5EPLA

Crystal structure of chromodomain of cbx4 in complex with inhibitor unc3866
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
54
structure length
54
Chain Sequence
b'GSEHVFAVESIEKKRIRKGRVEYLVKWRGWSPKYNTWEPEENILDPRLLIAFQN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 SUMO-protein ligase CBX4
publication title A cellular chemical probe targeting the chromodomains of Polycomb repressive complex 1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/transcription inhibitor
total genus 11
structure length 54
sequence length 54
chains with identical sequence B
ec nomenclature ec 6.3.2.-:
pdb deposition date 2015-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5eplA00
1J8IA 1EOTA 1X3PA 4RAUC 1M8AA 2KUMA 1G2SA 1U4PA 3LWEA 2RVLA 1AZQA 2K01A 4MHEA 4CJ2C 1PFMA 1U4MA 1SSOA 3UI2A 1ILPA 2EE1A 3DEOA 4RA8A 1CM9A 1F9SA 5EJWA 1U4RA 3GV6A 1NCVA 5EPJA 4OIJA 1CA6A 3MTSA 3DEPA 2B2TA 4DN4M 1DONA 1O7ZA 3SVMA 3I90A 5EPKA 4IUVA 5D65A 1WD1A 1KNEA 2HCIA 4IUUA 2DY7A 1DZ1A 2KECA 2R3ZA 4ZK9B 2HUGA 4QUFA 1RODA 2L9HA 2N55A 5EKIA 5JJZA 5E4XA 4IUPA 4QUCA 5EPLA 2FJ2A 2RSNA 1BO0A 2X6LA 4HSVA 1PDQA 3FPUB 1Q3LA 2B2TC 1F9RA 1RTOA 1HUMA 2JP1A 2VXWA 4X3SA 1WTPA 2N88A 1HUNA 1X3QA 3F2UA 3QO2A 5D14A 1S4ZA 2B2VC 1F9PA 3GV3A 3TN2A 1BNZA 1BF4A 1TVXA 1B4OA 1DOLA 1ZXTA 1HHVA 5AFWA 4O42A 5CBEE 5COYA 1MSGA 1EL0A 2K03A 1HFNA 2RA4A 2B2YC 1A15A 1WVLA 2K04A 1XYIA 2K05A 2NZ1D 1F2LA 1DOMA 1IL8A 1LV9A 1RJTA 1SDFA 2L1BA 5DNFA 2B2VA 4IURA 1IKMA 3I91A 1NAPA 1X32A 2X6GA 3ONAB 2FMMA 5T1GA 1B53A 1PLFA 3G7LA 2X69A 5T1IA 3N52A 2B2WC 1WTRA 1J9OA 1CA5A 3IFDA 1HA6A 1F9QA 4CJ1B 2B2YA 4HCSA 1AP0A 1EIGA 2JYOA 3Q6SA 2L4NA 1ICWA 2XIWA 4IUQA 2NWGA 3DM1A 1BBXC 2HCCA 1G91A 4OIKA 1QG7A 1PFBA 2K28A 4X3UA 4CJ0B 5EQ0A 1RTNA 2Q8RE 4XDXA 4UAIA 1WD0A 1JICA 1NR2A 2MJ8A 1SAPA 2B2WA 2HDMA 4LMQD 4R8IA 4HAEA 4XT3B 3MWYW 2CVRA 1IKLA 1WTOA 2HDLA 4ZAIA 1O7YA 3D6WA 3KBXA 1MSHA 2FINB 1MGSA 2SDFA 4MN3A 4X3KA 2B2UC 4HEDA 3H91A 2FHTA 3P7JA 3KUPA 1KNAA 2H1EA 2KEDA 5E4WC 1PFNA 3R93A 1WTVA 1MI2A 1DOKA 1JE4A 2EOTA 2J7ZA 1G6ZA 1B2TA 2D9UA 2K1BA 1O80A 4XT1B 1ILQA 2MPMA 1GUWA 2L11A 1U4LA 5CMDA 2MGSA 1RHPA 4NW2A 4ZKCB 1HRJA 4RWSC 1QE6A 1E0BA 1XX8A 1EIHA 4X3TA 4ZLTF 1AZPA 2KOLA 2L12A 2B2UA 2IL8A 4ZKBB 5CORA 2KEEA 1EQTA 1ML0D 3IL8A 2Q8TA 1C8CA 4R9WA 3TZDA 2DY8A 3I3CA 1VMCA 1HFGA 3FDTA 4IUTA 2M2LA 2NYZD 2RSOA 4U68A 1WTWA 1G2TA 1ESRA 3I8ZA 1WTXA 1B50A 2KVMA 1B3AA 1QNKA 2EPBA 2FFKB 2MP1A 1VMPA 3HP3A 1WTQA 2BDNA 5CBAE 1NR4A
chains in the Genus database with same CATH superfamily
3TP7A 1X65A 5CV4A 1BQQT 2PO4A 4JI7Q 1UWVA 4DV5L 2NVTH 3HZXA 3SK6A 4A93B 1QCBD 3M3YH 1KNEA 4DR6Q 3H0GB 1YHAA 1SN8A 1K73C 1T5EA 4QGUA 3OHXC 2A68D 1QWYA 4JI0Q 1RTOA 1FGBD 1HUMA 2ENBA 2E8GA 2VXWA 2F0TA 4HCEA 1SR3A 3RUZA 1LTSD 1BOSA 1PMRA 1IW7C 3H3VH 4O42A 3IAYA 2WACA 1MSGA 1V8QA 3OW7A 1XNRQ 2Z0SA 2WAQG 4IPHA 4DR3L 3I7FA 1Y1VG 1K9MC 3JAMc 5LL6S 3PQIA 2XWJB 3HOUG 3QB3A 3I91A 2EVBA 1YVCA 2ZM6L 3F8TA 5M3MB 1M1KC 1B9MA 4NXNQ 4N9PA 4BXXG 2M9VA 4HCSA 2UXCQ 1N36Q 1Z47A 4IUQA 3J81c 2F52A 1KABA 1HR0W 3PV0A 3UE0A 2GN5A 2R92H 4LF7L 1CT1D 2R7ZH 1JICA 1JC7A 1GUOA 2VB3X 5CGKA 1ET9A 1LTBD 3MZ5A 1YNJD 4QB4A 1IKLA 3CCEA 1EZ8A 4YWLA 4LK1C 1N8RC 2ZXPA 1MJCA 4A93G 3KBXA 3CAMA 5H1SE 4LF9Q 1VQ9A 2OQKA 1SRUA 3ND8A 4X3KA 4DUYL 1HNWQ 4RGOS 3F2BA 3TEHB 3R93A 4G57A 1MI2A 1JOQA 1RF2D 3PO2G 2KJXA 1SBBB 3KF6B 1JR0D 4RMFA 3OW2A 1OTCA 3CF5A 3HOXH 1HA5A 4YCUA 2WFWA 5IGFA 4B3MQ 3JC66 2EDGA 3BYYB 2WP8J 5C3EG 1UEBA 2F0WA 3I4MH 1EQTA 1VQPA 4DXGA 4R4TA 3SK8A 2F0IA 5JEAJ 1WTXA 5JVH3 3AMUA 5ELDA 3E0JA 1A2TA 2ZJQA 1X55A 3I2ZA 2E76C 1I94Q 3D4RA 2UU9Q 3GTQH 2D2CC 3FKIH 4ODGA 4YWMA 2N78A 1C4QA 1JJCB 2VL6A 4A3BG 2NB0A 3MC0B 5IWAQ 1SNDA 1F9SA 1LT6D 4FNFA 3M7NA 3CMAA 1PFSA 1XXGA 4CKEA 1SE4A 4DR1Q 2F0UA 3CCRA 3NE5B 3K5LA 3EROA 4HIMA 2EJFC 3GTJB 3VR6A 2N55A 2FJ2A 5A2QL 2M00A 2E2HB 3C3LA 5E7NA 1UAPA 1JWSD 2ES2A 1L2FA 4IFDG 1I3QB 1SJHD 1PVOA 1CUKA 5IYCG 1WCMH 1SYCA 4JOIC 1W2BA 1Q90A 1CHPD 4Q0FA 3V2TA 2VQFQ 3S2HB 3H6MA 2N8NA 1SDFA 2Q8IB 4OO1I 5DNFA 5BR8Q 4DR2Q 4HSPA 2FMMA 3A74A 3KDFA 2F1MA 2X69A 4P71A 2B2WC 2F0JA 4K5XA 1F9QA 2AMCB 2AQ1B 3T51B 1HTPA 4CDFC 3G4SA 3J7A5 2HCCA 4KN7C 4CKBA 2K28A 4HN7A 5C4JB 3PUXA 1NUCA 3UDIA 3UDFA 4JI1L 5M5WH 1PTOB 3X3MA 1PYWD 1Q46A 1GXDC 4P74A 4TQUS 2EXDA 4LMQD 1IHZA 1V9PA 2NTSA 4XT3B 3TSSA 1I50B 2B8GA 4A3GB 1N34L 3HEJA 4BBRB 3CC7A 1PH4A 3STBD 5C44H 5A35A 1VQ5A 2CH4W 1F77A 2SDFA 3J80E 1SJED 4HEDA 1YJ9A 4B3SL 4RH6A 2KEDA 3I4NB 1F2YA 1S5DD 5IP9H 3MFGA 1EU4A 3KBGA 3NBHB 4DNIA 1J5EL 1E1OA 3R3OA 1NTGA 4LUZA 1VQ4A 4ZKBB 2J0TD 2K5VA 4HJ7A 1TQOA 3P75A 1VQ8A 4GN4B 3M4YA 2TMPA 4UDUC 1WTWA 3S14B 2ZTEA 2CFMA 2NZOA 4PNYA 2OEOA 1QNKA 4FF1A 2DUDA 4I65A 3SR1A 2XGTA 4CDDC 4OO1G 2BOSA 1JWMD 1V43A 1IYVA 1I5FA 4KY5A 4GS3A 4DV2Q 3K58A 2VZAA 3HGBA 2BA1A 3DEPA 5IP9G 1DONA 1ZYRD 3CRKC 3E9HA 2HD3A 3KF8A 2R6GA 2DY7A 5I9PA 4A3GG 4J8QA 1TWFB 1RODA 3PUWA 3DUZA 2OXPA 3LNNA 1SROA 1PTOC 3FP9A 1BO0A 3GO5A 1Q3LA 2JA7B 3QIAA 5JJLA 3I4NG 1LTAD 4N9TA 5J1ZA 1LTLA 3OIPA 2B2VC 4X65L 1YIJA 3HOYG 3DLLA 1STBA 3GP7A 5COYA 4GKJQ 3M4OB 1AH9A 4K5WA 1AW7A 4AYBG 1CZGA 4RFBA 2F0QA 1E7ZA 1U0LA 5FLMH 4GNXB 4FF4A 1XYIA 5HGQA 3NPPA 4IPDA 1EEID 2F0KA 3FHWA 3QG1A 2VQEL 5I6YA 1KD1C 4CJ1B 3BVMA 3GTKH 2QCPX 1VQGA 1IYJB 2IW3A 1XNQL 5EQ0A 3KLSA 2E2DC 1WTHA 4R8NA 4KKSA 1EWIA 1MBYA 4DV5Q 5FLXc 1E1TA 5IYBH 2AKWB 3MWYW 4KD4A 3NHHA 1ENCA 3RZDB 2NN6H 3BG3A 1SNMA 4ZAIA 4DAPA 2K50A 2K6AA 1JWUD 4QMGA 4L5RC 3CU7A 2ID0A 1FNVA 1UE5A 3OMGA 4XYOA 2CCZA 1PFNA 2AWOA 4IO9A 1UNSA 2K1BA 1GUWA 2FXQA 3VYTA 4A3KB 2RKSA 2AQ2B 1TS5A 4DR3Q 3QOJA 2EYHA 4A3JB 4DK1A 1Q8KA 1HFGA 5M3FH 2IX3A 5BN3A 3KLRA 1PH9A 5IT9c 1SEBD 1QVGA 1YNJC 4QQBX 3HP3A 1X56A 5CBAE 4NMZA 1NMFA 3GD7A 4LF6L 1D2BA 3LGJA 4A76A 4GNXC 1HNXQ 1Q81C 3A54A 4J6HA 2YTVA 4A3CG 1BKBA 1JB3A 1U4MA 4LF7Q 5JAVA 2NBFA 3K81C 5FKAC 5CC4A 4YY3L 3A5ZB 1S5CD 2JA6G 4C56C 3NTHA 4G7OC 4IALA 3J80L 2VUMB 1DM0B 3H09A 3ULLA 4ULLA 4IUPA 2A69D 5E3FA 4OWXB 1EWCA 1LTRD 1VQCA 1GHJA 1MKHA 4K2LA 5FLXE 1KXLA 2EY5A 2JP1A 2MQHA 3E6ZX 1XMOL 1KTKA 2VNUD 5CV7A 5D3DA 4IPCA 2VB2X 1ZKOA 4ZCKA 1FL0A 1SXTA 5IP7H 2B2YC 1VDZA 3W2DA 1B9NA 4GOPC 1KQSA 1EZ6A 3PO3B 4A3LH 5CYUA 3OWFA 4NDXA 1RD9D 4MNOA 4QCLA 1IKMA 2WV6D 2A6ED 2RHSB 3KYHC 3N52A 4JOIA 4C3JH 4WJ4A 3K5NA 3D3RA 4ZQ3A 4BWGB 3KF6A 1SLJA 5DM73 1X3GA 2I5MX 3S1NB 4LUVA 2Q8RE 3HG9A 4EQPA 3S2DB 5IT9E 4NXMQ 5EKKA 2JA5H 2B2WA 2PQAA 1BXTA 2D5DA 5FJ8G 4OX9L 3T13A 1WTOA 3C46A 3HOZB 3F2CA 4JI5L 4OEMB 3JAMi 2B2UC 3H91A 3J7AF 2I46A 2F0VA 2QF7A 1VQHA 1YNXA 1H9JA 1CTMA 4A3EG 3VYSA 1XX8A 2V1CC 1HNZQ 1E24A 2JXMB 3SXHA 1PA6A 1SYFA 3OIQA 3J81i 3HKZG 1FD7D 5ELCA 3S16B 1VMCA 1D7QA 3PO3G 1H95A 3S1MH 4JYAL 3KDFB 3EFXD 3OSOA 1EEFD 1K83B 4A3FH 3PIOA 1V1QA 3STBC 3GTMB 2K01A 4P72A 4JI1Q 1ILPA 1EY0A 1R9TB 4L5TA 3WOEA 1GJXA 1ASZA 3MTSA 1TIID 1EYCA 3DWPA 2KCCA 3R8BA 1N34Q 4M1UB 3NQIA 1STAA 2IT1A 2LMCB 2HUGA 2Y0SB 1A3UA 3S17B 1TWCH 4DAYB 5JEAG 2D0PA 4UP7A 4HSVA 3W3AA 4A3IH 2BDOA 2UXBQ 1STNA 1EY6A 1K8MA 4XQJA 4OL7A 1F9PA 2CH4A 4XTCS 2A6HC 3B6YA 4BY1H 4LW1A 2BH2A 1EIYB 4KY6A 3ICEA 3RR5A 3BZDB 3RD4A 1IL8A 2B2VA 4IURA 2LXJA 3K59A 1Y8NB 1GKHA 2XSCA 5T1IA 1ZYRC 1TWHB 2ZTDA 1KDCA 1B8AA 4OHJA 4K0KL 2XIWA 1Q86C 3NUCA 3I73A 2EYLA 1RTNA 1FGUA 4UAIA 3HFZB 5EGTA 2VW9A 4DR4L 3LX0A 3EIVA 2F3VA 3Q24A 3CCJA 3HOWH 5C4XH 1TR5A 3KF8B 3SEBA 1YJWA 4IQZA 2UUCL 4LUOA 1VQBA 3FRPB 5FLXL 1BVSA 4JI6L 5DEHA 3P7JA 1IYUA 1OO9B 2DNCA 4NPSA 4QY7A 3K8AA 1MJEA 3ER0A 4O1NA 4C2MB 1N33L 4LFAL 1ILQA 2EYPA 2F4VL 4ZLTF 1CZWA 3ZJYC 4J1MA 4PZ7A 4K5VA 1IBKL 4IUTA 1JMCA 3FDTA 1JB7A 2M2LA 3URYA 3PUVA 2VQEQ 4A3MG 3QR8A 4E6IA 3TDQA 1EOVA 3BYTB 3CQZH 1FNUA 1DCZA 1K8OA 5IGGA 4KMUC 1BCPD 1LTTD 3ITPA 4FXKC 3SGIA 1Q7YC 1L0YB 1XNQQ 1LYLA 1X3FA 4CJ2C 1VQJA 2WAQB 3U4ZA 1Y1VB 2IJ0A 1LABA 3J7ZC 1B3QA 2JA8G 3SVMA 2JQOA 3OMCA 5D65A 4MTNA 4GNXA 3TMEA 4BBSG 3CKIB 1YI2A 2R3ZA 4TSSA 3KK7A 3RNUA 2NVXH 5DAUA 1RDPD 1X54A 4DV0L 3F2UA 1STHA 3GTPB 4BY7H 1I6HH 5GROA 3GTGH 4DUZL 2F0OA 4RGNA 3PGZA 1M90C 2RBMA 3H3VI 1VQFA 1XTCD 3K7UC 2O5JC 2IX0A 3K5MA 1HH2P 2K04A 4Z9CB 1ONLA 1OXTA 1B53A 1TY0A 2AUKA 3IFDA 3PO2B 2B2YA 3GTOB 4GOPA 1BBXC 4LF8L 1E3PA 4L6TB 2XN9C 4HIOA 1SMYD 4P75A 1VQIA 2R7DA 4OIKA 3S15H 2A69C 1CKNA 1WD0A 4FP5D 2B63G 3X3NA 1XJVA 2QEJC 4YY3Q 5C3EB 2E2IB 4DV4L 3VA5A 5K36H 5TSSA 2A73B 5IODA 4X62Q 1ASYA 5ELEA 2R7ZB 1MSHA 1LT5D 2WB1E 2PMZE 4H02A 1TY2A 2Z8LA 2RQXA 2H1EA 3AU7A 3L3OC 1JCKB 4I7ZC 5ELBA 1WTVA 3RZOB 1XMOQ 1K0SA 1TWAB 2D9UA 2UXDL 3CCSA 2L11A 