2EDGA

Solution structure of the gcv_h domain from mouse glycine
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
130
structure length
130
Chain Sequence
b'GSSGSSGRKFTEKHEWITTEEGIGTVGISNFAQEALGDVVYCSLPEVGTKLKKQEEFGALESVKAASELYSPLSGEVTEVNEALAENPGLVNKSCYEDGWLIKMTLSDPSELDELMSEEAYEKYVKSIEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycine cleavage system H protein
publication title Solution structure of the GCV_H domain from mouse glycine
rcsb
source organism Mus musculus
molecule tags Biosynthetic protein
total genus 16
structure length 130
sequence length 130
ec nomenclature
pdb deposition date 2007-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01597 GCV_H Glycine cleavage H-protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2edgA00
4I7ZC 2A68D 4DNTB 3PUXA 1LABA 2JEBI 2A68C 3QG1A 4KN4C 2B8GA 1GHKA 1CTMA 4H0LC 2LMCB 3VR4A 3VR6A 1K8OA 5KNDA 3P20A 2IT1A 1GUTA 1Q12A 3MXUA 2K7VA 4OGQC 1OXUA 1B9MA 4GZYC 1A6XA 2EJFC 1HTPA 1Q90A 1FYCA 3I73A 3U9SA 1SMYC 4KKTA 3M7NA 3IKJA 1HPCA 3FPPA 1I6VC 1GHJA 1BDOA 1GUGA 4RCNA 2YYZA 4KKSA 1E2ZA 1CFMA 5KNCA 1H9JA 2JXMB 3H94A 1QJOA 3T51B 2CW0C 1Z6HA 3T53B 2EJMA 2A6HD 2KCCA 3OPOA 3OW7A 4OO1G 4KN7C 3AB9A 2B8FA 4IQZA 5JEAH 2PNRC 3ND9A 1Q1EA 4KHZA 2D62A 2AUKA 2A6HC 1GUOA 1OXSC 2DNCA 4H13C 2V4DA 2A6ED 2EDGA 2K32A 3CRLC 4DK1A 5JEAG 1Q1BA 1G291 4G7ZC 1Y69U 1H9MA 1GUSA 4BA1I 2K33A 1H9KA 1V43A 1ONLA 3BG3A 2A6EC 3VR5A 5BN3A 3A8KE 2JEAI 1H9SB 3PUVA 1E2WA 3HGBA 1YNNC 1VCIA 2D5DA 1GJXA 1Y8NB 2BE5D 1EWHA 1IW7D 1TKWB 2BA0A 2E74C 3NE5B 5BN4A 3VA7A 3L7ZC 2O5IC 3I4LA 4KMUC 1Z7TA 3PV0A 2R6GA 4LJZC 1IW7C 1O7LA 3EQLC 4KKUA 3N6RA 4HR7B 2NN6H 3LNNA 3PUYA 3GQBA 3OOCA 3FMCA 1OXTA 1DCZA 4TKOB 1ZKOA 2DN8A 4DNRB 1FR3A 1YNJC 3IFTA 1V8QA 1VDZA 2NN6G 3KLRA 5K36H 3TZUA 1K8MA 4XTCS 1OXVA 2PCFB 1H9SA 2JE6I 1HCZA 3BDOA 3M4YA 2EVBA 1Y8PB 4H44C 1PMRA 4IFDH 4JK1C 3WDNA 3QIAA 3VR2A 2Q8IB 4L8JA 5A35A 4KI0A 3VR3A 3QJYA 5BN5A 2EJGC 1Y8OB 2NN6I 3D4RA 5KNBA 3I72A 4LK1C 2AUJD 3A8JE 4G7OC 2E75C 1ZYRC 4PV1C 1IYVA 1DXMA 3A8IE 4DK0A 2BE5C 1HQMC 2O5JC 1GUNA 2D2CC 4G7HC 2PPBC 1T5EA 3LWUA 3PUWA 4XIGS 3ND8A 3SDZA 1E2VA 1CI3M 5C0XH 2AWOA 3W3AA 3RLFA 3A7AB 1VF7A 2BA1A 3CRKC 4BA2I 1OXXK 1O78A 5C0XG 1LACA 3PUZA 2ZT9C 3SE0A 2QF7A 1IYUA 2F1MA 3D31A 3GD7A 3MFYA 2A69D 2E76C 2BDOA 3M85A 2DNEA 1VF5C 1TU2B 1H9RA 4OO1H 4JBWA 5K36G 2A69C 1DD2A 1B9NA 3DXJC 2KA7A 4TQUS 4IFDG 2L5TA 3T56B 3A7LA
chains in the Genus database with same CATH superfamily
2AQ2B 4WFN3 2JQOA 1RCVD 4X65L 3NPPA 2RCNA 3FP9A 4UHVA 1HH2P 4V190 1IKLA 1SYFA 3TS0A 1SXTA 1U9RA 1TWCB 2F52A 3I4NG 1K8OA 4NDXA 4A3KB 1A62A 4IFDI 2PI2A 3L0OA 1JMCA 4IJLA 2EYMA 4U68A 1B44D 1SMYC 4O1NA 2NVQH 2F0IA 4ODGA 3J80i 4JV5Q 2JP1A 3CC7A 4LF4L 3I4MH 1VS0A 4IUQA 4DNIA 4RCOA 5AFWA 1JT8A 1Z6HA 3QWNA 1EU3A 1SROA 5M5XB 3KDFB 5F2DA 3SGIA 2B8FA 4IQZA 3ND9A 3X3MA 5M3FH 4DV0L 2A6HC 3UDXA 1OXSC 1O7ZA 1V1PB 3V2TA 5DNFA 2A6ED 5FK9C 3G4SA 2Q2TA 4C3JH 1G291 4BBRB 1AEXA 1YITA 4UAIA 2D0OA 1E22A 4C3IH 1IZ6A 3HOUG 2H5XA 2E5LL 2D9UA 3S1MB 2KVMA 5FLXc 2HCCA 3V05A 1VQ4A 3PO3B 1RDPD 1PV4A 2R93G 4C3HG 5GAHC 3H0GG 3GTPB 1A3VA 1LT5D 4K2LA 2YTXA 4N8X1 1CM9A 4NB3A 2RDHA 2WKDA 3K5NA 1TIID 2XSCA 4DUYQ 2R92H 1FR3A 5AJ3L 3J7AV 2HQLA 3J81c 3TSSA 2F4IA 3ONAB 1D5ZC 3IL8A 4IPGA 1EEFD 2K5QA 4R4TA 3DM3A 1EY4A 5D3IB 3K0XA 5BR8L 5EAYA 3EIVA 1B7YB 4JI3L 3L2PA 3E0JA 5A2QE 2PW5A 1IYVA 3BZKA 5C5LA 5C5MA 2EOTA 3DMUA 4A3MB 3EJIA 4JI1L 2EYOA 1WTXA 4JBKA 3J7A5 1CKOA 2CH4W 5J22A 2JA5H 3GTOH 4GNXC 3M7GA 5IWAQ 2H1EA 2YTYA 3SK6A 4CGYB 2EY6A 4A3GG 4Q0FA 1E7ZA 1AW7A 1EQTA 1PHJA 2A68D 5EKLA 3S2HB 3BU2A 1M4VA 2F0EA 5EKIA 1S40A 2PQAB 3TDQA 2SNSA 3GTGH 1PTOD 2HUGA 1GHKA 3P20A 3R2TA 1BNZA 2IW3A 1ZXTA 4YCVA 4DPGA 3U4VA 2JA6G 1NSNS 2K28A 1KAWA 1GHJA 1WJJA 1XMOL 1XX8A 1GUGA 3KUPA 2WB1E 2R7ZG 2MO1A 1M8AA 1H9JA 2JXMB 4A3JB 2WAQE 3BS1A 4X3TA 4F88A 5C4ZA 4NXNL 4A3LG 3AYHB 2ENBA 1SYBA 5FLXE 2UXCL 4DUZL 5DM63 2K5HA 4RAUC 1D7QA 4KJOA 4XDXA 1GUOA 2DNCA 4Q5VA 1WD1A 4BWGB 2WINB 1E24A 1R4QB 3K59A 3G6EA 1N36L 4DR4Q 2K33A 1QZGA 3PO2H 4WJ4A 4C3HB 4WRDA 1E2WA 2I46A 3H0GB 3J81E 2F0QA 4OXPA 1N32L 3CXCA 3TEHB 3S17H 2WP8J 1CSPA 1V1QA 3I4LA 4HIKA 4KY7A 2ZM6Q 1TWFB 2HQEA 4L5QA 3CKIB 3RD4A 3NWSA 3TP5A 3I4MG 1PTOF 4TRDA 4JI2Q 4IUTA 1N33Q 2EYHA 4XTCS 4JI8Q 5M3FG 1XNRQ 1NR4A 1HR0Q 3PF4A 1GVPA 1YZ6A 4C3JG 4KI0A 1SN8A 1XTCD 2Z6KA 4DV5L 2RCFA 1KLGD 4C3IG 4XQNA 3EBEA 1YHAA 1GUNA 4CDDC 4JOIC 1E2VA 4IUNA 4A76A 1IYJB 4EX5A 3H3VC 4JYAL 3SR1A 3J7AF 5IYCH 2QA4A 2NZOA 1B8AA 3UE0A 2SNMA 1VF5C 2R92G 1B53A 2N3SA 4JI4Q 1U0LA 4APVA 3HOWH 4DV6L 2QW7A 2N55A 4MHEA 2RKSA 4L63B 1JCKB 2CKZB 1B4OA 2UXBQ 2JA6B 3K58A 2KUMA 2GVAA 4BY7H 3EROA 1F77A 3BYYB 1YJWA 1DM0B 4JI5Q 5EPJA 2V1CC 1KDAA 3LX0A 1WTRA 1STYA 1SBBB 4JI6L 2EPBA 1I94Q 3CP0A 2NVYH 2UUBQ 1CFMA 1EZ6A 2JA5G 4YWMA 2XTIA 4PQXA 3S1NH 3KF8A 1JR0D 3FVQA 4HJAA 4NXMQ 2PZTA 5E4WC 2QGQA 3KBGA 1LTAD 3TN2A 3I8ZA 2B2UA 2F0MA 4KLKA 1EY0A 4DK3C 1FJGL 3FKIG 3QOLA 2JJQA 1J5EL 3GTMB 5BN3A 2NYZD 4R4OA 3W1GA 4B3SL 1A15A 1EWCA 2WV6D 1QB5D 3HRZC 2NVQB 3G48A 2PMZE 1DONA 3H6MA 5BN4A 1KC8C 1G8ZD 5C3EH 1PZID 1KIXA 1X32A 1IBKQ 5I4DA 5TSSA 3PUYA 3CCVA 5M3FB 2Q2UA 4TKOB 3IFTA 5ISRA 4LUVA 1OXVA 4B3ML 3BDOA 4LF8Q 1TS3A 3MXPA 2K52A 5CR3A 1EEID 1TXYA 1BO0A 2Z9HA 3ULJA 2EY1A 4HTHA 2XRSD 2VXWA 2YU9H 3PO2G 2VB3X 1ZYRC 3ITPA 1T9HA 2IL8A 4OIJA 4NPSA 1EOTA 2TMPA 2AHOB 3W3AA 1BCPD 2PW7A 1I5FA 3BZCA 2R92B 1KDCA 5IY0A 1SE8A 1HZAA 1V9PA 4A93H 2QCPX 2A1AA 1E1OA 3S24A 4JI7Q 4C2MH 3DXJC 1EIYB 1JORA 4JV5L 4LF5Q 3R2IA 1UUPA 1VQOA 1DJRD 1HXYD 4ME5A 5IGDA 2DUDA 1SNDA 1PH8A 4HJ5A 5HGQA 2WB1G 3TQYA 2IT1A 1PLFA 1DOMA 2F0NA 2WAQG 1B9MA 2JA5B 3STBC 2L11A 5BR8Q 3MWYW 4U673 4X3UA 2PZWA 2DY8A 1X65A 5IYCG 2F0WA 3QO2A 1YIJA 3NELA 3K5MA 1Y1WH 3TP8A 1WTOA 4LFCQ 2CW0C 3RUZA 2LSSA 4PZ6A 2IHFA 2J7ZA 2ZJPA 1Q1EA 4KHZA 1BCPF 3RZDB 3HOWG 4ZKCB 1I4GA 1ET6A 4OIKA 1HA6A 2KHIA 3GTGB 3S14B 4DA2A 4J8QA 4DUYL 1AN8A 4DV3Q 4OWTB 3T16A 4BY7G 1FNUA 1F2MA 2L15A 4R4IA 1PFBA 1MSHA 2GA4B 4AYBE 4K14A 5JPMC 5EBDA 5T1GA 4CJ2C 2ID0A 4P73A 3EQLC 2B3GA 4IPDA 4OELB 4IUVA 1SE4A 1AFPA 3ZYYX 1YNJD 1YVCA 3TZDA 1WCMH 3P1HA 2LFNA 2LXJA 2ZXPA 1XPUA 3KOJA 5DLQE 2CFMA 1K0RA 4LF7Q 2E2IB 4Y7NB 2B29A 2EY2A 4CKBA 1S72A 5IWAL 5ELNA 4LK1C 1ASYA 2SDFA 3KF6B 3F8TA 2E2DC 2LS01 1RKNA 4F87A 1HJPA 2AKWB 3AEVA 1EIHA 5C3EG 2Y0SB 1KXLA 4X62Q 2EY5A 2E8GA 2B39A 3CQZB 3KLSA 2Z0SA 5EPKA 4DAYA 1CKNA 1MJEA 3TP7A 4GZYC 3CCEA 4A3IH 5C3XA 1TU2B 4IOCA 4A3DH 3RMHA 3A54A 1AE2A 2NVTB 2OCEA 4A3FB 2HIXA 2WAQB 1W3SA 3D0FA 3QG1A 3J81j 1L0XB 1GUWA 5LHY1 2HCIA 3VYSA 3KFUA 4KTAA 2CQAA 2EJFC 5CBEE 1BR9A 2XGTA 1VQIA 4P74A 2VS1A 4DR4L 3FEWX 4KKSA 1F2LA 1RODA 4K8IA 2A74C 3ZJYC 1WTVA 3OIPA 1SR3A 1U4MA 3F2UA 1K28A 3CCLA 1NMGA 4GKKQ 1VMPA 1Q82C 2L9HA 2QEJC 3E5SA 4H13C 3VA5A 2ZM6L 3HOUH 4DKAC 1S5FD 1WFQA 2LXKA 4PMCA 5IGEA 1YNND 2A6EC 2JEAI 4JI2L 3W5OA 1LO5D 2IX0A 1N33L 1BBXC 2ICEC 2MJ8A 5I2XA 3U50C 4JI8L 1XNRL 1T5XD 2BE5D 1HR0L 4L5SA 2UU9Q 2NVYB 3K7UC 3WOEA 3PSIA 4HR7B 3OW2A 1C0AA 1IL2A 1Y1WG 5M3MB 1AZQA 2M2LA 2OT2A 1TR5A 3R3OA 4P75A 3H3VI 4BBSH 1K8MA 1L1OC 1NTGA 3D8GA 4GOPB 3MC0B 1CZGA 1HCZA 1MSGA 3KLWA 3R8BA 4IOAA 4X64Q 3QR8A 3V96A 1PFMA 2EJGC 4QUFA 1LT6D 3P75A 5CV4A 2K14A 5C3EB 4JI4L 2O5JC 3A74A 5GROA 2ZTCA 3SDZA 4ABNA 3LWEA 3HKZB 2UXBL 1UEAB 2I5HA 2K04A 1DZ1A 1WCMG 1ILPA 2JA9A 2I5MX 1SSOA 4GLXA 4JI5L 4UY8C 1JOKA 4GNXA 4GN5A 5ELFA 1BCPB 2PNHA 3RR5A 1I94L 2UUBL 4DXFA 1B1ZA 1X3PA 2JEBI 4K8JA 2A68C 1NCVA 3UDGA 3JAMc 3DHQA 4B3MQ 4NXML 4KHPQ 1P8LA 4PZ8A 2VW9A 4B3TQ 1PTOC 3KK7A 2ES2A 1PH4A 2ZXOA 4GN4B 3M3YH 1WYDA 3NXWA 4A93B 4QB4A 1E2ZA 3T51B 4OEMB 2F3VA 5KIXA 5I2YA 3NQTA 1VQ7A 4I65A 1BKBA 5IT9c 4A3DG 3AQQA 4JC0A 4DR3Q 1KNEA 5D65A 2EYLA 1IBKL 1V1OA 4G7ZC 2AQ3B 1TWGH 3DEOA 4PG3A 5C4XH 4AYBG 1STAA 3MHBA 3BVZA 1MJCA 1Q81C 2F0GA 4LF8L 1IW7D 2OQKA 1F9PA 1VQFA 1G91A 1P16A 2XRQD 1Z7TA 2R6GA 2IPKD 2CH4A 1EYGA 4ZCKA 1PH6A 3T4AC 3OOCA 1FL0A 4B08A 1UWVA 1YJNA 4PNYA 2RVLA 1GO3E 3TZUA 2OEOA 2JE6I 4TSSA 4CJ1B 1J6QA 5A2QL 4A75A 2B63H 2B2YC 2KJXA 4YWKA 4ILWA 4KV6A 4XQJA 4CJ0B 2AUJD 4DR2Q 1Y1VB 4JI7L 1B2TA 4RHRA 4QIWE 1M1KC 4LF5L 1LTBD 1CSQA 1PFNA 3BVGA 4A3BH 1WOCA 4HIOA 3NSWA 4WORA 3E9HA 3K6OA 4WJWA 4KJNA 3JAME 4DV2Q 3SE0A 5C4JH 1VQDA 4CDFC 5GAGC 1K3BC 1PFSA 4AH6A 2G5DA 4BBSG 1KDBA 1EIFA 2RHQB 3M4QA 4X66Q 4N9PA 3HOZG 4I7ZC 1ENFA 3PUXA 4LFCL 2F0TA 1O7IA 4KN4C 3LGJA 5H1SE 2HDLA 3HOYB 3JC66 1VQMA 2A5HA 5CV6A 4KHVA 5IT9E 2AMCB 2K7VA 4CKEA 4Z9CB 5I9OA 2FMCA 