2CQOA

Solution structure of the s1 rna binding domain of human hypothetical protein flj11067
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
119
structure length
119
Chain Sequence
GSSGSSGMNSGRPETMENLPALYTIFQGEVAMVTDYGAFIKIPGCRKQGLVHRTHMSSCRVDKPSEIVDVGDKVWVKLIGREMKNDRIKVSLSMKVVNQGTGKDLDPNNVIIESGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords Nucleolar protein of 40 kDa
publication title Solution structure of the S1 RNA binding domain of human hypothetical protein FLJ11067
rcsb
source organism Homo sapiens
total genus 12
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2005-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00575 S1 S1 RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2cqoA01
4JBWA 1MJEA 1TWAH 1N34Q 3CCLA 4A3KH 1JE5A 4DR6Q 1NBWA 2OCEA 2JEBI 2NVQH 3PF5A 4X6AH 1A0IA 4JV5Q 2HT1A 4A3FH 1OXVA 3A0JA 4NXNL 3KJOA 1LM0A 1GVPA 4LF7L 1J5EQ 3M85A 4OXPA 1SRUA 1QVCA 3CMAA 2JQOA 1PHJA 2E5LQ 4GLAC 3T1HQ 4BY7H 4IO9A 1IL2A 2JA6H 3PUWA 2R92G 5IYDH 3K7UC 4IPHA 4ALPA 3JC66 4GLXA 2UXDQ 4OWXB 4AYBE 1GO3E 1BBWA 1JJ2A 4GS3A 2C35B 4DV0Q 3K8AA 4A3MH 1EQRA 1L0WA 3TEHB 3VDYA 3EBEA 3F2CA 3H3VH 2PMZE 3PO2G 3M4OH 5IWAQ 3OYYA 1BVSA 4H02A 1QUQB 5E7NA 1VQ9A 3BZKA 2UUBL 2UXBQ 5IYBH 3CCQA 5GAEC 4A3JH 1XMOL 4DV7L 1PV4A 3FKIH 3KF8B 2E2IH 1G6PA 1Q8KA 3G48A 4LWCA 1QUQA 1X55A 3IRBA 2MNAA 3CC7A 1VQGA 1I94L 1I3QH 1N9WA 1OXXK 4DR2Q 5M5XH 4GKJL 4TVAB 3NENA 1Q86C 3RN2A 1HNWL 4TQUS 4X65L 1HR0W 2YTYA 4A93H 1SMXA 5HY6A 3UE0A 3HKZG 1N36Q 3L2PA 1VQAA 4DR1L 1Q81C 1FGUA 2VL6A 2N3SA 4A3KG 2JA5H 3S2HH 2I5MX 1PH1A 2Q2HA 1NJIC 4BBRH 3I4OA 1VQKA 4GN5A 1B7YB 3PUXA 3HOUH 1PFSA 2R6GA 5JJKA 1X65A 2ZM6Q 3CC2A 1SE8A 3PGZA 1K83H 3MXNB 4AYBG 4DV3L 1VQ5A 3I2ZA 2PI2E 4IPGA 1IXRA 4NXNQ 1N33L 3WWVA 4QGUA 2JA6G 4PZ6A 1KQSA 2NZHA 1D8LA 1OXSC 3J7A5 5LMNL 4K0KQ 3KFUA 1FL0A 4DUYL 4KHPL 2KCMA 2WFWA 5JEAG 2UXCQ 2R93H 1KHIA 4IOAA 3H15A 2UXCL 4LFCQ 2R7DA 2ZTEA 3HOZG 2MQHA 1N34L 1XPOA 1E7ZA 2N8NA 1K8AC 3HOWG 2H5XA 1HH2P 5FJ8H 1TWGH 4MZ9A 5AJ3Q 1YIJA 2Q2UA 4JI3Q 1VQDA 4JV5L 3AQQA 5IYBG 4UP7A 1Q7YC 2K5NA 4A3JG 3NBHB 3JAMc 3J81c 3I4MG 1RL2A 2K4KA 2NZOA 4RMFA 4KLKA 4XTCS 1A63A 4LUZA 3PUZA 5IYCH 2E5LL 4B3TL 2YU9H 4MNOA 2RF4A 4YWMA 1XMOQ 2EQSA 5C3EH 3CPFA 2BA1A 3S1MH 2CQOA 1XJVA 1NY4A 1UE7A 5IP9G 5C44H 1G51A 1ASYA 4R4IA 4POFA 3S1QH 1EFWA 5GADC 4C3HH 4JBKA 3AYHB 4DV0L 2HIXA 2AWNA 2B63H 2R7ZH 4HJ8A 3CCRA 2ZJPA 4C3IH 1PH8A 1Z47A 1PYBA 1HNWQ 1WYDA 5IWAL 4X65Q 1WI5A 2QA4A 2UUAQ 1OXUA 4DAYB 2PNHA 1E1TA 4HIDA 5EAYA 4R4OA 4JI1L 1U5KA 3S17H 1Q12A 4DR4L 3S1NH 2RHQB 3J80c 1WOCA 1K3RA 1VQFA 3RLNA 1MIUA 4APVA 1L1OC 1QZHA 1Q82C 2WB1G 4LF8Q 4WJ3M 4PZ7A 1PA6A 1X54A 1IYJB 3KF6B 2DUDA 5IT9c 1N8RC 5IE8A 5IP7H 5K36G 2VS1A 1CKNB 2Y0SE 4OX9Q 3ZJYC 5JJLA 3BU2A 4X66Q 4DV5L 3W1BA 4JI7Q 3KF6A 2F4VQ 4A3GG 4R4CA 4P75A 2WAQG 3GTQH 4BA2I 1CKNA 3ULLA 2JA8H 1PH5A 4QIWE 5C0XI 3J81j 1T9HA 3W5OA 2K75A 3ULPA 3G71A 1KL9A 4A75A 2GVBA 4NB3A 3E0EA 2ZM6L 2UU9Q 4PG3A 1EWIA 2BH8A 1HZCA 5IYCG 1NMFA 1LYLA 3H0GH 3M9BA 5C3EG 1YITA 2Q2TA 4YWLA 4UY8C 3I56A 4AIMA 5C44G 2ES2A 3T1YL 3U58A 4A3CG 4K0KL 1L2FA 1V9PA 4B3TQ 1EIFA 3OW2A 4BBSH 2N78A 1BKBA 2JEAI 3CQZH 4LFCL 3HOYH 2JJQA 4HIMA 1YHAA 3U4VA 2RHSB 1ASZA 4JBMA 3GTGH 5AJ3L 4A3DG 4LNQA 4JI3L 4DR7Q 4IFDG 3E9HA 1VS0A 1PYSB 1B70B 2F3IA 4L5SA 2VUMH 3PUVA 5C4XG 2NN6G 5M3MG 4AQYL 1Y1WG 4Y7NH 4O2DA 1A8VA 1MKHA 4UPAA 1XPRA 4YCWA 4JI1Q 4JI6Q 4DR4Q 4R1JA 4HJ9A 1VQ8A 4DAMA 3K81C 4JOIC 1Y1VH 4OONA 1Q1BA 1YBYA 4JI5Q 2NVYH 3RZDH 2NVTH 3HOVH 2CWAA 1I5FA 4KI0A 4DV4Q 4RG1A 4IJLA 4P74A 3F2DA 4DV6Q 4QQBX 5GQOA 4DR6L 4LFBQ 1LUZA 4HJ7A 1HNZQ 2UUAL 1VQHA 3GTPH 4DV5Q 1A62A 1J6QA 1WJJA 4IJHA 3MEFA 5GAGC 4AH6A 1GKHA 3FP9A 4HJ5A 5BR8Q 3ICEA 4IFDI 4JI4Q 1K9MC 2K5VA 4A3BH 1VQLA 3TS2A 4DUZQ 4A3FG 2HHHQ 1UE5A 3H0GG 4DKAC 4LF8L 2RCNA 2JA7H 1VQ7A 1YHBA 2NN6I 4QJFA 1KC8C 3S16H 4JG2A 2OQKA 2IY5B 4YCVA 4JI2L 1FVIA 1VQMA 4OX9L 4A3EH 2ASBA 4BY7G 4BBSG 5IYDG 3EIVA 4X66L 2ZJQA 1X56A 4JI7L 3I4NH 3W1GA 1M90C 4UP9A 2VZAA 3T1YQ 1JJCB 2A19A 3CCEA 4LF9Q 2WP8J 1YJNA 2F4VL 3S2DH 4BXXH 3F8TA 3TQYA 4A3MG 3K0XA 3TS0A 3A74A 2LSSA 2Z6KC 5LMNW 2K5HA 4BA1I 4DV2L 1LTLA 2VY3A 2CKZB 1GM5A 2UU9L 3UDXA 3GTLH 2Q2IA 1E22A 4GNXC 3SGIA 4LF6L 1M1KC 1SN8A 2EIFA 2MO1A 1S3OA 1SR3A 1L1OB 4LF5Q 1VQOA 1UE6A 4IPCA 3FKIG 1Y1VG 4AQYQ 1DGSA 4A3IH 3E9IA 4A3LH 1TXYA 1XMQQ 3L7ZC 4BY1H 1L1OA 3CAMA 3HFZB 2JE6I 3S14H 1FJGQ 1KD1C 4DR5Q 1W2BA 1D7QA 1C9OA 1WCMH 4HIOA 3STBD 2AKWB 1KRSA 5J3BA 3G4SA 1UEBA 4IOCA 4DR7L 4A93G 1K8GA 3K7AH 2NVXH 3AFPA 1JB7A 3PV0A 3PF4A 2JA5G 1IZ6A 1QVFA 1VQBA 1AE2A 3CXCA 2JA9A 4A3BG 2BA0A 4BBRG 1K0RA 1GD7A 2ZTDA 1E1OA 3H3VI 4GN4B 3PIOA 1HZAA 3GDEA 3HOUG 4JI6L 2VQEL 1CKOA 2PI2A 1PH2A 2VNUD 2OTLA 3I7FA 4X64L 3PO3G 3TRZA 1PH7A 1XNQQ 1R9TH 4A76A 3CD6A 1AE3A 3RNUA 4R4TA 4LFAQ 4JI5L 1SFOH 2V1CC 1CUKA 3D0FA 2KENA 4LW1A 4DV4L 5ELNA 4JI2Q 4DV6L 3AFQA 4LFBL 1HNZL 4DV1L 4P71A 4L5QA 2R93G 2A1AA 1IBLL 1YI2A 4LUVA 4DNIA 3AEVA 2IHFA 5BR8L 3RLFA 5FJ8G 1P16A 4JI4L 4B3RL 1TWHH 3CMEA 1HJPA 3PO2H 4HIKA 1PH3A 1CKMA 3STBC 1OXTA 4DUZL 2D0PA 4GN3B 4EX5A 3GTMH 4JBJA 3TREA 4DV2Q 1MJCA 5C4JH 4R4QA 3RR5A 4LF6Q 5JJIA 4IPDA 3HOXH 3S24A 3K80C 3G6EA 4A3IG 3PSIA 2CFMA 1VQCA 3S15H 4JI8Q 1VQNA 3M3YH 2K14A 2OQ0A 2CCZA 2N49A 2E2HH 1P8LA 4JOIA 4LF9L 1NE3A 3CCMA 1BBUA 3JAMi 4YHHL 1VQIA 4GOPC 3J81i 2ZTCA 1S72A 1K73C 1OTCA 2B63G 4YCUA 2R7ZG 3CF5A 3OTOQ 1VQPA 4POGA 1JJGA 4P72A 1PH9A 1PH4A 4LF5L 1JT8A 4DR3L 1HNXQ 3M7NA 2ZJRA 1PVOA 2Y0SG 3HKZE 1SLJA 2EXDA 1Q46A 2CWPA 2ALYB 3CCJA 4MTNA 2L15A 1XMQL 2LXKA 1B8AA 2JK8A 1HZBA 2VQEQ 1VQ4A 1EQQA 5C0XJ 1CSQA 3A5UA 2AMCB 2K52A 1FJGL 3DLLA 4X64Q 4DR5L 3UDGA 5IP7G 4JYAQ 4DPGA 3L0OA 2UUCQ 5M5WH 3I55A 3CP0A 1O7IA 2E8GA 3BJUA 1UE1A 4NXMQ 3CCUA 2DGYA 3J80i 2Z0SA 2KHJA 4DV1Q 4GNXB 4X62L 3HOZH 2JA8G 1IBLQ 4JC0A 4A4IA 4JI0Q 3HOWH 2GVAA 4GKKQ 1EUJA 2Z6KA 2K50A 1YZ6A 2AWOA 3PO3H 4B3RQ 1E24A 1C0AA 4XIGS 3HOXG 4GNXA 1YEZA 3KYHC 1XNQL 2F52A 2YTXA 3I4MH 2D0OA 4LFAL 1XTDA 4PZ8A 5DLQE 4JCVE 3PIPA 1NTGA 2D62A 5M3FH 1HR0L 2IT1A 2A8VA 3CCVA 2HQLA 4YY3L 2B29A 1KRTA 5IP9H 1KAWA 2QEXA 1X3EA 2GN5A 3HOYG 4OO1G 1XNRL 4B3SQ 2VQFQ 2AHOB 2IHEA 3FHWA 5LMUQ 4B3ML 1N32Q 3UE1A 4YHHQ 1IBMQ 5FLMH 3KDFB 1G291 4LF4L 1X6OA 4L5TA 1Y14B 1YNXA 5GROA 4C3JH 5HGQA 1X9NA 2VUMG 4C2MH 3GTJH 3F1ZA 2FXQA 2QGQA 3KDFA 4DR3Q 4JI8L 1KIXA 1KXLA 5H1SE 1IBKL 1YJWA 3PCOB 1VCIA 2PQAB 4IFDJ 1E3PA 4LF7Q 1VQEA 1I6HH 1Q1EA 3HOVG 2MO0A 1S40A 3U4ZA 2E2JH 1WFQA 3F2BA 4YWKA 4O0AA 2KHIA 2PQAA 3GD7A 3OTOL 3DM3A 3M4PA 3B6YA 2WB1E 1U0LA 3S1RH 4OO1I 3ERSX 4L5RC 4A3GH 1YJ9A 4ME3A 3J7ZC 4FDBA 1CSPA 3A5ZB 1V43A 3CCSA 2OTJA 5ELOA 4Y52H 1HNXL 3ER0A 4X62Q 4WJ4A 1YVCA 2I0QA 2HHHL 2UXBL 3CPWA 1PH6A 1J5EL 3UDFA 3ULJA 3Q8DA 2XTIA 3PUYA 2UUBQ 2R7FA 2JA7G 2WAQE 1Z9FA 1X3GA 1VQJA 4GLVB 5M3FG 2KCTA 1I50H 5M5YH 4HJAA 3RN5A 4DV7Q 3T1HL 4JYAL 2UUCL 4A3EG 1JMCA 4GOPB 4A3CH 4NXML 2UXDL 3I4NG 3CW2C 3BZCA 1HR0Q 1VQ6A 1I94Q 2OWOA 4BXXG 4DK6C 4EQ5A 2R92H 2I5HA 3LGJA 4YY3Q 4LUOA 3GTOH 4GKJQ 2BH2A 1X3FA 2XGTA 5FLMG 4GOPA 1TWCH 1TWFH 5C0XG 4JI0L 1EIYB 4QL5A 4UP8A 2YYZA 4GKKL 3NEMA 4DK3C 3HKSA 1XNRQ 1YHQA 2I5LX 2LXJA 4A3DH 1W3SA 3NELA 4OWTB 4B3MQ 4DR1Q 3GTKH 1SROA 4P73A 3U50C 2VW9A 3KOJA 1EOVA 4LF4Q 1QVGA 5C4XH 1RIPA 5M3MH 2YV5A 2KBNA 3KLWA 5JEAJ 1Y1WH 4J15A 2HIVA 3GO5A 3CC4A 3RLOA 4A3LG 4BY1G 4DR2L 4PMWA 2ATWA 5GAHC 1UWVA 4DV3Q 1IBKQ 1N33Q 2IX0A 4QY7A 2IX1A 1AH9A 1H95A 4B3SL 3EN2A 2VQFL 1WCMG 3D31A 3M4QA 4KHZA 1N36L 1V1QA 2MFIA 1HZ9A 5IY0A 5LMUL 2B3GA 1QZGA 1XPUA 1IBML 1N32L 5LMNQ 4DUYQ 4KHPQ 3UDIA 4OWWB 5FLXc 3KJPA 2ID0A 4NPSA 1C7YA 1EYGA 2YTVA 3RZOH 1NMGA
chains in the Genus database with same CATH superfamily
1MJEA 1H9SB 3WOEA 4DR6Q 1LTRD 1IKLA 2OCEA 4IUQA 2JEBI 3S1NB 1BUVT 2KEDA 4X6AH 4DK1A 1EZ8A 3FVQA 2HT1A 1LM0A 1EFID 2B2VA 1J5EQ 3M85A 2KUMA 2E76C 2Q8RE 1SRUA 1QVCA 1NR2A 2JQOA 5EPLA 2PO4A 2E5LQ 3T1HQ 3K58A 4HCEA 4FO2A 4IPHA 1GHKA 4GLXA 4RWSC 3O13A 1NR4A 3SK8A 1DOMA 3MAQA 2F0DA 3PO2G 3L3OC 3EBEA 3R93A 1BVSA 2UXBQ 1QUQB 2UUBL 3BZKA 5G3LD 4A3JH 1PV4A 4F8MA 1G6PA 1Q8KA 2K05A 1PTOF 5DAUA 5LL6X 1ILPA 4KKSA 2OT2A 2XWBB 3RN2A 4L8JA 3DEOA 2F0LA 1HR0W 3I8ZA 1U4RA 2DJFC 3UE0A 3L2PA 2K7VA 5D3DA 1NJIC 4K6DA 4L63B 1VQKA 4Y7NB 1NNXA 1ET9A 2VXWA 3PGZA 3PO3H 3I2ZA 2PI2E 1IXRA 4QGUA 4PZ6A 3QOLA 5EPJA 2K33A 1FL0A 5T1GA 2KCMA 2WFWA 3NTHA 4K2KA 4IOAA 3Q0AA 1F2LA 1XTCD 4DR6L 3HOWG 3K0YA 5FJ8H 4MZ9A 3FPPA 5IYBG 2MP1A 5KNCA 1Q7YC 3NBHB 5IODA 3J81c 4ZYSA 1RL2A 4XTCS 3PUZA 2DN8A 5I6WA 2E5LL 3C1FA 4YWMA 1A3UA 5C3EH 2BA1A 3I4NB 4LAAA 1UE7A 4R4IA 4POFA 1O7ZA 1EFWA 4C3HH 3CCRA 2ZJPA 1A15A 1PYBA 1HNWQ 5KNDA 3GTLB 1FNVA 4C3JG 4DAYB 5EKIA 1Q12A 4WRDA 4K5WA 4DU9A 4BY1B 4X3KA 3VA7A 2IWHA 4ZKCB 4G4KA 2HUGA 3D4RA 1GUWA 2L55A 1IYJB 5IT9c 1N8RC 5IP7H 2Y0SE 5JJLA 1D1IA 2Z4IA 3BU2A 1K8MA 4X66Q 3DXJC 2EYMA 3W1BA 1H9RA 5I9PA 1EY8A 2JA8H 1JWSD 3OPOA 2VB2X 1EYAA 1EIGA 5AFWA 1KL9A 2UU9Q 1BCPB 2BH8A 3ITPA 1AP0A 3SXHA 3M9BA 3CKIB 4UDUC 5L37A 3I56A 1JICA 4AIMA 5C44G 4A3CG 5JJZA 1V9PA 5KIXA 5CORA 4RKLA 5DM63 1TWCB 2K32A 3EJIA 3CQZH 1QWYA 4HIMA 1MSHA 1TWHB 4LNQA 4KMUC 3KLRA 2EY6A 5JVH3 2SNMA 1B70B 5EKKA 2VUMH 2EE1A 1U4MA 2PZUA 3X3NA 2NN6G 5M3MG 4AQYL 1O80A 4JI1Q 2ICIA 3K81C 5CV6A 3PMFA 2B2TC 4OONA 1YBYA 2NVYH 3IL8A 2F0WA 3KLSX 3OOCA 5KEEA 4DV4Q 1WTPA 4IJLA 4P74A 4DV6Q 4QQBX 3HKZB 1LUZA 4OIKA 1TWAB 5C5LA 1A62A 2NVQB 3FP9A 3CRKC 4RGOS 