3NUCA

Staphlococcal nuclease, 1-n-propane thiol disulfide to v23c variant
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
135
structure length
134
Chain Sequence
LHKEPATLIKAIDGDTKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords STAPHYLOCOCCAL NUCLEASE
publication title Mobile unnatural amino acid side chains in the core of staphylococcal nuclease.
pubmed rcsb
source organism Staphylococcus aureus
total genus 32
structure length 134
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 1997-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3nucA00
2SNSA 3SK5A 1NSNS 4KY5A 1KDCA 2F0PA 4B9WA 5I9PA 2EYOA 4TRDA 3C1EA 5KEEA 1SYEA 4H7BA 4KV6A 2F0SA 4KTAA 5EKKA 3HEJA 5C3XA 1SYBA 1A2TA 3H6MA 4K8JA 2PW7A 5C4ZA 4WRDA 5J1ZA 4QB4A 2EYMA 3NP8A 3NXWA 3QOJA 5HGTA 3D6CA 2QDBA 4EQOA 1A3TA 3MVVA 3ITPA 3TP5A 3OMCA 3T16A 4DGZA 5KGUA 5I6WA 4K8IA 3EROA 1EQVA 3HZXA 5I9OA 4HMIA 3TP7A 3TMEA 1EY7A 1JOKA 2OF1A 4NKLA 2F0LA 2EY6A 3OMGA 2SNMA 5CV6A 1SNDA 4ZQ3A 3MXPA 3VA5A 3SHLA 4OL7A 3BDCA 3BDLA 4PMCA 2EY1A 1ENAA 2F0DA 5C5LA 3SK4A 3QB3A 4K5XA 4ODGA 4WORA 1TT2A 5CR3A 4DFAA 2F0MA 1A3UA 2RBMA 1KAAA 3E5SA 4HMJA 4QMGA 5CV5A 3NQTA 5CC4A 5IGGA 1EY5A 5C3WA 2O4XA 4KD3A 4PNYA 3PMFA 1EYAA 3RUZA 3OSOA 1SYFA 4HTHA 5DAUA 4F7XA 5KIXA 4KJNA 3TP6A 4LAAA 5KYLA 4KHVA 4KY6A 5HURA 2EYJA 5CV9A 4DF7A 2F0GA 4NMZA 2OXPA 5IGDA 3LX0A 1KDAA 3P75A 2F3VA 4KJOA 1SNMA 1EZ6A 2F0QA 4ME5A 3SK8A 1EY9A 3D4DA 3V2TA 5I6YA 2EYHA 1A3VA 1ENCA 2F3WA 4K2LA 2F0UA 3D8GA 1SNCA 5JOBA 5IGFA 4IZ8A 3EVQA 1SYCA 4MIUA 5J39A 1SNOA 5DEHA 4B9XA 4YIJA 2RDFA 1JOQA 2WACA 3OWFA 4IUNA 5F2DA 4S3SA 1EY4A 2F0JA 5KYIA 5KRUA 1EY0A 4G57A 3TP8A 3S9WA 3P1HA 1F2YA 4IALA 2PW5A 4RKLA 5C4HA 5C5MA 2ENBA 5J22A 4EVOA 2F0EA 4NDXA 2PYKA 4PMBA 4QF4A 3T13A 2F0WA 4K6DA 4ZUIA 3QOLA 2F0VA 5CV8A 3SK6A 1RKNA 1U9RA 1EZ8A 4EQPA 2EYPA 4J1MA 4R8NA 5IGBA 1STGA 4KD4A 4EQNA 5IODA 4E6IA 3MEHA 2NUCA 2KHSA 5EKLA 4NP5A 5CV4A 5E3FA 2KQ3A 2HQEA 4K14A 2F0TA 1F2MA 1IHZA 1KABA 5M9OA 2EYLA 3EJIA 1EYCA 1TQOA 1EYDA 1STHA 1A2UA 1SYDA 1STNA 3NUCA 3MZ5A 2F0IA 4N9TA 4F8MA 2PZUA 1NUCA 3DMUA 1EY8A 2EYFA 4K5VA 5ISRA 5IGEA 3NK9A 2F0KA 2F0NA 1SYGA 4KY7A 2F0HA 5IIFA 5E1FA 1TR5A 4ZUJA 4DU9A 2EXZA 2SOBA 4I65A 2F0FA 2PZWA 4K5WA 3DHQA 4J6HA 3R3OA 2OEOA 4N9PA 4RKBA 5CV7A 1SNQA 5EGTA 1II3A 1SNPA 2EY2A 5C6AA 5JAVA 2PQEA 3U9OA 5IOCA 1F2ZA 5CGKA 1JORA 1STYA 3D4WA 3SXHA 5NUCA 1STAA 2LKVA 2M00A 1STBA 2RKSA 3ERQA 1AEXA 1EY6A 3MHBA 2F0OA 3NHHA 3SR1A 5K5PA 1JOOA 2PZTA 2EY5A 5IGCA 1KDBA 4K2KA 4ID6A 3C1FA
chains in the Genus database with same CATH superfamily