1ENAA 1Q90A 4XYOA 4NP5A 4ZYSA 3OSOA 2L4NA 1PH7A 1R9TB 4A3IB 5FLXL 3VYRA 1SE2A 1Q7YC 4HJ9A 2FHTA 2YYZA 2HHHQ 5IGCA 4DV3L 1RHPA 3S1RH 4A3DB 2RBMA 2IX1A 3T53B 4OX9Q 3M4OB 3K5LA 1PA6A 2Q8TA 3FKIH 3I4NB 1O7YA 1SDFA 4AYBB 1I6HH 3PGZA 4NKLA 2V4DA 3BYTB 1WTWA 3NBHB 3J81L 3PMFA 2KQ3A 5CBAE 1FVIA 1Q86C 2F0VA 1FNWA 4DXGA 3F2DA 4L6TB 5LMNQ 2D5DA 1K8GA 4OWWB 4LF7L 1MHWC 4RA8A 2BA0A 1QG7A 1HNXQ 2FXQA 2JYOA 3VYTA 3DWQA 4ZKBB 1KHIA 4KKUA 3MEFA 4OONA 5E7NA 4UP8A 3MAQA 4DNRB 4S3SA 3HOUB 2KCNA 4LMQD 4ZRZA 3F1ZA 4ME3A 1TVXA 2Z8LA 1X55A 1PMRA 3MXNA 4X62L 2R93B 3BDCA 5A35A 5HY6A 2BOSA 5ELOA 1J8IA 5C4XG 3TS2A 4FXDA 2A8VA 4AIMA 1VQ5A 1PYBA 1JQYD 2K4KA 3O13A 4PV1C 1D5XC 1JWMD 3QOJA 4JPBW 4DK0A 1C4QA 2VL6A 4R8IA 3M4PA 3HKSA 1UE7A 3NQIA 1K9MC 2E2HB 3I4OA 3GO5A 4QCLA 1XTDA 2CWAA 2TSSA 3NBHA 3CRKC 3GDEA 2ZT9C 1NJIC 4LF9Q 3D31A 1R4PB 4GLVB 2CVRA 4J1MA 2Z4IA 2RA4A 2Z6BA 4DAPA 2VQFQ 2K5NA 4EQPA 3KF8B 5IP7H 1AP0A 1KNAA 2B2WC 1JE5A 2B63G 3QB3A 4TVAB 1XNQQ 3A5UA 2GVBA 4GKKL 3IFDA 5JOBA 4OO1I 3ULLA 3S16H 3ICEA 3SXHA 2SOBA 3U9SA 4A3GB 1UAPA 3PIOA 3FPPA 3C1EA 3K5OA 5FJ8H 1EQVA 4A3BG 1BDOA 4UP9A 1EY9A 5KYLA 3T1HQ 5C0XJ 2G9HD 1QILA 4IALA 3HP3A 1A2TA 1CKMA 2VUMH 2KECA 2UU9L 2F0PA 2D62A 3J81i 1CT1D 3S15H 5KGUA 1FD7D 2EDGA 5J1ZA 4LAAA 1RF2D 2R7ZB 4QGUA 2F0UA 4IUUA 4JBMA 1EWIA 4ZK9B 3GTLB 3VA7A 4X64L 2P5ZX 5IGFA 3TBIB 1I50B 2MNAA 1KTKA 2QEXA 1O7LA 1RTOA 3PIO3 4YIJA 2OQ0A 1G2SA 4QY7A 1SYEA 1SFOH 2MGSA 1YNJC 2JK8A 2NN6G 5M5YH 3E6ZX 1D6EC 1WVLA 2PCFB 4XQQA 2EVBA 1CQVA 3N52A 1C48A 1L0YB 3PIPA 3DEPA 5K5PA 4DV7Q 1TY0A 3AFQA 2NN6I 1L0WA 1MBYA 3A55A 5FO7B 3I4MB 4GKJQ 4G7OC 1A8VA 1HQMC 1STBA 3Q22A 2O2LD 3BVMA 4XIGS 3ND8A 3D3RA 3AFPA 1QOHA 1WTHA 4HCEA 1VF7A 3MA2B 4RGMA 5EKKA 3Q8DA 3GV3A 4YY3Q 1HRJA 3OMGA 2N8NA 4KK7A 4C3JB 3D4DA 1OXXK 4CBVA 4FNFA 5C0XG 4ALPA 4KHPL 3MFYA 2PYKA 4C3IB 4MZ9A 4B3TL 1LTRD 2PQEA 2VZAA 2F0JA 1NAPA 2BH2A 2JA8H 2KA7A 3HZXA 5C0XI 4JI0Q 4DNTB 4HJ8A 3CHBD 3A56A 4RGTA 3GTJH 1SEBD 3VR6A 2A73B 1EIGA 3MXUA 3AU7A 4DR3L 2KBNA 4DFAA 1IBMQ 1IHZA 5C4JB 3CC4A 1I6VC 2ALYB 1OTCA 1QNUA 1TWAH 1KRTA 1SNMA 1STGA 4DR5Q 3RZOH 3I3CA 3HOVH 2F0SA 1J9OA 3VDYA 1X3GA 1A3UA 5LMNW 1SYCA 3PF5A 4QL5A 1VMCA 2VQEQ 5IP7G 1VQLA 1BBWA 1LT3D 1KAAA 1W6KA 2L55A 2Z4HA 1ENCA 3I2ZA 3E3XA 3GV6A 3GTOB 2K5WA 1YNNC 1VCIA 4C1NI 3H3VH 1GJXA 4DN4M 4XT3B 3S1RB 2RHSB 1Z9FA 4B3RQ 4FVMA 3CCSA 3OTOQ 5CV7A 3WOFA 5I9PA 4XXEA 5FJ8G 3FKIB 1JWUD 1TWCH 1NMFA 1OXTA 4GN3B 4DR2L 3RLNA 1F2YA 3FHWA 1I4HA 1VQBA 3I56A 1Q46A 2VUMG 1EYAA 4A3CH 4QIWB 5IIFA 5LMUQ 4CKCA 4DAYB 1CKNB 1H9SA 4OHJA 2L1BA 5DM73 2XWBB 4UP7A 4DR6Q 1A3TA 3BJUA 3H91A 4K2KA 1KD1C 1C8CA 1I4XA 1SYGA 5FO8B 4DV2L 1EFWA 5KNBA 1L1OA 3DWPA 2JN4A 1HNZQ 1QNKA 3A8JE 1AH9A 3EN2A 4M1UB 3OMCA 3J7ZC 4POGA 3NTKA 3CC2A 3T1YQ 1JB3A 2F0OA 1PRTD 3MVVA 4X66L 2FFKB 4MTKA 1BUVT 1HHVA 4RWSC 1LTGD 1O78A 1JC7A 3HS0C 2J0TD 3ER0A 4DR7Q 3PO2B 1XMQQ 3K0YA 4OWXB 2FINB 4JBWA 2IY5B 1QUQB 2K03A 4O2DA 1B9NA 2B2UC 1UEBA 2K5VA 3S17B 1C7YA 3CCRA 1JJ2A 2HHHL 1BBUA 2MPMA 5IODA 1G2TA 4OX9L 3MTSA 1I4PA 3H09A 4QQBX 1G51A 1CTMA 2NTTA 4H0LC 2R61A 1VQKA 1GUTA 2HD3A 1JJGA 1X9NA 3VYUA 2DY7A 1CUKA 1C9OA 3OIQA 1TS2A 1EZ8A 4UPAA 3SK4A 2ZTDA 4NMZA 3MZ5A 5LMNL 1PYWD 1U4LA 1SNOA 2QDBA 5M5WH 1PRTF 1HNXL 2WB1B 2D0PA 4A3MH 3G71A 2JA8G 3URYA 1F9QA 3CRLC 1Q1BA 1Q8KA 1Y69U 4J15A 2SEBD 1E0BA 1CK1A 3HGBA 1PH3A 4FF3A 2ATWA 1QUQA 1Z47A 2VB2X 1X3QA 5LL6X 1VQ9A 3HOWB 1IW7C 4LFAQ 2VUMB 1BVSA 3LNNA 5JPNC 3I91A 3HOVG 4HJ7A 1PH1A 3GTQH 1IL8A 4BY7B 3CCJA 1SLJA 1XWEA 2EYFA 3CU7A 3CMAA 5EPLA 3I55A 4K6LA 1BQQT 3CCUA 1U4RA 4RGOS 4A3JH 4LF9L 4GNXB 5GADC 1YHQA 4R4QA 3OHXC 3S1NB 2A19A 2B2YA 4G57A 2PPBC 2VQFL 1EY8A 3NEMA 3G6JB 2X6LA 1VQGA 2F3IA 2DJGC 5FKAC 3RLFA 5ELCA 4LUZA 3UDFA 1QVCA 1SFOB 1XNQL 1RTNA 5M5YB 4BA2I 3PUZA 3W1BA 1IYUA 2A69D 3HOZH 3SEBA 4A3CG 1CA6A 1F2ZA 2B2VC 2X6GA 4TQUS 1E3PA 3FDTA 5JEAH 5IYBG 2OWOA 3SHLA 3S2DH 1Q3LA 1MD2D 1LYLA 3T1HL 3C46A 2LMCB 2UUAQ 1ILQA 1SMXA 4CHTB 1PYSB 1OXUA 1KQSA 1SNPA 1K83H 1JOQA 1LTSD 3I73A 3IKJA 1HPCA 2MO0A 2K1BA 2F4VQ 1TT2A 1S5ED 2I07B 1PXUA 4XT1B 4P2CB 1U4PA 1UE6A 1BOSA 4DAVA 1RIPA 1PVOA 2YU9B 1KRSA 3U9OA 2PNRC 3PO3G 4F7XA 1WTQA 2F0HA 4HSPA 1EFID 4DV1Q 4P71A 4DK1A 4R4CA 1ICWA 3EVQA 4BA1I 5GQOA 5CV5A 3A8KE 4ZUJA 2E2JH 1STHA 3GTKH 3H15A 5J39A 4F8MA 1PH2A 2OXPA 4K5WA 4LF6Q 1EL0A 2N88A 3MFGA 4IURA 4C2MB 1HA5A 3PV0A 1SNCA 4DV7L 2PMZB 4L5TA 1PZKD 4GKJL 1EUJA 2UUCQ 1Y14B 4EGVA 2XWJB 2DN8A 2PZUA 3DLLA 1VQ6A 5EJWA 1L2FA 4QJFA 4RMFA 2JSOA 4A3MG 5L37A 4H44C 4DK6C 4YY3L 3QIAA 5JEAJ 4RKLA 3AMUA 3F2BA 3S9WA 1G6PA 5BN5A 1YHBA 3I72A 1CQFA 3NWTA 3IRBA 5FLMH 4YCUA 1Y1WB 1I4RA 3JAML 2EYJA 1X54A 2MP1A 4JI0L 1ZEQX 4GLAC 4K0KQ 5CV9A 4X6AH 4HEDA 1NBWA 5IGBA 1I3QH 5IYDH 3GTMH 2FMMA 4PZ7A 5KYIA 4KY6A 3DWAA 4LW1A 1LACA 3A5ZB 2XIWA 2E76C 2F03A 3C2PA 4OO1H 3D6CA 1PRTB 1IBML 1CHPD 1HZ9A 5HGTA 3TP6A 2NTSA 2L5TA 4DAMA 1YJ9A 3KJOA 4DR5L 2Q8RE 4FO2A 5IT9L 4HN7A 1UNSA 1IXRA 2NWGA 2RSOA 4A3JG 2RSNA 4YHHQ 4N9TA 4HMJA 2B2WA 4L5RC 2NVXH 1WCMB 4ULLA 1IBLQ 4IZ8A 2MQHA 1Q12A 2VQEL 4IN3A 1EYDA 1RL2A 3HEJA 1A6XA 4GS3A 4JOIA 3M7NA 3T13A 4YWLA 2KCMA 5E1FA 5J3BA 4G4KA 5ELBA 1HUNA 1X3FA 3OPOA 4LWCA 1NUCA 4PMBA 1S3OA 4DR1Q 2M9VA 4B3RL 3CPFA 3OTOL 4Y52H 3KJPA 2AWNA 1A0IA 5JEAG 2J4XA 1GKHA 2VY3A 5IGGA 1GUSA 2VNUD 1V43A 4EVOA 1YNXA 1S5BD 3PUVA 3MXNB 2BCOA 3K57A 2ZXRA 2EZVA 5LMUL 5I6YA 3NTIA 2QKIC 2I0QA 2O5IC 4DR6L 2HT1A 4O0AA 5JJIA 3KDFA 4EQNA 1EQQA 5IP9G 5D3DA 5M5WB 2NN6H 4FF4A 4CDCC 1HNZL 2B2TC 1DOLA 2F3WA 1V1PA 3J7YW 5I6WA 3EFXD 1ZKOA 3T1YL 1TWHH 3BDLA 1BXTA 1V8QA 1HFNA 4X3SA 2K50A 5K36H 3TMEA 1N34Q 3VR2A 2Q8IB 1GOZA 4YCWA 1PTOH 3KLSX 4DR7L 2E75C 4B9XA 1XMQL 3JAMi 1DXMA 3E9IA 2Y0SE 3F2CA 3RZDH 2OF1A 4G7HC 1T5EA 5T1IA 3S1QH 1B3QA 2RDFA 3S14H 4GOPC 1CI3M 1FGBD 5C0XH 3U58A 3PQIA 3ERSX 2AWOA 4LUOA 3A7AB 3GTQB 1EYCA 1ML0D 2ZJQA 2HDMA 3EA6A 1NR2A 5E3FA 1LTTD 1DD2A 1LV9A 3K8AA 3OWEB 1II3A 3PCOB 4HMIA 4IUPA 2L0CA 2N78A 1HNWQ 2WIIB 3CW2C 4CDEC 5FLMG 3WWVA 3VR4A 1SMYD 3E0EA 1OO9B 1VQNA 2E2IH 4BXXH 4BBSB 1BCPC 1FYCA 1UE1A 4Y7NH 1G6ZA 5CORA 5IYDG 1SNQA 3KYHC 1DYQA 3HOZB 5C4HA 3H94A 3UDIA 1QJOA 2CQOA 2A6HD 4KD3A 4OO1G 1JE4A 4QUCA 4FYDA 3FRPB 3S2DB 1K0SA 2PQAA 2AUKA 4IPHA 4ZUIA 4HIDA 4BY1H 4LFAL 2K32A 3CQZH 5FOBB 1CA5A 5M9OA 4RHSA 3NTHA 1CHQD 1K83B 3ERQA 4FF1A 2Z1CA 3L7ZC 1RD9D 3HOXH 2NVTH 4LJZC 5JVG3 4A3FH 1JB7A 3N6RA 4EQ5A 2K01A 3FMCA 4M8AA 1YBYA 3UI2A 1EY7A 2ASBA 5JAVA 1VDZA 3NUCA 2UXDQ 5KEEA 2NB0A 4DV4Q 3M4YA 3GTKB 1SJED 2CWPA 2E2JB 1HTLD 3M3YB 1JJCB 1D1IA 1ESFA 3QJYA 5IE8A 4FF2A 4DGZA 3Q23A 1LM0A 3Q24A 1YEZA 3HKZE 1VQHA 2NBFA 3A8IE 3CF5A 4C1NK 2PI2E 4A3EH 1PDQA 1ASZA 1VQAA 4IJHA 1JICA 3HFZB 3I70A 3RLOA 4FXKC 1PRTC 3NBIA 1TWGB 5C4XB 2UUAL 3DM1A 3GD7A 2MHVA 2IJ0A 4K6DA 4E6IA 5K36G 2JA7H 1A2UA 1K73C 3CD6A 4HCSA 1HZBA 3A7LA 2F4VL 3OWFA 5M3MH 1X3EA 4AQYQ 3RNUA 2B8GA 2DJFC 3SK5A 1QVFA 2BH8A 2X69A 2YTVA 3P7JA 5KNDA 1I3QB 4OGQC 1WD0A 1HTPA 4DV1L 1MKHA 2KOLA 3C1FA 1XPOA 2F0DA 1O80A 1NY4A 4LFBQ 3I7FA 1QE6A 2F0FA 4FXGC 5KNCA 5C3WA 4X65Q 2B63B 4JG2A 2EJMA 2KCCA 4KN7C 4LF6L 2KEEA 2LY7A 1EY6A 2R7FA 1U5KA 3PIP3 2BDNA 3MXGA 2KENA 1MI2A 2UUCL 3OYYA 2NVXB 5JJLA 3K7AH 4A3BB 4LF4Q 1H9SB 1XPRA 3UE1A 1X6OA 1KABA 1VQ8A 4XYQA 3U4ZA 1EWHA 4ZAIA 1TKWB 1L1OB 4DV0Q 4BXXG 2EIFA 2RF4A 1PH5A 2KHJA 4A4IA 5DEHA 1LTLA 1SAPA 4I7AA 1MIUA 1GXDC 4J6HA 2WFWA 1D2BA 5C44H 3K81C 4QF4A 3C3LA 2Z6KC 1HZCA 2E5LQ 4K0KL 1K3RA 1W6JA 4FP5D 5D14A 4N8FA 3NENA 1KLUD 3NHHA 5ELDA 2Y0SG 4BY1G 1S5DD 1M90C 3VR3A 2K6AA 1LT4D 3CAMA 2GN5A 1QVGA 2L12A 2BE5C 5C6AA 2D2CC 5AJ3Q 1MGSA 1HQRD 1B3AA 1B70B 2WKCA 3HOXG 4A3KH 1I6HB 1TQOA 4A3FG 4H7BA 2WACA 3RN5A 1TWHB 4YHHL 1D5MC 3KBXA 1VQPA 5EBCA 1UE5A 1K8AC 5ELEA 2F1MA 3M9BA 1IBLL 4JI3Q 2BDOA 2DNEA 5IYBH 2IHEA 1HUMA 1CZWA 2K05A 1PTOB 2A69C 1BF4A 4HSVA 5M5XH 4KD4A 3T56B 3RN2A 4MNOA 4JI1Q 2EE1A 2C9OA 4NW2A 5CC4A 3S1QB 2B2VA 2KEDA 4BBRH 4DR1L 2I5LX 4A3EG 1QZHA 4PMWA 2Q2IA 4KY5A 2F0LA 1SE3A 1STEA 3ULPA 1LLRD 1JWSD 3S1MH 1EOVA 4RCNA 5NUCA 5FO9B 3PO3H 4H02A 1NE3A 4MIUA 1HR0W 2ZJRA 2NZ1D 1Y1VH 4MTNA 3GTPH 5HURA 1SRUA 1XJVA 1IKMA 1GD7A 4ZLTF 2JA7G 2R3ZA 1N9WA 1TS5A 1H9KA 1XMOQ 1ONLA 5M3MG 3VR5A 3R93A 1DOKA 4IO9A 3GP7A 1AE3A 4NXNQ 1S4ZA 4RFBA 2UXCQ 4DUZQ 1N34L 2M00A 1DGSA 4KMUC 1VQCA 4DF7A 2NZHA 2FJ2A 1I4QA 2XVSA 4QMGA 4RG1A 1AZPA 1N8RC 5CYUA 1N36Q 4JCVE 3HOYH 4R9WA 4V0BA 4BY1B 1EY5A 5JJKA 3I90A 2K5DA 3D4WA 1R9TH 3S16B 3DUZA 2EXZA 1N32Q 3HKZG 1EQRA 4IFDH 1Y8PB 4JK1C 3WDNA 5GAEC 4L8JA 1Q8IA 5DAUA 1ZYRD 3TRZA 