2CQOA

Solution structure of the s1 rna binding domain of human hypothetical protein flj11067
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
119
structure length
119
Chain Sequence
GSSGSSGMNSGRPETMENLPALYTIFQGEVAMVTDYGAFIKIPGCRKQGLVHRTHMSSCRVDKPSEIVDVGDKVWVKLIGREMKNDRIKVSLSMKVVNQGTGKDLDPNNVIIESGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleolar protein of 40 kDa
publication title Solution structure of the S1 RNA binding domain of human hypothetical protein FLJ11067
rcsb
source organism Homo sapiens
molecule tags Ribosome
total genus 12
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2005-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00575 S1 S1 RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2cqoA01
2UUBQ 4LF6L 2UXCQ 1NE3A 4HJ7A 4UP8A 4WJ4A 4LF7Q 1LUZA 4GS3A 4YCUA 5GAGC 2MNAA 4ALPA 1XMQQ 1JJCB 1PH7A 1VQEA 2BH8A 4AH6A 3EN2A 4A93G 1BBWA 2NVXH 5IE8A 1ASZA 2JEAI 2A8VA 1E7ZA 2VQEL 4P73A 3JAMc 2KENA 1YVCA 4X65Q 4JOIC 2YTXA 5AJ3L 3UE1A 2PMZE 1OXVA 3G48A 1C9OA 2JA9A 1NMFA 1UEBA 4DPGA 1HJPA 4BBSG 2UXDQ 4A3IG 3PUYA 1XPOA 2Y0SE 1QVGA 1SR3A 4DV7Q 2VUMH 4A76A 4DUZQ 5C0XI 2PQAB 2ZJQA 4DR5L 1TWCH 2YV5A 4QY7A 1VQIA 2EXDA 3CW2C 5C44H 4RG1A 2K50A 5H1SE 4A3KG 3KFUA 4GOPA 4A4IA 1IBKQ 1B70B 4DNIA 4GLVB 4DV2Q 1KAWA 1HZ9A 3GTOH 1N34Q 1UE6A 1K8GA 4KI0A 1UE5A 4R4QA 1K83H 3ZJYC 1HH2P 4C2MH 3STBD 3J80c 4OO1G 1HR0Q 2V1CC 4PZ6A 3U58A 4XTCS 1WCMH 4IFDG 2E5LL 3TREA 5LMNQ 1IL2A 3I4NH 1EQRA 2GVBA 4YCVA 3CP0A 2GN5A 4DK3C 1XMOQ 1FJGL 3RZDH 4B3SL 1E1TA 2PI2E 1SE8A 4YWKA 4DR6Q 2UU9Q 4IFDJ 1VQHA 2JA5H 1D7QA 4NPSA 4A3DG 1JT8A 4BY1G 4QIWE 1B7YB 2KBNA 5GQOA 2VS1A 1VQBA 4KLKA 4OXPA 3L2PA 4L5TA 4O0AA 2OCEA 3LGJA 2AKWB 2R7ZG 1Y1VG 1X6OA 5E7NA 1KC8C 3K7AH 5FJ8H 1A8VA 3DLLA 1VQ4A 3A0JA 1NMGA 5M5YH 4LW1A 4JBMA 1QVCA 3E9IA 3I4MG 1X56A 3HOVG 3HOXG 4JI2Q 3RNUA 4LNQA 5M5XH 4MTNA 5IWAQ 4GN3B 5IY0A 3KF6B 2HHHQ 1PFSA 4JI0L 2Q2UA 4UY8C 1TWGH 2ASBA 3RLNA 4X64Q 1N9WA 1OXXK 4GKKQ 4BY7H 2DGYA 1CKOA 1HNWQ 4IO9A 1VQ5A 1LYLA 4JG2A 2BA0A 4OX9L 4JI4Q 1CKNA 5C4XH 3S1NH 4A93H 4JYAQ 3OTOQ 2YTVA 4X66L 4DR4L 4EX5A 1UWVA 3CCVA 1VQNA 5K36G 1QZHA 4OWWB 3ULLA 1EFWA 3AEVA 5EAYA 3AQQA 1TXYA 4DV3L 1VQ9A 2K5VA 1VQDA 2R6GA 4LUZA 2JA6G 3GTLH 4BBSH 4DV6Q 5JEAG 1EIFA 2OTLA 2VY3A 1Y1WG 3S1RH 4QL5A 1PH6A 3S2HH 1Q81C 4IPHA 1PHJA 4A3GG 3BU2A 4R4TA 5JEAJ 2WAQE 1M90C 4DR2L 3BZKA 4YY3L 3M85A 4B3TQ 3E0EA 1AE3A 1YBYA 1VS0A 3CCJA 2K4KA 5FLMG 1LTLA 3HOYG 3HKZG 1OTCA 5BR8L 4A3CH 4DUYQ 3UDGA 4A3KH 4JV5L 1WOCA 5M3MH 2ZTEA 1VQPA 1O7IA 1A62A 1DGSA 3KDFA 3NELA 4XIGS 4BBRH 3L7ZC 4C3IH 3PUWA 5IT9c 4B3RL 4DV5Q 1CSPA 2JJQA 4KHPQ 4IJHA 3H0GG 2IT1A 2KHJA 1SMXA 4BA1I 3J81c 3CCUA 1IBML 2NZOA 2F4VQ 4DR3L 4NXMQ 4OWTB 3G6EA 1JE5A 4GKJL 3CPWA 3CC4A 4UPAA 3JAMi 3RLFA 2UUAQ 4JCVE 4JI5L 3T1HL 4HIOA 4A3FH 4JI1L 3MXNB 1N32L 4LF7L 1E24A 4LFCL 3K7UC 1XNRQ 2I5MX 5JJLA 1Q46A 1NTGA 3S24A 1VQ7A 2OWOA 3CCLA 1HZBA 1KL9A 1Y1VH 2OQ0A 2E2HH 2VZAA 2K5NA 4ME3A 5GROA 3S16H 4JOIA 1FVIA 3L0OA 2I0QA 2B63H 3S14H 2LXJA 3RN5A 2ZTCA 1EUJA 1JB7A 4JI7Q 4L5RC 4HIMA 3CCRA 4DV4Q 1PH8A 3HOVH 3B6YA 4A3LG 1IYJB 4J15A 2Q2TA 4NXNL 4LF4Q 3PSIA 2FXQA 2C35B 5J3BA 1YITA 4X62Q 4LF8L 4RMFA 2R92H 4DV7L 3UDFA 4K0KL 2I5HA 2PNHA 3CC2A 2PQAA 3HOZG 2ZJRA 1K73C 1W2BA 2KCMA 3CPFA 5IP7G 4QQBX 3D0FA 1N8RC 1A63A 1E22A 2YYZA 2Q2HA 3PF4A 4JBJA 4A3MH 4AYBG 3S1QH 3K0XA 3U50C 2YU9H 5M3FH 3GTQH 4Y52H 5GAEC 4LUVA 2VQFQ 1N36Q 5C0XG 2JA6H 3W1GA 3HOWG 1E3PA 1X55A 3ERSX 1Q1EA 1YJNA 4JBKA 5C0XJ 4DV1Q 1TWHH 1PH9A 4O2DA 4P71A 2CWPA 3OYYA 1K3RA 1Q12A 3F1ZA 2QGQA 1HNXQ 3SGIA 1VQOA 4A3JH 5FLMH 2LXKA 4BXXH 4DAYB 4EQ5A 1X3FA 4P74A 1I94L 1S40A 4P75A 4A3DH 3TEHB 1GKHA 3GTJH 1VQLA 3G71A 4LF6Q 4YWLA 2JA8H 2A19A 2R93H 1NJIC 2WB1E 3RR5A 1YHAA 3KYHC 3DM3A 3PO3G 4IPGA 4POGA 2JA7H 2F52A 4JC0A 2VQEQ 4JI3L 3BZCA 3PF5A 1QZGA 5IYCG 2HHHL 3KF6A 2GVAA 3H15A 3AYHB 2JE6I 2AWNA 2NN6I 1T9HA 4X64L 1VQGA 3K81C 1R9TH 4JI8L 1EWIA 1WJJA 2WP8J 1EIYB 3TS0A 4JI4L 2IX1A 1AE2A 1B8AA 1WI5A 2F3IA 1HZAA 1V1QA 2DUDA 3CXCA 2QEXA 1HNZL 3U4VA 2UUCL 1L1OB 1L1OC 1KQSA 1BBUA 1YZ6A 1J5EL 4DR5Q 1N33Q 2NVTH 4DR7L 1Q82C 1A0IA 1WFQA 4DV0L 4LF5L 1QVFA 1TWFH 2JK8A 2N8NA 1Z9FA 4UP7A 4DV6L 4DR1L 4A3LH 2Q2IA 4AQYL 5LMUL 1HZCA 1GM5A 2ZM6L 1K0RA 1C0AA 4YHHL 5GADC 3I4OA 1YHBA 1VQJA 3T1YL 3KJPA 1PYSB 2MO0A 2ATWA 2CQOA 1J6QA 2I5LX 1KRSA 3PV0A 4GLAC 1SLJA 1FJGQ 1VCIA 4B3SQ 4A3IH 4GN4B 1VQ6A 3EIVA 2E8GA 3U4ZA 3PO2G 4IOAA 5JJIA 1XJVA 2R7DA 3W1BA 2R7FA 4LFAL 4NXML 1V43A 3G4SA 3AFQA 2AMCB 4H02A 2UXBL 1U0LA 3M7NA 2KHIA 3K8AA 2B3GA 3M4QA 4MNOA 1XNQQ 2IY5B 5JJKA 4LF9L 2VW9A 4LFBL 4B3ML 1X54A 4DK6C 2JEBI 1I50H 4A3BG 5M5WH 3I55A 2IX0A 4HJ8A 1X9NA 2VUMG 4JI0Q 3A5UA 3CCSA 1KHIA 2K52A 1G51A 1LM0A 3Q8DA 4LUOA 1KD1C 4BA2I 5LMNW 3UE0A 5C44G 1IBLQ 3FHWA 4X6AH 1MKHA 2ES2A 3ER0A 3F2BA 3PUVA 4OX9Q 1YHQA 2UUBL 4JI7L 2UXCL 1Q7YC 4X66Q 4DR4Q 2RF4A 1XMQL 2IHFA 2NVQH 5IYCH 5C3EG 1GVPA 1PYBA 1XPUA 1Z47A 3PGZA 4BY1H 2EIFA 3NENA 4DV3Q 5FLXc 2R7ZH 5HY6A 4X65L 2HQLA 2Y0SG 5C4JH 1WCMG 2Z6KC 3I4NG 3I4MH 3IRBA 4YCWA 3S15H 4TQUS 3HOXH 4YY3Q 2UXDL 4R4CA 1NBWA 3W5OA 3CAMA 3E9HA 4HJ5A 2JA5G 5BR8Q 1VQFA 1U5KA 1YIJA 4JV5Q 5IYBG 1PH2A 4DUZL 1QUQB 2HIXA 1J5EQ 2YTYA 3J80i 4JI6Q 4B3RQ 2EQSA 1G291 3FKIG 3I2ZA 3K80C 1VQ8A 1OXUA 1EOVA 3STBC 5FJ8G 3HKZE 5GAHC 1IBKL 1JJGA 3CC7A 1IBMQ 3M9BA 1Q8KA 4DR3Q 4A3EG 4DV2L 4GKJQ 3CMAA 1PVOA 2OQKA 3NBHB 4R4IA 3RLOA 1N34L 3HOUG 5IP9G 4JI5Q 3GTGH 4JI1Q 1BVSA 1N32Q 2AWOA 3H3VH 3PO2H 1HR0L 2JQOA 3D31A 4LFCQ 4L5SA 4LWCA 1Y1WH 4BY7G 3M3YH 3CCMA 4A3GH 5LMNL 1D8LA 1X65A 1PH1A 5C4XG 1XTDA 1XMOL 2IHEA 4QJFA 3J7A5 3KLWA 2MO1A 1GO3E 2UU9L 2N78A 3HOYH 4DR6L 4AIMA 1FL0A 3PIOA 4GNXB 4IPDA 4GNXC 4A75A 1EQQA 1YJ9A 2CCZA 4HJAA 3CCEA 4A3BH 4NXNQ 3S17H 3I7FA 3CMEA 3TQYA 3H0GH 3FP9A 4LF8Q 3PUXA 2HT1A 3GTPH 1K9MC 1L1OA 4C3HH 4K0KQ 2RCNA 4JI2L 3GD7A 1N33L 1G6PA 1TWAH 2D62A 5IWAL 1L0WA 4A3CG 2HIVA 2NN6G 5AJ3Q 5M3MG 1K8AC 2VNUD 2D0OA 1W3SA 4IPCA 1P16A 1MIUA 1PH3A 4BBRG 1E1OA 4GKKL 3PIPA 2E2IH 5C3EH 3GTMH 4R4OA 3RZOH 2K14A 1HNWL 2NZHA 5ELNA 1S3OA 2D0PA 2MQHA 3PUZA 1MJCA 3OTOL 4HIDA 3OW2A 4JYAL 3HFZB 2K5HA 2KCTA 3TRZA 4P72A 4PZ7A 4AYBE 3NEMA 1SN8A 2A1AA 2WFWA 4OO1I 1PH5A 2WAQG 2Z0SA 2ALYB 2B29A 1Q86C 4A3FG 4IFDI 4GOPB 4GOPC 5IYDG 1YI2A 1OXTA 2CWAA 3UDXA 1I3QH 2L15A 1SROA 3M4PA 2H5XA 3F2DA 1I94Q 1YNXA 4DAMA 5IYBH 3EBEA 1P8LA 3J81i 3F2CA 4KHZA 4OONA 4WJ3M 4B3TL 3HOZH 4FDBA 4JBWA 3WWVA 5DLQE 5IP7H 3FKIH 3CD6A 3S1MH 1XNQL 2E2JH 4PZ8A 4DUYL 4GLXA 2B63G 4UP9A 1YEZA 2E5LQ 4A3EH 1CSQA 4Y7NH 3S2DH 4DV5L 1I6HH 1UE7A 2BA1A 4C3JH 4JI3Q 1AH9A 3HOUH 2XGTA 5IP9H 2QA4A 3GTKH 4KHPL 2N49A 4QGUA 1FGUA 2R92G 1IZ6A 2F4VL 3HOWH 3ICEA 1OXSC 1VQCA 5ELOA 1JJ2A 3RN2A 3KF8B 1VQAA 4POFA 1WYDA 4JI8Q 1IBLL 1SRUA 2UUAL 3A5ZB 1CKMA 1EYGA 1CUKA 3A74A 3VDYA 3J81j 1HNZQ 4A3MG 3CF5A 1Y14B 1JMCA 2MFIA 2UUCQ 2PI2A 1UE1A 4HJ9A 3ULPA 1XNRL 1NY4A 1YJWA 3M4OH 4DR7Q 3ULJA 1KIXA 4R1JA 5M3FG 4DV0Q 4LF5Q 4YWMA 1HR0W 4DR1Q 3BJUA 3H3VI 3CQZH 4AQYQ 2Z6KA 3JC66 1PA6A 2XTIA 2N3SA 5LMUQ 2ZM6Q 1RIPA 1CKNB 3GO5A 4YHHQ 1RL2A 4DV4L 1XPRA 3PO3H 3I56A 2ZJPA 4NB3A 2RHSB 3T1YQ 4A3JG 1ASYA 4LF4L 4BXXG 1L2FA 1BKBA 1V9PA 4X62L 3KOJA 2ZTDA 4TVAB 1QUQA 2BH2A 1C7YA 4JI6L 3UDIA 1MJEA 2RHQB 2CFMA 2VL6A 2JA8G 3HKSA 2OTJA 4IOCA 3KJOA 1S72A 4LFAQ 1X3EA 4DR2Q 1M1KC 2JA7G 2UXBQ 1I5FA 1IXRA 1Q1BA 3AFPA 4IJLA 4DKAC 3TS2A 4OWXB 2ID0A 2VQFL 1SFOH 1N36L 2LSSA 4B3MQ 4LF9Q 4HIKA 4LFBQ 2K75A 3CCQA 5IYDH 3KDFB 4GN5A 4PG3A 4DV1L 4APVA 1KXLA 4MZ9A 3J7ZC 2R93G 5HGQA 1PV4A 1KRTA 3PCOB 2AHOB 3GDEA 1VQMA 1HNXL 4L5QA 1PH4A 1H95A 1X3GA 2NVYH 3MEFA 1VQKA 2CKZB 4PMWA 1GD7A 2WB1G 3F8TA 4GNXA 3T1HQ
chains in the Genus database with same CATH superfamily
2UUBQ 2EXZA 4LF7Q 2MNAA 1O80A 1JJCB 1PH7A 1DONA 2A6HD 2NBFA 2NVXH 1CQFA 3S9WA 1DM0B 1C9OA 2NWGA 3PUYA 5I9PA 3S16B 3FDTA 2B63B 4RCOA 2Y0SE 1QVGA 2VUMH 4K6DA 5C0XI 2ZJQA 1TWCH 5JOBA 4WJWA 3VYSA 1FYCA 3H09A 4A3KG 2R92B 4XT3B 1GHJA 4DNIA 4GLVB 3GTOH 1ENCA 3Q24A 1UE6A 4KI0A 3I70A 4A3MB 1F9RA 3N6RA 2V1CC 4PZ6A 3E6ZX 3U58A 4IFDG 5M3FB 3I4NH 1KNEA 1DZ1A 4DK3C 2GN5A 3N52A 1FJGL 2EOTA 2JA6B 3RZDH 2PI2E 1A3UA 2QW7A 4YWKA 1TS2A 2EY5A 1VQHA 2UU9Q 1TKWB 1SYFA 3C1FA 3MXGA 1IL8A 1KC8C 2CH4A 1VQBA 1H9JA 2X6GA 1RTNA 1G91A 2AKWB 4DXFA 2O2LD 1A8VA 1QVCA 3E9IA 5EKIA 2O5IC 3HOVG 4LNQA 2JA8B 3KF6B 4UY8C 4Z9CB 1TWGH 3RLNA 2AUJD 4FP5D 1OXXK 1CKOA 4IO9A 2PQEA 1VQ5A 4OX9L 1IKLA 4A93H 1TS4A 3OTOQ 1UWVA 3CCVA 1QZHA 1R9TB 1EFWA 3AEVA 2R93B 2K5VA 4LUZA 3GTLH 4RAUC 4DV6Q 1J8IA 2OTLA 2VY3A 2NVTB 3BDLA 2XRQD 4IPHA 1HPCA 1M90C 4F88A 4B9WA 3M85A 2MPMA 2D2CC 1STAA 1WOCA 1VQPA 1O7IA 1A62A 3NELA 4XIGS 4BBRH 4C3IH 1J5EL 3J7AF 3PUWA 4ZRZA 2F0OA 2NZOA 4DR3L 4NXMQ 1EZ8A 4OWTB 1FNWA 3CC4A 5C3XA 4UPAA 3MAQA 2EE1A 4A3IB 2UUAQ 3MHBA 3T1HL 4HIOA 4MHEA 1MHWC 2LFNA 2C5CA 4P2CB 4U673 4LFCL 1HFNA 4F87A 2E75C 1BXTA 1HZBA 2OQ0A 3LNNA 4X3UA 2VZAA 2K5NA 3S16H 2PPBC 1FVIA 5DM63 2B63H 1PZKD 4HIMA 1D6EC 2RQXA 1Y8PB 4LF4Q 2FXQA 2R92H 4DAPA 4K0KL 2I5HA 2PNHA 3A54A 5E1FA 2KCMA 5FLXL 1A63A 4X3TA 2YYZA 5L37A 2Q2HA 2J7ZA 4A3MH 1SNMA 4BY1B 3R2IA 3K0XA 5M3FH 1STYA 3I4LA 4LUVA 5C0XG 2JA6H 1AZPA 4UDUC 3I4MB 3NTIA 2QEJC 3R2TA 1ICWA 2KEDA 3ITPA 3SGIA 1VQOA 4BXXH 5FLMH 2LXKA 5D14A 1X3FA 1PYWD 3I91A 3TEHB 1GKHA 1B2TA 4HMIA 2KCCA 2JA8H 1GUTA 2A19A 4FF2A 1BUVT 1ET9A 2K5WA 1JCKB 4XQJA 3DM3A 4TRDA 3NUCA 2OF1A 5IYCG 1WTWA 1QZGA 4K14A 1PLFA 1X32A 