2EDGA

Solution structure of the gcv_h domain from mouse glycine
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
130
structure length
130
Chain Sequence
GSSGSSGRKFTEKHEWITTEEGIGTVGISNFAQEALGDVVYCSLPEVGTKLKKQEEFGALESVKAASELYSPLSGEVTEVNEALAENPGLVNKSCYEDGWLIKMTLSDPSELDELMSEEAYEKYVKSIEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycine cleavage system H protein
publication title Solution structure of the GCV_H domain from mouse glycine
rcsb
source organism Mus musculus
molecule tags Biosynthetic protein
total genus 16
structure length 130
sequence length 130
ec nomenclature
pdb deposition date 2007-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01597 GCV_H Glycine cleavage H-protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2edgA00
1E2ZA 2DNCA 3PUYA 1Y8OB 3QJYA 2BE5C 5JEAH 1CFMA 2CW0C 3RLFA 2E74C 3LWUA 2O5JC 2BA1A 2Q8IB 1IYVA 2B8GA 3A8JE 2A6HC 3NE5B 5BN4A 2AUKA 3SDZA 2E75C 5C0XG 3I73A 1H9SA 4G7HC 1DXMA 1Y8NB 1OXTA 5BN3A 2NN6H 2DNEA 1E2WA 2JE6I 3OPOA 5JEAG 2JXMB 4TKOB 3PUVA 3M7NA 1GHJA 4H44C 3PUWA 4IQZA 2D5DA 1VF5C 3BDOA 3OW7A 1YNNC 2KCCA 3QIAA 1OXSC 3T53B 4JK1C 1ZKOA 3D4RA 1GHKA 1H9SB 1OXVA 3GD7A 1T5EA 3FMCA 3HGBA 2NN6G 3VA7A 3PV0A 3PUZA 2AUJD 2PPBC 1BDOA 1B9MA 1V43A 2LMCB 2QF7A 2K7VA 3P20A 3DXJC 2D2CC 1VCIA 1IW7D 1DCZA 3M4YA 2K32A 1A6XA 3TZUA 1K8MA 1EWHA 1DD2A 4H0LC 4KKSA 3AB9A 2B8FA 1IW7C 2A6ED 2EJMA 3I4LA 2AWOA 1H9RA 4LK1C 2BDOA 2R6GA 1O7LA 3I72A 3D31A 2A6EC 2A69D 2EJFC 4I7ZC 2EVBA 1Y8PB 3QG1A 4BA2I 1TU2B 3A8KE 1ONLA 5KNCA 1GUSA 3VR6A 5A35A 3IKJA 2A69C 1Y69U 4OO1H 3IFTA 1FR3A 1HQMC 2F1MA 1GUOA 1ZYRC 4KN7C 3FPPA 2E76C 2IT1A 2K33A 4RCNA 1VF7A 1Z6HA 3VR3A 5KNBA 3OOCA 1K8OA 3VR4A 1O78A 3PUXA 1E2VA 1HTPA 3BG3A 4JBWA 3MXUA 1H9MA 2EDGA 4XIGS 4KHZA 4OO1G 1TKWB 4LJZC 2O5IC 4G7OC 2V4DA 2YYZA 1Q90A 4BA1I 3L7ZC 2D62A 3LNNA 5KNDA 2NN6I 3N6RA 2BA0A 3MFYA 4XTCS 1V8QA 3A7LA 1I6VC 4TQUS 5K36H 1H9JA 3M85A 4H13C 4KKUA 2DN8A 4IFDH 4KKTA 4KN4C 1SMYC 1Z7TA 3WDNA 1GUGA 1CTMA 1QJOA 3CRLC 1HCZA 3T51B 3T56B 1LACA 1Q1EA 1G291 2KA7A 3EQLC 3GQBA 4KMUC 3VR2A 2L5TA 3ND8A 5K36G 2ZT9C 3U9SA 1HPCA 1VDZA 2EJGC 1OXXK 2A68D 4DNTB 4DNRB 4IFDG 1IYUA 2JEAI 1YNJC 4OGQC 3SE0A 4HR7B 3CRKC 3ND9A 2A68C 1Q12A 3A8IE 1GJXA 1CI3M 3A7AB 4PV1C 3H94A 2PNRC 3KLRA 4G7ZC 4KI0A 1Q1BA 3VR5A 4L8JA 1LABA 2JEBI 4DK1A 4DK0A 5BN5A 1GUNA 5C0XH 1PMRA 1B9NA 2BE5D 4GZYC 1GUTA 1FYCA 1H9KA 1OXUA 3W3AA 2A6HD 2PCFB
chains in the Genus database with same CATH superfamily
2O4XA 1LUZA 2O5JC 1J6QA 4LF9Q 1VQGA 2E8GA 5C3WA 1SNCA 3EBEA 1LT5D 2H4OA 4K14A 5DLQE 3V96A 1MI2A 5FLXL 2OCEA 2OTLA 1V1PA 3D4WA 4XDXA 5M5YH 2Z6KC 2KHJA 4LUVA 3GTGB 2IL8A 4PMCA 1A15A 1F9QA 4GN3B 3U50C 2RA4A 3C2PA 4OX9L 2NN6G 4JV5Q 4U673 1JC7A 4JG2A 1YHAA 5KEEA 2MP1A 4B08A 3IRBA 3KF8A 1SFOH 1DD2A 2CVRA 2HQLA 4ZQ3A 1SYDA 3NWTA 1H9RA 2OWOA 1Y1VH 3I72A 2B2TC 2E2DC 3SK5A 4FF4A 4I7ZC 2JA8G 1RTNA 1ONLA 3GV6A 4F8MA 3DLLA 3VR6A 2E2HH 2C35B 4JI0Q 2OEOA 5CV4A 1IL8A 2IT1A 5ELEA 4C1NI 1Z6HA 4K8JA 1CHQD 4WFN3 1M90C 4C3JG 1N34L 4IUUA 4MN3A 2R93H 3A5ZB 5D3IB 4JI1L 2E5LL 4QQBX 4HMJA 1L1OA 1KDCA 4HN7A 1OO9B 4BA1I 1WFQA 1PFNA 4MHEA 4A3DH 3D6WA 1HTLD 5FO8B 3N6RA 3RLOA 3HOVG 4KJOA 1E3PA 2Z8LA 4BBSB 3TEHB 5FO9B 3Q22A 4JYAQ 2ICEC 2VQFQ 4H13C 1EQQA 3TN2A 1ILQA 3TSSA 1PFMA 2M2LA 2X69A 2O2LD 2UU9Q 1PLFA 3GP7A 2WP8J 4A3EB 4GLAC 3VR2A 5IYCH 2F0EA 4DXFA 2QW7A 4DR5Q 2Z1CA 1SDFA 5ELFA 4OGQC 1EEID 2CCZA 5GAHC 2MPMA 1FJGQ 4KTAA 1EUJA 2WV6D 4RGNA 1SJED 2RHQB 3M4QA 4J6HA 1PH7A 1MJCA 1I6HB 5I6YA 1TWHB 1VQDA 5C3EG 1B9NA 1NSNS 4GZYC 1GUTA 1CHPD 2PCFB 1CSQA 3OWEB 4FYDA 1I4XA 4GOPA 2F0OA 4LFAL 3PO3B 2D0PA 4RGTA 4XQQA 4UP9A 3KFUA 1HZCA 4R4CA 4N9PA 5KIXA 5HURA 3HOXB 1K28A 1G51A 3K5NA 1PV4A 2N3SA 1EY4A 1PTOB 4LF6Q 4TKOB 4ZAIA 2GN5A 4UDUC 3PIPA 1RODA 5CV8A 2ZJQA 3CQZH 5IT9L 1T5EA 1IHZA 4CDFC 3W1BA 4DK3C 4LFCL 4HMIA 3HOZB 2I07B 1SR3A 1UE6A 5M3MG 2N49A 2N88A 3HOYB 1DGSA 4DR4Q 1KLUD 2BOSA 5IOCA 2A6ED 5DEHA 2NZOA 2BDOA 2SOBA 4BY1G 5FLMG 5GADC 2A6EC 3I4MG 4HJAA 1TIID 3A8KE 1STEA 3CXCA 3C1EA 4K2LA 3Q6SA 4LW1A 4DV6Q 4GNXA 2ZJRA 4NMZA 3NK9A 4KN7C 3HKZB 2KCNA 2OTJA 2VL6A 4P2CB 4DV0L 3S2HH 1Q81C 4NDXA 3H3VH 3PO2G 4N8FA 5CORA 1X3GA 2O5IC 4A3LG 5E4XA 2J0TD 4CGYB 4C3IH 4DFAA 1HNWQ 1IKLA 3A7LA 4TQUS 1QZGA 1JB7A 4NXNQ 4A3KG 3SGIA 1Z7TA 3MA2B 3CRLC 4YY3L 1EOVA 1TWCB 4JI6Q 3MC0B 1VQ9A 2MHVA 1I4GA 4O2DA 1X32A 3DEOA 2A68D 3UI2A 1V1OA 1QVCA 1VS0A 2A68C 4NXML 3L0OA 1VQKA 3ICEA 4G7ZC 4FDBA 2RCFA 1Y1WB 5C4XH 4BY7H 4A3BG 4L5QA 1LABA 2JEBI 5L37A 3TS0A 2CWPA 5T1IA 2CW0D 2R92B 1EQRA 3E5SA 2CW0C 3Q0AA 2R3ZA 2VB3X 3CPWA 2PMZB 3IL8A 3HFZB 3KBGA 4HJ5A 1GM5A 2P5ZX 4A3CH 1MBYA 1E2WA 2ZM6Q 3ER0A 2Q8RE 3GTKH 4K8IA 5IIFA 4LWCA 2YV5A 3GD7A 1MIUA 3VA7A 4KY7A 1HNZL 3QO2A 2N78A 4EX5A 4AQYQ 2F3IA 3J80c 4KJNA 3QB3A 1IW7D 2JA6G 5J1ZA 1F2ZA 3S15B 1BR9A 3S1NH 1IW7C 4A93B 4KHPL 1CKNB 1NE3A 2JA5H 4DN4M 4QUCA 4OWTB 5AJ3Q 2L0CA 4WORA 1NY4A 1QG7A 3KLSX 1WTWA 2L55A 3A56A 5IY0A 3GTMB 1RHPA 4GKKL 1XX8A 1Q46A 2LSSA 3MXNA 2B2YC 4B3TL 1I3QB 3M4OB 4FF3A 2XWJB 5KYIA 4GN4B 4Y7NH 4OO1G 1CM9A 4JI2Q 4LJZC 3TDQA 1SE2A 4LF5L 4ZLTF 2BA0A 1SYCA 2RDHA 1SMYD 2NVQB 1U4LA 1N36Q 1PHJA 5IWAL 5JVH3 4PMBA 1SMYC 2H5XA 2SNMA 1I94Q 1HCZA 1LACA 3GQBA 4LUZA 5D3DA 3ZYYX 1PH1A 4A75A 3EROA 5C4HA 4I65A 4QUFA 4DV3Q 1ENFA 4YHHL 2A1AA 1CI3M 4XYQA 1K3RA 3MFGA 1GOZA 1YIJA 1EL0A 4YCVA 5JJLA 3P7JA 4AYBB 1PMRA 2GVAA 4DV7L 2A6HD 3QOJA 1D1IA 3H0GB 5JEAH 3I56A 3QWNA 2VW9A 1KXLA 1EY8A 2A6HC 1XPRA 4K5WA 2AUKA 2F0FA 4NP5A 5ELNA 2WFWA 1PH9A 2QCPX 1E0BA 3I4NG 4FF2A 5LHY1 2Z0SA 4RH6A 1HZ9A 2Q2HA 5C4JB 3PO3G 1VF5C 5M3FG 1B53A 1PYSB 4ZYSA 5LL6S 3K7UC 2PQAB 1I50H 4IALA 3HOWG 2LMCB 1XMQL 1AN8A 1FGUA 2JA9A 2J7ZA 2LS01 1LM0A 3H3VC 5I9PA 1NCVA 2D9UA 3I4LA 2AWOA 1CZGA 3NELA 1O7LA 4XYOA 3HOYG 2IY5B 2ALYB 3T1YL 5EGTA 4LF4L 4FVMA 5KGUA 4A3GH 2YTYA 2NVTB 4DV1Q 2PW5A 1F2MA 5KNBA 3JAMi 3TP5A 1PVOA 1KHIA 1U4RA 1NNXA 4C2MB 4DPGA 1E2VA 2JA8B 2KEDA 3K0XA 3LGJA 5EPLA 1A3UA 1S3OA 1D1KA 2D62A 3LNNA 3KF6A 3RZDH 2K14A 2WB1E 3HEJA 3OW2A 4C3JB 3GV3A 2ASBA 1AZQA 1EIGA 1ESFA 5LMUL 2KJXA 3HKSA 3S1MH 2ZXPA 1EQTA 2OT2A 3CCMA 1B44D 3T51B 1Z47A 4RG1A 4L6TB 1A8VA 5C4ZA 1I5FA 2AHOB 2WAQG 3NENA 1IBLL 3BDCA 1EYDA 4BBRH 2K01A 1CKMA 1HUMA 1PYBA 4ZK9B 1NMFA 1AH9A 5I6WA 2RQXA 3SK4A 1TWGB 5COYA 4J15A 1Y8OB 2F0QA 4A3IH 1J5EQ 3GTLB 1XJVA 1QOHA 3LWUA 2BA1A 3HG9A 1Y1WG 2E75C 4X65L 3D4DA 3K8AA 2RVLA 2BDNA 1G6ZA 3S1QH 2JE6I 1CQVA 3C3LA 2NVXB 2HIVA 1WCMH 4CDCC 3DWAA 3A5UA 2B63H 1TT2A 3G6EA 5CYUA 3HGBA 1L0XB 2N55A 3BDLA 3W1GA 3AFPA 4DU9A 1KDBA 2A74C 1V43A 4JBMA 2QF7A 2D2CC 1B1ZA 4POGA 2EY5A 4OWXB 2MNAA 1PRTD 4HIKA 3HKZE 2IX3A 2ZTDA 2KCMA 1XMOQ 4LF7L 4IUQA 3WOEA 1PRTC 4DAVA 3CCJA 1YITA 2E2IH 3RLNA 3E3XA 3S17B 1LTAD 2K28A 2K6AA 2EVBA 5M3MB 1STHA 1MHWC 2NZHA 1GUSA 3SK8A 3IKJA 1N9WA 3G71A 2VUMH 1HR0L 1HQMC 3S1RH 3B6YA 1D5MC 4A93G 1L1OC 5KYLA 1J9OA 2K03A 5M5XH 3OMGA 4DV5L 5HGTA 4HCSA 2KCTA 1FNVA 2RSOA 1RIPA 1XPOA 3MAQA 1JE4A 1U4MA 2NTTA 5HGQA 3O13A 2DN8A 3PO2B 3H91A 3R2IA 1EY6A 4K6DA 4DGZA 3FKIH 4BXXG 1KNEA 4UPAA 2ZT9C 3A0JA 3OYYA 1JB3A 4P74A 5CV7A 1M4VA 4F7XA 4Q5VA 4CBVA 4KY6A 2PMZE 4DK6C 1QNUA 4JBJA 1VMPA 1K83H 2PNRC 5EBCA 1Q8KA 2UXBQ 4GOPC 3AMUA 3AQQA 2EY1A 4K2KA 1GUNA 5C0XH 1IBML 1JT8A 4IO9A 1QB5D 1BF4A 4V190 1HFNA 1C0AA 1TWAB 1RJTA 2ZXOA 2KEEA 4M8AA 1E1TA 3STBD 3T1HL 1K0SA 4TSSA 1E2ZA 5G3LD 2IHFA 1KAWA 3U58A 1M8AA 1PYWD 3RLFA 1IYVA 2E74C 3STBC 1EZ6A 3CAMA 3NE5B 5BN4A 4UY8C 5C44H 1BCPB 1FGBD 1JOKA 4HIDA 4A3BB 1EU4A 1L2FA 1LTID 3TBIB 5BN3A 5CGKA 4DR7Q 4GKKQ 2DNEA 3NTHA 5M5YB 1XXGA 2EOTA 2V1CC 4X66L 3M7NA 1STYA 1VQMA 3PUWA 3HRZC 4HIOA 4A3FH 4RGMA 1PDQA 3QIAA 4WRDA 5IYBG 3MEHA 4GKJQ 1KDAA 1C48A 2FMCA 3NBHB 5EPKA 2PQEA 2CWAA 3R93A 3F2BA 4ZKCB 4C3HH 1GKHA 1Q8IA 4KV6A 4RCOA 4H0LC 4KKSA 4PZ8A 3W5OA 3CC2A 1EYAA 1HZBA 2H1EA 4GNXC 2EYOA 4PMWA 4FO2A 3D3RA 4ME5A 3PIOA 1Y8PB 2NB0A 3CKIB 5FLXc 1ZYRD 2RDGA 2EZVA 1PH5A 2JA6B 4QIWB 3S16H 3BYYB 1QE6A 3E6ZX 4V0BA 4YHHQ 1ZYRC 4B3ML 1K8OA 3VR4A 2JA7H 2UXCL 3EVQA 4WJ3M 1JOQA 2K75A 3E9IA 1JQYD 1N8RC 2YYZA 4A3DB 3M7GA 2MO0A 1HA5A 3MFYA 4EVOA 1UUPA 3MXGA 4GS3A 1NR4A 1XNRL 3L3OC 2OQ0A 1XTDA 1YJWA 4KKTA 4BWGB 4KN4C 2KENA 3BVGA 3FRPB 1GUGA 1QJOA 5CBAE 3IAYA 4IZ8A 5FO7B 1VQHA 5E3FA 4AYBE 1QVGA 1SNPA 2LXKA 1PXUA 1VDZA 2N8NA 2SNSA 1X3PA 1OXXK 1RTOA 1SNDA 5LL6X 1HH2P 2EYFA 1RD9D 2JN4A 2WINB 1UWVA 3U4ZA 1X55A 3GTQH 2XRSD 1EQVA 2NYZD 5CV6A 3GTGH 3X3NA 1QWYA 1CZWA 2Z9HA 3V2TA 4X64Q 4DK0A 5I2XA 3BVMA 1EFID 1V1QA 2YTVA 4DR1L 