1RHPA

Crystal structure of recombinant human platelet factor 4
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
64
structure length
64
Chain Sequence
DLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of recombinant human platelet factor 4.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Platelet factor
molecule keywords PLATELET FACTOR 4
total genus 11
structure length 64
sequence length 64
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1994-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1rhpA00
2H1EA 4UAIA 1LV9A 4MN3A 1B4OA 3I90A 5JJZA 1F9SA 1EIGA 2VXWA 1G2TA 4IUQA 2D9UA 2Q8RE 1EL0A 1HFNA 4RWSC 3Q6SA 4HEDA 5D65A 2EPBA 2FINB 1QNKA 3D6WA 5CMDA 1ILPA 2MPMA 2B2VC 3G7LA 1AZQA 1XYIA 2X6LA 1F9PA 2DY8A 5AFWA 5EPKA 2B2WA 4LMQD 4DN4M 3SVMA 1U4MA 1SDFA 1F9RA 1U4LA 2N55A 2KECA 4ZAIA 4OIKA 1X32A 2FMMA 4CJ0B 1NCVA 4HCSA 1PFMA 1HA6A 2K04A 1X3PA 1VMPA 1VMCA 3DM1A 1RODA 1BBXC 1DONA 4U68A 2NWGA 5E4XA 1BF4A 1O7ZA 4IUPA 5T1IA 2RSOA 1IKMA 2M2LA 1HRJA 4X3TA 1CA6A 4CJ2C 5EPJA 1WTPA 1WTOA 1G2SA 1EOTA 1NAPA 2L1BA 1DZ1A 2DY7A 1B53A 1RJTA 2FFKB 2KOLA 2B2WC 1RHPA 1MGSA 2K03A 1MSGA 1O7YA 2SDFA 2K05A 2B2VA 1CM9A 1A15A 1HUMA 4RA8A 5CBEE 1AP0A 3DEOA 3H91A 2HCIA 2B2YA 2B2UC 4MHEA 1BO0A 1PLFA 4HAEA 1WD0A 1G6ZA 4QUCA 2L12A 2HDMA 1SAPA 4ZK9B 2B2UA 1M8AA 2KEEA 2B2YC 3MTSA 4X3UA 1RTNA 1JE4A 3TN2A 5E4WC 2L9HA 4NW2A 1IKLA 3GV6A 1WTVA 1DOMA 3TZDA 2J7ZA 1NR4A 2KEDA 3DEPA 4O42A 4IUUA 5EPLA 4ZKBB 1AZPA 1B3AA 3QO2A 5EQ0A 2KVMA 3KBXA 1QE6A 2RA4A 3FPUB 3IL8A 5CORA 2JP1A 4OIJA 2K28A 1DOKA 1PDQA 1NR2A 1C8CA 1Q3LA 1SSOA 3I91A 5DNFA 2N88A 2B2TA 2CVRA 1MI2A 3I8ZA 3HP3A 1QG7A 4IUTA 1U4RA 1ILQA 2K01A 3I3CA 1F9QA 4X3SA 5EJWA 2KUMA 3F2UA 3FDTA 2MGSA 2MJ8A 4QUFA 1WVLA 1CA5A 4IURA 3IFDA 1HHVA 1WTXA 1KNEA 5T1GA 1HFGA 1IL8A 1JICA 1XX8A 2JYOA 4XT1B 3R93A 4XT3B 4XDXA 1ESRA 1ZXTA 3GV3A 2RSNA 1PFNA 3LWEA 1GUWA 1J8IA 4ZKCB 2L4NA 2EOTA 2FJ2A 2BDNA 5D14A 1U4PA 1MSHA 1E0BA 2B2TC 1KNAA 1F2LA 2HCCA 2MP1A 5EKIA 4CJ1B 1WTWA 4IUVA 1WTRA 2HDLA 3KUPA 2EE1A 4R8IA 4ZLTF 2HUGA 4X3KA 3ONAB 1B2TA 2IL8A 1EQTA 1B50A 2FHTA 3P7JA 1ICWA 4RAUC 1WD1A 2NYZD 3N52A 2Q8TA 3UI2A 5CBAE 1PFBA 1DOLA 2XIWA 3MWYW 1WTQA 4R9WA 1EIHA 1BNZA 1RTOA 2L11A 2NZ1D 1J9OA 1S4ZA 1ML0D 2R3ZA 2RVLA 2X6GA 4HSVA 1G91A 1X3QA 1TVXA 1O80A 1HUNA 5COYA 2X69A 2K1BA
chains in the Genus database with same CATH superfamily
3PCOB 5FO7B 1PH5A 5C4XG 3A74A 5JJZA 5K36H 2Z8LA 2VXWA 4KKTA 2PQEA 3NXWA 2NUCA 3TRZA 1I4PA 3PV0A 4A3JG 1PFSA 1AZQA 2K5WA 4PZ6A 2E5LQ 1LUZA 3A5UA 1XJVA 4BY1G 2NTTA 1SDFA 2ZTCA 1U4LA 4NKLA 3TBIB 2WAQB 1K0SA 1Y1VB 2KHSA 3Q24A 3BJUA 4TSSA 4B3ML 1VMCA 2XWJB 3F1ZA 3S24A 4O2DA 5AJ3Q 3HOXG 3HOYH 4GKKL 3PSIA 4AH6A 3BZCA 4NXMQ 1G2SA 4PMCA 2EIFA 4CKEA 1Q90A 3N6RA 1A15A 1FNUA 3NBHA 3H91A 2BOSA 2F0OA 1TQOA 3C3LA 4WFN3 2Z4HA 4K5VA 2JA7H 5ELCA 1I6HB 1KLGD 1W6KA 4YY3Q 3GV6A 1JJ2A 1NR4A 4A3DB 1Y8NB 2V1CC 1H95A 3PO3G 1VQ4A 4DR6L 1LTGD 1ENFA 4B3MQ 1LTID 3FEWX 1ICFB 1T5EA 4HIOA 1WVLA 1YHAA 2WP8J 2B29A 3AFPA 2CW0C 3FP9A 2WAQE 4A3MG 3ERQA 1XWEA 3HFZB 4A3IH 4H13C 3I4OA 3OMCA 1XMQL 4LUVA 1X3FA 4HR7B 2VQFL 1HNWQ 3CCJA 1JB3A 2R7DA 2F4VL 3OIQA 1D6EC 5IGDA 4Y52H 2TSSA 4E6IA 5DAUA 4CHTB 5BN3A 1EIHA 1LTSD 2E2IH 1YEZA 3EJIA 2WB1B 1HUNA 4DV4Q 4DV5L 1V1PA 4M1UB 4R4CA 5C6AA 4K14A 3D8GA 1C0AA 4H44C 1B7YB 3L9AX 4A3KH 1EFWA 2VB3X 1CK1A 5JPNC 4BY7G 2ZM6Q 4YWLA 1JJGA 2Q8RE 1TWGB 1E24A 1PRTD 4ILWA 3K5LA 3HOUG 3CD6A 2WFWA 1VQIA 2CWPA 3GTPH 4DV0Q 2F0EA 4LMQD 1GHKA 3DM3A 1KTKA 1DGSA 4F8MA 2R7FA 5HY6A 1CKOA 4X62Q 1NCVA 3LX0A 1YJWA 4IJLA 3OOCA 5E4XA 2R6GA 1VQJA 3S1NB 5C3EB 1WFQA 4JOIA 2G9HD 1TS3A 1NAPA 1T5XD 1K9MC 1B53A 3U4ZA 3GTJB 2BA1A 3NWSA 1TWHB 3J80c 3A8KE 3K5NA 2F0KA 1NUCA 1EQQA 5KEEA 2KEEA 3JAMi 5IYCH 2NVQH 2RCNA 1LT6D 3M4QA 1TS4A 3HKZG 1C4QA 2Z6KC 3O13A 5EBDA 4XTCS 5EQ0A 3TS0A 4IPCA 3RLFA 2Q2TA 1EQRA 4IJHA 3H3VI 1BCPF 1Q3LA 2DUDA 4K8IA 1SSOA 3UDGA 1O7IA 1D1IA 5LHY1 2F4IA 4OGQC 3M3YH 2E2HH 4A3DG 4JI3L 5KNCA 1DCZA 5JJKA 2PQAA 3NEMA 3NBHB 4ZUJA 4CDCC 5M3MG 3B6YA 3AQQA 1L0WA 4GLVB 1XNRL 3GTGB 1V8QA 4JBKA 3GTKH 2NN6G 2F0QA 1MSHA 3KK7A 1GD7A 4DR3L 1S5DD 3KUPA 4X3KA 5TSSA 5IYBH 2UXCL 3ZJYC 4RAUC 1LM0A 4G7HC 1YVCA 2OEOA 1SFOB 2R92G 2XN9C 1VQ5A 2NZOA 3I4NG 3A7AB 4UHVA 4DXGA 3W5OA 1KXLA 4UAIA 4GOPA 2E75C 4RGTA 4GNXB 4IPHA 3K81C 2L55A 3NQTA 4A3IG 2A5HA 1G291 3KYHC 5LMNQ 3I4LA 1CUKA 3PIPA 3VYSA 2JA8B 2E2JH 1YNNC 3S17H 4R4QA 1F9RA 1EU4A 4ZAIA 2RKSA 2AQ3B 1NNXA 2V4DA 3T13A 4IFDH 4LW1A 4J15A 5HURA 3UDFA 1PH9A 4I7ZC 1SYFA 2HHHL 3W1GA 3PF4A 4DR6Q 2RHSB 3HRZC 4XQJA 4CJ2C 1ZYRC 4YIJA 3H15A 4A3KB 2DY7A 4A3MB 2B2WC 2ID0A 3M3YB 2ZJQA 1W6JA 2C9OA 2LMCB 4RA8A 1DYQA 3GTOH 3KDFA 1UE6A 4HAEA 3RNUA 4L5QA 3FPPA 1HTPA 4ZCKA 1W3SA 1N33L 2IHEA 3S17B 2XNAC 4HJ8A 1VQFA 4KY5A 1I4XA 3D31A 3J81c 3FVQA 1HJPA 2WB1G 4N8FA 1AEXA 4AQYQ 3QO2A 1LT5D 3ND8A 4OX9Q 5C44G 3M4OH 3H0GH 2QW7A 1VF5C 3T56B 2UUBQ 1CTMA 3JAMc 3AU7A 3VYTA 1JWUD 3S1MB 1TT2A 4A3FB 4K5XA 4LUZA 3ULLA 2D5DA 1JOOA 1EWHA 4C1NK 4G7ZC 1ILQA 3EIVA 5F2DA 4K6LA 4X3SA 4K0KL 5JVH3 4KJOA 2PZWA 2MJ8A 2Q8IB 4FO2A 3CXCA 4UPAA 4A3GB 1RKNA 1TXYA 2BA0A 5GQOA 2L4NA 1BVSA 4JI8L 3S9WA 1F2LA 2R93H 2RF4A 5CR3A 4ZLTF 5KRUA 5CC4A 1PRTB 3MC0B 1IBLQ 4QIWE 4JYAQ 4C56C 4XQNA 4KI0A 5C44B 3M9BA 2AKWB 1WTQA 2OWOA 2GVAA 4KY7A 2B63B 4DR2L 4QCLA 4QIWB 3I4MG 2YTVA 4JBWA 2NZHA 1YNJC 4XYOA 4RWSC 2G9DA 4A3LH 3TREA 1QILA 3GDEA 3KOJA 3AYHB 4NB3A 2DNCA 1XXGA 5C4XB 5EPKA 2M9VA 3NTKA 2L0CA 1X6OA 1VQNA 3QOLA 5IYDG 2R93B 4FXGC 4LAAA 1CQVA 3EN2A 1GUGA 1SNMA 4JC0A 4C3JH 5LMUQ 3K0XA 5C4ZA 4U68A 3TP6A 1BF4A 2NVQB 4GLAC 3OHXC 3NP8A 3F8TA 1HRJA 3FKIB 1IYVA 2JQOA 3VR5A 1YJ9A 2JA6H 5JJIA 3PIOA 1SE3A 1O7LA 2A69D 4IZ8A 1X54A 2B2YA 4MHEA 2F1MA 4FYDA 3PMFA 4UP9A 2I5HA 3HOZG 1KAAA 2XSCA 4OL7A 4X3UA 4LF6L 1YNJD 3TN2A 1I4HA 4POGA 1EUJA 3I4NB 5FJ8H 4JK1C 4ZQ3A 4ZKBB 1MJEA 3GTLH 4DUZQ 2R92B 3TP5A 3HG9A 3S16B 4BBRH 3HOYB 1E2ZA 4JOIC 2B63H 1C9OA 2AWNA 4FNFA 2KHIA 1PYBA 4DGZA 5E3FA 3MAQA 3MXNA 2KQ3A 1XPUA 1DD2A 3QB3A 5ISRA 3NE5B 2N49A 3I3CA 1OXSC 1Y69U 2ZT9C 1AE3A 3FDTA 3T1HL 2EYPA 5CGKA 4Y7NH 4B9WA 2JN4A 1UEBA 2Q2HA 1E2VA 1PZKD 3OTOL 2B8GA 1E22A 1K28A 3CRLC 4A3BG 3NHHA 2FHTA 2AHOB 2DJGC 4B3TL 3CKIB 2RVLA 3PUWA 2R3ZA 4A3CH 2D0OA 2LFNA 1G91A 1TVXA 3HKZB 4HMIA 4RH6A 3MEFA 2JE6I 4A3EB 3RR5A 4MN3A 3H09A 2GA4B 1ZYRD 3C1FA 1SJED 5EKLA 4POFA 4LFCL 1YNXA 3IFTA 3V05A 5M5XB 3S2HH 3S1QH 2CFMA 3D3RA 5AJ3L 4TKOB 1Q8IA 1TS2A 2RCFA 3I2ZA 4OIKA 1VMPA 2QDBA 4K2KA 4DR4L 5C5LA 3Q0AA 4LF7L 3RZOH 4HIMA 1ENAA 3K80C 4BY7H 1K8OA 5IGFA 1EOTA 1HH2P 2PPBC 4TVAB 1XPRA 1MSGA 4YY3L 3S1RB 1I50H 1HNXQ 1HUMA 3GTMH 3ULJA 2QDLA 1YHQA 4HTHA 4K0KQ 4IFDI 3RZDB 1A0IA 1GUTA 1PYSB 1SNDA 2A73B 4RCNA 3NSWA 3CP0A 4L5SA 3T53B 2JEBI 1DOMA 4A4IA 1K8AC 2OXPA 1Q46A 1HQRD 5EPLA 2KVMA 2E2IB 4PG3A 4U673 5C3EG 2GN5A 1MHWC 1SE8A 4DNRB 1NR2A 2JA6G 3I4MH 1JT8A 4OEMB 1LT4D 4DNTB 3VYUA 2D62A 3HP3A 1VDZA 2WB1E 3Q22A 1SNPA 4KJNA 4IUTA 1BDOA 5C0XG 4JI6Q 3VYRA 2K6AA 4DV3Q 1TWCH 4HJAA 4DR1Q 1N32L 2WV6D 3HOUB 5GAHC 1ZXTA 2F0SA 1S5FD 1KRTA 1PFNA 3K7AH 5DM63 4ZKCB 2UXCQ 3PUZA 4YWMA 1STAA 5BR8L 1AH9A 1JE5A 1KNAA 3MVVA 1V1OA 1GUNA 1WOCA 1WCMH 2J0TD 2E2DC 1LT3D 1SNOA 1ZEQX 3OW7A 5D3DA 4DV0L 5IT9E 2K1BA 1Y14B 3VR3A 1XNQQ 2EYOA 1IYJB 4IUQA 4DV6L 1G8ZD 2AUKA 1EFID 1QNKA 3D6WA 3RZDH 1B70B 4BXXH 1H9RA 2DY8A 2JXMB 1CSQA 3SVMA 4CDFC 2Q2IA 1AE2A 3KJPA 2FMCA 3X3MA 1QZGA 3CHBD 4DV3L 3PIO3 3I4MB 1RF2D 1A3UA 2PI2E 4I65A 3J81i 1PA6A 4WJ3M 1RODA 4DA2A 4X64L 3HZXA 1NJIC 1UEAB 2HIXA 5T1IA 1IZ6A 2OQKA 1PH7A 5IP7H 2Z4IA 1EY7A 4MNOA 2A6EC 2L1BA 2KCTA 4ALPA 2A68C 4BBRG 1TWCB 4GKKQ 4LFBL 2K5VA 1SMYC 1LTLA 1OO9B 4BWGB 2BE5C 5ELNA 4DR7Q 2F03A 2K5HA 2SNSA 2HDMA 4ZK9B 4HIKA 1X3GA 1M8AA 1Q8KA 3X3NA 3KF8A 2AWOA 2A68D 4A3EG 1D7QA 3H6MA 1CI3M 1M1KC 3DLLA 1B3AA 1S5CD 1SYEA 2LKVA 1EY9A 1BBWA 5LMNW 4BA2I 1HZ9A 1SROA 1VQKA 5CV9A 2LSSA 1WCMB 2N8NA 4RGMA 1S72A 3H94A 3S15B 4GN5A 3HOVH 1I50B 4K5WA 1GKHA 1HZAA 1IXRA 3IKJA 3QOJA 3D0FA 1IW7D 3OMGA 3ERSX 3K8AA 2A6ED 1VQGA 1KNEA 1HFGA 3R93A 1VQBA 4LJZC 3CCQA 4A3GH 3I4NH 2FXQA 2B2TC 2MP1A 3PUYA 3M4PA 1L0XB 1B3QA 3KLSX 1EQTA 3HOXH 1L0YB 4DR2Q 1PFBA 3KDFB 3S2HB 3VR6A 1FYCA 2X6GA 1IL2A 3A56A 4WJWA 1KD1C 2VUMG 4L5RC 1RCVD 5A35A 2PZTA 2OQ0A 5KIXA 2IPKD 1FGBD 3A7LA 4JW0A 5IYBG 2EDGA 3MFGA 4DUYQ 5JEAH 4AYBE 1WI5A 4OXPA 2NVXB 5M3FB 2PCFB 5C3XA 1R9TH 4DV7Q 4KN7C 2M00A 2Y0SG 1OTCA 3E9HA 2WIIB 1O78A 1LABA 2EZVA 2NVYH 3D6CA 4LF9L 4A3BH 1SR3A 4HCSA 1X3PA 4OO1H 2R7ZH 2BCOA 3A55A 2B8FA 1IBKQ 3C46A 4X6AH 3UE0A 