3ZYYX 3H0GH 4A3BB 5I2XA 1EIHA 4MIUA 3SHLA 1JQYD 2B2UA 4K6DA 2KEEA 3T1HL 2EQSA 1C8CA 4YHHL 3IRBA 3I3CA 3GDEA 1FVIA 3P1HA 2RSOA 1HZBA 4MZ9A 3D31A 3G48A 4DKAC 4F88A 1J8IA 3K5OA 4DNRB 1G291 2BH8A 3H3VC 5EKLA 3W1BA 3PUYA 3FPPA 2MO0A 4DFAA 3TQYA 2PPBC 1KHIA 4RA8A 3MHBA 1K28A 5M3MH 4GKKL 5EJWA 3ULJA 2PQAB 3GV6A 2R93H 1PZKD 3GTQB 3FKIB 1JT8A 4DU9A 3FVQA 2EYFA 4C3IH 2KECA 1IBLL 3SK5A 4JI5Q 3V05A 4QUFA 2DN8A 3TZUA 2R92G 2R7ZG 2CQOA 4DR7Q 2RDHA 2OTLA 1OXUA 4GLVB 1A2UA 1JJGA 4L5SA 3BDOA 5D14A 3TN2A 2OF1A 2E2JB 2F03A 4IUNA 3MEFA 3J80c 4JW0A 4EQNA 4OWWB 3PMFA 1Y14B 3K7AB 1A15A 1I4RA 1M4VA 1PYSB 2K05A 3HOXG 1NBWA 1DOMA 1GOZA 2KQ3A 1PRTD 3PF5A 1K8AC 1GM5A 3UDXA 2N49A 2Z4HA 3G7LA 5GAEC 1L1OC 5M9OA 4B9XA 3I4MG 1AP0A 2JYOA 2NWGA 1IXRA 1Y69U 4ZYSA 1C7YA 1QG7A 1LTID 2IHEA 1RCVD 3RMHA 1SYEA 4LWCA 1TS3A 2KA7A 1SFOB 4HJAA 4Y7NB 4JI2L 2O4XA 4KLKA 1BR9A 3FKIG 2E75C 1FR3A 3CRLC 1A8VA 2SOBA 2WINB 1KC8C 4IJHA 2PI2E 1QVFA 3KLWA 2K14A 1CKOA 1EQRA 1XWEA 5LMUQ 1UEAB 1O78A 1BCPF 1JE4A 3MXPA 4X6AH 5LMNL 3T16A 3K6OA 4P73A 4ZKCB 2H4OA 1QE6A 3MXGA 3GTJH 3D4WA 1SNOA 2KOLA 1VQ7A 2V4DA 4CHTB 3PF4A 5FO7B 3A7AB 2E2HH 3T1YL 5I2YA 3T56B 1PH7A 1GD7A 4RCOA 1CKMA 1I3QH 1WCMG 4C3HH 2MP1A 4EQ5A 4KK7A 1VMPA 4TKOB 2KHJA 3L9AX 1SE2A 4DAYA 4K0KQ 2MUYA 3OPOA 4LJZC 3MEHA 3HOYB 2HIXA 1GO3E 4LNQA 3AEVA 3U9OA 4AYBB 1CM9A 4DR4Q 2WB1G 1FJGL 4B3TL 3A8IE 5EPJA 4PMBA 1VQLA 4S3SA 5KNDA 3BVZA 2UUCQ 4UPAA 1PHJA 2HIVA 4JK1C 2SNSA 4JI6Q 1TWGB 2B3GA 2EXZA 5C4JH 1HJPA 2ATWA 4LF4L 1XTDA 4JI3L 2ZJPA 2NVYB 4OGQC 1KDAA 5AJ3L 4LFAQ 1BNZA 1I50H 2O2LD 4HJ8A 5GADC 1ZXTA 2ZT9C 4BBRH 5C44G 3BDLA 1EL0A 4K8IA 4IPGA 2LS01 1IBKQ 2ICIA 2L15A 4QIWE 4GZYC 3H94A 1IL2A 4F8MA 1PXUA 3TP5A 1X6OA 1QZGA 1XPRA 3BJUA 5T1GA 4GLAC 4FF3A 1YHBA 5CV9A 2EJGC 2K75A 5C5LA 4QF4A 4AQYQ 1PH2A 1SYGA 5JJKA 4XDXA 3KLSX 2YTXA 4A3DH 3NTKA 4DPGA 3O13A 4LAAA 1N9WA 1SNCA 1VCIA 4H44C 3VR3A 2OWOA 2KENA 4KN4C 3NWSA 1MGSA 1PH6A 2NN6I 2KCMA 1AN8A 4LFCL 2E5LQ 2K5DA 3BS1A 5E4WC 1U5KA 4OONA 4DV0Q 4F7XA 3A56A 1DGSA 3CD6A 4C1NI 4RG1A 1NY4A 4POFA 1AFPA 2CW0D 4KI0A 5CMDA 1RHPA 1XMQL 1MHWC 3AYHB 2A68C 1TWFH 3E0EA 2F0HA 2CHBD 2JA6B 2KBNA 4IJLA 3KJOA 2JA7H 1GHKA 2PCFB 5C0XH 3A5UA 4LFBL 2NUCA 2I5LX 2IPKD 2KVMA 3DMUA 3CMEA 2NVQH 3KFUA 3M4OH 1HXYD 3DWAA 2HHHL 4A3DG 1EOTA 1X3PA 4JI8L 4GOPB 3J7YW 3VA7A 4KD3A 5FLMG 4APVA 1QNUA 4I7AA 2OQ0A 1CKNB 1SSOA 1V1PB 2K7VA 3CCQA 2LFNA 1DYQA 1CA6A 4DV4Q 2F3WA 5IGCA 4DN4M 1N32L 1O7ZA 1YITA 3TBIB 3I90A 3TP6A 1ICFB 1PRTF 1NNXA 3CXCA 2ZM6Q 5BN5A 3UE1A 2RSNA 2X6LA 5IYBG 2L55A 3AFPA 3MA2B 2NN6G 3RZDH 5LL6X 1HZCA 1HHVA 4X66L 2D0OA 5M5XB 3ERQA 1HFNA 4G7HC 1HQRD 3M7GA 3S1QB 1A0IA 5KYIA 1B7YB 2DGYA 1KAAA 3KOJA 2RCNA 4DR6L 1B1ZA 1X32A 4A3KH 5ELNA 1K8GA 4DUYQ 2I07B 1J9OA 3CP0A 3S9WA 2Z6BA 5EBCA 5JPNC 3DM1A 4A3JH 3E5SA 4A3EB 5M3FG 4Y52H 4X3UA 2BCOA 3HRZC 4KHZA 4RHSA 1HTLD 3HKZB 3FEWX 3VDYA 2B39A 2IWHA 1L1OA 3BU2A 4R8IA 1MIUA 3MAQA 2E74C 1KRSA 1VQKA 2EZVA 5I9OA 1G51A 1IBLQ 1ENFA 3RN2A 3QWNA 1CSPA 4B08A 1GVPA 1YNND 2HT1A 3KUPA 2UXCL 4XQQA 1YJNA 2SEBD 2EOTA 1B2TA 1AEXA 3ND9A 4OXPA 4L5QA 2VUMH 1EQQA 4ABNA 3GTLB 3V96A 3SK4A 2KHIA 1JORA 3U50C 1H9RA 5JJIA 4LF9L 2VS1A 4WJ3M 2FFKB 5IP7G 2Q2UA 1SYDA 1NR4A 2B2TC 3W5OA 2HQLA 3T53B 4PZ6A 5GAGC 4UP9A 3J7AV 4XQNA 5C5MA 4A3LG 3LWEA 4K2KA 3NELA 1UUPA 4B3ML 4ME5A 4DNTB 1ET6A 1NCVA 4JI2Q 4C3JG 4NB3A 1WD1A 4FXDA 4ZK9B 1UE7A 5E4XA 3S2DH 2JA5G 2N88A 1X3QA 5LMNQ 2DJFC 3GQBA 3HOZH 1DOLA 1ZEQX 1D8LA 2JK8A 5IWAL 3WOFA 2PYKA 1CSQA 1WJJA 3OYYA 1H9KA 4PZ8A 1VF7A 5HURA 2G9DA 1GUNA 4HMJA 2RHQB 4BY1B 3WWVA 4DXFA 3S24A 1O7IA 4JBJA 5IGDA 4B3SQ 4OWTB 2JE6I 1EUJA 1H9SA 4PMCA 1UE1A 2L4NA 3NXWA 1E2WA 3RLOA 1J5EQ 2JA9A 1FJGQ 3PCOB 4K8JA 2VQFL 4A3FG 1K83H 4QJFA 2NTTA 1LACA 4HAEA 2ZXOA 4R4OA 4HTHA 4XXEA 2UUAL 3J80i 1EYGA 3GTMH 2D62A 4A3MB 1WOCA 2FINB 4FDBA 2JEAI 1LM0A 2IHFA 1Y1WH 5IYDH 4G7ZC 4JI3Q 5C4XB 5AJ3Q 1B44D 4UHVA 4DK0A 1ESFA 2XVSA 5IOCA 1DJRD 2BE5D 4PQXA 1K0RA 2L12A 2F0EA 4H0LC 4JC0A 4A3IG 1X9NA 1ML0D 2XRQD 2JA8B 5FK9C 5DM63 3VR2A 2A19A 5J3BA 2PZUA 2K52A 4BBSB 2C35B 3P20A 4BY1G 5HGTA 4YIJA 1CQVA 2BDNA 1RIPA 4ILWA 3Q22A 1QJOA 4PV1C 4R4QA 1J6QA 4CGYB 4X65Q 1PFMA 3I72A 2A5HA 1EY9A 2AUJD 1CK1A 1TWHH 2QDBA 5ELOA 2F0DA 2CW0C 1DZ1A 3NEMA 4JG2A 4XIGS 4LFCQ 2YU9B 3Q8DA 1GUTA 1JOOA 4WJWA 5CR3A 1BUVT 5C0XJ 4RKBA 3HOWG 1F9RA 2Z9HA 5M5YB 4O2DA 5C4XG 2F0NA 3S1RB 3HOVH 5C3XA 3BZCA 1XMQQ 1BF4A 2ALYB 3FMCA 2YV5A 3MXNB 4DV2L 5CV8A 2B63B 3TS0A 2K5HA 2C9OA 2NZHA 3CCVA 4M8AA 3CCUA 1WVLA 4LFBQ 1BDOA 1EY7A 2DJGC 2ZXRA 4EGVA 1H9MA 4UP8A 5JOBA 4YCVA 4B9WA 2NVTB 4JI8Q 1HA6A 5GQOA 1ICWA 1F2MA 2LXKA 5IGEA 3M3YB 5C6AA 3VR4A 3DWQA 1PFBA 4CJ0B 3OTOL 4CKCA 4WORA 4H7BA 1D1KA 4YCWA 3CCMA 1PTOD 1S40A 3D4DA 2F0MA 1Z9FA 2F3IA 1B70B 1O7YA 5J39A 4BA2I 2Z4IA 4LF6Q 1PH3A 1PH5A 1Y1VH 4YWKA 3IKJA 4XT1B 2XRSD 3HOUH 4X66Q 4NW2A 2B8FA 1KDBA 3RN5A 3HKSA 3CHBD 1V1PA 3K80C 2IY5B 2IL8A 4BXXH 3A8JE 3NENA 1TS4A 1R4QB 1KAWA 2CQAA 4ZUIA 1V1OA 2MNAA 4AIMA 3TREA 4BY7G 4U68A 3GTPH 1G2TA 2J4XA 1DD2A 4DV1L 2R92B 2I0QA 1B3AA 3LWUA 3OOCA 1Q8IA 5FO8B 4RGMA 4ID6A 1G2SA 3NSWA 5CV6A 2F0PA 1D5MC 2PZWA 1YNNC 4A93H 2A6EC 1VQOA 2MHVA 1A3VA 4KHPL 5ELFA 1OXXK 1YZ6A 3F2DA 2C5CA 3AB9A 1U4RA 1L1OB 5KGUA 3CC2A 4LF5L 1Y8OB 1A62A 2B2TA 3PO2H 4L8JA 1II3A 4DV3L 3HOXB 3GTOH 4CDEC 3E9IA 2R93B 5JJZA 3I4MB 5C3EH 1STEA 1G8ZD 4J15A 1L0WA 2E2IH 1HCZA 1HNXL 4C3IB 5K36G 1C0AA 1I6VC 1VQAA 3U9SA 4DR5L 2UUBL 5I6WA 4OX9Q 1NJIC 3RZOH 1I4XA 2PZTA 1NSNS 1KRTA 1TWAH 2L1BA 3I4LA 3H0GG 3G6EA 2F0GA 1EWHA 4A3BH 1SE8A 4IFDI 1P8LA 1KL9A 1SNQA 4KJNA 2VY3A 4RGTA 1LLRD 4HR7B 2JEBI 1VQ6A 3L7ZC 3G71A 3CCLA 2XNAC 3MFYA 2F0FA 3L2PA 2FMCA 2LY7A 2MJ8A 5ISRA 2K32A 4Q5VA 1LT4D 1SAPA 2F0SA 2HDMA 2TSSA 3EA6A 3CC4A 2CVRA 3F1ZA 4A75A 3EBEA 5LMNW 3NWTA 1HR0L 2I5HA 2SNMA 3I70A 4JCVE 4AYBE 1WCMB 4JYAQ 4IFDH 5IYCH 1TU2B 4F87A 2R93G 5M3MG 2JJQA 3K0XA 3JAME 1U4LA 1UE6A 2CKZB 3QJYA 4RHRA 1ENAA 4C3IG 1E0BA 2WB1B 2PMZB 2MFIA 3J81j 4NXML 2EJMA 4KKUA 5CORA 5E1FA 4DV7L 3A7LA 1EY5A 3ULPA 1X3EA 3J81E 3I8ZA 1BBUA 3K57A 2E2JH 5M5WB 2JN4A 2EPBA 5K5PA 1BCPB 2H5XA 1H9SB 3VYRA 2B29A 1YHQA 3K7AH 1STGA 3Q23A 4KY7A 1SYBA 4IN3A 5C44B 4C3HB 3UI2A 1HNZL 3AFQA 1VS0A 4BS9A 3PIPA 4B3RL 2UUAQ 4PMWA 3PIP3 1G6PA 2BE5C 1SMXA 2Q2TA 1GUGA 3NQTA 5EPLA 2RDGA 4A4IA 1SFOH 1HUNA 4Y7NH 3N6RA 2RDFA 5HY6A 3S2HH 1S4ZA 4RCNA 1U9RA 3E3XA 1PZJD 1TXYA 1LUZA 5LHY1 1D1IA 4HIDA 1PTOF 4OO1H 2RCFA 3EN2A 2ASBA 1NAPA 1I4HA 2OT2A 1Z6HA 1YBYA 1O7LA 3U58A 1PTOH 3VYUA 2UXBL 2A1AA 1N33Q 4JBMA 4POGA 2EYJA 4A3GH 2F4VQ 4C3HG 2EY1A 2HQEA 1BCPC 1E2VA 2RF4A 4JI4L 4GN5A 4JV5L 1A63A 3I4NH 3H15A 3EJIA 3HOYH 1T5XD 1CHQD 5IGBA 2A6HD 1EY8A 4MN3A 4A3DB 4DA2A 2A74C 2FHTA 4BA1I 2P5ZX 5DLQE 4EX5A 3OWEB 3I56A 2MPMA 4JPBW 1TWGH 3S14H 5J22A 1CI3M 4DAMA 2Q2IA 1D6EC 2GA4B 5CV5A 4HJ5A 3IL8A 4R9WA 2ZTCA 1HZ9A 3GTKB 2NVYH 5C3WA 2AQ3B 4BBRG 4X64L 3C1FA 5C0XI 3NP8A 1LT3D 5G3LD 1K3BC 2KCTA 4RAUC 1M8AA 4FXGC 1U4PA 3EQLC 5IE8A 1WI5A 3OTOQ 4DUZQ 3DXJC 2NVQB 3MXNA 1EYAA 2EE1A 2YTYA 4OELB 1QUQA 3RLFA 1SMYC 4TVAB 4HJ9A 1QOHA 1KIXA 2LSSA 1K3RA 1QVCA 3HKZE 5EKIA 3A0JA 3JAML 3FPUB 1PZID 4LF8Q 1VQDA 5M3FB 3AQQA 1TVXA 4AH6A 1LTGD 4EQOA 5I4DA 5AFWA 2A8VA 1VQEA 1TKWB 5FOBB 1W6JA 2RA4A 5KIXA 3J81L 3IFTA 2PQEA 4GN3B 4NKLA 1EY4A 1PRTB 3A55A 4L63B 1R4PB 3D6CA 1LV9A 4DV1Q 1AZQA 1RJTA 1IBML 4A3CH 2ICEC 2LKVA 2X6GA 3ONAB 1EQVA 3BDCA 4JVZA 4H13C 4DV6L 1KLGD 4R1JA 1WFQA 2QILA 4QIWB 2JA6H 2JA7G 5C0XG 2UXDQ 2WKDA 4N8X1 4KHPQ 4JI7L 4U673 2CWAA 2K4KA 4LF5Q 2Z6KC 4V0BA 1E2ZA 4KJOA 4DV3Q 3T1HQ 4YHHQ 3DM3A 2PNRC 3KJPA 2OTJA 1F2ZA 4PG3A 3PSIA 2EIFA 3Q0AA 3CW2C 1TS2A 4IZ8A 3C1EA 1W3SA 4HMIA 3VR5A 1LO5D 1Y8PB 2EYMA 4JI0L 1G6ZA 1O80A 4CDCC 4FVMA 5L37A 1L0XB 3BVGA 5KEEA 2PNHA 4GKKQ 1QZHA 4C3JB 4DR5Q 3U4VA 2UUBQ 1XNRL 1EIFA 5EBDA 2QA4A 3MVVA 1OXVA 1D5ZC 1AE3A 1PYBA 4X62L 4K14A 4QL5A 4FF2A 1ESRA 4KKTA 1IW7D 5M5XH 3HS0C 2JA5B 2YYZA 4ZRZA 4NXNL 5FJ8H 4IFDJ 1XPOA 1N36L 2L5TA 1C9OA 3S1QH 2DNEA 1PRTC 2RVLA 5EAYA 4IOCA 2QKIC 2IX1A 2Y0SE 4A3KG 4KTAA 1BBWA 3DEOA 4O0AA 1OXSC 1QILA 3PUZA 4A3JG 2KCNA 5EPKA 1TT2A 1Q82C 1HR0Q 2EYOA 4IUUA 4A3EH 5C4HA 5KYLA 1HNWL 1JOKA 3TP8A 4ZUJA 3GV3A 3PO3H 1P16A 3S1MB 4HIKA 5NUCA 1Z7TA 1YEZA 5D3IB 5CBEE 2ZJRA 1I4QA 2CWPA 4A3FB 4WFN3 5BN4A 3D0FA 4DV7Q 4JBKA 1GUSA 4GLXA 2Q2HA 1I4PA 4DAVA 2PW7A 2G5DA 3M9BA 1F2LA 1KLUD 1W6KA 3M4PA 4UY8C 2VUMG 1HQMC 2QDLA 3S1NH 2R61A 1PLFA 4FYDA 2OCEA 4P2CB 1WTRA 4DR7L 3GTLH 1E22A 3BZKA 3ERSX 1SE3A 4JBWA 1PH8A 1I94L 2QW7A 2UU9L 1G91A 1MD2D 2BA0A 4FO2A 1TWCB 2MO1A 5JEAH 4R4IA 