1RHPA

Crystal structure of recombinant human platelet factor 4
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
64
structure length
64
Chain Sequence
DLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of recombinant human platelet factor 4.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Platelet factor
molecule keywords PLATELET FACTOR 4
total genus 11
structure length 64
sequence length 64
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1994-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1rhpA00
1WTRA 2J7ZA 1BBXC 2RSNA 2KEDA 2RSOA 4QUCA 4IUQA 1ZXTA 3ONAB 1HRJA 1WTXA 2HCIA 1ILPA 1LV9A 2DY7A 2FFKB 4XDXA 1J9OA 4X3TA 5CMDA 4X3UA 1XYIA 1WTPA 3UI2A 1HHVA 2L4NA 2RVLA 4DN4M 2L12A 1RJTA 1RODA 2K28A 1F9QA 3I91A 1U4MA 1U4PA 3MTSA 2X6GA 5EJWA 2K03A 1EIGA 2EE1A 3D6WA 4RA8A 3TN2A 2KUMA 1HFGA 5AFWA 3LWEA 1B50A 2K04A 4XT3B 5EPKA 1QNKA 5EPJA 1AZQA 1DOKA 5D65A 2B2UC 3H91A 3IL8A 4RWSC 1PLFA 2N55A 1ML0D 2MP1A 2Q8RE 2FHTA 1KNAA 4IUVA 2X69A 3KUPA 1IKLA 3G7LA 1IKMA 1KNEA 1HA6A 2BDNA 2K1BA 2HUGA 1Q3LA 1E0BA 1O7ZA 3F2UA 1EQTA 1ICWA 4R8IA 1BF4A 2KECA 1JICA 1WTQA 1XX8A 2B2YA 2HDLA 1DOLA 1NR4A 1X32A 1CA5A 1VMCA 5EPLA 2H1EA 1HFNA 2B2YC 4XT1B 1G2SA 1B4OA 2L9HA 3FPUB 5T1GA 2FJ2A 3P7JA 2X6LA 2L1BA 1F9RA 1TVXA 2FINB 4IUTA 2MJ8A 4U68A 4X3KA 5CORA 5D14A 5E4XA 1F9PA 2XIWA 3HP3A 3I3CA 3DEOA 1MSGA 1PDQA 3DEPA 5DNFA 2M2LA 1DONA 1DZ1A 3Q6SA 4MHEA 1QG7A 1RTOA 3FDTA 1RHPA 1PFNA 1X3QA 2EOTA 4IURA 4IUUA 2FMMA 2DY8A 1WVLA 1AZPA 3I90A 1J8IA 1HUNA 3I8ZA 1MI2A 1B2TA 1PFMA 2B2TA 2KEEA 1U4RA 1QE6A 3DM1A 1F2LA 1M8AA 1EOTA 4UAIA 1O80A 1U4LA 1CA6A 1B53A 4R9WA 3TZDA 1WD0A 1NR2A 4IUPA 1ILQA 2HDMA 1DOMA 2KOLA 2JP1A 1B3AA 2VXWA 2R3ZA 2MPMA 1MGSA 4CJ2C 2B2WC 1SSOA 4O42A 1WTOA 1A15A 4MN3A 5CBEE 1JE4A 1ESRA 1NAPA 2B2WA 1WTVA 2K05A 1WD1A 3N52A 4ZAIA 1G91A 4X3SA 1EL0A 3IFDA 4NW2A 4CJ1B 4ZK9B 5JJZA 3GV6A 3SVMA 2KVMA 5COYA 2N88A 1O7YA 1PFBA 4ZLTF 2SDFA 2JYOA 5EQ0A 2Q8TA 1GUWA 3KBXA 4HEDA 1VMPA 4LMQD 2NWGA 3GV3A 4OIJA 5EKIA 4ZKBB 5CBAE 2K01A 1MSHA 5T1IA 3R93A 4ZKCB 1C8CA 3MWYW 4HAEA 1EIHA 1RTNA 1NCVA 2B2UA 1WTWA 5E4WC 2NZ1D 1G2TA 2IL8A 1AP0A 1S4ZA 1IL8A 1G6ZA 1SDFA 4OIKA 1F9SA 2D9UA 2RA4A 4RAUC 3QO2A 2B2TC 1HUMA 2CVRA 2B2VC 4HSVA 4CJ0B 1SAPA 1CM9A 2L11A 1BNZA 2B2VA 2HCCA 2EPBA 2MGSA 1X3PA 4HCSA 4QUFA 2NYZD 1BO0A
chains in the Genus database with same CATH superfamily
4KHPL 1PRTD 4IZ8A 2A69D 4PZ7A 3NE5B 4JI3L 1S5CD 2ICIA 3PIP3 2JA7G 3STBC 2VUMG 5EKKA 3UI2A 2RVLA 3A5ZB 2EJMA 2JXMB 2D5DA 4YHHQ 5FLXL 1SNMA 2QW7A 4S3SA 4DR5Q 3I91A 3BS1A 3I72A 4IALA 1BDOA 2K4KA 1XMQQ 3U4ZA 4XQQA 1DD2A 3GTGH 1S40A 2D0OA 1DOKA 4X62L 4Z9CB 1N34Q 3EN2A 1U0LA 1WCMH 4DNIA 4JC0A 1EYDA 1X3EA 4MTKA 4GKKQ 2ICEC 2EY2A 3HOWB 2NVYB 1TWAH 4EQOA 1CI3M 2AQ2B 3AFPA 3J81c 3S2HB 1I5FA 2E2HB 2WKDA 5EPLA 1HFNA 5IGDA 5ELNA 1PH7A 4A3DH 2FJ2A 1VQ4A 3I4NB 3S2DB 1F2MA 2KBNA 4POGA 1BCPD 2R7ZB 5LL6X 1DZ1A 3EQLC 4MHEA 2QGQA 1KLUD 3C1EA 1RDPD 1LT6D 1B2TA 2F4IA 4R4QA 4DV4L 1M8AA 3HOVB 4O1NA 4DR6Q 1O80A 1U4LA 3HOWG 2B3GA 2Q8IB 1J5EQ 1GUNA 1H95A 5C4ZA 4OONA 1VQHA 1STNA 1FR3A 2BE5C 2IHFA 2VQFL 3AFQA 1Q1BA 2AKWB 3W1BA 5C3EB 3OTOL 2WV6D 4LF7Q 3GTKH 2QF7A 5CV7A 3TQYA 1YITA 3Q22A 1QOHA 4EX5A 1XMQL 1PHJA 4FXDA 2F3VA 4IFDH 1B44D 2Q2IA 4DUZL 4DAYB 5E4WC 1K3BC 1YVCA 1HNWQ 1QUQA 3KLSA 1IBLQ 4HSVA 1EIFA 3BJUA 5K5PA 3R3OA 2L11A 4A3FH 4DV2Q 3MA2B 3H0GB 3PUZA 1EFWA 1CKNB 3T53B 4C3JG 3VR5A 2F0JA 2XRSD 1XNRQ 1PH5A 1FGBD 1FVIA 1GO3E 1X55A 4ME5A 4NDXA 5JJKA 1LUZA 1AH9A 1PH2A 4A3BB 3PQIA 4BY7B 1EWIA 3I73A 4A3FG 2Z9HA 4LUOA 4C3JB 4I7ZC 3CRKC 4N9TA 1QNKA 2PZTA 4L5QA 2OCEA 3HOUB 4LF9Q 4M1UB 4IFDG 1S5ED 2ENBA 3A54A 5IWAL 1L1OA 4DV0Q 2EYOA 3EROA 3G7LA 2MO1A 5ELOA 1WI5A 3I4LA 3I70A 3AEVA 4BBSB 3JC66 2F3WA 3I4OA 4HN7A 1WTQA 1EWHA 1N36L 3BZDB 3K8AA 2Y0SE 4B3RQ 4UDUC 3FPUB 1Q46A 4OX9L 2QEJC 4BXXG 2PCFB 3K80C 4DUZQ 4QIWB 1VF7A 2EYFA 5K36H 3HOWH 2FMMA 4LFAL 2MUYA 1JWUD 4DAVA 4JI6L 2M00A 1CA6A 1Q7YC 2EY5A 3ULPA 3CMEA 1DOMA 3A8IE 1QILA 2EZVA 1XPUA 4GN5A 2Z6KC 1I4HA 2ZXOA 3RR5A 1QJOA 5H1SE 3G71A 1AN8A 2NVTB 2RF4A 2LY7A 4PMCA 1EIYB 4ZAIA 1PH3A 4DKAC 3FKIB 3CAMA 1V8QA 4DAYA 5HGTA 4JBWA 2YU9H 4YWKA 1SNDA 2Q8TA 5CGKA 3K5MA 5D3DA 5GAGC 4CKBA 4JI2L 1VQIA 4IJHA 5GAEC 2PMZB 5LL6S 3FRPB 4GKKL 1VQGA 3GTLH 1UE7A 2F0WA 1BBWA 4TRDA 2WIIB 5IP9H 2NVXB 5LMUQ 4BY7G 2K7VA 2PO4A 4OEMB 3CC7A 4YIJA 3TREA 4HJ9A 3AYHB 2EY1A 1VQLA 1Q8IA 2DN8A 3GTMH 1YHBA 4IUQA 2PYKA 5KNBA 1XTDA 1VQBA 1F2ZA 4RMFA 2L4NA 1YZ6A 1HJPA 3STBD 2UUAQ 2IJ0A 4P74A 1SE4A 2Q2UA 3T1YL 3PO2B 1EIGA 4RA8A 5K36G 4MTNA 1GXDC 4RFBA 1UE5A 2V4DA 4JBJA 1HCZA 3DHQA 5ELFA 2YYZA 2AWOA 2MHVA 1SE2A 1PA6A 1EU4A 1XMOQ 4DV6L 2MP1A 2HHHQ 1SFOB 1B9MA 4YWMA 4GLXA 1FNUA 3KDFB 3J81E 5LMNW 4R8NA 4LF6L 2DJGC 3ERSX 4V0BA 3RZDB 3GTJH 3NENA 3M4PA 4DGZA 1HZ9A 4FP5D 1SFOH 1VQPA 5IYCH 5J39A 2F0PA 1B70B 2SEBD 4C2MB 4DU9A 1C48A 2LXJA 3DEOA 1PDQA 4WJ4A 3BZKA 1BR9A 2F0GA 4LFCL 5ELEA 1EY6A 2I5HA 2E2IH 2AQ1B 2MO0A 5CV9A 1IBKQ 2K5HA 3HOZH 1NSNS 1BKBA 1LO5D 1NR2A 3J81i 5I4DA 2BA1A 2R7ZG 3UE1A 4X65L 2I5LX 4A3IG 2HQEA 4G7OC 2R3ZA 1A15A 1QZHA 1RCVD 1NAPA 1LTRD 3KOJA 3D4RA 3PUVA 4Y7NB 2VQFQ 5IT9c 4CJ1B 4KHPQ 1SMYD 3K59A 4LF7L 4KHVA 1PTOC 1ESFA 3S1RH 5C3XA 3JAML 1Y1WH 3K58A 3D4WA 2KCTA 1ICFB 2IPKD 1VMPA 3J80E 4JI1Q 3HG9A 3NWSA 3D4DA 5JPMC 4A93G 1GUGA 5LHY1 4DR2Q 2O5JC 2VQEL 4LF4L 3S1QB 4IPCA 1CKMA 4L8JA 2L5TA 2F0UA 1WYDA 3E0JA 4YWLA 4A3LG 3A0JA 3SE0A 1R4QB 1BNZA 5M5XH 1NTGA 3KJPA 4GLVB 2R93B 1HZAA 1SYEA 1Z7TA 4A75A 2R7ZH 1WTRA 4JG2A 1KD1C 2VY3A 4A3IH 2CQAA 2SNMA 4FO2A 1HRJA 1XNRL 4BY1H 3GTMB 3ULLA 1J9OA 1XYIA 1I4XA 1WTPA 2NUCA 3J81j 4A76A 1HNZL 1G51A 1PVOA 1ENCA 4DR3Q 1YNJC 4AH6A 4IN3A 3J7ZC 3SDZA 2A6HC 2PW5A 3MXUA 5I9OA 4A3GB 3BDLA 4APVA 2K04A 3RD4A 4O2DA 4OWWB 2ZXRA 3TP6A 1V1PB 4IJLA 3R2TA 1IKMA 4QF4A 4GOPA 1Q82C 1O7ZA 4CKCA 5IP7H 3P75A 1X6OA 3SGIA 1PH4A 2LMCB 2KECA 1JCKB 3MC0B 4GS3A 3PUWA 1I3QH 4QIWE 2XRQD 4KTAA 3I55A 4N8X1 5BN3A 3Q0AA 1EZ8A 1EOVA 4P72A 4F87A 4JI1L 4UPAA 2JA5G 3GTKB 3RZOB 5C44H 2NB0A 3ULJA 4JBKA 2IW3A 1RIPA 3B6YA 4KKUA 4IUUA 1K8MA 1LTID 2LSSA 4P2CB 1GHKA 1F2LA 1EOTA 4N8FA 4DV1L 2NN6I 3FP9A 3BVZA 4EGVA 4JYAL 1VQ6A 2HHHL 3GTOH 2XVSA 4JOIA 5AJ3L 1OXUA 1JR0D 4UHVA 1YHQA 1H9SB 4R4IA 1TWHH 2F0OA 1YJWA 3PMFA 1ENFA 1STEA 4A3JG 2B63G 1FYCA 1F2YA 2IY5B 4K2LA 3RMHA 4KHZA 4GN3B 3U4VA 3DWPA 4RKLA 4GN4B 3MXPA 4AYBE 3OMCA 1HUMA 1ZEQX 1E2ZA 3HFZB 3A56A 5JPNC 2RHSB 1NNXA 3AMUA 3R2IA 1HR0Q 4JI0L 2EYMA 4IPDA 1E1TA 1LT4D 3DLLA 1C7YA 2JA6H 4C3HG 1BBUA 1SYBA 3NTKA 2HQLA 2JEBI 3E6ZX 2K03A 4M8AA 2JA5H 2AUKA 5IYBH 1IBKL 1PRTC 2KUMA 4XT3B 3VR6A 3HOYG 3HGBA 5KEEA 1H9KA 1TS3A 5KNDA 3U58A 4L63B 2A1AA 2BH8A 2BDNA 1TWFB 1PTOF 4PG3A 2B2YA 3OW2A 5FKAC 1NR4A 2K52A 1JT8A 1P8LA 4NB3A 5GROA 3J80c 1DCZA 1Q1EA 1JOOA 2K5VA 1ET9A 3LWUA 4ZYSA 4A3IB 4OX9Q 2KCNA 1JC7A 1MSGA 3DEPA 5DNFA 1DONA 4HMJA 2F4VL 2WB1B 3K0XA 1CQFA 4R4TA 3I8ZA 4RCNA 4A3EH 3FHWA 3HOZG 5M5YH 2N78A 4QCLA 1G6PA 1ILQA 2HDMA 4ZUJA 1DYQA 3QB3A 1D5MC 3UE0A 1AE3A 1NJIC 3PO2H 4MN3A 5C5LA 5HGQA 4DUYL 3RN2A 4CDCC 1VQMA 4EVOA 4X6AH 1EL0A 1EU3A 2K5NA 1E2WA 1IBML 5COYA 3CCSA 4QB4A 1O7YA 4GKJL 3M9BA 2BCOA 4LMQD 3CPFA 1I3QB 1UEAB 3QJYA 4Q0FA 4A93H 4DR1Q 5EBCA 2EIFA 1KDBA 1NCVA 3SK4A 3NELA 4PQXA 5IOCA 1G2TA 1B7YB 2RA4A 4RAUC 4AQYL 1ENAA 4DA2A 2DUDA 2RBMA 3HKZG 4I65A 3T56B 2XTIA 1VQFA 2ZJRA 1TWCH 2C5CA 4X65Q 1CHQD 3A74A 3OW7A 2OQ0A 3KFUA 1KL9A 1LV9A 2WFWA 4RG1A 4PZ8A 2JK8A 1Y14B 3DWQA 2AMCB 1V1PA 4OXPA 2F4VQ 1V1OA 4KD4A 3KYHC 3BU2A 3ND8A 5M9OA 3RNUA 5IGFA 1WCMB 4YCUA 3S17H 2B2UC 2VUMB 1VQDA 1JJ2A 1SMXA 3FEWX 1CHPD 1IYVA 3AU7A 4K14A 1HA6A 2WB1G 1KNEA 1Y1WB 1ZYRC 4LWCA 4LF6Q 2XWBB 5M3FG 1LTTD 2Z6BA 3KDFA 4R8IA 3G4SA 1W2BA 3QIAA 1YJNA 3MAQA 2L9HA 1ASZA 4U68A 4A3KH 2F0IA 1SJHD 1C4QA 1N34L 4A3JB 1HNZQ 4DK0A 2B63B 2R93H 1RTOA 4LW1A 4JBMA 5G3LD 1EY7A 3X3NA 3JAMi 5FOBB 4BBRB 2F3IA 3TZDA 1HNXQ 1SMYC 4V190 2JA7H 3OYYA 2R7DA 4K0KL 2JP1A 1JJGA 1EZ6A 2H4OA 3A5UA 3KLRA 2RKSA 2YU9B 1SSOA 2NVQB 4BXXH 1R4PB 2A19A 5CBEE 1JE4A 1KDAA 1WTVA 4C1NI 2RHQB 1M1KC 2WP8J 3SVMA 2WAQB 2KVMA 3TEHB 4KN4C 2JYOA 4RGTA 1IXRA 5EKIA 1A3UA 2NWGA 1Z47A 4U673 5M5YB 1PTOB 1D5ZC 1P16A 2VQEQ 2PZWA 1IL8A 4ZUIA 1G6ZA 1QCBD 1G291 2O5IC 1EEID 4IUNA 2NVQH 3TRZA 3E9HA 3L0OA 2K75A 2EPBA 2NYZD 4H0LC 5JEAH 1NMGA 2R92H 3OTOQ 3G48A 1PTOH 1SYCA 1UUPA 1BBXC 4QUCA 1T5XD 1TS5A 1ZXTA 2WACA 1PZID 1PH8A 3S1NH 4PMBA 5GAHC 1CZGA 2K6AA 2JN4A 4X3UA 5CMDA 5C4XG 2B39A 2A74C 3EVQA 1RODA 1QUQB 2EVBA 4L6TB 1U4PA 4C2MH 2EE1A 1O7LA 4OO1I 1MJEA 