5FOBB 3TS2A 3H0GG 1ENFA 2RCNA 1YHBA 4RH6A 3OWEB 1KC8C 3S16H 2IY5B 4CKEA 4JI2L 1FVIA 1HA5A 2ASBA 2J0TD 1JQYD 4BY7G 2RDGA 3I73A 4X66L 1I4HA 3A8JE 3W1GA 1M90C 4UP9A 1JJCB 3CCEA 4LF9Q 5ELFA 2EXZA 1ESRA 1CT1D 2Z6BA 5LMNW 2K5HA 1B3QA 1GM5A 2VY3A 2UU9L 1HTPA 1HCZA 1I4RA 2K5DA 3SGIA 5FLXE 4GNXC 1SN8A 1IL8A 3C1EA 1Y1VG 1DGSA 2EVBA 3E9IA 1XMQQ 1NAPA 1L1OA 3HFZB 1JOQA 1KNEA 1LABA 3NP8A 3D6CA 1S4ZA 1KD1C 4BS9A 1B3AA 1DYQA 4G7HC 1WCMH 1KRSA 2F0PA 5J3BA 4A93G 1RTNA 1IZ6A 1VQBA 4KKUA 1AE2A 1R4QB 1VF7A 4A3BG 2BA0A 1A3TA 3A8IE 4KJNA 3HOUG 1AZPA 1LT3D 2OTLA 3I7FA 2SEBD 1SE2A 1I6HB 1R9TH 3CD6A 1FNUA 1SFOH 2KECA 2RCFA 5IGEA 4DV4L 2B2UA 2IX3A 4ZUJA 2A6HD 4DV6L 3AFQA 1BNZA 4DV1L 4XYOA 4A3GB 1HPCA 2XRSD 2A1AA 4DNIA 1CA6A 4KY7A 4KKTA 3TSSA 1CKMA 2D0PA 3TREA 4DV2Q 3BS1A 3SEBA 1HQMC 5M5YB 2B2WA 3K80C 3G6EA 1VQCA 3S15H 2PZWA 1LTGD 2OQ0A 2MPMA 2N49A 1P8LA 4JOIA 4LF9L 5J22A 3D3RA 4YHHL 2ZTCA 2B63G 3K6OA 4C3IG 3OTOQ 4A3DB 1AW7A 4BWGB 1JJGA 2BDOA 1PH9A 1KDBA 3SR1A 2JSOA 1PH4A 2RA4A 3ONAB 3PIO3 5C4XB 4B9WA 2RSNA 1GUSA 1Q46A 4MTNA 1XMQL 5LHY1 1CK1A 2G9DA 2K52A 2CW0D 4C56C 1F2YA 4DPGA 3L0OA 1D5XC 1QCBD 1S5DD 4K8IA 2Z0SA 5IGBA 2KHJA 3HOZH 1IBLQ 4H0LC 2PZTA 2GVAA 3IKJA 2K50A 1YZ6A 4B3RQ 4XT3B 1E24A 4XIGS 1VMPA 1B1ZA 4MTKA 5ELBA 3NUCA 5ELCA 4JCVE 4BBSB 5EBDA 2EYLA 2IT1A 2A8VA 3CCVA 2HQLA 1H9MA 3NSWA 3KLSA 1F9QA 3GTGB 3WDNA 4OO1G 5KGUA 1XNRL 5KNBA 3FHWA 2CW0C 3MEHA 3GP7A 3LWEA 1G291 1GUGA 4KJOA 1Y14B 3U9OA 4C2MH 1PRTD 3KDFA 4DR3Q 1KIXA 3FDTA 3MA2B 1YJWA 1VCIA 1E3PA 1RODA 2MO0A 3MVVA 4HTHA 2CH4A 1WFQA 3F2BA 4YWKA 3NE5B 3OTOL 1JE4A 2D2CC 1PXUA 3A5ZB 3DMUA 4ID6A 3ER0A 4X62Q 4WJ4A 5FK9C 3CPWA 2LY7A 3HG9A 3PUYA 1CHQD 4X3TA 1STNA 3PO3B 5M3FG 2KCTA 3RN5A 4DV7Q 4A3EG 1JMCA 1PRTC 3ZYYX 2E74C 4ZKBB 3BZCA 4BXXG 1I94Q 3QWNA 4DK6C 3GTOH 2I5HA 4YY3Q 4GKJQ 1X3FA 5FLMG 4GOPA 1TWCH 2PQEA 1B2TA 5IT9L 4ZLTF 3NELA 2EJFC 4P73A 2HDMA 1QVGA 1SYDA 2FFKB 4CJ2C 1RIPA 4A3IB 2KBNA 1V1PA 5FO9B 4IUVA 2QF7A 3RLOA 3S14B 2PNRC 3BVMA 4RGNA 4DV3Q 2XVSA 1IBKQ 1N33Q 4QY7A 1LTID 2IX1A 4C3HB 3EN2A 2NVXB 1V1QA 4N8FA 1B53A 1RJTA 1EYDA 3H09A 3UDIA 4OWWB 4G57A 5FLXc 4NPSA 4ZUIA 1EYGA 1TWAH 3CCLA 1JE5A 3BDLA 2F0EA 1LT5D 1Q8IA 2NVQH 3PF5A 2FINB 2R61A 1OXVA 3A0JA 1H9SA 1TQOA 3Q23A 1TT2A 2G9HD 2R92G 5IYDH 1ILQA 2SOBA 3JC66 2UXDQ 4OWXB 1GO3E 5JEAH 1JJ2A 2JA8B 4GS3A 1STHA 4DV0Q 4ILWA 4ZK9B 3RMHA 3TEHB 3VDYA 1F9SA 4XYQA 1AH9A 2PMZE 3OYYA 5CR3A 1WD0A 3CCQA 1B4OA 2AQ2B 1XMOL 3M3YB 4DV7L 3KF8B 3G48A 4LWCA 1QUQA 1X55A 3CC7A 4FYDA 3GV6A 1VQGA 4N9TA 1I94L 1JC7A 1N9WA 4GKJL 1FR3A 1EY7A 1SEBD 4H13C 2YTYA 3E6ZX 2EYFA 2WIIB 1Q81C 1D1KA 2VL6A 5TSSA 2JA5H 2VUMB 3S2HH 4X3SA 2FMCA 4RKBA 3CRLC 1B7YB 1PFSA 2R6GA 1QB5D 2IW3A 5JJKA 1X65A 3BYYB 1K83H 4AYBG 4DV3L 1N33L 4IPGA 3BDOA 5M5WB 2NVYB 3WWVA 4CDFC 1KQSA 2NZHA 1D8LA 1AFPA 1IHZA 2R93H 2A74C 3H15A 3DM1A 3VR5A 2EZVA 2N8NA 1B50A 1HH2P 4IALA 1TWGH 5I2YA 2EYHA 1VQDA 2ENBA 3K5OA 2TMPA 3BYTB 4UP7A 4A3JG 5C3XA 4F7XA 3FPUB 3S16B 2K4KA 3EA6A 4KLKA 4HEDA 4LUZA 1E2WA 4MNOA 3NBHA 3L9AX 4UAIA 3CPFA 1XJVA 1NY4A 3G6JB 3MWYW 1S5BD 2Z4HA 3D4WA 4JBKA 3J80L 4DV0L 2AWNA 5IOCA 1UUPA 3J7YW 3H94A 2AQ3B 1TS2A 1Q90A 5I4DA 3H3VC 3SK5A 3FRPB 1E1TA 2A69D 4R4OA 2F0UA 3S17H 1GJXA 4DR4L 4XXEA 1JWUD 3TP7A 3RLNA 2CQAA 1MIUA 1WTRA 1QZHA 4DAYA 2WB1G 4K5VA 4LF8Q 4FVMA 2E2JB 1PA6A 3KF6B 1WCMB 5IE8A 2F4IA 5K36G 2VS1A 2DY8A 3HGBA 1EQVA 2F4VQ 4R4CA 4MN3A 4P75A 2WAQG 2HDLA 1PH5A 4QIWE 5C0XI 4I65A 1T9HA 3W5OA 2K75A 4A75A 3HEJA 1I50B 3NWTA 4DXGA 2QCPX 1R9TB 1LYLA 1SFOB 5C3EG 1JCKB 4K2LA 4UY8C 1J8IA 1QG7A 2ES2A 3SDZA 1G6ZA 1PTOD 4PMBA 1KNAA 3OW2A 4BBSH 4MHEA 1TWFB 1LO5D 2RVLA 1WTXA 3HOYH 1YHAA 3GTGH 1A2UA 4IFDG 3E9HA 3CU7A 1Z6HA 4R8NA 3R2IA 3S15B 1Y1WG 4JI6Q 3TBIB 1XPRA 2F0IA 4R1JA 4N9PA 4OEMB 4HJ9A 1VQ8A 3OIQA 1U4LA 3HOVH 4OIJA 2CWAA 4RCOA 1I5FA 1A3VA 3M4YA 2M00A 4MIUA 2F0OA 5GQOA 1PTOC 1VQHA 4A3KB 3MEFA 4HJ5A 1A6XA 3ICEA 4JI4Q 1Y8NB 1MHWC 1EY9A 3MFYA 1EL0A 4QMGA 4EQOA 3K5MA 5EGTA 4A3FG 1UE5A 1TR5A 4LF8L 1GOZA 3H91A 2DNCA 3ND8A 4JG2A 4N8X1 3I72A 4YCVA 5J39A 3K5LA 2JA6B 1K0SA 2NTTA 4KN4C 5CV5A 3EIVA 2ZJQA 2E75C 3LNNA 2R3ZA 3TN2A 3BVGA 2F4VL 2A19A 1HUNA 1ICFB 2WP8J 1YJNA 3HOZB 4O42A 3VYRA 4QF4A 3TQYA 4A3MG 3K0XA 2LSSA 1SYBA 2Z6KC 4BA1I 2F3VA 1CFMA 2CKZB 1E22A 3NXWA 1M1KC 1EQTA 2EIFA 5HURA 1SR3A 4H7BA 1UE6A 2BCOA 3FKIG 3NQIA 4G7OC 4AQYQ 4A3IH 1TXYA 3L7ZC 3DUZA 3S14H 1FJGQ 1K3BC 4PV1C 2SDFA 1W2BA 3QIAA 4HIOA 4KK7A 3STBD 2AKWB 1K8GA 3K7AH 2NVXH 4WFN3 3KK7A 1TS4A 4C2MB 4BBRG 1K0RA 2KA7A 1E1OA 1CQFA 3NHHA 2D9UA 2GA4B 4JI6L 1CKOA 2PI2A 2HCCA 4K8JA 4B9XA 2VNUD 4H44C 1STBA 1XNQQ 2O4XA 4A76A 3RNUA 4IUUA 4ZCKA 1CUKA 1FYCA 4LW1A 4M1UB 1ICWA 4JI2Q 2WACA 5CMDA 4ZRZA 4P71A 4L5QA 1X3QA 2A6ED 4LMQD 4LUVA 3AEVA 3CHBD 3RLFA 4JI4L 1HJPA 1HUMA 4HIKA 3J7AF 3PO2H 3STBC 3GTMH 2B2YC 5J1ZA 4R4QA 2YU9B 3A56A 4IZ8A 1QOHA 1HXYD 1W6KA 2Z9HA 3S1MB 4JI8Q 1VQNA 3M3YH 3S1QB 1BF4A 3GTOB 1KLUD 1ZKOA 3CCMA 1G91A 3TDQA 3ERQA 2R7ZG 4YCUA 4ODGA 2L9HA 3HRZC 4POGA 2ZXRA 5LL6S 5CGKA 1TY0A 1PMRA 5K5PA 2A6EC 1II3A 2HHHQ 3M7NA 3CCJA 1KLGD 2L15A 1VQ4A 1EQQA 4XQQA 3DWAA 1SSOA 4DK0A 1CSQA 1FJGL 3DLLA 4XT1B 1EY0A 5M5WH 4NDXA 3BJUA 3GTQB 2MGSA 2DGYA 4KTAA 4DV1Q 4GNXB 3N52A 1TVXA 1VMCA 4JC0A 1BCPF 4RCNA 4A4IA 4JI0Q 3MTSA 3HOWH 4K5XA 2AWOA 4DFAA 3BVZA 2B2VC 3KUPA 1XNQL 2D0OA 4PQXA 5DLQE 2EYOA 5E1FA 2L0CA 4RFBA 2FHTA 4I7ZC 2WKDA 2GN5A 2IJ0A 2VQFQ 2AHOB 5LMUQ 1N32Q 2KCCA 4YHHQ 1IBMQ 3IAYA 1IKMA 2J4XA 3VA5A 2OF1A 4C3JH 1YNXA 1X9NA 1W6JA 1O78A 2QGQA 4JI8L 5H1SE 4DN4M 3PCOB 5C5MA 1QILA 5M9OA 4IFDJ 4LF7Q 2NVTB 4TSSA 3HZXA 3FEWX 1S40A 2E2JH 3GD7A 3M4PA 3B6YA 2WB1E 1U0LA 3S1RH 4CHTB 3ERSX 2JA5B 1L0XB 1YJ9A 3TP8A 3S2HB 1CSPA 1PYWD 2OTJA 2F0TA 2FMMA 1EZ6A 1YVCA 1AN8A 2HHHL 3J7AV 5EQ0A 1PH6A 4DNTB 1XXGA 2XTIA 2EDGA 1GUOA 5I9OA 1STEA 1K83B 2R7FA 2WAQE 2JA7G 1X3GA 2CH4W 3PIP3 1I50H 3NTKA 1EEID 1ZYRD 3OSOA 3OHXC 4A3CH 4KD3A 3I4NG 2R93B 3K5NA 1VQ6A 3D6WA 3VR2A 4EQ5A 2OWOA 4WJWA 4NP5A 2F0FA 2BH2A 1TWFH 5C0XG 1TWGB 1T5EA 2DNEA 4QL5A 4XDXA 4JI0L 1XNRQ 2I5LX 2LXJA 4DR1Q 3GTKH 3U50C 3DWQA 4C1NK 3KOJA 2QDBA 5F2DA 1DONA 2NN6H 5M3MH 2EY5A 3GO5A 2F0HA 4A3LG 4BY1G 4DR2L 2ICEC 1NUCA 5T1IA 5GAHC 1UWVA 2XRQD 4G7ZC 4RAUC 3GQBA 3SK6A 1PFBA 1RHPA 3NTIA 2VQFL 3M4QA 4KHZA 1N36L 5LMUL 1XPUA 1HZ9A 1N32L 3WOFA 2B3GA 1QZGA 1IBML 4DUYQ 4KHPQ 1YNND 4HCSA 2YTVA 2UXCQ 1NMGA 4JBWA 4A3KH 2A6HC 3S17B 2SNSA 4LJZC 1EY5A 2Y0SB 4R8IA 1ONLA 2RDFA 4CGYB 5BN4A 4NXNL 2F0MA 1GVPA 5KRUA 4LF7L 2E2DC 3MZ5A 3CMAA 1GXDC 5CV9A 4BY7H 4IO9A 2JA6H 3PUWA 2EPBA 1CM9A 1ENCA 1SYCA 4L6TB 5KYLA 3MXGA 3C46A 2C35B 4IN3A 3I91A 1BO0A 1V8QA 5C3WA 1EQRA 5IWAQ 1QJOA 5E7NA 1VQ9A 3HOXB 1YNNC 4CJ1B 5COYA 5GAEC 4UHVA 1GHJA 3IRBA 2RKSA 3MC0B 1PLFA 2KCNA 4KV6A 4OGQC 2O5IC 1OXXK 5M5XH 3HOYB 3KF8A 4TVAB 3NENA 4X65L 1OO9B 1M4VA 4RGTA 4A93H 1F77A 5HY6A 4GZYC 3E5SA 3HKZG 4DR1L 3X3MA 3LWUA 2I5MX 1PH1A 2Q2HA 4K14A 2Q8TA 1PFMA 3I4OA 3PUXA 3HOUH 1KDCA 3MXNB 1PRTB 2H4OA 1VQ5A 2BDNA 3HOVB 1SNOA 4K0KQ 5E3FA 3J81L 4DUYL 4KHPL 5JEAG 3HS0C 2BE5D 2UXCL 2PCFB 4RGMA 5E4XA 4ABNA 1XPOA 2QEJC 2Q2UA 2XNAC 3AQQA 5CBAE 4NW2A 3I4MG 2NZOA 4OELB 4RMFA 2JP1A 5IYCH 4B3TL 2YU9H 1XMOQ 2PPBC 3S1MH 5IP9G 3EFXD 3S1QH 5GADC 2KVMA 1ET6A 2B63H 4HJ8A 4C3IH 2Q8IB 4WORA 1PH8A 2I46A 1BDOA 5IWAL 1WI5A 2UUAQ 1TS5A 1OXUA 2LFNA 2PNHA 5ISRA 1U5KA 2RHQB 1WOCA 1Q82C 1L1OC 2L1BA 1IW7D 4WJ3M 4PZ7A 4FXDA 2DUDA 1LACA 1UAPA 1CKNB 4HN7A 4OX9Q 4HR7B 1WTHA 3K7AB 4DV5L 1BXTA 3KF6A 4A3GG 3GTQH 4BA2I 4J8QA 3ULLA 4EVOA 5D65A 1LV9A 4HMJA 1Q3LA 3G71A 2LMCB 2GVBA 4NB3A 3E0EA 2M2LA 1HZCA 1QE6A 4YWLA 2B2UC 2L5TA 3T1YL 3U58A 2OEOA 4K0KL 1L2FA 3T51B 1CI3M 2N78A 4OO1H 2JJQA 2RHSB 2EY1A 4V190 4A3DG 4DR7Q 3PO2B 1AEXA 3GTMB 2F3IA 1RCVD 2B2WC 5C4XG 3GV3A 4O2DA 4YCWA 1TKWB 4X3UA 4DR4Q 1KDAA 4JOIC 5E4WC 1Q1BA 3K59A 4JI5Q 5DNFA 3RZDH 2NVTH 4P2CB 4KI0A 3SHLA 4RG1A 3F2DA 3RZOB 1MSGA 4JVZA 4HJ7A 1HNZQ 1Y69U 2UUAL 1WJJA 1J6QA 4IJHA 3TP5A 1XWEA 5GAGC 2K6AA 1SMYD 2QW7A 1EWCA 2X69A 4DUZQ 1A2TA 4DKAC 1XYIA 3NQTA 1I4PA 2NTSA 2NN6I 1E2ZA 3M7GA 1QNUA 4QJFA 1VQ7A 1QNKA 2OQKA 2RSOA 4TKOB 1VQMA 4A3EH 4OX9L 4BBSG 1NSNS 3I70A 4JPBW 4KY6A 2VZAA 1D6EC 4BXXH 2EJMA 2X6LA 4HSPA 5BN3A 5JOBA 3HOWB 3M4OB 3VYTA 4JW0A 3TS0A 3ND9A 2JN4A 1LTLA 2HD3A 3UDXA 4LF6L 4TRDA 5EBCA 2E2IB 4O1NA 2O2LD 5A2QE 1KTKA 2Z8LA 2C5CA 1F9RA 1XX8A 1I3QB 4QUCA 4DF7A 1SNDA 1SMYC 2F0QA 3EROA 3CAMA 3BZDB 1EY6A 5JAVA 1TY2A 2I07B 3G4SA 4DR7L 1UEBA 1MI2A 1FGBD 3AFPA 5CV8A 1JB7A 3PF4A 4C3JB 2JYOA 1WTOA 1RD9D 2JA9A 1D5MC 3PIOA 3GDEA 1RDPD 2VQEL 3V2TA 3T56B 3OW7A 4X64L 3PO3G 1AE3A 4R4TA 4LFAQ 4JI5L 1X32A 2V1CC 2KENA 3N6RA 1LTSD 1ENAA 5ELNA 3S1RB 1SBBB 3VR4A 5KYIA 1HNZL 4FNFA 1EYCA 1YI2A 2IHFA 1STGA 5FJ8G 1Z7TA 2QKIC 2WKCA 4DUZL 2PW7A 4KHVA 3Q24A 4EX5A 4JBJA 1MJCA 1CZWA 2Z1CA 2ZXOA 5C4JH 5JJIA 3HOXH 3S24A 1SYGA 4I7AA 4A3IG 5JPMC 3QOJA 5C44B 5CV4A 2K14A 2A69C 2B2TA 1NE3A 4C3HG 2L12A 3JAMi 4GOPC 1PTOB 4HMIA 1RF2D 5CC4A 1OTCA 4IURA 4P72A 3GTKB 1GUTA 1DCZA 1JT8A 4V0BA 3NPPA 5M3MB 1X3PA 4DGZA 2ZJRA 2K1BA 3HKZE 2EXDA 2CWPA 2ALYB 4XQJA 1SNCA 2XWJB 3JAME 2NZ1D 2CVRA 5C4HA 1K8OA 3SVMA 3C3LA 1G2SA 1DD2A 2BOSA 3UDGA 5IP7G 4JYAQ 3K57A 3I55A 1O7IA 4NXMQ 3OIPA 3J80i 5EJWA 1WVLA 2JA8G 3MFGA 3MXUA 3H0GB 4CBVA 1C0AA 4GNXA 5I6YA 3KYHC 4KN7C 3T13A 2K03A 4LFAL 2NBFA 1L0YB 3TZDA 4PZ8A 2D62A 4BY7B 3J80E 1HR0L 4QUFA 4ULLA 2PMZB 4FXKC 2B29A 3W3AA 1KAWA 2QEXA 1X3EA 4B3SQ 5FO7B 4B3ML 