5EPLA

Crystal structure of chromodomain of cbx4 in complex with inhibitor unc3866
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
54
structure length
54
Chain Sequence
GSEHVFAVESIEKKRIRKGRVEYLVKWRGWSPKYNTWEPEENILDPRLLIAFQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 SUMO-protein ligase CBX4
publication title A cellular chemical probe targeting the chromodomains of Polycomb repressive complex 1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/transcription inhibitor
total genus 11
structure length 54
sequence length 54
chains with identical sequence B
ec nomenclature ec 6.3.2.-:
pdb deposition date 2015-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5eplA00
4ZAIA 2NWGA 1BF4A 1BNZA 2B2TC 1NR4A 1JE4A 1M8AA 2M2LA 2Q8RE 3IFDA 3LWEA 4HCSA 5EPLA 1U4LA 2B2YA 1EQTA 4R9WA 3GV3A 1O80A 5EPKA 2B2VA 1E0BA 1PFNA 1S4ZA 1SDFA 2J7ZA 1HFGA 1U4RA 1VMPA 2K28A 1O7ZA 1SAPA 4HSVA 1SSOA 2B2WC 2EOTA 4XDXA 5JJZA 1WTQA 1WD1A 2MP1A 1B53A 2RSNA 2H1EA 3I90A 2FINB 5CBEE 2HDMA 4HAEA 1G2TA 4XT1B 4X3KA 4QUCA 1GUWA 4IUPA 2N55A 2HCCA 1C8CA 1X3QA 3TN2A 1QNKA 5EKIA 1DOMA 1ICWA 2K01A 3FDTA 5AFWA 2RVLA 3HP3A 3SVMA 2NZ1D 2RA4A 5EQ0A 1HUMA 2FMMA 4ZKCB 1CA5A 5D65A 1G91A 1J9OA 2CVRA 3FPUB 3MTSA 4OIKA 2B2YC 4XT3B 2K04A 1HA6A 2B2UC 3H91A 1U4MA 2K1BA 1WTRA 4X3TA 3G7LA 4IUUA 1CM9A 4RWSC 1PDQA 5COYA 3QO2A 1A15A 1EL0A 1F9QA 3D6WA 2L12A 3DEOA 4ZK9B 1RODA 2KEDA 3DEPA 3IL8A 4ZKBB 1AZPA 2DY8A 4MN3A 1LV9A 4HEDA 1CA6A 1PFBA 2MJ8A 1WTWA 2JP1A 1G6ZA 5DNFA 4DN4M 1IKLA 2Q8TA 2K03A 3TZDA 2XIWA 1HHVA 1NCVA 1BBXC 2EE1A 1ESRA 1JICA 1F9RA 1IL8A 2L1BA 2B2TA 3KUPA 1QG7A 1MSHA 4IUQA 4X3SA 1F9SA 1G2SA 1Q3LA 4LMQD 1EIGA 1MI2A 5T1IA 1EOTA 1EIHA 1WVLA 1F9PA 1NR2A 2R3ZA 3P7JA 3F2UA 1WTVA 1WTPA 1B2TA 1QE6A 4X3UA 3ONAB 5CORA 2B2VC 2X6LA 2B2WA 2MGSA 1B3AA 4IURA 1DOKA 2FFKB 2FHTA 1O7YA 3I8ZA 1AP0A 2L4NA 1WD0A 5CMDA 2HDLA 3Q6SA 3I91A 1WTOA 2MPMA 1DOLA 4RAUC 1XX8A 1ILQA 1F2LA 2KVMA 5EPJA 1HRJA 3I3CA 3N52A 4QUFA 4NW2A 5E4WC 1U4PA 2IL8A 3R93A 2KOLA 1KNAA 4RA8A 2HCIA 4MHEA 3DM1A 4UAIA 5CBAE 1DZ1A 1TVXA 4CJ1B 1WTXA 1AZQA 1MSGA 2FJ2A 1B4OA 2KUMA 4CJ2C 4O42A 1HUNA 2VXWA 3MWYW 1IKMA 1B50A 2RSOA 1J8IA 2B2UA 1HFNA 2SDFA 4R8IA 1MGSA 1NAPA 3KBXA 1RTOA 1ML0D 2X69A 2K05A 1BO0A 2KECA 2L11A 4IUVA 5D14A 2L9HA 5T1GA 2DY7A 1PFMA 4OIJA 1ZXTA 1RJTA 1X3PA 2HUGA 2X6GA 1ILPA 1X32A 2D9UA 1VMCA 2EPBA 1RHPA 2N88A 3UI2A 1DONA 1KNEA 4ZLTF 4IUTA 3GV6A 1XYIA 1RTNA 4CJ0B 2BDNA 2JYOA 2KEEA 4U68A 1PLFA 5E4XA 2NYZD 5EJWA
chains in the Genus database with same CATH superfamily
1GD7A 1Z7TA 1TT2A 5LMNL 2A6HD 1S72A 3M4OB 1NJIC 2XN9C 2UXCL 5J22A 4LF5L 2Z4HA 3S1NB 1I3QH 1VQKA 3KLSA 1SMXA 2F4VQ 4KK7A 1N33Q 1WOCA 3D31A 1VQ7A 5L37A 4IO9A 1QZHA 1CKOA 1BCPC 1HR0W 1LTRD 4B3RQ 1ICWA 1TWCH 1TWFB 2LY7A 4LUOA 1Z47A 2C35B 2HIVA 2FMMA 4K6LA 1EFWA 2A1AA 1A0IA 4DUYQ 3H3VI 4OIKA 4CHTB 3J7AV 4DKAC 2VS1A 1PDQA 1A3TA 1A15A 1F9QA 1SLJA 3OWFA 1S3OA 2JN4A 2IX0A 4YCVA 1XTCD 1K28A 2RBMA 1WTWA 4I7ZC 5DEHA 1GO3E 4DV3Q 1L1OA 4EGVA 5C4JH 2RHQB 2K33A 4OELB 2F0NA 3T1HL 1GUOA 1QJOA 4QIWB 4AQYL 3LGJA 4F87A 1O7LA 3KDFB 4JV5Q 3HOZG 1PZKD 1KC8C 1N32Q 4DNTB 1IBMQ 1SMYD 4UHVA 1XMOQ 4YWLA 2WAQB 4N9TA 4JI3Q 5C4ZA 4R8NA 4OWTB 4HTHA 3HG9A 4FP5D 2ATWA 1DYQA 1TVXA 4DU9A 4C3HB 5M3FH 2RSOA 1A2UA 4LF6Q 4YWKA 4FF3A 4RGNA 5D14A 2QEJC 2XGTA 1X3EA 2XNAC 4OIJA 2Q8IB 4V190 3M4PA 2WB1G 2XRSD 1XPRA 4JW0A 1FGBD 1TKWB 1LM0A 1Q90A 1TS3A 2OT2A 4N8X1 2RCNA 1X55A 2OTJA 2K52A 5E4XA 5EJWA 3SXHA 2NWGA 3PIP3 2B2TC 3TSSA 1VQCA 3RLFA 4H13C 2ZTEA 1RF2D 2F0GA 4FF4A 1NNXA 5IGEA 5M9OA 1MD2D 4L5QA 5K5PA 1VQ5A 3A8JE 1X65A 3NWTA 2HDMA 1J5EQ 3K5OA 2NUCA 2AKWB 3KLWA 5KNBA 3CPWA 2HCCA 4ULLA 3KLRA 4HIDA 2K6AA 3BVGA 1BBUA 1SNMA 3TP8A 1C0AA 3SVMA 3HP3A 2YU9B 1JQYD 3H15A 1IBLQ 4GKJQ 4C3HG 1UAPA 4XT3B 2PQEA 4BBSH 4OO1G 5FOBB 4LF4Q 2DGYA 2A19A 4RWSC 1EL0A 1KLGD 5LHY1 5HGQA 1FJGL 2ID0A 4V0BA 3UDXA 1FYCA 2MJ8A 4AIMA 4H44C 2RDGA 1V1PB 1VQGA 4B3SQ 5GQOA 4X3SA 1F9SA 1F2YA 3PF4A 1K83H 5IP9G 4QIWE 3S9WA 4UPAA 4YHHL 3GTOB 1Q46A 1BKBA 3ONAB 2B2WA 3T16A 1D8LA 4IURA 4J6HA 4WORA 3I4OA 3BYTB 2HHHL 4RMFA 1SJHD 1SNQA 3KLSX 3K0YA 4K5WA 2E2JH 1S5ED 2Z1CA 4CDCC 1ILQA 3HFZB 2R7FA 5JEAJ 1LTBD 2WAQE 2ZJQA 3X3NA 2WKCA 1U4PA 1EZ6A 3HOXH 4RA8A 4XYQA 2YTYA 3GTQB 3OW7A 3K59A 1MSGA 2K4KA 3NWSA 4DV1Q 2OXPA 1XNRL 4JI2L 4LFAL 1IKMA 1W6JA 1BUVT 4JI6Q 1TWGH 1JJGA 2B63H 3OIQA 1PRTF 4UP7A 1Q8KA 1N36L 4JI0L 2F1MA 3HOUB 2VZAA 3D0FA 1L2FA 5C4XH 2UXCQ 4TVAB 1KTKA 3PUYA 2CW0D 2JXMB 3H0GB 2OEOA 3G6EA 1Y1VB 3MZ5A 3E9IA 2JA5B 4MZ9A 1GOZA 3D4DA 3U58A 3VYTA 2NVYH 4LFCL 1SDFA 1PFNA 2K28A 2K75A 1W6KA 2XSCA 2BCOA 2WV6D 5C44B 1S5DD 3A0JA 1B53A 2CKZB 2K7VA 4HAEA 4KKTA 2JA7B 2KHJA 4X3KA 1QILA 1B9NA 3CQZB 4A3JB 1SYCA 5LMUL 2IWHA 5EKIA 3RMHA 2ZTCA 3OTOL 1SYFA 5GROA 5IP7G 2HT1A 1HUMA 2KHIA 4ZKCB 1S5CD 1LTSD 2YTVA 4HSPA 4JYAQ 4DR3L 5IYCG 2JA8B 1EY7A 3HOUG 3HOYB 1EY0A 3T51B 1ENFA 2F0OA 3T1HQ 4P74A 3E0EA 4AQYQ 5K36G 1WJJA 3CRLC 5IWAL 1H9JA 2N49A 3H0GG 1CHQD 1Y1VG 3U4ZA 4AH6A 3K5NA 5D3DA 1S5BD 1JOKA 4ILWA 5IGDA 2B2VC 1YNJD 3NXWA 1YHQA 4B9WA 1I3QB 5HGTA 4C1NK 1B3AA 3VA7A 3PUWA 3ITPA 5C44G 3AQQA 3NQIA 3J7ZC 4PMBA 1WTOA 4DR7Q 4QB4A 5M5YH 2JA7G 2UU9Q 4DV4Q 4A3JG 1PTOF 3HKZB 1TWCB 4NW2A 2EYMA 3ER0A 3CCQA 2F03A 1B1ZA 4O42A 4L8JA 4IFDH 5I2YA 5TSSA 1UE1A 4JCVE 1OXUA 2HQEA 3S2DH 2K05A 3DUZA 1PXUA 3J80L 2CFMA 2JA8G 1RD9D 3HOZH 1VQ4A 3C2PA 1DM0B 1L1OB 1LTLA 4B3TL 3HOYG 1X32A 5I6WA 1Y8PB 3S1RH 1XXGA 4P72A 4YY3Q 4KHPL 2DJGC 4JK1C 5GAHC 1C4QA 3J81j 3FKIH 3OOCA 2KEEA 5C4JB 3T53B 1TU2B 1U5KA 1LT5D 1O80A 1CHPD 4NMZA 5EBDA 2J4XA 3HEJA 4FYDA 4BBRG 1AN8A 2F0EA 1GUTA 2F0KA 4C3JH 4A3DH 1DCZA 4JI8Q 3VR6A 3HKZG 1K0RA 2EY1A 3DHQA 3K0XA 1FJGQ 5M3FB 1PH9A 1FNWA 2C5CA 1V8QA 2B2YC 5CV7A 4X65Q 5I4DA 1I6HH 1RODA 1KABA 5C4HA 1VQOA 4PG3A 2HD3A 3KJOA 4PZ7A 1H9SB 4CGYB 5JJLA 2JA9A 1EYDA 2Q8TA 5M3MG 2OF1A 1YNNC 2KENA 3K58A 1F9RA 4IFDI 2HHHQ 1JJCB 3I73A 3PIPA 4DV7L 2ASBA 2LS01 1K8AC 1TS4A 3DWAA 3J7A5 3VR3A 1ICFB 4FO2A 5GAEC 2MGSA 2E2IH 2L15A 4BY1H 4QL5A 1DOKA 1KDAA 3I8ZA 3L7ZC 1XNRQ 4LFAQ 3GTPH 5E3FA 4BXXH 3U9OA 2KVMA 1Q82C 3NHHA 4CDFC 2F0QA 1LTGD 5E4WC 2IL8A 4PNYA 3HKZE 1D5XC 3BYYB 3L3OC 2O5IC 2EYPA 1TIID 1WTXA 4H02A 1DGSA 1EIFA 2ENBA 4LWCA 1ENAA 4ID6A 4BBSB 2AWOA 3F1ZA 2KECA 2KHSA 1O7IA 3NEMA 1PYWD 3K7AH 1GKHA 1Y8NB 3CAMA 4C3IH 1HNZL 4N9PA 4LUVA 5HURA 2NTSA 2F0UA 2AUKA 2H4OA 1XPUA 5H1SE 4CJ0B 2N3SA 2BDNA 1U9RA 5J1ZA 2D62A 1K83B 2OQ0A 3CPFA 1SNOA 3F8TA 2B2YA 1E2VA 3BDCA 4K5VA 3Q0AA 4GZYC 2EXDA 1A2TA 4CDEC 1KDBA 3OPOA 1HFGA 1ET6A 2BH8A 1BXTA 5DLQE 4DAPA 5JJZA 1JWSD 5NUCA 3H3VC 1JOQA 3M7GA 2E2JB 3CC2A 3RLNA 1IBKL 1IHZA 3VR2A 4DR3Q 3HOXB 3J80i 5AFWA 4B3MQ 3EN2A 2EYHA 4IN3A 4F8MA 1X9NA 1G91A 1J9OA 1TWGB 1CUKA 1CK1A 1STHA 4IJLA 4PZ8A 5KYLA 3H91A 2B63B 2PMZB 5IWAQ 4BBSG 3DXJC 3MC0B 1LACA 5COYA 1SYGA 4HMJA 5C4XB 5DNFA 2EQSA 3HGBA 2K03A 2K5NA 2IX3A 3V96A 3EQLC 1QCBD 4GN3B 1NY4A 5A2QE 5IP7H 4B9XA 3BU2A 3PO2H 3CCRA 1IL2A 2NVYB 2F0SA 2F0WA 2NVXH 4XYOA 4G7ZC 2A8VA 4FXKC 3MFGA 1YNND 2MFIA 2JEBI 5J3BA 3T4AC 3I91A 4KY5A 3M7NA 1SYDA 2VY3A 4JI4L 5EPJA 1ZYRD 1T5EA 3HOXG 2EY2A 3J80c 2KCCA 1B3QA 5CC4A 1HFNA 5IGGA 2SNSA 4JBMA 2ZXPA 1G6PA 4KHPQ 2WKDA 2B63G 1XTDA 4DA2A 2L11A 5EKKA 4HMIA 5IOCA 2JEAI 3EJIA 2SOBA 5KNCA 1JB7A 1E1OA 2PI2A 5C4XG 3KYHC 2N88A 4JI1L 2R92G 4AYBB 1FGUA 1EIYB 4A3FG 3A5UA 2RF4A 2NB0A 3RR5A 3D8GA 1GXDC 4ZAIA 4XQQA 1NR4A 3I7FA 5KIXA 3CMEA 4LJZC 2N78A 1HNWL 1E0BA 3CW2C 2PNRC 4DV5L 3VYRA 1VMPA 5DAUA 3KFUA 3ZJYC 4A3IG 1SE8A 1QB5D 1WD1A 2M00A 4A3MH 5CBEE 3BS1A 4IUPA 3OMCA 3VYSA 4Y7NH 1QVFA 2R7DA 3GTMH 1BCPF 4O0AA 3QOLA 2KBNA 2NZHA 3ND9A 1CSPA 2K50A 2NZ1D 4TKOB 2PYKA 1A3UA 4IQZA 2Z0SA 4IPHA 4A3GG 4X64Q 2OWOA 3S2DB 2PMZE 5ELFA 5EAYA 1STBA 3D6WA 5DM73 3HOZB 4ME5A 4GLXA 4NXNQ 2KEDA 4QF4A 3IL8A 3S1RB 2DY8A 3NBHB 4BBRH 2JP1A 4IOCA 5FKAC 3TZUA 1HHVA 4AYBG 3FKIB 1FNUA 1JICA 4JC0A 3HOVH 2EYJA 4H7BA 1HTPA 1JJ2A 3NP8A 1IXRA 2PZWA 2Q2IA 3JC66 4MNOA 1S40A 5KGUA 3PO3H 2SEBD 1JWUD 5IYDH 1QE6A 5LMNW 4YCWA 3I4MH 1B70B 5ELOA 2WB1B 4X6AH 3CCUA 3U4VA 3NTKA 4C3JB 2A69C 5M3MH 4K2LA 5IT9L 2F3VA 4A3DB 1D5MC 1STYA 3N52A 4ODGA 3DM1A 4UAIA 1PMRA 1AZQA 3W1BA 5C0XG 4CJ2C 1JOOA 1HNZQ 5ELEA 1B50A 3AFPA 5JPMC 4A3BH 4IFDG 2EXZA 3IAYA 1RTOA 3JAME 2PCFB 2L5TA 3I72A 3T13A 2F52A 1I6HB 2DY7A 1ZXTA 1RJTA 1X3PA 2Z6KC 2ZJRA 2O5JC 1B8AA 4QJFA 4RGTA 3MHBA 2WFWA 5IT9E 3PF5A 4AYBE 1CKMA 1IYJB 1V1QA 4XIGS 3SR1A 1C48A 3QG1A 3FKIG 5AJ3L 4L5SA 2GVAA 4N8FA 4RFBA 2M2LA 1M8AA 2Q8RE 3RN2A 4NDXA 1HZ9A 2CW0C 2TSSA 1YJNA 4WRDA 