1RHPA

Crystal structure of recombinant human platelet factor 4
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
64
structure length
64
Chain Sequence
b'DLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PLATELET FACTOR 4
publication title Crystal structure of recombinant human platelet factor 4.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Platelet factor
total genus 11
structure length 64
sequence length 64
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1994-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1rhpA00
2JYOA 4MHEA 4XT3B 1EIHA 2J7ZA 2MGSA 1WTRA 4NW2A 1VMCA 2B2WA 4ZAIA 2MP1A 1WD1A 1B4OA 1RTNA 5JJZA 2JP1A 5CMDA 1AZPA 2EPBA 1F9QA 1DZ1A 4HEDA 1B50A 1G91A 4CJ2C 1J8IA 2FINB 3DM1A 3IL8A 1IKMA 1B3AA 3TZDA 2IL8A 1G2SA 4ZKCB 3G7LA 1JE4A 1WTXA 1HHVA 3HP3A 1ICWA 2Q8RE 4HSVA 1HUMA 3GV3A 5EPJA 1F9SA 2KVMA 1O7YA 1M8AA 1QG7A 1U4RA 2EOTA 4X3SA 1PDQA 4XT1B 5E4XA 4UAIA 3SVMA 2B2TC 1ZXTA 2NZ1D 2MJ8A 3GV6A 1TVXA 2M2LA 1CM9A 2RA4A 5DNFA 1MI2A 2NWGA 3I8ZA 1HUNA 2K01A 1AZQA 2DY7A 3D6WA 2NYZD 2HCIA 1WVLA 1SDFA 3I3CA 3H91A 2L4NA 5EPLA 5EPKA 4ZK9B 1A15A 3KUPA 3FDTA 3DEPA 1IL8A 1MSHA 2B2TA 1NCVA 2B2UC 2H1EA 3I91A 1F9RA 2FFKB 2X6LA 4IURA 5T1GA 4IUPA 5EJWA 2RVLA 5T1IA 1BBXC 4RAUC 1J9OA 2KUMA 2HUGA 1F9PA 3TN2A 1KNAA 1X3QA 2B2UA 2FMMA 1KNEA 1PLFA 1B53A 4X3TA 1RTOA 1O7ZA 5D14A 1HFNA 2KOLA 1MSGA 4XDXA 1NR4A 1BO0A 4OIKA 5CORA 1WD0A 3N52A 1ILPA 4ZKBB 3FPUB 4U68A 4CJ1B 2D9UA 1WTVA 4DN4M 1LV9A 5COYA 1B2TA 2HDMA 1CA5A 2EE1A 1PFMA 3R93A 5CBAE 2L11A 1PFNA 4IUVA 1SAPA 1EL0A 1PFBA 1SSOA 1HA6A 1JICA 1WTOA 1QNKA 1O80A 2L12A 3MTSA 4HCSA 4IUUA 2B2YC 1WTQA 1G2TA 3F2UA 2K03A 4OIJA 1G6ZA 1WTPA 4QUCA 2XIWA 1X3PA 5EQ0A 5AFWA 1E0BA 1WTWA 4O42A 2L1BA 4IUQA 1ESRA 1XX8A 1X32A 2HDLA 3MWYW 4R9WA 4RWSC 2KEEA 1NAPA 2FHTA 2B2YA 2L9HA 2X69A 2X6GA 4MN3A 5EKIA 1XYIA 2VXWA 4QUFA 1CA6A 1DOMA 1HFGA 1RJTA 1U4PA 3DEOA 4CJ0B 3LWEA 2K04A 1EOTA 1U4LA 4X3UA 2KEDA 2K05A 1U4MA 1EQTA 4X3KA 4R8IA 1ML0D 4IUTA 2Q8TA 1S4ZA 2FJ2A 1NR2A 5D65A 1GUWA 2N88A 2BDNA 3KBXA 1DOLA 2SDFA 1AP0A 1RHPA 3I90A 1BF4A 1IKLA 2B2VC 3ONAB 1Q3LA 2CVRA 1DOKA 3IFDA 2RSOA 1C8CA 1RODA 1F2LA 1VMPA 2HCCA 2K1BA 1DONA 2B2VA 1ILQA 2KECA 2N55A 2R3ZA 4HAEA 1BNZA 2K28A 2RSNA 5E4WC 2DY8A 3P7JA 4RA8A 2MPMA 1HRJA 2B2WC 3Q6SA 4LMQD 1MGSA 1QE6A 3UI2A 4ZLTF 3QO2A 5CBEE 1EIGA
chains in the Genus database with same CATH superfamily
5ELDA 1GVPA 2RQXA 2N49A 2Q2TA 1QVFA 1JB3A 3S2HB 3DMUA 5EKLA 1L0YB 4OELB 4J15A 1HNXL 2K5DA 4C56C 1GKHA 2AQ3B 1QNUA 3GDEA 2CFMA 1G2SA 4X62L 1QUQB 1BCPF 3S17H 4IJLA 3I4MH 4DR6L 4JI6L 4XT1B 3URYA 1R9TB 2A68C 3SVMA 5C3EG 3G4SA 2NZ1D 3FKIB 2RA4A 2JA5B 1MI2A 1IBLL 3NQIA 4JBKA 3G48A 1LTSD 4HCEA 1E2VA 1TU2B 1SYCA 3A7AB 1WTVA 4KK7A 4HN7A 3VA7A 5LHY1 4DAYA 1OXXK 1STAA 4DK1A 2F3VA 4DF7A 2R93B 1O7IA 2DN8A 4DR3L 5IODA 1BVSA 2FMMA 1LTAD 4X3TA 2NN6I 2O4XA 5JEAH 4FF3A 1CFMA 1JMCA 1I3QB 2B3GA 4QIWE 3I56A 1LTID 2BCOA 2JN4A 4G7ZC 4RGNA 4C3IB 1EL0A 3K5OA 1SSOA 3PO2H 1QNKA 3KFUA 1IZ6A 1X9NA 4QUCA 4CDEC 3S16H 2E5LQ 1PH2A 2PNRC 3KJOA 4K8IA 4RH6A 5IYBH 1SJHD 3RLFA 3HOXH 4DV4L 2X69A 3HS0C 4IPHA 1SMYC 1HFGA 1S5ED 4JYAL 4AIMA 4X66L 5C0XG 4A3JH 2Y0SE 5GQOA 1CT1D 2JQOA 1PRTB 2NBFA 4EX5A 1KD1C 3S14H 1AEXA 1X55A 3W2DA 4CBVA 5FOBB 4YWMA 3TP5A 1B8AA 3S1MH 1L1OC 1LO5D 1HH2P 2F0UA 4NPSA 2NVQH 1N34Q 4NXNL 3D31A 1C8CA 5GROA 2EY6A 3AEVA 3H15A 5I6YA 1DONA 1CHPD 2BE5C 1ILQA 2ENBA 2WP8J 2IX1A 1GJXA 4OO1I 3NTKA 3NWSA 5K36G 3A0JA 1QE6A 4UHVA 4K6DA 4Y7NH 5CBEE 5J1ZA 3LNNA 4A3EG 2ES2A 2DNEA 1EU3A 1GO3E 2J7ZA 5KYIA 2G9HD 4ALPA 2F0MA 1HR0L 3PUZA 3RZDH 4V0BA 3D6CA 4O0AA 2NTSA 1B50A 1GUNA 2D62A 4HJ5A 1D5XC 1GUOA 4PG3A 1B9NA 4JI8Q 1VQIA 2R7ZG 2NZOA 1EY9A 3CCEA 4CKEA 5IT9L 2FXQA 3I72A 2UUBL 2Z4IA 4MIUA 2GN5A 1Z7TA 5AJ3L 3E9HA 5C3EB 3GTQB 3K6OA 2E74C 4A3BH 4QCLA 4NXMQ 4APVA 5T1GA 1DD2A 4X64L 2L5TA 3L0OA 1EY7A 4DKAC 4FVMA 1E2ZA 1X3QA 4DXFA 3NBHA 4IUNA 2B8GA 3C1FA 2PNHA 1LTBD 3U4ZA 4IOCA 4A3KH 1SN8A 1CSPA 1LT5D 2NN6G 1EEID 4HIMA 2EYLA 4WJ4A 2PPBC 5KYLA 2EE1A 3I55A 1BQQT 4FXKC 3J80i 2L11A 1QOHA 1TWAH 1TXYA 4A3DG 3ERQA 5FLXc 1VQKA 4ZUIA 4GN5A 5JJLA 4AH6A 1Y1WG 4HIKA 5G3LF 4B3RL 4IUQA 1FL0A 5CV8A 4JI1Q 1G51A 1L1OB 2K5VA 2H5XA 4MTKA 1RJTA 3ULPA 3HFZB 4WORA 4PZ6A 3LWEA 1M1KC 3S1RH 2K05A 4OXPA 3Q23A 1RL2A 4BY7G 1D5ZC 1ML0D 3VR3A 1PYWD 4I65A 3WOEA 2Z0SA 1WOCA 2C35B 1GD7A 1VQAA 5CV6A 3TQYA 3TBIB 4JI5Q 3UDGA 4B9WA 1NUCA 3H09A 4P71A 4DR2L 4DUZL 2DGYA 4XXEA 4HIDA 4K2LA 1SE3A 4QGUA 2Z6KA 2WB1E 1IBML 2XGTA 2K75A 1EQQA 3GO5A 3K8AA 5IYDH 5KRUA 4NMZA 1EUJA 3I4MG 1MKHA 4A3EB 3PO3G 1RTNA 5JJZA 3I73A 1VQHA 2K4KA 1JJ2A 2RCFA 2A73B 1NBWA 5ELBA 2QEXA 4JV5Q 2NVTB 1LABA 3IAYA 3Q0AA 4H02A 1F9SA 3EN2A 5ELNA 3STBC 1QZHA 2UXBL 2R7ZB 1SYDA 2AWOA 1SE8A 1EWCA 1YIJA 3BVZA 1DYQA 2NWGA 3I8ZA 1HUNA 4FDBA 2Q2UA 4RG1A 3H91A 3NQTA 2A8VA 4J6HA 1EY5A 5IYCG 1D8LA 1PA6A 1YNJD 1ICFB 4BS9A 3PSIA 2HUGA 4GN3B 2JEBI 2PW7A 3SK4A 1X6OA 3TEHB 2EZVA 1LT4D 1O7ZA 1I50H 2F0WA 4ME5A 2AUJD 3K5NA 1HNXQ 1NNXA 5CORA 5H1SE 3DWPA 4DNIA 1I6HB 4FF1A 4X62Q 5DM73 4P75A 5FKAC 3HOXG 2NVYH 4DR6Q 4JI6Q 1VQ6A 3K5MA 1TY2A 1D1KA 1PFSA 3MTSA 3K57A 1G2TA 4LFBL 3IRBA 1QVCA 1WTWA 1XPOA 1IBLQ 4A3DB 1X54A 2OT2A 2HDLA 1Y1WB 4KHVA 3K7UC 1SNCA 1VQ8A 1FNVA 3J7A5 1CSQA 1H9RA 2YTVA 3NTIA 4DR3Q 3FMCA 1CKMA 1P16A 3J81c 2UU9L 5C3WA 4IZ8A 3OOCA 1JC7A 3UDFA 2NUCA 1FYCA 2DJGC 2N88A 3NHHA 4NP5A 4BY7B 3VR4A 4DAYB 3C1EA 1O78A 2OQ0A 4K5VA 4PMWA 1STYA 2UXDL 1VQ9A 2BA0A 3I2ZA 2F0DA 4A3LG 1HTPA 2ATWA 4BBSH 1KRTA 3U9SA 2HD3A 1LT3D 3E0JA 3NENA 3MXNA 1STBA 1BNZA 1HRJA 1XPRA 4DV4Q 1SXTA 3VR5A 4Z9CB 4KHZA 4KV6A 4EQOA 4JYAQ 1JWSD 4YWKA 4X66Q 5C4JH 5IP7G 4FYDA 3I4MB 3N6RA 4CJ2C 1Z9FA 3PO3B 2Q2IA 4C3HH 3HRZC 1WTXA 4HSVA 4A3IH 4C2MB 1O7YA 2EOTA 4P72A 4NXNQ 3K59A 3L2PA 3CRLC 1ZXTA 3FP9A 3JAME 2E2DC 3S1NH 2NZHA 2L4NA 2ZJPA 1Q82C 2KHIA 3KUPA 4ZQ3A 5CV7A 4A3KG 2A69D 3DUZA 2JE6I 2JXMB 3V96A 2ZJQA 1HR0Q 1PZJD 1RKNA 1HZBA 1YEZA 3SHLA 1RDPD 4EQNA 5DLQE 1MIUA 3HOVG 1VQGA 2YTYA 4IOAA 1KDCA 3S16B 1PFMA 1XWEA 2Y0SG 4KY5A 1CTMA 1M4VA 1UE7A 3HOXB 4QQBX 4YY3L 2UUBQ 4KD3A 1WTPA 5AJ3Q 2XIWA 2G5DA 4EVOA 4GNXA 4KHPL 3V2TA 5E3FA 1X32A 3I4NG 3K0YA 4FF4A 3S14B 4X64Q 3I7FA 4HJAA 4CJ0B 4XYOA 2Z6BA 1IW7D 2O5IC 4LF7L 5ISRA 4X3UA 3CCJA 3H6MA 4CDFC 1JB7A 4GOPA 3X3NA 3EFXD 2K5QA 2QA4A 2NVQB 2IY5B 1K8AC 4A3GG 5GAEC 4R4OA 1HQMC 1C4QA 3E3XA 5JPNC 2O2LD 2VW9A 2IPKD 1D1IA 1PV4A 5IYDG 3M3YH 2I5LX 2VB2X 1KABA 2F52A 3D4WA 3H3VI 4POGA 2RSNA 1EOVA 4JW0A 4B3RQ 4ABNA 5GADC 4IPDA 5C4ZA 2F0PA 4JCVE 1VQLA 3KOJA 4BXXG 2YV5A 4JI3Q 3NTHA 1B9MA 1B4OA 5M3FG 1VQ5A 1TWFB 1DZ1A 3SK8A 5IGGA 3IKJA 2F0NA 2FINB 4BA2I 3M4OB 1DJRD 1CQFA 4UY8C 2CQOA 2CWPA 2ZXRA 1ICWA 2RBMA 3DM3A 1OXTA 1BCPD 3GV3A 3MXGA 5E7NA 1V43A 4JBMA 5C4XG 2LMCB 5DNFA 1RCVD 2LY7A 1PVOA 1D7QA 2DY7A 3TREA 4DR2Q 4DU9A 1LACA 1SDFA 4QIWB 4UDUC 4BA1I 3I91A 1L2FA 1PTOC 3H0GG 2FFKB 3I4OA 1IBMQ 4K0KL 5T1IA 1QVGA 4A3KB 2GVBA 1SE4A 2M00A 4XTCS 1VQPA 4DV2Q 2JA8H 1KNEA 2A19A 1PZID 2KOLA 1JCKB 2I5MX 2R92H 2RDHA 1A3UA 3HOUH 4IFDH 1SROA 5BR8L 2HDMA 1CA5A 2HT1A 3HOVB 1B2TA 4XQQA 2RF4A 3HKSA 5M9OA 2UXBQ 3HOZH 2Y0SB 2ZTCA 3DLLA 2WAQG 2PCFB 2VL6A 2XTIA 4TSSA 3OHXC 5DEHA 2PQEA 3S2DB 4LUOA 4DV1L 1S5BD 2NTTA 1EY8A 1E1TA 4DA2A 2VXWA 2QF7A 1MD2D 3R2IA 3VYTA 3KBGA 1AW7A 4OWTB 1LT6D 3I4NB 5C5LA 3CAMA 3CPWA 1PH4A 3BS1A 3F2BA 2WB1G 3M7NA 2SNSA 2UXCL 1S40A 5BN3A 1K8OA 1TIID 3CF5A 3EROA 3PIOA 4P74A 4JOIC 1KQSA 3ONAB 4A3GB 4GZYC 1DOKA 3EVQA 1RODA 4KKSA 3I70A 3GTJB 1W6JA 3GD7A 4LNQA 2V4DA 4LFBQ 2KECA 2R3ZA 2KQ3A 2K28A 3SK6A 3K58A 4KLKA 1K8GA 5ELEA 4CDDC 1I4QA 4C3HG 3M9BA 3K80C 4H44C 4A3CH 4A3IG 4IN3A 4IJHA 3QR8A 3OYYA 4B3TL 2JP1A 5CMDA 2OXPA 4RKBA 4JI4L 1EYCA 3C46A 5I9OA 3D0FA 2UU9Q 1GOZA 1Q46A 3J80E 5M3FB 1SNPA 4JK1C 4DK6C 1HHVA 3HP3A 2PZTA 2SOBA 1PYBA 1KDBA 4L6TB 1PRTC 1Q81C 5E4XA 5DAUA 3ND9A 4G7OC 1YZ6A 2UXDQ 1PH9A 2L55A 4PMBA 5C4XB 1WJJA 5C44H 4IFDI 2EIFA 5D3DA 5IIFA 2B2UC 3QG1A 4IUPA 3GTGB 3BDLA 5JAVA 1HZAA 1KHIA 3H0GB 1W3SA 3K7AH 4L5SA 1OO9B 2KCNA 3T56B 4PMCA 1HFNA 4OO1H 3WOFA 1YNND 1WCMH 2J0TD 3FVQA 1JQYD 4OONA 3NELA 1XXGA 4DR5L 3E5SA 4TVAB 5JJIA 4H0LC 3HOYH 4A93H 2E2JB 3S1QH 3TMEA 4KI0A 5IGEA 2JA6H 1K3BC 3MEHA 5HGQA 1DXMA 1K73C 1A2TA 2WAQB 5G3LD 3MFYA 1HZ9A 1CK1A 1ZYRD 4RWSC 1NAPA 1TS4A 2K33A 2XVSA 3CCLA 2A6HD 1Z6HA 3GTLH 3WDNA 3J81j 3F2CA 2KBNA 3Q22A 1TWGH 3F8TA 4OX9Q 1IHZA 1WTHA 5EBDA 2F3IA 3U58A 2LKVA 2WB1B 4HIOA 4LF8Q 2AHOB 4LF6L 5FO7B 2M9VA 4GLAC 1S5CD 4IQZA 3ERSX 3OMCA 3E6ZX 4YY3Q 2OTLA 4EQ5A 1SJED 1SNDA 