1RHPA

Crystal structure of recombinant human platelet factor 4
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
64
structure length
64
Chain Sequence
DLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of recombinant human platelet factor 4.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Platelet factor
molecule keywords PLATELET FACTOR 4
total genus 11
structure length 64
sequence length 64
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1994-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1rhpA00
2K1BA 1O80A 1PFNA 1X3QA 2H1EA 1MI2A 2J7ZA 4HEDA 1G2SA 2M2LA 1U4PA 1MGSA 1PDQA 1MSGA 1QNKA 2NZ1D 3ONAB 5EKIA 1F9PA 5AFWA 3G7LA 1X32A 1WTWA 1SAPA 3DEPA 4HCSA 2SDFA 1CA5A 2X6LA 2B2TA 4OIJA 1U4RA 1SSOA 2BDNA 2N55A 3I8ZA 1HUNA 3GV6A 4DN4M 1DOKA 2B2YA 2EPBA 1ICWA 1XYIA 1B50A 3LWEA 1HRJA 1DZ1A 1ZXTA 1VMCA 1IKMA 1IKLA 1B4OA 1TVXA 3GV3A 1WTVA 1GUWA 4ZLTF 1NR4A 4CJ0B 3MWYW 4RWSC 4CJ2C 1RODA 5JJZA 1O7ZA 1RHPA 3D6WA 3I91A 3KUPA 3KBXA 2HCCA 1G6ZA 2RVLA 2IL8A 1VMPA 1EIGA 4XT3B 1AP0A 1J8IA 2MGSA 2EOTA 2L9HA 1HA6A 2B2UC 2B2VC 4LMQD 5D14A 1Q3LA 5CBAE 2CVRA 4NW2A 2DY7A 3F2UA 2B2UA 2B2VA 4IUQA 2HDMA 3HP3A 4MHEA 4ZKCB 5DNFA 1E0BA 4X3UA 3H91A 1JICA 2X69A 3Q6SA 1WD0A 1J9OA 1WVLA 1PFMA 1S4ZA 2K04A 4HAEA 5CMDA 3IFDA 2R3ZA 4MN3A 1BO0A 4XDXA 1BF4A 4UAIA 2L1BA 4IURA 1M8AA 2HUGA 2NWGA 4R9WA 2JYOA 1EQTA 5CORA 2B2YC 1XX8A 4QUCA 5EPKA 4RA8A 2K28A 4QUFA 3SVMA 2RA4A 2K01A 4ZAIA 2MP1A 4O42A 2RSOA 2FJ2A 1ILPA 1SDFA 1AZQA 1KNAA 1KNEA 5T1GA 4HSVA 3TN2A 4ZKBB 2L12A 2JP1A 2Q8RE 1HUMA 4CJ1B 2KEEA 2NYZD 2X6GA 1WTXA 2K05A 1LV9A 1X3PA 5E4WC 2HCIA 1NR2A 3I3CA 5D65A 1BBXC 1NAPA 4X3SA 1WTOA 1WTRA 2KECA 3DM1A 1PFBA 4IUPA 4X3KA 1EOTA 1EIHA 4X3TA 2XIWA 1WTQA 1HFNA 2KOLA 3N52A 2FFKB 1B53A 1MSHA 2VXWA 1QG7A 3P7JA 1RJTA 1F9SA 1DONA 5E4XA 1JE4A 2KUMA 1O7YA 3I90A 1U4MA 2RSNA 1DOMA 1CM9A 3MTSA 1A15A 1WTPA 1ILQA 2B2WA 2N88A 3FPUB 1HHVA 5T1IA 1U4LA 3R93A 1G91A 1RTNA 2KVMA 1NCVA 4IUUA 2FHTA 2MJ8A 2EE1A 4RAUC 1C8CA 1AZPA 1ESRA 1F2LA 3QO2A 5EQ0A 4ZK9B 2FMMA 2MPMA 5EPJA 2D9UA 5EJWA 1IL8A 2B2WC 5EPLA 2Q8TA 4OIKA 1RTOA 4R8IA 2K03A 1HFGA 2HDLA 1WD1A 1CA6A 4U68A 1EL0A 3TZDA 1PLFA 1F9QA 4IUVA 1G2TA 1DOLA 1ML0D 3DEOA 2FINB 2DY8A 4XT1B 3IL8A 1B3AA 5CBEE 1BNZA 1B2TA 5COYA 3FDTA 2B2TC 1QE6A 2L11A 3UI2A 1F9RA 2L4NA 2KEDA 4IUTA
chains in the Genus database with same CATH superfamily
5M5WB 2PW5A 1NY4A 1HH2P 3NUCA 1B9MA 3SEBA 4KD4A 5DAUA 4K8IA 2I07B 2EXDA 3FKIH 4QJFA 1IBMQ 1ENCA 5ELOA 1Z6HA 4C2MB 2UXDL 3JAME 1V8QA 4DR2Q 4QB4A 3S16B 3QG1A 4PG3A 3NSWA 5ELDA 3S1QB 2UU9L 1HNWL 1LO5D 2K5HA 3Q22A 3B6YA 1XWEA 3MWYW 3T1HQ 1SMYC 3HRZC 3KUPA 4A93G 3FKIB 4IPDA 5A35A 4GKKL 3ZYYX 1A6XA 1EIFA 5KEEA 4O1NA 2JE6I 1KD1C 5JVH3 2DY7A 2AWOA 1M1KC 2ZTDA 1EY7A 2FXQA 1CFMA 1E0BA 1L0WA 3F2BA 5LHY1 5I4DA 1X6OA 1B7YB 2M00A 1PFMA 1GUGA 4TSSA 3GD7A 2E2HH 2IW3A 1Y1VH 2QA4A 1RF2D 4IURA 1I4XA 4A3KG 1E2ZA 1JB3A 4NPSA 1EEFD 3PIOA 4KI0A 4N8FA 1Y14B 3G48A 1B3QA 1H9MA 1B1ZA 4RGOS 5GAHC 5HGTA 2H4OA 1O78A 5IODA 5CV8A 4JI6L 5TSSA 1IXRA 3T56B 1KRTA 4A3MB 3I3CA 1AN8A 4ZUJA 1GHJA 1SBBB 3UE1A 4J15A 4X3SA 1BBXC 1AE3A 4IUPA 1VS0A 1X9NA 4H44C 5K36G 2PNRC 1YHAA 4C1NI 3RZOB 2A74C 1F2ZA 4PZ8A 2XRSD 4IQZA 2CWPA 1ASZA 2NN6G 3HOXG 5GROA 2B2WA 3FP9A 3FPUB 1YIJA 4A3MH 4LJZC 1UE1A 3J81j 1SRUA 2VUMG 4JI4Q 4B3RQ 1II3A 4MTNA 1L1OC 4A3KB 1KLGD 1N32L 1CKNB 1WYDA 2R7FA 3EIVA 4U68A 1SYFA 2AQ1B 1KAAA 1PLFA 1DOLA 1GUWA 4LFBL 2JA5B 2L11A 3HOXH 2K1BA 3C3LA 1AZQA 4QIWB 2R93H 1S3OA 1K3RA 2TMPA 1PTOH 3MFYA 2R92B 3GTMH 2F0JA 2N8NA 1F77A 3A7AB 2X6LA 1G8ZD 2N55A 5BR8L 4WFN3 1LYLA 2QW7A 2L55A 1GO3E 4GNXC 1WTVA 4RFBA 3CCVA 4DAMA 3BYTB 2HCCA 1W6KA 2E2HB 3KJOA 1GUSA 3QIAA 5LL6S 3VA7A 1EIGA 1SJED 3D0FA 1VQ7A 2PMZB 1Y8PB 4IFDG 1TS5A 1Q86C 2EOTA 1K8AC 2RHQB 3QR8A 4QIWE 4UHVA 1N36Q 2B8GA 3BJUA 2YTYA 3A54A 2K04A 1I4GA 1C48A 5IT9E 5FK9C 1IYJB 2XN9C 2CKZB 4E6IA 1JR0D 5CV9A 3M9BA 2F0KA 2R7ZB 4A3BH 2WKDA 2EY5A 3T4AC 4JI5Q 1STGA 2N78A 3SHLA 3UDXA 4AH6A 2YTXA 2JEAI 4HR7B 5C3WA 1XTDA 3H09A 2PZTA 2F0GA 4KHVA 4JV5L 1V9PA 5J3BA 3J7YW 1WTQA 4A3BG 2FFKB 1HTPA 1E3PA 3WOEA 1VQFA 2JSOA 3RLOA 4BBRB 2EY2A 5GQOA 4HIOA 2R92G 3A55A 2UUBL 3RN2A 3PO2H 1V1QA 2ZJRA 3GDEA 2RDGA 3D4DA 3E0JA 2N3SA 2JA6G 1PTOF 4A76A 2D9UA 2B2WC 2E75C 3I72A 4G7ZC 1EL0A 2V1CC 1E24A 4DV2Q 1F9QA 5BN5A 1EIYB 2MUYA 3X3MA 5C0XJ 1CHPD 4IOAA 4IFDH 1EY8A 4CKCA 1LT6D 1VQDA 1EEID 5C4JB 4LFAQ 4NXML 2H1EA 1JCKB 2CQOA 2R7DA 2CWAA 4DR7Q 2UXDQ 2NVXB 1D1KA 4H02A 2EJGC 2K14A 1JJGA 2OTLA 1SAPA 3DEPA 2K52A 1I50H 3OIPA 5FLXE 2A73B 4ZYSA 3C1FA 2A6HC 1TWHB 3I70A 1YJWA 4M1UB 1Q12A 4OWTB 4A93H 4DAPA 2ZM6L 4OL7A 2NVYB 1F2YA 1KTKA 2VQEL 1PZJD 3GTGH 2Q8IB 4DV5L 2E2IB 5IY0A 1SNDA 1TU2B 2V4DA 4UPAA 4DK6C 1K0SA 4LMQD 3PGZA 4K8JA 2LS01 4C3HB 1YNXA 3HP3A 5IWAQ 1JJCB 1IBKL 4IJHA 3D31A 1J9OA 3AFPA 1C9OA 4K5WA 2XVSA 4HAEA 4ZUIA 3P20A 3EA6A 3VR5A 1CZWA 3I4MB 3T53B 3CPFA 2NZHA 1XMOL 1XX8A 4OEMB 4QCLA 3NP8A 4DV6Q 5E3FA 2RSOA 2F1MA 5BN3A 2D2CC 1C0AA 2MNAA 3VR3A 1Z7TA 4K14A 1NJIC 5E4WC 3IFTA 1NAPA 5M5YH 2HD3A 2KECA 2F4IA 1A3VA 4X3KA 1EIHA 5M3FG 5FO9B 1QVFA 1Y1WH 3ITPA 4JI0Q 1FYCA 2K5NA 4H7BA 1VQJA 2E5LQ 5JJIA 2D0OA 1H9KA 2IHFA 3OSOA 3M3YB 2UU9Q 2EZVA 4BY7H 3OPOA 1G91A 4LW1A 2KVMA 1WCMB 2MJ8A 4LFBQ 4DK0A 4LUZA 2FMMA 1BDOA 2EXZA 2I0QA 2WIIB 1P16A 3NTKA 3S1NH 3I4NG 3RZDB 3VR2A 4UP7A 5C3EG 2KCMA 2F4VL 5FKAC 4GZYC 2YV5A 3DUZA 2KHIA 1A2UA 4KD3A 4QUCA 2WFWA 2HHHQ 3MHBA 2NTSA 3ONAB 3J80c 1QNUA 1U5KA 3GTGB 3F2CA 3BVZA 1RCVD 5IT9c 5K36H 4FP5D 4LAAA 3U4VA 4X64L 4RG1A 3UE0A 5IGBA 3QWNA 1CSPA 2F0LA 4XQNA 2VUMH 4O0AA 5FLXc 3GV6A 4HIMA 2Z6KC 1HR0W 1YZ6A 3DHQA 2A8VA 1DZ1A 1BBUA 2HIVA 3VYUA 2M9VA 4HN7A 3O13A 4JI6Q 3PO2B 1OXTA 2ES2A 4CGYB 1RODA 4GOPA 3RLFA 3FEWX 3GTLH 1FL0A 3NEMA 1JMCA 1MBYA 2A69D 2EVBA 3QOJA 4GKJQ 1I4HA 5FLMH 1TQOA 1I6HH 5IE8A 2K4KA 1BVSA 1JORA 3HEJA 3S14H 1YHQA 4A3CH 1SFOB 1SROA 4X3UA 4ID6A 4A3FH 3K5LA 3S1MH 1BCPC 3RD4A 3Q24A 5GAEC 4LF6Q 1WFQA 3K6OA 2HUGA 4R9WA 3HGBA 2F0IA 1JWSD 2WB1B 2CCZA 1QB5D 1LTAD 4DV3L 1HNXL 2LKVA 3CQZH 4DK1A 1A63A 1SE4A 4WRDA 3GTKB 2WV6D 1L0XB 1EU4A 5ELNA 4LF4L 1KL9A 1PH3A 1YVCA 1X3GA 5IYDG 2FMCA 3VYRA 2UUCQ 2ZXPA 1I94L 3KLSX 3D6CA 4P73A 1HPCA 2KUMA 2QF7A 1QILA 2AWNA 4DR4L 1VQLA 2NVYH 4ZK9B 1XXGA 2OT2A 3NBIA 1V1OA 3EQLC 1L2FA 3CCMA 1GKHA 4OO1H 4C3HG 3FHWA 1CT1D 3NELA 4J8QA 5EAYA 4A3IH 3PUWA 4BBSH 5D3DA 3GTQB 2GN5A 3TEHB 5FJ8H 5JEAJ 3J7AV 2UUAQ 2J7ZA 1BUVT 4HSPA 1YBYA 3T1YQ 1IHZA 1KDAA 1GM5A 1UE5A 3W1GA 3HOVH 1YNNC 3HOYH 1PRTB 1ICFB 1X55A 4Q5VA 3K7AB 1DYQA 4RH6A 1VQMA 1QJOA 1W6JA 2SOBA 2BDNA 1JT8A 1XNRQ 2LY7A 2ZM6Q 4QMGA 2OF1A 2ZXOA 5M3MH 5M5WH 2WACA 2QILA 5M5XB 3TP8A 4CJ2C 2HQLA 5JJZA 4JI0L 2JQOA 3I91A 3HFZB 2WP8J 2RQXA 4DR2L 3TS2A 4YWKA 4Y7NH 1PH5A 1QCBD 2O2LD 4LF9L 1QZHA 2B2VC 2F0SA 4DV7Q 4LK1C 4KY6A 1NE3A 2AQ2B 3HKZE 4KJOA 1RD9D 5DNFA 2BH8A 4RCNA 2X69A 1D5MC 5CMDA 1I4RA 3A5ZB 4I65A 4WJ4A 3RNUA 2RHSB 2NWGA 3S17B 1PTOC 2DGYA 5BR8Q 1VQ4A 4DAYA 1PH2A 1PTOD 2VNUD 1F2MA 3TRZA 4GN4B 4ZCKA 4LF5Q 1SDFA 3H15A 1KNAA 4DV1Q 1EQQA 4DUZL 1VDZA 4CJ1B 3L3OC 1EZ8A 2B8FA 2KEEA 4K2LA 4XTCS 3S2DH 3M4OH 3VYSA 3OTOL 5DLQE 5M3FB 4RKBA 5I6YA 2VB3X 2BH2A 1EYGA 3NPPA 4B3SQ 3E9HA 1CZGA 1W2BA 2EYPA 2KOLA 2O5JC 3OYYA 1A2TA 3M4YA 1SLJA 1LTGD 2UXBL 3PUVA 5E4XA 1NTGA 1HQMC 4BY7G 1A15A 5K5PA 2D5DA 1BCPF 5IGFA 1ENFA 2NVQB 3F8TA 4KKTA 3CMEA 2E2DC 4AQYL 4RAUC 4TRDA 5JPNC 1U0LA 5CR3A 3MA2B 2IJ0A 1IL8A 4CKEA 3W3AA 1Y1VG 1TWFH 5JVG3 1UE6A 2KQ3A 2IX0A 3I73A 3M7GA 3I4OA 4PQXA 4YIJA 3SDZA 3KF6A 3PV0A 3MVVA 3A5UA 4GLXA 3ULJA 3ICEA 4DR3Q 3BZKA 4Z9CB 1Y1WG 1X32A 5JJLA 1CA5A 1PXUA 1X54A 4B9WA 1SSOA 1OO9B 1EY5A 1LTLA 3IKJA 4YHHL 1PH1A 1PRTD 4C3IG 4RGMA 1EYDA 5CC4A 4C3JH 3WOFA 1ET9A 5C3EH 3HOVB 1VCIA 3HKZB 3OMGA 4A3EG 2IL8A 1VMPA 3PUXA 4B3TL 1ESFA 4X62Q 4X6AH 1QZGA 4HJ8A 1BKBA 2L9HA 4C3IH 2WB1G 1SR3A 4JBKA 1HNZL 1J6QA 2B2UA 2HDMA 4F7XA 3G4SA 1ZYRC 2B63B 1FJGQ 1JOOA 2K5DA 3BDOA 5C6AA 2EY1A 1HZ9A 1CQFA 2C5CA 1TIID 3T1YL 1L0YB 4DR4Q 2FJ2A 1ILPA 4B3ML 1N9WA 3A8JE 4ZKBB 2ENBA 4NB3A 1UNSA 4R8NA 1LV9A 3GTKH 5NUCA 1CK1A 4JG2A 2RDHA 1JB7A 1WTRA 4FO2A 4KK7A 3X3NA 3KK7A 4IZ8A 5JEAG 2JA6B 3S15H 4DKAC 4MNOA 3RZDH 3KF8B 2WAQB 4HJ9A 1PV4A 1WTPA 1Q46A 4LF9Q 2Z9HA 5T1IA 4R4TA 5LMUL 2BA0A 3G6EA 1LTRD 1XNRL 1LUZA 2MQHA 3QO2A 4EVOA 2K5WA 3DWQA 1XMOQ 5J1ZA 3K80C 3J7AF 2ZT9C 1DM0B 2DJGC 3PIPA 4FF4A 4TVAB 5COYA 5KYLA 3GTJB 1TY2A 1BXTA 1VQ9A 3GTQH 4BBSB 4FNFA 3QOLA 1I4PA 1LTSD 1SNMA 1PDQA 2DJFC 2NZ1D 1QNKA 5EKIA 3STBC 3HOYG 4OO1I 2RCFA 1YHBA 5HURA 