2XSCA

Crystal structure of the cell-binding b oligomer of verotoxin-1 from e. coli
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
69
structure length
69
Chain Sequence
b'TPDCVTGKVEYTKYNDDDTFTVKVGDKELFTNRWNLQSLLLSAQITGMTVTIKTNACHNGGGFSEVIFR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SHIGA-LIKE TOXIN 1 SUBUNIT B
publication title Crystal Structure of the Cell-Binding B Oligomer of Verotoxin-1 from E. Coli.
pubmed doi rcsb
molecule tags Toxin
total genus 16
structure length 69
sequence length 69
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2010-09-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.70 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2xscA00
1CZGA 1DM0B 1BOSA 1QNUA 2C5CA 2XSCA 2GA4B 3MXGA 2BOSA 1C48A 4P2CB 4ULLA 1D1KA 1R4QB 1CZWA 1CQFA 1R4PB 1C4QA 1D1IA 4M1UB 1QOHA
chains in the Genus database with same CATH superfamily
1ZYRC 2ZTCA 5C0XH 5JVG3 2MGSA 2JA7H 3K59A 1ILPA 3HZXA 1EWHA 2PPBC 2KVMA 1SROA 4X3UA 4DR7Q 3HGBA 1LYLA 3ITPA 1U5KA 3BU2A 3S14B 3W1BA 1F2MA 1NR4A 1V1PA 2HQLA 1BCPF 1J5EL 1I4GA 1WTHA 1KNEA 3NP8A 5NUCA 1P16A 1XX8A 4HTHA 4L5QA 1W6KA 3RLOA 2RA4A 1VMPA 3Q22A 2QILA 2NZ1D 2EY5A 2EYMA 3GTLH 3OTOL 3GTGB 2ZJRA 3NELA 4X3KA 2NYZD 1S40A 1BCPB 5M5YH 4OWXB 4FF3A 3K0YA 1WJJA 1Z7TA 5E4XA 2JA7B 4FXKC 2A6HD 4U68A 5IODA 4B3RL 3G6JB 4GNXB 2PW7A 2XRQD 4BA2I 1UE5A 3W5OA 4DAYB 1HTPA 3OIQA 3U58A 5CYUA 1IBLL 2D62A 3VR6A 3U4ZA 3KK7A 4IFDH 1SBBB 2EYLA 2GA4B 4LWCA 3OW7A 3M9BA 4G4KA 4UP8A 2X69A 1Q81C 1HHVA 3BYTB 1UE7A 2FMMA 2B2TC 2OTJA 3GTLB 4XDXA 1RD9D 1HNZL 4LF4L 2EJMA 4MNOA 5C0XG 1K83H 3AMUA 2JA7G 1WCMH 1YITA 5M5YB 1CZGA 1XMQQ 5IT9c 1IL2A 4A3BH 2J4XA 1KDCA 1EYAA 4KN4C 1IW7D 1GXDC 3PO2H 3KOJA 5A2QE 2EJGC 1IL8A 4ME5A 3U9OA 4IPDA 4QY7A 3RNUA 3Q24A 1JOQA 3H6MA 1E24A 2F1MA 1HNXL 4PZ6A 4P72A 1EUJA 3K81C 2CVRA 4X66Q 4NXNQ 3SK5A 1PTOD 2K14A 1VCIA 2VUMH 4ZRZA 5BR8Q 5C3XA 2KCNA 4H44C 3M7NA 1HRJA 2E76C 3CKIB 1HPCA 3JAMi 2HCCA 4KHZA 4P74A 3PIOA 3ICEA 1UEAB 1STAA 2MNAA 1U4PA 1GUSA 4DN4M 1MJEA 2EJFC 1E2ZA 1R4QB 5D14A 4ZQ3A 1K83B 5A2QL 1WCMB 3K58A 3PGZA 4KD3A 2F4VQ 4IPHA 1VQ5A 1B1ZA 4A3BB 2FFKB 1NTGA 1QCBD 1HJPA 4QMGA 3CRKC 1KD1C 1LABA 3PO2B 4K6LA 4DV5L 3K80C 1ASYA 1EFWA 1NR2A 3BZDB 2R6GA 2NZOA 4IFDG 5C0XJ 2NVXH 4KD4A 1G6PA 2D2CC 1BVSA 4JI2Q 2VUMB 3E9IA 2N88A 3P20A 5ELDA 2Y0SB 4J6HA 4JOIC 4P73A 5EBDA 2LKVA 2B8FA 4NDXA 4XIGS 2L4NA 2ZTDA 2F0HA 3HEJA 2JEBI 4L6TB 2GVBA 5JJLA 3A5UA 4FP5D 3MA2B 4K8IA 1S4ZA 1I6VC 3SK6A 3SXHA 4LUZA 3FDTA 3CCQA 4A3BG 4ZUJA 3T1YQ 1CUKA 3GTMH 3DEOA 4IURA 3BS1A 1N33Q 3MXGA 5M3FG 1C48A 5KNCA 2R7ZG 4ULLA 4HIOA 5ELFA 1HNWQ 1CZWA 2AWNA 4KHVA 4JCVE 1FD7D 1N36Q 2IX3A 2F3VA 2NVXB 1TQOA 3NQIA 5I9PA 1HQRD 2HCIA 1AP0A 4POGA 4DNTB 4ZCKA 2HDMA 4YWKA 4GN3B 2A73B 1RODA 1SNCA 1IBMQ 2NN6G 4V190 3AFQA 3OWEB 4DV0Q 4JPBW 4KY5A 5FKAC 3K5MA 1I4XA 2CFMA 2X6LA 5IP7H 3KDFA 3GTMB 2HQEA 2F0FA 3CCJA 2G5DA 1RL2A 2F0EA 3K8AA 2B2YA 2HIVA 3K7AH 1XXGA 3TQYA 3CU7A 4B08A 3FPUB 4FNFA 2A6HC 2F0SA 2NVTH 2QEJC 3L9AX 1H9KA 4EQNA 4Y52H 5LMNQ 4JBKA 4X66L 1KDBA 4KHPL 1WTOA 1Y69U 1EIFA 4HJ7A 2K52A 2K5QA 4CDCC 3PIPA 5HGQA 3GO5A 4CDEC 4XYOA 4TRDA 5DNFA 5CMDA 3FPPA 4A4IA 1KC8C 1XNQQ 4KY7A 4G7HC 5K36G 1LTLA 1MIUA 4AQYQ 1PRTF 1F2YA 4JW0A 4QIWE 3M4PA 2DY7A 1J6QA 3JC66 3K7AB 3TS2A 1D1IA 4K0KQ 1IW7C 4J1MA 3W3AA 5IY0A 2WB1E 4LF9Q 1CSQA 2NVTB 2OWOA 1F9PA 1SRUA 1XMOQ 3P7JA 2Z9HA 2CW0D 1V1OA 2KHJA 1LUZA 3J81c 2JE6I 1PTOC 4A3LG 4DR1Q 4KV6A 5BN3A 4L5RC 1K0SA 2IL8A 1MSHA 2FINB 3CCUA 2FJ2A 3D4WA 3L0OA 4OXPA 4RKBA 5GQOA 2HD3A 2JXMB 3FVQA 5IP7G 1PH8A 1V8QA 5TSSA 1K8AC 3KYHC 1N34Q 4JI0Q 3I56A 5CBEE 2VQEQ 4DV1L 1HNWL 4OO1H 3OPOA 2A6ED 1T9HA 2F0LA 2LSSA 4JI8Q 1VQ7A 1AFPA 5CORA 2WKDA 1KHIA 1IXRA 2O5IC 1C0AA 4BY1G 1OXSC 2B2UC 1WOCA 1SSOA 3T56B 5FLMH 3PSIA 5IYDH 1F9QA 5GAEC 4FF1A 1VF7A 3CCLA 1Q90A 4ID6A 4ZYSA 5J1ZA 1M1KC 4WJ4A 3HKZE 4DUYQ 3O13A 4DV0L 4P2CB 2MUYA 4OX9Q 1PH7A 4BY7G 2UXBQ 1PH9A 3T51B 1HA6A 1LO5D 2Q2TA 3HRZC 1KABA 3F2CA 2IHFA 2IWHA 3S2HH 3EA6A 2JP1A 3TN2A 2XRSD 3J81j 2MQHA 1KNAA 2J7ZA 3DWAA 1KDAA 1CHPD 1J9OA 1YEZA 4DV6Q 4IPGA 3MXUA 2KHSA 3EJIA 4HMIA 4A3FH 1Z6HA 3I4LA 2I46A 4FO2A 4MZ9A 2O5JC 5J39A 1IKLA 4DXFA 4LF8Q 1PA6A 1C4QA 2PQAB 2PMZB 1NUCA 5JAVA 4IJHA 2AMCB 3R93A 4IUTA 1SJED 4A76A 4G7ZC 1XNRL 3K0XA 1SXTA 2XIWA 1XNQL 3IFDA 4NP5A 2C9OA 2E2JH 2B2VC 3D31A 1JOOA 3A74A 4OL7A 3BJUA 2P5ZX 4APVA 4CDFC 4OO1G 4X6AH 3J80E 4KK7A 3S2HB 3I73A 3QB3A 1ET6A 2ICIA 3E3XA 4LF9L 1RJTA 4M1UB 3AU7A 5FLMG 3BZCA 1E3PA 5HY6A 1Q3LA 2EY6A 5IYDG 1JCKB 1L1OA 1CTMA 3H0GH 2Q8RE 5D65A 4XYQA 1BBXC 1EU3A 3D4RA 3G48A 4A3FB 4JBMA 1PLFA 3I4NG 5IGCA 1NMFA 4L5SA 4DR1L 5JVH3 1U4LA 2AKWB 4DAMA 2B3GA 2E5LL 1RF2D 1EOVA 5JPMC 3D3RA 3J80L 1BBWA 3MC0B 1VDZA 1ZKOA 4A3DH 2E2JB 1YJWA 4MIUA 1NE3A 5JEAH 1WI5A 3J80i 4LFAQ 4KKUA 2Y0SE 5IYBH 4L5TA 2PYKA 2I5MX 3CD6A 3ERQA 1AN8A 1IHZA 4LF5L 3RUZA 2F0QA 3NE5B 4JI7Q 1DONA 4A3FG 4CJ0B 1PRTD 2KECA 1T5XD 2G9DA 5DM73 1WFQA 1AH9A 3H0GB 2K04A 4JI5L 1AE2A 4F88A 1YHBA 2F0VA 2CW0C 3HP3A 2JEAI 2EQSA 3E0EA 3SDZA 4DR4Q 1FJGL 4HMJA 1AZPA 4BXXH 4K2LA 4LK1C 3VYSA 5EPKA 3V2TA 4OX9L 1PTOH 4R1JA 5H1SE 2YTVA 5KYLA 3FKIG 4N8FA 3NWSA 4H7BA 3KBGA 3NEMA 2F0IA 1TWFH 4A3DB 1I94L 4PMBA 2RHSB 2NVYH 4HSPA 4IPCA 1X3PA 2D0OA 2BH2A 1X9NA 4IUVA 2KQ3A 5CBAE 4NXML 1FNVA 5IOCA 3J7AF 3GTPH 2L12A 1XYIA 3H0GG 3I4MH 3S17H 2A6EC 1UAPA 2K01A 1DYQA 3UE1A 3OMCA 3S1RH 3DLLA 4DV6L 2K05A 4YY3L 4A3KG 4BBSH 5GADC 4DXGA 5AFWA 1Y1WH 1VQBA 4EGVA 4UY8C 2BA0A 3E6ZX 3MXNA 1Q82C 2A19A 2E2IH 2ICEC 2V1CC 3Q0AA 5LMUL 3NPPA 2X6GA 1VMCA 1CM9A 5EJWA 1ICFB 3BVMA 3A55A 4A3DG 3UDIA 1PTOB 3CXCA 1B3QA 4B9XA 4FF4A 5KRUA 1TWFB 2ZTEA 1GUTA 2JA5H 1JJGA 5IYBG 1JQYD 4IUNA 2NVYB 4A3MH 5IGEA 3NQTA 1G6ZA 3G6EA 3DUZA 3GTPB 1EZ6A 4PZ7A 5IGDA 2EDGA 4DUZQ 1G51A 4GLVB 4QQBX 3A7LA 1L2FA 3S17B 3I4MB 2K50A 4JI1L 4OIJA 2H4OA 3ULJA 3S1RB 1QZGA 1SNDA 2K5WA 2Z1CA 1FR3A 1EY4A 4DGZA 3VA5A 4UPAA 1TIID 4BBSB 4HIDA 3E0JA 2FXQA 4OEMB 1Y1WB 3S24A 2AWOA 4BXXG 2EOTA 3CQZH 2CWPA 1H95A 3EFXD 2E2IB 3IFTA 3MHBA 2EY2A 3OOCA 2UU9L 2BOSA 3OIPA 1ZXTA 5EGTA 2DNCA 4G57A 1VQIA 1EFID 1G2SA 1PZID 2Q2UA 1ESFA 1C7YA 2JA5B 1Q1EA 1C8CA 1UEBA 1VQOA 1SMXA 4A3MB 3CC4A 4LFAL 3C46A 2Q2HA 4JV5Q 3I4MG 4HCEA 1JB7A 4RGMA 3RZOH 4GKKL 5C44H 1ET9A 1GHKA 3MTSA 4B3SL 2IW3A 3H3VC 1LTTD 5FLXE 1VS0A 3NHHA 5FO7B 5JEAJ 4BBSG 3I90A 1Y1WG 1CHQD 1KRTA 4C56C 4DR6L 4LJZC 1QG7A 2N3SA 1UE6A 3MEHA 3Q6SA 4I65A 3GTQH 2KEEA 2B2UA 1VQHA 1DGSA 4DK6C 3EROA 3CQZB 1X3FA 2R61A 1AE3A 4PG3A 5HURA 5C0XI 3V05A 4JI6L 1CA5A 2JA5G 1X3EA 4A3MG 1FL0A 2ZXOA 4QB4A 3RLNA 3ER0A 2ZJQA 5I4DA 1A2TA 2IJ0A 4IZ8A 3CF5A 5FLXL 2UXCQ 2KCCA 4ZLTF 4TKOB 5FK9C 3RZOB 1TT2A 5C44B 3M3YH 1SLJA 3UDGA 2DGYA 1T5EA 2HUGA 1L0YB 3B6YA 5IWAQ 1D6EC 4Q5VA 1LTGD 1NAPA 4DNIA 2TMPA 3MXPA 3TZDA 3EQLC 2RDGA 1PRTC 2Z4IA 1O7YA 1QILA 4FDBA 3GTQB 3NBHA 2VY3A 4DNRB 2EY1A 2IT1A 3GP7A 3JAME 3G7LA 4LF7Q 5DAUA 2F0TA 5KNDA 4L8JA 2CHBD 4A3EH 2AHOB 1QE6A 3TRZA 5EKIA 2JSOA 4F7XA 5L37A 3PCOB 2PZWA 4JBJA 3FEWX 1JB3A 5FJ8H 1SMYD 3WDNA 4HJAA 2WV6D 4GN4B 1VQPA 1PHJA 1KL9A 2NVQH 1B53A 3HG9A 5C44G 4WJ3M 4XT3B 3W1GA 2B2VA 1JE4A 2EXZA 2PW5A 1E1TA 4IFDI 4BA1I 4IN3A 1H9RA 3M3YB 4RCOA 5D3IB 5M3FH 2ATWA 2R7ZH 2Q8TA 1EOTA 4OONA 4RAUC 3BDOA 1VQNA 3PUYA 3J7ZC 5ELNA 1S5CD 2PO4A 5AJ3L 1K3RA 1NY4A 3JAML 5I6YA 1XTDA 5I2YA 5BN4A 4S3SA 4HR7B 4RA8A 3G71A 1HTLD 1FGBD 3PUXA 2ZM6Q 4A93G 1IYVA 1S5FD 2PCFB 5ISRA 1WTWA 4DA2A 2EVBA 3SEBA 5CC4A 5DLQE 5IIFA 4A3EB 4LUVA 3T4AC 3MAQA 1U9RA 1WYDA 2JA6G 3NTKA 5KYIA 4HIKA 1M90C 3A7AB 5M3MH 2NN6H 4O0AA 4I7ZC 2NVQB 2BH8A 2F0UA 5I9OA 3E9HA 2WINB 4A3CG 1PVOA 3ULPA 1CK1A 3UE0A 5C6AA 2JJQA 4AYBB 3U9SA 4DR7L 5M3FB 1L1OC 2R7ZB 2C5CA 2RHQB 1X54A 5E7NA 4ZK9B 3I70A 1A3VA 4ZKCB 3KUPA 3LWEA 2WACA 2ES2A 1VF5C 4GS3A 1GD7A 4RGNA 3HOXH 3M7GA 5CGKA 3LGJA 3OW2A 4A3EG 4RHSA 1WTPA 1K8GA 2SNMA 3VYTA 1DD2A 3CC7A 2RCFA 5FJ8G 2PZTA 5ELBA 4DPGA 4LFCQ 3MWYW 3D6CA 1N8RC 3RD4A 5M3MB 1K3BC 1Y1VG 4AYBG 3KDFB 1L0WA 1SYGA 1JT8A 1PYSB 1SE3A 5K36H 3PO3H 5IT9E 4B3TQ 