1SMXA 2A68D 4HAEA 1S3OA 1T9HA 3I4LA 2YYZA 2PQAA 3UI2A 4GKKL 1GHJA 3QWNA 4XT3B 4C3HB 2HIXA 4ZAIA 2NVXH 4A3FH 3CC2A 4LF7Q 4A3IB 2EPBA 4GNXB 2EYPA 3J81i 3S15B 3CRKC 3FPPA 2VY3A 2E2IH 3MFGA 1FNWA 5LMUL 5IGCA 2CW0D 4XYQA 3S1NB 2N78A 4X3SA 3KF6A 1OXSC 2V1CC 5LL6S 4IPCA 4GOPB 4BBRH 3G6JB 5BN5A 3AFPA 1FVIA 2K5NA 5EBCA 3A8KE 3MWYW 3L3OC 2B2TA 1T5XD 1Y69U 2MNAA 3GTPH 2XRSD 1H9SA 3BVGA 1MSGA 1QILA 1UE1A 3GTMH 2F0SA 2LXJA 1BO0A 1ILPA 4OWWB 1Q12A 1YHBA 1HA5A 4U68A 5BN4A 2D9UA 1LTGD 1LV9A 3MHBA 2A74C 5LMNL 3NWTA 3CCRA 1EQVA 3GTOH 1ET9A 1VQNA 4C1NK 2EYHA 1O80A 2G9DA 2K03A 5IGBA 1VF5C 4NB3A 4DR1L 1MBYA 1MJEA 2F03A 1IYUA 3AMUA 4L5QA 3PUXA 2PW5A 3NK9A 1ET6A 2KEEA 3PMFA 1U5KA 2B2YA 2A5HA 2JSOA 1ENAA 2KA7A 5M3MG 2ZTEA 3DWAA 2ZXPA 4FF2A 3D4DA 1SRUA 4OEMB 3A8IE 1GUWA 3M3YB 5M5WB 2B2VC 4C3JH 5BR8Q 5I2YA 1TWCH 2B63H 4A3CG 1PRTF 3T16A 1VQMA 3RZOH 5J22A 1VMPA 1PH8A 1SNMA 1UWVA 3P7JA 4RA8A 5JVH3 4DV1Q 3Q6SA 4LMQD 1W6KA 1I4HA 1VQ4A 1Y1VG 5CR3A 2QDLA 1L0XB 2N3SA 3CQZH 1YHAA 4CHTB 3QOLA 3JAMc 2B2WA 4S3SA 2WAQE 2K7VA 3BU2A 1GUTA 4HJ8A 5ELFA 3IL8A 4UPAA 5EAYA 5C44G 2OQKA 4RHRA 2XN9C 2JJQA 4JG2A 4A75A 3ULLA 1B7YB 4CGYB 3SGIA 1IXRA 3VA5A 4OO1G 1TQOA 3A8JE 2H1EA 3OW2A 3KLSA 2HHHL 2F1MA 1VS0A 1YNJC 2ZJRA 3VYSA 1RIPA 3PV0A 1KNAA 4B3ML 4B08A 1Q1BA 2A6ED 2B8FA 4JI4Q 4B3SL 1FJGL 2JA6G 1HZCA 4DNRB 2WKDA 4OIKA 4DUYL 2CCZA 1R4QB 1LUZA 1KRSA 1C9OA 4PQXA 4L5TA 5CV9A 1K8MA 2OCEA 5CBAE 2EVBA 2E2HH 1HPCA 1HA6A 5JEAG 1JICA 5KNCA 3KF8A 1EIYB 1Y8PB 2RDGA 5AFWA 4O42A 2GA4B 4RGMA 1JWMD 3VYUA 2WINB 3CCQA 3K81C 5CYUA 3BYTB 5EGTA 3UDXA 3HOWH 5EKIA 5KIXA 3PO2G 4F8MA 1A63A 1E2WA 5C5MA 1V1PB 3VR2A 4UP8A 1S72A 3PIO3 5IYBG 1HQRD 2EY2A 4ME3A 3RD4A 2Q8TA 4KN4C 1WFQA 4LFCL 5M3MB 3SR1A 3SEBA 2SDFA 4DV7L 1EWIA 1SEBD 1D2BA 1IKLA 2L0CA 1NY4A 3QOJA 5LL6X 4DR5Q 5K5PA 3NE5B 4Q0FA 4A3JG 2K5WA 3S2HH 5M5XB 1TY0A 1IBKL 1TWHB 4DV0L 1A62A 5E4WC 1I6VC 4QB4A 1KIXA 5ELCA 1PH6A 2PO4A 5JOBA 3FRPB 2B39A 1EWHA 2DNCA 4I7ZC 2F3WA 1V8QA 1G291 1R9TH 3G71A 1Y1VB 4DK3C 3FKIH 2MP1A 1WD1A 2JA5H 2JEAI 2ZTDA 4GLVB 5DM63 3D3RA 1B3AA 3L9AX 2DJFC 1YBYA 3TZDA 1F77A 1JE4A 1JJCB 2KHJA 4LFAL 1YNXA 3KDFA 3BZKA 1U4RA 5C44B 4LF6Q 4C1NI 2ALYB 1F2YA 2AKWB 5HURA 3W1GA 4QF4A 2E76C 2M2LA 1B70B 2K01A 4JI2L 3K7AB 4E6IA 4K6LA 4P2CB 5FLMH 4YHHL 3FDTA 4CDCC 1IL8A 3K0XA 1KC8C 3WWVA 4GN4B 4BWGB 2FMCA 2F4VL 3S17B 1YITA 4GKKQ 5EJWA 4ID6A 2A69C 3TS2A 3BVMA 4C3IH 4DPGA 3S9WA 4IALA 2F0OA 3H3VH 3MZ5A 2CKZB 4A3BG 1NSNS 5JEAJ 5KGUA 1V1QA 4ODGA 5JPMC 2MQHA 2R6GA 2F0HA 1HR0W 5IWAL 1KLUD 1II3A 2E75C 2JA6B 5FLXE 3LGJA 3CHBD 4G57A 1NTGA 2R61A 3PQIA 1PMRA 1SYGA 2KCTA 1B1ZA 1X3PA 1E0BA 2F4IA 1GUGA 3PUWA 4DV5L 1C0AA 4B9XA 4KD4A 2CH4W 5L37A 5LMNW 3JC66 1BKBA 1FNUA 1CA6A 1PYSB 3A5UA 1AFPA 4DAVA 1WYDA 1E24A 1IW7C 4YIJA 3PO2B 3HEJA 1CQVA 2F0LA 4IUTA 2FJ2A 2XWBB 5GAGC 2QKIC 2CQAA 3D8GA 2YTXA 1K83H 3DWQA 2AMCB 5LMNQ 1H9SB 2E8GA 5M5YH 3J80c 4A3JB 1HJPA 4X65L 1I94L 5KNBA 5E1FA 3CU7A 1PZKD 3S1MB 5IP9H 2E5LL 3Q8DA 2K14A 1A8VA 3FEWX 1EFWA 1EIHA 2C9OA 1DGSA 3RN5A 3MC0B 4F87A 2RHQB 1CKOA 5C3EH 3OPOA 3HZXA 1I4PA 3GTQH 1J8IA 2RDFA 3A54A 3RUZA 1CI3M 2IL8A 3NBHB 3A55A 4Y7NB 4PZ8A 1BCPC 1QG7A 2F0GA 1WI5A 3HGBA 2WFWA 1Q8KA 4UAIA 3E0EA 1N34L 2GVAA 1STEA 3RZDB 3A5ZB 4RKLA 4LUZA 4RCNA 1VQJA 3DEPA 4IURA 2IX0A 1E1OA 2J4XA 4RCOA 4N8X1 3GTMB 2MHVA 3T13A 3JAML 2KUMA 2EQSA 1F9PA 4YCUA 5IY0A 4QL5A 1MJCA 1VCIA 2EYOA 2PZUA 3CKIB 4A3BB 4R4IA 1HXYD 3FPUB 1JORA 1S5FD 1U0LA 2Q8IB 1RF2D 1XTCD 1CZWA 3Q24A 3SE0A 2QILA 4DUZQ 3HOWG 1LTLA 3AU7A 2VUMH 4WJWA 1WTOA 3PF5A 1D5MC 2UUCL 5JJKA 4WRDA 2Z1CA 5C0XH 4J8QA 2D5DA 5IE8A 4PZ7A 1XX8A 5A2QE 2FHTA 2B29A 4OHJA 2EY1A 4MN3A 4OGQC 3J81E 2F0EA 2HHHQ 4CKCA 1H9MA 1TWAB 4XQNA 2K04A 1AN8A 1KL9A 3BDCA 4B3MQ 1EQTA 2IWHA 1K3RA 4GLXA 1CZGA 1FJGQ 4B3SQ 4L5RC 2AUKA 4DUYQ 3KBXA 2AWNA 1BXTA 4XQJA 1G6PA 3AYHB 1ASZA 5K36H 3UE1A 1X3GA 2CVRA 5ELOA 4F7XA 3S1RB 1L1OA 1XTDA 2WIIB 1NE3A 3LX0A 3U9OA 1Q7YC 1K28A 4XIGS 1SBBB 4KJNA 1CKNA 1UUPA 4MHEA 1ESFA 4BBSG 3SDZA 1BCPB 2WACA 1H9KA 3KF8B 1AZPA 1SNQA 1G91A 1ONLA 3DM1A 3CXCA 3T51B 4LFCQ 1EYDA 4N9PA 5FLMG 4DV7Q 3T53B 1HUMA 1N9WA 3TDQA 1GHKA 1SE2A 3NBIA 1A3VA 4OWXB 1UAPA 1XNRL 1KTKA 1VQBA 1LTRD 1W2BA 1X56A 1IBKQ 4DV0Q 1A15A 1MSHA 1Z47A 2X6LA 2F0IA 1TS3A 2QCPX 4EGVA 4UP9A 1JOOA 1XMOL 3OTOL 1KLGD 5C0XI 1YJ9A 3IFTA 4P73A 3TS0A 2K52A 4TQUS 1STHA 4L8JA 1V1OA 1YNNC 3N52A 4DV6L 3PUVA 4RFBA 1Y1WH 4GNXC 2VQFL 4LFAQ 4HMJA 2ICEC 2R7FA 1VQFA 5EKKA 2MUYA 3HOWB 1QWYA 4OIJA 1I50B 3PCOB 3F1ZA 4JI2Q 2OF1A 3U50C 4BY7H 1ASYA 4TRDA 4YHHQ 4DAPA 4A76A 1ZYRC 4GOPC 3A7LA 3TZUA 3KDFB 4DV3L 2F4VQ 4GS3A 4QUFA 2NVYB 3MXNB 2A6HC 3GTKH 2PI2A 1EZ8A 4A4IA 4DXGA 1YI2A 4O2DA 1UE6A 3PUYA 3CCVA 3MXUA 4RHSA 1FGBD 2AQ2B 1T5EA 5IWAQ 2K50A 5IP9G 1I4RA 4N9TA 1E3PA 2PMZE 1PRTD 2IT1A 2K1BA 3QJYA 4LW1A 2XSCA 1YJNA 1OXUA 3PO3H 2AQ1B 4DV5Q 4Y52H 3KYHC 1TR5A 4G4KA 2Z9HA 4FXDA 2C5CA 1WVLA 4C2MH 2SNMA 2ZT9C 5D3IB 2CWAA 1SYEA 4BBSB 4R4TA 1N32L 4LJZC 4HEDA 4HSPA 3RMHA 1IKMA 5IT9E 4JPBW 3PIPA 4ZKCB 3NSWA 4M1UB 1EYGA 2VQEL 3M4QA 4A3MH 5IYCH 3RLOA 1PDQA 2CW0C 3B6YA 4JI0L 3J80L 4KHPQ 5C4JB 1F2MA 2IW3A 5J39A 5C6AA 1PTOF 2D0PA 5I9PA 4X65Q 1I94Q 1A2UA 1SFOH 4JI7L 3CMEA 1V9PA 2RVLA 1BDOA 4K8JA 2HQEA 5I2XA 4MZ9A 3MXPA 2VUMG 1RTOA 4BY1H 1AE2A 4DNTB 3R3OA 1Q1EA 2IHEA 2XRQD 5COYA 2Z4HA 4KY6A 3CCSA 3BJUA 2JA8G 3RR5A 1SAPA 4DR7L 1C48A 3EIVA 1NMFA 1WTQA 3P75A 1G6ZA 3MVVA 2R92G 4DR4L 3HOUG 4IFDG 1EQRA 4RMFA 3OWFA 3P1HA 4R4QA 1SMYD 5F2DA 3HOZG 4PNYA 2F0VA 2JA9A 1SLJA 4AQYL 1K83B 4A3LH 3EJIA 1SR3A 3NUCA 2BDNA 1EU4A 1UNSA 5M5YB 5I6WA 4KJOA 4JBJA 1I5FA 4DK0A 1QCBD 5TSSA 3A74A 1F2LA 3J7ZC 2BE5D 1TWFH 1KAAA 2QDBA 2UUCQ 4F88A 1QB5D 4K0KQ 5IP7H 2DY8A 3M4OH 2K6AA 4FO2A 3J7YW 1J5EL 2VB3X 2F0KA 2YU9H 5FK9C 2JYOA 2K32A 3J7AV 1FGUA 2JK8A 4YCVA 3ZJYC 4NW2A 1X3EA 1PXUA 4NDXA 3ITPA 1A6XA 3VR6A 1DM0B 5EPJA 2KVMA 2LSSA 1VQOA 4LF9L 1JR0D 1STGA 3HKZG 3ULJA 1EIFA 1IL2A 2EJMA 3A56A 2BOSA 1Y8OB 3D6WA 3OIPA 4H7BA 1NJIC 2QEJC 5EPLA 4H13C 1VQCA 4G7HC 1NMGA 5C0XJ 3HOVH 5C3XA 1JWUD 1BBWA 1HTLD 5IGDA 2UXCQ 1YVCA 1AH9A 1XMQL 1N33L 4AYBG 2BDOA 2H4OA 2A6EC 1J6QA 3EA6A 4JI3L 2JA7H 3S2DH 4R1JA 1WD0A 1HNZL 3D4RA 2VUMB 2EXZA 1ZEQX 3TSSA 1A0IA 2ZM6L 1CKNB 2IX3A 4IFDJ 2I0QA 2CH4A 3OWEB 4DN4M 3T1YL 3NEMA 3RLNA 3CMAA 3F2DA 4GKJL 1PFNA 3W1BA 3I4NH 1PFBA 2I5HA 2PYKA 1XNRQ 1QJOA 1SYFA 2JA8B 1WCMG 5CV5A 4PV1C 1XNQL 2ASBA 1ESRA 4LF5L 1D6EC 2EYJA 3VDYA 2R92B 4YCWA 3CCMA 4A3GH 3HOUB 3HOYG 1LM0A 2X6GA 4B3TQ 4A93G 2RHSB 1Q86C 1XMOQ 5FJ8H 4HMIA 1BBUA 1ZKOA 3OTOQ 3GTJH 2Q2HA 3HOZB 2MO0A 3NXWA 4X3KA 2UUAL 1ENCA 4FP5D 1S4ZA 4DV2L 4LF4L 1TS2A 4TKOB 1XJVA 4RGOS 3SK5A 1AP0A 1EEFD 1RHPA 5GAHC 4DV6Q 2VNUD 4JVZA 3OW7A 2EJFC 2VQFQ 2VS1A 2K5HA 4DAMA 4BXXH 2CHBD 1YJWA 1SNOA 2D2CC 2N55A 4EQPA 4WFN3 5M3FH 3FHWA 1UEAB 3BZCA 1MGSA 2A1AA 3T1HL 1PTOH 4O1NA 3DXJC 5FO8B 3CPFA 4ZRZA 2BH2A 1XPUA 4DV3Q 3DHQA 4ILWA 2MGSA 2EYMA 4A3MG 4ULLA 2HQLA 5C4XH 2ZXOA 2ICIA 3M85A 5I4DA 4ZUJA 2F0JA 3G7LA 3MEFA 3MA2B 3TRZA 4MTNA 3GTGH 4A3FG 1M8AA 3H0GH 3STBD 1PHJA 3AQQA 2BA1A 2B2TC 2MJ8A 1IYVA 1TVXA 1K0RA 4DGZA 3J7AF 5HY6A 1Q90A 4K2KA 2NYZD 2HCIA 3CP0A 3E9IA 3HKZB 3P20A 3I3CA 1DCZA 3R8BA 5CC4A 5IGFA 4BY1G 3V05A 1TS5A 2LXKA 2XNAC 1BBXC 4YWLA 3MAQA 1VDZA 3TN2A 1JT8A 3L7ZC 2IHFA 2WV6D 4BBRG 4LUVA 2E2JH 1PLFA 1U9RA 2L15A 3QB3A 1N32Q 1GXDC 4KKTA 1C7YA 2R93H 1H9JA 4AYBB 3W3AA 3UDIA 1Y8NB 4I7AA 2O5JC 1I4XA 2VQEQ 2IJ0A 3RN2A 3GP7A 1BOSA 3R93A 3LWUA 4U673 4IUVA 1I3QH 1KDAA 4JI0Q 5C4HA 1HNWL 1STNA 4IUUA 2SEBD 2B2YC 1RD9D 3NP8A 1N36L 1BUVT 5EQ0A 4K14A 1IYJB 3GTKB 1WCMB 2KENA 3ND8A 1QUQA 1KXLA 4JI7Q 1VF7A 1DOMA 1U4PA 3DEOA 1OTCA 3BG3A 3HOYB 4A93B 2PQAB 4KMUC 1JOKA 3TP7A 3S1QB 2KEDA 3M7GA 3OIQA 5LMUQ 3H94A 3AFQA 2MO1A 1CHQD 3OSOA 3BZDB 3KJPA 4K5WA 3GTLB 1FR3A 4DR7Q 2HCCA 1TWGB 4JOIA 4HJ7A 3S15H 4ZYSA 4DR4Q 3KF6B 1EY4A 2B2WC 4C3JG 3CD6A 1CUKA 4HR7B 4ZLTF 3RNUA 2B63G 1EIGA 2XWJB 3KLSX 2OWOA 2EY5A 2R7DA 1YHQA 3PF4A 1WTRA 4KKUA 1M90C 3PIP3 1F9QA 1X3FA 3VYRA 4AQYQ 4A3MB 4KY7A 3CCUA 1G8ZD 4JBWA 3C2PA 4OX9L 1F2ZA 2Z6KC 3AB9A 3CC4A 4LK1C 3KK7A 2RKSA 3TP8A 4LF8L 4QJFA 4DR1Q 2NVXB 2D0OA 4OL7A 1HCZA 4A3FB 1CM9A 1LTTD 1SFOB 4L63B 2F0FA 4WJ3M 3CW2C 1Q8IA 1Y14B 1FD7D 5EPKA 2JA7G 1LLRD 4X6AH 1F9RA 4R4CA 2E2IB 1J5EQ 4BY1B 1PH3A 4V190 1I4GA 4RAUC 1J9OA 2EDGA 4HTHA 2OEOA 4ZCKA 5CV4A 2B2UA 2QGQA 4Q5VA 1B53A 5D14A 4LAAA 4BBRB 4XDXA 1NR4A 4QMGA 4RGTA 1H95A 3O13A 2RCNA 2Z8LA 3KLWA 3GTPB 4KTAA 1O7LA 5FJ8G 2KCCA 2L12A 4LF9Q 3F2UA 1VQEA 2P5ZX 3KLRA 5FLXL 2L1BA 1A3TA 4QY7A 