2B39A 1EOTA 4LF4L 1DOKA 4L5TA 2VUMG 1HFGA 5G3LF 2F0GA 3URYA 1KXLA 1Y1VB 2PQAB 1V1OA 1VQEA 5M5XB 1Q1EA 1SYFA 1JOOA 1SJED 3U4ZA 5K36H 2RQXA 2KHIA 4O0AA 2KQ3A 3GTPB 4A93B 2KOLA 4IUPA 2K5WA 4OO1I 5JVG3 2N55A 4L5RC 3J7ZC 4DA2A 1CA5A 4A3BB 1V43A 3CCSA 2VB3X 3T4AC 3HOUB 3TMEA 2JA7B 5BN5A 1J5EL 2MJ8A 3ULJA 3Q8DA 1PDQA 4FF3A 3TZUA 3T1HL 3EVQA 4Q5VA 4JYAL 5NUCA 4CJ0B 4J1MA 4YIJA 4RHRA 3VR3A 4NXML 3S2DB 3KBXA 3CW2C 1C4QA 3QR8A 1IYUA 4LUOA 2F1MA 1EIYB 2YYZA 2UXBL 4DK3C 1UNSA 1YHQA 4FXGC 4IFDH 4OWTB 1C8CA 1SROA 3VYSA 3VYUA 1CTMA 3KLWA 1Y1WH 5FLXL 4J15A 3CC4A 2O5JC 4PMWA 4CDDC 2ATWA 2AUJD 3P75A 2MHVA 4B3SL 1WCMG 3D31A 2B63B 2MFIA 4C3IB 5IY0A 4ME5A 2EOTA 5LMNQ 5C6AA 3KJPA 1C7YA 3RZOH 1BCPD 1N34Q 1NBWA 1C48A 1E0BA 3A54A 3A8KE 3OMGA 1A0IA 4JV5Q 2A68D 4A3FH 1SDFA 1DXMA 2F0NA 3KJOA 2L11A 4OXPA 1E2VA 1ML0D 2G5DA 1PHJA 4GLAC 2D5DA 2F0KA 4QIWB 1IL2A 4HAEA 1HA6A 4ZAIA 3K7UC 5I2XA 1M8AA 4ALPA 4QCLA 1WTVA 1JR0D 5ELEA 4AYBE 1BBWA 4PNYA 3K8AA 4A3MH 1L0WA 3H3VH 3F2CA 3M4OH 3LX0A 2F03A 4H02A 5A35A 5IYBH 3RUZA 3FKIH 1BCPC 4R9WA 2E2IH 2E2HB 1SE4A 2MNAA 3AU7A 2A68C 1I3QH 4DR2Q 2AUKA 4PMCA 1Q86C 1HNWL 4TQUS 4DNRB 1SMXA 4XQNA 1N36Q 1VQAA 1FGUA 4A3KG 2N3SA 2A73B 2EYPA 3IFTA 3HP3A 3R3OA 2FJ2A 4BBRH 1F2ZA 4GN5A 3FMCA 1U9RA 2ZM6Q 3E3XA 1SE8A 3CC2A 1HFNA 4NXNQ 5D14A 1BOSA 3RZDB 2JA6G 1OXSC 1LTBD 1I4QA 3J7A5 4IUTA 5LMNL 3MXNA 3KFUA 1KHIA 3PQIA 2RBMA 3DHQA 2R7DA 2ZTEA 4LFCQ 3HOZG 2MQHA 1N34L 1DZ1A 1E7ZA 1K8AC 2H5XA 4LK1C 5AJ3Q 1YIJA 4JI3Q 4JV5L 3I4MB 2K5NA 3JAMc 3Q22A 1HQRD 5M3FB 1A63A 1Y8OB 4A3EB 2RF4A 2EQSA 2WINB 2CQOA 3I3CA 4U673 5C44H 2IPKD 1G51A 1ASYA 4F87A 1S5FD 1SNMA 3AYHB 2HIXA 2R7ZH 1JORA 2F3WA 1Z47A 4Q0FA 4FP5D 1PTOH 1WYDA 4X65Q 4M8AA 2QA4A 3GTJB 1ZXTA 3R8BA 4HIDA 5EAYA 2EJGC 4JI1L 1BQQT 3S1NH 1RKNA 4EQNA 3J80c 1K3RA 1VQFA 4APVA 1K28A 4JK1C 2IL8A 2KHSA 3AMUA 3QJYA 1X54A 3ZJYC 1GUNA 1LTAD 4E6IA 1MGSA 4JI7Q 2K5QA 1EWHA 2XN9C 2OXPA 1CKNA 1ZYRC 1DM0B 3V05A 2QDLA 2XIWA 1ZEQX 3T53B 3J81j 3U9SA 1O7LA 3ULPA 2ZM6L 4PG3A 3V96A 2F0JA 1EWIA 5JPNC 1TIID 5IYCG 1NMFA 3H0GH 4HSVA 1YITA 2Q2TA 2R92B 1R4PB 4B3TQ 1BBXC 1EIFA 4NMZA 1BKBA 2JEAI 4LFCL 1PZKD 2N88A 3A7AB 3U4VA 1ASZA 1SE3A 4JBMA 5AJ3L 4JI3L 2K01A 2X6GA 1VS0A 1PYSB 4L5SA 5C4JB 3PUVA 4KY5A 1PFNA 2P5ZX 1MBYA 4Y7NH 4FF4A 1A8VA 1MKHA 4UPAA 1I6VC 1EU4A 5CYUA 4DAMA 1ESFA 1Y1VH 5C4ZA 3C2PA 3SK4A 3TP6A 2H1EA 3NK9A 4LFBQ 1U4PA 1SYEA 3GTPH 4DV5Q 1EY4A 1LT4D 4AH6A 1GKHA 5BR8Q 4IFDI 3F2UA 1K9MC 1DJRD 2K5VA 4A3BH 1VQLA 5IGDA 3P1HA 4AYBB 2JA7H 1MD2D 3SE0A 5IYDG 3E0JA 1SNQA 1X56A 4JI7L 4IUNA 5D3IB 3I4NH 3T1YQ 3A55A 3S2DH 3F8TA 2HQEA 4KD4A 5DEHA 5C0XH 3A74A 4DV2L 3GTLH 2Q2IA 4A3JB 4U68A 4CKBA 2MO1A 1S3OA 3QO2A 1L1OB 4LF5Q 1VQOA 3AB9A 4IPCA 4A3LH 4BY1H 1HRJA 3BDCA 5IGCA 2JE6I 1STYA 4CDCC 3KBGA 4DR5Q 1D7QA 1C9OA 2AQ1B 1D2BA 5FKAC 1EEFD 4IOCA 4EQPA 1YNJD 1DOLA 3PV0A 2M9VA 2JA5G 1QVFA 5DM73 1HTLD 3CXCA 3T16A 1WTQA 4F88A 3NWSA 1B9MA 3H3VI 1GD7A 2ZTDA 4GN4B 1HZAA 2LKVA 1PRTF 3MXPA 2BE5C 1PH2A 3P20A 2WB1B 1EU3A 3TRZA 1WD1A 1PH7A 3D0FA 1WTWA 4DXFA 3S9WA 2B8GA 4LFBL 5EKLA 2R93G 4DAPA 1CHPD 1IBLL 1F9PA 2WAQB 4FF2A 1F2MA 2JXMB 5BR8L 1P16A 4B3RL 1TWHH 2B8FA 1STAA 3CMEA 1G8ZD 1PH3A 1OXTA 4GN3B 2MUYA 3D8GA 1YNJC 2C9OA 4IQZA 4CDEC 3RR5A 4LF6Q 3G7LA 4IPDA 2WV6D 5C3EB 3PSIA 2CFMA 4RHSA 4ZQ3A 1BR9A 5A2QL 1S5CD 1T5XD 2CCZA 2E2HH 3I90A 4B08A 1HHVA 1BBUA 1K73C 1VQIA 4OHJA 3J81i 1S72A 1IW7C 3CF5A 2EY2A 1VQPA 2F0VA 3RD4A 1LTTD 2RDHA 4LF5L 4DR3L 2QILA 1HNXQ 1Y1WB 3Q6SA 1O7YA 1PVOA 2Y0SG 1SLJA 4K6LA 4J6HA 5IIFA 2LXKA 1B8AA 2JK8A 1HZBA 3EQLC 2VQEQ 5C0XJ 4C1NI 3J81E 3A5UA 2AMCB 2NWGA 4X64Q 2NB0A 4DR5L 1FD7D 3QG1A 2UUCQ 3CP0A 2E8GA 3W2DA 2PYKA 2ZXPA 1UE1A 3CCUA 5CBEE 4X62L 3VR6A 1IYVA 5IGGA 4GKKQ 2J7ZA 1EUJA 2Z6KA 4A3FB 1Y8PB 3HOXG 1YEZA 3DWPA 1JWMD 1H9JA 2F52A 2YTXA 3P7JA 3I4MH 1H9KA 3QB3A 1XTDA 5ELDA 3PIPA 1NTGA 2NUCA 1D5ZC 3H6MA 5M3FH 2PW5A 2V4DA 3CQZB 4YY3L 1KRTA 5IP9H 2EYJA 5IT9E 3HOYG 1KAAA 2IHEA 3UI2A 1G2TA 2XSCA 4A3MB 3UE1A 5FLMH 3NBIA 2ZT9C 3KDFB 1X6OA 2K04A 2HCIA 5HGQA 1SJHD 5GROA 3GTJH 3F1ZA 3OMCA 3FKIB 2FXQA 1JOKA 1IBKL 1VF5C 1PZID 1I6HH 2L4NA 3HOVG 1JB3A 1PZJD 1KABA 3JAML 3IFDA 2PQAA 3DM3A 1I4GA 2F0SA 1B9NA 1NCVA 2NYZD 5CV7A 2K28A 4EGVA 4A3GH 4ME3A 1SAPA 2DY7A 4FDBA 2KJXA 4BBRB 5ELOA 4Y52H 1HNXL 3A7LA 3OWFA 2I0QA 4DAVA 3UDFA 3I4LA 2UUBQ 2B2YA 4OL7A 2KEEA 1LLRD 1Z9FA 3MHBA 1VQJA 3DEPA 4GLVB 5M5YH 4HJAA 2UUCL 1RTOA 4GOPB 1B44D 3BG3A 3D4DA 4CKCA 2UXDL 1SNPA 1HR0Q 4Z9CB 2R92H 3LGJA 1EIHA 2XGTA 1AZQA 4FF1A 4UP8A 1LT6D 3NEMA 5EPKA 3HKSA 4A3DH 1VDZA 4GKKL 1V1PB 1W3SA 4B3MQ 1UEAB 2VW9A 1EOVA 1TS3A 1S5ED 4LF4Q 5FO8B 1FNWA 5C4XH 2YV5A 5JEAJ 4S3SA 1TU2B 2HIVA 2LS01 1I4XA 2A5HA 1J9OA 2DJGC 2IX0A 5HGTA 1H95A 5IGFA 2CHBD 2R7ZB 4QB4A 4RA8A 2TSSA 4NKLA 1CQVA 1SXTA 2ID0A 1CZGA 3R2TA
chains in the Genus database with same CATH topology
4JBWA 1MJEA 1TWAH 1N34Q 3CCLA 4A3KH 1JE5A 4DR6Q 1NBWA 2OCEA 2JEBI 2NVQH 3PF5A 4X6AH 1A0IA 4JV5Q 2HT1A 4A3FH 1OXVA 3A0JA 4NXNL 3KJOA 1LM0A 1GVPA 4LF7L 1J5EQ 3M85A 4OXPA 1SRUA 1QVCA 3CMAA 2JQOA 1PHJA 2E5LQ 4GLAC 3T1HQ 4BY7H 4IO9A 1IL2A 2JA6H 3PUWA 2R92G 5IYDH 3K7UC 4IPHA 4ALPA 3JC66 4GLXA 2UXDQ 4OWXB 4AYBE 1GO3E 1BBWA 1JJ2A 4GS3A 2C35B 4DV0Q 3K8AA 4A3MH 1EQRA 1L0WA 3TEHB 3VDYA 3EBEA 3F2CA 3H3VH 2PMZE 3PO2G 3M4OH 5IWAQ 3OYYA 1BVSA 4H02A 1QUQB 5E7NA 1VQ9A 3BZKA 2UUBL 2UXBQ 5IYBH 3CCQA 5GAEC 4A3JH 1XMOL 4DV7L 1PV4A 3FKIH 3KF8B 2E2IH 1G6PA 1Q8KA 3G48A 4LWCA 1QUQA 1X55A 3IRBA 2MNAA 3CC7A 1VQGA 1I94L 1I3QH 1N9WA 1OXXK 4DR2Q 5M5XH 4GKJL 4TVAB 3NENA 1Q86C 3RN2A 1HNWL 4TQUS 4X65L 1HR0W 2YTYA 4A93H 1SMXA 5HY6A 3UE0A 3HKZG 1N36Q 3L2PA 1VQAA 4DR1L 1Q81C 1FGUA 2VL6A 2N3SA 4A3KG 2JA5H 3S2HH 2I5MX 1PH1A 2Q2HA 1NJIC 4BBRH 3I4OA 1VQKA 4GN5A 1B7YB 3PUXA 3HOUH 1PFSA 2R6GA 5JJKA 1X65A 2ZM6Q 3CC2A 1SE8A 3PGZA 1K83H 3MXNB 4AYBG 4DV3L 1VQ5A 3I2ZA 2PI2E 4IPGA 1IXRA 4NXNQ 1N33L 3WWVA 4QGUA 2JA6G 4PZ6A 1KQSA 2NZHA 1D8LA 1OXSC 3J7A5 5LMNL 4K0KQ 3KFUA 1FL0A 4DUYL 4KHPL 2KCMA 2WFWA 5JEAG 2UXCQ 2R93H 1KHIA 4IOAA 3H15A 2UXCL 4LFCQ 2R7DA 2ZTEA 3HOZG 2MQHA 1N34L 1XPOA 1E7ZA 2N8NA 1K8AC 3HOWG 2H5XA 1HH2P 5FJ8H 1TWGH 4MZ9A 5AJ3Q 1YIJA 2Q2UA 4JI3Q 1VQDA 4JV5L 3AQQA 5IYBG 4UP7A 1Q7YC 2K5NA 4A3JG 3NBHB 3JAMc 3J81c 3I4MG 1RL2A 2K4KA 2NZOA 4RMFA 4KLKA 4XTCS 1A63A 4LUZA 3PUZA 5IYCH 2E5LL 4B3TL 2YU9H 4MNOA 2RF4A 4YWMA 1XMOQ 2EQSA 5C3EH 3CPFA 2BA1A 3S1MH 2CQOA 1XJVA 1NY4A 1UE7A 5IP9G 5C44H 1G51A 1ASYA 4R4IA 4POFA 3S1QH 1EFWA 5GADC 4C3HH 4JBKA 3AYHB 4DV0L 2HIXA 2AWNA 2B63H 2R7ZH 4HJ8A 3CCRA 2ZJPA 4C3IH 1PH8A 1Z47A 1PYBA 1HNWQ 1WYDA 5IWAL 4X65Q 1WI5A 2QA4A 2UUAQ 1OXUA 4DAYB 2PNHA 1E1TA 4HIDA 5EAYA 4R4OA 4JI1L 1U5KA 3S17H 1Q12A 4DR4L 3S1NH 2RHQB 3J80c 1WOCA 1K3RA 1VQFA 3RLNA 1MIUA 4APVA 1L1OC 1QZHA 1Q82C 2WB1G 4LF8Q 4WJ3M 4PZ7A 1PA6A 1X54A 1IYJB 3KF6B 2DUDA 5IT9c 1N8RC 5IE8A 5IP7H 5K36G 2VS1A 1CKNB 2Y0SE 4OX9Q 3ZJYC 5JJLA 3BU2A 4X66Q 4DV5L 3W1BA 4JI7Q 3KF6A 2F4VQ 4A3GG 4R4CA 4P75A 2WAQG 3GTQH 4BA2I 1CKNA 3ULLA 2JA8H 1PH5A 4QIWE 5C0XI 3J81j 1T9HA 3W5OA 2K75A 3ULPA 3G71A 1KL9A 4A75A 2GVBA 4NB3A 3E0EA 2ZM6L 2UU9Q 4PG3A 1EWIA 2BH8A 1HZCA 5IYCG 1NMFA 1LYLA 3H0GH 3M9BA 5C3EG 1YITA 2Q2TA 4YWLA 4UY8C 3I56A 4AIMA 5C44G 2ES2A 3T1YL 3U58A 4A3CG 4K0KL 1L2FA 1V9PA 4B3TQ 1EIFA 3OW2A 4BBSH 2N78A 1BKBA 2JEAI 3CQZH 4LFCL 3HOYH 2JJQA 4HIMA 1YHAA 3U4VA 2RHSB 1ASZA 4JBMA 3GTGH 5AJ3L 4A3DG 4LNQA 4JI3L 4DR7Q 4IFDG 3E9HA 1VS0A 1PYSB 1B70B 2F3IA 4L5SA 2VUMH 3PUVA 5C4XG 2NN6G 5M3MG 4AQYL 1Y1WG 4Y7NH 4O2DA 1A8VA 1MKHA 4UPAA 1XPRA 4YCWA 4JI1Q 4JI6Q 4DR4Q 4R1JA 4HJ9A 1VQ8A 4DAMA 3K81C 4JOIC 1Y1VH 4OONA 1Q1BA 1YBYA 4JI5Q 2NVYH 3RZDH 2NVTH 3HOVH 2CWAA 1I5FA 4KI0A 4DV4Q 4RG1A 4IJLA 4P74A 3F2DA 4DV6Q 4QQBX 5GQOA 4DR6L 4LFBQ 1LUZA 4HJ7A 1HNZQ 2UUAL 1VQHA 3GTPH 4DV5Q 1A62A 1J6QA 1WJJA 4IJHA 3MEFA 5GAGC 4AH6A 1GKHA 3FP9A 4HJ5A 5BR8Q 3ICEA 4IFDI 4JI4Q 1K9MC 2K5VA 4A3BH 1VQLA 3TS2A 4DUZQ 4A3FG 2HHHQ 1UE5A 3H0GG 4DKAC 4LF8L 2RCNA 2JA7H 1VQ7A 1YHBA 2NN6I 4QJFA 1KC8C 3S16H 4JG2A 2OQKA 2IY5B 4YCVA 4JI2L 1FVIA 1VQMA 4OX9L 4A3EH 2ASBA 4BY7G 4BBSG 5IYDG 3EIVA 4X66L 2ZJQA 1X56A 4JI7L 3I4NH 3W1GA 1M90C 4UP9A 2VZAA 3T1YQ 1JJCB 2A19A 3CCEA 4LF9Q 2WP8J 1YJNA 2F4VL 3S2DH 4BXXH 3F8TA 3TQYA 4A3MG 3K0XA 3TS0A 3A74A 2LSSA 2Z6KC 5LMNW 2K5HA 4BA1I 4DV2L 1LTLA 2VY3A 2CKZB 1GM5A 2UU9L 3UDXA 3GTLH 2Q2IA 1E22A 4GNXC 3SGIA 4LF6L 1M1KC 1SN8A 2EIFA 2MO1A 1S3OA 1SR3A 1L1OB 4LF5Q 1VQOA 1UE6A 4IPCA 3FKIG 1Y1VG 4AQYQ 1DGSA 4A3IH 3E9IA 4A3LH 1TXYA 1XMQQ 3L7ZC 4BY1H 1L1OA 3CAMA 3HFZB 2JE6I 3S14H 1FJGQ 1KD1C 4DR5Q 1W2BA 1D7QA 1C9OA 1WCMH 4HIOA 3STBD 2AKWB 1KRSA 5J3BA 3G4SA 1UEBA 4IOCA 4DR7L 4A93G 1K8GA 3K7AH 2NVXH 3AFPA 1JB7A 3PV0A 3PF4A 2JA5G 1IZ6A 1QVFA 1VQBA 1AE2A 3CXCA 2JA9A 4A3BG 2BA0A 4BBRG 1K0RA 1GD7A 2ZTDA 1E1OA 3H3VI 4GN4B 3PIOA 1HZAA 3GDEA 3HOUG 4JI6L 2VQEL 1CKOA 2PI2A 1PH2A 2VNUD 2OTLA 3I7FA 4X64L 3PO3G 3TRZA 1PH7A 1XNQQ 1R9TH 4A76A 3CD6A 1AE3A 3RNUA 4R4TA 4LFAQ 4JI5L 1SFOH 2V1CC 1CUKA 3D0FA 2KENA 4LW1A 4DV4L 5ELNA 4JI2Q 4DV6L 3AFQA 4LFBL 1HNZL 4DV1L 4P71A 4L5QA 2R93G 2A1AA 1IBLL 1YI2A 4LUVA 4DNIA 3AEVA 2IHFA 5BR8L 3RLFA 5FJ8G 1P16A 4JI4L 4B3RL 1TWHH 3CMEA 1HJPA 3PO2H 4HIKA 1PH3A 1CKMA 3STBC 1OXTA 4DUZL 2D0PA 4GN3B 4EX5A 3GTMH 4JBJA 3TREA 4DV2Q 1MJCA 5C4JH 4R4QA 3RR5A 4LF6Q 5JJIA 4IPDA 3HOXH 3S24A 3K80C 3G6EA 4A3IG 3PSIA 2CFMA 1VQCA 3S15H 4JI8Q 1VQNA 3M3YH 2K14A 2OQ0A 2CCZA 2N49A 2E2HH 1P8LA 4JOIA 4LF9L 