2E2IB 2UXBL 1F2ZA 5ELCA 1EY5A 4BY1B 1I4HA 2B2WC 3J7AF 1AE3A 1ET9A 3I90A 4C56C 2FINB 3GTPB 1F2MA 4DK3C 2LXKA 4KKSA 2F0TA 3RNUA 4C3JG 1PH8A 3QR8A 3IRBA 2QF7A 3SK4A 1QNKA 4LF7L 4A3DG 2SNMA 4GLVB 3AMUA 1VQJA 2GN5A 1HNXQ 4G7HC 4YCUA 3NELA 3T1YQ 3MVVA 4JI5L 1CM9A 1EY4A 3K7AB 2K5DA 2ZXRA 4C3IB 2VQFL 4DR2L 2R93G 3U50C 1Q7YC 3GP7A 4O1NA 5KEEA 2RQXA 1XMQL 1IYUA 4GKKL 1G8ZD 2A5HA 4J1MA 3A8KE 4EX5A 1JR0D 4C1NI 3MAQA 3KUPA 4M1UB 2UUAL 4TSSA 1P8LA 2R7ZH 5M5WH 3OWEB 4CDDC 1GUNA 4J8QA 1I4RA 1X3GA 3S17H 3TP5A 2VB3X 4BY1G 2Z6KA 2D5DA 4IJHA 1Y8OB 2LFNA 2WB1E 1KDCA 2WACA 3K81C 3BG3A 3QIAA 4BXXG 1RIPA 1YNJC 4JOIA 1UEAB 2GVBA 1HRJA 4RKBA 4QUFA 1VQFA 1PYBA 2KOLA 3K6OA 5FO9B 1B4OA 1EY9A 1STEA 2IW3A 1KRTA 4IPDA 1LABA 1ML0D 4O2DA 2UXDQ 1DXMA 2A69D 2L9HA 2AQ2B 2KCMA 1WCMH 4C3IG 3ERSX 2ZM6L 2CQAA 1VMCA 1V43A 1E24A 1HNWQ 5HY6A 4DV5Q 3MXNA 2RDHA 2VQEL 2EY6A 3SK8A 4U68A 1HZAA 4OHJA 5I9PA 3PO2B 2MNAA 3H6MA 1Y14B 4ZRZA 4GOPC 1EQTA 3A74A 2NVXB 4G57A 1ZKOA 2PW5A 3VR5A 2JK8A 2EOTA 4EQOA 1LTAD 1GM5A 2F0MA 4LUZA 5LMNQ 4HIKA 4QUCA 2RHSB 5LL6X 1XPOA 4NXML 1EWIA 2R92H 1EU4A 1ASYA 4LF5Q 1F77A 4A3FH 2IX1A 3IKJA 2XTIA 2ZTDA 1XNQL 2BH2A 3NTHA 2JQOA 2CWPA 1RKNA 2PO4A 2K1BA 4FDBA 4RHSA 2MO0A 1H95A 4DXGA 1VQPA 3STBC 3J81E 4A3IH 3ULJA 4MN3A 1BOSA 1S5FD 2BA1A 1VQBA 3K5LA 2K5WA 2XIWA 1SFOH 1K8OA 4X66L 1VQLA 4E6IA 3NE5B 1CKNA 5F2DA 1EYAA 1EQRA 3PO2G 3WOEA 4A3GH 3EBEA 3CCMA 2MQHA 2HIXA 1PRTC 3L9AX 5IT9c 3HRZC 3W5OA 1XJVA 5KYIA 1HH2P 4A3MB 3S16H 2DNEA 3GTKH 3HOWH 2L4NA 2GA4B 1HTLD 3GTMB 4Y7NB 4DUZL 3TBIB 1I6VC 4A93H 4RAUC 4YIJA 3S1QH 4J15A 3CD6A 3KF8B 4BY7H 2RKSA 3R93A 3ICEA 1ASZA 2HCIA 4R4IA 3Q23A 2KCTA 3LNNA 5FO8B 4GOPA 3BVZA 1MGSA 3C1FA 1PV4A 1RCVD 5EBCA 3BZDB 1D5ZC 3KOJA 4QMGA 4JI7L 1JC7A 3SE0A 5AJ3Q 3EA6A 1PFMA 3F2BA 1SYBA 3M3YH 2HUGA 4POFA 2X6GA 5ELBA 4BBRB 1FR3A 3BJUA 2N8NA 1LT4D 2QDBA 4LAAA 2VUMG 1BVSA 2QEXA 1Q1EA 2LMCB 2CWAA 5CR3A 1HZBA 4A4IA 3HOVB 1JWMD 2B39A 1VQ9A 5C0XH 3PO3B 1TY0A 3CHBD 5EPLA 2K5VA 4P71A 1VQHA 1K3BC 3FPPA 4DFAA 3SHLA 4GNXA 1VQEA 1PA6A 4LF7Q 3I4MB 3TP6A 1A62A 1NTGA 1VQIA 4A3MG 2UUBL 4XQNA 2XWBB 5BN3A 5M3MB 1C8CA 3K8AA 5FO7B 2DNCA 4KJOA 3K80C 1TQOA 1QUQA 2VQFQ 4DR2Q 4MTKA 4A3BB 1XMQQ 4GKKQ 2EYOA 2PI2E 4ZKBB 1I94L 3IFTA 1K0SA 4R1JA 1PTOC 1SE4A 5G3LF 4LW1A 3HOVG 3RD4A 1WTHA 3WOFA 3STBD 4Q0FA 1EIGA 3PO3G 4PQXA 1EIHA 3A55A 5IYDG 5CV9A 2QA4A 5JOBA 3FP9A 1KL9A 3I4MG 1VF5C 2R93H 2J0TD 1AP0A 1HZCA 4FNFA 4BWGB 3ERQA 3P20A 4YHHQ 1F2LA 1G51A 1UE6A 4KHVA 3I3CA 1X56A 5C0XI 1Q81C 2CH4W 4Q5VA 1PRTD 2KUMA 2ZM6Q 5FJ8G 1K9MC 5EKLA 4OX9L 4A3BG 3FHWA 3HS0C 1NAPA 2PNHA 1ZYRC 3NUCA 4FVMA 2LXJA 3GD7A 3MA2B 4IUVA 1YVCA 4CBVA 3KDFA 4JI2Q 1LYLA 2ICEC 1EFID 3TEHB 3CRKC 1Q8IA 5M5XH 4CKEA 1N36Q 4JI0Q 1PLFA 3MEHA 5I6YA 2F4VL 1SROA 3GDEA 1BNZA 1D1IA 1EEFD 5M5WB 1SXTA 2R7ZB 4HCSA 4ZYSA 5IE8A 1PH6A 2E5LL 4NXMQ 4KJNA 5I2XA 1LUZA 1CQVA 2PW7A 2QKIC 4RHRA 3S17B 1A63A 4XDXA 1D2BA 2I5HA 5FK9C 1UNSA 1R4QB 3S1MH 1G2TA 3RN5A 4DUYL 4UP9A 1PTOH 2EIFA 4EQNA 4LFCQ 3I4NH 2E74C 5IGFA 4KN7C 1VF7A 1I4QA 3PQIA 4LFBL 1E2ZA 2O4XA 4JBKA 1II3A 4DV3L 3L0OA 2ICIA 2HQLA 2F0PA 2L55A 1WTRA 5IGBA 3G7LA 5JEAH 5LMUQ 4X66Q 2Q2TA 1H9MA 1WCMB 4KTAA 3OTOQ 4P2CB 2YTXA 4I7AA 1PFBA 2A6ED 1RL2A 1IKLA 1PH1A 4RGMA 2IY5B 3P1HA 1YJ9A 3CCJA 5JVH3 1ESRA 1PZID 1KXLA 1SNPA 4OWWB 1IL8A 2L1BA 1VS0A 1QG7A 1QZGA 5A2QL 2R7ZG 5GADC 4DUZQ 1WVLA 1EZ8A 1SBBB 5CV8A 1WTVA 3HKSA 3R3OA 1PTOD 4XXEA 2PQAA 2DJFC 3QB3A 1DOLA 4HR7B 2EZVA 2R92B 1WFQA 2JA6G 1PH7A 2G9DA 1WI5A 3TDQA 2F3WA 4A3FB 4JI7Q 1D6EC 1HJPA 1V1PA 4I65A 4JG2A 4L63B 3X3MA 1GUGA 3MWYW 2B2UA 5JAVA 3W3AA 3CMAA 3FVQA 4DPGA 1Y69U 3OHXC 4K5XA 4A3IB 1WCMG 3MXUA 3UI2A 1SFOB 3FEWX 1ESFA 4FXGC 1SN8A 2ES2A 1JE4A 3IFDA 4B3TQ 4A3GB 1MKHA 4OONA 1YNXA 3QWNA 3C3LA 3SDZA 3A5ZB 3PSIA 2TMPA 1GHKA 3PUVA 3S16B 2E2DC 2MP1A 1IBLL 3GTKB 1PH2A 3HOWB 5C6AA 1CFMA 4JBWA 2DUDA 1NUCA 2BE5C 2N55A 4A93B 2VUMH 2KJXA 1X3QA 3S1QB 2KCNA 4BY7B 1O78A 5IIFA 4GOPB 1E1TA 2ZT9C 1EQQA 5D65A 3BZCA 4UP8A 4ME3A 1GVPA 1U4MA 4DK1A 4DV0L 3PIOA 4B3SL 3M3YB 4QQBX 5BN4A 1I5FA 1AZPA 1QWYA 3L2PA 4DV2L 3EROA 3GTJH 3MEFA 1UWVA 4HIMA 5M5YB 2H5XA 2M9VA 4F88A 4ABNA 1ENCA 4NB3A 1MSHA 1SR3A 4GNXB 1KAAA 1Y1WH 1YHAA 5T1IA 2NBFA 3UE0A 5KRUA 3PUXA 1F9PA 1NR2A 1B2TA 4NPSA 4JBJA 4X3UA 4GS3A 3CC7A 5KNDA 1AE2A 1YJWA 3A7AB 1DD2A 1STGA 2XWJB 1MJEA 1HR0L 1O7YA 1C9OA 4S3SA 3M9BA 1N8RC 1WD0A 2NVTH 3HOWG 3Q6SA 1QVCA 1JCKB 1SJED 2G5DA 4DV7Q 4RCNA 1XX8A 4A93G 4IPCA 4K8IA 1QUQB 4MIUA 3EVQA 4BY7G 1HPCA 4KY6A 1I4PA 2JJQA 1PRTB 3D3RA 2K5HA 5IGCA 4CKBA 1K3RA 1RDPD 2IHEA 1VQNA 3F2DA 4A3CH 2OQKA 2RCFA 1BO0A 5BN5A 3JAML 2V1CC 4EVOA 1DJRD 4MTNA 1WYDA 3EIVA 3TREA 3AU7A 3BZKA 2VW9A 2E5LQ 2IT1A 4KN4C 3W1GA 1SEBD 1AEXA 3S14H 3OYYA 1TWAH 2NN6H 5ISRA 5FJ8H 3LWEA 5J39A 3I70A 1U4LA 4TRDA 3VR4A 4A3KH 1Z6HA 2XRQD 1S4ZA 2E8GA 3G4SA 4BA2I 1O7ZA 1SAPA 3U9SA 1M1KC 3DMUA 1SSOA 5C0XJ 4LFBQ 2R93B 4K14A 1PHJA 4IFDJ 2Q2UA 2UUCL 5E1FA 1AH9A 1KLUD 1D1KA 4A3LH 1UUPA 4L6TB 4Z9CB 4JYAL 3M85A 1PVOA 1YBYA 3TN2A 1NMFA 4JOIC 4DNRB 2OCEA 4DAMA 3OSOA 2K01A 3TQYA 1KRSA 2CVRA 2Z6BA 2ZXOA 1IBKQ 4LNQA 2BE5D 1JB3A 1VQDA 3A56A 4KKUA 5CYUA 2D0PA 1SNCA 1HXYD 3MFYA 4WJ4A 3I56A 3TZDA 2Z8LA 4G4KA 3BDOA 2EYFA 5M5XB 1EQVA 1NMGA 1W3SA 5LL6S 4DV6L 4HN7A 3V05A 1LLRD 4DR1L 4DR7L 2A68D 1Q3LA 4OEMB 1CSQA 2DN8A 1I4XA 2UU9L 2G9HD 3ND8A 4DV4L 5ELNA 3URYA 4DK0A 3CCSA 4K0KL 3P75A 3Q22A 1EEID 3S1MB 1TXYA 1VDZA 4DAVA 5CV5A 5CMDA 4RKLA 1PTOB 3KK7A 1H9SA 2K5QA 2PZTA 2AUJD 2QDLA 3AEVA 2CQOA 3I4NB 2RDFA 2NN6I 3S15H 1N9WA 3DM3A 1VQMA 1K8GA 4MHEA 5C3EH 3A8IE 2WIIB 4DAYA 4YY3L 4R8IA 2MHVA 2X69A 2CCZA 4JI4Q 1B44D 4FF2A 3NPPA 4GN4B 4ZQ3A 1CI3M 4WJWA 3CU7A 3UDFA 1MIUA 3NENA 3H94A 4DR5L 1GHJA 2WAQG 2JA6H 1TWHH 4ZLTF 4LF8L 3A7LA 2JYOA 1X3FA 2F0IA 1H9RA 1U0LA 4P73A 2NYZD 3J7YW 2I5MX 4NP5A 4R9WA 2AHOB 2B29A 3GV3A 5ELDA 4JI1Q 1R9TH 1D7QA 4JI8L 4DR6L 1BCPD 1EYCA 2PQAB 2EVBA 4HCEA 1EUJA 4EQPA 1AW7A 3TS2A 1BDOA 4X62L 1OO9B 4X65L 1G291 1N34L 2Y0SB 4DV0Q 4A3EH 3JAMi 3I4NG 1OXSC 4DR4L 2BOSA 1I4GA 2RA4A 3W2DA 4DV2Q 4FXDA 3CC4A 3DWPA 3E0JA 3FPUB 3NTIA 4GLAC 5FLMH 1IZ6A 2VL6A 1ZEQX 3GTLH 4X3TA 4IUUA 3AYHB 5JEAG 3G48A 4C2MH 2NVQH 1STAA 4OXPA 3WDNA 1LV9A 3J81L 1CA6A 3SEBA 3D6CA 5E7NA 3KJPA 2NZOA 3LWUA 3G71A 4U673 2B2TA 2V4DA 2BA0A 4HJ7A 1HR0Q 1G2SA 1PH3A 4POGA 3CCLA 3PMFA 4GNXC 1XWEA 1Z9FA 4DNIA 2QCPX 5IYBH 4WFN3 4RH6A 5GAGC 4IPGA 4Y52H 2E75C 2QGQA 2QILA 2FFKB 4RGOS 1Q86C 3VDYA 1EU3A 1LTTD 2VUMB 4KD4A 5FLXL 2I46A 3I55A 1FD7D 2Y0SG 1SYEA 1JE5A 3RLOA 3JAMc 4CJ1B 1HUNA 2D2CC 1QOHA 1EYGA 3GTGH 3EFXD 4OL7A 1TR5A 4IZ8A 1OXVA 3PV0A 4UDUC 4ZCKA 4H0LC 4KHZA 3D4RA 3GTJB 1V9PA 4LF9L 4L5TA 5FLXE 3CF5A 1BBWA 1C7YA 1DONA 1KNEA 2R6GA 1B7YB 1LT3D 4OGQC 4R4OA 2MO1A 1Y1WB 2UUCQ 3K7UC 5JJIA 2MUYA 2J7ZA 1U4RA 1EY6A 2BDOA 3PIO3 3E5SA 3H09A 4B3ML 1IW7C 3KF6A 1NBWA 2NVTB 3I2ZA 2I0QA 1T9HA 3CCEA 3R8BA 3KBGA 1YHBA 2R61A 1T5XD 3S2HH 2Y0SE 2UXBQ 2WINB 1ONLA 3LX0A 1FL0A 2YYZA 2JA5G 2PPBC 3RUZA 3RZOH 1EOVA 2EYLA 2E2HH 1IYVA 5IY0A 3R2IA 2ALYB 2Z4IA 4DV6Q 2KA7A 1A8VA 4B08A 4ZK9B 3TRZA 3DEPA 4DR1Q 4EQ5A 3RZDH 1K8MA 3CKIB 4XTCS 1LT6D 3SK5A 3CP0A 3MXPA 5A35A 3S14B 5CV4A 1TWAB 1NCVA 4JI5Q 2EE1A 1E7ZA 2F0FA 4K0KQ 3HZXA 4YWMA 5BR8L 4IUQA 1I50H 3FMCA 4ZUJA 2A6EC 2Q2HA 1Y1WG 4A3KB 1EOTA 3M4OH 2CHBD 2F0HA 2R3ZA 1V1OA 4DK6C 2I07B 1KD1C 4HJAA 2B8GA 3S1NH 1X54A 2UUAQ 1TS5A 2NTTA 4A75A 2JE6I 4HJ9A 3CXCA 3NBHA 1MBYA 1R4PB 4JVZA 3B6YA 1TWFH 1CTMA 4DR5Q 3J81i 1J6QA 1J8IA 4KMUC 4XQJA 1MHWC 1HCZA 1L0YB 1TY2A 1KIXA 3WWVA 4A3CG 3J80E 1CQFA 1PFSA 4LF8Q 3M4YA 3O13A 1KQSA 4QGUA 4KD3A 3VYUA 3PCOB 4UY8C 1UE7A 3I4LA 1KAWA 2D9UA 3AFQA 3UDGA 1UE5A 5CV6A 4HJ5A 1STNA 3G6JB 3PGZA 2LKVA 4IUTA 2Z9HA 4DR6Q 1XYIA 4PMCA 4KI0A 3DLLA 1AFPA 1HQRD 1LTID 2NN6G 1VCIA 4M8AA 1B9MA 2A74C 1BF4A 1YI2A 1QNUA 1EWCA 4X62Q 3SGIA 4KY7A 2K14A 4PMWA 4A3KG 1OXTA 2B2VA 1N34Q 3E6ZX 1L0WA 3TMEA 4P75A 3UE1A 2VQEQ 1X6OA 4DR4Q 2LSSA 1WTQA 4K8JA 3V2TA 2H1EA 1BCPB 1YZ6A 3NSWA 4X64L 3A54A 2VNUD 4A3LG 3K57A 2IHFA 2YV5A 3S15B 4QCLA 1NSNS 3NQTA 4NXNL 4DAYB 5C3EB 2F0VA 4HIOA 3E3XA 3MXGA 5EQ0A 1IW7D 4C3HH 3OIPA 1SNDA 1N33L 3VA5A 4OO1H 2B2UC 3J81c 2QW7A 2EJMA 2AQ3B 4ZUIA 4B3RL 1XNQQ 2JSOA 2C9OA 3ZYYX 4DN4M 3GQBA 2XVSA 1E2WA 1TWHB 3NK9A 2JA6B 1OTCA 4RCOA 4BA1I 1YIJA 5C5MA 4QY7A 4A76A 1YEZA 3D4WA 4K2KA 5IP9H 5M3FG 1CZGA 1WTPA 3P7JA 2P5ZX 3F2UA 1R9TB 3R2TA 4APVA 3N6RA 2X6LA 5D3IB 5FLXc 2FHTA 4KLKA 3TS0A 2VB2X 2MPMA 3MXNB 2ZJPA 4TQUS 4BS9A 4A3EB 5JJKA 2E76C 3PUZA 3NBIA 3GO5A 4LK1C 1KNAA 4JV5L 4WJ3M 2F0JA 1SE3A 5C3EG 2YU9H 