1QUQB 2VZAA 2YV5A 3R2TA 3MVVA 4YHHQ 2LFNA 1SR3A 1HZ9A 2VW9A 1VQLA 1EWIA 1F2LA 4HN7A 4HCSA 1K28A 2HIXA 3H3VH 1YNJD 1OO9B 1G291 1DOMA 2MP1A 3A56A 3T16A 3HOXB 1U0LA 1LTBD 1EYDA 2KHIA 2L5TA 1PMRA 2FMCA 5IGFA 4JI3Q 3P75A 5CV7A 5M3MG 4A3LH 1E2VA 2NB0A 3CPFA 4K8JA 2YU9H 2QF7A 3T53B 5EQ0A 4IFDJ 4LAAA 3TP8A 3I7FA 1BUVT 3CPWA 1N32Q 5IT9L 1XMQL 1WTVA 2PZUA 4X64Q 2E2DC 1QVGA 4DF7A 1MKHA 3A54A 1ASZA 3PO3B 2AQ1B 1QVFA 5IGGA 2VXWA 3SE0A 1QUQA 1RDPD 4KJOA 4CJ2C 1JJCB 5C4JH 1PH1A 2O2LD 3GQBA 1HZAA 3X3MA 1XPRA 3BDLA 3HOXG 4AIMA 5JJKA 2B8GA 1SE4A 2WAQB 3S9WA 2NTSA 4NXNL 4BY1H 1HR0W 4HJ5A 4IJLA 5BR8L 3U50C 2F0MA 1FNUA 4LF6Q 1STHA 1Q12A 1S3OA 3BVGA 4RHRA 2K4KA 1B50A 1PFMA 2QCPX 4IUUA 2R93H 1FNWA 1VQ9A 3OSOA 4OWWB 3Q23A 2YU9B 5A35A 4O2DA 1GOZA 1I3QH 4OWTB 3PO3G 1QNKA 4BY7H 1SMYC 1E2WA 2F4VL 2K1BA 1YNXA 1EL0A 4WRDA 5C4JB 5EKLA 1RTNA 3KLSX 3HOUG 2WAQG 1SFOH 1GVPA 3HOVG 2K03A 1SAPA 1K8OA 2ENBA 3H94A 4CGYB 4JI2L 4BY1B 1DJRD 4H13C 2JQOA 3GD7A 1D2BA 2IX0A 1PRTB 2PI2E 4ZUIA 2DNEA 2RCNA 3DWPA 1S5BD 3GTJH 2R93B 2RVLA 1Q46A 1CI3M 1B2TA 3J7AV 4C2MH 4C3HH 2Z6BA 3T1YL 1LT6D 2SDFA 1I3QB 4BY7B 1N33L 2K5NA 3I55A 2F3IA 3PMFA 4DV3Q 1W2BA 1EQQA 1EY7A 4QUFA 1E1OA 4B3TL 2LMCB 1JWUD 2OQKA 1VQGA 1PXUA 2B29A 2K5DA 4XXEA 4A3GH 1SFOB 1QVCA 1HH2P 1TWHH 4NMZA 1N36L 4POFA 1SJHD 2VQFQ 1XPOA 1EY0A 1E0BA 1H9JA 5C5LA 2R93G 4RWSC 1BOSA 2GN5A 4ALPA 4J15A 2H5XA 3KF8A 3GTJB 2RBMA 3I4NH 4KLKA 3PUZA 1IBML 3SVMA 5GAHC 4OO1I 1BBUA 4DR3Q 1GJXA 1S72A 1AW7A 3HKSA 4C2MB 4C3HB 3C2PA 2SEBD 4QGUA 3RN2A 4JI4Q 3VDYA 2B2WA 4M8AA 1B8AA 1EU4A 4DV7Q 1B70B 4GOPC 2MO0A 4A3GB 2OXPA 2RKSA 3ERSX 2N55A 1B7YB 1TWHB 5LMNL 1S5DD 3DWQA 4RKLA 1EIYB 3Q8DA 1K0RA 3DM3A 1L1OB 2UUAQ 1RCVD 3NUCA 4R4IA 1YJ9A 3CCEA 2ASBA 1YNJC 4LF6L 3F2UA 2SNSA 3GTKH 4DR5Q 3L3OC 1YHQA 2D0PA 4F87A 2VB3X 4IOCA 3I4NB 4C3HG 3J81E 3CCSA 3RZDH 4R8IA 1ONLA 4DR2Q 1PH5A 1MD2D 2ALYB 3R3OA 1CKOA 3CHBD 2F4IA 1HFNA 1SEBD 4X62Q 1M4VA 4AQYL 1KRSA 1Y8NB 2PNHA 3FKIH 4YCVA 3D8GA 3LX0A 3OYYA 3TP7A 4HSVA 1STNA 2N8NA 4A3GG 4EQPA 2XN9C 3BYYB 2EYHA 2EYPA 4NB3A 4K0KL 1HCZA 4P71A 1V1QA 1G91A 1IZ6A 2JA8H 4GKJQ 5BN5A 1XMOL 4I7AA 4K5XA 1ZEQX 3TP6A 3SGIA 3J81L 3TP5A 2IPKD 1LACA 4KMUC 4RCNA 1CA6A 2OTLA 3GTKB 4A3KH 5E4WC 3TDQA 3M4QA 1I5FA 2KEDA 4CKBA 1KXLA 2KBNA 3J81i 3RZDB 4A3IH 4TSSA 1VQEA 4DV2Q 3S15H 4WFN3 1SYDA 1I6HH 2PQEA 3FKIB 3DXJC 1E22A 5D3DA 1BQQT 1TVXA 2BDNA 1N34L 1Y8PB 3T1HQ 4JI0L 4XQQA 2VQEL 4F8MA 1NBWA 4KKTA 5JOBA 4LFBQ 2L11A 4JI8L 1LTID 2JA8B 3M85A 1R4PB 2LS01 1GUNA 2ZJPA 3LNNA 4O1NA 1HR0Q 1CSPA 2E8GA 1VQ6A 4H0LC 3MXNB 2WP8J 4R9WA 5F2DA 1K8MA 3K7UC 4A3KB 4DUYL 4J8QA 2I5LX 1PH6A 4DR3L 3FHWA 1S5ED 4A75A 2JK8A 2UXBL 3QOLA 4KI0A 4A3IB 3S15B 1GUOA 1SYBA 2L0CA 1A0IA 3N6RA 3QJYA 3H09A 1ENAA 1J5EQ 3URYA 1YVCA 1LT3D 2ZT9C 1OXUA 2ZXPA 3BVZA 1HZCA 4DV7L 3M4OH 2JA8G 2M2LA 2O4XA 2UUBQ 4IO9A 1O7ZA 2CQOA 4O42A 1EQRA 1BKBA 3DM1A 1WD0A 3PIO3 3OTOQ 3OWFA 2BA1A 1HFGA 1KLUD 1W6JA 3EVQA 1WVLA 4ILWA 4LF8L 5C5MA 2UUCQ 4NW2A 5IGBA 4UAIA 2QKIC 1H9MA 3A8JE 4A3IG 2XTIA 1EYGA 4ME3A 2CKZB 1OXXK 4R4OA 4HIMA 4C3IG 4B3RQ 1VQ4A 2NZHA 5EKKA 5C4HA 2V4DA 3J7YW 1PYWD 3WWVA 2PNRC 3S1QH 1QNUA 4LUOA 4OELB 4ABNA 4IOAA 1IBLQ 1JORA 2M9VA 1EEFD 1L0XB 1CKNA 3M4OB 4GN5A 2C35B 2CCZA 4PMCA 3I4OA 1Y8OB 1TY2A 5KEEA 3CMAA 2QEXA 2MHVA 3BG3A 4FXDA 2YTYA 4Q0FA 1JJ2A 1AZQA 4E6IA 4CBVA 1HNZQ 1BNZA 4XQJA 2R3ZA 1CKMA 1EWCA 3TSSA 4DV4Q 2MJ8A 3HS0C 1R9TH 1LTSD 2Z6KA 2CQAA 1TWCH 4RFBA 1SE8A 4X3SA 4YWMA 2I5HA 3TZUA 4DV2L 1WTRA 4BBRG 3CAMA 3CC2A 3NENA 3CRLC 3S1QB 1A3UA 3ONAB 1YJNA 1ILQA 3F8TA 3T1HL 4QIWB 3A8KE 3VYRA 1F9RA 2KCTA 3KLWA 4DU9A 1PYBA 2QA4A 2WB1B 4JI7L 1TWGH 1RIPA 1RTOA 1BF4A 4R4QA 3DHQA 5LL6S 4GOPB 2A1AA 2WKCA 4CHTB 2F0JA 3QWNA 1KIXA 1BO0A 4DR4L 3NBHB 3QIAA 2H1EA 4XTCS 1R9TB 2DY8A 3FRPB 1HUMA 1TWCB 2IHEA 3KLSA 4DV5Q 1HA5A 1Q86C 4A93H 1HQMC 3MZ5A 3PV0A 5LMNW 1O7LA 1Z47A 1B4OA 5M5WH 2JA6H 1F77A 3C1FA 3AFPA 5G3LF 3DMUA 2WB1G 1WTXA 4JK1C 2A69D 4IQZA 1X6OA 2UUBL 4A3CH 3PIP3 5M5XH 2MPMA 3NTIA 2BDOA 1TWGB 3KF6A 4FVMA 5J22A 3J7A5 1D7QA 4GOPA 1A6XA 3N52A 1EZ8A 4OIKA 4KTAA 3NWTA 3VR5A 2A5HA 2UUCL 4MTNA 2PI2A 3F2DA 3HKZB 4EQOA 2MO1A 4DAVA 2EZVA 4CDDC 2RSNA 4K2KA 4C3JH 1OTCA 5KNBA 4HJ8A 4A93B 3U4VA 4RG1A 1TS3A 5EPJA 1YI2A 1DOLA 3IKJA 2RQXA 2B2WC 3NXWA 1X56A 5ELEA 1ML0D 5M5WB 2JA6B 4YWLA 4G7OC 1PFNA 2E75C 3I72A 1LM0A 1X3QA 1Y1VH 3K5NA 4DUZL 3HFZB 2F0WA 1A2UA 3STBD 2A74C 2PMZE 5M5XB 2EIFA 1UNSA 4B9WA 4KJNA 2BE5D 1N9WA 1SN8A 1LLRD 3SHLA 2VL6A 1SNQA 3TBIB 2GVAA 2L9HA 3HKZG 2A68D 1JWMD 2CWAA 4DV4L 2NBFA 2RDFA 2AUKA 2F03A 2Z0SA 2ID0A 4ZKBB 2F0NA 4OGQC 3EN2A 3OMGA 4C3JB 5I2XA 5DM63 4QJFA 1PH3A 4GNXA 3VR3A 1PDQA 1KAAA 4PMWA 4OHJA 3K5OA 2EYFA 1QB5D 4DAYA 3I91A 3QR8A 5CV4A 5EAYA 3A8IE 5C3EH 3IL8A 3WOFA 1B3AA 1SNOA 2XVSA 4KHPQ 1D5ZC 4EVOA 3S16H 3I8ZA 2A8VA 1JE5A 4JV5L 1CQVA 3GTOH 2FHTA 2CH4W 4GLXA 4JC0A 1Y1VB 3FP9A 5EPLA 1LT4D 1IBKQ 3RN5A 2DJFC 2E74C 1JMCA 4C1NI 1EY9A 2K28A 4L63B 1HZBA 2NN6I 4YIJA 1TS2A 4C3JG 2Q2IA 4RH6A 1MSGA 2EYJA 3ULLA 4HAEA 4PQXA 5T1IA 2OEOA 4X3TA 3C3LA 4MHEA 2WFWA 1MHWC 4YCUA 3M4YA 4BS9A 1EYCA 1OXVA 4JBWA 5C3EB 1VQFA 3S16B 2UXCL 4DK1A 2R92H 5ELCA 3GTOB 1CQFA 1SDFA 3P1HA 2N78A 1SYCA 1U4MA 1B44D 5IWAL 5GROA 1X32A 4ODGA 5ELOA 3PF5A 3CCMA 3IAYA 4QCLA 1WCMG 2KENA 3HOUH 3HOVH 1QZHA 2HHHQ 1X65A 5LL6X 3RMHA 4GLAC 1GUWA 3PO2G 2SOBA 4H02A 5FOBB 4LF7L 2QDBA 3HOWH 4DV1Q 1Q7YC 2L1BA 2CH4A 1O7IA 2EPBA 5C3EG 1VQDA 3MFYA 3AB9A 1MJCA 2AQ2B 2VUMG 2Y0SG 1Z9FA 1KQSA 4LNQA 1MGSA 1ENCA 1RKNA 3H3VI 4QF4A 1UWVA 1I4QA 3MEFA 1DM0B 2R92B 5LHY1 1SNPA 2LXKA 3L7ZC 5CV6A 1IKMA 1I50H 3F2BA 5CV8A 1TS5A 1BCPD 2F3WA 2A69C 1JC7A 3SR1A 4JYAQ 1XWEA 2Q8IB 3GV6A 4IUPA 5G3LD 3HOUB 1UE1A 4CKCA 2BCOA 3HOVB 3D0FA 1SYFA 1UUPA 2OT2A 2KA7A 2ZM6L 1V9PA 2XWBB 1Y14B 2JA9A 3HOWB 1EIGA 1EIHA 3TREA 1FYCA 1PV4A 1SYEA 2J0TD 2R92G 3H91A 1EQTA 2K32A 5IYCH 1RHPA 2EXDA 4P75A 3UDFA 3D6WA 3ND9A 4A3JH 3UDXA 3OHXC 2L55A 1IBKL 2I0QA 1I50B 1O80A 4K14A 3QOJA 3S1NH 1PFSA 4EX5A 4R4TA 3STBC 3NBIA 2AQ3B 1XNRQ 3A5ZB 1LTAD 2BE5C 1O78A 2Z6KC 1B9NA 3PQIA 3HOWG 4NPSA 1QJOA 2A68C 5C4XH 2Z4HA 4DK0A 1D5MC 1GUGA 4RGTA 3QO2A 1QWYA 1D5XC 4PV1C 3KF8B 3K6OA 1ESRA 4WORA 1C9OA 5JPNC 3KLRA 1EY8A 2KUMA 4LFCL 3HOZH 4EQ5A 1VQCA 2OF1A 1YNND 1NJIC 3H15A 2OCEA 2F0OA 3G4SA 4A3JB 5CR3A 2YTXA 3S1NB 4YHHL 5E1FA 3ZYYX 4UDUC 2RDHA 2E5LQ 1NMGA 2VS1A 5J3BA 4DKAC 1NSNS 3NK9A 5IP9H 1PZKD 4TQUS 3K5LA 3J80c 2HHHL 2DJGC 2F0GA 4HJ9A 3QG1A 1VQKA 2R7FA 4B3MQ 5C4XB 1EY6A 5GAGC 5JJZA 4JI3L 2VNUD 3VA7A 1A8VA 1CT1D 5E3FA 3AYHB 4XQNA 1NNXA 2Z8LA 3C1EA 1WD1A 1TXYA 1TS4A 1U4RA 3I2ZA 4LF5Q 2K5HA 3HOZB 2KCMA 4NKLA 5IYCG 3GV3A 1SNMA 2NTTA 1G8ZD 4A3JG 2EYOA 1STEA 1TU2B 1N32L 2YYZA 2VB2X 1KLGD 4MN3A 4BWGB 4PZ8A 1PFBA 3HOYH 2WIIB 1JICA 4X64L 4JI5Q 1M8AA 3I3CA 1J8IA 2XWJB 1GO3E 3CCRA 1FJGQ 2K33A 4JYAL 4UP7A 1D1KA 2QDLA 5IE8A 2B2TA 5C4XG 1I94Q 1H9SB 1Q1BA 1BR9A 1II3A 1KAWA 3KJPA 4NXMQ 3HOZG 1I4HA 4QUCA 1X55A 5EBCA 4CJ1B 2RSOA 4U673 1VQ8A 1TKWB 5FO8B 3F1ZA 1EEID 4AH6A 1BDOA 3ND8A 1Q8KA 4C1NK 1GKHA 4JVZA 2IY5B 2K5VA 4YY3Q 4DFAA 3HOYB 2KOLA 4N9TA 1A15A 2D9UA 2NUCA 5CV9A 3EBEA 1KTKA 1EQVA 1FGUA 3CW2C 1TY0A 1GM5A 3W2DA 3KJOA 2UXDQ 4K6DA 3VR2A 5IP9G 1IYUA 5LMUQ 1D8LA 4X65Q 4RGOS 3E5SA 1BCPC 3KFUA 1V43A 4TVAB 2B63H 3IRBA 3CMEA 1MI2A 2F0KA 1H9SA 2XSCA 1ZYRD 4IALA 4GNXC 4DK3C 1ICWA 2F0DA 1TR5A 1A62A 3PUWA 2AUJD 1YBYA 4AYBE 1BXTA 1VQMA 2HDLA 1AEXA 4FF2A 2B39A 1PZJD 1DXMA 3L2PA 3HOYG 2QW7A 2M00A 1LT5D 4R8NA 5COYA 4JI1Q 1K9MC 2G9HD 4KY6A 4MTKA 4C3IH 5CV5A 4JG2A 3K57A 4DV3L 2R7DA 3R2IA 4Y7NH 3RLFA 2JYOA 4IUQA 3TMEA 2PQAA 1ENFA 2UU9Q 4JOIA 1HUNA 1E7ZA 4UP9A 2E2HH 2XGTA 4QL5A 3EIVA 2VQFL 3CCVA 2B63B 3TEHB 1DCZA 2IX1A 2TSSA 4B3ML 4V0BA 4R4CA 2QGQA 1JWSD 2EE1A 4UHVA 3X3NA 4GKKQ 1XPUA 3NSWA 4B3SQ 3MFGA 3CP0A 4K5WA 4C3IB 5K5PA 4PNYA 4Z9CB 1STGA 4JI4L 1YNNC 4DR6Q 1I6HB 4BBRH 4K5VA 1A3TA 1LTRD 4KN7C 2JN4A 1QOHA 4Y7NB 1CKNB 1MBYA 1G2TA 5DEHA 3R8BA 3RR5A 2F52A 2B63G 4JI6Q 1HXYD 1X3GA 2E2HB 2LXJA 2UUAL 1DZ1A 1NCVA 1GHJA 1CFMA 4ZAIA 2OQ0A 3S1MH 3S2DH 2NWGA 3WOEA 2N49A 4DR5L 4WJWA 3UI2A 5FLXc 3A0JA 1PTOF 2I07B 4GZYC 5KIXA 1TWAH 4DR2L 1P8LA 4DAPA 3SK4A 3VR4A 1PH2A 4LW1A 4X62L 2DN8A 1SE2A 2WAQE 3DEPA 2K7VA 1I4PA 4BBRB 2XNAC 2D5DA 3FMCA 5I6WA 5HGTA 2UXDL 1W3SA 1JOKA 4RMFA 4X65L 3LWUA 1VQAA 5T1GA 4HEDA 1LV9A 4GKJL 2K6AA 3BDCA 5KGUA 2L15A 2RF4A 5JEAG 3TS0A 3GDEA 1A63A 5C3WA 1YHAA 4YCWA 4LF4Q 1EY5A 4LMQD 2HT1A 2B2YC 3S1MB 3S2DB 3T13A 1OXTA 3PF4A 1K73C 1WTQA 1YIJA 2KJXA 2MFIA 1I4RA 3BZKA 1STBA 1TWAB 2F0PA 3V96A 3S14H 1Q8IA 1JR0D 1VQJA 1HNXQ 3VYUA 1V1PB 5AJ3Q 2K75A 5C4ZA 3KBXA 1XJVA 4XT1B 3SK8A 3JAMc 1FVIA 5JJIA 4LFBL 1F9SA 4KKSA 3AEVA 4FYDA 1B9MA 3AQQA 4N9PA 1IYJB 2ZXRA 1PH4A 3D4DA 3KF6B 4CKEA 5M9OA 2DUDA 3PUVA 4FXGC 1YZ6A 1F2ZA 3GTGH 3ZJYC 1HR0L 4N8X1 1STYA 2LY7A 5FO9B 1DOKA 3NTHA 1XTCD
