2XSCA

Crystal structure of the cell-binding b oligomer of verotoxin-1 from e. coli
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
69
structure length
69
Chain Sequence
TPDCVTGKVEYTKYNDDDTFTVKVGDKELFTNRWNLQSLLLSAQITGMTVTIKTNACHNGGGFSEVIFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords SHIGA-LIKE TOXIN 1 SUBUNIT B
publication title Crystal Structure of the Cell-Binding B Oligomer of Verotoxin-1 from E. Coli.
pubmed doi rcsb
total genus 16
structure length 69
sequence length 69
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2010-09-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.70 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2xscA00
4P2CB 1D1KA 1R4PB 1CZWA 1QOHA 1D1IA 2BOSA 1QNUA 4ULLA 3MXGA 1CQFA 2GA4B 1DM0B 1BOSA 2XSCA 4M1UB 2C5CA 1C48A 1C4QA 1R4QB 1CZGA
chains in the Genus database with same CATH superfamily
1KRTA 3PV0A 4P2CB 4DR7Q 1VQPA 5JJZA 4C1NI 5C3WA 2XRQD 2NN6H 3HG9A 5KNBA 1GHKA 3D0FA 3G4SA 3T53B 1IBML 5CYUA 1NSNS 3M4YA 4L5QA 2XRSD 4CHTB 2F0IA 3I70A 4H0LC 1BVSA 1KIXA 3IKJA 4ZAIA 1FNUA 3S1NB 2E2JH 1EZ6A 1TWFB 5M5YH 4TQUS 3R8BA 2XVSA 4C3JG 1Q8IA 4RMFA 3KF6A 1SR3A 1XWEA 1EQQA 2MQHA 5K36H 5K5PA 4HJ8A 3I4NB 3HOZB 2ZT9C 2E2HB 1X3PA 2KCCA 1FJGQ 2GVAA 5J22A 2JA6B 1OXVA 3UDIA 1T9HA 3A55A 2MGSA 1HPCA 3TN2A 3OIQA 1JOKA 2AMCB 4I7AA 2A6ED 2JEAI 2LY7A 1D1IA 4ABNA 1QUQB 3KK7A 1UE5A 4GN4B 3J81j 4OEMB 2IPKD 2SDFA 3VA7A 3CCLA 4QL5A 2L5TA 4NKLA 4DK3C 3PUZA 2K32A 4GLVB 1PYBA 2CQAA 4A3DG 2ZTEA 1LM0A 4KTAA 1GUWA 4KKUA 3D6CA 2A8VA 1K73C 1FGBD 2JA5H 2F0DA 1K8OA 1PZID 2Z6KC 1H9RA 1HR0W 3HOXH 4GNXB 5IOCA 1XNQL 5ELFA 3BJUA 4ILWA 5EPLA 1HNXQ 2N78A 4A3IG 3BVZA 2ZXPA 4DAMA 3ICEA 1ML0D 4Q5VA 1ASYA 2R7ZH 2JA7H 3S1RB 1JE5A 3F2BA 3ZYYX 4A3KH 3AEVA 4BXXG 2AHOB 1WTPA 2M2LA 1VMPA 4KHPL 3S1MH 4GNXC 1I50B 1M90C 3HS0C 4XQNA 3UDFA 1K3RA 1BCPD 5IP7G 1MSHA 4DR5Q 3GDEA 5CV8A 5DEHA 3BDLA 4DFAA 4LFBQ 1DM0B 2M9VA 4DV0Q 2MO0A 3SK4A 4DR4Q 4LUOA 1X3QA 2R3ZA 3E5SA 3GV3A 3EBEA 4KD4A 3BS1A 1U4MA 1H9KA 5C4XH 1YZ6A 3HRZC 1IL2A 4ZCKA 3J7ZC 3EA6A 4KV6A 5KYLA 3HOYH 2AKWB 1ZYRD 2XGTA 4UY8C 5BR8L 2JA5B 3L7ZC 1OXTA 3A8IE 1PXUA 4C3HG 2SNSA 4NMZA 1PTOD 4RGNA 3M85A 5C4ZA 2A1AA 4A76A 4LF9Q 2WAQE 4NDXA 4PZ7A 1EY0A 3NBHB 1AZQA 3RNUA 5ELBA 2CW0C 1EU3A 2X6LA 2R7ZB 2UXBQ 4QCLA 4E6IA 1TU2B 4JBJA 2B2WC 3S1MB 3EQLC 2F0JA 4KN7C 1IHZA 1GUGA 2NZOA 1LLRD 3AB9A 3IFDA 4G7HC 1EQVA 2CH4W 2K03A 4JI4L 4OX9L 4A3JH 1DCZA 3S15B 1SJED 5M5WB 3U58A 1G2TA 1S5FD 3Q0AA 5IP9G 4RWSC 4NP5A 1CTMA 1IL8A 1RTNA 2PI2A 2WB1G 1LTID 2OQKA 1Y1WH 3MXNA 4ALPA 3EVQA 3V96A 5IODA 4YHHL 4QMGA 1MJCA 2FFKB 3QIAA 2B2UC 4IFDJ 5M3FH 3L0OA 1X9NA 4N8X1 2K5WA 3VR3A 2Y0SB 2BA0A 2K28A 5IGCA 2FMCA 4AYBG 1WTXA 1CKNA 1OXSC 2XSCA 3CCRA 4ZRZA 1QE6A 3I8ZA 2QF7A 4CKBA 3G71A 1V1PB 3K6OA 3GTGH 2WKDA 4LF5L 2EE1A 3QB3A 3E0JA 3HOWG 2IJ0A 4QIWB 2R93G 5AJ3Q 4BY1H 5NUCA 4A3LH 4YCUA 3J7AV 1GVPA 5CC4A 1YIJA 1ICWA 3S17H 4KHVA 4DGZA 4X62L 3DEPA 4B9XA 1AZPA 3KLSA 3A56A 3WDNA 1D5MC 3K0XA 1KHIA 4GN3B 1HH2P 2V1CC 3CPWA 1C7YA 1VQ5A 3KJOA 4B3SL 1I4RA 2QDBA 3T16A 4X3SA 1Z6HA 1CA5A 2F3WA 5T1IA 4DK6C 4EQ5A 1B9NA 2KHIA 1QCBD 4IPDA 4MNOA 3CC7A 4ZLTF 4ZKCB 4DV1Q 4U68A 1FR3A 5ISRA 5M3FB 1I4PA 2KVMA 2IHFA 1HFNA 3H0GG 3NUCA 1TKWB 5IGDA 1O7YA 4QUCA 1IW7C 5AFWA 4IOAA 1TWCH 1DOMA 2JEBI 1V43A 5E1FA 4RGTA 1LV9A 5C0XI 4DV5Q 4XT1B 1Y8OB 2EYPA 4N9TA 1A63A 3I4MG 4DV2Q 5C6AA 3SGIA 3EN2A 2B2TA 1PRTF 1A2UA 1HNZQ 2LSSA 1SRUA 1KABA 3FEWX 1B44D 4C3IH 2K5NA 4QUFA 1EY4A 4XQQA 2UU9Q 5JOBA 1CHPD 1SE4A 4S3SA 3D8GA 4RG1A 5G3LF 5IYCH 5I2YA 1YNXA 1BBWA 4HJAA 5JAVA 2B63H 2DNCA 2OXPA 1EEID 4F8MA 4HEDA 3J81L 1YI2A 1ET6A 3STBC 3MAQA 1K9MC 4GKJL 3T1HL 2RKSA 4CDDC 4BBRH 4DV4L 5IT9c 2ZM6L 4LAAA 4QJFA 1XPOA 5C4JB 4JI1L 2F0HA 1RODA 4YCWA 5C44H 5C0XH 2O4XA 3SHLA 1HUMA 1TWCB 1SNMA 2ICIA 4A3GG 3M4OH 1SNCA 5LMNL 1SYEA 2JJQA 4JG2A 4LMQD 1WJJA 5M3MB 1S3OA 4DKAC 2K5DA 1FVIA 3CQZH 4DV7Q 4JI0Q 2D0OA 3GTJB 1LUZA 4HJ5A 2YU9H 1LT5D 1B3QA 4WJ4A 5C3EB 1ESRA 4CJ1B 1RD9D 3PIP3 3NE5B 1A3VA 4LK1C 2NVTH 2K50A 2CWAA 3NQTA 1WTQA 2F0PA 3MEFA 2I5LX 2UUBQ 1QUQA 1WCMH 2ZTCA 1MJEA 1GM5A 2K52A 5FK9C 2Z6KA 1I3QB 4MN3A 4FDBA 2XN9C 1YNJC 2N88A 5JJLA 1AE3A 2B63B 1Y8NB 3KYHC 2KBNA 5D3DA 1STGA 3D3RA 2F0OA 2EYHA 4MZ9A 5CV4A 1I4XA 5IYBH 4IUTA 2A6HC 4A93G 1BBXC 3CMAA 2ENBA 4DR7L 5DM63 3MXPA 3N6RA 1ENAA 3TP8A 4DXGA 1SNQA 4X3TA 4G7OC 1EIHA 4R8NA 4GNXA 4RHSA 5C44B 1HJPA 2WB1E 1J8IA 5GROA 2X6GA 4RHRA 5C5LA 3KBXA 5IGGA 1BO0A 3HKZB 4DV6Q 4A4IA 2R92H 3CU7A 3K7UC 1DOKA 2V4DA 3OIPA 4G7ZC 1YJWA 4B3MQ 3CQZB 1SXTA 3A74A 5KRUA 1PFMA 4JBKA 2DY8A 5FLXE 5KGUA 4EQNA 3P75A 4AYBE 1A3TA 4ME5A 1BBUA 1H9JA 1YJNA 2F3IA 3OWEB 1Y1VH 4N8FA 4OWTB 3NTIA 4QQBX 4HMJA 5ELCA 5CV5A 3TZUA 2JSOA 1FJGL 4DR3Q 2K1BA 3QJYA 3RUZA 1A2TA 2WV6D 1S72A 3OOCA 1O80A 2NVYB 4A3CG 2HCCA 1Y1WG 2F4VQ 3PUVA 1QWYA 4X65Q 4A3BH 4AIMA 2Q8RE 4C3JB 1UAPA 2VUMG 1UEAB 3IAYA 1LTBD 5GAHC 2EJFC 1CKOA 2B2YC 2B2WA 5EKLA 3U4VA 4UHVA 4MTNA 1E2WA 1LT4D 1D8LA 2EYOA 5FO7B 4FNFA 1O78A 1OTCA 3FKIG 3NBHA 1D5ZC 4NW2A 1TWHH 1YHAA 2R92B 2JXMB 1L0XB 2A5HA 4KY7A 1AN8A 1EIYB 1HRJA 5GADC 2F52A 5JEAH 4L5TA 5M5XH 3KLWA 1BDOA 1GJXA 2Z4IA 4I7ZC 4GKKQ 4K6DA 1I4HA 3PO3G 1JWUD 1TS4A 4XDXA 4PQXA 4IALA 1HNXL 4X66Q 2QGQA 3HP3A 4ZK9B 1Y1VB 2B2UA 2A68D 3BG3A 1XMQQ 1STBA 4O1NA 4HTHA 1JC7A 1XYIA 1TIID 2G5DA 1SYBA 3G6EA 2PQAB 2VQEQ 4IJLA 2I5MX 4OIKA 4BBSB 1A3UA 4LW1A 4DR5L 2PZUA 4A3BB 4P71A 3VYTA 1YNJD 2A6EC 3K0YA 4LFBL 3MVVA 5FOBB 2B8GA 4DV0L 3UE0A 4DR4L 2VL6A 3RLFA 2A6HD 1SNPA 1PTOH 2EDGA 4V0BA 1V1PA 2LMCB 4CDEC 1N33Q 2KEDA 1OXUA 2EIFA 1G51A 1U4LA 3CCVA 4JI1Q 4J15A 5DAUA 4OIJA 2DGYA 1E7ZA 3P1HA 3T13A 1SSOA 1KNEA 4LF9L 2K4KA 1O7IA 4ODGA 4HSPA 3W1BA 2NZHA 4PMWA 3PO2G 3S1NH 1BCPB 1S5ED 4L8JA 1UE6A 1Q12A 3JAML 1JCKB 1FD7D 4R4IA 3S2HH 1PFSA 1I94Q 2CQOA 3I4NH 1QZGA 2JA8G 5DM73 3N52A 1TS2A 1HQMC 2O2LD 3HOZH 4MIUA 2F1MA 3SDZA 4C3HB 1BCPC 5ELNA 2E75C 5EJWA 2JA6H 1GUNA 1RTOA 3SEBA 4LF7Q 3A5ZB 3SK8A 1V1QA 2EY6A 4KKTA 5FJ8G 1XTDA 2UUCQ 2D2CC 2E8GA 3TEHB 3LWEA 3KLRA 1TS3A 1PTOB 2QCPX 1TY2A 1MKHA 2FJ2A 5C0XG 1WTOA 1Q8KA 4JYAQ 3DMUA 1J6QA 1LT6D 3AFQA 4YWKA 2LFNA 5IT9E 2Q2HA 1LTGD 1U5KA 4R4CA 3GTOB 2EY2A 2L11A 3AFPA 1ZYRC 2B2TC 3D4DA 2H4OA 2F0VA 2HCIA 3TREA 3CCMA 5LL6S 5IWAQ 4DXFA 1PTOC 1B70B 1K8AC 3RN2A 1FNWA 1PVOA 1NTGA 2PCFB 1STAA 1RJTA 1B2TA 1M4VA 3AQQA 4JI6Q 4YWMA 2K33A 2IX1A 1G6PA 4FVMA 4NPSA 2K14A 5AJ3L 2Z8LA 2WKCA 2A69D 2PYKA 2EPBA 1S5CD 3MXUA 1IBLQ 3ZJYC 3S2HB 1SFOB 5FLMH 4JBMA 2UXDQ 3KF8B 1EEFD 1PH9A 2YYZA 1WTHA 1LTAD 4IUVA 1VQNA 4WJ3M 3PIOA 3S1RH 3NWSA 1FNVA 3F2UA 2VQFQ 1D2BA 4AYBB 4DA2A 1SAPA 2LXJA 3HFZB 1WYDA 4LUVA 2H1EA 1I50H 2E5LQ 1NBWA 3HOUG 4OXPA 2XIWA 3A0JA 5EPJA 3QO2A 4JOIA 3KUPA 1GHJA 4FF1A 3HOWB 4POFA 2WINB 1PH3A 2EYFA 1EYDA 4DV1L 2E74C 4JV5Q 1LTLA 2RDGA 3OPOA 4KHZA 1X3FA 1ICFB 2ALYB 3H94A 3J7AF 4RGOS 1C48A 1BQQT 1GUSA 4A3MG 3D4WA 3KOJA 2K75A 3RN5A 5GAEC 3J81c 1MIUA 4DV5L 4HJ7A 3F2DA 5E3FA 1IXRA 3K81C 1EOVA 2F0GA 2VW9A 5E7NA 4DV2L 3RZDH 1Q81C 1HNZL 2A74C 2B29A 3W2DA 1PH5A 3J81i 3BVMA 3ERSX 1HR0Q 2L12A 1II3A 2UU9L 2QKIC 1U0LA 1X32A 3NTHA 4IO9A 3C1EA 3OWFA 4WFN3 3CCQA 3SE0A 5LMUQ 1PH7A 3NELA 1STYA 3ER0A 1IKLA 5I6WA 4R9WA 2EYMA 3VYRA 3I7FA 2K04A 2EYJA 4IFDI 3L2PA 1AW7A 3S15H 1YVCA 5M5WH 2HT1A 4HMIA 1QVFA 1YJ9A 1SLJA 3CRLC 3C3LA 3X3NA 4CJ2C 1R4QB 4IUUA 4PNYA 3NBIA 3HKSA 1E24A 2KENA 2LKVA 4IZ8A 3HGBA 2RDFA 3J80L 2RVLA 1VQJA 2KEEA 1EYCA 1ONLA 1QOHA 1JWMD 4CBVA 2QDLA 4WRDA 1JORA 1BR9A 4XIGS 5CV7A 5D3IB 2EY5A 4KI0A 4DV7L 1NCVA 4JI0L 4WJWA 1FYCA 2B2YA 5CR3A 3RZDB 1B9MA 5FLXc 1QB5D 5EKIA 4CGYB 4M1UB 4C2MH 2AWOA 3LGJA 3GP7A 5CORA 2KCTA 4LFCQ 1EY9A 4YY3Q 4HIDA 4FF3A 4IPHA 2K6AA 4XTCS 5CGKA 2UUBL 1Y8PB 1VQHA 1IYUA 1KLGD 1ZXTA 3CAMA 3E0EA 4IFDH 1SYFA 3P7JA 4A3EG 1CKMA 1SMXA 4CDFC 3GTLB 4BY7H 5L37A 4KMUC 1A0IA 1IBKQ 2MHVA 4OO1I 2CVRA 2XTIA 2KHJA 5IYDG 5F2DA 2HIVA 3T51B 2QA4A 4PMBA 1K83B 1VQ9A 1Q82C 1ILPA 3D31A 5ELEA 2R7FA 4DV6L 3A8KE 4B3ML 3UI2A 1YHQA 3K5LA 2Z1CA 4LF8Q 4K8IA 2C9OA 2LS01 1JT8A 1A62A 