1N32L 2FJ2A 1IBML 2VXWA 4NKLA 4LF9Q 3ULLA 1E22A 1XMOL 1HA5A 4G7OC 3GTLB 4JI3L 1VQ6A 1GUSA 4R4TA 3QJYA 3Q24A 4C2MB 2NVQB 3DWQA 2A6HC 1UEBA 1OXXK 1JT8A 1SE2A 4RG1A 1ILPA 5C5LA 1TS2A 4LF6L 2AQ1B 2EPBA 1NE3A 4DGZA 1RTNA 2K32A 4FF1A 1VQAA 2F0LA 3UDIA 2B3GA 4JPBW 4OO1I 1VQ8A 3AB9A 1YITA 3OW2A 3BVMA 5C3WA 5EPKA 4KV6A 3GTOH 2F3IA 3MTSA 2F0DA 4HSVA 1BQQT 2FXQA 2EJFC 2RSNA 3SK6A 1EWHA 4XT1B 1GUWA 1HNXL 2F4IA 3F2CA 4L5RC 1BR9A 3BDLA 3T1YL 3M4QA 1MJCA 4A3EG 1PYSB 1CKNB 2PZUA 1PH4A 1DOMA 3FDTA 2RVLA 3S24A 5JVG3 3GTQH 1A3VA 1CA5A 1J5EL 4K6DA 3GTGB 2IJ0A 2UUBQ 2FMCA 1HA6A 1CZWA 2K04A 5FLMG 4IALA 4DXFA 5IYCH 1A6XA 1E3PA 1JMCA 1FVIA 4R4QA 3QO2A 3FRPB 3DEOA 2L12A 5EGTA 4HJ8A 3HOUH 5BR8Q 5G3LD 5IODA 4HEDA 4GKJL 5K36H 1G6ZA 4IUNA 3K5MA 1I50B 1EY8A 4IOAA 4LF4L 2KQ3A 1BBXC 3H0GH 2EDGA 3OMGA 1Y1VH 2IPKD 1SMYC 2L0CA 2JA5H 4LMQD 1MI2A 2B8FA 1I94Q 1HQMC 3KF6B 3H3VH 1H9KA 5CORA 3Q8DA 1M90C 5IYBG 2I5LX 4PV1C 4OWXB 1QVGA 5C44H 5CGKA 4DF7A 2A68C 3C46A 1KHIA 2O2LD 3TP7A 5I9OA 2HDLA 1SRUA 2JA7H 2OTLA 4CKCA 1M4VA 2UXDL 1L1OC 3CQZH 3ULPA 1JORA 4A3JH 3S2HB 1GJXA 5CBAE 1DZ1A 1Q12A 2EJGC 1Q1BA 1W2BA 3RZOB 2AMCB 2E2HB 1K73C 2SDFA 2EY5A 1PZJD 5DM63 3KBXA 2WP8J 2A73B 2AWNA 4GN5A 5C3XA 2JA8H 2D0OA 5T1GA 3E9HA 3RZDB 3HOYH 4DV1L 1LO5D 3C1EA 3T56B 4JI6L 4OX9Q 5JPNC 2CH4A 1RHPA 3CCVA 1P16A 1FNVA 1PH5A 3GV6A 4ALPA 4PZ6A 1CT1D 4F7XA 3QOJA 3KF8A 4R4CA 1L0XB
chains in the Genus database with same CATH topology
1Z7TA 1TT2A 2A6HD 3M4OB 2XN9C 5J22A 2Z4HA 3S1NB 3KLSA 4KK7A 3D31A 1BCPC 1LTRD 1ICWA 1TWFB 2LY7A 1Z47A 2FMMA 4K6LA 4OIKA 4CHTB 3J7AV 1PDQA 1A3TA 1A15A 1F9QA 3OWFA 2IX0A 1XTCD 2RBMA 1WTWA 4I7ZC 5DEHA 4EGVA 2K33A 2F0NA 1GUOA 1QJOA 4QIWB 4F87A 1O7LA 1PZKD 4DNTB 1SMYD 2WAQB 4N9TA 5C4ZA 4R8NA 4HTHA 3HG9A 4FP5D 1DYQA 1TVXA 4DU9A 4C3HB 2RSOA 1A2UA 4FF3A 4RGNA 5D14A 2QEJC 2Q8IB 2XNAC 4OIJA 4V190 2XRSD 1FGBD 1TKWB 1Q90A 1TS3A 2OT2A 5E4XA 5EJWA 3SXHA 2NWGA 3PIP3 2B2TC 3TSSA 3RLFA 4H13C 1RF2D 2F0GA 4FF4A 5IGEA 5M9OA 1MD2D 5K5PA 3A8JE 3NWTA 2HDMA 3K5OA 2NUCA 5KNBA 2HCCA 4ULLA 3KLRA 2K6AA 3BVGA 1SNMA 3TP8A 3SVMA 3HP3A 2YU9B 1JQYD 4C3HG 1UAPA 4XT3B 2PQEA 4OO1G 5FOBB 4RWSC 1EL0A 1KLGD 5LHY1 2ID0A 4V0BA 1FYCA 2MJ8A 4H44C 2RDGA 1V1PB 4X3SA 1F9SA 1F2YA 3S9WA 3GTOB 3ONAB 2B2WA 3T16A 4IURA 4J6HA 4WORA 3BYTB 1SJHD 1SNQA 3KLSX 3K0YA 4K5WA 1S5ED 2Z1CA 1ILQA 5JEAJ 1LTBD 3X3NA 2WKCA 1U4PA 1EZ6A 4RA8A 4XYQA 3GTQB 3OW7A 3K59A 1MSGA 3NWSA 2OXPA 1IKMA 1W6JA 1BUVT 3OIQA 1PRTF 3HOUB 2F1MA 1KTKA 3PUYA 2CW0D 2JXMB 3H0GB 2OEOA 1Y1VB 3MZ5A 2JA5B 1GOZA 3D4DA 3VYTA 1SDFA 1PFNA 2K28A 1W6KA 2XSCA 2BCOA 2WV6D 5C44B 1S5DD 1B53A 2K7VA 4HAEA 4KKTA 2JA7B 4X3KA 1QILA 1B9NA 3CQZB 4A3JB 1SYCA 2IWHA 5EKIA 3RMHA 1SYFA 1HUMA 4ZKCB 1S5CD 1LTSD 4HSPA 2JA8B 1EY7A 3HOYB 1EY0A 3T51B 1ENFA 2F0OA 5K36G 3CRLC 1H9JA 1CHQD 3K5NA 5D3DA 1S5BD 1JOKA 4ILWA 5IGDA 2B2VC 1YNJD 3NXWA 4B9WA 1I3QB 5HGTA 4C1NK 1B3AA 3VA7A 3PUWA 3ITPA 3NQIA 4PMBA 1WTOA 4QB4A 1PTOF 3HKZB 1TWCB 4NW2A 2EYMA 2F03A 1B1ZA 4O42A 4L8JA 4IFDH 5I2YA 5TSSA 1OXUA 2HQEA 2K05A 3DUZA 1PXUA 3J80L 1RD9D 3C2PA 1DM0B 1X32A 5I6WA 1Y8PB 1XXGA 4JK1C 1C4QA 3OOCA 2KEEA 5C4JB 3T53B 1TU2B 1LT5D 1O80A 1CHPD 4NMZA 5EBDA 2J4XA 3HEJA 4FYDA 1AN8A 2F0EA 1GUTA 2F0KA 1DCZA 3VR6A 2EY1A 3DHQA 5M3FB 1FNWA 2C5CA 1V8QA 2B2YC 5CV7A 5I4DA 1RODA 1KABA 5C4HA 1H9SB 4CGYB 1EYDA 2Q8TA 2OF1A 1YNNC 3K58A 1F9RA 4IFDI 3I73A 2LS01 1TS4A 3DWAA 3VR3A 4FO2A 2MGSA 1DOKA 1KDAA 3I8ZA 3L7ZC 5E3FA 3U9OA 2KVMA 3NHHA 2F0QA 1LTGD 5E4WC 2IL8A 4PNYA 1D5XC 3BYYB 3L3OC 2O5IC 2EYPA 1TIID 1WTXA 2ENBA 4BBSB 1ENAA 4ID6A 2AWOA 2KECA 2KHSA 1PYWD 1Y8NB 4N9PA 5HURA 2NTSA 2F0UA 2AUKA 2H4OA 4CJ0B 2BDNA 1U9RA 5J1ZA 2D62A 1K83B 4K5VA 1SNOA 2B2YA 1E2VA 3BDCA 3Q0AA 4GZYC 1A2TA 1KDBA 3OPOA 1HFGA 1ET6A 1BXTA 4DAPA 5JJZA 1JWSD 5NUCA 3H3VC 1JOQA 3M7GA 2E2JB 1IHZA 3VR2A 3HOXB 5AFWA 2EYHA 4IN3A 4F8MA 1G91A 1J9OA 1TWGB 1STHA 1CK1A 2B63B 5KYLA 3H91A 2PMZB 3DXJC 3MC0B 1LACA 5COYA 1SYGA 4HMJA 5C4XB 5DNFA 3HGBA 2K03A 2IX3A 3V96A 3EQLC 1QCBD 5A2QE 4B9XA 2NVYB 2F0SA 2F0WA 4XYOA 4G7ZC 4FXKC 3MFGA 1YNND 2JEBI 3T4AC 3I91A 4KY5A 3M7NA 1SYDA 5EPJA 1ZYRD 1T5EA 2EY2A 2KCCA 5CC4A 1HFNA 5IGGA 2SNSA 2ZXPA 2WKDA 4DA2A 2L11A 5EKKA 4HMIA 5IOCA 2JEAI 3EJIA 2SOBA 5KNCA 2N88A 4AYBB 2NB0A 3D8GA 1GXDC 4ZAIA 4XQQA 1NR4A 5KIXA 4LJZC 1E0BA 2PNRC 3VYRA 1VMPA 5DAUA 1QB5D 1WD1A 2M00A 5CBEE 3BS1A 4IUPA 3OMCA 3VYSA 1BCPF 3QOLA 3ND9A 2NZ1D 4TKOB 2PYKA 1A3UA 4IQZA 3S2DB 5ELFA 1STBA 3D6WA 5DM73 3HOZB 4ME5A 2KEDA 4QF4A 3IL8A 3S1RB 2DY8A 2JP1A 5FKAC 3TZUA 1HHVA 3FKIB 1FNUA 1JICA 2EYJA 4H7BA 1HTPA 3NP8A 2PZWA 5KGUA 2SEBD 1JWUD 1QE6A 2WB1B 3NTKA 4C3JB 2A69C 4K2LA 5IT9L 2F3VA 4A3DB 1D5MC 1STYA 3N52A 4ODGA 3DM1A 4UAIA 1PMRA 1AZQA 5C0XG 4CJ2C 1JOOA 5ELEA 1B50A 5JPMC 4IFDG 2EXZA 3IAYA 1RTOA 3JAME 2PCFB 2L5TA 3I72A 3T13A 1I6HB 2DY7A 1ZXTA 1RJTA 1X3PA 2O5JC 4RGTA 3MHBA 5IT9E 4XIGS 3SR1A 1C48A 3QG1A 4RFBA 2M2LA 1M8AA 2Q8RE 4NDXA 2CW0C 2TSSA 4WRDA 2E2IB 1F2ZA 5ELCA 1EY5A 4BY1B 1I4HA 2B2WC 3J7AF 1ET9A 3I90A 4C56C 2FINB 3GTPB 1F2MA 4KKSA 2F0TA 4C3JG 2QF7A 3SK4A 1QNKA 2SNMA 3AMUA 4G7HC 3MVVA 1CM9A 1EY4A 3K7AB 2K5DA 2ZXRA 4C3IB 3GP7A 4O1NA 5KEEA 2RQXA 1IYUA 1G8ZD 2A5HA 4J1MA 3A8KE 1JR0D 4C1NI 3MAQA 3KUPA 4M1UB 4TSSA 3OWEB 1GUNA 4J8QA 1I4RA 3TP5A 2VB3X 2D5DA 1Y8OB 2LFNA 1KDCA 2WACA 3BG3A 3QIAA 1YNJC 1UEAB 1HRJA 4RKBA 4QUFA 2KOLA 3K6OA 5FO9B 1B4OA 1EY9A 1STEA 2IW3A 1LABA 1ML0D 1DXMA 2A69D 2L9HA 2AQ2B 4C3IG 2CQAA 1VMCA 1V43A 3MXNA 2RDHA 2EY6A 3SK8A 4U68A 4OHJA 5I9PA 3PO2B 3H6MA 4ZRZA 1EQTA 2NVXB 4G57A 1ZKOA 2PW5A 3VR5A 2EOTA 4EQOA 1LTAD 2F0MA 4QUCA 5LL6X 1EU4A 1F77A 2IX1A 3IKJA 3NTHA 1RKNA 2PO4A 2K1BA 4RHSA 4DXGA 3J81E 4MN3A 1BOSA 1S5FD 2BA1A 3K5LA 2K5WA 2XIWA 1K8OA 4E6IA 3NE5B 5F2DA 1EYAA 3WOEA 1PRTC 3L9AX 3HRZC 5KYIA 4A3MB 2DNEA 2L4NA 2GA4B 1HTLD 3GTMB 4Y7NB 3TBIB 1I6VC 4RAUC 4YIJA 2RKSA 3R93A 2HCIA 3Q23A 3LNNA 5FO8B 3BVZA 1MGSA 3C1FA 1RCVD 5EBCA 3BZDB 1D5ZC 4QMGA 1JC7A 3SE0A 3EA6A 1PFMA 1SYBA 2HUGA 2X6GA 5ELBA 4BBRB 1FR3A 1LT4D 2QDBA 4LAAA 1Q1EA 2LMCB 5CR3A 3HOVB 1JWMD 2B39A 5C0XH 3PO3B 1TY0A 3CHBD 5EPLA 4DFAA 3FPPA 3SHLA 3I4MB 3TP6A 4XQNA 2XWBB 5BN3A 5M3MB 1C8CA 5FO7B 2DNCA 4KJOA 1TQOA 4A3BB 2EYOA 4ZKBB 3IFTA 1PTOC 1SE4A 5G3LF 3RD4A 3WOFA 4Q0FA 1EIGA 4PQXA 1EIHA 3A55A 5CV9A 5JOBA 1VF5C 2J0TD 1AP0A 4FNFA 4BWGB 3ERQA 3P20A 1F2LA 4KHVA 3I3CA 5C0XI 4Q5VA 1PRTD 2KUMA 5EKLA 3HS0C 1NAPA 1ZYRC 3NUCA 4FVMA 3GD7A 3MA2B 4IUVA 4CBVA 2ICEC 1EFID 3CRKC 1Q8IA 4CKEA 1PLFA 3MEHA 5I6YA 1BNZA 2R7ZB 1D1IA 1EEFD 5M5WB 1SXTA 4HCSA 4ZYSA 4KJNA 5I2XA 1CQVA 2PW7A 2QKIC 4RHRA 3S17B 4XDXA 1D2BA 5FK9C 1UNSA 1R4QB 1G2TA 1PTOH 4EQNA 2E74C 5IGFA 4KN7C 1VF7A 1I4QA 1E2ZA 2O4XA 1II3A 2ICIA 2F0PA 2L55A 1WTRA 5IGBA 3G7LA 5JEAH 1H9MA 1WCMB 4KTAA 4P2CB 1PFBA 2A6ED 1IKLA 4RGMA 3P1HA 5JVH3 1ESRA 1PZID 1SNPA 1IL8A 2L1BA 1QG7A 5A2QL 1WVLA 1EZ8A 1SBBB 5CV8A 1WTVA 3R3OA 1PTOD 4XXEA 3QB3A 1DOLA 4HR7B 2EZVA 2R92B 2G9DA 3TDQA 2F3WA 4A3FB 1D6EC 1V1PA 4I65A 4L63B 3X3MA 1GUGA 3MWYW 2B2UA 5JAVA 3W3AA 3FVQA 1Y69U 3OHXC 4K5XA 4A3IB 3MXUA 3UI2A 1SFOB 3FEWX 1ESFA 4FXGC 1JE4A 3IFDA 4A3GB 3QWNA 3C3LA 3SDZA 2TMPA 1GHKA 3PUVA 3S16B 2E2DC 2MP1A 3GTKB 3HOWB 5C6AA 1CFMA 4JBWA 1NUCA 2BE5C 2N55A 4A93B 2KJXA 1X3QA 3S1QB 2KCNA 4BY7B 1O78A 5IIFA 2ZT9C 5D65A 1U4MA 4DK1A 3M3YB 5BN4A 1AZPA 1QWYA 3EROA 5M5YB 2M9VA 4F88A 4ABNA 1ENCA 1MSHA 1KAAA 5T1IA 2NBFA 5KRUA 3PUXA 1F9PA 1NR2A 1B2TA 4X3UA 5KNDA 3A7AB 1DD2A 1STGA 2XWJB 1O7YA 4S3SA 1WD0A 3Q6SA 1JCKB 1SJED 4RCNA 1XX8A 4K8IA 4MIUA 3EVQA 1HPCA 4KY6A 1I4PA 1PRTB 3D3RA 5IGCA 4CKBA 1RDPD 1BO0A 5BN5A 3JAML 4EVOA 1DJRD 3AU7A 2IT1A 4KN4C 1SEBD 1AEXA 2NN6H 5ISRA 3LWEA 5J39A 3I70A 1U4LA 4TRDA 3VR4A 1Z6HA 2XRQD 1S4ZA 4BA2I 1O7ZA 1SAPA 3U9SA 3DMUA 1SSOA 5C0XJ 2R93B 4K14A 4IFDJ 5E1FA 1KLUD 1D1KA 1UUPA 4L6TB 4Z9CB 3M85A 3TN2A 4DNRB 3OSOA 2K01A 2CVRA 2ZXOA 2BE5D 1JB3A 3A56A 4KKUA 5CYUA 1SNCA 1HXYD 3MFYA 3TZDA 2Z8LA 4G4KA 3BDOA 2EYFA 5M5XB 1EQVA 5LL6S 4HN7A 3V05A 1LLRD 2A68D 1Q3LA 2DN8A 1I4XA 2G9HD 3ND8A 3URYA 4DK0A 3P75A 3Q22A 1EEID 3S1MB 1VDZA 4DAVA 5CV5A 5CMDA 4RKLA 1PTOB 3KK7A 1H9SA 2K5QA 2PZTA 2AUJD 3I4NB 2RDFA 2NN6I 4MHEA 3A8IE 2WIIB 4DAYA 4R8IA 2MHVA 2X69A 1B44D 4FF2A 3NPPA 4ZQ3A 1CI3M 4WJWA 3CU7A 3H94A 1GHJA 4ZLTF 3A7LA 2JYOA 2F0IA 1H9RA 2NYZD 3J7YW 4NP5A 4R9WA 3GV3A 5ELDA 1BCPD 1EYCA 2EVBA 4HCEA 4EQPA 1AW7A 1BDOA 1OO9B 1G291 2Y0SB 1OXSC 2BOSA 1I4GA 2RA4A 3W2DA 4FXDA 3DWPA 3E0JA 3FPUB 3NTIA 1ZEQX 4X3TA 4IUUA 5JEAG 1STAA 3WDNA 1LV9A 3J81L 1CA6A 3SEBA 3D6CA 3LWUA 4U673 2B2TA 2V4DA 2BA0A 1G2SA 3PMFA 