2CQOA

Solution structure of the s1 rna binding domain of human hypothetical protein flj11067
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
119
structure length
119
Chain Sequence
b'GSSGSSGMNSGRPETMENLPALYTIFQGEVAMVTDYGAFIKIPGCRKQGLVHRTHMSSCRVDKPSEIVDVGDKVWVKLIGREMKNDRIKVSLSMKVVNQGTGKDLDPNNVIIESGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleolar protein of 40 kDa
publication title Solution structure of the S1 RNA binding domain of human hypothetical protein FLJ11067
rcsb
source organism Homo sapiens
molecule tags Ribosome
total genus 12
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2005-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00575 S1 S1 RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2cqoA01
4A3KH 3RLNA 5FJ8H 2ES2A 2R7DA 1A8VA 2L15A 2B63G 1WI5A 1CKOA 1J5EQ 2ZM6L 4H02A 2R7FA 2UXDQ 2KHJA 2MO1A 3I4OA 1VQKA 3I4NH 4RMFA 1E22A 1Y14B 4A75A 4IFDJ 1VS0A 1G51A 4LW1A 3L2PA 4NXMQ 1YJWA 1Q86C 1CUKA 3HKZG 5LMUL 4GLXA 1TWCH 5J3BA 4LFAL 1N34L 2Q2IA 2IX0A 1KQSA 2WB1E 1GM5A 2JA9A 2WAQE 3W5OA 1VQPA 1VQ8A 1Z47A 3CC4A 1XNRQ 1JB7A 3PO3G 4R4QA 3K8AA 4GNXC 2JA5G 4A3BG 2UUCL 1TWFH 2VS1A 4QGUA 4C3JH 3PSIA 1HNZL 2CWPA 4NXNQ 3GTLH 5IP7H 2Z6KA 1LYLA 4DR1Q 4A3JG 1VQOA 4JI6L 4OX9Q 4LFBL 3TS2A 4AYBG 5C4XG 1XMQQ 4GKJQ 4YY3Q 3S24A 1VQCA 4GKKL 4GOPC 1JJ2A 1SR3A 4A3DH 1TXYA 3JC66 3HOZG 3HOWH 2H5XA 1VQNA 4ALPA 1A63A 2YYZA 3FKIH 3K7UC 2R92H 3S1NH 1JMCA 4DR4L 3CC2A 1KRTA 4C3HH 3S2DH 4K0KQ 1Q12A 4LF8Q 3KOJA 2XGTA 4ME3A 5IYDG 1M90C 2F3IA 1VQBA 5ELNA 1IYJB 1X3FA 3KDFA 2PMZE 1FJGQ 1BBUA 4O2DA 2PNHA 4BBRG 3GDEA 2B63H 4JBMA 1X55A 3KJPA 4DV7L 1PH9A 1I94Q 3ER0A 1YI2A 1YJ9A 4C2MH 1WCMG 2Y0SG 3BU2A 1B70B 4DR7Q 5BR8L 4A93G 1IBML 4UP8A 1N8RC 1YITA 2EIFA 4JI1L 1VQGA 2CFMA 1K3RA 3KDFB 4FDBA 1R9TH 4LF4L 1CKNB 3MXNB 4JI5L 4Y52H 1K0RA 1U0LA 4TVAB 2UUBQ 3RN5A 4DR5L 5IYBG 3PO3H 3A0JA 4IPDA 1Q82C 3CW2C 2Q2HA 1J6QA 2VL6A 2VW9A 2JA5H 2UXBQ 4A3BH 3PUXA 4OXPA 2UUAQ 1PHJA 4PZ6A 5JJIA 3CD6A 2YTYA 1CSQA 5C4XH 4A3JH 1W2BA 4X65L 2K75A 4IPHA 1YNXA 3CCSA 2Q2TA 2AKWB 2IHFA 2YU9H 1QVCA 4JYAL 3D31A 3AFQA 1VQHA 1SMXA 3ZJYC 3HOZH 4MZ9A 4BY7G 2DGYA 4EX5A 1WFQA 1LUZA 1SRUA 2EQSA 4X64Q 4DV3Q 2E2HH 4UP7A 1Q1BA 3M9BA 3GTJH 1FGUA 4LWCA 2AHOB 2MO0A 4HJ5A 1K83H 1YZ6A 5IYDH 5IWAQ 3F2CA 4LF5L 1RIPA 1WJJA 4L5SA 4B3MQ 3I56A 3OTOL 4BBRH 3KLWA 4TQUS 4PZ7A 4NB3A 3CXCA 2VY3A 1ASZA 1X65A 2HQLA 2HHHL 2JE6I 1SE8A 2EXDA 1WCMH 1HH2P 4KI0A 3J81c 1DGSA 4JC0A 1IBLL 4B3SL 4DV4Q 2ATWA 2F52A 4A93H 4PMWA 4JI0L 1OXSC 1WYDA 2AWNA 4GS3A 2CWAA 3AEVA 2ZTDA 1VQMA 3CAMA 1VQ6A 1Q46A 5C0XJ 4NPSA 2D0OA 5IYBH 2ZTCA 3ERSX 2IHEA 2CKZB 2KBNA 4DR2L 3NELA 3T1YQ 3I55A 3T1HQ 3JAMc 1IBKQ 1B7YB 2HT1A 1V9PA 3LGJA 3S2HH 2CQOA 2K5NA 1N36L 4GNXA 2RF4A 4YWKA 3CMAA 3HKSA 2NZOA 1LTLA 2PQAB 4JBKA 3A5ZB 1OTCA 4BY7H 2AMCB 4DR6Q 1X6OA 1X54A 3CCLA 1SLJA 4BXXG 5M3MG 4YHHQ 3U50C 3BJUA 4HJ7A 1HR0L 3PV0A 2NVQH 1XPUA 2I0QA 3S1MH 4GNXB 3L7ZC 1QZGA 3K0XA 4DV5L 3BZKA 3ULPA 2K4KA 3RLFA 1KIXA 4LUVA 1Y1WG 1YVCA 4AH6A 1N32L 4JI4L 4OWWB 2ZJRA 5C4JH 1VQLA 4KHPQ 3PUYA 4DR3Q 3CPWA 3B6YA 5GAGC 1KC8C 4LNQA 3M4OH 2DUDA 4B3TL 4DPGA 3OW2A 3RN2A 2N3SA 2LXJA 4B3RQ 1EQRA 2YV5A 4LFCQ 4HIDA 4HIKA 1Y1VG 4P74A 1UE6A 5ELOA 1XMOQ 3HOVG 2GN5A 3ULLA 3NEMA 4P71A 1X56A 3NBHB 4DV0L 4DV6Q 4HJ8A 4JI3Q 2BH2A 4KHZA 1GD7A 1K73C 5JEAJ 4OO1G 4J15A 4DUYQ 4LF6Q 3A5UA 4LF9Q 3GTQH 3S16H 2V1CC 4A3FG 1Q8KA 3KF6A 2E5LQ 3KJOA 3CCQA 5IP9G 1E3PA 3HFZB 3HOXG 2ALYB 4LUOA 3CCJA 1YHBA 4QIWE 3H15A 3K81C 1YJNA 1J5EL 1K8GA 1XTDA 3KFUA 4GLAC 2FXQA 4KLKA 1KXLA 2UXDL 1C0AA 1XPOA 2WFWA 4JI1Q 5HY6A 4QL5A 5M3MH 4BXXH 5K36G 2VZAA 2B3GA 4DK3C 4LF4Q 1CKNA 1VQEA 5JJLA 1YBYA 2LSSA 5M3FG 4NXML 1NTGA 3KF6B 2WP8J 3Q8DA 3H0GG 1HZCA 5IT9c 3E0EA 1Q7YC 4UPAA 3FHWA 3E9HA 2VQFL 4DV1L 3M4PA 3STBC 1VQ9A 1YEZA 3A74A 3PF5A 4X62Q 3G71A 2K50A 2N78A 2A19A 3EN2A 1Y1WH 3RZOH 2HIVA 3RR5A 1VQ5A 1SROA 4BY1G 1XNQQ 2K14A 3AYHB 2I5HA 1HNWQ 2F4VQ 4NXNL 1JJCB 1HJPA 4PZ8A 4HIOA 2RCNA 1NE3A 4DR1L 4OX9L 1XMQL 1SFOH 4GKJL 1PFSA 4YY3L 4UY8C 4HJAA 4LF7Q 1Y1VH 3STBD 5LMNW 3HOVH 2BA0A 3DLLA 4JBJA 4AQYQ 1UE1A 4IJHA 3W1GA 2MQHA 1E1OA 3M85A 3CCUA 5LMNQ 4JV5Q 3PUVA 3F8TA 1I50H 3GTGH 4K0KL 4LF8L 2QEXA 2JEAI 1HZAA 3HKZE 3D0FA 5GQOA 2BH8A 1NMFA 4A3FH 1MJCA 1YIJA 2Z6KC 5DLQE 4IFDG 1ASYA 4DAYB 5IP9H 1FJGL 1EOVA 1QUQA 3HOXH 2RHQB 1HNXQ 3M3YH 1AH9A 1QZHA 1N33L 1I94L 1D7QA 1EQQA 1G6PA 1IBLQ 2AWOA 4C3IH 3GTMH 1S72A 2RHSB 2KHIA 4JI2Q 3FP9A 1K8AC 4DUZQ 4DR7L 1OXUA 2QA4A 3TQYA 5IYCG 4XIGS 4AYBE 5M3FH 2GVBA 2UU9Q 4P75A 2MNAA 4A3CG 3H0GH 1N9WA 3TRZA 5JJKA 3J80i 2IY5B 1QUQB 1GKHA 2UUBL 1AE2A 1PV4A 2ZJQA 2BA1A 2K5HA 2VQEQ 1BBWA 4R4IA 4UP9A 5C3EG 3PF4A 1PH8A 2UXBL 1PH2A 3CP0A 4A3IG 2PI2E 2UUAL 4WJ4A 2WB1G 5GROA 2WAQG 4BY1H 3ICEA 1GVPA 3CCRA 2PQAA 1E24A 2E2JH 2I5MX 3UDGA 4HJ9A 1P16A 2IX1A 3GTPH 2ASBA 4A3LG 3NENA 2JA6G 1I5FA 3PUWA 2KCTA 3CQZH 2Y0SE 4X64L 4DV3L 2NN6G 1X9NA 1WOCA 4OONA 4WJ3M 1TWGH 4YWMA 2ZM6Q 2JQOA 4R4CA 3CCVA 3KYHC 5M5YH 2B29A 3G4SA 3S14H 4YCWA 4JI7L 3S1RH 5IWAL 3I7FA 1EFWA 4YCVA 3CPFA 4B3ML 2JJQA 5LMUQ 3J7A5 4MTNA 1T9HA 4GOPA 3M4QA 2UXCQ 4DV2L 3CC7A 1A0IA 4LFAQ 1N34Q 3U4VA 1KD1C 4A3EG 3RLOA 1L1OC 1E1TA 2GVAA 2IT1A 2K52A 1YHQA 1PA6A 2ZJPA 4A4IA 3S1QH 3AQQA 2UUCQ 5IYCH 1B8AA 4DKAC 3PO2G 4JI8L 2I5LX 1HNZQ 4IO9A 1O7IA 1X3EA 4JI6Q 4A3CH 4DAMA 4BA2I 4LFBQ 4A76A 3UDIA 4QQBX 4X66L 1VQ4A 4GOPB 4O0AA 2YTVA 4GKKQ 1JJGA 1KL9A 1KRSA 2Z0SA 3F1ZA 4IJLA 5C3EH 3BZCA 1L0WA 4AIMA 1MJEA 5AJ3L 4A3GG 2N8NA 3T1YL 3H3VH 2KCMA 4A3IH 3T1HL 4XTCS 1K9MC 1IBKL 4JOIC 4DK6C 4DR4Q 1PH6A 2NVXH 1NMGA 1M1KC 3KF8B 5E7NA 4YWLA 3GD7A 3S15H 5GAHC 1VQ7A 3CCMA 4A3LH 1I3QH 1AE3A 2E8GA 3K7AH 1PH4A 2JA6H 4DR6L 4DV7Q 1JE5A 4YHHL 1TWHH 2NVYH 1CSPA 1OXXK 1VQIA 2YTXA 2C35B 2N49A 5C44G 1G291 4P73A 1VCIA 3J81j 2VQFQ 1NBWA 4BA1I 4DV1Q 3M7NA 4IFDI 5EAYA 4JCVE 1P8LA 5BR8Q 1C7YA 4L5RC 1UE7A 1IBMQ 3CMEA 4IOCA 5IY0A 1EYGA 1VQJA 5M5XH 3RZDH 3U58A 5GAEC 4JI5Q 4POGA 3E9IA 5C0XG 3I4MG 4DR5Q 2JA8G 4A3EH 1PVOA 4KHPL 4DR3L 2HIXA 1HZBA 1PH1A 2JK8A 2OTLA 3GTKH 3HOUG 4B3RL 1TWAH 1XNRL 4QY7A 4LFCL 3PO2H 3CF5A 1XMOL 2R7ZH 2VNUD 4X65Q 3W1BA 1BVSA 3J7ZC 4JYAQ 4DV6L 4BBSG 4JI3L 3ULJA 3PGZA 3AFPA 1BKBA 1SN8A 3EIVA 1KHIA 4DUYL 4A3GH 3GO5A 3H3VI 4APVA 5FLMG 4POFA 4LF6L 4LF9L 4IOAA 4PG3A 2MFIA 2LXKA 1N33Q 1FL0A 2E5LL 2NVTH 1IXRA 4L5TA 1NJIC 5FLXc 3TS0A 4OWTB 1YHAA 3U4ZA 4LF5Q 4P72A 5H1SE 1UE5A 1Z9FA 4L5QA 3OTOQ 3HOYG 1PYBA 3IRBA 1EIYB 2NN6I 4GN5A 5M5WH 2NZHA 2JA7G 1RL2A 3G6EA 4DNIA 5C44H 1VQFA 1Q81C 2HHHQ 1W3SA 4B3SQ 1PH7A 3F2DA 1S3OA 2R6GA 4JI0Q 4OWXB 2VUMG 4X62L 2R93G 1MKHA 3PCOB 4YCUA 5GADC 3EBEA 2Q2UA 3I4MH 1EWIA 1OXTA 2JA8H 1PH5A 1D8LA 4JG2A 4MNOA 5JEAG 3J81i 1XNQL 1XPRA 2F4VL 1HNWL 2K5VA 3K80C 2D62A 2KENA 4GN3B 4DR2Q 3VDYA 4A3MG 2OWOA 3HOUH 1IZ6A 1QVGA 4LF7L 4A3KG 4EQ5A 3F2BA 5FJ8G 1L1OA 1NY4A 1N36Q 1MIUA 1UWVA 4AQYL 5LMNL 4BBSH 1PH3A 5HGQA 1C9OA 3G48A 3TREA 4JI7Q 4JV5L 4RG1A 3SGIA 1V43A 1OXVA 1GO3E 3OYYA 3WWVA 3TEHB 3I4NG 1HR0W 5FLMH 2UXCL 3PIPA 3RNUA 1I6HH 2A8VA 3JAMi 1X3GA 4DV2Q 1HR0Q 2CCZA 2XTIA 3PIOA 1H95A 3J80c 1EIFA 1L1OB 4GN4B 2OQKA 3UE0A 1HNXL 1IL2A 1JT8A 4OO1I 4Y7NH 3L0OA 4DV5Q 4JOIA 4QJFA 4R4TA 1QVFA 2A1AA 1HZ9A 3GTOH 1UEBA 4JI2L 3HOYH 4JI8Q 1Q1EA 2JA7H 1L2FA 4DUZL 4HIMA 2OTJA 1VQDA 2ZTEA 4IPCA 3UE1A 4JI4Q 1N32Q 1XJVA 4X66Q 4R4OA 1VQAA 2OCEA 2UU9L 1EUJA 5IP7G 2JEBI 3UDFA 2ID0A 4B3TQ 1CKMA 4R1JA 4LUZA 1A62A 5IE8A 5AJ3Q 1FVIA 2VUMH 1E7ZA 4A3DG 3UDXA 3PUZA 4DV4L 1KAWA 1LM0A 2VQEL 2R93H 3HOWG 1V1QA 2OQ0A 3I2ZA 4DV0Q 5C0XI 1S40A 3FKIG 2R7ZG 4IPGA 3CCEA 1U5KA 2PI2A 4X6AH 2R92G 3DM3A 2E2IH 3S17H 1PYSB 2D0PA 4GLVB 4JBWA 4A3MH 3MEFA 2QGQA
chains in the Genus database with same CATH superfamily
4O1NA 1PMRA 4A3KH 3MWYW 4H13C 4CKCA 2KHSA 2LKVA 3GTJB 2ZM6L 5IIFA 4LMQD 2KHJA 2MO1A 1E22A 1J8IA 4F7XA 4BBRB 1ESFA 3L2PA 1PRTB 2HD3A 4RCNA 5LMUL 1Q86C 1CHQD 5J3BA 2PO4A 2Q2IA 1NUCA 2IX0A 4RHSA 3CC4A 1XNRQ 2WAQE 2EJMA 3BDOA 4R4QA 4GNXC 2JA5G 1XWEA 1SJHD 2UUCL 4C3JH 1BOSA 4O42A 4MIUA 4C1NK 2Z6KA 1LYLA 5IP7H 4DR1Q 4OX9Q 1NCVA 1XMQQ 2F0VA 3IFTA 1VQCA 4GOPC 3JC66 2K1BA 1A3VA 2H5XA 1PFNA 4RGMA 3HRZC 3S2HB 1AZPA 2X6GA 3MTSA 5T1GA 1B9NA 1Q12A 4LF8Q 2SOBA 3PIP3 1U4PA 3HS0C 4ME3A 1M90C 2ZXPA 5KYLA 1VQBA 1BUVT 4CKBA 2PMZE 4BBRG 4RH6A 1PH9A 3KJPA 1D5MC 1SYEA 3A8IE 1YI2A 1XYIA 3A55A 1DXMA 3BU2A 2D9UA 4RGTA 4CDEC 2XWJB 1IBML 1N8RC 1G6ZA 5I4DA 1X3QA 5FK9C 1K3RA 5FO8B 3R3OA 4J6HA 1U0LA 4UDUC 3HG9A 5ISRA 1SNPA 3RN5A 2FMCA 3A0JA 1SYBA 3CW2C 3K57A 2JA5H 4FF4A 3PUXA 4OXPA 2UUAQ 5JJIA 3CD6A 2B2UC 2K75A 2Q2TA 4JYAL 2YU9H 3D31A 1I4XA 1SMXA 1I4HA 1SMYD 1WFQA 1LABA 1LUZA 5C4ZA 2EQSA 4X64Q 4DV3Q 5I6WA 3NXWA 3GTJH 2AHOB 2MO0A 3HZXA 4HJ5A 1YZ6A 3O13A 5IWAQ 5CMDA 2CW0D 4MTKA 4TSSA 4BBRH 5M3MB 5A2QE 2HHHL 4B3SL 1FNUA 2TMPA 2ATWA 2RBMA 4PMWA 4JI0L 1SE3A 2XIWA 2AWNA 4GS3A 3AEVA 4K14A 3CAMA 2J0TD 4L8JA 4NPSA 3T4AC 3URYA 4HN7A 3ERSX 2CKZB 1Y1VB 2IW3A 3I55A 2JYOA 2HT1A 3CRKC 3LGJA 3S2HH 2CQOA 1N36L 1CT1D 2BOSA 1HUMA 2NZOA 1EU4A 3EROA 1JOOA 3RUZA 2B2WC 1WTOA 5M3MG 4HJ7A 1HR0L 2ZXRA 4GNXB 3L7ZC 2CHBD 5JVG3 1QCBD 3GTMB 3BZKA 5DM73 5KEEA 3NBHA 3J80L 5ELFA 4LUVA 5C5MA 5M3FB 1N32L 1F2ZA 4KMUC 4JI4L 1VQLA 3B6YA 5GAGC 1KC8C 2DUDA 2F0SA 5IGFA 2LXJA 2YV5A 1BQQT 4HIDA 1Y1VG 1XMOQ 3T16A 4BY1B 4DV6Q 2BH2A 4ULLA 5KIXA 4OO1G 4J15A 1ENFA 3A5UA 3GTPB 2V1CC 4A3FG 1PFBA 3CQZB 1H9SB 4X3TA 1BCPC 1HTLD 2L11A 2FFKB 3H15A 1J5EL 