2CQOA

Solution structure of the s1 rna binding domain of human hypothetical protein flj11067
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
119
structure length
119
Chain Sequence
GSSGSSGMNSGRPETMENLPALYTIFQGEVAMVTDYGAFIKIPGCRKQGLVHRTHMSSCRVDKPSEIVDVGDKVWVKLIGREMKNDRIKVSLSMKVVNQGTGKDLDPNNVIIESGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleolar protein of 40 kDa
publication title Solution structure of the S1 RNA binding domain of human hypothetical protein FLJ11067
rcsb
source organism Homo sapiens
molecule tags Ribosome
total genus 12
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2005-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00575 S1 S1 RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2cqoA01
2IHEA 2HHHQ 2ASBA 3F1ZA 3I4NG 4WJ3M 3KYHC 1A63A 2B3GA 4LF4Q 2VW9A 4MTNA 3A74A 3GTOH 3U50C 1QVGA 1EQQA 4LF6L 2JQOA 5IYCH 5EAYA 1PH8A 4A93G 4C3IH 2JEAI 2YU9H 1PH5A 4A3EH 3PUXA 4YWMA 3T1HQ 4DR4Q 4L5TA 1L1OC 4A3JG 1I94Q 3F2BA 4JI3Q 5M3MH 1IZ6A 4IPDA 2AHOB 4DPGA 1OTCA 3BZCA 3VDYA 1HNXQ 4BBSG 4WJ4A 5HGQA 4TVAB 3S16H 4JBJA 3PSIA 4BY7H 1CKOA 4UPAA 4JI1L 1LYLA 5JEAJ 5C0XI 2A1AA 4APVA 1YHAA 2KCTA 4B3TQ 2E5LL 1Q7YC 1HZAA 2B63H 4B3SL 4LF7Q 4AYBE 2I5LX 1PYBA 5IYBH 1LTLA 1AE3A 4DV1L 3PUZA 3A5UA 3S1NH 2RHQB 1EOVA 1OXSC 2LXKA 3GDEA 4ME3A 3UE1A 4HJ7A 2LXJA 1XMOQ 1I6HH 4MNOA 4C3HH 1XPUA 4JI4L 3F8TA 5C3EH 1VQ5A 1GD7A 1EUJA 1UE6A 1QUQB 3RNUA 1KRSA 4LF5Q 2F4VL 1JMCA 3PO2H 4A3CG 2UXDQ 3DM3A 3EIVA 4RMFA 1Q81C 4GNXB 2OWOA 3M3YH 1Q82C 4DV7Q 1CSQA 4OX9Q 4JBKA 4EQ5A 1IBML 3ULJA 2FXQA 1UE1A 4HJAA 2JA7G 2KENA 1CSPA 3STBD 4AQYQ 4NXNL 4LW1A 5JJKA 3HOZG 1GKHA 3BZKA 2WFWA 4R4IA 1NY4A 5C4XH 4DR3L 2N49A 4LF4L 5JJLA 1Z9FA 4X64Q 1B70B 3Q8DA 5JEAG 3KDFA 1TWHH 3KDFB 4A75A 4UP8A 3CP0A 1PA6A 4JYAQ 3ER0A 3I55A 4A3DH 5IYCG 2KHJA 4L5SA 1EQRA 1UE5A 4DUYQ 1GM5A 3I4OA 3CCEA 4A3BH 4A3EG 1KL9A 4P75A 1T9HA 4JI3L 1I94L 3I7FA 1Q46A 1HJPA 2JK8A 5FLXc 2BH8A 1HNXL 1HR0Q 2R93G 1VQBA 4P71A 3K7UC 1K8AC 3I4MH 5C4JH 1IBKQ 1OXVA 2NN6I 2MFIA 1ASZA 2H5XA 4DV0Q 4B3TL 1XNRQ 2JJQA 4HIOA 4Y7NH 3HFZB 1JJGA 4Y52H 5BR8L 1E1TA 5GADC 4DR6Q 1Q8KA 4IPHA 5IYBG 3G4SA 1YHQA 4BBRH 3H0GH 3PF4A 1Q86C 2CFMA 1X3FA 5C0XJ 5M3FH 1ASYA 3HOXG 1NBWA 4JI0Q 1L1OB 2UUCQ 3KF6A 5H1SE 2F3IA 3A5ZB 4UP7A 4HIKA 4C2MH 4B3MQ 2UXDL 4HIDA 1A8VA 3ULPA 3KFUA 1L0WA 1A62A 2Q2HA 4OX9L 1SLJA 3FP9A 4P72A 3U4ZA 4LWCA 2K5VA 4GLVB 4P74A 1JJCB 1OXUA 4IO9A 1QZGA 1IYJB 2UUAQ 1QVFA 1N36Q 1I3QH 1VQ6A 1Q12A 2JA5H 2E2HH 3ERSX 2QEXA 5DLQE 4AQYL 3RZOH 4JI1Q 2ALYB 1D8LA 3M9BA 3UDIA 2E5LQ 3FKIH 3NENA 1KD1C 4B3SQ 1G51A 3IRBA 3CCVA 4DV1Q 3K81C 4JI7L 1JE5A 2K4KA 1NMFA 2OTLA 5C4XG 2AMCB 1KIXA 1X55A 2E8GA 3CC2A 2ES2A 1V9PA 1Y1VH 3EN2A 4GN3B 1C0AA 1V43A 2RCNA 4A3LH 1HZ9A 1WCMH 2GVAA 4A3DG 4KHZA 3UDXA 3CCUA 4K0KQ 1PYSB 4A3BG 4DV5L 1C7YA 3HOYG 5IP7G 1E24A 3L2PA 4MZ9A 1HR0L 1N33Q 1IL2A 4PZ7A 4A3GG 1VQGA 1PH4A 1YJWA 4DV0L 3HOVH 2PI2E 4PG3A 1CKNB 1XJVA 1YVCA 2Q2TA 2WAQG 3G48A 4NXNQ 4DR6L 4JI5L 2K52A 1VQMA 5K36G 5FJ8H 4JI2Q 3E9IA 2VQEQ 2YTYA 2Z6KC 3BJUA 2Y0SG 1SE8A 3UE0A 4DR3Q 1KAWA 3SGIA 3T1YL 1IBLQ 2UXCL 1E1OA 4JI0L 3CW2C 4X65Q 1BBWA 1EFWA 5LMNL 2I0QA 4DAYB 4LUZA 4A3IG 2UUCL 3NELA 4B3ML 3RLOA 1Y14B 4JBMA 4JBWA 1AH9A 4UP9A 4DKAC 2EIFA 4BY1H 1PH9A 1I5FA 3KOJA 4R4QA 2UUAL 4IPGA 2JA8H 5GROA 1EWIA 3G6EA 1N36L 1N34Q 3S17H 3JC66 4JOIA 1M1KC 3PO3H 2R6GA 5IWAL 3JAMc 4LUVA 5GAGC 1S40A 3FHWA 2KCMA 3ULLA 1E22A 1MJCA 4A3KH 4A3MG 1KHIA 4LFBQ 4OO1I 1Q1BA 5BR8Q 2AKWB 1WI5A 3A0JA 1HNWL 1NMGA 5IYDG 3GTJH 2MQHA 3AEVA 1DGSA 3HOWH 4OWXB 1VQDA 1FGUA 3UDFA 1FJGQ 2VS1A 4IJLA 1MIUA 4DR7L 4BXXG 1FL0A 1Y1VG 2PNHA 2QGQA 1Q1EA 2KHIA 1KXLA 1EIYB 4K0KL 1CKMA 3D0FA 3STBC 2K75A 2R92G 3M4QA 2NN6G 3EBEA 4NPSA 1N33L 5HY6A 3CXCA 1YJNA 2I5HA 3W1GA 3RN2A 1VQAA 2K5HA 2I5MX 3B6YA 2HIXA 1S3OA 3PCOB 1JB7A 3F2CA 4LFCL 1VQ7A 1H95A 4DUZQ 2L15A 2N3SA 2VL6A 4JI2L 2VQEL 2OQKA 1X9NA 2BA0A 4JI7Q 3K8AA 5FJ8G 1C9OA 1IBLL 2ATWA 4GLAC 4X66Q 4DR1Q 1A0IA 1N32Q 4R4OA 4X65L 1VQPA 5AJ3Q 2R7ZH 3KLWA 2Z0SA 2BA1A 2YYZA 4LF8Q 4JCVE 3AFQA 1TXYA 5IP9H 4A3FH 1Z47A 2C35B 4R4CA 4YWLA 1VQHA 1TWCH 1K3RA 3AQQA 1VQIA 1HZBA 3TREA 4EX5A 5M5YH 4BY1G 1N34L 4UY8C 3CCRA 3RZDH 4DV5Q 3UDGA 1PV4A 1W3SA 5M3MG 1PHJA 3DLLA 3F2DA 3OYYA 5FLMH 4X6AH 1J5EQ 3S2HH 1VQJA 3U4VA 1HR0W 4LFBL 3M7NA 4JOIC 2Z6KA 3CD6A 4BY7G 2GN5A 3RLNA 3J7ZC 2B63G 4OWWB 3GTPH 2JE6I 2ZTEA 4JI5Q 4JG2A 2EQSA 4ALPA 1XPRA 4QY7A 1TWFH 3KJOA 4P73A 3T1YQ 2PQAA 4L5QA 4A76A 4DR5L 1SR3A 1BVSA 1S72A 3S15H 4GKKQ 5IE8A 1FJGL 1GO3E 1VQOA 1O7IA 3W1BA 2UXCQ 2E2IH 5ELOA 3KF6B 5LMNQ 5C3EG 1G6PA 2GVBA 2AWNA 2N78A 4DV4L 2NVXH 4IOAA 2JA6H 2IY5B 5GAHC 5C44H 5LMNW 4GLXA 3PO2G 4HJ9A 1TWAH 1JT8A 3HOUH 1X3EA 1YNXA 4GN4B 3PF5A 1XMQL 3CCQA 2YTVA 4GN5A 2UXBQ 3K80C 4YCUA 3CCJA 3CF5A 1N8RC 1SROA 4RG1A 5IWAQ 1U0LA 1MJEA 1P8LA 4DUZL 1FVIA 4QIWE 4PZ6A 1VQ4A 1K73C 4IJHA 4YY3Q 1U5KA 5ELNA 3GTLH 3OTOQ 1N32L 4X66L 4DR1L 1HNWQ 5M5XH 3J80c 5AJ3L 1VQNA 2CWAA 2E2JH 4A3JH 1B8AA 3BU2A 2CCZA 2IX1A 4JI6Q 4PMWA 3CAMA 4IFDI 4LF8L 3S1RH 1X65A 3CQZH 4DR7Q 4X62L 3ICEA 3H3VI 4XIGS 1I50H 4BBSH 1TWGH 4LNQA 3KF8B 2YTXA 1EYGA 4GKJQ 2IT1A 2RHSB 5C0XG 4HJ5A 4OO1G 1KRTA 1XNQQ 1J5EL 4DV6L 3I4MG 3S1MH 5GAEC 3TEHB 5FLMG 2PMZE 4JV5L 4LFCQ 2WB1G 1MKHA 1WFQA 3GTGH 4R4TA 1P16A 4DAMA 4LF9L 2QA4A 4A3CH 2VQFL 4B3RQ 3NBHB 3I2ZA 1AE2A 4XTCS 4BBRG 4GKKL 1UWVA 1VCIA 2A19A 3H0GG 2D0OA 1PH1A 2WAQE 4QQBX 3HKZG 3CC4A 2HIVA 5M3FG 1EIFA 2KBNA 2K14A 1CUKA 2DGYA 2MNAA 2Q2UA 2LSSA 2JA6G 1VQFA 2JA7H 1LUZA 2F52A 2UXBL 2NZHA 1YJ9A 4OXPA 4IPCA 1G291 4DNIA 3HOZH 3RN5A 5M5WH 2JA5G 2OTJA 1VS0A 1PH2A 2BH2A 1BKBA 1XTDA 4YY3L 1OXTA 3FKIG 3OTOL 2Q2IA 4DK3C 2ZM6Q 1VQ8A 4HIMA 4KI0A 3H3VH 4QGUA 3J81j 3CPFA 1PFSA 3E9HA 3GTKH 2NZOA 1YBYA 4DR5Q 4JI6L 1X54A 1J6QA 3HKSA 3J80i 2NVTH 2V1CC 3K0XA 3U58A 2R93H 4AYBG 2VZAA 3J81c 4DV4Q 1HNZL 2VNUD 1WYDA 1K83H 2RF4A 1WCMG 4DV2Q 4A3LG 4GKJL 4JI8Q 2UUBL 4POFA 1XMQQ 2VY3A 2EXDA 1XNQL 4IFDJ 1YHBA 1IXRA 3PUYA 2ZTCA 1PH3A 1WOCA 4DK6C 1VQEA 2CQOA 3GD7A 2ZJRA 4DV3Q 4LUOA 4LFAL 2VUMH 3HOVG 3CMAA 4FDBA 2HQLA 4DR2Q 4GOPC 3HOXH 1E7ZA 3PIPA 3CMEA 1Y1WH 2MO1A 4B3RL 3S24A 3AFPA 4IOCA 1E3PA 1HZCA 5LMUL 4POGA 1PH6A 1QUQA 3ZJYC 4YCVA 2A8VA 3PIOA 4NXMQ 3RR5A 1PH7A 1W2BA 4NB3A 4GNXA 1UE7A 3PV0A 4X62Q 3CPWA 3TS2A 4KLKA 4YHHQ 3PUVA 3M4OH 1OXXK 4GS3A 2CKZB 4C3JH 1SN8A 3M4PA 1K8GA 2JA8G 1PVOA 3RLFA 2HHHL 4BA1I 3KJPA 3PO3G 2WP8J 4AIMA 4DV6Q 1SMXA 2K5NA 4JV5Q 2ID0A 3OW2A 3JAMi 4A3KG 2ZM6L 3CCSA 3GTMH 2R7FA 5JJIA 4IFDG 1YZ6A 4LF9Q 4OWTB 2PQAB 2PI2A 3D31A 3AYHB 2VQFQ 1R9TH 1VQLA 3T1HL 1VQKA 1SRUA 2UU9Q 4QJFA 2ZJQA 3HOWG 3WWVA 4DR4L 2CWPA 3L7ZC 1B7YB 3TS0A 2JEBI 2XTIA 5IP7H 3HOYH 2NVQH 1M90C 2D0PA 4A3GH 1LM0A 3H15A 4DV2L 1SFOH 1KC8C 4JI8L 2IX0A 2YV5A 4AH6A 4KHPQ 3J81i 1NJIC 3I4NH 1XPOA 4LF7L 2ZTDA 1QZHA 1VQCA 2R7DA 3MEFA 4HJ8A 4DV3L 1D7QA 4LF5L 5E7NA 4BA2I 4DR2L 1XMOL 1BBUA 3CC7A 1VQ9A 2VUMG 2MO0A 3E0EA 1QVCA 2D62A 2DUDA 1X6OA 2N8NA 4J15A 4A3IH 1JJ2A 4A93H 5J3BA 1NTGA 1L1OA 3GO5A 1HH2P 3NEMA 4TQUS 1Y1WG 2OCEA 2IHFA 4JC0A 4LF6Q 1X3GA 4NXML 2R7ZG 5IT9c 5IY0A 2ZJPA 3CCMA 4YCWA 4DV7L 3CCLA 3PGZA 4O0AA 3LGJA 4YHHL 5IP9G 3PUWA 4A3FG 1HNZQ 1X56A 3I56A 3M85A 4GNXC 1V1QA 4A3MH 2OQ0A 1RL2A 1YEZA 1YIJA 2AWOA 2JA9A 2XGTA 1WJJA 1K0RA 2UUBQ 4L5RC 3S14H 4GOPA 4GOPB 4OONA 1YITA 5IYDH 3S1QH 2NVYH 4PZ8A 4LFAQ 1GVPA 1RIPA 1N9WA 3TQYA 4X64L 3GTQH 3W5OA 1YI2A 3K7AH 1L2FA 4BXXH 4JI4Q 4JYAL 1UEBA 4YWKA 5LMUQ 1NE3A 4H02A 4DUYL 1K9MC 2UU9L 3MXNB 2WB1E 2F4VQ 2R92H 4O2DA 2HT1A 1KQSA 2Y0SE 4QL5A 5GQOA 3J7A5 2B29A 1IBKL 1IBMQ 3L0OA 3S2DH 5C44G 3TRZA 1XNRL 3HKZE 4KHPL 4A4IA 3HOUG 4R1JA 2K50A 1CKNA 3G71A
chains in the Genus database with same CATH superfamily
1ILQA 1WTPA 2HHHQ 4RH6A 1JCKB 2B3GA 4A3KB 2HCCA 1ZEQX 2VW9A 1WTRA 4RWSC 2VB2X 1EQQA 5IYCH 2JEAI 3T1HQ 1L1OC 4A3JG 1RTOA 4TSSA 1B9MA 3MAQA 3BZCA 3VDYA 3KBXA 1HNXQ 4BBSG 4TVAB 2A1AA 1PLFA 2FFKB 3FPPA 2I5LX 1JQYD 4IUPA 1AE3A 3PUZA 1HCZA 1HXYD 3UE1A 1I6HH 4PQXA 4HJ7A 2LXJA 2EPBA 4RKBA 1GUWA 1Y1WB 2Q8TA 1GD7A 2Z4IA 3RNUA 2QDBA 4UAIA 1IYVA 4I7AA 3NBIA 2BOSA 4ZRZA 1IBML 1KDBA 4DK1A 1PXUA 4OELB 2F4IA 1UE1A 3K5NA 2JYOA 1CSPA 3STBD 5C4ZA 4NXNL 2ICIA 1CZWA 2WFWA 4J1MA 3EROA 4DR3L 4LF4L 5JJLA 5EBCA 3GTPB 5JEAG 3KDFA 3KDFB 2EY6A 1D5MC 3I55A 2PMZB 1O7YA 3R8BA 1T9HA 5C0XH 5EKLA 2NVQB 5C44B 3MTSA 1KLGD 2WV6D 4P71A 4DA2A 5ELDA 1JOKA 3I4MH 5KRUA 4B3TL 2MFIA 1XX8A 4Q5VA 3TMEA 4DR6Q 3I3CA 5IYBG 1YHQA 1TY2A 1SEBD 3H0GH 4CBVA 1Q86C 3AB9A 1EZ8A 3SEBA 2UUCQ 5H1SE 4N8X1 4UP7A 4XDXA 4HIDA 3C2PA 2F0IA 1A62A 4RA8A 1X32A 2K5VA 1QZGA 1JJCB 1I50B 2UUAQ 2I46A 1I3QH 4G7OC 1EYCA 3ERSX 4KY5A 5I2XA 1JOOA 2KJXA 2O4XA 1ENCA 3UDIA 1PRTD 3MVVA 4N9TA 1KD1C 3CCVA 3NP8A 2OTLA 5C4XG 1NR4A 4I7ZC 1V9PA 1Y1VH 2F0WA 2PNRC 4DXGA 5FOBB 1C0AA 2RCNA 4KHZA 1JORA 3EJIA 3HOYG 3MFYA 1YJWA 2E74C 1ONLA 1SNMA 2EDGA 2TMPA 2Q2TA 4JI5L 5A35A 2K52A 2EY5A 3E9IA 2VQEQ 3T1YL 3BG3A 3UE0A 3NBHA 1VMCA 3CW2C 1I6VC 4LUZA 2XN9C 1Y14B 5C4HA 4MTKA 3HEJA 4DKAC 1LO5D 2EIFA 4BY1H 3J7AV 4K2LA 4R4QA 3I8ZA 2R93B 1N34Q 1EWIA 3S17H 4LJZC 4JOIA 5J39A 1M1KC 2F0TA 4LUVA 5GAGC 1S40A 1LTTD 2KCMA 1E22A 3OOCA 2NYZD 5BR8Q 1B44D 1K28A 1XXGA 1DOKA 1I6HB 1DGSA 3HOWH 2F0LA 1VQDA 3K57A 4RCOA 2VS1A 1MBYA 2K03A 1Q1EA 1CKMA 3D0FA 4QIWB 3STBC 3LNNA 2OEOA 1N33L 4HAEA 4K6DA 1DOLA 2J4XA 1G8ZD 1H9JA 3PCOB 1VQ7A 1T5XD 4XQNA 2K32A 1XWEA 4JI2L 2OQKA 1EYAA 3VA5A 3K8AA 2F0VA 