2XSCA

Crystal structure of the cell-binding b oligomer of verotoxin-1 from e. coli
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
69
structure length
69
Chain Sequence
TPDCVTGKVEYTKYNDDDTFTVKVGDKELFTNRWNLQSLLLSAQITGMTVTIKTNACHNGGGFSEVIFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Cell-Binding B Oligomer of Verotoxin-1 from E. Coli.
pubmed doi rcsb
molecule tags Toxin
molecule keywords SHIGA-LIKE TOXIN 1 SUBUNIT B
total genus 16
structure length 69
sequence length 69
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2010-09-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.70 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2xscA00
3MXGA 1QNUA 1R4PB 4P2CB 4ULLA 2XSCA 2C5CA 1CZGA 2GA4B 2BOSA 1R4QB 1BOSA 1D1KA 1DM0B 1QOHA 1C4QA 4M1UB 1CZWA 1CQFA 1C48A 1D1IA
chains in the Genus database with same CATH superfamily
2MNAA 3S1QH 1KIXA 3PO2B 4DPGA 3KYHC 2AQ3B 2HCCA 2A6EC 4OEMB 3VDYA 1Q3LA 1KXLA 1VQCA 2CVRA 5C0XH 3R2TA 5AJ3L 3MVVA 3ULJA 4DR7L 5DAUA 1LTTD 1NJIC 5K36H 5E1FA 3MXPA 4DR2L 3PO2H 1KAWA 2PZTA 1GUOA 3QR8A 1E7ZA 3MTSA 3KDFA 2R7ZH 3AFPA 4FXDA 3AU7A 1EQVA 4JK1C 1HHVA 3URYA 3CCRA 2Z4HA 2IPKD 4ZUIA 1EZ8A 4ZRZA 1TR5A 2EY1A 4OWWB 2OQ0A 4XTCS 5D14A 4GLAC 2I46A 5FO7B 3BG3A 2RVLA 2Z0SA 3K5NA 5I2YA 3PV0A 4RG1A 1TWHB 4UP7A 3HRZC 2R7ZB 1AEXA 5IYCH 3CCJA 1RDPD 3RZDB 1GUNA 1LO5D 5FKAC 2ICEC 4B3SL 5EKKA 5COYA 5HGQA 5GAEC 1Q7YC 2ALYB 3CHBD 5C4JH 4A3IB 4R4QA 1X6OA 2VQFQ 2M2LA 1PYSB 1AN8A 2ZTEA 1WTPA 2EPBA 2K6AA 3FPPA 2J0TD 3K5OA 1DCZA 1RTOA 4X65L 1BBXC 4FYDA 3CU7A 1ENCA 5M3MG 2A8VA 1D1IA 4HSVA 4UDUC 2A69C 4RMFA 1VQ8A 2Z6BA 3GTJB 1B3AA 3FRPB 1X3QA 2MHVA 4DR6Q 4KN7C 3H15A 2EIFA 1QVCA 2GA4B 4J1MA 2A74C 2EDGA 1EL0A 5D3IB 2WIIB 3GV3A 3HOYB 1Y8OB 1IL2A 1U5KA 2F0OA 3E9IA 3S17H 3CCVA 4L5SA 3GTLH 2NZ1D 3GTJH 1L2FA 2JSOA 5BN4A 5C0XI 1GKHA 2KCCA 3D6WA 1WOCA 4A3JB 2TMPA 2Z9HA 4O0AA 3RLNA 4A3EG 4GKKQ 1EYCA 5IYBH 3OWFA 1P16A 3JAML 5C6AA 1M90C 4A3FB 1ICFB 1OXVA 4DAYA 4JBWA 3MXNA 2ATWA 3S17B 2N49A 4DAMA 5M9OA 1GM5A 5C3EG 2N8NA 1WVLA 4QJFA 1GUWA 1SYBA 3BVZA 4MHEA 3G4SA 3PIPA 1SE3A 1O7ZA 1QNUA 4KKTA 1J5EL 5IYCG 2QGQA 4JI6L 2XVSA 4IUUA 1HR0L 1XNQQ 5ISRA 4R4IA 4BY1H 3PIOA 2L9HA 4K5WA 1XMOL 2B63H 4AQYL 1X54A 1IW7D 1IBKQ 1FD7D 1D5XC 4FXKC 1HQMC 1U4MA 1H9SA 1QWYA 5D3DA 1ET6A 3VA5A 2WAQG 1K9MC 2JA6G 3CCMA 2NN6H 2ENBA 2MQHA 4P2CB 3BVGA 3J81E 1YI2A 1H9JA 2HIXA 1HZ9A 4MN3A 2R7DA 2Q8RE 4A3EH 3J7AV 1TS4A 4DUZQ 3W1BA 1EU4A 1SROA 3NTIA 1PLFA 4RKLA 2XRSD 2KCMA 4M1UB 4DFAA 1FJGQ 1Q8KA 4PNYA 2Q2TA 4EX5A 3DWQA 4JBMA 3MAQA 5FO8B 1CM9A 1QNKA 3TP7A 2JA9A 3TSSA 1STGA 4C3JB 3OWEB 1J9OA 3KF6B 4QGUA 3SE0A 5G3LD 1B8AA 2AWNA 3VR3A 5GAGC 3FEWX 3HGBA 2GVBA 1SNMA 4NKLA 1MI2A 3TRZA 1YNND 1G6PA 3LWEA 4YCWA 3R8BA 2ZXPA 4K5VA 2SOBA 4JPBW 1IZ6A 3AYHB 3TBIB 3WOFA 1VQIA 1R4PB 2XN9C 3GTMH 1YHBA 3TN2A 1Y14B 4O1NA 2EXDA 1N33Q 4KD3A 2LS01 5FJ8H 4O2DA 3J81i 4GOPB 5IT9c 3D4RA 1ET9A 1C8CA 4IN3A 3U9OA 4QUCA 3QG1A 4A3KH 1FGBD 1S5CD 5IP9H 1I4QA 3KUPA 1PYWD 1X3PA 5I4DA 2NBFA 4P75A 4HIMA 3HKZE 3E6ZX 3NSWA 4RGMA 3SXHA 2PO4A 1VQMA 2L55A 3HOVH 3RLOA 4A4IA 1Y1WG 2BA1A 1B1ZA 3Q24A 3V05A 2K4KA 5TSSA 1UUPA 1UAPA 5HY6A 3BS1A 4N8X1 1BBUA 2F1MA 3GDEA 3MFGA 1N33L 4A3BG 5EAYA 4DAYB 3KF8B 3S24A 2B2WC 1SYFA 1ASYA 3MXUA 5J1ZA 2MO0A 3NK9A 5IP7H 5E4XA 2F0MA 2QCPX 3CCQA 1K73C 3R2IA 1XWEA 1KDBA 5IODA 4V0BA 4GLXA 3PGZA 1TXYA 3S1MH 2VB2X 3FKIH 4Q0FA 3HP3A 3SK6A 2IY5B 5GROA 1VQ4A 3RUZA 1G2SA 3SHLA 2WAQB 3D3RA 4LNQA 2YV5A 4QUFA 1B3QA 1EOVA 2EY6A 1PH3A 2K5WA 3B6YA 1C48A 2R7ZG 3OW7A 2LSSA 4F8MA 3NXWA 3ND8A 1LT3D 1QE6A 1SLJA 2F0JA 2VXWA 1SFOB 3CC7A 2ZM6Q 5JJIA 3HOVB 2BCOA 4EQOA 4A3IG 4HTHA 4A3GH 4KI0A 3I55A 1JOQA 3SK8A 1V1OA 1FGUA 4MZ9A 1Q12A 5JPNC 1NAPA 2F0HA 2PW5A 5EKLA 4DU9A 4OGQC 1O7YA 4DKAC 2E2DC 1N32Q 2SNMA 2HQLA 1TWAH 4ULLA 3X3NA 1JWUD 2P5ZX 2PPBC 2CCZA 1XMOQ 1SDFA 5M3MH 3HZXA 5IYBG 3CMEA 2B3GA 3K5LA 1PDQA 5E7NA 5IGBA 2L0CA 2OTLA 2ZM6L 3FKIG 3TMEA 3AQQA 3MEFA 3WDNA 2MFIA 4EVOA 4YWKA 2HDLA 3V96A 2PQEA 1I3QH 4IFDJ 4Y7NB 1IKLA 4DUYL 3HOYG 4K14A 2A19A 1CT1D 4K5XA 4B08A 1KL9A 4L63B 3CCSA 2OCEA 1TIID 3AB9A 1VMCA 2BE5C 2JYOA 1HRJA 1R4QB 3S9WA 1QCBD 3GV6A 2EJGC 3PUWA 3PO3G 2IJ0A 1JJ2A 4P74A 4F88A 1OXSC 4H44C 5J39A 2NVTH 1IL8A 2PW7A 3EA6A 1BCPD 1RCVD 2SDFA 3ERSX 1G91A 3VYTA 1U4LA 5C4JB 1LTBD 1Q46A 3S1QB 2Z8LA 3K5MA 4DXFA 2QEJC 4HR7B 1EYGA 3PSIA 2C5CA 4EQPA 1XNRQ 1X9NA 1EIGA 2F0FA 4K2KA 5KIXA 4WJWA 4OO1H 1MSHA 2VQEL 5CV4A 2Z4IA 4OONA 2N88A 3ULLA 1MSGA 2EY2A 3A8JE 5KRUA 3DMUA 4LK1C 2JK8A 4CKCA 1KC8C 4OX9Q 2Y0SB 3S15H 4IALA 3HOUG 2J4XA 1O7IA 4DV6L 4CDEC 4A3MB 4S3SA 2HDMA 1PZJD 2UUBL 4A76A 4YY3Q 5DM73 4TSSA 5KYIA 2E74C 4DA2A 1S5FD 2K52A 2RDFA 3UDIA 1DONA 2OTJA 2NN6G 2B63G 1SMYC 2F0SA 2B8FA 3BVMA 4A3LH 2VQFL 3EQLC 1AZPA 1ENAA 1XX8A 4LF4L 3AEVA 2K33A 4OO1I 4KY6A 4BA2I 3UE0A 1TWCB 2J7ZA 4PG3A 2F3IA 4KHPL 3NE5B 4DV2Q 5KEEA 2ZTDA 1E3PA 3HOZG 4DN4M 2XWBB 1A2TA 2FHTA 1HNZQ 1I6HH 1AFPA 2AQ2B 4JVZA 5D65A 3RN5A 4ZUJA 2MUYA 4I65A 3V2TA 2LXKA 1ESRA 2D9UA 3KBGA 5M3FH 1UE1A 1MIUA 4N8FA 4X64L 4DV0L 4K8IA 1BO0A 2B29A 1B44D 3T56B 2MGSA 5JEAH 4KMUC 3RR5A 4K0KQ 1O80A 4E6IA 4BBSB 1HTPA 1V43A 5JPMC 1UEBA 1SSOA 2N78A 2WAQE 4DR7Q 2DN8A 5CYUA 2UXBL 4IUVA 2K32A 2B2UA 1IHZA 4RWSC 4A3JH 2NVTB 3T1HQ 4HMJA 1YNJD 4KHPQ 4CBVA 1IYUA 5EBDA 3U50C 4CGYB 5I6YA 3K8AA 3RZOH 1IXRA 1VQJA 2Q8IB 4A3BH 2L12A 3PCOB 2F52A 1K83H 3I4NB 5E4WC 4AQYQ 4G7OC 3RLFA 3Q0AA 3K7AH 2EYOA 1E2ZA 4NXNL 2IW3A 4A93B 2EJFC 2DJGC 3PF4A 4O42A 1VQHA 1FNWA 5M3FB 4DV6Q 4UPAA 4DV1L 1R9TB 2FINB 1GUGA 2F4IA 2R3ZA 2WP8J 2KVMA 5M5WB 1EFWA 4ZYSA 4JI3L 3J7A5 1JWMD 5C0XJ 5CBEE 1K8GA 1EYAA 2IHFA 4A3MH 1JC7A 3ND9A 3D4DA 2RSNA 4HJ8A 5IOCA 4A3LG 3EVQA 1LUZA 3I4LA 1F2LA 1B9NA 2BA0A 1IBLL 4ZLTF 2NN6I 4LMQD 1Q81C 4LF5L 1YEZA 2K5HA 1VQPA 2HHHQ 1EEID 4OIJA 2UXDL 5JVH3 4G57A 4M8AA 3F1ZA 4IJLA 1CA5A 5C3EB 3OSOA 3M4PA 4C3IH 4PZ7A 1CKOA 2K5QA 4YIJA 2UUCQ 2HHHL 4JI4Q 4LF9Q 4LJZC 2E5LL 1B2TA 1CUKA 1YBYA 1W6KA 1X3FA 2IHEA 1I4RA 5C3EH 3S2DH 1TWGH 3VR2A 1DJRD 4IFDH 4PZ8A 2YU9B 1WYDA 1EEFD 4LFBQ 3CPWA 1WD1A 3FPUB 5FK9C 4R9WA 1K8MA 2ES2A 4UP9A 1F9PA 5M5WH 4A3GG 3LGJA 4NDXA 3S16B 1XPOA 4JV5Q 3J81L 1KNEA 3A56A 3H0GG 2F4VL 3S2DB 1SEBD 4JI2L 1NSNS 4IO9A 2E2JB 3I70A 1CKNA 5JVG3 1ICWA 2HD3A 5EPJA 4L6TB 3W1GA 5LMNL 4LF7Q 4KKUA 2NB0A 4R4OA 2DY8A 1ML0D 3L0OA 4JW0A 1PV4A 2JE6I 1RTNA 4DK0A 2V4DA 4MTKA 2B2TC 1ZYRD 5EJWA 2CH4W 4JI8Q 2L1BA 2I5LX 1NUCA 2C35B 3I90A 1DGSA 1CZGA 1F9SA 1PFBA 2QF7A 3ZJYC 1GUTA 3NWSA 2UXBQ 3DWAA 1Q90A 1TY2A 1LM0A 1S5DD 5ELDA 1PTOD 5M5XB 1X56A 1D1KA 1GHKA 5K36G 3I7FA 3U4VA 4JI8L 1JR0D 2X6LA 3KK7A 2ZT9C 4JI7Q 4DNIA 1Z6HA 4X64Q 2YTXA 2JA8H 3TEHB 4IUNA 3A5ZB 1PH1A 2F03A 2BH2A 3EJIA 1NMFA 1LTLA 4LF7L 1CSQA 2LXJA 2OXPA 1VQ9A 1LTGD 4C3IG 1B9MA 2IX0A 1QG7A 1YJNA 3F2UA 1SR3A 2F4VQ 3BYYB 3PMFA 2KHIA 1NNXA 1KDCA 4JBKA 2NVXB 5IWAQ 4G7HC 2NYZD 1QB5D 2D5DA 4DR3Q 1RIPA 1LTSD 3NBIA 1Y8NB 1BCPF 4CDDC 3PUXA 3P20A 3VYSA 4LUOA 2F0VA 2L4NA 3KF8A 4A3DG 3MWYW 1SAPA 4RAUC 4A3GB 4A3FG 5HURA 1PTOF 3NENA 1D2BA 2UUBQ 4N9PA 3A54A 1XTCD 1YHQA 1HQRD 4BBRG 1JJCB 4EQ5A 5C4XG 1IKMA 3H0GH 4A75A 1TWAB 2VZAA 3TZDA 1YHAA 5IYDH 3CF5A 3UI2A 2D0PA 1SXTA 4JI0Q 4R8IA 2CFMA 3O13A 3C2PA 1K8OA 2EYFA 5J3BA 5ELNA 4CKBA 2A1AA 3HOVG 2MJ8A 3IAYA 1YJ9A 1QUQA 4X3UA 1D5ZC 5EKIA 2UXDQ 2H1EA 4H0LC 4DV4L 1G2TA 5K5PA 4EQNA 4ZAIA 4WJ3M 1VQLA 1XNRL 2WV6D 4BS9A 1VQFA 1STNA 1XPUA 1QUQB 1XMQL 4C2MH 2K5DA 3S2HH 3GTOB 2WKDA 5J22A 3DEOA 1HNXL 2LKVA 3K6OA 1SN8A 1GO3E 3EN2A 4JI0L 1LT4D 4FVMA 2NVXH 1TS2A 2CWPA 5EQ0A 4YHHL 3M7NA 4ILWA 4POFA 3CQZH 1E2VA 3J80L 1BKBA 4ZQ3A 3I4NH 4RHRA 4C3JG 4GNXB 4PMCA 5EGTA 5LMUQ 3C1FA 1FVIA 2I0QA 5I9OA 2OWOA 5KNCA 1BUVT 1A3VA 1WI5A 3D0FA 3F2DA 1K0SA 3PIP3 3OYYA 3HOXH 3DLLA 1K28A 4A3FH 4XQNA 2B2VC 1XYIA 3KF6A 2A68C 1A63A 1TS3A 4ODGA 4HJ7A 3S15B 2R92H 1V8QA 1EOTA 4YWMA 4DR3L 4BBRH 3JAME 4OWXB 4K6LA 2DGYA 3QIAA 4HJAA 1EZ6A 1N9WA 3T1HL 2OQKA 2PI2A 4XQJA 4BY7G 4I7AA 3A5UA 3C3LA 1KTKA 2F0NA 4IPGA 1RJTA 1PRTC 4A3IH 3QJYA 4IPCA 1YNXA 