3D4DA 5HGTA 3DHQA 1KXLA 2UXDL 2WFWA 5M3MH 4K6DA 4LF4Q 2EYFA 1YNJC 5M3FG 3H0GG 5IT9c 4RFBA 3E9HA 4NDXA 3STBC 2J7ZA 3G71A 3S1QB 2K50A 2ZT9C 1SROA 2XWBB 4BY1G 3AYHB 2I5HA 1HNWQ 1JJCB 1HJPA 2RCNA 2EXZA 3FPUB 4GKJL 4YY3L 4LF7Q 1Y1VH 1B3AA 5EKLA 1II3A 2DNCA 4HMJA 5LMNQ 2QW7A 2MQHA 1TS3A 1Q90A 3NHHA 3F8TA 4OO1H 1C48A 1HZAA 1K8MA 1HTPA 3D0FA 4R8NA 5GQOA 1MJCA 1I3QB 4A3FH 5BN3A 3BYYB 4DAYB 2V4DA 1FJGL 1LTTD 1TWHB 1X3PA 1N33L 2Z6BA 4HAEA 2EJFC 3GTMH 2DNEA 2RHSB 1BBXC 1MSGA 2LMCB 1W6JA 5DNFA 5IT9L 5M3FH 2UU9Q 4P75A 1Z7TA 4A3CG 3H0GH 5JJKA 4B9XA 2IY5B 1DYQA 1QUQB 3SE0A 4UP9A 2HUGA 2K5QA 4XQJA 4BY1H 3ICEA 3CCRA 2I5MX 3UDGA 4HJ9A 2IX1A 3GTPH 2HDMA 2RVLA 3NENA 3LWEA 3PUWA 3CQZH 5DEHA 1MHWC 4HSPA 2ZM6Q 2JQOA 4R4CA 2B29A 2NUCA 5KYIA 4IFDH 5LL6S 3CPFA 1ENCA 4HTHA 3FDTA 5CC4A 1IKMA 1HRJA 1DOMA 5LMUQ 3J7A5 3VYRA 1WTVA 4GOPA 1A0IA 3A7AB 1KD1C 2EJGC 2ENBA 2KECA 3FRPB 2K52A 1I4GA 4HCSA 3VA5A 1CM9A 3S1QH 1HQRD 2UUCQ 1AEXA 1B8AA 4DKAC 4JI8L 2JXMB 5CV5A 2DJFC 4A3CH 4IO9A 1X3EA 4DAMA 1T5EA 4BA2I 1S5DD 2JA8B 1VQ4A 3GQBA 1KRSA 4IJLA 4C56C 4K5VA 1BCPB 2N8NA 5EPLA 1K9MC 1DM0B 1NMGA 2KCCA 2QKIC 4DFAA 4DAVA 5BN4A 3GD7A 3S15H 1NSNS 5JPNC 1I3QH 1AE3A 3NPPA 2K01A 1G2TA 1QJOA 2EDGA 1TWHH 1OXXK 1VQIA 2YTXA 1G291 2VQFQ 5CV7A 3J81j 1NBWA 3TP7A 3NTKA 4JCVE 5M5YB 3E5SA 1P8LA 1FNVA 5IGEA 5AFWA 1UE7A 1IBMQ 5IY0A 1BXTA 1CFMA 1VQJA 3RZDH 3TBIB 3U58A 5GAEC 4POGA 3E9IA 1SYGA 3R2TA 4K6LA 3T51B 5C0XG 4N8X1 1BCPD 2JA8G 1TS5A 2D5DA 4DR3L 1HZBA 2JK8A 2OTLA 1XNRL 4QY7A 4LFCL 5EJWA 2R93B 1ICFB 4ZK9B 2F0KA 2R7ZH 2LFNA 1MI2A 1XX8A 4JYAQ 1FR3A 2F0JA 3S17B 4DUYL 1U4LA 3H3VI 5FLMG 4XXEA 4POFA 4PG3A 3WDNA 5D3DA 1NJIC 5FLXc 1J9OA 4DAPA 3OMGA 2MGSA 1TS2A 1TY2A 3IFDA 3IRBA 3Q6SA 2NN6I 4DNIA 2HHHQ 2O2LD 1W3SA 1TWCB 2E2DC 4B3SQ 4WRDA 1EU3A 4JI0Q 3OHXC 2IL8A 2EPBA 4F88A 4KD4A 2R93G 1TWFB 5GADC 1BNZA 3EBEA 2Q2UA 3MC0B 5C0XH 1V1PA 1M4VA 2JA8H 1PH5A 1D8LA 4QB4A 2F4VL 1E2WA 2D62A 4GN3B 2OWOA 5JVH3 1GOZA 4EQ5A 3F2BA 5FJ8G 5KNDA 1L1OA 1N36Q 5E3FA 4JI7Q 3TREA 4JV5L 1F9RA 1NNXA 1NR2A 1QNUA 1V43A 1OXVA 5FLMH 2M2LA 1HR0Q 2CCZA 2XTIA 3OIPA 1EIFA 4G4KA 3VR5A 1HNXL 3L0OA 1QVFA 2A1AA 3D3RA 3IAYA 1L2FA 2C5CA 5KNBA 4DUZL 4IPCA 1N32Q 5CYUA 4JI4Q 4EQNA 1PTOC 1A3TA 3HKZB 4ZRZA 1HA5A 1S4ZA 4ME5A 1U9RA 2VB3X 2AQ3B 3H09A 4R1JA 5IGGA 2R93H 2Z4IA 1EQVA 1S40A 4KKTA 1U5KA 2PI2A 1IKLA 1W6KA 5G3LD 4A3JB 3L3OC 1EWCA 3S17H 1VDZA 1PYSB 3MEFA 1F9QA 2F0GA 4RGNA 5FJ8H 2R7DA 1A8VA 4OHJA 2DN8A 4XDXA 1WI5A 1J5EQ 1Q8IA 2UXDQ 1VQKA 4RMFA 1Y14B 3DXJC 4A75A 1T5XD 1CUKA 3HKZG 3W2DA 1TWCH 1B3QA 2Y0SB 4XT3B 3W5OA 1VQPA 1VQ8A 3QOLA 3K8AA 1TWFH 4ID6A 4QGUA 3HP3A 3SEBA 1LLRD 1EEID 3PSIA 4JI6L 4LFBL 2F3VA 4A3JG 4FF2A 1SYDA 4GKJQ 2HDLA 1MD2D 3S24A 4YY3Q 4GKKL 1JJ2A 1SR3A 1TXYA 1SNDA 1EZ8A 2YYZA 3NK9A 1JMCA 3CC2A 1KRTA 2F0FA 3I72A 4JK1C 5D65A 3KDFA 3EQLC 1FJGQ 1X55A 1MSHA 2NVQB 2EVBA 3ER0A 1YJ9A 4B08A 2AUJD 2Y0SG 1B70B 2A5HA 4UP8A 4Z9CB 1YITA 1H9RA 4LF4L 4KHVA 4J8QA 4Y52H 4JI5L 4U68A 1K0RA 3T13A 4OELB 2P5ZX 2QEJC 3CHBD 1CSQA 1C4QA 4A3JH 2F0IA 1QVCA 2Z4HA 1VQHA 1CA6A 2KUMA 4MZ9A 2DGYA 3GTQB 4EX5A 5C3XA 2EOTA 5I9PA 1I4QA 1ET9A 1ILQA 3TP8A 4LF5L 3TDQA 1RIPA 1WJJA 4FXDA 1JC7A 5EQ0A 2LY7A 4PZ7A 2HQEA 2AQ2B 4NB3A 2VY3A 1X65A 1EYDA 2JE6I 3J81c 1HH2P 2F3WA 2GA4B 4KI0A 1A6XA 2SDFA 4M1UB 3MXPA 1H9JA 2F52A 5E4WC 2DY8A 1U4MA 1DOLA 1G2SA 5JAVA 1VQ6A 2D0OA 1SDFA 1SFOB 3NSWA 2JA5B 3CKIB 2C9OA 2K7VA 2G9DA 4NKLA 4G7ZC 3K5LA 4FF1A 1O7YA 1PTOD 4E6IA 1X6OA 1SLJA 1AW7A 2E76C 3BJUA 2NVQH 3PV0A 4FO2A 3ERQA 4C3IB 1QZGA 5EKKA 3R93A 3NP8A 2WACA 4AH6A 1B2TA 1RTNA 4DR3Q 4MHEA 3CPWA 2A74C 2NYZD 3OW2A 3RN2A 2N3SA 4LFCQ 3QB3A 1AN8A 2GN5A 4JVZA 3NEMA 4DV0L 3NBHB 1D5ZC 3D6WA 2EY6A 4HJ8A 3W3AA 3C1EA 1HA6A 4H44C 2E2JB 2EY2A 1K73C 4DUYQ 3D4RA 1PYWD 3GTQH 2BCOA 1Q8KA 2KVMA 3KF6A 5IP9G 1TIID 1TWGB 1YHBA 4QIWE 1RTOA 3K81C 4C3IG 4LJZC 3VYUA 2FXQA 1XPOA 4JI1Q 4QL5A 4DK3C 5JJLA 2RA4A 1VQEA 1YBYA 2LSSA 5IGDA 2PCFB 4NXML 2O4XA 4WFN3 4CDDC 3BS1A 3E0EA 2A69C 1JE4A 4UPAA 2VQFL 1AP0A 4ZCKA 2Z9HA 1YEZA 1YIJA 4K2KA 5KRUA 4ZAIA 3DWQA 3J7YW 2HIVA 3RR5A 1PDQA 2F4VQ 1CTMA 1ML0D 4TRDA 1SFOH 1O7LA 2BA0A 3M4YA 2HCCA 1HXYD 4BWGB 3W1GA 1E1OA 2MPMA 4JV5Q 3PUVA 3K5NA 2F0NA 4K0KL 1LTBD 3HKZE 4HEDA 3M7NA 2BH8A 3K7AB 2EYPA 5DLQE 3G7LA 2L55A 4IUVA 1ASYA 5IP9H 1EOVA 3QO2A 1HNXQ 4NP5A 1QZHA 1D7QA 3KLSX 1G6PA 1LT5D 4C3IH 1S72A 5IODA 4DUZQ 1OXUA 4XIGS 5M5XB 4DK1A 1HCZA 2B39A 3VR3A 5DM63 3J81E 1B9MA 4FXGC 2UUBL 4M8AA 4RWSC 2ZJQA 1PV4A 2L1BA 3GTKB 1TWAB 1PH8A 2UXBL 3CP0A 1QILA 4KN7C 2E2JH 3VR2A 2ASBA 1U4RA 2B2TA 1I5FA 2KEEA 2Y0SE 1QWYA 5EBCA 1TWGH 1STEA 3KBXA 1RODA 2QDBA 3VR6A 1SYFA 4YCWA 2RDGA 4R9WA 4JI7L 5EGTA 3I7FA 1EFWA 2OT2A 2VXWA 4A3FB 4B3ML 5IGBA 4MTNA 2A68D 3RLOA 1L1OC 5ELDA 2IT1A 3AQQA 1EEFD 2I5LX 3KF8A 4JI6Q 4LFBQ 2K6AA 4A76A 3H0GB 4QQBX 1S5ED 3VYSA 4GOPB 4IURA 4O0AA 4GKKQ 1KL9A 3BZCA 1MJEA 3HEJA 1GHKA 3T1HL 4DNTB 4CJ2C 1IBKL 1BDOA 1EYCA 3SK6A 5GAHC 3K7AH 3AU7A 5CBAE 5L37A 2IJ0A 1I6HB 1ZKOA 4EGVA 4YHHL 4P73A 5CBEE 4DV1Q 4BA1I 2SNMA 3I70A 4L5RC 3GTOB 3HOYB 1LO5D 4JPBW 1PFMA 4IOCA 2JA7B 1EYGA 5M5XH 4EQPA 4JI5Q 1GUTA 5FO9B 2HCIA 1PVOA 3GTKH 2VUMB 5J1ZA 1TWAH 2F0DA 1KABA 4CJ0B 3J7ZC 2N88A 1JOQA 1XTCD 2KQ3A 4JI3L 2WKCA 3ULJA 2IWHA 1WTQA 2A69D 1KHIA 2R61A 3CRLC 4APVA 3MAQA 4LF6L 2O5JC 1KNAA 2MFIA 2LXKA 1FL0A 2E5LL 4PQXA 3NTIA 1YHAA 3KBGA 1QNKA 5FKAC 4LF5Q 1QB5D 1PLFA 3V2TA 2PYKA 4P72A 1O7ZA 1UE5A 3FPPA 5H1SE 3EJIA 1F77A 3HOYG 4KJOA 2JA7G 4GN5A 3I3CA 1RL2A 1F9PA 2X69A 1ZXTA 1RCVD 1AFPA 4DF7A 4FVMA 1B4OA 1IW7D 3A8JE 1S3OA 1SBBB 1O78A 5M9OA 1ONLA 4F8MA 3X3NA 2VUMG 1F9SA 4X62L 4YCUA 3RZDB 3A8KE 4NMZA 1XNQL 4MNOA 5JEAG 3J81i 2PQEA 1D6EC 2K5VA 3K80C 3VDYA 3FMCA 1BR9A 4QCLA 1RKNA 3HOWB 4MN3A 1STYA 1NY4A 3FKIB 2R7ZB 1UWVA 5JJZA 3H3VC 3S1NB 1SNOA 1V1PB 3DUZA 3NE5B 2EYMA 1GUOA 1GO3E 3QWNA 1WD1A 2PZWA 2UXCL 3C1FA 5D3IB 2WIIB 3RNUA 1I6HH 2F0HA 3MFGA 4DV2Q 2B63B 2B2YA 3PIOA 1O80A 1ICWA 1H95A 1L1OB 1JT8A 4C2MB 1EFID 4R4TA 2FHTA 3ND8A 3GTOH 3HOYH 1UEBA 1JWUD 2ICEC 2JA7H 4HIMA 1WTPA 4UAIA 4X66Q 4R4OA 1RHPA 1VQAA 1AZQA 1EUJA 3UDFA 2ID0A 3VR4A 4IZ8A 3PO3B 5AJ3Q 2VUMH 1KAWA 2VQEL 3HOWG 1JORA 4DV0Q 5C0XI 3FKIG 4ILWA 4K2LA 2R7ZG 4X6AH 2MHVA 5JEAH 5C4XB 4AYBB 1MBYA 4JBWA 4OIKA 4G57A 3HOZB 2QGQA 1A2UA 3RLNA 3OOCA 2ES2A 2F0TA 2K32A 2E2HB 2L15A 2B63G 3DM1A 1CKOA 3N6RA 5TSSA 1TU2B 5KNCA 2Q8IB 2R7FA 4RKLA 4XQNA 3I4OA 3MXGA 3X3MA 4IFDJ 1VS0A 1G51A 4IUPA 4LW1A 4NXMQ 1YJWA 4GLXA 2KA7A 1CHPD 1RF2D 1WCMB 1N34L 4LFAL 1JB3A 2KEDA 1GM5A 4ZLTF 3PO3G 1Z47A 2VS1A 3OSOA 5C4XG 4RGOS 3TS2A 4AYBG 2F0EA 1TR5A 3HOZG 2PZUA 3HOWH 2DY7A 1QG7A 2BE5C 1VQNA 4ALPA 1A63A 2M00A 3FKIH 1D2BA 1WTXA 3S1NH 2NTTA 4DR4L 2RDHA 4K0KQ 2Q8TA 3KOJA 3U9SA 1K0SA 2F0LA 1BBUA 3GDEA 2B63H 2X6LA 2CVRA 1EYAA 1DOKA 1S5CD 3MZ5A 4RA8A 1SE4A 1WCMG 4C2MH 3OMCA 1X32A 4BS9A 3RD4A 5IGCA 2EIFA 4JI1L 1VQGA 3KDFB 2QCPX 3MXNB 2QILA 2UUBQ 1VMPA 3K59A 4DR5L 3PO3H 3M4OB 4HCEA 1Q82C 2VL6A 1J6QA 2VW9A 2UXBQ 4DU9A 2YTYA 1R4PB 5C4XH 1W2BA 5A35A 4X65L 4IPHA 1YNXA 2IHFA 5CV4A 1ET6A 3NWSA 3HOZH 4QMGA 2F1MA 1E2ZA 3A54A 3S16B 1SRUA 2E2HH 4ZUIA 4UP7A 1Q1BA 3TP5A 1LT6D 4LWCA 1D5XC 3F2UA 2F0QA 3F2CA 4L5SA 4B3MQ 1PRTF 3OTOL 3I56A 5FLXL 4TQUS 4LAAA 2G9HD 1QOHA 1SJED 4DNRB 1WCMH 2EXDA 1JR0D 1JICA 4JC0A 4DV4Q 2H1EA 3C2PA 1A3UA 2CWAA 1VQMA 2RKSA 5C0XJ 2ZTCA 3DEPA 1L0XB 2IHEA 2KBNA 4DR2L 3NELA 3T1HQ 3HOVB 3JAMc 1IBKQ 1V9PA 1JQYD 2K5NA 4IUNA 3CMAA 4PV1C 4FYDA 1I50B 2PQAB 3J7AV 3GTGB 3GP7A 2FMMA 2FJ2A 2AMCB 4BXXG 4YHHQ 3U50C 3M3YB 1CZGA 2F0OA 3NQTA 1XPUA 2I0QA 1K28A 3K0XA 2KOLA 2K4KA 3WOEA 2K5DA 4YIJA 3RLFA 1LTGD 2N55A 5ELCA 1TQOA 1EY9A 1BF4A 1H9KA 3PUYA 1LTRD 1TVXA 2B2TC 1EY6A 3M4OH 4DPGA 3NTHA 1SAPA 1EQRA 5EPKA 2A6EC 3HOVG 3ULLA 4P71A 1X56A 4JI3Q 3VYTA 1RDPD 4KHZA 1KLGD 4FNFA 4OEMB 1RJTA 1GD7A 3SVMA 4LF6Q 1YNNC 4KK7A 1A15A 3S16H 4CBVA 2E5LQ 1UNSA 3HFZB 1E3PA 1SNQA 2ALYB 2CH4W 4LUOA 3CCJA 1YJNA 1PZJD 1K8GA 5CR3A 3KFUA 4B9WA 4GLAC 2VB2X 2RCFA 1C0AA 4BXXH 3PQIA 5HY6A 5K36G 2EYJA 2VZAA 3MXNA 1JWMD 3KF6B 2BE5D 1VMCA 3KLSA 4RAUC 3FHWA 4DV1L 3PF5A 1ZEQX 3A74A 4ABNA 3NBIA 4X62Q 1IL8A 4CDCC 2A19A 1VQ5A 1XNQQ 1TKWB 4NXNL 1EQTA 2K5WA 3NWTA 2MUYA 1PFSA 5C3EB 2XVSA 4HJAA 2F0MA 5LMNW 1CQFA 3HOVH 4A3IB 2WB1B 1UE1A 4IJHA 5EBDA 3M85A 2PW5A 1CA5A 1I50H 3GTGH 5E1FA 2QEXA 2UXCQ 1NMFA 2JA6B 1EWHA 3SK4A 3M3YH 2NVYB 1DJRD 1I94L 2Q8RE 1EQQA 1IBLQ 2KHIA 4GZYC 1LT4D 1K8AC 5K36H 1PTOB 2QA4A 4DR7L 3TQYA 4I7ZC 4AYBE 1SXTA 2I46A 2GVBA 2MNAA 1LV9A 3TRZA 1F2LA 4HR7B 5I9OA 1GKHA 4ZKBB 2ZXOA 4A3EB 2ICIA 1AE2A 2R3ZA 3G6JB 1S5FD 3OW7A 2OXPA 2K5HA 2VQEQ 4K8JA 1ILPA 5C3EG 1E0BA 1PH2A 4A3IG 4WJ4A 2PI2E 1VF7A 2WB1G 5GROA 1KNEA 3I90A 1GVPA 2PQAA 1FD7D 1V8QA 4N8FA 1M8AA 5E4XA 3JAME 1WD0A 2JA6G 1B1ZA 2KCTA 2A73B 3K58A 1WOCA 3KUPA 4U673 4OONA 4WJ3M 4YWMA 2A68C 1BO0A 3CCVA 3E3XA 3KYHC 2EE1A 2PW7A 4RCOA 4Q0FA 1EY7A 1TY0A 3SK8A 1EOTA 4YCVA 2JJQA 5C44B 4CDFC 3M4QA 4DV2L 3CC7A 4LFAQ 1N34Q 3H91A 4A3EG 4CGYB 2AUKA 2GVAA 1PA6A 2F0WA 4A4IA 2NZ1D 3EVQA 3PO2G 3J81L 5A2QL 3I4MB 3UDIA 3DWAA 4X66L 2I07B 4WORA 1JJGA 2EZVA 2Z0SA 4CHTB 2B2YC 5C3EH 5AJ3L 2B8FA 3T1YL 2KCMA 4A3IH 4KV6A 2BDOA 3SXHA 1PH6A 2NVXH 4DR4Q 4BBSB 1VF5C 3KF8B 3IKJA 2L0CA 5E7NA 4YWLA 4WJWA 1VQ7A 3CCMA 2JA6H 1I4RA 1PH4A 3BZDB 2RSNA 4ZUJA 4DR6L 1KDAA 2A6ED 1GUGA 2NVYH 1CSPA 1SYCA 2C35B 2N49A 4I7AA 2F0UA 5C44G 1KDCA 3Q22A 4DA2A 2K05A 3MEHA 1KDBA 5EAYA 4Y7NB 2RQXA 1PTOH 