2XSCA

Crystal structure of the cell-binding b oligomer of verotoxin-1 from e. coli
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
69
structure length
69
Chain Sequence
TPDCVTGKVEYTKYNDDDTFTVKVGDKELFTNRWNLQSLLLSAQITGMTVTIKTNACHNGGGFSEVIFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SHIGA-LIKE TOXIN 1 SUBUNIT B
publication title Crystal Structure of the Cell-Binding B Oligomer of Verotoxin-1 from E. Coli.
pubmed doi rcsb
molecule tags Toxin
total genus 16
structure length 69
sequence length 69
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2010-09-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.70 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2xscA00
4P2CB 1CQFA 1R4PB 4M1UB 1CZWA 1QOHA 1R4QB 1C48A 2C5CA 1D1KA 4ULLA 1QNUA 1DM0B 1BOSA 1D1IA 2XSCA 1CZGA 2BOSA 3MXGA 2GA4B 1C4QA
chains in the Genus database with same CATH superfamily
5KYIA 4MZ9A 3I4MG 1HCZA 4X3TA 4JK1C 5GAGC 1HNXL 1MGSA 2XWJB 1KTKA 4H44C 3LGJA 4IOAA 4J8QA 1SYEA 4A3BH 1CKNA 1JB3A 1BDOA 2K4KA 1S5BD 1NMFA 1SNMA 3RZOB 5C3XA 3UE0A 3UDGA 2GVBA 4DKAC 5EJWA 4RCNA 2JA8G 2I0QA 4I65A 1XTCD 3K0XA 5J3BA 3CC4A 1PTOC 3HKZB 5FLXE 1B9MA 2QGQA 3GTOB 2WACA 1V1PB 2D2CC 4GOPA 4JI8L 3PUYA 4A3JG 2LKVA 2YTVA 3A74A 2JA5G 5KIXA 1WD0A 2K5DA 3PMFA 1STHA 4N8FA 1VQBA 2JEAI 2Q2TA 2JEBI 2Z6BA 3J7AF 3HOUG 4U68A 4R8NA 1STGA 1UE1A 3OW2A 3H6MA 1KXLA 3WDNA 1MHWC 4POGA 4ZKCB 5IWAL 3KFUA 1VQJA 1V1OA 1EIFA 5IGGA 1JMCA 5I6YA 3GTJB 2K28A 1AZPA 2CH4W 4PMBA 1FVIA 1NTGA 3WWVA 2SNMA 4IOCA 1F2MA 1EIYB 3DHQA 3T1YQ 1HR0Q 4CKEA 4BY1B 3CW2C 1EY8A 3FPPA 3NQTA 2F0TA 1MKHA 1AE3A 3UDXA 3QG1A 2F0IA 1G51A 2WP8J 4FXKC 1EIGA 1F9SA 1HTLD 2BE5C 5J1ZA 1XNQQ 4O1NA 4YCVA 3G6JB 4UPAA 1H9SA 3I4LA 4PMCA 2OQKA 4K5VA 4X66Q 2ZM6L 1J8IA 4PZ7A 5IT9E 1SMYC 4A3GG 3OOCA 4LMQD 2E2HB 3CPWA 3S1RB 2HHHL 1IL8A 1WTPA 1VQIA 4BY7G 5C3EH 2N55A 3U4ZA 1FD7D 4A3EG 3KLRA 3LX0A 3R93A 2E2JH 2Z0SA 2OWOA 2KBNA 1A0IA 2B2UA 3EQLC 5CV6A 3EA6A 1XWEA 3SGIA 3HOVG 2HCIA 1SYFA 1B50A 4CBVA 1TWAB 5BR8L 1KLGD 3DEOA 1ASYA 2EJMA 2WAQB 3FVQA 4B3TQ 3K5OA 2KECA 3GDEA 3JC66 2DN8A 3I4NH 4PQXA 4DV7Q 2AQ1B 1HJPA 4PV1C 5M5XH 2NB0A 1YHBA 2PQAB 3GD7A 1KD1C 3I7FA 4YHHL 1Q7YC 4YWLA 3K5LA 4LFAL 1OTCA 3TZDA 1GUNA 1E2WA 3IKJA 2DJGC 3SR1A 2F0FA 5CBEE 1I6HH 3FEWX 3A5ZB 2JJQA 1AP0A 4JI1Q 5LL6X 2R7DA 5EPJA 4HIOA 2F3WA 3J80L 4LJZC 1VQGA 2N8NA 3U4VA 4DAPA 1R4QB 1RTOA 3X3MA 3HOZG 4R4IA 3S9WA 2Z9HA 1GM5A 1S5CD 4L5QA 1IHZA 4XQJA 2WB1G 1I94Q 4ZYSA 3H0GB 2F0JA 2JA7G 2K75A 2BH2A 1BBWA 2B8GA 3IL8A 1XPOA 4GKJL 1RKNA 5ELEA 2O5IC 3B6YA 3CRKC 2N88A 4POFA 3D6WA 5COYA 3M4OH 1GUTA 1IL2A 1J9OA 2L12A 2B63B 1R4PB 1Y14B 2ZJPA 1SNOA 3M3YH 1TY2A 2KHSA 4YWMA 5JAVA 1WCMH 2XRSD 4AYBE 3ND9A 2BDNA 3TP6A 4AH6A 1YNJD 2UXCQ 4GN3B 4XXEA 4C3IH 4QUCA 4X64Q 3KLSA 2HT1A 1IKLA 4OX9Q 1CHQD 4J1MA 3F2BA 4OEMB 4UY8C 2JA6B 3KYHC 4DPGA 2R6GA 3T16A 2IY5B 4B3SL 1IYJB 1HUNA 3HP3A 2RCFA 1LT3D 4NW2A 1B3AA 1EYAA 2EY6A 3S2HB 1EZ6A 5I9PA 1QUQA 2KCTA 1I4QA 5LMNW 1D5XC 2H4OA 3KBGA 1C8CA 2PMZE 1RJTA 2FHTA 1U4RA 2A69D 3E3XA 2KJXA 3ICEA 2CW0D 1PRTC 2O2LD 4A3BG 3M7NA 2K5VA 1PFSA 3O13A 2QEJC 2OEOA 4JI2L 3WOFA 4IURA 3H15A 5KNDA 2L0CA 5K5PA 5IIFA 4A93B 5DAUA 4GNXA 3NSWA 1PVOA 2DY8A 1SN8A 2EYOA 2R7ZG 1PH4A 1YZ6A 2HD3A 3U58A 3J81j 5EGTA 3OHXC 3FDTA 1TR5A 2L4NA 1NY4A 2ZTEA 1LO5D 1LTID 1T5XD 3K7AH 4L6TB 1V43A 3GTLH 3MFYA 1BF4A 1M8AA 3CD6A 2F0DA 3URYA 2A68C 1XMQL 4TQUS 2FMMA 4QGUA 5JPMC 1YBYA 2F3VA 4YCUA 5E4XA 1SSOA 1U0LA 4XQNA 2K14A 1KNEA 3NWSA 3NELA 5IP7G 1HFGA 2D0PA 3N6RA 4XYOA 1PTOF 4LAAA 2AKWB 2R93G 2MGSA 1N36Q 3KJPA 1AEXA 2ENBA 3MXNA 4DN4M 4DXGA 2NYZD 5A2QL 4A3FB 3I55A 3A8KE 2RDHA 1BOSA 3F2CA 2IHEA 4OIKA 5FLXc 3EROA 4JI6Q 3RR5A 1PRTB 1XPUA 1H9RA 2LSSA 2A6HC 3QOJA 1WTWA 1TWHB 2ZM6Q 4JI5Q 2PW7A 3NXWA 2MJ8A 3C3LA 4P2CB 3RD4A 4ZRZA 1WI5A 3H09A 4ILWA 2Y0SB 4C1NI 1N34L 1CA5A 3A8JE 3BZCA 5C4XH 4A3LG 3RZDH 5C3EG 3PUVA 4DAYA 1H95A 5DM63 2UXDQ 1MBYA 2XSCA 3E0EA 2SOBA 3H94A 2YU9H 3I4MH 4A3KH 1BBXC 5IOCA 1I5FA 1VS0A 3K5NA 4WJ3M 4HJAA 1BO0A 1A3UA 4HSPA 2K05A 2PW5A 1KRSA 1PFMA 4JBJA 2VQFQ 2UU9Q 4QQBX 1AFPA 1VQ8A 4DFAA 1E2VA 1B8AA 1YIJA 4K0KQ 2H5XA 3M9BA 1LUZA 1NBWA 4HIMA 3I4NB 4C2MB 3V2TA 4DR1Q 4TSSA 5HGQA 4HMJA 4B3RQ 3OMGA 3R2TA 1RD9D 1IBLQ 5CBAE 1ENCA 4DR6L 4LFAQ 2VW9A 2UUAL 3BJUA 4O42A 1ENFA 3JAMi 1VQ7A 5IT9c 2F0GA 3HOUH 1CA6A 5M5WH 1HNWL 4QY7A 2NVTB 1SBBB 2DY7A 2XRQD 3S15B 2E2DC 1A6XA 2EYLA 3K59A 2JYOA 5L37A 3S17B 4JI0L 1FNUA 4R4OA 2WV6D 1A8VA 2GN5A 3M4QA 2RBMA 1OXTA 3PO2B 2K5HA 1KABA 4AQYL 1X6OA 1MJEA 1N8RC 3BVMA 4DK0A 1YNNC 3CMEA 4DNIA 4A4IA 1JORA 2QILA 2HCCA 2AQ2B 3NBHA 2E2IH 2L9HA 4A3DH 2KHIA 3MFGA 1Y8PB 2LMCB 3H3VH 2IWHA 3M85A 4DV2Q 1SE2A 2B2VA 2Z4HA 4HJ5A 4KJNA 5M3MH 1IZ6A 4OL7A 2UUCL 3TBIB 1SE3A 4LF7Q 4ABNA 5KNCA 2BH8A 1RL2A 4MHEA 5BN5A 2F0SA 1PH3A 4QB4A 4JBMA 3GO5A 5HURA 4ALPA 1WTXA 1WCMG 1PFNA 5BN3A 5EKLA 2F4VL 2KCCA 5KEEA 2MFIA 1JWUD 4C3IG 5C44G 2NVYB 2KUMA 5LMUQ 3A56A 2L11A 1CQVA 4A3IH 1G291 1STAA 4JC0A 4V0BA 4A3EH 4IQZA 1FGUA 1SEBD 1TWCB 3J81E 5I9OA 4KHPQ 2PPBC 2KEDA 1MSGA 5A35A 4GKKQ 3CC7A 2A73B 2EOTA 3CF5A 1EY9A 3GTGH 3GTKH 2BA1A 2ICEC 1PTOH 3GTQH 2D5DA 3NBIA 1L0XB 4ULLA 3MVVA 1UAPA 1LT4D 3T13A 4KKTA 4BXXH 1SFOH 1CSPA 2MO1A 1A2TA 4FO2A 3I91A 3GTMB 1R9TB 1SR3A 1LACA 2ZJQA 3U50C 1VF7A 1VQFA 5T1GA 3AFPA 2K52A 3E9IA 5GROA 1KNAA 2NZHA 1WTRA 3KOJA 3RN2A 1P8LA 1UE7A 1K83H 3GV3A 1TXYA 4KJOA 1EWIA 1N32L 1D5MC 4BBRG 1PH7A 4YCWA 1VQOA 3S2DB 1B2TA 1Q1BA 1K8GA 2ID0A 1WVLA 1AE2A 1G2TA 3A8IE 1E7ZA 4DAVA 1BCPD 3CRLC 4QMGA 5M3FH 5ELBA 3S1NH 2ZXOA 3LWUA 4ZCKA 3S14B 2D0OA 2QA4A 4JI7Q 1GXDC 3HOZH 2AUKA 1PRTF 4K8IA 3T1HL 4CJ2C 1Q1EA 2F0OA 1LM0A 1SNDA 2K5WA 1LT6D 5M9OA 1RCVD 2F0VA 1ILPA 1JJ2A 1D1KA 2PZWA 1Y1VH 4BBSH 2Q2HA 5HY6A 1EOTA 5JJKA 1O78A 4DV5Q 3OIPA 3KF6A 1TS5A 3F1ZA 2JP1A 4DR5Q 4ME3A 1BKBA 3FP9A 2B2YA 4EQNA 4DR7L 3CQZB 4R9WA 4KI0A 1O7YA 1L1OC 2O5JC 1VMCA 4C3HH 3X3NA 4H02A 4MTKA 1EY0A 3QO2A 1C48A 5ELFA 1O80A 4UP9A 2Q8IB 3J81i 4DU9A 3CMAA 3HOYB 1CZGA 4HTHA 3MAQA 5IYCG 3TS0A 4LF6Q 3I90A 1F9RA 3K81C 3JAMc 1A3VA 3RZDB 5C4XG 3P1HA 5LMNL 3I4MB 5J39A 1ONLA 4LFBQ 4A3KG 2EYHA 2RDFA 3OTOL 4O0AA 5CR3A 1JE4A 2SNSA 2K7VA 3K58A 1ZKOA 2NUCA 2EJGC 4P73A 4A3MB 2K32A 1E3PA 1SNQA 4HEDA 2F0UA 1Y1WB 3VA7A 2JA8B 3S1QH 1EUJA 3NUCA 5GAEC 1P16A 4X62Q 3TDQA 4UP8A 1TS3A 1DOMA 2VZAA 3J7AV 4A3JB 2YYZA 2JA5B 2G9DA 1DZ1A 1VQMA 2R7ZH 4X65L 1ICWA 1BVSA 2KQ3A 1D8LA 4N9TA 4JI4L 2DNEA 2R92B 3C2PA 1G6ZA 5BN4A 4F8MA 1FNWA 2EDGA 3MXGA 1NMGA 3NHHA 2M9VA 2JXMB 4DK6C 1HTPA 1H9JA 2KENA 1L1OB 4K5XA 4JBKA 2NVQH 1QWYA 3HRZC 1TS2A 4JV5L 3KF8B 1DOKA 1EEID 2E5LL 3TP8A 1EEFD 5C0XJ 4AQYQ 2HQEA 3OMCA 1L0WA 3TMEA 5IP7H 4IUNA 4KKSA 1J5EQ 1NSNS 1DM0B 3CCMA 3Q22A 2R93H 3TREA 3E5SA 2M00A 4A3DG 4DR3Q 3DM3A 4CJ0B 4DUZQ 1Q81C 3VR6A 1LT5D 1IBMQ 5M3MG 1IBKL 5C6AA 2MNAA 1W2BA 4GLAC 1XJVA 2AQ3B 1RIPA 3DUZA 1XMOL 4YIJA 3K8AA 2ZXRA 1WJJA 3FKIH 1QILA 3E6ZX 4L8JA 1HR0W 2UXBQ 1U4MA 1VQCA 2RSNA 4ZLTF 4LF8Q 4RMFA 4A3GB 4FF2A 5FO7B 4DR2L 5C0XH 3DMUA 4KN7C 5H1SE 4AIMA 2C35B 4A3IG 4KN4C 4A3LH 1S40A 4BY7B 4UP7A 5CV7A 4AYBG 1ENAA 4F88A 4LF4L 1I3QB 3F2DA 1U4PA 1B7YB 1K73C 1ZXTA 5JJIA 3HOVB 2CWAA 4IUVA 2QF7A 1PZJD 2VQEQ 4CDCC 3OW7A 4HMIA 1CK1A 3GTKB 4Y7NH 3S1MH 1V1PA 2L5TA 1JR0D 4DV1L 4A3CH 2RF4A 1HQMC 1IW7C 1X3GA 5EPKA 3GTPH 2WIIB 4FF3A 1SE4A 4BXXG 1CQFA 3A55A 4RAUC 1WOCA 3G6EA 1Q82C 1UNSA 1UUPA 1C9OA 3HKZE 2E74C 2E75C 3HOXB 1JCKB 1M4VA 5IODA 1U9RA 1GHJA 2PI2E 4LWCA 4DUYQ 1PYBA 1XNRL 4JYAQ 3T51B 1TKWB 1S4ZA 4DV6Q 2N3SA 1Q3LA 3W1BA 3F2UA 2VY3A 2XGTA 2ICIA 4QCLA 4PMWA 5IGBA 1GUGA 3J81c 5M3FG 2F0QA 4QJFA 3PF4A 2DNCA 2Z4IA 1F2ZA 3HOZB 3J80E 2B8FA 1NJIC 4DR4L 4LK1C 1B4OA 4IPGA 3KDFB 1KDCA 3EJIA 2WB1B 5M5YH 4NXMQ 1LTBD 2JA7B 4OHJA 1E1TA 1WFQA 3PGZA 1EWCA 4OELB 4RWSC 1N33L 1O7IA 4HR7B 1V8QA 3V05A 4JI3Q 1UE6A 4PNYA 1CHPD 1Y1VG 2EY5A 4BBSG 1IYUA 4DV0Q 2CKZB 2IJ0A 4LFCL 1VQKA 2IHFA 5FOBB 5J22A 4DV4Q 4RGTA 2OTJA 1VF5C 4DV3L 4NP5A 3NWTA 3NTIA 5EKKA 4J6HA 4YY3Q 5C44H 4HCEA 4C3HG 4LF5L 3HOWH 4WJ4A 2NVXB 1YI2A 1NUCA 3KLWA 1YJNA 2K1BA 2JA9A 1I4XA 1HHVA 4IUQA 4G7ZC 4G4KA 2VB2X 1SXTA 4RGMA 4MTNA 3VYRA 2RDGA 2C5CA 3QOLA 3SXHA 5CGKA 4ZUJA 1HRJA 4KD4A 5C4JH 3H3VI 4GS3A 1LLRD 2HQLA 2A74C 1VQPA 3S16H 1HNXQ 2EXZA 2VUMH 5IY0A 1ZYRC 1X55A 4NXNL 2Q2UA 2PQAA 1EFID 3PUXA 4A3BB 4WRDA 1KRTA 1X65A 3I8ZA 5LHY1 3QB3A 2LXKA 2CHBD 1LTLA 2WAQE 4HSVA 1KQSA 3SVMA 1CUKA 3PO3G 3CCJA 1DXMA 1DOLA 4OONA 2JN4A 4JBWA 1AN8A 1SJHD 2V1CC 1MIUA 5EAYA 4JI8Q 4OIJA 1DD2A 4BBRH 2C9OA 3CCQA 4G7HC 3CCRA 1F9QA 3WOEA 4NB3A 1GUSA 1FJGL 1CT1D 3TRZA 3MHBA 2EXDA 2Z6KC 2X6LA 3NK9A 3M4YA 4HJ9A 5K36H 2SDFA 3JAME 1PTOD 4B3ML 4RKLA 3J80i 1JC7A 1K3RA 2NN6G 1TS4A 5F2DA 2EYJA 5IWAQ 1ICFB 2K01A 1V1QA 4I7ZC 4G57A 4A93G 1WTVA 1PH5A 2OF1A 3RLOA 2K5NA 3I73A 3ERSX 4TVAB 4DK1A 1TWFH 1YEZA 2XN9C 4IJLA 1OO9B 1SYBA 1U5KA 2A6EC 5FO9B 4GZYC 3SK8A 4EQ5A 1YJWA 3PUZA 2ALYB 1I4GA 2TMPA 3ER0A 3R2IA 2XWBB 3C1EA 1CTMA 4CKCA 2RHQB 4NDXA 4APVA 1G91A 2AMCB 1SROA 2CCZA 5JEAJ 1JOOA 3FKIG 1B70B 1C4QA 2HIVA 3ZJYC 1TWGH 1VDZA 2K33A 1I50H 4OO1H 3NEMA 3D3RA 5IGCA 4XDXA 1VMPA 1ASZA 2RCNA 4KK7A 5IYCH 5C0XG 3J7ZC 2YTXA 4K5WA 2HHHQ 2BE5D 3BU2A 5C3EB 5C5LA 1E1OA 2K03A 5AJ3L 3W1GA 2E2JB 3D8GA 2UUBL 2EYPA 3HGBA 2VXWA 2KHJA 1SMYD 3NQIA 3M7GA 2EJFC 1MSHA 4ZK9B 1RHPA 1MD2D 2YV5A 1BUVT 3BS1A 1Q12A 4IZ8A 5BR8Q 1BCPB 2KA7A 1LTSD 4Y52H 3T53B 1X3EA 4A3CG 3NE5B 1S3OA 3R8BA 3R3OA 3A0JA 5DLQE 4LF9L 5IP9H 1YJ9A 5M5XB 1SDFA 2WFWA 3N52A 5CV8A 3I72A 1T5EA 2ATWA 1YHAA 4RKBA 4L5SA 1KDBA 4YHHQ 3QJYA 3MEFA 2J0TD 2PNRC 3RZOH 5CC4A 1SYGA 3IAYA 2EE1A 3NTHA 4WJWA 3D4DA 5FKAC 5AFWA 1JE5A 1N9WA 1I6HB 4EQOA 5CMDA 4ZQ3A 2N78A 4MIUA 1HH2P 3GTOH 4L63B 1EQQA 3NTKA 1IKMA 4B9WA 4RHRA 4Q5VA 1X56A 3HG9A 1LTTD 4IFDJ 3AFQA 2RKSA 5C4ZA 1KAAA 5KNBA 3I4OA 5M5YB 1SLJA 1FYCA 2VS1A 3GTJH 3CHBD 3MA2B 3CCUA 3MWYW 1QVCA 2FXQA 4DNRB 2NWGA 4GKJQ 4OWXB 5G3LF 3M4OB 3MC0B 1QB5D 3A5UA 3M3YB 1JQYD 3T1YL 1HR0L 1V9PA 2TSSA 1X3PA 3L0OA 3G4SA 1WCMB 4BY1H 1EQVA 4KY5A 3IRBA 4QL5A 2AWNA 4C3IB 4LUZA 1OXXK 2X69A 3TZUA 3TN2A 3J7A5 2NN6I 3VDYA 4IFDH 3Q6SA 3HOWG 1FNVA 1XNQL 1JWMD 2IX3A 4QF4A 4GOPC 2L55A 4X66L 2F52A 2Y0SE 4B3SQ 1C0AA 2CQAA 4NPSA 3K6OA 4DXFA 2A8VA 2K5QA 2E2HH 3J80c 3S1RH 1EIHA 3KJOA 3S16B 3P75A 2PNHA 2VUMG 1E22A 1PH6A 1D6EC 4FP5D 3VYSA 1EQRA 3V96A 1EZ8A 2Z8LA 3VR5A 1UEBA 1KAWA 1EY5A 3MZ5A 3STBC 3CP0A 4JI2Q 4C56C 2OXPA 3FPUB 4X3UA 5I6WA 1Z6HA 4CDEC 2RSOA 5C0XI 1SRUA 5EPLA 4JOIC 1TT2A 4B3TL 1PRTD 4BBRB 3W2DA 1SE8A 1M90C 4V190 1B9NA 1EY6A 3Q24A 3CAMA 4DV7L 4HJ8A 5K36G 5IYBH 4P72A 1WTHA 4EX5A 4C3JG 1CKNB 3BVGA 3K7AB 2OTLA 4OWTB 4CDFC 4GLXA 2G9HD 2RHSB 3CPFA 3GTLB 2EYFA 1MJCA 3OIQA 4K2KA 2PCFB 1EL0A 2JQOA 1VQ4A 1Q8IA 3AU7A 5I2YA 1VQ9A 1RF2D 2B2WC 3EBEA 1VCIA 2PYKA 4ZUIA 1TWFB 1XMQQ 5D14A 1LABA 3CKIB 3D31A 1LTAD 4JI1L 2MQHA 1AW7A 4GOPB 4L5RC 1WTOA 3U9SA 3I2ZA 2QCPX 2F0HA 3E9HA 2XTIA 1X3FA 5JOBA 2OCEA 3K80C 2A68D 4TRDA 2MP1A 1PDQA 1SNPA 1I94L 4P74A 1K9MC 3H0GH 1YNJC 1YNXA 1CKOA 3A54A 3ULPA 4F7XA 3D4WA 3OWFA 2PQEA 3AYHB 5IYDH 3SK4A 4OO1G 3BDLA 5E3FA 3VYUA 4BA2I 4M8AA 2JSOA 4RFBA 2B63H 1CM9A 2R7FA 2RVLA 1KHIA 1N34Q 1MI2A 5C4XB 2UXCL 4X64L 5EBDA 4RG1A 1SYCA 1G6PA 4OX9L 2YU9B 4PZ8A 4A3KB 1XX8A 2A6HD 5EKIA 4QIWB 2EQSA 2JA6H 1IYVA 2A69C 1H9SB 4X6AH 2CW0C 5JEAG 3C46A 1GD7A 2XVSA 1VQHA 3S2HH 3L3OC 1Y69U 3Q0AA 3PO3H 2Z1CA 1DJRD 1PHJA 4HN7A 5CV4A 4LF9Q 1G8ZD 3BZDB 4IO9A 4XYQA 2QDLA 1K0RA 5IP9G 3D6CA 4Q0FA 4J15A 1GKHA 4IUUA 3S24A 4A3MG 3BYTB 3IFDA 3NP8A 4IPCA 1Y1WG 4DR6Q 2UUAQ 1QG7A 5FLXL 1WYDA 3HOUB 4U673 3HS0C 5M5WB 1A62A 1LTGD 1HNWQ 1B53A 2NN6H 4A76A 3HKZG 5FO8B 1C7YA 4H13C 2IL8A 4RGNA 4JI0Q 4A93H 4LUOA 1L0YB 3RLNA 3CCVA 3TS2A 4XQQA 4M1UB 2QDBA 1GHKA 1HZAA 3TP5A 2R92G 2D9UA 1CI3M 1GUOA 2IX1A 3L7ZC 4A3DB 2E2IB 5E4WC 2I46A 3RUZA 3CCSA 2F0WA 1YHQA 5M3MB 1HNZL 3D0FA 3OYYA 2UUCQ 1Q46A 1Q90A 1HQRD 2XNAC 3K0YA 1QOHA 1YNND 4UAIA 1W6JA 1RTNA 3SK6A 4BY1G 1VQLA 2M2LA 4LUVA 5ELOA 2HIXA 2F4VQ 4JOIA 1N36L 3MEHA 3L9AX 1DYQA 5CV5A 4IFDG 1ET9A 4A3IB 1BQQT 3G7LA 4R4CA 4A3FH 4AYBB 2ZJRA 1TIID 3ONAB 1VQAA 4A3EB 4JI6L 2MO0A 3HZXA 1A3TA 1FL0A 2JE6I 4H7BA 5IT9L 4GNXC 4IJHA 1HA5A 2FINB 4NMZA 1TWHH 4JI5L 4E6IA 3J7YW 1GJXA 2IT1A 3CC2A 4IPDA 1SMXA 1IXRA 1EU4A 2QW7A 4KHVA 2ZTCA 1J6QA 2B2WA 4YWKA 1Z9FA 3GTGB 1GO3E 2BOSA 4QIWE 1PTOB 1EY4A 2PI2A 3GTQB 2UXDL 1HXYD 4UHVA 1PH2A 3DEPA 4EQPA 1F9PA 2KOLA 2ES2A 1PZID 3BDOA 1SFOB 2J4XA 2K6AA 2PMZB 2OT2A 1PFBA 1T9HA 4S3SA 1ESFA 4OO1I 5JJZA 5KYLA 1EFWA 2EIFA 1JT8A 2UU9L 2VQFL 1QNUA 5I2XA 2FMCA 4OXPA 1L1OA 3A7LA 2WAQG 1K83B 3RNUA 4K0KL 3KF8A 3DWQA 2K04A 4P71A 1N32Q 1H9MA 1QUQB 2HDMA 4R1JA 2IX0A 1L2FA 1BBUA 1SJED 3T56B 4C2MH 1XXGA 4K6LA 3DWAA 3OWEB 3PUWA 4DR1L 3STBD 3F8TA 1UEAB 4XTCS 4B3RL 4NKLA 5IYBG 3DM1A 5M3FB 3S1NB 3EIVA 1IBLL 1LV9A 1E2ZA 1HZ9A 1PMRA 3HOXG 4JCVE 3RN5A 5C5MA 5FJ8G 3PIOA 1XPRA 1QZGA 1TVXA 1QZHA 3ULLA 3T1HQ 4KHZA 4I7AA 5EBCA 2NVTH 3S15H 1EYGA 4OGQC 3S17H 1STYA 3ND8A 3PIPA 2FFKB 5NUCA 1PXUA 1Y1VB 4GNXB 2ZXPA 4BBSB 3PO2H 1AH9A 4IALA 1STBA 1HPCA 2KVMA 1EQTA 2A5HA 2F03A 4O2DA 3G48A 1PH9A 4Z9CB 3SDZA 1JB7A 5ELCA 2NZ1D 4DR7Q 1TU2B 4X3KA 3Q23A 4C3HB 4DV2L 3SE0A 3H0GG 2DJFC 3VR2A 1GUWA 5IGDA 4GN5A 4GLVB 4LF7L 1UWVA 5IYDG 2CFMA 1NR4A 4C1NK 1ET6A 4KTAA 4ME5A 2B63G 1HZBA 1K0SA 2E76C 5FLMG 3TQYA 5E7NA 3HKSA 2K50A 5LMUL 1S5ED 1II3A 1B3QA 2NVYH 3PSIA 2ZT9C 3MXNB 2EY1A 5LMNQ 4TKOB 1KC8C 3OTOQ 3P7JA 2Q8TA 1VQ5A 4PZ6A 1PZKD 1X54A 2JA6G 1AZQA 1TWCH 2Q2IA 1EU3A 1SAPA 4KHPL 5ELDA 4BWGB 1A2UA 1O7LA 3GQBA 2NZOA 3I70A 4JPBW 3TP7A 3S1QB 3PO3B 1QE6A 4MN3A 4RGOS 4GKKL 5T1IA 4CKBA 3VYTA 3EN2A 1ILQA 1LTRD 2F0MA 1NE3A 1S5FD 3RLFA 2B39A 2EZVA 4IFDI 1EOVA 2J7ZA 1LYLA 4B9XA 2GA4B 1BNZA 2B2VC 4DAYB 4FYDA 2R7ZB 1F77A 3HEJA 1H9KA 3BZKA 4X65Q 2R61A 4JI4Q 3LNNA 4R4QA 3K5MA 3GTMH 3KBXA 3KDFA 4EGVA 1R9TH 1NAPA 1K3BC 4XT1B 5JJLA 3AEVA 4C3JH 2VL6A 1BCPC 3BDCA 3IFTA 3K7UC 3T4AC 3FMCA 2DUDA 3I3CA 3CCLA 2NVQB 5E1FA 3E0JA 5ELNA 1BR9A 3TEHB 3G71A 4FF1A 1A15A 3M4PA 4JV5Q 5KRUA 3CXCA 3S2DH 2E5LQ 1QVFA 3JAML 3PCOB 1SNCA 1NCVA 1CFMA 2F0EA 3PQIA 4KMUC 1PV4A 4RA8A 1ML0D 4LW1A 4WFN3 2WB1E 2R93B 1Y8NB 1CZWA 4K2LA 5LL6S 5CV9A 4JI7L 3S14H 5HGTA 3SEBA 4JW0A 5KGUA 5IE8A 1Q8KA 1HNZQ 1IBKQ 4EVOA 1VQDA 2DGYA 3FKIB 1XMOQ 5A2QE 1KLUD 4FF4A 1W3SA 4RCOA 4OWWB 4PG3A 4KD3A 5ISRA 2P5ZX 3EVQA 3PV0A 4DV5L 4DR2Q 2I07B 4IN3A 4DR5L 2LFNA 1JJCB 2QEXA 3NENA 2NTSA 1A63A 4R4TA 1K28A 4A3FG 2ZTDA 3AB9A 3NBHB 3CQZH 2PZTA 4A75A 1I4PA 3VR4A 1ESRA 4LF4Q 1RDPD 1XYIA 5CYUA 3FHWA 5I4DA 3UDFA 2I5LX 3W5OA 3UDIA 4K14A 3HOYH 2LXJA 2JK8A 4FNFA 4BS9A 1Q86C 5GQOA 1F2YA 2MUYA 5JEAH 1UE5A 4LF6L 4Y7NB 3S1MB 1Z47A 1I4RA 2Y0SG 3DXJC 3LWEA 4KLKA 4DV1Q 2BDOA 1BXTA 1VQ6A 3BG3A 1PLFA 1K8OA 1YVCA 1D1IA 5CORA 3GTPB 4LFBL 4P75A 2AHOB 1G2SA 3AMUA 3VR3A 2PO4A 1VQEA 3ZYYX 3FRPB 1CKMA 2B2TC 2HDLA 4A3MH 2E8GA 3W3AA 1I6VC 2CH4A 1KDAA 4DGZA 2AUJD 1Y1WH 3EFXD 3HFZB 4FVMA 2A1AA 4XIGS 1XNRQ 2JA8H 1IW7D 4X62L 1PA6A 1U4LA 4DNTB 1YITA 1STNA 3I56A 2NBFA 2B2YC 3I4NG 4A3JH 1QVGA 5JVH3 2JA5H 4IUTA 1DONA 1PYWD 1GOZA 1PH1A 5G3LD 1EYCA 1JICA 4CHTB 2R92H 3MTSA 3BYYB 4DR4Q 2CWPA 4DK3C 1I4HA 1PH8A 2YTYA 1JJGA 4B08A 2F0KA 1WD1A 5C4HA 1QJOA 2EYMA 3P20A 1M1KC 2O4XA 3Q8DA 1N33Q 3OSOA 4IPHA 5IGEA 1STEA 1W6KA 2A19A 1GVPA 5D3DA 3PO2G 2N49A 3GV6A 2BA0A 2LY7A 4HIKA 1QNKA 2RA4A 4LFCQ 4LNQA 3D4RA 1J5EL 1HUMA 2V4DA 4HAEA 4ODGA 4DV3Q 4HCSA 1EWHA 3GP7A 4K6DA 5C44B 4DR3L 4DUZL 2GVAA 4HIDA 1B1ZA 3HOWB 1DGSA 2EY2A 5DNFA 1KL9A 1IBML 4LF5Q 4UDUC 3KK7A 4FXGC 2WKCA 2Z6KA 2H1EA 1HZCA 2D62A 3OPOA 2BCOA 3UI2A 2NTTA 1HFNA 3PF5A 4JVZA 2G5DA 2UXBL 3KUPA 2HUGA 4LF8L 3A7AB 4A3GH 3VA5A 1D2BA 2MPMA 4L5TA 5C4JB 2LS01 3KF6B 2L1BA 1VQNA 3K57A 3J81L 1OXUA 4IUPA 4BY7H 2VUMB 4X3SA 1TY0A 1EY7A 3MXUA 5D65A 4NXNQ 3SK5A 2KCNA 5JPNC 1I3QH 1S5DD 2AWOA 2EVBA 2F3IA 1TQOA 3CU7A 2F0LA 4DAMA 3HOVH 1X9NA 2VQEL 4KY7A 4KKUA 1TWAH 3DWPA 1OXSC 1PYSB 2I5MX 3QR8A 3H91A 1ZYRD 2QKIC 3NPPA 4F87A 1KIXA 2RQXA 2CQOA 1EYDA 1FGBD 3CCEA 1FJGQ 5C3WA 1S72A 3RMHA 4CDDC 2B29A 3QIAA 2MHVA 4C3JB 4ID6A 2Q8RE 5GADC 1OXVA 3HOXH 4B3MQ 1JOQA 1O7ZA 2XIWA 5FJ8H 1DCZA 1XTDA 4DUYL 4JYAL 3BVZA 4RH6A 4ZAIA 4DV6L 4KY6A 4QUFA 1X3QA 2F4IA 3ULJA 1E24A 4XT3B 1SYDA 4N9PA 4GN4B 4R8IA 4H0LC 1WTQA 5DEHA 4KV6A 5JVG3 2IW3A 1F2LA 4G7OC 2B2UC 5TSSA 2B3GA 4FDBA 5D3IB 3L2PA 1ZEQX 2WKDA 4HJ7A 1QCBD 2FJ2A 4JG2A 2SEBD 4NXML 1Z7TA 2EPBA 5EQ0A 2I5HA 3TSSA 3MXPA 4N8X1 4DA2A 2JA7H 3DLLA 1RODA 5GAHC 2B2TA 2A6ED 3SHLA 4JI3L 2CVRA 5DM73 3PIO3 2F1MA 1BCPF 2F0NA 1TWGB 3QWNA 1B44D 1I50B 1CSQA 4FXDA 1E0BA 4DF7A 4DV0L 1JWSD 3U9OA 2KEEA 4DV4L 3PIP3 2VNUD 3C1FA 2ASBA 4ZKBB 2IPKD 3H3VC 5FLMH 4YY3L 1HA6A 1NR2A 1D7QA 3UE1A 2R3ZA 5AJ3Q 5IGFA 2PZUA 2VB3X 4WORA 2NVXH 3KLSX 2UUBQ 1JOKA 4K8JA 4RHSA 4CJ1B 2L15A 1NNXA 2OQ0A 1K8MA 4BA1I 2WINB 2KCMA 1K8AC 3HOYG 1D5ZC 1X32A 4MNOA 2X6GA 3ERQA 1Y8OB 2F0PA 1FR3A 3ITPA 4CGYB 3AQQA 5FK9C