3M4OH 1Y8OB 3D4RA 1F9RA 1XXGA 3I4NH 3HOXB 3J80c 4HIMA 3S2HH 1LUZA 1WTPA 2CCZA 4RH6A 2RDGA 3BZDB 2C5CA 1HNWL 1D8LA 1FNVA 3S15B 5COYA 1GM5A 3SVMA 2K75A 4DV5Q 2R7DA 3CCMA 1H9RA 1HFGA 2EQSA 2NUCA 5C44G 2MUYA 4JW0A 4IPCA 4A93G 5IOCA 1ICFB 3KF6A 2MFIA 3MEHA 2EYPA 4BS9A 2H4OA 1LABA 4A3EB 4JYAQ 3NP8A 2RQXA 4MN3A 3TREA 5G3LD 3Q6SA 2QDLA 2IX3A 3STBD 5CV8A 2IWHA 1SJHD 3G7LA 4JVZA 3FPUB 1FGUA 2R93H 3D6WA 4C3HH 4KKTA 3H0GH 4A3KG 4DV6Q 1KL9A 2CW0D 1STNA 4RKBA 3J80L 5EQ0A 1PH9A 2JA7B 1A63A 3OW7A 5CMDA 5JVH3 1TWFH 1QCBD 3AB9A 4B9WA 1B50A 4O42A 1XYIA 1ESRA 4LNQA 2E2HH 4UDUC 1QWYA 2F0KA 4IFDJ 4WJ3M 2DGYA 4P72A 1H9MA 3BG3A 4R8NA 4JI6Q 2PO4A 4FDBA 2KCTA 1SYDA 4RGNA 1ET9A 4JBJA 3CPWA 4BBRG 2UXDL 1LTID 1H95A 1Y8NB 2AQ1B 5IP9H 4DV4L 1EU4A 5EGTA 2E74C 3NE5B 5KRUA 3B6YA 1D1KA 5JJZA 2JA8B 2YV5A 1FJGQ 2QILA 2ZTEA 3GQBA 3CMEA 5G3LF 3L3OC 3W2DA 1YI2A 1JOOA 1J5EQ 1Y1VG 3J80E 1DCZA 1RJTA 4B3SQ 3GTJB 2OTLA 2EXDA 4DU9A 2HIVA 3KLRA 4A3GH 2O4XA 1TS4A 3K7AB 2B2TA 3NK9A 1NNXA 1W2BA 1WI5A 4ZQ3A 3A0JA 1E1TA 1VQJA 1TWAB 3IAYA 2N49A 2XNAC 3RZOB 3K80C 3HOVB 5CGKA 2Q2HA 4HAEA 1F9SA 2OTJA 3LWUA 3PUWA 2JA6H 4ID6A 3X3NA 4EQOA 5LL6S 4X3KA 5E4XA 2R7ZH 5C44B 4AQYL 4C56C 2C35B 2BA1A 4K5VA 3L9AX 4R1JA 2CHBD 1VQEA 3Q0AA 2LKVA 1TY2A 3HG9A 2QF7A 4GOPA 3HOYG 4A3LH 4OL7A 3M85A 3CCQA 2KHSA 2G9DA 1S5CD 3SK8A 3GTLH 1I50H 2ICIA 4K5XA 2XN9C 4POFA 4A3IG 1X56A 4IFDG 4LFBL 1PZJD
chains in the Genus database with same CATH topology
2AQ2B 4WFN3 1RCVD 3NPPA 4V190 1IKLA 1SYFA 1SXTA 1U9RA 1TWCB 1K8OA 4NDXA 4A3KB 4IFDI 2EYMA 4U68A 1B44D 1SMYC 4O1NA 2F0IA 4ODGA 2JP1A 4IUQA 4RCOA 5AFWA 1Z6HA 3QWNA 1EU3A 5M5XB 5F2DA 2B8FA 4IQZA 3ND9A 3X3MA 2A6HC 1OXSC 1O7ZA 1V1PB 3V2TA 5DNFA 2A6ED 5FK9C 1G291 4BBRB 1AEXA 4UAIA 2D9UA 3S1MB 2KVMA 2HCCA 3V05A 3PO3B 1RDPD 4C3HG 3GTPB 1A3VA 1LT5D 4K2LA 1CM9A 2RDHA 2WKDA 3K5NA 1TIID 2XSCA 1FR3A 3J7AV 3TSSA 2F4IA 3ONAB 1D5ZC 3IL8A 1EEFD 2K5QA 1EY4A 5D3IB 3E0JA 5A2QE 2PW5A 1IYVA 5C5LA 5C5MA 2EOTA 3DMUA 4A3MB 3EJIA 2EYOA 1WTXA 5J22A 3M7GA 2H1EA 3SK6A 4CGYB 2EY6A 4Q0FA 1AW7A 1EQTA 2A68D 5EKLA 3S2HB 1M4VA 2F0EA 5EKIA 3TDQA 2SNSA 1PTOD 2HUGA 1GHKA 3P20A 3R2TA 1BNZA 2IW3A 1ZXTA 1NSNS 2K28A 1GHJA 1XX8A 1GUGA 3KUPA 1M8AA 1H9JA 2JXMB 4A3JB 3BS1A 4X3TA 4F88A 5C4ZA 2ENBA 1SYBA 5FLXE 5DM63 4RAUC 4KJOA 4XDXA 1GUOA 2DNCA 4Q5VA 1WD1A 4BWGB 2WINB 1R4QB 3K59A 2K33A 4C3HB 4WRDA 1E2WA 2I46A 3H0GB 3J81E 2F0QA 2WP8J 3I4LA 4KY7A 1TWFB 2HQEA 3CKIB 3RD4A 3NWSA 3TP5A 1PTOF 4TRDA 4IUTA 2EYHA 4XTCS 1NR4A 4C3JG 4KI0A 1XTCD 1KLGD 4C3IG 4XQNA 1GUNA 1E2VA 4IUNA 3H3VC 3SR1A 3J7AF 2SNMA 1VF5C 1B53A 2N55A 4MHEA 2RKSA 4L63B 1JCKB 1B4OA 2JA6B 3K58A 2KUMA 3EROA 1F77A 3BYYB 1DM0B 5EPJA 1KDAA 3LX0A 1WTRA 1STYA 1SBBB 2EPBA 1CFMA 1EZ6A 4PQXA 3KF8A 1JR0D 3FVQA 2PZTA 5E4WC 3KBGA 1LTAD 3TN2A 3I8ZA 2B2UA 2F0MA 1EY0A 3QOLA 3GTMB 5BN3A 2NYZD 1A15A 1EWCA 2WV6D 1QB5D 3HRZC 2NVQB 1DONA 3H6MA 5BN4A 1G8ZD 1PZID 1X32A 5I4DA 5TSSA 3PUYA 5M3FB 4TKOB 3IFTA 5ISRA 1OXVA 3BDOA 1TS3A 3MXPA 5CR3A 1EEID 1BO0A 2EY1A 4HTHA 2XRSD 2VXWA 2VB3X 1ZYRC 3ITPA 2IL8A 4OIJA 1EOTA 2TMPA 1BCPD 3W3AA 2PW7A 2R92B 1KDCA 2QCPX 3DXJC 1JORA 3R2IA 1UUPA 1DJRD 1HXYD 4ME5A 5IGDA 1SNDA 2IT1A 1PLFA 1DOMA 2F0NA 1B9MA 2JA5B 2L11A 4U673 3MWYW 4X3UA 2PZWA 2DY8A 2F0WA 3QO2A 3K5MA 3TP8A 1WTOA 2CW0C 3RUZA 2J7ZA 1Q1EA 4KHZA 1BCPF 3RZDB 4ZKCB 1I4GA 1ET6A 4OIKA 1HA6A 3GTGB 3S14B 4DA2A 4J8QA 1AN8A 3T16A 1FNUA 1F2MA 1PFBA 1MSHA 2GA4B 4K14A 5JPMC 5EBDA 5T1GA 4CJ2C 2ID0A 3EQLC 4IUVA 1SE4A 1AFPA 3ZYYX 1YNJD 3TZDA 3P1HA 2LFNA 2ZXPA 2E2IB 4Y7NB 2EY2A 4CKBA 4LK1C 2SDFA 2E2DC 2LS01 1RKNA 4F87A 1EIHA 2Y0SB 2EY5A 2B39A 3CQZB 5EPKA 3KLSA 4DAYA 3TP7A 4GZYC 5C3XA 1TU2B 3RMHA 3A54A 2NVTB 4A3FB 2WAQB 3QG1A 1L0XB 1GUWA 5LHY1 2HCIA 3VYSA 4KTAA 2CQAA 2EJFC 5CBEE 1BR9A 3FEWX 4KKSA 1F2LA 1RODA 4K8IA 2A74C 1WTVA 3OIPA 1U4MA 3F2UA 1VMPA 2L9HA 2QEJC 3E5SA 4H13C 3VA5A 1S5FD 4PMCA 5IGEA 1YNND 2A6EC 2JEAI 1LO5D 2IX0A 1BBXC 2ICEC 2MJ8A 5I2XA 1T5XD 2BE5D 2NVYB 3WOEA 4HR7B 5M3MB 1AZQA 2M2LA 2OT2A 1TR5A 3R3OA 1K8MA 3D8GA 3MC0B 1CZGA 1HCZA 1MSGA 3R8BA 3V96A 1PFMA 2EJGC 4QUFA 1LT6D 3P75A 5CV4A 5C3EB 2O5JC 3SDZA 4ABNA 3LWEA 3HKZB 1UEAB 2K04A 1DZ1A 1ILPA 1SSOA 1JOKA 5ELFA 1BCPB 4DXFA 1B1ZA 1X3PA 2JEBI 4K8JA 2A68C 1NCVA 3DHQA 1PTOC 3KK7A 2ZXOA 3NXWA 4A93B 4QB4A 1E2ZA 3T51B 2F3VA 5KIXA 5I2YA 3NQTA 4I65A 1KNEA 5D65A 2EYLA 1V1OA 4G7ZC 2AQ3B 3DEOA 1STAA 3MHBA 3BVZA 2F0GA 1IW7D 1F9PA 1G91A 2XRQD 1Z7TA 2R6GA 2IPKD 3T4AC 3OOCA 4B08A 4PNYA 2RVLA 3TZUA 2OEOA 2JE6I 4TSSA 4CJ1B 5A2QL 2B2YC 2KJXA 4ILWA 4KV6A 4XQJA 4CJ0B 2AUJD 1Y1VB 1B2TA 4RHRA 1LTBD 1PFNA 3BVGA 3NSWA 4WORA 3K6OA 4WJWA 4KJNA 3JAME 3SE0A 1KDBA 4N9PA 4I7ZC 1ENFA 3PUXA 2F0TA 4KN4C 2HDLA 3HOYB 2A5HA 5CV6A 4KHVA 5IT9E 2K7VA 4CKEA 4Z9CB 5I9OA 2FMCA 1ENAA 1Q90A 4XYOA 4NP5A 4ZYSA 3OSOA 2L4NA 1R9TB 4A3IB 5FLXL 3VYRA 1SE2A 2FHTA 2YYZA 5IGCA 1RHPA 4A3DB 2RBMA 2IX1A 3T53B 3M4OB 3K5LA 2Q8TA 3I4NB 1O7YA 1SDFA 4AYBB 4NKLA 2V4DA 3BYTB 1WTWA 3J81L 3PMFA 2KQ3A 5CBAE 2F0VA 1FNWA 4DXGA 4L6TB 2D5DA 4RA8A 2BA0A 1QG7A 2JYOA 3VYTA 3DWQA 4ZKBB 4KKUA 3MAQA 4DNRB 4S3SA 3HOUB 2KCNA 4LMQD 4ZRZA 1TVXA 2Z8LA 3MXNA 1PMRA 2R93B 3BDCA 5A35A 2BOSA 1J8IA 4FXDA 3O13A 1JQYD 4PV1C 1D5XC 1JWMD 3QOJA 4DK0A 1C4QA 4R8IA 3NQIA 2E2HB 3GO5A 4QCLA 2TSSA 3NBHA 3CRKC 2ZT9C 3D31A 1R4PB 2CVRA 4J1MA 2Z4IA 2RA4A 4DAPA 4EQPA 1AP0A 1KNAA 2B2WC 3QB3A 3IFDA 5JOBA 4OO1I 3SXHA 2SOBA 3U9SA 4A3GB 1UAPA 3FPPA 3C1EA 3K5OA 1EQVA 1BDOA 1EY9A 5KYLA 5C0XJ 2G9HD 1QILA 4IALA 3HP3A 1A2TA 2KECA 2F0PA 2D62A 1CT1D 5KGUA 1FD7D 2EDGA 5J1ZA 4LAAA 1RF2D 2R7ZB 2F0UA 4IUUA 4ZK9B 3GTLB 3VA7A 5IGFA 3TBIB 1I50B 1KTKA 1O7LA 1RTOA 3PIO3 4YIJA 1G2SA 1SYEA 2MGSA 1YNJC 2NN6G 3E6ZX 1D6EC 1WVLA 2PCFB 4XQQA 2EVBA 1CQVA 3N52A 1C48A 1L0YB 3DEPA 5K5PA 1TY0A 2NN6I 1MBYA 3A55A 5FO7B 3I4MB 4G7OC 1HQMC 1STBA 3Q22A 2O2LD 3BVMA 4XIGS 3ND8A 3D3RA 1QOHA 4HCEA 1VF7A 3MA2B 4RGMA 5EKKA 1HRJA 3GV3A 3OMGA 4KK7A 4C3JB 3D4DA 4CBVA 1OXXK 4FNFA 5C0XG 3MFYA 2PYKA 4C3IB 1LTRD 2PQEA 2F0JA 1NAPA 2KA7A 3HZXA 5C0XI 4DNTB 3CHBD 3A56A 4RGTA 1SEBD 3VR6A 2A73B 1EIGA 3MXUA 3AU7A 4DFAA 1IHZA 5C4JB 1I6VC 1QNUA 1SNMA 1STGA 3I3CA 2F0SA 1J9OA 1A3UA 1SYCA 1VMCA 1LT3D 1KAAA 1W6KA 2L55A 2Z4HA 1ENCA 3GV6A 3GTOB 2K5WA 1YNNC 1VCIA 4C1NI 1GJXA 4DN4M 4XT3B 3S1RB 4FVMA 5CV7A 3WOFA 5I9PA 4XXEA 3FKIB 1JWUD 1OXTA 1F2YA 1I4HA 1EYAA 4QIWB 5IIFA 4CKCA 1H9SA 4OHJA 2L1BA 5DM73 2XWBB 1A3TA 3H91A 4K2KA 1C8CA 1I4XA 1SYGA 5FO8B 5KNBA 3DWPA 1QNKA 3A8JE 4M1UB 3OMCA 3NTKA 1JB3A 2F0OA 1PRTD 3MVVA 2FFKB 1BUVT 1HHVA 4RWSC 1LTGD 1O78A 1JC7A 3HS0C 2J0TD 3PO2B 3K0YA 2FINB 4JBWA 2K03A 1B9NA 2B2UC 3S17B 2MPMA 5IODA 1G2TA 3MTSA 1I4PA 3H09A 1CTMA 2NTTA 4H0LC 2R61A 1GUTA 3VYUA 2DY7A 3OIQA 1TS2A 1EZ8A 3SK4A 4NMZA 3MZ5A 1PYWD 1U4LA 1SNOA 2QDBA 1PRTF 2WB1B 3URYA 1F9QA 3CRLC 1Q1BA 1Y69U 2SEBD 1E0BA 1CK1A 3HGBA 4FF3A 1Z47A 2VB2X 1X3QA 5LL6X 3HOWB 1IW7C 2VUMB 3LNNA 5JPNC 3I91A 1IL8A 4BY7B 1XWEA 2EYFA 3CU7A 5EPLA 4K6LA 1BQQT 1U4RA 4RGOS 3OHXC 3S1NB 2B2YA 4G57A 2PPBC 1EY8A 3G6JB 2X6LA 5FKAC 3RLFA 5ELCA 1SFOB 1RTNA 5M5YB 4BA2I 3PUZA 1IYUA 2A69D 3SEBA 1CA6A 1F2ZA 2B2VC 2X6GA 4TQUS 3FDTA 5JEAH 3SHLA 1Q3LA 1MD2D 3C46A 2LMCB 1ILQA 4CHTB 1OXUA 1SNPA 1JOQA 1LTSD 3I73A 3IKJA 1HPCA 2K1BA 1TT2A 1S5ED 2I07B 1PXUA 4XT1B 4P2CB 1U4PA 1BOSA 4DAVA 2YU9B 3U9OA 2PNRC 4F7XA 1WTQA 2F0HA 4HSPA 1EFID 4DK1A 1ICWA 3EVQA 4BA1I 5CV5A 3A8KE 4ZUJA 1STHA 5J39A 4F8MA 2OXPA 4K5WA 1EL0A 2N88A 3MFGA 4C2MB 4IURA 1HA5A 3PV0A 1SNCA 2PMZB 1PZKD 4EGVA 2XWJB 2DN8A 2PZUA 5EJWA 2JSOA 4H44C 3QIAA 5JEAJ 4RKLA 3AMUA 3S9WA 5BN5A 3I72A 1CQFA 3NWTA 1Y1WB 1I4RA 3JAML 2EYJA 2MP1A 1ZEQX 5CV9A 4HEDA 5IGBA 2FMMA 5KYIA 4KY6A 3DWAA 1LACA 2XIWA 2E76C 2F03A 3C2PA 4OO1H 3D6CA 1PRTB 1CHPD 5HGTA 3TP6A 2NTSA 2L5TA 2Q8RE 4FO2A 5IT9L 4HN7A 1UNSA 2NWGA 2RSOA 2RSNA 4N9TA 4HMJA 2B2WA 1WCMB 4ULLA 4IZ8A 1Q12A 4IN3A 1EYDA 3HEJA 1A6XA 3M7NA 3T13A 5E1FA 4G4KA 5ELBA 1HUNA 3OPOA 1NUCA 4PMBA 2M9VA 2AWNA 5JEAG 2J4XA 5IGGA 1GUSA 2VNUD 1V43A 4EVOA 1S5BD 3PUVA 2BCOA 3K57A 2ZXRA 2EZVA 5I6YA 3NTIA 2QKIC 2O5IC 4EQNA 5D3DA 5M5WB 2NN6H 4FF4A 2B2TC 1DOLA 2F3WA 1V1PA 3J7YW 5I6WA 3EFXD 1ZKOA 3BDLA 1BXTA 1V8QA 1HFNA 4X3SA 5K36H 3TMEA 3VR2A 2Q8IB 1GOZA 1PTOH 3KLSX 2E75C 4B9XA 1DXMA 2OF1A 4G7HC 1T5EA 5T1IA 2RDFA 1CI3M 1FGBD 5C0XH 2AWOA 3A7AB 3GTQB 1EYCA 1ML0D 2HDMA 3EA6A 1NR2A 5E3FA 1LTTD 1DD2A 1LV9A 3OWEB 1II3A 4HMIA 4IUPA 2L0CA 2WIIB 3VR4A 1SMYD 1OO9B 4BBSB 1BCPC 1FYCA 1G6ZA 5CORA 3HOZB 1SNQA 1DYQA 5C4HA 3H94A 1QJOA 2A6HD 4KD3A 4OO1G 1JE4A 