4IN3A 1YNND 1A2TA 1GXDC 1STBA 2DJGC 2XSCA 3I4MG 4DR5Q 4A3EH 4KHPL 1PH1A 4B3RL 3PO2H 1SE2A 3CF5A 4X65Q 3W1BA 1BVSA 4KY6A 4BBSG 3R2IA 4EQOA 1PXUA 3AFPA 1BKBA 1PRTD 5C6AA 4IUTA 4KY5A 1QE6A 3GO5A 4IOAA 4LF9L 3FEWX 1IXRA 1CZWA 2J4XA 4OWTB 1IW7C 1C8CA 3U4ZA 3ZYYX 4G7OC 2PZTA 3MA2B 3SR1A 3I4NB 1STAA 4FXKC 3DMUA 3OTOQ 3T53B 4HSVA 1PYBA 1EIYB 1Y8OB 4OIJA 5C44H 5BN5A 1VQFA 3TMEA 5COYA 4UHVA 5CORA 5HURA 3D4WA 3F2DA 2F03A 2R6GA 3A56A 1S5BD 1G91A 1FYCA 2NB0A 1MKHA 3I4MH 1EWIA 3GTLB 2B8GA 1BCPF 2KENA 4DR2Q 4A3DB 1IZ6A 1QVGA 4IALA 4QUFA 2LS01 3GV3A 2H4OA 2G5DA 4AQYL 2R92B 3TN2A 4BBSH 5HGQA 3C46A 1IYUA 1LTAD 3S2DB 4C3HB 3LNNA 3OYYA 3I4NG 3S9WA 1HR0W 3PIPA 1ZYRD 3JAMi 4K5WA 3J80c 4GN4B 1IL2A 4XT1B 1UUPA 3QJYA 3MXUA 4N9TA 4Y7NH 4OO1I 3AB9A 4JOIA 4QJFA 2EY5A 4JI2L 1Q1EA 2OTJA 1VQDA 3UE1A 1XJVA 1R9TB 3V96A 3J7AF 1CKMA 1I6VC 2NBFA 3I8ZA 1A62A 4A3DG 3PUZA 4DV4L 1LM0A 4A3BB 1B53A 1V1QA 2OQ0A 1UAPA 1ENAA 5LL6X 2R92G 2L5TA 4C3HG 3ZJYC 4DK6C 1F2YA 2EYOA 4H02A 1K83B 1LACA 1UEAB 3I4NH 3OPOA 4K8IA 1FNWA 2QDLA 3A7LA 1OO9B 4OL7A 2L4NA 2F4IA 1KQSA 4IFDI 1EIGA 2WB1E 2JA9A 3WOFA 4A93B 1JB7A 2WINB 3RMHA 4A3BG 1HNZL 2CWPA 4NXNQ 3GTLH 1VQOA 4A3DH 2XN9C 3P20A 1H9MA 5J22A 3K7UC 2R92H 1LT3D 3S2DH 4C3HH 2L12A 4PMBA 2XGTA 5G3LF 5K5PA 4CKEA 5IYDG 2F3IA 4BY7B 5ELNA 3PIO3 1IYJB 2A6HC 1X3FA 1HHVA 4O2DA 2PNHA 3OWEB 2E75C 1EIHA 4JBMA 4J1MA 4DV7L 2KCNA 3P7JA 1I94Q 1GHJA 2RSOA 4X3UA 4IQZA 3S1MB 2WKDA 2IPKD 2B2VA 4DR7Q 5BR8L 4A93G 1SEBD 2O5IC 5FO7B 2CFMA 4FDBA 1R9TH 3K0YA 1CKNB 4TVAB 5C4JB 1RD9D 3H94A 3IL8A 5IYBG 1JCKB 4IPDA 4XYOA 2Q2HA 5CV8A 2XNAC 3SK5A 4A3BH 2M9VA 1PHJA 4PZ6A 1WTHA 4H7BA 4X3SA 3CCSA 1I4PA 2AKWB 3AFQA 4BY7G 3KLRA 4XYQA 1ESRA 1CI3M 3MHBA 1K8OA 1Y69U 3M9BA 4OGQC 5I2YA 1Z6HA 5CV9A 1FGUA 2K03A 1K83H 5IYDH 4RHRA 3QR8A 3KLWA 3CXCA 3J80E 1ASZA 1TS4A 2HQLA 1SE8A 3TSSA 1DGSA 5C3WA 1IBLL 4A93H 2EYLA 1OXSC 3RZOB 1EY8A 1Y1WB 1WYDA 4DXFA 5ELEA 2ZTDA 2OEOA 1NAPA 1JOKA 1Q46A 5IYBH 3LWUA 1STHA 3T1YQ 1B7YB 1SNCA 3CU7A 5KGUA 4V190 3I4LA 4GNXA 2RF4A 4YWKA 3M7GA 3HKSA 1LTLA 4DK0A 4Q5VA 3KK7A 4JBKA 3A5ZB 1OTCA 4BY7H 2EYHA 4DR6Q 1HPCA 1X54A 3OWFA 3CCLA 3HOXB 1Q3LA 2KJXA 1WTRA 5I6YA 3SDZA 3S1MH 4KKUA 4DV5L 4ZYSA 3ULPA 4QUCA 5ELBA 3MFYA 1KIXA 1Y1WG 1YVCA 3BG3A 4OWWB 2ZJRA 5C4JH 4KHPQ 3N52A 4LNQA 2XRQD 3QOJA 4B3TL 4B3RQ 1H9SA 1EY5A 4HIKA 5ELOA 3NQIA 1UE6A 4P74A 5CV6A 2IX3A 5JEAJ 1GUSA 4P2CB 4TKOB 2MJ8A 3BVGA 4LF9Q 2AQ1B 3C3LA 3KJOA 3CCQA 5DAUA 3HOXG 3BVZA 4DGZA 1HFNA 1CK1A 2K28A 1WTWA 1XTDA 1PTOF 3S14B 1FGBD 4KLKA 3S1RB 4JW0A 3TZUA 2RDFA 2B2UA 4KD3A 2B3GA 3P1HA 1CKNA 5IT9E 1NTGA 2WP8J 3NUCA 3Q8DA 1HZCA 2D2CC 4IUQA 1Q7YC 4C1NI 3S15B 3QG1A 3M4PA 1VQ9A 4KKSA 4FF3A 2N78A 1Y1WH 3EN2A 3RZOH 2A6HD 4S3SA 5I2XA 2K14A 1YNJD 2XRSD 4PZ8A 4HIOA 4DR1L 1NE3A 1R4QB 4OX9L 1XMQL 1HFGA 4DAYA 4UY8C 3STBD 3R8BA 3D6CA 1B50A 4I65A 3DLLA 2F0PA 1G8ZD 4JBJA 2WAQB 4AQYQ 3CCUA 2JSOA 2SNSA 4LF8L 2JEAI 1KAAA 3ITPA 2Z6KC 3H6MA 1QUQA 3HOXH 2RHQB 1AH9A 4HMIA 2AWOA 4KY7A 4N9PA 4JI2Q 3FP9A 4K5XA 4KJNA 4QIWB 3VA7A 3E0JA 5IYCG 4X3KA 3Q24A 4LK1C 3D8GA 1KTKA 1N9WA 2B2WA 2PMZB 3J80i 4V0BA 2BA1A 1NR4A 5JOBA 1BBWA 4R4IA 3PF4A 1WVLA 2UUAL 2WAQG 3UI2A 1E24A 5D14A 1LTID 4H0LC 1P16A 2FINB 1EZ6A 4A3GB 3TZDA 4A3LG 3K6OA 4X64L 4DV3L 2NN6G 1X9NA 2NVTB 3AMUA 2MP1A 4L6TB 3L9AX 1DD2A 5M5YH 3V05A 3G4SA 3S14H 3S1RH 5IWAL 3ONAB 1GUWA 1L0YB 3SHLA 5M5WB 1T9HA 1SSOA 4ODGA 3BDLA 4CJ1B 1GJXA 4ZKCB 3U4VA 4ZQ3A 1E1TA 1YHQA 1EY0A 5IOCA 2ZJPA 5IYCH 1HNZQ 1O7IA 5LHY1 4G7HC 1CQVA 1STGA 1TT2A 3DWPA 1LTSD 2YTVA 3EFXD 1GUNA 3F1ZA 4NW2A 1L0WA 4AIMA 3HOUB 1DZ1A 4A3GG 3H3VH 4XTCS 4JOIC 2TSSA 1M1KC 4IFDG 1PZKD 3JAML 4A3LH 3BYTB 2E8GA 3BVMA 4EVOA 1KLUD 2NN6H 4DV7Q 1HUNA 1JE5A 3I73A 3DEOA 3BDCA 1SNMA 1XXGA 1PZID 1VCIA 3LX0A 4KTAA 5BR8Q 1C7YA 3E6ZX 3P75A 3CMEA 3Q23A 1MGSA 3PMFA 3U9OA 5F2DA 3ND9A 3K5MA 1PRTC 2WV6D 4IUUA 2HIXA 1IYVA 2NTSA 3HOUG 4DXGA 2E74C 1XMOL 3QIAA 1K3BC 2EY1A 2VNUD 4DV6L 1EL0A 3PGZA 4XQQA 3I91A 2QF7A 1SN8A 2E2IB 3EIVA 4A3MB 2K33A 4A3GH 3Q0AA 1F2MA 2CH4A 4RKBA 4A3KB 5FLXE 1N33Q 2NVTH 4L5TA 3TS0A 4R8IA 5JPMC 5CGKA 5FOBB 2NVXB 1Z9FA 4L5QA 3T56B 2Z1CA 5M5WH 2L9HA 2NZHA 3G6EA 1JWSD 5C4HA 1Q81C 5NUCA 3MVVA 4FP5D 1PH7A 1DONA 1SMYC 1Y8PB 4OWXB 1B44D 2NWGA 2Z8LA 3PCOB 4C3JB 1OXTA 1D1KA 5EPJA 2CW0C 4JG2A 1HNWL 1XPRA 4F87A 4A3MG 1ZYRC 5EKIA 3HOUH 1STNA 4LF7L 4A3KG 3PO2B 3GV6A 1HQMC 1MIUA 5LMNL 2B2VC 1PH3A 1V1OA 1C9OA 3EA6A 3G48A 3FVQA 4RG1A 3SGIA 1E2VA 2JP1A 3WWVA 3TEHB 1IHZA 2A8VA 1X3GA 2OF1A 3OIQA 5C5LA 4QF4A 2OQKA 3UE0A 4PMCA 4DV5Q 2SEBD 3K5OA 1HZ9A 4JI8Q 1DCZA 3TP6A 2ZTEA 2JN4A 4DN4M 5J39A 4PNYA 4C3JG 3HGBA 2UU9L 2OCEA 5IP7G 2JEBI 2K04A 4B3TQ 2PPBC 4LUZA 5IE8A 1EY4A 1FVIA 1E7ZA 2BDNA 3UDXA 5T1IA 1Y8NB 2PNRC 3I2ZA 2CQAA 4IPGA 3CCEA 3DM3A 4KN4C 4L63B 1D1IA 2E2IH 2YU9B 2D0PA 4GLVB 4A3MH
chains in the Genus database with same CATH topology
4A3KH 3RLNA 5FJ8H 2ES2A 2R7DA 1A8VA 2L15A 2B63G 1WI5A 1CKOA 1J5EQ 2ZM6L 4H02A 2R7FA 2UXDQ 2KHJA 2MO1A 3I4OA 1VQKA 3I4NH 4RMFA 1E22A 1Y14B 4A75A 4IFDJ 1VS0A 1G51A 4LW1A 3L2PA 4NXMQ 1YJWA 1Q86C 1CUKA 3HKZG 5LMUL 4GLXA 1TWCH 5J3BA 4LFAL 1N34L 2Q2IA 2IX0A 1KQSA 2WB1E 1GM5A 2JA9A 2WAQE 3W5OA 1VQPA 1VQ8A 1Z47A 3CC4A 1XNRQ 1JB7A 3PO3G 4R4QA 3K8AA 4GNXC 2JA5G 4A3BG 2UUCL 1TWFH 2VS1A 4QGUA 4C3JH 3PSIA 1HNZL 2CWPA 4NXNQ 3GTLH 5IP7H 2Z6KA 1LYLA 4DR1Q 4A3JG 1VQOA 4JI6L 4OX9Q 4LFBL 3TS2A 4AYBG 5C4XG 1XMQQ 4GKJQ 4YY3Q 3S24A 1VQCA 4GKKL 4GOPC 1JJ2A 1SR3A 4A3DH 1TXYA 3JC66 3HOZG 3HOWH 2H5XA 1VQNA 4ALPA 1A63A 2YYZA 3FKIH 3K7UC 2R92H 3S1NH 1JMCA 4DR4L 3CC2A 1KRTA 4C3HH 3S2DH 4K0KQ 1Q12A 4LF8Q 3KOJA 2XGTA 4ME3A 5IYDG 1M90C 2F3IA 1VQBA 5ELNA 1IYJB 1X3FA 3KDFA 2PMZE 1FJGQ 1BBUA 4O2DA 2PNHA 4BBRG 3GDEA 2B63H 4JBMA 1X55A 3KJPA 4DV7L 1PH9A 1I94Q 3ER0A 1YI2A 1YJ9A 4C2MH 1WCMG 2Y0SG 3BU2A 1B70B 4DR7Q 5BR8L 4A93G 1IBML 4UP8A 1N8RC 1YITA 2EIFA 4JI1L 1VQGA 2CFMA 1K3RA 3KDFB 4FDBA 1R9TH 4LF4L 1CKNB 3MXNB 4JI5L 4Y52H 1K0RA 1U0LA 4TVAB 2UUBQ 3RN5A 4DR5L 5IYBG 3PO3H 3A0JA 4IPDA 1Q82C 3CW2C 2Q2HA 1J6QA 2VL6A 2VW9A 2JA5H 2UXBQ 4A3BH 3PUXA 4OXPA 2UUAQ 1PHJA 4PZ6A 5JJIA 3CD6A 2YTYA 1CSQA 5C4XH 4A3JH 1W2BA 4X65L 2K75A 4IPHA 1YNXA 3CCSA 2Q2TA 2AKWB 2IHFA 2YU9H 1QVCA 4JYAL 3D31A 3AFQA 1VQHA 1SMXA 3ZJYC 3HOZH 4MZ9A 4BY7G 2DGYA 4EX5A 1WFQA 1LUZA 1SRUA 2EQSA 4X64Q 4DV3Q 2E2HH 4UP7A 1Q1BA 3M9BA 3GTJH 1FGUA 4LWCA 2AHOB 2MO0A 4HJ5A 1K83H 1YZ6A 5IYDH 5IWAQ 3F2CA 4LF5L 1RIPA 1WJJA 4L5SA 4B3MQ 3I56A 3OTOL 4BBRH 3KLWA 4TQUS 4PZ7A 4NB3A 3CXCA 2VY3A 1ASZA 1X65A 2HQLA 2HHHL 2JE6I 1SE8A 2EXDA 1WCMH 1HH2P 4KI0A 3J81c 1DGSA 4JC0A 1IBLL 4B3SL 4DV4Q 2ATWA 2F52A 4A93H 4PMWA 4JI0L 1OXSC 1WYDA 2AWNA 4GS3A 2CWAA 3AEVA 2ZTDA 1VQMA 3CAMA 1VQ6A 1Q46A 5C0XJ 4NPSA 2D0OA 5IYBH 2ZTCA 3ERSX 2IHEA 2CKZB 2KBNA 4DR2L 3NELA 3T1YQ 3I55A 3T1HQ 3JAMc 1IBKQ 1B7YB 2HT1A 1V9PA 3LGJA 3S2HH 2CQOA 2K5NA 1N36L 4GNXA 2RF4A 4YWKA 3CMAA 3HKSA 2NZOA 1LTLA 2PQAB 4JBKA 3A5ZB 1OTCA 4BY7H 2AMCB 4DR6Q 1X6OA 1X54A 3CCLA 1SLJA 4BXXG 5M3MG 4YHHQ 3U50C 3BJUA 4HJ7A 1HR0L 3PV0A 2NVQH 1XPUA 2I0QA 3S1MH 4GNXB 3L7ZC 1QZGA 3K0XA 4DV5L 3BZKA 3ULPA 2K4KA 3RLFA 1KIXA 4LUVA 1Y1WG 1YVCA 4AH6A 1N32L 4JI4L 4OWWB 2ZJRA 5C4JH 1VQLA 4KHPQ 3PUYA 4DR3Q 3CPWA 3B6YA 5GAGC 1KC8C 4LNQA 3M4OH 2DUDA 4B3TL 4DPGA 3OW2A 3RN2A 2N3SA 2LXJA 4B3RQ 1EQRA 2YV5A 4LFCQ 4HIDA 4HIKA 1Y1VG 4P74A 1UE6A 5ELOA 1XMOQ 3HOVG 2GN5A 3ULLA 3NEMA 4P71A 1X56A 3NBHB 4DV0L 4DV6Q 4HJ8A 4JI3Q 2BH2A 4KHZA 1GD7A 1K73C 5JEAJ 4OO1G 4J15A 4DUYQ 4LF6Q 3A5UA 4LF9Q 3GTQH 3S16H 2V1CC 4A3FG 1Q8KA 3KF6A 2E5LQ 3KJOA 3CCQA 5IP9G 1E3PA 3HFZB 3HOXG 2ALYB 4LUOA 3CCJA 1YHBA 4QIWE 3H15A 3K81C 1YJNA 1J5EL 1K8GA 1XTDA 3KFUA 4GLAC 2FXQA 4KLKA 1KXLA 2UXDL 1C0AA 1XPOA 2WFWA 4JI1Q 5HY6A 4QL5A 5M3MH 4BXXH 5K36G 2VZAA 2B3GA 4DK3C 4LF4Q 1CKNA 1VQEA 5JJLA 1YBYA 2LSSA 5M3FG 4NXML 1NTGA 3KF6B 2WP8J 3Q8DA 3H0GG 1HZCA 5IT9c 3E0EA 1Q7YC 4UPAA 3FHWA 3E9HA 2VQFL 4DV1L 3M4PA 3STBC 1VQ9A 1YEZA 3A74A 3PF5A 4X62Q 3G71A 2K50A 2N78A 2A19A 3EN2A 1Y1WH 3RZOH 2HIVA 3RR5A 1VQ5A 1SROA 4BY1G 1XNQQ 2K14A 3AYHB 2I5HA 1HNWQ 2F4VQ 4NXNL 1JJCB 1HJPA 4PZ8A 4HIOA 2RCNA 1NE3A 4DR1L 4OX9L 1XMQL 1SFOH 4GKJL 1PFSA 4YY3L 4UY8C 4HJAA 4LF7Q 1Y1VH 3STBD 5LMNW 3HOVH 2BA0A 3DLLA 4JBJA 4AQYQ 1UE1A 4IJHA 3W1GA 2MQHA 1E1OA 3M85A 3CCUA 5LMNQ 4JV5Q 3PUVA 3F8TA 1I50H 3GTGH 4K0KL 4LF8L 2QEXA 2JEAI 1HZAA 3HKZE 3D0FA 5GQOA 2BH8A 1NMFA 4A3FH 1MJCA 1YIJA 2Z6KC 5DLQE 4IFDG 1ASYA 4DAYB 5IP9H 1FJGL 1EOVA 1QUQA 3HOXH 2RHQB 1HNXQ 3M3YH 1AH9A 1QZHA 1N33L 1I94L 1D7QA 1EQQA 1G6PA 1IBLQ 2AWOA 4C3IH 3GTMH 1S72A 2RHSB 2KHIA 4JI2Q 3FP9A 1K8AC 4DUZQ 4DR7L 1OXUA 2QA4A 3TQYA 5IYCG 4XIGS 4AYBE 5M3FH 2GVBA 2UU9Q 4P75A 2MNAA 4A3CG 3H0GH 1N9WA 3TRZA 5JJKA 3J80i 2IY5B 1QUQB 1GKHA 2UUBL 1AE2A 1PV4A 2ZJQA 2BA1A 2K5HA 2VQEQ 1BBWA 4R4IA 4UP9A 5C3EG 3PF4A 1PH8A 2UXBL 1PH2A 3CP0A 4A3IG 2PI2E 2UUAL 4WJ4A 2WB1G 5GROA 2WAQG 4BY1H 3ICEA 1GVPA 3CCRA 2PQAA 1E24A 2E2JH 2I5MX 3UDGA 4HJ9A 1P16A 2IX1A 3GTPH 2ASBA 4A3LG 3NENA 2JA6G 1I5FA 3PUWA 2KCTA 3CQZH 2Y0SE 4X64L 4DV3L 2NN6G 1X9NA 1WOCA 4OONA 4WJ3M 1TWGH 4YWMA 2ZM6Q 2JQOA 4R4CA 3CCVA 3KYHC 5M5YH 2B29A 3G4SA 3S14H 4YCWA 4JI7L 3S1RH 5IWAL 3I7FA 1EFWA 4YCVA 3CPFA 4B3ML 2JJQA 5LMUQ 3J7A5 4MTNA 1T9HA 4GOPA 3M4QA 2UXCQ 4DV2L 3CC7A 1A0IA 4LFAQ 1N34Q 3U4VA 1KD1C 4A3EG 3RLOA 1L1OC 1E1TA 2GVAA 2IT1A 2K52A 1YHQA 1PA6A 2ZJPA 4A4IA 3S1QH 3AQQA 2UUCQ 5IYCH 1B8AA 4DKAC 3PO2G 4JI8L 2I5LX 1HNZQ 4IO9A 1O7IA 