1NE3A 3CCMA 1BBUA 3JAMi 4YHHL 1VQIA 4GOPC 3J81i 2ZTCA 1S72A 1K73C 1OTCA 2B63G 4YCUA 2R7ZG 3CF5A 3OTOQ 1VQPA 4POGA 1JJGA 4P72A 1PH9A 1PH4A 4LF5L 1JT8A 4DR3L 1HNXQ 3M7NA 2ZJRA 1PVOA 2Y0SG 3HKZE 1SLJA 2EXDA 1Q46A 2CWPA 2ALYB 3CCJA 4MTNA 2L15A 1XMQL 2LXKA 1B8AA 2JK8A 1HZBA 2VQEQ 1VQ4A 1EQQA 5C0XJ 1CSQA 3A5UA 2AMCB 2K52A 1FJGL 3DLLA 4X64Q 4DR5L 3UDGA 5IP7G 4JYAQ 4DPGA 3L0OA 2UUCQ 5M5WH 3I55A 3CP0A 1O7IA 2E8GA 3BJUA 1UE1A 4NXMQ 3CCUA 2DGYA 3J80i 2Z0SA 2KHJA 4DV1Q 4GNXB 4X62L 3HOZH 2JA8G 1IBLQ 4JC0A 4A4IA 4JI0Q 3HOWH 2GVAA 4GKKQ 1EUJA 2Z6KA 2K50A 1YZ6A 2AWOA 3PO3H 4B3RQ 1E24A 1C0AA 4XIGS 3HOXG 4GNXA 1YEZA 3KYHC 1XNQL 2F52A 2YTXA 3I4MH 2D0OA 4LFAL 1XTDA 4PZ8A 5DLQE 4JCVE 3PIPA 1NTGA 2D62A 5M3FH 1HR0L 2IT1A 2A8VA 3CCVA 2HQLA 4YY3L 2B29A 1KRTA 5IP9H 1KAWA 2QEXA 1X3EA 2GN5A 3HOYG 4OO1G 1XNRL 4B3SQ 2VQFQ 2AHOB 2IHEA 3FHWA 5LMUQ 4B3ML 1N32Q 3UE1A 4YHHQ 1IBMQ 5FLMH 3KDFB 1G291 4LF4L 1X6OA 4L5TA 1Y14B 1YNXA 5GROA 4C3JH 5HGQA 1X9NA 2VUMG 4C2MH 3GTJH 3F1ZA 2FXQA 2QGQA 3KDFA 4DR3Q 4JI8L 1KIXA 1KXLA 5H1SE 1IBKL 1YJWA 3PCOB 1VCIA 2PQAB 4IFDJ 1E3PA 4LF7Q 1VQEA 1I6HH 1Q1EA 3HOVG 2MO0A 1S40A 3U4ZA 2E2JH 1WFQA 3F2BA 4YWKA 4O0AA 2KHIA 2PQAA 3GD7A 3OTOL 3DM3A 3M4PA 3B6YA 2WB1E 1U0LA 3S1RH 4OO1I 3ERSX 4L5RC 4A3GH 1YJ9A 4ME3A 3J7ZC 4FDBA 1CSPA 3A5ZB 1V43A 3CCSA 2OTJA 5ELOA 4Y52H 1HNXL 3ER0A 4X62Q 4WJ4A 1YVCA 2I0QA 2HHHL 2UXBL 3CPWA 1PH6A 1J5EL 3UDFA 3ULJA 3Q8DA 2XTIA 3PUYA 2UUBQ 2R7FA 2JA7G 2WAQE 1Z9FA 1X3GA 1VQJA 4GLVB 5M3FG 2KCTA 1I50H 5M5YH 4HJAA 3RN5A 4DV7Q 3T1HL 4JYAL 2UUCL 4A3EG 1JMCA 4GOPB 4A3CH 4NXML 2UXDL 3I4NG 3CW2C 3BZCA 1HR0Q 1VQ6A 1I94Q 2OWOA 4BXXG 4DK6C 4EQ5A 2R92H 2I5HA 3LGJA 4YY3Q 4LUOA 3GTOH 4GKJQ 2BH2A 1X3FA 2XGTA 5FLMG 4GOPA 1TWCH 1TWFH 5C0XG 4JI0L 1EIYB 4QL5A 4UP8A 2YYZA 4GKKL 3NEMA 4DK3C 3HKSA 1XNRQ 1YHQA 2I5LX 2LXJA 4A3DH 1W3SA 3NELA 4OWTB 4B3MQ 4DR1Q 3GTKH 1SROA 4P73A 3U50C 2VW9A 3KOJA 1EOVA 4LF4Q 1QVGA 5C4XH 1RIPA 5M3MH 2YV5A 2KBNA 3KLWA 5JEAJ 1Y1WH 4J15A 2HIVA 3GO5A 3CC4A 3RLOA 4A3LG 4BY1G 4DR2L 4PMWA 2ATWA 5GAHC 1UWVA 4DV3Q 1IBKQ 1N33Q 2IX0A 4QY7A 2IX1A 1AH9A 1H95A 4B3SL 3EN2A 2VQFL 1WCMG 3D31A 3M4QA 4KHZA 1N36L 1V1QA 2MFIA 1HZ9A 5IY0A 5LMUL 2B3GA 1QZGA 1XPUA 1IBML 1N32L 5LMNQ 4DUYQ 4KHPQ 3UDIA 4OWWB 5FLXc 3KJPA 2ID0A 4NPSA 1C7YA 1EYGA 2YTVA 3RZOH 1NMGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JBW A;  1MJE A;  1TWA H;  1N34 Q;  3CCL A;  4A3K H;  1JE5 A;  4DR6 Q;  1NBW A;  2OCE A;  2JEB I;  2NVQ H;  3PF5 A;  4X6A H;  1A0I A;  4JV5 Q;  2HT1 A;  4A3F H;  1OXV A;  3A0J A;  4NXN L;  3KJO A;  1LM0 A;  1GVP A;  4LF7 L;  1J5E Q;  3M85 A;  4OXP A;  1SRU A;  1QVC A;  3CMA A;  2JQO A;  1PHJ A;  2E5L Q;  4GLA C;  3T1H Q;  4BY7 H;  4IO9 A;  1IL2 A;  2JA6 H;  3PUW A;  2R92 G;  5IYD H;  3K7U C;  4IPH A;  4ALP A;  3JC6 6;  4GLX A;  2UXD Q;  4OWX B;  4AYB E;  1GO3 E;  1BBW A;  1JJ2 A;  4GS3 A;  2C35 B;  4DV0 Q;  3K8A A;  4A3M H;  1EQR A;  1L0W A;  3TEH B;  3VDY A;  3EBE A;  3F2C A;  3H3V H;  2PMZ E;  3PO2 G;  3M4O H;  5IWA Q;  3OYY A;  1BVS A;  4H02 A;  1QUQ B;  5E7N A;  1VQ9 A;  3BZK A;  2UUB L;  2UXB Q;  5IYB H;  3CCQ A;  5GAE C;  4A3J H;  1XMO L;  4DV7 L;  1PV4 A;  3FKI H;  3KF8 B;  2E2I H;  1G6P A;  1Q8K A;  3G48 A;  4LWC A;  1QUQ A;  1X55 A;  3IRB A;  2MNA A;  3CC7 A;  1VQG A;  1I94 L;  1I3Q H;  1N9W A;  1OXX K;  4DR2 Q;  5M5X H;  4GKJ L;  4TVA B;  3NEN A;  1Q86 C;  3RN2 A;  1HNW L;  4TQU S;  4X65 L;  1HR0 W;  2YTY A;  4A93 H;  1SMX A;  5HY6 A;  3UE0 A;  3HKZ G;  1N36 Q;  3L2P A;  1VQA A;  4DR1 L;  1Q81 C;  1FGU A;  2VL6 A;  2N3S A;  4A3K G;  2JA5 H;  3S2H H;  2I5M X;  1PH1 A;  2Q2H A;  1NJI C;  4BBR H;  3I4O A;  1VQK A;  4GN5 A;  1B7Y B;  3PUX A;  3HOU H;  1PFS A;  2R6G A;  5JJK A;  1X65 A;  2ZM6 Q;  3CC2 A;  1SE8 A;  3PGZ A;  1K83 H;  3MXN B;  4AYB G;  4DV3 L;  1VQ5 A;  3I2Z A;  2PI2 E;  4IPG A;  1IXR A;  4NXN Q;  1N33 L;  3WWV A;  4QGU A;  2JA6 G;  4PZ6 A;  1KQS A;  2NZH A;  1D8L A;  1OXS C;  3J7A 5;  5LMN L;  4K0K Q;  3KFU A;  1FL0 A;  4DUY L;  4KHP L;  2KCM A;  2WFW A;  5JEA G;  2UXC Q;  2R93 H;  1KHI A;  4IOA A;  3H15 A;  2UXC L;  4LFC Q;  2R7D A;  2ZTE A;  3HOZ G;  2MQH A;  1N34 L;  1XPO A;  1E7Z A;  2N8N A;  1K8A C;  3HOW G;  2H5X A;  1HH2 P;  5FJ8 H;  1TWG H;  4MZ9 A;  5AJ3 Q;  1YIJ A;  2Q2U A;  4JI3 Q;  1VQD A;  4JV5 L;  3AQQ A;  5IYB G;  4UP7 A;  1Q7Y C;  2K5N A;  4A3J G;  3NBH B;  3JAM c;  3J81 c;  3I4M G;  1RL2 A;  2K4K A;  2NZO A;  4RMF A;  4KLK A;  4XTC S;  1A63 A;  4LUZ A;  3PUZ A;  5IYC H;  2E5L L;  4B3T L;  2YU9 H;  4MNO A;  2RF4 A;  4YWM A;  1XMO Q;  2EQS A;  5C3E H;  3CPF A;  2BA1 A;  3S1M H;  2CQO A;  1XJV A;  1NY4 A;  1UE7 A;  5IP9 G;  5C44 H;  1G51 A;  1ASY A;  4R4I A;  4POF A;  3S1Q H;  1EFW A;  5GAD C;  4C3H H;  4JBK A;  3AYH B;  4DV0 L;  2HIX A;  2AWN A;  2B63 H;  2R7Z H;  4HJ8 A;  3CCR A;  2ZJP A;  4C3I H;  1PH8 A;  1Z47 A;  1PYB A;  1HNW Q;  1WYD A;  5IWA L;  4X65 Q;  1WI5 A;  2QA4 A;  2UUA Q;  1OXU A;  4DAY B;  2PNH A;  1E1T A;  4HID A;  5EAY A;  4R4O A;  4JI1 L;  1U5K A;  3S17 H;  1Q12 A;  4DR4 L;  3S1N H;  2RHQ B;  3J80 c;  1WOC A;  1K3R A;  1VQF A;  3RLN A;  1MIU A;  4APV A;  1L1O C;  1QZH A;  1Q82 C;  2WB1 G;  4LF8 Q;  4WJ3 M;  4PZ7 A;  1PA6 A;  1X54 A;  1IYJ B;  3KF6 B;  2DUD A;  5IT9 c;  1N8R C;  5IE8 A;  5IP7 H;  5K36 G;  2VS1 A;  1CKN B;  2Y0S E;  4OX9 Q;  3ZJY C;  5JJL A;  3BU2 A;  4X66 Q;  4DV5 L;  3W1B A;  4JI7 Q;  3KF6 A;  2F4V Q;  4A3G G;  4R4C A;  4P75 A;  2WAQ G;  3GTQ H;  4BA2 I;  1CKN A;  3ULL A;  2JA8 H;  1PH5 A;  4QIW E;  5C0X I;  3J81 j;  1T9H A;  3W5O A;  2K75 A;  3ULP A;  3G71 A;  1KL9 A;  4A75 A;  2GVB A;  4NB3 A;  3E0E A;  2ZM6 L;  2UU9 Q;  4PG3 A;  1EWI A;  2BH8 A;  1HZC A;  5IYC G;  1NMF A;  1LYL A;  3H0G H;  3M9B A;  5C3E G;  1YIT A;  2Q2T A;  4YWL A;  4UY8 C;  3I56 A;  4AIM A;  5C44 G;  2ES2 A;  3T1Y L;  3U58 A;  4A3C G;  4K0K L;  1L2F A;  1V9P A;  4B3T Q;  1EIF A;  3OW2 A;  4BBS H;  2N78 A;  1BKB A;  2JEA I;  3CQZ H;  4LFC L;  3HOY H;  2JJQ A;  4HIM A;  1YHA A;  3U4V A;  2RHS B;  1ASZ A;  4JBM A;  3GTG H;  5AJ3 L;  4A3D G;  4LNQ A;  4JI3 L;  4DR7 Q;  4IFD G;  3E9H A;  1VS0 A;  1PYS B;  1B70 B;  2F3I A;  4L5S A;  2VUM H;  3PUV A;  5C4X G;  2NN6 G;  5M3M G;  4AQY L;  1Y1W G;  4Y7N H;  4O2D A;  1A8V A;  1MKH A;  4UPA A;  1XPR A;  4YCW A;  4JI1 Q;  4JI6 Q;  4DR4 Q;  4R1J A;  4HJ9 A;  1VQ8 A;  4DAM A;  3K81 C;  4JOI C;  1Y1V H;  4OON A;  1Q1B A;  1YBY A;  4JI5 Q;  2NVY H;  3RZD H;  2NVT H;  3HOV H;  2CWA A;  1I5F A;  4KI0 A;  4DV4 Q;  4RG1 A;  4IJL A;  4P74 A;  3F2D A;  4DV6 Q;  4QQB X;  5GQO A;  4DR6 L;  4LFB Q;  1LUZ A;  4HJ7 A;  1HNZ Q;  2UUA L;  1VQH A;  3GTP H;  4DV5 Q;  1A62 A;  1J6Q A;  1WJJ A;  4IJH A;  3MEF A;  5GAG C;  4AH6 A;  1GKH A;  3FP9 A;  4HJ5 A;  5BR8 Q;  3ICE A;  4IFD I;  4JI4 Q;  1K9M C;  2K5V A;  4A3B H;  1VQL A;  3TS2 A;  4DUZ Q;  4A3F G;  2HHH Q;  1UE5 A;  3H0G G;  4DKA C;  4LF8 L;  2RCN A;  2JA7 H;  1VQ7 A;  1YHB A;  2NN6 I;  4QJF A;  1KC8 C;  3S16 H;  4JG2 A;  2OQK A;  2IY5 B;  4YCV A;  4JI2 L;  1FVI A;  1VQM A;  4OX9 L;  4A3E H;  2ASB A;  4BY7 G;  4BBS G;  5IYD G;  3EIV A;  4X66 L;  2ZJQ A;  1X56 A;  4JI7 L;  3I4N H;  3W1G A;  1M90 C;  4UP9 A;  2VZA A;  3T1Y Q;  1JJC B;  2A19 A;  3CCE A;  4LF9 Q;  2WP8 J;  1YJN A;  2F4V L;  3S2D H;  4BXX H;  3F8T A;  3TQY A;  4A3M G;  3K0X A;  3TS0 A;  3A74 A;  2LSS A;  2Z6K C;  5LMN W;  2K5H A;  4BA1 I;  4DV2 L;  1LTL A;  2VY3 A;  2CKZ B;  1GM5 A;  2UU9 L;  3UDX A;  3GTL H;  2Q2I A;  1E22 A;  4GNX C;  3SGI A;  4LF6 L;  1M1K C;  1SN8 A;  2EIF A;  2MO1 A;  1S3O A;  1SR3 A;  1L1O B;  4LF5 Q;  1VQO A;  1UE6 A;  4IPC A;  3FKI G;  1Y1V G;  4AQY Q;  1DGS A;  4A3I H;  3E9I A;  4A3L H;  1TXY A;  1XMQ Q;  3L7Z C;  4BY1 H;  1L1O A;  3CAM A;  3HFZ B;  2JE6 I;  3S14 H;  1FJG Q;  1KD1 C;  4DR5 Q;  1W2B A;  1D7Q A;  1C9O A;  1WCM H;  4HIO A;  3STB D;  2AKW B;  1KRS A;  5J3B A;  3G4S A;  1UEB A;  4IOC A;  4DR7 L;  4A93 G;  1K8G A;  3K7A H;  2NVX H;  3AFP A;  1JB7 A;  3PV0 A;  3PF4 A;  2JA5 G;  1IZ6 A;  1QVF A;  1VQB A;  1AE2 A;  3CXC A;  2JA9 A;  4A3B G;  2BA0 A;  4BBR G;  1K0R A;  1GD7 A;  2ZTD A;  1E1O A;  3H3V I;  4GN4 B;  3PIO A;  1HZA A;  3GDE A;  3HOU G;  4JI6 L;  2VQE L;  1CKO A;  2PI2 A;  1PH2 A;  2VNU D;  2OTL A;  3I7F A;  4X64 L;  3PO3 G;  3TRZ A;  1PH7 A;  1XNQ Q;  1R9T H;  4A76 A;  3CD6 A;  1AE3 A;  3RNU A;  4R4T A;  4LFA Q;  4JI5 L;  1SFO H;  2V1C C;  1CUK A;  3D0F A;  2KEN A;  4LW1 A;  4DV4 L;  5ELN A;  4JI2 Q;  4DV6 L;  3AFQ A;  4LFB L;  1HNZ L;  4DV1 L;  4P71 A;  4L5Q A;  2R93 G;  2A1A A;  1IBL L;  1YI2 A;  4LUV A;  4DNI A;  3AEV A;  2IHF A;  5BR8 L;  3RLF A;  5FJ8 G;  1P16 A;  4JI4 L;  4B3R L;  1TWH H;  3CME A;  1HJP A;  3PO2 H;  4HIK A;  1PH3 A;  1CKM A;  3STB C;  1OXT A;  4DUZ L;  2D0P A;  4GN3 B;  4EX5 A;  3GTM H;  4JBJ A;  3TRE A;  4DV2 Q;  1MJC A;  5C4J H;  4R4Q A;  3RR5 A;  4LF6 Q;  5JJI A;  4IPD A;  3HOX H;  3S24 A;  3K80 C;  3G6E A;  4A3I G;  3PSI A;  2CFM A;  1VQC A;  3S15 H;  4JI8 Q;  1VQN A;  3M3Y H;  2K14 A;  2OQ0 A;  2CCZ A;  2N49 A;  2E2H H;  1P8L A;  4JOI A;  4LF9 L;  1NE3 A;  3CCM A;  1BBU A;  3JAM i;  4YHH L;  1VQI A;  4GOP C;  3J81 i;  2ZTC A;  1S72 A;  1K73 C;  1OTC A;  2B63 G;  4YCU A;  2R7Z G;  3CF5 A;  3OTO Q;  1VQP A;  4POG A;  1JJG A;  4P72 A;  1PH9 A;  1PH4 A;  