1WJJA

Solution structure of hypothetical protein f20o9.120 from arabidopsis thaliana
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
145
structure length
145
Chain Sequence
GSSGSSGSTVKRKPVFVKVEQLKPGTTGHTLTVKVIEANIVVPVTRKTRPASSLSRPSQPSRIVECLIGDETGCILFTARNDQVDLMKPGATVILRNSRIDMFKGTMRLGVDKWGRIEATGAASFTVKEDNNLSLVEYESGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein F20O9.120
publication title Solution structure of hypothetical protein F20O9.120 from Arabidopsis thaliana
rcsb
source organism Arabidopsis thaliana
total genus 15
structure length 145
sequence length 145
ec nomenclature
pdb deposition date 2004-05-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1wjjA01
1Q8KA 4AYBE 4PMWA 4GNXC 4LUOA 4LF7Q 1U0LA 4JOIC 3G6EA 4OX9L 3G48A 4BXXH 3PF4A 3CP0A 3I2ZA 5IT9c 4DR7L 2UXDL 1PHJA 5IYCH 3L0OA 1WOCA 4DV1Q 1X3GA 2QEXA 4JYAQ 4IOAA 4B3RQ 2VW9A 3M85A 1XPOA 1X3EA 1EFWA 1WFQA 4DKAC 3RN5A 3GTGH 3KFUA 1WYDA 3T1HQ 4NPSA 2KENA 4KI0A 3U4VA 1XMOQ 2L15A 4POGA 1KXLA 4BY1H 3J81j 2JE6I 2CCZA 4K0KL 4JCVE 2OQKA 4L5TA 5K36G 4JG2A 3ULLA 3GTQH 2D62A 4JI1Q 1CKNA 2YYZA 4UP8A 4AQYL 4LFCL 3RR5A 1SMXA 4DV2L 2I5MX 4IOCA 1L1OB 5HY6A 4DAYB 1Q7YC 4JI6Q 1NTGA 1TWAH 1X6OA 4L5QA 2ZM6L 1VQ7A 2Q2UA 4B3TL 2B63G 1TWCH 3RLNA 3J80i 4A3MH 1YEZA 4UPAA 2A1AA 4GS3A 4R4IA 1FL0A 3E9IA 2AWOA 2UXCL 3KF6B 5FLXc 2VNUD 1BBUA 3OTOQ 4BXXG 2I5HA 2XGTA 1PA6A 1PYBA 3PGZA 5IYCG 3I4NG 4DNIA 1IBKQ 1OXXK 2PQAA 4DR6L 2CFMA 1HR0L 4TVAB 1UE7A 2JA7H 1KL9A 3TRZA 1KC8C 4X62Q 2E2JH 5AJ3L 1JMCA 1UEBA 1S72A 3HOZH 5IP7H 2JJQA 5ELNA 4LF7L 4PG3A 1N9WA 4BY1G 1N34Q 4OWWB 5GAEC 2IHEA 4JBMA 2RCNA 2Y0SG 2ZJPA 2UXBQ 1HZ9A 4QIWE 1Q86C 5C0XI 1Y1VH 4DV1L 2R7ZH 1VQ5A 4JI3Q 3K81C 4JYAL 2KHJA 1IBMQ 4B3RL 4R4QA 1JJ2A 2VL6A 1HR0W 1VQBA 1BVSA 4JC0A 5C0XG 2YU9H 4GOPA 2B29A 2BH8A 2Q2IA 3I7FA 3T1HL 1X65A 4NXMQ 3G4SA 1XMOL 2F52A 2H5XA 1HZCA 2OQ0A 4IFDI 4QQBX 3GTLH 1UE6A 1PH6A 2ZJQA 2QA4A 3FKIH 4UP7A 3HFZB 3TEHB 1HNWQ 3I55A 4JI1L 4X6AH 3STBC 3EBEA 1XNQQ 4LF5Q 2R6GA 4IPCA 4JI6L 2Q2TA 1QVCA 4YCWA 1VQDA 5M5XH 4P71A 2HIXA 1R9TH 3CCJA 4DK6C 3L7ZC 3CC4A 2Z0SA 3OTOL 5IY0A 1G6PA 1EQQA 2UUCQ 4LFAQ 4HIOA 1N8RC 1XPRA 1IBKL 1X3FA 1OTCA 3CXCA 1I5FA 3OYYA 4GNXA 2R7ZG 4JOIA 4UY8C 1B7YB 1KIXA 3T1YQ 3B6YA 4X62L 3KDFA 3OW2A 3U58A 4LFBQ 1JT8A 1YJ9A 2WAQE 1HNZL 4R4CA 4DPGA 1JB7A 4A3LH 1N32Q 1N34L 3BJUA 3HOUH 1KHIA 5C3EH 1I50H 1SFOH 1EIYB 2JA8H 3FKIG 4J15A 1L1OC 1B70B 2GVBA 2WB1G 1IZ6A 1CKOA 5DLQE 2E5LQ 1FJGQ 2UXBL 4LNQA 2D0OA 4NB3A 3PIPA 1YBYA 1ASZA 1SE8A 1X56A 4JI3L 2K52A 3UDIA 5IWAQ 5C44H 1IBML 5ELOA 1XNRQ 4GKKQ 2PNHA 1L2FA 5GADC 5GAHC 5M3MH 2PI2E 3S1QH 4NXML 2IT1A 1WI5A 2YV5A 4X66Q 3CQZH 4BBSH 1CSQA 4A3BH 4K0KQ 1G51A 4YWLA 1W3SA 5LMUQ 3GTPH 1QVFA 4P75A 2LXJA 5EAYA 4IJLA 2EQSA 1QVGA 2ASBA 1WCMH 5J3BA 4IO9A 2UUAQ 1HNWL 4QY7A 3S1NH 3UE1A 3I4MG 4AIMA 4JI8Q 3LGJA 4AH6A 5JJIA 4A3FH 3AFPA 3GD7A 3VDYA 2N49A 1IBLQ 3J81i 1XNQL 3UDFA 4LF5L 3M4OH 4QGUA 3CCVA 3J81c 5LMNQ 2DGYA 1TWFH 4EX5A 3HOVH 4MZ9A 3TREA 1PH5A 2NVXH 1VQEA 2IX0A 3KYHC 1QZHA 2NVQH 1BKBA 2K75A 1LTLA 4JI7L 3ER0A 3PUWA 4O2DA 3AYHB 3CMEA 1TWGH 3CCRA 3HOUG 4A93H 1LM0A 3U4ZA 2UUCL 2JA8G 3PO3H 4LFAL 1EUJA 2K14A 3PV0A 4LW1A 2OWOA 2RF4A 3GTJH 4DV7Q 1I3QH 1Z47A 1H95A 1VQFA 4DR1Q 2KCMA 1MKHA 1NBWA 2LXKA 2R7FA 4MNOA 4TQUS 5C44G 2JA6H 5JJKA 3HOYH 3T1YL 4LFBL 3NEMA 1VQ6A 4DV6Q 3FHWA 1VQ8A 1YNXA 4A3EH 1PV4A 3AEVA 5M3MG 1K9MC 3H3VH 4APVA 1SLJA 4BBSG 4A3BG 1N32L 2MO1A 4DV5Q 1MJEA 1VQCA 3DM3A 4JBJA 4BA1I 2E5LL 1KD1C 1FJGL 2UU9L 3ULPA 1Q46A 4YWMA 3CD6A 2RHQB 5IWAL 1SN8A 4OWXB 1XNRL 5C0XJ 2E2HH 4DR4Q 3S16H 2N78A 3MEFA 1NE3A 4A3FG 2MQHA 5FLMH 2ES2A 2D0PA 4X66L 2K4KA 3RNUA 1A0IA 1S40A 3ULJA 4HJ9A 2DUDA 5LMUL 1OXTA 1QZGA 2VQFQ 1YI2A 3H0GH 4IFDJ 3BU2A 2GVAA 1A62A 5HGQA 1GVPA 2VQEQ 5JJLA 3SGIA 1CKMA 1QUQB 2RHSB 2Y0SE 3W5OA 2UUAL 3PF5A 3GTKH 1AE2A 4X65Q 4OO1G 3PO3G 3HKZG 2CWAA 4R4TA 1A63A 4JI8L 3WWVA 2OTLA 1N33Q 2N8NA 3D0FA 3I4OA 3K80C 2JK8A 1VQPA 4BA2I 1IBLL 3KLWA 1C9OA 2ZJRA 1EIFA 2R93H 1GO3E 2K5HA 1Q12A 2B3GA 5LMNL 1Q1BA 2JA6G 1KAWA 2VS1A 2AWNA 4A3IH 3HOYG 4BY7H 2XTIA 2JEAI 2NN6G 3IRBA 4A3EG 3S14H 1Q1EA 3NELA 4O0AA 3K0XA 3A5UA 1XMQQ 4A3MG 4P73A 5FJ8H 1NY4A 1E22A 4DV4Q 3NENA 2YTXA 1GM5A 2IX1A 4DAMA 5C4JH 3CC7A 1U5KA 4YHHQ 3AQQA 2OCEA 4IPHA 4DV7L 1E1TA 4XIGS 4LF9Q 2K5NA 3KOJA 3K7UC 4DR1L 1EQRA 4DUYQ 1PVOA 1NMFA 4IJHA 3RLOA 1XJVA 4A3JH 3W1BA 4GN4B 4DV6L 4OX9Q 2JA7G 5LMNW 4A3GH 5FLMG 3HOXH 3AFQA 3S17H 3CMAA 2AKWB 3JC66 5IP7G 4P72A 5M3FH 1J6QA 1UWVA 3H0GG 3UE0A 4DV5L 1VQ4A 1PYSB 4ME3A 3S24A 3KF6A 1ASYA 2LSSA 1AE3A 3I56A 1W2BA 1L0WA 3UDXA 2BH2A 4Y7NH 3J7A5 5IYBH 3PIOA 4DR4L 1Y1VG 1VQNA 3F2DA 1IYJB 4DUZQ 3HOZG 4OXPA 4A3KH 5JEAG 4BBRH 2R7DA 5IP9H 1FGUA 1Q81C 2I5LX 1D7QA 4GKJQ 3M7NA 2VQFL 4A3IG 1KRSA 1VS0A 2AMCB 3HKSA 3KJOA 5BR8Q 2VQEL 4YWKA 2JA5H 4WJ4A 4C2MH 5FJ8G 2WB1E 4JI4Q 1YHAA 1CKNB 4KHZA 4X65L 1TWHH 5C4XH 3S15H 1LUZA 2ZTEA 4HIMA 4DR3Q 1N33L 2GN5A 2MFIA 3RZDH 2PI2A 3G71A 4UP9A 4JBKA 1WJJA 4C3HH 4DK3C 3BZKA 4LFCQ 1K83H 2E8GA 2NVYH 5M5WH 2ATWA 4A3JG 1NJIC 1YJNA 4DV0Q 4A3GG 1VCIA 3HOXG 5IYDH 1I94Q 1X54A 4LWCA 1X55A 1OXSC 4DV4L 3CCSA 1VQLA 1IXRA 5M3FG 3A74A 1VQJA 2ZTDA 1K73C 2UXCQ 4YHHL 3DLLA 1MIUA 4JI2Q 5M5YH 2WP8J 2PQAB 4KHPQ 4YCVA 1GKHA 4LF9L 1HZBA 3CCLA 2QGQA 1YHBA 4OONA 4PZ8A 3CCMA 5IYBG 4DUYL 2Z6KC 3K7AH 1PH3A 2OTJA 3BZCA 1LYLA 3F2BA 1N36Q 2VUMH 1YZ6A 2ID0A 4BBRG 5IP9G 4LF4Q 1UE5A 2A19A 4GN5A 4AYBG 2HIVA 4DR2Q 1HNXQ 1EWIA 4A76A 3ICEA 4A3LG 4LUVA 3UDGA 1CUKA 4PZ6A 4HJAA 3E9HA 5C3EG 2A8VA 3GTMH 3ZJYC 1VQGA 1YJWA 3U50C 4A3CG 2JA5G 1GD7A 3FP9A 4A3DH 2K50A 3I4NH 4HIKA 1UE1A 5C4XG 4A3CH 4DUZL 3STBD 5H1SE 4GOPB 4PZ7A 2AHOB 1J5EQ 1JJCB 1YIJA 4GKJL 4POFA 1SROA 1YVCA 3PUZA 2N3SA 4B3MQ 4JI5Q 2YTYA 4RG1A 3PUYA 4X64Q 3J7ZC 4L5SA 5IYDG 5BR8L 2IHFA 1VQMA 1A8VA 1V43A 4JI4L 4JV5Q 4MTNA 4QJFA 1BBWA 1WCMG 4GLVB 3CCEA 1C0AA 4XTCS 4Y52H 3S1RH 4DR3L 4GKKL 2VZAA 3F1ZA 4JI0Q 3RN2A 1Y1WH 3TQYA 1P8LA 1Y14B 4WJ3M 1TXYA 1CSPA 3A0JA 2KHIA 2VY3A 2VUMG 4DV0L 3HOVG 4L5RC 4OO1I 1I94L 1PFSA 4DR5Q 2C35B 3PO2H 1E24A 3J80c 1V9PA 4GN3B 1VQKA 4JI2L 4A93G 3NBHB 4KLKA 4KHPL 3KJPA 3HKZE 4RMFA 4GNXB 4A3DG 2NN6I 4YY3Q 1K3RA 4B3SQ 4R1JA 2HQLA 4DV3Q 1M1KC 3H3VI 1HJPA 3KDFB 2MNAA 2F4VQ 1N36L 2UUBQ 4LF6Q 4HJ8A 1PH4A 4LF8Q 2MO0A 3EN2A 4LF4L 1T9HA 3M4PA 1VQIA 4HJ5A 1D8LA 3M3YH 1HNZQ 1KRTA 1E7ZA 1PH1A 2NZHA 3GDEA 4DR2L 1YITA 1HNXL 1XPUA 3S1MH 3Q8DA 1G291 3CC2A 2CWPA 2R92H 4R4OA 1PH9A 1AH9A 4GLAC 2CQOA 3CCUA 1YHQA 1MJCA 4A75A 3MXNB 4GLXA 1VQHA 1VQ9A 3K8AA 1EOVA 1DGSA 4H02A 5JEAJ 3PSIA 3TS0A 3EIVA 1P16A 4A4IA 4P74A 1PH8A 1M90C 2BA1A 1O7IA 2BA0A 4OWTB 4YCUA 4NXNQ 1Y1WG 2JQOA 1J5EL 3ERSX 2HHHQ 1L1OA 3GO5A 4C3IH 2NVTH 4JI5L 4B3ML 1IL2A 5GAGC 4X64L 2K5VA 1K0RA 3JAMi 3HOWH 5GQOA 3PO2G 4DR7Q 3JAMc 2UXDQ 1OXVA 3CPFA 4EQ5A 4JV5L 4IFDG 1S3OA 3CAMA 3PCOB 2EXDA 3S2DH 1JE5A 1FVIA 2WFWA 3KF8B 4LUZA 4C3JH 3H15A 4JI0L 1NMGA 3L2PA 4HJ7A 2HT1A 1K8AC 1HZAA 3A5ZB 2R93G 1VQAA 1VQOA 3F8TA 4BY7G 4DR5L 2Q2HA 2KCTA 4IPGA 4GOPC 1PH2A 3W1GA 3M4QA 1EYGA 1XTDA 4JI7Q 2Z6KA 5IE8A 3E0EA 3M9BA 1PH7A 1B8AA 2R92G 3CW2C 2I0QA 1QUQA 3I4MH 2CKZB 1OXUA 3TS2A 1SR3A 1Z9FA 3CF5A 4YY3L 4B3SL 4DV3L 4AQYQ 4ALPA 2F4VL 4DV2Q 1JJGA 2UUBL 4LF6L 2YTVA 4LF8L 3RZOH 2WAQG 3D31A 2IY5B 2ZM6Q 4B3TQ 3S2HH 1C7YA 4FDBA 2ZTCA 3CPWA 1KQSA 5E7NA 1XMQL 2KBNA 4QL5A 1RIPA 2V1CC 3PUVA 2JEBI 1RL2A 3PUXA 3F2CA 3HOWG 2F3IA 1K8GA 1X9NA 1E3PA 2UU9Q 2EIFA 2JA9A 4HIDA 1V1QA 1I6HH 2NZOA 5GROA 4DR6Q 2FXQA 1HR0Q 4IPDA 4NXNL 1SRUA 2PMZE 1E1OA 1Q82C 1HH2P 4A3KG 2E2IH 2ALYB 3RLFA 5AJ3Q 2HHHL 3GTOH 2B63H 4JBWA 3CCQA
chains in the Genus database with same CATH superfamily
4PMWA 2WINB 1I4HA 1IKMA 1U9RA 1VDZA 5IT9c 3I2ZA 1C48A 4IUTA 2F0UA 3DEPA 1XXGA 1WOCA 4DV1Q 1UAPA 2Q8IB 2QEXA 1ESRA 1CT1D 1WTOA 4JYAQ 2EYJA 3M85A 4ZQ3A 2A6ED 1WFQA 1PRTF 1KDBA 4EGVA 4POGA 1BCPD 2JE6I 1FNWA 3QWNA 5ELDA 2CCZA 5JOBA 2RSOA 4L5TA 5KRUA 2QF7A 3ULLA 1AW7A 2YYZA 1JICA 2HCCA 1SMXA 4ID6A 4K5XA 4IOCA 5HY6A 1NTGA 1TWAH 1X6OA 2ZM6L 4B3TL 3MFGA 3RLNA 5J39A 2HQEA 4UPAA 2A1AA 4R4IA 2AWOA 2UXCL 2EY6A 4PNYA 4B08A 4DNIA 3ONAB 1OXXK 1HR0L 4K6LA 4TVAB 1BQQT 2E2JH 1RODA 1JMCA 1UEBA 3I3CA 2B2VC 1STEA 2AQ1B 2JJQA 5ELNA 1CK1A 4NP5A 2R61A 4OWWB 2IHEA 2RCNA 2ZJPA 5D3IB 2BE5C 1Q86C 1STNA 1PZJD 1Y1VH 4C3JB 1VQ5A 1BNZA 1D1KA 1J9OA 4JVZA 3GV3A 1X65A 3G4SA 4HAEA 2RVLA 4JPBW 4IFDI 3GTLH 2F0PA 3MWYW 4FF1A 1U4MA 4ZYSA 2Q8RE 3I4MB 5E4WC 2G9HD 3I55A 2F4IA 5FO7B 4DAPA 3EBEA 3J81E 2ICIA 3BZDB 4JI6L 1MBYA 2KJXA 1VQDA 4XDXA 2HIXA 1F2LA 3NHHA 3CU7A 4WFN3 2MUYA 5EPJA 2Z0SA 1LO5D 5CV9A 5IY0A 3MC0B 3OTOL 2UUCQ 4LFAQ 1A3TA 4HIOA 1IBKL 1XPRA 1OTCA 1I5FA 2EJFC 3SK5A 3GTOB 2E2IB 3R93A 3T1YQ 4LFBQ 3HP3A 4BBSB 1TIID 2L55A 5FLXE 2F0EA 1JB7A 4A3LH 1N34L 1EIYB 1SFOH 3FKIG 2WB1G 2UXBL 1IZ6A 1H9RA 2B2YA 2X69A 3L3OC 4JI3L 2NWGA 4GKKQ 4OHJA 1GUTA 1L2FA 4C3JG 5IODA 3IAYA 3R2TA 1R4PB 3VYUA 2PI2E 4FNFA 4NXML 1Y8PB 1TU2B 2YV5A 5LMUQ 3DWAA 2ENBA 1QVFA 1DD2A 2LXJA 3A7AB 4IJLA 2EQSA 1HNWL 2LFNA 4QY7A 1UUPA 4DU9A 1PFBA 4AIMA 3I4MG 2BE5D 4AH6A 3KF8A 2JA6B 4V0BA 1IBLQ 3HOYB 1XNQL 4O1NA 4QGUA 1TWFH 4MZ9A 4A3MB 1FNVA 1VQEA 3KYHC 5DEHA 1QZHA 1LTLA 3I4LA 2JYOA 3ER0A 4O2DA 3PO3H 3U4ZA 3SK4A 2JA8G 2NUCA 1EUJA 1VMPA 1D2BA 4G7ZC 2OWOA 4DV7Q 3GTJH 5EPKA 1Z47A 1H95A 2B2VA 4IQZA 2VB3X 4DV6Q 1YNXA 2NN6H 4A3EH 5E1FA 3H3VH 1EYDA 5KIXA 3OWEB 4BBSG 4A3BG 3A8JE 4KKUA 3MTSA 1STBA 4DV5Q 