chains in the Genus database with same CATH topology
5KYIA 1HCZA 4X3TA 4JK1C 1MGSA 2XWJB 1KTKA 4H44C 4J8QA 1SYEA 1JB3A 1BDOA 1S5BD 1SNMA 3RZOB 5C3XA 5EJWA 4RCNA 4I65A 1XTCD 1PTOC 3HKZB 5FLXE 1B9MA 3GTOB 2WACA 1V1PB 2D2CC 3PUYA 2LKVA 5KIXA 1WD0A 2K5DA 3PMFA 1STHA 2JEAI 2JEBI 3J7AF 4U68A 4R8NA 1STGA 3H6MA 3WDNA 4ZKCB 1V1OA 5IGGA 5I6YA 3GTJB 2K28A 1AZPA 4PMBA 2SNMA 1F2MA 3DHQA 4CKEA 4BY1B 1EY8A 3FPPA 3NQTA 2F0TA 3QG1A 2F0IA 2WP8J 4FXKC 1EIGA 1F9SA 1HTLD 2BE5C 5J1ZA 4O1NA 3G6JB 1H9SA 3I4LA 4PMCA 4K5VA 1J8IA 5IT9E 1SMYC 3OOCA 4LMQD 2E2HB 3S1RB 1IL8A 1WTPA 2N55A 1FD7D 3KLRA 3LX0A 3R93A 2B2UA 3EQLC 5CV6A 3EA6A 1XWEA 2HCIA 1SYFA 1B50A 4CBVA 1TWAB 1KLGD 3DEOA 2EJMA 2WAQB 3FVQA 3K5OA 2KECA 2DN8A 4PQXA 2AQ1B 4PV1C 2NB0A 3GD7A 3K5LA 3TZDA 1GUNA 1E2WA 3IKJA 3SR1A 2F0FA 5CBEE 3FEWX 1AP0A 5LL6X 5EPJA 2F3WA 3J80L 4LJZC 4DAPA 1R4QB 1RTOA 3X3MA 3S9WA 1S5CD 1IHZA 4XQJA 4ZYSA 3H0GB 2F0JA 2B8GA 3IL8A 1RKNA 5ELEA 2O5IC 3CRKC 2N88A 3D6WA 5COYA 1GUTA 1J9OA 2L12A 2B63B 1R4PB 1SNOA 1TY2A 2KHSA 5JAVA 2XRSD 3ND9A 2BDNA 3TP6A 1YNJD 4XXEA 4QUCA 3KLSA 1IKLA 1CHQD 4J1MA 2JA6B 2R6GA 3T16A 1HUNA 3HP3A 1LT3D 4NW2A 1B3AA 1EYAA 2EY6A 3S2HB 1EZ6A 5I9PA 1I4QA 1D5XC 2H4OA 3KBGA 1C8CA 1RJTA 2FHTA 1U4RA 2A69D 2KJXA 2CW0D 1PRTC 2O2LD 3M7NA 3O13A 2QEJC 2OEOA 3WOFA 4IURA 5KNDA 2L0CA 5K5PA 5IIFA 4A93B 5DAUA 3NSWA 2DY8A 2EYOA 5EGTA 3OHXC 3FDTA 1TR5A 2L4NA 1LO5D 1LTID 1T5XD 4L6TB 1V43A 3MFYA 1BF4A 1M8AA 2F0DA 3URYA 2A68C 4TQUS 2FMMA 5JPMC 2F3VA 5E4XA 1SSOA 4XQNA 1KNEA 3NWSA 1HFGA 3N6RA 4XYOA 1PTOF 4LAAA 2MGSA 1AEXA 2ENBA 3MXNA 4DN4M 4DXGA 2NYZD 5A2QL 4A3FB 3A8KE 2RDHA 1BOSA 4OIKA 3EROA 1PRTB 1H9RA 2A6HC 3QOJA 1WTWA 1TWHB 2PW7A 3NXWA 2MJ8A 3C3LA 4P2CB 3RD4A 4ZRZA 3H09A 4ILWA 2Y0SB 4C1NI 1CA5A 3A8JE 3PUVA 4DAYA 5DM63 1MBYA 2XSCA 3H94A 2SOBA 1BBXC 5IOCA 3K5NA 1BO0A 1A3UA 4HSPA 2K05A 2PW5A 1PFMA 1AFPA 4DFAA 1E2VA 3I4NB 4C2MB 3V2TA 4TSSA 4HMJA 3OMGA 3R2TA 1RD9D 5CBAE 1ENCA 4O42A 1ENFA 2F0GA 1CA6A 2NVTB 1SBBB 2DY7A 2XRQD 3S15B 2E2DC 1A6XA 2EYLA 3K59A 2JYOA 3S17B 1FNUA 2WV6D 2RBMA 1OXTA 3PO2B 1KABA 3BVMA 4DK0A 1YNNC 1JORA 2QILA 2HCCA 2AQ2B 3NBHA 2L9HA 3MFGA 1Y8PB 2LMCB 2IWHA 3M85A 1SE2A 2B2VA 2Z4HA 4KJNA 4OL7A 3TBIB 1SE3A 4ABNA 5KNCA 4MHEA 5BN5A 2F0SA 4QB4A 3GO5A 5HURA 1WTXA 1PFNA 5BN3A 5EKLA 2KCCA 5KEEA 1JWUD 4C3IG 2NVYB 2KUMA 3A56A 2L11A 1CQVA 1G291 1STAA 4V0BA 4IQZA 1SEBD 1TWCB 3J81E 5I9OA 2PPBC 2KEDA 1MSGA 5A35A 2A73B 2EOTA 1EY9A 2BA1A 2ICEC 1PTOH 2D5DA 3NBIA 1L0XB 4ULLA 3MVVA 1UAPA 1LT4D 3T13A 4KKTA 1A2TA 4FO2A 3I91A 3GTMB 1R9TB 1LACA 1VF7A 5T1GA 1KNAA 1WTRA 3GV3A 4KJOA 1D5MC 3S2DB 1B2TA 1Q1BA 2ID0A 1WVLA 1G2TA 3A8IE 4DAVA 1BCPD 3CRLC 4QMGA 5ELBA 2ZXOA 3LWUA 3S14B 1GXDC 2AUKA 1PRTF 4K8IA 4CJ2C 1Q1EA 2F0OA 1SNDA 2K5WA 1LT6D 5M9OA 1RCVD 2F0VA 1ILPA 1D1KA 2PZWA 1EOTA 1O78A 3OIPA 1TS5A 2JP1A 2B2YA 4EQNA 3CQZB 4R9WA 4KI0A 1O7YA 2O5JC 1VMCA 3X3NA 1EY0A 3QO2A 1C48A 5ELFA 1O80A 2Q8IB 4DU9A 3HOYB 1CZGA 4HTHA 3MAQA 3I90A 1F9RA 1A3VA 3RZDB 3P1HA 3I4MB 5J39A 1ONLA 2EYHA 2RDFA 5CR3A 1JE4A 2SNSA 2K7VA 3K58A 1ZKOA 2NUCA 2EJGC 4A3MB 2K32A 4HEDA 1SNQA 2F0UA 1Y1WB 3VA7A 2JA8B 3NUCA 3TDQA 1TS3A 1DOMA 3J7AV 4A3JB 2YYZA 2JA5B 2G9DA 1DZ1A 1ICWA 2KQ3A 4N9TA 2DNEA 2R92B 3C2PA 1G6ZA 5BN4A 4F8MA 1FNWA 2EDGA 3MXGA 3NHHA 2M9VA 2JXMB 1HTPA 1H9JA 4K5XA 1QWYA 3HRZC 1TS2A 1DOKA 1EEID 3TP8A 1EEFD 5C0XJ 2HQEA 3OMCA 3TMEA 4IUNA 4KKSA 1NSNS 1DM0B 3Q22A 3E5SA 2M00A 4CJ0B 3VR6A 1LT5D 5C6AA 2AQ3B 3DUZA 4YIJA 2ZXRA 1QILA 3E6ZX 4L8JA 1U4MA 2RSNA 4ZLTF 4A3GB 4FF2A 5FO7B 5C0XH 3DMUA 4KN7C 4BY7B 4KN4C 5CV7A 1ENAA 4F88A 1I3QB 1U4PA 1ZXTA 3HOVB 4IUVA 2QF7A 1PZJD 3OW7A 4HMIA 1CK1A 3GTKB 1V1PA 2L5TA 1JR0D 1HQMC 1IW7C 5EPKA 2WIIB 4FF3A 1SE4A 1CQFA 3A55A 4RAUC 1UNSA 1UUPA 3HOXB 2E74C 2E75C 1JCKB 1M4VA 5IODA 1U9RA 1GHJA 3T51B 1TKWB 1S4ZA 1Q3LA 3F2UA 2ICIA 4QCLA 4PMWA 5IGBA 1GUGA 2F0QA 2DNCA 2Z4IA 1F2ZA 3HOZB 3J80E 2B8FA 4LK1C 1B4OA 1KDCA 3EJIA 2WB1B 1LTBD 2JA7B 4OHJA 1EWCA 4RWSC 4HR7B 1V8QA 3V05A 4PNYA 1CHPD 2EY5A 1IYUA 2IJ0A 5FOBB 5J22A 4RGTA 1VF5C 4NP5A 3NWTA 3NTIA 5EKKA 4J6HA 4HCEA 4C3HG 2NVXB 1NUCA 2K1BA 1I4XA 1HHVA 4IUQA 4G7ZC 4G4KA 2VB2X 1SXTA 4RGMA 3VYRA 2RDGA 2C5CA 3QOLA 3SXHA 5CGKA 4ZUJA 1HRJA 4KD4A 1LLRD 2A74C 2EXZA 1ZYRC 1EFID 3PUXA 4A3BB 4WRDA 3I8ZA 5LHY1 3QB3A 2CHBD 4HSVA 3SVMA 1DXMA 1DOLA 4JBWA 1AN8A 1SJHD 1DD2A 4OIJA 2C9OA 4G7HC 1F9QA 3WOEA 1GUSA 1CT1D 3MHBA 2X6LA 3NK9A 3M4YA 5K36H 2SDFA 3JAME 1PTOD 4RKLA 1JC7A 2NN6G 1TS4A 5F2DA 2EYJA 2K01A 4I7ZC 4G57A 1WTVA 2OF1A 3I73A 4DK1A 2XN9C 1OO9B 1SYBA 2A6EC 5FO9B 4GZYC 3SK8A 3PUZA 1I4GA 2TMPA 3R2IA 2XWBB 3C1EA 1CTMA 4CKCA 4NDXA 1G91A 5JEAJ 1JOOA 1C4QA 1VDZA 2K33A 4OO1H 3D3RA 5IGCA 4XDXA 1VMPA 4KK7A 5C0XG 4K5WA 2BE5D 5C3EB 5C5LA 2K03A 2E2JB 3D8GA 2EYPA 3HGBA 2VXWA 1SMYD 3NQIA 3M7GA 2EJFC 1MSHA 4ZK9B 1RHPA 1MD2D 1BUVT 3BS1A 1Q12A 4IZ8A 1BCPB 2KA7A 1LTSD 3T53B 3NE5B 3R8BA 3R3OA 5M5XB 1SDFA 3N52A 5CV8A 3I72A 1T5EA 4RKBA 1KDBA 3QJYA 2J0TD 2PNRC 5CC4A 1SYGA 3IAYA 2EE1A 3NTHA 4WJWA 3D4DA 5FKAC 5AFWA 1I6HB 4EQOA 5CMDA 4ZQ3A 4MIUA 4L63B 3NTKA 1IKMA 4B9WA 4RHRA 4Q5VA 3HG9A 1LTTD 4IFDJ 5C4ZA 2RKSA 1KAAA 5KNBA 5M5YB 1FYCA 3CHBD 3MA2B 3MWYW 4DNRB 2NWGA 5G3LF 3M4OB 3MC0B 1QB5D 3M3YB 1JQYD 2TSSA 1X3PA 1WCMB 1EQVA 4KY5A 2AWNA 4C3IB 1OXXK 2X69A 3TZUA 3TN2A 2NN6I 4IFDH 3Q6SA 1FNVA 1JWMD 2IX3A 4QF4A 2L55A 2CQAA 3K6OA 4DXFA 2K5QA 1EIHA 3S16B 3P75A 1D6EC 4FP5D 3VYSA 3V96A 1EZ8A 2Z8LA 3VR5A 1EY5A 3MZ5A 4C56C 2OXPA 3FPUB 4X3UA 5I6WA 1Z6HA 2RSOA 5C0XI 5EPLA 1TT2A 1PRTD 4BBRB 3W2DA 4V190 1B9NA 1EY6A 3Q24A 5K36G 4C3JG 3BVGA 3K7AB 2G9HD 3GTLB 2EYFA 3OIQA 4K2KA 2PCFB 1EL0A 5I2YA 1Q8IA 3AU7A 1RF2D 2B2WC 1VCIA 2PYKA 4ZUIA 1TWFB 5D14A 1LABA 3CKIB 3D31A 1LTAD 1AW7A 1WTOA 3U9SA 2QCPX 2F0HA 5JOBA 2A68D 4TRDA 2MP1A 1PDQA 1SNPA 1YNJC 3A54A 4F7XA 3D4WA 3OWFA 2PQEA 3SK4A 4OO1G 3BDLA 5E3FA 3VYUA 4BA2I 4M8AA 2JSOA 4RFBA 1CM9A 2RVLA 1MI2A 5C4XB 5EBDA 1SYCA 2YU9B 4A3KB 1XX8A 2A6HD 5EKIA 4QIWB 1IYVA 2A69C 1H9SB 2CW0C 5JEAG 3C46A 2XVSA 3L3OC 1Y69U 3Q0AA 2Z1CA 1DJRD 4HN7A 5CV4A 1G8ZD 3BZDB 4XYQA 3D6CA 4Q0FA 4IUUA 3BYTB 3IFDA 3NP8A 1QG7A 5FLXL 3HOUB 4U673 3HS0C 5M5WB 1LTGD 1B53A 2NN6H 5FO8B 4H13C 2IL8A 4RGNA 1L0YB 4XQQA 4M1UB 2QDBA 1GHKA 3TP5A 2D9UA 1CI3M 1GUOA 2IX1A 3L7ZC 4A3DB 2E2IB 5E4WC 2I46A 3RUZA 2F0WA 5M3MB 1Q90A 1HQRD 2XNAC 3K0YA 1QOHA 1YNND 4UAIA 1W6JA 1RTNA 3SK6A 2M2LA 3MEHA 3L9AX 1DYQA 5CV5A 4IFDG 1ET9A 4A3IB 1BQQT 3G7LA 4AYBB 1TIID 3ONAB 4A3EB 3HZXA 1A3TA 2JE6I 4H7BA 5IT9L 1HA5A 2FINB 4NMZA 4E6IA 3J7YW 1GJXA 2IT1A 1EU4A 4KHVA 2B2WA 3GTGB 2BOSA 1PTOB 1EY4A 3GTQB 1HXYD 3DEPA 4EQPA 1F9PA 2KOLA 1PZID 3BDOA 1SFOB 2J4XA 2K6AA 2PMZB 2OT2A 1PFBA 4S3SA 1ESFA 4OO1I 5JJZA 5KYLA 1QNUA 5I2XA 2FMCA 3A7LA 1K83B 3KF8A 3DWQA 2K04A 1H9MA 2HDMA 2IX0A 1SJED 3T56B 1XXGA 4K6LA 3DWAA 3OWEB 3PUWA 1UEAB 4XTCS 4NKLA 3S1NB 3DM1A 5M3FB 1LV9A 1E2ZA 1PMRA 5C5MA 1TVXA 4KHZA 5EBCA 4OGQC 1STYA 3ND8A 2FFKB 5NUCA 1PXUA 1Y1VB 2ZXPA 4BBSB 4IALA 1STBA 1HPCA 2KVMA 1EQTA 2A5HA 2F03A 4Z9CB 3SDZA 5ELCA 2NZ1D 1TU2B 4X3KA 3Q23A 4C3HB 3SE0A 3VR2A 1GUWA 5IGDA 1NR4A 4C1NK 1ET6A 4KTAA 4ME5A 2E76C 1S5ED 1II3A 2ZT9C 2EY1A 4TKOB 3P7JA 2Q8TA 1PZKD 1AZQA 1EU3A 1SAPA 5ELDA 4BWGB 1A2UA 1O7LA 3GQBA 3I70A 3TP7A 3S1QB 3PO3B 1QE6A 4MN3A 4RGOS 5T1IA 4CKBA 3VYTA 1ILQA 1LTRD 2F0MA 1S5FD 3RLFA 2B39A 2EZVA 4IFDI 2J7ZA 4B9XA 2GA4B 1BNZA 2B2VC 4FYDA 2R7ZB 1F77A 3HEJA 1H9KA 2R61A 3LNNA 3K5MA 3KBXA 4EGVA 1NAPA 4XT1B 1BCPC 3BDCA 3IFTA 3T4AC 3FMCA 3I3CA 2NVQB 5E1FA 3E0JA 1BR9A 4FF1A 1A15A 5KRUA 3JAML 1SNCA 1NCVA 1CFMA 2F0EA 4KMUC 4RA8A 1ML0D 4WFN3 2R93B 1Y8NB 1CZWA 4K2LA 5LL6S 5CV9A 5HGTA 3SEBA 5KGUA 4EVOA 3FKIB 5A2QE 1KLUD 4FF4A 4RCOA 4KD3A 5ISRA 3EVQA 3PV0A 2I07B 4IN3A 2LFNA 2NTSA 3AB9A 2PZTA 1I4PA 3VR4A 1ESRA 1RDPD 1XYIA 5CYUA 5I4DA 4K14A 4FNFA 4BS9A 1F2YA 2MUYA 5JEAH 4Y7NB 3S1MB 1Z47A 1I4RA 3DXJC 3LWEA 2BDOA 1BXTA 3BG3A 1PLFA 1K8OA 1D1IA 5CORA 3GTPB 1G2SA 3AMUA 3VR3A 2PO4A 3ZYYX 3FRPB 2B2TC 2HDLA 3W3AA 1I6VC 1KDAA 4DGZA 2AUJD 3EFXD 4FVMA 4XIGS 1IW7D 1U4LA 4DNTB 1STNA 2NBFA 2B2YC 5JVH3 4IUTA 1DONA 1PYWD 1GOZA 5G3LD 1EYCA 1JICA 4CHTB 3MTSA 3BYYB 1I4HA 4B08A 2F0KA 1WD1A 5C4HA 1QJOA 2EYMA 3P20A 2O4XA 3OSOA 5IGEA 1STEA 1W6KA 5D3DA 3GV6A 2BA0A 2LY7A 1QNKA 2RA4A 3D4RA 1HUMA 2V4DA 4HAEA 4ODGA 4HCSA 1EWHA 3GP7A 4K6DA 5C44B 1B1ZA 3HOWB 2EY2A 5DNFA 4UDUC 3KK7A 4FXGC 2WKCA 2H1EA 2D62A 3OPOA 2BCOA 3UI2A 2NTTA 1HFNA 3KUPA 2HUGA 3A7AB 3VA5A 1D2BA 2MPMA 5C4JB 2LS01 2L1BA 3K57A 3J81L 1OXUA 4IUPA 2VUMB 4X3SA 1TY0A 1EY7A 3MXUA 5D65A 3SK5A 2KCNA 5JPNC 1S5DD 2AWOA 2EVBA 1TQOA 3CU7A 2F0LA 4KY7A 4KKUA 3DWPA 1OXSC 3H91A 1ZYRD 2QKIC 3NPPA 4F87A 2RQXA 1EYDA 1FGBD 5C3WA 3RMHA 3QIAA 2MHVA 4C3JB 4ID6A 2Q8RE 1OXVA 1JOQA 1O7ZA 2XIWA 1DCZA 3BVZA 4RH6A 4ZAIA 4KY6A 4QUFA 1X3QA 2F4IA 4XT3B 1SYDA 4N9PA 4R8IA 4H0LC 1WTQA 5DEHA 4KV6A 5JVG3 2IW3A 1F2LA 4G7OC 2B2UC 5TSSA 5D3IB 1ZEQX 2WKDA 1QCBD 2FJ2A 2SEBD 1Z7TA 2EPBA 5EQ0A 3TSSA 3MXPA 4DA2A 1RODA 2B2TA 2A6ED 3SHLA 3PIO3 2CVRA 5DM73 2F1MA 1BCPF 2F0NA 1TWGB 3QWNA 1B44D 1I50B 4FXDA 1E0BA 4DF7A 1JWSD 3U9OA 2KEEA 3PIP3 2VNUD 3C1FA 4ZKBB 2IPKD 3H3VC 1HA6A 1NR2A 2R3ZA 5IGFA 2PZUA 2VB3X 4WORA 3KLSX 1JOKA 4K8JA 4RHSA 4CJ1B 1K8MA 4BA1I 2WINB 1D5ZC 1X32A 2X6GA 3ERQA 1Y8OB 2F0PA 1FR3A 3ITPA 4CGYB 5FK9C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P2C B;  1CQF A;  1R4P B;  4M1U B;  1CZW A;  1QOH A;  1R4Q B;  1C48 A;  2C5C A;  1D1K A;  4ULL A;  1QNU A;  1DM0 B;  1BOS A;  1D1I A;  2XSC A;  1CZG A;  2BOS A;  3MXG A;  2GA4 B;  1C4Q A; 
#chains in the Genus database with same CATH topology
 5KYI A;  4MZ9 A;  3I4M G;  1HCZ A;  4X3T A;  4JK1 C;  5GAG C;  1HNX L;  1MGS A;  2XWJ B;  1KTK A;  4H44 C;  3LGJ A;  4IOA A;  4J8Q A;  1SYE A;  4A3B H;  1CKN A;  1JB3 A;  1BDO A;  2K4K A;  1S5B D;  1NMF A;  1SNM A;  3RZO B;  5C3X A;  3UE0 A;  3UDG A;  2GVB A;  4DKA C;  5EJW A;  4RCN A;  2JA8 G;  2I0Q A;  4I65 A;  1XTC D;  3K0X A;  5J3B A;  3CC4 A;  1PTO C;  3HKZ B;  5FLX E;  1B9M A;  2QGQ A;  3GTO B;  2WAC A;  1V1P B;  2D2C C;  4GOP A;  4JI8 L;  3PUY A;  4A3J G;  2LKV A;  2YTV A;  3A74 A;  2JA5 G;  5KIX A;  1WD0 A;  2K5D A;  3PMF A;  1STH A;  4N8F A;  1VQB A;  2JEA I;  2Q2T A;  2JEB I;  2Z6B A;  3J7A F;  3HOU G;  4U68 A;  4R8N A;  1STG A;  1UE1 A;  3OW2 A;  3H6M A;  1KXL A;  3WDN A;  1MHW C;  4POG A;  4ZKC B;  5IWA L;  3KFU A;  1VQJ A;  1V1O A;  1EIF A;  5IGG A;  1JMC A;  5I6Y A;  3GTJ B;  2K28 A;  1AZP A;  2CH4 W;  4PMB A;  1FVI A;  1NTG A;  3WWV A;  2SNM A;  4IOC A;  1F2M A;  1EIY B;  3DHQ A;  3T1Y Q;  1HR0 Q;  4CKE A;  4BY1 B;  3CW2 C;  1EY8 A;  3FPP A;  3NQT A;  2F0T A;  1MKH A;  1AE3 A;  3UDX A;  3QG1 A;  2F0I A;  1G51 A;  2WP8 J;  4FXK C;  1EIG A;  1F9S A;  1HTL D;  2BE5 C;  5J1Z A;  1XNQ Q;  4O1N A;  4YCV A;  3G6J B;  4UPA A;  1H9S A;  3I4L A;  4PMC A;  2OQK A;  4K5V A;  4X66 Q;  2ZM6 L;  1J8I A;  4PZ7 A;  5IT9 E;  1SMY C;  4A3G G;  3OOC A;  4LMQ D;  2E2H B;  3CPW A;  3S1R B;  2HHH L;  1IL8 A;  1WTP A;  1VQI A;  4BY7 G;  5C3E H;  2N55 A;  3U4Z A;  1FD7 D;  4A3E G;  3KLR A;  3LX0 A;  3R93 A;  2E2J H;  2Z0S A;  2OWO A;  2KBN A;  1A0I A;  2B2U A;  3EQL C;  5CV6 A;  3EA6 A;  1XWE A;  3SGI A;  3HOV G;  2HCI A;  1SYF A;  1B50 A;  4CBV A;  1TWA B;  5BR8 L;  1KLG D;  3DEO A;  1ASY A;  2EJM A;  2WAQ B;  3FVQ A;  4B3T Q;  3K5O A;  2KEC A;  3GDE A;  3JC6 6;  2DN8 A;  3I4N H;  4PQX A;  4DV7 Q;  2AQ1 B;  1HJP A;  4PV1 C;  5M5X H;  2NB0 A;  1YHB A;  2PQA B;  3GD7 A;  1KD1 C;  3I7F A;  4YHH L;  1Q7Y C;  4YWL A;  3K5L A;  4LFA L;  1OTC A;  3TZD A;  1GUN A;  1E2W A;  3IKJ A;  2DJG C;  3SR1 A;  2F0F A;  5CBE E;  1I6H H;  3FEW X;  3A5Z B;  2JJQ A;  1AP0 A;  4JI1 Q;  5LL6 X;  2R7D A;  5EPJ A;  4HIO A;  2F3W A;  3J80 L;  4LJZ C;  1VQG A;  2N8N A;  3U4V A;  4DAP A;  1R4Q B;  1RTO A;  3X3M A;  3HOZ G;  4R4I A;  3S9W A;  2Z9H A;  1GM5 A;  1S5C D;  4L5Q A;  1IHZ A;  4XQJ A;  2WB1 G;  1I94 Q;  4ZYS A;  3H0G B;  2F0J A;  2JA7 G;  2K75 A;  2BH2 A;  1BBW A;  2B8G A;  3IL8 A;  1XPO A;  4GKJ L;  1RKN A;  5ELE A;  2O5I C;  3B6Y A;  3CRK C;  2N88 A;  4POF A;  3D6W A;  5COY A;  3M4O H;  1GUT A;  1IL2 A;  1J9O A;  2L12 A;  2B63 B;  1R4P B;  1Y14 B;  2ZJP A;  1SNO A;  3M3Y H;  1TY2 A;  2KHS A;  4YWM A;  5JAV A;  1WCM H;  2XRS D;  4AYB E;  3ND9 A;  2BDN A;  3TP6 A;  4AH6 A;  1YNJ D;  2UXC Q;  4GN3 B;  4XXE A;  4C3I H;  4QUC A;  4X64 Q;  3KLS A;  2HT1 A;  1IKL A;  4OX9 Q;  1CHQ D;  4J1M A;  3F2B A;  4OEM B;  4UY8 C;  2JA6 B;  3KYH C;  4DPG A;  2R6G A;  3T16 A;  2IY5 B;  4B3S L;  1IYJ B;  1HUN A;  3HP3 A;  2RCF A;  1LT3 D;  4NW2 A;  1B3A A;  1EYA A;  2EY6 A;  3S2H B;  1EZ6 A;  5I9P A;  1QUQ A;  2KCT A;  1I4Q A;  5LMN W;  1D5X C;  2H4O A;  3KBG A;  1C8C A;  2PMZ E;  1RJT A;  2FHT A;  1U4R A;  2A69 D;  3E3X A;  2KJX A;  3ICE A;  2CW0 D;  1PRT C;  2O2L D;  4A3B G;  3M7N A;  2K5V A;  1PFS A;  3O13 A;  2QEJ C;  2OEO A;  4JI2 L;  3WOF A;  4IUR A;  3H15 A;  5KND A;  2L0C A;  5K5P A;  5IIF A;  4A93 B;  5DAU A;  4GNX A;  3NSW A;  1PVO A;  2DY8 A;  1SN8 A;  2EYO A;  2R7Z G;  1PH4 A;  1YZ6 A;  2HD3 A;  3U58 A;  3J81 j;  5EGT A;  3OHX C;  3FDT A;  1TR5 A;  2L4N A;  1NY4 A;  2ZTE A;  1LO5 D;  1LTI D;  1T5X D;  3K7A H;  4L6T B;  1V43 A;  3GTL H;  3MFY A;  1BF4 A;  1M8A A;  3CD6 A;  2F0D A;  3URY A;  2A68 C;  1XMQ L;  4TQU S;  2FMM A;  4QGU A;  5JPM C;  1YBY A;  2F3V A;  4YCU A;  5E4X A;  1SSO A;  1U0L A;  4XQN A;  2K14 A;  1KNE A;  3NWS A;  3NEL A;  5IP7 G;  1HFG A;  2D0P A;  3N6R A;  4XYO A;  1PTO F;  4LAA A;  2AKW B;  2R93 G;  2MGS A;  1N36 Q;  3KJP A;  1AEX A;  2ENB A;  3MXN A;  4DN4 M;  4DXG A;  2NYZ D;  5A2Q L;  4A3F B;  3I55 A;  3A8K E;  2RDH A;  1BOS A;  3F2C A;  2IHE A;  4OIK A;  5FLX c;  3ERO A;  4JI6 Q;  3RR5 A;  1PRT B;  1XPU A;  1H9R A;  2LSS A;  2A6H C;  3QOJ A;  1WTW A;  1TWH B;  2ZM6 Q;  4JI5 Q;  2PW7 A;  3NXW A;  2MJ8 A;  3C3L A;  4P2C B;  3RD4 A;  4ZRZ A;  1WI5 A;  3H09 A;  4ILW A;  2Y0S B;  4C1N I;  1N34 L;  1CA5 A;  3A8J E;  3BZC A;  5C4X H;  4A3L G;  3RZD H;  5C3E G;  3PUV A;  4DAY A;  1H95 A;  5DM6 3;  2UXD Q;  1MBY A;  2XSC A;  3E0E A;  2SOB A;  3H94 A;  2YU9 H;  3I4M H;  4A3K H;  1BBX C;  5IOC A;  1I5F A;  1VS0 A;  3K5N A;  4WJ3 M;  4HJA A;  1BO0 A;  1A3U A;  4HSP A;  2K05 A;  2PW5 A;  1KRS A;  1PFM A;  4JBJ A;  2VQF Q;  2UU9 Q;  4QQB X;  1AFP A;  1VQ8 A;  4DFA A;  1E2V A;  1B8A A;  1YIJ A;  4K0K Q;  2H5X A;  3M9B A;  1LUZ A;  1NBW A;  4HIM A;  3I4N B;  4C2M B;  3V2T A;  4DR1 Q;  4TSS A;  5HGQ A;  4HMJ A;  4B3R Q;  3OMG A;  3R2T A;  1RD9 D;  1IBL Q;  5CBA E;  1ENC A;  4DR6 L;  4LFA Q;  2VW9 A;  2UUA L;  3BJU A;  4O42 A;  1ENF A;  3JAM i;  1VQ7 A;  5IT9 c;  2F0G A;  3HOU H;  1CA6 A;  5M5W H;  1HNW L;  4QY7 A;  2NVT B;  1SBB B;  2DY7 A;  2XRQ D;  3S15 B;  2E2D C;  1A6X A;  2EYL A;  3K59 A;  2JYO A;  5L37 A;  3S17 B;  4JI0 L;  1FNU A;  4R4O A;  2WV6 D;  1A8V A;  2GN5 A;  3M4Q A;  2RBM A;  1OXT A;  3PO2 B;  2K5H A;  1KAB A;  4AQY L;  1X6O A;  1MJE A;  1N8R C;  3BVM A;  4DK0 A;  1YNN C;  3CME A;  4DNI A;  4A4I A;  1JOR A;  2QIL A;  2HCC A;  2AQ2 B;  3NBH A;  2E2I H;  2L9H A;  4A3D H;  2KHI A;  3MFG A;  1Y8P B;  2LMC B;  3H3V H;  2IWH A;  3M85 A;  4DV2 Q;  1SE2 A;  2B2V A;  2Z4H A;  4HJ5 A;  