5EPLA

Crystal structure of chromodomain of cbx4 in complex with inhibitor unc3866
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
54
structure length
54
Chain Sequence
GSEHVFAVESIEKKRIRKGRVEYLVKWRGWSPKYNTWEPEENILDPRLLIAFQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/transcription inhibitor
molecule keywords E3 SUMO-protein ligase CBX4
publication title A cellular chemical probe targeting the chromodomains of Polycomb repressive complex 1.
pubmed doi rcsb
source organism Homo sapiens
total genus 11
structure length 54
sequence length 54
chains with identical sequence B
ec nomenclature ec 6.3.2.-:
pdb deposition date 2015-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5eplA00
1DOKA 3DEPA 4XDXA 2RVLA 3UI2A 4XT1B 1WTOA 1X3PA 1G6ZA 3LWEA 4HSVA 2KUMA 4QUCA 4HCSA 1AZPA 2RA4A 4X3UA 3F2UA 1C8CA 2VXWA 1S4ZA 1EL0A 1J9OA 1F9PA 1B4OA 1QE6A 2B2WA 2RSNA 5EPLA 1XYIA 1CM9A 5EJWA 2B2YA 4DN4M 5CBAE 1Q3LA 2KEEA 1ICWA 1HFGA 2KECA 1BO0A 2L12A 5T1GA 1WTPA 2BDNA 2K01A 5AFWA 1ML0D 2H1EA 2DY7A 1RJTA 3I90A 2NZ1D 2EE1A 3P7JA 3TZDA 3I91A 2B2UC 1IKMA 1E0BA 1BBXC 2MPMA 2JP1A 3Q6SA 1J8IA 1EOTA 5T1IA 4XT3B 5EKIA 1HFNA 2MJ8A 1WD0A 1SAPA 5CORA 1U4PA 2FMMA 2JYOA 3D6WA 4O42A 1EQTA 1RHPA 5COYA 4IUPA 1WTVA 1IL8A 5CBEE 2B2TA 1MSHA 1O7ZA 1SSOA 1F9QA 2J7ZA 1PLFA 2B2VA 4ZAIA 4R8IA 4IUQA 1AZQA 1BNZA 2X6GA 1RODA 1MSGA 1HUMA 1MGSA 3DEOA 1X3QA 4X3SA 4X3KA 4ZKBB 3MWYW 3G7LA 2L11A 2EOTA 2MP1A 4IUTA 1EIGA 1PFNA 1DONA 4ZKCB 3R93A 1HUNA 1B50A 1CA5A 2L9HA 2EPBA 1WD1A 2Q8TA 2N88A 5D65A 1CA6A 1KNEA 2R3ZA 3KBXA 4IUUA 1MI2A 1F9SA 2L4NA 1QG7A 4OIKA 5CMDA 1WTXA 4X3TA 4LMQD 1F2LA 1O80A 4IUVA 1WTWA 1HHVA 3ONAB 4UAIA 1HRJA 5EPKA 3QO2A 1WVLA 2FJ2A 5E4WC 2B2WC 1XX8A 1LV9A 1PFMA 2FINB 5DNFA 2K1BA 3TN2A 1QNKA 2B2YC 1KNAA 2KOLA 3GV6A 5EQ0A 4RAUC 4HEDA 2NYZD 4U68A 1EIHA 2HDMA 2L1BA 2SDFA 4QUFA 1ILQA 1NCVA 1RTNA 2HUGA 2K28A 5D14A 1PDQA 4IURA 1A15A 4NW2A 5E4XA 2HCIA 3I3CA 2FFKB 5JJZA 3MTSA 1BF4A 4R9WA 2X6LA 1DOMA 1F9RA 1U4LA 2K04A 3FPUB 3KUPA 4OIJA 1ILPA 1IKLA 1B53A 1M8AA 2KEDA 4CJ1B 3IL8A 3HP3A 2K05A 2B2UA 1O7YA 2FHTA 4CJ0B 3SVMA 1NR2A 2NWGA 1JE4A 3DM1A 1GUWA 2M2LA 4RWSC 4ZK9B 3H91A 1G91A 1VMPA 2B2TC 2HCCA 2B2VC 1U4MA 2D9UA 4MHEA 2DY8A 1G2SA 3FDTA 2N55A 1WTRA 2XIWA 4HAEA 1PFBA 1DZ1A 2X69A 1JICA 1NR4A 1AP0A 1TVXA 3N52A 2KVMA 2Q8RE 1U4RA 4ZLTF 1B3AA 1ZXTA 4MN3A 4RA8A 3I8ZA 1WTQA 1B2TA 3IFDA 1SDFA 1X32A 3GV3A 5EPJA 1G2TA 1VMCA 2HDLA 4CJ2C 1HA6A 2MGSA 1ESRA 2IL8A 1DOLA 2RSOA 1RTOA 2CVRA 2K03A 1NAPA
chains in the Genus database with same CATH superfamily
3CU7A 4KV6A 4XT1B 4RCNA 3PO2B 4WFN3 4H44C 4PMWA 5ELDA 1TWCH 1X54A 3I4OA 3MVVA 2OEOA 5C5LA 3ZJYC 3KJPA 5HGQA 3NK9A 3TQYA 4HJ9A 1EIYB 4DK6C 1K28A 4R4QA 5EPLA 2EYMA 2K5VA 1GM5A 4HTHA 2MO0A 4QY7A 5AFWA 1BQQT 3M4QA 2MHVA 2VZAA 1SFOB 5GAEC 3KLWA 5CV5A 4KD4A 5E1FA 1BBXC 4S3SA 3CC4A 4L5SA 4Y52H 3NBHB 3TRZA 4KMUC 3A8JE 4DR1L 5JJLA 1IL8A 4ZAIA 1O7ZA 2E2JH 1S5CD 1FNWA 4NPSA 4F87A 1PTOC 1ONLA 4TKOB 2JEBI 3S1RH 5J3BA 1B50A 4JOIA 2I5HA 1CUKA 1CKNA 5D65A 1IZ6A 4NXML 2L4NA 1AW7A 2IHEA 4YCVA 2HD3A 4OO1G 4A93B 1HA5A 4P2CB 4IFDH 2BOSA 3TDQA 1XNRL 2L5TA 2VB3X 5GADC 1ASZA 3MXNA 2R7ZH 2F03A 2F4VQ 3H3VC 2J0TD 2LXKA 3TN2A 3CHBD 4KHPL 4RAUC 2VQEL 2NYZD 1H9SB 3PF4A 1SBBB 4IPHA 1WCMB 4ZRZA 4DV1L 1PA6A 2HUGA 4AYBB 2NTSA 5ISRA 2JA5B 3KUPA 2QGQA 3J81c 2K6AA 3GO5A 3IL8A 4OELB 2KJXA 2K05A 1O7YA 4MNOA 1IBLL 2M2LA 4IJHA 4EVOA 1G91A 1SYGA 1OTCA 4DUZQ 2UXDL 1UE5A 2UXBL 4DPGA 1Y1WB 3GTOB 1IBKQ 2UUCL 1JCKB 1YNND 2KHSA 1S5FD 3P1HA 2JJQA 1LTSD 4P74A 4DAYB 3KOJA 4XXEA 4JI6L 2BCOA 4A3JB 2IJ0A 4N9TA 1X3EA 1LT5D 1GUGA 1B7YB 5GROA 3VYTA 3CCSA 5CV9A 2QA4A 1D2BA 3IKJA 4WJWA 1XYIA 5EJWA 2NTTA 4OWTB 3PQIA 1EYDA 1VQAA 4IO9A 2VQFQ 3T16A 5C0XH 1SNDA 5EKLA 5HY6A 1EU4A 1JJ2A 3FP9A 3PO3B 3S1MH 3KYHC 3NQIA 5KGUA 2EYHA 4GOPC 4XQJA 1BBWA 3S2DB 1HNWQ 4HIOA 5C44B 4TSSA 2A68D 1VS0A 3HOYB 1ESFA 2R93G 2NVYB 1GKHA 4LJZC 3QOLA 2VUMB 3KBXA 2WAQE 1MBYA 1CZGA 4JC0A 3A56A 4LMQD 3FVQA 2PI2E 4YWKA 2F0HA 4IFDJ 5DNFA 1SROA 2XRQD 1SYEA 2JA7G 1NMFA 5C4XG 3BS1A 4DR5L 2IW3A 3KDFA 4KHVA 2WKCA 4BWGB 3HOXB 1TWCB 1ZYRD 5JPNC 1PRTD 4X66Q 2OTLA 2X6LA 4CDDC 4A3FH 4CJ1B 4L5QA 1CZWA 1EYAA 1NNXA 3PMFA 1S5ED 1PHJA 4HMJA 1YJ9A 2ATWA 1YJWA 3U4VA 1EEFD 3A7AB 1FVIA 1U4RA 4POGA 1I50H 3GQBA 4A75A 1VQ4A 1SNMA 4A3CH 1D1IA 1I4HA 1DOKA 1QOHA 2CWPA 3OTOQ 3J81E 3S1RB 4ME5A 4DU9A 3HZXA 1XMQL 1H9SA 5EAYA 4A3MH 4DR7Q 1FGBD 2F0VA 1KRSA 4YY3L 4GS3A 1D5MC 4B3ML 3HKZG 2RSNA 2B2WA 1LT4D 1XTCD 2VS1A 3N6RA 2K5NA 2NN6G 4LFBQ 2R7ZB 1QILA 3PUYA 1STNA 1YNJC 1JC7A 1Y14B 2CH4W 5C0XJ 1HQRD 1E0BA 3S14B 4XQQA 2EY6A 4BBSH 1EY7A 1U4PA 3GTLH 4O42A 3AQQA 2F0LA 3A5ZB 4ALPA 1SNPA 1UEAB 3E9HA 3RLOA 4F7XA 3EVQA 4DAYA 3ERQA 4DAMA 5KYLA 2MFIA 1PZJD 1PFNA 3DHQA 2RQXA 4H02A 1I3QB 3D8GA 2RDGA 1EZ6A 4HJ5A 3UDGA 4WJ3M 5CMDA 4LF7L 3CMAA 3D4DA 3BVZA 2JA8G 3SK6A 3AMUA 1N33Q 1EFWA 4PZ7A 4JV5L 2XVSA 3STBC 1RL2A 2K52A 1UWVA 1CFMA 3RZOH 1GUNA 1PH5A 4FXKC 2GVAA 1Y1VG 2K50A 3C2PA 1K0SA 1RTNA 4JI3Q 1XNQQ 1Q7YC 2EYFA 2K04A 1RF2D 2MNAA 1T5EA 1YZ6A 4KN7C 4XIGS 4M8AA 1V9PA 2WV6D 2UU9L 3I2ZA 4RWSC 2IX1A 5JEAG 2F0GA 2B2TC 1A0IA 2D9UA 3SDZA 3F8TA 3K58A 2E74C 2XIWA 4A3IG 4A3KG 2ZT9C 1BBUA 2KCMA 1AEXA 3S1MB 3WOFA 5FJ8H 5C4ZA 1SXTA 5C3EG 1SMYD 3J81j 1L1OB 1Y8OB 1G8ZD 4KD3A 4DR3L 1KXLA 4XYOA 4XDXA 3A0JA 1V1OA 3GDEA 1S5BD 3L7ZC 4TRDA 4ZCKA 1I94L 1VQIA 3F2UA 1HCZA 4DR4L 3OIQA 1CM9A 1HR0W 4DNIA 4G7ZC 1BR9A 1TWHH 2IT1A 2KEEA 4DNRB 3M3YH 5JJIA 1SEBD 2L12A 4IOCA 4K8IA 1XPUA 3HOVH 4A3LH 3W2DA 2F0EA 2F3VA 3ERSX 1Z47A 4IJLA 1LUZA 2D2CC 3X3NA 2QILA 3NBIA 2EDGA 1M90C 3CCMA 1A63A 3OYYA 1VQHA 3H6MA 4K2LA 2SNSA 3HKSA 1A3VA 1MSGA 3J81i 4FVMA 4P71A 4LUVA 4XTCS 3R2IA 1X9NA 1KD1C 1HUNA 3K57A 1JB3A 3NTIA 1AE3A 1KNEA 1CSPA 4FYDA 2NVTB 3MFGA 4A76A 1VQPA 4AYBE 2UXCQ 2QDBA 2IY5B 1KHIA 1I50B 3LGJA 2R92G 5EPKA 2OTJA 1EY5A 5C0XI 3U9OA 2Z1CA 5GAHC 1AFPA 2M9VA 4JI5Q 4HCEA 4A3MB 3A8KE 2CCZA 4NW2A 4HMIA 5K5PA 2AQ1B 3PO2H 3ULLA 1LACA 2YV5A 5E7NA 3FKIG 4P75A 5J39A 1ILPA 5LMNW 5C4XH 3A8IE 5LMUQ 3RN2A 4IUNA 4H13C 4C1NK 2MQHA 3CCLA 4P73A 3UE0A 2HCCA 4YIJA 5AJ3Q 2WP8J 2K5QA 3M85A 1TS2A 2D5DA 4X64L 3TEHB 5JJKA 2E2HH 4MN3A 4RHRA 3GTLB 1SE2A 1SDFA 2A6EC 5EPJA 2HDLA 3T4AC 4UPAA 1YIJA 1HA6A 3UDXA 2RSOA 2BDOA 2ZXRA 4DV3L 2PQEA 3BDLA 4JPBW 1W6JA 4KY6A 4QJFA 1WTOA 3M4YA 2ICEC 2B29A 2R6GA 1KDBA 4RCOA 3GTPB 1KL9A 3A54A 2WB1G 2UUBL 4FF1A 2DNEA 1SR3A 1YNNC 1ICWA 4J6HA 1OXTA 3KLRA 3TMEA 3NE5B 3EJIA 2C5CA 3CCVA 1VQ6A 2RCNA 3V2TA 2IHFA 1J5EQ 4BS9A 1TQOA 3I91A 2WFWA 4OHJA 2NN6H 4JI7Q 2EY5A 4BXXG 3NUCA 1V1PB 1Q1EA 2RDFA 1EYGA 1QCBD 1WI5A 1L1OA 5BN4A 2PNRC 1PLFA 4X3SA 1TWFH 3RZDH 3SEBA 1FJGQ 1IXRA 2A74C 1PH8A 3I4LA 4GN3B 4FXDA 2IX3A 2Q8TA 1VQCA 1Q46A 3H0GH 4IUUA 3HOUG 2HQEA 1W2BA 1B44D 2A69D 4KKTA 4LF4Q 4L8JA 3GTOH 1Y8NB 2Q2IA 5CYUA 3K5NA 3T13A 2AHOB 2PCFB 2EJFC 3OW2A 3S17H 1HNWL 3V05A 1PFMA 1G6PA 2JEAI 2B2YC 1SRUA 3L0OA 1PV4A 3G4SA 3NTHA 2A68C 4MZ9A 3HG9A 5F2DA 2BA1A 2CFMA 2WKDA 1BDOA 2DJFC 2IPKD 2K28A 5E4XA 3AEVA 3LX0A 3TBIB 3I3CA 2ZJRA 3J80L 3HOZG 2O4XA 4P72A 5FO7B 2A8VA 3G48A 4GKJQ 2RF4A 3VA5A 5IYBG 1TWHB 4GKKQ 1YHQA 3M3YB 1NR2A 3CKIB 4WRDA 3CCQA 1A3UA 4Q0FA 1D5XC 4CGYB 4RGNA 4FXGC 1ZEQX 4LUZA 2FMCA 5EBCA 4MTNA 2JSOA 1LTTD 4IPCA 1N32L 1STYA 2AKWB 2Z6KA 1B2TA 3PO3H 1WTHA 3VYSA 5BR8L 4HIKA 5IGEA 1ESRA 1JWMD 2XGTA 3JC66 1JWSD 4IN3A 2PPBC 3Q0AA 1I6HH 1AH9A 3DEPA 1SMXA 3UI2A 5LHY1 5KIXA 2KCNA 4L5TA 3S2HH 3I4MG 3SHLA 4JK1C 2NVYH 2Z0SA 5DM73 4K0KQ 1Z7TA 2R93B 2EXDA 2NZOA 4A3BG 3MHBA 1HNZQ 4B3RQ 3ULJA 2E76C 1NMGA 3OTOL 1IKMA 4HIMA 2OCEA 3Q6SA 3AYHB 1NBWA 3T1YQ 4CKEA 1XTDA 1PH6A 1W3SA 1X55A 3VR5A 3HOXH 1BCPD 2YTXA 2J7ZA 3I4NH 5C4XB 1K8MA 5IWAQ 1RODA 1MGSA 2PI2A 5I9PA 4LFBL 4KKSA 3R3OA 1K0RA 4JI0Q 5M5XB 2OWOA 4JI1L 3PUWA 3ULPA 1F9SA 3CC2A 4A3GG 2DUDA 1PTOB 1YJNA 2E2HB 4I7AA 1WVLA 5CV4A 5E4WC 4ZYSA 2K1BA 5CV8A 1JORA 2F0TA 2KOLA 3GV6A 4IZ8A 4GNXA 5LL6X 2NZHA 2HCIA 2MUYA 2ENBA 1K8OA 3NHHA 3RD4A 3QG1A 3ZYYX 1GXDC 1X6OA 1LLRD 1UAPA 1YVCA 2F0MA 2ZM6Q 2NUCA 4OWXB 1N33L 5IYCG 2ZXPA 3E9IA 1RKNA 1STHA 3U58A 5C3WA 2BA0A 3E5SA 3HKZB 1X56A 2B2VC 3KBGA 4IPDA 3FKIH 4GLXA 5GAGC 2E8GA 5IP7G 4NXNL 1TKWB 4JI3L 3S14H 3VDYA 2N3SA 5KNCA 3CRKC 1OXVA 2BE5D 2LMCB 1QB5D 4C2MH 4X65Q 3C46A 1QVFA 3ITPA 1N34Q 5JEAJ 1DM0B 3K8AA 1DOLA 1TWFB 2G9DA 2K03A 2SNMA 2LY7A 3KF6A 2KBNA 4K5XA 4YCWA 3RZDB 4G4KA 1EWCA 5A35A 4J15A 3JAML 4OONA 3H0GB 1X3FA 1I3QH 1YHAA 3S1QH 1STBA 4JI4Q 3F2BA 3TS0A 5M3FG 1QNUA 1WYDA 1HFGA 2Z9HA 4C1NI 1GUSA 3S17B 2H1EA 3I56A 3NXWA 