5COYA 4RH6A 3CRKC 2PQAA 4C2MB 1J9OA 3Q6SA 2F0TA 1HZ9A 1F2LA 3I4NG 1O7ZA 3W5OA 2HQLA 1F9QA 1P8LA 1BUVT 3HZXA 1E2VA 4DR3L 1WI5A 1MBYA 1W6KA 3M9BA 3RD4A 4OO1H 1PLFA 2I5HA 1BOSA 4BY7B 2F0MA 2F4VL 3M3YB 4X65L 4OGQC 3BYYB 1EWIA 3MTSA 2KECA 3TRZA 3SK6A 5IGFA 1Q1EA 2EOTA 1XNRQ 3LNNA 2NN6G 2FINB 3I4LA 1PH4A 2PW7A 1S40A 1Q7YC 5EBCA 1KC8C 2AQ3B 3EIVA 3GTMH 3H15A 2HDMA 3K5MA 1KAAA 1PZKD 1I6HB 1WD1A 2K5HA 1VCIA 3U4ZA 4AQYQ 2F0FA 1F2MA 4K5XA 5C4JH 1EOTA 2K7VA 3GTQH 4GS3A 3Q24A 1YBYA 1TXYA 3DHQA 4GKKL 3HOVB 4KY5A 2VUMB 1T5EA 5K36G 5M3MH 2ICEC 1EY8A 4X66L 1SBBB 4KD3A 3KLSX 4J8QA 1XMQL 1W2BA 1WOCA 3A54A 3NEMA 1TWAB 2VY3A 3CXCA 3GTJH 5CV9A 4JI3Q 2L15A 1Q46A 2L9HA 3A5UA 5C3EH 2MP1A 4A3FH 3FKIB 2EJGC 3SK5A 4ID6A 5A35A 2DJFC 5GQOA 2F0KA 2KCNA 4KJNA 2VQEL 1VQ7A 1B4OA 1N32Q 4R8IA 1QZHA 4GZYC 2HD3A 4UP9A 3FMCA 1N36Q 2XWBB 1EIFA 3F8TA 1G2SA 4KJOA 1I3QH 1HA6A 2JQOA 2VXWA 2F4IA 4J1MA 3O13A 1S5BD 1X54A 4G57A 3CCEA 3GTMB 5JPNC 1DXMA 4IURA 4OWWB 3S14B 3FDTA 1SE8A 3MFGA 4C1NK 1N33L 1C0AA 4O2DA 2I07B 4GN5A 1QVGA 3Q22A 2BE5D 2KA7A 2WFWA 3W1GA 3PUWA 1TR5A 3JAMi 2JA5G 1CQVA 1HA5A 2D0PA 1PH6A 5EAYA 3GTQB 3I90A 4KLKA 3EROA 2G9DA 1Q1BA 4CJ0B 4JI7Q 3HOXG 1KTKA 1Z9FA 3KF8A 1IZ6A 2Q2IA 3NTKA 4ZUJA 3J81E 3M4PA 2F0WA 1GUOA 3WOEA 2MPMA 5CBAE 5JVG3 3H3VC 3PUYA 2YV5A 1LACA 4F88A 2R7ZG 1F9RA 4DAPA 2JA7G 2A68C 2PMZE 4A3KG 1JJ2A 1BCPF 5HGQA 4JOIC 4A3FB 5C5MA 1RF2D 3MZ5A 1EIGA 1N34Q 3MWYW 3J7YW 1I94L 2D5DA 2O5IC 4DR6Q 2CCZA 2WAQB 2NZ1D 3S24A 4IPGA 1MD2D 3E9IA 4LF7L 1K28A 4X64Q 4Z9CB 4DR2Q 3PO2B 2UUCL 5KIXA 2NVYH 1VQ8A 2UUAQ 1JB3A 2L1BA 4O42A 2PNHA 3NENA 3R93A 5C4XG 1PYSB 4C3JH 3CW2C 1PTOF 4LF4L 3HOYG 4JYAL 1JICA 3ONAB 1E2ZA 2JA8B 2PPBC 3PGZA 3NXWA 1VQ4A 3NQIA 4B08A 5IWAL 4H7BA 4CKEA 5EGTA 3ND9A 5CBEE 2NUCA 4QB4A 4JI6L 3QR8A 3Q8DA 1VF5C 2VNUD 1B8AA 4JI2Q 1IBLL 1K3BC 2AQ2B 2I46A 4ULLA 4K2LA 4IFDG 2UXDL 3FHWA 3FPUB 3OTOQ 1EL0A 1HZAA 3I73A 2L55A 4HAEA 2VQFL 4A3JG 2KCMA 3S16B 5HY6A 1HNWQ 4C56C 1WVLA 2JE6I 4A3DH 2E5LL 3PCOB 2IT1A 1BNZA 2JK8A 4X6AH 2MJ8A 5BN5A 1X56A 2ZTDA 1FGUA 4BBSH 4DK1A 2E2IH 1VQGA 2D62A 1PH1A 1TVXA 3D4RA 2B2VA 2N55A 3RLOA 1XXGA 1STHA 4ZUIA 2FMMA 4KN4C 4JV5L 1JQYD 4OONA 5M3FG 4OL7A 1D7QA 2KOLA 3I56A 1F9PA 1O7LA 3X3MA 1NAPA 4A3IH 1E1TA 1L0YB 1ENFA 1VQFA 4IOCA 5CV6A 4BXXH 1EU4A 1L2FA 2RCNA 5I6YA 4JK1C 4QGUA 1SE2A 2F0SA 3HOUB 1IKMA 1SMYD 1VQKA 3H91A 4XXEA 1F77A 3G7LA 1I6VC 1ILQA 4KKSA 1G8ZD 5IP7H 4BY1G 3RMHA 2K5QA 2G9HD 1UNSA 3WWVA 4A3LG 3I91A 4FF4A 3J7A5 4P73A 2A69C 1Y14B 2A73B 3HEJA 4HCEA 2JP1A 1QNKA 1SN8A 4H02A 2F0EA 2Q2TA 4JBWA 5EQ0A 1XPRA 1PHJA 1HR0L 4MTKA 1BXTA 4DNIA 2WIIB 5EBDA 4GOPB 1EWHA 4A3DB 2NWGA 2NVQB 4MHEA 1PV4A 5LMUL 1RIPA 3SVMA 3S2DB 1AH9A 2MUYA 3J80i 3W3AA 3PF5A 2E2IB 2H5XA 3CMEA 4C3HH 1YNND 1PFNA 4IPCA 1TWGB 5LL6X 4U673 4HIKA 1K8GA 1L0WA 4HJ9A 3TS2A 1HXYD 2CH4A 4XYOA 4FXDA 1NNXA 1JR0D 4P72A 4GOPC 2NYZD 1QILA 4DV3Q 2OF1A 4A3IB 4DU9A 3DUZA 3TQYA 4B9WA 2HDLA 2F0LA 4DUZQ 4H13C 4QY7A 2OTLA 1B1ZA 4POGA 4DNRB 5FO9B 3GTOH 1DJRD 3QG1A 3CC2A 1VQAA 4JI8Q 4Y7NB 2ZJQA 3GO5A 2UXCQ 1X6OA 1F2YA 4JCVE 4EX5A 1XMOQ 4LFCL 5FKAC 3EJIA 4YY3L 5IP9H 5LMNW 4C3IG 4RKLA 4L63B 2NB0A 1CZGA 1ZEQX 2DY7A 2PW5A 2QILA 1HFGA 1SFOH 2BOSA 2WP8J 5IYCG 3LWUA 2VZAA 3VR6A 2IW3A 4CDCC 2B63G 4UPAA 1IBKL 1ASZA 4RAUC 4UDUC 3IL8A 1HTLD 4BBRG 3V2TA 3JAME 3FVQA 2AWNA 2RBMA 4B3TQ 2HIXA 4TVAB 3HOWH 2JN4A 2R93H 2EXDA 1CZWA 5C44G 1VF7A 5IY0A 3K58A 1H9MA 3TMEA 4LF4Q 1RCVD 1RDPD 4A3EB 4LF8L 3JC66 3K8AA 2RDHA 3CCJA 2EYLA 5I9PA 3CF5A 1KRSA 4UP7A 2Y0SE 3CCUA 4EQPA 5J3BA 1L1OB 2B8FA 5KEEA 5KNCA 3F2CA 1H95A 2R7DA 5CMDA 1LYLA 2WB1B 4BS9A 3B6YA 1OXXK 1WCMG 2ID0A 2ES2A 4RCOA 4QIWE 3FRPB 1XTCD 4BA1I 5LHY1 3I72A 1D6EC 3T4AC 1OO9B 5A2QL 4DAYB 3PMFA 4JI5Q 1L1OC 1Y69U 3A7LA 3RR5A 3H0GH 1KL9A 4DUYQ 1K0SA 2NVXH 4F87A 5IYBG 1NMFA 2A19A 4ZKBB 2N3SA 2EY1A 1VQIA 2VB3X 3ERQA 1CM9A 2J4XA 1H9SB 1XNRL 4B3RQ 2F0QA 2XNAC 4ME3A 3U50C 2R93B 3E3XA 4GLXA 3I4MH 3R2TA 3WOFA 5A2QE 1HQRD 1RHPA 5J1ZA 3M4QA 2QEXA 4DF7A 4PMCA 3E9HA 4IJHA 2R92G 1DOLA 4AQYL 2RHSB 4GLAC 4UP8A 4FO2A 1AP0A 1SYDA 4LFAQ 1PRTD 1U4RA 3P20A 3OMGA 3U9SA 1Z47A 3AMUA 2BH8A 5EKKA 2BCOA 1STEA 2RSOA 3CPFA 4FF2A 1Y1VG 4JC0A 2SNMA 2OTJA 1U9RA 2HUGA 1VQCA 5G3LD 4JI3L 3TSSA 2Z4HA 1KD1C 1A15A 4PZ6A 2ZXOA 3FPPA 3OW2A 2IX0A 1CSQA 2RF4A 4N9PA 3H0GB 1VQ6A 4NXNQ 4LWCA 1SE3A 3NPPA 5E4WC 4BBSG 2E2JB 1N32L 4A3BG 4R1JA 2NVXB 5M5YB 2B39A 2NTTA 4OWXB 1N36L 3KJPA 1J5EQ 2Z9HA 5IGBA 4A3GH 2OQ0A 3GTLH 1F9SA 2EXZA 3OYYA 2GA4B 1YEZA 3I4MB 4RFBA 3ITPA 4NXMQ 2ZXRA 1WTRA 5C3XA 4DAVA 4BA2I 4PV1C 1PMRA 4H44C 1QVCA 2ASBA 4LUZA 5JEAG 4XYQA 1K83H 2QW7A 3T1YL 3K7AH 1PZJD 4HN7A 5KNDA 3K5OA 4JI7L 2L4NA 2SEBD 1MSGA 3GQBA 2HHHQ 2RHQB 2DN8A 1PH2A 3KBGA 3K59A 2KUMA 4JW0A 2K5VA 3TS0A 1V9PA 1X55A 3KDFB 1HUNA 2SOBA 2O5JC 1EQRA 3TP6A 4O0AA 5I9OA 1KNAA 2CWPA 4A93H 2FXQA 3J80E 4A75A 1N34L 2B2VC 3TP7A 3UDXA 1YHBA 3G6JB 1JB7A 3OSOA 4QF4A 4RKBA 3RLNA 4DR6L 2VS1A 1EUJA 4ZQ3A 3HOXB 3ULJA 1VQDA 4A3GB 1KDBA 1SEBD 5JPMC 1EZ8A 4K0KQ 3C46A 1EY7A 4X64L 4DR2L 2I0QA 4HIMA 1CSPA 1TY0A 1X3GA 3EFXD 2UUAL 3M3YH 4M8AA 4PG3A 1FL0A 2JA7B 2NTSA 4A3KB 1VQOA 1TQOA 1GD7A 3M7GA 3CCSA 4DR1Q 2B3GA 2BDOA 3OHXC 2BE5C 5D14A 1YITA 3K7AB 1E22A 5I4DA 1CQFA 3BYTB 1I6HH 4Y52H 1VDZA 1U4PA 2KJXA 3PIPA 3HKZE 2JYOA 1E1OA 3H3VI 3PIO3 4GOPA 4A3CH 4JPBW 4UAIA 2AQ1B 1KLUD 1HHVA 2R6GA 5IE8A 3HOVH 4JI2L 5C4XB 2DUDA 1UE7A 4A93B 2VUMH 1Z7TA 2IX3A 1CA6A 5JJKA 1G91A 2J7ZA 1VQLA 2Q8TA 3HOYB 1N9WA 3HOZG 3OTOL 1G291 1TWAH 3VR5A 5T1GA 5E4XA 1LO5D 4IUPA 1IBMQ 2JA6G 1NY4A 2N49A 2WACA 3FKIH 1HNWL 2C5CA 1JOOA 1MGSA 3TDQA 2F0UA 3DWPA 1AFPA 4RGMA 1VS0A 4K5VA 3GV6A 3PO3H 3DEOA 2Q2UA 3CKIB 1RL2A 1UWVA 1EY6A 2Z0SA 5HGTA 3S14H 4APVA 2K05A 2RCFA 4A3JB 3H3VH 1NMGA 2MO1A 3MA2B 4ZYSA 3CD6A 1C4QA 1EYGA 3NP8A 1D5XC 1W6JA 3URYA 1Y1WB 1KXLA 1CHQD 2KQ3A 2AUJD 3E6ZX 3NSWA 4WORA 2PQEA 2PI2E 1A6XA 4TRDA 4EQOA 4P74A 5FLMG 2BDNA 3MXGA 4PZ8A 1GKHA 3AU7A 1JJGA 2OWOA 2P5ZX 3NHHA 2Z6BA 3CHBD 2FHTA 5BN4A 5D65A 1LABA 3IFTA 2VB2X 5C4HA 4YWLA 1ENCA 5FO8B 1JOQA 4TKOB 1HCZA 3GTGB 4HIOA 3FP9A 2NBFA 1I5FA 2IHEA 3PUXA 5JVH3 4BY1B 2PZWA 2GVBA 3Q23A 3PO3B 5J39A 3K5NA 3I3CA 1SJHD 1XNQQ 2CW0D 3NK9A 3JAMc 1HTPA 3PO2H 3S17B 5DNFA 1WFQA 4DV3L 1JE4A 4IN3A 4DPGA 4IUQA 4DUZL 1DGSA 1L1OA 2F0NA 3DWAA 4I65A 3VR4A 4KHPQ 2JA8H 3KF6B 4K14A 2OT2A 3T1YQ 1DONA 2J0TD 1PA6A 2ZJPA 1SMYC 1CFMA 4JI8L 1XX8A 1E3PA 2MFIA 2RA4A 1SROA 2UXCL 4DAYA 2XWJB 1XPUA 2Q8IB 4K8JA 1XMOL 1NUCA 2PNRC 5FJ8H 2ATWA 4KY6A 3VYUA 3H6MA 1Q86C 1SNDA 2N8NA 3DWQA 4EGVA 5DLQE 4L5SA 3IRBA 3C1FA 4X3KA 1VQEA 1H9SA 1R4PB 2OEOA 2DNEA 2QEJC 4YIJA 4IUNA 3T56B 1JMCA 5BR8Q 2E2DC 4DN4M 3RZOH 3R2IA 1SNOA 2JA9A 4IQZA 1I4GA 3S16H 1YNNC 2D9UA 5KYIA 4JVZA 1PDQA 1EY5A 4B3TL 1PFBA 1XJVA 3BU2A 4C3IB 2EQSA 3D6WA 5C0XJ 1CI3M 1V1OA 1DZ1A 1BKBA 1K0RA 3S9WA 1LTSD 1P16A 2Y0SG 4HCSA 2TMPA 2L0CA 2IL8A 4JI4Q 4LF6L 3CP0A 2F3VA 3U9OA 4OX9Q 1CT1D 1B7YB 1STNA 2RQXA 1LT3D 1Q3LA 3R3OA 4R4TA 1TT2A 1NR2A 5TSSA 1KDAA 3HOUH 1TS5A 4L6TB 4R4QA 4BBRB 2R61A 5FLXL 4J6HA 1R9TH 3TZDA 2X69A 2GN5A 1C9OA 1CK1A 2F03A 1UUPA 2DJGC 4RA8A 4YHHQ 3K57A 1B3AA 1HZBA 3GD7A 3DLLA 4OELB 3M4OB 1GO3E 1MHWC 4JI5L 1AE2A 4BY7G 4KK7A 3RZOB 5JJIA 2BH2A 4DUYL 1IW7D 1MI2A 3DXJC 2NVQH 4A3MH 3M7NA 2YU9B 3S1QH 1ESFA 2CFMA 3VYSA 3GTKH 1IYJB 4FXGC 3S2DH 3F1ZA 4LF5Q 4B3RL 1B50A 1QJOA 1EYAA 2NVTB 3L9AX 3BZKA 3A8JE 2CHBD 1TWGH 1KDCA 3SR1A 3UDGA 3QWNA 1X65A 1S5DD 1WCMB 4BWGB 4CKCA 5IGEA 1WTVA 1GUTA 1ZKOA 4X62Q 3BZDB 3KDFA 1ET9A 2LXKA 4Q0FA 5M9OA 3LX0A 4LFAL 1I4QA 5ELOA 5EPKA 4B3SQ 4F7XA 2AUKA 2IWHA 1GOZA 3HOVG 2TSSA 4OHJA 3VR2A 1SYCA 4HSVA 2YTYA 4R4OA 4K2KA 1N8RC 1R9TB 4Y7NH 1F2ZA 5I2XA 3STBD 1B53A 5ELDA 3DM1A 1S4ZA 4OO1G 1WD0A 3J80c 3K80C 1K8MA 1EFWA 1W3SA 3MHBA 4NXNL 3UE1A 3DM3A 4A3MB 2IY5B 3MXNB 3NWTA 1J5EL 3S1QB 3GTKB 3VA5A 3TP5A 1SYGA 3QOLA 1A8VA 4FP5D 5IIFA 3ULPA 1LTTD 1PRTB 2E76C 4G4KA 1GXDC 3OW7A 4LNQA 1G6ZA 4NXML 3GTPH 4L5RC 1CKNB 1EFID 1DYQA 5JEAJ 2MNAA 4X3UA 3I55A 2K01A 3BVGA 3MFYA 1M1KC 1KAWA 1D1KA 3MC0B 1PRTC 2HQEA 3H09A 4K6LA 1WTWA 2HHHL 5M3MG 5BN3A 4A3EH 1PH8A 1VMCA 3I2ZA 4FYDA 1E0BA 1T5XD 4EVOA 3G48A 1AEXA 1X3EA 3V05A 5C3EG 1IYVA 5IYDH 4A3FG 4GKJQ 3T1HQ 4P75A 1TWHB 2KHSA 4DV4Q 1KQSA 3I4OA 3ND8A 3QOJA 5GAGC 2ZM6Q 3C2PA 3A7AB 3L3OC 5M5XB 2WAQG 4DK0A 4RCNA 3PSIA 1Q90A 3OMCA 4NB3A 1JJCB 2NN6I 1VQMA 1UEBA 1HZCA 2RSNA 1EQTA 1RKNA 3MEHA 5LMNQ 4K0KL 1NR4A 4K5WA 3SXHA 3PQIA 4AH6A 2OCEA 2PMZB 3BZCA 2EVBA 1QG7A 4DNTB 1EWCA 4TSSA 1TWFH 2C35B 3BDCA 2CKZB 3GTPB 2UXBL 1CUKA 1M8AA 1C8CA 3CC4A 4DR1L 3AYHB 1SDFA 1UE1A 1DD2A 5HURA 4XT3B 2PO4A 3PF4A 3KFUA 2EZVA 4FXKC 1BF4A 4XQJA 1VQBA 4YCVA 2E2HH 3VDYA 1QNUA 3HKZG 5IT9L 3BDOA 2ZJRA 1NJIC 1PYWD 1V8QA 5H1SE 1LTRD 2YTXA 1NE3A 4HR7B 2PZTA 1JWSD 4LJZC 4LF6Q 4V190 3TBIB 2EJMA 2M00A 2BA1A 3ULLA 2YTVA