4KJN A;  5M3M H;  1IZ6 A;  4OL7 A;  2UUC L;  3TBI B;  1SE3 A;  4LF7 Q;  4ABN A;  5KNC A;  2BH8 A;  1RL2 A;  4MHE A;  5BN5 A;  2F0S A;  1PH3 A;  4QB4 A;  4JBM A;  3GO5 A;  5HUR A;  4ALP A;  1WTX A;  1WCM G;  1PFN A;  5BN3 A;  5EKL A;  2F4V L;  2KCC A;  5KEE A;  2MFI A;  1JWU D;  4C3I G;  5C44 G;  2NVY B;  2KUM A;  5LMU Q;  3A56 A;  2L11 A;  1CQV A;  4A3I H;  1G29 1;  1STA A;  4JC0 A;  4V0B A;  4A3E H;  4IQZ A;  1FGU A;  1SEB D;  1TWC B;  3J81 E;  5I9O A;  4KHP Q;  2PPB C;  2KED A;  1MSG A;  5A35 A;  4GKK Q;  3CC7 A;  2A73 B;  2EOT A;  3CF5 A;  1EY9 A;  3GTG H;  3GTK H;  2BA1 A;  2ICE C;  1PTO H;  3GTQ H;  2D5D A;  3NBI A;  1L0X B;  4ULL A;  3MVV A;  1UAP A;  1LT4 D;  3T13 A;  4KKT A;  4BXX H;  1SFO H;  1CSP A;  2MO1 A;  1A2T A;  4FO2 A;  3I91 A;  3GTM B;  1R9T B;  1SR3 A;  1LAC A;  2ZJQ A;  3U50 C;  1VF7 A;  1VQF A;  5T1G A;  3AFP A;  2K52 A;  3E9I A;  5GRO A;  1KNA A;  2NZH A;  1WTR A;  3KOJ A;  3RN2 A;  1P8L A;  1UE7 A;  1K83 H;  3GV3 A;  1TXY A;  4KJO A;  1EWI A;  1N32 L;  1D5M C;  4BBR G;  1PH7 A;  4YCW A;  1VQO A;  3S2D B;  1B2T A;  1Q1B A;  1K8G A;  2ID0 A;  1WVL A;  1AE2 A;  1G2T A;  3A8I E;  1E7Z A;  4DAV A;  1BCP D;  3CRL C;  4QMG A;  5M3F H;  5ELB A;  3S1N H;  2ZXO A;  3LWU A;  4ZCK A;  3S14 B;  2D0O A;  2QA4 A;  4JI7 Q;  1GXD C;  3HOZ H;  2AUK A;  1PRT F;  4K8I A;  3T1H L;  4CJ2 C;  1Q1E A;  2F0O A;  1LM0 A;  1SND A;  2K5W A;  1LT6 D;  5M9O A;  1RCV D;  2F0V A;  1ILP A;  1JJ2 A;  1D1K A;  2PZW A;  1Y1V H;  4BBS H;  2Q2H A;  5HY6 A;  1EOT A;  5JJK A;  1O78 A;  4DV5 Q;  3OIP A;  3KF6 A;  1TS5 A;  3F1Z A;  2JP1 A;  4DR5 Q;  4ME3 A;  1BKB A;  3FP9 A;  2B2Y A;  4EQN A;  4DR7 L;  3CQZ B;  4R9W A;  4KI0 A;  1O7Y A;  1L1O C;  2O5J C;  1VMC A;  4C3H H;  3X3N A;  4H02 A;  4MTK A;  1EY0 A;  3QO2 A;  1C48 A;  5ELF A;  1O80 A;  4UP9 A;  2Q8I B;  3J81 i;  4DU9 A;  3CMA A;  3HOY B;  1CZG A;  4HTH A;  3MAQ A;  5IYC G;  3TS0 A;  4LF6 Q;  3I90 A;  1F9R A;  3K81 C;  3JAM c;  1A3V A;  3RZD B;  5C4X G;  3P1H A;  5LMN L;  3I4M B;  5J39 A;  1ONL A;  4LFB Q;  4A3K G;  2EYH A;  2RDF A;  3OTO L;  4O0A A;  5CR3 A;  1JE4 A;  2SNS A;  2K7V A;  3K58 A;  1ZKO A;  2NUC A;  2EJG C;  4P73 A;  4A3M B;  2K32 A;  1E3P A;  1SNQ A;  4HED A;  2F0U A;  1Y1W B;  3VA7 A;  2JA8 B;  3S1Q H;  1EUJ A;  3NUC A;  5GAE C;  1P16 A;  4X62 Q;  3TDQ A;  4UP8 A;  1TS3 A;  1DOM A;  2VZA A;  3J7A V;  4A3J B;  2YYZ A;  2JA5 B;  2G9D A;  1DZ1 A;  1VQM A;  2R7Z H;  4X65 L;  1ICW A;  1BVS A;  2KQ3 A;  1D8L A;  4N9T A;  4JI4 L;  2DNE A;  2R92 B;  3C2P A;  1G6Z A;  5BN4 A;  4F8M A;  1FNW A;  2EDG A;  3MXG A;  1NMG A;  3NHH A;  2M9V A;  2JXM B;  4DK6 C;  1HTP A;  1H9J A;  2KEN A;  1L1O B;  4K5X A;  4JBK A;  2NVQ H;  1QWY A;  3HRZ C;  1TS2 A;  4JV5 L;  3KF8 B;  1DOK A;  1EEI D;  2E5L L;  3TP8 A;  1EEF D;  5C0X J;  4AQY Q;  2HQE A;  3OMC A;  1L0W A;  3TME A;  5IP7 H;  4IUN A;  4KKS A;  1J5E Q;  1NSN S;  1DM0 B;  3CCM A;  3Q22 A;  2R93 H;  3TRE A;  3E5S A;  2M00 A;  4A3D G;  4DR3 Q;  3DM3 A;  4CJ0 B;  4DUZ Q;  1Q81 C;  3VR6 A;  1LT5 D;  1IBM Q;  5M3M G;  1IBK L;  5C6A A;  2MNA A;  1W2B A;  4GLA C;  1XJV A;  2AQ3 B;  1RIP A;  3DUZ A;  1XMO L;  4YIJ A;  3K8A A;  2ZXR A;  1WJJ A;  3FKI H;  1QIL A;  3E6Z X;  4L8J A;  1HR0 W;  2UXB Q;  1U4M A;  1VQC A;  2RSN A;  4ZLT F;  4LF8 Q;  4RMF A;  4A3G B;  4FF2 A;  5FO7 B;  4DR2 L;  5C0X H;  3DMU A;  4KN7 C;  5H1S E;  4AIM A;  2C35 B;  4A3I G;  4KN4 C;  4A3L H;  1S40 A;  4BY7 B;  4UP7 A;  5CV7 A;  4AYB G;  1ENA A;  4F88 A;  4LF4 L;  1I3Q B;  3F2D A;  1U4P A;  1B7Y B;  1K73 C;  1ZXT A;  5JJI A;  3HOV B;  2CWA A;  4IUV A;  2QF7 A;  1PZJ D;  2VQE Q;  4CDC C;  3OW7 A;  4HMI A;  1CK1 A;  3GTK B;  4Y7N H;  3S1M H;  1V1P A;  2L5T A;  1JR0 D;  4DV1 L;  4A3C H;  2RF4 A;  1HQM C;  1IW7 C;  1X3G A;  5EPK A;  3GTP H;  2WII B;  4FF3 A;  1SE4 A;  4BXX G;  1CQF A;  3A55 A;  4RAU C;  1WOC A;  3G6E A;  1Q82 C;  1UNS A;  1UUP A;  1C9O A;  3HKZ E;  2E74 C;  2E75 C;  3HOX B;  1JCK B;  1M4V A;  5IOD A;  1U9R A;  1GHJ A;  2PI2 E;  4LWC A;  4DUY Q;  1PYB A;  1XNR L;  4JYA Q;  3T51 B;  1TKW B;  1S4Z A;  4DV6 Q;  2N3S A;  1Q3L A;  3W1B A;  3F2U A;  2VY3 A;  2XGT A;  2ICI A;  4QCL A;  4PMW A;  5IGB A;  1GUG A;  3J81 c;  5M3F G;  2F0Q A;  4QJF A;  3PF4 A;  2DNC A;  2Z4I A;  1F2Z A;  3HOZ B;  3J80 E;  2B8F A;  1NJI C;  4DR4 L;  4LK1 C;  1B4O A;  4IPG A;  3KDF B;  1KDC A;  3EJI A;  2WB1 B;  5M5Y H;  4NXM Q;  1LTB D;  2JA7 B;  4OHJ A;  1E1T A;  1WFQ A;  3PGZ A;  1EWC A;  4OEL B;  4RWS C;  1N33 L;  1O7I A;  4HR7 B;  1V8Q A;  3V05 A;  4JI3 Q;  1UE6 A;  4PNY A;  1CHP D;  1Y1V G;  2EY5 A;  4BBS G;  1IYU A;  4DV0 Q;  2CKZ B;  2IJ0 A;  4LFC L;  1VQK A;  2IHF A;  5FOB B;  5J22 A;  4DV4 Q;  4RGT A;  2OTJ A;  1VF5 C;  4DV3 L;  4NP5 A;  3NWT A;  3NTI A;  5EKK A;  4J6H A;  4YY3 Q;  5C44 H;  4HCE A;  4C3H G;  4LF5 L;  3HOW H;  4WJ4 A;  2NVX B;  1YI2 A;  1NUC A;  3KLW A;  1YJN A;  2K1B A;  2JA9 A;  1I4X A;  1HHV A;  4IUQ A;  4G7Z C;  4G4K A;  2VB2 X;  1SXT A;  4RGM A;  4MTN A;  3VYR A;  2RDG A;  2C5C A;  3QOL A;  3SXH A;  5CGK A;  4ZUJ A;  1HRJ A;  4KD4 A;  5C4J H;  3H3V I;  4GS3 A;  1LLR D;  2HQL A;  2A74 C;  1VQP A;  3S16 H;  1HNX Q;  2EXZ A;  2VUM H;  5IY0 A;  1ZYR C;  1X55 A;  4NXN L;  2Q2U A;  2PQA A;  1EFI D;  3PUX A;  4A3B B;  4WRD A;  1KRT A;  1X65 A;  3I8Z A;  5LHY 1;  3QB3 A;  2LXK A;  2CHB D;  1LTL A;  2WAQ E;  4HSV A;  1KQS A;  3SVM A;  1CUK A;  3PO3 G;  3CCJ A;  1DXM A;  1DOL A;  4OON A;  2JN4 A;  4JBW A;  1AN8 A;  1SJH D;  2V1C C;  1MIU A;  5EAY A;  4JI8 Q;  4OIJ A;  1DD2 A;  4BBR H;  2C9O A;  3CCQ A;  4G7H C;  3CCR A;  1F9Q A;  3WOE A;  4NB3 A;  1GUS A;  1FJG L;  1CT1 D;  3TRZ A;  3MHB A;  2EXD A;  2Z6K C;  2X6L A;  3NK9 A;  3M4Y A;  4HJ9 A;  5K36 H;  2SDF A;  3JAM E;  1PTO D;  4B3M L;  4RKL A;  3J80 i;  1JC7 A;  1K3R A;  2NN6 G;  1TS4 A;  5F2D A;  2EYJ A;  5IWA Q;  1ICF B;  2K01 A;  1V1Q A;  4I7Z C;  4G57 A;  4A93 G;  1WTV A;  1PH5 A;  2OF1 A;  3RLO A;  2K5N A;  3I73 A;  3ERS X;  4TVA B;  4DK1 A;  1TWF H;  1YEZ A;  2XN9 C;  4IJL A;  1OO9 B;  1SYB A;  1U5K A;  2A6E C;  5FO9 B;  4GZY C;  3SK8 A;  4EQ5 A;  1YJW A;  3PUZ A;  2ALY B;  1I4G A;  2TMP A;  3ER0 A;  3R2I A;  2XWB B;  3C1E A;  1CTM A;  4CKC A;  2RHQ B;  4NDX A;  4APV A;  1G91 A;  2AMC B;  1SRO A;  2CCZ A;  5JEA J;  1JOO A;  3FKI G;  1B70 B;  1C4Q A;  2HIV A;  3ZJY C;  1TWG H;  1VDZ A;  2K33 A;  1I50 H;  4OO1 H;  3NEM A;  3D3R A;  5IGC A;  4XDX A;  1VMP A;  1ASZ A;  2RCN A;  4KK7 A;  5IYC H;  5C0X G;  3J7Z C;  2YTX A;  4K5W A;  2HHH Q;  2BE5 D;  3BU2 A;  5C3E B;  5C5L A;  1E1O A;  2K03 A;  5AJ3 L;  3W1G A;  2E2J B;  3D8G A;  2UUB L;  2EYP A;  3HGB A;  2VXW A;  2KHJ A;  1SMY D;  3NQI A;  3M7G A;  2EJF C;  1MSH A;  4ZK9 B;  1RHP A;  1MD2 D;  2YV5 A;  1BUV T;  3BS1 A;  1Q12 A;  4IZ8 A;  5BR8 Q;  1BCP B;  2KA7 A;  1LTS D;  4Y52 H;  3T53 B;  1X3E A;  4A3C G;  3NE5 B;  1S3O A;  3R8B A;  3R3O A;  3A0J A;  5DLQ E;  4LF9 L;  5IP9 H;  1YJ9 A;  5M5X B;  1SDF A;  2WFW A;  3N52 A;  5CV8 A;  3I72 A;  1T5E A;  2ATW A;  1YHA A;  4RKB A;  4L5S A;  1KDB A;  4YHH Q;  3QJY A;  3MEF A;  2J0T D;  2PNR C;  3RZO H;  5CC4 A;  1SYG A;  3IAY A;  2EE1 A;  3NTH A;  4WJW A;  3D4D A;  5FKA C;  5AFW A;  1JE5 A;  1N9W A;  1I6H B;  4EQO A;  5CMD A;  4ZQ3 A;  2N78 A;  4MIU A;  1HH2 P;  3GTO H;  4L63 B;  1EQQ A;  3NTK A;  1IKM A;  4B9W A;  4RHR A;  4Q5V A;  1X56 A;  3HG9 A;  1LTT D;  4IFD J;  3AFQ A;  2RKS A;  5C4Z A;  1KAA A;  5KNB A;  3I4O A;  5M5Y B;  1SLJ A;  1FYC A;  2VS1 A;  3GTJ H;  3CHB D;  3MA2 B;  3CCU A;  3MWY W;  1QVC A;  2FXQ A;  4DNR B;  2NWG A;  4GKJ Q;  4OWX B;  5G3L F;  3M4O B;  3MC0 B;  1QB5 D;  3A5U A;  3M3Y B;  1JQY D;  3T1Y L;  1HR0 L;  1V9P A;  2TSS A;  1X3P A;  3L0O A;  3G4S A;  1WCM B;  4BY1 H;  1EQV A;  4KY5 A;  3IRB A;  4QL5 A;  2AWN A;  4C3I B;  4LUZ A;  1OXX K;  2X69 A;  3TZU A;  3TN2 A;  3J7A 5;  2NN6 I;  3VDY A;  4IFD H;  3Q6S A;  3HOW G;  1FNV A;  1XNQ L;  1JWM D;  2IX3 A;  4QF4 A;  4GOP C;  2L55 A;  4X66 L;  2F52 A;  2Y0S E;  4B3S Q;  1C0A A;  2CQA A;  4NPS A;  3K6O A;  4DXF A;  2A8V A;  2K5Q A;  2E2H H;  3J80 c;  3S1R H;  1EIH A;  3KJO A;  3S16 B;  3P75 A;  2PNH A;  2VUM G;  1E22 A;  1PH6 A;  1D6E C;  4FP5 D;  3VYS A;  1EQR A;  3V96 A;  1EZ8 A;  2Z8L A;  3VR5 A;  1UEB A;  1KAW A;  1EY5 A;  3MZ5 A;  3STB C;  3CP0 A;  4JI2 Q;  4C56 C;  2OXP A;  3FPU B;  4X3U A;  5I6W A;  1Z6H A;  4CDE C;  2RSO A;  5C0X I;  1SRU A;  5EPL A;  4JOI C;  1TT2 A;  4B3T L;  1PRT D;  4BBR B;  3W2D A;  1SE8 A;  1M90 C;  4V19 0;  1B9N A;  1EY6 A;  3Q24 A;  3CAM A;  4DV7 L;  4HJ8 A;  5K36 G;  5IYB H;  4P72 A;  1WTH A;  4EX5 A;  4C3J G;  1CKN B;  3BVG A;  3K7A B;  2OTL A;  4OWT B;  4CDF C;  4GLX A;  2G9H D;  2RHS B;  3CPF A;  3GTL B;  2EYF A;  1MJC A;  3OIQ A;  4K2K A;  2PCF B;  1EL0 A;  2JQO A;  1VQ4 A;  1Q8I A;  3AU7 A;  5I2Y A;  1VQ9 A;  1RF2 D;  2B2W C;  3EBE A;  1VCI A;  2PYK A;  4ZUI A;  1TWF B;  1XMQ Q;  5D14 A;  1LAB A;  3CKI B;  3D31 A;  1LTA D;  4JI1 L;  2MQH A;  1AW7 A;  4GOP B;  4L5R C;  1WTO A;  3U9S A;  3I2Z A;  2QCP X;  2F0H A;  3E9H A;  2XTI A;  1X3F A;  5JOB A;  2OCE A;  3K80 C;  2A68 D;  4TRD A;  2MP1 A;  1PDQ A;  1SNP A;  1I94 L;  4P74 A;  1K9M C;  3H0G H;  1YNJ C;  1YNX A;  1CKO A;  3A54 A;  3ULP A;  4F7X A;  3D4W A;  3OWF A;  2PQE A;  3AYH B;  5IYD H;  3SK4 A;  4OO1 G;  3BDL A;  5E3F A;  3VYU A;  4BA2 I;  4M8A A;  2JSO A;  4RFB A;  2B63 H;  1CM9 A;  2R7F A;  2RVL A;  1KHI A;  1N34 Q;  1MI2 A;  5C4X B;  2UXC L;  4X64 L;  5EBD A;  4RG1 A;  1SYC A;  1G6P A;  4OX9 L;  2YU9 B;  4PZ8 A;  4A3K B;  1XX8 A;  2A6H D;  5EKI A;  4QIW B;  2EQS A;  2JA6 H;  1IYV A;  2A69 C;  1H9S B;  4X6A H;  2CW0 C;  5JEA G;  3C46 A;  1GD7 A;  2XVS A;  1VQH A;  3S2H H;  3L3O C;  1Y69 U;  3Q0A A;  3PO3 H;  2Z1C A;  1DJR D;  1PHJ A;  4HN7 A;  5CV4 A;  4LF9 Q;  1G8Z D;  3BZD B;  4IO9 A;  4XYQ A;  2QDL A;  1K0R A;  5IP9 G;  3D6C A;  4Q0F A;  4J15 A;  1GKH A;  4IUU A;  3S24 A;  4A3M G;  3BYT B;  3IFD A;  3NP8 A;  4IPC A;  1Y1W G;  4DR6 Q;  2UUA Q;  1QG7 A;  5FLX L;  1WYD A;  3HOU B;  4U67 3;  3HS0 C;  5M5W B;  1A62 A;  1LTG D;  1HNW Q;  1B53 A;  2NN6 H;  4A76 A;  3HKZ G;  5FO8 B;  1C7Y A;  4H13 C;  2IL8 A;  4RGN A;  4JI0 Q;  4A93 H;  4LUO A;  1L0Y B;  3RLN A;  3CCV A;  3TS2 A;  4XQQ A;  4M1U B;  2QDB A;  1GHK A;  1HZA A;  3TP5 A;  2R92 G;  2D9U A;  1CI3 M;  1GUO A;  2IX1 A;  3L7Z C;  4A3D B;  2E2I B;  5E4W C;  2I46 A;  3RUZ A;  3CCS A;  2F0W A;  1YHQ A;  5M3M B;  1HNZ L;  3D0F A;  3OYY A;  2UUC Q;  1Q46 A;  1Q90 A;  1HQR D;  2XNA C;  3K0Y A;  1QOH A;  1YNN D;  4UAI A;  1W6J A;  1RTN A;  3SK6 A;  4BY1 G;  1VQL A;  2M2L A;  4LUV A;  5ELO A;  2HIX A;  2F4V Q;  4JOI A;  1N36 L;  3MEH A;  3L9A X;  1DYQ A;  5CV5 A;  4IFD G;  1ET9 A;  4A3I B;  1BQQ T;  3G7L A;  4R4C A;  4A3F H;  4AYB B;  2ZJR A;  1TII D;  3ONA B;  1VQA A;  4A3E B;  4JI6 L;  2MO0 A;  3HZX A;  1A3T A;  1FL0 A;  2JE6 I;  4H7B A;  5IT9 L;  4GNX C;  4IJH A;  1HA5 A;  2FIN B;  4NMZ A;  1TWH H;  4JI5 L;  4E6I A;  3J7Y W;  1GJX A;  2IT1 A;  3CC2 A;  4IPD A;  1SMX A;  1IXR A;  1EU4 A;  2QW7 A;  4KHV A;  2ZTC A;  1J6Q A;  2B2W A;  4YWK A;  1Z9F A;  3GTG B;  1GO3 E;  2BOS A;  4QIW E;  1PTO B;  1EY4 A;  2PI2 A;  3GTQ B;  2UXD L;  1HXY D;  4UHV A;  1PH2 A;  3DEP A;  4EQP A;  1F9P A;  2KOL A;  2ES2 A;  1PZI D;  3BDO A;  1SFO B;  2J4X A;  2K6A A;  2PMZ B;  2OT2 A;  1PFB A;  1T9H A;  4S3S A;  1ESF A;  4OO1 I;  5JJZ A;  5KYL A;  1EFW A;  2EIF A;  1JT8 A;  2UU9 L;  2VQF L;  1QNU A;  5I2X A;  2FMC A;  4OXP A;  1L1O A;  3A7L A;  2WAQ G;  1K83 B;  3RNU A;  4K0K L;  3KF8 A;  3DWQ A;  2K04 A;  4P71 A;  1N32 Q;  1H9M A;  1QUQ B;  2HDM A;  4R1J A;  2IX0 A;  1L2F A;  1BBU A;  1SJE D;  3T56 B;  4C2M H;  1XXG A;  4K6L A;  3DWA A;  3OWE B;  3PUW A;  4DR1 L;  3STB D;  3F8T A;  1UEA B;  4XTC S;  4B3R L;  4NKL A;  5IYB G;  3DM1 A;  5M3F B;  3S1N B;  3EIV A;  1IBL L;  1LV9 A;  1E2Z A;  1HZ9 A;  1PMR A;  3HOX G;  4JCV E;  3RN5 A;  5C5M A;  5FJ8 G;  3PIO A;  1XPR A;  1QZG A;  1TVX A;  1QZH A;  3ULL A;  3T1H Q;  4KHZ A;  4I7A A;  5EBC A;  2NVT H;  3S15 H;  1EYG A;  4OGQ C;  3S17 H;  1STY A;  3ND8 A;  3PIP A;  2FFK B;  5NUC A;  1PXU A;  1Y1V B;  4GNX B;  2ZXP A;  4BBS B;  3PO2 H;  1AH9 A;  4IAL A;  1STB A;  1HPC A;  2KVM A;  1EQT A;  2A5H A;  2F03 A;  4O2D A;  3G48 A;  1PH9 A;  4Z9C B;  3SDZ A;  1JB7 A;  5ELC A;  2NZ1 D;  4DR7 Q;  1TU2 B;  4X3K A;  3Q23 A;  4C3H B;  4DV2 L;  3SE0 A;  3H0G G;  2DJF C;  3VR2 A;  1GUW A;  5IGD A;  4GN5 A;  4GLV B;  4LF7 L;  1UWV A;  5IYD G;  2CFM A;  1NR4 A;  4C1N K;  1ET6 A;  4KTA A;  4ME5 A;  2B63 G;  1HZB A;  1K0S A;  2E76 C;  5FLM G;  3TQY A;  5E7N A;  3HKS A;  2K50 A;  5LMU L;  1S5E D;  1II3 A;  1B3Q A;  2NVY H;  3PSI A;  2ZT9 C;  3MXN B;  2EY1 A;  5LMN Q;  4TKO B;  1KC8 C;  3OTO Q;  3P7J A;  2Q8T A;  1VQ5 A;  4PZ6 A;  1PZK D;  1X54 A;  2JA6 G;  1AZQ A;  1TWC H;  2Q2I A;  1EU3 A;  1SAP A;  4KHP L;  5ELD A;  4BWG B;  1A2U A;  1O7L A;  3GQB A;  2NZO A;  3I70 A;  4JPB W;  3TP7 A;  3S1Q B;  3PO3 B;  1QE6 A;  4MN3 A;  4RGO S;  4GKK L;  5T1I A;  4CKB A;  3VYT A;  3EN2 A;  1ILQ A;  1LTR D;  2F0M A;  1NE3 A;  1S5F D;  3RLF A;  2B39 A;  2EZV A;  4IFD I;  1EOV A;  2J7Z A;  1LYL A;  4B9X A;  2GA4 B;  1BNZ A;  2B2V C;  4DAY B;  4FYD A;  2R7Z B;  1F77 A;  3HEJ A;  1H9K A;  3BZK A;  4X65 Q;  2R61 A;  4JI4 Q;  3LNN A;  4R4Q A;  3K5M A;  3GTM H;  3KBX A;  3KDF A;  4EGV A;  1R9T H;  1NAP A;  1K3B C;  4XT1 B;  5JJL A;  3AEV A;  4C3J H;  2VL6 A;  1BCP C;  3BDC A;  3IFT A;  3K7U C;  3T4A C;  3FMC A;  2DUD A;  3I3C A;  3CCL A;  2NVQ B;  5E1F A;  3E0J A;  5ELN A;  1BR9 A;  3TEH B;  3G71 A;  4FF1 A;  1A15 A;  3M4P A;  4JV5 Q;  5KRU A;  3CXC A;  3S2D H;  2E5L Q;  1QVF A;  3JAM L;  3PCO B;  1SNC A;  1NCV A;  1CFM A;  2F0E A;  3PQI A;  4KMU C;  1PV4 A;  4RA8 A;  1ML0 D;  4LW1 A;  4WFN 3;  2WB1 E;  2R93 B;  1Y8N B;  1CZW A;  4K2L A;  5LL6 S;  5CV9 A;  4JI7 L;  3S14 H;  5HGT A;  3SEB A;  4JW0 A;  5KGU A;  5IE8 A;  1Q8K A;  1HNZ Q;  1IBK Q;  4EVO A;  1VQD A;  2DGY A;  3FKI B;  1XMO Q;  5A2Q E;  1KLU D;  4FF4 A;  1W3S A;  4RCO A;  4OWW B;  4PG3 A;  4KD3 A;  5ISR A;  2P5Z X;  3EVQ A;  3PV0 A;  4DV5 L;  4DR2 Q;  2I07 B;  4IN3 A;  4DR5 L;  2LFN A;  1JJC B;  2QEX A;  3NEN A;  2NTS A;  1A63 A;  4R4T A;  1K28 A;  4A3F G;  2ZTD A;  3AB9 A;  3NBH B;  3CQZ H;  2PZT A;  4A75 A;  1I4P A;  3VR4 A;  1ESR A;  4LF4 Q;  1RDP D;  1XYI A;  5CYU A;  3FHW A;  5I4D A;  3UDF A;  2I5L X;  3W5O A;  3UDI A;  4K14 A;  3HOY H;  2LXJ A;  2JK8 A;  4FNF A;  4BS9 A;  1Q86 C;  5GQO A;  1F2Y A;  2MUY A;  5JEA H;  1UE5 A;  4LF6 L;  4Y7N B;  3S1M B;  1Z47 A;  1I4R A;  2Y0S G;  3DXJ C;  3LWE A;  4KLK A;  4DV1 Q;  2BDO A;  1BXT A;  1VQ6 A;  3BG3 A;  1PLF A;  1K8O A;  1YVC A;  1D1I A;  5COR A;  3GTP B;  4LFB L;  4P75 A;  2AHO B;  1G2S A;  3AMU A;  3VR3 A;  2PO4 A;  1VQE A;  3ZYY X;  3FRP B;  1CKM A;  2B2T C;  2HDL A;  4A3M H;  2E8G A;  3W3A A;  1I6V C;  2CH4 A;  1KDA A;  4DGZ A;  2AUJ D;  1Y1W H;  3EFX D;  3HFZ B;  4FVM A;  2A1A A;  4XIG S;  1XNR Q;  2JA8 H;  1IW7 D;  4X62 L;  1PA6 A;  1U4L A;  4DNT B;  1YIT A;  1STN A;  3I56 A;  2NBF A;  2B2Y C;  3I4N G;  4A3J H;  1QVG A;  5JVH 3;  2JA5 H;  4IUT A;  1DON A;  1PYW D;  1GOZ A;  1PH1 A;  5G3L D;  1EYC A;  1JIC A;  4CHT B;  2R92 H;  3MTS A;  3BYY B;  4DR4 Q;  2CWP A;  4DK3 C;  1I4H A;  1PH8 A;  2YTY A;  1JJG A;  4B08 A;  2F0K A;  1WD1 A;  5C4H A;  1QJO A;  2EYM A;  3P20 A;  1M1K C;  2O4X A;  3Q8D A;  1N33 Q;  3OSO A;  4IPH A;  5IGE A;  1STE A;  1W6K A;  2A19 A;  1GVP A;  5D3D A;  3PO2 G;  2N49 A;  3GV6 A;  2BA0 A;  2LY7 A;  4HIK A;  1QNK A;  2RA4 A;  4LFC Q;  4LNQ A;  3D4R A;  1J5E L;  1HUM A;  2V4D A;  4HAE A;  4ODG A;  4DV3 Q;  4HCS A;  1EWH A;  3GP7 A;  4K6D A;  5C44 B;  4DR3 L;  4DUZ L;  2GVA A;  4HID A;  1B1Z A;  3HOW B;  1DGS A;  2EY2 