3BYTB 5JVG3 1HZAA 3SE0A 3P20A 4DR2Q 5T1IA 4XT3B 5EKIA 1TS3A 1SAPA 4E6IA 3E0JA 1ENFA 2ASBA 4IUPA 4ZUJA 4B3TL 2EXZA 1HTPA 3GTQB 4KJOA 1U5KA 1PYBA 3PF5A 4BA2I 1NUCA 4BXXH 4KI0A 2UUAL 4RKLA 1E2ZA 1CA5A 4GOPB 4HR7B 1WD1A 5JAVA 3J80c 2JQOA 3HOWG 5KNDA 4K2KA 1HZ9A 3Q24A 1O78A 1HR0Q 4DR6Q 4LNQA 1VQKA 2L55A 1SE4A 1EY6A 3P75A 1R4PB 4B9WA 3NPPA 3NQTA 2PZTA 3BYYB 2F0NA 1VQNA 1K83H 1LV9A 2HT1A 1I6HB 2PMZB 1SLJA 1EIHA 1HNXQ 1U9RA 2NN6I 5C3EB 3S2HB 2CW0D 3D3RA 1DOMA 1LABA 4LAAA 4H7BA 3QB3A 1L0XB 4FP5D 4C3HG 1GUWA 1PH3A 3GP7A 4KHZA 1Q1BA 1HJPA 3C1EA 4A3EG 2ZTDA 1S5DD 1PH2A 5KNBA 3K6OA 3M9BA 1DZ1A 3BDOA 2R7FA 3BJUA 3TP7A 2D0OA 2A5HA 1EIFA 3NBHA 3I70A 1TY2A 3I4NB 2F0SA 2MGSA 2IL8A 4BY1G 5GQOA 1LTAD 3WDNA 1C7YA 4DV5Q 1EOVA 2DN8A 4C3JH 5C3XA 4B3SQ 3QR8A 4KLKA 3SR1A 3FEWX 1GOZA 4HCSA 5IP9G 1DD2A 5LMNQ 1C4QA 4PQXA 2RHQB 1BCPF 4KTAA 3H94A 4X62L 4I65A 3S24A 5ELFA 1S3OA 4OXPA 2KHJA 3MEHA 1W6KA 1IBMQ 2NVTH 2F0QA 2H5XA 5T1GA 2K01A 4LF9L 3I4MH 5FLMG 1OXUA 1XMOQ 2K33A 5BN3A 3TZDA 4L5RC 3H09A 2F0KA 3T1HQ 1O7LA 1PH9A 2R92B 4A3BH 1KLGD 3J7ZC 4DGZA 1IYJB 1V8QA 1SSOA 1J6QA 2F0OA 5E3FA 4AIMA 1NY4A 4DV4Q 1YI2A 4GN5A 1FL0A 1B70B 3HFZB 1GHJA 3FKIB 2WIIB 1KDCA 3F2DA 5ELOA 1SYBA 3KF8B 3J7AF 4JYAL 5FO8B 1O80A 5ELCA 4GN4B 1WTWA 4C2MB 3TS2A 3AB9A 1VQMA 4LF8Q 2K75A 3G6EA 2A73B 3EIVA 1E1TA 2C35B 2Y0SG 1WCMG 3D4RA 3GTKH 3OWFA 1ENAA 3S1QB 1YNXA 1FNUA 3K5LA 3GTPH 2EY1A 2F0JA 2N78A 5I2XA 1Z9FA 3J80E 1L2FA 2NWGA 3E3XA 2CHBD 2WB1B 5IT9L 4C56C 4DR1Q 3JAMc 1G2SA 2XSCA 4HAEA 5A2QE 4PZ6A 2G9HD 3E6ZX 4JVZA 1K8AC 1PFSA 2JE6I 4H0LC 4QB4A 3T56B 4EQNA 4OO1H 3MXUA 1WTQA 1RDPD 2EQSA 3T53B 1Q82C 3A74A 2JA6G 3MEFA 4LWCA 3K5OA 1YITA 4UDUC 4GKJL 5IP7H 1RCVD 4A3JG 1XNRQ 1CQFA 3SK4A 4DUYQ 2PNHA 3ER0A 3W3AA 3RR5A 2KENA 4M1UB 2DJGC 2N49A 4O1NA 1QE6A 3PUZA 1QUQB 4DV0L 2F3WA 5CR3A 4KHPQ 2VQEQ 2OXPA 2AWOA 3MZ5A 3NWTA 4DV1Q 1SNOA 4K6DA 4IFDI 2E75C 1K83B 1ML0D 1KAAA 4K8JA 3I90A 3RMHA 4L63B 4EQOA 3P7JA 1BUVT 1JB7A 5FKAC 5M5WH 2B2UC 2E5LQ 5M3FH 3MA2B 5NUCA 5C6AA 1IBLQ 3L9AX 1IW7C 2MJ8A 4QMGA 2A6HC 1JE5A 3NTKA 1M4VA 1CT1D 1JMCA 2JYOA 1VQBA 5CBEE 2HHHQ 2UXDQ 2UXBQ 3UDIA 4LUOA 1K73C 4JI8L 3CD6A 5M5YH 2UUCQ 3S15H 1EIGA 5G3LD 3HOYG 2LXJA 1LTGD 5FK9C 2AUKA 1PVOA 3SXHA 3ICEA 1Q8IA 4JI6Q 2PZWA 3CC7A 1GJXA 3A7LA 2RCFA 3MXGA 2Q2HA 2AQ2B 5FOBB 1CKMA 3Q23A 1NE3A 1BCPC 3BZDB 4ODGA 4YCUA 1X65A 3K7AH 3C1FA 2F3IA 4C3JB 2HDMA 4QUFA 2EZVA 1NCVA 1KABA 4FNFA 3HKZE 2OQ0A 2FFKB 3MTSA 2DNCA 3OHXC 1KC8C 1B53A 4R1JA 1PRTF 2KEDA 1V1QA 1GD7A 2LS01 3SVMA 3O13A 3TREA 3I4MB 2R93H 2AMCB 5C4JB 2YYZA 3BZKA 5DEHA 2NBFA 2N55A 1EUJA 1ASYA 3KF8A 1TWGH 2Z8LA 4DAPA 2Q8RE 4C3HH 1XPOA 4A3BB 1B3AA 4K5WA 2EY2A 1H9MA 3OSOA 1HZBA 2I5MX 1FGUA 4OIJA 2JA7H 2F0PA 3K7UC 1EQQA 1F2ZA 4CHTB 1E1OA 5KRUA 4JBMA 3QWNA 4JBJA 1AZPA 5M5XH 1C8CA 2F4VL 4BY1H 4GZYC 1EL0A 3JAME 2F52A 3J80i 4DR5Q 3DM3A 1KIXA 1PTOH 4TQUS 4PZ8A 4QCLA 4CDEC 4X65L 3AFQA 3NWSA 1JJCB 4KKUA 4A3GB 2MPMA 3KLSX 5BN5A 3PIP3 3CCRA 1VQOA 4G57A 4BBRG 1I4RA 5CORA 4Q5VA 3GTKB 4R4TA 1SE3A 5COYA 1RHPA 4DUZL 2B2TA 4RGOS 4JI4L 3H3VH 4N9PA 4AQYQ 1IBKL 3CP0A 1CQVA 4JBWA 1FYCA 1UNSA 2PMZE 5KYIA 2N8NA 4OX9Q 1C48A 2K5WA 4OIKA 3B6YA 1A62A 1FD7D 2WINB 1QUQA 2H4OA 1VQDA 1XMQQ 4DXGA 4C3IG 2J4XA 3CRLC 4RGTA 3MFYA 5CV7A 4EQ5A 5IT9c 4B3MQ 3K59A 1A6XA 1EQVA 1QNKA 1KNAA 1PXUA 1DGSA 3S16H 1LM0A 1EY4A 4IURA 1A15A 3T51B 1YNJD 5EGTA 3I55A 2VQFL 2K5HA 4R9WA 1K8GA 1JT8A 1Z6HA 1QVGA 1ET9A 3MC0B 1CKNB 2YU9H 4HIDA 4NDXA 4DV6Q 5M5WB 2DY8A 3FDTA 4LFCQ 2HQLA 2PO4A 4GNXC 5M3FB 1JICA 2JA8H 4JOIC 5I9OA 4V190 4DV7Q 2ID0A 2O5JC 4BA1I 5IGFA 3FHWA 4LF7Q 3GTMB 3GTQH 3S15B 5M5YB 4X6AH 3PUXA 4A3DG 1NJIC 1Y1VH 4KY7A 3BG3A 4A4IA 1X3PA 5DLQE 4F88A 4JV5Q 1G6ZA 3WOEA 4RH6A 1VQFA 1LTBD 4JCVE 5A2QL 1Y69U 1F9PA 3CPWA 3DWAA 1D7QA 4NKLA 2KECA 1BO0A 5JEAH 1ZYRC 5G3LF 4JI2Q 4X66L 1PRTC 1STAA 4KY5A 4OGQC 1RJTA 3K7AB 4A3IH 4A3KH 2GN5A 2Z4IA 4OO1I 1HFNA 1AN8A 1E3PA 2E2DC 5C3EH 2M00A 2K7VA 1EQTA 2F0DA 1C9OA 4A3FG 2Q2TA 4Y7NB 3RN5A 4RG1A 4X3KA 2ALYB 2XNAC 1JOOA 4ZUIA 2MP1A 2EJGC 2PYKA 3GTJH 3RUZA 5M9OA 1PH1A 3CXCA 1SYFA 1SJHD 2K32A 1TWAB 2L0CA 3PV0A 1QG7A 2PQAB 1TWGB 3JAMi 4C3HB 4X3TA 1GUTA 1Y8PB 1NTGA 3M4OB 1HHVA 4DKAC 4DR7L 1SNQA 3QO2A 4AH6A 4A3EB 1LO5D 4POFA 3HEJA 3OMCA 3BDCA 4DR4Q 2RBMA 2JA7B 2NVQH 4TVAB 3OPOA 4HEDA 1E2WA 2L1BA 1I4QA 4A3MG 2WB1E 1Q86C 4RHSA 2XTIA 3PUVA 4IPGA 4APVA 1EU3A 5JJZA 4BY1B 1QJOA 3I7FA 4LF5Q 3S1NH 1M8AA 4RMFA 3FRPB 4LFAQ 1PZKD 1CSQA 1A2TA 1TU2B 1VF5C 3BU2A 4BY7G 4V0BA 2F0FA 2QCPX 4LF8L 2B39A 4FF2A 1Q8KA 5IT9E 3G6JB 1O7IA 1EQRA 2XWBB 4BBSG 2FXQA 1TS5A 2WAQG 4ME3A 3VR4A 1HH2P 4ZLTF 1B1ZA 5J22A 4XQNA 1B9MA 2RHSB 2R92H 3IFDA 5DM63 1G2TA 1ENCA 1V1PA 1BKBA 3KDFB 5I6YA 1RTOA 3TP8A 4QIWB 1I4GA 1A8VA 1B3QA 1S40A 1QWYA 4ABNA 4HN7A 1IHZA 1BXTA 3BZCA 1B4OA 3D0FA 5I4DA 1UE6A 2KA7A 3CCEA 2B2YA 2EYJA 1F77A 3FPPA 3I72A 2ZJPA 2BDNA 3OOCA 1XNQL 2DY7A 4HSPA 3VR3A 2R61A 3OMGA 4DV2Q 2LKVA 1QVCA 3AFPA 3D4WA 3S16B 2JP1A 3SK8A 3VR2A 4R4CA 4YHHQ 4DUYL 1EY9A 2QKIC 1WD0A 3OWEB 1CI3M 2A19A 4LK1C 1NSNS 3QIAA 4IUQA 2KCCA 2B8GA 2Z4HA 3EA6A 3DEOA 2Y0SB 3DWPA 3TP5A 4ZKBB 1VQJA 5FO9B 4X64Q 1XJVA 2YU9B 4BBRH 3R93A 2SEBD 2A6ED 1EY8A 2YTVA 1SMYC 3HGBA 3W5OA 5D3IB 2E5LL 2B3GA 4YWLA 1II3A 2EYLA 5ELBA 2E2IH 4DV3Q 4OWWB 2JA8B 4WORA 5FJ8G 1S72A 4JW0A 4NMZA 4IALA 1K3BC 1JOQA 1VQEA 2O5IC 4NP5A 3CAMA 1VQ8A 1R4QB 2LSSA 4CDFC 2HHHL 2B2WC 3MAQA 5CC4A 2UUBQ 5C4HA 4R4IA 1Y1VB 2EYOA 4IQZA 4C3IH 2Q8IB 4J8QA 1N36Q 2JA6B 1BF4A 3LWUA 5IODA 2EJMA 2WACA 1TXYA 5M3MG 3VR6A 1JWUD 5LL6S 1D1KA 3H3VI 1LT6D 4CJ0B 2JK8A 3VYRA 4G7HC 3K0YA 1MHWC 3HOVG 4A3LG 1MD2D 3U9SA 1H9JA 2B63G 2VB2X 3PCOB 5FLXE 4DNTB 1U4MA 1K3RA 4MHEA 5CV6A 1G291 3L3OC 4A3IB 4A3KB 1GVPA 2RDHA 3CW2C 4K6LA 3HOUH 1G51A 2PQAA 3EFXD 1VQ9A 4L6TB 3CCUA 1PH7A 3G71A 3A5UA 2F1MA 1H95A 3IRBA 1H9KA 4XYQA 4CJ2C 2KQ3A 2CVRA 2SOBA 3Q22A 2C9OA 3PIO3 2RVLA 2UXCL 3GTJB 3R8BA 4WJ4A 4HSVA 1GUOA 2K4KA 4O2DA 5JVH3 2KUMA 3HOZH 1S4ZA 2OF1A 3LNNA 1N8RC 1J9OA 1M1KC 4KN4C 4JI5L 4DN4M 4A3DH 2LFNA 5IYBH 1STGA 3L2PA 1R9TH 1PZID 5IYDG 1K9MC 1VF7A 3K5MA 2NVQB 2EE1A 4YWMA 3CQZH 4O0AA 3Q8DA 5LMUL 1B9NA 2TSSA 3EROA 1TT2A 3ND8A 5C5MA 2CQOA 1I4XA 3PO2G 3S1NB 3D6WA 1IYVA 5AJ3L 4R8IA 2B2VA 1BNZA 1I5FA 1STEA 3MWYW 3G7LA 1N32Q 3QJYA 1BVSA 3PSIA 4ULLA 4HJ7A 2I46A 3W1BA 1H9RA 3PIPA 2ZJQA 5BR8Q 5J1ZA 4NB3A 4B08A 5C4JH 1TY0A 4FDBA 1OO9B 1GO3E 1KAWA 1XWEA 2DGYA 1QZHA 1WTXA 1FNVA 1HZCA 1YBYA 2XRSD 1D5ZC 3J7AV 3KK7A 3ONAB 1TR5A 1DXMA 4DK3C 2FJ2A 3M7GA 3EBEA 1I6VC 1DJRD 1XX8A 1YEZA 4AQYL 3U50C 1DYQA 4LF6Q 1ILQA 3DMUA 4K14A 5JOBA 4HJ8A 2E2JB 4OX9L 5ELNA 1T5XD 2QW7A 1J5EL 5HURA 1SYCA 2QF7A 1UUPA 3HP3A 1JE4A 4JI7L 4A93G 4ZK9B 2OQKA 1WOCA 3H91A 3R2TA 4U673 5IGBA 5IGGA 1IYUA 3NELA 1E2VA 1WJJA 4RFBA 3F1ZA 1SYDA 2XN9C 4PNYA 3M7NA 3M4PA 3RLNA 2I5LX 1NR4A 4A3GH 1FJGL 1ZXTA 4MIUA 3URYA 3U4ZA 3MXPA 4BY7H 5EKKA 3RLFA 3F2CA 4AYBG 4JI1Q 2VW9A 2PW5A 3DLLA 3CF5A 3RNUA 2JA5G 5D3DA 3OIPA 2NB0A 3TP6A 4QQBX 1NAPA 3WWVA 2G5DA 4BBRB 2A69C 4LF4L 4DFAA 4N8FA 3QOJA 3GD7A 4DV6L 2PW7A 1VQGA 3E0EA 3H0GG 4LFCL 5KEEA 4GOPA 2E2IB 4GLVB 1PTOD 1Q3LA 5IOCA 1Y1WG 3SK5A 5IYCH 4DXFA 2K14A 4DV7L 1N9WA 1L0WA 4JG2A 2KCTA 5L37A 2P5ZX 4UP8A 4NXMQ 2F0WA 3BVGA 4GKKL 4C3IB 1MIUA 1WFQA 4R4OA 5IGDA 1E24A 1TIID 1KLUD 2CKZB 1WTVA 1C0AA 4N8X1 3GTGH 1AZQA 2VNUD 3D31A 2KHIA 3OW7A 1CK1A 2O2LD 4NXNQ 4ILWA 1UE1A 2L11A 3TSSA 3VA7A 1KTKA 4JI2L 3DWQA 2EPBA 3K80C 3CCJA 3C3LA 1Q81C 1CA6A 1MI2A 2RKSA 3HOUB 1PYWD 2YTYA 1KRTA 1DCZA 2HIVA 1AE2A 1SNCA 1HRJA 3PO3G 1F2YA 2CQAA 1EEID 2L15A 1ICFB 2QEXA 4K0KL 5C44G 1CHQD 4FF3A 2SDFA 3K0XA 3GTMH 2NVXH 3HRZC 1PDQA 3EN2A 3V96A 4F8MA 3HOZB 1P8LA 1HNZL 4B3RL 1BCPB 3FPUB 1U4LA 4G7OC 2VUMG 4A3DB 1HTLD 3DUZA 3NSWA 4QGUA 2AQ3B 2FHTA 3NENA 1R9TB 3T1YL 1CHPD 5I6WA 3ND9A 1EWHA 1L1OC 3AU7A 5CGKA 1MJEA 4B3TQ 5IE8A 3CQZB 5M3MH 1WTRA 3HOWH 4QIWE 5K36G 5IWAL 1PFBA 1EFID 1TVXA 3N52A 2MO1A 2AWNA 1JOKA 2UUAQ 4RA8A 3H15A 4JI0L 2CWAA 1VCIA 5TSSA 1X32A 2B63H 3HOXG 4LF5L 4EGVA 3I4NG 2XWJB 4MTKA 1EYCA 1VQ5A 1PH4A 4DA2A 3DXJC 3KFUA 4LFAL 4KJNA 3BVMA 1EZ8A 4Y7NH 5FLXL 3NEMA 4PMBA 4Z9CB 3J7A5 4QUCA 4OL7A 1KQSA 4A3FB 1HQMC 1ET6A 4QF4A 1TWAH 2ZTEA 1SJED 3HS0C 5IGCA 2EYPA 2I07B 2V1CC 1HXYD 1WTPA 2F0UA 4EX5A 3M4OH 1UE7A 3J7YW 1V43A 2OT2A 4A3EH 2Y0SE 2PZUA 1VQLA 4PMCA 1D6EC 4B9XA 2ZM6L 1J8IA 1XPRA 2A1AA 1VQ7A 5IYDH 4KK7A 2JN4A 4PV1C 2F0IA 3X3MA 1Q90A 1LTID 1JR0D 2AUJD 1X3QA 2Z6KC 1L0YB 2EOTA 4IFDG 4RGMA 2L9HA 2R7ZG 2BE5C 1UEBA 4CDCC 4IOAA 4DV2L 5IP9H 1N34L 1FR3A 3CPFA 1A2UA 4ZQ3A 4YHHL 1LYLA 4CKBA 