2WB1B 3GTPB 5FLMH 1GJXA 1VQEA 3PO3B 3UE1A 3A55A 4IZ8A 1WTRA 4C3IB 1TWHH 4X6AH 4LF6Q 3M3YB 4HSPA 1JJGA 3BDCA 5C0XG 5BR8Q 1SMYD 4UHVA 1EYDA 4OIKA 1BVSA 5T1GA 3IFDA 2BE5D 5AFWA 2KHSA 3M7GA 3SDZA 1ASZA 1A3UA 3S1RH 1QOHA 3U58A 1PZKD 5ELCA 5ELOA 2EJMA 1M1KC 1ENFA 2Z6KA 1J5EQ 1WTHA 3HOYH 1WTVA 4C1NI 4RFBA 5IY0A 2Q2IA 3OIQA 4QQBX 2OT2A 4WRDA 1Q1EA 3TS2A 1LT6D 1SBBB 5A2QE 1Z47A 3GO5A 2WFWA 1JICA 2RDHA 2H4OA 3I2ZA 1VQKA 2FXQA 3KLRA 3R3OA 1MKHA 1Y8PB 3S2HB 4JI5Q 1N34L 4POGA 4CDCC 4QIWE 1SJHD 2RCNA 1JQYD 2QEXA 3NBHB 4X3TA 3VYRA 3ER0A 4L5RC 4DNRB 4GKJQ 1PZID 4L5QA 5ELFA 1AH9A 3M85A 3VR5A 3M3YH 2A6HD 5IT9E 4B9XA 2QDBA 1Q82C 1OO9B 3CCUA 2VQEQ 4OO1G 1FYCA 1I50H 4A93H 2K03A 1MJEA 3BYTB 2A5HA 2N3SA 1O7LA 4ID6A 1CA6A 5FLXE 4HIOA 1YZ6A 3VR6A 2E5LQ 4LF9L 4DR6L 2FFKB 4GKJL 4QB4A 1SNOA 3J80i 2WINB 3FP9A 3D31A 4JC0A 3P75A 4FF1A 3TQYA 4XIGS 2XRQD 4F87A 2GVAA 4DR1L 4LFAQ 1N34Q 2V1CC 1RKNA 1A2UA 3H3VH 2PQAB 4LF5Q 3E0EA 1TQOA 1LTRD 3T1YL 1V1PA 2F0PA 1PFSA 3F2BA 3K0XA 4P71A 1E1TA 2JQOA 4NB3A 3KFUA 1QVFA 5T1IA 1DD2A 1JE5A 5C5LA 4RKBA 1CHQD 1M4VA 3VR4A 2NTSA 3T51B 1FNVA 5IP7G 1AP0A 5DLQE 4B3SQ 3D6CA 4DK3C 1MHWC 4DV1Q 1M8AA 3HOZH 4IPHA 3FVQA 2Q2HA 1X3GA 2ZXRA 3M4QA 4RCOA 2JA7H 3I72A 3HKZG 1PFNA 4Z9CB 1NTGA 1RODA 4ME5A 1KABA 3FKIB 1A62A 4HMIA 4R1JA 3M9BA 4L5TA 1N32L 2WB1G 5IGFA 4LF6L 4A93G 1FL0A 2RCFA 2NWGA 1H9RA 3NELA 1KRSA 5LL6X 3EIVA 4PMWA 4DR2Q 5C4ZA 5IYDG 2B2YC 4JCVE 3P1HA 5FO9B 1T9HA 3MEHA 3PUYA 3NHHA 4MTNA 1EQQA 1N8RC 2PYKA 2K05A 3CD6A 1SFOH 3G48A 1WTXA 1IW7C 1STEA 3Q6SA 2R93H 5CBAE 3MA2B 3F8TA 1Z9FA 1YVCA 2O5IC 1WTQA 1EQRA 3TP5A 1U9RA 3T4AC 1KHIA 3S1MB 1K3RA 1H9KA 2AQ1B 4ZK9B 2JJQA 3GTKB 2E76C 2JA5B 2PQAA 1Y1VG 2F0QA 1W2BA 1Q86C 1TVXA 1QVGA 1BQQT 5C4XH 1II3A 4A3BB 3I91A 3SVMA 1X65A 3CRKC 1W3SA 2DNEA 4J15A 4MIUA 3GTQH 3HOXG 3RD4A 2KOLA 1HNXQ 2KBNA 3H91A 2AKWB 1SYCA 2F0UA 4DAPA 4IUPA 1MJCA 2SNSA 2R7FA 2Q8TA 3S16H 1PFMA 3J80c 1AE2A 1MD2D 1S40A 3ICEA 4ZKCB 2L15A 1N36L 2BH8A 3MC0B 4X66L 2NZOA 2ZJPA 4LFAL 5CV5A 4B9WA 2K5NA 1CZWA 1WJJA 4DR1Q 4J8QA 4QF4A 2DJFC 3IKJA 1G51A 1V1QA 5FLMG 2NVQB 2Z1CA 3L7ZC 1FNUA 1STYA 1PH6A 1WCMH 2EY5A 1I4XA 5CV6A 2JA5H 1RD9D 2RA4A 2EYLA 3A7LA 4KLKA 5BN5A 3BZCA 1PRTF 2A68D 4ME3A 4GZYC 2DY7A 4NPSA 5JJKA 3T53B 5CGKA 4TRDA 1EIFA 1EY7A 2EYPA 1VF7A 4N9TA 1KAAA 2XIWA 3S14B 2K7VA 1AE3A 2F0IA 1CKMA 3R93A 2F0GA 3TS0A 1O78A 3KBXA 3M4YA 1EY6A 4JI1L 3I4MG 4PV1C 4RH6A 4U68A 4BY7H 5E3FA 1VQDA 4DV7Q 1NR4A 2JA6B 2EQSA 2B2UC 2R92B 2YU9H 4GOPA 1AW7A 1NCVA 2E2IB 4OELB 2NTTA 1YNJC 1NE3A 2GN5A 4C2MB 4CHTB 1KQSA 3OMCA 1L0XB 1NMGA 4UAIA 1D6EC 4GN5A 4KV6A 4DR5L 4DV5L 4K2LA 1FJGL 4DAVA 1EY8A 1PH9A 4DV3Q 3H6MA 1KLUD 4R4TA 3GTGH 3TDQA 3NP8A 2JXMB 4B3ML 2EXZA 5GADC 5C3WA 2LFNA 5JJLA 3GTQB 1H9MA 5DM63 1EY5A 1ZYRC 3T13A 2JA8G 1L1OA 2A6HC 4NW2A 1Y1WB 2EVBA 4JG2A 4UY8C 5FOBB 4K8JA 1BNZA 5LMNQ 3NTKA 1EY4A 3KJPA 2E2IH 1HUNA 4LW1A 3JAMi 3DM1A 4FXGC 2OEOA 4Y7NH 4HN7A 1UWVA 4G4KA 1Y69U 4IPDA 2HUGA 1U4PA 3LNNA 1S72A 1B70B 4CKEA 1HNWL 2O2LD 4JV5L 2CH4A 4G7ZC 1HH2P 2UU9L 1X3EA 1AZQA 2B39A 5C4HA 3DM3A 3HEJA 2HIVA 1V9PA 4OXPA 5I9PA 3HOXB 2FMMA 3J81c 4OL7A 2PCFB 2EZVA 4HJ9A 4QL5A 2UUCL 4JI4L 3AFQA 3NBHA 1DOKA 3KLSX 2Y0SE 1G8ZD 2KECA 2K1BA 2VL6A 4LUVA 1BXTA 1PTOB 4DK1A 4FDBA 3NWTA 3CRLC 5IT9L 2VS1A 3VYUA 2BOSA 1D8LA 2K5VA 1C7YA 2G9HD 4LFCQ 3CCLA 1IBLQ 1VCIA 4LUZA 3SK4A 4DV4Q 4FF4A 3HG9A 3H09A 2RBMA 4KJOA 1ONLA 3PO3H 2EYJA 2MO1A 4A3CH 1JOKA 5KNBA 1QILA 3OHXC 4IOCA 2K50A 3C1EA 5EPKA 1I6HB 4BWGB 3S1NH 1B53A 4JI3Q 4GOPC 4HJ5A 4IJHA 2QDLA 3H3VI 5CV9A 3I4NG 5LMNW 1I4GA 1SYEA 3QB3A 2UUAQ 1I94L 2JA7G 3A0JA 3DEPA 5CC4A 3W2DA 5JOBA 3DUZA 2TSSA 3K81C 3S1NB 2VUMB 3BDOA 3HKZB 4CJ1B 4CJ2C 5GQOA 1JMCA 3JAMc 3CC2A 1LLRD 3L9AX 3RZDH 1A6XA 2B2TA 4B3MQ 5IWAL 1NR2A 2AMCB 3CMAA 1I50B 3A8IE 1BDOA 1VQ7A 3AMUA 3NUCA 3L3OC 4KKSA 3GQBA 3RZOB 3WOEA 5F2DA 3I3CA 4P73A 1HZAA 4DR5Q 1L1OB 3G6JB 4BBRB 2PMZB 4K0KL 1E2WA 2HQEA 4MNOA 2CKZB 1L1OC 4GN4B 3CKIB 4DV0Q 2I5MX 1LTAD 4IURA 1EWHA 2HCIA 1SMXA 2WB1E 4A3DB 3QOLA 1SJED 3GTPH 5C5MA 1HNZL 4DV7L 4DXGA 5AJ3Q 2C9OA 3E9HA 4DV2L 2K04A 1YJWA 1FR3A 1K3BC 5L37A 1BCPC 4RA8A 2FMCA 4LF4Q 2EYMA 3F2CA 4B3RL 1U0LA 2L11A 3KDFB 4JYAQ 1ZEQX 2RKSA 1Z7TA 2Q2UA 1HTLD 2CQOA 1TWFB 4R4CA 1VQNA 2N55A 4BY1B 3HS0C 2YTVA 2UUAL 1YIJA 4H7BA 4JI2Q 3U4ZA 1HR0Q 1XNQL 4XT1B 3BZDB 1WCMG 3PUVA 1EFID 3OIPA 2IX3A 1PXUA 3PUZA 2JA5G 2CWAA 4KK7A 4KD4A 1ZKOA 4RCNA 2EYHA 1SRUA 3LWUA 3HFZB 4Y52H 3OPOA 1PMRA 3MZ5A 4OX9L 1VDZA 3QOJA 4BBSG 3BZKA 4I7ZC 4DK6C 2CW0C 3J81j 1N36Q 1KRTA 1I6VC 1V1PB 3C46A 3J7AF 4H02A 2RSOA 2WKCA 2AUKA 4WORA 1A0IA 2NVYB 1CHPD 3EBEA 2XWJB 4KHZA 2OF1A 1EY9A 1S5ED 3E0JA 1PA6A 2XGTA 3G6EA 2XSCA 1GXDC 5LHY1 1HCZA 4H13C 2AWOA 4C3HH 3G7LA 3IL8A 2K01A 4TVAB 4JOIC 3J80E 2UXCQ 4AYBG 1WFQA 1K0RA 1L0WA 1WTWA 3N6RA 2NZHA 2ASBA 3HOWB 1QJOA 2R61A 1KLGD 1SNQA 2DNCA 2VW9A 2JA6H 1S3OA 4DUYQ 4C3HB 3GD7A 3NQTA 3GTKH 2R6GA 4GLVB 1PH4A 1DXMA 5KYLA 1HPCA 3E5SA 3M4OH 4NXNQ 1P8LA 2ICIA 2NVYH 2RDGA 5JEAJ 5KGUA 4HIDA 3PO2G 2Y0SG 1B50A 2CHBD 4LAAA 4X62Q 3K59A 2NVQH 1A15A 1EWCA 2B8GA 1T5XD 3STBC 1Y1VB 2CQAA 1GD7A 1LT5D 1F9RA 3ERQA 3G71A 4X62L 3L2PA 3CXCA 4EGVA 1CKNB 3A74A 2I5HA 3Q23A 1JT8A 3X3MA 1PYBA 4J6HA 1F77A 4GN3B 2JP1A 4RGTA 4DR4L 2XTIA 3EROA 2F0EA 1EQTA 2ZTCA 3OTOL 1YNNC 2R93G 3MXGA 4F7XA 2G5DA 2F0WA 3MFYA 1LABA 3MHBA 3NTHA 2D0OA 4QIWB 1VMPA 3HOWH 2IWHA 4BY7B 5ELEA 5IGCA 4GNXC 2RQXA 3H0GB 3HOUB 5FJ8G 3ULPA 4FF3A 3CW2C 1I3QB 3SEBA 3CC4A 2K75A 2VNUD 2B2WA 4Q5VA 2R93B 5FLXc 3BU2A 4DNTB 1Y1VH 1SE2A 2M9VA 1HFGA 2JEAI 2X69A 1A8VA 1G291 2VB3X 2H5XA 3FHWA 3IRBA 2EE1A 2PNHA 1RHPA 1Y1WH 1LACA 2MPMA 2PZUA 4R8NA 1PRTB 5M5XH 4HAEA 4A3CG 2QKIC 1B7YB 1JWSD 1B4OA 1PHJA 2IL8A 2BDOA 4WJ4A 1TY0A 1GHJA 4ABNA 1DOMA 1BOSA 4YY3L 2SEBD 4GNXA 2E75C 1EIHA 1KNAA 5CR3A 4UP8A 4NMZA 3NQIA 3K58A 1HUMA 1TKWB 4C56C 5I2XA 3K80C 1OXXK 2PNRC 1JB3A 4LWCA 4RGNA 4IFDI 4KHVA 1RF2D 4P72A 4JI5L 4X66Q 4GS3A 2F3VA 4A3DH 2F0DA 3GTOH 2VY3A 4FP5D 2AUJD 5A2QL 1L0YB 3M4OB 4FO2A 1JE4A 3PF5A 1LTID 3FDTA 4AH6A 5M5YB 4JBJA 3E3XA 1J6QA 4JYAL 1XTDA 4X3SA 1CQFA 5M3FG 4RHSA 2A73B 1F2ZA 4YCVA 3Q22A 3IFTA 5A35A 2Z6KC 1G6ZA 3DWPA 4XYQA 4BXXG 4B3TQ 2NUCA 3RNUA 4NXMQ 5CMDA 4ALPA 2KA7A 1QZHA 4DGZA 2B2YA 2BDNA 5CV8A 2X6GA 2QW7A 1SYDA 4L8JA 2AHOB 2M00A 1TWCH 4HCSA 2CW0D 2KEDA 3NPPA 1UE5A 3S14H 3K7AB 5BR8L 3UDGA 3KJOA 3TZUA 1STBA 3J7YW 4KY7A 1PTOH 2YTYA 1BR9A 4U673 4QCLA 2E2HB 1CQVA 4PZ6A 5BN3A 2PI2E 1DOLA 1ESFA 4DR4Q 1JB7A 1BF4A 4C3JH 1IBMQ 4BA1I 3LX0A 2O4XA 4DUZL 1VS0A 2VUMG 1GOZA 1E22A 1UE6A 3VA7A 3I4OA 1C9OA 1VQ6A 4ZKBB 3CQZB 4KJNA 3JC66 5ELBA 3WWVA 3TP6A 1GUSA 3Q8DA 1YITA 1X55A 3I4MB 4XQQA 3GTMB 3FMCA 1I94Q 2ID0A 1PTOC 1IYJB 5EBCA 5LMUL 5C3XA 1HA5A 2ZJRA 2O5JC 1K83B 4ZCKA 4APVA 2KUMA 3GTLB 2F0KA 4NP5A 3SGIA 4BBSH 2B63B 4A3KB 4B3TL 3QO2A 3I8ZA 1RL2A 5CORA 3K0YA 2DUDA 5JAVA 1CTMA 3STBD 3GP7A 2KCNA 5DNFA 4WFN3 1R9TH 3EFXD 4IUTA 1CK1A 3T1YQ 2MP1A 3ONAB 4LFCL 4A3KG 4A3EB 5IP9G 1U4RA 2YYZA 1ILQA 4XDXA 2QA4A 2QILA 3T16A 4AYBB 2JN4A 1SNPA 1EIYB 1VQOA 4TQUS 3W3AA 4GKKL 3H3VC 2VUMH 4AIMA 3QWNA 4TKOB 1DYQA 4C1NK 1HJPA 5CV7A 2G9DA 1JOOA 1OXTA 1W6JA 1UE7A 2KENA 3CP0A 3S1RB 4C3HG 1PH8A 3H94A 3KLWA 1EWIA 3A8KE 3I73A 1MBYA 1C0AA 2A6ED 1TU2B 3PQIA 4IUQA 3HKSA 1S5BD 2UU9Q 1HZBA 1SNDA 1PH5A 3SK5A 1KDAA 1TT2A 2E2HH 2JA7B 1IYVA 1HR0W 3CPFA 1D7QA 1HXYD 4DF7A 2K28A 1F2MA 1UNSA 1XXGA 2F0LA 2A69D 1HNWQ 3OMGA 4OWTB 2JA8B 2LMCB 1CSPA 1KD1C 4X65Q 1CI3M 5IGGA 1QZGA 1UEAB 1HA6A 1I4PA 2FJ2A 1J8IA 4CDFC 3W5OA 2RHQB 1WCMB 2F0TA 4B3RQ 3BDLA 5C4XB 1STAA 3OOCA 4JI7L 4AYBE 3P7JA 4KTAA 5HGTA 2D62A 1D5MC 4QMGA 4PMBA 5JEAG 1PVOA 3OTOQ 1HFNA 5I6WA 1EUJA 3K57A 3I4MH 3BJUA 1XPRA 1BCPB 4X3KA 1LV9A 4QY7A 4DV3L 1I4HA 1T5EA 3DHQA 2XNAC 4A3JG 1X32A 2K14A 4XXEA 1TWFH 3HOWG 4DV5Q 2LY7A 1I5FA 2RHSB 3D8GA 3RMHA 1WTOA 4BY1G 2D2CC 1E24A 1TS5A 2KJXA 4HIKA 1H9SB 3D4WA 2KCTA 1EY0A 3U9SA 3OW2A 3CCEA 2ZJQA 4V190 4IOAA 1PRTD 1LYLA 2I07B 3UDFA 1VF5C 2KHJA 2WACA 1IBML 1TWGB 4KY5A 1MGSA 3CAMA 4HCEA 5M5YH 5C44G 1GVPA 4JI1Q 2JEBI 1DZ1A 3GTGB 4LFBL 3HOZB 2KQ3A 5G3LF 4A3MG 1IBKL 2PMZE 4LF8L 3SR1A 1CFMA 2UXCL 2RF4A 1VQBA 1JCKB 1K8AC 2B2VA 5LL6S 1SNCA 1ILPA 3MXNB 1A3TA 1S4ZA 4FF2A 3DXJC 1STHA 4JI6Q 2HT1A 5JJZA 5H1SE 4YHHQ 4NXML 5DEHA 4XT3B 2F3WA 4HEDA 1E0BA 3KOJA 5IE8A 5EPLA 1NY4A 4YCUA 1PH2A 1F9QA 1SE8A 3NEMA 1VQ5A 1XMQQ 1WD0A 2L5TA 1OTCA 1F2YA 4XYOA 4K6DA 5IGEA 3KLSA 3A7AB 3TP8A 5M3MB 4JOIA 1DM0B 1VQAA 1C4QA 1NBWA 4IFDG 3N52A 2KEEA 1Q8IA 3TREA 3PIO3 3UDXA 2E2JH 3RN2A 2R92G 4OHJA 1PH7A 3HOUH 2IX1A 1JORA 5FLXL 5C44H 4KN4C 5IGDA 4BXXH 3J7ZC 5GAHC 1BBWA 1VQGA 3ZYYX 2PZWA 3K7UC 1HZCA 1Q1BA 4YWLA 2E8GA 4FNFA 4PQXA 1SE4A 1EU3A 4IQZA 5IIFA 1ZXTA 3I56A 5NUCA 1SYGA 2ZXOA 2IT1A 4LF8Q 2EOTA 4RGOS 1XJVA 1H95A 5KNDA 1OXUA 3ITPA 5C44B 1E1OA 4CJ0B