chains in the Genus database with same CATH topology
3PV0A 4P2CB 5JJZA 4C1NI 5C3WA 2XRQD 2NN6H 3HG9A 5KNBA 1GHKA 3T53B 5CYUA 1NSNS 3M4YA 2XRSD 4CHTB 2F0IA 3I70A 4H0LC 3IKJA 4ZAIA 1FNUA 3S1NB 1EZ6A 1TWFB 4TQUS 3R8BA 2XVSA 4C3JG 1Q8IA 1XWEA 5K36H 5K5PA 3I4NB 3HOZB 2ZT9C 2E2HB 1X3PA 2KCCA 5J22A 2JA6B 1OXVA 3A55A 2MGSA 1HPCA 3TN2A 3OIQA 1JOKA 2A6ED 2JEAI 2LY7A 1D1IA 4ABNA 3KK7A 2IPKD 2SDFA 3VA7A 2L5TA 4NKLA 3PUZA 2K32A 2CQAA 4KTAA 1GUWA 4KKUA 3D6CA 1FGBD 2F0DA 1K8OA 1PZID 1H9RA 5IOCA 5ELFA 4ILWA 5EPLA 3BVZA 2ZXPA 1ML0D 4Q5VA 3S1RB 3ZYYX 1WTPA 2M2LA 1VMPA 1I50B 3HS0C 4XQNA 1BCPD 1MSHA 5CV8A 5DEHA 3BDLA 4DFAA 1DM0B 2M9VA 3SK4A 1X3QA 2R3ZA 3E5SA 3GV3A 4KD4A 3BS1A 1U4MA 1H9KA 3HRZC 3EA6A 4KV6A 5KYLA 1ZYRD 2JA5B 3L7ZC 1OXTA 3A8IE 1PXUA 4C3HG 2SNSA 4NMZA 1PTOD 4RGNA 3M85A 5C4ZA 4NDXA 1EY0A 1AZQA 5ELBA 2CW0C 1EU3A 2X6LA 2R7ZB 4QCLA 4E6IA 1TU2B 2B2WC 3S1MB 3EQLC 2F0JA 4KN7C 1IHZA 1GUGA 3AB9A 1LLRD 3IFDA 4G7HC 1EQVA 2K03A 1DCZA 3S15B 1SJED 5M5WB 1G2TA 1S5FD 3Q0AA 4RWSC 4NP5A 1CTMA 1IL8A 1RTNA 1LTID 3MXNA 3EVQA 3V96A 5IODA 4QMGA 2FFKB 3QIAA 2B2UC 4IFDJ 2K5WA 3VR3A 2Y0SB 2BA0A 2K28A 5IGCA 2FMCA 1WTXA 1OXSC 2XSCA 4ZRZA 1QE6A 3I8ZA 2QF7A 4CKBA 1V1PB 3K6OA 2WKDA 2EE1A 3QB3A 3E0JA 2IJ0A 4QIWB 5NUCA 3J7AV 5CC4A 1ICWA 4KHVA 4DGZA 3DEPA 4B9XA 1AZPA 3KLSA 3A56A 3WDNA 1D5MC 1I4RA 2QDBA 3T16A 4X3SA 1Z6HA 1CA5A 2F3WA 5T1IA 1B9NA 1QCBD 4ZLTF 4ZKCB 4U68A 1FR3A 5ISRA 5M3FB 1I4PA 2KVMA 1HFNA 3NUCA 1TKWB 5IGDA 1O7YA 4QUCA 1IW7C 5AFWA 1DOMA 2JEBI 1V43A 5E1FA 4RGTA 1LV9A 5C0XI 4XT1B 1Y8OB 2EYPA 4N9TA 5C6AA 2B2TA 1PRTF 1A2UA 1KABA 3FEWX 1B44D 4QUFA 1EY4A 4XQQA 5JOBA 1CHPD 1SE4A 4S3SA 3D8GA 5G3LF 5I2YA 5JAVA 2DNCA 2OXPA 1EEID 4F8MA 4HEDA 3J81L 1ET6A 3MAQA 2RKSA 4LAAA 5C4JB 2F0HA 1RODA 5C0XH 2O4XA 3SHLA 1HUMA 1TWCB 1SNMA 2ICIA 1SNCA 1SYEA 4LMQD 5M3MB 2K5DA 3GTJB 1LT5D 5C3EB 1ESRA 4CJ1B 1RD9D 3PIP3 3NE5B 1A3VA 4LK1C 3NQTA 1WTQA 2F0PA 5FK9C 1I3QB 4MN3A 2XN9C 1YNJC 2N88A 2B63B 1Y8NB 5D3DA 1STGA 3D3RA 2F0OA 2EYHA 5CV4A 1I4XA 4IUTA 2A6HC 1BBXC 2ENBA 5DM63 3MXPA 3N6RA 1ENAA 4DXGA 3TP8A 1SNQA 4X3TA 4G7OC 1EIHA 4R8NA 4RHSA 5C44B 1J8IA 2X6GA 4RHRA 5C5LA 3KBXA 5IGGA 1BO0A 3HKZB 3CU7A 3OIPA 1DOKA 2V4DA 4G7ZC 3CQZB 1SXTA 5KRUA 1PFMA 2DY8A 5FLXE 5KGUA 4EQNA 3P75A 1A3TA 4ME5A 1H9JA 3OWEB 3NTIA 4HMJA 5ELCA 5CV5A 3TZUA 2JSOA 2K1BA 3QJYA 3RUZA 1A2TA 2WV6D 3OOCA 1O80A 2NVYB 2HCCA 3PUVA 1QWYA 2Q8RE 4C3JB 1UAPA 1UEAB 3IAYA 1LTBD 2EJFC 5EKLA 2B2YC 2B2WA 1E2WA 1LT4D 2EYOA 5FO7B 4FNFA 1O78A 3NBHA 1D5ZC 4NW2A 2R92B 2JXMB 1L0XB 2A5HA 4KY7A 1AN8A 1HRJA 5JEAH 1BDOA 1GJXA 2Z4IA 4I7ZC 4K6DA 1I4HA 1JWUD 1TS4A 4XDXA 4PQXA 4IALA 3HP3A 4ZK9B 1Y1VB 2B2UA 2A68D 3BG3A 1STBA 4O1NA 4HTHA 1JC7A 1XYIA 1TIID 1SYBA 4OIKA 4BBSB 1A3UA 2PZUA 4A3BB 3VYTA 1YNJD 2A6EC 3K0YA 3MVVA 5FOBB 2B8GA 3RLFA 2A6HD 1SNPA 1PTOH 2EDGA 4V0BA 1V1PA 2LMCB 2KEDA 1OXUA 1U4LA 5DAUA 4OIJA 3P1HA 3T13A 1SSOA 1KNEA 4ODGA 4HSPA 4PMWA 1BCPB 1S5ED 4L8JA 1Q12A 3JAML 1JCKB 1FD7D 5DM73 3N52A 1TS2A 1HQMC 2O2LD 4MIUA 2F1MA 3SDZA 4C3HB 1BCPC 2E75C 5EJWA 1GUNA 1RTOA 3SEBA 3SK8A 2EY6A 4KKTA 2D2CC 3LWEA 3KLRA 1TS3A 1PTOB 2QCPX 1TY2A 2FJ2A 5C0XG 1WTOA 3DMUA 1LT6D 5IT9E 2LFNA 1LTGD 3GTOB 2EY2A 2L11A 1ZYRC 2B2TC 3D4DA 2H4OA 2F0VA 2HCIA 5LL6S 4DXFA 1PTOC 1FNWA 2PCFB 1STAA 1RJTA 1B2TA 1M4VA 2K33A 2IX1A 4FVMA 2Z8LA 2WKCA 2A69D 2PYKA 2EPBA 1S5CD 3MXUA 3S2HB 1SFOB 1EEFD 2YYZA 1LTAD 4IUVA 3NWSA 1FNVA 3F2UA 1D2BA 4AYBB 4DA2A 1SAPA 2H1EA 2XIWA 5EPJA 3QO2A 3KUPA 1GHJA 4FF1A 3HOWB 2WINB 2EYFA 1EYDA 2E74C 2RDGA 3OPOA 4KHZA 3H94A 3J7AF 4RGOS 1C48A 1BQQT 1GUSA 3D4WA 5E3FA 2F0GA 2A74C 3W2DA 3BVMA 2L12A 1II3A 2QKIC 1X32A 3NTHA 3C1EA 3OWFA 4WFN3 3SE0A 1STYA 1IKLA 5I6WA 4R9WA 2EYMA 3VYRA 2K04A 2EYJA 4IFDI 1AW7A 4HMIA 3CRLC 3C3LA 3X3NA 4CJ2C 1R4QB 4IUUA 4PNYA 3NBIA 2LKVA 4IZ8A 3HGBA 2RDFA 3J80L 2RVLA 2KEEA 1EYCA 1ONLA 1QOHA 4CBVA 1JWMD 4WRDA 1JORA 1BR9A 4XIGS 5CV7A 5D3IB 2EY5A 4KI0A 1NCVA 4WJWA 1FYCA 2B2YA 5CR3A 3RZDB 1B9MA 1QB5D 5EKIA 4CGYB 4M1UB 2AWOA 3GP7A 5CORA 1EY9A 4FF3A 2K6AA 4XTCS 5CGKA 1Y8PB 1IYUA 1KLGD 1ZXTA 4IFDH 1SYFA 3P7JA 3GTLB 4KMUC 2MHVA 4OO1I 2CVRA 5F2DA 3T51B 4PMBA 1K83B 1ILPA 3D31A 5ELEA 3A8KE 3UI2A 3K5LA 2Z1CA 4K8IA 2C9OA 2LS01 5COYA 4RH6A 3CRKC 4C2MB 1J9OA 3Q6SA 2F0TA 1F2LA 1O7ZA 1F9QA 1BUVT 3HZXA 1E2VA 1W6KA 1MBYA 3RD4A 4OO1H 1PLFA 1BOSA 4BY7B 2F0MA 3M3YB 4OGQC 3BYYB 3MTSA 2KECA 3SK6A 5IGFA 1Q1EA 2EOTA 3LNNA 2NN6G 2FINB 3I4LA 2PW7A 5EBCA 2AQ3B 2HDMA 3K5MA 1KAAA 1PZKD 1I6HB 1WD1A 1VCIA 2F0FA 1F2MA 4K5XA 1EOTA 2K7VA 3Q24A 3DHQA 3HOVB 4KY5A 2VUMB 1T5EA 5K36G 2ICEC 1EY8A 1SBBB 4KD3A 3KLSX 4J8QA 3A54A 1TWAB 5CV9A 2L9HA 2MP1A 3FKIB 2EJGC 3SK5A 4ID6A 5A35A 2F0KA 2KCNA 4KJNA 1B4OA 4R8IA 4GZYC 3FMCA 2XWBB 1G2SA 4KJOA 1HA6A 2VXWA 2F4IA 4J1MA 3O13A 1S5BD 4G57A 3GTMB 5JPNC 1DXMA 4IURA 3S14B 3FDTA 3MFGA 4C1NK 2I07B 3Q22A 2BE5D 2KA7A 3PUWA 1TR5A 1CQVA 1HA5A 3GTQB 3I90A 3EROA 2G9DA 1Q1BA 4CJ0B 1KTKA 3KF8A 3NTKA 4ZUJA 3J81E 2F0WA 1GUOA 3WOEA 2MPMA 5CBAE 5JVG3 3H3VC 3PUYA 1LACA 4F88A 1F9RA 4DAPA 2A68C 1BCPF 4A3FB 5C5MA 1RF2D 3MZ5A 1EIGA 3MWYW 3J7YW 2D5DA 2O5IC 2WAQB 2NZ1D 1MD2D 4Z9CB 3PO2B 5KIXA 1JB3A 2L1BA 4O42A 3R93A 1PTOF 1JICA 3ONAB 1E2ZA 2JA8B 2PPBC 3NXWA 3NQIA 4B08A 4H7BA 4CKEA 5EGTA 3ND9A 5CBEE 2NUCA 4QB4A 1VF5C 2VNUD 2AQ2B 2I46A 4ULLA 4K2LA 4IFDG 3FPUB 1EL0A 3I73A 2L55A 4HAEA 3S16B 4C56C 1WVLA 2JE6I 2IT1A 1BNZA 2MJ8A 5BN5A 4DK1A 2D62A 1TVXA 3D4RA 2B2VA 2N55A 1XXGA 1STHA 4ZUIA 2FMMA 4KN4C 1JQYD 4OL7A 2KOLA 1F9PA 1O7LA 3X3MA 1NAPA 1L0YB 1ENFA 5CV6A 1EU4A 5I6YA 4JK1C 1SE2A 2F0SA 3HOUB 1IKMA 1SMYD 4XXEA 3H91A 1F77A 3G7LA 1I6VC 4KKSA 1ILQA 1G8ZD 3RMHA 2K5QA 2G9HD 1UNSA 3I91A 4FF4A 2A69C 2A73B 3HEJA 4HCEA 2JP1A 1QNKA 2F0EA 4JBWA 5EQ0A 1BXTA 2WIIB 5EBDA 1EWHA 4A3DB 2NWGA 2NVQB 4MHEA 3SVMA 3S2DB 2MUYA 3W3AA 2E2IB 1YNND 1PFNA 5LL6X 1TWGB 4U673 1HXYD 4XYOA 4FXDA 1JR0D 2NYZD 1QILA 2OF1A 4A3IB 4DU9A 3DUZA 4B9WA 2HDLA 2F0LA 4H13C 1B1ZA 4DNRB 5FO9B 1DJRD 3QG1A 4Y7NB 3GO5A 1F2YA 5FKAC 3EJIA 4C3IG 4RKLA 4L63B 2NB0A 1CZGA 1ZEQX 2DY7A 2PW5A 2QILA 1HFGA 2BOSA 2WP8J 3LWUA 3VR6A 2IW3A 4RAUC 4UDUC 3IL8A 1HTLD 3V2TA 3JAME 3FVQA 2AWNA 2RBMA 1CZWA 1VF7A 3K58A 1H9MA 3TMEA 1RCVD 1RDPD 4A3EB 2RDHA 2EYLA 5I9PA 4EQPA 2B8FA 5KEEA 5KNCA 5CMDA 2WB1B 4BS9A 1OXXK 2ID0A 4RCOA 3FRPB 1XTCD 4BA1I 5LHY1 3I72A 1D6EC 3T4AC 1OO9B 5A2QL 3PMFA 1Y69U 3A7LA 4F87A 4ZKBB 2EY1A 2VB3X 3ERQA 1CM9A 2J4XA 1H9SB 2F0QA 2XNAC 2R93B 3R2TA 3WOFA 5A2QE 1HQRD 1RHPA 5J1ZA 4DF7A 4PMCA 1DOLA 4FO2A 1AP0A 1SYDA 1PRTD 1U4RA 3P20A 3OMGA 3U9SA 1Z47A 3AMUA 5EKKA 2BCOA 1STEA 2RSOA 4FF2A 2SNMA 1U9RA 2HUGA 5G3LD 3TSSA 2Z4HA 1A15A 2ZXOA 3FPPA 2IX0A 4N9PA 3H0GB 1SE3A 3NPPA 5E4WC 2E2JB 2NVXB 5M5YB 2B39A 2NTTA 5IGBA 1F9SA 2EXZA 2GA4B 3I4MB 4RFBA 3ITPA 2ZXRA 1WTRA 5C3XA 4DAVA 4BA2I 4PV1C 1PMRA 4H44C 5JEAG 4XYQA 1PZJD 4HN7A 5KNDA 3K5OA 2L4NA 2SEBD 1MSGA 3GQBA 2DN8A 3KBGA 3K59A 2KUMA 1HUNA 2SOBA 2O5JC 3TP6A 5I9OA 1KNAA 3J80E 2B2VC 3TP7A 3G6JB 3OSOA 4QF4A 4RKBA 4ZQ3A 3HOXB 4A3GB 1KDBA 1SEBD 5JPMC 1EZ8A 3C46A 1EY7A 1TY0A 3EFXD 4M8AA 2JA7B 2NTSA 4A3KB 1TQOA 3M7GA 2BDOA 3OHXC 2BE5C 5D14A 3K7AB 5I4DA 1CQFA 3BYTB 1VDZA 1U4PA 2KJXA 2JYOA 3PIO3 4UAIA 2AQ1B 1KLUD 1HHVA 2R6GA 5C4XB 4A93B 1Z7TA 2IX3A 1CA6A 1G91A 