1WJJA

Solution structure of hypothetical protein f20o9.120 from arabidopsis thaliana
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
145
structure length
145
Chain Sequence
GSSGSSGSTVKRKPVFVKVEQLKPGTTGHTLTVKVIEANIVVPVTRKTRPASSLSRPSQPSRIVECLIGDETGCILFTARNDQVDLMKPGATVILRNSRIDMFKGTMRLGVDKWGRIEATGAASFTVKEDNNLSLVEYESGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein F20O9.120
publication title Solution structure of hypothetical protein F20O9.120 from Arabidopsis thaliana
rcsb
source organism Arabidopsis thaliana
molecule tags Structural genomics, unknown function
total genus 15
structure length 145
sequence length 145
ec nomenclature
pdb deposition date 2004-05-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1wjjA01
4HIMA 5IP7G 2QEXA 3STBD 4B3SQ 4HJ8A 4DV2L 4LFAQ 4B3RL 4TVAB 2XTIA 4MTNA 1BBUA 2DGYA 3S1QH 4GS3A 2I5LX 1LM0A 2ZTCA 1HNWQ 1VQ5A 5FJ8G 1IBMQ 1IBKQ 4POFA 3K7AH 4JOIC 5M3MH 4AQYQ 2HIXA 1J5EQ 3HOWH 2ID0A 2JJQA 2HIVA 5LMUL 4JI1Q 4JG2A 4DR3Q 1WJJA 3I4NH 4LF6Q 1PHJA 4GLVB 1MKHA 5GAHC 3GTQH 3HOWG 3PO2H 3ZJYC 5M3MG 1X3FA 2QGQA 4A75A 5ELOA 3ULPA 4B3MQ 4BA2I 4DV3Q 3GTGH 2D62A 1VQ7A 1YJNA 2IX1A 3I4NG 4QGUA 2ZJPA 5C3EH 2UU9L 4DR1Q 2R7DA 3PO2G 4UP8A 1OXTA 2AMCB 1KL9A 1YNXA 3J81j 1PH5A 2R92H 4QQBX 4LF7L 1G51A 1GM5A 3RN2A 2ZM6L 4YHHL 1SMXA 5C3EG 4IJHA 1C7YA 1VQPA 1EIFA 1PH3A 2K4KA 1IBLL 2ZJQA 4OX9L 3T1HL 4P71A 2ASBA 5IP9H 4R4QA 4JBKA 1SR3A 1EUJA 2BA1A 4BY7G 2VZAA 1SE8A 4LF9L 4DR4Q 4DV0Q 3KYHC 3J81c 4X65Q 1IYJB 5IP9G 5IT9c 3CC7A 3CCUA 3PUYA 4DV1L 1BVSA 4A3MG 1BKBA 1VQMA 2R7ZH 3GTMH 4UY8C 4BXXH 1VQCA 2K5NA 2A1AA 2BA0A 2YTYA 2GVAA 3A74A 3CW2C 4UP9A 3ULJA 1EWIA 4AIMA 4X62L 4LF4L 4GKKL 1C0AA 4HIDA 2N49A 1PA6A 4BBSH 5IYDH 2R7ZG 1X9NA 4GOPC 1BBWA 1QVGA 1UWVA 1CUKA 3KF6A 1N33Q 2HT1A 3S17H 4BXXG 1JMCA 3KJPA 1P8LA 2MO0A 3T1YL 5IYDG 3NEMA 3RLOA 1A62A 3I2ZA 4X66L 1MJEA 3FP9A 3J80i 1N9WA 3F1ZA 5JJLA 1LYLA 1L1OC 1EIYB 1E7ZA 3FKIH 3PF5A 4JI7Q 4DV5L 1X3GA 2AHOB 1Q12A 3ERSX 4A3EH 1VQJA 1E24A 1Q82C 1PH6A 4LFAL 3RZOH 2VS1A 4LFCL 3S14H 3GTKH 4OONA 2VUMG 2H5XA 2ZTDA 1JT8A 4JI5Q 2NN6G 4C3JH 1RIPA 3FKIG 3TS0A 4HIOA 4DR2Q 3U4ZA 1HNWL 4AQYL 1RL2A 1AE3A 3F2BA 4A3EG 4A3JH 4O0AA 1Y1VH 2GN5A 4A3KH 4JI1L 2E8GA 3DM3A 4GNXA 5M3FH 3J80c 3PUZA 1SFOH 4LF8L 2K14A 2WP8J 3IRBA 3G48A 5IY0A 2JA9A 1TWCH 2UUAQ 4A3JG 5IWAQ 1Y1VG 4JBJA 4DV3L 3OTOQ 4A3KG 1NY4A 2MO1A 5GAEC 1XNQQ 4NXMQ 3JAMc 5M3FG 1HZCA 2PNHA 3CMAA 4QL5A 3KLWA 1AE2A 4LF5Q 1Z9FA 4JV5Q 2K5HA 3I4MH 1Z47A 2PQAB 1FJGQ 3S2DH 1FVIA 2MQHA 4A4IA 2E2HH 2FXQA 2B29A 5HY6A 2VQEQ 1QVFA 4A3GH 3I7FA 1L0WA 5BR8Q 3J7A5 1OXUA 3HOYH 1N36Q 1XNRQ 2WAQG 1NE3A 3I4MG 4P73A 3E9IA 2CWAA 4A3GG 1GD7A 3UDIA 3GTJH 3AFPA 5C0XG 2R93H 3GTLH 1P16A 2RHQB 3CCSA 4LUOA 4JCVE 4GKJQ 3SGIA 2VNUD 2KCMA 1S72A 4LW1A 1X6OA 3CPWA 1Q7YC 3HOYG 5LMNL 4LUVA 3EBEA 2AWOA 3BZCA 4GLAC 4MZ9A 5M5YH 4DV7Q 1YITA 2I5HA 3HKZG 4IPCA 3M85A 4HIKA 4LNQA 2R93G 2WAQE 5IP7H 4YY3L 3DLLA 4B3TL 2ALYB 1G291 2F4VQ 4UPAA 1Q86C 3RZDH 1Q1BA 1PVOA 1D7QA 4R4CA 1E22A 3GD7A 4JI0L 4QIWE 4QJFA 5FJ8H 2JA5H 2JA7H 2CCZA 3HKZE 4IPHA 3F2CA 3F2DA 3HKSA 3TEHB 3G71A 1QUQB 4BBRH 1IZ6A 4X64Q 3GTPH 3E9HA 4DR7L 1JJGA 1B70B 3M4QA 3M9BA 4NPSA 2JA5G 1IXRA 4JI6L 2JA7G 3AEVA 2IY5B 1I5FA 1YHAA 5C44H 1XMQQ 1FGUA 2OQ0A 3OYYA 4EQ5A 3RR5A 1KQSA 1I94Q 4DUYQ 4JI2Q 4BA1I 3UDXA 1PH1A 3MEFA 4BBRG 1I6HH 4X6AH 3CPFA 2Z6KC 4DNIA 4DV4Q 1H95A 3F8TA 5C44G 2A19A 1W2BA 4L5SA 2JE6I 1NTGA 3KDFB 3CCQA 4GOPB 1N34Q 4JI4L 2EXDA 3PIPA 2Q2UA 4NB3A 4KI0A 3G4SA 3EN2A 4NXNQ 3K8AA 3J81i 2IHEA 3GTOH 4PMWA 2UUAL 4AYBG 3AYHB 4HJ9A 1EOVA 1VCIA 3OTOL 3HOXH 1KIXA 1XNQL 2NN6I 4PZ6A 1L1OB 1I50H 1B8AA 1OXSC 1TXYA 1VQHA 1VQGA 1YHBA 4BY7H 2PI2E 3S1RH 1XMOL 4R4TA 1HNXQ 1Q1EA 1JJCB 3HOXG 2NVTH 3L2PA 4A3MH 1XTDA 4EX5A 4JC0A 2VQEL 4DUZQ 3S15H 1HH2P 3L0OA 2VQFQ 1K83H 4L5TA 4AYBE 1UEBA 5AJ3L 4GNXC 2LSSA 1HR0L 1O7IA 3NENA 4A3BH 1N36L 4DR5Q 1N32Q 5JJIA 1FL0A 4AH6A 5J3BA 1V9PA 1VQ4A 1EYGA 2IHFA 3G6EA 3WWVA 1CKNB 4GLXA 1JB7A 3W5OA 2Q2IA 4GKJL 1E3PA 1UE6A 3M7NA 3HOZH 4A3BG 2NVYH 2V1CC 2UXBL 3U4VA 4A3CH 4DV7L 1UE7A 2OQKA 4YCVA 4JI8Q 1K8GA 2Q2HA 3PCOB 2NZOA 4PZ8A 2AWNA 4Y52H 3E0EA 4RMFA 3HOUG 3HOZG 4JBWA 5C0XI 3Q8DA 4XTCS 3S1MH 4A3CG 4KHPQ 1HZ9A 4OO1I 2NVXH 2PQAA 2WB1G 3A5ZB 1HNZQ 4HJAA 5C4JH 4DV6L 2EQSA 3W1BA 3H0GH 4YWKA 2UUBQ 1HZAA 4QY7A 4BY1H 4B3SL 2E5LQ 3JAMi 5IYCH 1V43A 1VQKA 4K0KQ 4OWXB 1TWGH 2UUCQ 2N78A 4IFDJ 1I3QH 2KENA 4X64L 3H0GG 1MJCA 4BY1G 1IBML 1IBKL 2LXKA 1G6PA 4KHZA 3AQQA 3FHWA 5HGQA 5IYCG 1YI2A 1J5EL 2VUMH 3UDFA 4DR3L 1TWHH 3S1NH 4DV2Q 1NMGA 2K75A 2Y0SG 3PGZA 4LF6L 1VS0A 1MIUA 2A8VA 4IFDG 1UE5A 2YYZA 2Z0SA 2K50A 3M4PA 1VQFA 1TWAH 3I4OA 5GROA 4B3ML 2JA6G 1XPUA 2K52A 2JEAI 3TS2A 5E7NA 3STBC 1N34L 3RNUA 2EIFA 4DR1L 4A93H 4GN3B 4P74A 1ASYA 3HOVG 2F52A 2Y0SE 1YZ6A 2OCEA 4OWTB 4JYAQ 3PIOA 4A3DH 1QVCA 3UE1A 1QUQA 2BH8A 4R4IA 1PV4A 4A93G 4JI3Q 1X56A 5K36G 2DUDA 4IO9A 1HNXL 4PG3A 1LTLA 2UU9Q 3CCRA 3PV0A 1XPOA 4A3DG 3CAMA 2VQFL 1K0RA 2B63H 4LF7Q 3PUVA 2KBNA 2ZM6Q 2VY3A 3GDEA 4YHHQ 4POGA 4DR4L 4DV0L 5JEAJ 1XPRA 4X65L 1CKMA 1W3SA 1N32L 4P75A 1JE5A 1IBLQ 5IE8A 3KDFA 4ME3A 4GOPA 2B63G 4GN5A 1EFWA 1E1TA 3ULLA 2GVBA 1CSQA 1VQLA 1IL2A 2JQOA 3BZKA 3ER0A 3EIVA 1K3RA 4LF9Q 5JEAG 3MXNB 4DAMA 4JI8L 1WI5A 4DV1Q 1L1OA 2QA4A 1VQ9A 1N33L 3U50C 2MFIA 1VQEA 1SLJA 4LUZA 1VQBA 4APVA 3CCEA 1QZHA 1A63A 4IOAA 4XIGS 4X62Q 1HNZL 2E2JH 1XJVA 4LF4Q 2UXCQ 1WOCA 3K80C 4OXPA 3M3YH 3CP0A 4A3FH 2UUBL 4JI7L 1S40A 4K0KL 4LFBQ 1PFSA 1PYBA 3JC66 2MNAA 3L7ZC 3T1YQ 1WYDA 4DK3C 3VDYA 1A0IA 4JI5L 4X66Q 3KJOA 3AFQA 3UDGA 3K7UC 4R1JA 4DR2L 4A3FG 3PF4A 4O2DA 1VQNA 1CKNA 3A5UA 4C3IH 1EQQA 3I55A 5C4XH 4DV5Q 2R6GA 3BJUA 3KFUA 1NMFA 1YJWA 1PH9A 1ASZA 5FLXc 2VW9A 4LFCQ 1K73C 1DGSA 1YBYA 2YV5A 5IWAL 2RCNA 4HJ5A 2YTVA 5IYBH 5M5XH 3H3VH 5C4XG 4NXML 1VQDA 3D31A 4IJLA 1E1OA 1GVPA 1A8VA 2CFMA 2HHHQ 3CMEA 1LUZA 4LF5L 1GKHA 2CQOA 2ZTEA 1R9TH 4H02A 4JV5L 4R4OA 2VL6A 1OXVA 5IYBG 1Y1WH 4LF8Q 1FJGL 4L5RC 2BH2A 3PO3H 4IFDI 4JYAL 4DR6Q 3H15A 2IX0A 5BR8L 1KD1C 1OTCA 4JI3L 1XNRL 1Y1WG 1YHQA 3PO3G 3PSIA 5LMNW 1D8LA 2L15A 3CCLA 4A76A 2UXDQ 2LXJA 1VQAA 4YCWA 5ELNA 1GO3E 2D0OA 2IT1A 2XGTA 3D0FA 3OW2A 3HOUH 4WJ4A 5EAYA 3LGJA 2R92G 4DK6C 4J15A 1KHIA 2N8NA 2KCTA 2RF4A 1WFQA 1EQRA 4PZ7A 2NVQH 4ALPA 2F4VL 1PH7A 5GQOA 1T9HA 5LMNQ 2OTLA 4RG1A 3B6YA 2JA8H 1OXXK 2OWOA 3CCVA 2RHSB 1KRTA 5H1SE 3GO5A 4JOIA 2K5VA 4A3IH 1PH8A 1KAWA 3M4OH 4YY3Q 1Y14B 1Q81C 4B3TQ 2UXCL 1KC8C 2JA8G 4GN4B 2Z6KA 4MNOA 1VQOA 2R7FA 4JI0Q 1TWFH 4A3IG 3NELA 5FLMH 1XMQL 2WB1E 2JA6H 5GAGC 2ES2A 3TRZA 4LFBL 3S16H 1I94L 4DUYL 4JI2L 4B3RQ 1VQ6A 1YVCA 4BBSG 4DV4L 1HJPA 1NBWA 1WCMH 4YWMA 4C3HH 4Y7NH 5FLMG 3HOVH 3A0JA 3CCJA 4DR7Q 1J6QA 3RLFA 1VQIA 4KLKA 1N8RC 2HQLA 3KF8B 5GADC 4JI6Q 1KRSA 1U0LA 2JK8A 4LWCA 3BU2A 5LMUQ 1YJ9A 4NXNL 1WCMG 1K9MC 3J7ZC 3CC4A 5DLQE 2ZJRA 1NJIC 1PYSB 1X54A 1YEZA 2F3IA 1PH4A 1SROA 1X65A 2I0QA 4UP7A 3U58A 2HHHL 3CXCA 2ATWA 1B7YB 4JI4Q 4IPDA 4C2MH 1L2FA 2NZHA 3CF5A 3CD6A 1YIJA 2I5MX 1SRUA 4DPGA 1Q46A 1X55A 4IPGA 1HR0W 4JBMA 4OWWB 1QZGA 1Q8KA 4DUZL 4DAYB 2JEBI 4DR6L 1S3OA 3KF6B 2PI2A 2Q2TA 2YTXA 3KOJA 4DR5L 2D0PA 1CKOA 2C35B 2CWPA 3CQZH 5JJKA 1XMOQ 1JJ2A 1CSPA 3RLNA 4OX9Q 3T1HQ 3TREA 2UXDL 5C0XJ 5M5WH 2WFWA 3H3VI 1X3EA 3ICEA 1SN8A 1C9OA 5AJ3Q 2PMZE 1HR0Q 2OTJA 4YCUA 3CCMA 3PUWA 1PH2A 3NBHB 4YWLA 2E2IH 4L5QA 1K8AC 3I56A 4DKAC 2YU9H 4A3LH 3S2HH 4KHPL 4HJ7A 4GKKQ 2N3SA 3S24A 3PUXA 4GNXB 1UE1A 4IOCA 2UXBQ 1V1QA 4P72A 1AH9A 4OO1G 4FDBA 3UE0A 3W1GA 1HZBA 2KHJA 3HFZB 2E5LL 1KXLA 1M1KC 1U5KA 2B3GA 3RN5A 1M90C 2KHIA 4A3LG 3TQYA 2UUCL 3K0XA 4TQUS 3CC2A 2CKZB 2AKWB 1VQ8A 3K81C 4DV6Q 4WJ3M
chains in the Genus database with same CATH superfamily
2F0LA 3OHXC 3STBD 4HJ8A 3M7GA 4DV2L 3QR8A 4B3RL 2XTIA 5KEEA 2DGYA 3BYTB 3S1QH 1JWSD 2ZTCA 5M3MH 1EL0A 1JC7A 1HA5A 1RF2D 4L63B 4JI1Q 1PHJA 1R9TB 3PO2H 4OL7A 2VB3X 3ULPA 2KHSA 3SDZA 3OMGA 2D62A 1YJNA 4QGUA 3GTGB 1SAPA 2R7DA 5KGUA 3J81j 1CI3M 3VA7A 4QQBX 3M4YA 1H9SB 4QUFA 4LF7L 2R92B 3RN2A 1FD7D 1ESFA 5C3EG 4ULLA 1B4OA 2K03A 1PH3A 2ENBA 3GQBA 2ASBA 1JCKB 1NCVA 4JBKA 3V2TA 4BY7G 3A8KE 2EYOA 2CH4W 2I46A 1IYJB 5IP9G 2EY5A 3PUYA 5FO8B 1BVSA 1AN8A 2JA8B 1VQCA 2A1AA 3EQLC 4A3IB 3MXUA 4OHJA 3C3LA 1HTLD 1PA6A 4DAYA 2R7ZG 4GOPC 4BXXG 5I6YA 1N33Q 1DCZA 3FMCA 1TWFB 1A62A 1JICA 2K01A 4IQZA 3S16B 1MJEA 3FP9A 5JJLA 2Z8LA 2EYFA 1EIYB 2NN6H 1AZPA 3FKIH 2WV6D 1A3VA 2F3WA 3K6OA 4DV5L 1X3GA 4A3EH 3PQIA 1RTOA 4LFAL 3RZOH 3ITPA 4TRDA 3EFXD 3S14B 4C3JH 2OEOA 3TP6A 2KVMA 4HIOA 2I07B 1RL2A 3HRZC 1Y1VH 3Q0AA 2LKVA 1XWEA 5M3FH 5IT9E 2PMZB 1SFOH 2WP8J 3IRBA 1LT4D 2L11A 4A3KG 1NY4A 2MO1A 4ODGA 1ICWA 4QMGA 3JAMc 4XQNA 1HZCA 2NZ1D 3QOLA 1AE2A 1A2TA 4H44C 1Z9FA 4X3UA 2SEBD 1ESRA 4A3GH 3I7FA 2F0SA 4KD4A 1L0WA 3BVGA 1EU4A 1N36Q 2WAQG 3I4MG 4P73A 1BOSA 3HG9A 3GTJH 3AFPA 5C0XG 2PYKA 2R93H 3GTLH 1P16A 3SGIA 3HOYG 1S72A 4LW1A 2YU9B 5LMNL 1W6KA 5IGGA 5M5YH 4MZ9A 2L55A 4KD3A 4DV7Q 2I5HA 3M85A 4QF4A 4RHRA 5IP7H 3DLLA 2HUGA 4B3TL 2ALYB 4L6TB 1Q3LA 5ELBA 5G3LD 4C56C 2F4VQ 2LFNA 1E22A 3GD7A 1H9SA 5CV5A 4QIWE 2F0OA 5FJ8H 2FHTA 1BCPD 3TSSA 2CCZA 3F2CA 1B3QA 3HKSA 1PRTB 1LTRD 2VXWA 5CV7A 3S1QB 2JA7G 2FINB 3AEVA 1B3AA 2IY5B 1XMQQ 1YHAA 2RKSA 2NWGA 4EQ5A 4Z9CB 1ICFB 5M3MB 1PMRA 1F2LA 1PH1A 3MEFA 4IUVA 2IWHA 4BBRG 1I6HH 4DV4Q 1DOMA 1H95A 5C44G 2BCOA 2L1BA 1F2ZA 1STGA 3PO2B 4IUPA 5CV8A 2Q2UA 3K8AA 3GTOH 2IHEA 2MPMA 2A6HD 1ENCA 