2XSCA

Crystal structure of the cell-binding b oligomer of verotoxin-1 from e. coli
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
69
structure length
69
Chain Sequence
TPDCVTGKVEYTKYNDDDTFTVKVGDKELFTNRWNLQSLLLSAQITGMTVTIKTNACHNGGGFSEVIFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Cell-Binding B Oligomer of Verotoxin-1 from E. Coli.
pubmed doi rcsb
molecule tags Toxin
molecule keywords SHIGA-LIKE TOXIN 1 SUBUNIT B
total genus 16
structure length 69
sequence length 69
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2010-09-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.70 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2xscA00
1D1KA 4ULLA 2GA4B 1R4PB 1DM0B 2XSCA 1CZWA 1QOHA 1C4QA 2C5CA 4M1UB 1CQFA 1D1IA 4P2CB 3MXGA 2BOSA 1CZGA 1R4QB 1QNUA 1BOSA 1C48A
chains in the Genus database with same CATH superfamily
2EYPA 4Q5VA 3HKSA 5C3EH 4RCNA 3BDOA 5IYDH 2YU9B 5FO9B 5M5WB 4GNXB 2JA8B 1EU4A 4BXXH 4XTCS 1HH2P 3L2PA 1LLRD 4B9XA 2QKIC 3SEBA 2F52A 4LUZA 4A75A 4CJ2C 1PH2A 3L0OA 4K2KA 4MZ9A 4QUFA 4IUPA 2F3IA 3KLSA 2RKSA 1B44D 2V1CC 3MZ5A 3T1HL 3G7LA 2AMCB 5LHY1 1AE3A 4ZKCB 5KYLA 4C3HH 4DV7L 4X62Q 1VQLA 3CCRA 2R93H 1NMFA 5CBEE 3OW7A 1SROA 1KD1C 1W6JA 1K0RA 2B3GA 3OSOA 4C3JB 5IE8A 3S24A 3G48A 2JJQA 2KHSA 4WORA 3STBC 1EFWA 2L15A 5LMNL 3ZYYX 3A55A 5CV8A 3I90A 3RN2A 1IKMA 3WWVA 3G6EA 4N9PA 5GQOA 3GTMH 4RKBA 4CKEA 4I7AA 2I46A 3ZJYC 1B3AA 3MVVA 5G3LF 4JI5L 1PRTF 3CQZB 2LMCB 2R61A 5IY0A 5C3EB 4BS9A 2D2CC 3HS0C 2N3SA 1VQ5A 3FKIB 4AQYL 1SE8A 1EYAA 1SYEA 3I8ZA 2PCFB 3FEWX 3KJPA 1SMYC 1LTAD 2E5LL 2EY6A 1HCZA 2D5DA 3VR2A 3M7NA 1SNPA 3RD4A 4A3MB 1TS5A 3M3YH 1LTSD 2PMZE 2VUMH 5IGGA 1G91A 4A3GB 2MGSA 3MXGA 2K7VA 5E7NA 3HOWG 3MA2B 5IP7G 4IZ8A 3S17B 1QUQB 3KLWA 1Y69U 4C3HB 2ICEC 2EVBA 1STHA 2IX3A 1P16A 4AYBG 1ZYRC 1L0WA 1TS2A 1RL2A 2CCZA 2KJXA 1A3VA 2GN5A 2R93G 1E3PA 1YBYA 2JA7G 3PF4A 1CQFA 1S5DD 1PLFA 4JI8L 2PQAA 1HJPA 4GKJQ 2NVXH 1D6EC 1TS3A 1TIID 4XIGS 3NQTA 1BCPD 3FPPA 1I4XA 4X3SA 2F0SA 4LFAL 4R9WA 1GUTA 4AIMA 4F87A 3FDTA 1FJGL 1SAPA 4DR4Q 3LGJA 1U4PA 1CKMA 3KLSX 2VQFQ 3NWTA 1IBLQ 2XTIA 4BXXG 3CQZH 4UP7A 3M9BA 3KDFA 2KVMA 3EIVA 3A8JE 5C0XI 1K28A 3Q24A 1A0IA 3D0FA 1QVGA 3X3NA 2D9UA 2B2WC 3WOEA 5DNFA 2EPBA 3S2HH 3S16H 3E6ZX 4ME3A 5BR8L 3NTHA 1XPRA 2R7FA 1EWIA 1XNQQ 5KNCA 4OX9L 2C5CA 1ICFB 5HURA 4IUQA 4B3TL 3I4NG 3GTLB 4P2CB 2B39A 3H3VI 2M9VA 1NTGA 3SE0A 4POFA 1SNMA 5E4XA 5A2QE 4DV3Q 2Z6KA 1KLGD 4HJ7A 3SHLA 5A35A 3EROA 1I50B 4JOIC 5ELNA 4KHPL 2OQKA 3QOJA 5C3XA 4A3EB 1Z6HA 2KQ3A 3OTOQ 3FP9A 3GDEA 1GJXA 5DM63 2BH8A 2K1BA 3VR5A 4KMUC 3T13A 3T1YQ 1JWUD 4IQZA 3HP3A 3EQLC 4M1UB 1HR0Q 3I4MH 1HNXL 1SYCA 4NW2A 4L5QA 5BN3A 4POGA 4IFDG 1RD9D 3BJUA 2LKVA 4F88A 4B3SQ 1WI5A 3KBXA 2X6GA 4LW1A 1B1ZA 4JI4L 1HZAA 1FNUA 2B2WA 1N34L 1ICWA 3FRPB 4K8IA 3OTOL 1PZKD 2R92H 2R7DA 4DV4Q 5KNBA 5JEAH 5C4JB 4A4IA 5C3WA 1IL8A 1A6XA 1YIJA 4DV3L 1M4VA 3MHBA 1PFBA 2PNRC 1BDOA 2OT2A 2MP1A 2Q2IA 1E24A 3PIOA 2Z6KC 4DR2Q 2K04A 4BA1I 1NAPA 2ZXOA 3S15H 1SXTA 1V8QA 4GKKQ 4A3JG 5IGBA 3OMCA 1X3FA 5K36H 2RDGA 4RMFA 2M2LA 5D65A 3PV0A 2L5TA 3GP7A 5AJ3Q 4A3LG 4DAPA 3HOZB 1L1OA 2ZM6Q 1ENCA 3W2DA 4BY1H 3EJIA 4A3GH 5IOCA 4LUVA 2K32A 2JSOA 3M85A 4J8QA 4RHRA 1X6OA 2ZTCA 4HCEA 1EIHA 4LJZC 2WINB 4YHHQ 2L11A 2RQXA 1Q3LA 2QA4A 2I07B 4P72A 2KCMA 4GNXC 2B63H 1IW7D 4JI2Q 1PV4A 5FKAC 4KY6A 1PYWD 3S9WA 4FXDA 2BA1A 4OX9Q 4O2DA 1GUWA 1JICA 2E2HH 1D7QA 1X65A 3K81C 3E0EA 2L1BA 4L5SA 2QDBA 1PH9A 1V1PA 3GTPB 2KCCA 4N8FA 4RFBA 1XNRL 3GTPH 1XX8A 1EQQA 3RN5A 2EYMA 1XYIA 3GTMB 4B3RL 5CV9A 5JPNC 4FO2A 3RR5A 3PUVA 1HUMA 2LSSA 1KL9A 4KJOA 1CA6A 3HOYG 2RHSB 2K52A 1E0BA 1WJJA 3K5LA 5FLXc 2L0CA 2O5JC 3OMGA 3CPFA 2WKCA 4X65L 1NNXA 1A3TA 3LX0A 1WCMG 4DK1A 2A19A 4GOPC 1VQJA 2EY1A 5M3MG 1BCPF 1S40A 5IYBG 5IP7H 3HOWH 1BR9A 3Q0AA 2UUBL 2BE5C 2VUMG 4NXML 3RZOB 5FLXL 1VMCA 1K8MA 4LAAA 3GO5A 1B9MA 3GV6A 1QUQA 3K5OA 5JJZA 4IOCA 3G71A 5IIFA 3I7FA 2O2LD 4JBKA 4LF6L 4FF1A 2EYHA 1I50H 1QNUA 1PH1A 3JAML 1TU2B 2A6EC 4X3TA 1SBBB 1Y1WH 1EL0A 1QVFA 1VQEA 2K6AA 1UEAB 3CMEA 1TQOA 4JI1L 4R8IA 4R1JA 2JK8A 1PH4A 1KXLA 1TWAB 4YHHL 1U0LA 1F9RA 2EJFC 1J5EQ 3IFTA 5H1SE 3NK9A 5HGQA 1I3QH 2YU9H 5I9OA 1BVSA 4BBRB 4Q0FA 1WD1A 1BQQT 1Y1VG 1KDBA 3A8IE 2ASBA 3BU2A 2EYJA 1EYGA 4L63B 4OWWB 3MXNA 2VW9A 4J1MA 4YY3L 5IT9E 5I6WA 1WFQA 4ZYSA 3RUZA 3C2PA 2GVAA 3DXJC 4BWGB 5IYCG 1KABA 2CWPA 4O1NA 3CU7A 1G6ZA 3DHQA 2K33A 1KDCA 3ND8A 4N9TA 3FVQA 2KEDA 1SE3A 4EGVA 4DUZQ 4C3HG 2CWAA 5F2DA 3TS0A 3SXHA 3HGBA 1IBKQ 4ILWA 4JI3Q 1CKNB 3A5ZB 5EPKA 2KCNA 3HOXG 3HOVB 3VR4A 5BR8Q 2KCTA 3TZUA 4JOIA 3NXWA 4DR6L 5DAUA 1QZHA 4ZAIA 3SVMA 5C4HA 5CMDA 2NN6H 4TVAB 1HTLD 1SDFA 1R9TH 1EEID 4PMBA 1DD2A 2HD3A 5LL6S 4A3EG 4APVA 2NZ1D 3QG1A 2EYFA 1LTTD 1UE5A 4DAVA 3K0YA 2EY2A 2Z1CA 4DGZA 3NUCA 1WTOA 2ZXRA 3ULLA 2P5ZX 4ZRZA 5NUCA 5IYCH 3I72A 1LTRD 3I3CA 1K0SA 1F2ZA 3A8KE 3W1BA 3CD6A 4IOAA 3PO3H 1FD7D 1LT6D 4A3BB 2UU9L 3L7ZC 1GUNA 1UE1A 2ZJQA 4A3BH 1CZGA 1HZ9A 1R4QB 1G2TA 4A3MH 2OXPA 1TXYA 5T1IA 2F0DA 2EIFA 5KYIA 3OWFA 3OIQA 2CW0D 2K5WA 3VR3A 1I4PA 3SR1A 3F2BA 4NXNQ 5J3BA 4BBSB 3BDLA 4OO1I 3CW2C 1N36Q 1LTLA 2VQEL 3ITPA 1Y1WG 2PI2A 3S1NH 1TVXA 1E22A 4Z9CB 5EAYA 1TY0A 1BXTA 4O42A 1U4LA 2B2VC 4CGYB 2TMPA 3EN2A 4OO1H 5FJ8G 5EKIA 1JC7A 1IKLA 3UDXA 2A8VA 3NBHB 4V0BA 1BKBA 1D1KA 2F0KA 3BYYB 1JJCB 3M3YB 1CKOA 2JP1A 1F2YA 2GA4B 2PQAB 4P74A 1MBYA 2OTLA 3CHBD 4LF9L 3C1FA 1B50A 1TY2A 4K2LA 1PYSB 4RGOS 1SMYD 3K7UC 5CORA 1JMCA 2WFWA 5I2YA 1E7ZA 1KAAA 1FGUA 4XDXA 4HR7B 2PNHA 3KF6A 2AQ2B 4OWTB 1UE6A 3J7YW 1J9OA 3D8GA 4DKAC 3HOYH 1LTID 5C6AA 4LF7Q 1HUNA 1DM0B 1I3QB 2UUAL 2F0TA 5IGFA 1OXTA 1ENAA 3PGZA 2CFMA 2UXDL 4DNTB 2Q8IB 2BDNA 4X62L 1STNA 1VDZA 2Z8LA 3E9IA 5J1ZA 1XMOL 4FXGC 2MHVA 2G9HD 1RDPD 3D4RA 3S1RB 4QQBX 4BA2I 2VY3A 1V43A 2DY7A 4IPCA 2KUMA 2FMMA 3T16A 2BH2A 3U58A 1CT1D 2K14A 4UDUC 1JORA 3J81i 2N49A 5M3FH 4I7ZC 2MPMA 4B3RQ 1GUOA 1Z9FA 1VQ6A 1HNWQ 3MFYA 1NBWA 2AWOA 2J4XA 3PIPA 4PG3A 1M8AA 2I5MX 3KF8B 4DUZL 2JA7B 4Y52H 2JA8H 3OYYA 3PSIA 2UU9Q 1MKHA 5I4DA 3HOVG 1TWFH 3MFGA 3MXNB 3S17H 4AYBE 1X56A 4K6DA 2J7ZA 4A3GG 5ELCA 3NELA 1VQDA 3HKZG 1AH9A 4BY1G 1I4QA 4KY7A 4RKLA 4A3LH 5IWAQ 1AZPA 2YYZA 4RAUC 4NXMQ 2HQEA 4A3JH 3T56B 1HZBA 1QG7A 2ES2A 2UUBQ 2AUJD 3TN2A 4X64L 3PO2B 1B8AA 3K5MA 4KKUA 2F4VL 4UY8C 2XRQD 3F2UA 1YEZA 1SNCA 4LF8L 2UXBQ 4ABNA 2DUDA 1QCBD 2PMZB 4JI0Q 2R92G 3CAMA 1RJTA 1ET6A 1BBWA 4IO9A 4JV5Q 4IPHA 2K5QA 3GTQB 2LFNA 2EJGC 5CV6A 2WAQE 4A3KB 2XNAC 2VS1A 1CHQD 2FHTA 3HOZH 5K5PA 4IFDH 1PFMA 2N8NA 3DUZA 1EYCA 4ODGA 1OXUA 1JE5A 1WCMB 2JYOA 5CGKA 5GAHC 1C8CA 1PTOH 3A5UA 1A62A 1DYQA 5JEAJ 1EZ8A 1DOLA 2LXJA 3DEOA 3DLLA 1MGSA 4G4KA 1S4ZA 1STEA 3A7LA 4DFAA 4DN4M 4DK0A 1BBXC 2A68C 3Q6SA 4GN5A 4I65A 4C2MB 4B08A 1STBA 2WP8J 5LMUQ 4JI2L 3J80L 4RH6A 3ND9A 4KD4A 2EZVA 4U673 3MTSA 2WB1E 2A68D 3E0JA 3GQBA 4A3CH 1HZCA 1PRTD 2RDHA 3I4NH 1HNWL 1J5EL 4LF4Q 1VQGA 3FPUB 1CK1A 1WTHA 2F1MA 1NY4A 2UUCL 1VQ8A 2R7ZB 4EQOA 1X32A 4TQUS 2E2IH 1PH6A 2R7ZH 1V1PB 3KK7A 3CRKC 4DK6C 4K5WA 1JWSD 2R93B 1D1IA 3TP8A 4EQ5A 1KRTA 1IBMQ 3K5NA 4LFCQ 2F0NA 4A3JB 1NUCA 3N6RA 2SEBD 1GUSA 5IGEA 2JA5H 3QR8A 2XN9C 1SFOB 1O78A 4LF7L 5LMNW 1Y8NB 1Y8OB 5C4XB 3I4LA 1E2VA 3D4DA 4WJ3M 4DR7L 3MC0B 1HQMC 3RMHA 5D3DA 1GM5A 4HN7A 3KOJA 1NJIC 5CR3A 2F03A 4R4OA 1HPCA 3GTOB 5LL6X 4GLVB 1SE2A 4R4TA 3C46A 2K50A 1YVCA 2CQAA 1F9SA 3RZOH 3BZCA 4OGQC 4OEMB 1GHJA 1LT5D 5M3FB 2HT1A 1YITA 1U9RA 1N33Q 3DWAA 2FJ2A 1J8IA 3R2IA 3K58A 1H9SA 3B6YA 1LV9A 1F77A 1QOHA 3CP0A 3I56A 4RHSA 3NQIA 2B2UA 1SR3A 3D6CA 4HMJA 2OF1A 3DEPA 3ULPA 3HKZB 2ZXPA 4KD3A 4DR2L 2KECA 1OO9B 4QL5A 4C3JG 1RIPA 2EJMA 3F8TA 1LM0A 1SNOA 5ELFA 3STBD 2IY5B 1LYLA 1JJ2A 1EOVA 1YJWA 2NZOA 4LF9Q 2ALYB 3I2ZA 2KOLA 1IHZA 2EOTA 1EWHA 2G5DA 3OPOA 3NENA 1HHVA 2JA6G 1EZ6A 1DJRD 3D6WA 3S16B 1AN8A 4QF4A 2M00A 3E3XA 1CQVA 1KNAA 3HOWB 5HGTA 4HIKA 2TSSA 3U9OA 1C48A 3CC4A 1Y14B 2D62A 1DONA 1JJGA 4DV0L 1HNXQ 3NHHA 3PO2G 2CVRA 3OW2A 1HNZQ 1AP0A 5EKLA 1RTOA 3BS1A 2IX1A 2PZUA 4JI7Q 1I94Q 5M5XB 5CV5A 