2J7ZA 2Q8TA 3HOYB 1G291 3VR5A 5T1GA 5E4XA 1LO5D 4IUPA 2WACA 2C5CA 1JOOA 1MGSA 3TDQA 2F0UA 3DWPA 1AFPA 4RGMA 4K5VA 3GV6A 3DEOA 3CKIB 1EY6A 5HGTA 2K05A 4A3JB 3MA2B 4ZYSA 1C4QA 3NP8A 1D5XC 1W6JA 3URYA 1Y1WB 1CHQD 2KQ3A 2AUJD 3E6ZX 3NSWA 4WORA 2PQEA 1A6XA 4TRDA 4EQOA 2BDNA 3MXGA 3AU7A 3NHHA 3CHBD 2FHTA 5BN4A 5D65A 1LABA 3IFTA 2VB2X 5C4HA 1ENCA 5FO8B 1JOQA 4TKOB 1HCZA 3GTGB 2NBFA 3PUXA 5JVH3 4BY1B 2PZWA 3Q23A 3PO3B 5J39A 3K5NA 3I3CA 1SJHD 2CW0D 3NK9A 1HTPA 3S17B 5DNFA 1JE4A 4IN3A 4IUQA 2F0NA 3DWAA 4I65A 3VR4A 4K14A 2OT2A 1DONA 2J0TD 1SMYC 1CFMA 1XX8A 2RA4A 4DAYA 2XWJB 2Q8IB 4K8JA 1NUCA 2PNRC 4KY6A 3VYUA 3H6MA 1SNDA 3DWQA 4EGVA 3C1FA 4X3KA 1H9SA 1R4PB 2OEOA 2DNEA 2QEJC 4YIJA 4IUNA 3T56B 2E2DC 4DN4M 3R2IA 1SNOA 4IQZA 1I4GA 1YNNC 2D9UA 5KYIA 1PDQA 1EY5A 1PFBA 4C3IB 3D6WA 5C0XJ 1CI3M 1V1OA 1DZ1A 3S9WA 1LTSD 4HCSA 2TMPA 2L0CA 2IL8A 2F3VA 3U9OA 1CT1D 1STNA 2RQXA 1LT3D 1Q3LA 3R3OA 1TT2A 5TSSA 1NR2A 1KDAA 1TS5A 4L6TB 4BBRB 2R61A 5FLXL 4J6HA 3TZDA 2X69A 1CK1A 2F03A 1UUPA 4RA8A 3K57A 1B3AA 3GD7A 3M4OB 4KK7A 3RZOB 1IW7D 1MI2A 3DXJC 3M7NA 2YU9B 1ESFA 3VYSA 4FXGC 1B50A 1QJOA 1EYAA 2NVTB 3L9AX 3A8JE 2CHBD 1KDCA 3SR1A 3QWNA 1WCMB 1S5DD 4BWGB 4CKCA 5IGEA 1WTVA 1GUTA 1ZKOA 3BZDB 1ET9A 4Q0FA 5M9OA 3LX0A 1I4QA 5EPKA 4F7XA 2AUKA 2IWHA 1GOZA 2TSSA 4OHJA 3VR2A 1SYCA 4HSVA 4K2KA 1R9TB 1F2ZA 5I2XA 1B53A 5ELDA 3DM1A 1S4ZA 4OO1G 1WD0A 1K8MA 3MHBA 4A3MB 3S1QB 3NWTA 3GTKB 3VA5A 3TP5A 1SYGA 3QOLA 4FP5D 5IIFA 1LTTD 1PRTB 2E76C 4G4KA 1GXDC 3OW7A 1G6ZA 1EFID 1DYQA 5JEAJ 4X3UA 2K01A 3BVGA 3MFYA 1D1KA 3MC0B 1PRTC 2HQEA 3H09A 4K6LA 1WTWA 5BN3A 1VMCA 4FYDA 1E0BA 1T5XD 4EVOA 1AEXA 3V05A 1IYVA 1TWHB 2KHSA 3ND8A 3QOJA 3C2PA 3A7AB 3L3OC 5M5XB 4DK0A 4RCNA 1Q90A 3OMCA 2NN6I 2RSNA 1EQTA 1RKNA 3MEHA 1NR4A 4K5WA 3SXHA 2PMZB 2EVBA 1QG7A 4DNTB 1EWCA 4TSSA 3BDCA 3GTPB 1M8AA 1C8CA 1SDFA 1DD2A 5HURA 4XT3B 2PO4A 2EZVA 4FXKC 1BF4A 4XQJA 1QNUA 5IT9L 3BDOA 1PYWD 1V8QA 1LTRD 4HR7B 2PZTA 1JWSD 4LJZC 4V190 3TBIB 2EJMA 2M00A 2BA1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P2C B;  1D1K A;  1R4P B;  1CZW A;  1QOH A;  1D1I A;  2BOS A;  1QNU A;  4ULL A;  3MXG A;  1CQF A;  2GA4 B;  1DM0 B;  1BOS A;  2XSC A;  4M1U B;  2C5C A;  1C48 A;  1C4Q A;  1R4Q B;  1CZG A; 
#chains in the Genus database with same CATH topology
 1KRT A;  3PV0 A;  4P2C B;  4DR7 Q;  1VQP A;  5JJZ A;  4C1N I;  5C3W A;  2XRQ D;  2NN6 H;  3HG9 A;  5KNB A;  1GHK A;  3D0F A;  3G4S A;  3T53 B;  1IBM L;  5CYU A;  1NSN S;  3M4Y A;  4L5Q A;  2XRS D;  4CHT B;  2F0I A;  3I70 A;  4H0L C;  1BVS A;  1KIX A;  3IKJ A;  4ZAI A;  1FNU A;  3S1N B;  2E2J H;  1EZ6 A;  1TWF B;  5M5Y H;  4TQU S;  3R8B A;  2XVS A;  4C3J G;  1Q8I A;  4RMF A;  3KF6 A;  1SR3 A;  1XWE A;  1EQQ A;  2MQH A;  5K36 H;  5K5P A;  4HJ8 A;  3I4N B;  3HOZ B;  2ZT9 C;  2E2H B;  1X3P A;  2KCC A;  1FJG Q;  2GVA A;  5J22 A;  2JA6 B;  1OXV A;  3UDI A;  1T9H A;  3A55 A;  2MGS A;  1HPC A;  3TN2 A;  3OIQ A;  1JOK A;  2AMC B;  4I7A A;  2A6E D;  2JEA I;  2LY7 A;  1D1I A;  4ABN A;  1QUQ B;  3KK7 A;  1UE5 A;  4GN4 B;  3J81 j;  4OEM B;  2IPK D;  2SDF A;  3VA7 A;  3CCL A;  4QL5 A;  2L5T A;  4NKL A;  4DK3 C;  3PUZ A;  2K32 A;  4GLV B;  1PYB A;  2CQA A;  4A3D G;  2ZTE A;  1LM0 A;  4KTA A;  1GUW A;  4KKU A;  3D6C A;  2A8V A;  1K73 C;  1FGB D;  2JA5 H;  2F0D A;  1K8O A;  1PZI D;  2Z6K C;  1H9R A;  1HR0 W;  3HOX H;  4GNX B;  5IOC A;  1XNQ L;  5ELF A;  3BJU A;  4ILW A;  5EPL A;  1HNX Q;  2N78 A;  4A3I G;  3BVZ A;  2ZXP A;  4DAM A;  3ICE A;  1ML0 D;  4Q5V A;  1ASY A;  2R7Z H;  2JA7 H;  3S1R B;  1JE5 A;  3F2B A;  3ZYY X;  4A3K H;  3AEV A;  4BXX G;  2AHO B;  1WTP A;  2M2L A;  1VMP A;  4KHP L;  3S1M H;  4GNX C;  1I50 B;  1M90 C;  3HS0 C;  4XQN A;  3UDF A;  1K3R A;  1BCP D;  5IP7 G;  1MSH A;  4DR5 Q;  3GDE A;  5CV8 A;  5DEH A;  3BDL A;  4DFA A;  4LFB Q;  1DM0 B;  2M9V A;  4DV0 Q;  2MO0 A;  3SK4 A;  4DR4 Q;  4LUO A;  1X3Q A;  2R3Z A;  3E5S A;  3GV3 A;  3EBE A;  4KD4 A;  3BS1 A;  1U4M A;  1H9K A;  5C4X H;  1YZ6 A;  3HRZ C;  1IL2 A;  4ZCK A;  3J7Z C;  3EA6 A;  4KV6 A;  5KYL A;  3HOY H;  2AKW B;  1ZYR D;  2XGT A;  4UY8 C;  5BR8 L;  2JA5 B;  3L7Z C;  1OXT A;  3A8I E;  1PXU A;  4C3H G;  2SNS A;  4NMZ A;  1PTO D;  4RGN A;  3M85 A;  5C4Z A;  2A1A A;  4A76 A;  4LF9 Q;  2WAQ E;  4NDX A;  4PZ7 A;  1EY0 A;  3NBH B;  1AZQ A;  3RNU A;  5ELB A;  2CW0 C;  1EU3 A;  2X6L A;  2R7Z B;  2UXB Q;  4QCL A;  4E6I A;  1TU2 B;  4JBJ A;  2B2W C;  3S1M B;  3EQL C;  2F0J A;  4KN7 C;  1IHZ A;  1GUG A;  2NZO A;  1LLR D;  3AB9 A;  3IFD A;  4G7H C;  1EQV A;  2CH4 W;  2K03 A;  4JI4 L;  4OX9 L;  4A3J H;  1DCZ A;  3S15 B;  1SJE D;  5M5W B;  3U58 A;  1G2T A;  1S5F D;  3Q0A A;  5IP9 G;  4RWS C;  4NP5 A;  1CTM A;  1IL8 A;  1RTN A;  2PI2 A;  2WB1 G;  1LTI D;  2OQK A;  1Y1W H;  3MXN A;  4ALP A;  3EVQ A;  3V96 A;  5IOD A;  4YHH L;  4QMG A;  1MJC A;  2FFK B;  3QIA A;  2B2U C;  4IFD J;  5M3F H;  3L0O A;  1X9N A;  4N8X 1;  2K5W A;  3VR3 A;  2Y0S B;  2BA0 A;  2K28 A;  5IGC A;  2FMC A;  4AYB G;  1WTX A;  1CKN A;  1OXS C;  2XSC A;  3CCR A;  4ZRZ A;  1QE6 A;  3I8Z A;  2QF7 A;  4CKB A;  3G71 A;  1V1P B;  3K6O A;  3GTG H;  2WKD A;  4LF5 L;  2EE1 A;  3QB3 A;  3E0J A;  3HOW G;  2IJ0 A;  4QIW B;  2R93 G;  5AJ3 Q;  4BY1 H;  5NUC A;  4A3L H;  4YCU A;  3J7A V;  1GVP A;  5CC4 A;  1YIJ A;  1ICW A;  3S17 H;  4KHV A;  4DGZ A;  4X62 L;  3DEP A;  4B9X A;  1AZP A;  3KLS A;  3A56 A;  3WDN A;  1D5M C;  3K0X A;  1KHI A;  4GN3 B;  1HH2 P;  2V1C C;  3CPW A;  1C7Y A;  1VQ5 A;  3KJO A;  4B3S L;  1I4R A;  2QDB A;  3T16 A;  4X3S A;  1Z6H A;  1CA5 A;  2F3W A;  5T1I A;  4DK6 C;  4EQ5 A;  1B9N A;  2KHI A;  1QCB D;  4IPD A;  4MNO A;  3CC7 A;  4ZLT F;  4ZKC B;  4DV1 Q;  4U68 A;  1FR3 A;  5ISR A;  5M3F B;  1I4P A;  2KVM A;  2IHF A;  1HFN A;  3H0G G;  3NUC A;  1TKW B;  5IGD A;  1O7Y A;  4QUC A;  1IW7 C;  5AFW A;  4IOA A;  1TWC H;  1DOM A;  2JEB I;  1V43 A;  5E1F A;  4RGT A;  1LV9 A;  5C0X I;  4DV5 Q;  4XT1 B;  1Y8O B;  2EYP A;  4N9T A;  1A63 A;  3I4M G;  4DV2 Q;  5C6A A;  3SGI A;  3EN2 A;  2B2T A;  1PRT F;  1A2U A;  1HNZ Q;  2LSS A;  1SRU A;  1KAB A;  3FEW X;  1B44 D;  4C3I H;  2K5N A;  4QUF A;  1EY4 A;  4XQQ A;  2UU9 Q;  5JOB A;  1CHP D;  1SE4 A;  4S3S A;  3D8G A;  4RG1 A;  5G3L F;  5IYC H;  5I2Y A;  1YNX A;  1BBW A;  4HJA A;  5JAV A;  2B63 H;  2DNC A;  2OXP A;  1EEI D;  4F8M A;  4HED A;  3J81 L;  1YI2 A;  1ET6 A;  3STB C;  3MAQ A;  1K9M C;  4GKJ L;  3T1H L;  2RKS A;  4CDD C;  4BBR H;  4DV4 L;  5IT9 c;  2ZM6 L;  4LAA A;  4QJF A;  1XPO A;  5C4J B;  4JI1 L;  2F0H A;  1ROD A;  4YCW A;  5C44 H;  5C0X H;  2O4X A;  3SHL A;  1HUM A;  1TWC B;  1SNM A;  2ICI A;  4A3G G;  3M4O H;  1SNC A;  5LMN L;  1SYE A;  2JJQ A;  4JG2 A;  4LMQ D;  1WJJ A;  5M3M B;  1S3O A;  4DKA C;  2K5D A;  1FVI A;  3CQZ H;  4DV7 Q;  4JI0 Q;  2D0O A;  3GTJ B;  1LUZ A;  4HJ5 A;  2YU9 H;  1LT5 D;  1B3Q A;  4WJ4 A;  5C3E B;  1ESR A;  4CJ1 B;  1RD9 D;  3PIP 3;  3NE5 B;  1A3V A;  4LK1 C;  2NVT H;  2K50 A;  2CWA A;  3NQT A;  1WTQ A;  2F0P A;  3MEF A;  2I5L X;  2UUB Q;  1QUQ A;  1WCM H;  2ZTC A;  1MJE A;  1GM5 A;  2K52 A;  5FK9 C;  2Z6K A;  1I3Q B;  4MN3 A;  4FDB A;  2XN9 C;  1YNJ C;  2N88 A;  5JJL A;  1AE3 A;  2B63 B;  1Y8N B;  3KYH C;  2KBN A;  5D3D A;  1STG A;  3D3R A;  2F0O A;  2EYH A;  4MZ9 A;  5CV4 A;  1I4X A;  5IYB H;  4IUT A;  2A6H C;  4A93 G;  1BBX C;  3CMA A;  2ENB A;  4DR7 L;  5DM6 3;  3MXP A;  3N6R A;  1ENA A;  3TP8 A;  4DXG A;  1SNQ A;  4X3T A;  4G7O C;  1EIH A;  4R8N A;  4GNX A;  4RHS A;  5C44 B;  1HJP A;  2WB1 E;  1J8I A;  5GRO A;  2X6G A;  4RHR A;  5C5L A;  3KBX A;  5IGG A;  1BO0 A;  3HKZ B;  4DV6 Q;  4A4I A;  2R92 H;  3CU7 A;  3K7U C;  1DOK A;  2V4D A;  3OIP A;  4G7Z C;  1YJW A;  4B3M Q;  3CQZ B;  1SXT A;  3A74 A;  5KRU A;  1PFM A;  4JBK A;  2DY8 A;  5FLX E;  5KGU A;  4EQN A;  3P75 A;  4AYB E;  1A3T A;  4ME5 A;  1BBU A;  1H9J A;  1YJN A;  2F3I A;  3OWE B;  1Y1V H;  4N8F A;  4OWT B;  3NTI A;  4QQB