2PI2E 4FNFA 1OXVA 4KN7C 5M5WH 1EZ6A 2L9HA 2EXDA 4LWCA 2PMZB 1K9MC 3HKZE 3GTOB 2I07B 1U4LA 1L0WA 1U4MA 1XMQQ 1N33Q 1UE5A 3R2TA 2DUDA 1N8RC 1HNZQ 1DOLA 4JI8L 2MFIA 2ZM6Q 4MNOA 1BF4A 1JJGA 3X3MA 1Q3LA 3T1YQ 2F0QA 3BYYB 2BH8A 4FXGC 4GKJQ 1R4PB 1GM5A 2KHSA 5FO9B 2TMPA 4AYBE 2YU9B 5IT9c 1S5DD 4NXML 1XNQQ 1PH5A 1B44D 1X65A 1EY6A 5KEEA 4LF5Q 3M4YA 4HJ9A 2LFNA 4C3JB 2B63B 1B3QA 1TWCB 3RZOB 1VMCA 3ZYYX 1PH7A 4NKLA 2UUAQ 1SYBA 1EY0A 4CKBA 2QW7A 2WKCA 4LF4Q 2KCMA 4A3EH 2Q8RE 4R8NA 3U4VA 3FKIG 2JA5G 2NVTH 1VQ7A 1JOQA 3CQZB 4POFA 3GQBA 3GV6A 1JE5A 3W5OA 2NB0A 1AZQA 4M8AA 5HGTA 4ZK9B 3C3LA 2EJGC 3T4AC 1PTOD 2TSSA 4JI1L 2R7ZH 1NCVA 3HG9A 2R93G 3NPPA 3T1HQ 2PZWA 2JA7B 2KJXA 1E7ZA 1K0SA 2N8NA 4UP7A 5NUCA 1EYAA 1ENFA 3ER0A 5IOCA 1MHWC 4IPGA 2VZAA 4ZKBB 4CJ1B 2F0TA 4C3IG 3BDOA 4JI5L 3EQLC 5JVG3 2ID0A 1I6HH 3K5LA 4HCSA 4K5XA 5A35A 5CGKA 5M3MH 2NN6H 5KNDA 4R9WA 5J3BA 4J1MA 3JAMi 4N8FA 1XYIA 4A3DH 2E2HB 1P8LA 5A2QL 3PGZA 1EOTA 3H3VC 1GUSA 5M5XH 4JV5L 2OTJA 1AE3A 1TWHH 4R8IA 3J81L 2LS01 1NR2A 5D65A 1LYLA 1QZGA 3S24A 3I90A 1BR9A 1TT2A 2I46A 2EYFA 1EFID 3M4PA 3IFDA 3G6EA 1E22A 3TP6A 2RSOA 1Y1VH 4IO9A 3EBEA 1PH1A 1PTOB 1HNWQ 2B2VA 3QIAA 3OMGA 1N36Q 4DFAA 1TKWB 1VQDA 4JC0A 3SXHA 2MPMA 1UEBA 1KAWA 1V1PA 3CC7A 3ICEA 3QO2A 2HIVA 3UE0A
chains in the Genus database with same CATH topology
5ELDA 2RQXA 1JB3A 3S2HB 3DMUA 5EKLA 1L0YB 2K5DA 4C56C 2AQ3B 1QNUA 1G2SA 1BCPF 4XT1B 3URYA 1R9TB 2A68C 3SVMA 2NZ1D 3FKIB 2RA4A 2JA5B 1MI2A 3NQIA 4HCEA 1LTSD 1E2VA 1TU2B 1SYCA 3A7AB 1WTVA 4KK7A 4HN7A 3VA7A 5LHY1 4DAYA 1OXXK 1STAA 4DK1A 2F3VA 4DF7A 2R93B 2DN8A 5IODA 2FMMA 1LTAD 4X3TA 2NN6I 2O4XA 5JEAH 4FF3A 1CFMA 1I3QB 1LTID 2BCOA 4G7ZC 4RGNA 4C3IB 1EL0A 3K5OA 1SSOA 1QNKA 4QUCA 2PNRC 4K8IA 4RH6A 1SJHD 3RLFA 2X69A 3HS0C 1SMYC 1HFGA 1S5ED 5C0XG 1CT1D 1PRTB 2NBFA 1AEXA 3W2DA 4CBVA 5FOBB 3TP5A 1LO5D 2F0UA 3D31A 1C8CA 2EY6A 5I6YA 1DONA 1CHPD 2BE5C 1ILQA 2ENBA 2WP8J 2IX1A 1GJXA 4OO1I 3NTKA 3NWSA 5K36G 1QE6A 4K6DA 5CBEE 5J1ZA 3LNNA 2DNEA 1EU3A 2J7ZA 5KYIA 2G9HD 2F0MA 3PUZA 4V0BA 3D6CA 2NTSA 1B50A 1GUNA 2D62A 1D5XC 1GUOA 1B9NA 1EY9A 4CKEA 5IT9L 3I72A 2Z4IA 4MIUA 1Z7TA 5C3EB 3GTQB 3K6OA 2E74C 4QCLA 5T1GA 1DD2A 2L5TA 1EY7A 4FVMA 1E2ZA 1X3QA 4DXFA 3NBHA 4IUNA 2B8GA 3C1FA 1LTBD 1LT5D 2NN6G 1EEID 2EYLA 2PPBC 5KYLA 2EE1A 1BQQT 4FXKC 2L11A 1QOHA 3ERQA 4ZUIA 5G3LF 4IUQA 5CV8A 1RJTA 4WORA 3LWEA 2K05A 3Q23A 1D5ZC 1ML0D 3VR3A 1PYWD 4I65A 3WOEA 5CV6A 3TBIB 4B9WA 1NUCA 3H09A 4XXEA 4K2LA 1SE3A 3GO5A 5KRUA 4NMZA 4A3EB 1RTNA 5JJZA 3I73A 5ELBA 2A73B 2NVTB 1LABA 3IAYA 3Q0AA 1F9SA 2R7ZB 1SYDA 2AWOA 1EWCA 3BVZA 1DYQA 2NWGA 3I8ZA 1HUNA 3H91A 3NQTA 4J6HA 1EY5A 1YNJD 4BS9A 2HUGA 2JEBI 2PW7A 3SK4A 2EZVA 1LT4D 1O7ZA 2F0WA 4ME5A 2AUJD 3K5NA 5CORA 3DWPA 1I6HB 4FF1A 5DM73 5FKAC 3K5MA 1TY2A 1D1KA 3MTSA 3K57A 1G2TA 1WTWA 4A3DB 2OT2A 2HDLA 1Y1WB 4KHVA 1SNCA 1FNVA 1H9RA 3NTIA 3FMCA 5C3WA 4IZ8A 3OOCA 1JC7A 2NUCA 1FYCA 2N88A 3NHHA 4NP5A 4BY7B 3VR4A 3C1EA 1O78A 4K5VA 4PMWA 1STYA 2BA0A 2F0DA 1HTPA 3U9SA 1LT3D 3E0JA 3MXNA 1STBA 1BNZA 1HRJA 1SXTA 3VR5A 4Z9CB 4KHZA 4KV6A 4EQOA 1JWSD 4FYDA 3I4MB 3N6RA 4CJ2C 3PO3B 3HRZC 1WTXA 4HSVA 4C2MB 1O7YA 2EOTA 3K59A 3CRLC 1ZXTA 3JAME 2E2DC 2L4NA 3KUPA 4ZQ3A 5CV7A 2A69D 3DUZA 2JE6I 2JXMB 3V96A 1PZJD 1RKNA 3SHLA 1RDPD 4EQNA 1KDCA 3S16B 1PFMA 1XWEA 4KY5A 1CTMA 1M4VA 3HOXB 4KD3A 1WTPA 2XIWA 4EVOA 3V2TA 5E3FA 1X32A 3K0YA 4FF4A 3S14B 4CJ0B 4XYOA 2O5IC 1IW7D 5ISRA 4X3UA 3H6MA 2NVQB 3X3NA 3EFXD 2K5QA 1HQMC 1C4QA 5JPNC 2O2LD 2IPKD 1D1IA 2VB2X 1KABA 3D4WA 2RSNA 4ABNA 5C4ZA 2F0PA 3NTHA 1B9MA 1B4OA 1TWFB 1DZ1A 3SK8A 5IGGA 3IKJA 2F0NA 2FINB 4BA2I 3M4OB 1DJRD 1CQFA 2ZXRA 1ICWA 2RBMA 1OXTA 1BCPD 3GV3A 3MXGA 1V43A 2LMCB 5DNFA 1RCVD 2LY7A 2DY7A 4DU9A 1LACA 1SDFA 4QIWB 4UDUC 4BA1I 3I91A 1PTOC 2FFKB 5T1IA 4A3KB 1SE4A 2M00A 4XTCS 1KNEA 1PZID 2KOLA 1JCKB 2RDHA 1A3UA 4IFDH 1B2TA 2HDMA 1CA5A 3HOVB 4XQQA 5M9OA 2Y0SB 2PCFB 4TSSA 3OHXC 5DEHA 2PQEA 3S2DB 1S5BD 2NTTA 1EY8A 4DA2A 2VXWA 2QF7A 1MD2D 3R2IA 3VYTA 3KBGA 1AW7A 1LT6D 3I4NB 5C5LA 3BS1A 3M7NA 2SNSA 5BN3A 1K8OA 1TIID 3EROA 4GZYC 3ONAB 4A3GB 1DOKA 3EVQA 1RODA 4KKSA 3I70A 3GTJB 1W6JA 3GD7A 2V4DA 2KECA 2R3ZA 2KQ3A 2K28A 3SK6A 3K58A 5ELEA 1I4QA 4C3HG 4H44C 4IN3A 2JP1A 5CMDA 2OXPA 4RKBA 3C46A 1EYCA 5I9OA 1GOZA 3J80E 5M3FB 1SNPA 4JK1C 1HHVA 3HP3A 2PZTA 2SOBA 4L6TB 1KDBA 1PRTC 5E4XA 5DAUA 3ND9A 4G7OC 2L55A 4PMBA 5C4XB 4IFDI 5IIFA 5D3DA 2B2UC 3QG1A 4IUPA 3GTGB 3BDLA 5JAVA 3H0GB 1OO9B 2KCNA 3T56B 4PMCA 1HFNA 4OO1H 3WOFA 1YNND 2J0TD 3FVQA 1JQYD 1XXGA 3E5SA 4H0LC 2E2JB 3TMEA 4KI0A 5IGEA 3MEHA 1DXMA 1A2TA 2WAQB 5G3LD 3MFYA 1CK1A 1ZYRD 4RWSC 1NAPA 1TS4A 2K33A 2XVSA 2A6HD 1Z6HA 3WDNA 3Q22A 1IHZA 5EBDA 2LKVA 2WB1B 5FO7B 2M9VA 1S5CD 4IQZA 3OMCA 3E6ZX 1SJED 1SNDA 2A68D 4HAEA 3I4LA 2YYZA 3UI2A 1GHJA 3QWNA 4XT3B 4C3HB 4ZAIA 4A3IB 2EPBA 2EYPA 3S15B 3CRKC 3FPPA 3MFGA 1FNWA 5IGCA 2CW0D 4XYQA 3S1NB 4X3SA 1OXSC 5LL6S 5BN5A 3G6JB 5EBCA 3A8KE 3MWYW 3L3OC 2B2TA 1T5XD 1Y69U 2XRSD 1H9SA 3BVGA 1MSGA 1QILA 2F0SA 1BO0A 1ILPA 1Q12A 1HA5A 4U68A 5BN4A 2D9UA 1LTGD 1LV9A 3MHBA 2A74C 3NWTA 1EQVA 1ET9A 4C1NK 2EYHA 1O80A 2G9DA 2K03A 5IGBA 1VF5C 1MBYA 2F03A 1IYUA 3AMUA 3PUXA 2PW5A 3NK9A 1ET6A 2KEEA 3PMFA 2B2YA 2A5HA 2JSOA 1ENAA 2KA7A 3DWAA 2ZXPA 4FF2A 3D4DA 3A8IE 1GUWA 3M3YB 5M5WB 2B2VC 5I2YA 1PRTF 3T16A 5J22A 1VMPA 1SNMA 3P7JA 4RA8A 5JVH3 3Q6SA 4LMQD 1W6KA 1I4HA 5CR3A 1L0XB 4CHTB 3QOLA 2B2WA 4S3SA 2K7VA 1GUTA 5ELFA 3IL8A 4RHRA 2XN9C 4CGYB 3VA5A 4OO1G 1TQOA 3A8JE 2H1EA 3KLSA 2F1MA 1YNJC 3VYSA 3PV0A 1KNAA 4B08A 1Q1BA 2A6ED 2B8FA 4DNRB 2WKDA 4OIKA 1R4QB 4PQXA 5CV9A 1K8MA 5CBAE 2EVBA 1HA6A 1HPCA 5JEAG 1JICA 5KNCA 3KF8A 1Y8PB 2RDGA 5AFWA 4O42A 2GA4B 4RGMA 1JWMD 3VYUA 2WINB 5CYUA 3BYTB 5EGTA 5EKIA 5KIXA 4F8MA 1E2WA 5C5MA 1V1PB 3VR2A 3PIO3 1HQRD 2EY2A 3RD4A 2Q8TA 4KN4C 5M3MB 3SR1A 3SEBA 2SDFA 1SEBD 1D2BA 1IKLA 2L0CA 3QOJA 5LL6X 5K5PA 3NE5B 4Q0FA 2K5WA 5M5XB 1TY0A 1TWHB 5E4WC 1I6VC 4QB4A 5ELCA 2PO4A 5JOBA 3FRPB 2B39A 1EWHA 2DNCA 4I7ZC 2F3WA 1V8QA 1G291 1Y1VB 2MP1A 1WD1A 2JEAI 5DM63 3D3RA 1B3AA 3L9AX 3TZDA 1F77A 1JE4A 1U4RA 5C44B 4C1NI 1F2YA 5HURA 4QF4A 2E76C 2M2LA 2K01A 3K7AB 4E6IA 4K6LA 4P2CB 3FDTA 1IL8A 4BWGB 2FMCA 3S17B 5EJWA 4ID6A 2A69C 3BVMA 3S9WA 4IALA 2F0OA 3MZ5A 1NSNS 5JEAJ 5KGUA 4ODGA 5JPMC 2R6GA 2F0HA 1KLUD 1II3A 2E75C 2JA6B 5FLXE 3CHBD 4G57A 2R61A 1PMRA 1SYGA 1B1ZA 1X3PA 1E0BA 2F4IA 1GUGA 3PUWA 4B9XA 4KD4A 1FNUA 1CA6A 1AFPA 4DAVA 1IW7C 4YIJA 3PO2B 3HEJA 1CQVA 2F0LA 4IUTA 2FJ2A 2XWBB 2QKIC 2CQAA 3D8GA 3DWQA 1H9SB 4A3JB 5KNBA 5E1FA 3CU7A 1PZKD 3S1MB 3FEWX 1EIHA 2C9OA 3MC0B 4F87A 3OPOA 3HZXA 1I4PA 1J8IA 2RDFA 3A54A 3RUZA 1CI3M 2IL8A 3A55A 4Y7NB 1BCPC 1QG7A 2F0GA 3HGBA 4UAIA 1STEA 3RZDB 4RKLA 4RCNA 3DEPA 4IURA 2IX0A 2J4XA 4RCOA 3GTMB 2MHVA 3T13A 3JAML 2KUMA 1F9PA 1VCIA 2EYOA 2PZUA 3CKIB 4A3BB 1HXYD 3FPUB 1JORA 1S5FD 2Q8IB 1RF2D 1XTCD 1CZWA 3Q24A 3SE0A 2QILA 3AU7A 4WJWA 1WTOA 1D5MC 4WRDA 2Z1CA 5C0XH 4J8QA 2D5DA 1XX8A 5A2QE 2FHTA 4OHJA 2EY1A 4MN3A 4OGQC 3J81E 2F0EA 4CKCA 1H9MA 1TWAB 4XQNA 2K04A 1AN8A 3BDCA 1EQTA 2IWHA 1CZGA 2AUKA 3KBXA 2AWNA 1BXTA 4XQJA 5K36H 2CVRA 4F7XA 3S1RB 2WIIB 3LX0A 3U9OA 4XIGS 1SBBB 4KJNA 1UUPA 4MHEA 1ESFA 3SDZA 1BCPB 2WACA 1H9KA 1AZPA 1SNQA 1G91A 1ONLA 3DM1A 3T51B 1EYDA 4N9PA 3T53B 1HUMA 3TDQA 1GHKA 1SE2A 3NBIA 1A3VA 1UAPA 1KTKA 1LTRD 1A15A 1MSHA 1Z47A 2X6LA 2F0IA 1TS3A 2QCPX 4EGVA 1JOOA 1KLGD 5C0XI 3IFTA 4TQUS 1STHA 4L8JA 1V1OA 1YNNC 3N52A 3PUVA 4RFBA 4HMJA 2ICEC 5EKKA 2MUYA 3HOWB 1QWYA 4OIJA 1I50B 2OF1A 4TRDA 4DAPA 1ZYRC 3A7LA 3TZUA 4QUFA 2NVYB 2A6HC 1EZ8A 4DXGA 3PUYA 3MXUA 4RHSA 1FGBD 2AQ2B 1T5EA 1I4RA 4N9TA 1PRTD 2IT1A 2K1BA 3QJYA 2XSCA 1OXUA 2AQ1B 1TR5A 4G4KA 4FXDA 2C5CA 1WVLA 2SNMA 2ZT9C 5D3IB 1SYEA 4BBSB 4LJZC 4HEDA 4HSPA 3RMHA 1IKMA 5IT9E 4ZKCB 3NSWA 4M1UB 1PDQA 2CW0C 3J80L 5C4JB 1F2MA 2IW3A 5J39A 5C6AA 1PTOF 5I9PA 1A2UA 2RVLA 1BDOA 4K8JA 2HQEA 5I2XA 3MXPA 1RTOA 4DNTB 3R3OA 1Q1EA 2XRQD 5COYA 2Z4HA 4KY6A 1SAPA 1C48A 1WTQA 3P75A 1G6ZA 3MVVA 4IFDG 3OWFA 3P1HA 1SMYD 5F2DA 4PNYA 2F0VA 1K83B 3EJIA 3NUCA 2BDNA 1EU4A 1UNSA 5M5YB 5I6WA 4KJOA 4DK0A 1QCBD 5TSSA 1F2LA 2BE5D 1KAAA 2QDBA 4F88A 1QB5D 2DY8A 2K6AA 4FO2A 3J7YW 2VB3X 2F0KA 5FK9C 2JYOA 2K32A 3J7AV 4NW2A 1PXUA 4NDXA 3ITPA 1A6XA 3VR6A 1DM0B 5EPJA 2KVMA 1JR0D 1STGA 2EJMA 3A56A 2BOSA 1Y8OB 3D6WA 3OIPA 4H7BA 2QEJC 5EPLA 4H13C 4G7HC 5C0XJ 5C3XA 1JWUD 1HTLD 5IGDA 2BDOA 2H4OA 2A6EC 3EA6A 1WD0A 2VUMB 3D4RA 2EXZA 1ZEQX 3TSSA 2IX3A 4IFDJ 3OWEB 4DN4M 1PFNA 1PFBA 2PYKA 1QJOA 1SYFA 2JA8B 