4FXDA 1N32Q 2ATWA 4X66Q 1A0IA 1JWUD 2MPMA 3SK8A 5I2YA 2YYZA 4FF2A 2L4NA 1Z47A 2C35B 1KNAA 1VQHA 5M5YH 4EX5A 3AQQA 1EL0A 5IT9L 3CCRA 5IGFA 3HGBA 1W3SA 3RMHA 4U68A 2B2TA 1A2UA 2NZ1D 2F0SA 1PZID 5FO9B 4X6AH 3U4VA 4LMQD 4LFBL 2PZTA 2JP1A 2WIIB 4ALPA 2EQSA 4QY7A 2M2LA 3ND9A 4DR5L 1IYUA 4GKKQ 5IE8A 3W1BA 2E2IH 5LMNQ 1XTCD 3KF6B 5D14A 2J0TD 1G6PA 2GVBA 3D6WA 2JA6H 2IY5B 2TSSA 4GLXA 1PRTC 1TWAH 3HOUH 1GUGA 3R93A 2MUYA 2YTVA 1A3VA 2UXBQ 5CBEE 3NWTA 1SROA 1U0LA 1FVIA 3BVZA 1STGA 4KKSA 2EZVA 2NVYB 1JC7A 4YY3Q 5ELNA 1HNWQ 5M5XH 1QCBD 5ELFA 5AJ3L 1VQNA 1WTXA 2E2JH 4R8NA 1Y1VB 1A6XA 3MXGA 4KK7A 3S1RH 1X65A 3VYTA 2OT2A 2R92B 1TWGH 1F9QA 1PTOF 3KF8A 3KF8B 2F03A 1DJRD 3DWPA 5C0XG 4PNYA 1KRTA 2PQEA 1J5EL 3I4LA 3I4MG 3SDZA 3QOLA 3GTGH 1GJXA 1P16A 2Q8IB 4DAMA 4LF9L 1SAPA 1ICFB 2IPKD 1IL8A 2WKCA 1VCIA 3H0GG 2H1EA 3ONAB 1SMYD 2HIVA 2KBNA 2K14A 4BY1B 2LSSA 1E2WA 1SE3A 4PV1C 2JA7H 5ELEA 4K5XA 1TKWB 2EJGC 1G291 3W3AA 4OXPA 4DNIA 3X3MA 3JAME 3RN5A 2K1BA 2VXWA 1VS0A 2F0FA 2EJMA 1TU2B 4HIMA 3GV3A 3GTKH 2LMCB 3E9HA 2NZOA 1C48A 1YBYA 1S5FD 5EKKA 3K0XA 1BBXC 1HNZL 2RSOA 3QR8A 2D5DA 4GKJL 4XQQA 1CA6A 2ZJRA 4WFN3 4FF3A 4FDBA 4V190 3HOXH 4DK0A 1QJOA 4RGNA 2IWHA 4B3RL 3K0YA 4IOCA 1E3PA 4POGA 1WD0A 1TWHB 3PIOA 4NXMQ 4GNXA 2N55A 4X3SA 4X62Q 2B2WC 3U9SA 2CKZB 3EA6A 1B1ZA 1B3QA 1PVOA 3K5LA 1TS4A 4ZYSA 1LT6D 1OO9B 4UDUC 2ZM6L 3CCSA 3K5MA 2R7FA 1CQFA 4G57A 5C3WA 2PI2A 1R9TH 1LLRD 5M3FB 2ZJQA 1SRUA 1I4PA 3HOWG 4DR4L 2E2IB 1JB3A 2CWPA 3L7ZC 3H3VC 3TS0A 5IP7H 1M90C 1YNJD 2JA6B 1AZPA 1KAAA 4RAUC 1PDQA 2IX0A 2YV5A 2F0GA 4AH6A 4K14A 1XPOA 2E2HB 2ZTDA 1VQCA 3MEFA 4HJ8A 3OWFA 4LF5L 1JWMD 1J9OA 1BBUA 1CI3M 3CC7A 2VUMG 4J15A 1JJ2A 4A3IH 3A55A 3D3RA 1SYFA 1HTLD 1KLUD 1L1OA 5M5XB 3R2TA 2E2JB 2A73B 2LFNA 1BR9A 5IY0A 1LTSD 3S1RB 4YCWA 1TWGB 3LGJA 5KNCA 4YHHL 3QO2A 2A6ED 1V1QA 1RL2A 1WJJA 1R4QB 4KD4A 4RGTA 4OONA 1YITA 3LWEA 5IYDH 3S1QH 3GTQH 3DMUA 1YI2A 3GTGB 1L2FA 4HSPA 4BXXH 5AFWA 1WTOA 1DXMA 4BWGB 2UU9L 4XT1B 3IKJA 1QG7A 1STEA 1AW7A 2F0NA 4HR7B 5CV8A 2G9HD 5GQOA 1IBMQ 2EYOA 3L0OA 3D6CA 2LS01 3HOUG 4R1JA 4QUFA 1MI2A 2IHEA 2ASBA 2F3WA 1K0SA 4K6LA 1A63A 4IUNA 5NUCA 4JPBW 5JEAH 4LF4Q 3A74A 3GP7A 1K8MA 2NTTA 1QVGA 5EAYA 3GTKB 4A93G 3CRKC 2YU9H 2V4DA 4QMGA 4OIKA 2K6AA 4L5TA 4H13C 3SE0A 5CV7A 2BDNA 2HCIA 4IPDA 3A56A 4KY6A 4WJ4A 3S16H 3PSIA 4BY7H 4B3TQ 1LYLA 5D65A 3TDQA 5KGUA 3K59A 2E5LL 4AYBE 1SJED 5IYBH 2XVSA 1LTLA 4DV1L 3A5UA 2RHQB 4ME3A 5ELBA 4DNRB 2KECA 3MHBA 1B50A 4MNOA 1D5XC 1PZKD 1C8CA 5C3EH 1VQ5A 1BQQT 1EUJA 1UE6A 1QUQB 5TSSA 3PO2H 5CV6A 4RMFA 2EXZA 3M3YH 4DV7Q 3L3OC 4A3FB 1I4XA 1X3PA 5D3DA 4C1NI 4RKLA 3T56B 3ULJA 4DFAA 2JA7G 2KENA 1V1PA 1V1PB 5KEEA 4J6HA 2RCFA 2KEEA 5C4XH 4TKOB 2N49A 1HUMA 1JOQA 1RHPA 4KN7C 4A75A 3S9WA 3H91A 1PA6A 4JYAQ 1H9SB 3BDCA 3ER0A 1R9TB 4L5SA 1EQRA 1UE5A 4Q0FA 5JVH3 4DUYQ 3J80L 2SOBA 4P75A 4JI3L 3I7FA 4F7XA 3GQBA 2NN6I 1ASZA 1NR2A 1XNRQ 4HIOA 1TS5A 4IN3A 1E1TA 1Q8KA 4ID6A 3G4SA 1EOTA 4BBRH 1BO0A 1WTQA 3PF4A 1ZKOA 1X3FA 2XSCA 5C0XJ 3HOXG 4C3HG 3A5ZB 2A6EC 1S4ZA 1A8VA 3ULPA 5IT9E 1L0WA 3FVQA 4OX9L 3FP9A 3U4ZA 2AQ2B 1OXUA 4H7BA 1VQ6A 2M00A 3URYA 2DJFC 2QEXA 4JI1Q 3M9BA 1Q3LA 4B3SQ 3OMGA 3JAML 2KOLA 1NMFA 3NWSA 4JVZA 2E76C 2AMCB 3GTQB 5CC4A 4X3UA 2E8GA 3LX0A 3A8IE 1V43A 1HZ9A 1WCMH 2GVAA 4A3DG 3D8GA 3NSWA 2J7ZA 4QCLA 5IP7G 1E24A 1PTOD 1N33Q 3M7GA 2NBFA 1EWHA 3HOVH 2F0DA 3OMCA 3IAYA 3BVGA 3W2DA 2WAQG 3G48A 2L12A 5M5WB 2SDFA 4JI2Q 2EOTA 2Z6KC 1HA5A 1KAWA 4JI0L 4B3ML 4A3IG 2YU9B 1E0BA 4JBWA 1PH9A 1KTKA 3KOJA 1JWSD 5GROA 1N36L 1K83B 3PO3H 3S16B 5IWAL 3JAMc 4BY7B 1SE2A 1KHIA 5FKAC 4LFBQ 1D2BA 3A0JA 4IUUA 2B2VC 5IYDG 2MQHA 3GTJH 4KV6A 1O80A 4XT3B 3OHXC 4IJLA 4DR7L 1MIUA 1MHWC 4BXXG 1G2TA 1ENAA 2QGQA 3PO2B 1KXLA 1U4RA 4K0KL 4H0LC 2K75A 3M3YB 2NN6G 4NPSA 5HY6A 1O7ZA 1K3BC 3W1GA 3RN2A 1QILA 1VQAA 3HP3A 2I5MX 1JB7A 1STNA 4LFCL 1H95A 1D5ZC 2RDFA 3D4RA 2L15A 2EE1A 2VL6A 1U4LA 5C4XB 4JI7Q 1IBLL 4X65L 2R7ZH 5AJ3Q 2BA1A 3R2IA 3CKIB 2HD3A 4R4CA 1TWCH 1K3RA 3N6RA 3HOYB 4UY8C 2WKDA 3V05A 4DV5Q 2E75C 2F0UA 1SYGA 1J5EQ 1F9RA 3S2HH 1HR0W 4BY7G 3CD6A 2EYMA 4FP5D 5ELCA 3RLNA 5EPJA 3T53B 1I4GA 2B2YA 4JG2A 4BBRB 1TWFH 3LWUA 1S72A 3S15H 1BVSA 1LV9A 2OF1A 2CQAA 2UXCQ 1GO3E 1O7IA 4IALA 2KA7A 1HRJA 2RQXA 5JPNC 5C3EG 2N78A 2AWNA 2RSNA 4TRDA 1SNCA 5LMNW 3PO2G 1JT8A 1SYDA 3BYYB 4GN4B 3CCQA 1S5CD 4YCUA 1CK1A 3SK4A 3Q6SA 4RG1A 1MJEA 1P8LA 2MP1A 1WTVA 1L0XB 2NWGA 3MXUA 5LL6X 4QIWE 1VQ4A 4MHEA 4S3SA 4JK1C 3D4WA 3GTLH 4DR1L 3NTIA 5CR3A 1EY8A 1PTOC 1B8AA 3BU2A 2CCZA 1CA5A 4PMWA 3CAMA 4LF8L 3VR4A 3CRLC 2JXMB 2PW5A 3ICEA 3H3VI 1QWYA 4XIGS 1WCMB 5E3FA 4JW0A 1Z6HA 4LNQA 1EYGA 4GKJQ 2RHSB 4HJ5A 4CGYB 4DV6L 3S1MH 2G9DA 4ZAIA 5FLMG 4F88A 2WB1G 2K04A 1Q8IA 2XRSD 1WFQA 2QA4A 1JICA 1S5ED 4B3RQ 3NBHB 4XTCS 1AE2A 4BBRG 1BF4A 3OWEB 1PH1A 4QQBX 2B2UA 3HKZG 3I91A 3CC4A 2B2WA 5A2QE 1CUKA 3NQTA 2Q2UA 2MNAA 1SNDA 1VQFA 1LUZA 4HSVA 3EVQA 3PO3B 2F0QA 3HOZH 3KUPA 2RKSA 1PH2A 3M4YA 2F0KA 3HZXA 1OXTA 2ZM6Q 2Q2IA 4DK3C 1I4QA 3GTJB 4QGUA 3EFXD 5CBAE 1A3UA 4JI6L 1HPCA 3OIPA 1EYDA 2D9UA 3J80i 2NVTH 4DV4Q 1TY0A 1WCMG 1I4RA 2UUBL 1XMQQ 1D6EC 2KQ3A 4IFDJ 3VR6A 1IXRA 2M9VA 3PUYA 5FLXL 2ZTCA 5DAUA 2CQOA 3GD7A 5G3LF 4LFAL 3HOVG 2VUMH 3CMAA 2DN8A 2FJ2A 1X3QA 4GOPC 3NQIA 2K28A 1NNXA 2B8GA 3U9OA 1CQVA 1MSGA 1B3AA 1HZCA 5LMUL 1AFPA 1PH6A 1AZQA 2A8VA 4IQZA 1W2BA 1BCPC 1UE7A 5I9OA 3PV0A 2PYKA 1TWCB 4CKCA 3TS2A 4YHHQ 3PUVA 1OXXK 4ZKBB 1Y8PB 3NXWA 4C3JH 1SN8A 1SYCA 3RLFA 2HHHL 3I4MB 3PO3G 1CM9A 3S2HB 1SMXA 3PIP3 2HDMA 2K5NA 4JV5Q 2RDGA 3OW2A 3JAMi 3K58A 3GTMH 5JJZA 4ILWA 3H0GB 3I72A 4OWTB 3S15B 3D31A 3FRPB 2VQFQ 3T1HL 1VQKA 2UU9Q 4QJFA 2K33A 1O7LA 2PW7A 1UEAB 1B7YB 2DJGC 2XTIA 3T13A 3T51B 4A3GH 1F9SA 1BDOA 4DV2L 1G6ZA 1ENFA 2CW0C 1I3QB 3OW7A 3VR5A 3E0JA 1TVXA 1VQ9A 4CKEA 3E0EA 2DUDA 4A93H 3GTLB 5JPMC 2PPBC 3BDLA 3GO5A 4TQUS 3J80E 3SHLA 1FNVA 2QDLA 2R7ZG 1ICWA 5IT9c 1DZ1A 5D3IB 2ZJPA 3CCMA 1K8OA 4K5WA 1X56A 3M85A 2L0CA 5EQ0A 1LACA 4A3MH 2OQ0A 4L5RC 2JA9A 1K0RA 5FK9C 3Q24A 2E2DC 3T4AC 1GVPA 1N9WA 3MEHA 5E4XA 4LK1C 3K7AH 2ZXRA 4KKTA 4YWKA 4DGZA 4O2DA 2HUGA 1HFGA 1J8IA 2Y0SE 4QL5A 2B29A 1SXTA 3S2DH 2ZXOA 3S17B 1X3EA 1CKNA 1SNPA 1EQVA 1JE4A 3F1ZA 3I4NG 3DM1A 3KYHC 1BNZA 4FXGC 2IX3A 4HN7A 1I4HA 3GTOH 4ZCKA 3L9AX 1Y69U 3U50C 3DXJC 3GV6A 4LF6L 2JQOA 3A7LA 4DAYA 1PH8A 4C3IH 3HOWB 1II3A 5CMDA 1PH5A 3PUXA 4YWMA 1UUPA 3F2BA 4JI3Q 5M3MH 2AHOB 4DPGA 1OTCA 5HGQA 1SJHD 4JBJA 5IODA 1KDCA 4ULLA 5JEAJ 4APVA 2KCTA 4OHJA 1HZAA 4G7HC 4LF7Q 1PYBA 1EY6A 3S1NH 2VUMB 1EOVA 1OXSC 1ZYRC 2LXKA 3GDEA 2EY2A 1XMOQ 1H9KA 4C3HH 3F8TA 3C46A 3UI2A 2F4VL 1KRSA 1JMCA 3TP7A 3DM3A 4X3KA 1Q81C 4GNXB 4OX9Q 4JBKA 1F2MA 2SEBD 4K8JA 2AQ1B 5M5YB 2L9HA 2FXQA 4C3JB 1BCPF 5KIXA 4LW1A 3HOZG 1GKHA 3BZKA 1H9RA 2EY1A 1NY4A 1PTOH 4F87A 2HQEA 4X64Q 3GTMB 1LTID 4UP8A 3CP0A 1G91A 4A3DH 1SYEA 3BDOA 1EIGA 2R3ZA 1GUOA 3CCEA 4A3EG 1I94L 2CH4A 3QJYA 2EYLA 1Q46A 1IW7C 2JK8A 5CV5A 1TWAB 1VQBA 1K8AC 3HOUB 5C4JH 1IBKQ 2JJQA 4Y7NH 4FNFA 4Y52H 5BR8L 4RHRA 5BN5A 5KYLA 1U9RA 1LT3D 3BZDB 1U4MA 2EYFA 2XNAC 3P20A 4A93B 1ASYA 4JI0Q 1NBWA 1L1OB 4B3MQ 2F3IA 2UXDL 2NUCA 5T1GA 1CHQD 3KBGA 2XWBB 3KFUA 4P72A 1FYCA 1CT1D 4B9WA 1WD1A 4GLVB 4IO9A 3VR2A 5HGTA 1N36Q 4PMBA 1H9MA 5A2QL 3TBIB 1F9PA 2JA5H 2A68C 3P75A 4OGQC 4A3MB 4G7ZC 5DLQE 4AQYL 3RZOH 2ALYB 1D8LA 1ESFA 4C3JG 2X69A 1G51A 2RBMA 3K81C 2K4KA 4EQPA 1PFNA 1X55A 1QOHA 5I4DA 3CC2A 5FO7B 4A3LH 1RCVD 2BDOA 2NN6H 1UNSA 4J8QA 1PYSB 5LL6S 4K0KQ 1HA6A 4A3BG 2Z6BA 3L2PA 1HR0L 4MZ9A 1CTMA 3HS0C 4A3GG 3S2DB 2JA7B 4DV0L 3J81L 3J7AF 2L11A 2QW7A 5F2DA 1F77A 2B2TC 4NXNQ 3SR1A 1VQMA 3I73A 4ZUIA 5K36G 4WJWA 2HDLA 2K5WA 3DHQA 4DR3Q 2Y0SG 1SE8A 2A74C 3KLSX 3GTOB 1IBLQ 1E1OA 2G5DA 4X65Q 1BBWA 2PO4A 5LMNL 4XXEA 3NELA 2ZT9C 1E2ZA 3RLOA 4JBMA 1PFMA 4K2KA 2XWJB 4QF4A 4HCSA 3R3OA 4IPGA 2JA8H 2C5CA 5C5MA 4QB4A 1W6KA 3ULLA 4A3KH 4A3MG 1NAPA 2MJ8A 3NE5B 3IL8A 2AKWB 1WI5A 4H44C 3S1NB 1HNWL 3AEVA 3HOXB 1B4OA 4OWXB 4HMJA 4C3HB 3WDNA 2PCFB 5J1ZA 1FNWA 1TIID 4CJ2C 1Y8OB 3M4QA 3CXCA 1YJNA 2I5HA 3VA7A 3B6YA 2HIXA 1S3OA 5I6WA 5G3LD 3DEOA 2L55A 3NTKA 4L63B 3CHBD 5FJ8G 4NMZA 4GLAC 4DR1Q 1FR3A 2KCCA 4R4OA 3AMUA 3KLWA 3T16A 1TR5A 2Z0SA 1Y8NB 1YNND 4A3DB 4LF8Q 2EVBA 4JCVE 4C3IG 4N8FA 4BS9A 4YWLA 4WORA 3TREA 1VQIA 1U4PA 1ET9A 3RZDH 5FLXE 1PV4A 1ET6A 5M3MG 1PHJA 3DLLA 3F2DA 4X3TA 5C4JB 5FLMH 2AUJD 1VQJA 2WAQB 4Y7NB 1STYA 3M7NA 3AU7A 2GN5A 3J7ZC 3FEWX 3GTPH 3QWNA 2ZTEA 4PMCA 4JI5Q 4NKLA 1QNKA 5EGTA 4CKBA 1MD2D 3T1YQ 2PQAA 4L5QA 4A76A 1C4QA 3IFDA 4RHSA 4A3IB 4EQOA 5COYA 1FJGL 1VQOA 4FF4A 4XYQA 2NVXH 3KLSA 3A8KE 5GAHC 5C44H 1E2VA 4HJ9A 3G6JB 5C5LA 3PF5A 1IKMA 4GN5A 3K80C 3CCJA 3CF5A 2JA5B 4FYDA 3RZOB 1VMPA 4DUZL 1S5BD 2CVRA 4PZ6A 1GHKA 1K73C 3S1QB 1U5KA 4RGMA 1ILPA 3J80c 1A2TA 1HUNA 2IX1A 4JI6Q 5IGCA 1S5DD 4AYBB 3CQZH 4X62L 2Q8RE 1I50H 1B9NA 3C3LA 4RFBA 4C1NK 2RDHA 1QE6A 2PMZE 5EKIA 2A5HA 4A3CH 4G4KA 3I2ZA 2I07B 1UWVA 2A19A 2D0OA 3MXNA 4B9XA 1EIFA 3QG1A 5JAVA 1DOMA 3A8JE 2DGYA 4HCEA 3KLRA 2JA8B 3MXPA 3PMFA 2EYPA 3QIAA 1SNOA 4ZQ3A 2H4OA 2JA5G 4ODGA 2F0PA 2OTJA 5BN3A 1EY4A 1BKBA 2P5ZX 3OTOL 3PQIA 4KI0A 3H3VH 3J81j 3CPFA 1PFSA 1RJTA 1EU4A 4DR5Q 1EY7A 4FVMA 5C3EB 3HKSA 1PRTB 2CHBD 1WTWA 2V1CC 3U58A 2R93H 2MGSA 4AYBG 4U673 2Z1CA 4A3LG 2RF4A 4DV2Q 4POFA 3Q23A 1XNQL 1YHBA 3NK9A 4LUOA 1YNNC 2HQLA 3S24A 3AFPA 2F3VA 4HTHA 4NB3A 1TS3A 1D1IA 3CPWA 4KLKA 1CHPD 4GS3A 3M4OH 3ITPA 3RZDB 1K8GA 