2JE6I 1T9HA 3JAME 1R9TH 1EWIA 1EIYB 3VR3A 3HOYB 2R93H 1AE2A 1B8AA 3CXCA 2QEXA 4G7ZC 2VB3X 2NVTH 4DR5Q 4DR7L 3F2UA 1A0IA 1WFQA 1CTMA 4NW2A 5IGFA 1K0SA 2BOSA 3GTPB 1YNNC 4DR1L 4A3LH 2KECA 1TWAB 1HZCA 2AQ3B 3M4YA 1GM5A 2G9HD 4YHHL 3IFDA 1RDPD 1YHBA 1VQJA 2PZUA 3T1YL 3GQBA 1BCPF 3FMCA 4KTAA 2ATWA 4KV6A 1J6QA 2KA7A 4CHTB 5C3EB 3GTMB 4PV1C 1KRSA 2HCCA 5BN3A 1F9QA 2QKIC 1VCIA 4A3IH 1LTBD 4GN4B 1VQ6A 2E8GA 4LMQD 2L1BA 2Y0SB 4N9TA 1XJVA 4GZYC 3QOLA 3W1BA 3OOCA 1V43A 2L5TA 5CV7A 3AFQA 4H02A 2UXBL 5C4ZA 2KHIA 1GXDC 1STBA 3K8AA 1XYIA 1I3QB 4LFBL 3MEHA 1LT5D 4IUVA 1SMYC 4DK6C 2VXWA 5FKAC 1AEXA 3S1MB 4HJ8A 1X9NA 2VUMG 2RDFA 1BCPD 2B39A 2WV6D 4AYBB 4A3EB 1VF7A 4Y7NB 1SYBA 4C3JB 3ER0A 1PRTB 1SJHD 4ZK9B 4DK0A 1GVPA 1XPUA 1Z47A 4BY1H 4FXDA 2EIFA 3P7JA 4ABNA 1FGBD 4ZUIA 3M4OB 2F4IA 2Z6KC 5KNBA 3I4NG 3I4MH 2EYPA 4TQUS 4YY3Q 3BZDB 3W5OA 4HJ5A 5BR8Q 1YIJA 3ERQA 1QUQB 3H6MA 4O42A 1EY6A 2EQSA 3VR5A 3FKIG 4ZQ3A 5GAHC 1C4QA 3STBC 1SJED 3HKZE 3SE0A 2K1BA 3KLRA 3M9BA 3OIPA 2HUGA 2E76C 1N34L 4JI5Q 1QE6A 2Q8IB 2AWOA 4V0BA 3H94A 1I6VC 3T53B 1LABA 5LMNL 4EGVA 1G6ZA 1LLRD 4JVZA 5CR3A 2MO1A 2Z4IA 4C56C 3HOYH 4XQQA 1HTPA 1LO5D 1X3QA 2LKVA 3NE5B 4GNXB 1EQQA 5CV6A 4G57A 5CV9A 1L0YB 2M2LA 2G5DA 2NVYB 4RH6A 3I7FA 3TQYA 4LF8Q 3GTPH 3PUXA 2N88A 1HQRD 5C5LA 3I8ZA 1LT6D 3GD7A 1N33L 1TWAH 3NPPA 1HQMC 1L0WA 3D4WA 5KEEA 3MXPA 1LTSD 5AJ3Q 4I7AA 1P16A 4C3IG 4BBRG 2QDBA 5G3LD 5C3EH 3GTMH 5ELNA 3QIAA 4I7ZC 1S3OA 3A8IE 1E2ZA 3TRZA 2KCTA 2OXPA 4WFN3 2WFWA 2WKCA 1IW7D 2ALYB 1Q86C 1C48A 1O7YA 3UDXA 1I3QH 1R4QB 1STEA 2H5XA 5KNDA 2B8FA 2KVMA 1YNXA 4DAMA 1I94Q 1QILA 2B2VC 3F2CA 4WJ3M 2QF7A 5DLQE 5IP7H 3CD6A 3S1MH 2B63G 4UP9A 3ZYYX 1YEZA 2E5LQ 1PTOB 4A3EH 4Y7NH 1ICFB 4C3JH 1AH9A 1VMCA 5EGTA 4KHPL 1WCMB 3OHXC 2R92G 1VQCA 3V05A 1JJ2A 4K2LA 4QUCA 1WYDA 3A5ZB 1CKMA 4A3MG 1UUPA 3CF5A 3FPUB 5EBCA 1B3AA 2IJ0A 2CH4W 3ULPA 1NY4A 3HGBA 3M4OH 1HRJA 4YIJA 2M00A 5M3FG 4ZKBB 3K7AB 1VMPA 3DUZA 4K2KA 2Z4HA 3BJUA 2Z6KA 3JC66 5ELCA 2XTIA 2N3SA 5LMUQ 1DYQA 2ZM6Q 3HP3A 1O7ZA 1XPRA 2IX3A 3I56A 4NB3A 5IODA 4BXXG 1L2FA 1V9PA 1RHPA 3QO2A 1EY8A 2DNCA 4TVAB 5C4XB 3UDIA 3TMEA 5CC4A 1MJEA 2RHQB 2CFMA 2JA8G 1JWUD 3MC0B 1WTHA 2PNRC 1BDOA 4LFAQ 1O7LA 4BBSB 2JP1A 3AFPA 1YNJD 4OWXB 2VQFL 1N36L 5IIFA 3S2HB 2LSSA 4B3MQ 4HIKA 5IYDH 3KDFB 3SK5A 2LS01 4KMUC 1KDAA 4MZ9A 3EJIA 2R93G 1HFGA 1EWHA 3GDEA 1VQMA 1H95A 2MUYA 2NVYH 2A5HA 4LF6L 2UXCQ 3FEWX 4GS3A 5GAGC 5NUCA 4ALPA 2BH2A 1QWYA 2H1EA 1VQEA 3EA6A 2BH8A 3G6JB 2JN4A 2WAQB 4A3FB 5IE8A 1ASZA 1XXGA 1EY9A 1PRTD 4X65Q 1KDBA 4JOIC 2YTXA 1CHPD 3UE1A 2PMZE 1DOKA 1OXVA 1AW7A 1VF5C 3G48A 4FXGC 5FLXE 1NMFA 1HJPA 1Y1VB 5I6WA 4A3IG 1Z6HA 4FO2A 3S14B 5F2DA 4DV7Q 1GOZA 4R8IA 2XNAC 3LWUA 3K0YA 2YV5A 1QB5D 3CW2C 3Q22A 1IBKQ 1EU3A 3CHBD 5LL6X 4DV2Q 1F2MA 5CYUA 1WTXA 1K8GA 2B2VA 1PTOH 1U4PA 3QG1A 5ELDA 4CJ0B 4R4QA 2CW0D 1HH2P 5A35A 1HR0Q 4BWGB 2YU9B 1WCMH 1DCZA 3EVQA 1G8ZD 1A6XA 2GVBA 4FXKC 4YCVA 1XMOQ 1TS3A 2CVRA 4B3SL 4IFDJ 1B4OA 4DR6Q 2BE5D 2JA5H 4BY1G 1B7YB 5GQOA 5FOBB 2VS1A 2OCEA 3KF8A 3J80L 3HKZB 3K7AH 2DJFC 4JBMA 2OT2A 3A0JA 3I4MG 3C3LA 5E4XA 1S5DD 2IPKD 2A68C 4K8JA 3GTJB 5M5XH 4MTNA 2EJMA 2HHHQ 1PFSA 1V1PA 5CMDA 4JI0L 1Y69U 1N9WA 4GKKQ 3P1HA 1K8MA 2DGYA 1EYDA 2LMCB 2BA0A 4JI4Q 5C4XH 4ILWA 4RKLA 4X66L 2IW3A 1II3A 1VQNA 1ONLA 3ULLA 3MFGA 3AQQA 1VQDA 2R6GA 3NWTA 4WORA 4BBSH 1EIFA 2KJXA 1PH6A 3S2HH 2WB1B 1PHJA 3BU2A 4HR7B 1F2YA 4B3TQ 2K03A 1VS0A 2K4KA 3HOYG 4A3CH 1OTCA 5M3MH 4A3DG 3L7ZC 4B3RL 4K5XA 4IJHA 2HDLA 5E3FA 3J81c 3CCUA 1IBML 1D5ZC 3G6EA 2F0PA 4GKJL 4JCVE 2Z1CA 4A3FH 1H9MA 1RF2D 1N32L 4LF7L 3DEOA 2EYHA 3T4AC 4CJ1B 5IT9L 1VQ7A 5CGKA 5ELEA 1R4PB 4H0LC 1Y1VH 4KKTA 1H9SB 4ME3A 1PFBA 3L0OA 4JOIA 2I0QA 3S14H 5DAUA 1EUJA 4JI7Q 1PH8A 2H4OA 4NXNL 1STGA 4OHJA 5J3BA 2RSNA 2X69A 2PQAA 2ZJRA 3SXHA 1K73C 3CPFA 1A2TA 5D65A 5IP7G 1N8RC 1E22A 1HCZA 2MJ8A 2M9VA 1B1ZA 1SNOA 4JBJA 4L63B 3PF4A 2PCFB 4AYBG 3U50C 2YU9H 2EYOA 5GAEC 1D1KA 5C4JB 1E3PA 3S15B 3HOXB 2L11A 5C0XJ 4DV1Q 1JE4A 1U4LA 2K6AA 4P71A 5JJZA 3J7YW 1K3RA 3R8BA 1HNXQ 2QGQA 1WTQA 4DAYB 4P74A 3ND9A 5IGGA 3GTJH 1TU2B 4PMCA 5JPNC 4RGMA 4QB4A 4KKSA 1U4MA 1XWEA 2PZWA 4RKBA 2O5JC 2EDGA 3KYHC 4CKCA 4IPGA 4POGA 1QJOA 3H3VC 3BZCA 2Z9HA 5KYLA 1Y1WB 3M3YB 4A3GB 3AYHB 3K81C 2FMMA 2KOLA 2IX1A 1BCPB 4DN4M 2F3IA 1HNZL 1V1QA 4X3SA 3VYTA 1HUNA 1L1OC 2OEOA 1YZ6A 5FK9C 1Q82C 3PIP3 4A3BB 4DV0L 4KY5A 4LF5L 1SE4A 4ZUJA 2N8NA 1Z9FA 4DV6L 4C3HB 1IHZA 3KK7A 3SK4A 1K0RA 1C0AA 5GADC 3I4OA 1JQYD 4HCEA 2RDGA 2DJGC 5IOCA 2MO0A 2SDFA 2I5LX 3PV0A 2EYFA 4GLAC 1SLJA 4B08A 1FJGQ 1JOKA 5EBDA 3PO2G 2VB2X 4IOAA 3EIVA 3U4ZA 1NSNS 5BN5A 3NP8A 4NXML 2AMCB 1RKNA 3A55A 4CDFC 1SEBD 4MNOA 1XNQQ 2IY5B 1I4PA 1AFPA 3MXNA 4B9XA 3HOZB 2K32A 4IUQA 1S5FD 2IX0A 2E2JB 2NYZD 4C1NI 3NXWA 5M5YB 4OO1H 4LUOA 3D6CA 1MI2A 5ELFA 3UE0A 1I6HB 1GUGA 3A56A 1MKHA 4OX9Q 2QILA 3PUVA 2PW7A 1CM9A 1XMQL 3IFTA 1YNND 2IHFA 2ZXPA 3KLSA 1EY7A 3PGZA 4N8X1 3QJYA 1F9SA 1SYDA 2FHTA 1WTVA 3VA7A 5C4JH 1WCMG 1GUWA 4YCWA 3S15H 3HOXH 2UXDL 2K05A 1NBWA 3CAMA 3VYUA 2JA5G 3CQZB 1A3TA 2I07B 5CORA 3DEPA 1PH2A 1ILQA 4DUZL 5KGUA 2HIXA 1J5EQ 3R3OA 2YTYA 5KIXA 4RGOS 1G291 3I2ZA 1OXUA 1HA6A 2EY2A 1B50A 1NNXA 1CZGA 4DR3Q 5K36H 1ZKOA 2OQKA 3NBHB 3NHHA 3HOUG 4FF4A 5IP9G 2WACA 3H91A 2CHBD 4CKBA 1BVSA 5JEAH 3D31A 3KUPA 4LFCQ 4PQXA 1Y1WH 3M3YH 4A3GH 2A69D 4HMJA 1D8LA 2RBMA 1EEFD 5C4XG 2EVBA 4QJFA 4R9WA 1XTCD 1GO3E 2N78A 4G7OC 5CV8A 3OIQA 3K58A 1FL0A 3PIOA 4HCSA 4XXEA 2E2DC 1GHKA 4A3BH 2AUKA 2HT1A 3CMEA 1BOSA 1GUOA 1MSGA 4K0KQ 1L1OA 4C3HH 1W6KA 4JI2L 2L0CA 4TSSA 1EYCA 5DEHA 2F03A 5IWAL 4A3CG 1A2UA 5M3MG 1K8AC 4Q5VA 2D0OA 1W3SA 1VDZA 3Q23A 2A6ED 4ZCKA 1E1OA 3AB9A 4KY7A 4R4OA 1HNWL 4JYAL 1MJCA 3OW2A 3HFZB 4P72A 1FNVA 1SN8A 4OO1I 4IN3A 1PH5A 4ZYSA 2WAQG 2Z0SA 2B29A 4A3FG 5KYIA 4GOPC 1YI2A 2CWAA 3TDQA 1TWHB 3F2DA 4FYDA 5IYBH 3EBEA 3J81i 3HOZH 2L12A 2E2JH 4PZ8A 4DUYL 1NAPA 3TZUA 2F0IA 5LHY1 3J80E 1UAPA 1CSQA 1K83B 2IL8A 1PZJD 3MFYA 4C2MB 4DV5L 1I6HH 2BA1A 1BR9A 2XGTA 4QGUA 1FGUA 4NDXA 1IZ6A 4NKLA 2F4VL 4FVMA 1OXSC 5ELOA 1A3VA 3RN2A 4EQOA 1HXYD 1EYGA 3J81j 1Y14B 3G7LA 3K59A 1UE1A 1XNRL 4DR7Q 1CI3M 3ULJA 2F3WA 3MXUA 4R1JA 1DXMA 1A15A 1CT1D 3TP7A 4YWMA 2K28A 4DR1Q 2RSOA 4V190 5CV5A 3CQZH 4FF1A 2QCPX 1BBXC 1RIPA 4YHHQ 1RL2A 5JAVA 4DV4L 4WRDA 3PQIA 3T1YQ 1KLGD 1EIHA 4X62L 4BY7B 3D4DA 2ZTDA 2GA4B 3HKSA 2OTJA 4IOCA 2DY8A 4DR2Q 2RDHA 1M1KC 1CA6A 2UXBQ 1EL0A 4DF7A 4IJLA 1IXRA 3A8KE 1C8CA 3TS2A 1B9MA 4LFBQ 3FRPB 1ZEQX 2EZVA 5HGQA 1PV4A 1KRTA 4ZKCB 2TSSA 3PCOB 4A3KB 1WTRA 5IT9E 3T51B 3VR2A 1X3GA 3MEFA 2CKZB 1GD7A 1SYCA 2WB1G 1I50B 3E0JA 1SYEA 3TP8A 4WJ4A 4UP8A 5AFWA 4AH6A 4A93G 1Z7TA 2JEAI 1E7ZA 2VQEL 1YVCA 5AJ3L 1W6JA 5EPLA 3V96A 4DPGA 2DNEA 3T13A 1XPOA 2NTSA 3AMUA 3KBXA 4A76A 3HOVB 4QY7A 3U9OA 1VQIA 2EXDA 2XSCA 2K50A 5H1SE 1EY4A 5DM73 1B3QA 4A4IA 4GOPA 1KAWA 4XDXA 1N34Q 3BVGA 3MWYW 1K83H 3ZJYC 4C2MH 4M8AA 4OO1G 2LY7A 4XTCS 1NR4A 2E5LL 3TREA 5LMNQ 4DK1A 3PIO3 2SNSA 1SXTA 3CP0A 3K5OA 3O13A 5COYA 1KDCA 2B2YC 5CBAE 1JT8A 4QIWE 2KBNA 3L2PA 4KLKA 4OXPA 4L5TA 5E7NA 5FJ8H 2EYJA 1VQ4A 4LW1A 2XN9C 3MTSA 4KN7C 3HOXG 4FNFA 2J0TD 4GN3B 4RA8A 3TBIB 5IY0A 1Q90A 3UI2A 2ASBA 1J9OA 4HTHA 4X64Q 4BY7H 4JG2A 5EPKA 1CKNA 2L55A 3K5LA 5IGDA 1DOMA 4DR4L 4EX5A 1DJRD 5K36G 5EAYA 1TXYA 1VQ9A 4DV3L 2JA6G 4CDEC 5JEAG 1Y1WG 2K5QA 4LK1C 4A3GG 1LTGD 2B8GA 3MZ5A 3SVMA 1TWFB 4DNTB 3PMFA 1AE3A 1L0XB 1YBYA 5FLMG 1LTLA 3UDGA 4A3KH 4JV5L 4JW0A 2ZTEA 3SR1A 1DGSA 3GP7A 4X3KA 3URYA 2MHVA 1D1IA 1CSPA 3OMCA 2JJQA 5J22A 3VR6A 4KHPQ 2KHJA 1SMXA 4J1MA 1B44D 3EFXD 3SDZA 4XQNA 3JAMi 1PFNA 2A68D 4JI1L 4CGYB 1E24A 3DWPA 4ZAIA 3K7UC 2I5MX 5JJLA 3W2DA 1NTGA 2BDNA 2R3ZA 2OWOA 3BYTB 5K5PA 3IL8A 5GROA 3OW7A 2L4NA 1EIGA 3RN5A 2ZTCA 5M5WB 4DXGA 3HOVH 4L5RC 2NTTA 2F0QA 2JXMB 3NQTA 3B6YA 4A3LG 4J15A 4NMZA 1PZID 3HZXA 3WOEA 4G4KA 2MGSA 1UNSA 2C35B 3PSIA 2Q2TA 1STHA 4KKUA 4DV7L 2D9UA 1JWSD 4H13C 3UDFA 3CC2A 2F0LA 3HOZG 1W2BA 5I2YA 3D0FA 4OELB 1JWMD 1O78A 3FPPA 4F7XA 2F0MA 1K28A 1IW7C 1S5ED 2R7ZB 1ET6A 1RJTA 2XVSA 2VQFQ 2AQ1B 1N36Q 3W1GA 1X55A 3ERSX 4JBKA 4CDCC 1FNUA 1PH9A 1ZYRD 2ICIA 2ZT9C 2CWPA 3LX0A 1Q12A 3F1ZA 2B2YA 3E5SA 3BYYB 4P75A 2B2WC 4LF6Q 1H9RA 2PZTA 3G71A 1RODA 4KJOA 3KLSX 2BDOA 1NJIC 3RR5A 3GTGB 3TP5A 4KHVA 4RGTA 2F52A 3A8JE 4JI3L 3PF5A 2HHHL 3KF6A 2A73B 3TSSA 3H15A 2AWNA 4N9PA 2NZ1D 3BDOA 3OWFA 4JI8L 1WJJA 2WP8J 4JI4L 1WI5A 1KABA 2DUDA 2UUCL 1QOHA 1KQSA 3P75A 4HSPA 3W3AA 1QVFA 4RGNA 1TWFH 3S17B 2JK8A 4M1UB 3H0GB 4R8NA 4UP7A 3OWEB 4KD3A 4AQYL 4KK7A 1E0BA 3BVZA 3I90A 4DAVA 4ID6A 2CQOA 2E2IB 3RZOB 2KUMA 1T5EA 1ENAA 1LTID 1QCBD 1UEAB 2FFKB 1LTRD 4B3SQ 3R93A 5JJIA 4TKOB 3I4NB 1FR3A 2HDMA 3AU7A 2CQAA 3M7NA 2B3GA 4OIJA 4LF9L 2VW9A 1X54A 1RCVD 3K5NA 3FKIB 5M5WH 1TT2A 1JICA 1SNCA 1V1OA 1ESFA 4JI0Q 3A5UA 3CCSA 2F0SA 2K52A 1G51A 3SHLA 4BA2I 1KD1C 1D5MC 3S2DB 3TN2A 1IBLQ 3FHWA 4X6AH 1GUNA 2ES2A 2UUBL 4JI7L 1PRTC 4X66Q 3WOFA 4CKEA 2RF4A 3HOWB 1TR5A 4HAEA 1CA5A 5IYCH 5C3EG 1PYBA 4ME5A 5HURA 4RFBA 2F0GA 4KY6A 2R7ZH 5HY6A 4Q0FA 2Y0SG 2I46A 3I72A 1F9PA 2E74C 4J8QA 1I4XA 1BF4A 1VQFA 1U5KA 5T1IA 3I73A 3NQIA 2F0KA 5C5MA 2D5DA 4CBVA 4JI6Q 3PO3B 4B3RQ 1VQ8A 2CW0C 3K80C 1EOVA 5FJ8G 3BDCA 1IBMQ 4A3EG 1HUMA 4IUNA 4GKJQ 1PVOA 4C3JG 3WDNA 5FO8B 3GTGH 2B2WA 1N32Q 2BE5C 2JQOA 4L5SA 4LWCA 4BY7G 3QWNA 3CCMA 2FJ2A 1PH1A 1XTDA 3U9SA 4EVOA 4DFAA 1SFOB 3DWAA 2UU9L 4GNXC 4DNRB 4A75A 1YJ9A 1ENFA 1NCVA 2EYMA 