1EY0A 3H3VI 2CKZB 5D65A 5CV5A 4RWSC 2WAQG 3GTJB 1J5EL 3NWTA 4X64Q 1ML0D 2Q8RE 4XYOA 1A62A 4DAPA 3V05A 3M4OH 4AQYQ 2E2JH 2ZT9C 1XJVA 1MIUA 2C35B 4HIOA 3CCLA 4F8MA 3OHXC 4GKJQ 3P7JA 3RN5A 4LJZC 1F9RA 2YV5A 4IUTA 3FPPA 5D14A 1HTPA 1CZWA 2NTTA 4KD3A 3DXJC 3UDXA 4OL7A 3QOJA 1N32L 1GJXA 3S2HH 4YCWA 3HOVG 1PFNA 5M3MG 5I2XA 2RCNA 1C9OA 1WVLA 3CC4A 1E7ZA 3DM1A 2HIVA 1M90C 1XXGA 4JI6Q 3TS2A 1IW7D 2JJQA 1MD2D 2KHJA 3UDFA 4LUVA 1HXYD 2KOLA 3I4NG 3J80i 4WORA 4JCVE 3S14H 5LMNQ 1GOZA 1KTKA 1NBWA 3A7LA 1GUOA 2CWPA 5CV8A 1EY4A 1HTLD 2N88A 4LAAA 4A3KB 1TR5A 4NXNQ 2PQAB 3BYTB 3D31A 4J6HA 4IPGA 5M5WH 3KBXA 2BOSA 4X62Q 1SJED 1Y8NB 2FXQA 1S4ZA 1K28A 4H13C 3CU7A 2NVXH 2D9UA 4B3ML 1D7QA 3U9SA 4G57A 1VQ7A 3E3XA 4DUYQ 5L37A 1UNSA 2B2VA 2MGSA 3J81L 1VQKA 1E2VA 4OELB 1Z6HA 5BR8L 3MXNA 3MXNB 3HZXA 5DEHA 4TKOB 4JI4L 3ONAB 5C0XH 3BDOA 1SEBD 4XIGS 2Z6KA 4A3BH 4XDXA 3QOLA 1KDCA 5C3WA 1W6KA 2BH2A 4J15A 4GNXA 2AQ3B 1HZBA 3AQQA 5M3MH 3OOCA 2ZTDA 5DLQE 1GKHA 5AFWA 5JEAG 2OTJA 1QZGA 4RH6A 2NN6G 1L0WA 4IQZA 3F8TA 3H91A 2R92B 4P75A 1XPRA 2XSCA 2FHTA 5E1FA 1VQ8A 2IX1A 5M3MB 3D3RA 1TY0A 2K1BA 3T1HL 3WOEA 1Q3LA 1D5XC 1S5BD 3MHBA 4DR4Q 4KLKA 3MVVA 3C1FA 3QWNA 3CKIB 3SR1A 5C0XJ 3J7YW 2EYPA 2YTYA 1I6HH 3K5OA 2VL6A 3DMUA 4DXFA 1YNNC 3I3CA 4IO9A 2K5DA 1PFSA 4JI2Q 2KHSA 1E22A 5ELCA 4HJ8A 5CC4A 1IBLL 4TQUS 3J7AV 4NKLA 2E2JB 1PRTF 3I90A 3M4QA 4DNRB 1MI2A 3LX0A 4HJAA 2JEAI 1PFMA 2B2TA 2A6EC 4KJOA 1PZJD 2VUMH 3S17B 2KJXA 1X3FA 3L7ZC 3S2DH 1PYBA 1DJRD 3TSSA 1MGSA 3CQZB 2JE6I 5ELBA 1VQAA 2PNHA 1BCPF 3MEFA 3P1HA 1STGA 3I56A 3TDQA 2RDHA 2K05A 1KC8C 2UXCL 2GVBA 2N49A 1KIXA 5IP9G 2UXDL 1TWAB 4P73A 2UXBL 4B9WA 2JA6B 5C4JH 4B3RL 1TS2A 1CTMA 5FLMG 3MEHA 1GUWA 4HEDA 1EYAA 2NZHA 2Q2HA 2K01A 3CW2C 1K8GA 1CSQA 1SROA 2Z1CA 3R93A 1NMFA 4WJ3M 3MWYW 4YCVA 1IL2A 1S5FD 5JJIA 1TS4A 5KYIA 3CQZH 3IAYA 3H3VC 1XWEA 1I4PA 4DR6L 2CH4W 2EXDA 2F0HA 1JORA 3HOXB 2IHEA 1YNXA 2I5MX 3C3LA 3Q8DA 4TSSA 1LTAD 1VQOA 2TMPA 2ALYB 1CFMA 1RKNA 4L5RC 3TP8A 2L12A 2F0NA 1GD7A 5C0XG 1IHZA 1N32Q 1S3OA 4LF4Q 2R93G 1TWFH 3S14B 1BOSA 1RL2A 5IODA 5FLXE 2AHOB 2CH4A 5HY6A 5JVG3 2CW0D 3VYSA 3JAMc 3K5NA 1MHWC 3WDNA 4R1JA 3J7AF 4AIMA 4XTCS 4DV5L 1WJJA 3MZ5A 3J7A5 3EJIA 3K7AB 4HIDA 3H0GG 3GTQH 1MJCA 1HR0W 3CP0A 1ICWA 4TVAB 1I4RA 1PXUA 4HIKA 1XX8A 2UXCQ 1Q8KA 2GVAA 4C3IB 3GTQB 1G2SA 4NXNL 2E76C 2ZM6Q 1LTSD 2PI2A 3OMGA 4C3IH 1ASYA 1TWCB 3K81C 3T13A 4H02A 2L15A 2FMCA 1STAA 3NBHB 1FNVA 3SK6A 4POFA 2XGTA 3PUXA 1WOCA 4DF7A 5C3EG 2UUBL 1HZCA 3FVQA 3PCOB 2VS1A 3F1ZA 2L0CA 1AEXA 4BY1G 2D2CC 1DGSA 5IWAQ 1BCPC 4JV5Q 4HIMA 4JPBW 2B2WC 1X65A 2R7FA 4C56C 5AJ3Q 4A3KG 4NP5A 1ESRA 1DXMA 1LLRD 3R8BA 3T16A 2F0FA 3UDIA 1N36Q 1FJGQ 5JJZA 3CCVA 3OSOA 3ZYYX 2CQOA 2OEOA 4FNFA 4A3DB 5EQ0A 2K5WA 1GHJA 5IGBA 5KYLA 3GTOB 1A8VA 4HMIA 1CKOA 2P5ZX 1N33Q 2I0QA 1MBYA 2PZUA 2V1CC 3KK7A 2NVYH 1Y1WG 2JA5B 3G6JB 3PO2G 2JA9A 3KJOA 2KENA 1CM9A 3H94A 5FLXc 4DR4L 4MIUA 4QUFA 1SNPA 5LMNL 1EQQA 1BO0A 1FGUA 4R4OA 2E8GA 4OHJA 3I4NH 1I6VC 3UDGA 4A3BG 3GDEA 3PF5A 4A3EG 5FJ8H 2FFKB 4GNXC 2L55A 1BXTA 2A69C 3A7AB 3TBIB 2QDLA 2UXDQ 4LFCQ 2PQEA 4FVMA 1K73C 1ET6A 2G9DA 3LWEA 3NHHA 4GZYC 2IT1A 5IYDH 3P20A 2UUCL 4B9XA 1VQ5A 3CXCA 5ISRA 4DR2L 5C5MA 4X64L 4JYAQ 4GOPC 2IWHA 5FK9C 1IZ6A 3HOXG 1A3VA 4XQNA 1BVSA 3K0YA 5CV6A 4FYDA 4FXKC 1OO9B 4K6LA 4A3MG 1GM5A 4ID6A 4A3JH 2B63H 1GUTA 4QL5A 1VMCA 3IFTA 1I4GA 1X54A 2F0LA 2K32A 3VA5A 1B9NA 1PTOD 1UE6A 4ODGA 4JI5Q 3CCQA 4H44C 2MJ8A 3F2CA 5E4XA 5I2YA 3MXGA 3EFXD 5JEAJ 1UWVA 3PUYA 3FDTA 3PO3H 5CV4A 1YI2A 1UEBA 2DY8A 4KI0A 1U4RA 1QE6A 1V9PA 2LS01 1KRSA 1WTHA 1B53A 1FD7D 4JI0Q 1CKNA 3T4AC 4CJ2C 2MPMA 4L5TA 1NE3A 2R92G 1TWHB 3ZJYC 3M3YH 3KF8B 1WD1A 4LUZA 5KRUA 4ZK9B 2PNRC 4K8IA 3OWEB 1XNQL 5M3FB 2PMZE 3M3YB 1CK1A 4BBSG 3C2PA 1IW7C 1AFPA 4CDDC 1LT5D 2N8NA 5EGTA 1ZKOA 5M3FH 4XYQA 2LXKA 1C8CA 2F03A 2HIXA 2IL8A 4FF2A 1W3SA 1Q86C 2B2TC 2ZXPA 1HH2P 3FMCA 2XWJB 1VF5C 1LTLA 2O2LD 5IYBG 2ZJQA 4NW2A 4B3SQ 3I4MG 2F0KA 4HJ7A 2F0MA 5BR8Q 1OXTA 3SXHA 2KEDA 4JI4Q 3VYTA 1CQVA 2JA6G 2HCIA 3S1RB 3CCUA 4L5SA 2A68D 4K8JA 3OWFA 2AWNA 1A3TA 2ZTEA 3GTPB 1EY5A 4LF8L 4A3GG 2K28A 1U4MA 5D3IB 1K0SA 2KCCA 3QR8A 2F52A 4KMUC 2QEXA 1XPOA 4NXMQ 3S16B 1PYSB 3S1QH 3HKZB 4KY6A 1B50A 4JK1C 2KCMA 4YY3Q 1PH9A 2UU9Q 1X3GA 4K5WA 4PZ6A 5F2DA 4JV5L 1EEFD 3AB9A 4OO1H 4AYBB 2BDOA 3KF8A 3MFGA 1E24A 1KAAA 4DK6C 5J3BA 4HR7B 2EJFC 1D6EC 1LYLA 1TXYA 3NEMA 3RLFA 2K5QA 3LNNA 3NBHA 1LTBD 3E0EA 1OXXK 4I7AA 4A3CG 3SK8A 3CCJA 4C1NK 4HCEA 2L1BA 1TVXA 2KHIA 5I9PA 4ALPA 1O7IA 5FO7B 1N33L 2JA8B 3EIVA 2M2LA 1OTCA 4KKSA 1B8AA 2GA4B 1PZKD 2B29A 1QG7A 2QDBA 2B8FA 1H9SA 1SLJA 1AZPA 1Y1VB 4XXEA 3ITPA 3OPOA 2A6ED 5IGGA 1N8RC 3ERQA 1SBBB 2E75C 1B3AA 5C44G 4K5VA 2VXWA 5DM73 2DJFC 4DPGA 4C3IG 2JA8H 2CW0C 2WB1E 3WWVA 3Q24A 1IBMQ 1STHA 2UUAL 4CKEA 4A3CH 1L2FA 2NZOA 4LK1C 1TKWB 5IE8A 3EBEA 5CBAE 3NK9A 1MSHA 3D0FA 2ES2A 3PGZA 4HAEA 3H0GH 4DR5L 2D62A 2RCFA 1WFQA 3T51B 2SNSA 2RDFA 3DUZA 3M4OB 1SAPA 2D0PA 3PO3B 4CGYB 5C6AA 2HCCA 1D2BA 2QA4A 1QWYA 2CCZA 2M9VA 2CFMA 2F0DA 2RSOA 1KXLA 1H9MA 1WTXA 1Z9FA 1VQCA 4DV7L 2DY7A 3KF6A 4DV3Q 4DK3C 3G6EA 4Y7NH 1RJTA 2EXZA 3NQIA 1D8LA 1EWCA 3MTSA 5EJWA 4LFAQ 4A4IA 5IYCG 1HFGA 1JJCB 4WRDA 1OXVA 5EPJA 2VZAA 3IL8A 3HKSA 4DV5Q 5IT9L 4DR1L 1FL0A 1VCIA 1Y1VG 1U9RA 1KNAA 4DV0L 5J22A 3NP8A 5C4HA 4G4KA 4QGUA 4ZCKA 1IYUA 3F2UA 3GTPH 4B3SL 1JICA 4K5XA 3CMAA 1DOLA 1CA5A 2RQXA 1HR0L 1M4VA 5T1GA 4WFN3 4O0AA 1SNCA 1TQOA 4JOIC 1I4QA 4OGQC 4LFBQ 4LF8Q 1FJGL 3H09A 4IURA 1LTGD 1X3QA 3S16H 3FKIG 2OF1A 3CC2A 2F0EA 3GTLB 2ID0A 1G8ZD 2HD3A 2OT2A 4UAIA 1R9TH 4FDBA 4DAMA 1WD0A 4GLAC 1LACA 1YNND 1H9JA 3IKJA 1EYGA 1PMRA 2QILA 2YTXA 4DV7Q 1STBA 2B8GA 4BA1I 3GV6A 1SYFA 4K6DA 4NMZA 5A2QE 5JVH3 2NBFA 4PV1C 4DXGA 3U50C 3L3OC 3CCEA 2CHBD 1E1OA 3HOXH 4H7BA 1Y1VH 2MNAA 3J80L 3QO2A 4KN7C 1Y69U 1PH1A 1EQVA 2LFNA 2UUCQ 1K9MC 4IFDI 4ZRZA 1MKHA 2OQKA 2E5LL 3TP7A 1VQEA 3S1MH 1EUJA 2Z4HA 2PI2E 4FXGC 4ZQ3A 2VB2X 4JI7L 1ILPA 1SYGA 4K2KA 3F2BA 1YBYA 2K33A 1PH6A 4EQ5A 3CF5A 2X6GA 3PO3G 4ABNA 1UE1A 4RGNA 5GQOA 3TN2A 1I6HB 5EPKA 1OXSC 3K5LA 3NTHA 4CBVA 1HNXL 2GN5A 4RKBA 2BE5D 3PIO3 4A93B 2WINB 3KUPA 4C3HB 2E2IB 2VW9A 1YEZA 4DK1A 1E0BA 1D1IA 1XTCD 5FLMH 1CUKA 1EQTA 3BYYB 1BF4A 1L1OB 3S1NB 3H15A 4XT1B 3GTGB 3T1YQ 1B4OA 4Q5VA 2PPBC 2J0TD 5CORA 4X66L 3OIPA 3ND9A 1JOQA 1O78A 2Y0SG 1UAPA 5CR3A 4PMWA 3GP7A 2HT1A 1J8IA 4NPSA 4RHSA 1ONLA 2ZJPA 4ME3A 1E3PA 4BA2I 3I7FA 3BVGA 2PQAA 4R9WA 1R9TB 5DM63 5E7NA 3VR3A 1U5KA 2KA7A 1JB7A 4O42A 1KAWA 3HOYB 4CDEC 1CT1D 2Z0SA 1G91A 1SYDA 1HPCA 5E3FA 1VDZA 4FF1A 3D6CA 1L0YB 4B3TQ 1K0RA 5IY0A 1L0XB 4ZKBB 2TSSA 1JB3A 2EYJA 2VNUD 3HS0C 2NTSA 3Q23A 2VB3X 4HJ5A 2G5DA 1A0IA 4DR7L 5IYDG 3X3MA 4J1MA 4CJ0B 2CVRA 3LGJA 3KF6B 2QKIC 1X56A 1K8AC 2UU9L 1WTWA 2J4XA 2KQ3A 2AUJD 3KBGA 5IIFA 4A3GH 2MFIA 5FJ8G 4X66Q 5C3EH 1I94Q 1S5DD 3M4YA 3HOVH 5G3LF 5JAVA 4A3EB 3RZOH 5EKLA 3U9OA 3CRLC 4WJWA 4DR3L 4MNOA 4QQBX 1SE8A 3S15B 1KHIA 3I4MH 3KLSX 1AZQA 1YNJD 2JA7B 1CSPA 1XMOL 3S15H 1F77A 1PRTB 1IKLA 3NQTA 1RF2D 1FNWA 5KIXA 4QMGA 1STYA 4IOAA 3H3VH 5JOBA 3TS0A 1AE2A 5C44B 3VA7A 4IFDJ 2HDLA 4JI8Q 2JQOA 4UY8C 5IGCA 3S1MB 2G9HD 3W3AA 3CD6A 1K3RA 1D1KA 2EQSA 1TU2B 2X6LA 5EAYA 3PIOA 4X3KA 4B3TL 1A6XA 4JI7Q 3IRBA 2XIWA 4IPHA 3HP3A 3A55A 1SE3A 4OWXB 3L9AX 1SRUA 5J1ZA 1RHPA 1TIID 3VYRA 4E6IA 4C3HH 1TY2A 3K7UC 1N9WA 1K8OA 1V43A 4CDFC 4CHTB 4QY7A 5ELDA 5FO9B 4XQJA 3W1GA 3HEJA 4G7ZC 3PIPA 1T5EA 2A73B 3HOZB 4LNQA 3CPWA 4J8QA 1GVPA 3A8KE 1B1ZA 1Y8PB 4BY7H 5KNCA 1Q90A 2B2WA 2K14A 4AYBG 3N52A 3MFYA 3NXWA 3TZUA 3IFDA 2F1MA 3F2DA 4G7HC 4A3MB 4UP8A 4HTHA 3C46A 4ZLTF 4HSPA 4BS9A 2Z4IA 2A8VA 1PYWD 2F0SA 1VQJA 4A3MH 4DV3L 4F7XA 4LFBL 1L1OC 2Q2TA 1EIHA 3JAME 3V96A 1WCMG 1SDFA 2R6GA 3GQBA 2B2VC 5DAUA 1BCPB 1KLGD 3NSWA 1LT3D 1RD9D 3RLNA 3PSIA 1LM0A 2Z8LA 2RSNA 4B08A 5M5WB 3M7NA 4UP9A 2I46A 2SOBA 4RGMA 5C4JB 1VQ9A 1EY8A 3WOFA 3NTIA 4JVZA 4X3TA 1TT2A 3FKIH 1B3QA 4ULLA 5EBDA 3HRZC 5M5XB 1HNWL 1YHAA 2WAQE 4DFAA 3D6WA 3SEBA 2K50A 3K6OA 2UUBQ 1NY4A 1GUSA 2ZTCA 3GD7A 2C9OA 5CYUA 2N55A 4LF9L 1I50H 3A8JE 4KV6A 4ILWA 4K0KQ 2A68C 4BBRH 4B3MQ 4DR7Q 1VS0A 1QVCA 5C4XB 2HUGA 4FF4A 5IT9E 1A2TA 1I50B 3M7GA 4DNTB 1X32A 2YTVA 2UXBQ 2H1EA 2O4XA 2B2YC 2E5LQ 2IX0A 5FO8B 5A2QL 4JI3Q 1VQNA 2IX3A 3I4MB 4JI5L 1LABA 3O13A 1QB5D 2EJGC 2FINB 2JA8G 5BN5A 2NN6H 3E5SA 3RZDH 4UP7A 3PV0A 1Q81C 2ATWA 4YHHL 3BVMA 2EDGA 3Q6SA 1SNOA 4LF5Q 2LKVA 1AW7A 3OIQA 1S72A 2CWAA 2MQHA 3DM3A 4PNYA 5HURA 2R61A 3H6MA 4BWGB 4EQPA 5NUCA 3VR4A 3M85A 2OTLA 2DNEA 4DV4Q 