4BY7B 4UAIA 5HGTA 4CKCA 4JBKA 5FLMH 2FINB 1SFOH 1OXSC 5EQ0A 4BBSB 4UP9A 2WAQB 3D6CA 4X62Q 4FF4A 2B8FA 4K5VA 4LF9Q 1SN8A 4DAVA 1F9RA 4ID6A 1X3GA 2ICIA 5IY0A 1VDZA 2B2UA 1HPCA 1I4PA 2BH8A 4DR2L 2R7DA 2JA9A 3TZUA 4EQPA 1QZGA 1GHKA 1JQYD 2QEJC 4YY3Q 1VMPA 1RIPA 5IIFA 1AP0A 1A3TA 4A93H 1PTOF 1N36L 3I8ZA 3GV3A 3RZOB 1EWIA 1LT3D 3GTGB 2HIXA 1PMRA 3J81L 3W1GA 5JPMC 4JYAQ 4GNXB 1MJCA 1HR0L 4DR6L 1LTRD 1T9HA 1ZKOA 1RD9D 3A55A 4I7ZC 4GLAC 3LWEA 1WCMH 3UDFA 5H1SE 2V4DA 2ZXOA 2IWHA 5I2YA 2EVBA 5C0XG 4UHVA 4UP7A 1JJGA 2RA4A 4X3UA 3PGZA 2VXWA 3VYUA 2JA5H 4QL5A 2VY3A 3K81C 1U0LA 4RKBA 1BOSA 5CBAE 1HNXL 4HJAA 5EBDA 3MXNB 2TMPA 2Q2UA 2IX0A 2CW0C 4UY8C 2ZTCA 3PIOA 4DF7A 3IFTA 2NZ1D 1IL2A 4LW1A 1OXXK 2ES2A 5ELEA 1Y1WH 1EOTA 4DK0A 2NVXB 1EY0A 3STBD 1F2MA 1Q12A 2FMMA 1CTMA 1PRTB 2Z6BA 3UE1A 2D0PA 3KF6B 2JA6H 1MSHA 1F9QA 2X6GA 5DAUA 1HUMA 1SE8A 2GA4B 4IUTA 4J1MA 4A3JH 4ZKCB 2BH2A 1DONA 1PYSB 5M3MB 2N88A 3HOWB 2R3ZA 1LTLA 1E22A 3KJOA 4OEMB 3SGIA 1YHBA 2I0QA 4DV5L 2F4IA 4R8NA 1P16A 1F2LA 2UU9Q 4IUVA 4B3SL 3HOVB 3IAYA 2B63B 1B8AA 4DK1A 1CKOA 5LMNL 4DV0Q 3EQLC 4CBVA 4C3JG 4U68A 1E7ZA 2GVBA 2JXMB 1IBML 5D14A 1TS4A 2EIFA 2CH4A 1XMOL 1KDAA 1IKLA 4FO2A 3S2DH 4DR3Q 1XXGA 3FMCA 3S9WA 5C44H 3T1HL 1IW7D 3DM1A 3NP8A 2A6HD 3I73A 5FLXc 3HOYH 1I94Q 4PG3A 2VUMH 4JI8Q 2QDLA 4A3CG 2X69A 2K5DA 3KLSA 1D8LA 4LF6L 2KVMA 4DV4L 1MKHA 1VMCA 2D62A 5K36H 2VL6A 3CMEA
chains in the Genus database with same CATH topology
3CU7A 4KV6A 4XT1B 4RCNA 3PO2B 4WFN3 4H44C 4PMWA 5ELDA 3MVVA 5C5LA 2OEOA 3NK9A 5EPLA 2EYMA 4HTHA 5AFWA 1BQQT 2MHVA 1SFOB 5CV5A 4KD4A 5E1FA 1BBXC 4S3SA 4KMUC 3A8JE 1IL8A 4ZAIA 1O7ZA 1S5CD 1FNWA 4F87A 1PTOC 1ONLA 4TKOB 2JEBI 1B50A 5D65A 2L4NA 1AW7A 4OO1G 4A93B 1HA5A 4P2CB 4IFDH 2BOSA 3TDQA 2L5TA 2VB3X 3MXNA 2F03A 3H3VC 2J0TD 3TN2A 3CHBD 4RAUC 2NYZD 1H9SB 1SBBB 1WCMB 4ZRZA 2HUGA 4AYBB 2NTSA 5ISRA 2JA5B 3KUPA 2K6AA 3GO5A 3IL8A 2KJXA 2K05A 1O7YA 2M2LA 4EVOA 1G91A 1SYGA 1Y1WB 3GTOB 1JCKB 1YNND 2KHSA 1S5FD 3P1HA 1LTSD 4XXEA 2BCOA 4A3JB 2IJ0A 4N9TA 1LT5D 1GUGA 3VYTA 5CV9A 1D2BA 3IKJA 4WJWA 1XYIA 5EJWA 2NTTA 1EYDA 3T16A 5C0XH 1SNDA 5EKLA 1EU4A 3PO3B 3NQIA 5KGUA 2EYHA 4XQJA 3S2DB 5C44B 4TSSA 2A68D 3HOYB 1ESFA 2NVYB 4LJZC 3QOLA 2VUMB 3KBXA 1MBYA 1CZGA 3A56A 4LMQD 3FVQA 2F0HA 4IFDJ 5DNFA 2XRQD 1SYEA 3BS1A 2IW3A 4KHVA 2WKCA 4BWGB 3HOXB 1TWCB 1ZYRD 5JPNC 1PRTD 2X6LA 4CJ1B 1CZWA 1EYAA 3PMFA 1S5ED 4HMJA 1EEFD 3A7AB 1U4RA 3GQBA 1SNMA 1D1IA 1I4HA 1DOKA 1QOHA 3J81E 3S1RB 4ME5A 4DU9A 3HZXA 1H9SA 1FGBD 2F0VA 1D5MC 2RSNA 2B2WA 1LT4D 1XTCD 3N6RA 2NN6G 2R7ZB 1QILA 3PUYA 1STNA 1YNJC 1JC7A 5C0XJ 1HQRD 1E0BA 3S14B 4XQQA 2EY6A 1EY7A 1U4PA 4O42A 2F0LA 1SNPA 1UEAB 4F7XA 3EVQA 4DAYA 3ERQA 5KYLA 3DHQA 1PZJD 1PFNA 2RQXA 1I3QB 3D8GA 2RDGA 1EZ6A 5CMDA 3D4DA 3BVZA 3SK6A 3AMUA 2XVSA 1CFMA 1GUNA 4FXKC 3C2PA 1RTNA 2EYFA 2K04A 1RF2D 1T5EA 4KN7C 4XIGS 4M8AA 2WV6D 4RWSC 2IX1A 5JEAG 2F0GA 2B2TC 2D9UA 3SDZA 3K58A 2E74C 2XIWA 2ZT9C 1AEXA 3S1MB 3WOFA 5C4ZA 1SXTA 1SMYD 1Y8OB 1G8ZD 4KD3A 4XYOA 4XDXA 1V1OA 1S5BD 3L7ZC 4TRDA 3F2UA 1HCZA 3OIQA 1CM9A 4G7ZC 1BR9A 2IT1A 2KEEA 4DNRB 1SEBD 2L12A 4K8IA 3W2DA 2F0EA 2F3VA 1Z47A 2D2CC 3X3NA 2QILA 3NBIA 2EDGA 3H6MA 4K2LA 2SNSA 1A3VA 1MSGA 4FVMA 4XTCS 3R2IA 1HUNA 3K57A 1JB3A 3NTIA 1KNEA 4FYDA 2NVTB 3MFGA 2QDBA 1I50B 5EPKA 1EY5A 5C0XI 3U9OA 2Z1CA 1AFPA 2M9VA 4HCEA 4A3MB 3A8KE 4NW2A 4HMIA 5K5PA 2AQ1B 1LACA 5J39A 1ILPA 3A8IE 4IUNA 4H13C 4C1NK 2HCCA 4YIJA 2WP8J 2K5QA 3M85A 1TS2A 2D5DA 4MN3A 4RHRA 3GTLB 1SE2A 1SDFA 2A6EC 5EPJA 2HDLA 3T4AC 1HA6A 2RSOA 2BDOA 2ZXRA 2PQEA 3BDLA 1W6JA 4KY6A 1WTOA 3M4YA 2ICEC 2R6GA 1KDBA 4RCOA 3GTPB 3A54A 4FF1A 2DNEA 1YNNC 1ICWA 4J6HA 1OXTA 3KLRA 3TMEA 3NE5B 3EJIA 2C5CA 3V2TA 4BS9A 1TQOA 3I91A 4OHJA 2NN6H 2EY5A 3NUCA 1V1PB 1Q1EA 2RDFA 1QCBD 5BN4A 2PNRC 1PLFA 4X3SA 3SEBA 2A74C 3I4LA 4FXDA 2IX3A 2Q8TA 4IUUA 2HQEA 1B44D 2A69D 4KKTA 4L8JA 1Y8NB 5CYUA 3K5NA 3T13A 2PCFB 2EJFC 3V05A 1PFMA 2JEAI 2B2YC 3NTHA 2A68C 3HG9A 5F2DA 2BA1A 2WKDA 1BDOA 2IPKD 2K28A 5E4XA 3LX0A 3TBIB 3I3CA 3J80L 2O4XA 5FO7B 3VA5A 1TWHB 3M3YB 1NR2A 3CKIB 4WRDA 1A3UA 4Q0FA 1D5XC 4CGYB 4RGNA 4FXGC 1ZEQX 2FMCA 5EBCA 2JSOA 1LTTD 1STYA 1B2TA 3VYSA 5IGEA 1ESRA 1JWMD 4IN3A 1JWSD 2PPBC 3Q0AA 3DEPA 3UI2A 5LHY1 5KIXA 2KCNA 3SHLA 4JK1C 5DM73 1Z7TA 2R93B 3MHBA 2E76C 1IKMA 3Q6SA 4CKEA 3VR5A 1BCPD 2J7ZA 5C4XB 1K8MA 1RODA 1MGSA 5I9PA 4KKSA 3R3OA 5M5XB 3PUWA 1F9SA 1PTOB 2E2HB 1WVLA 5CV4A 5E4WC 4ZYSA 2K1BA 5CV8A 1JORA 2F0TA 2KOLA 3GV6A 4IZ8A 5LL6X 2HCIA 2MUYA 2ENBA 1K8OA 3NHHA 3RD4A 3QG1A 3ZYYX 1GXDC 1LLRD 1UAPA 2F0MA 2NUCA 2ZXPA 1RKNA 1STHA 5C3WA 2BA0A 3E5SA 3HKZB 2B2VC 3KBGA 1TKWB 5KNCA 3CRKC 1OXVA 2BE5D 2LMCB 1QB5D 3C46A 3ITPA 5JEAJ 1DM0B 1DOLA 1TWFB 2G9DA 2K03A 2SNMA 2LY7A 4K5XA 3RZDB 4G4KA 1EWCA 5A35A 3JAML 3H0GB 1STBA 1QNUA 1HFGA 4C1NI 1GUSA 3S17B 2H1EA 3NXWA 3BYTB 5JVG3 3SE0A 3P20A 5T1IA 4XT3B 5EKIA 1TS3A 1SAPA 4E6IA 3E0JA 1ENFA 4IUPA 4ZUJA 2EXZA 1HTPA 3GTQB 4KJOA 4BA2I 1NUCA 4KI0A 4RKLA 1E2ZA 1CA5A 4HR7B 1WD1A 5JAVA 5KNDA 4K2KA 3Q24A 1O78A 2L55A 1SE4A 1EY6A 3P75A 1R4PB 4B9WA 3NPPA 3NQTA 2PZTA 3BYYB 2F0NA 1LV9A 1I6HB 2PMZB 1EIHA 1U9RA 2NN6I 5C3EB 3S2HB 2CW0D 3D3RA 1DOMA 1LABA 4LAAA 4H7BA 3QB3A 1L0XB 4FP5D 4C3HG 1GUWA 3GP7A 4KHZA 1Q1BA 3C1EA 1S5DD 5KNBA 3K6OA 1DZ1A 3BDOA 3TP7A 2A5HA 3NBHA 3I70A 1TY2A 3I4NB 2F0SA 2MGSA 2IL8A 1LTAD 3WDNA 2DN8A 5C3XA 3SR1A 3FEWX 1GOZA 4HCSA 1DD2A 1C4QA 4PQXA 1BCPF 4KTAA 3H94A 4I65A 5ELFA 3MEHA 1W6KA 2F0QA 5T1GA 2K01A 1OXUA 2K33A 5BN3A 3TZDA 3H09A 2F0KA 1O7LA 2R92B 1KLGD 4DGZA 1V8QA 1SSOA 2F0OA 5E3FA 1GHJA 3FKIB 2WIIB 1KDCA 3J7AF 1SYBA 5FO8B 1O80A 5ELCA 1WTWA 4C2MB 3AB9A 2A73B 3D4RA 3OWFA 1ENAA 3S1QB 1FNUA 3K5LA 2EY1A 2F0JA 5I2XA 3J80E 2NWGA 2CHBD 2WB1B 5IT9L 4C56C 1G2SA 2XSCA 4HAEA 5A2QE 2G9HD 3E6ZX 2JE6I 4H0LC 4QB4A 3T56B 4EQNA 4OO1H 3MXUA 1WTQA 1RDPD 3T53B 3K5OA 4UDUC 1RCVD 1CQFA 3SK4A 3W3AA 4M1UB 4O1NA 1QE6A 3PUZA 2F3WA 5CR3A 2OXPA 2AWOA 3MZ5A 3NWTA 1SNOA 4K6DA 4IFDI 2E75C 1K83B 1ML0D 1KAAA 4K8JA 3I90A 3RMHA 4L63B 4EQOA 3P7JA 1BUVT 5FKAC 2B2UC 3MA2B 5NUCA 5C6AA 3L9AX 1IW7C 2MJ8A 4QMGA 2A6HC 3NTKA 1M4VA 1CT1D 2JYOA 5CBEE 1EIGA 5G3LD 1LTGD 5FK9C 2AUKA 3SXHA 1Q8IA 2PZWA 1GJXA 3A7LA 3MXGA 2AQ2B 5FOBB 3Q23A 1BCPC 3BZDB 4ODGA 3C1FA 4C3JB 2HDMA 4QUFA 2EZVA 1NCVA 1KABA 4FNFA 2FFKB 3MTSA 2DNCA 3OHXC 1B53A 1PRTF 2KEDA 2LS01 3SVMA 3O13A 3I4MB 5C4JB 2YYZA 5DEHA 2NBFA 2N55A 3KF8A 2Z8LA 4DAPA 2Q8RE 4A3BB 1B3AA 4K5WA 2EY2A 1H9MA 3OSOA 4OIJA 2F0PA 1F2ZA 4CHTB 5KRUA 3QWNA 1AZPA 1C8CA 4GZYC 1EL0A 3JAME 1PTOH 4TQUS 4QCLA 3NWSA 4KKUA 4A3GB 2MPMA 3KLSX 5BN5A 3PIP3 4G57A 1I4RA 5CORA 4Q5VA 3GTKB 1SE3A 5COYA 1RHPA 2B2TA 4RGOS 4N9PA 1CQVA 4JBWA 1FYCA 1UNSA 5KYIA 1C48A 2K5WA 4OIKA 1FD7D 2WINB 2H4OA 4DXGA 4C3IG 2J4XA 3CRLC 4RGTA 3MFYA 5CV7A 3K59A 1A6XA 1EQVA 1QNKA 1KNAA 1PXUA 1EY4A 4IURA 1A15A 3T51B 1YNJD 5EGTA 4R9WA 1Z6HA 1ET9A 3MC0B 4NDXA 5M5WB 2DY8A 3FDTA 2PO4A 5M3FB 1JICA 5I9OA 4V190 2ID0A 2O5JC 4BA1I 5IGFA 3GTMB 5M5YB 3S15B 3PUXA 4KY7A 3BG3A 4F88A 1X3PA 1G6ZA 3WOEA 4RH6A 1LTBD 5A2QL 1Y69U 1F9PA 3DWAA 4NKLA 2KECA 1BO0A 5JEAH 1ZYRC 5G3LF 1PRTC 1STAA 4KY5A 4OGQC 1RJTA 3K7AB 2Z4IA 4OO1I 1HFNA 1AN8A 2E2DC 2M00A 2K7VA 1EQTA 2F0DA 4Y7NB 4X3KA 4ZUIA 2XNAC 1JOOA 2MP1A 2EJGC 2PYKA 3RUZA 5M9OA 1SYFA 1SJHD 2K32A 1TWAB 2L0CA 3PV0A 1QG7A 1TWGB 4C3HB 4X3TA 1GUTA 1Y8PB 3M4OB 1HHVA 1SNQA 3QO2A 4A3EB 1LO5D 3HEJA 3OMCA 3BDCA 2RBMA 2JA7B 3OPOA 4HEDA 1E2WA 2L1BA 1I4QA 4RHSA 3PUVA 1EU3A 5JJZA 4BY1B 1QJOA 1M8AA 3FRPB 1PZKD 1A2TA 1TU2B 1VF5C 4V0BA 2F0FA 2QCPX 2B39A 4FF2A 5IT9E 3G6JB 2XWBB 1TS5A 3VR4A 5J22A 4XQNA 4ZLTF 1B1ZA 1B9MA 3IFDA 5DM63 1G2TA 1ENCA 1V1PA 5I6YA 1RTOA 3TP8A 4QIWB 1I4GA 1QWYA 4ABNA 4HN7A 1IHZA 1BXTA 1B4OA 5I4DA 2KA7A 2B2YA 2EYJA 1F77A 3FPPA 3I72A 2BDNA 3OOCA 2DY7A 4HSPA 3VR3A 2R61A 3OMGA 2LKVA 3D4WA 3S16B 2JP1A 3SK8A 3VR2A 1EY9A 2QKIC 1WD0A 3OWEB 1CI3M 4LK1C 1NSNS 3QIAA 4IUQA 2KCCA 2B8GA 2Z4HA 3EA6A 3DEOA 2Y0SB 3DWPA 3TP5A 4ZKBB 5FO9B 2YU9B 3R93A 2SEBD 2A6ED 1EY8A 1SMYC 3HGBA 5D3IB 1II3A 2EYLA 5ELBA 2JA8B 4WORA 4NMZA 4IALA 1JOQA 2O5IC 4NP5A 1R4QB 2B2WC 3MAQA 5CC4A 5C4HA 1Y1VB 2EYOA 4IQZA 2Q8IB 4J8QA 2JA6B 1BF4A 3LWUA 5IODA 2EJMA 2WACA 3VR6A 1JWUD 5LL6S 1D1KA 1LT6D 4CJ0B 3VYRA 4G7HC 3K0YA 1MD2D 3U9SA 1H9JA 2VB2X 5FLXE 4DNTB 1U4MA 4MHEA 5CV6A 1G291 3L3OC 4A3IB 4A3KB 2RDHA 4K6LA 3EFXD 4L6TB 2F1MA 1H9KA 4XYQA 4CJ2C 2KQ3A 2CVRA 2SOBA 3Q22A 2C9OA 3PIO3 2RVLA 3GTJB 3R8BA 4HSVA 1GUOA 5JVH3 2KUMA 1S4ZA 2OF1A 3LNNA 1J9OA 4KN4C 4DN4M 2LFNA 1STGA 1PZID 1VF7A 3K5MA 2NVQB 2EE1A 