4RMFA 3SR1A 3F2BA 2J4XA 1DZ1A 2MO0A 2L5TA 4DV2L 4A76A 1MGSA 1Z7TA 4DAVA 3JAME 4EX5A 2UXBL 3VDYA 1EZ8A 3GTQB 2F52A 3HKZE 3DMUA 1V9PA 1S3OA 4LF6Q 4C3IH 2E5LL 4H7BA 3GTPB 1G6ZA 4QUCA 1G6PA 5IP9H 1AN8A 2B2UA 4DAYB 5M3MB 4ZYSA 5D3IB 2PYKA 1CT1D 4C3JG 1JC7A 3U4VA 4XIGS 4YCUA 2ZTEA 4O42A 2O4XA 1UNSA 2OTJA 5CORA 1FL0A 5IP7G 2XWBB 4Q0FA 1HNZL 1BKBA 4M8AA 3U50C 1PH1A 2N88A 5ELFA 5C0XI 1QJOA 4IPDA 1K8MA 4B3RQ 1KDBA 3CCVA 4G4KA 3GTJH 2LS01 1I6VC 2WINB 3CPWA 2RDGA 4EQNA 3A5ZB 2QKIC 5IY0A 2Z0SA 1E3PA 3UE1A 1KABA 4WORA 3OYYA 4DPGA 1CKMA 1WYDA 4IQZA 4JI5L 3K58A 2HQEA 2JSOA 4PZ8A 1CKNB 3H3VH 2L15A 1C48A 3QR8A 4FXKC 5EGTA 4IUVA 2HDLA 3BVZA 4R8IA 2PZUA 2HUGA 3H0GB 3N52A 1J6QA 4F88A 2WAQG 4GKJL 4ZUIA 3BDCA 5CV4A 1VQAA 4R4OA 1ML0D 2UUCL 4BY1B 4LWCA 4HCEA 2HIVA 4OWTB 4BBSH 3KF6B 1HZBA 3CMEA 1S5ED 4A3MH 5C4JH 3CAMA 5IT9L 2YTYA 4JI2L 1EL0A 4NDXA 2I5MX 1PH8A 2JA7B 1EYCA 2NVTB 1TY2A 4FF3A 2QEJC 3RLOA 1XYIA 4QMGA 5EAYA 4X66Q 3S1QB 1SYBA 1EEFD 1YNND 3GQBA 3WWVA 1V1QA 4C3HB 1I4GA 2YV5A 1ENCA 1HA6A 2K04A 2MO1A 3OWFA 1PTOD 2NWGA 2JJQA 5CV7A 1J5EQ 2SEBD 1PH2A 4H0LC 3HS0C 3U9OA 1H9KA 3H3VC 3NTIA 4JV5Q 5E7NA 1PZID 2C35B 1DJRD 2QCPX 2L12A 1ET6A 1YIJA 4X65L 3NELA 5E4WC 1IKLA 5JEAG 4IUNA 1U0LA 4DR5Q 2DN8A 2D2CC 4JI1Q 3AEVA 3BDLA 2KCNA 1EZ6A 3HEJA 1WJJA 4OIJA 2K28A 2UXDL 4L5TA 1ZKOA 1KIXA 1JCKB 1FR3A 1K0RA 2IJ0A 2SNMA 3NPPA 5DNFA 3K0YA 2PNRC 4OX9L 5M5WH 3E0JA 4C3IG 4DR1L 1N32Q 1EWIA 1PTOB 2NVTH 1MJCA 2UUBL 1QB5D 1VQCA 1PYWD 4GNXA 4DUYL 1JB7A 3K7UC 4DK1A 5CV8A 1Q82C 2JYOA 1EWCA 1JICA 2VNUD 3TP7A 4I7AA 4MTKA 2RSNA 4QGUA 2O2LD 2R7ZG 5DM73 1HXYD 4BS9A 4HN7A 1QVFA 4B3SQ 1GOZA 4C2MH 1B2TA 1A63A 3QG1A 4UP8A 3SGIA 3J80L 2NVXH 2IT1A 2Z6BA 1J9OA 5FK9C 1EQVA 1TWHH 4DR5L 1HHVA 4DNIA 4GOPB 1LLRD 2C5CA 3PO2B 2UXBQ 5IGEA 1QUQB 1K8GA 3L0OA 1E2WA 1EY8A 2CH4W 1IBMQ 1BBUA 3G7LA 4P73A 4IO9A 4A3JB 3JAML 1FVIA 2B2WA 3ND9A 4OWXB 2BH8A 2BH2A 2KECA 3E5SA 2ZJPA 1I94L 2NN6I 1M4VA 5DEHA 2MFIA 2E74C 1BBXC 4FXDA 5IIFA 2CH4A 1TWFH 2VB2X 2QA4A 1WTHA 3PGZA 1LYLA 2B3GA 4RGOS 3TDQA 4HJ7A 5M3MH 4BBSB 3CMAA 1QCBD 3PO3H 4B3RL 1JORA 1KDAA 2XRQD 3CQZB 4L8JA 5I6WA 1ET9A 4DV1Q 2B2UC 1STGA 4CKCA 4LF7Q 3HOZB 4OO1I 2E2JB 2IY5B 3CCEA 3I73A 4JI7L 3GD7A 5CYUA 4BY7B 3K5OA 1RTNA 5IGCA 3AFQA 1STNA 2PI2A 2KEDA 1NE3A 4IUUA 5A2QL 4IPGA 3FPUB 3FKIG 1PHJA 2NB0A 5J22A 2BE5D 3BVMA 3W2DA 1A62A 3EVQA 1BOSA 2MNAA 5M9OA 2ICEC 1K83H 5BR8Q 3CQZH 2EYJA 2EVBA 2F3IA 4F87A 1CA5A 1N33Q 4X62L 5C3WA 1IL8A 4LF4L 3T4AC 1CZGA 1VQ9A 3S14B 3SK5A 4KKSA 1U4PA 1LTBD 5IWAQ 5C0XH 1Y1WB 1H9JA 3DXJC 5FO8B 4DXFA 3ONAB 4A93G 2VUMH 2E2HB 3R2TA 1RIPA 2XIWA 4GZYC 1EIFA 1I4QA 5FOBB 4JBMA 4A93B 2AMCB 1J5EL 1PRTC 5IT9c 4P74A 3TMEA 3BYTB 1EIGA 3RZOB 3HOZH 2UUAQ 3STBC 4O0AA 1E7ZA 2X6LA 1EY5A 2TMPA 4DN4M 3EFXD 4LFAQ 1P8LA 2P5ZX 3MXGA 1IBLL 1I3QB 3MXPA 3HOVG 2K7VA 3KLSA 2XTIA 1O7ZA 1MKHA 1PH3A 2RDHA 2F0DA 4PZ7A 1WTPA 4DK6C 1Q81C 4EQPA 4A3FH 2F0TA 3D4RA 4EQ5A 2QILA 1GHJA 3T16A 4R4TA 1JWMD 1OXXK 4DR3Q 1Y1WG 4RHRA 1VQ7A 4OWWB 1VQOA 4GN3B 1FGUA 1B9NA 1G51A 2F0WA 3PUXA 2F0FA 1HNXL 4LF8Q 4PNYA 2L9HA 4K8JA 3CW2C 5C3EH 2IWHA 2J7ZA 4MZ9A 3SE0A 3TSSA 3OSOA 1K3RA 2UUAL 2K32A 1TS5A 4RG1A 3KJOA 1PH6A 3OWEB 3RD4A 1JOKA 1DXMA 1QVCA 2ENBA 3MXNB 4R8NA 1GUOA 5I4DA 2EYFA 4KMUC 4CGYB 4N9TA 1NTGA 3R2IA 5T1GA 1EYDA 5M3FG 5GROA 3P20A 5FO9B 4JVZA 3EA6A 3J7YW 3MFYA 5JVG3 1XMOL 2BDNA 5D14A 2EQSA 5M5YH 1WTVA 4JI4Q 1B9MA 4CJ1B 1FD7D 3G4SA 4B9XA 3MZ5A 4R4IA 4V190 3SK4A 3HOVB 3SHLA 2JA8H 5LL6X 1IHZA 1Y8OB 2Q8TA 1WD1A 3LNNA 1SYDA 1V43A 2EXDA 4IALA 2G5DA 1BCPD 3S14H 4A3JH 1E1TA 1O80A 1SEBD 3J80E 2X69A 4X3TA 2UU9Q 4O1NA 4EVOA 3NQIA 2K5DA 3I90A 2KCMA 1BCPB 1CSPA 3CCLA 4YHHL 3S1NH 2IW3A 2D9UA 1BXTA 4L6TB 4HEDA 1JOQA 1F2ZA 3BZKA 1EYAA 4QL5A 1N36L 1YI2A 4AYBG 1SNCA 2WACA 2RHQB 4JI0L 4ULLA 1IBKL 2JA8G 2B63G 1N9WA 3I7FA 2N3SA 3J7AV 2LY7A 1BQQT 1TIID 3T1YL 4DV2Q 2HQLA 3MXUA 4ZRZA 1MBYA 5I9PA 5I2XA 4B3TQ 1EY4A 2KHJA 1VF7A 5J3BA 4A3DH 1ESFA 1DONA 3S16H 2EJGC 4ABNA 2VQEL 2M2LA 1CA6A 3QIAA 2KOLA 4HSPA 1TWAH 2NBFA 4MIUA 2SDFA 3KBGA 2B2VA 2MUYA 3BG3A 3L2PA 3CC4A 4A3CG 4A3BB 2CCZA 1BCPC 1ONLA 1AP0A 3DEOA 1LTAD 1F2YA 2EYHA 3E0EA 2OTLA 4JYAL 5M5YB 4FF2A 4RKLA 5JAVA 2OT2A 3BYYB 1STBA 2R92H 4NW2A 4DR7L 4GS3A 2F0LA 4BBRB 3G48A 1MD2D 4DKAC 2VY3A 3RLNA 5J1ZA 3HOUH 2EYLA 4JG2A 3CCSA 1QOHA 1UE1A 5C4HA 2RA4A 5LMNL 4DR4Q 4IOCA 3ULPA 3AMUA 1SYCA 2RBMA 1QZHA 4FF4A 3C1EA 4JBJA 3T1YQ 3I8ZA 3IAYA 3JC66 5FLXL 1B8AA 4DV4L 4DV5Q 1Q1BA 1NY4A 1GUSA 2KENA 1SMYD 5EJWA 2KUMA 3R8BA 1H9SA 1PMRA 2JA9A 4IURA 1HNZQ 4LF5Q 1PZJD 1WTXA 5LMUL 1RD9D 3NUCA 1VQDA 4FF1A 4XDXA 4B3SL 1HPCA 1UUPA 2EJFC 1WTWA 1VQPA 5DLQE 3WOEA 4JCVE 4OHJA 1B50A 4F7XA 2OCEA 4DF7A 1TKWB 1VQLA 3EQLC 4PV1C 3U58A 5IYCG 1RTOA 4XYQA 5J39A 3H0GG 3PUVA 4QF4A 5FLMG 2YU9B 1OXUA 1TWAB 2A6HD 4JI6L 1F9SA 4KHVA 2A19A 5ELDA 4A3IB 1SRUA 2KA7A 3M7NA 1IW7C 2K5QA 3SK6A 2UUCQ 2JA5H 1MIUA 1HR0Q 4LF8L 3WOFA 1U4MA 1Y1WH 3KF8B 1TU2B 4YWKA 2N55A 1EOVA 3ITPA 5KNBA 3G71A 1X32A 4JI2Q 3RUZA 5FLMH 1OXVA 4J1MA 1HQMC 2RSOA 1L1OC 1D5MC 3OIPA 4B08A 2DNEA 5EPJA 4DAMA 1Z6HA 4KV6A 3QWNA 1X65A 3DWQA 3V96A 1WTOA 3F2CA 2K05A 5KGUA 1KAWA 4JI1L 2ES2A 4RCOA 3CU7A 1B1ZA 1FNWA 4FVMA 5IGBA 3OW2A 5IGGA 2B2YC 3EROA 1NMFA 1VQ6A 4J8QA 1TR5A 1YJNA 4LUOA 3M4YA 2F3VA 1VQHA 4Y7NB 4IFDJ 2F0UA 1KDCA 3E6ZX 1TWFB 1PDQA 1B44D 2PMZE 4RFBA 5K36G 1HR0L 4CDEC 3I91A 2IHFA 1SMXA 3A0JA 1A3VA 2PW5A 4P72A 1QG7A 3PO3B 2XVSA 3U9SA 2K01A 1AW7A 1GJXA 5IYDH 1NBWA 2Y0SB 1A2TA 3TEHB 5FKAC 5C4JB 3NWTA 5M5XH 5IWAL 2PQAB 1T9HA 1A3TA 4XT1B 3MHBA 4XT3B 2LXJA 4JI0Q 1UAPA 1Z9FA 4K2LA 4BA1I 2IX3A 1PTOH 1E0BA 5EKIA 1C7YA 2PW7A 1QWYA 4XQQA 2EE1A 3EBEA 2XGTA 5BN5A 2A74C 1SFOH 2K52A 4PMBA 4DK3C 2OF1A 2MHVA 4YCWA 1DOLA 1LO5D 3RN5A 1EY6A 4UY8C 5L37A 1BNZA 2NZ1D 3K6OA 3M4OB 3HOWG 2Y0SE 1QVGA 3NBIA 4HMJA 1B4OA 1YBYA 3GTGH 4ID6A 4IOAA 3VA7A 3KLWA 1G2TA 1HFNA 3Q6SA 2EPBA 2FINB 2RDFA 3W3AA 5JPMC 2B2VC 3M85A 5AFWA 2LXKA 4C1NI 1K3BC 3D4WA 4YCVA 5C4XH 4NXML 3L3OC 1FNVA 1A6XA 1HTLD 3S2DB 3CCUA 3DM1A 1FJGL 4P71A 3SXHA 5JJLA 1XPOA 1OXTA 4IUPA 4HJ5A 4P2CB 3K5MA 2ZTDA 1BR9A 2R93G 1D8LA 4HIDA 4Q5VA 3J80i 4GNXC 1CM9A 1PRTF 3K57A 5HGTA 1U9RA 1RL2A 4EGVA 4UP7A 1PLFA 3UDXA 3GO5A 2KBNA 4LF5L 1I4RA 1PV4A 4KHPL 1VQMA 1JE4A 5EBCA 2A8VA 3G6JB 3T51B 1Q7YC 1CZWA 1E1OA 3KBXA 1XNQL 4NP5A 5EKKA 2JP1A 1SXTA 2CWAA 2R61A 2Z6KA 1SE4A 1STEA 1D2BA 1YZ6A 3DUZA 5C44H 1SBBB 1X3EA 4C3JB 4CKBA 2EY5A 2EYMA 4NPSA 2VQFQ 1HNWL 1F9QA 4QJFA 1VQEA 3TP8A 1U5KA 4ODGA 4NXNL 1XMOQ 1TWGH 1LTRD 4OO1G 4WJ4A 4X64Q 1Q12A 3J81L 3LWEA 1GUWA 3TQYA 1EEID 1L1OA 5G3LF 3S2DH 2CQAA 3I56A 4K6DA 3RMHA 1I6HH 2EY1A 1IYUA 3J81j 2EY2A 4LNQA 2ATWA 1Y1VG 2JA5B 4PMWA 2K50A 3UI2A 5CBAE 3TS2A 4KD3A 4R9WA 2L11A 3L7ZC 2ICIA 4P75A 4HSVA 2ASBA 1JQYD 4KHZA 3WDNA 2H1EA 3KF6A 1PVOA 1N34L 1Z47A 1EU3A 2AUJD 1HZCA 4A75A 3E3XA 3C2PA 1TY0A 2AQ2B 1UE7A 1EY0A 4QQBX 2GVBA 5I9OA 4JI5Q 4A3LG 4ME3A 1F9PA 1D1KA 2ZXPA 3HOWB 2VUMB 1CQFA 5FLXc 3HKSA 5CV5A 4DFAA 2O5IC 1S40A 4CBVA 2ZM6L 1X9NA 5IE8A 4NXNQ 2N78A 3GTLB 3NENA 4GLXA 1GVPA 2I07B 3ER0A 2JA6B 4APVA 5I6YA 1ASYA 4G57A 5A2QE 2Z9HA 1JWSD 5LL6S 2KJXA 1NMGA 1I3QH 1JJCB 1K83B 1N8RC 5CBEE 2H5XA 1EIYB 2HCIA 1BO0A 2F0IA 3DHQA 3T1HQ 2F0GA 5KYIA 1F77A 1XTDA 3HOWH 3I72A 3LWUA 1QUQA 5FLXE 1W2BA 4X66L 3VR2A 4DV1L 3IRBA 3CRKC 4S3SA 3TZDA 3OTOQ 3DEPA 4MTNA 3LGJA 4BBSG 1QE6A 2ZJRA 1SLJA 4NMZA 4LK1C 3GTOB 1CFMA 1NSNS 3NK9A 1PTOF 4DV7L 4AIMA 1EYGA 4JI4L 1GO3E 1PH4A 4RHSA 3OPOA 4KN4C 3K59A 3Q8DA 5BN4A 2Z1CA 3S1RH 2CHBD 4UDUC 1HCZA 4KTAA 3ZYYX 4KLKA 5GAGC 3PO2H 1RDPD 1F2MA 2EOTA 1JR0D 2FJ2A 5ELBA 3PO2G 2AQ1B 3A8JE 2PO4A 2UU9L 2WKDA 3A54A 2UXDQ 1R4QB 2K75A 1H9MA 2Q2UA 1FJGQ 1XNRQ 3GP7A 4C2MB 2F0JA 3M7GA 1H9SB 4KK7A 2CKZB 5COYA 1YITA 3PQIA 2A1AA 4KD4A 3VR4A 2R7ZB 1QNUA 2HD3A 2YU9H 5D65A 4RGNA 1KL9A 5CMDA 3Q23A 1ASZA 5G3LD 1K73C 3A8IE 4BY1H 4OONA 2VQEQ 1UE5A 2K14A 4H02A 3CCMA 2VS1A 4YHHQ 4C3IB 5IODA 1L1OB 3GTKB 3V2TA 2F0PA 4CJ0B 4G7OC 1X56A 1IKMA 3PF5A 1LTTD 1L2FA 2VZAA 2FFKB 1RJTA 1RHPA 4TRDA 1O7YA 1SYGA 2EJMA 1KC8C 4IFDG 1Y1VH 1D5ZC 1CHPD 1YHBA 3S15H 3VA5A 4AQYL 2JA7G 3S1MH 1WD0A 2B39A 4DAPA 1SAPA 2VW9A 1UWVA 2ALYB 1LACA 3MTSA 5I2YA 5IP9G 1I94Q 3SEBA 1CHQD 3FKIH 3BS1A 3PIP3 3KFUA 1AZPA 2F0MA 1Q1EA 3IL8A 1DOKA 2JK8A 4RKBA 3J7AF 4DAYA 3P1HA 2A69C 2B2TA 4WRDA 1MI2A 1HR0W 4C3HG 2D0PA 3FMCA 3DWPA 4FP5D 5C5MA 3GTQH 2F0HA 4TQUS 3CC2A 2EY6A 5CV6A 4Z9CB 2MGSA 1KQSA 1M90C 3IFDA 5C0XJ 2CQOA 2HT1A 1ESRA 3GV3A 2IX0A 1GM5A 4JI3Q 5ELEA 4DU9A 1J8IA 3CF5A 3MA2B 2HCCA 4FDBA 