1X3EA 4JI6Q 4A3CH 4DAMA 4BA2I 4LFBQ 4A76A 3UDIA 4QQBX 4X66L 1VQ4A 4GOPB 4O0AA 2YTVA 4GKKQ 1JJGA 1KL9A 1KRSA 2Z0SA 3F1ZA 4IJLA 5C3EH 3BZCA 1L0WA 4AIMA 1MJEA 5AJ3L 4A3GG 2N8NA 3T1YL 3H3VH 2KCMA 4A3IH 3T1HL 4XTCS 1K9MC 1IBKL 4JOIC 4DK6C 4DR4Q 1PH6A 2NVXH 1NMGA 1M1KC 3KF8B 5E7NA 4YWLA 3GD7A 3S15H 5GAHC 1VQ7A 3CCMA 4A3LH 1I3QH 1AE3A 2E8GA 3K7AH 1PH4A 2JA6H 4DR6L 4DV7Q 1JE5A 4YHHL 1TWHH 2NVYH 1CSPA 1OXXK 1VQIA 2YTXA 2C35B 2N49A 5C44G 1G291 4P73A 1VCIA 3J81j 2VQFQ 1NBWA 4BA1I 4DV1Q 3M7NA 4IFDI 5EAYA 4JCVE 1P8LA 5BR8Q 1C7YA 4L5RC 1UE7A 1IBMQ 3CMEA 4IOCA 5IY0A 1EYGA 1VQJA 5M5XH 3RZDH 3U58A 5GAEC 4JI5Q 4POGA 3E9IA 5C0XG 3I4MG 4DR5Q 2JA8G 4A3EH 1PVOA 4KHPL 4DR3L 2HIXA 1HZBA 1PH1A 2JK8A 2OTLA 3GTKH 3HOUG 4B3RL 1TWAH 1XNRL 4QY7A 4LFCL 3PO2H 3CF5A 1XMOL 2R7ZH 2VNUD 4X65Q 3W1BA 1BVSA 3J7ZC 4JYAQ 4DV6L 4BBSG 4JI3L 3ULJA 3PGZA 3AFPA 1BKBA 1SN8A 3EIVA 1KHIA 4DUYL 4A3GH 3GO5A 3H3VI 4APVA 5FLMG 4POFA 4LF6L 4LF9L 4IOAA 4PG3A 2MFIA 2LXKA 1N33Q 1FL0A 2E5LL 2NVTH 1IXRA 4L5TA 1NJIC 5FLXc 3TS0A 4OWTB 1YHAA 3U4ZA 4LF5Q 4P72A 5H1SE 1UE5A 1Z9FA 4L5QA 3OTOQ 3HOYG 1PYBA 3IRBA 1EIYB 2NN6I 4GN5A 5M5WH 2NZHA 2JA7G 1RL2A 3G6EA 4DNIA 5C44H 1VQFA 1Q81C 2HHHQ 1W3SA 4B3SQ 1PH7A 3F2DA 1S3OA 2R6GA 4JI0Q 4OWXB 2VUMG 4X62L 2R93G 1MKHA 3PCOB 4YCUA 5GADC 3EBEA 2Q2UA 3I4MH 1EWIA 1OXTA 2JA8H 1PH5A 1D8LA 4JG2A 4MNOA 5JEAG 3J81i 1XNQL 1XPRA 2F4VL 1HNWL 2K5VA 3K80C 2D62A 2KENA 4GN3B 4DR2Q 3VDYA 4A3MG 2OWOA 3HOUH 1IZ6A 1QVGA 4LF7L 4A3KG 4EQ5A 3F2BA 5FJ8G 1L1OA 1NY4A 1N36Q 1MIUA 1UWVA 4AQYL 5LMNL 4BBSH 1PH3A 5HGQA 1C9OA 3G48A 3TREA 4JI7Q 4JV5L 4RG1A 3SGIA 1V43A 1OXVA 1GO3E 3OYYA 3WWVA 3TEHB 3I4NG 1HR0W 5FLMH 2UXCL 3PIPA 3RNUA 1I6HH 2A8VA 3JAMi 1X3GA 4DV2Q 1HR0Q 2CCZA 2XTIA 3PIOA 1H95A 3J80c 1EIFA 1L1OB 4GN4B 2OQKA 3UE0A 1HNXL 1IL2A 1JT8A 4OO1I 4Y7NH 3L0OA 4DV5Q 4JOIA 4QJFA 4R4TA 1QVFA 2A1AA 1HZ9A 3GTOH 1UEBA 4JI2L 3HOYH 4JI8Q 1Q1EA 2JA7H 1L2FA 4DUZL 4HIMA 2OTJA 1VQDA 2ZTEA 4IPCA 3UE1A 4JI4Q 1N32Q 1XJVA 4X66Q 4R4OA 1VQAA 2OCEA 2UU9L 1EUJA 5IP7G 2JEBI 3UDFA 2ID0A 4B3TQ 1CKMA 4R1JA 4LUZA 1A62A 5IE8A 5AJ3Q 1FVIA 2VUMH 1E7ZA 4A3DG 3UDXA 3PUZA 4DV4L 1KAWA 1LM0A 2VQEL 2R93H 3HOWG 1V1QA 2OQ0A 3I2ZA 4DV0Q 5C0XI 1S40A 3FKIG 2R7ZG 4IPGA 3CCEA 1U5KA 2PI2A 4X6AH 2R92G 3DM3A 2E2IH 3S17H 1PYSB 2D0PA 4GLVB 4JBWA 4A3MH 3MEFA 2QGQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3K H;  3RLN A;  5FJ8 H;  2ES2 A;  2R7D A;  1A8V A;  2L15 A;  2B63 G;  1WI5 A;  1CKO A;  1J5E Q;  2ZM6 L;  4H02 A;  2R7F A;  2UXD Q;  2KHJ A;  2MO1 A;  3I4O A;  1VQK A;  3I4N H;  4RMF A;  1E22 A;  1Y14 B;  4A75 A;  4IFD J;  1VS0 A;  1G51 A;  4LW1 A;  3L2P A;  4NXM Q;  1YJW A;  1Q86 C;  1CUK A;  3HKZ G;  5LMU L;  4GLX A;  1TWC H;  5J3B A;  4LFA L;  1N34 L;  2Q2I A;  2IX0 A;  1KQS A;  2WB1 E;  1GM5 A;  2JA9 A;  2WAQ E;  3W5O A;  1VQP A;  1VQ8 A;  1Z47 A;  3CC4 A;  1XNR Q;  1JB7 A;  3PO3 G;  4R4Q A;  3K8A A;  4GNX C;  2JA5 G;  4A3B G;  2UUC L;  1TWF H;  2VS1 A;  4QGU A;  4C3J H;  3PSI A;  1HNZ L;  2CWP A;  4NXN Q;  3GTL H;  5IP7 H;  2Z6K A;  1LYL A;  4DR1 Q;  4A3J G;  1VQO A;  4JI6 L;  4OX9 Q;  4LFB L;  3TS2 A;  4AYB G;  5C4X G;  1XMQ Q;  4GKJ Q;  4YY3 Q;  3S24 A;  1VQC A;  4GKK L;  4GOP C;  1JJ2 A;  1SR3 A;  4A3D H;  1TXY A;  3JC6 6;  3HOZ G;  3HOW H;  2H5X A;  1VQN A;  4ALP A;  1A63 A;  2YYZ A;  3FKI H;  3K7U C;  2R92 H;  3S1N H;  1JMC A;  4DR4 L;  3CC2 A;  1KRT A;  4C3H H;  3S2D H;  4K0K Q;  1Q12 A;  4LF8 Q;  3KOJ A;  2XGT A;  4ME3 A;  5IYD G;  1M90 C;  2F3I A;  1VQB A;  5ELN A;  1IYJ B;  1X3F A;  3KDF A;  2PMZ E;  1FJG Q;  1BBU A;  4O2D A;  2PNH A;  4BBR G;  3GDE A;  2B63 H;  4JBM A;  1X55 A;  3KJP A;  4DV7 L;  1PH9 A;  1I94 Q;  3ER0 A;  1YI2 A;  1YJ9 A;  4C2M H;  1WCM G;  2Y0S G;  3BU2 A;  1B70 B;  4DR7 Q;  5BR8 L;  4A93 G;  1IBM L;  4UP8 A;  1N8R C;  1YIT A;  2EIF A;  4JI1 L;  1VQG A;  2CFM A;  1K3R A;  3KDF B;  4FDB A;  1R9T H;  4LF4 L;  1CKN B;  3MXN B;  4JI5 L;  4Y52 H;  1K0R A;  1U0L A;  4TVA B;  2UUB Q;  3RN5 A;  4DR5 L;  5IYB G;  3PO3 H;  3A0J A;  4IPD A;  1Q82 C;  3CW2 C;  2Q2H A;  1J6Q A;  2VL6 A;  2VW9 A;  2JA5 H;  2UXB Q;  4A3B H;  3PUX A;  4OXP A;  2UUA Q;  1PHJ A;  4PZ6 A;  5JJI A;  3CD6 A;  2YTY A;  1CSQ A;  5C4X H;  4A3J H;  1W2B A;  4X65 L;  2K75 A;  4IPH A;  1YNX A;  3CCS A;  2Q2T A;  2AKW B;  2IHF A;  2YU9 H;  1QVC A;  4JYA L;  3D31 A;  3AFQ A;  1VQH A;  1SMX A;  3ZJY C;  3HOZ H;  4MZ9 A;  4BY7 G;  2DGY A;  4EX5 A;  1WFQ A;  1LUZ A;  1SRU A;  2EQS A;  4X64 Q;  4DV3 Q;  2E2H H;  4UP7 A;  1Q1B A;  3M9B A;  3GTJ H;  1FGU A;  4LWC A;  2AHO B;  2MO0 A;  4HJ5 A;  1K83 H;  1YZ6 A;  5IYD H;  5IWA Q;  3F2C A;  4LF5 L;  1RIP A;  1WJJ A;  4L5S A;  4B3M Q;  3I56 A;  3OTO L;  4BBR H;  3KLW A;  4TQU S;  4PZ7 A;  4NB3 A;  3CXC A;  2VY3 A;  1ASZ A;  1X65 A;  2HQL A;  2HHH L;  2JE6 I;  1SE8 A;  2EXD A;  1WCM H;  1HH2 P;  4KI0 A;  3J81 c;  1DGS A;  4JC0 A;  1IBL L;  4B3S L;  4DV4 Q;  2ATW A;  2F52 A;  4A93 H;  4PMW A;  4JI0 L;  1OXS C;  1WYD A;  2AWN A;  4GS3 A;  2CWA A;  3AEV A;  2ZTD A;  1VQM A;  3CAM A;  1VQ6 A;  1Q46 A;  5C0X J;  4NPS A;  2D0O A;  5IYB H;  2ZTC A;  3ERS X;  2IHE A;  2CKZ B;  2KBN A;  4DR2 L;  3NEL A;  3T1Y Q;  3I55 A;  3T1H Q;  3JAM c;  1IBK Q;  1B7Y B;  2HT1 A;  1V9P A;  3LGJ A;  3S2H H;  2CQO A;  2K5N A;  1N36 L;  4GNX A;  2RF4 A;  4YWK A;  3CMA A;  3HKS A;  2NZO A;  1LTL A;  2PQA B;  4JBK A;  3A5Z B;  1OTC A;  4BY7 H;  2AMC B;  4DR6 Q;  1X6O A;  1X54 A;  3CCL A;  1SLJ A;  4BXX G;  5M3M G;  4YHH Q;  3U50 C;  3BJU A;  4HJ7 A;  1HR0 L;  3PV0 A;  2NVQ H;  1XPU A;  2I0Q A;  3S1M H;  4GNX B;  3L7Z C;  1QZG A;  3K0X A;  4DV5 L;  3BZK A;  3ULP A;  2K4K A;  3RLF A;  1KIX A;  4LUV A;  1Y1W G;  1YVC A;  4AH6 A;  1N32 L;  4JI4 L;  4OWW B;  2ZJR A;  5C4J H;  1VQL A;  4KHP Q;  3PUY A;  4DR3 Q;  3CPW A;  3B6Y A;  5GAG C;  1KC8 C;  4LNQ A;  3M4O H;  2DUD A;  4B3T L;  4DPG A;  3OW2 A;  3RN2 A;  2N3S A;  2LXJ A;  4B3R Q;  1EQR A;  2YV5 A;  4LFC Q;  4HID A;  4HIK A;  1Y1V G;  4P74 A;  1UE6 A;  5ELO A;  1XMO Q;  3HOV G;  2GN5 A;  3ULL A;  3NEM A;  4P71 A;  1X56 A;  3NBH B;  4DV0 L;  4DV6 Q;  4HJ8 A;  4JI3 Q;  2BH2 A;  4KHZ A;  1GD7 A;  1K73 C;  5JEA J;  4OO1 G;  4J15 A;  4DUY Q;  4LF6 Q;  3A5U A;  4LF9 Q;  3GTQ H;  3S16 H;  2V1C C;  4A3F G;  1Q8K A;  3KF6 A;  2E5L Q;  3KJO A;  3CCQ A;  5IP9 G;  1E3P A;  3HFZ B;  3HOX G;  2ALY B;  4LUO A;  3CCJ A;  1YHB A;  4QIW E;  3H15 A;  3K81 C;  1YJN A;  1J5E L;  1K8G A;  1XTD A;  3KFU A;  4GLA C;  2FXQ A;  4KLK A;  1KXL A;  2UXD L;  1C0A A;  1XPO A;  2WFW A;  4JI1 Q;  5HY6 A;  4QL5 A;  5M3M H;  4BXX H;  5K36 G;  2VZA A;  2B3G A;  4DK3 C;  4LF4 Q;  1CKN A;  1VQE A;  5JJL A;  1YBY A;  2LSS A;  5M3F G;  4NXM L;  1NTG A;  3KF6 B;  2WP8 J;  3Q8D A;  3H0G G;  1HZC A;  5IT9 c;  3E0E A;  1Q7Y C;  4UPA A;  3FHW A;  3E9H A;  2VQF L;  4DV1 L;  3M4P A;  3STB C;  1VQ9 A;  1YEZ A;  3A74 A;  3PF5 A;  4X62 Q;  3G71 A;  2K50 A;  2N78 A;  2A19 A;  3EN2 A;  1Y1W H;  3RZO H;  2HIV A;  3RR5 A;  1VQ5 A;  1SRO A;  4BY1 G;  1XNQ Q;  2K14 A;  3AYH B;  2I5H A;  1HNW Q;  2F4V Q;  4NXN L;  1JJC B;  1HJP A;  4PZ8 A;  4HIO A;  2RCN A;  1NE3 A;  4DR1 L;  4OX9 L;  1XMQ L;  1SFO H;  4GKJ L;  1PFS A;  4YY3 L;  4UY8 C;  4HJA A;  4LF7 Q;  1Y1V H;  3STB D;  5LMN W;  3HOV H;  2BA0 A;  3DLL A;  4JBJ A;  4AQY Q;  1UE1 A;  4IJH A;  3W1G A;  2MQH A;  1E1O A;  3M85 A;  3CCU A;  5LMN Q;  4JV5 Q;  3PUV A;  3F8T A;  1I50 H;  3GTG H;  4K0K L;  4LF8 L;  2QEX A;  2JEA I;  1HZA A;  3HKZ E;  3D0F A;  5GQO A;  2BH8 A;  1NMF A;  4A3F H;  1MJC A;  1YIJ A;  2Z6K C;  5DLQ E;  4IFD G;  1ASY A;  4DAY B;  5IP9 H;  1FJG L;  1EOV A;  1QUQ A;  3HOX H;  2RHQ B;  1HNX Q;  3M3Y H;  1AH9 A;  1QZH A;  1N33 L;  1I94 L;  1D7Q A;  1EQQ A;  1G6P A;  1IBL Q;  2AWO A;  4C3I H;  3GTM H;  1S72 A;  2RHS B;  2KHI A;  4JI2 Q;  3FP9 A;  1K8A C;  4DUZ Q;  4DR7 L;  1OXU A;  2QA4 A;  3TQY A;  5IYC G;  4XIG S;  4AYB E;  5M3F H;  2GVB A;  2UU9 Q;  4P75 A;  2MNA A;  4A3C G;  3H0G H;  1N9W A;  3TRZ A;  5JJK A;  3J80 i;  2IY5 B;  1QUQ B;  1GKH A;  2UUB L;  1AE2 A;  1PV4 A;  2ZJQ A;  2BA1 A;  2K5H A;  2VQE Q;  1BBW A;  4R4I A;  4UP9 A;  5C3E G;  3PF4 A;  1PH8 A;  2UXB L;  1PH2 A;  3CP0 A;  4A3I G;  2PI2 E;  2UUA L;  4WJ4 A;  2WB1 G;  5GRO A;  2WAQ G;  4BY1 H;  3ICE A;  1GVP A;  3CCR A;  2PQA A;  1E24 A;  2E2J H;  2I5M X;  3UDG A;  4HJ9 A;  1P16 A;  2IX1 A;  3GTP H;  2ASB A;  4A3L G;  3NEN A;  2JA6 G;  1I5F A;  3PUW A;  2KCT A;  3CQZ H;  2Y0S E;  4X64 L;  4DV3 L;  2NN6 G;  1X9N A;  1WOC A;  4OON A;  4WJ3 M;  1TWG H;  4YWM A;  2ZM6 Q;  2JQO A;  4R4C A;  3CCV A;  3KYH C;  5M5Y H;  2B29 A;  3G4S A;  3S14 H;  4YCW A;  4JI7 L;  3S1R H;  5IWA L;  3I7F A;  1EFW A;  4YCV A;  3CPF A;  4B3M L;  2JJQ A;  5LMU Q;  3J7A 5;  4MTN A;  1T9H A;  4GOP A;  3M4Q A;  2UXC Q;  4DV2 L;  3CC7 A;  1A0I A;  4LFA Q;  1N34 Q;  3U4V A;  1KD1 C;  4A3E G;  3RLO A;  1L1O C;  1E1T A;  2GVA A;  2IT1 A;  2K52 A;  1YHQ A;  1PA6 A;  2ZJP A;  4A4I A;  3S1Q H;  3AQQ A;  2UUC Q;  5IYC H;  1B8A A;  4DKA C;  3PO2 G;  4JI8 L;  2I5L X;  1HNZ Q;  4IO9 A;  1O7I A;  1X3E A;  4JI6 Q;  4A3C H;  4DAM A;  4BA2 I;  4LFB Q;  4A76 A;  3UDI A;  4QQB X;  4X66 L;  1VQ4 A;  4GOP B;  4O0A A;  2YTV A;  4GKK Q;  1JJG A;  1KL9 A;  1KRS A;  2Z0S A;  3F1Z A;  4IJL A;  5C3E H;  3BZC A;  1L0W A;  