3BDCA 4PZ6A 1X3PA 2A74C 2E76C 4CJ0B 3RLFA 1RKNA 1WTRA 4H44C 3S1NB 1VCIA 4C1NK 2F4IA 3LWUA 1XPOA 1KTKA 3PF5A 5FLXE 1EQRA 5CYUA 2MNAA 3CCJA 2NVQH 1VF7A 1SSOA 2Y0SB 2PO4A 1FR3A 4A3IH 2NVYH 3LWEA 2H5XA 1PH3A 3IFDA 4ME5A 4G7HC 4JI4Q 1VQAA 1NE3A 3R2TA 5E4WC 5GAEC 1CHPD 3K80C 2D0OA 3R3OA 2AWNA 1EIGA 1Q1BA 3SGIA 3URYA 3VA5A 1WTXA 1Q1EA 5JJLA 2N78A 1K83H 2PYKA 4FP5D 1N8RC 4FDBA 1X55A 1K8OA 1IL2A 5IYDG 1EY9A 4GOPB 3D3RA 3W5OA 2K75A 3K59A 1ESRA 3KUPA 4RG1A 4OHJA 1PZJD 1QJOA 3RZDH 1H9SB 1TR5A 2Z6BA 2K03A 1D2BA 4PNYA 2EE1A 1X3GA 5C5LA 4K0KQ 3FHWA 2JN4A 4GKJL 4DR3Q 3F2CA 2R7ZG 2CH4A 3TMEA 3EA6A 1PVOA 1LTBD 3NEMA 3NBIA 1K83B 1I4GA 4ZUIA 2A6HD 5E3FA 2ID0A 5IT9L 1DOKA 1T9HA 2B2YA 4KLKA 2AHOB 2WACA 1NR4A 1STAA 4O0AA 4BY7H 4J15A 3TP6A 1N34Q 1X9NA 4A76A 5JPMC 2JEBI 4JK1C 5KEEA 2PZTA 4DXFA 1Q86C 3U50C 1ASYA 4YIJA 2NN6I 2FMCA 1LACA 2PPBC 4FXKC 3CC7A 1H9RA 1Q81C 2JXMB 3R93A 1NR2A 3PIO3 2IL8A 5IODA 2NVTH 3HOZG 3F1ZA 1UNSA 2C9OA 1JCKB 1PRTB 3PQIA 2B29A 3K6OA 4HIMA 1S5ED 3M4OB 1EY0A 4C56C 5J39A 3IL8A 3NE5B 1G51A 5CV4A 4G7ZC 2N55A 4V190 2WKDA 4K5XA 1PRTC 1Y1WB 2Z4HA 3TSSA 2A73B 1B2TA 1Q12A 3BYTB 4JI3L 1VQKA 4HJ8A 4FF3A 4NMZA 2ZJPA 5FLMG 5JVH3 3ERSX 4P75A 4LMQD 1O7LA 1E1TA 4QY7A 2G9DA 1B9NA 4RGTA 3PUWA 4UP8A 5IGDA 1G291 2LY7A 4K6LA 4DV7Q 2O4XA 4P73A 1VQ4A 4S3SA 3M4OH 3GTOH 2A6ED 4GZYC 1I6HB 2MO0A 1QZGA 1PH7A 3K7AH 4JI7L 1T5EA 2B2UC 3D31A 3TREA 2JA8G 4A93H 3H0GB 3VYSA 2YV5A 4ZCKA 4BBSG 3PUXA 3QJYA 4EQNA 4WJWA 4CDCC 1BF4A 2NVXB 4NPSA 1I6VC 3H3VH 2EXDA 4A3IB 4C3IB 4BBSH 4QB4A 3UDIA 1JOQA 4C3IH 1EU3A 2F0PA 3H94A 4JI8Q 1WTPA 3VYUA 3S2HB 5LMNQ 1BCPB 1K3BC 2EYOA 1TWHH 2KHJA 1GOZA 4PQXA 1D8LA 3UI2A 1PDQA 4FF4A 3KF6B 4A93B 4BY1B 2YTYA 2IHEA 1BOSA 1BCPC 3GD7A 1WTWA 1RF2D 1IBLL 2FINB 2GVBA 4DAYA 1ENFA 1GD7A 1H9KA 5FOBB 1H9JA 3S1QH 1BBUA 1O7YA 3M4PA 1FNWA 4CHTB 1HXYD 5IP9H 2MQHA 3BZKA 1S5CD 2PQEA 5C0XJ 4XXEA 3K0XA 5LMUL 4IALA 2JEAI 1YHBA 3RLNA 4OXPA 4ZK9B 1Q82C 4MTNA 2RVLA 1ILQA 4DAMA 3HRZC 4ZLTF 2I0QA 2KA7A 4IUUA 4XQJA 1O7IA 1ASZA 4ULLA 1M1KC 1U5KA 4IPGA 3J7AF 1UE7A 1MJCA 3P1HA 4HJ9A 1FGBD 4CKBA 1I6HH 1A63A 2NVYB 3BZDB 1WTQA 4PZ7A 4JBWA 4X65Q 1RTNA 2AQ3B 4BY7G 1QWYA 2KHIA 4A3KG 2BCOA 3TP7A 4B3MQ 5KNDA 2HHHQ 1ZEQX 2NYZD 2VQEQ 1CSPA 4A3MG 2OTJA 4PMCA 3T1YL 4CDFC 4GLXA 1XTDA 4DR1Q 3PMFA 4A3FB 1XXGA 3TQYA 2A5HA 3J81E 1FYCA 4DV1L 3PO3G 4DV2L 1L0XB 3LNNA 1TWGB 3AU7A 1V1OA 1TS4A 4JBJA 3J7A5 4JI1Q 1MSGA 3L3OC 4LFBL 3CRLC 3Q23A 5M9OA 4GOPA 2AKWB 1GXDC 4DNIA 4MN3A 1EUJA 1MSHA 1RHPA 2RHQB 5ELDA 1KC8C 1VQOA 2RF4A 3P7JA 4GN3B 1XNQL 3D4WA 3HOYB 3Q22A 2E8GA 2IX0A 2E2DC 4YCVA 4K0KL 2NVTB 4A3FH 1IXRA 1Q7YC 1VQ7A 1RCVD 2DJFC 5I9PA 4IFDJ 2PW7A 1OXVA 5JVG3 3S1RH 4A3DH 5ELBA 2NVQB 1ML0D 1CM9A 4MNOA 4KKSA 2JA9A 4XT3B 4A3FG 4DV6Q 2KBNA 3A54A 2QGQA 3H91A 5CV7A 3DMUA 3KJOA 4Y7NH 3R8BA 5JAVA 1Q8IA 4KY5A 2WB1G 4NKLA 4RA8A 1G2SA 3VDYA 3QOLA 1O80A 4F7XA 4H0LC 2HUGA 3NTKA 1D5ZC 4QIWE 1BNZA 1KHIA 3MXUA 2OCEA 2E5LQ 5ISRA 1S72A 2BE5D 3H09A 2K5VA 3MWYW 5CBAE 3NTIA 4XT1B 1W3SA 2I5HA 5M5YH 4LF6Q 4K5VA 5J22A 2E75C 1L2FA 1JQYD 3CCUA 2OQ0A 3TZDA 1XMQQ 1YI2A 1ET9A 4A3KH 1E2WA 1SYBA 5IGCA 2ENBA 4JYAQ 4LFBQ 1KDAA 2VZAA 2K4KA 4PMWA 4DV2Q 4C1NI 2C35B 4OIKA 3S14H 4KK7A 1I94L 2WB1B 2VXWA 4YWKA 1V9PA 1EEFD 5I2XA 2ZM6L 4C3JH 2E2JB 1N33L 3VYTA 4KN7C 3H3VC 1SLJA 4DUYL 1STYA 1YJNA 1GVPA 2ZT9C 4R8NA 2E2HB 5IYBH 3ULJA 1SYGA 3X3MA 1C7YA 4JI5Q 1XMOQ 4HIOA 3BVGA 4JW0A 4BBRG 2F3VA 3SK4A 1XWEA 2SNSA 5IP9G 1V1QA 2MO1A 3P20A 1F2MA 4IN3A 4DR7Q 2VB2X 1G6PA 1H95A 1AFPA 4ZKBB 1VQCA 1II3A 1F9PA 3V05A 2CW0C 2Y0SG 4MHEA 3C1EA 2HIVA 2F0QA 4ID6A 3MEFA 1CSQA 2YTXA 1YNJD 5C44B 3GTJH 3AQQA 2DNCA 1TWHB 4YCWA 1PH8A 1FL0A 1SE4A 4G57A 1AE2A 1B7YB 1GKHA 1I5FA 4CKCA 3A7AB 1TKWB 4U68A 3S2DH 2VNUD 3U9SA 3P75A 4XQQA 1QVCA 3KBGA 3PO3B 3IKJA 4YWLA 2XRSD 2UUCQ 5C4JH 5GROA 5IT9c 4BY7B 4C3IG 4DR1L 1BO0A 4HJ5A 1ESFA 4UP9A 2X69A 2IW3A 4LFAQ 5BN4A 4DK3C 1IZ6A 3JC66 2Q8TA 1MI2A 5AJ3L 2B63G 2HQLA 2JA6B 1XJVA 5D14A 2B8GA 2B2YC 1LO5D 3H0GG 3UDGA 3I4MB 2UXDQ 5A2QL 3SK5A 1T5XD 2F0EA 3S2DB 1C0AA 1D5MC 4LFCL 3G6JB 2QILA 1IBML 2F0UA 1PHJA 5M3MB 1IYVA 4A3CG 1OXXK 3G4SA 1DOMA 5T1GA 2UXCQ 1EY8A 1PA6A 5AFWA 2A1AA 4DV4L 4YCUA 2NZHA 1IYUA 1JE4A 2F0VA 5FK9C 1K8AC 1DGSA 1QE6A 5FLMH 2K05A 1EIFA 2XWJB 1ZKOA 1SMXA 3QWNA 2Q8RE 3PIP3 3VR6A 4DV5L 4HTHA 1WD0A 5C44H 3GTJB 4R4QA 1DCZA 4DV1Q 3PUYA 4AYBB 4L5RC 5EPLA 5E1FA 1ZYRD 3AB9A 3FKIG 5ELOA 4GKKL 3KYHC 5FO8B 4RGMA 3S1MH 2F0IA 1E2ZA 3RLOA 1STGA 2K28A 4B3ML 2FXQA 5M5WH 4LF5L 1O7ZA 1PFNA 4X66L 3M7GA 4PZ8A 1Y1VB 3NP8A 1D5XC 5I6YA 3I4MG 1K3RA 2VB3X 1DXMA 2B2TC 4LK1C 1QILA 3FKIH 2BOSA 1KLUD 2B63B 5C44G 2SOBA 5M5XH 3RNUA 4UHVA 1SYFA 1YHAA 2WV6D 2Z4IA 2ZTDA 5G3LD 1CTMA 4X66Q 1JB3A 3IAYA 3KDFB 4TRDA 3VYRA 1UAPA 1VF5C 2VUMB 1EY4A 5CC4A 3A56A 1HR0L 1DZ1A 4HIDA 1CFMA 4MIUA 4MTKA 3T53B 2E2JH 2YTVA 1EWCA 1Z7TA 3CCLA 2XIWA 3CCSA 4JV5L 1J6QA 4HJAA 1EY7A 3W3AA 4H13C 2RCFA 3KF8A 1G8ZD 3JAMc 2D0PA 3HG9A 1AW7A 4TKOB 1CI3M 3HOVH 4DR6Q 2NBFA 2F0LA 4C2MH 2R6GA 1UEBA 4N8X1 3H0GH 4CBVA 2DJGC 1B53A 3ER0A 4B3TQ 1N32L 2A69D 2MJ8A 1K73C 4FF2A 2B8FA 4OELB 3DWQA 3S1QB 1W6KA 3S14B 2JE6I 1JOOA 4K8JA 4P71A 3OWEB 2IPKD 2NTSA 4KV6A 3U4ZA 2HCIA 4RCOA 1HA5A 5EKKA 3J80i 3AFQA 1PYBA 1JR0D 1AEXA 3K7AB 4IUNA 1PH5A 1MHWC 3GTLH 3H15A 4DXGA 2JQOA 2R92B 1B4OA 4L6TB 2H1EA 2QF7A 1N32Q 1A2TA 2FFKB 1WYDA 3HKZE 4LF5Q 4IUVA 1CKNA 2PI2E 1EOTA 1VQPA 2QDLA 4A3IG 1FJGQ 2JA7H 1YNXA 5JJIA 1JOKA 4RWSC 1CUKA 4XYOA 3NWSA 3J7ZC 1YNND 3TRZA 2V4DA 2ZJRA 2R3ZA 2NTTA 5EBCA 1S3OA 2WIIB 3CKIB 1UUPA 3MXPA 3V2TA 4BBRH 3DM3A 3DM1A 4EX5A 2RBMA 4DF7A 1WTVA 5EJWA 2EQSA 1A2UA 2HDMA 4KHVA 2SDFA 1TWAH 1XPUA 2B2TA 4JCVE 2Q2TA 3AEVA 3QB3A 3PO2H 4HSPA 3V96A 3WDNA 5FJ8H 4OO1G 1JT8A 4YWMA 4X3KA 2UXCL 1L0YB 5BN5A 3CCMA 1XNRQ 1ONLA 5EPJA 3GTKB 4X3UA 2E2IB 3GTGH 4HCSA 1M90C 3GTKH 2X6LA 4FNFA 2L9HA 3KFUA 3GTGB 1X54A 2JA6H 4JPBW 3U4VA 3HFZB 4Y7NB 3J80c 1SJED 3QO2A 4GN4B 1EY6A 3JAMi 1B70B 1WVLA 2F0FA 3CCQA 2DY8A 1TT2A 4HMIA 2NWGA 1SNQA 4LWCA 4FYDA 2BA0A 4XQNA 1X3EA 2F0MA 3HOUB 2NUCA 3I4NB 3M4YA 2XWBB 4DV5Q 5JJKA 1B3QA 4IFDI 3N52A 1KAWA 1R9TB 3PUZA 4KKTA 1N36L 1VQ9A 5EGTA 4ZUJA 4DA2A 1EYDA 1LUZA 3CXCA 4ALPA 3OHXC 5EBDA 2K5DA 5GAGC 2SNMA 4OL7A 4KJNA 4M8AA 4A3EH 1K8GA 1AZQA 3OOCA 4ZQ3A 3GTQH 1E1OA 3T51B 4KTAA 1W2BA 2NN6G 4H02A 5TSSA 3BG3A 3BVZA 4JG2A 1PTOD 4KHZA 2PW5A 2RSOA 2HCCA 4DAYB 4A3DG 2XVSA 1OXSC 1S5BD 1SN8A 1VMPA 2B2VA 2IJ0A 4KN4C 3TBIB 2CKZB 3CC2A 3TEHB 1A3UA 3HOXH 1IYJB 1L1OB 1PTOC 4JC0A 1YHQA 4LF4L 2ATWA 4IUTA 4WJ4A 4YY3Q 3HOXB 2EDGA 4XYQA 3E5SA 2F3WA 2ICIA 2JA5G 1LT4D 5C3EG 1FNVA 2WAQB 4OONA 2NB0A 1F2LA 4DR4L 3AFPA 1L1OC 1PTOB 1VQNA 2XSCA 1JWMD 3IRBA 5C4XH 1Q8KA 3EBEA 3CPWA 2QEXA 1HQRD 4DR5L 3NSWA 1SEBD 3A74A 3CCEA 1U4RA 3A0JA 3S15B 3AYHB 2H4OA 2K5HA 1U4MA 4B9WA 1LABA 2ZTEA 4HSVA 1IBKL 1Y1VH 1H9MA 4DR3L 3C3LA 4H7BA 1UWVA 1PXUA 1YZ6A 4OIJA 2LXKA 4UAIA 4X6AH 2Z9HA 3HOUH 2RDFA 5KIXA 1EQVA 4CDDC 1OTCA 3S1MB 4AH6A 1MD2D 4CDEC 4NP5A 1PMRA 1YNNC 4NB3A 3VA7A 4DR5Q 1FVIA 4JI6Q 2WAQG 3AMUA 1C9OA 4DU9A 4DUYQ 5C0XH 3J7AV 2IWHA 2HHHL 2Q2HA 2AQ1B 1HNZL 1SRUA 1Q46A 2L55A 1NMGA 4A3DB 4KHPQ 1SJHD 4UPAA 4EQPA 2K5NA 2F0HA 4DNRB 2CH4W 4RGNA 3ONAB 4LF8Q 2UXBL 1BUVT 3DWPA 1VQMA 2F0GA 5DEHA 5C5MA 4JI6L 1XMQL 5M3MH 2F4VQ 4IURA 1WCMH 3I4OA 1GUGA 2IHFA 1K9MC 2EYLA 3PCOB 2Q2UA 4JYAL 4QGUA 2A6HC 1VQFA 3W1GA 1YJ9A 3EFXD 2HIXA 1MIUA 2PZWA 3J81j 2DGYA 1X3QA 1QNKA 4NDXA 3RZDB 1NSNS 1NCVA 3QIAA 5KRUA 3J80E 2MFIA 1IW7C 1VQBA 3FMCA 1ILPA 3K8AA 4DV0Q 3MEHA 2RSNA 2JA5B 1P8LA 1EFID 1GO3E 1PTOF 3I91A 4QJFA 3CF5A 2K01A 2KEEA 2DN8A 2QEJC 3I73A 1PFSA 5ELEA 4IJLA 3TP5A 5DM73 4E6IA 2QCPX 1R4PB 4FVMA 3GV3A 4X64Q 1LT3D 4J6HA 4WFN3 1RODA 4QUCA 1C4QA 2MUYA 4LNQA 5IWAL 3TS2A 3UE0A 4EVOA 2A69C 1SYDA 4L5TA 2EXZA 3UDFA 2F0OA 1N9WA 5GADC 5D3IB 5M3FG 4HAEA 3KLRA 1SFOH 4A93G 2DNEA 2RA4A 1KRSA 2J0TD 3T4AC 5FO7B 1MJEA 3CMAA 2UUAQ 2IT1A 4GNXA 3SK8A 4L8JA 4WRDA 4QIWB 3ICEA 1F9QA 1KQSA 4PV1C 3HZXA 1TWGH 2F0WA 2OEOA 4IJHA 5EQ0A 3JAME 2AUKA 2KENA 3H6MA 1JB7A 1VQHA 2Y0SE 3CCVA 2OWOA 1HA6A 5K36G 1QB5D 5C4ZA 3I70A 1SNDA 2LS01 4K14A 4QMGA 4DPGA 2CHBD 1VQIA 3WOFA 4GLAC 1WOCA 1EY5A 5L37A 4CJ1B 1S5FD 2EY5A 4IPDA 3E9HA 4DV6L 1I4HA 2VQFL 1Q90A 2N88A 3SK6A 4LUOA 1HFNA 4AQYQ 1HTPA 5HY6A 1KIXA 4OWXB 1CZWA 3NPPA 5JEAG 3OIPA 1A15A 2CQOA 3I55A 4F8MA 2VL6A 2RCNA 1KNEA 3SDZA 1YNJC 3EVQA 5M5YB 3J81c 2L4NA 3TDQA 3ERQA 3BVMA 5COYA 4NXNL 2Z0SA 5KGUA 5C0XG 1Z47A 3L9AX 3K57A 1I4RA 4HEDA 1TWCB 2E74C 2HDLA 1TWCH 4KI0A 1PZID 2BDOA 3HEJA 1ZXTA 4JBMA 1HR0W 3HOUG 2XGTA 5JOBA 4B3SL 5DLQE 1TWFB 4R4IA 1LTGD 4TSSA 4JI0L 3M4QA 1XTCD 3MAQA 4A3BG 1VS0A 2F0JA 1CA5A 3O13A 2QW7A 1HRJA 3F2DA 3UE1A 3Q8DA 4R4CA 3NBHA 3J81L 1HFGA 1EIYB 4G7OC 1A8VA 1EQTA 1Y8PB 3T1HQ 5C4XG 4GS3A 4JVZA 1GHKA 2I5LX 2L12A 4QCLA 2O5IC