4LF5 L;  1JT8 A;  4DR3 L;  1HNX Q;  3M7N A;  2ZJR A;  1PVO A;  2Y0S G;  3HKZ E;  1SLJ A;  2EXD A;  1Q46 A;  2CWP A;  2ALY B;  3CCJ A;  4MTN A;  2L15 A;  1XMQ L;  2LXK A;  1B8A A;  2JK8 A;  1HZB A;  2VQE Q;  1VQ4 A;  1EQQ A;  5C0X J;  1CSQ A;  3A5U A;  2AMC B;  2K52 A;  1FJG L;  3DLL A;  4X64 Q;  4DR5 L;  3UDG A;  5IP7 G;  4JYA Q;  4DPG A;  3L0O A;  2UUC Q;  5M5W H;  3I55 A;  3CP0 A;  1O7I A;  2E8G A;  3BJU A;  1UE1 A;  4NXM Q;  3CCU A;  2DGY A;  3J80 i;  2Z0S A;  2KHJ A;  4DV1 Q;  4GNX B;  4X62 L;  3HOZ H;  2JA8 G;  1IBL Q;  4JC0 A;  4A4I A;  4JI0 Q;  3HOW H;  2GVA A;  4GKK Q;  1EUJ A;  2Z6K A;  2K50 A;  1YZ6 A;  2AWO A;  3PO3 H;  4B3R Q;  1E24 A;  1C0A A;  4XIG S;  3HOX G;  4GNX A;  1YEZ A;  3KYH C;  1XNQ L;  2F52 A;  2YTX A;  3I4M H;  2D0O A;  4LFA L;  1XTD A;  4PZ8 A;  5DLQ E;  4JCV E;  3PIP A;  1NTG A;  2D62 A;  5M3F H;  1HR0 L;  2IT1 A;  2A8V A;  3CCV A;  2HQL A;  4YY3 L;  2B29 A;  1KRT A;  5IP9 H;  1KAW A;  2QEX A;  1X3E A;  2GN5 A;  3HOY G;  4OO1 G;  1XNR L;  4B3S Q;  2VQF Q;  2AHO B;  2IHE A;  3FHW A;  5LMU Q;  4B3M L;  1N32 Q;  3UE1 A;  4YHH Q;  1IBM Q;  5FLM H;  3KDF B;  1G29 1;  4LF4 L;  1X6O A;  4L5T A;  1Y14 B;  1YNX A;  5GRO A;  4C3J H;  5HGQ A;  1X9N A;  2VUM G;  4C2M H;  3GTJ H;  3F1Z A;  2FXQ A;  2QGQ A;  3KDF A;  4DR3 Q;  4JI8 L;  1KIX A;  1KXL A;  5H1S E;  1IBK L;  1YJW A;  3PCO B;  1VCI A;  2PQA B;  4IFD J;  1E3P A;  4LF7 Q;  1VQE A;  1I6H H;  1Q1E A;  3HOV G;  2MO0 A;  1S40 A;  3U4Z A;  2E2J H;  1WFQ A;  3F2B A;  4YWK A;  4O0A A;  2KHI A;  2PQA A;  3GD7 A;  3OTO L;  3DM3 A;  3M4P A;  3B6Y A;  2WB1 E;  1U0L A;  3S1R H;  4OO1 I;  3ERS X;  4L5R C;  4A3G H;  1YJ9 A;  4ME3 A;  3J7Z C;  4FDB A;  1CSP A;  3A5Z B;  1V43 A;  3CCS A;  2OTJ A;  5ELO A;  4Y52 H;  1HNX L;  3ER0 A;  4X62 Q;  4WJ4 A;  1YVC A;  2I0Q A;  2HHH L;  2UXB L;  3CPW A;  1PH6 A;  1J5E L;  3UDF A;  3ULJ A;  3Q8D A;  2XTI A;  3PUY A;  2UUB Q;  2R7F A;  2JA7 G;  2WAQ E;  1Z9F A;  1X3G A;  1VQJ A;  4GLV B;  5M3F G;  2KCT A;  1I50 H;  5M5Y H;  4HJA A;  3RN5 A;  4DV7 Q;  3T1H L;  4JYA L;  2UUC L;  4A3E G;  1JMC A;  4GOP B;  4A3C H;  4NXM L;  2UXD L;  3I4N G;  3CW2 C;  3BZC A;  1HR0 Q;  1VQ6 A;  1I94 Q;  2OWO A;  4BXX G;  4DK6 C;  4EQ5 A;  2R92 H;  2I5H A;  3LGJ A;  4YY3 Q;  4LUO A;  3GTO H;  4GKJ Q;  2BH2 A;  1X3F A;  2XGT A;  5FLM G;  4GOP A;  1TWC H;  1TWF H;  5C0X G;  4JI0 L;  1EIY B;  4QL5 A;  4UP8 A;  2YYZ A;  4GKK L;  3NEM A;  4DK3 C;  3HKS A;  1XNR Q;  1YHQ A;  2I5L X;  2LXJ A;  4A3D H;  1W3S A;  3NEL A;  4OWT B;  4B3M Q;  4DR1 Q;  3GTK H;  1SRO A;  4P73 A;  3U50 C;  2VW9 A;  3KOJ A;  1EOV A;  4LF4 Q;  1QVG A;  5C4X H;  1RIP A;  5M3M H;  2YV5 A;  2KBN A;  3KLW A;  5JEA J;  1Y1W H;  4J15 A;  2HIV A;  3GO5 A;  3CC4 A;  3RLO A;  4A3L G;  4BY1 G;  4DR2 L;  4PMW A;  2ATW A;  5GAH C;  1UWV A;  4DV3 Q;  1IBK Q;  1N33 Q;  2IX0 A;  4QY7 A;  2IX1 A;  1AH9 A;  1H95 A;  4B3S L;  3EN2 A;  2VQF L;  1WCM G;  3D31 A;  3M4Q A;  4KHZ A;  1N36 L;  1V1Q A;  2MFI A;  1HZ9 A;  5IY0 A;  5LMU L;  2B3G A;  1QZG A;  1XPU A;  1IBM L;  1N32 L;  5LMN Q;  4DUY Q;  4KHP Q;  3UDI A;  4OWW B;  5FLX c;  3KJP A;  2ID0 A;  4NPS A;  1C7Y A;  1EYG A;  2YTV A;  3RZO H;  1NMG A; 
#chains in the Genus database with same CATH topology
 1MJE A;  1H9S B;  3WOE A;  4DR6 Q;  1LTR D;  1IKL A;  2OCE A;  4IUQ A;  2JEB I;  3S1N B;  1BUV T;  2KED A;  4X6A H;  4DK1 A;  1EZ8 A;  3FVQ A;  2HT1 A;  1LM0 A;  1EFI D;  2B2V A;  1J5E Q;  3M85 A;  2KUM A;  2E76 C;  2Q8R E;  1SRU A;  1QVC A;  1NR2 A;  2JQO A;  5EPL A;  2PO4 A;  2E5L Q;  3T1H Q;  3K58 A;  4HCE A;  4FO2 A;  4IPH A;  1GHK A;  4GLX A;  4RWS C;  3O13 A;  1NR4 A;  3SK8 A;  1DOM A;  3MAQ A;  2F0D A;  3PO2 G;  3L3O C;  3EBE A;  3R93 A;  1BVS A;  2UXB Q;  1QUQ B;  2UUB L;  3BZK A;  5G3L D;  4A3J H;  1PV4 A;  4F8M A;  1G6P A;  1Q8K A;  2K05 A;  1PTO F;  5DAU A;  5LL6 X;  1ILP A;  4KKS A;  2OT2 A;  2XWB B;  3RN2 A;  4L8J A;  3DEO A;  2F0L A;  1HR0 W;  3I8Z A;  1U4R A;  2DJF C;  3UE0 A;  3L2P A;  2K7V A;  5D3D A;  1NJI C;  4K6D A;  4L63 B;  1VQK A;  4Y7N B;  1NNX A;  1ET9 A;  2VXW A;  3PGZ A;  3PO3 H;  3I2Z A;  2PI2 E;  1IXR A;  4QGU A;  4PZ6 A;  3QOL A;  5EPJ A;  2K33 A;  1FL0 A;  5T1G A;  2KCM A;  2WFW A;  3NTH A;  4K2K A;  4IOA A;  3Q0A A;  1F2L A;  1XTC D;  4DR6 L;  3HOW G;  3K0Y A;  5FJ8 H;  4MZ9 A;  3FPP A;  5IYB G;  2MP1 A;  5KNC A;  1Q7Y C;  3NBH B;  5IOD A;  3J81 c;  4ZYS A;  1RL2 A;  4XTC S;  3PUZ A;  2DN8 A;  5I6W A;  2E5L L;  3C1F A;  4YWM A;  1A3U A;  5C3E H;  2BA1 A;  3I4N B;  4LAA A;  1UE7 A;  4R4I A;  4POF A;  1O7Z A;  1EFW A;  4C3H H;  3CCR A;  2ZJP A;  1A15 A;  1PYB A;  1HNW Q;  5KND A;  3GTL B;  1FNV A;  4C3J G;  4DAY B;  5EKI A;  1Q12 A;  4WRD A;  4K5W A;  4DU9 A;  4BY1 B;  4X3K A;  3VA7 A;  2IWH A;  4ZKC B;  4G4K A;  2HUG A;  3D4R A;  1GUW A;  2L55 A;  1IYJ B;  5IT9 c;  1N8R C;  5IP7 H;  2Y0S E;  5JJL A;  1D1I A;  2Z4I A;  3BU2 A;  1K8M A;  4X66 Q;  3DXJ C;  2EYM A;  3W1B A;  1H9R A;  5I9P A;  1EY8 A;  2JA8 H;  1JWS D;  3OPO A;  2VB2 X;  1EYA A;  1EIG A;  5AFW A;  1KL9 A;  2UU9 Q;  1BCP B;  2BH8 A;  3ITP A;  1AP0 A;  3SXH A;  3M9B A;  3CKI B;  4UDU C;  5L37 A;  3I56 A;  1JIC A;  4AIM A;  5C44 G;  4A3C G;  5JJZ A;  1V9P A;  5KIX A;  5COR A;  4RKL A;  5DM6 3;  1TWC B;  2K32 A;  3EJI A;  3CQZ H;  1QWY A;  4HIM A;  1MSH A;  1TWH B;  4LNQ A;  4KMU C;  3KLR A;  2EY6 A;  5JVH 3;  2SNM A;  1B70 B;  5EKK A;  2VUM H;  2EE1 A;  1U4M A;  2PZU A;  3X3N A;  2NN6 G;  5M3M G;  4AQY L;  1O80 A;  4JI1 Q;  2ICI A;  3K81 C;  5CV6 A;  3PMF A;  2B2T C;  4OON A;  1YBY A;  2NVY H;  3IL8 A;  2F0W A;  3KLS X;  3OOC A;  5KEE A;  4DV4 Q;  1WTP A;  4IJL A;  4P74 A;  4DV6 Q;  4QQB X;  3HKZ B;  1LUZ A;  4OIK A;  1TWA B;  5C5L A;  1A62 A;  2NVQ B;  3FP9 A;  3CRK C;  4RGO S;  5FOB B;  3TS2 A;  3H0G G;  1ENF A;  2RCN A;  1YHB A;  4RH6 A;  3OWE B;  1KC8 C;  3S16 H;  2IY5 B;  4CKE A;  4JI2 L;  1FVI A;  1HA5 A;  2ASB A;  2J0T D;  1JQY D;  4BY7 G;  2RDG A;  3I73 A;  4X66 L;  1I4H A;  3A8J E;  3W1G A;  1M90 C;  4UP9 A;  1JJC B;  3CCE A;  4LF9 Q;  5ELF A;  2EXZ A;  1ESR A;  1CT1 D;  2Z6B A;  5LMN W;  2K5H A;  1B3Q A;  1GM5 A;  2VY3 A;  2UU9 L;  1HTP A;  1HCZ A;  1I4R A;  2K5D A;  3SGI A;  5FLX E;  4GNX C;  1SN8 A;  1IL8 A;  3C1E A;  1Y1V G;  1DGS A;  2EVB A;  3E9I A;  1XMQ Q;  1NAP A;  1L1O A;  3HFZ B;  1JOQ A;  1KNE A;  1LAB A;  3NP8 A;  3D6C A;  1S4Z A;  1KD1 C;  4BS9 A;  1B3A A;  1DYQ A;  4G7H C;  1WCM H;  1KRS A;  2F0P A;  5J3B A;  4A93 G;  1RTN A;  1IZ6 A;  1VQB A;  4KKU A;  1AE2 A;  1R4Q B;  1VF7 A;  4A3B G;  2BA0 A;  1A3T A;  3A8I E;  4KJN A;  3HOU G;  1AZP A;  1LT3 D;  2OTL A;  3I7F A;  2SEB D;  1SE2 A;  1I6H B;  1R9T H;  3CD6 A;  1FNU A;  1SFO H;  2KEC A;  2RCF A;  5IGE A;  4DV4 L;  2B2U A;  2IX3 A;  4ZUJ A;  2A6H D;  4DV6 L;  3AFQ A;  1BNZ A;  4DV1 L;  4XYO A;  4A3G B;  1HPC A;  2XRS D;  2A1A A;  4DNI A;  1CA6 A;  4KY7 A;  4KKT A;  3TSS A;  1CKM A;  2D0P A;  3TRE A;  4DV2 Q;  3BS1 A;  3SEB A;  1HQM C;  5M5Y B;  2B2W A;  3K80 C;  3G6E A;  1VQC A;  3S15 H;  2PZW A;  1LTG D;  2OQ0 A;  2MPM A;  2N49 A;  1P8L A;  4JOI A;  4LF9 L;  5J22 A;  3D3R A;  4YHH L;  2ZTC A;  2B63 G;  3K6O A;  4C3I G;  3OTO Q;  4A3D B;  1AW7 A;  4BWG B;  1JJG A;  2BDO A;  1PH9 A;  1KDB A;  3SR1 A;  2JSO A;  1PH4 A;  2RA4 A;  3ONA B;  3PIO 3;  5C4X B;  4B9W A;  2RSN A;  1GUS A;  1Q46 A;  4MTN A;  1XMQ L;  5LHY 1;  1CK1 A;  2G9D A;  2K52 A;  2CW0 D;  4C56 C;  1F2Y A;  4DPG A;  3L0O A;  1D5X C;  1QCB D;  1S5D D;  4K8I A;  2Z0S A;  5IGB A;  2KHJ A;  3HOZ H;  1IBL Q;  4H0L C;  2PZT A;  2GVA A;  3IKJ A;  2K50 A;  1YZ6 A;  4B3R Q;  4XT3 B;  1E24 A;  4XIG S;  1VMP A;  1B1Z A;  4MTK A;  5ELB A;  3NUC A;  5ELC A;  4JCV E;  4BBS B;  5EBD A;  2EYL A;  2IT1 A;  2A8V A;  3CCV A;  2HQL A;  1H9M A;  3NSW A;  3KLS A;  1F9Q A;  3GTG B;  3WDN A;  4OO1 G;  5KGU A;  1XNR L;  5KNB A;  3FHW A;  2CW0 C;  3MEH A;  3GP7 A;  3LWE A;  1G29 1;  1GUG A;  4KJO A;  1Y14 B;  3U9O A;  4C2M H;  1PRT D;  3KDF A;  4DR3 Q;  1KIX A;  3FDT A;  3MA2 B;  1YJW A;  1VCI A;  1E3P A;  1ROD A;  2MO0 A;  3MVV A;  4HTH A;  2CH4 A;  1WFQ A;  3F2B A;  4YWK A;  3NE5 B;  3OTO L;  1JE4 A;  2D2C C;  1PXU A;  3A5Z B;  3DMU A;  4ID6 A;  3ER0 A;  4X62 Q;  4WJ4 A;  5FK9 C;  3CPW A;  2LY7 A;  3HG9 A;  3PUY A;  1CHQ D;  4X3T A;  1STN A;  3PO3 B;  5M3F G;  2KCT A;  3RN5 A;  4DV7 Q;  4A3E G;  1JMC A;  1PRT C;  3ZYY X;  2E74 C;  4ZKB B;  3BZC A;  4BXX G;  1I94 Q;  3QWN A;  4DK6 C;  3GTO H;  2I5H A;  4YY3 Q;  4GKJ Q;  1X3F A;  5FLM G;  4GOP A;  1TWC H;  2PQE A;  1B2T A;  5IT9 L;  4ZLT F;  3NEL A;  2EJF C;  4P73 A;  2HDM A;  1QVG A;  1SYD A;  2FFK B;  4CJ2 C;  1RIP A;  4A3I B;  2KBN A;  1V1P A;  5FO9 B;  4IUV A;  2QF7 A;  3RLO A;  3S14 B;  2PNR C;  3BVM A;  4RGN A;  4DV3 Q;  2XVS A;  1IBK Q;  1N33 Q;  4QY7 A;  1LTI D;  2IX1 A;  4C3H B;  3EN2 A;  2NVX B;  1V1Q A;  4N8F A;  1B53 A;  1RJT A;  1EYD A;  3H09 A;  3UDI A;  4OWW B;  4G57 A;  5FLX c;  4NPS A;  4ZUI A;  1EYG A;  1TWA H;  3CCL A;  1JE5 A;  3BDL A;  2F0E A;  1LT5 D;  1Q8I A;  2NVQ H;  3PF5 A;  2FIN B;  2R61 A;  1OXV A;  3A0J A;  1H9S A;  1TQO A;  3Q23 A;  1TT2 A;  2G9H D;  2R92 G;  5IYD H;  1ILQ A;  2SOB A;  3JC6 6;  2UXD Q;  4OWX B;  1GO3 E;  5JEA H;  1JJ2 A;  2JA8 