1MJEA 1QOHA 1VQCA 1KD1C 1JQYD 2ICEC 5A2QE 2UU9L 3ULPA 1FJGL 3URYA 4RCNA 2KCCA 2RHQB 5IWAL 1XNRL 4OWXB 4DR4Q 3S16H 2B2WC 3MEFA 1EFID 3NWTA 1B2TA 3X3MA 1S40A 3ULJA 1QZGA 1WTPA 5I4DA 3BU2A 3W5OA 2Y0SE 4KKTA 1BF4A 2UUAL 1SAPA 4R4TA 1A63A 1YNJD 3WWVA 1N33Q 2PO4A 3D0FA 4BA2I 2F03A 3HGBA 1CFMA 2IX3A 3KLWA 4OGQC 3VR5A 1C9OA 4Q5VA 2ZJRA 2R93H 2JA6G 4A3IH 3HOYG 2AWNA 3HG9A 2P5ZX 5M5XB 2XTIA 4KJOA 3NELA 5M3FB 5JPMC 4A3MG 4P73A 4DV4Q 1E22A 3NENA 5FO9B 2V4DA 1U5KA 5D14A 4YHHQ 5CV7A 5TSSA 4GZYC 3H91A 4XT1B 1E1TA 4CKEA 2K01A 4V190 1A3UA 1NMFA 3M3YH 4A3JH 1ENFA 2K6AA 4A3GH 5FLMG 2AKWB 1I50B 3RD4A 1PYSB 4C2MB 4NDXA 3S24A 3RMHA 3NQIA 2KCNA 3I56A 1ASYA 3H3VC 2F0HA 1JOQA 4MHEA 5C44B 3J7A5 3PIOA 1ZEQX 1M4VA 1SDFA 2K5WA 3HOZG 4OXPA 5M3MB 2EYHA 2SEBD 3M7GA 4BBRH 5KNBA 5M5WB 1B44D 4F7XA 2VQFL 1JOOA 3D4WA 2DNEA 3BVGA 3K0YA 4QB4A 1S5FD 3KJOA 1WTQA 5FJ8G 3KBXA 4JI4Q 1SYDA 5EPLA 4HCSA 5C4XH 2EYPA 3S15H 2EYFA 4HIMA 2GN5A 2MFIA 3NSWA 3RZDH 3G71A 2VUMB 3BZKA 1K83H 2TMPA 1NJIC 2C9OA 1OXSC 3Q24A 1IXRA 5JJZA 4A93B 1GUOA 5M3FG 3A74A 1VQJA 2ZTDA 5C4HA 1BCPB 1MIUA 4JI2Q 2WP8J 4KHPQ 4OONA 2Z6KC 2FJ2A 3CHBD 1N36Q 2A19A 4QCLA 1EIHA 1L0XB 1YNND 3NXWA 2HIVA 1HNXQ 2DY8A 3UDGA 1YJWA 3T13A 3BDLA 2JA5G 3IKJA 3S1RB 2KOLA 3TP6A 2D9UA 2XSCA 1CZWA 4PZ7A 1JJCB 2CW0C 2CH4A 3C1EA 2B2UC 1SJED 3PUZA 4JI5Q 2YTYA 3J7ZC 3JAME 4HSPA 1PXUA 3DEOA 4EVOA 5BR8L 3MZ5A 1A8VA 5KNCA 2JXMB 3GTKB 4MTNA 4GLVB 3ITPA 4R9WA 4XTCS 2PPBC 4DR3L 4GKKL 1TS5A 4IUNA 4JI0Q 3J81L 4BS9A 3DHQA 1Y14B 1ZKOA 2DY7A 2PNRC 2VUMG 2KHIA 3S14B 2GA4B 1I94L 1PFSA 4JK1C 2C35B 2Z8LA 1LT3D 3S1MB 3J80c 4GN3B 1RDPD 4A93G 2FHTA 4HCEA 3K58A 4A3DG 2NN6I 5CMDA 4YY3Q 3BDCA 4DV3Q 3H3VI 4JW0A 1HJPA 3FVQA 4CBVA 1K8OA 4HJ8A 2IW3A 1BOSA 4S3SA 3TSSA 1T9HA 3M4PA 4LF4L 1D8LA 1HNZQ 1E7ZA 5FLXL 4RGTA 2NZHA 4DR2L 1G291 4WRDA 2CWPA 2R92H 4R4OA 1AH9A 3S2DB 4A75A 1SYCA 1S5ED 4H02A 2D2CC 1M90C 3EIVA 4P74A 2BA0A 1DOKA 4NXNQ 2JQOA 3GO5A 1Y8NB 2NVTH 2EVBA 1I4RA 1TS3A 3HOWH 3DWQA 3PO2G 1OXVA 4EQ5A 4JV5L 4IFDG 4YIJA 5G3LF 2QCPX 3KF8B 4LUZA 3FPPA 2XN9C 3A7LA 4KHVA 2NVYB 1TQOA 5DNFA 2EYMA 1F77A 5C3WA 4GOPC 3M4QA 5HGTA 2Z6KA 5LL6X 5M5YB 1QUQA 2CKZB 5CBEE 4IURA 2F4VL 4B9WA 4K8IA 3K6OA 1CI3M 2PQEA 2KECA 1PTOH 2ZM6Q 4B3TQ 1STGA 3S2HH 4FDBA 2SDFA 1HUNA 2KBNA 1RIPA 1RL2A 5A2QL 2EOTA 4TKOB 5NUCA 3I4NB 4WORA 3OMGA 1KLUD 2RQXA 2JA9A 1LTAD 4HIDA 2B2UA 3H09A 5T1GA 1HR0Q 4LK1C 1SYGA 4RKLA 2HHHL 1EZ8A 1IW7D 1H9SA 1CTMA 1T5XD 4JBWA 1Q8KA 4AYBE 1JWSD 1U0LA 4QIWB 2PW5A 3CP0A 4KN4C 1QB5D 3QO2A 2O5IC 2EJGC 2F0SA 5IIFA 4G57A 1S5DD 4IOAA 3TZUA 3NE5B 3GTGH 3KFUA 3T56B 3DUZA 3PIP3 1F9RA 1TWAB 5ELEA 1KXLA 4BY1H 2A6HD 5BN3A 3CRLC 1HA6A 1M8AA 2HD3A 5K36G 4JG2A 1HFGA 3GTQH 3U9SA 3T51B 3GP7A 3RR5A 3KUPA 2LKVA 4DV2L 2E2JB 4DK1A 4JI6Q 2K5DA 2EY2A 1TWCH 4DFAA 1H9KA 1YEZA 4RGNA 2F0JA 1IKLA 2CVRA 1FL0A 2JP1A 3OTOQ 3N52A 2I5HA 4KY5A 5I2YA 2A69C 2WKDA 1PYBA 3PGZA 2ZT9C 3I4NG 2RA4A 1IBKQ 2X6LA 2CFMA 3ERQA 1V1OA 3O13A 1HHVA 2EZVA 1KC8C 2ZXOA 3CKIB 4LF7L 2G5DA 1N34Q 3C3LA 2UXBQ 1HZ9A 4U68A 1X3QA 2R7ZH 4JI3Q 4B3RL 1JJ2A 2VL6A 1HR0W 1BVSA 5C0XG 2YU9H 4GOPA 2BH8A 3I7FA 5C4ZA 3T1HL 4NXMQ 1XMOL 2F52A 2A5HA 2OQ0A 3BDOA 2ZJQA 3GQBA 3NWSA 1HUMA 3TEHB 2XWBB 5L37A 4FO2A 1HNWQ 3AU7A 4JI1L 1GJXA 1O7YA 3G7LA 3RZOB 1XNQQ 2R6GA 1EY9A 4G7OC 1QVCA 3OSOA 1R9TH 1SFOB 4DK6C 4KTAA 3L7ZC 5HURA 1G6PA 1EQQA 2B8FA 2K05A 3NBHA 4IZ8A 1N8RC 1X3FA 3CXCA 1DZ1A 4J1MA 1EL0A 2EXZA 4UY8C 1XWEA 4X62L 1JT8A 1TY2A 2HDLA 2WAQE 5D3DA 3ZYYX 1HNZL 1HQMC 2MP1A 3FMCA 3M4YA 5CYUA 3BJUA 3HOUH 1KHIA 4A3CH 1D7QA 4J15A 1L1OC 1B70B 1FJGQ 1CKOA 4DNTB 1STYA 1D5XC 1PTOF 2D0OA 2Z4HA 3PIPA 5IWAQ 3UDIA 2K52A 1XNRQ 3ND9A 5ELOA 3A8IE 3V96A 2EJMA 5GADC 3KBGA 2IT1A 1G51A 4YWLA 2CH4W 3GTPH 4P75A 1EU4A 1QVGA 4IO9A 2UUAQ 1LTGD 4KY7A 3HZXA 3S1NH 1ENCA 3LGJA 3AFPA 3VDYA 1SNOA 5ELCA 2NBFA 1W6JA 3OOCA 3UDFA 4LF5L 3M4OH 4A3EB 1D6EC 3D6CA 2DGYA 3HOVH 4EX5A 1PRTD 2F0VA 1S4ZA 4ODGA 2NVXH 3KLSA 2SNSA 1BKBA 3PUWA 4DAVA 3AYHB 1ICFB 1D5MC 1DYQA 2K14A 3PV0A 3F2UA 1I3QH 3S16B 1F9PA 2JA7B 1NBWA 2LXKA 1PZKD 2OF1A 1VQ8A 1PV4A 4NW2A 2F1MA 2K5QA 3C46A 4KK7A 3DM3A 4BA1I 3T16A 5JVG3 1EOTA 1SN8A 4J6HA 5C0XJ 1C4QA 2N78A 1NE3A 1A6XA 3MFYA 4K8JA 4RKBA 4ABNA 4A3IB 1FR3A 2IJ0A 2K4KA 3RNUA 4K0KL 2DUDA 4X3TA 2VQFQ 2L0CA 3FKIB 2WB1B 2GVAA 1VMCA 1GVPA 3SGIA 1CKMA 1O78A 1QUQB 2RHSB 1AE2A 4DGZA 3PO3G 1V1PA 2OTLA 3I4OA 3SE0A 4CJ0B 4FF4A 1B4OA 3M3YB 2B3GA 5LMNL 4BY7H 1Z7TA 2NN6G 2RDFA 3IRBA 4A3EG 3K0XA 3QOJA 3A5UA 1XMQQ 3C2PA 1GM5A 4PV1C 4I65A 3NTHA 2A68C 3CC7A 4CDCC 3AQQA 2OCEA 4ME5A 1EU3A 4XIGS 4DR1L 4CDDC 3OIPA 4IJHA 1H9SB 1KDAA 4GN4B 4OX9Q 2JA7G 4DAYA 4KKSA 5IP7G 5C3EB 4P72A 2JA8B 1VQ4A 2SOBA 4ME3A 4N8X1 2LSSA 1AE3A 5C4XB 1L0WA 3UDXA 5IYBH 1IYJB 4RHRA 3S1QB 4A3KH 5JEAG 1K83B 1JWMD 3CQZB 4XYQA 4DXFA 3BVMA 4A3BB 1EWHA 2G9DA 1B9NA 4A3IG 3HKSA 4CJ1B 5BR8Q 4J8QA 1WCMB 2VQEL 5EKIA 1HTLD 4X65L 1JB3A 2ZTEA 4DR3Q 1SMYC 1ILQA 1GUWA 4UP9A 4LFCQ 4C3HH 3PIO3 2E8GA 4A3JG 4RCOA 3BG3A 4A3GG 2LY7A 5IYDH 2NVQB 1I94Q 1X54A 4K14A 4OIJA 4ZAIA 5FKAC 1VQLA 1O80A 2PYKA 4K5WA 2B2TC 1GKHA 4LF9L 1HZBA 2RCFA 2QGQA 1YHBA 2J0TD 4DUYL 1WTVA 1PH3A 5D65A 3BZCA 3RUZA 1LTRD 3F2BA 4BBRG 4LF4Q 1ESFA 4NKLA 4DR2Q 3R3OA 1EWIA 4A76A 2N55A 3QR8A 4HJAA 5C3EG 1VQGA 3FP9A 3SVMA 4HIKA 5C4XG 2H4OA 4DN4M 5H1SE 4GOPB 4HR7B 4L6TB 1QJOA 1ZYRC 1SROA 3OHXC 1JC7A 1YVCA 2N3SA 1NR4A 1CQFA 1HA5A 4RG1A 4CKCA 4L5SA 1G91A 2DNCA 2FINB 1V43A 3L9AX 1DJRD 4JV5Q 4QJFA 3CCEA 1BBWA 1WCMG 1C0AA 3HOZB 4Y52H 2VZAA 3F1ZA 5ELBA 1SNPA 3NTIA 2L12A 2Z4IA 1P8LA 3TQYA 1KDCA 1SNMA 1TXYA 3BS1A 2VY3A 4L8JA 2R92B 5C4JB 1ET6A 3EVQA 2IPKD 3NBHB 3KJPA 3HKZE 1OO9B 2KEEA 1K3RA 1M1KC 3DM1A 2F4VQ 3S17B 4HJ5A 3P7JA 5EGTA 4G7HC 5EJWA 2Z1CA 5FOBB 3GDEA 3HOWB 5I2XA 1F2YA 3CC2A 5EQ0A 3VR3A 1YHQA 1V8QA 4CDFC 1VQHA 1VQ9A 2PMZB 1EOVA 1DGSA 5JEAJ 4UAIA 2K7VA 2BA1A 1SE4A 4OWTB 2HHHQ 4KMUC 3ERSX 3K5NA 1BR9A 4CDEC 1CA6A 2JA5B 2A74C 2RSNA 5GQOA 3VR6A 1TWHB 2EXDA 4X3KA 1IYUA 4HEDA 1EY0A 3H15A 4C3JH 1KABA 4HJ7A 1QILA 2HT1A 2M00A 3I91A 1VQAA 1D5ZC 3A8KE 1VQOA 2EPBA 2JSOA 2F0DA 2B2TA 2KCTA 1PH2A 3W1GA 1EYGA 4JI7Q 5IE8A 1B8AA 2R92G 3CW2C 3I4MH 1OXUA 2L4NA 3K7AB 3CF5A 1CA5A 1AFPA 4PMCA 4OIKA 3SEBA 4DV2Q 1AZPA 2UUBL 4LF6L 2NB0A 3D31A 3H94A 3K5LA 1PYWD 1QE6A 1EEID 5E7NA 1XMQL 4XQNA 2V1CC 1SXTA 3D4RA 3GTMB 1PRTB 3PUVA 3F2CA 3HOWG 2F3IA 4A3DB 1K8GA 1X9NA 1E3PA 2EIFA 5GROA 1HCZA 1LTTD 1Q82C 4OX9L 1HH2P 3GTOH 1QCBD 2E2IH 2B63H 1KNAA 2I0QA 2QDBA 4LF7Q 1E2VA 4JOIC 3G6EA 2B2WA 3G48A 4BXXH 3PF4A 1ZXTA 2F3VA 4DR7L 2UXDL 2CHBD 1PHJA 1EIGA 2ZXPA 1SSOA 5IYCH 1V1PB 3L0OA 4FF3A 3I70A 1X3GA 5CV4A 3MXUA 4R8IA 1MSHA 4B3RQ 1U4RA 1D1IA 5KEEA 1EFWA 3RN5A 1WYDA 4CJ2C 3T1HQ 1RD9D 2KENA 4KI0A 3U4VA 1XMOQ 2L15A 1TWCB 2EY1A 3PO2B 3J81j 2DN8A 4JCVE 2OQKA 1WTXA 2AUKA 4KY6A 4JI1Q 1CKNA 4DXGA 3HRZC 4UP8A 1U4PA 4LFCL 3TN2A 1EY4A 4XQQA 2I5MX 2Z9HA 1L1OB 4ZKCB 4DAYB 4QUCA 4L5QA 1I4QA 2LMCB 1B53A 3J80i 1I6VC 4A3MH 3E9IA 2EE1A 3WOEA 5FLXc 1BBUA 4TRDA 2XGTA 1EY8A 2J4XA 2VB2X 2B8GA 1UE7A 4X62Q 5IGBA 2EYOA 5A35A 1SE2A 4PG3A 4BY1G 3BYYB 2Y0SG 4X3UA 4QIWE 4C1NK 1I4PA 2PW7A 3K81C 1K28A 4R8NA 4JC0A 2B29A 1XYIA 1EQVA 5EKLA 1SNDA 2H5XA 1DOMA 5I6WA 5IT9E 1PH6A 1LLRD 3HFZB 3A55A 2F0FA 2NTSA 2OEOA 4X6AH 1U4LA 5G3LD 3STBC 4FXDA 4ZKBB 2KEDA 3K5OA 4O42A 5EBDA 1LTSD 1A3VA 4LF5Q 3NP8A 1BBXC 3FEWX 4F88A 3P75A 2F0IA 2CW0D 5M5XH 4P71A 3AB9A 4KJNA 3H6MA 5KNDA 1I6HB 1EQTA 4HMIA 2HDMA 2R7ZG 4N8FA 4JOIA 2KA7A 1KIXA 2MHVA 1Y69U 3KDFA 3OW2A 3IFDA 4IUPA 4R4CA 4DPGA 2PCFB 1PDQA 3NTKA 1I50H 2HCIA 5DLQE 5IGGA 4NB3A 1ASZA 1YBYA 3MXNA 3TBIB 5C44H 1IBML 2PNHA 5M3MH 4ZK9B 1PFNA 4K0KQ 2F0TA 2NVXB 1W3SA 2NYZD 5EAYA 4IUUA 3TDQA 5J3BA 2KQ3A 3UE1A 5JJIA 2AQ3B 4A3FH 1TS2A 2MGSA 1HPCA 1MGSA 3C1FA 3CCVA 5LMNQ 1DCZA 4MTKA 1BDOA 1RF2D 1PH5A 1GUGA 5CV5A 2I46A 4JI7L 2K75A 3VR4A 2QW7A 1TWGH 4H44C 3CCRA 3HOUG 1LM0A 4A93H 4OO1H 1LABA 5FO8B 3KLSX 4LW1A 3SK6A 4DR1Q 3QIAA 3TP7A 4MNOA 3I72A 4RGOS 1C8CA 3EJIA 3NEMA 1VQ6A 1B50A 3G6JB 2R3ZA 3E6ZX 1K9MC 2D5DA 2SNMA 1FD7D 4XXEA 1SLJA 3SXHA 4EQPA 2J7ZA 1N32L 4IUQA 1WTWA 2E5LL 1PTOC 1Y1VB 1Q46A 2F0LA 2I07B 4YWMA 2E2HH 4M1UB 2ES2A 1F9QA 1GUSA 1GOZA 3HS0C 4NMZA 4X66L 3GTLB 1A15A 4HJ9A 2WIIB 1OXTA 2F0WA 1YI2A 3H0GH 4IFDJ 1B1ZA 1A62A 5HGQA 2VQEQ 1MD2D 3GTKH 4X65Q 1DM0B 2WACA 4JI8L 5CGKA 3K80C 2JK8A 1WD0A 1LACA 1EIFA 1Q1BA 2K03A 2VS1A 5T1IA 3S14H 1Q1EA 5C3XA 2H1EA 3OWFA 1NY4A 2XRSD 4DAMA 1CQVA 4WJWA 4IPHA 4LF9Q 2K5NA 1E0BA 4DUYQ 1PVOA 2C5CA 3RLOA 1BUVT 3W1BA 4AYBB 5LMNW 2O4XA 1BCPC 5DM73 3HOXH 3CMAA 1K8MA 3JC66 3MEHA 1J6QA 1UWVA 3UE0A 1G6ZA 5DAUA 2AQ2B 3KF6A 1W2BA 3DMUA 4Y7NH 3FDTA 1Y1VG 3U9OA 1VQNA 3F2DA 3TZDA 3MXPA 2F0QA 3LX0A 2Q8TA 5I6YA 5IP9H 4HMJA 3M7NA 3JAML 1R4QB 3QG1A 4YWKA 4WJ4A 2WB1E 4UHVA 4ZUJA 1CKNB 4KHZA 4DA2A 3Q6SA 3E5SA 2A69D 4DNRB 2PI2A 4JBKA 1WJJA 1NUCA 2EYLA 1TWFB 2BOSA 2NVYH 2XRQD 1VCIA 4RGMA 1X55A 1Y8OB 1SBBB 2DJGC 3PO3B 2L11A 5E3FA 1K73C 3DLLA 2BDNA 5M5YH 1A2UA 3GTJB 1JCKB 3CCLA 3CCMA 1QNUA 5IYBG 2OTJA 1YZ6A 2ID0A 3Q22A 5BN5A 2M9VA 3IFTA 4AYBG 4MN3A 1TKWB 4F8MA 1K0SA 4ILWA 1NAPA 4A3LG 1CUKA 2A8VA 4RA8A 3ZJYC 3U50C 1ML0D 1GD7A 3AMUA 2K50A 3I4NH 4FXGC 1O7ZA 4DUZL 1T5EA 2AHOB 3TP5A 2NTTA 3E0JA 1YIJA 3WDNA 4C3HG 2B2YC 4GKJL 3I73A 1BCPF 3VA5A 5IT9L 1EZ6A 2E74C 5IYDG 2IHFA 3SK8A 5DM63 3R2IA 5ELFA 2DJFC 4HN7A 3RN2A 5C0XH 1Y1WH 2R93B 3MXGA 4WJ3M 1GXDC 1XTCD 3A0JA 4DV0L 4BWGB 4L5RC 4OO1I 