4A3IB 1JJ2A 2N3SA 4ALPA 4B3RQ 1D5XC 3M85A 3I55A 3D8GA 1S72A 1VF5C 3T4AC 2HDLA 4C1NK 2Z1CA 3T1YQ 4V190 4DR1L 2WKCA 3D6WA 1JE5A 1C48A 1FNWA 1PV4A 5G3LF 2O5IC 2EY6A 1Q1BA 4NP5A 1DOKA 4XYQA 1A3TA 3PIO3 3WDNA 2WIIB 3S16H 4RKLA 1I4GA 2MGSA 1Y1WB 1HPCA 2K5NA 4X3TA 3K0YA 1XPUA 4B3TQ 4EVOA 3G6JB 1DXMA 1S5FD 3NK9A 2K5WA 3HOZG 1B50A 5BR8L 4DR2L 2WAQE 3TRZA 2F4IA 3RLNA 4LF4Q 5KRUA 3DHQA 5LMUL 3HOWB 1R9TH 1SNPA 2KUMA 4MTKA 1CQFA 1AE2A 4DGZA 4MHEA 1CFMA 4DK6C 4JI4Q 1S3OA 3S17H 1VQMA 4OIJA 4JV5Q 1RKNA 5FO9B 2EY2A 4CBVA 5IIFA 1S5ED 1S5BD 4IUVA 2HCIA 3EVQA 3W1GA 2L9HA 3SDZA 4QUCA 2K5QA 1PDQA 5IY0A 4X3SA 1WTPA 1EFWA 3QO2A 2XWBB 2JSOA 5KNCA 3CPWA 1Q1EA 1B4OA 4A3MH 3NBHA 3CQZB 2K03A 1Y1WG 5IYDG 4K6LA 1STYA 2KHSA 1QB5D 3HOVB 2L0CA 3NBIA 4R4CA 1HZAA 2G9HD 5JVG3 2PW5A 2XTIA 4KHVA 2NZ1D 4KV6A 2QGQA 4X64Q 1PH1A 2GVBA 2Y0SG 4DK3C 5GAHC 2AHOB 2K33A 1EYDA 1CA5A 1EIGA 3L0OA 3NTIA 3Q6SA 1WYDA 2JA8H 4BBSH 3SE0A 1EFID 1NMGA 5KNBA 3M4QA 2NVXB 2PI2A 1NR2A 1RL2A 1QUQB 4DF7A 4TRDA 1Q12A 1FYCA 3I4OA 1EU3A 3QOLA 4BY7B 1A6XA 1I6HB 3GTGB 4C2MH 1VQNA 3R2TA 4ME3A 5F2DA 1IZ6A 1KNAA 2HHHQ 2Z6KA 1T9HA 2J7ZA 2R7FA 5IT9L 4AQYL 3UDGA 4IOAA 5A2QE 5JPMC 1HRJA 4N8FA 4RWSC 3R2IA 3C2PA 1AZPA 2YU9H 4GKJL 1NE3A 3CPFA 1N32Q 2Q8TA 3A8KE 3HOUB 3TZDA 2DY8A 5M5YH 3HOVG 1IBMQ 2AWNA 2NYZD 3S1RH 2F0LA 4WRDA 3S15B 3MXUA 4G4KA 2QEXA 2GVAA 4DV6Q 5C4ZA 2B63H 2E5LL 3TS2A 1WTQA
chains in the Genus database with same CATH topology
3TP7A 5CV4A 1BQQT 2PO4A 3HZXA 3SK6A 4A93B 1QCBD 1KNEA 3H0GB 1T5EA 3OHXC 2A68D 1QWYA 1RTOA 1FGBD 1HUMA 2ENBA 2VXWA 2F0TA 4HCEA 3RUZA 1LTSD 1BOSA 1PMRA 1IW7C 4O42A 3IAYA 2WACA 1MSGA 1V8QA 3OW7A 5LL6S 2XWJB 3QB3A 3I91A 2EVBA 5M3MB 1B9MA 4N9PA 2M9VA 4HCSA 1Z47A 4IUQA 1KABA 3PV0A 1CT1D 1JICA 1JC7A 1GUOA 2VB3X 5CGKA 1ET9A 1LTBD 3MZ5A 1YNJD 4QB4A 1IKLA 1EZ8A 4LK1C 2ZXPA 3KBXA 3ND8A 4X3KA 4RGOS 3R93A 4G57A 1MI2A 1JOQA 1RF2D 2KJXA 1SBBB 1JR0D 1HA5A 5IGFA 2EDGA 3BYYB 2WP8J 2F0WA 1EQTA 4DXGA 3SK8A 2F0IA 5JEAJ 1WTXA 5JVH3 3AMUA 5ELDA 3E0JA 1A2TA 2E76C 3D4RA 2D2CC 4ODGA 1C4QA 2NB0A 3MC0B 1SNDA 1F9SA 1LT6D 4FNFA 3M7NA 1XXGA 4CKEA 1SE4A 2F0UA 3NE5B 3K5LA 3EROA 2EJFC 3GTJB 3VR6A 2N55A 2FJ2A 5A2QL 2M00A 2E2HB 3C3LA 1UAPA 1JWSD 4IFDG 1I3QB 1SJHD 1SYCA 1Q90A 1CHPD 4Q0FA 3V2TA 3S2HB 3H6MA 1SDFA 2Q8IB 4OO1I 5DNFA 4HSPA 2FMMA 2F1MA 2X69A 2B2WC 2F0JA 4K5XA 1F9QA 2AQ1B 3T51B 1HTPA 2HCCA 4KN7C 4CKBA 2K28A 4HN7A 5C4JB 3PUXA 1NUCA 1PTOB 3X3MA 1PYWD 1GXDC 4TQUS 4LMQD 1IHZA 2NTSA 3TSSA 4XT3B 1I50B 2B8GA 4A3GB 3HEJA 4BBRB 5A35A 1F77A 2SDFA 3J80E 1SJED 4HEDA 4RH6A 2KEDA 3I4NB 1F2YA 1S5DD 3MFGA 1EU4A 3KBGA 3R3OA 4ZKBB 2J0TD 1TQOA 3P75A 3M4YA 2TMPA 4UDUC 1WTWA 3S14B 4PNYA 2OEOA 1QNKA 4FF1A 4I65A 3SR1A 4OO1G 2BOSA 1JWMD 1V43A 1IYVA 4KY5A 3K58A 3HGBA 2BA1A 3DEPA 1DONA 1ZYRD 3CRKC 3KF8A 2R6GA 2DY7A 5I9PA 4J8QA 1TWFB 1RODA 3PUWA 3DUZA 2OXPA 3LNNA 1PTOC 1BO0A 3GO5A 1Q3LA 2JA7B 3QIAA 1LTAD 4N9TA 5J1ZA 3OIPA 2B2VC 1STBA 3GP7A 5COYA 3M4OB 4K5WA 1AW7A 1CZGA 4RFBA 2F0QA 4FF4A 1XYIA 3NPPA 1EEID 2F0KA 3QG1A 5I6YA 4CJ1B 3BVMA 2QCPX 2IW3A 5EQ0A 3KLSA 2E2DC 4R8NA 4KKSA 1MBYA 3MWYW 4KD4A 3NHHA 1ENCA 3RZDB 2NN6H 3BG3A 4DAPA 1SNMA 4ZAIA 2K6AA 1JWUD 4QMGA 3CU7A 2ID0A 1FNVA 3OMGA 4XYOA 1PFNA 2AWOA 1UNSA 2K1BA 1GUWA 3VYTA 4A3KB 2RKSA 2AQ2B 1TS5A 3QOJA 2EYHA 4A3JB 4DK1A 1HFGA 2IX3A 5BN3A 3KLRA 1SEBD 1YNJC 3HP3A 5CBAE 4NMZA 3GD7A 1D2BA 3A54A 4J6HA 1JB3A 1U4MA 5JAVA 2NBFA 5FKAC 5CC4A 1S5CD 4C56C 3NTHA 4G7OC 4IALA 3J80L 2VUMB 1DM0B 3H09A 4ULLA 4IUPA 2A69D 5E3FA 1EWCA 1LTRD 1GHJA 4K2LA 5FLXE 2EY5A 2JP1A 3E6ZX 1KTKA 2VNUD 5CV7A 5D3DA 2VB2X 1ZKOA 1SXTA 2B2YC 1VDZA 3W2DA 1B9NA 1EZ6A 3PO3B 5CYUA 3OWFA 4NDXA 1RD9D 4QCLA 1IKMA 2WV6D 2A6ED 3N52A 3K5NA 3D3RA 4ZQ3A 4BWGB 5DM73 3S1NB 2Q8RE 3HG9A 4EQPA 3S2DB 5IT9E 5EKKA 2B2WA 1BXTA 2D5DA 3T13A 1WTOA 3C46A 3HOZB 2B2UC 3H91A 3J7AF 2I46A 2F0VA 2QF7A 1H9JA 1CTMA 3VYSA 1XX8A 2JXMB 3SXHA 1SYFA 3OIQA 1FD7D 5ELCA 3S16B 1VMCA 3EFXD 3OSOA 1EEFD 1K83B 3GTMB 2K01A 1ILPA 1EY0A 1R9TB 3WOEA 1GJXA 3MTSA 1TIID 1EYCA 3DWPA 2KCCA 3R8BA 4M1UB 3NQIA 1STAA 2IT1A 2LMCB 2HUGA 2Y0SB 1A3UA 3S17B 5JEAG 4HSVA 3W3AA 2BDOA 1STNA 1EY6A 1K8MA 4XQJA 4OL7A 1F9PA 4XTCS 2A6HC 4KY6A 3BZDB 3RD4A 1IL8A 2B2VA 4IURA 3K59A 1Y8NB 2XSCA 5T1IA 1ZYRC 1TWHB 1KDCA 4OHJA 2XIWA 3NUCA 3I73A 2EYLA 1RTNA 4UAIA 5EGTA 3LX0A 2F3VA 3Q24A 1TR5A 3SEBA 4IQZA 3FRPB 5FLXL 5DEHA 3P7JA 1IYUA 1OO9B 2DNCA 4O1NA 4C2MB 1ILQA 2EYPA 4ZLTF 1CZWA 4J1MA 4K5VA 4IUTA 3FDTA 2M2LA 3URYA 3PUVA 4E6IA 3TDQA 3BYTB 1FNUA 1DCZA 1K8OA 5IGGA 4KMUC 1BCPD 1LTTD 3ITPA 4FXKC 1L0YB 4CJ2C 2WAQB 1Y1VB 2IJ0A 1LABA 3SVMA 3OMCA 5D65A 3TMEA 3CKIB 2R3ZA 4TSSA 3KK7A 5DAUA 1RDPD 3F2UA 1STHA 3GTPB 2F0OA 4RGNA 2RBMA 1XTCD 2O5JC 2IX0A 3K5MA 2K04A 4Z9CB 1ONLA 1OXTA 1B53A 1TY0A 2AUKA 3IFDA 3PO2B 2B2YA 3GTOB 1BBXC 4L6TB 2XN9C 1SMYD 4OIKA 2A69C 1WD0A 4FP5D 3X3NA 2QEJC 5C3EB 2E2IB 3VA5A 5K36H 5TSSA 2A73B 5IODA 5ELEA 2R7ZB 1MSHA 1LT5D 1TY2A 2Z8LA 2RQXA 2H1EA 3AU7A 3L3OC 1JCKB 4I7ZC 5ELBA 1WTVA 3RZOB 1TWAB 2D9UA 2L11A 3ZYYX 4A3BB 5I2XA 1EIHA 4MIUA 3SHLA 1JQYD 2B2UA 4K6DA 2KEEA 1C8CA 3I3CA 3P1HA 2RSOA 3D31A 1J8IA 4F88A 3K5OA 4DNRB 1G291 3H3VC 5EKLA 3PUYA 3FPPA 4DFAA 2PPBC 4RA8A 3MHBA 5EJWA 3GV6A 1PZKD 3GTQB 3FKIB 4DU9A 3FVQA 2EYFA 2KECA 3SK5A 3V05A 4QUFA 2DN8A 3TZUA 2RDHA 1OXUA 1A2UA 3BDOA 5D14A 3TN2A 2OF1A 2E2JB 2F03A 4IUNA 4EQNA 3PMFA 3K7AB 1A15A 1I4RA 1M4VA 2K05A 1DOMA 1GOZA 2KQ3A 1PRTD 3G7LA 2Z4HA 5M9OA 4B9XA 1AP0A 2JYOA 2NWGA 1Y69U 4ZYSA 1QG7A 1LTID 1RCVD 3RMHA 1SYEA 1TS3A 2KA7A 1SFOB 4Y7NB 2O4XA 1BR9A 2E75C 1FR3A 3CRLC 2SOBA 2WINB 1XWEA 1UEAB 1O78A 1BCPF 1JE4A 3MXPA 3T16A 3K6OA 4ZKCB 2H4OA 1QE6A 3MXGA 3D4WA 1SNOA 2KOLA 2V4DA 4CHTB 5FO7B 3A7AB 5I2YA 3T56B 4RCOA 2MP1A 4KK7A 1VMPA 4TKOB 3L9AX 1SE2A 4DAYA 2MUYA 3OPOA 4LJZC 3MEHA 3HOYB 3U9OA 4AYBB 1CM9A 3A8IE 5EPJA 4PMBA 4S3SA 5KNDA 3BVZA 4JK1C 2SNSA 1TWGB 2EXZA 2NVYB 4OGQC 1KDAA 1BNZA 2O2LD 1ZXTA 2ZT9C 3BDLA 1EL0A 4K8IA 2LS01 2ICIA 4GZYC 3H94A 4F8MA 1PXUA 3TP5A 5T1GA 4FF3A 5CV9A 2EJGC 5C5LA 4QF4A 1SYGA 4XDXA 3KLSX 3NTKA 3O13A 4LAAA 1VCIA 1SNCA 4H44C 3VR3A 4KN4C 3NWSA 1MGSA 2NN6I 1AN8A 2K5DA 3BS1A 5E4WC 4F7XA 3A56A 4C1NI 1AFPA 2CW0D 4KI0A 5CMDA 1RHPA 2A68C 2F0HA 2CHBD 2JA6B 1GHKA 2PCFB 5C0XH 2NUCA 2IPKD 2KVMA 3DMUA 1HXYD 3DWAA 1EOTA 1X3PA 3J7YW 3VA7A 4KD3A 1QNUA 1SSOA 1V1PB 2K7VA 2LFNA 1DYQA 1CA6A 2F3WA 5IGCA 4DN4M 1O7ZA 3TBIB 3I90A 3TP6A 1PRTF 5BN5A 2RSNA 2X6LA 2L55A 3MA2B 2NN6G 5LL6X 1HHVA 5M5XB 3ERQA 1HFNA 4G7HC 1HQRD 3M7GA 3S1QB 5KYIA 1KAAA 1B1ZA 1X32A 2I07B 1J9OA 3S9WA 5EBCA 5JPNC 3DM1A 3E5SA 4A3EB 4X3UA 2BCOA 3HRZC 4KHZA 4RHSA 1HTLD 3HKZB 3FEWX 2B39A 2IWHA 3MAQA 4R8IA 2E74C 2EZVA 5I9OA 1ENFA 3QWNA 4B08A 1YNND 3KUPA 4XQQA 2SEBD 2EOTA 1B2TA 1AEXA 3ND9A 4ABNA 3GTLB 3V96A 3SK4A 1JORA 1H9RA 2FFKB 1SYDA 1NR4A 2B2TC 3T53B 3J7AV 4XQNA 5C5MA 3LWEA 4K2KA 1UUPA 4ME5A 4DNTB 1ET6A 1NCVA 4C3JG 1WD1A 4FXDA 4ZK9B 5E4XA 2N88A 1X3QA 3GQBA 1DOLA 1ZEQX 3WOFA 2PYKA 1H9KA 1VF7A 5HURA 2G9DA 1GUNA 4HMJA 4BY1B 4DXFA 5IGDA 2JE6I 1H9SA 4PMCA 3NXWA 2L4NA 1E2WA 4K8JA 2NTTA 1LACA 4HAEA 2ZXOA 4HTHA 4XXEA 2D62A 4A3MB 2FINB 2JEAI 4G7ZC 5C4XB 1B44D 4DK0A 1ESFA 2XVSA 5IOCA 1DJRD 2BE5D 4PQXA 2L12A 2F0EA 4H0LC 1ML0D 2XRQD 2JA8B 5FK9C 5DM63 3VR2A 2PZUA 4BBSB 3P20A 5HGTA 4YIJA 1CQVA 2BDNA 4ILWA 3Q22A 1QJOA 4PV1C 4CGYB 1PFMA 3I72A 2A5HA 1EY9A 2AUJD 1CK1A 2QDBA 2F0DA 2CW0C 1DZ1A 4XIGS 2YU9B 1GUTA 1JOOA 4WJWA 5CR3A 1BUVT 5C0XJ 4RKBA 5M5YB 1F9RA 2F0NA 3S1RB 5C3XA 1BF4A 3FMCA 5CV8A 2B63B 2C9OA 4M8AA 1WVLA 1BDOA 1EY7A 2ZXRA 4EGVA 1H9MA 5JOBA 4B9WA 2NVTB 1HA6A 1ICWA 1F2MA 5IGEA 3M3YB 5C6AA 3VR4A 3DWQA 1PFBA 4CJ0B 4CKCA 4WORA 4H7BA 1D1KA 1PTOD 3D4DA 2F0MA 1O7YA 5J39A 4BA2I 2Z4IA 3IKJA 4XT1B 2XRSD 4NW2A 2B8FA 1KDBA 3CHBD 1V1PA 2IL8A 3A8JE 1TS4A 1R4QB 2CQAA 4ZUIA 1V1OA 4U68A 1G2TA 2J4XA 1DD2A 2R92B 1B3AA 3LWUA 3OOCA 1Q8IA 5FO8B 4RGMA 4ID6A 1G2SA 3NSWA 5CV6A 2F0PA 1D5MC 2PZWA 1YNNC 2A6EC 2MHVA 1A3VA 5ELFA 1OXXK 2C5CA 3AB9A 1U4RA 5KGUA 1Y8OB 2B2TA 4L8JA 1II3A 3HOXB 2R93B 5JJZA 3I4MB 1STEA 1G8ZD 1HCZA 4C3IB 5K36G 1I6VC 3U9SA 5I6WA 1I4XA 2PZTA 1NSNS 2L1BA 3I4LA 2F0GA 1EWHA 4IFDI 1SNQA 4KJNA 4RGTA 1LLRD 4HR7B 2JEBI 3L7ZC 2XNAC 3MFYA 2F0FA 2FMCA 2LY7A 2MJ8A 5ISRA 2K32A 4Q5VA 1SAPA 1LT4D 2F0SA 2HDMA 2TSSA 3EA6A 2CVRA 3NWTA 4IFDH 3I70A 2SNMA 1WCMB 1TU2B 4F87A 3JAME 1U4LA 3QJYA 4RHRA 4C3IG 1ENAA 1E0BA 2WB1B 2PMZB 2EJMA 4KKUA 5CORA 5E1FA 3A7LA 1EY5A 3J81E 3I8ZA 3K57A 5M5WB 2EPBA 5K5PA 1BCPB 1H9SB 3VYRA 1STGA 3Q23A 4KY7A 1SYBA 4IN3A 5C44B 4C3HB 3UI2A 4BS9A 4PMWA 3PIP3 