1FVIA 3SK5A 2MFIA 3J81L 1GVPA 4LJZC 1H9RA 1IYUA 4GLVB 4HAEA 3VDYA 5EPKA 1ICFB 2FJ2A 2MUYA 5C0XI 4EQOA 2QDBA 1A3TA 2CCZA 2MP1A 1KAWA 4RFBA 1EIFA 3OMCA 3FMCA 3NQIA 4A3IG 4A3CH 1TWFB 3EROA 3OTOQ 3NSWA 3TMEA 4B3TQ 3D4RA 3I70A 2HDLA 3R2TA 3BJUA 4CJ2C 4NXNQ 1BXTA 4A3JG 4CKCA 4LF4L 3MFYA 4RHSA 2Y0SE 1Q1EA 1S5DD 3SHLA 2RDHA 3KFUA 1K83B 1CSPA 1KRSA 5C3EG 3CPWA 3GD7A 2K5HA 1V1PA 3M4OH 3JC66 4A3MG 4KY6A 4OWWB 1HA6A 2EYJA 3T53B 1IBKQ 3C46A 4RMFA 1AP0A 1DD2A 3CC4A 2F4VL 1SMYD 4QQBX 3SK8A 1PTOB 3D4DA 2DN8A 2JA5H 1YZ6A 2Z8LA 4A3IH 4YIJA 3F2BA 2IX0A 4LF6Q 2WACA 4DV0Q 4BXXG 3A56A 1KD1C 4R4TA 3S9WA 5C0XG 1W3SA 4A3JH 1JB7A 3GTLH 3NE5B 3KF8A 5KNBA 2B2YA 2JXMB 2QF7A 5C3EH 1U9RA 3I4MG 4JI0Q 4J1MA 2Z9HA 4AYBB 3RR5A 1MI2A 3NENA 1NBWA 2L11A 2F0TA 1WTRA 1U5KA 1MSHA 1MHWC 5G3LF 5M5XH 4BWGB 1BVSA 1VQPA 3FP9A 1HHVA 1N36L 1S3OA 3KYHC 4QUFA 1WTXA 4FO2A 3VYRA 5ISRA 2D5DA 2Z0SA 1NMGA 2L5TA 1PH5A 2KHIA 4BXXH 4KN4C 4HEDA 1GXDC 4IURA 2N8NA 5C0XH 3PUVA 1HNWL 1E22A 4LK1C 2FXQA 1BUVT 1D1KA 3KDFB 2Z6KA 4DV5Q 3EBEA 3I4MH 4YWLA 2GVBA 3CQZH 3I2ZA 1PRTC 4IOCA 2R92B 1Q86C 5M5YB 4DNRB 2R93G 4X62L 1VQAA 2G9DA 4K0KL 4IO9A 1E1OA 5HGTA 1M8AA 4JI4L 1X56A 1EQRA 5M3MG 1PFSA 1Q7YC 2E2JB 1I50H 1A15A 3A74A 2F4IA 4JI5L 5A2QL 4B3RL 1GUTA 3H15A 2WFWA 1A62A 1VCIA 1Y1VG 3HOXH 2Z1CA 1LACA 3JAML 1M1KC 4C3JG 3P7JA 3S1QH 1XMOL 4DAVA 3QB3A 4K5XA 2PO4A 5IYDG 1N9WA 3CCVA 1EY5A 1QVGA 4P74A 3KLRA 1HH2P 4B3MQ 1UEBA 2KA7A 2KCMA 3VR3A 4LF8L 2HQLA 2HHHL 3NELA 1S5CD 4GKKQ 2R93H 4GNXC 4WJWA 5IYCG 2FMMA 1EOTA 4CDFC 5E4WC 1U4RA 1EY9A 1PHJA 2WV6D 2VXWA 4C3IB 3BDOA 1JR0D 2HIXA 4N8FA 5JOBA 3D0FA 5M3MH 3PO2G 1VQLA 1EQTA 1R4PB 2JA5B 1PVOA 4JV5Q 4FXDA 3HOYG 1Y1VH 4A3IB 4XXEA 3DM3A 4K6LA 4EVOA 4C3JH 2CH4A 2Y0SB 3I91A 2AUKA 1L1OA 3I73A 4ZUIA 3QOLA 3UDXA 1EU4A 5IYDH 3OTOL 1FD7D 4G7HC 4DR7Q 4NXNL 2MJ8A 4HSVA 4NP5A 2WKDA 5LL6S 3TZDA 3ICEA 3E9IA 3TRZA 3D31A 3ULJA 1X9NA 2B63G 5IYCH 5I4DA 1B44D 1PZJD 1WTHA 2AWNA 3J81c 4OO1H 2IY5B 4L63B 4BBRG 5COYA 1VQJA 5M5XB 2MGSA 4DU9A 4XYOA 4IOAA 2F0FA 1EOVA 1HCZA 3GTQH 3PSIA 1B7YB 5EGTA 4RKBA 1K0SA 1R9TB 4CDEC 4Y7NB 5LMNW 5IOCA 3HOYH 3NBHA 2B2TA 2D0OA 5FLXc 1PH1A 1UE1A 3K7AB 2UU9L 4KLKA 3TS0A 4RGNA 3RMHA 5IGCA 4HR7B 3NWTA 4POGA 1I4PA 1X65A 2WIIB 2BOSA 4Z9CB 2RHSB 1BF4A 3H3VC 1PZKD 4TRDA 1TY0A 3C1EA 2L9HA 4GLAC 2ASBA 2E2DC 4PMWA 2ZXOA 3CQZB 4DPGA 4HSPA 1HQRD 1Q8IA 2B63H 1BDOA 4JBKA 1I4XA 3TP5A 5KGUA 4BBRH 2NVXB 1O7YA 3L0OA 1EQVA 2M2LA 4KHPL 3J7AV 5JVH3 3W1GA 1XWEA 1LYLA 1U4LA 3T1YQ 2E74C 4N8X1 3HOXB 4IUPA 4A3DG 3S1QB 5KNDA 1A3UA 2RBMA 1VQMA 5C4XH 1HTLD 1HNZL 2O4XA 3I56A 4YHHL 3PIP3 2JA7G 2ID0A 2Z4HA 5IT9E 2K5NA 4LAAA 2A1AA 2EYHA 4DV5L 2AMCB 2RA4A 3MXGA 1TY2A 1FJGQ 3GTOH 