4OWTB 4DV1Q 2ASBA 2OXPA 4KK7A 1H9RA 1HQRD 3D8GA 4N9PA 4IUPA 3TMEA 3E9IA 3ER0A 5IGEA 4KY5A 4C3JH 3T1HQ 1QVGA 1EYCA 4A3LH 1I94L 4DV2L 3GO5A 4X3SA 3TP5A 5KGUA 4RHRA 4F88A 3HOUG 1PFBA 5IP7G 1V1QA 1K83H 1W6JA 5T1IA 3HOUH 4JW0A 5A35A 1RTNA 1K83B 2E74C 2JSOA 1AP0A 1F9SA 2E2DC 4P71A 3BZCA 1A2UA 3VYUA 2EYLA 5LMUL 1KRTA 3S9WA 3DWAA 3NBIA 3RLOA 1DM0B 3SK5A 4JI8L 1JE5A 2J7ZA 4KY7A 2OWOA 1QNUA 2ZM6L 2N3SA 3K57A 2EYHA 1HHVA 4DN4M 1HQMC 2F0QA 2XN9C 5TSSA 2E2HH 1SN8A 4RCOA 3N6RA 1F9QA 4IOCA 4LF5L 3S24A 1KQSA 2WKCA 2NVTH 3VDYA 1A63A 4GNXB 4EQNA 3L2PA 2QCPX 1II3A 3SHLA 1Y8OB 2DNCA 5GADC 4A3DG 3URYA 3CCMA 1X9NA 4MZ9A 1PLFA 3NPPA 4IUVA 2X69A 1QVFA 2F0VA 2EY6A 1YIJA 4KKTA 4BBRG 4QJFA 3QG1A 1Q12A 4GOPB 1T9HA 3NUCA 1XNQQ 4BY1B 1BQQT 3HOYH 4Y52H 1KABA 3PF4A 1JOKA 4YY3L 1F9PA 3EA6A 3HKZE 5BN4A 1SXTA 2EOTA 1EFID 1JQYD 2XNAC 5C4XH 1C0AA 1HUNA 1J6QA 2KEEA 3W2DA 3RUZA 5I6YA 1SR3A 4KJNA 3W5OA 5I6WA 1EQRA 2I07B 1ZYRD 1JWMD 1YJ9A 4R4CA 5JJLA 2A5HA 1NUCA 2F0TA 2PW7A 1TWGB 1WTOA 3I2ZA 2RDGA 2BA0A 1JMCA 1IYJB 3CHBD 1PV4A 4A3FB 3BG3A 2H5XA 3CCRA 2SDFA 2DGYA 4OIJA 1HA5A 4RGOS 3GV3A 4OO1G 1BUVT 4ZKCB 1SNQA 1JWSD 2B2UA 4FF3A 3ICEA 2NZ1D 4DV6Q 4BBSH 2Y0SB 4OIKA 3K7AH 3BDCA 4NXML 1TWGH 5C0XI 3KLWA 1EY9A 3V2TA 3VR2A 2A6HD 1X3PA 4HCSA
chains in the Genus database with same CATH topology
1PRTD 4IZ8A 2A69D 3NE5B 1S5CD 2ICIA 3PIP3 5EKKA 3UI2A 2RVLA 2EJMA 2JXMB 2D5DA 5FLXL 1SNMA 4S3SA 3I91A 3BS1A 3I72A 4IALA 1BDOA 4XQQA 1DD2A 1DOKA 4Z9CB 1EYDA 2ICEC 2EY2A 3HOWB 2NVYB 4EQOA 1CI3M 2AQ2B 3S2HB 2E2HB 2WKDA 5EPLA 1HFNA 5IGDA 2FJ2A 3S2DB 3I4NB 1F2MA 1BCPD 2R7ZB 5LL6X 1DZ1A 3EQLC 4MHEA 1KLUD 3C1EA 1RDPD 1LT6D 1B2TA 2F4IA 1M8AA 3HOVB 4O1NA 1O80A 1U4LA 2Q8IB 1GUNA 5C4ZA 1STNA 1FR3A 2BE5C 1Q1BA 5C3EB 2WV6D 2QF7A 5CV7A 3Q22A 1QOHA 4FXDA 2F3VA 4IFDH 1B44D 5E4WC 3KLSA 4HSVA 5K5PA 3R3OA 2L11A 3MA2B 3H0GB 3PUZA 3T53B 4C3JG 3VR5A 2F0JA 2XRSD 1FGBD 4ME5A 4NDXA 4A3BB 4BY7B 3I73A 4C3JB 4I7ZC 3CRKC 4N9TA 1QNKA 2PZTA 3HOUB 4M1UB 4IFDG 1S5ED 2ENBA 3A54A 2EYOA 3EROA 3G7LA 3I4LA 3I70A 4BBSB 2F3WA 4HN7A 1WTQA 1EWHA 3BZDB 4UDUC 3FPUB 2QEJC 2PCFB 4QIWB 1VF7A 2EYFA 5K36H 2FMMA 2MUYA 1JWUD 4DAVA 2M00A 1CA6A 2EY5A 1DOMA 3A8IE 1QILA 2EZVA 1I4HA 2ZXOA 1QJOA 1AN8A 2NVTB 2LY7A 4PMCA 4ZAIA 3FKIB 1V8QA 4DAYA 5HGTA 4JBWA 1SNDA 2Q8TA 5CGKA 3K5MA 5D3DA 4CKBA 2PMZB 5LL6S 3FRPB 2F0WA 4TRDA 2WIIB 2NVXB 2K7VA 2PO4A 4YIJA 2EY1A 1Q8IA 2DN8A 4IUQA 2PYKA 5KNBA 1F2ZA 2L4NA 2IJ0A 1SE4A 3PO2B 1EIGA 4RA8A 5K36G 4RFBA 1GXDC 2V4DA 1HCZA 3DHQA 5ELFA 2YYZA 2AWOA 2MHVA 1SE2A 1EU4A 2MP1A 1SFOB 1B9MA 1FNUA 3J81E 4R8NA 4V0BA 3RZDB 4DGZA 4FP5D 5J39A 2F0PA 2SEBD 4C2MB 4DU9A 1C48A 3DEOA 1PDQA 1BR9A 2F0GA 5ELEA 1EY6A 2AQ1B 5CV9A 1NSNS 1LO5D 1NR2A 5I4DA 2BA1A 4G7OC 2HQEA 2R3ZA 1A15A 1RCVD 1NAPA 1LTRD 3D4RA 3PUVA 4Y7NB 4CJ1B 1SMYD 3K59A 4KHVA 1PTOC 1ESFA 5C3XA 3JAML 3K58A 3D4WA 2IPKD 1VMPA 3J80E 5JPMC 3HG9A 3NWSA 3D4DA 1GUGA 5LHY1 2O5JC 3S1QB 4L8JA 2L5TA 2F0UA 3E0JA 3SE0A 1R4QB 1BNZA 2R93B 1SYEA 1Z7TA 1WTRA 2CQAA 2SNMA 4FO2A 1HRJA 3GTMB 1J9OA 1XYIA 1WTPA 1I4XA 2NUCA 1ENCA 1YNJC 4IN3A 3SDZA 2A6HC 2PW5A 3MXUA 5I9OA 4A3GB 3BDLA 2K04A 3RD4A 2ZXRA 3TP6A 1V1PB 3R2TA 1IKMA 4QF4A 1O7ZA 4CKCA 3P75A 2LMCB 2KECA 1JCKB 3MC0B 3PUWA 2XRQD 4KTAA 5BN3A 3Q0AA 1EZ8A 4F87A 3GTKB 3RZOB 2NB0A 2IW3A 4IUUA 4KKUA 1K8MA 1LTID 4P2CB 1GHKA 1F2LA 1EOTA 2NN6I 3BVZA 4EGVA 2XVSA 1OXUA 1JR0D 1H9SB 2F0OA 3PMFA 1ENFA 1STEA 1FYCA 1F2YA 4K2LA 3RMHA 4KHZA 3DWPA 4RKLA 3MXPA 3OMCA 1HUMA 1ZEQX 1E2ZA 3A56A 5JPNC 3AMUA 3R2IA 2EYMA 1LT4D 4C3HG 1SYBA 3NTKA 2JEBI 3E6ZX 2K03A 4M8AA 2AUKA 1PRTC 2KUMA 4XT3B 3VR6A 3HGBA 5KEEA 1H9KA 1TS3A 5KNDA 4L63B 2BDNA 1TWFB 1PTOF 2B2YA 5FKAC 1NR4A 1DCZA 1Q1EA 1JOOA 1ET9A 3LWUA 4ZYSA 4A3IB 2KCNA 1JC7A 1MSGA 3DEPA 5DNFA 1DONA 4HMJA 2WB1B 1CQFA 3I8ZA 4RCNA 4QCLA 1ILQA 2HDMA 4ZUJA 1DYQA 3QB3A 1D5MC 4MN3A 5C5LA 4EVOA 1EL0A 1EU3A 1E2WA 5COYA 4QB4A 1O7YA 2BCOA 4LMQD 3QJYA 1I3QB 1UEAB 4Q0FA 5EBCA 1KDBA 1NCVA 3SK4A 4PQXA 5IOCA 1G2TA 2RA4A 4RAUC 1ENAA 4DA2A 4I65A 2RBMA 3T56B 2C5CA 1CHQD 3OW7A 1LV9A 3DWQA 1V1PA 1V1OA 4KD4A 3ND8A 5M9OA 5IGFA 1WCMB 2VUMB 2B2UC 3FEWX 1CHPD 1IYVA 3AU7A 4K14A 1HA6A 1KNEA 1Y1WB 1ZYRC 2XWBB 1LTTD 4R8IA 3QIAA 3MAQA 2L9HA 4U68A 2F0IA 1SJHD 1C4QA 4A3JB 2B63B 4DK0A 1RTOA 5G3LD 1EY7A 3X3NA 5FOBB 4BBRB 3TZDA 1SMYC 4V190 2JP1A 1EZ6A 2H4OA 3KLRA 2RKSA 2YU9B 1SSOA 2NVQB 1R4PB 5CBEE 1JE4A 1KDAA 1WTVA 4C1NI 2WP8J 3SVMA 2WAQB 2KVMA 4KN4C 2JYOA 4RGTA 5EKIA 1A3UA 2NWGA 1Z47A 4U673 5M5YB 1PTOB 1D5ZC 2PZWA 1IL8A 4ZUIA 1G6ZA 1QCBD 1G291 2O5IC 1EEID 4IUNA 2EPBA 2NYZD 4H0LC 5JEAH 1PTOH 1BBXC 1SYCA 1UUPA 4QUCA 1T5XD 1TS5A 1ZXTA 2WACA 1PZID 4PMBA 1CZGA 2K6AA 5CMDA 4X3UA 2B39A 2A74C 3EVQA 1RODA 2EVBA 4L6TB 1U4PA 2EE1A 1O7LA 4OO1I 1EY0A 5D65A 5CV5A 4RWSC 3GTJB 3NWTA 1ML0D 2Q8RE 4XYOA 4DAPA 3V05A 2ZT9C 4F8MA 3OHXC 3P7JA 4LJZC 1F9RA 5D14A 4IUTA 3FPPA 1HTPA 1CZWA 2NTTA 4KD3A 3DXJC 4OL7A 3QOJA 1GJXA 1PFNA 5I2XA 1WVLA 3DM1A 1XXGA 1IW7D 1MD2D 1HXYD 2KOLA 4WORA 1GOZA 1KTKA 3A7LA 1GUOA 5CV8A 1EY4A 1HTLD 2N88A 4LAAA 4A3KB 1TR5A 3BYTB 3D31A 4J6HA 3KBXA 2BOSA 1SJED 1Y8NB 1S4ZA 4H13C 3CU7A 2D9UA 3U9SA 4G57A 1UNSA 2B2VA 2MGSA 3J81L 1E2VA 1Z6HA 3MXNA 3HZXA 5DEHA 4TKOB 3ONAB 5C0XH 3BDOA 1SEBD 4XIGS 4XDXA 3QOLA 1KDCA 5C3WA 1W6KA 2AQ3B 3OOCA 5AFWA 5JEAG 4RH6A 2NN6G 4IQZA 3H91A 2R92B 2XSCA 2FHTA 5E1FA 2IX1A 5M3MB 3D3RA 1TY0A 2K1BA 3WOEA 1Q3LA 1D5XC 1S5BD 3MHBA 3MVVA 3C1FA 3QWNA 3CKIB 3SR1A 5C0XJ 3J7YW 2EYPA 3K5OA 3DMUA 4DXFA 1YNNC 3I3CA 2K5DA 2KHSA 5ELCA 5CC4A 4TQUS 3J7AV 4NKLA 2E2JB 1PRTF 3I90A 4DNRB 2JEAI 1MI2A 3LX0A 1PFMA 2B2TA 2A6EC 4KJOA 1PZJD 3S17B 2KJXA 3L7ZC 1DJRD 3TSSA 1MGSA 3CQZB 2JE6I 5ELBA 1BCPF 3P1HA 1STGA 3TDQA 2RDHA 2K05A 1TWAB 4B9WA 2JA6B 1TS2A 1CTMA 3MEHA 1GUWA 4HEDA 1EYAA 2K01A 2Z1CA 3R93A 3MWYW 1S5FD 1TS4A 5KYIA 3IAYA 3H3VC 1XWEA 1I4PA 2F0HA 1JORA 3HOXB 3C3LA 4TSSA 1LTAD 2TMPA 1CFMA 1RKNA 3TP8A 2L12A 2F0NA 5C0XG 1IHZA 3S14B 1BOSA 5IODA 5FLXE 5JVG3 2CW0D 3VYSA 3K5NA 3WDNA 3J7AF 4XTCS 3MZ5A 3EJIA 3K7AB 1ICWA 1I4RA 1PXUA 1XX8A 4C3IB 3GTQB 1G2SA 2E76C 1LTSD 3OMGA 1TWCB 3T13A 2FMCA 1STAA 1FNVA 3SK6A 3PUXA 4DF7A 3FVQA 2L0CA 1AEXA 2D2CC 1BCPC 2B2WC 4C56C 4NP5A 1ESRA 1DXMA 1LLRD 3R8BA 3T16A 2F0FA 5JJZA 3OSOA 3ZYYX 2OEOA 4FNFA 4A3DB 5EQ0A 2K5WA 1GHJA 5IGBA 5KYLA 3GTOB 4HMIA 1MBYA 2PZUA 3KK7A 2JA5B 3G6JB 1CM9A 3H94A 4MIUA 4QUFA 1SNPA 1BO0A 4OHJA 1I6VC 2FFKB 2L55A 1BXTA 2A69C 3A7AB 3TBIB 2PQEA 4FVMA 1ET6A 2G9DA 3LWEA 3NHHA 4GZYC 2IT1A 3P20A 4B9XA 5ISRA 5C5MA 2IWHA 5FK9C 1A3VA 4XQNA 3K0YA 5CV6A 4FYDA 4FXKC 1OO9B 4K6LA 4ID6A 1GUTA 1VMCA 3IFTA 1I4GA 2K32A 2F0LA 3VA5A 1B9NA 1PTOD 4ODGA 4H44C 2MJ8A 5E4XA 5I2YA 3MXGA 3EFXD 5JEAJ 3PUYA 3FDTA 5CV4A 2DY8A 4KI0A 1U4RA 1QE6A 2LS01 1B53A 1FD7D 3T4AC 4CJ2C 2MPMA 1TWHB 1WD1A 5KRUA 4ZK9B 2PNRC 4K8IA 3OWEB 5M3FB 3M3YB 1CK1A 3C2PA 1IW7C 1AFPA 1LT5D 5EGTA 1ZKOA 4XYQA 1C8CA 2F03A 2IL8A 4FF2A 2B2TC 2ZXPA 3FMCA 2XWJB 1VF5C 2O2LD 4NW2A 2F0KA 2F0MA 1OXTA 3SXHA 2KEDA 3VYTA 1CQVA 2HCIA 3S1RB 2A68D 4K8JA 3OWFA 2AWNA 1A3TA 3GTPB 1EY5A 2K28A 1U4MA 5D3IB 2KCCA 4KMUC 3S16B 3HKZB 4KY6A 1B50A 4JK1C 4K5WA 5F2DA 1EEFD 3AB9A 4OO1H 4AYBB 2BDOA 3KF8A 3MFGA 1KAAA 4HR7B 2EJFC 1D6EC 3RLFA 2K5QA 3LNNA 3NBHA 1LTBD 1OXXK 3SK8A 4C1NK 4HCEA 2L1BA 1TVXA 5I9PA 5FO7B 2JA8B 2M2LA 4KKSA 2GA4B 1PZKD 2QDBA 1QG7A 2B8FA 1H9SA 1AZPA 1Y1VB 4XXEA 3ITPA 3OPOA 2A6ED 5IGGA 3ERQA 1SBBB 2E75C 1B3AA 4K5VA 2VXWA 5DM73 4C3IG 2CW0C 3Q24A 1STHA 4CKEA 4LK1C 1TKWB 5CBAE 3NK9A 1MSHA 4HAEA 2D62A 3T51B 2SNSA 2RDFA 3DUZA 3M4OB 1SAPA 3PO3B 4CGYB 5C6AA 2HCCA 1D2BA 1QWYA 2M9VA 2F0DA 2RSOA 1H9MA 1WTXA 2DY7A 1RJTA 2EXZA 3NQIA 1EWCA 3MTSA 5EJWA 1HFGA 4WRDA 1OXVA 5EPJA 3IL8A 5IT9L 1VCIA 1U9RA 1KNAA 5J22A 3NP8A 5C4HA 4G4KA 1IYUA 3F2UA 1JICA 4K5XA 1DOLA 1CA5A 2RQXA 1M4VA 5T1GA 4WFN3 1SNCA 1TQOA 1I4QA 4OGQC 3H09A 4IURA 1LTGD 1X3QA 2OF1A 3GTLB 2F0EA 2ID0A 1G8ZD 2OT2A 4UAIA 1WD0A 1LACA 1YNND 1H9JA 3IKJA 1PMRA 2QILA 1STBA 2B8GA 4BA1I 3GV6A 1SYFA 4K6DA 4NMZA 5A2QE 5JVH3 2NBFA 4PV1C 4DXGA 3L3OC 2CHBD 4H7BA 3J80L 3QO2A 4KN7C 1Y69U 1EQVA 2LFNA 4IFDI 4ZRZA 3TP7A 2Z4HA 4FXGC 4ZQ3A 1ILPA 2VB2X 1SYGA 4K2KA 2K33A 2X6GA 4ABNA 4RGNA 3TN2A 1I6HB 5EPKA 1OXSC 3K5LA 3NTHA 4CBVA 4RKBA 2BE5D 3PIO3 4A93B 2WINB 3KUPA 4C3HB 2E2IB 4DK1A 1E0BA 1D1IA 1XTCD 1EQTA 3BYYB 1BF4A 3S1NB 4XT1B 3GTGB 1B4OA 4Q5VA 2PPBC 2J0TD 5CORA 3OIPA 3ND9A 1JOQA 1O78A 1UAPA 5CR3A 4PMWA 3GP7A 1J8IA 4RHSA 1ONLA 4BA2I 4R9WA 3BVGA 1R9TB 5DM63 3VR3A 2KA7A 4O42A 3HOYB 1CT1D 1G91A 1SYDA 1HPCA 5E3FA 1VDZA 4FF1A 