2BE5C 1GUGA 3NQTA 5EPLA 2RDGA 1HUNA 3N6RA 2RDFA 1S4ZA 4RCNA 1U9RA 1PZJD 5LHY1 1D1IA 1PTOF 4OO1H 1NAPA 1I4HA 2OT2A 1Z6HA 1O7LA 1PTOH 3VYUA 2EYJA 4C3HG 2EY1A 2HQEA 1BCPC 1E2VA 3EJIA 1T5XD 1CHQD 5IGBA 2A6HD 1EY8A 4MN3A 4A3DB 4DA2A 2A74C 2FHTA 4BA1I 3OWEB 2MPMA 5J22A 1CI3M 1D6EC 2GA4B 5CV5A 3IL8A 4R9WA 3GTKB 5C3WA 2AQ3B 3C1FA 5C0XI 3NP8A 1LT3D 5G3LD 4RAUC 1M8AA 4FXGC 1U4PA 3EQLC 3DXJC 2NVQB 3MXNA 1EYAA 2EE1A 3RLFA 1SMYC 1QOHA 5EKIA 3JAML 3FPUB 1PZID 5M3FB 1TVXA 1LTGD 4EQOA 5I4DA 5AFWA 5FOBB 1TKWB 1W6JA 2RA4A 5KIXA 3J81L 3IFTA 2PQEA 4NKLA 1EY4A 1PRTB 3A55A 4L63B 1R4PB 3D6CA 1LV9A 1AZQA 1RJTA 2ICEC 2LKVA 2X6GA 3ONAB 1EQVA 3BDCA 4H13C 1KLGD 2QILA 4QIWB 5C0XG 2WKDA 4U673 4V0BA 1E2ZA 4KJOA 2PNRC 1F2ZA 3Q0AA 1TS2A 4IZ8A 3C1EA 4HMIA 3VR5A 1LO5D 1Y8PB 2EYMA 1G6ZA 1O80A 4FVMA 1L0XB 3BVGA 5KEEA 4C3JB 5EBDA 3MVVA 1OXVA 1D5ZC 4K14A 4FF2A 1ESRA 4KKTA 1IW7D 3HS0C 2JA5B 2YYZA 4ZRZA 4IFDJ 2L5TA 2DNEA 1PRTC 2RVLA 2QKIC 2IX1A 4KTAA 3DEOA 1OXSC 1QILA 3PUZA 2KCNA 5EPKA 1TT2A 2EYOA 4IUUA 5C4HA 5KYLA 1JOKA 3TP8A 4ZUJA 3GV3A 3S1MB 5NUCA 1Z7TA 5D3IB 5CBEE 1I4QA 4A3FB 4WFN3 5BN4A 1GUSA 1I4PA 4DAVA 2PW7A 1F2LA 1KLUD 1W6KA 1HQMC 2R61A 1PLFA 4FYDA 4P2CB 1WTRA 1SE3A 4JBWA 1G91A 1MD2D 2BA0A 4FO2A 1TWCB 5JEAH 4A3IB 1D5XC 3M85A 3D8GA 1VF5C 3T4AC 2HDLA 4C1NK 2Z1CA 4V190 2WKCA 3D6WA 1C48A 1FNWA 5G3LF 2O5IC 2EY6A 1Q1BA 4NP5A 1DOKA 4XYQA 1A3TA 3PIO3 3WDNA 2WIIB 4RKLA 1I4GA 2MGSA 1Y1WB 1HPCA 4X3TA 3K0YA 4EVOA 3G6JB 1DXMA 1S5FD 3NK9A 2K5WA 1B50A 2F4IA 5KRUA 3DHQA 3HOWB 1SNPA 2KUMA 1CQFA 4DGZA 4MHEA 1CFMA 4OIJA 1RKNA 5FO9B 2EY2A 4CBVA 5IIFA 1S5ED 1S5BD 4IUVA 2HCIA 3EVQA 2L9HA 3SDZA 4QUCA 2K5QA 1PDQA 4X3SA 1WTPA 3QO2A 2XWBB 2JSOA 5KNCA 1Q1EA 1B4OA 3NBHA 3CQZB 2K03A 4K6LA 1STYA 2KHSA 1QB5D 3HOVB 2L0CA 3NBIA 2G9HD 5JVG3 2PW5A 4KHVA 2NZ1D 4KV6A 2K33A 1EYDA 1CA5A 1EIGA 3NTIA 3Q6SA 3SE0A 1EFID 5KNBA 2NVXB 1NR2A 4DF7A 4TRDA 1Q12A 1FYCA 1EU3A 3QOLA 4BY7B 1A6XA 1I6HB 3GTGB 3R2TA 5F2DA 1KNAA 2J7ZA 5IT9L 5A2QE 5JPMC 1HRJA 4RWSC 3R2IA 3C2PA 1AZPA 2Q8TA 3A8KE 3HOUB 3TZDA 2DY8A 2AWNA 2NYZD 3S15B 2F0LA 4WRDA 3MXUA 4G4KA 5C4ZA 1WTQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J8I A;  1EOT A;  1X3P A;  4RAU C;  1M8A A;  2KUM A;  1G2S A;  1U4P A;  3LWE A;  2RVL A;  1AZQ A;  2K01 A;  4MHE A;  4CJ2 C;  1PFM A;  1U4M A;  1SSO A;  3UI2 A;  1ILP A;  2EE1 A;  3DEO A;  4RA8 A;  1CM9 A;  1F9S A;  5EJW A;  1U4R A;  3GV6 A;  1NCV A;  5EPJ A;  4OIJ A;  1CA6 A;  3MTS A;  3DEP A;  2B2T A;  4DN4 M;  1DON A;  1O7Z A;  3SVM A;  3I90 A;  5EPK A;  4IUV A;  5D65 A;  1WD1 A;  1KNE A;  2HCI A;  4IUU A;  2DY7 A;  1DZ1 A;  2KEC A;  2R3Z A;  4ZK9 B;  2HUG A;  4QUF A;  1ROD A;  2L9H A;  2N55 A;  5EKI A;  5JJZ A;  5E4X A;  4IUP A;  4QUC A;  5EPL A;  2FJ2 A;  2RSN A;  1BO0 A;  2X6L A;  4HSV A;  1PDQ A;  3FPU B;  1Q3L A;  2B2T C;  1F9R A;  1RTO A;  1HUM A;  2JP1 A;  2VXW A;  4X3S A;  1WTP A;  2N88 A;  1HUN A;  1X3Q A;  3F2U A;  3QO2 A;  5D14 A;  1S4Z A;  2B2V C;  1F9P A;  3GV3 A;  3TN2 A;  1BNZ A;  1BF4 A;  1TVX A;  1B4O A;  1DOL A;  1ZXT A;  1HHV A;  5AFW A;  4O42 A;  5CBE E;  5COY A;  1MSG A;  1EL0 A;  2K03 A;  1HFN A;  2RA4 A;  2B2Y C;  1A15 A;  1WVL A;  2K04 A;  1XYI A;  2K05 A;  2NZ1 D;  1F2L A;  1DOM A;  1IL8 A;  1LV9 A;  1RJT A;  1SDF A;  2L1B A;  5DNF A;  2B2V A;  4IUR A;  1IKM A;  3I91 A;  1NAP A;  1X32 A;  2X6G A;  3ONA B;  2FMM A;  5T1G A;  1B53 A;  1PLF A;  3G7L A;  2X69 A;  5T1I A;  3N52 A;  2B2W C;  1WTR A;  1J9O A;  1CA5 A;  3IFD A;  1HA6 A;  1F9Q A;  4CJ1 B;  2B2Y A;  4HCS A;  1AP0 A;  1EIG A;  2JYO A;  3Q6S A;  2L4N A;  1ICW A;  2XIW A;  4IUQ A;  2NWG A;  3DM1 A;  1BBX C;  2HCC A;  1G91 A;  4OIK A;  1QG7 A;  1PFB A;  2K28 A;  4X3U A;  4CJ0 B;  5EQ0 A;  1RTN A;  2Q8R E;  4XDX A;  4UAI A;  1WD0 A;  1JIC A;  1NR2 A;  2MJ8 A;  1SAP A;  2B2W A;  2HDM A;  4LMQ D;  4R8I A;  4HAE A;  4XT3 B;  3MWY W;  2CVR A;  1IKL A;  1WTO A;  2HDL A;  4ZAI A;  1O7Y A;  3D6W A;  3KBX A;  1MSH A;  2FIN B;  1MGS A;  2SDF A;  4MN3 A;  4X3K A;  2B2U C;  4HED A;  3H91 A;  2FHT A;  3P7J A;  3KUP A;  1KNA A;  2H1E A;  2KED A;  5E4W C;  1PFN A;  3R93 A;  1WTV A;  1MI2 A;  1DOK A;  1JE4 A;  2EOT A;  2J7Z A;  1G6Z A;  1B2T A;  2D9U A;  2K1B A;  1O80 A;  4XT1 B;  1ILQ A;  2MPM A;  1GUW A;  2L11 A;  1U4L A;  5CMD A;  2MGS A;  1RHP A;  4NW2 A;  4ZKC B;  1HRJ A;  4RWS C;  1QE6 A;  1E0B A;  1XX8 A;  1EIH A;  4X3T A;  4ZLT F;  1AZP A;  2KOL A;  2L12 A;  2B2U A;  2IL8 A;  4ZKB B;  5COR A;  2KEE A;  1EQT A;  1ML0 D;  3IL8 A;  2Q8T A;  1C8C A;  4R9W A;  3TZD A;  2DY8 A;  3I3C A;  1VMC A;  1HFG A;  3FDT A;  4IUT A;  2M2L A;  2NYZ D;  2RSO A;  4U68 A;  1WTW A;  1G2T A;  1ESR A;  3I8Z A;  1WTX A;  1B50 A;  2KVM A;  1B3A A;  1QNK A;  2EPB A;  2FFK B;  2MP1 A;  1VMP A;  3HP3 A;  1WTQ A;  2BDN A;  5CBA E;  1NR4 A; 
#chains in the Genus database with same CATH topology
 3TP7 A;  1X65 A;  5CV4 A;  1BQQ T;  2PO4 A;  4JI7 Q;  1UWV A;  4DV5 L;  2NVT H;  3HZX A;  3SK6 A;  4A93 B;  1QCB D;  3M3Y H;  1KNE A;  4DR6 Q;  3H0G B;  1YHA A;  1SN8 A;  1K73 C;  1T5E A;  4QGU A;  3OHX C;  2A68 D;  1QWY A;  4JI0 Q;  1RTO A;  1FGB D;  1HUM A;  2ENB A;  2E8G A;  2VXW A;  2F0T A;  4HCE A;  1SR3 A;  3RUZ A;  1LTS D;  1BOS A;  1PMR A;  1IW7 C;  3H3V H;  4O42 A;  3IAY A;  2WAC A;  1MSG A;  1V8Q A;  3OW7 A;  1XNR Q;  2Z0S A;  2WAQ G;  4IPH A;  4DR3 L;  3I7F A;  1Y1V G;  1K9M C;  3JAM c;  5LL6 S;  3PQI A;  2XWJ B;  3HOU G;  3QB3 A;  3I91 A;  2EVB A;  1YVC A;  2ZM6 L;  3F8T A;  5M3M B;  1M1K C;  1B9M A;  4NXN Q;  4N9P A;  4BXX G;  2M9V A;  4HCS A;  2UXC Q;  1N36 Q;  1Z47 A;  4IUQ A;  3J81 c;  2F52 A;  1KAB A;  1HR0 W;  3PV0 A;  3UE0 A;  2GN5 A;  2R92 H;  4LF7 L;  1CT1 D;  2R7Z H;  1JIC A;  1JC7 A;  1GUO A;  2VB3 X;  5CGK A;  1ET9 A;  1LTB D;  3MZ5 A;  1YNJ D;  4QB4 A;  1IKL A;  3CCE A;  1EZ8 A;  4YWL A;  4LK1 C;  1N8R C;  2ZXP A;  1MJC A;  4A93 G;  3KBX A;  3CAM A;  5H1S E;  4LF9 Q;  1VQ9 A;  2OQK A;  1SRU A;  3ND8 A;  4X3K A;  4DUY L;  1HNW Q;  4RGO S;  3F2B A;  3TEH B;  3R93 A;  4G57 A;  1MI2 A;  1JOQ A;  1RF2 D;  3PO2 G;  2KJX A;  1SBB B;  3KF6 B;  1JR0 D;  4RMF A;  3OW2 A;  1OTC A;  3CF5 A;  3HOX H;  1HA5 A;  4YCU A;  2WFW A;  5IGF A;  4B3M Q;  3JC6 6;  2EDG A;  3BYY B;  2WP8 J;  5C3E G;  1UEB A;  2F0W A;  3I4M H;  1EQT A;  1VQP A;  4DXG A;  4R4T A;  3SK8 A;  2F0I A;  5JEA J;  1WTX A;  5JVH 3;  3AMU A;  5ELD A;  3E0J A;  1A2T A;  2ZJQ A;  1X55 A;  3I2Z A;  2E76 C;  1I94 Q;  3D4R A;  2UU9 Q;  3GTQ H;  2D2C C;  3FKI H;  4ODG A;  4YWM A;  2N78 A;  1C4Q A;  1JJC B;  2VL6 A;  4A3B G;  2NB0 A;  3MC0 B;  5IWA Q;  1SND A;  1F9S A;  1LT6 D;  4FNF A;  3M7N A;  3CMA A;  1PFS A;  1XXG A;  4CKE A;  1SE4 A;  4DR1 Q;  2F0U A;  3CCR A;  3NE5 B;  3K5L A;  3ERO A;  4HIM A;  2EJF C;  3GTJ B;  3VR6 A;  2N55 A;  2FJ2 A;  5A2Q L;  2M00 A;  2E2H B;  3C3L A;  5E7N A;  1UAP A;  1JWS D;  2ES2 A;  1L2F A;  4IFD G;  1I3Q B;  1SJH D;  1PVO A;  1CUK A;  5IYC G;  1WCM H;  1SYC A;  4JOI C;  1W2B A;  1Q90 A;  1CHP D;  4Q0F A;  3V2T A;  2VQF Q;  3S2H B;  3H6M A;  2N8N A;  1SDF A;  2Q8I B;  4OO1 I;  5DNF A;  5BR8 Q;  4DR2 Q;  4HSP A;  2FMM A;  3A74 A;  3KDF A;  2F1M A;  2X69 A;  4P71 A;  2B2W C;  2F0J A;  4K5X A;  1F9Q A;  2AMC B;  2AQ1 B;  3T51 B;  1HTP A;  4CDF C;  3G4S A;  3J7A 5;  2HCC A;  4KN7 C;  4CKB A;  2K28 A;  4HN7 A;  5C4J B;  3PUX A;  1NUC A;  3UDI A;  3UDF A;  4JI1 L;  5M5W H;  1PTO B;  3X3M A;  1PYW D;  1Q46 A;  1GXD C;  4P74 A;  4TQU S;  2EXD A;  4LMQ D;  1IHZ A;  1V9P A;  2NTS A;  4XT3 B;  3TSS A;  1I50 B;  2B8G A;  4A3G B;  1N34 L;  3HEJ A;  4BBR B;  3CC7 A;  1PH4 A;  3STB D;  5C44 H;  5A35 A;  1VQ5 A;  2CH4 W;  1F77 A;  2SDF A;  3J80 E;  1SJE D;  4HED A;  1YJ9 A;  4B3S L;  4RH6 A;  2KED A;  3I4N B;  1F2Y A;  1S5D D;  5IP9 H;  3MFG A;  1EU4 A;  3KBG A;  3NBH B;  4DNI A;  1J5E L;  1E1O A;  3R3O A;  1NTG A;  4LUZ A;  1VQ4 A;  4ZKB B;  2J0T D;  2K5V A;  4HJ7 A;  1TQO A;  3P75 A;  1VQ8 A;  4GN4 B;  3M4Y A;  2TMP A;  4UDU C;  1WTW A;  3S14 B;  2ZTE A;  2CFM A;  2NZO A;  4PNY A;  2OEO A;  1QNK A;  4FF1 A;  2DUD A;  4I65 A;  3SR1 A;  2XGT A;  4CDD C;  4OO1 G;  2BOS A;  1JWM D;  1V43 A;  1IYV A;  1I5F A;  4KY5 A;  4GS3 A;  4DV2 Q;  3K58 A;  2VZA A;  3HGB A;  2BA1 A;  3DEP A;  5IP9 G;  1DON A;  1ZYR D;  3CRK C;  3E9H A;  2HD3 A;  3KF8 A;  2R6G A;  2DY7 A;  5I9P A;  4A3G G;  4J8Q A;  1TWF B;  1ROD A;  3PUW A;  3DUZ A;  2OXP A;  3LNN A;  1SRO A;  1PTO C;  3FP9 A;  