5CV5A 4PV1C 1ESRA 1D6EC 2EYJA 2R92B 3HOUB 2X6GA 4HMIA 1ZKOA 3HOZB 3NXWA 4X3KA 1ENCA 4FP5D 1S4ZA 1TS2A 4TKOB 4RGOS 3SK5A 1AP0A 1EEFD 1RHPA 2VNUD 3OW7A 2EJFC 2CHBD 1SNOA 2D2CC 2N55A 4EQPA 4WFN3 1UEAB 1MGSA 1PTOH 4O1NA 3DXJC 5FO8B 4ZRZA 3DHQA 4ILWA 2MGSA 2EYMA 4ULLA 2ZXOA 2ICIA 3M85A 5I4DA 4ZUJA 2F0JA 3G7LA 3MA2B 1M8AA 2BA1A 2B2TC 2MJ8A 1IYVA 1TVXA 3J7AF 4DGZA 1Q90A 4K2KA 2NYZD 2HCIA 3HKZB 3R8BA 3P20A 3I3CA 1DCZA 5CC4A 5IGFA 3V05A 1TS5A 2XNAC 1BBXC 3MAQA 1VDZA 3TN2A 3L7ZC 2WV6D 1PLFA 1U9RA 3QB3A 1GXDC 4KKTA 1H9JA 4AYBB 3W3AA 1Y8NB 2O5JC 1I4XA 2IJ0A 3GP7A 1BOSA 3R93A 3LWUA 4U673 4IUVA 1KDAA 5C4HA 1STNA 4IUUA 2SEBD 2B2YC 1RD9D 3NP8A 1BUVT 5EQ0A 4K14A 3GTKB 1WCMB 3ND8A 1VF7A 1DOMA 1U4PA 3DEOA 3BG3A 3HOYB 4A93B 4KMUC 3TP7A 1JOKA 3S1QB 2KEDA 3M7GA 3OIQA 3H94A 1CHQD 3OSOA 3BZDB 4K5WA 3GTLB 1FR3A 2HCCA 1TWGB 4ZYSA 1EY4A 2B2WC 4C3JG 4HR7B 4ZLTF 1EIGA 2XWJB 3KLSX 2EY5A 1WTRA 4KKUA 3PIP3 1F9QA 3VYRA 4A3MB 4KY7A 1G8ZD 4JBWA 3C2PA 1F2ZA 3AB9A 4LK1C 3KK7A 2RKSA 3TP8A 2NVXB 4OL7A 1HCZA 4A3FB 1CM9A 1LTTD 1SFOB 4L63B 2F0FA 1Q8IA 1FD7D 5EPKA 1LLRD 1F9RA 2E2IB 4BY1B 4V190 1I4GA 4RAUC 1J9OA 2EDGA 4HTHA 2OEOA 5CV4A 2B2UA 4Q5VA 1B53A 5D14A 4BBRB 4LAAA 4XDXA 1NR4A 4QMGA 4RGTA 3O13A 2Z8LA 3GTPB 4KTAA 1O7LA 2KCCA 2L12A 3F2UA 3KLRA 5FLXL 2L1BA 1A3TA 4FNFA 1OXVA 4KN7C 1EZ6A 2L9HA 2PMZB 3GTOB 2I07B 1U4LA 1U4MA 3R2TA 1DOLA 1BF4A 3X3MA 1Q3LA 2F0QA 3BYYB 4FXGC 1R4PB 2KHSA 5FO9B 2TMPA 2YU9B 1S5DD 1B44D 1EY6A 5KEEA 3M4YA 2LFNA 4C3JB 2B63B 1TWCB 3RZOB 1VMCA 3ZYYX 4NKLA 1SYBA 1EY0A 4CKBA 2WKCA 2Q8RE 4R8NA 1JOQA 3CQZB 3GQBA 3GV6A 2NB0A 1AZQA 4M8AA 5HGTA 4ZK9B 3C3LA 2EJGC 3T4AC 1PTOD 2TSSA 1NCVA 3HG9A 3NPPA 2PZWA 2JA7B 2KJXA 5NUCA 1EYAA 1ENFA 5IOCA 4ZKBB 4CJ1B 2F0TA 4C3IG 3BDOA 3EQLC 5JVG3 2ID0A 3K5LA 4HCSA 4K5XA 5A35A 5CGKA 2NN6H 5KNDA 4R9WA 4J1MA 1XYIA 2E2HB 5A2QL 1EOTA 3H3VC 1GUSA 4R8IA 3J81L 2LS01 1NR2A 5D65A 3I90A 1BR9A 1TT2A 2I46A 2EYFA 1EFID 3IFDA 3TP6A 2RSOA 1PTOB 2B2VA 3QIAA 3OMGA 4DFAA 1TKWB 3SXHA 2MPMA 1V1PA 3QO2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JYO A;  4MHE A;  4XT3 B;  1EIH A;  2J7Z A;  2MGS A;  1WTR A;  4NW2 A;  1VMC A;  2B2W A;  4ZAI A;  2MP1 A;  1WD1 A;  1B4O A;  1RTN A;  5JJZ A;  2JP1 A;  5CMD A;  1AZP A;  2EPB A;  1F9Q A;  1DZ1 A;  4HED A;  1B50 A;  1G91 A;  4CJ2 C;  1J8I A;  2FIN B;  3DM1 A;  3IL8 A;  1IKM A;  1B3A A;  3TZD A;  2IL8 A;  1G2S A;  4ZKC B;  3G7L A;  1JE4 A;  1WTX A;  1HHV A;  3HP3 A;  1ICW A;  2Q8R E;  4HSV A;  1HUM A;  3GV3 A;  5EPJ A;  1F9S A;  2KVM A;  1O7Y A;  1M8A A;  1QG7 A;  1U4R A;  2EOT A;  4X3S A;  1PDQ A;  4XT1 B;  5E4X A;  4UAI A;  3SVM A;  2B2T C;  1ZXT A;  2NZ1 D;  2MJ8 A;  3GV6 A;  1TVX A;  2M2L A;  1CM9 A;  2RA4 A;  5DNF A;  1MI2 A;  2NWG A;  3I8Z A;  1HUN A;  2K01 A;  1AZQ A;  2DY7 A;  3D6W A;  2NYZ D;  2HCI A;  1WVL A;  1SDF A;  3I3C A;  3H91 A;  2L4N A;  5EPL A;  5EPK A;  4ZK9 B;  1A15 A;  3KUP A;  3FDT A;  3DEP A;  1IL8 A;  1MSH A;  2B2T A;  1NCV A;  2B2U C;  2H1E A;  3I91 A;  1F9R A;  2FFK B;  2X6L A;  4IUR A;  5T1G A;  4IUP A;  5EJW A;  2RVL A;  5T1I A;  1BBX C;  4RAU C;  1J9O A;  2KUM A;  2HUG A;  1F9P A;  3TN2 A;  1KNA A;  1X3Q A;  2B2U A;  2FMM A;  1KNE A;  1PLF A;  1B53 A;  4X3T A;  1RTO A;  1O7Z A;  5D14 A;  1HFN A;  2KOL A;  1MSG A;  4XDX A;  1NR4 A;  1BO0 A;  4OIK A;  5COR A;  1WD0 A;  3N52 A;  1ILP A;  4ZKB B;  3FPU B;  4U68 A;  4CJ1 B;  2D9U A;  1WTV A;  4DN4 M;  1LV9 A;  5COY A;  1B2T A;  2HDM A;  1CA5 A;  2EE1 A;  1PFM A;  3R93 A;  5CBA E;  2L11 A;  1PFN A;  4IUV A;  1SAP A;  1EL0 A;  1PFB A;  1SSO A;  1HA6 A;  1JIC A;  1WTO A;  1QNK A;  1O80 A;  2L12 A;  3MTS A;  4HCS A;  4IUU A;  2B2Y C;  1WTQ A;  1G2T A;  3F2U A;  2K03 A;  4OIJ A;  1G6Z A;  1WTP A;  4QUC A;  2XIW A;  1X3P A;  5EQ0 A;  5AFW A;  1E0B A;  1WTW A;  4O42 A;  2L1B A;  4IUQ A;  1ESR A;  1XX8 A;  1X32 A;  2HDL A;  3MWY W;  4R9W A;  4RWS C;  2KEE A;  1NAP A;  2FHT A;  2B2Y A;  2L9H A;  2X69 A;  2X6G A;  4MN3 A;  5EKI A;  1XYI A;  2VXW A;  4QUF A;  1CA6 A;  1DOM A;  1HFG A;  1RJT A;  1U4P A;  3DEO A;  4CJ0 B;  3LWE A;  2K04 A;  1EOT A;  1U4L A;  4X3U A;  2KED A;  2K05 A;  1U4M A;  1EQT A;  4X3K A;  4R8I A;  1ML0 D;  4IUT A;  2Q8T A;  1S4Z A;  2FJ2 A;  1NR2 A;  5D65 A;  1GUW A;  2N88 A;  2BDN A;  3KBX A;  1DOL A;  2SDF A;  1AP0 A;  1RHP A;  3I90 A;  1BF4 A;  1IKL A;  2B2V C;  3ONA B;  1Q3L A;  2CVR A;  1DOK A;  3IFD A;  2RSO A;  1C8C A;  1ROD A;  1F2L A;  1VMP A;  2HCC A;  2K1B A;  1DON A;  2B2V A;  1ILQ A;  2KEC A;  2N55 A;  2R3Z A;  4HAE A;  1BNZ A;  2K28 A;  2RSN A;  5E4W C;  2DY8 A;  3P7J A;  4RA8 A;  2MPM A;  1HRJ A;  2B2W C;  3Q6S A;  4LMQ D;  1MGS A;  1QE6 A;  3UI2 A;  4ZLT F;  3QO2 A;  5CBE E;  1EIG A; 
#chains in the Genus database with same CATH topology
 5ELD A;  1GVP A;  2RQX A;  2N49 A;  2Q2T A;  1QVF A;  1JB3 A;  3S2H B;  3DMU A;  5EKL A;  1L0Y B;  4OEL B;  4J15 A;  1HNX L;  2K5D A;  4C56 C;  1GKH A;  2AQ3 B;  1QNU A;  3GDE A;  2CFM A;  1G2S A;  4X62 L;  1QUQ B;  1BCP F;  3S17 H;  4IJL A;  3I4M H;  4DR6 L;  4JI6 L;  4XT1 B;  3URY A;  1R9T B;  2A68 C;  3SVM A;  5C3E G;  3G4S A;  2NZ1 D;  3FKI B;  2RA4 A;  2JA5 B;  1MI2 A;  1IBL L;  3NQI A;  4JBK A;  3G48 A;  1LTS D;  4HCE A;  1E2V A;  1TU2 B;  1SYC A;  3A7A B;  1WTV A;  4KK7 A;  4HN7 A;  3VA7 A;  5LHY 1;  4DAY A;  1OXX K;  1STA A;  4DK1 A;  2F3V A;  4DF7 A;  2R93 B;  1O7I A;  2DN8 A;  4DR3 L;  5IOD A;  1BVS A;  2FMM A;  1LTA D;  4X3T A;  2NN6 I;  2O4X A;  5JEA H;  4FF3 A;  1CFM A;  1JMC A;  1I3Q B;  2B3G A;  4QIW E;  3I56 A;  1LTI D;  2BCO A;  2JN4 A;  4G7Z C;  4RGN A;  4C3I B;  1EL0 A;  3K5O A;  1SSO A;  3PO2 H;  1QNK A;  3KFU A;  1IZ6 A;  1X9N A;  4QUC A;  4CDE C;  3S16 H;  2E5L Q;  1PH2 A;  2PNR C;  3KJO A;  4K8I A;  4RH6 A;  5IYB H;  1SJH D;  3RLF A;  3HOX H;  4DV4 L;  2X69 A;  3HS0 C;  4IPH A;  1SMY C;  1HFG A;  1S5E D;  4JYA L;  4AIM A;  4X66 L;  5C0X G;  4A3J H;  2Y0S E;  5GQO A;  1CT1 D;  2JQO A;  1PRT B;  2NBF A;  4EX5 A;  1KD1 C;  3S14 H;  1AEX A;  1X55 A;  3W2D A;  4CBV A;  5FOB B;  4YWM A;  3TP5 A;  1B8A A;  3S1M H;  1L1O C;  1LO5 D;  1HH2 P;  2F0U A;  4NPS A;  2NVQ H;  1N34 Q;  4NXN L;  3D31 A;  1C8C A;  5GRO A;  2EY6 A;  3AEV A;  3H15 A;  5I6Y A;  1DON A;  1CHP D;  2BE5 C;  1ILQ A;  2ENB A;  2WP8 J;  2IX1 A;  1GJX A;  4OO1 I;  3NTK A;  3NWS A;  5K36 G;  3A0J A;  1QE6 A;  4UHV A;  4K6D A;  4Y7N H;  5CBE E;  5J1Z A;  3LNN A;  4A3E G;  2ES2 A;  2DNE A;  1EU3 A;  1GO3 E;  2J7Z A;  5KYI A;  2G9H D;  4ALP A;  2F0M A;  1HR0 L;  3PUZ A;  3RZD H;  4V0B A;  3D6C A;  4O0A A;  2NTS A;  1B50 A;  1GUN A;  2D62 A;  4HJ5 A;  1D5X C;  1GUO A;  4PG3 A;  1B9N A;  4JI8 Q;  1VQI A;  2R7Z G;  2NZO A;  1EY9 A;  3CCE A;  4CKE A;  5IT9 L;  2FXQ A;  3I72 A;  2UUB L;  2Z4I A;  4MIU A;  2GN5 A;  1Z7T A;  5AJ3 L;  3E9H A;  5C3E B;  3GTQ B;  3K6O A;  2E74 C;  4A3B H;  4QCL A;  4NXM Q;  4APV A;  5T1G A;  1DD2 A;  4X64 L;  2L5T A;  3L0O A;  1EY7 A;  4DKA C;  4FVM A;  1E2Z A;  1X3Q A;  4DXF A;  3NBH A;  4IUN A;  2B8G A;  3C1F A;  2PNH A;  1LTB D;  3U4Z A;  4IOC A;  4A3K H;  1SN8 A;  1CSP A;  1LT5 D;  2NN6 G;  1EEI D;  4HIM A;  2EYL A;  4WJ4 A;  2PPB C;  5KYL A;  2EE1 A;  3I55 A;  1BQQ T;  4FXK C;  3J80 i;  2L11 A;  1QOH A;  1TWA H;  1TXY A;  4A3D G;  3ERQ A;  5FLX c;  1VQK A;  4ZUI A;  4GN5 A;  5JJL A;  4AH6 A;  1Y1W G;  4HIK A;  5G3L F;  4B3R L;  4IUQ A;  1FL0 A;  5CV8 A;  4JI1 Q;  1G51 A;  1L1O B;  2K5V A;  2H5X A;  4MTK A;  1RJT A;  3ULP A;  3HFZ B;  4WOR A;  4PZ6 A;  3LWE A;  1M1K C;  3S1R H;  2K05 A;  4OXP A;  3Q23 A;  1RL2 A;  4BY7 G;  1D5Z C;  1ML0 D;  3VR3 A;  1PYW D;  4I65 A;  3WOE A;  2Z0S A;  1WOC A;  2C35 B;  1GD7 A;  1VQA A;  5CV6 A;  3TQY A;  3TBI B;  4JI5 Q;  3UDG A;  4B9W A;  1NUC A;  3H09 A;  4P71 A;  4DR2 L;  4DUZ L;  2DGY A;  4XXE A;  4HID A;  4K2L A;  1SE3 A;  4QGU A;  2Z6K A;  2WB1 E;  1IBM L;  2XGT A;  2K75 A;  1EQQ A;  3GO5 A;  3K8A A;  5IYD H;  5KRU A;  4NMZ A;  1EUJ A;  3I4M G;  1MKH A;  4A3E B;  3PO3 G;  1RTN A;  5JJZ A;  3I73 A;  1VQH A;  2K4K A;  1JJ2 A;  2RCF A;  2A73 B;  1NBW A;  5ELB A;  2QEX A;  4JV5 Q;  2NVT B;  1LAB A;  3IAY A;  3Q0A A;  4H02 A;  1F9S A;  3EN2 A;  5ELN A;  3STB C;  1QZH A;  2UXB L;  2R7Z B;  1SYD A;  2AWO A;  1SE8 A;  1EWC A;  1YIJ A;  3BVZ A;  1DYQ A;  2NWG A;  3I8Z A;  1HUN A;  4FDB A;  2Q2U A;  4RG1 A;  3H91 A;  3NQT A;  2A8V A;  4J6H A;  1EY5 A;  5IYC G;  1D8L A;  1PA6 A;  1YNJ D;  