1B9NA 2TSSA 3EROA 1TT2A 3ND8A 5C5MA 1I4XA 3S1NB 3D6WA 1IYVA 4R8IA 2B2VA 1BNZA 1STEA 3MWYW 3G7LA 3QJYA 4ULLA 2I46A 1H9RA 5J1ZA 4B08A 1TY0A 1OO9B 1XWEA 1WTXA 1FNVA 2XRSD 1D5ZC 3J7AV 3KK7A 3ONAB 1TR5A 1DXMA 2FJ2A 3M7GA 1I6VC 1DJRD 1XX8A 1DYQA 1ILQA 3DMUA 4K14A 5JOBA 2E2JB 1T5XD 5HURA 1SYCA 2QF7A 1UUPA 3HP3A 1JE4A 4ZK9B 3H91A 3R2TA 4U673 5IGBA 5IGGA 1IYUA 1E2VA 4RFBA 4PNYA 1SYDA 2XN9C 3M7NA 1NR4A 1ZXTA 4MIUA 3URYA 3MXPA 5EKKA 3RLFA 2PW5A 5D3DA 3OIPA 2NB0A 3TP6A 1NAPA 4BBRB 2A69C 4DFAA 3QOJA 3GD7A 2PW7A 5KEEA 2E2IB 1PTOD 1Q3LA 5IOCA 3SK5A 4DXFA 2F0WA 3BVGA 4C3IB 5IGDA 1TIID 1KLUD 1WTVA 1AZQA 2VNUD 3D31A 3OW7A 1CK1A 2O2LD 4ILWA 2L11A 3TSSA 3VA7A 1KTKA 3DWQA 2EPBA 3C3LA 1CA6A 1MI2A 2RKSA 3HOUB 1PYWD 1DCZA 1SNCA 1HRJA 1F2YA 2CQAA 1EEID 1CHQD 4FF3A 2SDFA 3HRZC 1PDQA 4F8MA 3V96A 3HOZB 1BCPB 3FPUB 1U4LA 4G7OC 4A3DB 1HTLD 3DUZA 3NSWA 2AQ3B 2FHTA 1R9TB 1CHPD 5I6WA 3ND9A 1EWHA 3AU7A 5CGKA 3CQZB 1WTRA 5K36G 1PFBA 1EFID 1TVXA 3N52A 2AWNA 1JOKA 4RA8A 5TSSA 1VCIA 1X32A 4EGVA 2XWJB 1EYCA 4DA2A 3DXJC 4KJNA 3BVMA 1EZ8A 5FLXL 4PMBA 4Z9CB 4QUCA 4OL7A 4A3FB 1HQMC 1ET6A 4QF4A 1SJED 3HS0C 5IGCA 2EYPA 2I07B 1HXYD 1WTPA 2F0UA 3J7YW 1V43A 2OT2A 2PZUA 4PMCA 1D6EC 4B9XA 1J8IA 4KK7A 4PV1C 2F0IA 3X3MA 1Q90A 1LTID 1JR0D 2AUJD 1X3QA 1L0YB 2EOTA 4IFDG 4RGMA 2L9HA 2BE5C 1FR3A 1A2UA 4ZQ3A 4CKBA 4BY7B 4UAIA 5HGTA 4CKCA 2FINB 1OXSC 5EQ0A 4BBSB 2WAQB 3D6CA 4FF4A 2B8FA 4K5VA 4DAVA 1F9RA 4ID6A 2ICIA 1VDZA 2B2UA 1HPCA 1I4PA 3TZUA 4EQPA 1GHKA 1JQYD 2QEJC 1VMPA 5IIFA 1AP0A 1A3TA 1PTOF 3I8ZA 3GV3A 3RZOB 1LT3D 3GTGB 1PMRA 3J81L 5JPMC 1LTRD 1ZKOA 1RD9D 3A55A 4I7ZC 3LWEA 2V4DA 5I2YA 2IWHA 2ZXOA 2EVBA 5C0XG 2RA4A 4X3UA 2VXWA 3VYUA 4RKBA 1BOSA 5CBAE 5EBDA 2TMPA 2IX0A 2CW0C 4DF7A 3IFTA 2NZ1D 1OXXK 5ELEA 1EOTA 4DK0A 2NVXB 1EY0A 1F2MA 1Q12A 2FMMA 1CTMA 1PRTB 1MSHA 1F9QA 2X6GA 5DAUA 1HUMA 2GA4B 4IUTA 4J1MA 1DONA 4ZKCB 5M3MB 2N88A 3HOWB 2R3ZA 2F4IA 4R8NA 1F2LA 3HOVB 4IUVA 3IAYA 2B63B 4DK1A 3EQLC 4CBVA 4C3JG 4U68A 2JXMB 5D14A 1TS4A 1KDAA 1IKLA 4FO2A 1XXGA 3FMCA 3S9WA 1IW7D 3DM1A 3NP8A 2A6HD 3I73A 2X69A 2K5DA 3KLSA 2KVMA 1VMCA 2D62A 5K36H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DOK A;  3DEP A;  4XDX A;  2RVL A;  3UI2 A;  4XT1 B;  1WTO A;  1X3P A;  1G6Z A;  3LWE A;  4HSV A;  2KUM A;  4QUC A;  4HCS A;  1AZP A;  2RA4 A;  4X3U A;  3F2U A;  1C8C A;  2VXW A;  1S4Z A;  1EL0 A;  1J9O A;  1F9P A;  1B4O A;  1QE6 A;  2B2W A;  2RSN A;  5EPL A;  1XYI A;  1CM9 A;  5EJW A;  2B2Y A;  4DN4 M;  5CBA E;  1Q3L A;  2KEE A;  1ICW A;  1HFG A;  2KEC A;  1BO0 A;  2L12 A;  5T1G A;  1WTP A;  2BDN A;  2K01 A;  5AFW A;  1ML0 D;  2H1E A;  2DY7 A;  1RJT A;  3I90 A;  2NZ1 D;  2EE1 A;  3P7J A;  3TZD A;  3I91 A;  2B2U C;  1IKM A;  1E0B A;  1BBX C;  2MPM A;  2JP1 A;  3Q6S A;  1J8I A;  1EOT A;  5T1I A;  4XT3 B;  5EKI A;  1HFN A;  2MJ8 A;  1WD0 A;  1SAP A;  5COR A;  1U4P A;  2FMM A;  2JYO A;  3D6W A;  4O42 A;  1EQT A;  1RHP A;  5COY A;  4IUP A;  1WTV A;  1IL8 A;  5CBE E;  2B2T A;  1MSH A;  1O7Z A;  1SSO A;  1F9Q A;  2J7Z A;  1PLF A;  2B2V A;  4ZAI A;  4R8I A;  4IUQ A;  1AZQ A;  1BNZ A;  2X6G A;  1ROD A;  1MSG A;  1HUM A;  1MGS A;  3DEO A;  1X3Q A;  4X3S A;  4X3K A;  4ZKB B;  3MWY W;  3G7L A;  2L11 A;  2EOT A;  2MP1 A;  4IUT A;  1EIG A;  1PFN A;  1DON A;  4ZKC B;  3R93 A;  1HUN A;  1B50 A;  1CA5 A;  2L9H A;  2EPB A;  1WD1 A;  2Q8T A;  2N88 A;  5D65 A;  1CA6 A;  1KNE A;  2R3Z A;  3KBX A;  4IUU A;  1MI2 A;  1F9S A;  2L4N A;  1QG7 A;  4OIK A;  5CMD A;  1WTX A;  4X3T A;  4LMQ D;  1F2L A;  1O80 A;  4IUV A;  1WTW A;  1HHV A;  3ONA B;  4UAI A;  1HRJ A;  5EPK A;  3QO2 A;  1WVL A;  2FJ2 A;  5E4W C;  2B2W C;  1XX8 A;  1LV9 A;  1PFM A;  2FIN B;  5DNF A;  2K1B A;  3TN2 A;  1QNK A;  2B2Y C;  1KNA A;  2KOL A;  3GV6 A;  5EQ0 A;  4RAU C;  4HED A;  2NYZ D;  4U68 A;  1EIH A;  2HDM A;  2L1B A;  2SDF A;  4QUF A;  1ILQ A;  1NCV A;  1RTN A;  2HUG A;  2K28 A;  5D14 A;  1PDQ A;  4IUR A;  1A15 A;  4NW2 A;  5E4X A;  2HCI A;  3I3C A;  2FFK B;  5JJZ A;  3MTS A;  1BF4 A;  4R9W A;  2X6L A;  1DOM A;  1F9R A;  1U4L A;  2K04 A;  3FPU B;  3KUP A;  4OIJ A;  1ILP A;  1IKL A;  1B53 A;  1M8A A;  2KED A;  4CJ1 B;  3IL8 A;  3HP3 A;  2K05 A;  2B2U A;  1O7Y A;  2FHT A;  4CJ0 B;  3SVM A;  1NR2 A;  2NWG A;  1JE4 A;  3DM1 A;  1GUW A;  2M2L A;  4RWS C;  4ZK9 B;  3H91 A;  1G91 A;  1VMP A;  2B2T C;  2HCC A;  2B2V C;  1U4M A;  2D9U A;  4MHE A;  2DY8 A;  1G2S A;  3FDT A;  2N55 A;  1WTR A;  2XIW A;  4HAE A;  1PFB A;  1DZ1 A;  2X69 A;  1JIC A;  1NR4 A;  1AP0 A;  1TVX A;  3N52 A;  2KVM A;  2Q8R E;  1U4R A;  4ZLT F;  1B3A A;  1ZXT A;  4MN3 A;  4RA8 A;  3I8Z A;  1WTQ A;  1B2T A;  3IFD A;  1SDF A;  1X32 A;  3GV3 A;  5EPJ A;  1G2T A;  1VMC A;  2HDL A;  4CJ2 C;  1HA6 A;  2MGS A;  1ESR A;  2IL8 A;  1DOL A;  2RSO A;  1RTO A;  2CVR A;  2K03 A;  1NAP A; 
#chains in the Genus database with same CATH topology
 3CU7 A;  4KV6 A;  4XT1 B;  4RCN A;  3PO2 B;  4WFN 3;  4H44 C;  4PMW A;  5ELD A;  1TWC H;  1X54 A;  3I4O A;  3MVV A;  2OEO A;  5C5L A;  3ZJY C;  3KJP A;  5HGQ A;  3NK9 A;  3TQY A;  4HJ9 A;  1EIY B;  4DK6 C;  1K28 A;  4R4Q A;  5EPL A;  2EYM A;  2K5V A;  1GM5 A;  4HTH A;  2MO0 A;  4QY7 A;  5AFW A;  1BQQ T;  3M4Q A;  2MHV A;  2VZA A;  1SFO B;  5GAE C;  3KLW A;  5CV5 A;  4KD4 A;  5E1F A;  1BBX C;  4S3S A;  3CC4 A;  4L5S A;  4Y52 H;  3NBH B;  3TRZ A;  4KMU C;  3A8J E;  4DR1 L;  5JJL A;  1IL8 A;  4ZAI A;  1O7Z A;  2E2J H;  1S5C D;  1FNW A;  4NPS A;  4F87 A;  1PTO C;  1ONL A;  4TKO B;  2JEB I;  3S1R H;  5J3B A;  1B50 A;  4JOI A;  2I5H A;  1CUK A;  1CKN A;  5D65 A;  1IZ6 A;  4NXM L;  2L4N A;  1AW7 A;  2IHE A;  4YCV A;  2HD3 A;  4OO1 G;  4A93 B;  1HA5 A;  4P2C B;  4IFD H;  2BOS A;  3TDQ A;  1XNR L;  2L5T A;  2VB3 X;  5GAD C;  1ASZ A;  3MXN A;  2R7Z H;  2F03 A;  2F4V Q;  3H3V C;  2J0T D;  2LXK A;  3TN2 A;  3CHB D;  4KHP L;  4RAU C;  2VQE L;  2NYZ D;  1H9S B;  3PF4 A;  1SBB B;  4IPH A;  1WCM B;  4ZRZ A;  4DV1 L;  1PA6 A;  2HUG A;  4AYB B;  2NTS A;  5ISR A;  2JA5 B;  3KUP A;  2QGQ A;  3J81 c;  2K6A A;  3GO5 A;  3IL8 A;  4OEL B;  2KJX A;  2K05 A;  1O7Y A;  4MNO A;  1IBL L;  2M2L A;  4IJH A;  4EVO A;  1G91 A;  1SYG A;  1OTC A;  4DUZ Q;  2UXD L;  1UE5 A;  2UXB L;  4DPG A;  1Y1W B;  3GTO B;  1IBK Q;  2UUC L;  1JCK B;  1YNN D;  2KHS A;  1S5F D;  3P1H A;  2JJQ A;  1LTS D;  4P74 A;  4DAY B;  3KOJ A;  4XXE A;  4JI6 L;  2BCO A;  4A3J B;  2IJ0 A;  4N9T A;  1X3E A;  1LT5 D;  1GUG A;  1B7Y B;  5GRO A;  3VYT A;  3CCS A;  5CV9 A;  2QA4 A;  1D2B A;  3IKJ A;  4WJW A;  1XYI A;  5EJW A;  2NTT A;  4OWT B;  3PQI A;  1EYD A;  1VQA A;  4IO9 A;  2VQF Q;  3T16 A;  5C0X H;  1SND A;  5EKL A;  5HY6 A;  1EU4 A;  1JJ2 A;  3FP9 A;  3PO3 B;  3S1M H;  3KYH C;  3NQI A;  5KGU A;  2EYH A;  4GOP C;  4XQJ A;  1BBW A;  3S2D B;  1HNW Q;  4HIO A;  5C44 B;  4TSS A;  2A68 D;  1VS0 A;  3HOY B;  1ESF A;  2R93 G;  2NVY B;  1GKH A;  4LJZ C;  3QOL A;  2VUM B;  3KBX A;  2WAQ E;  1MBY A;  1CZG A;  4JC0 A;  3A56 A;  4LMQ D;  3FVQ A;  2PI2 E;  4YWK A;  2F0H A;  4IFD J;  5DNF A;  1SRO A;  2XRQ D;  1SYE A;  2JA7 G;  1NMF A;  5C4X G;  3BS1 A;  4DR5 L;  2IW3 A;  3KDF A;  4KHV A;  2WKC A;  4BWG B;  3HOX B;  1TWC B;  1ZYR D;  5JPN C;  1PRT D;  4X66 Q;  2OTL A;  2X6L A;  4CDD C;  4A3F H;  4CJ1 B;  4L5Q A;  1CZW A;  1EYA A;  1NNX A;  3PMF A;  1S5E D;  1PHJ A;  4HMJ A;  1YJ9 A;  2ATW A;  1YJW A;  3U4V A;  1EEF D;  3A7A B;  1FVI A;  1U4R A;  4POG A;  1I50 H;  3GQB A;  4A75 A;  1VQ4 A;  1SNM A;  4A3C H;  1D1I A;  1I4H A;  1DOK A;  1QOH A;  2CWP A;  3OTO Q;  3J81 E;  3S1R B;  4ME5 A;  4DU9 A;  3HZX A;  1XMQ L;  1H9S A;  5EAY A;  4A3M H;  4DR7 Q;  1FGB D;  2F0V A;  1KRS A;  4YY3 L;  4GS3 A;  1D5M C;  4B3M L;  3HKZ G;  2RSN A;  2B2W A;  1LT4 D;  1XTC D;  2VS1 A;  3N6R A;  2K5N A;  2NN6 G;  4LFB Q;  2R7Z B;  1QIL A;  3PUY A;  1STN A;  1YNJ C;  1JC7 A;  1Y14 B;  2CH4 W;  5C0X J;  1HQR D;  1E0B A;  3S14 B;  4XQQ A;  2EY6 A;  4BBS H;  1EY7 A;  1U4P A;  3GTL H;  4O42 A;  3AQQ A;  2F0L A;  3A5Z B;  4ALP A;  1SNP A;  1UEA B;  3E9H A;  3RLO A;  4F7X A;  3EVQ A;  4DAY A;  3ERQ A;  4DAM A;  5KYL A;  2MFI A;  1PZJ D;  1PFN A;  3DHQ A;  2RQX A;  4H02 A;  1I3Q B;  3D8G A;  2RDG A;  1EZ6 A;  4HJ5 A;  3UDG A;  4WJ3 M;  5CMD A;  4LF7 L;  3CMA A;  3D4D A;  3BVZ A;  2JA8 G;  3SK6 A;  3AMU A;  1N33 Q;  1EFW A;  4PZ7 A;  4JV5 L;  2XVS A;  3STB C;  1RL2 A;  2K52 A;  1UWV A;  1CFM A;  3RZO H;  1GUN A;  1PH5 A;  4FXK C;  2GVA A;  1Y1V G;  2K50 