BA 5JJKA 3GO5A 3MWYW 3E5SA 1DYQA 1VQAA 3IKJA 1WI5A 4RMFA 1N33Q 2WAQE 2A5HA 4A3KH 2QW7A 1LLRD 2RDHA 1FGUA 4AYBG 2IX1A 2PO4A 4MNOA 4DA2A 3RZDH 1YHBA 3M7GA 4LUOA 3MFYA 2NVXH 4J6HA 3GTLB 4G7HC 2QKIC 3PCOB 1YZ6A 4QUFA 1PRTC 3I91A 1I94Q 2JN4A 2V1CC 1SBBB 2A19A 1SAPA 3J7A5 1O7LA 3PUZA 3DLLA 3E0EA 3CCMA 1G91A 5M3FG 4XTCS 1S40A 4POGA 5C0XJ 2ALYB 1A2UA 2E2IB 3Q6SA 2LKVA 1YNJC 4Y52H 3EIVA 2F03A 1VQNA 1JMCA 3OIQA 2RVLA 2L9HA 2QEJC 4K8JA 1HQRD 1N34L 1QCBD 1JOKA 1SMYC 1K0SA 3FDTA 4B9XA 3RN5A 5AJ3Q 1VQ4A 1HZ9A 1X56A 1ESFA 5BN3A 3HEJA 2MNAA 2AQ1B 1E0BA 5FLMH 3BVGA 3A0JA 2Y0SG 4WRDA 2PYKA 3FPUB 1D1KA 1V8QA 4BS9A 2HD3A 4X3KA 4LWCA 1LT3D 3S1RB 2R7DA 4HMJA 4IFDI 1ICFB 3MXUA 4GKKQ 1UAPA 5EPJA 3BVZA 4A3BG 1R9TH 1LYLA 1QOHA 3F2DA 2MUYA 4GKJQ 2IPKD 1MJCA 1GHJA 1WCMH 1CKNB 3MEHA 3GTJH 1S5ED 2DUDA 2Z9HA 1QWYA 1PFNA 4HEDA 2LXKA 1HFNA 4K5VA 3K0YA 3RMHA 2JA6G 3J81i 3T56B 4DF7A 1C7YA 3HOWH 3A74A 4CKBA 1PTOF 3K6OA 4ZK9B 3RN2A 5CC4A 2J0TD 3J81c 5FJ8H 4JK1C 2O4XA 1VQBA 1WYDA 1TS3A 3NSWA 1BKBA 1K8GA 4X62Q 2MHVA 1LT5D 3U4VA 2OEOA 2EE1A 5IY0A 4GN4B 3PIPA 1Y1VB 3OHXC 1HHVA 2NYZD 3I4MG 1SEBD 1RCVD 2UUBL 4DV4L 3VR2A 4GS3A 4LF9L 5T1IA 2JE6I 1G2TA 2NZ1D 4B3SQ 3GQBA 1YEZA 4JI3L 2BH2A 2L4NA 3EVQA 5M5WB 1F2MA 1TS5A 2K4KA 5LL6S 2XVSA 4BBRG 2UUCL 1RD9D 3V2TA 1LT6D 5JOBA 1I4XA 2IX0A 4RH6A 3MXPA 3CCJA 1G291 5C0XH 5GQOA 5D14A 4B3RL 3QG1A 2Q2HA 3M4QA 3F1ZA 4A3FB 1E2ZA 1GVPA 3D3RA 3M7NA 1D1IA 3GTMH 2X6GA 1XPRA 1O78A 4JI5L 1QILA 5C4JH 1L0XB 5D65A 5KYLA 3JAME 3I2ZA 2K04A 2WFWA 5BN5A 2B63B 1NNXA 4FF4A 2RA4A 3NBHA 1LTID 4J1MA 1A62A 3STBD 2PW5A 5I4DA 2RDGA 2RHSB 3W3AA 1JQYD 4C3HH 3NXWA 4KV6A 3PO2B 1BCPB 4DR1L 1ZKOA 4ZUIA 1A8VA 2DY8A 4KKUA 1I6HH 4R8IA 1WOCA 2FJ2A 3IFTA 4N8X1 4IPCA 1KLGD 1KIXA 2YV5A 1MJEA 4OIKA 1PA6A 4HJ7A 4LAAA 5AFWA 4JI2Q 1TWFH 5IYDG 4XYQA 1VQ5A 5CV9A 4PMCA 4JYAL 4DAYA 2KHJA 3NHHA 3U58A 3G6JB 3C3LA 5IWAL 1GUOA 4FF1A 1ILPA 3MXNB 1NJIC 1VQKA 1JWMD 3FKIB 5M5YB 1FL0A 2ATWA 1EY5A 2R93G 1VS0A 1BBWA 4TKOB 2IJ0A 1I4GA 1JT8A 2K75A 3G4SA 1A15A 2CQOA 4C3JG 4CDEC 3NTHA 4X64L 3BZCA 2CQAA 4DV5Q 2A6HC 1XMQQ 2K50A 3M3YH 2I5HA 2M2LA 2K33A 2QDBA 2VXWA 3D0FA 3SR1A 5JVH3 2XGTA 2A1AA 2CVRA 3I55A 4QCLA 3URYA 4YY3Q 3CXCA 2D0OA 1X55A 2EQSA 2F0WA 3M4OB 3S2HB 1QG7A 1FGBD 1Y8NB 1Y8PB 1H9MA 3NE5B 2E2JH 2UXCL 3ZJYC 5GAGC 4BBSH 4KHVA 4AQYL 3R8BA 1G2SA 1D5XC 1EY9A 3HOVH 1JOQA 4RCNA 1XX8A 2JK8A 1IBML 1SXTA 2EZVA 2EY5A 4A4IA 4DV3Q 1UEAB 2ICIA 1JE4A 5IIFA 2G9DA 5CR3A 4LFAL 1SDFA 3CP0A 3GTGH 3HOXH 2AUJD 2CKZB
chains in the Genus database with same CATH topology
1BR9A 1KDAA 2DNCA 1EY7A 5HGTA 3HOYB 4OIJA 5C6AA 3A55A 1WTPA 1TWAB 1EY4A 3RZOB 2AWNA 3OWEB 3I3CA 3F2UA 3MAQA 3S1NB 1SNPA 3GD7A 3K5MA 2WB1B 5ELDA 5C4ZA 5IGEA 2XRSD 5EGTA 1G8ZD 3C1EA 1DOMA 1RTOA 4IUUA 1IHZA 3TP8A 3X3MA 3A54A 3VA5A 3T13A 1E2VA 3QOLA 2F0LA 1OXXK 2L11A 1EQVA 3P7JA 4IFDH 2H1EA 3PO3B 3OMCA 1RHPA 3Q24A 4RGNA 2FMMA 1U4PA 4KN7C 2E2HB 4CKEA 1DM0B 1SYFA 2F0OA 2PPBC 1VCIA 5C44B 3TP5A 4RCOA 3T53B 1EY6A 2KEDA 1R4QB 1WD0A 3DXJC 5IOCA 4OO1I 2LFNA 4MHEA 2BE5C 1LV9A 4C3IB 2NVQB 4PMBA 3K5NA 3SK5A 1PTOC 2EDGA 1YNNC 4DFAA 3QWNA 1RTNA 3P1HA 1CA5A 1SNOA 2B2VA 5IGDA 5JJZA 3S14B 2F0KA 2F0FA 2XIWA 5JEAJ 3MTSA 2R7ZB 5EPKA 3PMFA 3DM1A 1IKLA 5EJWA 5D3IB 3HOUB 3QB3A 2RKSA 1IW7D 3D4DA 2G9HD 4U673 2NVYB 5CV4A 4KN4C 3PUVA 2B2VC 1O7YA 3WOEA 3V05A 2F3WA 4M8AA 3PIP3 3DWPA 1KNEA 2ZT9C 4OHJA 1BCPF 1KABA 3RLFA 1PDQA 1B44D 4HCEA 4RA8A 4J8QA 4KJOA 4DXFA 4OGQC 3D8GA 1HPCA 3DHQA 3GV6A 2EJGC 5F2DA 1OXUA 3R2TA 4AYBB 2MP1A 3IFDA 3W2DA 3J7YW 2RBMA 1AW7A 3P75A 4HN7A 3U9SA 5C4HA 3BYTB 1PRTD 2CHBD 5M3FB 3DEOA 1C48A 5E4XA 1EIHA 5KNDA 2R6GA 5JEAH 1VMCA 4LJZC 2RSNA 4QB4A 1RDPD 4EQOA 4Q5VA 1OXSC 3IL8A 4K8IA 1YNJD 2NN6G 3T51B 3CQZB 3I73A 4CJ1B 1SMYD 3S2DB 4L6TB 3BG3A 3D4WA 4BWGB 1GHKA 2KQ3A 3VYSA 4HAEA 2QCPX 4UAIA 1I3QB 2F0PA 5KEEA 4A3BB 2DN8A 1QJOA 2ZXOA 5IT9E 5KYIA 1F9SA 1SYDA 2M00A 1HUNA 2CW0D 5EKIA 1EIGA 1TY0A 4FXGC 2JA6B 2SDFA 4O1NA 2BCOA 2XWJB 3FPPA 4ILWA 3VYRA 1CHPD 5I9OA 2NTTA 1V1PB 2V4DA 4TQUS 2LY7A 1GJXA 1PTOH 4ID6A 1MD2D 5JPNC 1PYWD 2TSSA 3Q22A 2L0CA 2K05A 5A35A 5COYA 1LT4D 1U4MA 2E74C 1O80A 5DNFA 5EQ0A 2K7VA 1TWCB 5M5XB 2PW7A 1NUCA 3I4MB 4I65A 3K58A 1H9SA 3SK6A 4QUCA 2F0QA 3E0JA 3DWAA 1BXTA 3I90A 1ZYRD 3T4AC 5G3LF 4BBRB 3QO2A 5FLXE 4R9WA 1FNVA 2A69C 4R8NA 1F2LA 4NW2A 3S16B 4QIWB 4DN4M 3GTOB 1D5ZC 5I9PA 1VDZA 1I6VC 4EGVA 3S9WA 1SE4A 1T5EA 1IYUA 1EEID 3BDLA 4JBWA 1LABA 4G4KA 4OO1H 1DONA 1F77A 3KLRA 4ZUJA 2L5TA 1LTBD 1HA6A 2Z1CA 3OW7A 5E3FA 1NR2A 1FYCA 1STAA 2XWBB 1PFMA 3KLSA 5KNBA 2SNMA 2OT2A 2A74C 1X32A 3ONAB 3OOCA 4RKLA 3GV3A 1SE2A 1EEFD 4ABNA 3P20A 1SFOB 2B2WA 3QOJA 2WV6D 3ITPA 1DXMA 2KVMA 2Q8RE 1O7ZA 2F3VA 1KLUD 3SK8A 5CBAE 1ONLA 2R93B 1UUPA 4XQJA 1WVLA 5D3DA 4OL7A 1K83B 4HTHA 2BA1A 3AB9A 4C3JB 5I2XA 4X3SA 4XT1B 3SHLA 3VYUA 4FXDA 5FK9C 1H9KA 3MXNA 2A6HD 1WTRA 3A8KE 1BCPC 3VR5A 3EFXD 2DNEA 1Y8OB 3I70A 3MZ5A 4NP5A 1AP0A 2QILA 1PRTB 3J81E 5IODA 3A8JE 1EQTA 5CBEE 2ZXPA 1F9QA 1W6KA 2PQEA 5ELBA 1EWHA 1JWUD 3ND9A 5FOBB 3HKZB 2A68C 3CRLC 4A3MB 2R3ZA 1D2BA 4C1NI 4KI0A 3VR3A 3BS1A 2KHSA 1MBYA 3K57A 4QF4A 4E6IA 3L7ZC 3HGBA 2JXMB 1FD7D 5C4XB 2EY1A 1STBA 4QMGA 2EY6A 2K6AA 4ZLTF 2EJFC 1ESRA 1DCZA 5IGCA 2EXZA 2L1BA 3TBIB 1B4OA 3S1QB 1PFBA 4BA1I 3C46A 3DMUA 1TVXA 1TY2A 5C0XG 1WTOA 3K59A 3MXGA 1NR4A 1QE6A 1IKMA 3S1MB 1LO5D 2JYOA 3H94A 2JP1A 3A7AB 1CFMA 4IN3A 5CV5A 3K5LA 1KDBA 1QNUA 4CJ0B 1TS4A 5T1GA 4K6DA 4XXEA 3NK9A 1GUNA 3LWUA 1ET9A 1Q8IA 2H4OA 2NTSA 2NWGA 3R3OA 3H6MA 2K28A 4C3HG 2N88A 3GTQB 4G7OC 4X3UA 5IT9L 2BE5D 1TR5A 1UNSA 4PQXA 1PTOD 1YNND 5K5PA 2Q8TA 3BVMA 4KD3A 2BDNA 4HSPA 1QNKA 1EY8A 3WDNA 2LS01 4Q0FA 1U4LA 1BDOA 3DUZA 1A3TA 5M9OA 1HQMC 3FMCA 1W6JA 2EYFA 5BN4A 4LMQD 1TKWB 4A3IB 5CV6A 2BOSA 1BF4A 3CKIB 4M1UB 5FLXL 4IUVA 2ENBA 5FO8B 3DEPA 3IAYA 1S5FD 1OXVA 3MFGA 2XSCA 3MC0B 1Z47A 2MPMA 4NKLA 1FNWA 1EY0A 1CZGA 1BOSA 2X69A 1WTXA 1HTLD 4A93B 4BY1B 4ME5A 1C4QA 2WINB 4RHRA 1VF5C 1C8CA 1JOOA 2Z4HA 1BQQT 5IGGA 2Z4IA 3SE0A 5FO9B 1TWGB 3H09A 5CMDA 4A3GB 2KJXA 1A3VA 4A3EB 4IUPA 2WKCA 2JA7B 2IL8A 1STEA 3HOZB 1M4VA 1LTRD 2IWHA 4N9TA 2YYZA 4C1NK 1Q1BA 1BO0A 1V1OA 4GZYC 2A6EC 1IYVA 4RHSA 2D5DA 2R92B 1PZID 3TMEA 3I72A 4IFDG 3UI2A 3RD4A 4KMUC 3KF8A 2F0DA 4WJWA 4RGMA 2PZTA 5CV7A 3AMUA 1MSGA 5CGKA 4CJ2C 2KUMA 2EPBA 4I7ZC 1U9RA 2EYMA 4EQPA 5ELCA 1HA5A 2RQXA 1H9RA 5CYUA 3O13A 1WD1A 4BA2I 3T16A 3J81L 2HQEA 1S5DD 4MIUA 2EY2A 3CRKC 1ENCA 2F0MA 1GOZA 1JB3A 3A56A 4HR7B 5I2YA 3M85A 1EOTA 2J4XA 4XDXA 4V190 