1RHPA

Crystal structure of recombinant human platelet factor 4
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
64
structure length
64
Chain Sequence
DLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Platelet factor
molecule keywords PLATELET FACTOR 4
publication title Crystal structure of recombinant human platelet factor 4.
pubmed doi rcsb
source organism Homo sapiens
total genus 11
structure length 64
sequence length 64
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1994-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1rhpA00
5AFWA 1WTXA 4XDXA 2FHTA 1DONA 2FJ2A 4X3TA 1RTOA 1NCVA 2L12A 1DOMA 3Q6SA 1CA6A 2JP1A 1ZXTA 4O42A 2L11A 2B2WA 4R9WA 4U68A 2K01A 2L9HA 1HA6A 4RA8A 2KEEA 2RSNA 4ZLTF 1BF4A 1KNEA 1RJTA 2HCCA 1O7YA 1F2LA 1WD0A 1HUNA 2XIWA 2HUGA 5DNFA 1WTWA 1RODA 1MSHA 1VMPA 4ZK9B 1JE4A 4ZKBB 2IL8A 1NAPA 2NYZD 2RSOA 2B2UC 4HAEA 5EKIA 1QE6A 3I91A 2K05A 2Q8RE 1AP0A 2B2YC 2X69A 1E0BA 2MJ8A 1MI2A 5COYA 2EPBA 3MTSA 5T1GA 1PFNA 2MPMA 2FMMA 1TVXA 3GV6A 5E4XA 4MHEA 4RWSC 2X6LA 3KUPA 5EJWA 1XX8A 2RA4A 4QUFA 1WTOA 4CJ1B 2J7ZA 2B2VA 2JYOA 1QG7A 3DEPA 3SVMA 1LV9A 4ZAIA 2NZ1D 4X3SA 1EOTA 1ICWA 5D14A 5EPKA 1O80A 5CBAE 4IUVA 4HCSA 3N52A 2K1BA 2Q8TA 4HEDA 4DN4M 1C8CA 1EIGA 2L4NA 3G7LA 1AZQA 2B2TC 5EPJA 2N55A 1RTNA 4X3KA 4X3UA 1WD1A 1B3AA 1IKMA 4UAIA 1X3PA 4OIJA 1ML0D 4MN3A 1PLFA 2B2UA 1HUMA 1B4OA 5CMDA 5E4WC 3D6WA 1SDFA 1EQTA 3R93A 1CM9A 2H1EA 2B2YA 3DEOA 1QNKA 2KECA 3F2UA 2VXWA 3IFDA 1ILPA 2FFKB 5EQ0A 4ZKCB 1X3QA 1B2TA 5JJZA 2KVMA 1M8AA 1F9RA 3LWEA 4LMQD 1MGSA 2K28A 1CA5A 1J9OA 3I90A 1BBXC 2K04A 1F9SA 1SAPA 1U4RA 2BDNA 2RVLA 4NW2A 4CJ0B 2DY7A 1DOLA 4IURA 1G2TA 2DY8A 2EOTA 1WTQA 1U4PA 1J8IA 1KNAA 1G91A 2MGSA 1HFGA 1S4ZA 1HHVA 1PDQA 1Q3LA 3IL8A 3FDTA 2KEDA 1DOKA 3FPUB 1WTPA 1U4LA 2FINB 5D65A 1BNZA 2HDLA 3I8ZA 4IUUA 2MP1A 2B2TA 3KBXA 1B50A 4RAUC 2M2LA 4XT1B 2NWGA 1AZPA 1F9QA 4HSVA 2L1BA 4IUTA 1NR2A 4OIKA 1PFBA 3I3CA 4XT3B 3UI2A 1GUWA 1IL8A 1BO0A 1DZ1A 1ESRA 3P7JA 1EL0A 2HCIA 1SSOA 1HRJA 5T1IA 1XYIA 1A15A 2B2WC 2HDMA 3ONAB 5CORA 5EPLA 1EIHA 1G6ZA 2N88A 3TN2A 1WTRA 1G2SA 2K03A 2KOLA 1RHPA 1F9PA 2EE1A 3DM1A 3TZDA 3MWYW 1WVLA 1ILQA 2CVRA 2D9UA 3GV3A 4QUCA 1HFNA 1MSGA 1WTVA 1IKLA 2R3ZA 1O7ZA 3H91A 2X6GA 1PFMA 3QO2A 2SDFA 4IUQA 2KUMA 3HP3A 4IUPA 4CJ2C 1NR4A 1X32A 1JICA 1U4MA 4R8IA 1B53A 5CBEE 1VMCA 2B2VC
chains in the Genus database with same CATH superfamily
2IJ0A 3SEBA 2IX3A 2FHTA 1DONA 3S2HB 1NTGA 4KN4C 3UDFA 1TS2A 5I9OA 1JWMD 2K52A 1DD2A 5FO9B 5I2XA 3F2CA 3ND8A 1XPOA 1FYCA 4K5VA 2EZVA 3C2PA 2A5HA 1ENAA 3HOYG 2BE5D 1Q1BA 3KDFB 1S5BD 2DJFC 4DR6L 2B2YC 3CCVA 3D4WA 3PIOA 1JOQA 1TVXA 3GV6A 2HHHQ 4LF9L 1IYJB 2MHVA 1OTCA 2Q2IA 4FVMA 1SFOB 1B8AA 2EYOA 3DEPA 4PMCA 1EFWA 4LFBL 1BCPB 1I5FA 5FK9C 3S1NB 3H09A 4DV5L 1EIYB 2D5DA 3BZDB 3SK5A 1TWHB 4IJHA 1C8CA 4HEDA 3SXHA 1EIGA 1HCZA 2HIXA 5IT9L 3I56A 1WD1A 1BR9A 4IPCA 4BY7G 4IJLA 4BY7B 1CHQD 1GUTA 4R4IA 4GLAC 2NUCA 3KLSX 4BA2I 1LTID 4RHSA 1SYEA 1WFQA 1PRTB 2A1AA 1Y14B 3GTKH 2CQOA 3PO2H 2J0TD 1UE6A 2ID0A 1KLGD 1BBXC 2PPBC 1RCVD 4P2CB 4IURA 4JBKA 1EY6A 1G51A 3KK7A 3GTMB 1Q3LA 4JYAL 1CHPD 1MHWC 2B39A 3CPFA 3HG9A 3J80L 1UWVA 2LSSA 2NZHA 4BBSB 1PVOA 4BXXH 4XT1B 1NR2A 4O0AA 5IYCH 1EWIA 2RDHA 4L5QA 1S72A 3J7ZC 4HCEA 4PZ6A 3NQIA 4EX5A 2R61A 3QJYA 4DFAA 4R8NA 4CGYB 3S14B 2GN5A 4LUOA 4M8AA 3M85A 3DM3A 2QEJC 4TKOB 2ZXRA 3VYUA 2VB2X 3PCOB 5DM73 4POGA 4R8IA 1TY0A 3I4NH 1VQKA 2I5LX 3STBD 4IOCA 3NK9A 4TRDA 2FJ2A 4JI0L 3Q6SA 4GKKL 3HOXH 1GUSA 3JAML 4LWCA 5GADC 3SHLA 1MD2D 3CQZB 2A69D 3GTGH 3I2ZA 2JA5H 1STBA 1SMYD 4EQPA 1EY7A 2BDOA 4OX9Q 5DNFA 5EKLA 4DKAC 5TSSA 1WYDA 2NYZD 4HAEA 1HZBA 3I91A 3KFUA 4X62Q 1Z47A 4FF4A 3RZDB 1JJ2A 3GTLH 3WOFA 4JCVE 1X54A 2R92H 3D4RA 5C44G 2N3SA 4DF7A 5C44B 4NXNQ 1G8ZD 2NVXH 1GOZA 4LFCL 2EQSA 1VQMA 3IKJA 3BU2A 4DV0Q 4YCWA 5CV7A 3M7GA 4C1NK 1IXRA 4KI0A 1N36Q 1T5XD 4JI8Q 3KLRA 1CI3M 4LAAA 4CKEA 1LUZA 4PG3A 3CC7A 2ES2A 3G4SA 1BDOA 2E2JB 3X3NA 3OPOA 1OXTA 4OO1I 1K8OA 2A73B 2SNSA 2F52A 4ZKCB 4B9WA 4OXPA 1GUNA 1BVSA 3DMUA 3MXGA 3HEJA 2E2IH 2LMCB 4LUVA 1VQ4A 3A8KE 5DM63 1N8RC 1KNAA 4X64L 2F0PA 1SXTA 5D65A 1JB7A 2Q8IB 1SR3A 5GAGC 1KL9A 4KHPQ 3D31A 2IPKD 4HJAA 1VQBA 2D0PA 1PXUA 2PI2A 4IUNA 4DV3L 1L1OB 4I7AA 4GNXC 1RHPA 1YVCA 3GD7A 1EY4A 4FF1A 3MWYW 1H9MA 2KENA 3BYTB 4C3JH 4DXGA 2A68D 4RKBA 1LTRD 3CCEA 2Z6KA 4K0KQ 2O4XA 1BCPC 5LL6S 4DR4L 4JV5L 4G7HC 4A3BH 4KD3A 3I4MG 1WTXA 4BBRB 1D1KA 3GTOH 1W6KA 3I4MB 3ULPA 5E3FA 1QB5D 4YY3Q 3NENA 1VQ7A 3PIO3 4A3DG 1R4PB 5FJ8G 1RJTA 1II3A 2AQ2B 4A3DB 4A3KG 4XIGS 1PRTC 2WP8J 2ZXOA 2IY5B 2IL8A 4ID6A 2A19A 2F0IA 1EU4A 4AH6A 2K05A 1FD7D 2Q8RE 2Z1CA 5CV8A 5COYA 1I50H 2ASBA 1XMOL 2C35B 5IP9G 2LS01 1BBWA 3IAYA 1XJVA 3PO3G 1CTMA 1EZ8A 3P1HA 1VQ8A 3PO3B 1JWSD 1O80A 4HTHA 1IBML 3GTQH 1NBWA 4DR5L 4OGQC 5KIXA 2E2HH 3MHBA 5EPJA 1H95A 4OWTB 4K2LA 2N55A 3D6CA 3EFXD 5HGTA 1B3AA 2B63G 1IYUA 1P8LA 4L6TB 1C4QA 5IIFA 2B63B 4CDCC 3RLFA 1B4OA 4P73A 3S16B 3BJUA 4B3RQ 1B44D 1N33L 1IZ6A 4IALA 5F2DA 2JQOA 4J1MA 1PH9A 1I4HA 3MXPA 3NE5B 3TZUA 2KVMA 4B3ML 4LMQD 4HIDA 3MXNA 4UDUC 4K2KA 1D1IA 2ZXPA 3S9WA 3OWFA 2QKIC 2MGSA 2EYJA 1DOKA 2N49A 3GO5A 4DR6Q 2NVTB 5ELCA 4JI5L 1TIID 3I3CA 1VQCA 1YNXA 5FLMG 2R93H 1XYIA 2B2WC 3T1HL 2EY1A 4LF9Q 3H3VC 3U9OA 3DM1A 4LFBQ 1KRSA 1SE8A 4I7ZC 2D9UA 3H6MA 1PTOH 2WV6D 3FP9A 1SNOA 4MIUA 3C46A 4CJ2C 2AUKA 2ZM6L 3KJOA 2Q2TA 3L0OA 1KD1C 3A74A 1B53A 3GTJH 3A55A 1SNMA 4QGUA 1V1OA 3ULLA 4ZUIA 2Z8LA 4YHHQ 2L12A 1LTLA 4NKLA 2QW7A 3NELA 3A54A 3AB9A 4C2MB 3CCJA 3CC4A 4P75A 5C4XH 4JPBW 5K36G 1M1KC 4BY1G 3ULJA 5FLXc 3HOWH 4BY1B 3LX0A 1VQ9A 1I6HH 1ZYRD 2K5WA 1T5EA 5L37A 1LLRD 5IGEA 4JYAQ 1PFNA 3NPPA 4NXML 2MFIA 3K5LA 4A3GG 2TMPA 4A3GB 3HOUH 5IGCA 1HZ9A 2VQFL 2PQEA 3MEFA 4CKCA 4WJ3M 3VYTA 4KKTA 5A35A 1LTSD 1STNA 1L0YB 3SK4A 3OMGA 3K7AB 3TP7A 3HOZG 3AMUA 1HNZL 1L1OC 1SYGA 1UEAB 4OWXB 2AMCB 3DWAA 1QNUA 1KAAA 1QILA 2QGQA 3CAMA 1SDFA 1C48A 2H1EA 2LY7A 3DEOA 4H02A 3FHWA 1D5ZC 1ILPA 4LF4L 5JPMC 4N8X1 1PZJD 4DNTB 2F3VA 4JI0Q 4GKKQ 4DV1L 1FVIA 2DY7A 2R7DA 1G2TA 1WTQA 4DK0A 1EIFA 2VY3A 3PMFA 4RGMA 1IBKL 1PDQA 2G5DA 1IBLL 5IGDA 3NP8A 4X65Q 1DZ1A 2F4VL 4EQ5A 1YI2A 1EL0A 1SYDA 1QCBD 1ASYA 4RCNA 1NJIC 5CORA 4HR7B 4K14A 1SNCA 2YU9H 4A3JG 4LFCQ 4A3JB 1IKLA 3BZCA 2RDGA 4XQNA 3MZ5A 4XTCS 2QDLA 1H9SB 4JK1C 2YYZA 5C4ZA 3MFGA 2B2VC 5G3LF 2XRSD 1QOHA 3M9BA 4C1NI 4DK3C 4IFDH 2K50A 1I4QA 2V4DA 4G4KA 4RA8A 2VUMH 3LGJA 2EY5A 1KQSA 4JG2A 5I2YA 4X64Q 4WORA 3R2TA 4PZ8A 2X69A 5I6WA 1AN8A 1TR5A 1UE5A 4A3FH 1A63A 5EJWA 2F0DA 2CWAA 2JSOA 1F77A 1BKBA 2MUYA 4FXKC 5KRUA 4JI4L 1EOTA 4DV3Q 4NP5A 4YWLA 4MZ9A 3CP0A 2CH4A 4ME3A 2ICEC 1SJED 4X3KA 4X3UA 2QCPX 2XGTA 4G7OC 2E2DC 2JN4A 2PW7A 2MO0A 1I4XA 1JOOA 2A6HC 3NBHA 4J6HA 2F0FA 3W1GA 4QIWE 4DR4Q 4JV5Q 3S2DH 3V2TA 1TWCB 1AEXA 1E2WA 2V1CC 3P75A 3CF5A 3HOVG 3EA6A 4Y52H 3S1RB 1X3QA 5IGFA 3WDNA 4FO2A 1XPRA 2EIFA 2PCFB 2K28A 2RVLA 3BVMA 2UXCQ 2QILA 4A3EG 4JI1L 4A3EB 1K9MC 3T4AC 1R9TH 2EOTA 3F8TA 3M4QA 5M5WH 4FNFA 3S24A 1K8AC 2R7ZH 2SOBA 5M5YB 2UU9L 1JJGA 2JA6G 1PH3A 1TS3A 2JA6B 3FVQA 1BNZA 3U4VA 4A3IG 2O5IC 4A3LH 4A3IB 3MVVA 3UI2A 1X3EA 4C3IG 1STAA 3HS0C 1Y8NB 2OQ0A 4C3IB 1XMOQ 1R4QB 1BOSA 1CFMA 1G6ZA 2HQEA 2NVYH 1O78A 1WTRA 3J7AV 5JVH3 1Q7YC 2UUAL 5M5XB 2EVBA 5IE8A 3CMEA 2F0GA 5D3IB 1WTVA 2Q2HA 3H91A 1IBMQ 4P74A 1NNXA 1SROA 4LK1C 1HZAA 2NN6I 2A74C 3TSSA 1VMCA 3P20A 1K73C 2VW9A 3TRZA 1CKNA 1RTOA 1FGUA 4RKLA 2JP1A 4GS3A 3W3AA 1JB3A 3OW2A 4B08A 1WCMH 1B1ZA 4B3MQ 2RSNA 1YEZA 1BF4A 3VR4A 3MXUA 5J39A 3T1YL 1M4VA 1EQVA 1HPCA 1Q46A 4AYBE 1XMQL 2EPBA 4LF8L 2RHQB 4K6DA 3DWPA 5EBDA 4JI5Q 3PUZA 1HZCA 1WTHA 2J7ZA 2VL6A 3CHBD 1BCPD 4PV1C 3VR3A 3T1HQ 5BN4A 1C9OA 1DM0B 4NDXA 4IPHA 4DN4M 5I4DA 2L4NA 3BDLA 2RDFA 4LF7L 1IHZA 3TP5A 3K5OA 4A3CH 2OQKA 1TWAB 4GNXB 2E5LQ 2ZM6Q 1PLFA 5E4WC 1EQTA 2E76C 5HY6A 2YTVA 3EQLC 5C3XA 2KECA 5KNDA 1PRTD 1SYBA 4JI7L 3CKIB 4ZQ3A 1XNRL 2JA9A 4WFN3 1RKNA 4HJ8A 1EEFD 5IP7H 3GTKB 2K04A 4A3MG 4A3MB 3FKIH 4B9XA 2JXMB 1L0XB 1U4PA 1G91A 4L5SA 1Y1WG 3FDTA 4QIWB 1Y1WB 2HDLA 2RKSA 3RN2A 1D5MC 2HIVA 4BXXG 1GUWA 2GVBA 4DV4L 5IYCG 1GM5A 3I4OA 3BVZA 4ME5A 5FLXE 3FEWX 2F0HA 4NXMQ 1Q81C 3MC0B 3HOYH 4ALPA 4BA1I 1GKHA 2VQFQ 1EY0A 1XTDA 1MSGA 2E8GA 1LTBD 3D8GA 2KUMA 2I0QA 1B7YB 4BBSG 1CSPA 3VA5A 1V43A 3I4NG 1SFOH 4KY7A 3I4NB 3M4OH 2F0VA 1JWUD 5LMNW 4X3TA 2LKVA 4NPSA 2O5JC 2AWOA 3KF6B 1I3QB 3F2BA 1ZXTA 1TWHH 5A2QE 4LF4Q 3NUCA 4QL5A 1H9JA 3IFTA 3K0XA 1D2BA 4DV1Q 2G9DA 3QR8A 1K8MA 3CC2A 1KLUD 1NAPA 1PFSA 4GOPA 1RF2D 1IBKQ 3NQTA 