1KLUD 4GOPC 4IN3A 3J81E 4C3HH 3DWAA 3I55A 2IL8A 1SJHD 4BXXG 2NN6H 3P7JA 1ICWA 2NYZD 3MWYW 4JV5L 2QGQA 1S4ZA 1CKNA 1R9TB 5ELOA 4JI8Q 1X3QA 2JA5G 1KRSA 2JEAI 1JMCA 4X65Q 3F2DA 1KHIA 1LV9A 3RN2A 2NTSA 2K4KA 2ZXRA 4A93H 2SOBA 2CW0D 4LFBQ 4OELB 5E1FA 2RQXA 5HGQA 5KNDA 2O5JC 4LF4Q 1VCIA 3BVGA 4A3GG 1ILPA 2MPMA 3D4DA 3QJYA 1XMQQ 3UDIA 3URYA 3GTMB 2EXZA 1N36Q 2I46A 2FMMA 2F4VQ 4QY7A 3J7A5 2DJFC 1PFMA 4KY6A 3I70A 1BUVT 2I5LX 1DM0B 5GADC 4QB4A 4R1JA 2F3WA 5K5PA 4N8X1 1PTOC 2H4OA 2K03A 3TZUA 2HHHQ 1STHA 1PXUA 4HJ9A 5IOCA 1HA5A 4KHPQ 5JOBA 4AYBB 5H1SE 1SE2A 1A8VA 4DUZL 5JEAJ 4GKJQ 5M3FH 5GAEC 1II3A 1X55A 2QF7A 3AB9A 4LFAL 1XTCD 3K7AB 4GN4B 3BZDB 4N9PA 2PMZB 2WKCA 2F0VA 3NTHA 4J6HA 4CDDC 1I5FA 1Q86C 3FHWA 3SK8A 2E76C 4KKUA 2YYZA 1R4PB 2PNHA 3E9IA 4L63B 4A3KG 1P16A 3MEHA 3HGBA 4A3FG 3CCRA 3CC7A 3HOXB 3J7ZC 1C8CA 2NVYB 4EQOA 4JPBW 2CVRA 2E8GA 4PQXA 4DK0A 1IBML 4ME5A 3BU2A 5FJ8G 2XRSD 2YTXA 1S5BD 2DGYA 2F0NA 1U4RA 2K5NA 3W1BA 5KYLA 1SNQA 1AFPA 2BDOA 2K33A 3STBD 3F2UA 4QUFA 3ICEA 2I0QA 3R3OA 2A6HC 2QEXA 1XX8A 4XXEA 3G6EA 2MQHA 1VQ8A 2KCCA 1SN8A 4A3EH 1WTRA 1A2UA 1STYA 1WCMG 5M5WB 3KLRA 1GXDC 2ZXOA 2IX1A 4V0BA 1Y8PB 1V1PB 3HOYG 4LF9Q 1VS0A 4LFCQ 1N34Q 3P75A 3CPFA 5NUCA 3FRPB 3SDZA 2VL6A 4JI7Q 1D5XC 4DV6Q 3BDOA
chains in the Genus database with same CATH topology
5FO7B 5JJZA 5K36H 2Z8LA 2VXWA 4KKTA 2PQEA 3NXWA 2NUCA 1I4PA 3PV0A 1AZQA 2K5WA 2NTTA 1SDFA 1U4LA 4NKLA 3TBIB 2WAQB 1Y1VB 2KHSA 3Q24A 4TSSA 1VMCA 2XWJB 1G2SA 4PMCA 4CKEA 1Q90A 3N6RA 1A15A 1FNUA 3NBHA 3H91A 2BOSA 2F0OA 1TQOA 3C3LA 4WFN3 2Z4HA 4K5VA 5ELCA 1I6HB 1KLGD 1W6KA 3GV6A 1NR4A 4A3DB 1Y8NB 1LTGD 1ENFA 1LTID 3FEWX 1T5EA 1WVLA 2WP8J 2CW0C 3ERQA 1XWEA 4H13C 3OMCA 4HR7B 1JB3A 3OIQA 1D6EC 5IGDA 2TSSA 4E6IA 5DAUA 4CHTB 5BN3A 1EIHA 1LTSD 3EJIA 2WB1B 1HUNA 1V1PA 4M1UB 5C6AA 4K14A 3D8GA 4H44C 3L9AX 2VB3X 1CK1A 5JPNC 2Q8RE 1TWGB 1PRTD 4ILWA 3K5LA 2F0EA 4LMQD 1GHKA 1KTKA 4F8MA 1NCVA 3LX0A 3OOCA 5E4XA 2R6GA 3S1NB 5C3EB 2G9HD 1TS3A 1NAPA 1T5XD 1B53A 3GTJB 2BA1A 3NWSA 1TWHB 3A8KE 3K5NA 2F0KA 1NUCA 5KEEA 2KEEA 1LT6D 1TS4A 1C4QA 3O13A 5EBDA 4XTCS 5EQ0A 3RLFA 1BCPF 1Q3LA 4K8IA 1SSOA 1D1IA 5LHY1 2F4IA 4OGQC 5KNCA 1DCZA 4ZUJA 3GTGB 1V8QA 2NN6G 2F0QA 1MSHA 3KK7A 1S5DD 3KUPA 4X3KA 5TSSA 4RAUC 4G7HC 2OEOA 1SFOB 2XN9C 3A7AB 4DXGA 4UAIA 2E75C 4RGTA 2L55A 3NQTA 2A5HA 1G291 3I4LA 3VYSA 2JA8B 1YNNC 1F9RA 1EU4A 4ZAIA 2RKSA 2AQ3B 2V4DA 3T13A 4IFDH 5HURA 4I7ZC 1SYFA 3HRZC 4XQJA 4CJ2C 1ZYRC 4YIJA 4A3KB 4A3MB 2DY7A 2B2WC 2ID0A 3M3YB 1W6JA 2C9OA 2LMCB 4RA8A 1DYQA 4HAEA 3FPPA 1HTPA 3S17B 2XNAC 4KY5A 1I4XA 3D31A 3FVQA 1AEXA 3QO2A 1LT5D 3ND8A 3T56B 1VF5C 1CTMA 3AU7A 3VYTA 1JWUD 3S1MB 1TT2A 4A3FB 4K5XA 4C1NK 4G7ZC 2D5DA 1JOOA 1EWHA 1ILQA 5F2DA 4K6LA 4X3SA 5JVH3 4KJOA 2PZWA 2MJ8A 2Q8IB 4FO2A 4A3GB 1RKNA 2BA0A 2L4NA 3S9WA 1F2LA 5CR3A 4ZLTF 5KRUA 5CC4A 1PRTB 3MC0B 4C56C 4XQNA 4KI0A 5C44B 1WTQA 4KY7A 2B63B 4QCLA 4QIWB 4JBWA 1YNJC 4XYOA 4RWSC 2G9DA 1QILA 2DNCA 1XXGA 5C4XB 5EPKA 2M9VA 3NTKA 2L0CA 3QOLA 2R93B 4FXGC 4LAAA 1CQVA 1GUGA 1SNMA 5C4ZA 4U68A 3TP6A 1BF4A 2NVQB 3OHXC 3NP8A 1HRJA 3FKIB 1IYVA 3VR5A 1SE3A 1O7LA 2A69D 4IZ8A 2B2YA 4MHEA 2F1MA 4FYDA 3PMFA 1KAAA 2XSCA 4OL7A 4X3UA 1YNJD 3TN2A 1I4HA 3I4NB 4JK1C 4ZQ3A 4ZKBB 2R92B 3TP5A 3HG9A 3S16B 3HOYB 1E2ZA 2AWNA 4FNFA 4DGZA 5E3FA 3MAQA 3MXNA 2KQ3A 1DD2A 3QB3A 5ISRA 3NE5B 3I3CA 1OXSC 1Y69U 2ZT9C 3FDTA 2EYPA 5CGKA 4B9WA 1E2VA 1PZKD 2B8GA 3CRLC 3NHHA 2FHTA 3CKIB 2RVLA 3PUWA 2R3ZA 1G91A 2LFNA 1TVXA 3HKZB 4HMIA 4RH6A 2JE6I 4A3EB 4MN3A 3H09A 2GA4B 1ZYRD 3C1FA 1SJED 5EKLA 3IFTA 3V05A 5M5XB 3D3RA 4TKOB 1Q8IA 1TS2A 4OIKA 1VMPA 2QDBA 4K2KA 5C5LA 3Q0AA 1ENAA 1K8OA 5IGFA 1EOTA 2PPBC 1MSGA 3S1RB 1HUMA 4HTHA 4IFDI 3RZDB 1GUTA 1SNDA 2A73B 4RCNA 3NSWA 3T53B 2JEBI 1DOMA 2OXPA 5EPLA 1HQRD 2KVMA 2E2IB 4U673 4DNRB 1NR2A 1LT4D 4DNTB 3VYUA 2D62A 3HP3A 1VDZA 3Q22A 1SNPA 4KJNA 4IUTA 1BDOA 5C0XG 3VYRA 2K6AA 2WV6D 3HOUB 1ZXTA 2F0SA 1S5FD 1PFNA 5DM63 4ZKCB 3PUZA 1STAA 1KNAA 3MVVA 1V1OA 1GUNA 2J0TD 2E2DC 1LT3D 1SNOA 1ZEQX 3OW7A 5D3DA 5IT9E 2K1BA 3VR3A 2EYOA 4IUQA 1G8ZD 2AUKA 1EFID 1QNKA 3D6WA 1H9RA 2DY8A 2JXMB 3SVMA 2FMCA 3X3MA 3CHBD 3PIO3 3I4MB 1RF2D 1A3UA 4I65A 1RODA 4DA2A 3HZXA 1UEAB 5T1IA 2Z4IA 1EY7A 2A6EC 2L1BA 2A68C 1TWCB 1SMYC 1OO9B 4BWGB 2BE5C 2F03A 2SNSA 2HDMA 4ZK9B 1M8AA 3X3NA 3KF8A 2AWOA 2A68D 3H6MA 1CI3M 1B3AA 1S5CD 1SYEA 2LKVA 1EY9A 4BA2I 5CV9A 3S15B 1WCMB 4RGMA 3H94A 1I50B 4K5WA 3IKJA 3QOJA 1IW7D 3OMGA 2A6ED 1KNEA 1HFGA 3R93A 4LJZC 2B2TC 2MP1A 3PUYA 1L0XB 3KLSX 1EQTA 1L0YB 1PFBA 3S2HB 3VR6A 1FYCA 2X6GA 3A56A 4WJWA 1RCVD 5A35A 2PZTA 5KIXA 2IPKD 1FGBD 3A7LA 2EDGA 3MFGA 5JEAH 2NVXB 5M3FB 2PCFB 5C3XA 4KN7C 2M00A 2WIIB 1O78A 1LABA 2EZVA 3D6CA 4HCSA 1X3PA 4OO1H 2BCOA 3A55A 2B8FA 3C46A 3SR1A 1DZ1A 2J4XA 2L5TA 1MGSA 1Z7TA 4DAVA 3JAME 1EZ8A 3GTQB 3DMUA 4H7BA 3GTPB 1G6ZA 4QUCA 1AN8A 2B2UA 5M3MB 4ZYSA 5D3IB 2PYKA 1CT1D 4C3JG 1JC7A 4XIGS 4O42A 2O4XA 1UNSA 5CORA 2XWBB 4Q0FA 4M8AA 2N88A 5ELFA 5C0XI 1QJOA 1K8MA 1KDBA 4G4KA 2LS01 1I6VC 2WINB 4EQNA 2RDGA 2QKIC 1KABA 4WORA 4IQZA 3K58A 2HQEA 2JSOA 1C48A 4FXKC 5EGTA 4IUVA 2HDLA 3BVZA 4R8IA 2PZUA 2HUGA 3H0GB 3N52A 4F88A 4ZUIA 3BDCA 5CV4A 1ML0D 4BY1B 4HCEA 1S5ED 5IT9L 1EL0A 4NDXA 2JA7B 1EYCA 2NVTB 1TY2A 4FF3A 2QEJC 1XYIA 4QMGA 3S1QB 1SYBA 1EEFD 1YNND 3GQBA 4C3HB 1I4GA 1ENCA 1HA6A 2K04A 3OWFA 1PTOD 2NWGA 5CV7A 2SEBD 4H0LC 3HS0C 3U9OA 1H9KA 3H3VC 3NTIA 1PZID 1DJRD 2QCPX 2L12A 1ET6A 5E4WC 1IKLA 5JEAG 4IUNA 2DN8A 2D2CC 3BDLA 2KCNA 1EZ6A 3HEJA 4OIJA 2K28A 1ZKOA 1JCKB 1FR3A 2IJ0A 2SNMA 3NPPA 5DNFA 3K0YA 2PNRC 3E0JA 4C3IG 1PTOB 1QB5D 1PYWD 4DK1A 5CV8A 2JYOA 1EWCA 1JICA 2VNUD 3TP7A 2RSNA 2O2LD 5DM73 1HXYD 4BS9A 4HN7A 1GOZA 1B2TA 3QG1A 3J80L 2IT1A 1J9OA 5FK9C 1EQVA 1HHVA 1LLRD 2C5CA 3PO2B 5IGEA 1E2WA 1EY8A 3G7LA 4A3JB 3JAML 2B2WA 3ND9A 2KECA 3E5SA 2NN6I 1M4VA 5DEHA 2E74C 1BBXC 4FXDA 5IIFA 2VB2X 4RGOS 3TDQA 4BBSB 1QCBD 1JORA 1KDAA 2XRQD 3CQZB 4L8JA 5I6WA 1ET9A 2B2UC 1STGA 4CKCA 3HOZB 4OO1I 2E2JB 3I73A 4BY7B 3GD7A 5CYUA 3K5OA 1RTNA 5IGCA 1STNA 2KEDA 4IUUA 5A2QL 3FPUB 2NB0A 5J22A 2BE5D 3BVMA 3W2DA 3EVQA 1BOSA 5M9OA 2ICEC 2EYJA 2EVBA 4F87A 1CA5A 5C3WA 1IL8A 3T4AC 1CZGA 3S14B 3SK5A 4KKSA 1U4PA 1LTBD 5C0XH 1Y1WB 1H9JA 3DXJC 5FO8B 4DXFA 3ONAB 2E2HB 3R2TA 2XIWA 4GZYC 1I4QA 5FOBB 4A93B 1PRTC 3TMEA 3BYTB 1EIGA 3RZOB 2X6LA 1EY5A 2TMPA 4DN4M 3EFXD 3MXGA 1I3QB 3MXPA 2K7VA 3KLSA 1O7ZA 2RDHA 2F0DA 1WTPA 4EQPA 2F0TA 3D4RA 2QILA 1GHJA 3T16A 1JWMD 1OXXK 4RHRA 1B9NA 2F0WA 3PUXA 2F0FA 4PNYA 2L9HA 4K8JA 2IWHA 2J7ZA 3SE0A 3TSSA 3OSOA 2K32A 1TS5A 3OWEB 3RD4A 1JOKA 1DXMA 2ENBA 4R8NA 1GUOA 5I4DA 2EYFA 4KMUC 4CGYB 4N9TA 3R2IA 5T1GA 1EYDA 3P20A 5FO9B 3EA6A 3J7YW 3MFYA 5JVG3 2BDNA 5D14A 1WTVA 1B9MA 4CJ1B 1FD7D 4B9XA 3MZ5A 4V190 3SK4A 3HOVB 3SHLA 5LL6X 1IHZA 1Y8OB 2Q8TA 1WD1A 3LNNA 1SYDA 1V43A 4IALA 1BCPD 1O80A 1SEBD 3J80E 2X69A 4X3TA 4O1NA 4EVOA 3NQIA 2K5DA 3I90A 1BCPB 2IW3A 2D9UA 1BXTA 4L6TB 4HEDA 1JOQA 1F2ZA 1EYAA 1SNCA 2WACA 4ULLA 3J7AV 2LY7A 1BQQT 1TIID 3MXUA 4ZRZA 1MBYA 5I9PA 5I2XA 1EY4A 1VF7A 1DONA 1ESFA 2EJGC 4ABNA 2M2LA 1CA6A 3QIAA 2KOLA 4HSPA 2NBFA 4MIUA 2SDFA 3KBGA 2B2VA 2MUYA 3BG3A 4A3BB 1BCPC 1ONLA 1AP0A 3DEOA 1LTAD 1F2YA 2EYHA 5M5YB 4FF2A 4RKLA 5JAVA 2OT2A 3BYYB 1STBA 4NW2A 2F0LA 4BBRB 1MD2D 5J1ZA 2EYLA 1QOHA 5C4HA 2RA4A 3AMUA 1SYCA 2RBMA 4FF4A 3C1EA 3I8ZA 3IAYA 5FLXL 1Q1BA 1GUSA 1SMYD 5EJWA 2KUMA 3R8BA 1H9SA 1PMRA 4IURA 1PZJD 1WTXA 1RD9D 3NUCA 4FF1A 4XDXA 1HPCA 1UUPA 2EJFC 1WTWA 3WOEA 4OHJA 1B50A 4F7XA 4DF7A 1TKWB 3EQLC 4PV1C 1RTOA 4XYQA 5J39A 3PUVA 4QF4A 2YU9B 1OXUA 1TWAB 2A6HD 1F9SA 4KHVA 5ELDA 4A3IB 2KA7A 3M7NA 1IW7C 2K5QA 3SK6A 3WOFA 1U4MA 1TU2B 2N55A 3ITPA 5KNBA 1X32A 3RUZA 1OXVA 4J1MA 1HQMC 2RSOA 1D5MC 3OIPA 4B08A 2DNEA 5EPJA 1Z6HA 4KV6A 3QWNA 3V96A 3DWQA 1WTOA 2K05A 5KGUA 4RCOA 3CU7A 1B1ZA 1FNWA 4FVMA 5IGBA 5IGGA 2B2YC 3EROA 4J8QA 1TR5A 3M4YA 2F3VA 4Y7NB 4IFDJ 2F0UA 1KDCA 3E6ZX 1TWFB 1PDQA 1B44D 4RFBA 5K36G 3I91A 1A3VA 2PW5A 1QG7A 3PO3B 2XVSA 3U9SA 2K01A 1AW7A 1GJXA 2Y0SB 1A2TA 5FKAC 5C4JB 3NWTA 4XT1B 1A3TA 3MHBA 4XT3B 1UAPA 4K2LA 4BA1I 2IX3A 1E0BA 1PTOH 5EKIA 2PW7A 1QWYA 4XQQA 2EE1A 5BN5A 2A74C 4PMBA 2OF1A 2MHVA 1DOLA 1LO5D 1EY6A 1BNZA 2NZ1D 3K6OA 3M4OB 3NBIA 4HMJA 1B4OA 4ID6A 1G2TA 3VA7A 1HFNA 3Q6SA 2EPBA 2FINB 2RDFA 3W3AA 5JPMC 2B2VC 3M85A 5AFWA 4C1NI 3D4WA 3L3OC 1FNVA 1A6XA 1HTLD 3S2DB 3DM1A 3SXHA 1OXTA 4IUPA 4P2CB 3K5MA 1BR9A 4Q5VA 1CM9A 1PRTF 3K57A 5HGTA 1U9RA 4EGVA 1PLFA 3GO5A 1I4RA 1JE4A 5EBCA 3G6JB 3T51B 1CZWA 3KBXA 4NP5A 5EKKA 