1ICF B;  4BS9 A;  3PSI A;  2HUG A;  4GN3 B;  2JEB I;  2PW7 A;  3SK4 A;  1X6O A;  3TEH B;  2EZV A;  1LT4 D;  1O7Z A;  1I50 H;  2F0W A;  4ME5 A;  2AUJ D;  3K5N A;  1HNX Q;  1NNX A;  5COR A;  5H1S E;  3DWP A;  4DNI A;  1I6H B;  4FF1 A;  4X62 Q;  5DM7 3;  4P75 A;  5FKA C;  3HOX G;  2NVY H;  4DR6 Q;  4JI6 Q;  1VQ6 A;  3K5M A;  1TY2 A;  1D1K A;  1PFS A;  3MTS A;  3K57 A;  1G2T A;  4LFB L;  3IRB A;  1QVC A;  1WTW A;  1XPO A;  1IBL Q;  4A3D B;  1X54 A;  2OT2 A;  2HDL A;  1Y1W B;  4KHV A;  3K7U C;  1SNC A;  1VQ8 A;  1FNV A;  3J7A 5;  1CSQ A;  1H9R A;  2YTV A;  3NTI A;  4DR3 Q;  3FMC A;  1CKM A;  1P16 A;  3J81 c;  2UU9 L;  5C3W A;  4IZ8 A;  3OOC A;  1JC7 A;  3UDF A;  2NUC A;  1FYC A;  2DJG C;  2N88 A;  3NHH A;  4NP5 A;  4BY7 B;  3VR4 A;  4DAY B;  3C1E A;  1O78 A;  2OQ0 A;  4K5V A;  4PMW A;  1STY A;  2UXD L;  1VQ9 A;  2BA0 A;  3I2Z A;  2F0D A;  4A3L G;  1HTP A;  2ATW A;  4BBS H;  1KRT A;  3U9S A;  2HD3 A;  1LT3 D;  3E0J A;  3NEN A;  3MXN A;  1STB A;  1BNZ A;  1HRJ A;  1XPR A;  4DV4 Q;  1SXT A;  3VR5 A;  4Z9C B;  4KHZ A;  4KV6 A;  4EQO A;  4JYA Q;  1JWS D;  4YWK A;  4X66 Q;  5C4J H;  5IP7 G;  4FYD A;  3I4M B;  3N6R A;  4CJ2 C;  1Z9F A;  3PO3 B;  2Q2I A;  4C3H H;  3HRZ C;  1WTX A;  4HSV A;  4A3I H;  4C2M B;  1O7Y A;  2EOT A;  4P72 A;  4NXN Q;  3K59 A;  3L2P A;  3CRL C;  1ZXT A;  3FP9 A;  3JAM E;  2E2D C;  3S1N H;  2NZH A;  2L4N A;  2ZJP A;  1Q82 C;  2KHI A;  3KUP A;  4ZQ3 A;  5CV7 A;  4A3K G;  2A69 D;  3DUZ A;  2JE6 I;  2JXM B;  3V96 A;  2ZJQ A;  1HR0 Q;  1PZJ D;  1RKN A;  1HZB A;  1YEZ A;  3SHL A;  1RDP D;  4EQN A;  5DLQ E;  1MIU A;  3HOV G;  1VQG A;  2YTY A;  4IOA A;  1KDC A;  3S16 B;  1PFM A;  1XWE A;  2Y0S G;  4KY5 A;  1CTM A;  1M4V A;  1UE7 A;  3HOX B;  4QQB X;  4YY3 L;  2UUB Q;  4KD3 A;  1WTP A;  5AJ3 Q;  2XIW A;  2G5D A;  4EVO A;  4GNX A;  4KHP L;  3V2T A;  5E3F A;  1X32 A;  3I4N G;  3K0Y A;  4FF4 A;  3S14 B;  4X64 Q;  3I7F A;  4HJA A;  4CJ0 B;  4XYO A;  2Z6B A;  1IW7 D;  2O5I C;  4LF7 L;  5ISR A;  4X3U A;  3CCJ A;  3H6M A;  4CDF C;  1JB7 A;  4GOP A;  3X3N A;  3EFX D;  2K5Q A;  2QA4 A;  2NVQ B;  2IY5 B;  1K8A C;  4A3G G;  5GAE C;  4R4O A;  1HQM C;  1C4Q A;  3E3X A;  5JPN C;  2O2L D;  2VW9 A;  2IPK D;  1D1I A;  1PV4 A;  5IYD G;  3M3Y H;  2I5L X;  2VB2 X;  1KAB A;  2F52 A;  3D4W A;  3H3V I;  4POG A;  2RSN A;  1EOV A;  4JW0 A;  4B3R Q;  4ABN A;  5GAD C;  4IPD A;  5C4Z A;  2F0P A;  4JCV E;  1VQL A;  3KOJ A;  4BXX G;  2YV5 A;  4JI3 Q;  3NTH A;  1B9M A;  1B4O A;  5M3F G;  1VQ5 A;  1TWF B;  1DZ1 A;  3SK8 A;  5IGG A;  3IKJ A;  2F0N A;  2FIN B;  4BA2 I;  3M4O B;  1DJR D;  1CQF A;  4UY8 C;  2CQO A;  2CWP A;  2ZXR A;  1ICW A;  2RBM A;  3DM3 A;  1OXT A;  1BCP D;  3GV3 A;  3MXG A;  5E7N A;  1V43 A;  4JBM A;  5C4X G;  2LMC B;  5DNF A;  1RCV D;  2LY7 A;  1PVO A;  1D7Q A;  2DY7 A;  3TRE A;  4DR2 Q;  4DU9 A;  1LAC A;  1SDF A;  4QIW B;  4UDU C;  4BA1 I;  3I91 A;  1L2F A;  1PTO C;  3H0G G;  2FFK B;  3I4O A;  1IBM Q;  4K0K L;  5T1I A;  1QVG A;  4A3K B;  2GVB A;  1SE4 A;  2M00 A;  4XTC S;  1VQP A;  4DV2 Q;  2JA8 H;  1KNE A;  2A19 A;  1PZI D;  2KOL A;  1JCK B;  2I5M X;  2R92 H;  2RDH A;  1A3U A;  3HOU H;  4IFD H;  1SRO A;  5BR8 L;  2HDM A;  1CA5 A;  2HT1 A;  3HOV B;  1B2T A;  4XQQ A;  2RF4 A;  3HKS A;  5M9O A;  2UXB Q;  3HOZ H;  2Y0S B;  2ZTC A;  3DLL A;  2WAQ G;  2PCF B;  2VL6 A;  2XTI A;  4TSS A;  3OHX C;  5DEH A;  2PQE A;  3S2D B;  4LUO A;  4DV1 L;  1S5B D;  2NTT A;  1EY8 A;  1E1T A;  4DA2 A;  2VXW A;  2QF7 A;  1MD2 D;  3R2I A;  3VYT A;  3KBG A;  1AW7 A;  4OWT B;  1LT6 D;  3I4N B;  5C5L A;  3CAM A;  3CPW A;  1PH4 A;  3BS1 A;  3F2B A;  2WB1 G;  3M7N A;  2SNS A;  2UXC L;  1S40 A;  5BN3 A;  1K8O A;  1TII D;  3CF5 A;  3ERO A;  3PIO A;  4P74 A;  4JOI C;  1KQS A;  3ONA B;  4A3G B;  4GZY C;  1DOK A;  3EVQ A;  1ROD A;  4KKS A;  3I70 A;  3GTJ B;  1W6J A;  3GD7 A;  4LNQ A;  2V4D A;  4LFB Q;  2KEC A;  2R3Z A;  2KQ3 A;  2K28 A;  3SK6 A;  3K58 A;  4KLK A;  1K8G A;  5ELE A;  4CDD C;  1I4Q A;  4C3H G;  3M9B A;  3K80 C;  4H44 C;  4A3C H;  4A3I G;  4IN3 A;  4IJH A;  3QR8 A;  3OYY A;  4B3T L;  2JP1 A;  5CMD A;  2OXP A;  4RKB A;  4JI4 L;  1EYC A;  3C46 A;  5I9O A;  3D0F A;  2UU9 Q;  1GOZ A;  1Q46 A;  3J80 E;  5M3F B;  1SNP A;  4JK1 C;  4DK6 C;  1HHV A;  3HP3 A;  2PZT A;  2SOB A;  1PYB A;  1KDB A;  4L6T B;  1PRT C;  1Q81 C;  5E4X A;  5DAU A;  3ND9 A;  4G7O C;  1YZ6 A;  2UXD Q;  1PH9 A;  2L55 A;  4PMB A;  5C4X B;  1WJJ A;  5C44 H;  4IFD I;  2EIF A;  5D3D A;  5IIF A;  2B2U C;  3QG1 A;  4IUP A;  3GTG B;  3BDL A;  5JAV A;  1HZA A;  1KHI A;  3H0G B;  1W3S A;  3K7A H;  4L5S A;  1OO9 B;  2KCN A;  3T56 B;  4PMC A;  1HFN A;  4OO1 H;  3WOF A;  1YNN D;  1WCM H;  2J0T D;  3FVQ A;  1JQY D;  4OON A;  3NEL A;  1XXG A;  4DR5 L;  3E5S A;  4TVA B;  5JJI A;  4H0L C;  3HOY H;  4A93 H;  2E2J B;  3S1Q H;  3TME A;  4KI0 A;  5IGE A;  2JA6 H;  1K3B C;  3MEH A;  5HGQ A;  1DXM A;  1K73 C;  1A2T A;  2WAQ B;  5G3L D;  3MFY A;  1HZ9 A;  1CK1 A;  1ZYR D;  4RWS C;  1NAP A;  1TS4 A;  2K33 A;  2XVS A;  3CCL A;  2A6H D;  1Z6H A;  3GTL H;  3WDN A;  3J81 j;  3F2C A;  2KBN A;  3Q22 A;  1TWG H;  3F8T A;  4OX9 Q;  1IHZ A;  1WTH A;  5EBD A;  2F3I A;  3U58 A;  2LKV A;  2WB1 B;  4HIO A;  4LF8 Q;  2AHO B;  4LF6 L;  5FO7 B;  2M9V A;  4GLA C;  1S5C D;  4IQZ A;  3ERS X;  3OMC A;  3E6Z X;  4YY3 Q;  2OTL A;  4EQ5 A;  1SJE D;  1SND A;  1SMX A;  2A68 D;  4HAE A;  1S3O A;  1T9H A;  3I4L A;  2YYZ A;  2PQA A;  3UI2 A;  4GKK L;  1GHJ A;  3QWN A;  4XT3 B;  4C3H B;  2HIX A;  4ZAI A;  2NVX H;  4A3F H;  3CC2 A;  4LF7 Q;  4A3I B;  2EPB A;  4GNX B;  2EYP A;  3J81 i;  3S15 B;  3CRK C;  3FPP A;  2VY3 A;  2E2I H;  3MFG A;  1FNW A;  5LMU L;  5IGC A;  2CW0 D;  4XYQ A;  3S1N B;  2N78 A;  4X3S A;  3KF6 A;  1OXS C;  2V1C C;  5LL6 S;  4IPC A;  4GOP B;  4BBR H;  3G6J B;  5BN5 A;  3AFP A;  1FVI A;  2K5N A;  5EBC A;  3A8K E;  3MWY W;  3L3O C;  2B2T A;  1T5X D;  1Y69 U;  2MNA A;  3GTP H;  2XRS D;  1H9S A;  3BVG A;  1MSG A;  1QIL A;  1UE1 A;  3GTM H;  2F0S A;  2LXJ A;  1BO0 A;  1ILP A;  4OWW B;  1Q12 A;  1YHB A;  1HA5 A;  4U68 A;  5BN4 A;  2D9U A;  1LTG D;  1LV9 A;  3MHB A;  2A74 C;  5LMN L;  3NWT A;  3CCR A;  1EQV A;  3GTO H;  1ET9 A;  1VQN A;  4C1N K;  2EYH A;  1O80 A;  2G9D A;  2K03 A;  5IGB A;  1VF5 C;  4NB3 A;  4DR1 L;  1MBY A;  1MJE A;  2F03 A;  1IYU A;  3AMU A;  4L5Q A;  3PUX A;  2PW5 A;  3NK9 A;  1ET6 A;  2KEE A;  3PMF A;  1U5K A;  2B2Y A;  2A5H A;  2JSO A;  1ENA A;  2KA7 A;  5M3M G;  2ZTE A;  3DWA A;  2ZXP A;  4FF2 A;  3D4D A;  1SRU A;  4OEM B;  3A8I E;  1GUW A;  3M3Y B;  5M5W B;  2B2V C;  4C3J H;  5BR8 Q;  5I2Y A;  1TWC H;  2B63 H;  4A3C G;  1PRT F;  3T16 A;  1VQM A;  3RZO H;  5J22 A;  1VMP A;  1PH8 A;  1SNM A;  1UWV A;  3P7J A;  4RA8 A;  5JVH 3;  4DV1 Q;  3Q6S A;  4LMQ D;  1W6K A;  1I4H A;  1VQ4 A;  1Y1V G;  5CR3 A;  2QDL A;  1L0X B;  2N3S A;  3CQZ H;  1YHA A;  4CHT B;  3QOL A;  3JAM c;  2B2W A;  4S3S A;  2WAQ E;  2K7V A;  3BU2 A;  1GUT A;  4HJ8 A;  5ELF A;  3IL8 A;  4UPA A;  5EAY A;  5C44 G;  2OQK A;  4RHR A;  2XN9 C;  2JJQ A;  4JG2 A;  4A75 A;  3ULL A;  1B7Y B;  4CGY B;  3SGI A;  1IXR A;  3VA5 A;  4OO1 G;  1TQO A;  3A8J E;  2H1E A;  3OW2 A;  3KLS A;  2HHH L;  2F1M A;  1VS0 A;  1YNJ C;  2ZJR A;  3VYS A;  1RIP A;  3PV0 A;  1KNA A;  4B3M L;  4B08 A;  1Q1B A;  2A6E D;  2B8F A;  4JI4 Q;  4B3S L;  1FJG L;  2JA6 G;  1HZC A;  4DNR B;  2WKD A;  4OIK A;  4DUY L;  2CCZ A;  1R4Q B;  1LUZ A;  1KRS A;  1C9O A;  4PQX A;  4L5T A;  5CV9 A;  1K8M A;  2OCE A;  5CBA E;  2EVB A;  2E2H H;  1HPC A;  1HA6 A;  5JEA G;  1JIC A;  5KNC A;  3KF8 A;  1EIY B;  1Y8P B;  2RDG A;  5AFW A;  4O42 A;  2GA4 B;  4RGM A;  1JWM D;  3VYU A;  2WIN B;  3CCQ A;  3K81 C;  5CYU A;  3BYT B;  5EGT A;  3UDX A;  3HOW H;  5EKI A;  5KIX A;  3PO2 G;  4F8M A;  1A63 A;  1E2W A;  5C5M A;  1V1P B;  3VR2 A;  4UP8 A;  1S72 A;  3PIO 3;  5IYB G;  1HQR D;  2EY2 A;  4ME3 A;  3RD4 A;  2Q8T A;  4KN4 C;  1WFQ A;  4LFC L;  5M3M B;  3SR1 A;  3SEB A;  2SDF A;  4DV7 L;  1EWI A;  1SEB D;  1D2B A;  1IKL A;  2L0C A;  1NY4 A;  3QOJ A;  5LL6 X;  4DR5 Q;  5K5P A;  3NE5 B;  4Q0F A;  4A3J G;  2K5W A;  3S2H H;  5M5X B;  1TY0 A;  1IBK L;  1TWH B;  4DV0 L;  1A62 A;  5E4W C;  1I6V C;  4QB4 A;  1KIX A;  5ELC A;  1PH6 A;  2PO4 A;  5JOB A;  3FRP B;  2B39 A;  1EWH A;  2DNC A;  4I7Z C;  2F3W A;  1V8Q A;  1G29 1;  1R9T H;  3G71 A;  1Y1V B;  4DK3 C;  3FKI H;  2MP1 A;  1WD1 A;  