1H9KA 3J81i 4JI4L 1CKNA 4AIMA 1QVFA 3CCUA 2UXDQ 1NUCA 1N33Q 4DXGA 3I55A 5ELOA 3SDZA 1XNQQ 3L2PA 2YU9B 4LF4Q 4RMFA 5JJKA 2VS1A 4ABNA 3H3VI 3NBIA 3OPOA 1MGSA 2PW7A 5H1SE 4LFBQ 1BKBA 2MO1A 2A73B 2FJ2A 5CV5A 4EQNA 4G4KA 2DGYA 2F0NA 3C1FA 2DY8A 2RF4A 3PUZA 3T16A 3I4NB 1LTRD 5J39A 1PRTF 5D14A 4B3SL 1LV9A 4LF8L 3HOUG 1A6XA 1A0IA 2R61A 5M3FB 1JJCB 2EYHA 1JWMD 5IP9H 3NXWA 1WTVA 2QGQA 2Y0SG 1DJRD 4JI3Q 4X3UA 1ET9A 2R6GA 4BBSH 2UUBL 3HOWB 2L4NA 1KD1C 2K5QA 5CBEE 5EKIA 1GD7A 4B9WA 2F4IA 3GTOB 3JAMc 1I4HA 4P72A 1VQ6A 3D0FA 4A3EH 3VR3A 5ELBA 3OOCA 3S2HB 4ALPA 5J3BA 2HHHL 4KK7A 5IT9c 1CKOA 2RCNA 4NPSA 3RR5A 4KHZA 1LLRD 4R4TA 4R4IA 4G7OC 4DR6Q 3L7ZC 2HIXA 3AU7A 1WVLA 2R7ZG 1N32Q 4X62L 4UHVA 1WTHA 3I90A 3GTPB 5K36H 3DWPA 4DKAC 5IP7G 1IBKL 1I6HH 3DHQA 1GXDC 4R4OA 3M85A 4DUZQ 1TWHH 1KLGD 4CJ0B 4B3RQ 2WACA 4IUVA 2UUCQ 1EY5A 3PO3H 2JJQA 4X3TA 3T4AC 4IJHA 2KBNA 4DAYB 1IYUA 1C8CA 2I5MX 3HOXH 2PQAA 4HR7B 3A8IE 4JC0A 1PTOH 1WTQA 1TVXA 3TS2A 1FNUA 1UNSA 4XQNA 3RNUA 1VQOA 1O80A 4A3JG 3CC7A 5G3LF 1JMCA 1JJGA 3LX0A 4RKLA 2BE5D 2WAQB 1VQ4A 4EGVA 3RZOH 1U5KA 2XNAC 3HOZH 2DNCA 2BE5C 4XT3B 3L9AX 4KD3A 4ME3A 2B8GA 2IWHA 2M00A 3NUCA 1SNQA 4DR3L 2CH4W 1H95A 3KUPA 3UDFA 3S9WA 2Q2TA 1R9TB 5I4DA 4JI7L 4IQZA 3CCRA 2KCCA 5IGDA 4DR2L 3KBXA 1OXSC 4HEDA 3ONAB 2PO4A 2VQEQ 5EBDA 2Q2IA 5NUCA 1V1PB 5JPMC 3QR8A 2F0DA 3K7AB 5ELCA 5BR8L 1XWEA 3DXJC 1VCIA 3K81C 3M4YA 4CKBA 5AFWA 3P75A 1K9MC 3PIO3 1TS5A 3S1NB 1W2BA 5JEAJ 2B8FA 1JICA 2CHBD 5C5LA 4DV2L 3KF8B 5DM63 4RA8A 3SXHA 1SRUA 2MUYA 2PZUA 4JVZA 4X3SA 3PSIA 1IYJB 5DNFA 2UUAQ 1Y1VG 3MZ5A 1D8LA 1TWCH 3AFQA 1E22A 1VQ7A 4Y7NB 3M3YB 3BVZA 1IBMQ 3KOJA 4XIGS 4EQPA 4Z9CB 4PZ6A 3G6JB 4OWWB 5IYDH 5KNDA 4CJ1B 3UE0A 3F2UA 4APVA 3I3CA 4HIMA 1SJHD 2M9VA 4PG3A 2R93G 4K0KQ 1PH3A 1X54A 1O7YA 1HNXL 2R92H 4A3DG 4OHJA 5EPJA 1YBYA 3DWQA 1LT3D 2JSOA 4IPDA 1F77A 3U9SA 3QOLA 3MEFA 2LY7A 3OTOL 4DNTB 4MIUA 1DM0B 2F3WA 3SE0A 2EXDA 1IZ6A 2E2JB 1XPUA 4FP5D 1VQ8A 5IYCG 1LTTD 3CCEA 4DAMA 2F0MA 3VR5A 1YJ9A 3PQIA 2A8VA 2PI2E 4QGUA 3FVQA 4OL7A 4BS9A 4IURA 4CHTB 4A3MH 4X3KA 1PA6A 2X6LA 1HXYD 4IPGA 4TVAB 4L5SA 4MNOA 1G91A 5KRUA 3I73A 1QCBD 1H9SA 1S5DD 1SEBD 1M1KC 1Y8NB 4OX9Q 1VQEA 3S15H 1LT6D 2BH2A 1TQOA 4RHSA 1VQFA 3A54A 1ASZA 4LF9L 2VNUD 2MFIA 1FVIA 2Z4IA 2CKZB 2XRQD 3NQTA 2EYLA 1BDOA 3X3MA 4G57A 2B2VA 4R8IA 4M1UB 4UAIA 1I3QH 4QIWE 1EIHA 2FINB 4O0AA 1DCZA 4F87A 1PH4A 2OQKA 5A2QE 4JV5L 4ID6A 2F0SA 5ISRA 1SE4A 1MJEA 2FFKB 2ICIA 1GUWA 3K80C 1N34Q 3AEVA 3GTJB 1HR0W 1CQFA 4JI1Q 2NVQH 1GO3E 2E5LQ 1Y69U 2KECA 2L15A 2L1BA 5IGFA 5DAUA 4N9TA 5JVG3 2RSNA 4L5TA 1WJJA 5FJ8H 1AP0A 2I0QA 2VZAA 3DMUA 5FOBB 3TP8A 1W6KA 4JBWA 1EZ8A 3LWEA 1PTOD 1WD1A 4JI0L 3MWYW 4KY5A 1PTOC 2HD3A 2HUGA 2G9HD 2F4VL 1BVSA 1I4QA 4H02A 4IFDH 3CU7A 1X3QA 4LMQD 1CTMA 2PI2A 3T56B 4C3IG 2XWBB 3H0GH 1O7IA 2HDLA 4FNFA 3KK7A 4JYAL 2VQFL 4YCWA 2NVYH 3NBHA 3TP7A 5EJWA 3PF4A 2UU9L 5C4JH 3M9BA 4LFAQ 2C5CA 4ZUJA 3J81c 4DV4L 4WJ4A 4DR5L 1YJNA 2JYOA 1LTGD 3W3AA 2CQOA 2QEJC 1FJGL 3F8TA 2Q8IB 4C1NK 4BY7G 5C4XG 1WTPA 1LYLA 4PQXA 1HQRD 1D7QA 1DOMA 1QUQB 2GVBA 2NN6H 1PZKD 2KUMA 4JI5L 1YNND 1SXTA 4LFCQ 3K5LA 3PUVA 1WCMB 3OW7A 4QF4A 1YNNC 1RF2D 1ZKOA 3SK6A 3NTKA 5GAEC 5LMNL 4A3CG 1MKHA 2NVTH 1JR0D 4NB3A 1W3SA 1KC8C 4LF6L 1YEZA 3M4PA 1DOLA 1IBKQ 5C0XJ 3KDFB 2K7VA 4NKLA 4C2MH 2JA8H 1HZAA 1Q82C 2F52A 2D0OA 3AB9A 4ULLA 3MTSA 2F3VA 2X6GA 3ITPA 1TWFB 4DV0Q 4C3JH 2FMMA 2HCIA 5JOBA 1B7YB 3HOUB 4DR4L 5C0XI 2Y0SB 1GUOA 1YHBA 2JA5G 3DM3A 3HOVH 5M5XB 1CA5A 1OTCA 2XN9C 1A63A 3DEPA 3U9OA 1K8GA 4DV6L 2V4DA 1X9NA 5JPNC 1G2TA 4CJ2C 1AEXA 5M5WB 1KIXA 4YY3Q 1BQQT 5CC4A 3K0YA 4JOIA 2A5HA 1I6VC 1AE2A 1WTXA 4HAEA 4KKUA 1TWGH 4NXMQ 4DUYL 2R7ZB 1D5XC 3FP9A 1UEAB 3EQLC 1HNWL 2L5TA 2WAQE 4OIKA 4OIJA 3I4OA 4DNRB 2TSSA 5C5MA 3K5OA 4NXNL 2JEAI 5IGEA 3BYTB 5C3EH 4K5VA 3CRKC 5CV9A 2HT1A 4N8X1 2MGSA 2F0VA 1GJXA 4JI6L 1K83B 3VYSA 2I5LX 4DAPA 3I7FA 1B8AA 1SNOA 1K3BC 2RKSA 4KHVA 2WIIB 4RWSC 4HJ8A 3UDIA 5A2QL 2K5DA 3KYHC 2VB2X 4DV2Q 3CCVA 2JQOA 3S14H 1LO5D 4A3JB 1QZHA 1MSHA 1BXTA 1HNZQ 1BBUA 2R7FA 4KD4A 3SR1A 5JEAG 2K4KA 1V9PA 1GHJA 4JCVE 4A3FB 1CT1D 5M3MH 3NP8A 1HUNA 4IJLA 3JAME 1OXVA 2GA4B 1AZPA 4POFA 2ZM6L 4R9WA 2AUJD 4KHPQ 1ILPA 3TRZA 5IT9E 5IP7H 5FLMH 4BY1H 3I4MH 2NBFA 5IGBA 1EWHA 3KLSA 2KQ3A 2IPKD 1VMCA 3S2DH 4HJ9A 2ZTEA 4AQYL 3TQYA 3KLWA 3D31A 1QNKA 4B3TQ 4GLVB 3QG1A 4DAYA 2EY6A 2EYPA 2CFMA 5A35A 1ET6A 3PO2H 3IFTA 4LF5Q 2ZTCA 4A3LH 3PGZA 5E7NA 2QDLA 1PTOF 5AJ3L 1VF7A 2JA7B 3PUXA 1SFOB 5EAYA 1I4PA 1B3QA 2JK8A 3FEWX 4MZ9A 4PNYA 4A3GG 5IWAQ 3C46A 1Q90A 4A3KH 1Y1VB 5EKKA 1UE1A 3CW2C 2BH8A 1B4OA 4JI2L 1VQAA 1EY7A 2QA4A 2E2HB 1R4QB 1TWAH 2DY7A 2DJGC 5DM73 1G291 3KF6B 4KMUC 3VYRA 5FKAC 2IHEA 2R93B 5GROA 1N36L 1U9RA 4A3BH 1STBA 2DJFC 1F9SA 4ZUIA 4DV7Q 1I94L 3GTQB 3R3OA 3WOFA 3E0JA 1U0LA 2EE1A 1VQIA 1EU3A 5BN5A 4S3SA 3K59A 1T5XD 4DV3L 4BBRG 3QJYA 4IPCA 2NUCA 1CFMA 1JJ2A 1S5BD 3R8BA 1UAPA 5FK9C 4NW2A 3OWFA 1HJPA 5EKLA 3CPFA 4A3IG 2PZWA 1SE8A 3EFXD 1XMQQ 5E1FA 3F2CA 2QDBA 1SAPA 3FMCA 2JA6H 1BBWA 1EIFA 4CKCA 3J80E 1ICWA 1S5FD 1WCMG 4R8NA 2B2WA 1EEFD 2B63G 2F4VQ 2QKIC 1LT4D 2J4XA 1E1OA 1JWSD 3T1YQ 1HRJA 2EYMA 1PZJD 4XT1B 4HSPA 1P8LA 4IN3A 1F2YA 3DUZA 1O7ZA 2WKCA 4DNIA 3K58A 3CQZB 1IL2A 4OO1H 3VYUA 3AYHB 4QCLA 5IGGA 1S72A 2E76C 2B2UA 1SYGA 4KLKA 4DV4Q 2B3GA 3CMAA 1G8ZD 2WB1B 3MXUA 1H9MA 1II3A 1TKWB 2VUMG 1D2BA 1S4ZA 5LMUQ 4DV1L 3KJPA 1CUKA 2DUDA 3CHBD 3I91A 1FD7D 1YI2A 1A3TA 2TMPA 1QILA 4K6LA 1ML0D 1IBLQ 4JI5Q 4LNQA 5I2YA 2QILA 2KOLA 4OEMB 2B29A 1JORA 1D6EC 2A19A 2MJ8A 2YU9H 5LMNQ 2ID0A 1TS3A 1UE7A 3F2DA 3VYTA 3JAML 3FKIG 1Q12A 3G48A 4RKBA 2AQ3B 4C3IB 1X6OA 3H94A 4PV1C 2IJ0A 2K5NA 1BO0A 3DM1A 1F9PA 1TY0A 2Z6BA 1S40A 4L8JA 4PZ7A 4X65Q 1B2TA 1B3AA 3RZOB 1YZ6A 1KAAA 1OXUA 4E6IA 3I4NH 4TRDA 4UP7A 1VQLA 2F0HA 2OXPA 4J1MA 4LUOA 2L11A 5C0XG 1J8IA 5M3FH 3P1HA 3S24A 3EA6A 1SSOA 1DZ1A 1SMXA 1BNZA 1J5EL 4O42A 1WD0A 1LTSD 2EXZA 3HOWH 5C44G 3MHBA 5C4XB 2B2VC 4BY7B 2IW3A 3TZDA 1GHKA 1JWUD 3GTOH 2Z6KA 4LF7Q 2AWNA 1EFWA 2LXJA 4UP8A 4DF7A 4A3FG 2Y0SE 4FXGC 3ZJYC 1K8MA 1WTRA 3HOYH 1SBBB 1MSGA 5T1GA 2EJMA 1HR0Q 1TY2A 4DUYQ 1EY9A 4LK1C 1SN8A 2F0WA 3GTPH 4C3HG 2EJFC 4DV5Q 3GTKB 4IPHA 1PH8A 3OIPA 1IKMA 3I8ZA 4DA2A 1TS4A 1XMOL 1E7ZA 1FR3A 1ASYA 2K5VA 4OELB 1A3VA 2B2TA 3OMCA 4L63B 4QJFA 4RCNA 1L0YB 1BCPD 4LAAA 4YWKA 3A55A 4FXKC 5JJIA 4JBKA 1Q3LA 4XQJA 3BG3A 1JCKB 2F0JA 2EDGA 1BCPC 1CSPA 4I7AA 1KTKA 1WOCA 3HZXA 4EQOA 2JA5B 4QMGA 3J81E 1KL9A 4Q0FA 4XTCS 3EIVA 2JA7G 1D5ZC 1QUQA 4YIJA 4P75A 4CDDC 1EYGA 3WDNA 2EYJA 3BZDB 4HCEA 1VQNA 3BZCA 1IXRA 2KA7A 4Y52H 1YNJD 3ERQA 3NSWA 2Q8TA 3H15A 1G6PA 1ZEQX 1YNJC 2C9OA 3FDTA 3T1HQ 1PRTB 2NZ1D 4FXDA 1UEBA 1R9TH 5HY6A 1EWIA 1DYQA 3T13A 3KDFA 1UE5A 4K5XA 1HFGA 3Q23A 1FNWA 4DK1A 3J80L 1Y1WH 2K1BA 5I9OA 1WTOA 2PYKA 3PCOB 2ZXRA 5E4WC 3G7LA 3ULPA 4F88A 2IX1A 1TR5A 1L1OB 1C7YA 2CH4A 3CD6A 3J7AF 3UDXA 4HTHA 4A3MB 3PUYA 2ZJPA 1AW7A 4X66Q 2F0KA 3PF5A 1F9RA 3K7AH 2CQAA 4IFDJ 1ESRA 2UXBL 2XSCA 1FL0A 2IX0A 1I4RA 1TS2A 4ODGA 5EQ0A 1DOKA 3CCSA 5LMNW 1RCVD 4R1JA 3T53B 4IUNA 4JK1C 4FF1A 4DR7L 1SYFA 1EY0A 4QL5A 4IFDI 3PV0A 3RN5A 1SE3A 1JOOA 1DONA 4GN5A 4JI8L 1STAA 4YWLA 4O1NA 3M3YH 3TZUA 3KJOA 2ATWA 1VQCA 2F0UA 3EJIA 2KHIA 4GKJL 2RBMA 4JPBW 4ZRZA 3MVVA 3NQIA 4A93H 4B3MQ 3NPPA 3J7A5 3JC66 2K50A 3URYA 3N52A 1HHVA 4GOPB 1BBXC 4BA2I 1TU2B 2UXCQ 3MXPA 5IP9G 4C56C 3D8GA 3GO5A 1YHQA 1SROA 2F1MA 3GTMH 3TMEA 1I50B 4BBSG 4WJWA 3J81j 1XNRQ 3M4OH 5CMDA 4JOIC 1NMGA 4J8QA 2WKDA 2E2JH 1X65A 2KVMA 2NN6I 4A4IA 4A3EG 1PZID 4B9XA 4XXEA 4BXXH 2LFNA 3RMHA 1H9JA 2XIWA 1XYIA 3CC4A 2WB1G 4AH6A 4A3GB 3H09A 5K36G 5C3XA 4IOCA 3G4SA 4OONA 1E24A 3HP3A 5IGCA 1XTCD 3PIP3 1ENAA 2NVYB 5D65A 4DR1Q 3ND9A 1SLJA 4JI4Q 2G9DA 3OIQA 4GNXB 1RL2A 5C6AA 3RZDB 4GLXA 3SEBA 1EWCA 3CCQA 1KRTA 2ES2A 3HOXG 3S1MB 1B50A 2K52A 2K5HA 3EN2A 1S5CD 3A8JE 4IUPA 3RD4A 2AKWB 4IOAA 4X64L 2JP1A 2EIFA 1OXTA 5IYBH 4R4QA 2K5WA 2KHSA 1P16A 3I2ZA 3HOZG 4BBRB 3IFDA 3CMEA 1VQPA 2UXDL 2JXMB 1N33L 4B3SQ 2XGTA 4H44C 1A2TA 3OSOA 2D5DA 3BDOA 2K05A 4LF8Q 4H7BA 4MTNA 3GTJH 1XNQL 2PZTA 5J22A 3D4RA 4L5RC 3NHHA 1NR2A 3I70A 1C4QA 1YNXA 4A76A 2FXQA 4A3IB 1W6JA 3Q24A 4LFBL 1LTLA 4QY7A 2HQEA 2G5DA 3ERSX 2UUBQ 3P20A 3J81L 3J7YW 3TP6A 3SVMA 2F0GA 3CCLA 2Z4HA 2F0IA 2AQ2B 3E0EA 3J7ZC 3S1QB 3HKZG 1NBWA 1Y14B 1X3EA 4RGOS 1EOTA 4HSVA 2PNHA 2A69D 5FLXE 5M9OA 1AFPA 2B63B 2HHHQ 2F0TA 5KNCA 1BCPF 1BOSA 2A69C 2K04A 2FHTA 5GAGC 5IE8A 4JI3L 3HOVB 4X62Q 2F0PA 1O78A 3W2DA 3K5MA 4CDEC 1SYEA 1TXYA 1STGA 2R7DA 