2JP1A 1SXTA 2R61A 1SE4A 1STEA 1D2BA 3DUZA 1SBBB 4C3JB 4CKBA 2EY5A 2EYMA 1F9QA 3TP8A 4ODGA 1LTRD 4OO1G 1Q12A 3J81L 3LWEA 1GUWA 1EEID 5G3LF 2CQAA 4K6DA 3RMHA 2EY1A 1IYUA 2JA5B 2EY2A 4PMWA 3UI2A 5CBAE 4KD3A 4R9WA 2L11A 3L7ZC 2ICIA 4HSVA 1JQYD 4KHZA 3WDNA 2H1EA 1Z47A 1EU3A 2AUJD 3C2PA 1TY0A 2AQ2B 1EY0A 5I9OA 1F9PA 1D1KA 2ZXPA 3HOWB 2VUMB 1CQFA 5CV5A 4DFAA 2O5IC 4CBVA 3GTLB 2I07B 2JA6B 5I6YA 4G57A 5A2QE 1JWSD 5LL6S 2KJXA 1K83B 5CBEE 2HCIA 1BO0A 2F0IA 3DHQA 2F0GA 5KYIA 1F77A 3I72A 3LWUA 5FLXE 3VR2A 3CRKC 4S3SA 3TZDA 3DEPA 1QE6A 4NMZA 4LK1C 3GTOB 1CFMA 1NSNS 3NK9A 1PTOF 4RHSA 3OPOA 4KN4C 3K59A 5BN4A 2Z1CA 2CHBD 4UDUC 1HCZA 4KTAA 3ZYYX 1RDPD 1F2MA 2EOTA 1JR0D 2FJ2A 5ELBA 2AQ1B 3A8JE 2PO4A 2WKDA 3A54A 1R4QB 1H9MA 3GP7A 4C2MB 2F0JA 3M7GA 1H9SB 4KK7A 5COYA 4KD4A 3VR4A 2R7ZB 1QNUA 5D65A 4RGNA 5CMDA 3Q23A 5G3LD 3A8IE 4C3IB 5IODA 3GTKB 3V2TA 2F0PA 4CJ0B 4G7OC 1IKMA 1LTTD 2FFKB 1RJTA 1RHPA 4TRDA 1O7YA 1SYGA 2EJMA 4IFDG 1CHPD 1D5ZC 3VA5A 1WD0A 2B39A 4DAPA 1SAPA 1LACA 3MTSA 5I2YA 3SEBA 1CHQD 3BS1A 3PIP3 1AZPA 2F0MA 1Q1EA 3IL8A 1DOKA 4RKBA 3J7AF 4DAYA 3P1HA 2A69C 2B2TA 4WRDA 1MI2A 4C3HG 3FMCA 3DWPA 4FP5D 5C5MA 2F0HA 4TQUS 2EY6A 5CV6A 4Z9CB 2MGSA 3IFDA 5C0XJ 1ESRA 3GV3A 2IX0A 5ELEA 4DU9A 1J8IA 3MA2B 2HCCA 1KLUD 4IN3A 3J81E 3DWAA 2IL8A 1SJHD 2NN6H 3P7JA 1ICWA 2NYZD 3MWYW 1S4ZA 1R9TB 1X3QA 2JEAI 1LV9A 2NTSA 2ZXRA 2SOBA 2CW0D 5E1FA 2RQXA 5KNDA 2O5JC 1VCIA 3BVGA 1ILPA 2MPMA 3D4DA 3QJYA 3URYA 3GTMB 2EXZA 2I46A 2FMMA 1PFMA 4KY6A 3I70A 1BUVT 1DM0B 4QB4A 2F3WA 5K5PA 1PTOC 2H4OA 2K03A 3TZUA 1STHA 1PXUA 5IOCA 1HA5A 5JOBA 4AYBB 1SE2A 5JEAJ 1II3A 2QF7A 3AB9A 1XTCD 3K7AB 3BZDB 4N9PA 2PMZB 2WKCA 2F0VA 3NTHA 4J6HA 3SK8A 2E76C 4KKUA 2YYZA 1R4PB 4L63B 3MEHA 3HGBA 3HOXB 1C8CA 4EQOA 2NVYB 2CVRA 4PQXA 4DK0A 4ME5A 2XRSD 1S5BD 2F0NA 1U4RA 5KYLA 1SNQA 1AFPA 2BDOA 2K33A 3F2UA 4QUFA 3R3OA 2A6HC 1XX8A 4XXEA 2KCCA 1WTRA 1A2UA 1STYA 5M5WB 3KLRA 1GXDC 2ZXOA 2IX1A 4V0BA 1Y8PB 1V1PB 3P75A 5NUCA 3FRPB 3SDZA 1D5XC 3BDOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H1E A;  4UAI A;  1LV9 A;  4MN3 A;  1B4O A;  3I90 A;  5JJZ A;  1F9S A;  1EIG A;  2VXW A;  1G2T A;  4IUQ A;  2D9U A;  2Q8R E;  1EL0 A;  1HFN A;  4RWS C;  3Q6S A;  4HED A;  5D65 A;  2EPB A;  2FIN B;  1QNK A;  3D6W A;  5CMD A;  1ILP A;  2MPM A;  2B2V C;  3G7L A;  1AZQ A;  1XYI A;  2X6L A;  1F9P A;  2DY8 A;  5AFW A;  5EPK A;  2B2W A;  4LMQ D;  4DN4 M;  3SVM A;  1U4M A;  1SDF A;  1F9R A;  1U4L A;  2N55 A;  2KEC A;  4ZAI A;  4OIK A;  1X32 A;  2FMM A;  4CJ0 B;  1NCV A;  4HCS A;  1PFM A;  1HA6 A;  2K04 A;  1X3P A;  1VMP A;  1VMC A;  3DM1 A;  1ROD A;  1BBX C;  1DON A;  4U68 A;  2NWG A;  5E4X A;  1BF4 A;  1O7Z A;  4IUP A;  5T1I A;  2RSO A;  1IKM A;  2M2L A;  1HRJ A;  4X3T A;  1CA6 A;  4CJ2 C;  5EPJ A;  1WTP A;  1WTO A;  1G2S A;  1EOT A;  1NAP A;  2L1B A;  1DZ1 A;  2DY7 A;  1B53 A;  1RJT A;  2FFK B;  2KOL A;  2B2W C;  1RHP A;  1MGS A;  2K03 A;  1MSG A;  1O7Y A;  2SDF A;  2K05 A;  2B2V A;  1CM9 A;  1A15 A;  1HUM A;  4RA8 A;  5CBE E;  1AP0 A;  3DEO A;  3H91 A;  2HCI A;  2B2Y A;  2B2U C;  4MHE A;  1BO0 A;  1PLF A;  4HAE A;  1WD0 A;  1G6Z A;  4QUC A;  2L12 A;  2HDM A;  1SAP A;  4ZK9 B;  2B2U A;  1M8A A;  2KEE A;  2B2Y C;  3MTS A;  4X3U A;  1RTN A;  1JE4 A;  3TN2 A;  5E4W C;  2L9H A;  4NW2 A;  1IKL A;  3GV6 A;  1WTV A;  1DOM A;  3TZD A;  2J7Z A;  1NR4 A;  2KED A;  3DEP A;  4O42 A;  4IUU A;  5EPL A;  4ZKB B;  1AZP A;  1B3A A;  3QO2 A;  5EQ0 A;  2KVM A;  3KBX A;  1QE6 A;  2RA4 A;  3FPU B;  3IL8 A;  5COR A;  2JP1 A;  4OIJ A;  2K28 A;  1DOK A;  1PDQ A;  1NR2 A;  1C8C A;  1Q3L A;  1SSO A;  3I91 A;  5DNF A;  2N88 A;  2B2T A;  2CVR A;  1MI2 A;  3I8Z A;  3HP3 A;  1QG7 A;  4IUT A;  1U4R A;  1ILQ A;  2K01 A;  3I3C A;  1F9Q A;  4X3S A;  5EJW A;  2KUM A;  3F2U A;  3FDT A;  2MGS A;  2MJ8 A;  4QUF A;  1WVL A;  1CA5 A;  4IUR A;  3IFD A;  1HHV A;  1WTX A;  1KNE A;  5T1G A;  1HFG A;  1IL8 A;  1JIC A;  1XX8 A;  2JYO A;  4XT1 B;  3R93 A;  4XT3 B;  4XDX A;  1ESR A;  1ZXT A;  3GV3 A;  2RSN A;  1PFN A;  3LWE A;  1GUW A;  1J8I A;  4ZKC B;  2L4N A;  2EOT A;  2FJ2 A;  2BDN A;  5D14 A;  1U4P A;  1MSH A;  1E0B A;  2B2T C;  1KNA A;  1F2L A;  2HCC A;  2MP1 A;  5EKI A;  4CJ1 B;  1WTW A;  4IUV A;  1WTR A;  2HDL A;  3KUP A;  2EE1 A;  4R8I A;  4ZLT F;  2HUG A;  4X3K A;  3ONA B;  1B2T A;  2IL8 A;  1EQT A;  1B50 A;  2FHT A;  3P7J A;  1ICW A;  4RAU C;  1WD1 A;  2NYZ D;  3N52 A;  2Q8T A;  3UI2 A;  5CBA E;  1PFB A;  1DOL A;  2XIW A;  3MWY W;  1WTQ A;  4R9W A;  1EIH A;  1BNZ A;  1RTO A;  2L11 A;  2NZ1 D;  1J9O A;  1S4Z A;  1ML0 D;  2R3Z A;  2RVL A;  2X6G A;  4HSV A;  1G91 A;  1X3Q A;  1TVX A;  1O80 A;  1HUN A;  5COY A;  2X69 A;  2K1B A; 
#chains in the Genus database with same CATH topology
 3PCO B;  5FO7 B;  1PH5 A;  5C4X G;  3A74 A;  5JJZ A;  5K36 H;  2Z8L A;  2VXW A;  4KKT A;  2PQE A;  3NXW A;  2NUC A;  3TRZ A;  1I4P A;  3PV0 A;  4A3J G;  1PFS A;  1AZQ A;  2K5W A;  4PZ6 A;  2E5L Q;  1LUZ A;  3A5U A;  1XJV A;  4BY1 G;  2NTT A;  1SDF A;  2ZTC A;  1U4L A;  4NKL A;  3TBI B;  2WAQ B;  1K0S A;  1Y1V B;  2KHS A;  3Q24 A;  3BJU A;  4TSS A;  4B3M L;  1VMC A;  2XWJ B;  3F1Z A;  3S24 A;  4O2D A;  5AJ3 Q;  3HOX G;  3HOY H;  4GKK L;  3PSI A;  4AH6 A;  3BZC A;  4NXM Q;  1G2S A;  4PMC A;  2EIF A;  4CKE A;  1Q90 A;  3N6R A;  1A15 A;  1FNU A;  3NBH A;  3H91 A;  2BOS A;  2F0O A;  1TQO A;  3C3L A;  4WFN 3;  2Z4H A;  4K5V A;  2JA7 H;  5ELC A;  1I6H B;  1KLG D;  1W6K A;  4YY3 Q;  3GV6 A;  1JJ2 A;  1NR4 A;  4A3D B;  1Y8N B;  2V1C C;  1H95 A;  3PO3 G;  1VQ4 A;  4DR6 L;  1LTG D;  1ENF A;  4B3M Q;  1LTI D;  3FEW X;  1ICF B;  1T5E A;  4HIO A;  1WVL A;  1YHA A;  2WP8 J;  2B29 A;  3AFP A;  2CW0 C;  3FP9 A;  2WAQ E;  4A3M G;  3ERQ A;  1XWE A;  3HFZ B;  4A3I H;  4H13 C;  3I4O A;  3OMC A;  1XMQ L;  4LUV A;  1X3F A;  4HR7 B;  2VQF L;  1HNW Q;  3CCJ A;  1JB3 A;  2R7D A;  2F4V L;  3OIQ A;  1D6E C;  5IGD A;  4Y52 H;  2TSS A;  4E6I A;  5DAU A;  4CHT B;  5BN3 A;  1EIH A;  1LTS D;  2E2I H;  1YEZ A;  3EJI A;  2WB1 B;  1HUN A;  4DV4 Q;  4DV5 L;  1V1P A;  4M1U B;  4R4C A;  5C6A A;  4K14 A;  3D8G A;  1C0A A;  4H44 C;  1B7Y B;  3L9A X;  4A3K H;  1EFW A;  2VB3 X;  1CK1 A;  5JPN C;  4BY7 G;  2ZM6 Q;  4YWL A;  1JJG A;  2Q8R E;  1TWG B;  1E24 A;  1PRT D;  4ILW A;  3K5L A;  3HOU G;  3CD6 A;  2WFW A;  1VQI A;  2CWP A;  3GTP H;  4DV0 Q;  2F0E A;  4LMQ D;  1GHK A;  3DM3 A;  1KTK A;  1DGS A;  4F8M A;  2R7F A;  5HY6 A;  1CKO A;  4X62 Q;  1NCV A;  3LX0 A;  1YJW A;  4IJL A;  3OOC A;  5E4X A;  2R6G A;  1VQJ A;  3S1N B;  5C3E B;  1WFQ A;  4JOI A;  2G9H D;  1TS3 A;  1NAP A;  1T5X D;  1K9M C;  1B53 A;  3U4Z A;  3GTJ B;  2BA1 A;  3NWS A;  1TWH B;  3J80 c;  3A8K E;  3K5N A;  2F0K A;  1NUC A;  1EQQ A;  5KEE A;  2KEE A;  3JAM i;  5IYC H;  2NVQ H;  2RCN A;  1LT6 D;  3M4Q A;  1TS4 A;  3HKZ G;  1C4Q A;  2Z6K C;  3O13 A;  5EBD A;  4XTC S;  5EQ0 A;  3TS0 A;  4IPC A;  3RLF A;  2Q2T A;  1EQR A;  4IJH A;  3H3V I;  1BCP F;  1Q3L A;  2DUD A;  4K8I A;  1SSO A;  3UDG A;  1O7I A;  1D1I A;  5LHY 1;  2F4I A;  4OGQ C;  3M3Y H;  2E2H H;  4A3D G;  4JI3 L;  5KNC A;  1DCZ A;  5JJK A;  2PQA A;  3NEM A;  3NBH B;  4ZUJ A;  4CDC C;  5M3M G;  3B6Y A;  3AQQ A;  1L0W A;  4GLV B;  1XNR L;  3GTG B;  1V8Q A;  4JBK A;  3GTK H;  2NN6 G;  2F0Q A;  1MSH A;  3KK7 A;  1GD7 A;  4DR3 L;  1S5D D;  3KUP A;  4X3K A;  5TSS A;  5IYB H;  2UXC L;  3ZJY C;  4RAU C;  1LM0 A;  4G7H C;  1YVC A;  2OEO A;  1SFO B;  2R92 G;  2XN9 C;  1VQ5 A;  2NZO A;  3I4N G;  3A7A B;  4UHV A;  4DXG A;  3W5O A;  1KXL A;  4UAI A;  4GOP A;  2E75 C;  4RGT A;  4GNX B;  4IPH A;  3K81 C;  2L55 A;  3NQT A;  4A3I G;  2A5H A;  1G29 1;  3KYH C;  5LMN Q;  3I4L A;  1CUK A;  3PIP A;  3VYS A;  2JA8 B;  2E2J H;  1YNN C;  3S17 H;  4R4Q A;  1F9R A;  1EU4 A;  4ZAI A;  2RKS A;  2AQ3 B;  1NNX A;  2V4D A;  3T13 A;  4IFD H;  4LW1 A;  4J15 A;  5HUR A;  3UDF A;  1PH9 A;  4I7Z C;  1SYF A;  2HHH L;  3W1G A;  3PF4 A;  4DR6 Q;  2RHS B;  3HRZ C;  4XQJ A;  4CJ2 C;  1ZYR C;  4YIJ A;  3H15 A;  4A3K B;  2DY7 A;  4A3M B;  2B2W C;  2ID0 A;  3M3Y B;  2ZJQ A;  1W6J A;  2C9O A;  2LMC B;  4RA8 A;  1DYQ A;  3GTO H;  3KDF A;  1UE6 A;  4HAE A;  3RNU A;  4L5Q A;  3FPP A;  1HTP A;  4ZCK A;  1W3S A;  1N33 L;  2IHE A;  3S17 B;  2XNA C;  4HJ8 A;  1VQF A;  4KY5 A;  1I4X A;  3D31 A;  3J81 c;  3FVQ A;  1HJP A;  2WB1 G;  4N8F A;  1AEX A;  4AQY Q;  3QO2 A;  1LT5 D;  3ND8 A;  4OX9 Q;  5C44 G;  3M4O