1VF5C 2F0PA 2SNSA 4AYBG 4HJ9A 2LMCB 3HOXH 3E5SA 1HQMC 3SE0A 1VQHA 2BE5C 1JJCB 1AW7A 1K3BC 4EX5A 3T16A 4A3MB 4L5TA 5I6WA 4GNXC 1MSGA 3VA5A 4A3BH 4WJWA 5JJIA 1FL0A 2ICEC 1EY4A 1VQ4A 2SDFA 3WWVA 1CKNB 4GLXA 3W5OA 1UE6A 3M7NA 2EY2A 4YIJA 2E74C 3U4VA 4K5WA 1K8GA 2OQKA 4JI8Q 1HA6A 2F0MA 3PCOB 4PZ8A 3H09A 1DM0B 5FLXE 1LTAD 3HOUG 5C0XI 3Q8DA 1HZ9A 4HJAA 2XNAC 4DV6L 2EQSA 1TKWB 2B2TC 3H3VC 1E2VA 2F0NA 3JAMi 4NDXA 4RGMA 1V43A 3FKIB 4A3EB 4DF7A 3H91A 4BY1G 4FF2A 1BDOA 1YNND 3EVQA 1G6PA 3FHWA 5HGQA 4C3JB 2XWBB 5EPKA 3PGZA 1Y1VB 1D1KA 2A8VA 3S1NB 2YYZA 2Z0SA 5M3FB 5JPMC 4N8FA 5GROA 1VQFA 2JA6G 3I4OA 2VUMG 2JEAI 1N34L 3RNUA 3FRPB 1STAA 2L12A 5KIXA 3A7LA 4A3DH 3MVVA 1EU3A 2WKDA 1SYDA 5K36G 1CZGA 1SNOA 1HNXL 1F9QA 3D4RA 2RDFA 3PV0A 4QIWB 3CAMA 2B63H 3LX0A 3GTJB 2Q8IB 4POGA 2R93B 3GTLB 2B2WC 2E76C 2F0HA 5DM73 3H94A 3R2IA 1B2TA 4I65A 5BN4A 1IW7C 5IE8A 1B1ZA 3DM1A 4IUUA 2LS01 3VR4A 3ER0A 3EIVA 3F2UA 4LF9Q 3HGBA 4PQXA 1WI5A 1N33L 4QB4A 4PV1C 3U50C 1SLJA 3NTIA 1Y8OB 1SSOA 1FNUA 3CCEA 1A63A 1QZHA 4P2CB 4DGZA 4X62Q 1HNZL 2E2JH 4LF4Q 2UXCQ 4G7OC 3T1YQ 4OELB 1JWMD 4DK3C 3VDYA 4FO2A 4X66Q 3UDGA 2AQ1B 2E75C 2QKIC 4A3FG 3PF4A 1CKNA 4C3IH 3BJUA 2KCNA 2KOLA 3R3OA 2PPBC 1NMFA 3T4AC 5CV6A 3RMHA 2N88A 3GTOB 2YTVA 5M5XH 3H3VH 1SJHD 1VQDA 1E1OA 2CFMA 1A8VA 2HHHQ 3HOXB 3TP7A 1CT1D 3E0JA 1GJXA 1STEA 1XX8A 4R4OA 4R9WA 4L5RC 3PO3H 1D6EC 4C1NI 1H9RA 1WTPA 1U4LA 1OTCA 2IPKD 1BO0A 1Y1WG 2B8GA 4A3BB 1I4QA 3DXJC 5LMNW 3CCLA 2LXJA 1VMPA 1VQAA 2RBMA 3OW2A 1GO3E 2XGTA 4WJ4A 1U4RA 2PNRC 2ZXPA 4DK6C 3NTHA 2KCTA 2WB1B 1WFQA 1EQRA 4PZ7A 2NVQH 4ALPA 2F4VL 1PFNA 2A68C 2FJ2A 3EROA 2F0EA 4FP5D 1KRTA 4XYOA 3MHBA 1KAWA 3M4OH 3K0YA 2XN9C 4O1NA 1IYUA 4HMIA 4MNOA 1VQOA 3WDNA 1QG7A 2R7FA 4DA2A 1FR3A 1XMQL 1EY0A 5GAGC 2ES2A 1E2ZA 3TRZA 3LNNA 4ABNA 4B3RQ 1YVCA 4DV4L 1HJPA 1WCMH 4C3HH 4Y7NH 3KF8B 4JI6Q 3HOVB 2JK8A 4LWCA 4ZUIA 5IGFA 1YJ9A 1G2TA 1I4RA 3NBHA 4WFN3 3J7ZC 2ZJRA 3C1EA 4KN4C 2F3IA 1PH4A 2I0QA 1X65A 3U58A 3CXCA 2XRSD 2A69C 4A3DB 3CD6A 1SRUA 3NHHA 4DPGA 1KNAA 1X55A 3I73A 4IPGA 3TP5A 1Q8KA 4EGVA 2F3VA 1EY5A 3AMUA 2B63B 1KABA 3KOJA 5LL6S 5G3LF 5JJKA 1XMOQ 5IODA 2K6AA 2UXDL 5KYIA 5M5WH 1X3EA 1EYAA 1SN8A 1BCPF 5EKLA 3CHBD 1C9OA 1LO5D 1I4GA 1HR0Q 4YCUA 3CCMA 3PUWA 1PH2A 1QJOA 3SK5A 4OO1H 4KY6A 4E6IA 5FO9B 4GNXB 2UXBQ 1V1QA 2HQEA 4FDBA 3VYRA 2E2JB 1HZBA 3HFZB 3NQTA 5A2QE 3MXGA 1KXLA 3RN5A 1BQQT 4A3LG 1U4MA 1SNMA 1QCBD 4IUNA 5CGKA 2AKWB 1VQ8A 3MFYA 4IUQA 4WJ3M 4KK7A 4HIMA 3D4DA 5IP7G 2KJXA 4B3SQ 1STHA 4IZ8A 4C3IB 4LFAQ 5I2YA 3VYSA 1F2MA 1LM0A 4N8X1 3QO2A 5FJ8G 2OF1A 1CM9A 2HIXA 4HSPA 2AQ3B 2HIVA 5LMUL 5M5XB 4DR3Q 1WJJA 4J8QA 4LF6Q 3T56B 1MKHA 1UNSA 2EPBA 3HOWG 2K5DA 3ZJYC 1X3FA 2F1MA 2QDBA 4CJ1B 3GTGH 3PO3B 4QUCA 1K0SA 3I4NG 4CJ0B 1A3TA 2KEEA 2R92H 1PH5A 1AP0A 4MTKA 1G51A 1GM5A 1L0YB 2M00A 1EIFA 4OX9L 2ZJQA 3KF8A 3T1HL 1PFMA 3Q6SA 4CHTB 1SR3A 2FMMA 2NVQB 1PRTC 2NTTA 4LF9L 4K2LA 4DR4Q 3K5MA 3KYHC 4CKEA 1VQMA 3CC7A 3MA2B 3GV6A 1BKBA 2K5NA 2R7ZB 1D1IA 2NYZD 2GVAA 4UP9A 4AIMA 5IT9L 4X62L 5T1GA 4LF4L 1C0AA 4HIDA 3C2PA 5IGCA 1X9NA 5FO7B 4BBSB 2R61A 2HT1A 4LJZC 4KKUA 1JMCA 4DXGA 2MO0A 3T1YL 5IYDG 4K5VA 4X66L 3GP7A 2BOSA 4C3HB 4Y7NB 4JI7Q 1Q82C 1VQJA 4DU9A 3S14H 4CJ2C 4OONA 2H5XA 1JR0D 2KCCA 4JI5Q 1G91A 1RIPA 4DR2Q 3J7YW 4AQYL 4CDEC 4A3JH 4O0AA 3R8BA 3VR3A 4GNXA 4FF4A 4MHEA 2G9HD 4KHVA 5IY0A 5C4ZA 3R93A 4O42A 5IWAQ 4JBJA 1NAPA 4DV3L 3RD4A 2L4NA 4XQQA 1XYIA 5FKAC 1SJED 4LF5Q 4JV5Q 1PTOD 2K5HA 3O13A 1FVIA 2B29A 1OXUA 3NTKA 1A2UA 5ELDA 4RKLA 1XNRQ 2MUYA 3E9IA 3QJYA 4FF1A 2CWAA 3HOYB 4B9XA 4Q5VA 1WTQA 4JK1C 3KUPA 4H7BA 2KCMA 1X6OA 1Q7YC 3EBEA 4GLAC 3HKZG 1B50A 5JVG3 4LNQA 3MFGA 1G291 4HAEA 3RZDH 1WTVA 1F9SA 1RD9D 1FNWA 1GUWA 1CFMA 2RCFA 1QUQB 3VR6A 4IUTA 4WORA 1JJGA 2JA5G 3M9BA 4NPSA 4JI6L 4BBRB 3CRLC 3OYYA 4G7HC 2WIIB 3NK9A 4DUYQ 4BA1I 1S5BD 1KLUD 3SEBA 5ELFA 1Q8IA 3A56A 2A19A 3K5OA 1W2BA 2JE6I 1NTGA 1EFID 3L9AX 3CCQA 1N34Q 3PIPA 1K8MA 2B2WA 5CBAE 3G4SA 3EN2A 1FNVA 5EQ0A 1QWYA 4PMWA 2UUAL 3OTOL 1XNQL 4HN7A 1I50H 5BN5A 1TXYA 1NSNS 1R4PB 2PI2E 1XMOL 2QILA 1HNXQ 1FYCA 4A3MH 4JC0A 2VQEL 1BR9A 1HH2P 3L0OA 5J39A 1UEBA 2LSSA 1HR0L 4CKBA 3NENA 5JJZA 4DR5Q 5EJWA 4PNYA 5J3BA 4DNTB 2IHFA 2RDHA 2Q2IA 4FVMA 2V1CC 2UXBL 4A3CH 1K8OA 4FXDA 1UE7A 4J1MA 1SYCA 1CHPD 2NBFA 4RMFA 2XWJB 3HOZG 4XDXA 3S1MH 1HCZA 4KHPQ 1MHWC 1HNZQ 2F0QA 5C4JH 1UUPA 3W1BA 3H0GH 4YWKA 2NVXB 1HZAA 4B3SL 4V0BA 2E5LQ 1G2SA 2RSOA 1C8CA 4BY1B 4OWXB 1TWGH 1HQRD 1RJTA 2UUCQ 5CORA 1MSHA 4FYDA 2CW0C 4IFDH 2LXKA 3AQQA 3MZ5A 5HGTA 5IYCG 4X3TA 4F88A 1F2YA 3UDFA 4DR3L 1TWHH 1E2WA 2A5HA 2TMPA 4A3JB 4LF6L 3S1NH 1MIUA 3K5LA 2B39A 4DFAA 1TWAH 2K52A 2OXPA 3STBC 2F0FA 1RCVD 1XTCD 3P75A 4A93H 1SYBA 2Y0SE 1YZ6A 3KLSX 2Q8RE 1EYCA 2B2VA 3UE1A 1QUQA 4RGOS 1PV4A 1TS3A 2HCIA 2DUDA 1HFNA 1B53A 1LTLA 4IURA 1IYVA 1ONLA 3Q22A 5D3IB 3I4LA 2ZM6Q 2VY3A 3GDEA 2J0TD 2QEJC 2K33A 4DR4L 1XPRA 5JEAJ 1N32L 3IFTA 4ME3A 2EYJA 1E1TA 2GVBA 3TN2A 2JQOA 4ZLTF 1IL2A 1LTBD 3BZKA 4KTAA 1K3RA 2PZUA 4DAMA 4DV1Q 3RZDB 2K05A 3DUZA 1UAPA 1VQBA 3HP3A 1D5MC 3K5NA 1PZID 3BG3A 3DEOA 4OXPA 3M3YH 4JI7L 3AB9A 2AUKA 5EKIA 1S40A 1PDQA 1GXDC 4V190 3DWAA 3KBXA 2MNAA 4JI5L 3KJOA 1Z7TA 4DR2L 5C3WA 4KN7C 4FXKC 1VQNA 5C4XH 2MP1A 3KFUA 1YJWA 2VW9A 1YBYA 3G6JB 5IWAL 1WTRA 3A7AB 4IJLA 1S5DD 1SNCA 3CMEA 3PIO3 4OEMB 1I50B 4XT1B 2PQEA 4LF5L 2K28A 4H02A 2F0TA 4JV5L 1ZYRD 5IYBG 4LF8Q 2BH2A 3H15A 2QF7A 4JI3L 2EY6A 2EY1A 2DNEA 1XNRL 1S5ED 5E3FA 2L15A 4A76A 2UXDQ 5F2DA 1K28A 3C1FA 2K7VA 5EAYA 1O7YA 3EA6A 2R92G 1KHIA 3LWUA 3K57A 2RF4A 2L5TA 2IX3A 2AUJD 4KJNA 5KYLA 2OTLA 2EJFC 3S1MB 1EIGA 3B6YA 2F0JA 2N55A 4XT3B 2OWOA 2RHSB 4IALA 5C4JB 3A8JE 1ENFA 1PH8A 3H0GB 2ICIA 5COYA 1RTNA 4YY3Q 1Q81C 1SXTA 2JA8G 1TWGB 4GN4B 1KDBA 4HCEA 1GUNA 2Y0SB 4JI0Q 4A3IG 2WB1E 4KV6A 1EWHA 2MGSA 4LFBL 4DUYL 2EOTA 3D4WA 4ZAIA 2F0VA 1VQ6A 1TWHB 4YWMA 1PXUA 5FLMG 3HOVH 1GOZA 4DR7Q 4KLKA 1N8RC 4ME5A 1TU2B 5KNCA 2HQLA 3FPPA 1PTOF 1BCPC 1TWAB 5GADC 5LMUQ 1G6ZA 1WTXA 4OIJA 2FFKB 4HR7B 4G7ZC 2DNCA 3NQIA 1O7ZA 3HEJA 4A93B 1SROA 1B7YB 3FEWX 4IPDA 1LTSD 4C2MH 2PW7A 4FF3A 1HR0W 2F03A 4I7AA 1QZGA 1IL8A 2CH4A 3P7JA 3KF6B 2PI2A 4PMCA 2Q2TA 4JVZA 5J22A 4DR5L 4RFBA 3T13A 2D5DA 3CQZH 2CWPA 1JJ2A 2A6HC 3RLNA 3BDCA 5JEAH 4OX9Q 3T1HQ 3MEHA 5C0XJ 1GHJA 1TY0A 4CKCA 5AJ3Q 3J7AV 5I4DA 3NBHB 1JOKA 4XQJA 4RKBA 2E2IH 1K8AC 3FVQA 4KHPL 4F8MA 3T51B 2N3SA 3OWEB 3PUXA 5AFWA 1UE1A 1AH9A 4UDUC 2KHJA 2E5LL 4ZCKA 3M3YB 1M1KC 1U5KA 3OSOA 1M90C 1JWUD 2UUCL 1L0XB 1SYGA 3MXPA 2CKZB 5TSSA 2GA4B 1JOQA 2QDLA 2QEXA 3TMEA 1EZ6A 1EYDA 1ZXTA 4CDCC 5I9OA 3Q23A 1PZKD 5C4XB 1ET9A 3P20A 1WTWA 1SMYD 2C9OA 2L9HA 1IBKQ 4AQYQ 1YNJD 1X3PA 4JOIC 1J5EQ 3SK6A 1KNEA 2ID0A 2JJQA 1I6VC 3K7AB 4JG2A 2A6ED 4GLVB 4K8JA 5EKKA 2Z1CA 3I4NB 3MAQA 2DY7A 2SNMA 1YNNC 5M3MG 2QGQA 4BA2I 5ELOA 1HFGA 4B3MQ 5FOBB 4DV3Q 2IX1A 5C3EH 2O4XA 3PO2G 4UP8A 2XVSA 2AMCB 1KL9A 1YNXA 1SYFA 1A15A 2O5JC 2Z6BA 2ZM6L 1Y8NB 4RH6A 1KAAA 5NUCA 2JYOA 1C7YA 1VQPA 1Z6HA 2RVLA 4P71A 4X3KA 4XXEA 5IP9H 4R4QA 1EY6A 2BA1A 2RA4A 5E4WC 2B2VC 4DV0Q 4X65Q 5IT9c 4DV1L 4A3MG 2R7ZH 3GTMH 4UY8C 1RDPD 5C3XA 4HCSA 4BXXH 1OO9B 2BA0A 1HTPA 2YTYA 3CW2C 2F0UA 3ULJA 1EWIA 3J81L 3E3XA 1HPCA 4GKKL 4BBSH 3K59A 2KQ3A 1AEXA 2EYPA 1UWVA 3KF6A 3S17H 1S5CD 2V4DA 2LY7A 3NEMA 5C6AA 2KA7A 3RLOA 1V8QA 3J80i 1N9WA 3F1ZA 1LYLA 1E7ZA 5DAUA 1KDCA 4K2KA 1WD0A 3BDLA 1Q12A 3ERSX 4HMJA 1PH6A 1E24A 3GTKH 3WOEA 1JT8A 2ZTDA 2NN6G 3FKIG 3TS0A 1HNWL 4QCLA 3U4ZA 2H4OA 5CR3A 1AE3A 3F2BA 4A3EG 1V1OA 1HHVA 4A3KH 3I3CA 2E8GA 3DM3A 3W3AA 4C3JG 2R3ZA 4C2MB 2PZTA 1BNZA 4LF8L 2UUAQ 1TVXA 2JA9A 1TWCH 5M9OA 1Y1VG 3OTOQ 1XNQQ 2CQAA 5GAEC 5M3FG 3J80L 3KBGA 3I4MH 3OIPA 3CQZB 1FJGQ 1G8ZD 1QVFA 2VQEQ 5HY6A 5C0XH 2XSCA 4N9PA 5BR8Q 3J7A5 3HOYH 5ISRA 1CQVA 1NE3A 4A3GG 1GD7A 3KLSA 2E2IB 3CCSA 2Z4IA 4DK0A 2VNUD 3BZCA 4IPCA 1STBA 2R93G 4RGNA 2WAQE 1TT2A 1B9NA 4YY3L 3D6CA 4UPAA 1Q1BA 4CDDC 4JI0L 3JAME 4QJFA 1EOTA 1STYA 1VMCA 4EQOA 2JA7H 3ND8A 3BYYB 2JA5B 3TEHB 4BBRH 1IZ6A 3GTPH 4DR7L 3E9HA 3M4QA 1IXRA 5C44H 2OQ0A 3RR5A 1I94Q 1QB5D 3CPFA 5LHY1 3I72A 4DNIA 2PW5A 1NR4A 4L5SA 2HDLA 4U673 4G57A 2VB2X 4KI0A 4NXNQ 4DAPA 5C3EB 1H9JA 4IN3A 1VCIA 4RA8A 1KIXA 2NN6I 4PZ6A 1L1OB 1OXSC 1TIID 5EPJA 1BCPB 1VQGA 4BY7B 3HOXG 1XTDA 3S15H 2NVTB 3HS0C 1EQVA 4AYBE 5AJ3L 5EGTA 2F4IA 1N32Q 3LWEA 1V9PA 4C1NK 1EYGA 3DMUA 5E4XA 3GTMB 4GKJL 5IGBA 1JB7A 1LACA 1E3PA 4A3BG 2DJGC 2NVYH 3BZDB 4F7XA 2DY8A 3K58A 4Y52H 4L8JA 3E0EA 3S17B 4JBWA 2EE1A 3ERQA 2NVXH 1I4XA 2WB1G 3A5ZB 4BY1H 4QY7A 1ET6A 1VQKA 1SNQA 1LABA 2N78A 4IFDJ 5HURA 1I3QH 3QB3A 2KENA 4X64L 1DOKA 1MJCA 3GTKB 1IBKL 5EBCA 2QW7A 1J5EL 2VUMH 1YI2A 4RCOA 4A3KB 1EY9A 3U9OA 2K50A 1B44D 1XPUA 4B3ML 3TS2A 1KTKA 4UHVA 1TWCB 3IKJA 3TP8A 2EIFA 5DNFA 3TBIB 3P1HA 1ASYA 3HOVG 2F52A 5K36H 4JPBW 1LT3D 5IIFA 2WAQB 3I4MB 2BH8A 4TKOB 4JI3Q 4IO9A 1MGSA 2UU9Q 1PLFA 3CCRA 4A3DG 1GUGA 2VQFL 1HUNA 1F9RA 3VYUA 3PUVA 2KBNA 1BF4A 4YHHQ 5D65A 2F0IA 5EBDA 4DV0L 4X65L 1W3SA 1WTHA 1ILPA 4P75A 1IBLQ 1NR2A 2B63G 4GN5A 3NXWA 1CTMA 5JEAG 1VDZA 1VQ9A 1L1OA 2QA4A 5CBEE 2NTSA 2MFIA 1VQEA 4OIKA 3G7LA 4RWSC 4LUZA 2JA7B 4IOAA 4XIGS 1MBYA 5LL6X 1D5ZC 1XJVA 4A3FH 2UUBL 2MHVA 3GTPB 1E0BA 4K0KL 3MTSA 4LFBQ 1PFSA 3JC66 5C44B 3L7ZC 2CVRA 5JVH3 2EJGC 3A5UA 2B8FA 4EQPA 1EQQA 3SVMA 4AYBB 4LFCQ 1PH9A 5I9PA 1DD2A 2F0GA 3OW7A 3BDOA 1EEID 1WVLA 4C3IG 3IAYA 4DNRB 3SK8A 1GVPA 5FLXL 4RGTA 3OOCA 3OWFA 1GKHA 