4QUCA 4FYDA 3FRPB 3S2DB 2AUKA 4ZUIA 2K32A 5FOBB 1CA5A 5M9OA 4RHSA 3NTHA 1CHQD 1K83B 3ERQA 4FF1A 2Z1CA 3L7ZC 1RD9D 4LJZC 5JVG3 3N6RA 2K01A 3FMCA 4M8AA 3UI2A 1EY7A 5JAVA 1VDZA 3NUCA 5KEEA 2NB0A 3M4YA 3GTKB 1SJED 2E2JB 1HTLD 3M3YB 1D1IA 1ESFA 3QJYA 4FF2A 4DGZA 3Q23A 3Q24A 2NBFA 3A8IE 4C1NK 1PDQA 1JICA 3I70A 4FXKC 1PRTC 3NBIA 1TWGB 5C4XB 3DM1A 3GD7A 2MHVA 2IJ0A 4K6DA 4E6IA 5K36G 1A2UA 4HCSA 3A7LA 3OWFA 2B8GA 3SK5A 2X69A 3P7JA 5KNDA 1I3QB 4OGQC 1WD0A 1HTPA 2KOLA 3C1FA 2F0DA 1O80A 1QE6A 2F0FA 4FXGC 5KNCA 5C3WA 2B63B 2EJMA 2KCCA 4KN7C 2KEEA 2LY7A 1EY6A 3PIP3 2BDNA 3MXGA 1MI2A 2NVXB 4A3BB 1H9SB 1KABA 4XYQA 1EWHA 4ZAIA 1TKWB 5DEHA 1SAPA 1GXDC 4J6HA 1D2BA 4QF4A 3C3LA 1W6JA 4FP5D 5D14A 5ELDA 1KLUD 3NHHA 1S5DD 3VR3A 2K6AA 1LT4D 2L12A 2BE5C 5C6AA 2D2CC 1MGSA 1HQRD 1B3AA 2WKCA 1I6HB 1TQOA 4H7BA 2WACA 1TWHB 1D5MC 3KBXA 5EBCA 5ELEA 2F1MA 2BDOA 2DNEA 1HUMA 1CZWA 2K05A 1PTOB 2A69C 1BF4A 4HSVA 4KD4A 3T56B 2EE1A 2C9OA 4NW2A 5CC4A 3S1QB 2B2VA 2KEDA 4PMWA 4KY5A 2F0LA 1SE3A 1STEA 1LLRD 1JWSD 4RCNA 5FO9B 5NUCA 4MIUA 2NZ1D 5HURA 1IKMA 4ZLTF 2R3ZA 1TS5A 1H9KA 1ONLA 3VR5A 3R93A 1DOKA 3GP7A 1S4ZA 4RFBA 2M00A 4KMUC 4DF7A 2FJ2A 1I4QA 2XVSA 4QMGA 1AZPA 5CYUA 4R9WA 4V0BA 4BY1B 1EY5A 3I90A 2K5DA 3D4WA 3S16B 3DUZA 2EXZA 4IFDH 1Y8PB 4JK1C 3WDNA 4L8JA 1Q8IA 5DAUA 1ZYRD 1Y8OB 3D4RA 1F9RA 1XXGA 3HOXB 1WTPA 4RH6A 2RDGA 3BZDB 2C5CA 1FNVA 3S15B 5COYA 3SVMA 1H9RA 1HFGA 2NUCA 2MUYA 5IOCA 3MEHA 2EYPA 4BS9A 2H4OA 1LABA 4A3EB 3NP8A 2RQXA 4MN3A 5G3LD 3Q6SA 2IX3A 5CV8A 2IWHA 1SJHD 3G7LA 3FPUB 3D6WA 4KKTA 2CW0D 1STNA 4RKBA 3J80L 5EQ0A 2JA7B 3OW7A 5CMDA 5JVH3 1QCBD 3AB9A 4B9WA 1B50A 4O42A 1XYIA 1ESRA 4UDUC 1QWYA 2F0KA 4IFDJ 1H9MA 3BG3A 4R8NA 2PO4A 1SYDA 4RGNA 1ET9A 1LTID 1Y8NB 2AQ1B 1EU4A 5EGTA 2E74C 3NE5B 5KRUA 1D1KA 5JJZA 2JA8B 2QILA 3GQBA 5G3LF 3L3OC 3W2DA 1JOOA 3J80E 1DCZA 1RJTA 3GTJB 4DU9A 3KLRA 2O4XA 1TS4A 3K7AB 2B2TA 3NK9A 4ZQ3A 3IAYA 1TWAB 2XNAC 3RZOB 3HOVB 5CGKA 4HAEA 1F9SA 3LWUA 3PUWA 4ID6A 3X3NA 4EQOA 5LL6S 4X3KA 5E4XA 5C44B 4C56C 2BA1A 4K5VA 3L9AX 2CHBD 3Q0AA 2LKVA 1TY2A 3HG9A 2QF7A 4OL7A 3M85A 2KHSA 2G9DA 1S5CD 3SK8A 4K5XA 2ICIA 2XN9C 4IFDG 1PZJD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I7Z C;  2A68 D;  4DNT B;  3PUX A;  1LAB A;  2JEB I;  2A68 C;  3QG1 A;  4KN4 C;  2B8G A;  1GHK A;  1CTM A;  4H0L C;  2LMC B;  3VR4 A;  3VR6 A;  1K8O A;  5KND A;  3P20 A;  2IT1 A;  1GUT A;  1Q12 A;  3MXU A;  2K7V A;  4OGQ C;  1OXU A;  1B9M A;  4GZY C;  1A6X A;  2EJF C;  1HTP A;  1Q90 A;  1FYC A;  3I73 A;  3U9S A;  1SMY C;  4KKT A;  3M7N A;  3IKJ A;  1HPC A;  3FPP A;  1I6V C;  1GHJ A;  1BDO A;  1GUG A;  4RCN A;  2YYZ A;  4KKS A;  1E2Z A;  1CFM A;  5KNC A;  1H9J A;  2JXM B;  3H94 A;  1QJO A;  3T51 B;  2CW0 C;  1Z6H A;  3T53 B;  2EJM A;  2A6H D;  2KCC A;  3OPO A;  3OW7 A;  4OO1 G;  4KN7 C;  3AB9 A;  2B8F A;  4IQZ A;  5JEA H;  2PNR C;  3ND9 A;  1Q1E A;  4KHZ A;  2D62 A;  2AUK A;  2A6H C;  1GUO A;  1OXS C;  2DNC A;  4H13 C;  2V4D A;  2A6E D;  2EDG A;  2K32 A;  3CRL C;  4DK1 A;  5JEA G;  1Q1B A;  1G29 1;  4G7Z C;  1Y69 U;  1H9M A;  1GUS A;  4BA1 I;  2K33 A;  1H9K A;  1V43 A;  1ONL A;  3BG3 A;  2A6E C;  3VR5 A;  5BN3 A;  3A8K E;  2JEA I;  1H9S B;  3PUV A;  1E2W A;  3HGB A;  1YNN C;  1VCI A;  2D5D A;  1GJX A;  1Y8N B;  2BE5 D;  1EWH A;  1IW7 D;  1TKW B;  2BA0 A;  2E74 C;  3NE5 B;  5BN4 A;  3VA7 A;  3L7Z C;  2O5I C;  3I4L A;  4KMU C;  1Z7T A;  3PV0 A;  2R6G A;  4LJZ C;  1IW7 C;  1O7L A;  3EQL C;  4KKU A;  3N6R A;  4HR7 B;  2NN6 H;  3LNN A;  3PUY A;  3GQB A;  3OOC A;  3FMC A;  1OXT A;  1DCZ A;  4TKO B;  1ZKO A;  2DN8 A;  4DNR B;  1FR3 A;  1YNJ C;  3IFT A;  1V8Q A;  1VDZ A;  2NN6 G;  3KLR A;  5K36 H;  3TZU A;  1K8M A;  4XTC S;  1OXV A;  2PCF B;  1H9S A;  2JE6 I;  1HCZ A;  3BDO A;  3M4Y A;  2EVB A;  1Y8P B;  4H44 C;  1PMR A;  4IFD H;  4JK1 C;  3WDN A;  3QIA A;  3VR2 A;  2Q8I B;  4L8J A;  5A35 A;  4KI0 A;  3VR3 A;  3QJY A;  5BN5 A;  2EJG C;  1Y8O B;  2NN6 I;  3D4R A;  5KNB A;  3I72 A;  4LK1 C;  2AUJ D;  3A8J E;  4G7O C;  2E75 C;  1ZYR C;  4PV1 C;  1IYV A;  1DXM A;  3A8I E;  4DK0 A;  2BE5 C;  1HQM C;  2O5J C;  1GUN A;  2D2C C;  4G7H C;  2PPB C;  1T5E A;  3LWU A;  3PUW A;  4XIG S;  3ND8 A;  3SDZ A;  1E2V A;  1CI3 M;  5C0X H;  2AWO A;  3W3A A;  3RLF A;  3A7A B;  1VF7 A;  2BA1 A;  3CRK C;  4BA2 I;  1OXX K;  1O78 A;  5C0X G;  1LAC A;  3PUZ A;  2ZT9 C;  3SE0 A;  2QF7 A;  1IYU A;  2F1M A;  3D31 A;  3GD7 A;  3MFY A;  2A69 D;  2E76 C;  2BDO A;  3M85 A;  2DNE A;  1VF5 C;  1TU2 B;  1H9R A;  4OO1 H;  4JBW A;  5K36 G;  2A69 C;  1DD2 A;  1B9N A;  3DXJ C;  2KA7 A;  4TQU S;  4IFD G;  2L5T A;  3T56 B;  3A7L A; 
#chains in the Genus database with same CATH topology
 2AQ2 B;  4WFN 3;  2JQO A;  1RCV D;  4X65 L;  3NPP A;  2RCN A;  3FP9 A;  4UHV A;  1HH2 P;  4V19 0;  1IKL A;  1SYF A;  3TS0 A;  1SXT A;  1U9R A;  1TWC B;  2F52 A;  3I4N G;  1K8O A;  4NDX A;  4A3K B;  1A62 A;  4IFD I;  2PI2 A;  3L0O A;  1JMC A;  4IJL A;  2EYM A;  4U68 A;  1B44 D;  1SMY C;  4O1N A;  2NVQ H;  2F0I A;  4ODG A;  3J80 i;  4JV5 Q;  2JP1 A;  3CC7 A;  4LF4 L;  3I4M H;  1VS0 A;  4IUQ A;  4DNI A;  4RCO A;  5AFW A;  1JT8 A;  1Z6H A;  3QWN A;  1EU3 A;  1SRO A;  5M5X B;  3KDF B;  5F2D A;  3SGI A;  2B8F A;  4IQZ A;  3ND9 A;  3X3M A;  5M3F H;  4DV0 L;  2A6H C;  3UDX A;  1OXS C;  1O7Z A;  1V1P B;  3V2T A;  5DNF A;  2A6E D;  5FK9 C;  3G4S A;  2Q2T A;  4C3J H;  1G29 1;  4BBR B;  1AEX A;  1YIT A;  4UAI A;  2D0O A;  1E22 A;  4C3I H;  1IZ6 A;  3HOU G;  2H5X A;  2E5L L;  2D9U A;  3S1M B;  2KVM A;  5FLX c;  2HCC A;  3V05 A;  1VQ4 A;  3PO3 B;  1RDP D;  1PV4 A;  2R93 G;  4C3H G;  5GAH C;  3H0G G;  3GTP B;  1A3V A;  1LT5 D;  4K2L A;  2YTX A;  4N8X 1;  1CM9 A;  4NB3 A;  2RDH A;  2WKD A;  3K5N A;  1TII D;  2XSC A;  4DUY Q;  2R92 H;  1FR3 A;  5AJ3 L;  3J7A V;  2HQL A;  3J81 c;  3TSS A;  2F4I A;  3ONA B;  1D5Z C;  3IL8 A;  4IPG A;  1EEF D;  2K5Q A;  4R4T A;  3DM3 A;  1EY4 A;  5D3I B;  3K0X A;  5BR8 L;  5EAY A;  3EIV A;  1B7Y B;  4JI3 L;  3L2P A;  3E0J A;  5A2Q E;  2PW5 A;  1IYV A;  3BZK A;  5C5L A;  5C5M A;  2EOT A;  3DMU A;  4A3M B;  3EJI A;  4JI1 L;  2EYO A;  1WTX A;  4JBK A;  3J7A 5;  1CKO A;  2CH4 W;  5J22 A;  2JA5 H;  3GTO H;  4GNX C;  3M7G A;  5IWA Q;  2H1E A;  2YTY A;  3SK6 A;  4CGY B;  2EY6 A;  4A3G G;  4Q0F A;  1E7Z A;  1AW7 A;  1EQT A;  1PHJ A;  2A68 D;  5EKL A;  3S2H B;  3BU2 A;  1M4V A;  2F0E A;  5EKI A;  1S40 A;  2PQA B;  3TDQ A;  2SNS A;  3GTG H;  1PTO D;  2HUG A;  1GHK A;  3P20 A;  3R2T A;  1BNZ A;  2IW3 A;  1ZXT A;  4YCV A;  4DPG A;  3U4V A;  2JA6 G;  1NSN S;  2K28 A;  1KAW A;  1GHJ A;  1WJJ A;  1XMO L;  1XX8 A;  1GUG A;  3KUP A;  2WB1 E;  2R7Z G;  2MO1 A;  1M8A A;  1H9J A;  2JXM B;  4A3J B;  2WAQ E;  3BS1 A;  4X3T A;  4F88 A;  5C4Z A;  4NXN L;  4A3L G;  3AYH B;  2ENB A;  1SYB A;  5FLX E;  2UXC L;  4DUZ L;  5DM6 3;  2K5H A;  4RAU C;  1D7Q A;  4KJO A;  4XDX A;  1GUO A;  2DNC A;  4Q5V A;  1WD1 A;  4BWG B;  2WIN B;  1E24 A;  1R4Q B;  3K59 A;  3G6E A;  1N36 L;  4DR4 Q;  2K33 A;  1QZG A;  3PO2 H;  4WJ4 A;  4C3H B;  4WRD A;  1E2W A;  2I46 A;  3H0G B;  3J81 E;  2F0Q A;  4OXP A;  1N32 L;  3CXC A;  3TEH B;  3S17 H;  2WP8 J;  1CSP A;  1V1Q A;  3I4L A;  4HIK A;  4KY7 A;  2ZM6 Q;  1TWF B;  2HQE A;  4L5Q A;  3CKI B;  3RD4 A;  3NWS A;  3TP5 A;  3I4M G;  1PTO F;  4TRD A;  4JI2 Q;  4IUT A;  1N33 Q;  2EYH A;  4XTC S;  4JI8 Q;  5M3F G;  1XNR Q;  1NR4 A;  1HR0 Q;  3PF4 A;  1GVP A;  1YZ6 A;  4C3J G;  4KI0 A;  1SN8 A;  1XTC D;  2Z6K A;  4DV5 L;  2RCF A;  1KLG D;  4C3I G;  4XQN A;  3EBE A;  1YHA A;  1GUN A;  4CDD C;  4JOI C;  1E2V A;  4IUN A;  4A76 A;  1IYJ B;  4EX5 A;  3H3V C;  4JYA L;  3SR1 A;  3J7A F;  5IYC H;  2QA4 A;  2NZO A;  1B8A A;  3UE0 A;  2SNM A;  1VF5 C;  2R92 G;  1B53 A;  2N3S A;  4JI4 Q;  1U0L A;  4APV A;  3HOW H;  4DV6 L;  2QW7 A;  2N55 A;  4MHE A;  2RKS A;  4L63 B;  1JCK B;  2CKZ B;  1B4O A;  2UXB Q;  2JA6 B;  3K58 A;  2KUM A;  2GVA A;  4BY7 H;  3ERO A;  1F77 A;  3BYY B;  1YJW A;  1DM0 B;  4JI5 Q;  5EPJ A;  2V1C C;  1KDA A;  3LX0 A;  1WTR A;  1STY A;  1SBB B;  4JI6 L;  2EPB A;  1I94 Q;  3CP0 A;  2NVY H;  2UUB Q;  1CFM A;  1EZ6 A;  2JA5 G;  4YWM A;  2XTI A;  4PQX A;  3S1N H;  3KF8 A;  1JR0 D;  3FVQ A;  4HJA A;  4NXM Q;  2PZT A;  5E4W C;  2QGQ A;  3KBG A;  1LTA D;  3TN2 A;  3I8Z A;  2B2U A;  2F0M A;  4KLK A;  1EY0 A;  4DK3 C;  1FJG L;  3FKI G;  3QOL A;  2JJQ A;  1J5E L;  3GTM B;  5BN3 A;  2NYZ D;  4R4O A;  3W1G A;  4B3S L;  1A15 A;  1EWC A;  2WV6 D;  1QB5 D;  3HRZ C;  2NVQ B;  3G48 A;  2PMZ E;  1DON A;  3H6M A;  5BN4 A;  1KC8 C;  1G8Z D;  5C3E H;  1PZI D;  1KIX A;  1X32 A;  1IBK Q;  5I4D A;  5TSS A;  3PUY A;  3CCV A;  5M3F B;  2Q2U A;  4TKO B;  3IFT A;  5ISR A;  4LUV A;  1OXV A;  4B3M L;  3BDO A;  4LF8 Q;  1TS3 A;  3MXP A;  2K52 A;  5CR3 A;  1EEI D;  1TXY A;  1BO0 A;  2Z9H A;  3ULJ A;  2EY1 A;  4HTH A;  2XRS D;  2VXW A;  2YU9 H;  3PO2 G;  2VB3 X;  1ZYR C;  3ITP A;  1T9H A;  2IL8 A;  4OIJ A;  4NPS A;  1EOT A;  2TMP A;  2AHO B;  3W3A A;  1BCP D;  2PW7 A;  1I5F A;  3BZC A;  2R92 B;  1KDC A;  5IY0 A;  1SE8 A;  1HZA A;  1V9P A;  4A93 H;  2QCP X;  2A1A A;  1E1O A;  3S24 A;  4JI7 Q;  4C2M H;  3DXJ C;  1EIY B;  1JOR A;  4JV5 L;  4LF5 Q;  3R2I A;  1UUP A;  1VQO A;  1DJR D;  1HXY D;  4ME5 A;  5IGD A;  2DUD A;  1SND A;  1PH8 A;  4HJ5 A;  5HGQ A;  2WB1 G;  3TQY A;  2IT1 A;  1PLF A;  1DOM A;  2F0N A;  2WAQ G;  1B9M A;  2JA5 B;  3STB C;  2L11 A;  5BR8 Q;  3MWY W;  4U67 3;  4X3U A;  2PZW A;  2DY8 A;  1X65 A;  5IYC G;  2F0W A;  3QO2 A;  1YIJ A;  3NEL A;  3K5M A;  1Y1W H;  3TP8 A;  1WTO A;  4LFC Q;  2CW0 C;  3RUZ A;  2LSS A;  4PZ6 A;  2IHF A;  2J7Z A;  2ZJP A;  1Q1E A;  4KHZ A;  1BCP F;  3RZD B;  3HOW G;  4ZKC B;  1I4G A;  1ET6 A;  4OIK A;  1HA6 A;  2KHI A;  3GTG B;  3S14 B;  4DA2 A;  4J8Q A;  4DUY L;  1AN8 A;  4DV3 Q;  4OWT B;  3T16 A;  4BY7 G;  1FNU A;  1F2M A;  2L15 A;  4R4I A;  1PFB A;  1MSH A;  2GA4 B;  4AYB E;  4K14 A;  5JPM C;  5EBD A;  5T1G A;  4CJ2 C;  2ID0 A;  4P73 A;  3EQL C;  2B3G A;  4IPD A;  4OEL B;  4IUV A;  1SE4 A;  1AFP A;  3ZYY X;  1YNJ D;  1YVC A;  3TZD A;  1WCM H;  3P1H A;  2LFN A;  2LXJ A;  2ZXP A;  1XPU A;  3KOJ A;  5DLQ E;  2CFM A;  1K0R A;  4LF7 Q;  2E2I B;  4Y7N B;  2B29 A;  2EY2 A;  4CKB A;  1S72 A;  5IWA L;  5ELN A;  4LK1 C;  1ASY A;  2SDF A;  3KF6 B;  3F8T A;  2E2D C;  2LS0 1;  1RKN A;  4F87 A;  1HJP A;  2AKW B;  3AEV A;  1EIH A;  5C3E G;  2Y0S B;  1KXL A;  4X62 Q;  2EY5 A;  2E8G A;  2B39 A;  3CQZ B;  3KLS A;  2Z0S A;  5EPK A;  4DAY A;  1CKN A;  1MJE A;  3TP7 A;  4GZY C;  3CCE A;  4A3I H;  5C3X A;  1TU2 B;  4IOC A;  4A3D H;  3RMH A;  3A54 A;  1AE2 A;  2NVT B;  2OCE A;  4A3F B;  2HIX A;  2WAQ B;  1W3S A;  3D0F A;  3QG1 A;  3J81 j;  1L0X B;  1GUW A;  5LHY 1;  2HCI A;  3VYS A;  3KFU A;  4KTA A;  2CQA A;  2EJF C;  5CBE E;  1BR9 A;  2XGT A;  1VQI A;  4P74 A;  2VS1 A;  4DR4 L;  3FEW X;  4KKS A;  1F2L A;  1ROD A;  4K8I A;  2A74 C;  3ZJY C;  1WTV A;  3OIP A;  1SR3 A;  1U4M A;  3F2U A;  1K28 A;  3CCL A;  1NMG A;  4GKK Q;  1VMP A;  1Q82 C;  2L9H A;  2QEJ C;  3E5S A;  4H13 C;  3VA5 A;  2ZM6 L;  3HOU H;  4DKA C;  1S5F D;  1WFQ A;  2LXK A;  4PMC A;  5IGE A;  1YNN D;  2A6E C;  2JEA I;  4JI2 L;  3W5O A;  1LO5 D;  2IX0 A;  1N33 L;  1BBX C;  2ICE C;  2MJ8 A;  5I2X A;  3U50 C;  4JI8 L;  1XNR L;  1T5X D;  2BE5 D;  1HR0 L;  4L5S A;  2UU9 Q;  2NVY B;  3K7U C;  3WOE A;  3PSI A;  4HR7 B;  3OW2 A;  1C0A A;  1IL2 A;  1Y1W G;  5M3M B;  1AZQ A;  2M2L A;  2OT2 A;  1TR5 A;  3R3O A;  4P75 A;  3H3V I;  4BBS H;  1K8M A;  1L1O C;  1NTG A;  3D8G A;  4GOP B;  3MC0 B;  1CZG A;  1HCZ A;  1MSG A;  3KLW A;  3R8B A;  4IOA A;  4X64 Q;  3QR8 A;  3V96 A;  1PFM A;  2EJG C;  4QUF A;  1LT6 D;  3P75 A;  5CV4 A;  2K14 A;  5C3E B;  4JI4 L;  2O5J C;  3A74 A;  5GRO A;  2ZTC A;  3SDZ A;  4ABN A;  3LWE A;  3HKZ B;  2UXB L;  1UEA B;  2I5H A;  2K04 A;  1DZ1 A;  1WCM G;  1ILP A;  2JA9 A;  2I5M X;  1SSO A;  4GLX A;  4JI5 L;  4UY8 C;  1JOK A;  4GNX A;  4GN5 A;  5ELF A;  1BCP B;  2PNH A;  3RR5 A;  1I94 L;  2UUB L;  4DXF A;  1B1Z A;  1X3P A;  2JEB I;  4K8J A;  2A68 C;  1NCV A;  3UDG A;  3JAM c;  3DHQ A;  4B3M Q;  4NXM L;  4KHP Q;  1P8L A;  4PZ8 A;  2VW9 A;  4B3T Q;  1PTO C;  3KK7 A;  2ES2 A;  1PH4 A;  2ZXO A;  4GN4 B;  3M3Y H;  1WYD A;  3NXW A;  4A93 B;  4QB4 A;  1E2Z A;  3T51 B;  4OEM B;  2F3V A;  5KIX A;  5I2Y A;  3NQT A;  1VQ7 A;  4I65 A;  1BKB A;  5IT9 c;  4A3D G;  3AQQ A;  4JC0 A;  4DR3 Q;  1KNE A;  5D65 A;  2EYL A;  1IBK L;  1V1O A;  4G7Z C;  2AQ3 B;  1TWG H;  3DEO A;  4PG3 A;  5C4X H;  4AYB G;  1STA A;  3MHB A;  3BVZ A;  1MJC A;  1Q81 C;  2F0G A;  4LF8 L;  1IW7 D;  2OQK A;  1F9P A;  1VQF A;  1G91 A;  1P16 A;  2XRQ D;  1Z7T A;  2R6G A;  2IPK D;  2CH4 A;  1EYG A;  4ZCK A;  1PH6 A;  3T4A C;  3OOC A;  1FL0 A;  4B08 A;  1UWV A;  1YJN A;  4PNY A;  2RVL A;  1GO3 E;  3TZU A;  2OEO A;  2JE6 I;  4TSS A;  4CJ1 B;  1J6Q A;  5A2Q L;  4A75 A;  2B63 H;  2B2Y C;  2KJX A;  4YWK A;  4ILW A;  4KV6 A;  4XQJ A;  4CJ0 B;  2AUJ D;  4DR2 Q;  1Y1V B;  4JI7 L;  1B2T A;  4RHR A;  4QIW E;  1M1K C;  4LF5 L;  1LTB D;  1CSQ A;  1PFN A;  3BVG A;  4A3B H;  1WOC A;  4HIO A;  3NSW A;  4WOR A;  3E9H A;  3K6O A;  4WJW A;  4KJN A;  3JAM E;  4DV2 Q;  3SE0 A;  5C4J H;  1VQD A;  4CDF C;  5GAG C;  1K3B C;  1PFS A;  4AH6 A;  2G5D A;  4BBS G;  1KDB A;  1EIF A;  2RHQ B;  3M4Q A;  4X66 Q;  4N9P A;  3HOZ G;  4I7Z C;  1ENF A;  3PUX A;  4LFC L;  2F0T A;  1O7I A;  4KN4 C;  3LGJ A;  5H1S E;  2HDL A;  3HOY B;  3JC6 6;  1VQM A;  2A5H A;  5CV6 A;  4KHV A;  5IT9 E;  2AMC B;  2K7V A;  4CKE A;  4Z9C B;  5I9O A;  2FMC A;  1ENA A;  1Q90 A;  4XYO A;  4NP5 A;  4ZYS A;  3OSO A;  2L4N A;  1PH7 A;  1R9T B;  4A3I B;  5FLX L;  3VYR A;  1SE2 A;  1Q7Y C;  4HJ9 A;  2FHT A;  2YYZ A;  2HHH Q;  5IGC A;  4DV3 L;  1RHP A;  3S1R H;  4A3D B;  2RBM A;  2IX1 A;  3T53 B;  4OX9 Q;  3M4O B;  3K5L A;  1PA6 A;  2Q8T A;  3FKI H;  3I4N B;  1O7Y A;  1SDF A;  4AYB B;  1I6H H;  3PGZ A;  4NKL A;  2V4D A;  3BYT B;  1WTW A;  3NBH B;  3J81 L;  3PMF A;  2KQ3 A;  5CBA E;  1FVI A;  1Q86 C;  2F0V A;  1FNW A;  4DXG A;  3F2D A;  4L6T B;  5LMN Q;  2D5D A;  1K8G A;  4OWW B;  4LF7 L;  1MHW C;  4RA8 A;  2BA0 A;  1QG7 A;  1HNX Q;  2FXQ A;  2JYO A;  3VYT A;  3DWQ A;  4ZKB B;  1KHI A;  4KKU A;  3MEF A;  4OON A;  5E7N A;  4UP8 A;  3MAQ A;  4DNR B;  4S3S A;  3HOU B;  2KCN A;  4LMQ D;  4ZRZ A;  3F1Z A;  4ME3 A;  1TVX A;  2Z8L A;  1X55 A;  1PMR A;  3MXN A;  4X62 L;  2R93 B;  3BDC A;  5A35 A;  5HY6 A;  2BOS A;  5ELO A;  1J8I A;  5C4X G;  3TS2 A;  4FXD A;  2A8V A;  4AIM A;  1VQ5 A;  1PYB A;  1JQY D;  2K4K A;  3O13 A;  4PV1 C;  1D5X C;  1JWM D;  3QOJ A;  4JPB W;  4DK0 A;  1C4Q A;  2VL6 A;  4R8I A;  3M4P A;  3HKS A;  1UE7 A;  3NQI A;  1K9M C;  2E2H B;  3I4O A;  3GO5 A;  4QCL A;  1XTD A;  2CWA A;  2TSS A;  3NBH A;  3CRK C;  3GDE A;  2ZT9 C;  1NJI C;  4LF9 Q;  3D31 A;  1R4P B;  4GLV B;  2CVR A;  4J1M A;  2Z4I A;  2RA4 A;  2Z6B A;  4DAP A;  2VQF Q;  2K5N A;  4EQP A;  3KF8 B;  5IP7 H;  1AP0 A;  1KNA A;  2B2W C;  1JE5 A;  2B63 G;  3QB3 A;  4TVA B;  1XNQ Q;  3A5U A;  2GVB A;  4GKK L;  3IFD A;  5JOB A;  4OO1 I;  3ULL A;  3S16 H;  3ICE A;  3SXH A;  2SOB A;  3U9S A;  4A3G B;  1UAP A;  3PIO A;  3FPP A;  3C1E A;  3K5O A;  5FJ8 H;  1EQV A;  4A3B G;  1BDO A;  4UP9 A;  1EY9 A;  5KYL A;  3T1H Q;  5C0X J;  2G9H D;  1QIL A;  4IAL A;  3HP3 A;  1A2T A;  1CKM A;  2VUM H;  2KEC A;  2UU9 L;  2F0P A;  2D62 A;  3J81 i;  1CT1 D;  3S15 H;  5KGU A;  1FD7 D;  2EDG A;  5J1Z A;  4LAA A;  1RF2 D;  2R7Z B;  4QGU A;  2F0U A;  4IUU A;  4JBM A;  1EWI A;  4ZK9 B;  3GTL B;  3VA7 A;  4X64 L;  2P5Z X;  5IGF A;  3TBI B;  1I50 B;  2MNA A;  1KTK A;  2QEX A;  1O7L A;  1RTO A;  3PIO 3;  4YIJ A;  2OQ0 A;  1G2S A;  4QY7 A;  1SYE A;  1SFO H;  2MGS A;  1YNJ C;  2JK8 A;  2NN6 G;  5M5Y H;  3E6Z X;  1D6E C;  1WVL A;  2PCF B;  4XQQ A;  2EVB A;  1CQV A;  3N52 A;  1C48 A;  1L0Y B;  3PIP A;  3DEP A;  5K5P A;  4DV7 Q;  1TY0 A;  3AFQ A;  2NN6 I;  1L0W A;  1MBY A;  3A55 A;  5FO7 B;  3I4M B;  4GKJ Q;  4G7O C;  1A8V A;  1HQM C;  1STB A;  3Q22 A;  2O2L D;  3BVM A;  4XIG S;  3ND8 A;  3D3R A;  3AFP A;  1QOH A;  1WTH A;  4HCE A;  1VF7 A;  3MA2 B;  4RGM A;  5EKK A;  3Q8D A;  3GV3 A;  4YY3 Q;  1HRJ A;  3OMG A;  2N8N A;  4KK7 A;  4C3J B;  3D4D A;  1OXX K;  4CBV A;  4FNF A;  5C0X G;  4ALP A;  4KHP L;  3MFY A;  2PYK A;  4C3I B;  4MZ9 A;  4B3T L;  1LTR D;  2PQE A;  2VZA A;  2F0J A;  1NAP A;  2BH2 A;  2JA8 H;  2KA7 A;  3HZX A;  5C0X I;  4JI0 Q;  4DNT B;  4HJ8 A;  3CHB D;  3A56 A;  4RGT A;  3GTJ H;  1SEB D;  3VR6 A;  2A73 B;  1EIG A;  3MXU A;  3AU7 A;  4DR3 L;  2KBN A;  4DFA A;  1IBM Q;  1IHZ A;  5C4J B;  3CC4 A;  1I6V C;  2ALY B;  1OTC A;  1QNU A;  1TWA H;  1KRT A;  1SNM A;  1STG A;  4DR5 Q;  3RZO H;  3I3C A;  3HOV H;  2F0S A;  1J9O A;  3VDY A;  1X3G A;  1A3U A;  5LMN W;  1SYC