H;  3H0G H;  2QW7 A;  1VF5 C;  3T56 B;  2UUB Q;  1CTM A;  3JAM c;  3AU7 A;  3VYT A;  1JWU D;  3S1M B;  1TT2 A;  4A3F B;  4K5X A;  4LUZ A;  3ULL A;  2D5D A;  1JOO A;  1EWH A;  4C1N K;  4G7Z C;  1ILQ A;  3EIV A;  5F2D A;  4K6L A;  4X3S A;  4K0K L;  5JVH 3;  4KJO A;  2PZW A;  2MJ8 A;  2Q8I B;  4FO2 A;  3CXC A;  4UPA A;  4A3G B;  1RKN A;  1TXY A;  2BA0 A;  5GQO A;  2L4N A;  1BVS A;  4JI8 L;  3S9W A;  1F2L A;  2R93 H;  2RF4 A;  5CR3 A;  4ZLT F;  5KRU A;  5CC4 A;  1PRT B;  3MC0 B;  1IBL Q;  4QIW E;  4JYA Q;  4C56 C;  4XQN A;  4KI0 A;  5C44 B;  3M9B A;  2AKW B;  1WTQ A;  2OWO A;  2GVA A;  4KY7 A;  2B63 B;  4DR2 L;  4QCL A;  4QIW B;  3I4M G;  2YTV A;  4JBW A;  2NZH A;  1YNJ C;  4XYO A;  4RWS C;  2G9D A;  4A3L H;  3TRE A;  1QIL A;  3GDE A;  3KOJ A;  3AYH B;  4NB3 A;  2DNC A;  1XXG A;  5C4X B;  5EPK A;  2M9V A;  3NTK A;  2L0C A;  1X6O A;  1VQN A;  3QOL A;  5IYD G;  2R93 B;  4FXG C;  4LAA A;  1CQV A;  3EN2 A;  1GUG A;  1SNM A;  4JC0 A;  4C3J H;  5LMU Q;  3K0X A;  5C4Z A;  4U68 A;  3TP6 A;  1BF4 A;  2NVQ B;  4GLA C;  3OHX C;  3NP8 A;  3F8T A;  1HRJ A;  3FKI B;  1IYV A;  2JQO A;  3VR5 A;  1YJ9 A;  2JA6 H;  5JJI A;  3PIO A;  1SE3 A;  1O7L A;  2A69 D;  4IZ8 A;  1X54 A;  2B2Y A;  4MHE A;  2F1M A;  4FYD A;  3PMF A;  4UP9 A;  2I5H A;  3HOZ G;  1KAA A;  2XSC A;  4OL7 A;  4X3U A;  4LF6 L;  1YNJ D;  3TN2 A;  1I4H A;  4POG A;  1EUJ A;  3I4N B;  5FJ8 H;  4JK1 C;  4ZQ3 A;  4ZKB B;  1MJE A;  3GTL H;  4DUZ Q;  2R92 B;  3TP5 A;  3HG9 A;  3S16 B;  4BBR H;  3HOY B;  1E2Z A;  4JOI C;  2B63 H;  1C9O A;  2AWN A;  4FNF A;  2KHI A;  1PYB A;  4DGZ A;  5E3F A;  3MAQ A;  3MXN A;  2KQ3 A;  1XPU A;  1DD2 A;  3QB3 A;  5ISR A;  3NE5 B;  2N49 A;  3I3C A;  1OXS C;  1Y69 U;  2ZT9 C;  1AE3 A;  3FDT A;  3T1H L;  2EYP A;  5CGK A;  4Y7N H;  4B9W A;  2JN4 A;  1UEB A;  2Q2H A;  1E2V A;  1PZK D;  3OTO L;  2B8G A;  1E22 A;  1K28 A;  3CRL C;  4A3B G;  3NHH A;  2FHT A;  2AHO B;  2DJG C;  4B3T L;  3CKI B;  2RVL A;  3PUW A;  2R3Z A;  4A3C H;  2D0O A;  2LFN A;  1G91 A;  1TVX A;  3HKZ B;  4HMI A;  4RH6 A;  3MEF A;  2JE6 I;  4A3E B;  3RR5 A;  4MN3 A;  3H09 A;  2GA4 B;  1ZYR D;  3C1F A;  1SJE D;  5EKL A;  4POF A;  4LFC L;  1YNX A;  3IFT A;  3V05 A;  5M5X B;  3S2H H;  3S1Q H;  2CFM A;  3D3R A;  5AJ3 L;  4TKO B;  1Q8I A;  1TS2 A;  2RCF A;  3I2Z A;  4OIK A;  1VMP A;  2QDB A;  4K2K A;  4DR4 L;  5C5L A;  3Q0A A;  4LF7 L;  3RZO H;  4HIM A;  1ENA A;  3K80 C;  4BY7 H;  1K8O A;  5IGF A;  1EOT A;  1HH2 P;  2PPB C;  4TVA B;  1XPR A;  1MSG A;  4YY3 L;  3S1R B;  1I50 H;  1HNX Q;  1HUM A;  3GTM H;  3ULJ A;  2QDL A;  1YHQ A;  4HTH A;  4K0K Q;  4IFD I;  3RZD B;  1A0I A;  1GUT A;  1PYS B;  1SND A;  2A73 B;  4RCN A;  3NSW A;  3CP0 A;  4L5S A;  3T53 B;  2JEB I;  1DOM A;  4A4I A;  1K8A C;  2OXP A;  1Q46 A;  1HQR D;  5EPL A;  2KVM A;  2E2I B;  4PG3 A;  4U67 3;  5C3E G;  2GN5 A;  1MHW C;  1SE8 A;  4DNR B;  1NR2 A;  2JA6 G;  3I4M H;  1JT8 A;  4OEM B;  1LT4 D;  4DNT B;  3VYU A;  2D62 A;  3HP3 A;  1VDZ A;  2WB1 E;  3Q22 A;  1SNP A;  4KJN A;  4IUT A;  1BDO A;  5C0X G;  4JI6 Q;  3VYR A;  2K6A A;  4DV3 Q;  1TWC H;  4HJA A;  4DR1 Q;  1N32 L;  2WV6 D;  3HOU B;  5GAH C;  1ZXT A;  2F0S A;  1S5F D;  1KRT A;  1PFN A;  3K7A H;  5DM6 3;  4ZKC B;  2UXC Q;  3PUZ A;  4YWM A;  1STA A;  5BR8 L;  1AH9 A;  1JE5 A;  1KNA A;  3MVV A;  1V1O A;  1GUN A;  1WOC A;  1WCM H;  2J0T D;  2E2D C;  1LT3 D;  1SNO A;  1ZEQ X;  3OW7 A;  5D3D A;  4DV0 L;  5IT9 E;  2K1B A;  1Y14 B;  3VR3 A;  1XNQ Q;  2EYO A;  1IYJ B;  4IUQ A;  4DV6 L;  1G8Z D;  2AUK A;  1EFI D;  1QNK A;  3D6W A;  3RZD H;  1B70 B;  4BXX H;  1H9R A;  2DY8 A;  2JXM B;  1CSQ A;  3SVM A;  4CDF C;  2Q2I A;  1AE2 A;  3KJP A;  2FMC A;  3X3M A;  1QZG A;  3CHB D;  4DV3 L;  3PIO 3;  3I4M B;  1RF2 D;  1A3U A;  2PI2 E;  4I65 A;  3J81 i;  1PA6 A;  4WJ3 M;  1ROD A;  4DA2 A;  4X64 L;  3HZX A;  1NJI C;  1UEA B;  2HIX A;  5T1I A;  1IZ6 A;  2OQK A;  1PH7 A;  5IP7 H;  2Z4I A;  1EY7 A;  4MNO A;  2A6E C;  2L1B A;  2KCT A;  4ALP A;  2A68 C;  4BBR G;  1TWC B;  4GKK Q;  4LFB L;  2K5V A;  1SMY C;  1LTL A;  1OO9 B;  4BWG B;  2BE5 C;  5ELN A;  4DR7 Q;  2F03 A;  2K5H A;  2SNS A;  2HDM A;  4ZK9 B;  4HIK A;  1X3G A;  1M8A A;  1Q8K A;  3X3N A;  3KF8 A;  2AWO A;  2A68 D;  4A3E G;  1D7Q A;  3H6M A;  1CI3 M;  1M1K C;  3DLL A;  1B3A A;  1S5C D;  1SYE A;  2LKV A;  1EY9 A;  1BBW A;  5LMN W;  4BA2 I;  1HZ9 A;  1SRO A;  1VQK A;  5CV9 A;  2LSS A;  1WCM B;  2N8N A;  4RGM A;  1S72 A;  3H94 A;  3S15 B;  4GN5 A;  3HOV H;  1I50 B;  4K5W A;  1GKH A;  1HZA A;  1IXR A;  3IKJ A;  3QOJ A;  3D0F A;  1IW7 D;  3OMG A;  3ERS X;  3K8A A;  2A6E D;  1VQG A;  1KNE A;  1HFG A;  3R93 A;  1VQB A;  4LJZ C;  3CCQ A;  4A3G H;  3I4N H;  2FXQ A;  2B2T C;  2MP1 A;  3PUY A;  3M4P A;  1L0X B;  1B3Q A;  3KLS X;  1EQT A;  3HOX H;  1L0Y B;  4DR2 Q;  1PFB A;  3KDF B;  3S2H B;  3VR6 A;  1FYC A;  2X6G A;  1IL2 A;  3A56 A;  4WJW A;  1KD1 C;  2VUM G;  4L5R C;  1RCV D;  5A35 A;  2PZT A;  2OQ0 A;  5KIX A;  2IPK D;  1FGB D;  3A7L A;  4JW0 A;  5IYB G;  2EDG A;  3MFG A;  4DUY Q;  5JEA H;  4AYB E;  1WI5 A;  4OXP A;  2NVX B;  5M3F B;  2PCF B;  5C3X A;  1R9T H;  4DV7 Q;  4KN7 C;  2M00 A;  2Y0S G;  1OTC A;  3E9H A;  2WII B;  1O78 A;  1LAB A;  2EZV A;  2NVY H;  3D6C A;  4LF9 L;  4A3B H;  1SR3 A;  4HCS A;  1X3P A;  4OO1 H;  2R7Z H;  2BCO A;  3A55 A;  2B8F A;  1IBK Q;  3C46 A;  4X6A H;  3UE0 A;  4RMF A;  3SR1 A;  3F2B A;  2J4X A;  1DZ1 A;  2MO0 A;  2L5T A;  4DV2 L;  4A76 A;  1MGS A;  1Z7T A;  4DAV A;  3JAM E;  4EX5 A;  2UXB L;  3VDY A;  1EZ8 A;  3GTQ B;  2F52 A;  3HKZ E;  3DMU A;  1V9P A;  1S3O A;  4LF6 Q;  4C3I H;  2E5L L;  4H7B A;  3GTP B;  1G6Z A;  4QUC A;  1G6P A;  5IP9 H;  1AN8 A;  2B2U A;  4DAY B;  5M3M B;  4ZYS A;  5D3I B;  2PYK A;  1CT1 D;  4C3J G;  1JC7 A;  3U4V A;  4XIG S;  4YCU A;  2ZTE A;  4O42 A;  2O4X A;  1UNS A;  2OTJ A;  5COR A;  1FL0 A;  5IP7 G;  2XWB B;  4Q0F A;  1HNZ L;  1BKB A;  4M8A A;  3U50 C;  1PH1 A;  2N88 A;  5ELF A;  5C0X I;  1QJO A;  4IPD A;  1K8M A;  4B3R Q;  1KDB A;  3CCV A;  4G4K A;  3GTJ H;  2LS0 1;  1I6V C;  2WIN B;  3CPW A;  2RDG A;  4EQN A;  3A5Z B;  2QKI C;  5IY0 A;  2Z0S A;  1E3P A;  3UE1 A;  1KAB A;  4WOR A;  3OYY A;  4DPG A;  1CKM A;  1WYD A;  4IQZ A;  4JI5 L;  3K58 A;  2HQE A;  2JSO A;  4PZ8 A;  1CKN B;  3H3V H;  2L15 A;  1C48 A;  3QR8 A;  4FXK C;  5EGT A;  4IUV A;  2HDL A;  3BVZ A;  4R8I A;  2PZU A;  2HUG A;  3H0G B;  3N52 A;  1J6Q A;  4F88 A;  2WAQ G;  4GKJ L;  4ZUI A;  3BDC A;  5CV4 A;  1VQA A;  4R4O A;  1ML0 D;  2UUC L;  4BY1 B;  4LWC A;  4HCE A;  2HIV A;  4OWT B;  4BBS H;  3KF6 B;  1HZB A;  3CME A;  1S5E D;  4A3M H;  5C4J H;  3CAM A;  5IT9 L;  2YTY A;  4JI2 L;  1EL0 A;  4NDX A;  2I5M X;  1PH8 A;  2JA7 B;  1EYC A;  2NVT B;  1TY2 A;  4FF3 A;  2QEJ C;  3RLO A;  1XYI A;  4QMG A;  5EAY A;  4X66 Q;  3S1Q B;  1SYB A;  1EEF D;  1YNN D;  3GQB A;  3WWV A;  1V1Q A;  4C3H B;  1I4G A;  2YV5 A;  1ENC A;  1HA6 A;  2K04 A;  2MO1 A;  3OWF A;  1PTO D;  2NWG A;  2JJQ A;  5CV7 A;  1J5E Q;  2SEB D;  1PH2 A;  4H0L C;  3HS0 C;  3U9O A;  1H9K A;  3H3V C;  3NTI A;  4JV5 Q;  5E7N A;  1PZI D;  2C35 B;  1DJR D;  2QCP X;  2L12 A;  1ET6 A;  1YIJ A;  4X65 L;  3NEL A;  5E4W C;  1IKL A;  5JEA G;  4IUN A;  1U0L A;  4DR5 Q;  2DN8 A;  2D2C C;  4JI1 Q;  3AEV A;  3BDL A;  2KCN A;  1EZ6 A;  3HEJ A;  1WJJ A;  4OIJ A;  2K28 A;  2UXD L;  4L5T A;  1ZKO A;  1KIX A;  1JCK B;  1FR3 A;  1K0R A;  2IJ0 A;  2SNM A;  3NPP A;  5DNF A;  3K0Y A;  2PNR C;  4OX9 L;  5M5W H;  3E0J A;  4C3I G;  4DR1 L;  1N32 Q;  1EWI A;  1PTO B;  2NVT H;  1MJC A;  2UUB L;  1QB5 D;  1VQC A;  1PYW D;  4GNX A;  4DUY L;  1JB7 A;  3K7U C;  4DK1 A;  5CV8 A;  1Q82 C;  2JYO A;  1EWC A;  1JIC A;  2VNU D;  3TP7 A;  4I7A A;  4MTK A;  2RSN A;  4QGU A;  2O2L D;  2R7Z G;  5DM7 3;  1HXY D;  4BS9 A;  4HN7 A;  1QVF A;  4B3S Q;  1GOZ A;  4C2M H;  1B2T A;  1A63 A;  3QG1 A;  4UP8 A;  3SGI A;  3J80 L;  2NVX H;  2IT1 A;  2Z6B A;  1J9O A;  5FK9 C;  1EQV A;  1TWH H;  4DR5 L;  1HHV A;  4DNI A;  4GOP B;  1LLR D;  2C5C A;  3PO2 B;  2UXB Q;  5IGE A;  1QUQ B;  1K8G A;  3L0O A;  1E2W A;  1EY8 A;  2CH4 W;  1IBM Q;  1BBU A;  3G7L A;  4P73 A;  4IO9 A;  4A3J B;  3JAM L;  1FVI A;  2B2W A;  3ND9 A;  4OWX B;  2BH8 A;  2BH2 A;  2KEC A;  3E5S A;  2ZJP A;  1I94 L;  2NN6 I;  1M4V A;  5DEH A;  2MFI A;  2E74 C;  1BBX C;  4FXD A;  5IIF A;  2CH4 A;  1TWF H;  2VB2 X;  2QA4 A;  1WTH A;  3PGZ A;  