3HZXA 1AEXA 1F9RA 1V1PA 1HTPA 3U9OA 4KTAA 1RKNA 1HCZA 3S17B 2E76C 4KY5A 2F0UA 2JSOA 1K8OA 4EVOA 2F1MA 2EYOA 3A8IE 2A69D 1XYIA 1SNDA 1VF7A 2K32A 3BDOA 3TP6A 5C5MA 1J8IA 1OXTA 1NCVA 3NTIA 1ICWA 4K6LA 1B2TA 1CQFA 1ZEQX 2EOTA 2WKDA 3NBIA 2FMCA 1TQOA 3R93A 3N6RA 2KECA 4PMWA 4A3KB 3LNNA 2HCCA 1U4RA 3ND8A 3KBGA 5C5LA 1PZKD 3RZDB 3CU7A 2XRQD 1II3A 1JC7A 2D2CC 2PMZB 4KD4A 5J1ZA 2NVXB 3QIAA 2MJ8A 4H7BA 5EKKA 5TSSA 5KRUA 1CQVA 1KNAA 4PNYA 5I6WA 2K1BA 3NQIA 3TZDA 1S4ZA 1Y69U 5JEAG 4IUNA 2EJMA 4WORA 1Q3LA 3PIO3 1KTKA 1DJRD 2EYLA 3Q0AA 3ERQA 5DM73 3K5OA 3L9AX 5K36H 2F0HA 5FKAC 3TN2A 5DEHA 3PUYA 2HUGA 1R9TB 4CBVA 1STGA 1QB5D 2VNUD 4H13C 2A73B 1RJTA 4FXKC 1WCMB 3HRZC 3GTJB 3D4RA 3LWEA 2F0EA 1KDCA 2HDMA 1I4QA 2AWOA 4DNRB 2XN9C 2O5IC 3HOWB 3J80E 1G6ZA 1EFID 1LTGD 5DM63 2BDOA 1OO9B 3WOFA 3DWQA 3SK4A 3D6CA 2KCCA 2A68D 1TIID 3EA6A 1PMRA 5J22A 2PNRC 1CZWA 2PCFB 1HXYD 2B2TA 3KUPA 1DD2A 4N9PA 5IGBA 2NUCA 2BA0A 4FVMA 3N52A 5KNCA 3HS0C 1WTVA 1R4PB 4XQQA 4ZRZA 1ENFA 1SYBA 1CK1A 4K2LA 5KIXA 1BNZA 2WP8J 4FP5D 3Q23A 2NBFA 3CHBD 2J7ZA 5ISRA 3FVQA 4ZAIA 2B2TC 3PUXA 4IUQA 3GTMB 3D6WA 1J9OA 1B1ZA 4XQNA 5C4JB 5CV8A 1AZPA 4NDXA 2K03A 3HG9A 4RFBA 4B9WA 4OO1G 1HRJA 3OWFA 1SNMA 4ZKBB 2X6LA 4C3HB 2O5JC 5A2QL 1XTCD 4RGTA 2PZWA 2WAQB 4G7ZC 2CW0C 1I6HB 4NMZA 4V0BA 3C1FA 4K5WA 2WIIB 1FR3A 2B2WC 3X3NA 4PV1C 2K5DA 2R61A 1TWFB 1I4RA 1SYEA 1K8MA 4F8MA 1T5XD 3LX0A 2AQ2B 5NUCA 1H9SB 3VA7A 4UDUC 3VR6A 1MI2A 4P2CB 2L12A 4KK7A 4HCSA 1EZ8A 3M3YB 5G3LD 4B08A 3OSOA 1ZYRC 1E2WA 2C5CA 4FYDA 3VR4A 2N55A 2K01A 2D62A 2O2LD 5IGFA 3TP7A 2F0IA 3VYTA 4DU9A 2E2JB 3PUWA 5LHY1 1PXUA 4BBSB 4F7XA 5J39A 2AUKA 2RDFA 3HOVB 3R2IA 1Q1EA 1DZ1A 4KY7A 3SEBA 3GTGB 1Z6HA 1A2TA 1B3AA 3HOXB 3NWTA 3PV0A 4TSSA 2ICEC 3HP3A 4WFN3 2VB2X 1BBXC 2ID0A 1Z7TA 4K14A 4RWSC 2NVTB 4EQNA 4RGOS 5M3MB 2MGSA 4FF3A 2NN6I 4C2MB 3BYYB 2FINB 1GUTA 4CHTB 4G57A 3EROA 1SNQA 1I50B 3GTKB 2VB3X 1ENAA 1CI3M 1JICA 4Z9CB 4CGYB 3H3VC 4IURA 3D31A 4Y7NB 3NQTA 1A3UA 1X3PA 1MGSA 1M8AA 2F0JA 4TRDA 1PLFA 2A6ED 2NB0A 1EWCA 2F0NA 4IFDJ 5ELFA 2I07B 1EU3A 1SYCA 1DOLA 1CHQD 1NSNS 4IUTA 1I4PA 4FF2A 1B9MA 5E4WC 5I6YA 1EYAA 4O42A 3AU7A 3G7LA 2Z8LA 1B53A 3SVMA 4XT3B 2JEAI 5C3XA 2WACA 1AZQA 3GP7A 3S15B 3OMGA 2QF7A 3FRPB 1SJHD 2GA4B 4CKCA 1AFPA 5JAVA 3NWSA 5EPLA 1IL8A 2K5QA 2B2YA 1GXDC 1TU2B 3J80L 2E2DC 3MVVA 4ZKCB 1D5MC 1SE3A 5KGUA 1ILQA 1I4HA 2L55A 2EYHA 3BDCA 3SXHA 4XIGS 1VMPA 1EL0A 4A3JB 2AQ3B 4IZ8A 1JWSD 4ODGA 2B2UA 1KAAA 1LTSD 1Q90A 2B8FA 1ET6A 4LK1C 2EYJA 2B2YC 2KCNA 5JPMC 3E6ZX 1SSOA 4DXGA 1F2ZA 3NUCA 3NP8A 3GTPB 4DK0A 3KK7A 1Y1WB 2LMCB 1XXGA 4KKTA 2HDLA 3QJYA 5HURA 4DAPA 1STNA 1TT2A 2B2UC 1AN8A 2B8GA 4KKSA 1PRTF 1NAPA 1B9NA 3OPOA 1H9JA 4L8JA 2F0VA 3A7LA 4IQZA 4KJNA 4H0LC 2EVBA 1SYGA 2PZUA 1PZJD 2F4IA 4DGZA 2JEBI 1CT1D 5LL6X 2OF1A 3SDZA 1Q12A 2HCIA 2SNSA 2F0SA 5A2QE 4KY6A 5C3WA 1GUWA 1JCKB 1STYA 3BZDB 1CA6A 3ZYYX 1HUMA 3OIPA 1CM9A 2F0TA 4XYOA 4L63B 3I4LA 5C3EB 2DY7A 1S5BD 1D6EC 1GUGA 1RF2D 2D9UA 3H91A 1CTMA 4DAVA 1B50A 1DOKA 4H44C 5EBDA 2JA5B 2VUMB 4U68A 1TS2A 1JORA 1A6XA 3TDQA 3MHBA 1RODA 1GUSA 4C56C 3NPPA 1LACA 5JVG3 3M4YA 2YU9B 4A3DB 3RUZA 3H0GB 4S3SA 1TWHB 4F88A 3NTKA 2IT1A 5DAUA 1EZ6A 1XWEA 1PTOB 4X3TA 3K7AB 5CORA 4HSVA 1L0YB 1V43A 2NN6H 3JAML 2M9VA 2I46A 2SEBD 3TSSA 3TZUA 1STHA 5C0XI 1BUVT 2KOLA 3J7AV 2K5WA 4HMIA 4ZQ3A 3EJIA 3KLSX 5ELEA 1EU4A 1LTTD 1FNUA 1S5CD 5FO7B 2B39A 3FEWX 5EBCA 1F9PA 4F87A 4C3IG 4FNFA 1ML0D 1ZXTA 3EQLC 4KHZA 3C2PA 1EYDA 2FFKB 2Y0SB 2C9OA 4RAUC 4ZYSA 4BY7B 4IALA 3KBXA 4ULLA 1MSHA 1LTAD 2FHTA 3L3OC 1EYCA 2RSOA 2ZXRA 3I8ZA 1F2YA 2E75C 1IW7C 1X3QA 1WTQA 4RKBA 3I4NB 3V96A 1HFGA 1SNCA 1JR0D 4MN3A 2OXPA 2SOBA 1BCPD 2XNAC 5E1FA 4YIJA 2KEEA 4DK1A 4DNTB 4FO2A 3J7AF 2IW3A 3MA2B 2KA7A 1WTWA 2Q8IB 4K2KA 1SJED 2F0GA 2JA8B 2TMPA 2EYPA 4K5XA 2IX3A 5K36G 3GO5A 3MWYW 3E5SA 1DYQA 3IKJA 2A5HA 1LLRD 2RDHA 2IX1A 2PO4A 4DA2A 3M7GA 3MFYA 4J6HA 3GTLB 4G7HC 2QKIC 4QUFA 1PRTC 3I91A 1SBBB 1SAPA 1O7LA 3PUZA 1G91A 4XTCS 5C0XJ 1A2UA 2E2IB 3Q6SA 2LKVA 1YNJC 2F03A 3OIQA 2RVLA 2L9HA 2QEJC 4K8JA 1HQRD 1QCBD 1JOKA 1SMYC 3FDTA 4B9XA 1ESFA 5BN3A 3HEJA 2AQ1B 1E0BA 3BVGA 4WRDA 2PYKA 1D1KA 3FPUB 1V8QA 4BS9A 4X3KA 1LT3D 3S1RB 4HMJA 4IFDI 3MXUA 1UAPA 5EPJA 3BVZA 1QOHA 2MUYA 2IPKD 1GHJA 3MEHA 1S5ED 1QWYA 1PFNA 4HEDA 1HFNA 4K5VA 3K0YA 3RMHA 3T56B 4DF7A 4CKBA 1PTOF 3K6OA 4ZK9B 5CC4A 2J0TD 4JK1C 2O4XA 1TS3A 3NSWA 2MHVA 1LT5D 2OEOA 2EE1A 1Y1VB 3OHXC 1HHVA 2NYZD 1SEBD 1RCVD 3VR2A 5T1IA 2JE6I 1G2TA 2NZ1D 3GQBA 2L4NA 3EVQA 5M5WB 1F2MA 1TS5A 5LL6S 2XVSA 1RD9D 3V2TA 1LT6D 5JOBA 1I4XA 2IX0A 4RH6A 3MXPA 1G291 5C0XH 5D14A 3QG1A 4A3FB 1E2ZA 3D3RA 3M7NA 1D1IA 2X6GA 1O78A 1QILA 1L0XB 5D65A 5KYLA 3JAME 2K04A 5BN5A 2B63B 4FF4A 2RA4A 3NBHA 1LTID 4J1MA 2PW5A 5I4DA 2RDGA 3W3AA 1JQYD 3NXWA 4KV6A 3PO2B 1BCPB 1ZKOA 4ZUIA 2DY8A 4KKUA 4R8IA 2FJ2A 3IFTA 1KLGD 4OIKA 4LAAA 5AFWA 4XYQA 5CV9A 4PMCA 4DAYA 3NHHA 3G6JB 3C3LA 1GUOA 4FF1A 1ILPA 1JWMD 3FKIB 5M5YB 1EY5A 4TKOB 2IJ0A 1I4GA 1A15A 4C3JG 3NTHA 2CQAA 2A6HC 2M2LA 2K33A 2QDBA 2VXWA 3SR1A 5JVH3 2CVRA 4QCLA 3URYA 2F0WA 3M4OB 3S2HB 1QG7A 1FGBD 1Y8NB 1Y8PB 1H9MA 3NE5B 4KHVA 3R8BA 1G2SA 1D5XC 1EY9A 1JOQA 4RCNA 1XX8A 1SXTA 2EZVA 2EY5A 1UEAB 2ICIA 1JE4A 5IIFA 2G9DA 5CR3A 1SDFA 2AUJD 5EKLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AWO A;  3ND9 A;  5BN3 A;  2NN6 G;  4DNR B;  5BN5 A;  3BDO A;  2YYZ A;  3WDN A;  1CI3 M;  1Q1B A;  4DK0 A;  1OXT A;  1IYU A;  1T5E A;  1V8Q A;  2DNC A;  3I73 A;  3T51 B;  2O5I C;  4GZY C;  1K8M A;  2A68 C;  1LAC A;  2A6E C;  3M4Y A;  4JBW A;  2LMC B;  1BDO A;  4KKT A;  1LAB A;  1IW7 D;  2BDO A;  3BG3 A;  3MXU A;  3CRL C;  2D5D A;  3QJY A;  3W3A A;  3D31 A;  4OO1 H;  1GHK A;  1H9S B;  4KI0 A;  1HQM C;  4KN4 C;  3VR3 A;  3PUV A;  3I72 A;  3FMC A;  3VA7 A;  4IFD G;  4DK1 A;  3KLR A;  4DNT B;  1ZKO A;  2KCC A;  2A68 D;  1GHJ A;  2L5T A;  2DN8 A;  2A6E D;  2B8G A;  2IT1 A;  3GD7 A;  3N6R A;  1PMR A;  4KKU A;  4KKS A;  4KMU C;  3OW7 A;  3IFT A;  2PNR C;  3VR6 A;  1FYC A;  1QJO A;  5BN4 A;  3L7Z C;  3LNN A;  2ZT9 C;  2PCF B;  2KA7 A;  1B9N A;  3HGB A;  3OPO A;  3ND8 A;  1H9J A;  2JXM B;  1TKW B;  4L8J A;  3A7L A;  1DD2 A;  2Q8I B;  5KNB A;  4IQZ A;  3T56 B;  4H0L C;  4I7Z C;  2D2C C;  1V43 A;  2EVB A;  2NN6 H;  3OOC A;  3RLF A;  1B9M A;  2EJF C;  1ZYR C;  1E2W A;  1DCZ A;  2BA0 A;  3QIA A;  2JEB I;  3TZU A;  1H9R A;  3P20 A;  3VR4 A;  3FPP A;  5KNC A;  4OGQ C;  1GUO A;  2D62 A;  4JK1 C;  5K36 G;  1HPC A;  4BA1 I;  4BA2 I;  