chains in the Genus database with same CATH topology
1ZYRC 5C0XH 5JVG3 2MGSA 3K59A 1ILPA 3HZXA 1EWHA 2PPBC 2KVMA 4X3UA 3HGBA 3ITPA 3S14B 1F2MA 1NR4A 1V1PA 1BCPF 1I4GA 1KNEA 3NP8A 5NUCA 1XX8A 4HTHA 1W6KA 2RA4A 1VMPA 3Q22A 2QILA 2NZ1D 2EY5A 2EYMA 3GTGB 4X3KA 2NYZD 1BCPB 4FF3A 3K0YA 1Z7TA 5E4XA 2JA7B 4FXKC 2A6HD 4U68A 5IODA 3G6JB 2PW7A 2XRQD 4BA2I 1HTPA 3OIQA 5CYUA 2D62A 3VR6A 3KK7A 4IFDH 1SBBB 2EYLA 2GA4B 3OW7A 4G4KA 2X69A 1HHVA 3BYTB 2FMMA 2B2TC 3GTLB 4XDXA 1RD9D 2EJMA 5C0XG 3AMUA 5M5YB 1CZGA 2J4XA 1KDCA 1EYAA 4KN4C 1IW7D 1GXDC 5A2QE 2EJGC 1IL8A 4ME5A 3U9OA 3Q24A 1JOQA 3H6MA 2F1MA 2CVRA 3SK5A 1PTOD 1VCIA 4ZRZA 5C3XA 2KCNA 4H44C 3M7NA 1HRJA 2E76C 3CKIB 1HPCA 2HCCA 4KHZA 1UEAB 1STAA 1U4PA 1GUSA 4DN4M 2EJFC 1E2ZA 1R4QB 5D14A 4ZQ3A 1K83B 5A2QL 1WCMB 3K58A 4KD3A 4A3BB 1B1ZA 2FFKB 1QCBD 4QMGA 3CRKC 1LABA 3PO2B 4K6LA 1NR2A 3BZDB 2R6GA 4IFDG 5C0XJ 4KD4A 2D2CC 2VUMB 2N88A 3P20A 5ELDA 2Y0SB 4J6HA 5EBDA 2LKVA 2B8FA 4NDXA 4XIGS 2L4NA 2F0HA 3HEJA 2JEBI 4L6TB 4FP5D 3MA2B 4K8IA 1S4ZA 1I6VC 3SK6A 3SXHA 3FDTA 4ZUJA 3DEOA 4IURA 3BS1A 3MXGA 1C48A 5KNCA 4ULLA 5ELFA 1CZWA 2AWNA 4KHVA 1FD7D 2IX3A 2F3VA 2NVXB 1TQOA 3NQIA 5I9PA 1HQRD 2HCIA 1AP0A 4DNTB 2HDMA 2A73B 1RODA 1SNCA 2NN6G 4V190 3OWEB 4KY5A 5FKAC 3K5MA 1I4XA 2X6LA 3GTMB 2HQEA 2F0FA 2F0EA 2B2YA 1XXGA 3CU7A 4B08A 3FPUB 4FNFA 2A6HC 2F0SA 2QEJC 3L9AX 1H9KA 4EQNA 1KDBA 1WTOA 1Y69U 2K5QA 3GO5A 4XYOA 4TRDA 5DNFA 5CMDA 3FPPA 4KY7A 4G7HC 5K36G 1PRTF 1F2YA 2DY7A 3K7AB 1D1IA 1IW7C 4J1MA 3W3AA 2NVTB 1F9PA 3P7JA 2CW0D 1V1OA 2JE6I 1PTOC 4KV6A 5BN3A 2IL8A 1MSHA 2FINB 2FJ2A 3D4WA 4RKBA 2JXMB 3FVQA 1V8QA 5TSSA 5CBEE 4OO1H 3OPOA 2A6ED 2F0LA 1AFPA 5CORA 2WKDA 2O5IC 1OXSC 2B2UC 1SSOA 3T56B 1F9QA 4FF1A 1VF7A 1Q90A 4ID6A 4ZYSA 5J1ZA 3O13A 4P2CB 2MUYA 3T51B 1HA6A 1LO5D 3HRZC 1KABA 2IWHA 3EA6A 2JP1A 3TN2A 2XRSD 1KNAA 2J7ZA 3DWAA 1KDAA 1CHPD 1J9OA 3MXUA 2KHSA 3EJIA 4HMIA 1Z6HA 3I4LA 2I46A 4FO2A 2O5JC 5J39A 1IKLA 4DXFA 1C4QA 2PMZB 1NUCA 5JAVA 3R93A 4IUTA 1SJED 4G7ZC 1SXTA 2XIWA 3IFDA 4NP5A 2C9OA 2B2VC 3D31A 1JOOA 4OL7A 4OO1G 3J80E 4KK7A 3S2HB 3I73A 3QB3A 1ET6A 2ICIA 1RJTA 4M1UB 3AU7A 1Q3LA 2EY6A 1JCKB 1CTMA 5D65A 2Q8RE 4XYQA 1BBXC 1EU3A 3D4RA 4A3FB 1PLFA 5IGCA 5JVH3 1U4LA 1RF2D 5JPMC 3D3RA 3J80L 3MC0B 1VDZA 1ZKOA 2E2JB 4MIUA 5JEAH 4KKUA 2PYKA 3ERQA 1AN8A 1IHZA 3RUZA 2F0QA 3NE5B 1DONA 4CJ0B 1PRTD 2KECA 1T5XD 2G9DA 5DM73 3H0GB 2K04A 4F88A 2F0VA 2CW0C 3HP3A 2JEAI 3SDZA 4HMJA 1AZPA 4K2LA 4LK1C 3VYSA 5EPKA 3V2TA 1PTOH 5KYLA 3NWSA 4H7BA 3KBGA 2F0IA 4A3DB 4PMBA 4HSPA 1X3PA 4IUVA 2KQ3A 5CBAE 1FNVA 5IOCA 3J7AF 2L12A 1XYIA 2A6EC 1UAPA 2K01A 1DYQA 3OMCA 2K05A 4DXGA 5AFWA 4EGVA 2BA0A 3E6ZX 3MXNA 2ICEC 3Q0AA 3NPPA 2X6GA 1VMCA 1CM9A 5EJWA 3BVMA 3A55A 1PTOB 4B9XA 4FF4A 5KRUA 1TWFB 1GUTA 1JQYD 4IUNA 2NVYB 5IGEA 3NQTA 1G6ZA 3DUZA 3GTPB 1EZ6A 5IGDA 2EDGA 3A7LA 3S17B 3I4MB 4OIJA 2H4OA 3S1RB 1SNDA 2K5WA 2Z1CA 1FR3A 1EY4A 4DGZA 3VA5A 1TIID 4BBSB 3E0JA 1Y1WB 2AWOA 2EOTA 3EFXD 2E2IB 3IFTA 3MHBA 2EY2A 3OOCA 2BOSA 3OIPA 1ZXTA 5EGTA 2DNCA 4G57A 1EFID 1G2SA 1PZID 1ESFA 2JA5B 1Q1EA 1C8CA 4A3MB 3C46A 4HCEA 4RGMA 1ET9A 1GHKA 3MTSA 2IW3A 3H3VC 1LTTD 5FLXE 3NHHA 5FO7B 5JEAJ 3I90A 1CHQD 4C56C 4LJZC 1QG7A 3MEHA 3Q6SA 4I65A 2KEEA 2B2UA 3EROA 3CQZB 2R61A 5HURA 5C0XI 3V05A 1CA5A 2ZXOA 4QB4A 5I4DA 1A2TA 2IJ0A 4IZ8A 5FLXL 2KCCA 4ZLTF 4TKOB 5FK9C 3RZOB 1TT2A 5C44B 1T5EA 2HUGA 1L0YB 1D6EC 4Q5VA 1LTGD 1NAPA 2TMPA 3MXPA 3TZDA 3EQLC 2RDGA 1PRTC 2Z4IA 1O7YA 1QILA 3GTQB 3NBHA 4DNRB 2EY1A 2IT1A 3GP7A 3JAME 3G7LA 5DAUA 2F0TA 5KNDA 4L8JA 2CHBD 1QE6A 5EKIA 2JSOA 4F7XA 2PZWA 3FEWX 1JB3A 1SMYD 3WDNA 2WV6D 1B53A 3HG9A 4XT3B 2B2VA 1JE4A 2EXZA 2PW5A 4IFDI 4BA1I 4IN3A 1H9RA 3M3YB 4RCOA 5D3IB 2Q8TA 1EOTA 4RAUC 3BDOA 3PUYA 1S5CD 2PO4A 3JAML 5I6YA 5I2YA 5BN4A 4S3SA 4HR7B 4RA8A 1HTLD 1FGBD 3PUXA 1IYVA 1S5FD 2PCFB 5ISRA 1WTWA 4DA2A 2EVBA 3SEBA 5CC4A 5IIFA 4A3EB 3T4AC 3MAQA 1U9RA 3NTKA 5KYIA 3A7AB 2NN6H 4I7ZC 2NVQB 2F0UA 5I9OA 2WINB 1CK1A 5C6AA 4AYBB 3U9SA 5M3FB 2R7ZB 2C5CA 4ZK9B 3I70A 1A3VA 4ZKCB 3KUPA 3LWEA 2WACA 1VF5C 4RGNA 3M7GA 5CGKA 4RHSA 1WTPA 2SNMA 3VYTA 1DD2A 2PZTA 5ELBA 3MWYW 3D6CA 3RD4A 5M3MB 1SYGA 1SE3A 5K36H 5IT9E 3R2TA 3MVVA 2LFNA 1F2LA 4HN7A 4HCSA 1YNJD 1OO9B 1G291 1DOMA 2MP1A 3A56A 3T16A 3HOXB 1LTBD 1EYDA 2L5TA 1PMRA 2FMCA 5IGFA 3P75A 5CV7A 1E2VA 2NB0A 4K8JA 2QF7A 3T53B 5EQ0A 4IFDJ 4LAAA 3TP8A 1BUVT 5IT9L 1WTVA 2PZUA 2E2DC 4DF7A 3A54A 3PO3B 2AQ1B 5IGGA 2VXWA 3SE0A 4CJ2C 1RDPD 4KJOA 2O2LD 3GQBA 3X3MA 3BDLA 2B8GA 1SE4A 2WAQB 3S9WA 2NTSA 2F0MA 1FNUA 1STHA 1Q12A 3BVGA 4RHRA 1B50A 1PFMA 2QCPX 4IUUA 1FNWA 3OSOA 3Q23A 2YU9B 5A35A 1GOZA 1QNKA 1SMYC 1E2WA 2K1BA 1EL0A 4WRDA 5C4JB 5EKLA 1RTNA 3KLSX 2K03A 1SAPA 1K8OA 2ENBA 3H94A 4CGYB 4BY1B 1DJRD 4H13C 3GD7A 1D2BA 2IX0A 1PRTB 4ZUIA 2DNEA 3DWPA 1S5BD 2R93B 2RVLA 1CI3M 1B2TA 3J7AV 1LT6D 2SDFA 1I3QB 4BY7B 3PMFA 1EY7A 4QUFA 2LMCB 1JWUD 1PXUA 2K5DA 4XXEA 1SFOB 4NMZA 1SJHD 1EY0A 1E0BA 1H9JA 5C5LA 4RWSC 1BOSA 3KF8A 3GTJB 2RBMA 3PUZA 3SVMA 4OO1I 1GJXA 1AW7A 4C2MB 4C3HB 3C2PA 2SEBD 2B2WA 4M8AA 1EU4A 4A3GB 2OXPA 2RKSA 2N55A 1TWHB 1S5DD 3DWQA 4RKLA 1RCVD 3NUCA 1YNJC 3F2UA 2SNSA 3L3OC 4F87A 2VB3X 3I4NB 4C3HG 3J81E 4R8IA 1ONLA 1MD2D 3R3OA 3CHBD 2F4IA 1HFNA 1SEBD 1M4VA 1Y8NB 3D8GA 3LX0A 3TP7A 4HSVA 1STNA 4EQPA 2XN9C 3BYYB 2EYHA 2EYPA 1HCZA 1G91A 5BN5A 4K5XA 1ZEQX 3TP6A 3J81L 3TP5A 2IPKD 1LACA 4KMUC 4RCNA 1CA6A 3GTKB 5E4WC 3TDQA 2KEDA 4CKBA 3RZDB 4TSSA 4WFN3 1SYDA 2PQEA 3FKIB 3DXJC 5D3DA 1BQQT 1TVXA 2BDNA 1Y8PB 4XQQA 4F8MA 4KKTA 5JOBA 2L11A 1LTID 2JA8B 3M85A 1R4PB 2LS01 1GUNA 3LNNA 4O1NA 4H0LC 2WP8J 4R9WA 5F2DA 1K8MA 4A3KB 4J8QA 1S5ED 3QOLA 4KI0A 4A3IB 3S15B 1GUOA 1SYBA 2L0CA 3N6RA 3QJYA 3H09A 1ENAA 3URYA 1LT3D 2ZT9C 1OXUA 2ZXPA 3BVZA 2M2LA 2O4XA 1O7ZA 4O42A 3DM1A 1WD0A 3PIO3 3OWFA 2BA1A 1HFGA 1KLUD 1W6JA 3EVQA 1WVLA 4ILWA 5C5MA 4NW2A 5IGBA 4UAIA 2QKIC 1H9MA 3A8JE 1OXXK 4C3IG 5EKKA 5C4HA 2V4DA 3J7YW 1PYWD 2PNRC 1QNUA 4ABNA 1JORA 2M9VA 1EEFD 1L0XB 3M4OB 4PMCA 1Y8OB 1TY2A 5KEEA 2MHVA 3BG3A 4FXDA 4Q0FA 1AZQA 4E6IA 4CBVA 1BNZA 4XQJA 2R3ZA 1EWCA 3TSSA 2MJ8A 3HS0C 1LTSD 2CQAA 4RFBA 4X3SA 3TZUA 1WTRA 3CRLC 3S1QB 1A3UA 3ONAB 1ILQA 4QIWB 3A8KE 3VYRA 1F9RA 4DU9A 2WB1B 1RTOA 1BF4A 3DHQA 5LL6S 2WKCA 4CHTB 2F0JA 3QWNA 1BO0A 3QIAA 2H1EA 4XTCS 1R9TB 2DY8A 3FRPB 1HUMA 1TWCB 3KLSA 1HA5A 1HQMC 3MZ5A 3PV0A 1O7LA 1Z47A 1B4OA 1F77A 3C1FA 5G3LF 3DMUA 1WTXA 4JK1C 2A69D 4IQZA 3PIP3 2MPMA 3NTIA 2BDOA 1TWGB 4FVMA 5J22A 1A6XA 3N52A 1EZ8A 4OIKA 4KTAA 3NWTA 3VR5A 2A5HA 3HKZB 4EQOA 4DAVA 2EZVA 2RSNA 4K2KA 5KNBA 4A93B 1TS3A 5EPJA 1DOLA 3IKJA 2RQXA 2B2WC 3NXWA 5ELEA 1ML0D 5M5WB 2JA6B 4G7OC 1PFNA 2E75C 3I72A 1X3QA 3K5NA 2F0WA 1A2UA 2A74C 5M5XB 1UNSA 4B9WA 4KJNA 2BE5D 1LLRD 3SHLA 1SNQA 3TBIB 2L9HA 2A68D 1JWMD 2NBFA 2RDFA 2AUKA 2F03A 2ID0A 4ZKBB 2F0NA 4OGQC 4C3JB 3OMGA 5I2XA 5DM63 3VR3A 1PDQA 1KAAA 4PMWA 4OHJA 3K5OA 2EYFA 1QB5D 4DAYA 3I91A 5CV4A 3A8IE 3IL8A 3WOFA 1B3AA 1SNOA 2XVSA 1D5ZC 4EVOA 3I8ZA 1CQVA 2FHTA 1Y1VB 5EPLA 1LT4D 2E74C 4C1NI 1EY9A 2K28A 4L63B 2NN6I 4YIJA 1TS2A 4C3JG 4RH6A 1MSGA 2EYJA 4HAEA 4PQXA 5T1IA 2OEOA 4X3TA 3C3LA 4MHEA 3M4YA 4BS9A 1EYCA 1OXVA 4JBWA 5C3EB 3S16B 4DK1A 3GTOB 5ELCA 1CQFA 1SDFA 3P1HA 1SYCA 1U4MA 1B44D 1X32A 