3QB3A 2CCZA 4HJAA 1TS5A 4OL7A 4NXNQ 1WD0A 3S17H 3EQLC 3H0GH 3FP9A 5IGCA 2K33A 1K9MC 2XWJB 5C4HA 4RCNA 1G6PA 2D62A 1M8AA 1SBBB 1G2SA 2HIVA 1D2BA 4KD4A 4DGZA 2F0DA 1PH3A 1KLUD 2F0HA 4OEMB 2E2IH 3RZOH 4IALA 2NZHA 3L9AX 2D0PA 3OTOL 1TY2A 4JK1C 4AYBE 3NEMA 1GUSA 2C9OA 5D3IB 1I4GA 3C2PA 5IYDG 1WTPA 2L15A 1SROA 5C44B 2F0UA 4H44C 4HEDA 4KHZA 4OONA 4JBWA 3WWVA 1I4RA 1CHQD 3FKIH 1XNQL 2PMZB 1PTOC 5E4WC 1M4VA 2EJGC 3S2DH 1EQVA 3SK8A 5A2QL 4MIUA 2B2UC 3L3OC 3HOWH 1LACA 1NUCA 4IQZA 3RD4A 1HA5A 1IYUA 3DM1A 3KF8B 4L6TB 2KCNA 3X3NA 2UUAL 1SRUA 1CUKA 3A74A 1HNZQ 2MFIA 2SEBD 2PI2A 1CZWA 4HJ9A 1YJWA 2Z6BA 1KIXA 1XX8A 4DV0Q 4LF5Q 1EFID 1V1PB 5DNFA 2A6HC 1AP0A 4DU9A 4FF3A 3GV6A 3PO3H 2ZJPA 2PW5A 2RHSB 1DD2A 3MVVA 4LF4L 4K6LA 1QUQA 3S1NB 2F1MA 1C7YA 2VL6A 3KJOA 2JSOA 3HRZC 1S72A 2F0JA 4EQNA 1Q1BA 1D5XC 1QNKA 3NSWA 3S1RB 1SFOH 5ELBA 4KJNA 3HEJA 3J7AV 4GN5A 3BS1A 1KXLA 3OPOA 1H9KA 2AHOB 3EROA 1AZQA 5LL6S 3D6WA 4L5QA 1PH4A 1DOLA 3K6OA 1VQKA 1SMYD 4GNXA 3T1HQ 1LTAD 1NE3A 4HJ7A 1LUZA 4K5VA 4YCUA 1XMQQ 3EN2A 1EZ6A 1KAAA 4UAIA 1BBWA 4NP5A 4RWSC 3LWEA 2A8VA 2ENBA 1F77A 4P73A 3JAMc 1SDFA 2KENA 2V4DA 1LT4D 3CRLC 3K57A 2JA9A 1UEBA 4BBSG 2UXDQ 2E2HB 4PMBA 1PMRA 1SR3A 4DUZQ 2PQAB 4DR5L 1MSHA 5BN4A 5C44H 1LV9A 1I4HA 4RG1A 1EY0A 3KFUA 4QCLA 1B70B 4XYOA 1LT3D 3D8GA 1HZ9A 1CQVA 1UE5A 3J80c 3STBD 3DHQA 3S1QB 1JR0D 4MTKA 1RTOA 1IL2A 3NWSA 3GTQB 1EQRA 1EYAA 1FD7D 1IKMA 3VYRA 1E1TA 1SE8A 4F8MA 2B2UA 1D7QA 3NBIA 4NPSA 1EOTA 1KTKA 5IGBA 2F0NA 4O0AA 3LGJA 2R7ZG 1Y1VG 1X6OA 4K8IA 1HTLD 4A3JB 3X3MA 1G2TA 3DLLA 1S5BD 1NMGA 5EKLA 4IUUA 5M5YH 1X56A 4U68A 4A3DB 2N55A 2RKSA 4JI2Q 3RNUA 5IWAQ 1F2LA 4UHVA 2Q2UA 1WD1A 1RD9D 1Y8OB 2F0EA 2JA7B 3ND8A 1HNWQ 1LYLA 1WTOA 3S1NH 5M9OA 3SEBA 4JYAQ 2YTVA 4BS9A 3NTKA 1MBYA 4IUTA 4OWWB 1WVLA 3I3CA 1AN8A 4QMGA 2RCFA 3S1RH 4QL5A 1STNA 1Q81C 2HQEA 5JEAJ 4R4TA 2WAQE 2XIWA 5T1GA 4DR2L 1B9NA 3BZKA 4YY3L 3E0EA 3CCJA 3HKZG 3OMGA 5BR8L 4DUYQ 3BVMA 2NN6H 2XWBB 3KDFA 3OSOA 5IT9c 4DV5Q 3HS0C 3H0GG 2IT1A 5EPJA 4BA1I 2F4VQ 1JE5A 2A69C 4LJZC 4QF4A 3CPWA 3RLFA 4JI5L 2KEEA 1S5CD 3MXNB 4IUPA 2F3VA 3CKIB 2XRSD 1XNRQ 3VA5A 1Q46A 3S24A 2DN8A 3CCLA 3J81L 1KL9A 5I9OA 2E2HH 1KNAA 2WIIB 2KQ3A 2LXJA 3T56B 1JB7A 1F2ZA 1TIID 3CCRA 4DV4Q 1IYJB 3RMHA 3E3XA 1X3PA 2F0WA 3QR8A 1V8QA 1YITA 4X62Q 4LF8L 2A6EC 4RMFA 3IKJA 3NK9A 2B2TC 4QQBX 1SE3A 2NVQB 2WINB 5KRUA 3S1QH 5J1ZA 3GTQH 4Y52H 2G9DA 4CJ2C 3HOWG 1YJNA 1Q1EA 1BNZA 3TP6A 3FVQA 1TWHH 2HCIA 5G3LF 4O2DA 5CV4A 2WKDA 4H7BA 5C3WA 3OYYA 4OIKA 4A3JH 4J6HA 4EQ5A 5EKKA 1I94L 1S40A 4A3DH 1VQLA 4S3SA 4YWLA 5FO7B 1K3BC 4HN7A 3IAYA 5JVG3 2WB1E 4JPBW 1YHAA 5CBEE 3PO3G 3VR4A 2JA7H 4JC0A 2VQEQ 3PO2B 4G7HC 3DWQA 1TY0A 2GVAA 4QUFA 1HHVA 4IURA 2NN6I 2QDLA 4X64L 1VQGA 2P5ZX 4C1NK 1JORA 3TS0A 1BCPC 2SNMA 1HZAA 3C46A 3U4VA 1L1OB 1BBUA 1N33Q 3GV3A 4LAAA 1MGSA 1BQQT 1MD2D 2Q2IA 1LTTD 5LMUL 4XT1B 2ZM6L 3KJPA 1PYSB 2EY1A 3CRKC 2Q8TA 2O4XA 1CFMA 3C1EA 5J39A 2K7VA 1TQOA 1ML0D 1Q3LA 2R7DA 2R7FA 4LFAL 3A7AB 3G4SA 5A2QE 1U0LA 3M4QA 1EQTA 5C6AA 5IGEA 1NR2A 2JA5B 5JJKA 4B3ML 1OO9B 2JEBI 3ONAB 1I50H 4A3BG 2PYKA 3I55A 2JYOA 2EYLA 1K8OA 4CDDC 1KHIA 4C3HG 1H9SA 1LM0A 3Q8DA 4DA2A 5LMNW 5M5XB 1SSOA 5C44G 4IFDH 3HOUB 3F2BA 3GTKB 1YHQA 2UXCL 1Q7YC 4DR4Q 1GJXA 4ULLA 2NVQH 1EWCA 1Y8NB 4ZLTF 2F0FA 1SNQA 3NENA 4DV3Q 5FLXc 2B2TA 2K01A 4X65L 2HQLA 2ZXOA 3IRBA 5D3DA 2FINB 4R4CA 3E9HA 4L8JA 1PRTF 5ISRA 2F0VA 2K04A 2IWHA 5IYBG 2NUCA 4JV5Q 2Z8LA 3J80i 1BO0A 3K5MA 1QG7A 1SNPA 1IBKL 2SOBA 1JJGA 5M3MB 3CC7A 1Q8KA 3Q6SA 4DV2L 4DAYA 3CMAA 4MN3A 1PDQA 4R4IA 3RLOA 1E2WA 3DMUA 4JI1Q 4HSVA 5FO9B 2K5DA 3KBGA 3H3VH 2J4XA 3PO2H 1JC7A 1ESRA 3MA2B 1HR0L 2EY6A 3A7LA 1X65A 5TSSA 2R61A 1XMOL 2IHEA 3SK6A 3J7A5 3KLWA 4DR6L 5EJWA 2RA4A 4AIMA 4IPDA 1QNUA 3P20A 3CCEA 2MP1A 1JB3A 3M7GA 2PO4A 2RVLA 1PXUA 5I2XA 2RCNA 2DY7A 3DXJC 3JAML 3QOJA 3TZDA 2NN6G 2VNUD 2NB0A 4IPCA 1MIUA 5KNCA 2NVXB 4GKKL 1JOOA 3PIPA 2K14A 2MQHA 3PUZA 4HIDA 2K5HA 3BG3A 2EJFC 4PZ7A 2A1AA 4EQPA 4I65A 4IFDI 1SE2A 4OGQC 2A74C 4GOPB 2VUMB 1OXTA 1TWCB 3M4PA 1Q8IA 1IYVA 1S4ZA 1P8LA 4B3TL 4FDBA 4GLXA 3GTOB 4KN4C 5I4DA 2AQ2B 1T5XD 1YNJC 2HD3A 1ILPA 1UE7A 4JI3Q 4RHSA 2QA4A 5IP9H 3HOUH 3GTKH 5JPMC 2N49A 1E2VA 5C0XH 3NTHA 3ICEA 1EY5A 4E6IA 1VQAA 4POFA 4RHRA 2ZXRA 4JI8Q 3RZDB 1IBLL 4IZ8A 1JMCA 3VDYA 2Q8RE 2UUCQ 1ZXTA 1CK1A 3D4RA 1PTOF 3RUZA 2F0TA 1HR0W 2BCOA 3H3VI 4AQYQ 1JOQA 1PA6A 1U9RA 3GO5A 1CKNB 3V2TA 1U4RA 5HGTA 1TVXA 1TWGB 3HG9A 4A3JG 1ASYA 4O1NA 1BKBA 1I4QA 2L9HA 3KOJA 4QIWB 4A93B 4JI6L 2EPBA 1EU4A 4XYQA 5JVH3 1SAPA 4ODGA 3D3RA 1X3EA 1ZYRC 2JA7G 2X6LA 1PTOD 4N8FA 3Q0AA 1SYGA 1EEID 3NBHA 1I5FA 4K5WA 3GTLB 3CU7A 4DKAC 3T16A 2ID0A 1PFMA 4LF9Q 2K75A 3CCQA 5EQ0A 4PG3A 2FMCA 2ICEC 2TMPA 1B53A 4DV1L 4APVA 3J7ZC 1SNDA 1HNXL 2KHSA 4C3IB 4BBRB 4PNYA 4PMWA 5I6YA 3F8TA 3J81E
chains in the Genus database with same CATH topology
2UUBQ 4LF6L 2UXCQ 1NE3A 4HJ7A 4UP8A 4WJ4A 4LF7Q 1LUZA 4GS3A 4YCUA 5GAGC 2MNAA 4ALPA 1XMQQ 1JJCB 1PH7A 1VQEA 2BH8A 4AH6A 3EN2A 4A93G 1BBWA 2NVXH 5IE8A 1ASZA 2JEAI 2A8VA 1E7ZA 2VQEL 4P73A 3JAMc 2KENA 1YVCA 4X65Q 4JOIC 2YTXA 5AJ3L 3UE1A 2PMZE 1OXVA 3G48A 1C9OA 2JA9A 1NMFA 1UEBA 4DPGA 1HJPA 4BBSG 2UXDQ 4A3IG 3PUYA 1XPOA 2Y0SE 1QVGA 1SR3A 4DV7Q 2VUMH 4A76A 4DUZQ 5C0XI 2PQAB 2ZJQA 4DR5L 1TWCH 2YV5A 4QY7A 1VQIA 2EXDA 3CW2C 5C44H 4RG1A 2K50A 5H1SE 4A3KG 3KFUA 4GOPA 4A4IA 1IBKQ 1B70B 4DNIA 4GLVB 4DV2Q 1KAWA 1HZ9A 3GTOH 1N34Q 1UE6A 1K8GA 4KI0A 1UE5A 4R4QA 1K83H 3ZJYC 1HH2P 4C2MH 3STBD 3J80c 4OO1G 1HR0Q 2V1CC 4PZ6A 3U58A 4XTCS 1WCMH 4IFDG 2E5LL 3TREA 5LMNQ 1IL2A 3I4NH 1EQRA 2GVBA 4YCVA 3CP0A 2GN5A 4DK3C 1XMOQ 1FJGL 3RZDH 4B3SL 1E1TA 2PI2E 1SE8A 4YWKA 4DR6Q 2UU9Q 4IFDJ 1VQHA 2JA5H 1D7QA 4NPSA 4A3DG 1JT8A 4BY1G 4QIWE 1B7YB 2KBNA 5GQOA 2VS1A 1VQBA 4KLKA 4OXPA 3L2PA 4L5TA 4O0AA 2OCEA 3LGJA 2AKWB 2R7ZG 1Y1VG 1X6OA 5E7NA 1KC8C 3K7AH 5FJ8H 1A8VA 3DLLA 1VQ4A 3A0JA 1NMGA 5M5YH 4LW1A 4JBMA 1QVCA 3E9IA 3I4MG 1X56A 3HOVG 3HOXG 4JI2Q 3RNUA 4LNQA 5M5XH 4MTNA 5IWAQ 4GN3B 5IY0A 3KF6B 2HHHQ 1PFSA 4JI0L 2Q2UA 4UY8C 1TWGH 2ASBA 3RLNA 4X64Q 1N9WA 1OXXK 4GKKQ 4BY7H 2DGYA 1CKOA 1HNWQ 4IO9A 1VQ5A 1LYLA 4JG2A 2BA0A 4OX9L 4JI4Q 1CKNA 5C4XH 3S1NH 4A93H 4JYAQ 3OTOQ 2YTVA 4X66L 4DR4L 4EX5A 1UWVA 3CCVA 1VQNA 5K36G 1QZHA 4OWWB 3ULLA 1EFWA 3AEVA 5EAYA 3AQQA 1TXYA 4DV3L 1VQ9A 2K5VA 1VQDA 2R6GA 4LUZA 2JA6G 3GTLH 4BBSH 4DV6Q 5JEAG 1EIFA 2OTLA 2VY3A 1Y1WG 3S1RH 4QL5A 1PH6A 3S2HH 1Q81C 4IPHA 1PHJA 4A3GG 3BU2A 4R4TA 5JEAJ 2WAQE 1M90C 4DR2L 3BZKA 4YY3L 3M85A 4B3TQ 3E0EA 1AE3A 1YBYA 1VS0A 3CCJA 2K4KA 5FLMG 1LTLA 3HOYG 3HKZG 1OTCA 5BR8L 4A3CH 4DUYQ 3UDGA 4A3KH 4JV5L 1WOCA 5M3MH 2ZTEA 1VQPA 1O7IA 1A62A 1DGSA 3KDFA 3NELA 4XIGS 4BBRH 3L7ZC 4C3IH 3PUWA 5IT9c 4B3RL 4DV5Q 1CSPA 2JJQA 4KHPQ 4IJHA 3H0GG 2IT1A 2KHJA 1SMXA 4BA1I 3J81c 3CCUA 1IBML 2NZOA 2F4VQ 4DR3L 4NXMQ 4OWTB 3G6EA 1JE5A 4GKJL 3CPWA 3CC4A 4UPAA 3JAMi 3RLFA 2UUAQ 4JCVE 4JI5L 3T1HL 4HIOA 4A3FH 4JI1L 3MXNB 1N32L 4LF7L 1E24A 4LFCL 3K7UC 1XNRQ 2I5MX 5JJLA 1Q46A 1NTGA 3S24A 1VQ7A 2OWOA 3CCLA 1HZBA 1KL9A 1Y1VH 2OQ0A 2E2HH 2VZAA 2K5NA 4ME3A 5GROA 3S16H 4JOIA 1FVIA 3L0OA 2I0QA 2B63H 3S14H 2LXJA 3RN5A 2ZTCA 1EUJA 1JB7A 4JI7Q 4L5RC 4HIMA 3CCRA 4DV4Q 1PH8A 3HOVH 3B6YA 4A3LG 1IYJB 4J15A 2Q2TA 4NXNL 4LF4Q 3PSIA 2FXQA 2C35B 5J3BA 1YITA 4X62Q 4LF8L 4RMFA 2R92H 4DV7L 3UDFA 4K0KL 2I5HA 2PNHA 3CC2A 2PQAA 3HOZG 2ZJRA 1K73C 1W2BA 2KCMA 3CPFA 5IP7G 4QQBX 3D0FA 1N8RC 1A63A 1E22A 2YYZA 2Q2HA 3PF4A 4JBJA 4A3MH 4AYBG 3S1QH 3K0XA 3U50C 2YU9H 5M3FH 3GTQH 4Y52H 5GAEC 4LUVA 2VQFQ 1N36Q 5C0XG 2JA6H 3W1GA 3HOWG 1E3PA 1X55A 3ERSX 1Q1EA 1YJNA 4JBKA 5C0XJ 4DV1Q 1TWHH 1PH9A 4O2DA 4P71A 2CWPA 3OYYA 1K3RA 1Q12A 3F1ZA 2QGQA 1HNXQ 3SGIA 1VQOA 4A3JH 5FLMH 2LXKA 4BXXH 4DAYB 4EQ5A 1X3FA 4P74A 1I94L 1S40A 4P75A 4A3DH 3TEHB 1GKHA 3GTJH 1VQLA 3G71A 4LF6Q 4YWLA 2JA8H 2A19A 2R93H 1NJIC 2WB1E 3RR5A 1YHAA 3KYHC 3DM3A 3PO3G 4IPGA 4POGA 2JA7H 2F52A 4JC0A 2VQEQ 4JI3L 3BZCA 3PF5A 1QZGA 5IYCG 2HHHL 3KF6A 2GVAA 3H15A 3AYHB 2JE6I 2AWNA 2NN6I 1T9HA 4X64L 1VQGA 3K81C 1R9TH 4JI8L 1EWIA 1WJJA 2WP8J 1EIYB 3TS0A 4JI4L 2IX1A 1AE2A 1B8AA 1WI5A 2F3IA 1HZAA 1V1QA 2DUDA 3CXCA 2QEXA 1HNZL 3U4VA 2UUCL 1L1OB 1L1OC 1KQSA 1BBUA 1YZ6A 1J5EL 4DR5Q 1N33Q 2NVTH 4DR7L 1Q82C 1A0IA 1WFQA 4DV0L 4LF5L 1QVFA 1TWFH 2JK8A 2N8NA 1Z9FA 4UP7A 4DV6L 4DR1L 4A3LH 2Q2IA 4AQYL 5LMUL 1HZCA 1GM5A 2ZM6L 1K0RA 1C0AA 4YHHL 5GADC 3I4OA 1YHBA 1VQJA 3T1YL 3KJPA 1PYSB 2MO0A 2ATWA 2CQOA 1J6QA 2I5LX 1KRSA 3PV0A 4GLAC 1SLJA 1FJGQ 1VCIA 4B3SQ 4A3IH 4GN4B 1VQ6A 3EIVA 2E8GA 3U4ZA 3PO2G 4IOAA 5JJIA 1XJVA 2R7DA 3W1BA 2R7FA 4LFAL 4NXML 1V43A 3G4SA 3AFQA 2AMCB 4H02A 2UXBL 1U0LA 3M7NA 2KHIA 3K8AA 2B3GA 3M4QA 4MNOA 1XNQQ 2IY5B 5JJKA 4LF9L 2VW9A 4LFBL 4B3ML 1X54A 4DK6C 2JEBI 1I50H 4A3BG 5M5WH 3I55A 2IX0A 4HJ8A 1X9NA 2VUMG 4JI0Q 3A5UA 3CCSA 1KHIA 2K52A 1G51A 1LM0A 3Q8DA 4LUOA 1KD1C 4BA2I 5LMNW 3UE0A 5C44G 1IBLQ 3FHWA 4X6AH 1MKHA 2ES2A 3ER0A 3F2BA 3PUVA 4OX9Q 1YHQA 2UUBL 4JI7L 2UXCL 1Q7YC 4X66Q 4DR4Q 2RF4A 1XMQL 2IHFA 2NVQH 5IYCH 5C3EG 1GVPA 1PYBA 1XPUA 1Z47A 3PGZA 4BY1H 2EIFA 3NENA 4DV3Q 5FLXc 2R7ZH 5HY6A 4X65L 2HQLA 2Y0SG 5C4JH 1WCMG 2Z6KC 3I4NG 3I4MH 3IRBA 4YCWA 3S15H 4TQUS 3HOXH 4YY3Q 2UXDL 4R4CA 1NBWA 3W5OA 3CAMA 3E9HA 4HJ5A 2JA5G 5BR8Q 1VQFA 1U5KA 1YIJA 4JV5Q 5IYBG 1PH2A 4DUZL 1QUQB 2HIXA 1J5EQ 2YTYA 3J80i 4JI6Q 4B3RQ 2EQSA 1G291 3FKIG 3I2ZA 3K80C 1VQ8A 1OXUA 1EOVA 3STBC 5FJ8G 3HKZE 5GAHC 