2JA8G 4BA1I 3Q22A 1BCPD 2WP8J 2WB1B 5EPKA 4R9WA 4N9PA 4NP5A 1BUVT 1EQTA 4A3KG 4KD3A 3OSOA 3HG9A 5I6YA 3PIO3 4LF9Q 4FF1A 2O2LD 1LTAD 3HKZB 3OIQA 3AYHB 3P7JA 1EY5A 3D4DA 4OIJA 1TS2A 1VQLA 3WWVA 4LAAA 2JEBI 3ND8A 1SNQA 1SBBB 2NVXB 3VYSA 5IGGA 2D0PA 2QILA 1LM0A 3H15A 4O1NA 3QB3A 1SFOH 4JI8L 1Q90A 3J81i 2JN4A 3I4NH 1CZGA 4DF7A 1QZHA 4DV3L 1D7QA 5E7NA 4ZK9B 4DR2L 3EQLC 2D62A 1MGSA 3BYTB 2CW0D 5J3BA 3NEMA 1HH2P 4LF6Q 1Y1WG 2IHFA 4EQNA 2KUMA 4KY7A 4DV7L 3CQZB 5CV4A 2KHSA 3CCLA 2BE5D 3PGZA 4O0AA 5E4WC 1HNZQ 3I56A 2A6HC 1SE4A 2Z9HA 2F0JA 4ME5A 3HOVB 1QNUA 2QKIC 3S14H 2NVYH 2O5IC 3MFGA 1RIPA 3TQYA 4IUTA 2ZXPA 3F2UA 4JYAL 1UEBA 4ZLTF 4DAPA 4DUYL 4H02A 2AUKA 2F4VQ 2R92H 1DYQA 3SK5A 1GOZA 1B53A 5ISRA 3J7A5 5C44G 3TRZA 1XNRL 4E6IA 4KHPL 2K05A 3A7AB 3DUZA 3K5OA 4WJ3M 5DM73 4CDCC 4EGVA 4MTNA 4DU9A 2DNCA 1DCZA 1G2SA 4A3EH 4CHTB 4DR4Q 3QOJA 3H6MA 1I94Q 1IZ6A 3E5SA 3J81E 3K6OA 4V0BA 1CKOA 4UPAA 4JI1L 5C0XI 1YHAA 2B63H 1Q7YC 4B3SL 4IUQA 2Z4HA 4HEDA 2FMCA 4LF5Q 4CJ1B 2A69D 1XYIA 4IUVA 1XPUA 2IJ0A 4JI4L 4HMIA 3IFTA 3FDTA 4A3CG 2R7ZB 2UXDQ 3EIVA 2CH4W 1ZYRD 4NDXA 2OWOA 2F0OA 4ZKCB 1CSQA 1Q82C 2RA4A 4EQ5A 1EU3A 1CFMA 3M4OB 4HJAA 1LTRD 4F8MA 4AQYQ 1EY9A 3C1EA 5JJKA 1EY0A 4R4IA 5J22A 1O78A 4I65A 1Z9FA 1B2TA 1B70B 3Q8DA 1TWHH 3O13A 1TWFB 2QCPX 1SDFA 5DNFA 5IYCG 2KHJA 4KJOA 5K5PA 1GM5A 3I4OA 4A3BH 3NTHA 1KL9A 1D1KA 1HHVA 4ZUJA 1HJPA 4OO1H 4K8IA 1F2ZA 4OEMB 5FLXc 2BH8A 1HNXL 1HR0Q 2R93G 1SFOB 3K7UC 1OXVA 2H5XA 4DV0Q 3HFZB 3I4NB 1JJGA 5K36H 2IW3A 2OXPA 4L8JA 3CU7A 5KNBA 5GADC 5LHY1 4KHVA 1IW7D 4IPHA 4M1UB 1NSNS 2NTSA 2CFMA 2BE5C 1W6JA 5M3FH 1IHZA 4Z9CB 3KF6A 4HIKA 1STHA 4C2MH 1RODA 2L1BA 4IURA 2O5JC 4DXFA 2Q2HA 1SLJA 1LT4D 4LWCA 4P74A 1IYJB 1NUCA 3NPPA 1QVFA 1Q12A 1DM0B 1QB5D 2E2HH 1LABA 3DWAA 1ZXTA 1HFNA 2E5LQ 3S14B 3FKIH 3NENA 3S1MB 3IRBA 1DD2A 4DV1Q 4JI7L 1JE5A 5EJWA 1RTNA 1KIXA 2A68D 1EEID 2EJFC 3DWQA 2ES2A 3EN2A 2K5DA 4GN3B 3I90A 3UDXA 3CCUA 1M8AA 1EWCA 3HRZC 4DV5L 1C7YA 3ERQA 1IL2A 4FXKC 4PZ7A 1VQGA 1PH4A 2PI2E 1A15A 2ENBA 4PG3A 5E1FA 1CKNB 1XJVA 1YVCA 4RGOS 3HOZB 4QUCA 4DR6L 3J7YW 1KNEA 1T5EA 5FJ8H 2YTYA 3BJUA 5I9PA 2EYJA 3SGIA 1HQRD 2UXCL 5CV9A 2B2YC 3V2TA 5KNDA 1EFWA 2I0QA 4DAYB 2UUCL 1STBA 3C1FA 2FINB 4A3EB 1AH9A 4UP9A 3TP6A 1I5FA 5IIFA 2UUAL 2NB0A 2NVTB 1TQOA 3G6EA 1GUSA 3JC66 2A69C 2F0EA 2R6GA 4KMUC 4DN4M 4OL7A 3FHWA 1MJCA 2KVMA 2B63B 4OO1I 1Q1BA 2FHTA 3TP5A 4IFDH 1NMGA 3E6ZX 3MA2B 1EZ6A 1FGUA 3UDFA 1FJGQ 3I70A 1IKLA 1FL0A 1Y1VG 2PNHA 2KHIA 1EIYB 1F2LA 4FO2A 2R92G 3A54A 3EBEA 5IGBA 5JVG3 2K01A 2K5HA 2K7VA 4KN4C 3F2CA 4DUZQ 2N3SA 2K5QA 1FD7D 2VQEL 1V1OA 1PFBA 1X9NA 2BA0A 5IGEA 4C56C 1C9OA 1VQPA 3V96A 1HQMC 2AQ3B 3FMCA 1SSOA 3WOFA 3AFQA 1TXYA 5IP9H 4A3FH 1M4VA 4A3BB 2B2UC 1HZBA 4BY1G 1N34L 2DY7A 4A3GB 3UDGA 1RD9D 5C6AA 2XRQD 3OYYA 1BXTA 1PYWD 1Z7TA 2Z8LA 5C3XA 3MWYW 4JOIC 2Z6KA 3OPOA 2N88A 2B39A 2B63G 1GXDC 4OWWB 2JE6I 2Y0SB 2F0MA 1XPRA 3KJOA 4P73A 4M8AA 1SR3A 5M9OA 2F0HA 5ELOA 4C2MB 2PZWA 4DV4L 4IOAA 1PMRA 3H94A 1VDZA 1YNXA 2D2CC 5DM63 1XMQL 2XIWA 1N8RC 5IWAQ 3BVMA 1PRTF 4DAVA 1RKNA 2B2VA 3FKIB 3SVMA 2QEJC 4IJHA 1RF2D 4GZYC 1N32L 1JR0D 3OTOQ 4X66L 5CGKA 2CWAA 4DNTB 3K7AB 4A3JH 3TSSA 4IFDI 4DR7Q 1L0YB 4BBSH 2B8FA 5HURA 2YTXA 2IT1A 4OO1G 2F1MA 1XNQQ 4CDEC 5GAEC 3TEHB 1SMYC 1WTHA 4LFCQ 4JV5L 2KCNA 1AP0A 1FNUA 5BN4A 3X3NA 5KYIA 1MKHA 1AEXA 2EYHA 4R4TA 2GA4B 3VR3A 4MN3A 2VQFL 4GKKL 2WAQE 2DY8A 4RCNA 4C3IB 5M3FG 2JA6G 1R4PB 2F52A 5M3MB 4WRDA 2UXBL 2NZHA 1YJ9A 4IPCA 3KK7A 5IOCA 4KTAA 1LTBD 5M5WH 1A3TA 3G7LA 5DEHA 1EEFD 2BH2A 5T1IA 1XTDA 4YY3L 3FKIG 1VQ8A 4P2CB 3ZYYX 1KDAA 2SNMA 3SXHA 1X54A 1J6QA 3E3XA 3DEPA 2QF7A 2VZAA 3J81c 4XYOA 2VNUD 1WYDA 1K83H 4KJNA 1VF5C 2LKVA 2VB3X 2BCOA 4JI8Q 2VY3A 5JOBA 2EXDA 5EBDA 4R8IA 1PH3A 3TZDA 1WOCA 2KEDA 4DK6C 1VQEA 4DV3Q 1VF7A 4DR2Q 4O42A 1E7ZA 3PIPA 1PTOB 1EIHA 3CMEA 1Y1WH 2MO1A 1QUQA 3ZJYC 4YCVA 3BS1A 1WVLA 3RR5A 3H09A 1PH7A 4B08A 2DNEA 4MIUA 3VYRA 3RUZA 2WACA 1RDPD 1GUTA 1KABA 3M4PA 1HTPA 3P1HA 3KJPA 4AIMA 2L5TA 4DV6Q 4XQJA 1DONA 3VYUA 2ID0A 1AN8A 4IZ8A 3N52A 1YNJC 5JJIA 4IFDG 1YZ6A 2PQAB 1H9SA 1UAPA 2R61A 1PZJD 2SNSA 3NUCA 3RD4A 3Q0AA 2LY7A 3HOYH 1NCVA 1F2YA 2NVQH 1MSHA 2PZUA 2RVLA 1KC8C 3FPUB 4KHPQ 2MHVA 1NJIC 4LF7L 3SK6A 2R7DA 1FGBD 4BA2I 1LTGD 1XMOL 4CDDC 5CORA 2MO0A 1QVCA 2N8NA 1X6OA 2X6GA 1NTGA 2C9OA 3MZ5A 2OCEA 4JC0A 1EFID 1X3GA 4L6TB 4A3JB 4NXML 3TP8A 1LT5D 4ABNA 4BBSB 5IP9G 3PUWA 4A3FG 4NW2A 4GNXC 4KKUA 1YIJA 1YEZA 2IL8A 2AWOA 2XGTA 4UHVA 4K5VA 2UUBQ 2X6LA 1GUNA 3TN2A 2ICEC 4GOPA 2JSOA 4GOPB 1TT2A 1STAA 5FO8B 4PZ8A 3TZUA 4LFAQ 1ML0D 4X64L 1SYBA 2A6HD 3W5OA 1V8QA 1ESRA 4JI4Q 5L37A 1BCPB 5LMUQ 1NE3A 1K9MC 4CDFC 3MXNB 2WB1E 3WOEA 4CJ0B 5EPLA 2HT1A 5CYUA 1KQSA 1BOSA 4EVOA 4YIJA 2WINB 5IGDA 3NHHA 1IBKL 3MC0B 1GHJA 2FMMA 3HKZE 4A4IA 2K50A 3G71A
chains in the Genus database with same CATH topology
2IHEA 2HHHQ 2ASBA 3F1ZA 3I4NG 4WJ3M 3KYHC 1A63A 2B3GA 4LF4Q 2VW9A 4MTNA 3A74A 3GTOH 3U50C 1QVGA 1EQQA 4LF6L 2JQOA 5IYCH 5EAYA 1PH8A 4A93G 4C3IH 2JEAI 2YU9H 1PH5A 4A3EH 3PUXA 4YWMA 3T1HQ 4DR4Q 4L5TA 1L1OC 4A3JG 1I94Q 3F2BA 4JI3Q 5M3MH 1IZ6A 4IPDA 2AHOB 4DPGA 1OTCA 3BZCA 3VDYA 1HNXQ 4BBSG 4WJ4A 5HGQA 4TVAB 3S16H 4JBJA 3PSIA 4BY7H 1CKOA 4UPAA 4JI1L 1LYLA 5JEAJ 5C0XI 2A1AA 4APVA 1YHAA 2KCTA 4B3TQ 2E5LL 1Q7YC 1HZAA 2B63H 4B3SL 4LF7Q 4AYBE 2I5LX 1PYBA 5IYBH 1LTLA 1AE3A 4DV1L 3PUZA 3A5UA 3S1NH 2RHQB 1EOVA 1OXSC 2LXKA 3GDEA 4ME3A 3UE1A 4HJ7A 2LXJA 1XMOQ 1I6HH 4MNOA 4C3HH 1XPUA 4JI4L 3F8TA 5C3EH 1VQ5A 1GD7A 1EUJA 1UE6A 1QUQB 3RNUA 1KRSA 4LF5Q 2F4VL 1JMCA 3PO2H 4A3CG 2UXDQ 3DM3A 3EIVA 4RMFA 1Q81C 4GNXB 2OWOA 3M3YH 1Q82C 4DV7Q 1CSQA 4OX9Q 4JBKA 4EQ5A 1IBML 3ULJA 2FXQA 1UE1A 4HJAA 2JA7G 2KENA 1CSPA 3STBD 4AQYQ 4NXNL 4LW1A 5JJKA 3HOZG 1GKHA 3BZKA 2WFWA 4R4IA 1NY4A 5C4XH 4DR3L 2N49A 4LF4L 5JJLA 1Z9FA 4X64Q 1B70B 3Q8DA 5JEAG 3KDFA 1TWHH 3KDFB 4A75A 4UP8A 3CP0A 1PA6A 4JYAQ 3ER0A 3I55A 4A3DH 5IYCG 2KHJA 4L5SA 1EQRA 1UE5A 4DUYQ 1GM5A 3I4OA 3CCEA 4A3BH 4A3EG 1KL9A 4P75A 1T9HA 4JI3L 1I94L 3I7FA 1Q46A 1HJPA 2JK8A 5FLXc 2BH8A 1HNXL 1HR0Q 2R93G 1VQBA 4P71A 3K7UC 1K8AC 3I4MH 5C4JH 1IBKQ 1OXVA 2NN6I 2MFIA 1ASZA 2H5XA 4DV0Q 4B3TL 1XNRQ 2JJQA 4HIOA 4Y7NH 3HFZB 1JJGA 4Y52H 5BR8L 1E1TA 5GADC 4DR6Q 1Q8KA 4IPHA 5IYBG 3G4SA 1YHQA 4BBRH 3H0GH 3PF4A 1Q86C 2CFMA 1X3FA 5C0XJ 5M3FH 1ASYA 3HOXG 1NBWA 4JI0Q 1L1OB 2UUCQ 3KF6A 5H1SE 2F3IA 3A5ZB 4UP7A 4HIKA 4C2MH 4B3MQ 2UXDL 4HIDA 1A8VA 3ULPA 3KFUA 1L0WA 1A62A 2Q2HA 4OX9L 1SLJA 3FP9A 4P72A 3U4ZA 4LWCA 2K5VA 4GLVB 4P74A 1JJCB 1OXUA 4IO9A 1QZGA 1IYJB 2UUAQ 1QVFA 1N36Q 1I3QH 1VQ6A 1Q12A 2JA5H 2E2HH 3ERSX 2QEXA 5DLQE 4AQYL 3RZOH 4JI1Q 2ALYB 1D8LA 3M9BA 3UDIA 2E5LQ 3FKIH 3NENA 1KD1C 4B3SQ 1G51A 3IRBA 3CCVA 4DV1Q 3K81C 4JI7L 1JE5A 2K4KA 1NMFA 2OTLA 5C4XG 2AMCB 1KIXA 1X55A 2E8GA 3CC2A 2ES2A 1V9PA 1Y1VH 3EN2A 4GN3B 1C0AA 1V43A 2RCNA 4A3LH 1HZ9A 1WCMH 2GVAA 4A3DG 4KHZA 3UDXA 3CCUA 4K0KQ 1PYSB 4A3BG 4DV5L 1C7YA 3HOYG 5IP7G 1E24A 3L2PA 4MZ9A 1HR0L 1N33Q 1IL2A 4PZ7A 4A3GG 1VQGA 1PH4A 1YJWA 4DV0L 3HOVH 2PI2E 4PG3A 1CKNB 1XJVA 1YVCA 2Q2TA 2WAQG 3G48A 4NXNQ 4DR6L 4JI5L 2K52A 1VQMA 5K36G 5FJ8H 4JI2Q 3E9IA 2VQEQ 2YTYA 2Z6KC 3BJUA 2Y0SG 1SE8A 3UE0A 4DR3Q 1KAWA 3SGIA 3T1YL 1IBLQ 2UXCL 1E1OA 4JI0L 3CW2C 4X65Q 1BBWA 1EFWA 5LMNL 2I0QA 4DAYB 4LUZA 4A3IG 2UUCL 3NELA 4B3ML 3RLOA 1Y14B 4JBMA 4JBWA 1AH9A 4UP9A 4DKAC 2EIFA 4BY1H 1PH9A 1I5FA 3KOJA 4R4QA 2UUAL 4IPGA 2JA8H 5GROA 1EWIA 3G6EA 1N36L 1N34Q 3S17H 3JC66 4JOIA 1M1KC 3PO3H 2R6GA 5IWAL 3JAMc 4LUVA 5GAGC 1S40A 3FHWA 2KCMA 3ULLA 1E22A 1MJCA 4A3KH 4A3MG 1KHIA 4LFBQ 4OO1I 1Q1BA 5BR8Q 2AKWB 1WI5A 3A0JA 1HNWL 1NMGA 5IYDG 3GTJH 2MQHA 3AEVA 1DGSA 3HOWH 4OWXB 1VQDA 1FGUA 3UDFA 1FJGQ 2VS1A 4IJLA 1MIUA 4DR7L 4BXXG 1FL0A 1Y1VG 2PNHA 2QGQA 1Q1EA 2KHIA 1KXLA 1EIYB 4K0KL 1CKMA 3D0FA 3STBC 2K75A 2R92G 3M4QA 2NN6G 3EBEA 4NPSA 1N33L 5HY6A 3CXCA 1YJNA 2I5HA 3W1GA 3RN2A 1VQAA 2K5HA 2I5MX 3B6YA 2HIXA 1S3OA 3PCOB 1JB7A 3F2CA 4LFCL 1VQ7A 1H95A 4DUZQ 2L15A 2N3SA 2VL6A 4JI2L 2VQEL 2OQKA 1X9NA 2BA0A 4JI7Q 3K8AA 5FJ8G 1C9OA 1IBLL 2ATWA 4GLAC 4X66Q 4DR1Q 1A0IA 1N32Q 4R4OA 4X65L 1VQPA 5AJ3Q 2R7ZH 3KLWA 2Z0SA 2BA1A 2YYZA 4LF8Q 4JCVE 3AFQA 1TXYA 5IP9H 4A3FH 1Z47A 2C35B 4R4CA 4YWLA 1VQHA 1TWCH 1K3RA 3AQQA 1VQIA 1HZBA 3TREA 4EX5A 5M5YH 4BY1G 1N34L 4UY8C 3CCRA 3RZDH 4DV5Q 3UDGA 1PV4A 1W3SA 5M3MG 1PHJA 3DLLA 3F2DA 3OYYA 5FLMH 4X6AH 1J5EQ 3S2HH 1VQJA 3U4VA 1HR0W 4LFBL 3M7NA 4JOIC 2Z6KA 3CD6A 4BY7G 2GN5A 3RLNA 3J7ZC 2B63G 4OWWB 3GTPH 2JE6I 2ZTEA 4JI5Q 4JG2A 2EQSA 4ALPA 1XPRA 4QY7A 1TWFH 3KJOA 4P73A 3T1YQ 2PQAA 4L5QA 4A76A 4DR5L 1SR3A 1BVSA 1S72A 3S15H 4GKKQ 5IE8A 1FJGL 1GO3E 1VQOA 1O7IA 3W1BA 2UXCQ 2E2IH 5ELOA 3KF6B 5LMNQ 5C3EG 1G6PA 2GVBA 2AWNA 2N78A 4DV4L 2NVXH 4IOAA 2JA6H 2IY5B 5GAHC 5C44H 5LMNW 4GLXA 3PO2G 4HJ9A 1TWAH 1JT8A 3HOUH 1X3EA 1YNXA 4GN4B 3PF5A 1XMQL 3CCQA 2YTVA 4GN5A 2UXBQ 3K80C 4YCUA 3CCJA 3CF5A 1N8RC 1SROA 4RG1A 5IWAQ 1U0LA 1MJEA 1P8LA 4DUZL 1FVIA 4QIWE 4PZ6A 1VQ4A 1K73C 4IJHA 4YY3Q 1U5KA 5ELNA 3GTLH 3OTOQ 1N32L 4X66L 4DR1L 1HNWQ 5M5XH 3J80c 5AJ3L 1VQNA 2CWAA 2E2JH 4A3JH 1B8AA 3BU2A 2CCZA 2IX1A 4JI6Q 4PMWA 3CAMA 4IFDI 4LF8L 3S1RH 1X65A 3CQZH 4DR7Q 4X62L 3ICEA 3H3VI 4XIGS 1I50H 4BBSH 1TWGH 4LNQA 3KF8B 2YTXA 1EYGA 4GKJQ 2IT1A 2RHSB 5C0XG 4HJ5A 4OO1G 1KRTA 1XNQQ 1J5EL 4DV6L 3I4MG 3S1MH 5GAEC 3TEHB 5FLMG 2PMZE 4JV5L 4LFCQ 2WB1G 1MKHA 1WFQA 3GTGH 4R4TA 1P16A 4DAMA 4LF9L 2QA4A 