chains in the Genus database with same CATH topology
2EYPA 4Q5VA 4RCNA 3BDOA 2YU9B 5FO9B 5M5WB 2JA8B 1EU4A 4XTCS 1LLRD 4B9XA 2QKIC 3SEBA 4CJ2C 4K2KA 4QUFA 4IUPA 3KLSA 2RKSA 1B44D 3MZ5A 3G7LA 5LHY1 4ZKCB 5KYLA 5CBEE 3OW7A 1W6JA 3OSOA 4C3JB 2KHSA 4WORA 3ZYYX 3A55A 5CV8A 3I90A 1IKMA 4N9PA 4RKBA 4CKEA 2I46A 1B3AA 3MVVA 5G3LF 1PRTF 3CQZB 2LMCB 2R61A 5C3EB 4BS9A 2D2CC 3HS0C 3FKIB 1EYAA 1SYEA 3I8ZA 2PCFB 3FEWX 1SMYC 1LTAD 2EY6A 1HCZA 2D5DA 3VR2A 3M7NA 1SNPA 3RD4A 4A3MB 1TS5A 1LTSD 5IGGA 1G91A 4A3GB 2MGSA 3MXGA 2K7VA 3MA2B 4IZ8A 3S17B 1Y69U 4C3HB 2ICEC 2EVBA 1STHA 2IX3A 1ZYRC 1TS2A 2KJXA 1A3VA 1CQFA 1S5DD 1PLFA 1D6EC 1TS3A 1TIID 4XIGS 3NQTA 1BCPD 3FPPA 1I4XA 4X3SA 2F0SA 4R9WA 1GUTA 4F87A 3FDTA 1SAPA 1U4PA 3KLSX 3NWTA 2KVMA 3A8JE 5C0XI 3Q24A 3X3NA 2D9UA 2B2WC 3WOEA 5DNFA 2EPBA 3E6ZX 3NTHA 5KNCA 2C5CA 5HURA 4IUQA 3GTLB 4P2CB 2B39A 2M9VA 3SE0A 1SNMA 5E4XA 5A2QE 1KLGD 3SHLA 5A35A 3EROA 1I50B 3QOJA 5C3XA 4A3EB 1Z6HA 2KQ3A 1GJXA 5DM63 2K1BA 3VR5A 4KMUC 3T13A 1JWUD 4IQZA 3HP3A 3EQLC 4M1UB 1SYCA 4NW2A 5BN3A 4IFDG 1RD9D 2LKVA 4F88A 3KBXA 2X6GA 1B1ZA 1FNUA 2B2WA 1ICWA 3FRPB 4K8IA 1PZKD 5KNBA 5JEAH 5C4JB 5C3WA 1IL8A 1A6XA 1M4VA 3MHBA 1PFBA 2PNRC 1BDOA 2OT2A 2MP1A 2K04A 4BA1I 1NAPA 2ZXOA 1SXTA 1V8QA 5IGBA 3OMCA 5K36H 2RDGA 5D65A 2M2LA 3PV0A 2L5TA 3GP7A 4DAPA 3HOZB 1ENCA 3W2DA 3EJIA 5IOCA 2K32A 2JSOA 3M85A 4J8QA 4RHRA 4HCEA 1EIHA 4LJZC 2WINB 2L11A 2RQXA 1Q3LA 2I07B 1IW7D 5FKAC 4KY6A 1PYWD 3S9WA 4FXDA 2BA1A 1GUWA 1JICA 2L1BA 2QDBA 1V1PA 3GTPB 2KCCA 4RFBA 1XX8A 1XYIA 2EYMA 3GTMB 5CV9A 5JPNC 4FO2A 3PUVA 1HUMA 4KJOA 1CA6A 1E0BA 3K5LA 2L0CA 2O5JC 3OMGA 2WKCA 1A3TA 3LX0A 4DK1A 2EY1A 1BCPF 1BR9A 3Q0AA 2BE5C 3RZOB 5FLXL 1VMCA 1K8MA 4LAAA 3GO5A 1B9MA 3GV6A 5JJZA 3K5OA 5IIFA 2O2LD 4FF1A 2EYHA 1QNUA 3JAML 1TU2B 2A6EC 4X3TA 1SBBB 1EL0A 2K6AA 1UEAB 1TQOA 4R8IA 1TWAB 1F9RA 2EJFC 3IFTA 3NK9A 5I9OA 4BBRB 4Q0FA 1WD1A 1BQQT 1KDBA 3A8IE 2EYJA 4L63B 3MXNA 4J1MA 5IT9E 5I6WA 4ZYSA 3RUZA 3C2PA 3DXJC 4BWGB 1KABA 4O1NA 3CU7A 1G6ZA 3DHQA 2K33A 1KDCA 3ND8A 4N9TA 3FVQA 2KEDA 1SE3A 4EGVA 4C3HG 5F2DA 3SXHA 3HGBA 4ILWA 5EPKA 2KCNA 3HOVB 3VR4A 3TZUA 3NXWA 5DAUA 4ZAIA 3SVMA 5C4HA 5CMDA 2NN6H 1HTLD 1SDFA 1EEID 4PMBA 1DD2A 5LL6S 2NZ1D 3QG1A 2EYFA 1LTTD 4DAVA 3K0YA 2EY2A 2Z1CA 4DGZA 3NUCA 1WTOA 2ZXRA 5NUCA 4ZRZA 3I72A 1LTRD 3I3CA 1F2ZA 3A8KE 1FD7D 1LT6D 4A3BB 3L7ZC 1GUNA 1CZGA 1R4QB 1G2TA 2OXPA 5T1IA 2F0DA 5KYIA 3OWFA 3OIQA 2CW0D 2K5WA 3VR3A 1I4PA 3SR1A 4BBSB 3BDLA 4OO1I 3ITPA 1TVXA 4Z9CB 1TY0A 1BXTA 4O42A 1U4LA 2B2VC 4CGYB 2TMPA 4OO1H 5EKIA 1JC7A 1IKLA 4V0BA 1D1KA 2F0KA 3BYYB 3M3YB 2JP1A 1F2YA 2GA4B 1MBYA 3CHBD 3C1FA 1B50A 1TY2A 4K2LA 4RGOS 1SMYD 5CORA 5I2YA 1KAAA 4XDXA 4HR7B 2AQ2B 3J7YW 1J9OA 3D8GA 1LTID 5C6AA 1HUNA 1DM0B 1I3QB 2F0TA 5IGFA 1OXTA 1ENAA 4DNTB 2Q8IB 2BDNA 1STNA 1VDZA 2Z8LA 5J1ZA 4FXGC 2MHVA 2G9HD 1RDPD 3D4RA 3S1RB 4BA2I 1V43A 2DY7A 2KUMA 2FMMA 3T16A 1CT1D 4UDUC 1JORA 4I7ZC 2MPMA 1GUOA 3MFYA 2AWOA 2J4XA 1M8AA 2JA7B 5I4DA 3MFGA 4K6DA 2J7ZA 5ELCA 1I4QA 4KY7A 4RKLA 1AZPA 2YYZA 4RAUC 2HQEA 3T56B 1QG7A 2AUJD 3TN2A 3PO2B 3K5MA 4KKUA 2XRQD 3F2UA 1SNCA 4ABNA 1QCBD 2PMZB 1RJTA 1ET6A 2K5QA 3GTQB 2LFNA 2EJGC 5CV6A 4A3KB 2XNAC 1CHQD 2FHTA 5K5PA 4IFDH 1PFMA 3DUZA 1EYCA 4ODGA 1OXUA 1WCMB 2JYOA 5CGKA 1C8CA 1PTOH 1DYQA 5JEAJ 1EZ8A 1DOLA 3DEOA 1MGSA 4G4KA 1S4ZA 1STEA 4DN4M 3A7LA 4DFAA 4DK0A 1BBXC 2A68C 3Q6SA 4I65A 4C2MB 4B08A 1STBA 2WP8J 3J80L 4RH6A 3ND9A 4KD4A 2EZVA 4U673 3MTSA 2A68D 3E0JA 3GQBA 1PRTD 2RDHA 3FPUB 1CK1A 2F1MA 2R7ZB 4EQOA 1X32A 4TQUS 1V1PB 3KK7A 3CRKC 4K5WA 1JWSD 2R93B 1D1IA 3TP8A 3K5NA 2F0NA 4A3JB 1NUCA 3N6RA 2SEBD 1GUSA 5IGEA 2XN9C 1SFOB 1O78A 1Y8NB 1Y8OB 5C4XB 3I4LA 1E2VA 3D4DA 3MC0B 1HQMC 3RMHA 5D3DA 4HN7A 5CR3A 2F03A 3GTOB 1HPCA 5LL6X 1SE2A 3C46A 2CQAA 1F9SA 4OGQC 1GHJA 1LT5D 5M3FB 1U9RA 3DWAA 2FJ2A 1J8IA 3R2IA 3K58A 1H9SA 1LV9A 1F77A 1QOHA 4RHSA 3NQIA 2B2UA 3D6CA 4HMJA 2OF1A 3DEPA 3HKZB 2ZXPA 4KD3A 2KECA 1OO9B 4C3JG 2EJMA 1SNOA 5ELFA 2KOLA 1IHZA 2EOTA 1EWHA 3OPOA 1HHVA 1EZ6A 1DJRD 3D6WA 3S16B 1AN8A 4QF4A 2M00A 1CQVA 1KNAA 3HOWB 5HGTA 2TSSA 3U9OA 1C48A 2D62A 1DONA 3NHHA 2CVRA 1AP0A 5EKLA 1RTOA 3BS1A 2IX1A 2PZUA 5M5XB 5CV5A 3BDCA 1X3PA 2A74C 2E76C 4CJ0B 3RLFA 1RKNA 1WTRA 4H44C 3S1NB 1VCIA 4C1NK 2F4IA 3LWUA 1KTKA 5FLXE 5CYUA 1VF7A 1SSOA 2Y0SB 2PO4A 1FR3A 3LWEA 3IFDA 4ME5A 4G7HC 3R2TA 5E4WC 1CHPD 3R3OA 2AWNA 1EIGA 1Q1BA 3URYA 3VA5A 1WTXA 1Q1EA 2PYKA 4FP5D 1K8OA 1EY9A 3D3RA 3K59A 1ESRA 3KUPA 4OHJA 1PZJD 1QJOA 1H9SB 1TR5A 2K03A 1D2BA 4PNYA 2EE1A 5C5LA 3TMEA 3EA6A 1LTBD 3NBIA 1K83B 1I4GA 4ZUIA 2A6HD 5E3FA 2ID0A 5IT9L 1DOKA 2B2YA 2WACA 1NR4A 1STAA 3TP6A 5JPMC 2JEBI 4JK1C 5KEEA 2PZTA 4DXFA 4YIJA 2NN6I 2FMCA 1LACA 2PPBC 4FXKC 1H9RA 2JXMB 3R93A 1NR2A 3PIO3 2IL8A 5IODA 1UNSA 2C9OA 1JCKB 1PRTB 3K6OA 1S5ED 3M4OB 1EY0A 4C56C 5J39A 3IL8A 3NE5B 5CV4A 4G7ZC 2N55A 4V190 2WKDA 4K5XA 1PRTC 1Y1WB 2Z4HA 3TSSA 2A73B 1B2TA 1Q12A 3BYTB 4FF3A 4NMZA 5JVH3 4LMQD 1O7LA 2G9DA 1B9NA 4RGTA 3PUWA 5IGDA 1G291 2LY7A 4K6LA 2O4XA 4S3SA 2A6ED 4GZYC 1I6HB 1T5EA 2B2UC 3D31A 3H0GB 3VYSA 3PUXA 3QJYA 4EQNA 4WJWA 1BF4A 2NVXB 1I6VC 4A3IB 4C3IB 4QB4A 1JOQA 1EU3A 2F0PA 3H94A 1WTPA 3VYUA 3S2HB 1BCPB 2EYOA 1GOZA 4PQXA 3UI2A 1PDQA 4FF4A 4A93B 4BY1B 1BOSA 1BCPC 3GD7A 1WTWA 1RF2D 2FINB 4DAYA 1ENFA 1H9KA 5FOBB 1H9JA 1O7YA 1FNWA 4CHTB 1HXYD 1S5CD 2PQEA 5C0XJ 4XXEA 4IALA 2JEAI 4ZK9B 2RVLA 1ILQA 3HRZC 4ZLTF 2KA7A 4IUUA 4XQJA 4ULLA 3J7AF 3P1HA 1FGBD 4CKBA 2NVYB 3BZDB 1WTQA 4JBWA 1RTNA 2AQ3B 1QWYA 2BCOA 3TP7A 5KNDA 1ZEQX 2NYZD 4PMCA 3PMFA 4A3FB 1XXGA 2A5HA 3J81E 1FYCA 1L0XB 1TWGB 3AU7A 3LNNA 1V1OA 1TS4A 1MSGA 3L3OC 3CRLC 3Q23A 5M9OA 1GXDC 4MN3A 1MSHA 1RHPA 5ELDA 3P7JA 3D4WA 3HOYB 3Q22A 2IX0A 2E2DC 2NVTB 5I9PA 1RCVD 4IFDJ 2PW7A 1OXVA 5JVG3 5ELBA 2NVQB 1ML0D 1CM9A 4KKSA 4XT3B 3A54A 3H91A 5CV7A 3DMUA 3R8BA 5JAVA 1Q8IA 4KY5A 4NKLA 4RA8A 1G2SA 3QOLA 1O80A 4F7XA 4H0LC 2HUGA 3NTKA 1D5ZC 1BNZA 3MXUA 5ISRA 2BE5D 3H09A 5CBAE 3MWYW 3NTIA 4XT1B 4K5VA 5J22A 2E75C 1JQYD 3TZDA 1ET9A 1E2WA 1SYBA 5IGCA 2ENBA 1KDAA 4PMWA 4C1NI 4OIKA 4KK7A 2WB1B 2VXWA 1EEFD 5I2XA 2E2JB 3VYTA 4KN7C 3H3VC 1STYA 2E2HB 2ZT9C 4R8NA 1SYGA 3X3MA 3BVGA 2F3VA 3SK4A 1XWEA 2SNSA 3P20A 1F2MA 4IN3A 2VB2X 1AFPA 4ZKBB 1II3A 1F9PA 3V05A 2CW0C 4MHEA 3C1EA 2F0QA 4ID6A 1YNJD 5C44B 2DNCA 1TWHB 1SE4A 4G57A 4CKCA 3A7AB 1TKWB 4U68A 2VNUD 3U9SA 3P75A 4XQQA 3PO3B 3KBGA 3IKJA 2XRSD 4BY7B 4C3IG 1BO0A 1ESFA 2X69A 2IW3A 5BN4A 2Q8TA 2JA6B 1MI2A 5D14A 2B8GA 2B2YC 1LO5D 3I4MB 5A2QL 3SK5A 1T5XD 2F0EA 3S2DB 1D5MC 3G6JB 2QILA 2F0UA 5M3MB 1IYVA 1OXXK 1DOMA 5T1GA 1EY8A 5AFWA 1IYUA 1JE4A 2F0VA 5FK9C 1QE6A 2K05A 2XWJB 1ZKOA 3QWNA 2Q8RE 3PIP3 3VR6A 4HTHA 1WD0A 3GTJB 1DCZA 3PUYA 4AYBB 5EPLA 5E1FA 1ZYRD 3AB9A 5FO8B 4RGMA 2F0IA 1E2ZA 1STGA 2K28A 1O7ZA 1PFNA 3M7GA 1Y1VB 3NP8A 1D5XC 5I6YA 2VB3X 1DXMA 2B2TC 4LK1C 1QILA 2BOSA 1KLUD 2B63B 2SOBA 1SYFA 2WV6D 2Z4IA 5G3LD 1CTMA 3IAYA 1JB3A 4TRDA 3VYRA 1UAPA 1VF5C 2VUMB 1EY4A 5CC4A 3A56A 1DZ1A 1CFMA 4MIUA 3T53B 1EWCA 1Z7TA 2XIWA 1EY7A 3W3AA 4H13C 3KF8A 1G8ZD 3HG9A 1AW7A 4TKOB 1CI3M 2NBFA 2F0LA 2R6GA 4CBVA 1B53A 2A69D 2MJ8A 4FF2A 2B8FA 3DWQA 3S1QB 1W6KA 3S14B 2JE6I 1JOOA 4K8JA 3OWEB 2IPKD 2NTSA 4KV6A 2HCIA 4RCOA 1HA5A 5EKKA 1JR0D 1AEXA 3K7AB 