2JA5 H;  2JEA I;  2ZTD A;  4GLV B;  5DM6 3;  3D3R A;  1B3A A;  3L9A X;  2DJF C;  1YBY A;  3TZD A;  1F77 A;  1JE4 A;  1JJC B;  2KHJ A;  4LFA L;  1YNX A;  3KDF A;  3BZK A;  1U4R A;  5C44 B;  4LF6 Q;  4C1N I;  2ALY B;  1F2Y A;  2AKW B;  5HUR A;  3W1G A;  4QF4 A;  2E76 C;  2M2L A;  1B70 B;  2K01 A;  4JI2 L;  3K7A B;  4E6I A;  4K6L A;  4P2C B;  5FLM H;  4YHH L;  3FDT A;  4CDC C;  1IL8 A;  3K0X A;  1KC8 C;  3WWV A;  4GN4 B;  4BWG B;  2FMC A;  2F4V L;  3S17 B;  1YIT A;  4GKK Q;  5EJW A;  4ID6 A;  2A69 C;  3TS2 A;  3BVM A;  4C3I H;  4DPG A;  3S9W A;  4IAL A;  2F0O A;  3H3V H;  3MZ5 A;  2CKZ B;  4A3B G;  1NSN S;  5JEA J;  5KGU A;  1V1Q A;  4ODG A;  5JPM C;  2MQH A;  2R6G A;  2F0H A;  1HR0 W;  5IWA L;  1KLU D;  1II3 A;  2E75 C;  2JA6 B;  5FLX E;  3LGJ A;  3CHB D;  4G57 A;  1NTG A;  2R61 A;  3PQI A;  1PMR A;  1SYG A;  2KCT A;  1B1Z A;  1X3P A;  1E0B A;  2F4I A;  1GUG A;  3PUW A;  4DV5 L;  1C0A A;  4B9X A;  4KD4 A;  2CH4 W;  5L37 A;  5LMN W;  3JC6 6;  1BKB A;  1FNU A;  1CA6 A;  1PYS B;  3A5U A;  1AFP A;  4DAV A;  1WYD A;  1E24 A;  1IW7 C;  4YIJ A;  3PO2 B;  3HEJ A;  1CQV A;  2F0L A;  4IUT A;  2FJ2 A;  2XWB B;  5GAG C;  2QKI C;  2CQA A;  3D8G A;  2YTX A;  1K83 H;  3DWQ A;  2AMC B;  5LMN Q;  1H9S B;  2E8G A;  5M5Y H;  3J80 c;  4A3J B;  1HJP A;  4X65 L;  1I94 L;  5KNB A;  5E1F A;  3CU7 A;  1PZK D;  3S1M B;  5IP9 H;  2E5L L;  3Q8D A;  2K14 A;  1A8V A;  3FEW X;  1EFW A;  1EIH A;  2C9O A;  1DGS A;  3RN5 A;  3MC0 B;  4F87 A;  2RHQ B;  1CKO A;  5C3E H;  3OPO A;  3HZX A;  1I4P A;  3GTQ H;  1J8I A;  2RDF A;  3A54 A;  3RUZ A;  1CI3 M;  2IL8 A;  3NBH B;  3A55 A;  4Y7N B;  4PZ8 A;  1BCP C;  1QG7 A;  2F0G A;  1WI5 A;  3HGB A;  2WFW A;  1Q8K A;  4UAI A;  3E0E A;  1N34 L;  2GVA A;  1STE A;  3RZD B;  3A5Z B;  4RKL A;  4LUZ A;  4RCN A;  1VQJ A;  3DEP A;  4IUR A;  2IX0 A;  1E1O A;  2J4X A;  4RCO A;  4N8X 1;  3GTM B;  2MHV A;  3T13 A;  3JAM L;  2KUM A;  2EQS A;  1F9P A;  4YCU A;  5IY0 A;  4QL5 A;  1MJC A;  1VCI A;  2EYO A;  2PZU A;  3CKI B;  4A3B B;  4R4I A;  1HXY D;  3FPU B;  1JOR A;  1S5F D;  1U0L A;  2Q8I B;  1RF2 D;  1XTC D;  1CZW A;  3Q24 A;  3SE0 A;  2QIL A;  4DUZ Q;  3HOW G;  1LTL A;  3AU7 A;  2VUM H;  4WJW A;  1WTO A;  3PF5 A;  1D5M C;  2UUC L;  5JJK A;  4WRD A;  2Z1C A;  5C0X H;  4J8Q A;  2D5D A;  5IE8 A;  4PZ7 A;  1XX8 A;  5A2Q E;  2FHT A;  2B29 A;  4OHJ A;  2EY1 A;  4MN3 A;  4OGQ C;  3J81 E;  2F0E A;  2HHH Q;  4CKC A;  1H9M A;  1TWA B;  4XQN A;  2K04 A;  1AN8 A;  1KL9 A;  3BDC A;  4B3M Q;  1EQT A;  2IWH A;  1K3R A;  4GLX A;  1CZG A;  1FJG Q;  4B3S Q;  4L5R C;  2AUK A;  4DUY Q;  3KBX A;  2AWN A;  1BXT A;  4XQJ A;  1G6P A;  3AYH B;  1ASZ A;  5K36 H;  3UE1 A;  1X3G A;  2CVR A;  5ELO A;  4F7X A;  3S1R B;  1L1O A;  1XTD A;  2WII B;  1NE3 A;  3LX0 A;  3U9O A;  1Q7Y C;  1K28 A;  4XIG S;  1SBB B;  4KJN A;  1CKN A;  1UUP A;  4MHE A;  1ESF A;  4BBS G;  3SDZ A;  1BCP B;  2WAC A;  1H9K A;  3KF8 B;  1AZP A;  1SNQ A;  1G91 A;  1ONL A;  3DM1 A;  3CXC A;  3T51 B;  4LFC Q;  1EYD A;  4N9P A;  5FLM G;  4DV7 Q;  3T53 B;  1HUM A;  1N9W A;  3TDQ A;  1GHK A;  1SE2 A;  3NBI A;  1A3V A;  4OWX B;  1UAP A;  1XNR L;  1KTK A;  1VQB A;  1LTR D;  1W2B A;  1X56 A;  1IBK Q;  4DV0 Q;  1A15 A;  1MSH A;  1Z47 A;  2X6L A;  2F0I A;  1TS3 A;  2QCP X;  4EGV A;  4UP9 A;  1JOO A;  1XMO L;  3OTO L;  1KLG D;  5C0X I;  1YJ9 A;  3IFT A;  4P73 A;  3TS0 A;  2K52 A;  4TQU S;  1STH A;  4L8J A;  1V1O A;  1YNN C;  3N52 A;  4DV6 L;  3PUV A;  4RFB A;  1Y1W H;  4GNX C;  2VQF L;  4LFA Q;  4HMJ A;  2ICE C;  2R7F A;  1VQF A;  5EKK A;  2MUY A;  3HOW B;  1QWY A;  4OIJ A;  1I50 B;  3PCO B;  3F1Z A;  4JI2 Q;  2OF1 A;  3U50 C;  4BY7 H;  1ASY A;  4TRD A;  4YHH Q;  4DAP A;  4A76 A;  1ZYR C;  4GOP C;  3A7L A;  3TZU A;  3KDF B;  4DV3 L;  2F4V Q;  4GS3 A;  4QUF A;  2NVY B;  3MXN B;  2A6H C;  3GTK H;  2PI2 A;  1EZ8 A;  4A4I A;  4DXG A;  1YI2 A;  4O2D A;  1UE6 A;  3PUY A;  3CCV A;  3MXU A;  4RHS A;  1FGB D;  2AQ2 B;  1T5E A;  5IWA Q;  2K50 A;  5IP9 G;  1I4R A;  4N9T A;  1E3P A;  2PMZ E;  1PRT D;  2IT1 A;  2K1B A;  3QJY A;  4LW1 A;  2XSC A;  1YJN A;  1OXU A;  3PO3 H;  2AQ1 B;  4DV5 Q;  4Y52 H;  3KYH C;  1TR5 A;  4G4K A;  2Z9H A;  4FXD A;  2C5C A;  1WVL A;  4C2M H;  2SNM A;  2ZT9 C;  5D3I B;  2CWA A;  1SYE A;  4BBS B;  4R4T A;  1N32 L;  4LJZ C;  4HED A;  4HSP A;  3RMH A;  1IKM A;  5IT9 E;  4JPB W;  3PIP A;  4ZKC B;  3NSW A;  4M1U B;  1EYG A;  2VQE L;  3M4Q A;  4A3M H;  5IYC H;  3RLO A;  1PDQ A;  2CW0 C;  3B6Y A;  4JI0 L;  3J80 L;  4KHP Q;  5C4J B;  1F2M A;  2IW3 A;  5J39 A;  5C6A A;  1PTO F;  2D0P A;  5I9P A;  4X65 Q;  1I94 Q;  1A2U A;  1SFO H;  4JI7 L;  3CME A;  1V9P A;  2RVL A;  1BDO A;  4K8J A;  2HQE A;  5I2X A;  4MZ9 A;  3MXP A;  2VUM G;  1RTO A;  4BY1 H;  1AE2 A;  4DNT B;  3R3O A;  1Q1E A;  2IHE A;  2XRQ D;  5COY A;  2Z4H A;  4KY6 A;  3CCS A;  3BJU A;  2JA8 G;  3RR5 A;  1SAP A;  4DR7 L;  1C48 A;  3EIV A;  1NMF A;  1WTQ A;  3P75 A;  1G6Z A;  3MVV A;  2R92 G;  4DR4 L;  3HOU G;  4IFD G;  1EQR A;  4RMF A;  3OWF A;  3P1H A;  4R4Q A;  1SMY D;  5F2D A;  3HOZ G;  4PNY A;  2F0V A;  2JA9 A;  1SLJ A;  4AQY L;  1K83 B;  4A3L H;  3EJI A;  1SR3 A;  3NUC A;  2BDN A;  1EU4 A;  1UNS A;  5M5Y B;  5I6W A;  4KJO A;  4JBJ A;  1I5F A;  4DK0 A;  1QCB D;  5TSS A;  3A74 A;  1F2L A;  3J7Z C;  2BE5 D;  1TWF H;  1KAA A;  2QDB A;  2UUC Q;  4F88 A;  1QB5 D;  4K0K Q;  5IP7 H;  2DY8 A;  3M4O H;  2K6A A;  4FO2 A;  3J7Y W;  1J5E L;  2VB3 X;  2F0K A;  2YU9 H;  5FK9 C;  2JYO A;  2K32 A;  3J7A V;  1FGU A;  2JK8 A;  4YCV A;  3ZJY C;  4NW2 A;  1X3E A;  1PXU A;  4NDX A;  3ITP A;  1A6X A;  3VR6 A;  1DM0 B;  5EPJ A;  2KVM A;  2LSS A;  1VQO A;  4LF9 L;  1JR0 D;  1STG A;  3HKZ G;  3ULJ A;  1EIF A;  1IL2 A;  2EJM A;  3A56 A;  2BOS A;  1Y8O B;  3D6W A;  3OIP A;  4H7B A;  1NJI C;  2QEJ C;  5EPL A;  4H13 C;  1VQC A;  4G7H C;  1NMG A;  5C0X J;  3HOV H;  5C3X A;  1JWU D;  1BBW A;  1HTL D;  5IGD A;  2UXC Q;  1YVC A;  1AH9 A;  1XMQ L;  1N33 L;  4AYB G;  2BDO A;  2H4O A;  2A6E C;  1J6Q A;  3EA6 A;  4JI3 L;  2JA7 H;  3S2D H;  4R1J A;  1WD0 A;  1HNZ L;  3D4R A;  2VUM B;  2EXZ A;  1ZEQ X;  3TSS A;  1A0I A;  2ZM6 L;  1CKN B;  2IX3 A;  4IFD J;  2I0Q A;  2CH4 A;  3OWE B;  4DN4 M;  3T1Y L;  3NEM A;  3RLN A;  3CMA A;  3F2D A;  4GKJ L;  1PFN A;  3W1B A;  3I4N H;  1PFB A;  2I5H A;  2PYK A;  1XNR Q;  1QJO A;  1SYF A;  2JA8 B;  1WCM G;  5CV5 A;  4PV1 C;  1XNQ L;  2ASB A;  1ESR A;  4LF5 L;  1D6E C;  2EYJ A;  3VDY A;  2R92 B;  4YCW A;  3CCM A;  4A3G H;  3HOU B;  3HOY G;  1LM0 A;  2X6G A;  4B3T Q;  4A93 G;  2RHS B;  1Q86 C;  1XMO Q;  5FJ8 H;  4HMI A;  1BBU A;  1ZKO A;  3OTO Q;  3GTJ H;  2Q2H A;  3HOZ B;  2MO0 A;  3NXW A;  4X3K A;  2UUA L;  1ENC A;  4FP5 D;  1S4Z A;  4DV2 L;  4LF4 L;  1TS2 A;  4TKO B;  1XJV A;  4RGO S;  3SK5 A;  1AP0 A;  1EEF D;  1RHP A;  5GAH C;  4DV6 Q;  2VNU D;  4JVZ A;  3OW7 A;  2EJF C;  2VQF Q;  2VS1 A;  2K5H A;  4DAM A;  4BXX H;  2CHB D;  1YJW A;  1SNO A;  2D2C C;  2N55 A;  4EQP A;  4WFN 3;  5M3F H;  3FHW A;  1UEA B;  3BZC A;  1MGS A;  2A1A A;  3T1H L;  1PTO H;  4O1N A;  3DXJ C;  5FO8 B;  3CPF A;  4ZRZ A;  2BH2 A;  1XPU A;  4DV3 Q;  3DHQ A;  4ILW A;  2MGS A;  2EYM A;  4A3M G;  4ULL A;  2HQL A;  5C4X H;  2ZXO A;  2ICI A;  3M85 A;  5I4D A;  4ZUJ A;  2F0J A;  3G7L A;  3MEF A;  3MA2 B;  3TRZ A;  4MTN A;  3GTG H;  4A3F G;  1M8A A;  3H0G H;  3STB D;  1PHJ A;  3AQQ A;  2BA1 A;  2B2T C;  2MJ8 A;  1IYV A;  1TVX A;  1K0R A;  4DGZ A;  3J7A F;  5HY6 A;  1Q90 A;  4K2K A;  2NYZ D;  2HCI A;  3CP0 A;  3E9I A;  3HKZ B;  3P20 A;  3I3C A;  1DCZ A;  3R8B A;  5CC4 A;  5IGF A;  4BY1 G;  3V05 A;  1TS5 A;  2LXK A;  2XNA C;  1BBX C;  4YWL A;  3MAQ A;  1VDZ A;  3TN2 A;  1JT8 A;  3L7Z C;  2IHF A;  2WV6 D;  4BBR G;  4LUV A;  2E2J H;  1PLF A;  1U9R A;  2L15 A;  3QB3 A;  1N32 Q;  1GXD C;  4KKT A;  1C7Y A;  2R93 H;  1H9J A;  4AYB B;  3W3A A;  3UDI A;  1Y8N B;  4I7A A;  2O5J C;  1I4X A;  2VQE Q;  2IJ0 A;  3RN2 A;  3GP7 A;  1BOS A;  3R93 A;  3LWU A;  4U67 3;  4IUV A;  1I3Q H;  1KDA A;  4JI0 Q;  5C4H A;  1HNW L;  1STN A;  4IUU A;  2SEB D;  2B2Y C;  1RD9 D;  3NP8 A;  1N36 L;  1BUV T;  5EQ0 A;  4K14 A;  1IYJ B;  3GTK B;  1WCM B;  2KEN A;  3ND8 A;  1QUQ A;  1KXL A;  4JI7 Q;  1VF7 A;  1DOM A;  1U4P A;  3DEO A;  1OTC A;  3BG3 A;  3HOY B;  4A93 B;  2PQA B;  4KMU C;  1JOK A;  3TP7 A;  3S1Q B;  2KED A;  3M7G A;  3OIQ A;  5LMU Q;  3H94 A;  3AFQ A;  2MO1 A;  