4A3CH 2VQFL 4B3RQ 3NBHB 3I2ZA 1AE2A 4XTCS 4BBRG 4GKKL 1UWVA 1VCIA 2A19A 3H0GG 2D0OA 1PH1A 2WAQE 4QQBX 3HKZG 3CC4A 2HIVA 5M3FG 1EIFA 2KBNA 2K14A 1CUKA 2DGYA 2MNAA 2Q2UA 2LSSA 2JA6G 1VQFA 2JA7H 1LUZA 2F52A 2UXBL 2NZHA 1YJ9A 4OXPA 4IPCA 1G291 4DNIA 3HOZH 3RN5A 5M5WH 2JA5G 2OTJA 1VS0A 1PH2A 2BH2A 1BKBA 1XTDA 4YY3L 1OXTA 3FKIG 3OTOL 2Q2IA 4DK3C 2ZM6Q 1VQ8A 4HIMA 4KI0A 3H3VH 4QGUA 3J81j 3CPFA 1PFSA 3E9HA 3GTKH 2NZOA 1YBYA 4DR5Q 4JI6L 1X54A 1J6QA 3HKSA 3J80i 2NVTH 2V1CC 3K0XA 3U58A 2R93H 4AYBG 2VZAA 3J81c 4DV4Q 1HNZL 2VNUD 1WYDA 1K83H 2RF4A 1WCMG 4DV2Q 4A3LG 4GKJL 4JI8Q 2UUBL 4POFA 1XMQQ 2VY3A 2EXDA 1XNQL 4IFDJ 1YHBA 1IXRA 3PUYA 2ZTCA 1PH3A 1WOCA 4DK6C 1VQEA 2CQOA 3GD7A 2ZJRA 4DV3Q 4LUOA 4LFAL 2VUMH 3HOVG 3CMAA 4FDBA 2HQLA 4DR2Q 4GOPC 3HOXH 1E7ZA 3PIPA 3CMEA 1Y1WH 2MO1A 4B3RL 3S24A 3AFPA 4IOCA 1E3PA 1HZCA 5LMUL 4POGA 1PH6A 1QUQA 3ZJYC 4YCVA 2A8VA 3PIOA 4NXMQ 3RR5A 1PH7A 1W2BA 4NB3A 4GNXA 1UE7A 3PV0A 4X62Q 3CPWA 3TS2A 4KLKA 4YHHQ 3PUVA 3M4OH 1OXXK 4GS3A 2CKZB 4C3JH 1SN8A 3M4PA 1K8GA 2JA8G 1PVOA 3RLFA 2HHHL 4BA1I 3KJPA 3PO3G 2WP8J 4AIMA 4DV6Q 1SMXA 2K5NA 4JV5Q 2ID0A 3OW2A 3JAMi 4A3KG 2ZM6L 3CCSA 3GTMH 2R7FA 5JJIA 4IFDG 1YZ6A 4LF9Q 4OWTB 2PQAB 2PI2A 3D31A 3AYHB 2VQFQ 1R9TH 1VQLA 3T1HL 1VQKA 1SRUA 2UU9Q 4QJFA 2ZJQA 3HOWG 3WWVA 4DR4L 2CWPA 3L7ZC 1B7YB 3TS0A 2JEBI 2XTIA 5IP7H 3HOYH 2NVQH 1M90C 2D0PA 4A3GH 1LM0A 3H15A 4DV2L 1SFOH 1KC8C 4JI8L 2IX0A 2YV5A 4AH6A 4KHPQ 3J81i 1NJIC 3I4NH 1XPOA 4LF7L 2ZTDA 1QZHA 1VQCA 2R7DA 3MEFA 4HJ8A 4DV3L 1D7QA 4LF5L 5E7NA 4BA2I 4DR2L 1XMOL 1BBUA 3CC7A 1VQ9A 2VUMG 2MO0A 3E0EA 1QVCA 2D62A 2DUDA 1X6OA 2N8NA 4J15A 4A3IH 1JJ2A 4A93H 5J3BA 1NTGA 1L1OA 3GO5A 1HH2P 3NEMA 4TQUS 1Y1WG 2OCEA 2IHFA 4JC0A 4LF6Q 1X3GA 4NXML 2R7ZG 5IT9c 5IY0A 2ZJPA 3CCMA 4YCWA 4DV7L 3CCLA 3PGZA 4O0AA 3LGJA 4YHHL 5IP9G 3PUWA 4A3FG 1HNZQ 1X56A 3I56A 3M85A 4GNXC 1V1QA 4A3MH 2OQ0A 1RL2A 1YEZA 1YIJA 2AWOA 2JA9A 2XGTA 1WJJA 1K0RA 2UUBQ 4L5RC 3S14H 4GOPA 4GOPB 4OONA 1YITA 5IYDH 3S1QH 2NVYH 4PZ8A 4LFAQ 1GVPA 1RIPA 1N9WA 3TQYA 4X64L 3GTQH 3W5OA 1YI2A 3K7AH 1L2FA 4BXXH 4JI4Q 4JYAL 1UEBA 4YWKA 5LMUQ 1NE3A 4H02A 4DUYL 1K9MC 2UU9L 3MXNB 2WB1E 2F4VQ 2R92H 4O2DA 2HT1A 1KQSA 2Y0SE 4QL5A 5GQOA 3J7A5 2B29A 1IBKL 1IBMQ 3L0OA 3S2DH 5C44G 3TRZA 1XNRL 3HKZE 4KHPL 4A4IA 3HOUG 4R1JA 2K50A 1CKNA 3G71A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IHE A;  2HHH Q;  2ASB A;  3F1Z A;  3I4N G;  4WJ3 M;  3KYH C;  1A63 A;  2B3G A;  4LF4 Q;  2VW9 A;  4MTN A;  3A74 A;  3GTO H;  3U50 C;  1QVG A;  1EQQ A;  4LF6 L;  2JQO A;  5IYC H;  5EAY A;  1PH8 A;  4A93 G;  4C3I H;  2JEA I;  2YU9 H;  1PH5 A;  4A3E H;  3PUX A;  4YWM A;  3T1H Q;  4DR4 Q;  4L5T A;  1L1O C;  4A3J G;  1I94 Q;  3F2B A;  4JI3 Q;  5M3M H;  1IZ6 A;  4IPD A;  2AHO B;  4DPG A;  1OTC A;  3BZC A;  3VDY A;  1HNX Q;  4BBS G;  4WJ4 A;  5HGQ A;  4TVA B;  3S16 H;  4JBJ A;  3PSI A;  4BY7 H;  1CKO A;  4UPA A;  4JI1 L;  1LYL A;  5JEA J;  5C0X I;  2A1A A;  4APV A;  1YHA A;  2KCT A;  4B3T Q;  2E5L L;  1Q7Y C;  1HZA A;  2B63 H;  4B3S L;  4LF7 Q;  4AYB E;  2I5L X;  1PYB A;  5IYB H;  1LTL A;  1AE3 A;  4DV1 L;  3PUZ A;  3A5U A;  3S1N H;  2RHQ B;  1EOV A;  1OXS C;  2LXK A;  3GDE A;  4ME3 A;  3UE1 A;  4HJ7 A;  2LXJ A;  1XMO Q;  1I6H H;  4MNO A;  4C3H H;  1XPU A;  4JI4 L;  3F8T A;  5C3E H;  1VQ5 A;  1GD7 A;  1EUJ A;  1UE6 A;  1QUQ B;  3RNU A;  1KRS A;  4LF5 Q;  2F4V L;  1JMC A;  3PO2 H;  4A3C G;  2UXD Q;  3DM3 A;  3EIV A;  4RMF A;  1Q81 C;  4GNX B;  2OWO A;  3M3Y H;  1Q82 C;  4DV7 Q;  1CSQ A;  4OX9 Q;  4JBK A;  4EQ5 A;  1IBM L;  3ULJ A;  2FXQ A;  1UE1 A;  4HJA A;  2JA7 G;  2KEN A;  1CSP A;  3STB D;  4AQY Q;  4NXN L;  4LW1 A;  5JJK A;  3HOZ G;  1GKH A;  3BZK A;  2WFW A;  4R4I A;  1NY4 A;  5C4X H;  4DR3 L;  2N49 A;  4LF4 L;  5JJL A;  1Z9F A;  4X64 Q;  1B70 B;  3Q8D A;  5JEA G;  3KDF A;  1TWH H;  3KDF B;  4A75 A;  4UP8 A;  3CP0 A;  1PA6 A;  4JYA Q;  3ER0 A;  3I55 A;  4A3D H;  5IYC G;  2KHJ A;  4L5S A;  1EQR A;  1UE5 A;  4DUY Q;  1GM5 A;  3I4O A;  3CCE A;  4A3B H;  4A3E G;  1KL9 A;  4P75 A;  1T9H A;  4JI3 L;  1I94 L;  3I7F A;  1Q46 A;  1HJP A;  2JK8 A;  5FLX c;  2BH8 A;  1HNX L;  1HR0 Q;  2R93 G;  1VQB A;  4P71 A;  3K7U C;  1K8A C;  3I4M H;  5C4J H;  1IBK Q;  1OXV A;  2NN6 I;  2MFI A;  1ASZ A;  2H5X A;  4DV0 Q;  4B3T L;  1XNR Q;  2JJQ A;  4HIO A;  4Y7N H;  3HFZ B;  1JJG A;  4Y52 H;  5BR8 L;  1E1T A;  5GAD C;  4DR6 Q;  1Q8K A;  4IPH A;  5IYB G;  3G4S A;  1YHQ A;  4BBR H;  3H0G H;  3PF4 A;  1Q86 C;  2CFM A;  1X3F A;  5C0X J;  5M3F H;  1ASY A;  3HOX G;  1NBW A;  4JI0 Q;  1L1O B;  2UUC Q;  3KF6 A;  5H1S E;  2F3I A;  3A5Z B;  4UP7 A;  4HIK A;  4C2M H;  4B3M Q;  2UXD L;  4HID A;  1A8V A;  3ULP A;  3KFU A;  1L0W A;  1A62 A;  2Q2H A;  4OX9 L;  1SLJ A;  3FP9 A;  4P72 A;  3U4Z A;  4LWC A;  2K5V A;  4GLV B;  4P74 A;  1JJC B;  1OXU A;  4IO9 A;  1QZG A;  1IYJ B;  2UUA Q;  1QVF A;  1N36 Q;  1I3Q H;  1VQ6 A;  1Q12 A;  2JA5 H;  2E2H H;  3ERS X;  2QEX A;  5DLQ E;  4AQY L;  3RZO H;  4JI1 Q;  2ALY B;  1D8L A;  3M9B A;  3UDI A;  2E5L Q;  3FKI H;  3NEN A;  1KD1 C;  4B3S Q;  1G51 A;  3IRB A;  3CCV A;  4DV1 Q;  3K81 C;  4JI7 L;  1JE5 A;  2K4K A;  1NMF A;  2OTL A;  5C4X G;  2AMC B;  1KIX A;  1X55 A;  2E8G A;  3CC2 A;  2ES2 A;  1V9P A;  1Y1V H;  3EN2 A;  4GN3 B;  1C0A A;  1V43 A;  2RCN A;  4A3L H;  1HZ9 A;  1WCM H;  2GVA A;  4A3D G;  4KHZ A;  3UDX A;  3CCU A;  4K0K Q;  1PYS B;  4A3B G;  4DV5 L;  1C7Y A;  3HOY G;  5IP7 G;  1E24 A;  3L2P A;  4MZ9 A;  1HR0 L;  1N33 Q;  1IL2 A;  4PZ7 A;  4A3G G;  1VQG A;  1PH4 A;  1YJW A;  4DV0 L;  3HOV H;  2PI2 E;  4PG3 A;  1CKN B;  1XJV A;  1YVC A;  2Q2T A;  2WAQ G;  3G48 A;  4NXN Q;  4DR6 L;  4JI5 L;  2K52 A;  1VQM A;  5K36 G;  5FJ8 H;  4JI2 Q;  3E9I A;  2VQE Q;  2YTY A;  2Z6K C;  3BJU A;  2Y0S G;  1SE8 A;  3UE0 A;  4DR3 Q;  1KAW A;  3SGI A;  3T1Y L;  1IBL Q;  2UXC L;  1E1O A;  4JI0 L;  3CW2 C;  4X65 Q;  1BBW A;  1EFW A;  5LMN L;  2I0Q A;  4DAY B;  4LUZ A;  4A3I G;  2UUC L;  3NEL A;  4B3M L;  3RLO A;  1Y14 B;  4JBM A;  4JBW A;  1AH9 A;  4UP9 A;  4DKA C;  2EIF A;  4BY1 H;  1PH9 A;  1I5F A;  3KOJ A;  4R4Q A;  2UUA L;  4IPG A;  2JA8 H;  5GRO A;  1EWI A;  3G6E A;  1N36 L;  1N34 Q;  3S17 H;  3JC6 6;  4JOI A;  1M1K C;  3PO3 H;  2R6G A;  5IWA L;  3JAM c;  4LUV A;  5GAG C;  1S40 A;  3FHW A;  2KCM A;  3ULL A;  1E22 A;  1MJC A;  4A3K H;  4A3M G;  1KHI A;  4LFB Q;  4OO1 I;  1Q1B A;  5BR8 Q;  2AKW B;  1WI5 A;  3A0J A;  1HNW L;  1NMG A;  5IYD G;  3GTJ H;  2MQH A;  3AEV A;  1DGS A;  3HOW H;  4OWX B;  1VQD A;  1FGU A;  3UDF A;  1FJG Q;  2VS1 A;  4IJL A;  1MIU A;  4DR7 L;  4BXX G;  1FL0 A;  1Y1V G;  2PNH A;  2QGQ A;  1Q1E A;  2KHI A;  1KXL A;  1EIY B;  4K0K L;  1CKM A;  3D0F A;  3STB C;  2K75 A;  2R92 G;  3M4Q A;  2NN6 G;  3EBE A;  4NPS A;  1N33 L;  5HY6 A;  3CXC A;  1YJN A;  2I5H A;  3W1G A;  3RN2 A;  1VQA A;  2K5H A;  2I5M X;  3B6Y A;  2HIX A;  1S3O A;  3PCO B;  1JB7 A;  3F2C A;  4LFC L;  1VQ7 A;  1H95 A;  4DUZ Q;  2L15 A;  2N3S A;  2VL6 A;  4JI2 L;  2VQE L;  2OQK A;  1X9N A;  2BA0 A;  4JI7 Q;  3K8A A;  5FJ8 G;  1C9O A;  1IBL L;  2ATW A;  4GLA C;  4X66 Q;  4DR1 Q;  1A0I A;  1N32 Q;  4R4O A;  4X65 L;  1VQP A;  5AJ3 Q;  2R7Z H;  3KLW A;  2Z0S A;  2BA1 A;  2YYZ A;  4LF8 Q;  4JCV E;  3AFQ A;  1TXY A;  5IP9 H;  4A3F H;  1Z47 A;  2C35 B;  4R4C A;  4YWL A;  1VQH A;  1TWC H;  1K3R A;  3AQQ A;  1VQI A;  1HZB A;  3TRE A;  4EX5 A;  5M5Y H;  4BY1 G;  1N34 L;  4UY8 C;  3CCR A;  3RZD H;  4DV5 Q;  3UDG A;  1PV4 A;  1W3S A;  5M3M G;  1PHJ A;  3DLL A;  3F2D A;  3OYY A;  5FLM H;  4X6A H;  1J5E Q;  3S2H H;  1VQJ A;  3U4V A;  1HR0 W;  4LFB L;  3M7N A;  4JOI C;  2Z6K A;  3CD6 A;  4BY7 G;  2GN5 A;  3RLN A;  3J7Z C;  2B63 G;  4OWW B;  3GTP H;  2JE6 I;  2ZTE A;  4JI5 Q;  4JG2 A;  2EQS A;  4ALP A;  1XPR A;  4QY7 A;  1TWF H;  3KJO A;  4P73 A;  3T1Y Q;  2PQA A;  4L5Q A;  4A76 A;  4DR5 L;  1SR3 A;  1BVS A;  1S72 A;  3S15 H;  4GKK Q;  5IE8 A;  1FJG L;  1GO3 E;  1VQO A;  1O7I A;  3W1B A;  2UXC Q;  2E2I H;  5ELO A;  3KF6 B;  5LMN Q;  5C3E G;  1G6P A;  2GVB A;  2AWN A;  2N78 A;  4DV4 L;  2NVX H;  4IOA A;  2JA6 H;  2IY5 B;  5GAH C;  5C44 H;  5LMN W;  4GLX A;  3PO2 G;  4HJ9 A;  1TWA H;  1JT8 A;  3HOU H;  1X3E A;  1YNX A;  4GN4 B;  3PF5 A;  1XMQ L;  3CCQ A;  2YTV A;  4GN5 A;  2UXB Q;  3K80 C;  4YCU A;  3CCJ A;  3CF5 A;  1N8R C;  1SRO A;  4RG1 A;  5IWA Q;  1U0L A;  1MJE A;  1P8L A;  4DUZ L;  1FVI A;  4QIW E;  4PZ6 A;  1VQ4 A;  1K73 C;  4IJH A;  4YY3 Q;  1U5K A;  5ELN A;  3GTL H;  3OTO Q;  1N32 L;  4X66 L;  4DR1 L;  1HNW Q;  5M5X H;  3J80 c;  5AJ3 L;  1VQN A;  2CWA A;  2E2J H;  4A3J H;  1B8A A;  3BU2 A;  2CCZ A;  2IX1 A;  4JI6 Q;  4PMW A;  3CAM A;  4IFD I;  4LF8 L;  3S1R H;  1X65 A;  3CQZ H;  4DR7 Q;  4X62 L;  3ICE A;  3H3V I;  4XIG S;  1I50 H;  4BBS H;  1TWG H;  4LNQ A;  3KF8 B;  2YTX A;  1EYG A;  4GKJ Q;  2IT1 A;  2RHS B;  5C0X G;  4HJ5 A;  4OO1 G;  1KRT A;  1XNQ Q;  1J5E L;  4DV6 L;  3I4M G;  3S1M H;  5GAE C;  3TEH B;  5FLM G;  2PMZ E;  4JV5 L;  4LFC Q;  2WB1 G;  1MKH A;  1WFQ A;  3GTG H;  4R4T A;  1P16 A;  4DAM A;  4LF9 L;  2QA4 A;  4A3C H;  2VQF L;  4B3R Q;  3NBH B;  3I2Z A;  1AE2 A;  4XTC S;  4BBR G;  4GKK L;  1UWV A;  1VCI A;  2A19 A;  3H0G G;  2D0O A;  1PH1 A;  2WAQ E;  4QQB X;  3HKZ G;  3CC4 A;  2HIV A;  5M3F G;  1EIF A;  2KBN A;  2K14 A;  