4IUNA 4DXGA 2R92B 1B4OA 4L6TB 2H1EA 2QF7A 1A2TA 2FFKB 4IUVA 1EOTA 1JOKA 4RWSC 4XYOA 3NWSA 1YNND 2V4DA 2R3ZA 2NTTA 5EBCA 2WIIB 3CKIB 3MXPA 1UUPA 3V2TA 3DM1A 2RBMA 4DF7A 1WTVA 5EJWA 1A2UA 2HDMA 4KHVA 2SDFA 2B2TA 3QB3A 4HSPA 3V96A 3WDNA 4OO1G 4X3KA 1L0YB 5BN5A 3GTKB 1ONLA 5EPJA 4X3UA 2E2IB 4HCSA 2X6LA 4FNFA 2L9HA 3GTGB 4Y7NB 1SJED 3QO2A 1EY6A 1WVLA 2F0FA 2DY8A 1TT2A 4HMIA 2NWGA 1SNQA 4FYDA 2BA0A 4XQNA 2F0MA 3HOUB 2NUCA 3I4NB 3M4YA 2XWBB 4IFDI 3N52A 1R9TB 3PUZA 4KKTA 5EGTA 4ZUJA 4DA2A 1EYDA 3OHXC 5EBDA 2K5DA 2SNMA 4OL7A 4KJNA 4M8AA 1AZQA 3OOCA 4ZQ3A 3T51B 4KTAA 2NN6G 5TSSA 3BG3A 3BVZA 1PTOD 4KHZA 2PW5A 2RSOA 2HCCA 2XVSA 1OXSC 1S5BD 1VMPA 2B2VA 2IJ0A 4KN4C 3TBIB 1A3UA 1PTOC 4IUTA 3HOXB 2EDGA 4XYQA 3E5SA 2F3WA 2ICIA 1LT4D 1FNVA 2WAQB 2NB0A 1F2LA 1PTOB 2XSCA 1JWMD 1HQRD 3NSWA 1SEBD 1U4RA 3S15B 2H4OA 1U4MA 4B9WA 1LABA 4HSVA 1H9MA 3C3LA 4H7BA 1PXUA 4OIJA 4UAIA 2RDFA 5KIXA 1EQVA 3S1MB 1MD2D 4NP5A 1PMRA 1YNNC 3VA7A 3AMUA 4DU9A 5C0XH 3J7AV 2IWHA 2AQ1B 2L55A 4A3DB 1SJHD 4EQPA 2F0HA 4DNRB 4RGNA 3ONAB 1BUVT 3DWPA 5C5MA 2F0GA 5DEHA 4IURA 1GUGA 2EYLA 2A6HC 3EFXD 2PZWA 1X3QA 1QNKA 4NDXA 3RZDB 1NSNS 1NCVA 3QIAA 5KRUA 3J80E 1IW7C 3FMCA 1ILPA 3MEHA 2RSNA 2JA5B 1EFID 1PTOF 3I91A 2K01A 2KEEA 2DN8A 2QEJC 3I73A 5ELEA 3TP5A 5DM73 4E6IA 2QCPX 1R4PB 4FVMA 3GV3A 1LT3D 4J6HA 4WFN3 1RODA 4QUCA 1C4QA 2MUYA 4EVOA 2A69C 1SYDA 2EXZA 2F0OA 5D3IB 4HAEA 3KLRA 2DNEA 2RA4A 2J0TD 3T4AC 5FO7B 2IT1A 3SK8A 4L8JA 4WRDA 4QIWB 1F9QA 4PV1C 3HZXA 2F0WA 2OEOA 5EQ0A 3JAME 2AUKA 3H6MA 1HA6A 5K36G 1QB5D 5C4ZA 3I70A 1SNDA 2LS01 4K14A 4QMGA 2CHBD 3WOFA 1EY5A 4CJ1B 1S5FD 2EY5A 1I4HA 1Q90A 2N88A 3SK6A 1HFNA 1HTPA 1CZWA 3NPPA 5JEAG 3OIPA 1A15A 4F8MA 1KNEA 3SDZA 1YNJC 3EVQA 5M5YB 2L4NA 3TDQA 3ERQA 3BVMA 5COYA 5KGUA 5C0XG 1Z47A 3L9AX 3K57A 1I4RA 4HEDA 1TWCB 2E74C 2HDLA 4KI0A 1PZID 2BDOA 3HEJA 1ZXTA 5JOBA 1TWFB 1LTGD 4TSSA 3MAQA 1XTCD 2F0JA 1CA5A 3O13A 1HRJA 3NBHA 3J81L 1HFGA 4G7OC 1EQTA 1Y8PB 1GHKA 2L12A 4QCLA 2O5IC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D1K A;  4ULL A;  2GA4 B;  1R4P B;  1DM0 B;  2XSC A;  1CZW A;  1QOH A;  1C4Q A;  2C5C A;  4M1U B;  1CQF A;  1D1I A;  4P2C B;  3MXG A;  2BOS A;  1CZG A;  1R4Q B;  1QNU A;  1BOS A;  1C48 A; 
#chains in the Genus database with same CATH topology
 2EYP A;  4Q5V A;  3HKS A;  5C3E H;  4RCN A;  3BDO A;  5IYD H;  2YU9 B;  5FO9 B;  5M5W B;  4GNX B;  2JA8 B;  1EU4 A;  4BXX H;  4XTC S;  1HH2 P;  3L2P A;  1LLR D;  4B9X A;  2QKI C;  3SEB A;  2F52 A;  4LUZ A;  4A75 A;  4CJ2 C;  1PH2 A;  3L0O A;  4K2K A;  4MZ9 A;  4QUF A;  4IUP A;  2F3I A;  3KLS A;  2RKS A;  1B44 D;  2V1C C;  3MZ5 A;  3T1H L;  3G7L A;  2AMC B;  5LHY 1;  1AE3 A;  4ZKC B;  5KYL A;  4C3H H;  4DV7 L;  4X62 Q;  1VQL A;  3CCR A;  2R93 H;  1NMF A;  5CBE E;  3OW7 A;  1SRO A;  1KD1 C;  1W6J A;  1K0R A;  2B3G A;  3OSO A;  4C3J B;  5IE8 A;  3S24 A;  3G48 A;  2JJQ A;  2KHS A;  4WOR A;  3STB C;  1EFW A;  2L15 A;  5LMN L;  3ZYY X;  3A55 A;  5CV8 A;  3I90 A;  3RN2 A;  1IKM A;  3WWV A;  3G6E A;  4N9P A;  5GQO A;  3GTM H;  4RKB A;  4CKE A;  4I7A A;  2I46 A;  3ZJY C;  1B3A A;  3MVV A;  5G3L F;  4JI5 L;  1PRT F;  3CQZ B;  2LMC B;  2R61 A;  5IY0 A;  5C3E B;  4BS9 A;  2D2C C;  3HS0 C;  2N3S A;  1VQ5 A;  3FKI B;  4AQY L;  1SE8 A;  1EYA A;  1SYE A;  3I8Z A;  2PCF B;  3FEW X;  3KJP A;  1SMY C;  1LTA D;  2E5L L;  2EY6 A;  1HCZ A;  2D5D A;  3VR2 A;  3M7N A;  1SNP A;  3RD4 A;  4A3M B;  1TS5 A;  3M3Y H;  1LTS D;  2PMZ E;  2VUM H;  5IGG A;  1G91 A;  4A3G B;  2MGS A;  3MXG A;  2K7V A;  5E7N A;  3HOW G;  3MA2 B;  5IP7 G;  4IZ8 A;  3S17 B;  1QUQ B;  3KLW A;  1Y69 U;  4C3H B;  2ICE C;  2EVB A;  1STH A;  2IX3 A;  1P16 A;  4AYB G;  1ZYR C;  1L0W A;  1TS2 A;  1RL2 A;  2CCZ A;  2KJX A;  1A3V A;  2GN5 A;  2R93 G;  1E3P A;  1YBY A;  2JA7 G;  3PF4 A;  1CQF A;  1S5D D;  1PLF A;  4JI8 L;  2PQA A;  1HJP A;  4GKJ Q;  2NVX H;  1D6E C;  1TS3 A;  1TII D;  4XIG S;  3NQT A;  1BCP D;  3FPP A;  1I4X A;  4X3S A;  2F0S A;  4LFA L;  4R9W A;  1GUT A;  4AIM A;  4F87 A;  3FDT A;  1FJG L;  1SAP A;  4DR4 Q;  3LGJ A;  1U4P A;  1CKM A;  3KLS X;  2VQF Q;  3NWT A;  1IBL Q;  2XTI A;  4BXX G;  3CQZ H;  4UP7 A;  3M9B A;  3KDF A;  2KVM A;  3EIV A;  3A8J E;  5C0X I;  1K28 A;  3Q24 A;  1A0I A;  3D0F A;  1QVG A;  3X3N A;  2D9U A;  2B2W C;  3WOE A;  5DNF A;  2EPB A;  3S2H H;  3S16 H;  3E6Z X;  4ME3 A;  5BR8 L;  3NTH A;  1XPR A;  2R7F A;  1EWI A;  1XNQ Q;  5KNC A;  4OX9 L;  2C5C A;  1ICF B;  5HUR A;  4IUQ A;  4B3T L;  3I4N G;  3GTL B;  4P2C B;  2B39 A;  3H3V I;  2M9V A;  1NTG A;  3SE0 A;  4POF A;  1SNM A;  5E4X A;  5A2Q E;  4DV3 Q;  2Z6K A;  1KLG D;  4HJ7 A;  3SHL A;  5A35 A;  3ERO A;  1I50 B;  4JOI C;  5ELN A;  4KHP L;  2OQK A;  3QOJ A;  5C3X A;  4A3E B;  1Z6H A;  2KQ3 A;  3OTO Q;  3FP9 A;  3GDE A;  1GJX A;  5DM6 3;  2BH8 A;  2K1B A;  3VR5 A;  4KMU C;  3T13 A;  3T1Y Q;  1JWU D;  4IQZ A;  3HP3 A;  3EQL C;  4M1U B;  1HR0 Q;  3I4M H;  1HNX L;  1SYC A;  4NW2 A;  4L5Q A;  5BN3 A;  4POG A;  4IFD G;  1RD9 D;  3BJU A;  2LKV A;  4F88 A;  4B3S Q;  1WI5 A;  3KBX A;  2X6G A;  4LW1 A;  1B1Z A;  4JI4 L;  1HZA A;  1FNU A;  2B2W A;  1N34 L;  1ICW A;  3FRP B;  4K8I A;  3OTO L;  1PZK D;  2R92 H;  2R7D A;  4DV4 Q;  5KNB A;  5JEA H;  5C4J B;  4A4I A;  5C3W A;  1IL8 A;  1A6X A;  1YIJ A;  4DV3 L;  1M4V A;  3MHB A;  1PFB A;  2PNR C;  1BDO A;  2OT2 A;  2MP1 A;  2Q2I A;  1E24 A;  3PIO A;  2Z6K C;  4DR2 Q;  2K04 A;  4BA1 I;  1NAP A;  2ZXO A;  3S15 H;  1SXT A;  1V8Q A;  4GKK Q;  4A3J G;  5IGB A;  3OMC A;  1X3F A;  5K36 H;  2RDG A;  4RMF A;  2M2L A;  5D65 A;  3PV0 A;  2L5T A;  3GP7 A;  5AJ3 Q;  4A3L G;  4DAP A;  3HOZ B;  1L1O A;  2ZM6 Q;  1ENC A;  3W2D A;  4BY1 H;  3EJI A;  4A3G H;  5IOC A;  4LUV A;  2K32 A;  2JSO A;  3M85 A;  4J8Q A;  4RHR A;  1X6O A;  2ZTC A;  4HCE A;  1EIH A;  4LJZ C;  2WIN B;  4YHH Q;  2L11 A;  2RQX A;  1Q3L A;  2QA4 A;  2I07 B;  4P72 A;  2KCM A;  4GNX C;  2B63 H;  1IW7 D;  4JI2 Q;  1PV4 A;  5FKA C;  4KY6 A;  1PYW D;  3S9W A;  4FXD A;  2BA1 A;  4OX9 Q;  4O2D A;  1GUW A;  1JIC A;  2E2H H;  1D7Q A;  1X65 A;  3K81 C;  3E0E A;  2L1B A;  4L5S A;  2QDB A;  1PH9 A;  1V1P A;  3GTP B;  2KCC A;  4N8F A;  4RFB A;  1XNR L;  3GTP H;  1XX8 A;  1EQQ A;  3RN5 A;  2EYM A;  1XYI A;  3GTM B;  4B3R L;  5CV9 A;  5JPN C;  4FO2 A;  3RR5 A;  3PUV A;  1HUM A;  2LSS A;  1KL9 A;  4KJO A;  1CA6 A;  3HOY G;  2RHS B;  2K52 A;  1E0B A;  1WJJ A;  3K5L A;  5FLX c;  2L0C A;  2O5J C;  3OMG A;  3CPF A;  2WKC A;  4X65 L;  1NNX A;  1A3T A;  3LX0 A;  1WCM G;  4DK1 A;  2A19 A;  4GOP C;  1VQJ A;  2EY1 A;  5M3M G;  1BCP F;  1S40 A;  5IYB G;  5IP7 H;  3HOW H;  1BR9 A;  3Q0A A;  2UUB L;  2BE5 C;  2VUM G;  4NXM L;  3RZO B;  5FLX L;  1VMC A;  1K8M A;  4LAA A;  3GO5 A;  1B9M A;  3GV6 A;  1QUQ A;  3K5O A;  5JJZ A;  4IOC A;  3G71 A;  5IIF A;  3I7F A;  2O2L D;  4JBK A;  4LF6 L;  4FF1 A;  2EYH A;  1I50 H;  1QNU A;  1PH1 A;  3JAM L;  1TU2 B;  2A6E C;  4X3T A;  1SBB B;  1Y1W H;  1EL0 A;  1QVF A;  1VQE A;  2K6A A;  1UEA B;  3CME A;  1TQO A;  4JI1 L;  4R8I A;  4R1J A;  2JK8 A;  1PH4 A;  1KXL A;  1TWA B;  4YHH L;  1U0L A;  1F9R A;  2EJF C;  1J5E Q;  3IFT A;  5H1S E;  3NK9 A;  5HGQ A;  1I3Q H;  2YU9 H;  5I9O A;  1BVS A;  4BBR B;  4Q0F A;  1WD1 A;  1BQQ T;  1Y1V G;  1KDB A;  3A8I E;  2ASB A;  3BU2 A;  2EYJ A;  1EYG A;  4L63 B;  4OWW B;  3MXN A;  2VW9 A;  4J1M A;  4YY3 L;  5IT9 E;  5I6W A;  1WFQ A;  4ZYS A;  3RUZ A;  3C2P A;  2GVA A;  3DXJ C;  4BWG B;  5IYC G;  1KAB A;  2CWP A;  4O1N A;  3CU7 A;  1G6Z A;  3DHQ A;  2K33 A;  1KDC A;  3ND8 A;  4N9T A;  3FVQ A;  2KED A;  1SE3 A;  4EGV A;  4DUZ Q;  4C3H G;  2CWA A;  5F2D A;  3TS0 A;  3SXH A;  3HGB A;  1IBK Q;  4ILW A;  4JI3 Q;  1CKN B;  3A5Z B;  5EPK A;  2KCN A;  3HOX G;  3HOV B;  3VR4 A;  5BR8 Q;  2KCT A;  3TZU A;  4JOI A;  3NXW A;  4DR6 L;  5DAU A;  1QZH A;  4ZAI A;  3SVM A;  5C4H A;  5CMD A;  2NN6 H;  4TVA B;  1HTL D;  1SDF A;  1R9T H;  1EEI D;  4PMB