4ODGA 3IAYA 4QCLA 5LL6X 3RMHA 1GUWA 2SOBA 5FOBB 2QDBA 2L1BA 2EPBA 3MFYA 3AB9A 2AQ2B 1MGSA 1ENCA 1RKNA 4QF4A 1I4QA 1DM0B 2R92B 5LHY1 1SNPA 5CV6A 3L7ZC 1IKMA 5CV8A 1TS5A 1BCPD 2F3WA 3SR1A 2A69C 1JC7A 1XWEA 2Q8IB 3GV6A 4IUPA 5G3LD 3HOUB 4CKCA 2BCOA 3HOVB 1SYFA 1UUPA 2OT2A 2KA7A 2XWBB 3HOWB 1EIGA 1EIHA 1FYCA 1SYEA 2J0TD 3H91A 1EQTA 2K32A 1RHPA 3D6WA 3ND9A 3OHXC 2L55A 1I50B 1O80A 4K14A 3QOJA 3NBIA 2AQ3B 1LTAD 2BE5C 1O78A 1B9NA 1QJOA 2A68C 2Z4HA 4DK0A 1D5MC 1GUGA 4RGTA 3QO2A 1QWYA 1D5XC 4PV1C 3K6OA 1ESRA 4WORA 5JPNC 3KLRA 1EY8A 2KUMA 2OF1A 1YNND 2F0OA 4A3JB 5CR3A 3S1NB 5E1FA 3ZYYX 4UDUC 2RDHA 1NSNS 3NK9A 1PZKD 4TQUS 3K5LA 2F0GA 3QG1A 5C4XB 1EY6A 5JJZA 2VNUD 3VA7A 1CT1D 5E3FA 4XQNA 2Z8LA 3C1EA 1WD1A 1TS4A 1U4RA 3HOZB 4NKLA 3GV3A 1SNMA 2NTTA 1G8ZD 2EYOA 1STEA 1TU2B 2YYZA 2VB2X 1KLGD 4MN3A 4BWGB 1PFBA 2WIIB 1JICA 1M8AA 3I3CA 1J8IA 2XWJB 2K33A 1D1KA 2B2TA 1H9SB 1Q1BA 1BR9A 1II3A 1I4HA 4QUCA 5EBCA 4CJ1B 2RSOA 4U673 1TKWB 5FO8B 1EEID 1BDOA 3ND8A 4C1NK 3HOYB 4DFAA 2KOLA 4N9TA 1A15A 2D9UA 2NUCA 5CV9A 1KTKA 1EQVA 1TY0A 3W2DA 4K6DA 3VR2A 1IYUA 4RGOS 3E5SA 1BCPC 1V43A 1MI2A 2F0KA 1H9SA 2XSCA 1ZYRD 4IALA 1ICWA 2F0DA 1TR5A 3PUWA 2AUJD 1BXTA 2HDLA 1AEXA 4FF2A 2B39A 1PZJD 1DXMA 2M00A 1LT5D 5COYA 4R8NA 2G9HD 4KY6A 5CV5A 3K57A 3R2IA 3RLFA 2JYOA 4IUQA 3TMEA 1ENFA 1HUNA 2B63B 2IX1A 1DCZA 2TSSA 4V0BA 1JWSD 2EE1A 3X3NA 3NSWA 3MFGA 4K5WA 4C3IB 5K5PA 4PNYA 4Z9CB 1STGA 1YNNC 1I6HB 4K5VA 1A3TA 1LTRD 4KN7C 1QOHA 4Y7NB 1MBYA 1G2TA 5DEHA 3R8BA 1HXYD 2E2HB 1DZ1A 1NCVA 1GHJA 1CFMA 4ZAIA 2NWGA 3WOEA 4WJWA 3UI2A 1PTOF 2I07B 4GZYC 5KIXA 4DAPA 3SK4A 3VR4A 2DN8A 1SE2A 3DEPA 2K7VA 1I4PA 4BBRB 2XNAC 2D5DA 3FMCA 5I6WA 5HGTA 1JOKA 3LWUA 5T1GA 4HEDA 1LV9A 2K6AA 3BDCA 5KGUA 5JEAG 5C3WA 1EY5A 4LMQD 2B2YC 3S1MB 3S2DB 3T13A 1OXTA 1WTQA 2KJXA 1I4RA 1STBA 1TWAB 2F0PA 3V96A 1Q8IA 1JR0D 3VYUA 1V1PB 5C4ZA 3KBXA 4XT1B 3SK8A 1F9SA 4KKSA 4FYDA 1B9MA 4N9PA 2ZXRA 3D4DA 5M9OA 4CKEA 3PUVA 4FXGC 1F2ZA 1STYA 2LY7A 5FO9B 1DOKA 3NTHA 1XTCD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CZG A;  1DM0 B;  1BOS A;  1QNU A;  2C5C A;  2XSC A;  2GA4 B;  3MXG A;  2BOS A;  1C48 A;  4P2C B;  4ULL A;  1D1K A;  1R4Q B;  1CZW A;  1CQF A;  1R4P B;  1C4Q A;  1D1I A;  4M1U B;  1QOH A; 
#chains in the Genus database with same CATH topology
 1ZYR C;  2ZTC A;  5C0X H;  5JVG 3;  2MGS A;  2JA7 H;  3K59 A;  1ILP A;  3HZX A;  1EWH A;  2PPB C;  2KVM A;  1SRO A;  4X3U A;  4DR7 Q;  3HGB A;  1LYL A;  3ITP A;  1U5K A;  3BU2 A;  3S14 B;  3W1B A;  1F2M A;  1NR4 A;  1V1P A;  2HQL A;  1BCP F;  1J5E L;  1I4G A;  1WTH A;  1KNE A;  3NP8 A;  5NUC A;  1P16 A;  1XX8 A;  4HTH A;  4L5Q A;  1W6K A;  3RLO A;  2RA4 A;  1VMP A;  3Q22 A;  2QIL A;  2NZ1 D;  2EY5 A;  2EYM A;  3GTL H;  3OTO L;  3GTG B;  2ZJR A;  3NEL A;  4X3K A;  2NYZ D;  1S40 A;  1BCP B;  5M5Y H;  4OWX B;  4FF3 A;  3K0Y A;  1WJJ A;  1Z7T A;  5E4X A;  2JA7 B;  4FXK C;  2A6H D;  4U68 A;  5IOD A;  4B3R L;  3G6J B;  4GNX B;  2PW7 A;  2XRQ D;  4BA2 I;  1UE5 A;  3W5O A;  4DAY B;  1HTP A;  3OIQ A;  3U58 A;  5CYU A;  1IBL L;  2D62 A;  3VR6 A;  3U4Z A;  3KK7 A;  4IFD H;  1SBB B;  2EYL A;  2GA4 B;  4LWC A;  3OW7 A;  3M9B A;  4G4K A;  4UP8 A;  2X69 A;  1Q81 C;  1HHV A;  3BYT B;  1UE7 A;  2FMM A;  2B2T C;  2OTJ A;  3GTL B;  4XDX A;  1RD9 D;  1HNZ L;  4LF4 L;  2EJM A;  4MNO A;  5C0X G;  1K83 H;  3AMU A;  2JA7 G;  1WCM H;  1YIT A;  5M5Y B;  1CZG A;  1XMQ Q;  5IT9 c;  1IL2 A;  4A3B H;  2J4X A;  1KDC A;  1EYA A;  4KN4 C;  1IW7 D;  1GXD C;  3PO2 H;  3KOJ A;  5A2Q E;  2EJG C;  1IL8 A;  4ME5 A;  3U9O A;  4IPD A;  4QY7 A;  3RNU A;  3Q24 A;  1JOQ A;  3H6M A;  1E24 A;  2F1M A;  1HNX L;  4PZ6 A;  4P72 A;  1EUJ A;  3K81 C;  2CVR A;  4X66 Q;  4NXN Q;  3SK5 A;  1PTO D;  2K14 A;  1VCI A;  2VUM H;  4ZRZ A;  5BR8 Q;  5C3X A;  2KCN A;  4H44 C;  3M7N A;  1HRJ A;  2E76 C;  3CKI B;  1HPC A;  3JAM i;  2HCC A;  4KHZ A;  4P74 A;  3PIO A;  3ICE A;  1UEA B;  1STA A;  2MNA A;  1U4P A;  1GUS A;  4DN4 M;  1MJE A;  2EJF C;  1E2Z A;  1R4Q B;  5D14 A;  4ZQ3 A;  1K83 B;  5A2Q L;  1WCM B;  3K58 A;  3PGZ A;  4KD3 A;  2F4V Q;  4IPH A;  1VQ5 A;  1B1Z A;  4A3B B;  2FFK B;  1NTG A;  1QCB D;  1HJP A;  4QMG A;  3CRK C;  1KD1 C;  1LAB A;  3PO2 B;  4K6L A;  4DV5 L;  3K80 C;  1ASY A;  1EFW A;  1NR2 A;  3BZD B;  2R6G A;  2NZO A;  4IFD G;  5C0X J;  2NVX H;  4KD4 A;  1G6P A;  2D2C C;  1BVS A;  4JI2 Q;  2VUM B;  3E9I A;  2N88 A;  3P20 A;  5ELD A;  2Y0S B;  4J6H A;  4JOI C;  4P73 A;  5EBD A;  2LKV A;  2B8F A;  4NDX A;  4XIG S;  2L4N A;  2ZTD A;  2F0H A;  3HEJ A;  2JEB I;  4L6T B;  2GVB A;  5JJL A;  3A5U A;  4FP5 D;  3MA2 B;  4K8I A;  1S4Z A;  1I6V C;  3SK6 A;  3SXH A;  4LUZ A;  3FDT A;  3CCQ A;  4A3B G;  4ZUJ A;  3T1Y Q;  1CUK A;  3GTM H;  3DEO A;  4IUR A;  3BS1 A;  1N33 Q;  3MXG A;  5M3F G;  1C48 A;  5KNC A;  2R7Z G;  4ULL A;  4HIO A;  5ELF A;  1HNW Q;  1CZW A;  2AWN A;  4KHV A;  4JCV E;  1FD7 D;  1N36 Q;  2IX3 A;  2F3V A;  2NVX B;  1TQO A;  3NQI A;  5I9P A;  1HQR D;  2HCI A;  1AP0 A;  4POG A;  4DNT B;  4ZCK A;  2HDM A;  4YWK A;  4GN3 B;  2A73 B;  1ROD A;  1SNC A;  1IBM Q;  2NN6 G;  4V19 0;  3AFQ A;  3OWE B;  4DV0 Q;  4JPB W;  4KY5 A;  5FKA C;  3K5M A;  1I4X A;  2CFM A;  2X6L A;  5IP7 H;  3KDF A;  3GTM B;  2HQE A;  2F0F A;  3CCJ A;  2G5D A;  1RL2 A;  2F0E A;  3K8A A;  2B2Y A;  2HIV A;  3K7A H;  1XXG A;  3TQY A;  3CU7 A;  4B08 A;  3FPU B;  4FNF A;  2A6H C;  2F0S A;  2NVT H;  2QEJ C;  3L9A X;  1H9K A;  4EQN A;  4Y52 H;  5LMN Q;  4JBK A;  4X66 L;  1KDB A;  4KHP L;  1WTO A;  1Y69 U;  1EIF A;  4HJ7 A;  2K52 A;  2K5Q A;  4CDC C;  3PIP A;  5HGQ A;  3GO5 A;  4CDE C;  4XYO A;  4TRD A;  5DNF A;  5CMD A;  3FPP A;  4A4I A;  1KC8 C;  1XNQ Q;  4KY7 A;  4G7H C;  5K36 G;  1LTL A;  1MIU A;  4AQY Q;  1PRT F;  1F2Y A;  4JW0 A;  4QIW E;  3M4P A;  2DY7 A;  1J6Q A;  3JC6 6;  3K7A B;  3TS2 A;  1D1I A;  4K0K Q;  1IW7 C;  4J1M A;  3W3A A;  5IY0 A;  2WB1 E;  4LF9 Q;  1CSQ A;  2NVT B;  2OWO A;  1F9P A;  1SRU A;  1XMO Q;  3P7J A;  2Z9H A;  2CW0 D;  1V1O A;  2KHJ A;  1LUZ A;  3J81 c;  2JE6 I;  1PTO C;  4A3L G;  4DR1 Q;  4KV6 A;  5BN3 A;  4L5R C;  1K0S A;  2IL8 A;  1MSH A;  2FIN B;  3CCU A;  2FJ2 A;  3D4W A;  3L0O A;  4OXP A;  4RKB A;  5GQO A;  2HD3 A;  2JXM B;  3FVQ A;  5IP7 G;  1PH8 A;  1V8Q A;  5TSS A;  1K8A C;  3KYH C;  1N34 Q;  4JI0 Q;  3I56 A;  5CBE E;  2VQE Q;  4DV1 L;  1HNW L;  4OO1 H;  3OPO A;  2A6E D;  1T9H A;  2F0L A;  2LSS A;  4JI8 Q;  1VQ7 A;  1AFP A;  5COR A;  2WKD A;  1KHI A;  1IXR A;  2O5I C;  1C0A A;  4BY1 G;  1OXS C;  2B2U C;  1WOC A;  1SSO A;  3T56 B;  5FLM H;  3PSI A;  5IYD H;  1F9Q A;  5GAE C;  4FF1 A;  1VF7 A;  3CCL A;  1Q90 A;  4ID6 A;  4ZYS A;  5J1Z A;  1M1K C;  4WJ4 A;  3HKZ E;  4DUY Q;  3O13 A;  4DV0 L;  4P2C B;  2MUY A;  4OX9 Q;  1PH7 A;  4BY7 G;  2UXB Q;  1PH9 A;  3T51 B;  1HA6 A;  1LO5 D;  2Q2T A;  3HRZ C;  1KAB A;  3F2C A;  2IHF A;  2IWH A;  3S2H H;  3EA6 A;  2JP1 A;  3TN2 A;  2XRS D;  3J81 j;  2MQH A;  1KNA A;  2J7Z A;  3DWA A;  1KDA A;  1CHP D;  1J9O A;  1YEZ A;  4DV6 Q;  4IPG A;  3MXU A;  2KHS A;  3EJI A;  4HMI A;  4A3F H;  1Z6H A;  3I4L A;  2I46 A;  4FO2 A;  4MZ9 A;  2O5J C;  5J39 A;  1IKL A;  4DXF A;  4LF8 Q;  1PA6 A;  1C4Q A;  2PQA B;  2PMZ B;  1NUC A;  5JAV A;  4IJH A;  2AMC B;  3R93 A;  4IUT A;  1SJE D;  4A76 A;  4G7Z C;  1XNR L;  3K0X A;  1SXT A;  2XIW A;  1XNQ L;  3IFD A;  4NP5 A;  2C9O A;  2E2J H;  2B2V C;  3D31 A;  1JOO A;  3A74 A;  4OL7 A;  3BJU A;  2P5Z X;  4APV A;  4CDF C;  4OO1 G;  4X6A H;  3J80 E;  4KK7 A;  3S2H B;  3I73 A;  3QB3 A;  1ET6 A;  2ICI A;  3E3X A;  4LF9 L;  1RJT A;  4M1U B;  3AU7 A;  5FLM G;  3BZC A;  1E3P A;  5HY6 A;  1Q3L A;  2EY6 A;  5IYD G;  1JCK B;  1L1O A;  1CTM A;  3H0G H;  2Q8R E;  5D65 A;  4XYQ A;  1BBX C;  1EU3 A;  3D4R A;  3G48 A;  4A3F B;  4JBM A;  1PLF A;  3I4N G;  5IGC A;  1NMF A;  4L5S A;  4DR1 L;  5JVH 3;  1U4L A;  2AKW B;  4DAM A;  2B3G A;  2E5L L;  1RF2 D;  1EOV A;  5JPM C;  