4AIM A;  1MJE A;  5AJ3 L;  4A3G G;  2N8N A;  3T1Y L;  3H3V H;  2KCM A;  4A3I H;  3T1H L;  4XTC S;  1K9M C;  1IBK L;  4JOI C;  4DK6 C;  4DR4 Q;  1PH6 A;  2NVX H;  1NMG A;  1M1K C;  3KF8 B;  5E7N A;  4YWL A;  3GD7 A;  3S15 H;  5GAH C;  1VQ7 A;  3CCM A;  4A3L H;  1I3Q H;  1AE3 A;  2E8G A;  3K7A H;  1PH4 A;  2JA6 H;  4DR6 L;  4DV7 Q;  1JE5 A;  4YHH L;  1TWH H;  2NVY H;  1CSP A;  1OXX K;  1VQI A;  2YTX A;  2C35 B;  2N49 A;  5C44 G;  1G29 1;  4P73 A;  1VCI A;  3J81 j;  2VQF Q;  1NBW A;  4BA1 I;  4DV1 Q;  3M7N A;  4IFD I;  5EAY A;  4JCV E;  1P8L A;  5BR8 Q;  1C7Y A;  4L5R C;  1UE7 A;  1IBM Q;  3CME A;  4IOC A;  5IY0 A;  1EYG A;  1VQJ A;  5M5X H;  3RZD H;  3U58 A;  5GAE C;  4JI5 Q;  4POG A;  3E9I A;  5C0X G;  3I4M G;  4DR5 Q;  2JA8 G;  4A3E H;  1PVO A;  4KHP L;  4DR3 L;  2HIX A;  1HZB A;  1PH1 A;  2JK8 A;  2OTL A;  3GTK H;  3HOU G;  4B3R L;  1TWA H;  1XNR L;  4QY7 A;  4LFC L;  3PO2 H;  3CF5 A;  1XMO L;  2R7Z H;  2VNU D;  4X65 Q;  3W1B A;  1BVS A;  3J7Z C;  4JYA Q;  4DV6 L;  4BBS G;  4JI3 L;  3ULJ A;  3PGZ A;  3AFP A;  1BKB A;  1SN8 A;  3EIV A;  1KHI A;  4DUY L;  4A3G H;  3GO5 A;  3H3V I;  4APV A;  5FLM G;  4POF A;  4LF6 L;  4LF9 L;  4IOA A;  4PG3 A;  2MFI A;  2LXK A;  1N33 Q;  1FL0 A;  2E5L L;  2NVT H;  1IXR A;  4L5T A;  1NJI C;  5FLX c;  3TS0 A;  4OWT B;  1YHA A;  3U4Z A;  4LF5 Q;  4P72 A;  5H1S E;  1UE5 A;  1Z9F A;  4L5Q A;  3OTO Q;  3HOY G;  1PYB A;  3IRB A;  1EIY B;  2NN6 I;  4GN5 A;  5M5W H;  2NZH A;  2JA7 G;  1RL2 A;  3G6E A;  4DNI A;  5C44 H;  1VQF A;  1Q81 C;  2HHH Q;  1W3S A;  4B3S Q;  1PH7 A;  3F2D A;  1S3O A;  2R6G A;  4JI0 Q;  4OWX B;  2VUM G;  4X62 L;  2R93 G;  1MKH A;  3PCO B;  4YCU A;  5GAD C;  3EBE A;  2Q2U A;  3I4M H;  1EWI A;  1OXT A;  2JA8 H;  1PH5 A;  1D8L A;  4JG2 A;  4MNO A;  5JEA G;  3J81 i;  1XNQ L;  1XPR A;  2F4V L;  1HNW L;  2K5V A;  3K80 C;  2D62 A;  2KEN A;  4GN3 B;  4DR2 Q;  3VDY A;  4A3M G;  2OWO A;  3HOU H;  1IZ6 A;  1QVG A;  4LF7 L;  4A3K G;  4EQ5 A;  3F2B A;  5FJ8 G;  1L1O A;  1NY4 A;  1N36 Q;  1MIU A;  1UWV A;  4AQY L;  5LMN L;  4BBS H;  1PH3 A;  5HGQ A;  1C9O A;  3G48 A;  3TRE A;  4JI7 Q;  4JV5 L;  4RG1 A;  3SGI A;  1V43 A;  1OXV A;  1GO3 E;  3OYY A;  3WWV A;  3TEH B;  3I4N G;  1HR0 W;  5FLM H;  2UXC L;  3PIP A;  3RNU A;  1I6H H;  2A8V A;  3JAM i;  1X3G A;  4DV2 Q;  1HR0 Q;  2CCZ A;  2XTI A;  3PIO A;  1H95 A;  3J80 c;  1EIF A;  1L1O B;  4GN4 B;  2OQK A;  3UE0 A;  1HNX L;  1IL2 A;  1JT8 A;  4OO1 I;  4Y7N H;  3L0O A;  4DV5 Q;  4JOI A;  4QJF A;  4R4T A;  1QVF A;  2A1A A;  1HZ9 A;  3GTO H;  1UEB A;  4JI2 L;  3HOY H;  4JI8 Q;  1Q1E A;  2JA7 H;  1L2F A;  4DUZ L;  4HIM A;  2OTJ A;  1VQD A;  2ZTE A;  4IPC A;  3UE1 A;  4JI4 Q;  1N32 Q;  1XJV A;  4X66 Q;  4R4O A;  1VQA A;  2OCE A;  2UU9 L;  1EUJ A;  5IP7 G;  2JEB I;  3UDF A;  2ID0 A;  4B3T Q;  1CKM A;  4R1J A;  4LUZ A;  1A62 A;  5IE8 A;  5AJ3 Q;  1FVI A;  2VUM H;  1E7Z A;  4A3D G;  3UDX A;  3PUZ A;  4DV4 L;  1KAW A;  1LM0 A;  2VQE L;  2R93 H;  3HOW G;  1V1Q A;  2OQ0 A;  3I2Z A;  4DV0 Q;  5C0X I;  1S40 A;  3FKI G;  2R7Z G;  4IPG A;  3CCE A;  1U5K A;  2PI2 A;  4X6A H;  2R92 G;  3DM3 A;  2E2I H;  3S17 H;  1PYS B;  2D0P A;  4GLV B;  4JBW A;  4A3M H;  3MEF A;  2QGQ A; 
#chains in the Genus database with same CATH topology
 4O1N A;  1PMR A;  4A3K H;  3MWY W;  4H13 C;  4CKC A;  2KHS A;  2LKV A;  3GTJ B;  2ZM6 L;  5IIF A;  4LMQ D;  2KHJ A;  2MO1 A;  1E22 A;  1J8I A;  4F7X A;  4BBR B;  1ESF A;  3L2P A;  1PRT B;  2HD3 A;  4RCN A;  5LMU L;  1Q86 C;  1CHQ D;  5J3B A;  2PO4 A;  2Q2I A;  1NUC A;  2IX0 A;  4RHS A;  3CC4 A;  1XNR Q;  2WAQ E;  2EJM A;  3BDO A;  4R4Q A;  4GNX C;  2JA5 G;  1XWE A;  1SJH D;  2UUC L;  4C3J H;  1BOS A;  4O42 A;  4MIU A;  4C1N K;  2Z6K A;  1LYL A;  5IP7 H;  4DR1 Q;  4OX9 Q;  1NCV A;  1XMQ Q;  2F0V A;  3IFT A;  1VQC A;  4GOP C;  3JC6 6;  2K1B A;  1A3V A;  2H5X A;  1PFN A;  4RGM A;  3HRZ C;  3S2H B;  1AZP A;  2X6G A;  3MTS A;  5T1G A;  1B9N A;  1Q12 A;  4LF8 Q;  2SOB A;  3PIP 3;  1U4P A;  3HS0 C;  4ME3 A;  1M90 C;  2ZXP A;  5KYL A;  1VQB A;  1BUV T;  4CKB A;  2PMZ E;  4BBR G;  4RH6 A;  1PH9 A;  3KJP A;  1D5M C;  1SYE A;  3A8I E;  1YI2 A;  1XYI A;  3A55 A;  1DXM A;  3BU2 A;  2D9U A;  4RGT A;  4CDE C;  2XWJ B;  1IBM L;  1N8R C;  1G6Z A;  5I4D A;  1X3Q A;  5FK9 C;  1K3R A;  5FO8 B;  3R3O A;  4J6H A;  1U0L A;  4UDU C;  3HG9 A;  5ISR A;  1SNP A;  3RN5 A;  2FMC A;  3A0J A;  1SYB A;  3CW2 C;  3K57 A;  2JA5 H;  4FF4 A;  3PUX A;  4OXP A;  2UUA Q;  5JJI A;  3CD6 A;  2B2U C;  2K75 A;  2Q2T A;  4JYA L;  2YU9 H;  3D31 A;  1I4X A;  1SMX A;  1I4H A;  1SMY D;  1WFQ A;  1LAB A;  1LUZ A;  5C4Z A;  2EQS A;  4X64 Q;  4DV3 Q;  5I6W A;  3NXW A;  3GTJ H;  2AHO B;  2MO0 A;  3HZX A;  4HJ5 A;  1YZ6 A;  3O13 A;  5IWA Q;  5CMD A;  2CW0 D;  4MTK A;  4TSS A;  4BBR H;  5M3M B;  5A2Q E;  2HHH L;  4B3S L;  1FNU A;  2TMP A;  2ATW A;  2RBM A;  4PMW A;  4JI0 L;  1SE3 A;  2XIW A;  2AWN A;  4GS3 A;  3AEV A;  4K14 A;  3CAM A;  2J0T D;  4L8J A;  4NPS A;  3T4A C;  3URY A;  4HN7 A;  3ERS X;  2CKZ B;  1Y1V B;  2IW3 A;  3I55 A;  2JYO A;  2HT1 A;  3CRK C;  3LGJ A;  3S2H H;  2CQO A;  1N36 L;  1CT1 D;  2BOS A;  1HUM A;  2NZO A;  1EU4 A;  3ERO A;  1JOO A;  3RUZ A;  2B2W C;  1WTO A;  5M3M G;  4HJ7 A;  1HR0 L;  2ZXR A;  4GNX B;  3L7Z C;  2CHB D;  5JVG 3;  1QCB D;  3GTM B;  3BZK A;  5DM7 3;  5KEE A;  3NBH A;  3J80 L;  5ELF A;  4LUV A;  5C5M A;  5M3F B;  1N32 L;  1F2Z A;  4KMU C;  4JI4 L;  1VQL A;  3B6Y A;  5GAG C;  1KC8 C;  2DUD A;  2F0S A;  5IGF A;  2LXJ A;  2YV5 A;  1BQQ T;  4HID A;  1Y1V G;  1XMO Q;  3T16 A;  4BY1 B;  4DV6 Q;  2BH2 A;  4ULL A;  5KIX A;  4OO1 G;  4J15 A;  1ENF A;  3A5U A;  3GTP B;  2V1C C;  4A3F G;  1PFB A;  3CQZ B;  1H9S B;  4X3T A;  1BCP C;  1HTL D;  2L11 A;  2FFK B;  3H15 A;  1J5E L;  3D4D A;  5HGT A;  3DHQ A;  1KXL A;  2UXD L;  2WFW A;  5M3M H;  4K6D A;  4LF4 Q;  2EYF A;  1YNJ C;  5M3F G;  3H0G G;  5IT9 c;  4RFB A;  3E9H A;  4NDX A;  3STB C;  2J7Z A;  3G71 A;  3S1Q B;  2K50 A;  2ZT9 C;  1SRO A;  2XWB B;  4BY1 G;  3AYH B;  2I5H A;  1HNW Q;  1JJC B;  1HJP A;  2RCN A;  2EXZ A;  3FPU B;  4GKJ L;  4YY3 L;  4LF7 Q;  1Y1V H;  1B3A A;  5EKL A;  1II3 A;  2DNC A;  4HMJ A;  5LMN Q;  2QW7 A;  2MQH A;  1TS3 A;  1Q90 A;  3NHH A;  3F8T A;  4OO1 H;  1C48 A;  1HZA A;  1K8M A;  1HTP A;  3D0F A;  4R8N A;  5GQO A;  1MJC A;  1I3Q B;  4A3F H;  5BN3 A;  3BYY B;  4DAY B;  2V4D A;  1FJG L;  1LTT D;  1TWH B;  1X3P A;  1N33 L;  2Z6B A;  4HAE A;  2EJF C;  3GTM H;  2DNE A;  2RHS B;  1BBX C;  1MSG A;  2LMC B;  1W6J A;  5DNF A;  5IT9 L;  5M3F H;  2UU9 Q;  4P75 A;  1Z7T A;  4A3C G;  3H0G H;  5JJK A;  4B9X A;  2IY5 B;  1DYQ A;  1QUQ B;  3SE0 A;  4UP9 A;  2HUG A;  2K5Q A;  4XQJ A;  4BY1 H;  3ICE A;  3CCR A;  2I5M X;  3UDG A;  4HJ9 A;  2IX1 A;  3GTP H;  2HDM A;  2RVL A;  3NEN A;  3LWE A;  3PUW A;  3CQZ H;  5DEH A;  1MHW C;  4HSP A;  2ZM6 Q;  2JQO A;  4R4C A;  2B29 A;  2NUC A;  5KYI A;  4IFD H;  5LL6 S;  3CPF A;  1ENC A;  4HTH A;  3FDT A;  5CC4 A;  1IKM A;  1HRJ A;  1DOM A;  5LMU Q;  3J7A 5;  3VYR A;  1WTV A;  4GOP A;  1A0I A;  3A7A B;  1KD1 C;  2EJG C;  2ENB A;  2KEC A;  3FRP B;  2K52 A;  1I4G A;  4HCS A;  3VA5 A;  1CM9 A;  3S1Q H;  1HQR D;  2UUC Q;  1AEX A;  1B8A A;  4DKA C;  4JI8 L;  2JXM B;  5CV5 A;  2DJF C;  4A3C H;  4IO9 A;  1X3E A;  4DAM A;  1T5E A;  4BA2 I;  1S5D D;  2JA8 B;  1VQ4 A;  3GQB A;  1KRS A;  4IJL A;  4C56 C;  4K5V A;  1BCP B;  2N8N A;  5EPL A;  1K9M C;  1DM0 B;  1NMG A;  2KCC A;  2QKI C;  4DFA A;  4DAV A;  5BN4 A;  3GD7 A;  3S15 H;  1NSN S;  5JPN C;  1I3Q H;  1AE3 A;  3NPP A;  2K01 A;  1G2T A;  1QJO A;  2EDG A;  1TWH H;  1OXX K;  1VQI A;  2YTX A;  1G29 1;  2VQF Q;  5CV7 A;  3J81 j;  1NBW A;  3TP7 A;  3NTK A;  4JCV E;  5M5Y B;  3E5S A;  1P8L A;  1FNV A;  5IGE A;  5AFW A;  1UE7 A;  1IBM Q;  5IY0 A;  1BXT A;  1CFM A;  1VQJ A;  3RZD H;  3TBI B;  3U58 A;  5GAE C;  4POG A;  3E9I A;  1SYG A;  3R2T A;  4K6L A;  3T51 B;  5C0X G;  4N8X 1;  1BCP D;  2JA8 G;  1TS5 A;  2D5D A;  4DR3 L;  1HZB A;  2JK8 A;  2OTL A;  1XNR L;  4QY7 A;  4LFC L;  5EJW A;  2R93 B;  1ICF B;  4ZK9 B;  2F0K A;  2R7Z H;  2LFN A;  1MI2 A;  1XX8 A;  4JYA Q;  1FR3 A;  2F0J A;  3S17 B;  4DUY L;  1U4L A;  3H3V I;  5FLM G;  4XXE A;  4POF A;  4PG3 A;  3WDN A;  5D3D A;  1NJI C;  5FLX c;  1J9O A;  4DAP A;  3OMG A;  2MGS A;  1TS2 A;  1TY2 A;  3IFD A;  3IRB A;  3Q6S A;  2NN6 I;  4DNI A;  2HHH Q;  2O2L D;  1W3S A;  1TWC B;  2E2D C;  4B3S Q;  4WRD A;  1EU3 A;  4JI0 Q;  3OHX C;  2IL8 A;  2EPB A;  4F88 A;  4KD4 A;  2R93 G;  1TWF B;  5GAD C;  1BNZ A;  3EBE A;  2Q2U A;  3MC0 B;  5C0X H;  1V1P A;  1M4V A;  2JA8 H;  1PH5 A;  1D8L A;  4QB4 A;  2F4V L;  1E2W A;  2D62 A;  4GN3 B;  2OWO A;  5JVH 3;  1GOZ A;  4EQ5 A;  3F2B A;  5FJ8 G;  5KND A;  1L1O A;  1N36 Q;  5E3F A;  4JI7 Q;  3TRE A;  4JV5 L;  1F9R A;  1NNX A;  1NR2 A;  1QNU A;  1V43 A;  1OXV A;  5FLM H;  2M2L A;  1HR0 Q;  2CCZ A;  2XTI A;  3OIP A;  1EIF A;  4G4K A;  3VR5 A;  1HNX L;  3L0O A;  1QVF A;  2A1A A;  3D3R A;  3IAY A;  1L2F A;  2C5C A;  5KNB A;  4DUZ L;  4IPC A;  1N32 Q;  5CYU A;  4JI4 Q;  4EQN A;  1PTO C;  1A3T A;  3HKZ B;  4ZRZ A;  1HA5 A;  1S4Z A;  4ME5 A;  1U9R A;  2VB3 X;  2AQ3 B;  3H09 A;  4R1J A;  5IGG A;  2R93 H;  2Z4I A;  1EQV A;  1S40 A;  4KKT A;  1U5K A;  