1LYL A;  2B3G A;  4RGO S;  3TDQ A;  4HJ7 A;  5M3M H;  4BBS B;  3CMA A;  1QCB D;  3PO3 H;  4B3R L;  1JOR A;  1KDA A;  2XRQ D;  3CQZ B;  4L8J A;  5I6W A;  1ET9 A;  4DV1 Q;  2B2U C;  1STG A;  4CKC A;  4LF7 Q;  3HOZ B;  4OO1 I;  2E2J B;  2IY5 B;  3CCE A;  3I73 A;  4JI7 L;  3GD7 A;  5CYU A;  4BY7 B;  3K5O A;  1RTN A;  5IGC A;  3AFQ A;  1STN A;  2PI2 A;  2KED A;  1NE3 A;  4IUU A;  5A2Q L;  4IPG A;  3FPU B;  3FKI G;  1PHJ A;  2NB0 A;  5J22 A;  2BE5 D;  3BVM A;  3W2D A;  1A62 A;  3EVQ A;  1BOS A;  2MNA A;  5M9O A;  2ICE C;  1K83 H;  5BR8 Q;  3CQZ H;  2EYJ A;  2EVB A;  2F3I A;  4F87 A;  1CA5 A;  1N33 Q;  4X62 L;  5C3W A;  1IL8 A;  4LF4 L;  3T4A C;  1CZG A;  1VQ9 A;  3S14 B;  3SK5 A;  4KKS A;  1U4P A;  1LTB D;  5IWA Q;  5C0X H;  1Y1W B;  1H9J A;  3DXJ C;  5FO8 B;  4DXF A;  3ONA B;  4A93 G;  2VUM H;  2E2H B;  3R2T A;  1RIP A;  2XIW A;  4GZY C;  1EIF A;  1I4Q A;  5FOB B;  4JBM A;  4A93 B;  2AMC B;  1J5E L;  1PRT C;  5IT9 c;  4P74 A;  3TME A;  3BYT B;  1EIG A;  3RZO B;  3HOZ H;  2UUA Q;  3STB C;  4O0A A;  1E7Z A;  2X6L A;  1EY5 A;  2TMP A;  4DN4 M;  3EFX D;  4LFA Q;  1P8L A;  2P5Z X;  3MXG A;  1IBL L;  1I3Q B;  3MXP A;  3HOV G;  2K7V A;  3KLS A;  2XTI A;  1O7Z A;  1MKH A;  1PH3 A;  2RDH A;  2F0D A;  4PZ7 A;  1WTP A;  4DK6 C;  1Q81 C;  4EQP A;  4A3F H;  2F0T A;  3D4R A;  4EQ5 A;  2QIL A;  1GHJ A;  3T16 A;  4R4T A;  1JWM D;  1OXX K;  4DR3 Q;  1Y1W G;  4RHR A;  1VQ7 A;  4OWW B;  1VQO A;  4GN3 B;  1FGU A;  1B9N A;  1G51 A;  2F0W A;  3PUX A;  2F0F A;  1HNX L;  4LF8 Q;  4PNY A;  2L9H A;  4K8J A;  3CW2 C;  5C3E H;  2IWH A;  2J7Z A;  4MZ9 A;  3SE0 A;  3TSS A;  3OSO A;  1K3R A;  2UUA L;  2K32 A;  1TS5 A;  4RG1 A;  3KJO A;  1PH6 A;  3OWE B;  3RD4 A;  1JOK A;  1DXM A;  1QVC A;  2ENB A;  3MXN B;  4R8N A;  1GUO A;  5I4D A;  2EYF A;  4KMU C;  4CGY B;  4N9T A;  1NTG A;  3R2I A;  5T1G A;  1EYD A;  5M3F G;  5GRO A;  3P20 A;  5FO9 B;  4JVZ A;  3EA6 A;  3J7Y W;  3MFY A;  5JVG 3;  1XMO L;  2BDN A;  5D14 A;  2EQS A;  5M5Y H;  1WTV A;  4JI4 Q;  1B9M A;  4CJ1 B;  1FD7 D;  3G4S A;  4B9X A;  3MZ5 A;  4R4I A;  4V19 0;  3SK4 A;  3HOV B;  3SHL A;  2JA8 H;  5LL6 X;  1IHZ A;  1Y8O B;  2Q8T A;  1WD1 A;  3LNN A;  1SYD A;  1V43 A;  2EXD A;  4IAL A;  2G5D A;  1BCP D;  3S14 H;  4A3J H;  1E1T A;  1O80 A;  1SEB D;  3J80 E;  2X69 A;  4X3T A;  2UU9 Q;  4O1N A;  4EVO A;  3NQI A;  2K5D A;  3I90 A;  2KCM A;  1BCP B;  1CSP A;  3CCL A;  4YHH L;  3S1N H;  2IW3 A;  2D9U A;  1BXT A;  4L6T B;  4HED A;  1JOQ A;  1F2Z A;  3BZK A;  1EYA A;  4QL5 A;  1N36 L;  1YI2 A;  4AYB G;  1SNC A;  2WAC A;  2RHQ B;  4JI0 L;  4ULL A;  1IBK L;  2JA8 G;  2B63 G;  1N9W A;  3I7F A;  2N3S A;  3J7A V;  2LY7 A;  1BQQ T;  1TII D;  3T1Y L;  4DV2 Q;  2HQL A;  3MXU A;  4ZRZ A;  1MBY A;  5I9P A;  5I2X A;  4B3T Q;  1EY4 A;  2KHJ A;  1VF7 A;  5J3B A;  4A3D H;  1ESF A;  1DON A;  3S16 H;  2EJG C;  4ABN A;  2VQE L;  2M2L A;  1CA6 A;  3QIA A;  2KOL A;  4HSP A;  1TWA H;  2NBF A;  4MIU A;  2SDF A;  3KBG A;  2B2V A;  2MUY A;  3BG3 A;  3L2P A;  3CC4 A;  4A3C G;  4A3B B;  2CCZ A;  1BCP C;  1ONL A;  1AP0 A;  3DEO A;  1LTA D;  1F2Y A;  2EYH A;  3E0E A;  2OTL A;  4JYA L;  5M5Y B;  4FF2 A;  4RKL A;  5JAV A;  2OT2 A;  3BYY B;  1STB A;  2R92 H;  4NW2 A;  4DR7 L;  4GS3 A;  2F0L A;  4BBR B;  3G48 A;  1MD2 D;  4DKA C;  2VY3 A;  3RLN A;  5J1Z A;  3HOU H;  2EYL A;  4JG2 A;  3CCS A;  1QOH A;  1UE1 A;  5C4H A;  2RA4 A;  5LMN L;  4DR4 Q;  4IOC A;  3ULP A;  3AMU A;  1SYC A;  2RBM A;  1QZH A;  4FF4 A;  3C1E A;  4JBJ A;  3T1Y Q;  3I8Z A;  3IAY A;  3JC6 6;  5FLX L;  1B8A A;  4DV4 L;  4DV5 Q;  1Q1B A;  1NY4 A;  1GUS A;  2KEN A;  1SMY D;  5EJW A;  2KUM A;  3R8B A;  1H9S A;  1PMR A;  2JA9 A;  4IUR A;  1HNZ Q;  4LF5 Q;  1PZJ D;  1WTX A;  5LMU L;  1RD9 D;  3NUC A;  1VQD A;  4FF1 A;  4XDX A;  4B3S L;  1HPC A;  1UUP A;  2EJF C;  1WTW A;  1VQP A;  5DLQ E;  3WOE A;  4JCV E;  4OHJ A;  1B50 A;  4F7X A;  2OCE A;  4DF7 A;  1TKW B;  1VQL A;  3EQL C;  4PV1 C;  3U58 A;  5IYC G;  1RTO A;  4XYQ A;  5J39 A;  3H0G G;  3PUV A;  4QF4 A;  5FLM G;  2YU9 B;  1OXU A;  1TWA B;  2A6H D;  4JI6 L;  1F9S A;  4KHV A;  2A19 A;  5ELD A;  4A3I B;  1SRU A;  2KA7 A;  3M7N A;  1IW7 C;  2K5Q A;  3SK6 A;  2UUC Q;  2JA5 H;  1MIU A;  1HR0 Q;  4LF8 L;  3WOF A;  1U4M A;  1Y1W H;  3KF8 B;  1TU2 B;  4YWK A;  2N55 A;  1EOV A;  3ITP A;  5KNB A;  3G71 A;  1X32 A;  4JI2 Q;  3RUZ A;  5FLM H;  1OXV A;  4J1M A;  1HQM C;  2RSO A;  1L1O C;  1D5M C;  3OIP A;  4B08 A;  2DNE A;  5EPJ A;  4DAM A;  1Z6H A;  4KV6 A;  3QWN A;  1X65 A;  3DWQ A;  3V96 A;  1WTO A;  3F2C A;  2K05 A;  5KGU A;  1KAW A;  4JI1 L;  2ES2 A;  4RCO A;  3CU7 A;  1B1Z A;  1FNW A;  4FVM A;  5IGB A;  3OW2 A;  5IGG A;  2B2Y C;  3ERO A;  1NMF A;  1VQ6 A;  4J8Q A;  1TR5 A;  1YJN A;  4LUO A;  3M4Y A;  2F3V A;  1VQH A;  4Y7N B;  4IFD J;  2F0U A;  1KDC A;  3E6Z X;  1TWF B;  1PDQ A;  1B44 D;  2PMZ E;  4RFB A;  5K36 G;  1HR0 L;  4CDE C;  3I91 A;  2IHF A;  1SMX A;  3A0J A;  1A3V A;  2PW5 A;  4P72 A;  1QG7 A;  3PO3 B;  2XVS A;  3U9S A;  2K01 A;  1AW7 A;  1GJX A;  5IYD H;  1NBW A;  2Y0S B;  1A2T A;  3TEH B;  5FKA C;  5C4J B;  3NWT A;  5M5X H;  5IWA L;  2PQA B;  1T9H A;  1A3T A;  4XT1 B;  3MHB A;  4XT3 B;  2LXJ A;  4JI0 Q;  1UAP A;  1Z9F A;  4K2L A;  4BA1 I;  2IX3 A;  1PTO H;  1E0B A;  5EKI A;  1C7Y A;  2PW7 A;  1QWY A;  4XQQ A;  2EE1 A;  3EBE A;  2XGT A;  5BN5 A;  2A74 C;  1SFO H;  2K52 A;  4PMB A;  4DK3 C;  2OF1 A;  2MHV A;  4YCW A;  1DOL A;  1LO5 D;  3RN5 A;  1EY6 A;  4UY8 C;  5L37 A;  1BNZ A;  2NZ1 D;  3K6O A;  3M4O B;  3HOW G;  2Y0S E;  1QVG A;  3NBI A;  4HMJ A;  1B4O A;  1YBY A;  3GTG H;  4ID6 A;  4IOA A;  3VA7 A;  3KLW A;  1G2T A;  1HFN A;  3Q6S A;  2EPB A;  2FIN B;  2RDF A;  3W3A A;  5JPM C;  2B2V C;  3M85 A;  5AFW A;  2LXK A;  4C1N I;  1K3B C;  3D4W A;  4YCV A;  5C4X H;  4NXM L;  3L3O C;  1FNV A;  1A6X A;  1HTL D;  3S2D B;  3CCU A;  3DM1 A;  1FJG L;  4P71 A;  3SXH A;  5JJL A;  1XPO A;  1OXT A;  4IUP A;  4HJ5 A;  4P2C B;  3K5M A;  2ZTD A;  1BR9 A;  2R93 G;  1D8L A;  4HID A;  4Q5V A;  3J80 i;  4GNX C;  1CM9 A;  1PRT F;  3K57 A;  5HGT A;  1U9R A;  1RL2 A;  4EGV A;  4UP7 A;  1PLF A;  3UDX A;  3GO5 A;  2KBN A;  4LF5 L;  1I4R A;  1PV4 A;  4KHP L;  1VQM A;  1JE4 A;  5EBC A;  2A8V A;  3G6J B;  3T51 B;  1Q7Y C;  1CZW A;  1E1O A;  3KBX A;  1XNQ L;  4NP5 A;  5EKK A;  2JP1 A;  1SXT A;  2CWA A;  2R61 A;  2Z6K A;  1SE4 A;  1STE A;  1D2B A;  1YZ6 A;  3DUZ A;  5C44 H;  1SBB B;  1X3E A;  4C3J B;  4CKB A;  2EY5 A;  2EYM A;  4NPS A;  2VQF Q;  1HNW L;  1F9Q A;  4QJF A;  1VQE A;  3TP8 A;  1U5K A;  4ODG A;  4NXN L;  1XMO Q;  1TWG H;  1LTR D;  4OO1 G;  4WJ4 A;  4X64 Q;  1Q12 A;  3J81 L;  3LWE A;  1GUW A;  3TQY A;  1EEI D;  1L1O A;  5G3L F;  3S2D H;  2CQA A;  3I56 A;  4K6D A;  3RMH A;  1I6H H;  2EY1 A;  1IYU A;  3J81 j;  2EY2 A;  4LNQ A;  2ATW A;  1Y1V G;  2JA5 B;  4PMW A;  2K50 A;  3UI2 A;  5CBA E;  3TS2 A;  4KD3 A;  4R9W A;  2L11 A;  3L7Z C;  2ICI A;  4P75 A;  4HSV A;  2ASB A;  1JQY D;  4KHZ A;  3WDN A;  2H1E A;  3KF6 A;  1PVO A;  1N34 L;  1Z47 A;  1EU3 A;  2AUJ D;  1HZC A;  4A75 A;  3E3X A;  3C2P A;  1TY0 A;  2AQ2 B;  1UE7 A;  1EY0 A;  4QQB X;  2GVB A;  5I9O A;  4JI5 Q;  4A3L G;  4ME3 A;  1F9P A;  1D1K A;  2ZXP A;  3HOW B;  2VUM B;  1CQF A;  5FLX c;  3HKS A;  5CV5 A;  4DFA A;  2O5I C;  1S40 A;  4CBV A;  2ZM6 L;  1X9N A;  5IE8 A;  4NXN Q;  2N78 A;  3GTL B;  3NEN A;  4GLX A;  1GVP A;  2I07 B;  3ER0 A;  2JA6 B;  4APV A;  5I6Y A;  1ASY A;  4G57 A;  5A2Q E;  2Z9H A;  1JWS D;  5LL6 S;  2KJX A;  1NMG A;  1I3Q H;  1JJC B;  1K83 B;  1N8R C;  5CBE E;  2H5X A;  1EIY B;  2HCI A;  1BO0 A;  2F0I A;  3DHQ A;  3T1H Q;  2F0G A;  5KYI A;  1F77 A;  1XTD A;  3HOW H;  3I72 A;  3LWU A;  1QUQ A;  5FLX E;  1W2B A;  4X66 L;  3VR2 A;  4DV1 L;  3IRB A;  3CRK C;  4S3S A;  3TZD A;  3OTO Q;  3DEP A;  4MTN A;  3LGJ A;  4BBS G;  1QE6 A;  2ZJR A;  1SLJ A;  4NMZ A;  4LK1 C;  3GTO B;  1CFM A;  1NSN S;  3NK9 A;  1PTO F;  4DV7 L;  4AIM A;  1EYG A;  4JI4 L;  1GO3 E;  1PH4 A;  4RHS A;  3OPO A;  4KN4 C;  3K59 A;  3Q8D A;  5BN4 A;  2Z1C A;  3S1R H;  2CHB D;  4UDU C;  1HCZ A;  4KTA A;  3ZYY X;  4KLK A;  5GAG C;  3PO2 H;  1RDP D;  1F2M A;  2EOT A;  1JR0 D;  2FJ2 A;  5ELB A;  3PO2 G;  2AQ1 B;  3A8J E;  2PO4 A;  2UU9 L;  2WKD A;  3A54 A;  2UXD Q;  1R4Q B;  2K75 A;  1H9M A;  2Q2U A;  1FJG Q;  1XNR Q;  3GP7 A;  4C2M B;  2F0J A;  3M7G A;  1H9S B;  4KK7 A;  2CKZ B;  5COY A;  1YIT A;  3PQI A;  2A1A A;  4KD4 A;  3VR4 A;  2R7Z B;  1QNU A;  2HD3 A;  2YU9 H;  5D65 A;  4RGN A;  1KL9 A;  5CMD A;  3Q23 A;  1ASZ A;  5G3L D;  1K73 C;  3A8I E;  4BY1 H;  4OON A;  2VQE Q;  1UE5 A;  2K14 A;  4H02 A;  3CCM A;  2VS1 A;  4YHH Q;  4C3I B;  5IOD A;  1L1O B;  3GTK B;  3V2T A;  2F0P A;  4CJ0 B;  4G7O C;  1X56 A;  1IKM A;  3PF5 A;  1LTT D;  1L2F A;  2VZA A;  2FFK B;  1RJT A;  1RHP A;  4TRD A;  1O7Y A;  1SYG A;  2EJM A;  1KC8 C;  4IFD G;  1Y1V H;  1D5Z C;  1CHP D;  1YHB A;  3S15 H;  3VA5 A;  4AQY L;  2JA7 G;  3S1M H;  1WD0 A;  2B39 A;  4DAP A;  1SAP A;  2VW9 A;  1UWV A;  2ALY B;  1LAC A;  3MTS A;  5I2Y A;  5IP9 G;  1I94 Q;  3SEB A;  1CHQ D;  3FKI H;  3BS1 A;  3PIP 3;  3KFU A;  1AZP A;  2F0M A;  1Q1E A;  3IL8 A;  1DOK A;  2JK8 A;  4RKB A;  3J7A F;  4DAY A;  3P1H A;  2A69 C;  2B2T A;  4WRD A;  1MI2 A;  1HR0 W;  4C3H G;  2D0P A;  3FMC A;  3DWP A;  4FP5 D;  5C5M A;  3GTQ H;  2F0H A;  4TQU S;  3CC2 A;  2EY6 A;  5CV6 A;  4Z9C B;  2MGS A;  1KQS A;  1M90 C;  3IFD A;  5C0X J;  2CQO A;  2HT1 A;  1ESR A;  3GV3 A;  2IX0 A;  1GM5 A;  4JI3 Q;  5ELE A;  4DU9 A;  1J8I A;  3CF5 A;  3MA2 B;  2HCC A;  4FDB A;  1KLU D;  4GOP C;  4IN3 A;  3J81 E;  4C3H H;  3DWA A;  3I55 A;  2IL8 A;  1SJH D;  4BXX G;  2NN6 H;  3P7J A;  1ICW A;  2NYZ D;  3MWY W;  4JV5 L;  2QGQ A;  1S4Z A;  1CKN A;  1R9T B;  5ELO A;  4JI8 Q;  1X3Q A;  2JA5 G;  1KRS A;  2JEA I;  1JMC A;  4X65 Q;  3F2D A;  1KHI A;  1LV9 A;  3RN2 A;  2NTS A;  2K4K A;  2ZXR A;  4A93 H;  2SOB A;  2CW0 D;  4LFB Q;  4OEL B;  5E1F A;  2RQX A;  5HGQ A;  5KND A;  2O5J C;  4LF4 Q;  1VCI A;  3BVG A;  4A3G G;  1ILP A;  2MPM A;  3D4D A;  3QJY A;  1XMQ Q;  3UDI A;  3URY A;  3GTM B;  2EXZ A;  1N36 Q;  2I46 A;  2FMM A;  2F4V Q;  4QY7 A;  3J7A 5;  2DJF C;  1PFM A;  4KY6 A;  3I70 A;  1BUV T;  2I5L X;  1DM0 B;  5GAD C;  4QB4 A;  4R1J A;  2F3W A;  5K5P A;  4N8X 1;  1PTO C;  2H4O A;  2K03 A;  3TZU A;  2HHH Q;  1STH A;  1PXU A;  4HJ9 A;  5IOC A;  1HA5 A;  4KHP Q;  5JOB A;  4AYB B;  5H1S E;  1SE2 A;  1A8V A;  4DUZ L;  5JEA J;  4GKJ Q;  5M3F H;  5GAE C;  1II3 A;  1X55 A;  2QF7 A;  3AB9 A;  4LFA L;  1XTC D;  3K7A B;  4GN4 B;  3BZD B;  4N9P A;  2PMZ B;  2WKC A;  2F0V A;  3NTH A;  4J6H A;  4CDD C;  1I5F A;  1Q86 C;  3FHW A;  3SK8 A;  2E76 C;  4KKU A;  2YYZ A;  1R4P B;  2PNH A;  3E9I A;  4L63 B;  4A3K G;  1P16 A;  3MEH A;  3HGB A;  4A3F G;  3CCR A;  3CC7 A;  3HOX B;  3J7Z C;  1C8C A;  2NVY B;  4EQO A;  4JPB W;  2CVR A;  2E8G A;  4PQX A;  4DK0 A;  1IBM L;  4ME5 A;  3BU2 A;  5FJ8 G;  2XRS D;  2YTX A;  1S5B D;  2DGY A;  2F0N A;  1U4R A;  2K5N A;  3W1B A;  5KYL A;  1SNQ A;  1AFP A;  2BDO A;  2K33 A;  3STB D;  3F2U A;  4QUF A;  3ICE A;  2I0Q A;  3R3O A;  2A6H C;  2QEX A;  1XX8 A;  4XXE A;  3G6E A;  2MQH A;  1VQ8 A;  2KCC A;  1SN8 A;  4A3E H;  1WTR A;  1A2U A;  1STY A;  1WCM G;  5M5W B;  3KLR A;  1GXD C;  2ZXO A;  2IX1 A;  4V0B A;  1Y8P B;  1V1P B;  3HOY G;  4LF9 Q;  1VS0 A;  4LFC Q;  1N34 Q;  3P75 A;  3CPF A;  5NUC A;  3FRP B;  3SDZ A;  2VL6 A;  4JI7 Q;  1D5X C;  4DV6 Q;  3BDO A; 
#chains in the Genus database with same CATH homology
 5FO7 B;  5JJZ A;  5K36 H;  2Z8L A;  2VXW A;  4KKT A;  2PQE A;  3NXW A;  2NUC A;  1I4P A;  3PV0 A;  1AZQ A;  2K5W A;  2NTT A;  1SDF A;  1U4L A;  4NKL A;  3TBI B;  2WAQ B;  1Y1V B;  2KHS A;  3Q24 A;  4TSS A;  1VMC A;  2XWJ B;  1G2S A;  4PMC A;  4CKE A;  1Q90 A;  3N6R A;  1A15 A;  1FNU A;  3NBH A;  3H91 A;  2BOS A;  2F0O A;  1TQO A;  3C3L A;  4WFN 3;  2Z4H A;  4K5V A;  5ELC A;  1I6H B;  1KLG D;  1W6K A;  3GV6 A;  1NR4 A;  4A3D B;  1Y8N B;  1LTG D;  1ENF A;  1LTI D;  3FEW X;  1T5E A;  1WVL A;  2WP8 J;  2CW0 C;  3ERQ A;  1XWE A;  4H13 C;  3OMC A;  4HR7 B;  1JB3 A;  3OIQ A;  1D6E C;  5IGD A;  2TSS A;  4E6I A;  5DAU A;  4CHT B;  5BN3 A;  1EIH A;  1LTS D;  3EJI A;  2WB1 B;  1HUN A;  1V1P A;  4M1U B;  5C6A A;  4K14 A;  3D8G A;  4H44 C;  3L9A X;  2VB3 X;  1CK1 A;  5JPN C;  2Q8R E;  1TWG B;  1PRT D;  4ILW A;  3K5L A;  2F0E A;  4LMQ D;  1GHK A;  1KTK A;  4F8M A;  1NCV A;  3LX0 A;  3OOC A;  5E4X A;  2R6G A;  3S1N B;  5C3E B;  2G9H D;  1TS3 A;  1NAP A;  1T5X D;  1B53 A;  3GTJ B;  2BA1 A;  3NWS A;  1TWH B;  3A8K E;  3K5N A;  2F0K A;  1NUC A;  5KEE A;  2KEE A;  1LT6 D;  1TS4 A;  1C4Q A;  3O13 A;  5EBD A;  4XTC S;  5EQ0 A;  3RLF A;  1BCP F;  1Q3L A;  4K8I A;  1SSO A;  1D1I A;  5LHY 1;  2F4I A;  4OGQ C;  5KNC A;  1DCZ A;  4ZUJ A;  3GTG B;  1V8Q A;  2NN6 G;  2F0Q A;  1MSH A;  3KK7 A;  1S5D D;  3KUP A;  4X3K A;  5TSS A;  4RAU C;  4G7H C;  2OEO A;  1SFO B;  2XN9 C;  3A7A B;  4DXG A;  4UAI A;  2E75 C;  4RGT A;  2L55 A;  3NQT A;  2A5H A;  1G29 1;  3I4L A;  3VYS A;  2JA8 B;  1YNN C;  1F9R A;  1EU4 A;  4ZAI A;  2RKS A;  2AQ3 B;  2V4D A;  3T13 A;  4IFD H;  5HUR A;  4I7Z C;  1SYF A;  3HRZ C;  4XQJ A;  4CJ2 C;  1ZYR C;  4YIJ A;  4A3K B;  4A3M B;  2DY7 A;  2B2W C;  2ID0 A;  3M3Y B;  1W6J A;  2C9O A;  2LMC B;  4RA8 A;  1DYQ A;  4HAE A;  3FPP A;  1HTP A;  3S17 B;  2XNA C;  4KY5 A;  1I4X A;  3D31 A;  3FVQ A;  1AEX A;  3QO2 A;  1LT5 D;  3ND8 A;  3T56 B;  1VF5 C;  1CTM A;  3AU7 A;  3VYT A;  1JWU D;  3S1M B;  1TT2 A;  4A3F B;  4K5X A;  4C1N K;  4G7Z C;  2D5D A;  1JOO A;  1EWH A;  1ILQ A;  5F2D A;  4K6L A;  4X3S A;  5JVH 3;  4KJO A;  2PZW A;  2MJ8 A;  2Q8I B;  4FO2 A;  4A3G B;  1RKN A;  2BA0 A;  2L4N A;  3S9W A;  1F2L A;  5CR3 A;  4ZLT F;  5KRU A;  5CC4 A;  1PRT B;  3MC0 B;  4C56 C;  4XQN A;  4KI0 A;  5C44 B;  1WTQ A;  4KY7 A;  2B63 B;  4QCL A;  4QIW B;  4JBW A;  1YNJ C;  4XYO A;  4RWS C;  2G9D A;  1QIL A;  2DNC A;  1XXG A;  5C4X B;  5EPK A;  2M9V A;  3NTK A;  2L0C A;  3QOL A;  2R93 B;  4FXG C;  4LAA A;  1CQV A;  1GUG A;  1SNM A;  5C4Z A;  4U68 A;  3TP6 A;  1BF4 A;  2NVQ B;  3OHX C;  3NP8 A;  1HRJ A;  3FKI B;  1IYV A;  3VR5 A;  1SE3 A;  1O7L A;  2A69 D;  4IZ8 A;  2B2Y A;  4MHE A;  2F1M A;  4FYD A;  3PMF A;  1KAA A;  2XSC A;  4OL7 A;  4X3U A;  1YNJ D;  3TN2 A;  1I4H A;  3I4N B;  4JK1 C;  4ZQ3 A;  4ZKB B;  2R92 B;  3TP5 A;  3HG9 A;  3S16 B;  3HOY B;  1E2Z A;  2AWN A;  4FNF A;  4DGZ A;  5E3F A;  3MAQ A;  3MXN A;  2KQ3 A;  1DD2 A;  3QB3 A;  5ISR A;  3NE5 B;  3I3C A;  1OXS C;  1Y69 U;  2ZT9 C;  3FDT A;  2EYP A;  5CGK A;  4B9W A;  1E2V A;  1PZK D;  2B8G A;  3CRL C;  3NHH A;  2FHT A;  3CKI B;  2RVL A;  3PUW A;  2R3Z A;  1G91 A;  2LFN A;  1TVX A;  3HKZ B;  4HMI A;  4RH6 A;  2JE6 I;  4A3E B;  4MN3 A;  3H09 A;  2GA4 B;  1ZYR D;  3C1F A;  1SJE D;  5EKL A;  3IFT A;  3V05 A;  5M5X B;  3D3R A;  4TKO B;  1Q8I A;  1TS2 A;  4OIK A;  1VMP A;  2QDB A;  4K2K A;  5C5L A;  3Q0A A;  1ENA A;  1K8O A;  5IGF A;  1EOT A;  2PPB C;  1MSG A;  3S1R B;  1HUM A;  4HTH A;  4IFD I;  3RZD B;  1GUT A;  1SND A;  2A73 B;  4RCN A;  3NSW A;  3T53 B;  2JEB I;  1DOM A;  2OXP A;  5EPL A;  1HQR D;  2KVM A;  2E2I B;  4U67 3;  4DNR B;  1NR2 A;  1LT4 D;  4DNT B;  3VYU A;  2D62 A;  3HP3 A;  1VDZ A;  3Q22 A;  1SNP A;  4KJN A;  4IUT A;  1BDO A;  5C0X G;  3VYR A;  2K6A A;  2WV6 D;  3HOU B;  1ZXT A;  2F0S A;  1S5F D;  1PFN A;  5DM6 3;  4ZKC B;  3PUZ A;  1STA A;  1KNA A;  3MVV A;  1V1O A;  1GUN A;  2J0T D;  2E2D C;  1LT3 D;  1SNO A;  1ZEQ X;  3OW7 A;  5D3D A;  5IT9 E;  2K1B A;  3VR3 A;  2EYO A;  4IUQ A;  1G8Z D;  2AUK A;  1EFI D;  1QNK A;  3D6W A;  1H9R A;  2DY8 A;  2JXM B;  3SVM A;  2FMC A;  3X3M A;  3CHB D;  3PIO 3;  3I4M B;  1RF2 D;  1A3U A;  4I65 A;  1ROD A;  4DA2 A;  3HZX A;  1UEA B;  5T1I A;  2Z4I A;  1EY7 A;  2A6E C;  2L1B A;  2A68 C;  1TWC B;  1SMY C;  1OO9 B;  4BWG B;  2BE5 C;  2F03 A;  2SNS A;  2HDM A;  4ZK9 B;  1M8A A;  3X3N A;  3KF8 A;  2AWO A;  2A68 D;  3H6M A;  1CI3 M;  1B3A A;  1S5C D;  1SYE A;  2LKV A;  1EY9 A;  4BA2 I;  5CV9 A;  3S15 B;  1WCM B;  4RGM A;  3H94 A;  1I50 B;  4K5W A;  3IKJ A;  3QOJ A;  1IW7 D;  3OMG A;  2A6E D;  1KNE A;  1HFG A;  3R93 A;  4LJZ C;  2B2T C;  2MP1 A;  3PUY A;  1L0X B;  3KLS X;  1EQT A;  1L0Y B;  1PFB A;  3S2H B;  3VR6 A;  1FYC A;  2X6G A;  3A56 A;  4WJW A;  1RCV D;  5A35 A;  2PZT A;  5KIX A;  2IPK D;  1FGB D;  3A7L A;  2EDG A;  3MFG A;  5JEA H;  2NVX B;  5M3F B;  2PCF B;  5C3X A;  4KN7 C;  2M00 A;  2WII B;  1O78 A;  1LAB A;  2EZV A;  3D6C A;  4HCS A;  1X3P A;  4OO1 H;  2BCO A;  3A55 A;  2B8F A;  3C46 A;  3SR1 A;  1DZ1 A;  2J4X A;  2L5T A;  1MGS A;  1Z7T A;  4DAV A;  3JAM E;  1EZ8 A;  3GTQ B;  3DMU A;  4H7B A;  3GTP B;  1G6Z A;  4QUC A;  1AN8 A;  2B2U A;  5M3M B;  4ZYS A;  5D3I B;  