1GJXA 1TS3A 2NYZD 4IUNA 4OX9Q 4IFDI 4IUVA 1EY0A 3TP8A 2L4NA 2RHQB 5AFWA 4GKJL 2BCOA 2B2YC 2F0EA 1BBUA 4K6DA 4KKTA 4G7ZC 5CV8A 2EYPA 2A74C 3GTGH 1HR0Q 4A3DH 1STGA 3M4PA 1Y1WH 1ILQA 2OT2A 3MEHA 1IW7C 1LV9A 1OXXK 4DKAC 5IWAL 4A76A 3J81j 3PUXA 5CV4A 1I4QA 2JA7H 3GTMB 3HOVH 2LY7A 1HXYD 4X65Q 4HJ7A 4UY8C 5IT9c 1STNA 1SYDA 1MD2D 2D0PA 4BA2I 2EYFA 3URYA 2F0HA 1ML0D 3A5ZB 1NJIC 4XIGS 4B3SQ 4B3ML 4DV1L 2YV5A 5FO8B 1II3A 5FO7B 4GKKL 1A0IA 3D4WA 2XN9C 1STAA 3R8BA 1V1QA 2RKSA 5I2XA 1TS4A 3MHBA 2E2HH 4DAPA 2K14A 3JAMc 3GP7A 2L1BA 4IFDG 1EWCA 4UDUC 3J81i 5I9PA 3S14B 4JW0A 1SYEA 4Q0FA 5EKKA 1X3FA 4IUTA 1PRTB 2FMCA 3Q23A 1BCPD 4IUUA 4JG2A 3PO3B 2I5HA 1CUKA 3CHBD 2JA6B 2JA9A 1S5FD 1QB5D 2QCPX 1EEFD 1RDPD 1WCMB 3MXNA 4QIWE 3U50C 1VQDA 2WAQG 1VQIA 2ZTDA 1RTNA 2CWAA 1JE4A 2K03A 4DR5Q 3J7ZC 3BDLA 3I55A 1L0YB 4DV2Q 4DR6Q 4ODGA 1G6PA 1TWAB 2BH8A 5DNFA 4OIKA 1SE2A 4LMQD 4IFDH 1E24A 1QNUA 3A8KE 5C4XB 1UNSA 1N32Q 3GV3A 2KUMA 2F3VA 1EL0A 2JE6I 4GNXB 1A3VA 1HZAA 1SE8A 1TS2A 3DUZA 1G8ZD 1E2ZA 2L0CA 2NWGA 1FGBD 1VQ8A 2GVAA 1EY4A 3N6RA 3RLNA 5DM63 2KECA 4XYQA 3CMEA 4DR2Q 3GTJH 2KBNA 4EQPA 2J7ZA 3L7ZC 2VS1A 4JI1Q 3WWVA 5IODA 3MA2B 2Q8IB 3ND9A 3S2HB 2K01A 3S1RH 1CA6A 1Y1WB 3T1YL 1H95A 5IP7G 2VUMB 2JA7B 2WB1G 2R7FA 3DMUA 3HOVB 4K5VA 3KOJA 2SOBA 1XXGA 1KNAA 3MC0B 3CAMA 1H9SA 1EWIA 4CKEA 3IKJA 4J15A 4IPGA 2LS01 1L0XB 3VR6A 3ERQA 3HP3A 2PCFB 2K32A 1NTGA 2A5HA 3AB9A 4PV1C 4GZYC 3T4AC 3DEOA 4RAUC 5IY0A 4DUZL 1IBLQ 2YTVA 3C1FA 3M3YB 2E2HB 2EYOA 2I0QA 2B3GA 3Q6SA 4AH6A 3HRZC 5IP7H 4ZRZA 1XNQQ 2K5VA 3LWEA 4A3EB 1F9SA 4B08A 5BR8Q 4DAMA 3AFQA 1YVCA 5GAHC 2F4VQ 1PV4A 5JPMC 2A19A 1Q46A 3K80C 3JAMi 5M3FB 4X65L 1PYWD 5TSSA 1OO9B 1B70B 2DGYA 3TBIB 5AJ3L 3A8JE 3PUZA 4GOPC 1KAAA 5FLMG 1BCPF 1V1PB 4B3SL 2QGQA 2HD3A 3S17B 2DY8A 2AHOB 5ELNA 5KYLA 3S2DH 1H9JA 5HURA 5GAEC 5CV9A 1VDZA 2F0GA 1MBYA 1KDAA 5I6YA 4ME5A 4PZ6A 2JA8G 2KOLA 3KBGA 4X6AH 3D8GA 2LXJA 3D6WA 3C3LA 1N33L 4GN5A 4XT1B 1JOQA 4OONA 4RHRA 4S3SA 4TKOB 1DONA 4QIWB 1N36Q 2N55A 3S1NB 4IALA 4DNIA 3L9AX 1Q8KA 3NWSA 4X3SA 2NZOA 4JC0A 1X3QA 4CJ1B 2JEAI 5FLMH 2NN6G 3E0JA 5E7NA 3A0JA 1GD7A 3ZJYC 3HOUG 1MGSA 3EIVA 3M4YA 4DV2L 2F0IA 3PIPA 4QCLA 1SMYC 3STBC 1S5ED 1PTOD 2JA8H 1PZID 2CW0C 2F0KA 4LNQA 1X55A 1WYDA 2EXZA 3VYUA 4UP7A 2ZJRA 4R4OA 4K0KQ 5C4JB 4TSSA 1PXUA 2R7ZB 2IJ0A 3U9OA 4JI4Q 1N32L 3K0YA 1QZHA 4JI5Q 3HOZH 1TWCH 4BY7G 4DR4L 2JP1A 4YWMA 1N34L 1LO5D 4C3HB 2WKCA 2N49A 2Q2UA 2KCTA 5C44G 1MSGA 1GO3E 3I8ZA 2OCEA 2NZHA 4FF1A 1DM0B 3R2IA 5C4ZA 1ZYRD 1Q3LA 4HIDA 3T51B 1OXSC 4DGZA 5JVG3 1JC7A 4JI1L 4LF8Q 3VR5A 2HHHQ 3HOWB 3A8IE 1JOKA 2B2VC 2OF1A 3MWYW 3U9SA 3S15H 3GDEA 3CW2C 