3D3R A;  3J80 L;  1BBW A;  3MC0 B;  1VDZ A;  1ZKO A;  4A3D H;  2E2J B;  1YJW A;  4MIU A;  1NE3 A;  5JEA H;  1WI5 A;  3J80 i;  4LFA Q;  4KKU A;  2Y0S E;  5IYB H;  4L5T A;  2PYK A;  2I5M X;  3CD6 A;  3ERQ A;  1AN8 A;  1IHZ A;  4LF5 L;  3RUZ A;  2F0Q A;  3NE5 B;  4JI7 Q;  1DON A;  4A3F G;  4CJ0 B;  1PRT D;  2KEC A;  1T5X D;  2G9D A;  5DM7 3;  1WFQ A;  1AH9 A;  3H0G B;  2K04 A;  4JI5 L;  1AE2 A;  4F88 A;  1YHB A;  2F0V A;  2CW0 C;  3HP3 A;  2JEA I;  2EQS A;  3E0E A;  3SDZ A;  4DR4 Q;  1FJG L;  4HMJ A;  1AZP A;  4BXX H;  4K2L A;  4LK1 C;  3VYS A;  5EPK A;  3V2T A;  4OX9 L;  1PTO H;  4R1J A;  5H1S E;  2YTV A;  5KYL A;  3FKI G;  4N8F A;  3NWS A;  4H7B A;  3KBG A;  3NEM A;  2F0I A;  1TWF H;  4A3D B;  1I94 L;  4PMB A;  2RHS B;  2NVY H;  4HSP A;  4IPC A;  1X3P A;  2D0O A;  2BH2 A;  1X9N A;  4IUV A;  2KQ3 A;  5CBA E;  4NXM L;  1FNV A;  5IOC A;  3J7A F;  3GTP H;  2L12 A;  1XYI A;  3H0G G;  3I4M H;  3S17 H;  2A6E C;  1UAP A;  2K01 A;  1DYQ A;  3UE1 A;  3OMC A;  3S1R H;  3DLL A;  4DV6 L;  2K05 A;  4YY3 L;  4A3K G;  4BBS H;  5GAD C;  4DXG A;  5AFW A;  1Y1W H;  1VQB A;  4EGV A;  4UY8 C;  2BA0 A;  3E6Z X;  3MXN A;  1Q82 C;  2A19 A;  2E2I H;  2ICE C;  2V1C C;  3Q0A A;  5LMU L;  3NPP A;  2X6G A;  1VMC A;  1CM9 A;  5EJW A;  1ICF B;  3BVM A;  3A55 A;  4A3D G;  3UDI A;  1PTO B;  3CXC A;  1B3Q A;  4B9X A;  4FF4 A;  5KRU A;  1TWF B;  2ZTE A;  1GUT A;  2JA5 H;  1JJG A;  5IYB G;  1JQY D;  4IUN A;  2NVY B;  4A3M H;  5IGE A;  3NQT A;  1G6Z A;  3G6E A;  3DUZ A;  3GTP B;  1EZ6 A;  4PZ7 A;  5IGD A;  2EDG A;  4DUZ Q;  1G51 A;  4GLV B;  4QQB X;  3A7L A;  1L2F A;  3S17 B;  3I4M B;  2K50 A;  4JI1 L;  4OIJ A;  2H4O A;  3ULJ A;  3S1R B;  1QZG A;  1SND A;  2K5W A;  2Z1C A;  1FR3 A;  1EY4 A;  4DGZ A;  3VA5 A;  4UPA A;  1TII D;  4BBS B;  4HID A;  3E0J A;  2FXQ A;  4OEM B;  1Y1W B;  3S24 A;  2AWO A;  4BXX G;  2EOT A;  3CQZ H;  2CWP A;  1H95 A;  3EFX D;  2E2I B;  3IFT A;  3MHB A;  2EY2 A;  3OOC A;  2UU9 L;  2BOS A;  3OIP A;  1ZXT A;  5EGT A;  2DNC A;  4G57 A;  1VQI A;  1EFI D;  1G2S A;  1PZI D;  2Q2U A;  1ESF A;  1C7Y A;  2JA5 B;  1Q1E A;  1C8C A;  1UEB A;  1VQO A;  1SMX A;  4A3M B;  3CC4 A;  4LFA L;  3C46 A;  2Q2H A;  4JV5 Q;  3I4M G;  4HCE A;  1JB7 A;  4RGM A;  3RZO H;  4GKK L;  5C44 H;  1ET9 A;  1GHK A;  3MTS A;  4B3S L;  2IW3 A;  3H3V C;  1LTT D;  5FLX E;  1VS0 A;  3NHH A;  5FO7 B;  5JEA J;  4BBS G;  3I90 A;  1Y1W G;  1CHQ D;  1KRT A;  4C56 C;  4DR6 L;  4LJZ C;  1QG7 A;  2N3S A;  1UE6 A;  3MEH A;  3Q6S A;  4I65 A;  3GTQ H;  2KEE A;  2B2U A;  1VQH A;  1DGS A;  4DK6 C;  3ERO A;  3CQZ B;  1X3F A;  2R61 A;  1AE3 A;  4PG3 A;  5HUR A;  5C0X I;  3V05 A;  4JI6 L;  1CA5 A;  2JA5 G;  1X3E A;  4A3M G;  1FL0 A;  2ZXO A;  4QB4 A;  3RLN A;  3ER0 A;  2ZJQ A;  5I4D A;  1A2T A;  2IJ0 A;  4IZ8 A;  3CF5 A;  5FLX L;  2UXC Q;  2KCC A;  4ZLT F;  4TKO B;  5FK9 C;  3RZO B;  1TT2 A;  5C44 B;  3M3Y H;  1SLJ A;  3UDG A;  2DGY A;  1T5E A;  2HUG A;  1L0Y B;  3B6Y A;  5IWA Q;  1D6E C;  4Q5V A;  1LTG D;  1NAP A;  4DNI A;  2TMP A;  3MXP A;  3TZD A;  3EQL C;  2RDG A;  1PRT C;  2Z4I A;  1O7Y A;  1QIL A;  4FDB A;  3GTQ B;  3NBH A;  2VY3 A;  4DNR B;  2EY1 A;  2IT1 A;  3GP7 A;  3JAM E;  3G7L A;  4LF7 Q;  5DAU A;  2F0T A;  5KND A;  4L8J A;  2CHB D;  4A3E H;  2AHO B;  1QE6 A;  3TRZ A;  5EKI A;  2JSO A;  4F7X A;  5L37 A;  3PCO B;  2PZW A;  4JBJ A;  3FEW X;  1JB3 A;  5FJ8 H;  1SMY D;  3WDN A;  4HJA A;  2WV6 D;  4GN4 B;  1VQP A;  1PHJ A;  1KL9 A;  2NVQ H;  1B53 A;  3HG9 A;  5C44 G;  4WJ3 M;  4XT3 B;  3W1G A;  2B2V A;  1JE4 A;  2EXZ A;  2PW5 A;  1E1T A;  4IFD I;  4BA1 I;  4IN3 A;  1H9R A;  3M3Y B;  4RCO A;  5D3I B;  5M3F H;  2ATW A;  2R7Z H;  2Q8T A;  1EOT A;  4OON A;  4RAU C;  3BDO A;  1VQN A;  3PUY A;  3J7Z C;  5ELN A;  1S5C D;  2PO4 A;  5AJ3 L;  1K3R A;  1NY4 A;  3JAM L;  5I6Y A;  1XTD A;  5I2Y A;  5BN4 A;  4S3S A;  4HR7 B;  4RA8 A;  3G71 A;  1HTL D;  1FGB D;  3PUX A;  2ZM6 Q;  4A93 G;  1IYV A;  1S5F D;  2PCF B;  5ISR A;  1WTW A;  4DA2 A;  2EVB A;  3SEB A;  5CC4 A;  5DLQ E;  5IIF A;  4A3E B;  4LUV A;  3T4A C;  3MAQ A;  1U9R A;  1WYD A;  2JA6 G;  3NTK A;  5KYI A;  4HIK A;  1M90 C;  3A7A B;  5M3M H;  2NN6 H;  4O0A A;  4I7Z C;  2NVQ B;  2BH8 A;  2F0U A;  5I9O A;  3E9H A;  2WIN B;  4A3C G;  1PVO A;  3ULP A;  1CK1 A;  3UE0 A;  5C6A A;  2JJQ A;  4AYB B;  3U9S A;  4DR7 L;  5M3F B;  1L1O C;  2R7Z B;  2C5C A;  2RHQ B;  1X54 A;  5E7N A;  4ZK9 B;  3I70 A;  1A3V A;  4ZKC B;  3KUP A;  3LWE A;  2WAC A;  2ES2 A;  1VF5 C;  4GS3 A;  1GD7 A;  4RGN A;  3HOX H;  3M7G A;  5CGK A;  3LGJ A;  3OW2 A;  4A3E G;  4RHS A;  1WTP A;  1K8G A;  2SNM A;  3VYT A;  1DD2 A;  3CC7 A;  2RCF A;  5FJ8 G;  2PZT A;  5ELB A;  4DPG A;  4LFC Q;  3MWY W;  3D6C A;  1N8R C;  3RD4 A;  5M3M B;  1K3B C;  1Y1V G;  4AYB G;  3KDF B;  1L0W A;  1SYG A;  1JT8 A;  1PYS B;  1SE3 A;  5K36 H;  3PO3 H;  5IT9 E;  4B3T Q;  1QUQ B;  2VZA A;  2YV5 A;  3R2T A;  3MVV A;  4YHH Q;  2LFN A;  1SR3 A;  1HZ9 A;  2VW9 A;  1VQL A;  1EWI A;  1F2L A;  4HN7 A;  4HCS A;  1K28 A;  2HIX A;  3H3V H;  1YNJ D;  1OO9 B;  1G29 1;  1DOM A;  2MP1 A;  3A56 A;  3T16 A;  3HOX B;  1U0L A;  1LTB D;  1EYD A;  2KHI A;  2L5T A;  1PMR A;  2FMC A;  5IGF A;  4JI3 Q;  3P75 A;  5CV7 A;  5M3M G;  4A3L H;  1E2V A;  2NB0 A;  3CPF A;  4K8J A;  2YU9 H;  2QF7 A;  3T53 B;  5EQ0 A;  4IFD J;  4LAA A;  3TP8 A;  3I7F A;  1BUV T;  3CPW A;  1N32 Q;  5IT9 L;  1XMQ L;  1WTV A;  2PZU A;  4X64 Q;  2E2D C;  1QVG A;  4DF7 A;  1MKH A;  3A54 A;  1ASZ A;  3PO3 B;  2AQ1 B;  1QVF A;  5IGG A;  2VXW A;  3SE0 A;  1QUQ A;  1RDP D;  4KJO A;  4CJ2 C;  1JJC B;  5C4J H;  1PH1 A;  2O2L D;  3GQB A;  1HZA A;  3X3M A;  1XPR A;  3BDL A;  3HOX G;  4AIM A;  5JJK A;  2B8G A;  1SE4 A;  2WAQ B;  3S9W A;  2NTS A;  4NXN L;  4BY1 H;  1HR0 W;  4HJ5 A;  4IJL A;  5BR8 L;  3U50 C;  2F0M A;  1FNU A;  4LF6 Q;  1STH A;  1Q12 A;  1S3O A;  3BVG A;  4RHR A;  2K4K A;  1B50 A;  1PFM A;  2QCP X;  4IUU A;  2R93 H;  1FNW A;  1VQ9 A;  3OSO A;  4OWW B;  3Q23 A;  2YU9 B;  5A35 A;  4O2D A;  1GOZ A;  1I3Q H;  4OWT B;  3PO3 G;  1QNK A;  4BY7 H;  1SMY C;  1E2W A;  2F4V L;  2K1B A;  1YNX A;  1EL0 A;  4WRD A;  5C4J B;  5EKL A;  1RTN A;  3KLS X;  3HOU G;  2WAQ G;  1SFO H;  1GVP A;  3HOV G;  2K03 A;  1SAP A;  1K8O A;  2ENB A;  3H94 A;  4CGY B;  4JI2 L;  4BY1 B;  1DJR D;  4H13 C;  2JQO A;  3GD7 A;  1D2B A;  2IX0 A;  1PRT B;  2PI2 E;  4ZUI A;  2DNE A;  2RCN A;  3DWP A;  1S5B D;  3GTJ H;  2R93 B;  2RVL A;  1Q46 A;  1CI3 M;  1B2T A;  3J7A V;  4C2M H;  4C3H H;  2Z6B A;  3T1Y L;  1LT6 D;  2SDF A;  1I3Q B;  4BY7 B;  1N33 L;  2K5N A;  3I55 A;  2F3I A;  3PMF A;  4DV3 Q;  1W2B A;  1EQQ A;  1EY7 A;  4QUF A;  1E1O A;  4B3T L;  2LMC B;  1JWU D;  2OQK A;  1VQG A;  1PXU A;  2B29 A;  2K5D A;  4XXE A;  4A3G H;  1SFO B;  1QVC A;  1HH2 P;  1TWH H;  4NMZ A;  1N36 L;  4POF A;  1SJH D;  2VQF Q;  1XPO A;  1EY0 A;  1E0B A;  1H9J A;  5C5L A;  2R93 G;  4RWS C;  1BOS A;  2GN5 A;  4ALP A;  4J15 A;  2H5X A;  3KF8 A;  3GTJ B;  2RBM A;  3I4N H;  4KLK A;  3PUZ A;  1IBM L;  3SVM A;  5GAH C;  4OO1 I;  1BBU A;  4DR3 Q;  1GJX A;  1S72 A;  1AW7 A;  3HKS A;  4C2M B;  4C3H B;  3C2P A;  2SEB D;  4QGU A;  3RN2 A;  4JI4 Q;  3VDY A;  2B2W A;  4M8A A;  1B8A A;  1EU4 A;  4DV7 Q;  1B70 B;  4GOP C;  2MO0 A;  4A3G B;  2OXP A;  2RKS A;  3ERS X;  2N55 A;  1B7Y B;  1TWH B;  5LMN L;  1S5D D;  3DWQ A;  4RKL A;  1EIY B;  3Q8D A;  1K0R A;  3DM3 A;  1L1O B;  2UUA Q;  1RCV D;  3NUC A;  4R4I A;  1YJ9 A;  3CCE A;  2ASB A;  1YNJ C;  4LF6 L;  3F2U A;  2SNS A;  3GTK H;  4DR5 Q;  3L3O C;  1YHQ A;  2D0P A;  4F87 A;  2VB3 X;  4IOC A;  3I4N B;  4C3H G;  3J81 E;  3CCS A;  3RZD H;  4R8I A;  1ONL A;  4DR2 Q;  1PH5 A;  1MD2 D;  2ALY B;  3R3O A;  1CKO A;  3CHB D;  2F4I A;  1HFN A;  1SEB D;  4X62 Q;  1M4V A;  4AQY L;  1KRS A;  1Y8N B;  2PNH A;  3FKI H;  4YCV A;  3D8G A;  3LX0 A;  3OYY A;  3TP7 A;  4HSV A;  1STN A;  2N8N A;  4A3G G;  4EQP