1DXM A;  1E2V A;  2JEA I;  3SDZ A;  2V4D A;  1Q12 A;  3IKJ A;  2EJG C;  3PUW A;  4TQU S;  1OXX K;  4TKO B;  5C0X G;  4IFD H;  1ONL A;  1GJX A;  2QF7 A;  1OXV A;  2AUK A;  5A35 A;  1OXU A;  3CRK C;  2E74 C;  4KN7 C;  1Q1E A;  1Y69 U;  2BA1 A;  2K7V A;  2A6H C;  3A7A B;  3AB9 A;  1CFM A;  3H94 A;  3PUX A;  5JEA G;  3VR2 A;  2K33 A;  2JE6 I;  2EJM A;  4HR7 B;  2PPB C;  1VCI A;  3MFY A;  1TU2 B;  4G7H C;  3M85 A;  1IYV A;  1H9S A;  3T53 B;  1H9K A;  3GQB A;  1Z6H A;  3DXJ C;  2A6H D;  1GUN A;  2K32 A;  3LWU A;  3A8K E;  2BE5 C;  3PV0 A;  3EQL C;  4KHZ A;  1Y8P B;  1Y8N B;  1HTP A;  1H9M A;  3NE5 B;  5K36 H;  3I4L A;  3VR5 A;  1O7L A;  3PUZ A;  4PV1 C;  3U9S A;  2DNE A;  1Y8O B;  4OO1 G;  4XIG S;  3PUY A;  2EDG A;  4XTC S;  1YNN C;  1G29 1;  5C0X H;  4G7O C;  1GUG A;  3QG1 A;  1Z7T A;  1HCZ A;  1VF5 C;  4RCN A;  2O5J C;  1CTM A;  1E2Z A;  2BE5 D;  2E76 C;  1Q90 A;  2A69 C;  3M7N A;  4H44 C;  3A8J E;  3SE0 A;  1YNJ C;  4H13 C;  4G7Z C;  1K8O A;  2CW0 C;  5KND A;  2R6G A;  5JEA H;  2B8F A;  2NN6 I;  2F1M A;  1O78 A;  4LK1 C;  3A8I E;  3D4R A;  1VDZ A;  2E75 C;  1SMY C;  1GUT A;  1EWH A;  4LJZ C;  1FR3 A;  1IW7 C;  1I6V C;  2A69 D;  1A6X A;  1OXS C;  1GUS A;  2AUJ D;  1VF7 A; 
#chains in the Genus database with same CATH topology
 1BR9 A;  5DLQ E;  4AIM A;  2ZTD A;  1KDA A;  2DNC A;  1EY7 A;  5HGT A;  3HOY B;  4A3M G;  4OIJ A;  4YCU A;  5C6A A;  3A55 A;  1WTP A;  1TWA B;  4LF7 L;  1L1O B;  1EY4 A;  3RZO B;  1X54 A;  4OX9 Q;  4HJ9 A;  2NVT H;  2AWN A;  3OWE B;  3I3C A;  3F2U A;  3MAQ A;  3S1N B;  1GM5 A;  1SNP A;  2MQH A;  5M3M H;  1IL2 A;  2HQL A;  4CDF C;  3GD7 A;  3J7Z C;  3K5M A;  4C2M H;  1I5F A;  2WB1 B;  5ELD A;  5C4Z A;  5IGE A;  2XRS D;  2RCN A;  5EGT A;  4H02 A;  5C4X G;  1JB7 A;  1I50 H;  4R1J A;  3GTK H;  1G8Z D;  3C1E A;  1DOM A;  1RTO A;  2QGQ A;  4IUU A;  2VQE L;  1IHZ A;  3TP8 A;  3CW2 C;  3X3M A;  4JI6 Q;  1KAW A;  4Y7N H;  3KJP A;  3A54 A;  2UUA Q;  2N78 A;  4QGU A;  3VA5 A;  3T13 A;  1D7Q A;  2JJQ A;  1E2V A;  3QOL A;  2ZM6 L;  2F0L A;  1OXX K;  2L11 A;  1EQV A;  3P7J A;  3VDY A;  1IBK Q;  2H1E A;  3PO3 B;  4IFD H;  3OMC A;  1RHP A;  3Q24 A;  4IPD A;  4RGN A;  1EOV A;  1U4P A;  2FMM A;  4KN7 C;  1CKO A;  1E22 A;  4CKE A;  1DM0 B;  1SYF A;  4LF8 Q;  2E2H B;  2F0O A;  2PPB C;  1VCI A;  5C44 B;  3TP5 A;  1ASZ A;  4RCO A;  4JI0 Q;  3T53 B;  2F52 A;  1EY6 A;  2KED A;  4PZ6 A;  1R4Q B;  1WD0 A;  1AE3 A;  3DXJ C;  5IOC A;  4OO1 I;  2LFN A;  4MHE A;  2BE5 C;  1LV9 A;  1T9H A;  4C3I B;  2NZH A;  2NVQ B;  4PMB A;  3K5N A;  3S15 H;  4LF6 L;  3SK5 A;  1PTO C;  4YWM A;  2EDG A;  1YNN C;  4K0K Q;  4DFA A;  3QWN A;  1RTN A;  3P1H A;  1CA5 A;  2Z0S A;  1SNO A;  4O0A A;  2B2V A;  4B3T L;  3KJO A;  5IGD A;  5JJZ A;  1PH8 A;  2F0K A;  1UE7 A;  3S14 B;  2F0F A;  1FJG Q;  2XIW A;  2VQF Q;  5JEA J;  3MTS A;  2R7Z B;  1X3G A;  5IYB H;  5EPK A;  3PMF A;  1SRO A;  3DM1 A;  1HNZ L;  1IKL A;  5EJW A;  4LUZ A;  5D3I B;  2VL6 A;  3HOU B;  4JV5 L;  1EQQ A;  3QB3 A;  1JJC B;  3TRE A;  2RKS A;  1IW7 D;  3D4D A;  4A3J H;  3ERS X;  4DR4 Q;  1WTH A;  2G9H D;  4U67 3;  2NVY B;  1KL9 A;  5CV4 A;  4KN4 C;  3PUV A;  4R4I A;  2B2V C;  3RLN A;  1O7Y A;  3WOE A;  1CUK A;  3V05 A;  2F3W A;  2YTV A;  3AYH B;  3CCR A;  4M8A A;  1LUZ A;  3PIP 3;  2UXD Q;  3DWP A;  1KNE A;  2ZT9 C;  4A3I G;  4OHJ A;  1XNQ Q;  1E1O A;  1HZB A;  1BCP F;  3GTP H;  1KAB A;  3NEM A;  3RLF A;  1PDQ A;  2K14 A;  1B44 D;  2ZTC A;  4HCE A;  1Y1W H;  4RA8 A;  4J8Q A;  4KJO A;  4DXF A;  4OGQ C;  3B6Y A;  2Y0S E;  3D8G A;  4LW1 A;  1HPC A;  1QUQ B;  3DHQ A;  3GV6 A;  2EJG C;  5F2D A;  2FXQ A;  4KHP Q;  1FVI A;  1OXU A;  1QVC A;  3R2T A;  4AYB B;  4GOP B;  1E7Z A;  2D0P A;  2MP1 A;  3IFD A;  3W2D A;  1YBY A;  3J7Y W;  3BJU A;  2RBM A;  3T1Y L;  1AW7 A;  3P75 A;  4HN7 A;  4DV1 Q;  4A93 G;  4BY1 G;  3U9S A;  5C4H A;  4YHH Q;  2HT1 A;  3BYT B;  1PRT D;  2CHB D;  4X66 L;  5M3F B;  3DEO A;  1C48 A;  4WJ3 M;  5E4X A;  4JBM A;  4A3E G;  1EIH A;  5KND A;  2R6G A;  5JEA H;  4DV6 Q;  2JA7 G;  1VMC A;  3KF8 B;  3HOZ G;  3RNU A;  4LJZ C;  2RSN A;  4P72 A;  4QB4 A;  1RDP D;  4EQO A;  4Q5V A;  1OXS C;  3IL8 A;  1JE5 A;  4DKA C;  4K8I A;  3EBE A;  4LFB L;  1YNJ D;  2H5X A;  2NN6 G;  3BU2 A;  5C3E H;  3T51 B;  3CQZ B;  3I73 A;  4CJ1 B;  1SMY D;  2R92 G;  3S2D B;  4L6T B;  3BG3 A;  3D4W A;  4BWG B;  1GHK A;  4DR3 Q;  2KQ3 A;  3FP9 A;  3VYS A;  4HAE A;  4DUZ Q;  2QCP X;  4UAI A;  1I3Q B;  2F0P A;  1YIT A;  2HHH L;  4DUY Q;  5KEE A;  4A3B B;  2AHO B;  2JA5 H;  4X6A H;  2DN8 A;  4JI7 L;  2VUM H;  3ULL A;  2ES2 A;  1QJO A;  1LTL A;  2ZXO A;  5IT9 E;  4DV2 Q;  5KYI A;  1F9S A;  1SYD A;  2M00 A;  5AJ3 L;  1HUN A;  2CW0 D;  1YJ9 A;  1NTG A;  1EIG A;  2VZA A;  1TY0 A;  5EKI A;  4FXG C;  2JA6 B;  2SDF A;  2YU9 H;  2K52 A;  3TQY A;  1P8L A;  4MTK A;  4O1N A;  2BCO A;  2XWJ B;  4DV7 Q;  1EQR A;  4A3D H;  3FPP A;  4ILW A;  1NE3 A;  1KC8 C;  3VYR A;  3H0G H;  4JI4 L;  1CHP D;  1TWH H;  5I9O A;  2NTT A;  1V1P B;  3CCL A;  2V4D A;  4TQU S;  1VQP A;  2LY7 A;  1GJX A;  1PTO H;  4ID6 A;  1MD2 D;  3G48 A;  1PYW D;  2TSS A;  5JPN C;  4X65 L;  3Q22 A;  2L0C A;  4GLX A;  1N36 L;  2K05 A;  5A35 A;  3K7A H;  3F2C A;  5COY A;  1LT4 D;  1U4M A;  2E74 C;  1O80 A;  5DNF A;  5EQ0 A;  1KD1 C;  3T1H L;  2K7V A;  1TWC B;  5M5X B;  2PW7 A;  1NUC A;  3I4M B;  3J80 c;  4I65 A;  3U4Z A;  3K58 A;  1H9S A;  3SK6 A;  2IHF A;  4QUC A;  3SGI A;  2F0Q A;  3E0J A;  2F3I A;  3DWA A;  1BXT A;  3I90 A;  1ZYR D;  4DR7 L;  3T4A C;  2E5L Q;  5G3L F;  4BBR B;  1SR3 A;  4IOA A;  3QO2 A;  3CPW A;  1EUJ A;  5FLX E;  4R9W A;  1FNV A;  2MFI A;  4ME3 A;  2A69 C;  5BR8 Q;  4R8N A;  5IYC H;  1F2L A;  4YCW A;  4NW2 A;  4DR5 L;  4JBK A;  3S16 B;  4QIW B;  1QZG A;  4DN4 M;  3GTO B;  2MO0 A;  1D5Z C;  5I9P A;  1VDZ A;  2ASB A;  3A5U A;  1I6V C;  2OQK A;  4EGV A;  3S9W A;  1SE4 A;  1T5E A;  1IYU A;  1EEI D;  2DGY A;  3BDL A;  4JBW A;  5J3B A;  1VQL A;  3CCS A;  1LAB A;  1Q8K A;  4G4K A;  4OO1 H;  1N32 Q;  4BY7 H;  1DON A;  2UU9 Q;  4TVA B;  4BXX H;  1F77 A;  1XTD A;  3KLR A;  4ZUJ A;  4A3K G;  1NY4 A;  1LTB D;  2L5T A;  1HA6 A;  2Z1C A;  3OW7 A;  5E3F A;  1NR2 A;  3K81 C;  1FYC A;  4R4O A;  2K5V A;  3I4N H;  1STA A;  2XWB B;  1PFM A;  3KLS A;  5KNB A;  2SNM A;  2OT2 A;  2A74 C;  1X32 A;  3ONA B;  3OOC A;  4RKL A;  3GDE A;  4DV0 L;  3GV3 A;  1SE2 A;  1EEF D;  4ABN A;  3P20 