2ZTEA 5KNBA 4JW0A 1OXVA 4FNFA 5DEHA 1Y1WH 1FJGL 3KK7A 4JYAL 2JXMB 2IX0A 5BR8L 3S15B 1KD1C 4I7ZC 1JQYD 5KRUA 1DONA 1YHQA 3PO3G 3PSIA 4KKTA 4K6LA 4YCWA 3QG1A 5ELNA 1BBXC 2D0OA 2IT1A 2X69A 3D0FA 3LGJA 4HSVA 1C4QA 3HOUB 2XRQD 2NVYB 4J15A 1PTOC 1SEBD 3CRKC 1SYEA 3A55A 5EPLA 3I8ZA 1PH7A 2X6LA 5GQOA 4RG1A 1OXXK 3C46A 2F0WA 3GO5A 4JOIA 2DN8A 2CHBD 2QCPX 1Y14B 4U68A 1EY7A 2Z6KA 3URYA 3NSWA 3OIQA 3WOFA 5JPNC 1I3QB 3NELA 2B2YA 2JA6B 2VUMB 1I94L 4BBSG 1NBWA 1KLGD 3CCJA 1J6QA 3RLFA 1O80A 2TSSA 1KRSA 4NXNL 4M1UB 1WCMG 2BE5D 4C3HG 1K9MC 2H1EA 1NJIC 1PRTF 1PYSB 3X3MA 4N9TA 4UP7A 1TR5A 3D6WA 1T5EA 2B2UC 3NBIA 2ATWA 4JI4Q 3CF5A 1QE6A 1ILQA 5I2XA 3NUCA 5C5MA 4JBMA 5C5LA 4NMZA 2JEBI 3IL8A 2K32A 4NW2A 4DR6L 1S3OA 5BN3A 1QNKA 4OGQC 1GUSA 1CA6A 2NB0A 1DJRD 2BDOA 1CKOA 1CSPA 4ILWA 3TREA 2Z4HA 3NPPA 3H3VI 2P5ZX 2MJ8A 1CZWA 5JOBA 2OTJA 3W2DA 4ZQ3A 4YWLA 5FK9C 5CV4A 4L5QA 3I90A 3I56A 3IFDA 3R2TA 3SHLA 2C5CA 4A3LH 4GKKQ 3S2HB 4P72A 4OO1G 3W1GA 1RODA 4A3FB 2J7ZA 3TQYA 3K0XA 1J9OA 4WRDA 2OT2A 3K81C 3NWTA 1PTOH 2IJ0A 1EWCA 1GHKA 1SE4A 1RKNA 3OPOA 1D2BA 4MN3A 4TVAB 4MTNA 1BBUA 2F0DA 4GS3A 2I5LX 2J4XA 3SXHA 1VQ5A 1HNWQ 1IBMQ 3HOWH 4POFA 1CHQD 3K7AH 4XYQA 1H9MA 3T53B 1LV9A 1EEFD 1IHZA 3I4NH 1U9RA 5GAHC 3GTQH 2BDNA 4RAUC 4A75A 1CQFA 1O78A 1Y1WB 1VQ7A 2ZJPA 1Q90A 3ONAB 2UU9L 4DR1Q 1OXTA 1IW7D 3Q24A 5T1IA 1SMXA 4YHHL 1M8AA 3H6MA 4LMQD 4K5XA 1I4PA 4IJHA 4EVOA 3J7AF 2K4KA 1IBLL 4HTHA 3QWNA 1EUJA 2VZAA 1SE8A 3J81c 3CCUA 4G4KA 2G9DA 3VR5A 3VYTA 3A74A 4Q0FA 5IYDH 3PMFA 2N49A 3OMCA 4ZYSA 1QVGA 1BBWA 3DEPA 1CUKA 3NWSA 3KJPA 1P8LA 3I2ZA 2Z9HA 1KDAA 4ID6A 1L1OC 3PF5A 5E1FA 2AHOB 1X32A 4OO1I 2VS1A 4LFCL 2WINB 5CC4A 3MC0B 3RZOB 3FDTA 5D3DA 2GN5A 4F87A 2K1BA 4JI1L 5IGEA 1II3A 2HDMA 2EYMA 4RHSA 3J80c 3PUZA 1S4ZA 2K14A 1LTTD 3G48A 4LK1C 4A3JG 4KY5A 1SFOB 5A2QL 4NXMQ 2PNHA 4CDFC 2PO4A 4QL5A 3CMAA 1HRJA 3KLWA 3A54A 4EQNA 2RSNA 3S2DH 1Z47A 2PQAB 3JAML 2MQHA 4A4IA 2E2HH 2FXQA 4A3GB 4NKLA 5CYUA 1HUMA 2A68D 2G5DA 4GZYC 1ZYRC 3E6ZX 1AFPA 3UDIA 2X6GA 3NE5B 4R8NA 4KKSA 1LT6D 3ZYYX 2RHQB 4LUOA 3DWQA 3EJIA 4JCVE 4GKJQ 5D14A 3CPWA 4PMBA 4LUVA 2AWOA 3TZDA 1YITA 4HIKA 4NP5A 3GV3A 5M5YB 1BUVT 1NNXA 2Q8TA 1Q86C 2WKCA 1PVOA 1D7QA 4R4CA 1LT5D 2D9UA 2F0KA 2JA5H 1PTOB 3HKZE 4IPHA 4S3SA 2WACA 3F2DA 4DXFA 3G71A 5ELCA 4X64Q 1B70B 1JORA 1TS4A 1I5FA 1TQOA 1FGUA 3HOWB 1SE3A 1SDFA 1KQSA 1IKMA 1GUTA 2A69D 4JI2Q 3UDXA 4X6AH 2Z6KC 2A73B 5A35A 5C4HA 1I6HB 4RCNA 3F8TA 2B2YC 3GTQB 2KECA 3KDFB 5L37A 4GOPB 4JI4L 2EXDA 3MWYW 4NB3A 3J81i 3AYHB 1EOVA 1MI2A 1M4VA 1B8AA 1U4PA 1YHBA 4BY7H 3S1RH 1JE4A 4R4TA 1Q1EA 4M8AA 2NVTH 3L2PA 5KNDA 3FPUB 4DUZQ 2VQFQ 1K83H 3A8IE 1O7IA 1N36L 1JB3A 4AH6A 1DXMA 2M2LA 2JSOA 3G6EA 1ZKOA 5IGDA 3HOZH 5CV9A 4DV7L 3NP8A 3DWPA 4YCVA 3V96A 4R8IA 2Q2HA 2NZOA 2AWNA 4XTCS 4A3CG 1EQTA 2PQAA 2K5QA 3BS1A 2UUBQ 1H9KA 1IKLA 5IYCH 4K0KQ 1O7LA 1QILA 1EIHA 2NUCA 2XIWA 4ZKBB 2EYLA 3H0GG 1TS5A 3VR2A 1IBML 1STNA 4KHZA 3BVMA 1ENAA 3I70A 1D5XC 2PZWA 2K04A 1XXGA 1NMGA 2K75A 2Y0SG 4DV2Q 1VS0A 1RHPA 4IFDG 1UE5A 3PIP3 1SBBB 3D8GA 1GUOA 3M4PA 5JAVA 1V1PB 1QNUA 1CA5A 5E7NA 2O2LD 2EVBA 2AQ2B 4DR1L 2K5WA 1ZEQX 1SMYC 4GN3B 4P74A 2SOBA 2OCEA 4OWTB 4JYAQ 4B08A 1YNJC 3PIOA 1DYQA 3S2DB 1QVCA 2E2HB 2M9VA 4R4IA 4A93G 1PRTD 1X56A 2A6EC 4PG3A 1J8IA 1XPOA 1A3UA 2ZXRA 1K0RA 4LF7Q 3HKZB 1B9MA 1SNDA 3KLRA 1I4HA 1CKMA 1JE5A 4ZK9B 3U9SA 1MD2D 3KDFA 4GOPA 1EFWA 3ULLA 1CSQA 1VQLA 1Y69U 1EZ8A 3MXNB 4JI8L 2EDGA 1ML0D 3CU7A 4APVA 3HZXA 1BXTA 4ZUJA 1WOCA 3K80C 2RQXA 3CP0A 1NUCA 1UEAB 2RDGA 2B2UA 1PYBA 1LTID 1WYDA 1A0IA 3AFQA 3K7UC 4R1JA 4O2DA 2O5IC 2JP1A 1S5FD 3QIAA 3I55A 4DV5Q 2R6GA 3RUZA 1ASZA 2PCFB 5FLXc 1AZQA 1K73C 2EZVA 4KY7A 1DGSA 2IW3A 2YV5A 3CKIB 3UI2A 2RCNA 2IL8A 4CGYB 5IYBH 4HJ5A 4TSSA 5C4XG 1LTGD 4NXML 3D31A 1F77A 1LUZA 4B9WA 2CQOA 2E2DC 1R9TH 2JN4A 2VL6A 3S1RB 4IFDI 3ND9A 4DR6Q 1TY2A 1K83B 1JOOA 3TDQA 1HXYD 1PZJD 3AU7A 2ZXOA 1D8LA 2A74C 2DJFC 2L0CA 4H13C 3HOUH 1QOHA 3L3OC 1V1PA 3HOZB 3V05A 5DM63 2N8NA 2EYHA 1X3QA 1C48A 4KJOA 4DAVA 3BVZA 1T9HA 5J1ZA 5LMNQ 2JA8H 2KUMA 3CCVA 5H1SE 3N6RA 4MIUA 4H0LC 2K5VA 4DN4M 4A3IH 4K8IA 1WTOA 4UAIA 4B3TQ 3DHQA 3M4OB 2UXCL 1KC8C 2ZT9C 4FXGC 1TWFH 5FLMH 2JA6H 5ELEA 3SK4A 3S16H 3X3NA 1WD1A 4JI2L 4J6HA 1A6XA 1CK1A 3A0JA 1EY8A 1VQIA 1WCMB 1VF7A 1DZ1A 1U0LA 3BU2A 4KMUC 4K14A 3MXNA 2EJMA 3CC4A 1F9PA 5DLQE 3QOJA 1X54A 1YEZA 2FMCA 1TS2A 2HHHL 5CMDA 1SE2A 3J81E 1L2FA 2NZHA 4LAAA 1YIJA 2I5MX 4ZKCB 1PFBA 5IOCA 1R4QB 1Q46A 4K6DA 2EXZA 3S9WA 4OWWB 1SNPA 4DUZL 4DAYB 1W6JA 2YTXA 3I91A 2D0PA 2C35B 3SR1A 2HCCA 2WFWA 4CBVA 1FGBD 2KEDA 3ICEA 5M5WB 2PMZE 4X3SA 1Y8PB 1DOLA 2B2TA 4DKAC 2YU9H 3S2HH 4HJ7A 2HD3A 3S24A 4BS9A 2D2CC 2CW0D 5K5PA 4IOCA 4ZRZA 3UE0A 4BWGB 4DK1A 2B3GA 3D3RA 1T5XD 1PYWD 2KHIA 3N52A 4TQUS 3J80E 3CC2A 1LLRD 4HEDA 3TZUA 4DV6Q
chains in the Genus database with same CATH topology
4HIMA 5IP7G 2QEXA 3STBD 4B3SQ 4HJ8A 4DV2L 4LFAQ 4B3RL 4TVAB 2XTIA 4MTNA 1BBUA 2DGYA 3S1QH 4GS3A 2I5LX 1LM0A 2ZTCA 1HNWQ 1VQ5A 5FJ8G 1IBMQ 1IBKQ 4POFA 3K7AH 4JOIC 5M3MH 4AQYQ 2HIXA 1J5EQ 3HOWH 2ID0A 2JJQA 2HIVA 5LMUL 4JI1Q 4JG2A 4DR3Q 1WJJA 3I4NH 4LF6Q 1PHJA 4GLVB 1MKHA 5GAHC 3GTQH 3HOWG 3PO2H 3ZJYC 5M3MG 1X3FA 2QGQA 4A75A 5ELOA 3ULPA 4B3MQ 4BA2I 4DV3Q 3GTGH 2D62A 1VQ7A 1YJNA 2IX1A 3I4NG 4QGUA 2ZJPA 5C3EH 2UU9L 4DR1Q 2R7DA 3PO2G 4UP8A 1OXTA 2AMCB 1KL9A 1YNXA 3J81j 1PH5A 2R92H 4QQBX 4LF7L 1G51A 1GM5A 3RN2A 2ZM6L 4YHHL 1SMXA 5C3EG 4IJHA 1C7YA 1VQPA 1EIFA 1PH3A 2K4KA 1IBLL 2ZJQA 4OX9L 3T1HL 4P71A 2ASBA 5IP9H 4R4QA 4JBKA 1SR3A 1EUJA 2BA1A 4BY7G 2VZAA 1SE8A 4LF9L 4DR4Q 4DV0Q 3KYHC 3J81c 4X65Q 1IYJB 5IP9G 5IT9c 3CC7A 3CCUA 3PUYA 4DV1L 1BVSA 4A3MG 1BKBA 1VQMA 2R7ZH 3GTMH 4UY8C 4BXXH 1VQCA 2K5NA 2A1AA 2BA0A 2YTYA 2GVAA 3A74A 3CW2C 4UP9A 3ULJA 1EWIA 4AIMA 4X62L 4LF4L 4GKKL 1C0AA 4HIDA 2N49A 1PA6A 4BBSH 5IYDH 2R7ZG 1X9NA 4GOPC 1BBWA 1QVGA 1UWVA 1CUKA 3KF6A 1N33Q 2HT1A 3S17H 4BXXG 1JMCA 3KJPA 1P8LA 2MO0A 3T1YL 5IYDG 3NEMA 3RLOA 1A62A 3I2ZA 4X66L 1MJEA 3FP9A 3J80i 1N9WA 3F1ZA 5JJLA 1LYLA 1L1OC 1EIYB 1E7ZA 3FKIH 3PF5A 4JI7Q 4DV5L 1X3GA 2AHOB 1Q12A 3ERSX 4A3EH 1VQJA 1E24A 1Q82C 1PH6A 4LFAL 3RZOH 2VS1A 4LFCL 3S14H 3GTKH 4OONA 2VUMG 2H5XA 2ZTDA 1JT8A 4JI5Q 2NN6G 4C3JH 1RIPA 3FKIG 3TS0A 4HIOA 4DR2Q 3U4ZA 1HNWL 4AQYL 1RL2A 1AE3A 3F2BA 4A3EG 4A3JH 4O0AA 1Y1VH 2GN5A 4A3KH 4JI1L 2E8GA 3DM3A 4GNXA 5M3FH 3J80c 3PUZA 1SFOH 4LF8L 2K14A 2WP8J 3IRBA 3G48A 5IY0A 2JA9A 1TWCH 2UUAQ 4A3JG 5IWAQ 1Y1VG 4JBJA 4DV3L 3OTOQ 4A3KG 1NY4A 2MO1A 5GAEC 1XNQQ 4NXMQ 3JAMc 5M3FG 1HZCA 2PNHA 3CMAA 4QL5A 3KLWA 1AE2A 4LF5Q 1Z9FA 4JV5Q 2K5HA 3I4MH 1Z47A 2PQAB 1FJGQ 3S2DH 1FVIA 2MQHA 4A4IA 2E2HH 2FXQA 2B29A 5HY6A 2VQEQ 1QVFA 4A3GH 3I7FA 1L0WA 5BR8Q 3J7A5 1OXUA 3HOYH 1N36Q 1XNRQ 2WAQG 1NE3A 3I4MG 4P73A 3E9IA 2CWAA 4A3GG 1GD7A 3UDIA 3GTJH 3AFPA 5C0XG 2R93H 3GTLH 1P16A 2RHQB 3CCSA 4LUOA 4JCVE 4GKJQ 3SGIA 2VNUD 2KCMA 1S72A 4LW1A 1X6OA 3CPWA 1Q7YC 3HOYG 5LMNL 4LUVA 3EBEA 2AWOA 3BZCA 4GLAC 4MZ9A 5M5YH 4DV7Q 1YITA 2I5HA 3HKZG 4IPCA 3M85A 4HIKA 4LNQA 2R93G 2WAQE 5IP7H 4YY3L 3DLLA 4B3TL 2ALYB 1G291 2F4VQ 4UPAA 1Q86C 3RZDH 1Q1BA 1PVOA 1D7QA 4R4CA 1E22A 3GD7A 4JI0L 4QIWE 4QJFA 5FJ8H 2JA5H 2JA7H 2CCZA 3HKZE 4IPHA 3F2CA 3F2DA 3HKSA 3TEHB 3G71A 1QUQB 4BBRH 1IZ6A 4X64Q 3GTPH 3E9HA 4DR7L 1JJGA 1B70B 3M4QA 3M9BA 4NPSA 2JA5G 1IXRA 4JI6L 2JA7G 3AEVA 2IY5B 1I5FA 1YHAA 5C44H 1XMQQ 1FGUA 2OQ0A 3OYYA 4EQ5A 3RR5A 1KQSA 1I94Q 4DUYQ 4JI2Q 4BA1I 3UDXA 1PH1A 3MEFA 4BBRG 1I6HH 4X6AH 3CPFA 2Z6KC 4DNIA 4DV4Q 1H95A 3F8TA 5C44G 2A19A 1W2BA 4L5SA 2JE6I 1NTGA 3KDFB 3CCQA 4GOPB 1N34Q 4JI4L 2EXDA 3PIPA 2Q2UA 4NB3A 4KI0A 3G4SA 3EN2A 4NXNQ 3K8AA 3J81i 2IHEA 3GTOH 4PMWA 2UUAL 4AYBG 3AYHB 4HJ9A 1EOVA 1VCIA 3OTOL 3HOXH 1KIXA 1XNQL 2NN6I 4PZ6A 1L1OB 1I50H 1B8AA 1OXSC 1TXYA 1VQHA 1VQGA 1YHBA 4BY7H 2PI2E 3S1RH 1XMOL 4R4TA 1HNXQ 1Q1EA 1JJCB 3HOXG 2NVTH 3L2PA 4A3MH 1XTDA 4EX5A 4JC0A 2VQEL 4DUZQ 3S15H 1HH2P 3L0OA 2VQFQ 1K83H 4L5TA 4AYBE 1UEBA 5AJ3L 4GNXC 2LSSA 1HR0L 1O7IA 3NENA 4A3BH 1N36L 4DR5Q 1N32Q 5JJIA 1FL0A 4AH6A 5J3BA 1V9PA 1VQ4A 1EYGA 2IHFA 3G6EA 3WWVA 1CKNB 4GLXA 1JB7A 3W5OA 2Q2IA 4GKJL 1E3PA 1UE6A 3M7NA 3HOZH 4A3BG 2NVYH 2V1CC 2UXBL 3U4VA 4A3CH 4DV7L 1UE7A 2OQKA 4YCVA 4JI8Q 1K8GA 2Q2HA 3PCOB 2NZOA 4PZ8A 2AWNA 4Y52H 3E0EA 4RMFA 3HOUG 3HOZG 4JBWA 5C0XI 3Q8DA 4XTCS 3S1MH 4A3CG 4KHPQ 1HZ9A 4OO1I 2NVXH 2PQAA 2WB1G 3A5ZB 1HNZQ 4HJAA 5C4JH 4DV6L 2EQSA 3W1BA 3H0GH 4YWKA 2UUBQ 1HZAA 4QY7A 4BY1H 4B3SL 2E5LQ 3JAMi 5IYCH 1V43A 1VQKA 4K0KQ 4OWXB 1TWGH 2UUCQ 2N78A 4IFDJ 1I3QH 2KENA 4X64L 3H0GG 1MJCA 4BY1G 1IBML 1IBKL 2LXKA 1G6PA 4KHZA 3AQQA 3FHWA 5HGQA 5IYCG 1YI2A 1J5EL 2VUMH 3UDFA 4DR3L 1TWHH 3S1NH 4DV2Q 1NMGA 2K75A 2Y0SG 3PGZA 4LF6L 1VS0A 1MIUA 2A8VA 4IFDG 1UE5A 2YYZA 2Z0SA 2K50A 3M4PA 1VQFA 1TWAH 3I4OA 5GROA 4B3ML 2JA6G 1XPUA 2K52A 2JEAI 3TS2A 5E7NA 3STBC 1N34L 3RNUA 2EIFA 4DR1L 4A93H 4GN3B 4P74A 1ASYA 3HOVG 2F52A 2Y0SE 1YZ6A 2OCEA 4OWTB 4JYAQ 3PIOA 4A3DH 1QVCA 3UE1A 1QUQA 2BH8A 4R4IA 1PV4A 4A93G 4JI3Q 1X56A 5K36G 2DUDA 4IO9A 1HNXL 4PG3A 1LTLA 2UU9Q 3CCRA 3PV0A 1XPOA 4A3DG 3CAMA 2VQFL 1K0RA 2B63H 4LF7Q 3PUVA 2KBNA 2ZM6Q 2VY3A 3GDEA 4YHHQ 4POGA 4DR4L 4DV0L 5JEAJ 1XPRA 4X65L 1CKMA 1W3SA 1N32L 4P75A 1JE5A 1IBLQ 5IE8A 3KDFA 4ME3A 4GOPA 2B63G 4GN5A 1EFWA 1E1TA 3ULLA 2GVBA 1CSQA 1VQLA 1IL2A 2JQOA 3BZKA 3ER0A 3EIVA 1K3RA 4LF9Q 5JEAG 3MXNB 4DAMA 4JI8L 1WI5A 4DV1Q 1L1OA 2QA4A 1VQ9A 1N33L 3U50C 2MFIA 