2DNEA 4L5RC 1UUPA 2HQEA 2PW7A 3K5NA 2K5QA 4X64Q 2JA7G 3L9AX 4JOIA 1Y8NB 1Q1EA 1SEBD 1PFSA 1U4RA 1FNUA 2G9HD 1NMGA 3GTJH 1EFID 5IGEA 1ICWA 3KYHC 1XYIA 3I55A 3LWEA 3VR6A 4H13C 5LL6X 3PIO3 1YJNA 4C3HH 1D2BA 4LUVA 3D3RA 1OXUA 2R6GA 1PYSB 1GHKA 2GVAA 1IYVA 1SYGA 1PZID 3TQYA 1EU3A 5I2XA 2CVRA 1J5EQ 3OTOQ 2B2VA 3BDCA 4PNYA 1S5ED 3C46A 1JICA 4JI8Q 2DNCA 1HNWQ 4I7AA 1BF4A 4HJ5A 2PQAB 4GKKQ 2G5DA 1AFPA 2JYOA 5G3LF 1NMFA 5CORA 5C3XA 1B9NA 2B2YC 4R4OA 2EYJA 2RA4A 2K01A 1LM0A 4DV0L 4DU9A 2F3VA 1PA6A 4DUYQ 5T1GA 2RDFA 4YCUA 2OEOA 2PI2E 5C4XG 4KHPQ 4GLVB 2JJQA 4HIDA 4JI3Q 1NR2A 5M3FH 3E9IA 1CI3M 1HTLD 2K7VA 3TP7A 2OXPA 1MSHA 2VXWA 1PMRA 1DONA 1RJTA 1DJRD 2QCPX 1TS2A 3MTSA 5C4JH 2QDBA 1A62A 4AYBE 4DNTB 1EQVA 5IGCA 5IP9H 3HKZG 4A3EB 1UE7A 1HFGA 1IW7C 1YEZA 1YNJC 3SR1A 4IPCA 2VUMB 1YNJD 3S15B 2PQAA 4DR3L 4DXFA 2B2TC 3C1EA 1GUNA 4DR5Q 1OXVA 3PCOB 2UUAL 4IUTA 1I6VC 1PFNA 1HCZA 5IT9L 4G7HC 4X65L 3CCUA 3H3VH 1OTCA 3CRKC 4YHHQ 4YWLA 1B70B 2H5XA 3PUYA 1JWUD 4IO9A 1Q7YC 4LF7L 3CCJA 1KDCA 4A3BB 2GA4B 5M3MB 4RKLA 5JOBA 2VL6A 2QDLA 3DXJC 1PH4A 1R9TH 3NWSA 4ZLTF 1NR4A 4M8AA 1MJCA 4IJLA 1HJPA 1GUTA 4NKLA 2KHJA 2ALYB 2E8GA 3KJPA 3WWVA 3K5MA 3R2TA 2ZXRA 1A8VA 2PQEA 3GO5A 4OHJA 1Q3LA 1STYA 4C3IB 4PZ7A 1A3UA 5M9OA 2NN6H 3S1QH 2N49A 3GTPH 5IYBG 2PNHA 3Q6SA 4IUNA 4DPGA 4DXGA 5IIFA 2I5MX 4MN3A 1TWCH 5FO8B 1IL2A 3S2DB 2P5ZX 5I9OA 1GD7A 3TS0A 1E7ZA 3FKIG 3BS1A 3NQIA 5JEAH 1EZ6A 5KNDA 3BU2A 4DR1Q 4O42A 3HOZG 3PO3G 3EVQA 1STNA 3MC0B 2E5LL 3R3OA 2OWOA 2X6GA 1WTXA 2CHBD 1QVCA 1X3PA 1ZKOA 4UP8A 4DV6L 1IW7D 2JA8G 3D4RA 2E2JB 2F3IA 2JK8A 1VQ8A 1QG7A 1F9SA 1TWHH 1DGSA 1E22A 1IYUA 3AQQA 1HR0Q 1ILQA 1BBWA 3U9OA 2D62A 4K5VA 3TP5A 4GNXB 3HZXA 1MD2D 4RMFA 1AEXA 3H0GB 1TWFB 2Z6KA 2EDGA 4KKUA 4RHSA 3KF6B 1NUCA 1MKHA 1CUKA 1X3EA 2FINB 3HS0C 5FLXL 3RUZA 3T1HL 3FDTA 1I5FA 3CP0A 1F9RA 3ER0A 3EJIA 4OX9L 4ME5A 3CKIB 5C44H 1HR0L 1U4PA 1TKWB 1LT5D 1LABA 3MXUA 1SNQA 3OWFA 4I7ZC 1TWGH 3H0GH 2JA7H 1M4VA 2RKSA 1WTWA 2AMCB 4P74A 2F0VA 1I6HB 1STAA 1ZYRD 3I8ZA 3PQIA 1TY0A 2JA5G 3I2ZA 4A3IB 1D7QA 4DN4M 1DOKA 1B50A 3D8GA 3JAML 1OXXK 4A3FG 1TVXA 3K0XA 3KDFB 4RWSC 4FF2A 2EYMA 2QKIC 1K3BC 1XMQL 2Q2TA 2Z4IA 2MGSA 3SGIA 1XPOA 3H3VI 3N6RA 1XNQQ 3GQBA 4YWMA 3F2UA 4KHPL 4A3CG 3K7UC 4X66L 3S16H 1EQRA 4JBJA 4B08A 4C3JB 1HXYD 5LMUQ 1WD0A 3PF5A 3ERSX 2UUBQ 4GOPC 2L5TA 4IOCA 1TWAB 2RF4A 1TWCB 2F0TA 1M8AA 2XGTA 3RN5A 1JQYD 1AE2A 2Y0SG 1EQTA 3S1NB 3VR4A 2QEJC 1LTTD 4RGNA 2MP1A 4WJWA 1O7LA 1VQCA 4JI4L 4B3RL 2PO4A 4B3MQ 4HSVA 4A3GH 4R1JA 4LFAL 2K05A 2B63H 1PRTF 1SNCA 5D65A 3S2HB 2NUCA 2LXJA 4HTHA 3U4ZA 5C44G 1WTOA 2WINB 1R4PB 1Y1WB 1Y8OB 4BXXH 2F0HA 1D1IA 3NE5B 3DWPA 4RCOA 3STBD 5IYCH 4HIKA 4KMUC 3MFGA 1WJJA 1U4MA 3A56A 1X56A 2LSSA 4QQBX 1DD2A 3E6ZX 3NTIA 1EY6A 1RTNA 2Q2UA 1CHQD 4IUUA 3KF8A 5CGKA 2WAQE 3GTMB 2MPMA 4KN4C 1CA6A 4FXDA 2XWBB 4DNIA 1SJHD 2Q2HA 3J81L 4NXMQ 3A0JA 1OXSC 4JCVE 2M2LA 2VS1A 1MGSA 1SXTA 3IAYA 4TQUS 4GLAC 2VQFQ 1LLRD 4JW0A 4CKBA 4RHRA 3CMAA 1D5XC 2C35B 4A3KH 1D6EC 4HCSA 3SXHA 1CKMA 4OIJA 2RCNA 1STEA 4MIUA 2EPBA 3CU7A 2VY3A 3L7ZC 3VA5A 5DEHA 4IPGA 3GP7A 2IX1A 3I56A 5I9PA 3CF5A 4P71A 4BY1H 1O7ZA 4OWWB 2ICEC 3TMEA 3T16A 1J8IA 1S40A 1I50B 1HA6A 2ZJQA 3CPWA 1IBLQ 4JK1C 1GUOA 4JYAQ 2YU9B 1BR9A 2MO0A 1N32Q 3AFQA 3CCLA 3OIQA 2ID0A 3MZ5A 5EBDA 5C44B 1S4ZA 2JA9A 2IY5B 2SNSA 1BO0A 1NBWA 4NXNQ 4FF3A 4A3JH 3LX0A 4GKJL 4XYQA 3UDFA 1FJGL 4QUFA 4DF7A 1ONLA 5KNCA 2CFMA 3FPPA 1JWMD 3PMFA 5C4HA 2F4VQ 2EYFA 2JP1A 3J81E 1HUMA 1ET6A 4DGZA 4YY3Q 4PMCA 1WOCA 5CYUA 3PUZA 2A6ED 2F0QA 5ISRA 3KOJA 4BS9A 2DUDA 3TBIB 3HOUH 1RL2A 4G7OC 2F3WA 3DM3A 2VQEQ 4CDEC 1YNND 5ELFA 1JE5A 3M3YH 1BCPB 4A3GB 3P75A 2F52A 3CHBD 3OW7A 2CH4W 4JI1L 2NN6I 4JI5L 3NXWA 2BOSA 4CDCC 2VW9A 1S5CD 1K9MC 5JJKA 2XSCA 5EQ0A 1VQPA 5EPJA 4X66Q 5IGGA 3CC4A 2UXBQ 1HFNA 5EPLA 5M5YB 4Y7NB 2L0CA 1BQQT 4K6LA 3CCQA 2KCCA 5CBEE 1BNZA 4LF8Q 2ATWA 4JBWA 4C56C 4DR6L 4DV0Q 4KY7A 3K0YA 3J7ZC 1X3QA 3U9SA 1MI2A 4TKOB 3EBEA 3J80E 1Q82C 4B9XA 4BA2I 2YYZA 5IYDH 2SDFA 2F0EA 4JC0A 4BWGB 4JV5Q 5EGTA 4RGTA 1K8MA 4HJAA 4ALPA 1DCZA 1EFWA 2RBMA 3GV3A 1PH9A 4P75A 4ULLA 2RVLA 3WDNA 1JC7A 2C9OA 3AU7A 4KLKA 2NVTB 4DNRB 1EUJA 2BE5D 4L63B 1VQKA 1Q90A 4A3IG 3E0EA 1SMXA 2NZOA 4GS3A 4U673 1EWCA 1SFOH 3HOUG 1HZCA 1PRTC 4X65Q 1W3SA 1QWYA 1UEBA 4HCEA 2MHVA 2B63G 2R3ZA 1FNVA 4XDXA 4NMZA 2CW0D 3J81c 3SK8A 4POFA 3K59A 1Q1BA 3JAMc 4GN5A 1G6PA 1L1OB 4RA8A 2K28A 3G6JB 4DV3Q 2SNMA 4ZAIA 1HNXQ 4R4QA 5C4XH 3J81i 4A3GG 4ILWA 1SNPA 3CAMA 4N8X1 2ICIA 3VYTA 4LUOA 3HOVG 2ASBA 2Z6BA 4V0BA 2NB0A 1EOTA 2E76C 1SYBA 5ELCA 3RZOH 1B53A 5C4XB 1D8LA 1N34L 1O7YA 2RSNA 1DOMA 3V2TA 4APVA 1PYWD 4LF5L 1VF7A 5C3EB 1SYEA 4BY1B 3K58A 1SYDA 1U9RA 1ESRA 2ZTCA 3Q8DA 2I5LX 5KRUA 4ZRZA 5EKKA 2JA7B 2NBFA 4OELB 3AEVA 1K0RA 5KNBA 1JOKA 4XT1B 3UDIA 1HZAA 2VQFL 4QY7A 2R7ZG 1QE6A 4DFAA 1EWHA 4XXEA 1AP0A 2KEDA 2F0OA 3VDYA 3QJYA 3TDQA 4AIMA 4HEDA 3H94A 1MSGA 1QUQA 5I6WA 1TS3A 4N9TA 3TSSA 3G7LA 4BXXG 1G51A 4JYAL 5I2YA 2K6AA 1MIUA 3ND9A 3HOUB 4UP9A 4A3LG 2K33A 1UEAB 2R7ZH 1Q8KA 1K8GA 2B2YA 1LACA 4L5TA 2Z0SA 3HOWH 1EY0A 2PI2A 4KY5A 5KGUA 4DV5Q 5C0XG 1E2WA 4LWCA 2DN8A 1H95A 1WTHA 1BCPD 2G9DA 2J4XA 2IWHA 4OO1G 4IUQA 4MHEA 1H9SA 4DR7L 3PIP3 3H91A 4UDUC 4K6DA 3E3XA 1TR5A 3BDLA 4DR6Q 2K32A 2Y0SB 3CCSA 4YY3L 3AMUA 5IYCG 3W2DA 4JVZA 3GTPB 1I3QB 1HNZQ 2JA8B 2KA7A 2OQ0A 3SE0A 3SK6A 3TN2A 3QB3A 2Q8RE 2PYKA 3K57A 2L15A 2E74C 4QL5A 4BA1I 3MXNB 1KRSA 1STHA 3NWTA 4KJNA 5GAGC 1XPUA 2A19A 5D3IB 3HOZB 1XMQQ 3PO3B 2EJMA 2PZUA 2F0UA 3S17H 4LF6L 4O2DA 4FYDA 1JE4A 4A3JG 2F0PA 3R2IA 3ULPA 2N88A 1EY9A 1PH6A 1U4LA 1K8OA 1CTMA 2YTVA 3DMUA 4OGQC 4HJ7A 4A3MG 1C8CA 4R4IA 2BDOA 3D4WA 4DV4Q 1TWGB 1ENAA 4OWXB 5J22A 2D0PA 5AJ3L 3TREA 4P2CB 5FLMG 1RTOA 2MFIA 1WD1A 1KDBA 3TZDA 4IUVA 2DY8A 4C2MH 3I4NH 4EQPA 3S1RH 2HT1A 4EQOA 1FVIA 4ABNA 2K5VA 3DLLA 4ZKCB 1S5DD 4JI2L 1G2SA 2NVXH 4PMWA 1VQEA 1M90C 4DV4L 4NXNL 4CBVA 1TT2A 3MEHA 4JPBW 4A4IA 4OONA 1RIPA 1ZEQX 1STBA 3BZCA 2F03A 2LMCB 1EYCA 4LF4Q 3HKSA 3BVMA 1PH7A 3A74A 1HQRD 5JAVA 3NQTA 1HRJA 4F8MA 4CDDC 1IKLA 4JOIC 3KLWA 2F0MA 4L8JA 2F0NA 2R93G 1I94Q 1SE3A 4LF7Q 1XJVA 4XQQA 4X62L 3FMCA 3L0OA 3SK4A 2WAQG 2ZTEA 5E1FA 5C5LA 1EOVA 2JEBI 3KFUA 1HA5A 4AYBG 4JI1Q 3IRBA 4DR1L 3K8AA 1H9RA 4A3DB 1QUQB 4OXPA 3OHXC 1V1PB 3U50C 3F1ZA 1VQIA 4S3SA 2EY6A 3EN2A 5FO7B 1DXMA 3I4MH 4BBSG 1P8LA 3A8KE 4IFDJ 4LFCL 1FR3A 3EFXD 3SVMA 4Y52H 4JI7L 1VQ6A 5KYIA 1KLUD 1LTID 5DM63 2NVQH 1IZ6A 2A6HD 1Q8IA 2F0DA 1AW7A 1D5ZC 3GTLB 3ZJYC 5IYBH 3MXNA 3T51B 1S5FD 3OMCA 4X3TA 2XIWA 1B44D 1EY4A 4ODGA 1BOSA 1CKNA 2TSSA 4CDFC 1CSQA 1Q81C 1KIXA 3AYHB 4KKSA 1IBLL 4K2KA 1PH8A 1UWVA 3M4OB 3HOXB 5GADC 1HHVA 4A3DG 3PSIA 3OWEB 1AZPA 3E5SA 2R93B 1F2LA 3F2DA 3J7A5 3TP6A 1I4QA 2NVTH 3JC66 5A2QL 1Y69U 3DEOA 4K0KL 1B3AA 2IPKD 1SE2A 1NSNS 4G4KA 1B2TA 3CXCA 2QEXA 1I3QH 4JBMA 2JA8H 3GTOH 4L6TB 5JPMC 5IP7G 3DWAA 1WCMG 4EX5A 4K5XA 1N33Q 5AFWA 3BYYB 1IBML 5LMNL 3K7AH 2HIXA 1PYBA 2JA5H 3C2PA 1K28A 4KHZA 2GVBA 2YU9H 2CQAA 1R4QB 5ELBA 2KENA 4FF1A 3MXPA 1ZXTA 1VMCA 4YCVA 1LTBD 4MZ9A 1XNQL 5M3MG 4CJ0B 1MHWC 2F0FA 3HOYB 2NTTA 3D6WA 3H6MA 1EWIA 3FRPB 5IGDA 1A0IA 3MXGA 1SYCA 1SN8A 2KCTA 3W5OA 1Z47A 1SMYD 4FXGC 5F2DA 2E2JH 2KJXA 2B2UC 4A3JB 4AQYQ 1T5XD 1RKNA 4NW2A 3CW2C 2VZAA 5ELEA 3PO2G 3OW2A 3K5OA 3J80L 4JI8L 1VQ5A 1B8AA 2R61A 1LT3D 1E2VA 1L1OA 1XPRA 3IFDA 5CV7A 2Z1CA 1JJ2A 4A3DH 1E1TA 4GNXA 2UUCL 3H3VC 4WORA 5IOCA 1IBKQ 1G291 1C4QA 5HGQA 4DUYL 4N9PA 1KNEA 2CH4A 4DV1L 3M4QA 3NBHA 5HY6A 2EIFA 2ZJPA 2NYZD 3KLSA 1PHJA 4IFDI 5CV5A 2HCIA 1A3TA 1WCMH 2Y0SE 3DM1A 4IPHA 4UY8C 2IHEA 3N52A 1VQAA 3P7JA 2A69C 3V05A 2PZWA 2XNAC 4GN3B 5G3LD 1PVOA 4FXKC 2A68C 5C5MA 4DV2L 1R9TB 2OTJA 5E7NA 2EE1A 3HG9A 2Q2IA 1YI2A 2PMZE 3NTHA 4OIKA 2XRQD 2K03A 2BCOA 2HDLA 2K75A 2JA6H 3CD6A 1WI5A 2JN4A 1UAPA 1KHIA 2PCFB 3LWUA 2OQKA 5BN4A 1TXYA 5CV6A 1CQVA 2B3GA 4XIGS 5C4ZA 2L4NA 1MJEA 1FD7D 4H0LC 4NP5A 2LFNA 4DAVA 2O5IC 4BY1G 1F9PA 3HOWG 3KDFA 2VB2X 4LF8L 1YITA 3HOWB 4L5SA 5CV4A 2E2IH 4JI7Q 4QF4A 1LT4D 4L5QA 1J5EL 4J1MA 1GOZA 5C0XH 5C0XI 5DM73 1KABA 3CRLC 4IALA 3EROA 2I46A 2MO1A 1HUNA 2Z8LA 4JI3L 4POGA 1B4OA 4KV6A 4AYBB 1S72A 2J0TD 5J39A 2O4XA 1RHPA 2AUJD 3K81C 3J80i 3T13A 5IP9G 2EJFC 1YJ9A 3KLRA 2PPBC 2BA1A 3W1BA 4EGVA 5LMNW 1T5EA 1GVPA 2LXKA 3S14B 3NK9A 2IT1A 5KIXA 1C7YA 3A7LA 4DUZQ 1ASYA 3AB9A 3L2PA 1FGUA 3PF4A 2BE5C 2OCEA 4LFCQ 1H9SB 3CCRA 4DR5L 2L1BA 4A75A 1AH9A 4FDBA 2WKCA 4LNQA 3HOZH 3PO3H 5FOBB 4IN3A 2A1AA 3OOCA 1SNOA 4BBRH 1O7IA 2CW0C 4ME3A 5M5XH 3LGJA 2A6EC 4C3JG 