1BO0 A;  3GO5 A;  1Q3L A;  2JA7 B;  3QIA A;  5JJL A;  3I4N G;  1LTA D;  4N9T A;  5J1Z A;  1LTL A;  3OIP A;  2B2V C;  4X65 L;  1YIJ A;  3HOY G;  3DLL A;  1STB A;  3GP7 A;  5COY A;  4GKJ Q;  3M4O B;  1AH9 A;  4K5W A;  1AW7 A;  4AYB G;  1CZG A;  4RFB A;  2F0Q A;  1E7Z A;  1U0L A;  5FLM H;  4GNX B;  4FF4 A;  1XYI A;  5HGQ A;  3NPP A;  4IPD A;  1EEI D;  2F0K A;  3FHW A;  3QG1 A;  2VQE L;  5I6Y A;  1KD1 C;  4CJ1 B;  3BVM A;  3GTK H;  2QCP X;  1VQG A;  1IYJ B;  2IW3 A;  1XNQ L;  5EQ0 A;  3KLS A;  2E2D C;  1WTH A;  4R8N A;  4KKS A;  1EWI A;  1MBY A;  4DV5 Q;  5FLX c;  1E1T A;  5IYB H;  2AKW B;  3MWY W;  4KD4 A;  3NHH A;  1ENC A;  3RZD B;  2NN6 H;  3BG3 A;  1SNM A;  4ZAI A;  4DAP A;  2K50 A;  2K6A A;  1JWU D;  4QMG A;  4L5R C;  3CU7 A;  2ID0 A;  1FNV A;  1UE5 A;  3OMG A;  4XYO A;  2CCZ A;  1PFN A;  2AWO A;  4IO9 A;  1UNS A;  2K1B A;  1GUW A;  2FXQ A;  3VYT A;  4A3K B;  2RKS A;  2AQ2 B;  1TS5 A;  4DR3 Q;  3QOJ A;  2EYH A;  4A3J B;  4DK1 A;  1Q8K A;  1HFG A;  5M3F H;  2IX3 A;  5BN3 A;  3KLR A;  1PH9 A;  5IT9 c;  1SEB D;  1QVG A;  1YNJ C;  4QQB X;  3HP3 A;  1X56 A;  5CBA E;  4NMZ A;  1NMF A;  3GD7 A;  4LF6 L;  1D2B A;  3LGJ A;  4A76 A;  4GNX C;  1HNX Q;  1Q81 C;  3A54 A;  4J6H A;  2YTV A;  4A3C G;  1BKB A;  1JB3 A;  1U4M A;  4LF7 Q;  5JAV A;  2NBF A;  3K81 C;  5FKA C;  5CC4 A;  4YY3 L;  3A5Z B;  1S5C D;  2JA6 G;  4C56 C;  3NTH A;  4G7O C;  4IAL A;  3J80 L;  2VUM B;  1DM0 B;  3H09 A;  3ULL A;  4ULL A;  4IUP A;  2A69 D;  5E3F A;  4OWX B;  1EWC A;  1LTR D;  1VQC A;  1GHJ A;  1MKH A;  4K2L A;  5FLX E;  1KXL A;  2EY5 A;  2JP1 A;  2MQH A;  3E6Z X;  1XMO L;  1KTK A;  2VNU D;  5CV7 A;  5D3D A;  4IPC A;  2VB2 X;  1ZKO A;  4ZCK A;  1FL0 A;  1SXT A;  5IP7 H;  2B2Y C;  1VDZ A;  3W2D A;  1B9N A;  4GOP C;  1KQS A;  1EZ6 A;  3PO3 B;  4A3L H;  5CYU A;  3OWF A;  4NDX A;  1RD9 D;  4MNO A;  4QCL A;  1IKM A;  2WV6 D;  2A6E D;  2RHS B;  3KYH C;  3N52 A;  4JOI A;  4C3J H;  4WJ4 A;  3K5N A;  3D3R A;  4ZQ3 A;  4BWG B;  3KF6 A;  1SLJ A;  5DM7 3;  1X3G A;  2I5M X;  3S1N B;  4LUV A;  2Q8R E;  3HG9 A;  4EQP A;  3S2D B;  5IT9 E;  4NXM Q;  5EKK A;  2JA5 H;  2B2W A;  2PQA A;  1BXT A;  2D5D A;  5FJ8 G;  4OX9 L;  3T13 A;  1WTO A;  3C46 A;  3HOZ B;  3F2C A;  4JI5 L;  4OEM B;  3JAM i;  2B2U C;  3H91 A;  3J7A F;  2I46 A;  2F0V A;  2QF7 A;  1VQH A;  1YNX A;  1H9J A;  1CTM A;  4A3E G;  3VYS A;  1XX8 A;  2V1C C;  1HNZ Q;  1E24 A;  2JXM B;  3SXH A;  1PA6 A;  1SYF A;  3OIQ A;  3J81 i;  3HKZ G;  1FD7 D;  5ELC A;  3S16 B;  1VMC A;  1D7Q A;  3PO3 G;  1H95 A;  3S1M H;  4JYA L;  3KDF B;  3EFX D;  3OSO A;  1EEF D;  1K83 B;  4A3F H;  3PIO A;  1V1Q A;  3STB C;  3GTM B;  2K01 A;  4P72 A;  4JI1 Q;  1ILP A;  1EY0 A;  1R9T B;  4L5T A;  3WOE A;  1GJX A;  1ASZ A;  3MTS A;  1TII D;  1EYC A;  3DWP A;  2KCC A;  3R8B A;  1N34 Q;  4M1U B;  3NQI A;  1STA A;  2IT1 A;  2LMC B;  2HUG A;  2Y0S B;  1A3U A;  3S17 B;  1TWC H;  4DAY B;  5JEA G;  2D0P A;  4UP7 A;  4HSV A;  3W3A A;  4A3I H;  2BDO A;  2UXB Q;  1STN A;  1EY6 A;  1K8M A;  4XQJ A;  4OL7 A;  1F9P A;  2CH4 A;  4XTC S;  2A6H C;  3B6Y A;  4BY1 H;  4LW1 A;  2BH2 A;  1EIY B;  4KY6 A;  3ICE A;  3RR5 A;  3BZD B;  3RD4 A;  1IL8 A;  2B2V A;  4IUR A;  2LXJ A;  3K59 A;  1Y8N B;  1GKH A;  2XSC A;  5T1I A;  1ZYR C;  1TWH B;  2ZTD A;  1KDC A;  1B8A A;  4OHJ A;  4K0K L;  2XIW A;  1Q86 C;  3NUC A;  3I73 A;  2EYL A;  1RTN A;  1FGU A;  4UAI A;  3HFZ B;  5EGT A;  2VW9 A;  4DR4 L;  3LX0 A;  3EIV A;  2F3V A;  3Q24 A;  3CCJ A;  3HOW H;  5C4X H;  1TR5 A;  3KF8 B;  3SEB A;  1YJW A;  4IQZ A;  2UUC L;  4LUO A;  1VQB A;  3FRP B;  5FLX L;  1BVS A;  4JI6 L;  5DEH A;  3P7J A;  1IYU A;  1OO9 B;  2DNC A;  4NPS A;  4QY7 A;  3K8A A;  1MJE A;  3ER0 A;  4O1N A;  4C2M B;  1N33 L;  4LFA L;  1ILQ A;  2EYP A;  2F4V L;  4ZLT F;  1CZW A;  3ZJY C;  4J1M A;  4PZ7 A;  4K5V A;  1IBK L;  4IUT A;  1JMC A;  3FDT A;  1JB7 A;  2M2L A;  3URY A;  3PUV A;  2VQE Q;  4A3M G;  3QR8 A;  4E6I A;  3TDQ A;  1EOV A;  3BYT B;  3CQZ H;  1FNU A;  1DCZ A;  1K8O A;  5IGG A;  4KMU C;  1BCP D;  1LTT D;  3ITP A;  4FXK C;  3SGI A;  1Q7Y C;  1L0Y B;  1XNQ Q;  1LYL A;  1X3F A;  4CJ2 C;  1VQJ A;  2WAQ B;  3U4Z A;  1Y1V B;  2IJ0 A;  1LAB A;  3J7Z C;  1B3Q A;  2JA8 G;  3SVM A;  2JQO A;  3OMC A;  5D65 A;  4MTN A;  4GNX A;  3TME A;  4BBS G;  3CKI B;  1YI2 A;  2R3Z A;  4TSS A;  3KK7 A;  3RNU A;  2NVX H;  5DAU A;  1RDP D;  1X54 A;  4DV0 L;  3F2U A;  1STH A;  3GTP B;  4BY7 H;  1I6H H;  5GRO A;  3GTG H;  4DUZ L;  2F0O A;  4RGN A;  3PGZ A;  1M90 C;  2RBM A;  3H3V I;  1VQF A;  1XTC D;  3K7U C;  2O5J C;  2IX0 A;  3K5M A;  1HH2 P;  2K04 A;  4Z9C B;  1ONL A;  1OXT A;  1B53 A;  1TY0 A;  2AUK A;  3IFD A;  3PO2 B;  2B2Y A;  3GTO B;  4GOP A;  1BBX C;  4LF8 L;  1E3P A;  4L6T B;  2XN9 C;  4HIO A;  1SMY D;  4P75 A;  1VQI A;  2R7D A;  4OIK A;  3S15 H;  2A69 C;  1CKN A;  1WD0 A;  4FP5 D;  2B63 G;  3X3N A;  1XJV A;  2QEJ C;  4YY3 Q;  5C3E B;  2E2I B;  4DV4 L;  3VA5 A;  5K36 H;  5TSS A;  2A73 B;  5IOD A;  4X62 Q;  1ASY A;  5ELE A;  2R7Z B;  1MSH A;  1LT5 D;  2WB1 E;  2PMZ E;  4H02 A;  1TY2 A;  2Z8L A;  2RQX A;  2H1E A;  3AU7 A;  3L3O C;  1JCK B;  4I7Z C;  5ELB A;  1WTV A;  3RZO B;  1XMO Q;  1K0S A;  1TWA B;  2D9U A;  2UXD L;  3CCS A;  2L11 A;  3ZYY X;  3H0G H;  4A3B B;  5I2X A;  1EIH A;  4MIU A;  3SHL A;  1JQY D;  2B2U A;  4K6D A;  2KEE A;  3T1H L;  2EQS A;  1C8C A;  4YHH L;  3IRB A;  3I3C A;  3GDE A;  1FVI A;  3P1H A;  2RSO A;  1HZB A;  4MZ9 A;  3D31 A;  3G48 A;  4DKA C;  4F88 A;  1J8I A;  3K5O A;  4DNR B;  1G29 1;  2BH8 A;  3H3V C;  5EKL A;  3W1B A;  3PUY A;  3FPP A;  2MO0 A;  4DFA A;  3TQY A;  2PPB C;  1KHI A;  4RA8 A;  3MHB A;  1K28 A;  5M3M H;  4GKK L;  5EJW A;  3ULJ A;  2PQA B;  3GV6 A;  2R93 H;  1PZK D;  3GTQ B;  3FKI B;  1JT8 A;  4DU9 A;  3FVQ A;  2EYF A;  4C3I H;  2KEC A;  1IBL L;  3SK5 A;  4JI5 Q;  3V05 A;  4QUF A;  2DN8 A;  3TZU A;  2R92 G;  2R7Z G;  2CQO A;  4DR7 Q;  2RDH A;  2OTL A;  1OXU A;  4GLV B;  1A2U A;  1JJG A;  4L5S A;  3BDO A;  5D14 A;  3TN2 A;  2OF1 A;  2E2J B;  2F03 A;  4IUN A;  3MEF A;  3J80 c;  4JW0 A;  4EQN A;  4OWW B;  3PMF A;  1Y14 B;  3K7A B;  1A15 A;  1I4R A;  1M4V A;  1PYS B;  2K05 A;  3HOX G;  1NBW A;  1DOM A;  1GOZ A;  2KQ3 A;  1PRT D;  3PF5 A;  1K8A C;  1GM5 A;  3UDX A;  2N49 A;  2Z4H A;  3G7L A;  5GAE C;  1L1O C;  5M9O A;  4B9X A;  3I4M G;  1AP0 A;  2JYO A;  2NWG A;  1IXR A;  1Y69 U;  4ZYS A;  1C7Y A;  1QG7 A;  1LTI D;  2IHE A;  1RCV D;  3RMH A;  1SYE A;  4LWC A;  1TS3 A;  2KA7 A;  1SFO B;  4HJA A;  4Y7N B;  4JI2 L;  2O4X A;  4KLK A;  1BR9 A;  3FKI G;  2E75 C;  1FR3 A;  3CRL C;  1A8V A;  2SOB A;  2WIN B;  1KC8 C;  4IJH A;  2PI2 E;  1QVF A;  3KLW A;  2K14 A;  1CKO A;  1EQR A;  1XWE A;  5LMU Q;  1UEA B;  1O78 A;  1BCP F;  1JE4 A;  3MXP A;  4X6A H;  5LMN L;  3T16 A;  3K6O A;  4P73 A;  4ZKC B;  2H4O A;  1QE6 A;  3MXG A;  3GTJ H;  3D4W A;  1SNO A;  2KOL A;  1VQ7 A;  2V4D A;  4CHT B;  3PF4 A;  5FO7 B;  3A7A B;  2E2H H;  3T1Y L;  5I2Y A;  3T56 B;  1PH7 A;  1GD7 A;  4RCO A;  1CKM A;  1I3Q H;  1WCM G;  4C3H H;  2MP1 A;  4EQ5 A;  4KK7 A;  1VMP A;  4TKO B;  2KHJ A;  3L9A X;  1SE2 A;  4DAY A;  4K0K Q;  2MUY A;  3OPO A;  4LJZ C;  3MEH A;  3HOY B;  2HIX A;  1GO3 E;  4LNQ A;  3AEV A;  3U9O A;  4AYB B;  1CM9 A;  4DR4 Q;  2WB1 G;  1FJG L;  4B3T L;  3A8I E;  5EPJ A;  4PMB A;  1VQL A;  4S3S A;  5KND A;  3BVZ A;  2UUC Q;  4UPA A;  1PHJ A;  2HIV A;  4JK1 C;  2SNS A;  4JI6 Q;  1TWG B;  2B3G A;  2EXZ A;  5C4J H;  1HJP A;  2ATW A;  4LF4 L;  1XTD A;  4JI3 L;  2ZJP A;  2NVY B;  4OGQ C;  1KDA A;  5AJ3 L;  4LFA Q;  1BNZ A;  1I50 H;  2O2L D;  4HJ8 A;  5GAD C;  1ZXT A;  2ZT9 C;  4BBR H;  5C44 G;  3BDL A;  1EL0 A;  4K8I A;  4IPG A;  2LS0 1;  1IBK Q;  2ICI A;  2L15 A;  4QIW E;  4GZY C;  3H94 A;  1IL2 A;  4F8M A;  1PXU A;  3TP5 A;  1X6O A;  1QZG A;  1XPR A;  3BJU A;  5T1G A;  4GLA C;  4FF3 A;  1YHB A;  5CV9 A;  2EJG C;  2K75 A;  5C5L A;  4QF4 A;  4AQY Q;  1PH2 A;  1SYG A;  5JJK A;  4XDX A;  3KLS X;  2YTX A;  4A3D H;  3NTK A;  4DPG A;  3O13 A;  4LAA A;  1N9W A;  1SNC A;  1VCI A;  4H44 C;  3VR3 A;  2OWO A;  2KEN A;  4KN4 C;  3NWS A;  1MGS A;  1PH6 A;  2NN6 I;  2KCM A;  1AN8 A;  4LFC L;  2E5L Q;  2K5D A;  3BS1 A;  5E4W C;  1U5K A;  4OON A;  4DV0 Q;  4F7X A;  3A56 A;  1DGS A;  3CD6 A;  4C1N I;  4RG1 A;  1NY4 A;  4POF A;  1AFP A;  2CW0 D;  4KI0 A;  5CMD A;  1RHP A;  1XMQ L;  1MHW C;  3AYH B;  2A68 C;  1TWF H;  3E0E A;  