X;  4HMJ A;  5ELC A;  5CV5 A;  3TZU A;  2JSO A;  1FJG L;  4DR3 Q;  2K1B A;  3QJY A;  3RUZ A;  1A2T A;  2WV6 D;  1S72 A;  3OOC A;  1O80 A;  2NVY B;  4A3C G;  2HCC A;  1Y1W G;  2F4V Q;  3PUV A;  1QWY A;  4X65 Q;  4A3B H;  4AIM A;  2Q8R E;  4C3J B;  1UAP A;  2VUM G;  1UEA B;  3IAY A;  1LTB D;  5GAH C;  2EJF C;  1CKO A;  2B2Y C;  2B2W A;  5EKL A;  3U4V A;  4UHV A;  4MTN A;  1E2W A;  1LT4 D;  1D8L A;  2EYO A;  5FO7 B;  4FNF A;  1O78 A;  1OTC A;  3FKI G;  3NBH A;  1D5Z C;  4NW2 A;  1TWH H;  1YHA A;  2R92 B;  2JXM B;  1L0X B;  2A5H A;  4KY7 A;  1AN8 A;  1EIY B;  1HRJ A;  5GAD C;  2F52 A;  5JEA H;  4L5T A;  5M5X H;  3KLW A;  1BDO A;  1GJX A;  2Z4I A;  4I7Z C;  4GKK Q;  4K6D A;  1I4H A;  3PO3 G;  1JWU D;  1TS4 A;  4XDX A;  4PQX A;  4IAL A;  1HNX L;  4X66 Q;  2QGQ A;  3HP3 A;  4ZK9 B;  1Y1V B;  2B2U A;  2A68 D;  3BG3 A;  1XMQ Q;  1STB A;  4O1N A;  4HTH A;  1JC7 A;  1XYI A;  1TII D;  2G5D A;  1SYB A;  3G6E A;  2PQA B;  2VQE Q;  4IJL A;  2I5M X;  4OIK A;  4BBS B;  1A3U A;  4LW1 A;  4DR5 L;  2PZU A;  4A3B B;  4P71 A;  3VYT A;  1YNJ D;  2A6E C;  3K0Y A;  4LFB L;  3MVV A;  5FOB B;  2B8G A;  4DV0 L;  3UE0 A;  4DR4 L;  2VL6 A;  3RLF A;  2A6H D;  1SNP A;  1PTO H;  2EDG A;  4V0B A;  1V1P A;  2LMC B;  4CDE C;  1N33 Q;  2KED A;  1OXU A;  2EIF A;  1G51 A;  1U4L A;  3CCV A;  4JI1 Q;  4J15 A;  5DAU A;  4OIJ A;  2DGY A;  1E7Z A;  3P1H A;  3T13 A;  1SSO A;  1KNE A;  4LF9 L;  2K4K A;  1O7I A;  4ODG A;  4HSP A;  3W1B A;  2NZH A;  4PMW A;  3PO2 G;  3S1N H;  1BCP B;  1S5E D;  4L8J A;  1UE6 A;  1Q12 A;  3JAM L;  1JCK B;  1FD7 D;  4R4I A;  3S2H H;  1PFS A;  1I94 Q;  2CQO A;  3I4N H;  1QZG A;  2JA8 G;  5DM7 3;  3N52 A;  1TS2 A;  1HQM C;  2O2L D;  3HOZ H;  4MIU A;  2F1M A;  3SDZ A;  4C3H B;  1BCP C;  5ELN A;  2E75 C;  5EJW A;  2JA6 H;  1GUN A;  1RTO A;  3SEB A;  4LF7 Q;  3A5Z B;  3SK8 A;  1V1Q A;  2EY6 A;  4KKT A;  5FJ8 G;  1XTD A;  2UUC Q;  2D2C C;  2E8G A;  3TEH B;  3LWE A;  3KLR A;  1TS3 A;  1PTO B;  2QCP X;  1TY2 A;  1MKH A;  2FJ2 A;  5C0X G;  1WTO A;  1Q8K A;  4JYA Q;  3DMU A;  1J6Q A;  1LT6 D;  3AFQ A;  4YWK A;  2LFN A;  5IT9 E;  2Q2H A;  1LTG D;  1U5K A;  4R4C A;  3GTO B;  2EY2 A;  2L11 A;  3AFP A;  1ZYR C;  2B2T C;  3D4D A;  2H4O A;  2F0V A;  2HCI A;  3TRE A;  3CCM A;  5LL6 S;  5IWA Q;  4DXF A;  1PTO C;  1B70 B;  1K8A C;  3RN2 A;  1FNW A;  1PVO A;  1NTG A;  2PCF B;  1STA A;  1RJT A;  1B2T A;  1M4V A;  3AQQ A;  4JI6 Q;  4YWM A;  2K33 A;  2IX1 A;  1G6P A;  4FVM A;  4NPS A;  2K14 A;  5AJ3 L;  2Z8L A;  2WKC A;  2A69 D;  2PYK A;  2EPB A;  1S5C D;  3MXU A;  1IBL Q;  3ZJY C;  3S2H B;  1SFO B;  5FLM H;  4JBM A;  2UXD Q;  3KF8 B;  1EEF D;  1PH9 A;  2YYZ A;  1WTH A;  1LTA D;  4IUV A;  1VQN A;  4WJ3 M;  3PIO A;  3S1R H;  3NWS A;  1FNV A;  3F2U A;  2VQF Q;  1D2B A;  4AYB B;  4DA2 A;  1SAP A;  2LXJ A;  3HFZ B;  1WYD A;  4LUV A;  2H1E A;  1I50 H;  2E5L Q;  1NBW A;  3HOU G;  4OXP A;  2XIW A;  3A0J A;  5EPJ A;  3QO2 A;  4JOI A;  3KUP A;  1GHJ A;  4FF1 A;  3HOW B;  4POF A;  2WIN B;  1PH3 A;  2EYF A;  1EYD A;  4DV1 L;  2E74 C;  4JV5 Q;  1LTL A;  2RDG A;  3OPO A;  4KHZ A;  1X3F A;  1ICF B;  2ALY B;  3H94 A;  3J7A F;  4RGO S;  1C48 A;  1BQQ T;  1GUS A;  4A3M G;  3D4W A;  3KOJ A;  2K75 A;  3RN5 A;  5GAE C;  3J81 c;  1MIU A;  4DV5 L;  4HJ7 A;  3F2D A;  5E3F A;  1IXR A;  3K81 C;  1EOV A;  2F0G A;  2VW9 A;  5E7N A;  4DV2 L;  3RZD H;  1Q81 C;  1HNZ L;  2A74 C;  2B29 A;  3W2D A;  1PH5 A;  3J81 i;  3BVM A;  3ERS X;  1HR0 Q;  2L12 A;  1II3 A;  2UU9 L;  2QKI C;  1U0L A;  1X32 A;  3NTH A;  4IO9 A;  3C1E A;  3OWF A;  4WFN 3;  3CCQ A;  3SE0 A;  5LMU Q;  1PH7 A;  3NEL A;  1STY A;  3ER0 A;  1IKL A;  5I6W A;  4R9W A;  2EYM A;  3VYR A;  3I7F A;  2K04 A;  2EYJ A;  4IFD I;  3L2P A;  1AW7 A;  3S15 H;  1YVC A;  5M5W H;  2HT1 A;  4HMI A;  1QVF A;  1YJ9 A;  1SLJ A;  3CRL C;  3C3L A;  3X3N A;  4CJ2 C;  1R4Q B;  4IUU A;  4PNY A;  3NBI A;  3HKS A;  1E24 A;  2KEN A;  2LKV A;  4IZ8 A;  3HGB A;  2RDF A;  3J80 L;  2RVL A;  1VQJ A;  2KEE A;  1EYC A;  1ONL A;  1QOH A;  1JWM D;  4CBV A;  2QDL A;  4WRD A;  1JOR A;  1BR9 A;  4XIG S;  5CV7 A;  5D3I B;  2EY5 A;  4KI0 A;  4DV7 L;  1NCV A;  4JI0 L;  4WJW A;  1FYC A;  2B2Y A;  5CR3 A;  3RZD B;  1B9M A;  5FLX c;  1QB5 D;  5EKI A;  4CGY B;  4M1U B;  4C2M H;  2AWO A;  3LGJ A;  3GP7 A;  5COR A;  2KCT A;  4LFC Q;  1EY9 A;  4YY3 Q;  4HID A;  4FF3 A;  4IPH A;  2K6A A;  4XTC S;  5CGK A;  2UUB L;  1Y8P B;  1VQH A;  1IYU A;  1KLG D;  1ZXT A;  3CAM A;  3E0E A;  4IFD H;  1SYF A;  3P7J A;  4A3E G;  1CKM A;  1SMX A;  4CDF C;  3GTL B;  4BY7 H;  5L37 A;  4KMU C;  1A0I A;  1IBK Q;  2MHV A;  4OO1 I;  2CVR A;  2XTI A;  2KHJ A;  5IYD G;  5F2D A;  2HIV A;  3T51 B;  2QA4 A;  4PMB A;  1K83 B;  1VQ9 A;  1Q82 C;  1ILP A;  3D31 A;  5ELE A;  2R7F A;  4DV6 L;  3A8K E;  4B3M L;  3UI2 A;  1YHQ A;  3K5L A;  2Z1C A;  4LF8 Q;  4K8I A;  2C9O A;  2LS0 1;  1JT8 A;  1A62 A;  5COY A;  4RH6 A;  3CRK C;  2PQA A;  4C2M B;  1J9O A;  3Q6S A;  2F0T A;  1HZ9 A;  1F2L A;  3I4N G;  1O7Z A;  3W5O A;  2HQL A;  1F9Q A;  1P8L A;  1BUV T;  3HZX A;  1E2V A;  4DR3 L;  1WI5 A;  1MBY A;  1W6K A;  3M9B A;  3RD4 A;  4OO1 H;  1PLF A;  2I5H A;  1BOS A;  4BY7 B;  2F0M A;  2F4V L;  3M3Y B;  4X65 L;  4OGQ C;  3BYY B;  1EWI A;  3MTS A;  2KEC A;  3TRZ A;  3SK6 A;  5IGF A;  1Q1E A;  2EOT A;  1XNR Q;  3LNN A;  2NN6 G;  2FIN B;  3I4L A;  1PH4 A;  2PW7 A;  1S40 A;  1Q7Y C;  5EBC A;  1KC8 C;  2AQ3 B;  3EIV A;  3GTM H;  3H15 A;  2HDM A;  3K5M A;  1KAA A;  1PZK D;  1I6H B;  1WD1 A;  2K5H A;  1VCI A;  3U4Z A;  4AQY Q;  2F0F A;  1F2M A;  4K5X A;  5C4J H;  1EOT A;  2K7V A;  3GTQ H;  4GS3 A;  3Q24 A;  1YBY A;  1TXY A;  3DHQ A;  4GKK L;  3HOV B;  4KY5 A;  2VUM B;  1T5E A;  5K36 G;  5M3M H;  2ICE C;  1EY8 A;  4X66 L;  1SBB B;  4KD3 A;  3KLS X;  4J8Q A;  1XMQ L;  1W2B A;  1WOC A;  3A54 A;  3NEM A;  1TWA B;  2VY3 A;  3CXC A;  3GTJ H;  5CV9 A;  4JI3 Q;  2L15 A;  1Q46 A;  2L9H A;  3A5U A;  5C3E H;  2MP1 A;  4A3F H;  3FKI B;  2EJG C;  3SK5 A;  4ID6 A;  5A35 A;  2DJF C;  5GQO A;  2F0K A;  2KCN A;  4KJN A;  2VQE L;  1VQ7 A;  1B4O A;  1N32 Q;  4R8I A;  1QZH A;  4GZY C;  2HD3 A;  4UP9 A;  3FMC A;  1N36 Q;  2XWB B;  1EIF A;  3F8T A;  1G2S A;  4KJO A;  1I3Q H;  1HA6 A;  2JQO A;  2VXW A;  2F4I A;  4J1M A;  3O13 A;  1S5B D;  1X54 A;  4G57 A;  3CCE A;  3GTM B;  5JPN C;  1DXM A;  4IUR A;  4OWW B;  3S14 B;  3FDT A;  1SE8 A;  3MFG A;  4C1N K;  1N33 L;  1C0A A;  4O2D A;  2I07 B;  4GN5 A;  1QVG A;  3Q22 A;  2BE5 D;  2KA7 A;  2WFW A;  3W1G A;  3PUW A;  1TR5 A;  3JAM i;  2JA5 G;  1CQV A;  1HA5 A;  2D0P A;  1PH6 A;  5EAY A;  3GTQ B;  3I90 A;  4KLK A;  3ERO A;  2G9D A;  1Q1B A;  4CJ0 B;  4JI7 Q;  3HOX G;  1KTK A;  1Z9F A;  3KF8 A;  1IZ6 A;  2Q2I A;  3NTK A;  4ZUJ A;  3J81 E;  3M4P A;  2F0W A;  1GUO A;  3WOE A;  2MPM A;  5CBA E;  5JVG 3;  3H3V C;  3PUY A;  2YV5 A;  1LAC A;  4F88 A;  2R7Z G;  1F9R A;  4DAP A;  2JA7 G;  2A68 C;  2PMZ E;  4A3K G;  1JJ2 A;  1BCP F;  5HGQ A;  4JOI C;  4A3F B;  5C5M A;  1RF2 D;  3MZ5 A;  1EIG A;  1N34 Q;  3MWY W;  3J7Y W;  1I94 L;  2D5D A;  2O5I C;  4DR6 Q;  2CCZ A;  2WAQ B;  2NZ1 D;  3S24 A;  4IPG A;  1MD2 D;  3E9I A;  4LF7 L;  1K28 A;  4X64 Q;  4Z9C B;  4DR2 Q;  3PO2 B;  2UUC L;  5KIX A;  2NVY H;  1VQ8 A;  2UUA Q;  1JB3 A;  2L1B A;  4O42 A;  2PNH A;  3NEN A;  3R93 A;  5C4X G;  1PYS B;  4C3J H;  3CW2 C;  1PTO F;  4LF4 L;  3HOY G;  4JYA L;  1JIC A;  3ONA B;  1E2Z A;  2JA8 B;  2PPB C;  3PGZ A;  3NXW A;  1VQ4 A;  3NQI A;  4B08 A;  5IWA L;  4H7B A;  4CKE A;  5EGT A;  3ND9 A;  5CBE E;  2NUC A;  4QB4 A;  4JI6 L;  3QR8 A;  3Q8D A;  1VF5 C;  2VNU D;  1B8A A;  4JI2 Q;  1IBL L;  1K3B C;  2AQ2 B;  2I46 A;  4ULL A;  4K2L A;  4IFD G;  2UXD L;  3FHW A;  3FPU B;  3OTO Q;  1EL0 A;  1HZA A;  3I73 A;  2L55 A;  4HAE A;  2VQF L;  4A3J G;  2KCM A;  3S16 B;  5HY6 A;  1HNW Q;  4C56 C;  1WVL A;  2JE6 I;  4A3D H;  2E5L L;  3PCO B;  2IT1 A;  1BNZ A;  