4OXPA 3BZKA 1ENCA 5K5PA 2NTSA 2B2YA 3UDGA 1WYDA 1WI5A 2SEBD 2E2IB 4YCUA 1R4PB 2MQHA 3FHWA 2LKVA 2HCCA 4X6AH 4ZCKA 4DR6L 2VUMB 3S1RB 3NEMA 5IYDG 1N32L 3A74A 4CKEA 3J7AV 2BCOA 4HJ7A 3ND8A 1Q86C 4P73A 2RHSB 5JAVA 2EJGC 1EYCA 1X3FA 1RKNA 2YTXA 4DUZL 1AE3A 1BUVT 2QEXA 5C3EB 4B3RL 2R92G 2UUCL 5CR3A 3KLRA 2L9HA 3MXNB 4KI0A 1Q1BA 5IODA 4ZKBB 1G2SA 1K8AC 3K6OA 4DR3Q 1VQ5A 1C9OA 3ULLA 1T9HA 3BS1A 3FKIB 4MTKA 5F2DA 1LTBD 4JI7Q 3GTLH 1SYBA 3S14B 1JE5A 4EQ5A 4DR2Q 1CA6A 1ICFB 3D6CA 4G7HC 1DXMA 3HS0C 2EQSA 1X56A 2NWGA 2XTIA 4A3MG 1KNAA 2NVXH 1YVCA 1TWFH 5BR8Q 1VQJA 2Q2UA 3HOUH 2VY3A 3K57A 2B2WC 3PMFA 1H9SB 3WWVA 3NWSA 1Q7YC 3BJUA 2I46A 3RUZA 1A2UA 2PPBC 5TSSA 1GVPA 3CF5A 1KQSA 4BY1B 1B9MA 3I4MB 3E9HA 2K32A 5C44B 5ELDA 2I5HA 3S2DB 1S5ED 3J80i 3Q8DA 2VQEL 1U4PA 2AQ1B 2RDFA 3CP0A 4ILWA 4JW0A 5M5WH 1NTGA 3FPUB 1L0WA 1A62A 1MD2D 3RN2A 3U4VA 3S17H 3OHXC 2EY2A 2ENBA 2B2UC 5JJZA 1VQBA 4IUTA 2OF1A 1RDPD 1STNA 2HDMA 2SDFA 3F1ZA 3H6MA 2R7ZH 3FPPA 2K33A 2EPBA 2VXWA 4P71A 3SHLA 4C3HB 1HTPA 4RHRA 3NTIA 4A3KB 1ZXTA 1HNXQ 1K73C 2UUAL 5FJ8G 3VDYA 1NAPA 4RFBA 1V8QA 1F2LA 5GQOA 3V05A 3OTOQ 3UE1A 3S16B 2F0LA 1PH6A 1Q1EA 3VA5A 2F03A 1SNMA 2XVSA 3GDEA 3TREA 4U68A 1NJIC 1B70B 1HPCA 4AYBG 1HA6A 4A3JH 4IFDG 4K0KL 2B39A 4RAUC 3BU2A 1PFSA 3H0GG 4JI8Q 3A7AB 1KABA 1PFBA 1K0RA 3ULJA 2L12A 4QB4A 2AMCB 3R2TA 4YWMA 1PH2A 1Z9FA 1FYCA 1KRSA 1CK1A 4OO1I 1EIYB
chains in the Genus database with same CATH topology
2O4XA 2O5JC 5C3WA 1SNCA 4K14A 1LT5D 2H4OA 3V96A 5FLXL 1MI2A 1V1PA 3D4WA 4XDXA 3GTGB 2IL8A 4PMCA 1A15A 1F9QA 2RA4A 3C2PA 2NN6G 4U673 1JC7A 5KEEA 2MP1A 4B08A 3KF8A 1DD2A 2CVRA 4ZQ3A 1SYDA 3NWTA 1H9RA 3I72A 2B2TC 2E2DC 3SK5A 4FF4A 4I7ZC 1RTNA 1ONLA 3GV6A 4F8MA 3VR6A 2OEOA 5CV4A 1IL8A 2IT1A 5ELEA 4C1NI 1Z6HA 4K8JA 1CHQD 4WFN3 4C3JG 4IUUA 4MN3A 5D3IB 4HMJA 1KDCA 4HN7A 1OO9B 4BA1I 1PFNA 4MHEA 3D6WA 1HTLD 5FO8B 3N6RA 4KJOA 2Z8LA 4BBSB 5FO9B 3Q22A 2ICEC 4H13C 3TN2A 1ILQA 3TSSA 1PFMA 2M2LA 2X69A 2O2LD 1PLFA 3GP7A 2WP8J 4A3EB 3VR2A 2F0EA 4DXFA 2Z1CA 1SDFA 5ELFA 4OGQC 1EEID 2MPMA 4KTAA 2WV6D 4RGNA 1SJED 1I6HB 4J6HA 5I6YA 1TWHB 1B9NA 1NSNS 4GZYC 1GUTA 1CHPD 2PCFB 3OWEB 4FYDA 1I4XA 2F0OA 3PO3B 4RGTA 4XQQA 4N9PA 5KIXA 5HURA 3HOXB 3K5NA 1EY4A 1PTOB 4TKOB 4ZAIA 4UDUC 1RODA 5CV8A 5IT9L 1T5EA 1IHZA 4HMIA 3HOZB 2I07B 2N88A 3HOYB 1KLUD 2BOSA 5IOCA 2A6ED 5DEHA 2BDOA 2SOBA 2A6EC 1TIID 3A8KE 1STEA 3C1EA 4K2LA 3Q6SA 4NMZA 3NK9A 4KN7C 3HKZB 2KCNA 4P2CB 4NDXA 5CORA 2O5IC 5E4XA 2J0TD 4CGYB 4DFAA 1IKLA 3A7LA 4TQUS 1Z7TA 3MA2B 3CRLC 1TWCB 3MC0B 2MHVA 1I4GA 1X32A 3DEOA 2A68D 3UI2A 1V1OA 2A68C 4G7ZC 1Y1WB 1LABA 2JEBI 5T1IA 2CW0D 2R92B 3E5SA 2CW0C 3Q0AA 2R3ZA 2VB3X 2PMZB 3IL8A 3KBGA 1MBYA 1E2WA 2Q8RE 4K8IA 5IIFA 3GD7A 3VA7A 4KY7A 3QO2A 4KJNA 3QB3A 1IW7D 5J1ZA 1F2ZA 3S15B 1BR9A 1IW7C 4A93B 4DN4M 4QUCA 2L0CA 4WORA 1QG7A 3KLSX 1WTWA 2L55A 3A56A 3GTMB 1RHPA 1XX8A 3MXNA 2B2YC 1I3QB 3M4OB 4FF3A 2XWJB 5KYIA 4OO1G 1CM9A 3TDQA 4LJZC 1SE2A 4ZLTF 2BA0A 1SYCA 2RDHA 1SMYD 2NVQB 1U4LA 5JVH3 4PMBA 1SMYC 2SNMA 1HCZA 1LACA 3GQBA 3ZYYX 5D3DA 3EROA 5C4HA 4I65A 4QUFA 1ENFA 1CI3M 4XYQA 3MFGA 1GOZA 1EL0A 3P7JA 4AYBB 1PMRA 2A6HD 3QOJA 1D1IA 3H0GB 5JEAH 3QWNA 1EY8A 2A6HC 4K5WA 2AUKA 2F0FA 4NP5A 2QCPX 1E0BA 4FF2A 5LHY1 4RH6A 5C4JB 1VF5C 1B53A 4ZYSA 5LL6S 4IALA 2LMCB 1AN8A 2J7ZA 2LS01 3H3VC 5I9PA 1NCVA 2D9UA 3I4LA 2AWOA 1CZGA 1O7LA 4XYOA 5EGTA 4FVMA 5KGUA 2NVTB 2PW5A 1F2MA 5KNBA 3TP5A 1U4RA 4C2MB 1E2VA 2JA8B 2KEDA 5EPLA 1A3UA 1D1KA 2D62A 3LNNA 3HEJA 4C3JB 3GV3A 1AZQA 1EIGA 1ESFA 2KJXA 2ZXPA 1EQTA 2OT2A 1B44D 3T51B 1Z47A 4L6TB 5C4ZA 3BDCA 1EYDA 2K01A 1HUMA 4ZK9B 5I6WA 2RQXA 3SK4A 1TWGB 5COYA 1Y8OB 2F0QA 3GTLB 1QOHA 3LWUA 2BA1A 3HG9A 2E75C 3D4DA 2RVLA 2BDNA 1G6ZA 2JE6I 1CQVA 3C3LA 2NVXB 3DWAA 1TT2A 5CYUA 3HGBA 1L0XB 2N55A 3BDLA 4DU9A 1KDBA 2A74C 1V43A 2QF7A 2D2CC 1B1ZA 2EY5A 1PRTD 2IX3A 4IUQA 3WOEA 1PRTC 4DAVA 3S17B 1LTAD 2K28A 2K6AA 2EVBA 5M3MB 1STHA 1GUSA 3SK8A 3IKJA 1HQMC 1D5MC 5KYLA 1J9OA 2K03A 3OMGA 5HGTA 4HCSA 1FNVA 2RSOA 3MAQA 1JE4A 1U4MA 2NTTA 3O13A 2DN8A 3PO2B 3H91A 3R2IA 1EY6A 4K6DA 4DGZA 1KNEA 2ZT9C 1JB3A 5CV7A 1M4VA 4F7XA 4Q5VA 4CBVA 4KY6A 1QNUA 1VMPA 2PNRC 5EBCA 3AMUA 4K2KA 2EY1A 1GUNA 5C0XH 1QB5D 1BF4A 4V190 1HFNA 1TWAB 1RJTA 2ZXOA 2KEEA 4M8AA 4TSSA 1E2ZA 5G3LD 1M8AA 1PYWD 3RLFA 1IYVA 2E74C 1EZ6A 3NE5B 5BN4A 1BCPB 1FGBD 1JOKA 4A3BB 1EU4A 1LTID 3TBIB 5BN3A 5CGKA 5M5YB 2DNEA 3NTHA 1XXGA 2EOTA 3M7NA 1STYA 3PUWA 3HRZC 4RGMA 1PDQA 3QIAA 4WRDA 3MEHA 1KDAA 1C48A 2FMCA 5EPKA 2PQEA 3R93A 4ZKCB 1Q8IA 4KV6A 4RCOA 4H0LC 4KKSA 1EYAA 2H1EA 2EYOA 4PMWA 4FO2A 3D3RA 4ME5A 1Y8PB 2NB0A 3CKIB 1ZYRD 2RDGA 2EZVA 2JA6B 4QIWB 3BYYB 1QE6A 3E6ZX 4V0BA 1ZYRC 1K8OA 3VR4A 3EVQA 1JOQA 1JQYD 2YYZA 4A3DB 3M7GA 1HA5A 3MFYA 4EVOA 1UUPA 3MXGA 1NR4A 3L3OC 4KKTA 4BWGB 4KN4C 3BVGA 3FRPB 1GUGA 1QJOA 5CBAE 3IAYA 4IZ8A 5FO7B 5E3FA 1SNPA 1PXUA 1VDZA 2SNSA 1X3PA 1OXXK 1RTOA 1SNDA 5LL6X 2EYFA 1RD9D 2WINB 2XRSD 1EQVA 2NYZD 5CV6A 3X3NA 1QWYA 1CZWA 3V2TA 4DK0A 5I2XA 3BVMA 1EFID 1H9KA 1NUCA 4DXGA 3SDZA 2YU9B 4ABNA 3NBIA 3OPOA 1MGSA 2PW7A 2A73B 2FJ2A 5CV5A 4EQNA 4G4KA 2F0NA 3C1FA 2DY8A 3PUZA 3T16A 3I4NB 1LTRD 5J39A 1PRTF 5D14A 1LV9A 1A6XA 2R61A 5M3FB 2EYHA 1JWMD 3NXWA 1WTVA 1DJRD 4X3UA 1ET9A 2R6GA 3HOWB 2L4NA 2K5QA 5CBEE 5EKIA 4B9WA 2F4IA 3GTOB 1I4HA 3VR3A 5ELBA 3OOCA 3S2HB 4KK7A 4KHZA 1LLRD 4G7OC 3L7ZC 3AU7A 1WVLA 3I90A 3GTPB 5K36H 3DWPA 3DHQA 1GXDC 3M85A 1KLGD 4CJ0B 2WACA 4IUVA 1EY5A 4X3TA 3T4AC 1IYUA 1C8CA 4HR7B 3A8IE 1PTOH 1WTQA 1TVXA 1FNUA 1UNSA 4XQNA 1O80A 5G3LF 3LX0A 4RKLA 2BE5D 2WAQB 4EGVA 2XNAC 2DNCA 2BE5C 4XT3B 3L9AX 4KD3A 2B8GA 2IWHA 2M00A 3NUCA 1SNQA 3KUPA 3S9WA 1R9TB 5I4DA 4IQZA 2KCCA 5IGDA 3KBXA 1OXSC 4HEDA 3ONAB 2PO4A 5EBDA 5NUCA 1V1PB 5JPMC 2F0DA 3K7AB 5ELCA 1XWEA 3DXJC 1VCIA 3M4YA 4CKBA 5AFWA 3P75A 3PIO3 1TS5A 3S1NB 5JEAJ 2B8FA 1JICA 2CHBD 5C5LA 5DM63 4RA8A 3SXHA 2MUYA 2PZUA 4X3SA 5DNFA 3MZ5A 4Y7NB 3M3YB 3BVZA 4XIGS 4EQPA 4Z9CB 3G6JB 5KNDA 4CJ1B 3F2UA 3I3CA 1SJHD 2M9VA 1O7YA 4OHJA 5EPJA 3DWQA 1LT3D 2JSOA 1F77A 3U9SA 3QOLA 2LY7A 4DNTB 4MIUA 1DM0B 2F3WA 3SE0A 2E2JB 4FP5D 1LTTD 2F0MA 3VR5A 3FVQA 4OL7A 4BS9A 4IURA 4CHTB 4X3KA 2X6LA 1HXYD 1G91A 5KRUA 3I73A 1QCBD 1H9SA 1S5DD 1SEBD 1Y8NB 1LT6D 1TQOA 4RHSA 3A54A 2VNUD 2Z4IA 2XRQD 3NQTA 2EYLA 1BDOA 3X3MA 4G57A 2B2VA 4R8IA 4M1UB 4UAIA 1EIHA 2FINB 1DCZA 4F87A 5A2QE 4ID6A 2F0SA 5ISRA 1SE4A 2FFKB 2ICIA 1GUWA 3GTJB 1CQFA 1Y69U 2KECA 2L1BA 5IGFA 5DAUA 4N9TA 5JVG3 2RSNA 1AP0A 3DMUA 5FOBB 3TP8A 1W6KA 4JBWA 1EZ8A 3LWEA 1PTOD 1WD1A 3MWYW 4KY5A 1PTOC 2HUGA 2G9HD 1I4QA 4IFDH 3CU7A 1X3QA 4LMQD 1CTMA 4C3IG 3T56B 2XWBB 2HDLA 4FNFA 3KK7A 3NBHA 3TP7A 5EJWA 2C5CA 4ZUJA 2JYOA 1LTGD 3W3AA 2QEJC 2Q8IB 4C1NK 1WTPA 4PQXA 1HQRD 1DOMA 2NN6H 1PZKD 2KUMA 1YNND 1SXTA 3K5LA 3PUVA 1WCMB 3OW7A 4QF4A 1YNNC 1RF2D 1ZKOA 3SK6A 3NTKA 1JR0D 1DOLA 5C0XJ 2K7VA 4NKLA 3AB9A 4ULLA 3MTSA 2F3VA 2X6GA 3ITPA 1TWFB 2FMMA 2HCIA 5JOBA 3HOUB 5C0XI 2Y0SB 1GUOA 5M5XB 1CA5A 2XN9C 3DEPA 3U9OA 2V4DA 5JPNC 1G2TA 4CJ2C 1AEXA 5M5WB 1BQQT 5CC4A 3K0YA 2A5HA 1I6VC 1WTXA 4HAEA 4KKUA 2R7ZB 1D5XC 1UEAB 3EQLC 2L5TA 4OIKA 4OIJA 4DNRB 2TSSA 5C5MA 3K5OA 2JEAI 5IGEA 3BYTB 4K5VA 3CRKC 5CV9A 2MGSA 2F0VA 1GJXA 1K83B 3VYSA 4DAPA 1SNOA 2RKSA 4KHVA 4RWSC 2WIIB 5A2QL 2K5DA 2VB2X 1LO5D 4A3JB 1MSHA 1BXTA 4KD4A 3SR1A 5JEAG 1GHJA 4A3FB 1CT1D 3NP8A 1HUNA 3JAME 1OXVA 2GA4B 1AZPA 4R9WA 2AUJD 1ILPA 5IT9E 2NBFA 5IGBA 1EWHA 3KLSA 2KQ3A 2IPKD 1VMCA 3D31A 1QNKA 3QG1A 4DAYA 2EY6A 2EYPA 5A35A 1ET6A 3IFTA 1PTOF 1VF7A 2JA7B 3PUXA 1SFOB 1I4PA 3FEWX 4PNYA 3C46A 1Q90A 1Y1VB 5EKKA 1B4OA 1EY7A 2E2HB 1R4QB 2DY7A 5DM73 1G291 4KMUC 3VYRA 5FKAC 2R93B 1U9RA 1STBA 1F9SA 4ZUIA 3GTQB 3R3OA 3WOFA 3E0JA 2EE1A 1EU3A 5BN5A 4S3SA 3K59A 1T5XD 3QJYA 2NUCA 1CFMA 1S5BD 3R8BA 1UAPA 5FK9C 4NW2A 3OWFA 5EKLA 2PZWA 3EFXD 5E1FA 2QDBA 1SAPA 3FMCA 4CKCA 3J80E 1ICWA 1S5FD 4R8NA 2B2WA 1EEFD 2QKIC 1LT4D 2J4XA 1JWSD 1HRJA 2EYMA 1PZJD 4XT1B 4HSPA 4IN3A 1F2YA 3DUZA 1O7ZA 2WKCA 3K58A 3CQZB 4OO1H 3VYUA 4QCLA 5IGGA 2E76C 2B2UA 1SYGA 1G8ZD 2WB1B 3MXUA 1H9MA 1II3A 1TKWB 1D2BA 1S4ZA 3CHBD 3I91A 1FD7D 1A3TA 2TMPA 1QILA 4K6LA 1ML0D 5I2YA 2QILA 2KOLA 1JORA 1D6EC 2MJ8A 2ID0A 1TS3A 3VYTA 3JAML 1Q12A 4RKBA 2AQ3B 4C3IB 4PV1C 3H94A 2IJ0A 1BO0A 3DM1A 1F9PA 1TY0A 4L8JA 1B2TA 1B3AA 3RZOB 1KAAA 1OXUA 4E6IA 4TRDA 2F0HA 2OXPA 4J1MA 2L11A 5C0XG 1J8IA 3P1HA 3EA6A 1SSOA 1DZ1A 1BNZA 4O42A 1WD0A 1LTSD 2EXZA 5C4XB 3MHBA 4BY7B 2B2VC 2IW3A 3TZDA 1GHKA 1JWUD 2AWNA 4DF7A 4FXGC 1K8MA 1WTRA 1SBBB 1MSGA 