2QDLA 1E24A 1SE3A 4G4KA 3D8GA 1VQKA 4CKBA 3K59A 4KLKA 2HUGA 4RMFA 2F0KA 4P2CB 4A3JB 2WAQB 3KDFB 4A3GB 4Q0FA 2JN4A 2UUBQ 4LF6Q 1NNXA 2MO0A 3EN2A 3W2DA 1VQIA 5C5LA 3NPPA 3QJYA 1PH1A 1YITA 3VYTA 2KHSA 4C1NI 2CQOA 1EY6A 3MXNB 4GLXA 3K8AA 3PSIA 4K2LA 3TS0A 4BBRB 1O7IA 5BN4A 4YCUA 1EWCA 5M9OA 1J5EL 1L1OA 1MHWC 2A73B 3SR1A 4C3IH 4B3ML 4X64L 2K5VA 3EQLC 1K0RA 4DR7Q 2K28A 2UXDQ 2FFKB 3CPFA 2KVMA 2FMMA 3PCOB 3S15B 2MPMA 1FVIA 4I7ZC 5IGDA 3RZDB 3NBIA 4LAAA 4ZLTF 3IL8A 1B3QA 1JOKA 1H9JA 1NMGA 3L2PA 2XVSA 1K8AC 3A5ZB 3DWPA 2R93G 4FVMA 3F8TA 1E2WA 5CORA 5IGFA 4DR5L 3D6WA 3BVZA 4RHSA 1PH7A 1EYCA 5KYLA 1HTPA 1Z9FA 4IN3A 4QMGA 3LNNA 4B3SL 1F9SA 4ALPA 4HSVA 1JORA 1DXMA 1JJGA 5CC4A 3W3AA 4LF8L 3RZOH 1CHQD 2B63B 2WAQG 1PMRA 3J80E 1G2SA 1PZID 4N9PA 4QL5A 3FRPB 1O7LA 1YNJC 3QOLA 2FXQA 2IWHA 2NZ1D 4EQOA 1E1OA 2PMZE 4LNQA 3CCQA 3EFXD 3SDZA 1EEFD 1I4XA 4GNXC 3P20A 4LUOA 1F2MA 5LHY1 5J22A 3I90A 2RKSA 3LWUA 1PFMA 1BXTA 1F2ZA 4E6IA 2A68D 1RKNA 2FMCA 3MHBA 2VW9A 1XPOA 1X3EA 3VA7A 1SYBA 3Q0AA 2F0MA 4DKAC 3N6RA 4NPSA 1EYAA 1HQRD 3KK7A 1NCVA 4FXKC 2D62A 1SJHD 3EA6A 4RH6A 4AQYL 1IYVA 2K32A 1B3AA 3P1HA 1Q7YC 2ZXRA 2L1BA 1X3PA 1VQ7A 2Q2UA 2MJ8A 2B63G 1MI2A 1E2ZA 5COYA 4GS3A 2BCOA 3KF6B 2QKIC 2VNUD 4BXXG 1PA6A 5IYCG 4PMBA 2PQAA 4DR6L 3QB3A 1SMYD 4LMQD 2JA7H 1KL9A 5CBAE 1AN8A 4I7AA 3TRZA 5AJ3L 1S72A 2NVTB 2RDGA 1FNUA 5IP7H 4QUFA 1LTID 4N9TA 1N9WA 5GAEC 4JBMA 3J7AV 5C0XI 1DOLA 4DV1L 1SYEA 4PQXA 4JYAL 2K1BA 2KHJA 1IBMQ 3MAQA 4R4QA 5JEAH 1Z6HA 3S9WA 1VQBA 2Q2IA 3OIQA 1YNNC 1HZCA 3X3NA 4QQBX 1UE6A 2XNAC 2QA4A 1KLGD 1W6KA 3FKIH 5JPNC 1TS4A 3V2TA 4UP7A 3WOFA 1MSGA 2E2DC 3LWEA 4B9XA 4IPCA 3ND8A 1PTOB 2Q2TA 3S2HB 1G8ZD 2Z6BA 4YCWA 1ZYRD 3CCJA 3CC4A 1X32A 1RHPA 4TSSA 1ONLA 2EY5A 5CV6A 3OYYA 4GNXA 1S5CD 1B7YB 1ENAA 3NK9A 3B6YA 3U58A 1YJ9A 3DXJC 2F0OA 4K5VA 1N32Q 5KGUA 5C3EH 2OXPA 2JA8H 4HTHA 1NR2A 2E5LQ 2GVBA 1SE8A 1X56A 5EBCA 3J7YW 4A3FB 3SHLA 3T53B 3GTGB 5GAHC 2AUJD 5CR3A 3S1QH 4X66Q 1UNSA 1WI5A 4BY1B 3CQZH 4BBSH 1CSQA 4A3BH 1ILPA 3EROA 2CQAA 4ZCKA 2Y0SB 2BDOA 1GHJA 4DK0A 1TWGB 2ASBA 3GTQB 1WCMH 3HKZB 4CGYB 4RWSC 5F2DA 3MVVA 4JI8Q 5C5MA 1WTRA 2EDGA 3GD7A 5EKKA 2N49A 3J81i 3J81c 1DONA 4QF4A 3TREA 1AEXA 2IX0A 2NVQH 3I8ZA 1HFNA 1VF5C 1I4GA 3CMEA 2WV6D 5JVH3 2KUMA 2UUCL 1Q8IA 4LFAL 3GV6A 4U673 2RF4A 2E2HB 4H7BA 1VQFA 2QEJC 2KCMA 1MKHA 4TQUS 2R7FA 5C44G 2JA6H 5JJKA 3HOYH 3T1YL 4LFBL 3FHWA 3AEVA 5AFWA 5M3MG 1S5BD 1KAAA 1H9MA 1JR0D 1ICWA 3H0GB 1B9MA 4APVA 1AZQA 3KLRA 2MO1A 4M8AA 1QNKA 1K3BC 2TSSA 4JBJA 2IL8A 1TY0A 2R7ZB 3CD6A 1A2TA 2K33A 2VXWA 4H0LC 2YU9B 4A3FG 1QWYA 2MQHA 2L9HA 5I9PA 5FLMH 2D0PA 1A0IA 3FPUB 5LMUL 1LT5D 2E75C 2OT2A 3HEJA 2B39A 2QILA 5JJLA 3PF5A 4OO1G 3HKZG 2CWAA 5IGCA 3HOZH 2N8NA 1VQPA 3E3XA 1IBLL 1IW7C 4XT3B 1GHKA 1GO3E 2K5HA 1Q12A 4EQNA 1KAWA 3HOXB 3J80L 2JEAI 1QG7A 1R9TB 1L0YB 4O0AA 5FJ8H 2YTXA 2IX1A 1GUNA 5C4JH 5IOCA 1JE4A 1STHA 4Y7NB 4DV7L 3NUCA 3KOJA 3K7UC 1EQRA 5IGEA 1IHZA 1XJVA 1J8IA 1ET9A 1TR5A 4DV6L 4RFBA 2A6HC 3S17H 3AFQA 4KV6A 1STAA 1RTNA 3HOUB 5M3FH 3D4DA 3H0GG 4DV5L 1NSNS 2PZUA 5KYIA 1SNQA 1LTBD 2BH2A 3VYRA 2PZWA 4DR4L 4DUZQ 3VR2A 1II3A 2R7DA 1FGUA 1Q81C 2I5LX 3A56A 1EY7A 4GKJQ 3GTPB 2WKCA 4FF2A 1KRSA 1VS0A 2AMCB 1AP0A 2JA5H 4C2MH 2F0GA 1YHAA 3S1NB 4OELB 2F3WA 1TWHH 1LUZA 4C56C 1N33L 1CM9A 3M4OB 5JAVA 4DK3C 3HOVB 5M5WH 4IUVA 2ATWA 1YJNA 4DV0Q 2L5TA 3NQTA 4K2KA 3HOXG 4LWCA 3OW7A 2F0NA 5CV8A 4DV4L 3CCSA 2UXCQ 4YHHL 1IL8A 1I3QB 2PQAB 3VYSA 4YCVA 2O2LD 5E4XA 4PZ8A 3K7AH 3TP8A 1WD1A 1LYLA 2VUMH 1JWUD 5IP9G 1UE5A 4GN5A 1RCVD 1G2TA 4KD3A 3ICEA 4LUVA 4PZ6A 1TVXA 3E9HA 3GTMH 4A3CG 4A3DH 1SEBD 3PMFA 1Q90A 1UE1A 5ISRA 1Y1WB 3K57A 3STBD 4RAUC 1J5EQ 5LL6S 4POFA 1EY5A 3TMEA 4B3MQ 3PUYA 4X64Q 1VF7A 4Z9CB 1VQMA 3J7AF 2PZTA 4JI4L 4CHTB 3S1RH 1LT6D 2RBMA 4OL7A 4BY7B 1CSPA 1KNEA 2E76C 3T4AC 4FP5D 3HOVG 4DR5Q 2XIWA 3PO2H 4IFDH 4LJZC 5FK9C 3K5MA 1V9PA 1HRJA 4XYOA 4JI2L 3CRKC 1XX8A 2LS01 1FYCA 4KHPL 4GNXB 4B3SQ 4R1JA 2HQLA 3UI2A 2MNAA 1N36L 1WVLA 1PH4A 4LF8Q 4C3IB 1CZGA 3OPOA 4X3SA 1KRTA 1XPUA 1HNXL 3S1MH 5C6AA 3Q8DA 1PH9A 4GLAC 2M2LA 3CCUA 1MJCA 5K5PA 1TT2A 2A6EC 1PH8A 1PLFA 5J1ZA 1HXYD 1KTKA 1P16A 1SYFA 4A4IA 5I9OA 4A3KB 1PRTC 1Y1WG 4IALA 4JI5L 1RTOA 1IL2A 1UEAB 4L63B 5GAGC 4FYDA 3JAMi 4ZUIA 4H13C 2RDHA 4UDUC 3JAMc 2N88A 1S3OA 3CAMA 3S2DH 1JE5A 2WFWA 2XWJB 3BYTB 4JI0L 4ULLA 4C3HB 1RJTA 4ZRZA 1HZAA 2X6GA 1WTHA 3OMCA 4BY7G 3MA2B 2Q2HA 1SNCA 4IPGA 4XQJA 1XTDA 4KN7C 3E0EA 3M9BA 4MIUA 4KD4A 1PTOD 2K04A 4F87A 3TS2A 1SR3A 4YY3L 1BO0A 3D3RA 4DV3L 4AQYQ 1Q3LA 3V05A 2YTVA 3PQIA 2IY5B 1LT4D 4DF7A 1C7YA 2ZTCA 4C3IG 3CPWA 1KQSA 4OEMB 1LV9A 5K36H 3PUXA 2JEBI 4K6DA 3R8BA 2UU9Q 3A54A 2O5JC 1V1QA 1I6HH 2NZOA 1FGBD 4DR6Q 1CHPD 4IPDA 4NXNL 1SRUA 4A3KG 2ALYB 3RLFA 5AJ3Q 3Q23A
chains in the Genus database with same CATH topology
1Q8KA 4AYBE 4PMWA 4GNXC 4LUOA 4LF7Q 1U0LA 4JOIC 3G6EA 4OX9L 3G48A 4BXXH 3PF4A 3CP0A 3I2ZA 5IT9c 4DR7L 2UXDL 1PHJA 5IYCH 3L0OA 1WOCA 4DV1Q 1X3GA 2QEXA 4JYAQ 4IOAA 4B3RQ 2VW9A 3M85A 1XPOA 1X3EA 1EFWA 1WFQA 4DKAC 3RN5A 3GTGH 3KFUA 1WYDA 3T1HQ 4NPSA 2KENA 4KI0A 3U4VA 1XMOQ 2L15A 4POGA 1KXLA 4BY1H 3J81j 2JE6I 2CCZA 4K0KL 4JCVE 2OQKA 4L5TA 5K36G 4JG2A 3ULLA 3GTQH 2D62A 4JI1Q 1CKNA 2YYZA 4UP8A 4AQYL 4LFCL 3RR5A 1SMXA 4DV2L 2I5MX 4IOCA 1L1OB 5HY6A 4DAYB 1Q7YC 4JI6Q 1NTGA 1TWAH 1X6OA 4L5QA 2ZM6L 1VQ7A 2Q2UA 4B3TL 2B63G 1TWCH 3RLNA 3J80i 4A3MH 1YEZA 4UPAA 2A1AA 4GS3A 4R4IA 1FL0A 3E9IA 2AWOA 2UXCL 3KF6B 5FLXc 2VNUD 1BBUA 3OTOQ 4BXXG 2I5HA 2XGTA 1PA6A 1PYBA 3PGZA 5IYCG 3I4NG 4DNIA 1IBKQ 1OXXK 2PQAA 4DR6L 2CFMA 1HR0L 4TVAB 1UE7A 2JA7H 1KL9A 3TRZA 1KC8C 4X62Q 2E2JH 5AJ3L 1JMCA 1UEBA 1S72A 3HOZH 5IP7H 2JJQA 5ELNA 4LF7L 4PG3A 1N9WA 4BY1G 1N34Q 4OWWB 5GAEC 2IHEA 4JBMA 2RCNA 2Y0SG 2ZJPA 2UXBQ 1HZ9A 4QIWE 1Q86C 5C0XI 1Y1VH 4DV1L 2R7ZH 1VQ5A 4JI3Q 3K81C 4JYAL 2KHJA 1IBMQ 4B3RL 4R4QA 1JJ2A 2VL6A 1HR0W 1VQBA 1BVSA 4JC0A 5C0XG 2YU9H 4GOPA 2B29A 2BH8A 2Q2IA 3I7FA 3T1HL 1X65A 4NXMQ 3G4SA 1XMOL 2F52A 2H5XA 1HZCA 2OQ0A 4IFDI 4QQBX 3GTLH 1UE6A 1PH6A 2ZJQA 2QA4A 3FKIH 4UP7A 3HFZB 3TEHB 1HNWQ 3I55A 4JI1L 4X6AH 3STBC 3EBEA 1XNQQ 4LF5Q 2R6GA 4IPCA 4JI6L 2Q2TA 1QVCA 4YCWA 1VQDA 5M5XH 4P71A 2HIXA 1R9TH 3CCJA 4DK6C 3L7ZC 3CC4A 2Z0SA 3OTOL 5IY0A 1G6PA 1EQQA 2UUCQ 4LFAQ 4HIOA 1N8RC 1XPRA 1IBKL 1X3FA 1OTCA 3CXCA 1I5FA 3OYYA 4GNXA 2R7ZG 4JOIA 4UY8C 1B7YB 1KIXA 3T1YQ 3B6YA 4X62L 3KDFA 3OW2A 3U58A 4LFBQ 1JT8A 1YJ9A 2WAQE 1HNZL 4R4CA 4DPGA 1JB7A 4A3LH 1N32Q 1N34L 3BJUA 3HOUH 1KHIA 5C3EH 1I50H 1SFOH 1EIYB 2JA8H 3FKIG 4J15A 1L1OC 1B70B 2GVBA 2WB1G 1IZ6A 1CKOA 5DLQE 2E5LQ 1FJGQ 2UXBL 4LNQA 2D0OA 4NB3A 3PIPA 1YBYA 1ASZA 1SE8A 1X56A 4JI3L 2K52A 3UDIA 5IWAQ 5C44H 1IBML 5ELOA 1XNRQ 4GKKQ 2PNHA 1L2FA 5GADC 5GAHC 5M3MH 2PI2E 3S1QH 4NXML 2IT1A 1WI5A 2YV5A 4X66Q 3CQZH 4BBSH 1CSQA 4A3BH 4K0KQ 1G51A 4YWLA 1W3SA 5LMUQ 3GTPH 1QVFA 4P75A 2LXJA 5EAYA 4IJLA 2EQSA 1QVGA 2ASBA 1WCMH 5J3BA 4IO9A 2UUAQ 1HNWL 4QY7A 3S1NH 3UE1A 3I4MG 4AIMA 4JI8Q 3LGJA 4AH6A 5JJIA 4A3FH 3AFPA 3GD7A 3VDYA 2N49A 1IBLQ 3J81i 1XNQL 3UDFA 4LF5L 3M4OH 4QGUA 3CCVA 3J81c 5LMNQ 2DGYA 1TWFH 4EX5A 3HOVH 4MZ9A 3TREA 1PH5A 2NVXH 1VQEA 2IX0A 3KYHC 1QZHA 2NVQH 1BKBA 2K75A 1LTLA 4JI7L 3ER0A 3PUWA 4O2DA 3AYHB 3CMEA 1TWGH 3CCRA 3HOUG 4A93H 1LM0A 3U4ZA 2UUCL 2JA8G 3PO3H 4LFAL 1EUJA 2K14A 3PV0A 4LW1A 2OWOA 2RF4A 3GTJH 4DV7Q 1I3QH 1Z47A 1H95A 1VQFA 4DR1Q 2KCMA 1MKHA 1NBWA 2LXKA 2R7FA 4MNOA 4TQUS 5C44G 2JA6H 5JJKA 3HOYH 3T1YL 4LFBL 3NEMA 1VQ6A 4DV6Q 3FHWA 1VQ8A 1YNXA 4A3EH 1PV4A 3AEVA 5M3MG 1K9MC 3H3VH 4APVA 1SLJA 4BBSG 4A3BG 1N32L 2MO1A 4DV5Q 1MJEA 1VQCA 3DM3A 4JBJA 4BA1I 2E5LL 1KD1C 1FJGL 2UU9L 3ULPA 1Q46A 4YWMA 3CD6A 2RHQB 5IWAL 1SN8A 4OWXB 1XNRL 5C0XJ 2E2HH 4DR4Q 3S16H 2N78A 3MEFA 1NE3A 4A3FG 2MQHA 5FLMH 2ES2A 2D0PA 4X66L 2K4KA 3RNUA 1A0IA 1S40A 3ULJA 4HJ9A 2DUDA 5LMUL 1OXTA 1QZGA 2VQFQ 1YI2A 3H0GH 4IFDJ 3BU2A 2GVAA 1A62A 5HGQA 1GVPA 2VQEQ 5JJLA 3SGIA 1CKMA 1QUQB 2RHSB 2Y0SE 3W5OA 2UUAL 3PF5A 3GTKH 1AE2A 4X65Q 4OO1G 3PO3G 3HKZG 2CWAA 4R4TA 1A63A 4JI8L 3WWVA 2OTLA 1N33Q 2N8NA 3D0FA 3I4OA 3K80C 2JK8A 1VQPA 4BA2I 1IBLL 3KLWA 1C9OA 2ZJRA 1EIFA 2R93H 1GO3E 2K5HA 1Q12A 2B3GA 5LMNL 1Q1BA 2JA6G 1KAWA 2VS1A 2AWNA 4A3IH 3HOYG 4BY7H 2XTIA 2JEAI 2NN6G 3IRBA 4A3EG 3S14H 1Q1EA 3NELA 4O0AA 3K0XA 3A5UA 1XMQQ 4A3MG 4P73A 5FJ8H 1NY4A 1E22A 4DV4Q 3NENA 2YTXA 1GM5A 2IX1A 4DAMA 5C4JH 3CC7A 1U5KA 4YHHQ 3AQQA 2OCEA 4IPHA 4DV7L 1E1TA 4XIGS 4LF9Q 2K5NA 3KOJA 3K7UC 4DR1L 1EQRA 4DUYQ 1PVOA 1NMFA 4IJHA 3RLOA 1XJVA 4A3JH 3W1BA 4GN4B 4DV6L 4OX9Q 2JA7G 5LMNW 4A3GH 5FLMG 3HOXH 3AFQA 3S17H 3CMAA 2AKWB 3JC66 5IP7G 4P72A 5M3FH 1J6QA 1UWVA 3H0GG 3UE0A 4DV5L 1VQ4A 1PYSB 4ME3A 3S24A 3KF6A 1ASYA 2LSSA 1AE3A 3I56A 1W2BA 1L0WA 3UDXA 2BH2A 4Y7NH 3J7A5 5IYBH 3PIOA 4DR4L 1Y1VG 1VQNA 3F2DA 1IYJB 4DUZQ 3HOZG 4OXPA 4A3KH 5JEAG 4BBRH 2R7DA 5IP9H 1FGUA 1Q81C 2I5LX 1D7QA 4GKJQ 3M7NA 2VQFL 4A3IG 1KRSA 1VS0A 2AMCB 3HKSA 3KJOA 5BR8Q 2VQEL 4YWKA 2JA5H 4WJ4A 4C2MH 5FJ8G 2WB1E 4JI4Q 1YHAA 1CKNB 4KHZA 4X65L 1TWHH 5C4XH 3S15H 1LUZA 2ZTEA 4HIMA 4DR3Q 1N33L 2GN5A 2MFIA 3RZDH 2PI2A 3G71A 4UP9A 4JBKA 1WJJA 4C3HH 4DK3C 3BZKA 4LFCQ 1K83H 2E8GA 2NVYH 5M5WH 2ATWA 4A3JG 1NJIC 1YJNA 4DV0Q 4A3GG 1VCIA 3HOXG 5IYDH 1I94Q 1X54A 4LWCA 1X55A 1OXSC 4DV4L 3CCSA 1VQLA 1IXRA 5M3FG 3A74A 1VQJA 2ZTDA 1K73C 2UXCQ 4YHHL 3DLLA 1MIUA 4JI2Q 5M5YH 2WP8J 2PQAB 4KHPQ 4YCVA 1GKHA 4LF9L 1HZBA 3CCLA 2QGQA 1YHBA 