2F0H A;  2CHB D;  2JA6 B;  2KBN A;  4IJL A;  3KJO A;  2JA7 H;  1GHK A;  2PCF B;  5C0X H;  3A5U A;  4LFB L;  2NUC A;  2I5L X;  2IPK D;  2KVM A;  3DMU A;  3CME A;  2NVQ H;  3KFU A;  3M4O H;  1HXY D;  3DWA A;  2HHH L;  4A3D G;  1EOT A;  1X3P A;  4JI8 L;  4GOP B;  3J7Y W;  3VA7 A;  4KD3 A;  5FLM G;  4APV A;  1QNU A;  4I7A A;  2OQ0 A;  1CKN B;  1SSO A;  1V1P B;  2K7V A;  3CCQ A;  2LFN A;  1DYQ A;  1CA6 A;  4DV4 Q;  2F3W A;  5IGC A;  4DN4 M;  1N32 L;  1O7Z A;  1YIT A;  3TBI B;  3I90 A;  3TP6 A;  1ICF B;  1PRT F;  1NNX A;  3CXC A;  2ZM6 Q;  5BN5 A;  3UE1 A;  2RSN A;  2X6L A;  5IYB G;  2L55 A;  3AFP A;  3MA2 B;  2NN6 G;  3RZD H;  5LL6 X;  1HZC A;  1HHV A;  4X66 L;  2D0O A;  5M5X B;  3ERQ A;  1HFN A;  4G7H C;  1HQR D;  3M7G A;  3S1Q B;  1A0I A;  5KYI A;  1B7Y B;  2DGY A;  1KAA A;  3KOJ A;  2RCN A;  4DR6 L;  1B1Z A;  1X32 A;  4A3K H;  5ELN A;  1K8G A;  4DUY Q;  2I07 B;  1J9O A;  3CP0 A;  3S9W A;  2Z6B A;  5EBC A;  5JPN C;  3DM1 A;  4A3J H;  3E5S A;  4A3E B;  5M3F G;  4Y52 H;  4X3U A;  2BCO A;  3HRZ C;  4KHZ A;  4RHS A;  1HTL D;  3HKZ B;  3FEW X;  3VDY A;  2B39 A;  2IWH A;  1L1O A;  3BU2 A;  4R8I A;  1MIU A;  3MAQ A;  2E74 C;  1KRS A;  1VQK A;  2EZV A;  5I9O A;  1G51 A;  1IBL Q;  1ENF A;  3RN2 A;  3QWN A;  1CSP A;  4B08 A;  1GVP A;  1YNN D;  2HT1 A;  3KUP A;  2UXC L;  4XQQ A;  1YJN A;  2SEB D;  2EOT A;  1B2T A;  1AEX A;  3ND9 A;  4OXP A;  4L5Q A;  2VUM H;  1EQQ A;  4ABN A;  3GTL B;  3V96 A;  3SK4 A;  2KHI A;  1JOR A;  3U50 C;  1H9R A;  5JJI A;  4LF9 L;  2VS1 A;  4WJ3 M;  2FFK B;  5IP7 G;  2Q2U A;  1SYD A;  1NR4 A;  2B2T C;  3W5O A;  2HQL A;  3T53 B;  4PZ6 A;  5GAG C;  4UP9 A;  3J7A V;  4XQN A;  5C5M A;  4A3L G;  3LWE A;  4K2K A;  3NEL A;  1UUP A;  4B3M L;  4ME5 A;  4DNT B;  1ET6 A;  1NCV A;  4JI2 Q;  4C3J G;  4NB3 A;  1WD1 A;  4FXD A;  4ZK9 B;  1UE7 A;  5E4X A;  3S2D H;  2JA5 G;  2N88 A;  1X3Q A;  5LMN Q;  2DJF C;  3GQB A;  3HOZ H;  1DOL A;  1ZEQ X;  1D8L A;  2JK8 A;  5IWA L;  3WOF A;  2PYK A;  1CSQ A;  1WJJ A;  3OYY A;  1H9K A;  4PZ8 A;  1VF7 A;  5HUR A;  2G9D A;  1GUN A;  4HMJ A;  2RHQ B;  4BY1 B;  3WWV A;  4DXF A;  3S24 A;  1O7I A;  4JBJ A;  5IGD A;  4B3S Q;  4OWT B;  2JE6 I;  1EUJ A;  1H9S A;  4PMC A;  1UE1 A;  2L4N A;  3NXW A;  1E2W A;  3RLO A;  1J5E Q;  2JA9 A;  1FJG Q;  3PCO B;  4K8J A;  2VQF L;  4A3F G;  1K83 H;  4QJF A;  2NTT A;  1LAC A;  4HAE A;  2ZXO A;  4R4O A;  4HTH A;  4XXE A;  2UUA L;  3J80 i;  1EYG A;  3GTM H;  2D62 A;  4A3M B;  1WOC A;  2FIN B;  4FDB A;  2JEA I;  1LM0 A;  2IHF A;  1Y1W H;  5IYD H;  4G7Z C;  4JI3 Q;  5C4X B;  5AJ3 Q;  1B44 D;  4UHV A;  4DK0 A;  1ESF A;  2XVS A;  5IOC A;  1DJR D;  2BE5 D;  4PQX A;  1K0R A;  2L12 A;  2F0E A;  4H0L C;  4JC0 A;  4A3I G;  1X9N A;  1ML0 D;  2XRQ D;  2JA8 B;  5FK9 C;  5DM6 3;  3VR2 A;  2A19 A;  5J3B A;  2PZU A;  2K52 A;  4BBS B;  2C35 B;  3P20 A;  4BY1 G;  5HGT A;  4YIJ A;  1CQV A;  2BDN A;  1RIP A;  4ILW A;  3Q22 A;  1QJO A;  4PV1 C;  4R4Q A;  1J6Q A;  4CGY B;  4X65 Q;  1PFM A;  3I72 A;  2A5H A;  1EY9 A;  2AUJ D;  1CK1 A;  1TWH H;  2QDB A;  5ELO A;  2F0D A;  2CW0 C;  1DZ1 A;  3NEM A;  4JG2 A;  4XIG S;  4LFC Q;  2YU9 B;  3Q8D A;  1GUT A;  1JOO A;  4WJW A;  5CR3 A;  1BUV T;  5C0X J;  4RKB A;  3HOW G;  1F9R A;  2Z9H A;  5M5Y B;  4O2D A;  5C4X G;  2F0N A;  3S1R B;  3HOV H;  5C3X A;  3BZC A;  1XMQ Q;  1BF4 A;  2ALY B;  3FMC A;  2YV5 A;  3MXN B;  4DV2 L;  5CV8 A;  2B63 B;  3TS0 A;  2K5H A;  2C9O A;  2NZH A;  3CCV A;  4M8A A;  3CCU A;  1WVL A;  4LFB Q;  1BDO A;  1EY7 A;  2DJG C;  2ZXR A;  4EGV A;  1H9M A;  4UP8 A;  5JOB A;  4YCV A;  4B9W A;  2NVT B;  4JI8 Q;  1HA6 A;  5GQO A;  1ICW A;  1F2M A;  2LXK A;  5IGE A;  3M3Y B;  5C6A A;  3VR4 A;  3DWQ A;  1PFB A;  4CJ0 B;  3OTO L;  4CKC A;  4WOR A;  4H7B A;  1D1K A;  4YCW A;  3CCM A;  1PTO D;  1S40 A;  3D4D A;  2F0M A;  1Z9F A;  2F3I A;  1B70 B;  1O7Y A;  5J39 A;  4BA2 I;  2Z4I A;  4LF6 Q;  1PH3 A;  1PH5 A;  1Y1V H;  4YWK A;  3IKJ A;  4XT1 B;  2XRS D;  3HOU H;  4X66 Q;  4NW2 A;  2B8F A;  1KDB A;  3RN5 A;  3HKS A;  3CHB D;  1V1P A;  3K80 C;  2IY5 B;  2IL8 A;  4BXX H;  3A8J E;  3NEN A;  1TS4 A;  1R4Q B;  1KAW A;  2CQA A;  4ZUI A;  1V1O A;  2MNA A;  4AIM A;  3TRE A;  4BY7 G;  4U68 A;  3GTP H;  1G2T A;  2J4X A;  1DD2 A;  4DV1 L;  2R92 B;  2I0Q A;  1B3A A;  3LWU A;  3OOC A;  1Q8I A;  5FO8 B;  4RGM A;  4ID6 A;  1G2S A;  3NSW A;  5CV6 A;  2F0P A;  1D5M C;  2PZW A;  1YNN C;  4A93 H;  2A6E C;  1VQO A;  2MHV A;  1A3V A;  4KHP L;  5ELF A;  1OXX K;  1YZ6 A;  3F2D A;  2C5C A;  3AB9 A;  1U4R A;  1L1O B;  5KGU A;  3CC2 A;  4LF5 L;  1Y8O B;  1A62 A;  2B2T A;  3PO2 H;  4L8J A;  1II3 A;  4DV3 L;  3HOX B;  3GTO H;  4CDE C;  3E9I A;  2R93 B;  5JJZ A;  3I4M B;  5C3E H;  1STE A;  1G8Z D;  4J15 A;  1L0W A;  2E2I H;  1HCZ A;  1HNX L;  4C3I B;  5K36 G;  1C0A A;  1I6V C;  1VQA A;  3U9S A;  4DR5 L;  2UUB L;  5I6W A;  4OX9 Q;  1NJI C;  3RZO H;  1I4X A;  2PZT A;  1NSN S;  1KRT A;  1TWA H;  2L1B A;  3I4L A;  3H0G G;  3G6E A;  2F0G A;  1EWH A;  4A3B H;  1SE8 A;  4IFD I;  1P8L A;  1KL9 A;  1SNQ A;  4KJN A;  2VY3 A;  4RGT A;  1LLR D;  4HR7 B;  2JEB I;  1VQ6 A;  3L7Z C;  3G71 A;  3CCL A;  2XNA C;  3MFY A;  2F0F A;  3L2P A;  2FMC A;  2LY7 A;  2MJ8 A;  5ISR A;  2K32 A;  4Q5V A;  1LT4 D;  1SAP A;  2F0S A;  2HDM A;  2TSS A;  3EA6 A;  3CC4 A;  2CVR A;  3F1Z A;  4A75 A;  3EBE A;  5LMN W;  3NWT A;  1HR0 L;  2I5H A;  2SNM A;  3I70 A;  4JCV E;  4AYB E;  1WCM B;  4JYA Q;  4IFD H;  5IYC H;  1TU2 B;  4F87 A;  2R93 G;  5M3M G;  2JJQ A;  3K0X A;  3JAM E;  1U4L A;  1UE6 A;  2CKZ B;  3QJY A;  4RHR A;  1ENA A;  4C3I G;  1E0B A;  2WB1 B;  2PMZ B;  2MFI A;  3J81 j;  4NXM L;  2EJM A;  4KKU A;  5COR A;  5E1F A;  4DV7 L;  3A7L A;  1EY5 A;  3ULP A;  1X3E A;  3J81 E;  3I8Z A;  1BBU A;  3K57 A;  2E2J H;  5M5W B;  2JN4 A;  2EPB A;  5K5P A;  1BCP B;  2H5X A;  1H9S B;  3VYR A;  2B29 A;  1YHQ A;  3K7A H;  1STG A;  3Q23 A;  4KY7 A;  1SYB A;  4IN3 A;  5C44 B;  4C3H B;  3UI2 A;  1HNZ L;  3AFQ A;  1VS0 A;  4BS9 A;  3PIP A;  4B3R L;  2UUA Q;  4PMW A;  3PIP 3;  1G6P A;  2BE5 C;  1SMX A;  2Q2T A;  1GUG A;  3NQT A;  5EPL A;  2RDG A;  4A4I A;  1SFO H;  1HUN A;  4Y7N H;  3N6R A;  2RDF A;  5HY6 A;  3S2H H;  1S4Z A;  4RCN A;  1U9R A;  3E3X A;  1PZJ D;  1TXY A;  1LUZ A;  5LHY 1;  1D1I A;  4HID A;  1PTO F;  4OO1 H;  2RCF A;  3EN2 A;  2ASB A;  1NAP A;  1I4H A;  2OT2 A;  1Z6H A;  1YBY A;  1O7L A;  3U58 A;  1PTO H;  3VYU A;  2UXB L;  2A1A A;  1N33 Q;  4JBM A;  4POG A;  2EYJ A;  4A3G H;  2F4V Q;  4C3H G;  2EY1 A;  2HQE A;  1BCP C;  1E2V A;  2RF4 A;  4JI4 L;  4GN5 A;  4JV5 L;  1A63 A;  3I4N H;  3H15 A;  3EJI A;  3HOY H;  1T5X D;  1CHQ D;  5IGB A;  2A6H D;  1EY8 A;  4MN3 A;  4A3D B;  4DA2 A;  2A74 C;  2FHT A;  4BA1 I;  2P5Z X;  5DLQ E;  4EX5 A;  3OWE B;  3I56 A;  2MPM A;  4JPB W;  1TWG H;  3S14 H;  5J22 A;  1CI3 M;  4DAM A;  2Q2I A;  1D6E C;  2GA4 B;  5CV5 A;  4HJ5 A;  3IL8 A;  4R9W A;  2ZTC A;  1HZ9 A;  3GTK B;  2NVY H;  5C3W A;  2AQ3 B;  4BBR G;  4X64 L;  3C1F A;  5C0X I;  3NP8 A;  1LT3 D;  5G3L D;  1K3B C;  2KCT A;  4RAU C;  1M8A A;  4FXG C;  1U4P A;  3EQL C;  5IE8 A;  1WI5 A;  3OTO Q;  4DUZ Q;  3DXJ C;  2NVQ B;  3MXN A;  1EYA A;  2EE1 A;  2YTY A;  4OEL B;  1QUQ A;  3RLF A;  1SMY C;  4TVA B;  4HJ9 A;  1QOH A;  1KIX A;  2LSS A;  1K3R A;  1QVC A;  3HKZ E;  5EKI A;  3A0J A;  3JAM L;  3FPU B;  1PZI D;  4LF8 Q;  1VQD A;  5M3F B;  3AQQ A;  1TVX A;  4AH6 A;  1LTG D;  4EQO A;  5I4D A;  5AFW A;  2A8V A;  1VQE A;  1TKW B;  5FOB B;  1W6J A;  2RA4 A;  5KIX A;  3J81 L;  3IFT A;  2PQE A;  4GN3 B;  4NKL A;  1EY4 A;  1PRT B;  3A55 A;  4L63 B;  1R4P B;  3D6C A;  1LV9 A;  4DV1 Q;  1AZQ A;  1RJT A;  1IBM L;  4A3C H;  2ICE C;  2LKV A;  2X6G A;  3ONA B;  1EQV A;  3BDC A;  4JVZ A;  4H13 C;  4DV6 L;  1KLG D;  4R1J A;  1WFQ A;  2QIL A;  4QIW B;  2JA6 H;  2JA7 G;  5C0X G;  2UXD Q;  2WKD A;  4N8X 1;  4KHP Q;  4JI7 L;  4U67 3;  2CWA A;  2K4K A;  4LF5 Q;  2Z6K C;  4V0B A;  1E2Z A;  4KJO A;  4DV3 Q;  3T1H Q;  4YHH Q;  3DM3 A;  2PNR C;  3KJP A;  2OTJ A;  1F2Z A;  4PG3 A;  3PSI A;  2EIF A;  3Q0A A;  3CW2 C;  1TS2 A;  4IZ8 A;  3C1E A;  1W3S A;  4HMI A;  3VR5 A;  1LO5 D;  1Y8P B;  2EYM A;  4JI0 L;  1G6Z A;  1O80 A;  4CDC C;  4FVM A;  5L37 A;  1L0X B;  3BVG A;  5KEE A;  2PNH A;  4GKK Q;  1QZH A;  4C3J B;  4DR5 Q;  3U4V A;  2UUB Q;  1XNR L;  1EIF A;  5EBD A;  2QA4 A;  3MVV A;  1OXV A;  1D5Z C;  1AE3 A;  1PYB A;  4X62 L;  4K14 A;  