2PI2 A;  1IKL A;  1W6K A;  5G3L D;  4A3J B;  3L3O C;  1EWC A;  3S17 H;  1VDZ A;  1PYS B;  3MEF A;  1F9Q A;  2F0G A;  4RGN A;  5FJ8 H;  2R7D A;  1A8V A;  4OHJ A;  2DN8 A;  4XDX A;  1WI5 A;  1J5E Q;  1Q8I A;  2UXD Q;  1VQK A;  4RMF A;  1Y14 B;  3DXJ C;  4A75 A;  1T5X D;  1CUK A;  3HKZ G;  3W2D A;  1TWC H;  1B3Q A;  2Y0S B;  4XT3 B;  3W5O A;  1VQP A;  1VQ8 A;  3QOL A;  3K8A A;  1TWF H;  4ID6 A;  4QGU A;  3HP3 A;  3SEB A;  1LLR D;  1EEI D;  3PSI A;  4JI6 L;  4LFB L;  2F3V A;  4A3J G;  4FF2 A;  1SYD A;  4GKJ Q;  2HDL A;  1MD2 D;  3S24 A;  4YY3 Q;  4GKK L;  1JJ2 A;  1SR3 A;  1TXY A;  1SND A;  1EZ8 A;  2YYZ A;  3NK9 A;  1JMC A;  3CC2 A;  1KRT A;  2F0F A;  3I72 A;  4JK1 C;  5D65 A;  3KDF A;  3EQL C;  1FJG Q;  1X55 A;  1MSH A;  2NVQ B;  2EVB A;  3ER0 A;  1YJ9 A;  4B08 A;  2AUJ D;  2Y0S G;  1B70 B;  2A5H A;  4UP8 A;  4Z9C B;  1YIT A;  1H9R A;  4LF4 L;  4KHV A;  4J8Q A;  4Y52 H;  4JI5 L;  4U68 A;  1K0R A;  3T13 A;  4OEL B;  2P5Z X;  2QEJ C;  3CHB D;  1CSQ A;  1C4Q A;  4A3J H;  2F0I A;  1QVC A;  2Z4H A;  1VQH A;  1CA6 A;  2KUM A;  4MZ9 A;  2DGY A;  3GTQ B;  4EX5 A;  5C3X A;  2EOT A;  5I9P A;  1I4Q A;  1ET9 A;  1ILQ A;  3TP8 A;  4LF5 L;  3TDQ A;  1RIP A;  1WJJ A;  4FXD A;  1JC7 A;  5EQ0 A;  2LY7 A;  4PZ7 A;  2HQE A;  2AQ2 B;  4NB3 A;  2VY3 A;  1X65 A;  1EYD A;  2JE6 I;  3J81 c;  1HH2 P;  2F3W A;  2GA4 B;  4KI0 A;  1A6X A;  2SDF A;  4M1U B;  3MXP A;  1H9J A;  2F52 A;  5E4W C;  2DY8 A;  1U4M A;  1DOL A;  1G2S A;  5JAV A;  1VQ6 A;  2D0O A;  1SDF A;  1SFO B;  3NSW A;  2JA5 B;  3CKI B;  2C9O A;  2K7V A;  2G9D A;  4NKL A;  4G7Z C;  3K5L A;  4FF1 A;  1O7Y A;  1PTO D;  4E6I A;  1X6O A;  1SLJ A;  1AW7 A;  2E76 C;  3BJU A;  2NVQ H;  3PV0 A;  4FO2 A;  3ERQ A;  4C3I B;  1QZG A;  5EKK A;  3R93 A;  3NP8 A;  2WAC A;  4AH6 A;  1B2T A;  1RTN A;  4DR3 Q;  4MHE A;  3CPW A;  2A74 C;  2NYZ D;  3OW2 A;  3RN2 A;  2N3S A;  4LFC Q;  3QB3 A;  1AN8 A;  2GN5 A;  4JVZ A;  3NEM A;  4DV0 L;  3NBH B;  1D5Z C;  3D6W A;  2EY6 A;  4HJ8 A;  3W3A A;  3C1E A;  1HA6 A;  4H44 C;  2E2J B;  2EY2 A;  1K73 C;  4DUY Q;  3D4R A;  1PYW D;  3GTQ H;  2BCO A;  1Q8K A;  2KVM A;  3KF6 A;  5IP9 G;  1TII D;  1TWG B;  1YHB A;  4QIW E;  1RTO A;  3K81 C;  4C3I G;  4LJZ C;  3VYU A;  2FXQ A;  1XPO A;  4JI1 Q;  4QL5 A;  4DK3 C;  5JJL A;  2RA4 A;  1VQE A;  1YBY A;  2LSS A;  5IGD A;  2PCF B;  4NXM L;  2O4X A;  4WFN 3;  4CDD C;  3BS1 A;  3E0E A;  2A69 C;  1JE4 A;  4UPA A;  2VQF L;  1AP0 A;  4ZCK A;  2Z9H A;  1YEZ A;  1YIJ A;  4K2K A;  5KRU A;  4ZAI A;  3DWQ A;  3J7Y W;  2HIV A;  3RR5 A;  1PDQ A;  2F4V Q;  1CTM A;  1ML0 D;  4TRD A;  1SFO H;  1O7L A;  2BA0 A;  3M4Y A;  2HCC A;  1HXY D;  4BWG B;  3W1G A;  1E1O A;  2MPM A;  4JV5 Q;  3PUV A;  3K5N A;  2F0N A;  4K0K L;  1LTB D;  3HKZ E;  4HED A;  3M7N A;  2BH8 A;  3K7A B;  2EYP A;  5DLQ E;  3G7L A;  2L55 A;  4IUV A;  1ASY A;  5IP9 H;  1EOV A;  3QO2 A;  1HNX Q;  4NP5 A;  1QZH A;  1D7Q A;  3KLS X;  1G6P A;  1LT5 D;  4C3I H;  1S72 A;  5IOD A;  4DUZ Q;  1OXU A;  4XIG S;  5M5X B;  4DK1 A;  1HCZ A;  2B39 A;  3VR3 A;  5DM6 3;  3J81 E;  1B9M A;  4FXG C;  2UUB L;  4M8A A;  4RWS C;  2ZJQ A;  1PV4 A;  2L1B A;  3GTK B;  1TWA B;  1PH8 A;  2UXB L;  3CP0 A;  1QIL A;  4KN7 C;  2E2J H;  3VR2 A;  2ASB A;  1U4R A;  2B2T A;  1I5F A;  2KEE A;  2Y0S E;  1QWY A;  5EBC A;  1TWG H;  1STE A;  3KBX A;  1ROD A;  2QDB A;  3VR6 A;  1SYF A;  4YCW A;  2RDG A;  4R9W A;  4JI7 L;  5EGT A;  3I7F A;  1EFW A;  2OT2 A;  2VXW A;  4A3F B;  4B3M L;  5IGB A;  4MTN A;  2A68 D;  3RLO A;  1L1O C;  5ELD A;  2IT1 A;  3AQQ A;  1EEF D;  2I5L X;  3KF8 A;  4JI6 Q;  4LFB Q;  2K6A A;  4A76 A;  3H0G B;  4QQB X;  1S5E D;  3VYS A;  4GOP B;  4IUR A;  4O0A A;  4GKK Q;  1KL9 A;  3BZC A;  1MJE A;  3HEJ A;  1GHK A;  3T1H L;  4DNT B;  4CJ2 C;  1IBK L;  1BDO A;  1EYC A;  3SK6 A;  5GAH C;  3K7A H;  3AU7 A;  5CBA E;  5L37 A;  2IJ0 A;  1I6H B;  1ZKO A;  4EGV A;  4YHH L;  4P73 A;  5CBE E;  4DV1 Q;  4BA1 I;  2SNM A;  3I70 A;  4L5R C;  3GTO B;  3HOY B;  1LO5 D;  4JPB W;  1PFM A;  4IOC A;  2JA7 B;  1EYG A;  5M5X H;  4EQP A;  4JI5 Q;  1GUT A;  5FO9 B;  2HCI A;  1PVO A;  3GTK H;  2VUM B;  5J1Z A;  1TWA H;  2F0D A;  1KAB A;  4CJ0 B;  3J7Z C;  2N88 A;  1JOQ A;  1XTC D;  2KQ3 A;  4JI3 L;  2WKC A;  3ULJ A;  2IWH A;  1WTQ A;  2A69 D;  1KHI A;  2R61 A;  3CRL C;  4APV A;  3MAQ A;  4LF6 L;  2O5J C;  1KNA A;  2MFI A;  2LXK A;  1FL0 A;  2E5L L;  4PQX A;  3NTI A;  1YHA A;  3KBG A;  1QNK A;  5FKA C;  4LF5 Q;  1QB5 D;  1PLF A;  3V2T A;  2PYK A;  4P72 A;  1O7Z A;  1UE5 A;  3FPP A;  5H1S E;  3EJI A;  1F77 A;  3HOY G;  4KJO A;  2JA7 G;  4GN5 A;  3I3C A;  1RL2 A;  1F9P A;  2X69 A;  1ZXT A;  1RCV D;  1AFP A;  4DF7 A;  4FVM A;  1B4O A;  1IW7 D;  3A8J E;  1S3O A;  1SBB B;  1O78 A;  5M9O A;  1ONL A;  4F8M A;  3X3N A;  2VUM G;  1F9S A;  4X62 L;  4YCU A;  3RZD B;  3A8K E;  4NMZ A;  1XNQ L;  4MNO A;  5JEA G;  3J81 i;  2PQE A;  1D6E C;  2K5V A;  3K80 C;  3VDY A;  3FMC A;  1BR9 A;  4QCL A;  1RKN A;  3HOW B;  4MN3 A;  1STY A;  1NY4 A;  3FKI B;  2R7Z B;  1UWV A;  5JJZ A;  3H3V C;  3S1N B;  1SNO A;  1V1P B;  3DUZ A;  3NE5 B;  2EYM A;  1GUO A;  1GO3 E;  3QWN A;  1WD1 A;  2PZW A;  2UXC L;  3C1F A;  5D3I B;  2WII B;  3RNU A;  1I6H H;  2F0H A;  3MFG A;  4DV2 Q;  2B63 B;  2B2Y A;  3PIO A;  1O80 A;  1ICW A;  1H95 A;  1L1O B;  1JT8 A;  4C2M B;  1EFI D;  4R4T A;  2FHT A;  3ND8 A;  3GTO H;  3HOY H;  1UEB A;  1JWU D;  2ICE C;  2JA7 H;  4HIM A;  1WTP A;  4UAI A;  4X66 Q;  4R4O A;  1RHP A;  1VQA A;  1AZQ A;  1EUJ A;  3UDF A;  2ID0 A;  3VR4 A;  4IZ8 A;  3PO3 B;  5AJ3 Q;  2VUM H;  1KAW A;  2VQE L;  3HOW G;  1JOR A;  4DV0 Q;  5C0X I;  3FKI G;  4ILW A;  4K2L A;  2R7Z G;  4X6A H;  2MHV A;  5JEA H;  5C4X B;  4AYB B;  1MBY A;  4JBW A;  4OIK A;  4G57 A;  3HOZ B;  2QGQ A;  1A2U A;  3RLN A;  3OOC A;  2ES2 A;  2F0T A;  2K32 A;  2E2H B;  2L15 A;  2B63 G;  3DM1 A;  1CKO A;  3N6R A;  5TSS A;  1TU2 B;  5KNC A;  2Q8I B;  2R7F A;  4RKL A;  4XQN A;  3I4O A;  3MXG A;  3X3M A;  4IFD J;  1VS0 A;  1G51 A;  4IUP A;  4LW1 A;  4NXM Q;  1YJW A;  4GLX A;  2KA7 A;  1CHP D;  1RF2 D;  1WCM B;  1N34 L;  4LFA L;  1JB3 A;  2KED A;  1GM5 A;  4ZLT F;  3PO3 G;  1Z47 A;  2VS1 A;  3OSO A;  5C4X G;  4RGO S;  3TS2 A;  4AYB G;  2F0E A;  1TR5 A;  3HOZ G;  2PZU A;  3HOW H;  2DY7 A;  1QG7 A;  2BE5 C;  1VQN A;  4ALP A;  1A63 A;  2M00 A;  3FKI H;  1D2B A;  1WTX A;  3S1N H;  2NTT A;  4DR4 L;  2RDH A;  4K0K Q;  2Q8T A;  3KOJ A;  3U9S A;  1K0S A;  2F0L A;  1BBU A;  3GDE A;  2B63 H;  2X6L A;  2CVR A;  1EYA A;  1DOK A;  1S5C D;  3MZ5 A;  4RA8 A;  1SE4 A;  1WCM G;  4C2M H;  3OMC A;  1X32 A;  4BS9 A;  3RD4 A;  5IGC A;  2EIF A;  4JI1 L;  1VQG A;  3KDF B;  2QCP X;  3MXN B;  2QIL A;  2UUB Q;  1VMP A;  3K59 A;  4DR5 L;  3PO3 H;  3M4O B;  4HCE A;  1Q82 C;  2VL6 A;  1J6Q A;  2VW9 A;  2UXB Q;  4DU9 A;  2YTY A;  1R4P B;  5C4X H;  1W2B A;  5A35 A;  4X65 L;  4IPH A;  1YNX A;  2IHF A;  5CV4 A;  1ET6 A;  3NWS A;  3HOZ H;  4QMG A;  2F1M A;  1E2Z A;  3A54 A;  3S16 B;  1SRU A;  2E2H H;  4ZUI A;  4UP7 A;  1Q1B A;  3TP5 A;  1LT6 D;  4LWC A;  1D5X C;  3F2U A;  2F0Q A;  3F2C A;  4L5S A;  4B3M Q;  1PRT F;  3OTO L;  3I56 A;  5FLX L;  4TQU S;  4LAA A;  2G9H D;  1QOH A;  1SJE D;  4DNR B;  1WCM H;  2EXD A;  1JR0 D;  1JIC A;  4JC0 A;  4DV4 Q;  2H1E A;  3C2P A;  1A3U A;  2CWA A;  1VQM A;  2RKS A;  5C0X J;  2ZTC A;  3DEP A;  1L0X B;  2IHE A;  2KBN A;  4DR2 L;  3NEL A;  3T1H Q;  3HOV B;  3JAM c;  1IBK Q;  1V9P A;  1JQY D;  2K5N A;  4IUN A;  3CMA A;  4PV1 C;  4FYD A;  1I50 B;  2PQA B;  3J7A V;  3GTG B;  3GP7 A;  2FMM A;  2FJ2 A;  2AMC B;  4BXX G;  4YHH Q;  3U50 C;  3M3Y B;  1CZG A;  2F0O A;  3NQT A;  1XPU A;  2I0Q A;  1K28 A;  3K0X A;  2KOL A;  2K4K A;  3WOE A;  2K5D A;  4YIJ A;  3RLF A;  1LTG D;  2N55 A;  5ELC A;  1TQO A;  1EY9 A;  1BF4 A;  1H9K A;  3PUY A;  1LTR D;  1TVX A;  2B2T C;  1EY6 A;  3M4O H;  4DPG A;  3NTH A;  1SAP A;  1EQR A;  5EPK A;  2A6E C;  3HOV G;  3ULL A;  4P71 A;  1X56 A;  4JI3 Q;  3VYT A;  1RDP D;  4KHZ A;  1KLG D;  4FNF A;  4OEM B;  1RJT A;  1GD7 A;  3SVM A;  4LF6 Q;  1YNN C;  4KK7 A;  1A15 A;  3S16 H;  4CBV A;  2E5L Q;  1UNS A;  3HFZ B;  1E3P A;  1SNQ A;  2ALY B;  2CH4 W;  4LUO A;  3CCJ A;  1YJN A;  1PZJ D;  1K8G A;  5CR3 A;  3KFU A;  4B9W A;  4GLA C;  2VB2 X;  2RCF A;  1C0A A;  4BXX H;  3PQI A;  5HY6 A;  5K36 G;  2EYJ A;  2VZA A;  3MXN A;  1JWM D;  3KF6 B;  2BE5 D;  1VMC A;  3KLS A;  4RAU C;  3FHW A;  4DV1 L;  3PF5 A;  1ZEQ X;  3A74 A;  4ABN A;  3NBI A;  4X62 Q;  1IL8 A;  4CDC C;  2A19 A;  1VQ5 A;  1XNQ Q;  1TKW B;  4NXN L;  1EQT A;  2K5W A;  3NWT A;  2MUY A;  1PFS A;  5C3E B;  2XVS A;  4HJA A;  2F0M A;  5LMN W;  1CQF A;  3HOV H;  4A3I B;  2WB1 B;  1UE1 A;  4IJH A;  5EBD A;  3M85 A;  2PW5 A;  1CA5 A;  1I50 H;  3GTG H;  5E1F A;  2QEX A;  2UXC Q;  1NMF A;  2JA6 B;  1EWH A;  3SK4 A;  3M3Y H;  2NVY B;  1DJR D;  1I94 L;  2Q8R E;  1EQQ A;  1IBL Q;  2KHI A;  4GZY C;  1LT4 D;  1K8A C;  5K36 H;  1PTO B;  2QA4 A;  4DR7 L;  3TQY A;  4I7Z C;  4AYB E;  1SXT A;  2I46 A;  2GVB A;  2MNA A;  1LV9 A;  3TRZ A;  1F2L A;  4HR7 B;  5I9O A;  1GKH A;  4ZKB B;  2ZXO A;  4A3E B;  2ICI A;  1AE2 A;  2R3Z A;  3G6J B;  1S5F D;  3OW7 A;  2OXP A;  2K5H A;  2VQE Q;  4K8J A;  1ILP A;  5C3E G;  1E0B A;  1PH2 A;  4A3I G;  4WJ4 A;  