chains in the Genus database with same CATH topology
3PO2B 2AQ3B 2HCCA 2A6EC 1Q3LA 2CVRA 5C0XH 3R2TA 3MVVA 5DAUA 1LTTD 5K36H 5E1FA 3MXPA 2PZTA 1GUOA 3MTSA 4FXDA 3AU7A 1EQVA 4JK1C 1HHVA 3URYA 2Z4HA 2IPKD 4ZUIA 1EZ8A 4ZRZA 1TR5A 2EY1A 4XTCS 5D14A 2I46A 5FO7B 3BG3A 2RVLA 3K5NA 5I2YA 3PV0A 1TWHB 3HRZC 2R7ZB 1AEXA 1RDPD 3RZDB 1GUNA 1LO5D 5FKAC 2ICEC 5EKKA 5COYA 3CHBD 4A3IB 2M2LA 1AN8A 1WTPA 2EPBA 2K6AA 3FPPA 2J0TD 3K5OA 1DCZA 1RTOA 1BBXC 4FYDA 3CU7A 1ENCA 1D1IA 4HSVA 4UDUC 2A69C 3GTJB 1B3AA 3FRPB 1X3QA 2MHVA 4KN7C 2GA4B 4J1MA 2A74C 2EDGA 1EL0A 5D3IB 2WIIB 3GV3A 3HOYB 1Y8OB 2F0OA 2NZ1D 2JSOA 5BN4A 5C0XI 4A3JB 2KCCA 3D6WA 2TMPA 1EYCA 3OWFA 3JAML 5C6AA 4A3FB 1OXVA 4DAYA 4JBWA 3MXNA 3S17B 5M9OA 1WVLA 1GUWA 1SYBA 3BVZA 4MHEA 1SE3A 1O7ZA 1QNUA 4KKTA 2XVSA 4IUUA 5ISRA 2L9HA 4K5WA 1IW7D 1FD7D 1D5XC 4FXKC 1HQMC 1U4MA 1H9SA 1QWYA 5D3DA 1ET6A 3VA5A 2NN6H 2ENBA 4P2CB 3BVGA 3J81E 1H9JA 4MN3A 2Q8RE 3J7AV 1TS4A 1EU4A 3NTIA 1PLFA 4RKLA 2XRSD 4DFAA 4M1UB 4PNYA 3DWQA 3MAQA 5FO8B 1CM9A 1QNKA 3TP7A 3TSSA 1STGA 4C3JB 3OWEB 1J9OA 3SE0A 5G3LD 2AWNA 3VR3A 3FEWX 3HGBA 1SNMA 4NKLA 1MI2A 1YNND 3LWEA 3R8BA 2ZXPA 4K5VA 2SOBA 3TBIB 3WOFA 1R4PB 2XN9C 3TN2A 4O1NA 4KD3A 2LS01 3D4RA 1ET9A 1C8CA 4IN3A 3U9OA 4QUCA 3QG1A 1FGBD 1S5CD 1I4QA 3KUPA 1PYWD 1X3PA 5I4DA 2NBFA 3E6ZX 3NSWA 4RGMA 3SXHA 2PO4A 2L55A 2BA1A 1B1ZA 3Q24A 3V05A 5TSSA 1UUPA 1UAPA 3BS1A 2F1MA 3MFGA 2B2WC 1SYFA 3MXUA 5J1ZA 3NK9A 5E4XA 2F0MA 2QCPX 3R2IA 1XWEA 1KDBA 5IODA 4V0BA 2VB2X 4Q0FA 3HP3A 3SK6A 3RUZA 1G2SA 3SHLA 2WAQB 3D3RA 4QUFA 2EY6A 2K5WA 1C48A 3OW7A 4F8MA 3NXWA 3ND8A 1LT3D 1QE6A 2F0JA 2VXWA 1SFOB 3HOVB 2BCOA 4EQOA 4HTHA 4KI0A 1JOQA 3SK8A 1V1OA 5JPNC 1Q12A 1NAPA 2F0HA 2PW5A 5EKLA 4DU9A 4OGQC 1O7YA 2E2DC 2SNMA 3X3NA 4ULLA 1JWUD 2PPBC 1SDFA 3HZXA 3K5LA 1PDQA 5IGBA 2L0CA 3TMEA 3WDNA 4EVOA 2HDLA 3V96A 2PQEA 4IFDJ 4Y7NB 1IKLA 4K14A 1CT1D 4K5XA 4B08A 4L63B 1TIID 3AB9A 1VMCA 2BE5C 2JYOA 1HRJA 1R4QB 3S9WA 1QCBD 3GV6A 2EJGC 3PUWA 2IJ0A 4F88A 1OXSC 4H44C 5J39A 1IL8A 2PW7A 3EA6A 1BCPD 1RCVD 2SDFA 1G91A 3VYTA 1U4LA 5C4JB 1LTBD 3S1QB 2Z8LA 3K5MA 4DXFA 2QEJC 4HR7B 2C5CA 4EQPA 1EIGA 2F0FA 4K2KA 5KIXA 4WJWA 4OO1H 1MSHA 5CV4A 2Z4IA 2N88A 1MSGA 2EY2A 3A8JE 5KRUA 3DMUA 4LK1C 4CKCA 2Y0SB 4IALA 2J4XA 4A3MB 4S3SA 2HDMA 1PZJD 5DM73 5KYIA 4TSSA 2E74C 4DA2A 1S5FD 2RDFA 1DONA 2NN6G 1SMYC 2F0SA 2B8FA 3BVMA 3EQLC 1AZPA 1ENAA 1XX8A 2K33A 4OO1I 4KY6A 4BA2I 1TWCB 2J7ZA 3NE5B 5KEEA 4DN4M 2XWBB 1A2TA 2FHTA 1AFPA 2AQ2B 5D65A 4ZUJA 2MUYA 4I65A 3V2TA 1ESRA 2D9UA 3KBGA 4K8IA 1BO0A 1B44D 3T56B 2MGSA 5JEAH 4KMUC 1O80A 4E6IA 4BBSB 1HTPA 1V43A 5JPMC 1SSOA 2DN8A 5CYUA 4IUVA 2K32A 2B2UA 1IHZA 4RWSC 2NVTB 4HMJA 1YNJD 4CBVA 1IYUA 5EBDA 4CGYB 5I6YA 2Q8IB 2L12A 3I4NB 5E4WC 4G7OC 3RLFA 3Q0AA 2EYOA 1E2ZA 2IW3A 4A93B 2EJFC 4O42A 5M3FB 1FNWA 1R9TB 2FINB 1GUGA 2F4IA 2R3ZA 2WP8J 2KVMA 5M5WB 4ZYSA 1JWMD 5C0XJ 5CBEE 1EYAA 1JC7A 3ND9A 3D4DA 2RSNA 5IOCA 3EVQA 3I4LA 1F2LA 1B9NA 2BA0A 4ZLTF 2NN6I 4LMQD 1EEID 4OIJA 5JVH3 4G57A 4M8AA 1CA5A 5C3EB 3OSOA 2K5QA 4YIJA 4LJZC 1B2TA 1W6KA 1I4RA 3VR2A 1DJRD 4IFDH 2YU9B 1EEFD 1WD1A 3FPUB 5FK9C 4R9WA 1K8MA 1F9PA 4NDXA 3S16B 3J81L 1KNEA 3A56A 3S2DB 1SEBD 1NSNS 2E2JB 3I70A 5JVG3 1ICWA 5EPJA 4L6TB 4KKUA 2NB0A 2DY8A 1ML0D 2JE6I 1RTNA 4DK0A 2V4DA 2B2TC 1ZYRD 5EJWA 2L1BA 1NUCA 3I90A 1PFBA 1CZGA 1F9SA 2QF7A 1GUTA 3NWSA 3DWAA 1Q90A 1TY2A 1S5DD 5ELDA 1PTOD 5M5XB 1D1KA 1GHKA 5K36G 1JR0D 2X6LA 3KK7A 2ZT9C 1Z6HA 4IUNA 2F03A 3EJIA 2OXPA 1LTGD 4C3IG 1B9MA 2IX0A 1QG7A 3F2UA 3BYYB 3PMFA 1KDCA 2NVXB 4G7HC 2NYZD 1QB5D 2D5DA 1LTSD 3NBIA 1Y8NB 1BCPF 3PUXA 3P20A 3VYSA 2F0VA 2L4NA 3KF8A 3MWYW 1SAPA 4RAUC 4A3GB 5HURA 1PTOF 1D2BA 4N9PA 3A54A 1XTCD 1HQRD 1IKMA 1TWAB 3TZDA 3UI2A 1SXTA 4R8IA 3C2PA 3O13A 1K8OA 2EYFA 4CKBA 2MJ8A 3IAYA 4X3UA 1D5ZC 5EKIA 2H1EA 4H0LC 1G2TA 5K5PA 4EQNA 4ZAIA 2WV6D 4BS9A 1STNA 2K5DA 3GTOB 2WKDA 5J22A 3DEOA 2LKVA 3K6OA 1LT4D 4FVMA 1TS2A 5EQ0A 3M7NA 4ILWA 1E2VA 3J80L 4ZQ3A 4RHRA 4C3JG 4PMCA 5EGTA 3C1FA 5I9OA 5KNCA 1BUVT 1A3VA 3PIP3 4XQNA 2B2VC 1XYIA 2A68C 1TS3A 4ODGA 3S15B 1V8QA 1EOTA 3JAME 4K6LA 3QIAA 1EZ6A 4XQJA 3C3LA 1KTKA 2F0NA 1RJTA 1PRTC 3QJYA 2WB1B 3GTPB 1GJXA 3PO3B 3A55A 4IZ8A 1WTRA 4C3IB 3M3YB 4HSPA 3BDCA 5C0XG 1SMYD 1EYDA 4OIKA 5T1GA 3IFDA 2BE5D 5AFWA 2KHSA 3M7GA 3SDZA 1A3UA 1QOHA 1PZKD 5ELCA 2EJMA 1ENFA 1WTVA 4C1NI 4RFBA 3OIQA 2OT2A 4WRDA 1Q1EA 1LT6D 1SBBB 5A2QE 1Z47A 3GO5A 1JICA 2RDHA 2H4OA 3KLRA 3R3OA 1Y8PB 3S2HB 1SJHD 1JQYD 4X3TA 3VYRA 4DNRB 1PZID 5ELFA 3M85A 3VR5A 2A6HD 5IT9E 4B9XA 2QDBA 1OO9B 4OO1G 1FYCA 2K03A 3BYTB 2A5HA 1CA6A 1O7LA 4ID6A 5FLXE 3VR6A 2FFKB 4QB4A 1SNOA 2WINB 3D31A 3P75A 4FF1A 4XIGS 2XRQD 4F87A 1RKNA 1A2UA 1TQOA 1LTRD 1V1PA 2F0PA 5T1IA 1DD2A 5C5LA 4RKBA 1CHQD 1M4VA 3VR4A 2NTSA 3T51B 1FNVA 1AP0A 3D6CA 1M8AA 3FVQA 2ZXRA 4RCOA 3I72A 1PFNA 4Z9CB 1RODA 4ME5A 1KABA 3FKIB 4HMIA 5IGFA 2NWGA 1H9RA 5LL6X 4PMWA 5C4ZA 2B2YC 3P1HA 5FO9B 3MEHA 3PUYA 3NHHA 2PYKA 2K05A 1WTXA 1IW7C 1STEA 3Q6SA 5CBAE 3MA2B 2O5IC 1WTQA 3TP5A 1U9RA 3T4AC 3S1MB 1H9KA 2AQ1B 4ZK9B 3GTKB 2E76C 2JA5B 2F0QA 1TVXA 1BQQT 1II3A 4A3BB 3I91A 3SVMA 3CRKC 2DNEA 4MIUA 3RD4A 2KOLA 3H91A 1SYCA 2F0UA 4DAPA 4IUPA 2SNSA 2Q8TA 1PFMA 1MD2D 4ZKCB 3MC0B 5CV5A 4B9WA 1CZWA 4J8QA 4QF4A 3IKJA 2NVQB 2Z1CA 3L7ZC 1FNUA 1STYA 2EY5A 1I4XA 5CV6A 1RD9D 2RA4A 2EYLA 3A7LA 5BN5A 1PRTF 2A68D 4GZYC 2DY7A 3T53B 5CGKA 4TRDA 1EY7A 2EYPA 1VF7A 4N9TA 1KAAA 2XIWA 3S14B 2K7VA 2F0IA 3R93A 2F0GA 1O78A 3KBXA 3M4YA 1EY6A 4PV1C 4RH6A 4U68A 5E3FA 1NR4A 2JA6B 2B2UC 2R92B 1AW7A 1NCVA 2E2IB 2NTTA 1YNJC 4C2MB 4CHTB 3OMCA 1L0XB 4UAIA 1D6EC 4KV6A 4K2LA 4DAVA 1EY8A 3H6MA 1KLUD 3TDQA 3NP8A 2JXMB 2EXZA 5C3WA 2LFNA 3GTQB 1H9MA 5DM63 1EY5A 1ZYRC 3T13A 2A6HC 4NW2A 1Y1WB 2EVBA 5FOBB 4K8JA 1BNZA 3NTKA 1EY4A 1HUNA 3DM1A 4FXGC 2OEOA 4HN7A 1Y69U 4G4KA 2HUGA 1U4PA 3LNNA 4CKEA 2O2LD 4G7ZC 1AZQA 2B39A 5C4HA 3HEJA 5I9PA 3HOXB 2FMMA 4OL7A 2PCFB 2EZVA 3NBHA 1DOKA 3KLSX 1G8ZD 2KECA 2K1BA 1BXTA 1PTOB 4DK1A 3NWTA 3CRLC 5IT9L 3VYUA 2BOSA 2G9HD 1VCIA 3SK4A 4FF4A 3HG9A 3H09A 2RBMA 4KJOA 1ONLA 2EYJA 1JOKA 5KNBA 1QILA 3OHXC 3C1EA 5EPKA 1I6HB 4BWGB 1B53A 5CV9A 1I4GA 1SYEA 3QB3A 3DEPA 5CC4A 3W2DA 5JOBA 3DUZA 2TSSA 3S1NB 2VUMB 3BDOA 3HKZB 4CJ1B 4CJ2C 1LLRD 3L9AX 1A6XA 2B2TA 1NR2A 1I50B 3A8IE 1BDOA 3AMUA 3NUCA 3L3OC 4KKSA 3GQBA 3RZOB 3WOEA 5F2DA 3I3CA 3G6JB 4BBRB 2PMZB 1E2WA 2HQEA 3CKIB 1LTAD 4IURA 1EWHA 2HCIA 4A3DB 3QOLA 1SJED 5C5MA 4DXGA 2C9OA 2K04A 1FR3A 1BCPC 4RA8A 2FMCA 2EYMA 2L11A 1ZEQX 2RKSA 1Z7TA 1HTLD 1TWFB 2N55A 4BY1B 3HS0C 4H7BA 4XT1B 3BZDB 3PUVA 1EFID 3OIPA 2IX3A 1PXUA 3PUZA 4KD4A 4KK7A 1ZKOA 4RCNA 2EYHA 3LWUA 3OPOA 1PMRA 3MZ5A 1VDZA 3QOJA 4I7ZC 2CW0C 1I6VC 1V1PB 3C46A 3J7AF 2RSOA 2WKCA 2AUKA 4WORA 2NVYB 1CHPD 4KHZA 2XWJB 2OF1A 1EY9A 1S5ED 3E0JA 2XSCA 1GXDC 5LHY1 1HCZA 4H13C 2AWOA 3G7LA 3IL8A 2K01A 3J80E 1WTWA 3N6RA 3HOWB 1QJOA 2R61A 1KLGD 1SNQA 2DNCA 4C3HB 3GD7A 3NQTA 2R6GA 1DXMA 5KYLA 1HPCA 3E5SA 2ICIA 5JEAJ 2RDGA 5KGUA 1B50A 2CHBD 4LAAA 3K59A 1A15A 1EWCA 2B8GA 1T5XD 1Y1VB 2CQAA 1LT5D 1F9RA 3ERQA 4EGVA 3Q23A 3X3MA 4J6HA 1F77A 2JP1A 4RGTA 3EROA 2F0EA 1EQTA 1YNNC 3MXGA 4F7XA 3NTHA 2F0WA 3MFYA 1LABA 3MHBA 4QIWB 1VMPA 2IWHA 4BY7B 5ELEA 5IGCA 2RQXA 3H0GB 3HOUB 4FF3A 1I3QB 3SEBA 2VNUD 2B2WA 4Q5VA 2R93B 4DNTB 1SE2A 2M9VA 1HFGA 2JEAI 2X69A 1G291 2VB3X 2EE1A 1RHPA 1LACA 2MPMA 2PZUA 4R8NA 1PRTB 4HAEA 2QKIC 1JWSD 1B4OA 2IL8A 2BDOA 1TY0A 1GHJA 4ABNA 1DOMA 1BOSA 2SEBD 2E75C 1EIHA 1KNAA 5CR3A 4NMZA 3NQIA 3K58A 1HUMA 1TKWB 4C56C 5I2XA 1OXXK 2PNRC 1JB3A 4RGNA 4IFDI 4KHVA 1RF2D 2F3VA 2F0DA 4FP5D 2AUJD 5A2QL 1L0YB 3M4OB 4FO2A 1JE4A 1LTID 3FDTA 5M5YB 4X3SA 1CQFA 4RHSA 2A73B 1F2ZA 3Q22A 3IFTA 5A35A 1G6ZA 3DWPA 4XYQA 2NUCA 5CMDA 2KA7A 4DGZA 2B2YA 2BDNA 5CV8A 2X6GA 1SYDA 2M00A 4L8JA 4HCSA 2CW0D 2KEDA 3NPPA 3K7AB 3TZUA 1STBA 3J7YW 1PTOH 4KY7A 1BR9A 4U673 4QCLA 2E2HB 1CQVA 5BN3A 1DOLA 1ESFA 1BF4A 4BA1I 3LX0A 2O4XA 1GOZA 3VA7A 4ZKBB 3CQZB 4KJNA 5ELBA 3TP6A 1GUSA 3I4MB 4XQQA 3GTMB 3FMCA 2ID0A 1PTOC 5EBCA 5C3XA 1HA5A 2O5JC 1K83B 2KUMA 3GTLB 2F0KA 4NP5A 2B63B 4A3KB 3I8ZA 3QO2A 5CORA 3K0YA 5JAVA 1CTMA 3GP7A 2KCNA 5DNFA 4WFN3 3EFXD 4IUTA 1CK1A 2MP1A 3ONAB 4A3EB 1U4RA 2YYZA 1ILQA 4XDXA 2QILA 3T16A 4AYBB 1SNPA 4TQUS 3W3AA 3H3VC 3QWNA 4TKOB 1DYQA 4C1NK 5CV7A 2G9DA 1JOOA 1OXTA 1W6JA 3S1RB 4C3HG 3H94A 3A8KE 3I73A 1MBYA 2A6ED 1TU2B 4IUQA 1S5BD 1SNDA 3SK5A 1KDAA 1TT2A 2JA7B 1IYVA 1HXYD 4DF7A 2K28A 1F2MA 1UNSA 1XXGA 2F0LA 2A69D 3OMGA 2JA8B 2LMCB 1CI3M 5IGGA 1UEAB 1HA6A 1I4PA 2FJ2A 1J8IA 1WCMB 2F0TA 3BDLA 5C4XB 1STAA 3OOCA 3P7JA 4KTAA 5HGTA 2D62A 1D5MC 4QMGA 4PMBA 5JEAG 1HFNA 5I6WA 3K57A 1BCPB 4X3KA 1LV9A 1I4HA 1T5EA 3DHQA 2XNAC 1X32A 4XXEA 2LY7A 3D8GA 1WTOA 3RMHA 2D2CC 1TS5A 2KJXA 1H9SB 3D4WA 1EY0A 3U9SA 4V190 1PRTD 2I07B 1VF5C 2WACA 1TWGB 4KY5A 1MGSA 4HCEA 2JEBI 1DZ1A 3GTGB 3HOZB 2KQ3A 5G3LF 3SR1A 1CFMA 1JCKB 2B2VA 5LL6S 1SNCA 1ILPA 1A3TA 1S4ZA 4FF2A 3DXJC 1STHA 5JJZA 5DEHA 4XT3B 2F3WA 4HEDA 1E0BA 5EPLA 1F9QA 1WD0A 2L5TA 1F2YA 4XYOA 4K6DA 5IGEA 3KLSA 3A7AB 3TP8A 5M3MB 1DM0B 1C4QA 4IFDG 3N52A 2KEEA 1Q8IA 3PIO3 4OHJA 2IX1A 1JORA 5FLXL 4KN4C 5IGDA 3ZYYX 2PZWA 1Q1BA 4FNFA 4PQXA 1SE4A 1EU3A 4IQZA 5IIFA 1ZXTA 5NUCA 1SYGA 2ZXOA 2IT1A 2EOTA 4RGOS 5KNDA 1OXUA 3ITPA 5C44B 4CJ0B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MXG A;  1QNU A;  1R4P B;  4P2C B;  4ULL A;  2XSC A;  2C5C A;  1CZG A;  2GA4 B;  2BOS A;  1R4Q B;  1BOS A;  1D1K A;  1DM0 B;  1QOH A;  1C4Q A;  4M1U B;  1CZW A;  1CQF A;  1C48 A;  1D1I A; 
#chains in the Genus database with same CATH topology
 2MNA A;  3S1Q H;  1KIX A;  3PO2 B;  4DPG A;  3KYH C;  2AQ3 B;  2HCC A;  2A6E C;  4OEM B;  3VDY A;  1Q3L A;  1KXL A;  1VQC A;  2CVR A;  5C0X H;  3R2T A;  5AJ3 L;  3MVV A;  3ULJ A;  4DR7 L;  5DAU A;  1LTT D;  1NJI C;  5K36 H;  5E1F A;  3MXP A;  4DR2 L;  3PO2 H;  1KAW A;  2PZT A;  1GUO A;  3QR8 A;  1E7Z A;  3MTS A;  3KDF A;  2R7Z H;  3AFP A;  4FXD A;  3AU7 A;  1EQV A;  4JK1 C;  1HHV A;  3URY A;  3CCR A;  2Z4H A;  2IPK D;  4ZUI A;  1EZ8 A;  4ZRZ A;  1TR5 A;  2EY1 A;  4OWW B;  2OQ0 A;  4XTC S;  5D14 A;  4GLA C;  2I46 A;  5FO7 B;  3BG3 A;  2RVL A;  2Z0S A;  3K5N A;  5I2Y A;  3PV0 A;  4RG1 A;  1TWH B;  4UP7 A;  3HRZ C;  2R7Z B;  1AEX A;  5IYC H;  3CCJ A;  1RDP D;  3RZD B;  1GUN A;  1LO5 D;  5FKA C;  2ICE C;  4B3S L;  5EKK A;  5COY A;  5HGQ A;  5GAE C;  1Q7Y C;  2ALY B;  3CHB D;  5C4J H;  4A3I B;  4R4Q A;  1X6O A;  2VQF Q;  2M2L A;  1PYS B;  1AN8 A;  2ZTE A;  1WTP A;  2EPB A;  2K6A A;  3FPP A;  2J0T D;  3K5O A;  1DCZ A;  1RTO A;  4X65 L;  1BBX C;  4FYD A;  3CU7 A;  1ENC A;  5M3M G;  2A8V A;  1D1I A;  4HSV A;  4UDU C;  2A69 C;  4RMF A;  1VQ8 A;  2Z6B A;  3GTJ B;  1B3A A;  3FRP B;  1X3Q A;  2MHV A;  4DR6 Q;  4KN7 C;  3H15 A;  2EIF A;  1QVC A;  2GA4 B;  4J1M A;  2A74 C;  2EDG A;  1EL0 A;  5D3I B;  2WII B;  3GV3 A;  3HOY B;  1Y8O B;  1IL2 A;  1U5K A;  2F0O A;  3E9I A;  3S17 H;  3CCV A;  4L5S A;  3GTL H;  2NZ1 D;  3GTJ H;  1L2F A;  2JSO A;  5BN4 A;  5C0X I;  1GKH A;  2KCC A;  3D6W A;  1WOC A;  4A3J B;  2TMP A;  2Z9H A;  4O0A A;  3RLN A;  4A3E G;  4GKK Q;  1EYC A;  5IYB H;  3OWF A;  1P16 A;  3JAM L;  5C6A A;  1M90 C;  4A3F B;  1ICF B;  1OXV A;  4DAY A;  4JBW A;  3MXN A;  2ATW A;  3S17 B;  2N49 A;  4DAM A;  5M9O A;  1GM5 A;  5C3E G;  2N8N A;  1WVL A;  4QJF A;  1GUW A;  1SYB A;  3BVZ A;  4MHE A;  3G4S A;  3PIP A;  1SE3 A;  1O7Z A;  1QNU A;  4KKT A;  1J5E L;  5IYC G;  2QGQ A;  4JI6 L;  2XVS A;  4IUU A;  1HR0 L;  1XNQ Q;  5ISR A;  4R4I A;  4BY1 H;  3PIO A;  2L9H A;  4K5W A;  1XMO L;  2B63 H;  4AQY L;  1X54 A;  1IW7 D;  1IBK Q;  1FD7 D;  1D5X C;  4FXK C;  1HQM C;  1U4M A;  1H9S A;  1QWY A;  5D3D A;  1ET6 A;  3VA5 A;  2WAQ G;  1K9M C;  2JA6 G;  3CCM A;  2NN6 H;  2ENB A;  2MQH A;  4P2C B;  3BVG A;  3J81 E;  1YI2 A;  1H9J A;  2HIX A;  1HZ9 A;  4MN3 A;  2R7D A;  2Q8R E;  4A3E H;  3J7A V;  1TS4 A;  4DUZ Q;  3W1B A;  1EU4 A;  1SRO A;  3NTI A;  1PLF A;  4RKL A;  2XRS D;  2KCM A;  4M1U B;  4DFA A;  1FJG Q;  1Q8K A;  4PNY A;  2Q2T A;  4EX5 A;  3DWQ A;  4JBM A;  3MAQ A;  5FO8 B;  1CM9 A;  1QNK A;  3TP7 A;  2JA9 A;  3TSS A;  1STG A;  4C3J B;  3OWE B;  1J9O A;  3KF6 B;  4QGU A;  3SE0 A;  5G3L D;  1B8A A;  2AWN A;  3VR3 A;  5GAG C;  3FEW X;  3HGB A;  2GVB A;  1SNM A;  4NKL A;  1MI2 A;  3TRZ A;  1YNN D;  1G6P A;  3LWE A;  4YCW A;  3R8B A;  2ZXP A;  4K5V A;  2SOB A;  4JPB W;  1IZ6 A;  3AYH B;  3TBI B;  3WOF A;  1VQI A;  1R4P B;  2XN9 C;  3GTM H;  1YHB A;  3TN2 A;  1Y14 B;  4O1N A;  2EXD A;  1N33 Q;  4KD3 A;  2LS0 1;  5FJ8 H;  4O2D A;  3J81 i;  4GOP B;  5IT9 c;  3D4R A;  1ET9 A;  1C8C A;  4IN3 A;  3U9O A;  4QUC A;  3QG1 A;  4A3K H;  1FGB D;  1S5C D;  5IP9 H;  1I4Q A;  3KUP A;  1PYW D;  1X3P A;  5I4D A;  2NBF A;  4P75 A;  4HIM A;  3HKZ E;  3E6Z X;  3NSW A;  4RGM A;  3SXH A;  2PO4 A;  1VQM A;  2L55 A;  3HOV H;  3RLO A;  4A4I A;  1Y1W G;  2BA1 A;  1B1Z A;  3Q24 A;  3V05 A;  2K4K A;  5TSS A;  1UUP A;  1UAP A;  5HY6 A;  3BS1 A;  4N8X 1;  1BBU A;  2F1M A;  3GDE A;  3MFG A;  1N33 L;  4A3B G;  5EAY A;  4DAY B;  3KF8 B;  3S24 A;  2B2W C;  1SYF A;  1ASY A;  3MXU A;  5J1Z A;  2MO0 A;  3NK9 A;  5IP7 H;  5E4X A;  2F0M A;  2QCP X;  3CCQ A;  1K73 C;  3R2I A;  1XWE A;  1KDB A;  5IOD A;  4V0B A;  4GLX A;  3PGZ A;  1TXY A;  3S1M H;  2VB2 X;  3FKI H;  4Q0F A;  3HP3 A;  3SK6 A;  2IY5 B;  5GRO A;  1VQ4 A;  3RUZ A;  1G2S A;  3SHL A;  2WAQ B;  3D3R A;  4LNQ A;  2YV5 A;  4QUF A;  1B3Q A;  1EOV A;  2EY6 A;  1PH3 A;  2K5W A;  3B6Y A;  1C48 A;  2R7Z G;  3OW7 A;  2LSS A;  4F8M A;  3NXW A;  3ND8 A;  1LT3 D;  1QE6 A;  1SLJ A;  2F0J A;  2VXW A;  1SFO B;  3CC7 A;  2ZM6 Q;  5JJI A;  3HOV B;  2BCO A;  4EQO A;  4A3I G;  4HTH A;  4A3G H;  4KI0 A;  3I55 A;  1JOQ A;  3SK8 A;  1V1O A;  1FGU A;  4MZ9 A;  1Q12 A;  5JPN C;  1NAP A;  2F0H A;  2PW5 A;  5EKL A;  4DU9 A;  4OGQ C;  1O7Y A;  4DKA C;  2E2D C;  1N32 Q;  2SNM A;  2HQL A;  1TWA H;  4ULL A;  3X3N A;  1JWU D;  2P5Z X;  2PPB C;  2CCZ A;  1XMO Q;  1SDF A;  5M3M H;  3HZX A;  5IYB G;  3CME A;  2B3G A;  3K5L A;  1PDQ A;  5E7N A;  5IGB A;  2L0C A;  2OTL A;  2ZM6 L;  3FKI G;  3TME A;  3AQQ A;  3MEF A;  3WDN A;  2MFI A;  4EVO A;  4YWK A;  2HDL A;  3V96 A;  2PQE A;  1I3Q H;  4IFD J;  4Y7N B;  1IKL A;  4DUY L;  3HOY G;  4K14 A;  2A19 A;  1CT1 D;  4K5X A;  4B08 A;  1KL9 A;  4L63 B;  3CCS A;  2OCE A;  1TII D;  3AB9 A;  1VMC A;  2BE5 C;  2JYO A;  1HRJ A;  1R4Q B;  3S9W A;  1QCB D;  3GV6 A;  2EJG C;  3PUW A;  3PO3 G;  2IJ0 A;  1JJ2 A;  4P74 A;  4F88 A;  1OXS C;  4H44 C;  5J39 A;  2NVT H;  1IL8 A;  2PW7 A;  3EA6 A;  1BCP D;  1RCV D;  2SDF A;  3ERS X;  1G91 A;  3VYT A;  1U4L A;  5C4J B;  1LTB D;  1Q46 A;  3S1Q B;  2Z8L A;  3K5M A;  4DXF A;  2QEJ C;  4HR7 B;  1EYG A;  3PSI A;  2C5C A;  4EQP A;  1XNR Q;  1X9N A;  1EIG A;  2F0F A;  4K2K A;  5KIX A;  4WJW A;  4OO1 H;  1MSH A;  2VQE L;  5CV4 A;  2Z4I A;  4OON A;  2N88 A;  3ULL A;  1MSG A;  2EY2 A;  3A8J E;  5KRU A;  3DMU A;  4LK1 C;  2JK8 A;  4CKC A;  1KC8 C;  4OX9 Q;  2Y0S B;  3S15 H;  4IAL A;  3HOU G;  2J4X A;  1O7I A;  4DV6 L;  4CDE C;  4A3M B;  4S3S A;  2HDM A;  1PZJ D;  2UUB L;  4A76 A;  4YY3 Q;  5DM7 3;  4TSS A;  5KYI A;  2E74 C;  4DA2 A;  1S5F D;  2K52 A;  2RDF