A;  3C2P A;  1K0S A;  1RTN A;  4JI3 Q;  1XNQ Q;  1Q7Y C;  2EYF A;  2K04 A;  1RF2 D;  2MNA A;  1T5E A;  1YZ6 A;  4KN7 C;  4XIG S;  4M8A A;  1V9P A;  2WV6 D;  2UU9 L;  3I2Z A;  4RWS C;  2IX1 A;  5JEA G;  2F0G A;  2B2T C;  1A0I A;  2D9U A;  3SDZ A;  3F8T A;  3K58 A;  2E74 C;  2XIW A;  4A3I G;  4A3K G;  2ZT9 C;  1BBU A;  2KCM A;  1AEX A;  3S1M B;  3WOF A;  5FJ8 H;  5C4Z A;  1SXT A;  5C3E G;  1SMY D;  3J81 j;  1L1O B;  1Y8O B;  1G8Z D;  4KD3 A;  4DR3 L;  1KXL A;  4XYO A;  4XDX A;  3A0J A;  1V1O A;  3GDE A;  1S5B D;  3L7Z C;  4TRD A;  4ZCK A;  1I94 L;  1VQI A;  3F2U A;  1HCZ A;  4DR4 L;  3OIQ A;  1CM9 A;  1HR0 W;  4DNI A;  4G7Z C;  1BR9 A;  1TWH H;  2IT1 A;  2KEE A;  4DNR B;  3M3Y H;  5JJI A;  1SEB D;  2L12 A;  4IOC A;  4K8I A;  1XPU A;  3HOV H;  4A3L H;  3W2D A;  2F0E A;  2F3V A;  3ERS X;  1Z47 A;  4IJL A;  1LUZ A;  2D2C C;  3X3N A;  2QIL A;  3NBI A;  2EDG A;  1M90 C;  3CCM A;  1A63 A;  3OYY A;  1VQH A;  3H6M A;  4K2L A;  2SNS A;  3HKS A;  1A3V A;  1MSG A;  3J81 i;  4FVM A;  4P71 A;  4LUV A;  4XTC S;  3R2I A;  1X9N A;  1KD1 C;  1HUN A;  3K57 A;  1JB3 A;  3NTI A;  1AE3 A;  1KNE A;  1CSP A;  4FYD A;  2NVT B;  3MFG A;  4A76 A;  1VQP A;  4AYB E;  2UXC Q;  2QDB A;  2IY5 B;  1KHI A;  1I50 B;  3LGJ A;  2R92 G;  5EPK A;  2OTJ A;  1EY5 A;  5C0X I;  3U9O A;  2Z1C A;  5GAH C;  1AFP A;  2M9V A;  4JI5 Q;  4HCE A;  4A3M B;  3A8K E;  2CCZ A;  4NW2 A;  4HMI A;  5K5P A;  2AQ1 B;  3PO2 H;  3ULL A;  1LAC A;  2YV5 A;  5E7N A;  3FKI G;  4P75 A;  5J39 A;  1ILP A;  5LMN W;  5C4X H;  3A8I E;  5LMU Q;  3RN2 A;  4IUN A;  4H13 C;  4C1N K;  2MQH A;  3CCL A;  4P73 A;  3UE0 A;  2HCC A;  4YIJ A;  5AJ3 Q;  2WP8 J;  2K5Q A;  3M85 A;  1TS2 A;  2D5D A;  4X64 L;  3TEH B;  5JJK A;  2E2H H;  4MN3 A;  4RHR A;  3GTL B;  1SE2 A;  1SDF A;  2A6E C;  5EPJ A;  2HDL A;  3T4A C;  4UPA A;  1YIJ A;  1HA6 A;  3UDX A;  2RSO A;  2BDO A;  2ZXR A;  4DV3 L;  2PQE A;  3BDL A;  4JPB W;  1W6J A;  4KY6 A;  4QJF A;  1WTO A;  3M4Y A;  2ICE C;  2B29 A;  2R6G A;  1KDB A;  4RCO A;  3GTP B;  1KL9 A;  3A54 A;  2WB1 G;  2UUB L;  4FF1 A;  2DNE A;  1SR3 A;  1YNN C;  1ICW A;  4J6H A;  1OXT A;  3KLR A;  3TME A;  3NE5 B;  3EJI A;  2C5C A;  3CCV A;  1VQ6 A;  2RCN A;  3V2T A;  2IHF A;  1J5E Q;  4BS9 A;  1TQO A;  3I91 A;  2WFW A;  4OHJ A;  2NN6 H;  4JI7 Q;  2EY5 A;  4BXX G;  3NUC A;  1V1P B;  1Q1E A;  2RDF A;  1EYG A;  1QCB D;  1WI5 A;  1L1O A;  5BN4 A;  2PNR C;  1PLF A;  4X3S A;  1TWF H;  3RZD H;  3SEB A;  1FJG Q;  1IXR A;  2A74 C;  1PH8 A;  3I4L A;  4GN3 B;  4FXD A;  2IX3 A;  2Q8T A;  1VQC A;  1Q46 A;  3H0G H;  4IUU A;  3HOU G;  2HQE A;  1W2B A;  1B44 D;  2A69 D;  4KKT A;  4LF4 Q;  4L8J A;  3GTO H;  1Y8N B;  2Q2I A;  5CYU A;  3K5N A;  3T13 A;  2AHO B;  2PCF B;  2EJF C;  3OW2 A;  3S17 H;  1HNW L;  3V05 A;  1PFM A;  1G6P A;  2JEA I;  2B2Y C;  1SRU A;  3L0O A;  1PV4 A;  3G4S A;  3NTH A;  2A68 C;  4MZ9 A;  3HG9 A;  5F2D A;  2BA1 A;  2CFM A;  2WKD A;  1BDO A;  2DJF C;  2IPK D;  2K28 A;  5E4X A;  3AEV A;  3LX0 A;  3TBI B;  3I3C A;  2ZJR A;  3J80 L;  3HOZ G;  2O4X A;  4P72 A;  5FO7 B;  2A8V A;  3G48 A;  4GKJ Q;  2RF4 A;  3VA5 A;  5IYB G;  1TWH B;  4GKK Q;  1YHQ A;  3M3Y B;  1NR2 A;  3CKI B;  4WRD A;  3CCQ A;  1A3U A;  4Q0F A;  1D5X C;  4CGY B;  4RGN A;  4FXG C;  1ZEQ X;  4LUZ A;  2FMC A;  5EBC A;  4MTN A;  2JSO A;  1LTT D;  4IPC A;  1N32 L;  1STY A;  2AKW B;  2Z6K A;  1B2T A;  3PO3 H;  1WTH A;  3VYS A;  5BR8 L;  4HIK A;  5IGE A;  1ESR A;  1JWM D;  2XGT A;  3JC6 6;  1JWS D;  4IN3 A;  2PPB C;  3Q0A A;  1I6H H;  1AH9 A;  3DEP A;  1SMX A;  3UI2 A;  5LHY 1;  5KIX A;  2KCN A;  4L5T A;  3S2H H;  3I4M G;  3SHL A;  4JK1 C;  2NVY H;  2Z0S A;  5DM7 3;  4K0K Q;  1Z7T A;  2R93 B;  2EXD A;  2NZO A;  4A3B G;  3MHB A;  1HNZ Q;  4B3R Q;  3ULJ A;  2E76 C;  1NMG A;  3OTO L;  1IKM A;  4HIM A;  2OCE A;  3Q6S A;  3AYH B;  1NBW A;  3T1Y Q;  4CKE A;  1XTD A;  1PH6 A;  1W3S A;  1X55 A;  3VR5 A;  3HOX H;  1BCP D;  2YTX A;  2J7Z A;  3I4N H;  5C4X B;  1K8M A;  5IWA Q;  1ROD A;  1MGS A;  2PI2 A;  5I9P A;  4LFB L;  4KKS A;  3R3O A;  1K0R A;  4JI0 Q;  5M5X B;  2OWO A;  4JI1 L;  3PUW A;  3ULP A;  1F9S A;  3CC2 A;  4A3G G;  2DUD A;  1PTO B;  1YJN A;  2E2H B;  4I7A A;  1WVL A;  5CV4 A;  5E4W C;  4ZYS A;  2K1B A;  5CV8 A;  1JOR A;  2F0T A;  2KOL A;  3GV6 A;  4IZ8 A;  4GNX A;  5LL6 X;  2NZH A;  2HCI A;  2MUY A;  2ENB A;  1K8O A;  3NHH A;  3RD4 A;  3QG1 A;  3ZYY X;  1GXD C;  1X6O A;  1LLR D;  1UAP A;  1YVC A;  2F0M A;  2ZM6 Q;  2NUC A;  4OWX B;  1N33 L;  5IYC G;  2ZXP A;  3E9I A;  1RKN A;  1STH A;  3U58 A;  5C3W A;  2BA0 A;  3E5S A;  3HKZ B;  1X56 A;  2B2V C;  3KBG A;  4IPD A;  3FKI H;  4GLX A;  5GAG C;  2E8G A;  5IP7 G;  4NXN L;  1TKW B;  4JI3 L;  3S14 H;  3VDY A;  2N3S A;  5KNC A;  3CRK C;  1OXV A;  2BE5 D;  2LMC B;  1QB5 D;  4C2M H;  4X65 Q;  3C46 A;  1QVF A;  3ITP A;  1N34 Q;  5JEA J;  1DM0 B;  3K8A A;  1DOL A;  1TWF B;  2G9D A;  2K03 A;  2SNM A;  2LY7 A;  3KF6 A;  2KBN A;  4K5X A;  4YCW A;  3RZD B;  4G4K A;  1EWC A;  5A35 A;  4J15 A;  3JAM L;  4OON A;  3H0G B;  1X3F A;  1I3Q H;  1YHA A;  3S1Q H;  1STB A;  4JI4 Q;  3F2B A;  3TS0 A;  5M3F G;  1QNU A;  1WYD A;  1HFG A;  2Z9H A;  4C1N I;  1GUS A;  3S17 B;  2H1E A;  3I56 A;  3NXW A;  3BYT B;  5JVG 3;  1HZA A;  3SE0 A;  3P20 A;  4DR2 Q;  5T1I A;  4XT3 B;  5EKI A;  1TS3 A;  1SAP A;  4E6I A;  3E0J A;  1ENF A;  2ASB A;  4IUP A;  4ZUJ A;  4B3T L;  2EXZ A;  1HTP A;  3GTQ B;  4KJO A;  1U5K A;  1PYB A;  3PF5 A;  4BA2 I;  1NUC A;  4BXX H;  4KI0 A;  2UUA L;  4RKL A;  1E2Z A;  1CA5 A;  4GOP B;  4HR7 B;  1WD1 A;  5JAV A;  3J80 c;  2JQO A;  3HOW G;  5KND A;  4K2K A;  1HZ9 A;  3Q24 A;  1O78 A;  1HR0 Q;  4DR6 Q;  4LNQ A;  1VQK A;  2L55 A;  1SE4 A;  1EY6 A;  3P75 A;  1R4P B;  4B9W A;  3NPP A;  3NQT A;  2PZT A;  3BYY B;  2F0N A;  1VQN A;  1K83 H;  1LV9 A;  2HT1 A;  1I6H B;  2PMZ B;  1SLJ A;  1EIH A;  1HNX Q;  1U9R A;  2NN6 I;  5C3E B;  3S2H B;  2CW0 D;  3D3R A;  1DOM A;  1LAB A;  4LAA A;  4H7B A;  3QB3 A;  1L0X B;  4FP5 D;  4C3H G;  1GUW A;  1PH3 A;  3GP7 A;  4KHZ A;  1Q1B A;  1HJP A;  3C1E A;  4A3E G;  2ZTD A;  1S5D D;  1PH2 A;  5KNB A;  3K6O A;  3M9B A;  1DZ1 A;  3BDO A;  2R7F A;  3BJU A;  3TP7 A;  2D0O A;  2A5H A;  1EIF A;  3NBH A;  3I70 A;  1TY2 A;  3I4N B;  2F0S A;  2MGS A;  2IL8 A;  4BY1 G;  5GQO A;  1LTA D;  3WDN A;  1C7Y A;  4DV5 Q;  1EOV A;  2DN8 A;  4C3J H;  5C3X A;  4B3S Q;  3QR8 A;  4KLK A;  3SR1 A;  3FEW X;  1GOZ A;  4HCS A;  5IP9 G;  1DD2 A;  5LMN Q;  1C4Q A;  4PQX A;  2RHQ B;  1BCP F;  4KTA A;  3H94 A;  4X62 L;  4I65 A;  3S24 A;  5ELF A;  1S3O A;  4OXP A;  2KHJ A;  3MEH A;  1W6K A;  1IBM Q;  2NVT H;  2F0Q A;  2H5X A;  5T1G A;  2K01 A;  4LF9 L;  3I4M H;  5FLM G;  1OXU A;  1XMO Q;  2K33 A;  5BN3 A;  3TZD A;  4L5R C;  3H09 A;  2F0K A;  3T1H Q;  1O7L A;  1PH9 A;  2R92 B;  4A3B H;  1KLG D;  3J7Z C;  4DGZ A;  1IYJ B;  1V8Q A;  1SSO A;  1J6Q A;  2F0O A;  5E3F A;  4AIM A;  1NY4 A;  4DV4 Q;  1YI2 A;  4GN5 A;  1FL0 A;  1B70 B;  3HFZ B;  1GHJ A;  3FKI B;  2WII B;  1KDC A;  3F2D A;  5ELO A;  1SYB A;  3KF8 B;  3J7A F;  4JYA L;  5FO8 B;  1O80 A;  5ELC A;  4GN4 B;  1WTW A;  4C2M B;  3TS2 A;  3AB9 A;  1VQM A;  4LF8 Q;  2K75 A;  3G6E A;  2A73 B;  3EIV A;  1E1T A;  2C35 B;  2Y0S G;  1WCM G;  3D4R A;  3GTK H;  3OWF A;  1ENA A;  3S1Q B;  1YNX A;  1FNU A;  3K5L A;  3GTP H;  2EY1 A;  2F0J A;  2N78 A;  5I2X A;  1Z9F A;  3J80 E;  1L2F A;  2NWG A;  3E3X A;  2CHB D;  2WB1 B;  5IT9 L;  4C56 C;  4DR1 Q;  3JAM c;  1G2S A;  2XSC A;  4HAE A;  5A2Q E;  4PZ6 A;  2G9H D;  3E6Z X;  4JVZ A;  1K8A C;  1PFS A;  2JE6 I;  4H0L C;  4QB4 A;  3T56 B;  4EQN A;  4OO1 H;  3MXU A;  1WTQ A;  1RDP D;  2EQS A;  3T53 B;  1Q82 C;  3A74 A;  2JA6 G;  3MEF A;  4LWC A;  3K5O A;  1YIT A;  4UDU C;  4GKJ L;  5IP7 H;  1RCV D;  4A3J G;  1XNR Q;  1CQF A;  3SK4 A;  4DUY Q;  2PNH A;  3ER0 A;  3W3A A;  3RR5 A;  2KEN A;  4M1U B;  2DJG C;  2N49 A;  4O1N A;  1QE6 A;  3PUZ A;  1QUQ B;  4DV0 L;  2F3W A;  5CR3 A;  4KHP Q;  2VQE Q;  2OXP A;  2AWO A;  3MZ5 A;  3NWT A;  4DV1 Q;  1SNO A;  4K6D A;  4IFD I;  2E75 C;  1K83 B;  1ML0 D;  1KAA A;  4K8J A;  3I90 A;  3RMH A;  4L63 B;  4EQO A;  3P7J A;  1BUV T;  1JB7 A;  5FKA C;  5M5W H;  2B2U C;  2E5L Q;  5M3F H;  3MA2 B;  5NUC A;  5C6A A;  1IBL Q;  3L9A X;  1IW7 C;  2MJ8 A;  4QMG A;  2A6H C;  1JE5 A;  3NTK A;  1M4V A;  1CT1 D;  1JMC A;  2JYO A;  1VQB A;  5CBE E;  2HHH Q;  2UXD Q;  2UXB Q;  3UDI A;  4LUO