1CUK A;  2DGY A;  2MNA A;  2Q2U A;  2LSS A;  2JA6 G;  1VQF A;  2JA7 H;  1LUZ A;  2F52 A;  2UXB L;  2NZH A;  1YJ9 A;  4OXP A;  4IPC A;  1G29 1;  4DNI A;  3HOZ H;  3RN5 A;  5M5W H;  2JA5 G;  2OTJ A;  1VS0 A;  1PH2 A;  2BH2 A;  1BKB A;  1XTD A;  4YY3 L;  1OXT A;  3FKI G;  3OTO L;  2Q2I A;  4DK3 C;  2ZM6 Q;  1VQ8 A;  4HIM A;  4KI0 A;  3H3V H;  4QGU A;  3J81 j;  3CPF A;  1PFS A;  3E9H A;  3GTK H;  2NZO A;  1YBY A;  4DR5 Q;  4JI6 L;  1X54 A;  1J6Q A;  3HKS A;  3J80 i;  2NVT H;  2V1C C;  3K0X A;  3U58 A;  2R93 H;  4AYB G;  2VZA A;  3J81 c;  4DV4 Q;  1HNZ L;  2VNU D;  1WYD A;  1K83 H;  2RF4 A;  1WCM G;  4DV2 Q;  4A3L G;  4GKJ L;  4JI8 Q;  2UUB L;  4POF A;  1XMQ Q;  2VY3 A;  2EXD A;  1XNQ L;  4IFD J;  1YHB A;  1IXR A;  3PUY A;  2ZTC A;  1PH3 A;  1WOC A;  4DK6 C;  1VQE A;  2CQO A;  3GD7 A;  2ZJR A;  4DV3 Q;  4LUO A;  4LFA L;  2VUM H;  3HOV G;  3CMA A;  4FDB A;  2HQL A;  4DR2 Q;  4GOP C;  3HOX H;  1E7Z A;  3PIP A;  3CME A;  1Y1W H;  2MO1 A;  4B3R L;  3S24 A;  3AFP A;  4IOC A;  1E3P A;  1HZC A;  5LMU L;  4POG A;  1PH6 A;  1QUQ A;  3ZJY C;  4YCV A;  2A8V A;  3PIO A;  4NXM Q;  3RR5 A;  1PH7 A;  1W2B A;  4NB3 A;  4GNX A;  1UE7 A;  3PV0 A;  4X62 Q;  3CPW A;  3TS2 A;  4KLK A;  4YHH Q;  3PUV A;  3M4O H;  1OXX K;  4GS3 A;  2CKZ B;  4C3J H;  1SN8 A;  3M4P A;  1K8G A;  2JA8 G;  1PVO A;  3RLF A;  2HHH L;  4BA1 I;  3KJP A;  3PO3 G;  2WP8 J;  4AIM A;  4DV6 Q;  1SMX A;  2K5N A;  4JV5 Q;  2ID0 A;  3OW2 A;  3JAM i;  4A3K G;  2ZM6 L;  3CCS A;  3GTM H;  2R7F A;  5JJI A;  4IFD G;  1YZ6 A;  4LF9 Q;  4OWT B;  2PQA B;  2PI2 A;  3D31 A;  3AYH B;  2VQF Q;  1R9T H;  1VQL A;  3T1H L;  1VQK A;  1SRU A;  2UU9 Q;  4QJF A;  2ZJQ A;  3HOW G;  3WWV A;  4DR4 L;  2CWP A;  3L7Z C;  1B7Y B;  3TS0 A;  2JEB I;  2XTI A;  5IP7 H;  3HOY H;  2NVQ H;  1M90 C;  2D0P A;  4A3G H;  1LM0 A;  3H15 A;  4DV2 L;  1SFO H;  1KC8 C;  4JI8 L;  2IX0 A;  2YV5 A;  4AH6 A;  4KHP Q;  3J81 i;  1NJI C;  3I4N H;  1XPO A;  4LF7 L;  2ZTD A;  1QZH A;  1VQC A;  2R7D A;  3MEF A;  4HJ8 A;  4DV3 L;  1D7Q A;  4LF5 L;  5E7N A;  4BA2 I;  4DR2 L;  1XMO L;  1BBU A;  3CC7 A;  1VQ9 A;  2VUM G;  2MO0 A;  3E0E A;  1QVC A;  2D62 A;  2DUD A;  1X6O A;  2N8N A;  4J15 A;  4A3I H;  1JJ2 A;  4A93 H;  5J3B A;  1NTG A;  1L1O A;  3GO5 A;  1HH2 P;  3NEM A;  4TQU S;  1Y1W G;  2OCE A;  2IHF A;  4JC0 A;  4LF6 Q;  1X3G A;  4NXM L;  2R7Z G;  5IT9 c;  5IY0 A;  2ZJP A;  3CCM A;  4YCW A;  4DV7 L;  3CCL A;  3PGZ A;  4O0A A;  3LGJ A;  4YHH L;  5IP9 G;  3PUW A;  4A3F G;  1HNZ Q;  1X56 A;  3I56 A;  3M85 A;  4GNX C;  1V1Q A;  4A3M H;  2OQ0 A;  1RL2 A;  1YEZ A;  1YIJ A;  2AWO A;  2JA9 A;  2XGT A;  1WJJ A;  1K0R A;  2UUB Q;  4L5R C;  3S14 H;  4GOP A;  4GOP B;  4OON A;  1YIT A;  5IYD H;  3S1Q H;  2NVY H;  4PZ8 A;  4LFA Q;  1GVP A;  1RIP A;  1N9W A;  3TQY A;  4X64 L;  3GTQ H;  3W5O A;  1YI2 A;  3K7A H;  1L2F A;  4BXX H;  4JI4 Q;  4JYA L;  1UEB A;  4YWK A;  5LMU Q;  1NE3 A;  4H02 A;  4DUY L;  1K9M C;  2UU9 L;  3MXN B;  2WB1 E;  2F4V Q;  2R92 H;  4O2D A;  2HT1 A;  1KQS A;  2Y0S E;  4QL5 A;  5GQO A;  3J7A 5;  2B29 A;  1IBK L;  1IBM Q;  3L0O A;  3S2D H;  5C44 G;  3TRZ A;  1XNR L;  3HKZ E;  4KHP L;  4A4I A;  3HOU G;  4R1J A;  2K50 A;  1CKN A;  3G71 A; 
#chains in the Genus database with same CATH topology
 1ILQ A;  1WTP A;  2HHH Q;  4RH6 A;  1JCK B;  2B3G A;  4A3K B;  2HCC A;  1ZEQ X;  2VW9 A;  1WTR A;  4RWS C;  2VB2 X;  1EQQ A;  5IYC H;  2JEA I;  3T1H Q;  1L1O C;  4A3J G;  1RTO A;  4TSS A;  1B9M A;  3MAQ A;  3BZC A;  3VDY A;  3KBX A;  1HNX Q;  4BBS G;  4TVA B;  2A1A A;  1PLF A;  2FFK B;  3FPP A;  2I5L X;  1JQY D;  4IUP A;  1AE3 A;  3PUZ A;  1HCZ A;  1HXY D;  3UE1 A;  1I6H H;  4PQX A;  4HJ7 A;  2LXJ A;  2EPB A;  4RKB A;  1GUW A;  1Y1W B;  2Q8T A;  1GD7 A;  2Z4I A;  3RNU A;  2QDB A;  4UAI A;  1IYV A;  4I7A A;  3NBI A;  2BOS A;  4ZRZ A;  1IBM L;  1KDB A;  4DK1 A;  1PXU A;  4OEL B;  2F4I A;  1UE1 A;  3K5N A;  2JYO A;  1CSP A;  3STB D;  5C4Z A;  4NXN L;  2ICI A;  1CZW A;  2WFW A;  4J1M A;  3ERO A;  4DR3 L;  4LF4 L;  5JJL A;  5EBC A;  3GTP B;  5JEA G;  3KDF A;  3KDF B;  2EY6 A;  1D5M C;  3I55 A;  2PMZ B;  1O7Y A;  3R8B A;  1T9H A;  5C0X H;  5EKL A;  2NVQ B;  5C44 B;  3MTS A;  1KLG D;  2WV6 D;  4P71 A;  4DA2 A;  5ELD A;  1JOK A;  3I4M H;  5KRU A;  4B3T L;  2MFI A;  1XX8 A;  4Q5V A;  3TME A;  4DR6 Q;  3I3C A;  5IYB G;  1YHQ A;  1TY2 A;  1SEB D;  3H0G H;  4CBV A;  1Q86 C;  3AB9 A;  1EZ8 A;  3SEB A;  2UUC Q;  5H1S E;  4N8X 1;  4UP7 A;  4XDX A;  4HID A;  3C2P A;  2F0I A;  1A62 A;  4RA8 A;  1X32 A;  2K5V A;  1QZG A;  1JJC B;  1I50 B;  2UUA Q;  2I46 A;  1I3Q H;  4G7O C;  1EYC A;  3ERS X;  4KY5 A;  5I2X A;  1JOO A;  2KJX A;  2O4X A;  1ENC A;  3UDI A;  1PRT D;  3MVV A;  4N9T A;  1KD1 C;  3CCV A;  3NP8 A;  2OTL A;  5C4X G;  1NR4 A;  4I7Z C;  1V9P A;  1Y1V H;  2F0W A;  2PNR C;  4DXG A;  5FOB B;  1C0A A;  2RCN A;  4KHZ A;  1JOR A;  3EJI A;  3HOY G;  3MFY A;  1YJW A;  2E74 C;  1ONL A;  1SNM A;  2EDG A;  2TMP A;  2Q2T A;  4JI5 L;  5A35 A;  2K52 A;  2EY5 A;  3E9I A;  2VQE Q;  3T1Y L;  3BG3 A;  3UE0 A;  3NBH A;  1VMC A;  3CW2 C;  1I6V C;  4LUZ A;  2XN9 C;  1Y14 B;  5C4H A;  4MTK A;  3HEJ A;  4DKA C;  1LO5 D;  2EIF A;  4BY1 H;  3J7A V;  4K2L A;  4R4Q A;  3I8Z A;  2R93 B;  1N34 Q;  1EWI A;  3S17 H;  4LJZ C;  4JOI A;  5J39 A;  1M1K C;  2F0T A;  4LUV A;  5GAG C;  1S40 A;  1LTT D;  2KCM A;  1E22 A;  3OOC A;  2NYZ D;  5BR8 Q;  1B44 D;  1K28 A;  1XXG A;  1DOK A;  1I6H B;  1DGS A;  3HOW H;  2F0L A;  1VQD A;  3K57 A;  4RCO A;  2VS1 A;  1MBY A;  2K03 A;  1Q1E A;  1CKM A;  3D0F A;  4QIW B;  3STB C;  3LNN A;  2OEO A;  1N33 L;  4HAE A;  4K6D A;  1DOL A;  2J4X A;  1G8Z D;  1H9J A;  3PCO B;  1VQ7 A;  1T5X D;  4XQN A;  2K32 A;  1XWE A;  4JI2 L;  2OQK A;  1EYA A;  3VA5 A;  3K8A A;  2F0V A;  4FXD A;  1N32 Q;  2ATW A;  4X66 Q;  1A0I A;  1JWU D;  2MPM A;  3SK8 A;  5I2Y A;  2YYZ A;  4FF2 A;  2L4N A;  1Z47 A;  2C35 B;  1KNA A;  1VQH A;  5M5Y H;  4EX5 A;  3AQQ A;  1EL0 A;  5IT9 L;  3CCR A;  5IGF A;  3HGB A;  1W3S A;  3RMH A;  4U68 A;  2B2T A;  1A2U A;  2NZ1 D;  2F0S A;  1PZI D;  5FO9 B;  4X6A H;  3U4V A;  4LMQ D;  4LFB L;  2PZT A;  2JP1 A;  2WII B;  4ALP A;  2EQS A;  4QY7 A;  2M2L A;  3ND9 A;  4DR5 L;  1IYU A;  4GKK Q;  5IE8 A;  3W1B A;  2E2I H;  5LMN Q;  1XTC D;  3KF6 B;  5D14 A;  2J0T D;  1G6P A;  2GVB A;  3D6W A;  2JA6 H;  2IY5 B;  2TSS A;  4GLX A;  1PRT C;  1TWA H;  3HOU H;  1GUG A;  3R93 A;  2MUY A;  2YTV A;  1A3V A;  2UXB Q;  5CBE E;  3NWT A;  1SRO A;  1U0L A;  1FVI A;  3BVZ A;  1STG A;  4KKS A;  2EZV A;  2NVY B;  1JC7 A;  4YY3 Q;  5ELN A;  1HNW Q;  5M5X H;  1QCB D;  5ELF A;  5AJ3 L;  1VQN A;  1WTX A;  2E2J H;  4R8N A;  1Y1V B;  1A6X A;  3MXG A;  4KK7 A;  3S1R H;  1X65 A;  3VYT A;  2OT2 A;  2R92 B;  1TWG H;  1F9Q A;  1PTO F;  3KF8 A;  3KF8 B;  2F03 A;  1DJR D;  3DWP A;  5C0X G;  4PNY A;  1KRT A;  2PQE A;  1J5E L;  3I4L A;  3I4M G;  3SDZ A;  3QOL A;  3GTG H;  1GJX A;  1P16 A;  2Q8I B;  4DAM A;  4LF9 L;  1SAP A;  1ICF B;  2IPK D;  1IL8 A;  2WKC A;  1VCI A;  3H0G G;  2H1E A;  3ONA B;  1SMY D;  2HIV A;  2KBN A;  2K14 A;  4BY1 B;  2LSS A;  1E2W A;  1SE3 A;  4PV1 C;  2JA7 H;  5ELE A;  4K5X A;  1TKW B;  2EJG C;  1G29 1;  3W3A A;  4OXP A;  4DNI A;  3X3M A;  3JAM E;  3RN5 A;  2K1B A;  2VXW A;  1VS0 A;  2F0F A;  2EJM A;  1TU2 B;  4HIM A;  3GV3 A;  3GTK H;  2LMC B;  3E9H A;  2NZO A;  1C48 A;  1YBY A;  1S5F D;  5EKK A;  3K0X A;  1BBX C;  1HNZ L;  2RSO A;  3QR8 A;  2D5D A;  4GKJ L;  4XQQ A;  1CA6 A;  2ZJR A;  4WFN 3;  4FF3 A;  4FDB A;  4V19 0;  3HOX H;  4DK0 A;  1QJO A;  4RGN A;  2IWH A;  4B3R L;  3K0Y A;  4IOC A;  1E3P A;  4POG A;  1WD0 A;  1TWH B;  3PIO A;  4NXM Q;  4GNX A;  2N55 A;  4X3S A;  4X62 Q;  2B2W C;  3U9S A;  2CKZ B;  3EA6 A;  1B1Z A;  1B3Q A;  1PVO A;  3K5L A;  1TS4 A;  4ZYS A;  1LT6 D;  1OO9 B;  4UDU C;  2ZM6 L;  3CCS A;  3K5M A;  2R7F A;  1CQF A;  4G57 A;  5C3W A;  2PI2 A;  1R9T H;  1LLR D;  5M3F B;  2ZJQ A;  1SRU A;  1I4P A;  3HOW G;  4DR4 L;  2E2I B;  1JB3 A;  2CWP A;  3L7Z C;  3H3V C;  3TS0 A;  5IP7 H;  1M90 C;  1YNJ D;  2JA6 B;  1AZP A;  1KAA A;  4RAU C;  1PDQ A;  2IX0 A;  2YV5 A;  2F0G A;  4AH6 A;  4K14 A;  1XPO A;  2E2H B;  2ZTD A;  1VQC A;  3MEF A;  4HJ8 A;  3OWF A;  4LF5 L;  1JWM D;  1J9O A;  1BBU A;  1CI3 M;  3CC7 A;  2VUM G;  4J15 A;  1JJ2 A;  4A3I H;  3A55 A;  3D3R A;  1SYF A;  1HTL D;  1KLU D;  1L1O A;  5M5X B;  3R2T A;  2E2J B;  2A73 B;  2LFN A;  1BR9 A;  5IY0 A;  1LTS D;  3S1R B;  4YCW A;  1TWG B;  3LGJ A;  5KNC A;  4YHH L;  3QO2 A;  2A6E D;  1V1Q A;  1RL2 A;  1WJJ A;  1R4Q B;  4KD4 A;  4RGT A;  4OON A;  1YIT A;  3LWE A;  5IYD H;  3S1Q H;  3GTQ H;  3DMU A;  1YI2 A;  3GTG B;  1L2F A;  4HSP A;  4BXX H;  5AFW A;  1WTO A;  1DXM A;  4BWG B;  2UU9 L;  4XT1 B;  3IKJ A;  1QG7 A;  1STE A;  1AW7 A;  2F0N A;  4HR7 B;  5CV8 A;  2G9H D;  5GQO A;  1IBM Q;  2EYO A;  3L0O A;  3D6C A;  2LS0 1;  3HOU G;  4R1J A;  4QUF A;  1MI2 A;  2IHE A;  2ASB A;  2F3W A;  1K0S A;  4K6L A;  1A63 A;  4IUN A;  5NUC A;  4JPB W;  5JEA H;  4LF4 Q;  3A74 A;  3GP7 A;  1K8M A;  2NTT A;  1QVG A;  5EAY A;  3GTK B;  4A93 G;  3CRK C;  2YU9 H;  2V4D A;  4QMG A;  4OIK A;  2K6A A;  4L5T A;  4H13 C;  3SE0 A;  5CV7 A;  2BDN A;  2HCI A;  4IPD A;  3A56 A;  4KY6 A;  4WJ4 A;  3S16 H;  3PSI A;  