A;  1SFO B;  3CME A;  2B2W A;  3QOJ A;  2WV6 D;  1PHJ A;  3ITP A;  2B3G A;  1DXM A;  2KVM A;  2Q8R E;  1O7Z A;  4LF4 Q;  1VQ6 A;  1HNW L;  2F3V A;  1KLU D;  3SK8 A;  5CBA E;  1ONL A;  2R93 B;  1UUP A;  4XQJ A;  1Q7Y C;  4IPG A;  1WVL A;  2R7F A;  5D3D A;  2OQ0 A;  4OL7 A;  1K83 B;  4HTH A;  2Q2I A;  2BA1 A;  3AB9 A;  5IP7 H;  4C3J B;  1HZA A;  4X3S A;  4XT1 B;  5I2X A;  2F4V Q;  3FHW A;  2N49 A;  3MEF A;  1K9M C;  1HNX Q;  3SHL A;  3VYU A;  4FXD A;  5FK9 C;  1H9K A;  2PNH A;  1NMG A;  2JA8 H;  3MXN A;  5FLM G;  2A6H D;  1WTR A;  3A8K E;  4JI1 Q;  4LF5 Q;  1BCP C;  4R4T A;  3VR5 A;  1KRT A;  3EFX D;  2DNE A;  1Y8O B;  5GAH C;  3I70 A;  3MZ5 A;  4NP5 A;  2CCZ A;  1AP0 A;  2QA4 A;  1E24 A;  2QIL A;  1PRT B;  3ULJ A;  3J81 E;  5IOD A;  4B3M Q;  2B29 A;  3A8J E;  1EQT A;  1WCM G;  5CBE E;  1P16 A;  2ZXP A;  1F9Q A;  1YHQ A;  1W6K A;  2PQE A;  5ELB A;  1EWH A;  1SMX A;  1JWU D;  1PH7 A;  3ND9 A;  5FOB B;  3HOW G;  4GNX B;  4N8F A;  3HKZ B;  3W1B A;  2A68 C;  1K3R A;  2YTY A;  4P71 A;  5HGQ A;  5FJ8 G;  1B70 B;  3CRL C;  4A3M B;  2R3Z A;  1D2B A;  1HR0 L;  4C1N I;  4KI0 A;  2E2I H;  3H3V I;  1O7I A;  3VR3 A;  4EX5 A;  2KHI A;  3BS1 A;  1PH2 A;  2KHS A;  3JAM i;  1MBY A;  3K57 A;  4QF4 A;  4E6I A;  1QVG A;  3L7Z C;  1G51 A;  3HGB A;  2JXM B;  1FD7 D;  5C4X B;  2EY1 A;  1STB A;  4QMG A;  2EY6 A;  2K6A A;  1PH9 A;  2UXB L;  4ZLT F;  2EJF C;  3S1R H;  1ESR A;  1L1O A;  1DCZ A;  3NEN A;  5LMN L;  5IGC A;  2N3S A;  1N34 Q;  2EXZ A;  2L1B A;  3TBI B;  2CWP A;  1Q82 C;  1B4O A;  2RF4 A;  3S1Q B;  1PFB A;  4BA1 I;  3K80 C;  3C46 A;  3DMU A;  1TVX A;  1TY2 A;  5C0X G;  5EKL A;  1WTO A;  3K59 A;  3MXG A;  1NR4 A;  3A5Z B;  4A3L H;  1QE6 A;  1IKM A;  3S1M B;  1ASY A;  1LO5 D;  2JYO A;  1OTC A;  3H94 A;  2JP1 A;  3A7A B;  1CFM A;  4IN3 A;  5CV5 A;  3K5L A;  1KDB A;  1QNU A;  4CJ0 B;  5GAD C;  1TS4 A;  5T1G A;  4K6D A;  2CFM A;  4QJF A;  3M4P A;  4XXE A;  3NK9 A;  1GUN A;  3LWU A;  1ET9 A;  1VQE A;  1Q8I A;  2Z6K A;  2H4O A;  2NTS A;  2NWG A;  1L0W A;  1EWI A;  3R3O A;  3H6M A;  2K28 A;  4C3H G;  2N88 A;  3GTQ B;  4G7O C;  2WB1 E;  4X3U A;  1Y1V H;  5IT9 L;  2BE5 D;  1TR5 A;  2WAQ G;  1YJW A;  1UNS A;  4PQX A;  1PTO D;  1YNN D;  5K5P A;  1PH3 A;  3DM3 A;  2Q8T A;  3PIO A;  5ELN A;  3BVM A;  4KD3 A;  2BDN A;  5M5W H;  2EIF A;  2OWO A;  2AMC B;  1B3Q A;  4HSP A;  1QNK A;  1EY8 A;  3WDN A;  2UUB Q;  2LS0 1;  4Q0F A;  4DV4 Q;  1U4L A;  4LF9 Q;  1BDO A;  3DUZ A;  1A3T A;  4NXN L;  1SLJ A;  4JI3 Q;  5M9O A;  1V9P A;  4A3F H;  1HQM C;  4O2D A;  4DR6 L;  2GN5 A;  1VQ7 A;  3FMC A;  2UUC Q;  4AH6 A;  1PFS A;  1X3E A;  1W6J A;  2EYF A;  5BN4 A;  3OW2 A;  4LMQ D;  4B3R Q;  3HKZ G;  1TKW B;  4A3I B;  1UE5 A;  4I7A A;  5CV6 A;  2BOS A;  2B63 H;  4LFC Q;  1BF4 A;  1K73 C;  3CKI B;  1G6P A;  4M1U B;  4DR2 L;  4JI5 Q;  5FLX L;  2JQO A;  1XPO A;  3PO2 H;  5ELO A;  4IUV A;  2ENB A;  5FO8 B;  3DEP A;  4BBS G;  2I5L X;  3IAY A;  3OTO L;  3HOV G;  1S5F D;  2HIV A;  2RCF A;  1OXV A;  1UE1 A;  3MFG A;  4HID A;  2XSC A;  4JI8 L;  4NXM L;  3MC0 B;  4YWL A;  4DR1 Q;  1Z47 A;  5LMU L;  2MPM A;  4NB3 A;  4NKL A;  3CCV A;  3TS2 A;  1FNW A;  3HOX G;  1EY0 A;  1CZG A;  1BOS A;  1QUQ A;  1L2F A;  4IO9 A;  3FKI H;  2LXJ A;  2X69 A;  1WTX A;  1HTL D;  4A93 B;  4BY1 B;  4ME5 A;  4JYA Q;  1C4Q A;  2WIN B;  4RHR A;  4GOP A;  1VF5 C;  5IWA Q;  1C8C A;  5M3M G;  1JOO A;  3CPF A;  2Z4H A;  1BQQ T;  5IGG A;  2Z4I A;  3SE0 A;  5FO9 B;  1TWG B;  3H09 A;  5CMD A;  4A3G B;  2KJX A;  4DK3 C;  1A3V A;  4A3E B;  4IUP A;  1D8L A;  2WKC A;  2JA7 B;  2IL8 A;  1STE A;  3HOZ B;  3M4O H;  1M4V A;  1LTR D;  3S2H H;  4X64 Q;  1VQG A;  2IWH A;  4N9T A;  4DK6 C;  2YYZ A;  4C1N K;  1Q1B A;  2L15 A;  1BO0 A;  1V1O A;  4GZY C;  2A6E C;  1IYV A;  2E8G A;  4RHS A;  2D5D A;  2R92 B;  1PZI D;  3TME A;  1HR0 W;  4YWK A;  4GOP C;  3I72 A;  4IFD G;  3UI2 A;  4AYB E;  2I5M X;  3TRZ A;  3RD4 A;  4KMU C;  2UXC Q;  3KF8 A;  1E3P A;  2F0D A;  4WJW A;  4RGM A;  1W2B A;  2PZT A;  5CV7 A;  3AMU A;  1IBL L;  4AQY Q;  2Q2U A;  1MSG A;  3QR8 A;  5CGK A;  4YCV A;  1IBM Q;  4GN3 B;  2KUM A;  4CJ2 C;  2EPB A;  4I7Z C;  2VS1 A;  1U9R A;  2EYM A;  3E3X A;  3CCE A;  1WJJ A;  5ELC A;  4EQP A;  3HOY H;  1TWA H;  1HA5 A;  2RQX A;  1H9R A;  1X9N A;  4DR3 L;  1Q46 A;  5CYU A;  2CH4 A;  3O13 A;  1WD1 A;  4BA2 I;  3T16 A;  3J81 L;  4DAM A;  4P73 A;  2HQE A;  1S5D D;  2PQA A;  4MIU A;  2EY2 A;  4LF7 Q;  3H3V H;  3CRK C;  1ENC A;  4HIM A;  2F0M A;  1GOZ A;  1UEB A;  1X3F A;  5IP9 H;  1JB3 A;  3A56 A;  1XMO L;  4HR7 B;  5I2Y A;  3M85 A;  1EOT A;  2J4X A;  4XDX A;  1EFW A;  5IYB G;  4V19 0;  1AE2 A;  3HZX A;  3CC7 A;  4IJH A;  1AEX A;  4OON A;  1F9R A;  1V1P A;  2MO1 A;  1HTP A;  1XNR L;  3E9H A;  3U9O A;  4A3J G;  3PO3 H;  4KTA A;  2VQE Q;  1W3S A;  1RKN A;  1HCZ A;  1NMF A;  3S17 B;  2E76 C;  4KY5 A;  1J5E L;  2F0U A;  1S72 A;  2E2H H;  3W1G A;  2JSO A;  1K8O A;  2ZM6 Q;  4EVO A;  5C44 H;  2F1M A;  2EYO A;  3A8I E;  2A69 D;  1XYI A;  1SND A;  1VF7 A;  2K32 A;  5GAE C;  2GVA A;  4C3I H;  3BDO A;  3TP6 A;  1Y1W G;  2NVQ H;  4A3C G;  5C5M A;  1J8I A;  2E5L L;  1OXT A;  1N33 L;  1NCV A;  3NTI A;  1ICW A;  4PZ7 A;  4HIO A;  4K6L A;  1B2T A;  1CQF A;  1ZEQ X;  2EOT A;  2WKD A;  2OTL A;  4A3G G;  3NBI A;  2FMC A;  1TQO A;  3K8A A;  4MTN A;  3S14 H;  2K5H A;  1Y14 B;  3R93 A;  2KEN A;  3N6R A;  2KEC A;  4PMW A;  1Z9F A;  4A3K B;  4LF6 Q;  3LNN A;  2HCC A;  1I94 L;  2R7Z H;  3KF6 B;  1U4R A;  3ND8 A;  3KBG A;  1N8R C;  1JJ2 A;  5C5L A;  1PZK D;  3RZD B;  3CU7 A;  4B3T Q;  4HIK A;  2XRQ D;  1PH4 A;  1II3 A;  3HOU H;  1JC7 A;  2D2C C;  2PMZ B;  4GLA C;  4KD4 A;  4JOI A;  5J1Z A;  2NVX B;  3QIA A;  4DNI A;  2MJ8 A;  1VQ8 A;  2NVY H;  4H7B A;  5EKK A;  5TSS A;  5KRU A;  1CQV A;  1HNZ Q;  3L0O A;  2DJG C;  1KNA A;  2LSS A;  4JV5 Q;  4PNY A;  5I6W A;  1EIY B;  4QIW E;  2K5N A;  2K1B A;  3NQI A;  3TZD A;  2NZO A;  1S4Z A;  4NPS A;  1Y69 U;  5JEA G;  2CWA A;  4R4C A;  4IUN A;  2EJM A;  4PZ8 A;  4WOR A;  1Q3L A;  4GKK L;  4JOI C;  3PIO 3;  1KTK A;  1DJR D;  2EYL A;  3Q0A A;  3AEV A;  5C3E G;  3ERQ A;  4GKJ L;  5DM7 3;  1CKN A;  3K5O A;  3L9A X;  5K36 H;  2F0H A;  1VQC A;  4PG3 A;  1X6O A;  3UE0 A;  5FKA C;  3TN2 A;  5DEH A;  3PUY A;  2HUG A;  2ZJQ A;  1RIP A;  1R9T B;  2JA5 G;  4CBV A;  1STG A;  1QB5 D;  2VNU D;  2VUM G;  4H13 C;  2A73 B;  1RJT A;  2OCE A;  3AFQ A;  4FXK C;  1K0R A;  1WCM B;  3HRZ C;  3GTJ B;  2PI2 A;  3D4R A;  3LWE A;  2F0E A;  1KDC A;  2HDM A;  1I4Q A;  2AWO A;  4DNR B;  3KDF B;  3KLW A;  2XN9 C;  4X62 L;  2O5I C;  2ZJR A;  1YI2 A;  4A3D G;  3HOW B;  3J80 E;  2IY5 B;  1G6Z A;  3CCQ A;  1EFI D;  1LTG D;  5DM6 3;  2BDO A;  3H0G G;  1BVS A;  3AQQ A;  1MIU A;  5M3F H;  1OO9 B;  3WOF A;  2C35 B;  3UDI A;  4JBJ A;  3DWQ A;  3T1Y Q;  3SK4 A;  3D6C A;  2KCC A;  3WWV A;  2A68 D;  4B3S L;  1TII D;  3EA6 A;  1PMR A;  5J22 A;  2PNR C;  1IZ6 A;  2EXD A;  1CZW A;  2PCF B;  4X66 Q;  1HXY D;  2PI2 E;  2B2T A;  3KUP A;  1DD2 A;  4N9P A;  4GNX A;  5IGB A;  4MZ9 A;  5JJL A;  3CQZ H;  3H15 A;  3AFP A;  2NUC A;  2BA0 A;  3S2D H;  4FVM A;  3N52 A;  5KNC A;  1M90 C;  3HS0 C;  1WTV A;  1R4P B;  1I3Q H;  4XQQ A;  4L5T A;  4LFB Q;  4ZRZ A;  4A3B H;  1ENF A;  1SYB A;  4UP9 A;  1CK1 A;  4K2L A;  1YIJ A;  5KIX A;  1BNZ A;  2WP8 J;  4FP5 D;  3Q23 A;  2NBF A;  3CHB D;  3BZK A;  2J7Z A;  4JG2 A;  5ISR A;  4CDD C;  5IYC G;  3FVQ A;  4ZAI A;  2B2T C;  3PUX A;  4IUQ A;  2HHH Q;  3GTM B;  4GNX C;  2JA6 H;  1VQH A;  3D6W A;  1J9O A;  1B1Z A;  4XQN A;  4JI7 Q;  3HKZ E;  5C4J B;  4L5S A;  4OEM B;  5CV8 A;  1HZC A;  1AZP A;  4NDX A;  4P74 A;  2K03 A;  1SRU A;  1UWV A;  3HG9 A;  4RFB A;  4B9W A;  4OO1 G;  3E9I A;  1HRJ A;  4BY7 G;  3OWF A;  1SNM A;  4ZKB B;  4CDC C;  2X6L A;  4BXX G;  3PSI A;  4C3H B;  1XPU A;  3TS0 A;  2O5J C;  5A2Q L;  4LNQ A;  4JI2 L;  4JI4 Q;  1TWC H;  1XTC D;  5M5X H;  4RGT A;  1CSP A;  2PZW A;  2WAQ B;  4G7Z C;  3I4M H;  2CW0 C;  1XJV A;  4JW0 A;  1I6H B;  4NMZ A;  4V0B A;  3NEL A;  3C1F A;  3I4N G;  3JC6 6;  2WII B;  4K5W A;  1FR3 A;  2B2W C;  1CSQ A;  4X65 Q;  1N36 Q;  3X3N A;  4PV1 C;  2K5D A;  2R61 A;  3T1H Q;  1TWF B;  1I4R A;  4BBR H;  1SYE A;  1Q86 C;  1K8M A;  1K3B C;  4F8M A;  3OYY A;  1T5X D;  3LX0 A;  2AQ2 B;  1V1Q A;  5NUC A;  1H9S B;  3IRB A;  4DV5 L;  1XMQ L;  3K0X A;  3VA7 A;  4DR7 Q;  4UDU C;  3GTL H;  3UDF A;  3S16 H;  3GTO H;  4YY3 L;  3VR6 A;  4POF A;  1MI2 A;  4P2C B;  3EN2 A;  5IP7 G;  1IXR A;  4UHV A;  2L12 A;  1C0A A;  4KK7 A;  4HCS A;  1EZ8 A;  3M3Y B;  2KBN A;  5G3L D;  4B08 A;  1PV4 A;  2Q2T A;  4OWW B;  3OSO A;  1ZYR C;  1E2W A;  2C5C A;  4FYD A;  4DR5 Q;  2JA8 G;  3W5O A;  4OXP A;  3VR4 A;  5EAY A;  2N55 A;  4J15 A;  2K01 A;  2D62 A;  2O2L D;  5IGF A;  3TP7 A;  2F0I A;  3VYT A;  2XTI A;  4DU9 A;  1BBU A;  4DV3 L;  2E2J B;  3PUW A;  5LHY 1;  1NBW A;  5H1S E;  1PXU A;  4BBS B;  4F7X A;  1B7Y B;  5J39 A;  2AUK A;  2RDF A;  3JAM c;  3HOV B;  1VQI A;  3R2I A;  1Q1E A;  4GLV B;  4LFC L;  1DZ1 A;  4KY7 A;  1YVC A;  3CC2 A;  3SEB A;  5IYD H;  2QEX A;  3ULP A;  1SFO H;  3GTG B;  2OTJ A;  1Z6H A;  4OX9 L;  5GRO A;  3F2B A;  3PGZ A;  4QL5 A;  1A2T A;  1B3A A;  3HOX B;  3NWT A;  3PV0 A;  4TSS A;  2ICE C;  3HP3 A;  4WFN 3;  2VB2 X;  4JC0 A;  1BBX C;  2R93 H;  1RL2 A;  2ID0 A;  4DV0 Q;  1GD7 A;  1Z7T A;  4K14 A;  1K83 H;  4RWS C;  4L5R C;  2NVT B;  4EQN A;  4RGO S;  4C3J H;  5M3M B;  2MGS A;  4FF3 A;  1M1K C;  1C9O A;  2NN6 I;  4C2M B;  1HNW Q;  3BYY B;  1L1O C;  1VQ9 A;  4JI6 L;  2FIN B;  1GUT A;  2UUA L;  4CHT B;  4G57 A;  3ERO A;  1SNQ A;  1I50 B;  4LUV A;  1PYB A;  3GTK B;  1PH1 A;  2VB3 X;  1ENA A;  1CI3 M;  4WJ4 A;  1A0I A;  1SE8 A;  1JIC A;  1IBK L;  2P5Z X;  4Z9C B;  4CGY B;  3H3V C;  4IUR A;  3D31 A;  1QVF A;  4Y7N B;  3NQT A;  1A3U A;  4ZCK A;  1X3P A;  1MGS A;  4LF8 L;  4RG1 A;  1M8A A;  2F0J A;  4TRD A;  1PLF A;  2A6E D;  2NB0 A;  1EWC A;  4JI0 L;  4A3L G;  3UE1 A;  2F0N A;  2KCM A;  4IFD J;  5ELF A;  2I07 B;  1EU3 A;  3HFZ B;  1SYC A;  1DOL A;  1CHQ D;  1NSN S;  1KRS A;  3PF5 A;  4IUT A;  3G71 A;  2Z6K C;  1VQM A;  1I4P A;  4FF2 A;  1B9M A;  5E4W C;  3CD6 A;  5I6Y A;  1EYA A;  4O42 A;  3AU7 A;  4K0K L;  3G7L A;  4A3M H;  3RLO A;  2Z8L A;  1B53 A;  3UDX A;  1FJG L;  3SVM A;  4XT3 B;  2JEA I;  5C3X A;  2WAC A;  2VQF L;  1AZQ A;  1VQJ A;  3GP7 A;  3S15 B;  3OMG A;  2QF7 A;  3FRP B;  1Y1V G;  1SJH D;  5E7N A;  3RR5 A;  1EIF A;  2GA4 B;  4CKC A;  1AFP A;  5JAV A;  1HR0 Q;  4UY8 C;  1WFQ A;  3NWS A;  5C4X H;  3HKS A;  5EPL A;  3CCU A;  2KCT A;  1IL8 A;  1X65 A;  2B2Y A;  1GXD C;  2K5Q A;  1S3O A;  1TU2 B;  4DR4 L;  3UDG A;  2G5D A;  3J80 L;  3F8T A;  2E2D C;  3MVV A;  3KOJ A;  2QDL A;  1N9W A;  1D5M C;  4ZKC B;  3S1Q H;  1SE3 A;  5KGU A;  1ILQ A;  1I4H A;  2L55 A;  2EYH A;  2UXB Q;  3BDC A;  2Z6B A;  3NBH B;  3SXH A;  4XIG S;  1VMP A;  2UXD L;  1EL0 A;  4A3F G;  5LMN Q;  2AQ3 B;  4IZ8 A;  1JWS D;  4A3J B;  1XNQ L;  3S1M H;  4ODG A;  2B2U A;  1KAA A;  1LTS D;  1Q90 A;  4HJ8 A;  1MHW C;  1SN8 A;  2B8F A;  1GKH A;  1ET6 A;  4KLK A;  2EYJ A;  2B2Y C;  4LK1 C;  2KCN A;  5JPM C;  3STB C;  3E6Z X;  1SSO A;  4DXG A;  1F2Z A;  1E1T A;  5M5Y H;  4A76 A;  2B63 G;  1U0L A;  3NUC A;  2ZTE A;  3NP8 A;  1PH6 A;  3GTP B;  4DK0 A;  2IHE A;  4KHP L;  3KK7 A;  1Y1W B;  2LMC B;  1XXG A;  3Q8D A;  2HDL A;  4KKT A;  3GTQ H;  3QJY A;  4DAY B;  4DAP A;  5HUR A;  1YJN A;  1STN A;  3PO2 G;  1TT2 A;  3CF5 A;  2B2U C;  1AN8 A;  2B8G A;  4GN5 A;  4KKS A;  4DPG A;  1PRT F;  1NAP A;  1YNX A;  1B9N A;  3OPO A;  1H9J A;  4L8J A;  2F0V A;  3A7L A;  1YHA A;  4IQZ A;  4KJN A;  4DV1 L;  4HJA A;  4H0L C;  2EVB A;  4YHH L;  1SYG A;  2PZU A;  1PZJ D;  2F4I A;  1HH2 P;  4DGZ A;  4EQ5 A;  2JEB I;  2CH4 W;  3FKI G;  1CT1 D;  5LL6 X;  3KFU A;  2YTX A;  3U50 C;  2I0Q A;  4OEL B;  2OF1 A;  4IPH A;  3SDZ A;  4OWX B;  1Q12 A;  4DV6 L;  2HCI A;  2SNS A;  2F0S A;  5A2Q E;  4KY6 A;  1K8A C;  3PQI A;  3KF6 A;  4NXN Q;  5C3W A;  4A3I H;  1GUW A;  1JCK B;  1STY A;  4DR6 Q;  3BZD B;  1PYS B;  4HJ5 A;  2ZJP A;  1CA6 A;  2GVB A;  3ICE A;  3K7U C;  4LFA Q;  3ZYY X;  1HUM A;  5LMN W;  3RZO H;  3OIP A;  1AH9 A;  1CM9 A;  2A8V A;  2F0T A;  4DUZ L;  4UP7 A;  4APV A;  4JCV E;  4IJL A;  3S1N H;  4DUY L;  4XYO A;  1LM0 A;  4L63 B;  4P75 A;  1PH5 A;  3I4L A;  5C3E B;  2AKW B;  2DY7 A;  3I7F A;  2DJF C;  4DV2 L;  1D6E C;  1S5B D;  1GUG A;  1RF2 D;  4DR2 Q;  2JA9 A;  2D9U A;  3H91 A;  1CTM A;  4DAV A;  1K28 A;  1B50 A;  1DOK A;  4H44 C;  4QY7 A;  5EBD A;  2JA5 B;  1J6Q A;  2VUM B;  2PMZ E;  4DV7 L;  4JVZ A;  4U68 A;  3OTO Q;  1TS2 A;  1H95 A;  2VW9 A;  1JOR A;  4R4Q A;  4UP8 A;  1A6X A;  3TDQ A;  3MHB A;  1ROD A;  1GUS A;  4JI8 Q;  4NXM Q;  4C56 C;  3NPP A;  3HOY G;  3CC4 A;  5LMU Q;  3J81 j;  1LAC A;  2HIX A;  3M4Y A;  5JVG 3;  