A;  1DD2 A;  2HD3 A;  5LL6 S;  4A3E G;  4APV A;  2NZ1 D;  3QG1 A;  2EYF A;  1LTT D;  1UE5 A;  4DAV A;  3K0Y A;  2EY2 A;  2Z1C A;  4DGZ A;  3NUC A;  1WTO A;  2ZXR A;  3ULL A;  2P5Z X;  4ZRZ A;  5NUC A;  5IYC H;  3I72 A;  1LTR D;  3I3C A;  1K0S A;  1F2Z A;  3A8K E;  3W1B A;  3CD6 A;  4IOA A;  3PO3 H;  1FD7 D;  1LT6 D;  4A3B B;  2UU9 L;  3L7Z C;  1GUN A;  1UE1 A;  2ZJQ A;  4A3B H;  1CZG A;  1HZ9 A;  1R4Q B;  1G2T A;  4A3M H;  2OXP A;  1TXY A;  5T1I A;  2F0D A;  2EIF A;  5KYI A;  3OWF A;  3OIQ A;  2CW0 D;  2K5W A;  3VR3 A;  1I4P A;  3SR1 A;  3F2B A;  4NXN Q;  5J3B A;  4BBS B;  3BDL A;  4OO1 I;  3CW2 C;  1N36 Q;  1LTL A;  2VQE L;  3ITP A;  1Y1W G;  2PI2 A;  3S1N H;  1TVX A;  1E22 A;  4Z9C B;  5EAY A;  1TY0 A;  1BXT A;  4O42 A;  1U4L A;  2B2V C;  4CGY B;  2TMP A;  3EN2 A;  4OO1 H;  5FJ8 G;  5EKI A;  1JC7 A;  1IKL A;  3UDX A;  2A8V A;  3NBH B;  4V0B A;  1BKB A;  1D1K A;  2F0K A;  3BYY B;  1JJC B;  3M3Y B;  1CKO A;  2JP1 A;  1F2Y A;  2GA4 B;  2PQA B;  4P74 A;  1MBY A;  2OTL A;  3CHB D;  4LF9 L;  3C1F A;  1B50 A;  1TY2 A;  4K2L A;  1PYS B;  4RGO S;  1SMY D;  3K7U C;  5COR A;  1JMC A;  2WFW A;  5I2Y A;  1E7Z A;  1KAA A;  1FGU A;  4XDX A;  4HR7 B;  2PNH A;  3KF6 A;  2AQ2 B;  4OWT B;  1UE6 A;  3J7Y W;  1J9O A;  3D8G A;  4DKA C;  3HOY H;  1LTI D;  5C6A A;  4LF7 Q;  1HUN A;  1DM0 B;  1I3Q B;  2UUA L;  2F0T A;  5IGF A;  1OXT A;  1ENA A;  3PGZ A;  2CFM A;  2UXD L;  4DNT B;  2Q8I B;  2BDN A;  4X62 L;  1STN A;  1VDZ A;  2Z8L A;  3E9I A;  5J1Z A;  1XMO L;  4FXG C;  2MHV A;  2G9H D;  1RDP D;  3D4R A;  3S1R B;  4QQB X;  4BA2 I;  2VY3 A;  1V43 A;  2DY7 A;  4IPC A;  2KUM A;  2FMM A;  3T16 A;  2BH2 A;  3U58 A;  1CT1 D;  2K14 A;  4UDU C;  1JOR A;  3J81 i;  2N49 A;  5M3F H;  4I7Z C;  2MPM A;  4B3R Q;  1GUO A;  1Z9F A;  1VQ6 A;  1HNW Q;  3MFY A;  1NBW A;  2AWO A;  2J4X A;  3PIP A;  4PG3 A;  1M8A A;  2I5M X;  3KF8 B;  4DUZ L;  2JA7 B;  4Y52 H;  2JA8 H;  3OYY A;  3PSI A;  2UU9 Q;  1MKH A;  5I4D A;  3HOV G;  1TWF H;  3MFG A;  3MXN B;  3S17 H;  4AYB E;  1X56 A;  4K6D A;  2J7Z A;  4A3G G;  5ELC A;  3NEL A;  1VQD A;  3HKZ G;  1AH9 A;  4BY1 G;  1I4Q A;  4KY7 A;  4RKL A;  4A3L H;  5IWA Q;  1AZP A;  2YYZ A;  4RAU C;  4NXM Q;  2HQE A;  4A3J H;  3T56 B;  1HZB A;  1QG7 A;  2ES2 A;  2UUB Q;  2AUJ D;  3TN2 A;  4X64 L;  3PO2 B;  1B8A A;  3K5M A;  4KKU A;  2F4V L;  4UY8 C;  2XRQ D;  3F2U A;  1YEZ A;  1SNC A;  4LF8 L;  2UXB Q;  4ABN A;  2DUD A;  1QCB D;  2PMZ B;  4JI0 Q;  2R92 G;  3CAM A;  1RJT A;  1ET6 A;  1BBW A;  4IO9 A;  4JV5 Q;  4IPH A;  2K5Q A;  3GTQ B;  2LFN A;  2EJG C;  5CV6 A;  2WAQ E;  4A3K B;  2XNA C;  2VS1 A;  1CHQ D;  2FHT A;  3HOZ H;  5K5P A;  4IFD H;  1PFM A;  2N8N A;  3DUZ A;  1EYC A;  4ODG A;  1OXU A;  1JE5 A;  1WCM B;  2JYO A;  5CGK A;  5GAH C;  1C8C A;  1PTO H;  3A5U A;  1A62 A;  1DYQ A;  5JEA J;  1EZ8 A;  1DOL A;  2LXJ A;  3DEO A;  3DLL A;  1MGS A;  4G4K A;  1S4Z A;  1STE A;  3A7L A;  4DFA A;  4DN4 M;  4DK0 A;  1BBX C;  2A68 C;  3Q6S A;  4GN5 A;  4I65 A;  4C2M B;  4B08 A;  1STB A;  2WP8 J;  5LMU Q;  4JI2 L;  3J80 L;  4RH6 A;  3ND9 A;  4KD4 A;  2EZV A;  4U67 3;  3MTS A;  2WB1 E;  2A68 D;  3E0J A;  3GQB A;  4A3C H;  1HZC A;  1PRT D;  2RDH A;  3I4N H;  1HNW L;  1J5E L;  4LF4 Q;  1VQG A;  3FPU B;  1CK1 A;  1WTH A;  2F1M A;  1NY4 A;  2UUC L;  1VQ8 A;  2R7Z B;  4EQO A;  1X32 A;  4TQU S;  2E2I H;  1PH6 A;  2R7Z H;  1V1P B;  3KK7 A;  3CRK C;  4DK6 C;  4K5W A;  1JWS D;  2R93 B;  1D1I A;  3TP8 A;  4EQ5 A;  1KRT A;  1IBM Q;  3K5N A;  4LFC Q;  2F0N A;  4A3J B;  1NUC A;  3N6R A;  2SEB D;  1GUS A;  5IGE A;  2JA5 H;  3QR8 A;  2XN9 C;  1SFO B;  1O78 A;  4LF7 L;  5LMN W;  1Y8N B;  1Y8O B;  5C4X B;  3I4L A;  1E2V A;  3D4D A;  4WJ3 M;  4DR7 L;  3MC0 B;  1HQM C;  3RMH A;  5D3D A;  1GM5 A;  4HN7 A;  3KOJ A;  1NJI C;  5CR3 A;  2F03 A;  4R4O A;  1HPC A;  3GTO B;  5LL6 X;  4GLV B;  1SE2 A;  4R4T A;  3C46 A;  2K50 A;  1YVC A;  2CQA A;  1F9S A;  3RZO H;  3BZC A;  4OGQ C;  4OEM B;  1GHJ A;  1LT5 D;  5M3F B;  2HT1 A;  1YIT A;  1U9R A;  1N33 Q;  3DWA A;  2FJ2 A;  1J8I A;  3R2I A;  3K58 A;  1H9S A;  3B6Y A;  1LV9 A;  1F77 A;  1QOH A;  3CP0 A;  3I56 A;  4RHS A;  3NQI A;  2B2U A;  1SR3 A;  3D6C A;  4HMJ A;  2OF1 A;  3DEP A;  3ULP A;  3HKZ B;  2ZXP A;  4KD3 A;  4DR2 L;  2KEC A;  1OO9 B;  4QL5 A;  4C3J G;  1RIP A;  2EJM A;  3F8T A;  1LM0 A;  1SNO A;  5ELF A;  3STB D;  2IY5 B;  1LYL A;  1JJ2 A;  1EOV A;  1YJW A;  2NZO A;  4LF9 Q;  2ALY B;  3I2Z A;  2KOL A;  1IHZ A;  2EOT A;  1EWH A;  2G5D A;  3OPO A;  3NEN A;  1HHV A;  2JA6 G;  1EZ6 A;  1DJR D;  3D6W A;  3S16 B;  1AN8 A;  4QF4 A;  2M00 A;  3E3X A;  1CQV A;  1KNA A;  3HOW B;  5HGT A;  4HIK A;  2TSS A;  3U9O A;  1C48 A;  3CC4 A;  1Y14 B;  2D62 A;  1DON A;  1JJG A;  4DV0 L;  1HNX Q;  3NHH A;  3PO2 G;  2CVR A;  3OW2 A;  1HNZ Q;  1AP0 A;  5EKL A;  1RTO A;  3BS1 A;  2IX1 A;  2PZU A;  4JI7 Q;  1I94 Q;  5M5X B;  5CV5 A;  3BDC A;  4PZ6 A;  1X3P A;  2A74 C;  2E76 C;  4CJ0 B;  3RLF A;  1RKN A;  1WTR A;  4H44 C;  3S1N B;  1VCI A;  4C1N K;  2F4I A;  3LWU A;  1XPO A;  1KTK A;  3PF5 A;  5FLX E;  1EQR A;  5CYU A;  2MNA A;  3CCJ A;  2NVQ H;  1VF7 A;  1SSO A;  2Y0S B;  2PO4 A;  1FR3 A;  4A3I H;  2NVY H;  3LWE A;  2H5X A;  1PH3 A;  3IFD A;  4ME5 A;  4G7H C;  4JI4 Q;  1VQA A;  1NE3 A;  3R2T A;  5E4W C;  5GAE C;  1CHP D;  3K80 C;  2D0O A;  3R3O A;  2AWN A;  1EIG A;  1Q1B A;  3SGI A;  3URY A;  3VA5 A;  1WTX A;  1Q1E A;  5JJL A;  2N78 A;  1K83 H;  2PYK A;  4FP5 D;  1N8R C;  4FDB A;  1X55 A;  1K8O A;  1IL2 A;  5IYD G;  1EY9 A;  4GOP B;  3D3R A;  3W5O A;  2K75 A;  3K59 A;  1ESR A;  3KUP A;  4RG1 A;  4OHJ A;  1PZJ D;  1QJO A;  3RZD H;  1H9S B;  1TR5 A;  2Z6B A;  2K03 A;  1D2B A;  4PNY A;  2EE1 A;  1X3G A;  5C5L A;  4K0K Q;  3FHW A;  2JN4 A;  4GKJ L;  4DR3 Q;  3F2C A;  2R7Z G;  2CH4 A;  3TME A;  3EA6 A;  1PVO A;  1LTB D;  3NEM A;  3NBI A;  1K83 B;  1I4G A;  4ZUI A;  2A6H D;  5E3F A;  2ID0 A;  5IT9 L;  1DOK A;  1T9H A;  2B2Y A;  4KLK A;  2AHO B;  2WAC A;  1NR4 A;  1STA A;  4O0A A;  4BY7 H;  4J15 A;  3TP6 A;  1N34 Q;  1X9N A;  4A76 A;  5JPM C;  2JEB I;  4JK1 C;  5KEE A;  2PZT A;  4DXF A;  1Q86 C;  3U50 C;  1ASY A;  4YIJ A;  2NN6 I;  2FMC A;  1LAC A;  2PPB C;  4FXK C;  3CC7 A;  1H9R A;  1Q81 C;  2JXM B;  3R93 A;  1NR2 A;  3PIO 3;  2IL8 A;  5IOD A;  2NVT H;  3HOZ G;  3F1Z A;  1UNS A;  2C9O A;  1JCK B;  1PRT B;  3PQI A;  2B29 A;  3K6O A;  4HIM A;  1S5E D;  3M4O B;  1EY0 A;  4C56 C;  5J39 A;  3IL8 A;  3NE5 B;  1G51 A;  5CV4 A;  4G7Z C;  2N55 A;  4V19 0;  2WKD A;  4K5X A;  1PRT C;  1Y1W B;  2Z4H A;  3TSS A;  2A73 B;  1B2T A;  1Q12 A;  3BYT B;  4JI3 L;  1VQK A;  4HJ8 A;  4FF3 A;  4NMZ A;  2ZJP A;  5FLM G;  5JVH 3;  3ERS X;  4P75 A;  4LMQ D;  1O7L A;  1E1T A;  4QY7 A;  2G9D A;  1B9N A;  4RGT A;  3PUW A;  4UP8 A;  5IGD A;  1G29 1;  2LY7 A;  4K6L A;  4DV7 Q;  2O4X A;  4P73 A;  1VQ4 A;  4S3S A;  3M4O H;  3GTO H;  2A6E D;  4GZY C;  1I6H B;  2MO0 A;  1QZG A;  1PH7 A;  3K7A H;  4JI7 L;  1T5E A;  2B2U C;  3D31 A;  3TRE A;  2JA8 G;  4A93 H;  3H0G B;  3VYS A;  2YV5 A;  4ZCK A;  4BBS G;  3PUX A;  3QJY A;  4EQN A;  4WJW A;  4CDC C;  1BF4 A;  2NVX B;  4NPS A;  1I6V C;  3H3V H;  2EXD A;  4A3I B;  4C3I B;  4BBS H;  4QB4 A;  3UDI A;  1JOQ A;  4C3I H;  1EU3 A;  2F0P A;  3H94 A;  4JI8 Q;  1WTP A;  3VYU A;  3S2H B;  5LMN Q;  1BCP B;  1K3B C;  2EYO A;  1TWH H;  2KHJ A;  1GOZ A;  4PQX A;  1D8L A;  3UI2 A;  1PDQ A;  4FF4 A;  3KF6 B;  4A93 B;  4BY1 B;  2YTY A;  2IHE A;  1BOS A;  1BCP C;  3GD7 A;  1WTW A;  1RF2 D;  1IBL L;  2FIN B;  2GVB A;  4DAY A;  1ENF A;  1GD7 A;  1H9K A;  5FOB B;  1H9J A;  3S1Q H;  1BBU A;  1O7Y A;  3M4P A;  1FNW A;  4CHT B;  1HXY D;  5IP9 H;  2MQH A;  3BZK A;  1S5C D;  2PQE A;  5C0X J;  4XXE A;  3K0X A;  5LMU L;  4IAL A;  2JEA I;  1YHB A;  3RLN A;  4OXP A;  4ZK9 B;  1Q82 C;  4MTN A;  2RVL A;  1ILQ A;  4DAM A;  3HRZ C;  4ZLT F;  2I0Q A;  2KA7 A;  4IUU A;  4XQJ A;  