2JK8 A;  4X6A H;  2MJ8 A;  5BN5 A;  1X56 A;  2ZTD A;  1FGU A;  4BBS H;  4DK1 A;  2E2I H;  1VQG A;  2D62 A;  1PH1 A;  1TVX A;  3D4R A;  2B2V A;  2N55 A;  3RLO A;  1XXG A;  1STH A;  4ZUI A;  2FMM A;  4KN4 C;  4JV5 L;  1JQY D;  4OON A;  5M3F G;  4OL7 A;  1D7Q A;  2KOL A;  3I56 A;  1F9P A;  1O7L A;  3X3M A;  1NAP A;  4A3I H;  1E1T A;  1L0Y B;  1ENF A;  1VQF A;  4IOC A;  5CV6 A;  4BXX H;  1EU4 A;  1L2F A;  2RCN A;  5I6Y A;  4JK1 C;  4QGU A;  1SE2 A;  2F0S A;  3HOU B;  1IKM A;  1SMY D;  1VQK A;  3H91 A;  4XXE A;  1F77 A;  3G7L A;  1I6V C;  1ILQ A;  4KKS A;  1G8Z D;  5IP7 H;  4BY1 G;  3RMH A;  2K5Q A;  2G9H D;  1UNS A;  3WWV A;  4A3L G;  3I91 A;  4FF4 A;  3J7A 5;  4P73 A;  2A69 C;  1Y14 B;  2A73 B;  3HEJ A;  4HCE A;  2JP1 A;  1QNK A;  1SN8 A;  4H02 A;  2F0E A;  2Q2T A;  4JBW A;  5EQ0 A;  1XPR A;  1PHJ A;  1HR0 L;  4MTK A;  1BXT A;  4DNI A;  2WII B;  5EBD A;  4GOP B;  1EWH A;  4A3D B;  2NWG A;  2NVQ B;  4MHE A;  1PV4 A;  5LMU L;  1RIP A;  3SVM A;  3S2D B;  1AH9 A;  2MUY A;  3J80 i;  3W3A A;  3PF5 A;  2E2I B;  2H5X A;  3CME A;  4C3H H;  1YNN D;  1PFN A;  4IPC A;  1TWG B;  5LL6 X;  4U67 3;  4HIK A;  1K8G A;  1L0W A;  4HJ9 A;  3TS2 A;  1HXY D;  2CH4 A;  4XYO A;  4FXD A;  1NNX A;  1JR0 D;  4P72 A;  4GOP C;  2NYZ D;  1QIL A;  4DV3 Q;  2OF1 A;  4A3I B;  4DU9 A;  3DUZ A;  3TQY A;  4B9W A;  2HDL A;  2F0L A;  4DUZ Q;  4H13 C;  4QY7 A;  2OTL A;  1B1Z A;  4POG A;  4DNR B;  5FO9 B;  3GTO H;  1DJR D;  3QG1 A;  3CC2 A;  1VQA A;  4JI8 Q;  4Y7N B;  2ZJQ A;  3GO5 A;  2UXC Q;  1X6O A;  1F2Y A;  4JCV E;  4EX5 A;  1XMO Q;  4LFC L;  5FKA C;  3EJI A;  4YY3 L;  5IP9 H;  5LMN W;  4C3I G;  4RKL A;  4L63 B;  2NB0 A;  1CZG A;  1ZEQ X;  2DY7 A;  2PW5 A;  2QIL A;  1HFG A;  1SFO H;  2BOS A;  2WP8 J;  5IYC G;  3LWU A;  2VZA A;  3VR6 A;  2IW3 A;  4CDC C;  2B63 G;  4UPA A;  1IBK L;  1ASZ A;  4RAU C;  4UDU C;  3IL8 A;  1HTL D;  4BBR G;  3V2T A;  3JAM E;  3FVQ A;  2AWN A;  2RBM A;  4B3T Q;  2HIX A;  4TVA B;  3HOW H;  2JN4 A;  2R93 H;  2EXD A;  1CZW A;  5C44 G;  1VF7 A;  5IY0 A;  3K58 A;  1H9M A;  3TME A;  4LF4 Q;  1RCV D;  1RDP D;  4A3E B;  4LF8 L;  3JC6 6;  3K8A A;  2RDH A;  3CCJ A;  2EYL A;  5I9P A;  3CF5 A;  1KRS A;  4UP7 A;  2Y0S E;  3CCU A;  4EQP A;  5J3B A;  1L1O B;  2B8F A;  5KEE A;  5KNC A;  3F2C A;  1H95 A;  2R7D A;  5CMD A;  1LYL A;  2WB1 B;  4BS9 A;  3B6Y A;  1OXX K;  1WCM G;  2ID0 A;  2ES2 A;  4RCO A;  4QIW E;  3FRP B;  1XTC D;  4BA1 I;  5LHY 1;  3I72 A;  1D6E C;  3T4A C;  1OO9 B;  5A2Q L;  4DAY B;  3PMF A;  4JI5 Q;  1L1O C;  1Y69 U;  3A7L A;  3RR5 A;  3H0G H;  1KL9 A;  4DUY Q;  1K0S A;  2NVX H;  4F87 A;  5IYB G;  1NMF A;  2A19 A;  4ZKB B;  2N3S A;  2EY1 A;  1VQI A;  2VB3 X;  3ERQ A;  1CM9 A;  2J4X A;  1H9S B;  1XNR L;  4B3R Q;  2F0Q A;  2XNA C;  4ME3 A;  3U50 C;  2R93 B;  3E3X A;  4GLX A;  3I4M H;  3R2T A;  3WOF A;  5A2Q E;  1HQR D;  1RHP A;  5J1Z A;  3M4Q A;  2QEX A;  4DF7 A;  4PMC A;  3E9H A;  4IJH A;  2R92 G;  1DOL A;  4AQY L;  2RHS B;  4GLA C;  4UP8 A;  4FO2 A;  1AP0 A;  1SYD A;  4LFA Q;  1PRT D;  1U4R A;  3P20 A;  3OMG A;  3U9S A;  1Z47 A;  3AMU A;  2BH8 A;  5EKK A;  2BCO A;  1STE A;  2RSO A;  3CPF A;  4FF2 A;  1Y1V G;  4JC0 A;  2SNM A;  2OTJ A;  1U9R A;  2HUG A;  1VQC A;  5G3L D;  4JI3 L;  3TSS A;  2Z4H A;  1KD1 C;  1A15 A;  4PZ6 A;  2ZXO A;  3FPP A;  3OW2 A;  2IX0 A;  1CSQ A;  2RF4 A;  4N9P A;  3H0G B;  1VQ6 A;  4NXN Q;  4LWC A;  1SE3 A;  3NPP A;  5E4W C;  4BBS G;  2E2J B;  1N32 L;  4A3B G;  4R1J A;  2NVX B;  5M5Y B;  2B39 A;  2NTT A;  4OWX B;  1N36 L;  3KJP A;  1J5E Q;  2Z9H A;  5IGB A;  4A3G H;  2OQ0 A;  3GTL H;  1F9S A;  2EXZ A;  3OYY A;  2GA4 B;  1YEZ A;  3I4M B;  4RFB A;  3ITP A;  4NXM Q;  2ZXR A;  1WTR A;  5C3X A;  4DAV A;  4BA2 I;  4PV1 C;  1PMR A;  4H44 C;  1QVC A;  2ASB A;  4LUZ A;  5JEA G;  4XYQ A;  1K83 H;  2QW7 A;  3T1Y L;  3K7A H;  1PZJ D;  4HN7 A;  5KND A;  3K5O A;  4JI7 L;  2L4N A;  2SEB D;  1MSG A;  3GQB A;  2HHH Q;  2RHQ B;  2DN8 A;  1PH2 A;  3KBG A;  3K59 A;  2KUM A;  4JW0 A;  2K5V A;  3TS0 A;  1V9P A;  1X55 A;  3KDF B;  1HUN A;  2SOB A;  2O5J C;  1EQR A;  3TP6 A;  4O0A A;  5I9O A;  1KNA A;  2CWP A;  4A93 H;  2FXQ A;  3J80 E;  4A75 A;  1N34 L;  2B2V C;  3TP7 A;  3UDX A;  1YHB A;  3G6J B;  1JB7 A;  3OSO A;  4QF4 A;  4RKB A;  3RLN A;  4DR6 L;  2VS1 A;  1EUJ A;  4ZQ3 A;  3HOX B;  3ULJ A;  1VQD A;  4A3G B;  1KDB A;  1SEB D;  5JPM C;  1EZ8 A;  4K0K Q;  3C46 A;  1EY7 A;  4X64 L;  4DR2 L;  2I0Q A;  4HIM A;  1CSP A;  1TY0 A;  1X3G A;  3EFX D;  2UUA L;  3M3Y H;  4M8A A;  4PG3 A;  1FL0 A;  2JA7 B;  2NTS A;  4A3K B;  1VQO A;  1TQO A;  1GD7 A;  3M7G A;  3CCS A;  4DR1 Q;  2B3G A;  2BDO A;  3OHX C;  2BE5 C;  5D14 A;  1YIT A;  3K7A B;  1E22 A;  5I4D A;  1CQF A;  3BYT B;  1I6H H;  4Y52 H;  1VDZ A;  1U4P A;  2KJX A;  3PIP A;  3HKZ E;  2JYO A;  1E1O A;  3H3V I;  3PIO 3;  4GOP A;  4A3C H;  4JPB W;  4UAI A;  2AQ1 B;  1KLU D;  1HHV A;  2R6G A;  5IE8 A;  3HOV H;  4JI2 L;  5C4X B;  2DUD A;  1UE7 A;  4A93 B;  2VUM H;  1Z7T A;  2IX3 A;  1CA6 A;  5JJK A;  1G91 A;  2J7Z A;  1VQL A;  2Q8T A;  3HOY B;  1N9W A;  3HOZ G;  3OTO L;  1G29 1;  1TWA H;  3VR5 A;  5T1G A;  5E4X A;  1LO5 D;  4IUP A;  1IBM Q;  2JA6 G;  1NY4 A;  2N49 A;  2WAC A;  3FKI H;  1HNW L;  2C5C A;  1JOO A;  1MGS A;  3TDQ A;  2F0U A;  3DWP A;  1AFP A;  4RGM A;  1VS0 A;  4K5V A;  3GV6 A;  3PO3 H;  3DEO A;  2Q2U A;  3CKI B;  1RL2 A;  1UWV A;  1EY6 A;  2Z0S A;  5HGT A;  3S14 H;  4APV A;  2K05 A;  2RCF A;  4A3J B;  3H3V H;  1NMG A;  2MO1 A;  3MA2 B;  4ZYS A;  3CD6 A;  1C4Q A;  1EYG A;  3NP8 A;  1D5X C;  1W6J A;  3URY A;  1Y1W B;  1KXL A;  1CHQ D;  2KQ3 A;  2AUJ D;  3E6Z X;  3NSW A;  4WOR A;  2PQE A;  2PI2 E;  1A6X A;  4TRD A;  4EQO A;  4P74 A;  5FLM G;  2BDN A;  3MXG A;  4PZ8 A;  1GKH A;  3AU7 A;  1JJG A;  2OWO A;  2P5Z X;  3NHH A;  2Z6B A;  3CHB D;  2FHT A;  5BN4 A;  5D65 A;  1LAB A;  3IFT A;  2VB2 X;  5C4H A;  4YWL A;  1ENC A;  5FO8 B;  1JOQ A;  4TKO B;  1HCZ A;  3GTG B;  4HIO A;  3FP9 A;  2NBF A;  1I5F A;  2IHE A;  3PUX A;  5JVH 3;  4BY1 B;  2PZW A;  2GVB A;  3Q23 A;  3PO3 B;  5J39 A;  3K5N A;  3I3C A;  1SJH D;  1XNQ Q;  2CW0 D;  3NK9 A;  3JAM c;  1HTP A;  3PO2 H;  3S17 B;  5DNF A;  1WFQ A;  4DV3 L;  1JE4 A;  4IN3 A;  4DPG A;  4IUQ A;  4DUZ L;  1DGS A;  1L1O A;  2F0N A;  3DWA A;  4I65 A;  3VR4 A;  4KHP Q;  2JA8 H;  3KF6 B;  4K14 A;  2OT2 A;  3T1Y Q;  1DON A;  2J0T D;  1PA6 A;  2ZJP A;  1SMY C;  1CFM A;  4JI8 L;  1XX8 A;  1E3P A;  2MFI A;  2RA4 A;  1SRO A;  2UXC L;  4DAY A;  2XWJ B;  1XPU A;  2Q8I B;  4K8J A;  1XMO L;  1NUC A;  2PNR C;  5FJ8 H;  2ATW A;  4KY6 A;  3VYU A;  3H6M A;  1Q86 C;  1SND A;  2N8N A;  3DWQ A;  4EGV A;  5DLQ E;  4L5S A;  3IRB A;  3C1F A;  4X3K A;  1VQE A;  1H9S A;  1R4P B;  2OEO A;  2DNE A;  2QEJ C;  4YIJ A;  4IUN A;  3T56 B;  1JMC A;  5BR8 Q;  2E2D C;  4DN4 M;  3RZO H;  3R2I A;  1SNO A;  2JA9 A;  4IQZ A;  1I4G A;  3S16 H;  1YNN C;  2D9U A;  5KYI A;  4JVZ A;  1PDQ A;  1EY5 A;  4B3T L;  1PFB A;  1XJV A;  3BU2 A;  4C3I B;  2EQS A;  3D6W A;  5C0X J;  1CI3 M;  1V1O A;  1DZ1 A;  1BKB A;  1K0R A;  3S9W A;  1LTS D;  1P16 A;  2Y0S G;  4HCS A;  2TMP A;  2L0C A;  2IL8 A;  4JI4 Q;  4LF6 L;  3CP0 A;  2F3V A;  3U9O A;  4OX9 Q;  1CT1 D;  1B7Y B;  1STN A;  2RQX A;  1LT3 D;  1Q3L A;  3R3O A;  4R4T A;  1TT2 A;  1NR2 A;  5TSS A;  1KDA A;  3HOU H;  1TS5 A;  4L6T B;  4R4Q A;  4BBR B;  2R61 A;  5FLX L;  4J6H A;  1R9T H;  3TZD A;  2X69 A;  2GN5 A;  1C9O A;  1CK1 A;  2F03 A;  1UUP A;  2DJG C;  4RA8 A;  4YHH Q;  3K57 A;  1B3A A;  1HZB A;  3GD7 A;  3DLL A;  4OEL B;  3M4O B;  1GO3 E;  1MHW C;  4JI5 L;  1AE2 A;  4BY7 G;  4KK7 A;  3RZO B;  5JJI A;  2BH2 A;  4DUY L;  1IW7 D;  1MI2 A;  3DXJ C;  2NVQ H;  4A3M H;  3M7N A;  2YU9 B;  3S1Q H;  1ESF A;  2CFM A;  3VYS A;  3GTK H;  1IYJ B;  4FXG C;  3S2D H;  3F1Z A;  4LF5 Q;  4B3R L;  1B50 A;  1QJO A;  1EYA A;  2NVT B;  3L9A X;  3BZK A;  3A8J E;  2CHB D;  1TWG