1XWEA 2QCPX 4WFN3 4RH6A 2E75C 2QILA 2FFKB 4RGOS 1EU3A 1LTTD 2VUMB 4KD4A 5FLXL 2I46A 1FD7D 1SYEA 4CJ1B 1HUNA 2D2CC 1QOHA 3EFXD 4OL7A 1TR5A 4IZ8A 1OXVA 3PV0A 4UDUC 4H0LC 4KHZA 3D4RA 3GTJB 5FLXE 1DONA 1KNEA 2R6GA 1LT3D 4OGQC 1Y1WB 2MUYA 2J7ZA 1U4RA 1EY6A 2BDOA 3PIO3 3E5SA 3H09A 1IW7C 2NVTB 3R8BA 3KBGA 2R61A 1T5XD 2WINB 1ONLA 3LX0A 2YYZA 2PPBC 3RUZA 2EYLA 1IYVA 3R2IA 2Z4IA 2KA7A 4ZK9B 4B08A 3DEPA 1K8MA 3CKIB 4XTCS 1LT6D 3SK5A 3MXPA 5A35A 3S14B 5CV4A 1TWAB 1NCVA 2EE1A 2F0FA 3HZXA 4IUQA 3FMCA 4ZUJA 2A6EC 4A3KB 1EOTA 2CHBD 2F0HA 2R3ZA 1V1OA 2I07B 2B8GA 1TS5A 2NTTA 2JE6I 3NBHA 1MBYA 1R4PB 1CTMA 1J8IA 4KMUC 4XQJA 1HCZA 1L0YB 1TY2A 3J80E 1CQFA 3M4YA 3O13A 4KD3A 3VYUA 3I4LA 2D9UA 5CV6A 1STNA 3G6JB 2LKVA 4IUTA 1XYIA 4PMCA 4KI0A 1AFPA 1HQRD 1LTID 2NN6G 1VCIA 4M8AA 1B9MA 2A74C 1BF4A 1QNUA 1EWCA 4KY7A 4PMWA 1OXTA 2B2VA 3E6ZX 3TMEA 1WTQA 4K8JA 3V2TA 2H1EA 1BCPB 3NSWA 3A54A 2VNUD 3K57A 3S15B 4QCLA 1NSNS 3NQTA 5C3EB 2F0VA 3MXGA 5EQ0A 1IW7D 3OIPA 1SNDA 3VA5A 4OO1H 2B2UC 2EJMA 2AQ3B 4ZUIA 2JSOA 2C9OA 3ZYYX 4DN4M 3GQBA 2XVSA 1E2WA 1TWHB 3NK9A 2JA6B 4RCOA 4BA1I 5C5MA 4K2KA 3D4WA 1CZGA 1WTPA 3P7JA 3F2UA 1R9TB 3R2TA 3N6RA 2X6LA 5D3IB 2FHTA 2VB2X 2MPMA 4TQUS 4BS9A 4A3EB 2E76C 3PUZA 3NBIA 3GO5A 4LK1C 1KNAA 2F0JA 1SE3A 2FJ2A 2VXWA 4NKLA 4G7OC 1HA5A 3GTLB 1GUSA 3QJYA 3Q24A 4C2MB 2NVQB 3DWQA 2A6HC 1OXXK 1SE2A 1ILPA 5C5LA 1TS2A 2AQ1B 2EPBA 4DGZA 1RTNA 2K32A 4FF1A 2F0LA 4OO1I 3AB9A 3BVMA 5C3WA 5EPKA 4KV6A 3MTSA 2F0DA 4HSVA 1BQQT 2EJFC 2RSNA 3SK6A 1EWHA 4XT1B 1GUWA 2F4IA 1BR9A 3BDLA 2PZUA 1DOMA 3FDTA 2RVLA 5JVG3 1A3VA 1CA5A 4K6DA 3GTGB 2IJ0A 1HA6A 2FMCA 1CZWA 2K04A 4IALA 4DXFA 1A6XA 3QO2A 3FRPB 3DEOA 2L12A 5EGTA 5G3LD 5IODA 4HEDA 5K36H 1G6ZA 4IUNA 3K5MA 1I50B 1EY8A 2KQ3A 1BBXC 2EDGA 3OMGA 2IPKD 1SMYC 2L0CA 4LMQD 1MI2A 2B8FA 1HQMC 1H9KA 5CORA 4PV1C 5CGKA 4DF7A 2A68C 3C46A 2O2LD 3TP7A 5I9OA 2HDLA 4CKCA 1M4VA 1JORA 3S2HB 1GJXA 5CBAE 1DZ1A 1Q12A 2EJGC 1Q1BA 3RZOB 2E2HB 2SDFA 2EY5A 1PZJD 5DM63 3KBXA 2WP8J 2A73B 2AWNA 5C3XA 5T1GA 3RZDB 1LO5D 3C1EA 3T56B 5JPNC 1RHPA 1FNVA 3GV6A 1CT1D 4F7XA 3QOJA 3KF8A 1L0XB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZAI A;  2NWG A;  1BF4 A;  1BNZ A;  2B2T C;  1NR4 A;  1JE4 A;  1M8A A;  2M2L A;  2Q8R E;  3IFD A;  3LWE A;  4HCS A;  5EPL A;  1U4L A;  2B2Y A;  1EQT A;  4R9W A;  3GV3 A;  1O80 A;  5EPK A;  2B2V A;  1E0B A;  1PFN A;  1S4Z A;  1SDF A;  2J7Z A;  1HFG A;  1U4R A;  1VMP A;  2K28 A;  1O7Z A;  1SAP A;  4HSV A;  1SSO A;  2B2W C;  2EOT A;  4XDX A;  5JJZ A;  1WTQ A;  1WD1 A;  2MP1 A;  1B53 A;  2RSN A;  2H1E A;  3I90 A;  2FIN B;  5CBE E;  2HDM A;  4HAE A;  1G2T A;  4XT1 B;  4X3K A;  4QUC A;  1GUW A;  4IUP A;  2N55 A;  2HCC A;  1C8C A;  1X3Q A;  3TN2 A;  1QNK A;  5EKI A;  1DOM A;  1ICW A;  2K01 A;  3FDT A;  5AFW A;  2RVL A;  3HP3 A;  3SVM A;  2NZ1 D;  2RA4 A;  5EQ0 A;  1HUM A;  2FMM A;  4ZKC B;  1CA5 A;  5D65 A;  1G91 A;  1J9O A;  2CVR A;  3FPU B;  3MTS A;  4OIK A;  2B2Y C;  4XT3 B;  2K04 A;  1HA6 A;  2B2U C;  3H91 A;  1U4M A;  2K1B A;  1WTR A;  4X3T A;  3G7L A;  4IUU A;  1CM9 A;  4RWS C;  1PDQ A;  5COY A;  3QO2 A;  1A15 A;  1EL0 A;  1F9Q A;  3D6W A;  2L12 A;  3DEO A;  4ZK9 B;  1ROD A;  2KED A;  3DEP A;  3IL8 A;  4ZKB B;  1AZP A;  2DY8 A;  4MN3 A;  1LV9 A;  4HED A;  1CA6 A;  1PFB A;  2MJ8 A;  1WTW A;  2JP1 A;  1G6Z A;  5DNF A;  4DN4 M;  1IKL A;  2Q8T A;  2K03 A;  3TZD A;  2XIW A;  1HHV A;  1NCV A;  1BBX C;  2EE1 A;  1ESR A;  1JIC A;  1F9R A;  1IL8 A;  2L1B A;  2B2T A;  3KUP A;  1QG7 A;  1MSH A;  4IUQ A;  4X3S A;  1F9S A;  1G2S A;  1Q3L A;  4LMQ D;  1EIG A;  1MI2 A;  5T1I A;  1EOT A;  1EIH A;  1WVL A;  1F9P A;  1NR2 A;  2R3Z A;  3P7J A;  3F2U A;  1WTV A;  1WTP A;  1B2T A;  1QE6 A;  4X3U A;  3ONA B;  5COR A;  2B2V C;  2X6L A;  2B2W A;  2MGS A;  1B3A A;  4IUR A;  1DOK A;  2FFK B;  2FHT A;  1O7Y A;  3I8Z A;  1AP0 A;  2L4N A;  1WD0 A;  5CMD A;  2HDL A;  3Q6S A;  3I91 A;  1WTO A;  2MPM A;  1DOL A;  4RAU C;  1XX8 A;  1ILQ A;  1F2L A;  2KVM A;  5EPJ A;  1HRJ A;  3I3C A;  3N52 A;  4QUF A;  4NW2 A;  5E4W C;  1U4P A;  2IL8 A;  3R93 A;  2KOL A;  1KNA A;  4RA8 A;  2HCI A;  4MHE A;  3DM1 A;  4UAI A;  5CBA E;  1DZ1 A;  1TVX A;  4CJ1 B;  1WTX A;  1AZQ A;  1MSG A;  2FJ2 A;  1B4O A;  2KUM A;  4CJ2 C;  4O42 A;  1HUN A;  2VXW A;  3MWY W;  1IKM A;  1B50 A;  2RSO A;  1J8I A;  2B2U A;  1HFN A;  2SDF A;  4R8I A;  1MGS A;  1NAP A;  3KBX A;  1RTO A;  1ML0 D;  2X69 A;  2K05 A;  1BO0 A;  2KEC A;  2L11 A;  4IUV A;  5D14 A;  2L9H A;  5T1G A;  2DY7 A;  1PFM A;  4OIJ A;  1ZXT A;  1RJT A;  1X3P A;  2HUG A;  2X6G A;  1ILP A;  1X32 A;  2D9U A;  1VMC A;  2EPB A;  1RHP A;  2N88 A;  3UI2 A;  1DON A;  1KNE A;  4ZLT F;  4IUT A;  3GV6 A;  1XYI A;  1RTN A;  4CJ0 B;  2BDN A;  2JYO A;  2KEE A;  4U68 A;  1PLF A;  5E4X A;  2NYZ D;  5EJW A; 
#chains in the Genus database with same CATH topology
 1GD7 A;  1Z7T A;  1TT2 A;  5LMN L;  2A6H D;  1S72 A;  3M4O B;  1NJI C;  2XN9 C;  2UXC L;  5J22 A;  4LF5 L;  2Z4H A;  3S1N B;  1I3Q H;  1VQK A;  3KLS A;  1SMX A;  2F4V Q;  4KK7 A;  1N33 Q;  1WOC A;  3D31 A;  1VQ7 A;  5L37 A;  4IO9 A;  1QZH A;  1CKO A;  1BCP C;  1HR0 W;  1LTR D;  4B3R Q;  1ICW A;  1TWC H;  1TWF B;  2LY7 A;  4LUO A;  1Z47 A;  2C35 B;  2HIV A;  2FMM A;  4K6L A;  1EFW A;  2A1A A;  1A0I A;  4DUY Q;  3H3V I;  4OIK A;  4CHT B;  3J7A V;  4DKA C;  2VS1 A;  1PDQ A;  1A3T A;  1A15 A;  1F9Q A;  1SLJ A;  3OWF A;  1S3O A;  2JN4 A;  2IX0 A;  4YCV A;  1XTC D;  1K28 A;  2RBM A;  1WTW A;  4I7Z C;  5DEH A;  1GO3 E;  4DV3 Q;  1L1O A;  4EGV A;  5C4J H;  2RHQ B;  2K33 A;  4OEL B;  2F0N A;  3T1H L;  1GUO A;  1QJO A;  4QIW B;  4AQY L;  3LGJ A;  4F87 A;  1O7L A;  3KDF B;  4JV5 Q;  3HOZ G;  1PZK D;  1KC8 C;  1N32 Q;  4DNT B;  1IBM Q;  1SMY D;  4UHV A;  1XMO Q;  4YWL A;  2WAQ B;  4N9T A;  4JI3 Q;  5C4Z A;  4R8N A;  4OWT B;  4HTH A;  3HG9 A;  4FP5 D;  2ATW A;  1DYQ A;  1TVX A;  4DU9 A;  4C3H B;  5M3F H;  2RSO A;  1A2U A;  4LF6 Q;  4YWK A;  4FF3 A;  4RGN A;  5D14 A;  2QEJ C;  2XGT A;  1X3E A;  2XNA C;  4OIJ A;  2Q8I B;  4V19 0;  3M4P A;  2WB1 G;  2XRS D;  1XPR A;  4JW0 A;  1FGB D;  1TKW B;  1LM0 A;  1Q90 A;  1TS3 A;  2OT2 A;  4N8X 1;  2RCN A;  1X55 A;  2OTJ A;  2K52 A;  5E4X A;  5EJW A;  3SXH A;  2NWG A;  3PIP 3;  2B2T C;  3TSS A;  1VQC A;  3RLF A;  4H13 C;  2ZTE A;  1RF2 D;  2F0G A;  4FF4 A;  1NNX A;  5IGE A;  5M9O A;  1MD2 D;  4L5Q A;  5K5P A;  1VQ5 A;  3A8J E;  1X65 A;  3NWT A;  2HDM A;  1J5E Q;  3K5O A;  2NUC A;  2AKW B;  3KLW A;  5KNB A;  3CPW A;  2HCC A;  4ULL A;  3KLR A;  4HID A;  2K6A A;  3BVG A;  1BBU A;  1SNM A;  3TP8 A;  1C0A A;  3SVM A;  3HP3 A;  2YU9 B;  1JQY D;  3H15 A;  1IBL Q;  4GKJ Q;  4C3H G;  1UAP A;  4XT3 B;  2PQE A;  4BBS H;  4OO1 G;  5FOB B;  4LF4 Q;  2DGY A;  2A19 A;  4RWS C;  1EL0 A;  1KLG D;  5LHY 1;  5HGQ A;  1FJG L;  2ID0 A;  4V0B A;  3UDX A;  1FYC A;  2MJ8 A;  4AIM A;  4H44 C;  2RDG A;  1V1P B;  1VQG A;  4B3S Q;  5GQO A;  4X3S A;  1F9S A;  1F2Y A;  3PF4 A;  1K83 H;  5IP9 G;  4QIW E;  3S9W A;  4UPA A;  4YHH L;  3GTO B;  1Q46 A;  1BKB A;  3ONA B;  2B2W A;  3T16 A;  1D8L A;  4IUR A;  4J6H A;  4WOR A;  3I4O A;  3BYT B;  2HHH L;  4RMF A;  1SJH D;  1SNQ A;  3KLS X;  3K0Y A;  4K5W A;  2E2J H;  1S5E D;  2Z1C A;  4CDC C;  1ILQ A;  3HFZ B;  2R7F A;  5JEA J;  1LTB D;  2WAQ E;  2ZJQ A;  3X3N A;  2WKC A;  1U4P A;  1EZ6 A;  3HOX H;  4RA8 A;  4XYQ A;  2YTY A;  3GTQ B;  3OW7 A;  3K59 A;  1MSG A;  2K4K A;  3NWS A;  4DV1 Q;  2OXP A;  1XNR L;  4JI2 L;  4LFA L;  1IKM A;  1W6J A;  1BUV T;  4JI6 Q;  1TWG H;  1JJG A;  2B63 H;  3OIQ A;  1PRT F;  4UP7 A;  1Q8K A;  1N36 L;  4JI0 L;  2F1M A;  3HOU B;  2VZA A;  3D0F A;  1L2F A;  5C4X H;  2UXC Q;  4TVA B;  1KTK A;  3PUY A;  2CW0 D;  2JXM B;  3H0G B;  2OEO A;  3G6E A;  1Y1V B;  3MZ5 A;  3E9I A;  2JA5 B;  4MZ9 A;  1GOZ A;  3D4D A;  3U58 A;  3VYT A;  2NVY H;  4LFC L;  1SDF A;  1PFN A;  2K28 A;  2K75 A;  1W6K A;  2XSC A;  2BCO A;  2WV6 D;  5C44 B;  1S5D D;  3A0J A;  1B53 A;  2CKZ B;  2K7V A;  4HAE A;  4KKT A;  2JA7 B;  2KHJ A;  4X3K A;  1QIL A;  1B9N A;  3CQZ B;  4A3J B;  1SYC A;  5LMU L;  2IWH A;  5EKI A;  3RMH A;  2ZTC A;  3OTO L;  1SYF A;  5GRO A;  5IP7 G;  2HT1 A;  1HUM A;  2KHI A;  4ZKC B;  1S5C D;  1LTS D;  2YTV A;  4HSP A;  4JYA Q;  4DR3 L;  5IYC G;  2JA8 B;  1EY7 A;  3HOU G;  3HOY B;  1EY0 A;  3T51 B;  1ENF A;  2F0O A;  3T1H Q;  4P74 A;  3E0E A;  4AQY Q;  5K36 G;  1WJJ A;  3CRL C;  5IWA L;  1H9J A;  2N49 A;  3H0G