2PI2 E;  1VF7 A;  2WB1 G;  5GRO A;  1KNE A;  3I90 A;  1GVP A;  2PQA A;  1FD7 D;  1V8Q A;  4N8F A;  1M8A A;  5E4X A;  3JAM E;  1WD0 A;  2JA6 G;  1B1Z A;  2KCT A;  2A73 B;  3K58 A;  1WOC A;  3KUP A;  4U67 3;  4OON A;  4WJ3 M;  4YWM A;  2A68 C;  1BO0 A;  3CCV A;  3E3X A;  3KYH C;  2EE1 A;  2PW7 A;  4RCO A;  4Q0F A;  1EY7 A;  1TY0 A;  3SK8 A;  1EOT A;  4YCV A;  2JJQ A;  5C44 B;  4CDF C;  3M4Q A;  4DV2 L;  3CC7 A;  4LFA Q;  1N34 Q;  3H91 A;  4A3E G;  4CGY B;  2AUK A;  2GVA A;  1PA6 A;  2F0W A;  4A4I A;  2NZ1 D;  3EVQ A;  3PO2 G;  3J81 L;  5A2Q L;  3I4M B;  3UDI A;  3DWA A;  4X66 L;  2I07 B;  4WOR A;  1JJG A;  2EZV A;  2Z0S A;  4CHT B;  2B2Y C;  5C3E H;  5AJ3 L;  2B8F A;  3T1Y L;  2KCM A;  4A3I H;  4KV6 A;  2BDO A;  3SXH A;  1PH6 A;  2NVX H;  4DR4 Q;  4BBS B;  1VF5 C;  3KF8 B;  3IKJ A;  2L0C A;  5E7N A;  4YWL A;  4WJW A;  1VQ7 A;  3CCM A;  2JA6 H;  1I4R A;  1PH4 A;  3BZD B;  2RSN A;  4ZUJ A;  4DR6 L;  1KDA A;  2A6E D;  1GUG A;  2NVY H;  1CSP A;  1SYC A;  2C35 B;  2N49 A;  4I7A A;  2F0U A;  5C44 G;  1KDC A;  3Q22 A;  4DA2 A;  2K05 A;  3MEH A;  1KDB A;  5EAY A;  4Y7N B;  2RQX A;  1PTO H;  4IN3 A;  1YNN D;  1A2T A;  1GXD C;  1STB A;  2DJG C;  2XSC A;  3I4M G;  4DR5 Q;  4A3E H;  4KHP L;  1PH1 A;  4B3R L;  3PO2 H;  1SE2 A;  3CF5 A;  4X65 Q;  3W1B A;  1BVS A;  4KY6 A;  4BBS G;  3R2I A;  4EQO A;  1PXU A;  3AFP A;  1BKB A;  1PRT D;  5C6A A;  4IUT A;  4KY5 A;  1QE6 A;  3GO5 A;  4IOA A;  4LF9 L;  3FEW X;  1IXR A;  1CZW A;  2J4X A;  4OWT B;  1IW7 C;  1C8C A;  3U4Z A;  3ZYY X;  4G7O C;  2PZT A;  3MA2 B;  3SR1 A;  3I4N B;  1STA A;  4FXK C;  3DMU A;  3OTO Q;  3T53 B;  4HSV A;  1PYB A;  1EIY B;  1Y8O B;  4OIJ A;  5C44 H;  5BN5 A;  1VQF A;  3TME A;  5COY A;  4UHV A;  5COR A;  5HUR A;  3D4W A;  3F2D A;  2F03 A;  2R6G A;  3A56 A;  1S5B D;  1G91 A;  1FYC A;  2NB0 A;  1MKH A;  3I4M H;  1EWI A;  3GTL B;  2B8G A;  1BCP F;  2KEN A;  4DR2 Q;  4A3D B;  1IZ6 A;  1QVG A;  4IAL A;  4QUF A;  2LS0 1;  3GV3 A;  2H4O A;  2G5D A;  4AQY L;  2R92 B;  3TN2 A;  4BBS H;  5HGQ A;  3C46 A;  1IYU A;  1LTA D;  3S2D B;  4C3H B;  3LNN A;  3OYY A;  3I4N G;  3S9W A;  1HR0 W;  3PIP A;  1ZYR D;  3JAM i;  4K5W A;  3J80 c;  4GN4 B;  1IL2 A;  4XT1 B;  1UUP A;  3QJY A;  3MXU A;  4N9T A;  4Y7N H;  4OO1 I;  3AB9 A;  4JOI A;  4QJF A;  2EY5 A;  4JI2 L;  1Q1E A;  2OTJ A;  1VQD A;  3UE1 A;  1XJV A;  1R9T B;  3V96 A;  3J7A F;  1CKM A;  1I6V C;  2NBF A;  3I8Z A;  1A62 A;  4A3D G;  3PUZ A;  4DV4 L;  1LM0 A;  4A3B B;  1B53 A;  1V1Q A;  2OQ0 A;  1UAP A;  1ENA A;  5LL6 X;  2R92 G;  2L5T A;  4C3H G;  3ZJY C;  4DK6 C;  1F2Y A;  2EYO A;  4H02 A;  1K83 B;  1LAC A;  1UEA B;  3I4N H;  3OPO A;  4K8I A;  1FNW A;  2QDL A;  3A7L A;  1OO9 B;  4OL7 A;  2L4N A;  2F4I A;  1KQS A;  4IFD I;  1EIG A;  2WB1 E;  2JA9 A;  3WOF A;  4A93 B;  1JB7 A;  2WIN B;  3RMH A;  4A3B G;  1HNZ L;  2CWP A;  4NXN Q;  3GTL H;  1VQO A;  4A3D H;  2XN9 C;  3P20 A;  1H9M A;  5J22 A;  3K7U C;  2R92 H;  1LT3 D;  3S2D H;  4C3H H;  2L12 A;  4PMB A;  2XGT A;  5G3L F;  5K5P A;  4CKE A;  5IYD G;  2F3I A;  4BY7 B;  5ELN A;  3PIO 3;  1IYJ B;  2A6H C;  1X3F A;  1HHV A;  4O2D A;  2PNH A;  3OWE B;  2E75 C;  1EIH A;  4JBM A;  4J1M A;  4DV7 L;  2KCN A;  3P7J A;  1I94 Q;  1GHJ A;  2RSO A;  4X3U A;  4IQZ A;  3S1M B;  2WKD A;  2IPK D;  2B2V A;  4DR7 Q;  5BR8 L;  4A93 G;  1SEB D;  2O5I C;  5FO7 B;  2CFM A;  4FDB A;  1R9T H;  3K0Y A;  1CKN B;  4TVA B;  5C4J B;  1RD9 D;  3H94 A;  3IL8 A;  5IYB G;  1JCK B;  4IPD A;  4XYO A;  2Q2H A;  5CV8 A;  2XNA C;  3SK5 A;  4A3B H;  2M9V A;  1PHJ A;  4PZ6 A;  1WTH A;  4H7B A;  4X3S A;  3CCS A;  1I4P A;  2AKW B;  3AFQ A;  4BY7 G;  3KLR A;  4XYQ A;  1ESR A;  1CI3 M;  3MHB A;  1K8O A;  1Y69 U;  3M9B A;  4OGQ C;  5I2Y A;  1Z6H A;  5CV9 A;  1FGU A;  2K03 A;  1K83 H;  5IYD H;  4RHR A;  3QR8 A;  3KLW A;  3CXC A;  3J80 E;  1ASZ A;  1TS4 A;  2HQL A;  1SE8 A;  3TSS A;  1DGS A;  5C3W A;  1IBL L;  4A93 H;  2EYL A;  1OXS C;  3RZO B;  1EY8 A;  1Y1W B;  1WYD A;  4DXF A;  5ELE A;  2ZTD A;  2OEO A;  1NAP A;  1JOK A;  1Q46 A;  5IYB H;  3LWU A;  1STH A;  3T1Y Q;  1B7Y B;  1SNC A;  3CU7 A;  5KGU A;  4V19 0;  3I4L A;  4GNX A;  2RF4 A;  4YWK A;  3M7G A;  3HKS A;  1LTL A;  4DK0 A;  4Q5V A;  3KK7 A;  4JBK A;  3A5Z B;  1OTC A;  4BY7 H;  2EYH A;  4DR6 Q;  1HPC A;  1X54 A;  3OWF A;  3CCL A;  3HOX B;  1Q3L A;  2KJX A;  1WTR A;  5I6Y A;  3SDZ A;  3S1M H;  4KKU A;  4DV5 L;  4ZYS A;  3ULP A;  4QUC A;  5ELB A;  3MFY A;  1KIX A;  1Y1W G;  1YVC A;  3BG3 A;  4OWW B;  2ZJR A;  5C4J H;  4KHP Q;  3N52 A;  4LNQ A;  2XRQ D;  3QOJ A;  4B3T L;  4B3R Q;  1H9S A;  1EY5 A;  4HIK A;  5ELO A;  3NQI A;  1UE6 A;  4P74 A;  5CV6 A;  2IX3 A;  5JEA J;  1GUS A;  4P2C B;  4TKO B;  2MJ8 A;  3BVG A;  4LF9 Q;  2AQ1 B;  3C3L A;  3KJO A;  3CCQ A;  5DAU A;  3HOX G;  3BVZ A;  4DGZ A;  1HFN A;  1CK1 A;  2K28 A;  1WTW A;  1XTD A;  1PTO F;  3S14 B;  1FGB D;  4KLK A;  3S1R B;  4JW0 A;  3TZU A;  2RDF A;  2B2U A;  4KD3 A;  2B3G A;  3P1H A;  1CKN A;  5IT9 E;  1NTG A;  2WP8 J;  3NUC A;  3Q8D A;  1HZC A;  2D2C C;  4IUQ A;  1Q7Y C;  4C1N I;  3S15 B;  3QG1 A;  3M4P A;  1VQ9 A;  4KKS A;  4FF3 A;  2N78 A;  1Y1W H;  3EN2 A;  3RZO H;  2A6H D;  4S3S A;  5I2X A;  2K14 A;  1YNJ D;  2XRS D;  4PZ8 A;  4HIO A;  4DR1 L;  1NE3 A;  1R4Q B;  4OX9 L;  1XMQ L;  1HFG A;  4DAY A;  4UY8 C;  3STB D;  3R8B A;  3D6C A;  1B50 A;  4I65 A;  3DLL A;  2F0P A;  1G8Z D;  4JBJ A;  2WAQ B;  4AQY Q;  3CCU A;  2JSO A;  2SNS A;  4LF8 L;  2JEA I;  1KAA A;  3ITP A;  2Z6K C;  3H6M A;  1QUQ A;  3HOX H;  2RHQ B;  1AH9 A;  4HMI A;  2AWO A;  4KY7 A;  4N9P A;  4JI2 Q;  3FP9 A;  4K5X A;  4KJN A;  4QIW B;  3VA7 A;  3E0J A;  5IYC G;  4X3K A;  3Q24 A;  4LK1 C;  3D8G A;  1KTK A;  1N9W A;  2B2W A;  2PMZ B;  3J80 i;  4V0B A;  2BA1 A;  1NR4 A;  5JOB A;  1BBW A;  4R4I A;  3PF4 A;  1WVL A;  2UUA L;  2WAQ G;  3UI2 A;  1E24 A;  5D14 A;  1LTI D;  4H0L C;  1P16 A;  2FIN B;  1EZ6 A;  4A3G B;  3TZD A;  4A3L G;  3K6O A;  4X64 L;  4DV3 L;  2NN6 G;  1X9N A;  2NVT B;  3AMU A;  2MP1 A;  4L6T B;  3L9A X;  1DD2 A;  5M5Y H;  3V05 A;  3G4S A;  3S14 H;  3S1R H;  5IWA L;  3ONA B;  1GUW A;  1L0Y B;  3SHL A;  5M5W B;  1T9H A;  1SSO A;  4ODG A;  3BDL A;  4CJ1 B;  1GJX A;  4ZKC B;  3U4V A;  4ZQ3 A;  1E1T A;  1YHQ A;  1EY0 A;  5IOC A;  2ZJP A;  5IYC H;  1HNZ Q;  1O7I A;  5LHY 1;  4G7H C;  1CQV A;  1STG A;  1TT2 A;  3DWP A;  1LTS D;  2YTV A;  3EFX D;  1GUN A;  3F1Z A;  4NW2 A;  1L0W A;  4AIM A;  3HOU B;  1DZ1 A;  4A3G G;  3H3V H;  4XTC S;  4JOI C;  2TSS A;  1M1K C;  4IFD G;  1PZK D;  3JAM L;  4A3L H;  3BYT B;  2E8G A;  3BVM A;  4EVO A;  1KLU D;  2NN6 H;  4DV7 Q;  1HUN A;  1JE5 A;  3I73 A;  3DEO A;  3BDC A;  1SNM A;  1XXG A;  1PZI D;  1VCI A;  3LX0 A;  4KTA A;  5BR8 Q;  1C7Y A;  3E6Z X;  3P75 A;  3CME A;  3Q23 A;  1MGS A;  3PMF A;  3U9O A;  5F2D A;  3ND9 A;  3K5M A;  1PRT C;  2WV6 D;  4IUU A;  2HIX A;  1IYV A;  2NTS A;  3HOU G;  4DXG A;  2E74 C;  1XMO L;  3QIA A;  1K3B C;  2EY1 A;  2VNU D;  4DV6 L;  1EL0 A;  3PGZ A;  4XQQ A;  3I91 A;  2QF7 A;  1SN8 A;  2E2I B;  3EIV A;  4A3M B;  2K33 A;  4A3G H;  3Q0A A;  1F2M A;  2CH4 A;  4RKB A;  4A3K B;  5FLX E;  1N33 Q;  2NVT H;  4L5T A;  3TS0 A;  4R8I A;  5JPM C;  5CGK A;  5FOB B;  2NVX B;  1Z9F A;  4L5Q A;  3T56 B;  2Z1C A;  5M5W H;  2L9H A;  2NZH A;  3G6E A;  1JWS D;  5C4H A;  1Q81 C;  5NUC A;  3MVV A;  4FP5 D;  1PH7 A;  1DON A;  1SMY C;  1Y8P B;  4OWX B;  1B44 D;  2NWG A;  2Z8L A;  3PCO B;  4C3J B;  1OXT A;  1D1K A;  5EPJ A;  2CW0 C;  4JG2 A;  1HNW L;  1XPR A;  4F87 A;  4A3M G;  1ZYR C;  5EKI A;  3HOU H;  1STN A;  4LF7 L;  4A3K G;  3PO2 B;  3GV6 A;  1HQM C;  1MIU A;  5LMN L;  2B2V C;  1PH3 A;  1V1O A;  1C9O A;  3EA6 A;  3G48 A;  3FVQ A;  4RG1 A;  3SGI A;  1E2V A;  2JP1 A;  3WWV A;  3TEH B;  1IHZ A;  2A8V A;  1X3G A;  2OF1 A;  3OIQ A;  5C5L A;  4QF4 A;  2OQK A;  3UE0 A;  4PMC A;  4DV5 Q;  2SEB D;  3K5O A;  1HZ9 A;  4JI8 Q;  1DCZ A;  3TP6 A;  2ZTE A;  2JN4 A;  4DN4 M;  5J39 A;  4PNY A;  4C3J G;  3HGB A;  2UU9 L;  2OCE A;  5IP7 G;  2JEB I;  2K04 A;  4B3T Q;  2PPB C;  4LUZ A;  5IE8 A;  1EY4 A;  1FVI A;  1E7Z A;  2BDN A;  3UDX A;  5T1I A;  1Y8N B;  2PNR C;  3I2Z A;  2CQA A;  4IPG A;  3CCE A;  3DM3 A;  4KN4 C;  4L63 B;  1D1I A;  2E2I H;  2YU9 B;  2D0P A;  4GLV B;  4A3M H; 
#chains in the Genus database with same CATH homology