5T1GA 2EJMA 1TY2A 1EY9A 4LK1C 2F0WA 4C3HG 2EJFC 3GTKB 3OIPA 1IKMA 3I8ZA 4DA2A 1TS4A 1FR3A 1A3VA 2B2TA 3OMCA 4L63B 4RCNA 1L0YB 1BCPD 4LAAA 3A55A 4FXKC 1Q3LA 4XQJA 3BG3A 1JCKB 2F0JA 2EDGA 1BCPC 1KTKA 3HZXA 4EQOA 2JA5B 4QMGA 3J81E 4Q0FA 4XTCS 1D5ZC 4YIJA 3WDNA 2EYJA 3BZDB 4HCEA 2KA7A 1YNJD 3ERQA 3NSWA 2Q8TA 1ZEQX 1YNJC 2C9OA 3FDTA 1PRTB 2NZ1D 4FXDA 1DYQA 3T13A 4K5XA 1HFGA 3Q23A 1FNWA 4DK1A 3J80L 2K1BA 5I9OA 1WTOA 2PYKA 2ZXRA 5E4WC 3G7LA 4F88A 2IX1A 1TR5A 3J7AF 4HTHA 4A3MB 3PUYA 1AW7A 2F0KA 1F9RA 2CQAA 4IFDJ 1ESRA 2XSCA 2IX0A 1I4RA 1TS2A 4ODGA 5EQ0A 1DOKA 1RCVD 3T53B 4IUNA 4JK1C 4FF1A 1SYFA 1EY0A 4IFDI 3PV0A 1SE3A 1JOOA 1DONA 1STAA 4O1NA 3TZUA 2F0UA 3EJIA 2RBMA 4ZRZA 3MVVA 3NQIA 3NPPA 3URYA 3N52A 1HHVA 1BBXC 4BA2I 1TU2B 3MXPA 4C56C 3D8GA 3GO5A 2F1MA 3TMEA 1I50B 4WJWA 5CMDA 4J8QA 2WKDA 2KVMA 2NN6I 1PZID 4B9XA 4XXEA 2LFNA 3RMHA 1H9JA 2XIWA 1XYIA 4A3GB 3H09A 5K36G 5C3XA 3HP3A 5IGCA 1XTCD 3PIP3 1ENAA 2NVYB 5D65A 3ND9A 2G9DA 3OIQA 5C6AA 3RZDB 3SEBA 1EWCA 3S1MB 1B50A 1S5CD 3A8JE 4IUPA 3RD4A 2JP1A 1OXTA 2K5WA 2KHSA 4BBRB 3IFDA 2JXMB 4H44C 1A2TA 3OSOA 2D5DA 3BDOA 2K05A 4H7BA 2PZTA 5J22A 3D4RA 3NHHA 1NR2A 3I70A 1C4QA 4A3IB 1W6JA 3Q24A 2HQEA 3P20A 3J81L 3J7YW 3TP6A 3SVMA 2F0GA 2Z4HA 2F0IA 2AQ2B 3S1QB 4RGOS 1EOTA 4HSVA 2A69D 5FLXE 5M9OA 1AFPA 2B63B 2F0TA 5KNCA 1BCPF 1BOSA 2A69C 2K04A 2FHTA 3HOVB 2F0PA 1O78A 3W2DA 3K5MA 1SYEA 1STGA 1ENCA 5K5PA 2NTSA 2B2YA 2SEBD 2E2IB 1R4PB 2LKVA 2HCCA 2VUMB 3S1RB 4CKEA 3J7AV 2BCOA 3ND8A 5JAVA 2EJGC 1EYCA 1RKNA 1BUVT 5C3EB 5CR3A 3KLRA 2L9HA 4KI0A 1Q1BA 5IODA 4ZKBB 1G2SA 3K6OA 3BS1A 3FKIB 5F2DA 1LTBD 1SYBA 3S14B 1CA6A 3D6CA 4G7HC 1DXMA 3HS0C 2NWGA 1KNAA 3K57A 2B2WC 3PMFA 1H9SB 3NWSA 2I46A 3RUZA 1A2UA 2PPBC 5TSSA 4BY1B 1B9MA 3I4MB 2K32A 5C44B 5ELDA 3S2DB 1S5ED 1U4PA 2AQ1B 2RDFA 4ILWA 3FPUB 1MD2D 3OHXC 2EY2A 2ENBA 2B2UC 5JJZA 4IUTA 2OF1A 1RDPD 1STNA 2HDMA 2SDFA 3H6MA 3FPPA 2K33A 2EPBA 2VXWA 3SHLA 4C3HB 1HTPA 4RHRA 3NTIA 4A3KB 1ZXTA 1NAPA 4RFBA 1V8QA 1F2LA 3V05A 3S16B 2F0LA 1Q1EA 3VA5A 2F03A 1SNMA 2XVSA 4U68A 1HPCA 1HA6A 4IFDG 2B39A 4RAUC 1KABA 1PFBA 3A7AB 2L12A 4QB4A 3R2TA 1FYCA 1CK1A 4OO1I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E2Z A;  2DNC A;  3PUY A;  1Y8O B;  3QJY A;  2BE5 C;  5JEA H;  1CFM A;  2CW0 C;  3RLF A;  2E74 C;  3LWU A;  2O5J C;  2BA1 A;  2Q8I B;  1IYV A;  2B8G A;  3A8J E;  2A6H C;  3NE5 B;  5BN4 A;  2AUK A;  3SDZ A;  2E75 C;  5C0X G;  3I73 A;  1H9S A;  4G7H C;  1DXM A;  1Y8N B;  1OXT A;  5BN3 A;  2NN6 H;  2DNE A;  1E2W A;  2JE6 I;  3OPO A;  5JEA G;  2JXM B;  4TKO B;  3PUV A;  3M7N A;  1GHJ A;  4H44 C;  3PUW A;  4IQZ A;  2D5D A;  1VF5 C;  3BDO A;  3OW7 A;  1YNN C;  2KCC A;  3QIA A;  1OXS C;  3T53 B;  4JK1 C;  1ZKO A;  3D4R A;  1GHK A;  1H9S B;  1OXV A;  3GD7 A;  1T5E A;  3FMC A;  3HGB A;  2NN6 G;  3VA7 A;  3PV0 A;  3PUZ A;  2AUJ D;  2PPB C;  1BDO A;  1B9M A;  1V43 A;  2LMC B;  2QF7 A;  2K7V A;  3P20 A;  3DXJ C;  2D2C C;  1VCI A;  1IW7 D;  1DCZ A;  3M4Y A;  2K32 A;  1A6X A;  3TZU A;  1K8M A;  1EWH A;  1DD2 A;  4H0L C;  4KKS A;  3AB9 A;  2B8F A;  1IW7 C;  2A6E D;  2EJM A;  3I4L A;  2AWO A;  1H9R A;  4LK1 C;  2BDO A;  2R6G A;  1O7L A;  3I72 A;  3D31 A;  2A6E C;  2A69 D;  2EJF C;  4I7Z C;  2EVB A;  1Y8P B;  3QG1 A;  4BA2 I;  1TU2 B;  3A8K E;  1ONL A;  5KNC A;  1GUS A;  3VR6 A;  5A35 A;  3IKJ A;  2A69 C;  1Y69 U;  4OO1 H;  3IFT A;  1FR3 A;  1HQM C;  2F1M A;  1GUO A;  1ZYR C;  4KN7 C;  3FPP A;  2E76 C;  2IT1 A;  2K33 A;  4RCN A;  1VF7 A;  1Z6H A;  3VR3 A;  5KNB A;  3OOC A;  1K8O A;  3VR4 A;  1O78 A;  3PUX A;  1E2V A;  1HTP A;  3BG3 A;  4JBW A;  3MXU A;  1H9M A;  2EDG A;  4XIG S;  4KHZ A;  4OO1 G;  1TKW B;  4LJZ C;  2O5I C;  4G7O C;  2V4D A;  2YYZ A;  1Q90 A;  4BA1 I;  3L7Z C;  2D62 A;  3LNN A;  5KND A;  2NN6 I;  3N6R A;  2BA0 A;  3MFY A;  4XTC S;  1V8Q A;  3A7L A;  1I6V C;  4TQU S;  5K36 H;  1H9J A;  3M85 A;  4H13 C;  4KKU A;  2DN8 A;  4IFD H;  4KKT A;  4KN4 C;  1SMY C;  1Z7T A;  3WDN A;  1GUG A;  1CTM A;  1QJO A;  3CRL C;  1HCZ A;  3T51 B;  3T56 B;  1LAC A;  1Q1E A;  1G29 1;  2KA7 A;  3EQL C;  3GQB A;  4KMU C;  3VR2 A;  2L5T A;  3ND8 A;  5K36 G;  2ZT9 C;  3U9S A;  1HPC A;  1VDZ A;  2EJG C;  1OXX K;  2A68 D;  4DNT B;  4DNR B;  4IFD G;  1IYU A;  2JEA I;  1YNJ C;  4OGQ C;  3SE0 A;  4HR7 B;  3CRK C;  3ND9 A;  2A68 C;  1Q12 A;  3A8I E;  1GJX A;  1CI3 M;  3A7A B;  4PV1 C;  3H94 A;  2PNR C;  3KLR A;  4G7Z C;  4KI0 A;  1Q1B A;  3VR5 A;  4L8J A;  1LAB A;  2JEB I;  4DK1 A;  4DK0 A;  5BN5 A;  1GUN A;  5C0X H;  1PMR A;  1B9N A;  2BE5 D;  4GZY C;  1GUT A;  1FYC A;  1H9K A;  1OXU A;  3W3A A;  2A6H D;  2PCF B; 
#chains in the Genus database with same CATH topology
 2O4X A;  1LUZ A;  2O5J C;  1J6Q A;  4LF9 Q;  1VQG A;  2E8G A;  5C3W A;  1SNC A;  3EBE A;  1LT5 D;  2H4O A;  4K14 A;  5DLQ E;  3V96 A;  1MI2 A;  5FLX L;  2OCE A;  2OTL A;  1V1P A;  3D4W A;  4XDX A;  5M5Y H;  2Z6K C;  2KHJ A;  4LUV A;  3GTG B;  2IL8 A;  4PMC A;  1A15 A;  1F9Q A;  4GN3 B;  3U50 C;  2RA4 A;  3C2P A;  4OX9 L;  2NN6 G;  4JV5 Q;  4U67 3;  1JC7 A;  4JG2 A;  1YHA A;  5KEE A;  2MP1 A;  4B08 A;  3IRB A;  3KF8 A;  1SFO H;  1DD2 A;  2CVR A;  2HQL A;  4ZQ3 A;  1SYD A;  3NWT A;  1H9R A;  2OWO A;  1Y1V H;  3I72 A;  2B2T C;  2E2D C;  3SK5 A;  4FF4 A;  4I7Z C;  2JA8 G;  1RTN A;  1ONL A;  3GV6 A;  4F8M A;  3DLL A;  3VR6 A;  2E2H H;  2C35 B;  4JI0 Q;  2OEO A;  5CV4 A;  1IL8 A;  2IT1 A;  5ELE A;  4C1N I;  1Z6H A;  4K8J A;  1CHQ D;  4WFN 3;  1M90 C;  4C3J G;  1N34 L;  4IUU A;  4MN3 A;  2R93 H;  3A5Z B;  5D3I B;  4JI1 L;  2E5L L;  4QQB X;  4HMJ A;  1L1O A;  1KDC A;  4HN7 A;  1OO9 B;  4BA1 I;  1WFQ A;  1PFN A;  4MHE A;  4A3D H;  3D6W A;  1HTL D;  5FO8 B;  3N6R A;  3RLO A;  3HOV G;  4KJO A;  1E3P A;  2Z8L A;  4BBS B;  3TEH B;  5FO9 B;  3Q22 A;  4JYA Q;  2ICE C;  2VQF Q;  4H13 C;  1EQQ A;  3TN2 A;  1ILQ A;  3TSS A;  1PFM A;  2M2L A;  2X69 A;  2O2L D;  2UU9 Q;  1PLF A;  3GP7 A;  2WP8 J;  4A3E B;  4GLA C;  3VR2 A;  5IYC H;  2F0E A;  4DXF A;  2QW7 A;  4DR5 Q;  2Z1C A;  1SDF A;  5ELF A;  4OGQ C;  1EEI D;  2CCZ A;  5GAH C;  2MPM A;  1FJG Q;  4KTA A;  1EUJ A;  2WV6 D;  4RGN A;  1SJE D;  2RHQ B;  3M4Q A;  4J6H A;  1PH7 A;  1MJC A;  1I6H B;  5I6Y A;  1TWH B;  1VQD A;  5C3E G;  1B9N A;  1NSN S;  4GZY C;  1GUT A;  1CHP D;  2PCF B;  1CSQ A;  3OWE B;  4FYD A;  1I4X A;  4GOP A;  2F0O A;  4LFA L;  3PO3 B;  2D0P A;  4RGT A;  4XQQ A;  4UP9 A;  3KFU A;  1HZC A;  4R4C A;  4N9P A;  5KIX A;  5HUR A;  3HOX B;  1K28 A;  1G51 A;  3K5N A;  1PV4 A;  2N3S A;  1EY4 A;  1PTO B;  4LF6 Q;  4TKO B;  4ZAI A;  2GN5 A;  4UDU C;  3PIP A;  1ROD A;  5CV8 A;  2ZJQ A;  3CQZ H;  5IT9 L;  1T5E A;  1IHZ A;  4CDF C;  3W1B A;  4DK3 C;  4LFC L;  4HMI A;  3HOZ B;  2I07 B;  1SR3 A;  1UE6 A;  5M3M G;  2N49 A;  2N88 A;  3HOY B;  1DGS A;  4DR4 Q;  1KLU D;  2BOS A;  5IOC A;  2A6E D;  5DEH A;  2NZO A;  2BDO A;  2SOB A;  4BY1 G;  5FLM G;  5GAD C;  2A6E C;  3I4M G;  4HJA A;  1TII D;  3A8K E;  1STE A;  3CXC A;  3C1E A;  4K2L A;  3Q6S A;  4LW1 A;  4DV6 Q;  4GNX A;  2ZJR A;  4NMZ A;  3NK9 A;  4KN7 C;  3HKZ B;  2KCN A;  2OTJ A;  2VL6 A;  4P2C B;  4DV0 L;  3S2H H;  1Q81 C;  4NDX A;  3H3V H;  3PO2 G;  4N8F A;  5COR A;  1X3G A;  2O5I C;  4A3L G;  5E4X A;  2J0T D;  4CGY B;  4C3I H;  4DFA A;  1HNW Q;  1IKL A;  3A7L A;  4TQU S;  1QZG A;  1JB7 A;  4NXN Q;  4A3K G;  3SGI A;  1Z7T A;  3MA2 B;  3CRL C;  4YY3 L;  1EOV A;  1TWC B;  4JI6 Q;  3MC0 B;  1VQ9 A;  2MHV A;  1I4G A;  4O2D A;  1X32 A;  3DEO A;  2A68 D;  3UI2 A;  1V1O A;  1QVC A;  1VS0 A;  2A68 C;  4NXM L;  3L0O A;  1VQK A;  3ICE A;  4G7Z C;  4FDB A;  2RCF A;  1Y1W B;  5C4X H;  4BY7 H;  4A3B G;  4L5Q A;  1LAB A;  2JEB I;  5L37 A;  3TS0 A;  2CWP A;  5T1I A;  2CW0 D;  2R92 B;  1EQR A;  3E5S A;  2CW0 C;  3Q0A A;  2R3Z A;  2VB3 X;  3CPW A;  2PMZ B;  3IL8 A;  3HFZ B;  3KBG A;  4HJ5 A;  1GM5 A;  2P5Z X;  4A3C H;  1MBY A;  1E2W A;  2ZM6 Q;  3ER0 A;  2Q8R E;  3GTK H;  4K8I A;  5IIF A;  4LWC A;  2YV5 A;  3GD7 A;  1MIU A;  3VA7 A;  4KY7 A;  1HNZ L;  3QO2 A;  2N78 A;  4EX5 A;  4AQY Q;  2F3I A;  3J80 c;  4KJN A;  3QB3 A;  1IW7 D;  2JA6 G;  5J1Z A;  1F2Z A;  3S15 B;  1BR9 A;  3S1N H;  1IW7 C;  4A93 B;  4KHP L;  1CKN B;  1NE3 A;  2JA5 H;  4DN4 M;  4QUC A;  4OWT B;  5AJ3 Q;  2L0C A;  4WOR A;  1NY4 A;  1QG7 A;  3KLS X;  1WTW A;  2L55 A;  3A56 A;  5IY0 A;  3GTM B;  1RHP A;  4GKK L;  1XX8 A;  1Q46 A;  2LSS A;  3MXN A;  2B2Y