3D6CA 1L0YB 1L0XB 4ZKBB 2TSSA 1JB3A 2EYJA 2VNUD 3HS0C 3Q23A 2NTSA 2VB3X 3X3MA 4J1MA 4CJ0B 2CVRA 2QKIC 1WTWA 2J4XA 2KQ3A 2AUJD 3KBGA 5IIFA 1S5DD 3M4YA 5G3LF 5JAVA 4A3EB 5EKLA 3U9OA 3CRLC 4WJWA 3S15B 3KLSX 1AZQA 1YNJD 2JA7B 1F77A 1PRTB 1IKLA 3NQTA 1RF2D 1FNWA 5KIXA 4QMGA 1STYA 5JOBA 5C44B 3VA7A 4IFDJ 2HDLA 5IGCA 3S1MB 2G9HD 3W3AA 1D1KA 2X6LA 1TU2B 1A6XA 4X3KA 2XIWA 3HP3A 3A55A 1SE3A 3L9AX 5J1ZA 1RHPA 1TIID 3VYRA 4E6IA 1TY2A 1K8OA 1V43A 4CHTB 5ELDA 5FO9B 4XQJA 3HEJA 4G7ZC 1T5EA 2A73B 3HOZB 4J8QA 3A8KE 1B1ZA 1Y8PB 5KNCA 1Q90A 2B2WA 3N52A 3MFYA 3NXWA 3TZUA 3IFDA 2F1MA 4G7HC 4A3MB 4HTHA 3C46A 4ZLTF 4HSPA 4BS9A 2Z4IA 1PYWD 2F0SA 4F7XA 1EIHA 3JAME 3V96A 1SDFA 2R6GA 3GQBA 2B2VC 5DAUA 1BCPB 1KLGD 3NSWA 1LT3D 1RD9D 2Z8LA 2RSNA 4B08A 5M5WB 3M7NA 5C4JB 2I46A 2SOBA 4RGMA 1EY8A 3WOFA 3NTIA 4X3TA 1TT2A 4ULLA 5EBDA 3HRZC 5M5XB 4DFAA 3D6WA 3SEBA 3K6OA 1GUSA 3GD7A 2C9OA 5CYUA 2N55A 3A8JE 4KV6A 4ILWA 2A68C 5C4XB 2HUGA 4FF4A 5IT9E 1A2TA 1I50B 3M7GA 4DNTB 1X32A 2H1EA 2O4XA 2B2YC 2IX0A 5FO8B 5A2QL 3I4MB 2IX3A 1LABA 3O13A 1QB5D 2EJGC 2FINB 5BN5A 2NN6H 3E5SA 3PV0A 3BVMA 2EDGA 3Q6SA 1SNOA 2LKVA 1AW7A 3OIQA 4PNYA 5HURA 2R61A 3H6MA 4EQPA 4BWGB 5NUCA 3VR4A 3M85A 2DNEA 2OXPA 4KK7A 1H9RA 1HQRD 3D8GA 4N9PA 4IUPA 3TMEA 5IGEA 4KY5A 1EYCA 3GO5A 4X3SA 5KGUA 3TP5A 4RHRA 4F88A 1PFBA 1W6JA 5T1IA 5A35A 1RTNA 1K83B 2E74C 2JSOA 1AP0A 1F9SA 2E2DC 1A2UA 3VYUA 2EYLA 3S9WA 3DWAA 3NBIA 1DM0B 3SK5A 2J7ZA 4KY7A 1QNUA 3K57A 2EYHA 1HHVA 4DN4M 1HQMC 2F0QA 2XN9C 5TSSA 4RCOA 3N6RA 1F9QA 2WKCA 4EQNA 2QCPX 1II3A 3SHLA 1Y8OB 2DNCA 3URYA 1PLFA 3NPPA 4IUVA 2X69A 2F0VA 2EY6A 4KKTA 3QG1A 1Q12A 3NUCA 4BY1B 1BQQT 1KABA 1JOKA 1F9PA 3EA6A 5BN4A 1SXTA 2EOTA 1EFID 1JQYD 2XNAC 1HUNA 2KEEA 3W2DA 3RUZA 5I6YA 4KJNA 5I6WA 2I07B 1ZYRD 1JWMD 2A5HA 1NUCA 2F0TA 2PW7A 1TWGB 1WTOA 2RDGA 2BA0A 3CHBD 4A3FB 3BG3A 2SDFA 1HA5A 4OIJA 4RGOS 3GV3A 4OO1G 1BUVT 4ZKCB 1SNQA 1JWSD 2B2UA 4FF3A 2NZ1D 2Y0SB 4OIKA 3BDCA 5C0XI 1EY9A 3V2TA 3VR2A 2A6HD 1X3PA 4HCSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WTR A;  2J7Z A;  1BBX C;  2RSN A;  2KED A;  2RSO A;  4QUC A;  4IUQ A;  1ZXT A;  3ONA B;  1HRJ A;  1WTX A;  2HCI A;  1ILP A;  1LV9 A;  2DY7 A;  2FFK B;  4XDX A;  1J9O A;  4X3T A;  5CMD A;  4X3U A;  1XYI A;  1WTP A;  3UI2 A;  1HHV A;  2L4N A;  2RVL A;  4DN4 M;  2L12 A;  1RJT A;  1ROD A;  2K28 A;  1F9Q A;  3I91 A;  1U4M A;  1U4P A;  3MTS A;  2X6G A;  5EJW A;  2K03 A;  1EIG A;  2EE1 A;  3D6W A;  4RA8 A;  3TN2 A;  2KUM A;  1HFG A;  5AFW A;  3LWE A;  1B50 A;  2K04 A;  4XT3 B;  5EPK A;  1QNK A;  5EPJ A;  1AZQ A;  1DOK A;  5D65 A;  2B2U C;  3H91 A;  3IL8 A;  4RWS C;  1PLF A;  2N55 A;  1ML0 D;  2MP1 A;  2Q8R E;  2FHT A;  1KNA A;  4IUV A;  2X69 A;  3KUP A;  1IKL A;  3G7L A;  1IKM A;  1KNE A;  1HA6 A;  2BDN A;  2K1B A;  2HUG A;  1Q3L A;  1E0B A;  1O7Z A;  3F2U A;  1EQT A;  1ICW A;  4R8I A;  1BF4 A;  2KEC A;  1JIC A;  1WTQ A;  1XX8 A;  2B2Y A;  2HDL A;  1DOL A;  1NR4 A;  1X32 A;  1CA5 A;  1VMC A;  5EPL A;  2H1E A;  1HFN A;  2B2Y C;  4XT1 B;  1G2S A;  1B4O A;  2L9H A;  3FPU B;  5T1G A;  2FJ2 A;  3P7J A;  2X6L A;  2L1B A;  1F9R A;  1TVX A;  2FIN B;  4IUT A;  2MJ8 A;  4U68 A;  4X3K A;  5COR A;  5D14 A;  5E4X A;  1F9P A;  2XIW A;  3HP3 A;  3I3C A;  3DEO A;  1MSG A;  1PDQ A;  3DEP A;  5DNF A;  2M2L A;  1DON A;  1DZ1 A;  3Q6S A;  4MHE A;  1QG7 A;  1RTO A;  3FDT A;  1RHP A;  1PFN A;  1X3Q A;  2EOT A;  4IUR A;  4IUU A;  2FMM A;  2DY8 A;  1WVL A;  1AZP A;  3I90 A;  1J8I A;  1HUN A;  3I8Z A;  1MI2 A;  1B2T A;  1PFM A;  2B2T A;  2KEE A;  1U4R A;  1QE6 A;  3DM1 A;  1F2L A;  1M8A A;  1EOT A;  4UAI A;  1O80 A;  1U4L A;  1CA6 A;  1B53 A;  4R9W A;  3TZD A;  1WD0 A;  1NR2 A;  4IUP A;  1ILQ A;  2HDM A;  1DOM A;  2KOL A;  2JP1 A;  1B3A A;  2VXW A;  2R3Z A;  2MPM A;  1MGS A;  4CJ2 C;  2B2W C;  1SSO A;  4O42 A;  1WTO A;  1A15 A;  4MN3 A;  5CBE E;  1JE4 A;  1ESR A;  1NAP A;  2B2W A;  1WTV A;  2K05 A;  1WD1 A;  3N52 A;  4ZAI A;  1G91 A;  4X3S A;  1EL0 A;  3IFD A;  4NW2 A;  4CJ1 B;  4ZK9 B;  5JJZ A;  3GV6 A;  3SVM A;  2KVM A;  5COY A;  2N88 A;  1O7Y A;  1PFB A;  4ZLT F;  2SDF A;  2JYO A;  5EQ0 A;  2Q8T A;  1GUW A;  3KBX A;  4HED A;  1VMP A;  4LMQ D;  2NWG A;  3GV3 A;  4OIJ A;  5EKI A;  4ZKB B;  5CBA E;  2K01 A;  1MSH A;  5T1I A;  3R93 A;  4ZKC B;  1C8C A;  3MWY W;  4HAE A;  1EIH A;  1RTN A;  1NCV A;  2B2U A;  1WTW A;  5E4W C;  2NZ1 D;  1G2T A;  2IL8 A;  1AP0 A;  1S4Z A;  1IL8 A;  1G6Z A;  1SDF A;  4OIK A;  1F9S A;  2D9U A;  2RA4 A;  4RAU C;  3QO2 A;  2B2T C;  1HUM A;  2CVR A;  2B2V C;  4HSV A;  4CJ0 B;  1SAP A;  1CM9 A;  2L11 A;  1BNZ A;  2B2V A;  2HCC A;  2EPB A;  2MGS A;  1X3P A;  4HCS A;  4QUF A;  2NYZ D;  1BO0 A; 
#chains in the Genus database with same CATH topology
 4KHP L;  1PRT D;  4IZ8 A;  2A69 D;  4PZ7 A;  3NE5 B;  4JI3 L;  1S5C D;  2ICI A;  3PIP 3;  2JA7 G;  3STB C;  2VUM G;  5EKK A;  3UI2 A;  2RVL A;  3A5Z B;  2EJM A;  2JXM B;  2D5D A;  4YHH Q;  5FLX L;  1SNM A;  2QW7 A;  4S3S A;  4DR5 Q;  3I91 A;  3BS1 A;  3I72 A;  4IAL A;  1BDO A;  2K4K A;  1XMQ Q;  3U4Z A;  4XQQ A;  1DD2 A;  3GTG H;  1S40 A;  2D0O A;  1DOK A;  4X62 L;  4Z9C B;  1N34 Q;  3EN2 A;  1U0L A;  1WCM H;  4DNI A;  4JC0 A;  1EYD A;  1X3E A;  4MTK A;  4GKK Q;  2ICE C;  2EY2 A;  3HOW B;  2NVY B;  1TWA H;  4EQO A;  1CI3 M;  2AQ2 B;  3AFP A;  3J81 c;  3S2H B;  1I5F A;  2E2H B;  2WKD A;  5EPL A;  1HFN A;  5IGD A;  5ELN A;  1PH7 A;  4A3D H;  2FJ2 A;  1VQ4 A;  3I4N B;  3S2D B;  1F2M A;  2KBN A;  4POG A;  1BCP D;  2R7Z B;  5LL6 X;  1DZ1 A;  3EQL C;  4MHE A;  2QGQ A;  1KLU D;  3C1E A;  1RDP D;  1LT6 D;  1B2T A;  2F4I A;  4R4Q A;  4DV4 L;  1M8A A;  3HOV B;  4O1N A;  4DR6 Q;  1O80 A;  1U4L A;  3HOW G;  2B3G A;  2Q8I B;  1J5E Q;  1GUN A;  1H95 A;  5C4Z A;  4OON A;  1VQH A;  1STN A;  1FR3 A;  2BE5 C;  2IHF A;  2VQF L;  3AFQ A;  1Q1B A;  2AKW B;  3W1B A;  5C3E B;  3OTO L;  2WV6 D;  4LF7 Q;  3GTK H;  2QF7 A;  5CV7 A;  3TQY A;  1YIT A;  3Q22 A;  1QOH A;  4EX5 A;  1XMQ L;  1PHJ A;  4FXD A;  2F3V A;  4IFD H;  1B44 D;  2Q2I A;  4DUZ L;  4DAY B;  5E4W C;  1K3B C;  1YVC A;  1HNW Q;  1QUQ A;  3KLS A;  1IBL Q;  4HSV A;  1EIF A;  3BJU A;  5K5P A;  3R3O A;  2L11 A;  4A3F H;  4DV2 Q;  3MA2 B;  3H0G B;  3PUZ A;  1EFW A;  1CKN B;  3T53 B;  4C3J G;  3VR5 A;  2F0J A;  2XRS D;  1XNR Q;  1PH5 A;  1FGB D;  1FVI A;  1GO3 E;  1X55 A;  4ME5 A;  4NDX A;  5JJK A;  1LUZ A;  1AH9 A;  1PH2 A;  4A3B B;  3PQI A;  4BY7 B;  1EWI A;  3I73 A;  4A3F G;  2Z9H A;  4LUO A;  4C3J B;  4I7Z C;  3CRK C;  4N9T A;  1QNK A;  2PZT A;  4L5Q A;  2OCE A;  3HOU B;  4LF9 Q;  4M1U B;  4IFD G;  1S5E D;  2ENB A;  3A54 A;  5IWA L;  1L1O A;  4DV0 Q;  2EYO A;  3ERO A;  3G7L A;  2MO1 A;  5ELO A;  1WI5 A;  3I4L A;  3I70 A;  3AEV A;  4BBS B;  3JC6 6;  2F3W A;  3I4O A;  4HN7 A;  1WTQ A;  1EWH A;  1N36 L;  3BZD B;  3K8A A;  2Y0S E;  4B3R Q;  4UDU C;  3FPU B;  1Q46 A;  4OX9 L;  2QEJ C;  4BXX G;  2PCF B;  3K80 C;  4DUZ Q;  4QIW B;  1VF7 A;  2EYF A;  5K36 H;  3HOW H;  2FMM A;  4LFA L;  2MUY A;  1JWU D;  4DAV A;  4JI6 L;  2M00 A;  1CA6 A;  1Q7Y C;  2EY5 A;  3ULP A;  3CME A;  1DOM A;  3A8I E;  1QIL A;  2EZV A;  1XPU A;  4GN5 A;  2Z6K C;  1I4H A;  2ZXO A;  3RR5 A;  1QJO A;  5H1S E;  3G71 A;  1AN8 A;  2NVT B;  2RF4 A;  2LY7 A;  4PMC A;  1EIY B;  4ZAI A;  1PH3 A;  4DKA C;  3FKI B;  3CAM A;  1V8Q A;  4DAY A;  5HGT A;  4JBW A;  2YU9 H;  4YWK A;  1SND A;  2Q8T A;  5CGK A;  3K5M A;  5D3D A;  5GAG C;  4CKB A;  4JI2 L;  1VQI A;  4IJH A;  5GAE C;  2PMZ B;  5LL6 S;  3FRP B;  4GKK L;  1VQG A;  3GTL H;  1UE7 A;  2F0W A;  1BBW A;  4TRD A;  2WII B;  5IP9 H;  2NVX B;  5LMU Q;  4BY7 G;  2K7V A;  2PO4 A;  4OEM B;  3CC7 A;  4YIJ A;  3TRE A;  4HJ9 A;  3AYH B;  2EY1 A;  1VQL A;  1Q8I A;  2DN8 A;  3GTM H;  1YHB A;  4IUQ A;  2PYK A;  5KNB A;  1XTD A;  1VQB A;  1F2Z A;  4RMF A;  2L4N A;  1YZ6 A;  1HJP A;  3STB D;  2UUA Q;  2IJ0 A;  4P74 A;  1SE4 A;  2Q2U A;  3T1Y L;  3PO2 B;  1EIG A;  4RA8 A;  5K36 G;  4MTN A;  1GXD C;  4RFB A;  1UE5 A;  2V4D A;  4JBJ A;  1HCZ A;  3DHQ A;  5ELF A;  2YYZ A;  2AWO A;  2MHV A;  1SE2 A;  1PA6 A;  1EU4 A;  1XMO Q;  4DV6 L;  2MP1 A;  2HHH Q;  1SFO B;  1B9M A;  4YWM A;  4GLX A;  1FNU A;  3KDF B;  3J81 E;  5LMN W;  4R8N A;  4LF6 L;  2DJG C;  3ERS X;  4V0B A;  3RZD B;  3GTJ H;  3NEN A;  3M4P A;  4DGZ A;  1HZ9 A;  4FP5 D;  1SFO H;  1VQP A;  5IYC H;  5J39 A;  2F0P A;  1B70 B;  2SEB D;  4C2M B;  4DU9 A;  1C48 