4BY1 H;  2YU9 B;  4UPA A;  4A93 H;  4A3C H;  4A3D B;  2VY3 A;  3RUZ A;  3KYH C;  3H0G B;  1DGS A;  4S3S A;  3CMA A;  3S24 A;  1TWH B;  1UE6 A;  2WB1 G;  3NTK A;  4F88 A;  1TWG H;  4IOC A;  2IT1 A;  4A3G H;  5DAU A;  1EZ6 A;  1XWE A;  1PTO B;  4A3E H;  5L37 A;  4X3T A;  3TEH B;  3K7A B;  1KXL A;  2JA7 H;  5HY6 A;  5IP9 G;  3HOZ H;  5COR A;  3KDF A;  1U5K A;  4HSV A;  1L0Y B;  1V43 A;  2NN6 H;  3JAM L;  2M9V A;  2I46 A;  2SEB D;  1Q81 C;  3TSS A;  3TZU A;  1CKM A;  1STH A;  3LGJ A;  2R92 H;  4L5Q A;  5C0X I;  1BUV T;  2KOL A;  5BR8 L;  3J7A V;  3PO3 G;  2K5W A;  3G6E A;  1B8A A;  4HMI A;  3CAM A;  4ZQ3 A;  2N8N A;  3EJI A;  3KLS X;  5ELE A;  5C44 G;  1EU4 A;  3PF4 A;  1LTT D;  1FNU A;  1S5C D;  2RHQ B;  2B39 A;  5FO7 B;  4FDB A;  1JJG A;  3FEW X;  3I4O A;  1N32 L;  5EBC A;  1F9P A;  4OWT B;  4F87 A;  2UU9 L;  1PVO A;  4C3I G;  1IBL Q;  4FNF A;  1ML0 D;  4QQB X;  1ZXT A;  3EQL C;  4KHZ A;  3C2P A;  1EYD A;  2FFK B;  4ALP A;  5IT9 c;  2Y0S B;  2C9O A;  4RAU C;  4ZYS A;  4BY7 B;  4IAL A;  3KBX A;  4ULL A;  1MSH A;  1LTA D;  2FHT A;  3ER0 A;  1EYC A;  3L3O C;  2RSO A;  2ZXR A;  3I8Z A;  5JJI A;  4JPB W;  1IYJ B;  2R7Z G;  1F2Y A;  2E75 C;  2PQA B;  1IW7 C;  1X3Q A;  1WTQ A;  4RKB A;  3I4N B;  3V96 A;  1TXY A;  1VQF A;  1HJP A;  3HOU G;  1HFG A;  4LF4 L;  1SNC A;  1JR0 D;  4MN3 A;  2OXP A;  1XMO Q;  2SOB A;  1VQO A;  1BCP D;  2XNA C;  5E1F A;  4A75 A;  3S17 H;  2F4V L;  1A63 A;  4YIJ A;  5IE8 A;  3L2P A;  2KEE A;  4DK1 A;  4DNT B;  1HNX L;  1XNR Q;  4FO2 A;  1MKH A;  1KQS A;  3J7A F;  2IW3 A;  3MA2 B;  2KA7 A;  1WTW A;  3J80 i;  4JI1 L;  4LF5 L;  2Q8I B;  1J5E Q;  1VQD A;  4K2K A;  1GO3 E;  1SJE D;  1EYG A;  5FLX c;  2F0G A;  1KHI A;  2BH8 A;  2JA8 B;  1QZH A;  2TMP A;  2EYP A;  4K5X A;  2IX3 A;  3I56 A;  4B3M L;  5K36 G;  3M9B A;  5JJK A;  3GO5 A;  3MWY W;  3E5S A;  1DYQ A;  1VQA A;  3IKJ A;  1WI5 A;  4RMF A;  1N33 Q;  2WAQ E;  2A5H A;  4A3K H;  2QW7 A;  1LLR D;  2RDH A;  1FGU A;  4AYB G;  2IX1 A;  2PO4 A;  4MNO A;  4DA2 A;  3RZD H;  1YHB A;  3M7G A;  4LUO A;  3MFY A;  2NVX H;  4J6H A;  3GTL B;  4G7H C;  2QKI C;  3PCO B;  1YZ6 A;  4QUF A;  1PRT C;  3I91 A;  1I94 Q;  2JN4 A;  2V1C C;  1SBB B;  2A19 A;  1SAP A;  3J7A 5;  1O7L A;  3PUZ A;  3DLL A;  3E0E A;  3CCM A;  1G91 A;  5M3F G;  4XTC S;  1S40 A;  4POG A;  5C0X J;  2ALY B;  1A2U A;  2E2I B;  3Q6S A;  2LKV A;  1YNJ C;  4Y52 H;  3EIV A;  2F03 A;  1VQN A;  1JMC A;  3OIQ A;  2RVL A;  2L9H A;  2QEJ C;  4K8J A;  1HQR D;  1N34 L;  1QCB D;  1JOK A;  1SMY C;  1K0S A;  3FDT A;  4B9X A;  3RN5 A;  5AJ3 Q;  1VQ4 A;  1HZ9 A;  1X56 A;  1ESF A;  5BN3 A;  3HEJ A;  2MNA A;  2AQ1 B;  1E0B A;  5FLM H;  3BVG A;  3A0J A;  2Y0S G;  4WRD A;  2PYK A;  3FPU B;  1D1K A;  1V8Q A;  4BS9 A;  2HD3 A;  4X3K A;  4LWC A;  1LT3 D;  3S1R B;  2R7D A;  4HMJ A;  4IFD I;  1ICF B;  3MXU A;  4GKK Q;  1UAP A;  5EPJ A;  3BVZ A;  4A3B G;  1R9T H;  1LYL A;  1QOH A;  3F2D A;  2MUY A;  4GKJ Q;  2IPK D;  1MJC A;  1GHJ A;  1WCM H;  1CKN B;  3MEH A;  3GTJ H;  1S5E D;  2DUD A;  2Z9H A;  1QWY A;  1PFN A;  4HED A;  2LXK A;  1HFN A;  4K5V A;  3K0Y A;  3RMH A;  2JA6 G;  3J81 i;  3T56 B;  4DF7 A;  1C7Y A;  3HOW H;  3A74 A;  4CKB A;  1PTO F;  3K6O A;  4ZK9 B;  3RN2 A;  5CC4 A;  2J0T D;  3J81 c;  5FJ8 H;  4JK1 C;  2O4X A;  1VQB A;  1WYD A;  1TS3 A;  3NSW A;  1BKB A;  1K8G A;  4X62 Q;  2MHV A;  1LT5 D;  3U4V A;  2OEO A;  2EE1 A;  5IY0 A;  4GN4 B;  3PIP A;  1Y1V B;  3OHX C;  1HHV A;  2NYZ D;  3I4M G;  1SEB D;  1RCV D;  2UUB L;  4DV4 L;  3VR2 A;  4GS3 A;  4LF9 L;  5T1I A;  2JE6 I;  1G2T A;  2NZ1 D;  4B3S Q;  3GQB A;  1YEZ A;  4JI3 L;  2BH2 A;  2L4N A;  3EVQ A;  5M5W B;  1F2M A;  1TS5 A;  2K4K A;  5LL6 S;  2XVS A;  4BBR G;  2UUC L;  1RD9 D;  3V2T A;  1LT6 D;  5JOB A;  1I4X A;  2IX0 A;  4RH6 A;  3MXP A;  3CCJ A;  1G29 1;  5C0X H;  5GQO A;  5D14 A;  4B3R L;  3QG1 A;  2Q2H A;  3M4Q A;  3F1Z A;  4A3F B;  1E2Z A;  1GVP A;  3D3R A;  3M7N A;  1D1I A;  3GTM H;  2X6G A;  1XPR A;  1O78 A;  4JI5 L;  1QIL A;  5C4J H;  1L0X B;  5D65 A;  5KYL A;  3JAM E;  3I2Z A;  2K04 A;  2WFW A;  5BN5 A;  2B63 B;  1NNX A;  4FF4 A;  2RA4 A;  3NBH A;  1LTI D;  4J1M A;  1A62 A;  3STB D;  2PW5 A;  5I4D A;  2RDG A;  2RHS B;  3W3A A;  1JQY D;  4C3H H;  3NXW A;  4KV6 A;  3PO2 B;  1BCP B;  4DR1 L;  1ZKO A;  4ZUI A;  1A8V A;  2DY8 A;  4KKU A;  1I6H H;  4R8I A;  1WOC A;  2FJ2 A;  3IFT A;  4N8X 1;  4IPC A;  1KLG D;  1KIX A;  2YV5 A;  1MJE A;  4OIK A;  1PA6 A;  4HJ7 A;  4LAA A;  5AFW A;  4JI2 Q;  1TWF H;  5IYD G;  4XYQ A;  1VQ5 A;  5CV9 A;  4PMC A;  4JYA L;  4DAY A;  2KHJ A;  3NHH A;  3U58 A;  3G6J B;  3C3L A;  5IWA L;  1GUO A;  4FF1 A;  1ILP A;  3MXN B;  1NJI C;  1VQK A;  1JWM D;  3FKI B;  5M5Y B;  1FL0 A;  2ATW A;  1EY5 A;  2R93 G;  1VS0 A;  1BBW A;  4TKO B;  2IJ0 A;  1I4G A;  1JT8 A;  2K75 A;  3G4S A;  1A15 A;  2CQO A;  4C3J G;  4CDE C;  3NTH A;  4X64 L;  3BZC A;  2CQA A;  4DV5 Q;  2A6H C;  1XMQ Q;  2K50 A;  3M3Y H;  2I5H A;  2M2L A;  2K33 A;  2QDB A;  2VXW A;  3D0F A;  3SR1 A;  5JVH 3;  2XGT A;  2A1A A;  2CVR A;  3I55 A;  4QCL A;  3URY A;  4YY3 Q;  3CXC A;  2D0O A;  1X55 A;  2EQS A;  2F0W A;  3M4O B;  3S2H B;  1QG7 A;  1FGB D;  1Y8N B;  1Y8P B;  1H9M A;  3NE5 B;  2E2J H;  2UXC L;  3ZJY C;  5GAG C;  4BBS H;  4KHV A;  4AQY L;  3R8B A;  1G2S A;  1D5X C;  1EY9 A;  3HOV H;  1JOQ A;  4RCN A;  1XX8 A;  2JK8 A;  1IBM L;  1SXT A;  2EZV A;  2EY5 A;  4A4I A;  4DV3 Q;  1UEA B;  2ICI A;  1JE4 A;  5IIF A;  2G9D A;  5CR3 A;  4LFA L;  1SDF A;  3CP0 A;  3GTG H;  3HOX H;  2AUJ D;  2CKZ B; 
#chains in the Genus database with same CATH homology