C;  4B3T L;  1I3Q B;  3M4O B;  4FF3 A;  2XWJ B;  5KYI A;  4GN4 B;  4Y7N H;  4OO1 G;  1CM9 A;  4JI2 Q;  4LJZ C;  3TDQ A;  1SE2 A;  4LF5 L;  4ZLT F;  2BA0 A;  1SYC A;  2RDH A;  1SMY D;  2NVQ B;  1U4L A;  1N36 Q;  1PHJ A;  5IWA L;  5JVH 3;  4PMB A;  1SMY C;  2H5X A;  2SNM A;  1I94 Q;  1HCZ A;  1LAC A;  3GQB A;  4LUZ A;  5D3D A;  3ZYY X;  1PH1 A;  4A75 A;  3ERO A;  5C4H A;  4I65 A;  4QUF A;  4DV3 Q;  1ENF A;  4YHH L;  2A1A A;  1CI3 M;  4XYQ A;  1K3R A;  3MFG A;  1GOZ A;  1YIJ A;  1EL0 A;  4YCV A;  5JJL A;  3P7J A;  4AYB B;  1PMR A;  2GVA A;  4DV7 L;  2A6H D;  3QOJ A;  1D1I A;  3H0G B;  5JEA H;  3I56 A;  3QWN A;  2VW9 A;  1KXL A;  1EY8 A;  2A6H C;  1XPR A;  4K5W A;  2AUK A;  2F0F A;  4NP5 A;  5ELN A;  2WFW A;  1PH9 A;  2QCP X;  1E0B A;  3I4N G;  4FF2 A;  5LHY 1;  2Z0S A;  4RH6 A;  1HZ9 A;  2Q2H A;  5C4J B;  3PO3 G;  1VF5 C;  5M3F G;  1B53 A;  1PYS B;  4ZYS A;  5LL6 S;  3K7U C;  2PQA B;  1I50 H;  4IAL A;  3HOW G;  2LMC B;  1XMQ L;  1AN8 A;  1FGU A;  2JA9 A;  2J7Z A;  2LS0 1;  1LM0 A;  3H3V C;  5I9P A;  1NCV A;  2D9U A;  3I4L A;  2AWO A;  1CZG A;  3NEL A;  1O7L A;  4XYO A;  3HOY G;  2IY5 B;  2ALY B;  3T1Y L;  5EGT A;  4LF4 L;  4FVM A;  5KGU A;  4A3G H;  2YTY A;  2NVT B;  4DV1 Q;  2PW5 A;  1F2M A;  5KNB A;  3JAM i;  3TP5 A;  1PVO A;  1KHI A;  1U4R A;  1NNX A;  4C2M B;  4DPG A;  1E2V A;  2JA8 B;  2KED A;  3K0X A;  3LGJ A;  5EPL A;  1A3U A;  1S3O A;  1D1K A;  2D62 A;  3LNN A;  3KF6 A;  3RZD H;  2K14 A;  2WB1 E;  3HEJ A;  3OW2 A;  4C3J B;  3GV3 A;  2ASB A;  1AZQ A;  1EIG A;  1ESF A;  5LMU L;  2KJX A;  3HKS A;  3S1M H;  2ZXP A;  1EQT A;  2OT2 A;  3CCM A;  1B44 D;  3T51 B;  1Z47 A;  4RG1 A;  4L6T B;  1A8V A;  5C4Z A;  1I5F A;  2AHO B;  2WAQ G;  3NEN A;  1IBL L;  3BDC A;  1EYD A;  4BBR H;  2K01 A;  1CKM A;  1HUM A;  1PYB A;  4ZK9 B;  1NMF A;  1AH9 A;  5I6W A;  2RQX A;  3SK4 A;  1TWG B;  5COY A;  4J15 A;  1Y8O B;  2F0Q A;  4A3I H;  1J5E Q;  3GTL B;  1XJV A;  1QOH A;  3LWU A;  2BA1 A;  3HG9 A;  1Y1W G;  2E75 C;  4X65 L;  3D4D A;  3K8A A;  2RVL A;  2BDN A;  1G6Z A;  3S1Q H;  2JE6 I;  1CQV A;  3C3L A;  2NVX B;  2HIV A;  1WCM H;  4CDC C;  3DWA A;  3A5U A;  2B63 H;  1TT2 A;  3G6E A;  5CYU A;  3HGB A;  1L0X B;  2N55 A;  3BDL A;  3W1G A;  3AFP A;  4DU9 A;  1KDB A;  2A74 C;  1V43 A;  4JBM A;  2QF7 A;  2D2C C;  1B1Z A;  4POG A;  2EY5 A;  4OWX B;  2MNA A;  1PRT D;  4HIK A;  3HKZ E;  2IX3 A;  2ZTD A;  2KCM A;  1XMO Q;  4LF7 L;  4IUQ A;  3WOE A;  1PRT C;  4DAV A;  3CCJ A;  1YIT A;  2E2I H;  3RLN A;  3E3X A;  3S17 B;  1LTA D;  2K28 A;  2K6A A;  2EVB A;  5M3M B;  1STH A;  1MHW C;  2NZH A;  1GUS A;  3SK8 A;  3IKJ A;  1N9W A;  3G71 A;  2VUM H;  1HR0 L;  1HQM C;  3S1R H;  3B6Y A;  1D5M C;  4A93 G;  1L1O C;  5KYL A;  1J9O A;  2K03 A;  5M5X H;  3OMG A;  4DV5 L;  5HGT A;  4HCS A;  2KCT A;  1FNV A;  2RSO A;  1RIP A;  1XPO A;  3MAQ A;  1JE4 A;  1U4M A;  2NTT A;  5HGQ A;  3O13 A;  2DN8 A;  3PO2 B;  3H91 A;  3R2I A;  1EY6 A;  4K6D A;  4DGZ A;  3FKI H;  4BXX G;  1KNE A;  4UPA A;  2ZT9 C;  3A0J A;  3OYY A;  1JB3 A;  4P74 A;  5CV7 A;  1M4V A;  4F7X A;  4Q5V A;  4CBV A;  4KY6 A;  2PMZ E;  4DK6 C;  1QNU A;  4JBJ A;  1VMP A;  1K83 H;  2PNR C;  5EBC A;  1Q8K A;  2UXB Q;  4GOP C;  3AMU A;  3AQQ A;  2EY1 A;  4K2K A;  1GUN A;  5C0X H;  1IBM L;  1JT8 A;  4IO9 A;  1QB5 D;  1BF4 A;  4V19 0;  1HFN A;  1C0A A;  1TWA B;  1RJT A;  2ZXO A;  2KEE A;  4M8A A;  1E1T A;  3STB D;  3T1H L;  1K0S A;  4TSS A;  1E2Z A;  5G3L D;  2IHF A;  1KAW A;  3U58 A;  1M8A A;  1PYW D;  3RLF A;  1IYV A;  2E74 C;  3STB C;  1EZ6 A;  3CAM A;  3NE5 B;  5BN4 A;  4UY8 C;  5C44 H;  1BCP B;  1FGB D;  1JOK A;  4HID A;  4A3B B;  1EU4 A;  1L2F A;  1LTI D;  3TBI B;  5BN3 A;  5CGK A;  4DR7 Q;  4GKK Q;  2DNE A;  3NTH A;  5M5Y B;  1XXG A;  2EOT A;  2V1C C;  4X66 L;  3M7N A;  1STY A;  1VQM A;  3PUW A;  3HRZ C;  4HIO A;  4A3F H;  4RGM A;  1PDQ A;  3QIA A;  4WRD A;  5IYB G;  3MEH A;  4GKJ Q;  1KDA A;  1C48 A;  2FMC A;  3NBH B;  5EPK A;  2PQE A;  2CWA A;  3R93 A;  3F2B A;  4ZKC B;  4C3H H;  1GKH A;  1Q8I A;  4KV6 A;  4RCO A;  4H0L C;  4KKS A;  4PZ8 A;  3W5O A;  3CC2 A;  1EYA A;  1HZB A;  2H1E A;  4GNX C;  2EYO A;  4PMW A;  4FO2 A;  3D3R A;  4ME5 A;  3PIO A;  1Y8P B;  2NB0 A;  3CKI B;  5FLX c;  1ZYR D;  2RDG A;  2EZV A;  1PH5 A;  2JA6 B;  4QIW B;  3S16 H;  3BYY B;  1QE6 A;  3E6Z X;  4V0B A;  4YHH Q;  1ZYR C;  4B3M L;  1K8O A;  3VR4 A;  2JA7 H;  2UXC L;  3EVQ A;  4WJ3 M;  1JOQ A;  2K75 A;  3E9I A;  1JQY D;  1N8R C;  2YYZ A;  4A3D B;  3M7G A;  2MO0 A;  1HA5 A;  3MFY A;  4EVO A;  1UUP A;  3MXG A;  4GS3 A;  1NR4 A;  1XNR L;  3L3O C;  2OQ0 A;  1XTD A;  1YJW A;  4KKT A;  4BWG B;  4KN4 C;  2KEN A;  3BVG A;  3FRP B;  1GUG A;  1QJO A;  5CBA E;  3IAY A;  4IZ8 A;  5FO7 B;  1VQH A;  5E3F A;  4AYB E;  1QVG A;  1SNP A;  2LXK A;  1PXU A;  1VDZ A;  2N8N A;  2SNS A;  1X3P A;  1OXX K;  1RTO A;  1SND A;  5LL6 X;  1HH2 P;  2EYF A;  1RD9 D;  2JN4 A;  2WIN B;  1UWV A;  3U4Z A;  1X55 A;  3GTQ H;  2XRS D;  1EQV A;  2NYZ D;  5CV6 A;  3GTG H;  3X3N A;  1QWY A;  1CZW A;  2Z9H A;  3V2T A;  4X64 Q;  4DK0 A;  5I2X A;  3BVM A;  1EFI D;  1V1Q A;  2YTV A;  4DR1 L;  1H9K A;  3J81 i;  4JI4 L;  1CKN A;  4AIM A;  1QVF A;  3CCU A;  2UXD Q;  1NUC A;  1N33 Q;  4DXG A;  3I55 A;  5ELO A;  3SDZ A;  1XNQ Q;  3L2P A;  2YU9 B;  4LF4 Q;  4RMF A;  5JJK A;  2VS1 A;  4ABN A;  3H3V I;  3NBI A;  3OPO A;  1MGS A;  2PW7 A;  5H1S E;  4LFB Q;  1BKB A;  2MO1 A;  2A73 B;  2FJ2 A;  5CV5 A;  4EQN A;  4G4K A;  2DGY A;  2F0N A;  3C1F A;  2DY8 A;  2RF4 A;  3PUZ A;  3T16 A;  3I4N B;  1LTR D;  5J39 A;  1PRT F;  5D14 A;  4B3S L;  1LV9 A;  4LF8 L;  3HOU G;  1A6X A;  1A0I A;  2R61 A;  5M3F B;  1JJC B;  2EYH A;  1JWM D;  5IP9 H;  3NXW A;  1WTV A;  2QGQ A;  2Y0S G;  1DJR D;  4JI3 Q;  4X3U A;  1ET9 A;  2R6G A;  4BBS H;  2UUB L;  3HOW B;  2L4N A;  1KD1 C;  2K5Q A;  5CBE E;  5EKI A;  1GD7 A;  4B9W A;  2F4I A;  3GTO B;  3JAM c;  1I4H A;  4P72 A;  1VQ6 A;  3D0F A;  4A3E H;  3VR3 A;  5ELB A;  3OOC A;  3S2H B;  4ALP A;  5J3B A;  2HHH L;  4KK7 A;  5IT9 c;  1CKO A;  2RCN A;  4NPS A;  3RR5 A;  4KHZ A;  1LLR D;  4R4T A;  4R4I A;  4G7O C;  4DR6 Q;  3L7Z C;  2HIX A;  3AU7 A;  1WVL A;  2R7Z G;  1N32 Q;  4X62 L;  4UHV A;  1WTH A;  3I90 A;  3GTP B;  5K36 H;  3DWP A;  4DKA C;  5IP7 G;  1IBK L;  1I6H H;  3DHQ A;  1GXD C;  4R4O A;  3M85 A;  4DUZ Q;  1TWH H;  1KLG D;  4CJ0 B;  4B3R Q;  2WAC A;  4IUV A;  2UUC Q;  1EY5 A;  3PO3 H;  2JJQ A;  4X3T A;  3T4A C;  4IJH A;  2KBN A;  4DAY B;  1IYU A;  1C8C A;  2I5M X;  3HOX H;  2PQA A;  4HR7 B;  3A8I E;  4JC0 A;  1PTO H;  1WTQ A;  1TVX A;  3TS2 A;  1FNU A;  1UNS A;  4XQN A;  3RNU A;  1VQO A;  1O80 A;  4A3J G;  3CC7 A;  5G3L F;  1JMC A;  1JJG A;  3LX0 A;  4RKL A;  2BE5 D;  2WAQ B;  1VQ4 A;  4EGV A;  3RZO H;  1U5K A;  2XNA C;  3HOZ H;  2DNC A;  2BE5 C;  4XT3 B;  3L9A X;  4KD3 A;  4ME3 A;  2B8G A;  2IWH A;  2M00 A;  3NUC A;  1SNQ A;  4DR3 L;  2CH4 W;  1H95 A;  3KUP A;  3UDF A;  3S9W A;  2Q2T A;  1R9T B;  5I4D A;  4JI7 L;  4IQZ A;  3CCR A;  2KCC A;  5IGD A;  4DR2 L;  3KBX A;  1OXS C;  4HED A;  3ONA B;  2PO4 A;  2VQE Q;  5EBD A;  2Q2I A;  5NUC A;  1V1P B;  5JPM C;  3QR8 A;  2F0D A;  3K7A B;  5ELC A;  5BR8 L;  1XWE A;  3DXJ C;  1VCI A;  3K81 C;  3M4Y A;  4CKB A;  5AFW A;  3P75 A;  1K9M C;  3PIO 3;  1TS5 A;  3S1N B;  1W2B A;  5JEA J;  2B8F A;  1JIC A;  2CHB D;  5C5L A;  4DV2 L;  3KF8 B;  5DM6 3;  4RA8 A;  3SXH A;  1SRU A;  2MUY A;  2PZU A;  4JVZ A;  4X3S A;  3PSI A;  1IYJ B;  5DNF A;  2UUA Q;  1Y1V G;  3MZ5 A;  1D8L A;  1TWC H;  3AFQ A;  1E22 A;  1VQ7 A;  4Y7N B;  3M3Y B;  3BVZ A;  1IBM Q;  3KOJ A;  4XIG S;  4EQP A;  4Z9C B;  4PZ6 A;  3G6J B;  4OWW B;  5IYD H;  5KND A;  4CJ1 B;  3UE0 A;  3F2U A;  4APV A;  3I3C A;  4HIM A;  1SJH D;  2M9V A;  4PG3 A;  2R93 G;  4K0K Q;  1PH3 A;  1X54 A;  1O7Y A;  1HNX L;  2R92 H;  4A3D G;  4OHJ A;  5EPJ A;  1YBY A;  3DWQ A;  1LT3 D;  2JSO A;  4IPD A;  1F77 A;  3U9S A;  3QOL A;  3MEF A;  2LY7 A;  3OTO L;  4DNT B;  4MIU A;  1DM0 B;  2F3W A;  3SE0 A;  2EXD A;  1IZ6 A;  2E2J B;  1XPU A;  4FP5 D;  1VQ8 A;  5IYC G;  1LTT D;  3CCE A;  4DAM A;  2F0M A;  3VR5 A;  1YJ9 A;  3PQI A;  2A8V A;  2PI2 E;  4QGU A;  3FVQ A;  4OL7 A;  4BS9 A;  4IUR A;  4CHT B;  4A3M H;  4X3K A;  1PA6 A;  2X6L A;  1HXY D;  4IPG A;  4TVA B;  4L5S A;  4MNO A;  1G91 A;  5KRU A;  3I73 A;  1QCB D;  1H9S A;  1S5D D;  1SEB D;  1M1K