A;  2LXJ A;  3DEO A;  1PDQ A;  4WJ4 A;  3BZK A;  1BR9 A;  2F0G A;  4LFC L;  5ELE A;  1EY6 A;  2I5H A;  2E2I H;  2AQ1 B;  2MO0 A;  5CV9 A;  1IBK Q;  2K5H A;  3HOZ H;  1NSN S;  1BKB A;  1LO5 D;  1NR2 A;  3J81 i;  5I4D A;  2BA1 A;  2R7Z G;  3UE1 A;  4X65 L;  2I5L X;  4A3I G;  2HQE A;  4G7O C;  2R3Z A;  1A15 A;  1QZH A;  1RCV D;  1NAP A;  1LTR D;  3KOJ A;  3D4R A;  3PUV A;  4Y7N B;  2VQF Q;  5IT9 c;  4CJ1 B;  4KHP Q;  1SMY D;  3K59 A;  4LF7 L;  4KHV A;  1PTO C;  1ESF A;  3S1R H;  5C3X A;  3JAM L;  1Y1W H;  3K58 A;  3D4W A;  2KCT A;  1ICF B;  2IPK D;  1VMP A;  3J80 E;  4JI1 Q;  3HG9 A;  3NWS A;  3D4D A;  5JPM C;  4A93 G;  1GUG A;  5LHY 1;  4DR2 Q;  2O5J C;  2VQE L;  4LF4 L;  3S1Q B;  4IPC A;  1CKM A;  4L8J A;  2L5T A;  2F0U A;  1WYD A;  3E0J A;  4YWL A;  4A3L G;  3A0J A;  3SE0 A;  1R4Q B;  1BNZ A;  5M5X H;  1NTG A;  3KJP A;  4GLV B;  2R93 B;  1HZA A;  1SYE A;  1Z7T A;  4A75 A;  2R7Z H;  1WTR A;  4JG2 A;  1KD1 C;  2VY3 A;  4A3I H;  2CQA A;  2SNM A;  4FO2 A;  1HRJ A;  1XNR L;  4BY1 H;  3GTM B;  3ULL A;  1J9O A;  1XYI A;  1I4X A;  1WTP A;  2NUC A;  3J81 j;  4A76 A;  1HNZ L;  1G51 A;  1PVO A;  1ENC A;  4DR3 Q;  1YNJ C;  4AH6 A;  4IN3 A;  3J7Z C;  3SDZ A;  2A6H C;  2PW5 A;  3MXU A;  5I9O A;  4A3G B;  3BDL A;  4APV A;  2K04 A;  3RD4 A;  4O2D A;  4OWW B;  2ZXR A;  3TP6 A;  1V1P B;  4IJL A;  3R2T A;  1IKM A;  4QF4 A;  4GOP A;  1Q82 C;  1O7Z A;  4CKC A;  5IP7 H;  3P75 A;  1X6O A;  3SGI A;  1PH4 A;  2LMC B;  2KEC A;  1JCK B;  3MC0 B;  4GS3 A;  3PUW A;  1I3Q H;  4QIW E;  2XRQ D;  4KTA A;  3I55 A;  4N8X 1;  5BN3 A;  3Q0A A;  1EZ8 A;  1EOV A;  4P72 A;  4F87 A;  4JI1 L;  4UPA A;  2JA5 G;  3GTK B;  3RZO B;  5C44 H;  2NB0 A;  3ULJ A;  4JBK A;  2IW3 A;  1RIP A;  3B6Y A;  4KKU A;  4IUU A;  1K8M A;  1LTI D;  2LSS A;  4P2C B;  1GHK A;  1F2L A;  1EOT A;  4N8F A;  4DV1 L;  2NN6 I;  3FP9 A;  3BVZ A;  4EGV A;  4JYA L;  1VQ6 A;  2HHH L;  3GTO H;  2XVS A;  4JOI A;  5AJ3 L;  1OXU A;  1JR0 D;  4UHV A;  1YHQ A;  1H9S B;  4R4I A;  1TWH H;  2F0O A;  1YJW A;  3PMF A;  1ENF A;  1STE A;  4A3J G;  2B63 G;  1FYC A;  1F2Y A;  2IY5 B;  4K2L A;  3RMH A;  4KHZ A;  4GN3 B;  3U4V A;  3DWP A;  4RKL A;  4GN4 B;  3MXP A;  4AYB E;  3OMC A;  1HUM A;  1ZEQ X;  1E2Z A;  3HFZ B;  3A56 A;  5JPN C;  2RHS B;  1NNX A;  3AMU A;  3R2I A;  1HR0 Q;  4JI0 L;  2EYM A;  4IPD A;  1E1T A;  1LT4 D;  3DLL A;  1C7Y A;  2JA6 H;  4C3H G;  1BBU A;  1SYB A;  3NTK A;  2HQL A;  2JEB I;  3E6Z X;  2K03 A;  4M8A A;  2JA5 H;  2AUK A;  5IYB H;  1IBK L;  1PRT C;  2KUM A;  4XT3 B;  3VR6 A;  3HOY G;  3HGB A;  5KEE A;  1H9K A;  1TS3 A;  5KND A;  3U58 A;  4L63 B;  2A1A A;  2BH8 A;  2BDN A;  1TWF B;  1PTO F;  4PG3 A;  2B2Y A;  3OW2 A;  5FKA C;  1NR4 A;  2K52 A;  1JT8 A;  1P8L A;  4NB3 A;  5GRO A;  3J80 c;  1DCZ A;  1Q1E A;  1JOO A;  2K5V A;  1ET9 A;  3LWU A;  4ZYS A;  4A3I B;  4OX9 Q;  2KCN A;  1JC7 A;  1MSG A;  3DEP A;  5DNF A;  1DON A;  4HMJ A;  2F4V L;  2WB1 B;  3K0X A;  1CQF A;  4R4T A;  3I8Z A;  4RCN A;  4A3E H;  3FHW A;  3HOZ G;  5M5Y H;  2N78 A;  4QCL A;  1G6P A;  1ILQ A;  2HDM A;  4ZUJ A;  1DYQ A;  3QB3 A;  1D5M C;  3UE0 A;  1AE3 A;  1NJI C;  3PO2 H;  4MN3 A;  5C5L A;  5HGQ A;  4DUY L;  3RN2 A;  4CDC C;  1VQM A;  4EVO A;  4X6A H;  1EL0 A;  1EU3 A;  2K5N A;  1E2W A;  1IBM L;  5COY A;  3CCS A;  4QB4 A;  1O7Y A;  4GKJ L;  3M9B A;  2BCO A;  4LMQ D;  3CPF A;  1I3Q B;  1UEA B;  3QJY A;  4Q0F A;  4A93 H;  4DR1 Q;  5EBC A;  2EIF A;  1KDB A;  1NCV A;  3SK4 A;  3NEL A;  4PQX A;  5IOC A;  1G2T A;  1B7Y B;  2RA4 A;  4RAU C;  4AQY L;  1ENA A;  4DA2 A;  2DUD A;  2RBM A;  3HKZ G;  4I65 A;  3T56 B;  2XTI A;  1VQF A;  2ZJR A;  1TWC H;  2C5C A;  4X65 Q;  1CHQ D;  3A74 A;  3OW7 A;  2OQ0 A;  3KFU A;  1KL9 A;  1LV9 A;  2WFW A;  4RG1 A;  4PZ8 A;  2JK8 A;  1Y14 B;  3DWQ A;  2AMC B;  1V1P A;  4OXP A;  2F4V Q;  1V1O A;  4KD4 A;  3KYH C;  3BU2 A;  3ND8 A;  5M9O A;  3RNU A;  5IGF A;  1WCM B;  4YCU A;  3S17 H;  2B2U C;  2VUM B;  1VQD A;  1JJ2 A;  1SMX A;  3FEW X;  1CHP D;  1IYV A;  3AU7 A;  4K14 A;  1HA6 A;  2WB1 G;  1KNE A;  1Y1W B;  1ZYR C;  4LWC A;  4LF6 Q;  2XWB B;  5M3F G;  1LTT D;  2Z6B A;  3KDF A;  4R8I A;  3G4S A;  1W2B A;  3QIA A;  1YJN A;  3MAQ A;  2L9H A;  1ASZ A;  4U68 A;  4A3K H;  2F0I A;  1SJH D;  1C4Q A;  1N34 L;  4A3J B;  1HNZ Q;  4DK0 A;  2B63 B;  2R93 H;  1RTO A;  4LW1 A;  4JBM A;  5G3L D;  1EY7 A;  3X3N A;  3JAM i;  5FOB B;  4BBR B;  2F3I A;  3TZD A;  1HNX Q;  1SMY C;  4V19 0;  2JA7 H;  3OYY A;  2R7D A;  4K0K L;  2JP1 A;  1JJG A;  1EZ6 A;  2H4O A;  3A5U A;  3KLR A;  2RKS A;  2YU9 B;  1SSO A;  2NVQ B;  4BXX H;  1R4P B;  2A19 A;  5CBE E;  1JE4 A;  1KDA A;  1WTV A;  4C1N I;  2RHQ B;  1M1K C;  2WP8 J;  3SVM A;  2WAQ B;  2KVM A;  3TEH B;  4KN4 C;  2JYO A;  4RGT A;  1IXR A;  5EKI A;  1A3U A;  2NWG A;  1Z47 A;  4U67 3;  5M5Y B;  1PTO B;  1D5Z C;  1P16 A;  2VQE Q;  2PZW A;  1IL8 A;  4ZUI A;  1G6Z A;  1QCB D;  1G29 1;  2O5I C;  1EEI D;  4IUN A;  2NVQ H;  3TRZ A;  3E9H A;  3L0O A;  2K75 A;  2EPB A;  2NYZ D;  4H0L C;  5JEA H;  1NMG A;  2R92 H;  3OTO Q;  3G48 A;  1PTO H;  1SYC A;  1UUP A;  1BBX C;  4QUC A;  1T5X D;  1TS5 A;  1ZXT A;  2WAC A;  1PZI D;  1PH8 A;  3S1N H;  4PMB A;  5GAH C;  1CZG A;  2K6A A;  2JN4 A;  4X3U A;  5CMD A;  5C4X G;  2B39 A;  2A74 C;  3EVQ A;  1ROD A;  1QUQ B;  2EVB A;  4L6T B;  1U4P A;  4C2M H;  2EE1 A;  1O7L A;  4OO1 I;  1MJE A;  1EY0 A;  3H3V I;  2CKZ B;  5D65 A;  5CV5 A;  4RWS C;  2WAQ G;  3GTJ B;  1J5E L;  3NWT A;  4X64 Q;  1ML0 D;  2Q8R E;  4XYO A;  1A62 A;  4DAP A;  3V05 A;  3M4O H;  4AQY Q;  2E2J H;  2ZT9 C;  1XJV A;  1MIU A;  2C35 B;  4HIO A;  3CCL A;  4F8M A;  3OHX C;  4GKJ Q;  3P7J A;  3RN5 A;  4LJZ C;  1F9R A;  2YV5 A;  4IUT A;  3FPP A;  5D14 A;  1HTP A;  1CZW A;  2NTT A;  4KD3 A;  3DXJ C;  3UDX A;  4OL7 A;  3QOJ A;  1N32 L;  1GJX A;  3S2H H;  4YCW A;  3HOV G;  1PFN A;  5M3M G;  5I2X A;  2RCN A;  1C9O A;  1WVL A;  3CC4 A;  1E7Z A;  3DM1 A;  2HIV A;  1M90 C;  1XXG A;  4JI6 Q;  3TS2 A;  1IW7 D;  2JJQ A;  1MD2 D;  2KHJ A;  3UDF A;  4LUV A;  1HXY D;  2KOL A;  3I4N G;  3J80 i;  4WOR A;  4JCV E;  3S14 H;  5LMN Q;  1GOZ A;  1KTK A;  1NBW A;  3A7L A;  1GUO A;  2CWP A;  5CV8 A;  1EY4 A;  1HTL D;  2N88 A;  4LAA A;  4A3K B;  1TR5 A;  4NXN Q;  2PQA B;  3BYT B;  3D31 A;  4J6H A;  4IPG A;  5M5W H;  3KBX A;  2BOS A;  4X62 Q;  1SJE D;  1Y8N B;  2FXQ A;  1S4Z A;  1K28 A;  4H13 C;  3CU7 A;  2NVX H;  2D9U A;  4B3M L;  1D7Q A;  3U9S A;  4G57 A;  1VQ7 A;  3E3X A;  4DUY Q;  5L37 A;  1UNS A;  2B2V A;  2MGS A;  3J81 L;  1VQK A;  1E2V A;  4OEL B;  1Z6H A;  5BR8 L;  3MXN A;  3MXN B;  3HZX A;  5DEH A;  4TKO B;  4JI4 L;  3ONA B;  5C0X H;  3BDO A;  1SEB D;  4XIG S;  2Z6K A;  4A3B H;  4XDX A;  3QOL A;  1KDC A;  5C3W A;  1W6K A;  2BH2 A;  4J15 A;  4GNX A;  2AQ3 B;  1HZB A;  3AQQ A;  5M3M H;  3OOC A;  2ZTD A;  5DLQ E;  1GKH A;  5AFW A;  5JEA G;  2OTJ A;  1QZG A;  4RH6 A;  2NN6 G;  1L0W A;  4IQZ A;  3F8T A;  3H91 A;  2R92 B;  4P75 A;  1XPR A;  2XSC A;  2FHT A;  5E1F A;  1VQ8 A;  2IX1 A;  5M3M B;  3D3R A;  1TY0 A;  2K1B A;  3T1H L;  3WOE A;  1Q3L A;  1D5X C;  1S5B D;  3MHB A;  4DR4 Q;  4KLK A;  3MVV A;  3C1F A;  3QWN A;  3CKI B;  3SR1 A;  5C0X J;  3J7Y W;  2EYP A;  2YTY A;  1I6H H;  3K5O A;  2VL6 A;  3DMU A;  4DXF A;  1YNN C;  3I3C A;  4IO9 A;  2K5D A;  1PFS A;  4JI2 Q;  2KHS A;  1E22 A;  5ELC A;  4HJ8 A;  5CC4 A;  1IBL L;  4TQU S;  3J7A V;  4NKL A;  2E2J B;  1PRT F;  3I90 A;  3M4Q A;  4DNR B;  1MI2 A;  3LX0 A;  4HJA A;  2JEA I;  1PFM A;  2B2T A;  2A6E C;  4KJO A;  1PZJ D;  2VUM H;  3S17 B;  2KJX A;  1X3F A;  3L7Z C;  3S2D H;  1PYB A;  1DJR D;  3TSS A;  1MGS A;  3CQZ B;  2JE6 I;  5ELB A;  1VQA A;  2PNH A;  1BCP F;  3MEF A;  3P1H A;  1STG A;  3I56 A;  3TDQ A;  2RDH A;  2K05 A;  1KC8 C;  2UXC L;  2GVB A;  2N49 A;  1KIX A;  5IP9 G;  2UXD L;  1TWA B;  4P73 A;  2UXB L;  4B9W A;  2JA6 B;  5C4J H;  4B3R L;  1TS2 A;  1CTM A;  5FLM G;  3MEH A;  1GUW A;  4HED A;  1EYA A;  2NZH A;  2Q2H A;  2K01 A;  3CW2 C;  1K8G A;  1CSQ A;  1SRO A;  2Z1C A;  3R93 A;  1NMF A;  4WJ3 M;  3MWY W;  4YCV A;  1IL2 A;  1S5F D;  5JJI A;  1TS4 A;  5KYI A;  3CQZ H;  3IAY A;  3H3V C;  1XWE A;  1I4P A;  4DR6 L;  2CH4 W;  2EXD A;  2F0H A;  1JOR A;  3HOX B;  2IHE A;  1YNX A;  2I5M X;  3C3L A;  3Q8D A;  4TSS A;  1LTA D;  1VQO A;  2TMP A;  2ALY B;  1CFM A;  1RKN A;  4L5R C;  3TP8 A;  2L12 A;  2F0N A;  1GD7 A;  5C0X G;  