1IBKL 1JJGA 3CC7A 1IBMQ 3M9BA 1Q8KA 4DR3Q 4A3EG 4DV2L 4GKJQ 3CMAA 1PVOA 2OQKA 3NBHB 4R4IA 3RLOA 1N34L 3HOUG 5IP9G 4JI5Q 3GTGH 4JI1Q 1BVSA 1N32Q 2AWOA 3H3VH 3PO2H 1HR0L 2JQOA 3D31A 4LFCQ 4L5SA 4LWCA 1Y1WH 4BY7G 3M3YH 3CCMA 4A3GH 5LMNL 1D8LA 1X65A 1PH1A 5C4XG 1XTDA 1XMOL 2IHEA 4QJFA 3J7A5 3KLWA 2MO1A 1GO3E 2UU9L 2N78A 3HOYH 4DR6L 4AIMA 1FL0A 3PIOA 4GNXB 4IPDA 4GNXC 4A75A 1EQQA 1YJ9A 2CCZA 4HJAA 3CCEA 4A3BH 4NXNQ 3S17H 3I7FA 3CMEA 3TQYA 3H0GH 3FP9A 4LF8Q 3PUXA 2HT1A 3GTPH 1K9MC 1L1OA 4C3HH 4K0KQ 2RCNA 4JI2L 3GD7A 1N33L 1G6PA 1TWAH 2D62A 5IWAL 1L0WA 4A3CG 2HIVA 2NN6G 5AJ3Q 5M3MG 1K8AC 2VNUD 2D0OA 1W3SA 4IPCA 1P16A 1MIUA 1PH3A 4BBRG 1E1OA 4GKKL 3PIPA 2E2IH 5C3EH 3GTMH 4R4OA 3RZOH 2K14A 1HNWL 2NZHA 5ELNA 1S3OA 2D0PA 2MQHA 3PUZA 1MJCA 3OTOL 4HIDA 3OW2A 4JYAL 3HFZB 2K5HA 2KCTA 3TRZA 4P72A 4PZ7A 4AYBE 3NEMA 1SN8A 2A1AA 2WFWA 4OO1I 1PH5A 2WAQG 2Z0SA 2ALYB 2B29A 1Q86C 4A3FG 4IFDI 4GOPB 4GOPC 5IYDG 1YI2A 1OXTA 2CWAA 3UDXA 1I3QH 2L15A 1SROA 3M4PA 2H5XA 3F2DA 1I94Q 1YNXA 4DAMA 5IYBH 3EBEA 1P8LA 3J81i 3F2CA 4KHZA 4OONA 4WJ3M 4B3TL 3HOZH 4FDBA 4JBWA 3WWVA 5DLQE 5IP7H 3FKIH 3CD6A 3S1MH 1XNQL 2E2JH 4PZ8A 4DUYL 4GLXA 2B63G 4UP9A 1YEZA 2E5LQ 4A3EH 1CSQA 4Y7NH 3S2DH 4DV5L 1I6HH 1UE7A 2BA1A 4C3JH 4JI3Q 1AH9A 3HOUH 2XGTA 5IP9H 2QA4A 3GTKH 4KHPL 2N49A 4QGUA 1FGUA 2R92G 1IZ6A 2F4VL 3HOWH 3ICEA 1OXSC 1VQCA 5ELOA 1JJ2A 3RN2A 3KF8B 1VQAA 4POFA 1WYDA 4JI8Q 1IBLL 1SRUA 2UUAL 3A5ZB 1CKMA 1EYGA 1CUKA 3A74A 3VDYA 3J81j 1HNZQ 4A3MG 3CF5A 1Y14B 1JMCA 2MFIA 2UUCQ 2PI2A 1UE1A 4HJ9A 3ULPA 1XNRL 1NY4A 1YJWA 3M4OH 4DR7Q 3ULJA 1KIXA 4R1JA 5M3FG 4DV0Q 4LF5Q 4YWMA 1HR0W 4DR1Q 3BJUA 3H3VI 3CQZH 4AQYQ 2Z6KA 3JC66 1PA6A 2XTIA 2N3SA 5LMUQ 2ZM6Q 1RIPA 1CKNB 3GO5A 4YHHQ 1RL2A 4DV4L 1XPRA 3PO3H 3I56A 2ZJPA 4NB3A 2RHSB 3T1YQ 4A3JG 1ASYA 4LF4L 4BXXG 1L2FA 1BKBA 1V9PA 4X62L 3KOJA 2ZTDA 4TVAB 1QUQA 2BH2A 1C7YA 4JI6L 3UDIA 1MJEA 2RHQB 2CFMA 2VL6A 2JA8G 3HKSA 2OTJA 4IOCA 3KJOA 1S72A 4LFAQ 1X3EA 4DR2Q 1M1KC 2JA7G 2UXBQ 1I5FA 1IXRA 1Q1BA 3AFPA 4IJLA 4DKAC 3TS2A 4OWXB 2ID0A 2VQFL 1SFOH 1N36L 2LSSA 4B3MQ 4LF9Q 4HIKA 4LFBQ 2K75A 3CCQA 5IYDH 3KDFB 4GN5A 4PG3A 4DV1L 4APVA 1KXLA 4MZ9A 3J7ZC 2R93G 5HGQA 1PV4A 1KRTA 3PCOB 2AHOB 3GDEA 1VQMA 1HNXL 4L5QA 1PH4A 1H95A 1X3GA 2NVYH 3MEFA 1VQKA 2CKZB 4PMWA 1GD7A 2WB1G 3F8TA 4GNXA 3T1HQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UUB Q;  4LF6 L;  2UXC Q;  1NE3 A;  4HJ7 A;  4UP8 A;  4WJ4 A;  4LF7 Q;  1LUZ A;  4GS3 A;  4YCU A;  5GAG C;  2MNA A;  4ALP A;  1XMQ Q;  1JJC B;  1PH7 A;  1VQE A;  2BH8 A;  4AH6 A;  3EN2 A;  4A93 G;  1BBW A;  2NVX H;  5IE8 A;  1ASZ A;  2JEA I;  2A8V A;  1E7Z A;  2VQE L;  4P73 A;  3JAM c;  2KEN A;  1YVC A;  4X65 Q;  4JOI C;  2YTX A;  5AJ3 L;  3UE1 A;  2PMZ E;  1OXV A;  3G48 A;  1C9O A;  2JA9 A;  1NMF A;  1UEB A;  4DPG A;  1HJP A;  4BBS G;  2UXD Q;  4A3I G;  3PUY A;  1XPO A;  2Y0S E;  1QVG A;  1SR3 A;  4DV7 Q;  2VUM H;  4A76 A;  4DUZ Q;  5C0X I;  2PQA B;  2ZJQ A;  4DR5 L;  1TWC H;  2YV5 A;  4QY7 A;  1VQI A;  2EXD A;  3CW2 C;  5C44 H;  4RG1 A;  2K50 A;  5H1S E;  4A3K G;  3KFU A;  4GOP A;  4A4I A;  1IBK Q;  1B70 B;  4DNI A;  4GLV B;  4DV2 Q;  1KAW A;  1HZ9 A;  3GTO H;  1N34 Q;  1UE6 A;  1K8G A;  4KI0 A;  1UE5 A;  4R4Q A;  1K83 H;  3ZJY C;  1HH2 P;  4C2M H;  3STB D;  3J80 c;  4OO1 G;  1HR0 Q;  2V1C C;  4PZ6 A;  3U58 A;  4XTC S;  1WCM H;  4IFD G;  2E5L L;  3TRE A;  5LMN Q;  1IL2 A;  3I4N H;  1EQR A;  2GVB A;  4YCV A;  3CP0 A;  2GN5 A;  4DK3 C;  1XMO Q;  1FJG L;  3RZD H;  4B3S L;  1E1T A;  2PI2 E;  1SE8 A;  4YWK A;  4DR6 Q;  2UU9 Q;  4IFD J;  1VQH A;  2JA5 H;  1D7Q A;  4NPS A;  4A3D G;  1JT8 A;  4BY1 G;  4QIW E;  1B7Y B;  2KBN A;  5GQO A;  2VS1 A;  1VQB A;  4KLK A;  4OXP A;  3L2P A;  4L5T A;  4O0A A;  2OCE A;  3LGJ A;  2AKW B;  2R7Z G;  1Y1V G;  1X6O A;  5E7N A;  1KC8 C;  3K7A H;  5FJ8 H;  1A8V A;  3DLL A;  1VQ4 A;  3A0J A;  1NMG A;  5M5Y H;  4LW1 A;  4JBM A;  1QVC A;  3E9I A;  3I4M G;  1X56 A;  3HOV G;  3HOX G;  4JI2 Q;  3RNU A;  4LNQ A;  5M5X H;  4MTN A;  5IWA Q;  4GN3 B;  5IY0 A;  3KF6 B;  2HHH Q;  1PFS A;  4JI0 L;  2Q2U A;  4UY8 C;  1TWG H;  2ASB A;  3RLN A;  4X64 Q;  1N9W A;  1OXX K;  4GKK Q;  4BY7 H;  2DGY A;  1CKO A;  1HNW Q;  4IO9 A;  1VQ5 A;  1LYL A;  4JG2 A;  2BA0 A;  4OX9 L;  4JI4 Q;  1CKN A;  5C4X H;  3S1N H;  4A93 H;  4JYA Q;  3OTO Q;  2YTV A;  4X66 L;  4DR4 L;  4EX5 A;  1UWV A;  3CCV A;  1VQN A;  5K36 G;  1QZH A;  4OWW B;  3ULL A;  1EFW A;  3AEV A;  5EAY A;  3AQQ A;  1TXY A;  4DV3 L;  1VQ9 A;  2K5V A;  1VQD A;  2R6G A;  4LUZ A;  2JA6 G;  3GTL H;  4BBS H;  4DV6 Q;  5JEA G;  1EIF A;  2OTL A;  2VY3 A;  1Y1W G;  3S1R H;  4QL5 A;  1PH6 A;  3S2H H;  1Q81 C;  4IPH A;  1PHJ A;  4A3G G;  3BU2 A;  4R4T A;  5JEA J;  2WAQ E;  1M90 C;  4DR2 L;  3BZK A;  4YY3 L;  3M85 A;  4B3T Q;  3E0E A;  1AE3 A;  1YBY A;  1VS0 A;  3CCJ A;  2K4K A;  5FLM G;  1LTL A;  3HOY G;  3HKZ G;  1OTC A;  5BR8 L;  4A3C H;  4DUY Q;  3UDG A;  4A3K H;  4JV5 L;  1WOC A;  5M3M H;  2ZTE A;  1VQP A;  1O7I A;  1A62 A;  1DGS A;  3KDF A;  3NEL A;  4XIG S;  4BBR H;  3L7Z C;  4C3I H;  3PUW A;  5IT9 c;  4B3R L;  4DV5 Q;  1CSP A;  2JJQ A;  4KHP Q;  4IJH A;  3H0G G;  2IT1 A;  2KHJ A;  1SMX A;  4BA1 I;  3J81 c;  3CCU A;  1IBM L;  2NZO A;  2F4V Q;  4DR3 L;  4NXM Q;  4OWT B;  3G6E A;  1JE5 A;  4GKJ L;  3CPW A;  3CC4 A;  4UPA A;  3JAM i;  3RLF A;  2UUA Q;  4JCV E;  4JI5 L;  3T1H L;  4HIO A;  4A3F H;  4JI1 L;  3MXN B;  1N32 L;  4LF7 L;  1E24 A;  4LFC L;  3K7U C;  1XNR Q;  2I5M X;  5JJL A;  1Q46 A;  1NTG A;  3S24 A;  1VQ7 A;  2OWO A;  3CCL A;  1HZB A;  1KL9 A;  1Y1V H;  2OQ0 A;  2E2H H;  2VZA A;  2K5N A;  4ME3 A;  5GRO A;  3S16 H;  4JOI A;  1FVI A;  3L0O A;  2I0Q A;  2B63 H;  3S14 H;  2LXJ A;  3RN5 A;  2ZTC A;  1EUJ A;  1JB7 A;  4JI7 Q;  4L5R C;  4HIM A;  3CCR A;  4DV4 Q;  1PH8 A;  3HOV H;  3B6Y A;  4A3L G;  1IYJ B;  4J15 A;  2Q2T A;  4NXN L;  4LF4 Q;  3PSI A;  2FXQ A;  2C35 B;  5J3B A;  1YIT A;  4X62 Q;  4LF8 L;  4RMF A;  2R92 H;  4DV7 L;  3UDF A;  4K0K L;  2I5H A;  2PNH A;  3CC2 A;  2PQA A;  3HOZ G;  2ZJR A;  1K73 C;  1W2B A;  2KCM A;  3CPF A;  5IP7 G;  4QQB X;  3D0F A;  1N8R C;  1A63 A;  1E22 A;  2YYZ A;  2Q2H A;  3PF4 A;  4JBJ A;  4A3M H;  4AYB G;  3S1Q H;  3K0X A;  3U50 C;  2YU9 H;  5M3F H;  3GTQ H;  4Y52 H;  5GAE C;  4LUV A;  2VQF Q;  1N36 Q;  5C0X G;  2JA6 H;  3W1G A;  3HOW G;  1E3P A;  1X55 A;  3ERS X;  1Q1E A;  1YJN A;  4JBK A;  5C0X J;  4DV1 Q;  1TWH H;  1PH9 A;  4O2D A;  4P71 A;  2CWP A;  3OYY A;  1K3R A;  1Q12 A;  3F1Z A;  2QGQ A;  1HNX Q;  3SGI A;  1VQO A;  4A3J H;  5FLM H;  2LXK A;  4BXX H;  4DAY B;  4EQ5 A;  1X3F A;  4P74 A;  1I94 L;  1S40 A;  4P75 A;  4A3D H;  3TEH B;  1GKH A;  3GTJ H;  1VQL A;  3G71 A;  4LF6 Q;  4YWL A;  2JA8 H;  2A19 A;  2R93 H;  1NJI C;  2WB1 E;  3RR5 A;  1YHA A;  3KYH C;  3DM3 A;  3PO3 G;  4IPG A;  4POG A;  2JA7 H;  2F52 A;  4JC0 A;  2VQE Q;  4JI3 L;  3BZC A;  3PF5 A;  1QZG A;  5IYC G;  2HHH L;  3KF6 A;  2GVA A;  3H15 A;  3AYH B;  2JE6 I;  2AWN A;  2NN6 I;  1T9H A;  4X64 L;  1VQG A;  3K81 C;  1R9T H;  4JI8 L;  1EWI A;  1WJJ A;  2WP8 J;  1EIY B;  3TS0 A;  4JI4 L;  2IX1 A;  1AE2 A;  1B8A A;  1WI5 A;  2F3I A;  1HZA A;  1V1Q A;  2DUD A;  3CXC A;  2QEX A;  1HNZ L;  3U4V A;  2UUC L;  1L1O B;  1L1O C;  1KQS A;  1BBU A;  1YZ6 A;  1J5E L;  4DR5 Q;  1N33 Q;  2NVT H;  4DR7 L;  1Q82 C;  1A0I A;  1WFQ A;  4DV0 L;  4LF5 L;  1QVF A;  1TWF H;  2JK8 A;  2N8N A;  1Z9F A;  4UP7 A;  4DV6 L;  4DR1 L;  4A3L H;  2Q2I A;  4AQY L;  5LMU L;  1HZC A;  1GM5 A;  2ZM6 L;  1K0R A;  1C0A A;  4YHH L;  5GAD C;  3I4O A;  1YHB A;  1VQJ A;  3T1Y L;  3KJP A;  1PYS B;  2MO0 A;  2ATW A;  2CQO A;  1J6Q A;  2I5L X;  1KRS A;  3PV0 A;  4GLA C;  1SLJ A;  1FJG Q;  1VCI A;  4B3S Q;  4A3I H;  4GN4 B;  1VQ6 A;  3EIV A;  2E8G A;  3U4Z A;  3PO2 G;  4IOA A;  5JJI A;  1XJV A;  2R7D A;  3W1B A;  2R7F A;  4LFA L;  4NXM L;  1V43 A;  3G4S A;  3AFQ A;  2AMC B;  4H02 A;  2UXB L;  1U0L A;  3M7N A;  2KHI A;  3K8A A;  2B3G A;  3M4Q A;  4MNO A;  1XNQ Q;  2IY5 B;  5JJK A;  4LF9 L;  2VW9 A;  4LFB L;  4B3M L;  1X54 A;  4DK6 C;  2JEB I;  1I50 H;  4A3B G;  5M5W H;  3I55 A;  2IX0 A;  4HJ8 A;  1X9N A;  2VUM G;  4JI0 Q;  3A5U A;  3CCS A;  1KHI A;  2K52 A;  1G51 A;  1LM0 A;  3Q8D A;  4LUO A;  1KD1 C;  4BA2 I;  5LMN W;  3UE0 A;  5C44 G;  1IBL Q;  3FHW A;  4X6A H;  1MKH A;  2ES2 A;  3ER0 A;  3F2B A;  3PUV A;  4OX9 Q;  1YHQ A;  2UUB L;  4JI7 L;  2UXC L;  1Q7Y C;  4X66 Q;  4DR4 Q;  2RF4 A;  1XMQ L;  2IHF A;  2NVQ H;  5IYC H;  5C3E G;  1GVP A;  1PYB A;  1XPU A;  1Z47 A;  3PGZ A;  4BY1 H;  2EIF A;  3NEN A;  4DV3 Q;  5FLX c;  2R7Z H;  5HY6 A;  4X65 L;  2HQL A;  2Y0S G;  5C4J H;  1WCM G;  2Z6K C;  3I4N G;  3I4M H;  3IRB A;  4YCW A;  3S15 H;  4TQU S;  3HOX H;  4YY3 Q;  2UXD L;  4R4C A;  1NBW A;  3W5O A;  3CAM A;  3E9H A;  4HJ5 A;  2JA5 G;  5BR8 Q;  1VQF A;  1U5K A;  1YIJ A;  4JV5 Q;  5IYB G;  1PH2 A;  4DUZ L;  1QUQ B;  2HIX A;  1J5E Q;  2YTY A;  3J80 i;  4JI6 Q;  4B3R Q;  2EQS A;  1G29 1;  3FKI G;  3I2Z A;  3K80 C;  1VQ8 A;  1OXU A;  1EOV A;  3STB C;  5FJ8 G;  3HKZ E;  5GAH C;  1IBK L;  1JJG A;  3CC7 A;  1IBM Q;  3M9B A;  1Q8K A;  4DR3 Q;  4A3E G;  4DV2 L;  4GKJ Q;  3CMA A;  1PVO A;  2OQK A;  3NBH B;  4R4I A;  3RLO A;  1N34 L;  3HOU G;  5IP9 G;  4JI5 Q;  3GTG H;  4JI1 Q;  1BVS A;  1N32 Q;  