4QL5 A;  4FF2 A;  1ESR A;  4KKT A;  1IW7 D;  5M5X H;  3HS0 C;  2JA5 B;  2YYZ A;  4ZRZ A;  4NXN L;  5FJ8 H;  4IFD J;  1XPO A;  1N36 L;  2L5T A;  1C9O A;  3S1Q H;  2DNE A;  1PRT C;  2RVL A;  5EAY A;  4IOC A;  2QKI C;  2IX1 A;  2Y0S E;  4A3K G;  4KTA A;  1BBW A;  3DEO A;  4O0A A;  1OXS C;  1QIL A;  3PUZ A;  4A3J G;  2KCN A;  5EPK A;  1TT2 A;  1Q82 C;  1HR0 Q;  2EYO A;  4IUU A;  4A3E H;  5C4H A;  5KYL A;  1HNW L;  1JOK A;  3TP8 A;  4ZUJ A;  3GV3 A;  3PO3 H;  1P16 A;  3S1M B;  4HIK A;  5NUC A;  1Z7T A;  1YEZ A;  5D3I B;  5CBE E;  2ZJR A;  1I4Q A;  2CWP A;  4A3F B;  4WFN 3;  5BN4 A;  3D0F A;  4DV7 Q;  4JBK A;  1GUS A;  4GLX A;  2Q2H A;  1I4P A;  4DAV A;  2PW7 A;  2G5D A;  3M9B A;  1F2L A;  1KLU D;  1W6K A;  3M4P A;  4UY8 C;  2VUM G;  1HQM C;  2QDL A;  3S1N H;  2R61 A;  1PLF A;  4FYD A;  2OCE A;  4P2C B;  1WTR A;  4DR7 L;  3GTL H;  1E22 A;  3BZK A;  3ERS X;  1SE3 A;  4JBW A;  1PH8 A;  1I94 L;  2QW7 A;  2UU9 L;  1G91 A;  1MD2 D;  2BA0 A;  4FO2 A;  1TWC B;  2MO1 A;  5JEA H;  4R4I A;  4A3I B;  1JJ2 A;  2N3S A;  4ALP A;  4B3R Q;  1D5X C;  3M85 A;  3I55 A;  3D8G A;  1S72 A;  1VF5 C;  3T4A C;  2HDL A;  4C1N K;  2Z1C A;  3T1Y Q;  4V19 0;  4DR1 L;  2WKC A;  3D6W A;  1JE5 A;  1C48 A;  1FNW A;  1PV4 A;  5G3L F;  2O5I C;  2EY6 A;  1Q1B A;  4NP5 A;  1DOK A;  4XYQ A;  1A3T A;  3PIO 3;  3WDN A;  2WII B;  3S16 H;  4RKL A;  1I4G A;  2MGS A;  1Y1W B;  1HPC A;  2K5N A;  4X3T A;  3K0Y A;  1XPU A;  4B3T Q;  4EVO A;  3G6J B;  1DXM A;  1S5F D;  3NK9 A;  2K5W A;  3HOZ G;  1B50 A;  5BR8 L;  4DR2 L;  2WAQ E;  3TRZ A;  2F4I A;  3RLN A;  4LF4 Q;  5KRU A;  3DHQ A;  5LMU L;  3HOW B;  1R9T H;  1SNP A;  2KUM A;  4MTK A;  1CQF A;  1AE2 A;  4DGZ A;  4MHE A;  1CFM A;  4DK6 C;  4JI4 Q;  1S3O A;  3S17 H;  1VQM A;  4OIJ A;  4JV5 Q;  1RKN A;  5FO9 B;  2EY2 A;  4CBV A;  5IIF A;  1S5E D;  1S5B D;  4IUV A;  2HCI A;  3EVQ A;  3W1G A;  2L9H A;  3SDZ A;  4QUC A;  2K5Q A;  1PDQ A;  5IY0 A;  4X3S A;  1WTP A;  1EFW A;  3QO2 A;  2XWB B;  2JSO A;  5KNC A;  3CPW A;  1Q1E A;  1B4O A;  4A3M H;  3NBH A;  3CQZ B;  2K03 A;  1Y1W G;  5IYD G;  4K6L A;  1STY A;  2KHS A;  1QB5 D;  3HOV B;  2L0C A;  3NBI A;  4R4C A;  1HZA A;  2G9H D;  5JVG 3;  2PW5 A;  2XTI A;  4KHV A;  2NZ1 D;  4KV6 A;  2QGQ A;  4X64 Q;  1PH1 A;  2GVB A;  2Y0S G;  4DK3 C;  5GAH C;  2AHO B;  2K33 A;  1EYD A;  1CA5 A;  1EIG A;  3L0O A;  3NTI A;  3Q6S A;  1WYD A;  2JA8 H;  4BBS H;  3SE0 A;  1EFI D;  1NMG A;  5KNB A;  3M4Q A;  2NVX B;  2PI2 A;  1NR2 A;  1RL2 A;  1QUQ B;  4DF7 A;  4TRD A;  1Q12 A;  1FYC A;  3I4O A;  1EU3 A;  3QOL A;  4BY7 B;  1A6X A;  1I6H B;  3GTG B;  4C2M H;  1VQN A;  3R2T A;  4ME3 A;  5F2D A;  1IZ6 A;  1KNA A;  2HHH Q;  2Z6K A;  1T9H A;  2J7Z A;  2R7F A;  5IT9 L;  4AQY L;  3UDG A;  4IOA A;  5A2Q E;  5JPM C;  1HRJ A;  4N8F A;  4RWS C;  3R2I A;  3C2P A;  1AZP A;  2YU9 H;  4GKJ L;  1NE3 A;  3CPF A;  1N32 Q;  2Q8T A;  3A8K E;  3HOU B;  3TZD A;  2DY8 A;  5M5Y H;  3HOV G;  1IBM Q;  2AWN A;  2NYZ D;  3S1R H;  2F0L A;  4WRD A;  3S15 B;  3MXU A;  4G4K A;  2QEX A;  2GVA A;  4DV6 Q;  5C4Z A;  2B63 H;  2E5L L;  3TS2 A;  1WTQ A; 
#chains in the Genus database with same CATH homology
 3TP7 A;  5CV4 A;  1BQQ T;  2PO4 A;  3HZX A;  3SK6 A;  4A93 B;  1QCB D;  1KNE A;  3H0G B;  1T5E A;  3OHX C;  2A68 D;  1QWY A;  1RTO A;  1FGB D;  1HUM A;  2ENB A;  2VXW A;  2F0T A;  4HCE A;  3RUZ A;  1LTS D;  1BOS A;  1PMR A;  1IW7 C;  4O42 A;  3IAY A;  2WAC A;  1MSG A;  1V8Q A;  3OW7 A;  5LL6 S;  2XWJ B;  3QB3 A;  3I91 A;  2EVB A;  5M3M B;  1B9M A;  4N9P A;  2M9V A;  4HCS A;  1Z47 A;  4IUQ A;  1KAB A;  3PV0 A;  1CT1 D;  1JIC A;  1JC7 A;  1GUO A;  2VB3 X;  5CGK A;  1ET9 A;  1LTB D;  3MZ5 A;  1YNJ D;  4QB4 A;  1IKL A;  1EZ8 A;  4LK1 C;  2ZXP A;  3KBX A;  3ND8 A;  4X3K A;  4RGO S;  3R93 A;  4G57 A;  1MI2 A;  1JOQ A;  1RF2 D;  2KJX A;  1SBB B;  1JR0 D;  1HA5 A;  5IGF A;  2EDG A;  3BYY B;  2WP8 J;  2F0W A;  1EQT A;  4DXG A;  3SK8 A;  2F0I A;  5JEA J;  1WTX A;  5JVH 3;  3AMU A;  5ELD A;  3E0J A;  1A2T A;  2E76 C;  3D4R A;  2D2C C;  4ODG A;  1C4Q A;  2NB0 A;  3MC0 B;  1SND A;  1F9S A;  1LT6 D;  4FNF A;  3M7N A;  1XXG A;  4CKE A;  1SE4 A;  2F0U A;  3NE5 B;  3K5L A;  3ERO A;  2EJF C;  3GTJ B;  3VR6 A;  2N55 A;  2FJ2 A;  5A2Q L;  2M00 A;  2E2H B;  3C3L A;  1UAP A;  1JWS D;  4IFD G;  1I3Q B;  1SJH D;  1SYC A;  1Q90 A;  1CHP D;  4Q0F A;  3V2T A;  3S2H B;  3H6M A;  1SDF A;  2Q8I B;  4OO1 I;  5DNF A;  4HSP A;  2FMM A;  2F1M A;  2X69 A;  2B2W C;  2F0J A;  4K5X A;  1F9Q A;  2AQ1 B;  3T51 B;  1HTP A;  2HCC A;  4KN7 C;  4CKB A;  2K28 A;  4HN7 A;  5C4J B;  3PUX A;  1NUC A;  1PTO B;  3X3M A;  1PYW D;  1GXD C;  4TQU S;  4LMQ D;  1IHZ A;  2NTS A;  3TSS A;  4XT3 B;  1I50 B;  2B8G A;  4A3G B;  3HEJ A;  4BBR B;  5A35 A;  1F77 A;  2SDF A;  3J80 E;  1SJE D;  4HED A;  4RH6 A;  2KED A;  3I4N B;  1F2Y A;  1S5D D;  3MFG A;  1EU4 A;  3KBG A;  3R3O A;  4ZKB B;  2J0T D;  1TQO A;  3P75 A;  3M4Y A;  2TMP A;  4UDU C;  1WTW A;  3S14 B;  4PNY A;  2OEO A;  1QNK A;  4FF1 A;  4I65 A;  3SR1 A;  4OO1 G;  2BOS A;  1JWM D;  1V43 A;  1IYV A;  4KY5 A;  3K58 A;  3HGB A;  2BA1 A;  3DEP A;  1DON A;  1ZYR D;  3CRK C;  3KF8 A;  2R6G A;  2DY7 A;  5I9P A;  4J8Q A;  1TWF B;  1ROD A;  3PUW A;  3DUZ A;  2OXP A;  3LNN A;  1PTO C;  1BO0 A;  3GO5 A;  1Q3L A;  2JA7 B;  3QIA A;  1LTA D;  4N9T A;  5J1Z A;  3OIP A;  2B2V C;  1STB A;  3GP7 A;  5COY A;  3M4O B;  4K5W A;  1AW7 A;  1CZG A;  4RFB A;  2F0Q A;  4FF4 A;  1XYI A;  3NPP A;  1EEI D;  2F0K A;  3QG1 A;  5I6Y A;  4CJ1 B;  3BVM A;  2QCP X;  2IW3 A;  5EQ0 A;  3KLS A;  2E2D C;  4R8N A;  4KKS A;  1MBY A;  3MWY W;  4KD4 A;  3NHH A;  1ENC A;  3RZD B;  2NN6 H;  3BG3 A;  4DAP A;  1SNM A;  4ZAI A;  2K6A A;  1JWU D;  4QMG A;  3CU7 A;  2ID0 A;  1FNV A;  3OMG A;  4XYO A;  1PFN A;  2AWO A;  1UNS A;  2K1B A;  1GUW A;  3VYT A;  4A3K B;  2RKS A;  2AQ2 B;  1TS5 A;  3QOJ A;  2EYH A;  4A3J B;  4DK1 A;  1HFG A;  2IX3 A;  5BN3 A;  3KLR A;  1SEB D;  1YNJ C;  3HP3 A;  5CBA E;  4NMZ A;  3GD7 A;  1D2B A;  3A54 A;  4J6H A;  1JB3 A;  1U4M A;  5JAV A;  2NBF A;  5FKA C;  5CC4 A;  1S5C D;  4C56 C;  3NTH A;  4G7O C;  4IAL A;  3J80 L;  2VUM B;  1DM0 B;  3H09 A;  4ULL A;  4IUP A;  2A69 D;  5E3F A;  1EWC A;  1LTR D;  1GHJ A;  4K2L A;  5FLX E;  2EY5 A;  2JP1 A;  3E6Z X;  1KTK A;  2VNU D;  5CV7 A;  5D3D A;  2VB2 X;  1ZKO A;  1SXT A;  2B2Y C;  1VDZ A;  3W2D A;  1B9N A;  1EZ6 A;  3PO3 B;  5CYU A;  3OWF A;  4NDX A;  1RD9 D;  4QCL A;  1IKM A;  2WV6 D;  2A6E D;  3N52 A;  3K5N A;  3D3R A;  4ZQ3 A;  4BWG B;  5DM7 3;  3S1N B;  2Q8R E;  3HG9 A;  4EQP A;  3S2D B;  5IT9 E;  5EKK A;  2B2W A;  1BXT A;  2D5D A;  3T13 A;  1WTO A;  3C46 A;  3HOZ B;  2B2U C;  3H91 A;  3J7A F;  2I46 A;  2F0V A;  2QF7 A;  1H9J A;  1CTM A;  3VYS A;  1XX8 A;  2JXM B;  3SXH A;  1SYF A;  3OIQ A;  1FD7 D;  5ELC A;  3S16 B;  1VMC A;  3EFX D;  3OSO A;  1EEF D;  1K83 B;  3GTM B;  2K01 A;  1ILP A;  1EY0 A;  1R9T B;  3WOE A;  1GJX A;  3MTS A;  1TII D;  1EYC A;  3DWP A;  2KCC A;  3R8B A;  4M1U B;  3NQI A;  1STA A;  2IT1 A;  2LMC B;  2HUG A;  2Y0S B;  1A3U A;  3S17 B;  5JEA G;  4HSV A;  3W3A A;  2BDO A;  1STN A;  1EY6 A;  1K8M A;  4XQJ A;  4OL7 A;  1F9P A;  4XTC S;  2A6H C;  4KY6 A;  3BZD B;  3RD4 A;  1IL8 A;  2B2V A;  4IUR A;  3K59 A;  1Y8N B;  2XSC A;  5T1I A;  1ZYR C;  1TWH B;  1KDC A;  4OHJ A;  2XIW A;  3NUC A;  3I73 A;  2EYL A;  1RTN A;  4UAI A;  5EGT A;  3LX0 A;  2F3V A;  3Q24 A;  1TR5 A;  3SEB A;  4IQZ A;  3FRP B;  5FLX L;  5DEH A;  3P7J A;  1IYU A;  1OO9 B;  2DNC A;  4O1N A;  4C2M B;  1ILQ A;  2EYP A;  4ZLT F;  1CZW A;  4J1M A;  4K5V A;  4IUT A;  3FDT A;  2M2L A;  3URY A;  3PUV A;  4E6I A;  3TDQ A;  3BYT B;  1FNU A;  1DCZ A;  1K8O A;  5IGG A;  4KMU C;  1BCP D;  1LTT D;  3ITP A;  4FXK C;  1L0Y B;  4CJ2 C;  2WAQ B;  1Y1V B;  2IJ0 A;  1LAB A;  3SVM A;  3OMC A;  5D65 A;  3TME A;  3CKI B;  2R3Z A;  4TSS A;  3KK7 A;  5DAU A;  1RDP D;  3F2U A;  1STH A;  3GTP B;  2F0O A;  4RGN A;  2RBM A;  1XTC D;  2O5J C;  2IX0 A;  3K5M A;  2K04 A;  4Z9C B;  1ONL A;  1OXT A;  1B53 A;  1TY0 A;  2AUK A;  3IFD A;  3PO2 B;  2B2Y A;  3GTO B;  1BBX C;  4L6T B;  2XN9 C;  1SMY D;  4OIK A;  2A69 C;  1WD0 A;  4FP5 D;  3X3N A;  2QEJ C;  5C3E B;  2E2I B;  3VA5 A;  5K36 H;  5TSS A;  2A73 B;  5IOD A;  5ELE A;  2R7Z B;  1MSH A;  1LT5 D;  1TY2 A;  2Z8L A;  2RQX A;  2H1E A;  3AU7 A;  3L3O C;  1JCK B;  4I7Z C;  5ELB A;  1WTV A;  3RZO B;  1TWA