1O7I A;  1ASZ A;  4ULL A;  1M1K C;  1U5K A;  4IPG A;  3J7A F;  1UE7 A;  1MJC A;  3P1H A;  4HJ9 A;  1FGB D;  4CKB A;  1I6H H;  1A63 A;  2NVY B;  3BZD B;  1WTQ A;  4PZ7 A;  4JBW A;  4X65 Q;  1RTN A;  2AQ3 B;  4BY7 G;  1QWY A;  2KHI A;  4A3K G;  2BCO A;  3TP7 A;  4B3M Q;  5KND A;  2HHH Q;  1ZEQ X;  2NYZ D;  2VQE Q;  1CSP A;  4A3M G;  2OTJ A;  4PMC A;  3T1Y L;  4CDF C;  4GLX A;  1XTD A;  4DR1 Q;  3PMF A;  4A3F B;  1XXG A;  3TQY A;  2A5H A;  3J81 E;  1FYC A;  4DV1 L;  3PO3 G;  4DV2 L;  1L0X B;  3LNN A;  1TWG B;  3AU7 A;  1V1O A;  1TS4 A;  4JBJ A;  3J7A 5;  4JI1 Q;  1MSG A;  3L3O C;  4LFB L;  3CRL C;  3Q23 A;  5M9O A;  4GOP A;  2AKW B;  1GXD C;  4DNI A;  4MN3 A;  1EUJ A;  1MSH A;  1RHP A;  2RHQ B;  5ELD A;  1KC8 C;  1VQO A;  2RF4 A;  3P7J A;  4GN3 B;  1XNQ L;  3D4W A;  3HOY B;  3Q22 A;  2E8G A;  2IX0 A;  2E2D C;  4YCV A;  4K0K L;  2NVT B;  4A3F H;  1IXR A;  1Q7Y C;  1VQ7 A;  1RCV D;  2DJF C;  5I9P A;  4IFD J;  2PW7 A;  1OXV A;  5JVG 3;  3S1R H;  4A3D H;  5ELB A;  2NVQ B;  1ML0 D;  1CM9 A;  4MNO A;  4KKS A;  2JA9 A;  4XT3 B;  4A3F G;  4DV6 Q;  2KBN A;  3A54 A;  2QGQ A;  3H91 A;  5CV7 A;  3DMU A;  3KJO A;  4Y7N H;  3R8B A;  5JAV A;  1Q8I A;  4KY5 A;  2WB1 G;  4NKL A;  4RA8 A;  1G2S A;  3VDY A;  3QOL A;  1O80 A;  4F7X A;  4H0L C;  2HUG A;  3NTK A;  1D5Z C;  4QIW E;  1BNZ A;  1KHI A;  3MXU A;  2OCE A;  2E5L Q;  5ISR A;  1S72 A;  2BE5 D;  3H09 A;  2K5V A;  3MWY W;  5CBA E;  3NTI A;  4XT1 B;  1W3S A;  2I5H A;  5M5Y H;  4LF6 Q;  4K5V A;  5J22 A;  2E75 C;  1L2F A;  1JQY D;  3CCU A;  2OQ0 A;  3TZD A;  1XMQ Q;  1YI2 A;  1ET9 A;  4A3K H;  1E2W A;  1SYB A;  5IGC A;  2ENB A;  4JYA Q;  4LFB Q;  1KDA A;  2VZA A;  2K4K A;  4PMW A;  4DV2 Q;  4C1N I;  2C35 B;  4OIK A;  3S14 H;  4KK7 A;  1I94 L;  2WB1 B;  2VXW A;  4YWK A;  1V9P A;  1EEF D;  5I2X A;  2ZM6 L;  4C3J H;  2E2J B;  1N33 L;  3VYT A;  4KN7 C;  3H3V C;  1SLJ A;  4DUY L;  1STY A;  1YJN A;  1GVP A;  2ZT9 C;  4R8N A;  2E2H B;  5IYB H;  3ULJ A;  1SYG A;  3X3M A;  1C7Y A;  4JI5 Q;  1XMO Q;  4HIO A;  3BVG A;  4JW0 A;  4BBR G;  2F3V A;  3SK4 A;  1XWE A;  2SNS A;  5IP9 G;  1V1Q A;  2MO1 A;  3P20 A;  1F2M A;  4IN3 A;  4DR7 Q;  2VB2 X;  1G6P A;  1H95 A;  1AFP A;  4ZKB B;  1VQC A;  1II3 A;  1F9P A;  3V05 A;  2CW0 C;  2Y0S G;  4MHE A;  3C1E A;  2HIV A;  2F0Q A;  4ID6 A;  3MEF A;  1CSQ A;  2YTX A;  1YNJ D;  5C44 B;  3GTJ H;  3AQQ A;  2DNC A;  1TWH B;  4YCW A;  1PH8 A;  1FL0 A;  1SE4 A;  4G57 A;  1AE2 A;  1B7Y B;  1GKH A;  1I5F A;  4CKC A;  3A7A B;  1TKW B;  4U68 A;  3S2D H;  2VNU D;  3U9S A;  3P75 A;  4XQQ A;  1QVC A;  3KBG A;  3PO3 B;  3IKJ A;  4YWL A;  2XRS D;  2UUC Q;  5C4J H;  5GRO A;  5IT9 c;  4BY7 B;  4C3I G;  4DR1 L;  1BO0 A;  4HJ5 A;  1ESF A;  4UP9 A;  2X69 A;  2IW3 A;  4LFA Q;  5BN4 A;  4DK3 C;  1IZ6 A;  3JC6 6;  2Q8T A;  1MI2 A;  5AJ3 L;  2B63 G;  2HQL A;  2JA6 B;  1XJV A;  5D14 A;  2B8G A;  2B2Y C;  1LO5 D;  3H0G G;  3UDG A;  3I4M B;  2UXD Q;  5A2Q L;  3SK5 A;  1T5X D;  2F0E A;  3S2D B;  1C0A A;  1D5M C;  4LFC L;  3G6J B;  2QIL A;  1IBM L;  2F0U A;  1PHJ A;  5M3M B;  1IYV A;  4A3C G;  1OXX K;  3G4S A;  1DOM A;  5T1G A;  2UXC Q;  1EY8 A;  1PA6 A;  5AFW A;  2A1A A;  4DV4 L;  4YCU A;  2NZH A;  1IYU A;  1JE4 A;  2F0V A;  5FK9 C;  1K8A C;  1DGS A;  1QE6 A;  5FLM H;  2K05 A;  1EIF A;  2XWJ B;  1ZKO A;  1SMX A;  3QWN A;  2Q8R E;  3PIP 3;  3VR6 A;  4DV5 L;  4HTH A;  1WD0 A;  5C44 H;  3GTJ B;  4R4Q A;  1DCZ A;  4DV1 Q;  3PUY A;  4AYB B;  4L5R C;  5EPL A;  5E1F A;  1ZYR D;  3AB9 A;  3FKI G;  5ELO A;  4GKK L;  3KYH C;  5FO8 B;  4RGM A;  3S1M H;  2F0I A;  1E2Z A;  3RLO A;  1STG A;  2K28 A;  4B3M L;  2FXQ A;  5M5W H;  4LF5 L;  1O7Z A;  1PFN A;  4X66 L;  3M7G A;  4PZ8 A;  1Y1V B;  3NP8 A;  1D5X C;  5I6Y A;  3I4M G;  1K3R A;  2VB3 X;  1DXM A;  2B2T C;  4LK1 C;  1QIL A;  3FKI H;  2BOS A;  1KLU D;  2B63 B;  5C44 G;  2SOB A;  5M5X H;  3RNU A;  4UHV A;  1SYF A;  1YHA A;  2WV6 D;  2Z4I A;  2ZTD A;  5G3L D;  1CTM A;  4X66 Q;  1JB3 A;  3IAY A;  3KDF B;  4TRD A;  3VYR A;  1UAP A;  1VF5 C;  2VUM B;  1EY4 A;  5CC4 A;  3A56 A;  1HR0 L;  1DZ1 A;  4HID A;  1CFM A;  4MIU A;  4MTK A;  3T53 B;  2E2J H;  2YTV A;  1EWC A;  1Z7T A;  3CCL A;  2XIW A;  3CCS A;  4JV5 L;  1J6Q A;  4HJA A;  1EY7 A;  3W3A A;  4H13 C;  2RCF A;  3KF8 A;  1G8Z D;  3JAM c;  2D0P A;  3HG9 A;  1AW7 A;  4TKO B;  1CI3 M;  3HOV H;  4DR6 Q;  2NBF A;  2F0L A;  4C2M H;  2R6G A;  1UEB A;  4N8X 1;  3H0G H;  4CBV A;  2DJG C;  1B53 A;  3ER0 A;  4B3T Q;  1N32 L;  2A69 D;  2MJ8 A;  1K73 C;  4FF2 A;  2B8F A;  4OEL B;  3DWQ A;  3S1Q B;  1W6K A;  3S14 B;  2JE6 I;  1JOO A;  4K8J A;  4P71 A;  3OWE B;  2IPK D;  2NTS A;  4KV6 A;  3U4Z A;  2HCI A;  4RCO A;  1HA5 A;  5EKK A;  3J80 i;  3AFQ A;  1PYB A;  1JR0 D;  1AEX A;  3K7A B;  4IUN A;  1PH5 A;  1MHW C;  3GTL H;  3H15 A;  4DXG A;  2JQO A;  2R92 B;  1B4O A;  4L6T B;  2H1E A;  2QF7 A;  1N32 Q;  1A2T A;  2FFK B;  1WYD A;  3HKZ E;  4LF5 Q;  4IUV A;  1CKN A;  2PI2 E;  1EOT A;  1VQP A;  2QDL A;  4A3I G;  1FJG Q;  2JA7 H;  1YNX A;  5JJI A;  1JOK A;  4RWS C;  1CUK A;  4XYO A;  3NWS A;  3J7Z C;  1YNN D;  3TRZ A;  2V4D A;  2ZJR A;  2R3Z A;  2NTT A;  5EBC A;  1S3O A;  2WII B;  3CKI B;  1UUP A;  3MXP A;  3V2T A;  4BBR H;  3DM3 A;  3DM1 A;  4EX5 A;  2RBM A;  4DF7 A;  1WTV A;  5EJW A;  2EQS A;  1A2U A;  2HDM A;  4KHV A;  2SDF A;  1TWA H;  1XPU A;  2B2T A;  4JCV E;  2Q2T A;  3AEV A;  3QB3 A;  3PO2 H;  4HSP A;  3V96 A;  3WDN A;  5FJ8 H;  4OO1 G;  1JT8 A;  4YWM A;  4X3K A;  2UXC L;  1L0Y B;  5BN5 A;  3CCM A;  1XNR Q;  1ONL A;  5EPJ A;  3GTK B;  4X3U A;  2E2I B;  3GTG H;  4HCS A;  1M90 C;  3GTK H;  2X6L A;  4FNF A;  2L9H A;  3KFU A;  3GTG B;  1X54 A;  2JA6 H;  4JPB W;  3U4V A;  3HFZ B;  4Y7N B;  3J80 c;  1SJE D;  3QO2 A;  4GN4 B;  1EY6 A;  3JAM i;  1B70 B;  1WVL A;  2F0F A;  3CCQ A;  2DY8 A;  1TT2 A;  4HMI A;  2NWG A;  1SNQ A;  4LWC A;  4FYD A;  2BA0 A;  4XQN A;  1X3E A;  2F0M A;  3HOU B;  2NUC A;  3I4N B;  3M4Y A;  2XWB B;  4DV5 Q;  5JJK A;  1B3Q A;  4IFD I;  3N52 A;  1KAW A;  1R9T B;  3PUZ A;  4KKT A;  1N36 L;  1VQ9 A;  5EGT A;  4ZUJ A;  4DA2 A;  1EYD A;  1LUZ A;  3CXC A;  4ALP A;  3OHX C;  5EBD A;  2K5D A;  5GAG C;  2SNM A;  4OL7 A;  4KJN A;  4M8A A;  4A3E H;  1K8G A;  1AZQ A;  3OOC A;  4ZQ3 A;  3GTQ H;  1E1O A;  3T51 B;  4KTA A;  1W2B A;  2NN6 G;  4H02 A;  5TSS A;  3BG3 A;  3BVZ A;  4JG2 A;  1PTO D;  4KHZ A;  2PW5 A;  2RSO A;  2HCC A;  4DAY B;  4A3D G;  2XVS A;  1OXS C;  1S5B D;  1SN8 A;  1VMP A;  2B2V A;  2IJ0 A;  4KN4 C;  3TBI B;  2CKZ B;  3CC2 A;  3TEH B;  1A3U A;  3HOX H;  1IYJ B;  1L1O B;  1PTO C;  4JC0 A;  1YHQ A;  4LF4 L;  2ATW A;  4IUT A;  4WJ4 A;  4YY3 Q;  3HOX B;  2EDG A;  4XYQ A;  3E5S A;  2F3W A;  2ICI A;  2JA5 G;  1LT4 D;  5C3E G;  1FNV A;  2WAQ B;  4OON A;  2NB0 A;  1F2L A;  4DR4 L;  3AFP A;  1L1O C;  1PTO B;  1VQN A;  2XSC A;  1JWM D;  3IRB A;  5C4X H;  1Q8K A;  3EBE A;  3CPW A;  2QEX A;  1HQR D;  4DR5 L;  3NSW A;  1SEB D;  3A74 A;  3CCE A;  1U4R A;  3A0J A;  3S15 B;  3AYH B;  2H4O A;  2K5H A;  1U4M A;  4B9W A;  1LAB A;  2ZTE A;  4HSV A;  1IBK L;  1Y1V H;  1H9M A;  4DR3 L;  3C3L A;  4H7B A;  1UWV A;  1PXU A;  1YZ6 A;  4OIJ A;  2LXK A;  4UAI A;  4X6A H;  2Z9H A;  3HOU H;  2RDF A;  5KIX A;  1EQV A;  4CDD C;  1OTC A;  3S1M B;  4AH6 A;  1MD2 D;  4CDE C;  4NP5 A;  1PMR A;  1YNN C;  4NB3 A;  3VA7 A;  4DR5 Q;  1FVI A;  4JI6 Q;  2WAQ G;  3AMU A;  1C9O A;  4DU9 A;  4DUY Q;  5C0X H;  3J7A V;  2IWH A;  2HHH L;  2Q2H A;  2AQ1 B;  1HNZ L;  1SRU A;  1Q46 A;  2L55 A;  1NMG A;  4A3D B;  4KHP Q;  1SJH D;  4UPA A;  4EQP A;  2K5N A;  2F0H A;  4DNR B;  2CH4 W;  4RGN A;  3ONA B;  4LF8 Q;  2UXB L;  1BUV T;  3DWP A;  1VQM A;  2F0G A;  5DEH A;  5C5M A;  4JI6 L;  1XMQ L;  5M3M H;  2F4V Q;  4IUR A;  1WCM H;  3I4O A;  1GUG A;  2IHF A;  1K9M C;  2EYL A;  3PCO B;  2Q2U A;  4JYA L;  4QGU A;  2A6H C;  1VQF A;  3W1G A;  1YJ9 A;  3EFX D;  2HIX A;  