1VQEA 1SLJA 4LUZA 1VQBA 4APVA 3CCEA 1QZHA 1A63A 4IOAA 4XIGS 4X62Q 1HNZL 2E2JH 1XJVA 4LF4Q 2UXCQ 1WOCA 3K80C 4OXPA 3M3YH 3CP0A 4A3FH 2UUBL 4JI7L 1S40A 4K0KL 4LFBQ 1PFSA 1PYBA 3JC66 2MNAA 3L7ZC 3T1YQ 1WYDA 4DK3C 3VDYA 1A0IA 4JI5L 4X66Q 3KJOA 3AFQA 3UDGA 3K7UC 4R1JA 4DR2L 4A3FG 3PF4A 4O2DA 1VQNA 1CKNA 3A5UA 4C3IH 1EQQA 3I55A 5C4XH 4DV5Q 2R6GA 3BJUA 3KFUA 1NMFA 1YJWA 1PH9A 1ASZA 5FLXc 2VW9A 4LFCQ 1K73C 1DGSA 1YBYA 2YV5A 5IWAL 2RCNA 4HJ5A 2YTVA 5IYBH 5M5XH 3H3VH 5C4XG 4NXML 1VQDA 3D31A 4IJLA 1E1OA 1GVPA 1A8VA 2CFMA 2HHHQ 3CMEA 1LUZA 4LF5L 1GKHA 2CQOA 2ZTEA 1R9TH 4H02A 4JV5L 4R4OA 2VL6A 1OXVA 5IYBG 1Y1WH 4LF8Q 1FJGL 4L5RC 2BH2A 3PO3H 4IFDI 4JYAL 4DR6Q 3H15A 2IX0A 5BR8L 1KD1C 1OTCA 4JI3L 1XNRL 1Y1WG 1YHQA 3PO3G 3PSIA 5LMNW 1D8LA 2L15A 3CCLA 4A76A 2UXDQ 2LXJA 1VQAA 4YCWA 5ELNA 1GO3E 2D0OA 2IT1A 2XGTA 3D0FA 3OW2A 3HOUH 4WJ4A 5EAYA 3LGJA 2R92G 4DK6C 4J15A 1KHIA 2N8NA 2KCTA 2RF4A 1WFQA 1EQRA 4PZ7A 2NVQH 4ALPA 2F4VL 1PH7A 5GQOA 1T9HA 5LMNQ 2OTLA 4RG1A 3B6YA 2JA8H 1OXXK 2OWOA 3CCVA 2RHSB 1KRTA 5H1SE 3GO5A 4JOIA 2K5VA 4A3IH 1PH8A 1KAWA 3M4OH 4YY3Q 1Y14B 1Q81C 4B3TQ 2UXCL 1KC8C 2JA8G 4GN4B 2Z6KA 4MNOA 1VQOA 2R7FA 4JI0Q 1TWFH 4A3IG 3NELA 5FLMH 1XMQL 2WB1E 2JA6H 5GAGC 2ES2A 3TRZA 4LFBL 3S16H 1I94L 4DUYL 4JI2L 4B3RQ 1VQ6A 1YVCA 4BBSG 4DV4L 1HJPA 1NBWA 1WCMH 4YWMA 4C3HH 4Y7NH 5FLMG 3HOVH 3A0JA 3CCJA 4DR7Q 1J6QA 3RLFA 1VQIA 4KLKA 1N8RC 2HQLA 3KF8B 5GADC 4JI6Q 1KRSA 1U0LA 2JK8A 4LWCA 3BU2A 5LMUQ 1YJ9A 4NXNL 1WCMG 1K9MC 3J7ZC 3CC4A 5DLQE 2ZJRA 1NJIC 1PYSB 1X54A 1YEZA 2F3IA 1PH4A 1SROA 1X65A 2I0QA 4UP7A 3U58A 2HHHL 3CXCA 2ATWA 1B7YB 4JI4Q 4IPDA 4C2MH 1L2FA 2NZHA 3CF5A 3CD6A 1YIJA 2I5MX 1SRUA 4DPGA 1Q46A 1X55A 4IPGA 1HR0W 4JBMA 4OWWB 1QZGA 1Q8KA 4DUZL 4DAYB 2JEBI 4DR6L 1S3OA 3KF6B 2PI2A 2Q2TA 2YTXA 3KOJA 4DR5L 2D0PA 1CKOA 2C35B 2CWPA 3CQZH 5JJKA 1XMOQ 1JJ2A 1CSPA 3RLNA 4OX9Q 3T1HQ 3TREA 2UXDL 5C0XJ 5M5WH 2WFWA 3H3VI 1X3EA 3ICEA 1SN8A 1C9OA 5AJ3Q 2PMZE 1HR0Q 2OTJA 4YCUA 3CCMA 3PUWA 1PH2A 3NBHB 4YWLA 2E2IH 4L5QA 1K8AC 3I56A 4DKAC 2YU9H 4A3LH 3S2HH 4KHPL 4HJ7A 4GKKQ 2N3SA 3S24A 3PUXA 4GNXB 1UE1A 4IOCA 2UXBQ 1V1QA 4P72A 1AH9A 4OO1G 4FDBA 3UE0A 3W1GA 1HZBA 2KHJA 3HFZB 2E5LL 1KXLA 1M1KC 1U5KA 2B3GA 3RN5A 1M90C 2KHIA 4A3LG 3TQYA 2UUCL 3K0XA 4TQUS 3CC2A 2CKZB 2AKWB 1VQ8A 3K81C 4DV6Q 4WJ3M
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HIM A;  5IP7 G;  2QEX A;  3STB D;  4B3S Q;  4HJ8 A;  4DV2 L;  4LFA Q;  4B3R L;  4TVA B;  2XTI A;  4MTN A;  1BBU A;  2DGY A;  3S1Q H;  4GS3 A;  2I5L X;  1LM0 A;  2ZTC A;  1HNW Q;  1VQ5 A;  5FJ8 G;  1IBM Q;  1IBK Q;  4POF A;  3K7A H;  4JOI C;  5M3M H;  4AQY Q;  2HIX A;  1J5E Q;  3HOW H;  2ID0 A;  2JJQ A;  2HIV A;  5LMU L;  4JI1 Q;  4JG2 A;  4DR3 Q;  1WJJ A;  3I4N H;  4LF6 Q;  1PHJ A;  4GLV B;  1MKH A;  5GAH C;  3GTQ H;  3HOW G;  3PO2 H;  3ZJY C;  5M3M G;  1X3F A;  2QGQ A;  4A75 A;  5ELO A;  3ULP A;  4B3M Q;  4BA2 I;  4DV3 Q;  3GTG H;  2D62 A;  1VQ7 A;  1YJN A;  2IX1 A;  3I4N G;  4QGU A;  2ZJP A;  5C3E H;  2UU9 L;  4DR1 Q;  2R7D A;  3PO2 G;  4UP8 A;  1OXT A;  2AMC B;  1KL9 A;  1YNX A;  3J81 j;  1PH5 A;  2R92 H;  4QQB X;  4LF7 L;  1G51 A;  1GM5 A;  3RN2 A;  2ZM6 L;  4YHH L;  1SMX A;  5C3E G;  4IJH A;  1C7Y A;  1VQP A;  1EIF A;  1PH3 A;  2K4K A;  1IBL L;  2ZJQ A;  4OX9 L;  3T1H L;  4P71 A;  2ASB A;  5IP9 H;  4R4Q A;  4JBK A;  1SR3 A;  1EUJ A;  2BA1 A;  4BY7 G;  2VZA A;  1SE8 A;  4LF9 L;  4DR4 Q;  4DV0 Q;  3KYH C;  3J81 c;  4X65 Q;  1IYJ B;  5IP9 G;  5IT9 c;  3CC7 A;  3CCU A;  3PUY A;  4DV1 L;  1BVS A;  4A3M G;  1BKB A;  1VQM A;  2R7Z H;  3GTM H;  4UY8 C;  4BXX H;  1VQC A;  2K5N A;  2A1A A;  2BA0 A;  2YTY A;  2GVA A;  3A74 A;  3CW2 C;  4UP9 A;  3ULJ A;  1EWI A;  4AIM A;  4X62 L;  4LF4 L;  4GKK L;  1C0A A;  4HID A;  2N49 A;  1PA6 A;  4BBS H;  5IYD H;  2R7Z G;  1X9N A;  4GOP C;  1BBW A;  1QVG A;  1UWV A;  1CUK A;  3KF6 A;  1N33 Q;  2HT1 A;  3S17 H;  4BXX G;  1JMC A;  3KJP A;  1P8L A;  2MO0 A;  3T1Y L;  5IYD G;  3NEM A;  3RLO A;  1A62 A;  3I2Z A;  4X66 L;  1MJE A;  3FP9 A;  3J80 i;  1N9W A;  3F1Z A;  5JJL A;  1LYL A;  1L1O C;  1EIY B;  1E7Z A;  3FKI H;  3PF5 A;  4JI7 Q;  4DV5 L;  1X3G A;  2AHO B;  1Q12 A;  3ERS X;  4A3E H;  1VQJ A;  1E24 A;  1Q82 C;  1PH6 A;  4LFA L;  3RZO H;  2VS1 A;  4LFC L;  3S14 H;  3GTK H;  4OON A;  2VUM G;  2H5X A;  2ZTD A;  1JT8 A;  4JI5 Q;  2NN6 G;  4C3J H;  1RIP A;  3FKI G;  3TS0 A;  4HIO A;  4DR2 Q;  3U4Z A;  1HNW L;  4AQY L;  1RL2 A;  1AE3 A;  3F2B A;  4A3E G;  4A3J H;  4O0A A;  1Y1V H;  2GN5 A;  4A3K H;  4JI1 L;  2E8G A;  3DM3 A;  4GNX A;  5M3F H;  3J80 c;  3PUZ A;  1SFO H;  4LF8 L;  2K14 A;  2WP8 J;  3IRB A;  3G48 A;  5IY0 A;  2JA9 A;  1TWC H;  2UUA Q;  4A3J G;  5IWA Q;  1Y1V G;  4JBJ A;  4DV3 L;  3OTO Q;  4A3K G;  1NY4 A;  2MO1 A;  5GAE C;  1XNQ Q;  4NXM Q;  3JAM c;  5M3F G;  1HZC A;  2PNH A;  3CMA A;  4QL5 A;  3KLW A;  1AE2 A;  4LF5 Q;  1Z9F A;  4JV5 Q;  2K5H A;  3I4M H;  1Z47 A;  2PQA B;  1FJG Q;  3S2D H;  1FVI A;  2MQH A;  4A4I A;  2E2H H;  2FXQ A;  2B29 A;  5HY6 A;  2VQE Q;  1QVF A;  4A3G H;  3I7F A;  1L0W A;  5BR8 Q;  3J7A 5;  1OXU A;  3HOY H;  1N36 Q;  1XNR Q;  2WAQ G;  1NE3 A;  3I4M G;  4P73 A;  3E9I A;  2CWA A;  4A3G G;  1GD7 A;  3UDI A;  3GTJ H;  3AFP A;  5C0X G;  2R93 H;  3GTL H;  1P16 A;  2RHQ B;  3CCS A;  4LUO A;  4JCV E;  4GKJ Q;  3SGI A;  2VNU D;  2KCM A;  1S72 A;  4LW1 A;  1X6O A;  3CPW A;  1Q7Y C;  3HOY G;  5LMN L;  4LUV A;  3EBE A;  2AWO A;  3BZC A;  4GLA C;  4MZ9 A;  5M5Y H;  4DV7 Q;  1YIT A;  2I5H A;  3HKZ G;  4IPC A;  3M85 A;  4HIK A;  4LNQ A;  2R93 G;  2WAQ E;  5IP7 H;  4YY3 L;  3DLL A;  4B3T L;  2ALY B;  1G29 1;  2F4V Q;  4UPA A;  1Q86 C;  3RZD H;  1Q1B A;  1PVO A;  1D7Q A;  4R4C A;  1E22 A;  3GD7 A;  4JI0 L;  4QIW E;  4QJF A;  5FJ8 H;  2JA5 H;  2JA7 H;  2CCZ A;  3HKZ E;  4IPH A;  3F2C A;  3F2D A;  3HKS A;  3TEH B;  3G71 A;  1QUQ B;  4BBR H;  1IZ6 A;  4X64 Q;  3GTP H;  3E9H A;  4DR7 L;  1JJG A;  1B70 B;  3M4Q A;  3M9B A;  4NPS A;  2JA5 G;  1IXR A;  4JI6 L;  2JA7 G;  3AEV A;  2IY5 B;  1I5F A;  1YHA A;  5C44 H;  1XMQ Q;  1FGU A;  2OQ0 A;  3OYY A;  4EQ5 A;  3RR5 A;  1KQS A;  1I94 Q;  4DUY Q;  4JI2 Q;  4BA1 I;  3UDX A;  1PH1 A;  3MEF A;  4BBR G;  1I6H H;  4X6A H;  3CPF A;  2Z6K C;  4DNI A;  4DV4 Q;  1H95 A;  3F8T A;  5C44 G;  2A19 A;  1W2B A;  4L5S A;  2JE6 I;  1NTG A;  3KDF B;  3CCQ A;  4GOP B;  1N34 Q;  4JI4 L;  2EXD A;  3PIP A;  2Q2U A;  4NB3 A;  4KI0 A;  3G4S A;  3EN2 A;  4NXN Q;  3K8A A;  3J81 i;  2IHE A;  3GTO H;  4PMW A;  2UUA L;  4AYB G;  3AYH B;  4HJ9 A;  1EOV A;  1VCI A;  3OTO L;  3HOX H;  1KIX A;  1XNQ L;  2NN6 I;  4PZ6 A;  1L1O B;  1I50 H;  1B8A A;  1OXS C;  1TXY A;  1VQH A;  1VQG A;  1YHB A;  4BY7 H;  2PI2 E;  3S1R H;  1XMO L;  4R4T A;  1HNX Q;  1Q1E A;  1JJC B;  3HOX G;  2NVT H;  3L2P A;  4A3M H;  1XTD A;  4EX5 A;  4JC0 A;  2VQE L;  4DUZ Q;  3S15 H;  1HH2 P;  3L0O A;  2VQF Q;  1K83 H;  4L5T A;  4AYB E;  1UEB A;  5AJ3 L;  4GNX C;  2LSS A;  1HR0 L;  1O7I A;  3NEN A;  4A3B H;  1N36 L;  4DR5 Q;  1N32 Q;  5JJI A;  1FL0 A;  4AH6 A;  5J3B A;  1V9P A;  1VQ4 A;  1EYG A;  2IHF A;  3G6E A;  3WWV A;  1CKN B;  4GLX A;  1JB7 A;  3W5O A;  2Q2I A;  4GKJ L;  1E3P A;  1UE6 A;  3M7N A;  3HOZ H;  4A3B G;  2NVY H;  2V1C C;  2UXB L;  3U4V A;  4A3C H;  4DV7 L;  1UE7 A;  2OQK A;  4YCV A;  4JI8 Q;  1K8G A;  2Q2H A;  3PCO B;  2NZO A;  4PZ8 A;  2AWN A;  4Y52 H;  3E0E A;  4RMF A;  3HOU G;  3HOZ G;  4JBW A;  5C0X I;  3Q8D A;  4XTC S;  3S1M H;  4A3C G;  4KHP Q;  1HZ9 A;  4OO1 I;  2NVX H;  2PQA A;  2WB1 G;  3A5Z B;  1HNZ Q;  4HJA A;  5C4J H;  4DV6 L;  2EQS A;  3W1B A;  3H0G H;  4YWK A;  2UUB Q;  1HZA A;  4QY7 A;  4BY1 H;  4B3S L;  2E5L Q;  3JAM i;  5IYC H;  1V43 A;  1VQK A;  4K0K Q;  4OWX B;  1TWG H;  2UUC Q;  2N78 A;  4IFD J;  1I3Q H;  2KEN A;  4X64 L;  3H0G G;  1MJC A;  4BY1 G;  1IBM L;  1IBK L;  2LXK A;  1G6P A;  4KHZ A;  3AQQ A;  3FHW A;  5HGQ A;  5IYC G;  1YI2 A;  1J5E L;  2VUM H;  3UDF A;  4DR3 L;  1TWH H;  3S1N H;  4DV2 Q;  1NMG A;  2K75 A;  2Y0S G;  3PGZ A;  4LF6 L;  1VS0 A;  1MIU A;  2A8V A;  4IFD G;  1UE5 A;  2YYZ A;  2Z0S A;  2K50 A;  3M4P A;  1VQF A;  1TWA H;  3I4O A;  5GRO A;  4B3M L;  2JA6 G;  1XPU A;  2K52 A;  2JEA I;  3TS2 A;  5E7N A;  3STB C;  1N34 L;  3RNU A;  2EIF A;  4DR1 L;  4A93 H;  4GN3 B;  4P74 A;  1ASY A;  3HOV G;  2F52 A;  2Y0S E;  1YZ6 A;  2OCE A;  4OWT B;  4JYA Q;  3PIO A;  4A3D H;  1QVC A;  3UE1 A;  1QUQ A;  2BH8 A;  4R4I A;  1PV4 A;  4A93 G;  4JI3 Q;  1X56 A;  5K36 G;  2DUD A;  4IO9 A;  1HNX L;  4PG3 A;  1LTL A;  2UU9 Q;  3CCR A;  3PV0 A;  1XPO A;  4A3D G;  3CAM A;  2VQF L;  1K0R A;  2B63 H;  4LF7 Q;  3PUV A;  2KBN A;  2ZM6 Q;  2VY3 A;  3GDE A;  4YHH Q;  4POG A;  4DR4 L;  4DV0 L;  5JEA J;  1XPR A;  4X65 L;  1CKM A;  1W3S A;  1N32 L;  4P75 A;  1JE5 A;  1IBL Q;  5IE8 A;  3KDF A;  4ME3 A;  4GOP A;  2B63 G;  4GN5 A;  1EFW A;  1E1T A;  3ULL A;  2GVB A;  1CSQ A;  1VQL A;  1IL2 A;  2JQO A;  3BZK A;  3ER0 A;  3EIV A;  1K3R A;  4LF9 Q;  5JEA G;  3MXN B;  4DAM A;  4JI8 L;  1WI5 A;  4DV1 Q;  1L1O A;  2QA4 A;  1VQ9 A;  1N33 L;  3U50 C;  2MFI A;  1VQE A;  1SLJ A;  4LUZ A;  1VQB A;  4APV A;  3CCE A;  1QZH A;  1A63 A;  4IOA A;  4XIG S;  4X62 Q;  1HNZ L;  2E2J H;  1XJV A;  4LF4 Q;  2UXC Q;  1WOC A;  3K80 C;  4OXP A;  3M3Y H;  3CP0 A;  4A3F H;  2UUB L;  