H;  1KDC A;  3SR1 A;  3UDG A;  3QWN A;  1X65 A;  1S5D D;  1WCM B;  4BWG B;  4CKC A;  5IGE A;  1WTV A;  1GUT A;  1ZKO A;  4X62 Q;  3BZD B;  3KDF A;  1ET9 A;  2LXK A;  4Q0F A;  5M9O A;  3LX0 A;  4LFA L;  1I4Q A;  5ELO A;  5EPK A;  4B3S Q;  4F7X A;  2AUK A;  2IWH A;  1GOZ A;  3HOV G;  2TSS A;  4OHJ A;  3VR2 A;  1SYC A;  4HSV A;  2YTY A;  4R4O A;  4K2K A;  1N8R C;  1R9T B;  4Y7N H;  1F2Z A;  5I2X A;  3STB D;  1B53 A;  5ELD A;  3DM1 A;  1S4Z A;  4OO1 G;  1WD0 A;  3J80 c;  3K80 C;  1K8M A;  1EFW A;  1W3S A;  3MHB A;  4NXN L;  3UE1 A;  3DM3 A;  4A3M B;  2IY5 B;  3MXN B;  3NWT A;  1J5E L;  3S1Q B;  3GTK B;  3VA5 A;  3TP5 A;  1SYG A;  3QOL A;  1A8V A;  4FP5 D;  5IIF A;  3ULP A;  1LTT D;  1PRT B;  2E76 C;  4G4K A;  1GXD C;  3OW7 A;  4LNQ A;  1G6Z A;  4NXM L;  3GTP H;  4L5R C;  1CKN B;  1EFI D;  1DYQ A;  5JEA J;  2MNA A;  4X3U A;  3I55 A;  2K01 A;  3BVG A;  3MFY A;  1M1K C;  1KAW A;  1D1K A;  3MC0 B;  1PRT C;  2HQE A;  3H09 A;  4K6L A;  1WTW A;  2HHH L;  5M3M G;  5BN3 A;  4A3E H;  1PH8 A;  1VMC A;  3I2Z A;  4FYD A;  1E0B A;  1T5X D;  4EVO A;  3G48 A;  1AEX A;  1X3E A;  3V05 A;  5C3E G;  1IYV A;  5IYD H;  4A3F G;  4GKJ Q;  3T1H Q;  4P75 A;  1TWH B;  2KHS A;  4DV4 Q;  1KQS A;  3I4O A;  3ND8 A;  3QOJ A;  5GAG C;  2ZM6 Q;  3C2P A;  3A7A B;  3L3O C;  5M5X B;  2WAQ G;  4DK0 A;  4RCN A;  3PSI A;  1Q90 A;  3OMC A;  4NB3 A;  1JJC B;  2NN6 I;  1VQM A;  1UEB A;  1HZC A;  2RSN A;  1EQT A;  1RKN A;  3MEH A;  5LMN Q;  4K0K L;  1NR4 A;  4K5W A;  3SXH A;  3PQI A;  4AH6 A;  2OCE A;  2PMZ B;  3BZC A;  2EVB A;  1QG7 A;  4DNT B;  1EWC A;  4TSS A;  1TWF H;  2C35 B;  3BDC A;  2CKZ B;  3GTP B;  2UXB L;  1CUK A;  1M8A A;  1C8C A;  3CC4 A;  4DR1 L;  3AYH B;  1SDF A;  1UE1 A;  1DD2 A;  5HUR A;  4XT3 B;  2PO4 A;  3PF4 A;  3KFU A;  2EZV A;  4FXK C;  1BF4 A;  4XQJ A;  1VQB A;  4YCV A;  2E2H H;  3VDY A;  1QNU A;  3HKZ G;  5IT9 L;  3BDO A;  2ZJR A;  1NJI C;  1PYW D;  1V8Q A;  5H1S E;  1LTR D;  2YTX A;  1NE3 A;  4HR7 B;  2PZT A;  1JWS D;  4LJZ C;  4LF6 Q;  4V19 0;  3TBI B;  2EJM A;  2M00 A;  2BA1 A;  3ULL A;  2YTV A; 
#chains in the Genus database with same CATH homology
 3PV0 A;  4P2C B;  5JJZ A;  4C1N I;  5C3W A;  2XRQ D;  2NN6 H;  3HG9 A;  5KNB A;  1GHK A;  3T53 B;  5CYU A;  1NSN S;  3M4Y A;  2XRS D;  4CHT B;  2F0I A;  3I70 A;  4H0L C;  3IKJ A;  4ZAI A;  1FNU A;  3S1N B;  1EZ6 A;  1TWF B;  4TQU S;  3R8B A;  2XVS A;  4C3J G;  1Q8I A;  1XWE A;  5K36 H;  5K5P A;  3I4N B;  3HOZ B;  2ZT9 C;  2E2H B;  1X3P A;  2KCC A;  5J22 A;  2JA6 B;  1OXV A;  3A55 A;  2MGS A;  1HPC A;  3TN2 A;  3OIQ A;  1JOK A;  2A6E D;  2JEA I;  2LY7 A;  1D1I A;  4ABN A;  3KK7 A;  2IPK D;  2SDF A;  3VA7 A;  2L5T A;  4NKL A;  3PUZ A;  2K32 A;  2CQA A;  4KTA A;  1GUW A;  4KKU A;  3D6C A;  1FGB D;  2F0D A;  1K8O A;  1PZI D;  1H9R A;  5IOC A;  5ELF A;  4ILW A;  5EPL A;  3BVZ A;  2ZXP A;  1ML0 D;  4Q5V A;  3S1R B;  3ZYY X;  1WTP A;  2M2L A;  1VMP A;  1I50 B;  3HS0 C;  4XQN A;  1BCP D;  1MSH A;  5CV8 A;  5DEH A;  3BDL A;  4DFA A;  1DM0 B;  2M9V A;  3SK4 A;  1X3Q A;  2R3Z A;  3E5S A;  3GV3 A;  4KD4 A;  3BS1 A;  1U4M A;  1H9K A;  3HRZ C;  3EA6 A;  4KV6 A;  5KYL A;  1ZYR D;  2JA5 B;  3L7Z C;  1OXT A;  3A8I E;  1PXU A;  4C3H G;  2SNS A;  4NMZ A;  1PTO D;  4RGN A;  3M85 A;  5C4Z A;  4NDX A;  1EY0 A;  1AZQ A;  5ELB A;  2CW0 C;  1EU3 A;  2X6L A;  2R7Z B;  4QCL A;  4E6I A;  1TU2 B;  2B2W C;  3S1M B;  3EQL C;  2F0J A;  4KN7 C;  1IHZ A;  1GUG A;  3AB9 A;  1LLR D;  3IFD A;  4G7H C;  1EQV A;  2K03 A;  1DCZ A;  3S15 B;  1SJE D;  5M5W B;  1G2T A;  1S5F D;  3Q0A A;  4RWS C;  4NP5 A;  1CTM A;  1IL8 A;  1RTN A;  1LTI D;  3MXN A;  3EVQ A;  3V96 A;  5IOD A;  4QMG A;  2FFK B;  3QIA A;  2B2U C;  4IFD J;  2K5W A;  3VR3 A;  2Y0S B;  2BA0 A;  2K28 A;  5IGC A;  2FMC A;  1WTX A;  1OXS C;  2XSC A;  4ZRZ A;  1QE6 A;  3I8Z A;  2QF7 A;  4CKB A;  1V1P B;  3K6O A;  2WKD A;  2EE1 A;  3QB3 A;  3E0J A;  2IJ0 A;  4QIW B;  5NUC A;  3J7A V;  5CC4 A;  1ICW A;  4KHV A;  4DGZ A;  3DEP A;  4B9X A;  1AZP A;  3KLS A;  3A56 A;  3WDN A;  1D5M C;  1I4R A;  2QDB A;  3T16 A;  4X3S A;  1Z6H A;  1CA5 A;  2F3W A;  5T1I A;  1B9N A;  1QCB D;  4ZLT F;  4ZKC B;  4U68 A;  1FR3 A;  5ISR A;  5M3F B;  1I4P A;  2KVM A;  1HFN A;  3NUC A;  1TKW B;  5IGD A;  1O7Y A;  4QUC A;  1IW7 C;  5AFW A;  1DOM A;  2JEB I;  1V43 A;  5E1F A;  4RGT A;  1LV9 A;  5C0X I;  4XT1 B;  1Y8O B;  2EYP A;  4N9T A;  5C6A A;  2B2T A;  1PRT F;  1A2U A;  1KAB A;  3FEW X;  1B44 D;  4QUF A;  1EY4 A;  4XQQ A;  5JOB A;  1CHP D;  1SE4 A;  4S3S A;  3D8G A;  5G3L F;  5I2Y A;  5JAV A;  2DNC A;  2OXP A;  1EEI D;  4F8M A;  4HED A;  3J81 L;  1ET6 A;  3MAQ A;  2RKS A;  4LAA A;  5C4J B;  2F0H A;  1ROD A;  5C0X H;  2O4X A;  3SHL A;  1HUM A;  1TWC B;  1SNM A;  2ICI A;  1SNC A;  1SYE A;  4LMQ D;  5M3M B;  2K5D A;  3GTJ B;  1LT5 D;  5C3E B;  1ESR A;  4CJ1 B;  1RD9 D;  3PIP 3;  3NE5 B;  1A3V A;  4LK1 C;  3NQT A;  1WTQ A;  2F0P A;  5FK9 C;  1I3Q B;  4MN3 A;  2XN9 C;  1YNJ C;  2N88 A;  2B63 B;  1Y8N B;  5D3D A;  1STG A;  3D3R A;  2F0O A;  2EYH A;  5CV4 A;  1I4X A;  4IUT A;  2A6H C;  1BBX C;  2ENB A;  5DM6 3;  3MXP A;  3N6R A;  1ENA A;  4DXG A;  3TP8 A;  1SNQ A;  4X3T A;  4G7O C;  1EIH A;  4R8N A;  4RHS A;  5C44 B;  1J8I A;  2X6G A;  4RHR A;  5C5L A;  3KBX A;  5IGG A;  1BO0 A;  3HKZ B;  3CU7 A;  3OIP A;  1DOK A;  2V4D A;  4G7Z C;  3CQZ B;  1SXT A;  5KRU A;  1PFM A;  2DY8 A;  5FLX E;  5KGU A;  4EQN A;  3P75 A;  1A3T A;  4ME5 A;  1H9J A;  3OWE B;  3NTI A;  4HMJ A;  5ELC A;  5CV5 A;  3TZU A;  2JSO A;  2K1B A;  3QJY A;  3RUZ A;  1A2T A;  2WV6 D;  3OOC A;  1O80 A;  2NVY B;  2HCC A;  3PUV A;  1QWY A;  2Q8R E;  4C3J B;  1UAP A;  1UEA B;  3IAY A;  1LTB D;  2EJF C;  5EKL A;  2B2Y C;  2B2W A;  1E2W A;  1LT4 D;  2EYO A;  5FO7 B;  4FNF A;  1O78 A;  3NBH A;  1D5Z C;  4NW2 A;  2R92 B;  2JXM B;  1L0X B;  2A5H A;  4KY7 A;  1AN8 A;  1HRJ A;  5JEA H;  1BDO A;  1GJX A;  2Z4I A;  4I7Z C;  4K6D A;  1I4H A;  1JWU D;  1TS4 A;  4XDX A;  4PQX A;  4IAL A;  3HP3 A;  4ZK9 B;  1Y1V B;  2B2U A;  2A68 D;  3BG3 A;  1STB A;  4O1N A;  4HTH A;  1JC7 A;  1XYI A;  1TII D;  1SYB A;  4OIK A;  4BBS B;  1A3U A;  2PZU A;  4A3B B;  3VYT A;  1YNJ D;  2A6E C;  3K0Y A;  3MVV A;  5FOB B;  2B8G A;  3RLF A;  2A6H D;  1SNP A;  1PTO H;  2EDG A;  4V0B A;  1V1P A;  2LMC B;  2KED A;  1OXU A;  1U4L A;  5DAU A;  4OIJ A;  3P1H A;  3T13 A;  1SSO A;  1KNE A;  4ODG A;  4HSP A;  4PMW A;  1BCP B;  1S5E D;  4L8J A;  1Q12 A;  3JAM L;  1JCK B;  1FD7 D;  5DM7 3;  3N52 A;  1TS2 A;  1HQM C;  2O2L D;  4MIU A;  2F1M A;  3SDZ A;  4C3H B;  1BCP C;  2E75 C;  5EJW A;  1GUN A;  1RTO A;  3SEB A;  3SK8 A;  2EY6 A;  4KKT A;  2D2C C;  3LWE A;  3KLR A;  1TS3 A;  1PTO B;  2QCP X;  1TY2 A;  2FJ2 A;  5C0X G;  1WTO A;  3DMU A;  1LT6 D;  5IT9 E;  2LFN A;  1LTG D;  3GTO B;  2EY2 A;  2L11 A;  1ZYR C;  2B2T C;  3D4D A;  2H4O A;  2F0V A;  2HCI A;  5LL6 S;  4DXF A;  1PTO C;  1FNW A;  2PCF B;  1STA A;  1RJT A;  1B2T A;  1M4V A;  2K33 A;  2IX1 A;  4FVM A;  2Z8L A;  2WKC A;  2A69 D;  2PYK A;  2EPB A;  1S5C D;  3MXU A;  3S2H B;  1SFO B;  1EEF D;  2YYZ A;  1LTA D;  4IUV A;  3NWS A;  1FNV A;  3F2U A;  1D2B A;  4AYB B;  4DA2 A;  1SAP A;  2H1E A;  2XIW A;  5EPJ A;  3QO2 A;  3KUP A;  1GHJ A;  4FF1 A;  3HOW B;  2WIN B;  2EYF A;  1EYD A;  2E74 C;  2RDG A;  3OPO A;  4KHZ A;  3H94 A;  3J7A F;  4RGO S;  1C48 A;  1BQQ T;  1GUS A;  3D4W A;  5E3F A;  2F0G A;  2A74 C;  3W2D A;  3BVM A;  2L12 A;  1II3 A;  2QKI C;  1X32 A;  3NTH A;  3C1E A;  3OWF A;  4WFN 3;  3SE0 A;  1STY A;  1IKL A;  5I6W A;  4R9W A;  2EYM A;  3VYR A;  2K04 A;  2EYJ A;  4IFD I;  1AW7 A;  4HMI A;  3CRL C;  3C3L A;  3X3N A;  4CJ2 C;  1R4Q B;  4IUU A;  4PNY A;  3NBI A;  2LKV A;  4IZ8 A;  3HGB A;  2RDF A;  3J80 L;  2RVL A;  2KEE A;  1EYC A;  1ONL A;  1QOH A;  4CBV A;  1JWM D;  4WRD A;  1JOR A;  1BR9 A;  4XIG S;  5CV7 A;  5D3I B;  2EY5 A;  4KI0 A;  1NCV A;  