4OONA 4PZ8A 3CCMA 5IYBG 4DUYL 2Z6KC 3K7AH 1PH3A 2OTJA 3BZCA 1LYLA 3F2BA 1N36Q 2VUMH 1YZ6A 2ID0A 4BBRG 5IP9G 4LF4Q 1UE5A 2A19A 4GN5A 4AYBG 2HIVA 4DR2Q 1HNXQ 1EWIA 4A76A 3ICEA 4A3LG 4LUVA 3UDGA 1CUKA 4PZ6A 4HJAA 3E9HA 5C3EG 2A8VA 3GTMH 3ZJYC 1VQGA 1YJWA 3U50C 4A3CG 2JA5G 1GD7A 3FP9A 4A3DH 2K50A 3I4NH 4HIKA 1UE1A 5C4XG 4A3CH 4DUZL 3STBD 5H1SE 4GOPB 4PZ7A 2AHOB 1J5EQ 1JJCB 1YIJA 4GKJL 4POFA 1SROA 1YVCA 3PUZA 2N3SA 4B3MQ 4JI5Q 2YTYA 4RG1A 3PUYA 4X64Q 3J7ZC 4L5SA 5IYDG 5BR8L 2IHFA 1VQMA 1A8VA 1V43A 4JI4L 4JV5Q 4MTNA 4QJFA 1BBWA 1WCMG 4GLVB 3CCEA 1C0AA 4XTCS 4Y52H 3S1RH 4DR3L 4GKKL 2VZAA 3F1ZA 4JI0Q 3RN2A 1Y1WH 3TQYA 1P8LA 1Y14B 4WJ3M 1TXYA 1CSPA 3A0JA 2KHIA 2VY3A 2VUMG 4DV0L 3HOVG 4L5RC 4OO1I 1I94L 1PFSA 4DR5Q 2C35B 3PO2H 1E24A 3J80c 1V9PA 4GN3B 1VQKA 4JI2L 4A93G 3NBHB 4KLKA 4KHPL 3KJPA 3HKZE 4RMFA 4GNXB 4A3DG 2NN6I 4YY3Q 1K3RA 4B3SQ 4R1JA 2HQLA 4DV3Q 1M1KC 3H3VI 1HJPA 3KDFB 2MNAA 2F4VQ 1N36L 2UUBQ 4LF6Q 4HJ8A 1PH4A 4LF8Q 2MO0A 3EN2A 4LF4L 1T9HA 3M4PA 1VQIA 4HJ5A 1D8LA 3M3YH 1HNZQ 1KRTA 1E7ZA 1PH1A 2NZHA 3GDEA 4DR2L 1YITA 1HNXL 1XPUA 3S1MH 3Q8DA 1G291 3CC2A 2CWPA 2R92H 4R4OA 1PH9A 1AH9A 4GLAC 2CQOA 3CCUA 1YHQA 1MJCA 4A75A 3MXNB 4GLXA 1VQHA 1VQ9A 3K8AA 1EOVA 1DGSA 4H02A 5JEAJ 3PSIA 3TS0A 3EIVA 1P16A 4A4IA 4P74A 1PH8A 1M90C 2BA1A 1O7IA 2BA0A 4OWTB 4YCUA 4NXNQ 1Y1WG 2JQOA 1J5EL 3ERSX 2HHHQ 1L1OA 3GO5A 4C3IH 2NVTH 4JI5L 4B3ML 1IL2A 5GAGC 4X64L 2K5VA 1K0RA 3JAMi 3HOWH 5GQOA 3PO2G 4DR7Q 3JAMc 2UXDQ 1OXVA 3CPFA 4EQ5A 4JV5L 4IFDG 1S3OA 3CAMA 3PCOB 2EXDA 3S2DH 1JE5A 1FVIA 2WFWA 3KF8B 4LUZA 4C3JH 3H15A 4JI0L 1NMGA 3L2PA 4HJ7A 2HT1A 1K8AC 1HZAA 3A5ZB 2R93G 1VQAA 1VQOA 3F8TA 4BY7G 4DR5L 2Q2HA 2KCTA 4IPGA 4GOPC 1PH2A 3W1GA 3M4QA 1EYGA 1XTDA 4JI7Q 2Z6KA 5IE8A 3E0EA 3M9BA 1PH7A 1B8AA 2R92G 3CW2C 2I0QA 1QUQA 3I4MH 2CKZB 1OXUA 3TS2A 1SR3A 1Z9FA 3CF5A 4YY3L 4B3SL 4DV3L 4AQYQ 4ALPA 2F4VL 4DV2Q 1JJGA 2UUBL 4LF6L 2YTVA 4LF8L 3RZOH 2WAQG 3D31A 2IY5B 2ZM6Q 4B3TQ 3S2HH 1C7YA 4FDBA 2ZTCA 3CPWA 1KQSA 5E7NA 1XMQL 2KBNA 4QL5A 1RIPA 2V1CC 3PUVA 2JEBI 1RL2A 3PUXA 3F2CA 3HOWG 2F3IA 1K8GA 1X9NA 1E3PA 2UU9Q 2EIFA 2JA9A 4HIDA 1V1QA 1I6HH 2NZOA 5GROA 4DR6Q 2FXQA 1HR0Q 4IPDA 4NXNL 1SRUA 2PMZE 1E1OA 1Q82C 1HH2P 4A3KG 2E2IH 2ALYB 3RLFA 5AJ3Q 2HHHL 3GTOH 2B63H 4JBWA 3CCQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q8K A;  4AYB E;  4PMW A;  4GNX C;  4LUO A;  4LF7 Q;  1U0L A;  4JOI C;  3G6E A;  4OX9 L;  3G48 A;  4BXX H;  3PF4 A;  3CP0 A;  3I2Z A;  5IT9 c;  4DR7 L;  2UXD L;  1PHJ A;  5IYC H;  3L0O A;  1WOC A;  4DV1 Q;  1X3G A;  2QEX A;  4JYA Q;  4IOA A;  4B3R Q;  2VW9 A;  3M85 A;  1XPO A;  1X3E A;  1EFW A;  1WFQ A;  4DKA C;  3RN5 A;  3GTG H;  3KFU A;  1WYD A;  3T1H Q;  4NPS A;  2KEN A;  4KI0 A;  3U4V A;  1XMO Q;  2L15 A;  4POG A;  1KXL A;  4BY1 H;  3J81 j;  2JE6 I;  2CCZ A;  4K0K L;  4JCV E;  2OQK A;  4L5T A;  5K36 G;  4JG2 A;  3ULL A;  3GTQ H;  2D62 A;  4JI1 Q;  1CKN A;  2YYZ A;  4UP8 A;  4AQY L;  4LFC L;  3RR5 A;  1SMX A;  4DV2 L;  2I5M X;  4IOC A;  1L1O B;  5HY6 A;  4DAY B;  1Q7Y C;  4JI6 Q;  1NTG A;  1TWA H;  1X6O A;  4L5Q A;  2ZM6 L;  1VQ7 A;  2Q2U A;  4B3T L;  2B63 G;  1TWC H;  3RLN A;  3J80 i;  4A3M H;  1YEZ A;  4UPA A;  2A1A A;  4GS3 A;  4R4I A;  1FL0 A;  3E9I A;  2AWO A;  2UXC L;  3KF6 B;  5FLX c;  2VNU D;  1BBU A;  3OTO Q;  4BXX G;  2I5H A;  2XGT A;  1PA6 A;  1PYB A;  3PGZ A;  5IYC G;  3I4N G;  4DNI A;  1IBK Q;  1OXX K;  2PQA A;  4DR6 L;  2CFM A;  1HR0 L;  4TVA B;  1UE7 A;  2JA7 H;  1KL9 A;  3TRZ A;  1KC8 C;  4X62 Q;  2E2J H;  5AJ3 L;  1JMC A;  1UEB A;  1S72 A;  3HOZ H;  5IP7 H;  2JJQ A;  5ELN A;  4LF7 L;  4PG3 A;  1N9W A;  4BY1 G;  1N34 Q;  4OWW B;  5GAE C;  2IHE A;  4JBM A;  2RCN A;  2Y0S G;  2ZJP A;  2UXB Q;  1HZ9 A;  4QIW E;  1Q86 C;  5C0X I;  1Y1V H;  4DV1 L;  2R7Z H;  1VQ5 A;  4JI3 Q;  3K81 C;  4JYA L;  2KHJ A;  1IBM Q;  4B3R L;  4R4Q A;  1JJ2 A;  2VL6 A;  1HR0 W;  1VQB A;  1BVS A;  4JC0 A;  5C0X G;  2YU9 H;  4GOP A;  2B29 A;  2BH8 A;  2Q2I A;  3I7F A;  3T1H L;  1X65 A;  4NXM Q;  3G4S A;  1XMO L;  2F52 A;  2H5X A;  1HZC A;  2OQ0 A;  4IFD I;  4QQB X;  3GTL H;  1UE6 A;  1PH6 A;  2ZJQ A;  2QA4 A;  3FKI H;  4UP7 A;  3HFZ B;  3TEH B;  1HNW Q;  3I55 A;  4JI1 L;  4X6A H;  3STB C;  3EBE A;  1XNQ Q;  4LF5 Q;  2R6G A;  4IPC A;  4JI6 L;  2Q2T A;  1QVC A;  4YCW A;  1VQD A;  5M5X H;  4P71 A;  2HIX A;  1R9T H;  3CCJ A;  4DK6 C;  3L7Z C;  3CC4 A;  2Z0S A;  3OTO L;  5IY0 A;  1G6P A;  1EQQ A;  2UUC Q;  4LFA Q;  4HIO A;  1N8R C;  1XPR A;  1IBK L;  1X3F A;  1OTC A;  3CXC A;  1I5F A;  3OYY A;  4GNX A;  2R7Z G;  4JOI A;  4UY8 C;  1B7Y B;  1KIX A;  3T1Y Q;  3B6Y A;  4X62 L;  3KDF A;  3OW2 A;  3U58 A;  4LFB Q;  1JT8 A;  1YJ9 A;  2WAQ E;  1HNZ L;  4R4C A;  4DPG A;  1JB7 A;  4A3L H;  1N32 Q;  1N34 L;  3BJU A;  3HOU H;  1KHI A;  5C3E H;  1I50 H;  1SFO H;  1EIY B;  2JA8 H;  3FKI G;  4J15 A;  1L1O C;  1B70 B;  2GVB A;  2WB1 G;  1IZ6 A;  1CKO A;  5DLQ E;  2E5L Q;  1FJG Q;  2UXB L;  4LNQ A;  2D0O A;  4NB3 A;  3PIP A;  1YBY A;  1ASZ A;  1SE8 A;  1X56 A;  4JI3 L;  2K52 A;  3UDI A;  5IWA Q;  5C44 H;  1IBM L;  5ELO A;  1XNR Q;  4GKK Q;  2PNH A;  1L2F A;  5GAD C;  5GAH C;  5M3M H;  2PI2 E;  3S1Q H;  4NXM L;  2IT1 A;  1WI5 A;  2YV5 A;  4X66 Q;  3CQZ H;  4BBS H;  1CSQ A;  4A3B H;  4K0K Q;  1G51 A;  4YWL A;  1W3S A;  5LMU Q;  3GTP H;  1QVF A;  4P75 A;  2LXJ A;  5EAY A;  4IJL A;  2EQS A;  1QVG A;  2ASB A;  1WCM H;  5J3B A;  4IO9 A;  2UUA Q;  1HNW L;  4QY7 A;  3S1N H;  3UE1 A;  3I4M G;  4AIM A;  4JI8 Q;  3LGJ A;  4AH6 A;  5JJI A;  4A3F H;  3AFP A;  3GD7 A;  3VDY A;  2N49 A;  1IBL Q;  3J81 i;  1XNQ L;  3UDF A;  4LF5 L;  3M4O H;  4QGU A;  3CCV A;  3J81 c;  5LMN Q;  2DGY A;  1TWF H;  4EX5 A;  3HOV H;  4MZ9 A;  3TRE A;  1PH5 A;  2NVX H;  1VQE A;  2IX0 A;  3KYH C;  1QZH A;  2NVQ H;  1BKB A;  2K75 A;  1LTL A;  4JI7 L;  3ER0 A;  3PUW A;  4O2D A;  3AYH B;  3CME A;  1TWG H;  3CCR A;  3HOU G;  4A93 H;  1LM0 A;  3U4Z A;  2UUC L;  2JA8 G;  3PO3 H;  4LFA L;  1EUJ A;  2K14 A;  3PV0 A;  4LW1 A;  2OWO A;  2RF4 A;  3GTJ H;  4DV7 Q;  1I3Q H;  1Z47 A;  1H95 A;  1VQF A;  4DR1 Q;  2KCM A;  1MKH A;  1NBW A;  2LXK A;  2R7F A;  4MNO A;  4TQU S;  5C44 G;  2JA6 H;  5JJK A;  3HOY H;  3T1Y L;  4LFB L;  3NEM A;  1VQ6 A;  4DV6 Q;  3FHW A;  1VQ8 A;  1YNX A;  4A3E H;  1PV4 A;  3AEV A;  5M3M G;  1K9M C;  3H3V H;  4APV A;  1SLJ A;  4BBS G;  4A3B G;  1N32 L;  2MO1 A;  4DV5 Q;  1MJE A;  1VQC A;  3DM3 A;  4JBJ A;  4BA1 I;  2E5L L;  1KD1 C;  1FJG L;  2UU9 L;  3ULP A;  1Q46 A;  4YWM A;  3CD6 A;  2RHQ B;  5IWA L;  1SN8 A;  4OWX B;  1XNR L;  5C0X J;  2E2H H;  4DR4 Q;  3S16 H;  2N78 A;  3MEF A;  1NE3 A;  4A3F G;  2MQH A;  5FLM H;  2ES2 A;  2D0P A;  4X66 L;  2K4K A;  3RNU A;  1A0I A;  1S40 A;  3ULJ A;  4HJ9 A;  2DUD A;  5LMU L;  1OXT A;  1QZG A;  2VQF Q;  1YI2 A;  3H0G H;  4IFD J;  3BU2 A;  2GVA A;  1A62 A;  5HGQ A;  1GVP A;  2VQE Q;  5JJL A;  3SGI A;  1CKM A;  1QUQ B;  2RHS B;  2Y0S E;  3W5O A;  2UUA L;  3PF5 A;  3GTK H;  1AE2 A;  4X65 Q;  4OO1 G;  3PO3 G;  3HKZ G;  2CWA A;  4R4T A;  1A63 A;  4JI8 L;  3WWV A;  2OTL A;  1N33 Q;  2N8N A;  3D0F A;  3I4O A;  3K80 C;  2JK8 A;  1VQP A;  4BA2 I;  1IBL L;  3KLW A;  1C9O A;  2ZJR A;  1EIF A;  2R93 H;  1GO3 E;  2K5H A;  1Q12 A;  2B3G A;  5LMN L;  1Q1B A;  2JA6 G;  1KAW A;  2VS1 A;  2AWN A;  4A3I H;  3HOY G;  4BY7 H;  2XTI A;  2JEA I;  2NN6 G;  3IRB A;  4A3E G;  3S14 H;  1Q1E A;  3NEL A;  4O0A A;  3K0X A;  3A5U A;  1XMQ Q;  4A3M G;  4P73 A;  5FJ8 H;  1NY4 A;  1E22 A;  4DV4 Q;  3NEN A;  2YTX A;  1GM5 A;  2IX1 A;  4DAM A;  5C4J H;  3CC7 A;  1U5K A;  4YHH Q;  3AQQ A;  2OCE A;  4IPH A;  4DV7 L;  1E1T A;  4XIG S;  4LF9 Q;  2K5N A;  3KOJ A;  3K7U C;  4DR1 L;  1EQR A;  4DUY Q;  1PVO A;  1NMF A;  4IJH A;  3RLO A;  1XJV A;  4A3J H;  3W1B A;  4GN4 B;  4DV6 L;  4OX9 Q;  2JA7 G;  5LMN W;  4A3G H;  5FLM G;  3HOX H;  3AFQ A;  3S17 H;  3CMA A;  2AKW B;  3JC6 6;  5IP7 G;  4P72 A;  5M3F H;  1J6Q A;  1UWV A;  3H0G G;  3UE0 A;  4DV5 L;  1VQ4 A;  1PYS B;  4ME3 A;  3S24 A;  3KF6 A;  1ASY A;  2LSS A;  1AE3 A;  3I56 A;  1W2B A;  1L0W A;  3UDX A;  2BH2 A;  4Y7N H;  3J7A 5;  5IYB H;  3PIO A;  4DR4 L;  1Y1V G;  1VQN A;  3F2D A;  1IYJ B;  4DUZ Q;  3HOZ G;  4OXP A;  4A3K H;  5JEA G;  4BBR H;  2R7D A;  5IP9 H;  1FGU A;  1Q81 C;  2I5L X;  1D7Q A;  4GKJ Q;  3M7N A;  2VQF L;  4A3I G;  1KRS A;  1VS0 A;  2AMC B;  3HKS A;  3KJO A;  5BR8 Q;  2VQE L;  4YWK A;  2JA5 H;  4WJ4 A;  4C2M H;  5FJ8 G;  2WB1 E;  4JI4 Q;  1YHA A;  1CKN B;  4KHZ A;  4X65 L;  1TWH H;  5C4X H;  3S15 H;  1LUZ A;  2ZTE A;  4HIM A;  4DR3 Q;  1N33 L;  2GN5 A;  2MFI A;  3RZD H;  2PI2 A;  3G71 A;  4UP9 A;  4JBK A;  1WJJ A;  4C3H H;  4DK3 C;  3BZK A;  4LFC Q;  1K83 H;  2E8G A;  2NVY H;  5M5W H;  2ATW A;  4A3J G;  1NJI C;  1YJN A;  4DV0 Q;  4A3G G;  1VCI A;  3HOX G;  5IYD H;  1I94 Q;  1X54 A;  4LWC A;  1X55 A;  1OXS C;  4DV4 L;  3CCS A;  1VQL A;  1IXR A;  5M3F G;  3A74 A;  1VQJ A;  2ZTD A;  1K73 C;  2UXC Q;  4YHH L;  3DLL A;  1MIU A;  4JI2 Q;  5M5Y H;  2WP8 J;  2PQA B;  4KHP Q;  4YCV A;  1GKH A;  4LF9 L;  1HZB A;  3CCL A;  2QGQ A;  1YHB A;  4OON A;  4PZ8 A;  3CCM A;  5IYB G;  4DUY L;  2Z6K C;  3K7A H;  1PH3 A;  2OTJ A;  3BZC A;  1LYL A;  3F2B A;  1N36 Q;  2VUM H;  1YZ6 A;  2ID0 A;  4BBR G;  5IP9 G;  4LF4 Q;  1UE5 A;  2A19 A;  