A;  2XN9 C;  3BYY B;  2EYH A;  2EYP A;  4NB3 A;  4K0K L;  1HCZ A;  4P71 A;  1V1Q A;  1G91 A;  1IZ6 A;  2JA8 H;  4GKJ Q;  5BN5 A;  1XMO L;  4I7A A;  4K5X A;  1ZEQ X;  3TP6 A;  3SGI A;  3J81 L;  3TP5 A;  2IPK D;  1LAC A;  4KMU C;  4RCN A;  1CA6 A;  2OTL A;  3GTK B;  4A3K H;  5E4W C;  3TDQ A;  3M4Q A;  1I5F A;  2KED A;  4CKB A;  1KXL A;  2KBN A;  3J81 i;  3RZD B;  4A3I H;  4TSS A;  1VQE A;  4DV2 Q;  3S15 H;  4WFN 3;  1SYD A;  1I6H H;  2PQE A;  3FKI B;  3DXJ C;  1E22 A;  5D3D A;  1BQQ T;  1TVX A;  2BDN A;  1N34 L;  1Y8P B;  3T1H Q;  4JI0 L;  4XQQ A;  2VQE L;  4F8M A;  1NBW A;  4KKT A;  5JOB A;  4LFB Q;  2L11 A;  4JI8 L;  1LTI D;  2JA8 B;  3M85 A;  1R4P B;  2LS0 1;  1GUN A;  2ZJP A;  3LNN A;  4O1N A;  1HR0 Q;  1CSP A;  2E8G A;  1VQ6 A;  4H0L C;  3MXN B;  2WP8 J;  4R9W A;  5F2D A;  1K8M A;  3K7U C;  4A3K B;  4DUY L;  4J8Q A;  2I5L X;  1PH6 A;  4DR3 L;  3FHW A;  1S5E D;  4A75 A;  2JK8 A;  2UXB L;  3QOL A;  4KI0 A;  4A3I B;  3S15 B;  1GUO A;  1SYB A;  2L0C A;  1A0I A;  3N6R A;  3QJY A;  3H09 A;  1ENA A;  1J5E Q;  3URY A;  1YVC A;  1LT3 D;  2ZT9 C;  1OXU A;  2ZXP A;  3BVZ A;  1HZC A;  4DV7 L;  3M4O H;  2JA8 G;  2M2L A;  2O4X A;  2UUB Q;  4IO9 A;  1O7Z A;  2CQO A;  4O42 A;  1EQR A;  1BKB A;  3DM1 A;  1WD0 A;  3PIO 3;  3OTO Q;  3OWF A;  2BA1 A;  1HFG A;  1KLU D;  1W6J A;  3EVQ A;  1WVL A;  4ILW A;  4LF8 L;  5C5M A;  2UUC Q;  4NW2 A;  5IGB A;  4UAI A;  2QKI C;  1H9M A;  3A8J E;  4A3I G;  2XTI A;  1EYG A;  4ME3 A;  2CKZ B;  1OXX K;  4R4O A;  4HIM A;  4C3I G;  4B3R Q;  1VQ4 A;  2NZH A;  5EKK A;  5C4H A;  2V4D A;  3J7Y W;  1PYW D;  3WWV A;  2PNR C;  3S1Q H;  1QNU A;  4LUO A;  4OEL B;  4ABN A;  4IOA A;  1IBL Q;  1JOR A;  2M9V A;  1EEF D;  1L0X B;  1CKN A;  3M4O B;  4GN5 A;  2C35 B;  2CCZ A;  4PMC A;  3I4O A;  1Y8O B;  1TY2 A;  5KEE A;  3CMA A;  2QEX A;  2MHV A;  3BG3 A;  4FXD A;  2YTY A;  4Q0F A;  1JJ2 A;  1AZQ A;  4E6I A;  4CBV A;  1HNZ Q;  1BNZ A;  4XQJ A;  2R3Z A;  1CKM A;  1EWC A;  3TSS A;  4DV4 Q;  2MJ8 A;  3HS0 C;  1R9T H;  1LTS D;  2Z6K A;  2CQA A;  1TWC H;  4RFB A;  1SE8 A;  4X3S A;  4YWM A;  2I5H A;  3TZU A;  4DV2 L;  1WTR A;  4BBR G;  3CAM A;  3CC2 A;  3NEN A;  3CRL C;  3S1Q B;  1A3U A;  3ONA B;  1YJN A;  1ILQ A;  3F8T A;  3T1H L;  4QIW B;  3A8K E;  3VYR A;  1F9R A;  2KCT A;  3KLW A;  4DU9 A;  1PYB A;  2QA4 A;  2WB1 B;  4JI7 L;  1TWG H;  1RIP A;  1RTO A;  1BF4 A;  4R4Q A;  3DHQ A;  5LL6 S;  4GOP B;  2A1A A;  2WKC A;  4CHT B;  2F0J A;  3QWN A;  1KIX A;  1BO0 A;  4DR4 L;  3NBH B;  3QIA A;  2H1E A;  4XTC S;  1R9T B;  2DY8 A;  3FRP B;  1HUM A;  1TWC B;  2IHE A;  3KLS A;  4DV5 Q;  1HA5 A;  1Q86 C;  4A93 H;  1HQM C;  3MZ5 A;  3PV0 A;  5LMN W;  1O7L A;  1Z47 A;  1B4O A;  5M5W H;  2JA6 H;  1F77 A;  3C1F A;  3AFP A;  5G3L F;  3DMU A;  2WB1 G;  1WTX A;  4JK1 C;  2A69 D;  4IQZ A;  1X6O A;  2UUB L;  4A3C H;  3PIP 3;  5M5X H;  2MPM A;  3NTI A;  2BDO A;  1TWG B;  3KF6 A;  4FVM A;  5J22 A;  3J7A 5;  1D7Q A;  4GOP A;  1A6X A;  3N52 A;  1EZ8 A;  4OIK A;  4KTA A;  3NWT A;  3VR5 A;  2A5H A;  2UUC L;  4MTN A;  2PI2 A;  3F2D A;  3HKZ B;  4EQO A;  2MO1 A;  4DAV A;  2EZV A;  4CDD C;  2RSN A;  4K2K A;  4C3J H;  1OTC A;  5KNB A;  4HJ8 A;  4A93 B;  3U4V A;  4RG1 A;  1TS3 A;  5EPJ A;  1YI2 A;  1DOL A;  3IKJ A;  2RQX A;  2B2W C;  3NXW A;  1X56 A;  5ELE A;  1ML0 D;  5M5W B;  2JA6 B;  4YWL A;  4G7O C;  1PFN A;  2E75 C;  3I72 A;  1LM0 A;  1X3Q A;  1Y1V H;  3K5N A;  4DUZ L;  3HFZ B;  2F0W A;  1A2U A;  3STB D;  2A74 C;  2PMZ E;  5M5X B;  2EIF A;  1UNS A;  4B9W A;  4KJN A;  2BE5 D;  1N9W A;  1SN8 A;  1LLR D;  3SHL A;  2VL6 A;  1SNQ A;  3TBI B;  2GVA A;  2L9H A;  3HKZ G;  2A68 D;  1JWM D;  2CWA A;  4DV4 L;  2NBF A;  2RDF A;  2AUK A;  2F03 A;  2Z0S A;  2ID0 A;  4ZKB B;  2F0N A;  4OGQ C;  3EN2 A;  3OMG A;  4C3J B;  5I2X A;  5DM6 3;  4QJF A;  1PH3 A;  4GNX A;  3VR3 A;  1PDQ A;  1KAA A;  4PMW A;  4OHJ A;  3K5O A;  2EYF A;  1QB5 D;  4DAY A;  3I91 A;  3QR8 A;  5CV4 A;  5EAY A;  3A8I E;  5C3E H;  3IL8 A;  3WOF A;  1B3A A;  1SNO A;  2XVS A;  4KHP Q;  1D5Z C;  4EVO A;  3S16 H;  3I8Z A;  2A8V A;  1JE5 A;  4JV5 L;  1CQV A;  3GTO H;  2FHT A;  2CH4 W;  4GLX A;  4JC0 A;  1Y1V B;  3FP9 A;  5EPL A;  1LT4 D;  1IBK Q;  3RN5 A;  2DJF C;  2E74 C;  1JMC A;  4C1N I;  1EY9 A;  2K28 A;  4L63 B;  1HZB A;  2NN6 I;  4YIJ A;  1TS2 A;  4C3J G;  2Q2I A;  4RH6 A;  1MSG A;  2EYJ A;  3ULL A;  4HAE A;  4PQX A;  5T1I A;  2OEO A;  4X3T A;  3C3L A;  4MHE A;  2WFW A;  1MHW C;  4YCU A;  3M4Y A;  4BS9 A;  1EYC A;  1OXV A;  4JBW A;  5C3E B;  1VQF A;  3S16 B;  2UXC L;  4DK1 A;  2R92 H;  5ELC A;  3GTO B;  1CQF A;  1SDF A;  3P1H A;  2N78 A;  1SYC A;  1U4M A;  1B44 D;  5IWA L;  5GRO A;  1X32 A;  4ODG A;  5ELO A;  3PF5 A;  3CCM A;  3IAY A;  4QCL A;  1WCM G;  2KEN A;  3HOU H;  3HOV H;  1QZH A;  2HHH Q;  1X65 A;  5LL6 X;  3RMH A;  4GLA C;  1GUW A;  3PO2 G;  2SOB A;  4H02 A;  5FOB B;  4LF7 L;  2QDB A;  3HOW H;  4DV1 Q;  1Q7Y C;  2L1B A;  2CH4 A;  1O7I A;  2EPB A;  5C3E G;  1VQD A;  3MFY A;  3AB9 A;  1MJC A;  2AQ2 B;  2VUM G;  2Y0S G;  1Z9F A;  1KQS A;  4LNQ A;  1MGS A;  1ENC A;  1RKN A;  3H3V I;  4QF4 A;  1UWV A;  1I4Q A;  3MEF A;  1DM0 B;  2R92 B;  5LHY 1;  1SNP A;  2LXK A;  3L7Z C;  5CV6 A;  1IKM A;  1I50 H;  3F2B A;  5CV8 A;  1TS5 A;  1BCP D;  2F3W A;  2A69 C;  1JC7 A;  3SR1 A;  4JYA Q;  1XWE A;  2Q8I B;  3GV6 A;  4IUP A;  5G3L D;  3HOU B;  1UE1 A;  4CKC A;  2BCO A;  3HOV B;  3D0F A;  1SYF A;  1UUP A;  2OT2 A;  2KA7 A;  2ZM6 L;  1V9P A;  2XWB B;  1Y14 B;  2JA9 A;  3HOW B;  1EIG A;  1EIH A;  3TRE A;  1FYC A;  1PV4 A;  1SYE A;  2J0T D;  2R92 G;  3H91 A;  1EQT A;  2K32 A;  5IYC H;  1RHP A;  2EXD A;  4P75 A;  3UDF A;  3D6W A;  3ND9 A;  4A3J H;  3UDX A;  3OHX C;  2L55 A;  1IBK L;  2I0Q A;  1I50 B;  1O80 A;  4K14 A;  3QOJ A;  3S1N H;  1PFS A;  4EX5 A;  4R4T A;  3STB C;  3NBI A;  2AQ3 B;  1XNR Q;  3A5Z B;  1LTA D;  2BE5 C;  1O78 A;  2Z6K C;  1B9N A;  3PQI A;  3HOW G;  4NPS A;  1QJO A;  2A68 C;  5C4X H;  2Z4H A;  4DK0 A;  1D5M C;  1GUG A;  4RGT A;  3QO2 A;  1QWY A;  1D5X C;  4PV1 C;  3KF8 B;  3K6O A;  1ESR A;  4WOR A;  1C9O A;  5JPN C;  3KLR A;  1EY8 A;  2KUM A;  4LFC L;  3HOZ H;  4EQ5 A;  1VQC A;  2OF1 A;  1YNN D;  1NJI C;  3H15 A;  2OCE A;  2F0O A;  3G4S A;  4A3J B;  5CR3 A;  2YTX A;  3S1N B;  4YHH L;  5E1F A;  3ZYY X;  4UDU C;  2RDH A;  2E5L Q;  1NMG A;  2VS1 A;  5J3B A;  4DKA C;  1NSN S;  3NK9 A;  5IP9 H;  1PZK D;  4TQU S;  3K5L A;  3J80 c;  2HHH L;  2DJG C;  2F0G A;  4HJ9 A;  3QG1 A;  1VQK A;  2R7F A;  4B3M Q;  5C4X B;  1EY6 A;  5GAG C;  5JJZ A;  4JI3 L;  2VNU D;  3VA7 A;  1A8V A;  1CT1 D;  5E3F A;  3AYH B;  4XQN A;  1NNX A;  2Z8L A;  3C1E A;  1WD1 A;  1TXY A;  1TS4 A;  1U4R A;  3I2Z A;  4LF5 Q;  2K5H A;  3HOZ B;  2KCM A;  4NKL A;  5IYC G;  3GV3 A;  1SNM A;  2NTT A;  1G8Z D;  4A3J G;  2EYO A;  1STE A;  1TU2 B;  1N32 L;  2YYZ A;  2VB2 X;  1KLG D;  4MN3 A;  4BWG B;  4PZ8 A;  1PFB A;  3HOY H;  2WII B;  1JIC A;  4X64 L;  4JI5 Q;  1M8A A;  3I3C A;  1J8I A;  2XWJ B;  1GO3 E;  3CCR A;  1FJG Q;  2K33 A;  4JYA L;  4UP7 A;  1D1K A;  2QDL A;  5IE8 A;  2B2T A;  5C4X G;  1I94 Q;  1H9S B;  1Q1B A;  1BR9 A;  1II3 A;  1KAW A;  3KJP A;  4NXM Q;  3HOZ G;  1I4H A;  4QUC A;  1X55 A;  5EBC A;  4CJ1 B;  2RSO A;  4U67 3;  1VQ8 A;  1TKW B;  5FO8 B;  3F1Z A;  1EEI D;  4AH6 A;  1BDO A;  3ND8 A;  1Q8K A;  4C1N K;  1GKH A;  4JVZ A;  2IY5 B;  2K5V A;  4YY3 Q;  4DFA A;  3HOY B;  2KOL A;  4N9T A;  1A15 A;  2D9U A;  2NUC A;  5CV9 A;  3EBE A;  1KTK A;  1EQV A;  1FGU A;  3CW2 C;  1TY0 A;  1GM5 A;  3W2D A;  3KJO A;  2UXD Q;  4K6D A;  3VR2 A;  5IP9 G;  1IYU A;  5LMU Q;  1D8L A;  4X65 Q;  4RGO S;  3E5S A;  1BCP C;  3KFU A;  1V43 A;  4TVA B;  2B63 H;  3IRB A;  3CME A;  1MI2 A;  2F0K A;  1H9S A;  2XSC A;  1ZYR D;  4IAL A;  4GNX C;  4DK3 C;  1ICW A;  2F0D A;  1TR5 A;  1A62 A;  3PUW A;  2AUJ D;  1YBY A;  4AYB E;  1BXT A;  1VQM A;  2HDL A;  1AEX A;  4FF2 