A;  5DNF A;  1KL9 A;  1IBM L;  4LF5 Q;  4UDU C;  3KK7 A;  4FXG C;  2WKC A;  2Z6K A;  2H1E A;  1HZC A;  2D62 A;  3OPO A;  2BCO A;  3UI2 A;  2NTT A;  1HFN A;  3PF5 A;  4JVZ A;  2G5D A;  2UXB L;  3KUP A;  2HUG A;  4LF8 L;  3A7A B;  4A3G H;  3VA5 A;  1D2B A;  2MPM A;  4L5T A;  5C4J B;  2LS0 1;  3KF6 B;  2L1B A;  1VQN A;  3K57 A;  3J81 L;  1OXU A;  4IUP A;  4BY7 H;  2VUM B;  4X3S A;  1TY0 A;  1EY7 A;  3MXU A;  5D65 A;  4NXN Q;  3SK5 A;  2KCN A;  5JPN C;  1I3Q H;  1S5D D;  2AWO A;  2EVB A;  2F3I A;  1TQO A;  3CU7 A;  2F0L A;  4DAM A;  3HOV H;  1X9N A;  2VQE L;  4KY7 A;  4KKU A;  1TWA H;  3DWP A;  1OXS C;  1PYS B;  2I5M X;  3QR8 A;  3H91 A;  1ZYR D;  2QKI C;  3NPP A;  4F87 A;  1KIX A;  2RQX A;  2CQO A;  1EYD A;  1FGB D;  3CCE A;  1FJG Q;  5C3W A;  1S72 A;  3RMH A;  4CDD C;  2B29 A;  3QIA A;  2MHV A;  4C3J B;  4ID6 A;  2Q8R E;  5GAD C;  1OXV A;  3HOX H;  4B3M Q;  1JOQ A;  1O7Z A;  2XIW A;  5FJ8 H;  1DCZ A;  1XTD A;  4DUY L;  4JYA L;  3BVZ A;  4RH6 A;  4ZAI A;  4DV6 L;  4KY6 A;  4QUF A;  1X3Q A;  2F4I A;  3ULJ A;  1E24 A;  4XT3 B;  1SYD A;  4N9P A;  4GN4 B;  4R8I A;  4H0L C;  1WTQ A;  5DEH A;  4KV6 A;  5JVG 3;  2IW3 A;  1F2L A;  4G7O C;  2B2U C;  5TSS A;  2B3G A;  4FDB A;  5D3I B;  3L2P A;  1ZEQ X;  2WKD A;  4HJ7 A;  1QCB D;  2FJ2 A;  4JG2 A;  2SEB D;  4NXM L;  1Z7T A;  2EPB A;  5EQ0 A;  2I5H A;  3TSS A;  3MXP A;  4N8X 1;  4DA2 A;  2JA7 H;  3DLL A;  1ROD A;  5GAH C;  2B2T A;  2A6E D;  3SHL A;  4JI3 L;  2CVR A;  5DM7 3;  3PIO 3;  2F1M A;  1BCP F;  2F0N A;  1TWG B;  3QWN A;  1B44 D;  1I50 B;  1CSQ A;  4FXD A;  1E0B A;  4DF7 A;  4DV0 L;  1JWS D;  3U9O A;  2KEE A;  4DV4 L;  3PIP 3;  2VNU D;  3C1F A;  2ASB A;  4ZKB B;  2IPK D;  3H3V C;  5FLM H;  4YY3 L;  1HA6 A;  1NR2 A;  1D7Q A;  3UE1 A;  2R3Z A;  5AJ3 Q;  5IGF A;  2PZU A;  2VB3 X;  4WOR A;  2NVX H;  3KLS X;  2UUB Q;  1JOK A;  4K8J A;  4RHS A;  4CJ1 B;  2L15 A;  1NNX A;  2OQ0 A;  1K8M A;  4BA1 I;  2WIN B;  2KCM A;  1K8A C;  3HOY G;  1D5Z C;  1X32 A;  4MNO A;  2X6G A;  3ERQ A;  1Y8O B;  2F0P A;  1FR3 A;  3ITP A;  4CGY B;  3AQQ A;  5FK9 C; 
#chains in the Genus database with same CATH homology
 5KYI A;  1HCZ A;  4X3T A;  4JK1 C;  1MGS A;  2XWJ B;  1KTK A;  4H44 C;  4J8Q A;  1SYE A;  1JB3 A;  1BDO A;  1S5B D;  1SNM A;  3RZO B;  5C3X A;  5EJW A;  4RCN A;  4I65 A;  1XTC D;  1PTO C;  3HKZ B;  5FLX E;  1B9M A;  3GTO B;  2WAC A;  1V1P B;  2D2C C;  3PUY A;  2LKV A;  5KIX A;  1WD0 A;  2K5D A;  3PMF A;  1STH A;  2JEA I;  2JEB I;  3J7A F;  4U68 A;  4R8N A;  1STG A;  3H6M A;  3WDN A;  4ZKC B;  1V1O A;  5IGG A;  5I6Y A;  3GTJ B;  2K28 A;  1AZP A;  4PMB A;  2SNM A;  1F2M A;  3DHQ A;  4CKE A;  4BY1 B;  1EY8 A;  3FPP A;  3NQT A;  2F0T A;  3QG1 A;  2F0I A;  2WP8 J;  4FXK C;  1EIG A;  1F9S A;  1HTL D;  2BE5 C;  5J1Z A;  4O1N A;  3G6J B;  1H9S A;  3I4L A;  4PMC A;  4K5V A;  1J8I A;  5IT9 E;  1SMY C;  3OOC A;  4LMQ D;  2E2H B;  3S1R B;  1IL8 A;  1WTP A;  2N55 A;  1FD7 D;  3KLR A;  3LX0 A;  3R93 A;  2B2U A;  3EQL C;  5CV6 A;  3EA6 A;  1XWE A;  2HCI A;  1SYF A;  1B50 A;  4CBV A;  1TWA B;  1KLG D;  3DEO A;  2EJM A;  2WAQ B;  3FVQ A;  3K5O A;  2KEC A;  2DN8 A;  4PQX A;  2AQ1 B;  4PV1 C;  2NB0 A;  3GD7 A;  3K5L A;  3TZD A;  1GUN A;  1E2W A;  3IKJ A;  3SR1 A;  2F0F A;  5CBE E;  3FEW X;  1AP0 A;  5LL6 X;  5EPJ A;  2F3W A;  3J80 L;  4LJZ C;  4DAP A;  1R4Q B;  1RTO A;  3X3M A;  3S9W A;  1S5C D;  1IHZ A;  4XQJ A;  4ZYS A;  3H0G B;  2F0J A;  2B8G A;  3IL8 A;  1RKN A;  5ELE A;  2O5I C;  3CRK C;  2N88 A;  3D6W A;  5COY A;  1GUT A;  1J9O A;  2L12 A;  2B63 B;  1R4P B;  1SNO A;  1TY2 A;  2KHS A;  5JAV A;  2XRS D;  3ND9 A;  2BDN A;  3TP6 A;  1YNJ D;  4XXE A;  4QUC A;  3KLS A;  1IKL A;  1CHQ D;  4J1M A;  2JA6 B;  2R6G A;  3T16 A;  1HUN A;  3HP3 A;  1LT3 D;  4NW2 A;  1B3A A;  1EYA A;  2EY6 A;  3S2H B;  1EZ6 A;  5I9P A;  1I4Q A;  1D5X C;  2H4O A;  3KBG A;  1C8C A;  1RJT A;  2FHT A;  1U4R A;  2A69 D;  2KJX A;  2CW0 D;  1PRT C;  2O2L D;  3M7N A;  3O13 A;  2QEJ C;  2OEO A;  3WOF A;  4IUR A;  5KND A;  2L0C A;  5K5P A;  5IIF A;  4A93 B;  5DAU A;  3NSW A;  2DY8 A;  2EYO A;  5EGT A;  3OHX C;  3FDT A;  1TR5 A;  2L4N A;  1LO5 D;  1LTI D;  1T5X D;  4L6T B;  1V43 A;  3MFY A;  1BF4 A;  1M8A A;  2F0D A;  3URY A;  2A68 C;  4TQU S;  2FMM A;  5JPM C;  2F3V A;  5E4X A;  1SSO A;  4XQN A;  1KNE A;  3NWS A;  1HFG A;  3N6R A;  4XYO A;  1PTO F;  4LAA A;  2MGS A;  1AEX A;  2ENB A;  3MXN A;  4DN4 M;  4DXG A;  2NYZ D;  5A2Q L;  4A3F B;  3A8K E;  2RDH A;  1BOS A;  4OIK A;  3ERO A;  1PRT B;  1H9R A;  2A6H C;  3QOJ A;  1WTW A;  1TWH B;  2PW7 A;  3NXW A;  2MJ8 A;  3C3L A;  4P2C B;  3RD4 A;  4ZRZ A;  3H09 A;  4ILW A;  2Y0S B;  4C1N I;  1CA5 A;  3A8J E;  3PUV A;  4DAY A;  5DM6 3;  1MBY A;  2XSC A;  3H94 A;  2SOB A;  1BBX C;  5IOC A;  3K5N A;  1BO0 A;  1A3U A;  4HSP A;  2K05 A;  2PW5 A;  1PFM A;  1AFP A;  4DFA A;  1E2V A;  3I4N B;  4C2M B;  3V2T A;  4TSS A;  4HMJ A;  3OMG A;  3R2T A;  1RD9 D;  5CBA E;  1ENC A;  4O42 A;  1ENF A;  2F0G A;  1CA6 A;  2NVT B;  1SBB B;  2DY7 A;  2XRQ D;  3S15 B;  2E2D C;  1A6X A;  2EYL A;  3K59 A;  2JYO A;  3S17 B;  1FNU A;  2WV6 D;  2RBM A;  1OXT A;  3PO2 B;  1KAB A;  3BVM A;  4DK0 A;  1YNN C;  1JOR A;  2QIL A;  2HCC A;  2AQ2 B;  3NBH A;  2L9H A;  3MFG A;  1Y8P B;  2LMC B;  2IWH A;  3M85 A;  1SE2 A;  2B2V A;  2Z4H A;  4KJN A;  4OL7 A;  3TBI B;  1SE3 A;  4ABN A;  5KNC A;  4MHE A;  5BN5 A;  2F0S A;  4QB4 A;  3GO5 A;  5HUR A;  1WTX A;  1PFN A;  5BN3 A;  5EKL A;  2KCC A;  5KEE A;  1JWU D;  4C3I G;  2NVY B;  2KUM A;  3A56 A;  2L11 A;  1CQV A;  1G29 1;  1STA A;  4V0B A;  4IQZ A;  1SEB D;  1TWC B;  3J81 E;  5I9O A;  2PPB C;  2KED A;  1MSG A;  5A35 A;  2A73 B;  2EOT A;  1EY9 A;  2BA1 A;  2ICE C;  1PTO H;  2D5D A;  3NBI A;  1L0X B;  4ULL A;  3MVV A;  1UAP A;  1LT4 D;  3T13 A;  4KKT A;  1A2T A;  4FO2 A;  3I91 A;  3GTM B;  1R9T B;  1LAC A;  1VF7 A;  5T1G A;  1KNA A;  1WTR A;  3GV3 A;  4KJO A;  1D5M C;  3S2D B;  1B2T A;  1Q1B A;  2ID0 A;  1WVL A;  1G2T A;  3A8I E;  4DAV A;  1BCP D;  3CRL C;  4QMG A;  5ELB A;  2ZXO A;  3LWU A;  3S14 B;  1GXD C;  2AUK A;  1PRT F;  4K8I A;  4CJ2 C;  1Q1E A;  2F0O A;  1SND A;  2K5W A;  1LT6 D;  5M9O A;  1RCV D;  2F0V A;  1ILP A;  1D1K A;  2PZW A;  1EOT A;  1O78 A;  3OIP A;  1TS5 A;  2JP1 A;  2B2Y A;  4EQN A;  3CQZ B;  4R9W A;  4KI0 A;  1O7Y A;  2O5J C;  1VMC A;  3X3N A;  1EY0 A;  3QO2 A;  1C48 A;  5ELF A;  1O80 A;  2Q8I B;  4DU9 A;  3HOY B;  1CZG A;  4HTH A;  3MAQ A;  3I90 A;  1F9R A;  1A3V A;  3RZD B;  3P1H A;  3I4M B;  5J39 A;  1ONL A;  2EYH A;  2RDF A;  5CR3 A;  1JE4 A;  2SNS A;  2K7V A;  3K58 A;  1ZKO A;  2NUC A;  2EJG C;  4A3M B;  2K32 A;  4HED A;  1SNQ A;  2F0U A;  1Y1W B;  3VA7 A;  2JA8 B;  3NUC A;  3TDQ A;  1TS3 A;  1DOM A;  3J7A V;  4A3J B;  2YYZ A;  2JA5 B;  2G9D A;  1DZ1 A;  1ICW A;  2KQ3 A;  4N9T A;  2DNE A;  2R92 B;  3C2P A;  1G6Z A;  5BN4 A;  4F8M A;  1FNW A;  2EDG A;  3MXG A;  3NHH A;  2M9V A;  2JXM B;  1HTP A;  1H9J A;  4K5X A;  1QWY A;  3HRZ C;  1TS2 A;  1DOK A;  1EEI D;  3TP8 A;  1EEF D;  5C0X J;  2HQE A;  3OMC A;  3TME A;  4IUN A;  4KKS A;  1NSN S;  1DM0 B;  3Q22 A;  3E5S A;  2M00 A;  4CJ0 B;  3VR6 A;  1LT5 D;  5C6A A;  2AQ3 B;  3DUZ A;  4YIJ A;  2ZXR A;  1QIL A;  3E6Z X;  4L8J A;  1U4M A;  2RSN A;  4ZLT F;  4A3G B;  4FF2 A;  5FO7 B;  5C0X H;  3DMU A;  4KN7 C;  4BY7 B;  4KN4 C;  5CV7 A;  1ENA A;  4F88 A;  1I3Q B;  1U4P A;  1ZXT A;  3HOV B;  4IUV A;  2QF7 A;  1PZJ D;  3OW7 A;  4HMI A;  1CK1 A;  3GTK B;  1V1P A;  2L5T A;  1JR0 D;  1HQM C;  1IW7 C;  5EPK A;  2WII B;  4FF3 A;  1SE4 A;  1CQF A;  3A55 A;  4RAU C;  1UNS A;  1UUP A;  3HOX B;  2E74 C;  2E75 C;  1JCK B;  1M4V A;  5IOD A;  1U9R A;  1GHJ A;  3T51 B;  1TKW B;  1S4Z A;  1Q3L A;  3F2U A;  2ICI A;  4QCL A;  4PMW A;  5IGB A;  1GUG A;  2F0Q A;  2DNC A;  2Z4I A;  1F2Z A;  3HOZ B;  3J80 E;  2B8F A;  4LK1 C;  1B4O A;  1KDC A;  3EJI A;  2WB1 B;  