1IHZ A;  1N32 Q;  1S3O A;  4LF4 Q;  2R93 G;  1TWF H;  3S14 B;  1BOS A;  1RL2 A;  5IOD A;  5FLX E;  2AHO B;  2CH4 A;  5HY6 A;  5JVG 3;  2CW0 D;  3VYS A;  3JAM c;  3K5N A;  1MHW C;  3WDN A;  4R1J A;  3J7A F;  4AIM A;  4XTC S;  4DV5 L;  1WJJ A;  3MZ5 A;  3J7A 5;  3EJI A;  3K7A B;  4HID A;  3H0G G;  3GTQ H;  1MJC A;  1HR0 W;  3CP0 A;  1ICW A;  4TVA B;  1I4R A;  1PXU A;  4HIK A;  1XX8 A;  2UXC Q;  1Q8K A;  2GVA A;  4C3I B;  3GTQ B;  1G2S A;  4NXN L;  2E76 C;  2ZM6 Q;  1LTS D;  2PI2 A;  3OMG A;  4C3I H;  1ASY A;  1TWC B;  3K81 C;  3T13 A;  4H02 A;  2L15 A;  2FMC A;  1STA A;  3NBH B;  1FNV A;  3SK6 A;  4POF A;  2XGT A;  3PUX A;  1WOC A;  4DF7 A;  5C3E G;  2UUB L;  1HZC A;  3FVQ A;  3PCO B;  2VS1 A;  3F1Z A;  2L0C A;  1AEX A;  4BY1 G;  2D2C C;  1DGS A;  5IWA Q;  1BCP C;  4JV5 Q;  4HIM A;  4JPB W;  2B2W C;  1X65 A;  2R7F A;  4C56 C;  5AJ3 Q;  4A3K G;  4NP5 A;  1ESR A;  1DXM A;  1LLR D;  3R8B A;  3T16 A;  2F0F A;  3UDI A;  1N36 Q;  1FJG Q;  5JJZ A;  3CCV A;  3OSO A;  3ZYY X;  2CQO A;  2OEO A;  4FNF A;  4A3D B;  5EQ0 A;  2K5W A;  1GHJ A;  5IGB A;  5KYL A;  3GTO B;  1A8V A;  4HMI A;  1CKO A;  2P5Z X;  1N33 Q;  2I0Q A;  1MBY A;  2PZU A;  2V1C C;  3KK7 A;  2NVY H;  1Y1W G;  2JA5 B;  3G6J B;  3PO2 G;  2JA9 A;  3KJO A;  2KEN A;  1CM9 A;  3H94 A;  5FLX c;  4DR4 L;  4MIU A;  4QUF A;  1SNP A;  5LMN L;  1EQQ A;  1BO0 A;  1FGU A;  4R4O A;  2E8G A;  4OHJ A;  3I4N H;  1I6V C;  3UDG A;  4A3B G;  3GDE A;  3PF5 A;  4A3E G;  5FJ8 H;  2FFK B;  4GNX C;  2L55 A;  1BXT A;  2A69 C;  3A7A B;  3TBI B;  2QDL A;  2UXD Q;  4LFC Q;  2PQE A;  4FVM A;  1K73 C;  1ET6 A;  2G9D A;  3LWE A;  3NHH A;  4GZY C;  2IT1 A;  5IYD H;  3P20 A;  2UUC L;  4B9X A;  1VQ5 A;  3CXC A;  5ISR A;  4DR2 L;  5C5M A;  4X64 L;  4JYA Q;  4GOP C;  2IWH A;  5FK9 C;  1IZ6 A;  3HOX G;  1A3V A;  4XQN A;  1BVS A;  3K0Y A;  5CV6 A;  4FYD A;  4FXK C;  1OO9 B;  4K6L A;  4A3M G;  1GM5 A;  4ID6 A;  4A3J H;  2B63 H;  1GUT A;  4QL5 A;  1VMC A;  3IFT A;  1I4G A;  1X54 A;  2F0L A;  2K32 A;  3VA5 A;  1B9N A;  1PTO D;  1UE6 A;  4ODG A;  4JI5 Q;  3CCQ A;  4H44 C;  2MJ8 A;  3F2C A;  5E4X A;  5I2Y A;  3MXG A;  3EFX D;  5JEA J;  1UWV A;  3PUY A;  3FDT A;  3PO3 H;  5CV4 A;  1YI2 A;  1UEB A;  2DY8 A;  4KI0 A;  1U4R A;  1QE6 A;  1V9P A;  2LS0 1;  1KRS A;  1WTH A;  1B53 A;  1FD7 D;  4JI0 Q;  1CKN A;  3T4A C;  4CJ2 C;  2MPM A;  4L5T A;  1NE3 A;  2R92 G;  1TWH B;  3ZJY C;  3M3Y H;  3KF8 B;  1WD1 A;  4LUZ A;  5KRU A;  4ZK9 B;  2PNR C;  4K8I A;  3OWE B;  1XNQ L;  5M3F B;  2PMZ E;  3M3Y B;  1CK1 A;  4BBS G;  3C2P A;  1IW7 C;  1AFP A;  4CDD C;  1LT5 D;  2N8N A;  5EGT A;  1ZKO A;  5M3F H;  4XYQ A;  2LXK A;  1C8C A;  2F03 A;  2HIX A;  2IL8 A;  4FF2 A;  1W3S A;  1Q86 C;  2B2T C;  2ZXP A;  1HH2 P;  3FMC A;  2XWJ B;  1VF5 C;  1LTL A;  2O2L D;  5IYB G;  2ZJQ A;  4NW2 A;  4B3S Q;  3I4M G;  2F0K A;  4HJ7 A;  2F0M A;  5BR8 Q;  1OXT A;  3SXH A;  2KED A;  4JI4 Q;  3VYT A;  1CQV A;  2JA6 G;  2HCI A;  3S1R B;  3CCU A;  4L5S A;  2A68 D;  4K8J A;  3OWF A;  2AWN A;  1A3T A;  2ZTE A;  3GTP B;  1EY5 A;  4LF8 L;  4A3G G;  2K28 A;  1U4M A;  5D3I B;  1K0S A;  2KCC A;  3QR8 A;  2F52 A;  4KMU C;  2QEX A;  1XPO A;  4NXM Q;  3S16 B;  1PYS B;  3S1Q H;  3HKZ B;  4KY6 A;  1B50 A;  4JK1 C;  2KCM A;  4YY3 Q;  1PH9 A;  2UU9 Q;  1X3G A;  4K5W A;  4PZ6 A;  5F2D A;  4JV5 L;  1EEF D;  3AB9 A;  4OO1 H;  4AYB B;  2BDO A;  3KF8 A;  3MFG A;  1E24 A;  1KAA A;  4DK6 C;  5J3B A;  4HR7 B;  2EJF C;  1D6E C;  1LYL A;  1TXY A;  3NEM A;  3RLF A;  2K5Q A;  3LNN A;  3NBH A;  1LTB D;  3E0E A;  1OXX K;  4I7A A;  4A3C G;  3SK8 A;  3CCJ A;  4C1N K;  4HCE A;  2L1B A;  1TVX A;  2KHI A;  5I9P A;  4ALP A;  1O7I A;  5FO7 B;  1N33 L;  2JA8 B;  3EIV A;  2M2L A;  1OTC A;  4KKS A;  1B8A A;  2GA4 B;  1PZK D;  2B29 A;  1QG7 A;  2QDB A;  2B8F A;  1H9S A;  1SLJ A;  1AZP A;  1Y1V B;  4XXE A;  3ITP A;  3OPO A;  2A6E D;  5IGG A;  1N8R C;  3ERQ A;  1SBB B;  2E75 C;  1B3A A;  5C44 G;  4K5V A;  2VXW A;  5DM7 3;  2DJF C;  4DPG A;  4C3I G;  2JA8 H;  2CW0 C;  2WB1 E;  3WWV A;  3Q24 A;  1IBM Q;  1STH A;  2UUA L;  4CKE A;  4A3C H;  1L2F A;  2NZO A;  4LK1 C;  1TKW B;  5IE8 A;  3EBE A;  5CBA E;  3NK9 A;  1MSH A;  3D0F A;  2ES2 A;  3PGZ A;  4HAE A;  3H0G H;  4DR5 L;  2D62 A;  2RCF A;  1WFQ A;  3T51 B;  2SNS A;  2RDF A;  3DUZ A;  3M4O B;  1SAP A;  2D0P A;  3PO3 B;  4CGY B;  5C6A A;  2HCC A;  1D2B A;  2QA4 A;  1QWY A;  2CCZ A;  2M9V A;  2CFM A;  2F0D A;  2RSO A;  1KXL A;  1H9M A;  1WTX A;  1Z9F A;  1VQC A;  4DV7 L;  2DY7 A;  3KF6 A;  4DV3 Q;  4DK3 C;  3G6E A;  4Y7N H;  1RJT A;  2EXZ A;  3NQI A;  1D8L A;  1EWC A;  3MTS A;  5EJW A;  4LFA Q;  4A4I A;  5IYC G;  1HFG A;  1JJC B;  4WRD A;  1OXV A;  5EPJ A;  2VZA A;  3IL8 A;  3HKS A;  4DV5 Q;  5IT9 L;  4DR1 L;  1FL0 A;  1VCI A;  1Y1V G;  1U9R A;  1KNA A;  4DV0 L;  5J22 A;  3NP8 A;  5C4H A;  4G4K A;  4QGU A;  4ZCK A;  1IYU A;  3F2U A;  3GTP H;  4B3S L;  1JIC A;  4K5X A;  3CMA A;  1DOL A;  1CA5 A;  2RQX A;  1HR0 L;  1M4V A;  5T1G A;  4WFN 3;  4O0A A;  1SNC A;  1TQO A;  4JOI C;  1I4Q A;  4OGQ C;  4LFB Q;  4LF8 Q;  1FJG L;  3H09 A;  4IUR A;  1LTG D;  1X3Q A;  3S16 H;  3FKI G;  2OF1 A;  3CC2 A;  2F0E A;  3GTL B;  2ID0 A;  1G8Z D;  2HD3 A;  2OT2 A;  4UAI A;  1R9T H;  4FDB A;  4DAM A;  1WD0 A;  4GLA C;  1LAC A;  1YNN D;  1H9J A;  3IKJ A;  1EYG A;  1PMR A;  2QIL A;  2YTX A;  4DV7 Q;  1STB A;  2B8G A;  4BA1 I;  3GV6 A;  1SYF A;  4K6D A;  4NMZ A;  5A2Q E;  5JVH 3;  2NBF A;  4PV1 C;  4DXG A;  3U50 C;  3L3O C;  3CCE A;  2CHB D;  1E1O A;  3HOX H;  4H7B A;  1Y1V H;  2MNA A;  3J80 L;  3QO2 A;  4KN7 C;  1Y69 U;  1PH1 A;  1EQV A;  2LFN A;  2UUC Q;  1K9M C;  4IFD I;  4ZRZ A;  1MKH A;  2OQK A;  2E5L L;  3TP7 A;  1VQE A;  3S1M H;  1EUJ A;  2Z4H A;  2PI2 E;  4FXG C;  4ZQ3 A;  2VB2 X;  4JI7 L;  1ILP A;  1SYG A;  4K2K A;  3F2B A;  1YBY A;  2K33 A;  1PH6 A;  4EQ5 A;  3CF5 A;  2X6G A;  3PO3 G;  4ABN A;  1UE1 A;  4RGN A;  5GQO A;  3TN2 A;  1I6H B;  5EPK A;  1OXS C;  3K5L A;  3NTH A;  4CBV A;  1HNX L;  2GN5 A;  4RKB A;  2BE5 D;  3PIO 3;  4A93 B;  2WIN B;  3KUP A;  4C3H B;  2E2I B;  2VW9 A;  1YEZ A;  4DK1 A;  1E0B A;  1D1I A;  1XTC D;  5FLM H;  1CUK A;  1EQT A;  3BYY B;  1BF4 A;  1L1O B;  3S1N B;  3H15 A;  4XT1 B;  3GTG B;  3T1Y Q;  1B4O A;  4Q5V A;  2PPB C;  2J0T D;  5COR A;  4X66 L;  3OIP A;  3ND9 A;  1JOQ A;  1O78 A;  2Y0S G;  1UAP A;  5CR3 A;  4PMW A;  3GP7 A;  2HT1 A;  1J8I A;  4NPS A;  4RHS A;  1ONL A;  2ZJP A;  4ME3 A;  1E3P A;  4BA2 I;  3I7F A;  3BVG A;  2PQA A;  4R9W A;  1R9T B;  5DM6 3;  5E7N A;  3VR3 A;  1U5K A;  2KA7 A;  1JB7 A;  4O42 A;  1KAW A;  3HOY B;  4CDE C;  1CT1 D;  2Z0S A;  1G91 A;  1SYD A;  1HPC A;  5E3F A;  1VDZ A;  4FF1 A;  3D6C A;  1L0Y B;  4B3T Q;  1K0R A;  5IY0 A;  1L0X B;  4ZKB B;  2TSS A;  1JB3 A;  2EYJ A;  2VNU D;  3HS0 C;  2NTS A;  3Q23 A;  2VB3 X;  4HJ5 A;  2G5D A;  1A0I A;  4DR7 L;  5IYD G;  3X3M A;  4J1M A;  4CJ0 B;  2CVR A;  3LGJ A;  3KF6 B;  2QKI C;  1X56 A;  1K8A C;  2UU9 L;  1WTW A;  2J4X A;  2KQ3 A;  2AUJ D;  3KBG A;  5IIF A;  4A3G H;  2MFI A;  5FJ8 G;  4X66 Q;  5C3E H;  1I94 Q;  1S5D D;  3M4Y A;  3HOV H;  5G3L F;  5JAV A;  4A3E B;  3RZO H;  5EKL A;  3U9O A;  3CRL C;  4WJW A;  4DR3 L;  4MNO A;  4QQB X;  1SE8 A;  3S15 B;  1KHI A;  3I4M H;  3KLS X;  1AZQ A;  1YNJ D;  2JA7 B;  1CSP A;  1XMO L;  3S15 H;  1F77 A;  1PRT B;  1IKL A;  3NQT A;  1RF2 D;  1FNW A;  5KIX A;  4QMG A;  1STY A;  4IOA A;  3H3V H;  5JOB A;  3TS0 A;  1AE2 A;  5C44 B;  3VA7 A;  4IFD J;  2HDL A;  4JI8 Q;  2JQO A;  4UY8 C;  5IGC A;  3S1M B;  2G9H D;  3W3A A;  3CD6 A;  1K3R A;  1D1K A;  2EQS A;  1TU2 B;  2X6L A;  5EAY A;  3PIO A;  4X3K A;  4B3T L;  1A6X A;  4JI7 Q;  3IRB A;  2XIW A;  4IPH A;  3HP3 A;  3A55 A;  1SE3 A;  4OWX B;  3L9A X;  1SRU A;  5J1Z A;  1RHP A;  1TII D;  3VYR A;  4E6I A;  4C3H H;  1TY2 A;  3K7U C;  1N9W A;  1K8O A;  1V43 A;  4CDF C;  4CHT B;  4QY7 A;  5ELD A;  5FO9 B;  4XQJ A;  3W1G A;  3HEJ A;  4G7Z C;  3PIP A;  1T5E A;  2A73 B;  3HOZ B;  4LNQ A;  3CPW A;  4J8Q A;  1GVP A;  3A8K E;  1B1Z A;  1Y8P B;  4BY7 H;  5KNC A;  1Q90 A;  2B2W A;  2K14 A;  4AYB G;  3N52 A;  3MFY A;  3NXW A;  3TZU A;  3IFD A;  2F1M A;  3F2D A;  4G7H C;  4A3M B;  4UP8 A;  4HTH A;  3C46 A;  4ZLT F;  4HSP A;  4BS9 A;  2Z4I A;  2A8V A;  1PYW D;  2F0S A;  1VQJ A;  4A3M H;  4DV3 L;  4F7X A;  4LFB L;  1L1O C;  2Q2T A;  1EIH A;  3JAM E;  3V96 A;  1WCM G;  1SDF