1CHQ D;  3OSO A;  3BZD B;  3KJP A;  4K5W A;  3GTL B;  1FR3 A;  4DR7 Q;  2HCC A;  1TWG B;  4JOI A;  4HJ7 A;  3S15 H;  4ZYS A;  4DR4 Q;  3KF6 B;  1EY4 A;  2B2W C;  4C3J G;  3CD6 A;  1CUK A;  4HR7 B;  4ZLT F;  3RNU A;  2B63 G;  1EIG A;  2XWJ B;  3KLS X;  2OWO A;  2EY5 A;  2R7D A;  1YHQ A;  3PF4 A;  1WTR A;  4KKU A;  1M90 C;  3PIP 3;  1F9Q A;  1X3F A;  3VYR A;  4AQY Q;  4A3M B;  4KY7 A;  3CCU A;  1G8Z D;  4JBW A;  3C2P A;  4OX9 L;  1F2Z A;  2Z6K C;  3AB9 A;  3CC4 A;  4LK1 C;  3KK7 A;  2RKS A;  3TP8 A;  4LF8 L;  4QJF A;  4DR1 Q;  2NVX B;  2D0O A;  4OL7 A;  1HCZ A;  4A3F B;  1CM9 A;  1LTT D;  1SFO B;  4L63 B;  2F0F A;  4WJ3 M;  3CW2 C;  1Q8I A;  1Y14 B;  1FD7 D;  5EPK A;  2JA7 G;  1LLR D;  4X6A H;  1F9R A;  4R4C A;  2E2I B;  1J5E Q;  4BY1 B;  1PH3 A;  4V19 0;  1I4G A;  4RAU C;  1J9O A;  2EDG A;  4HTH A;  2OEO A;  4ZCK A;  5CV4 A;  2B2U A;  2QGQ A;  4Q5V A;  1B53 A;  5D14 A;  4LAA A;  4BBR B;  4XDX A;  1NR4 A;  4QMG A;  4RGT A;  1H95 A;  3O13 A;  2RCN A;  2Z8L A;  3KLW A;  3GTP B;  4KTA A;  1O7L A;  5FJ8 G;  2KCC A;  2L12 A;  4LF9 Q;  3F2U A;  1VQE A;  2P5Z X;  3KLR A;  5FLX L;  2L1B A;  1A3T A;  4QY7 A;  2PI2 E;  4FNF A;  1OXV A;  4KN7 C;  5M5W H;  1EZ6 A;  2L9H A;  2EXD A;  4LWC A;  2PMZ B;  1K9M C;  3HKZ E;  3GTO B;  2I07 B;  1U4L A;  1L0W A;  1U4M A;  1XMQ Q;  1N33 Q;  1UE5 A;  3R2T A;  2DUD A;  1N8R C;  1HNZ Q;  1DOL A;  4JI8 L;  2MFI A;  2ZM6 Q;  4MNO A;  1BF4 A;  1JJG A;  3X3M A;  1Q3L A;  3T1Y Q;  2F0Q A;  3BYY B;  2BH8 A;  4FXG C;  4GKJ Q;  1R4P B;  1GM5 A;  2KHS A;  5FO9 B;  2TMP A;  4AYB E;  2YU9 B;  5IT9 c;  1S5D D;  4NXM L;  1XNQ Q;  1PH5 A;  1B44 D;  1X65 A;  1EY6 A;  5KEE A;  4LF5 Q;  3M4Y A;  4HJ9 A;  2LFN A;  4C3J B;  2B63 B;  1B3Q A;  1TWC B;  3RZO B;  1VMC A;  3ZYY X;  1PH7 A;  4NKL A;  2UUA Q;  1SYB A;  1EY0 A;  4CKB A;  2QW7 A;  2WKC A;  4LF4 Q;  2KCM A;  4A3E H;  2Q8R E;  4R8N A;  3U4V A;  3FKI G;  2JA5 G;  2NVT H;  1VQ7 A;  1JOQ A;  3CQZ B;  4POF A;  3GQB A;  3GV6 A;  1JE5 A;  3W5O A;  2NB0 A;  1AZQ A;  4M8A A;  5HGT A;  4ZK9 B;  3C3L A;  2EJG C;  3T4A C;  1PTO D;  2TSS A;  4JI1 L;  2R7Z H;  1NCV A;  3HG9 A;  2R93 G;  3NPP A;  3T1H Q;  2PZW A;  2JA7 B;  2KJX A;  1E7Z A;  1K0S A;  2N8N A;  4UP7 A;  5NUC A;  1EYA A;  1ENF A;  3ER0 A;  5IOC A;  1MHW C;  4IPG A;  2VZA A;  4ZKB B;  4CJ1 B;  2F0T A;  4C3I G;  3BDO A;  4JI5 L;  3EQL C;  5JVG 3;  2ID0 A;  1I6H H;  3K5L A;  4HCS A;  4K5X A;  5A35 A;  5CGK A;  5M3M H;  2NN6 H;  5KND A;  4R9W A;  5J3B A;  4J1M A;  3JAM i;  4N8F A;  1XYI A;  4A3D H;  2E2H B;  1P8L A;  5A2Q L;  3PGZ A;  1EOT A;  3H3V C;  1GUS A;  5M5X H;  4JV5 L;  2OTJ A;  1AE3 A;  1TWH H;  4R8I A;  3J81 L;  2LS0 1;  1NR2 A;  5D65 A;  1LYL A;  1QZG A;  3S24 A;  3I90 A;  1BR9 A;  1TT2 A;  2I46 A;  2EYF A;  1EFI D;  3M4P A;  3IFD A;  3G6E A;  1E22 A;  3TP6 A;  2RSO A;  1Y1V H;  4IO9 A;  3EBE A;  1PH1 A;  1PTO B;  1HNW Q;  2B2V A;  3QIA A;  3OMG A;  1N36 Q;  4DFA A;  1TKW B;  1VQD A;  4JC0 A;  3SXH A;  2MPM A;  1UEB A;  1KAW A;  1V1P A;  3CC7 A;  3ICE A;  3QO2 A;  2HIV A;  3UE0 A; 
#chains in the Genus database with same CATH homology
 5ELD A;  2RQX A;  1JB3 A;  3S2H B;  3DMU A;  5EKL A;  1L0Y B;  2K5D A;  4C56 C;  2AQ3 B;  1QNU A;  1G2S A;  1BCP F;  4XT1 B;  3URY A;  1R9T B;  2A68 C;  3SVM A;  2NZ1 D;  3FKI B;  2RA4 A;  2JA5 B;  1MI2 A;  3NQI A;  4HCE A;  1LTS D;  1E2V A;  1TU2 B;  1SYC A;  3A7A B;  1WTV A;  4KK7 A;  4HN7 A;  3VA7 A;  5LHY 1;  4DAY A;  1OXX K;  1STA A;  4DK1 A;  2F3V A;  4DF7 A;  2R93 B;  2DN8 A;  5IOD A;  2FMM A;  1LTA D;  4X3T A;  2NN6 I;  2O4X A;  5JEA H;  4FF3 A;  1CFM A;  1I3Q B;  1LTI D;  2BCO A;  4G7Z C;  4RGN A;  4C3I B;  1EL0 A;  3K5O A;  1SSO A;  1QNK A;  4QUC A;  2PNR C;  4K8I A;  4RH6 A;  1SJH D;  3RLF A;  2X69 A;  3HS0 C;  1SMY C;  1HFG A;  1S5E D;  5C0X G;  1CT1 D;  1PRT B;  2NBF A;  1AEX A;  3W2D A;  4CBV A;  5FOB B;  3TP5 A;  1LO5 D;  2F0U A;  3D31 A;  1C8C A;  2EY6 A;  5I6Y A;  1DON A;  1CHP D;  2BE5 C;  1ILQ A;  2ENB A;  2WP8 J;  2IX1 A;  1GJX A;  4OO1 I;  3NTK A;  3NWS A;  5K36 G;  1QE6 A;  4K6D A;  5CBE E;  5J1Z A;  3LNN A;  2DNE A;  1EU3 A;  2J7Z A;  5KYI A;  2G9H D;  2F0M A;  3PUZ A;  4V0B A;  3D6C A;  2NTS A;  1B50 A;  1GUN A;  2D62 A;  1D5X C;  1GUO A;  1B9N A;  1EY9 A;  4CKE A;  5IT9 L;  3I72 A;  2Z4I A;  4MIU A;  1Z7T A;  5C3E B;  3GTQ B;  3K6O A;  2E74 C;  4QCL A;  5T1G A;  1DD2 A;  2L5T A;  1EY7 A;  4FVM A;  1E2Z A;  1X3Q A;  4DXF A;  3NBH A;  4IUN A;  2B8G A;  3C1F A;  1LTB D;  1LT5 D;  2NN6 G;  1EEI D;  2EYL A;  2PPB C;  5KYL A;  2EE1 A;  1BQQ T;  4FXK C;  2L11 A;  1QOH A;  3ERQ A;  4ZUI A;  5G3L F;  4IUQ A;  5CV8 A;  1RJT A;  4WOR A;  3LWE A;  2K05 A;  3Q23 A;  1D5Z C;  1ML0 D;  3VR3 A;  1PYW D;  4I65 A;  3WOE A;  5CV6 A;  3TBI B;  4B9W A;  1NUC A;  3H09 A;  4XXE A;  4K2L A;  1SE3 A;  3GO5 A;  5KRU A;  4NMZ A;  4A3E B;  1RTN A;  5JJZ A;  3I73 A;  5ELB A;  2A73 B;  2NVT B;  1LAB A;  3IAY A;  3Q0A A;  1F9S A;  2R7Z B;  1SYD A;  2AWO A;  1EWC A;  3BVZ A;  1DYQ A;  2NWG A;  3I8Z A;  1HUN A;  3H91 A;  3NQT A;  4J6H A;  1EY5 A;  1YNJ D;  4BS9 A;  2HUG A;  2JEB I;  2PW7 A;  3SK4 A;  2EZV A;  1LT4 D;  1O7Z A;  2F0W A;  4ME5 A;  2AUJ D;  3K5N A;  5COR A;  3DWP A;  1I6H B;  4FF1 A;  5DM7 3;  5FKA C;  3K5M A;  1TY2 A;  1D1K A;  3MTS A;  3K57 A;  1G2T A;  1WTW A;  4A3D B;  2OT2 A;  2HDL A;  1Y1W B;  4KHV A;  1SNC A;  1FNV A;  1H9R A;  3NTI A;  3FMC A;  5C3W A;  4IZ8 A;  3OOC A;  1JC7 A;  2NUC A;  1FYC A;  2N88 A;  3NHH A;  4NP5 A;  4BY7 B;  3VR4 A;  3C1E A;  1O78 A;  4K5V A;  4PMW A;  1STY A;  2BA0 A;  2F0D A;  1HTP A;  3U9S A;  1LT3 D;  3E0J A;  3MXN A;  1STB A;  1BNZ A;  1HRJ A;  1SXT A;  3VR5 A;  4Z9C B;  4KHZ A;  4KV6 A;  4EQO A;  1JWS D;  4FYD A;  3I4M B;  3N6R A;  4CJ2 C;  3PO3 B;  3HRZ C;  1WTX A;  4HSV A;  4C2M B;  1O7Y A;  2EOT A;  3K59 A;  3CRL C;  1ZXT A;  3JAM E;  2E2D C;  2L4N A;  3KUP A;  4ZQ3 A;  5CV7 A;  2A69 D;  3DUZ A;  2JE6 I;  2JXM B;  3V96 A;  1PZJ D;  1RKN A;  3SHL A;  1RDP D;  4EQN A;  1KDC A;  3S16 B;  1PFM A;  1XWE A;  4KY5 A;  1CTM A;  1M4V A;  3HOX B;  4KD3 A;  1WTP A;  2XIW A;  4EVO A;  3V2T A;  5E3F A;  1X32 A;  3K0Y A;  4FF4 A;  3S14 B;  4CJ0 B;  4XYO A;  2O5I C;  1IW7 D;  5ISR A;  4X3U A;  3H6M A;  2NVQ B;  3X3N A;  3EFX D;  2K5Q A;  1HQM C;  1C4Q A;  5JPN C;  2O2L D;  2IPK D;  1D1I A;  2VB2 X;  1KAB A;  3D4W A;  2RSN A;  4ABN A;  5C4Z A;  2F0P A;  3NTH A;  1B9M A;  1B4O A;  1TWF B;  1DZ1 A;  3SK8 A;  5IGG A;  3IKJ A;  2F0N A;  2FIN B;  4BA2 I;  3M4O B;  1DJR D;  1CQF A;  2ZXR A;  1ICW A;  2RBM A;  1OXT A;  1BCP D;  3GV3 A;  3MXG A;  1V43 A;  2LMC B;  5DNF A;  1RCV D;  2LY7 A;  2DY7 A;  4DU9 A;  1LAC A;  1SDF A;  4QIW B;  4UDU C;  4BA1 I;  3I91 A;  1PTO C;  2FFK B;  5T1I A;  4A3K B;  1SE4 A;  2M00 A;  4XTC S;  1KNE A;  1PZI D;  2KOL A;  1JCK B;  2RDH A;  1A3U A;  4IFD H;  1B2T A;  2HDM A;  1CA5 A;  3HOV B;  4XQQ A;  5M9O A;  2Y0S B;  2PCF B;  4TSS A;  3OHX C;  5DEH A;  2PQE A;  3S2D B;  1S5B D;  2NTT A;  1EY8 A;  4DA2 A;  2VXW A;  2QF7 A;  1MD2 D;  3R2I A;  3VYT A;  3KBG A;  1AW7 A;  1LT6 D;  3I4N B;  5C5L A;  3BS1 A;  3M7N A;  2SNS A;  5BN3 A;  1K8O A;  1TII D;  3ERO A;  4GZY C;  3ONA B;  4A3G B;  1DOK A;  3EVQ A;  1ROD A;  4KKS A;  3I70 A;  3GTJ B;  1W6J A;  3GD7 A;  2V4D A;  2KEC A;  2R3Z A;  2KQ3 A;  2K28 A;  3SK6 A;  3K58 A;  5ELE A;  1I4Q A;  4C3H G;  4H44 C;  4IN3 A;  2JP1 A;  5CMD A;  2OXP A;  4RKB A;  3C46 A;  1EYC A;  5I9O A;  1GOZ A;  3J80 E;  5M3F B;  1SNP A;  4JK1 C;  1HHV A;  3HP3 A;  2PZT A;  2SOB A;  4L6T B;  1KDB A;  1PRT C;  5E4X A;  5DAU A;  3ND9 A;  4G7O C;  2L55 A;  4PMB A;  5C4X B;  4IFD I;  5IIF A;  5D3D A;  2B2U C;  3QG1 A;  4IUP A;  3GTG B;  3BDL A;  5JAV A;  3H0G B;  1OO9 B;  2KCN A;  3T56 B;  4PMC A;  1HFN A;  4OO1 H;  3WOF A;  1YNN D;  2J0T D;  3FVQ A;  1JQY D;  1XXG A;  3E5S A;  4H0L C;  2E2J B;  3TME A;  4KI0 A;  5IGE A;  3MEH A;  1DXM A;  1A2T A;  2WAQ B;  5G3L D;  3MFY A;  1CK1 A;  1ZYR D;  4RWS C;  1NAP A;  1TS4 A;  2K33 A;  2XVS A;  2A6H D;  1Z6H A;  3WDN A;  3Q22 A;  1IHZ A;  5EBD A;  2LKV A;  2WB1 B;  5FO7 B;  2M9V A;  1S5C D;  4IQZ A;  3OMC A;  3E6Z X;  1SJE D;  1SND A;  2A68 D;  4HAE A;  3I4L A;  2YYZ A;  3UI2 A;  1GHJ A;  3QWN A;  4XT3 B;  4C3H B;  4ZAI A;  4A3I B;  2EPB A;  2EYP A;  3S15 B;  3CRK C;  3FPP A;  3MFG A;  1FNW A;  5IGC A;  2CW0 D;  4XYQ A;  3S1N