A;  3UDI A;  1DON A;  2OTJ A;  2NN6 G;  2B63 G;  1SMY C;  2F0S A;  2B8F A;  3BVM A;  4A3L H;  2VQF L;  3EQL C;  1AZP A;  1ENA A;  1XX8 A;  4LF4 L;  3AEV A;  2K33 A;  4OO1 I;  4KY6 A;  4BA2 I;  3UE0 A;  1TWC B;  2J7Z A;  4PG3 A;  2F3I A;  4KHP L;  3NE5 B;  4DV2 Q;  5KEE A;  2ZTD A;  1E3P A;  3HOZ G;  4DN4 M;  2XWB B;  1A2T A;  2FHT A;  1HNZ Q;  1I6H H;  1AFP A;  2AQ2 B;  4JVZ A;  5D65 A;  3RN5 A;  4ZUJ A;  2MUY A;  4I65 A;  3V2T A;  2LXK A;  1ESR A;  2D9U A;  3KBG A;  5M3F H;  1UE1 A;  1MIU A;  4N8F A;  4X64 L;  4DV0 L;  4K8I A;  1BO0 A;  2B29 A;  1B44 D;  3T56 B;  2MGS A;  5JEA H;  4KMU C;  3RR5 A;  4K0K Q;  1O80 A;  4E6I A;  4BBS B;  1HTP A;  1V43 A;  5JPM C;  1UEB A;  1SSO A;  2N78 A;  2WAQ E;  4DR7 Q;  2DN8 A;  5CYU A;  2UXB L;  4IUV A;  2K32 A;  2B2U A;  1IHZ A;  4RWS C;  4A3J H;  2NVT B;  3T1H Q;  4HMJ A;  1YNJ D;  4KHP Q;  4CBV A;  1IYU A;  5EBD A;  3U50 C;  4CGY B;  5I6Y A;  3K8A A;  3RZO H;  1IXR A;  1VQJ A;  2Q8I B;  4A3B H;  2L12 A;  3PCO B;  2F52 A;  1K83 H;  3I4N B;  5E4W C;  4AQY Q;  4G7O C;  3RLF A;  3Q0A A;  3K7A H;  2EYO A;  1E2Z A;  4NXN L;  2IW3 A;  4A93 B;  2EJF C;  2DJG C;  3PF4 A;  4O42 A;  1VQH A;  1FNW A;  5M3F B;  4DV6 Q;  4UPA A;  4DV1 L;  1R9T B;  2FIN B;  1GUG A;  2F4I A;  2R3Z A;  2WP8 J;  2KVM A;  5M5W B;  1EFW A;  4ZYS A;  4JI3 L;  3J7A 5;  1JWM D;  5C0X J;  5CBE E;  1K8G A;  1EYA A;  2IHF A;  4A3M H;  1JC7 A;  3ND9 A;  3D4D A;  2RSN A;  4HJ8 A;  5IOC A;  4A3L G;  3EVQ A;  1LUZ A;  3I4L A;  1F2L A;  1B9N A;  2BA0 A;  1IBL L;  4ZLT F;  2NN6 I;  4LMQ D;  1Q81 C;  4LF5 L;  1YEZ A;  2K5H A;  1VQP A;  2HHH Q;  1EEI D;  4OIJ A;  2UXD L;  5JVH 3;  4G57 A;  4M8A A;  3F1Z A;  4IJL A;  1CA5 A;  5C3E B;  3OSO A;  3M4P A;  4C3I H;  4PZ7 A;  1CKO A;  2K5Q A;  4YIJ A;  2UUC Q;  2HHH L;  4JI4 Q;  4LF9 Q;  4LJZ C;  2E5L L;  1B2T A;  1CUK A;  1YBY A;  1W6K A;  1X3F A;  2IHE A;  1I4R A;  5C3E H;  3S2D H;  1TWG H;  3VR2 A;  1DJR D;  4IFD H;  4PZ8 A;  2YU9 B;  1WYD A;  1EEF D;  4LFB Q;  3CPW A;  1WD1 A;  3FPU B;  5FK9 C;  4R9W A;  1K8M A;  2ES2 A;  4UP9 A;  1F9P A;  5M5W H;  4A3G G;  3LGJ A;  4NDX A;  3S16 B;  1XPO A;  4JV5 Q;  3J81 L;  1KNE A;  3A56 A;  3H0G G;  2F4V L;  3S2D B;  1SEB D;  4JI2 L;  1NSN S;  4IO9 A;  2E2J B;  3I70 A;  1CKN A;  5JVG 3;  1ICW A;  2HD3 A;  5EPJ A;  4L6T B;  3W1G A;  5LMN L;  4LF7 Q;  4KKU A;  2NB0 A;  4R4O A;  2DY8 A;  1ML0 D;  3L0O A;  4JW0 A;  1PV4 A;  2JE6 I;  1RTN A;  4DK0 A;  2V4D A;  4MTK A;  2B2T C;  1ZYR D;  5EJW A;  2CH4 W;  4JI8 Q;  2L1B A;  2I5L X;  1NUC A;  2C35 B;  3I90 A;  1DGS A;  1CZG A;  1F9S A;  1PFB A;  2QF7 A;  3ZJY C;  1GUT A;  3NWS A;  2UXB Q;  3DWA A;  1Q90 A;  1TY2 A;  1LM0 A;  1S5D D;  5ELD A;  1PTO D;  5M5X B;  1X56 A;  1D1K A;  1GHK A;  5K36 G;  3I7F A;  3U4V A;  4JI8 L;  1JR0 D;  2X6L A;  3KK7 A;  2ZT9 C;  4JI7 Q;  4DNI A;  1Z6H A;  4X64 Q;  2YTX A;  2JA8 H;  3TEH B;  4IUN A;  3A5Z B;  1PH1 A;  2F03 A;  2BH2 A;  3EJI A;  1NMF A;  1LTL A;  4LF7 L;  1CSQ A;  2LXJ A;  2OXP A;  1VQ9 A;  1LTG D;  4C3I G;  1B9M A;  2IX0 A;  1QG7 A;  1YJN A;  3F2U A;  1SR3 A;  2F4V Q;  3BYY B;  3PMF A;  2KHI A;  1NNX A;  1KDC A;  4JBK A;  2NVX B;  5IWA Q;  4G7H C;  2NYZ D;  1QB5 D;  2D5D A;  4DR3 Q;  1RIP A;  1LTS D;  3NBI A;  1Y8N B;  1BCP F;  4CDD C;  3PUX A;  3P20 A;  3VYS A;  4LUO A;  2F0V A;  2L4N A;  3KF8 A;  4A3D G;  3MWY W;  1SAP A;  4RAU C;  4A3G B;  4A3F G;  5HUR A;  1PTO F;  3NEN A;  1D2B A;  2UUB Q;  4N9P A;  3A54 A;  1XTC D;  1YHQ A;  1HQR D;  4BBR G;  1JJC B;  4EQ5 A;  5C4X G;  1IKM A;  3H0G H;  4A75 A;  1TWA B;  2VZA A;  3TZD A;  1YHA A;  5IYD H;  3CF5 A;  3UI2 A;  2D0P A;  1SXT A;  4JI0 Q;  4R8I A;  2CFM A;  3O13 A;  3C2P A;  1K8O A;  2EYF A;  5J3B A;  5ELN A;  4CKB A;  2A1A A;  3HOV G;  2MJ8 A;  3IAY A;  1YJ9 A;  1QUQ A;  4X3U A;  1D5Z C;  5EKI A;  2UXD Q;  2H1E A;  4H0L C;  4DV4 L;  1G2T A;  5K5P A;  4EQN A;  4ZAI A;  4WJ3 M;  1VQL A;  1XNR L;  2WV6 D;  4BS9 A;  1VQF A;  1STN A;  1XPU A;  1QUQ B;  1XMQ L;  4C2M H;  2K5D A;  3S2H H;  3GTO B;  2WKD A;  5J22 A;  3DEO A;  1HNX L;  2LKV A;  3K6O A;  1SN8 A;  1GO3 E;  3EN2 A;  4JI0 L;  1LT4 D;  4FVM A;  2NVX H;  1TS2 A;  2CWP A;  5EQ0 A;  4YHH L;  3M7N A;  4ILW A;  4POF A;  3CQZ H;  1E2V A;  3J80 L;  1BKB A;  4ZQ3 A;  3I4N H;  4RHR A;  4C3J G;  4GNX B;  4PMC A;  5EGT A;  5LMU Q;  3C1F A;  1FVI A;  2I0Q A;  5I9O A;  2OWO A;  5KNC A;  1BUV T;  1A3V A;  1WI5 A;  3D0F A;  3F2D A;  1K0S A;  3PIP 3;  3OYY A;  3HOX H;  3DLL A;  1K28 A;  4A3F H;  4XQN A;  2B2V C;  1XYI A;  3KF6 A;  2A68 C;  1A63 A;  1TS3 A;  4ODG A;  4HJ7 A;  3S15 B;  2R92 H;  1V8Q A;  1EOT A;  4YWM A;  4DR3 L;  4BBR H;  3JAM E;  4OWX B;  4K6L A;  2DGY A;  3QIA A;  4HJA A;  1EZ6 A;  1N9W A;  3T1H L;  2OQK A;  2PI2 A;  4XQJ A;  4BY7 G;  4I7A A;  3A5U A;  3C3L A;  1KTK A;  2F0N A;  4IPG A;  1RJT A;  1PRT C;  4A3I H;  3QJY A;  4IPC A;  1YNX A;  2WB1 B;  3GTP B;  5FLM H;  1GJX A;  1VQE A;  3PO3 B;  3UE1 A;  3A55 A;  4IZ8 A;  1WTR A;  4C3I B;  1TWH H;  4X6A H;  4LF6 Q;  3M3Y B;  4HSP A;  1JJG A;  3BDC A;  5C0X G;  5BR8 Q;  1SMY D;  4UHV A;  1EYD A;  4OIK A;  1BVS A;  5T1G A;  3IFD A;  2BE5 D;  5AFW A;  2KHS A;  3M7G A;  3SDZ A;  1ASZ A;  1A3U A;  3S1R H;  1QOH A;  3U58 A;  1PZK D;  5ELC A;  5ELO A;  2EJM A;  1M1K C;  1ENF A;  2Z6K A;  1J5E Q;  1WTH A;  3HOY H;  1WTV A;  4C1N I;  4RFB A;  5IY0 A;  2Q2I A;  3OIQ A;  4QQB X;  2OT2 A;  4WRD A;  1Q1E A;  3TS2 A;  1LT6 D;  1SBB B;  5A2Q E;  1Z47 A;  3GO5 A;  2WFW A;  1JIC A;  2RDH A;  2H4O A;  3I2Z A;  1VQK A;  2FXQ A;  3KLR A;  3R3O A;  1MKH A;  1Y8P B;  3S2H B;  4JI5 Q;  1N34 L;  4POG A;  4CDC C;  4QIW E;  1SJH D;  2RCN A;  1JQY D;  2QEX A;  3NBH B;  4X3T A;  3VYR A;  3ER0 A;  4L5R C;  4DNR B;  4GKJ Q;  1PZI D;  4L5Q A;  5ELF A;  1AH9 A;  3M85 A;  3VR5 A;  3M3Y H;  2A6H D;  5IT9 E;  4B9X A;  2QDB A;  1Q82 C;  1OO9 B;  3CCU A;  2VQE Q;  4OO1 G;  1FYC A;  1I50 H;  4A93 H;  2K03 A;  1MJE A;  3BYT B;  2A5H A;  2N3S A;  1O7L A;  4ID6 A;  1CA6 A;  5FLX E;  4HIO A;  1YZ6 A;  3VR6 A;  2E5L Q;  4LF9 L;  4DR6 L;  2FFK B;  4GKJ L;  4QB4 A;  1SNO A;  3J80 i;  2WIN B;  3FP9 A;  3D31 A;  4JC0 A;  3P75 A;  4FF1 A;  3TQY A;  4XIG S;  2XRQ D;  4F87 A;  2GVA A;  4DR1 L;  4LFA Q;  1N34 Q;  2V1C C;  1RKN A;  1A2U A;  3H3V H;  2PQA B;  4LF5 Q;  3E0E A;  1TQO A;  1LTR D;  3T1Y L;  1V1P A;  2F0P A;  1PFS A;  3F2B A;  3K0X A;  4P71 A;  1E1T A;  2JQO A;  4NB3 A;  3KFU A;  1QVF A;  5T1I A;  1DD2 A;  1JE5 A;  5C5L A;  4RKB A;  1CHQ D;  1M4V A;  3VR4 A;  2NTS A;  3T51 B;  1FNV A;  5IP7 G;  1AP0 A;  5DLQ E;  4B3S Q;  3D6C A;  4DK3 C;  1MHW C;  4DV1 Q;  1M8A A;  3HOZ H;  4IPH A;  3FVQ A;  2Q2H A;  1X3G A;  2ZXR A;  3M4Q A;  4RCO A;  2JA7 H;  3I72 A;  3HKZ G;  1PFN A;  4Z9C B;  1NTG A;  1ROD A;  4ME5 A;  1KAB A;  3FKI B;  1A62 A;  4HMI A;  4R1J A;  3M9B A;  4L5T A;  1N32 L;  2WB1 G;  5IGF A;  4LF6 L;  4A93 G;  1FL0 A;  2RCF A;  2NWG A;  1H9R A;  3NEL A;  1KRS A;  5LL6 X;  3EIV A;  4PMW A;  4DR2 Q;  5C4Z A;  5IYD G;  2B2Y C;  4JCV E;  3P1H A;  5FO9 B;  1T9H A;  3MEH A;  3PUY A;  3NHH A;  4MTN A;  1EQQ A;  1N8R C;  2PYK A;  2K05 A;  3CD6 A;  1SFO H;  3G48 A;  1WTX A;  1IW7 C;  1STE A;  3Q6S A;  2R93 H;  5CBA E;  3MA2 B;  3F8T A;  1Z9F A;  1YVC A;  2O5I C;  1WTQ A;  1EQR A;  3TP5 A;  1U9R A;  3T4A C;  1KHI A;  3S1M B;  1K3R A;  1H9K A;  2AQ1 B;  4ZK9 B;  2JJQ A;  3GTK B;  2E76 C;  2JA5 B;  2PQA A;  1Y1V G;  2F0Q A;  1W2B A;  1Q86 C;  1TVX A;  1QVG A;  1BQQ T;  5C4X H;  1II3 A;  4A3B B;  3I91 A;  3SVM A;  1X65 A;  3CRK C;  1W3S A;  2DNE A;  4J15 A;  4MIU A;  3GTQ H;  3HOX G;  3RD4 A;  2KOL A;  1HNX Q;  2KBN A;  3H91 A;  2AKW B;  1SYC A;  2F0U A;  4DAP A;  4IUP A;  1MJC A;  2SNS A;  2R7F A;  2Q8T A;  3S16 H;  1PFM A;  3J80 c;  1AE2 A;  1MD2 D;  1S40 A;  3ICE A;  4ZKC B;  2L15 A;  1N36 L;  2BH8 A;  3MC0 B;  4X66 L;  2NZO A;  2ZJP A;  4LFA L;  5CV5 