2AWO A;  3H3V H;  3PO2 H;  1HR0 L;  2JQO A;  3D31 A;  4LFC Q;  4L5S A;  4LWC A;  1Y1W H;  4BY7 G;  3M3Y H;  3CCM A;  4A3G H;  5LMN L;  1D8L A;  1X65 A;  1PH1 A;  5C4X G;  1XTD A;  1XMO L;  2IHE A;  4QJF A;  3J7A 5;  3KLW A;  2MO1 A;  1GO3 E;  2UU9 L;  2N78 A;  3HOY H;  4DR6 L;  4AIM A;  1FL0 A;  3PIO A;  4GNX B;  4IPD A;  4GNX C;  4A75 A;  1EQQ A;  1YJ9 A;  2CCZ A;  4HJA A;  3CCE A;  4A3B H;  4NXN Q;  3S17 H;  3I7F A;  3CME A;  3TQY A;  3H0G H;  3FP9 A;  4LF8 Q;  3PUX A;  2HT1 A;  3GTP H;  1K9M C;  1L1O A;  4C3H H;  4K0K Q;  2RCN A;  4JI2 L;  3GD7 A;  1N33 L;  1G6P A;  1TWA H;  2D62 A;  5IWA L;  1L0W A;  4A3C G;  2HIV A;  2NN6 G;  5AJ3 Q;  5M3M G;  1K8A C;  2VNU D;  2D0O A;  1W3S A;  4IPC A;  1P16 A;  1MIU A;  1PH3 A;  4BBR G;  1E1O A;  4GKK L;  3PIP A;  2E2I H;  5C3E H;  3GTM H;  4R4O A;  3RZO H;  2K14 A;  1HNW L;  2NZH A;  5ELN A;  1S3O A;  2D0P A;  2MQH A;  3PUZ A;  1MJC A;  3OTO L;  4HID A;  3OW2 A;  4JYA L;  3HFZ B;  2K5H A;  2KCT A;  3TRZ A;  4P72 A;  4PZ7 A;  4AYB E;  3NEM A;  1SN8 A;  2A1A A;  2WFW A;  4OO1 I;  1PH5 A;  2WAQ G;  2Z0S A;  2ALY B;  2B29 A;  1Q86 C;  4A3F G;  4IFD I;  4GOP B;  4GOP C;  5IYD G;  1YI2 A;  1OXT A;  2CWA A;  3UDX A;  1I3Q H;  2L15 A;  1SRO A;  3M4P A;  2H5X A;  3F2D A;  1I94 Q;  1YNX A;  4DAM A;  5IYB H;  3EBE A;  1P8L A;  3J81 i;  3F2C A;  4KHZ A;  4OON A;  4WJ3 M;  4B3T L;  3HOZ H;  4FDB A;  4JBW A;  3WWV A;  5DLQ E;  5IP7 H;  3FKI H;  3CD6 A;  3S1M H;  1XNQ L;  2E2J H;  4PZ8 A;  4DUY L;  4GLX A;  2B63 G;  4UP9 A;  1YEZ A;  2E5L Q;  4A3E H;  1CSQ A;  4Y7N H;  3S2D H;  4DV5 L;  1I6H H;  1UE7 A;  2BA1 A;  4C3J H;  4JI3 Q;  1AH9 A;  3HOU H;  2XGT A;  5IP9 H;  2QA4 A;  3GTK H;  4KHP L;  2N49 A;  4QGU A;  1FGU A;  2R92 G;  1IZ6 A;  2F4V L;  3HOW H;  3ICE A;  1OXS C;  1VQC A;  5ELO A;  1JJ2 A;  3RN2 A;  3KF8 B;  1VQA A;  4POF A;  1WYD A;  4JI8 Q;  1IBL L;  1SRU A;  2UUA L;  3A5Z B;  1CKM A;  1EYG A;  1CUK A;  3A74 A;  3VDY A;  3J81 j;  1HNZ Q;  4A3M G;  3CF5 A;  1Y14 B;  1JMC A;  2MFI A;  2UUC Q;  2PI2 A;  1UE1 A;  4HJ9 A;  3ULP A;  1XNR L;  1NY4 A;  1YJW A;  3M4O H;  4DR7 Q;  3ULJ A;  1KIX A;  4R1J A;  5M3F G;  4DV0 Q;  4LF5 Q;  4YWM A;  1HR0 W;  4DR1 Q;  3BJU A;  3H3V I;  3CQZ H;  4AQY Q;  2Z6K A;  3JC6 6;  1PA6 A;  2XTI A;  2N3S A;  5LMU Q;  2ZM6 Q;  1RIP A;  1CKN B;  3GO5 A;  4YHH Q;  1RL2 A;  4DV4 L;  1XPR A;  3PO3 H;  3I56 A;  2ZJP A;  4NB3 A;  2RHS B;  3T1Y Q;  4A3J G;  1ASY A;  4LF4 L;  4BXX G;  1L2F A;  1BKB A;  1V9P A;  4X62 L;  3KOJ A;  2ZTD A;  4TVA B;  1QUQ A;  2BH2 A;  1C7Y A;  4JI6 L;  3UDI A;  1MJE A;  2RHQ B;  2CFM A;  2VL6 A;  2JA8 G;  3HKS A;  2OTJ A;  4IOC A;  3KJO A;  1S72 A;  4LFA Q;  1X3E A;  4DR2 Q;  1M1K C;  2JA7 G;  2UXB Q;  1I5F A;  1IXR A;  1Q1B A;  3AFP A;  4IJL A;  4DKA C;  3TS2 A;  4OWX B;  2ID0 A;  2VQF L;  1SFO H;  1N36 L;  2LSS A;  4B3M Q;  4LF9 Q;  4HIK A;  4LFB Q;  2K75 A;  3CCQ A;  5IYD H;  3KDF B;  4GN5 A;  4PG3 A;  4DV1 L;  4APV A;  1KXL A;  4MZ9 A;  3J7Z C;  2R93 G;  5HGQ A;  1PV4 A;  1KRT A;  3PCO B;  2AHO B;  3GDE A;  1VQM A;  1HNX L;  4L5Q A;  1PH4 A;  1H95 A;  1X3G A;  2NVY H;  3MEF A;  1VQK A;  2CKZ B;  4PMW A;  1GD7 A;  2WB1 G;  3F8T A;  4GNX A;  3T1H Q; 
#chains in the Genus database with same CATH topology
 2UUB Q;  2EXZ A;  4LF7 Q;  2MNA A;  1O80 A;  1JJC B;  1PH7 A;  1DON A;  2A6H D;  2NBF A;  2NVX H;  1CQF A;  3S9W A;  1DM0 B;  1C9O A;  2NWG A;  3PUY A;  5I9P A;  3S16 B;  3FDT A;  2B63 B;  4RCO A;  2Y0S E;  1QVG A;  2VUM H;  4K6D A;  5C0X I;  2ZJQ A;  1TWC H;  5JOB A;  4WJW A;  3VYS A;  1FYC A;  3H09 A;  4A3K G;  2R92 B;  4XT3 B;  1GHJ A;  4DNI A;  4GLV B;  3GTO H;  1ENC A;  3Q24 A;  1UE6 A;  4KI0 A;  3I70 A;  4A3M B;  1F9R A;  3N6R A;  2V1C C;  4PZ6 A;  3E6Z X;  3U58 A;  4IFD G;  5M3F B;  3I4N H;  1KNE A;  1DZ1 A;  4DK3 C;  2GN5 A;  3N52 A;  1FJG L;  2EOT A;  2JA6 B;  3RZD H;  2PI2 E;  1A3U A;  2QW7 A;  4YWK A;  1TS2 A;  2EY5 A;  1VQH A;  2UU9 Q;  1TKW B;  1SYF A;  3C1F A;  3MXG A;  1IL8 A;  1KC8 C;  2CH4 A;  1VQB A;  1H9J A;  2X6G A;  1RTN A;  1G91 A;  2AKW B;  4DXF A;  2O2L D;  1A8V A;  1QVC A;  3E9I A;  5EKI A;  2O5I C;  3HOV G;  4LNQ A;  2JA8 B;  3KF6 B;  4UY8 C;  4Z9C B;  1TWG H;  3RLN A;  2AUJ D;  4FP5 D;  1OXX K;  1CKO A;  4IO9 A;  2PQE A;  1VQ5 A;  4OX9 L;  1IKL A;  4A93 H;  1TS4 A;  3OTO Q;  1UWV A;  3CCV A;  1QZH A;  1R9T B;  1EFW A;  3AEV A;  2R93 B;  2K5V A;  4LUZ A;  3GTL H;  4RAU C;  4DV6 Q;  1J8I A;  2OTL A;  2VY3 A;  2NVT B;  3BDL A;  2XRQ D;  4IPH A;  1HPC A;  1M90 C;  4F88 A;  4B9W A;  3M85 A;  2MPM A;  2D2C C;  1STA A;  1WOC A;  1VQP A;  1O7I A;  1A62 A;  3NEL A;  4XIG S;  4BBR H;  4C3I H;  1J5E L;  3J7A F;  3PUW A;  4ZRZ A;  2F0O A;  2NZO A;  4DR3 L;  4NXM Q;  1EZ8 A;  4OWT B;  1FNW A;  3CC4 A;  5C3X A;  4UPA A;  3MAQ A;  2EE1 A;  4A3I B;  2UUA Q;  3MHB A;  3T1H L;  4HIO A;  4MHE A;  1MHW C;  2LFN A;  2C5C A;  4P2C B;  4U67 3;  4LFC L;  1HFN A;  4F87 A;  2E75 C;  1BXT A;  1HZB A;  2OQ0 A;  3LNN A;  4X3U A;  2VZA A;  2K5N A;  3S16 H;  2PPB C;  1FVI A;  5DM6 3;  2B63 H;  1PZK D;  4HIM A;  1D6E C;  2RQX A;  1Y8P B;  4LF4 Q;  2FXQ A;  2R92 H;  4DAP A;  4K0K L;  2I5H A;  2PNH A;  3A54 A;  5E1F A;  2KCM A;  5FLX L;  1A63 A;  4X3T A;  2YYZ A;  5L37 A;  2Q2H A;  2J7Z A;  4A3M H;  1SNM A;  4BY1 B;  3R2I A;  3K0X A;  5M3F H;  1STY A;  3I4L A;  4LUV A;  5C0X G;  2JA6 H;  1AZP A;  4UDU C;  3I4M B;  3NTI A;  2QEJ C;  3R2T A;  1ICW A;  2KED A;  3ITP A;  3SGI A;  1VQO A;  4BXX H;  5FLM H;  2LXK A;  5D14 A;  1X3F A;  1PYW D;  3I91 A;  3TEH B;  1GKH A;  1B2T A;  4HMI A;  2KCC A;  2JA8 H;  1GUT A;  2A19 A;  4FF2 A;  1BUV T;  1ET9 A;  2K5W A;  1JCK B;  4XQJ A;  3DM3 A;  4TRD A;  3NUC A;  2OF1 A;  5IYC G;  1WTW A;  1QZG A;  4K14 A;  1PLF A;  1X32 A;  2JE6 I;  1T9H A;  3JAM E;  1R9T H;  1EWI A;  1EIY B;  3VR3 A;  3HOY B;  2R93 H;  1AE2 A;  1B8A A;  3CXC A;  2QEX A;  4G7Z C;  2VB3 X;  2NVT H;  4DR5 Q;  4DR7 L;  3F2U A;  1A0I A;  1WFQ A;  1CTM A;  4NW2 A;  5IGF A;  1K0S A;  2BOS A;  3GTP B;  1YNN C;  4DR1 L;  4A3L H;  2KEC A;  1TWA B;  1HZC A;  2AQ3 B;  3M4Y A;  1GM5 A;  2G9H D;  4YHH L;  3IFD A;  1RDP D;  1YHB A;  1VQJ A;  2PZU A;  3T1Y L;  3GQB A;  1BCP F;  3FMC A;  4KTA A;  2ATW A;  4KV6 A;  1J6Q A;  2KA7 A;  4CHT B;  5C3E B;  3GTM B;  4PV1 C;  1KRS A;  2HCC A;  5BN3 A;  1F9Q A;  2QKI C;  1VCI A;  4A3I H;  1LTB D;  4GN4 B;  1VQ6 A;  2E8G A;  4LMQ D;  2L1B A;  2Y0S B;  4N9T A;  1XJV A;  4GZY C;  3QOL A;  3W1B A;  3OOC A;  1V43 A;  2L5T A;  5CV7 A;  3AFQ A;  4H02 A;  2UXB L;  5C4Z A;  2KHI A;  1GXD C;  1STB A;  3K8A A;  1XYI A;  1I3Q B;  4LFB L;  3MEH A;  1LT5 D;  4IUV A;  1SMY C;  4DK6 C;  2VXW A;  5FKA C;  1AEX A;  3S1M B;  4HJ8 A;  1X9N A;  2VUM G;  2RDF A;  1BCP D;  2B39 A;  2WV6 D;  4AYB B;  4A3E B;  1VF7 A;  4Y7N B;  1SYB A;  4C3J B;  3ER0 A;  1PRT B;  1SJH D;  4ZK9 B;  4DK0 A;  1GVP A;  1XPU A;  1Z47 A;  4BY1 H;  4FXD A;  2EIF A;  3P7J A;  4ABN A;  1FGB D;  4ZUI A;  3M4O B;  2F4I A;  2Z6K C;  5KNB A;  3I4N G;  3I4M H;  2EYP A;  4TQU S;  4YY3 Q;  3BZD B;  3W5O A;  4HJ5 A;  5BR8 Q;  1YIJ A;  3ERQ A;  1QUQ B;  3H6M A;  4O42 A;  1EY6 A;  2EQS A;  3VR5 A;  3FKI G;  4ZQ3 A;  5GAH C;  1C4Q A;  3STB C;  1SJE D;  3HKZ E;  3SE0 A;  2K1B A;  3KLR A;  3M9B A;  3OIP A;  2HUG A;  2E76 C;  1N34 L;  4JI5 Q;  1QE6 A;  2Q8I B;  2AWO A;  4V0B A;  3H94 A;  1I6V C;  3T53 B;  1LAB A;  5LMN L;  4EGV A;  1G6Z A;  1LLR D;  4JVZ A;  5CR3 A;  2MO1 A;  2Z4I A;  4C56 C;  3HOY H;  4XQQ A;  1HTP A;  1LO5 D;  1X3Q A;  2LKV A;  3NE5 B;  4GNX B;  1EQQ A;  5CV6 A;  4G57 A;  5CV9 A;  1L0Y B;  2M2L A;  2G5D A;  2NVY B;  4RH6 A;  3I7F A;  3TQY A;  4LF8 Q;  3GTP H;  3PUX A;  2N88 A;  1HQR D;  5C5L A;  3I8Z A;  1LT6 D;  3GD7 A;  1N33 L;  1TWA H;  3NPP A;  1HQM C;  1L0W A;  3D4W A;  5KEE A;  3MXP A;  1LTS D;  5AJ3 Q;  4I7A A;  1P16 A;  4C3I G;  4BBR G;  2QDB A;  5G3L D;  5C3E H;  3GTM H;  5ELN A;  3QIA A;  4I7Z C;  1S3O A;  3A8I E;  1E2Z A;  3TRZ A;  2KCT A;  2OXP A;  4WFN 3;  2WFW A;  2WKC A;  1IW7 D;  2ALY B;  1Q86 C;  1C48 A;  1O7Y A;  3UDX A;  1I3Q H;  1R4Q B;  1STE A;  2H5X A;  5KND A;  2B8F A;  2KVM A;  1YNX A;  4DAM A;  1I94 Q;  1QIL A;  2B2V C;  3F2C A;  4WJ3 M;  2QF7 A;  5DLQ E;  5IP7 H;  3CD6 A;  3S1M H;  2B63 G;  4UP9 A;  3ZYY X;  1YEZ A;  2E5L Q;  1PTO B;  4A3E H;  4Y7N H;  1ICF B;  4C3J H;  1AH9 A;  1VMC A;  5EGT A;  4KHP L;  1WCM B;  3OHX C;  2R92 G;  1VQC A;  3V05 A;  1JJ2 A;  4K2L A;  4QUC A;  1WYD A;  3A5Z B;  1CKM A;  4A3M G;  1UUP A;  3CF5 A;  3FPU B;  5EBC A;  1B3A A;  2IJ0 A;  2CH4 W;  3ULP A;  1NY4 A;  3HGB A;  3M4O H;  1HRJ A;  4YIJ A;  2M00 A;  5M3F G;  4ZKB B;  3K7A B;  1VMP A;  3DUZ A;  4K2K A;  2Z4H A;  3BJU A;  2Z6K A;  3JC6 6;  5ELC A;  2XTI A;  2N3S A;  5LMU Q;  1DYQ A;  2ZM6 Q;  3HP3 A;  1O7Z A;  1XPR A;  2IX3 A;  3I56 A;  4NB3 A;  5IOD A;  4BXX G;  1L2F A;  1V9P A;  1RHP A;  3QO2 A;  1EY8 A;  2DNC A;  4TVA B;  5C4X B;  3UDI A;  3TME A;  5CC4 A;  1MJE A;  2RHQ B;  2CFM A;  2JA8 G;  1JWU D;  3MC0 B;  1WTH A;  2PNR C;  1BDO A;  4LFA Q;  1O7L A;  4BBS B;  2JP1 A;  3AFP A;  1YNJ D;  4OWX B;  2VQF L;  1N36 L;  5IIF A;  3S2H B;  2LSS A;  4B3M Q;  4HIK A;  5IYD H;  3KDF B;  3SK5 A;  2LS0 1;  4KMU C;  1KDA A;  4MZ9 A;  3EJI A;  