4WJW A;  1FYC A;  2B2Y A;  5CR3 A;  3RZD B;  1B9M A;  1QB5 D;  5EKI A;  4CGY B;  4M1U B;  2AWO A;  3GP7 A;  5COR A;  1EY9 A;  4FF3 A;  2K6A A;  4XTC S;  5CGK A;  1Y8P B;  1IYU A;  1KLG D;  1ZXT A;  4IFD H;  1SYF A;  3P7J A;  3GTL B;  4KMU C;  2MHV A;  4OO1 I;  2CVR A;  5F2D A;  3T51 B;  4PMB A;  1K83 B;  1ILP A;  3D31 A;  5ELE A;  3A8K E;  3UI2 A;  3K5L A;  2Z1C A;  4K8I A;  2C9O A;  2LS0 1;  5COY A;  4RH6 A;  3CRK C;  4C2M B;  1J9O A;  3Q6S A;  2F0T A;  1F2L A;  1O7Z A;  1F9Q A;  1BUV T;  3HZX A;  1E2V A;  1W6K A;  1MBY A;  3RD4 A;  4OO1 H;  1PLF A;  1BOS A;  4BY7 B;  2F0M A;  3M3Y B;  4OGQ C;  3BYY B;  3MTS A;  2KEC A;  3SK6 A;  5IGF A;  1Q1E A;  2EOT A;  3LNN A;  2NN6 G;  2FIN B;  3I4L A;  2PW7 A;  5EBC A;  2AQ3 B;  2HDM A;  3K5M A;  1KAA A;  1PZK D;  1I6H B;  1WD1 A;  1VCI A;  2F0F A;  1F2M A;  4K5X A;  1EOT A;  2K7V A;  3Q24 A;  3DHQ A;  3HOV B;  4KY5 A;  2VUM B;  1T5E A;  5K36 G;  2ICE C;  1EY8 A;  1SBB B;  4KD3 A;  3KLS X;  4J8Q A;  3A54 A;  1TWA B;  5CV9 A;  2L9H A;  2MP1 A;  3FKI B;  2EJG C;  3SK5 A;  4ID6 A;  5A35 A;  2F0K A;  2KCN A;  4KJN A;  1B4O A;  4R8I A;  4GZY C;  3FMC A;  2XWB B;  1G2S A;  4KJO A;  1HA6 A;  2VXW A;  2F4I A;  4J1M A;  3O13 A;  1S5B D;  4G57 A;  3GTM B;  5JPN C;  1DXM A;  4IUR A;  3S14 B;  3FDT A;  3MFG A;  4C1N K;  2I07 B;  3Q22 A;  2BE5 D;  2KA7 A;  3PUW A;  1TR5 A;  1CQV A;  1HA5 A;  3GTQ B;  3I90 A;  3ERO A;  2G9D A;  1Q1B A;  4CJ0 B;  1KTK A;  3KF8 A;  3NTK A;  4ZUJ A;  3J81 E;  2F0W A;  1GUO A;  3WOE A;  2MPM A;  5CBA E;  5JVG 3;  3H3V C;  3PUY A;  1LAC A;  4F88 A;  1F9R A;  4DAP A;  2A68 C;  1BCP F;  4A3F B;  5C5M A;  1RF2 D;  3MZ5 A;  1EIG A;  3MWY W;  3J7Y W;  2D5D A;  2O5I C;  2WAQ B;  2NZ1 D;  1MD2 D;  4Z9C B;  3PO2 B;  5KIX A;  1JB3 A;  2L1B A;  4O42 A;  3R93 A;  1PTO F;  1JIC A;  3ONA B;  1E2Z A;  2JA8 B;  2PPB C;  3NXW A;  3NQI A;  4B08 A;  4H7B A;  4CKE A;  5EGT A;  3ND9 A;  5CBE E;  2NUC A;  4QB4 A;  1VF5 C;  2VNU D;  2AQ2 B;  2I46 A;  4ULL A;  4K2L A;  4IFD G;  3FPU B;  1EL0 A;  3I73 A;  2L55 A;  4HAE A;  3S16 B;  4C56 C;  1WVL A;  2JE6 I;  2IT1 A;  1BNZ A;  2MJ8 A;  5BN5 A;  4DK1 A;  2D62 A;  1TVX A;  3D4R A;  2B2V A;  2N55 A;  1XXG A;  1STH A;  4ZUI A;  2FMM A;  4KN4 C;  1JQY D;  4OL7 A;  2KOL A;  1F9P A;  1O7L A;  3X3M A;  1NAP A;  1L0Y B;  1ENF A;  5CV6 A;  1EU4 A;  5I6Y A;  4JK1 C;  1SE2 A;  2F0S A;  3HOU B;  1IKM A;  1SMY D;  4XXE A;  3H91 A;  1F77 A;  3G7L A;  1I6V C;  4KKS A;  1ILQ A;  1G8Z D;  3RMH A;  2K5Q A;  2G9H D;  1UNS A;  3I91 A;  4FF4 A;  2A69 C;  2A73 B;  3HEJ A;  4HCE A;  2JP1 A;  1QNK A;  2F0E A;  4JBW A;  5EQ0 A;  1BXT A;  2WII B;  5EBD A;  1EWH A;  4A3D B;  2NWG A;  2NVQ B;  4MHE A;  3SVM A;  3S2D B;  2MUY A;  3W3A A;  2E2I B;  1YNN D;  1PFN A;  5LL6 X;  1TWG B;  4U67 3;  1HXY D;  4XYO A;  4FXD A;  1JR0 D;  2NYZ D;  1QIL A;  2OF1 A;  4A3I B;  4DU9 A;  3DUZ A;  4B9W A;  2HDL A;  2F0L A;  4H13 C;  1B1Z A;  4DNR B;  5FO9 B;  1DJR D;  3QG1 A;  4Y7N B;  3GO5 A;  1F2Y A;  5FKA C;  3EJI A;  4C3I G;  4RKL A;  4L63 B;  2NB0 A;  1CZG A;  1ZEQ X;  2DY7 A;  2PW5 A;  2QIL A;  1HFG A;  2BOS A;  2WP8 J;  3LWU A;  3VR6 A;  2IW3 A;  4RAU C;  4UDU C;  3IL8 A;  1HTL D;  3V2T A;  3JAM E;  3FVQ A;  2AWN A;  2RBM A;  1CZW A;  1VF7 A;  3K58 A;  1H9M A;  3TME A;  1RCV D;  1RDP D;  4A3E B;  2RDH A;  2EYL A;  5I9P A;  4EQP A;  2B8F A;  5KEE A;  5KNC A;  5CMD A;  2WB1 B;  4BS9 A;  1OXX K;  2ID0 A;  4RCO A;  3FRP B;  1XTC D;  4BA1 I;  5LHY 1;  3I72 A;  1D6E C;  3T4A C;  1OO9 B;  5A2Q L;  3PMF A;  1Y69 U;  3A7L A;  4F87 A;  4ZKB B;  2EY1 A;  2VB3 X;  3ERQ A;  1CM9 A;  2J4X A;  1H9S B;  2F0Q A;  2XNA C;  2R93 B;  3R2T A;  3WOF A;  5A2Q E;  1HQR D;  1RHP A;  5J1Z A;  4DF7 A;  4PMC A;  1DOL A;  4FO2 A;  1AP0 A;  1SYD A;  1PRT D;  1U4R A;  3P20 A;  3OMG A;  3U9S A;  1Z47 A;  3AMU A;  5EKK A;  2BCO A;  1STE A;  2RSO A;  4FF2 A;  2SNM A;  1U9R A;  2HUG A;  5G3L D;  3TSS A;  2Z4H A;  1A15 A;  2ZXO A;  3FPP A;  2IX0 A;  4N9P A;  3H0G B;  1SE3 A;  3NPP A;  5E4W C;  2E2J B;  2NVX B;  5M5Y B;  2B39 A;  2NTT A;  5IGB A;  1F9S A;  2EXZ A;  2GA4 B;  3I4M B;  4RFB A;  3ITP A;  2ZXR A;  1WTR A;  5C3X A;  4DAV A;  4BA2 I;  4PV1 C;  1PMR A;  4H44 C;  5JEA G;  4XYQ A;  1PZJ D;  4HN7 A;  5KND A;  3K5O A;  2L4N A;  2SEB D;  1MSG A;  3GQB A;  2DN8 A;  3KBG A;  3K59 A;  2KUM A;  1HUN A;  2SOB A;  2O5J C;  3TP6 A;  5I9O A;  1KNA A;  3J80 E;  2B2V C;  3TP7 A;  3G6J B;  3OSO A;  4QF4 A;  4RKB A;  4ZQ3 A;  3HOX B;  4A3G B;  1KDB A;  1SEB D;  5JPM C;  1EZ8 A;  3C46 A;  1EY7 A;  1TY0 A;  3EFX D;  4M8A A;  2JA7 B;  2NTS A;  4A3K B;  1TQO A;  3M7G A;  2BDO A;  3OHX C;  2BE5 C;  5D14 A;  3K7A B;  5I4D A;  1CQF A;  3BYT B;  1VDZ A;  1U4P A;  2KJX A;  2JYO A;  3PIO 3;  4UAI A;  2AQ1 B;  1KLU D;  1HHV A;  2R6G A;  5C4X B;  4A93 B;  1Z7T A;  2IX3 A;  1CA6 A;  1G91 A;  2J7Z A;  2Q8T A;  3HOY B;  1G29 1;  3VR5 A;  5T1G A;  5E4X A;  1LO5 D;  4IUP A;  2WAC A;  2C5C A;  1JOO A;  1MGS A;  3TDQ A;  2F0U A;  3DWP A;  1AFP A;  4RGM A;  4K5V A;  3GV6 A;  3DEO A;  3CKI B;  1EY6 A;  5HGT A;  2K05 A;  4A3J B;  3MA2 B;  4ZYS A;  1C4Q A;  3NP8 A;  1D5X C;  1W6J A;  3URY A;  1Y1W B;  1CHQ D;  2KQ3 A;  2AUJ D;  3E6Z X;  3NSW A;  4WOR A;  2PQE A;  1A6X A;  4TRD A;  4EQO A;  2BDN A;  3MXG A;  3AU7 A;  3NHH A;  3CHB D;  2FHT A;  5BN4 A;  5D65 A;  1LAB A;  3IFT A;  2VB2 X;  5C4H A;  1ENC A;  5FO8 B;  1JOQ A;  4TKO B;  1HCZ A;  3GTG B;  2NBF A;  3PUX A;  5JVH 3;  4BY1 B;  2PZW A;  3Q23 A;  3PO3 B;  5J39 A;  3K5N A;  3I3C A;  1SJH D;  2CW0 D;  3NK9 A;  1HTP A;  3S17 B;  5DNF A;  1JE4 A;  4IN3 A;  4IUQ A;  2F0N A;  3DWA A;  4I65 A;  3VR4 A;  4K14 A;  2OT2 A;  1DON A;  2J0T D;  1SMY C;  1CFM A;  1XX8 A;  2RA4 A;  4DAY A;  2XWJ B;  2Q8I B;  4K8J A;  1NUC A;  2PNR C;  4KY6 A;  3VYU A;  3H6M A;  1SND A;  3DWQ A;  4EGV A;  3C1F A;  4X3K A;  1H9S A;  1R4P B;  2OEO A;  2DNE A;  2QEJ C;  4YIJ A;  4IUN A;  3T56 B;  2E2D C;  4DN4 M;  3R2I A;  1SNO A;  4IQZ A;  1I4G A;  1YNN C;  2D9U A;  5KYI A;  1PDQ A;  1EY5 A;  1PFB A;  4C3I B;  3D6W A;  5C0X J;  1CI3 M;  1V1O A;  1DZ1 A;  3S9W A;  1LTS D;  4HCS A;  2TMP A;  2L0C A;  2IL8 A;  2F3V A;  3U9O A;  1CT1 D;  1STN A;  2RQX A;  1LT3 D;  1Q3L A;  3R3O A;  1TT2 A;  5TSS A;  1NR2 A;  1KDA A;  1TS5 A;  4L6T B;  4BBR B;  2R61 A;  5FLX L;  4J6H A;  3TZD A;  2X69 A;  1CK1 A;  2F03 A;  1UUP A;  4RA8 A;  3K57 A;  1B3A A;  3GD7 A;  3M4O B;  4KK7 A;  3RZO B;  1IW7 D;  1MI2 A;  3DXJ C;  3M7N A;  2YU9 B;  1ESF A;  3VYS A;  4FXG C;  1B50 A;  1QJO A;  1EYA A;  2NVT B;  3L9A X;  3A8J E;  2CHB D;  1KDC A;  3SR1 A;  3QWN A;  1WCM B;  1S5D D;  4BWG B;  4CKC A;  5IGE A;  1WTV A;  1GUT A;  1ZKO A;  3BZD B;  1ET9 A;  4Q0F A;  5M9O A;  3LX0 A;  1I4Q A;  5EPK A;  4F7X A;  2AUK A;  2IWH A;  1GOZ A;  2TSS A;  4OHJ A;  3VR2 A;  1SYC A;  4HSV A;  4K2K A;  1R9T B;  1F2Z A;  5I2X A;  1B53 A;  5ELD A;  3DM1 A;  1S4Z A;  4OO1 G;  1WD0 A;  1K8M A;  3MHB A;  4A3M B;  3S1Q B;  3NWT A;  3GTK B;  3VA5 A;  3TP5 A;  1SYG A;  3QOL A;  4FP5 D;  5IIF A;  1LTT D;  1PRT B;  2E76 C;  4G4K A;  1GXD C;  3OW7 A;  1G6Z A;  1EFI D;  1DYQ A;  5JEA J;  4X3U A;  2K01 A;  3BVG A;  3MFY A;  1D1K A;  3MC0 B;  1PRT C;  2HQE A;  3H09 A;  4K6L A;  1WTW A;  5BN3 A;  1VMC A;  4FYD A;  1E0B A;  1T5X D;  4EVO A;  1AEX A;  3V05 A;  1IYV A;  1TWH B;  2KHS A;  3ND8 A;  3QOJ A;  3C2P A;  3A7A B;  3L3O C;  5M5X B;  4DK0 A;  4RCN A;  1Q90 A;  3OMC A;  2NN6 I;  2RSN A;  1EQT A;  1RKN A;  3MEH A;  1NR4 A;  4K5W A;  3SXH A;  2PMZ B;  2EVB A;  1QG7 A;  4DNT B;  1EWC A;  4TSS A;  3BDC A;  3GTP B;  1M8A A;  1C8C A;  1SDF A;  1DD2 A;  5HUR A;  4XT3 B;  2PO4 A;  2EZV A;  4FXK C;  1BF4 A;  4XQJ A;  1QNU A;  5IT9 L;  3BDO A;  1PYW D;  1V8Q A;  1LTR D;  4HR7 B;  2PZT A;  1JWS D;  4LJZ C;  4V19 0;  3TBI B;  2EJM A;  2M00 A;  2BA1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...