4BY7 H;  4B3T Q;  1LYL A;  5D65 A;  3TDQ A;  5KGU A;  3K59 A;  2E5L L;  4AYB E;  1SJE D;  5IYB H;  2XVS A;  1LTL A;  4DV1 L;  3A5U A;  2RHQ B;  4ME3 A;  5ELB A;  4DNR B;  2KEC A;  3MHB A;  1B50 A;  4MNO A;  1D5X C;  1PZK D;  1C8C A;  5C3E H;  1VQ5 A;  1BQQ T;  1EUJ A;  1UE6 A;  1QUQ B;  5TSS A;  3PO2 H;  5CV6 A;  4RMF A;  2EXZ A;  3M3Y H;  4DV7 Q;  3L3O C;  4A3F B;  1I4X A;  1X3P A;  5D3D A;  4C1N I;  4RKL A;  3T56 B;  3ULJ A;  4DFA A;  2JA7 G;  2KEN A;  1V1P A;  1V1P B;  5KEE A;  4J6H A;  2RCF A;  2KEE A;  5C4X H;  4TKO B;  2N49 A;  1HUM A;  1JOQ A;  1RHP A;  4KN7 C;  4A75 A;  3S9W A;  3H91 A;  1PA6 A;  4JYA Q;  1H9S B;  3BDC A;  3ER0 A;  1R9T B;  4L5S A;  1EQR A;  1UE5 A;  4Q0F A;  5JVH 3;  4DUY Q;  3J80 L;  2SOB A;  4P75 A;  4JI3 L;  3I7F A;  4F7X A;  3GQB A;  2NN6 I;  1ASZ A;  1NR2 A;  1XNR Q;  4HIO A;  1TS5 A;  4IN3 A;  1E1T A;  1Q8K A;  4ID6 A;  3G4S A;  1EOT A;  4BBR H;  1BO0 A;  1WTQ A;  3PF4 A;  1ZKO A;  1X3F A;  2XSC A;  5C0X J;  3HOX G;  4C3H G;  3A5Z B;  2A6E C;  1S4Z A;  1A8V A;  3ULP A;  5IT9 E;  1L0W A;  3FVQ A;  4OX9 L;  3FP9 A;  3U4Z A;  2AQ2 B;  1OXU A;  4H7B A;  1VQ6 A;  2M00 A;  3URY A;  2DJF C;  2QEX A;  4JI1 Q;  3M9B A;  1Q3L A;  4B3S Q;  3OMG A;  3JAM L;  2KOL A;  1NMF A;  3NWS A;  4JVZ A;  2E76 C;  2AMC B;  3GTQ B;  5CC4 A;  4X3U A;  2E8G A;  3LX0 A;  3A8I E;  1V43 A;  1HZ9 A;  1WCM H;  2GVA A;  4A3D G;  3D8G A;  3NSW A;  2J7Z A;  4QCL A;  5IP7 G;  1E24 A;  1PTO D;  1N33 Q;  3M7G A;  2NBF A;  1EWH A;  3HOV H;  2F0D A;  3OMC A;  3IAY A;  3BVG A;  3W2D A;  2WAQ G;  3G48 A;  2L12 A;  5M5W B;  2SDF A;  4JI2 Q;  2EOT A;  2Z6K C;  1HA5 A;  1KAW A;  4JI0 L;  4B3M L;  4A3I G;  2YU9 B;  1E0B A;  4JBW A;  1PH9 A;  1KTK A;  3KOJ A;  1JWS D;  5GRO A;  1N36 L;  1K83 B;  3PO3 H;  3S16 B;  5IWA L;  3JAM c;  4BY7 B;  1SE2 A;  1KHI A;  5FKA C;  4LFB Q;  1D2B A;  3A0J A;  4IUU A;  2B2V C;  5IYD G;  2MQH A;  3GTJ H;  4KV6 A;  1O80 A;  4XT3 B;  3OHX C;  4IJL A;  4DR7 L;  1MIU A;  1MHW C;  4BXX G;  1G2T A;  1ENA A;  2QGQ A;  3PO2 B;  1KXL A;  1U4R A;  4K0K L;  4H0L C;  2K75 A;  3M3Y B;  2NN6 G;  4NPS A;  5HY6 A;  1O7Z A;  1K3B C;  3W1G A;  3RN2 A;  1QIL A;  1VQA A;  3HP3 A;  2I5M X;  1JB7 A;  1STN A;  4LFC L;  1H95 A;  1D5Z C;  2RDF A;  3D4R A;  2L15 A;  2EE1 A;  2VL6 A;  1U4L A;  5C4X B;  4JI7 Q;  1IBL L;  4X65 L;  2R7Z H;  5AJ3 Q;  2BA1 A;  3R2I A;  3CKI B;  2HD3 A;  4R4C A;  1TWC H;  1K3R A;  3N6R A;  3HOY B;  4UY8 C;  2WKD A;  3V05 A;  4DV5 Q;  2E75 C;  2F0U A;  1SYG A;  1J5E Q;  1F9R A;  3S2H H;  1HR0 W;  4BY7 G;  3CD6 A;  2EYM A;  4FP5 D;  5ELC A;  3RLN A;  5EPJ A;  3T53 B;  1I4G A;  2B2Y A;  4JG2 A;  4BBR B;  1TWF H;  3LWU A;  1S72 A;  3S15 H;  1BVS A;  1LV9 A;  2OF1 A;  2CQA A;  2UXC Q;  1GO3 E;  1O7I A;  4IAL A;  2KA7 A;  1HRJ A;  2RQX A;  5JPN C;  5C3E G;  2N78 A;  2AWN A;  2RSN A;  4TRD A;  1SNC A;  5LMN W;  3PO2 G;  1JT8 A;  1SYD A;  3BYY B;  4GN4 B;  3CCQ A;  1S5C D;  4YCU A;  1CK1 A;  3SK4 A;  3Q6S A;  4RG1 A;  1MJE A;  1P8L A;  2MP1 A;  1WTV A;  1L0X B;  2NWG A;  3MXU A;  5LL6 X;  4QIW E;  1VQ4 A;  4MHE A;  4S3S A;  4JK1 C;  3D4W A;  3GTL H;  4DR1 L;  3NTI A;  5CR3 A;  1EY8 A;  1PTO C;  1B8A A;  3BU2 A;  2CCZ A;  1CA5 A;  4PMW A;  3CAM A;  4LF8 L;  3VR4 A;  3CRL C;  2JXM B;  2PW5 A;  3ICE A;  3H3V I;  1QWY A;  4XIG S;  1WCM B;  5E3F A;  4JW0 A;  1Z6H A;  4LNQ A;  1EYG A;  4GKJ Q;  2RHS B;  4HJ5 A;  4CGY B;  4DV6 L;  3S1M H;  2G9D A;  4ZAI A;  5FLM G;  4F88 A;  2WB1 G;  2K04 A;  1Q8I A;  2XRS D;  1WFQ A;  2QA4 A;  1JIC A;  1S5E D;  4B3R Q;  3NBH B;  4XTC S;  1AE2 A;  4BBR G;  1BF4 A;  3OWE B;  1PH1 A;  4QQB X;  2B2U A;  3HKZ G;  3I91 A;  3CC4 A;  2B2W A;  5A2Q E;  1CUK A;  3NQT A;  2Q2U A;  2MNA A;  1SND A;  1VQF A;  1LUZ A;  4HSV A;  3EVQ A;  3PO3 B;  2F0Q A;  3HOZ H;  3KUP A;  2RKS A;  1PH2 A;  3M4Y A;  2F0K A;  3HZX A;  1OXT A;  2ZM6 Q;  2Q2I A;  4DK3 C;  1I4Q A;  3GTJ B;  4QGU A;  3EFX D;  5CBA E;  1A3U A;  4JI6 L;  1HPC A;  3OIP A;  1EYD A;  2D9U A;  3J80 i;  2NVT H;  4DV4 Q;  1TY0 A;  1WCM G;  1I4R A;  2UUB L;  1XMQ Q;  1D6E C;  2KQ3 A;  4IFD J;  3VR6 A;  1IXR A;  2M9V A;  3PUY A;  5FLX L;  2ZTC A;  5DAU A;  2CQO A;  3GD7 A;  5G3L F;  4LFA L;  3HOV G;  2VUM H;  3CMA A;  2DN8 A;  2FJ2 A;  1X3Q A;  4GOP C;  3NQI A;  2K28 A;  1NNX A;  2B8G A;  3U9O A;  1CQV A;  1MSG A;  1B3A A;  1HZC A;  5LMU L;  1AFP A;  1PH6 A;  1AZQ A;  2A8V A;  4IQZ A;  1W2B A;  1BCP C;  1UE7 A;  5I9O A;  3PV0 A;  2PYK A;  1TWC B;  4CKC A;  3TS2 A;  4YHH Q;  3PUV A;  1OXX K;  4ZKB B;  1Y8P B;  3NXW A;  4C3J H;  1SN8 A;  1SYC A;  3RLF A;  2HHH L;  3I4M B;  3PO3 G;  1CM9 A;  3S2H B;  1SMX A;  3PIP 3;  2HDM A;  2K5N A;  4JV5 Q;  2RDG A;  3OW2 A;  3JAM i;  3K58 A;  3GTM H;  5JJZ A;  4ILW A;  3H0G B;  3I72 A;  4OWT B;  3S15 B;  3D31 A;  3FRP B;  2VQF Q;  3T1H L;  1VQK A;  2UU9 Q;  4QJF A;  2K33 A;  1O7L A;  2PW7 A;  1UEA B;  1B7Y B;  2DJG C;  2XTI A;  3T13 A;  3T51 B;  4A3G H;  1F9S A;  1BDO A;  4DV2 L;  1G6Z A;  1ENF A;  2CW0 C;  1I3Q B;  3OW7 A;  3VR5 A;  3E0J A;  1TVX A;  1VQ9 A;  4CKE A;  3E0E A;  2DUD A;  4A93 H;  3GTL B;  5JPM C;  2PPB C;  3BDL A;  3GO5 A;  4TQU S;  3J80 E;  3SHL A;  1FNV A;  2QDL A;  2R7Z G;  1ICW A;  5IT9 c;  1DZ1 A;  5D3I B;  2ZJP A;  3CCM A;  1K8O A;  4K5W A;  1X56 A;  3M85 A;  2L0C A;  5EQ0 A;  1LAC A;  4A3M H;  2OQ0 A;  4L5R C;  2JA9 A;  1K0R A;  5FK9 C;  3Q24 A;  2E2D C;  3T4A C;  1GVP A;  1N9W A;  3MEH A;  5E4X A;  4LK1 C;  3K7A H;  2ZXR A;  4KKT A;  4YWK A;  4DGZ A;  4O2D A;  2HUG A;  1HFG A;  1J8I A;  2Y0S E;  4QL5 A;  2B29 A;  1SXT A;  3S2D H;  2ZXO A;  3S17 B;  1X3E A;  1CKN A;  1SNP A;  1EQV A;  1JE4 A;  3F1Z A;  3I4N G;  3DM1 A;  3KYH C;  1BNZ A;  4FXG C;  2IX3 A;  4HN7 A;  1I4H A;  3GTO H;  4ZCK A;  3L9A X;  1Y69 U;  3U50 C;  3DXJ C;  3GV6 A;  4LF6 L;  2JQO A;  3A7L A;  4DAY A;  1PH8 A;  4C3I H;  3HOW B;  1II3 A;  5CMD A;  1PH5 A;  3PUX A;  4YWM A;  1UUP A;  3F2B A;  4JI3 Q;  5M3M H;  2AHO B;  4DPG A;  1OTC A;  5HGQ A;  1SJH D;  4JBJ A;  5IOD A;  1KDC A;  4ULL A;  5JEA J;  4APV A;  2KCT A;  4OHJ A;  1HZA A;  4G7H C;  4LF7 Q;  1PYB A;  1EY6 A;  3S1N H;  2VUM B;  1EOV A;  1OXS C;  1ZYR C;  2LXK A;  3GDE A;  2EY2 A;  1XMO Q;  1H9K A;  4C3H H;  3F8T A;  3C46 A;  3UI2 A;  2F4V L;  1KRS A;  1JMC A;  3TP7 A;  3DM3 A;  4X3K A;  1Q81 C;  4GNX B;  4OX9 Q;  4JBK A;  1F2M A;  2SEB D;  4K8J A;  2AQ1 B;  5M5Y B;  2L9H A;  2FXQ A;  4C3J B;  1BCP F;  5KIX A;  4LW1 A;  3HOZ G;  1GKH A;  3BZK A;  1H9R A;  2EY1 A;  1NY4 A;  1PTO H;  4F87 A;  2HQE A;  4X64 Q;  3GTM B;  1LTI D;  4UP8 A;  3CP0 A;  1G91 A;  4A3D H;  1SYE A;  3BDO A;  1EIG A;  2R3Z A;  1GUO A;  3CCE A;  4A3E G;  1I94 L;  2CH4 A;  3QJY A;  2EYL A;  1Q46 A;  1IW7 C;  2JK8 A;  5CV5 A;  1TWA B;  1VQB A;  1K8A C;  3HOU B;  5C4J H;  1IBK Q;  2JJQ A;  4Y7N H;  4FNF A;  4Y52 H;  5BR8 L;  4RHR A;  5BN5 A;  5KYL A;  1U9R A;  1LT3 D;  3BZD B;  1U4M A;  2EYF A;  2XNA C;  3P20 A;  4A93 B;  1ASY A;  4JI0 Q;  1NBW A;  1L1O B;  4B3M Q;  2F3I A;  2UXD L;  2NUC A;  5T1G A;  1CHQ D;  3KBG A;  2XWB B;  3KFU A;  4P72 A;  1FYC A;  1CT1 D;  4B9W A;  1WD1 A;  4GLV B;  4IO9 A;  3VR2 A;  5HGT A;  1N36 Q;  4PMB A;  1H9M A;  5A2Q L;  3TBI B;  1F9P A;  2JA5 H;  2A68 C;  3P75 A;  4OGQ C;  4A3M B;  4G7Z C;  5DLQ E;  4AQY L;  3RZO H;  2ALY B;  1D8L A;  1ESF A;  4C3J G;  2X69 A;  1G51 A;  2RBM A;  3K81 C;  2K4K A;  4EQP A;  1PFN A;  1X55 A;  1QOH A;  5I4D A;  3CC2 A;  5FO7 B;  4A3L H;  1RCV D;  2BDO A;  2NN6 H;  1UNS A;  4J8Q A;  1PYS B;  5LL6 S;  4K0K Q;  1HA6 A;  4A3B G;  2Z6B A;  3L2P A;  1HR0 L;  4MZ9 A;  1CTM A;  3HS0 C;  4A3G G;  3S2D B;  2JA7 B;  4DV0 L;  3J81 L;  3J7A F;  2L11 A;  2QW7 A;  5F2D A;  1F77 A;  2B2T C;  4NXN Q;  3SR1 A;  1VQM A;  3I73 A;  4ZUI A;  5K36 G;  4WJW A;  2HDL A;  2K5W A;  3DHQ A;  4DR3 Q;  2Y0S G;  1SE8 A;  2A74 C;  3KLS X;  3GTO B;  1IBL Q;  1E1O A;  2G5D A;  4X65 Q;  1BBW A;  2PO4 A;  5LMN L;  4XXE A;  3NEL A;  2ZT9 C;  1E2Z A;  3RLO A;  4JBM A;  1PFM A;  4K2K A;  2XWJ B;  4QF4 A;  4HCS A;  3R3O A;  4IPG A;  2JA8 H;  2C5C A;  5C5M A;  4QB4 A;  1W6K A;  3ULL A;  4A3K H;  4A3M G;  1NAP A;  2MJ8 A;  3NE5 B;  3IL8 A;  2AKW B;  1WI5 A;  4H44 C;  3S1N B;  1HNW L;  3AEV A;  3HOX B;  1B4O A;  4OWX B;  4HMJ A;  4C3H B;  3WDN A;  2PCF B;  5J1Z A;  1FNW A;  1TII D;  4CJ2 C;  1Y8O B;  3M4Q A;  3CXC A;  1YJN A;  2I5H A;  3VA7 A;  3B6Y A;  2HIX A;  1S3O A;  5I6W A;  5G3L D;  3DEO A;  2L55 A;  3NTK A;  4L63 B;  3CHB D;  5FJ8 G;  4NMZ A;  4GLA C;  4DR1 Q;  1FR3 A;  2KCC A;  4R4O A;  3AMU A;  3KLW A;  3T16 A;  1TR5 A;  2Z0S A;  1Y8N B;  1YNN D;  4A3D B;  4LF8 Q;  2EVB A;  4JCV E;  4C3I G;  4N8F A;  4BS9 A;  4YWL A;  4WOR A;  3TRE A;  1VQI A;  1U4P A;  1ET9 A;  3RZD H;  5FLX E;  1PV4 A;  1ET6 A;  5M3M G;  1PHJ A;  3DLL A;  3F2D A;  4X3T A;  5C4J B;  5FLM H;  2AUJ D;  1VQJ A;  2WAQ B;  4Y7N B;  1STY A;  3M7N A;  3AU7 A;  2GN5 A;  3J7Z C;  3FEW X;  3GTP H;  3QWN A;  2ZTE A;  4PMC A;  4JI5 Q;  4NKL A;  1QNK A;  5EGT A;  4CKB A;  1MD2 D;  3T1Y Q;  2PQA A;  4L5Q A;  4A76 A;  1C4Q A;  3IFD A;  4RHS A;  4A3I B;  4EQO A;  5COY A;  1FJG L;  1VQO A;  4FF4 A;  4XYQ A;  2NVX H;  3KLS A;  3A8K E;  5GAH C;  5C44 H;  1E2V A;  4HJ9 A;  3G6J B;  5C5L A;  3PF5 A;  