A;  3PF5 A;  4QL5 A;  1VMC A;  2VQE Q;  5IP7 G;  1VQL A;  1BBW A;  1LT3 D;  1KAA A;  1W6K A;  2L55 A;  2Z4H A;  1ENC A;  3I2Z A;  3E3X A;  3GV6 A;  3GTO B;  2K5W A;  1YNN C;  1VCI A;  4C1N I;  3H3V H;  1GJX A;  4DN4 M;  4XT3 B;  3S1R B;  2RHS B;  1Z9F A;  4B3R Q;  4FVM A;  3CCS A;  3OTO Q;  5CV7 A;  3WOF A;  5I9P A;  4XXE A;  5FJ8 G;  3FKI B;  1JWU D;  1TWC H;  1NMF A;  1OXT A;  4GN3 B;  4DR2 L;  3RLN A;  1F2Y A;  3FHW A;  1I4H A;  1VQB A;  3I56 A;  1Q46 A;  2VUM G;  1EYA A;  4A3C H;  4QIW B;  5IIF A;  5LMU Q;  4CKC A;  4DAY B;  1CKN B;  1H9S A;  4OHJ A;  2L1B A;  5DM7 3;  2XWB B;  4UP7 A;  4DR6 Q;  1A3T A;  3BJU A;  3H91 A;  4K2K A;  1KD1 C;  1C8C A;  1I4X A;  1SYG A;  5FO8 B;  4DV2 L;  1EFW A;  5KNB A;  1L1O A;  3DWP A;  2JN4 A;  1HNZ Q;  1QNK A;  3A8J E;  1AH9 A;  3EN2 A;  4M1U B;  3OMC A;  3J7Z C;  4POG A;  3NTK A;  3CC2 A;  3T1Y Q;  1JB3 A;  2F0O A;  1PRT D;  3MVV A;  4X66 L;  2FFK B;  4MTK A;  1BUV T;  1HHV A;  4RWS C;  1LTG D;  1O78 A;  1JC7 A;  3HS0 C;  2J0T D;  3ER0 A;  4DR7 Q;  3PO2 B;  1XMQ Q;  3K0Y A;  4OWX B;  2FIN B;  4JBW A;  2IY5 B;  1QUQ B;  2K03 A;  4O2D A;  1B9N A;  2B2U C;  1UEB A;  2K5V A;  3S17 B;  1C7Y A;  3CCR A;  1JJ2 A;  2HHH L;  1BBU A;  2MPM A;  5IOD A;  1G2T A;  4OX9 L;  3MTS A;  1I4P A;  3H09 A;  4QQB X;  1G51 A;  1CTM A;  2NTT A;  4H0L C;  2R61 A;  1VQK A;  1GUT A;  2HD3 A;  1JJG A;  1X9N A;  3VYU A;  2DY7 A;  1CUK A;  1C9O A;  3OIQ A;  1TS2 A;  1EZ8 A;  4UPA A;  3SK4 A;  2ZTD A;  4NMZ A;  3MZ5 A;  5LMN L;  1PYW D;  1U4L A;  1SNO A;  2QDB A;  5M5W H;  1PRT F;  1HNX L;  2WB1 B;  2D0P A;  4A3M H;  3G71 A;  2JA8 G;  3URY A;  1F9Q A;  3CRL C;  1Q1B A;  1Q8K A;  1Y69 U;  4J15 A;  2SEB D;  1E0B A;  1CK1 A;  3HGB A;  1PH3 A;  4FF3 A;  2ATW A;  1QUQ A;  1Z47 A;  2VB2 X;  1X3Q A;  5LL6 X;  1VQ9 A;  3HOW B;  1IW7 C;  4LFA Q;  2VUM B;  1BVS A;  3LNN A;  5JPN C;  3I91 A;  3HOV G;  4HJ7 A;  1PH1 A;  3GTQ H;  1IL8 A;  4BY7 B;  3CCJ A;  1SLJ A;  1XWE A;  2EYF A;  3CU7 A;  3CMA A;  5EPL A;  3I55 A;  4K6L A;  1BQQ T;  3CCU A;  1U4R A;  4RGO S;  4A3J H;  4LF9 L;  4GNX B;  5GAD C;  1YHQ A;  4R4Q A;  3OHX C;  3S1N B;  2A19 A;  2B2Y A;  4G57 A;  2PPB C;  2VQF L;  1EY8 A;  3NEM A;  3G6J B;  2X6L A;  1VQG A;  2F3I A;  2DJG C;  5FKA C;  3RLF A;  5ELC A;  4LUZ A;  3UDF A;  1QVC A;  1SFO B;  1XNQ L;  1RTN A;  5M5Y B;  4BA2 I;  3PUZ A;  3W1B A;  1IYU A;  2A69 D;  3HOZ H;  3SEB A;  4A3C G;  1CA6 A;  1F2Z A;  2B2V C;  2X6G A;  4TQU S;  1E3P A;  3FDT A;  5JEA H;  5IYB G;  2OWO A;  3SHL A;  3S2D H;  1Q3L A;  1MD2 D;  1LYL A;  3T1H L;  3C46 A;  2LMC B;  2UUA Q;  1ILQ A;  1SMX A;  4CHT B;  1PYS B;  1OXU A;  1KQS A;  1SNP A;  1K83 H;  1JOQ A;  1LTS D;  3I73 A;  3IKJ A;  1HPC A;  2MO0 A;  2K1B A;  2F4V Q;  1TT2 A;  1S5E D;  2I07 B;  1PXU A;  4XT1 B;  4P2C B;  1U4P A;  1UE6 A;  1BOS A;  4DAV A;  1RIP A;  1PVO A;  2YU9 B;  1KRS A;  3U9O A;  2PNR C;  3PO3 G;  4F7X A;  1WTQ A;  2F0H A;  4HSP A;  1EFI D;  4DV1 Q;  4P71 A;  4DK1 A;  4R4C A;  1ICW A;  3EVQ A;  4BA1 I;  5GQO A;  5CV5 A;  3A8K E;  4ZUJ A;  2E2J H;  1STH A;  3GTK H;  3H15 A;  5J39 A;  4F8M A;  1PH2 A;  2OXP A;  4K5W A;  4LF6 Q;  1EL0 A;  2N88 A;  3MFG A;  4IUR A;  4C2M B;  1HA5 A;  3PV0 A;  1SNC A;  4DV7 L;  2PMZ B;  4L5T A;  1PZK D;  4GKJ L;  1EUJ A;  2UUC Q;  1Y14 B;  4EGV A;  2XWJ B;  2DN8 A;  2PZU A;  3DLL A;  1VQ6 A;  5EJW A;  1L2F A;  4QJF A;  4RMF A;  2JSO A;  4A3M G;  5L37 A;  4H44 C;  4DK6 C;  4YY3 L;  3QIA A;  5JEA J;  4RKL A;  3AMU A;  3F2B A;  3S9W A;  1G6P A;  5BN5 A;  1YHB A;  3I72 A;  1CQF A;  3NWT A;  3IRB A;  5FLM H;  4YCU A;  1Y1W B;  1I4R A;  3JAM L;  2EYJ A;  1X54 A;  2MP1 A;  4JI0 L;  1ZEQ X;  4GLA C;  4K0K Q;  5CV9 A;  4X6A H;  4HED A;  1NBW A;  5IGB A;  1I3Q H;  5IYD H;  3GTM H;  2FMM A;  4PZ7 A;  5KYI A;  4KY6 A;  3DWA A;  4LW1 A;  1LAC A;  3A5Z B;  2XIW A;  2E76 C;  2F03 A;  3C2P A;  4OO1 H;  3D6C A;  1PRT B;  1IBM L;  1CHP D;  1HZ9 A;  5HGT A;  3TP6 A;  2NTS A;  2L5T A;  4DAM A;  1YJ9 A;  3KJO A;  4DR5 L;  2Q8R E;  4FO2 A;  5IT9 L;  4HN7 A;  1UNS A;  1IXR A;  2NWG A;  2RSO A;  4A3J G;  2RSN A;  4YHH Q;  4N9T A;  4HMJ A;  2B2W A;  4L5R C;  2NVX H;  1WCM B;  4ULL A;  1IBL Q;  4IZ8 A;  2MQH A;  1Q12 A;  2VQE L;  4IN3 A;  1EYD A;  1RL2 A;  3HEJ A;  1A6X A;  4GS3 A;  4JOI A;  3M7N A;  3T13 A;  4YWL A;  2KCM A;  5E1F A;  5J3B A;  4G4K A;  5ELB A;  1HUN A;  1X3F A;  3OPO A;  4LWC A;  1NUC A;  4PMB A;  1S3O A;  4DR1 Q;  2M9V A;  4B3R L;  3CPF A;  3OTO L;  4Y52 H;  3KJP A;  2AWN A;  1A0I A;  5JEA G;  2J4X A;  1GKH A;  2VY3 A;  5IGG A;  1GUS A;  2VNU D;  1V43 A;  4EVO A;  1YNX A;  1S5B D;  3PUV A;  3MXN B;  2BCO A;  3K57 A;  2ZXR A;  2EZV A;  5LMU L;  5I6Y A;  3NTI A;  2QKI C;  2I0Q A;  2O5I C;  4DR6 L;  2HT1 A;  4O0A A;  5JJI A;  3KDF A;  4EQN A;  1EQQ A;  5IP9 G;  5D3D A;  5M5W B;  2NN6 H;  4FF4 A;  4CDC C;  1HNZ L;  2B2T C;  1DOL A;  2F3W A;  1V1P A;  3J7Y W;  5I6W A;  3EFX D;  1ZKO A;  3T1Y L;  1TWH H;  3BDL A;  1BXT A;  1V8Q A;  1HFN A;  4X3S A;  2K50 A;  5K36 H;  3TME A;  1N34 Q;  3VR2 A;  2Q8I B;  1GOZ A;  4YCW A;  1PTO H;  3KLS X;  4DR7 L;  2E75 C;  4B9X A;  1XMQ L;  3JAM i;  1DXM A;  3E9I A;  2Y0S E;  3F2C A;  3RZD H;  2OF1 A;  4G7H C;  1T5E A;  5T1I A;  3S1Q H;  1B3Q A;  2RDF A;  3S14 H;  4GOP C;  1CI3 M;  1FGB D;  5C0X H;  3U58 A;  3PQI A;  3ERS X;  2AWO A;  4LUO A;  3A7A B;  3GTQ B;  1EYC A;  1ML0 D;  2ZJQ A;  2HDM A;  3EA6 A;  1NR2 A;  5E3F A;  1LTT D;  1DD2 A;  1LV9 A;  3K8A A;  3OWE B;  1II3 A;  3PCO B;  4HMI A;  4IUP A;  2L0C A;  2N78 A;  1HNW Q;  2WII B;  3CW2 C;  4CDE C;  5FLM G;  3WWV A;  3VR4 A;  1SMY D;  3E0E A;  1OO9 B;  1VQN A;  2E2I H;  4BXX H;  4BBS B;  1BCP C;  1FYC A;  1UE1 A;  4Y7N H;  1G6Z A;  5COR A;  5IYD G;  1SNQ A;  3KYH C;  1DYQ A;  3HOZ B;  5C4H A;  3H94 A;  3UDI A;  1QJO A;  2CQO A;  2A6H D;  4KD3 A;  4OO1 G;  1JE4 A;  4QUC A;  4FYD A;  3FRP B;  3S2D B;  1K0S A;  2PQA A;  2AUK A;  4IPH A;  4ZUI A;  4HID A;  4BY1 H;  4LFA L;  2K32 A;  3CQZ H;  5FOB B;  1CA5 A;  5M9O A;  4RHS A;  3NTH A;  1CHQ D;  1K83 B;  3ERQ A;  4FF1 A;  2Z1C A;  3L7Z C;  1RD9 D;  3HOX H;  2NVT H;  4LJZ C;  5JVG 3;  4A3F H;  1JB7 A;  3N6R A;  4EQ5 A;  2K01 A;  3FMC A;  4M8A A;  1YBY A;  3UI2 A;  1EY7 A;  2ASB A;  5JAV A;  1VDZ A;  3NUC A;  2UXD Q;  5KEE A;  2NB0 A;  4DV4 Q;  3M4Y A;  3GTK B;  1SJE D;  2CWP A;  2E2J B;  1HTL D;  3M3Y B;  1JJC B;  1D1I A;  1ESF A;  3QJY A;  5IE8 A;  4FF2 A;  4DGZ A;  3Q23 A;  1LM0 A;  3Q24 A;  1YEZ A;  3HKZ E;  1VQH A;  2NBF A;  3A8I E;  3CF5 A;  4C1N K;  2PI2 E;  4A3E H;  1PDQ A;  1ASZ A;  1VQA A;  4IJH A;  1JIC A;  3HFZ B;  3I70 A;  3RLO A;  4FXK C;  1PRT C;  3NBI A;  1TWG B;  5C4X B;  2UUA L;  3DM1 A;  3GD7 A;  2MHV A;  2IJ0 A;  4K6D A;  4E6I A;  5K36 G;  2JA7 H;  1A2U A;  1K73 C;  3CD6 A;  4HCS A;  1HZB A;  3A7L A;  2F4V L;  3OWF A;  5M3M H;  1X3E A;  4AQY Q;  3RNU A;  2B8G A;  2DJF C;  3SK5 A;  1QVF A;  2BH8 A;  2X69 A;  2YTV A;  3P7J A;  5KND A;  1I3Q B;  4OGQ C;  1WD0 A;  1HTP A;  4DV1 L;  1MKH A;  2KOL A;  3C1F A;  1XPO A;  2F0D A;  1O80 A;  1NY4 A;  4LFB Q;  3I7F A;  1QE6 A;  2F0F A;  4FXG C;  5KNC A;  5C3W A;  4X65 Q;  2B63 B;  4JG2 A;  2EJM A;  2KCC A;  4KN7 C;  4LF6 L;  2KEE A;  2LY7 A;  1EY6 A;  2R7F A;  1U5K A;  3PIP 3;  2BDN A;  3MXG A;  2KEN A;  1MI2 A;  2UUC L;  3OYY A;  2NVX B;  5JJL A;  3K7A H;  4A3B B;  4LF4 Q;  1H9S B;  1XPR A;  3UE1 A;  1X6O A;  1KAB A;  1VQ8 A;  4XYQ A;  3U4Z A;  1EWH A;  4ZAI A;  1TKW B;  1L1O B;  4DV0 Q;  4BXX G;  2EIF A;  2RF4 A;  1PH5 A;  2KHJ A;  4A4I A;  5DEH A;  1LTL A;  1SAP A;  4I7A A;  1MIU A;  1GXD C;  4J6H A;  2WFW A;  1D2B A;  5C44 H;  3K81 C;  4QF4 A;  3C3L A;  2Z6K C;  1HZC A;  2E5L Q;  4K0K L;  1K3R A;  1W6J A;  4FP5 D;  5D14 A;  4N8F A;  3NEN A;  1KLU D;  3NHH A;  5ELD A;  2Y0S G;  4BY1 G;  1S5D D;  1M90 C;  3VR3 A;  2K6A A;  1LT4 D;  3CAM A;  2GN5 A;  1QVG A;  2L12 A;  2BE5 C;  5C6A A;  2D2C C;  5AJ3 Q;  1MGS A;  1HQR D;  1B3A A;  1B70 B;  2WKC A;  3HOX G;  4A3K H;  1I6H B;  1TQO A;  4A3F G;  4H7B A;  2WAC A;  3RN5 A;  1TWH B;  4YHH L;  1D5M C;  3KBX A;  1VQP A;  5EBC A;  1UE5 A;  1K8A C;  5ELE A;  2F1M A;  3M9B A;  1IBL L;  4JI3 Q;  2BDO A;  2DNE A;  5IYB H;  2IHE A;  1HUM A;  1CZW A;  2K05 A;  1PTO B;  2A69 C;  1BF4 A;  4HSV A;  5M5X H;  4KD4 A;  3T56 B;  3RN2 A;  4MNO A;  4JI1 Q;  2EE1 A;  2C9O A;  4NW2 