1LTB D;  2JA7 B;  4OHJ A;  1EWC A;  4RWS C;  4HR7 B;  1V8Q A;  3V05 A;  4PNY A;  1CHP D;  2EY5 A;  1IYU A;  2IJ0 A;  5FOB B;  5J22 A;  4RGT A;  1VF5 C;  4NP5 A;  3NWT A;  3NTI A;  5EKK A;  4J6H A;  4HCE A;  4C3H G;  2NVX B;  1NUC A;  2K1B A;  1I4X A;  1HHV A;  4IUQ A;  4G7Z C;  4G4K A;  2VB2 X;  1SXT A;  4RGM A;  3VYR A;  2RDG A;  2C5C A;  3QOL A;  3SXH A;  5CGK A;  4ZUJ A;  1HRJ A;  4KD4 A;  1LLR D;  2A74 C;  2EXZ A;  1ZYR C;  1EFI D;  3PUX A;  4A3B B;  4WRD A;  3I8Z A;  5LHY 1;  3QB3 A;  2CHB D;  4HSV A;  3SVM A;  1DXM A;  1DOL A;  4JBW A;  1AN8 A;  1SJH D;  1DD2 A;  4OIJ A;  2C9O A;  4G7H C;  1F9Q A;  3WOE A;  1GUS A;  1CT1 D;  3MHB A;  2X6L A;  3NK9 A;  3M4Y A;  5K36 H;  2SDF A;  3JAM E;  1PTO D;  4RKL A;  1JC7 A;  2NN6 G;  1TS4 A;  5F2D A;  2EYJ A;  2K01 A;  4I7Z C;  4G57 A;  1WTV A;  2OF1 A;  3I73 A;  4DK1 A;  2XN9 C;  1OO9 B;  1SYB A;  2A6E C;  5FO9 B;  4GZY C;  3SK8 A;  3PUZ A;  1I4G A;  2TMP A;  3R2I A;  2XWB B;  3C1E A;  1CTM A;  4CKC A;  4NDX A;  1G91 A;  5JEA J;  1JOO A;  1C4Q A;  1VDZ A;  2K33 A;  4OO1 H;  3D3R A;  5IGC A;  4XDX A;  1VMP A;  4KK7 A;  5C0X G;  4K5W A;  2BE5 D;  5C3E B;  5C5L A;  2K03 A;  2E2J B;  3D8G A;  2EYP A;  3HGB A;  2VXW A;  1SMY D;  3NQI A;  3M7G A;  2EJF C;  1MSH A;  4ZK9 B;  1RHP A;  1MD2 D;  1BUV T;  3BS1 A;  1Q12 A;  4IZ8 A;  1BCP B;  2KA7 A;  1LTS D;  3T53 B;  3NE5 B;  3R8B A;  3R3O A;  5M5X B;  1SDF A;  3N52 A;  5CV8 A;  3I72 A;  1T5E A;  4RKB A;  1KDB A;  3QJY A;  2J0T D;  2PNR C;  5CC4 A;  1SYG A;  3IAY A;  2EE1 A;  3NTH A;  4WJW A;  3D4D A;  5FKA C;  5AFW A;  1I6H B;  4EQO A;  5CMD A;  4ZQ3 A;  4MIU A;  4L63 B;  3NTK A;  1IKM A;  4B9W A;  4RHR A;  4Q5V A;  3HG9 A;  1LTT D;  4IFD J;  5C4Z A;  2RKS A;  1KAA A;  5KNB A;  5M5Y B;  1FYC A;  3CHB D;  3MA2 B;  3MWY W;  4DNR B;  2NWG A;  5G3L F;  3M4O B;  3MC0 B;  1QB5 D;  3M3Y B;  1JQY D;  2TSS A;  1X3P A;  1WCM B;  1EQV A;  4KY5 A;  2AWN A;  4C3I B;  1OXX K;  2X69 A;  3TZU A;  3TN2 A;  2NN6 I;  4IFD H;  3Q6S A;  1FNV A;  1JWM D;  2IX3 A;  4QF4 A;  2L55 A;  2CQA A;  3K6O A;  4DXF A;  2K5Q A;  1EIH A;  3S16 B;  3P75 A;  1D6E C;  4FP5 D;  3VYS A;  3V96 A;  1EZ8 A;  2Z8L A;  3VR5 A;  1EY5 A;  3MZ5 A;  4C56 C;  2OXP A;  3FPU B;  4X3U A;  5I6W A;  1Z6H A;  2RSO A;  5C0X I;  5EPL A;  1TT2 A;  1PRT D;  4BBR B;  3W2D A;  4V19 0;  1B9N A;  1EY6 A;  3Q24 A;  5K36 G;  4C3J G;  3BVG A;  3K7A B;  2G9H D;  3GTL B;  2EYF A;  3OIQ A;  4K2K A;  2PCF B;  1EL0 A;  5I2Y A;  1Q8I A;  3AU7 A;  1RF2 D;  2B2W C;  1VCI A;  2PYK A;  4ZUI A;  1TWF B;  5D14 A;  1LAB A;  3CKI B;  3D31 A;  1LTA D;  1AW7 A;  1WTO A;  3U9S A;  2QCP X;  2F0H A;  5JOB A;  2A68 D;  4TRD A;  2MP1 A;  1PDQ A;  1SNP A;  1YNJ C;  3A54 A;  4F7X A;  3D4W A;  3OWF A;  2PQE A;  3SK4 A;  4OO1 G;  3BDL A;  5E3F A;  3VYU A;  4BA2 I;  4M8A A;  2JSO A;  4RFB A;  1CM9 A;  2RVL A;  1MI2 A;  5C4X B;  5EBD A;  1SYC A;  2YU9 B;  4A3K B;  1XX8 A;  2A6H D;  5EKI A;  4QIW B;  1IYV A;  2A69 C;  1H9S B;  2CW0 C;  5JEA G;  3C46 A;  2XVS A;  3L3O C;  1Y69 U;  3Q0A A;  2Z1C A;  1DJR D;  4HN7 A;  5CV4 A;  1G8Z D;  3BZD B;  4XYQ A;  3D6C A;  4Q0F A;  4IUU A;  3BYT B;  3IFD A;  3NP8 A;  1QG7 A;  5FLX L;  3HOU B;  4U67 3;  3HS0 C;  5M5W B;  1LTG D;  1B53 A;  2NN6 H;  5FO8 B;  4H13 C;  2IL8 A;  4RGN A;  1L0Y B;  4XQQ A;  4M1U B;  2QDB A;  1GHK A;  3TP5 A;  2D9U A;  1CI3 M;  1GUO A;  2IX1 A;  3L7Z C;  4A3D B;  2E2I B;  5E4W C;  2I46 A;  3RUZ A;  2F0W A;  5M3M B;  1Q90 A;  1HQR D;  2XNA C;  3K0Y A;  1QOH A;  1YNN D;  4UAI A;  1W6J A;  1RTN A;  3SK6 A;  2M2L A;  3MEH A;  3L9A X;  1DYQ A;  5CV5 A;  4IFD G;  1ET9 A;  4A3I B;  1BQQ T;  3G7L A;  4AYB B;  1TII D;  3ONA B;  4A3E B;  3HZX A;  1A3T A;  2JE6 I;  4H7B A;  5IT9 L;  1HA5 A;  2FIN B;  4NMZ A;  4E6I A;  3J7Y W;  1GJX A;  2IT1 A;  1EU4 A;  4KHV A;  2B2W A;  3GTG B;  2BOS A;  1PTO B;  1EY4 A;  3GTQ B;  1HXY D;  3DEP A;  4EQP A;  1F9P A;  2KOL A;  1PZI D;  3BDO A;  1SFO B;  2J4X A;  2K6A A;  2PMZ B;  2OT2 A;  1PFB A;  4S3S A;  1ESF A;  4OO1 I;  5JJZ A;  5KYL A;  1QNU A;  5I2X A;  2FMC A;  3A7L A;  1K83 B;  3KF8 A;  3DWQ A;  2K04 A;  1H9M A;  2HDM A;  2IX0 A;  1SJE D;  3T56 B;  1XXG A;  4K6L A;  3DWA A;  3OWE B;  3PUW A;  1UEA B;  4XTC S;  4NKL A;  3S1N B;  3DM1 A;  5M3F B;  1LV9 A;  1E2Z A;  1PMR A;  5C5M A;  1TVX A;  4KHZ A;  5EBC A;  4OGQ C;  1STY A;  3ND8 A;  2FFK B;  5NUC A;  1PXU A;  1Y1V B;  2ZXP A;  4BBS B;  4IAL A;  1STB A;  1HPC A;  2KVM A;  1EQT A;  2A5H A;  2F03 A;  4Z9C B;  3SDZ A;  5ELC A;  2NZ1 D;  1TU2 B;  4X3K A;  3Q23 A;  4C3H B;  3SE0 A;  3VR2 A;  1GUW A;  5IGD A;  1NR4 A;  4C1N K;  1ET6 A;  4KTA A;  4ME5 A;  2E76 C;  1S5E D;  1II3 A;  2ZT9 C;  2EY1 A;  4TKO B;  3P7J A;  2Q8T A;  1PZK D;  1AZQ A;  1EU3 A;  1SAP A;  5ELD A;  4BWG B;  1A2U A;  1O7L A;  3GQB A;  3I70 A;  3TP7 A;  3S1Q B;  3PO3 B;  1QE6 A;  4MN3 A;  4RGO S;  5T1I A;  4CKB A;  3VYT A;  1ILQ A;  1LTR D;  2F0M A;  1S5F D;  3RLF A;  2B39 A;  2EZV A;  4IFD I;  2J7Z A;  4B9X A;  2GA4 B;  1BNZ A;  2B2V C;  4FYD A;  2R7Z B;  1F77 A;  3HEJ A;  1H9K A;  2R61 A;  3LNN A;  3K5M A;  3KBX A;  4EGV A;  1NAP A;  4XT1 B;  1BCP C;  3BDC A;  3IFT A;  3T4A C;  3FMC A;  3I3C A;  2NVQ B;  5E1F A;  3E0J A;  1BR9 A;  4FF1 A;  1A15 A;  5KRU A;  3JAM L;  1SNC A;  1NCV A;  1CFM A;  2F0E A;  4KMU C;  4RA8 A;  1ML0 D;  4WFN 3;  2R93 B;  1Y8N B;  1CZW A;  4K2L A;  5LL6 S;  5CV9 A;  5HGT A;  3SEB A;  5KGU A;  4EVO A;  3FKI B;  5A2Q E;  1KLU D;  4FF4 A;  4RCO A;  4KD3 A;  5ISR A;  3EVQ A;  3PV0 A;  2I07 B;  4IN3 A;  2LFN A;  2NTS A;  3AB9 A;  2PZT A;  1I4P A;  3VR4 A;  1ESR A;  1RDP D;  1XYI A;  5CYU A;  5I4D A;  4K14 A;  4FNF A;  4BS9 A;  1F2Y A;  2MUY A;  5JEA H;  4Y7N B;  3S1M B;  1Z47 A;  1I4R A;  3DXJ C;  3LWE A;  2BDO A;  1BXT A;  3BG3 A;  1PLF A;  1K8O A;  1D1I A;  5COR A;  3GTP B;  1G2S A;  3AMU A;  3VR3 A;  2PO4 A;  3ZYY X;  3FRP B;  2B2T C;  2HDL A;  3W3A A;  1I6V C;  1KDA A;  4DGZ A;  2AUJ D;  3EFX D;  4FVM A;  4XIG S;  1IW7 D;  1U4L A;  4DNT B;  1STN A;  2NBF A;  2B2Y C;  5JVH 3;  4IUT A;  1DON A;  1PYW D;  1GOZ A;  5G3L D;  1EYC A;  1JIC A;  4CHT B;  3MTS A;  3BYY B;  1I4H A;  4B08 A;  2F0K A;  1WD1 A;  5C4H A;  1QJO A;  2EYM A;  3P20 A;  2O4X A;  3OSO A;  5IGE A;  1STE A;  1W6K A;  5D3D A;  3GV6 A;  2BA0 A;  2LY7 A;  1QNK A;  2RA4 A;  3D4R A;  1HUM A;  2V4D A;  4HAE A;  4ODG A;  4HCS A;  1EWH A;  3GP7 A;  4K6D A;  5C44 B;  1B1Z A;  3HOW B;  2EY2 A;  5DNF A;  4UDU C;  3KK7 A;  4FXG C;  2WKC A;  2H1E A;  2D62 A;  3OPO A;  2BCO A;  3UI2 A;  2NTT A;  1HFN A;  3KUP A;  2HUG A;  3A7A B;  3VA5 A;  1D2B A;  2MPM A;  5C4J B;  2LS0 1;  2L1B A;  3K57 A;  3J81 L;  1OXU A;  4IUP A;  2VUM B;  4X3S A;  1TY0 A;  1EY7 A;  3MXU A;  5D65 A;  3SK5 A;  2KCN A;  5JPN C;  1S5D D;  2AWO A;  2EVB A;  1TQO A;  3CU7 A;  2F0L A;  4KY7 A;  4KKU A;  3DWP A;  1OXS C;  3H91 A;  1ZYR D;  2QKI C;  3NPP A;  4F87 A;  2RQX A;  1EYD A;  1FGB D;  5C3W A;  3RMH A;  3QIA A;  2MHV A;  4C3J B;  4ID6 A;  2Q8R E;  1OXV A;  1JOQ A;  1O7Z A;  2XIW A;  1DCZ A;  3BVZ A;  4RH6 A;  4ZAI A;  4KY6 A;  4QUF A;  1X3Q A;  2F4I A;  4XT3 B;  1SYD A;  4N9P A;  4R8I A;  4H0L C;  1WTQ A;  5DEH A;  4KV6 A;  5JVG 3;  2IW3 A;  1F2L A;  4G7O C;  2B2U C;  5TSS A;  5D3I B;  1ZEQ X;  2WKD A;  1QCB D;  2FJ2 A;  2SEB D;  1Z7T A;  2EPB A;  5EQ0 A;  3TSS A;  3MXP A;  4DA2 A;  1ROD A;  2B2T A;  2A6E D;  3SHL A;  3PIO 3;  2CVR A;  5DM7 3;  2F1M A;  1BCP F;  2F0N A;  1TWG B;  3QWN A;  1B44 D;  1I50 B;  4FXD A;  1E0B A;  4DF7 A;  1JWS D;  3U9O A;  2KEE A;  3PIP 3;  2VNU D;  3C1F A;  4ZKB B;  2IPK D;  3H3V C;  1HA6 A;  1NR2 A;  2R3Z A;  5IGF A;  2PZU A;  2VB3 X;  4WOR A;  3KLS X;  1JOK A;  4K8J A;  4RHS A;  4CJ1 B;  1K8M A;  4BA1 I;  2WIN B;  1D5Z C;  1X32 A;  2X6G A;  3ERQ A;  1Y8O B;  2F0P A;  1FR3 A;  3ITP A;  4CGY B;  5FK9 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...