1IKM A;  4GN5 A;  3K80 C;  3CCJ A;  3CF5 A;  2JA5 B;  4FYD A;  3RZO B;  1VMP A;  4DUZ L;  1S5B D;  2CVR A;  4PZ6 A;  1GHK A;  1K73 C;  3S1Q B;  1U5K A;  4RGM A;  1ILP A;  3J80 c;  1A2T A;  1HUN A;  2IX1 A;  4JI6 Q;  5IGC A;  1S5D D;  4AYB B;  3CQZ H;  4X62 L;  2Q8R E;  1I50 H;  1B9N A;  3C3L A;  4RFB A;  4C1N K;  2RDH A;  1QE6 A;  2PMZ E;  5EKI A;  2A5H A;  4A3C H;  4G4K A;  3I2Z A;  2I07 B;  1UWV A;  2A19 A;  2D0O A;  3MXN A;  4B9X A;  1EIF A;  3QG1 A;  5JAV A;  1DOM A;  3A8J E;  2DGY A;  4HCE A;  3KLR A;  2JA8 B;  3MXP A;  3PMF A;  2EYP A;  3QIA A;  1SNO A;  4ZQ3 A;  2H4O A;  2JA5 G;  4ODG A;  2F0P A;  2OTJ A;  5BN3 A;  1EY4 A;  1BKB A;  2P5Z X;  3OTO L;  3PQI A;  4KI0 A;  3H3V H;  3J81 j;  3CPF A;  1PFS A;  1RJT A;  1EU4 A;  4DR5 Q;  1EY7 A;  4FVM A;  5C3E B;  3HKS A;  1PRT B;  2CHB D;  1WTW A;  2V1C C;  3U58 A;  2R93 H;  2MGS A;  4AYB G;  4U67 3;  2Z1C A;  4A3L G;  2RF4 A;  4DV2 Q;  4POF A;  3Q23 A;  1XNQ L;  1YHB A;  3NK9 A;  4LUO A;  1YNN C;  2HQL A;  3S24 A;  3AFP A;  2F3V A;  4HTH A;  4NB3 A;  1TS3 A;  1D1I A;  3CPW A;  4KLK A;  1CHP D;  4GS3 A;  3M4O H;  3ITP A;  3RZD B;  1K8G A;  2JA8 G;  4BA1 I;  3Q22 A;  1BCP D;  2WP8 J;  2WB1 B;  5EPK A;  4R9W A;  4N9P A;  4NP5 A;  1BUV T;  1EQT A;  4A3K G;  4KD3 A;  3OSO A;  3HG9 A;  5I6Y A;  3PIO 3;  4LF9 Q;  4FF1 A;  2O2L D;  1LTA D;  3HKZ B;  3OIQ A;  3AYH B;  3P7J A;  1EY5 A;  3D4D A;  4OIJ A;  1TS2 A;  1VQL A;  3WWV A;  4LAA A;  2JEB I;  3ND8 A;  1SNQ A;  1SBB B;  2NVX B;  3VYS A;  5IGG A;  2D0P A;  2QIL A;  1LM0 A;  3H15 A;  4O1N A;  3QB3 A;  1SFO H;  4JI8 L;  1Q90 A;  3J81 i;  2JN4 A;  3I4N H;  1CZG A;  4DF7 A;  1QZH A;  4DV3 L;  1D7Q A;  5E7N A;  4ZK9 B;  4DR2 L;  3EQL C;  2D62 A;  1MGS A;  3BYT B;  2CW0 D;  5J3B A;  3NEM A;  1HH2 P;  4LF6 Q;  1Y1W G;  2IHF A;  4EQN A;  2KUM A;  4KY7 A;  4DV7 L;  3CQZ B;  5CV4 A;  2KHS A;  3CCL A;  2BE5 D;  3PGZ A;  4O0A A;  5E4W C;  1HNZ Q;  3I56 A;  2A6H C;  1SE4 A;  2Z9H A;  2F0J A;  4ME5 A;  3HOV B;  1QNU A;  2QKI C;  3S14 H;  2NVY H;  2O5I C;  3MFG A;  1RIP A;  3TQY A;  4IUT A;  2ZXP A;  3F2U A;  4JYA L;  1UEB A;  4ZLT F;  4DAP A;  4DUY L;  4H02 A;  2AUK A;  2F4V Q;  2R92 H;  1DYQ A;  3SK5 A;  1GOZ A;  1B53 A;  5ISR A;  3J7A 5;  5C44 G;  3TRZ A;  1XNR L;  4E6I A;  4KHP L;  2K05 A;  3A7A B;  3DUZ A;  3K5O A;  4WJ3 M;  5DM7 3;  4CDC C;  4EGV A;  4MTN A;  4DU9 A;  2DNC A;  1DCZ A;  1G2S A;  4A3E H;  4CHT B;  4DR4 Q;  3QOJ A;  3H6M A;  1I94 Q;  1IZ6 A;  3E5S A;  3J81 E;  3K6O A;  4V0B A;  1CKO A;  4UPA A;  4JI1 L;  5C0X I;  1YHA A;  2B63 H;  1Q7Y C;  4B3S L;  4IUQ A;  2Z4H A;  4HED A;  2FMC A;  4LF5 Q;  4CJ1 B;  2A69 D;  1XYI A;  4IUV A;  1XPU A;  2IJ0 A;  4JI4 L;  4HMI A;  3IFT A;  3FDT A;  4A3C G;  2R7Z B;  2UXD Q;  3EIV A;  2CH4 W;  1ZYR D;  4NDX A;  2OWO A;  2F0O A;  4ZKC B;  1CSQ A;  1Q82 C;  2RA4 A;  4EQ5 A;  1EU3 A;  1CFM A;  3M4O B;  4HJA A;  1LTR D;  4F8M A;  4AQY Q;  1EY9 A;  3C1E A;  5JJK A;  1EY0 A;  4R4I A;  5J22 A;  1O78 A;  4I65 A;  1Z9F A;  1B2T A;  1B70 B;  3Q8D A;  1TWH H;  3O13 A;  1TWF B;  2QCP X;  1SDF A;  5DNF A;  5IYC G;  2KHJ A;  4KJO A;  5K5P A;  1GM5 A;  3I4O A;  4A3B H;  3NTH A;  1KL9 A;  1D1K A;  1HHV A;  4ZUJ A;  1HJP A;  4OO1 H;  4K8I A;  1F2Z A;  4OEM B;  5FLX c;  2BH8 A;  1HNX L;  1HR0 Q;  2R93 G;  1SFO B;  3K7U C;  1OXV A;  2H5X A;  4DV0 Q;  3HFZ B;  3I4N B;  1JJG A;  5K36 H;  2IW3 A;  2OXP A;  4L8J A;  3CU7 A;  5KNB A;  5GAD C;  5LHY 1;  4KHV A;  1IW7 D;  4IPH A;  4M1U B;  1NSN S;  2NTS A;  2CFM A;  2BE5 C;  1W6J A;  5M3F H;  1IHZ A;  4Z9C B;  3KF6 A;  4HIK A;  1STH A;  4C2M H;  1ROD A;  2L1B A;  4IUR A;  2O5J C;  4DXF A;  2Q2H A;  1SLJ A;  1LT4 D;  4LWC A;  4P74 A;  1IYJ B;  1NUC A;  3NPP A;  1QVF A;  1Q12 A;  1DM0 B;  1QB5 D;  2E2H H;  1LAB A;  3DWA A;  1ZXT A;  1HFN A;  2E5L Q;  3S14 B;  3FKI H;  3NEN A;  3S1M B;  3IRB A;  1DD2 A;  4DV1 Q;  4JI7 L;  1JE5 A;  5EJW A;  1RTN A;  1KIX A;  2A68 D;  1EEI D;  2EJF C;  3DWQ A;  2ES2 A;  3EN2 A;  2K5D A;  4GN3 B;  3I90 A;  3UDX A;  3CCU A;  1M8A A;  1EWC A;  3HRZ C;  4DV5 L;  1C7Y A;  3ERQ A;  1IL2 A;  4FXK C;  4PZ7 A;  1VQG A;  1PH4 A;  2PI2 E;  1A15 A;  2ENB A;  4PG3 A;  5E1F A;  1CKN B;  1XJV A;  1YVC A;  4RGO S;  3HOZ B;  4QUC A;  4DR6 L;  3J7Y W;  1KNE A;  1T5E A;  5FJ8 H;  2YTY A;  3BJU A;  5I9P A;  2EYJ A;  3SGI A;  1HQR D;  2UXC L;  5CV9 A;  2B2Y C;  3V2T A;  5KND A;  1EFW A;  2I0Q A;  4DAY B;  2UUC L;  1STB A;  3C1F A;  2FIN B;  4A3E B;  1AH9 A;  4UP9 A;  3TP6 A;  1I5F A;  5IIF A;  2UUA L;  2NB0 A;  2NVT B;  1TQO A;  3G6E A;  1GUS A;  3JC6 6;  2A69 C;  2F0E A;  2R6G A;  4KMU C;  4DN4 M;  4OL7 A;  3FHW A;  1MJC A;  2KVM A;  2B63 B;  4OO1 I;  1Q1B A;  2FHT A;  3TP5 A;  4IFD H;  1NMG A;  3E6Z X;  3MA2 B;  1EZ6 A;  1FGU A;  3UDF A;  1FJG Q;  3I70 A;  1IKL A;  1FL0 A;  1Y1V G;  2PNH A;  2KHI A;  1EIY B;  1F2L A;  4FO2 A;  2R92 G;  3A54 A;  3EBE A;  5IGB A;  5JVG 3;  2K01 A;  2K5H A;  2K7V A;  4KN4 C;  3F2C A;  4DUZ Q;  2N3S A;  2K5Q A;  1FD7 D;  2VQE L;  1V1O A;  1PFB A;  1X9N A;  2BA0 A;  5IGE A;  4C56 C;  1C9O A;  1VQP A;  3V96 A;  1HQM C;  2AQ3 B;  3FMC A;  1SSO A;  3WOF A;  3AFQ A;  1TXY A;  5IP9 H;  4A3F H;  1M4V A;  4A3B B;  2B2U C;  1HZB A;  4BY1 G;  1N34 L;  2DY7 A;  4A3G B;  3UDG A;  1RD9 D;  5C6A A;  2XRQ D;  3OYY A;  1BXT A;  1PYW D;  1Z7T A;  2Z8L A;  5C3X A;  3MWY W;  4JOI C;  2Z6K A;  3OPO A;  2N88 A;  2B39 A;  2B63 G;  1GXD C;  4OWW B;  2JE6 I;  2Y0S B;  2F0M A;  1XPR A;  3KJO A;  4P73 A;  4M8A A;  1SR3 A;  5M9O A;  2F0H A;  5ELO A;  4C2M B;  2PZW A;  4DV4 L;  4IOA A;  1PMR A;  3H94 A;  1VDZ A;  1YNX A;  2D2C C;  5DM6 3;  1XMQ L;  2XIW A;  1N8R C;  5IWA Q;  3BVM A;  1PRT F;  4DAV A;  1RKN A;  2B2V A;  3FKI B;  3SVM A;  2QEJ C;  4IJH A;  1RF2 D;  4GZY C;  1N32 L;  1JR0 D;  3OTO Q;  4X66 L;  5CGK A;  2CWA A;  4DNT B;  3K7A B;  4A3J H;  3TSS A;  4IFD I;  4DR7 Q;  1L0Y B;  4BBS H;  2B8F A;  5HUR A;  2YTX A;  2IT1 A;  4OO1 G;  2F1M A;  1XNQ Q;  4CDE C;  5GAE C;  3TEH B;  1SMY C;  1WTH A;  4LFC Q;  4JV5 L;  2KCN A;  1AP0 A;  1FNU A;  5BN4 A;  3X3N A;  5KYI A;  1MKH A;  1AEX A;  2EYH A;  4R4T A;  2GA4 B;  3VR3 A;  4MN3 A;  2VQF L;  4GKK L;  2WAQ E;  2DY8 A;  4RCN A;  4C3I B;  5M3F G;  2JA6 G;  1R4P B;  2F52 A;  5M3M B;  4WRD A;  2UXB L;  2NZH A;  1YJ9 A;  4IPC A;  3KK7 A;  5IOC A;  4KTA A;  1LTB D;  5M5W H;  1A3T A;  3G7L A;  5DEH A;  1EEF D;  2BH2 A;  5T1I A;  1XTD A;  4YY3 L;  3FKI G;  1VQ8 A;  4P2C B;  3ZYY X;  1KDA A;  2SNM A;  3SXH A;  1X54 A;  1J6Q A;  3E3X A;  3DEP A;  2QF7 A;  2VZA A;  3J81 c;  4XYO A;  2VNU D;  1WYD A;  1K83 H;  4KJN A;  1VF5 C;  2LKV A;  2VB3 X;  2BCO A;  4JI8 Q;  2VY3 A;  5JOB A;  2EXD A;  5EBD A;  4R8I A;  1PH3 A;  3TZD A;  1WOC A;  2KED A;  4DK6 C;  1VQE A;  4DV3 Q;  1VF7 A;  4DR2 Q;  4O42 A;  1E7Z A;  3PIP A;  1PTO B;  1EIH A;  3CME A;  1Y1W H;  2MO1 A;  1QUQ A;  3ZJY C;  4YCV A;  3BS1 A;  1WVL A;  3RR5 A;  3H09 A;  1PH7 A;  4B08 A;  2DNE A;  4MIU A;  3VYR A;  3RUZ A;  2WAC A;  1RDP D;  1GUT A;  1KAB A;  3M4P A;  1HTP A;  3P1H A;  3KJP A;  4AIM A;  2L5T A;  4DV6 Q;  4XQJ A;  1DON A;  3VYU A;  2ID0 A;  1AN8 A;  4IZ8 A;  3N52 A;  1YNJ C;  5JJI A;  4IFD G;  1YZ6 A;  2PQA B;  1H9S A;  1UAP A;  2R61 A;  1PZJ D;  2SNS A;  3NUC A;  3RD4 A;  3Q0A A;  2LY7 A;  3HOY H;  1NCV A;  1F2Y A;  2NVQ H;  1MSH A;  2PZU A;  2RVL A;  1KC8 C;  3FPU B;  4KHP Q;  2MHV A;  1NJI C;  4LF7 L;  3SK6 A;  2R7D A;  1FGB D;  4BA2 I;  1LTG D;  1XMO L;  4CDD C;  5COR A;  2MO0 A;  1QVC A;  2N8N A;  1X6O A;  2X6G A;  1NTG A;  2C9O A;  3MZ5 A;  2OCE A;  4JC0 A;  1EFI D;  1X3G A;  4L6T B;  4A3J B;  4NXM L;  3TP8 A;  1LT5 D;  4ABN A;  4BBS B;  5IP9 G;  3PUW A;  4A3F G;  4NW2 A;  4GNX C;  4KKU A;  1YIJ A;  1YEZ A;  2IL8 A;  2AWO A;  2XGT A;  4UHV A;  4K5V A;  2UUB Q;  2X6L A;  1GUN A;  3TN2 A;  2ICE C;  4GOP A;  2JSO A;  4GOP B;  1TT2 A;  1STA A;  5FO8 B;  4PZ8 A;  3TZU A;  4LFA Q;  1ML0 D;  4X64 L;  1SYB A;  2A6H D;  3W5O A;  1V8Q A;  1ESR A;  4JI4 Q;  5L37 A;  1BCP B;  5LMU Q;  1NE3 A;  1K9M C;  4CDF C;  3MXN B;  2WB1 E;  3WOE A;  4CJ0 B;  5EPL A;  2HT1 A;  5CYU A;  1KQS A;  1BOS A;  4EVO A;  4YIJ A;  2WIN B;  5IGD A;  3NHH A;  1IBK L;  3MC0 B;  1GHJ A;  2FMM A;  3HKZ E;  4A4I A;  2K50 A;  3G71 A; 
#chains in the Genus database with same CATH homology