A;  2R6G A;  3GQB A;  2B2V C;  5DAU A;  1BCP B;  1KLG D;  3NSW A;  1LT3 D;  1RD9 D;  3RLN A;  3PSI A;  1LM0 A;  2Z8L A;  2RSN A;  4B08 A;  5M5W B;  3M7N A;  4UP9 A;  2I46 A;  2SOB A;  4RGM A;  5C4J B;  1VQ9 A;  1EY8 A;  3WOF A;  3NTI A;  4JVZ A;  4X3T A;  1TT2 A;  3FKI H;  1B3Q A;  4ULL A;  5EBD A;  3HRZ C;  5M5X B;  1HNW L;  1YHA A;  2WAQ E;  4DFA A;  3D6W A;  3SEB A;  2K50 A;  3K6O A;  2UUB Q;  1NY4 A;  1GUS A;  2ZTC A;  3GD7 A;  2C9O A;  5CYU A;  2N55 A;  4LF9 L;  1I50 H;  3A8J E;  4KV6 A;  4ILW A;  4K0K Q;  2A68 C;  4BBR H;  4B3M Q;  4DR7 Q;  1VS0 A;  1QVC A;  5C4X B;  2HUG A;  4FF4 A;  5IT9 E;  1A2T A;  1I50 B;  3M7G A;  4DNT B;  1X32 A;  2YTV A;  2UXB Q;  2H1E A;  2O4X A;  2B2Y C;  2E5L Q;  2IX0 A;  5FO8 B;  5A2Q L;  4JI3 Q;  1VQN A;  2IX3 A;  3I4M B;  4JI5 L;  1LAB A;  3O13 A;  1QB5 D;  2EJG C;  2FIN B;  2JA8 G;  5BN5 A;  2NN6 H;  3E5S A;  3RZD H;  4UP7 A;  3PV0 A;  1Q81 C;  2ATW A;  4YHH L;  3BVM A;  2EDG A;  3Q6S A;  1SNO A;  4LF5 Q;  2LKV A;  1AW7 A;  3OIQ A;  1S72 A;  2CWA A;  2MQH A;  3DM3 A;  4PNY A;  5HUR A;  2R61 A;  3H6M A;  4BWG B;  4EQP A;  5NUC A;  3VR4 A;  3M85 A;  2OTL A;  2DNE A;  4DV4 Q;  4OWT B;  4DV1 Q;  2ASB A;  2OXP A;  4KK7 A;  1H9R A;  1HQR D;  3D8G A;  4N9P A;  4IUP A;  3TME A;  3E9I A;  3ER0 A;  5IGE A;  4KY5 A;  4C3J H;  3T1H Q;  1QVG A;  1EYC A;  4A3L H;  1I94 L;  4DV2 L;  3GO5 A;  4X3S A;  3TP5 A;  5KGU A;  4RHR A;  4F88 A;  3HOU G;  1PFB A;  5IP7 G;  1V1Q A;  1K83 H;  1W6J A;  5T1I A;  3HOU H;  4JW0 A;  5A35 A;  1RTN A;  1K83 B;  2E74 C;  2JSO A;  1AP0 A;  1F9S A;  2E2D C;  4P71 A;  3BZC A;  1A2U A;  3VYU A;  2EYL A;  5LMU L;  1KRT A;  3S9W A;  3DWA A;  3NBI A;  3RLO A;  1DM0 B;  3SK5 A;  4JI8 L;  1JE5 A;  2J7Z A;  4KY7 A;  2OWO A;  1QNU A;  2ZM6 L;  2N3S A;  3K57 A;  2EYH A;  1HHV A;  4DN4 M;  1HQM C;  2F0Q A;  2XN9 C;  5TSS A;  2E2H H;  1SN8 A;  4RCO A;  3N6R A;  1F9Q A;  4IOC A;  4LF5 L;  3S24 A;  1KQS A;  2WKC A;  2NVT H;  3VDY A;  1A63 A;  4GNX B;  4EQN A;  3L2P A;  2QCP X;  1II3 A;  3SHL A;  1Y8O B;  2DNC A;  5GAD C;  4A3D G;  3URY A;  3CCM A;  1X9N A;  4MZ9 A;  1PLF A;  3NPP A;  4IUV A;  2X69 A;  1QVF A;  2F0V A;  2EY6 A;  1YIJ A;  4KKT A;  4BBR G;  4QJF A;  3QG1 A;  1Q12 A;  4GOP B;  1T9H A;  3NUC A;  1XNQ Q;  4BY1 B;  1BQQ T;  3HOY H;  4Y52 H;  1KAB A;  3PF4 A;  1JOK A;  4YY3 L;  1F9P A;  3EA6 A;  3HKZ E;  5BN4 A;  1SXT A;  2EOT A;  1EFI D;  1JQY D;  2XNA C;  5C4X H;  1C0A A;  1HUN A;  1J6Q A;  2KEE A;  3W2D A;  3RUZ A;  5I6Y A;  1SR3 A;  4KJN A;  3W5O A;  5I6W A;  1EQR A;  2I07 B;  1ZYR D;  1JWM D;  1YJ9 A;  4R4C A;  5JJL A;  2A5H A;  1NUC A;  2F0T A;  2PW7 A;  1TWG B;  1WTO A;  3I2Z A;  2RDG A;  2BA0 A;  1JMC A;  1IYJ B;  3CHB D;  1PV4 A;  4A3F B;  3BG3 A;  2H5X A;  3CCR A;  2SDF A;  2DGY A;  4OIJ A;  1HA5 A;  4RGO S;  3GV3 A;  4OO1 G;  1BUV T;  4ZKC B;  1SNQ A;  1JWS D;  2B2U A;  4FF3 A;  3ICE A;  2NZ1 D;  4DV6 Q;  4BBS H;  2Y0S B;  4OIK A;  3K7A H;  3BDC A;  4NXM L;  1TWG H;  5C0X I;  3KLW A;  1EY9 A;  3V2T A;  3VR2 A;  2A6H D;  1X3P A;  4HCS A; 
#chains in the Genus database with same CATH homology
 1PRT D;  4IZ8 A;  2A69 D;  3NE5 B;  1S5C D;  2ICI A;  3PIP 3;  5EKK A;  3UI2 A;  2RVL A;  2EJM A;  2JXM B;  2D5D A;  5FLX L;  1SNM A;  4S3S A;  3I91 A;  3BS1 A;  3I72 A;  4IAL A;  1BDO A;  4XQQ A;  1DD2 A;  1DOK A;  4Z9C B;  1EYD A;  2ICE C;  2EY2 A;  3HOW B;  2NVY B;  4EQO A;  1CI3 M;  2AQ2 B;  3S2H B;  2E2H B;  2WKD A;  5EPL A;  1HFN A;  5IGD A;  2FJ2 A;  3S2D B;  3I4N B;  1F2M A;  1BCP D;  2R7Z B;  5LL6 X;  1DZ1 A;  3EQL C;  4MHE A;  1KLU D;  3C1E A;  1RDP D;  1LT6 D;  1B2T A;  2F4I A;  1M8A A;  3HOV B;  4O1N A;  1O80 A;  1U4L A;  2Q8I B;  1GUN A;  5C4Z A;  1STN A;  1FR3 A;  2BE5 C;  1Q1B A;  5C3E B;  2WV6 D;  2QF7 A;  5CV7 A;  3Q22 A;  1QOH A;  4FXD A;  2F3V A;  4IFD H;  1B44 D;  5E4W C;  3KLS A;  4HSV A;  5K5P A;  3R3O A;  2L11 A;  3MA2 B;  3H0G B;  3PUZ A;  3T53 B;  4C3J G;  3VR5 A;  2F0J A;  2XRS D;  1FGB D;  4ME5 A;  4NDX A;  4A3B B;  4BY7 B;  3I73 A;  4C3J B;  4I7Z C;  3CRK C;  4N9T A;  1QNK A;  2PZT A;  3HOU B;  4M1U B;  4IFD G;  1S5E D;  2ENB A;  3A54 A;  2EYO A;  3ERO A;  3G7L A;  3I4L A;  3I70 A;  4BBS B;  2F3W A;  4HN7 A;  1WTQ A;  1EWH A;  3BZD B;  4UDU C;  3FPU B;  2QEJ C;  2PCF B;  4QIW B;  1VF7 A;  2EYF A;  5K36 H;  2FMM A;  2MUY A;  1JWU D;  4DAV A;  2M00 A;  1CA6 A;  2EY5 A;  1DOM A;  3A8I E;  1QIL A;  2EZV A;  1I4H A;  2ZXO A;  1QJO A;  1AN8 A;  2NVT B;  2LY7 A;  4PMC A;  4ZAI A;  3FKI B;  1V8Q A;  4DAY A;  5HGT A;  4JBW A;  1SND A;  2Q8T A;  5CGK A;  3K5M A;  5D3D A;  4CKB A;  2PMZ B;  5LL6 S;  3FRP B;  2F0W A;  4TRD A;  2WII B;  2NVX B;  2K7V A;  2PO4 A;  4YIJ A;  2EY1 A;  1Q8I A;  2DN8 A;  4IUQ A;  2PYK A;  5KNB A;  1F2Z A;  2L4N A;  2IJ0 A;  1SE4 A;  3PO2 B;  1EIG A;  4RA8 A;  5K36 G;  4RFB A;  1GXD C;  2V4D A;  1HCZ A;  3DHQ A;  5ELF A;  2YYZ A;  2AWO A;  2MHV A;  1SE2 A;  1EU4 A;  2MP1 A;  1SFO B;  1B9M A;  1FNU A;  3J81 E;  4R8N A;  4V0B A;  3RZD B;  4DGZ A;  4FP5 D;  5J39 A;  2F0P A;  2SEB D;  4C2M B;  4DU9 A;  1C48 A;  3DEO A;  1PDQ A;  1BR9 A;  2F0G A;  5ELE A;  1EY6 A;  2AQ1 B;  5CV9 A;  1NSN S;  1LO5 D;  1NR2 A;  5I4D A;  2BA1 A;  4G7O C;  2HQE A;  2R3Z A;  1A15 A;  1RCV D;  1NAP A;  1LTR D;  3D4R A;  3PUV A;  4Y7N B;  4CJ1 B;  1SMY D;  3K59 A;  4KHV A;  1PTO C;  1ESF A;  5C3X A;  3JAM L;  3K58 A;  3D4W A;  2IPK D;  1VMP A;  3J80 E;  5JPM C;  3HG9 A;  3NWS A;  3D4D A;  1GUG A;  5LHY 1;  2O5J C;  3S1Q B;  4L8J A;  2L5T A;  2F0U A;  3E0J A;  3SE0 A;  1R4Q B;  1BNZ A;  2R93 B;  1SYE A;  1Z7T A;  1WTR A;  2CQA A;  2SNM A;  4FO2 A;  1HRJ A;  3GTM B;  1J9O A;  1XYI A;  1WTP A;  1I4X A;  2NUC A;  1ENC A;  1YNJ C;  4IN3 A;  3SDZ A;  2A6H C;  2PW5 A;  3MXU A;  5I9O A;  4A3G B;  3BDL A;  2K04 A;  3RD4 A;  2ZXR A;  3TP6 A;  1V1P B;  3R2T A;  1IKM A;  4QF4 A;  1O7Z A;  4CKC A;  3P75 A;  2LMC B;  2KEC A;  1JCK B;  3MC0 B;  3PUW A;  2XRQ D;  4KTA A;  5BN3 A;  3Q0A A;  1EZ8 A;  4F87 A;  3GTK B;  3RZO B;  2NB0 A;  2IW3 A;  4IUU A;  4KKU A;  1K8M A;  1LTI D;  4P2C B;  1GHK A;  1F2L A;  1EOT A;  2NN6 I;  3BVZ A;  4EGV A;  2XVS A;  1OXU A;  1JR0 D;  1H9S B;  2F0O A;  3PMF A;  1ENF A;  1STE A;  1FYC A;  1F2Y A;  4K2L A;  3RMH A;  4KHZ A;  3DWP A;  4RKL A;  3MXP A;  3OMC A;  1HUM A;  1ZEQ X;  1E2Z A;  3A56 A;  5JPN C;  3AMU A;  3R2I A;  2EYM A;  1LT4 D;  4C3H G;  1SYB A;  3NTK A;  2JEB I;  3E6Z X;  2K03 A;  4M8A A;  2AUK A;  1PRT C;  2KUM A;  4XT3 B;  3VR6 A;  3HGB A;  5KEE A;  1H9K A;  1TS3 A;  5KND A;  4L63 B;  2BDN A;  1TWF B;  1PTO F;  2B2Y A;  5FKA C;  1NR4 A;  1DCZ A;  1Q1E A;  1JOO A;  1ET9 A;  3LWU A;  4ZYS A;  4A3I B;  2KCN A;  1JC7 A;  1MSG A;  3DEP A;  5DNF A;  1DON A;  4HMJ A;  2WB1 B;  1CQF A;  3I8Z A;  4RCN A;  4QCL A;  1ILQ A;  2HDM A;  4ZUJ A;  1DYQ A;  3QB3 A;  1D5M C;  4MN3 A;  5C5L A;  4EVO A;  1EL0 A;  1EU3 A;  1E2W A;  5COY A;  4QB4 A;  1O7Y A;  2BCO A;  4LMQ D;  3QJY A;  1I3Q B;  1UEA B;  4Q0F A;  5EBC A;  1KDB A;  1NCV A;  3SK4 A;  4PQX A;  5IOC A;  1G2T A;  2RA4 A;  4RAU C;  1ENA A;  4DA2 A;  4I65 A;  2RBM A;  3T56 B;  2C5C A;  1CHQ D;  3OW7 A;  1LV9 A;  3DWQ A;  1V1P A;  1V1O A;  4KD4 A;  3ND8 A;  5M9O A;  5IGF A;  1WCM B;  2VUM B;  2B2U C;  3FEW X;  1CHP D;  1IYV A;  3AU7 A;  4K14 A;  1HA6 A;  1KNE A;  1Y1W B;  1ZYR C;  2XWB B;  1LTT D;  4R8I A;  3QIA A;  3MAQ A;  2L9H A;  4U68 A;  2F0I A;  1SJH D;  1C4Q A;  4A3J B;  2B63 B;  4DK0 A;  1RTO A;  5G3L D;  1EY7 A;  3X3N A;  5FOB B;  4BBR B;  3TZD A;  1SMY C;  4V19 0;  2JP1 A;  1EZ6 A;  2H4O A;  3KLR A;  2RKS A;  2YU9 B;  1SSO A;  2NVQ B;  1R4P B;  5CBE E;  1JE4 A;  1KDA A;  1WTV A;  4C1N I;  2WP8 J;  3SVM A;  2WAQ B;  2KVM A;  4KN4 C;  2JYO A;  4RGT A;  5EKI A;  1A3U A;  2NWG A;  1Z47 A;  4U67 3;  5M5Y B;  1PTO B;  1D5Z C;  2PZW A;  1IL8 A;  4ZUI A;  1G6Z A;  1QCB D;  1G29 1;  2O5I C;  1EEI D;  4IUN A;  2EPB A;  2NYZ D;  4H0L C;  5JEA H;  1PTO H;  1BBX C;  1SYC A;  1UUP A;  4QUC A;  1T5X D;  1TS5 A;  1ZXT A;  2WAC A;  1PZI D;  4PMB A;  1CZG A;  2K6A A;  5CMD A;  4X3U A;  2B39 A;  2A74 C;  3EVQ A;  1ROD A;  2EVB A;  4L6T B;  1U4P A;  2EE1 A;  1O7L A;  4OO1 I;  1EY0 A;  5D65 A;  5CV5 A;  4RWS C;  3GTJ B;  3NWT A;  1ML0 D;  2Q8R E;  4XYO A;  4DAP A;  3V05 A;  2ZT9 C;  4F8M A;  3OHX C;  3P7J A;  4LJZ C;  1F9R A;  5D14 A;  4IUT A;  3FPP A;  1HTP A;  1CZW A;  