 1BR9 A;  1KDA A;  2DNC A;  1EY7 A;  5HGT A;  3HOY B;  4OIJ A;  5C6A A;  3A55 A;  1WTP A;  1TWA B;  1EY4 A;  3RZO B;  2AWN A;  3OWE B;  3I3C A;  3F2U A;  3MAQ A;  3S1N B;  1SNP A;  3GD7 A;  3K5M A;  2WB1 B;  5ELD A;  5C4Z A;  5IGE A;  2XRS D;  5EGT A;  1G8Z D;  3C1E A;  1DOM A;  1RTO A;  4IUU A;  1IHZ A;  3TP8 A;  3X3M A;  3A54 A;  3VA5 A;  3T13 A;  1E2V A;  3QOL A;  2F0L A;  1OXX K;  2L11 A;  1EQV A;  3P7J A;  4IFD H;  2H1E A;  3PO3 B;  3OMC A;  1RHP A;  3Q24 A;  4RGN A;  2FMM A;  1U4P A;  4KN7 C;  2E2H B;  4CKE A;  1DM0 B;  1SYF A;  2F0O A;  2PPB C;  1VCI A;  5C44 B;  3TP5 A;  4RCO A;  3T53 B;  1EY6 A;  2KED A;  1R4Q B;  1WD0 A;  3DXJ C;  5IOC A;  4OO1 I;  2LFN A;  4MHE A;  2BE5 C;  1LV9 A;  4C3I B;  2NVQ B;  4PMB A;  3K5N A;  3SK5 A;  1PTO C;  2EDG A;  1YNN C;  4DFA A;  3QWN A;  1RTN A;  3P1H A;  1CA5 A;  1SNO A;  2B2V A;  5IGD A;  5JJZ A;  3S14 B;  2F0K A;  2F0F A;  2XIW A;  5JEA J;  3MTS A;  2R7Z B;  5EPK A;  3PMF A;  3DM1 A;  1IKL A;  5EJW A;  5D3I B;  3HOU B;  3QB3 A;  2RKS A;  1IW7 D;  3D4D A;  2G9H D;  4U67 3;  2NVY B;  5CV4 A;  4KN4 C;  3PUV A;  2B2V C;  1O7Y A;  3WOE A;  3V05 A;  2F3W A;  4M8A A;  3PIP 3;  3DWP A;  1KNE A;  2ZT9 C;  4OHJ A;  1BCP F;  1KAB A;  3RLF A;  1PDQ A;  1B44 D;  4HCE A;  4RA8 A;  4J8Q A;  4KJO A;  4DXF A;  4OGQ C;  3D8G A;  1HPC A;  3DHQ A;  3GV6 A;  2EJG C;  5F2D A;  1OXU A;  3R2T A;  4AYB B;  2MP1 A;  3IFD A;  3W2D A;  3J7Y W;  2RBM A;  1AW7 A;  3P75 A;  4HN7 A;  3U9S A;  5C4H A;  3BYT B;  1PRT D;  2CHB D;  5M3F B;  3DEO A;  1C48 A;  5E4X A;  1EIH A;  5KND A;  2R6G A;  5JEA H;  1VMC A;  4LJZ C;  2RSN A;  4QB4 A;  1RDP D;  4EQO A;  4Q5V A;  1OXS C;  3IL8 A;  4K8I A;  1YNJ D;  2NN6 G;  3T51 B;  3CQZ B;  3I73 A;  4CJ1 B;  1SMY D;  3S2D B;  4L6T B;  3BG3 A;  3D4W A;  4BWG B;  1GHK A;  2KQ3 A;  3VYS A;  4HAE A;  2QCP X;  4UAI A;  1I3Q B;  2F0P A;  5KEE A;  4A3B B;  2DN8 A;  1QJO A;  2ZXO A;  5IT9 E;  5KYI A;  1F9S A;  1SYD A;  2M00 A;  1HUN A;  2CW0 D;  5EKI A;  1EIG A;  1TY0 A;  4FXG C;  2JA6 B;  2SDF A;  4O1N A;  2BCO A;  2XWJ B;  3FPP A;  4ILW A;  3VYR A;  1CHP D;  5I9O A;  2NTT A;  1V1P B;  2V4D A;  4TQU S;  2LY7 A;  1GJX A;  1PTO H;  4ID6 A;  1MD2 D;  5JPN C;  1PYW D;  2TSS A;  3Q22 A;  2L0C A;  2K05 A;  5A35 A;  5COY A;  1LT4 D;  1U4M A;  2E74 C;  1O80 A;  5DNF A;  5EQ0 A;  2K7V A;  1TWC B;  5M5X B;  2PW7 A;  1NUC A;  3I4M B;  4I65 A;  3K58 A;  1H9S A;  3SK6 A;  4QUC A;  2F0Q A;  3E0J A;  3DWA A;  1BXT A;  3I90 A;  1ZYR D;  3T4A C;  5G3L F;  4BBR B;  3QO2 A;  5FLX E;  4R9W A;  1FNV A;  2A69 C;  4R8N A;  1F2L A;  4NW2 A;  3S16 B;  4QIW B;  4DN4 M;  3GTO B;  1D5Z C;  5I9P A;  1VDZ A;  1I6V C;  4EGV A;  3S9W A;  1SE4 A;  1T5E A;  1IYU A;  1EEI D;  3BDL A;  4JBW A;  1LAB A;  4G4K A;  4OO1 H;  1DON A;  1F77 A;  3KLR A;  4ZUJ A;  2L5T A;  1LTB D;  1HA6 A;  2Z1C A;  3OW7 A;  5E3F A;  1NR2 A;  1FYC A;  1STA A;  2XWB B;  1PFM A;  3KLS A;  5KNB A;  2SNM A;  2OT2 A;  2A74 C;  1X32 A;  3ONA B;  3OOC A;  4RKL A;  3GV3 A;  1SE2 A;  1EEF D;  4ABN A;  3P20 A;  1SFO B;  2B2W A;  3QOJ A;  2WV6 D;  3ITP A;  1DXM A;  2KVM A;  2Q8R E;  1O7Z A;  2F3V A;  1KLU D;  3SK8 A;  5CBA E;  1ONL A;  2R93 B;  1UUP A;  4XQJ A;  1WVL A;  5D3D A;  4OL7 A;  1K83 B;  4HTH A;  2BA1 A;  3AB9 A;  4C3J B;  5I2X A;  4X3S A;  4XT1 B;  3SHL A;  3VYU A;  4FXD A;  5FK9 C;  1H9K A;  3MXN A;  2A6H D;  1WTR A;  3A8K E;  1BCP C;  3VR5 A;  3EFX D;  2DNE A;  1Y8O B;  3I70 A;  3MZ5 A;  4NP5 A;  1AP0 A;  2QIL A;  1PRT B;  3J81 E;  5IOD A;  3A8J E;  1EQT A;  5CBE E;  2ZXP A;  1F9Q A;  1W6K A;  2PQE A;  5ELB A;  1EWH A;  1JWU D;  3ND9 A;  5FOB B;  3HKZ B;  2A68 C;  3CRL C;  4A3M B;  2R3Z A;  1D2B A;  4C1N I;  4KI0 A;  3VR3 A;  3BS1 A;  2KHS A;  1MBY A;  3K57 A;  4QF4 A;  4E6I A;  3L7Z C;  3HGB A;  2JXM B;  1FD7 D;  5C4X B;  2EY1 A;  1STB A;  4QMG A;  2EY6 A;  2K6A A;  4ZLT F;  2EJF C;  1ESR A;  1DCZ A;  5IGC A;  2EXZ A;  2L1B A;  3TBI B;  1B4O A;  3S1Q B;  1PFB A;  4BA1 I;  3C46 A;  3DMU A;  1TVX A;  1TY2 A;  5C0X G;  1WTO A;  3K59 A;  3MXG A;  1NR4 A;  1QE6 A;  1IKM A;  3S1M B;  1LO5 D;  2JYO A;  3H94 A;  2JP1 A;  3A7A B;  1CFM A;  4IN3 A;  5CV5 A;  3K5L A;  1KDB A;  1QNU A;  4CJ0 B;  1TS4 A;  5T1G A;  4K6D A;  4XXE A;  3NK9 A;  1GUN A;  3LWU A;  1ET9 A;  1Q8I A;  2H4O A;  2NTS A;  2NWG A;  3R3O A;  3H6M A;  2K28 A;  4C3H G;  2N88 A;  3GTQ B;  4G7O C;  4X3U A;  5IT9 L;  2BE5 D;  1TR5 A;  1UNS A;  4PQX A;  1PTO D;  1YNN D;  5K5P A;  2Q8T A;  3BVM A;  4KD3 A;  2BDN A;  4HSP A;  1QNK A;  1EY8 A;  3WDN A;  2LS0 1;  4Q0F A;  1U4L A;  1BDO A;  3DUZ A;  1A3T A;  5M9O A;  1HQM C;  3FMC A;  1W6J A;  2EYF A;  5BN4 A;  4LMQ D;  1TKW B;  4A3I B;  5CV6 A;  2BOS A;  1BF4 A;  3CKI B;  4M1U B;  5FLX L;  4IUV A;  2ENB A;  5FO8 B;  3DEP A;  3IAY A;  1S5F D;  1OXV A;  3MFG A;  2XSC A;  3MC0 B;  1Z47 A;  2MPM A;  4NKL A;  1FNW A;  1EY0 A;  1CZG A;  1BOS A;  2X69 A;  1WTX A;  1HTL D;  4A93 B;  4BY1 B;  4ME5 A;  1C4Q A;  2WIN B;  4RHR A;  1VF5 C;  1C8C A;  1JOO A;  2Z4H A;  1BQQ T;  5IGG A;  2Z4I A;  3SE0 A;  5FO9 B;  1TWG B;  3H09 A;  5CMD A;  4A3G B;  2KJX A;  1A3V A;  4A3E B;  4IUP A;  2WKC A;  2JA7 B;  2IL8 A;  1STE A;  3HOZ B;  1M4V A;  1LTR D;  2IWH A;  4N9T A;  2YYZ A;  4C1N K;  1Q1B A;  1BO0 A;  1V1O A;  4GZY C;  2A6E C;  1IYV A;  4RHS A;  2D5D A;  2R92 B;  1PZI D;  3TME A;  3I72 A;  4IFD G;  3UI2 A;  3RD4 A;  4KMU C;  3KF8 A;  2F0D A;  4WJW A;  4RGM A;  2PZT A;  5CV7 A;  3AMU A;  1MSG A;  5CGK A;  4CJ2 C;  2KUM A;  2EPB A;  4I7Z C;  1U9R A;  2EYM A;  4EQP A;  5ELC A;  1HA5 A;  2RQX A;  1H9R A;  5CYU A;  3O13 A;  1WD1 A;  4BA2 I;  3T16 A;  3J81 L;  2HQE A;  1S5D D;  4MIU A;  2EY2 A;  3CRK C;  1ENC A;  2F0M A;  1GOZ A;  1JB3 A;  3A56 A;  4HR7 B;  5I2Y A;  3M85 A;  1EOT A;  2J4X A;  4XDX A;  4V19 0;  3HZX A;  1AEX A;  1F9R A;  1V1P A;  1HTP A;  3U9O A;  4KTA A;  1RKN A;  1HCZ A;  3S17 B;  2E76 C;  4KY5 A;  2F0U A;  2JSO A;  1K8O A;  4EVO A;  2F1M A;  2EYO A;  3A8I E;  2A69 D;  1XYI A;  1SND A;  1VF7 A;  2K32 A;  3BDO A;  3TP6 A;  5C5M A;  1J8I A;  1OXT A;  1NCV A;  3NTI A;  1ICW A;  4K6L A;  1B2T A;  1CQF A;  1ZEQ X;  2EOT A;  2WKD A;  3NBI A;  2FMC A;  1TQO A;  3R93 A;  3N6R A;  2KEC A;  4PMW A;  4A3K B;  3LNN A;  2HCC A;  1U4R A;  3ND8 A;  3KBG A;  5C5L A;  1PZK D;  3RZD B;  3CU7 A;  2XRQ D;  1II3 A;  1JC7 A;  2D2C C;  2PMZ B;  4KD4 A;  5J1Z A;  2NVX B;  3QIA A;  2MJ8 A;  4H7B A;  5EKK A;  5TSS A;  5KRU A;  1CQV A;  1KNA A;  4PNY A;  5I6W A;  2K1B A;  3NQI A;  3TZD A;  1S4Z A;  1Y69 U;  5JEA G;  4IUN A;  2EJM A;  4WOR A;  1Q3L A;  3PIO 3;  1KTK A;  1DJR D;  2EYL A;  3Q0A A;  3ERQ A;  5DM7 3;  3K5O A;  3L9A X;  5K36 H;  2F0H A;  5FKA C;  3TN2 A;  5DEH A;  3PUY A;  2HUG A;  1R9T B;  4CBV A;  1STG A;  1QB5 D;  2VNU D;  4H13 C;  2A73 B;  1RJT A;  4FXK C;  1WCM B;  3HRZ C;  3GTJ B;  3D4R A;  3LWE A;  2F0E A;  1KDC A;  2HDM A;  1I4Q A;  2AWO A;  4DNR B;  2XN9 C;  2O5I C;  3HOW B;  3J80 E;  1G6Z A;  1EFI D;  1LTG D;  5DM6 3;  2BDO A;  1OO9 B;  3WOF A;  3DWQ A;  3SK4 A;  3D6C A;  2KCC A;  2A68 D;  1TII D;  3EA6 A;  1PMR A;  5J22 A;  2PNR C;  1CZW A;  2PCF B;  1HXY D;  2B2T A;  3KUP A;  1DD2 A;  4N9P A;  5IGB A;  2NUC A;  2BA0 A;  