4GN5 A;  4AYB G;  2HIV A;  4DR2 Q;  1HNX Q;  1EWI A;  4A76 A;  3ICE A;  4A3L G;  4LUV A;  3UDG A;  1CUK A;  4PZ6 A;  4HJA A;  3E9H A;  5C3E G;  2A8V A;  3GTM H;  3ZJY C;  1VQG A;  1YJW A;  3U50 C;  4A3C G;  2JA5 G;  1GD7 A;  3FP9 A;  4A3D H;  2K50 A;  3I4N H;  4HIK A;  1UE1 A;  5C4X G;  4A3C H;  4DUZ L;  3STB D;  5H1S E;  4GOP B;  4PZ7 A;  2AHO B;  1J5E Q;  1JJC B;  1YIJ A;  4GKJ L;  4POF A;  1SRO A;  1YVC A;  3PUZ A;  2N3S A;  4B3M Q;  4JI5 Q;  2YTY A;  4RG1 A;  3PUY A;  4X64 Q;  3J7Z C;  4L5S A;  5IYD G;  5BR8 L;  2IHF A;  1VQM A;  1A8V A;  1V43 A;  4JI4 L;  4JV5 Q;  4MTN A;  4QJF A;  1BBW A;  1WCM G;  4GLV B;  3CCE A;  1C0A A;  4XTC S;  4Y52 H;  3S1R H;  4DR3 L;  4GKK L;  2VZA A;  3F1Z A;  4JI0 Q;  3RN2 A;  1Y1W H;  3TQY A;  1P8L A;  1Y14 B;  4WJ3 M;  1TXY A;  1CSP A;  3A0J A;  2KHI A;  2VY3 A;  2VUM G;  4DV0 L;  3HOV G;  4L5R C;  4OO1 I;  1I94 L;  1PFS A;  4DR5 Q;  2C35 B;  3PO2 H;  1E24 A;  3J80 c;  1V9P A;  4GN3 B;  1VQK A;  4JI2 L;  4A93 G;  3NBH B;  4KLK A;  4KHP L;  3KJP A;  3HKZ E;  4RMF A;  4GNX B;  4A3D G;  2NN6 I;  4YY3 Q;  1K3R A;  4B3S Q;  4R1J A;  2HQL A;  4DV3 Q;  1M1K C;  3H3V I;  1HJP A;  3KDF B;  2MNA A;  2F4V Q;  1N36 L;  2UUB Q;  4LF6 Q;  4HJ8 A;  1PH4 A;  4LF8 Q;  2MO0 A;  3EN2 A;  4LF4 L;  1T9H A;  3M4P A;  1VQI A;  4HJ5 A;  1D8L A;  3M3Y H;  1HNZ Q;  1KRT A;  1E7Z A;  1PH1 A;  2NZH A;  3GDE A;  4DR2 L;  1YIT A;  1HNX L;  1XPU A;  3S1M H;  3Q8D A;  1G29 1;  3CC2 A;  2CWP A;  2R92 H;  4R4O A;  1PH9 A;  1AH9 A;  4GLA C;  2CQO A;  3CCU A;  1YHQ A;  1MJC A;  4A75 A;  3MXN B;  4GLX A;  1VQH A;  1VQ9 A;  3K8A A;  1EOV A;  1DGS A;  4H02 A;  5JEA J;  3PSI A;  3TS0 A;  3EIV A;  1P16 A;  4A4I A;  4P74 A;  1PH8 A;  1M90 C;  2BA1 A;  1O7I A;  2BA0 A;  4OWT B;  4YCU A;  4NXN Q;  1Y1W G;  2JQO A;  1J5E L;  3ERS X;  2HHH Q;  1L1O A;  3GO5 A;  4C3I H;  2NVT H;  4JI5 L;  4B3M L;  1IL2 A;  5GAG C;  4X64 L;  2K5V A;  1K0R A;  3JAM i;  3HOW H;  5GQO A;  3PO2 G;  4DR7 Q;  3JAM c;  2UXD Q;  1OXV A;  3CPF A;  4EQ5 A;  4JV5 L;  4IFD G;  1S3O A;  3CAM A;  3PCO B;  2EXD A;  3S2D H;  1JE5 A;  1FVI A;  2WFW A;  3KF8 B;  4LUZ A;  4C3J H;  3H15 A;  4JI0 L;  1NMG A;  3L2P A;  4HJ7 A;  2HT1 A;  1K8A C;  1HZA A;  3A5Z B;  2R93 G;  1VQA A;  1VQO A;  3F8T A;  4BY7 G;  4DR5 L;  2Q2H A;  2KCT A;  4IPG A;  4GOP C;  1PH2 A;  3W1G A;  3M4Q A;  1EYG A;  1XTD A;  4JI7 Q;  2Z6K A;  5IE8 A;  3E0E A;  3M9B A;  1PH7 A;  1B8A A;  2R92 G;  3CW2 C;  2I0Q A;  1QUQ A;  3I4M H;  2CKZ B;  1OXU A;  3TS2 A;  1SR3 A;  1Z9F A;  3CF5 A;  4YY3 L;  4B3S L;  4DV3 L;  4AQY Q;  4ALP A;  2F4V L;  4DV2 Q;  1JJG A;  2UUB L;  4LF6 L;  2YTV A;  4LF8 L;  3RZO H;  2WAQ G;  3D31 A;  2IY5 B;  2ZM6 Q;  4B3T Q;  3S2H H;  1C7Y A;  4FDB A;  2ZTC A;  3CPW A;  1KQS A;  5E7N A;  1XMQ L;  2KBN A;  4QL5 A;  1RIP A;  2V1C C;  3PUV A;  2JEB I;  1RL2 A;  3PUX A;  3F2C A;  3HOW G;  2F3I A;  1K8G A;  1X9N A;  1E3P A;  2UU9 Q;  2EIF A;  2JA9 A;  4HID A;  1V1Q A;  1I6H H;  2NZO A;  5GRO A;  4DR6 Q;  2FXQ A;  1HR0 Q;  4IPD A;  4NXN L;  1SRU A;  2PMZ E;  1E1O A;  1Q82 C;  1HH2 P;  4A3K G;  2E2I H;  2ALY B;  3RLF A;  5AJ3 Q;  2HHH L;  3GTO H;  2B63 H;  4JBW A;  3CCQ A; 
#chains in the Genus database with same CATH topology
 4PMW A;  2WIN B;  1I4H A;  1IKM A;  1U9R A;  1VDZ A;  5IT9 c;  3I2Z A;  1C48 A;  4IUT A;  2F0U A;  3DEP A;  1XXG A;  1WOC A;  4DV1 Q;  1UAP A;  2Q8I B;  2QEX A;  1ESR A;  1CT1 D;  1WTO A;  4JYA Q;  2EYJ A;  3M85 A;  4ZQ3 A;  2A6E D;  1WFQ A;  1PRT F;  1KDB A;  4EGV A;  4POG A;  1BCP D;  2JE6 I;  1FNW A;  3QWN A;  5ELD A;  2CCZ A;  5JOB A;  2RSO A;  4L5T A;  5KRU A;  2QF7 A;  3ULL A;  1AW7 A;  2YYZ A;  1JIC A;  2HCC A;  1SMX A;  4ID6 A;  4K5X A;  4IOC A;  5HY6 A;  1NTG A;  1TWA H;  1X6O A;  2ZM6 L;  4B3T L;  3MFG A;  3RLN A;  5J39 A;  2HQE A;  4UPA A;  2A1A A;  4R4I A;  2AWO A;  2UXC L;  2EY6 A;  4PNY A;  4B08 A;  4DNI A;  3ONA B;  1OXX K;  1HR0 L;  4K6L A;  4TVA B;  1BQQ T;  2E2J H;  1ROD A;  1JMC A;  1UEB A;  3I3C A;  2B2V C;  1STE A;  2AQ1 B;  2JJQ A;  5ELN A;  1CK1 A;  4NP5 A;  2R61 A;  4OWW B;  2IHE A;  2RCN A;  2ZJP A;  5D3I B;  2BE5 C;  1Q86 C;  1STN A;  1PZJ D;  1Y1V H;  4C3J B;  1VQ5 A;  1BNZ A;  1D1K A;  1J9O A;  4JVZ A;  3GV3 A;  1X65 A;  3G4S A;  4HAE A;  2RVL A;  4JPB W;  4IFD I;  3GTL H;  2F0P A;  3MWY W;  4FF1 A;  1U4M A;  4ZYS A;  2Q8R E;  3I4M B;  5E4W C;  2G9H D;  3I55 A;  2F4I A;  5FO7 B;  4DAP A;  3EBE A;  3J81 E;  2ICI A;  3BZD B;  4JI6 L;  1MBY A;  2KJX A;  1VQD A;  4XDX A;  2HIX A;  1F2L A;  3NHH A;  3CU7 A;  4WFN 3;  2MUY A;  5EPJ A;  2Z0S A;  1LO5 D;  5CV9 A;  5IY0 A;  3MC0 B;  3OTO L;  2UUC Q;  4LFA Q;  1A3T A;  4HIO A;  1IBK L;  1XPR A;  1OTC A;  1I5F A;  2EJF C;  3SK5 A;  3GTO B;  2E2I B;  3R93 A;  3T1Y Q;  4LFB Q;  3HP3 A;  4BBS B;  1TII D;  2L55 A;  5FLX E;  2F0E A;  1JB7 A;  4A3L H;  1N34 L;  1EIY B;  1SFO H;  3FKI G;  2WB1 G;  2UXB L;  1IZ6 A;  1H9R A;  2B2Y A;  2X69 A;  3L3O C;  4JI3 L;  2NWG A;  4GKK Q;  4OHJ A;  1GUT A;  1L2F A;  4C3J G;  5IOD A;  3IAY A;  3R2T A;  1R4P B;  3VYU A;  2PI2 E;  4FNF A;  4NXM L;  1Y8P B;  1TU2 B;  2YV5 A;  5LMU Q;  3DWA A;  2ENB A;  1QVF A;  1DD2 A;  2LXJ A;  3A7A B;  4IJL A;  2EQS A;  1HNW L;  2LFN A;  4QY7 A;  1UUP A;  4DU9 A;  1PFB A;  4AIM A;  3I4M G;  2BE5 D;  4AH6 A;  3KF8 A;  2JA6 B;  4V0B A;  1IBL Q;  3HOY B;  1XNQ L;  4O1N A;  4QGU A;  1TWF H;  4MZ9 A;  4A3M B;  1FNV A;  1VQE A;  3KYH C;  5DEH A;  1QZH A;  1LTL A;  3I4L A;  2JYO A;  3ER0 A;  4O2D A;  3PO3 H;  3U4Z A;  3SK4 A;  2JA8 G;  2NUC A;  1EUJ A;  1VMP A;  1D2B A;  4G7Z C;  2OWO A;  4DV7 Q;  3GTJ H;  5EPK A;  1Z47 A;  1H95 A;  2B2V A;  4IQZ A;  2VB3 X;  4DV6 Q;  1YNX A;  2NN6 H;  4A3E H;  5E1F A;  3H3V H;  1EYD A;  5KIX A;  3OWE B;  4BBS G;  4A3B G;  3A8J E;  4KKU A;  3MTS A;  1STB A;  4DV5 Q;  1MJE A;  1QOH A;  1VQC A;  1KD1 C;  1JQY D;  2ICE C;  5A2Q E;  2UU9 L;  3ULP A;  1FJG L;  3URY A;  4RCN A;  2KCC A;  2RHQ B;  5IWA L;  1XNR L;  4OWX B;  4DR4 Q;  3S16 H;  2B2W C;  3MEF A;  1EFI D;  3NWT A;  1B2T A;  3X3M A;  1S40 A;  3ULJ A;  1QZG A;  1WTP A;  5I4D A;  3BU2 A;  3W5O A;  2Y0S E;  4KKT A;  1BF4 A;  2UUA L;  1SAP A;  4R4T A;  1A63 A;  1YNJ D;  3WWV A;  1N33 Q;  2PO4 A;  3D0F A;  4BA2 I;  2F03 A;  3HGB A;  1CFM A;  2IX3 A;  3KLW A;  4OGQ C;  3VR5 A;  1C9O A;  4Q5V A;  2ZJR A;  2R93 H;  2JA6 G;  4A3I H;  3HOY G;  2AWN A;  3HG9 A;  2P5Z X;  5M5X B;  2XTI A;  4KJO A;  3NEL A;  5M3F B;  5JPM C;  4A3M G;  4P73 A;  4DV4 Q;  1E22 A;  3NEN A;  5FO9 B;  2V4D A;  1U5K A;  5D14 A;  4YHH Q;  5CV7 A;  5TSS A;  4GZY C;  3H91 A;  4XT1 B;  1E1T A;  4CKE A;  2K01 A;  4V19 0;  1A3U A;  1NMF A;  3M3Y H;  4A3J H;  1ENF A;  2K6A A;  4A3G H;  5FLM G;  2AKW B;  1I50 B;  3RD4 A;  1PYS B;  4C2M B;  4NDX A;  3S24 A;  3RMH A;  3NQI A;  2KCN A;  3I56 A;  1ASY A;  3H3V C;  2F0H A;  1JOQ A;  4MHE A;  5C44 B;  3J7A 5;  3PIO A;  1ZEQ X;  1M4V A;  1SDF A;  2K5W A;  3HOZ G;  4OXP A;  5M3M B;  2EYH A;  2SEB D;  3M7G A;  4BBR H;  5KNB A;  5M5W B;  1B44 D;  4F7X A;  2VQF L;  1JOO A;  3D4W A;  2DNE A;  3BVG A;  3K0Y A;  4QB4 A;  1S5F D;  3KJO A;  1WTQ A;  5FJ8 G;  3KBX A;  4JI4 Q;  1SYD A;  5EPL A;  4HCS A;  5C4X H;  2EYP A;  3S15 H;  2EYF A;  4HIM A;  2GN5 A;  2MFI A;  3NSW A;  3RZD H;  3G71 A;  2VUM B;  3BZK A;  1K83 H;  2TMP A;  1NJI C;  2C9O A;  1OXS C;  3Q24 A;  1IXR A;  5JJZ A;  4A93 B;  1GUO A;  5M3F G;  3A74 A;  1VQJ A;  2ZTD A;  5C4H A;  1BCP B;  1MIU A;  4JI2 Q;  2WP8 J;  4KHP Q;  4OON A;  2Z6K C;  2FJ2 A;  3CHB D;  1N36 Q;  2A19 A;  4QCL A;  1EIH A;  1L0X B;  1YNN D;  3NXW A;  2HIV A;  1HNX Q;  2DY8 A;  3UDG A;  1YJW A;  3T13 A;  3BDL A;  2JA5 G;  3IKJ A;  3S1R B;  2KOL A;  3TP6 A;  2D9U A;  2XSC A;  1CZW A;  4PZ7 A;  1JJC B;  2CW0 C;  2CH4 A;  3C1E A;  2B2U C;  1SJE D;  3PUZ A;  4JI5 Q;  2YTY A;  3J7Z C;  3JAM E;  4HSP A;  1PXU A;  3DEO A;  4EVO A;  5BR8 L;  3MZ5 A;  1A8V A;  5KNC A;  2JXM B;  3GTK B;  4MTN A;  4GLV B;  3ITP A;  4R9W A;  4XTC S;  2PPB C;  4DR3 L;  4GKK L;  1TS5 A;  4IUN A;  4JI0 Q;  3J81 L;  4BS9 A;  3DHQ A;  1Y14 B;  1ZKO A;  2DY7 A;  2PNR C;  2VUM G;  2KHI A;  3S14 B;  2GA4 B;  1I94 L;  1PFS A;  4JK1 C;  2C35 B;  2Z8L A;  1LT3 D;  3S1M B;  3J80 c;  4GN3 B;  1RDP D;  4A93 G;  2FHT A;  4HCE A;  3K58 A;  4A3D G;  2NN6 I;  5CMD A;  4YY3 Q;  3BDC A;  4DV3 Q;  3H3V I;  4JW0 A;  1HJP A;  3FVQ A;  4CBV A;  1K8O A;  4HJ8 A;  2IW3 A;  1BOS A;  4S3S A;  3TSS A;  1T9H A;  3M4P A;  4LF4 L;  1D8L A;  1HNZ Q;  1E7Z A;  5FLX L;  4RGT A;  2NZH A;  4DR2 L;  1G29 1;  4WRD A;  2CWP A;  2R92 H;  4R4O A;  1AH9 A;  3S2D B;  4A75 A;  1SYC A;  1S5E D;  4H02 A;  2D2C C;  1M90 C;  3EIV A;  4P74 A;  2BA0 A;  1DOK A;  4NXN Q;  2JQO A;  3GO5 A;  1Y8N B;  2NVT H;  2EVB A;  1I4R A;  1TS3 A;  3HOW H;  3DWQ A;  3PO2 G;  1OXV A;  4EQ5 A;  4JV5 L;  4IFD G;  4YIJ A;  5G3L F;  2QCP X;  3KF8 B;  4LUZ A;  3FPP A;  2XN9 C;  3A7L A;  4KHV A;  2NVY B;  1TQO A;  5DNF A;  2EYM A;  1F77 A;  5C3W A;  4GOP C;  3M4Q A;  5HGT A;  2Z6K A;  5LL6 X;  5M5Y B;  1QUQ A;  2CKZ B;  5CBE E;  4IUR A;  2F4V L;  4B9W A;  4K8I A;  3K6O A;  1CI3 M;  2PQE A;  2KEC A;  1PTO H;  2ZM6 Q;  4B3T Q;  1STG A;  3S2H H;  4FDB A;  2SDF A;  1HUN A;  2KBN A;  1RIP A;  1RL2 A;  5A2Q L;  