3K81C 1S5BD 5CV6A 2Q8RE 1SNDA 2PMZE 2IWHA 3SEBA 1WTPA 1L2FA 3F8TA 3SK4A 4UPAA 4BY7H 3LGJA 4LWCA 1C9OA 5KIXA 2NTTA 4JBWA 1P8LA 1M90C 1EQQA 1VMPA 1DGSA 4A3FB 1EZ6A 1L0WA 3ERSX 2NVTB 2CQAA 4A4IA 1X54A 3Q0AA 5IGFA 1IBLL 4DK3C 1CZWA 4B9XA 2K04A 2RDFA 3N52A 5D65A 3S16B 5F2DA 1I3QB 1SROA 1K8AC 4ZCKA 2R3ZA 1RODA 4RKLA 1J5EL 5C5MA 1BO0A 1QZGA 4JI7L 1XNQL 1YBYA 4JBJA 1KIXA 4R4CA 1GHKA 5BR8L 4R8NA 4KD4A 4R9WA 2A6HC 1B3QA 2EOTA 2UU9Q 1HRJA 1KABA 1IHZA 2NZ1D 1BOSA 1YJWA 5ELCA 4O0AA 1ILPA 3I3CA 3CP0A 4N9TA 3AFPA 3RLOA 3HKZB 3KF6B 1TR5A 3I90A 1I6HH 2ZXPA 4XT3B 4K5WA 2JA8B 1FNUA 4N9PA 1IKMA 5C6AA 2ZXRA 2YU9H 1JORA 4ZKBB 2K33A 5T1IA 3SXHA 2WP8J 3NBHB 3NHHA 4KHPQ 2ICEC 2XIWA 1PA6A 2PZTA 2X69A 3OIQA 1UUPA 2CWPA 3IL8A 3HOZB 4A3MH 5EKLA 4A3KG 1SAPA 3OWEB 1PTOF 4KV6A 4GLXA 4K8JA 1CKNA 2QDLA 2UXBL 3NP8A 1HNZQ 1QG7A 4YHHQ 3I4NB 1AH9A 2IHEA 1B53A 3GTPB 3UDGA 1Y8PB 4HMIA 1WTQA 4HIMA 1X32A 4JBMA 1YITA 4O2DA 2YTYA 2F3IA 3QR8A 1T5XD 4PMCA 3ULPA 3S1MH 2NVQB 3DWQA 5IP9G 3Q8DA 4DNTB 4JI6Q 3A5UA 1Q82C 2PQAB 3CRKC 4V0BA 3M9BA 4GKJQ 4GOPB 1K3RA 4A3KH 1PYSB 1GUSA 2AWOA 5JEAG 5FOBB 4KKSA 1VQ9A 1VQOA 2E5LQ 4KJOA 4CBVA 4RGMA 3TZUA 1Z47A 2OTJA 5IWAQ 4K2LA 1YEZA 2NVYH 4ZYSA 2ZTEA 4MIUA 2N88A 3VYTA 2KEDA 5KRUA 1JE5A 4QJFA 2A73B 1XTCD 4G57A 2DY7A 1WI5A 3KK7A 1U4PA 3W2DA 2PMZB 2LXKA 2DNEA 2AQ1B 1K8GA 4DV1Q 2ICIA 1PFBA 4H44C 4PZ7A 1B2TA 2BA1A 3J81E 3M4OB 1FNWA 3KLWA 5JEAH 1F2MA 1AE2A 3GQBA 4DV4L 1EYCA 1SBBB 1TQOA 1A2UA 4IN3A 5JJLA 2A6ED 2KVMA 1JB3A 2JEBI 1PFNA 3TSSA 1BKBA 4FDBA 4FNFA 1Q12A 3K8AA 1SRUA 2UUCQ 5IGEA 5FLXE 5IIFA 1LTSD 1LTLA 2VZAA 4J6HA 3W5OA 2PQEA 4A3JB 3GTLB 1LT4D 2R61A 1I4GA 5NUCA 1AN8A 2B2UA 5C3EB 1Y14B 4FVMA 1V9PA 1DZ1A 2I46A 4JVZA 3H09A 1CTMA 1KDCA 1Y8OB 1VQCA 4DXGA 2FINB 4XTCS 4A3MB 1QE6A 2ZM6L 3GTKH 3PO2H 4C1NK 2OQKA 1NMFA 3MVVA 2A69C 3PF5A 5I6WA 1D6EC 1FYCA 5D14A 3J7A5 1GOZA 3AMUA 4LFAQ 4DR1Q 5GQOA 3MXPA 5DLQE 5BN5A 4IJHA 4OL7A 5CBEE 4R1JA 3TEHB 2F0DA 5C5LA 1LTAD 1A6XA 3F2CA 3I4MB 2V4DA 3P20A 1LUZA 4C56C 1ESRA 1I4HA 5KNCA 3RUZA 2MO1A 3H91A 3PMFA 5LL6X 3K0XA 4KJNA 3M4QA 4LF7L 1LTRD 3SDZA 4IPDA 3Q22A 1JT8A 3LX0A 1WVLA 1I50B 1TIID 3SVMA 3ZYYX 1QNKA 2QA4A 5ELFA 1PMRA 4U673 4JYAL 1F2YA 2IPKD 4JOIA 4QF4A 4QGUA 5EQ0A 1GM5A 1QUQA 4DXFA 4BY1G 3KLSX 1RKNA 4ALPA 4DV6Q 3KDFA 4O1NA 5ELOA 2J0TD 2L15A 3UDFA 2R93B 2C35B 1EEID 1P16A 4DUZQ 4F8MA 1IL2A 1CKOA 1DOMA 1QVFA 4DK1A 4JI6L 5M3MB 3BZCA 1ET9A 3CCLA 2B39A 1O7ZA 3JAME 2F52A 1Y1VB 1Y69U 5CGKA 1M4VA 4C3JB 1BR9A 1UAPA 2E5LL 2M00A 5D3IB 1EY6A 3M7GA 4BY1H 1KDBA 2N3SA 1Y8NB 4NKLA 1RIPA 4EGVA 2SNSA 4KY5A 1A63A 2CKZB 5KEEA 4OHJA 4OWXB 5AJ3Q 2MO0A 1B9MA 3HEJA 4EX5A 