A;  5CC4 A;  3S1Q B;  2B2V A;  2KED A;  4BBR H;  4DR1 L;  2I5L X;  4A3E G;  1QZH A;  4PMW A;  2Q2I A;  4KY5 A;  2F0L A;  1SE3 A;  1STE A;  3ULP A;  1LLR D;  1JWS D;  3S1M H;  1EOV A;  4RCN A;  5NUC A;  5FO9 B;  3PO3 H;  4H02 A;  1NE3 A;  4MIU A;  1HR0 W;  2ZJR A;  2NZ1 D;  1Y1V H;  4MTN A;  3GTP H;  5HUR A;  1SRU A;  1XJV A;  1IKM A;  1GD7 A;  4ZLT F;  2JA7 G;  2R3Z A;  1N9W A;  1TS5 A;  1H9K A;  1XMO Q;  1ONL A;  5M3M G;  3VR5 A;  3R93 A;  1DOK A;  4IO9 A;  3GP7 A;  1AE3 A;  4NXN Q;  1S4Z A;  4RFB A;  2UXC Q;  4DUZ Q;  1N34 L;  2M00 A;  1DGS A;  4KMU C;  1VQC A;  4DF7 A;  2NZH A;  2FJ2 A;  1I4Q A;  2XVS A;  4QMG A;  4RG1 A;  1AZP A;  1N8R C;  5CYU A;  1N36 Q;  4JCV E;  3HOY H;  4R9W A;  4V0B A;  4BY1 B;  1EY5 A;  5JJK A;  3I90 A;  2K5D A;  3D4W A;  1R9T H;  3S16 B;  3DUZ A;  2EXZ A;  1N32 Q;  3HKZ G;  1EQR A;  4IFD H;  1Y8P B;  4JK1 C;  3WDN A;  5GAE C;  4L8J A;  1Q8I A;  5DAU A;  1ZYR D;  3TRZ A;  3M4O H;  1Y8O B;  3D4R A;  1F9R A;  1XXG A;  3I4N H;  3HOX B;  3J80 c;  4HIM A;  3S2H H;  1LUZ A;  1WTP A;  2CCZ A;  4RH6 A;  2RDG A;  3BZD B;  2C5C A;  1HNW L;  1D8L A;  1FNV A;  3S15 B;  5COY A;  1GM5 A;  3SVM A;  2K75 A;  4DV5 Q;  2R7D A;  3CCM A;  1H9R A;  1HFG A;  2EQS A;  2NUC A;  5C44 G;  2MUY A;  4JW0 A;  4IPC A;  4A93 G;  5IOC A;  1ICF B;  3KF6 A;  2MFI A;  3MEH A;  2EYP A;  4BS9 A;  2H4O A;  1LAB A;  4A3E B;  4JYA Q;  3NP8 A;  2RQX A;  4MN3 A;  3TRE A;  5G3L D;  3Q6S A;  2QDL A;  2IX3 A;  3STB D;  5CV8 A;  2IWH A;  1SJH D;  3G7L A;  4JVZ A;  3FPU B;  1FGU A;  2R93 H;  3D6W A;  4C3H H;  4KKT A;  3H0G H;  4A3K G;  4DV6 Q;  1KL9 A;  2CW0 D;  1STN A;  4RKB A;  3J80 L;  5EQ0 A;  1PH9 A;  2JA7 B;  1A63 A;  3OW7 A;  5CMD A;  5JVH 3;  1TWF H;  1QCB D;  3AB9 A;  4B9W A;  1B50 A;  4O42 A;  1XYI A;  1ESR A;  4LNQ A;  2E2H H;  4UDU C;  1QWY A;  2F0K A;  4IFD J;  4WJ3 M;  2DGY A;  4P72 A;  1H9M A;  3BG3 A;  4R8N A;  4JI6 Q;  2PO4 A;  4FDB A;  2KCT A;  1SYD A;  4RGN A;  1ET9 A;  4JBJ A;  3CPW A;  4BBR G;  2UXD L;  1LTI D;  1H95 A;  1Y8N B;  2AQ1 B;  5IP9 H;  4DV4 L;  1EU4 A;  5EGT A;  2E74 C;  3NE5 B;  5KRU A;  3B6Y A;  1D1K A;  5JJZ A;  2JA8 B;  2YV5 A;  1FJG Q;  2QIL A;  2ZTE A;  3GQB A;  3CME A;  5G3L F;  3L3O C;  3W2D A;  1YI2 A;  1JOO A;  1J5E Q;  1Y1V G;  3J80 E;  1DCZ A;  1RJT A;  4B3S Q;  3GTJ B;  2OTL A;  2EXD A;  4DU9 A;  2HIV A;  3KLR A;  4A3G H;  2O4X A;  1TS4 A;  3K7A B;  2B2T A;  3NK9 A;  1NNX A;  1W2B A;  1WI5 A;  4ZQ3 A;  3A0J A;  1E1T A;  1VQJ A;  1TWA B;  3IAY A;  2N49 A;  2XNA C;  3RZO B;  3K80 C;  3HOV B;  5CGK A;  2Q2H A;  4HAE A;  1F9S A;  2OTJ A;  3LWU A;  3PUW A;  2JA6 H;  4ID6 A;  3X3N A;  4EQO A;  5LL6 S;  4X3K A;  5E4X A;  2R7Z H;  5C44 B;  4AQY L;  4C56 C;  2C35 B;  2BA1 A;  4K5V A;  3L9A X;  4R1J A;  2CHB D;  1VQE A;  3Q0A A;  2LKV A;  1TY2 A;  3HG9 A;  2QF7 A;  4GOP A;  3HOY G;  4A3L H;  4OL7 A;  3M85 A;  3CCQ A;  2KHS A;  2G9D A;  1S5C D;  3SK8 A;  3GTL H;  1I50 H;  2ICI A;  4K5X A;  2XN9 C;  4POF A;  4A3I G;  1X56 A;  4IFD G;  4LFB L;  1PZJ D; 
#chains in the Genus database with same CATH homology
 2AQ2 B;  4WFN 3;  1RCV D;  3NPP A;  4V19 0;  1IKL A;  1SYF A;  1SXT A;  1U9R A;  1TWC B;  1K8O A;  4NDX A;  4A3K B;  4IFD I;  2EYM A;  4U68 A;  1B44 D;  1SMY C;  4O1N A;  2F0I A;  4ODG A;  2JP1 A;  4IUQ A;  4RCO A;  5AFW A;  1Z6H A;  3QWN A;  1EU3 A;  5M5X B;  5F2D A;  2B8F A;  4IQZ A;  3ND9 A;  3X3M A;  2A6H C;  1OXS C;  1O7Z A;  1V1P B;  3V2T A;  5DNF A;  2A6E D;  5FK9 C;  1G29 1;  4BBR B;  1AEX A;  4UAI A;  2D9U A;  3S1M B;  2KVM A;  2HCC A;  3V05 A;  3PO3 B;  1RDP D;  4C3H G;  3GTP B;  1A3V A;  1LT5 D;  4K2L A;  1CM9 A;  2RDH A;  2WKD A;  3K5N A;  1TII D;  2XSC A;  1FR3 A;  3J7A V;  3TSS A;  2F4I A;  3ONA B;  1D5Z C;  3IL8 A;  1EEF D;  2K5Q A;  1EY4 A;  5D3I B;  3E0J A;  5A2Q E;  2PW5 A;  1IYV A;  5C5L A;  5C5M A;  2EOT A;  3DMU A;  4A3M B;  3EJI A;  2EYO A;  1WTX A;  5J22 A;  3M7G A;  2H1E A;  3SK6 A;  4CGY B;  2EY6 A;  4Q0F A;  1AW7 A;  1EQT A;  2A68 D;  5EKL A;  3S2H B;  1M4V A;  2F0E A;  5EKI A;  3TDQ A;  2SNS A;  1PTO D;  2HUG A;  1GHK A;  3P20 A;  3R2T A;  1BNZ A;  2IW3 A;  1ZXT A;  1NSN S;  2K28 A;  1GHJ A;  1XX8 A;  1GUG A;  3KUP A;  1M8A A;  1H9J A;  2JXM B;  4A3J B;  3BS1 A;  4X3T A;  4F88 A;  5C4Z A;  2ENB A;  1SYB A;  5FLX E;  5DM6 3;  4RAU C;  4KJO A;  4XDX A;  1GUO A;  2DNC A;  4Q5V A;  1WD1 A;  4BWG B;  2WIN B;  1R4Q B;  3K59 A;  2K33 A;  4C3H B;  4WRD A;  1E2W A;  2I46 A;  3H0G B;  3J81 E;  2F0Q A;  2WP8 J;  3I4L A;  4KY7 A;  1TWF B;  2HQE A;  3CKI B;  3RD4 A;  3NWS A;  3TP5 A;  1PTO F;  4TRD A;  4IUT A;  2EYH A;  4XTC S;  1NR4 A;  4C3J G;  4KI0 A;  1XTC D;  1KLG D;  4C3I G;  4XQN A;  1GUN A;  1E2V A;  4IUN A;  3H3V C;  3SR1 A;  3J7A F;  2SNM A;  1VF5 C;  1B53 A;  2N55 A;  4MHE A;  2RKS A;  4L63 B;  1JCK B;  1B4O A;  2JA6 B;  3K58 A;  2KUM A;  3ERO A;  1F77 A;  3BYY B;  1DM0 B;  5EPJ A;  1KDA A;  3LX0 A;  1WTR A;  1STY A;  1SBB B;  2EPB A;  1CFM A;  1EZ6 A;  4PQX A;  3KF8 A;  1JR0 D;  3FVQ A;  2PZT A;  5E4W C;  3KBG A;  1LTA D;  3TN2 A;  3I8Z A;  2B2U A;  2F0M A;  1EY0 A;  3QOL A;  3GTM B;  5BN3 A;  2NYZ D;  1A15 A;  1EWC A;  2WV6 D;  1QB5 D;  3HRZ C;  2NVQ B;  1DON A;  3H6M A;  5BN4 A;  1G8Z D;  1PZI D;  1X32 A;  5I4D A;  5TSS A;  3PUY A;  5M3F B;  4TKO B;  3IFT A;  5ISR A;  1OXV A;  3BDO A;  1TS3 A;  3MXP A;  5CR3 A;  1EEI D;  1BO0 A;  2EY1 A;  4HTH A;  2XRS D;  2VXW A;  2VB3 X;  1ZYR C;  3ITP A;  2IL8 A;  4OIJ A;  1EOT A;  2TMP A;  1BCP D;  3W3A A;  2PW7 A;  2R92 B;  1KDC A;  2QCP X;  3DXJ C;  1JOR A;  3R2I A;  1UUP A;  1DJR D;  1HXY D;  4ME5 A;  5IGD A;  1SND A;  2IT1 A;  1PLF A;  1DOM A;  2F0N A;  1B9M A;  2JA5 B;  2L11 A;  4U67 3;  3MWY W;  4X3U A;  2PZW A;  2DY8 A;  2F0W A;  3QO2 A;  3K5M A;  3TP8 A;  1WTO A;  2CW0 C;  3RUZ A;  2J7Z A;  1Q1E A;  4KHZ A;  1BCP F;  3RZD B;  4ZKC B;  1I4G A;  1ET6 A;  4OIK A;  1HA6 A;  3GTG B;  3S14 B;  4DA2 A;  4J8Q A;  1AN8 A;  3T16 A;  1FNU A;  1F2M A;  1PFB A;  1MSH A;  2GA4 B;  4K14 A;  5JPM C;  5EBD A;  5T1G A;  4CJ2 C;  2ID0 A;  3EQL C;  4IUV A;  1SE4 A;  1AFP A;  3ZYY X;  1YNJ D;  3TZD A;  3P1H A;  2LFN A;  2ZXP A;  2E2I B;  4Y7N B;  2EY2 A;  4CKB A;  4LK1 C;  2SDF A;  2E2D C;  2LS0 1;  1RKN A;  4F87 A;  1EIH A;  2Y0S B;  2EY5 A;  2B39 A;  3CQZ B;  5EPK A;  3KLS A;  4DAY A;  3TP7 A;  4GZY C;  5C3X A;  1TU2 B;  3RMH A;  3A54 A;  2NVT B;  4A3F B;  2WAQ B;  3QG1 A;  1L0X B;  1GUW A;  5LHY 1;  2HCI A;  3VYS A;  4KTA A;  2CQA A;  2EJF C;  5CBE E;  1BR9 A;  3FEW X;  4KKS A;  1F2L A;  1ROD A;  4K8I A;  2A74 C;  1WTV A;  3OIP A;  1U4M A;  3F2U A;  1VMP A;  2L9H A;  2QEJ C;  3E5S A;  4H13 C;  3VA5 A;  1S5F D;  4PMC A;  5IGE A;  1YNN D;  2A6E C;  2JEA I;  1LO5 D;  2IX0 A;  1BBX C;  2ICE C;  2MJ8 A;  5I2X A;  1T5X D;  2BE5 D;  2NVY B;  3WOE A;  4HR7 B;  5M3M B;  1AZQ A;  2M2L A;  2OT2 A;  1TR5 A;  3R3O A;  1K8M A;  3D8G A;  3MC0 B;  1CZG A;  1HCZ A;  1MSG A;  3R8B A;  3V96 A;  1PFM A;  2EJG C;  4QUF A;  1LT6 D;  3P75 A;  5CV4 A;  5C3E B;  2O5J C;  3SDZ A;  4ABN A;  3LWE A;  3HKZ B;  1UEA B;  2K04 A;  1DZ1 A;  1ILP A;  1SSO A;  1JOK A;  5ELF A;  1BCP B;  4DXF A;  1B1Z A;  1X3P A;  2JEB I;  4K8J A;  2A68 C;  1NCV A;  3DHQ A;  1PTO C;  3KK7 A;  2ZXO A;  3NXW A;  4A93 B;  4QB4 A;  1E2Z A;  3T51 B;  2F3V A;  5KIX A;  5I2Y A;  3NQT A;  4I65 A;  1KNE A;  5D65 A;  2EYL A;  1V1O A;  4G7Z C;  2AQ3 B;  3DEO A;  1STA A;  3MHB A;  3BVZ A;  2F0G A;  1IW7 D;  1F9P A;  1G91 A;  2XRQ D;  1Z7T A;  2R6G A;  2IPK D;  3T4A C;  3OOC A;  4B08 A;  4PNY A;  2RVL A;  3TZU A;  2OEO A;  2JE6 I;  4TSS A;  4CJ1 B;  5A2Q L;  2B2Y C;  2KJX A;  4ILW A;  4KV6 A;  4XQJ A;  4CJ0 B;  2AUJ D;  1Y1V B;  1B2T A;  4RHR A;  1LTB D;  1PFN A;  3BVG A;  3NSW A;  4WOR A;  3K6O A;  4WJW A;  4KJN A;  3JAM E;  3SE0 A;  1KDB A;  4N9P A;  4I7Z C;  1ENF A;  3PUX A;  2F0T A;  4KN4 C;  2HDL A;  3HOY B;  2A5H A;  5CV6 A;  4KHV A;  5IT9 E;  2K7V A;  4CKE A;  4Z9C B;  5I9O A;  2FMC A;  1ENA A;  1Q90 A;  4XYO A;  4NP5 A;  4ZYS A;  3OSO A;  2L4N A;  1R9T B;  4A3I B;  5FLX L;  3VYR A;  1SE2 A;  2FHT A;  2YYZ A;  5IGC A;  1RHP A;  4A3D B;  2RBM A;  2IX1 A;  3T53 B;  3M4O B;  3K5L A;  2Q8T A;  3I4N B;  1O7Y A;  1SDF A;  4AYB B;  4NKL A;  2V4D A;  3BYT B;  1WTW A;  3J81 L;  3PMF A;  2KQ3 A;  5CBA E;  2F0V A;  1FNW A;  4DXG A;  4L6T B;  2D5D A;  4RA8 A;  2BA0 