2EOT A;  4TKO B;  5NUC A;  3I4N B;  4WOR A;  3OMG A;  1KLU D;  2RQX A;  2JA9 A;  1LTA D;  4HID A;  2B2U A;  3H09 A;  5T1G A;  1HR0 Q;  4LK1 C;  1SYG A;  4RKL A;  2HHH L;  1EZ8 A;  1IW7 D;  1H9S A;  1CTM A;  1T5X D;  4JBW A;  1Q8K A;  4AYB E;  1JWS D;  1U0L A;  4QIW B;  2PW5 A;  3CP0 A;  4KN4 C;  1QB5 D;  3QO2 A;  2O5I C;  2EJG C;  2F0S A;  5IIF A;  4G57 A;  1S5D D;  4IOA A;  3TZU A;  3NE5 B;  3GTG H;  3KFU A;  3T56 B;  3DUZ A;  3PIP 3;  1F9R A;  1TWA B;  5ELE A;  1KXL A;  4BY1 H;  2A6H D;  5BN3 A;  3CRL C;  1HA6 A;  1M8A A;  2HD3 A;  5K36 G;  4JG2 A;  1HFG A;  3GTQ H;  3U9S A;  3T51 B;  3GP7 A;  3RR5 A;  3KUP A;  2LKV A;  4DV2 L;  2E2J B;  4DK1 A;  4JI6 Q;  2K5D A;  2EY2 A;  1TWC H;  4DFA A;  1H9K A;  1YEZ A;  4RGN A;  2F0J A;  1IKL A;  2CVR A;  1FL0 A;  2JP1 A;  3OTO Q;  3N52 A;  2I5H A;  4KY5 A;  5I2Y A;  2A69 C;  2WKD A;  1PYB A;  3PGZ A;  2ZT9 C;  3I4N G;  2RA4 A;  1IBK Q;  2X6L A;  2CFM A;  3ERQ A;  1V1O A;  3O13 A;  1HHV A;  2EZV A;  1KC8 C;  2ZXO A;  3CKI B;  4LF7 L;  2G5D A;  1N34 Q;  3C3L A;  2UXB Q;  1HZ9 A;  4U68 A;  1X3Q A;  2R7Z H;  4JI3 Q;  4B3R L;  1JJ2 A;  2VL6 A;  1HR0 W;  1BVS A;  5C0X G;  2YU9 H;  4GOP A;  2BH8 A;  3I7F A;  5C4Z A;  3T1H L;  4NXM Q;  1XMO L;  2F52 A;  2A5H A;  2OQ0 A;  3BDO A;  2ZJQ A;  3GQB A;  3NWS A;  1HUM A;  3TEH B;  2XWB B;  5L37 A;  4FO2 A;  1HNW Q;  3AU7 A;  4JI1 L;  1GJX A;  1O7Y A;  3G7L A;  3RZO B;  1XNQ Q;  2R6G A;  1EY9 A;  4G7O C;  1QVC A;  3OSO A;  1R9T H;  1SFO B;  4DK6 C;  4KTA A;  3L7Z C;  5HUR A;  1G6P A;  1EQQ A;  2B8F A;  2K05 A;  3NBH A;  4IZ8 A;  1N8R C;  1X3F A;  3CXC A;  1DZ1 A;  4J1M A;  1EL0 A;  2EXZ A;  4UY8 C;  1XWE A;  4X62 L;  1JT8 A;  1TY2 A;  2HDL A;  2WAQ E;  5D3D A;  3ZYY X;  1HNZ L;  1HQM C;  2MP1 A;  3FMC A;  3M4Y A;  5CYU A;  3BJU A;  3HOU H;  1KHI A;  4A3C H;  1D7Q A;  4J15 A;  1L1O C;  1B70 B;  1FJG Q;  1CKO A;  4DNT B;  1STY A;  1D5X C;  1PTO F;  2D0O A;  2Z4H A;  3PIP A;  5IWA Q;  3UDI A;  2K52 A;  1XNR Q;  3ND9 A;  5ELO A;  3A8I E;  3V96 A;  2EJM A;  5GAD C;  3KBG A;  2IT1 A;  1G51 A;  4YWL A;  2CH4 W;  3GTP H;  4P75 A;  1EU4 A;  1QVG A;  4IO9 A;  2UUA Q;  1LTG D;  4KY7 A;  3HZX A;  3S1N H;  1ENC A;  3LGJ A;  3AFP A;  3VDY A;  1SNO A;  5ELC A;  2NBF A;  1W6J A;  3OOC A;  3UDF A;  4LF5 L;  3M4O H;  4A3E B;  1D6E C;  3D6C A;  2DGY A;  3HOV H;  4EX5 A;  1PRT D;  2F0V A;  1S4Z A;  4ODG A;  2NVX H;  3KLS A;  2SNS A;  1BKB A;  3PUW A;  4DAV A;  3AYH B;  1ICF B;  1D5M C;  1DYQ A;  2K14 A;  3PV0 A;  3F2U A;  1I3Q H;  3S16 B;  1F9P A;  2JA7 B;  1NBW A;  2LXK A;  1PZK D;  2OF1 A;  1VQ8 A;  1PV4 A;  4NW2 A;  2F1M A;  2K5Q A;  3C46 A;  4KK7 A;  3DM3 A;  4BA1 I;  3T16 A;  5JVG 3;  1EOT A;  1SN8 A;  4J6H A;  5C0X J;  1C4Q A;  2N78 A;  1NE3 A;  1A6X A;  3MFY A;  4K8J A;  4RKB A;  4ABN A;  4A3I B;  1FR3 A;  2IJ0 A;  2K4K A;  3RNU A;  4K0K L;  2DUD A;  4X3T A;  2VQF Q;  2L0C A;  3FKI B;  2WB1 B;  2GVA A;  1VMC A;  1GVP A;  3SGI A;  1CKM A;  1O78 A;  1QUQ B;  2RHS B;  1AE2 A;  4DGZ A;  3PO3 G;  1V1P A;  2OTL A;  3I4O A;  3SE0 A;  4CJ0 B;  4FF4 A;  1B4O A;  3M3Y B;  2B3G A;  5LMN L;  4BY7 H;  1Z7T A;  2NN6 G;  2RDF A;  3IRB A;  4A3E G;  3K0X A;  3QOJ A;  3A5U A;  1XMQ Q;  3C2P A;  1GM5 A;  4PV1 C;  4I65 A;  3NTH A;  2A68 C;  3CC7 A;  4CDC C;  3AQQ A;  2OCE A;  4ME5 A;  1EU3 A;  4XIG S;  4DR1 L;  4CDD C;  3OIP A;  4IJH A;  1H9S B;  1KDA A;  4GN4 B;  4OX9 Q;  2JA7 G;  4DAY A;  4KKS A;  5IP7 G;  5C3E B;  4P72 A;  2JA8 B;  1VQ4 A;  2SOB A;  4ME3 A;  4N8X 1;  2LSS A;  1AE3 A;  5C4X B;  1L0W A;  3UDX A;  5IYB H;  1IYJ B;  4RHR A;  3S1Q B;  4A3K H;  5JEA G;  1K83 B;  1JWM D;  3CQZ B;  4XYQ A;  4DXF A;  3BVM A;  4A3B B;  1EWH A;  2G9D A;  1B9N A;  4A3I G;  3HKS A;  4CJ1 B;  5BR8 Q;  4J8Q A;  1WCM B;  2VQE L;  5EKI A;  1HTL D;  4X65 L;  1JB3 A;  2ZTE A;  4DR3 Q;  1SMY C;  1ILQ A;  1GUW A;  4UP9 A;  4LFC Q;  4C3H H;  3PIO 3;  2E8G A;  4A3J G;  4RCO A;  3BG3 A;  4A3G G;  2LY7 A;  5IYD H;  2NVQ B;  1I94 Q;  1X54 A;  4K14 A;  4OIJ A;  4ZAI A;  5FKA C;  1VQL A;  1O80 A;  2PYK A;  4K5W A;  2B2T C;  1GKH A;  4LF9 L;  1HZB A;  2RCF A;  2QGQ A;  1YHB A;  2J0T D;  4DUY L;  1WTV A;  1PH3 A;  5D65 A;  3BZC A;  3RUZ A;  1LTR D;  3F2B A;  4BBR G;  4LF4 Q;  1ESF A;  4NKL A;  4DR2 Q;  3R3O A;  1EWI A;  4A76 A;  2N55 A;  3QR8 A;  4HJA A;  5C3E G;  1VQG A;  3FP9 A;  3SVM A;  4HIK A;  5C4X G;  2H4O A;  4DN4 M;  5H1S E;  4GOP B;  4HR7 B;  4L6T B;  1QJO A;  1ZYR C;  1SRO A;  3OHX C;  1JC7 A;  1YVC A;  2N3S A;  1NR4 A;  1CQF A;  1HA5 A;  4RG1 A;  4CKC A;  4L5S A;  1G91 A;  2DNC A;  2FIN B;  1V43 A;  3L9A X;  1DJR D;  4JV5 Q;  4QJF A;  3CCE A;  1BBW A;  1WCM G;  1C0A A;  3HOZ B;  4Y52 H;  2VZA A;  3F1Z A;  5ELB A;  1SNP A;  3NTI A;  2L12 A;  2Z4I A;  1P8L A;  3TQY A;  1KDC A;  1SNM A;  1TXY A;  3BS1 A;  2VY3 A;  4L8J A;  2R92 B;  5C4J B;  1ET6 A;  3EVQ A;  2IPK D;  3NBH B;  3KJP A;  3HKZ E;  1OO9 B;  2KEE A;  1K3R A;  1M1K C;  3DM1 A;  2F4V Q;  3S17 B;  4HJ5 A;  3P7J A;  5EGT A;  4G7H C;  5EJW A;  2Z1C A;  5FOB B;  3GDE A;  3HOW B;  5I2X A;  1F2Y A;  3CC2 A;  5EQ0 A;  3VR3 A;  1YHQ A;  1V8Q A;  4CDF C;  1VQH A;  1VQ9 A;  2PMZ B;  1EOV A;  1DGS A;  5JEA J;  4UAI A;  2K7V A;  2BA1 A;  1SE4 A;  4OWT B;  2HHH Q;  4KMU C;  3ERS X;  3K5N A;  1BR9 A;  4CDE C;  1CA6 A;  2JA5 B;  2A74 C;  2RSN A;  5GQO A;  3VR6 A;  1TWH B;  2EXD A;  4X3K A;  1IYU A;  4HED A;  1EY0 A;  3H15 A;  4C3J H;  1KAB A;  4HJ7 A;  1QIL A;  2HT1 A;  2M00 A;  3I91 A;  1VQA A;  1D5Z C;  3A8K E;  1VQO A;  2EPB A;  2JSO A;  2F0D A;  2B2T A;  2KCT A;  1PH2 A;  3W1G A;  1EYG A;  4JI7 Q;  5IE8 A;  1B8A A;  2R92 G;  3CW2 C;  3I4M H;  1OXU A;  2L4N A;  3K7A B;  3CF5 A;  1CA5 A;  1AFP A;  4PMC A;  4OIK A;  3SEB A;  4DV2 Q;  1AZP A;  2UUB L;  4LF6 L;  2NB0 A;  3D31 A;  3H94 A;  3K5L A;  1PYW D;  1QE6 A;  1EEI D;  5E7N A;  1XMQ L;  4XQN A;  2V1C C;  1SXT A;  3D4R A;  3GTM B;  1PRT B;  3PUV A;  3F2C A;  3HOW G;  2F3I A;  4A3D B;  1K8G A;  1X9N A;  1E3P A;  2EIF A;  5GRO A;  1HCZ A;  1LTT D;  1Q82 C;  4OX9 L;  1HH2 P;  3GTO H;  1QCB D;  2E2I H;  2B63 H;  1KNA A;  2I0Q A;  2QDB A;  4LF7 Q;  1E2V A;  4JOI C;  3G6E A;  2B2W A;  3G48 A;  4BXX H;  3PF4 A;  1ZXT A;  2F3V A;  4DR7 L;  2UXD L;  2CHB D;  1PHJ A;  1EIG A;  2ZXP A;  1SSO A;  5IYC H;  1V1P B;  3L0O A;  4FF3 A;  3I70 A;  1X3G A;  5CV4 A;  3MXU A;  4R8I A;  1MSH A;  4B3R Q;  1U4R A;  1D1I A;  5KEE A;  1EFW A;  3RN5 A;  1WYD A;  4CJ2 C;  3T1H Q;  1RD9 D;  2KEN A;  4KI0 A;  3U4V A;  1XMO Q;  2L15 A;  1TWC B;  2EY1 A;  3PO2 B;  3J81 j;  2DN8 A;  4JCV E;  2OQK A;  1WTX A;  2AUK A;  4KY6 A;  4JI1 Q;  1CKN A;  4DXG A;  3HRZ C;  4UP8 A;  1U4P A;  4LFC L;  3TN2 A;  1EY4 A;  4XQQ A;  2I5M X;  2Z9H A;  1L1O B;  4ZKC B;  4DAY B;  4QUC A;  4L5Q A;  1I4Q A;  2LMC B;  1B53 A;  3J80 i;  1I6V C;  4A3M H;  3E9I A;  2EE1 A;  3WOE A;  5FLX c;  1BBU A;  4TRD A;  2XGT A;  1EY8 A;  2J4X A;  2VB2 X;  2B8G A;  1UE7 A;  4X62 Q;  5IGB A;  2EYO A;  5A35 A;  1SE2 A;  4PG3 A;  4BY1 G;  3BYY B;  2Y0S G;  4X3U A;  4QIW E;  4C1N K;  1I4P A;  2PW7 A;  3K81 C;  1K28 A;  4R8N A;  4JC0 A;  2B29 A;  1XYI A;  1EQV A;  5EKL A;  1SND A;  2H5X A;  1DOM A;  5I6W A;  5IT9 E;  1PH6 A;  1LLR D;  3HFZ B;  3A55 A;  2F0F A;  2NTS A;  2OEO A;  4X6A H;  1U4L A;  5G3L D;  3STB C;  4FXD A;  4ZKB B;  2KED A;  3K5O A;  4O42 A;  5EBD A;  1LTS D;  1A3V A;  4LF5 Q;  3NP8 A;  1BBX C;  3FEW X;  4F88 A;  3P75 A;  2F0I A;  2CW0 D;  5M5X H;  4P71 A;  3AB9 A;  4KJN A;  3H6M A;  5KND A;  1I6H B;  1EQT A;  4HMI A;  2HDM A;  2R7Z G;  4N8F A;  4JOI A;  2KA7 A;  1KIX A;  2MHV A;  1Y69 U;  3KDF A;  3OW2 A;  3IFD A;  4IUP A;  4R4C A;  4DPG A;  2PCF B;  1PDQ A;  3NTK A;  1I50 H;  2HCI A;  5DLQ E;  5IGG A;  4NB3 A;  1ASZ A;  1YBY A;  3MXN A;  3TBI B;  5C44 H;  1IBM L;  2PNH A;  5M3M H;  4ZK9 B;  1PFN A;  4K0K Q;  2F0T A;  2NVX B;  1W3S A;  2NYZ D;  5EAY A;  4IUU A;  3TDQ A;  5J3B A;  2KQ3 A;  3UE1 A;  5JJI A;  2AQ3 B;  4A3F H;  1TS2 A;  2MGS A;  1HPC A;  1MGS A;  3C1F A;  3CCV A;  5LMN Q;  1DCZ A;  4MTK A;  1BDO A;  1RF2 D;  1PH5 A;  1GUG A;  5CV5 A;  2I46 A;  4JI7 L;  2K75 A;  3VR4 A;  2QW7 A;  1TWG H;  4H44 C;  3CCR A;  3HOU G;  1LM0 A;  4A93 H;  4OO1 H;  1LAB A;  5FO8 B;  3KLS X;  4LW1 A;  3SK6 A;  4DR1 Q;  3QIA A;  3TP7 A;  4MNO A;  3I72 A;  4RGO S;  1C8C A;  3EJI A;  3NEM A;  1VQ6 A;  1B50 A;  3G6J B;  2R3Z A;  3E6Z X;  1K9M C;  2D5D A;  2SNM A;  1FD7 D;  4XXE A;  1SLJ A;  3SXH A;  4EQP A;  2J7Z A;  1N32 L;  4IUQ A;  1WTW A;  2E5L L;  1PTO C;  1Y1V B;  1Q46 A;  2F0L A;  2I07 B;  4YWM A;  2E2H H;  4M1U B;  2ES2 A;  1F9Q A;  1GUS A;  1GOZ A;  3HS0 C;  4NMZ A;  4X66 L;  3GTL B;  1A15 A;  4HJ9 A;  2WII B;  1OXT A;  2F0W A;  1YI2 A;  3H0G H;  4IFD J;  1B1Z A;  1A62 A;  5HGQ A;  2VQE Q;  1MD2 D;  3GTK H;  4X65 Q;  1DM0 B;  2WAC A;  4JI8 L;  5CGK A;  3K80 C;  2JK8 A;  1WD0 A;  1LAC A;  1EIF A;  1Q1B A;  2K03 A;  2VS1 A;  5T1I A;  3S14 H;  1Q1E A;  5C3X A;  2H1E A;  3OWF A;  1NY4 A;  2XRS D;  4DAM A;  1CQV A;  4WJW A;  4IPH A;  4LF9 Q;  2K5N A;  1E0B A;  4DUY Q;  1PVO A;  2C5C A;  3RLO A;  1BUV T;  3W1B A;  4AYB B;  5LMN W;  2O4X A;  1BCP C;  5DM7 3;  3HOX H;  3CMA A;  1K8M A;  3JC6 6;  3MEH A;  1J6Q A;  1UWV A;  3UE0 A;  1G6Z A;  5DAU