5C3XA 1IBMQ 3X3MA 2K4KA 5C0XJ 2BDNA 2JSOA 5J1ZA 1YJNA 5FJ8G 3KJPA 2LFNA 1V1OA 4YY3Q 1UE7A 3T16A 3K5LA 4GN3B 3OPOA 3PO2B 5I9OA 1YNJD 3GTQB 1EY7A 2VQEL 4C1NI 1JCKB 1J8IA 1C8CA 4DUYL 2Z6KC 1O78A 3HOYB 3EA6A 5L37A 1VQFA 2WINB 1DYQA 1C48A 5ELBA 3I4LA 1YNNC 2HDMA 2DJFC 1N33Q 4TQUS 1PYBA 2UUCL 4AQYQ 3TREA 5CR3A 2CQOA 3GV6A 3NBIA 2IX3A 5IGGA 4A3GG 2BDOA 1E3PA 1IKLA 1I4RA 1EYAA 1TS5A 4F7XA 4NXML 3FPUB 1V43A 3RNUA 1D5XC 1CQVA 4BBSG 1KXLA 1ENFA 1YIJA 1SE4A 4G4KA 2B63B 3J7AF 5FJ8H 4X64Q 4BBRB 3NPPA 4IUQA 2QEXA 3K5MA 5J39A 2WAQE 1SNOA 1VQ5A 3OWFA 2F0JA 4UP8A 3H0GG 2IT1A 1EFID 4ZAIA 4NB3A 3G6EA 3A55A 5LMNL 3HFZB 3CRLC 3DEPA 2E76C 1T5EA 2A68D 2NB0A 4A3GH 5J3BA 1XJVA 2HCIA 2Q8TA 2F1MA 4A93G 4OEMB 4LFAL 4DR1L 2B2WA 4I7ZC 4DR4Q 3EJIA 1N34Q 1STHA 3MZ5A 4BBSH 1TWGH 4DA2A 2V1CC 3J80L 1KRTA 3A7AB 1EFWA 4DK0A 3GTOB 4ULLA 1U0LA 1L1OC 3DHQA 3R3OA 2VL6A 1SNQA 2C9OA 3RD4A 3MFGA 3H0GH 2EXDA 5LMUL 1DJRD 4DAYB 1EWHA 1ET6A 2LKVA 4DN4M 4L5RC 1JWSD 3SR1A 1Q81C 4A3BG 1E0BA 3GTGB 4A3DB 4K2KA 1ZKOA 2XNAC 4DK6C 2X6GA 5E4XA 3OW7A 4HJ8A 1K0RA 1NSNS 2ZTCA 1FL0A 3MTSA 4ZKCB 3H6MA 2PW7A 2WB1E 1D5MC 1NCVA 3HG9A 2M9VA 3CCUA 1QJOA 4DV6L 2PI2A 2B2TC 4BA1I 2VQFQ 5EAYA 3OMGA 4FF2A 1J9OA 1SXTA 3FKIG 1KLGD 1EIHA 1CM9A 2UXCQ 1TT2A 4CDDC 3UE0A 4A3BH 4HCSA 4HMJA 5CV5A 2N78A 1J5EQ 3K5OA 4HTHA 1SYFA 5DAUA 4JI7Q 1MKHA 3AU7A 4DV3L 5CORA 1SMXA 2OXPA 3E6ZX 4HIOA 1ASZA 3V2TA 1ZEQX 3QO2A 1ZYRC 1SLJA 1JJCB 4POFA 2Z4IA 1BCPB 1HJPA 4LFCL 2H4OA 2PPBC 4IZ8A 3G48A 2NN6I 1HZ9A 2I5MX 1CKMA 2B8GA 2JK8A 5C4HA 2PW5A 1BBWA 1IBML 4OELB 4ABNA 3BYTB 1D2BA 4U68A 1VF7A 4YY3L 3I72A 5IGBA 1VQEA 2KEEA 3F2DA 1RJTA 1CSQA 2A8VA 1B50A 4AIMA 4AQYL 3Q24A 3K7UC 5M5WH 3BZKA 4JI2L 1GUOA 4LUOA 2WAQB 1A8VA 2UXBQ 1QVCA 1E7ZA 3KF8B 5ELDA 2K5WA 3C2PA 1LM0A 1FNVA 2Z6BA 3CCRA 1GHJA 2FHTA 1K83H 3GTJB 5GAGC 1STEA 4X64L 1JOOA 5K36G 4Q5VA 3PUWA 1SDFA 1KL9A 4AYBG 1YJ9A 2K6AA 1UE6A 3IRBA 3S1RB 3ND8A 2F0SA 4KTAA 3DXJC 4QB4A 5LHY1 1DOKA 1U4MA 1K73C 3QOJA 1F9PA 1PTOH 4X3TA 2QILA 1F9RA 4K8IA 1XNRL 4GNXA 3J7YW 1NNXA 3WOFA 1KC8C 2SNMA 2JYOA 1PH9A 3ONAB 2L55A 2E2IH 3BDCA 2EY1A 1ENAA 1DOLA 4LFBQ 1LABA 2MHVA 4WORA 3HKSA 4XQNA 2RSNA 2LMCB 2NN6H 5K36H 2K05A 3HOUH 2R92G 3OSOA 4KKUA 1VQBA 1WTOA 2AKWB 3IFTA 4P72A 4KN7C 2RQXA 4UAIA 1G91A 1B9NA 2D2CC 1SNMA 2RCNA 1TVXA 1CA5A 2WB1B 2B8FA 2IHFA 3TDQA 4DV4Q 4IFDJ 4A3CG 3ER0A 3J80c 3OYYA 1ZXTA 1OXTA 3KUPA 2XWBB 3OHXC 1WTVA 2VB2X 1XMQL 2IW3A 1WTWA 5C44H 3BYYB 1EYGA 4WJ4A 5CYUA 2F03A 1EZ8A 3LNNA 2BE5D 1LT6D 1BNZA 4LF5Q 1D8LA 3V05A 1EUJA 2VQFL 1MJCA 5E3FA 2KQ3A 1SFOH 2HQEA 2R92H 4LUZA 5M5YH 3S2DB 1VQGA 1S72A 3DM1A 5HGQA 2UXCL 4C3IG 5JJIA 