1GHKA 3OIQA 1IBLQ 4EGVA 1XNQL 3AFPA 4RWSC 3G71A 2F0KA 1HR0L 3A8IE 1F2YA 4DPGA 2R92B 2F4VQ 2NTSA 1QG7A 4FP5D 2WAQE 4GN4B 4AYBG 4RGNA 1EEID 4AYBB 2NVXB 4UP7A 2VB3X 3VYRA 2K1BA 1I4GA 3AFQA 5GROA 3E9HA 4U673 4JI3L 3K6OA 2N78A 1I94L 2JA8H 1ML0D 3E0JA 1K3BC 2B2UA 5J22A 3NXWA 1QNKA 3GTPH 1YJ9A 2FFKB 2Z6BA 3OOCA 5EQ0A 2KQ3A 1B2TA 3S14H 1NMGA 2JEBI 4G57A 5FO8B 3D0FA 1MGSA 2NBFA 3PGZA 2R6GA 1YNNC 2ZJQA 2E2IB 3DHQA 1VS0A 1J8IA 3QOJA 5IY0A 4DUYL 1CKOA 1U4LA 3TBIB 2B2TA 2L1BA 3O13A 1UEBA 2BA1A 2P5ZX 1NY4A 2PZWA 2KCMA 1V1PA 1Q12A 4Y7NB 3VR6A 2NN6H 3BZKA 2ALYB 1HXYD 5GAEC 3GV3A 2JA7H 1CQVA 1HFNA 4C3JG 1BQQT 1O7ZA 5KYLA 1VQ6A 1QJOA 4C3JB 2KHIA 1FL0A 1GUGA 1D5XC 3EJIA 1JICA 2CFMA 2XTIA 4KJNA 4DAYA 4XXEA 2F0UA 4JOIC 4OELB 1SNPA 5C44H 1A62A 1BUVT 5IWAL 3UE1A 1HNWQ 2M9VA 3GTOB 2L55A 4YCUA 2RQXA 1MIUA 2PQAA 1PTOF 1HNXL 4U68A 5DLQE 3W1BA 2HCCA 1HUNA 1TXYA 1WTWA 4ZK9B 4OONA 4JI1Q 1JE4A 1Q82C 2B3GA 1CK1A 2KHSA 2IX0A 3KYHC 2F0QA 4ILWA 2E2JH 1LT6D 2UU9Q 1AH9A 1SE3A 5FLXL 3E6ZX 2WIIB 3PUXA 1VQNA 5CGKA 3AU7A 4IQZA 4BBRG 2VQEL 2E75C 4DXFA 5LMUL 1W6JA 3B6YA 4YWKA 3CPWA 3J81j 2SNMA 3SVMA 1PYSB 3RLOA 3F1ZA 2NZ1D 3A7LA 3QB3A 2LFNA 5ELOA 2UUAQ 4B3TL 3GTQB 1V1QA 3L3OC 1LACA 4IFDI 3CW2C 4OEMB 2GA4B 1J5EL 1N32Q 3J7A5 2HT1A 1HJPA 3K8AA 5GQOA 2WAQG 3Q8DA 2ZT9C 2WAQB 2B2YA 4P71A 4KHZA 4RG1A 3M3YH 1H9RA 5JJZA 1VQHA 1CA5A 1J9OA 2AQ3B 4HIOA 4A93G 2UXDL 5M3MH 4A93B 1TWGH 2I46A 1DGSA 3I55A 1M90C 2F3WA 3T1YQ 3HZXA 1D6EC 1VCIA 2PI2E 1CZGA 1GXDC 3I4MH 4GN3B 4LW1A 3S15B 1PFBA 1IW7C 3Q23A 4LF8Q 1ENCA 2CH4W 2R93G 2K32A 1JJCB 3TN2A 2R93B 4A75A 4LJZC 4KTAA 2JEAI 1G2SA 5BR8L 2XVSA 2ZTDA 3V96A 2UXBL 2A6HD 4A3KH 3PUWA 3DLLA 2F0OA 1B70B 3AQQA 4EQOA 1A3UA 1PTOB 2OTJA 1PH7A 4LF7Q 3J81E 4DV6L 1S5ED 2EXZA 4C3HG 3CRKC 5C3EG 5AFWA 3VA7A 4C3HB 1K8GA 5C3EB 1LT4D 4IPDA 3M7NA 3GQBA 3AYHB 4O1NA 2F0LA 2KCNA 3PSIA 3UE0A 4JI7Q 1KABA 1NUCA 1XNRQ 2B8GA 4H13C 2K01A 2KEEA 1SYFA 5C4XG 2B8FA 5AJ3L 2XIWA 4DV5Q 5C4XB 1MSHA 2B63H 3HOWG 3S16H 3HOWB 3I72A 1AP0A 2OT2A 1QUQA 4K6LA 2FXQA 5C4HA 3RZOH 4KJOA 1PH2A 2FMMA 5C4JB 2IX1A 5C0XH 4QUFA 4S3SA 1WTOA 3D3RA 4DV4Q 3G6EA 4ZUJA 1TWFH 1WOCA 3W2DA 1ICWA 5FO7B 2XNAC 5C3WA 4OO1G 3EIVA 1QVCA 3KOJA 1DCZA 1W2BA 4DR2L 1Q90A 2VXWA 3NTHA 3ERQA 4PZ7A 1EYAA 2ENBA 2EYHA 1WI5A 4KN7C 1VF7A 3LWEA 3HFZB 3RMHA 3NWTA 2K7VA 3ZJYC 3DWQA 1JMCA 1ESFA 3T51B 3TP8A 1HTPA 2FINB 3OW7A 3S17B 4IUUA 2NVQB 3FPPA 2I5HA 4M1UB 2PMZE 4HMIA 1F9QA 4OIKA 3OYYA 1B9NA 1NMFA 1IL8A 1ESRA 4LNQA 5M3FG 5IYBG 1XNQQ 5M3FB 1ICFB 1L2FA 1MJEA 1HR0Q 1LYLA 5JEAJ 1RL2A 5K36H 4BY1H 2F0MA 3J7AF 3D4DA 1S5DD 4QUCA 3CMAA 2RBMA 3T53B 2X6GA 4CHTB 2BH8A 2CW0C 1Q8KA 4KY5A 4F88A 3HKZE 4DNRB 5IYDH 4JI3Q 1RDPD 1I94Q 1X6OA 4K5WA 4A3GH 1LO5D 1NCVA 4ZRZA 1CA6A 1K83B 3KDFA 2OF1A 3H0GH 4Q5VA 1HA6A 4R4OA 3K7AH 4KK7A 2VUMG 3HOZH 5JOBA 2VUMB 4FF2A 3TQYA 5JJLA 1EU3A 1OXUA 4JVZA 3QIAA 5T1GA 3H15A 2MPMA 2KHJA 2F03A 4CJ1B 3NHHA 5D3DA 3S1QH 2K5DA 1FNVA 4ZAIA 5FKAC 4WJ4A 4H7BA 5EPKA 3ICEA 3NTIA 1EWCA 2HD3A 5CYUA 4MNOA 3TDQA 5C5LA 5ELBA 1PH6A 3N6RA 4DV2L 5CV9A 3G6JB 4UAIA 4DR1L 2UUCL 1PYBA 4R4QA 4MN3A 1OXVA 3K59A 4OHJA 3D6WA 2WB1G 4FXGC 4YIJA 2WB1B 1F2MA 4NXNL 1Y69U 3BS1A 1EY8A 3BVGA 3I73A 3KLWA 1SNQA 4L5TA 4QB4A 5IWAQ 3S2DB 1TS4A 1PTOC 2CKZB 4ABNA 1I4PA 2WKDA 1OXXK 4DK6C 1U4RA 1N36L 1KDAA 1HNXQ 4N9PA 1VQDA 2ZJPA 1R9TB 3MXNB 2KEDA 5M5WB 4QJFA 2BOSA 2MP1A 2ICIA 4KY6A 1YHQA 2K4KA 2PO4A 2KBNA 4PQXA 3OWEB 1GO3E 1BO0A 3OTOL 4RGTA 4L5RC 3RN5A 2H5XA 5JEAG 2VQEQ 1N9WA 5LMUQ 5G3LD 1F9PA 2EE1A 4A4IA 1HQMC 1Y8PB 3EN2A 3L2PA 2PMZB 3HP3A 5LMNL 4B3TQ 2EY2A 3LWUA 4TQUS 3VYSA 1HTLD 2ZJRA 2EY6A 1YHBA 2B29A 1J5EQ 1YNND 1EYDA 3QOLA 3TMEA 3J80E 1CZWA 1H9KA 2PNHA 2PZUA 2ZTCA 1KDCA 2QF7A 1C7YA 1U0LA 4DK1A 2B2WA 3RNUA 3BG3A 4K0KL 3HKZG 1GHJA 1PZID 3HKZB 1Z9FA 4V190 3TS2A 2UXDQ 1UUPA 1Y1VG 2I5MX 5JJKA 4DR5Q 1Y1VB 3H94A 3J7YW 1TWCH 1ASZA 1BCPF 3S1MH 5LL6X 2Z4HA 3HKSA 4MHEA 3HOVH 1K28A 3KUPA 1Q86C 4CDFC 1E7ZA 1FR3A 5KNCA 3H3VI 2IHEA 4LFAL 2AWNA 1N33Q 4X6AH 1TU2B 1JOKA 5NUCA 4Q0FA 4RFBA 5BR8Q 2Q8TA 2JA6H 2UXBQ 1JORA 3PUYA 1PHJA 3PF5A 4QMGA 2XN9C 2F3IA 1S40A 1RTNA 4A3IH 1PRTF 1VQ5A 1IKMA 1BBUA 4OIJA 4UP8A 2K6AA 4F8MA 1HQRD 4CKBA 4HIKA 3NWSA 4DV6Q 4ZCKA 1NSNS 2K75A 1ZEQX 5M5XH 5K5PA 3J81c 1U9RA 3E0EA 1F9SA 3GP7A 2Z9HA 2RHSB 1AE3A 2Z6KC 3FMCA 4G7ZC 5JVG3 3FKIG 1A3VA 3VR2A 3FKIB 5AJ3Q 1CSQA 1XXGA 2Q2UA 4GKJL 3I8ZA 5IGBA 1SYCA 1EWHA 4B3SL 4IUTA 1L1OA 2LXJA 4IPGA 4OL7A 3VDYA 1MBYA 1A15A 1MKHA 3QWNA 1YITA 3A56A 2KOLA 3V05A 4E6IA 3X3MA 3IRBA 3PO2G 2CVRA 3HOYB 3PO2B 2R3ZA 2DN8A 3QO2A 3CCLA 4FF3A 4OWWB 3CCRA 2WINB 4X66L 2EYFA 4CBVA 4JI6L 3UDXA 3S2HH 4GZYC 2AKWB 4K8IA 1EYGA 3VR5A 4KHVA 1A2UA 1KDBA 1O7LA 3M4YA 4FYDA 3M4OB 4DR2Q 1S3OA 1P16A 1YBYA 4O42A 3KF8B 5EGTA 1CUKA 4IZ8A 2MQHA 4R9WA 1X56A 1TT2A 1IW7D 2N8NA 4QF4A 2EYLA 3U9SA 1TWAH 4K8JA 4A76A 4GN5A 4DAPA 4YHHL 1HA5A 4JBMA 1DYQA 1HNZQ 1Y8OB 2FMCA 2IT1A 2B2VA 3U58A 3S1NH 1LT3D 1S5CD 1YNJC 3HOXG 4A3MH 1EY5A 1QWYA 3NSWA 5D14A 3HOXB 1AW7A 2JA5G 3N52A 2O2LD 1EOVA 1Y1WH 3GTGB 4DU9A 2JA5B 1FJGL 3WWVA 4BY7H 1V8QA 1G291 3HRZC 2K33A 1TY2A 1VQOA 2JA8G 3W5OA 2JA8B 3K5MA 1AE2A 3GTLB 2YV5A 4NMZA 2R92G 3GTPB 2BH2A 1SN8A 3NBHB 3L9AX 3ZYYX 3SK8A 3TP6A 3RUZA 1KXLA 4GLVB 3GTMH 2DY8A 3KLSA 5C0XI 1SE4A 4LF6L 1HFGA 3IL8A 4BBSH 3WOEA 1WTPA 3T56B 3BYYB 1B50A 2K5VA 2F4IA 4RAUC 4HSVA 4XT3B 2F1MA 4B3SQ 2KCTA 2K5NA 4J8QA 1I3QH 2DUDA 1E3PA 5T1IA 2HDMA 3T13A 3K57A 2D2CC 5ELNA 3URYA 2DJGC 2NN6G 4O2DA 2NZOA 1ILQA 5CV6A 4DA2A 3OSOA 3A7AB 2QEXA 2JA7G 1DJRD 1FNUA 2JA7B 4X65L 1TS5A 2JE6I 3KBGA 5JAVA 1U4MA 1E24A 1A8VA 2PW5A 4DV2Q 4KLKA 3A5UA 3A8JE 4DR1Q 2UUCQ 1IL2A 4DV7L 3K58A 4XDXA 4HIMA 4K5XA 4CDDC 1EY9A 3CQZH 1EQQA 4KD4A 3FRPB 1CKNB 4KKUA 1KRTA 3C3LA 1VQLA 4H44C 1O7YA 1N34L 4JI4Q 1WD0A 1MJCA 1RODA 1SBBB 3SK6A 2D0OA 4Z9CB 4QCLA 3RZDH 3H3VH 3HGBA 3R2IA 4UY8C 1PH1A 1ZKOA 3G48A 5E4XA 4DUZL 2K5QA 5KYIA 4A3BG 2CW0D 4A3BB 3MFYA 4DR7L 5C0XJ 1VQPA 1I6VC 1SE2A 2KJXA 3OTOQ 5IT9c 1CQFA 4IN3A 1EYCA 5CBAE 1KC8C 1BXTA 1CT1D 3I7FA 2L5TA 3PQIA 1STEA 4RMFA 1ET6A 3DXJC 4L63B 5LMNQ 1PH8A 1O7IA 5CV5A 5CMDA 3R93A 1SJHD 4POFA 1VDZA 2A6EC 5EBCA 2EDGA 1I50B 4Y7NH 4AQYL 3M3YB 1SAPA 3J80c 1EZ6A 5M3MG 1VQGA 2XRQD 1XTCD 3E5SA 2K14A 3SGIA 5M3MB 4F7XA 1TWGB 1EUJA 1X65A 2K5HA 2ZTEA 1UE1A 2E2HB 4R4CA 1RIPA 2M2LA 1AZPA 1L0WA 4L8JA 5KEEA 4RH6A 2F0JA 5A2QL 3J81i 4LF5L 3RD4A 2BE5C 2HCIA 2RCFA 1HRJA 1NE3A 2F0NA 3NTKA 2UXCL 2F0WA 2F0EA 5ELFA 4LFAQ 3U50C 2QA4A 1JT8A 1VQIA 3L7ZC 1B9MA 1H9SA 2WFWA 4A3KB 2H4OA 1PTOD 4TSSA 2SEBD 2PZTA 3JC66 2OEOA 2YTYA 4BBRH 2LXKA 1XMQQ 3JAMc 2R7FA 2AQ1B 1GVPA 1YIJA 2ATWA 1HR0W 1T9HA 3K81C 4A3DH 2CCZA 1VF5C 5FJ8H 1GUOA 5ISRA 1KNEA 1E22A 1WJJA 5HGQA 1F2LA 2CHBD 2HUGA 3LNNA 4ZKBB 4IO9A 3ITPA 4C56C 4JI2L 1VQEA 4WRDA 2MJ8A 4F87A 1QVGA 3MTSA 2QDBA 1Q1EA 4KKSA 1FGBD 4GKJQ 5IP9H 4GOPB 2TSSA 1KTKA 2X6LA 2EXDA 3MA2B 1XX8A 2RA4A 3BDOA 1JCKB 3PIPA 4DR3L 5C0XG 1QZHA 3RZOB 5M9OA 3GTJB 3PO3H 2UUBL 3OHXC 5LHY1 1LV9A 4APVA 3ERSX 2AHOB 4A93H 5CR3A 4DNIA 1TWFB 3EROA 4IFDJ 4HCSA 1KAWA 1ET9A 3G7LA 1AZQA 4FDBA 1Z6HA 1Z7TA 4HMJA 3CCUA 3S15H 1LTGD 2A8VA 2PNRC 1X3PA 1I6HB 4X66Q 3F2UA 1JQYD 2VS1A 3OIPA 4JI6Q 2AUJD 1GJXA 4CDEC 4PMBA 1STYA 1M8AA 2DNEA 2EJFC 5KNBA 2OWOA 2WB1E 3HOUG 5E1FA 2RCNA 1STGA 4CJ0B 3HOUB 4HN7A 3EVQA 1EFID 2DNCA 3RR5A 3STBC 1SLJA 2IHFA 2Y0SE 2EJMA 2E5LL 2NVTH 1S4ZA 1HHVA 1QZGA 2OTLA 2F0TA 4C3HH 2HHHL 5C3EH 1ENFA 5I9PA 2A69C 2NWGA 4MTKA 1SMYC 3I4LA 5FLMH 4HSPA 1V9PA 3PV0A 5IOCA 1K3RA 3EBEA 4IOAA 2RF4A 3Q22A 3C1EA 3ONAB 4RGOS 3CCSA 4UHVA 4UP9A 2K03A 1LM0A 1VQFA 2OCEA 1WVLA 3PF4A 3DUZA 1KIXA 1OXSC 4YWMA 1V1PB 3ND9A 2G9HD 4IUPA 1FJGQ 5C4JH 1GD7A 1LTAD 4YCVA 3A5ZB 4LUZA 4HJ7A 1E2VA 5IYDG 1CKMA 1RD9D 5ELDA 1UE7A 3C1FA 4DAVA 2EJGC 1DOMA 1PH4A 4FXDA 4DAYB 4C2MH 2BA0A 5HURA 2MO1A 1X3FA 3H0GG 3U4ZA 4ZLTF 3H0GB 5CV4A 3CD6A 2EYMA 1OO9B 4DAMA 4OO1H 1XWEA 1SEBD 4N9TA 4AIMA 2J4XA 2PQAB 1D7QA 2YU9B 1YZ6A 2WKCA 4DGZA 3HOZB 1QE6A 4LF6Q 3CU7A 2L0CA 4ODGA 3SDZA 1MI2A 1JR0D 3QG1A 3K0YA 5ELEA 1QVFA 3CRLC 4QY7A 5BN3A 4HJ5A 3SE0A 4QQBX 4JOIA 2JYOA 3MAQA 3E9IA 2D62A 4IFDG 4X3SA 5J3BA 3S1QB 1J6QA 1K0RA 4XYOA 3R3OA 3UDIA 1A0IA 1B3QA 4GNXA 3S17H 3Q24A 3R8BA 2NVQH 3OMCA 1ONLA 3TEHB 4JBJA 4DUYQ 5M3FH 5IYBH 4XQQA 5H1SE 2OXPA 3RLNA 2EYPA 3IFDA 4A3FG 3MEHA 2A68C 4KV6A 4NB3A 2Z0SA 4A3FB 4DV7Q 5C5MA 2PYKA 4EQNA 2JJQA 1X9NA 1PV4A 1EQRA 5IODA 4OX9L 3TREA 2BDNA 1SRUA 1DOLA 1E2ZA 1X3GA 2C9OA 2MNAA 1UAPA 1E1OA 3J81L 4X62L 1N34Q 3FPUB 2F0SA 3TS0A 2VNUD 1YNJD 2XWBB 3T16A 4XYQA 