2R93 G;  1HFG A;  1EWH A;  3GDE A;  1VQM A;  1H95 A;  2MUY A;  2NVY H;  2A5H A;  4LF6 L;  2UXC Q;  3FEW X;  4GS3 A;  5GAG C;  5NUC A;  4ALP A;  2BH2 A;  1QWY A;  2H1E A;  1VQE A;  3EA6 A;  2BH8 A;  3G6J B;  2JN4 A;  2WAQ B;  4A3F B;  5IE8 A;  1ASZ A;  1XXG A;  1EY9 A;  1PRT D;  4X65 Q;  1KDB A;  4JOI C;  2YTX A;  1CHP D;  3UE1 A;  2PMZ E;  1DOK A;  1OXV A;  1AW7 A;  1VF5 C;  3G48 A;  4FXG C;  5FLX E;  1NMF A;  1HJP A;  1Y1V B;  5I6W A;  4A3I G;  1Z6H A;  4FO2 A;  3S14 B;  5F2D A;  4DV7 Q;  1GOZ A;  4R8I A;  2XNA C;  3LWU A;  3K0Y A;  2YV5 A;  1QB5 D;  3CW2 C;  3Q22 A;  1IBK Q;  1EU3 A;  3CHB D;  5LL6 X;  4DV2 Q;  1F2M A;  5CYU A;  1WTX A;  1K8G A;  2B2V A;  1PTO H;  1U4P A;  3QG1 A;  5ELD A;  4CJ0 B;  4R4Q A;  2CW0 D;  1HH2 P;  5A35 A;  1HR0 Q;  4BWG B;  2YU9 B;  1WCM H;  1DCZ A;  3EVQ A;  1G8Z D;  1A6X A;  2GVB A;  4FXK C;  4YCV A;  1XMO Q;  1TS3 A;  2CVR A;  4B3S L;  4IFD J;  1B4O A;  4DR6 Q;  2BE5 D;  2JA5 H;  4BY1 G;  1B7Y B;  5GQO A;  5FOB B;  2VS1 A;  2OCE A;  3KF8 A;  3J80 L;  3HKZ B;  3K7A H;  2DJF C;  4JBM A;  2OT2 A;  3A0J A;  3I4M G;  3C3L A;  5E4X A;  1S5D D;  2IPK D;  2A68 C;  4K8J A;  3GTJ B;  5M5X H;  4MTN A;  2EJM A;  2HHH Q;  1PFS A;  1V1P A;  5CMD A;  4JI0 L;  1Y69 U;  1N9W A;  4GKK Q;  3P1H A;  1K8M A;  2DGY A;  1EYD A;  2LMC B;  2BA0 A;  4JI4 Q;  5C4X H;  4ILW A;  4RKL A;  4X66 L;  2IW3 A;  1II3 A;  1VQN A;  1ONL A;  3ULL A;  3MFG A;  3AQQ A;  1VQD A;  2R6G A;  3NWT A;  4WOR A;  4BBS H;  1EIF A;  2KJX A;  1PH6 A;  3S2H H;  2WB1 B;  1PHJ A;  3BU2 A;  4HR7 B;  1F2Y A;  4B3T Q;  2K03 A;  1VS0 A;  2K4K A;  3HOY G;  4A3C H;  1OTC A;  5M3M H;  4A3D G;  3L7Z C;  4B3R L;  4K5X A;  4IJH A;  2HDL A;  5E3F A;  3J81 c;  3CCU A;  1IBM L;  1D5Z C;  3G6E A;  2F0P A;  4GKJ L;  4JCV E;  2Z1C A;  4A3F H;  1H9M A;  1RF2 D;  1N32 L;  4LF7 L;  3DEO A;  2EYH A;  3T4A C;  4CJ1 B;  5IT9 L;  1VQ7 A;  5CGK A;  5ELE A;  1R4P B;  4H0L C;  1Y1V H;  4KKT A;  1H9S B;  4ME3 A;  1PFB A;  3L0O A;  4JOI A;  2I0Q A;  3S14 H;  5DAU A;  1EUJ A;  4JI7 Q;  1PH8 A;  2H4O A;  4NXN L;  1STG A;  4OHJ A;  5J3B A;  2RSN A;  2X69 A;  2PQA A;  2ZJR A;  3SXH A;  1K73 C;  3CPF A;  1A2T A;  5D65 A;  5IP7 G;  1N8R C;  1E22 A;  1HCZ A;  2MJ8 A;  2M9V A;  1B1Z A;  1SNO A;  4JBJ A;  4L63 B;  3PF4 A;  2PCF B;  4AYB G;  3U50 C;  2YU9 H;  2EYO A;  5GAE C;  1D1K A;  5C4J B;  1E3P A;  3S15 B;  3HOX B;  2L11 A;  5C0X J;  4DV1 Q;  1JE4 A;  1U4L A;  2K6A A;  4P71 A;  5JJZ A;  3J7Y W;  1K3R A;  3R8B A;  1HNX Q;  2QGQ A;  1WTQ A;  4DAY B;  4P74 A;  3ND9 A;  5IGG A;  3GTJ H;  1TU2 B;  4PMC A;  5JPN C;  4RGM A;  4QB4 A;  4KKS A;  1U4M A;  1XWE A;  2PZW A;  4RKB A;  2O5J C;  2EDG A;  3KYH C;  4CKC A;  4IPG A;  4POG A;  1QJO A;  3H3V C;  3BZC A;  2Z9H A;  5KYL A;  1Y1W B;  3M3Y B;  4A3G B;  3AYH B;  3K81 C;  2FMM A;  2KOL A;  2IX1 A;  1BCP B;  4DN4 M;  2F3I A;  1HNZ L;  1V1Q A;  4X3S A;  3VYT A;  1HUN A;  1L1O C;  2OEO A;  1YZ6 A;  5FK9 C;  1Q82 C;  3PIP 3;  4A3B B;  4DV0 L;  4KY5 A;  4LF5 L;  1SE4 A;  4ZUJ A;  2N8N A;  1Z9F A;  4DV6 L;  4C3H B;  1IHZ A;  3KK7 A;  3SK4 A;  1K0R A;  1C0A A;  5GAD C;  3I4O A;  1JQY D;  4HCE A;  2RDG A;  2DJG C;  5IOC A;  2MO0 A;  2SDF A;  2I5L X;  3PV0 A;  2EYF A;  4GLA C;  1SLJ A;  4B08 A;  1FJG Q;  1JOK A;  5EBD A;  3PO2 G;  2VB2 X;  4IOA A;  3EIV A;  3U4Z A;  1NSN S;  5BN5 A;  3NP8 A;  4NXM L;  2AMC B;  1RKN A;  3A55 A;  4CDF C;  1SEB D;  4MNO A;  1XNQ Q;  2IY5 B;  1I4P A;  1AFP A;  3MXN A;  4B9X A;  3HOZ B;  2K32 A;  4IUQ A;  1S5F D;  2IX0 A;  2E2J B;  2NYZ D;  4C1N I;  3NXW A;  5M5Y B;  4OO1 H;  4LUO A;  3D6C A;  1MI2 A;  5ELF A;  3UE0 A;  1I6H B;  1GUG A;  3A56 A;  1MKH A;  4OX9 Q;  2QIL A;  3PUV A;  2PW7 A;  1CM9 A;  1XMQ L;  3IFT A;  1YNN D;  2IHF A;  2ZXP A;  3KLS A;  1EY7 A;  3PGZ A;  4N8X 1;  3QJY A;  1F9S A;  1SYD A;  2FHT A;  1WTV A;  3VA7 A;  5C4J H;  1WCM G;  1GUW A;  4YCW A;  3S15 H;  3HOX H;  2UXD L;  2K05 A;  1NBW A;  3CAM A;  3VYU A;  2JA5 G;  3CQZ B;  1A3T A;  2I07 B;  5COR A;  3DEP A;  1PH2 A;  1ILQ A;  4DUZ L;  5KGU A;  2HIX A;  1J5E Q;  3R3O A;  2YTY A;  5KIX A;  4RGO S;  1G29 1;  3I2Z A;  1OXU A;  1HA6 A;  2EY2 A;  1B50 A;  1NNX A;  1CZG A;  4DR3 Q;  5K36 H;  1ZKO A;  2OQK A;  3NBH B;  3NHH A;  3HOU G;  4FF4 A;  5IP9 G;  2WAC A;  3H91 A;  2CHB D;  4CKB A;  1BVS A;  5JEA H;  3D31 A;  3KUP A;  4LFC Q;  4PQX A;  1Y1W H;  3M3Y H;  4A3G H;  2A69 D;  4HMJ A;  1D8L A;  2RBM A;  1EEF D;  5C4X G;  2EVB A;  4QJF A;  4R9W A;  1XTC D;  1GO3 E;  2N78 A;  4G7O C;  5CV8 A;  3OIQ A;  3K58 A;  1FL0 A;  3PIO A;  4HCS A;  4XXE A;  2E2D C;  1GHK A;  4A3B H;  2AUK A;  2HT1 A;  3CME A;  1BOS A;  1GUO A;  1MSG A;  4K0K Q;  1L1O A;  4C3H H;  1W6K A;  4JI2 L;  2L0C A;  4TSS A;  1EYC A;  5DEH A;  2F03 A;  5IWA L;  4A3C G;  1A2U A;  5M3M G;  1K8A C;  4Q5V A;  2D0O A;  1W3S A;  1VDZ A;  3Q23 A;  2A6E D;  4ZCK A;  1E1O A;  3AB9 A;  4KY7 A;  4R4O A;  1HNW L;  4JYA L;  1MJC A;  3OW2 A;  3HFZ B;  4P72 A;  1FNV A;  1SN8 A;  4OO1 I;  4IN3 A;  1PH5 A;  4ZYS A;  2WAQ G;  2Z0S A;  2B29 A;  4A3F G;  5KYI A;  4GOP C;  1YI2 A;  2CWA A;  3TDQ A;  1TWH B;  3F2D A;  4FYD A;  5IYB H;  3EBE A;  3J81 i;  3HOZ H;  2L12 A;  2E2J H;  4PZ8 A;  4DUY L;  1NAP A;  3TZU A;  2F0I A;  5LHY 1;  3J80 E;  1UAP A;  1CSQ A;  1K83 B;  2IL8 A;  1PZJ D;  3MFY A;  4C2M B;  4DV5 L;  1I6H H;  2BA1 A;  1BR9 A;  2XGT A;  4QGU A;  1FGU A;  4NDX A;  1IZ6 A;  4NKL A;  2F4V L;  4FVM A;  1OXS C;  5ELO A;  1A3V A;  3RN2 A;  4EQO A;  1HXY D;  1EYG A;  3J81 j;  1Y14 B;  3G7L A;  3K59 A;  1UE1 A;  1XNR L;  4DR7 Q;  1CI3 M;  3ULJ A;  2F3W A;  3MXU A;  4R1J A;  1DXM A;  1A15 A;  1CT1 D;  3TP7 A;  4YWM A;  2K28 A;  4DR1 Q;  2RSO A;  4V19 0;  5CV5 A;  3CQZ H;  4FF1 A;  2QCP X;  1BBX C;  1RIP A;  4YHH Q;  1RL2 A;  5JAV A;  4DV4 L;  4WRD A;  3PQI A;  3T1Y Q;  1KLG D;  1EIH A;  4X62 L;  4BY7 B;  3D4D A;  2ZTD A;  2GA4 B;  3HKS A;  2OTJ A;  4IOC A;  2DY8 A;  4DR2 Q;  2RDH A;  1M1K C;  1CA6 A;  2UXB Q;  1EL0 A;  4DF7 A;  4IJL A;  1IXR A;  3A8K E;  1C8C A;  3TS2 A;  1B9M A;  4LFB Q;  3FRP B;  1ZEQ X;  2EZV A;  5HGQ A;  1PV4 A;  1KRT A;  4ZKC B;  2TSS A;  3PCO B;  4A3K B;  1WTR A;  5IT9 E;  3T51 B;  3VR2 A;  1X3G A;  3MEF A;  2CKZ B;  1GD7 A;  1SYC A;  2WB1 G;  1I50 B;  3E0J A;  1SYE A;  3TP8 A;  4WJ4 A;  4UP8 A;  5AFW A;  4AH6 A;  4A93 G;  1Z7T A;  2JEA I;  1E7Z A;  2VQE L;  1YVC A;  5AJ3 L;  1W6J A;  5EPL A;  3V96 A;  4DPG A;  2DNE A;  3T13 A;  1XPO A;  2NTS A;  3AMU A;  3KBX A;  4A76 A;  3HOV B;  4QY7 A;  3U9O A;  1VQI A;  2EXD A;  2XSC A;  2K50 A;  5H1S E;  1EY4 A;  5DM7 3;  1B3Q A;  4A4I A;  4GOP A;  1KAW A;  4XDX A;  1N34 Q;  3BVG A;  3MWY W;  1K83 H;  3ZJY C;  4C2M H;  4M8A A;  4OO1 G;  2LY7 A;  4XTC S;  1NR4 A;  2E5L L;  3TRE A;  5LMN Q;  4DK1 A;  3PIO 3;  2SNS A;  1SXT A;  3CP0 A;  3K5O A;  3O13 A;  5COY A;  1KDC A;  2B2Y C;  5CBA E;  1JT8 A;  4QIW E;  2KBN A;  3L2P A;  4KLK A;  4OXP A;  4L5T A;  5E7N A;  5FJ8 H;  2EYJ A;  1VQ4 A;  4LW1 A;  2XN9 C;  3MTS A;  4KN7 C;  3HOX G;  4FNF A;  2J0T D;  4GN3 B;  4RA8 A;  3TBI B;  5IY0 A;  1Q90 A;  3UI2 A;  2ASB A;  1J9O A;  4HTH A;  4X64 Q;  4BY7 H;  4JG2 A;  5EPK A;  1CKN A;  2L55 A;  3K5L A;  5IGD A;  1DOM A;  4DR4 L;  4EX5 A;  1DJR D;  5K36 G;  5EAY A;  1TXY A;  1VQ9 A;  4DV3 L;  2JA6 G;  4CDE C;  5JEA G;  1Y1W G;  2K5Q A;  4LK1 C;  4A3G G;  1LTG D;  2B8G A;  3MZ5 A;  3SVM A;  1TWF B;  4DNT B;  3PMF A;  1AE3 A;  1L0X B;  1YBY A;  5FLM G;  1LTL A;  3UDG A;  4A3K H;  4JV5 L;  4JW0 A;  2ZTE A;  3SR1 A;  1DGS A;  3GP7 A;  4X3K A;  3URY A;  2MHV A;  1D1I A;  1CSP A;  3OMC A;  2JJQ A;  5J22 A;  3VR6 A;  4KHP Q;  2KHJ A;  1SMX A;  4J1M A;  1B44 D;  3EFX D;  3SDZ A;  4XQN A;  3JAM i;  1PFN A;  2A68 D;  4JI1 L;  4CGY B;  1E24 A;  3DWP A;  4ZAI A;  3K7U C;  2I5M X;  5JJL A;  3W2D A;  1NTG A;  2BDN A;  2R3Z A;  2OWO A;  3BYT B;  5K5P A;  3IL8 A;  5GRO A;  3OW7 A;  2L4N A;  1EIG A;  3RN5 A;  2ZTC A;  5M5W B;  4DXG A;  3HOV H;  4L5R C;  2NTT A;  2F0Q A;  2JXM B;  3NQT A;  3B6Y A;  4A3L G;  4J15 A;  4NMZ A;  1PZI D;  3HZX A;  3WOE A;  4G4K A;  2MGS A;  1UNS A;  2C35 B;  3PSI A;  2Q2T A;  1STH A;  4KKU A;  4DV7 L;  2D9U A;  1JWS D;  4H13 C;  3UDF A;  3CC2 A;  2F0L A;  3HOZ G;  1W2B A;  5I2Y A;  3D0F A;  4OEL B;  1JWM D;  1O78 A;  3FPP A;  4F7X A;  2F0M A;  1K28 A;  1IW7 C;  1S5E D;  2R7Z B;  1ET6 A;  1RJT A;  2XVS A;  2VQF Q;  2AQ1 B;  1N36 Q;  3W1G A;  1X55 A;  3ERS X;  4JBK A;  4CDC C;  1FNU A;  1PH9 A;  1ZYR D;  2ICI A;  2ZT9 C;  2CWP A;  3LX0 A;  1Q12 A;  3F1Z A;  2B2Y A;  3E5S A;  3BYY B;  4P75 A;  2B2W C;  4LF6 Q;  1H9R A;  2PZT A;  3G71 A;  1ROD A;  4KJO A;  3KLS X;  2BDO A;  1NJI C;  3RR5 A;  3GTG B;  3TP5 A;  4KHV A;  4RGT A;  2F52 A;  3A8J E;  4JI3 L;  3PF5 A;  2HHH L;  3KF6 A;  2A73 B;  3TSS A;  3H15 A;  2AWN A;  4N9P A;  2NZ1 D;  3BDO A;  3OWF A;  4JI8 L;  1WJJ A;  2WP8 J;  4JI4 L;  1WI5 A;  1KAB A;  2DUD A;  2UUC L;  1QOH A;  1KQS A;  3P75 A;  4HSP A;  3W3A A;  1QVF A;  4RGN A;  1TWF H;  3S17 B;  2JK8 A;  4M1U B;  3H0G B;  4R8N A;  4UP7 A;  3OWE B;  4KD3 A;  4AQY L;  4KK7 A;  1E0B A;  3BVZ A;  3I90 A;  4DAV A;  4ID6 A;  2CQO A;  2E2I B;  3RZO B;  2KUM A;  1T5E A;  1ENA A;  1LTI D;  1QCB D;  1UEA B;  2FFK B;  1LTR D;  4B3S Q;  