2L12A 1H9JA 4JI2Q 4KTAA 2AUKA 4OX9Q 4B3TQ 5L37A 4DAYB 4HMJA 1KC8C 1PFBA 3M7NA 5FJ8G 3CC2A 3RLNA 4F87A 2EYLA 4YCWA 4XYOA 5A2QE 1N33L 3S9WA 3I90A 2B29A 3MEFA 3CQZB 3P1HA 3BVGA 3R93A 1VF5C 3Q23A 2EYOA 1NCVA 4K0KQ 3I4MG 5EBCA 1E1OA 2Q8TA 1KXLA 3FVQA 4P72A 4ZQ3A 1G2TA 2IX3A 1ML0D 3IL8A 1S5BD 1T9HA 4FVMA 3UI2A 4DK3C 5IP7H 1QOHA 3R8BA 5IWAL 1K73C 1O80A 4PMBA 3S24A 3M85A 3Q0AA 4V190 2A5HA 2B39A 2I5HA 4GOPB 3U58A 1VQNA 2B2TA 3NENA 4G57A 3ERQA 1FGBD 1Z9FA 2AQ3B 4F88A 3I4NB 1IKMA 1X65A 2XTIA 1PZKD 3I4LA 1XTCD 4BBRG 4R4CA 5AJ3Q 4A93B 2KHSA 1KQSA 3KBXA 3S1MB 1G6ZA 1N8RC 3SK5A 2K50A 4XT3B 1JOQA 1TWAH 3ULLA 4KN7C 3JAMi 3NBHB 4EQ5A 3BG3A 5D14A 5CBAE 5EKLA 4Q0FA 4C1NK 3CCEA 1VQHA 1K83B 1WVLA 2EYHA 3UDGA 2AHOB 1N36L 1KAWA 2UXCQ 4XQJA 1Y1VB 1PTOB 2JXMB 4DV7L 2R92H 4UAIA 4PV1C 4J6HA 3H0GG 2SEBD 1X3FA 4HMIA 1EYAA 5EPKA 1HZBA 3G71A 4CHTB 4A3LH 1NNXA 4A3FB 1V1PA 2AKWB 4PZ6A 1GXDC 2F0WA 3RR5A 1K83H 1VQGA 1RDPD 3I7FA 1N34Q 3RMHA 2HHHL 4QGUA 2EQSA 2KCNA 1VQOA 2UXCL 1VQBA 3LNNA 5LMNQ 1CKOA 3M4PA 3MAQA 2A68D 4NDXA 4EQNA 3V96A 3S1RB 3KBGA 3URYA 4DA2A 1FNWA 1CM9A 2KBNA 1SE8A 3ND8A 4MTKA 2Z4HA 3GTOB 2WB1E 4B3SL 2FHTA 3A8IE 2QGQA 3S2HH 5EJWA 1TS4A 2XWJB 4R8IA 5H1SE 1GJXA 1V43A 3CC7A 3TZUA 3BZDB 4BY7B 1QVGA 3NHHA 4A3EH 4WJ3M
chains in the Genus database with same CATH topology
5M5WB 2PW5A 3NUCA 1B9MA 3SEBA 4KD4A 5DAUA 4K8IA 2I07B 1ENCA 1Z6HA 4C2MB 3JAME 1V8QA 3S16B 4QB4A 3QG1A 3NSWA 5ELDA 3S1QB 1LO5D 3Q22A 1XWEA 3MWYW 1SMYC 3HRZC 3KUPA 3FKIB 5A35A 3ZYYX 1A6XA 5KEEA 4O1NA 2JE6I 5JVH3 2DY7A 2AWOA 1EY7A 1CFMA 1E0BA 5LHY1 5I4DA 2M00A 1PFMA 1GUGA 4TSSA 3GD7A 2IW3A 1RF2D 4IURA 1I4XA 1E2ZA 1JB3A 1EEFD 4KI0A 1H9MA 1B1ZA 4RGOS 5HGTA 2H4OA 1O78A 5IODA 5CV8A 5TSSA 3T56B 4A3MB 3I3CA 1AN8A 4ZUJA 1GHJA 1SBBB 1BBXC 4X3SA 4IUPA 4H44C 5K36G 2PNRC 3RZOB 4C1NI 2A74C 1F2ZA 2XRSD 4IQZA 2NN6G 2B2WA 3FPUB 4LJZC 1II3A 4A3KB 1KLGD 4U68A 1SYFA 2AQ1B 1KAAA 1PLFA 1DOLA 1GUWA 2JA5B 2L11A 2K1BA 3C3LA 1AZQA 4QIWB 2TMPA 1PTOH 3MFYA 2R92B 2F0JA 1F77A 3A7AB 2X6LA 1G8ZD 2N55A 4WFN3 2L55A 1WTVA 4RFBA 3BYTB 2HCCA 1W6KA 2E2HB 1GUSA 3QIAA 5LL6S 3VA7A 1EIGA 1SJED 2PMZB 1Y8PB 4IFDG 1TS5A 2EOTA 2B8GA 3A54A 2K04A 1I4GA 1C48A 5IT9E 5FK9C 2XN9C 4E6IA 1JR0D 5CV9A 2F0KA 2R7ZB 2WKDA 2EY5A 3T4AC 1STGA 3SHLA 2JEAI 4HR7B 5C3WA 3H09A 2PZTA 2F0GA 4KHVA 3J7YW 1WTQA 2FFKB 1HTPA 3WOEA 2JSOA 4BBRB 2EY2A 3A55A 2RDGA 3D4DA 3E0JA 1PTOF 2D9UA 2B2WC 2E75C 3I72A 4G7ZC 1EL0A 1F9QA 5BN5A 2MUYA 3X3MA 5C0XJ 1CHPD 4IFDH 1EY8A 4CKCA 1LT6D 1EEID 5C4JB 2H1EA 1JCKB 2NVXB 1D1KA 2EJGC 1SAPA 3DEPA 5FLXE 3OIPA 2A73B 4ZYSA 3C1FA 2A6HC 1TWHB 3I70A 4M1UB 1Q12A 4DAPA 4OL7A 2NVYB 1F2YA 1KTKA 1PZJD 2Q8IB 2E2IB 1SNDA 1TU2B 2V4DA 4LMQD 4K8JA 2LS01 4C3HB 3HP3A 3D31A 1J9OA 4K5WA 2XVSA 4HAEA 4ZUIA 3P20A 3EA6A 3VR5A 1CZWA 3I4MB 3T53B 1XX8A 4QCLA 3NP8A 5E3FA 2RSOA 2F1MA 5BN3A 2D2CC 3VR3A 1Z7TA 4K14A 5E4WC 3IFTA 1NAPA 2KECA 2F4IA 1A3VA 4X3KA 1EIHA 5FO9B 3ITPA 1FYCA 4H7BA 1H9KA 3OSOA 3M3YB 2EZVA 3OPOA 1G91A 2KVMA 1WCMB 2MJ8A 4DK0A 2FMMA 1BDOA 2EXZA 2WIIB 3NTKA 3RZDB 3VR2A 5FKAC 4GZYC 3DUZA 1A2UA 4KD3A 4QUCA 3MHBA 2NTSA 3ONAB 1QNUA 3GTGB 3BVZA 1RCVD 5K36H 4FP5D 4LAAA 5IGBA 3QWNA 2F0LA 4XQNA 3GV6A 3DHQA 1DZ1A 3VYUA 2M9VA 4HN7A 3O13A 3PO2B 1OXTA 4CGYB 1RODA 3RLFA 3FEWX 1MBYA 2A69D 2EVBA 3QOJA 1I4HA 1TQOA 1JORA 3HEJA 1SFOB 4X3UA 4ID6A 3K5LA 1BCPC 3RD4A 3Q24A 3K6OA 2HUGA 4R9WA 3HGBA 2F0IA 1JWSD 2WB1B 1QB5D 1LTAD 2LKVA 4DK1A 1SE4A 4WRDA 3GTKB 2WV6D 1L0XB 1EU4A 2FMCA 3VYRA 2ZXPA 3KLSX 3D6CA 1HPCA 2KUMA 2QF7A 1QILA 2AWNA 4ZK9B 1XXGA 2OT2A 3NBIA 1V1OA 3EQLC 4OO1H 4C3HG 1CT1D 4J8QA 3PUWA 5D3DA 3GTQB 5JEAJ 3J7AV 2J7ZA 1BUVT 4HSPA 1IHZA 1KDAA 1YNNC 1PRTB 4Q5VA 3K7AB 1DYQA 4RH6A 1QJOA 1W6JA 2SOBA 2BDNA 2LY7A 4QMGA 2OF1A 2ZXOA 2WACA 2QILA 5M5XB 3TP8A 4CJ2C 5JJZA 3I91A 2WP8J 2RQXA 1QCBD 2O2LD 2B2VC 2F0SA 4LK1C 4KY6A 2AQ2B 4KJOA 1RD9D 5DNFA 4RCNA 2X69A 1D5MC 5CMDA 1I4RA 4I65A 2NWGA 3S17B 1PTOC 4DAYA 1PTOD 2VNUD 1F2MA 1SDFA 1KNAA 1VDZA 4CJ1B 3L3OC 1EZ8A 2B8FA 2KEEA 4K2LA 4XTCS 3VYSA 5M3FB 4RKBA 5I6YA 2VB3X 3NPPA 1CZGA 2EYPA 2KOLA 2O5JC 1A2TA 3M4YA 1LTGD 3PUVA 5E4XA 1HQMC 1A15A 5K5PA 2D5DA 1BCPF 5IGFA 1ENFA 2NVQB 4KKTA 2E2DC 4RAUC 4TRDA 5JPNC 5CR3A 3MA2B 2IJ0A 1IL8A 4CKEA 3W3AA 5JVG3 2KQ3A 2IX0A 3I73A 3M7GA 4PQXA 4YIJA 3SDZA 3PV0A 3MVVA 4Z9CB 1X32A 1CA5A 1PXUA 4B9WA 1SSOA 1OO9B 1EY5A 3IKJA 1PRTD 4C3IG 4RGMA 1EYDA 5CC4A 3WOFA 1ET9A 3HOVB 1VCIA 3HKZB 3OMGA 2IL8A 1VMPA 3PUXA 1ESFA 2L9HA 2B2UA 2HDMA 4F7XA 1ZYRC 2B63B 1JOOA 2K5DA 3BDOA 5C6AA 2EY1A 1CQFA 2C5CA 1TIID 1L0YB 2FJ2A 1ILPA 3A8JE 4ZKBB 2ENBA 1UNSA 4R8NA 1LV9A 5NUCA 1CK1A 2RDHA 1WTRA 4FO2A 4KK7A 3X3NA 3KK7A 4IZ8A 5JEAG 2JA6B 2WAQB 1WTPA 5T1IA 2BA0A 1LTRD 3QO2A 4EVOA 2K5WA 3DWQA 5J1ZA 3J7AF 2ZT9C 1DM0B 4FF4A 5COYA 5KYLA 3GTJB 1TY2A 1BXTA 4BBSB 4FNFA 3QOLA 1I4PA 1LTSD 1SNMA 1PDQA 2NZ1D 5EKIA 1QNKA 4OO1I 5HURA 2DNEA 1UUPA 2HQEA 2PW7A 3K5NA 2K5QA 3L9AX 1Y8NB 1Q1EA 1SEBD 1U4RA 1FNUA 2G9HD 1EFID 5IGEA 1ICWA 1XYIA 3LWEA 3VR6A 4H13C 5LL6X 3PIO3 1D2BA 3D3RA 1OXUA 2R6GA 1GHKA 1IYVA 1SYGA 1PZID 1EU3A 5I2XA 2CVRA 2B2VA 3BDCA 4PNYA 1S5ED 3C46A 1JICA 2DNCA 1BF4A 1AFPA 2JYOA 5G3LF 5C3XA 5CORA 1B9NA 2B2YC 2EYJA 2RA4A 2K01A 4DU9A 2F3VA 5T1GA 2RDFA 2OEOA 1NR2A 1CI3M 1HTLD 2K7VA 3TP7A 2OXPA 1MSHA 2VXWA 1PMRA 1DONA 1RJTA 1DJRD 2QCPX 1TS2A 3MTSA 2QDBA 4DNTB 1EQVA 5IGCA 4A3EB 1HFGA 1IW7C 1YNJC 3SR1A 2VUMB 1YNJD 3S15B 4DXFA 2B2TC 3C1EA 1GUNA 1OXVA 4IUTA 1I6VC 1PFNA 1HCZA 5IT9L 4G7HC 3CRKC 3PUYA 1JWUD 1KDCA 4A3BB 2GA4B 5M3MB 4RKLA 5JOBA 3DXJC 3NWSA 4ZLTF 1NR4A 4M8AA 1GUTA 4NKLA 3K5MA 3R2TA 2ZXRA 2PQEA 3GO5A 4OHJA 1Q3LA 1STYA 4C3IB 1A3UA 5M9OA 2NN6H 3Q6SA 4IUNA 4DXGA 5IIFA 4MN3A 5FO8B 3S2DB 5I9OA 3BS1A 3NQIA 5JEAH 1EZ6A 5KNDA 4O42A 3EVQA 1STNA 3MC0B 3R3OA 2X6GA 1WTXA 2CHBD 1X3PA 1ZKOA 1IW7D 3D4RA 2E2JB 1QG7A 1F9SA 1IYUA 1ILQA 3U9OA 2D62A 4K5VA 3TP5A 3HZXA 1MD2D 1AEXA 3H0GB 1TWFB 2EDGA 4KKUA 4RHSA 1NUCA 2FINB 3HS0C 5FLXL 3RUZA 3FDTA 1F9RA 3EJIA 4ME5A 3CKIB 1U4PA 1TKWB 1LT5D 1LABA 3MXUA 1SNQA 3OWFA 4I7ZC 1M4VA 2RKSA 1WTWA 2F0VA 1I6HB 1STAA 1ZYRD 3I8ZA 1TY0A 4A3IB 4DN4M 1DOKA 1B50A 3D8GA 3JAML 1OXXK 1TVXA 4RWSC 4FF2A 2EYMA 2QKIC 2Z4IA 2MGSA 3N6RA 3GQBA 3F2UA 4B08A 4C3JB 1HXYD 1WD0A 2L5TA 1TWAB 1TWCB 2F0TA 1M8AA 1JQYD 1EQTA 3S1NB 3VR4A 2QEJC 1LTTD 4RGNA 2MP1A 4WJWA 1O7LA 2PO4A 4HSVA 2K05A 1PRTF 1SNCA 5D65A 3S2HB 2NUCA 4HTHA 1WTOA 2WINB 1R4PB 1Y1WB 1Y8OB 2F0HA 1D1IA 3NE5B 3DWPA 4RCOA 4KMUC 3MFGA 1U4MA 3A56A 1DD2A 3E6ZX 3NTIA 1EY6A 1RTNA 1CHQD 4IUUA 3KF8A 5CGKA 3GTMB 2MPMA 4KN4C 1CA6A 4FXDA 2XWBB 1SJHD 3J81L 1OXSC 2M2LA 1MGSA 1SXTA 3IAYA 4TQUS 1LLRD 4CKBA 4RHRA 1D5XC 1D6EC 4HCSA 3SXHA 4OIJA 1STEA 4MIUA 2EPBA 3CU7A 3L7ZC 3VA5A 5DEHA 3GP7A 2IX1A 5I9PA 1O7ZA 2ICEC 3TMEA 3T16A 1J8IA 1I50B 1HA6A 4JK1C 1GUOA 2YU9B 1BR9A 3OIQA 2ID0A 3MZ5A 5EBDA 5C44B 1S4ZA 2SNSA 1BO0A 4FF3A 3LX0A 4XYQA 4QUFA 4DF7A 1ONLA 5KNCA 3FPPA 1JWMD 3PMFA 5C4HA 2EYFA 2JP1A 3J81E 1HUMA 1ET6A 4DGZA 4PMCA 5CYUA 3PUZA 2A6ED 2F0QA 5ISRA 4BS9A 3TBIB 4G7OC 2F3WA 1YNND 5ELFA 1BCPB 4A3GB 3P75A 3CHBD 3OW7A 2NN6I 3NXWA 2BOSA 1S5CD 2XSCA 5EQ0A 5EPJA 5IGGA 1HFNA 5EPLA 5M5YB 4Y7NB 2L0CA 1BQQT 4K6LA 5CBEE 2KCCA 1BNZA 4JBWA 4C56C 4KY7A 3K0YA 1X3QA 3U9SA 1MI2A 4TKOB 3J80E 4B9XA 4BA2I 2YYZA 2SDFA 2F0EA 4BWGB 5EGTA 4RGTA 1K8MA 1DCZA 2RBMA 3GV3A 4ULLA 2RVLA 3WDNA 1JC7A 2C9OA 3AU7A 2NVTB 4DNRB 2BE5D 4L63B 1Q90A 4U673 1EWCA 1PRTC 1QWYA 4HCEA 2MHVA 2R3ZA 1FNVA 4XDXA 4NMZA 2CW0D 3SK8A 3K59A 1Q1BA 4RA8A 2K28A 3G6JB 2SNMA 4ZAIA 4ILWA 1SNPA 2ICIA 3VYTA 4V0BA 2NB0A 1EOTA 2E76C 1SYBA 5ELCA 1B53A 5C4XB 1O7YA 2RSNA 1DOMA 3V2TA 1PYWD 1VF7A 5C3EB 1SYEA 4BY1B 3K58A 1SYDA 1U9RA 1ESRA 5KRUA 4ZRZA 5EKKA 2JA7B 2NBFA 5KNBA 1JOKA 4XT1B 1QE6A 4DFAA 1EWHA 4XXEA 1AP0A 2KEDA 2F0OA 3QJYA 3TDQA 4HEDA 3H94A 1MSGA 5I6WA 1TS3A 4N9TA 3TSSA 3G7LA 5I2YA 2K6AA 3ND9A 3HOUB 2K33A 1UEAB 2B2YA 1LACA 1EY0A 4KY5A 5KGUA 5C0XG 1E2WA 2DN8A 1BCPD 2G9DA 2J4XA 2IWHA 4OO1G 4IUQA 4MHEA 1H9SA 3PIP3 3H91A 4UDUC 4K6DA 1TR5A 3BDLA 2K32A 2Y0SB 3AMUA 3W2DA 3GTPB 1I3QB 2JA8B 2KA7A 3SE0A 3SK6A 3TN2A 3QB3A 2Q8RE 2PYKA 3K57A 2E74C 4BA1I 1STHA 3NWTA 4KJNA 5D3IB 3HOZB 3PO3B 2EJMA 2PZUA 2F0UA 4FYDA 1JE4A 2F0PA 3R2IA 2N88A 1EY9A 1U4LA 1K8OA 1CTMA 3DMUA 4OGQC 1C8CA 2BDOA 3D4WA 1TWGB 1ENAA 5J22A 4P2CB 1RTOA 1WD1A 1KDBA 3TZDA 4IUVA 2DY8A 4EQPA 4EQOA 4ABNA 4ZKCB 1S5DD 1G2SA 4PMWA 4CBVA 1TT2A 3MEHA 1ZEQX 2F03A 1STBA 2LMCB 1EYCA 3BVMA 1HQRD 5JAVA 3NQTA 1HRJA 4F8MA 1IKLA 2F0MA 4L8JA 2F0NA 1SE3A 4XQQA 3FMCA 3SK4A 5E1FA 5C5LA 