B;  2D9U A;  2L11 A;  3ZYY X;  4A3B B;  5I2X A;  1EIH A;  4MIU A;  3SHL A;  1JQY D;  2B2U A;  4K6D A;  2KEE A;  1C8C A;  3I3C A;  3P1H A;  2RSO A;  3D31 A;  1J8I A;  4F88 A;  3K5O A;  4DNR B;  1G29 1;  3H3V C;  5EKL A;  3PUY A;  3FPP A;  4DFA A;  2PPB C;  4RA8 A;  3MHB A;  5EJW A;  3GV6 A;  1PZK D;  3GTQ B;  3FKI B;  4DU9 A;  3FVQ A;  2EYF A;  2KEC A;  3SK5 A;  3V05 A;  4QUF A;  2DN8 A;  3TZU A;  2RDH A;  1OXU A;  1A2U A;  3BDO A;  5D14 A;  3TN2 A;  2OF1 A;  2E2J B;  2F03 A;  4IUN A;  4EQN A;  3PMF A;  3K7A B;  1A15 A;  1I4R A;  1M4V A;  2K05 A;  1DOM A;  1GOZ A;  2KQ3 A;  1PRT D;  3G7L A;  2Z4H A;  5M9O A;  4B9X A;  1AP0 A;  2JYO A;  2NWG A;  1Y69 U;  4ZYS A;  1QG7 A;  1LTI D;  1RCV D;  3RMH A;  1SYE A;  1TS3 A;  2KA7 A;  1SFO B;  4Y7N B;  2O4X A;  1BR9 A;  2E75 C;  1FR3 A;  3CRL C;  2SOB A;  2WIN B;  1XWE A;  1UEA B;  1O78 A;  1BCP F;  1JE4 A;  3MXP A;  3T16 A;  3K6O A;  4ZKC B;  2H4O A;  1QE6 A;  3MXG A;  3D4W A;  1SNO A;  2KOL A;  2V4D A;  4CHT B;  5FO7 B;  3A7A B;  5I2Y A;  3T56 B;  4RCO A;  2MP1 A;  4KK7 A;  1VMP A;  4TKO B;  3L9A X;  1SE2 A;  4DAY A;  2MUY A;  3OPO A;  4LJZ C;  3MEH A;  3HOY B;  3U9O A;  4AYB B;  1CM9 A;  3A8I E;  5EPJ A;  4PMB A;  4S3S A;  5KND A;  3BVZ A;  4JK1 C;  2SNS A;  1TWG B;  2EXZ A;  2NVY B;  4OGQ C;  1KDA A;  1BNZ A;  2O2L D;  1ZXT A;  2ZT9 C;  3BDL A;  1EL0 A;  4K8I A;  2LS0 1;  2ICI A;  4GZY C;  3H94 A;  4F8M A;  1PXU A;  3TP5 A;  5T1G A;  4FF3 A;  5CV9 A;  2EJG C;  5C5L A;  4QF4 A;  1SYG A;  4XDX A;  3KLS X;  3NTK A;  3O13 A;  4LAA A;  1VCI A;  1SNC A;  4H44 C;  3VR3 A;  4KN4 C;  3NWS A;  1MGS A;  2NN6 I;  1AN8 A;  2K5D A;  3BS1 A;  5E4W C;  4F7X A;  3A56 A;  4C1N I;  1AFP A;  2CW0 D;  4KI0 A;  5CMD A;  1RHP A;  2A68 C;  2F0H A;  2CHB D;  2JA6 B;  1GHK A;  2PCF B;  5C0X H;  2NUC A;  2IPK D;  2KVM A;  3DMU A;  1HXY D;  3DWA A;  1EOT A;  1X3P A;  3J7Y W;  3VA7 A;  4KD3 A;  1QNU A;  1SSO A;  1V1P B;  2K7V A;  2LFN A;  1DYQ A;  1CA6 A;  2F3W A;  5IGC A;  4DN4 M;  1O7Z A;  3TBI B;  3I90 A;  3TP6 A;  1PRT F;  5BN5 A;  2RSN A;  2X6L A;  2L55 A;  3MA2 B;  2NN6 G;  5LL6 X;  1HHV A;  5M5X B;  3ERQ A;  1HFN A;  4G7H C;  1HQR D;  3M7G A;  3S1Q B;  5KYI A;  1KAA A;  1B1Z A;  1X32 A;  2I07 B;  1J9O A;  3S9W A;  5EBC A;  5JPN C;  3DM1 A;  3E5S A;  4A3E B;  4X3U A;  2BCO A;  3HRZ C;  4KHZ A;  4RHS A;  1HTL D;  3HKZ B;  3FEW X;  2B39 A;  2IWH A;  3MAQ A;  4R8I A;  2E74 C;  2EZV A;  5I9O A;  1ENF A;  3QWN A;  4B08 A;  1YNN D;  3KUP A;  4XQQ A;  2SEB D;  2EOT A;  1B2T A;  1AEX A;  3ND9 A;  4ABN A;  3GTL B;  3V96 A;  3SK4 A;  1JOR A;  1H9R A;  2FFK B;  1SYD A;  1NR4 A;  2B2T C;  3T53 B;  3J7A V;  4XQN A;  5C5M A;  3LWE A;  4K2K A;  1UUP A;  4ME5 A;  4DNT B;  1ET6 A;  1NCV A;  4C3J G;  1WD1 A;  4FXD A;  4ZK9 B;  5E4X A;  2N88 A;  1X3Q A;  3GQB A;  1DOL A;  1ZEQ X;  3WOF A;  2PYK A;  1H9K A;  1VF7 A;  5HUR A;  2G9D A;  1GUN A;  4HMJ A;  4BY1 B;  4DXF A;  5IGD A;  2JE6 I;  1H9S A;  4PMC A;  3NXW A;  2L4N A;  1E2W A;  4K8J A;  2NTT A;  1LAC A;  4HAE A;  2ZXO A;  4HTH A;  4XXE A;  2D62 A;  4A3M B;  2FIN B;  2JEA I;  4G7Z C;  5C4X B;  1B44 D;  4DK0 A;  1ESF A;  2XVS A;  5IOC A;  1DJR D;  2BE5 D;  4PQX A;  2L12 A;  2F0E A;  4H0L C;  1ML0 D;  2XRQ D;  2JA8 B;  5FK9 C;  5DM6 3;  3VR2 A;  2PZU A;  4BBS B;  3P20 A;  5HGT A;  4YIJ A;  1CQV A;  2BDN A;  4ILW A;  3Q22 A;  1QJO A;  4PV1 C;  4CGY B;  1PFM A;  3I72 A;  2A5H A;  1EY9 A;  2AUJ D;  1CK1 A;  2QDB A;  2F0D A;  2CW0 C;  1DZ1 A;  4XIG S;  2YU9 B;  1GUT A;  1JOO A;  4WJW A;  5CR3 A;  1BUV T;  5C0X J;  4RKB A;  5M5Y B;  1F9R A;  2F0N A;  3S1R B;  5C3X A;  1BF4 A;  3FMC A;  5CV8 A;  2B63 B;  2C9O A;  4M8A A;  1WVL A;  1BDO A;  1EY7 A;  2ZXR A;  4EGV A;  1H9M A;  5JOB A;  4B9W A;  2NVT B;  1HA6 A;  1ICW A;  1F2M A;  5IGE A;  3M3Y B;  5C6A A;  3VR4 A;  3DWQ A;  1PFB A;  4CJ0 B;  4CKC A;  4WOR A;  4H7B A;  1D1K A;  1PTO D;  3D4D A;  2F0M A;  1O7Y A;  5J39 A;  4BA2 I;  2Z4I A;  3IKJ A;  4XT1 B;  2XRS D;  4NW2 A;  2B8F A;  1KDB A;  3CHB D;  1V1P A;  2IL8 A;  3A8J E;  1TS4 A;  1R4Q B;  2CQA A;  4ZUI A;  1V1O A;  4U68 A;  1G2T A;  2J4X A;  1DD2 A;  2R92 B;  1B3A A;  3LWU A;  3OOC A;  1Q8I A;  5FO8 B;  4RGM A;  4ID6 A;  1G2S A;  3NSW A;  5CV6 A;  2F0P A;  1D5M C;  2PZW A;  1YNN C;  2A6E C;  2MHV A;  1A3V A;  5ELF A;  1OXX K;  2C5C A;  3AB9 A;  1U4R A;  5KGU A;  1Y8O B;  2B2T A;  4L8J A;  1II3 A;  3HOX B;  2R93 B;  5JJZ A;  3I4M B;  1STE A;  1G8Z D;  1HCZ A;  4C3I B;  5K36 G;  1I6V C;  3U9S A;  5I6W A;  1I4X A;  2PZT A;  1NSN S;  2L1B A;  3I4L A;  2F0G A;  1EWH A;  4IFD I;  1SNQ A;  4KJN A;  4RGT A;  1LLR D;  4HR7 B;  2JEB I;  3L7Z C;  2XNA C;  3MFY A;  2F0F A;  2FMC A;  2LY7 A;  2MJ8 A;  5ISR A;  2K32 A;  4Q5V A;  1SAP A;  1LT4 D;  2F0S A;  2HDM A;  2TSS A;  3EA6 A;  2CVR A;  3NWT A;  4IFD H;  3I70 A;  2SNM A;  1WCM B;  1TU2 B;  4F87 A;  3JAM E;  1U4L A;  3QJY A;  4RHR A;  4C3I G;  1ENA A;  1E0B A;  2WB1 B;  2PMZ B;  2EJM A;  4KKU A;  5COR A;  5E1F A;  3A7L A;  1EY5 A;  3J81 E;  3I8Z A;  3K57 A;  5M5W B;  2EPB A;  5K5P A;  1BCP B;  1H9S B;  3VYR A;  1STG A;  3Q23 A;  4KY7 A;  1SYB A;  4IN3 A;  5C44 B;  4C3H B;  3UI2 A;  4BS9 A;  4PMW A;  3PIP 3;  2BE5 C;  1GUG A;  3NQT A;  5EPL A;  2RDG A;  1HUN A;  3N6R A;  2RDF A;  1S4Z A;  4RCN A;  1U9R A;  1PZJ D;  5LHY 1;  1D1I A;  1PTO F;  4OO1 H;  1NAP A;  1I4H A;  2OT2 A;  1Z6H A;  1O7L A;  1PTO H;  3VYU A;  2EYJ A;  4C3H G;  2EY1 A;  2HQE A;  1BCP C;  1E2V A;  3EJI A;  1T5X D;  1CHQ D;  5IGB A;  2A6H D;  1EY8 A;  4MN3 A;  4A3D B;  4DA2 A;  2A74 C;  2FHT A;  4BA1 I;  3OWE B;  2MPM A;  5J22 A;  1CI3 M;  1D6E C;  2GA4 B;  5CV5 A;  3IL8 A;  4R9W A;  3GTK B;  5C3W A;  2AQ3 B;  3C1F A;  5C0X I;  3NP8 A;  1LT3 D;  5G3L D;  4RAU C;  1M8A A;  4FXG C;  1U4P A;  3EQL C;  3DXJ C;  2NVQ B;  3MXN A;  1EYA A;  2EE1 A;  3RLF A;  1SMY C;  1QOH A;  5EKI A;  3JAM L;  3FPU B;  1PZI D;  5M3F B;  1TVX A;  1LTG D;  4EQO A;  5I4D A;  5AFW A;  5FOB B;  1TKW B;  1W6J A;  2RA4 A;  5KIX A;  3J81 L;  3IFT A;  2PQE A;  4NKL A;  1EY4 A;  1PRT B;  3A55 A;  4L63 B;  1R4P B;  3D6C A;  1LV9 A;  1AZQ A;  1RJT A;  2ICE C;  2LKV A;  2X6G A;  3ONA B;  1EQV A;  3BDC A;  4H13 C;  1KLG D;  2QIL A;  4QIW B;  5C0X G;  2WKD A;  4U67 3;  4V0B A;  1E2Z A;  4KJO A;  2PNR C;  1F2Z A;  3Q0A A;  1TS2 A;  4IZ8 A;  3C1E A;  4HMI A;  3VR5 A;  1LO5 D;  1Y8P B;  2EYM A;  1G6Z A;  1O80 A;  4FVM A;  1L0X B;  3BVG A;  5KEE A;  4C3J B;  5EBD A;  3MVV A;  1OXV A;  1D5Z C;  4K14 A;  4FF2 A;  1ESR A;  4KKT A;  1IW7 D;  3HS0 C;  2JA5 B;  2YYZ A;  4ZRZ A;  4IFD J;  2L5T A;  2DNE A;  1PRT C;  2RVL A;  2QKI C;  2IX1 A;  4KTA A;  3DEO A;  1OXS C;  1QIL A;  3PUZ A;  2KCN A;  5EPK A;  1TT2 A;  2EYO A;  4IUU A;  5C4H A;  5KYL A;  1JOK A;  3TP8 A;  4ZUJ A;  3GV3 A;  3S1M B;  5NUC A;  1Z7T A;  5D3I B;  5CBE E;  1I4Q A;  4A3F B;  4WFN 3;  5BN4 A;  1GUS A;  1I4P A;  4DAV A;  2PW7 A;  1F2L A;  1KLU D;  1W6K A;  1HQM C;  2R61 A;  1PLF A;  4FYD A;  4P2C B;  1WTR A;  1SE3 A;  4JBW A;  1G91 A;  1MD2 D;  2BA0 A;  4FO2 A;  1TWC B;  5JEA H;  4A3I B;  1D5X C;  3M85 A;  3D8G A;  1VF5 C;  3T4A C;  2HDL A;  4C1N K;  2Z1C A;  4V19 0;  2WKC A;  3D6W A;  1C48 A;  1FNW A;  5G3L F;  2O5I C;  2EY6 A;  1Q1B A;  4NP5 A;  1DOK A;  4XYQ A;  1A3T A;  3PIO 3;  3WDN A;  2WII B;  4RKL A;  1I4G A;  2MGS A;  1Y1W B;  1HPC A;  4X3T A;  3K0Y A;  4EVO A;  3G6J B;  1DXM A;  1S5F D;  3NK9 A;  2K5W A;  1B50 A;  2F4I A;  5KRU A;  3DHQ A;  3HOW B;  1SNP A;  2KUM A;  1CQF A;  4DGZ A;  4MHE A;  1CFM A;  4OIJ A;  1RKN A;  5FO9 B;  2EY2 A;  4CBV A;  5IIF A;  1S5E D;  1S5B D;  4IUV A;  2HCI A;  3EVQ A;  2L9H A;  3SDZ A;  4QUC A;  2K5Q A;  1PDQ A;  4X3S A;  1WTP A;  3QO2 A;  2XWB B;  2JSO A;  5KNC A;  1Q1E A;  1B4O A;  3NBH A;  3CQZ B;  2K03 A;  4K6L A;  1STY A;  2KHS A;  1QB5 D;  3HOV B;  2L0C A;  3NBI A;  2G9H D;  5JVG 3;  2PW5 A;  4KHV A;  2NZ1 D;  4KV6 A;  2K33 A;  1EYD A;  1CA5 A;  1EIG A;  3NTI A;  3Q6S A;  3SE0 A;  1EFI D;  5KNB A;  2NVX B;  1NR2 A;  4DF7 A;  4TRD A;  1Q12 A;  1FYC A;  1EU3 A;  3QOL A;  4BY7 B;  1A6X A;  1I6H B;  3GTG B;  3R2T A;  5F2D A;  1KNA A;  2J7Z A;  5IT9 L;  5A2Q E;  5JPM C;  1HRJ A;  4RWS C;  3R2I A;  3C2P A;  1AZP A;  2Q8T A;  3A8K E;  3HOU B;  3TZD A;  2DY8 A;  2AWN A;  2NYZ D;  3S15 B;  2F0L A;  4WRD A;  3MXU A;  4G4K A;  5C4Z A;  1WTQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...