A;  1K73 C;  4JI8 L;  3CD6 A;  5M5Y H;  2UUC Q;  3S15 H;  1EIG A;  5G3L D;  3HOY G;  2LXJ A;  1LTG D;  5FK9 C;  2AUK A;  1PVO A;  3SXH A;  3ICE A;  1Q8I A;  4JI6 Q;  2PZW A;  3CC7 A;  1GJX A;  3A7L A;  2RCF A;  3MXG A;  2Q2H A;  2AQ2 B;  5FOB B;  1CKM A;  3Q23 A;  1NE3 A;  1BCP C;  3BZD B;  4ODG A;  4YCU A;  1X65 A;  3K7A H;  3C1F A;  2F3I A;  4C3J B;  2HDM A;  4QUF A;  2EZV A;  1NCV A;  1KAB A;  4FNF A;  3HKZ E;  2OQ0 A;  2FFK B;  3MTS A;  2DNC A;  3OHX C;  1KC8 C;  1B53 A;  4R1J A;  1PRT F;  2KED A;  1V1Q A;  1GD7 A;  2LS0 1;  3SVM A;  3O13 A;  3TRE A;  3I4M B;  2R93 H;  2AMC B;  5C4J B;  2YYZ A;  3BZK A;  5DEH A;  2NBF A;  2N55 A;  1EUJ A;  1ASY A;  3KF8 A;  1TWG H;  2Z8L A;  4DAP A;  2Q8R E;  4C3H H;  1XPO A;  4A3B B;  1B3A A;  4K5W A;  2EY2 A;  1H9M A;  3OSO A;  1HZB A;  2I5M X;  1FGU A;  4OIJ A;  2JA7 H;  2F0P A;  3K7U C;  1EQQ A;  1F2Z A;  4CHT B;  1E1O A;  5KRU A;  4JBM A;  3QWN A;  4JBJ A;  1AZP A;  5M5X H;  1C8C A;  2F4V L;  4BY1 H;  4GZY C;  1EL0 A;  3JAM E;  2F52 A;  3J80 i;  4DR5 Q;  3DM3 A;  1KIX A;  1PTO H;  4TQU S;  4PZ8 A;  4QCL A;  4CDE C;  4X65 L;  3AFQ A;  3NWS A;  1JJC B;  4KKU A;  4A3G B;  2MPM A;  3KLS X;  5BN5 A;  3PIP 3;  3CCR A;  1VQO A;  4G57 A;  4BBR G;  1I4R A;  5COR A;  4Q5V A;  3GTK B;  4R4T A;  1SE3 A;  5COY A;  1RHP A;  4DUZ L;  2B2T A;  4RGO S;  4JI4 L;  3H3V H;  4N9P A;  4AQY Q;  1IBK L;  3CP0 A;  1CQV A;  4JBW A;  1FYC A;  1UNS A;  2PMZ E;  5KYI A;  2N8N A;  4OX9 Q;  1C48 A;  2K5W A;  4OIK A;  3B6Y A;  1A62 A;  1FD7 D;  2WIN B;  1QUQ A;  2H4O A;  1VQD A;  1XMQ Q;  4DXG A;  4C3I G;  2J4X A;  3CRL C;  4RGT A;  3MFY A;  5CV7 A;  4EQ5 A;  5IT9 c;  4B3M Q;  3K59 A;  1A6X A;  1EQV A;  1QNK A;  1KNA A;  1PXU A;  1DGS A;  3S16 H;  1LM0 A;  1EY4 A;  4IUR A;  1A15 A;  3T51 B;  1YNJ D;  5EGT A;  3I55 A;  2VQF L;  2K5H A;  4R9W A;  1K8G A;  1JT8 A;  1Z6H A;  1QVG A;  1ET9 A;  3MC0 B;  1CKN B;  2YU9 H;  4HID A;  4NDX A;  4DV6 Q;  5M5W B;  2DY8 A;  3FDT A;  4LFC Q;  2HQL A;  2PO4 A;  4GNX C;  5M3F B;  1JIC A;  2JA8 H;  4JOI C;  5I9O A;  4V19 0;  4DV7 Q;  2ID0 A;  2O5J C;  4BA1 I;  5IGF A;  3FHW A;  4LF7 Q;  3GTM B;  3GTQ H;  3S15 B;  5M5Y B;  4X6A H;  3PUX A;  4A3D G;  1NJI C;  1Y1V H;  4KY7 A;  3BG3 A;  4A4I A;  1X3P A;  5DLQ E;  4F88 A;  4JV5 Q;  1G6Z A;  3WOE A;  4RH6 A;  1VQF A;  1LTB D;  4JCV E;  5A2Q L;  1Y69 U;  1F9P A;  3CPW A;  3DWA A;  1D7Q A;  4NKL A;  2KEC A;  1BO0 A;  5JEA H;  1ZYR C;  5G3L F;  4JI2 Q;  4X66 L;  1PRT C;  1STA A;  4KY5 A;  4OGQ C;  1RJT A;  3K7A B;  4A3I H;  4A3K H;  2GN5 A;  2Z4I A;  4OO1 I;  1HFN A;  1AN8 A;  1E3P A;  2E2D C;  5C3E H;  2M00 A;  2K7V A;  1EQT A;  2F0D A;  1C9O A;  4A3F G;  2Q2T A;  4Y7N B;  3RN5 A;  4RG1 A;  4X3K A;  2ALY B;  2XNA C;  1JOO A;  4ZUI A;  2MP1 A;  2EJG C;  2PYK A;  3GTJ H;  3RUZ A;  5M9O A;  1PH1 A;  3CXC A;  1SYF A;  1SJH D;  2K32 A;  1TWA B;  2L0C A;  3PV0 A;  1QG7 A;  2PQA B;  1TWG B;  3JAM i;  4C3H B;  4X3T A;  1GUT A;  1Y8P B;  1NTG A;  3M4O B;  1HHV A;  4DKA C;  4DR7 L;  1SNQ A;  3QO2 A;  4AH6 A;  4A3E B;  1LO5 D;  4POF A;  3HEJ A;  3OMC A;  3BDC A;  4DR4 Q;  2RBM A;  2JA7 B;  2NVQ H;  4TVA B;  3OPO A;  4HED A;  1E2W A;  2L1B A;  1I4Q A;  4A3M G;  2WB1 E;  1Q86 C;  4RHS A;  2XTI A;  3PUV A;  4IPG A;  4APV A;  1EU3 A;  5JJZ A;  4BY1 B;  1QJO A;  3I7F A;  4LF5 Q;  3S1N H;  1M8A A;  4RMF A;  3FRP B;  4LFA Q;  1PZK D;  1CSQ A;  1A2T A;  1TU2 B;  1VF5 C;  3BU2 A;  4BY7 G;  4V0B A;  2F0F A;  2QCP X;  4LF8 L;  2B39 A;  4FF2 A;  1Q8K A;  5IT9 E;  3G6J B;  1O7I A;  1EQR A;  2XWB B;  4BBS G;  2FXQ A;  1TS5 A;  2WAQ G;  4ME3 A;  3VR4 A;  1HH2 P;  4ZLT F;  1B1Z A;  5J22 A;  4XQN A;  1B9M A;  2RHS B;  2R92 H;  3IFD A;  5DM6 3;  1G2T A;  1ENC A;  1V1P A;  1BKB A;  3KDF B;  5I6Y A;  1RTO A;  3TP8 A;  4QIW B;  1I4G A;  1A8V A;  1B3Q A;  1S40 A;  1QWY A;  4ABN A;  4HN7 A;  1IHZ A;  1BXT A;  3BZC A;  1B4O A;  3D0F A;  5I4D A;  1UE6 A;  2KA7 A;  3CCE A;  2B2Y A;  2EYJ A;  1F77 A;  3FPP A;  3I72 A;  2ZJP A;  2BDN A;  3OOC A;  1XNQ L;  2DY7 A;  4HSP A;  3VR3 A;  2R61 A;  3OMG A;  4DV2 Q;  2LKV A;  1QVC A;  3AFP A;  3D4W A;  3S16 B;  2JP1 A;  3SK8 A;  3VR2 A;  4R4C A;  4YHH Q;  4DUY L;  1EY9 A;  2QKI C;  1WD0 A;  3OWE B;  1CI3 M;  2A19 A;  4LK1 C;  1NSN S;  3QIA A;  4IUQ A;  2KCC A;  2B8G A;  2Z4H A;  3EA6 A;  3DEO A;  2Y0S B;  3DWP A;  3TP5 A;  4ZKB B;  1VQJ A;  5FO9 B;  4X64 Q;  1XJV A;  2YU9 B;  4BBR H;  3R93 A;  2SEB D;  2A6E D;  1EY8 A;  2YTV A;  1SMY C;  3HGB A;  3W5O A;  5D3I B;  2E5L L;  2B3G A;  4YWL A;  1II3 A;  2EYL A;  5ELB A;  2E2I H;  4DV3 Q;  4OWW B;  2JA8 B;  4WOR A;  5FJ8 G;  1S72 A;  4JW0 A;  4NMZ A;  4IAL A;  1K3B C;  1JOQ A;  1VQE A;  2O5I C;  4NP5 A;  3CAM A;  1VQ8 A;  1R4Q B;  2LSS A;  4CDF C;  2HHH L;  2B2W C;  3MAQ A;  5CC4 A;  2UUB Q;  5C4H A;  4R4I A;  1Y1V B;  2EYO A;  4IQZ A;  4C3I H;  2Q8I B;  4J8Q A;  1N36 Q;  2JA6 B;  1BF4 A;  3LWU A;  5IOD A;  2EJM A;  2WAC A;  1TXY A;  5M3M G;  3VR6 A;  1JWU D;  5LL6 S;  1D1K A;  3H3V I;  1LT6 D;  4CJ0 B;  2JK8 A;  3VYR A;  4G7H C;  3K0Y A;  1MHW C;  3HOV G;  4A3L G;  1MD2 D;  3U9S A;  1H9J A;  2B63 G;  2VB2 X;  3PCO B;  5FLX E;  4DNT B;  1U4M A;  1K3R A;  4MHE A;  5CV6 A;  1G29 1;  3L3O C;  4A3I B;  4A3K B;  1GVP A;  2RDH A;  3CW2 C;  4K6L A;  3HOU H;  1G51 A;  2PQA A;  3EFX D;  1VQ9 A;  4L6T B;  3CCU A;  1PH7 A;  3G71 A;  3A5U A;  2F1M A;  1H95 A;  3IRB A;  1H9K A;  4XYQ A;  4CJ2 C;  2KQ3 A;  2CVR A;  2SOB A;  3Q22 A;  2C9O A;  3PIO 3;  2RVL A;  2UXC L;  3GTJ B;  3R8B A;  4WJ4 A;  4HSV A;  1GUO A;  2K4K A;  4O2D A;  5JVH 3;  2KUM A;  3HOZ H;  1S4Z A;  2OF1 A;  3LNN A;  1N8R C;  1J9O A;  1M1K C;  4KN4 C;  4JI5 L;  4DN4 M;  4A3D H;  2LFN A;  5IYB H;  1STG A;  3L2P A;  1R9T H;  1PZI D;  5IYD G;  1K9M C;  1VF7 A;  3K5M A;  2NVQ B;  2EE1 A;  4YWM A;  3CQZ H;  4O0A A;  3Q8D A;  5LMU L;  1B9N A;  2TSS A;  3ERO A;  1TT2 A;  3ND8 A;  5C5M A;  2CQO A;  1I4X A;  3PO2 G;  3S1N B;  3D6W A;  1IYV A;  5AJ3 L;  4R8I A;  2B2V A;  1BNZ A;  1I5F A;  1STE A;  3MWY W;  3G7L A;  1N32 Q;  3QJY A;  1BVS A;  3PSI A;  4ULL A;  4HJ7 A;  2I46 A;  3W1B A;  1H9R A;  3PIP A;  2ZJQ A;  5BR8 Q;  5J1Z A;  4NB3 A;  4B08 A;  5C4J H;  1TY0 A;  4FDB A;  1OO9 B;  1GO3 E;  1KAW A;  1XWE A;  2DGY A;  1QZH A;  1WTX A;  1FNV A;  1HZC A;  1YBY A;  2XRS D;  1D5Z C;  3J7A V;  3KK7 A;  3ONA B;  1TR5 A;  1DXM A;  4DK3 C;  2FJ2 A;  3M7G A;  3EBE A;  1I6V C;  1DJR D;  1XX8 A;  1YEZ A;  4AQY L;  3U50 C;  1DYQ A;  4LF6 Q;  1ILQ A;  3DMU A;  4K14 A;  5JOB A;  4HJ8 A;  2E2J B;  4OX9 L;  5ELN A;  1T5X D;  2QW7 A;  1J5E L;  5HUR A;  1SYC A;  2QF7 A;  1UUP A;  3HP3 A;  1JE4 A;  4JI7 L;  4A93 G;  4ZK9 B;  2OQK A;  1WOC A;  3H91 A;  3R2T A;  4U67 3;  5IGB A;  5IGG A;  1IYU A;  3NEL A;  1E2V A;  1WJJ A;  4RFB A;  3F1Z A;  1SYD A;  2XN9 C;  4PNY A;  3M7N A;  3M4P A;  3RLN A;  2I5L X;  1NR4 A;  4A3G H;  1FJG L;  1ZXT A;  4MIU A;  3URY A;  3U4Z A;  3MXP A;  4BY7 H;  5EKK A;  3RLF A;  3F2C A;  4AYB G;  4JI1 Q;  2VW9 A;  2PW5 A;  3DLL A;  3CF5 A;  3RNU A;  2JA5 G;  5D3D A;  3OIP A;  2NB0 A;  3TP6 A;  4QQB X;  1NAP A;  3WWV A;  2G5D A;  4BBR B;  2A69 C;  4LF4 L;  4DFA A;  4N8F A;  3QOJ A;  3GD7 A;  4DV6 L;  2PW7 A;  1VQG A;  3E0E A;  3H0G G;  4LFC L;  5KEE A;  4GOP A;  2E2I B;  4GLV B;  1PTO D;  1Q3L A;  5IOC A;  1Y1W G;  3SK5 A;  5IYC H;  4DXF A;  2K14 A;  4DV7 L;  1N9W A;  1L0W A;  4JG2 A;  2KCT A;  5L37 A;  2P5Z X;  4UP8 A;  4NXM Q;  2F0W A;  3BVG A;  4GKK L;  4C3I B;  1MIU A;  1WFQ A;  4R4O A;  5IGD A;  1E24 A;  1TII D;  1KLU D;  2CKZ B;  1WTV A;  1C0A A;  4N8X 1;  3GTG H;  1AZQ A;  2VNU D;  3D31 A;  2KHI A;  3OW7 A;  1CK1 A;  2O2L D;  4NXN Q;  4ILW A;  1UE1 A;  2L11 A;  3TSS A;  3VA7 A;  1KTK A;  4JI2 L;  3DWQ A;  2EPB A;  3K80 C;  3CCJ A;  3C3L A;  1Q81 C;  1CA6 A;  1MI2 A;  2RKS A;  3HOU B;  1PYW D;  2YTY A;  1KRT A;  1DCZ A;  2HIV A;  1AE2 A;  1SNC A;  1HRJ A;  3PO3 G;  1F2Y A;  2CQA A;  1EEI D;  2L15 A;  1ICF B;  2QEX A;  4K0K L;  5C44 G;  1CHQ D;  4FF3 A;  2SDF A;  3K0X A;  3GTM H;  2NVX H;  3HRZ C;  1PDQ A;  3EN2 A;  3V96 A;  4F8M A;  3HOZ B;  1P8L A;  1HNZ L;  4B3R L;  1BCP B;  3FPU B;  1U4L A;  4G7O C;  2VUM G;  4A3D B;  1HTL D;  3DUZ A;  3NSW A;  4QGU A;  2AQ3 B;  2FHT A;  3NEN A;  1R9T B;  3T1Y L;  1CHP D;  5I6W A;  3ND9 A;  1EWH A;  1L1O C;  3AU7 A;  5CGK A;  1MJE A;  4B3T Q;  5IE8 A;  3CQZ B;  5M3M H;  1WTR A;  3HOW