3R93 A;  5JJI A;  4TKO B;  3I4N B;  1FR3 A;  2HDM A;  3AU7 A;  2CQA A;  3M7N A;  2B3G A;  4OIJ A;  4LF9 L;  2VW9 A;  1X54 A;  1RCV D;  3K5N A;  3FKI B;  5M5W H;  1TT2 A;  1JIC A;  1SNC A;  1V1O A;  1ESF A;  4JI0 Q;  3A5U A;  3CCS A;  2F0S A;  2K52 A;  1G51 A;  3SHL A;  4BA2 I;  1KD1 C;  1D5M C;  3S2D B;  3TN2 A;  1IBL Q;  3FHW A;  4X6A H;  1GUN A;  2ES2 A;  2UUB L;  4JI7 L;  1PRT C;  4X66 Q;  3WOF A;  4CKE A;  2RF4 A;  3HOW B;  1TR5 A;  4HAE A;  1CA5 A;  5IYC H;  5C3E G;  1PYB A;  4ME5 A;  5HUR A;  4RFB A;  2F0G A;  4KY6 A;  2R7Z H;  5HY6 A;  4Q0F A;  2Y0S G;  2I46 A;  3I72 A;  1F9P A;  2E74 C;  4J8Q A;  1I4X A;  1BF4 A;  1VQF A;  1U5K A;  5T1I A;  3I73 A;  3NQI A;  2F0K A;  5C5M A;  2D5D A;  4CBV A;  4JI6 Q;  3PO3 B;  4B3R Q;  1VQ8 A;  2CW0 C;  3K80 C;  1EOV A;  5FJ8 G;  3BDC A;  1IBM Q;  4A3E G;  1HUM A;  4IUN A;  4GKJ Q;  1PVO A;  4C3J G;  3WDN A;  5FO8 B;  3GTG H;  2B2W A;  1N32 Q;  2BE5 C;  2JQO A;  4L5S A;  4LWC A;  4BY7 G;  3QWN A;  3CCM A;  2FJ2 A;  1PH1 A;  1XTD A;  3U9S A;  4EVO A;  4DFA A;  1SFO B;  3DWA A;  2UU9 L;  4GNX C;  4DNR B;  4A75 A;  1YJ9 A;  1ENF A;  1NCV A;  2EYM A;  3QB3 A;  2CCZ A;  4HJA A;  1TS5 A;  4OL7 A;  4NXN Q;  1WD0 A;  3S17 H;  3EQL C;  3H0G H;  3FP9 A;  5IGC A;  2K33 A;  1K9M C;  2XWJ B;  5C4H A;  4RCN A;  1G6P A;  2D62 A;  1M8A A;  1SBB B;  1G2S A;  2HIV A;  1D2B A;  4KD4 A;  4DGZ A;  2F0D A;  1PH3 A;  1KLU D;  2F0H A;  4OEM B;  2E2I H;  3RZO H;  4IAL A;  2NZH A;  3L9A X;  2D0P A;  3OTO L;  1TY2 A;  4JK1 C;  4AYB E;  3NEM A;  1GUS A;  2C9O A;  5D3I B;  1I4G A;  3C2P A;  5IYD G;  1WTP A;  2L15 A;  1SRO A;  5C44 B;  2F0U A;  4H44 C;  4HED A;  4KHZ A;  4OON A;  4JBW A;  3WWV A;  1I4R A;  1CHQ D;  3FKI H;  1XNQ L;  2PMZ B;  1PTO C;  5E4W C;  1M4V A;  2EJG C;  3S2D H;  1EQV A;  3SK8 A;  5A2Q L;  4MIU A;  2B2U C;  3L3O C;  3HOW H;  1LAC A;  1NUC A;  4IQZ A;  3RD4 A;  1HA5 A;  1IYU A;  3DM1 A;  3KF8 B;  4L6T B;  2KCN A;  3X3N A;  2UUA L;  1SRU A;  1CUK A;  3A74 A;  1HNZ Q;  2MFI A;  2SEB D;  2PI2 A;  1CZW A;  4HJ9 A;  1YJW A;  2Z6B A;  1KIX A;  1XX8 A;  4DV0 Q;  4LF5 Q;  1EFI D;  1V1P B;  5DNF A;  2A6H C;  1AP0 A;  4DU9 A;  4FF3 A;  3GV6 A;  3PO3 H;  2ZJP A;  2PW5 A;  2RHS B;  1DD2 A;  3MVV A;  4LF4 L;  4K6L A;  1QUQ A;  3S1N B;  2F1M A;  1C7Y A;  2VL6 A;  3KJO A;  2JSO A;  3HRZ C;  1S72 A;  2F0J A;  4EQN A;  1Q1B A;  1D5X C;  1QNK A;  3NSW A;  3S1R B;  1SFO H;  5ELB A;  4KJN A;  3HEJ A;  3J7A V;  4GN5 A;  3BS1 A;  1KXL A;  3OPO A;  1H9K A;  2AHO B;  3ERO A;  1AZQ A;  5LL6 S;  3D6W A;  4L5Q A;  1PH4 A;  1DOL A;  3K6O A;  1VQK A;  1SMY D;  4GNX A;  3T1H Q;  1LTA D;  1NE3 A;  4HJ7 A;  1LUZ A;  4K5V A;  4YCU A;  1XMQ Q;  3EN2 A;  1EZ6 A;  1KAA A;  4UAI A;  1BBW A;  4NP5 A;  4RWS C;  3LWE A;  2A8V A;  2ENB A;  1F77 A;  4P73 A;  3JAM c;  1SDF A;  2KEN A;  2V4D A;  1LT4 D;  3CRL C;  3K57 A;  2JA9 A;  1UEB A;  4BBS G;  2UXD Q;  2E2H B;  4PMB A;  1PMR A;  1SR3 A;  4DUZ Q;  2PQA B;  4DR5 L;  1MSH A;  5BN4 A;  5C44 H;  1LV9 A;  1I4H A;  4RG1 A;  1EY0 A;  3KFU A;  4QCL A;  1B70 B;  4XYO A;  1LT3 D;  3D8G A;  1HZ9 A;  1CQV A;  1UE5 A;  3J80 c;  3STB D;  3DHQ A;  3S1Q B;  1JR0 D;  4MTK A;  1RTO A;  1IL2 A;  3NWS A;  3GTQ B;  1EQR A;  1EYA A;  1FD7 D;  1IKM A;  3VYR A;  1E1T A;  1SE8 A;  4F8M A;  2B2U A;  1D7Q A;  3NBI A;  4NPS A;  1EOT A;  1KTK A;  5IGB A;  2F0N A;  4O0A A;  3LGJ A;  2R7Z G;  1Y1V G;  1X6O A;  4K8I A;  1HTL D;  4A3J B;  3X3M A;  1G2T A;  3DLL A;  1S5B D;  1NMG A;  5EKL A;  4IUU A;  5M5Y H;  1X56 A;  4U68 A;  4A3D B;  2N55 A;  2RKS A;  4JI2 Q;  3RNU A;  5IWA Q;  1F2L A;  4UHV A;  2Q2U A;  1WD1 A;  1RD9 D;  1Y8O B;  2F0E A;  2JA7 B;  3ND8 A;  1HNW Q;  1LYL A;  1WTO A;  3S1N H;  5M9O A;  3SEB A;  4JYA Q;  2YTV A;  4BS9 A;  3NTK A;  1MBY A;  4IUT A;  4OWW B;  1WVL A;  3I3C A;  1AN8 A;  4QMG A;  2RCF A;  3S1R H;  4QL5 A;  1STN A;  1Q81 C;  2HQE A;  5JEA J;  4R4T A;  2WAQ E;  2XIW A;  5T1G A;  4DR2 L;  1B9N A;  3BZK A;  4YY3 L;  3E0E A;  3CCJ A;  3HKZ G;  3OMG A;  5BR8 L;  4DUY Q;  3BVM A;  2NN6 H;  2XWB B;  3KDF A;  3OSO A;  5IT9 c;  4DV5 Q;  3HS0 C;  3H0G G;  2IT1 A;  5EPJ A;  4BA1 I;  2F4V Q;  1JE5 A;  2A69 C;  4LJZ C;  4QF4 A;  3CPW A;  3RLF A;  4JI5 L;  2KEE A;  1S5C D;  3MXN B;  4IUP A;  2F3V A;  3CKI B;  2XRS D;  1XNR Q;  3VA5 A;  1Q46 A;  3S24 A;  2DN8 A;  3CCL A;  3J81 L;  1KL9 A;  5I9O A;  2E2H H;  1KNA A;  2WII B;  2KQ3 A;  2LXJ A;  3T56 B;  1JB7 A;  1F2Z A;  1TII D;  3CCR A;  4DV4 Q;  1IYJ B;  3RMH A;  3E3X A;  1X3P A;  2F0W A;  3QR8 A;  1V8Q A;  1YIT A;  4X62 Q;  4LF8 L;  2A6E C;  4RMF A;  3IKJ A;  3NK9 A;  2B2T C;  4QQB X;  1SE3 A;  2NVQ B;  2WIN B;  5KRU A;  3S1Q H;  5J1Z A;  3GTQ H;  4Y52 H;  2G9D A;  4CJ2 C;  3HOW G;  1YJN A;  1Q1E A;  1BNZ A;  3TP6 A;  3FVQ A;  1TWH H;  2HCI A;  5G3L F;  4O2D A;  5CV4 A;  2WKD A;  4H7B A;  5C3W A;  3OYY A;  4OIK A;  4A3J H;  4J6H A;  4EQ5 A;  5EKK A;  1I94 L;  1S40 A;  4A3D H;  1VQL A;  4S3S A;  4YWL A;  5FO7 B;  1K3B C;  4HN7 A;  3IAY A;  5JVG 3;  2WB1 E;  4JPB W;  1YHA A;  5CBE E;  3PO3 G;  3VR4 A;  2JA7 H;  4JC0 A;  2VQE Q;  3PO2 B;  4G7H C;  3DWQ A;  1TY0 A;  2GVA A;  4QUF A;  1HHV A;  4IUR A;  2NN6 I;  2QDL A;  4X64 L;  1VQG A;  2P5Z X;  4C1N K;  1JOR A;  3TS0 A;  1BCP C;  2SNM A;  1HZA A;  3C46 A;  3U4V A;  1L1O B;  1BBU A;  1N33 Q;  3GV3 A;  4LAA A;  1MGS A;  1BQQ T;  1MD2 D;  2Q2I A;  1LTT D;  5LMU L;  4XT1 B;  2ZM6 L;  3KJP A;  1PYS B;  2EY1 A;  3CRK C;  2Q8T A;  2O4X A;  1CFM A;  3C1E A;  5J39 A;  2K7V A;  1TQO A;  1ML0 D;  1Q3L A;  2R7D A;  2R7F A;  4LFA L;  3A7A B;  3G4S A;  5A2Q E;  1U0L A;  3M4Q A;  1EQT A;  5C6A A;  5IGE A;  1NR2 A;  2JA5 B;  5JJK A;  4B3M L;  1OO9 B;  2JEB I;  3ONA B;  1I50 H;  4A3B G;  2PYK A;  3I55 A;  2JYO A;  2EYL A;  1K8O A;  4CDD C;  1KHI A;  4C3H G;  1H9S A;  1LM0 A;  3Q8D A;  4DA2 A;  5LMN W;  5M5X B;  1SSO A;  5C44 G;  4IFD H;  3HOU B;  3F2B A;  3GTK B;  1YHQ A;  2UXC L;  1Q7Y C;  4DR4 Q;  1GJX A;  4ULL A;  2NVQ H;  1EWC A;  1Y8N B;  4ZLT F;  2F0F A;  1SNQ A;  3NEN A;  4DV3 Q;  5FLX c;  2B2T A;  2K01 A;  4X65 L;  2HQL A;  2ZXO A;  3IRB A;  5D3D A;  2FIN B;  4R4C A;  3E9H A;  4L8J A;  1PRT F;  5ISR A;  2F0V A;  2K04 A;  2IWH A;  5IYB G;  2NUC A;  4JV5 Q;  2Z8L A;  3J80 i;  1BO0 A;  3K5M A;  1QG7 A;  1SNP A;  1IBK L;  2SOB A;  1JJG A;  5M3M B;  3CC7 A;  1Q8K A;  3Q6S A;  4DV2 L;  4DAY A;  3CMA A;  4MN3 A;  1PDQ A;  4R4I A;  3RLO A;  1E2W A;  3DMU A;  4JI1 Q;  4HSV A;  5FO9 B;  2K5D A;  3KBG A;  3H3V H;  2J4X A;  3PO2 H;  1JC7 A;  1ESR A;  3MA2 B;  1HR0 L;  2EY6 A;  3A7L A;  1X65 A;  5TSS A;  2R61 A;  1XMO L;  2IHE A;  3SK6 A;  3J7A 5;  3KLW A;  4DR6 L;  5EJW A;  2RA4 A;  4AIM A;  4IPD A;  1QNU A;  3P20 A;  3CCE A;  2MP1 A;  1JB3 A;  3M7G A;  2PO4 A;  2RVL A;  1PXU A;  5I2X A;  2RCN A;  2DY7 A;  3DXJ C;  3JAM L;  3QOJ A;  3TZD A;  2NN6 G;  2VNU D;  2NB0 A;  4IPC A;  1MIU A;  5KNC A;  2NVX B;  4GKK L;  1JOO A;  3PIP A;  2K14 A;  2MQH A;  3PUZ A;  4HID A;  2K5H A;  3BG3 A;  2EJF C;  4PZ7 A;  2A1A A;  4EQP A;  4I65 A;  4IFD I;  1SE2 A;  4OGQ C;  2A74 C;  4GOP B;  2VUM B;  1OXT A;  1TWC B;  3M4P A;  1Q8I A;  1IYV A;  1S4Z A;  1P8L A;  4B3T L;  4FDB A;  4GLX A;  3GTO B;  4KN4 C;  5I4D A;  2AQ2 B;  1T5X D;  1YNJ C;  2HD3 A;  1ILP A;  1UE7 A;  4JI3 Q;  4RHS A;  2QA4 A;  5IP9 H;  3HOU H;  3GTK H;  5JPM C;  2N49 A;  1E2V A;  5C0X H;  3NTH A;  3ICE A;  1EY5 A;  4E6I A;  1VQA A;  4POF A;  4RHR A;  2ZXR A;  4JI8 Q;  3RZD B;  1IBL L;  4IZ8 A;  1JMC A;  3VDY A;  2Q8R E;  2UUC Q;  1ZXT A;  1CK1 A;  3D4R A;  1PTO F;  3RUZ A;  2F0T A;  1HR0 W;  2BCO A;  3H3V I;  4AQY Q;  1JOQ A;  1PA6 A;  1U9R A;  3GO5 A;  1CKN B;  3V2T A;  1U4R A;  5HGT A;  1TVX A;  1TWG B;  3HG9 A;  4A3J G;  1ASY A;  4O1N A;  1BKB A;  1I4Q A;  2L9H A;  3KOJ A;  4QIW B;  4A93 B;  4JI6 L;  2EPB A;  1EU4 A;  4XYQ A;  5JVH 3;  1SAP A;  4ODG A;  3D3R A;  1X3E A;  1ZYR C;  2JA7 G;  2X6L A;  1PTO D;  4N8F A;  3Q0A A;  1SYG A;  1EEI D;  3NBH A;  1I5F A;  4K5W A;  3GTL B;  3CU7 A;  4DKA C;  3T16 A;  2ID0 A;  1PFM A;  4LF9 Q;  2K75 A;  3CCQ A;  5EQ0 A;  4PG3 A;  2FMC A;  2ICE C;  2TMP A;  1B53 A;  4DV1 L;  4APV A;  3J7Z C;  1SND A;  1HNX L;  2KHS A;  4C3I B;  4BBR B;  4PNY A;  4PMW A;  5I6Y A;  3F8T A;  3J81 E; 
#chains in the Genus database with same CATH homology