1MIU A;  2PZW A;  3J81 j;  2DGY A;  1X3Q A;  1QNK A;  4NDX A;  3RZD B;  1NSN S;  1NCV A;  3QIA A;  5KRU A;  3J80 E;  2MFI A;  1IW7 C;  1VQB A;  3FMC A;  1ILP A;  3K8A A;  4DV0 Q;  3MEH A;  2RSN A;  2JA5 B;  1P8L A;  1EFI D;  1GO3 E;  1PTO F;  3I91 A;  4QJF A;  3CF5 A;  2K01 A;  2KEE A;  2DN8 A;  2QEJ C;  3I73 A;  1PFS A;  5ELE A;  4IJL A;  3TP5 A;  5DM7 3;  4E6I A;  2QCP X;  1R4P B;  4FVM A;  3GV3 A;  4X64 Q;  1LT3 D;  4J6H A;  4WFN 3;  1ROD A;  4QUC A;  1C4Q A;  2MUY A;  4LNQ A;  5IWA L;  3TS2 A;  3UE0 A;  4EVO A;  2A69 C;  1SYD A;  4L5T A;  2EXZ A;  3UDF A;  2F0O A;  1N9W A;  5GAD C;  5D3I B;  5M3F G;  4HAE A;  3KLR A;  1SFO H;  4A93 G;  2DNE A;  2RA4 A;  1KRS A;  2J0T D;  3T4A C;  5FO7 B;  1MJE A;  3CMA A;  2UUA Q;  2IT1 A;  4GNX A;  3SK8 A;  4L8J A;  4WRD A;  4QIW B;  3ICE A;  1F9Q A;  1KQS A;  4PV1 C;  3HZX A;  1TWG H;  2F0W A;  2OEO A;  4IJH A;  5EQ0 A;  3JAM E;  2AUK A;  2KEN A;  3H6M A;  1JB7 A;  1VQH A;  2Y0S E;  3CCV A;  2OWO A;  1HA6 A;  5K36 G;  1QB5 D;  5C4Z A;  3I70 A;  1SND A;  2LS0 1;  4K14 A;  4QMG A;  4DPG A;  2CHB D;  1VQI A;  3WOF A;  4GLA C;  1WOC A;  1EY5 A;  5L37 A;  4CJ1 B;  1S5F D;  2EY5 A;  4IPD A;  3E9H A;  4DV6 L;  1I4H A;  2VQF L;  1Q90 A;  2N88 A;  3SK6 A;  4LUO A;  1HFN A;  4AQY Q;  1HTP A;  5HY6 A;  1KIX A;  4OWX B;  1CZW A;  3NPP A;  5JEA G;  3OIP A;  1A15 A;  2CQO A;  3I55 A;  4F8M A;  2VL6 A;  2RCN A;  1KNE A;  3SDZ A;  1YNJ C;  3EVQ A;  5M5Y B;  3J81 c;  2L4N A;  3TDQ A;  3ERQ A;  3BVM A;  5COY A;  4NXN L;  2Z0S A;  5KGU A;  5C0X G;  1Z47 A;  3L9A X;  3K57 A;  1I4R A;  4HED A;  1TWC B;  2E74 C;  2HDL A;  1TWC H;  4KI0 A;  1PZI D;  2BDO A;  3HEJ A;  1ZXT A;  4JBM A;  1HR0 W;  3HOU G;  2XGT A;  5JOB A;  4B3S L;  5DLQ E;  1TWF B;  4R4I A;  1LTG D;  4TSS A;  4JI0 L;  3M4Q A;  1XTC D;  3MAQ A;  4A3B G;  1VS0 A;  2F0J A;  1CA5 A;  3O13 A;  2QW7 A;  1HRJ A;  3F2D A;  3UE1 A;  3Q8D A;  4R4C A;  3NBH A;  3J81 L;  1HFG A;  1EIY B;  4G7O C;  1A8V A;  1EQT A;  1Y8P B;  3T1H Q;  5C4X G;  4GS3 A;  4JVZ A;  1GHK A;  2I5L X;  2L12 A;  4QCL A;  2O5I C; 
#chains in the Genus database with same CATH homology
 2EYP A;  4Q5V A;  4RCN A;  3BDO A;  2YU9 B;  5FO9 B;  5M5W B;  2JA8 B;  1EU4 A;  4XTC S;  1LLR D;  4B9X A;  2QKI C;  3SEB A;  4CJ2 C;  4K2K A;  4QUF A;  4IUP A;  3KLS A;  2RKS A;  1B44 D;  3MZ5 A;  3G7L A;  5LHY 1;  4ZKC B;  5KYL A;  5CBE E;  3OW7 A;  1W6J A;  3OSO A;  4C3J B;  2KHS A;  4WOR A;  3ZYY X;  3A55 A;  5CV8 A;  3I90 A;  1IKM A;  4N9P A;  4RKB A;  4CKE A;  2I46 A;  1B3A A;  3MVV A;  5G3L F;  1PRT F;  3CQZ B;  2LMC B;  2R61 A;  5C3E B;  4BS9 A;  2D2C C;  3HS0 C;  3FKI B;  1EYA A;  1SYE A;  3I8Z A;  2PCF B;  3FEW X;  1SMY C;  1LTA D;  2EY6 A;  1HCZ A;  2D5D A;  3VR2 A;  3M7N A;  1SNP A;  3RD4 A;  4A3M B;  1TS5 A;  1LTS D;  5IGG A;  1G91 A;  4A3G B;  2MGS A;  3MXG A;  2K7V A;  3MA2 B;  4IZ8 A;  3S17 B;  1Y69 U;  4C3H B;  2ICE C;  2EVB A;  1STH A;  2IX3 A;  1ZYR C;  1TS2 A;  2KJX A;  1A3V A;  1CQF A;  1S5D D;  1PLF A;  1D6E C;  1TS3 A;  1TII D;  4XIG S;  3NQT A;  1BCP D;  3FPP A;  1I4X A;  4X3S A;  2F0S A;  4R9W A;  1GUT A;  4F87 A;  3FDT A;  1SAP A;  1U4P A;  3KLS X;  3NWT A;  2KVM A;  3A8J E;  5C0X I;  3Q24 A;  3X3N A;  2D9U A;  2B2W C;  3WOE A;  5DNF A;  2EPB A;  3E6Z X;  3NTH A;  5KNC A;  2C5C A;  5HUR A;  4IUQ A;  3GTL B;  4P2C B;  2B39 A;  2M9V A;  3SE0 A;  1SNM A;  5E4X A;  5A2Q E;  1KLG D;  3SHL A;  5A35 A;  3ERO A;  1I50 B;  3QOJ A;  5C3X A;  4A3E B;  1Z6H A;  2KQ3 A;  1GJX A;  5DM6 3;  2K1B A;  3VR5 A;  4KMU C;  3T13 A;  1JWU D;  4IQZ A;  3HP3 A;  3EQL C;  4M1U B;  1SYC A;  4NW2 A;  5BN3 A;  4IFD G;  1RD9 D;  2LKV A;  4F88 A;  3KBX A;  2X6G A;  1B1Z A;  1FNU A;  2B2W A;  1ICW A;  3FRP B;  4K8I A;  1PZK D;  5KNB A;  5JEA H;  5C4J B;  5C3W A;  1IL8 A;  1A6X A;  1M4V A;  3MHB A;  1PFB A;  2PNR C;  1BDO A;  2OT2 A;  2MP1 A;  2K04 A;  4BA1 I;  1NAP A;  2ZXO A;  1SXT A;  1V8Q A;  5IGB A;  3OMC A;  5K36 H;  2RDG A;  5D65 A;  2M2L A;  3PV0 A;  2L5T A;  3GP7 A;  4DAP A;  3HOZ B;  1ENC A;  3W2D A;  3EJI A;  5IOC A;  2K32 A;  2JSO A;  3M85 A;  4J8Q A;  4RHR A;  4HCE A;  1EIH A;  4LJZ C;  2WIN B;  2L11 A;  2RQX A;  1Q3L A;  2I07 B;  1IW7 D;  5FKA C;  4KY6 A;  1PYW D;  3S9W A;  4FXD A;  2BA1 A;  1GUW A;  1JIC A;  2L1B A;  2QDB A;  1V1P A;  3GTP B;  2KCC A;  4RFB A;  1XX8 A;  1XYI A;  2EYM A;  3GTM B;  5CV9 A;  5JPN C;  4FO2 A;  3PUV A;  1HUM A;  4KJO A;  1CA6 A;  1E0B A;  3K5L A;  2L0C A;  2O5J C;  3OMG A;  2WKC A;  1A3T A;  3LX0 A;  4DK1 A;  2EY1 A;  1BCP F;  1BR9 A;  3Q0A A;  2BE5 C;  3RZO B;  5FLX L;  1VMC A;  1K8M A;  4LAA A;  3GO5 A;  1B9M A;  3GV6 A;  5JJZ A;  3K5O A;  5IIF A;  2O2L D;  4FF1 A;  2EYH A;  1QNU A;  3JAM L;  1TU2 B;  2A6E C;  4X3T A;  1SBB B;  1EL0 A;  2K6A A;  1UEA B;  1TQO A;  4R8I A;  1TWA B;  1F9R A;  2EJF C;  3IFT A;  3NK9 A;  5I9O A;  4BBR B;  4Q0F A;  1WD1 A;  1BQQ T;  1KDB A;  3A8I E;  2EYJ A;  4L63 B;  3MXN A;  4J1M A;  5IT9 E;  5I6W A;  4ZYS A;  3RUZ A;  3C2P A;  3DXJ C;  4BWG B;  1KAB A;  4O1N A;  3CU7 A;  1G6Z A;  3DHQ A;  2K33 A;  1KDC A;  3ND8 A;  4N9T A;  3FVQ A;  2KED A;  1SE3 A;  4EGV A;  4C3H G;  5F2D A;  3SXH A;  3HGB A;  4ILW A;  5EPK A;  2KCN A;  3HOV B;  3VR4 A;  3TZU A;  3NXW A;  5DAU A;  4ZAI A;  3SVM A;  5C4H A;  5CMD A;  2NN6 H;  1HTL D;  1SDF A;  1EEI D;  4PMB A;  1DD2 A;  5LL6 S;  2NZ1 D;  3QG1 A;  2EYF A;  1LTT D;  4DAV A;  3K0Y A;  2EY2 A;  2Z1C A;  4DGZ A;  3NUC A;  1WTO A;  2ZXR A;  5NUC A;  4ZRZ A;  3I72 A;  1LTR D;  3I3C A;  1F2Z A;  3A8K E;  1FD7 D;  1LT6 D;  4A3B B;  3L7Z C;  1GUN A;  1CZG A;  1R4Q B;  1G2T A;  2OXP A;  5T1I A;  2F0D A;  5KYI A;  3OWF A;  3OIQ A;  2CW0 D;  2K5W A;  3VR3 A;  1I4P A;  3SR1 A;  4BBS B;  3BDL A;  4OO1 I;  3ITP A;  1TVX A;  4Z9C B;  1TY0 A;  1BXT A;  4O42 A;  1U4L A;  2B2V C;  4CGY B;  2TMP A;  4OO1 H;  5EKI A;  1JC7 A;  1IKL A;  4V0B A;  1D1K A;  2F0K A;  3BYY B;  3M3Y B;  2JP1 A;  1F2Y A;  2GA4 B;  1MBY A;  3CHB D;  3C1F A;  1B50 A;  1TY2 A;  4K2L A;  4RGO S;  1SMY D;  5COR A;  5I2Y A;  1KAA A;  4XDX A;  4HR7 B;  2AQ2 B;  3J7Y W;  1J9O A;  3D8G A;  1LTI D;  5C6A A;  1HUN A;  1DM0 B;  1I3Q B;  2F0T A;  5IGF A;  1OXT A;  1ENA A;  4DNT B;  2Q8I B;  2BDN A;  1STN A;  1VDZ A;  2Z8L A;  5J1Z A;  4FXG C;  2MHV A;  2G9H D;  1RDP D;  3D4R A;  3S1R B;  4BA2 I;  1V43 A;  2DY7 A;  2KUM A;  2FMM A;  3T16 A;  1CT1 D;  4UDU C;  1JOR A;  4I7Z C;  2MPM A;  1GUO A;  3MFY A;  2AWO A;  2J4X A;  1M8A A;  2JA7 B;  5I4D A;  3MFG A;  4K6D A;  2J7Z A;  5ELC A;  1I4Q A;  4KY7 A;  4RKL A;  1AZP A;  2YYZ A;  4RAU C;  2HQE A;  3T56 B;  1QG7 A;  2AUJ D;  3TN2 A;  3PO2 B;  3K5M A;  4KKU A;  2XRQ D;  3F2U A;  1SNC A;  4ABN A;  1QCB D;  2PMZ B;  1RJT A;  1ET6 A;  2K5Q A;  3GTQ B;  2LFN A;  2EJG C;  5CV6 A;  4A3K B;  2XNA C;  1CHQ D;  2FHT A;  5K5P A;  4IFD H;  1PFM A;  3DUZ A;  1EYC A;  4ODG A;  1OXU A;  1WCM B;  2JYO A;  5CGK A;  1C8C A;  1PTO H;  1DYQ A;  5JEA J;  1EZ8 A;  1DOL A;  3DEO A;  1MGS A;  4G4K A;  1S4Z A;  1STE A;  4DN4 M;  3A7L A;  4DFA A;  4DK0 A;  1BBX C;  2A68 C;  3Q6S A;  4I65 A;  4C2M B;  4B08 A;  1STB A;  2WP8 J;  3J80 L;  4RH6 A;  3ND9 A;  4KD4 A;  2EZV A;  4U67 3;  3MTS A;  2A68 D;  3E0J A;  3GQB A;  1PRT D;  2RDH A;  3FPU B;  1CK1 A;  2F1M A;  2R7Z B;  4EQO A;  1X32 A;  4TQU S;  1V1P B;  3KK7 A;  3CRK C;  4K5W A;  1JWS D;  2R93 B;  1D1I A;  3TP8 A;  3K5N A;  2F0N A;  4A3J B;  1NUC A;  3N6R A;  2SEB D;  1GUS A;  5IGE A;  2XN9 C;  1SFO B;  1O78 A;  1Y8N B;  1Y8O B;  5C4X B;  3I4L A;  1E2V A;  3D4D A;  3MC0 B;  1HQM C;  3RMH A;  5D3D A;  4HN7 A;  5CR3 A;  2F03 A;  3GTO B;  1HPC A;  5LL6 X;  1SE2 A;  3C46 A;  2CQA A;  1F9S A;  4OGQ C;  1GHJ A;  1LT5 D;  5M3F B;  1U9R A;  3DWA A;  2FJ2 A;  1J8I A;  3R2I A;  3K58 A;  1H9S A;  1LV9 A;  1F77 A;  1QOH A;  4RHS A;  3NQI A;  2B2U A;  3D6C A;  4HMJ A;  2OF1 A;  3DEP A;  3HKZ B;  2ZXP