C;  1Y8N B;  4OX9 Q;  1VQE A;  3S15 H;  1LT6 D;  2BH2 A;  1TQO A;  4RHS A;  1VQF A;  3A54 A;  1ASZ A;  4LF9 L;  2VNU D;  2MFI A;  1FVI A;  2Z4I A;  2CKZ B;  2XRQ D;  3NQT A;  2EYL A;  1BDO A;  3X3M A;  4G57 A;  2B2V A;  4R8I A;  4M1U B;  4UAI A;  1I3Q H;  4QIW E;  1EIH A;  2FIN B;  4O0A A;  1DCZ A;  4F87 A;  1PH4 A;  2OQK A;  5A2Q E;  4JV5 L;  4ID6 A;  2F0S A;  5ISR A;  1SE4 A;  1MJE A;  2FFK B;  2ICI A;  1GUW A;  3K80 C;  1N34 Q;  3AEV A;  3GTJ B;  1HR0 W;  1CQF A;  4JI1 Q;  2NVQ H;  1GO3 E;  2E5L Q;  1Y69 U;  2KEC A;  2L15 A;  2L1B A;  5IGF A;  5DAU A;  4N9T A;  5JVG 3;  2RSN A;  4L5T A;  1WJJ A;  5FJ8 H;  1AP0 A;  2I0Q A;  2VZA A;  3DMU A;  5FOB B;  3TP8 A;  1W6K A;  4JBW A;  1EZ8 A;  3LWE A;  1PTO D;  1WD1 A;  4JI0 L;  3MWY W;  4KY5 A;  1PTO C;  2HD3 A;  2HUG A;  2G9H D;  2F4V L;  1BVS A;  1I4Q A;  4H02 A;  4IFD H;  3CU7 A;  1X3Q A;  4LMQ D;  1CTM A;  2PI2 A;  3T56 B;  4C3I G;  2XWB B;  3H0G H;  1O7I A;  2HDL A;  4FNF A;  3KK7 A;  4JYA L;  2VQF L;  4YCW A;  2NVY H;  3NBH A;  3TP7 A;  5EJW A;  3PF4 A;  2UU9 L;  5C4J H;  3M9B A;  4LFA Q;  2C5C A;  4ZUJ A;  3J81 c;  4DV4 L;  4WJ4 A;  4DR5 L;  1YJN A;  2JYO A;  1LTG D;  3W3A A;  2CQO A;  2QEJ C;  1FJG L;  3F8T A;  2Q8I B;  4C1N K;  4BY7 G;  5C4X G;  1WTP A;  1LYL A;  4PQX A;  1HQR D;  1D7Q A;  1DOM A;  1QUQ B;  2GVB A;  2NN6 H;  1PZK D;  2KUM A;  4JI5 L;  1YNN D;  1SXT A;  4LFC Q;  3K5L A;  3PUV A;  1WCM B;  3OW7 A;  4QF4 A;  1YNN C;  1RF2 D;  1ZKO A;  3SK6 A;  3NTK A;  5GAE C;  5LMN L;  4A3C G;  1MKH A;  2NVT H;  1JR0 D;  4NB3 A;  1W3S A;  1KC8 C;  4LF6 L;  1YEZ A;  3M4P A;  1DOL A;  1IBK Q;  5C0X J;  3KDF B;  2K7V A;  4NKL A;  4C2M H;  2JA8 H;  1HZA A;  1Q82 C;  2F52 A;  2D0O A;  3AB9 A;  4ULL A;  3MTS A;  2F3V A;  2X6G A;  3ITP A;  1TWF B;  4DV0 Q;  4C3J H;  2FMM A;  2HCI A;  5JOB A;  1B7Y B;  3HOU B;  4DR4 L;  5C0X I;  2Y0S B;  1GUO A;  1YHB A;  2JA5 G;  3DM3 A;  3HOV H;  5M5X B;  1CA5 A;  1OTC A;  2XN9 C;  1A63 A;  3DEP A;  3U9O A;  1K8G A;  4DV6 L;  2V4D A;  1X9N A;  5JPN C;  1G2T A;  4CJ2 C;  1AEX A;  5M5W B;  1KIX A;  4YY3 Q;  1BQQ T;  5CC4 A;  3K0Y A;  4JOI A;  2A5H A;  1I6V C;  1AE2 A;  1WTX A;  4HAE A;  4KKU A;  1TWG H;  4NXM Q;  4DUY L;  2R7Z B;  1D5X C;  3FP9 A;  1UEA B;  3EQL C;  1HNW L;  2L5T A;  2WAQ E;  4OIK A;  4OIJ A;  3I4O A;  4DNR B;  2TSS A;  5C5M A;  3K5O A;  4NXN L;  2JEA I;  5IGE A;  3BYT B;  5C3E H;  4K5V A;  3CRK C;  5CV9 A;  2HT1 A;  4N8X 1;  2MGS A;  2F0V A;  1GJX A;  4JI6 L;  1K83 B;  3VYS A;  2I5L X;  4DAP A;  3I7F A;  1B8A A;  1SNO A;  1K3B C;  2RKS A;  4KHV A;  2WII B;  4RWS C;  4HJ8 A;  3UDI A;  5A2Q L;  2K5D A;  3KYH C;  2VB2 X;  4DV2 Q;  3CCV A;  2JQO A;  3S14 H;  1LO5 D;  4A3J B;  1QZH A;  1MSH A;  1BXT A;  1HNZ Q;  1BBU A;  2R7F A;  4KD4 A;  3SR1 A;  5JEA G;  2K4K A;  1V9P A;  1GHJ A;  4JCV E;  4A3F B;  1CT1 D;  5M3M H;  3NP8 A;  1HUN A;  4IJL A;  3JAM E;  1OXV A;  2GA4 B;  1AZP A;  4POF A;  2ZM6 L;  4R9W A;  2AUJ D;  4KHP Q;  1ILP A;  3TRZ A;  5IT9 E;  5IP7 H;  5FLM H;  4BY1 H;  3I4M H;  2NBF A;  5IGB A;  1EWH A;  3KLS A;  2KQ3 A;  2IPK D;  1VMC A;  3S2D H;  4HJ9 A;  2ZTE A;  4AQY L;  3TQY A;  3KLW A;  3D31 A;  1QNK A;  4B3T Q;  4GLV B;  3QG1 A;  4DAY A;  2EY6 A;  2EYP A;  2CFM A;  5A35 A;  1ET6 A;  3PO2 H;  3IFT A;  4LF5 Q;  2ZTC A;  4A3L H;  3PGZ A;  5E7N A;  2QDL A;  1PTO F;  5AJ3 L;  1VF7 A;  2JA7 B;  3PUX A;  1SFO B;  5EAY A;  1I4P A;  1B3Q A;  2JK8 A;  3FEW X;  4MZ9 A;  4PNY A;  4A3G G;  5IWA Q;  3C46 A;  1Q90 A;  4A3K H;  1Y1V B;  5EKK A;  1UE1 A;  3CW2 C;  2BH8 A;  1B4O A;  4JI2 L;  1VQA A;  1EY7 A;  2QA4 A;  2E2H B;  1R4Q B;  1TWA H;  2DY7 A;  2DJG C;  5DM7 3;  1G29 1;  3KF6 B;  4KMU C;  3VYR A;  5FKA C;  2IHE A;  2R93 B;  5GRO A;  1N36 L;  1U9R A;  4A3B H;  1STB A;  2DJF C;  1F9S A;  4ZUI A;  4DV7 Q;  1I94 L;  3GTQ B;  3R3O A;  3WOF A;  3E0J A;  1U0L A;  2EE1 A;  1VQI A;  1EU3 A;  5BN5 A;  4S3S A;  3K59 A;  1T5X D;  4DV3 L;  4BBR G;  3QJY A;  4IPC A;  2NUC A;  1CFM A;  1JJ2 A;  1S5B D;  3R8B A;  1UAP A;  5FK9 C;  4NW2 A;  3OWF A;  1HJP A;  5EKL A;  3CPF A;  4A3I G;  2PZW A;  1SE8 A;  3EFX D;  1XMQ Q;  5E1F A;  3F2C A;  2QDB A;  1SAP A;  3FMC A;  2JA6 H;  1BBW A;  1EIF A;  4CKC A;  3J80 E;  1ICW A;  1S5F D;  1WCM G;  4R8N A;  2B2W A;  1EEF D;  2B63 G;  2F4V Q;  2QKI C;  1LT4 D;  2J4X A;  1E1O A;  1JWS D;  3T1Y Q;  1HRJ A;  2EYM A;  1PZJ D;  4XT1 B;  4HSP A;  1P8L A;  4IN3 A;  1F2Y A;  3DUZ A;  1O7Z A;  2WKC A;  4DNI A;  3K58 A;  3CQZ B;  1IL2 A;  4OO1 H;  3VYU A;  3AYH B;  4QCL A;  5IGG A;  1S72 A;  2E76 C;  2B2U A;  1SYG A;  4KLK A;  4DV4 Q;  2B3G A;  3CMA A;  1G8Z D;  2WB1 B;  3MXU A;  1H9M A;  1II3 A;  1TKW B;  2VUM G;  1D2B A;  1S4Z A;  5LMU Q;  4DV1 L;  3KJP A;  1CUK A;  2DUD A;  3CHB D;  3I91 A;  1FD7 D;  1YI2 A;  1A3T A;  2TMP A;  1QIL A;  4K6L A;  1ML0 D;  1IBL Q;  4JI5 Q;  4LNQ A;  5I2Y A;  2QIL A;  2KOL A;  4OEM B;  2B29 A;  1JOR A;  1D6E C;  2A19 A;  2MJ8 A;  2YU9 H;  5LMN Q;  2ID0 A;  1TS3 A;  1UE7 A;  3F2D A;  3VYT A;  3JAM L;  3FKI G;  1Q12 A;  3G48 A;  4RKB A;  2AQ3 B;  4C3I B;  1X6O A;  3H94 A;  4PV1 C;  2IJ0 A;  2K5N A;  1BO0 A;  3DM1 A;  1F9P A;  1TY0 A;  2Z6B A;  1S40 A;  4L8J A;  4PZ7 A;  4X65 Q;  1B2T A;  1B3A A;  3RZO B;  1YZ6 A;  1KAA A;  1OXU A;  4E6I A;  3I4N H;  4TRD A;  4UP7 A;  1VQL A;  2F0H A;  2OXP A;  4J1M A;  4LUO A;  2L11 A;  5C0X G;  1J8I A;  5M3F H;  3P1H A;  3S24 A;  3EA6 A;  1SSO A;  1DZ1 A;  1SMX A;  1BNZ A;  1J5E L;  4O42 A;  1WD0 A;  1LTS D;  2EXZ A;  3HOW H;  5C44 G;  3MHB A;  5C4X B;  2B2V C;  4BY7 B;  2IW3 A;  3TZD A;  1GHK A;  1JWU D;  3GTO H;  2Z6K A;  4LF7 Q;  2AWN A;  1EFW A;  2LXJ A;  4UP8 A;  4DF7 A;  4A3F G;  2Y0S E;  4FXG C;  3ZJY C;  1K8M A;  1WTR A;  3HOY H;  1SBB B;  1MSG A;  5T1G A;  2EJM A;  1HR0 Q;  1TY2 A;  4DUY Q;  1EY9 A;  4LK1 C;  1SN8 A;  2F0W A;  3GTP H;  4C3H G;  2EJF C;  4DV5 Q;  3GTK B;  4IPH A;  1PH8 A;  3OIP A;  1IKM A;  3I8Z A;  4DA2 A;  1TS4 A;  1XMO L;  1E7Z A;  1FR3 A;  1ASY A;  2K5V A;  4OEL B;  1A3V A;  2B2T A;  3OMC A;  4L63 B;  4QJF A;  4RCN A;  1L0Y B;  1BCP D;  4LAA A;  4YWK A;  3A55 A;  4FXK C;  5JJI A;  4JBK A;  1Q3L A;  4XQJ A;  3BG3 A;  1JCK B;  2F0J A;  2EDG A;  1BCP C;  1CSP A;  4I7A A;  1KTK A;  1WOC A;  3HZX A;  4EQO A;  2JA5 B;  4QMG A;  3J81 E;  1KL9 A;  4Q0F A;  4XTC S;  3EIV A;  2JA7 G;  1D5Z C;  1QUQ A;  4YIJ A;  4P75 A;  4CDD C;  1EYG A;  3WDN A;  2EYJ A;  3BZD B;  4HCE A;  1VQN A;  3BZC A;  1IXR A;  2KA7 A;  4Y52 H;  1YNJ D;  3ERQ A;  3NSW A;  2Q8T A;  3H15 A;  1G6P A;  1ZEQ X;  1YNJ C;  2C9O A;  3FDT A;  3T1H Q;  1PRT B;  2NZ1 D;  4FXD A;  1UEB A;  1R9T H;  5HY6 A;  1EWI A;  1DYQ A;  3T13 A;  3KDF A;  1UE5 A;  4K5X A;  1HFG A;  3Q23 A;  1FNW A;  4DK1 A;  3J80 L;  1Y1W H;  2K1B A;  5I9O A;  1WTO A;  2PYK A;  3PCO B;  2ZXR A;  5E4W C;  3G7L A;  3ULP A;  4F88 A;  2IX1 A;  1TR5 A;  1L1O B;  1C7Y A;  2CH4 A;  3CD6 A;  3J7A F;  3UDX A;  4HTH A;  4A3M B;  3PUY A;  2ZJP A;  1AW7 A;  4X66 Q;  2F0K A;  3PF5 A;  1F9R A;  3K7A H;  2CQA A;  4IFD J;  1ESR A;  2UXB L;  2XSC A;  1FL0 A;  2IX0 A;  1I4R A;  1TS2 A;  4ODG A;  5EQ0 A;  1DOK A;  3CCS A;  5LMN W;  1RCV D;  4R1J A;  3T53 B;  4IUN A;  4JK1 C;  4FF1 A;  4DR7 L;  1SYF A;  1EY0 A;  4QL5 A;  4IFD I;  3PV0 A;  3RN5 A;  1SE3 A;  1JOO A;  1DON A;  4GN5 A;  4JI8 L;  1STA A;  4YWL A;  4O1N A;  3M3Y H;  3TZU A;  3KJO A;  2ATW A;  1VQC A;  2F0U A;  3EJI A;  2KHI A;  4GKJ L;  2RBM A;  4JPB W;  4ZRZ A;  3MVV A;  3NQI A;  4A93 H;  4B3M Q;  3NPP A;  3J7A 5;  3JC6 6;  2K50 A;  3URY A;  3N52 A;  1HHV A;  4GOP B;  1BBX C;  4BA2 I;  1TU2 B;  2UXC Q;  3MXP A;  5IP9 G;  4C56 C;  3D8G A;  3GO5 A;  1YHQ A;  1SRO A;  2F1M A;  3GTM H;  3TME A;  1I50 B;  4BBS G;  4WJW A;  3J81 j;  1XNR Q;  3M4O H;  5CMD A;  4JOI C;  1NMG A;  4J8Q A;  2WKD A;  2E2J H;  1X65 A;  2KVM A;  2NN6 I;  4A4I A;  4A3E G;  1PZI D;  4B9X A;  4XXE A;  4BXX H;  2LFN A;  3RMH A;  1H9J A;  2XIW A;  1XYI A;  3CC4 A;  2WB1 G;  4AH6 A;  4A3G B;  3H09 A;  5K36 G;  5C3X A;  4IOC A;  3G4S A;  4OON A;  1E24 A;  3HP3 A;  5IGC A;  1XTC D;  3PIP 3;  1ENA A;  2NVY B;  5D65 A;  4DR1 Q;  3ND9 A;  1SLJ A;  4JI4 Q;  2G9D A;  3OIQ A;  4GNX B;  1RL2 A;  5C6A A;  3RZD B;  4GLX A;  3SEB A;  1EWC A;  3CCQ A;  1KRT A;  2ES2 A;  3HOX G;  3S1M B;  1B50 A;  2K52 A;  2K5H A;  3EN2 A;  1S5C D;  3A8J E;  4IUP A;  3RD4 