G;  1CHQ D;  1Y1V G;  3U4Z A;  4AH6 A;  3K5N A;  5D3D A;  1S5B D;  1JOK A;  4ILW A;  5IGD A;  2B2V C;  1YNJ D;  3NXW A;  1YHQ A;  4B9W A;  1I3Q B;  5HGT A;  4C1N K;  1B3A A;  3VA7 A;  3PUW A;  3ITP A;  5C44 G;  3AQQ A;  3NQI A;  3J7Z C;  4PMB A;  1WTO A;  4DR7 Q;  4QB4 A;  5M5Y H;  2JA7 G;  2UU9 Q;  4DV4 Q;  4A3J G;  1PTO F;  3HKZ B;  1TWC B;  4NW2 A;  2EYM A;  3ER0 A;  3CCQ A;  2F03 A;  1B1Z A;  4O42 A;  4L8J A;  4IFD H;  5I2Y A;  5TSS A;  1UE1 A;  4JCV E;  1OXU A;  2HQE A;  3S2D H;  2K05 A;  3DUZ A;  1PXU A;  3J80 L;  2CFM A;  2JA8 G;  1RD9 D;  3HOZ H;  1VQ4 A;  3C2P A;  1DM0 B;  1L1O B;  1LTL A;  4B3T L;  3HOY G;  1X32 A;  5I6W A;  1Y8P B;  3S1R H;  1XXG A;  4P72 A;  4YY3 Q;  4KHP L;  2DJG C;  4JK1 C;  5GAH C;  1C4Q A;  3J81 j;  3FKI H;  3OOC A;  2KEE A;  5C4J B;  3T53 B;  1TU2 B;  1U5K A;  1LT5 D;  1O80 A;  1CHP D;  4NMZ A;  5EBD A;  2J4X A;  3HEJ A;  4FYD A;  4BBR G;  1AN8 A;  2F0E A;  1GUT A;  2F0K A;  4C3J H;  4A3D H;  1DCZ A;  4JI8 Q;  3VR6 A;  3HKZ G;  1K0R A;  2EY1 A;  3DHQ A;  3K0X A;  1FJG Q;  5M3F B;  1PH9 A;  1FNW A;  2C5C A;  1V8Q A;  2B2Y C;  5CV7 A;  4X65 Q;  5I4D A;  1I6H H;  1ROD A;  1KAB A;  5C4H A;  1VQO A;  4PG3 A;  2HD3 A;  3KJO A;  4PZ7 A;  1H9S B;  4CGY B;  5JJL A;  2JA9 A;  1EYD A;  2Q8T A;  5M3M G;  2OF1 A;  1YNN C;  2KEN A;  3K58 A;  1F9R A;  4IFD I;  2HHH Q;  1JJC B;  3I73 A;  3PIP A;  4DV7 L;  2ASB A;  2LS0 1;  1K8A C;  1TS4 A;  3DWA A;  3J7A 5;  3VR3 A;  1ICF B;  4FO2 A;  5GAE C;  2MGS A;  2E2I H;  2L15 A;  4BY1 H;  4QL5 A;  1DOK A;  1KDA A;  3I8Z A;  3L7Z C;  1XNR Q;  4LFA Q;  3GTP H;  5E3F A;  4BXX H;  3U9O A;  2KVM A;  1Q82 C;  3NHH A;  4CDF C;  2F0Q A;  1LTG D;  5E4W C;  2IL8 A;  4PNY A;  3HKZ E;  1D5X C;  3BYY B;  3L3O C;  2O5I C;  2EYP A;  1TII D;  1WTX A;  4H02 A;  1DGS A;  1EIF A;  2ENB A;  4LWC A;  1ENA A;  4ID6 A;  4BBS B;  2AWO A;  3F1Z A;  2KEC A;  2KHS A;  1O7I A;  3NEM A;  1PYW D;  3K7A H;  1GKH A;  1Y8N B;  3CAM A;  4C3I H;  1HNZ L;  4N9P A;  4LUV A;  5HUR A;  2NTS A;  2F0U A;  2AUK A;  2H4O A;  1XPU A;  5H1S E;  4CJ0 B;  2N3S A;  2BDN A;  1U9R A;  5J1Z A;  2D62 A;  1K83 B;  2OQ0 A;  3CPF A;  1SNO A;  3F8T A;  2B2Y A;  1E2V A;  3BDC A;  4K5V A;  3Q0A A;  4GZY C;  2EXD A;  1A2T A;  4CDE C;  1KDB A;  3OPO A;  1HFG A;  1ET6 A;  2BH8 A;  1BXT A;  5DLQ E;  4DAP A;  5JJZ A;  1JWS D;  5NUC A;  3H3V C;  1JOQ A;  3M7G A;  2E2J B;  3CC2 A;  3RLN A;  1IBK L;  1IHZ A;  3VR2 A;  4DR3 Q;  3HOX B;  3J80 i;  5AFW A;  4B3M Q;  3EN2 A;  2EYH A;  4IN3 A;  4F8M A;  1X9N A;  1G91 A;  1J9O A;  1TWG B;  1CUK A;  1CK1 A;  1STH A;  4IJL A;  4PZ8 A;  5KYL A;  3H91 A;  2B63 B;  2PMZ B;  5IWA Q;  4BBS G;  3DXJ C;  3MC0 B;  1LAC A;  5COY A;  1SYG A;  4HMJ A;  5C4X B;  5DNF A;  2EQS A;  3HGB A;  2K03 A;  2K5N A;  2IX3 A;  3V96 A;  3EQL C;  1QCB D;  4GN3 B;  1NY4 A;  5A2Q E;  5IP7 H;  4B9X A;  3BU2 A;  3PO2 H;  3CCR A;  1IL2 A;  2NVY B;  2F0S A;  2F0W A;  2NVX H;  4XYO A;  4G7Z C;  2A8V A;  4FXK C;  3MFG A;  1YNN D;  2MFI A;  2JEB I;  5J3B A;  3T4A C;  3I91 A;  4KY5 A;  3M7N A;  1SYD A;  2VY3 A;  4JI4 L;  5EPJ A;  1ZYR D;  1T5E A;  3HOX G;  2EY2 A;  3J80 c;  2KCC A;  1B3Q A;  5CC4 A;  1HFN A;  5IGG A;  2SNS A;  4JBM A;  2ZXP A;  1G6P A;  4KHP Q;  2WKD A;  2B63 G;  1XTD A;  4DA2 A;  2L11 A;  5EKK A;  4HMI A;  5IOC A;  2JEA I;  3EJI A;  2SOB A;  5KNC A;  1JB7 A;  1E1O A;  2PI2 A;  5C4X G;  3KYH C;  2N88 A;  4JI1 L;  2R92 G;  4AYB B;  1FGU A;  1EIY B;  4A3F G;  3A5U A;  2RF4 A;  2NB0 A;  3RR5 A;  3D8G A;  1GXD C;  4ZAI A;  4XQQ A;  1NR4 A;  3I7F A;  5KIX A;  3CME A;  4LJZ C;  2N78 A;  1HNW L;  1E0B A;  3CW2 C;  2PNR C;  4DV5 L;  3VYR A;  1VMP A;  5DAU A;  3KFU A;  3ZJY C;  4A3I G;  1SE8 A;  1QB5 D;  1WD1 A;  2M00 A;  4A3M H;  5CBE E;  3BS1 A;  4IUP A;  3OMC A;  3VYS A;  4Y7N H;  1QVF A;  2R7D A;  3GTM H;  1BCP F;  4O0A A;  3QOL A;  2KBN A;  2NZH A;  3ND9 A;  1CSP A;  2K50 A;  2NZ1 D;  4TKO B;  2PYK A;  1A3U A;  4IQZ A;  2Z0S A;  4IPH A;  4A3G G;  4X64 Q;  2OWO A;  3S2D B;  2PMZ E;  5ELF A;  5EAY A;  1STB A;  3D6W A;  5DM7 3;  3HOZ B;  4ME5 A;  4GLX A;  4NXN Q;  2KED A;  4QF4 A;  3IL8 A;  3S1R B;  2DY8 A;  3NBH B;  4BBR H;  2JP1 A;  4IOC A;  5FKA C;  3TZU A;  1HHV A;  4AYB G;  3FKI B;  1FNU A;  1JIC A;  4JC0 A;  3HOV H;  2EYJ A;  4H7B A;  1HTP A;  1JJ2 A;  3NP8 A;  1IXR A;  2PZW A;  2Q2I A;  3JC6 6;  4MNO A;  1S40 A;  5KGU A;  3PO3 H;  2SEB D;  1JWU D;  5IYD H;  1QE6 A;  5LMN W;  4YCW A;  3I4M H;  1B70 B;  5ELO A;  2WB1 B;  4X6A H;  3CCU A;  3U4V A;  3NTK A;  4C3J B;  2A69 C;  5M3M H;  4K2L A;  5IT9 L;  2F3V A;  4A3D B;  1D5M C;  1STY A;  3N52 A;  4ODG A;  3DM1 A;  4UAI A;  1PMR A;  1AZQ A;  3W1B A;  5C0X G;  4CJ2 C;  1JOO A;  1HNZ Q;  5ELE A;  1B50 A;  3AFP A;  5JPM C;  4A3B H;  4IFD G;  2EXZ A;  3IAY A;  1RTO A;  3JAM E;  2PCF B;  2L5T A;  3I72 A;  3T13 A;  2F52 A;  1I6H B;  2DY7 A;  1ZXT A;  1RJT A;  1X3P A;  2Z6K C;  2ZJR A;  2O5J C;  1B8A A;  4QJF A;  4RGT A;  3MHB A;  2WFW A;  5IT9 E;  3PF5 A;  4AYB E;  1CKM A;  1IYJ B;  1V1Q A;  4XIG S;  3SR1 A;  1C48 A;  3QG1 A;  3FKI G;  5AJ3 L;  4L5S A;  2GVA A;  4N8F A;  4RFB A;  2M2L A;  1M8A A;  2Q8R E;  3RN2 A;  4NDX A;  1HZ9 A;  2CW0 C;  2TSS A;  1YJN A;  4WRD A;  2E2I B;  2UXB L;  1F2Z A;  5ELC A;  1EY5 A;  4BY1 B;  1I4H A;  2B2W C;  3J7A F;  1AE3 A;  1ET9 A;  3I90 A;  4C56 C;  2FIN B;  3GTP B;  1F2M A;  4DK3 C;  2LXK A;  4KKS A;  2F0T A;  3RNU A;  4C3J G;  1PH8 A;  3QR8 A;  3IRB A;  2QF7 A;  3SK4 A;  1QNK A;  4LF7 L;  4A3D G;  2SNM A;  4GLV B;  3AMU A;  1VQJ A;  2GN5 A;  1HNX Q;  4G7H C;  4YCU A;  3NEL A;  3T1Y Q;  3MVV A;  4JI5 L;  1CM9 A;  1EY4 A;  3K7A B;  2K5D A;  2ZXR A;  4C3I B;  2VQF L;  4DR2 L;  2R93 G;  3U50 C;  1Q7Y C;  3GP7 A;  4O1N A;  5KEE A;  2RQX A;  1XMQ L;  1IYU A;  4GKK L;  1G8Z D;  2A5H A;  4J1M A;  3A8K E;  4EX5 A;  1JR0 D;  4C1N I;  3MAQ A;  3KUP A;  4M1U B;  2UUA L;  4TSS A;  1P8L A;  2R7Z H;  5M5W H;  3OWE B;  4CDD C;  1GUN A;  4J8Q A;  1I4R A;  1X3G A;  3S17 H;  3TP5 A;  2VB3 X;  4BY1 G;  2Z6K A;  2D5D A;  4IJH A;  1Y8O B;  2LFN A;  2WB1 E;  1KDC A;  2WAC A;  3K81 C;  3BG3 A;  3QIA A;  4BXX G;  1RIP A;  1YNJ C;  4JOI A;  1UEA B;  2GVB A;  1HRJ A;  4RKB A;  4QUF A;  1VQF A;  1PYB A;  2KOL A;  3K6O A;  5FO9 B;  1B4O A;  1EY9 A;  1STE A;  2IW3 A;  1KRT A;  4IPD A;  1LAB A;  1ML0 D;  4O2D A;  2UXD Q;  1DXM A;  2A69 D;  2L9H A;  2AQ2 B;  2KCM A;  1WCM H;  4C3I G;  3ERS X;  2ZM6 L;  2CQA A;  1VMC A;  1V43 A;  1E24 A;  1HNW Q;  5HY6 A;  4DV5 Q;  3MXN A;  2RDH A;  2VQE L;  2EY6 A;  3SK8 A;  4U68 A;  1HZA A;  4OHJ A;  5I9P A;  3PO2 B;  2MNA A;  3H6M A;  1Y14 B;  4ZRZ A;  4GOP C;  1EQT A;  3A74 A;  2NVX B;  4G57 A;  1ZKO A;  2PW5 A;  3VR5 A;  2JK8 A;  2EOT A;  4EQO A;  1LTA D;  1GM5 A;  2F0M A;  4LUZ A;  5LMN Q;  4HIK A;  4QUC A;  2RHS B;  5LL6 X;  1XPO A;  4NXM L;  1EWI A;  2R92 H;  1EU4 A;  1ASY A;  4LF5 Q;  1F77 A;  4A3F H;  2IX1 A;  3IKJ A;  2XTI A;  2ZTD A;  1XNQ L;  2BH2 A;  3NTH A;  2JQO A;  2CWP A;  1RKN A;  2PO4 A;  2K1B A;  4FDB A;  4RHS A;  2MO0 A;  1H95 A;  4DXG A;  1VQP A;  3STB C;  3J81 E;  4A3I H;  3ULJ A;  4MN3 A;  1BOS A;  1S5F D;  2BA1 A;  1VQB A;  3K5L A;  2K5W A;  2XIW A;  1SFO H;  1K8O A;  4X66 L;  1VQL A;  4E6I A;  3NE5 B;  1CKN A;  5F2D A;  1EYA A;  1EQR A;  3PO2 G;  3WOE A;  4A3G H;  3EBE A;  3CCM A;  2MQH A;  2HIX A;  1PRT C;  3L9A X;  5IT9 c;  3HRZ C;  3W5O A;  1XJV A;  5KYI A;  1HH2 P;  4A3M B;  3S16 H;  2DNE A;  3GTK H;  3HOW H;  2L4N A;  2GA4 B;  1HTL D;  3GTM B;  4Y7N B;  4DUZ L;  3TBI B;  1I6V C;  4A93 H;  4RAU C;  4YIJ A;  3S1Q H;  4J15 A;  3CD6 A;  3KF8 B;  4BY7 H;  2RKS A;  3R93 A;  3ICE A;  1ASZ A;  2HCI A;  4R4I A;  3Q23 A;  2KCT A;  3LNN A;  5FO8 B;  4GOP A;  3BVZ A;  1MGS A;  3C1F A;  1PV4 A;  1RCV D;  5EBC A;  3BZD B;  1D5Z C;  3KOJ A;  4QMG A;  4JI7 L;  1JC7 A;  3SE0 A;  5AJ3 Q;  3EA6 A;  1PFM A;  3F2B A;  1SYB A;  3M3Y H;  2HUG A;  4POF A;  2X6G A;  5ELB A;  4BBR B;  1FR3 A;  3BJU A;  2N8N A;  1LT4 D;  2QDB A;  4LAA A;  2VUM G;  1BVS A;  2QEX A;  1Q1E A;  2LMC B;  2CWA A;  5CR3 A;  1HZB A;  4A4I A;  3HOV B;  1JWM D;  2B39 A;  1VQ9 A;  5C0X H;  3PO3 B;  1TY0 A;  3CHB D;  5EPL A;  2K5V A;  4P71 A;  1VQH A;  1K3B C;  3FPP A;  4DFA A;  3SHL A;  4GNX A;  1VQE A;  1PA6 A;  4LF7 Q;  3I4M B;  3TP6 A;  1A62 A;  1NTG A;  1VQI A;  4A3M G;  2UUB L;  4XQN A;  2XWB B;  5BN3 A;  5M3M B;  1C8C A;  3K8A