A;  1QG7 A;  2JYO A;  3VYT A;  3DWQ A;  4ZKB B;  4KKU A;  3MAQ A;  4DNR B;  4S3S A;  3HOU B;  2KCN A;  4LMQ D;  4ZRZ A;  1TVX A;  2Z8L A;  3MXN A;  1PMR A;  2R93 B;  3BDC A;  5A35 A;  2BOS A;  1J8I A;  4FXD A;  3O13 A;  1JQY D;  4PV1 C;  1D5X C;  1JWM D;  3QOJ A;  4DK0 A;  1C4Q A;  4R8I A;  3NQI A;  2E2H B;  3GO5 A;  4QCL A;  2TSS A;  3NBH A;  3CRK C;  2ZT9 C;  3D31 A;  1R4P B;  2CVR A;  4J1M A;  2Z4I A;  2RA4 A;  4DAP A;  4EQP A;  1AP0 A;  1KNA A;  2B2W C;  3QB3 A;  3IFD A;  5JOB A;  4OO1 I;  3SXH A;  2SOB A;  3U9S A;  4A3G B;  1UAP A;  3FPP A;  3C1E A;  3K5O A;  1EQV A;  1BDO A;  1EY9 A;  5KYL A;  5C0X J;  2G9H D;  1QIL A;  4IAL A;  3HP3 A;  1A2T A;  2KEC A;  2F0P A;  2D62 A;  1CT1 D;  5KGU A;  1FD7 D;  2EDG A;  5J1Z A;  4LAA A;  1RF2 D;  2R7Z B;  2F0U A;  4IUU A;  4ZK9 B;  3GTL B;  3VA7 A;  5IGF A;  3TBI B;  1I50 B;  1KTK A;  1O7L A;  1RTO A;  3PIO 3;  4YIJ A;  1G2S A;  1SYE A;  2MGS A;  1YNJ C;  2NN6 G;  3E6Z X;  1D6E C;  1WVL A;  2PCF B;  4XQQ A;  2EVB A;  1CQV A;  3N52 A;  1C48 A;  1L0Y B;  3DEP A;  5K5P A;  1TY0 A;  2NN6 I;  1MBY A;  3A55 A;  5FO7 B;  3I4M B;  4G7O C;  1HQM C;  1STB A;  3Q22 A;  2O2L D;  3BVM A;  4XIG S;  3ND8 A;  3D3R A;  1QOH A;  4HCE A;  1VF7 A;  3MA2 B;  4RGM A;  5EKK A;  1HRJ A;  3GV3 A;  3OMG A;  4KK7 A;  4C3J B;  3D4D A;  4CBV A;  1OXX K;  4FNF A;  5C0X G;  3MFY A;  2PYK A;  4C3I B;  1LTR D;  2PQE A;  2F0J A;  1NAP A;  2KA7 A;  3HZX A;  5C0X I;  4DNT B;  3CHB D;  3A56 A;  4RGT A;  1SEB D;  3VR6 A;  2A73 B;  1EIG A;  3MXU A;  3AU7 A;  4DFA A;  1IHZ A;  5C4J B;  1I6V C;  1QNU A;  1SNM A;  1STG A;  3I3C A;  2F0S A;  1J9O A;  1A3U A;  1SYC A;  1VMC A;  1LT3 D;  1KAA A;  1W6K A;  2L55 A;  2Z4H A;  1ENC A;  3GV6 A;  3GTO B;  2K5W A;  1YNN C;  1VCI A;  4C1N I;  1GJX A;  4DN4 M;  4XT3 B;  3S1R B;  4FVM A;  5CV7 A;  3WOF A;  5I9P A;  4XXE A;  3FKI B;  1JWU D;  1OXT A;  1F2Y A;  1I4H A;  1EYA A;  4QIW B;  5IIF A;  4CKC A;  1H9S A;  4OHJ A;  2L1B A;  5DM7 3;  2XWB B;  1A3T A;  3H91 A;  4K2K A;  1C8C A;  1I4X A;  1SYG A;  5FO8 B;  5KNB A;  3DWP A;  1QNK A;  3A8J E;  4M1U B;  3OMC A;  3NTK A;  1JB3 A;  2F0O A;  1PRT D;  3MVV A;  2FFK B;  1BUV T;  1HHV A;  4RWS C;  1LTG D;  1O78 A;  1JC7 A;  3HS0 C;  2J0T D;  3PO2 B;  3K0Y A;  2FIN B;  4JBW A;  2K03 A;  1B9N A;  2B2U C;  3S17 B;  2MPM A;  5IOD A;  1G2T A;  3MTS A;  1I4P A;  3H09 A;  1CTM A;  2NTT A;  4H0L C;  2R61 A;  1GUT A;  3VYU A;  2DY7 A;  3OIQ A;  1TS2 A;  1EZ8 A;  3SK4 A;  4NMZ A;  3MZ5 A;  1PYW D;  1U4L A;  1SNO A;  2QDB A;  1PRT F;  2WB1 B;  3URY A;  1F9Q A;  3CRL C;  1Q1B A;  1Y69 U;  2SEB D;  1E0B A;  1CK1 A;  3HGB A;  4FF3 A;  1Z47 A;  2VB2 X;  1X3Q A;  5LL6 X;  3HOW B;  1IW7 C;  2VUM B;  3LNN A;  5JPN C;  3I91 A;  1IL8 A;  4BY7 B;  1XWE A;  2EYF A;  3CU7 A;  5EPL A;  4K6L A;  1BQQ T;  1U4R A;  4RGO S;  3OHX C;  3S1N B;  2B2Y A;  4G57 A;  2PPB C;  1EY8 A;  3G6J B;  2X6L A;  5FKA C;  3RLF A;  5ELC A;  1SFO B;  1RTN A;  5M5Y B;  4BA2 I;  3PUZ A;  1IYU A;  2A69 D;  3SEB A;  1CA6 A;  1F2Z A;  2B2V C;  2X6G A;  4TQU S;  3FDT A;  5JEA H;  3SHL A;  1Q3L A;  1MD2 D;  3C46 A;  2LMC B;  1ILQ A;  4CHT B;  1OXU A;  1SNP A;  1JOQ A;  1LTS D;  3I73 A;  3IKJ A;  1HPC A;  2K1B A;  1TT2 A;  1S5E D;  2I07 B;  1PXU A;  4XT1 B;  4P2C B;  1U4P A;  1BOS A;  4DAV A;  2YU9 B;  3U9O A;  2PNR C;  4F7X A;  1WTQ A;  2F0H A;  4HSP A;  1EFI D;  4DK1 A;  1ICW A;  3EVQ A;  4BA1 I;  5CV5 A;  3A8K E;  4ZUJ A;  1STH A;  5J39 A;  4F8M A;  2OXP A;  4K5W A;  1EL0 A;  2N88 A;  3MFG A;  4C2M B;  4IUR A;  1HA5 A;  3PV0 A;  1SNC A;  2PMZ B;  1PZK D;  4EGV A;  2XWJ B;  2DN8 A;  2PZU A;  5EJW A;  2JSO A;  4H44 C;  3QIA A;  5JEA J;  4RKL A;  3AMU A;  3S9W A;  5BN5 A;  3I72 A;  1CQF A;  3NWT A;  1Y1W B;  1I4R A;  3JAM L;  2EYJ A;  2MP1 A;  1ZEQ X;  5CV9 A;  4HED A;  5IGB A;  2FMM A;  5KYI A;  4KY6 A;  3DWA A;  1LAC A;  2XIW A;  2E76 C;  2F03 A;  3C2P A;  4OO1 H;  3D6C A;  1PRT B;  1CHP D;  5HGT A;  3TP6 A;  2NTS A;  2L5T A;  2Q8R E;  4FO2 A;  5IT9 L;  4HN7 A;  1UNS A;  2NWG A;  2RSO A;  2RSN A;  4N9T A;  4HMJ A;  2B2W A;  1WCM B;  4ULL A;  4IZ8 A;  1Q12 A;  4IN3 A;  1EYD A;  3HEJ A;  1A6X A;  3M7N A;  3T13 A;  5E1F A;  4G4K A;  5ELB A;  1HUN A;  3OPO A;  1NUC A;  4PMB A;  2M9V A;  2AWN A;  5JEA G;  2J4X A;  5IGG A;  1GUS A;  2VNU D;  1V43 A;  4EVO A;  1S5B D;  3PUV A;  2BCO A;  3K57 A;  2ZXR A;  2EZV A;  5I6Y A;  3NTI A;  2QKI C;  2O5I C;  4EQN A;  5D3D A;  5M5W B;  2NN6 H;  4FF4 A;  2B2T C;  1DOL A;  2F3W A;  1V1P A;  3J7Y W;  5I6W A;  3EFX D;  1ZKO A;  3BDL A;  1BXT A;  1V8Q A;  1HFN A;  4X3S A;  5K36 H;  3TME A;  3VR2 A;  2Q8I B;  1GOZ A;  1PTO H;  3KLS X;  2E75 C;  4B9X A;  1DXM A;  2OF1 A;  4G7H C;  1T5E A;  5T1I A;  2RDF A;  1CI3 M;  1FGB D;  5C0X H;  2AWO A;  3A7A B;  3GTQ B;  1EYC A;  1ML0 D;  2HDM A;  3EA6 A;  1NR2 A;  5E3F A;  1LTT D;  1DD2 A;  1LV9 A;  3OWE B;  1II3 A;  4HMI A;  4IUP A;  2L0C A;  2WII B;  3VR4 A;  1SMY D;  1OO9 B;  4BBS B;  1BCP C;  1FYC A;  1G6Z A;  5COR A;  3HOZ B;  1SNQ A;  1DYQ A;  5C4H A;  3H94 A;  1QJO A;  2A6H D;  4KD3 A;  4OO1 G;  1JE4 A;  4QUC A;  4FYD A;  3FRP B;  3S2D B;  2AUK A;  4ZUI A;  2K32 A;  5FOB B;  1CA5 A;  5M9O A;  4RHS A;  3NTH A;  1CHQ D;  1K83 B;  3ERQ A;  4FF1 A;  2Z1C A;  3L7Z C;  1RD9 D;  4LJZ C;  5JVG 3;  3N6R A;  2K01 A;  3FMC A;  4M8A A;  3UI2 A;  1EY7 A;  5JAV A;  1VDZ A;  3NUC A;  5KEE A;  2NB0 A;  3M4Y A;  3GTK B;  1SJE D;  2E2J B;  1HTL D;  3M3Y B;  1D1I A;  1ESF A;  3QJY A;  4FF2 A;  4DGZ A;  3Q23 A;  3Q24 A;  2NBF A;  3A8I E;  4C1N K;  1PDQ A;  1JIC A;  3I70 A;  4FXK C;  1PRT C;  3NBI A;  1TWG B;  5C4X B;  3DM1 A;  3GD7 A;  2MHV A;  2IJ0 A;  4K6D A;  4E6I A;  5K36 G;  1A2U A;  4HCS A;  3A7L A;  3OWF A;  2B8G A;  3SK5 A;  2X69 A;  3P7J A;  5KND A;  1I3Q B;  4OGQ C;  1WD0 A;  1HTP A;  2KOL A;  3C1F A;  2F0D A;  1O80 A;  1QE6 A;  2F0F A;  4FXG C;  5KNC A;  5C3W A;  2B63 B;  2EJM A;  2KCC A;  4KN7 C;  2KEE A;  2LY7 A;  1EY6 A;  3PIP 3;  2BDN A;  3MXG A;  1MI2 A;  2NVX B;  4A3B B;  1H9S B;  1KAB A;  4XYQ A;  1EWH A;  4ZAI A;  1TKW B;  5DEH A;  1SAP A;  1GXD C;  4J6H A;  1D2B A;  4QF4 A;  3C3L A;  1W6J A;  4FP5 D;  5D14 A;  5ELD A;  1KLU D;  3NHH A;  1S5D D;  3VR3 A;  2K6A A;  1LT4 D;  2L12 A;  2BE5 C;  5C6A A;  2D2C C;  1MGS A;  1HQR D;  1B3A A;  2WKC A;  1I6H B;  1TQO A;  4H7B A;  2WAC A;  1TWH B;  1D5M C;  3KBX A;  5EBC A;  5ELE A;  2F1M A;  2BDO A;  2DNE A;  1HUM A;  1CZW A;  2K05 A;  1PTO B;  2A69 C;  1BF4 A;  4HSV A;  4KD4 A;  3T56 B;  2EE1 A;  2C9O A;  4NW2 A;  5CC4 A;  3S1Q B;  2B2V A;  2KED A;  4PMW A;  4KY5 A;  2F0L A;  1SE3 A;  1STE A;  1LLR D;  1JWS D;  4RCN A;  5FO9 B;  5NUC A;  4MIU A;  2NZ1 D;  5HUR A;  1IKM A;  4ZLT F;  2R3Z A;  1TS5 A;  1H9K A;  1ONL A;  3VR5 A;  3R93 A;  1DOK A;  3GP7 A;  1S4Z A;  4RFB A;  2M00 A;  4KMU C;  4DF7 A;  2FJ2 A;  1I4Q A;  2XVS A;  4QMG A;  1AZP A;  5CYU A;  4R9W A;  4V0B A;  4BY1 B;  1EY5 A;  3I90 A;  2K5D A;  3D4W A;  3S16 B;  3DUZ A;  2EXZ A;  4IFD H;  1Y8P B;  4JK1 C;  3WDN A;  4L8J A;  1Q8I A;  5DAU A;  1ZYR D;  1Y8O B;  3D4R A;  1F9R A;  1XXG A;  3HOX B;  1WTP A;  4RH6 A;  2RDG A;  3BZD B;  2C5C A;  1FNV A;  3S15 B;  5COY A;  3SVM A;  1H9R A;  1HFG A;  2NUC A;  2MUY A;  5IOC A;  3MEH A;  2EYP A;  4BS9 A;  2H4O A;  1LAB A;  4A3E B;  3NP8 A;  2RQX A;  4MN3 A;  5G3L D;  3Q6S A;  2IX3 A;  5CV8 A;  2IWH A;  1SJH D;  3G7L A;  3FPU B;  3D6W A;  4KKT A;  2CW0 D;  1STN A;  4RKB A;  3J80 L;  5EQ0 A;  2JA7 B;  3OW7 A;  5CMD A;  5JVH 3;  1QCB D;  3AB9 A;  4B9W A;  1B50 A;  4O42 A;  1XYI A;  1ESR A;  4UDU C;  1QWY A;  2F0K A;  4IFD J;  1H9M A;  3BG3 A;  4R8N A;  2PO4 A;  1SYD A;  4RGN A;  1ET9 A;  1LTI D;  1Y8N B;  2AQ1 B;  1EU4 A;  5EGT A;  2E74 C;  3NE5 B;  5KRU A;  1D1K A;  5JJZ A;  2JA8 B;  2QIL A;  3GQB A;  5G3L F;  3L3O C;  3W2D A;  1JOO A;  3J80 E;  1DCZ A;  1RJT A;  3GTJ B;  4DU9 A;  3KLR A;  2O4X A;  1TS4 A;  3K7A B;  2B2T A;  3NK9 A;  4ZQ3 A;  3IAY A;  1TWA B;  2XNA C;  3RZO B;  3HOV B;  5CGK A;  4HAE A;  1F9S A;  3LWU A;  3PUW A;  4ID6 A;  3X3N A;  4EQO A;  5LL6 S;  4X3K A;  5E4X A;  5C44 B;  4C56 C;  2BA1 A;  4K5V A;  3L9A X;  2CHB D;  3Q0A A;  2LKV A;  1TY2 A;  3HG9 A;  2QF7 A;  4OL7 A;  3M85 A;  2KHS A;  2G9D A;  1S5C D;  3SK8 A;  4K5X A;  2ICI A;  2XN9 C;  4IFD G;  1PZJ D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...