1SMXA 3KBXA 1TKWB 3KF8A 1C0AA 4UPAA 3F2DA 1XPUA 1K83H 3P7JA 3K80C 2M00A 4DUZQ 3M4PA 5EPLA 3J80i 5E7NA 3SR1A 4DV0L 2Y0SG 5KGUA 2IW3A 2Y0SB 1U5KA 2L15A 2Z4IA 4DR7Q 4JW0A 3CXCA 1X55A 5BN5A 4A3JH 4ZYSA 4GOPC 4XQJA 4V0BA 1YJNA 1A3TA 4JI8L 4I65A 4RHRA 1A6XA 2SDFA 4IUQA 5IGGA 3UDGA 1NR4A 2R7ZG 1SNDA 2R7ZB 3NEMA 1VQJA 5JJIA 3KF6A 5IT9E 1AFPA 4A3LG 2E74C 5EKKA 1PMRA 2CWPA 2KA7A 2CQAA 3CCMA 2L11A 4AQYQ 2L9HA 3K7UC 2NVYB 2DGYA 3PIP3 1LABA 3JAMi 1VMPA 2RSOA 2B2UC 4JC0A 5EKIA 2IWHA 3E3XA 5DEHA 1YHAA 1UNSA 1E0BA 4KHPL 2KCCA 1HNWL 3CCQA 2XSCA 3S1MB 2WACA 1QUQB 3HOVB 2NTTA 1TQOA 4J15A 1LT5D 4LF5Q 2I07B 4WJWA 1PH5A 2YTXA 3GDEA 4MTNA 4RCOA 4IUVA 3PUVA 1STHA 1I4RA 1WCMG 4JBWA 1WCMB 1K0SA 2B2TC 1VQAA 1A2TA 1JE5A 1PA6A 1Q8IA 4BS9A 3K5NA 1KHIA 1S5FD 3AEVA 1FNWA 1HUMA 2JK8A 1CM9A 2GVAA 1JC7A 2BCOA 5JEAH 3S1RH 1E1TA 2NB0A 4YY3L 4PNYA 4R1JA 1W3SA 1F9RA 3A0JA 1HH2P 3BDCA 4A3EH 3I90A 4BWGB 4NW2A 5M5YH 4ULLA 4TVAB 3KJPA 3JAME 1N32L 2VZAA 4HJ9A 4GLXA 4EVOA 1PZKD 2XWJB 1PYWD 1D8LA 1IYVA 4A3CG 5DAUA 4C3IH 4JI2Q 5EAYA 2HQLA 4KMUC 3I70A 1SSOA 5GAHC 3Q0AA 1G6PA 4DR3Q 1EIHA 2C5CA 2N88A 5CC4A 1ZYRC 4PMWA 4P72A 5J1ZA 5JPNC 1LTTD 2UUBQ 5FOBB 3TZDA 5IP7G 3ER0A 2A6ED 1Y1VH 4R4TA 1PFMA 4N8FA 4H0LC 5I6YA 1F2ZA 1X32A 3NBIA 4B3RL 1YJWA 5C6AA 5CBEE 1DXMA
chains in the Genus database with same CATH topology
2IJ0A 3SEBA 2IX3A 2FHTA 1DONA 3S2HB 4KN4C 1TS2A 5I9OA 1JWMD 1DD2A 5FO9B 5I2XA 3ND8A 1FYCA 4K5VA 2EZVA 3C2PA 2A5HA 1ENAA 2BE5D 1Q1BA 1S5BD 2B2YC 3D4WA 1JOQA 1TVXA 3GV6A 2MHVA 4FVMA 1SFOB 2EYOA 3DEPA 4PMCA 1BCPB 5FK9C 3S1NB 3H09A 2D5DA 3BZDB 3SK5A 1TWHB 1C8CA 4HEDA 3SXHA 1EIGA 1HCZA 5IT9L 1WD1A 1BR9A 4BY7B 1CHQD 1GUTA 2NUCA 3KLSX 4BA2I 1LTID 4RHSA 1SYEA 1PRTB 2J0TD 2ID0A 1KLGD 1BBXC 2PPBC 1RCVD 4P2CB 4IURA 1EY6A 3KK7A 3GTMB 1Q3LA 1CHPD 2B39A 3J80L 3HG9A 4BBSB 4XT1B 1NR2A 2RDHA 4HCEA 3NQIA 2R61A 3QJYA 4DFAA 4R8NA 4CGYB 3S14B 4M8AA 3M85A 2QEJC 4TKOB 2ZXRA 3VYUA 2VB2X 5DM73 4R8IA 1TY0A 3NK9A 4TRDA 2FJ2A 3Q6SA 1GUSA 3JAML 3SHLA 1MD2D 3CQZB 2A69D 1STBA 1SMYD 4EQPA 1EY7A 2BDOA 5DNFA 5EKLA 5TSSA 2NYZD 4HAEA 3I91A 1Z47A 4FF4A 3RZDB 3WOFA 3D4RA 4DF7A 5C44B 1G8ZD 1GOZA 3IKJA 5CV7A 3M7GA 4C1NK 4KI0A 1T5XD 4CKEA 3KLRA 1CI3M 4LAAA 1BDOA 2E2JB 3X3NA 3OPOA 1OXTA 4OO1I 1K8OA 2A73B 2SNSA 4ZKCB 4B9WA 1GUNA 3DMUA 3MXGA 3HEJA 2LMCB 3A8KE 5DM63 1KNAA 2F0PA 1SXTA 5D65A 2Q8IB 3D31A 2IPKD 1PXUA 4IUNA 1RHPA 3GD7A 1EY4A 4FF1A 3MWYW 1H9MA 3BYTB 4DXGA 2A68D 4RKBA 1LTRD 2O4XA 1BCPC 5LL6S 4G7HC 4KD3A 1WTXA 4BBRB 1D1KA 1W6KA 3I4MB 5E3FA 1QB5D 3PIO3 1R4PB 1RJTA 1II3A 2AQ2B 4A3DB 4XIGS 1PRTC 2WP8J 2ZXOA 2IL8A 4ID6A 2F0IA 1EU4A 5CV8A 2K05A 1FD7D 2Q8RE 2Z1CA 5COYA 2LS01 3IAYA 1CTMA 1EZ8A 3P1HA 3PO3B 1JWSD 1O80A 4HTHA 4OGQC 5KIXA 3MHBA 5EPJA 4K2LA 2N55A 3D6CA 3EFXD 5HGTA 1B3AA 1IYUA 4L6TB 1C4QA 5IIFA 2B63B 3RLFA 1B4OA 3S16B 1B44D 4IALA 5F2DA 4J1MA 1I4HA 3MXPA 3NE5B 3TZUA 2KVMA 4LMQD 3MXNA 4UDUC 4K2KA 1D1IA 2ZXPA 3S9WA 3OWFA 2QKIC 2MGSA 2EYJA 1DOKA 3GO5A 2NVTB 5ELCA 1TIID 3I3CA 1XYIA 2B2WC 2EY1A 3H3VC 3U9OA 3DM1A 4I7ZC 2D9UA 3H6MA 1PTOH 2WV6D 1SNOA 4MIUA 3C46A 4CJ2C 2AUKA 1B53A 3A55A 1SNMA 1V1OA 4ZUIA 2Z8LA 2L12A 4NKLA 4C2MB 3A54A 3AB9A 5K36G 4BY1B 3LX0A 1ZYRD 2K5WA 1T5EA 1LLRD 5IGEA 1PFNA 3NPPA 3K5LA 2TMPA 4A3GB 5IGCA 2PQEA 4CKCA 3VYTA 4KKTA 5A35A 1LTSD 1STNA 1L0YB 3SK4A 3OMGA 3K7AB 3TP7A 3AMUA 1SYGA 1UEAB 3DWAA 1QNUA 1KAAA 1QILA 1SDFA 1C48A 2H1EA 2LY7A 3DEOA 1D5ZC 1ILPA 5JPMC 1PZJD 4DNTB 2F3VA 2DY7A 1G2TA 1WTQA 4DK0A 3PMFA 4RGMA 1PDQA 5IGDA 3NP8A 1DZ1A 1EL0A 1SYDA 1QCBD 4RCNA 5CORA 4HR7B 4K14A 1SNCA 4A3JB 1IKLA 2RDGA 4XQNA 3MZ5A 4XTCS 1H9SB 4JK1C 2YYZA 5C4ZA 3MFGA 2B2VC 5G3LF 2XRSD 1QOHA 4C1NI 4IFDH 1I4QA 2V4DA 4G4KA 4RA8A 2EY5A 5I2YA 4WORA 3R2TA 2X69A 5I6WA 1AN8A 1TR5A 5EJWA 2F0DA 2JSOA 1F77A 2MUYA 4FXKC 5KRUA 1EOTA 4NP5A 2ICEC 1SJED 4X3KA 4X3UA 2QCPX 4G7OC 2E2DC 2PW7A 1I4XA 1JOOA 2A6HC 3NBHA 4J6HA 2F0FA 3V2TA 1TWCB 1AEXA 1E2WA 3P75A 3EA6A 3S1RB 1X3QA 5IGFA 3WDNA 4FO2A 2PCFB 2K28A 2RVLA 3BVMA 2QILA 4A3EB 3T4AC 2EOTA 4FNFA 2SOBA 5M5YB 1TS3A 2JA6B 3FVQA 1BNZA 2O5IC 4A3IB 3MVVA 3UI2A 4C3IG 1STAA 3HS0C 1Y8NB 4C3IB 1R4QB 1BOSA 1CFMA 1G6ZA 2HQEA 1O78A 1WTRA 3J7AV 5JVH3 5M5XB 2EVBA 2F0GA 5D3IB 1WTVA 3H91A 4LK1C 2NN6I 2A74C 3TSSA 1VMCA 3P20A 1RTOA 4RKLA 2JP1A 3W3AA 1JB3A 4B08A 1B1ZA 2RSNA 1BF4A 3VR4A 3MXUA 5J39A 1M4VA 1EQVA 1HPCA 2EPBA 4K6DA 3DWPA 5EBDA 3PUZA 2J7ZA 3CHBD 1BCPD 4PV1C 3VR3A 5BN4A 1DM0B 4NDXA 5I4DA 4DN4M 2L4NA 3BDLA 2RDFA 1IHZA 3TP5A 3K5OA 1TWAB 1PLFA 5E4WC 1EQTA 2E76C 3EQLC 5KNDA 2KECA 5C3XA 1PRTD 1SYBA 3CKIB 4ZQ3A 4WFN3 1RKNA 1EEFD 3GTKB 2K04A 4A3MB 4B9XA 2JXMB 1L0XB 1U4PA 1G91A 3FDTA 4QIWB 1Y1WB 2HDLA 2RKSA 1D5MC 1GUWA 3BVZA 4ME5A 5FLXE 3FEWX 2F0HA 3MC0B 4BA1I 1EY0A 1MSGA 1LTBD 3D8GA 2KUMA 3VA5A 1V43A 4KY7A 3I4NB 2F0VA 1JWUD 4X3TA 2LKVA 2O5JC 2AWOA 1I3QB 1ZXTA 5A2QE 3NUCA 1H9JA 3IFTA 1D2BA 2G9DA 1K8MA 1KLUD 1NAPA 1RF2D 3NQTA 1GHKA 3OIQA 4EGVA 4RWSC 2F0KA 3A8IE 1F2YA 2R92B 2NTSA 1QG7A 4FP5D 4RGNA 1EEID 4AYBB 2NVXB 3VYRA 2VB3X 2K1BA 1I4GA 4U673 3K6OA 1ML0D 3E0JA 2B2UA 5J22A 3NXWA 1QNKA 2FFKB 3OOCA 5EQ0A 2KQ3A 1B2TA 2JEBI 4G57A 5FO8B 1MGSA 2NBFA 2R6GA 1YNNC 2E2IB 3DHQA 1J8IA 3QOJA 1U4LA 3TBIB 2B2TA 2L1BA 3O13A 2BA1A 2PZWA 1V1PA 1Q12A 4Y7NB 3VR6A 2NN6H 1HXYD 3GV3A 1CQVA 1HFNA 4C3JG 1BQQT 1O7ZA 5KYLA 1QJOA 4C3JB 1GUGA 1D5XC 3EJIA 1JICA 4KJNA 4DAYA 4XXEA 2F0UA 1SNPA 1BUVT 2M9VA 3GTOB 2L55A 2RQXA 1PTOF 4U68A 2HCCA 1HUNA 1WTWA 4ZK9B 1JE4A 1CK1A 2KHSA 2IX0A 2F0QA 4ILWA 1LT6D 1SE3A 5FLXL 3E6ZX 2WIIB 3PUXA 5CGKA 3AU7A 4IQZA 2E75C 4DXFA 1W6JA 2SNMA 3SVMA 2NZ1D 3A7LA 3QB3A 2LFNA 3GTQB 3L3OC 1LACA 4IFDI 2GA4B 2ZT9C 2WAQB 2B2YA 4KHZA 1H9RA 5JJZA 1CA5A 1J9OA 2AQ3B 4A93B 2I46A 2F3WA 3HZXA 1D6EC 1VCIA 1CZGA 1GXDC 3S15B 1PFBA 1IW7C 3Q23A 1ENCA 2K32A 3TN2A 2R93B 4LJZC 4KTAA 2JEAI 1G2SA 2XVSA 3V96A 2A6HD 3PUWA 2F0OA 4EQOA 1A3UA 1PTOB 3J81E 1S5ED 2EXZA 4C3HG 3CRKC 5AFWA 3VA7A 4C3HB 5C3EB 1LT4D 3M7NA 3GQBA 4O1NA 2F0LA 2KCNA 1KABA 1NUCA 2B8GA 4H13C 2K01A 2KEEA 1SYFA 2B8FA 2XIWA 5C4XB 1MSHA 3HOWB 3I72A 1AP0A 2OT2A 4K6LA 5C4HA 4KJOA 2FMMA 5C4JB 2IX1A 5C0XH 4QUFA 4S3SA 1WTOA 3D3RA 4ZUJA 3W2DA 1ICWA 5FO7B 2XNAC 5C3WA 4OO1G 1DCZA 1Q90A 2VXWA 3ERQA 3NTHA 1EYAA 2ENBA 2EYHA 4KN7C 1VF7A 3LWEA 3RMHA 3NWTA 2K7VA 3DWQA 1ESFA 3T51B 3TP8A 1HTPA 2FINB 3OW7A 3S17B 4IUUA 2NVQB 3FPPA 4M1UB 4HMIA 1F9QA 4OIKA 1B9NA 1IL8A 1ESRA 5M3FB 5JEAJ 5K36H 2F0MA 3J7AF 3D4DA 1S5DD 4QUCA 2RBMA 3T53B 2X6GA 4CHTB 2CW0C 4KY5A 4F88A 4DNRB 1RDPD 4K5WA 1LO5D 1NCVA 4ZRZA 1CA6A 1K83B 2OF1A 4Q5VA 1HA6A 4KK7A 5JOBA 2VUMB 4FF2A 1EU3A 1OXUA 3QIAA 5T1GA 2MPMA 2F03A 4CJ1B 3NHHA 5D3DA 2K5DA 1FNVA 4ZAIA 5FKAC 4H7BA 5EPKA 3NTIA 1EWCA 5CYUA 3TDQA 5C5LA 5ELBA 3N6RA 5CV9A 3G6JB 4UAIA 4MN3A 1OXVA 3K59A 4OHJA 3D6WA 4YIJA 4FXGC 2WB1B 1F2MA 1Y69U 3BS1A 1EY8A 3BVGA 3I73A 1SNQA 4QB4A 3S2DB 1TS4A 1PTOC 4ABNA 1I4PA 2WKDA 1OXXK 1U4RA 1KDAA 4N9PA 1R9TB 5M5WB 2KEDA 2BOSA 2MP1A 2ICIA 4KY6A 2PO4A 4PQXA 3OWEB 1BO0A 4RGTA 5JEAG 5G3LD 1F9PA 2EE1A 1HQMC 1Y8PB 2PMZB 3HP3A 2EY2A 3LWUA 4TQUS 3VYSA 1HTLD 2EY6A 1YNND 1EYDA 3QOLA 3TMEA 3J80E 1CZWA 1H9KA 2PZUA 1KDCA 2QF7A 4DK1A 2B2WA 3BG3A 1GHJA 1PZID 3HKZB 4V190 1UUPA 1Y1VB 3H94A 3J7YW 1BCPF 5LL6X 2Z4HA 4MHEA 3KUPA 1FR3A 5KNCA 2AWNA 1TU2B 1JOKA 5NUCA 4Q0FA 4RFBA 2Q8TA 1JORA 3PUYA 4QMGA 2XN9C 1RTNA 1PRTF 1IKMA 4OIJA 2K6AA 4F8MA 1HQRD 4CKBA 3NWSA 1NSNS 1ZEQX 5K5PA 1U9RA 1F9SA 3GP7A 3FMCA 4G7ZC 5JVG3 1A3VA 3VR2A 3FKIB 1XXGA 3I8ZA 5IGBA 1SYCA 1EWHA 4IUTA 4OL7A 1MBYA 1A15A 3QWNA 3A56A 2KOLA 3V05A 4E6IA 3X3MA 2CVRA 3HOYB 3PO2B 2R3ZA 2DN8A 3QO2A 4FF3A 2WINB 2EYFA 4CBVA 4GZYC 4K8IA 3VR5A 4KHVA 1A2UA 1KDBA 1O7LA 3M4YA 4FYDA 3M4OB 4O42A 5EGTA 4IZ8A 4R9WA 1TT2A 1IW7D 4QF4A 2EYLA 3U9SA 4K8JA 4DAPA 1HA5A 1DYQA 1Y8OB 2FMCA 2IT1A 2B2VA 1LT3D 1S5CD 1YNJC 1EY5A 1QWYA 3NSWA 5D14A 3HOXB 1AW7A 3N52A 2O2LD 3GTGB 2JA5B 4DU9A 1V8QA 1G291 3HRZC 2K33A 1TY2A 2JA8B 3K5MA 3GTLB 4NMZA 3GTPB 3L9AX 3ZYYX 3SK8A 3TP6A 3RUZA 2DY8A 3KLSA 5C0XI 1SE4A 1HFGA 3IL8A 3WOEA 1WTPA 3T56B 3BYYB 1B50A 2F4IA 4RAUC 4HSVA 4XT3B 2F1MA 4J8QA 5T1IA 2HDMA 3T13A 3K57A 2D2CC 3URYA 2NN6G 5CV6A 1ILQA 4DA2A 3OSOA 3A7AB 1DJRD 1FNUA 2JA7B 1TS5A 2JE6I 3KBGA 5JAVA 1U4MA 2PW5A 3A8JE 3K58A 4XDXA 4K5XA 1EY9A 4KD4A 3FRPB 4KKUA 3C3LA 4H44C 1O7YA 1WD0A 1RODA 1SBBB 3SK6A 4Z9CB 4QCLA 3HGBA 3R2IA 1ZKOA 5E4XA 2K5QA 5KYIA 2CW0D 4A3BB 3MFYA 5C0XJ 1I6VC 1SE2A 2KJXA 1CQFA 4IN3A 1EYCA 5CBAE 1BXTA 1CT1D 2L5TA 1STEA 1ET6A 3DXJC 4L63B 5CV5A 5CMDA 3R93A 1SJHD 1VDZA 2A6EC 5EBCA 2EDGA 