B;  4GS3 A;  1STH A;  4DV0 Q;  4ILW A;  4ZK9 B;  3RMH A;  3TEH B;  3VDY A;  1F9S A;  4XYQ A;  1AH9 A;  2PMZ E;  3OYY A;  5CR3 A;  1WD0 A;  3CCQ A;  1B4O A;  2AQ2 B;  1XMO L;  3M3Y B;  4DV7 L;  3KF8 B;  3G48 A;  4LWC A;  1QUQ A;  1X55 A;  3CC7 A;  4FYD A;  3GV6 A;  1VQG A;  4N9T A;  1I94 L;  1JC7 A;  1N9W A;  4GKJ L;  1FR3 A;  1EY7 A;  1SEB D;  4H13 C;  2YTY A;  3E6Z X;  2EYF A;  2WII B;  1Q81 C;  1D1K A;  2VL6 A;  5TSS A;  2JA5 H;  2VUM B;  3S2H H;  4X3S A;  2FMC A;  4RKB A;  3CRL C;  1B7Y B;  1PFS A;  2R6G A;  1QB5 D;  2IW3 A;  5JJK A;  1X65 A;  3BYY B;  1K83 H;  4AYB G;  4DV3 L;  1N33 L;  4IPG A;  3BDO A;  5M5W B;  2NVY B;  3WWV A;  4CDF C;  1KQS A;  2NZH A;  1D8L A;  1AFP A;  1IHZ A;  2R93 H;  2A74 C;  3H15 A;  3DM1 A;  3VR5 A;  2EZV A;  2N8N A;  1B50 A;  1HH2 P;  4IAL A;  1TWG H;  5I2Y A;  2EYH A;  1VQD A;  2ENB A;  3K5O A;  2TMP A;  3BYT B;  4UP7 A;  4A3J G;  5C3X A;  4F7X A;  3FPU B;  3S16 B;  2K4K A;  3EA6 A;  4KLK A;  4HED A;  4LUZ A;  1E2W A;  4MNO A;  3NBH A;  3L9A X;  4UAI A;  3CPF A;  1XJV A;  1NY4 A;  3G6J B;  3MWY W;  1S5B D;  2Z4H A;  3D4W A;  4JBK A;  3J80 L;  4DV0 L;  2AWN A;  5IOC A;  1UUP A;  3J7Y W;  3H94 A;  2AQ3 B;  1TS2 A;  1Q90 A;  5I4D A;  3H3V C;  3SK5 A;  3FRP B;  1E1T A;  2A69 D;  4R4O A;  2F0U A;  3S17 H;  1GJX A;  4DR4 L;  4XXE A;  1JWU D;  3TP7 A;  3RLN A;  2CQA A;  1MIU A;  1WTR A;  1QZH A;  4DAY A;  2WB1 G;  4K5V A;  4LF8 Q;  4FVM A;  2E2J B;  1PA6 A;  3KF6 B;  1WCM B;  5IE8 A;  2F4I A;  5K36 G;  2VS1 A;  2DY8 A;  3HGB A;  1EQV A;  2F4V Q;  4R4C A;  4MN3 A;  4P75 A;  2WAQ G;  2HDL A;  1PH5 A;  4QIW E;  5C0X I;  4I65 A;  1T9H A;  3W5O A;  2K75 A;  4A75 A;  3HEJ A;  1I50 B;  3NWT A;  4DXG A;  2QCP X;  1R9T B;  1LYL A;  1SFO B;  5C3E G;  1JCK B;  4K2L A;  4UY8 C;  1J8I A;  1QG7 A;  2ES2 A;  3SDZ A;  1G6Z A;  1PTO D;  4PMB A;  1KNA A;  3OW2 A;  4BBS H;  4MHE A;  1TWF B;  1LO5 D;  2RVL A;  1WTX A;  3HOY H;  1YHA A;  3GTG H;  1A2U A;  4IFD G;  3E9H A;  3CU7 A;  1Z6H A;  4R8N A;  3R2I A;  3S15 B;  1Y1W G;  4JI6 Q;  3TBI B;  1XPR A;  2F0I A;  4R1J A;  4N9P A;  4OEM B;  4HJ9 A;  1VQ8 A;  3OIQ A;  1U4L A;  3HOV H;  4OIJ A;  2CWA A;  4RCO A;  1I5F A;  1A3V A;  3M4Y A;  2M00 A;  4MIU A;  2F0O A;  5GQO A;  1PTO C;  1VQH A;  4A3K B;  3MEF A;  4HJ5 A;  1A6X A;  3ICE A;  4JI4 Q;  1Y8N B;  1MHW C;  1EY9 A;  3MFY A;  1EL0 A;  4QMG A;  4EQO A;  3K5M A;  5EGT A;  4A3F G;  1UE5 A;  1TR5 A;  4LF8 L;  1GOZ A;  3H91 A;  2DNC A;  3ND8 A;  4JG2 A;  4N8X 1;  3I72 A;  4YCV A;  5J39 A;  3K5L A;  2JA6 B;  1K0S A;  2NTT A;  4KN4 C;  5CV5 A;  3EIV A;  2ZJQ A;  2E75 C;  3LNN A;  2R3Z A;  3TN2 A;  3BVG A;  2F4V L;  2A19 A;  1HUN A;  1ICF B;  2WP8 J;  1YJN A;  3HOZ B;  4O42 A;  3VYR A;  4QF4 A;  3TQY A;  4A3M G;  3K0X A;  2LSS A;  1SYB A;  2Z6K C;  4BA1 I;  2F3V A;  1CFM A;  2CKZ B;  1E22 A;  3NXW A;  1M1K C;  1EQT A;  2EIF A;  5HUR A;  1SR3 A;  4H7B A;  1UE6 A;  2BCO A;  3FKI G;  3NQI A;  4G7O C;  4AQY Q;  4A3I H;  1TXY A;  3L7Z C;  3DUZ A;  3S14 H;  1FJG Q;  1K3B C;  4PV1 C;  2SDF A;  1W2B A;  3QIA A;  4HIO A;  4KK7 A;  3STB D;  2AKW B;  1K8G A;  3K7A H;  2NVX H;  4WFN 3;  3KK7 A;  1TS4 A;  4C2M B;  4BBR G;  1K0R A;  2KA7 A;  1E1O A;  1CQF A;  3NHH A;  2D9U A;  2GA4 B;  4JI6 L;  1CKO A;  2PI2 A;  2HCC A;  4K8J A;  4B9X A;  2VNU D;  4H44 C;  1STB A;  1XNQ Q;  2O4X A;  4A76 A;  3RNU A;  4IUU A;  4ZCK A;  1CUK A;  1FYC A;  4LW1 A;  4M1U B;  1ICW A;  4JI2 Q;  2WAC A;  5CMD A;  4ZRZ A;  4P71 A;  4L5Q A;  1X3Q A;  2A6E D;  4LMQ D;  4LUV A;  3AEV A;  3CHB D;  3RLF A;  4JI4 L;  1HJP A;  1HUM A;  4HIK A;  3J7A F;  3PO2 H;  3STB C;  3GTM H;  2B2Y C;  5J1Z A;  4R4Q A;  2YU9 B;  3A56 A;  4IZ8 A;  1QOH A;  1HXY D;  1W6K A;  2Z9H A;  3S1M B;  4JI8 Q;  1VQN A;  3M3Y H;  3S1Q B;  1BF4 A;  3GTO B;  1KLU D;  1ZKO A;  3CCM A;  1G91 A;  3TDQ A;  3ERQ A;  2R7Z G;  4YCU A;  4ODG A;  2L9H A;  3HRZ C;  4POG A;  2ZXR A;  5LL6 S;  5CGK A;  1TY0 A;  1PMR A;  5K5P A;  2A6E C;  1II3 A;  2HHH Q;  3M7N A;  3CCJ A;  1KLG D;  2L15 A;  1VQ4 A;  1EQQ A;  4XQQ A;  3DWA A;  1SSO A;  4DK0 A;  1CSQ A;  1FJG L;  3DLL A;  4XT1 B;  1EY0 A;  5M5W H;  4NDX A;  3BJU A;  3GTQ B;  2MGS A;  2DGY A;  4KTA A;  4DV1 Q;  4GNX B;  3N52 A;  1TVX A;  1VMC A;  4JC0 A;  1BCP F;  4RCN A;  4A4I A;  4JI0 Q;  3MTS A;  3HOW H;  4K5X A;  2AWO A;  4DFA A;  3BVZ A;  2B2V C;  3KUP A;  1XNQ L;  2D0O A;  4PQX A;  5DLQ E;  2EYO A;  5E1F A;  2L0C A;  4RFB A;  2FHT A;  4I7Z C;  2WKD A;  2GN5 A;  2IJ0 A;  2VQF Q;  2AHO B;  5LMU Q;  1N32 Q;  2KCC A;  4YHH Q;  1IBM Q;  3IAY A;  1IKM A;  2J4X A;  3VA5 A;  2OF1 A;  4C3J H;  1YNX A;  1X9N A;  1W6J A;  1O78 A;  2QGQ A;  4JI8 L;  5H1S E;  4DN4 M;  3PCO B;  5C5M A;  1QIL A;  5M9O A;  4IFD J;  4LF7 Q;  2NVT B;  4TSS A;  3HZX A;  3FEW X;  1S40 A;  2E2J H;  3GD7 A;  3M4P A;  3B6Y A;  2WB1 E;  1U0L A;  3S1R H;  4CHT B;  3ERS X;  2JA5 B;  1L0X B;  1YJ9 A;  3TP8 A;  3S2H B;  1CSP A;  1PYW D;  2OTJ A;  2F0T A;  2FMM A;  1EZ6 A;  1YVC A;  1AN8 A;  2HHH L;  3J7A V;  5EQ0 A;  1PH6 A;  4DNT B;  1XXG A;  2XTI A;  2EDG A;  1GUO A;  5I9O A;  1STE A;  1K83 B;  2R7F A;  2WAQ E;  2JA7 G;  1X3G A;  2CH4 W;  3PIP 3;  1I50 H;  3NTK A;  1EEI D;  1ZYR D;  3OSO A;  3OHX C;  4A3C H;  4KD3 A;  3I4N G;  2R93 B;  3K5N A;  1VQ6 A;  3D6W A;  3VR2 A;  4EQ5 A;  2OWO A;  4WJW A;  4NP5 A;  2F0F A;  2BH2 A;  1TWF H;  5C0X G;  1TWG B;  1T5E A;  2DNE A;  4QL5 A;  4XDX A;  4JI0 L;  1XNR Q;  2I5L X;  2LXJ A;  4DR1 Q;  3GTK H;  3U50 C;  3DWQ A;  4C1N K;  3KOJ A;  2QDB A;  5F2D A;  1DON A;  2NN6 H;  5M3M H;  2EY5 A;  3GO5 A;  2F0H A;  4A3L G;  4BY1 G;  4DR2 L;  2ICE C;  1NUC A;  5T1I A;  5GAH C;  1UWV A;  2XRQ D;  4G7Z C;  4RAU C;  3GQB A;  3SK6 A;  1PFB A;  1RHP A;  3NTI A;  2VQF L;  3M4Q A;  4KHZ A;  1N36 L;  5LMU L;  1XPU A;  1HZ9 A;  1N32 L;  3WOF A;  2B3G A;  1QZG A;  1IBM L;  4DUY Q;  4KHP Q;  1YNN D;  4HCS A;  2YTV A;  2UXC Q;  1NMG A;  4JBW A;  4A3K H;  2A6H C;  3S17 B;  2SNS A;  4LJZ C;  1EY5 A;  2Y0S B;  4R8I A;  1ONL A;  2RDF A;  4CGY B;  5BN4 A;  4NXN L;  2F0M A;  1GVP A;  5KRU A;  4LF7 L;  2E2D C;  3MZ5 A;  3CMA A;  1GXD C;  5CV9 A;  4BY7 H;  4IO9 A;  2JA6 H;  3PUW A;  2EPB A;  1CM9 A;  1ENC A;  1SYC A;  4L6T B;  5KYL A;  3MXG A;  3C46 A;  2C35 B;  4IN3 A;  3I91 A;  1BO0 A;  1V8Q A;  5C3W A;  1EQR A;  5IWA Q;  1QJO A;  5E7N A;  1VQ9 A;  3HOX B;  1YNN C;  4CJ1 B;  5COY A;  5GAE C;  4UHV A;  1GHJ A;  3IRB A;  2RKS A;  3MC0 B;  1PLF A;  2KCN A;  4KV6 A;  4OGQ C;  2O5I C;  1OXX K;  5M5X H;  3HOY B;  3KF8 A;  4TVA B;  3NEN A;  4X65 L;  1OO9 B;  1M4V A;  4RGT A;  4A93 H;  1F77 A;  5HY6 A;  4GZY C;  3E5S A;  3HKZ G;  4DR1 L;  3X3M A;  3LWU A;  2I5M X;  1PH1 A;  2Q2H A;  4K14 A;  2Q8T A;  1PFM A;  3I4O A;  3PUX A;  3HOU H;  1KDC A;  3MXN B;  1PRT B;  2H4O A;  1VQ5 A;  2BDN A;  3HOV B;  1SNO A;  4K0K Q;  5E3F A;  3J81 L;  4DUY L;  4KHP L;  5JEA G;  3HS0 C;  2BE5 D;  2UXC L;  2PCF B;  4RGM A;  5E4X A;  4ABN A;  1XPO A;  2QEJ C;  2Q2U A;  2XNA C;  3AQQ A;  5CBA E;  4NW2 A;  3I4M G;  2NZO A;  4OEL B;  4RMF A;  2JP1 A;  5IYC H;  4B3T L;  2YU9 H;  1XMO Q;  2PPB C;  3S1M H;  5IP9 G;  3EFX D;  3S1Q H;  5GAD C;  2KVM A;  1ET6 A;  2B63 H;  4HJ8 A;  4C3I H;  2Q8I B;  4WOR A;  1PH8 A;  2I46 A;  1BDO A;  5IWA L;  1WI5 A;  2UUA Q;  1TS5 A;  1OXU A;  2LFN A;  2PNH A;  5ISR A;  1U5K A;  2RHQ B;  1WOC A;  1Q82 C;  1L1O C;  2L1B A;  1IW7 D;  4WJ3 M;  4PZ7 A;  4FXD A;  2DUD A;  1LAC A;  1UAP A;  1CKN B;  4HN7 A;  4OX9 Q;  4HR7 B;  1WTH A;  3K7A B;  4DV5 L;  1BXT A;  3KF6 A;  4A3G G;  3GTQ H;  4BA2 I;  4J8Q A;  3ULL A;  4EVO A;  5D65 A;  1LV9 A;  4HMJ A;  1Q3L A;  3G71 A;  2LMC B;  2GVB A;  4NB3 A;  3E0E A;  2M2L A;  1HZC A;  1QE6 A;  4YWL A;  2B2U C;  2L5T A;  3T1Y L;  3U58 A;  2OEO A;  4K0K L;  1L2F A;  3T51 B;  1CI3 M;  2N78 A;  4OO1 H;  2JJQ A;  2RHS B;  2EY1 A;  4V19 0;  4A3D G;  4DR7 Q;  3PO2 B;  1AEX A;  3GTM B;  2F3I A;  1RCV D;  2B2W C;  5C4X G;  3GV3 A;  4O2D A;  4YCW A;  1TKW B;  4X3U A;  4DR4 Q;  1KDA A;  4JOI C;  5E4W C;  1Q1B A;  3K59 A;  4JI5 Q;  5DNF A;  3RZD H;  2NVT H;  4P2C B;  4KI0 A;  3SHL A;  4RG1 A;  3F2D A;  3RZO B;  1MSG A;  4JVZ A;  4HJ7 A;  1HNZ Q;  1Y69 U;  2UUA L;  1WJJ A;  1J6Q A;  4IJH A;  3TP5 A;  1XWE A;  5GAG C;  2K6A A;  1SMY D;  2QW7 A;  1EWC A;  2X69 A;  4DUZ Q;  1A2T A;  4DKA C;  1XYI A;  3NQT A;  1I4P A;  2NTS A;  2NN6 I;  1E2Z A;  3M7G A;  1QNU A;  4QJF A;  1VQ7 A;  1QNK A;  2OQK A;  2RSO A;  4TKO B;  1VQM A;  4A3E H;  4OX9 L;  4BBS G;  1NSN S;  3I70 A;  4JPB W;  4KY6 A;  2VZA A;  1D6E C;  4BXX H;  2EJM A;  2X6L A;  4HSP A;  5BN3 A;  5JOB A;  3HOW B;  3M4O B;  3VYT A;  4JW0 A;  3TS0 A;  3ND9 A;  2JN4 A;  1LTL A;  2HD3 A;  3UDX A;  4LF6 L;  4TRD A;  5EBC A;  2E2I B;  4O1N A;  2O2L D;  5A2Q E;  1KTK A;  2Z8L A;  2C5C A;  1F9R A;  1XX8 A;  1I3Q B;  4QUC A;  4DF7 A;  1SND A;  1SMY C;  2F0Q A;  3ERO A;  3CAM A;  3BZD B;  1EY6 A;  5JAV A;  1TY2 A;  2I07 B;  3G4S A;  4DR7 L;  1UEB A;  1MI2 A;  1FGB D;  3AFP A;  5CV8 A;  1JB7 A;  3PF4 A;  4C3J B;  2JYO A;  1WTO A;  1RD9 D;  2JA9 A;  1D5M C;  3PIO A;  3GDE A;  1RDP D;  2VQE L;  3V2T A;  3T56 B;  3OW7 A;  4X64 L;  3PO3 G;  1AE3 A;  4R4T A;  4LFA Q;  4JI5 L;  1X32 A;  2V1C C;  2KEN A;  3N6R A;  