A;  2AQ2 B;  3KF6 A;  1W2B A;  3DMU A;  4Y7N H;  3FDT A;  1Y1V G;  3U9O A;  1VQN A;  3F2D A;  3TZD A;  3MXP A;  2F0Q A;  3LX0 A;  2Q8T A;  5I6Y A;  5IP9 H;  4HMJ A;  3M7N A;  3JAM L;  1R4Q B;  3QG1 A;  4YWK A;  4WJ4 A;  2WB1 E;  4UHV A;  4ZUJ A;  1CKN B;  4KHZ A;  4DA2 A;  3Q6S A;  3E5S A;  2A69 D;  4DNR B;  2PI2 A;  4JBK A;  1WJJ A;  1NUC A;  2EYL A;  1TWF B;  2BOS A;  2NVY H;  2XRQ D;  1VCI A;  4RGM A;  1X55 A;  1Y8O B;  1SBB B;  2DJG C;  3PO3 B;  2L11 A;  5E3F A;  1K73 C;  3DLL A;  2BDN A;  5M5Y H;  1A2U A;  3GTJ B;  1JCK B;  3CCL A;  3CCM A;  1QNU A;  5IYB G;  2OTJ A;  1YZ6 A;  2ID0 A;  3Q22 A;  5BN5 A;  2M9V A;  3IFT A;  4AYB G;  4MN3 A;  1TKW B;  4F8M A;  1K0S A;  4ILW A;  1NAP A;  4A3L G;  1CUK A;  2A8V A;  4RA8 A;  3ZJY C;  3U50 C;  1ML0 D;  1GD7 A;  3AMU A;  2K50 A;  3I4N H;  4FXG C;  1O7Z A;  4DUZ L;  1T5E A;  2AHO B;  3TP5 A;  2NTT A;  3E0J A;  1YIJ A;  3WDN A;  4C3H G;  2B2Y C;  4GKJ L;  3I73 A;  1BCP F;  3VA5 A;  5IT9 L;  1EZ6 A;  2E74 C;  5IYD G;  2IHF A;  3SK8 A;  5DM6 3;  3R2I A;  5ELF A;  2DJF C;  4HN7 A;  3RN2 A;  5C0X H;  1Y1W H;  2R93 B;  3MXG A;  4WJ3 M;  1GXD C;  1XTC D;  3A0J A;  4DV0 L;  4BWG B;  4L5R C;  4OO1 I;  2QDL A;  1E24 A;  1SE3 A;  4G4K A;  3D8G A;  1VQK A;  4CKB A;  3K59 A;  4KLK A;  2HUG A;  4RMF A;  2F0K A;  4P2C B;  4A3J B;  2WAQ B;  3KDF B;  4A3G B;  4Q0F A;  2JN4 A;  2UUB Q;  4LF6 Q;  1NNX A;  2MO0 A;  3EN2 A;  3W2D A;  1VQI A;  5C5L A;  3NPP A;  3QJY A;  1PH1 A;  1YIT A;  3VYT A;  2KHS A;  4C1N I;  2CQO A;  1EY6 A;  3MXN B;  4GLX A;  3K8A A;  3PSI A;  4K2L A;  3TS0 A;  4BBR B;  1O7I A;  5BN4 A;  4YCU A;  1EWC A;  5M9O A;  1J5E L;  1L1O A;  1MHW C;  2A73 B;  3SR1 A;  4C3I H;  4B3M L;  4X64 L;  2K5V A;  3EQL C;  1K0R A;  4DR7 Q;  2K28 A;  2UXD Q;  2FFK B;  3CPF A;  2KVM A;  2FMM A;  3PCO B;  3S15 B;  2MPM A;  1FVI A;  4I7Z C;  5IGD A;  3RZD B;  3NBI A;  4LAA A;  4ZLT F;  3IL8 A;  1B3Q A;  1JOK A;  1H9J A;  1NMG A;  3L2P A;  2XVS A;  1K8A C;  3A5Z B;  3DWP A;  2R93 G;  4FVM A;  3F8T A;  1E2W A;  5COR A;  5IGF A;  4DR5 L;  3D6W A;  3BVZ A;  4RHS A;  1PH7 A;  1EYC A;  5KYL A;  1HTP A;  1Z9F A;  4IN3 A;  4QMG A;  3LNN A;  4B3S L;  1F9S A;  4ALP A;  4HSV A;  1JOR A;  1DXM A;  1JJG A;  5CC4 A;  3W3A A;  4LF8 L;  3RZO H;  1CHQ D;  2B63 B;  2WAQ G;  1PMR A;  3J80 E;  1G2S A;  1PZI D;  4N9P A;  4QL5 A;  3FRP B;  1O7L A;  1YNJ C;  3QOL A;  2FXQ A;  2IWH A;  2NZ1 D;  4EQO A;  1E1O A;  2PMZ E;  4LNQ A;  3CCQ A;  3EFX D;  3SDZ A;  1EEF D;  1I4X A;  4GNX C;  3P20 A;  4LUO A;  1F2M A;  5LHY 1;  5J22 A;  3I90 A;  2RKS A;  3LWU A;  1PFM A;  1BXT A;  1F2Z A;  4E6I A;  2A68 D;  1RKN A;  2FMC A;  3MHB A;  2VW9 A;  1XPO A;  1X3E A;  3VA7 A;  1SYB A;  3Q0A A;  2F0M A;  4DKA C;  3N6R A;  4NPS A;  1EYA A;  1HQR D;  3KK7 A;  1NCV A;  4FXK C;  2D62 A;  1SJH D;  3EA6 A;  4RH6 A;  4AQY L;  1IYV A;  2K32 A;  1B3A A;  3P1H A;  1Q7Y C;  2ZXR A;  2L1B A;  1X3P A;  1VQ7 A;  2Q2U A;  2MJ8 A;  2B63 G;  1MI2 A;  1E2Z A;  5COY A;  4GS3 A;  2BCO A;  3KF6 B;  2QKI C;  2VNU D;  4BXX G;  1PA6 A;  5IYC G;  4PMB A;  2PQA A;  4DR6 L;  3QB3 A;  1SMY D;  4LMQ D;  2JA7 H;  1KL9 A;  5CBA E;  1AN8 A;  4I7A A;  3TRZ A;  5AJ3 L;  1S72 A;  2NVT B;  2RDG A;  1FNU A;  5IP7 H;  4QUF A;  1LTI D;  4N9T A;  1N9W A;  5GAE C;  4JBM A;  3J7A V;  5C0X I;  1DOL A;  4DV1 L;  1SYE A;  4PQX A;  4JYA L;  2K1B A;  2KHJ A;  1IBM Q;  3MAQ A;  4R4Q A;  5JEA H;  1Z6H A;  3S9W A;  1VQB A;  2Q2I A;  3OIQ A;  1YNN C;  1HZC A;  3X3N A;  4QQB X;  1UE6 A;  2XNA C;  2QA4 A;  1KLG D;  1W6K A;  3FKI H;  5JPN C;  1TS4 A;  3V2T A;  4UP7 A;  3WOF A;  1MSG A;  2E2D C;  3LWE A;  4B9X A;  4IPC A;  3ND8 A;  1PTO B;  2Q2T A;  3S2H B;  1G8Z D;  2Z6B A;  4YCW A;  1ZYR D;  3CCJ A;  3CC4 A;  1X32 A;  1RHP A;  4TSS A;  1ONL A;  2EY5 A;  5CV6 A;  3OYY A;  4GNX A;  1S5C D;  1B7Y B;  1ENA A;  3NK9 A;  3B6Y A;  3U58 A;  1YJ9 A;  3DXJ C;  2F0O A;  4K5V A;  1N32 Q;  5KGU A;  5C3E H;  2OXP A;  2JA8 H;  4HTH A;  1NR2 A;  2E5L Q;  2GVB A;  1SE8 A;  1X56 A;  5EBC A;  3J7Y W;  4A3F B;  3SHL A;  3T53 B;  3GTG B;  5GAH C;  2AUJ D;  5CR3 A;  3S1Q H;  4X66 Q;  1UNS A;  1WI5 A;  4BY1 B;  3CQZ H;  4BBS H;  1CSQ A;  4A3B H;  1ILP A;  3ERO A;  2CQA A;  4ZCK A;  2Y0S B;  2BDO A;  1GHJ A;  4DK0 A;  1TWG B;  2ASB A;  3GTQ B;  1WCM H;  3HKZ B;  4CGY B;  4RWS C;  5F2D A;  3MVV A;  4JI8 Q;  5C5M A;  1WTR A;  2EDG A;  3GD7 A;  5EKK A;  2N49 A;  3J81 i;  3J81 c;  1DON A;  4QF4 A;  3TRE A;  1AEX A;  2IX0 A;  2NVQ H;  3I8Z A;  1HFN A;  1VF5 C;  1I4G A;  3CME A;  2WV6 D;  5JVH 3;  2KUM A;  2UUC L;  1Q8I A;  4LFA L;  3GV6 A;  4U67 3;  2RF4 A;  2E2H B;  4H7B A;  1VQF A;  2QEJ C;  2KCM A;  1MKH A;  4TQU S;  2R7F A;  5C44 G;  2JA6 H;  5JJK A;  3HOY H;  3T1Y L;  4LFB L;  3FHW A;  3AEV A;  5AFW A;  5M3M G;  1S5B D;  1KAA A;  1H9M A;  1JR0 D;  1ICW A;  3H0G B;  1B9M A;  4APV A;  1AZQ A;  3KLR A;  2MO1 A;  4M8A A;  1QNK A;  1K3B C;  2TSS A;  4JBJ A;  2IL8 A;  1TY0 A;  2R7Z B;  3CD6 A;  1A2T A;  2K33 A;  2VXW A;  4H0L C;  2YU9 B;  4A3F G;  1QWY A;  2MQH A;  2L9H A;  5I9P A;  5FLM H;  2D0P A;  1A0I A;  3FPU B;  5LMU L;  1LT5 D;  2E75 C;  2OT2 A;  3HEJ A;  2B39 A;  2QIL A;  5JJL A;  3PF5 A;  4OO1 G;  3HKZ G;  2CWA A;  5IGC A;  3HOZ H;  2N8N A;  1VQP A;  3E3X A;  1IBL L;  1IW7 C;  4XT3 B;  1GHK A;  1GO3 E;  2K5H A;  1Q12 A;  4EQN A;  1KAW A;  3HOX B;  3J80 L;  2JEA I;  1QG7 A;  1R9T B;  1L0Y B;  4O0A A;  5FJ8 H;  2YTX A;  2IX1 A;  1GUN A;  5C4J H;  5IOC A;  1JE4 A;  1STH A;  4Y7N B;  4DV7 L;  3NUC A;  3KOJ A;  3K7U C;  1EQR A;  5IGE A;  1IHZ A;  1XJV A;  1J8I A;  1ET9 A;  1TR5 A;  4DV6 L;  4RFB A;  2A6H C;  3S17 H;  3AFQ A;  4KV6 A;  1STA A;  1RTN A;  3HOU B;  5M3F H;  3D4D A;  3H0G G;  4DV5 L;  1NSN S;  2PZU A;  5KYI A;  1SNQ A;  1LTB D;  2BH2 A;  3VYR A;  2PZW A;  4DR4 L;  4DUZ Q;  3VR2 A;  1II3 A;  2R7D A;  1FGU A;  1Q81 C;  2I5L X;  3A56 A;  1EY7 A;  4GKJ Q;  3GTP B;  2WKC A;  4FF2 A;  1KRS A;  1VS0 A;  2AMC B;  1AP0 A;  2JA5 H;  4C2M H;  2F0G A;  1YHA A;  3S1N B;  4OEL B;  2F3W A;  1TWH H;  1LUZ A;  4C56 C;  1N33 L;  1CM9 A;  3M4O B;  5JAV A;  4DK3 C;  3HOV B;  5M5W H;  4IUV A;  2ATW A;  1YJN A;  4DV0 Q;  2L5T A;  3NQT A;  4K2K A;  3HOX G;  4LWC A;  3OW7 A;  2F0N A;  5CV8 A;  4DV4 L;  3CCS A;  2UXC Q;  4YHH L;  1IL8 A;  1I3Q B;  2PQA B;  3VYS A;  4YCV A;  2O2L D;  5E4X A;  4PZ8 A;  3K7A H;  3TP8 A;  1WD1 A;  1LYL A;  2VUM H;  1JWU D;  5IP9 G;  1UE5 A;  4GN5 A;  1RCV D;  1G2T A;  4KD3 A;  3ICE A;  4LUV A;  4PZ6 A;  1TVX A;  3E9H A;  3GTM H;  4A3C G;  4A3D H;  1SEB D;  3PMF A;  1Q90 A;  1UE1 A;  5ISR A;  1Y1W B;  3K57 A;  3STB D;  4RAU C;  1J5E Q;  5LL6 S;  4POF A;  1EY5 A;  3TME A;  4B3M Q;  3PUY A;  4X64 Q;  1VF7 A;  4Z9C B;  1VQM A;  3J7A F;  2PZT A;  4JI4 L;  4CHT B;  3S1R H;  1LT6 D;  2RBM A;  4OL7 A;  4BY7 B;  1CSP A;  1KNE A;  2E76 C;  3T4A C;  4FP5 D;  3HOV G;  4DR5 Q;  2XIW A;  3PO2 H;  4IFD H;  4LJZ C;  5FK9 C;  3K5M A;  1V9P A;  1HRJ A;  4XYO A;  4JI2 L;  3CRK C;  1XX8 A;  2LS0 1;  1FYC A;  4KHP L;  4GNX B;  4B3S Q;  4R1J A;  2HQL A;  3UI2 A;  2MNA A;  1N36 L;  1WVL A;  1PH4 A;  4LF8 Q;  4C3I B;  1CZG A;  3OPO A;  4X3S A;  1KRT A;  1XPU A;  1HNX L;  3S1M H;  5C6A A;  3Q8D A;  1PH9 A;  4GLA C;  2M2L A;  3CCU A;  1MJC A;  5K5P A;  1TT2 A;  2A6E C;  1PH8 A;  1PLF A;  5J1Z A;  1HXY D;  1KTK A;  1P16 A;  1SYF A;  4A4I A;  5I9O A;  4A3K B;  1PRT C;  1Y1W G;  4IAL A;  4JI5 L;  1RTO A;  1IL2 A;  1UEA B;  4L63 B;  5GAG C;  4FYD A;  3JAM i;  4ZUI A;  4H13 C;  2RDH A;  4UDU C;  3JAM c;  2N88 A;  1S3O A;  3CAM A;  3S2D H;  1JE5 A;  2WFW A;  2XWJ B;  3BYT B;  4JI0 L;  4ULL A;  4C3H B;  1RJT A;  4ZRZ A;  1HZA A;  2X6G A;  1WTH A;  3OMC A;  4BY7 G;  3MA2 B;  2Q2H A;  1SNC A;  4IPG A;  4XQJ A;  1XTD A;  4KN7 C;  3E0E A;  3M9B A;  4MIU A;  4KD4 A;  1PTO D;  2K04 A;  4F87 A;  3TS2 A;  1SR3 A;  4YY3 L;  1BO0 A;  3D3R A;  4DV3 L;  4AQY Q;  1Q3L A;  3V05 A;  2YTV A;  3PQI A;  2IY5 B;  1LT4 D;  4DF7 A;  1C7Y A;  2ZTC A;  4C3I G;  3CPW A;  1KQS A;  4OEM B;  1LV9 A;  5K36 H;  3PUX A;  2JEB I;  4K6D A;  3R8B A;  2UU9 Q;  3A54 A;  2O5J C;  1V1Q A;  1I6H H;  2NZO A;  1FGB D;  4DR6 Q;  1CHP D;  4IPD A;  4NXN L;  1SRU A;  4A3K G;  2ALY B;  3RLF A;  5AJ3 Q;  3Q23 A; 
#chains in the Genus database with same CATH homology