4FVM A;  3N52 A;  5KNC A;  3HS0 C;  1WTV A;  1R4P B;  4XQQ A;  4ZRZ A;  1ENF A;  1SYB A;  1CK1 A;  4K2L A;  5KIX A;  1BNZ A;  2WP8 J;  4FP5 D;  3Q23 A;  2NBF A;  3CHB D;  2J7Z A;  5ISR A;  3FVQ A;  4ZAI A;  2B2T C;  3PUX A;  4IUQ A;  3GTM B;  3D6W A;  1J9O A;  1B1Z A;  4XQN A;  5C4J B;  5CV8 A;  1AZP A;  4NDX A;  2K03 A;  3HG9 A;  4RFB A;  4B9W A;  4OO1 G;  1HRJ A;  3OWF A;  1SNM A;  4ZKB B;  2X6L A;  4C3H B;  2O5J C;  5A2Q L;  1XTC D;  4RGT A;  2PZW A;  2WAQ B;  4G7Z C;  2CW0 C;  1I6H B;  4NMZ A;  4V0B A;  3C1F A;  4K5W A;  2WII B;  1FR3 A;  2B2W C;  3X3N A;  4PV1 C;  2K5D A;  2R61 A;  1TWF B;  1I4R A;  1SYE A;  1K8M A;  4F8M A;  1T5X D;  3LX0 A;  2AQ2 B;  5NUC A;  1H9S B;  3VA7 A;  4UDU C;  3VR6 A;  1MI2 A;  4P2C B;  2L12 A;  4KK7 A;  4HCS A;  1EZ8 A;  3M3Y B;  5G3L D;  4B08 A;  3OSO A;  1ZYR C;  1E2W A;  2C5C A;  4FYD A;  3VR4 A;  2N55 A;  2K01 A;  2D62 A;  2O2L D;  5IGF A;  3TP7 A;  2F0I A;  3VYT A;  4DU9 A;  2E2J B;  3PUW A;  5LHY 1;  1PXU A;  4BBS B;  4F7X A;  5J39 A;  2AUK A;  2RDF A;  3HOV B;  3R2I A;  1Q1E A;  1DZ1 A;  4KY7 A;  3SEB A;  3GTG B;  1Z6H A;  1A2T A;  1B3A A;  3HOX B;  3NWT A;  3PV0 A;  4TSS A;  2ICE C;  3HP3 A;  4WFN 3;  2VB2 X;  1BBX C;  2ID0 A;  1Z7T A;  4K14 A;  4RWS C;  2NVT B;  4EQN A;  4RGO S;  5M3M B;  2MGS A;  4FF3 A;  2NN6 I;  4C2M B;  3BYY B;  2FIN B;  1GUT A;  4CHT B;  4G57 A;  3ERO A;  1SNQ A;  1I50 B;  3GTK B;  2VB3 X;  1ENA A;  1CI3 M;  1JIC A;  4Z9C B;  4CGY B;  3H3V C;  4IUR A;  3D31 A;  4Y7N B;  3NQT A;  1A3U A;  1X3P A;  1MGS A;  1M8A A;  2F0J A;  4TRD A;  1PLF A;  2A6E D;  2NB0 A;  1EWC A;  2F0N A;  4IFD J;  5ELF A;  2I07 B;  1EU3 A;  1SYC A;  1DOL A;  1CHQ D;  1NSN S;  4IUT A;  1I4P A;  4FF2 A;  1B9M A;  5E4W C;  5I6Y A;  1EYA A;  4O42 A;  3AU7 A;  3G7L A;  2Z8L A;  1B53 A;  3SVM A;  4XT3 B;  2JEA I;  5C3X A;  2WAC A;  1AZQ A;  3GP7 A;  3S15 B;  3OMG A;  2QF7 A;  3FRP B;  1SJH D;  2GA4 B;  4CKC A;  1AFP A;  5JAV A;  3NWS A;  5EPL A;  1IL8 A;  2K5Q A;  2B2Y A;  1GXD C;  1TU2 B;  3J80 L;  2E2D C;  3MVV A;  4ZKC B;  1D5M C;  1SE3 A;  5KGU A;  1ILQ A;  1I4H A;  2L55 A;  2EYH A;  3BDC A;  3SXH A;  4XIG S;  1VMP A;  1EL0 A;  4A3J B;  2AQ3 B;  4IZ8 A;  1JWS D;  4ODG A;  2B2U A;  1KAA A;  1LTS D;  1Q90 A;  2B8F A;  1ET6 A;  4LK1 C;  2EYJ A;  2B2Y C;  2KCN A;  5JPM C;  3E6Z X;  1SSO A;  4DXG A;  1F2Z A;  3NUC A;  3NP8 A;  3GTP B;  4DK0 A;  3KK7 A;  1Y1W B;  2LMC B;  1XXG A;  4KKT A;  2HDL A;  3QJY A;  5HUR A;  4DAP A;  1STN A;  1TT2 A;  2B2U C;  1AN8 A;  2B8G A;  4KKS A;  1PRT F;  1NAP A;  1B9N A;  3OPO A;  1H9J A;  4L8J A;  2F0V A;  3A7L A;  4IQZ A;  4KJN A;  4H0L C;  2EVB A;  1SYG A;  2PZU A;  1PZJ D;  2F4I A;  4DGZ A;  2JEB I;  1CT1 D;  5LL6 X;  2OF1 A;  3SDZ A;  1Q12 A;  2HCI A;  2SNS A;  2F0S A;  5A2Q E;  4KY6 A;  5C3W A;  1GUW A;  1JCK B;  1STY A;  3BZD B;  1CA6 A;  3ZYY X;  1HUM A;  3OIP A;  1CM9 A;  2F0T A;  4XYO A;  4L63 B;  3I4L A;  5C3E B;  2DY7 A;  1S5B D;  1D6E C;  1GUG A;  1RF2 D;  2D9U A;  3H91 A;  1CTM A;  4DAV A;  1B50 A;  1DOK A;  4H44 C;  5EBD A;  2JA5 B;  2VUM B;  4U68 A;  1TS2 A;  1JOR A;  1A6X A;  3TDQ A;  3MHB A;  1ROD A;  1GUS A;  4C56 C;  3NPP A;  1LAC A;  5JVG 3;  3M4Y A;  2YU9 B;  4A3D B;  3RUZ A;  3H0G B;  4S3S A;  1TWH B;  4F88 A;  3NTK A;  2IT1 A;  5DAU A;  1EZ6 A;  1XWE A;  1PTO B;  4X3T A;  3K7A B;  5COR A;  4HSV A;  1L0Y B;  1V43 A;  2NN6 H;  3JAM L;  2M9V A;  2I46 A;  2SEB D;  3TSS A;  3TZU A;  1STH A;  5C0X I;  1BUV T;  2KOL A;  3J7A V;  2K5W A;  4HMI A;  4ZQ3 A;  3EJI A;  3KLS X;  5ELE A;  1EU4 A;  1LTT D;  1FNU A;  1S5C D;  5FO7 B;  2B39 A;  3FEW X;  5EBC A;  1F9P A;  4F87 A;  4C3I G;  4FNF A;  1ML0 D;  1ZXT A;  3EQL C;  4KHZ A;  3C2P A;  1EYD A;  2FFK B;  2Y0S B;  2C9O A;  4RAU C;  4ZYS A;  4BY7 B;  4IAL A;  3KBX A;  4ULL A;  1MSH A;  1LTA D;  2FHT A;  3L3O C;  1EYC A;  2RSO A;  2ZXR A;  3I8Z A;  1F2Y A;  2E75 C;  1IW7 C;  1X3Q A;  1WTQ A;  4RKB A;  3I4N B;  3V96 A;  1HFG A;  1SNC A;  1JR0 D;  4MN3 A;  2OXP A;  2SOB A;  1BCP D;  2XNA C;  5E1F A;  4YIJ A;  2KEE A;  4DK1 A;  4DNT B;  4FO2 A;  3J7A F;  2IW3 A;  3MA2 B;  2KA7 A;  1WTW A;  2Q8I B;  4K2K A;  1SJE D;  2F0G A;  2JA8 B;  2TMP A;  2EYP A;  4K5X A;  2IX3 A;  5K36 G;  3GO5 A;  3MWY W;  3E5S A;  1DYQ A;  3IKJ A;  2A5H A;  1LLR D;  2RDH A;  2IX1 A;  2PO4 A;  4DA2 A;  3M7G A;  3MFY A;  4J6H A;  3GTL B;  4G7H C;  2QKI C;  4QUF A;  1PRT C;  3I91 A;  1SBB B;  1SAP A;  1O7L A;  3PUZ A;  1G91 A;  4XTC S;  5C0X J;  1A2U A;  2E2I B;  3Q6S A;  2LKV A;  1YNJ C;  2F03 A;  3OIQ A;  2RVL A;  2L9H A;  2QEJ C;  4K8J A;  1HQR D;  1QCB D;  1JOK A;  1SMY C;  3FDT A;  4B9X A;  1ESF A;  5BN3 A;  3HEJ A;  2AQ1 B;  1E0B A;  3BVG A;  4WRD A;  2PYK A;  1D1K A;  3FPU B;  1V8Q A;  4BS9 A;  4X3K A;  1LT3 D;  3S1R B;  4HMJ A;  4IFD I;  3MXU A;  1UAP A;  5EPJ A;  3BVZ A;  1QOH A;  2MUY A;  2IPK D;  1GHJ A;  3MEH A;  1S5E D;  1QWY A;  1PFN A;  4HED A;  1HFN A;  4K5V A;  3K0Y A;  3RMH A;  3T56 B;  4DF7 A;  4CKB A;  1PTO F;  3K6O A;  4ZK9 B;  5CC4 A;  2J0T D;  4JK1 C;  2O4X A;  1TS3 A;  3NSW A;  2MHV A;  1LT5 D;  2OEO A;  2EE1 A;  1Y1V B;  3OHX C;  1HHV A;  2NYZ D;  1SEB D;  1RCV D;  3VR2 A;  5T1I A;  2JE6 I;  1G2T A;  2NZ1 D;  3GQB A;  2L4N A;  3EVQ A;  5M5W B;  1F2M A;  1TS5 A;  5LL6 S;  2XVS A;  1RD9 D;  3V2T A;  1LT6 D;  5JOB A;  1I4X A;  2IX0 A;  4RH6 A;  3MXP A;  1G29 1;  5C0X H;  5D14 A;  3QG1 A;  4A3F B;  1E2Z A;  3D3R A;  3M7N A;  1D1I A;  2X6G A;  1O78 A;  1QIL A;  1L0X B;  5D65 A;  5KYL A;  3JAM E;  2K04 A;  5BN5 A;  2B63 B;  4FF4 A;  2RA4 A;  3NBH A;  1LTI D;  4J1M A;  2PW5 A;  5I4D A;  2RDG A;  3W3A A;  1JQY D;  3NXW A;  4KV6 A;  3PO2 B;  1BCP B;  1ZKO A;  4ZUI A;  2DY8 A;  4KKU A;  4R8I A;  2FJ2 A;  3IFT A;  1KLG D;  4OIK A;  4LAA A;  5AFW A;  4XYQ A;  5CV9 A;  4PMC A;  4DAY A;  3NHH A;  3G6J B;  3C3L A;  1GUO A;  4FF1 A;  1ILP A;  1JWM D;  3FKI B;  5M5Y B;  1EY5 A;  4TKO B;  2IJ0 A;  1I4G A;  1A15 A;  4C3J G;  3NTH A;  2CQA A;  2A6H C;  2M2L A;  2K33 A;  2QDB A;  2VXW A;  3SR1 A;  5JVH 3;  2CVR A;  4QCL A;  3URY A;  2F0W A;  3M4O B;  3S2H B;  1QG7 A;  1FGB D;  1Y8N B;  1Y8P B;  1H9M A;  3NE5 B;  4KHV A;  3R8B A;  1G2S A;  1D5X C;  1EY9 A;  1JOQ A;  4RCN A;  1XX8 A;  1SXT A;  2EZV A;  2EY5 A;  1UEA B;  2ICI A;  1JE4 A;  5IIF A;  2G9D A;  5CR3 A;  1SDF A;  2AUJ D;  5EKL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...