3NK9A 4CJ0B 4LF9Q 4L6TB 2E2JH 1S40A 4I65A 2RSOA 2JA5G 3KLSA 2ZM6Q 5M5WB 4ILWA 4P2CB 1LTBD 1L1OB 1O7IA 5FLXL 2Y0SG 3VR4A 1YHAA 2EDGA 4MTNA 1GUGA 4ZLTF 1JICA 3U4ZA 1B4OA 3HGBA 4MNOA 1HNXL 3KJOA 3UE1A 3NXWA 2NBFA 4MN3A 2A6EC 3CCQA 3TS2A 4XQQA 1LT5D 4C3IH 4LF7Q 1OXVA 3STBD 3TP7A 1D1IA 4APVA 2CW0D 4FF3A 1JJ2A 2UXDQ 2F0LA 1D7QA 3CC7A 3HS0C 4H13C 3SGIA 4KI0A 1ASYA 3G7LA 3VA5A 1TWCB 1X3GA 1LTTD 3KBXA 5EKIA 2E2IB 4MHEA 4HIKA 1Z9FA 1SE3A 3TQYA 4JYAQ 1CZGA 3TP6A 4KHVA 2EJGC 3CC2A 1AZQA 3HOUB 2IX1A 1KTKA 4QY7A 4JCVE 1VQ7A 1G6ZA 1NR4A 3ULLA 2XWJB 1SEBD 5EBDA 5I2YA 1SNCA 2ALYB 1SYCA 2GA4B 1RHPA 4R4IA 3S15B 3A54A 4Y52H 4IQZA 5IYBG 1RTOA 3G71A 2KJXA 3CPFA 1R9TH 1WD1A 3P1HA 4RH6A 4Y7NH 2VB3X 4L5QA 3QIAA 3HOXG 3FDTA 3K7AH 1C0AA 3BG3A 1OTCA 4BY7B 1QUQB 4DV7Q 1N8RC 1O80A 4EQNA 2EJFC 4WJ3M 3L3OC 4JI3Q 5C44B 1TXYA 2NUCA 1YHBA 4HN7A 4OO1I 2EPBA 5M9OA 2K7VA 3EQLC 5IT9L 2O5IC 4LFBL 1DXMA 3E9HA 1NE3A 1SFOB 2DJGC 4R4QA 4XQJA 2QEJC 3J80i 5GROA 2XGTA 1SYGA 4RGTA 2PI2E 1LTID 2NVXH 4YCWA 1YI2A 3NTKA 4OWTB 3SE0A 5IYBH 5IP9H 1E2VA 1XPUA 2EQSA 1RD9D 1IZ6A 2F0OA 4UP9A 5K5PA 2VQEQ 2EY5A 2XRSD 3E3XA 3PIOA 4DUYQ 3MXUA 2KCNA 2EIFA 4KK7A 4H7BA 2A6HD 3FVQA 2SDFA 4L8JA 4JK1C 3IAYA 1MIUA 2EYMA 3IFDA 2TMPA 3EN2A 2H5XA 3RN2A 4NXMQ 2E8GA 2CH4W 4LF5L 3HZXA 1I6HB 4OO1G 4LUVA 3PF4A 2YU9B 2UUBQ 1HZBA 4M1UB 4YWKA 1Z6HA 3NTIA 1HFNA 1SN8A 1LLRD 2KENA 3R93A 2E75C 4LF9L 1HZCA 4PNYA 1S4ZA 1W6KA 1HFGA 5LMNQ 1UWVA 3GTMH 1WFQA 4KHZA 3PO3G 3I7FA 4B3TL 3O13A 4YCUA 3MXNB 3BVGA 4X66Q 2JA6G 2F3WA 5EJWA 1X6OA 1X3PA 1WCMG 3EVQA 3OIPA 1YNJC 3KF6A 3I4OA 3TN2A 4RG1A 2VW9A 1NAPA 4IPCA 2VNUD 4NW2A 2K52A 1SR3A 1IYVA 4CHTB 3S1MB 1D5ZC 5T1GA 2XSCA 2F0VA 1IBKL 2YYZA 1PH4A 5LMUQ 1K3BC 1PRTD 4A3KB 3K59A 5FKAC 2UXDL 1BCPC 3S14H 5C4XG 3W1BA 3CCMA 3CCJA 3UI2A 4LF6L 4DV0L 4F87A 3PO3H 2CVRA 2PZUA 2NVYB 1EY8A 3CXCA 2JA6H 1VQKA 4JI8Q 3NEMA 1K28A 4X3KA 1WCMH 3BVZA 3QG1A 4L5TA 2OWOA 3K6OA 4JI0L 1O7LA 2ZT9C 4P73A 3H3VI 3BVMA 2K1BA 4NPSA 4C2MH 3M85A 3RZDH 1TWAH 2OQ0A 2A68C 2HUGA 4G7OC 4ID6A 2NTSA 1XPRA 3VYSA 1SJED 2F0PA 4B9WA 2PQAA 1Y1WG 3AQQA 4GOPA 5A2QE 1A2TA 2DNCA 1XPOA 2VUMG 4RGOS 3HOVG 1KHIA 2EVBA 2EE1A 5JPNC 4DV3Q 4DV7L 1AE3A 1H9SB 4JI3L 4UHVA 1F2LA 1LTGD 5EPJA 1FR3A 4ZQ3A 1XTDA 4A3LG 4LFCQ 4HCEA 1T9HA 4IJLA 1RF2D 3FRPB 4X3UA 4OXPA 4QMGA 5CC4A 5C3WA 1PH7A 1CFMA 1H9MA 2UUAQ 1VF5C 1CQFA 2XTIA 3S2HH 2BA0A 4MZ9A 1NY4A 3CU7A 3GTKB 3P75A 1HR0W 2ES2A 3S24A 2VUMH 1ENCA 3AEVA 2F0UA 4A3EG 3D3RA 2H1EA 1PFMA 3FEWX 4GS3A 1G291 5DEHA 4DR3Q 4MTKA 2A69D 2R6GA 5IE8A 5KYIA 5M3FG 3RZOH 4CGYB 1ICWA 4A3LH 2X6LA 2BH2A 3H94A 4NDXA 2PYKA 1YNXA 4JI2Q 2F0WA 4FXGC 3SK6A 2D62A 