4JI7 L;  1S40 A;  4K0K L;  4LFB Q;  1PFS A;  1PYB A;  3JC6 6;  2MNA A;  3L7Z C;  3T1Y Q;  1WYD A;  4DK3 C;  3VDY A;  1A0I A;  4JI5 L;  4X66 Q;  3KJO A;  3AFQ A;  3UDG A;  3K7U C;  4R1J A;  4DR2 L;  4A3F G;  3PF4 A;  4O2D A;  1VQN A;  1CKN A;  3A5U A;  4C3I H;  1EQQ A;  3I55 A;  5C4X H;  4DV5 Q;  2R6G A;  3BJU A;  3KFU A;  1NMF A;  1YJW A;  1PH9 A;  1ASZ A;  5FLX c;  2VW9 A;  4LFC Q;  1K73 C;  1DGS A;  1YBY A;  2YV5 A;  5IWA L;  2RCN A;  4HJ5 A;  2YTV A;  5IYB H;  5M5X H;  3H3V H;  5C4X G;  4NXM L;  1VQD A;  3D31 A;  4IJL A;  1E1O A;  1GVP A;  1A8V A;  2CFM A;  2HHH Q;  3CME A;  1LUZ A;  4LF5 L;  1GKH A;  2CQO A;  2ZTE A;  1R9T H;  4H02 A;  4JV5 L;  4R4O A;  2VL6 A;  1OXV A;  5IYB G;  1Y1W H;  4LF8 Q;  1FJG L;  4L5R C;  2BH2 A;  3PO3 H;  4IFD I;  4JYA L;  4DR6 Q;  3H15 A;  2IX0 A;  5BR8 L;  1KD1 C;  1OTC A;  4JI3 L;  1XNR L;  1Y1W G;  1YHQ A;  3PO3 G;  3PSI A;  5LMN W;  1D8L A;  2L15 A;  3CCL A;  4A76 A;  2UXD Q;  2LXJ A;  1VQA A;  4YCW A;  5ELN A;  1GO3 E;  2D0O A;  2IT1 A;  2XGT A;  3D0F A;  3OW2 A;  3HOU H;  4WJ4 A;  5EAY A;  3LGJ A;  2R92 G;  4DK6 C;  4J15 A;  1KHI A;  2N8N A;  2KCT A;  2RF4 A;  1WFQ A;  1EQR A;  4PZ7 A;  2NVQ H;  4ALP A;  2F4V L;  1PH7 A;  5GQO A;  1T9H A;  5LMN Q;  2OTL A;  4RG1 A;  3B6Y A;  2JA8 H;  1OXX K;  2OWO A;  3CCV A;  2RHS B;  1KRT A;  5H1S E;  3GO5 A;  4JOI A;  2K5V A;  4A3I H;  1PH8 A;  1KAW A;  3M4O H;  4YY3 Q;  1Y14 B;  1Q81 C;  4B3T Q;  2UXC L;  1KC8 C;  2JA8 G;  4GN4 B;  2Z6K A;  4MNO A;  1VQO A;  2R7F A;  4JI0 Q;  1TWF H;  4A3I G;  3NEL A;  5FLM H;  1XMQ L;  2WB1 E;  2JA6 H;  5GAG C;  2ES2 A;  3TRZ A;  4LFB L;  3S16 H;  1I94 L;  4DUY L;  4JI2 L;  4B3R Q;  1VQ6 A;  1YVC A;  4BBS G;  4DV4 L;  1HJP A;  1NBW A;  1WCM H;  4YWM A;  4C3H H;  4Y7N H;  5FLM G;  3HOV H;  3A0J A;  3CCJ A;  4DR7 Q;  1J6Q A;  3RLF A;  1VQI A;  4KLK A;  1N8R C;  2HQL A;  3KF8 B;  5GAD C;  4JI6 Q;  1KRS A;  1U0L A;  2JK8 A;  4LWC A;  3BU2 A;  5LMU Q;  1YJ9 A;  4NXN L;  1WCM G;  1K9M C;  3J7Z C;  3CC4 A;  5DLQ E;  2ZJR A;  1NJI C;  1PYS B;  1X54 A;  1YEZ A;  2F3I A;  1PH4 A;  1SRO A;  1X65 A;  2I0Q A;  4UP7 A;  3U58 A;  2HHH L;  3CXC A;  2ATW A;  1B7Y B;  4JI4 Q;  4IPD A;  4C2M H;  1L2F A;  2NZH A;  3CF5 A;  3CD6 A;  1YIJ A;  2I5M X;  1SRU A;  4DPG A;  1Q46 A;  1X55 A;  4IPG A;  1HR0 W;  4JBM A;  4OWW B;  1QZG A;  1Q8K A;  4DUZ L;  4DAY B;  2JEB I;  4DR6 L;  1S3O A;  3KF6 B;  2PI2 A;  2Q2T A;  2YTX A;  3KOJ A;  4DR5 L;  2D0P A;  1CKO A;  2C35 B;  2CWP A;  3CQZ H;  5JJK A;  1XMO Q;  1JJ2 A;  1CSP A;  3RLN A;  4OX9 Q;  3T1H Q;  3TRE A;  2UXD L;  5C0X J;  5M5W H;  2WFW A;  3H3V I;  1X3E A;  3ICE A;  1SN8 A;  1C9O A;  5AJ3 Q;  2PMZ E;  1HR0 Q;  2OTJ A;  4YCU A;  3CCM A;  3PUW A;  1PH2 A;  3NBH B;  4YWL A;  2E2I H;  4L5Q A;  1K8A C;  3I56 A;  4DKA C;  2YU9 H;  4A3L H;  3S2H H;  4KHP L;  4HJ7 A;  4GKK Q;  2N3S A;  3S24 A;  3PUX A;  4GNX B;  1UE1 A;  4IOC A;  2UXB Q;  1V1Q A;  4P72 A;  1AH9 A;  4OO1 G;  4FDB A;  3UE0 A;  3W1G A;  1HZB A;  2KHJ A;  3HFZ B;  2E5L L;  1KXL A;  1M1K C;  1U5K A;  2B3G A;  3RN5 A;  1M90 C;  2KHI A;  4A3L G;  3TQY A;  2UUC L;  3K0X A;  4TQU S;  3CC2 A;  2CKZ B;  2AKW B;  1VQ8 A;  3K81 C;  4DV6 Q;  4WJ3 M; 
#chains in the Genus database with same CATH topology
 2F0L A;  3OHX C;  3STB D;  4HJ8 A;  3M7G A;  4DV2 L;  3QR8 A;  4B3R L;  2XTI A;  5KEE A;  2DGY A;  3BYT B;  3S1Q H;  1JWS D;  2ZTC A;  5M3M H;  1EL0 A;  1JC7 A;  1HA5 A;  1RF2 D;  4L63 B;  4JI1 Q;  1PHJ A;  1R9T B;  3PO2 H;  4OL7 A;  2VB3 X;  3ULP A;  2KHS A;  3SDZ A;  3OMG A;  2D62 A;  1YJN A;  4QGU A;  3GTG B;  1SAP A;  2R7D A;  5KGU A;  3J81 j;  1CI3 M;  3VA7 A;  4QQB X;  3M4Y A;  1H9S B;  4QUF A;  4LF7 L;  2R92 B;  3RN2 A;  1FD7 D;  1ESF A;  5C3E G;  4ULL A;  1B4O A;  2K03 A;  1PH3 A;  2ENB A;  3GQB A;  2ASB A;  1JCK B;  1NCV A;  4JBK A;  3V2T A;  4BY7 G;  3A8K E;  2EYO A;  2CH4 W;  2I46 A;  1IYJ B;  5IP9 G;  2EY5 A;  3PUY A;  5FO8 B;  1BVS A;  1AN8 A;  2JA8 B;  1VQC A;  2A1A A;  3EQL C;  4A3I B;  3MXU A;  4OHJ A;  3C3L A;  1HTL D;  1PA6 A;  4DAY A;  2R7Z G;  4GOP C;  4BXX G;  5I6Y A;  1N33 Q;  1DCZ A;  3FMC A;  1TWF B;  1A62 A;  1JIC A;  2K01 A;  4IQZ A;  3S16 B;  1MJE A;  3FP9 A;  5JJL A;  2Z8L A;  2EYF A;  1EIY B;  2NN6 H;  1AZP A;  3FKI H;  2WV6 D;  1A3V A;  2F3W A;  3K6O A;  4DV5 L;  1X3G A;  4A3E H;  3PQI A;  1RTO A;  4LFA L;  3RZO H;  3ITP A;  4TRD A;  3EFX D;  3S14 B;  4C3J H;  2OEO A;  3TP6 A;  2KVM A;  4HIO A;  2I07 B;  1RL2 A;  3HRZ C;  1Y1V H;  3Q0A A;  2LKV A;  1XWE A;  5M3F H;  5IT9 E;  2PMZ B;  1SFO H;  2WP8 J;  3IRB A;  1LT4 D;  2L11 A;  4A3K G;  1NY4 A;  2MO1 A;  4ODG A;  1ICW A;  4QMG A;  3JAM c;  4XQN A;  1HZC A;  2NZ1 D;  3QOL A;  1AE2 A;  1A2T A;  4H44 C;  1Z9F A;  4X3U A;  2SEB D;  1ESR A;  4A3G H;  3I7F A;  2F0S A;  4KD4 A;  1L0W A;  3BVG A;  1EU4 A;  1N36 Q;  2WAQ G;  3I4M G;  4P73 A;  1BOS A;  3HG9 A;  3GTJ H;  3AFP A;  5C0X G;  2PYK A;  2R93 H;  3GTL H;  1P16 A;  3SGI A;  3HOY G;  1S72 A;  4LW1 A;  2YU9 B;  5LMN L;  1W6K A;  5IGG A;  5M5Y H;  4MZ9 A;  2L55 A;  4KD3 A;  4DV7 Q;  2I5H A;  3M85 A;  4QF4 A;  4RHR A;  5IP7 H;  3DLL A;  2HUG A;  4B3T L;  2ALY B;  4L6T B;  1Q3L A;  5ELB A;  5G3L D;  4C56 C;  2F4V Q;  2LFN A;  1E22 A;  3GD7 A;  1H9S A;  5CV5 A;  4QIW E;  2F0O A;  5FJ8 H;  2FHT A;  1BCP D;  3TSS A;  2CCZ A;  3F2C A;  1B3Q A;  3HKS A;  1PRT B;  1LTR D;  2VXW A;  5CV7 A;  3S1Q B;  2JA7 G;  2FIN B;  3AEV A;  1B3A A;  2IY5 B;  1XMQ Q;  1YHA A;  2RKS A;  2NWG A;  4EQ5 A;  4Z9C B;  1ICF B;  5M3M B;  1PMR A;  1F2L A;  1PH1 A;  3MEF A;  4IUV A;  2IWH A;  4BBR G;  1I6H H;  4DV4 Q;  1DOM A;  1H95 A;  5C44 G;  2BCO A;  2L1B A;  1F2Z A;  1STG A;  3PO2 B;  4IUP A;  5CV8 A;  2Q2U A;  3K8A A;  3GTO H;  2IHE A;  2MPM A;  2A6H D;  1ENC A;  1VF5 C;  2F0P A;  2SNS A;  4AYB G;  4HJ9 A;  2LMC B;  3HOX H;  3E5S A;  1HQM C;  3SE0 A;  1VQH A;  2BE5 C;  1JJC B;  1AW7 A;  1K3B C;  4EX5 A;  3T16 A;  4A3M B;  4L5T A;  5I6W A;  4GNX C;  1MSG A;  3VA5 A;  4A3B H;  4WJW A;  5JJI A;  1FL0 A;  2ICE C;  1EY4 A;  1VQ4 A;  2SDF A;  3WWV A;  1CKN B;  4GLX A;  3W5O A;  1UE6 A;  3M7N A;  2EY2 A;  4YIJ A;  2E74 C;  3U4V A;  4K5W A;  1K8G A;  2OQK A;  4JI8 Q;  1HA6 A;  2F0M A;  3PCO B;  4PZ8 A;  3H09 A;  1DM0 B;  5FLX E;  1LTA D;  3HOU G;  5C0X I;  3Q8D A;  1HZ9 A;  4HJA A;  2XNA C;  4DV6 L;  2EQS A;  1TKW B;  2B2T C;  3H3V C;  1E2V A;  2F0N A;  3JAM i;  4NDX A;  4RGM A;  1V43 A;  3FKI B;  4A3E B;  4DF7 A;  3H91 A;  4BY1 G;  4FF2 A;  1BDO A;  1YNN D;  3EVQ A;  1G6P A;  3FHW A;  5HGQ A;  4C3J B;  2XWB B;  5EPK A;  3PGZ A;  1Y1V B;  1D1K A;  2A8V A;  3S1N B;  2YYZ A;  2Z0S A;  5M3F B;  5JPM C;  4N8F A;  5GRO A;  1VQF A;  2JA6 G;  3I4O A;  2VUM G;  2JEA I;  1N34 L;  3RNU A;  3FRP B;  1STA A;  2L12 A;  5KIX A;  3A7L A;  4A3D H;  3MVV A;  1EU3 A;  2WKD A;  1SYD A;  5K36 G;  1CZG A;  1SNO A;  1HNX L;  1F9Q A;  3D4R A;  2RDF A;  3PV0 A;  4QIW B;  3CAM A;  2B63 H;  3LX0 A;  3GTJ B;  2Q8I B;  4POG A;  2R93 B;  3GTL B;  2B2W C;  2E76 C;  2F0H A;  5DM7 3;  3H94 A;  3R2I A;  1B2T A;  4I65 A;  5BN4 A;  1IW7 C;  5IE8 A;  1B1Z A;  3DM1 A;  4IUU A;  2LS0 1;  3VR4 A;  3ER0 A;  3EIV A;  3F2U A;  4LF9 Q;  3HGB A;  4PQX A;  1WI5 A;  1N33 L;  4QB4 A;  4PV1 C;  3U50 C;  1SLJ A;  3NTI A;  1Y8O B;  1SSO A;  1FNU A;  3CCE A;  1A63 A;  1QZH A;  4P2C B;  4DGZ A;  4X62 Q;  1HNZ L;  2E2J H;  4LF4 Q;  2UXC Q;  4G7O C;  3T1Y Q;  4OEL B;  1JWM D;  4DK3 C;  3VDY A;  4FO2 A;  4X66 Q;  3UDG A;  2AQ1 B;  2E75 C;  2QKI C;  4A3F G;  3PF4 A;  1CKN A;  4C3I H;  3BJU A;  2KCN A;  2KOL A;  3R3O A;  2PPB C;  1NMF A;  3T4A C;  5CV6 A;  3RMH A;  2N88 A;  3GTO B;  2YTV A;  5M5X H;  3H3V H;  1SJH D;  1VQD A;  1E1O A;  2CFM A;  1A8V A;  2HHH Q;  3HOX B;  3TP7 A;  1CT1 D;  3E0J A;  1GJX A;  1STE A;  1XX8 A;  4R4O A;  4R9W A;  4L5R C;  3PO3 H;  1D6E C;  4C1N I;  1H9R A;  1WTP A;  1U4L A;  1OTC A;  2IPK D;  1BO0 A;  1Y1W G;  2B8G A;  4A3B B;  1I4Q A;  3DXJ C;  5LMN W;  3CCL A;  2LXJ A;  1VMP A;  1VQA A;  2RBM A;  3OW2 A;  1GO3 E;  2XGT A;  4WJ4 A;  1U4R A;  2PNR C;  2ZXP A;  4DK6 C;  3NTH A;  2KCT A;  2WB1 B;  1WFQ A;  1EQR A;  4PZ7 A;  2NVQ H;  4ALP A;  2F4V L;  1PFN A;  2A68 C;  2FJ2 A;  3ERO A;  2F0E A;  4FP5 D;  1KRT A;  4XYO A;  3MHB A;  1KAW A;  3M4O H;  3K0Y A;  2XN9 C;  4O1N A;  1IYU A;  4HMI A;  4MNO A;  1VQO A;  3WDN A;  1QG7 A;  2R7F A;  4DA2 A;  1FR3 A;  1XMQ L;  1EY0 A;  5GAG C;  2ES2 A;  1E2Z A;  3TRZ A;  3LNN A;  4ABN A;  4B3R Q;  1YVC A;  4DV4 L;  1HJP A;  1WCM H;  4C3H H;  4Y7N H;  3KF8 B;  4JI6 Q;  3HOV B;  2JK8 A;  4LWC A;  4ZUI A;  5IGF A;  1YJ9 A;  1G2T A;  1I4R A;  3NBH A;  4WFN 3;  3J7Z C;  2ZJR A;  3C1E A;  4KN4 C;  2F3I A;  1PH4 A;  2I0Q A;  1X65 A;  3U58 A;  3CXC A;  2XRS D;  2A69 C;  4A3D B;  3CD6 A;  1SRU A;  3NHH A;  4DPG A;  1KNA A;  1X55 A;  3I73 A;  4IPG A;  3TP5 A;  1Q8K A;  4EGV A;  2F3V A;  1EY5 A;  3AMU A;  2B63 B;  1KAB A;  3KOJ A;  5LL6 S;  5G3L F;  5JJK A;  1XMO Q;  5IOD A;  2K6A A;  2UXD L;  5KYI A;  5M5W H;  1X3E A;  1EYA A;  1SN8 A;  1BCP F;  5EKL A;  3CHB D;  1C9O A;  1LO5 D;  1I4G A;  1HR0 Q;  4YCU A;  3CCM A;  3PUW A;  1PH2 A;  1QJO A;  3SK5 A;  4OO1 H;  4KY6 A;  4E6I A;  5FO9 B;  4GNX B;  2UXB Q;  1V1Q A;  2HQE A;  4FDB A;  