A;  4B9W A;  2K5N A;  1CZW A;  1WJJ A;  4DR1 Q;  4J8Q A;  4QF4 A;  2DJF C;  3IKJ A;  1G51 A;  1V1Q A;  5FLM G;  2NVQ B;  2Z1C A;  3L7Z C;  1FNU A;  1STY A;  1PH6 A;  1WCM H;  2EY5 A;  1I4X A;  5CV6 A;  2JA5 H;  1RD9 D;  2RA4 A;  2EYL A;  3A7L A;  4KLK A;  5BN5 A;  3BZC A;  1PRT F;  2A68 D;  4ME3 A;  4GZY C;  2DY7 A;  4NPS A;  5JJK A;  3T53 B;  5CGK A;  4TRD A;  1EIF A;  1EY7 A;  2EYP A;  1VF7 A;  4N9T A;  1KAA A;  2XIW A;  3S14 B;  2K7V A;  1AE3 A;  2F0I A;  1CKM A;  3R93 A;  2F0G A;  3TS0 A;  1O78 A;  3KBX A;  3M4Y A;  1EY6 A;  4JI1 L;  3I4M G;  4PV1 C;  4RH6 A;  4U68 A;  4BY7 H;  5E3F A;  1VQD A;  4DV7 Q;  1NR4 A;  2JA6 B;  2EQS A;  2B2U C;  2R92 B;  2YU9 H;  4GOP A;  1AW7 A;  1NCV A;  2E2I B;  4OEL B;  2NTT A;  1YNJ C;  1NE3 A;  2GN5 A;  4C2M B;  4CHT B;  1KQS A;  3OMC A;  1L0X B;  1NMG A;  4UAI A;  1D6E C;  4GN5 A;  4KV6 A;  4DR5 L;  4DV5 L;  4K2L A;  1FJG L;  4DAV A;  1EY8 A;  1PH9 A;  4DV3 Q;  3H6M A;  1KLU D;  4R4T A;  3GTG H;  3TDQ A;  3NP8 A;  2JXM B;  4B3M L;  2EXZ A;  5GAD C;  5C3W A;  2LFN A;  5JJL A;  3GTQ B;  1H9M A;  5DM6 3;  1EY5 A;  1ZYR C;  3T13 A;  2JA8 G;  1L1O A;  2A6H C;  4NW2 A;  1Y1W B;  2EVB A;  4JG2 A;  4UY8 C;  5FOB B;  4K8J A;  1BNZ A;  5LMN Q;  3NTK A;  1EY4 A;  3KJP A;  2E2I H;  1HUN A;  4LW1 A;  3JAM i;  3DM1 A;  4FXG C;  2OEO A;  4Y7N H;  4HN7 A;  1UWV A;  4G4K A;  1Y69 U;  4IPD A;  2HUG A;  1U4P A;  3LNN A;  1S72 A;  1B70 B;  4CKE A;  1HNW L;  2O2L D;  4JV5 L;  2CH4 A;  4G7Z C;  1HH2 P;  2UU9 L;  1X3E A;  1AZQ A;  2B39 A;  5C4H A;  3DM3 A;  3HEJ A;  2HIV A;  1V9P A;  4OXP A;  5I9P A;  3HOX B;  2FMM A;  3J81 c;  4OL7 A;  2PCF B;  2EZV A;  4HJ9 A;  4QL5 A;  2UUC L;  4JI4 L;  3AFQ A;  3NBH A;  1DOK A;  3KLS X;  2Y0S E;  1G8Z D;  2KEC A;  2K1B A;  2VL6 A;  4LUV A;  1BXT A;  1PTO B;  4DK1 A;  4FDB A;  3NWT A;  3CRL C;  5IT9 L;  2VS1 A;  3VYU A;  2BOS A;  1D8L A;  2K5V A;  1C7Y A;  2G9H D;  4LFC Q;  3CCL A;  1IBL Q;  1VCI A;  4LUZ A;  3SK4 A;  4DV4 Q;  4FF4 A;  3HG9 A;  3H09 A;  2RBM A;  4KJO A;  1ONL A;  3PO3 H;  2EYJ A;  2MO1 A;  4A3C H;  1JOK A;  5KNB A;  1QIL A;  3OHX C;  4IOC A;  2K50 A;  3C1E A;  5EPK A;  1I6H B;  4BWG B;  3S1N H;  1B53 A;  4JI3 Q;  4GOP C;  4HJ5 A;  4IJH A;  2QDL A;  3H3V I;  5CV9 A;  3I4N G;  5LMN W;  1I4G A;  1SYE A;  3QB3 A;  2UUA Q;  1I94 L;  2JA7 G;  3A0J A;  3DEP A;  5CC4 A;  3W2D A;  5JOB A;  3DUZ A;  2TSS A;  3K81 C;  3S1N B;  2VUM B;  3BDO A;  3HKZ B;  4CJ1 B;  4CJ2 C;  5GQO A;  1JMC A;  3JAM c;  3CC2 A;  1LLR D;  3L9A X;  3RZD H;  1A6X A;  2B2T A;  4B3M Q;  5IWA L;  1NR2 A;  2AMC B;  3CMA A;  1I50 B;  3A8I E;  1BDO A;  1VQ7 A;  3AMU A;  3NUC A;  3L3O C;  4KKS A;  3GQB A;  3RZO B;  3WOE A;  5F2D A;  3I3C A;  4P73 A;  1HZA A;  4DR5 Q;  1L1O B;  3G6J B;  4BBR B;  2PMZ B;  4K0K L;  1E2W A;  2HQE A;  4MNO A;  2CKZ B;  1L1O C;  4GN4 B;  3CKI B;  4DV0 Q;  2I5M X;  1LTA D;  4IUR A;  1EWH A;  2HCI A;  1SMX A;  2WB1 E;  4A3D B;  3QOL A;  1SJE D;  3GTP H;  5C5M A;  1HNZ L;  4DV7 L;  4DXG A;  5AJ3 Q;  2C9O A;  3E9H A;  4DV2 L;  2K04 A;  1YJW A;  1FR3 A;  1K3B C;  5L37 A;  1BCP C;  4RA8 A;  2FMC A;  4LF4 Q;  2EYM A;  3F2C A;  4B3R L;  1U0L A;  2L11 A;  3KDF B;  4JYA Q;  1ZEQ X;  2RKS A;  1Z7T A;  2Q2U A;  1HTL D;  2CQO A;  1TWF B;  4R4C A;  1VQN A;  2N55 A;  4BY1 B;  3HS0 C;  2YTV A;  2UUA L;  1YIJ A;  4H7B A;  4JI2 Q;  3U4Z A;  1HR0 Q;  1XNQ L;  4XT1 B;  3BZD B;  1WCM G;  3PUV A;  1EFI D;  3OIP A;  2IX3 A;  1PXU A;  3PUZ A;  2JA5 G;  2CWA A;  4KK7 A;  4KD4 A;  1ZKO A;  4RCN A;  2EYH A;  1SRU A;  3LWU A;  3HFZ B;  4Y52 H;  3OPO A;  1PMR A;  3MZ5 A;  4OX9 L;  1VDZ A;  3QOJ A;  4BBS G;  3BZK A;  4I7Z C;  4DK6 C;  2CW0 C;  3J81 j;  1N36 Q;  1KRT A;  1I6V C;  1V1P B;  3C46 A;  3J7A F;  4H02 A;  2RSO A;  2WKC A;  2AUK A;  4WOR A;  1A0I A;  2NVY B;  1CHP D;  3EBE A;  2XWJ B;  4KHZ A;  2OF1 A;  1EY9 A;  1S5E D;  3E0J A;  1PA6 A;  2XGT A;  3G6E A;  2XSC A;  1GXD C;  5LHY 1;  1HCZ A;  4H13 C;  2AWO A;  4C3H H;  3G7L A;  3IL8 A;  2K01 A;  4TVA B;  4JOI C;  3J80 E;  2UXC Q;  4AYB G;  1WFQ A;  1K0R A;  1L0W A;  1WTW A;  3N6R A;  2NZH A;  2ASB A;  3HOW B;  1QJO A;  2R61 A;  1KLG D;  1SNQ A;  2DNC A;  2VW9 A;  2JA6 H;  1S3O A;  4DUY Q;  4C3H B;  3GD7 A;  3NQT A;  3GTK H;  2R6G A;  4GLV B;  1PH4 A;  1DXM A;  5KYL A;  1HPC A;  3E5S A;  3M4O H;  4NXN Q;  1P8L A;  2ICI A;  2NVY H;  2RDG A;  5JEA J;  5KGU A;  4HID A;  3PO2 G;  2Y0S G;  1B50 A;  2CHB D;  4LAA A;  4X62 Q;  3K59 A;  2NVQ H;  1A15 A;  1EWC A;  2B8G A;  1T5X D;  3STB C;  1Y1V B;  2CQA A;  1GD7 A;  1LT5 D;  1F9R A;  3ERQ A;  3G71 A;  4X62 L;  3L2P A;  3CXC A;  4EGV A;  1CKN B;  3A74 A;  2I5H A;  3Q23 A;  1JT8 A;  3X3M A;  1PYB A;  4J6H A;  1F77 A;  4GN3 B;  2JP1 A;  4RGT A;  4DR4 L;  2XTI A;  3ERO A;  2F0E A;  1EQT A;  2ZTC A;  3OTO L;  1YNN C;  2R93 G;  3MXG A;  4F7X A;  2G5D A;  2F0W A;  3MFY A;  1LAB A;  3MHB A;  3NTH A;  2D0O A;  4QIW B;  1VMP A;  3HOW H;  2IWH A;  4BY7 B;  5ELE A;  5IGC A;  4GNX C;  2RQX A;  3H0G B;  3HOU B;  5FJ8 G;  3ULP A;  4FF3 A;  3CW2 C;  1I3Q B;  3SEB A;  3CC4 A;  2K75 A;  2VNU D;  2B2W A;  4Q5V A;  2R93 B;  5FLX c;  3BU2 A;  4DNT B;  1Y1V H;  1SE2 A;  2M9V A;  1HFG A;  2JEA I;  2X69 A;  1A8V A;  1G29 1;  2VB3 X;  2H5X A;  3FHW A;  3IRB A;  2EE1 A;  2PNH A;  1RHP A;  1Y1W H;  1LAC A;  2MPM A;  2PZU A;  4R8N A;  1PRT B;  5M5X H;  4HAE A;  4A3C G;  2QKI C;  1B7Y B;  1JWS D;  1B4O A;  1PHJ A;  2IL8 A;  2BDO A;  4WJ4 A;  1TY0 A;  1GHJ A;  4ABN A;  1DOM A;  1BOS A;  4YY3 L;  2SEB D;  4GNX A;  2E75 C;  1EIH A;  1KNA A;  5CR3 A;  4UP8 A;  4NMZ A;  3NQI A;  3K58 A;  1HUM A;  1TKW B;  4C56 C;  5I2X A;  3K80 C;  1OXX K;  2PNR C;  1JB3 A;  4LWC A;  4RGN A;  4IFD I;  4KHV A;  1RF2 D;  4P72 A;  4JI5 L;  4X66 Q;  4GS3 A;  2F3V A;  4A3D H;  2F0D A;  3GTO H;  2VY3 A;  4FP5 D;  2AUJ D;  5A2Q L;  1L0Y B;  3M4O B;  4FO2 A;  1JE4 A;  3PF5 A;  1LTI D;  3FDT A;  4AH6 A;  5M5Y B;  4JBJ A;  3E3X A;  1J6Q A;  4JYA L;  1XTD A;  4X3S A;  1CQF A;  5M3F G;  4RHS A;  2A73 B;  1F2Z A;  4YCV A;  3Q22 A;  3IFT A;  5A35 A;  2Z6K C;  1G6Z A;  3DWP A;  4XYQ A;  4BXX G;  4B3T Q;  2NUC A;  3RNU A;  4NXM Q;  5CMD A;  4ALP A;  2KA7 A;  1QZH A;  4DGZ A;  2B2Y A;  2BDN A;  5CV8 A;  2X6G A;  2QW7 A;  1SYD A;  4L8J A;  2AHO B;  2M00 A;  1TWC H;  4HCS A;  2CW0 D;  2KED A;  3NPP A;  1UE5 A;  3S14 H;  3K7A B;  5BR8 L;  3UDG A;  3KJO A;  3TZU A;  1STB A;  3J7Y W;  4KY7 A;  1PTO H;  2YTY A;  1BR9 A;  4U67 3;  4QCL A;  2E2H B;  1CQV A;  4PZ6 A;  5BN3 A;  2PI2 E;  1DOL A;  1ESF A;  4DR4 Q;  1JB7 A;  1BF4 A;  4C3J H;  1IBM Q;  4BA1 I;  3LX0 A;  2O4X A;  4DUZ L;  1VS0 A;  2VUM G;  1GOZ A;  1E22 A;  1UE6 A;  3VA7 A;  3I4O A;  1C9O A;  1VQ6 A;  4ZKB B;  3CQZ B;  4KJN A;  3JC6 6;  5ELB A;  3WWV A;  3TP6 A;  1GUS A;  3Q8D A;  1YIT A;  1X55 A;  3I4M B;  4XQQ A;  3GTM B;  3FMC A;  1I94 Q;  2ID0 A;  1PTO C;  1IYJ B;  5EBC A;  5LMU L;  5C3X A;  1HA5 A;  2ZJR A;  2O5J C;  1K83 B;  4ZCK A;  4APV A;  2KUM A;  3GTL B;  2F0K A;  4NP5 A;  3SGI A;  4BBS H;  2B63 B;  4A3K B;  4B3T L;  3QO2 A;  3I8Z A;  1RL2 A;  5COR A;  3K0Y A;  2DUD A;  5JAV A;  1CTM A;  3STB D;  3GP7 A;  2KCN A;  5DNF A;  4WFN 3;  1R9T H;  3EFX D;  4IUT A;  1CK1 A;  3T1Y Q;  2MP1 A;  3ONA B;  4LFC L;  4A3K G;  4A3E B;  5IP9 G;  1U4R A;  2YYZ A;  1ILQ A;  4XDX A;  2QA4 A;  2QIL A;  3T16 A;  4AYB B;  2JN4 A;  1SNP A;  1EIY B;  1VQO A;  4TQU S;  3W3A A;  4GKK L;  3H3V C;  2VUM H;  4AIM A;  3QWN A;  4TKO B;  1DYQ A;  4C1N K;  1HJP A;  5CV7 A;  2G9D A;  1JOO A;  1OXT A;  1W6J A;  1UE7 A;  2KEN A;  3CP0 A;  3S1R B;  4C3H G;  1PH8 A;  3H94 A;  3KLW A;  1EWI A;  3A8K E;  3I73 A;  1MBY A;  1C0A A;  2A6E D;  1TU2 B;  3PQI A;  4IUQ A;  3HKS A;  1S5B D;  2UU9 Q;  1HZB A;  1SND A;  1PH5 A;  3SK5 A;  1KDA A;  1TT2 A;  2E2H H;  2JA7 B;  1IYV A;  1HR0 W;  3CPF A;  1D7Q A;  1HXY D;  4DF7 A;  2K28 A;  1F2M A;  1UNS A;  