A;  2AKW B;  4IOA A;  4X64 L;  2JP1 A;  2EIF A;  1OXT A;  5IYB H;  4R4Q A;  2K5W A;  2KHS A;  1P16 A;  3I2Z A;  3HOZ G;  4BBR B;  3IFD A;  3CME A;  1VQP A;  2UXD L;  2JXM B;  1N33 L;  4B3S Q;  2XGT A;  4H44 C;  1A2T A;  3OSO A;  2D5D A;  3BDO A;  2K05 A;  4LF8 Q;  4H7B A;  4MTN A;  3GTJ H;  1XNQ L;  2PZT A;  5J22 A;  3D4R A;  4L5R C;  3NHH A;  1NR2 A;  3I70 A;  1C4Q A;  1YNX A;  4A76 A;  2FXQ A;  4A3I B;  1W6J A;  3Q24 A;  4LFB L;  1LTL A;  4QY7 A;  2HQE A;  2G5D A;  3ERS X;  2UUB Q;  3P20 A;  3J81 L;  3J7Y W;  3TP6 A;  3SVM A;  2F0G A;  3CCL A;  2Z4H A;  2F0I A;  2AQ2 B;  3E0E A;  3J7Z C;  3S1Q B;  3HKZ G;  1NBW A;  1Y14 B;  1X3E A;  4RGO S;  1EOT A;  4HSV A;  2PNH A;  2A69 D;  5FLX E;  5M9O A;  1AFP A;  2B63 B;  2HHH Q;  2F0T A;  5KNC A;  1BCP F;  1BOS A;  2A69 C;  2K04 A;  2FHT A;  5GAG C;  5IE8 A;  4JI3 L;  3HOV B;  4X62 Q;  2F0P A;  1O78 A;  3W2D A;  3K5M A;  4CDE C;  1SYE A;  1TXY A;  1STG A;  2R7D A;  4OXP A;  3BZK A;  1ENC A;  5K5P A;  2NTS A;  2B2Y A;  3UDG A;  1WYD A;  1WI5 A;  2SEB D;  2E2I B;  4YCU A;  1R4P B;  2MQH A;  3FHW A;  2LKV A;  2HCC A;  4X6A H;  4ZCK A;  4DR6 L;  2VUM B;  3S1R B;  3NEM A;  5IYD G;  1N32 L;  3A74 A;  4CKE A;  3J7A V;  2BCO A;  4HJ7 A;  3ND8 A;  1Q86 C;  4P73 A;  2RHS B;  5JAV A;  2EJG C;  1EYC A;  1X3F A;  1RKN A;  2YTX A;  4DUZ L;  1AE3 A;  1BUV T;  2QEX A;  5C3E B;  4B3R L;  2R92 G;  2UUC L;  5CR3 A;  3KLR A;  2L9H A;  3MXN B;  4KI0 A;  1Q1B A;  5IOD A;  4ZKB B;  1G2S A;  1K8A C;  3K6O A;  4DR3 Q;  1VQ5 A;  1C9O A;  3ULL A;  1T9H A;  3BS1 A;  3FKI B;  4MTK A;  5F2D A;  1LTB D;  4JI7 Q;  3GTL H;  1SYB A;  3S14 B;  1JE5 A;  4EQ5 A;  4DR2 Q;  1CA6 A;  1ICF B;  3D6C A;  4G7H C;  1DXM A;  3HS0 C;  2EQS A;  1X56 A;  2NWG A;  2XTI A;  4A3M G;  1KNA A;  2NVX H;  1YVC A;  1TWF H;  5BR8 Q;  1VQJ A;  2Q2U A;  3HOU H;  2VY3 A;  3K57 A;  2B2W C;  3PMF A;  1H9S B;  3WWV A;  3NWS A;  1Q7Y C;  3BJU A;  2I46 A;  3RUZ A;  1A2U A;  2PPB C;  5TSS A;  1GVP A;  3CF5 A;  1KQS A;  4BY1 B;  1B9M A;  3I4M B;  3E9H A;  2K32 A;  5C44 B;  5ELD A;  2I5H A;  3S2D B;  1S5E D;  3J80 i;  3Q8D A;  2VQE L;  1U4P A;  2AQ1 B;  2RDF A;  3CP0 A;  4ILW A;  4JW0 A;  5M5W H;  1NTG A;  3FPU B;  1L0W A;  1A62 A;  1MD2 D;  3RN2 A;  3U4V A;  3S17 H;  3OHX C;  2EY2 A;  2ENB A;  2B2U C;  5JJZ A;  1VQB A;  4IUT A;  2OF1 A;  1RDP D;  1STN A;  2HDM A;  2SDF A;  3F1Z A;  3H6M A;  2R7Z H;  3FPP A;  2K33 A;  2EPB A;  2VXW A;  4P71 A;  3SHL A;  4C3H B;  1HTP A;  4RHR A;  3NTI A;  4A3K B;  1ZXT A;  1HNX Q;  1K73 C;  2UUA L;  5FJ8 G;  3VDY A;  1NAP A;  4RFB A;  1V8Q A;  1F2L A;  5GQO A;  3V05 A;  3OTO Q;  3UE1 A;  3S16 B;  2F0L A;  1PH6 A;  1Q1E A;  3VA5 A;  2F03 A;  1SNM A;  2XVS A;  3GDE A;  3TRE A;  4U68 A;  1NJI C;  1B70 B;  1HPC A;  4AYB G;  1HA6 A;  4A3J H;  4IFD G;  4K0K L;  2B39 A;  4RAU C;  3BU2 A;  1PFS A;  3H0G G;  4JI8 Q;  3A7A B;  1KAB A;  1PFB A;  1K0R A;  3ULJ A;  2L12 A;  4QB4 A;  2AMC B;  3R2T A;  4YWM A;  1PH2 A;  1Z9F A;  1FYC A;  1KRS A;  1CK1 A;  4OO1 I;  1EIY B; 
#chains in the Genus database with same CATH homology
 2O4X A;  2O5J C;  5C3W A;  1SNC A;  4K14 A;  1LT5 D;  2H4O A;  3V96 A;  5FLX L;  1MI2 A;  1V1P A;  3D4W A;  4XDX A;  3GTG B;  2IL8 A;  4PMC A;  1A15 A;  1F9Q A;  2RA4 A;  3C2P A;  2NN6 G;  4U67 3;  1JC7 A;  5KEE A;  2MP1 A;  4B08 A;  3KF8 A;  1DD2 A;  2CVR A;  4ZQ3 A;  1SYD A;  3NWT A;  1H9R A;  3I72 A;  2B2T C;  2E2D C;  3SK5 A;  4FF4 A;  4I7Z C;  1RTN A;  1ONL A;  3GV6 A;  4F8M A;  3VR6 A;  2OEO A;  5CV4 A;  1IL8 A;  2IT1 A;  5ELE A;  4C1N I;  1Z6H A;  4K8J A;  1CHQ D;  4WFN 3;  4C3J G;  4IUU A;  4MN3 A;  5D3I B;  4HMJ A;  1KDC A;  4HN7 A;  1OO9 B;  4BA1 I;  1PFN A;  4MHE A;  3D6W A;  1HTL D;  5FO8 B;  3N6R A;  4KJO A;  2Z8L A;  4BBS B;  5FO9 B;  3Q22 A;  2ICE C;  4H13 C;  3TN2 A;  1ILQ A;  3TSS A;  1PFM A;  2M2L A;  2X69 A;  2O2L D;  1PLF A;  3GP7 A;  2WP8 J;  4A3E B;  3VR2 A;  2F0E A;  4DXF A;  2Z1C A;  1SDF A;  5ELF A;  4OGQ C;  1EEI D;  2MPM A;  4KTA A;  2WV6 D;  4RGN A;  1SJE D;  1I6H B;  4J6H A;  5I6Y A;  1TWH B;  1B9N A;  1NSN S;  4GZY C;  1GUT A;  1CHP D;  2PCF B;  3OWE B;  4FYD A;  1I4X A;  2F0O A;  3PO3 B;  4RGT A;  4XQQ A;  4N9P A;  5KIX A;  5HUR A;  3HOX B;  3K5N A;  1EY4 A;  1PTO B;  4TKO B;  4ZAI A;  4UDU C;  1ROD A;  5CV8 A;  5IT9 L;  1T5E A;  1IHZ A;  4HMI A;  3HOZ B;  2I07 B;  2N88 A;  3HOY B;  1KLU D;  2BOS A;  5IOC A;  2A6E D;  5DEH A;  2BDO A;  2SOB A;  2A6E C;  1TII D;  3A8K E;  1STE A;  3C1E A;  4K2L A;  3Q6S A;  4NMZ A;  3NK9 A;  4KN7 C;  3HKZ B;  2KCN A;  4P2C B;  4NDX A;  5COR A;  2O5I C;  5E4X A;  2J0T D;  4CGY B;  4DFA A;  1IKL A;  3A7L A;  4TQU S;  1Z7T A;  3MA2 B;  3CRL C;  1TWC B;  3MC0 B;  2MHV A;  1I4G A;  1X32 A;  3DEO A;  2A68 D;  3UI2 A;  1V1O A;  2A68 C;  4G7Z C;  1Y1W B;  1LAB A;  2JEB I;  5T1I A;  2CW0 D;  2R92 B;  3E5S A;  2CW0 C;  3Q0A A;  2R3Z A;  2VB3 X;  2PMZ B;  3IL8 A;  3KBG A;  1MBY A;  1E2W A;  2Q8R E;  4K8I A;  5IIF A;  3GD7 A;  3VA7 A;  4KY7 A;  3QO2 A;  4KJN A;  3QB3 A;  1IW7 D;  5J1Z A;  1F2Z A;  3S15 B;  1BR9 A;  1IW7 C;  4A93 B;  4DN4 M;  4QUC A;  2L0C A;  4WOR A;  1QG7 A;  3KLS X;  1WTW A;  2L55 A;  3A56 A;  3GTM B;  1RHP A;  1XX8 A;  3MXN A;  2B2Y C;  1I3Q B;  3M4O B;  4FF3 A;  2XWJ B;  5KYI A;  4OO1 G;  1CM9 A;  3TDQ A;  4LJZ C;  1SE2 A;  4ZLT F;  2BA0 A;  1SYC A;  2RDH A;  1SMY D;  2NVQ B;  1U4L A;  5JVH 3;  4PMB A;  1SMY C;  2SNM A;  1HCZ A;  1LAC A;  3GQB A;  3ZYY X;  5D3D A;  3ERO A;  5C4H A;  4I65 A;  4QUF A;  1ENF A;  1CI3 M;  4XYQ A;  3MFG A;  1GOZ A;  1EL0 A;  3P7J A;  4AYB B;  1PMR A;  2A6H D;  3QOJ A;  1D1I A;  3H0G B;  5JEA H;  3QWN A;  1EY8 A;  2A6H C;  4K5W A;  2AUK A;  2F0F A;  4NP5 A;  2QCP X;  1E0B A;  4FF2 A;  5LHY 1;  4RH6 A;  5C4J B;  1VF5 C;  1B53 A;  4ZYS A;  5LL6 S;  4IAL A;  2LMC B;  1AN8 A;  2J7Z A;  2LS0 1;  3H3V C;  5I9P A;  1NCV A;  2D9U A;  3I4L A;  2AWO A;  1CZG A;  1O7L A;  4XYO A;  5EGT A;  4FVM A;  5KGU A;  2NVT B;  2PW5 A;  1F2M A;  5KNB A;  3TP5 A;  1U4R A;  4C2M B;  1E2V A;  2JA8 B;  2KED A;  5EPL A;  1A3U A;  1D1K A;  2D62 A;  3LNN A;  3HEJ A;  4C3J B;  3GV3 A;  1AZQ A;  1EIG A;  1ESF A;  2KJX A;  2ZXP A;  1EQT A;  2OT2 A;  1B44 D;  3T51 B;  1Z47 A;  4L6T B;  5C4Z A;  3BDC A;  1EYD A;  2K01 A;  1HUM A;  4ZK9 B;  5I6W A;  2RQX A;  3SK4 A;  1TWG B;  5COY A;  1Y8O B;  2F0Q A;  3GTL B;  1QOH A;  3LWU A;  2BA1 A;  3HG9 A;  2E75 C;  3D4D A;  2RVL A;  2BDN A;  1G6Z A;  2JE6 I;  1CQV A;  3C3L A;  2NVX B;  3DWA A;  1TT2 A;  5CYU A;  3HGB A;  1L0X B;  2N55 A;  3BDL A;  4DU9 A;  1KDB A;  2A74 C;  1V43 A;  2QF7 A;  2D2C C;  1B1Z A;  2EY5 A;  1PRT D;  2IX3 A;  4IUQ A;  3WOE A;  1PRT C;  4DAV A;  3S17 B;  1LTA D;  2K28 A;  2K6A A;  2EVB A;  5M3M B;  1STH A;  1GUS A;  3SK8 A;  3IKJ A;  1HQM C;  1D5M C;  5KYL A;  1J9O A;  2K03 A;  3OMG A;  5HGT A;  4HCS A;  1FNV A;  2RSO A;  3MAQ A;  1JE4 A;  1U4M A;  2NTT A;  3O13 A;  2DN8 A;  3PO2 B;  3H91 A;  3R2I A;  1EY6 A;  4K6D A;  4DGZ A;  1KNE A;  2ZT9 C;  1JB3 A;  5CV7 A;  1M4V A;  4F7X A;  4Q5V A;  4CBV A;  4KY6 A;  1QNU A;  1VMP A;  2PNR C;  5EBC A;  3AMU A;  4K2K A;  2EY1 A;  1GUN A;  5C0X H;  1QB5 D;  1BF4 A;  4V19 0;  1HFN A;  1TWA B;  1RJT A;  2ZXO A;  2KEE A;  4M8A A;  4TSS A;  1E2Z A;  5G3L D;  1M8A A;  1PYW D;  3RLF A;  1IYV A;  2E74 C;  1EZ6 A;  3NE5 B;  5BN4 A;  1BCP B;  1FGB D;  1JOK A;  4A3B B;  1EU4 A;  1LTI D;  3TBI B;  5BN3 A;  5CGK A;  5M5Y B;  2DNE A;  3NTH A;  1XXG A;  2EOT A;  3M7N A;  1STY A;  3PUW A;  3HRZ C;  4RGM A;  1PDQ A;  3QIA A;  4WRD A;  3MEH A;  1KDA A;  1C48 A;  2FMC A;  5EPK A;  2PQE A;  3R93 A;  4ZKC B;  1Q8I A;  4KV6 A;  4RCO A;  4H0L C;  4KKS A;  1EYA A;  2H1E A;  2EYO A;  4PMW A;  4FO2 A;  3D3R A;  4ME5 A;  1Y8P B;  2NB0 A;  3CKI B;  1ZYR D;  2RDG A;  2EZV A;  2JA6 B;  4QIW B;  3BYY B;  1QE6 A;  3E6Z X;  4V0B A;  1ZYR C;  1K8O A;  3VR4 A;  3EVQ A;  1JOQ A;  1JQY D;  2YYZ A;  4A3D B;  3M7G A;  1HA5 A;  3MFY A;  4EVO A;  1UUP A;  3MXG A;  1NR4 A;  3L3O C;  4KKT A;  4BWG B;  4KN4 C;  3BVG A;  3FRP B;  1GUG A;  1QJO A;  5CBA E;  3IAY A;  4IZ8 A;  5FO7 B;  5E3F A;  1SNP A;  1PXU A;  1VDZ A;  2SNS A;  1X3P A;  1OXX K;  1RTO A;  1SND A;  5LL6 X;  2EYF A;  1RD9 D;  2WIN B;  2XRS D;  1EQV A;  2NYZ D;  5CV6 A;  3X3N A;  1QWY A;  1CZW A;  3V2T A;  4DK0 A;  5I2X A;  3BVM A;  1EFI D;  1H9K A;  1NUC A;  4DXG