2JEBI 1HA5A 1H9RA 4A3DB 3OHXC 1V1PB 4S3SA 2EY6A 5FO7B 1DXMA 3A8KE 4IFDJ 1FR3A 3EFXD 3SVMA 5KYIA 1KLUD 1LTID 5DM63 2A6HD 1Q8IA 2F0DA 1AW7A 1D5ZC 3GTLB 3MXNA 3T51B 1S5FD 3OMCA 4X3TA 2XIWA 1B44D 1EY4A 4ODGA 1BOSA 2TSSA 4KKSA 4K2KA 3M4OB 3HOXB 1HHVA 3OWEB 1AZPA 3E5SA 2R93B 1F2LA 3TP6A 1I4QA 5A2QL 1Y69U 3DEOA 1B3AA 2IPKD 1SE2A 1NSNS 4G4KA 1B2TA 4L6TB 5JPMC 3DWAA 4K5XA 5AFWA 3BYYB 3C2PA 4KHZA 2CQAA 1R4QB 5ELBA 4FF1A 3MXPA 1ZXTA 1VMCA 1LTBD 4CJ0B 2F0FA 3HOYB 2NTTA 3D6WA 3H6MA 3FRPB 5IGDA 3MXGA 1SYCA 1Z47A 1SMYD 4FXGC 5F2DA 2KJXA 2B2UC 4A3JB 1T5XD 1RKNA 4NW2A 5ELEA 3K5OA 3J80L 2R61A 1E2VA 1LT3D 3IFDA 5CV7A 2Z1CA 3H3VC 4WORA 5IOCA 1G291 1C4QA 4N9PA 1KNEA 3NBHA 2NYZD 3KLSA 4IFDI 5CV5A 2HCIA 1A3TA 3DM1A 3N52A 3P7JA 2A69C 3V05A 2PZWA 2XNAC 5G3LD 4FXKC 2A68C 5C5MA 1R9TB 2EE1A 3HG9A 3NTHA 4OIKA 2XRQD 2K03A 2BCOA 2HDLA 1UAPA 2PCFB 3LWUA 5BN4A 5CV6A 1CQVA 4XIGS 5C4ZA 2L4NA 1FD7D 4H0LC 4NP5A 2LFNA 4DAVA 2O5IC 1F9PA 2VB2X 3HOWB 5CV4A 4QF4A 1LT4D 4J1MA 1GOZA 5C0XH 5C0XI 5DM73 1KABA 3CRLC 4IALA 3EROA 2I46A 1HUNA 2Z8LA 1B4OA 4KV6A 4AYBB 2J0TD 5J39A 2O4XA 1RHPA 2AUJD 3T13A 2EJFC 3KLRA 2PPBC 2BA1A 4EGVA 1T5EA 3S14B 3NK9A 2IT1A 5KIXA 3A7LA 3AB9A 2BE5C 1H9SB 2L1BA 2WKCA 5FOBB 4IN3A 3OOCA 1SNOA 2CW0C 2A6EC 4C3JG 2L12A 1H9JA 4KTAA 2AUKA 4HMJA 1PFBA 3M7NA 4F87A 2EYLA 4XYOA 5A2QE 3S9WA 3I90A 3CQZB 3P1HA 3BVGA 3R93A 1VF5C 3Q23A 2EYOA 1NCVA 5EBCA 2Q8TA 3FVQA 4ZQ3A 1G2TA 2IX3A 1ML0D 3IL8A 1S5BD 4FVMA 3UI2A 1QOHA 3R8BA 1O80A 4PMBA 3M85A 3Q0AA 4V190 2A5HA 2B39A 2B2TA 4G57A 3ERQA 1FGBD 4F88A 2AQ3B 3I4NB 1IKMA 1PZKD 3I4LA 1XTCD 4A93B 2KHSA 3KBXA 3S1MB 1G6ZA 3SK5A 4XT3B 1JOQA 4KN7C 3BG3A 5D14A 5CBAE 5EKLA 4Q0FA 4C1NK 1K83B 1WVLA 2EYHA 4XQJA 1Y1VB 1PTOB 2JXMB 4UAIA 4PV1C 4J6HA 2SEBD 4HMIA 1EYAA 5EPKA 4CHTB 4A3FB 1V1PA 1GXDC 2F0WA 1RDPD 3RMHA 2KCNA 3LNNA 3MAQA 2A68D 4NDXA 4EQNA 3V96A 3S1RB 3KBGA 3URYA 4DA2A 1FNWA 1CM9A 3ND8A 2Z4HA 3GTOB 2FHTA 3A8IE 5EJWA 1TS4A 2XWJB 4R8IA 1GJXA 1V43A 3TZUA 3BZDB 4BY7B 3NHHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K1B A;  1O80 A;  1PFN A;  1X3Q A;  2H1E A;  1MI2 A;  2J7Z A;  4HED A;  1G2S A;  2M2L A;  1U4P A;  1MGS A;  1PDQ A;  1MSG A;  1QNK A;  2NZ1 D;  3ONA B;  5EKI A;  1F9P A;  5AFW A;  3G7L A;  1X32 A;  1WTW A;  1SAP A;  3DEP A;  4HCS A;  2SDF A;  1CA5 A;  2X6L A;  2B2T A;  4OIJ A;  1U4R A;  1SSO A;  2BDN A;  2N55 A;  3I8Z A;  1HUN A;  3GV6 A;  4DN4 M;  1DOK A;  2B2Y A;  2EPB A;  1ICW A;  1XYI A;  1B50 A;  3LWE A;  1HRJ A;  1DZ1 A;  1ZXT A;  1VMC A;  1IKM A;  1IKL A;  1B4O A;  1TVX A;  3GV3 A;  1WTV A;  1GUW A;  4ZLT F;  1NR4 A;  4CJ0 B;  3MWY W;  4RWS C;  4CJ2 C;  1ROD A;  5JJZ A;  1O7Z A;  1RHP A;  3D6W A;  3I91 A;  3KUP A;  3KBX A;  2HCC A;  1G6Z A;  2RVL A;  2IL8 A;  1VMP A;  1EIG A;  4XT3 B;  1AP0 A;  1J8I A;  2MGS A;  2EOT A;  2L9H A;  1HA6 A;  2B2U C;  2B2V C;  4LMQ D;  5D14 A;  1Q3L A;  5CBA E;  2CVR A;  4NW2 A;  2DY7 A;  3F2U A;  2B2U A;  2B2V A;  4IUQ A;  2HDM A;  3HP3 A;  4MHE A;  4ZKC B;  5DNF A;  1E0B A;  4X3U A;  3H91 A;  1JIC A;  2X69 A;  3Q6S A;  1WD0 A;  1J9O A;  1WVL A;  1PFM A;  1S4Z A;  2K04 A;  4HAE A;  5CMD A;  3IFD A;  2R3Z A;  4MN3 A;  1BO0 A;  4XDX A;  1BF4 A;  4UAI A;  2L1B A;  4IUR A;  1M8A A;  2HUG A;  2NWG A;  4R9W A;  2JYO A;  1EQT A;  5COR A;  2B2Y C;  1XX8 A;  4QUC A;  5EPK A;  4RA8 A;  2K28 A;  4QUF A;  3SVM A;  2RA4 A;  2K01 A;  4ZAI A;  2MP1 A;  4O42 A;  2RSO A;  2FJ2 A;  1ILP A;  1SDF A;  1AZQ A;  1KNA A;  1KNE A;  5T1G A;  4HSV A;  3TN2 A;  4ZKB B;  2L12 A;  2JP1 A;  2Q8R E;  1HUM A;  4CJ1 B;  2KEE A;  2NYZ D;  2X6G A;  1WTX A;  2K05 A;  1LV9 A;  1X3P A;  5E4W C;  2HCI A;  1NR2 A;  3I3C A;  5D65 A;  1BBX C;  1NAP A;  4X3S A;  1WTO A;  1WTR A;  2KEC A;  3DM1 A;  1PFB A;  4IUP A;  4X3K A;  1EOT A;  1EIH A;  4X3T A;  2XIW A;  1WTQ A;  1HFN A;  2KOL A;  3N52 A;  2FFK B;  1B53 A;  1MSH A;  2VXW A;  1QG7 A;  3P7J A;  1RJT A;  1F9S A;  1DON A;  5E4X A;  1JE4 A;  2KUM A;  1O7Y A;  3I90 A;  1U4M A;  2RSN A;  1DOM A;  1CM9 A;  3MTS A;  1A15 A;  1WTP A;  1ILQ A;  2B2W A;  2N88 A;  3FPU B;  1HHV A;  5T1I A;  1U4L A;  3R93 A;  1G91 A;  1RTN A;  2KVM A;  1NCV A;  4IUU A;  2FHT A;  2MJ8 A;  2EE1 A;  4RAU C;  1C8C A;  1AZP A;  1ESR A;  1F2L A;  3QO2 A;  5EQ0 A;  4ZK9 B;  2FMM A;  2MPM A;  5EPJ A;  2D9U A;  5EJW A;  1IL8 A;  2B2W C;  5EPL A;  2Q8T A;  4OIK A;  1RTO A;  4R8I A;  2K03 A;  1HFG A;  2HDL A;  1WD1 A;  1CA6 A;  4U68 A;  1EL0 A;  3TZD A;  1PLF A;  1F9Q A;  4IUV A;  1G2T A;  1DOL A;  1ML0 D;  3DEO A;  2FIN B;  2DY8 A;  4XT1 B;  3IL8 A;  1B3A A;  5CBE E;  1BNZ A;  1B2T A;  5COY A;  3FDT A;  2B2T C;  1QE6 A;  2L11 A;  3UI2 A;  1F9R A;  2L4N A;  2KED A;  4IUT A; 
#chains in the Genus database with same CATH topology
 5M5W B;  2PW5 A;  1NY4 A;  1HH2 P;  3NUC A;  1B9M A;  3SEB A;  4KD4 A;  5DAU A;  4K8I A;  2I07 B;  2EXD A;  3FKI H;  4QJF A;  1IBM Q;  1ENC A;  5ELO A;  1Z6H A;  4C2M B;  2UXD L;  3JAM E;  1V8Q A;  4DR2 Q;  4QB4 A;  3S16 B;  3QG1 A;  4PG3 A;  3NSW A;  5ELD A;  3S1Q B;  2UU9 L;  1HNW L;  1LO5 D;  2K5H A;  3Q22 A;  3B6Y A;  1XWE A;  3MWY W;  3T1H Q;  1SMY C;  3HRZ C;  3KUP A;  4A93 G;  3FKI B;  4IPD A;  5A35 A;  4GKK L;  3ZYY X;  1A6X A;  1EIF A;  5KEE A;  4O1N A;  2JE6 I;  1KD1 C;  5JVH 3;  2DY7 A;  2AWO A;  1M1K C;  2ZTD A;  1EY7 A;  2FXQ A;  1CFM A;  1E0B A;  1L0W A;  3F2B A;  5LHY 1;  5I4D A;  1X6O A;  1B7Y B;  2M00 A;  1PFM A;  1GUG A;  4TSS A;  3GD7 A;  2E2H H;  2IW3 A;  1Y1V H;  2QA4 A;  1RF2 D;  4IUR A;  1I4X A;  4A3K G;  1E2Z A;  1JB3 A;  4NPS A;  1EEF D;  3PIO A;  4KI0 A;  4N8F A;  1Y14 B;  3G48 A;  1B3Q A;  1H9M A;  1B1Z A;  4RGO S;  5GAH C;  5HGT A;  2H4O A;  1O78 A;  5IOD A;  5CV8 A;  4JI6 L;  5TSS A;  1IXR A;  3T56 B;  1KRT A;  4A3M B;  3I3C A;  1AN8 A;  4ZUJ A;  1GHJ A;  1SBB B;  3UE1 A;  4J15 A;  4X3S A;  1BBX C;  1AE3 A;  4IUP A;  1VS0 A;  1X9N A;  4H44 C;  5K36 G;  2PNR C;  1YHA A;  4C1N I;  3RZO B;  2A74 C;  1F2Z A;  4PZ8 A;  2XRS D;  4IQZ A;  2CWP A;  1ASZ A;  2NN6 G;  3HOX G;  5GRO A;  2B2W A;  3FP9 A;  3FPU B;  1YIJ A;  4A3M H;  4LJZ C;  1UE1 A;  3J81 j;  1SRU A;  2VUM G;  4JI4 Q;  4B3R Q;  1II3 A;  4MTN A;  1L1O C;  4A3K B;  1KLG D;  1N32 L;  1CKN B;  1WYD A;  2R7F A;  3EIV A;  4U68 A;  1SYF A;  2AQ1 B;  1KAA A;  1PLF A;  1DOL A;  1GUW A;  4LFB L;  2JA5 B;  2L11 A;  3HOX H;  2K1B A;  3C3L A;  1AZQ A;  4QIW B;  2R93 H;  1S3O A;  1K3R A;  2TMP A;  1PTO H;  3MFY A;  2R92 B;  3GTM H;  2F0J A;  2N8N A;  1F77 A;  3A7A B;  2X6L A;  1G8Z D;  2N55 A;  5BR8 L;  4WFN 3;  1LYL A;  2QW7 A;  2L55 A;  1GO3 E;  4GNX C;  1WTV A;  4RFB A;  3CCV A;  4DAM A;  3BYT B;  2HCC A;  1W6K A;  2E2H B;  3KJO A;  1GUS A;  3QIA A;  5LL6 S;  3VA7 A;  1EIG A;  1SJE D;  3D0F A;  1VQ7 A;  2PMZ B;  1Y8P B;  4IFD G;  1TS5 A;  1Q86 C;  2EOT A;  1K8A C;  2RHQ B;  3QR8 A;  4QIW E;  4UHV A;  1N36 Q;  2B8G A;  3BJU A;  2YTY A;  3A54 A;  2K04 A;  1I4G A;  1C48 A;  5IT9 E;  5FK9 C;  1IYJ B;  2XN9 C;  2CKZ B;  4E6I A;  1JR0 D;  5CV9 A;  3M9B A;  2F0K A;  2R7Z B;  4A3B H;  2WKD A;  2EY5 A;  3T4A C;  4JI5 Q;  1STG A;  2N78 A;  3SHL A;  3UDX A;  4AH6 A;  2YTX A;  2JEA I;  4HR7 B;  5C3W A;  1XTD A;  3H09 A;  2PZT A;  2F0G A;  4KHV A;  4JV5 L;  1V9P A;  5J3B A;  3J7Y W;  1WTQ A;  4A3B G;  2FFK B;  1HTP A;  1E3P A;  3WOE A;  1VQF A;  2JSO A;  3RLO A;  4BBR B;  2EY2 A;  5GQO A;  4HIO A;  2R92 G;  3A55 A;  2UUB L;  3RN2 A;  3PO2 H;  1V1Q A;  2ZJR A;  3GDE A;  2RDG A;  3D4D A;  3E0J A;  2N3S A;  2JA6 G;  1PTO F;  4A76 A;  2D9U A;  2B2W C;  2E75 C;  3I72 A;  4G7Z C;  1EL0 A;  2V1C C;  1E24 A;  4DV2 Q;  1F9Q A;  5BN5 A;  1EIY B;  2MUY A;  3X3M A;  5C0X J;  1CHP D;  4IOA A;  4IFD H;  1EY8 A;  4CKC A;  1LT6 D;  1VQD A;  1EEI D;  5C4J B;  4LFA Q;  4NXM L;  2H1E A;  1JCK B;  2CQO A;  2R7D A;  2CWA A;  4DR7 Q;  2UXD Q;  2NVX B;  1D1K A;  4H02 A;  2EJG C;  2K14 A;  1JJG A;  2OTL A;  1SAP A;  3DEP A;  2K52 A;  1I50 H;  3OIP A;  5FLX E;  2A73 B;  4ZYS A;  3C1F A;  2A6H C;  1TWH B;  3I70 A;  1YJW A;  4M1U B;  1Q12 A;  4OWT B;  4A93 H;  4DAP A;  2ZM6 L;  4OL7 A;  2NVY B;  1F2Y A;  1KTK A;  2VQE L;  1PZJ D;  3GTG H;  2Q8I B;  4DV5 L;  2E2I B;  5IY0 A;  1SND A;  1TU2 B;  2V4D A;  4UPA A;  4DK6 C;  1K0S A;  4LMQ D;  3PGZ A;  4K8J A;  2LS0 1;  4C3H B;  1YNX A;  3HP3 A;  5IWA Q;  1JJC B;  1IBK L;  4IJH A;  3D31 A;  1J9O A;  3AFP A;  1C9O A;  4K5W A;  2XVS A;  4HAE A;  4ZUI A;  3P20 