1I50B 3M3YB 1SAPA 1EZ6A 2XRQD 1XTCD 3E5SA 5M3MB 4F7XA 1TWGB 2E2HB 2M2LA 1AZPA 4L8JA 5KEEA 4RH6A 2F0JA 5A2QL 3RD4A 2BE5C 2HCIA 1HRJA 2F0NA 3NTKA 2F0WA 2F0EA 5ELFA 3L7ZC 1B9MA 1H9SA 4A3KB 2H4OA 1PTOD 4TSSA 2SEBD 2PZTA 2OEOA 2AQ1B 1VF5C 1GUOA 5ISRA 1KNEA 1F2LA 2CHBD 2HUGA 3LNNA 4ZKBB 3ITPA 4C56C 4WRDA 2MJ8A 4F87A 3MTSA 2QDBA 1Q1EA 4KKSA 1FGBD 2TSSA 1KTKA 2X6LA 3MA2B 1XX8A 2RA4A 3BDOA 1JCKB 3RZOB 5C0XG 5M9OA 3GTJB 3OHXC 5LHY1 1LV9A 5CR3A 4IFDJ 1TWFB 3EROA 4HCSA 1ET9A 3G7LA 1AZQA 1Z6HA 1Z7TA 4HMJA 1LTGD 2PNRC 1X3PA 1I6HB 3F2UA 1JQYD 3OIPA 2AUJD 1GJXA 4PMBA 1STYA 1M8AA 2DNEA 2EJFC 5KNBA 5E1FA 1STGA 4CJ0B 3HOUB 4HN7A 3EVQA 1EFID 2DNCA 2EJMA 1S4ZA 1HHVA 2F0TA 1ENFA 5I9PA 2A69C 2NWGA 1SMYC 3I4LA 4HSPA 3PV0A 5IOCA 3Q22A 3C1EA 3ONAB 4RGOS 2K03A 1WVLA 3DUZA 1OXSC 1V1PB 3ND9A 2G9HD 4IUPA 1LTAD 1E2VA 5ELDA 1RD9D 3C1FA 4DAVA 2EJGC 1DOMA 4FXDA 5HURA 2BA0A 4ZLTF 3H0GB 5CV4A 2EYMA 1OO9B 4OO1H 1XWEA 1SEBD 4N9TA 2J4XA 2YU9B 3HOZB 2WKCA 4DGZA 1QE6A 3SDZA 2L0CA 3CU7A 4ODGA 1MI2A 1JR0D 3QG1A 3K0YA 5ELEA 3CRLC 5BN3A 3SE0A 2JYOA 3MAQA 2D62A 4IFDG 4X3SA 3S1QB 4XYOA 3R3OA 3Q24A 3R8BA 3OMCA 1ONLA 4XQQA 2OXPA 2EYPA 3IFDA 3MEHA 2A68C 4KV6A 4A3FB 5C5MA 2PYKA 4EQNA 5IODA 2BDNA 1DOLA 1E2ZA 2C9OA 1UAPA 3J81L 3FPUB 2F0SA 2VNUD 1YNJD 2XWBB 3T16A 4XYQA 3KBXA 1TKWB 3KF8A 3P7JA 2M00A 5EPLA 3SR1A 5KGUA 2IW3A 2Y0SB 2Z4IA 5BN5A 4ZYSA 4XQJA 4V0BA 1A3TA 4I65A 4RHRA 1A6XA 2SDFA 4IUQA 5IGGA 1NR4A 1SNDA 2R7ZB 5IT9E 1AFPA 2E74C 5EKKA 1PMRA 2KA7A 2CQAA 2L11A 2L9HA 2NVYB 3PIP3 1LABA 1VMPA 2RSOA 2B2UC 5EKIA 2IWHA 5DEHA 1UNSA 1E0BA 2KCCA 2XSCA 3S1MB 2WACA 3HOVB 2NTTA 1TQOA 1LT5D 2I07B 4WJWA 4RCOA 4IUVA 3PUVA 1STHA 1I4RA 4JBWA 1WCMB 2B2TC 1A2TA 1Q8IA 4BS9A 3K5NA 1S5FD 1FNWA 1HUMA 1CM9A 1JC7A 2BCOA 5JEAH 2NB0A 4PNYA 1F9RA 3BDCA 3I90A 4BWGB 4NW2A 4ULLA 3JAME 4EVOA 1PZKD 2XWJB 1PYWD 1IYVA 5DAUA 4KMUC 3I70A 1SSOA 3Q0AA 1EIHA 2C5CA 2N88A 5CC4A 1ZYRC 4PMWA 5JPNC 5J1ZA 1LTTD 5FOBB 3TZDA 2A6ED 1PFMA 5I6YA 4H0LC 1F2ZA 1X32A 3NBIA 5C6AA 5CBEE 1DXMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AFW A;  1WTX A;  4XDX A;  2FHT A;  1DON A;  2FJ2 A;  4X3T A;  1RTO A;  1NCV A;  2L12 A;  1DOM A;  3Q6S A;  1CA6 A;  2JP1 A;  1ZXT A;  4O42 A;  2L11 A;  2B2W A;  4R9W A;  4U68 A;  2K01 A;  2L9H A;  1HA6 A;  4RA8 A;  2KEE A;  2RSN A;  4ZLT F;  1BF4 A;  1KNE A;  1RJT A;  2HCC A;  1O7Y A;  1F2L A;  1WD0 A;  1HUN A;  2XIW A;  2HUG A;  5DNF A;  1WTW A;  1ROD A;  1MSH A;  1VMP A;  4ZK9 B;  1JE4 A;  4ZKB B;  2IL8 A;  1NAP A;  2NYZ D;  2RSO A;  2B2U C;  4HAE A;  5EKI A;  1QE6 A;  3I91 A;  2K05 A;  2Q8R E;  1AP0 A;  2B2Y C;  2X69 A;  1E0B A;  2MJ8 A;  1MI2 A;  5COY A;  2EPB A;  3MTS A;  5T1G A;  1PFN A;  2MPM A;  2FMM A;  1TVX A;  3GV6 A;  5E4X A;  4MHE A;  4RWS C;  2X6L A;  3KUP A;  5EJW A;  1XX8 A;  2RA4 A;  4QUF A;  1WTO A;  4CJ1 B;  2J7Z A;  2B2V A;  2JYO A;  1QG7 A;  3DEP A;  3SVM A;  1LV9 A;  4ZAI A;  2NZ1 D;  4X3S A;  1EOT A;  1ICW A;  5D14 A;  5EPK A;  1O80 A;  5CBA E;  4IUV A;  4HCS A;  3N52 A;  2K1B A;  2Q8T A;  4HED A;  4DN4 M;  1C8C A;  1EIG A;  2L4N A;  3G7L A;  1AZQ A;  2B2T C;  5EPJ A;  2N55 A;  1RTN A;  4X3K A;  4X3U A;  1WD1 A;  1B3A A;  1IKM A;  4UAI A;  1X3P A;  4OIJ A;  1ML0 D;  4MN3 A;  1PLF A;  2B2U A;  1HUM A;  1B4O A;  5CMD A;  5E4W C;  3D6W A;  1SDF A;  1EQT A;  3R93 A;  1CM9 A;  2H1E A;  2B2Y A;  3DEO A;  1QNK A;  2KEC A;  3F2U A;  2VXW A;  3IFD A;  1ILP A;  2FFK B;  5EQ0 A;  4ZKC B;  1X3Q A;  1B2T A;  5JJZ A;  2KVM A;  1M8A A;  1F9R A;  3LWE A;  4LMQ D;  1MGS A;  2K28 A;  1CA5 A;  1J9O A;  3I90 A;  1BBX C;  2K04 A;  1F9S A;  1SAP A;  1U4R A;  2BDN A;  2RVL A;  4NW2 A;  4CJ0 B;  2DY7 A;  1DOL A;  4IUR A;  1G2T A;  2DY8 A;  2EOT A;  1WTQ A;  1U4P A;  1J8I A;  1KNA A;  1G91 A;  2MGS A;  1HFG A;  1S4Z A;  1HHV A;  1PDQ A;  1Q3L A;  3IL8 A;  3FDT A;  2KED A;  1DOK A;  3FPU B;  1WTP A;  1U4L A;  2FIN B;  5D65 A;  1BNZ A;  2HDL A;  3I8Z A;  4IUU A;  2MP1 A;  2B2T A;  3KBX A;  1B50 A;  4RAU C;  2M2L A;  4XT1 B;  2NWG A;  1AZP A;  1F9Q A;  4HSV A;  2L1B A;  4IUT A;  1NR2 A;  4OIK A;  1PFB A;  3I3C A;  4XT3 B;  3UI2 A;  1GUW A;  1IL8 A;  1BO0 A;  1DZ1 A;  1ESR A;  3P7J A;  1EL0 A;  2HCI A;  1SSO A;  1HRJ A;  5T1I A;  1XYI A;  1A15 A;  2B2W C;  2HDM A;  3ONA B;  5COR A;  5EPL A;  1EIH A;  1G6Z A;  2N88 A;  3TN2 A;  1WTR A;  1G2S A;  2K03 A;  2KOL A;  1RHP A;  1F9P A;  2EE1 A;  3DM1 A;  3TZD A;  3MWY W;  1WVL A;  1ILQ A;  2CVR A;  2D9U A;  3GV3 A;  4QUC A;  1HFN A;  1MSG A;  1WTV A;  1IKL A;  2R3Z A;  1O7Z A;  3H91 A;  2X6G A;  1PFM A;  3QO2 A;  2SDF A;  4IUQ A;  2KUM A;  3HP3 A;  4IUP A;  4CJ2 C;  1NR4 A;  1X32 A;  1JIC A;  1U4M A;  4R8I A;  1B53 A;  5CBE E;  1VMC A;  2B2V C; 
#chains in the Genus database with same CATH topology
 2IJ0 A;  3SEB A;  2IX3 A;  2FHT A;  1DON A;  3S2H B;  1NTG A;  4KN4 C;  3UDF A;  1TS2 A;  5I9O A;  1JWM D;  2K52 A;  1DD2 A;  5FO9 B;  5I2X A;  3F2C A;  3ND8 A;  1XPO A;  1FYC A;  4K5V A;  2EZV A;  3C2P A;  2A5H A;  1ENA A;  3HOY G;  2BE5 D;  1Q1B A;  3KDF B;  1S5B D;  2DJF C;  4DR6 L;  2B2Y C;  3CCV A;  3D4W A;  3PIO A;  1JOQ A;  1TVX A;  3GV6 A;  2HHH Q;  4LF9 L;  1IYJ B;  2MHV A;  1OTC A;  2Q2I A;  4FVM A;  1SFO B;  1B8A A;  2EYO A;  3DEP A;  4PMC A;  1EFW A;  4LFB L;  1BCP B;  1I5F A;  5FK9 C;  3S1N B;  3H09 A;  4DV5 L;  1EIY B;  2D5D A;  3BZD B;  3SK5 A;  1TWH B;  4IJH A;  1C8C A;  4HED A;  3SXH A;  1EIG A;  1HCZ A;  2HIX A;  5IT9 L;  3I56 A;  1WD1 A;  1BR9 A;  4IPC A;  4BY7 G;  4IJL A;  4BY7 B;  1CHQ D;  1GUT A;  4R4I A;  4GLA C;  2NUC A;  3KLS X;  4BA2 I;  1LTI D;  4RHS A;  1SYE A;  1WFQ A;  1PRT B;  2A1A A;  1Y14 B;  3GTK H;  2CQO A;  3PO2 H;  2J0T D;  1UE6 A;  2ID0 A;  1KLG D;  1BBX C;  2PPB C;  1RCV D;  4P2C B;  4IUR A;  4JBK A;  1EY6 A;  1G51 A;  3KK7 A;  3GTM B;  1Q3L A;  4JYA L;  1CHP D;  1MHW C;  2B39 A;  3CPF A;  3HG9 A;  3J80 L;  1UWV A;  2LSS A;  2NZH A;  4BBS B;  1PVO A;  4BXX H;  4XT1 B;  1NR2 A;  4O0A A;  5IYC H;  1EWI A;  2RDH A;  4L5Q A;  1S72 A;  3J7Z C;  4HCE A;  4PZ6 A;  3NQI A;  4EX5 A;  2R61 A;  3QJY A;  4DFA A;  4R8N A;  4CGY B;  3S14 B;  2GN5 A;  4LUO A;  4M8A A;  3M85 A;  3DM3 A;  2QEJ C;  4TKO B;  2ZXR A;  3VYU A;  2VB2 X;  3PCO B;  5DM7 3;  4POG A;  4R8I A;  1TY0 A;  3I4N H;  1VQK A;  2I5L X;  3STB D;  4IOC A;  3NK9 A;  4TRD A;  2FJ2 A;  4JI0 L;  3Q6S A;  4GKK L;  3HOX H;  1GUS A;  3JAM L;  4LWC A;  5GAD C;  3SHL A;  1MD2 D;  3CQZ B;  2A69 D;  3GTG H;  3I2Z A;  2JA5 H;  1STB A;  1SMY D;  4EQP A;  1EY7 A;  2BDO A;  4OX9 Q;  5DNF A;  5EKL A;  4DKA C;  5TSS A;  1WYD A;  2NYZ D;  4HAE A;  1HZB A;  3I91 A;  3KFU A;  4X62 Q;  1Z47 A;  4FF4 A;  3RZD B;  1JJ2 A;  3GTL H;  3WOF A;  4JCV E;  1X54 A;  2R92 H;  3D4R A;  5C44 G;  2N3S A;  4DF7 A;  5C44 B;  4NXN Q;  1G8Z D;  2NVX H;  1GOZ A;  4LFC L;  2EQS A;  1VQM A;  3IKJ A;  3BU2 A;  4DV0 Q;  4YCW A;  5CV7 A;  3M7G A;  4C1N K;  1IXR A;  4KI0 A;  1N36 Q;  1T5X D;  4JI8 Q;  3KLR A;  1CI3 M;  4LAA A;  4CKE A;  1LUZ A;  4PG3 A;  3CC7 A;  2ES2 A;  3G4S A;  1BDO A;  2E2J B;  3X3N A;  3OPO A;  1OXT A;  4OO1 I;  1K8O A;  2A73 B;  2SNS A;  2F52 A;  4ZKC B;  4B9W A;  4OXP A;  1GUN A;  1BVS A;  3DMU A;  3MXG A;  3HEJ A;  2E2I H;  2LMC B;  4LUV A;  1VQ4 A;  3A8K E;  5DM6 3;  1N8R C;  1KNA A;  4X64 L;  2F0P A;  1SXT A;  5D65 A;  1JB7 A;  2Q8I B;  1SR3 A;  5GAG C;  1KL9 A;  4KHP Q;  3D31 A;  2IPK D;  4HJA A;  1VQB A;  2D0P A;  1PXU A;  2PI2 A;  4IUN A;  4DV3 L;  1L1O B;  4I7A A;  4GNX C;  1RHP A;  1YVC A;  3GD7 A;  1EY4 A;  4FF1 A;  3MWY W;  1H9M A;  2KEN A;  3BYT B;  4C3J H;  4DXG A;  2A68 D;  4RKB A;  1LTR D;  3CCE A;  2Z6K A;  4K0K Q;  2O4X A;  1BCP C;  5LL6 S;  4DR4 L;  4JV5 L;  4G7H C;  4A3B H;  4KD3 A;  3I4M G;  1WTX A;  4BBR B;  1D1K A;  3GTO H;  1W6K A;  3I4M B;  3ULP A;  5E3F A;  1QB5 D;  4YY3 Q;  3NEN A;  1VQ7 A;  3PIO 3;  4A3D G;  1R4P B;  5FJ8 G;  1RJT A;  1II3 A;  2AQ2 B;  4A3D B;  4A3K G;  4XIG S;  1PRT C;  2WP8 J;  2ZXO A;  2IY5 B;  2IL8 A;  4ID6 A;  2A19 A;  2F0I A;  1EU4 A;  4AH6 A;  2K05 A;  1FD7 D;  2Q8R E;  2Z1C A;  5CV8 A;  5COY A;  1I50 H;  2ASB A;  1XMO L;  2C35 B;  5IP9 G;  2LS0 1;  1BBW A;  3IAY A;  1XJV A;  3PO3 G;  1CTM A;  1EZ8 A;  3P1H A;  1VQ8 A;  3PO3 B;  1JWS D;  1O80 A;  4HTH A;  1IBM L;  3GTQ H;  1NBW A;  4DR5 L;  4OGQ C;  5KIX A;  2E2H H;  3MHB A;  5EPJ A;  1H95 A;  4OWT B;  4K2L A;  2N55 A;  3D6C A;  3EFX D;  5HGT A;  1B3A