2NTT A;  4KD3 A;  3DXJ C;  4OL7 A;  3QOJ A;  1GJX A;  1PFN A;  5I2X A;  1WVL A;  3DM1 A;  1XXG A;  1IW7 D;  1MD2 D;  1HXY D;  2KOL A;  4WOR A;  1GOZ A;  1KTK A;  3A7L A;  1GUO A;  5CV8 A;  1EY4 A;  1HTL D;  2N88 A;  4LAA A;  4A3K B;  1TR5 A;  3BYT B;  3D31 A;  4J6H A;  3KBX A;  2BOS A;  1SJE D;  1Y8N B;  1S4Z A;  4H13 C;  3CU7 A;  2D9U A;  3U9S A;  4G57 A;  1UNS A;  2B2V A;  2MGS A;  3J81 L;  1E2V A;  1Z6H A;  3MXN A;  3HZX A;  5DEH A;  4TKO B;  3ONA B;  5C0X H;  3BDO A;  1SEB D;  4XIG S;  4XDX A;  3QOL A;  1KDC A;  5C3W A;  1W6K A;  2AQ3 B;  3OOC A;  5AFW A;  5JEA G;  4RH6 A;  2NN6 G;  4IQZ A;  3H91 A;  2R92 B;  2XSC A;  2FHT A;  5E1F A;  2IX1 A;  5M3M B;  3D3R A;  1TY0 A;  2K1B A;  3WOE A;  1Q3L A;  1D5X C;  1S5B D;  3MHB A;  3MVV A;  3C1F A;  3QWN A;  3CKI B;  3SR1 A;  5C0X J;  3J7Y W;  2EYP A;  3K5O A;  3DMU A;  4DXF A;  1YNN C;  3I3C A;  2K5D A;  2KHS A;  5ELC A;  5CC4 A;  4TQU S;  3J7A V;  4NKL A;  2E2J B;  1PRT F;  3I90 A;  4DNR B;  2JEA I;  1MI2 A;  3LX0 A;  1PFM A;  2B2T A;  2A6E C;  4KJO A;  1PZJ D;  3S17 B;  2KJX A;  3L7Z C;  1DJR D;  3TSS A;  1MGS A;  3CQZ B;  2JE6 I;  5ELB A;  1BCP F;  3P1H A;  1STG A;  3TDQ A;  2RDH A;  2K05 A;  1TWA B;  4B9W A;  2JA6 B;  1TS2 A;  1CTM A;  3MEH A;  1GUW A;  4HED A;  1EYA A;  2K01 A;  2Z1C A;  3R93 A;  3MWY W;  1S5F D;  1TS4 A;  5KYI A;  3IAY A;  3H3V C;  1XWE A;  1I4P A;  2F0H A;  1JOR A;  3HOX B;  3C3L A;  4TSS A;  1LTA D;  2TMP A;  1CFM A;  1RKN A;  3TP8 A;  2L12 A;  2F0N A;  5C0X G;  1IHZ A;  3S14 B;  1BOS A;  5IOD A;  5FLX E;  5JVG 3;  2CW0 D;  3VYS A;  3K5N A;  3WDN A;  3J7A F;  4XTC S;  3MZ5 A;  3EJI A;  3K7A B;  1ICW A;  1I4R A;  1PXU A;  1XX8 A;  4C3I B;  3GTQ B;  1G2S A;  2E76 C;  1LTS D;  3OMG A;  1TWC B;  3T13 A;  2FMC A;  1STA A;  1FNV A;  3SK6 A;  3PUX A;  4DF7 A;  3FVQ A;  2L0C A;  1AEX A;  2D2C C;  1BCP C;  2B2W C;  4C56 C;  4NP5 A;  1ESR A;  1DXM A;  1LLR D;  3R8B A;  3T16 A;  2F0F A;  5JJZ A;  3OSO A;  3ZYY X;  2OEO A;  4FNF A;  4A3D B;  5EQ0 A;  2K5W A;  1GHJ A;  5IGB A;  5KYL A;  3GTO B;  4HMI A;  1MBY A;  2PZU A;  3KK7 A;  2JA5 B;  3G6J B;  1CM9 A;  3H94 A;  4MIU A;  4QUF A;  1SNP A;  1BO0 A;  4OHJ A;  1I6V C;  2FFK B;  2L55 A;  1BXT A;  2A69 C;  3A7A B;  3TBI B;  2PQE A;  4FVM A;  1ET6 A;  2G9D A;  3LWE A;  3NHH A;  4GZY C;  2IT1 A;  3P20 A;  4B9X A;  5ISR A;  5C5M A;  2IWH A;  5FK9 C;  1A3V A;  4XQN A;  3K0Y A;  5CV6 A;  4FYD A;  4FXK C;  1OO9 B;  4K6L A;  4ID6 A;  1GUT A;  1VMC A;  3IFT A;  1I4G A;  2K32 A;  2F0L A;  3VA5 A;  1B9N A;  1PTO D;  4ODG A;  4H44 C;  2MJ8 A;  5E4X A;  5I2Y A;  3MXG A;  3EFX D;  5JEA J;  3PUY A;  3FDT A;  5CV4 A;  2DY8 A;  4KI0 A;  1U4R A;  1QE6 A;  2LS0 1;  1B53 A;  1FD7 D;  3T4A C;  4CJ2 C;  2MPM A;  1TWH B;  1WD1 A;  5KRU A;  4ZK9 B;  2PNR C;  4K8I A;  3OWE B;  5M3F B;  3M3Y B;  1CK1 A;  3C2P A;  1IW7 C;  1AFP A;  1LT5 D;  5EGT A;  1ZKO A;  4XYQ A;  1C8C A;  2F03 A;  2IL8 A;  4FF2 A;  2B2T C;  2ZXP A;  3FMC A;  2XWJ B;  1VF5 C;  2O2L D;  4NW2 A;  2F0K A;  2F0M A;  1OXT A;  3SXH A;  2KED A;  3VYT A;  1CQV A;  2HCI A;  3S1R B;  2A68 D;  4K8J A;  3OWF A;  2AWN A;  1A3T A;  3GTP B;  1EY5 A;  2K28 A;  1U4M A;  5D3I B;  2KCC A;  4KMU C;  3S16 B;  3HKZ B;  4KY6 A;  1B50 A;  4JK1 C;  4K5W A;  5F2D A;  1EEF D;  3AB9 A;  4OO1 H;  4AYB B;  2BDO A;  3KF8 A;  3MFG A;  1KAA A;  4HR7 B;  2EJF C;  1D6E C;  3RLF A;  2K5Q A;  3LNN A;  3NBH A;  1LTB D;  1OXX K;  3SK8 A;  4C1N K;  4HCE A;  2L1B A;  1TVX A;  5I9P A;  5FO7 B;  2JA8 B;  2M2L A;  4KKS A;  2GA4 B;  1PZK D;  2QDB A;  1QG7 A;  2B8F A;  1H9S A;  1AZP A;  1Y1V B;  4XXE A;  3ITP A;  3OPO A;  2A6E D;  5IGG A;  3ERQ A;  1SBB B;  2E75 C;  1B3A A;  4K5V A;  2VXW A;  5DM7 3;  4C3I G;  2CW0 C;  3Q24 A;  1STH A;  4CKE A;  4LK1 C;  1TKW B;  5CBA E;  3NK9 A;  1MSH A;  4HAE A;  2D62 A;  3T51 B;  2SNS A;  2RDF A;  3DUZ A;  3M4O B;  1SAP A;  3PO3 B;  4CGY B;  5C6A A;  2HCC A;  1D2B A;  1QWY A;  2M9V A;  2F0D A;  2RSO A;  1H9M A;  1WTX A;  2DY7 A;  1RJT A;  2EXZ A;  3NQI A;  1EWC A;  3MTS A;  5EJW A;  1HFG A;  4WRD A;  1OXV A;  5EPJ A;  3IL8 A;  5IT9 L;  1VCI A;  1U9R A;  1KNA A;  5J22 A;  3NP8 A;  5C4H A;  4G4K A;  1IYU A;  3F2U A;  1JIC A;  4K5X A;  1DOL A;  1CA5 A;  2RQX A;  1M4V A;  5T1G A;  4WFN 3;  1SNC A;  1TQO A;  1I4Q A;  4OGQ C;  3H09 A;  4IUR A;  1LTG D;  1X3Q A;  2OF1 A;  3GTL B;  2F0E A;  2ID0 A;  1G8Z D;  2OT2 A;  4UAI A;  1WD0 A;  1LAC A;  1YNN D;  1H9J A;  3IKJ A;  1PMR A;  2QIL A;  1STB A;  2B8G A;  4BA1 I;  3GV6 A;  1SYF A;  4K6D A;  4NMZ A;  5A2Q E;  5JVH 3;  2NBF A;  4PV1 C;  4DXG A;  3L3O C;  2CHB D;  4H7B A;  3J80 L;  3QO2 A;  4KN7 C;  1Y69 U;  1EQV A;  2LFN A;  4IFD I;  4ZRZ A;  3TP7 A;  2Z4H A;  4FXG C;  4ZQ3 A;  1ILP A;  2VB2 X;  1SYG A;  4K2K A;  2K33 A;  2X6G A;  4ABN A;  4RGN A;  3TN2 A;  1I6H B;  5EPK A;  1OXS C;  3K5L A;  3NTH A;  4CBV A;  4RKB A;  2BE5 D;  3PIO 3;  4A93 B;  2WIN B;  3KUP A;  4C3H B;  2E2I B;  4DK1 A;  1E0B A;  1D1I A;  1XTC D;  1EQT A;  3BYY B;  1BF4 A;  3S1N B;  4XT1 B;  3GTG B;  1B4O A;  4Q5V A;  2PPB C;  2J0T D;  5COR A;  3OIP A;  3ND9 A;  1JOQ A;  1O78 A;  1UAP A;  5CR3 A;  4PMW A;  3GP7 A;  1J8I A;  4RHS A;  1ONL A;  4BA2 I;  4R9W A;  3BVG A;  1R9T B;  5DM6 3;  3VR3 A;  2KA7 A;  4O42 A;  3HOY B;  1CT1 D;  1G91 A;  1SYD A;  1HPC A;  5E3F A;  1VDZ A;  4FF1 A;  3D6C A;  1L0Y B;  1L0X B;  4ZKB B;  2TSS A;  1JB3 A;  2EYJ A;  2VNU D;  3HS0 C;  3Q23 A;  2NTS A;  2VB3 X;  3X3M A;  4J1M A;  4CJ0 B;  2CVR A;  2QKI C;  1WTW A;  2J4X A;  2KQ3 A;  2AUJ D;  3KBG A;  5IIF A;  1S5D D;  3M4Y A;  5G3L F;  5JAV A;  4A3E B;  5EKL A;  3U9O A;  3CRL C;  4WJW A;  3S15 B;  3KLS X;  1AZQ A;  1YNJ D;  2JA7 B;  1F77 A;  1PRT B;  1IKL A;  3NQT A;  1RF2 D;  1FNW A;  5KIX A;  4QMG A;  1STY A;  5JOB A;  5C44 B;  3VA7 A;  4IFD J;  2HDL A;  5IGC A;  3S1M B;  2G9H D;  3W3A A;  1D1K A;  2X6L A;  1TU2 B;  1A6X A;  4X3K A;  2XIW A;  3HP3 A;  3A55 A;  1SE3 A;  3L9A X;  5J1Z A;  1RHP A;  1TII D;  3VYR A;  4E6I A;  1TY2 A;  1K8O A;  1V43 A;  4CHT B;  5ELD A;  5FO9 B;  4XQJ A;  3HEJ A;  4G7Z C;  1T5E A;  2A73 B;  3HOZ B;  4J8Q A;  3A8K E;  1B1Z A;  1Y8P B;  5KNC A;  1Q90 A;  2B2W A;  3N52 A;  3MFY A;  3NXW A;  3TZU A;  3IFD A;  2F1M A;  4G7H C;  4A3M B;  4HTH A;  3C46 A;  4ZLT F;  4HSP A;  4BS9 A;  2Z4I A;  1PYW D;  2F0S A;  4F7X A;  1EIH A;  3JAM E;  3V96 A;  1SDF A;  2R6G A;  3GQB A;  2B2V C;  5DAU A;  1BCP B;  1KLG D;  3NSW A;  1LT3 D;  1RD9 D;  2Z8L A;  2RSN A;  4B08 A;  5M5W B;  3M7N A;  5C4J B;  2I46 A;  2SOB A;  4RGM A;  1EY8 A;  3WOF A;  3NTI A;  4X3T A;  1TT2 A;  4ULL A;  5EBD A;  3HRZ C;  5M5X B;  4DFA A;  3D6W A;  3SEB A;  3K6O A;  1GUS A;  3GD7 A;  2C9O A;  5CYU A;  2N55 A;  3A8J E;  4KV6 A;  4ILW A;  2A68 C;  5C4X B;  2HUG A;  4FF4 A;  5IT9 E;  1A2T A;  1I50 B;  3M7G A;  4DNT B;  1X32 A;  2H1E A;  2O4X A;  2B2Y C;  2IX0 A;  5FO8 B;  5A2Q L;  3I4M B;  2IX3 A;  1LAB A;  3O13 A;  1QB5 D;  2EJG C;  2FIN B;  5BN5 A;  2NN6 H;  3E5S A;  3PV0 A;  3BVM A;  2EDG A;  3Q6S A;  1SNO A;  2LKV A;  1AW7 A;  3OIQ A;  4PNY A;  5HUR A;  2R61 A;  3H6M A;  4EQP A;  4BWG B;  5NUC A;  3VR4 A;  3M85 A;  2DNE A;  2OXP A;  4KK7 A;  1H9R A;  1HQR D;  3D8G A;  4N9P A;  4IUP A;  3TME A;  5IGE A;  4KY5 A;  1EYC A;  3GO5 A;  4X3S A;  5KGU A;  3TP5 A;  4RHR A;  4F88 A;  1PFB A;  1W6J A;  5T1I A;  5A35 A;  1RTN A;  1K83 B;  2E74 C;  2JSO A;  1AP0 A;  1F9S A;  2E2D C;  1A2U A;  3VYU A;  2EYL A;  3S9W A;  3DWA A;  3NBI A;  1DM0 B;  3SK5 A;  2J7Z A;  4KY7 A;  1QNU A;  3K57 A;  2EYH A;  1HHV A;  4DN4 M;  1HQM C;  2F0Q A;  2XN9 C;  5TSS A;  4RCO A;  3N6R A;  1F9Q A;  2WKC A;  4EQN A;  2QCP X;  1II3 A;  3SHL A;  1Y8O B;  2DNC A;  3URY A;  1PLF A;  3NPP A;  4IUV A;  2X69 A;  2F0V A;  2EY6 A;  4KKT A;  3QG1 A;  1Q12 A;  3NUC A;  4BY1 B;  1BQQ T;  1KAB A;  1JOK A;  1F9P A;  3EA6 A;  5BN4 A;  1SXT A;  2EOT A;  1EFI D;  1JQY D;  2XNA C;  1HUN A;  2KEE A;  3W2D A;  3RUZ A;  5I6Y A;  4KJN A;  5I6W A;  2I07 B;  1ZYR D;  1JWM D;  2A5H A;  1NUC A;  2F0T A;  2PW7 A;  1TWG B;  1WTO A;  2RDG A;  2BA0 A;  3CHB D;  4A3F B;  3BG3 A;  2SDF A;  1HA5 A;  4OIJ A;  4RGO S;  3GV3 A;  4OO1 G;  1BUV T;  4ZKC B;  1SNQ A;  1JWS D;  2B2U A;  4FF3 A;  2NZ1 D;  2Y0S B;  4OIK A;  3BDC A;  5C0X I;  1EY9 A;  3V2T A;  3VR2 A;  2A6H D;  1X3P A;  4HCS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...