 2UUB Q;  4LF6 L;  2UXC Q;  1NE3 A;  4HJ7 A;  4UP8 A;  4WJ4 A;  4LF7 Q;  1LUZ A;  4GS3 A;  4YCU A;  5GAG C;  2MNA A;  4ALP A;  1XMQ Q;  1JJC B;  1PH7 A;  1VQE A;  2BH8 A;  4AH6 A;  3EN2 A;  4A93 G;  1BBW A;  2NVX H;  5IE8 A;  1ASZ A;  2JEA I;  2A8V A;  1E7Z A;  2VQE L;  4P73 A;  3JAM c;  2KEN A;  1YVC A;  4X65 Q;  4JOI C;  2YTX A;  5AJ3 L;  3UE1 A;  2PMZ E;  1OXV A;  3G48 A;  1C9O A;  2JA9 A;  1NMF A;  1UEB A;  4DPG A;  1HJP A;  4BBS G;  2UXD Q;  4A3I G;  3PUY A;  1XPO A;  2Y0S E;  1QVG A;  1SR3 A;  4DV7 Q;  2VUM H;  4A76 A;  4DUZ Q;  5C0X I;  2PQA B;  2ZJQ A;  4DR5 L;  1TWC H;  2YV5 A;  4QY7 A;  1VQI A;  2EXD A;  3CW2 C;  5C44 H;  4RG1 A;  2K50 A;  5H1S E;  4A3K G;  3KFU A;  4GOP A;  4A4I A;  1IBK Q;  1B70 B;  4DNI A;  4GLV B;  4DV2 Q;  1KAW A;  1HZ9 A;  3GTO H;  1N34 Q;  1UE6 A;  1K8G A;  4KI0 A;  1UE5 A;  4R4Q A;  1K83 H;  3ZJY C;  1HH2 P;  4C2M H;  3STB D;  3J80 c;  4OO1 G;  1HR0 Q;  2V1C C;  4PZ6 A;  3U58 A;  4XTC S;  1WCM H;  4IFD G;  2E5L L;  3TRE A;  5LMN Q;  1IL2 A;  3I4N H;  1EQR A;  2GVB A;  4YCV A;  3CP0 A;  2GN5 A;  4DK3 C;  1XMO Q;  1FJG L;  3RZD H;  4B3S L;  1E1T A;  2PI2 E;  1SE8 A;  4YWK A;  4DR6 Q;  2UU9 Q;  4IFD J;  1VQH A;  2JA5 H;  1D7Q A;  4NPS A;  4A3D G;  1JT8 A;  4BY1 G;  4QIW E;  1B7Y B;  2KBN A;  5GQO A;  2VS1 A;  1VQB A;  4KLK A;  4OXP A;  3L2P A;  4L5T A;  4O0A A;  2OCE A;  3LGJ A;  2AKW B;  2R7Z G;  1Y1V G;  1X6O A;  5E7N A;  1KC8 C;  3K7A H;  5FJ8 H;  1A8V A;  3DLL A;  1VQ4 A;  3A0J A;  1NMG A;  5M5Y H;  4LW1 A;  4JBM A;  1QVC A;  3E9I A;  3I4M G;  1X56 A;  3HOV G;  3HOX G;  4JI2 Q;  3RNU A;  4LNQ A;  5M5X H;  4MTN A;  5IWA Q;  4GN3 B;  5IY0 A;  3KF6 B;  2HHH Q;  1PFS A;  4JI0 L;  2Q2U A;  4UY8 C;  1TWG H;  2ASB A;  3RLN A;  4X64 Q;  1N9W A;  1OXX K;  4GKK Q;  4BY7 H;  2DGY A;  1CKO A;  1HNW Q;  4IO9 A;  1VQ5 A;  1LYL A;  4JG2 A;  2BA0 A;  4OX9 L;  4JI4 Q;  1CKN A;  5C4X H;  3S1N H;  4A93 H;  4JYA Q;  3OTO Q;  2YTV A;  4X66 L;  4DR4 L;  4EX5 A;  1UWV A;  3CCV A;  1VQN A;  5K36 G;  1QZH A;  4OWW B;  3ULL A;  1EFW A;  3AEV A;  5EAY A;  3AQQ A;  1TXY A;  4DV3 L;  1VQ9 A;  2K5V A;  1VQD A;  2R6G A;  4LUZ A;  2JA6 G;  3GTL H;  4BBS H;  4DV6 Q;  5JEA G;  1EIF A;  2OTL A;  2VY3 A;  1Y1W G;  3S1R H;  4QL5 A;  1PH6 A;  3S2H H;  1Q81 C;  4IPH A;  1PHJ A;  4A3G G;  3BU2 A;  4R4T A;  5JEA J;  2WAQ E;  1M90 C;  4DR2 L;  3BZK A;  4YY3 L;  3M85 A;  4B3T Q;  3E0E A;  1AE3 A;  1YBY A;  1VS0 A;  3CCJ A;  2K4K A;  5FLM G;  1LTL A;  3HOY G;  3HKZ G;  1OTC A;  5BR8 L;  4A3C H;  4DUY Q;  3UDG A;  4A3K H;  4JV5 L;  1WOC A;  5M3M H;  2ZTE A;  1VQP A;  1O7I A;  1A62 A;  1DGS A;  3KDF A;  3NEL A;  4XIG S;  4BBR H;  3L7Z C;  4C3I H;  3PUW A;  5IT9 c;  4B3R L;  4DV5 Q;  1CSP A;  2JJQ A;  4KHP Q;  4IJH A;  3H0G G;  2IT1 A;  2KHJ A;  1SMX A;  4BA1 I;  3J81 c;  3CCU A;  1IBM L;  2NZO A;  2F4V Q;  4DR3 L;  4NXM Q;  4OWT B;  3G6E A;  1JE5 A;  4GKJ L;  3CPW A;  3CC4 A;  4UPA A;  3JAM i;  3RLF A;  2UUA Q;  4JCV E;  4JI5 L;  3T1H L;  4HIO A;  4A3F H;  4JI1 L;  3MXN B;  1N32 L;  4LF7 L;  1E24 A;  4LFC L;  3K7U C;  1XNR Q;  2I5M X;  5JJL A;  1Q46 A;  1NTG A;  3S24 A;  1VQ7 A;  2OWO A;  3CCL A;  1HZB A;  1KL9 A;  1Y1V H;  2OQ0 A;  2E2H H;  2VZA A;  2K5N A;  4ME3 A;  5GRO A;  3S16 H;  4JOI A;  1FVI A;  3L0O A;  2I0Q A;  2B63 H;  3S14 H;  2LXJ A;  3RN5 A;  2ZTC A;  1EUJ A;  1JB7 A;  4JI7 Q;  4L5R C;  4HIM A;  3CCR A;  4DV4 Q;  1PH8 A;  3HOV H;  3B6Y A;  4A3L G;  1IYJ B;  4J15 A;  2Q2T A;  4NXN L;  4LF4 Q;  3PSI A;  2FXQ A;  2C35 B;  5J3B A;  1YIT A;  4X62 Q;  4LF8 L;  4RMF A;  2R92 H;  4DV7 L;  3UDF A;  4K0K L;  2I5H A;  2PNH A;  3CC2 A;  2PQA A;  3HOZ G;  2ZJR A;  1K73 C;  1W2B A;  2KCM A;  3CPF A;  5IP7 G;  4QQB X;  3D0F A;  1N8R C;  1A63 A;  1E22 A;  2YYZ A;  2Q2H A;  3PF4 A;  4JBJ A;  4A3M H;  4AYB G;  3S1Q H;  3K0X A;  3U50 C;  2YU9 H;  5M3F H;  3GTQ H;  4Y52 H;  5GAE C;  4LUV A;  2VQF Q;  1N36 Q;  5C0X G;  2JA6 H;  3W1G A;  3HOW G;  1E3P A;  1X55 A;  3ERS X;  1Q1E A;  1YJN A;  4JBK A;  5C0X J;  4DV1 Q;  1TWH H;  1PH9 A;  4O2D A;  4P71 A;  2CWP A;  3OYY A;  1K3R A;  1Q12 A;  3F1Z A;  2QGQ A;  1HNX Q;  3SGI A;  1VQO A;  4A3J H;  5FLM H;  2LXK A;  4BXX H;  4DAY B;  4EQ5 A;  1X3F A;  4P74 A;  1I94 L;  1S40 A;  4P75 A;  4A3D H;  3TEH B;  1GKH A;  3GTJ H;  1VQL A;  3G71 A;  4LF6 Q;  4YWL A;  2JA8 H;  2A19 A;  2R93 H;  1NJI C;  2WB1 E;  3RR5 A;  1YHA A;  3KYH C;  3DM3 A;  3PO3 G;  4IPG A;  4POG A;  2JA7 H;  2F52 A;  4JC0 A;  2VQE Q;  4JI3 L;  3BZC A;  3PF5 A;  1QZG A;  5IYC G;  2HHH L;  3KF6 A;  2GVA A;  3H15 A;  3AYH B;  2JE6 I;  2AWN A;  2NN6 I;  1T9H A;  4X64 L;  1VQG A;  3K81 C;  1R9T H;  4JI8 L;  1EWI A;  1WJJ A;  2WP8 J;  1EIY B;  3TS0 A;  4JI4 L;  2IX1 A;  1AE2 A;  1B8A A;  1WI5 A;  2F3I A;  1HZA A;  1V1Q A;  2DUD A;  3CXC A;  2QEX A;  1HNZ L;  3U4V A;  2UUC L;  1L1O B;  1L1O C;  1KQS A;  1BBU A;  1YZ6 A;  1J5E L;  4DR5 Q;  1N33 Q;  2NVT H;  4DR7 L;  1Q82 C;  1A0I A;  1WFQ A;  4DV0 L;  4LF5 L;  1QVF A;  1TWF H;  2JK8 A;  2N8N A;  1Z9F A;  4UP7 A;  4DV6 L;  4DR1 L;  4A3L H;  2Q2I A;  4AQY L;  5LMU L;  1HZC A;  1GM5 A;  2ZM6 L;  1K0R A;  1C0A A;  4YHH L;  5GAD C;  3I4O A;  1YHB A;  1VQJ A;  3T1Y L;  3KJP A;  1PYS B;  2MO0 A;  2ATW A;  2CQO A;  1J6Q A;  2I5L X;  1KRS A;  3PV0 A;  4GLA C;  1SLJ A;  1FJG Q;  1VCI A;  4B3S Q;  4A3I H;  4GN4 B;  1VQ6 A;  3EIV A;  2E8G A;  3U4Z A;  3PO2 G;  4IOA A;  5JJI A;  1XJV A;  2R7D A;  3W1B A;  2R7F A;  4LFA L;  4NXM L;  1V43 A;  3G4S A;  3AFQ A;  2AMC B;  4H02 A;  2UXB L;  1U0L A;  3M7N A;  2KHI A;  3K8A A;  2B3G A;  3M4Q A;  4MNO A;  1XNQ Q;  2IY5 B;  5JJK A;  4LF9 L;  2VW9 A;  4LFB L;  4B3M L;  1X54 A;  4DK6 C;  2JEB I;  1I50 H;  4A3B G;  5M5W H;  3I55 A;  2IX0 A;  4HJ8 A;  1X9N A;  2VUM G;  4JI0 Q;  3A5U A;  3CCS A;  1KHI A;  2K52 A;  1G51 A;  1LM0 A;  3Q8D A;  4LUO A;  1KD1 C;  4BA2 I;  5LMN W;  3UE0 A;  5C44 G;  1IBL Q;  3FHW A;  4X6A H;  1MKH A;  2ES2 A;  3ER0 A;  3F2B A;  3PUV A;  4OX9 Q;  1YHQ A;  2UUB L;  4JI7 L;  2UXC L;  1Q7Y C;  4X66 Q;  4DR4 Q;  2RF4 A;  1XMQ L;  2IHF A;  2NVQ H;  5IYC H;  5C3E G;  1GVP A;  1PYB A;  1XPU A;  1Z47 A;  3PGZ A;  4BY1 H;  2EIF A;  3NEN A;  4DV3 Q;  5FLX c;  2R7Z H;  5HY6 A;  4X65 L;  2HQL A;  2Y0S G;  5C4J H;  1WCM G;  2Z6K C;  3I4N G;  3I4M H;  3IRB A;  4YCW A;  3S15 H;  4TQU S;  3HOX H;  4YY3 Q;  2UXD L;  4R4C A;  1NBW A;  3W5O A;  3CAM A;  3E9H A;  4HJ5 A;  2JA5 G;  5BR8 Q;  1VQF A;  1U5K A;  1YIJ A;  4JV5 Q;  5IYB G;  1PH2 A;  4DUZ L;  1QUQ B;  2HIX A;  1J5E Q;  2YTY A;  3J80 i;  4JI6 Q;  4B3R Q;  2EQS A;  1G29 1;  3FKI G;  3I2Z A;  3K80 C;  1VQ8 A;  1OXU A;  1EOV A;  3STB C;  5FJ8 G;  3HKZ E;  5GAH C;  1IBK L;  1JJG A;  3CC7 A;  1IBM Q;  3M9B A;  1Q8K A;  4DR3 Q;  4A3E G;  4DV2 L;  4GKJ Q;  3CMA A;  1PVO A;  2OQK A;  3NBH B;  4R4I A;  3RLO A;  1N34 L;  3HOU G;  5IP9 G;  4JI5 Q;  3GTG H;  4JI1 Q;  1BVS A;  1N32 Q;  2AWO A;  3H3V H;  3PO2 H;  1HR0 L;  2JQO A;  3D31 A;  4LFC Q;  4L5S A;  4LWC A;  1Y1W H;  4BY7 G;  3M3Y H;  3CCM A;  4A3G H;  5LMN L;  1D8L A;  1X65 A;  1PH1 A;  5C4X G;  1XTD A;  1XMO L;  2IHE A;  4QJF A;  3J7A 5;  3KLW A;  2MO1 A;  1GO3 E;  2UU9 L;  2N78 A;  3HOY H;  4DR6 L;  4AIM A;  1FL0 A;  3PIO A;  4GNX B;  4IPD A;  4GNX C;  4A75 A;  1EQQ A;  1YJ9 A;  2CCZ A;  4HJA A;  3CCE A;  4A3B H;  4NXN Q;  3S17 H;  3I7F A;  3CME A;  3TQY A;  3H0G H;  3FP9 A;  4LF8 Q;  3PUX A;  2HT1 A;  3GTP H;  1K9M C;  1L1O A;  4C3H H;  4K0K Q;  2RCN A;  4JI2 L;  3GD7 A;  1N33 L;  1G6P A;  1TWA H;  2D62 A;  5IWA L;  1L0W A;  4A3C G;  2HIV A;  2NN6 G;  5AJ3 Q;  5M3M G;  1K8A C;  2VNU D;  2D0O A;  1W3S A;  4IPC A;  1P16 A;  1MIU A;  1PH3 A;  4BBR G;  1E1O A;  4GKK L;  3PIP A;  2E2I H;  5C3E H;  3GTM H;  4R4O A;  3RZO H;  2K14 A;  1HNW L;  2NZH A;  5ELN A;  1S3O A;  2D0P A;  2MQH A;  3PUZ A;  1MJC A;  3OTO L;  4HID A;  3OW2 A;  4JYA L;  3HFZ B;  2K5H A;  2KCT A;  3TRZ A;  4P72 A;  4PZ7 A;  4AYB E;  3NEM A;  1SN8 A;  2A1A A;  2WFW A;  4OO1 I;  1PH5 A;  2WAQ G;  2Z0S A;  2ALY B;  2B29 A;  1Q86 C;  4A3F G;  4IFD I;  4GOP B;  4GOP C;  5IYD G;  1YI2 A;  1OXT A;  2CWA A;  3UDX A;  1I3Q H;  2L15 A;  1SRO A;  3M4P A;  2H5X A;  3F2D A;  1I94 Q;  1YNX A;  4DAM A;  5IYB H;  3EBE A;  1P8L A;  3J81 i;  3F2C A;  4KHZ A;  4OON A;  4WJ3 M;  4B3T L;  3HOZ H;  4FDB A;  4JBW A;  3WWV A;  5DLQ E;  5IP7 H;  3FKI H;  3CD6 A;  3S1M H;  1XNQ L;  2E2J H;  4PZ8 A;  4DUY L;  4GLX A;  2B63 G;  4UP9 A;  1YEZ A;  2E5L Q;  4A3E H;  1CSQ A;  4Y7N H;  3S2D H;  4DV5 L;  1I6H H;  1UE7 A;  2BA1 A;  4C3J H;  4JI3 Q;  1AH9 A;  3HOU H;  2XGT A;  5IP9 H;  2QA4 A;  3GTK H;  4KHP L;  2N49 A;  4QGU A;  1FGU A;  2R92 G;  1IZ6 A;  2F4V L;  3HOW H;  3ICE A;  1OXS C;  1VQC A;  5ELO A;  1JJ2 A;  3RN2 A;  3KF8 B;  1VQA A;  4POF A;  1WYD A;  4JI8 Q;  1IBL L;  1SRU A;  2UUA L;  3A5Z B;  1CKM A;  1EYG A;  1CUK A;  3A74 A;  3VDY A;  3J81 j;  1HNZ Q;  4A3M G;  3CF5 A;  1Y14 B;  1JMC A;  2MFI A;  2UUC Q;  2PI2 A;  1UE1 A;  4HJ9 A;  3ULP A;  1XNR L;  1NY4 A;  1YJW A;  3M4O H;  4DR7 Q;  3ULJ A;  1KIX A;  4R1J A;  5M3F G;  4DV0 Q;  4LF5 Q;  4YWM A;  1HR0 W;  4DR1 Q;  3BJU A;  3H3V I;  3CQZ H;  4AQY Q;  2Z6K A;  3JC6 6;  1PA6 A;  2XTI A;  2N3S A;  5LMU Q;  2ZM6 Q;  1RIP A;  1CKN B;  3GO5 A;  4YHH Q;  1RL2 A;  4DV4 L;  1XPR A;  3PO3 H;  3I56 A;  2ZJP A;  4NB3 A;  2RHS B;  3T1Y Q;  4A3J G;  1ASY A;  4LF4 L;  4BXX G;  1L2F A;  1BKB A;  1V9P A;  4X62 L;  3KOJ A;  2ZTD A;  4TVA B;  1QUQ A;  2BH2 A;  1C7Y A;  4JI6 L;  3UDI A;  1MJE A;  2RHQ B;  2CFM A;  2VL6 A;  2JA8 G;  3HKS A;  2OTJ A;  4IOC A;  3KJO A;  1S72 A;  4LFA Q;  1X3E A;  4DR2 Q;  1M1K C;  2JA7 G;  2UXB Q;  1I5F A;  1IXR A;  1Q1B A;  3AFP A;  4IJL A;  4DKA C;  3TS2 A;  4OWX B;  2ID0 A;  2VQF L;  1SFO H;  1N36 L;  2LSS A;  4B3M Q;  4LF9 Q;  4HIK A;  4LFB Q;  2K75 A;  3CCQ A;  5IYD H;  3KDF B;  4GN5 A;  4PG3 A;  4DV1 L;  4APV A;  1KXL A;  4MZ9 A;  3J7Z C;  2R93 G;  5HGQ A;  1PV4 A;  1KRT A;  3PCO B;  2AHO B;  3GDE A;  1VQM A;  1HNX L;  4L5Q A;  1PH4 A;  1H95 A;  1X3G A;  2NVY H;  3MEF A;  1VQK A;  2CKZ B;  4PMW A;  1GD7 A;  2WB1 G;  3F8T A;  4GNX A;  3T1H Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...