A;  2B39 A;  1PZJ D;  1DXM A;  3L2P A;  3HOY G;  2QW7 A;  2M00 A;  1LT5 D;  4R8N A;  5COY A;  4JI1 Q;  1K9M C;  2G9H D;  4KY6 A;  4MTK A;  4C3I H;  5CV5 A;  4JG2 A;  3K57 A;  4DV3 L;  2R7D A;  3R2I A;  4Y7N H;  3RLF A;  2JYO A;  4IUQ A;  3TME A;  2PQA A;  1ENF A;  2UU9 Q;  4JOI A;  1HUN A;  1E7Z A;  4UP9 A;  2E2H H;  2XGT A;  4QL5 A;  3EIV A;  2VQF L;  3CCV A;  2B63 B;  3TEH B;  1DCZ A;  2IX1 A;  2TSS A;  4B3M L;  4V0B A;  4R4C A;  2QGQ A;  1JWS D;  2EE1 A;  4UHV A;  3X3N A;  4GKK Q;  1XPU A;  3NSW A;  4B3S Q;  3MFG A;  3CP0 A;  4K5W A;  4C3I B;  5K5P A;  4PNY A;  4Z9C B;  1STG A;  4JI4 L;  1YNN C;  4DR6 Q;  1I6H B;  4BBR H;  4K5V A;  1A3T A;  1LTR D;  4KN7 C;  2JN4 A;  1QOH A;  4Y7N B;  1CKN B;  1MBY A;  1G2T A;  5DEH A;  3R8B A;  3RR5 A;  2F52 A;  2B63 G;  4JI6 Q;  1HXY D;  1X3G A;  2E2H B;  2LXJ A;  2UUA L;  1DZ1 A;  1NCV A;  1GHJ A;  1CFM A;  4ZAI A;  2OQ0 A;  3S1M H;  3S2D H;  2NWG A;  3WOE A;  2N49 A;  4DR5 L;  4WJW A;  3UI2 A;  5FLX c;  3A0J A;  1PTO F;  2I07 B;  4GZY C;  5KIX A;  1TWA H;  4DR2 L;  1P8L A;  4DAP A;  3SK4 A;  3VR4 A;  1PH2 A;  4LW1 A;  4X62 L;  2DN8 A;  1SE2 A;  2WAQ E;  3DEP A;  2K7V A;  1I4P A;  4BBR B;  2XNA C;  2D5D A;  3FMC A;  5I6W A;  5HGT A;  2UXD L;  1W3S A;  1JOK A;  4RMF A;  4X65 L;  3LWU A;  1VQA A;  5T1G A;  4HED A;  1LV9 A;  4GKJ L;  2K6A A;  3BDC A;  5KGU A;  2L15 A;  2RF4 A;  5JEA G;  3TS0 A;  3GDE A;  1A63 A;  5C3W A;  1YHA A;  4YCW A;  4LF4 Q;  1EY5 A;  4LMQ D;  2HT1 A;  2B2Y C;  3S1M B;  3S2D B;  3T13 A;  1OXT A;  3PF4 A;  1K73 C;  1WTQ A;  1YIJ A;  2KJX A;  2MFI A;  1I4R A;  3BZK A;  1STB A;  1TWA B;  2F0P A;  3V96 A;  3S14 H;  1Q8I A;  1JR0 D;  1VQJ A;  1HNX Q;  3VYU A;  1V1P B;  5AJ3 Q;  2K75 A;  5C4Z A;  3KBX A;  1XJV A;  4XT1 B;  3SK8 A;  3JAM c;  1FVI A;  5JJI A;  4LFB L;  1F9S A;  4KKS A;  3AEV A;  4FYD A;  1B9M A;  3AQQ A;  4N9P A;  1IYJ B;  2ZXR A;  1PH4 A;  3D4D A;  3KF6 B;  4CKE A;  5M9O A;  2DUD A;  3PUV A;  4FXG C;  1YZ6 A;  1F2Z A;  3GTG H;  3ZJY C;  1HR0 L;  4N8X 1;  1STY A;  2LY7 A;  5FO9 B;  1DOK A;  3NTH A;  1XTC D; 
#chains in the Genus database with same CATH homology
 1ZYR C;  5C0X H;  5JVG 3;  2MGS A;  3K59 A;  1ILP A;  3HZX A;  1EWH A;  2PPB C;  2KVM A;  4X3U A;  3HGB A;  3ITP A;  3S14 B;  1F2M A;  1NR4 A;  1V1P A;  1BCP F;  1I4G A;  1KNE A;  3NP8 A;  5NUC A;  1XX8 A;  4HTH A;  1W6K A;  2RA4 A;  1VMP A;  3Q22 A;  2QIL A;  2NZ1 D;  2EY5 A;  2EYM A;  3GTG B;  4X3K A;  2NYZ D;  1BCP B;  4FF3 A;  3K0Y A;  1Z7T A;  5E4X A;  2JA7 B;  4FXK C;  2A6H D;  4U68 A;  5IOD A;  3G6J B;  2PW7 A;  2XRQ D;  4BA2 I;  1HTP A;  3OIQ A;  5CYU A;  2D62 A;  3VR6 A;  3KK7 A;  4IFD H;  1SBB B;  2EYL A;  2GA4 B;  3OW7 A;  4G4K A;  2X69 A;  1HHV A;  3BYT B;  2FMM A;  2B2T C;  3GTL B;  4XDX A;  1RD9 D;  2EJM A;  5C0X G;  3AMU A;  5M5Y B;  1CZG A;  2J4X A;  1KDC A;  1EYA A;  4KN4 C;  1IW7 D;  1GXD C;  5A2Q E;  2EJG C;  1IL8 A;  4ME5 A;  3U9O A;  3Q24 A;  1JOQ A;  3H6M A;  2F1M A;  2CVR A;  3SK5 A;  1PTO D;  1VCI A;  4ZRZ A;  5C3X A;  2KCN A;  4H44 C;  3M7N A;  1HRJ A;  2E76 C;  3CKI B;  1HPC A;  2HCC A;  4KHZ A;  1UEA B;  1STA A;  1U4P A;  1GUS A;  4DN4 M;  2EJF C;  1E2Z A;  1R4Q B;  5D14 A;  4ZQ3 A;  1K83 B;  5A2Q L;  1WCM B;  3K58 A;  4KD3 A;  4A3B B;  1B1Z A;  2FFK B;  1QCB D;  4QMG A;  3CRK C;  1LAB A;  3PO2 B;  4K6L A;  1NR2 A;  3BZD B;  2R6G A;  4IFD G;  5C0X J;  4KD4 A;  2D2C C;  2VUM B;  2N88 A;  3P20 A;  5ELD A;  2Y0S B;  4J6H A;  5EBD A;  2LKV A;  2B8F A;  4NDX A;  4XIG S;  2L4N A;  2F0H A;  3HEJ A;  2JEB I;  4L6T B;  4FP5 D;  3MA2 B;  4K8I A;  1S4Z A;  1I6V C;  3SK6 A;  3SXH A;  3FDT A;  4ZUJ A;  3DEO A;  4IUR A;  3BS1 A;  3MXG A;  1C48 A;  5KNC A;  4ULL A;  5ELF A;  1CZW A;  2AWN A;  4KHV A;  1FD7 D;  2IX3 A;  2F3V A;  2NVX B;  1TQO A;  3NQI A;  5I9P A;  1HQR D;  2HCI A;  1AP0 A;  4DNT B;  2HDM A;  2A73 B;  1ROD A;  1SNC A;  2NN6 G;  4V19 0;  3OWE B;  4KY5 A;  5FKA C;  3K5M A;  1I4X A;  2X6L A;  3GTM B;  2HQE A;  2F0F A;  2F0E A;  2B2Y A;  1XXG A;  3CU7 A;  4B08 A;  3FPU B;  4FNF A;  2A6H C;  2F0S A;  2QEJ C;  3L9A X;  1H9K A;  4EQN A;  1KDB A;  1WTO A;  1Y69 U;  2K5Q A;  3GO5 A;  4XYO A;  4TRD A;  5DNF A;  5CMD A;  3FPP A;  4KY7 A;  4G7H C;  5K36 G;  1PRT F;  1F2Y A;  2DY7 A;  3K7A B;  1D1I A;  1IW7 C;  4J1M A;  3W3A A;  2NVT B;  1F9P A;  3P7J A;  2CW0 D;  1V1O A;  2JE6 I;  1PTO C;  4KV6 A;  5BN3 A;  2IL8 A;  1MSH A;  2FIN B;  2FJ2 A;  3D4W A;  4RKB A;  2JXM B;  3FVQ A;  1V8Q A;  5TSS A;  5CBE E;  4OO1 H;  3OPO A;  2A6E D;  2F0L A;  1AFP A;  5COR A;  2WKD A;  2O5I C;  1OXS C;  2B2U C;  1SSO A;  3T56 B;  1F9Q A;  4FF1 A;  1VF7 A;  1Q90 A;  4ID6 A;  4ZYS A;  5J1Z A;  3O13 A;  4P2C B;  2MUY A;  3T51 B;  1HA6 A;  1LO5 D;  3HRZ C;  1KAB A;  2IWH A;  3EA6 A;  2JP1 A;  3TN2 A;  2XRS D;  1KNA A;  2J7Z A;  3DWA A;  1KDA A;  1CHP D;  1J9O A;  3MXU A;  2KHS A;  3EJI A;  4HMI A;  1Z6H A;  3I4L A;  2I46 A;  4FO2 A;  2O5J C;  5J39 A;  1IKL A;  4DXF A;  1C4Q A;  2PMZ B;  1NUC A;  5JAV A;  3R93 A;  4IUT A;  1SJE D;  4G7Z C;  1SXT A;  2XIW A;  3IFD A;  4NP5 A;  2C9O A;  2B2V C;  3D31 A;  1JOO A;  4OL7 A;  4OO1 G;  3J80 E;  4KK7 A;  3S2H B;  3I73 A;  3QB3 A;  1ET6 A;  2ICI A;  1RJT A;  4M1U B;  3AU7 A;  1Q3L A;  2EY6 A;  1JCK B;  1CTM A;  5D65 A;  2Q8R E;  4XYQ A;  1BBX C;  1EU3 A;  3D4R A;  4A3F B;  1PLF A;  5IGC A;  5JVH 3;  1U4L A;  1RF2 D;  5JPM C;  3D3R A;  3J80 L;  3MC0 B;  1VDZ A;  1ZKO A;  2E2J B;  4MIU A;  5JEA H;  4KKU A;  2PYK A;  3ERQ A;  1AN8 A;  1IHZ A;  3RUZ A;  2F0Q A;  3NE5 B;  1DON A;  4CJ0 B;  1PRT D;  2KEC A;  1T5X D;  2G9D A;  5DM7 3;  3H0G B;  2K04 A;  4F88 A;  2F0V A;  2CW0 C;  3HP3 A;  2JEA I;  3SDZ A;  4HMJ A;  1AZP A;  4K2L A;  4LK1 C;  3VYS A;  5EPK A;  3V2T A;  1PTO H;  5KYL A;  3NWS A;  4H7B A;  3KBG A;  2F0I A;  4A3D B;  4PMB A;  4HSP A;  1X3P A;  4IUV A;  2KQ3 A;  5CBA E;  1FNV A;  5IOC A;  3J7A F;  2L12 A;  1XYI A;  2A6E C;  1UAP A;  2K01 A;  1DYQ A;  3OMC A;  2K05 A;  4DXG A;  5AFW A;  4EGV A;  2BA0 A;  3E6Z X;  3MXN A;  2ICE C;  3Q0A A;  3NPP A;  2X6G A;  1VMC A;  1CM9 A;  5EJW A;  3BVM A;  3A55 A;  1PTO B;  4B9X A;  4FF4 A;  5KRU A;  1TWF B;  1GUT A;  1JQY D;  4IUN A;  2NVY B;  5IGE A;  3NQT A;  1G6Z A;  3DUZ A;  3GTP B;  1EZ6 A;  5IGD A;  2EDG A;  3A7L A;  3S17 B;  3I4M B;  4OIJ A;  2H4O A;  3S1R B;  1SND A;  2K5W A;  2Z1C A;  1FR3 A;  1EY4 A;  4DGZ A;  3VA5 A;  1TII D;  4BBS B;  3E0J A;  1Y1W B;  2AWO A;  2EOT A;  3EFX D;  2E2I B;  3IFT A;  3MHB A;  2EY2 A;  3OOC A;  2BOS A;  3OIP A;  1ZXT A;  5EGT A;  2DNC A;  4G57 A;  1EFI D;  1G2S A;  1PZI D;  1ESF A;  2JA5 B;  1Q1E A;  1C8C A;  4A3M B;  3C46 A;  4HCE A;  4RGM A;  1ET9 A;  1GHK A;  3MTS A;  2IW3 A;  3H3V C;  1LTT D;  5FLX E;  3NHH A;  5FO7 B;  5JEA J;  3I90 A;  1CHQ D;  4C56 C;  4LJZ C;  1QG7 A;  3MEH A;  3Q6S A;  4I65 A;  2KEE A;  2B2U A;  3ERO A;  3CQZ B;  2R61 A;  5HUR A;  5C0X I;  3V05 A;  1CA5 A;  2ZXO A;  4QB4 A;  5I4D A;  1A2T A;  2IJ0 A;  4IZ8 A;  5FLX L;  2KCC A;  4ZLT F;  4TKO B;  5FK9 C;  3RZO B;  1TT2 A;  5C44 B;  1T5E A;  2HUG A;  1L0Y B;  1D6E C;  4Q5V A;  1LTG D;  1NAP A;  2TMP A;  3MXP A;  3TZD A;  3EQL C;  2RDG A;  1PRT C;  2Z4I A;  1O7Y A;  1QIL A;  3GTQ B;  3NBH A;  4DNR B;  2EY1 A;  2IT1 A;  3GP7 A;  3JAM E;  3G7L A;  5DAU A;  2F0T A;  5KND A;  4L8J A;  2CHB D;  1QE6 A;  5EKI A;  2JSO A;  4F7X A;  2PZW A;  3FEW X;  1JB3 A;  1SMY D;  3WDN A;  2WV6 D;  1B53 A;  3HG9 A;  4XT3 B;  2B2V A;  1JE4 A;  2EXZ A;  2PW5 A;  4IFD I;  4BA1 I;  4IN3 A;  1H9R A;  3M3Y B;  4RCO A;  5D3I B;  2Q8T A;  1EOT A;  4RAU C;  3BDO A;  3PUY A;  1S5C D;  2PO4 A;  3JAM L;  5I6Y A;  5I2Y A;  5BN4 A;  4S3S A;  4HR7 B;  4RA8 A;  1HTL D;  1FGB D;  3PUX A;  1IYV A;  1S5F D;  2PCF B;  5ISR A;  1WTW A;  4DA2 A;  2EVB A;  3SEB A;  5CC4 A;  5IIF A;  4A3E B;  3T4A C;  3MAQ A;  1U9R A;  3NTK A;  5KYI A;  3A7A B;  2NN6 H;  