3VYR A;  2E2J B;  1HZB A;  3HFZ B;  3NQT A;  5A2Q E;  3MXG A;  1KXL A;  3RN5 A;  1BQQ T;  4A3L G;  1U4M A;  1SNM A;  1QCB D;  4IUN A;  5CGK A;  2AKW B;  1VQ8 A;  3MFY A;  4IUQ A;  4WJ3 M;  4KK7 A;  4HIM A;  3D4D A;  5IP7 G;  2KJX A;  4B3S Q;  1STH A;  4IZ8 A;  4C3I B;  4LFA Q;  5I2Y A;  3VYS A;  1F2M A;  1LM0 A;  4N8X 1;  3QO2 A;  5FJ8 G;  2OF1 A;  1CM9 A;  2HIX A;  4HSP A;  2AQ3 B;  2HIV A;  5LMU L;  5M5X B;  4DR3 Q;  1WJJ A;  4J8Q A;  4LF6 Q;  3T56 B;  1MKH A;  1UNS A;  2EPB A;  3HOW G;  2K5D A;  3ZJY C;  1X3F A;  2F1M A;  2QDB A;  4CJ1 B;  3GTG H;  3PO3 B;  4QUC A;  1K0S A;  3I4N G;  4CJ0 B;  1A3T A;  2KEE A;  2R92 H;  1PH5 A;  1AP0 A;  4MTK A;  1G51 A;  1GM5 A;  1L0Y B;  2M00 A;  1EIF A;  4OX9 L;  2ZJQ A;  3KF8 A;  3T1H L;  1PFM A;  3Q6S A;  4CHT B;  1SR3 A;  2FMM A;  2NVQ B;  1PRT C;  2NTT A;  4LF9 L;  4K2L A;  4DR4 Q;  3K5M A;  3KYH C;  4CKE A;  1VQM A;  3CC7 A;  3MA2 B;  3GV6 A;  1BKB A;  2K5N A;  2R7Z B;  1D1I A;  2NYZ D;  2GVA A;  4UP9 A;  4AIM A;  5IT9 L;  4X62 L;  5T1G A;  4LF4 L;  1C0A A;  4HID A;  3C2P A;  5IGC A;  1X9N A;  5FO7 B;  4BBS B;  2R61 A;  2HT1 A;  4LJZ C;  4KKU A;  1JMC A;  4DXG A;  2MO0 A;  3T1Y L;  5IYD G;  4K5V A;  4X66 L;  3GP7 A;  2BOS A;  4C3H B;  4Y7N B;  4JI7 Q;  1Q82 C;  1VQJ A;  4DU9 A;  3S14 H;  4CJ2 C;  4OON A;  2H5X A;  1JR0 D;  2KCC A;  4JI5 Q;  1G91 A;  1RIP A;  4DR2 Q;  3J7Y W;  4AQY L;  4CDE C;  4A3J H;  4O0A A;  3R8B A;  3VR3 A;  4GNX A;  4FF4 A;  4MHE A;  2G9H D;  4KHV A;  5IY0 A;  5C4Z A;  3R93 A;  4O42 A;  5IWA Q;  4JBJ A;  1NAP A;  4DV3 L;  3RD4 A;  2L4N A;  4XQQ A;  1XYI A;  5FKA C;  1SJE D;  4LF5 Q;  4JV5 Q;  1PTO D;  2K5H A;  3O13 A;  1FVI A;  2B29 A;  1OXU A;  3NTK A;  1A2U A;  5ELD A;  4RKL A;  1XNR Q;  2MUY A;  3E9I A;  3QJY A;  4FF1 A;  2CWA A;  3HOY B;  4B9X A;  4Q5V A;  1WTQ A;  4JK1 C;  3KUP A;  4H7B A;  2KCM A;  1X6O A;  1Q7Y C;  3EBE A;  4GLA C;  3HKZ G;  1B50 A;  5JVG 3;  4LNQ A;  3MFG A;  1G29 1;  4HAE A;  3RZD H;  1WTV A;  1F9S A;  1RD9 D;  1FNW A;  1GUW A;  1CFM A;  2RCF A;  1QUQ B;  3VR6 A;  4IUT A;  4WOR A;  1JJG A;  2JA5 G;  3M9B A;  4NPS A;  4JI6 L;  4BBR B;  3CRL C;  3OYY A;  4G7H C;  2WII B;  3NK9 A;  4DUY Q;  4BA1 I;  1S5B D;  1KLU D;  3SEB A;  5ELF A;  1Q8I A;  3A56 A;  2A19 A;  3K5O A;  1W2B A;  2JE6 I;  1NTG A;  1EFI D;  3L9A X;  3CCQ A;  1N34 Q;  3PIP A;  1K8M A;  2B2W A;  5CBA E;  3G4S A;  3EN2 A;  1FNV A;  5EQ0 A;  1QWY A;  4PMW A;  2UUA L;  3OTO L;  1XNQ L;  4HN7 A;  1I50 H;  5BN5 A;  1TXY A;  1NSN S;  1R4P B;  2PI2 E;  1XMO L;  2QIL A;  1HNX Q;  1FYC A;  4A3M H;  4JC0 A;  2VQE L;  1BR9 A;  1HH2 P;  3L0O A;  5J39 A;  1UEB A;  2LSS A;  1HR0 L;  4CKB A;  3NEN A;  5JJZ A;  4DR5 Q;  5EJW A;  4PNY A;  5J3B A;  4DNT B;  2IHF A;  2RDH A;  2Q2I A;  4FVM A;  2V1C C;  2UXB L;  4A3C H;  1K8O A;  4FXD A;  1UE7 A;  4J1M A;  1SYC A;  1CHP D;  2NBF A;  4RMF A;  2XWJ B;  3HOZ G;  4XDX A;  3S1M H;  1HCZ A;  4KHP Q;  1MHW C;  1HNZ Q;  2F0Q A;  5C4J H;  1UUP A;  3W1B A;  3H0G H;  4YWK A;  2NVX B;  1HZA A;  4B3S L;  4V0B A;  2E5L Q;  1G2S A;  2RSO A;  1C8C A;  4BY1 B;  4OWX B;  1TWG H;  1HQR D;  1RJT A;  2UUC Q;  5COR A;  1MSH A;  4FYD A;  2CW0 C;  4IFD H;  2LXK A;  3AQQ A;  3MZ5 A;  5HGT A;  5IYC G;  4X3T A;  4F88 A;  1F2Y A;  3UDF A;  4DR3 L;  1TWH H;  1E2W A;  2A5H A;  2TMP A;  4A3J B;  4LF6 L;  3S1N H;  1MIU A;  3K5L A;  2B39 A;  4DFA A;  1TWA H;  2K52 A;  2OXP A;  3STB C;  2F0F A;  1RCV D;  1XTC D;  3P75 A;  4A93 H;  1SYB A;  2Y0S E;  1YZ6 A;  3KLS X;  2Q8R E;  1EYC A;  2B2V A;  3UE1 A;  1QUQ A;  4RGO S;  1PV4 A;  1TS3 A;  2HCI A;  2DUD A;  1HFN A;  1B53 A;  1LTL A;  4IUR A;  1IYV A;  1ONL A;  3Q22 A;  5D3I B;  3I4L A;  2ZM6 Q;  2VY3 A;  3GDE A;  2J0T D;  2QEJ C;  2K33 A;  4DR4 L;  1XPR A;  5JEA J;  1N32 L;  3IFT A;  4ME3 A;  2EYJ A;  1E1T A;  2GVB A;  3TN2 A;  2JQO A;  4ZLT F;  1IL2 A;  1LTB D;  3BZK A;  4KTA A;  1K3R A;  2PZU A;  4DAM A;  4DV1 Q;  3RZD B;  2K05 A;  3DUZ A;  1UAP A;  1VQB A;  3HP3 A;  1D5M C;  3K5N A;  1PZI D;  3BG3 A;  3DEO A;  4OXP A;  3M3Y H;  4JI7 L;  3AB9 A;  2AUK A;  5EKI A;  1S40 A;  1PDQ A;  1GXD C;  4V19 0;  3DWA A;  3KBX A;  2MNA A;  4JI5 L;  3KJO A;  1Z7T A;  4DR2 L;  5C3W A;  4KN7 C;  4FXK C;  1VQN A;  5C4X H;  2MP1 A;  3KFU A;  1YJW A;  2VW9 A;  1YBY A;  3G6J B;  5IWA L;  1WTR A;  3A7A B;  4IJL A;  1S5D D;  1SNC A;  3CME A;  3PIO 3;  4OEM B;  1I50 B;  4XT1 B;  2PQE A;  4LF5 L;  2K28 A;  4H02 A;  2F0T A;  4JV5 L;  1ZYR D;  5IYB G;  4LF8 Q;  2BH2 A;  3H15 A;  2QF7 A;  4JI3 L;  2EY6 A;  2EY1 A;  2DNE A;  1XNR L;  1S5E D;  5E3F A;  2L15 A;  4A76 A;  2UXD Q;  5F2D A;  1K28 A;  3C1F A;  2K7V A;  5EAY A;  1O7Y A;  3EA6 A;  2R92 G;  1KHI A;  3LWU A;  3K57 A;  2RF4 A;  2L5T A;  2IX3 A;  2AUJ D;  4KJN A;  5KYL A;  2OTL A;  2EJF C;  3S1M B;  1EIG A;  3B6Y A;  2F0J A;  2N55 A;  4XT3 B;  2OWO A;  2RHS B;  4IAL A;  5C4J B;  3A8J E;  1ENF A;  1PH8 A;  3H0G B;  2ICI A;  5COY A;  1RTN A;  4YY3 Q;  1Q81 C;  1SXT A;  2JA8 G;  1TWG B;  4GN4 B;  1KDB A;  4HCE A;  1GUN A;  2Y0S B;  4JI0 Q;  4A3I G;  2WB1 E;  4KV6 A;  1EWH A;  2MGS A;  4LFB L;  4DUY L;  2EOT A;  3D4W A;  4ZAI A;  2F0V A;  1VQ6 A;  1TWH B;  4YWM A;  1PXU A;  5FLM G;  3HOV H;  1GOZ A;  4DR7 Q;  4KLK A;  1N8R C;  4ME5 A;  1TU2 B;  5KNC A;  2HQL A;  3FPP A;  1PTO F;  1BCP C;  1TWA B;  5GAD C;  5LMU Q;  1G6Z A;  1WTX A;  4OIJ A;  2FFK B;  4HR7 B;  4G7Z C;  2DNC A;  3NQI A;  1O7Z A;  3HEJ A;  4A93 B;  1SRO A;  1B7Y B;  3FEW X;  4IPD A;  1LTS D;  4C2M H;  2PW7 A;  4FF3 A;  1HR0 W;  2F03 A;  4I7A A;  1QZG A;  1IL8 A;  2CH4 A;  3P7J A;  3KF6 B;  2PI2 A;  4PMC A;  2Q2T A;  4JVZ A;  5J22 A;  4DR5 L;  4RFB A;  3T13 A;  2D5D A;  3CQZ H;  2CWP A;  1JJ2 A;  2A6H C;  3RLN A;  3BDC A;  5JEA H;  4OX9 Q;  3T1H Q;  3MEH A;  5C0X J;  1GHJ A;  1TY0 A;  4CKC A;  5AJ3 Q;  3J7A V;  5I4D A;  3NBH B;  1JOK A;  4XQJ A;  4RKB A;  2E2I H;  1K8A C;  3FVQ A;  4KHP L;  4F8M A;  3T51 B;  2N3S A;  3OWE B;  3PUX A;  5AFW A;  1UE1 A;  1AH9 A;  4UDU C;  2KHJ A;  2E5L L;  4ZCK A;  3M3Y B;  1M1K C;  1U5K A;  3OSO A;  1M90 C;  1JWU D;  2UUC L;  1L0X B;  1SYG A;  3MXP A;  2CKZ B;  5TSS A;  2GA4 B;  1JOQ A;  2QDL A;  2QEX A;  3TME A;  1EZ6 A;  1EYD A;  1ZXT A;  4CDC C;  5I9O A;  3Q23 A;  1PZK D;  5C4X B;  1ET9 A;  3P20 A;  1WTW A;  1SMY D;  2C9O A;  2L9H A;  1IBK Q;  4AQY Q;  1YNJ D;  1X3P A;  4JOI C;  1J5E Q;  3SK6 A;  1KNE A;  2ID0 A;  2JJQ A;  1I6V C;  3K7A B;  4JG2 A;  2A6E D;  4GLV B;  4K8J A;  5EKK A;  2Z1C A;  3I4N B;  3MAQ A;  2DY7 A;  2SNM A;  1YNN C;  5M3M G;  2QGQ A;  4BA2 I;  5ELO A;  1HFG A;  4B3M Q;  5FOB B;  4DV3 Q;  2IX1 A;  5C3E H;  2O4X A;  3PO2 G;  4UP8 A;  2XVS A;  2AMC B;  1KL9 A;  1YNX A;  1SYF A;  1A15 A;  2O5J C;  2Z6B A;  2ZM6 L;  1Y8N B;  4RH6 A;  1KAA A;  5NUC A;  2JYO A;  1C7Y A;  1VQP A;  1Z6H A;  2RVL A;  4P71 A;  4X3K A;  4XXE A;  5IP9 H;  4R4Q A;  1EY6 A;  2BA1 A;  2RA4 A;  5E4W C;  2B2V C;  4DV0 Q;  4X65 Q;  5IT9 c;  4DV1 L;  4A3M G;  2R7Z H;  3GTM H;  4UY8 C;  1RDP D;  5C3X A;  4HCS A;  4BXX H;  1OO9 B;  2BA0 A;  1HTP A;  2YTY A;  3CW2 C;  2F0U A;  3ULJ A;  1EWI A;  3J81 L;  3E3X A;  1HPC A;  4GKK L;  4BBS H;  3K59 A;  2KQ3 A;  1AEX A;  2EYP A;  1UWV A;  3KF6 A;  3S17 H;  1S5C D;  2V4D A;  2LY7 A;  3NEM A;  5C6A A;  2KA7 A;  3RLO A;  1V8Q A;  3J80 i;  1N9W A;  3F1Z A;  1LYL A;  1E7Z A;  5DAU A;  1KDC A;  4K2K A;  1WD0 A;  3BDL A;  1Q12 A;  3ERS X;  4HMJ A;  1PH6 A;  1E24 A;  3GTK H;  3WOE A;  1JT8 A;  2ZTD A;  2NN6 G;  3FKI G;  3TS0 A;  1HNW L;  4QCL A;  3U4Z A;  2H4O A;  5CR3 A;  1AE3 A;  3F2B A;  4A3E G;  1V1O A;  1HHV A;  4A3K H;  3I3C A;  2E8G A;  3DM3 A;  3W3A A;  4C3J G;  2R3Z A;  4C2M B;  2PZT A;  1BNZ A;  4LF8 L;  2UUA Q;  1TVX A;  2JA9 A;  1TWC H;  5M9O A;  1Y1V G;  3OTO Q;  1XNQ Q;  2CQA A;  5GAE C;  5M3F G;  3J80 L;  3KBG A;  3I4M H;  3OIP A;  3CQZ B;  1FJG Q;  1G8Z D;  1QVF A;  2VQE Q;  5HY6 A;  5C0X H;  2XSC A;  4N9P A;  5BR8 Q;  3J7A 5;  3HOY H;  5ISR A;  1CQV A;  1NE3 A;  4A3G G;  1GD7 A;  3KLS A;  2E2I B;  3CCS A;  2Z4I A;  4DK0 A;  2VNU D;  3BZC A;  4IPC A;  1STB A;  2R93 G;  4RGN A;  2WAQ E;  1TT2 A;  1B9N A;  4YY3 L;  3D6C A;  4UPA A;  1Q1B A;  4CDD C;  4JI0 L;  3JAM E;  4QJF A;  1EOT A;  1STY A;  1VMC A;  4EQO A;  2JA7 H;  3ND8 A;  3BYY B;  2JA5 B;  3TEH B;  4BBR H;  1IZ6 A;  3GTP H;  4DR7 L;  3E9H A;  3M4Q A;  1IXR A;  5C44 H;  2OQ0 A;  3RR5 A;  1I94 Q;  1QB5 D;  3CPF A;  5LHY 1;  3I72 A;  4DNI A;  2PW5 A;  1NR4 A;  4L5S A;  2HDL A;  4U67 3;  4G57 A;  2VB2 X;  4KI0 A;  4NXN Q;  4DAP A;  5C3E B;  1H9J A;  4IN3 A;  1VCI A;  4RA8 A;  1KIX A;  2NN6 I;  4PZ6 A;  1L1O B;  1OXS C;  1TII D;  5EPJ A;  1BCP B;  1VQG A;  4BY7 B;  3HOX G;  1XTD A;  3S15 H;  2NVT B;  3HS0 C;  1EQV A;  4AYB E;  5AJ3 L;  5EGT A;  2F4I A;  1N32 Q;  3LWE A;  1V9P A;  4C1N K;  1EYG A;  3DMU A;  5E4X A;  3GTM B;  4GKJ L;  5IGB A;  1JB7 A;  1LAC A;  1E3P A;  4A3B G;  2DJG C;  2NVY H;  3BZD B;  4F7X A;  2DY8 A;  3K58 A;  4Y52 H;  4L8J A;  3E0E A;  3S17 B;  4JBW A;  2EE1 A;  3ERQ A;  2NVX H;  1I4X A;  2WB1 G;  3A5Z B;  4BY1 H;  4QY7 A;  1ET6 A;  1VQK A;  1SNQ A;  1LAB A;  2N78 A;  4IFD J;  5HUR A;  1I3Q H;  3QB3 A;  2KEN A;  4X64 L;  1DOK A;  1MJC A;  3GTK B;  1IBK L;  5EBC A;  2QW7 A;  