A;  3SDZ A;  2YU9 B;  4ABN A;  3NBI A;  3OPO A;  1MGS A;  2PW7 A;  2A73 B;  2FJ2 A;  5CV5 A;  4EQN A;  4G4K A;  2F0N A;  3C1F A;  2DY8 A;  3PUZ A;  3T16 A;  3I4N B;  1LTR D;  5J39 A;  1PRT F;  5D14 A;  1LV9 A;  1A6X A;  2R61 A;  5M3F B;  2EYH A;  1JWM D;  3NXW A;  1WTV A;  1DJR D;  4X3U A;  1ET9 A;  2R6G A;  3HOW B;  2L4N A;  2K5Q A;  5CBE E;  5EKI A;  4B9W A;  2F4I A;  3GTO B;  1I4H A;  3VR3 A;  5ELB A;  3OOC A;  3S2H B;  4KK7 A;  4KHZ A;  1LLR D;  4G7O C;  3L7Z C;  3AU7 A;  1WVL A;  3I90 A;  3GTP B;  5K36 H;  3DWP A;  3DHQ A;  1GXD C;  3M85 A;  1KLG D;  4CJ0 B;  2WAC A;  4IUV A;  1EY5 A;  4X3T A;  3T4A C;  1IYU A;  1C8C A;  4HR7 B;  3A8I E;  1PTO H;  1WTQ A;  1TVX A;  1FNU A;  1UNS A;  4XQN A;  1O80 A;  5G3L F;  3LX0 A;  4RKL A;  2BE5 D;  2WAQ B;  4EGV A;  2XNA C;  2DNC A;  2BE5 C;  4XT3 B;  3L9A X;  4KD3 A;  2B8G A;  2IWH A;  2M00 A;  3NUC A;  1SNQ A;  3KUP A;  3S9W A;  1R9T B;  5I4D A;  4IQZ A;  2KCC A;  5IGD A;  3KBX A;  1OXS C;  4HED A;  3ONA B;  2PO4 A;  5EBD A;  5NUC A;  1V1P B;  5JPM C;  2F0D A;  3K7A B;  5ELC A;  1XWE A;  3DXJ C;  1VCI A;  3M4Y A;  4CKB A;  5AFW A;  3P75 A;  3PIO 3;  1TS5 A;  3S1N B;  5JEA J;  2B8F A;  1JIC A;  2CHB D;  5C5L A;  5DM6 3;  4RA8 A;  3SXH A;  2MUY A;  2PZU A;  4X3S A;  5DNF A;  3MZ5 A;  4Y7N B;  3M3Y B;  3BVZ A;  4XIG S;  4EQP A;  4Z9C B;  3G6J B;  5KND A;  4CJ1 B;  3F2U A;  3I3C A;  1SJH D;  2M9V A;  1O7Y A;  4OHJ A;  5EPJ A;  3DWQ A;  1LT3 D;  2JSO A;  1F77 A;  3U9S A;  3QOL A;  2LY7 A;  4DNT B;  4MIU A;  1DM0 B;  2F3W A;  3SE0 A;  2E2J B;  4FP5 D;  1LTT D;  2F0M A;  3VR5 A;  3FVQ A;  4OL7 A;  4BS9 A;  4IUR A;  4CHT B;  4X3K A;  2X6L A;  1HXY D;  1G91 A;  5KRU A;  3I73 A;  1QCB D;  1H9S A;  1S5D D;  1SEB D;  1Y8N B;  1LT6 D;  1TQO A;  4RHS A;  3A54 A;  2VNU D;  2Z4I A;  2XRQ D;  3NQT A;  2EYL A;  1BDO A;  3X3M A;  4G57 A;  2B2V A;  4R8I A;  4M1U B;  4UAI A;  1EIH A;  2FIN B;  1DCZ A;  4F87 A;  5A2Q E;  4ID6 A;  2F0S A;  5ISR A;  1SE4 A;  2FFK B;  2ICI A;  1GUW A;  3GTJ B;  1CQF A;  1Y69 U;  2KEC A;  2L1B A;  5IGF A;  5DAU A;  4N9T A;  5JVG 3;  2RSN A;  1AP0 A;  3DMU A;  5FOB B;  3TP8 A;  1W6K A;  4JBW A;  1EZ8 A;  3LWE A;  1PTO D;  1WD1 A;  3MWY W;  4KY5 A;  1PTO C;  2HUG A;  2G9H D;  1I4Q A;  4IFD H;  3CU7 A;  1X3Q A;  4LMQ D;  1CTM A;  4C3I G;  3T56 B;  2XWB B;  2HDL A;  4FNF A;  3KK7 A;  3NBH A;  3TP7 A;  5EJW A;  2C5C A;  4ZUJ A;  2JYO A;  1LTG D;  3W3A A;  2QEJ C;  2Q8I B;  4C1N K;  1WTP A;  4PQX A;  1HQR D;  1DOM A;  2NN6 H;  1PZK D;  2KUM A;  1YNN D;  1SXT A;  3K5L A;  3PUV A;  1WCM B;  3OW7 A;  4QF4 A;  1YNN C;  1RF2 D;  1ZKO A;  3SK6 A;  3NTK A;  1JR0 D;  1DOL A;  5C0X J;  2K7V A;  4NKL A;  3AB9 A;  4ULL A;  3MTS A;  2F3V A;  2X6G A;  3ITP A;  1TWF B;  2FMM A;  2HCI A;  5JOB A;  3HOU B;  5C0X I;  2Y0S B;  1GUO A;  5M5X B;  1CA5 A;  2XN9 C;  3DEP A;  3U9O A;  2V4D A;  5JPN C;  1G2T A;  4CJ2 C;  1AEX A;  5M5W B;  1BQQ T;  5CC4 A;  3K0Y A;  2A5H A;  1I6V C;  1WTX A;  4HAE A;  4KKU A;  2R7Z B;  1D5X C;  1UEA B;  3EQL C;  2L5T A;  4OIK A;  4OIJ A;  4DNR B;  2TSS A;  5C5M A;  3K5O A;  2JEA I;  5IGE A;  3BYT B;  4K5V A;  3CRK C;  5CV9 A;  2MGS A;  2F0V A;  1GJX A;  1K83 B;  3VYS A;  4DAP A;  1SNO A;  2RKS A;  4KHV A;  4RWS C;  2WII B;  5A2Q L;  2K5D A;  2VB2 X;  1LO5 D;  4A3J B;  1MSH A;  1BXT A;  4KD4 A;  3SR1 A;  5JEA G;  1GHJ A;  4A3F B;  1CT1 D;  3NP8 A;  1HUN A;  3JAM E;  1OXV A;  2GA4 B;  1AZP A;  4R9W A;  2AUJ D;  1ILP A;  5IT9 E;  2NBF A;  5IGB A;  1EWH A;  3KLS A;  2KQ3 A;  2IPK D;  1VMC A;  3D31 A;  1QNK A;  3QG1 A;  4DAY A;  2EY6 A;  2EYP A;  5A35 A;  1ET6 A;  3IFT A;  1PTO F;  1VF7 A;  2JA7 B;  3PUX A;  1SFO B;  1I4P A;  3FEW X;  4PNY A;  3C46 A;  1Q90 A;  1Y1V B;  5EKK A;  1B4O A;  1EY7 A;  2E2H B;  1R4Q B;  2DY7 A;  5DM7 3;  1G29 1;  4KMU C;  3VYR A;  5FKA C;  2R93 B;  1U9R A;  1STB A;  1F9S A;  4ZUI A;  3GTQ B;  3R3O A;  3WOF A;  3E0J A;  2EE1 A;  1EU3 A;  5BN5 A;  4S3S A;  3K59 A;  1T5X D;  3QJY A;  2NUC A;  1CFM A;  1S5B D;  3R8B A;  1UAP A;  5FK9 C;  4NW2 A;  3OWF A;  5EKL A;  2PZW A;  3EFX D;  5E1F A;  2QDB A;  1SAP A;  3FMC A;  4CKC A;  3J80 E;  1ICW A;  1S5F D;  4R8N A;  2B2W A;  1EEF D;  2QKI C;  1LT4 D;  2J4X A;  1JWS D;  1HRJ A;  2EYM A;  1PZJ D;  4XT1 B;  4HSP A;  4IN3 A;  1F2Y A;  3DUZ A;  1O7Z A;  2WKC A;  3K58 A;  3CQZ B;  4OO1 H;  3VYU A;  4QCL A;  5IGG A;  2E76 C;  2B2U A;  1SYG A;  1G8Z D;  2WB1 B;  3MXU A;  1H9M A;  1II3 A;  1TKW B;  1D2B A;  1S4Z A;  3CHB D;  3I91 A;  1FD7 D;  1A3T A;  2TMP A;  1QIL A;  4K6L A;  1ML0 D;  5I2Y A;  2QIL A;  2KOL A;  1JOR A;  1D6E C;  2MJ8 A;  2ID0 A;  1TS3 A;  3VYT A;  3JAM L;  1Q12 A;  4RKB A;  2AQ3 B;  4C3I B;  4PV1 C;  3H94 A;  2IJ0 A;  1BO0 A;  3DM1 A;  1F9P A;  1TY0 A;  4L8J A;  1B2T A;  1B3A A;  3RZO B;  1KAA A;  1OXU A;  4E6I A;  4TRD A;  2F0H A;  2OXP A;  4J1M A;  2L11 A;  5C0X G;  1J8I A;  3P1H A;  3EA6 A;  1SSO A;  1DZ1 A;  1BNZ A;  4O42 A;  1WD0 A;  1LTS D;  2EXZ A;  5C4X B;  3MHB A;  4BY7 B;  2B2V C;  2IW3 A;  3TZD A;  1GHK A;  1JWU D;  2AWN A;  4DF7 A;  4FXG C;  1K8M A;  1WTR A;  1SBB B;  1MSG A;  5T1G A;  2EJM A;  1TY2 A;  1EY9 A;  4LK1 C;  2F0W A;  4C3H G;  2EJF C;  3GTK B;  3OIP A;  1IKM A;  3I8Z A;  4DA2 A;  1TS4 A;  1FR3 A;  1A3V A;  2B2T A;  3OMC A;  4L63 B;  4RCN A;  1L0Y B;  1BCP D;  4LAA A;  3A55 A;  4FXK C;  1Q3L A;  4XQJ A;  3BG3 A;  1JCK B;  2F0J A;  2EDG A;  1BCP C;  1KTK A;  3HZX A;  4EQO A;  2JA5 B;  4QMG A;  3J81 E;  4Q0F A;  4XTC S;  1D5Z C;  4YIJ A;  3WDN A;  2EYJ A;  3BZD B;  4HCE A;  2KA7 A;  1YNJ D;  3ERQ A;  3NSW A;  2Q8T A;  1ZEQ X;  1YNJ C;  2C9O A;  3FDT A;  1PRT B;  2NZ1 D;  4FXD A;  1DYQ A;  3T13 A;  4K5X A;  1HFG A;  3Q23 A;  1FNW A;  4DK1 A;  3J80 L;  2K1B A;  5I9O A;  1WTO A;  2PYK A;  2ZXR A;  5E4W C;  3G7L A;  4F88 A;  2IX1 A;  1TR5 A;  3J7A F;  4HTH A;  4A3M B;  3PUY A;  1AW7 A;  2F0K A;  1F9R A;  2CQA A;  4IFD J;  1ESR A;  2XSC A;  2IX0 A;  1I4R A;  1TS2 A;  4ODG A;  5EQ0 A;  1DOK A;  1RCV D;  3T53 B;  4IUN A;  4JK1 C;  4FF1 A;  1SYF A;  1EY0 A;  4IFD I;  3PV0 A;  1SE3 A;  1JOO A;  1DON A;  1STA A;  4O1N A;  3TZU A;  2F0U A;  3EJI A;  2RBM A;  4ZRZ A;  3MVV A;  3NQI A;  3NPP A;  3URY A;  3N52 A;  1HHV A;  1BBX C;  4BA2 I;  1TU2 B;  3MXP A;  4C56 C;  3D8G A;  3GO5 A;  2F1M A;  3TME A;  1I50 B;  4WJW A;  5CMD A;  4J8Q A;  2WKD A;  2KVM A;  2NN6 I;  1PZI D;  4B9X A;  4XXE A;  2LFN A;  3RMH A;  1H9J A;  2XIW A;  1XYI A;  4A3G B;  3H09 A;  5K36 G;  5C3X A;  3HP3 A;  5IGC A;  1XTC D;  3PIP 3;  1ENA A;  2NVY B;  5D65 A;  3ND9 A;  2G9D A;  3OIQ A;  5C6A A;  3RZD B;  3SEB A;  1EWC A;  3S1M B;  1B50 A;  1S5C D;  3A8J E;  4IUP A;  3RD4 A;  2JP1 A;  1OXT A;  2K5W A;  2KHS A;  4BBR B;  3IFD A;  2JXM B;  4H44 C;  1A2T A;  3OSO A;  2D5D A;  3BDO A;  2K05 A;  4H7B A;  2PZT A;  5J22 A;  3D4R A;  3NHH A;  1NR2 A;  3I70 A;  1C4Q A;  4A3I B;  1W6J A;  3Q24 A;  2HQE A;  3P20 A;  3J81 L;  3J7Y W;  3TP6 A;  3SVM A;  2F0G A;  2Z4H A;  2F0I A;  2AQ2 B;  3S1Q B;  4RGO S;  1EOT A;  4HSV A;  2A69 D;  5FLX E;  5M9O A;  1AFP A;  2B63 B;  2F0T A;  5KNC A;  1BCP F;  1BOS A;  2A69 C;  2K04 A;  2FHT A;  3HOV B;  2F0P A;  1O78 A;  3W2D A;  3K5M A;  1SYE A;  1STG A;  1ENC A;  5K5P A;  2NTS A;  2B2Y A;  2SEB D;  2E2I B;  1R4P B;  2LKV A;  2HCC A;  2VUM B;  3S1R B;  4CKE A;  3J7A V;  2BCO A;  3ND8 A;  5JAV A;  2EJG C;  1EYC A;  1RKN A;  1BUV T;  5C3E B;  5CR3 A;  3KLR A;  2L9H A;  4KI0 A;  1Q1B A;  5IOD A;  4ZKB B;  1G2S A;  3K6O A;  3BS1 A;  3FKI B;  5F2D A;  1LTB D;  1SYB A;  3S14 B;  1CA6 A;  3D6C A;  4G7H C;  1DXM A;  3HS0 C;  2NWG A;  1KNA A;  3K57 A;  2B2W C;  3PMF A;  1H9S B;  3NWS A;  2I46 A;  3RUZ A;  1A2U A;  2PPB C;  5TSS A;  4BY1 B;  1B9M A;  3I4M B;  2K32 A;  5C44 B;  5ELD A;  3S2D B;  1S5E D;  1U4P A;  2AQ1 B;  2RDF A;  4ILW A;  3FPU B;  1MD2 D;  3OHX C;  2EY2 A;  2ENB A;  2B2U C;  5JJZ A;  4IUT A;  2OF1 A;  1RDP D;  1STN A;  2HDM A;  2SDF A;  3H6M A;  3FPP A;  2K33 A;  2EPB A;  2VXW A;  3SHL A;  4C3H B;  1HTP A;  4RHR A;  3NTI A;  4A3K B;  1ZXT A;  1NAP A;  4RFB A;  1V8Q A;  1F2L A;  3V05 A;  3S16 B;  2F0L A;  1Q1E A;  3VA5 A;  2F03 A;  1SNM A;  2XVS A;  4U68 A;  1HPC A;  1HA6 A;  4IFD G;  2B39 A;  4RAU C;  1KAB A;  1PFB A;  3A7A B;  2L12 A;  4QB4 A;  3R2T A;  1FYC A;  1CK1 A;  4OO1 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...