A;  3EA6 A;  3VR5 A;  1CZW A;  3I4M B;  3T53 B;  3CPF A;  2NZH A;  1XMO L;  1XX8 A;  4OEM B;  4QCL A;  3NP8 A;  4DV6 Q;  5E3F A;  2RSO A;  2F1M A;  5BN3 A;  2D2C C;  1C0A A;  2MNA A;  3VR3 A;  1Z7T A;  4K14 A;  1NJI C;  5E4W C;  3IFT A;  1NAP A;  5M5Y H;  2HD3 A;  2KEC A;  2F4I A;  1A3V A;  4X3K A;  1EIH A;  5M3F G;  5FO9 B;  1QVF A;  1Y1W H;  3ITP A;  4JI0 Q;  1FYC A;  2K5N A;  4H7B A;  1VQJ A;  2E5L Q;  5JJI A;  2D0O A;  1H9K A;  2IHF A;  3OSO A;  3M3Y B;  2UU9 Q;  2EZV A;  4BY7 H;  3OPO A;  1G91 A;  4LW1 A;  2KVM A;  1WCM B;  2MJ8 A;  4LFB Q;  4DK0 A;  4LUZ A;  2FMM A;  1BDO A;  2EXZ A;  2I0Q A;  2WII B;  1P16 A;  3NTK A;  3S1N H;  3I4N G;  3RZD B;  3VR2 A;  4UP7 A;  5C3E G;  2KCM A;  2F4V L;  5FKA C;  4GZY C;  2YV5 A;  3DUZ A;  2KHI A;  1A2U A;  4KD3 A;  4QUC A;  2WFW A;  2HHH Q;  3MHB A;  2NTS A;  3ONA B;  3J80 c;  1QNU A;  1U5K A;  3GTG B;  3F2C A;  3BVZ A;  1RCV D;  5IT9 c;  5K36 H;  4FP5 D;  4LAA A;  3U4V A;  4X64 L;  4RG1 A;  3UE0 A;  5IGB A;  3QWN A;  1CSP A;  2F0L A;  4XQN A;  2VUM H;  4O0A A;  5FLX c;  3GV6 A;  4HIM A;  2Z6K C;  1HR0 W;  1YZ6 A;  3DHQ A;  2A8V A;  1DZ1 A;  1BBU A;  2HIV A;  3VYU A;  2M9V A;  4HN7 A;  3O13 A;  4JI6 Q;  3PO2 B;  1OXT A;  2ES2 A;  4CGY B;  1ROD A;  4GOP A;  3RLF A;  3FEW X;  3GTL H;  1FL0 A;  3NEM A;  1JMC A;  1MBY A;  2A69 D;  2EVB A;  3QOJ A;  4GKJ Q;  1I4H A;  5FLM H;  1TQO A;  1I6H H;  5IE8 A;  2K4K A;  1BVS A;  1JOR A;  3HEJ A;  3S14 H;  1YHQ A;  4A3C H;  1SFO B;  1SRO A;  4X3U A;  4ID6 A;  4A3F H;  3K5L A;  3S1M H;  1BCP C;  3RD4 A;  3Q24 A;  5GAE C;  4LF6 Q;  1WFQ A;  3K6O A;  2HUG A;  4R9W A;  3HGB A;  2F0I A;  1JWS D;  2WB1 B;  2CCZ A;  1QB5 D;  1LTA D;  4DV3 L;  1HNX L;  2LKV A;  3CQZ H;  4DK1 A;  1A63 A;  1SE4 A;  4WRD A;  3GTK B;  2WV6 D;  1L0X B;  1EU4 A;  5ELN A;  4LF4 L;  1KL9 A;  1PH3 A;  1YVC A;  1X3G A;  5IYD G;  2FMC A;  3VYR A;  2UUC Q;  2ZXP A;  1I94 L;  3KLS X;  3D6C A;  4P73 A;  1HPC A;  2KUM A;  2QF7 A;  1QIL A;  2AWN A;  4DR4 L;  1VQL A;  2NVY H;  4ZK9 B;  1XXG A;  2OT2 A;  3NBI A;  1V1O A;  3EQL C;  1L2F A;  3CCM A;  1GKH A;  4OO1 H;  4C3H G;  3FHW A;  1CT1 D;  3NEL A;  4J8Q A;  5EAY A;  4A3I H;  3PUW A;  4BBS H;  5D3D A;  3GTQ B;  2GN5 A;  3TEH B;  5FJ8 H;  5JEA J;  3J7A V;  2UUA Q;  2J7Z A;  1BUV T;  4HSP A;  1YBY A;  3T1Y Q;  1IHZ A;  1KDA A;  1GM5 A;  1UE5 A;  3W1G A;  3HOV H;  1YNN C;  3HOY H;  1PRT B;  1ICF B;  1X55 A;  4Q5V A;  3K7A B;  1DYQ A;  4RH6 A;  1VQM A;  1QJO A;  1W6J A;  2SOB A;  2BDN A;  1JT8 A;  1XNR Q;  2LY7 A;  2ZM6 Q;  4QMG A;  2OF1 A;  2ZXO A;  5M3M H;  5M5W H;  2WAC A;  2QIL A;  5M5X B;  3TP8 A;  4CJ2 C;  2HQL A;  5JJZ A;  4JI0 L;  2JQO A;  3I91 A;  3HFZ B;  2WP8 J;  2RQX A;  4DR2 L;  3TS2 A;  4YWK A;  4Y7N H;  1PH5 A;  1QCB D;  2O2L D;  4LF9 L;  1QZH A;  2B2V C;  2F0S A;  4DV7 Q;  4LK1 C;  4KY6 A;  1NE3 A;  2AQ2 B;  3HKZ E;  4KJO A;  1RD9 D;  5DNF A;  2BH8 A;  4RCN A;  2X69 A;  1D5M C;  5CMD A;  1I4R A;  3A5Z B;  4I65 A;  4WJ4 A;  3RNU A;  2RHS B;  2NWG A;  3S17 B;  1PTO C;  2DGY A;  5BR8 Q;  1VQ4 A;  4DAY A;  1PH2 A;  1PTO D;  2VNU D;  1F2M A;  3TRZ A;  4GN4 B;  4ZCK A;  4LF5 Q;  1SDF A;  3H15 A;  1KNA A;  4DV1 Q;  1EQQ A;  4DUZ L;  1VDZ A;  4CJ1 B;  3L3O C;  1EZ8 A;  2B8F A;  2KEE A;  4K2L A;  4XTC S;  3S2D H;  3M4O H;  3VYS A;  3OTO L;  5DLQ E;  5M3F B;  4RKB A;  5I6Y A;  2VB3 X;  2BH2 A;  1EYG A;  3NPP A;  4B3S Q;  3E9H A;  1CZG A;  1W2B A;  2EYP A;  2KOL A;  2O5J C;  3OYY A;  1A2T A;  3M4Y A;  1SLJ A;  1LTG D;  2UXB L;  3PUV A;  5E4X A;  1NTG A;  1HQM C;  4BY7 G;  1A15 A;  5K5P A;  2D5D A;  1BCP F;  5IGF A;  1ENF A;  2NVQ B;  3F8T A;  4KKT A;  3CME A;  2E2D C;  4AQY L;  4RAU C;  4TRD A;  5JPN C;  1U0L A;  5CR3 A;  3MA2 B;  2IJ0 A;  1IL8 A;  4CKE A;  3W3A A;  1Y1V G;  1TWF H;  5JVG 3;  1UE6 A;  2KQ3 A;  2IX0 A;  3I73 A;  3M7G A;  3I4O A;  4PQX A;  4YIJ A;  3SDZ A;  3KF6 A;  3PV0 A;  3MVV A;  3A5U A;  4GLX A;  3ULJ A;  3ICE A;  4DR3 Q;  3BZK A;  4Z9C B;  1Y1W G;  1X32 A;  5JJL A;  1CA5 A;  1PXU A;  1X54 A;  4B9W A;  1SSO A;  1OO9 B;  1EY5 A;  1LTL A;  3IKJ A;  4YHH L;  1PH1 A;  1PRT D;  4C3I G;  4RGM A;  1EYD A;  5CC4 A;  4C3J H;  3WOF A;  1ET9 A;  5C3E H;  3HOV B;  1VCI A;  3HKZ B;  3OMG A;  4A3E G;  2IL8 A;  1VMP A;  3PUX A;  4B3T L;  1ESF A;  4X62 Q;  4X6A H;  1QZG A;  4HJ8 A;  1BKB A;  2L9H A;  4C3I H;  2WB1 G;  1SR3 A;  4JBK A;  1HNZ L;  1J6Q A;  2B2U A;  2HDM A;  4F7X A;  3G4S A;  1ZYR C;  2B63 B;  1FJG Q;  1JOO A;  2K5D A;  3BDO A;  5C6A A;  2EY1 A;  1HZ9 A;  1CQF A;  2C5C A;  1TII D;  3T1Y L;  1L0Y B;  4DR4 Q;  2FJ2 A;  1ILP A;  4B3M L;  1N9W A;  3A8J E;  4ZKB B;  2ENB A;  4NB3 A;  1UNS A;  4R8N A;  1LV9 A;  3GTK H;  5NUC A;  1CK1 A;  4JG2 A;  2RDH A;  1JB7 A;  1WTR A;  4FO2 A;  4KK7 A;  3X3N A;  3KK7 A;  4IZ8 A;  5JEA G;  2JA6 B;  3S15 H;  4DKA C;  4MNO A;  3RZD H;  3KF8 B;  2WAQ B;  4HJ9 A;  1PV4 A;  1WTP A;  1Q46 A;  4LF9 Q;  2Z9H A;  5T1I A;  4R4T A;  5LMU L;  2BA0 A;  3G6E A;  1LTR D;  1XNR L;  1LUZ A;  2MQH A;  3QO2 A;  4EVO A;  2K5W A;  3DWQ A;  1XMO Q;  5J1Z A;  3K80 C;  3J7A F;  2ZT9 C;  1DM0 B;  2DJG C;  3PIP A;  4FF4 A;  4TVA B;  5COY A;  5KYL A;  3GTJ B;  1TY2 A;  1BXT A;  1VQ9 A;  3GTQ H;  4BBS B;  4FNF A;  3QOL A;  1I4P A;  1LTS D;  1SNM A;  1PDQ A;  2DJF C;  2NZ1 D;  1QNK A;  5EKI A;  3STB C;  3HOY G;  4OO1 I;  2RCF A;  1YHB A;  5HUR A;  2DNE A;  4L5R C;  1UUP A;  2HQE A;  2PW7 A;  3K5N A;  2K5Q A;  4X64 Q;  2JA7 G;  3L9A X;  4JOI A;  1Y8N B;  1Q1E A;  1SEB D;  1PFS A;  1U4R A;  1FNU A;  2G9H D;  1NMG A;  3GTJ H;  1EFI D;  5IGE A;  1ICW A;  3KYH C;  1XYI A;  3I55 A;  3LWE A;  3VR6 A;  4H13 C;  5LL6 X;  3PIO 3;  1YJN A;  4C3H H;  1D2B A;  4LUV A;  3D3R A;  1OXU A;  2R6G A;  1PYS B;  1GHK A;  2GVA A;  1IYV A;  1SYG A;  1PZI D;  3TQY A;  1EU3 A;  5I2X A;  2CVR A;  1J5E Q;  3OTO Q;  2B2V A;  3BDC A;  4PNY A;  1S5E D;  3C46 A;  1JIC A;  4JI8 Q;  2DNC A;  1HNW Q;  4I7A A;  1BF4 A;  4HJ5 A;  2PQA B;  4GKK Q;  2G5D A;  1AFP A;  2JYO A;  5G3L F;  1NMF A;  5COR A;  5C3X A;  1B9N A;  2B2Y C;  4R4O A;  2EYJ A;  2RA4 A;  2K01 A;  1LM0 A;  4DV0 L;  4DU9 A;  2F3V A;  1PA6 A;  4DUY Q;  5T1G A;  2RDF A;  4YCU A;  2OEO A;  2PI2 E;  5C4X G;  4KHP Q;  4GLV B;  2JJQ A;  4HID A;  4JI3 Q;  1NR2 A;  5M3F H;  3E9I A;  1CI3 M;  1HTL D;  2K7V A;  3TP7 A;  2OXP A;  1MSH A;  2VXW A;  1PMR A;  1DON A;  1RJT A;  1DJR D;  2QCP X;  1TS2 A;  3MTS A;  5C4J H;  2QDB A;  1A62 A;  4AYB E;  4DNT B;  1EQV A;  5IGC A;  5IP9 H;  3HKZ G;  4A3E B;  1UE7 A;  1HFG A;  1IW7 C;  1YEZ A;  1YNJ C;  3SR1 A;  4IPC A;  2VUM B;  1YNJ D;  3S15 B;  2PQA A;  4DR3 L;  4DXF A;  2B2T C;  3C1E A;  1GUN A;  4DR5 Q;  1OXV A;  3PCO B;  2UUA L;  4IUT A;  1I6V C;  1PFN A;  1HCZ A;  5IT9 L;  4G7H C;  4X65 L;  3CCU A;  3H3V H;  1OTC A;  3CRK C;  4YHH Q;  4YWL A;  1B70 B;  2H5X A;  3PUY A;  1JWU D;  4IO9 A;  1Q7Y C;  4LF7 L;  3CCJ A;  1KDC A;  4A3B B;  2GA4 B;  5M3M B;  4RKL A;  5JOB A;  2VL6 A;  2QDL A;  3DXJ C;  1PH4 A;  1R9T H;  3NWS A;  4ZLT F;  1NR4 A;  4M8A A;  1MJC A;  4IJL A;  1HJP A;  1GUT A;  4NKL A;  2KHJ A;  2ALY B;  2E8G A;  3KJP A;  3WWV A;  3K5M A;  3R2T A;  2ZXR A;  1A8V A;  2PQE A;  3GO5 A;  4OHJ A;  1Q3L A;  1STY A;  4C3I B;  4PZ7 A;  1A3U A;  5M9O A;  2NN6 H;  3S1Q H;  2N49 A;  3GTP H;  5IYB G;  2PNH A;  3Q6S A;  4IUN A;  4DPG A;  4DXG A;  5IIF A;  2I5M X;  4MN3 A;  1TWC H;  5FO8 B;  1IL2 A;  3S2D B;  2P5Z X;  5I9O A;  1GD7 A;  3TS0 A;  1E7Z A;  3FKI G;  3BS1 A;  3NQI A;  5JEA H;  1EZ6 A;  5KND A;  3BU2 A;  4DR1 Q;  4O42 A;  3HOZ G;  3PO3 G;  3EVQ A;  1STN A;  3MC0 B;  2E5L L;  3R3O A;  2OWO A;  2X6G A;  1WTX A;  2CHB D;  1QVC A;  1X3P A;  1ZKO A;  4UP8 A;  4DV6 L;  1IW7 D;  2JA8 G;  3D4R A;  2E2J B;  2F3I A;  2JK8 A;  1VQ8 A;  1QG7 A;  1F9S A;  1TWH H;  1DGS A;  1E22 A;  1IYU A;  3AQQ A;  1HR0 Q;  1ILQ A;  1BBW A;  3U9O A;  2D62 A;  4K5V A;  3TP5 A;  4GNX B;  3HZX A;  1MD2 D;  4RMF A;  1AEX A;  3H0G B;  1TWF B;  2Z6K A;  2EDG A;  4KKU A;  4RHS A;  3KF6 B;  1NUC A;  1MKH A;  1CUK A;  1X3E A;  2FIN B;  3HS0 C;  5FLX L;  3RUZ A;  3T1H L;  3FDT A;  1I5F A;  3CP0 A;  1F9R A;  3ER0 A;  3EJI A;  4OX9 L;  4ME5 A;  3CKI B;  5C44 H;  1HR0 L;  1U4P A;  1TKW B;  1LT5 D;  1LAB A;  3MXU A;  1SNQ A;  3OWF A;  4I7Z C;  1TWG H;  3H0G H;  2JA7 H;  1M4V A;  2RKS A;  1WTW A;  2AMC B;  4P74 A;  2F0V A;  1I6H B;  1STA A;  1ZYR D;  