A;  2B63 G;  1IYU A;  1P8L A;  4L6T B;  1C4Q A;  5IIF A;  2B63 B;  4CDC C;  3RLF A;  1B4O A;  4P73 A;  3S16 B;  3BJU A;  4B3R Q;  1B44 D;  1N33 L;  1IZ6 A;  4IAL A;  5F2D A;  2JQO A;  4J1M A;  1PH9 A;  1I4H A;  3MXP A;  3NE5 B;  3TZU A;  2KVM A;  4B3M L;  4LMQ D;  4HID A;  3MXN A;  4UDU C;  4K2K A;  1D1I A;  2ZXP A;  3S9W A;  3OWF A;  2QKI C;  2MGS A;  2EYJ A;  1DOK A;  2N49 A;  3GO5 A;  4DR6 Q;  2NVT B;  5ELC A;  4JI5 L;  1TII D;  3I3C A;  1VQC A;  1YNX A;  5FLM G;  2R93 H;  1XYI A;  2B2W C;  3T1H L;  2EY1 A;  4LF9 Q;  3H3V C;  3U9O A;  3DM1 A;  4LFB Q;  1KRS A;  1SE8 A;  4I7Z C;  2D9U A;  3H6M A;  1PTO H;  2WV6 D;  3FP9 A;  1SNO A;  4MIU A;  3C46 A;  4CJ2 C;  2AUK A;  2ZM6 L;  3KJO A;  2Q2T A;  3L0O A;  1KD1 C;  3A74 A;  1B53 A;  3GTJ H;  3A55 A;  1SNM A;  4QGU A;  1V1O A;  3ULL A;  4ZUI A;  2Z8L A;  4YHH Q;  2L12 A;  1LTL A;  4NKL A;  2QW7 A;  3NEL A;  3A54 A;  3AB9 A;  4C2M B;  3CCJ A;  3CC4 A;  4P75 A;  5C4X H;  4JPB W;  5K36 G;  1M1K C;  4BY1 G;  3ULJ A;  5FLX c;  3HOW H;  4BY1 B;  3LX0 A;  1VQ9 A;  1I6H H;  1ZYR D;  2K5W A;  1T5E A;  5L37 A;  1LLR D;  5IGE A;  4JYA Q;  1PFN A;  3NPP A;  4NXM L;  2MFI A;  3K5L A;  4A3G G;  2TMP A;  4A3G B;  3HOU H;  5IGC A;  1HZ9 A;  2VQF L;  2PQE A;  3MEF A;  4CKC A;  4WJ3 M;  3VYT A;  4KKT A;  5A35 A;  1LTS D;  1STN A;  1L0Y B;  3SK4 A;  3OMG A;  3K7A B;  3TP7 A;  3HOZ G;  3AMU A;  1HNZ L;  1L1O C;  1SYG A;  1UEA B;  4OWX B;  2AMC B;  3DWA A;  1QNU A;  1KAA A;  1QIL A;  2QGQ A;  3CAM A;  1SDF A;  1C48 A;  2H1E A;  2LY7 A;  3DEO A;  4H02 A;  3FHW A;  1D5Z C;  1ILP A;  4LF4 L;  5JPM C;  4N8X 1;  1PZJ D;  4DNT B;  2F3V A;  4JI0 Q;  4GKK Q;  4DV1 L;  1FVI A;  2DY7 A;  2R7D A;  1G2T A;  1WTQ A;  4DK0 A;  1EIF A;  2VY3 A;  3PMF A;  4RGM A;  1IBK L;  1PDQ A;  2G5D A;  1IBL L;  5IGD A;  3NP8 A;  4X65 Q;  1DZ1 A;  2F4V L;  4EQ5 A;  1YI2 A;  1EL0 A;  1SYD A;  1QCB D;  1ASY A;  4RCN A;  1NJI C;  5COR A;  4HR7 B;  4K14 A;  1SNC A;  2YU9 H;  4A3J G;  4LFC Q;  4A3J B;  1IKL A;  3BZC A;  2RDG A;  4XQN A;  3MZ5 A;  4XTC S;  2QDL A;  1H9S B;  4JK1 C;  2YYZ A;  5C4Z A;  3MFG A;  2B2V C;  5G3L F;  2XRS D;  1QOH A;  3M9B A;  4C1N I;  4DK3 C;  4IFD H;  2K50 A;  1I4Q A;  2V4D A;  4G4K A;  4RA8 A;  2VUM H;  3LGJ A;  2EY5 A;  1KQS A;  4JG2 A;  5I2Y A;  4X64 Q;  4WOR A;  3R2T A;  4PZ8 A;  2X69 A;  5I6W A;  1AN8 A;  1TR5 A;  1UE5 A;  4A3F H;  1A63 A;  5EJW A;  2F0D A;  2CWA A;  2JSO A;  1F77 A;  1BKB A;  2MUY A;  4FXK C;  5KRU A;  4JI4 L;  1EOT A;  4DV3 Q;  4NP5 A;  4YWL A;  4MZ9 A;  3CP0 A;  2CH4 A;  4ME3 A;  2ICE C;  1SJE D;  4X3K A;  4X3U A;  2QCP X;  2XGT A;  4G7O C;  2E2D C;  2JN4 A;  2PW7 A;  2MO0 A;  1I4X A;  1JOO A;  2A6H C;  3NBH A;  4J6H A;  2F0F A;  3W1G A;  4QIW E;  4DR4 Q;  4JV5 Q;  3S2D H;  3V2T A;  1TWC B;  1AEX A;  1E2W A;  2V1C C;  3P75 A;  3CF5 A;  3HOV G;  3EA6 A;  4Y52 H;  3S1R B;  1X3Q A;  5IGF A;  3WDN A;  4FO2 A;  1XPR A;  2EIF A;  2PCF B;  2K28 A;  2RVL A;  3BVM A;  2UXC Q;  2QIL A;  4A3E G;  4JI1 L;  4A3E B;  1K9M C;  3T4A C;  1R9T H;  2EOT A;  3F8T A;  3M4Q A;  5M5W H;  4FNF A;  3S24 A;  1K8A C;  2R7Z H;  2SOB A;  5M5Y B;  2UU9 L;  1JJG A;  2JA6 G;  1PH3 A;  1TS3 A;  2JA6 B;  3FVQ A;  1BNZ A;  3U4V A;  4A3I G;  2O5I C;  4A3L H;  4A3I B;  3MVV A;  3UI2 A;  1X3E A;  4C3I G;  1STA A;  3HS0 C;  1Y8N B;  2OQ0 A;  4C3I B;  1XMO Q;  1R4Q B;  1BOS A;  1CFM A;  1G6Z A;  2HQE A;  2NVY H;  1O78 A;  1WTR A;  3J7A V;  5JVH 3;  1Q7Y C;  2UUA L;  5M5X B;  2EVB A;  5IE8 A;  3CME A;  2F0G A;  5D3I B;  1WTV A;  2Q2H A;  3H91 A;  1IBM Q;  4P74 A;  1NNX A;  1SRO A;  4LK1 C;  1HZA A;  2NN6 I;  2A74 C;  3TSS A;  1VMC A;  3P20 A;  1K73 C;  2VW9 A;  3TRZ A;  1CKN A;  1RTO A;  1FGU A;  4RKL A;  2JP1 A;  4GS3 A;  3W3A A;  1JB3 A;  3OW2 A;  4B08 A;  1WCM H;  1B1Z A;  4B3M Q;  2RSN A;  1YEZ A;  1BF4 A;  3VR4 A;  3MXU A;  5J39 A;  3T1Y L;  1M4V A;  1EQV A;  1HPC A;  1Q46 A;  4AYB E;  1XMQ L;  2EPB A;  4LF8 L;  2RHQ B;  4K6D A;  3DWP A;  5EBD A;  4JI5 Q;  3PUZ A;  1HZC A;  1WTH A;  2J7Z A;  2VL6 A;  3CHB D;  1BCP D;  4PV1 C;  3VR3 A;  3T1H Q;  5BN4 A;  1C9O A;  1DM0 B;  4NDX A;  4IPH A;  4DN4 M;  5I4D A;  2L4N A;  3BDL A;  2RDF A;  4LF7 L;  1IHZ A;  3TP5 A;  3K5O A;  4A3C H;  2OQK A;  1TWA B;  4GNX B;  2E5L Q;  2ZM6 Q;  1PLF A;  5E4W C;  1EQT A;  2E76 C;  5HY6 A;  2YTV A;  3EQL C;  5C3X A;  2KEC A;  5KND A;  1PRT D;  1SYB A;  4JI7 L;  3CKI B;  4ZQ3 A;  1XNR L;  2JA9 A;  4WFN 3;  1RKN A;  4HJ8 A;  1EEF D;  5IP7 H;  3GTK B;  2K04 A;  4A3M G;  4A3M B;  3FKI H;  4B9X A;  2JXM B;  1L0X B;  1U4P A;  1G91 A;  4L5S A;  1Y1W G;  3FDT A;  4QIW B;  1Y1W B;  2HDL A;  2RKS A;  3RN2 A;  1D5M C;  2HIV A;  4BXX G;  1GUW A;  2GVB A;  4DV4 L;  5IYC G;  1GM5 A;  3I4O A;  3BVZ A;  4ME5 A;  5FLX E;  3FEW X;  2F0H A;  4NXM Q;  1Q81 C;  3MC0 B;  3HOY H;  4ALP A;  4BA1 I;  1GKH A;  2VQF Q;  1EY0 A;  1XTD A;  1MSG A;  2E8G A;  1LTB D;  3D8G A;  2KUM A;  2I0Q A;  1B7Y B;  4BBS G;  1CSP A;  3VA5 A;  1V43 A;  3I4N G;  1SFO H;  4KY7 A;  3I4N B;  3M4O H;  2F0V A;  1JWU D;  5LMN W;  4X3T A;  2LKV A;  4NPS A;  2O5J C;  2AWO A;  3KF6 B;  1I3Q B;  3F2B A;  1ZXT A;  1TWH H;  5A2Q E;  4LF4 Q;  3NUC A;  4QL5 A;  1H9J A;  3IFT A;  3K0X A;  1D2B A;  4DV1 Q;  2G9D A;  3QR8 A;  1K8M A;  3CC2 A;  1KLU D;  1NAP A;  1PFS A;  4GOP A;  1RF2 D;  1IBK Q;  3NQT A;  1GHK A;  3OIQ A;  1IBL Q;  4EGV A;  1XNQ L;  3AFP A;  4RWS C;  3G71 A;  2F0K A;  1HR0 L;  3A8I E;  1F2Y A;  4DPG A;  2R92 B;  2F4V Q;  2NTS A;  1QG7 A;  4FP5 D;  2WAQ E;  4GN4 B;  4AYB G;  4RGN A;  1EEI D;  4AYB B;  2NVX B;  4UP7 A;  2VB3 X;  3VYR A;  2K1B A;  1I4G A;  3AFQ A;  5GRO A;  3E9H A;  4U67 3;  4JI3 L;  3K6O A;  2N78 A;  1I94 L;  2JA8 H;  1ML0 D;  3E0J A;  1K3B C;  2B2U A;  5J22 A;  3NXW A;  1QNK A;  3GTP H;  1YJ9 A;  2FFK B;  2Z6B A;  3OOC A;  5EQ0 A;  2KQ3 A;  1B2T A;  3S14 H;  1NMG A;  2JEB I;  4G57 A;  5FO8 B;  3D0F A;  1MGS A;  2NBF A;  3PGZ A;  2R6G A;  1YNN C;  2ZJQ A;  2E2I B;  3DHQ A;  1VS0 A;  1J8I A;  3QOJ A;  5IY0 A;  4DUY L;  1CKO A;  1U4L A;  3TBI B;  2B2T A;  2L1B A;  3O13 A;  1UEB A;  2BA1 A;  2P5Z X;  1NY4 A;  2PZW A;  2KCM A;  1V1P A;  1Q12 A;  4Y7N B;  3VR6 A;  2NN6 H;  3BZK A;  2ALY B;  1HXY D;  5GAE C;  3GV3 A;  2JA7 H;  1CQV A;  1HFN A;  4C3J G;  1BQQ T;  1O7Z A;  5KYL A;  1VQ6 A;  1QJO A;  4C3J B;  2KHI A;  1FL0 A;  1GUG A;  1D5X C;  3EJI A;  1JIC A;  2CFM A;  2XTI A;  4KJN A;  4DAY A;  4XXE A;  2F0U A;  4JOI C;  4OEL B;  1SNP A;  5C44 H;  1A62 A;  1BUV T;  5IWA L;  3UE1 A;  1HNW Q;  2M9V A;  3GTO B;  2L55 A;  4YCU A;  2RQX A;  1MIU A;  2PQA A;  1PTO F;  1HNX L;  4U68 A;  5DLQ E;  3W1B A;  2HCC A;  1HUN A;  1TXY A;  1WTW A;  4ZK9 B;  4OON A;  4JI1 Q;  1JE4 A;  1Q82 C;  2B3G A;  1CK1 A;  2KHS A;  2IX0 A;  3KYH C;  2F0Q A;  4ILW A;  2E2J H;  1LT6 D;  2UU9 Q;  1AH9 A;  1SE3 A;  5FLX L;  3E6Z X;  2WII B;  3PUX A;  1VQN A;  5CGK A;  3AU7 A;  4IQZ A;  4BBR G;  2VQE L;  2E75 C;  4DXF A;  5LMU L;  1W6J A;  3B6Y A;  4YWK A;  3CPW A;  3J81 j;  2SNM A;  3SVM A;  1PYS B;  3RLO A;  3F1Z A;  2NZ1 D;  3A7L A;  3QB3 A;  2LFN A;  5ELO A;  2UUA Q;  4B3T L;  3GTQ B;  1V1Q A;  3L3O C;  1LAC A;  4IFD I;  3CW2 C;  4OEM B;  2GA4 B;  1J5E L;  1N32 Q;  3J7A 5;  2HT1 A;  1HJP A;  3K8A A;  5GQO A;  2WAQ G;  3Q8D A;  2ZT9 C;  2WAQ B;  2B2Y A;  4P71 A;  4KHZ A;  4RG1 A;  3M3Y H;  1H9R A;  5JJZ A;  1VQH A;  1CA5 A;  1J9O A;  2AQ3 B;  4HIO A;  4A93 G;  2UXD L;  5M3M H;  4A93 B;  1TWG H;  2I46 A;  1DGS A;  3I55 A;  1M90 C;  2F3W A;  3T1Y Q;  3HZX A;  1D6E C;  1VCI A;  2PI2 E;  1CZG A;  1GXD C;  3I4M H;  4GN3 B;  4LW1 A;  3S15 B;  1PFB A;  1IW7 C;  3Q23 A;  4LF8 Q;  1ENC A;  2CH4 W;  2R93 G;  2K32 A;  1JJC B;  3TN2 A;  2R93 B;  4A75 A;  4LJZ C;  4KTA A;  2JEA I;  1G2S A;  5BR8 L;  2XVS A;  2ZTD A;  3V96 A;  2UXB L;  2A6H D;  4A3K H;  3PUW A;  3DLL A;  2F0O A;  1B70 B;  3AQQ A;  4EQO A;  1A3U A;  1PTO B;  2OTJ A;  1PH7 A;  4LF7 Q;  3J81 E;  4DV6 L;  1S5E D;  2EXZ A;  4C3H G;  3CRK C;  5C3E G;  5AFW A;  3VA7 A;  4C3H B;  1K8G A;  5C3E B;  1LT4 D;  4IPD A;  3M7N A;  3GQB A;  3AYH B;  4O1N A;  2F0L A;  2KCN A;  3PSI A;  3UE0 A;  4JI7 Q;  1KAB A;  1NUC A;  1XNR Q;  2B8G A;  4H13 C;  2K01 A;  2KEE A;  1SYF A;  5C4X G;  2B8F A;  5AJ3 L;  2XIW A;  4DV5 Q;  5C4X B;  1MSH A;  2B63 H;  3HOW G;  3S16 H;  3HOW B;  3I72 A;  1AP0 A;  2OT2 A;  1QUQ A;  4K6L A;  2FXQ A;  5C4H