 2IHE A;  2HHH Q;  2ASB A;  3F1Z A;  3I4N G;  4WJ3 M;  3KYH C;  1A63 A;  2B3G A;  4LF4 Q;  2VW9 A;  4MTN A;  3A74 A;  3GTO H;  3U50 C;  1QVG A;  1EQQ A;  4LF6 L;  2JQO A;  5IYC H;  5EAY A;  1PH8 A;  4A93 G;  4C3I H;  2JEA I;  2YU9 H;  1PH5 A;  4A3E H;  3PUX A;  4YWM A;  3T1H Q;  4DR4 Q;  4L5T A;  1L1O C;  4A3J G;  1I94 Q;  3F2B A;  4JI3 Q;  5M3M H;  1IZ6 A;  4IPD A;  2AHO B;  4DPG A;  1OTC A;  3BZC A;  3VDY A;  1HNX Q;  4BBS G;  4WJ4 A;  5HGQ A;  4TVA B;  3S16 H;  4JBJ A;  3PSI A;  4BY7 H;  1CKO A;  4UPA A;  4JI1 L;  1LYL A;  5JEA J;  5C0X I;  2A1A A;  4APV A;  1YHA A;  2KCT A;  4B3T Q;  2E5L L;  1Q7Y C;  1HZA A;  2B63 H;  4B3S L;  4LF7 Q;  4AYB E;  2I5L X;  1PYB A;  5IYB H;  1LTL A;  1AE3 A;  4DV1 L;  3PUZ A;  3A5U A;  3S1N H;  2RHQ B;  1EOV A;  1OXS C;  2LXK A;  3GDE A;  4ME3 A;  3UE1 A;  4HJ7 A;  2LXJ A;  1XMO Q;  1I6H H;  4MNO A;  4C3H H;  1XPU A;  4JI4 L;  3F8T A;  5C3E H;  1VQ5 A;  1GD7 A;  1EUJ A;  1UE6 A;  1QUQ B;  3RNU A;  1KRS A;  4LF5 Q;  2F4V L;  1JMC A;  3PO2 H;  4A3C G;  2UXD Q;  3DM3 A;  3EIV A;  4RMF A;  1Q81 C;  4GNX B;  2OWO A;  3M3Y H;  1Q82 C;  4DV7 Q;  1CSQ A;  4OX9 Q;  4JBK A;  4EQ5 A;  1IBM L;  3ULJ A;  2FXQ A;  1UE1 A;  4HJA A;  2JA7 G;  2KEN A;  1CSP A;  3STB D;  4AQY Q;  4NXN L;  4LW1 A;  5JJK A;  3HOZ G;  1GKH A;  3BZK A;  2WFW A;  4R4I A;  1NY4 A;  5C4X H;  4DR3 L;  2N49 A;  4LF4 L;  5JJL A;  1Z9F A;  4X64 Q;  1B70 B;  3Q8D A;  5JEA G;  3KDF A;  1TWH H;  3KDF B;  4A75 A;  4UP8 A;  3CP0 A;  1PA6 A;  4JYA Q;  3ER0 A;  3I55 A;  4A3D H;  5IYC G;  2KHJ A;  4L5S A;  1EQR A;  1UE5 A;  4DUY Q;  1GM5 A;  3I4O A;  3CCE A;  4A3B H;  4A3E G;  1KL9 A;  4P75 A;  1T9H A;  4JI3 L;  1I94 L;  3I7F A;  1Q46 A;  1HJP A;  2JK8 A;  5FLX c;  2BH8 A;  1HNX L;  1HR0 Q;  2R93 G;  1VQB A;  4P71 A;  3K7U C;  1K8A C;  3I4M H;  5C4J H;  1IBK Q;  1OXV A;  2NN6 I;  2MFI A;  1ASZ A;  2H5X A;  4DV0 Q;  4B3T L;  1XNR Q;  2JJQ A;  4HIO A;  4Y7N H;  3HFZ B;  1JJG A;  4Y52 H;  5BR8 L;  1E1T A;  5GAD C;  4DR6 Q;  1Q8K A;  4IPH A;  5IYB G;  3G4S A;  1YHQ A;  4BBR H;  3H0G H;  3PF4 A;  1Q86 C;  2CFM A;  1X3F A;  5C0X J;  5M3F H;  1ASY A;  3HOX G;  1NBW A;  4JI0 Q;  1L1O B;  2UUC Q;  3KF6 A;  5H1S E;  2F3I A;  3A5Z B;  4UP7 A;  4HIK A;  4C2M H;  4B3M Q;  2UXD L;  4HID A;  1A8V A;  3ULP A;  3KFU A;  1L0W A;  1A62 A;  2Q2H A;  4OX9 L;  1SLJ A;  3FP9 A;  4P72 A;  3U4Z A;  4LWC A;  2K5V A;  4GLV B;  4P74 A;  1JJC B;  1OXU A;  4IO9 A;  1QZG A;  1IYJ B;  2UUA Q;  1QVF A;  1N36 Q;  1I3Q H;  1VQ6 A;  1Q12 A;  2JA5 H;  2E2H H;  3ERS X;  2QEX A;  5DLQ E;  4AQY L;  3RZO H;  4JI1 Q;  2ALY B;  1D8L A;  3M9B A;  3UDI A;  2E5L Q;  3FKI H;  3NEN A;  1KD1 C;  4B3S Q;  1G51 A;  3IRB A;  3CCV A;  4DV1 Q;  3K81 C;  4JI7 L;  1JE5 A;  2K4K A;  1NMF A;  2OTL A;  5C4X G;  2AMC B;  1KIX A;  1X55 A;  2E8G A;  3CC2 A;  2ES2 A;  1V9P A;  1Y1V H;  3EN2 A;  4GN3 B;  1C0A A;  1V43 A;  2RCN A;  4A3L H;  1HZ9 A;  1WCM H;  2GVA A;  4A3D G;  4KHZ A;  3UDX A;  3CCU A;  4K0K Q;  1PYS B;  4A3B G;  4DV5 L;  1C7Y A;  3HOY G;  5IP7 G;  1E24 A;  3L2P A;  4MZ9 A;  1HR0 L;  1N33 Q;  1IL2 A;  4PZ7 A;  4A3G G;  1VQG A;  1PH4 A;  1YJW A;  4DV0 L;  3HOV H;  2PI2 E;  4PG3 A;  1CKN B;  1XJV A;  1YVC A;  2Q2T A;  2WAQ G;  3G48 A;  4NXN Q;  4DR6 L;  4JI5 L;  2K52 A;  1VQM A;  5K36 G;  5FJ8 H;  4JI2 Q;  3E9I A;  2VQE Q;  2YTY A;  2Z6K C;  3BJU A;  2Y0S G;  1SE8 A;  3UE0 A;  4DR3 Q;  1KAW A;  3SGI A;  3T1Y L;  1IBL Q;  2UXC L;  1E1O A;  4JI0 L;  3CW2 C;  4X65 Q;  1BBW A;  1EFW A;  5LMN L;  2I0Q A;  4DAY B;  4LUZ A;  4A3I G;  2UUC L;  3NEL A;  4B3M L;  3RLO A;  1Y14 B;  4JBM A;  4JBW A;  1AH9 A;  4UP9 A;  4DKA C;  2EIF A;  4BY1 H;  1PH9 A;  1I5F A;  3KOJ A;  4R4Q A;  2UUA L;  4IPG A;  2JA8 H;  5GRO A;  1EWI A;  3G6E A;  1N36 L;  1N34 Q;  3S17 H;  3JC6 6;  4JOI A;  1M1K C;  3PO3 H;  2R6G A;  5IWA L;  3JAM c;  4LUV A;  5GAG C;  1S40 A;  3FHW A;  2KCM A;  3ULL A;  1E22 A;  1MJC A;  4A3K H;  4A3M G;  1KHI A;  4LFB Q;  4OO1 I;  1Q1B A;  5BR8 Q;  2AKW B;  1WI5 A;  3A0J A;  1HNW L;  1NMG A;  5IYD G;  3GTJ H;  2MQH A;  3AEV A;  1DGS A;  3HOW H;  4OWX B;  1VQD A;  1FGU A;  3UDF A;  1FJG Q;  2VS1 A;  4IJL A;  1MIU A;  4DR7 L;  4BXX G;  1FL0 A;  1Y1V G;  2PNH A;  2QGQ A;  1Q1E A;  2KHI A;  1KXL A;  1EIY B;  4K0K L;  1CKM A;  3D0F A;  3STB C;  2K75 A;  2R92 G;  3M4Q A;  2NN6 G;  3EBE A;  4NPS A;  1N33 L;  5HY6 A;  3CXC A;  1YJN A;  2I5H A;  3W1G A;  3RN2 A;  1VQA A;  2K5H A;  2I5M X;  3B6Y A;  2HIX A;  1S3O A;  3PCO B;  1JB7 A;  3F2C A;  4LFC L;  1VQ7 A;  1H95 A;  4DUZ Q;  2L15 A;  2N3S A;  2VL6 A;  4JI2 L;  2VQE L;  2OQK A;  1X9N A;  2BA0 A;  4JI7 Q;  3K8A A;  5FJ8 G;  1C9O A;  1IBL L;  2ATW A;  4GLA C;  4X66 Q;  4DR1 Q;  1A0I A;  1N32 Q;  4R4O A;  4X65 L;  1VQP A;  5AJ3 Q;  2R7Z H;  3KLW A;  2Z0S A;  2BA1 A;  2YYZ A;  4LF8 Q;  4JCV E;  3AFQ A;  1TXY A;  5IP9 H;  4A3F H;  1Z47 A;  2C35 B;  4R4C A;  4YWL A;  1VQH A;  1TWC H;  1K3R A;  3AQQ A;  1VQI A;  1HZB A;  3TRE A;  4EX5 A;  5M5Y H;  4BY1 G;  1N34 L;  4UY8 C;  3CCR A;  3RZD H;  4DV5 Q;  3UDG A;  1PV4 A;  1W3S A;  5M3M G;  1PHJ A;  3DLL A;  3F2D A;  3OYY A;  5FLM H;  4X6A H;  1J5E Q;  3S2H H;  1VQJ A;  3U4V A;  1HR0 W;  4LFB L;  3M7N A;  4JOI C;  2Z6K A;  3CD6 A;  4BY7 G;  2GN5 A;  3RLN A;  3J7Z C;  2B63 G;  4OWW B;  3GTP H;  2JE6 I;  2ZTE A;  4JI5 Q;  4JG2 A;  2EQS A;  4ALP A;  1XPR A;  4QY7 A;  1TWF H;  3KJO A;  4P73 A;  3T1Y Q;  2PQA A;  4L5Q A;  4A76 A;  4DR5 L;  1SR3 A;  1BVS A;  1S72 A;  3S15 H;  4GKK Q;  5IE8 A;  1FJG L;  1GO3 E;  1VQO A;  1O7I A;  3W1B A;  2UXC Q;  2E2I H;  5ELO A;  3KF6 B;  5LMN Q;  5C3E G;  1G6P A;  2GVB A;  2AWN A;  2N78 A;  4DV4 L;  2NVX H;  4IOA A;  2JA6 H;  2IY5 B;  5GAH C;  5C44 H;  5LMN W;  4GLX A;  3PO2 G;  4HJ9 A;  1TWA H;  1JT8 A;  3HOU H;  1X3E A;  1YNX A;  4GN4 B;  3PF5 A;  1XMQ L;  3CCQ A;  2YTV A;  4GN5 A;  2UXB Q;  3K80 C;  4YCU A;  3CCJ A;  3CF5 A;  1N8R C;  1SRO A;  4RG1 A;  5IWA Q;  1U0L A;  1MJE A;  1P8L A;  4DUZ L;  1FVI A;  4QIW E;  4PZ6 A;  1VQ4 A;  1K73 C;  4IJH A;  4YY3 Q;  1U5K A;  5ELN A;  3GTL H;  3OTO Q;  1N32 L;  4X66 L;  4DR1 L;  1HNW Q;  5M5X H;  3J80 c;  5AJ3 L;  1VQN A;  2CWA A;  2E2J H;  4A3J H;  1B8A A;  3BU2 A;  2CCZ A;  2IX1 A;  4JI6 Q;  4PMW A;  3CAM A;  4IFD I;  4LF8 L;  3S1R H;  1X65 A;  3CQZ H;  4DR7 Q;  4X62 L;  3ICE A;  3H3V I;  4XIG S;  1I50 H;  4BBS H;  1TWG H;  4LNQ A;  3KF8 B;  2YTX A;  1EYG A;  4GKJ Q;  2IT1 A;  2RHS B;  5C0X G;  4HJ5 A;  4OO1 G;  1KRT A;  1XNQ Q;  1J5E L;  4DV6 L;  3I4M G;  3S1M H;  5GAE C;  3TEH B;  5FLM G;  2PMZ E;  4JV5 L;  4LFC Q;  2WB1 G;  1MKH A;  1WFQ A;  3GTG H;  4R4T A;  1P16 A;  4DAM A;  4LF9 L;  2QA4 A;  4A3C H;  2VQF L;  4B3R Q;  3NBH B;  3I2Z A;  1AE2 A;  4XTC S;  4BBR G;  4GKK L;  1UWV A;  1VCI A;  2A19 A;  3H0G G;  2D0O A;  1PH1 A;  2WAQ E;  4QQB X;  3HKZ G;  3CC4 A;  2HIV A;  5M3F G;  1EIF A;  2KBN A;  2K14 A;  1CUK A;  2DGY A;  2MNA A;  2Q2U A;  2LSS A;  2JA6 G;  1VQF A;  2JA7 H;  1LUZ A;  2F52 A;  2UXB L;  2NZH A;  1YJ9 A;  4OXP A;  4IPC A;  1G29 1;  4DNI A;  3HOZ H;  3RN5 A;  5M5W H;  2JA5 G;  2OTJ A;  1VS0 A;  1PH2 A;  2BH2 A;  1BKB A;  1XTD A;  4YY3 L;  1OXT A;  3FKI G;  3OTO L;  2Q2I A;  4DK3 C;  2ZM6 Q;  1VQ8 A;  4HIM A;  4KI0 A;  3H3V H;  4QGU A;  3J81 j;  3CPF A;  1PFS A;  3E9H A;  3GTK H;  2NZO A;  1YBY A;  4DR5 Q;  4JI6 L;  1X54 A;  1J6Q A;  3HKS A;  3J80 i;  2NVT H;  2V1C C;  3K0X A;  3U58 A;  2R93 H;  4AYB G;  2VZA A;  3J81 c;  4DV4 Q;  1HNZ L;  2VNU D;  1WYD A;  1K83 H;  2RF4 A;  1WCM G;  4DV2 Q;  4A3L G;  4GKJ L;  4JI8 Q;  2UUB L;  4POF A;  1XMQ Q;  2VY3 A;  2EXD A;  1XNQ L;  4IFD J;  1YHB A;  1IXR A;  3PUY A;  2ZTC A;  1PH3 A;  1WOC A;  4DK6 C;  1VQE A;  2CQO A;  3GD7 A;  2ZJR A;  4DV3 Q;  4LUO A;  4LFA L;  2VUM H;  3HOV G;  3CMA A;  4FDB A;  2HQL A;  4DR2 Q;  4GOP C;  3HOX H;  1E7Z A;  3PIP A;  3CME A;  1Y1W H;  2MO1 A;  4B3R L;  3S24 A;  3AFP A;  4IOC A;  1E3P A;  1HZC A;  5LMU L;  4POG A;  1PH6 A;  1QUQ A;  3ZJY C;  4YCV A;  2A8V A;  3PIO A;  4NXM Q;  3RR5 A;  1PH7 A;  1W2B A;  4NB3 A;  4GNX A;  1UE7 A;  3PV0 A;  4X62 Q;  3CPW A;  3TS2 A;  4KLK A;  4YHH Q;  3PUV A;  3M4O H;  1OXX K;  4GS3 A;  2CKZ B;  4C3J H;  1SN8 A;  3M4P A;  1K8G A;  2JA8 G;  1PVO A;  3RLF A;  2HHH L;  4BA1 I;  3KJP A;  3PO3 G;  2WP8 J;  4AIM A;  4DV6 Q;  1SMX A;  2K5N A;  4JV5 Q;  2ID0 A;  3OW2 A;  3JAM i;  4A3K G;  2ZM6 L;  3CCS A;  3GTM H;  2R7F A;  5JJI A;  4IFD G;  1YZ6 A;  4LF9 Q;  4OWT B;  2PQA B;  2PI2 A;  3D31 A;  3AYH B;  2VQF Q;  1R9T H;  1VQL A;  3T1H L;  1VQK A;  1SRU A;  2UU9 Q;  4QJF A;  2ZJQ A;  3HOW G;  3WWV A;  4DR4 L;  2CWP A;  3L7Z C;  1B7Y B;  3TS0 A;  2JEB I;  2XTI A;  5IP7 H;  3HOY H;  2NVQ H;  1M90 C;  2D0P A;  4A3G H;  1LM0 A;  3H15 A;  4DV2 L;  1SFO H;  1KC8 C;  4JI8 L;  2IX0 A;  2YV5 A;  4AH6 A;  4KHP Q;  3J81 i;  1NJI C;  3I4N H;  1XPO A;  4LF7 L;  2ZTD A;  1QZH A;  1VQC A;  2R7D A;  3MEF A;  4HJ8 A;  4DV3 L;  1D7Q A;  4LF5 L;  5E7N A;  4BA2 I;  4DR2 L;  1XMO L;  1BBU A;  3CC7 A;  1VQ9 A;  2VUM G;  2MO0 A;  3E0E A;  1QVC A;  2D62 A;  2DUD A;  1X6O A;  2N8N A;  4J15 A;  4A3I H;  1JJ2 A;  4A93 H;  5J3B A;  1NTG A;  1L1O A;  3GO5 A;  1HH2 P;  3NEM A;  4TQU S;  1Y1W G;  2OCE A;  2IHF A;  4JC0 A;  4LF6 Q;  1X3G A;  4NXM L;  2R7Z G;  5IT9 c;  5IY0 A;  2ZJP A;  3CCM A;  4YCW A;  4DV7 L;  3CCL A;  3PGZ A;  4O0A A;  3LGJ A;  4YHH L;  5IP9 G;  3PUW A;  4A3F G;  1HNZ Q;  1X56 A;  3I56 A;  3M85 A;  4GNX C;  1V1Q A;  4A3M H;  2OQ0 A;  1RL2 A;  1YEZ A;  1YIJ A;  2AWO A;  2JA9 A;  2XGT A;  1WJJ A;  1K0R A;  2UUB Q;  4L5R C;  3S14 H;  4GOP A;  4GOP B;  4OON A;  1YIT A;  5IYD H;  3S1Q H;  2NVY H;  4PZ8 A;  4LFA Q;  1GVP A;  1RIP A;  1N9W A;  3TQY A;  4X64 L;  3GTQ H;  3W5O A;  1YI2 A;  3K7A H;  1L2F A;  4BXX H;  4JI4 Q;  4JYA L;  1UEB A;  4YWK A;  5LMU Q;  1NE3 A;  4H02 A;  4DUY L;  1K9M C;  2UU9 L;  3MXN B;  2WB1 E;  2F4V Q;  2R92 H;  4O2D A;  2HT1 A;  1KQS A;  2Y0S E;  4QL5 A;  5GQO A;  3J7A 5;  2B29 A;  1IBK L;  1IBM Q;  3L0O A;  3S2D H;  5C44 G;  3TRZ A;  1XNR L;  3HKZ E;  4KHP L;  4A4I A;  3HOU G;  4R1J A;  2K50 A;  1CKN A;  3G71 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...