3I8Z A;  3PQI A;  1TY0 A;  2JA5 G;  3I2Z A;  4A3I B;  1D7Q A;  4DN4 M;  1DOK A;  1B50 A;  3D8G A;  3JAM L;  1OXX K;  4A3F G;  1TVX A;  3K0X A;  3KDF B;  4RWS C;  4FF2 A;  2EYM A;  2QKI C;  1K3B C;  1XMQ L;  2Q2T A;  2Z4I A;  2MGS A;  3SGI A;  1XPO A;  3H3V I;  3N6R A;  1XNQ Q;  3GQB A;  4YWM A;  3F2U A;  4KHP L;  4A3C G;  3K7U C;  4X66 L;  3S16 H;  1EQR A;  4JBJ A;  4B08 A;  4C3J B;  1HXY D;  5LMU Q;  1WD0 A;  3PF5 A;  3ERS X;  2UUB Q;  4GOP C;  2L5T A;  4IOC A;  1TWA B;  2RF4 A;  1TWC B;  2F0T A;  1M8A A;  2XGT A;  3RN5 A;  1JQY D;  1AE2 A;  2Y0S G;  1EQT A;  3S1N B;  3VR4 A;  2QEJ C;  1LTT D;  4RGN A;  2MP1 A;  4WJW A;  1O7L A;  1VQC A;  4JI4 L;  4B3R L;  2PO4 A;  4B3M Q;  4HSV A;  4A3G H;  4R1J A;  4LFA L;  2K05 A;  2B63 H;  1PRT F;  1SNC A;  5D65 A;  3S2H B;  2NUC A;  2LXJ A;  4HTH A;  3U4Z A;  5C44 G;  1WTO A;  2WIN B;  1R4P B;  1Y1W B;  1Y8O B;  4BXX H;  2F0H A;  1D1I A;  3NE5 B;  3DWP A;  4RCO A;  3STB D;  5IYC H;  4HIK A;  4KMU C;  3MFG A;  1WJJ A;  1U4M A;  3A56 A;  1X56 A;  2LSS A;  4QQB X;  1DD2 A;  3E6Z X;  3NTI A;  1EY6 A;  1RTN A;  2Q2U A;  1CHQ D;  4IUU A;  3KF8 A;  5CGK A;  2WAQ E;  3GTM B;  2MPM A;  4KN4 C;  1CA6 A;  4FXD A;  2XWB B;  4DNI A;  1SJH D;  2Q2H A;  3J81 L;  4NXM Q;  3A0J A;  1OXS C;  4JCV E;  2M2L A;  2VS1 A;  1MGS A;  1SXT A;  3IAY A;  4TQU S;  4GLA C;  2VQF Q;  1LLR D;  4JW0 A;  4CKB A;  4RHR A;  3CMA A;  1D5X C;  2C35 B;  4A3K H;  1D6E C;  4HCS A;  3SXH A;  1CKM A;  4OIJ A;  2RCN A;  1STE A;  4MIU A;  2EPB A;  3CU7 A;  2VY3 A;  3L7Z C;  3VA5 A;  5DEH A;  4IPG A;  3GP7 A;  2IX1 A;  3I56 A;  5I9P A;  3CF5 A;  4P71 A;  4BY1 H;  1O7Z A;  4OWW B;  2ICE C;  3TME A;  3T16 A;  1J8I A;  1S40 A;  1I50 B;  1HA6 A;  2ZJQ A;  3CPW A;  1IBL Q;  4JK1 C;  1GUO A;  4JYA Q;  2YU9 B;  1BR9 A;  2MO0 A;  1N32 Q;  3AFQ A;  3CCL A;  3OIQ A;  2ID0 A;  3MZ5 A;  5EBD A;  5C44 B;  1S4Z A;  2JA9 A;  2IY5 B;  2SNS A;  1BO0 A;  1NBW A;  4NXN Q;  4FF3 A;  4A3J H;  3LX0 A;  4GKJ L;  4XYQ A;  3UDF A;  1FJG L;  4QUF A;  4DF7 A;  1ONL A;  5KNC A;  2CFM A;  3FPP A;  1JWM D;  3PMF A;  5C4H A;  2F4V Q;  2EYF A;  2JP1 A;  3J81 E;  1HUM A;  1ET6 A;  4DGZ A;  4YY3 Q;  4PMC A;  1WOC A;  5CYU A;  3PUZ A;  2A6E D;  2F0Q A;  5ISR A;  3KOJ A;  4BS9 A;  2DUD A;  3TBI B;  3HOU H;  1RL2 A;  4G7O C;  2F3W A;  3DM3 A;  2VQE Q;  4CDE C;  1YNN D;  5ELF A;  1JE5 A;  3M3Y H;  1BCP B;  4A3G B;  3P75 A;  2F52 A;  3CHB D;  3OW7 A;  2CH4 W;  4JI1 L;  2NN6 I;  4JI5 L;  3NXW A;  2BOS A;  4CDC C;  2VW9 A;  1S5C D;  1K9M C;  5JJK A;  2XSC A;  5EQ0 A;  1VQP A;  5EPJ A;  4X66 Q;  5IGG A;  3CC4 A;  2UXB Q;  1HFN A;  5EPL A;  5M5Y B;  4Y7N B;  2L0C A;  1BQQ T;  4K6L A;  3CCQ A;  2KCC A;  5CBE E;  1BNZ A;  4LF8 Q;  2ATW A;  4JBW A;  4C56 C;  4DR6 L;  4DV0 Q;  4KY7 A;  3K0Y A;  3J7Z C;  1X3Q A;  3U9S A;  1MI2 A;  4TKO B;  3EBE A;  3J80 E;  1Q82 C;  4B9X A;  4BA2 I;  2YYZ A;  5IYD H;  2SDF A;  2F0E A;  4JC0 A;  4BWG B;  4JV5 Q;  5EGT A;  4RGT A;  1K8M A;  4HJA A;  4ALP A;  1DCZ A;  1EFW A;  2RBM A;  3GV3 A;  1PH9 A;  4P75 A;  4ULL A;  2RVL A;  3WDN A;  1JC7 A;  2C9O A;  3AU7 A;  4KLK A;  2NVT B;  4DNR B;  1EUJ A;  2BE5 D;  4L63 B;  1VQK A;  1Q90 A;  4A3I G;  3E0E A;  1SMX A;  2NZO A;  4GS3 A;  4U67 3;  1EWC A;  1SFO H;  3HOU G;  1HZC A;  1PRT C;  4X65 Q;  1W3S A;  1QWY A;  1UEB A;  4HCE A;  2MHV A;  2B63 G;  2R3Z A;  1FNV A;  4XDX A;  4NMZ A;  2CW0 D;  3J81 c;  3SK8 A;  4POF A;  3K59 A;  1Q1B A;  3JAM c;  4GN5 A;  1G6P A;  1L1O B;  4RA8 A;  2K28 A;  3G6J B;  4DV3 Q;  2SNM A;  4ZAI A;  1HNX Q;  4R4Q A;  5C4X H;  3J81 i;  4A3G G;  4ILW A;  1SNP A;  3CAM A;  4N8X 1;  2ICI A;  3VYT A;  4LUO A;  3HOV G;  2ASB A;  2Z6B A;  4V0B A;  2NB0 A;  1EOT A;  2E76 C;  1SYB A;  5ELC A;  3RZO H;  1B53 A;  5C4X B;  1D8L A;  1N34 L;  1O7Y A;  2RSN A;  1DOM A;  3V2T A;  4APV A;  1PYW D;  4LF5 L;  1VF7 A;  5C3E B;  1SYE A;  4BY1 B;  3K58 A;  1SYD A;  1U9R A;  1ESR A;  2ZTC A;  3Q8D A;  2I5L X;  5KRU A;  4ZRZ A;  5EKK A;  2JA7 B;  2NBF A;  4OEL B;  3AEV A;  1K0R A;  5KNB A;  1JOK A;  4XT1 B;  3UDI A;  1HZA A;  2VQF L;  4QY7 A;  2R7Z G;  1QE6 A;  4DFA A;  1EWH A;  4XXE A;  1AP0 A;  2KED A;  2F0O A;  3VDY A;  3QJY A;  3TDQ A;  4AIM A;  4HED A;  3H94 A;  1MSG A;  1QUQ A;  5I6W A;  1TS3 A;  4N9T A;  3TSS A;  3G7L A;  4BXX G;  1G51 A;  4JYA L;  5I2Y A;  2K6A A;  1MIU A;  3ND9 A;  3HOU B;  4UP9 A;  4A3L G;  2K33 A;  1UEA B;  2R7Z H;  1Q8K A;  1K8G A;  2B2Y A;  1LAC A;  4L5T A;  2Z0S A;  3HOW H;  1EY0 A;  2PI2 A;  4KY5 A;  5KGU A;  4DV5 Q;  5C0X G;  1E2W A;  4LWC A;  2DN8 A;  1H95 A;  1WTH A;  1BCP D;  2G9D A;  2J4X A;  2IWH A;  4OO1 G;  4IUQ A;  4MHE A;  1H9S A;  4DR7 L;  3PIP 3;  3H91 A;  4UDU C;  4K6D A;  3E3X A;  1TR5 A;  3BDL A;  4DR6 Q;  2K32 A;  2Y0S B;  3CCS A;  4YY3 L;  3AMU A;  5IYC G;  3W2D A;  4JVZ A;  3GTP B;  1I3Q B;  1HNZ Q;  2JA8 B;  2KA7 A;  2OQ0 A;  3SE0 A;  3SK6 A;  3TN2 A;  3QB3 A;  2Q8R E;  2PYK A;  3K57 A;  2L15 A;  2E74 C;  4QL5 A;  4BA1 I;  3MXN B;  1KRS A;  1STH A;  3NWT A;  4KJN A;  5GAG C;  1XPU A;  2A19 A;  5D3I B;  3HOZ B;  1XMQ Q;  3PO3 B;  2EJM A;  2PZU A;  2F0U A;  3S17 H;  4LF6 L;  4O2D A;  4FYD A;  1JE4 A;  4A3J G;  2F0P A;  3R2I A;  3ULP A;  2N88 A;  1EY9 A;  1PH6 A;  1U4L A;  1K8O A;  1CTM A;  2YTV A;  3DMU A;  4OGQ C;  4HJ7 A;  4A3M G;  1C8C A;  4R4I A;  2BDO A;  3D4W A;  4DV4 Q;  1TWG B;  1ENA A;  4OWX B;  5J22 A;  2D0P A;  5AJ3 L;  3TRE A;  4P2C B;  5FLM G;  1RTO A;  2MFI A;  1WD1 A;  1KDB A;  3TZD A;  4IUV A;  2DY8 A;  4C2M H;  3I4N H;  4EQP A;  3S1R H;  2HT1 A;  4EQO A;  1FVI A;  4ABN A;  2K5V A;  3DLL A;  4ZKC B;  1S5D D;  4JI2 L;  1G2S A;  2NVX H;  4PMW A;  1VQE A;  1M90 C;  4DV4 L;  4NXN L;  4CBV A;  1TT2 A;  3MEH A;  4JPB W;  4A4I A;  4OON A;  1RIP A;  1ZEQ X;  1STB A;  3BZC A;  2F03 A;  2LMC B;  1EYC A;  4LF4 Q;  3HKS A;  3BVM A;  1PH7 A;  3A74 A;  1HQR D;  5JAV A;  3NQT A;  1HRJ A;  4F8M A;  4CDD C;  1IKL A;  4JOI C;  3KLW A;  2F0M A;  4L8J A;  2F0N A;  2R93 G;  1I94 Q;  1SE3 A;  4LF7 Q;  1XJV A;  4XQQ A;  4X62 L;  3FMC A;  3L0O A;  3SK4 A;  2WAQ G;  2ZTE A;  5E1F A;  5C5L A;  1EOV A;  2JEB I;  3KFU A;  1HA5 A;  4AYB G;  4JI1 Q;  3IRB A;  4DR1 L;  3K8A A;  1H9R A;  4A3D B;  1QUQ B;  4OXP A;  3OHX C;  1V1P B;  3U50 C;  3F1Z A;  1VQI A;  4S3S A;  2EY6 A;  3EN2 A;  5FO7 B;  1DXM A;  3I4M H;  4BBS G;  1P8L A;  3A8K E;  4IFD J;  4LFC L;  1FR3 A;  3EFX D;  3SVM A;  4Y52 H;  4JI7 L;  1VQ6 A;  5KYI A;  1KLU D;  1LTI D;  5DM6 3;  2NVQ H;  1IZ6 A;  2A6H D;  1Q8I A;  2F0D A;  1AW7 A;  1D5Z C;  3GTL B;  3ZJY C;  5IYB H;  3MXN A;  3T51 B;  1S5F D;  3OMC A;  4X3T A;  2XIW A;  1B44 D;  1EY4 A;  4ODG A;  1BOS A;  1CKN A;  2TSS A;  4CDF C;  1CSQ A;  1Q81 C;  1KIX A;  3AYH B;  4KKS A;  1IBL L;  4K2K A;  1PH8 A;  1UWV A;  3M4O B;  3HOX B;  5GAD C;  1HHV A;  4A3D G;  3PSI A;  3OWE B;  1AZP A;  3E5S A;  2R93 B;  1F2L A;  3F2D A;  3J7A 5;  3TP6 A;  1I4Q A;  2NVT H;  3JC6 6;  5A2Q L;  1Y69 U;  3DEO A;  4K0K L;  1B3A A;  2IPK D;  1SE2 A;  1NSN S;  4G4K A;  1B2T A;  3CXC A;  2QEX A;  1I3Q H;  4JBM A;  2JA8 H;  3GTO H;  4L6T B;  5JPM C;  5IP7 G;  3DWA A;  1WCM G;  4EX5 A;  4K5X A;  1N33 Q;  5AFW A;  3BYY B;  1IBM L;  5LMN L;  3K7A H;  2HIX A;  1PYB A;  2JA5 H;  3C2P A;  1K28 A;  4KHZ A;  2GVB A;  2YU9 H;  2CQA A;  1R4Q B;  5ELB A;  2KEN A;  4FF1 A;  3MXP A;  1ZXT A;  1VMC A;  4YCV A;  1LTB D;  4MZ9 A;  1XNQ L;  5M3M G;  4CJ0 B;  1MHW C;  2F0F A;  3HOY B;  2NTT A;  3D6W A;  3H6M A;  1EWI A;  3FRP B;  5IGD A;  1A0I A;  3MXG A;  1SYC A;  1SN8 A;  2KCT A;  3W5O A;  1Z47 A;  1SMY D;  4FXG C;  5F2D A;  2E2J H;  2KJX A;  2B2U C;  4A3J B;  4AQY Q;  1T5X D;  1RKN A;  4NW2 A;  3CW2 C;  2VZA A;  5ELE A;  3PO2 G;  3OW2 A;  3K5O A;  3J80 L;  4JI8 L;  1VQ5 A;  1B8A A;  2R61 A;  1LT3 D;  1E2V A;  1L1O A;  1XPR A;  3IFD A;  5CV7 A;  2Z1C A;  1JJ2 A;  4A3D H;  1E1T A;  4GNX A;  2UUC L;  3H3V C;  4WOR A;  5IOC A;  1IBK Q;  1G29 1;  1C4Q A;  5HGQ A;  4DUY L;  4N9P A;  1KNE A;  2CH4 A;  4DV1 L;  3M4Q A;  3NBH A;  5HY6 A;  2EIF A;  2ZJP A;  2NYZ D;  3KLS A;  1PHJ A;  4IFD I;  5CV5 A;  2HCI A;  1A3T A;  1WCM H;  2Y0S E;  3DM1 A;  4IPH A;  4UY8 C;  2IHE A;  3N52 A;  1VQA A;  3P7J A;  2A69 C;  3V05 A;  2PZW A;  2XNA C;  4GN3 B;  5G3L D;  1PVO A;  4FXK C;  2A68 C;  5C5M A;  4DV2 L;  1R9T B;  2OTJ A;  5E7N A;  2EE1 A;  3HG9 A;  2Q2I A;  1YI2 A;  2PMZ E;  3NTH A;  4OIK A;  2XRQ D;  2K03 A;  2BCO A;  2HDL A;  2K75 A;  2JA6 H;  3CD6 A;  1WI5 A;  2JN4 A;  1UAP A;  1KHI A;  2PCF B;  3LWU A;  2OQK A;  5BN4 A;  1TXY A;  5CV6 A;  1CQV A;  2B3G A;  4XIG S;  5C4Z A;  2L4N A;  1MJE A;  1FD7 D;  4H0L C;  4NP5 A;  2LFN A;  4DAV A;  2O5I C;  4BY1 G;  1F9P A;  3HOW G;  3KDF A;  2VB2 X;  4LF8 L;  1YIT A;  3HOW B;  4L5S A;  5CV4 A;  2E2I H;  4JI7 Q;  4QF4 A;  1LT4 D;  4L5Q A;  1J5E L;  4J1M A;  1GOZ A;  5C0X H;  5C0X I;  5DM7 3;  1KAB A;  3CRL C;  4IAL A;  3ERO A;  2I46 A;  2MO1 A;  1HUN A;  2Z8L A;  4JI3 L;  4POG A;  1B4O A;  4KV6 A;  4AYB B;  1S72 A;  2J0T D;  5J39 A;  2O4X A;  1RHP A;  2AUJ D;  3K81 C;  3J80 i;  3T13 A;  5IP9 G;  2EJF C;  1YJ9 A;  3KLR A;  2PPB C;  2BA1 A;  3W1B A;  4EGV A;  5LMN W;  1T5E A;  1GVP A;  2LXK A;  3S14 B;  3NK9 A;  2IT1 A;  5KIX A;  1C7Y A;  3A7L A;  4DUZ Q;  1ASY A;  3AB9 A;  3L2P A;  1FGU A;  3PF4 A;  2BE5 C;  2OCE A;  4LFC Q;  1H9S B;  3CCR A;  4DR5 L;  2L1B A;  4A75 A;  1AH9 A;  4FDB A;  2WKC A;  4LNQ A;  3HOZ H;  3PO3 H;  5FOB B;  4IN3 A;  2A1A A;  3OOC A;  1SNO A;  4BBR H;  1O7I A;  2CW0 C;  4ME3 A;  5M5X H;  3LGJ A;  2A6E C;  4C3J G;  2L12 A;  1H9J A;  4JI2 Q;  4KTA A;  2AUK A;  4OX9 Q;  4B3T Q;  5L37 A;  4DAY B;  4HMJ A;  1KC8 C;  1PFB A;  3M7N A;  5FJ8 G;  3CC2 A;  3RLN A;  4F87 A;  2EYL A;  4YCW A;  4XYO A;  5A2Q E;  1N33 L;  3S9W A;  3I90 A;  2B29 A;  3MEF A;  3CQZ B;  3P1H A;  3BVG A;  3R93 A;  1VF5 C;  3Q23 A;  2EYO A;  1NCV A;  4K0K Q;  3I4M G;  5EBC A;  1E1O A;  2Q8T A;  1KXL A;  3FVQ A;  4P72 A;  4ZQ3 A;  1G2T A;  2IX3 A;  1ML0 D;  3IL8 A;  1S5B D;  1T9H A;  4FVM A;  3UI2 A;  4DK3 C;  5IP7 H;  1QOH A;  3R8B A;  5IWA L;  1K73 C;  1O80 A;  4PMB A;  3S24 A;  3M85 A;  3Q0A A;  4V19 0;  2A5H A;  2B39 A;  2I5H A;  4GOP B;  3U58 A;  1VQN A;  2B2T A;  3NEN A;  4G57 A;  3ERQ A;  1FGB D;  1Z9F A;  2AQ3 B;  4F88 A;  3I4N B;  1IKM A;  1X65 A;  2XTI A;  1PZK D;  3I4L A;  1XTC D;  4BBR G;  4R4C A;  5AJ3 Q;  4A93 B;  2KHS A;  1KQS A;  3KBX A;  3S1M B;  1G6Z A;  1N8R C;  3SK5 A;  2K50 A;  4XT3 B;  1JOQ A;  1TWA H;  3ULL A;  4KN7 C;  3JAM i;  3NBH B;  4EQ5 A;  3BG3 A;  5D14 A;  5CBA E;  5EKL A;  4Q0F A;  4C1N K;  3CCE A;  1VQH A;  1K83 B;  1WVL A;  2EYH A;  3UDG A;  2AHO B;  1N36 L;  1KAW A;  2UXC Q;  4XQJ A;  1Y1V B;  1PTO B;  2JXM B;  4DV7 L;  2R92 H;  4UAI A;  4PV1 C;  4J6H A;  3H0G G;  2SEB D;  1X3F A;  4HMI A;  1EYA A;  5EPK A;  1HZB A;  3G71 A;  4CHT B;  4A3L H;  1NNX A;  4A3F B;  1V1P A;  2AKW B;  4PZ6 A;  1GXD C;  2F0W A;  3RR5 A;  1K83 H;  1VQG A;  1RDP D;  3I7F A;  1N34 Q;  3RMH A;  2HHH L;  4QGU A;  2EQS A;  2KCN A;  1VQO A;  2UXC L;  1VQB A;  3LNN A;  5LMN Q;  1CKO A;  3M4P A;  3MAQ A;  2A68 D;  4NDX A;  4EQN A;  3V96 A;  3S1R B;  3KBG A;  3URY A;  4DA2 A;  1FNW A;  1CM9 A;  2KBN A;  1SE8 A;  3ND8 A;  4MTK A;  2Z4H A;  3GTO B;  2WB1 E;  4B3S L;  2FHT A;  3A8I E;  2QGQ A;  3S2H H;  5EJW A;  1TS4 A;  2XWJ B;  4R8I A;  5H1S E;  1GJX A;  1V43 A;  3CC7 A;  3TZU A;  3BZD B;  4BY7 B;  1QVG A;  3NHH A;  4A3E H;  4WJ3 M; 
#chains in the Genus database with same CATH homology
 5M5W B;  2PW5 A;  3NUC A;  1B9M A;  3SEB A;  4KD4 A;  5DAU A;  4K8I A;  2I07 B;  1ENC A;  1Z6H A;  4C2M B;  3JAM E;  1V8Q A;  3S16 B;  4QB4 A;  3QG1 A;  3NSW A;  5ELD A;  3S1Q B;  1LO5 D;  3Q22 A;  1XWE A;  3MWY W;  1SMY C;  3HRZ C;  3KUP A;  3FKI B;  5A35 A;  3ZYY X;  1A6X A;  5KEE A;  4O1N A;  2JE6 I;  5JVH 3;  2DY7 A;  2AWO A;  1EY7 A;  1CFM A;  1E0B A;  5LHY 1;  5I4D A;  2M00 A;  1PFM A;  1GUG A;  4TSS A;  3GD7 A;  2IW3 A;  1RF2 D;  4IUR A;  1I4X A;  1E2Z A;  1JB3 A;  1EEF D;  4KI0 A;  1H9M A;  1B1Z A;  4RGO S;  5HGT A;  2H4O A;  1O78 A;  5IOD A;  5CV8 A;  5TSS A;  3T56 B;  4A3M B;  3I3C A;  1AN8 A;  4ZUJ A;  1GHJ A;  1SBB B;  1BBX C;  4X3S A;  4IUP A;  4H44 C;  5K36 G;  2PNR C;  3RZO B;  4C1N I;  2A74 C;  1F2Z A;  2XRS D;  4IQZ A;  2NN6 G;  2B2W A;  3FPU B;  4LJZ C;  1II3 A;  4A3K B;  1KLG D;  4U68 A;  1SYF A;  2AQ1 B;  1KAA A;  1PLF A;  1DOL A;  1GUW A;  2JA5 B;  2L11 A;  2K1B A;  3C3L A;  1AZQ A;  4QIW B;  2TMP A;  1PTO H;  3MFY A;  2R92 B;  2F0J A;  1F77 A;  3A7A B;  2X6L A;  1G8Z D;  2N55 A;  4WFN 3;  2L55 A;  1WTV A;  4RFB A;  3BYT B;  2HCC A;  1W6K A;  2E2H B;  1GUS A;  3QIA A;  5LL6 S;  3VA7 A;  1EIG A;  1SJE D;  2PMZ B;  1Y8P B;  4IFD G;  1TS5 A;  2EOT A;  2B8G A;  3A54 A;  2K04 A;  1I4G A;  1C48 A;  5IT9 E;  5FK9 C;  2XN9 C;  4E6I A;  1JR0 D;  5CV9 A;  2F0K A;  2R7Z B;  2WKD A;  2EY5 A;  3T4A C;  1STG A;  3SHL A;  2JEA I;  4HR7 B;  5C3W A;  3H09 A;  2PZT A;  2F0G A;  4KHV A;  3J7Y W;  1WTQ A;  2FFK B;  1HTP A;  3WOE A;  2JSO A;  4BBR B;  2EY2 A;  3A55 A;  2RDG A;  3D4D A;  3E0J A;  1PTO F;  2D9U A;  2B2W C;  2E75 C;  3I72 A;  4G7Z C;  1EL0 A;  1F9Q A;  5BN5 A;  2MUY A;  3X3M A;  5C0X J;  1CHP D;  4IFD H;  1EY8 A;  4CKC A;  1LT6 D;  1EEI D;  5C4J B;  2H1E A;  1JCK B;  2NVX B;  1D1K A;  2EJG C;  1SAP A;  3DEP A;  5FLX E;  3OIP A;  2A73 B;  4ZYS A;  3C1F A;  2A6H C;  1TWH B;  3I70 A;  4M1U B;  1Q12 A;  4DAP A;  4OL7 A;  2NVY B;  1F2Y A;  1KTK A;  1PZJ D;  2Q8I B;  2E2I B;  1SND A;  1TU2 B;  2V4D A;  4LMQ D;  4K8J A;  2LS0 1;  4C3H B;  3HP3 A;  3D31 A;  1J9O A;  4K5W A;  2XVS A;  4HAE A;  4ZUI A;  3P20 A;  3EA6 A;  3VR5 A;  1CZW A;  3I4M B;  3T53 B;  1XX8 A;  4QCL A;  3NP8 A;  5E3F A;  2RSO A;  2F1M A;  5BN3 A;  2D2C C;  3VR3 A;  1Z7T A;  4K14 A;  5E4W C;  3IFT A;  1NAP A;  2KEC A;  2F4I A;  1A3V A;  4X3K A;  1EIH A;  5FO9 B;  3ITP A;  1FYC A;  4H7B A;  1H9K A;  3OSO A;  3M3Y B;  2EZV A;  3OPO A;  1G91 A;  2KVM A;  1WCM B;  2MJ8 A;  4DK0 A;  2FMM A;  1BDO A;  2EXZ A;  2WII B;  3NTK A;  3RZD B;  3VR2 A;  5FKA C;  4GZY C;  3DUZ A;  1A2U A;  4KD3 A;  4QUC A;  3MHB A;  2NTS A;  3ONA B;  1QNU A;  3GTG B;  3BVZ A;  1RCV D;  5K36 H;  4FP5 D;  4LAA A;  5IGB A;  3QWN A;  2F0L A;  4XQN A;  3GV6 A;  3DHQ A;  1DZ1 A;  3VYU A;  2M9V A;  4HN7 A;  3O13 A;  3PO2 B;  1OXT A;  4CGY B;  1ROD A;  3RLF A;  3FEW X;  1MBY A;  2A69 D;  2EVB A;  3QOJ A;  1I4H A;  1TQO A;  1JOR A;  3HEJ A;  1SFO B;  4X3U A;  4ID6 A;  3K5L A;  1BCP C;  3RD4 A;  3Q24 A;  3K6O A;  2HUG A;  4R9W A;  3HGB A;  2F0I A;  1JWS D;  2WB1 B;  1QB5 D;  1LTA D;  2LKV A;  4DK1 A;  1SE4 A;  4WRD A;  3GTK B;  2WV6 D;  1L0X B;  1EU4 A;  2FMC A;  3VYR A;  2ZXP A;  3KLS X;  3D6C A;  1HPC A;  2KUM A;  2QF7 A;  1QIL A;  2AWN A;  4ZK9 B;  1XXG A;  2OT2 A;  3NBI A;  1V1O A;  3EQL C;  4OO1 H;  4C3H G;  1CT1 D;  4J8Q A;  3PUW A;  5D3D A;  3GTQ B;  5JEA J;  3J7A V;  2J7Z A;  1BUV T;  4HSP A;  1IHZ A;  1KDA A;  1YNN C;  1PRT B;  4Q5V A;  3K7A B;  1DYQ A;  4RH6 A;  1QJO A;  1W6J A;  2SOB A;  2BDN A;  2LY7 A;  4QMG A;  2OF1 A;  2ZXO A;  2WAC A;  2QIL A;  5M5X B;  3TP8 A;  4CJ2 C;  5JJZ A;  3I91 A;  2WP8 J;  2RQX A;  1QCB D;  2O2L D;  2B2V C;  2F0S A;  4LK1 C;  4KY6 A;  2AQ2 B;  4KJO A;  1RD9 D;  5DNF A;  4RCN A;  2X69 A;  1D5M C;  5CMD A;  1I4R A;  4I65 A;  2NWG A;  3S17 B;  1PTO C;  4DAY A;  1PTO D;  2VNU D;  1F2M A;  1SDF A;  1KNA A;  1VDZ A;  4CJ1 B;  3L3O C;  1EZ8 A;  2B8F A;  2KEE A;  4K2L A;  4XTC S;  3VYS A;  5M3F B;  4RKB A;  5I6Y A;  2VB3 X;  3NPP A;  1CZG A;  2EYP A;  2KOL A;  2O5J C;  1A2T A;  3M4Y A;  1LTG D;  3PUV A;  5E4X A;  1HQM C;  1A15 A;  5K5P A;  2D5D A;  1BCP F;  5IGF A;  1ENF A;  2NVQ B;  4KKT A;  2E2D C;  4RAU C;  4TRD A;  5JPN C;  5CR3 A;  3MA2 B;  2IJ0 A;  1IL8 A;  4CKE A;  3W3A A;  5JVG 3;  2KQ3 A;  2IX0 A;  3I73 A;  3M7G A;  4PQX A;  4YIJ A;  3SDZ A;  3PV0 A;  3MVV A;  4Z9C B;  1X32 A;  1CA5 A;  1PXU A;  4B9W A;  1SSO A;  1OO9 B;  1EY5 A;  3IKJ A;  1PRT D;  4C3I G;  4RGM A;  1EYD A;  5CC4 A;  3WOF A;  1ET9 A;  3HOV B;  1VCI A;  3HKZ B;  3OMG A;  2IL8 A;  1VMP A;  3PUX A;  1ESF A;  2L9H A;  2B2U A;  2HDM A;  4F7X A;  1ZYR C;  2B63 B;  1JOO A;  2K5D A;  3BDO A;  5C6A A;  2EY1 A;  1CQF A;  2C5C A;  1TII D;  1L0Y B;  2FJ2 A;  1ILP A;  3A8J E;  4ZKB B;  2ENB A;  1UNS A;  4R8N A;  1LV9 A;  5NUC A;  1CK1 A;  2RDH A;  1WTR A;  4FO2 A;  4KK7 A;  3X3N A;  3KK7 A;  4IZ8 A;  5JEA G;  2JA6 B;  2WAQ B;  1WTP A;  5T1I A;  2BA0 A;  1LTR D;  3QO2 A;  4EVO A;  2K5W A;  3DWQ A;  5J1Z A;  3J7A F;  2ZT9 C;  1DM0 B;  4FF4 A;  5COY A;  5KYL A;  3GTJ B;  1TY2 A;  1BXT A;  4BBS B;  4FNF A;  3QOL A;  1I4P A;  1LTS D;  1SNM A;  1PDQ A;  2NZ1 D;  5EKI A;  1QNK A;  4OO1 I;  5HUR A;  2DNE A;  1UUP A;  