A;  3RZO H;  4KJO A;  1PH2 A;  2FMM A;  5C4J B;  2IX1 A;  5C0X H;  4QUF A;  4S3S A;  1WTO A;  3D3R A;  4DV4 Q;  3G6E A;  4ZUJ A;  1TWF H;  1WOC A;  3W2D A;  1ICW A;  5FO7 B;  2XNA C;  5C3W A;  4OO1 G;  3EIV A;  1QVC A;  3KOJ A;  1DCZ A;  1W2B A;  4DR2 L;  1Q90 A;  2VXW A;  3NTH A;  3ERQ A;  4PZ7 A;  1EYA A;  2ENB A;  2EYH A;  1WI5 A;  4KN7 C;  1VF7 A;  3LWE A;  3HFZ B;  3RMH A;  3NWT A;  2K7V A;  3ZJY C;  3DWQ A;  1JMC A;  1ESF A;  3T51 B;  3TP8 A;  1HTP A;  2FIN B;  3OW7 A;  3S17 B;  4IUU A;  2NVQ B;  3FPP A;  2I5H A;  4M1U B;  2PMZ E;  4HMI A;  1F9Q A;  4OIK A;  3OYY A;  1B9N A;  1NMF A;  1IL8 A;  1ESR A;  4LNQ A;  5M3F G;  5IYB G;  1XNQ Q;  5M3F B;  1ICF B;  1L2F A;  1MJE A;  1HR0 Q;  1LYL A;  5JEA J;  1RL2 A;  5K36 H;  4BY1 H;  2F0M A;  3J7A F;  3D4D A;  1S5D D;  4QUC A;  3CMA A;  2RBM A;  3T53 B;  2X6G A;  4CHT B;  2BH8 A;  2CW0 C;  1Q8K A;  4KY5 A;  4F88 A;  3HKZ E;  4DNR B;  5IYD H;  4JI3 Q;  1RDP D;  1I94 Q;  1X6O A;  4K5W A;  4A3G H;  1LO5 D;  1NCV A;  4ZRZ A;  1CA6 A;  1K83 B;  3KDF A;  2OF1 A;  3H0G H;  4Q5V A;  1HA6 A;  4R4O A;  3K7A H;  4KK7 A;  2VUM G;  3HOZ H;  5JOB A;  2VUM B;  4FF2 A;  3TQY A;  5JJL A;  1EU3 A;  1OXU A;  4JVZ A;  3QIA A;  5T1G A;  3H15 A;  2MPM A;  2KHJ A;  2F03 A;  4CJ1 B;  3NHH A;  5D3D A;  3S1Q H;  2K5D A;  1FNV A;  4ZAI A;  5FKA C;  4WJ4 A;  4H7B A;  5EPK A;  3ICE A;  3NTI A;  1EWC A;  2HD3 A;  5CYU A;  4MNO A;  3TDQ A;  5C5L A;  5ELB A;  1PH6 A;  3N6R A;  4DV2 L;  5CV9 A;  3G6J B;  4UAI A;  4DR1 L;  2UUC L;  1PYB A;  4R4Q A;  4MN3 A;  1OXV A;  3K59 A;  4OHJ A;  3D6W A;  2WB1 G;  4FXG C;  4YIJ A;  2WB1 B;  1F2M A;  4NXN L;  1Y69 U;  3BS1 A;  1EY8 A;  3BVG A;  3I73 A;  3KLW A;  1SNQ A;  4L5T A;  4QB4 A;  5IWA Q;  3S2D B;  1TS4 A;  1PTO C;  2CKZ B;  4ABN A;  1I4P A;  2WKD A;  1OXX K;  4DK6 C;  1U4R A;  1N36 L;  1KDA A;  1HNX Q;  4N9P A;  1VQD A;  2ZJP A;  1R9T B;  3MXN B;  2KED A;  5M5W B;  4QJF A;  2BOS A;  2MP1 A;  2ICI A;  4KY6 A;  1YHQ A;  2K4K A;  2PO4 A;  2KBN A;  4PQX A;  3OWE B;  1GO3 E;  1BO0 A;  3OTO L;  4RGT A;  4L5R C;  3RN5 A;  2H5X A;  5JEA G;  2VQE Q;  1N9W A;  5LMU Q;  5G3L D;  1F9P A;  2EE1 A;  4A4I A;  1HQM C;  1Y8P B;  3EN2 A;  3L2P A;  2PMZ B;  3HP3 A;  5LMN L;  4B3T Q;  2EY2 A;  3LWU A;  4TQU S;  3VYS A;  1HTL D;  2ZJR A;  2EY6 A;  1YHB A;  2B29 A;  1J5E Q;  1YNN D;  1EYD A;  3QOL A;  3TME A;  3J80 E;  1CZW A;  1H9K A;  2PNH A;  2PZU A;  2ZTC A;  1KDC A;  2QF7 A;  1C7Y A;  1U0L A;  4DK1 A;  2B2W A;  3RNU A;  3BG3 A;  4K0K L;  3HKZ G;  1GHJ A;  1PZI D;  3HKZ B;  1Z9F A;  4V19 0;  3TS2 A;  2UXD Q;  1UUP A;  1Y1V G;  2I5M X;  5JJK A;  4DR5 Q;  1Y1V B;  3H94 A;  3J7Y W;  1TWC H;  1ASZ A;  1BCP F;  3S1M H;  5LL6 X;  2Z4H A;  3HKS A;  4MHE A;  3HOV H;  1K28 A;  3KUP A;  1Q86 C;  4CDF C;  1E7Z A;  1FR3 A;  5KNC A;  3H3V I;  2IHE A;  4LFA L;  2AWN A;  1N33 Q;  4X6A H;  1TU2 B;  1JOK A;  5NUC A;  4Q0F A;  4RFB A;  5BR8 Q;  2Q8T A;  2JA6 H;  2UXB Q;  1JOR A;  3PUY A;  1PHJ A;  3PF5 A;  4QMG A;  2XN9 C;  2F3I A;  1S40 A;  1RTN A;  4A3I H;  1PRT F;  1VQ5 A;  1IKM A;  1BBU A;  4OIJ A;  4UP8 A;  2K6A A;  4F8M A;  1HQR D;  4CKB A;  4HIK A;  3NWS A;  4DV6 Q;  4ZCK A;  1NSN S;  2K75 A;  1ZEQ X;  5M5X H;  5K5P A;  3J81 c;  1U9R A;  3E0E A;  1F9S A;  3GP7 A;  2Z9H A;  2RHS B;  1AE3 A;  2Z6K C;  3FMC A;  4G7Z C;  5JVG 3;  3FKI G;  1A3V A;  3VR2 A;  3FKI B;  5AJ3 Q;  1CSQ A;  1XXG A;  2Q2U A;  4GKJ L;  3I8Z A;  5IGB A;  1SYC A;  1EWH A;  4B3S L;  4IUT A;  1L1O A;  2LXJ A;  4IPG A;  4OL7 A;  3VDY A;  1MBY A;  1A15 A;  1MKH A;  3QWN A;  1YIT A;  3A56 A;  2KOL A;  3V05 A;  4E6I A;  3X3M A;  3IRB A;  3PO2 G;  2CVR A;  3HOY B;  3PO2 B;  2R3Z A;  2DN8 A;  3QO2 A;  3CCL A;  4FF3 A;  4OWW B;  3CCR A;  2WIN B;  4X66 L;  2EYF A;  4CBV A;  4JI6 L;  3UDX A;  3S2H H;  4GZY C;  2AKW B;  4K8I A;  1EYG A;  3VR5 A;  4KHV A;  1A2U A;  1KDB A;  1O7L A;  3M4Y A;  4FYD A;  3M4O B;  4DR2 Q;  1S3O A;  1P16 A;  1YBY A;  4O42 A;  3KF8 B;  5EGT A;  1CUK A;  4IZ8 A;  2MQH A;  4R9W A;  1X56 A;  1TT2 A;  1IW7 D;  2N8N A;  4QF4 A;  2EYL A;  3U9S A;  1TWA H;  4K8J A;  4A76 A;  4GN5 A;  4DAP A;  4YHH L;  1HA5 A;  4JBM A;  1DYQ A;  1HNZ Q;  1Y8O B;  2FMC A;  2IT1 A;  2B2V A;  3U58 A;  3S1N H;  1LT3 D;  1S5C D;  1YNJ C;  3HOX G;  4A3M H;  1EY5 A;  1QWY A;  3NSW A;  5D14 A;  3HOX B;  1AW7 A;  2JA5 G;  3N52 A;  2O2L D;  1EOV A;  1Y1W H;  3GTG B;  4DU9 A;  2JA5 B;  1FJG L;  3WWV A;  4BY7 H;  1V8Q A;  1G29 1;  3HRZ C;  2K33 A;  1TY2 A;  1VQO A;  2JA8 G;  3W5O A;  2JA8 B;  3K5M A;  1AE2 A;  3GTL B;  2YV5 A;  4NMZ A;  2R92 G;  3GTP B;  2BH2 A;  1SN8 A;  3NBH B;  3L9A X;  3ZYY X;  3SK8 A;  3TP6 A;  3RUZ A;  1KXL A;  4GLV B;  3GTM H;  2DY8 A;  3KLS A;  5C0X I;  1SE4 A;  4LF6 L;  1HFG A;  3IL8 A;  4BBS H;  3WOE A;  1WTP A;  3T56 B;  3BYY B;  1B50 A;  2K5V A;  2F4I A;  4RAU C;  4HSV A;  4XT3 B;  2F1M A;  4B3S Q;  2KCT A;  2K5N A;  4J8Q A;  1I3Q H;  2DUD A;  1E3P A;  5T1I A;  2HDM A;  3T13 A;  3K57 A;  2D2C C;  5ELN A;  3URY A;  2DJG C;  2NN6 G;  4O2D A;  2NZO A;  1ILQ A;  5CV6 A;  4DA2 A;  3OSO A;  3A7A B;  2QEX A;  2JA7 G;  1DJR D;  1FNU A;  2JA7 B;  4X65 L;  1TS5 A;  2JE6 I;  3KBG A;  5JAV A;  1U4M A;  1E24 A;  1A8V A;  2PW5 A;  4DV2 Q;  4KLK A;  3A5U A;  3A8J E;  4DR1 Q;  2UUC Q;  1IL2 A;  4DV7 L;  3K58 A;  4XDX A;  4HIM A;  4K5X A;  4CDD C;  1EY9 A;  3CQZ H;  1EQQ A;  4KD4 A;  3FRP B;  1CKN B;  4KKU A;  1KRT A;  3C3L A;  1VQL A;  4H44 C;  1O7Y A;  1N34 L;  4JI4 Q;  1WD0 A;  1MJC A;  1ROD A;  1SBB B;  3SK6 A;  2D0O A;  4Z9C B;  4QCL A;  3RZD H;  3H3V H;  3HGB A;  3R2I A;  4UY8 C;  1PH1 A;  1ZKO A;  3G48 A;  5E4X A;  4DUZ L;  2K5Q A;  5KYI A;  4A3B G;  2CW0 D;  4A3B B;  3MFY A;  4DR7 L;  5C0X J;  1VQP A;  1I6V C;  1SE2 A;  2KJX A;  3OTO Q;  5IT9 c;  1CQF A;  4IN3 A;  1EYC A;  5CBA E;  1KC8 C;  1BXT A;  1CT1 D;  3I7F A;  2L5T A;  3PQI A;  1STE A;  4RMF A;  1ET6 A;  3DXJ C;  4L63 B;  5LMN Q;  1PH8 A;  1O7I A;  5CV5 A;  5CMD A;  3R93 A;  1SJH D;  4POF A;  1VDZ A;  2A6E C;  5EBC A;  2EDG A;  1I50 B;  4Y7N H;  4AQY L;  3M3Y B;  1SAP A;  3J80 c;  1EZ6 A;  5M3M G;  1VQG A;  2XRQ D;  1XTC D;  3E5S A;  2K14 A;  3SGI A;  5M3M B;  4F7X A;  1TWG B;  1EUJ A;  1X65 A;  2K5H A;  2ZTE A;  1UE1 A;  2E2H B;  4R4C A;  1RIP A;  2M2L A;  1AZP A;  1L0W A;  4L8J A;  5KEE A;  4RH6 A;  2F0J A;  5A2Q L;  3J81 i;  4LF5 L;  3RD4 A;  2BE5 C;  2HCI A;  2RCF A;  1HRJ A;  1NE3 A;  2F0N A;  3NTK A;  2UXC L;  2F0W A;  2F0E A;  5ELF A;  4LFA Q;  3U50 C;  2QA4 A;  1JT8 A;  1VQI A;  3L7Z C;  1B9M A;  1H9S A;  2WFW A;  4A3K B;  2H4O A;  1PTO D;  4TSS A;  2SEB D;  2PZT A;  3JC6 6;  2OEO A;  2YTY A;  4BBR H;  2LXK A;  1XMQ Q;  3JAM c;  2R7F A;  2AQ1 B;  1GVP A;  1YIJ A;  2ATW A;  1HR0 W;  1T9H A;  3K81 C;  4A3D H;  2CCZ A;  1VF5 C;  5FJ8 H;  1GUO A;  5ISR A;  1KNE A;  1E22 A;  1WJJ A;  5HGQ A;  1F2L A;  2CHB D;  2HUG A;  3LNN A;  4ZKB B;  4IO9 A;  3ITP A;  4C56 C;  4JI2 L;  1VQE A;  4WRD A;  2MJ8 A;  4F87 A;  1QVG A;  3MTS A;  2QDB A;  1Q1E A;  4KKS A;  1FGB D;  4GKJ Q;  5IP9 H;  4GOP B;  2TSS A;  1KTK A;  2X6L A;  2EXD A;  3MA2 B;  1XX8 A;  2RA4 A;  3BDO A;  1JCK B;  3PIP A;  4DR3 L;  5C0X G;  1QZH A;  3RZO B;  5M9O A;  3GTJ B;  3PO3 H;  2UUB L;  3OHX C;  5LHY 1;  1LV9 A;  4APV A;  3ERS X;  2AHO B;  4A93 H;  5CR3 A;  4DNI A;  1TWF B;  3ERO A;  4IFD J;  4HCS A;  1KAW A;  1ET9 A;  3G7L A;  1AZQ A;  4FDB A;  1Z6H A;  1Z7T A;  4HMJ A;  3CCU A;  3S15 H;  1LTG D;  2A8V A;  2PNR C;  1X3P A;  1I6H B;  4X66 Q;  3F2U A;  1JQY D;  2VS1 A;  3OIP A;  4JI6 Q;  2AUJ D;  1GJX A;  4CDE C;  4PMB A;  1STY A;  1M8A A;  2DNE A;  2EJF C;  5KNB A;  2OWO A;  2WB1 E;  3HOU G;  5E1F A;  2RCN A;  1STG A;  4CJ0 B;  3HOU B;  4HN7 A;  3EVQ A;  1EFI D;  2DNC A;  3RR5 A;  3STB C;  1SLJ A;  2IHF A;  2Y0S E;  2EJM A;  2E5L L;  2NVT H;  1S4Z A;  1HHV A;  1QZG A;  2OTL A;  2F0T A;  4C3H H;  2HHH L;  5C3E H;  1ENF A;  5I9P A;  2A69 C;  2NWG A;  4MTK A;  1SMY C;  3I4L A;  5FLM H;  4HSP A;  1V9P A;  3PV0 A;  5IOC A;  1K3R A;  3EBE A;  4IOA A;  2RF4 A;  3Q22 A;  3C1E A;  3ONA B;  4RGO S;  3CCS A;  4UHV A;  4UP9 A;  2K03 A;  1LM0 A;  1VQF A;  2OCE A;  1WVL A;  3PF4 A;  3DUZ A;  1KIX A;  1OXS C;  4YWM A;  1V1P B;  3ND9 A;  2G9H D;  4IUP A;  1FJG Q;  5C4J H;  1GD7 A;  1LTA D;  4YCV A;  3A5Z B;  4LUZ A;  4HJ7 A;  1E2V A;  5IYD G;  1CKM A;  1RD9 D;  5ELD A;  1UE7 A;  3C1F