A;  5FO7 B;  2DNC A;  4KJO A;  3K80 C;  1TQO A;  1QUQ A;  2VQF Q;  4DR2 Q;  4MTK A;  4A3B B;  1XMQ Q;  4GKK Q;  2EYO A;  2PI2 E;  4ZKB B;  1I94 L;  3IFT A;  1K0S A;  4R1J A;  1PTO C;  1SE4 A;  5G3L F;  4LW1 A;  3HOV G;  3RD4 A;  1WTH A;  3WOF A;  3STB D;  4Q0F A;  1EIG A;  3PO3 G;  4PQX A;  1EIH A;  3A55 A;  5IYD G;  5CV9 A;  2QA4 A;  5JOB A;  3FP9 A;  1KL9 A;  3I4M G;  1VF5 C;  2R93 H;  2J0T D;  1AP0 A;  1HZC A;  4FNF A;  4BWG B;  3ERQ A;  3P20 A;  4YHH Q;  1F2L A;  1G51 A;  1UE6 A;  4KHV A;  3I3C A;  1X56 A;  5C0X I;  1Q81 C;  2CH4 W;  4Q5V A;  1PRT D;  2KUM A;  2ZM6 Q;  5FJ8 G;  1K9M C;  5EKL A;  4OX9 L;  4A3B G;  3FHW A;  3HS0 C;  1NAP A;  2PNH A;  1ZYR C;  3NUC A;  4FVM A;  2LXJ A;  3GD7 A;  3MA2 B;  4IUV A;  1YVC A;  4CBV A;  3KDF A;  4JI2 Q;  1LYL A;  2ICE C;  1EFI D;  3TEH B;  3CRK C;  1Q8I A;  5M5X H;  4CKE A;  1N36 Q;  4JI0 Q;  1PLF A;  3MEH A;  5I6Y A;  2F4V L;  1SRO A;  3GDE A;  1BNZ A;  1D1I A;  1EEF D;  5M5W B;  1SXT A;  2R7Z B;  4HCS A;  4ZYS A;  5IE8 A;  1PH6 A;  2E5L L;  4NXM Q;  4KJN A;  5I2X A;  1LUZ A;  1CQV A;  2PW7 A;  2QKI C;  4RHR A;  3S17 B;  1A63 A;  4XDX A;  1D2B A;  2I5H A;  5FK9 C;  1UNS A;  1R4Q B;  3S1M H;  1G2T A;  3RN5 A;  4DUY L;  4UP9 A;  1PTO H;  2EIF A;  4EQN A;  4LFC Q;  3I4N H;  2E74 C;  5IGF A;  4KN7 C;  1VF7 A;  1I4Q A;  3PQI A;  4LFB L;  1E2Z A;  2O4X A;  4JBK A;  1II3 A;  4DV3 L;  3L0O A;  2ICI A;  2HQL A;  2F0P A;  2L55 A;  1WTR A;  5IGB A;  3G7L A;  5JEA H;  5LMU Q;  4X66 Q;  2Q2T A;  1H9M A;  1WCM B;  4KTA A;  3OTO Q;  4P2C B;  2YTX A;  4I7A A;  1PFB A;  2A6E D;  1RL2 A;  1IKL A;  1PH1 A;  4RGM A;  2IY5 B;  3P1H A;  1YJ9 A;  3CCJ A;  5JVH 3;  1ESR A;  1PZI D;  1KXL A;  1SNP A;  4OWW B;  1IL8 A;  2L1B A;  1VS0 A;  1QG7 A;  1QZG A;  5A2Q L;  2R7Z G;  5GAD C;  4DUZ Q;  1WVL A;  1EZ8 A;  1SBB B;  5CV8 A;  1WTV A;  3HKS A;  3R3O A;  1PTO D;  4XXE A;  2PQA A;  2DJF C;  3QB3 A;  1DOL A;  4HR7 B;  2EZV A;  2R92 B;  1WFQ A;  2JA6 G;  1PH7 A;  2G9D A;  1WI5 A;  3TDQ A;  2F3W A;  4A3F B;  4JI7 Q;  1D6E C;  1HJP A;  1V1P A;  4I65 A;  4JG2 A;  4L63 B;  3X3M A;  1GUG A;  3MWY W;  2B2U A;  5JAV A;  3W3A A;  3CMA A;  3FVQ A;  4DPG A;  1Y69 U;  3OHX C;  4K5X A;  4A3I B;  1WCM G;  3MXU A;  3UI2 A;  1SFO B;  3FEW X;  1ESF A;  4FXG C;  1SN8 A;  2ES2 A;  1JE4 A;  3IFD A;  4B3T Q;  4A3G B;  1MKH A;  4OON A;  1YNX A;  3QWN A;  3C3L A;  3SDZ A;  3A5Z B;  3PSI A;  2TMP A;  1GHK A;  3PUV A;  3S16 B;  2E2D C;  2MP1 A;  1IBL L;  3GTK B;  1PH2 A;  3HOW B;  5C6A A;  1CFM A;  4JBW A;  2DUD A;  1NUC A;  2BE5 C;  2N55 A;  4A93 B;  2VUM H;  2KJX A;  1X3Q A;  3S1Q B;  2KCN A;  4BY7 B;  1O78 A;  5IIF A;  4GOP B;  1E1T A;  2ZT9 C;  1EQQ A;  5D65 A;  3BZC A;  4UP8 A;  4ME3 A;  1GVP A;  1U4M A;  4DK1 A;  4DV0 L;  3PIO A;  4B3S L;  3M3Y B;  4QQB X;  5BN4 A;  1I5F A;  1AZP A;  1QWY A;  3L2P A;  4DV2 L;  3ERO A;  3GTJ H;  3MEF A;  1UWV A;  4HIM A;  5M5Y B;  2H5X A;  2M9V A;  4F88 A;  4ABN A;  1ENC A;  4NB3 A;  1MSH A;  1SR3 A;  4GNX B;  1KAA A;  1Y1W H;  1YHA A;  5T1I A;  2NBF A;  3UE0 A;  5KRU A;  3PUX A;  1F9P A;  1NR2 A;  1B2T A;  4NPS A;  4JBJ A;  4X3U A;  4GS3 A;  3CC7 A;  5KND A;  1AE2 A;  1YJW A;  3A7A B;  1DD2 A;  1STG A;  2XWJ B;  1MJE A;  1HR0 L;  1O7Y A;  1C9O A;  4S3S A;  3M9B A;  1N8R C;  1WD0 A;  2NVT H;  3HOW G;  3Q6S A;  1QVC A;  1JCK B;  1SJE D;  2G5D A;  4DV7 Q;  4RCN A;  1XX8 A;  4A93 G;  4IPC A;  4K8I A;  1QUQ B;  4MIU A;  3EVQ A;  4BY7 G;  1HPC A;  4KY6 A;  1I4P A;  2JJQ A;  1PRT B;  3D3R A;  2K5H A;  5IGC A;  4CKB A;  1K3R A;  1RDP D;  2IHE A;  1VQN A;  3F2D A;  4A3C H;  2OQK A;  2RCF A;  1BO0 A;  5BN5 A;  3JAM L;  2V1C C;  4EVO A;  1DJR D;  4MTN A;  1WYD A;  3EIV A;  3TRE A;  3AU7 A;  3BZK A;  2VW9 A;  2E5L Q;  2IT1 A;  4KN4 C;  3W1G A;  1SEB D;  1AEX A;  3S14 H;  3OYY A;  1TWA H;  2NN6 H;  5ISR A;  5FJ8 H;  3LWE A;  5J39 A;  3I70 A;  1U4L A;  4TRD A;  3VR4 A;  4A3K H;  1Z6H A;  2XRQ D;  1S4Z A;  2E8G A;  3G4S A;  4BA2 I;  1O7Z A;  1SAP A;  3U9S A;  1M1K C;  3DMU A;  1SSO A;  5C0X J;  4LFB Q;  2R93 B;  4K14 A;  1PHJ A;  4IFD J;  2Q2U A;  2UUC L;  5E1F A;  1AH9 A;  1KLU D;  1D1K A;  4A3L H;  1UUP A;  4L6T B;  4Z9C B;  4JYA L;  3M85 A;  1PVO A;  1YBY A;  3TN2 A;  1NMF A;  4JOI C;  4DNR B;  2OCE A;  4DAM A;  3OSO A;  2K01 A;  3TQY A;  1KRS A;  2CVR A;  2Z6B A;  2ZXO A;  1IBK Q;  4LNQ A;  2BE5 D;  1JB3 A;  1VQD A;  3A56 A;  4KKU A;  5CYU A;  2D0P A;  1SNC A;  1HXY D;  3MFY A;  4WJ4 A;  3I56 A;  3TZD A;  2Z8L A;  4G4K A;  3BDO A;  2EYF A;  5M5X B;  1EQV A;  1NMG A;  1W3S A;  5LL6 S;  4DV6 L;  4HN7 A;  3V05 A;  1LLR D;  4DR1 L;  4DR7 L;  2A68 D;  1Q3L A;  4OEM B;  1CSQ A;  2DN8 A;  1I4X A;  2UU9 L;  2G9H D;  3ND8 A;  4DV4 L;  5ELN A;  3URY A;  4DK0 A;  3CCS A;  4K0K L;  3P75 A;  3Q22 A;  1EEI D;  3S1M B;  1TXY A;  1VDZ A;  4DAV A;  5CV5 A;  5CMD A;  4RKL A;  1PTO B;  3KK7 A;  1H9S A;  2K5Q A;  2PZT A;  2AUJ D;  2QDL A;  3AEV A;  2CQO A;  3I4N B;  2RDF A;  2NN6 I;  3S15 H;  1N9W A;  3DM3 A;  1VQM A;  1K8G A;  4MHE A;  5C3E H;  3A8I E;  2WII B;  4DAY A;  4YY3 L;  4R8I A;  2MHV A;  2X69 A;  2CCZ A;  4JI4 Q;  1B44 D;  4FF2 A;  3NPP A;  4GN4 B;  4ZQ3 A;  1CI3 M;  4WJW A;  3CU7 A;  3UDF A;  1MIU A;  3NEN A;  3H94 A;  4DR5 L;  1GHJ A;  2WAQ G;  2JA6 H;  1TWH H;  4ZLT F;  4LF8 L;  3A7L A;  2JYO A;  1X3F A;  2F0I A;  1H9R A;  1U0L A;  4P73 A;  2NYZ D;  3J7Y W;  2I5M X;  4NP5 A;  4R9W A;  2AHO B;  2B29 A;  3GV3 A;  5ELD A;  4JI1 Q;  1R9T H;  1D7Q A;  4JI8 L;  4DR6 L;  1BCP D;  1EYC A;  2PQA B;  2EVB A;  4HCE A;  1EUJ A;  4EQP A;  1AW7 A;  3TS2 A;  1BDO A;  4X62 L;  1OO9 B;  4X65 L;  1G29 1;  1N34 L;  2Y0S B;  4DV0 Q;  4A3E H;  3JAM i;  3I4N G;  1OXS C;  4DR4 L;  2BOS A;  1I4G A;  2RA4 A;  3W2D A;  4DV2 Q;  4FXD A;  3CC4 A;  3DWP A;  3E0J A;  3FPU B;  3NTI A;  4GLA C;  5FLM H;  1IZ6 A;  2VL6 A;  1ZEQ X;  3GTL H;  4X3T A;  4IUU A;  3AYH B;  5JEA G;  3G48 A;  4C2M H;  2NVQ H;  1STA A;  4OXP A;  3WDN A;  1LV9 A;  3J81 L;  1CA6 A;  3SEB A;  3D6C A;  5E7N A;  3KJP A;  2NZO A;  3LWU A;  3G71 A;  4U67 3;  2B2T A;  2V4D A;  2BA0 A;  4HJ7 A;  1HR0 Q;  1G2S A;  1PH3 A;  4POG A;  3CCL A;  3PMF A;  4GNX C;  1XWE A;  1Z9F A;  4DNI A;  2QCP X;  5IYB H;  4WFN 3;  4RH6 A;  5GAG C;  4IPG A;  4Y52 H;  2E75 C;  2QGQ A;  2QIL A;  2FFK B;  4RGO S;  1Q86 C;  3VDY A;  1EU3 A;  1LTT D;  2VUM B;  4KD4 A;  5FLX L;  2I46 A;  3I55 A;  1FD7 D;  2Y0S G;  1SYE A;  1JE5 A;  3RLO A;  3JAM c;  4CJ1 B;  1HUN A;  2D2C C;  1QOH A;  1EYG A;  3GTG H;  3EFX D;  4OL7 A;  1TR5 A;  4IZ8 A;  1OXV A;  3PV0 A;  4UDU C;  4ZCK A;  4H0L C;  4KHZ A;  3D4R A;  3GTJ B;  1V9P A;  4LF9 L;  4L5T A;  5FLX E;  3CF5 A;  1BBW A;  1C7Y A;  1DON A;  1KNE A;  2R6G A;  1B7Y B;  1LT3 D;  4OGQ C;  4R4O A;  2MO1 A;  1Y1W B;  2UUC Q;  3K7U C;  5JJI A;  2MUY A;  2J7Z A;  1U4R A;  1EY6 A;  2BDO A;  3PIO 3;  3E5S A;  3H09 A;  4B3M L;  1IW7 C;  3KF6 A;  1NBW A;  2NVT B;  3I2Z A;  2I0Q A;  1T9H A;  3CCE A;  3R8B A;  3KBG A;  1YHB A;  2R61 A;  1T5X D;  3S2H H;  2Y0S E;  2UXB Q;  2WIN B;  1ONL A;  3LX0 A;  1FL0 A;  2YYZ A;  2JA5 G;  2PPB C;  3RUZ A;  3RZO H;  1EOV A;  2EYL A;  2E2H H;  1IYV A;  5IY0 A;  3R2I A;  2ALY B;  2Z4I A;  4DV6 Q;  2KA7 A;  1A8V A;  4B08 A;  4ZK9 B;  3TRZ A;  3DEP A;  4DR1 Q;  4EQ5 A;  3RZD H;  1K8M A;  3CKI B;  4XTC S;  1LT6 D;  3SK5 A;  3CP0 A;  3MXP A;  5A35 A;  3S14 B;  5CV4 A;  1TWA B;  1NCV A;  4JI5 Q;  2EE1 A;  1E7Z A;  2F0F A;  4K0K Q;  3HZX A;  4YWM A;  5BR8 L;  4IUQ A;  1I50 H;  3FMC A;  4ZUJ A;  2A6E C;  2Q2H A;  1Y1W G;  4A3K B;  1EOT A;  3M4O H;  2CHB D;  2F0H A;  2R3Z A;  1V1O A;  4DK6 C;  2I07 B;  1KD1 C;  4HJA A;  2B8G A;  3S1N H;  1X54 A;  2UUA Q;  1TS5 A;  2NTT A;  4A75 A;  2JE6 I;  4HJ9 A;  3CXC A;  3NBH A;  1MBY A;  1R4P B;  4JVZ A;  3B6Y A;  1TWF H;  1CTM A;  4DR5 Q;  3J81 i;  1J6Q A;  1J8I A;  4KMU C;  4XQJ A;  1MHW C;  1HCZ A;  1L0Y B;  1TY2 A;  1KIX A;  3WWV A;  4A3C G;  3J80 E;  1CQF A;  1PFS A;  4LF8 Q;  3M4Y A;  3O13 A;  1KQS A;  4QGU A;  4KD3 A;  3VYU A;  3PCO B;  4UY8 C;  1UE7 A;  3I4L A;  1KAW A;  2D9U A;  3AFQ A;  3UDG A;  1UE5 A;  5CV6 A;  4HJ5 A;  1STN A;  3G6J B;  3PGZ A;  2LKV A;  4IUT A;  2Z9H A;  4DR6 Q;  1XYI A;  4PMC A;  4KI0 A;  3DLL A;  1AFP A;  1HQR D;  1LTI D;  2NN6 G;  1VCI A;  4M8A A;  1B9M A;  2A74 C;  1BF4 A;  1YI2 A;  1QNU A;  1EWC A;  4X62 Q;  3SGI A;  4KY7 A;  2K14 A;  4PMW A;  4A3K G;  