2YTXA 5DM73 2CHBD 1PH6A 2VY3A 1JWUD 2G9HD 4P71A 3M3YH 3QJYA 2UUBL 2K5QA 1MJEA 3H3VH 2EYLA 1PH2A 1EYDA 2K5DA 1E1TA 1GUNA 4ZK9B 3NUCA 3M7NA 4JV5L 1GUWA 1NUCA 3B6YA 2XVSA 4KMUC 2F0NA 1IXRA 4A3EH 2EZVA 1VMCA 2PZWA 1I94Q 1DCZA 3K57A 3DWAA 3PGZA 2EY2A 5JEAJ 5M3FH 2B29A 2O5JC 4DR7L 4J8QA 1PRTF 1XNRQ 4X66L 2B2VA 2QW7A 1AEXA 1UEAB 4RCNA 4EQ5A 5CBAE 3CCSA 3VA7A 4C2MB 3CF5A 3RZDB 4M8AA 3S17H 1VS0A 3PUYA 3BZDB 3K58A 4XDXA 1EIGA 1TKWB 1HA5A 2Q2IA 4CKBA 5FO9B 3MAQA 4I7AA 1G51A 4RCOA 4FXKC 1W2BA 1UE5A 1VQHA 4O42A 2PNRC 1GKHA 2B2UC 2EY6A 3PV0A 2R7ZG 3K5NA 3S1NH 3T1HQ 1JQYD 1K9MC 2RVLA 1IYJB 3RN5A 2ATWA 2I07B 4RA8A 2G5DA 2LSSA 2DUDA 1WOCA 4DFAA 4C3HG 1G2SA 4BY1B 4A93H 2F0MA 1R4QB 4JI8L 2I5LX 3DLLA 1G2TA 4JPBW 1IW7D 2GN5A 3G4SA 5ELEA 1Q1BA 4WFN3 1HPCA 2AQ3B 2P5ZX 1XMQQ 5D3DA 1TWHH 4LW1A 1PH8A 1WJJA 1HUNA 1B3AA 1JWMD 1PTOC 4F88A 1EIYB 4NMZA 2JN4A 3CCEA 2HT1A 2JQOA 1SSOA 1K8MA 2F0QA 4TVAB 2QKIC 4HJ5A 4HJAA 1AFPA 1CHPD 3HOWG 4GN4B 1OXUA 1PH3A 3UDIA 2XRQD 5JJKA 1PDQA 4FF4A 1KLUD 1X3EA 5FK9C 5C4JH 1JMCA 1J6QA 2IL8A 3AYHB 4CDCC 2R7ZH 1QCBD 1TU2B 2EJMA 2ENBA 5BN4A 3T13A 2RF4A 3RZOB 1JJGA 1HUMA 2AUJD 2Q2TA 1YNND 4C3HH 1ESFA 3V96A 1RL2A 2K28A 2O2LD 3DWPA 1NR2A 1AW7A 4K14A 1FJGL 4LF4Q 1F77A 1CT1D 4A3FG 4QL5A 1IL8A 4OX9L 1Q90A 4PZ8A 3X3NA 4KY7A 3PIO3 2CFMA 4ZUJA 1HNXQ 3OOCA 3HOWH 2Q2HA 4JOIC 2C5CA 2K50A 2KCCA 1CI3M 2UUAL 5HY6A 5JAVA 3FKIH 4BS9A 1HR0L 1F2ZA 2ZJPA 4A75A 2R7DA 1VQNA 2TSSA 3F1ZA 1STBA 1C4QA 2ZJQA 5EPLA 4A3GB 1QOHA 4FYDA 2BE5C 4DR3L 2HCCA 3CD6A 4H02A 5JJZA 3L2PA 2JJQA 1B8AA 1SYBA 1VQ4A 1V8QA 3QWNA 4H0LC 4WRDA 1TWFH 3W3AA 4BBSB 4A3FH 2FFKB 1TWGB 3A7LA 1YHQA 3LWUA 3D6CA 4P75A 2NVTH 1F9QA 3HKZG 3ITPA 3WOEA 3BS1A 3T56B 3PQIA 1WD0A 2PNHA 2K75A 3HKZE 1PLFA 3S16H 4RWSC 2MNAA 1Z7TA 1I5FA 1HTPA 1I3QH 1ONLA 5A35A 3H0GB 1AZPA 1K8OA 2RCFA 3WDNA 1I6VC 5CMDA 3RLFA 2AQ2B 1CK1A 1KNEA 4AYBE 3E5SA 4QUCA 3CKIB 3NTHA 3NQTA 3HOZG 5BN3A 2OTLA 3MEFA 5GADC 1BQQT 4KD3A 4YCVA 1I94L 4A93B 2D9UA 1CHQD 1CKNB 4FP5D 4DF7A 3BU2A 1XYIA 5IGDA 3FPPA 2RDGA 1HNWQ 1TWHB 3J80E 3CMAA 3I4NG 4V190 3E0EA 1QILA 4DR5L 1QWYA 1SJHD 5G3LD 5H1SE 4DR6L 3F2UA 1W6JA 3U58A 3OW2A 1B1ZA 4X62Q 1FGUA 5J22A 3GO5A 4PMBA 1C7YA 2J4XA 4DAYA 4A3BB 4E6IA 1VQ6A 4B3RQ 2KHSA 1LT3D 1H9KA 4OGQC 3T1HL 4IPHA 1XMOQ 1EU3A 3I4NH 1BBXC 4L5SA 4ME3A 2L12A 5E1FA 1HQMC 4DR2L 3GTPH 5EBCA 3G6JB 3EFXD 4R8IA 4HJ9A 2KHJA 2OEOA 5CV7A 1KQSA 1XX8A 1SNPA 4OIJA 1STYA 4PG3A 3FHWA 2SEBD 3PCOB 1E2WA 3FKIB 2NVQH 1RCVD 3U4VA 2B2WC 2HIVA 2MQHA 2MPMA 3VR2A 4PQXA
chains in the Genus database with same CATH topology