1LTS D;  1ENA A;  5ELN A;  3S1R B;  1SBB B;  3VR4 A;  5KYI A;  1HNZ L;  4FNF A;  1EYC A;  1YI2 A;  2IHF A;  1STG A;  5FJ8 G;  1Z7T A;  2QKI C;  2WKC A;  4DUZ L;  2PW7 A;  4KHV A;  3Q24 A;  4EX5 A;  4JBJ A;  1MJC A;  1CZW A;  2Z1C A;  2ZXO A;  5C4J H;  5JJI A;  3HOX H;  3S24 A;  1SYG A;  4I7A A;  4A3I G;  5JPM C;  3QOJ A;  5C44 B;  5CV4 A;  2K14 A;  2A69 C;  2B2T A;  1NE3 A;  4C3H G;  2L12 A;  3JAM i;  4GOP C;  1PTO B;  4HMI A;  1RF2 D;  5CC4 A;  1OTC A;  4IUR A;  4P72 A;  3GTK B;  1GUT A;  1DCZ A;  1JT8 A;  4V0B A;  3NPP A;  5M3M B;  1X3P A;  4DGZ A;  2ZJR A;  2K1B A;  3HKZ E;  2EXD A;  2CWP A;  2ALY B;  4XQJ A;  1SNC A;  2XWJ B;  3JAM E;  2NZ1 D;  2CVR A;  5C4H A;  1K8O A;  3SVM A;  3C3L A;  1G2S A;  1DD2 A;  2BOS A;  3UDG A;  5IP7 G;  4JYA Q;  3K57 A;  3I55 A;  1O7I A;  4NXM Q;  3OIP A;  3J80 i;  5EJW A;  1WVL A;  2JA8 G;  3MFG A;  3MXU A;  3H0G B;  4CBV A;  1C0A A;  4GNX A;  5I6Y A;  3KYH C;  4KN7 C;  3T13 A;  2K03 A;  4LFA L;  2NBF A;  1L0Y B;  3TZD A;  4PZ8 A;  2D62 A;  4BY7 B;  3J80 E;  1HR0 L;  4QUF A;  4ULL A;  2PMZ B;  4FXK C;  2B29 A;  3W3A A;  1KAW A;  2QEX A;  1X3E A;  4B3S Q;  5FO7 B;  4B3M L;  2B39 A;  1EOT A;  4LF4 L;  1DOK A;  4L5T A;  2VUM G;  1HFG A;  5G3L F;  2F0G A;  3URY A;  1KXL A;  1Y1V B;  2PQA B;  1V1O A;  1VQE A;  5M5X B;  1Q1E A;  1SYF A;  1JOO A;  1SJE D;  3U4Z A;  5K36 H;  2RQX A;  2KHI A;  4O0A A;  2KQ3 A;  3GTP B;  4A93 B;  2KOL A;  4IUP A;  2K5W A;  4OO1 I;  5JVG 3;  2N55 A;  4L5R C;  3J7Z C;  4DA2 A;  1CA5 A;  4A3B B;  1V43 A;  3CCS A;  2VB3 X;  3T4A C;  3HOU B;  3TME A;  2JA7 B;  5BN5 A;  1J5E L;  2MJ8 A;  3ULJ A;  3Q8D A;  1PDQ A;  4FF3 A;  3TZU A;  3T1H L;  3EVQ A;  4Q5V A;  4JYA L;  5NUC A;  4CJ0 B;  4J1M A;  4YIJ A;  4RHR A;  3VR3 A;  4NXM L;  3S2D B;  3KBX A;  3CW2 C;  1C4Q A;  3QR8 A;  1IYU A;  4LUO A;  2F1M A;  1EIY B;  2YYZ A;  2UXB L;  4DK3 C;  1UNS A;  1YHQ A;  4FXG C;  4IFD H;  4OWT B;  1C8C A;  1SRO A;  3VYS A;  3VYU A;  1CTM A;  3KLW A;  1Y1W H;  5FLX L;  4J15 A;  3CC4 A;  2O5J C;  4PMW A;  4CDD C;  2ATW A;  2AUJ D;  3P75 A;  2MHV A;  4B3S L;  1WCM G;  3D31 A;  2B63 B;  2MFI A;  4C3I B;  5IY0 A;  4ME5 A;  2EOT A;  5LMN Q;  5C6A A;  3KJP A;  1C7Y A;  3RZO H;  1BCP D;  1N34 Q;  1NBW A;  1C48 A;  1E0B A;  3A54 A;  3A8K E;  3OMG A;  1A0I A;  4JV5 Q;  2A68 D;  4A3F H;  1SDF A;  1DXM A;  2F0N A;  3KJO A;  2L11 A;  4OXP A;  1E2V A;  1ML0 D;  2G5D A;  1PHJ A;  4GLA C;  2D5D A;  2F0K A;  4QIW B;  1IL2 A;  4HAE A;  1HA6 A;  4ZAI A;  3K7U C;  5I2X A;  1M8A A;  4ALP A;  4QCL A;  1WTV A;  1JR0 D;  5ELE A;  4AYB E;  1BBW A;  4PNY A;  3K8A A;  4A3M H;  1L0W A;  3H3V H;  3F2C A;  3M4O H;  3LX0 A;  2F03 A;  4H02 A;  5A35 A;  5IYB H;  3RUZ A;  3FKI H;  1BCP C;  4R9W A;  2E2I H;  2E2H B;  1SE4 A;  2MNA A;  3AU7 A;  2A68 C;  1I3Q H;  4DR2 Q;  2AUK A;  4PMC A;  1Q86 C;  1HNW L;  4TQU S;  4DNR B;  1SMX A;  4XQN A;  1N36 Q;  1VQA A;  1FGU A;  4A3K G;  2N3S A;  2A73 B;  2EYP A;  3IFT A;  3HP3 A;  3R3O A;  2FJ2 A;  4BBR H;  1F2Z A;  4GN5 A;  3FMC A;  1U9R A;  2ZM6 Q;  3E3X A;  1SE8 A;  3CC2 A;  1HFN A;  4NXN Q;  5D14 A;  1BOS A;  3RZD B;  2JA6 G;  1OXS C;  1LTB D;  1I4Q A;  3J7A 5;  4IUT A;  5LMN L;  3MXN A;  3KFU A;  1KHI A;  3PQI A;  2RBM A;  3DHQ A;  2R7D A;  2ZTE A;  4LFC Q;  3HOZ G;  2MQH A;  1N34 L;  1DZ1 A;  1E7Z A;  1K8A C;  2H5X A;  4LK1 C;  5AJ3 Q;  1YIJ A;  4JI3 Q;  4JV5 L;  3I4M B;  2K5N A;  3JAM c;  3Q22 A;  1HQR D;  5M3F B;  1A63 A;  1Y8O B;  4A3E B;  2RF4 A;  2EQS A;  2WIN B;  2CQO A;  3I3C A;  4U67 3;  5C44 H;  2IPK D;  1G51 A;  1ASY A;  4F87 A;  1S5F D;  1SNM A;  3AYH B;  2HIX A;  2R7Z H;  1JOR A;  2F3W A;  1Z47 A;  4Q0F A;  4FP5 D;  1PTO H;  1WYD A;  4X65 Q;  4M8A A;  2QA4 A;  3GTJ B;  1ZXT A;  3R8B A;  4HID A;  5EAY A;  2EJG C;  4JI1 L;  1BQQ T;  3S1N H;  1RKN A;  4EQN A;  3J80 c;  1K3R A;  1VQF A;  4APV A;  1K28 A;  4JK1 C;  2IL8 A;  2KHS A;  3AMU A;  3QJY A;  1X54 A;  3ZJY C;  1GUN A;  1LTA D;  4E6I A;  1MGS A;  4JI7 Q;  2K5Q A;  1EWH A;  2XN9 C;  2OXP A;  1CKN A;  1ZYR C;  1DM0 B;  3V05 A;  2QDL A;  2XIW A;  1ZEQ X;  3T53 B;  3J81 j;  3U9S A;  1O7L A;  3ULP A;  2ZM6 L;  4PG3 A;  3V96 A;  2F0J A;  1EWI A;  5JPN C;  1TII D;  5IYC G;  1NMF A;  3H0G H;  4HSV A;  1YIT A;  2Q2T A;  2R92 B;  1R4P B;  4B3T Q;  1BBX C;  1EIF A;  4NMZ A;  1BKB A;  2JEA I;  4LFC L;  1PZK D;  2N88 A;  3A7A B;  3U4V A;  1ASZ A;  1SE3 A;  4JBM A;  5AJ3 L;  4JI3 L;  2K01 A;  2X6G A;  1VS0 A;  1PYS B;  4L5S A;  5C4J B;  3PUV A;  4KY5 A;  1PFN A;  2P5Z X;  1MBY A;  4Y7N H;  4FF4 A;  1A8V A;  1MKH A;  4UPA A;  1I6V C;  1EU4 A;  5CYU A;  4DAM A;  1ESF A;  1Y1V H;  5C4Z A;  3C2P A;  3SK4 A;  3TP6 A;  2H1E A;  3NK9 A;  4LFB Q;  1U4P A;  1SYE A;  3GTP H;  4DV5 Q;  1EY4 A;  1LT4 D;  4AH6 A;  1GKH A;  5BR8 Q;  4IFD I;  3F2U A;  1K9M C;  1DJR D;  2K5V A;  4A3B H;  1VQL A;  5IGD A;  3P1H A;  4AYB B;  2JA7 H;  1MD2 D;  3SE0 A;  5IYD G;  3E0J A;  1SNQ A;  1X56 A;  4JI7 L;  4IUN A;  5D3I B;  3I4N H;  3T1Y Q;  3A55 A;  3S2D H;  3F8T A;  2HQE A;  4KD4 A;  5DEH A;  5C0X H;  3A74 A;  4DV2 L;  3GTL H;  2Q2I A;  4A3J B;  4U68 A;  4CKB A;  2MO1 A;  1S3O A;  3QO2 A;  1L1O B;  4LF5 Q;  1VQO A;  3AB9 A;  4IPC A;  4A3L H;  4BY1 H;  1HRJ A;  3BDC A;  5IGC A;  2JE6 I;  1STY A;  4CDC C;  3KBG A;  4DR5 Q;  1D7Q A;  1C9O A;  2AQ1 B;  1D2B A;  5FKA C;  1EEF D;  4IOC A;  4EQP A;  1YNJ D;  1DOL A;  3PV0 A;  2M9V A;  2JA5 G;  1QVF A;  5DM7 3;  1HTL D;  3CXC A;  3T16 A;  1WTQ A;  4F88 A;  3NWS A;  1B9M A;  3H3V I;  1GD7 A;  2ZTD A;  4GN4 B;  1HZA A;  2LKV A;  1PRT F;  3MXP A;  2BE5 C;  1PH2 A;  3P20 A;  2WB1 B;  1EU3 A;  3TRZ A;  1WD1 A;  1PH7 A;  3D0F A;  1WTW A;  4DXF A;  3S9W A;  2B8G A;  4LFB L;  5EKL A;  2R93 G;  4DAP A;  1CHP D;  1IBL L;  1F9P A;  2WAQ B;  4FF2 A;  1F2M A;  2JXM B;  5BR8 L;  1P16 A;  4B3R L;  1TWH H;  2B8F A;  1STA A;  3CME A;  1G8Z D;  1PH3 A;  1OXT A;  4GN3 B;  2MUY A;  3D8G A;  1YNJ C;  2C9O A;  4IQZ A;  4CDE C;  3RR5 A;  4LF6 Q;  3G7L A;  4IPD A;  2WV6 D;  5C3E B;  3PSI A;  2CFM A;  4RHS A;  4ZQ3 A;  1BR9 A;  5A2Q L;  1S5C D;  1T5X D;  2CCZ A;  2E2H H;  3I90 A;  4B08 A;  1HHV A;  1BBU A;  1K73 C;  1VQI A;  4OHJ A;  3J81 i;  1S72 A;  1IW7 C;  3CF5 A;  2EY2 A;  1VQP A;  2F0V A;  3RD4 A;  1LTT D;  2RDH A;  4LF5 L;  4DR3 L;  2QIL A;  1HNX Q;  1Y1W B;  3Q6S A;  1O7Y A;  1PVO A;  2Y0S G;  1SLJ A;  4K6L A;  4J6H A;  5IIF A;  2LXK A;  1B8A A;  2JK8 A;  1HZB A;  3EQL C;  2VQE Q;  5C0X J;  4C1N I;  3J81 E;  3A5U A;  2AMC B;  2NWG A;  4X64 Q;  2NB0 A;  4DR5 L;  1FD7 D;  3QG1 A;  2UUC Q;  3CP0 A;  2E8G A;  3W2D A;  2PYK A;  2ZXP A;  1UE1 A;  3CCU A;  5CBE E;  4X62 L;  3VR6 A;  1IYV A;  5IGG A;  4GKK Q;  2J7Z A;  1EUJ A;  2Z6K A;  4A3F B;  1Y8P B;  3HOX G;  1YEZ A;  3DWP A;  1JWM D;  1H9J A;  2F52 A;  2YTX A;  3P7J A;  3I4M H;  1H9K A;  3QB3 A;  1XTD A;  5ELD A;  3PIP A;  1NTG A;  2NUC A;  1D5Z C;  3H6M A;  5M3F H;  2PW5 A;  2V4D A;  3CQZ B;  4YY3 L;  1KRT A;  5IP9 H;  2EYJ A;  5IT9 E;  3HOY G;  1KAA A;  2IHE A;  3UI2 A;  1G2T A;  2XSC A;  4A3M B;  3UE1 A;  5FLM H;  3NBI A;  2ZT9 C;  3KDF B;  1X6O A;  2K04 A;  2HCI A;  5HGQ A;  1SJH D;  5GRO A;  3GTJ H;  3F1Z A;  3OMC A;  3FKI B;  2FXQ A;  1JOK A;  1IBK L;  1VF5 C;  1PZI D;  1I6H H;  2L4N A;  3HOV G;  1JB3 A;  1PZJ D;  1KAB A;  3JAM L;  3IFD A;  2PQA A;  3DM3 A;  1I4G A;  2F0S A;  1B9N A;  1NCV A;  2NYZ D;  5CV7 A;  2K28 A;  4EGV A;  4A3G H;  4ME3 A;  1SAP A;  2DY7 A;  4FDB A;  2KJX A;  4BBR B;  5ELO A;  4Y52 H;  1HNX L;  3A7L A;  3OWF A;  2I0Q A;  4DAV A;  3UDF A;  3I4L A;  2UUB Q;  2B2Y A;  4OL7 A;  2KEE A;  1LLR D;  1Z9F A;  3MHB A;  1VQJ A;  3DEP A;  4GLV B;  5M5Y H;  4HJA A;  2UUC L;  1RTO A;  4GOP B;  1B44 D;  3BG3 A;  3D4D A;  4CKC A;  2UXD L;  1SNP A;  1HR0 Q;  4Z9C B;  2R92 H;  3LGJ A;  1EIH A;  2XGT A;  1AZQ A;  4FF1 A;  4UP8 A;  1LT6 D;  3NEM A;  5EPK A;  3HKS A;  4A3D H;  1VDZ A;  4GKK L;  1V1P B;  1W3S A;  4B3M Q;  1UEA B;  2VW9 A;  1EOV A;  1TS3 A;  1S5E D;  4LF4 Q;  5FO8 B;  1FNW A;  5C4X H;  2YV5 A;  5JEA J;  4S3S A;  1TU2 B;  2HIV A;  2LS0 1;  1I4X A;  2A5H A;  1J9O A;  2DJG C;  2IX0 A;  5HGT A;  1H95 A;  5IGF A;  2CHB D;  2R7Z B;  4QB4 A;  4RA8 A;  2TSS A;  4NKL A;  1CQV A;  1SXT A;  2ID0 A;  1CZG A;  3R2T A; 
#chains in the Genus database with same CATH homology