1OXT A;  2B2V A;  1N34 Q;  3E6Z X;  1L0W A;  3TME A;  4P75 A;  3UE1 A;  2VQE Q;  1X6O A;  4DR4 Q;  2LSS A;  1WTQ A;  4K8J A;  3V2T A;  2H1E A;  1BCP B;  1YZ6 A;  3NSW A;  4X64 L;  3A54 A;  2VNU D;  4A3L G;  3K57 A;  2IHF A;  2YV5 A;  3S15 B;  4QCL A;  1NSN S;  3NQT A;  4NXN L;  4DAY B;  5C3E B;  2F0V A;  4HIO A;  3E3X A;  3MXG A;  5EQ0 A;  1IW7 D;  4C3H H;  3OIP A;  1SND A;  1N33 L;  3VA5 A;  4OO1 H;  2B2U C;  3J81 c;  2QW7 A;  2EJM A;  2AQ3 B;  4ZUI A;  4B3R L;  1XNQ Q;  2JSO A;  2C9O A;  3ZYY X;  4DN4 M;  3GQB A;  2XVS A;  1E2W A;  1TWH B;  3NK9 A;  2JA6 B;  1OTC A;  4RCO A;  4BA1 I;  1YIJ A;  5C5M A;  4QY7 A;  4A76 A;  1YEZ A;  3D4W A;  4K2K A;  5IP9 H;  5M3F G;  1CZG A;  1WTP A;  3P7J A;  2P5Z X;  3F2U A;  1R9T B;  3R2T A;  4APV A;  3N6R A;  2X6L A;  5D3I B;  5FLX c;  2FHT A;  4KLK A;  3TS0 A;  2VB2 X;  2MPM A;  3MXN B;  2ZJP A;  4TQU S;  4BS9 A;  4A3E B;  5JJK A;  2E76 C;  3PUZ A;  3NBI A;  3GO5 A;  4LK1 C;  1KNA A;  4JV5 L;  4WJ3 M;  2F0J A;  1SE3 A;  5C3E G;  2YU9 H;  1N32 L;  2FJ2 A;  1IBM L;  2VXW A;  4NKL A;  4LF9 Q;  3ULL A;  1E22 A;  1XMO L;  1HA5 A;  4G7O C;  3GTL B;  4JI3 L;  1VQ6 A;  1GUS A;  4R4T A;  3QJY A;  3Q24 A;  4C2M B;  2NVQ B;  3DWQ A;  2A6H C;  1UEB A;  1OXX K;  1JT8 A;  1SE2 A;  4RG1 A;  1ILP A;  5C5L A;  1TS2 A;  4LF6 L;  2AQ1 B;  2EPB A;  1NE3 A;  4DGZ A;  1RTN A;  2K32 A;  4FF1 A;  1VQA A;  2F0L A;  3UDI A;  2B3G A;  4JPB W;  4OO1 I;  1VQ8 A;  3AB9 A;  1YIT A;  3OW2 A;  3BVM A;  5C3W A;  5EPK A;  4KV6 A;  3GTO H;  2F3I A;  3MTS A;  2F0D A;  4HSV A;  1BQQ T;  2FXQ A;  2EJF C;  2RSN A;  3SK6 A;  1EWH A;  4XT1 B;  1GUW A;  1HNX L;  2F4I A;  3F2C A;  4L5R C;  1BR9 A;  3BDL A;  3T1Y L;  3M4Q A;  1MJC A;  4A3E G;  1PYS B;  1CKN B;  2PZU A;  1PH4 A;  1DOM A;  3FDT A;  2RVL A;  3S24 A;  5JVG 3;  3GTQ H;  1A3V A;  1CA5 A;  1J5E L;  4K6D A;  3GTG B;  2IJ0 A;  2UUB Q;  2FMC A;  1HA6 A;  1CZW A;  2K04 A;  5FLM G;  4IAL A;  4DXF A;  5IYC H;  1A6X A;  1E3P A;  1JMC A;  1FVI A;  4R4Q A;  3QO2 A;  3FRP B;  3DEO A;  2L12 A;  5EGT A;  4HJ8 A;  3HOU H;  5BR8 Q;  5G3L D;  5IOD A;  4HED A;  4GKJ L;  5K36 H;  1G6Z A;  4IUN A;  3K5M A;  1I50 B;  1EY8 A;  4IOA A;  4LF4 L;  2KQ3 A;  1BBX C;  3H0G H;  2EDG A;  3OMG A;  1Y1V H;  2IPK D;  1SMY C;  2L0C A;  2JA5 H;  4LMQ D;  1MI2 A;  2B8F A;  1I94 Q;  1HQM C;  3KF6 B;  3H3V H;  1H9K A;  5COR A;  3Q8D A;  1M90 C;  5IYB G;  2I5L X;  4PV1 C;  4OWX B;  1QVG A;  5C44 H;  5CGK A;  4DF7 A;  2A68 C;  3C46 A;  1KHI A;  2O2L D;  3TP7 A;  5I9O A;  2HDL A;  1SRU A;  2JA7 H;  2OTL A;  4CKC A;  1M4V A;  2UXD L;  1L1O C;  3CQZ H;  3ULP A;  1JOR A;  4A3J H;  3S2H B;  1GJX A;  5CBA E;  1DZ1 A;  1Q12 A;  2EJG C;  1Q1B A;  1W2B A;  3RZO B;  2AMC B;  2E2H B;  1K73 C;  2SDF A;  2EY5 A;  1PZJ D;  5DM6 3;  3KBX A;  2WP8 J;  2A73 B;  2AWN A;  4GN5 A;  5C3X A;  2JA8 H;  2D0O A;  5T1G A;  3E9H A;  3RZD B;  3HOY H;  4DV1 L;  1LO5 D;  3C1E A;  3T56 B;  4JI6 L;  4OX9 Q;  5JPN C;  2CH4 A;  1RHP A;  3CCV A;  1P16 A;  1FNV A;  1PH5 A;  3GV6 A;  4ALP A;  4PZ6 A;  1CT1 D;  4F7X A;  3QOJ A;  3KF8 A;  4R4C A;  1L0X B; 
#chains in the Genus database with same CATH homology
 1Z7T A;  1TT2 A;  2A6H D;  3M4O B;  2XN9 C;  5J22 A;  2Z4H A;  3S1N B;  3KLS A;  4KK7 A;  3D31 A;  1BCP C;  1LTR D;  1ICW A;  1TWF B;  2LY7 A;  1Z47 A;  2FMM A;  4K6L A;  4OIK A;  4CHT B;  3J7A V;  1PDQ A;  1A3T A;  1A15 A;  1F9Q A;  3OWF A;  2IX0 A;  1XTC D;  2RBM A;  1WTW A;  4I7Z C;  5DEH A;  4EGV A;  2K33 A;  2F0N A;  1GUO A;  1QJO A;  4QIW B;  4F87 A;  1O7L A;  1PZK D;  4DNT B;  1SMY D;  2WAQ B;  4N9T A;  5C4Z A;  4R8N A;  4HTH A;  3HG9 A;  4FP5 D;  1DYQ A;  1TVX A;  4DU9 A;  4C3H B;  2RSO A;  1A2U A;  4FF3 A;  4RGN A;  5D14 A;  2QEJ C;  2Q8I B;  2XNA C;  4OIJ A;  4V19 0;  2XRS D;  1FGB D;  1TKW B;  1Q90 A;  1TS3 A;  2OT2 A;  5E4X A;  5EJW A;  3SXH A;  2NWG A;  3PIP 3;  2B2T C;  3TSS A;  3RLF A;  4H13 C;  1RF2 D;  2F0G A;  4FF4 A;  5IGE A;  5M9O A;  1MD2 D;  5K5P A;  3A8J E;  3NWT A;  2HDM A;  3K5O A;  2NUC A;  5KNB A;  2HCC A;  4ULL A;  3KLR A;  2K6A A;  3BVG A;  1SNM A;  3TP8 A;  3SVM A;  3HP3 A;  2YU9 B;  1JQY D;  4C3H G;  1UAP A;  4XT3 B;  2PQE A;  4OO1 G;  5FOB B;  4RWS C;  1EL0 A;  1KLG D;  5LHY 1;  2ID0 A;  4V0B A;  1FYC A;  2MJ8 A;  4H44 C;  2RDG A;  1V1P B;  4X3S A;  1F9S A;  1F2Y A;  3S9W A;  3GTO B;  3ONA B;  2B2W A;  3T16 A;  4IUR A;  4J6H A;  4WOR A;  3BYT B;  1SJH D;  1SNQ A;  3KLS X;  3K0Y A;  4K5W A;  1S5E D;  2Z1C A;  1ILQ A;  5JEA J;  1LTB D;  3X3N A;  2WKC A;  1U4P A;  1EZ6 A;  4RA8 A;  4XYQ A;  3GTQ B;  3OW7 A;  3K59 A;  1MSG A;  3NWS A;  2OXP A;  1IKM A;  1W6J A;  1BUV T;  3OIQ A;  1PRT F;  3HOU B;  2F1M A;  1KTK A;  3PUY A;  2CW0 D;  2JXM B;  3H0G B;  2OEO A;  1Y1V B;  3MZ5 A;  2JA5 B;  1GOZ A;  3D4D A;  3VYT A;  1SDF A;  1PFN A;  2K28 A;  1W6K A;  2XSC A;  2BCO A;  2WV6 D;  5C44 B;  1S5D D;  1B53 A;  2K7V A;  4HAE A;  4KKT A;  2JA7 B;  4X3K A;  1QIL A;  1B9N A;  3CQZ B;  4A3J B;  1SYC A;  2IWH A;  5EKI A;  3RMH A;  1SYF A;  1HUM A;  4ZKC B;  1S5C D;  1LTS D;  4HSP A;  2JA8 B;  1EY7 A;  3HOY B;  1EY0 A;  3T51 B;  1ENF A;  2F0O A;  5K36 G;  3CRL C;  1H9J A;  1CHQ D;  3K5N A;  5D3D A;  1S5B D;  1JOK A;  4ILW A;  5IGD A;  2B2V C;  1YNJ D;  3NXW A;  4B9W A;  1I3Q B;  5HGT A;  4C1N K;  1B3A A;  3VA7 A;  3PUW A;  3ITP A;  3NQI A;  4PMB A;  1WTO A;  4QB4 A;  1PTO F;  3HKZ B;  1TWC B;  4NW2 A;  2EYM A;  2F03 A;  1B1Z A;  4O42 A;  4L8J A;  4IFD H;  5I2Y A;  5TSS A;  1OXU A;  2HQE A;  2K05 A;  3DUZ A;  1PXU A;  3J80 L;  1RD9 D;  3C2P A;  1DM0 B;  1X32 A;  5I6W A;  1Y8P B;  1XXG A;  4JK1 C;  1C4Q A;  3OOC A;  2KEE A;  5C4J B;  3T53 B;  1TU2 B;  1LT5 D;  1O80 A;  1CHP D;  4NMZ A;  5EBD A;  2J4X A;  3HEJ A;  4FYD A;  1AN8 A;  2F0E A;  1GUT A;  2F0K A;  1DCZ A;  3VR6 A;  2EY1 A;  3DHQ A;  5M3F B;  1FNW A;  2C5C A;  1V8Q A;  2B2Y C;  5CV7 A;  5I4D A;  1ROD A;  1KAB A;  5C4H A;  1H9S B;  4CGY B;  1EYD A;  2Q8T A;  2OF1 A;  1YNN C;  3K58 A;  1F9R A;  4IFD I;  3I73 A;  2LS0 1;  1TS4 A;  3DWA A;  3VR3 A;  4FO2 A;  2MGS A;  1DOK A;  1KDA A;  3I8Z A;  3L7Z C;  5E3F A;  3U9O A;  2KVM A;  3NHH A;  2F0Q A;  1LTG D;  5E4W C;  2IL8 A;  4PNY A;  1D5X C;  3BYY B;  3L3O C;  2O5I C;  2EYP A;  1TII D;  1WTX A;  2ENB A;  4BBS B;  1ENA A;  4ID6 A;  2AWO A;  2KEC A;  2KHS A;  1PYW D;  1Y8N B;  4N9P A;  5HUR A;  2NTS A;  2F0U A;  2AUK A;  2H4O A;  4CJ0 B;  2BDN A;  1U9R A;  5J1Z A;  2D62 A;  1K83 B;  4K5V A;  1SNO A;  2B2Y A;  1E2V A;  3BDC A;  3Q0A A;  4GZY C;  1A2T A;  1KDB A;  3OPO A;  1HFG A;  1ET6 A;  1BXT A;  4DAP A;  5JJZ A;  1JWS D;  5NUC A;  3H3V C;  1JOQ A;  3M7G A;  2E2J B;  1IHZ A;  3VR2 A;  3HOX B;  5AFW A;  2EYH A;  4IN3 A;  4F8M A;  1G91 A;  1J9O A;  1TWG B;  1STH A;  1CK1 A;  2B63 B;  5KYL A;  3H91 A;  2PMZ B;  3DXJ C;  3MC0 B;  1LAC A;  5COY A;  1SYG A;  4HMJ A;  5C4X B;  5DNF A;  3HGB A;  2K03 A;  2IX3 A;  3V96 A;  3EQL C;  1QCB D;  5A2Q E;  4B9X A;  2NVY B;  2F0S A;  2F0W A;  4XYO A;  4G7Z C;  4FXK C;  3MFG A;  1YNN D;  2JEB I;  3T4A C;  3I91 A;  4KY5 A;  3M7N A;  1SYD A;  5EPJ A;  1ZYR D;  1T5E A;  2EY2 A;  2KCC A;  5CC4 A;  1HFN A;  5IGG A;  2SNS A;  2ZXP A;  2WKD A;  4DA2 A;  2L11 A;  5EKK A;  4HMI A;  5IOC A;  2JEA I;  3EJI A;  2SOB A;  5KNC A;  2N88 A;  4AYB B;  2NB0 A;  3D8G A;  1GXD C;  4ZAI A;  4XQQ A;  1NR4 A;  5KIX A;  4LJZ C;  1E0B A;  2PNR C;  3VYR A;  1VMP A;  5DAU A;  1QB5 D;  1WD1 A;  2M00 A;  5CBE E;  3BS1 A;  4IUP A;  3OMC A;  3VYS A;  1BCP F;  3QOL A;  3ND9 A;  2NZ1 D;  4TKO B;  2PYK A;  1A3U A;  4IQZ A;  3S2D B;  5ELF A;  1STB A;  3D6W A;  5DM7 3;  3HOZ B;  4ME5 A;  2KED A;  4QF4 A;  3IL8 A;  3S1R B;  2DY8 A;  2JP1 A;  5FKA C;  3TZU A;  1HHV A;  3FKI B;  1FNU A;  1JIC A;  2EYJ A;  4H7B A;  1HTP A;  3NP8 A;  2PZW A;  5KGU A;  2SEB D;  1JWU D;  1QE6 A;  2WB1 B;  3NTK A;  4C3J B;  2A69 C;  4K2L A;  5IT9 L;  2F3V A;  4A3D B;  1D5M C;  1STY A;  3N52 A;  4ODG A;  3DM1 A;  4UAI A;  1PMR A;  1AZQ A;  5C0X G;  4CJ2 C;  1JOO A;  5ELE A;  1B50 A;  5JPM C;  4IFD G;  2EXZ A;  3IAY A;  1RTO A;  3JAM E;  2PCF B;  2L5T A;  3I72 A;  3T13 A;  1I6H B;  2DY7 A;  1ZXT A;  1RJT A;  1X3P A;  2O5J C;  4RGT A;  3MHB A;  5IT9 E;  4XIG S;  3SR1 A;  1C48 A;  3QG1 A;  4RFB A;  2M2L A;  1M8A A;  2Q8R E;  4NDX A;  2CW0 C;  2TSS A;  4WRD A;  2E2I B;  1F2Z A;  5ELC A;  1EY5 A;  4BY1 B;  1I4H A;  2B2W C;  3J7A F;  1ET9 A;  