A;  4DAV A;  2EJG C;  1DOM A;  1PH4 A;  4FXD A;  4DAY B;  4C2M H;  2BA0 A;  5HUR A;  2MO1 A;  1X3F A;  3H0G G;  3U4Z A;  4ZLT F;  3H0G B;  5CV4 A;  3CD6 A;  2EYM A;  1OO9 B;  4DAM A;  4OO1 H;  1XWE A;  1SEB D;  4N9T A;  4AIM A;  2J4X A;  2PQA B;  1D7Q A;  2YU9 B;  1YZ6 A;  2WKC A;  4DGZ A;  3HOZ B;  1QE6 A;  4LF6 Q;  3CU7 A;  2L0C A;  4ODG A;  3SDZ A;  1MI2 A;  1JR0 D;  3QG1 A;  3K0Y A;  5ELE A;  1QVF A;  3CRL C;  4QY7 A;  5BN3 A;  4HJ5 A;  3SE0 A;  4QQB X;  4JOI A;  2JYO A;  3MAQ A;  3E9I A;  2D62 A;  4IFD G;  4X3S A;  5J3B A;  3S1Q B;  1J6Q A;  1K0R A;  4XYO A;  3R3O A;  3UDI A;  1A0I A;  1B3Q A;  4GNX A;  3S17 H;  3Q24 A;  3R8B A;  2NVQ H;  3OMC A;  1ONL A;  3TEH B;  4JBJ A;  4DUY Q;  5M3F H;  5IYB H;  4XQQ A;  5H1S E;  2OXP A;  3RLN A;  2EYP A;  3IFD A;  4A3F G;  3MEH A;  2A68 C;  4KV6 A;  4NB3 A;  2Z0S A;  4A3F B;  4DV7 Q;  5C5M A;  2PYK A;  4EQN A;  2JJQ A;  1X9N A;  1PV4 A;  1EQR A;  5IOD A;  4OX9 L;  3TRE A;  2BDN A;  1SRU A;  1DOL A;  1E2Z A;  1X3G A;  2C9O A;  2MNA A;  1UAP A;  1E1O A;  3J81 L;  4X62 L;  1N34 Q;  3FPU B;  2F0S A;  3TS0 A;  2VNU D;  1YNJ D;  2XWB B;  3T16 A;  4XYQ A;  1SMX A;  3KBX A;  1TKW B;  3KF8 A;  1C0A A;  4UPA A;  3F2D A;  1XPU A;  1K83 H;  3P7J A;  3K80 C;  2M00 A;  4DUZ Q;  3M4P A;  5EPL A;  3J80 i;  5E7N A;  3SR1 A;  4DV0 L;  2Y0S G;  5KGU A;  2IW3 A;  2Y0S B;  1U5K A;  2L15 A;  2Z4I A;  4DR7 Q;  4JW0 A;  3CXC A;  1X55 A;  5BN5 A;  4A3J H;  4ZYS A;  4GOP C;  4XQJ A;  4V0B A;  1YJN A;  1A3T A;  4JI8 L;  4I65 A;  4RHR A;  1A6X A;  2SDF A;  4IUQ A;  5IGG A;  3UDG A;  1NR4 A;  2R7Z G;  1SND A;  2R7Z B;  3NEM A;  1VQJ A;  5JJI A;  3KF6 A;  5IT9 E;  1AFP A;  4A3L G;  2E74 C;  5EKK A;  1PMR A;  2CWP A;  2KA7 A;  2CQA A;  3CCM A;  2L11 A;  4AQY Q;  2L9H A;  3K7U C;  2NVY B;  2DGY A;  3PIP 3;  1LAB A;  3JAM i;  1VMP A;  2RSO A;  2B2U C;  4JC0 A;  5EKI A;  2IWH A;  3E3X A;  5DEH A;  1YHA A;  1UNS A;  1E0B A;  4KHP L;  2KCC A;  1HNW L;  3CCQ A;  2XSC A;  3S1M B;  2WAC A;  1QUQ B;  3HOV B;  2NTT A;  1TQO A;  4J15 A;  1LT5 D;  4LF5 Q;  2I07 B;  4WJW A;  1PH5 A;  2YTX A;  3GDE A;  4MTN A;  4RCO A;  4IUV A;  3PUV A;  1STH A;  1I4R A;  1WCM G;  4JBW A;  1WCM B;  1K0S A;  2B2T C;  1VQA A;  1A2T A;  1JE5 A;  1PA6 A;  1Q8I A;  4BS9 A;  3K5N A;  1KHI A;  1S5F D;  3AEV A;  1FNW A;  1HUM A;  2JK8 A;  1CM9 A;  2GVA A;  1JC7 A;  2BCO A;  5JEA H;  3S1R H;  1E1T A;  2NB0 A;  4YY3 L;  4PNY A;  4R1J A;  1W3S A;  1F9R A;  3A0J A;  1HH2 P;  3BDC A;  4A3E H;  3I90 A;  4BWG B;  4NW2 A;  5M5Y H;  4ULL A;  4TVA B;  3KJP A;  3JAM E;  1N32 L;  2VZA A;  4HJ9 A;  4GLX A;  4EVO A;  1PZK D;  2XWJ B;  1PYW D;  1D8L A;  1IYV A;  4A3C G;  5DAU A;  4C3I H;  4JI2 Q;  5EAY A;  2HQL A;  4KMU C;  3I70 A;  1SSO A;  5GAH C;  3Q0A A;  1G6P A;  4DR3 Q;  1EIH A;  2C5C A;  2N88 A;  5CC4 A;  1ZYR C;  4PMW A;  4P72 A;  5J1Z A;  5JPN C;  1LTT D;  2UUB Q;  5FOB B;  3TZD A;  5IP7 G;  3ER0 A;  2A6E D;  1Y1V H;  4R4T A;  1PFM A;  4N8F A;  4H0L C;  5I6Y A;  1F2Z A;  1X32 A;  3NBI A;  4B3R L;  1YJW A;  5C6A A;  5CBE E;  1DXM A; 
#chains in the Genus database with same CATH homology
 2IJ0 A;  3SEB A;  2IX3 A;  2FHT A;  1DON A;  3S2H B;  4KN4 C;  1TS2 A;  5I9O A;  1JWM D;  1DD2 A;  5FO9 B;  5I2X A;  3ND8 A;  1FYC A;  4K5V A;  2EZV A;  3C2P A;  2A5H A;  1ENA A;  2BE5 D;  1Q1B A;  1S5B D;  2B2Y C;  3D4W A;  1JOQ A;  1TVX A;  3GV6 A;  2MHV A;  4FVM A;  1SFO B;  2EYO A;  3DEP A;  4PMC A;  1BCP B;  5FK9 C;  3S1N B;  3H09 A;  2D5D A;  3BZD B;  3SK5 A;  1TWH B;  1C8C A;  4HED A;  3SXH A;  1EIG A;  1HCZ A;  5IT9 L;  1WD1 A;  1BR9 A;  4BY7 B;  1CHQ D;  1GUT A;  2NUC A;  3KLS X;  4BA2 I;  1LTI D;  4RHS A;  1SYE A;  1PRT B;  2J0T D;  2ID0 A;  1KLG D;  1BBX C;  2PPB C;  1RCV D;  4P2C B;  4IUR A;  1EY6 A;  3KK7 A;  3GTM B;  1Q3L A;  1CHP D;  2B39 A;  3J80 L;  3HG9 A;  4BBS B;  4XT1 B;  1NR2 A;  2RDH A;  4HCE A;  3NQI A;  2R61 A;  3QJY A;  4DFA A;  4R8N A;  4CGY B;  3S14 B;  4M8A A;  3M85 A;  2QEJ C;  4TKO B;  2ZXR A;  3VYU A;  2VB2 X;  5DM7 3;  4R8I A;  1TY0 A;  3NK9 A;  4TRD A;  2FJ2 A;  3Q6S A;  1GUS A;  3JAM L;  3SHL A;  1MD2 D;  3CQZ B;  2A69 D;  1STB A;  1SMY D;  4EQP A;  1EY7 A;  2BDO A;  5DNF A;  5EKL A;  5TSS A;  2NYZ D;  4HAE A;  3I91 A;  1Z47 A;  4FF4 A;  3RZD B;  3WOF A;  3D4R A;  4DF7 A;  5C44 B;  1G8Z D;  1GOZ A;  3IKJ A;  5CV7 A;  3M7G A;  4C1N K;  4KI0 A;  1T5X D;  4CKE A;  3KLR A;  1CI3 M;  4LAA A;  1BDO A;  2E2J B;  3X3N A;  3OPO A;  1OXT A;  4OO1 I;  1K8O A;  2A73 B;  2SNS A;  4ZKC B;  4B9W A;  1GUN A;  3DMU A;  3MXG A;  3HEJ A;  2LMC B;  3A8K E;  5DM6 3;  1KNA A;  2F0P A;  1SXT A;  5D65 A;  2Q8I B;  3D31 A;  2IPK D;  1PXU A;  4IUN A;  1RHP A;  3GD7 A;  1EY4 A;  4FF1 A;  3MWY W;  1H9M A;  3BYT B;  4DXG A;  2A68 D;  4RKB A;  1LTR D;  2O4X A;  1BCP C;  5LL6 S;  4G7H C;  4KD3 A;  1WTX A;  4BBR B;  1D1K A;  1W6K A;  3I4M B;  5E3F A;  1QB5 D;  3PIO 3;  1R4P B;  1RJT A;  1II3 A;  2AQ2 B;  4A3D B;  4XIG S;  1PRT C;  2WP8 J;  2ZXO A;  2IL8 A;  4ID6 A;  2F0I A;  1EU4 A;  5CV8 A;  2K05 A;  1FD7 D;  2Q8R E;  2Z1C A;  5COY A;  2LS0 1;  3IAY A;  1CTM A;  1EZ8 A;  3P1H A;  3PO3 B;  1JWS D;  1O80 A;  4HTH A;  4OGQ C;  5KIX A;  3MHB A;  5EPJ A;  4K2L A;  2N55 A;  3D6C A;  3EFX D;  5HGT A;  1B3A A;  1IYU A;  4L6T B;  1C4Q A;  5IIF A;  2B63 B;  3RLF A;  1B4O A;  3S16 B;  1B44 D;  4IAL A;  5F2D A;  4J1M A;  1I4H A;  3MXP A;  3NE5 B;  3TZU A;  2KVM A;  4LMQ D;  3MXN A;  4UDU C;  4K2K A;  1D1I A;  2ZXP A;  3S9W A;  3OWF A;  2QKI C;  2MGS A;  2EYJ A;  1DOK A;  3GO5 A;  2NVT B;  5ELC A;  1TII D;  3I3C A;  1XYI A;  2B2W C;  2EY1 A;  3H3V C;  3U9O A;  3DM1 A;  4I7Z C;  2D9U A;  3H6M A;  1PTO H;  2WV6 D;  1SNO A;  4MIU A;  3C46 A;  4CJ2 C;  2AUK A;  1B53 A;  3A55 A;  1SNM A;  1V1O A;  4ZUI A;  2Z8L A;  2L12 A;  4NKL A;  4C2M B;  3A54 A;  3AB9 A;  5K36 G;  4BY1 B;  3LX0 A;  1ZYR D;  2K5W A;  1T5E A;  1LLR D;  5IGE A;  1PFN A;  3NPP A;  3K5L A;  2TMP A;  4A3G B;  5IGC A;  2PQE A;  4CKC A;  3VYT A;  4KKT A;  5A35 A;  1LTS D;  1STN A;  1L0Y B;  3SK4 A;  3OMG A;  3K7A B;  3TP7 A;  3AMU A;  1SYG A;  1UEA B;  3DWA A;  1QNU A;  1KAA A;  1QIL A;  1SDF A;  1C48 A;  2H1E A;  2LY7 A;  3DEO A;  1D5Z C;  1ILP A;  5JPM C;  1PZJ D;  4DNT B;  2F3V A;  2DY7 A;  1G2T A;  1WTQ A;  4DK0 A;  3PMF A;  4RGM A;  1PDQ A;  5IGD A;  3NP8 A;  1DZ1 A;  1EL0 A;  1SYD A;  1QCB D;  4RCN A;  5COR A;  4HR7 B;  4K14 A;  1SNC A;  4A3J B;  1IKL A;  2RDG A;  4XQN A;  3MZ5 A;  4XTC S;  1H9S B;  4JK1 C;  2YYZ A;  5C4Z A;  3MFG A;  2B2V C;  5G3L F;  2XRS D;  1QOH A;  4C1N I;  4IFD H;  1I4Q A;  2V4D A;  4G4K A;  4RA8 A;  2EY5 A;  5I2Y A;  4WOR A;  3R2T A;  2X69 A;  5I6W A;  1AN8 A;  1TR5 A;  5EJW A;  2F0D A;  2JSO A;  1F77 A;  2MUY A;  4FXK C;  5KRU A;  1EOT A;  4NP5 A;  2ICE C;  1SJE D;  4X3K A;  4X3U A;  2QCP X;  4G7O C;  2E2D C;  2PW7 A;  1I4X A;  1JOO A;  2A6H C;  3NBH A;  4J6H A;  2F0F A;  3V2T A;  1TWC B;  1AEX A;  1E2W A;  3P75 A;  3EA6 A;  3S1R B;  1X3Q A;  5IGF A;  3WDN A;  4FO2 A;  2PCF B;  2K28 A;  2RVL A;  3BVM A;  2QIL A;  4A3E B;  3T4A C;  2EOT A;  4FNF A;  2SOB A;  5M5Y B;  1TS3 A;  2JA6 B;  3FVQ A;  1BNZ A;  2O5I C;  4A3I B;  3MVV A;  3UI2 A;  4C3I G;  1STA A;  3HS0 C;  1Y8N B;  4C3I B;  1R4Q B;  1BOS A;  1CFM A;  1G6Z A;  2HQE A;  1O78 A;  1WTR A;  3J7A V;  5JVH 3;  5M5X B;  2EVB A;  2F0G A;  5D3I B;  1WTV A;  3H91 A;  4LK1 C;  2NN6 I;  2A74 C;  3TSS A;  1VMC A;  3P20 A;  1RTO A;  4RKL A;  2JP1 A;  3W3A A;  1JB3 A;  4B08 A;  1B1Z A;  2RSN A;  1BF4 A;  3VR4 A;  3MXU A;  5J39 A;  1M4V A;  1EQV A;  1HPC A;  2EPB A;  4K6D A;  3DWP A;  5EBD A;  3PUZ A;  2J7Z A;  3CHB D;  1BCP D;  4PV1 C;  3VR3 A;  5BN4 A;  1DM0 B;  4NDX A;  5I4D A;  4DN4 M;  2L4N A;  3BDL A;  2RDF A;  1IHZ A;  3TP5 A;  3K5O A;  1TWA B;  1PLF A;  5E4W C;  1EQT A;  2E76 C;  3EQL C;  5KND A;  2KEC A;  5C3X A;  1PRT D;  1SYB A;  3CKI B;  4ZQ3 A;  4WFN 3;  1RKN A;  1EEF D;  3GTK B;  2K04 A;  4A3M B;  4B9X A;  2JXM B;  1L0X B;  1U4P A;  1G91 A;  3FDT A;  4QIW B;  1Y1W B;  2HDL A;  2RKS A;  1D5M C;  1GUW A;  3BVZ A;  4ME5 A;  5FLX E;  3FEW X;  2F0H A;  3MC0 B;  4BA1 I;  1EY0 A;  1MSG A;  1LTB D;  3D8G A;  2KUM A;  3VA5 A;  1V43 A;  4KY7 A;  3I4N B;  2F0V A;  1JWU D;  4X3T A;  2LKV A;  2O5J C;  2AWO A;  1I3Q B;  1ZXT A;  5A2Q E;  3NUC A;  1H9J A;  3IFT A;  1D2B A;  2G9D A;  1K8M A;  1KLU D;  1NAP A;  1RF2 