2PYK A;  1CT1 D;  4C3J G;  1JC7 A;  4XIG S;  4O42 A;  2O4X A;  1UNS A;  5COR A;  2XWB B;  4Q0F A;  4M8A A;  2N88 A;  5ELF A;  5C0X I;  1QJO A;  1K8M A;  1KDB A;  4G4K A;  2LS0 1;  1I6V C;  2WIN B;  4EQN A;  2RDG A;  2QKI C;  1KAB A;  4WOR A;  4IQZ A;  3K58 A;  2HQE A;  2JSO A;  1C48 A;  4FXK C;  5EGT A;  4IUV A;  2HDL A;  3BVZ A;  4R8I A;  2PZU A;  2HUG A;  3H0G B;  3N52 A;  4F88 A;  4ZUI A;  3BDC A;  5CV4 A;  1ML0 D;  4BY1 B;  4HCE A;  1S5E D;  5IT9 L;  1EL0 A;  4NDX A;  2JA7 B;  1EYC A;  2NVT B;  1TY2 A;  4FF3 A;  2QEJ C;  1XYI A;  4QMG A;  3S1Q B;  1SYB A;  1EEF D;  1YNN D;  3GQB A;  4C3H B;  1I4G A;  1ENC A;  1HA6 A;  2K04 A;  3OWF A;  1PTO D;  2NWG A;  5CV7 A;  2SEB D;  4H0L C;  3HS0 C;  3U9O A;  1H9K A;  3H3V C;  3NTI A;  1PZI D;  1DJR D;  2QCP X;  2L12 A;  1ET6 A;  5E4W C;  1IKL A;  5JEA G;  4IUN A;  2DN8 A;  2D2C C;  3BDL A;  2KCN A;  1EZ6 A;  3HEJ A;  4OIJ A;  2K28 A;  1ZKO A;  1JCK B;  1FR3 A;  2IJ0 A;  2SNM A;  3NPP A;  5DNF A;  3K0Y A;  2PNR C;  3E0J A;  4C3I G;  1PTO B;  1QB5 D;  1PYW D;  4DK1 A;  5CV8 A;  2JYO A;  1EWC A;  1JIC A;  2VNU D;  3TP7 A;  2RSN A;  2O2L D;  5DM7 3;  1HXY D;  4BS9 A;  4HN7 A;  1GOZ A;  1B2T A;  3QG1 A;  3J80 L;  2IT1 A;  1J9O A;  5FK9 C;  1EQV A;  1HHV A;  1LLR D;  2C5C A;  3PO2 B;  5IGE A;  1E2W A;  1EY8 A;  3G7L A;  4A3J B;  3JAM L;  2B2W A;  3ND9 A;  2KEC A;  3E5S A;  2NN6 I;  1M4V A;  5DEH A;  2E74 C;  1BBX C;  4FXD A;  5IIF A;  2VB2 X;  4RGO S;  3TDQ A;  4BBS B;  1QCB D;  1JOR A;  1KDA A;  2XRQ D;  3CQZ B;  4L8J A;  5I6W A;  1ET9 A;  2B2U C;  1STG A;  4CKC A;  3HOZ B;  4OO1 I;  2E2J B;  3I73 A;  4BY7 B;  3GD7 A;  5CYU A;  3K5O A;  1RTN A;  5IGC A;  1STN A;  2KED A;  4IUU A;  5A2Q L;  3FPU B;  2NB0 A;  5J22 A;  2BE5 D;  3BVM A;  3W2D A;  3EVQ A;  1BOS A;  5M9O A;  2ICE C;  2EYJ A;  2EVB A;  4F87 A;  1CA5 A;  5C3W A;  1IL8 A;  3T4A C;  1CZG A;  3S14 B;  3SK5 A;  4KKS A;  1U4P A;  1LTB D;  5C0X H;  1Y1W B;  1H9J A;  3DXJ C;  5FO8 B;  4DXF A;  3ONA B;  2E2H B;  3R2T A;  2XIW A;  4GZY C;  1I4Q A;  5FOB B;  4A93 B;  1PRT C;  3TME A;  3BYT B;  1EIG A;  3RZO B;  2X6L A;  1EY5 A;  2TMP A;  4DN4 M;  3EFX D;  3MXG A;  1I3Q B;  3MXP A;  2K7V A;  3KLS A;  1O7Z A;  2RDH A;  2F0D A;  1WTP A;  4EQP A;  2F0T A;  3D4R A;  2QIL A;  1GHJ A;  3T16 A;  1JWM D;  1OXX K;  4RHR A;  1B9N A;  2F0W A;  3PUX A;  2F0F A;  4PNY A;  2L9H A;  4K8J A;  2IWH A;  2J7Z A;  3SE0 A;  3TSS A;  3OSO A;  2K32 A;  1TS5 A;  3OWE B;  3RD4 A;  1JOK A;  1DXM A;  2ENB A;  4R8N A;  1GUO A;  5I4D A;  2EYF A;  4KMU C;  4CGY B;  4N9T A;  3R2I A;  5T1G A;  1EYD A;  3P20 A;  5FO9 B;  3EA6 A;  3J7Y W;  3MFY A;  5JVG 3;  2BDN A;  5D14 A;  1WTV A;  1B9M A;  4CJ1 B;  1FD7 D;  4B9X A;  3MZ5 A;  4V19 0;  3SK4 A;  3HOV B;  3SHL A;  5LL6 X;  1IHZ A;  1Y8O B;  2Q8T A;  1WD1 A;  3LNN A;  1SYD A;  1V43 A;  4IAL A;  1BCP D;  1O80 A;  1SEB D;  3J80 E;  2X69 A;  4X3T A;  4O1N A;  4EVO A;  3NQI A;  2K5D A;  3I90 A;  1BCP B;  2IW3 A;  2D9U A;  1BXT A;  4L6T B;  4HED A;  1JOQ A;  1F2Z A;  1EYA A;  1SNC A;  2WAC A;  4ULL A;  3J7A V;  2LY7 A;  1BQQ T;  1TII D;  3MXU A;  4ZRZ A;  1MBY A;  5I9P A;  5I2X A;  1EY4 A;  1VF7 A;  1DON A;  1ESF A;  2EJG C;  4ABN A;  2M2L A;  1CA6 A;  3QIA A;  2KOL A;  4HSP A;  2NBF A;  4MIU A;  2SDF A;  3KBG A;  2B2V A;  2MUY A;  3BG3 A;  4A3B B;  1BCP C;  1ONL A;  1AP0 A;  3DEO A;  1LTA D;  1F2Y A;  2EYH A;  5M5Y B;  4FF2 A;  4RKL A;  5JAV A;  2OT2 A;  3BYY B;  1STB A;  4NW2 A;  2F0L A;  4BBR B;  1MD2 D;  5J1Z A;  2EYL A;  1QOH A;  5C4H A;  2RA4 A;  3AMU A;  1SYC A;  2RBM A;  4FF4 A;  3C1E A;  3I8Z A;  3IAY A;  5FLX L;  1Q1B A;  1GUS A;  1SMY D;  5EJW A;  2KUM A;  3R8B A;  1H9S A;  1PMR A;  4IUR A;  1PZJ D;  1WTX A;  1RD9 D;  3NUC A;  4FF1 A;  4XDX A;  1HPC A;  1UUP A;  2EJF C;  1WTW A;  3WOE A;  4OHJ A;  1B50 A;  4F7X A;  4DF7 A;  1TKW B;  3EQL C;  4PV1 C;  1RTO A;  4XYQ A;  5J39 A;  3PUV A;  4QF4 A;  2YU9 B;  1OXU A;  1TWA B;  2A6H D;  1F9S A;  4KHV A;  5ELD A;  4A3I B;  2KA7 A;  3M7N A;  1IW7 C;  2K5Q A;  3SK6 A;  3WOF A;  1U4M A;  1TU2 B;  2N55 A;  3ITP A;  5KNB A;  1X32 A;  3RUZ A;  1OXV A;  4J1M A;  1HQM C;  2RSO A;  1D5M C;  3OIP A;  4B08 A;  2DNE A;  5EPJ A;  1Z6H A;  4KV6 A;  3QWN A;  3V96 A;  3DWQ A;  1WTO A;  2K05 A;  5KGU A;  4RCO A;  3CU7 A;  1B1Z A;  1FNW A;  4FVM A;  5IGB A;  5IGG A;  2B2Y C;  3ERO A;  4J8Q A;  1TR5 A;  3M4Y A;  2F3V A;  4Y7N B;  4IFD J;  2F0U A;  1KDC A;  3E6Z X;  1TWF B;  1PDQ A;  1B44 D;  4RFB A;  5K36 G;  3I91 A;  1A3V A;  2PW5 A;  1QG7 A;  3PO3 B;  2XVS A;  3U9S A;  2K01 A;  1AW7 A;  1GJX A;  2Y0S B;  1A2T A;  5FKA C;  5C4J B;  3NWT A;  4XT1 B;  1A3T A;  3MHB A;  4XT3 B;  1UAP A;  4K2L A;  4BA1 I;  2IX3 A;  1E0B A;  1PTO H;  5EKI A;  2PW7 A;  1QWY A;  4XQQ A;  2EE1 A;  5BN5 A;  2A74 C;  4PMB A;  2OF1 A;  2MHV A;  1DOL A;  1LO5 D;  1EY6 A;  1BNZ A;  2NZ1 D;  3K6O A;  3M4O B;  3NBI A;  4HMJ A;  1B4O A;  4ID6 A;  1G2T A;  3VA7 A;  1HFN A;  3Q6S A;  2EPB A;  2FIN B;  2RDF A;  3W3A A;  5JPM C;  2B2V C;  3M85 A;  5AFW A;  4C1N I;  3D4W A;  3L3O C;  1FNV A;  1A6X A;  1HTL D;  3S2D B;  3DM1 A;  3SXH A;  1OXT A;  4IUP A;  4P2C B;  3K5M A;  1BR9 A;  4Q5V A;  1CM9 A;  1PRT F;  3K57 A;  5HGT A;  1U9R A;  4EGV A;  1PLF A;  3GO5 A;  1I4R A;  1JE4 A;  5EBC A;  3G6J B;  3T51 B;  1CZW A;  3KBX A;  4NP5 A;  5EKK A;  2JP1 A;  1SXT A;  2R61 A;  1SE4 A;  1STE A;  1D2B A;  3DUZ A;  1SBB B;  4C3J B;  4CKB A;  2EY5 A;  2EYM A;  1F9Q A;  3TP8 A;  4ODG A;  1LTR D;  4OO1 G;  1Q12 A;  3J81 L;  3LWE A;  1GUW A;  1EEI D;  5G3L F;  2CQA A;  4K6D A;  3RMH A;  2EY1 A;  1IYU A;  2JA5 B;  2EY2 A;  4PMW A;  3UI2 A;  5CBA E;  4KD3 A;  4R9W A;  2L11 A;  3L7Z C;  2ICI A;  4HSV A;  1JQY D;  4KHZ A;  3WDN A;  2H1E A;  1Z47 A;  1EU3 A;  2AUJ D;  3C2P A;  1TY0 A;  2AQ2 B;  1EY0 A;  5I9O A;  1F9P A;  1D1K A;  2ZXP A;  3HOW B;  2VUM B;  1CQF A;  5CV5 A;  4DFA A;  2O5I C;  4CBV A;  3GTL B;  2I07 B;  2JA6 B;  5I6Y A;  4G57 A;  5A2Q E;  1JWS D;  5LL6 S;  2KJX A;  1K83 B;  5CBE E;  2HCI A;  1BO0 A;  2F0I A;  3DHQ A;  2F0G A;  5KYI A;  1F77 A;  3I72 A;  3LWU A;  5FLX E;  3VR2 A;  3CRK C;  4S3S A;  3TZD A;  3DEP A;  1QE6 A;  4NMZ A;  4LK1 C;  3GTO B;  1CFM A;  1NSN S;  3NK9 A;  1PTO F;  4RHS A;  3OPO A;  4KN4 C;  3K59 A;  5BN4 A;  2Z1C A;  2CHB D;  4UDU C;  1HCZ A;  4KTA A;  3ZYY X;  1RDP D;  1F2M A;  2EOT A;  1JR0 D;  2FJ2 A;  5ELB A;  2AQ1 B;  3A8J E;  2PO4 A;  2WKD A;  3A54 A;  1R4Q B;  1H9M A;  3GP7 A;  4C2M B;  2F0J A;  3M7G A;  1H9S B;  4KK7 A;  5COY A;  4KD4 A;  3VR4 A;  2R7Z B;  1QNU A;  5D65 A;  4RGN A;  5CMD A;  3Q23 A;  5G3L D;  3A8I E;  4C3I B;  5IOD A;  3GTK B;  3V2T A;  2F0P A;  4CJ0 B;  4G7O C;  1IKM A;  1LTT D;  2FFK B;  1RJT A;  1RHP A;  4TRD A;  1O7Y A;  1SYG A;  2EJM A;  4IFD G;  1CHP D;  1D5Z C;  3VA5 A;  1WD0 A;  2B39 A;  4DAP A;  1SAP A;  1LAC A;  3MTS A;  5I2Y A;  3SEB A;  1CHQ D;  3BS1 A;  3PIP 3;  1AZP A;  2F0M A;  1Q1E A;  3IL8 A;  1DOK A;  4RKB A;  3J7A F;  4DAY A;  3P1H A;  2A69 C;  2B2T A;  4WRD A;  1MI2 A;  4C3H G;  3FMC A;  3DWP A;  4FP5 D;  5C5M A;  2F0H A;  4TQU S;  2EY6 A;  5CV6 A;  4Z9C B;  2MGS A;  3IFD A;  5C0X J;  1ESR A;  3GV3 A;  2IX0 A;  5ELE A;  4DU9 A;  1J8I A;  3MA2 B;  2HCC A;  1KLU D;  4IN3 A;  3J81 E;  3DWA A;  2IL8 A;  1SJH D;  2NN6 H;  3P7J A;  1ICW A;  2NYZ D;  3MWY W;  1S4Z A;  1R9T B;  1X3Q A;  2JEA I;  1LV9 A;  2NTS A;  2ZXR A;  2SOB A;  2CW0 D;  5E1F A;  2RQX A;  5KND A;  2O5J C;  1VCI A;  3BVG A;  1ILP A;  2MPM A;  3D4D A;  3QJY A;  3URY A;  3GTM B;  2EXZ A;  2I46 A;  2FMM A;  1PFM A;  4KY6 A;  3I70 A;  1BUV T;  1DM0 B;  4QB4 A;  2F3W A;  5K5P A;  1PTO C;  2H4O A;  2K03 A;  3TZU A;  1STH A;  1PXU A;  5IOC A;  1HA5 A;  5JOB A;  4AYB B;  1SE2 A;  5JEA J;  1II3 A;  2QF7 A;  3AB9 A;  1XTC D;  3K7A B;  3BZD B;  4N9P A;  2PMZ B;  2WKC A;  2F0V A;  3NTH A;  4J6H A;  3SK8 A;  2E76 C;  4KKU A;  2YYZ A;  1R4P B;  4L63 B;  3MEH A;  3HGB A;  3HOX B;  1C8C A;  4EQO A;  2NVY B;  2CVR A;  4PQX A;  4DK0 A;  4ME5 A;  2XRS D;  1S5B D;  2F0N A;  1U4R A;  5KYL A;  1SNQ A;  1AFP A;  2BDO A;  2K33 A;  3F2U A;  4QUF A;  3R3O A;  2A6H C;  1XX8 A;  4XXE A;  2KCC A;  1WTR A;  1A2U A;  1STY A;  5M5W B;  3KLR A;  1GXD C;  2ZXO A;  2IX1 A;  4V0B A;  1Y8P B;  1V1P B;  3P75 A;  5NUC A;  3FRP B;  3SDZ A;  1D5X C;  3BDO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...