 4JBW A;  1MJE A;  1TWA H;  1N34 Q;  3CCL A;  4A3K H;  1JE5 A;  4DR6 Q;  1NBW A;  2OCE A;  2JEB I;  2NVQ H;  3PF5 A;  4X6A H;  1A0I A;  4JV5 Q;  2HT1 A;  4A3F H;  1OXV A;  3A0J A;  4NXN L;  3KJO A;  1LM0 A;  1GVP A;  4LF7 L;  1J5E Q;  3M85 A;  4OXP A;  1SRU A;  1QVC A;  3CMA A;  2JQO A;  1PHJ A;  2E5L Q;  4GLA C;  3T1H Q;  4BY7 H;  4IO9 A;  1IL2 A;  2JA6 H;  3PUW A;  2R92 G;  5IYD H;  3K7U C;  4IPH A;  4ALP A;  3JC6 6;  4GLX A;  2UXD Q;  4OWX B;  4AYB E;  1GO3 E;  1BBW A;  1JJ2 A;  4GS3 A;  2C35 B;  4DV0 Q;  3K8A A;  4A3M H;  1EQR A;  1L0W A;  3TEH B;  3VDY A;  3EBE A;  3F2C A;  3H3V H;  2PMZ E;  3PO2 G;  3M4O H;  5IWA Q;  3OYY A;  1BVS A;  4H02 A;  1QUQ B;  5E7N A;  1VQ9 A;  3BZK A;  2UUB L;  2UXB Q;  5IYB H;  3CCQ A;  5GAE C;  4A3J H;  1XMO L;  4DV7 L;  1PV4 A;  3FKI H;  3KF8 B;  2E2I H;  1G6P A;  1Q8K A;  3G48 A;  4LWC A;  1QUQ A;  1X55 A;  3IRB A;  2MNA A;  3CC7 A;  1VQG A;  1I94 L;  1I3Q H;  1N9W A;  1OXX K;  4DR2 Q;  5M5X H;  4GKJ L;  4TVA B;  3NEN A;  1Q86 C;  3RN2 A;  1HNW L;  4TQU S;  4X65 L;  1HR0 W;  2YTY A;  4A93 H;  1SMX A;  5HY6 A;  3UE0 A;  3HKZ G;  1N36 Q;  3L2P A;  1VQA A;  4DR1 L;  1Q81 C;  1FGU A;  2VL6 A;  2N3S A;  4A3K G;  2JA5 H;  3S2H H;  2I5M X;  1PH1 A;  2Q2H A;  1NJI C;  4BBR H;  3I4O A;  1VQK A;  4GN5 A;  1B7Y B;  3PUX A;  3HOU H;  1PFS A;  2R6G A;  5JJK A;  1X65 A;  2ZM6 Q;  3CC2 A;  1SE8 A;  3PGZ A;  1K83 H;  3MXN B;  4AYB G;  4DV3 L;  1VQ5 A;  3I2Z A;  2PI2 E;  4IPG A;  1IXR A;  4NXN Q;  1N33 L;  3WWV A;  4QGU A;  2JA6 G;  4PZ6 A;  1KQS A;  2NZH A;  1D8L A;  1OXS C;  3J7A 5;  5LMN L;  4K0K Q;  3KFU A;  1FL0 A;  4DUY L;  4KHP L;  2KCM A;  2WFW A;  5JEA G;  2UXC Q;  2R93 H;  1KHI A;  4IOA A;  3H15 A;  2UXC L;  4LFC Q;  2R7D A;  2ZTE A;  3HOZ G;  2MQH A;  1N34 L;  1XPO A;  1E7Z A;  2N8N A;  1K8A C;  3HOW G;  2H5X A;  1HH2 P;  5FJ8 H;  1TWG H;  4MZ9 A;  5AJ3 Q;  1YIJ A;  2Q2U A;  4JI3 Q;  1VQD A;  4JV5 L;  3AQQ A;  5IYB G;  4UP7 A;  1Q7Y C;  2K5N A;  4A3J G;  3NBH B;  3JAM c;  3J81 c;  3I4M G;  1RL2 A;  2K4K A;  2NZO A;  4RMF A;  4KLK A;  4XTC S;  1A63 A;  4LUZ A;  3PUZ A;  5IYC H;  2E5L L;  4B3T L;  2YU9 H;  4MNO A;  2RF4 A;  4YWM A;  1XMO Q;  2EQS A;  5C3E H;  3CPF A;  2BA1 A;  3S1M H;  2CQO A;  1XJV A;  1NY4 A;  1UE7 A;  5IP9 G;  5C44 H;  1G51 A;  1ASY A;  4R4I A;  4POF A;  3S1Q H;  1EFW A;  5GAD C;  4C3H H;  4JBK A;  3AYH B;  4DV0 L;  2HIX A;  2AWN A;  2B63 H;  2R7Z H;  4HJ8 A;  3CCR A;  2ZJP A;  4C3I H;  1PH8 A;  1Z47 A;  1PYB A;  1HNW Q;  1WYD A;  5IWA L;  4X65 Q;  1WI5 A;  2QA4 A;  2UUA Q;  1OXU A;  4DAY B;  2PNH A;  1E1T A;  4HID A;  5EAY A;  4R4O A;  4JI1 L;  1U5K A;  3S17 H;  1Q12 A;  4DR4 L;  3S1N H;  2RHQ B;  3J80 c;  1WOC A;  1K3R A;  1VQF A;  3RLN A;  1MIU A;  4APV A;  1L1O C;  1QZH A;  1Q82 C;  2WB1 G;  4LF8 Q;  4WJ3 M;  4PZ7 A;  1PA6 A;  1X54 A;  1IYJ B;  3KF6 B;  2DUD A;  5IT9 c;  1N8R C;  5IE8 A;  5IP7 H;  5K36 G;  2VS1 A;  1CKN B;  2Y0S E;  4OX9 Q;  3ZJY C;  5JJL A;  3BU2 A;  4X66 Q;  4DV5 L;  3W1B A;  4JI7 Q;  3KF6 A;  2F4V Q;  4A3G G;  4R4C A;  4P75 A;  2WAQ G;  3GTQ H;  4BA2 I;  1CKN A;  3ULL A;  2JA8 H;  1PH5 A;  4QIW E;  5C0X I;  3J81 j;  1T9H A;  3W5O A;  2K75 A;  3ULP A;  3G71 A;  1KL9 A;  4A75 A;  2GVB A;  4NB3 A;  3E0E A;  2ZM6 L;  2UU9 Q;  4PG3 A;  1EWI A;  2BH8 A;  1HZC A;  5IYC G;  1NMF A;  1LYL A;  3H0G H;  3M9B A;  5C3E G;  1YIT A;  2Q2T A;  4YWL A;  4UY8 C;  3I56 A;  4AIM A;  5C44 G;  2ES2 A;  3T1Y L;  3U58 A;  4A3C G;  4K0K L;  1L2F A;  1V9P A;  4B3T Q;  1EIF A;  3OW2 A;  4BBS H;  2N78 A;  1BKB A;  2JEA I;  3CQZ H;  4LFC L;  3HOY H;  2JJQ A;  4HIM A;  1YHA A;  3U4V A;  2RHS B;  1ASZ A;  4JBM A;  3GTG H;  5AJ3 L;  4A3D G;  4LNQ A;  4JI3 L;  4DR7 Q;  4IFD G;  3E9H A;  1VS0 A;  1PYS B;  1B70 B;  2F3I A;  4L5S A;  2VUM H;  3PUV A;  5C4X G;  2NN6 G;  5M3M G;  4AQY L;  1Y1W G;  4Y7N H;  4O2D A;  1A8V A;  1MKH A;  4UPA A;  1XPR A;  4YCW A;  4JI1 Q;  4JI6 Q;  4DR4 Q;  4R1J A;  4HJ9 A;  1VQ8 A;  4DAM A;  3K81 C;  4JOI C;  1Y1V H;  4OON A;  1Q1B A;  1YBY A;  4JI5 Q;  2NVY H;  3RZD H;  2NVT H;  3HOV H;  2CWA A;  1I5F A;  4KI0 A;  4DV4 Q;  4RG1 A;  4IJL A;  4P74 A;  3F2D A;  4DV6 Q;  4QQB X;  5GQO A;  4DR6 L;  4LFB Q;  1LUZ A;  4HJ7 A;  1HNZ Q;  2UUA L;  1VQH A;  3GTP H;  4DV5 Q;  1A62 A;  1J6Q A;  1WJJ A;  4IJH A;  3MEF A;  5GAG C;  4AH6 A;  1GKH A;  3FP9 A;  4HJ5 A;  5BR8 Q;  3ICE A;  4IFD I;  4JI4 Q;  1K9M C;  2K5V A;  4A3B H;  1VQL A;  3TS2 A;  4DUZ Q;  4A3F G;  2HHH Q;  1UE5 A;  3H0G G;  4DKA C;  4LF8 L;  2RCN A;  2JA7 H;  1VQ7 A;  1YHB A;  2NN6 I;  4QJF A;  1KC8 C;  3S16 H;  4JG2 A;  2OQK A;  2IY5 B;  4YCV A;  4JI2 L;  1FVI A;  1VQM A;  4OX9 L;  4A3E H;  2ASB A;  4BY7 G;  4BBS G;  5IYD G;  3EIV A;  4X66 L;  2ZJQ A;  1X56 A;  4JI7 L;  3I4N H;  3W1G A;  1M90 C;  4UP9 A;  2VZA A;  3T1Y Q;  1JJC B;  2A19 A;  3CCE A;  4LF9 Q;  2WP8 J;  1YJN A;  2F4V L;  3S2D H;  4BXX H;  3F8T A;  3TQY A;  4A3M G;  3K0X A;  3TS0 A;  3A74 A;  2LSS A;  2Z6K C;  5LMN W;  2K5H A;  4BA1 I;  4DV2 L;  1LTL A;  2VY3 A;  2CKZ B;  1GM5 A;  2UU9 L;  3UDX A;  3GTL H;  2Q2I A;  1E22 A;  4GNX C;  3SGI A;  4LF6 L;  1M1K C;  1SN8 A;  2EIF A;  2MO1 A;  1S3O A;  1SR3 A;  1L1O B;  4LF5 Q;  1VQO A;  1UE6 A;  4IPC A;  3FKI G;  1Y1V G;  4AQY Q;  1DGS A;  4A3I H;  3E9I A;  4A3L H;  1TXY A;  1XMQ Q;  3L7Z C;  4BY1 H;  1L1O A;  3CAM A;  3HFZ B;  2JE6 I;  3S14 H;  1FJG Q;  1KD1 C;  4DR5 Q;  1W2B A;  1D7Q A;  1C9O A;  1WCM H;  4HIO A;  3STB D;  2AKW B;  1KRS A;  5J3B A;  3G4S A;  1UEB A;  4IOC A;  4DR7 L;  4A93 G;  1K8G A;  3K7A H;  2NVX H;  3AFP A;  1JB7 A;  3PV0 A;  3PF4 A;  2JA5 G;  1IZ6 A;  1QVF A;  1VQB A;  1AE2 A;  3CXC A;  2JA9 A;  4A3B G;  2BA0 A;  4BBR G;  1K0R A;  1GD7 A;  2ZTD A;  1E1O A;  3H3V I;  4GN4 B;  3PIO A;  1HZA A;  3GDE A;  3HOU G;  4JI6 L;  2VQE L;  1CKO A;  2PI2 A;  1PH2 A;  2VNU D;  2OTL A;  3I7F A;  4X64 L;  3PO3 G;  3TRZ A;  1PH7 A;  1XNQ Q;  1R9T H;  4A76 A;  3CD6 A;  1AE3 A;  3RNU A;  4R4T A;  4LFA Q;  4JI5 L;  1SFO H;  2V1C C;  1CUK A;  3D0F A;  2KEN A;  4LW1 A;  4DV4 L;  5ELN A;  4JI2 Q;  4DV6 L;  3AFQ A;  4LFB L;  1HNZ L;  4DV1 L;  4P71 A;  4L5Q A;  2R93 G;  2A1A A;  1IBL L;  1YI2 A;  4LUV A;  4DNI A;  3AEV A;  2IHF A;  5BR8 L;  3RLF A;  5FJ8 G;  1P16 A;  4JI4 L;  4B3R L;  1TWH H;  3CME A;  1HJP A;  3PO2 H;  4HIK A;  1PH3 A;  1CKM A;  3STB C;  1OXT A;  4DUZ L;  2D0P A;  4GN3 B;  4EX5 A;  3GTM H;  4JBJ A;  3TRE A;  4DV2 Q;  1MJC A;  5C4J H;  4R4Q A;  3RR5 A;  4LF6 Q;  5JJI A;  4IPD A;  3HOX H;  3S24 A;  3K80 C;  3G6E A;  4A3I G;  3PSI A;  2CFM A;  1VQC A;  3S15 H;  4JI8 Q;  1VQN A;  3M3Y H;  2K14 A;  2OQ0 A;  2CCZ A;  2N49 A;  2E2H H;  1P8L A;  4JOI A;  4LF9 L;  1NE3 A;  3CCM A;  1BBU A;  3JAM i;  4YHH L;  1VQI A;  4GOP C;  3J81 i;  2ZTC A;  1S72 A;  1K73 C;  1OTC A;  2B63 G;  4YCU A;  2R7Z G;  3CF5 A;  3OTO Q;  1VQP A;  4POG A;  1JJG A;  4P72 A;  1PH9 A;  1PH4 A;  4LF5 L;  1JT8 A;  4DR3 L;  1HNX Q;  3M7N A;  2ZJR A;  1PVO A;  2Y0S G;  3HKZ E;  1SLJ A;  2EXD A;  1Q46 A;  2CWP A;  2ALY B;  3CCJ A;  4MTN A;  2L15 A;  1XMQ L;  2LXK A;  1B8A A;  2JK8 A;  1HZB A;  2VQE Q;  1VQ4 A;  1EQQ A;  5C0X J;  1CSQ A;  3A5U A;  2AMC B;  2K52 A;  1FJG L;  3DLL A;  4X64 Q;  4DR5 L;  3UDG A;  5IP7 G;  4JYA Q;  4DPG A;  3L0O A;  2UUC Q;  5M5W H;  3I55 A;  3CP0 A;  1O7I A;  2E8G A;  3BJU A;  1UE1 A;  4NXM Q;  3CCU A;  2DGY A;  3J80 i;  2Z0S A;  2KHJ A;  4DV1 Q;  4GNX B;  4X62 L;  3HOZ H;  2JA8 G;  1IBL Q;  4JC0 A;  4A4I A;  4JI0 Q;  3HOW H;  2GVA A;  4GKK Q;  1EUJ A;  2Z6K A;  2K50 A;  1YZ6 A;  2AWO A;  3PO3 H;  4B3R Q;  1E24 A;  1C0A A;  4XIG S;  3HOX G;  4GNX A;  1YEZ A;  3KYH C;  1XNQ L;  2F52 A;  2YTX A;  3I4M H;  2D0O A;  4LFA L;  1XTD A;  4PZ8 A;  5DLQ E;  4JCV E;  3PIP A;  1NTG A;  2D62 A;  5M3F H;  1HR0 L;  2IT1 A;  2A8V A;  3CCV A;  2HQL A;  4YY3 L;  2B29 A;  1KRT A;  5IP9 H;  1KAW A;  2QEX A;  1X3E A;  2GN5 A;  3HOY G;  4OO1 G;  1XNR L;  4B3S Q;  2VQF Q;  2AHO B;  2IHE A;  3FHW A;  5LMU Q;  4B3M L;  1N32 Q;  3UE1 A;  4YHH Q;  1IBM Q;  5FLM H;  3KDF B;  1G29 1;  4LF4 L;  1X6O A;  4L5T A;  1Y14 B;  1YNX A;  5GRO A;  4C3J H;  5HGQ A;  1X9N A;  2VUM G;  4C2M H;  3GTJ H;  3F1Z A;  2FXQ A;  2QGQ A;  3KDF A;  4DR3 Q;  4JI8 L;  1KIX A;  1KXL A;  5H1S E;  1IBK L;  1YJW A;  3PCO B;  1VCI A;  2PQA B;  4IFD J;  1E3P A;  4LF7 Q;  1VQE A;  1I6H H;  1Q1E A;  3HOV G;  2MO0 A;  1S40 A;  3U4Z A;  2E2J H;  1WFQ A;  3F2B A;  4YWK A;  4O0A A;  2KHI A;  2PQA A;  3GD7 A;  3OTO L;  3DM3 A;  3M4P A;  3B6Y A;  2WB1 E;  1U0L A;  3S1R H;  4OO1 I;  3ERS X;  4L5R C;  4A3G H;  1YJ9 A;  4ME3 A;  3J7Z C;  4FDB A;  1CSP A;  3A5Z B;  1V43 A;  3CCS A;  2OTJ A;  5ELO A;  4Y52 H;  1HNX L;  3ER0 A;  4X62 Q;  4WJ4 A;  1YVC A;  2I0Q A;  2HHH L;  2UXB L;  3CPW A;  1PH6 A;  1J5E L;  3UDF A;  3ULJ A;  3Q8D A;  2XTI A;  3PUY A;  2UUB Q;  2R7F A;  2JA7 G;  2WAQ E;  1Z9F A;  1X3G A;  1VQJ A;  4GLV B;  5M3F G;  2KCT A;  1I50 H;  5M5Y H;  4HJA A;  3RN5 A;  4DV7 Q;  3T1H L;  4JYA L;  2UUC L;  4A3E G;  1JMC A;  4GOP B;  4A3C H;  4NXM L;  2UXD L;  3I4N G;  3CW2 C;  3BZC A;  1HR0 Q;  1VQ6 A;  1I94 Q;  2OWO A;  4BXX G;  4DK6 C;  4EQ5 A;  2R92 H;  2I5H A;  3LGJ A;  4YY3 Q;  4LUO A;  3GTO H;  4GKJ Q;  2BH2 A;  1X3F A;  2XGT A;  5FLM G;  4GOP A;  1TWC H;  1TWF H;  5C0X G;  4JI0 L;  1EIY B;  4QL5 A;  4UP8 A;  2YYZ A;  4GKK L;  3NEM A;  4DK3 C;  3HKS A;  1XNR Q;  1YHQ A;  2I5L X;  2LXJ A;  4A3D H;  1W3S A;  3NEL A;  4OWT B;  4B3M Q;  4DR1 Q;  3GTK H;  1SRO A;  4P73 A;  3U50 C;  2VW9 A;  3KOJ A;  1EOV A;  4LF4 Q;  1QVG A;  5C4X H;  1RIP A;  5M3M H;  2YV5 A;  2KBN A;  3KLW A;  5JEA J;  1Y1W H;  4J15 A;  2HIV A;  3GO5 A;  3CC4 A;  3RLO A;  4A3L G;  4BY1 G;  4DR2 L;  4PMW A;  2ATW A;  5GAH C;  1UWV A;  4DV3 Q;  1IBK Q;  1N33 Q;  2IX0 A;  4QY7 A;  2IX1 A;  1AH9 A;  1H95 A;  4B3S L;  3EN2 A;  2VQF L;  1WCM G;  3D31 A;  3M4Q A;  4KHZ A;  1N36 L;  1V1Q A;  2MFI A;  1HZ9 A;  5IY0 A;  5LMU L;  2B3G A;  1QZG A;  1XPU A;  1IBM L;  1N32 L;  5LMN Q;  4DUY Q;  4KHP Q;  3UDI A;  4OWW B;  5FLX c;  3KJP A;  2ID0 A;  4NPS A;  1C7Y A;  1EYG A;  2YTV A;  3RZO H;  1NMG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...