4I7Z C;  2NVQ B;  2F0U A;  5I9O A;  2WIN B;  1CK1 A;  5C6A A;  4AYB B;  3U9S A;  5M3F B;  2R7Z B;  2C5C A;  4ZK9 B;  3I70 A;  1A3V A;  4ZKC B;  3KUP A;  3LWE A;  2WAC A;  1VF5 C;  4RGN A;  3M7G A;  5CGK A;  4RHS A;  1WTP A;  2SNM A;  3VYT A;  1DD2 A;  2PZT A;  5ELB A;  3MWY W;  3D6C A;  3RD4 A;  5M3M B;  1SYG A;  1SE3 A;  5K36 H;  5IT9 E;  3R2T A;  3MVV A;  2LFN A;  1F2L A;  4HN7 A;  4HCS A;  1YNJ D;  1OO9 B;  1G29 1;  1DOM A;  2MP1 A;  3A56 A;  3T16 A;  3HOX B;  1LTB D;  1EYD A;  2L5T A;  1PMR A;  2FMC A;  5IGF A;  3P75 A;  5CV7 A;  1E2V A;  2NB0 A;  4K8J A;  2QF7 A;  3T53 B;  5EQ0 A;  4IFD J;  4LAA A;  3TP8 A;  1BUV T;  5IT9 L;  1WTV A;  2PZU A;  2E2D C;  4DF7 A;  3A54 A;  3PO3 B;  2AQ1 B;  5IGG A;  2VXW A;  3SE0 A;  4CJ2 C;  1RDP D;  4KJO A;  2O2L D;  3GQB A;  3X3M A;  3BDL A;  2B8G A;  1SE4 A;  2WAQ B;  3S9W A;  2NTS A;  2F0M A;  1FNU A;  1STH A;  1Q12 A;  3BVG A;  4RHR A;  1B50 A;  1PFM A;  2QCP X;  4IUU A;  1FNW A;  3OSO A;  3Q23 A;  2YU9 B;  5A35 A;  1GOZ A;  1QNK A;  1SMY C;  1E2W A;  2K1B A;  1EL0 A;  4WRD A;  5C4J B;  5EKL A;  1RTN A;  3KLS X;  2K03 A;  1SAP A;  1K8O A;  2ENB A;  3H94 A;  4CGY B;  4BY1 B;  1DJR D;  4H13 C;  3GD7 A;  1D2B A;  2IX0 A;  1PRT B;  4ZUI A;  2DNE A;  3DWP A;  1S5B D;  2R93 B;  2RVL A;  1CI3 M;  1B2T A;  3J7A V;  1LT6 D;  2SDF A;  1I3Q B;  4BY7 B;  3PMF A;  1EY7 A;  4QUF A;  2LMC B;  1JWU D;  1PXU A;  2K5D A;  4XXE A;  1SFO B;  4NMZ A;  1SJH D;  1EY0 A;  1E0B A;  1H9J A;  5C5L A;  4RWS C;  1BOS A;  3KF8 A;  3GTJ B;  2RBM A;  3PUZ A;  3SVM A;  4OO1 I;  1GJX A;  1AW7 A;  4C2M B;  4C3H B;  3C2P A;  2SEB D;  2B2W A;  4M8A A;  1EU4 A;  4A3G B;  2OXP A;  2RKS A;  2N55 A;  1TWH B;  1S5D D;  3DWQ A;  4RKL A;  1RCV D;  3NUC A;  1YNJ C;  3F2U A;  2SNS A;  3L3O C;  4F87 A;  2VB3 X;  3I4N B;  4C3H G;  3J81 E;  4R8I A;  1ONL A;  1MD2 D;  3R3O A;  3CHB D;  2F4I A;  1HFN A;  1SEB D;  1M4V A;  1Y8N B;  3D8G A;  3LX0 A;  3TP7 A;  4HSV A;  1STN A;  4EQP A;  2XN9 C;  3BYY B;  2EYH A;  2EYP A;  1HCZ A;  1G91 A;  5BN5 A;  4K5X A;  1ZEQ X;  3TP6 A;  3J81 L;  3TP5 A;  2IPK D;  1LAC A;  4KMU C;  4RCN A;  1CA6 A;  3GTK B;  5E4W C;  3TDQ A;  2KED A;  4CKB A;  3RZD B;  4TSS A;  4WFN 3;  1SYD A;  2PQE A;  3FKI B;  3DXJ C;  5D3D A;  1BQQ T;  1TVX A;  2BDN A;  1Y8P B;  4XQQ A;  4F8M A;  4KKT A;  5JOB A;  2L11 A;  1LTI D;  2JA8 B;  3M85 A;  1R4P B;  2LS0 1;  1GUN A;  3LNN A;  4O1N A;  4H0L C;  2WP8 J;  4R9W A;  5F2D A;  1K8M A;  4A3K B;  4J8Q A;  1S5E D;  3QOL A;  4KI0 A;  4A3I B;  3S15 B;  1GUO A;  1SYB A;  2L0C A;  3N6R A;  3QJY A;  3H09 A;  1ENA A;  3URY A;  1LT3 D;  2ZT9 C;  1OXU A;  2ZXP A;  3BVZ A;  2M2L A;  2O4X A;  1O7Z A;  4O42 A;  3DM1 A;  1WD0 A;  3PIO 3;  3OWF A;  2BA1 A;  1HFG A;  1KLU D;  1W6J A;  3EVQ A;  1WVL A;  4ILW A;  5C5M A;  4NW2 A;  5IGB A;  4UAI A;  2QKI C;  1H9M A;  3A8J E;  1OXX K;  4C3I G;  5EKK A;  5C4H A;  2V4D A;  3J7Y W;  1PYW D;  2PNR C;  1QNU A;  4ABN A;  1JOR A;  2M9V A;  1EEF D;  1L0X B;  3M4O B;  4PMC A;  1Y8O B;  1TY2 A;  5KEE A;  2MHV A;  3BG3 A;  4FXD A;  4Q0F A;  1AZQ A;  4E6I A;  4CBV A;  1BNZ A;  4XQJ A;  2R3Z A;  1EWC A;  3TSS A;  2MJ8 A;  3HS0 C;  1LTS D;  2CQA A;  4RFB A;  4X3S A;  3TZU A;  1WTR A;  3CRL C;  3S1Q B;  1A3U A;  3ONA B;  1ILQ A;  4QIW B;  3A8K E;  3VYR A;  1F9R A;  4DU9 A;  2WB1 B;  1RTO A;  1BF4 A;  3DHQ A;  5LL6 S;  2WKC A;  4CHT B;  2F0J A;  3QWN A;  1BO0 A;  3QIA A;  2H1E A;  4XTC S;  1R9T B;  2DY8 A;  3FRP B;  1HUM A;  1TWC B;  3KLS A;  1HA5 A;  1HQM C;  3MZ5 A;  3PV0 A;  1O7L A;  1Z47 A;  1B4O A;  1F77 A;  3C1F A;  5G3L F;  3DMU A;  1WTX A;  4JK1 C;  2A69 D;  4IQZ A;  3PIP 3;  2MPM A;  3NTI A;  2BDO A;  1TWG B;  4FVM A;  5J22 A;  1A6X A;  3N52 A;  1EZ8 A;  4OIK A;  4KTA A;  3NWT A;  3VR5 A;  2A5H A;  3HKZ B;  4EQO A;  4DAV A;  2EZV A;  2RSN A;  4K2K A;  5KNB A;  4A93 B;  1TS3 A;  5EPJ A;  1DOL A;  3IKJ A;  2RQX A;  2B2W C;  3NXW A;  5ELE A;  1ML0 D;  5M5W B;  2JA6 B;  4G7O C;  1PFN A;  2E75 C;  3I72 A;  1X3Q A;  3K5N A;  2F0W A;  1A2U A;  2A74 C;  5M5X B;  1UNS A;  4B9W A;  4KJN A;  2BE5 D;  1LLR D;  3SHL A;  1SNQ A;  3TBI B;  2L9H A;  2A68 D;  1JWM D;  2NBF A;  2RDF A;  2AUK A;  2F03 A;  2ID0 A;  4ZKB B;  2F0N A;  4OGQ C;  4C3J B;  3OMG A;  5I2X A;  5DM6 3;  3VR3 A;  1PDQ A;  1KAA A;  4PMW A;  4OHJ A;  3K5O A;  2EYF A;  1QB5 D;  4DAY A;  3I91 A;  5CV4 A;  3A8I E;  3IL8 A;  3WOF A;  1B3A A;  1SNO A;  2XVS A;  1D5Z C;  4EVO A;  3I8Z A;  1CQV A;  2FHT A;  1Y1V B;  5EPL A;  1LT4 D;  2E74 C;  4C1N I;  1EY9 A;  2K28 A;  4L63 B;  2NN6 I;  4YIJ A;  1TS2 A;  4C3J G;  4RH6 A;  1MSG A;  2EYJ A;  4HAE A;  4PQX A;  5T1I A;  2OEO A;  4X3T A;  3C3L A;  4MHE A;  3M4Y A;  4BS9 A;  1EYC A;  1OXV A;  4JBW A;  5C3E B;  3S16 B;  4DK1 A;  3GTO B;  5ELC A;  1CQF A;  1SDF A;  3P1H A;  1SYC A;  1U4M A;  1B44 D;  1X32 A;  4ODG A;  3IAY A;  4QCL A;  5LL6 X;  3RMH A;  1GUW A;  2SOB A;  5FOB B;  2QDB A;  2L1B A;  2EPB A;  3MFY A;  3AB9 A;  2AQ2 B;  1MGS A;  1ENC A;  1RKN A;  4QF4 A;  1I4Q A;  1DM0 B;  2R92 B;  5LHY 1;  1SNP A;  5CV6 A;  3L7Z C;  1IKM A;  5CV8 A;  1TS5 A;  1BCP D;  2F3W A;  3SR1 A;  2A69 C;  1JC7 A;  1XWE A;  2Q8I B;  3GV6 A;  4IUP A;  5G3L D;  3HOU B;  4CKC A;  2BCO A;  3HOV B;  1SYF A;  1UUP A;  2OT2 A;  2KA7 A;  2XWB B;  3HOW B;  1EIG A;  1EIH A;  1FYC A;  1SYE A;  2J0T D;  3H91 A;  1EQT A;  2K32 A;  1RHP A;  3D6W A;  3ND9 A;  3OHX C;  2L55 A;  1I50 B;  1O80 A;  4K14 A;  3QOJ A;  3NBI A;  2AQ3 B;  1LTA D;  2BE5 C;  1O78 A;  1B9N A;  1QJO A;  2A68 C;  2Z4H A;  4DK0 A;  1D5M C;  1GUG A;  4RGT A;  3QO2 A;  1QWY A;  1D5X C;  4PV1 C;  3K6O A;  1ESR A;  4WOR A;  5JPN C;  3KLR A;  1EY8 A;  2KUM A;  2OF1 A;  1YNN D;  2F0O A;  4A3J B;  5CR3 A;  3S1N B;  5E1F A;  3ZYY X;  4UDU C;  2RDH A;  1NSN S;  3NK9 A;  1PZK D;  4TQU S;  3K5L A;  2F0G A;  3QG1 A;  5C4X B;  1EY6 A;  5JJZ A;  2VNU D;  3VA7 A;  1CT1 D;  5E3F A;  4XQN A;  2Z8L A;  3C1E A;  1WD1 A;  1TS4 A;  1U4R A;  3HOZ B;  4NKL A;  3GV3 A;  1SNM A;  2NTT A;  1G8Z D;  2EYO A;  1STE A;  1TU2 B;  2YYZ A;  2VB2 X;  1KLG D;  4MN3 A;  4BWG B;  1PFB A;  2WII B;  1JIC A;  1M8A A;  3I3C A;  1J8I A;  2XWJ B;  2K33 A;  1D1K A;  2B2T A;  1H9S B;  1Q1B A;  1BR9 A;  1II3 A;  1I4H A;  4QUC A;  5EBC A;  4CJ1 B;  2RSO A;  4U67 3;  1TKW B;  5FO8 B;  1EEI D;  1BDO A;  3ND8 A;  4C1N K;  3HOY B;  4DFA A;  2KOL A;  4N9T A;  1A15 A;  2D9U A;  2NUC A;  5CV9 A;  1KTK A;  1EQV A;  1TY0 A;  3W2D A;  4K6D A;  3VR2 A;  1IYU A;  4RGO S;  3E5S A;  1BCP C;  1V43 A;  1MI2 A;  2F0K A;  1H9S A;  2XSC A;  1ZYR D;  4IAL A;  1ICW A;  2F0D A;  1TR5 A;  3PUW A;  2AUJ D;  1BXT A;  2HDL A;  1AEX A;  4FF2 A;  2B39 A;  1PZJ D;  1DXM A;  2M00 A;  1LT5 D;  5COY A;  4R8N A;  2G9H D;  4KY6 A;  5CV5 A;  3K57 A;  3R2I A;  3RLF A;  2JYO A;  4IUQ A;  3TME A;  1ENF A;  1HUN A;  2B63 B;  2IX1 A;  1DCZ A;  2TSS A;  4V0B A;  1JWS D;  2EE1 A;  3X3N A;  3NSW A;  3MFG A;  4K5W A;  4C3I B;  5K5P A;  4PNY A;  4Z9C B;  1STG A;  1YNN C;  1I6H B;  4K5V A;  1A3T A;  1LTR D;  4KN7 C;  1QOH A;  4Y7N B;  1MBY A;  1G2T A;  5DEH A;  3R8B A;  1HXY D;  2E2H B;  1DZ1 A;  1NCV A;  1GHJ A;  1CFM A;  4ZAI A;  2NWG A;  3WOE A;  4WJW A;  3UI2 A;  1PTO F;  2I07 B;  4GZY C;  5KIX A;  4DAP A;  3SK4 A;  3VR4 A;  2DN8 A;  1SE2 A;  3DEP A;  2K7V A;  1I4P A;  4BBR B;  2XNA C;  2D5D A;  3FMC A;  5I6W A;  5HGT A;  1JOK A;  3LWU A;  5T1G A;  4HED A;  1LV9 A;  2K6A A;  3BDC A;  5KGU A;  5JEA G;  5C3W A;  1EY5 A;  4LMQ D;  2B2Y C;  3S1M B;  3S2D B;  3T13 A;  1OXT A;  1WTQ A;  2KJX A;  1I4R A;  1STB A;  1TWA B;  2F0P A;  3V96 A;  1Q8I A;  1JR0 D;  3VYU A;  1V1P B;  5C4Z A;  3KBX A;  4XT1 B;  3SK8 A;  1F9S A;  4KKS A;  4FYD A;  1B9M A;  4N9P A;  2ZXR A;  3D4D A;  5M9O A;  4CKE A;  3PUV A;  4FXG C;  1F2Z A;  1STY A;  2LY7 A;  5FO9 B;  1DOK A;  3NTH A;  1XTC D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...