1XXG A;  2F0L A;  2A69 D;  1HNW Q;  3OMG A;  4OWT B;  2JA8 B;  2LMC B;  1CSP A;  1KD1 C;  4X65 Q;  1CI3 M;  5IGG A;  1QZG A;  1UEA B;  1HA6 A;  1I4P A;  2FJ2 A;  1J8I A;  4CDF C;  3W5O A;  2RHQ B;  1WCM B;  2F0T A;  4B3R Q;  3BDL A;  5C4X B;  1STA A;  3OOC A;  4JI7 L;  4AYB E;  3P7J A;  4KTA A;  5HGT A;  2D62 A;  1D5M C;  4QMG A;  4PMB A;  5JEA G;  1PVO A;  3OTO Q;  1HFN A;  5I6W A;  1EUJ A;  3K57 A;  3I4M H;  3BJU A;  1XPR A;  1BCP B;  4X3K A;  1LV9 A;  4QY7 A;  4DV3 L;  1I4H A;  1T5E A;  3DHQ A;  2XNA C;  4A3J G;  1X32 A;  2K14 A;  4XXE A;  1TWF H;  3HOW G;  4DV5 Q;  2LY7 A;  1I5F A;  2RHS B;  3D8G A;  3RMH A;  1WTO A;  4BY1 G;  2D2C C;  1E24 A;  1TS5 A;  2KJX A;  4HIK A;  1H9S B;  3D4W A;  2KCT A;  1EY0 A;  3U9S A;  3OW2 A;  3CCE A;  2ZJQ A;  4V19 0;  4IOA A;  1PRT D;  1LYL A;  2I07 B;  3UDF A;  1VF5 C;  2KHJ A;  2WAC A;  1IBM L;  1TWG B;  4KY5 A;  1MGS A;  3CAM A;  4HCE A;  5M5Y H;  5C44 G;  1GVP A;  4JI1 Q;  2JEB I;  1DZ1 A;  3GTG B;  4LFB L;  3HOZ B;  2KQ3 A;  5G3L F;  4A3M G;  1IBK L;  2PMZ E;  4LF8 L;  3SR1 A;  1CFM A;  2UXC L;  2RF4 A;  1VQB A;  1JCK B;  1K8A C;  2B2V A;  5LL6 S;  1SNC A;  1ILP A;  3MXN B;  1A3T A;  1S4Z A;  4FF2 A;  3DXJ C;  1STH A;  4JI6 Q;  2HT1 A;  5JJZ A;  5H1S E;  4YHH Q;  4NXM L;  5DEH A;  4XT3 B;  2F3W A;  4HED A;  1E0B A;  3KOJ A;  5IE8 A;  5EPL A;  1NY4 A;  4YCU A;  1PH2 A;  1F9Q A;  1SE8 A;  3NEM A;  1VQ5 A;  1XMQ Q;  1WD0 A;  2L5T A;  1OTC A;  1F2Y A;  4XYO A;  4K6D A;  5IGE A;  3KLS A;  3A7A B;  3TP8 A;  5M3M B;  4JOI A;  1DM0 B;  1VQA A;  1C4Q A;  1NBW A;  4IFD G;  3N52 A;  2KEE A;  1Q8I A;  3TRE A;  3PIO 3;  3UDX A;  2E2J H;  3RN2 A;  2R92 G;  4OHJ A;  1PH7 A;  3HOU H;  2IX1 A;  1JOR A;  5FLX L;  5C44 H;  4KN4 C;  5IGD A;  4BXX H;  3J7Z C;  5GAH C;  1BBW A;  1VQG A;  3ZYY X;  2PZW A;  3K7U C;  1HZC A;  1Q1B A;  4YWL A;  2E8G A;  4FNF A;  4PQX A;  1SE4 A;  1EU3 A;  4IQZ A;  5IIF A;  1ZXT A;  3I56 A;  5NUC A;  1SYG A;  2ZXO A;  2IT1 A;  4LF8 Q;  2EOT A;  4RGO S;  1XJV A;  1H95 A;  5KND A;  1OXU A;  3ITP A;  5C44 B;  1E1O A;  4CJ0 B; 
#chains in the Genus database with same CATH homology
 3PO2 B;  2AQ3 B;  2HCC A;  2A6E C;  1Q3L A;  2CVR A;  5C0X H;  3R2T A;  3MVV A;  5DAU A;  1LTT D;  5K36 H;  5E1F A;  3MXP A;  2PZT A;  1GUO A;  3MTS A;  4FXD A;  3AU7 A;  1EQV A;  4JK1 C;  1HHV A;  3URY A;  2Z4H A;  2IPK D;  4ZUI A;  1EZ8 A;  4ZRZ A;  1TR5 A;  2EY1 A;  4XTC S;  5D14 A;  2I46 A;  5FO7 B;  3BG3 A;  2RVL A;  3K5N A;  5I2Y A;  3PV0 A;  1TWH B;  3HRZ C;  2R7Z B;  1AEX A;  1RDP D;  3RZD B;  1GUN A;  1LO5 D;  5FKA C;  2ICE C;  5EKK A;  5COY A;  3CHB D;  4A3I B;  2M2L A;  1AN8 A;  1WTP A;  2EPB A;  2K6A A;  3FPP A;  2J0T D;  3K5O A;  1DCZ A;  1RTO A;  1BBX C;  4FYD A;  3CU7 A;  1ENC A;  1D1I A;  4HSV A;  4UDU C;  2A69 C;  3GTJ B;  1B3A A;  3FRP B;  1X3Q A;  2MHV A;  4KN7 C;  2GA4 B;  4J1M A;  2A74 C;  2EDG A;  1EL0 A;  5D3I B;  2WII B;  3GV3 A;  3HOY B;  1Y8O B;  2F0O A;  2NZ1 D;  2JSO A;  5BN4 A;  5C0X I;  4A3J B;  2KCC A;  3D6W A;  2TMP A;  1EYC A;  3OWF A;  3JAM L;  5C6A A;  4A3F B;  1OXV A;  4DAY A;  4JBW A;  3MXN A;  3S17 B;  5M9O A;  1WVL A;  1GUW A;  1SYB A;  3BVZ A;  4MHE A;  1SE3 A;  1O7Z A;  1QNU A;  4KKT A;  2XVS A;  4IUU A;  5ISR A;  2L9H A;  4K5W A;  1IW7 D;  1FD7 D;  1D5X C;  4FXK C;  1HQM C;  1U4M A;  1H9S A;  1QWY A;  5D3D A;  1ET6 A;  3VA5 A;  2NN6 H;  2ENB A;  4P2C B;  3BVG A;  3J81 E;  1H9J A;  4MN3 A;  2Q8R E;  3J7A V;  1TS4 A;  1EU4 A;  3NTI A;  1PLF A;  4RKL A;  2XRS D;  4DFA A;  4M1U B;  4PNY A;  3DWQ A;  3MAQ A;  5FO8 B;  1CM9 A;  1QNK A;  3TP7 A;  3TSS A;  1STG A;  4C3J B;  3OWE B;  1J9O A;  3SE0 A;  5G3L D;  2AWN A;  3VR3 A;  3FEW X;  3HGB A;  1SNM A;  4NKL A;  1MI2 A;  1YNN D;  3LWE A;  3R8B A;  2ZXP A;  4K5V A;  2SOB A;  3TBI B;  3WOF A;  1R4P B;  2XN9 C;  3TN2 A;  4O1N A;  4KD3 A;  2LS0 1;  3D4R A;  1ET9 A;  1C8C A;  4IN3 A;  3U9O A;  4QUC A;  3QG1 A;  1FGB D;  1S5C D;  1I4Q A;  3KUP A;  1PYW D;  1X3P A;  5I4D A;  2NBF A;  3E6Z X;  3NSW A;  4RGM A;  3SXH A;  2PO4 A;  2L55 A;  2BA1 A;  1B1Z A;  3Q24 A;  3V05 A;  5TSS A;  1UUP A;  1UAP A;  3BS1 A;  2F1M A;  3MFG A;  2B2W C;  1SYF A;  3MXU A;  5J1Z A;  3NK9 A;  5E4X A;  2F0M A;  2QCP X;  3R2I A;  1XWE A;  1KDB A;  5IOD A;  4V0B A;  2VB2 X;  4Q0F A;  3HP3 A;  3SK6 A;  3RUZ A;  1G2S A;  3SHL A;  2WAQ B;  3D3R A;  4QUF A;  2EY6 A;  2K5W A;  1C48 A;  3OW7 A;  4F8M A;  3NXW A;  3ND8 A;  1LT3 D;  1QE6 A;  2F0J A;  2VXW A;  1SFO B;  3HOV B;  2BCO A;  4EQO A;  4HTH A;  4KI0 A;  1JOQ A;  3SK8 A;  1V1O A;  5JPN C;  1Q12 A;  1NAP A;  2F0H A;  2PW5 A;  5EKL A;  4DU9 A;  4OGQ C;  1O7Y A;  2E2D C;  2SNM A;  3X3N A;  4ULL A;  1JWU D;  2PPB C;  1SDF A;  3HZX A;  3K5L A;  1PDQ A;  5IGB A;  2L0C A;  3TME A;  3WDN A;  4EVO A;  2HDL A;  3V96 A;  2PQE A;  4IFD J;  4Y7N B;  1IKL A;  4K14 A;  1CT1 D;  4K5X A;  4B08 A;  4L63 B;  1TII D;  3AB9 A;  1VMC A;  2BE5 C;  2JYO A;  1HRJ A;  1R4Q B;  3S9W A;  1QCB D;  3GV6 A;  2EJG C;  3PUW A;  2IJ0 A;  4F88 A;  1OXS C;  4H44 C;  5J39 A;  1IL8 A;  2PW7 A;  3EA6 A;  1BCP D;  1RCV D;  2SDF A;  1G91 A;  3VYT A;  1U4L A;  5C4J B;  1LTB D;  3S1Q B;  2Z8L A;  3K5M A;  4DXF A;  2QEJ C;  4HR7 B;  2C5C A;  4EQP A;  1EIG A;  2F0F A;  4K2K A;  5KIX A;  4WJW A;  4OO1 H;  1MSH A;  5CV4 A;  2Z4I A;  2N88 A;  1MSG A;  2EY2 A;  3A8J E;  5KRU A;  3DMU A;  4LK1 C;  4CKC A;  2Y0S B;  4IAL A;  2J4X A;  4A3M B;  4S3S A;  2HDM A;  1PZJ D;  5DM7 3;  5KYI A;  4TSS A;  2E74 C;  4DA2 A;  1S5F D;  2RDF A;  1DON A;  2NN6 G;  1SMY C;  2F0S A;  2B8F A;  3BVM A;  3EQL C;  1AZP A;  1ENA A;  1XX8 A;  2K33 A;  4OO1 I;  4KY6 A;  4BA2 I;  1TWC B;  2J7Z A;  3NE5 B;  5KEE A;  4DN4 M;  2XWB B;  1A2T A;  2FHT A;  1AFP A;  2AQ2 B;  5D65 A;  4ZUJ A;  2MUY A;  4I65 A;  3V2T A;  1ESR A;  2D9U A;  3KBG A;  4K8I A;  1BO0 A;  1B44 D;  3T56 B;  2MGS A;  5JEA H;  4KMU C;  1O80 A;  4E6I A;  4BBS B;  1HTP A;  1V43 A;  5JPM C;  1SSO A;  2DN8 A;  5CYU A;  4IUV A;  2K32 A;  2B2U A;  1IHZ A;  4RWS C;  2NVT B;  4HMJ A;  1YNJ D;  4CBV A;  1IYU A;  5EBD A;  4CGY B;  5I6Y A;  2Q8I B;  2L12 A;  3I4N B;  5E4W C;  4G7O C;  3RLF A;  3Q0A A;  2EYO A;  1E2Z A;  2IW3 A;  4A93 B;  2EJF C;  4O42 A;  5M3F B;  1FNW A;  1R9T B;  2FIN B;  1GUG A;  2F4I A;  2R3Z A;  2WP8 J;  2KVM A;  5M5W B;  4ZYS A;  1JWM D;  5C0X J;  5CBE E;  1EYA A;  1JC7 A;  3ND9 A;  3D4D A;  2RSN A;  5IOC A;  3EVQ A;  3I4L A;  1F2L A;  1B9N A;  2BA0 A;  4ZLT F;  2NN6 I;  4LMQ D;  1EEI D;  4OIJ A;  5JVH 3;  4G57 A;  4M8A A;  1CA5 A;  5C3E B;  3OSO A;  2K5Q A;  4YIJ A;  4LJZ C;  1B2T A;  1W6K A;  1I4R A;  3VR2 A;  1DJR D;  4IFD H;  2YU9 B;  1EEF D;  1WD1 A;  3FPU B;  5FK9 C;  4R9W A;  1K8M A;  1F9P A;  4NDX A;  3S16 B;  3J81 L;  1KNE A;  3A56 A;  3S2D B;  1SEB D;  1NSN S;  2E2J B;  3I70 A;  5JVG 3;  1ICW A;  5EPJ A;  4L6T B;  4KKU A;  2NB0 A;  2DY8 A;  1ML0 D;  2JE6 I;  1RTN A;  4DK0 A;  2V4D A;  2B2T C;  1ZYR D;  5EJW A;  2L1B A;  1NUC A;  3I90 A;  1PFB A;  1CZG A;  1F9S A;  2QF7 A;  1GUT A;  3NWS A;  3DWA A;  1Q90 A;  1TY2 A;  1S5D D;  5ELD A;  1PTO D;  5M5X B;  1D1K A;  1GHK A;  5K36 G;  1JR0 D;  2X6L A;  3KK7 A;  2ZT9 C;  1Z6H A;  4IUN A;  2F03 A;  3EJI A;  2OXP A;  1LTG D;  4C3I G;  1B9M A;  2IX0 A;  1QG7 A;  3F2U A;  3BYY B;  3PMF A;  1KDC A;  2NVX B;  4G7H C;  2NYZ D;  1QB5 D;  2D5D A;  1LTS D;  3NBI A;  1Y8N B;  1BCP F;  3PUX A;  3P20 A;  3VYS A;  2F0V A;  2L4N A;  3KF8 A;  3MWY W;  1SAP A;  4RAU C;  4A3G B;  5HUR A;  1PTO F;  1D2B A;  4N9P A;  3A54 A;  1XTC D;  1HQR D;  1IKM A;  1TWA B;  3TZD A;  3UI2 A;  1SXT A;  4R8I A;  3C2P A;  3O13 A;  1K8O A;  2EYF A;  4CKB A;  2MJ8 A;  3IAY A;  4X3U A;  1D5Z C;  5EKI A;  2H1E A;  4H0L C;  1G2T A;  5K5P A;  4EQN A;  4ZAI A;  2WV6 D;  4BS9 A;  1STN A;  2K5D A;  3GTO B;  2WKD A;  5J22 A;  3DEO A;  2LKV A;  3K6O A;  1LT4 D;  4FVM A;  1TS2 A;  5EQ0 A;  3M7N