D;  3NQT A;  1GHK A;  3OIQ A;  4EGV A;  4RWS C;  2F0K A;  3A8I E;  1F2Y A;  2R92 B;  2NTS A;  1QG7 A;  4FP5 D;  4RGN A;  1EEI D;  4AYB B;  2NVX B;  3VYR A;  2VB3 X;  2K1B A;  1I4G A;  4U67 3;  3K6O A;  1ML0 D;  3E0J A;  2B2U A;  5J22 A;  3NXW A;  1QNK A;  2FFK B;  3OOC A;  5EQ0 A;  2KQ3 A;  1B2T A;  2JEB I;  4G57 A;  5FO8 B;  1MGS A;  2NBF A;  2R6G A;  1YNN C;  2E2I B;  3DHQ A;  1J8I A;  3QOJ A;  1U4L A;  3TBI B;  2B2T A;  2L1B A;  3O13 A;  2BA1 A;  2PZW A;  1V1P A;  1Q12 A;  4Y7N B;  3VR6 A;  2NN6 H;  1HXY D;  3GV3 A;  1CQV A;  1HFN A;  4C3J G;  1BQQ T;  1O7Z A;  5KYL A;  1QJO A;  4C3J B;  1GUG A;  1D5X C;  3EJI A;  1JIC A;  4KJN A;  4DAY A;  4XXE A;  2F0U A;  1SNP A;  1BUV T;  2M9V A;  3GTO B;  2L55 A;  2RQX A;  1PTO F;  4U68 A;  2HCC A;  1HUN A;  1WTW A;  4ZK9 B;  1JE4 A;  1CK1 A;  2KHS A;  2IX0 A;  2F0Q A;  4ILW A;  1LT6 D;  1SE3 A;  5FLX L;  3E6Z X;  2WII B;  3PUX A;  5CGK A;  3AU7 A;  4IQZ A;  2E75 C;  4DXF A;  1W6J A;  2SNM A;  3SVM A;  2NZ1 D;  3A7L A;  3QB3 A;  2LFN A;  3GTQ B;  3L3O C;  1LAC A;  4IFD I;  2GA4 B;  2ZT9 C;  2WAQ B;  2B2Y A;  4KHZ A;  1H9R A;  5JJZ A;  1CA5 A;  1J9O A;  2AQ3 B;  4A93 B;  2I46 A;  2F3W A;  3HZX A;  1D6E C;  1VCI A;  1CZG A;  1GXD C;  3S15 B;  1PFB A;  1IW7 C;  3Q23 A;  1ENC A;  2K32 A;  3TN2 A;  2R93 B;  4LJZ C;  4KTA A;  2JEA I;  1G2S A;  2XVS A;  3V96 A;  2A6H D;  3PUW A;  2F0O A;  4EQO A;  1A3U A;  1PTO B;  3J81 E;  1S5E D;  2EXZ A;  4C3H G;  3CRK C;  5AFW A;  3VA7 A;  4C3H B;  5C3E B;  1LT4 D;  3M7N A;  3GQB A;  4O1N A;  2F0L A;  2KCN A;  1KAB A;  1NUC A;  2B8G A;  4H13 C;  2K01 A;  2KEE A;  1SYF A;  2B8F A;  2XIW A;  5C4X B;  1MSH A;  3HOW B;  3I72 A;  1AP0 A;  2OT2 A;  4K6L A;  5C4H A;  4KJO A;  2FMM A;  5C4J B;  2IX1 A;  5C0X H;  4QUF A;  4S3S A;  1WTO A;  3D3R A;  4ZUJ A;  3W2D A;  1ICW A;  5FO7 B;  2XNA C;  5C3W A;  4OO1 G;  1DCZ A;  1Q90 A;  2VXW A;  3ERQ A;  3NTH A;  1EYA A;  2ENB A;  2EYH A;  4KN7 C;  1VF7 A;  3LWE A;  3RMH A;  3NWT A;  2K7V A;  3DWQ A;  1ESF A;  3T51 B;  3TP8 A;  1HTP A;  2FIN B;  3OW7 A;  3S17 B;  4IUU A;  2NVQ B;  3FPP A;  4M1U B;  4HMI A;  1F9Q A;  4OIK A;  1B9N A;  1IL8 A;  1ESR A;  5M3F B;  5JEA J;  5K36 H;  2F0M A;  3J7A F;  3D4D A;  1S5D D;  4QUC A;  2RBM A;  3T53 B;  2X6G A;  4CHT B;  2CW0 C;  4KY5 A;  4F88 A;  4DNR B;  1RDP D;  4K5W A;  1LO5 D;  1NCV A;  4ZRZ A;  1CA6 A;  1K83 B;  2OF1 A;  4Q5V A;  1HA6 A;  4KK7 A;  5JOB A;  2VUM B;  4FF2 A;  1EU3 A;  1OXU A;  3QIA A;  5T1G A;  2MPM A;  2F03 A;  4CJ1 B;  3NHH A;  5D3D A;  2K5D A;  1FNV A;  4ZAI A;  5FKA C;  4H7B A;  5EPK A;  3NTI A;  1EWC A;  5CYU A;  3TDQ A;  5C5L A;  5ELB A;  3N6R A;  5CV9 A;  3G6J B;  4UAI A;  4MN3 A;  1OXV A;  3K59 A;  4OHJ A;  3D6W A;  4YIJ A;  4FXG C;  2WB1 B;  1F2M A;  1Y69 U;  3BS1 A;  1EY8 A;  3BVG A;  3I73 A;  1SNQ A;  4QB4 A;  3S2D B;  1TS4 A;  1PTO C;  4ABN A;  1I4P A;  2WKD A;  1OXX K;  1U4R A;  1KDA A;  4N9P A;  1R9T B;  5M5W B;  2KED A;  2BOS A;  2MP1 A;  2ICI A;  4KY6 A;  2PO4 A;  4PQX A;  3OWE B;  1BO0 A;  4RGT A;  5JEA G;  5G3L D;  1F9P A;  2EE1 A;  1HQM C;  1Y8P B;  2PMZ B;  3HP3 A;  2EY2 A;  3LWU A;  4TQU S;  3VYS A;  1HTL D;  2EY6 A;  1YNN D;  1EYD A;  3QOL A;  3TME A;  3J80 E;  1CZW A;  1H9K A;  2PZU A;  1KDC A;  2QF7 A;  4DK1 A;  2B2W A;  3BG3 A;  1GHJ A;  1PZI D;  3HKZ B;  4V19 0;  1UUP A;  1Y1V B;  3H94 A;  3J7Y W;  1BCP F;  5LL6 X;  2Z4H A;  4MHE A;  3KUP A;  1FR3 A;  5KNC A;  2AWN A;  1TU2 B;  1JOK A;  5NUC A;  4Q0F A;  4RFB A;  2Q8T A;  1JOR A;  3PUY A;  4QMG A;  2XN9 C;  1RTN A;  1PRT F;  1IKM A;  4OIJ A;  2K6A A;  4F8M A;  1HQR D;  4CKB A;  3NWS A;  1NSN S;  1ZEQ X;  5K5P A;  1U9R A;  1F9S A;  3GP7 A;  3FMC A;  4G7Z C;  5JVG 3;  1A3V A;  3VR2 A;  3FKI B;  1XXG A;  3I8Z A;  5IGB A;  1SYC A;  1EWH A;  4IUT A;  4OL7 A;  1MBY A;  1A15 A;  3QWN A;  3A56 A;  2KOL A;  3V05 A;  4E6I A;  3X3M A;  2CVR A;  3HOY B;  3PO2 B;  2R3Z A;  2DN8 A;  3QO2 A;  4FF3 A;  2WIN B;  2EYF A;  4CBV A;  4GZY C;  4K8I A;  3VR5 A;  4KHV A;  1A2U A;  1KDB A;  1O7L A;  3M4Y A;  4FYD A;  3M4O B;  4O42 A;  5EGT A;  4IZ8 A;  4R9W A;  1TT2 A;  1IW7 D;  4QF4 A;  2EYL A;  3U9S A;  4K8J A;  4DAP A;  1HA5 A;  1DYQ A;  1Y8O B;  2FMC A;  2IT1 A;  2B2V A;  1LT3 D;  1S5C D;  1YNJ C;  1EY5 A;  1QWY A;  3NSW A;  5D14 A;  3HOX B;  1AW7 A;  3N52 A;  2O2L D;  3GTG B;  2JA5 B;  4DU9 A;  1V8Q A;  1G29 1;  3HRZ C;  2K33 A;  1TY2 A;  2JA8 B;  3K5M A;  3GTL B;  4NMZ A;  3GTP B;  3L9A X;  3ZYY X;  3SK8 A;  3TP6 A;  3RUZ A;  2DY8 A;  3KLS A;  5C0X I;  1SE4 A;  1HFG A;  3IL8 A;  3WOE A;  1WTP A;  3T56 B;  3BYY B;  1B50 A;  2F4I A;  4RAU C;  4HSV A;  4XT3 B;  2F1M A;  4J8Q A;  5T1I A;  2HDM A;  3T13 A;  3K57 A;  2D2C C;  3URY A;  2NN6 G;  5CV6 A;  1ILQ A;  4DA2 A;  3OSO A;  3A7A B;  1DJR D;  1FNU A;  2JA7 B;  1TS5 A;  2JE6 I;  3KBG A;  5JAV A;  1U4M A;  2PW5 A;  3A8J E;  3K58 A;  4XDX A;  4K5X A;  1EY9 A;  4KD4 A;  3FRP B;  4KKU A;  3C3L A;  4H44 C;  1O7Y A;  1WD0 A;  1ROD A;  1SBB B;  3SK6 A;  4Z9C B;  4QCL A;  3HGB A;  3R2I A;  1ZKO A;  5E4X A;  2K5Q A;  5KYI A;  2CW0 D;  4A3B B;  3MFY A;  5C0X J;  1I6V C;  1SE2 A;  2KJX A;  1CQF A;  4IN3 A;  1EYC A;  5CBA E;  1BXT A;  1CT1 D;  2L5T A;  1STE A;  1ET6 A;  3DXJ C;  4L63 B;  5CV5 A;  5CMD A;  3R93 A;  1SJH D;  1VDZ A;  2A6E C;  5EBC A;  2EDG A;  1I50 B;  3M3Y B;  1SAP A;  1EZ6 A;  2XRQ D;  1XTC D;  3E5S A;  5M3M B;  4F7X A;  1TWG B;  2E2H B;  2M2L A;  1AZP A;  4L8J A;  5KEE A;  4RH6 A;  2F0J A;  5A2Q L;  3RD4 A;  2BE5 C;  2HCI A;  1HRJ A;  2F0N A;  3NTK A;  2F0W A;  2F0E A;  5ELF A;  3L7Z C;  1B9M A;  1H9S A;  4A3K B;  2H4O A;  1PTO D;  4TSS A;  2SEB D;  2PZT A;  2OEO A;  2AQ1 B;  1VF5 C;  1GUO A;  5ISR A;  1KNE A;  1F2L A;  2CHB D;  2HUG A;  3LNN A;  4ZKB B;  3ITP A;  4C56 C;  4WRD A;  2MJ8 A;  4F87 A;  3MTS A;  2QDB A;  1Q1E A;  4KKS A;  1FGB D;  2TSS A;  1KTK A;  2X6L A;  3MA2 B;  1XX8 A;  2RA4 A;  3BDO A;  1JCK B;  3RZO B;  5C0X G;  5M9O A;  3GTJ B;  3OHX C;  5LHY 1;  1LV9 A;  5CR3 A;  4IFD J;  1TWF B;  3ERO A;  4HCS A;  1ET9 A;  3G7L A;  1AZQ A;  1Z6H A;  1Z7T A;  4HMJ A;  1LTG D;  2PNR C;  1X3P A;  1I6H B;  3F2U A;  1JQY D;  3OIP A;  2AUJ D;  1GJX A;  4PMB A;  1STY A;  1M8A A;  2DNE A;  2EJF C;  5KNB A;  5E1F A;  1STG A;  4CJ0 B;  3HOU B;  4HN7 A;  3EVQ A;  1EFI D;  2DNC A;  2EJM A;  1S4Z A;  1HHV A;  2F0T A;  1ENF A;  5I9P A;  2A69 C;  2NWG A;  1SMY C;  3I4L A;  4HSP A;  3PV0 A;  5IOC A;  3Q22 A;  3C1E A;  3ONA B;  4RGO S;  2K03 A;  1WVL A;  3DUZ A;  1OXS C;  1V1P B;  3ND9 A;  2G9H D;  4IUP A;  1LTA D;  1E2V A;  5ELD A;  1RD9 D;  3C1F A;  4DAV A;  2EJG C;  1DOM A;  4FXD A;  5HUR A;  2BA0 A;  4ZLT F;  3H0G B;  5CV4 A;  2EYM A;  1OO9 B;  4OO1 H;  1XWE A;  1SEB D;  4N9T A;  2J4X A;  2YU9 B;  3HOZ B;  2WKC A;  4DGZ A;  1QE6 A;  3SDZ A;  2L0C A;  3CU7 A;  4ODG A;  1MI2 A;  1JR0 D;  3QG1 A;  3K0Y A;  5ELE A;  3CRL C;  5BN3 A;  3SE0 A;  2JYO A;  3MAQ A;  2D62 A;  4IFD G;  4X3S A;  3S1Q B;  4XYO A;  3R3O A;  3Q24 A;  3R8B A;  3OMC A;  1ONL A;  4XQQ A;  2OXP A;  2EYP A;  3IFD A;  3MEH A;  2A68 C;  4KV6 A;  4A3F B;  5C5M A;  2PYK A;  4EQN A;  5IOD A;  2BDN A;  1DOL A;  1E2Z A;  2C9O A;  1UAP A;  3J81 L;  3FPU B;  2F0S A;  2VNU D;  1YNJ D;  2XWB B;  3T16 A;  4XYQ A;  3KBX A;  1TKW B;  3KF8 A;  3P7J A;  2M00 A;  5EPL A;  3SR1 A;  5KGU A;  2IW3 A;  2Y0S B;  2Z4I A;  5BN5 A;  4ZYS A;  4XQJ A;  4V0B A;  1A3T A;  4I65 A;  4RHR A;  1A6X A;  2SDF A;  4IUQ A;  5IGG A;  1NR4 A;  1SND A;  2R7Z B;  5IT9 E;  1AFP A;  2E74 C;  5EKK A;  1PMR A;  2KA7 A;  2CQA A;  2L11 A;  2L9H A;  2NVY B;  3PIP 3;  1LAB A;  1VMP A;  2RSO A;  2B2U C;  5EKI A;  2IWH A;  5DEH A;  1UNS A;  1E0B A;  2KCC A;  2XSC A;  3S1M B;  2WAC A;  3HOV B;  2NTT A;  1TQO A;  1LT5 D;  2I07 B;  4WJW A;  4RCO A;  4IUV A;  3PUV A;  1STH A;  1I4R A;  4JBW A;  1WCM B;  2B2T C;  1A2T A;  1Q8I A;  4BS9 A;  3K5N A;  1S5F D;  1FNW A;  1HUM A;  1CM9 A;  1JC7 A;  2BCO A;  5JEA H;  2NB0 A;  4PNY A;  1F9R A;  3BDC A;  3I90 A;  4BWG B;  4NW2 A;  4ULL A;  3JAM E;  4EVO A;  1PZK D;  2XWJ B;  1PYW D;  1IYV A;  5DAU A;  4KMU C;  3I70 A;  1SSO A;  3Q0A A;  1EIH A;  2C5C A;  2N88 A;  5CC4 A;  1ZYR C;  4PMW A;  5JPN C;  5J1Z A;  1LTT D;  5FOB B;  3TZD A;  2A6E D;  1PFM A;  5I6Y A;  4H0L C;  1F2Z A;  1X32 A;  3NBI A;  5C6A A;  5CBE E;  1DXM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...