1J5E L;  2VUM H;  1YI2 A;  4RCO A;  4A3K B;  1EY9 A;  3U9O A;  2K50 A;  1B44 D;  1XPU A;  4B3M L;  3TS2 A;  1KTK A;  4UHV A;  1TWC B;  3IKJ A;  3TP8 A;  2EIF A;  5DNF A;  3TBI B;  3P1H A;  1ASY A;  3HOV G;  2F52 A;  5K36 H;  4JPB W;  1LT3 D;  5IIF A;  2WAQ B;  3I4M B;  2BH8 A;  4TKO B;  4JI3 Q;  4IO9 A;  1MGS A;  2UU9 Q;  1PLF A;  3CCR A;  4A3D G;  1GUG A;  2VQF L;  1HUN A;  1F9R A;  3VYU A;  3PUV A;  2KBN A;  1BF4 A;  4YHH Q;  5D65 A;  2F0I A;  5EBD A;  4DV0 L;  4X65 L;  1W3S A;  1WTH A;  1ILP A;  4P75 A;  1IBL Q;  1NR2 A;  2B63 G;  4GN5 A;  3NXW A;  1CTM A;  5JEA G;  1VDZ A;  1VQ9 A;  1L1O A;  2QA4 A;  5CBE E;  2NTS A;  2MFI A;  1VQE A;  4OIK A;  3G7L A;  4RWS C;  4LUZ A;  2JA7 B;  4IOA A;  4XIG S;  1MBY A;  5LL6 X;  1D5Z C;  1XJV A;  4A3F H;  2UUB L;  2MHV A;  3GTP B;  1E0B A;  4K0K L;  3MTS A;  4LFB Q;  1PFS A;  3JC6 6;  5C44 B;  3L7Z C;  2CVR A;  5JVH 3;  2EJG C;  3A5U A;  2B8F A;  4EQP A;  1EQQ A;  3SVM A;  4AYB B;  4LFC Q;  1PH9 A;  5I9P A;  1DD2 A;  2F0G A;  3OW7 A;  3BDO A;  1EEI D;  1WVL A;  4C3I G;  3IAY A;  4DNR B;  3SK8 A;  1GVP A;  5FLX L;  4RGT A;  3OOC A;  3OWF A;  1GKH A;  2ZTE A;  5KNB A;  4JW0 A;  1OXV A;  4FNF A;  5DEH A;  1Y1W H;  1FJG L;  3KK7 A;  4JYA L;  2JXM B;  2IX0 A;  5BR8 L;  3S15 B;  1KD1 C;  4I7Z C;  1JQY D;  5KRU A;  1DON A;  1YHQ A;  3PO3 G;  3PSI A;  4KKT A;  4K6L A;  4YCW A;  3QG1 A;  5ELN A;  1BBX C;  2D0O A;  2IT1 A;  2X69 A;  3D0F A;  3LGJ A;  4HSV A;  1C4Q A;  3HOU B;  2XRQ D;  2NVY B;  4J15 A;  1PTO C;  1SEB D;  3CRK C;  1SYE A;  3A55 A;  5EPL A;  3I8Z A;  1PH7 A;  2X6L A;  5GQO A;  4RG1 A;  1OXX K;  3C46 A;  2F0W A;  3GO5 A;  4JOI A;  2DN8 A;  2CHB D;  2QCP X;  1Y14 B;  4U68 A;  1EY7 A;  2Z6K A;  3URY A;  3NSW A;  3OIQ A;  3WOF A;  5JPN C;  1I3Q B;  3NEL A;  2B2Y A;  2JA6 B;  2VUM B;  1I94 L;  4BBS G;  1NBW A;  1KLG D;  3CCJ A;  1J6Q A;  3RLF A;  1O80 A;  2TSS A;  1KRS A;  4NXN L;  4M1U B;  1WCM G;  2BE5 D;  4C3H G;  1K9M C;  2H1E A;  1NJI C;  1PRT F;  1PYS B;  3X3M A;  4N9T A;  4UP7 A;  1TR5 A;  3D6W A;  1T5E A;  2B2U C;  3NBI A;  2ATW A;  4JI4 Q;  3CF5 A;  1QE6 A;  1ILQ A;  5I2X A;  3NUC A;  5C5M A;  4JBM A;  5C5L A;  4NMZ A;  2JEB I;  3IL8 A;  2K32 A;  4NW2 A;  4DR6 L;  1S3O A;  5BN3 A;  1QNK A;  4OGQ C;  1GUS A;  1CA6 A;  2NB0 A;  1DJR D;  2BDO A;  1CKO A;  1CSP A;  4ILW A;  3TRE A;  2Z4H A;  3NPP A;  3H3V I;  2P5Z X;  2MJ8 A;  1CZW A;  5JOB A;  2OTJ A;  3W2D A;  4ZQ3 A;  4YWL A;  5FK9 C;  5CV4 A;  4L5Q A;  3I90 A;  3I56 A;  3IFD A;  3R2T A;  3SHL A;  2C5C A;  4A3L H;  4GKK Q;  3S2H B;  4P72 A;  4OO1 G;  3W1G A;  1ROD A;  4A3F B;  2J7Z A;  3TQY A;  3K0X A;  1J9O A;  4WRD A;  2OT2 A;  3K81 C;  3NWT A;  1PTO H;  2IJ0 A;  1EWC A;  1GHK A;  1SE4 A;  1RKN A;  3OPO A;  1D2B A;  4MN3 A;  4TVA B;  4MTN A;  1BBU A;  2F0D A;  4GS3 A;  2I5L X;  2J4X A;  3SXH A;  1VQ5 A;  1HNW Q;  1IBM Q;  3HOW H;  4POF A;  1CHQ D;  3K7A H;  4XYQ A;  1H9M A;  3T53 B;  1LV9 A;  1EEF D;  1IHZ A;  3I4N H;  1U9R A;  5GAH C;  3GTQ H;  2BDN A;  4RAU C;  4A75 A;  1CQF A;  1O78 A;  1Y1W B;  1VQ7 A;  2ZJP A;  1Q90 A;  3ONA B;  2UU9 L;  4DR1 Q;  1OXT A;  1IW7 D;  3Q24 A;  5T1I A;  1SMX A;  4YHH L;  1M8A A;  3H6M A;  4LMQ D;  4K5X A;  1I4P A;  4IJH A;  4EVO A;  3J7A F;  2K4K A;  1IBL L;  4HTH A;  3QWN A;  1EUJ A;  2VZA A;  1SE8 A;  3J81 c;  3CCU A;  4G4K A;  2G9D A;  3VR5 A;  3VYT A;  3A74 A;  4Q0F A;  5IYD H;  3PMF A;  2N49 A;  3OMC A;  4ZYS A;  1QVG A;  1BBW A;  3DEP A;  1CUK A;  3NWS A;  3KJP A;  1P8L A;  3I2Z A;  2Z9H A;  1KDA A;  4ID6 A;  1L1O C;  3PF5 A;  5E1F A;  2AHO B;  1X32 A;  4OO1 I;  2VS1 A;  4LFC L;  2WIN B;  5CC4 A;  3MC0 B;  3RZO B;  3FDT A;  5D3D A;  2GN5 A;  4F87 A;  2K1B A;  4JI1 L;  5IGE A;  1II3 A;  2HDM A;  2EYM A;  4RHS A;  3J80 c;  3PUZ A;  1S4Z A;  2K14 A;  1LTT D;  3G48 A;  4LK1 C;  4A3J G;  4KY5 A;  1SFO B;  5A2Q L;  4NXM Q;  2PNH A;  4CDF C;  2PO4 A;  4QL5 A;  3CMA A;  1HRJ A;  3KLW A;  3A54 A;  4EQN A;  2RSN A;  3S2D H;  1Z47 A;  2PQA B;  3JAM L;  2MQH A;  4A4I A;  2E2H H;  2FXQ A;  4A3G B;  4NKL A;  5CYU A;  1HUM A;  2A68 D;  2G5D A;  4GZY C;  1ZYR C;  3E6Z X;  1AFP A;  3UDI A;  2X6G A;  3NE5 B;  4R8N A;  4KKS A;  1LT6 D;  3ZYY X;  2RHQ B;  4LUO A;  3DWQ A;  3EJI A;  4JCV E;  4GKJ Q;  5D14 A;  3CPW A;  4PMB A;  4LUV A;  2AWO A;  3TZD A;  1YIT A;  4HIK A;  4NP5 A;  3GV3 A;  5M5Y B;  1BUV T;  1NNX A;  2Q8T A;  1Q86 C;  2WKC A;  1PVO A;  1D7Q A;  4R4C A;  1LT5 D;  2D9U A;  2F0K A;  2JA5 H;  1PTO B;  3HKZ E;  4IPH A;  4S3S A;  2WAC A;  3F2D A;  4DXF A;  3G71 A;  5ELC A;  4X64 Q;  1B70 B;  1JOR A;  1TS4 A;  1I5F A;  1TQO A;  1FGU A;  3HOW B;  1SE3 A;  1SDF A;  1KQS A;  1IKM A;  1GUT A;  2A69 D;  4JI2 Q;  3UDX A;  4X6A H;  2Z6K C;  2A73 B;  5A35 A;  5C4H A;  1I6H B;  4RCN A;  3F8T A;  2B2Y C;  3GTQ B;  2KEC A;  3KDF B;  5L37 A;  4GOP B;  4JI4 L;  2EXD A;  3MWY W;  4NB3 A;  3J81 i;  3AYH B;  1EOV A;  1MI2 A;  1M4V A;  1B8A A;  1U4P A;  1YHB A;  4BY7 H;  3S1R H;  1JE4 A;  4R4T A;  1Q1E A;  4M8A A;  2NVT H;  3L2P A;  5KND A;  3FPU B;  4DUZ Q;  2VQF Q;  1K83 H;  3A8I E;  1O7I A;  1N36 L;  1JB3 A;  4AH6 A;  1DXM A;  2M2L A;  2JSO A;  3G6E A;  1ZKO A;  5IGD A;  3HOZ H;  5CV9 A;  4DV7 L;  3NP8 A;  3DWP A;  4YCV A;  3V96 A;  4R8I A;  2Q2H A;  2NZO A;  2AWN A;  4XTC S;  4A3C G;  1EQT A;  2PQA A;  2K5Q A;  3BS1 A;  2UUB Q;  1H9K A;  1IKL A;  5IYC H;  4K0K Q;  1O7L A;  1QIL A;  1EIH A;  2NUC A;  2XIW A;  4ZKB B;  2EYL A;  3H0G G;  1TS5 A;  3VR2 A;  1IBM L;  1STN A;  4KHZ A;  3BVM A;  1ENA A;  3I70 A;  1D5X C;  2PZW A;  2K04 A;  1XXG A;  1NMG A;  2K75 A;  2Y0S G;  4DV2 Q;  1VS0 A;  1RHP A;  4IFD G;  1UE5 A;  3PIP 3;  1SBB B;  3D8G A;  1GUO A;  3M4P A;  5JAV A;  1V1P B;  1QNU A;  1CA5 A;  5E7N A;  2O2L D;  2EVB A;  2AQ2 B;  4DR1 L;  2K5W A;  1ZEQ X;  1SMY C;  4GN3 B;  4P74 A;  2SOB A;  2OCE A;  4OWT B;  4JYA Q;  4B08 A;  1YNJ C;  3PIO A;  1DYQ A;  3S2D B;  1QVC A;  2E2H B;  2M9V A;  4R4I A;  4A93 G;  1PRT D;  1X56 A;  2A6E C;  4PG3 A;  1J8I A;  1XPO A;  1A3U A;  2ZXR A;  1K0R A;  4LF7 Q;  3HKZ B;  1B9M A;  1SND A;  3KLR A;  1I4H A;  1CKM A;  1JE5 A;  4ZK9 B;  3U9S A;  1MD2 D;  3KDF A;  4GOP A;  1EFW A;  3ULL A;  1CSQ A;  1VQL A;  1Y69 U;  1EZ8 A;  3MXN B;  4JI8 L;  2EDG A;  1ML0 D;  3CU7 A;  4APV A;  3HZX A;  1BXT A;  4ZUJ A;  1WOC A;  3K80 C;  2RQX A;  3CP0 A;  1NUC A;  1UEA B;  2RDG A;  2B2U A;  1PYB A;  1LTI D;  1WYD A;  1A0I A;  3AFQ A;  3K7U C;  4R1J A;  4O2D A;  2O5I C;  2JP1 A;  1S5F D;  3QIA A;  3I55 A;  4DV5 Q;  2R6G A;  3RUZ A;  1ASZ A;  2PCF B;  5FLX c;  1AZQ A;  1K73 C;  2EZV A;  4KY7 A;  1DGS A;  2IW3 A;  2YV5 A;  3CKI B;  3UI2 A;  2RCN A;  2IL8 A;  4CGY B;  5IYB H;  4HJ5 A;  4TSS A;  5C4X G;  1LTG D;  4NXM L;  3D31 A;  1F77 A;  1LUZ A;  4B9W A;  2CQO A;  2E2D C;  1R9T H;  2JN4 A;  2VL6 A;  3S1R B;  4IFD I;  3ND9 A;  4DR6 Q;  1TY2 A;  1K83 B;  1JOO A;  3TDQ A;  1HXY D;  1PZJ D;  3AU7 A;  2ZXO A;  1D8L A;  2A74 C;  2DJF C;  2L0C A;  4H13 C;  3HOU H;  1QOH A;  3L3O C;  1V1P A;  3HOZ B;  3V05 A;  5DM6 3;  2N8N A;  2EYH A;  1X3Q A;  1C48 A;  4KJO A;  4DAV A;  3BVZ A;  1T9H A;  5J1Z A;  5LMN Q;  2JA8 H;  2KUM A;  3CCV A;  5H1S E;  3N6R A;  4MIU A;  4H0L C;  2K5V A;  4DN4 M;  4A3I H;  4K8I A;  1WTO A;  4UAI A;  4B3T Q;  3DHQ A;  3M4O B;  2UXC L;  1KC8 C;  2ZT9 C;  4FXG C;  1TWF H;  5FLM H;  2JA6 H;  5ELE A;  3SK4 A;  3S16 H;  3X3N A;  1WD1 A;  4JI2 L;  4J6H A;  1A6X A;  1CK1 A;  3A0J A;  1EY8 A;  1VQI A;  1WCM B;  1VF7 A;  1DZ1 A;  1U0L A;  3BU2 A;  4KMU C;  4K14 A;  3MXN A;  2EJM A;  3CC4 A;  1F9P A;  5DLQ E;  3QOJ A;  1X54 A;  1YEZ A;  2FMC A;  1TS2 A;  2HHH L;  5CMD A;  1SE2 A;  3J81 E;  1L2F A;  2NZH A;  4LAA A;  1YIJ A;  2I5M X;  4ZKC B;  1PFB A;  5IOC A;  1R4Q B;  1Q46 A;  4K6D A;  2EXZ A;  3S9W A;  4OWW B;  1SNP A;  4DUZ L;  4DAY B;  1W6J A;  2YTX A;  3I91 A;  2D0P A;  2C35 B;  3SR1 A;  2HCC A;  2WFW A;  4CBV A;  1FGB D;  2KED A;  3ICE A;  5M5W B;  2PMZ E;  4X3S A;  1Y8P B;  1DOL A;  2B2T A;  4DKA C;  2YU9 H;  3S2H H;  4HJ7 A;  2HD3 A;  3S24 A;  4BS9 A;  2D2C C;  2CW0 D;  5K5P A;  4IOC A;  4ZRZ A;  3UE0 A;  4BWG B;  4DK1 A;  2B3G A;  3D3R A;  1T5X D;  1PYW D;  2KHI A;  3N52 A;  4TQU S;  3J80 E;  3CC2 A;  1LLR D;  4HED A;  3TZU A;  4DV6 Q; 
#chains in the Genus database with same CATH homology