A;  4KD3 A;  2KEC A;  1OO9 B;  4C3J G;  2EJM A;  1SNO A;  5ELF A;  2KOL A;  1IHZ A;  2EOT A;  1EWH A;  3OPO A;  1HHV A;  1EZ6 A;  1DJR D;  3D6W A;  3S16 B;  1AN8 A;  4QF4 A;  2M00 A;  1CQV A;  1KNA A;  3HOW B;  5HGT A;  2TSS A;  3U9O A;  1C48 A;  2D62 A;  1DON A;  3NHH A;  2CVR A;  1AP0 A;  5EKL A;  1RTO A;  3BS1 A;  2IX1 A;  2PZU A;  5M5X B;  5CV5 A;  3BDC A;  1X3P A;  2A74 C;  2E76 C;  4CJ0 B;  3RLF A;  1RKN A;  1WTR A;  4H44 C;  3S1N B;  1VCI A;  4C1N K;  2F4I A;  3LWU A;  1KTK A;  5FLX E;  5CYU A;  1VF7 A;  1SSO A;  2Y0S B;  2PO4 A;  1FR3 A;  3LWE A;  3IFD A;  4ME5 A;  4G7H C;  3R2T A;  5E4W C;  1CHP D;  3R3O A;  2AWN A;  1EIG A;  1Q1B A;  3URY A;  3VA5 A;  1WTX A;  1Q1E A;  2PYK A;  4FP5 D;  1K8O A;  1EY9 A;  3D3R A;  3K59 A;  1ESR A;  3KUP A;  4OHJ A;  1PZJ D;  1QJO A;  1H9S B;  1TR5 A;  2K03 A;  1D2B A;  4PNY A;  2EE1 A;  5C5L A;  3TME A;  3EA6 A;  1LTB D;  3NBI A;  1K83 B;  1I4G A;  4ZUI A;  2A6H D;  5E3F A;  2ID0 A;  5IT9 L;  1DOK A;  2B2Y A;  2WAC A;  1NR4 A;  1STA A;  3TP6 A;  5JPM C;  2JEB I;  4JK1 C;  5KEE A;  2PZT A;  4DXF A;  4YIJ A;  2NN6 I;  2FMC A;  1LAC A;  2PPB C;  4FXK C;  1H9R A;  2JXM B;  3R93 A;  1NR2 A;  3PIO 3;  2IL8 A;  5IOD A;  1UNS A;  2C9O A;  1JCK B;  1PRT B;  3K6O A;  1S5E D;  3M4O B;  1EY0 A;  4C56 C;  5J39 A;  3IL8 A;  3NE5 B;  5CV4 A;  4G7Z C;  2N55 A;  4V19 0;  2WKD A;  4K5X A;  1PRT C;  1Y1W B;  2Z4H A;  3TSS A;  2A73 B;  1B2T A;  1Q12 A;  3BYT B;  4FF3 A;  4NMZ A;  5JVH 3;  4LMQ D;  1O7L A;  2G9D A;  1B9N A;  4RGT A;  3PUW A;  5IGD A;  1G29 1;  2LY7 A;  4K6L A;  2O4X A;  4S3S A;  2A6E D;  4GZY C;  1I6H B;  1T5E A;  2B2U C;  3D31 A;  3H0G B;  3VYS A;  3PUX A;  3QJY A;  4EQN A;  4WJW A;  1BF4 A;  2NVX B;  1I6V C;  4A3I B;  4C3I B;  4QB4 A;  1JOQ A;  1EU3 A;  2F0P A;  3H94 A;  1WTP A;  3VYU A;  3S2H B;  1BCP B;  2EYO A;  1GOZ A;  4PQX A;  3UI2 A;  1PDQ A;  4FF4 A;  4A93 B;  4BY1 B;  1BOS A;  1BCP C;  3GD7 A;  1WTW A;  1RF2 D;  2FIN B;  4DAY A;  1ENF A;  1H9K A;  5FOB B;  1H9J A;  1O7Y A;  1FNW A;  4CHT B;  1HXY D;  1S5C D;  2PQE A;  5C0X J;  4XXE A;  4IAL A;  2JEA I;  4ZK9 B;  2RVL A;  1ILQ A;  3HRZ C;  4ZLT F;  2KA7 A;  4IUU A;  4XQJ A;  4ULL A;  3J7A F;  3P1H A;  1FGB D;  4CKB A;  2NVY B;  3BZD B;  1WTQ A;  4JBW A;  1RTN A;  2AQ3 B;  1QWY A;  2BCO A;  3TP7 A;  5KND A;  1ZEQ X;  2NYZ D;  4PMC A;  3PMF A;  4A3F B;  1XXG A;  2A5H A;  3J81 E;  1FYC A;  1L0X B;  1TWG B;  3AU7 A;  3LNN A;  1V1O A;  1TS4 A;  1MSG A;  3L3O C;  3CRL C;  3Q23 A;  5M9O A;  1GXD C;  4MN3 A;  1MSH A;  1RHP A;  5ELD A;  3P7J A;  3D4W A;  3HOY B;  3Q22 A;  2IX0 A;  2E2D C;  2NVT B;  5I9P A;  1RCV D;  4IFD J;  2PW7 A;  1OXV A;  5JVG 3;  5ELB A;  2NVQ B;  1ML0 D;  1CM9 A;  4KKS A;  4XT3 B;  3A54 A;  3H91 A;  5CV7 A;  3DMU A;  3R8B A;  5JAV A;  1Q8I A;  4KY5 A;  4NKL A;  4RA8 A;  1G2S A;  3QOL A;  1O80 A;  4F7X A;  4H0L C;  2HUG A;  3NTK A;  1D5Z C;  1BNZ A;  3MXU A;  5ISR A;  2BE5 D;  3H09 A;  5CBA E;  3MWY W;  3NTI A;  4XT1 B;  4K5V A;  5J22 A;  2E75 C;  1JQY D;  3TZD A;  1ET9 A;  1E2W A;  1SYB A;  5IGC A;  2ENB A;  1KDA A;  4PMW A;  4C1N I;  4OIK A;  4KK7 A;  2WB1 B;  2VXW A;  1EEF D;  5I2X A;  2E2J B;  3VYT A;  4KN7 C;  3H3V C;  1STY A;  2E2H B;  2ZT9 C;  4R8N A;  1SYG A;  3X3M A;  3BVG A;  2F3V A;  3SK4 A;  1XWE A;  2SNS A;  3P20 A;  1F2M A;  4IN3 A;  2VB2 X;  1AFP A;  4ZKB B;  1II3 A;  1F9P A;  3V05 A;  2CW0 C;  4MHE A;  3C1E A;  2F0Q A;  4ID6 A;  1YNJ D;  5C44 B;  2DNC A;  1TWH B;  1SE4 A;  4G57 A;  4CKC A;  3A7A B;  1TKW B;  4U68 A;  2VNU D;  3U9S A;  3P75 A;  4XQQ A;  3PO3 B;  3KBG A;  3IKJ A;  2XRS D;  4BY7 B;  4C3I G;  1BO0 A;  1ESF A;  2X69 A;  2IW3 A;  5BN4 A;  2Q8T A;  2JA6 B;  1MI2 A;  5D14 A;  2B8G A;  2B2Y C;  1LO5 D;  3I4M B;  5A2Q L;  3SK5 A;  1T5X D;  2F0E A;  3S2D B;  1D5M C;  3G6J B;  2QIL A;  2F0U A;  5M3M B;  1IYV A;  1OXX K;  1DOM A;  5T1G A;  1EY8 A;  5AFW A;  1IYU A;  1JE4 A;  2F0V A;  5FK9 C;  1QE6 A;  2K05 A;  2XWJ B;  1ZKO A;  3QWN A;  2Q8R E;  3PIP 3;  3VR6 A;  4HTH A;  1WD0 A;  3GTJ B;  1DCZ A;  3PUY A;  4AYB B;  5EPL A;  5E1F A;  1ZYR D;  3AB9 A;  5FO8 B;  4RGM A;  2F0I A;  1E2Z A;  1STG A;  2K28 A;  1O7Z A;  1PFN A;  3M7G A;  1Y1V B;  3NP8 A;  1D5X C;  5I6Y A;  2VB3 X;  1DXM A;  2B2T C;  4LK1 C;  1QIL A;  2BOS A;  1KLU D;  2B63 B;  2SOB A;  1SYF A;  2WV6 D;  2Z4I A;  5G3L D;  1CTM A;  3IAY A;  1JB3 A;  4TRD A;  3VYR A;  1UAP A;  1VF5 C;  2VUM B;  1EY4 A;  5CC4 A;  3A56 A;  1DZ1 A;  1CFM A;  4MIU A;  3T53 B;  1EWC A;  1Z7T A;  2XIW A;  1EY7 A;  3W3A A;  4H13 C;  3KF8 A;  1G8Z D;  3HG9 A;  1AW7 A;  4TKO B;  1CI3 M;  2NBF A;  2F0L A;  2R6G A;  4CBV A;  1B53 A;  2A69 D;  2MJ8 A;  4FF2 A;  2B8F A;  3DWQ A;  3S1Q B;  1W6K A;  3S14 B;  2JE6 I;  1JOO A;  4K8J A;  3OWE B;  2IPK D;  2NTS A;  4KV6 A;  2HCI A;  4RCO A;  1HA5 A;  5EKK A;  1JR0 D;  1AEX A;  3K7A B;  4IUN A;  4DXG A;  2R92 B;  1B4O A;  4L6T B;  2H1E A;  2QF7 A;  1A2T A;  2FFK B;  4IUV A;  1EOT A;  1JOK A;  4RWS C;  4XYO A;  3NWS A;  1YNN D;  2V4D A;  2R3Z A;  2NTT A;  5EBC A;  2WII B;  3CKI B;  3MXP A;  1UUP A;  3V2T A;  3DM1 A;  2RBM A;  4DF7 A;  1WTV A;  5EJW A;  1A2U A;  2HDM A;  4KHV A;  2SDF A;  2B2T A;  3QB3 A;  4HSP A;  3V96 A;  3WDN A;  4OO1 G;  4X3K A;  1L0Y B;  5BN5 A;  3GTK B;  1ONL A;  5EPJ A;  4X3U A;  2E2I B;  4HCS A;  2X6L A;  4FNF A;  2L9H A;  3GTG B;  4Y7N B;  1SJE D;  3QO2 A;  1EY6 A;  1WVL A;  2F0F A;  2DY8 A;  1TT2 A;  4HMI A;  2NWG A;  1SNQ A;  4FYD A;  2BA0 A;  4XQN A;  2F0M A;  3HOU B;  2NUC A;  3I4N B;  3M4Y A;  2XWB B;  4IFD I;  3N52 A;  1R9T B;  3PUZ A;  4KKT A;  5EGT A;  4ZUJ A;  4DA2 A;  1EYD A;  3OHX C;  5EBD A;  2K5D A;  2SNM A;  4OL7 A;  4KJN A;  4M8A A;  1AZQ A;  3OOC A;  4ZQ3 A;  3T51 B;  4KTA A;  2NN6 G;  5TSS A;  3BG3 A;  3BVZ A;  1PTO D;  4KHZ A;  2PW5 A;  2RSO A;  2HCC A;  2XVS A;  1OXS C;  1S5B D;  1VMP A;  2B2V A;  2IJ0 A;  4KN4 C;  3TBI B;  1A3U A;  1PTO C;  4IUT A;  3HOX B;  2EDG A;  4XYQ A;  3E5S A;  2F3W A;  2ICI A;  1LT4 D;  1FNV A;  2WAQ B;  2NB0 A;  1F2L A;  1PTO B;  2XSC A;  1JWM D;  1HQR D;  3NSW A;  1SEB D;  1U4R A;  3S15 B;  2H4O A;  1U4M A;  4B9W A;  1LAB A;  4HSV A;  1H9M A;  3C3L A;  4H7B A;  1PXU A;  4OIJ A;  4UAI A;  2RDF A;  5KIX A;  1EQV A;  3S1M B;  1MD2 D;  4NP5 A;  1PMR A;  1YNN C;  3VA7 A;  3AMU A;  4DU9 A;  5C0X H;  3J7A V;  2IWH A;  2AQ1 B;  2L55 A;  4A3D B;  1SJH D;  4EQP A;  2F0H A;  4DNR B;  4RGN A;  3ONA B;  1BUV T;  3DWP A;  5C5M A;  2F0G A;  5DEH A;  4IUR A;  1GUG A;  2EYL A;  2A6H C;  3EFX D;  2PZW A;  1X3Q A;  1QNK A;  4NDX A;  3RZD B;  1NSN S;  1NCV A;  3QIA A;  5KRU A;  3J80 E;  1IW7 C;  3FMC A;  1ILP A;  3MEH A;  2RSN A;  2JA5 B;  1EFI D;  1PTO F;  3I91 A;  2K01 A;  2KEE A;  2DN8 A;  2QEJ C;  3I73 A;  5ELE A;  3TP5 A;  5DM7 3;  4E6I A;  2QCP X;  1R4P B;  4FVM A;  3GV3 A;  1LT3 D;  4J6H A;  4WFN 3;  1ROD A;  4QUC A;  1C4Q A;  2MUY A;  4EVO A;  2A69 C;  1SYD A;  2EXZ A;  2F0O A;  5D3I B;  4HAE A;  3KLR A;  2DNE A;  2RA4 A;  2J0T D;  3T4A C;  5FO7 B;  2IT1 A;  3SK8 A;  4L8J A;  4WRD A;  4QIW B;  1F9Q A;  4PV1 C;  3HZX A;  2F0W A;  2OEO A;  5EQ0 A;  3JAM E;  2AUK A;  3H6M A;  1HA6 A;  5K36 G;  1QB5 D;  5C4Z A;  3I70 A;  1SND A;  2LS0 1;  4K14 A;  4QMG A;  2CHB D;  3WOF A;  1EY5 A;  4CJ1 B;  1S5F D;  2EY5 A;  1I4H A;  1Q90 A;  2N88 A;  3SK6 A;  1HFN A;  1HTP A;  1CZW A;  3NPP A;  5JEA G;  3OIP A;  1A15 A;  4F8M A;  1KNE A;  3SDZ A;  1YNJ C;  3EVQ A;  5M5Y B;  2L4N A;  3TDQ A;  3ERQ A;  3BVM A;  5COY A;  5KGU A;  5C0X G;  1Z47 A;  3L9A X;  3K57 A;  1I4R A;  4HED A;  1TWC B;  2E74 C;  2HDL A;  4KI0 A;  1PZI D;  2BDO A;  3HEJ A;  1ZXT A;  5JOB A;  1TWF B;  1LTG D;  4TSS A;  3MAQ A;  1XTC D;  2F0J A;  1CA5 A;  3O13 A;  1HRJ A;  3NBH A;  3J81 L;  1HFG A;  4G7O C;  1EQT A;  1Y8P B;  1GHK A;  2L12 A;  4QCL A;  2O5I C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...