2HQE A;  2PW7 A;  3K5N A;  2K5Q A;  3L9A X;  1Y8N B;  1Q1E A;  1SEB D;  1U4R A;  1FNU A;  2G9H D;  1EFI D;  5IGE A;  1ICW A;  1XYI A;  3LWE A;  3VR6 A;  4H13 C;  5LL6 X;  3PIO 3;  1D2B A;  3D3R A;  1OXU A;  2R6G A;  1GHK A;  1IYV A;  1SYG A;  1PZI D;  1EU3 A;  5I2X A;  2CVR A;  2B2V A;  3BDC A;  4PNY A;  1S5E D;  3C46 A;  1JIC A;  2DNC A;  1BF4 A;  1AFP A;  2JYO A;  5G3L F;  5C3X A;  5COR A;  1B9N A;  2B2Y C;  2EYJ A;  2RA4 A;  2K01 A;  4DU9 A;  2F3V A;  5T1G A;  2RDF A;  2OEO A;  1NR2 A;  1CI3 M;  1HTL D;  2K7V A;  3TP7 A;  2OXP A;  1MSH A;  2VXW A;  1PMR A;  1DON A;  1RJT A;  1DJR D;  2QCP X;  1TS2 A;  3MTS A;  2QDB A;  4DNT B;  1EQV A;  5IGC A;  4A3E B;  1HFG A;  1IW7 C;  1YNJ C;  3SR1 A;  2VUM B;  1YNJ D;  3S15 B;  4DXF A;  2B2T C;  3C1E A;  1GUN A;  1OXV A;  4IUT A;  1I6V C;  1PFN A;  1HCZ A;  5IT9 L;  4G7H C;  3CRK C;  3PUY A;  1JWU D;  1KDC A;  4A3B B;  2GA4 B;  5M3M B;  4RKL A;  5JOB A;  3DXJ C;  3NWS A;  4ZLT F;  1NR4 A;  4M8A A;  1GUT A;  4NKL A;  3K5M A;  3R2T A;  2ZXR A;  2PQE A;  3GO5 A;  4OHJ A;  1Q3L A;  1STY A;  4C3I B;  1A3U A;  5M9O A;  2NN6 H;  3Q6S A;  4IUN A;  4DXG A;  5IIF A;  4MN3 A;  5FO8 B;  3S2D B;  5I9O A;  3BS1 A;  3NQI A;  5JEA H;  1EZ6 A;  5KND A;  4O42 A;  3EVQ A;  1STN A;  3MC0 B;  3R3O A;  2X6G A;  1WTX A;  2CHB D;  1X3P A;  1ZKO A;  1IW7 D;  3D4R A;  2E2J B;  1QG7 A;  1F9S A;  1IYU A;  1ILQ A;  3U9O A;  2D62 A;  4K5V A;  3TP5 A;  3HZX A;  1MD2 D;  1AEX A;  3H0G B;  1TWF B;  2EDG A;  4KKU A;  4RHS A;  1NUC A;  2FIN B;  3HS0 C;  5FLX L;  3RUZ A;  3FDT A;  1F9R A;  3EJI A;  4ME5 A;  3CKI B;  1U4P A;  1TKW B;  1LT5 D;  1LAB A;  3MXU A;  1SNQ A;  3OWF A;  4I7Z C;  1M4V A;  2RKS A;  1WTW A;  2F0V A;  1I6H B;  1STA A;  1ZYR D;  3I8Z A;  1TY0 A;  4A3I B;  4DN4 M;  1DOK A;  1B50 A;  3D8G A;  3JAM L;  1OXX K;  1TVX A;  4RWS C;  4FF2 A;  2EYM A;  2QKI C;  2Z4I A;  2MGS A;  3N6R A;  3GQB A;  3F2U A;  4B08 A;  4C3J B;  1HXY D;  1WD0 A;  2L5T A;  1TWA B;  1TWC B;  2F0T A;  1M8A A;  1JQY D;  1EQT A;  3S1N B;  3VR4 A;  2QEJ C;  1LTT D;  4RGN A;  2MP1 A;  4WJW A;  1O7L A;  2PO4 A;  4HSV A;  2K05 A;  1PRT F;  1SNC A;  5D65 A;  3S2H B;  2NUC A;  4HTH A;  1WTO A;  2WIN B;  1R4P B;  1Y1W B;  1Y8O B;  2F0H A;  1D1I A;  3NE5 B;  3DWP A;  4RCO A;  4KMU C;  3MFG A;  1U4M A;  3A56 A;  1DD2 A;  3E6Z X;  3NTI A;  1EY6 A;  1RTN A;  1CHQ D;  4IUU A;  3KF8 A;  5CGK A;  3GTM B;  2MPM A;  4KN4 C;  1CA6 A;  4FXD A;  2XWB B;  1SJH D;  3J81 L;  1OXS C;  2M2L A;  1MGS A;  1SXT A;  3IAY A;  4TQU S;  1LLR D;  4CKB A;  4RHR A;  1D5X C;  1D6E C;  4HCS A;  3SXH A;  4OIJ A;  1STE A;  4MIU A;  2EPB A;  3CU7 A;  3L7Z C;  3VA5 A;  5DEH A;  3GP7 A;  2IX1 A;  5I9P A;  1O7Z A;  2ICE C;  3TME A;  3T16 A;  1J8I A;  1I50 B;  1HA6 A;  4JK1 C;  1GUO A;  2YU9 B;  1BR9 A;  3OIQ A;  2ID0 A;  3MZ5 A;  5EBD A;  5C44 B;  1S4Z A;  2SNS A;  1BO0 A;  4FF3 A;  3LX0 A;  4XYQ A;  4QUF A;  4DF7 A;  1ONL A;  5KNC A;  3FPP A;  1JWM D;  3PMF A;  5C4H A;  2EYF A;  2JP1 A;  3J81 E;  1HUM A;  1ET6 A;  4DGZ A;  4PMC A;  5CYU A;  3PUZ A;  2A6E D;  2F0Q A;  5ISR A;  4BS9 A;  3TBI B;  4G7O C;  2F3W A;  1YNN D;  5ELF A;  1BCP B;  4A3G B;  3P75 A;  3CHB D;  3OW7 A;  2NN6 I;  3NXW A;  2BOS A;  1S5C D;  2XSC A;  5EQ0 A;  5EPJ A;  5IGG A;  1HFN A;  5EPL A;  5M5Y B;  4Y7N B;  2L0C A;  1BQQ T;  4K6L A;  5CBE E;  2KCC A;  1BNZ A;  4JBW A;  4C56 C;  4KY7 A;  3K0Y A;  1X3Q A;  3U9S A;  1MI2 A;  4TKO B;  3J80 E;  4B9X A;  4BA2 I;  2YYZ A;  2SDF A;  2F0E A;  4BWG B;  5EGT A;  4RGT A;  1K8M A;  1DCZ A;  2RBM A;  3GV3 A;  4ULL A;  2RVL A;  3WDN A;  1JC7 A;  2C9O A;  3AU7 A;  2NVT B;  4DNR B;  2BE5 D;  4L63 B;  1Q90 A;  4U67 3;  1EWC A;  1PRT C;  1QWY A;  4HCE A;  2MHV A;  2R3Z A;  1FNV A;  4XDX A;  4NMZ A;  2CW0 D;  3SK8 A;  3K59 A;  1Q1B A;  4RA8 A;  2K28 A;  3G6J B;  2SNM A;  4ZAI A;  4ILW A;  1SNP A;  2ICI A;  3VYT A;  4V0B A;  2NB0 A;  1EOT A;  2E76 C;  1SYB A;  5ELC A;  1B53 A;  5C4X B;  1O7Y A;  2RSN A;  1DOM A;  3V2T A;  1PYW D;  1VF7 A;  5C3E B;  1SYE A;  4BY1 B;  3K58 A;  1SYD A;  1U9R A;  1ESR A;  5KRU A;  4ZRZ A;  5EKK A;  2JA7 B;  2NBF A;  5KNB A;  1JOK A;  4XT1 B;  1QE6 A;  4DFA A;  1EWH A;  4XXE A;  1AP0 A;  2KED A;  2F0O A;  3QJY A;  3TDQ A;  4HED A;  3H94 A;  1MSG A;  5I6W A;  1TS3 A;  4N9T A;  3TSS A;  3G7L A;  5I2Y A;  2K6A A;  3ND9 A;  3HOU B;  2K33 A;  1UEA B;  2B2Y A;  1LAC A;  1EY0 A;  4KY5 A;  5KGU A;  5C0X G;  1E2W A;  2DN8 A;  1BCP D;  2G9D A;  2J4X A;  2IWH A;  4OO1 G;  4IUQ A;  4MHE A;  1H9S A;  3PIP 3;  3H91 A;  4UDU C;  4K6D A;  1TR5 A;  3BDL A;  2K32 A;  2Y0S B;  3AMU A;  3W2D A;  3GTP B;  1I3Q B;  2JA8 B;  2KA7 A;  3SE0 A;  3SK6 A;  3TN2 A;  3QB3 A;  2Q8R E;  2PYK A;  3K57 A;  2E74 C;  4BA1 I;  1STH A;  3NWT A;  4KJN A;  5D3I B;  3HOZ B;  3PO3 B;  2EJM A;  2PZU A;  2F0U A;  4FYD A;  1JE4 A;  2F0P A;  3R2I A;  2N88 A;  1EY9 A;  1U4L A;  1K8O A;  1CTM A;  3DMU A;  4OGQ C;  1C8C A;  2BDO A;  3D4W A;  1TWG B;  1ENA A;  5J22 A;  4P2C B;  1RTO A;  1WD1 A;  1KDB A;  3TZD A;  4IUV A;  2DY8 A;  4EQP A;  4EQO A;  4ABN A;  4ZKC B;  1S5D D;  1G2S A;  4PMW A;  4CBV A;  1TT2 A;  3MEH A;  1ZEQ X;  2F03 A;  1STB A;  2LMC B;  1EYC A;  3BVM A;  1HQR D;  5JAV A;  3NQT A;  1HRJ A;  4F8M A;  1IKL A;  2F0M A;  4L8J A;  2F0N A;  1SE3 A;  4XQQ A;  3FMC A;  3SK4 A;  5E1F A;  5C5L A;  2JEB I;  1HA5 A;  1H9R A;  4A3D B;  3OHX C;  1V1P B;  4S3S A;  2EY6 A;  5FO7 B;  1DXM A;  3A8K E;  4IFD J;  1FR3 A;  3EFX D;  3SVM A;  5KYI A;  1KLU D;  1LTI D;  5DM6 3;  2A6H D;  1Q8I A;  2F0D A;  1AW7 A;  1D5Z C;  3GTL B;  3MXN A;  3T51 B;  1S5F D;  3OMC A;  4X3T A;  2XIW A;  1B44 D;  1EY4 A;  4ODG A;  1BOS A;  2TSS A;  4KKS A;  4K2K A;  3M4O B;  3HOX B;  1HHV A;  3OWE B;  1AZP A;  3E5S A;  2R93 B;  1F2L A;  3TP6 A;  1I4Q A;  5A2Q L;  1Y69 U;  3DEO A;  1B3A A;  2IPK D;  1SE2 A;  1NSN S;  4G4K A;  1B2T A;  4L6T B;  5JPM C;  3DWA A;  4K5X A;  5AFW A;  3BYY B;  3C2P A;  4KHZ A;  2CQA A;  1R4Q B;  5ELB A;  4FF1 A;  3MXP A;  1ZXT A;  1VMC A;  1LTB D;  4CJ0 B;  2F0F A;  3HOY B;  2NTT A;  3D6W A;  3H6M A;  3FRP B;  5IGD A;  3MXG A;  1SYC A;  1Z47 A;  1SMY D;  4FXG C;  5F2D A;  2KJX A;  2B2U C;  4A3J B;  1T5X D;  1RKN A;  4NW2 A;  5ELE A;  3K5O A;  3J80 L;  2R61 A;  1E2V A;  1LT3 D;  3IFD A;  5CV7 A;  2Z1C A;  3H3V C;  4WOR A;  5IOC A;  1G29 1;  1C4Q A;  4N9P A;  1KNE A;  3NBH A;  2NYZ D;  3KLS A;  4IFD I;  5CV5 A;  2HCI A;  1A3T A;  3DM1 A;  3N52 A;  3P7J A;  2A69 C;  3V05 A;  2PZW A;  2XNA C;  5G3L D;  4FXK C;  2A68 C;  5C5M A;  1R9T B;  2EE1 A;  3HG9 A;  3NTH A;  4OIK A;  2XRQ D;  2K03 A;  2BCO A;  2HDL A;  1UAP A;  2PCF B;  3LWU A;  5BN4 A;  5CV6 A;  1CQV A;  4XIG S;  5C4Z A;  2L4N A;  1FD7 D;  4H0L C;  4NP5 A;  2LFN A;  4DAV A;  2O5I C;  1F9P A;  2VB2 X;  3HOW B;  5CV4 A;  4QF4 A;  1LT4 D;  4J1M A;  1GOZ A;  5C0X H;  5C0X I;  5DM7 3;  1KAB A;  3CRL C;  4IAL A;  3ERO A;  2I46 A;  1HUN A;  2Z8L A;  1B4O A;  4KV6 A;  4AYB B;  2J0T D;  5J39 A;  2O4X A;  1RHP A;  2AUJ D;  3T13 A;  2EJF C;  3KLR A;  2PPB C;  2BA1 A;  4EGV A;  1T5E A;  3S14 B;  3NK9 A;  2IT1 A;  5KIX A;  3A7L A;  3AB9 A;  2BE5 C;  1H9S B;  2L1B A;  2WKC A;  5FOB B;  4IN3 A;  3OOC A;  1SNO A;  2CW0 C;  2A6E C;  4C3J G;  2L12 A;  1H9J A;  4KTA A;  2AUK A;  4HMJ A;  1PFB A;  3M7N A;  4F87 A;  2EYL A;  4XYO A;  5A2Q E;  3S9W A;  3I90 A;  3CQZ B;  3P1H A;  3BVG A;  3R93 A;  1VF5 C;  3Q23 A;  2EYO A;  1NCV A;  5EBC A;  2Q8T A;  3FVQ A;  4ZQ3 A;  1G2T A;  2IX3 A;  1ML0 D;  3IL8 A;  1S5B D;  4FVM A;  3UI2 A;  1QOH A;  3R8B A;  1O80 A;  4PMB A;  3M85 A;  3Q0A A;  4V19 0;  2A5H A;  2B39 A;  2B2T A;  4G57 A;  3ERQ A;  1FGB D;  4F88 A;  2AQ3 B;  3I4N B;  1IKM A;  1PZK D;  3I4L A;  1XTC D;  4A93 B;  2KHS A;  3KBX A;  3S1M B;  1G6Z A;  3SK5 A;  4XT3 B;  1JOQ A;  4KN7 C;  3BG3 A;  5D14 A;  5CBA E;  5EKL A;  4Q0F A;  4C1N K;  1K83 B;  1WVL A;  2EYH A;  4XQJ A;  1Y1V B;  1PTO B;  2JXM B;  4UAI A;  4PV1 C;  4J6H A;  2SEB D;  4HMI A;  1EYA A;  5EPK A;  4CHT B;  4A3F B;  1V1P A;  1GXD C;  2F0W A;  1RDP D;  3RMH A;  2KCN A;  3LNN A;  3MAQ A;  2A68 D;  4NDX A;  4EQN A;  3V96 A;  3S1R B;  3KBG A;  3URY A;  4DA2 A;  1FNW A;  1CM9 A;  3ND8 A;  2Z4H A;  3GTO B;  2FHT A;  3A8I E;  5EJW A;  1TS4 A;  2XWJ B;  4R8I A;  1GJX A;  1V43 A;  3TZU A;  3BZD B;  4BY7 B;  3NHH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...