H;  4QIW E;  5K36 G;  5IWA L;  1PFB A;  1EFI D;  1TVX A;  3N52 A;  2MO1 A;  2AWN A;  1JOK A;  2UUA Q;  4RA8 A;  3H15 A;  4JI0 L;  2CWA A;  1VCI A;  5TSS A;  1X32 A;  2B63 H;  3HOX G;  4LF5 L;  4EGV A;  3I4N G;  2XWJ B;  4MTK A;  1EYC A;  1VQ5 A;  1PH4 A;  4DA2 A;  3DXJ C;  3KFU A;  4LFA L;  4KJN A;  3BVM A;  1EZ8 A;  4Y7N H;  5FLX L;  3NEM A;  4PMB A;  4Z9C B;  3J7A 5;  4QUC A;  4OL7 A;  1KQS A;  4A3F B;  1HQM C;  1ET6 A;  4QF4 A;  1TWA H;  2ZTE A;  1SJE D;  3HS0 C;  5IGC A;  2EYP A;  2I07 B;  2V1C C;  1HXY D;  1WTP A;  2F0U A;  4EX5 A;  3M4O H;  1UE7 A;  3J7Y W;  1V43 A;  2OT2 A;  4A3E H;  2Y0S E;  2PZU A;  1VQL A;  4PMC A;  1D6E C;  4B9X A;  2ZM6 L;  1J8I A;  1XPR A;  2A1A A;  1VQ7 A;  5IYD H;  4KK7 A;  2JN4 A;  4PV1 C;  2F0I A;  3X3M A;  1Q90 A;  1LTI D;  1JR0 D;  2AUJ D;  1X3Q A;  2Z6K C;  1L0Y B;  2EOT A;  4IFD G;  4RGM A;  2L9H A;  2R7Z G;  2BE5 C;  1UEB A;  4CDC C;  4IOA A;  4DV2 L;  5IP9 H;  1N34 L;  1FR3 A;  3CPF A;  1A2U A;  4ZQ3 A;  4YHH L;  1LYL A;  4CKB A;  4BY7 B;  4UAI A;  5HGT A;  4CKC A;  4JBK A;  5FLM H;  2FIN B;  1SFO H;  1OXS C;  5EQ0 A;  4BBS B;  4UP9 A;  2WAQ B;  3D6C A;  4X62 Q;  4FF4 A;  2B8F A;  4K5V A;  4LF9 Q;  1SN8 A;  4DAV A;  1F9R A;  4ID6 A;  1X3G A;  2ICI A;  5IY0 A;  1VDZ A;  2B2U A;  1HPC A;  1I4P A;  2BH8 A;  4DR2 L;  2R7D A;  2JA9 A;  3TZU A;  4EQP A;  1QZG A;  1GHK A;  1JQY D;  2QEJ C;  4YY3 Q;  1VMP A;  1RIP A;  5IIF A;  1AP0 A;  1A3T A;  4A93 H;  1PTO F;  1N36 L;  3I8Z A;  3GV3 A;  3RZO B;  1EWI A;  1LT3 D;  3GTG B;  2HIX A;  1PMR A;  3J81 L;  3W1G A;  5JPM C;  4JYA Q;  4GNX B;  1MJC A;  1HR0 L;  4DR6 L;  1LTR D;  1T9H A;  1ZKO A;  1RD9 D;  3A55 A;  4I7Z C;  4GLA C;  3LWE A;  1WCM H;  3UDF A;  5H1S E;  2V4D A;  2ZXO A;  2IWH A;  5I2Y A;  2EVB A;  5C0X G;  4UHV A;  4UP7 A;  1JJG A;  2RA4 A;  4X3U A;  3PGZ A;  2VXW A;  3VYU A;  2JA5 H;  4QL5 A;  2VY3 A;  3K81 C;  1U0L A;  4RKB A;  1BOS A;  5CBA E;  1HNX L;  4HJA A;  5EBD A;  3MXN B;  2TMP A;  2Q2U A;  2IX0 A;  2CW0 C;  4UY8 C;  2ZTC A;  3PIO A;  4DF7 A;  3IFT A;  2NZ1 D;  1IL2 A;  4LW1 A;  1OXX K;  2ES2 A;  5ELE A;  1Y1W H;  1EOT A;  4DK0 A;  2NVX B;  1EY0 A;  3STB D;  1F2M A;  1Q12 A;  2FMM A;  1CTM A;  1PRT B;  2Z6B A;  3UE1 A;  2D0P A;  3KF6 B;  2JA6 H;  1MSH A;  1F9Q A;  2X6G A;  5DAU A;  1HUM A;  1SE8 A;  2GA4 B;  4IUT A;  4J1M A;  4A3J H;  4ZKC B;  2BH2 A;  1DON A;  1PYS B;  5M3M B;  2N88 A;  3HOW B;  2R3Z A;  1LTL A;  1E22 A;  3KJO A;  4OEM B;  3SGI A;  1YHB A;  2I0Q A;  4DV5 L;  2F4I A;  4R8N A;  1P16 A;  1F2L A;  2UU9 Q;  4IUV A;  4B3S L;  3HOV B;  3IAY A;  2B63 B;  1B8A A;  4DK1 A;  1CKO A;  5LMN L;  4DV0 Q;  3EQL C;  4CBV A;  4C3J G;  4U68 A;  1E7Z A;  2GVB A;  2JXM B;  1IBM L;  5D14 A;  1TS4 A;  2EIF A;  2CH4 A;  1XMO L;  1KDA A;  1IKL A;  4FO2 A;  3S2D H;  4DR3 Q;  1XXG A;  3FMC A;  3S9W A;  5C44 H;  3T1H L;  1IW7 D;  3DM1 A;  3NP8 A;  2A6H D;  3I73 A;  5FLX c;  3HOY H;  1I94 Q;  4PG3 A;  2VUM H;  4JI8 Q;  2QDL A;  4A3C G;  2X69 A;  2K5D A;  3KLS A;  1D8L A;  4LF6 L;  2KVM A;  4DV4 L;  1MKH A;  1VMC A;  2D62 A;  5K36 H;  2VL6 A;  3CME A; 
#chains in the Genus database with same CATH homology
 3CU7 A;  4KV6 A;  4XT1 B;  4RCN A;  3PO2 B;  4WFN 3;  4H44 C;  4PMW A;  5ELD A;  3MVV A;  5C5L A;  2OEO A;  3NK9 A;  5EPL A;  2EYM A;  4HTH A;  5AFW A;  1BQQ T;  2MHV A;  1SFO B;  5CV5 A;  4KD4 A;  5E1F A;  1BBX C;  4S3S A;  4KMU C;  3A8J E;  1IL8 A;  4ZAI A;  1O7Z A;  1S5C D;  1FNW A;  4F87 A;  1PTO C;  1ONL A;  4TKO B;  2JEB I;  1B50 A;  5D65 A;  2L4N A;  1AW7 A;  4OO1 G;  4A93 B;  1HA5 A;  4P2C B;  4IFD H;  2BOS A;  3TDQ A;  2L5T A;  2VB3 X;  3MXN A;  2F03 A;  3H3V C;  2J0T D;  3TN2 A;  3CHB D;  4RAU C;  2NYZ D;  1H9S B;  1SBB B;  1WCM B;  4ZRZ A;  2HUG A;  4AYB B;  2NTS A;  5ISR A;  2JA5 B;  3KUP A;  2K6A A;  3GO5 A;  3IL8 A;  2KJX A;  2K05 A;  1O7Y A;  2M2L A;  4EVO A;  1G91 A;  1SYG A;  1Y1W B;  3GTO B;  1JCK B;  1YNN D;  2KHS A;  1S5F D;  3P1H A;  1LTS D;  4XXE A;  2BCO A;  4A3J B;  2IJ0 A;  4N9T A;  1LT5 D;  1GUG A;  3VYT A;  5CV9 A;  1D2B A;  3IKJ A;  4WJW A;  1XYI A;  5EJW A;  2NTT A;  1EYD A;  3T16 A;  5C0X H;  1SND A;  5EKL A;  1EU4 A;  3PO3 B;  3NQI A;  5KGU A;  2EYH A;  4XQJ A;  3S2D B;  5C44 B;  4TSS A;  2A68 D;  3HOY B;  1ESF A;  2NVY B;  4LJZ C;  3QOL A;  2VUM B;  3KBX A;  1MBY A;  1CZG A;  3A56 A;  4LMQ D;  3FVQ A;  2F0H A;  4IFD J;  5DNF A;  2XRQ D;  1SYE A;  3BS1 A;  2IW3 A;  4KHV A;  2WKC A;  4BWG B;  3HOX B;  1TWC B;  1ZYR D;  5JPN C;  1PRT D;  2X6L A;  4CJ1 B;  1CZW A;  1EYA A;  3PMF A;  1S5E D;  4HMJ A;  1EEF D;  3A7A B;  1U4R A;  3GQB A;  1SNM A;  1D1I A;  1I4H A;  1DOK A;  1QOH A;  3J81 E;  3S1R B;  4ME5 A;  4DU9 A;  3HZX A;  1H9S A;  1FGB D;  2F0V A;  1D5M C;  2RSN A;  2B2W A;  1LT4 D;  1XTC D;  3N6R A;  2NN6 G;  2R7Z B;  1QIL A;  3PUY A;  1STN A;  1YNJ C;  1JC7 A;  5C0X J;  1HQR D;  1E0B A;  3S14 B;  4XQQ A;  2EY6 A;  1EY7 A;  1U4P A;  4O42 A;  2F0L A;  1SNP A;  1UEA B;  4F7X A;  3EVQ A;  4DAY A;  3ERQ A;  5KYL A;  3DHQ A;  1PZJ D;  1PFN A;  2RQX A;  1I3Q B;  3D8G A;  2RDG A;  1EZ6 A;  5CMD A;  3D4D A;  3BVZ A;  3SK6 A;  3AMU A;  2XVS A;  1CFM A;  1GUN A;  4FXK C;  3C2P A;  1RTN A;  2EYF A;  2K04 A;  1RF2 D;  1T5E A;  4KN7 C;  4XIG S;  4M8A A;  2WV6 D;  4RWS C;  2IX1 A;  5JEA G;  2F0G A;  2B2T C;  2D9U A;  3SDZ A;  3K58 A;  2E74 C;  2XIW A;  2ZT9 C;  1AEX A;  3S1M B;  3WOF A;  5C4Z A;  1SXT A;  1SMY D;  1Y8O B;  1G8Z D;  4KD3 A;  4XYO A;  4XDX A;  1V1O A;  1S5B D;  3L7Z C;  4TRD A;  3F2U A;  1HCZ A;  3OIQ A;  1CM9 A;  4G7Z C;  1BR9 A;  2IT1 A;  2KEE A;  4DNR B;  1SEB D;  2L12 A;  4K8I A;  3W2D A;  2F0E A;  2F3V A;  1Z47 A;  2D2C C;  3X3N A;  2QIL A;  3NBI A;  2EDG A;  3H6M A;  4K2L A;  2SNS A;  1A3V A;  1MSG A;  4FVM A;  4XTC S;  3R2I A;  1HUN A;  3K57 A;  1JB3 A;  3NTI A;  1KNE A;  4FYD A;  2NVT B;  3MFG A;  2QDB A;  1I50 B;  5EPK A;  1EY5 A;  5C0X I;  3U9O A;  2Z1C A;  1AFP A;  2M9V A;  4HCE A;  4A3M B;  3A8K E;  4NW2 A;  4HMI A;  5K5P A;  2AQ1 B;  1LAC A;  5J39 A;  1ILP A;  3A8I E;  4IUN A;  4H13 C;  4C1N K;  2HCC A;  4YIJ A;  2WP8 J;  2K5Q A;  3M85 A;  1TS2 A;  2D5D A;  4MN3 A;  4RHR A;  3GTL B;  1SE2 A;  1SDF A;  2A6E C;  5EPJ A;  2HDL A;  3T4A C;  1HA6 A;  2RSO A;  2BDO A;  2ZXR A;  2PQE A;  3BDL A;  1W6J A;  4KY6 A;  1WTO A;  3M4Y A;  2ICE C;  2R6G A;  1KDB A;  4RCO A;  3GTP B;  3A54 A;  4FF1 A;  2DNE A;  1YNN C;  1ICW A;  4J6H A;  1OXT A;  3KLR A;  3TME A;  3NE5 B;  3EJI A;  2C5C A;  3V2T A;  4BS9 A;  1TQO A;  3I91 A;  4OHJ A;  2NN6 H;  2EY5 A;  3NUC A;  1V1P B;  1Q1E A;  2RDF A;  1QCB D;  5BN4 A;  2PNR C;  1PLF A;  4X3S A;  3SEB A;  2A74 C;  3I4L A;  4FXD A;  2IX3 A;  2Q8T A;  4IUU A;  2HQE A;  1B44 D;  2A69 D;  4KKT A;  4L8J A;  1Y8N B;  5CYU A;  3K5N A;  3T13 A;  2PCF B;  2EJF C;  3V05 A;  1PFM A;  2JEA I;  2B2Y C;  3NTH A;  2A68 C;  3HG9 A;  5F2D A;  2BA1 A;  2WKD A;  1BDO A;  2IPK D;  2K28 A;  5E4X A;  3LX0 A;  3TBI B;  3I3C A;  3J80 L;  2O4X A;  5FO7 B;  3VA5 A;  1TWH B;  3M3Y B;  1NR2 A;  3CKI B;  4WRD A;  1A3U A;  4Q0F A;  1D5X C;  4CGY B;  4RGN A;  4FXG C;  1ZEQ X;  2FMC A;  5EBC A;  2JSO A;  1LTT D;  1STY A;  1B2T A;  3VYS A;  5IGE A;  1ESR A;  1JWM D;  4IN3 A;  1JWS D;  2PPB C;  3Q0A A;  3DEP A;  3UI2 A;  5LHY 1;  5KIX A;  2KCN A;  3SHL A;  4JK1 C;  5DM7 3;  1Z7T A;  2R93 B;  3MHB A;  2E76 C;  1IKM A;  3Q6S A;  4CKE A;  3VR5 A;  1BCP D;  2J7Z A;  5C4X B;  1K8M A;  1ROD A;  1MGS A;  5I9P A;  4KKS A;  3R3O A;  5M5X B;  3PUW A;  1F9S A;  1PTO B;  2E2H B;  1WVL A;  5CV4 A;  5E4W C;  4ZYS A;  2K1B A;  5CV8 A;  1JOR A;  2F0T A;  2KOL A;  3GV6 A;  4IZ8 A;  5LL6 X;  2HCI A;  2MUY A;  2ENB A;  1K8O A;  3NHH A;  3RD4 A;  3QG1 A;  3ZYY X;  1GXD C;  1LLR D;  1UAP A;  2F0M A;  2NUC A;  2ZXP A;  1RKN A;  1STH A;  5C3W A;  2BA0 A;  3E5S A;  3HKZ B;  2B2V C;  3KBG A;  1TKW B;  5KNC A;  3CRK C;  1OXV A;  2BE5 D;  2LMC B;  1QB5 D;  3C46 A;  3ITP A;  5JEA J;  1DM0 B;  1DOL A;  1TWF B;  2G9D A;  2K03 A;  2SNM A;  2LY7 A;  4K5X A;  3RZD B;  4G4K A;  1EWC A;  5A35 A;  3JAM L;  3H0G B;  1STB A;  1QNU A;  1HFG A;  4C1N I;  1GUS A;  3S17 B;  2H1E A;  3NXW A;  3BYT B;  5JVG 3;  3SE0 A;  3P20 A;  5T1I A;  4XT3 B;  5EKI A;  1TS3 A;  1SAP A;  4E6I A;  3E0J A;  1ENF A;  4IUP A;  4ZUJ A;  2EXZ A;  1HTP A;  3GTQ B;  4KJO A;  4BA2 I;  1NUC A;  4KI0 A;  4RKL A;  1E2Z A;  1CA5 A;  4HR7 B;  1WD1 A;  5JAV