B;  4X3S A;  1OXS C;  5LL6 S;  5BN5 A;  3G6J B;  5EBC A;  3A8K E;  3MWY W;  3L3O C;  2B2T A;  1T5X D;  1Y69 U;  2XRS D;  1H9S A;  3BVG A;  1MSG A;  1QIL A;  2F0S A;  1BO0 A;  1ILP A;  1Q12 A;  1HA5 A;  4U68 A;  5BN4 A;  2D9U A;  1LTG D;  1LV9 A;  3MHB A;  2A74 C;  3NWT A;  1EQV A;  1ET9 A;  4C1N K;  2EYH A;  1O80 A;  2G9D A;  2K03 A;  5IGB A;  1VF5 C;  1MBY A;  2F03 A;  1IYU A;  3AMU A;  3PUX A;  2PW5 A;  3NK9 A;  1ET6 A;  2KEE A;  3PMF A;  2B2Y A;  2A5H A;  2JSO A;  1ENA A;  2KA7 A;  3DWA A;  2ZXP A;  4FF2 A;  3D4D A;  3A8I E;  1GUW A;  3M3Y B;  5M5W B;  2B2V C;  5I2Y A;  1PRT F;  3T16 A;  5J22 A;  1VMP A;  1SNM A;  3P7J A;  4RA8 A;  5JVH 3;  3Q6S A;  4LMQ D;  1W6K A;  1I4H A;  5CR3 A;  1L0X B;  4CHT B;  3QOL A;  2B2W A;  4S3S A;  2K7V A;  1GUT A;  5ELF A;  3IL8 A;  4RHR A;  2XN9 C;  4CGY B;  3VA5 A;  4OO1 G;  1TQO A;  3A8J E;  2H1E A;  3KLS A;  2F1M A;  1YNJ C;  3VYS A;  3PV0 A;  1KNA A;  4B08 A;  1Q1B A;  2A6E D;  2B8F A;  4DNR B;  2WKD A;  4OIK A;  1R4Q B;  4PQX A;  5CV9 A;  1K8M A;  5CBA E;  2EVB A;  1HA6 A;  1HPC A;  5JEA G;  1JIC A;  5KNC A;  3KF8 A;  1Y8P B;  2RDG A;  5AFW A;  4O42 A;  2GA4 B;  4RGM A;  1JWM D;  3VYU A;  2WIN B;  5CYU A;  3BYT B;  5EGT A;  5EKI A;  5KIX A;  4F8M A;  1E2W A;  5C5M A;  1V1P B;  3VR2 A;  3PIO 3;  1HQR D;  2EY2 A;  3RD4 A;  2Q8T A;  4KN4 C;  5M3M B;  3SR1 A;  3SEB A;  2SDF A;  1SEB D;  1D2B A;  1IKL A;  2L0C A;  3QOJ A;  5LL6 X;  5K5P A;  3NE5 B;  4Q0F A;  2K5W A;  5M5X B;  1TY0 A;  1TWH B;  5E4W C;  1I6V C;  4QB4 A;  5ELC A;  2PO4 A;  5JOB A;  3FRP B;  2B39 A;  1EWH A;  2DNC A;  4I7Z C;  2F3W A;  1V8Q A;  1G29 1;  1Y1V B;  2MP1 A;  1WD1 A;  2JEA I;  5DM6 3;  3D3R A;  1B3A A;  3L9A X;  3TZD A;  1F77 A;  1JE4 A;  1U4R A;  5C44 B;  4C1N I;  1F2Y A;  5HUR A;  4QF4 A;  2E76 C;  2M2L A;  2K01 A;  3K7A B;  4E6I A;  4K6L A;  4P2C B;  3FDT A;  1IL8 A;  4BWG B;  2FMC A;  3S17 B;  5EJW A;  4ID6 A;  2A69 C;  3BVM A;  3S9W A;  4IAL A;  2F0O A;  3MZ5 A;  1NSN S;  5JEA J;  5KGU A;  4ODG A;  5JPM C;  2R6G A;  2F0H A;  1KLU D;  1II3 A;  2E75 C;  2JA6 B;  5FLX E;  3CHB D;  4G57 A;  2R61 A;  1PMR A;  1SYG A;  1B1Z A;  1X3P A;  1E0B A;  2F4I A;  1GUG A;  3PUW A;  4B9X A;  4KD4 A;  1FNU A;  1CA6 A;  1AFP A;  4DAV A;  1IW7 C;  4YIJ A;  3PO2 B;  3HEJ A;  1CQV A;  2F0L A;  4IUT A;  2FJ2 A;  2XWB B;  2QKI C;  2CQA A;  3D8G A;  3DWQ A;  1H9S B;  4A3J B;  5KNB A;  5E1F A;  3CU7 A;  1PZK D;  3S1M B;  3FEW X;  1EIH A;  2C9O A;  3MC0 B;  4F87 A;  3OPO A;  3HZX A;  1I4P A;  1J8I A;  2RDF A;  3A54 A;  3RUZ A;  1CI3 M;  2IL8 A;  3A55 A;  4Y7N B;  1BCP C;  1QG7 A;  2F0G A;  3HGB A;  4UAI A;  1STE A;  3RZD B;  4RKL A;  4RCN A;  3DEP A;  4IUR A;  2IX0 A;  2J4X A;  4RCO A;  3GTM B;  2MHV A;  3T13 A;  3JAM L;  2KUM A;  1F9P A;  1VCI A;  2EYO A;  2PZU A;  3CKI B;  4A3B B;  1HXY D;  3FPU B;  1JOR A;  1S5F D;  2Q8I B;  1RF2 D;  1XTC D;  1CZW A;  3Q24 A;  3SE0 A;  2QIL A;  3AU7 A;  4WJW A;  1WTO A;  1D5M C;  4WRD A;  2Z1C A;  5C0X H;  4J8Q A;  2D5D A;  1XX8 A;  5A2Q E;  2FHT A;  4OHJ A;  2EY1 A;  4MN3 A;  4OGQ C;  3J81 E;  2F0E A;  4CKC A;  1H9M A;  1TWA B;  4XQN A;  2K04 A;  1AN8 A;  3BDC A;  1EQT A;  2IWH A;  1CZG A;  2AUK A;  3KBX A;  2AWN A;  1BXT A;  4XQJ A;  5K36 H;  2CVR A;  4F7X A;  3S1R B;  2WII B;  3LX0 A;  3U9O A;  4XIG S;  1SBB B;  4KJN A;  1UUP A;  4MHE A;  1ESF A;  3SDZ A;  1BCP B;  2WAC A;  1H9K A;  1AZP A;  1SNQ A;  1G91 A;  1ONL A;  3DM1 A;  3T51 B;  1EYD A;  4N9P A;  3T53 B;  1HUM A;  3TDQ A;  1GHK A;  1SE2 A;  3NBI A;  1A3V A;  1UAP A;  1KTK A;  1LTR D;  1A15 A;  1MSH A;  1Z47 A;  2X6L A;  2F0I A;  1TS3 A;  2QCP X;  4EGV A;  1JOO A;  1KLG D;  5C0X I;  3IFT A;  4TQU S;  1STH A;  4L8J A;  1V1O A;  1YNN C;  3N52 A;  3PUV A;  4RFB A;  4HMJ A;  2ICE C;  5EKK A;  2MUY A;  3HOW B;  1QWY A;  4OIJ A;  1I50 B;  2OF1 A;  4TRD A;  4DAP A;  1ZYR C;  3A7L A;  3TZU A;  4QUF A;  2NVY B;  2A6H C;  1EZ8 A;  4DXG A;  3PUY A;  3MXU A;  4RHS A;  1FGB D;  2AQ2 B;  1T5E A;  1I4R A;  4N9T A;  1PRT D;  2IT1 A;  2K1B A;  3QJY A;  2XSC A;  1OXU A;  2AQ1 B;  1TR5 A;  4G4K A;  4FXD A;  2C5C A;  1WVL A;  2SNM A;  2ZT9 C;  5D3I B;  1SYE A;  4BBS B;  4LJZ C;  4HED A;  4HSP A;  3RMH A;  1IKM A;  5IT9 E;  4ZKC B;  3NSW A;  4M1U B;  1PDQ A;  2CW0 C;  3J80 L;  5C4J B;  1F2M A;  2IW3 A;  5J39 A;  5C6A A;  1PTO F;  5I9P A;  1A2U A;  2RVL A;  1BDO A;  4K8J A;  2HQE A;  5I2X A;  3MXP A;  1RTO A;  4DNT B;  3R3O A;  1Q1E A;  2XRQ D;  5COY A;  2Z4H A;  4KY6 A;  1SAP A;  1C48 A;  1WTQ A;  3P75 A;  1G6Z A;  3MVV A;  4IFD G;  3OWF A;  3P1H A;  1SMY D;  5F2D A;  4PNY A;  2F0V A;  1K83 B;  3EJI A;  3NUC A;  2BDN A;  1EU4 A;  1UNS A;  5M5Y B;  5I6W A;  4KJO A;  4DK0 A;  1QCB D;  5TSS A;  1F2L A;  2BE5 D;  1KAA A;  2QDB A;  4F88 A;  1QB5 D;  2DY8 A;  2K6A A;  4FO2 A;  3J7Y W;  2VB3 X;  2F0K A;  5FK9 C;  2JYO A;  2K32 A;  3J7A V;  4NW2 A;  1PXU A;  4NDX A;  3ITP A;  1A6X A;  3VR6 A;  1DM0 B;  5EPJ A;  2KVM A;  1JR0 D;  1STG A;  2EJM A;  3A56 A;  2BOS A;  1Y8O B;  3D6W A;  3OIP A;  4H7B A;  2QEJ C;  5EPL A;  4H13 C;  4G7H C;  5C0X J;  5C3X A;  1JWU D;  1HTL D;  5IGD A;  2BDO A;  2H4O A;  2A6E C;  3EA6 A;  1WD0 A;  2VUM B;  3D4R A;  2EXZ A;  1ZEQ X;  3TSS A;  2IX3 A;  4IFD J;  3OWE B;  4DN4 M;  1PFN A;  1PFB A;  2PYK A;  1QJO A;  1SYF A;  2JA8 B;  5CV5 A;  4PV1 C;  1ESR A;  1D6E C;  2EYJ A;  2R92 B;  3HOU B;  2X6G A;  4HMI A;  1ZKO A;  3HOZ B;  3NXW A;  4X3K A;  1ENC A;  4FP5 D;  1S4Z A;  1TS2 A;  4TKO B;  4RGO S;  3SK5 A;  1AP0 A;  1EEF D;  1RHP A;  2VNU D;  3OW7 A;  2EJF C;  2CHB D;  1SNO A;  2D2C C;  2N55 A;  4EQP A;  4WFN 3;  1UEA B;  1MGS A;  1PTO H;  4O1N A;  3DXJ C;  5FO8 B;  4ZRZ A;  3DHQ A;  4ILW A;  2MGS A;  2EYM A;  4ULL A;  2ZXO A;  2ICI A;  3M85 A;  5I4D A;  4ZUJ A;  2F0J A;  3G7L A;  3MA2 B;  1M8A A;  2BA1 A;  2B2T C;  2MJ8 A;  1IYV A;  1TVX A;  3J7A F;  4DGZ A;  1Q90 A;  4K2K A;  2NYZ D;  2HCI A;  3HKZ B;  3R8B A;  3P20 A;  3I3C A;  1DCZ A;  5CC4 A;  5IGF A;  3V05 A;  1TS5 A;  2XNA C;  1BBX C;  3MAQ A;  1VDZ A;  3TN2 A;  3L7Z C;  2WV6 D;  1PLF A;  1U9R A;  3QB3 A;  1GXD C;  4KKT A;  1H9J A;  4AYB B;  3W3A A;  1Y8N B;  2O5J C;  1I4X A;  2IJ0 A;  3GP7 A;  1BOS A;  3R93 A;  3LWU A;  4U67 3;  4IUV A;  1KDA A;  5C4H A;  1STN A;  4IUU A;  2SEB D;  2B2Y C;  1RD9 D;  3NP8 A;  1BUV T;  5EQ0 A;  4K14 A;  3GTK B;  1WCM B;  3ND8 A;  1VF7 A;  1DOM A;  1U4P A;  3DEO A;  3BG3 A;  3HOY B;  4A93 B;  4KMU C;  3TP7 A;  1JOK A;  3S1Q B;  2KED A;  3M7G A;  3OIQ A;  3H94 A;  1CHQ D;  3OSO A;  3BZD B;  4K5W A;  3GTL B;  1FR3 A;  2HCC A;  1TWG B;  4ZYS A;  1EY4 A;  2B2W C;  4C3J G;  4HR7 B;  4ZLT F;  1EIG A;  2XWJ B;  3KLS X;  2EY5 A;  1WTR A;  4KKU A;  3PIP 3;  1F9Q A;  3VYR A;  4A3M B;  4KY7 A;  1G8Z D;  4JBW A;  3C2P A;  1F2Z A;  3AB9 A;  4LK1 C;  3KK7 A;  2RKS A;  3TP8 A;  2NVX B;  4OL7 A;  1HCZ A;  4A3F B;  1CM9 A;  1LTT D;  1SFO B;  4L63 B;  2F0F A;  1Q8I A;  1FD7 D;  5EPK A;  1LLR D;  1F9R A;  2E2I B;  4BY1 B;  4V19 0;  1I4G A;  4RAU C;  1J9O A;  2EDG A;  4HTH A;  2OEO A;  5CV4 A;  2B2U A;  4Q5V A;  1B53 A;  5D14 A;  4BBR B;  4LAA A;  4XDX A;  1NR4 A;  4QMG A;  4RGT A;  3O13 A;  2Z8L A;  3GTP B;  4KTA A;  1O7L A;  2KCC A;  2L12 A;  3F2U A;  3KLR A;  5FLX L;  2L1B A;  1A3T A;  4FNF A;  1OXV A;  4KN7 C;  1EZ6 A;  2L9H A;  2PMZ B;  3GTO B;  2I07 B;  1U4L A;  1U4M A;  3R2T A;  1DOL A;  1BF4 A;  3X3M A;  1Q3L A;  2F0Q A;  3BYY B;  4FXG C;  1R4P B;  2KHS A;  5FO9 B;  2TMP A;  2YU9 B;  1S5D D;  1B44 D;  1EY6 A;  5KEE A;  3M4Y A;  2LFN A;  4C3J B;  2B63 B;  1TWC B;  3RZO B;  1VMC A;  3ZYY X;  4NKL A;  1SYB A;  1EY0 A;  4CKB A;  2WKC A;  2Q8R E;  4R8N A;  1JOQ A;  3CQZ B;  3GQB A;  3GV6 A;  2NB0 A;  1AZQ A;  4M8A A;  5HGT A;  4ZK9 B;  3C3L A;  2EJG C;  3T4A C;  1PTO D;  2TSS A;  1NCV A;  3HG9 A;  3NPP A;  2PZW A;  2JA7 B;  2KJX A;  5NUC A;  1EYA A;  1ENF A;  5IOC A;  4ZKB B;  4CJ1 B;  2F0T A;  4C3I G;  3BDO A;  3EQL C;  5JVG 3;  2ID0 A;  3K5L A;  4HCS A;  4K5X A;  5A35 A;  5CGK A;  2NN6 H;  5KND A;  4R9W A;  4J1M A;  1XYI A;  2E2H B;  5A2Q L;  1EOT A;  3H3V C;  1GUS A;  4R8I A;  3J81 L;  2LS0 1;  1NR2 A;  5D65 A;  3I90 A;  1BR9 A;  1TT2 A;  2I46 A;  2EYF A;  1EFI D;  3IFD A;  3TP6 A;  2RSO A;  1PTO B;  2B2V A;  3QIA A;  3OMG A;  4DFA A;  1TKW B;  3SXH A;  2MPM A;  1V1P A;  3QO2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...