A;  4ILW A;  1E2V A;  3J80 L;  4ZQ3 A;  4RHR A;  4C3J G;  4PMC A;  5EGT A;  3C1F A;  5I9O A;  5KNC A;  1BUV T;  1A3V A;  3PIP 3;  4XQN A;  2B2V C;  1XYI A;  2A68 C;  1TS3 A;  4ODG A;  3S15 B;  1V8Q A;  1EOT A;  3JAM E;  4K6L A;  3QIA A;  1EZ6 A;  4XQJ A;  3C3L A;  1KTK A;  2F0N A;  1RJT A;  1PRT C;  3QJY A;  2WB1 B;  3GTP B;  1GJX A;  3PO3 B;  3A55 A;  4IZ8 A;  1WTR A;  4C3I B;  3M3Y B;  4HSP A;  3BDC A;  5C0X G;  1SMY D;  1EYD A;  4OIK A;  5T1G A;  3IFD A;  2BE5 D;  5AFW A;  2KHS A;  3M7G A;  3SDZ A;  1A3U A;  1QOH A;  1PZK D;  5ELC A;  2EJM A;  1ENF A;  1WTV A;  4C1N I;  4RFB A;  3OIQ A;  2OT2 A;  4WRD A;  1Q1E A;  1LT6 D;  1SBB B;  5A2Q E;  1Z47 A;  3GO5 A;  1JIC A;  2RDH A;  2H4O A;  3KLR A;  3R3O A;  1Y8P B;  3S2H B;  1SJH D;  1JQY D;  4X3T A;  3VYR A;  4DNR B;  1PZI D;  5ELF A;  3M85 A;  3VR5 A;  2A6H D;  5IT9 E;  4B9X A;  2QDB A;  1OO9 B;  4OO1 G;  1FYC A;  2K03 A;  3BYT B;  2A5H A;  1CA6 A;  1O7L A;  4ID6 A;  5FLX E;  3VR6 A;  2FFK B;  4QB4 A;  1SNO A;  2WIN B;  3D31 A;  3P75 A;  4FF1 A;  4XIG S;  2XRQ D;  4F87 A;  1RKN A;  1A2U A;  1TQO A;  1LTR D;  1V1P A;  2F0P A;  5T1I A;  1DD2 A;  5C5L A;  4RKB A;  1CHQ D;  1M4V A;  3VR4 A;  2NTS A;  3T51 B;  1FNV A;  1AP0 A;  3D6C A;  1M8A A;  3FVQ A;  2ZXR A;  4RCO A;  3I72 A;  1PFN A;  4Z9C B;  1ROD A;  4ME5 A;  1KAB A;  3FKI B;  4HMI A;  5IGF A;  2NWG A;  1H9R A;  5LL6 X;  4PMW A;  5C4Z A;  2B2Y C;  3P1H A;  5FO9 B;  3MEH A;  3PUY A;  3NHH A;  2PYK A;  2K05 A;  1WTX A;  1IW7 C;  1STE A;  3Q6S A;  5CBA E;  3MA2 B;  2O5I C;  1WTQ A;  3TP5 A;  1U9R A;  3T4A C;  3S1M B;  1H9K A;  2AQ1 B;  4ZK9 B;  3GTK B;  2E76 C;  2JA5 B;  2F0Q A;  1TVX A;  1BQQ T;  1II3 A;  4A3B B;  3I91 A;  3SVM A;  3CRK C;  2DNE A;  4MIU A;  3RD4 A;  2KOL A;  3H91 A;  1SYC A;  2F0U A;  4DAP A;  4IUP A;  2SNS A;  2Q8T A;  1PFM A;  1MD2 D;  4ZKC B;  3MC0 B;  5CV5 A;  4B9W A;  1CZW A;  4J8Q A;  4QF4 A;  3IKJ A;  2NVQ B;  2Z1C A;  3L7Z C;  1FNU A;  1STY A;  2EY5 A;  1I4X A;  5CV6 A;  1RD9 D;  2RA4 A;  2EYL A;  3A7L A;  5BN5 A;  1PRT F;  2A68 D;  4GZY C;  2DY7 A;  3T53 B;  5CGK A;  4TRD A;  1EY7 A;  2EYP A;  1VF7 A;  4N9T A;  1KAA A;  2XIW A;  3S14 B;  2K7V A;  2F0I A;  3R93 A;  2F0G A;  1O78 A;  3KBX A;  3M4Y A;  1EY6 A;  4PV1 C;  4RH6 A;  4U68 A;  5E3F A;  1NR4 A;  2JA6 B;  2B2U C;  2R92 B;  1AW7 A;  1NCV A;  2E2I B;  2NTT A;  1YNJ C;  4C2M B;  4CHT B;  3OMC A;  1L0X B;  4UAI A;  1D6E C;  4KV6 A;  4K2L A;  4DAV A;  1EY8 A;  3H6M A;  1KLU D;  3TDQ A;  3NP8 A;  2JXM B;  2EXZ A;  5C3W A;  2LFN A;  3GTQ B;  1H9M A;  5DM6 3;  1EY5 A;  1ZYR C;  3T13 A;  2A6H C;  4NW2 A;  1Y1W B;  2EVB A;  5FOB B;  4K8J A;  1BNZ A;  3NTK A;  1EY4 A;  1HUN A;  3DM1 A;  4FXG C;  2OEO A;  4HN7 A;  1Y69 U;  4G4K A;  2HUG A;  1U4P A;  3LNN A;  4CKE A;  2O2L D;  4G7Z C;  1AZQ A;  2B39 A;  5C4H A;  3HEJ A;  5I9P A;  3HOX B;  2FMM A;  4OL7 A;  2PCF B;  2EZV A;  3NBH A;  1DOK A;  3KLS X;  1G8Z D;  2KEC A;  2K1B A;  1BXT A;  1PTO B;  4DK1 A;  3NWT A;  3CRL C;  5IT9 L;  3VYU A;  2BOS A;  2G9H D;  1VCI A;  3SK4 A;  4FF4 A;  3HG9 A;  3H09 A;  2RBM A;  4KJO A;  1ONL A;  2EYJ A;  1JOK A;  5KNB A;  1QIL A;  3OHX C;  3C1E A;  5EPK A;  1I6H B;  4BWG B;  1B53 A;  5CV9 A;  1I4G A;  1SYE A;  3QB3 A;  3DEP A;  5CC4 A;  3W2D A;  5JOB A;  3DUZ A;  2TSS A;  3S1N B;  2VUM B;  3BDO A;  3HKZ B;  4CJ1 B;  4CJ2 C;  1LLR D;  3L9A X;  1A6X A;  2B2T A;  1NR2 A;  1I50 B;  3A8I E;  1BDO A;  3AMU A;  3NUC A;  3L3O C;  4KKS A;  3GQB A;  3RZO B;  3WOE A;  5F2D A;  3I3C A;  3G6J B;  4BBR B;  2PMZ B;  1E2W A;  2HQE A;  3CKI B;  1LTA D;  4IUR A;  1EWH A;  2HCI A;  4A3D B;  3QOL A;  1SJE D;  5C5M A;  4DXG A;  2C9O A;  2K04 A;  1FR3 A;  1BCP C;  4RA8 A;  2FMC A;  2EYM A;  2L11 A;  1ZEQ X;  2RKS A;  1Z7T A;  1HTL D;  1TWF B;  2N55 A;  4BY1 B;  3HS0 C;  4H7B A;  4XT1 B;  3BZD B;  3PUV A;  1EFI D;  3OIP A;  2IX3 A;  1PXU A;  3PUZ A;  4KD4 A;  4KK7 A;  1ZKO A;  4RCN A;  2EYH A;  3LWU A;  3OPO A;  1PMR A;  3MZ5 A;  1VDZ A;  3QOJ A;  4I7Z C;  2CW0 C;  1I6V C;  1V1P B;  3C46 A;  3J7A F;  2RSO A;  2WKC A;  2AUK A;  4WOR A;  2NVY B;  1CHP D;  4KHZ A;  2XWJ B;  2OF1 A;  1EY9 A;  1S5E D;  3E0J A;  2XSC A;  1GXD C;  5LHY 1;  1HCZ A;  4H13 C;  2AWO A;  3G7L A;  3IL8 A;  2K01 A;  3J80 E;  1WTW A;  3N6R A;  3HOW B;  1QJO A;  2R61 A;  1KLG D;  1SNQ A;  2DNC A;  4C3H B;  3GD7 A;  3NQT A;  2R6G A;  1DXM A;  5KYL A;  1HPC A;  3E5S A;  2ICI A;  5JEA J;  2RDG A;  5KGU A;  1B50 A;  2CHB D;  4LAA A;  3K59 A;  1A15 A;  1EWC A;  2B8G A;  1T5X D;  1Y1V B;  2CQA A;  1LT5 D;  1F9R A;  3ERQ A;  4EGV A;  3Q23 A;  3X3M A;  4J6H A;  1F77 A;  2JP1 A;  4RGT A;  3ERO A;  2F0E A;  1EQT A;  1YNN C;  3MXG A;  4F7X A;  3NTH A;  2F0W A;  3MFY A;  1LAB A;  3MHB A;  4QIW B;  1VMP A;  2IWH A;  4BY7 B;  5ELE A;  5IGC A;  2RQX A;  3H0G B;  3HOU B;  4FF3 A;  1I3Q B;  3SEB A;  2VNU D;  2B2W A;  4Q5V A;  2R93 B;  4DNT B;  1SE2 A;  2M9V A;  1HFG A;  2JEA I;  2X69 A;  1G29 1;  2VB3 X;  2EE1 A;  1RHP A;  1LAC A;  2MPM A;  2PZU A;  4R8N A;  1PRT B;  4HAE A;  2QKI C;  1JWS D;  1B4O A;  2IL8 A;  2BDO A;  1TY0 A;  1GHJ A;  4ABN A;  1DOM A;  1BOS A;  2SEB D;  2E75 C;  1EIH A;  1KNA A;  5CR3 A;  4NMZ A;  3NQI A;  3K58 A;  1HUM A;  1TKW B;  4C56 C;  5I2X A;  1OXX K;  2PNR C;  1JB3 A;  4RGN A;  4IFD I;  4KHV A;  1RF2 D;  2F3V A;  2F0D A;  4FP5 D;  2AUJ D;  5A2Q L;  1L0Y B;  3M4O B;  4FO2 A;  1JE4 A;  1LTI D;  3FDT A;  5M5Y B;  4X3S A;  1CQF A;  4RHS A;  2A73 B;  1F2Z A;  3Q22 A;  3IFT A;  5A35 A;  1G6Z A;  3DWP A;  4XYQ A;  2NUC A;  5CMD A;  2KA7 A;  4DGZ A;  2B2Y A;  2BDN A;  5CV8 A;  2X6G A;  1SYD A;  2M00 A;  4L8J A;  4HCS A;  2CW0 D;  2KED A;  3NPP A;  3K7A B;  3TZU A;  1STB A;  3J7Y W;  1PTO H;  4KY7 A;  1BR9 A;  4U67 3;  4QCL A;  2E2H B;  1CQV A;  5BN3 A;  1DOL A;  1ESF A;  1BF4 A;  4BA1 I;  3LX0 A;  2O4X A;  1GOZ A;  3VA7 A;  4ZKB B;  3CQZ B;  4KJN A;  5ELB A;  3TP6 A;  1GUS A;  3I4M B;  4XQQ A;  3GTM B;  3FMC A;  2ID0 A;  1PTO C;  5EBC A;  5C3X A;  1HA5 A;  2O5J C;  1K83 B;  2KUM A;  3GTL B;  2F0K A;  4NP5 A;  2B63 B;  4A3K B;  3I8Z A;  3QO2 A;  5COR A;  3K0Y A;  5JAV A;  1CTM A;  3GP7 A;  2KCN A;  5DNF A;  4WFN 3;  3EFX D;  4IUT A;  1CK1 A;  2MP1 A;  3ONA B;  4A3E B;  1U4R A;  2YYZ A;  1ILQ A;  4XDX A;  2QIL A;  3T16 A;  4AYB B;  1SNP A;  4TQU S;  3W3A A;  3H3V C;  3QWN A;  4TKO B;  1DYQ A;  4C1N K;  5CV7 A;  2G9D A;  1JOO A;  1OXT A;  1W6J A;  3S1R B;  4C3H G;  3H94 A;  3A8K E;  3I73 A;  1MBY A;  2A6E D;  1TU2 B;  4IUQ A;  1S5B D;  1SND A;  3SK5 A;  1KDA A;  1TT2 A;  2JA7 B;  1IYV A;  1HXY D;  4DF7 A;  2K28 A;  1F2M A;  1UNS A;  1XXG A;  2F0L A;  2A69 D;  3OMG A;  2JA8 B;  2LMC B;  1CI3 M;  5IGG A;  1UEA B;  1HA6 A;  1I4P A;  2FJ2 A;  1J8I A;  1WCM B;  2F0T A;  3BDL A;  5C4X B;  1STA A;  3OOC A;  3P7J A;  4KTA A;  5HGT A;  2D62 A;  1D5M C;  4QMG A;  4PMB A;  5JEA G;  1HFN A;  5I6W A;  3K57 A;  1BCP B;  4X3K A;  1LV9 A;  1I4H A;  1T5E A;  3DHQ A;  2XNA C;  1X32 A;  4XXE A;  2LY7 A;  3D8G A;  1WTO A;  3RMH A;  2D2C C;  1TS5 A;  2KJX A;  1H9S B;  3D4W A;  1EY0 A;  3U9S A;  4V19 0;  1PRT D;  2I07 B;  1VF5 C;  2WAC A;  1TWG B;  4KY5 A;  1MGS A;  4HCE A;  2JEB I;  1DZ1 A;  3GTG B;  3HOZ B;  2KQ3 A;  5G3L F;  3SR1 A;  1CFM A;  1JCK B;  2B2V A;  5LL6 S;  1SNC A;  1ILP A;  1A3T A;  1S4Z A;  4FF2 A;  3DXJ C;  1STH A;  5JJZ A;  5DEH A;  4XT3 B;  2F3W A;  4HED A;  1E0B A;  5EPL A;  1F9Q A;  1WD0 A;  2L5T A;  1F2Y A;  4XYO A;  4K6D A;  5IGE A;  3KLS A;  3A7A B;  3TP8 A;  5M3M B;  1DM0 B;  1C4Q A;  4IFD G;  3N52 A;  2KEE A;  1Q8I A;  3PIO 3;  4OHJ A;  2IX1 A;  1JOR A;  5FLX L;  4KN4 C;  5IGD A;  3ZYY X;  2PZW A;  1Q1B A;  4FNF A;  4PQX A;  1SE4 A;  1EU3 A;  4IQZ A;  5IIF A;  1ZXT A;  5NUC A;  1SYG A;  2ZXO A;  2IT1 A;  2EOT A;  4RGO S;  5KND A;  1OXU A;  3ITP A;  5C44 B;  4CJ0 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...