 4A3K H;  3RLN A;  5FJ8 H;  2ES2 A;  2R7D A;  1A8V A;  2L15 A;  2B63 G;  1WI5 A;  1CKO A;  1J5E Q;  2ZM6 L;  4H02 A;  2R7F A;  2UXD Q;  2KHJ A;  2MO1 A;  3I4O A;  1VQK A;  3I4N H;  4RMF A;  1E22 A;  1Y14 B;  4A75 A;  4IFD J;  1VS0 A;  1G51 A;  4LW1 A;  3L2P A;  4NXM Q;  1YJW A;  1Q86 C;  1CUK A;  3HKZ G;  5LMU L;  4GLX A;  1TWC H;  5J3B A;  4LFA L;  1N34 L;  2Q2I A;  2IX0 A;  1KQS A;  2WB1 E;  1GM5 A;  2JA9 A;  2WAQ E;  3W5O A;  1VQP A;  1VQ8 A;  1Z47 A;  3CC4 A;  1XNR Q;  1JB7 A;  3PO3 G;  4R4Q A;  3K8A A;  4GNX C;  2JA5 G;  4A3B G;  2UUC L;  1TWF H;  2VS1 A;  4QGU A;  4C3J H;  3PSI A;  1HNZ L;  2CWP A;  4NXN Q;  3GTL H;  5IP7 H;  2Z6K A;  1LYL A;  4DR1 Q;  4A3J G;  1VQO A;  4JI6 L;  4OX9 Q;  4LFB L;  3TS2 A;  4AYB G;  5C4X G;  1XMQ Q;  4GKJ Q;  4YY3 Q;  3S24 A;  1VQC A;  4GKK L;  4GOP C;  1JJ2 A;  1SR3 A;  4A3D H;  1TXY A;  3JC6 6;  3HOZ G;  3HOW H;  2H5X A;  1VQN A;  4ALP A;  1A63 A;  2YYZ A;  3FKI H;  3K7U C;  2R92 H;  3S1N H;  1JMC A;  4DR4 L;  3CC2 A;  1KRT A;  4C3H H;  3S2D H;  4K0K Q;  1Q12 A;  4LF8 Q;  3KOJ A;  2XGT A;  4ME3 A;  5IYD G;  1M90 C;  2F3I A;  1VQB A;  5ELN A;  1IYJ B;  1X3F A;  3KDF A;  2PMZ E;  1FJG Q;  1BBU A;  4O2D A;  2PNH A;  4BBR G;  3GDE A;  2B63 H;  4JBM A;  1X55 A;  3KJP A;  4DV7 L;  1PH9 A;  1I94 Q;  3ER0 A;  1YI2 A;  1YJ9 A;  4C2M H;  1WCM G;  2Y0S G;  3BU2 A;  1B70 B;  4DR7 Q;  5BR8 L;  4A93 G;  1IBM L;  4UP8 A;  1N8R C;  1YIT A;  2EIF A;  4JI1 L;  1VQG A;  2CFM A;  1K3R A;  3KDF B;  4FDB A;  1R9T H;  4LF4 L;  1CKN B;  3MXN B;  4JI5 L;  4Y52 H;  1K0R A;  1U0L A;  4TVA B;  2UUB Q;  3RN5 A;  4DR5 L;  5IYB G;  3PO3 H;  3A0J A;  4IPD A;  1Q82 C;  3CW2 C;  2Q2H A;  1J6Q A;  2VL6 A;  2VW9 A;  2JA5 H;  2UXB Q;  4A3B H;  3PUX A;  4OXP A;  2UUA Q;  1PHJ A;  4PZ6 A;  5JJI A;  3CD6 A;  2YTY A;  1CSQ A;  5C4X H;  4A3J H;  1W2B A;  4X65 L;  2K75 A;  4IPH A;  1YNX A;  3CCS A;  2Q2T A;  2AKW B;  2IHF A;  2YU9 H;  1QVC A;  4JYA L;  3D31 A;  3AFQ A;  1VQH A;  1SMX A;  3ZJY C;  3HOZ H;  4MZ9 A;  4BY7 G;  2DGY A;  4EX5 A;  1WFQ A;  1LUZ A;  1SRU A;  2EQS A;  4X64 Q;  4DV3 Q;  2E2H H;  4UP7 A;  1Q1B A;  3M9B A;  3GTJ H;  1FGU A;  4LWC A;  2AHO B;  2MO0 A;  4HJ5 A;  1K83 H;  1YZ6 A;  5IYD H;  5IWA Q;  3F2C A;  4LF5 L;  1RIP A;  1WJJ A;  4L5S A;  4B3M Q;  3I56 A;  3OTO L;  4BBR H;  3KLW A;  4TQU S;  4PZ7 A;  4NB3 A;  3CXC A;  2VY3 A;  1ASZ A;  1X65 A;  2HQL A;  2HHH L;  2JE6 I;  1SE8 A;  2EXD A;  1WCM H;  1HH2 P;  4KI0 A;  3J81 c;  1DGS A;  4JC0 A;  1IBL L;  4B3S L;  4DV4 Q;  2ATW A;  2F52 A;  4A93 H;  4PMW A;  4JI0 L;  1OXS C;  1WYD A;  2AWN A;  4GS3 A;  2CWA A;  3AEV A;  2ZTD A;  1VQM A;  3CAM A;  1VQ6 A;  1Q46 A;  5C0X J;  4NPS A;  2D0O A;  5IYB H;  2ZTC A;  3ERS X;  2IHE A;  2CKZ B;  2KBN A;  4DR2 L;  3NEL A;  3T1Y Q;  3I55 A;  3T1H Q;  3JAM c;  1IBK Q;  1B7Y B;  2HT1 A;  1V9P A;  3LGJ A;  3S2H H;  2CQO A;  2K5N A;  1N36 L;  4GNX A;  2RF4 A;  4YWK A;  3CMA A;  3HKS A;  2NZO A;  1LTL A;  2PQA B;  4JBK A;  3A5Z B;  1OTC A;  4BY7 H;  2AMC B;  4DR6 Q;  1X6O A;  1X54 A;  3CCL A;  1SLJ A;  4BXX G;  5M3M G;  4YHH Q;  3U50 C;  3BJU A;  4HJ7 A;  1HR0 L;  3PV0 A;  2NVQ H;  1XPU A;  2I0Q A;  3S1M H;  4GNX B;  3L7Z C;  1QZG A;  3K0X A;  4DV5 L;  3BZK A;  3ULP A;  2K4K A;  3RLF A;  1KIX A;  4LUV A;  1Y1W G;  1YVC A;  4AH6 A;  1N32 L;  4JI4 L;  4OWW B;  2ZJR A;  5C4J H;  1VQL A;  4KHP Q;  3PUY A;  4DR3 Q;  3CPW A;  3B6Y A;  5GAG C;  1KC8 C;  4LNQ A;  3M4O H;  2DUD A;  4B3T L;  4DPG A;  3OW2 A;  3RN2 A;  2N3S A;  2LXJ A;  4B3R Q;  1EQR A;  2YV5 A;  4LFC Q;  4HID A;  4HIK A;  1Y1V G;  4P74 A;  1UE6 A;  5ELO A;  1XMO Q;  3HOV G;  2GN5 A;  3ULL A;  3NEM A;  4P71 A;  1X56 A;  3NBH B;  4DV0 L;  4DV6 Q;  4HJ8 A;  4JI3 Q;  2BH2 A;  4KHZ A;  1GD7 A;  1K73 C;  5JEA J;  4OO1 G;  4J15 A;  4DUY Q;  4LF6 Q;  3A5U A;  4LF9 Q;  3GTQ H;  3S16 H;  2V1C C;  4A3F G;  1Q8K A;  3KF6 A;  2E5L Q;  3KJO A;  3CCQ A;  5IP9 G;  1E3P A;  3HFZ B;  3HOX G;  2ALY B;  4LUO A;  3CCJ A;  1YHB A;  4QIW E;  3H15 A;  3K81 C;  1YJN A;  1J5E L;  1K8G A;  1XTD A;  3KFU A;  4GLA C;  2FXQ A;  4KLK A;  1KXL A;  2UXD L;  1C0A A;  1XPO A;  2WFW A;  4JI1 Q;  5HY6 A;  4QL5 A;  5M3M H;  4BXX H;  5K36 G;  2VZA A;  2B3G A;  4DK3 C;  4LF4 Q;  1CKN A;  1VQE A;  5JJL A;  1YBY A;  2LSS A;  5M3F G;  4NXM L;  1NTG A;  3KF6 B;  2WP8 J;  3Q8D A;  3H0G G;  1HZC A;  5IT9 c;  3E0E A;  1Q7Y C;  4UPA A;  3FHW A;  3E9H A;  2VQF L;  4DV1 L;  3M4P A;  3STB C;  1VQ9 A;  1YEZ A;  3A74 A;  3PF5 A;  4X62 Q;  3G71 A;  2K50 A;  2N78 A;  2A19 A;  3EN2 A;  1Y1W H;  3RZO H;  2HIV A;  3RR5 A;  1VQ5 A;  1SRO A;  4BY1 G;  1XNQ Q;  2K14 A;  3AYH B;  2I5H A;  1HNW Q;  2F4V Q;  4NXN L;  1JJC B;  1HJP A;  4PZ8 A;  4HIO A;  2RCN A;  1NE3 A;  4DR1 L;  4OX9 L;  1XMQ L;  1SFO H;  4GKJ L;  1PFS A;  4YY3 L;  4UY8 C;  4HJA A;  4LF7 Q;  1Y1V H;  3STB D;  5LMN W;  3HOV H;  2BA0 A;  3DLL A;  4JBJ A;  4AQY Q;  1UE1 A;  4IJH A;  3W1G A;  2MQH A;  1E1O A;  3M85 A;  3CCU A;  5LMN Q;  4JV5 Q;  3PUV A;  3F8T A;  1I50 H;  3GTG H;  4K0K L;  4LF8 L;  2QEX A;  2JEA I;  1HZA A;  3HKZ E;  3D0F A;  5GQO A;  2BH8 A;  1NMF A;  4A3F H;  1MJC A;  1YIJ A;  2Z6K C;  5DLQ E;  4IFD G;  1ASY A;  4DAY B;  5IP9 H;  1FJG L;  1EOV A;  1QUQ A;  3HOX H;  2RHQ B;  1HNX Q;  3M3Y H;  1AH9 A;  1QZH A;  1N33 L;  1I94 L;  1D7Q A;  1EQQ A;  1G6P A;  1IBL Q;  2AWO A;  4C3I H;  3GTM H;  1S72 A;  2RHS B;  2KHI A;  4JI2 Q;  3FP9 A;  1K8A C;  4DUZ Q;  4DR7 L;  1OXU A;  2QA4 A;  3TQY A;  5IYC G;  4XIG S;  4AYB E;  5M3F H;  2GVB A;  2UU9 Q;  4P75 A;  2MNA A;  4A3C G;  3H0G H;  1N9W A;  3TRZ A;  5JJK A;  3J80 i;  2IY5 B;  1QUQ B;  1GKH A;  2UUB L;  1AE2 A;  1PV4 A;  2ZJQ A;  2BA1 A;  2K5H A;  2VQE Q;  1BBW A;  4R4I A;  4UP9 A;  5C3E G;  3PF4 A;  1PH8 A;  2UXB L;  1PH2 A;  3CP0 A;  4A3I G;  2PI2 E;  2UUA L;  4WJ4 A;  2WB1 G;  5GRO A;  2WAQ G;  4BY1 H;  3ICE A;  1GVP A;  3CCR A;  2PQA A;  1E24 A;  2E2J H;  2I5M X;  3UDG A;  4HJ9 A;  1P16 A;  2IX1 A;  3GTP H;  2ASB A;  4A3L G;  3NEN A;  2JA6 G;  1I5F A;  3PUW A;  2KCT A;  3CQZ H;  2Y0S E;  4X64 L;  4DV3 L;  2NN6 G;  1X9N A;  1WOC A;  4OON A;  4WJ3 M;  1TWG H;  4YWM A;  2ZM6 Q;  2JQO A;  4R4C A;  3CCV A;  3KYH C;  5M5Y H;  2B29 A;  3G4S A;  3S14 H;  4YCW A;  4JI7 L;  3S1R H;  5IWA L;  3I7F A;  1EFW A;  4YCV A;  3CPF A;  4B3M L;  2JJQ A;  5LMU Q;  3J7A 5;  4MTN A;  1T9H A;  4GOP A;  3M4Q A;  2UXC Q;  4DV2 L;  3CC7 A;  1A0I A;  4LFA Q;  1N34 Q;  3U4V A;  1KD1 C;  4A3E G;  3RLO A;  1L1O C;  1E1T A;  2GVA A;  2IT1 A;  2K52 A;  1YHQ A;  1PA6 A;  2ZJP A;  4A4I A;  3S1Q H;  3AQQ A;  2UUC Q;  5IYC H;  1B8A A;  4DKA C;  3PO2 G;  4JI8 L;  2I5L X;  1HNZ Q;  4IO9 A;  1O7I A;  1X3E A;  4JI6 Q;  4A3C H;  4DAM A;  4BA2 I;  4LFB Q;  4A76 A;  3UDI A;  4QQB X;  4X66 L;  1VQ4 A;  4GOP B;  4O0A A;  2YTV A;  4GKK Q;  1JJG A;  1KL9 A;  1KRS A;  2Z0S A;  3F1Z A;  4IJL A;  5C3E H;  3BZC A;  1L0W A;  4AIM A;  1MJE A;  5AJ3 L;  4A3G G;  2N8N A;  3T1Y L;  3H3V H;  2KCM A;  4A3I H;  3T1H L;  4XTC S;  1K9M C;  1IBK L;  4JOI C;  4DK6 C;  4DR4 Q;  1PH6 A;  2NVX H;  1NMG A;  1M1K C;  3KF8 B;  5E7N A;  4YWL A;  3GD7 A;  3S15 H;  5GAH C;  1VQ7 A;  3CCM A;  4A3L H;  1I3Q H;  1AE3 A;  2E8G A;  3K7A H;  1PH4 A;  2JA6 H;  4DR6 L;  4DV7 Q;  1JE5 A;  4YHH L;  1TWH H;  2NVY H;  1CSP A;  1OXX K;  1VQI A;  2YTX A;  2C35 B;  2N49 A;  5C44 G;  1G29 1;  4P73 A;  1VCI A;  3J81 j;  2VQF Q;  1NBW A;  4BA1 I;  4DV1 Q;  3M7N A;  4IFD I;  5EAY A;  4JCV E;  1P8L A;  5BR8 Q;  1C7Y A;  4L5R C;  1UE7 A;  1IBM Q;  3CME A;  4IOC A;  5IY0 A;  1EYG A;  1VQJ A;  5M5X H;  3RZD H;  3U58 A;  5GAE C;  4JI5 Q;  4POG A;  3E9I A;  5C0X G;  3I4M G;  4DR5 Q;  2JA8 G;  4A3E H;  1PVO A;  4KHP L;  4DR3 L;  2HIX A;  1HZB A;  1PH1 A;  2JK8 A;  2OTL A;  3GTK H;  3HOU G;  4B3R L;  1TWA H;  1XNR L;  4QY7 A;  4LFC L;  3PO2 H;  3CF5 A;  1XMO L;  2R7Z H;  2VNU D;  4X65 Q;  3W1B A;  1BVS A;  3J7Z C;  4JYA Q;  4DV6 L;  4BBS G;  4JI3 L;  3ULJ A;  3PGZ A;  3AFP A;  1BKB A;  1SN8 A;  3EIV A;  1KHI A;  4DUY L;  4A3G H;  3GO5 A;  3H3V I;  4APV A;  5FLM G;  4POF A;  4LF6 L;  4LF9 L;  4IOA A;  4PG3 A;  2MFI A;  2LXK A;  1N33 Q;  1FL0 A;  2E5L L;  2NVT H;  1IXR A;  4L5T A;  1NJI C;  5FLX c;  3TS0 A;  4OWT B;  1YHA A;  3U4Z A;  4LF5 Q;  4P72 A;  5H1S E;  1UE5 A;  1Z9F A;  4L5Q A;  3OTO Q;  3HOY G;  1PYB A;  3IRB A;  1EIY B;  2NN6 I;  4GN5 A;  5M5W H;  2NZH A;  2JA7 G;  1RL2 A;  3G6E A;  4DNI A;  5C44 H;  1VQF A;  1Q81 C;  2HHH Q;  1W3S A;  4B3S Q;  1PH7 A;  3F2D A;  1S3O A;  2R6G A;  4JI0 Q;  4OWX B;  2VUM G;  4X62 L;  2R93 G;  1MKH A;  3PCO B;  4YCU A;  5GAD C;  3EBE A;  2Q2U A;  3I4M H;  1EWI A;  1OXT A;  2JA8 H;  1PH5 A;  1D8L A;  4JG2 A;  4MNO A;  5JEA G;  3J81 i;  1XNQ L;  1XPR A;  2F4V L;  1HNW L;  2K5V A;  3K80 C;  2D62 A;  2KEN A;  4GN3 B;  4DR2 Q;  3VDY A;  4A3M G;  2OWO A;  3HOU H;  1IZ6 A;  1QVG A;  4LF7 L;  4A3K G;  4EQ5 A;  3F2B A;  5FJ8 G;  1L1O A;  1NY4 A;  1N36 Q;  1MIU A;  1UWV A;  4AQY L;  5LMN L;  4BBS H;  1PH3 A;  5HGQ A;  1C9O A;  3G48 A;  3TRE A;  4JI7 Q;  4JV5 L;  4RG1 A;  3SGI A;  1V43 A;  1OXV A;  1GO3 E;  3OYY A;  3WWV A;  3TEH B;  3I4N G;  1HR0 W;  5FLM H;  2UXC L;  3PIP A;  3RNU A;  1I6H H;  2A8V A;  3JAM i;  1X3G A;  4DV2 Q;  1HR0 Q;  2CCZ A;  2XTI A;  3PIO A;  1H95 A;  3J80 c;  1EIF A;  1L1O B;  4GN4 B;  2OQK A;  3UE0 A;  1HNX L;  1IL2 A;  1JT8 A;  4OO1 I;  4Y7N H;  3L0O A;  4DV5 Q;  4JOI A;  4QJF A;  4R4T A;  1QVF A;  2A1A A;  1HZ9 A;  3GTO H;  1UEB A;  4JI2 L;  3HOY H;  4JI8 Q;  1Q1E A;  2JA7 H;  1L2F A;  4DUZ L;  4HIM A;  2OTJ A;  1VQD A;  2ZTE A;  4IPC A;  3UE1 A;  4JI4 Q;  1N32 Q;  1XJV A;  4X66 Q;  4R4O A;  1VQA A;  2OCE A;  2UU9 L;  1EUJ A;  5IP7 G;  2JEB I;  3UDF A;  2ID0 A;  4B3T Q;  1CKM A;  4R1J A;  4LUZ A;  1A62 A;  5IE8 A;  5AJ3 Q;  1FVI A;  2VUM H;  1E7Z A;  4A3D G;  3UDX A;  3PUZ A;  4DV4 L;  1KAW A;  1LM0 A;  2VQE L;  2R93 H;  3HOW G;  1V1Q A;  2OQ0 A;  3I2Z A;  4DV0 Q;  5C0X I;  1S40 A;  3FKI G;  2R7Z G;  4IPG A;  3CCE A;  1U5K A;  2PI2 A;  4X6A H;  2R92 G;  3DM3 A;  2E2I H;  3S17 H;  1PYS B;  2D0P A;  4GLV B;  4JBW A;  4A3M H;  3MEF A;  2QGQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...