A;  5KND A;  4K2K A;  3Q24 A;  1O78 A;  2L55 A;  1SE4 A;  1EY6 A;  3P75 A;  1R4P B;  4B9W A;  3NPP A;  3NQT A;  2PZT A;  3BYY B;  2F0N A;  1LV9 A;  1I6H B;  2PMZ B;  1EIH A;  1U9R A;  2NN6 I;  5C3E B;  3S2H B;  2CW0 D;  3D3R A;  1DOM A;  1LAB A;  4LAA A;  4H7B A;  3QB3 A;  1L0X B;  4FP5 D;  4C3H G;  1GUW A;  3GP7 A;  4KHZ A;  1Q1B A;  3C1E A;  1S5D D;  5KNB A;  3K6O A;  1DZ1 A;  3BDO A;  3TP7 A;  2A5H A;  3NBH A;  3I70 A;  1TY2 A;  3I4N B;  2F0S A;  2MGS A;  2IL8 A;  1LTA D;  3WDN A;  2DN8 A;  5C3X A;  3SR1 A;  3FEW X;  1GOZ A;  4HCS A;  1DD2 A;  1C4Q A;  4PQX A;  1BCP F;  4KTA A;  3H94 A;  4I65 A;  5ELF A;  3MEH A;  1W6K A;  2F0Q A;  5T1G A;  2K01 A;  1OXU A;  2K33 A;  5BN3 A;  3TZD A;  3H09 A;  2F0K A;  1O7L A;  2R92 B;  1KLG D;  4DGZ A;  1V8Q A;  1SSO A;  2F0O A;  5E3F A;  1GHJ A;  3FKI B;  2WII B;  1KDC A;  3J7A F;  1SYB A;  5FO8 B;  1O80 A;  5ELC A;  1WTW A;  4C2M B;  3AB9 A;  2A73 B;  3D4R A;  3OWF A;  1ENA A;  3S1Q B;  1FNU A;  3K5L A;  2EY1 A;  2F0J A;  5I2X A;  3J80 E;  2NWG A;  2CHB D;  2WB1 B;  5IT9 L;  4C56 C;  1G2S A;  2XSC A;  4HAE A;  5A2Q E;  2G9H D;  3E6Z X;  2JE6 I;  4H0L C;  4QB4 A;  3T56 B;  4EQN A;  4OO1 H;  3MXU A;  1WTQ A;  1RDP D;  3T53 B;  3K5O A;  4UDU C;  1RCV D;  1CQF A;  3SK4 A;  3W3A A;  4M1U B;  4O1N A;  1QE6 A;  3PUZ A;  2F3W A;  5CR3 A;  2OXP A;  2AWO A;  3MZ5 A;  3NWT A;  1SNO A;  4K6D A;  4IFD I;  2E75 C;  1K83 B;  1ML0 D;  1KAA A;  4K8J A;  3I90 A;  3RMH A;  4L63 B;  4EQO A;  3P7J A;  1BUV T;  5FKA C;  2B2U C;  3MA2 B;  5NUC A;  5C6A A;  3L9A X;  1IW7 C;  2MJ8 A;  4QMG A;  2A6H C;  3NTK A;  1M4V A;  1CT1 D;  2JYO A;  5CBE E;  1EIG A;  5G3L D;  1LTG D;  5FK9 C;  2AUK A;  3SXH A;  1Q8I A;  2PZW A;  1GJX A;  3A7L A;  3MXG A;  2AQ2 B;  5FOB B;  3Q23 A;  1BCP C;  3BZD B;  4ODG A;  3C1F A;  4C3J B;  2HDM A;  4QUF A;  2EZV A;  1NCV A;  1KAB A;  4FNF A;  2FFK B;  3MTS A;  2DNC A;  3OHX C;  1B53 A;  1PRT F;  2KED A;  2LS0 1;  3SVM A;  3O13 A;  3I4M B;  5C4J B;  2YYZ A;  5DEH A;  2NBF A;  2N55 A;  3KF8 A;  2Z8L A;  4DAP A;  2Q8R E;  4A3B B;  1B3A A;  4K5W A;  2EY2 A;  1H9M A;  3OSO A;  4OIJ A;  2F0P A;  1F2Z A;  4CHT B;  5KRU A;  3QWN A;  1AZP A;  1C8C A;  4GZY C;  1EL0 A;  3JAM E;  1PTO H;  4TQU S;  4QCL A;  3NWS A;  4KKU A;  4A3G B;  2MPM A;  3KLS X;  5BN5 A;  3PIP 3;  4G57 A;  1I4R A;  5COR A;  4Q5V A;  3GTK B;  1SE3 A;  5COY A;  1RHP A;  2B2T A;  4RGO S;  4N9P A;  1CQV A;  4JBW A;  1FYC A;  1UNS A;  5KYI A;  1C48 A;  2K5W A;  4OIK A;  1FD7 D;  2WIN B;  2H4O A;  4DXG A;  4C3I G;  2J4X A;  3CRL C;  4RGT A;  3MFY A;  5CV7 A;  3K59 A;  1A6X A;  1EQV A;  1QNK A;  1KNA A;  1PXU A;  1EY4 A;  4IUR A;  1A15 A;  3T51 B;  1YNJ D;  5EGT A;  4R9W A;  1Z6H A;  1ET9 A;  3MC0 B;  4NDX A;  5M5W B;  2DY8 A;  3FDT A;  2PO4 A;  5M3F B;  1JIC A;  5I9O A;  4V19 0;  2ID0 A;  2O5J C;  4BA1 I;  5IGF A;  3GTM B;  5M5Y B;  3S15 B;  3PUX A;  4KY7 A;  3BG3 A;  4F88 A;  1X3P A;  1G6Z A;  3WOE A;  4RH6 A;  1LTB D;  5A2Q L;  1Y69 U;  1F9P A;  3DWA A;  4NKL A;  2KEC A;  1BO0 A;  5JEA H;  1ZYR C;  5G3L F;  1PRT C;  1STA A;  4KY5 A;  4OGQ C;  1RJT A;  3K7A B;  2Z4I A;  4OO1 I;  1HFN A;  1AN8 A;  2E2D C;  2M00 A;  2K7V A;  1EQT A;  2F0D A;  4Y7N B;  4X3K A;  4ZUI A;  2XNA C;  1JOO A;  2MP1 A;  2EJG C;  2PYK A;  3RUZ A;  5M9O A;  1SYF A;  1SJH D;  2K32 A;  1TWA B;  2L0C A;  3PV0 A;  1QG7 A;  1TWG B;  4C3H B;  4X3T A;  1GUT A;  1Y8P B;  3M4O B;  1HHV A;  1SNQ A;  3QO2 A;  4A3E B;  1LO5 D;  3HEJ A;  3OMC A;  3BDC A;  2RBM A;  2JA7 B;  3OPO A;  4HED A;  1E2W A;  2L1B A;  1I4Q A;  4RHS A;  3PUV A;  1EU3 A;  5JJZ A;  4BY1 B;  1QJO A;  1M8A A;  3FRP B;  1PZK D;  1A2T A;  1TU2 B;  1VF5 C;  4V0B A;  2F0F A;  2QCP X;  2B39 A;  4FF2 A;  5IT9 E;  3G6J B;  2XWB B;  1TS5 A;  3VR4 A;  5J22 A;  4XQN A;  4ZLT F;  1B1Z A;  1B9M A;  3IFD A;  5DM6 3;  1G2T A;  1ENC A;  1V1P A;  5I6Y A;  1RTO A;  3TP8 A;  4QIW B;  1I4G A;  1QWY A;  4ABN A;  4HN7 A;  1IHZ A;  1BXT A;  1B4O A;  5I4D A;  2KA7 A;  2B2Y A;  2EYJ A;  1F77 A;  3FPP A;  3I72 A;  2BDN A;  3OOC A;  2DY7 A;  4HSP A;  3VR3 A;  2R61 A;  3OMG A;  2LKV A;  3D4W A;  3S16 B;  2JP1 A;  3SK8 A;  3VR2 A;  1EY9 A;  2QKI C;  1WD0 A;  3OWE B;  1CI3 M;  4LK1 C;  1NSN S;  3QIA A;  4IUQ A;  2KCC A;  2B8G A;  2Z4H A;  3EA6 A;  3DEO A;  2Y0S B;  3DWP A;  3TP5 A;  4ZKB B;  5FO9 B;  2YU9 B;  3R93 A;  2SEB D;  2A6E D;  1EY8 A;  1SMY C;  3HGB A;  5D3I B;  1II3 A;  2EYL A;  5ELB A;  2JA8 B;  4WOR A;  4NMZ A;  4IAL A;  1JOQ A;  2O5I C;  4NP5 A;  1R4Q B;  2B2W C;  3MAQ A;  5CC4 A;  5C4H A;  1Y1V B;  2EYO A;  4IQZ A;  2Q8I B;  4J8Q A;  2JA6 B;  1BF4 A;  3LWU A;  5IOD A;  2EJM A;  2WAC A;  3VR6 A;  1JWU D;  5LL6 S;  1D1K A;  1LT6 D;  4CJ0 B;  3VYR A;  4G7H C;  3K0Y A;  1MD2 D;  3U9S A;  1H9J A;  2VB2 X;  5FLX E;  4DNT B;  1U4M A;  4MHE A;  5CV6 A;  1G29 1;  3L3O C;  4A3I B;  4A3K B;  2RDH A;  4K6L A;  3EFX D;  4L6T B;  2F1M A;  1H9K A;  4XYQ A;  4CJ2 C;  2KQ3 A;  2CVR A;  2SOB A;  3Q22 A;  2C9O A;  3PIO 3;  2RVL A;  3GTJ B;  3R8B A;  4HSV A;  1GUO A;  5JVH 3;  2KUM A;  1S4Z A;  2OF1 A;  3LNN A;  1J9O A;  4KN4 C;  4DN4 M;  2LFN A;  1STG A;  1PZI D;  1VF7 A;  3K5M A;  2NVQ B;  2EE1 A;  1B9N A;  2TSS A;  3ERO A;  1TT2 A;  3ND8 A;  5C5M A;  1I4X A;  3S1N B;  3D6W A;  1IYV A;  4R8I A;  2B2V A;  1BNZ A;  1STE A;  3MWY W;  3G7L A;  3QJY A;  4ULL A;  2I46 A;  1H9R A;  5J1Z A;  4B08 A;  1TY0 A;  1OO9 B;  1XWE A;  1WTX A;  1FNV A;  2XRS D;  1D5Z C;  3J7A V;  3KK7 A;  3ONA B;  1TR5 A;  1DXM A;  2FJ2 A;  3M7G A;  1I6V C;  1DJR D;  1XX8 A;  1DYQ A;  1ILQ A;  3DMU A;  4K14 A;  5JOB A;  2E2J B;  1T5X D;  5HUR A;  1SYC A;  2QF7 A;  1UUP A;  3HP3 A;  1JE4 A;  4ZK9 B;  3H91 A;  3R2T A;  4U67 3;  5IGB A;  5IGG A;  1IYU A;  1E2V A;  4RFB A;  4PNY A;  1SYD A;  2XN9 C;  3M7N A;  1NR4 A;  1ZXT A;  4MIU A;  3URY A;  3MXP A;  5EKK A;  3RLF A;  2PW5 A;  5D3D A;  3OIP A;  2NB0 A;  3TP6 A;  1NAP A;  4BBR B;  2A69 C;  4DFA A;  3QOJ A;  3GD7 A;  2PW7 A;  5KEE A;  2E2I B;  1PTO D;  1Q3L A;  5IOC A;  3SK5 A;  4DXF A;  2F0W A;  3BVG A;  4C3I B;  5IGD A;  1TII D;  1KLU D;  1WTV A;  1AZQ A;  2VNU D;  3D31 A;  3OW7 A;  1CK1 A;  2O2L D;  4ILW A;  2L11 A;  3TSS A;  3VA7 A;  1KTK A;  3DWQ A;  2EPB A;  3C3L A;  1CA6 A;  1MI2 A;  2RKS A;  3HOU B;  1PYW D;  1DCZ A;  1SNC A;  1HRJ A;  1F2Y A;  2CQA A;  1EEI D;  1CHQ D;  4FF3 A;  2SDF A;  3HRZ C;  1PDQ A;  4F8M A;  3V96 A;  3HOZ B;  1BCP B;  3FPU B;  1U4L A;  4G7O C;  4A3D B;  1HTL D;  3DUZ A;  3NSW A;  2AQ3 B;  2FHT A;  1R9T B;  1CHP D;  5I6W A;  3ND9 A;  1EWH A;  3AU7 A;  5CGK A;  3CQZ B;  1WTR A;  5K36 G;  1PFB A;  1EFI D;  1TVX A;  3N52 A;  2AWN A;  1JOK A;  4RA8 A;  5TSS A;  1VCI A;  1X32 A;  4EGV A;  2XWJ B;  1EYC A;  4DA2 A;  3DXJ C;  4KJN A;  3BVM A;  1EZ8 A;  5FLX L;  4PMB A;  4Z9C B;  4QUC A;  4OL7 A;  4A3F B;  1HQM C;  1ET6 A;  4QF4 A;  1SJE D;  3HS0 C;  5IGC A;  2EYP A;  2I07 B;  1HXY D;  1WTP A;  2F0U A;  3J7Y W;  1V43 A;  2OT2 A;  2PZU A;  4PMC A;  1D6E C;  4B9X A;  1J8I A;  4KK7 A;  4PV1 C;  2F0I A;  3X3M A;  1Q90 A;  1LTI D;  1JR0 D;  2AUJ D;  1X3Q A;  1L0Y B;  2EOT A;  4IFD G;  4RGM A;  2L9H A;  2BE5 C;  1FR3 A;  1A2U A;  4ZQ3 A;  4CKB A;  4BY7 B;  4UAI A;  5HGT A;  4CKC A;  2FIN B;  1OXS C;  5EQ0 A;  4BBS B;  2WAQ B;  3D6C A;  4FF4 A;  2B8F A;  4K5V A;  4DAV A;  1F9R A;  4ID6 A;  2ICI A;  1VDZ A;  2B2U A;  1HPC A;  1I4P A;  3TZU A;  4EQP A;  1GHK A;  1JQY D;  2QEJ C;  1VMP A;  5IIF A;  1AP0 A;  1A3T A;  1PTO F;  3I8Z A;  3GV3 A;  3RZO B;  1LT3 D;  3GTG B;  1PMR A;  3J81 L;  5JPM C;  1LTR D;  1ZKO A;  1RD9 D;  3A55 A;  4I7Z C;  3LWE A;  2V4D A;  5I2Y A;  2IWH A;  2ZXO A;  2EVB A;  5C0X G;  2RA4 A;  4X3U A;  2VXW A;  3VYU A;  4RKB A;  1BOS A;  5CBA E;  5EBD A;  2TMP A;  2IX0 A;  2CW0 C;  4DF7 A;  3IFT A;  2NZ1 D;  1OXX K;  5ELE A;  1EOT A;  4DK0 A;  2NVX B;  1EY0 A;  1F2M A;  1Q12 A;  2FMM A;  1CTM A;  1PRT B;  1MSH A;  1F9Q A;  2X6G A;  5DAU A;  1HUM A;  2GA4 B;  4IUT A;  4J1M A;  1DON A;  4ZKC B;  5M3M B;  2N88 A;  3HOW B;  2R3Z A;  2F4I A;  4R8N A;  1F2L A;  3HOV B;  4IUV A;  3IAY A;  2B63 B;  4DK1 A;  3EQL C;  4CBV A;  4C3J G;  4U68 A;  2JXM B;  5D14 A;  1TS4 A;  1KDA A;  1IKL A;  4FO2 A;  1XXG A;  3FMC A;  3S9W A;  1IW7 D;  3DM1 A;  3NP8 A;  2A6H D;  3I73 A;  2X69 A;  2K5D A;  3KLS A;  2KVM A;  1VMC A;  2D62 A;  5K36 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...