3I90 A;  4C56 C;  2FIN B;  3GTP B;  1F2M A;  4KKS A;  2F0T A;  4C3J G;  2QF7 A;  3SK4 A;  1QNK A;  2SNM A;  3AMU A;  4G7H C;  3MVV A;  1CM9 A;  1EY4 A;  3K7A B;  2K5D A;  2ZXR A;  4C3I B;  3GP7 A;  4O1N A;  5KEE A;  2RQX A;  1IYU A;  1G8Z D;  2A5H A;  4J1M A;  3A8K E;  1JR0 D;  4C1N I;  3MAQ A;  3KUP A;  4M1U B;  4TSS A;  3OWE B;  1GUN A;  4J8Q A;  1I4R A;  3TP5 A;  2VB3 X;  2D5D A;  1Y8O B;  2LFN A;  1KDC A;  2WAC A;  3BG3 A;  3QIA A;  1YNJ C;  1UEA B;  1HRJ A;  4RKB A;  4QUF A;  2KOL A;  3K6O A;  5FO9 B;  1B4O A;  1EY9 A;  1STE A;  2IW3 A;  1LAB A;  1ML0 D;  1DXM A;  2A69 D;  2L9H A;  2AQ2 B;  4C3I G;  2CQA A;  1VMC A;  1V43 A;  3MXN A;  2RDH A;  2EY6 A;  3SK8 A;  4U68 A;  4OHJ A;  5I9P A;  3PO2 B;  3H6M A;  4ZRZ A;  1EQT A;  2NVX B;  4G57 A;  1ZKO A;  2PW5 A;  3VR5 A;  2EOT A;  4EQO A;  1LTA D;  2F0M A;  4QUC A;  5LL6 X;  1EU4 A;  1F77 A;  2IX1 A;  3IKJ A;  3NTH A;  1RKN A;  2PO4 A;  2K1B A;  4RHS A;  4DXG A;  3J81 E;  4MN3 A;  1BOS A;  1S5F D;  2BA1 A;  3K5L A;  2K5W A;  2XIW A;  1K8O A;  4E6I A;  3NE5 B;  5F2D A;  1EYA A;  3WOE A;  1PRT C;  3L9A X;  3HRZ C;  5KYI A;  4A3M B;  2DNE A;  2L4N A;  2GA4 B;  1HTL D;  3GTM B;  4Y7N B;  3TBI B;  1I6V C;  4RAU C;  4YIJ A;  2RKS A;  3R93 A;  2HCI A;  3Q23 A;  3LNN A;  5FO8 B;  3BVZ A;  1MGS A;  3C1F A;  1RCV D;  5EBC A;  3BZD B;  1D5Z C;  4QMG A;  1JC7 A;  3SE0 A;  3EA6 A;  1PFM A;  1SYB A;  2HUG A;  2X6G A;  5ELB A;  4BBR B;  1FR3 A;  1LT4 D;  2QDB A;  4LAA A;  1Q1E A;  2LMC B;  5CR3 A;  3HOV B;  1JWM D;  2B39 A;  5C0X H;  3PO3 B;  1TY0 A;  3CHB D;  5EPL A;  4DFA A;  3FPP A;  3SHL A;  3I4M B;  3TP6 A;  4XQN A;  2XWB B;  5BN3 A;  5M3M B;  1C8C A;  5FO7 B;  2DNC A;  4KJO A;  1TQO A;  4A3B B;  2EYO A;  4ZKB B;  3IFT A;  1PTO C;  1SE4 A;  5G3L F;  3RD4 A;  3WOF A;  4Q0F A;  1EIG A;  4PQX A;  1EIH A;  3A55 A;  5CV9 A;  5JOB A;  1VF5 C;  2J0T D;  1AP0 A;  4FNF A;  4BWG B;  3ERQ A;  3P20 A;  1F2L A;  4KHV A;  3I3C A;  5C0X I;  4Q5V A;  1PRT D;  2KUM A;  5EKL A;  3HS0 C;  1NAP A;  1ZYR C;  3NUC A;  4FVM A;  3GD7 A;  3MA2 B;  4IUV A;  4CBV A;  2ICE C;  1EFI D;  3CRK C;  1Q8I A;  4CKE A;  1PLF A;  3MEH A;  5I6Y A;  1BNZ A;  2R7Z B;  1D1I A;  1EEF D;  5M5W B;  1SXT A;  4HCS A;  4ZYS A;  4KJN A;  5I2X A;  1CQV A;  2PW7 A;  2QKI C;  4RHR A;  3S17 B;  4XDX A;  1D2B A;  5FK9 C;  1UNS A;  1R4Q B;  1G2T A;  1PTO H;  4EQN A;  2E74 C;  5IGF A;  4KN7 C;  1VF7 A;  1I4Q A;  1E2Z A;  2O4X A;  1II3 A;  2ICI A;  2F0P A;  2L55 A;  1WTR A;  5IGB A;  3G7L A;  5JEA H;  1H9M A;  1WCM B;  4KTA A;  4P2C B;  1PFB A;  2A6E D;  1IKL A;  4RGM A;  3P1H A;  5JVH 3;  1ESR A;  1PZI D;  1SNP A;  1IL8 A;  2L1B A;  1QG7 A;  5A2Q L;  1WVL A;  1EZ8 A;  1SBB B;  5CV8 A;  1WTV A;  3R3O A;  1PTO D;  4XXE A;  3QB3 A;  1DOL A;  4HR7 B;  2EZV A;  2R92 B;  2G9D A;  3TDQ A;  2F3W A;  4A3F B;  1D6E C;  1V1P A;  4I65 A;  4L63 B;  3X3M A;  1GUG A;  3MWY W;  2B2U A;  5JAV A;  3W3A A;  3FVQ A;  1Y69 U;  3OHX C;  4K5X A;  4A3I B;  3MXU A;  3UI2 A;  1SFO B;  3FEW X;  1ESF A;  4FXG C;  1JE4 A;  3IFD A;  4A3G B;  3QWN A;  3C3L A;  3SDZ A;  2TMP A;  1GHK A;  3PUV A;  3S16 B;  2E2D C;  2MP1 A;  3GTK B;  3HOW B;  5C6A A;  1CFM A;  4JBW A;  1NUC A;  2BE5 C;  2N55 A;  4A93 B;  2KJX A;  1X3Q A;  3S1Q B;  2KCN A;  4BY7 B;  1O78 A;  5IIF A;  2ZT9 C;  5D65 A;  1U4M A;  4DK1 A;  3M3Y B;  5BN4 A;  1AZP A;  1QWY A;  3ERO A;  5M5Y B;  2M9V A;  4F88 A;  4ABN A;  1ENC A;  1MSH A;  1KAA A;  5T1I A;  2NBF A;  5KRU A;  3PUX A;  1F9P A;  1NR2 A;  1B2T A;  4X3U A;  5KND A;  3A7A B;  1DD2 A;  1STG A;  2XWJ B;  1O7Y A;  4S3S A;  1WD0 A;  3Q6S A;  1JCK B;  1SJE D;  4RCN A;  1XX8 A;  4K8I A;  4MIU A;  3EVQ A;  1HPC A;  4KY6 A;  1I4P A;  1PRT B;  3D3R A;  5IGC A;  4CKB A;  1RDP D;  1BO0 A;  5BN5 A;  3JAM L;  4EVO A;  1DJR D;  3AU7 A;  2IT1 A;  4KN4 C;  1SEB D;  1AEX A;  2NN6 H;  5ISR A;  3LWE A;  5J39 A;  3I70 A;  1U4L A;  4TRD A;  3VR4 A;  1Z6H A;  2XRQ D;  1S4Z A;  4BA2 I;  1O7Z A;  1SAP A;  3U9S A;  3DMU A;  1SSO A;  5C0X J;  2R93 B;  4K14 A;  4IFD J;  5E1F A;  1KLU D;  1D1K A;  1UUP A;  4L6T B;  4Z9C B;  3M85 A;  3TN2 A;  4DNR B;  3OSO A;  2K01 A;  2CVR A;  2ZXO A;  2BE5 D;  1JB3 A;  3A56 A;  4KKU A;  5CYU A;  1SNC A;  1HXY D;  3MFY A;  3TZD A;  2Z8L A;  4G4K A;  3BDO A;  2EYF A;  5M5X B;  1EQV A;  5LL6 S;  4HN7 A;  3V05 A;  1LLR D;  2A68 D;  1Q3L A;  2DN8 A;  1I4X A;  2G9H D;  3ND8 A;  3URY A;  4DK0 A;  3P75 A;  3Q22 A;  1EEI D;  3S1M B;  1VDZ A;  4DAV A;  5CV5 A;  5CMD A;  4RKL A;  1PTO B;  3KK7 A;  1H9S A;  2K5Q A;  2PZT A;  2AUJ D;  3I4N B;  2RDF A;  2NN6 I;  4MHE A;  3A8I E;  2WII B;  4DAY A;  4R8I A;  2MHV A;  2X69 A;  1B44 D;  4FF2 A;  3NPP A;  4ZQ3 A;  1CI3 M;  4WJW A;  3CU7 A;  3H94 A;  1GHJ A;  4ZLT F;  3A7L A;  2JYO A;  2F0I A;  1H9R A;  2NYZ D;  3J7Y W;  4NP5 A;  4R9W A;  3GV3 A;  5ELD A;  1BCP D;  1EYC A;  2EVB A;  4HCE A;  4EQP A;  1AW7 A;  1BDO A;  1OO9 B;  1G29 1;  2Y0S B;  1OXS C;  2BOS A;  1I4G A;  2RA4 A;  3W2D A;  4FXD A;  3DWP A;  3E0J A;  3FPU B;  3NTI A;  1ZEQ X;  4X3T A;  4IUU A;  5JEA G;  1STA A;  3WDN A;  1LV9 A;  3J81 L;  1CA6 A;  3SEB A;  3D6C A;  3LWU A;  4U67 3;  2B2T A;  2V4D A;  2BA0 A;  1G2S A;  3PMF A;  1XWE A;  2QCP X;  4WFN 3;  4RH6 A;  2E75 C;  2QIL A;  2FFK B;  4RGO S;  1EU3 A;  1LTT D;  2VUM B;  4KD4 A;  5FLX L;  2I46 A;  1FD7 D;  1SYE A;  4CJ1 B;  1HUN A;  2D2C C;  1QOH A;  3EFX D;  4OL7 A;  1TR5 A;  4IZ8 A;  1OXV A;  3PV0 A;  4UDU C;  4H0L C;  4KHZ A;  3D4R A;  3GTJ B;  5FLX E;  1DON A;  1KNE A;  2R6G A;  1LT3 D;  4OGQ C;  1Y1W B;  2MUY A;  2J7Z A;  1U4R A;  1EY6 A;  2BDO A;  3PIO 3;  3E5S A;  3H09 A;  1IW7 C;  2NVT B;  3R8B A;  3KBG A;  2R61 A;  1T5X D;  2WIN B;  1ONL A;  3LX0 A;  2YYZ A;  2PPB C;  3RUZ A;  2EYL A;  1IYV A;  3R2I A;  2Z4I A;  2KA7 A;  4ZK9 B;  4B08 A;  3DEP A;  1K8M A;  3CKI B;  4XTC S;  1LT6 D;  3SK5 A;  3MXP A;  5A35 A;  3S14 B;  5CV4 A;  1TWA B;  1NCV A;  2EE1 A;  2F0F A;  3HZX A;  4IUQ A;  3FMC A;  4ZUJ A;  2A6E C;  4A3K B;  1EOT A;  2CHB D;  2F0H A;  2R3Z A;  1V1O A;  2I07 B;  2B8G A;  1TS5 A;  2NTT A;  2JE6 I;  3NBH A;  1MBY A;  1R4P B;  1CTM A;  1J8I A;  4KMU C;  4XQJ A;  1HCZ A;  1L0Y B;  1TY2 A;  3J80 E;  1CQF A;  3M4Y A;  3O13 A;  4KD3 A;  3VYU A;  3I4L A;  2D9U A;  5CV6 A;  1STN A;  3G6J B;  2LKV A;  4IUT A;  1XYI A;  4PMC A;  4KI0 A;  1AFP A;  1HQR D;  1LTI D;  2NN6 G;  1VCI A;  4M8A A;  1B9M A;  2A74 C;  1BF4 A;  1QNU A;  1EWC A;  4KY7 A;  4PMW A;  1OXT A;  2B2V A;  3E6Z X;  3TME A;  1WTQ A;  4K8J A;  3V2T A;  2H1E A;  1BCP B;  3NSW A;  3A54 A;  2VNU D;  3K57 A;  3S15 B;  4QCL A;  1NSN S;  3NQT A;  5C3E B;  2F0V A;  3MXG A;  5EQ0 A;  1IW7 D;  3OIP A;  1SND A;  3VA5 A;  4OO1 H;  2B2U C;  2EJM A;  2AQ3 B;  4ZUI A;  2JSO A;  2C9O A;  3ZYY X;  4DN4 M;  3GQB A;  2XVS A;  1E2W A;  1TWH B;  3NK9 A;  2JA6 B;  4RCO A;  4BA1 I;  5C5M A;  4K2K A;  3D4W A;  1CZG A;  1WTP A;  3P7J A;  3F2U A;  1R9T B;  3R2T A;  3N6R A;  2X6L A;  5D3I B;  2FHT A;  2VB2 X;  2MPM A;  4TQU S;  4BS9 A;  4A3E B;  2E76 C;  3PUZ A;  3NBI A;  3GO5 A;  4LK1 C;  1KNA A;  2F0J A;  1SE3 A;  2FJ2 A;  2VXW A;  4NKL A;  4G7O C;  1HA5 A;  3GTL B;  1GUS A;  3QJY A;  3Q24 A;  4C2M B;  2NVQ B;  3DWQ A;  2A6H C;  1OXX K;  1SE2 A;  1ILP A;  5C5L A;  1TS2 A;  2AQ1 B;  2EPB A;  4DGZ A;  1RTN A;  2K32 A;  4FF1 A;  2F0L A;  4OO1 I;  3AB9 A;  3BVM A;  5C3W A;  5EPK A;  4KV6 A;  3MTS A;  2F0D A;  4HSV A;  1BQQ T;  2EJF C;  2RSN A;  3SK6 A;  1EWH A;  4XT1 B;  1GUW A;  2F4I A;  1BR9 A;  3BDL A;  2PZU A;  1DOM A;  3FDT A;  2RVL A;  5JVG 3;  1A3V A;  1CA5 A;  4K6D A;  3GTG B;  2IJ0 A;  1HA6 A;  2FMC A;  1CZW A;  2K04 A;  4IAL A;  4DXF A;  1A6X A;  3QO2 A;  3FRP B;  3DEO A;  2L12 A;  5EGT A;  5G3L D;  5IOD A;  4HED A;  5K36 H;  1G6Z A;  4IUN A;  3K5M A;  1I50 B;  1EY8 A;  2KQ3 A;  1BBX C;  2EDG A;  3OMG A;  2IPK D;  1SMY C;  2L0C A;  4LMQ D;  1MI2 A;  2B8F A;  1HQM C;  1H9K A;  5COR A;  4PV1 C;  5CGK A;  4DF7 A;  2A68 C;  3C46 A;  2O2L D;  3TP7 A;  5I9O A;  2HDL A;  4CKC A;  1M4V A;  1JOR A;  3S2H B;  1GJX A;  5CBA E;  1DZ1 A;  1Q12 A;  2EJG C;  1Q1B A;  3RZO B;  2E2H B;  2SDF A;  2EY5 A;  1PZJ D;  5DM6 3;  3KBX A;  2WP8 J;  2A73 B;  2AWN A;  5C3X A;  5T1G A;  3RZD B;  1LO5 D;  3C1E A;  3T56 B;  5JPN C;  1RHP A;  1FNV A;  3GV6 A;  1CT1 D;  4F7X A;  3QOJ A;  3KF8 A;  1L0X B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...