 4HIM A;  5IP7 G;  2QEX A;  3STB D;  4B3S Q;  4HJ8 A;  4DV2 L;  4LFA Q;  4B3R L;  4TVA B;  2XTI A;  4MTN A;  1BBU A;  2DGY A;  3S1Q H;  4GS3 A;  2I5L X;  1LM0 A;  2ZTC A;  1HNW Q;  1VQ5 A;  5FJ8 G;  1IBM Q;  1IBK Q;  4POF A;  3K7A H;  4JOI C;  5M3M H;  4AQY Q;  2HIX A;  1J5E Q;  3HOW H;  2ID0 A;  2JJQ A;  2HIV A;  5LMU L;  4JI1 Q;  4JG2 A;  4DR3 Q;  1WJJ A;  3I4N H;  4LF6 Q;  1PHJ A;  4GLV B;  1MKH A;  5GAH C;  3GTQ H;  3HOW G;  3PO2 H;  3ZJY C;  5M3M G;  1X3F A;  2QGQ A;  4A75 A;  5ELO A;  3ULP A;  4B3M Q;  4BA2 I;  4DV3 Q;  3GTG H;  2D62 A;  1VQ7 A;  1YJN A;  2IX1 A;  3I4N G;  4QGU A;  2ZJP A;  5C3E H;  2UU9 L;  4DR1 Q;  2R7D A;  3PO2 G;  4UP8 A;  1OXT A;  2AMC B;  1KL9 A;  1YNX A;  3J81 j;  1PH5 A;  2R92 H;  4QQB X;  4LF7 L;  1G51 A;  1GM5 A;  3RN2 A;  2ZM6 L;  4YHH L;  1SMX A;  5C3E G;  4IJH A;  1C7Y A;  1VQP A;  1EIF A;  1PH3 A;  2K4K A;  1IBL L;  2ZJQ A;  4OX9 L;  3T1H L;  4P71 A;  2ASB A;  5IP9 H;  4R4Q A;  4JBK A;  1SR3 A;  1EUJ A;  2BA1 A;  4BY7 G;  2VZA A;  1SE8 A;  4LF9 L;  4DR4 Q;  4DV0 Q;  3KYH C;  3J81 c;  4X65 Q;  1IYJ B;  5IP9 G;  5IT9 c;  3CC7 A;  3CCU A;  3PUY A;  4DV1 L;  1BVS A;  4A3M G;  1BKB A;  1VQM A;  2R7Z H;  3GTM H;  4UY8 C;  4BXX H;  1VQC A;  2K5N A;  2A1A A;  2BA0 A;  2YTY A;  2GVA A;  3A74 A;  3CW2 C;  4UP9 A;  3ULJ A;  1EWI A;  4AIM A;  4X62 L;  4LF4 L;  4GKK L;  1C0A A;  4HID A;  2N49 A;  1PA6 A;  4BBS H;  5IYD H;  2R7Z G;  1X9N A;  4GOP C;  1BBW A;  1QVG A;  1UWV A;  1CUK A;  3KF6 A;  1N33 Q;  2HT1 A;  3S17 H;  4BXX G;  1JMC A;  3KJP A;  1P8L A;  2MO0 A;  3T1Y L;  5IYD G;  3NEM A;  3RLO A;  1A62 A;  3I2Z A;  4X66 L;  1MJE A;  3FP9 A;  3J80 i;  1N9W A;  3F1Z A;  5JJL A;  1LYL A;  1L1O C;  1EIY B;  1E7Z A;  3FKI H;  3PF5 A;  4JI7 Q;  4DV5 L;  1X3G A;  2AHO B;  1Q12 A;  3ERS X;  4A3E H;  1VQJ A;  1E24 A;  1Q82 C;  1PH6 A;  4LFA L;  3RZO H;  2VS1 A;  4LFC L;  3S14 H;  3GTK H;  4OON A;  2VUM G;  2H5X A;  2ZTD A;  1JT8 A;  4JI5 Q;  2NN6 G;  4C3J H;  1RIP A;  3FKI G;  3TS0 A;  4HIO A;  4DR2 Q;  3U4Z A;  1HNW L;  4AQY L;  1RL2 A;  1AE3 A;  3F2B A;  4A3E G;  4A3J H;  4O0A A;  1Y1V H;  2GN5 A;  4A3K H;  4JI1 L;  2E8G A;  3DM3 A;  4GNX A;  5M3F H;  3J80 c;  3PUZ A;  1SFO H;  4LF8 L;  2K14 A;  2WP8 J;  3IRB A;  3G48 A;  5IY0 A;  2JA9 A;  1TWC H;  2UUA Q;  4A3J G;  5IWA Q;  1Y1V G;  4JBJ A;  4DV3 L;  3OTO Q;  4A3K G;  1NY4 A;  2MO1 A;  5GAE C;  1XNQ Q;  4NXM Q;  3JAM c;  5M3F G;  1HZC A;  2PNH A;  3CMA A;  4QL5 A;  3KLW A;  1AE2 A;  4LF5 Q;  1Z9F A;  4JV5 Q;  2K5H A;  3I4M H;  1Z47 A;  2PQA B;  1FJG Q;  3S2D H;  1FVI A;  2MQH A;  4A4I A;  2E2H H;  2FXQ A;  2B29 A;  5HY6 A;  2VQE Q;  1QVF A;  4A3G H;  3I7F A;  1L0W A;  5BR8 Q;  3J7A 5;  1OXU A;  3HOY H;  1N36 Q;  1XNR Q;  2WAQ G;  1NE3 A;  3I4M G;  4P73 A;  3E9I A;  2CWA A;  4A3G G;  1GD7 A;  3UDI A;  3GTJ H;  3AFP A;  5C0X G;  2R93 H;  3GTL H;  1P16 A;  2RHQ B;  3CCS A;  4LUO A;  4JCV E;  4GKJ Q;  3SGI A;  2VNU D;  2KCM A;  1S72 A;  4LW1 A;  1X6O A;  3CPW A;  1Q7Y C;  3HOY G;  5LMN L;  4LUV A;  3EBE A;  2AWO A;  3BZC A;  4GLA C;  4MZ9 A;  5M5Y H;  4DV7 Q;  1YIT A;  2I5H A;  3HKZ G;  4IPC A;  3M85 A;  4HIK A;  4LNQ A;  2R93 G;  2WAQ E;  5IP7 H;  4YY3 L;  3DLL A;  4B3T L;  2ALY B;  1G29 1;  2F4V Q;  4UPA A;  1Q86 C;  3RZD H;  1Q1B A;  1PVO A;  1D7Q A;  4R4C A;  1E22 A;  3GD7 A;  4JI0 L;  4QIW E;  4QJF A;  5FJ8 H;  2JA5 H;  2JA7 H;  2CCZ A;  3HKZ E;  4IPH A;  3F2C A;  3F2D A;  3HKS A;  3TEH B;  3G71 A;  1QUQ B;  4BBR H;  1IZ6 A;  4X64 Q;  3GTP H;  3E9H A;  4DR7 L;  1JJG A;  1B70 B;  3M4Q A;  3M9B A;  4NPS A;  2JA5 G;  1IXR A;  4JI6 L;  2JA7 G;  3AEV A;  2IY5 B;  1I5F A;  1YHA A;  5C44 H;  1XMQ Q;  1FGU A;  2OQ0 A;  3OYY A;  4EQ5 A;  3RR5 A;  1KQS A;  1I94 Q;  4DUY Q;  4JI2 Q;  4BA1 I;  3UDX A;  1PH1 A;  3MEF A;  4BBR G;  1I6H H;  4X6A H;  3CPF A;  2Z6K C;  4DNI A;  4DV4 Q;  1H95 A;  3F8T A;  5C44 G;  2A19 A;  1W2B A;  4L5S A;  2JE6 I;  1NTG A;  3KDF B;  3CCQ A;  4GOP B;  1N34 Q;  4JI4 L;  2EXD A;  3PIP A;  2Q2U A;  4NB3 A;  4KI0 A;  3G4S A;  3EN2 A;  4NXN Q;  3K8A A;  3J81 i;  2IHE A;  3GTO H;  4PMW A;  2UUA L;  4AYB G;  3AYH B;  4HJ9 A;  1EOV A;  1VCI A;  3OTO L;  3HOX H;  1KIX A;  1XNQ L;  2NN6 I;  4PZ6 A;  1L1O B;  1I50 H;  1B8A A;  1OXS C;  1TXY A;  1VQH A;  1VQG A;  1YHB A;  4BY7 H;  2PI2 E;  3S1R H;  1XMO L;  4R4T A;  1HNX Q;  1Q1E A;  1JJC B;  3HOX G;  2NVT H;  3L2P A;  4A3M H;  1XTD A;  4EX5 A;  4JC0 A;  2VQE L;  4DUZ Q;  3S15 H;  1HH2 P;  3L0O A;  2VQF Q;  1K83 H;  4L5T A;  4AYB E;  1UEB A;  5AJ3 L;  4GNX C;  2LSS A;  1HR0 L;  1O7I A;  3NEN A;  4A3B H;  1N36 L;  4DR5 Q;  1N32 Q;  5JJI A;  1FL0 A;  4AH6 A;  5J3B A;  1V9P A;  1VQ4 A;  1EYG A;  2IHF A;  3G6E A;  3WWV A;  1CKN B;  4GLX A;  1JB7 A;  3W5O A;  2Q2I A;  4GKJ L;  1E3P A;  1UE6 A;  3M7N A;  3HOZ H;  4A3B G;  2NVY H;  2V1C C;  2UXB L;  3U4V A;  4A3C H;  4DV7 L;  1UE7 A;  2OQK A;  4YCV A;  4JI8 Q;  1K8G A;  2Q2H A;  3PCO B;  2NZO A;  4PZ8 A;  2AWN A;  4Y52 H;  3E0E A;  4RMF A;  3HOU G;  3HOZ G;  4JBW A;  5C0X I;  3Q8D A;  4XTC S;  3S1M H;  4A3C G;  4KHP Q;  1HZ9 A;  4OO1 I;  2NVX H;  2PQA A;  2WB1 G;  3A5Z B;  1HNZ Q;  4HJA A;  5C4J H;  4DV6 L;  2EQS A;  3W1B A;  3H0G H;  4YWK A;  2UUB Q;  1HZA A;  4QY7 A;  4BY1 H;  4B3S L;  2E5L Q;  3JAM i;  5IYC H;  1V43 A;  1VQK A;  4K0K Q;  4OWX B;  1TWG H;  2UUC Q;  2N78 A;  4IFD J;  1I3Q H;  2KEN A;  4X64 L;  3H0G G;  1MJC A;  4BY1 G;  1IBM L;  1IBK L;  2LXK A;  1G6P A;  4KHZ A;  3AQQ A;  3FHW A;  5HGQ A;  5IYC G;  1YI2 A;  1J5E L;  2VUM H;  3UDF A;  4DR3 L;  1TWH H;  3S1N H;  4DV2 Q;  1NMG A;  2K75 A;  2Y0S G;  3PGZ A;  4LF6 L;  1VS0 A;  1MIU A;  2A8V A;  4IFD G;  1UE5 A;  2YYZ A;  2Z0S A;  2K50 A;  3M4P A;  1VQF A;  1TWA H;  3I4O A;  5GRO A;  4B3M L;  2JA6 G;  1XPU A;  2K52 A;  2JEA I;  3TS2 A;  5E7N A;  3STB C;  1N34 L;  3RNU A;  2EIF A;  4DR1 L;  4A93 H;  4GN3 B;  4P74 A;  1ASY A;  3HOV G;  2F52 A;  2Y0S E;  1YZ6 A;  2OCE A;  4OWT B;  4JYA Q;  3PIO A;  4A3D H;  1QVC A;  3UE1 A;  1QUQ A;  2BH8 A;  4R4I A;  1PV4 A;  4A93 G;  4JI3 Q;  1X56 A;  5K36 G;  2DUD A;  4IO9 A;  1HNX L;  4PG3 A;  1LTL A;  2UU9 Q;  3CCR A;  3PV0 A;  1XPO A;  4A3D G;  3CAM A;  2VQF L;  1K0R A;  2B63 H;  4LF7 Q;  3PUV A;  2KBN A;  2ZM6 Q;  2VY3 A;  3GDE A;  4YHH Q;  4POG A;  4DR4 L;  4DV0 L;  5JEA J;  1XPR A;  4X65 L;  1CKM A;  1W3S A;  1N32 L;  4P75 A;  1JE5 A;  1IBL Q;  5IE8 A;  3KDF A;  4ME3 A;  4GOP A;  2B63 G;  4GN5 A;  1EFW A;  1E1T A;  3ULL A;  2GVB A;  1CSQ A;  1VQL A;  1IL2 A;  2JQO A;  3BZK A;  3ER0 A;  3EIV A;  1K3R A;  4LF9 Q;  5JEA G;  3MXN B;  4DAM A;  4JI8 L;  1WI5 A;  4DV1 Q;  1L1O A;  2QA4 A;  1VQ9 A;  1N33 L;  3U50 C;  2MFI A;  1VQE A;  1SLJ A;  4LUZ A;  1VQB A;  4APV A;  3CCE A;  1QZH A;  1A63 A;  4IOA A;  4XIG S;  4X62 Q;  1HNZ L;  2E2J H;  1XJV A;  4LF4 Q;  2UXC Q;  1WOC A;  3K80 C;  4OXP A;  3M3Y H;  3CP0 A;  4A3F H;  2UUB L;  4JI7 L;  1S40 A;  4K0K L;  4LFB Q;  1PFS A;  1PYB A;  3JC6 6;  2MNA A;  3L7Z C;  3T1Y Q;  1WYD A;  4DK3 C;  3VDY A;  1A0I A;  4JI5 L;  4X66 Q;  3KJO A;  3AFQ A;  3UDG A;  3K7U C;  4R1J A;  4DR2 L;  4A3F G;  3PF4 A;  4O2D A;  1VQN A;  1CKN A;  3A5U A;  4C3I H;  1EQQ A;  3I55 A;  5C4X H;  4DV5 Q;  2R6G A;  3BJU A;  3KFU A;  1NMF A;  1YJW A;  1PH9 A;  1ASZ A;  5FLX c;  2VW9 A;  4LFC Q;  1K73 C;  1DGS A;  1YBY A;  2YV5 A;  5IWA L;  2RCN A;  4HJ5 A;  2YTV A;  5IYB H;  5M5X H;  3H3V H;  5C4X G;  4NXM L;  1VQD A;  3D31 A;  4IJL A;  1E1O A;  1GVP A;  1A8V A;  2CFM A;  2HHH Q;  3CME A;  1LUZ A;  4LF5 L;  1GKH A;  2CQO A;  2ZTE A;  1R9T H;  4H02 A;  4JV5 L;  4R4O A;  2VL6 A;  1OXV A;  5IYB G;  1Y1W H;  4LF8 Q;  1FJG L;  4L5R C;  2BH2 A;  3PO3 H;  4IFD I;  4JYA L;  4DR6 Q;  3H15 A;  2IX0 A;  5BR8 L;  1KD1 C;  1OTC A;  4JI3 L;  1XNR L;  1Y1W G;  1YHQ A;  3PO3 G;  3PSI A;  5LMN W;  1D8L A;  2L15 A;  3CCL A;  4A76 A;  2UXD Q;  2LXJ A;  1VQA A;  4YCW A;  5ELN A;  1GO3 E;  2D0O A;  2IT1 A;  2XGT A;  3D0F A;  3OW2 A;  3HOU H;  4WJ4 A;  5EAY A;  3LGJ A;  2R92 G;  4DK6 C;  4J15 A;  1KHI A;  2N8N A;  2KCT A;  2RF4 A;  1WFQ A;  1EQR A;  4PZ7 A;  2NVQ H;  4ALP A;  2F4V L;  1PH7 A;  5GQO A;  1T9H A;  5LMN Q;  2OTL A;  4RG1 A;  3B6Y A;  2JA8 H;  1OXX K;  2OWO A;  3CCV A;  2RHS B;  1KRT A;  5H1S E;  3GO5 A;  4JOI A;  2K5V A;  4A3I H;  1PH8 A;  1KAW A;  3M4O H;  4YY3 Q;  1Y14 B;  1Q81 C;  4B3T Q;  2UXC L;  1KC8 C;  2JA8 G;  4GN4 B;  2Z6K A;  4MNO A;  1VQO A;  2R7F A;  4JI0 Q;  1TWF H;  4A3I G;  3NEL A;  5FLM H;  1XMQ L;  2WB1 E;  2JA6 H;  5GAG C;  2ES2 A;  3TRZ A;  4LFB L;  3S16 H;  1I94 L;  4DUY L;  4JI2 L;  4B3R Q;  1VQ6 A;  1YVC A;  4BBS G;  4DV4 L;  1HJP A;  1NBW A;  1WCM H;  4YWM A;  4C3H H;  4Y7N H;  5FLM G;  3HOV H;  3A0J A;  3CCJ A;  4DR7 Q;  1J6Q A;  3RLF A;  1VQI A;  4KLK A;  1N8R C;  2HQL A;  3KF8 B;  5GAD C;  4JI6 Q;  1KRS A;  1U0L A;  2JK8 A;  4LWC A;  3BU2 A;  5LMU Q;  1YJ9 A;  4NXN L;  1WCM G;  1K9M C;  3J7Z C;  3CC4 A;  5DLQ E;  2ZJR A;  1NJI C;  1PYS B;  1X54 A;  1YEZ A;  2F3I A;  1PH4 A;  1SRO A;  1X65 A;  2I0Q A;  4UP7 A;  3U58 A;  2HHH L;  3CXC A;  2ATW A;  1B7Y B;  4JI4 Q;  4IPD A;  4C2M H;  1L2F A;  2NZH A;  3CF5 A;  3CD6 A;  1YIJ A;  2I5M X;  1SRU A;  4DPG A;  1Q46 A;  1X55 A;  4IPG A;  1HR0 W;  4JBM A;  4OWW B;  1QZG A;  1Q8K A;  4DUZ L;  4DAY B;  2JEB I;  4DR6 L;  1S3O A;  3KF6 B;  2PI2 A;  2Q2T A;  2YTX A;  3KOJ A;  4DR5 L;  2D0P A;  1CKO A;  2C35 B;  2CWP A;  3CQZ H;  5JJK A;  1XMO Q;  1JJ2 A;  1CSP A;  3RLN A;  4OX9 Q;  3T1H Q;  3TRE A;  2UXD L;  5C0X J;  5M5W H;  2WFW A;  3H3V I;  1X3E A;  3ICE A;  1SN8 A;  1C9O A;  5AJ3 Q;  2PMZ E;  1HR0 Q;  2OTJ A;  4YCU A;  3CCM A;  3PUW A;  1PH2 A;  3NBH B;  4YWL A;  2E2I H;  4L5Q A;  1K8A C;  3I56 A;  4DKA C;  2YU9 H;  4A3L H;  3S2H H;  4KHP L;  4HJ7 A;  4GKK Q;  2N3S A;  3S24 A;  3PUX A;  4GNX B;  1UE1 A;  4IOC A;  2UXB Q;  1V1Q A;  4P72 A;  1AH9 A;  4OO1 G;  4FDB A;  3UE0 A;  3W1G A;  1HZB A;  2KHJ A;  3HFZ B;  2E5L L;  1KXL A;  1M1K C;  1U5K A;  2B3G A;  3RN5 A;  1M90 C;  2KHI A;  4A3L G;  3TQY A;  2UUC L;  3K0X A;  4TQU S;  3CC2 A;  2CKZ B;  2AKW B;  1VQ8 A;  3K81 C;  4DV6 Q;  4WJ3 M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...