 1Q8K A;  4AYB E;  4PMW A;  4GNX C;  4LUO A;  4LF7 Q;  1U0L A;  4JOI C;  3G6E A;  4OX9 L;  3G48 A;  4BXX H;  3PF4 A;  3CP0 A;  3I2Z A;  5IT9 c;  4DR7 L;  2UXD L;  1PHJ A;  5IYC H;  3L0O A;  1WOC A;  4DV1 Q;  1X3G A;  2QEX A;  4JYA Q;  4IOA A;  4B3R Q;  2VW9 A;  3M85 A;  1XPO A;  1X3E A;  1EFW A;  1WFQ A;  4DKA C;  3RN5 A;  3GTG H;  3KFU A;  1WYD A;  3T1H Q;  4NPS A;  2KEN A;  4KI0 A;  3U4V A;  1XMO Q;  2L15 A;  4POG A;  1KXL A;  4BY1 H;  3J81 j;  2JE6 I;  2CCZ A;  4K0K L;  4JCV E;  2OQK A;  4L5T A;  5K36 G;  4JG2 A;  3ULL A;  3GTQ H;  2D62 A;  4JI1 Q;  1CKN A;  2YYZ A;  4UP8 A;  4AQY L;  4LFC L;  3RR5 A;  1SMX A;  4DV2 L;  2I5M X;  4IOC A;  1L1O B;  5HY6 A;  4DAY B;  1Q7Y C;  4JI6 Q;  1NTG A;  1TWA H;  1X6O A;  4L5Q A;  2ZM6 L;  1VQ7 A;  2Q2U A;  4B3T L;  2B63 G;  1TWC H;  3RLN A;  3J80 i;  4A3M H;  1YEZ A;  4UPA A;  2A1A A;  4GS3 A;  4R4I A;  1FL0 A;  3E9I A;  2AWO A;  2UXC L;  3KF6 B;  5FLX c;  2VNU D;  1BBU A;  3OTO Q;  4BXX G;  2I5H A;  2XGT A;  1PA6 A;  1PYB A;  3PGZ A;  5IYC G;  3I4N G;  4DNI A;  1IBK Q;  1OXX K;  2PQA A;  4DR6 L;  2CFM A;  1HR0 L;  4TVA B;  1UE7 A;  2JA7 H;  1KL9 A;  3TRZ A;  1KC8 C;  4X62 Q;  2E2J H;  5AJ3 L;  1JMC A;  1UEB A;  1S72 A;  3HOZ H;  5IP7 H;  2JJQ A;  5ELN A;  4LF7 L;  4PG3 A;  1N9W A;  4BY1 G;  1N34 Q;  4OWW B;  5GAE C;  2IHE A;  4JBM A;  2RCN A;  2Y0S G;  2ZJP A;  2UXB Q;  1HZ9 A;  4QIW E;  1Q86 C;  5C0X I;  1Y1V H;  4DV1 L;  2R7Z H;  1VQ5 A;  4JI3 Q;  3K81 C;  4JYA L;  2KHJ A;  1IBM Q;  4B3R L;  4R4Q A;  1JJ2 A;  2VL6 A;  1HR0 W;  1VQB A;  1BVS A;  4JC0 A;  5C0X G;  2YU9 H;  4GOP A;  2B29 A;  2BH8 A;  2Q2I A;  3I7F A;  3T1H L;  1X65 A;  4NXM Q;  3G4S A;  1XMO L;  2F52 A;  2H5X A;  1HZC A;  2OQ0 A;  4IFD I;  4QQB X;  3GTL H;  1UE6 A;  1PH6 A;  2ZJQ A;  2QA4 A;  3FKI H;  4UP7 A;  3HFZ B;  3TEH B;  1HNW Q;  3I55 A;  4JI1 L;  4X6A H;  3STB C;  3EBE A;  1XNQ Q;  4LF5 Q;  2R6G A;  4IPC A;  4JI6 L;  2Q2T A;  1QVC A;  4YCW A;  1VQD A;  5M5X H;  4P71 A;  2HIX A;  1R9T H;  3CCJ A;  4DK6 C;  3L7Z C;  3CC4 A;  2Z0S A;  3OTO L;  5IY0 A;  1G6P A;  1EQQ A;  2UUC Q;  4LFA Q;  4HIO A;  1N8R C;  1XPR A;  1IBK L;  1X3F A;  1OTC A;  3CXC A;  1I5F A;  3OYY A;  4GNX A;  2R7Z G;  4JOI A;  4UY8 C;  1B7Y B;  1KIX A;  3T1Y Q;  3B6Y A;  4X62 L;  3KDF A;  3OW2 A;  3U58 A;  4LFB Q;  1JT8 A;  1YJ9 A;  2WAQ E;  1HNZ L;  4R4C A;  4DPG A;  1JB7 A;  4A3L H;  1N32 Q;  1N34 L;  3BJU A;  3HOU H;  1KHI A;  5C3E H;  1I50 H;  1SFO H;  1EIY B;  2JA8 H;  3FKI G;  4J15 A;  1L1O C;  1B70 B;  2GVB A;  2WB1 G;  1IZ6 A;  1CKO A;  5DLQ E;  2E5L Q;  1FJG Q;  2UXB L;  4LNQ A;  2D0O A;  4NB3 A;  3PIP A;  1YBY A;  1ASZ A;  1SE8 A;  1X56 A;  4JI3 L;  2K52 A;  3UDI A;  5IWA Q;  5C44 H;  1IBM L;  5ELO A;  1XNR Q;  4GKK Q;  2PNH A;  1L2F A;  5GAD C;  5GAH C;  5M3M H;  2PI2 E;  3S1Q H;  4NXM L;  2IT1 A;  1WI5 A;  2YV5 A;  4X66 Q;  3CQZ H;  4BBS H;  1CSQ A;  4A3B H;  4K0K Q;  1G51 A;  4YWL A;  1W3S A;  5LMU Q;  3GTP H;  1QVF A;  4P75 A;  2LXJ A;  5EAY A;  4IJL A;  2EQS A;  1QVG A;  2ASB A;  1WCM H;  5J3B A;  4IO9 A;  2UUA Q;  1HNW L;  4QY7 A;  3S1N H;  3UE1 A;  3I4M G;  4AIM A;  4JI8 Q;  3LGJ A;  4AH6 A;  5JJI A;  4A3F H;  3AFP A;  3GD7 A;  3VDY A;  2N49 A;  1IBL Q;  3J81 i;  1XNQ L;  3UDF A;  4LF5 L;  3M4O H;  4QGU A;  3CCV A;  3J81 c;  5LMN Q;  2DGY A;  1TWF H;  4EX5 A;  3HOV H;  4MZ9 A;  3TRE A;  1PH5 A;  2NVX H;  1VQE A;  2IX0 A;  3KYH C;  1QZH A;  2NVQ H;  1BKB A;  2K75 A;  1LTL A;  4JI7 L;  3ER0 A;  3PUW A;  4O2D A;  3AYH B;  3CME A;  1TWG H;  3CCR A;  3HOU G;  4A93 H;  1LM0 A;  3U4Z A;  2UUC L;  2JA8 G;  3PO3 H;  4LFA L;  1EUJ A;  2K14 A;  3PV0 A;  4LW1 A;  2OWO A;  2RF4 A;  3GTJ H;  4DV7 Q;  1I3Q H;  1Z47 A;  1H95 A;  1VQF A;  4DR1 Q;  2KCM A;  1MKH A;  1NBW A;  2LXK A;  2R7F A;  4MNO A;  4TQU S;  5C44 G;  2JA6 H;  5JJK A;  3HOY H;  3T1Y L;  4LFB L;  3NEM A;  1VQ6 A;  4DV6 Q;  3FHW A;  1VQ8 A;  1YNX A;  4A3E H;  1PV4 A;  3AEV A;  5M3M G;  1K9M C;  3H3V H;  4APV A;  1SLJ A;  4BBS G;  4A3B G;  1N32 L;  2MO1 A;  4DV5 Q;  1MJE A;  1VQC A;  3DM3 A;  4JBJ A;  4BA1 I;  2E5L L;  1KD1 C;  1FJG L;  2UU9 L;  3ULP A;  1Q46 A;  4YWM A;  3CD6 A;  2RHQ B;  5IWA L;  1SN8 A;  4OWX B;  1XNR L;  5C0X J;  2E2H H;  4DR4 Q;  3S16 H;  2N78 A;  3MEF A;  1NE3 A;  4A3F G;  2MQH A;  5FLM H;  2ES2 A;  2D0P A;  4X66 L;  2K4K A;  3RNU A;  1A0I A;  1S40 A;  3ULJ A;  4HJ9 A;  2DUD A;  5LMU L;  1OXT A;  1QZG A;  2VQF Q;  1YI2 A;  3H0G H;  4IFD J;  3BU2 A;  2GVA A;  1A62 A;  5HGQ A;  1GVP A;  2VQE Q;  5JJL A;  3SGI A;  1CKM A;  1QUQ B;  2RHS B;  2Y0S E;  3W5O A;  2UUA L;  3PF5 A;  3GTK H;  1AE2 A;  4X65 Q;  4OO1 G;  3PO3 G;  3HKZ G;  2CWA A;  4R4T A;  1A63 A;  4JI8 L;  3WWV A;  2OTL A;  1N33 Q;  2N8N A;  3D0F A;  3I4O A;  3K80 C;  2JK8 A;  1VQP A;  4BA2 I;  1IBL L;  3KLW A;  1C9O A;  2ZJR A;  1EIF A;  2R93 H;  1GO3 E;  2K5H A;  1Q12 A;  2B3G A;  5LMN L;  1Q1B A;  2JA6 G;  1KAW A;  2VS1 A;  2AWN A;  4A3I H;  3HOY G;  4BY7 H;  2XTI A;  2JEA I;  2NN6 G;  3IRB A;  4A3E G;  3S14 H;  1Q1E A;  3NEL A;  4O0A A;  3K0X A;  3A5U A;  1XMQ Q;  4A3M G;  4P73 A;  5FJ8 H;  1NY4 A;  1E22 A;  4DV4 Q;  3NEN A;  2YTX A;  1GM5 A;  2IX1 A;  4DAM A;  5C4J H;  3CC7 A;  1U5K A;  4YHH Q;  3AQQ A;  2OCE A;  4IPH A;  4DV7 L;  1E1T A;  4XIG S;  4LF9 Q;  2K5N A;  3KOJ A;  3K7U C;  4DR1 L;  1EQR A;  4DUY Q;  1PVO A;  1NMF A;  4IJH A;  3RLO A;  1XJV A;  4A3J H;  3W1B A;  4GN4 B;  4DV6 L;  4OX9 Q;  2JA7 G;  5LMN W;  4A3G H;  5FLM G;  3HOX H;  3AFQ A;  3S17 H;  3CMA A;  2AKW B;  3JC6 6;  5IP7 G;  4P72 A;  5M3F H;  1J6Q A;  1UWV A;  3H0G G;  3UE0 A;  4DV5 L;  1VQ4 A;  1PYS B;  4ME3 A;  3S24 A;  3KF6 A;  1ASY A;  2LSS A;  1AE3 A;  3I56 A;  1W2B A;  1L0W A;  3UDX A;  2BH2 A;  4Y7N H;  3J7A 5;  5IYB H;  3PIO A;  4DR4 L;  1Y1V G;  1VQN A;  3F2D A;  1IYJ B;  4DUZ Q;  3HOZ G;  4OXP A;  4A3K H;  5JEA G;  4BBR H;  2R7D A;  5IP9 H;  1FGU A;  1Q81 C;  2I5L X;  1D7Q A;  4GKJ Q;  3M7N A;  2VQF L;  4A3I G;  1KRS A;  1VS0 A;  2AMC B;  3HKS A;  3KJO A;  5BR8 Q;  2VQE L;  4YWK A;  2JA5 H;  4WJ4 A;  4C2M H;  5FJ8 G;  2WB1 E;  4JI4 Q;  1YHA A;  1CKN B;  4KHZ A;  4X65 L;  1TWH H;  5C4X H;  3S15 H;  1LUZ A;  2ZTE A;  4HIM A;  4DR3 Q;  1N33 L;  2GN5 A;  2MFI A;  3RZD H;  2PI2 A;  3G71 A;  4UP9 A;  4JBK A;  1WJJ A;  4C3H H;  4DK3 C;  3BZK A;  4LFC Q;  1K83 H;  2E8G A;  2NVY H;  5M5W H;  2ATW A;  4A3J G;  1NJI C;  1YJN A;  4DV0 Q;  4A3G G;  1VCI A;  3HOX G;  5IYD H;  1I94 Q;  1X54 A;  4LWC A;  1X55 A;  1OXS C;  4DV4 L;  3CCS A;  1VQL A;  1IXR A;  5M3F G;  3A74 A;  1VQJ A;  2ZTD A;  1K73 C;  2UXC Q;  4YHH L;  3DLL A;  1MIU A;  4JI2 Q;  5M5Y H;  2WP8 J;  2PQA B;  4KHP Q;  4YCV A;  1GKH A;  4LF9 L;  1HZB A;  3CCL A;  2QGQ A;  1YHB A;  4OON A;  4PZ8 A;  3CCM A;  5IYB G;  4DUY L;  2Z6K C;  3K7A H;  1PH3 A;  2OTJ A;  3BZC A;  1LYL A;  3F2B A;  1N36 Q;  2VUM H;  1YZ6 A;  2ID0 A;  4BBR G;  5IP9 G;  4LF4 Q;  1UE5 A;  2A19 A;  4GN5 A;  4AYB G;  2HIV A;  4DR2 Q;  1HNX Q;  1EWI A;  4A76 A;  3ICE A;  4A3L G;  4LUV A;  3UDG A;  1CUK A;  4PZ6 A;  4HJA A;  3E9H A;  5C3E G;  2A8V A;  3GTM H;  3ZJY C;  1VQG A;  1YJW A;  3U50 C;  4A3C G;  2JA5 G;  1GD7 A;  3FP9 A;  4A3D H;  2K50 A;  3I4N H;  4HIK A;  1UE1 A;  5C4X G;  4A3C H;  4DUZ L;  3STB D;  5H1S E;  4GOP B;  4PZ7 A;  2AHO B;  1J5E Q;  1JJC B;  1YIJ A;  4GKJ L;  4POF A;  1SRO A;  1YVC A;  3PUZ A;  2N3S A;  4B3M Q;  4JI5 Q;  2YTY A;  4RG1 A;  3PUY A;  4X64 Q;  3J7Z C;  4L5S A;  5IYD G;  5BR8 L;  2IHF A;  1VQM A;  1A8V A;  1V43 A;  4JI4 L;  4JV5 Q;  4MTN A;  4QJF A;  1BBW A;  1WCM G;  4GLV B;  3CCE A;  1C0A A;  4XTC S;  4Y52 H;  3S1R H;  4DR3 L;  4GKK L;  2VZA A;  3F1Z A;  4JI0 Q;  3RN2 A;  1Y1W H;  3TQY A;  1P8L A;  1Y14 B;  4WJ3 M;  1TXY A;  1CSP A;  3A0J A;  2KHI A;  2VY3 A;  2VUM G;  4DV0 L;  3HOV G;  4L5R C;  4OO1 I;  1I94 L;  1PFS A;  4DR5 Q;  2C35 B;  3PO2 H;  1E24 A;  3J80 c;  1V9P A;  4GN3 B;  1VQK A;  4JI2 L;  4A93 G;  3NBH B;  4KLK A;  4KHP L;  3KJP A;  3HKZ E;  4RMF A;  4GNX B;  4A3D G;  2NN6 I;  4YY3 Q;  1K3R A;  4B3S Q;  4R1J A;  2HQL A;  4DV3 Q;  1M1K C;  3H3V I;  1HJP A;  3KDF B;  2MNA A;  2F4V Q;  1N36 L;  2UUB Q;  4LF6 Q;  4HJ8 A;  1PH4 A;  4LF8 Q;  2MO0 A;  3EN2 A;  4LF4 L;  1T9H A;  3M4P A;  1VQI A;  4HJ5 A;  1D8L A;  3M3Y H;  1HNZ Q;  1KRT A;  1E7Z A;  1PH1 A;  2NZH A;  3GDE A;  4DR2 L;  1YIT A;  1HNX L;  1XPU A;  3S1M H;  3Q8D A;  1G29 1;  3CC2 A;  2CWP A;  2R92 H;  4R4O A;  1PH9 A;  1AH9 A;  4GLA C;  2CQO A;  3CCU A;  1YHQ A;  1MJC A;  4A75 A;  3MXN B;  4GLX A;  1VQH A;  1VQ9 A;  3K8A A;  1EOV A;  1DGS A;  4H02 A;  5JEA J;  3PSI A;  3TS0 A;  3EIV A;  1P16 A;  4A4I A;  4P74 A;  1PH8 A;  1M90 C;  2BA1 A;  1O7I A;  2BA0 A;  4OWT B;  4YCU A;  4NXN Q;  1Y1W G;  2JQO A;  1J5E L;  3ERS X;  2HHH Q;  1L1O A;  3GO5 A;  4C3I H;  2NVT H;  4JI5 L;  4B3M L;  1IL2 A;  5GAG C;  4X64 L;  2K5V A;  1K0R A;  3JAM i;  3HOW H;  5GQO A;  3PO2 G;  4DR7 Q;  3JAM c;  2UXD Q;  1OXV A;  3CPF A;  4EQ5 A;  4JV5 L;  4IFD G;  1S3O A;  3CAM A;  3PCO B;  2EXD A;  3S2D H;  1JE5 A;  1FVI A;  2WFW A;  3KF8 B;  4LUZ A;  4C3J H;  3H15 A;  4JI0 L;  1NMG A;  3L2P A;  4HJ7 A;  2HT1 A;  1K8A C;  1HZA A;  3A5Z B;  2R93 G;  1VQA A;  1VQO A;  3F8T A;  4BY7 G;  4DR5 L;  2Q2H A;  2KCT A;  4IPG A;  4GOP C;  1PH2 A;  3W1G A;  3M4Q A;  1EYG A;  1XTD A;  4JI7 Q;  2Z6K A;  5IE8 A;  3E0E A;  3M9B A;  1PH7 A;  1B8A A;  2R92 G;  3CW2 C;  2I0Q A;  1QUQ A;  3I4M H;  2CKZ B;  1OXU A;  3TS2 A;  1SR3 A;  1Z9F A;  3CF5 A;  4YY3 L;  4B3S L;  4DV3 L;  4AQY Q;  4ALP A;  2F4V L;  4DV2 Q;  1JJG A;  2UUB L;  4LF6 L;  2YTV A;  4LF8 L;  3RZO H;  2WAQ G;  3D31 A;  2IY5 B;  2ZM6 Q;  4B3T Q;  3S2H H;  1C7Y A;  4FDB A;  2ZTC A;  3CPW A;  1KQS A;  5E7N A;  1XMQ L;  2KBN A;  4QL5 A;  1RIP A;  2V1C C;  3PUV A;  2JEB I;  1RL2 A;  3PUX A;  3F2C A;  3HOW G;  2F3I A;  1K8G A;  1X9N A;  1E3P A;  2UU9 Q;  2EIF A;  2JA9 A;  4HID A;  1V1Q A;  1I6H H;  2NZO A;  5GRO A;  4DR6 Q;  2FXQ A;  1HR0 Q;  4IPD A;  4NXN L;  1SRU A;  2PMZ E;  1E1O A;  1Q82 C;  1HH2 P;  4A3K G;  2E2I H;  2ALY B;  3RLF A;  5AJ3 Q;  2HHH L;  3GTO H;  2B63 H;  4JBW A;  3CCQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...