3SK5A 3J81L 4LJZC 1H9RA 1IYUA 4HAEA 5EPKA 2FJ2A 2MUYA 5C0XI 4EQOA 2QDBA 1A3TA 2MP1A 4RFBA 3OMCA 3FMCA 3NQIA 1TWFB 3EROA 3NSWA 3TMEA 3D4RA 3I70A 2HDLA 3R2TA 4CJ2C 1BXTA 4CKCA 3MFYA 4RHSA 1Q1EA 1S5DD 3SHLA 2RDHA 1K83B 3GD7A 1V1PA 1HA6A 4KY6A 2EYJA 3T53B 3C46A 1AP0A 1DD2A 1SMYD 3SK8A 1PTOB 3D4DA 2DN8A 2Z8LA 4YIJA 2IX0A 2WACA 3A56A 3S9WA 5C0XG 3NE5B 3KF8A 5KNBA 2B2YA 2JXMB 2QF7A 1U9RA 4J1MA 4AYBB 1MI2A 2L11A 2F0TA 1WTRA 1MSHA 5G3LF 4BWGB 1HHVA 4QUFA 1WTXA 4FO2A 3VYRA 5ISRA 2D5DA 2L5TA 4KN4C 4HEDA 1GXDC 4IURA 5C0XH 3PUVA 4LK1C 1BUVT 1D1KA 1PRTC 2R92B 5M5YB 4DNRB 2G9DA 5HGTA 1M8AA 2E2JB 1A15A 2F4IA 5A2QL 1GUTA 1VCIA 2Z1CA 1LACA 3JAML 4C3JG 3P7JA 4DAVA 3QB3A 4K5XA 2PO4A 1EY5A 3KLRA 2KA7A 3VR3A 1S5CD 4WJWA 2FMMA 1EOTA 5E4WC 1U4RA 1EY9A 2WV6D 2VXWA 4C3IB 3BDOA 1JR0D 5JOBA 1EQTA 1R4PB 2JA5B 4FXDA 4A3IB 4XXEA 4K6LA 4EVOA 2Y0SB 3I91A 2AUKA 3I73A 4ZUIA 3QOLA 1EU4A 1FD7D 4G7HC 2MJ8A 4HSVA 4NP5A 2WKDA 5LL6S 3TZDA 3D31A 5I4DA 1B44D 1PZJD 2AWNA 4OO1H 4L63B 5COYA 5M5XB 2MGSA 4DU9A 4XYOA 2F0FA 1HCZA 5EGTA 4RKBA 1R9TB 4Y7NB 5IOCA 3NBHA 2B2TA 3K7AB 4RGNA 3RMHA 5IGCA 4HR7B 3NWTA 1I4PA 2WIIB 4Z9CB 2BOSA 1BF4A 3H3VC 1PZKD 4TRDA 1TY0A 3C1EA 2L9HA 2E2DC 4PMWA 2ZXOA 3CQZB 4HSPA 1HQRD 1Q8IA 1BDOA 1I4XA 3TP5A 5KGUA 2NVXB 1O7YA 1EQVA 2M2LA 3J7AV 5JVH3 1XWEA 1U4LA 2E74C 3HOXB 4IUPA 3S1QB 5KNDA 1A3UA 2RBMA 1HTLD 2O4XA 3PIP3 2ID0A 2Z4HA 5IT9E 4LAAA 2EYHA 2RA4A 3MXGA 1TY2A 1GJXA 1TS3A 2NYZD 4IUNA 4IFDI 4IUVA 1EY0A 3TP8A 2L4NA 5AFWA 2BCOA 2B2YC 2F0EA 4K6DA 4KKTA 4G7ZC 5CV8A 2EYPA 2A74C 1STGA 1ILQA 2OT2A 3MEHA 1IW7C 1LV9A 1OXXK 3PUXA 5CV4A 1I4QA 3GTMB 2LY7A 1HXYD 1STNA 1SYDA 1MD2D 4BA2I 2EYFA 3URYA 2F0HA 1ML0D 4XIGS 5FO8B 1II3A 5FO7B 3D4WA 2XN9C 1STAA 3R8BA 2RKSA 5I2XA 1TS4A 3MHBA 4DAPA 3GP7A 2L1BA 4IFDG 1EWCA 4UDUC 3S14B 5I9PA 1SYEA 4Q0FA 5EKKA 4IUTA 1PRTB 2FMCA 3Q23A 1BCPD 4IUUA 3PO3B 3CHBD 2JA6B 1S5FD 1QB5D 2QCPX 1EEFD 1RDPD 1WCMB 3MXNA 1RTNA 1JE4A 2K03A 3BDLA 1L0YB 4ODGA 1TWAB 5DNFA 4OIKA 1SE2A 4LMQD 4IFDH 1QNUA 3A8KE 5C4XB 1UNSA 3GV3A 2KUMA 2F3VA 1EL0A 2JE6I 1A3VA 1TS2A 1G8ZD 3DUZA 1E2ZA 2L0CA 2NWGA 1FGBD 3N6RA 1EY4A 5DM63 2KECA 4XYQA 4EQPA 2J7ZA 3L7ZC 5IODA 3MA2B 2Q8IB 3ND9A 3S2HB 2K01A 1CA6A 1Y1WB 2VUMB 2JA7B 3DMUA 3HOVB 4K5VA 2SOBA 1XXGA 1KNAA 3MC0B 1H9SA 4CKEA 3IKJA 2LS01 1L0XB 3VR6A 3ERQA 3HP3A 2PCFB 2K32A 2A5HA 3AB9A 4PV1C 4GZYC 3T4AC 4RAUC 3DEOA 3C1FA 3M3YB 2E2HB 2EYOA 3Q6SA 3HRZC 4ZRZA 3LWEA 4A3EB 1F9SA 4B08A 5JPMC 5M3FB 1PYWD 5TSSA 1OO9B 3TBIB 3A8JE 3PUZA 1KAAA 1BCPF 1V1PB 3S17B 2DY8A 5KYLA 1H9JA 5HURA 5CV9A 1VDZA 2F0GA 1MBYA 1KDAA 5I6YA 4ME5A 2KOLA 3KBGA 3D8GA 3D6WA 3C3LA 4XT1B 1JOQA 4RHRA 4S3SA 4TKOB 1DONA 4QIWB 2N55A 3S1NB 4IALA 3L9AX 4X3SA 3NWSA 1X3QA 4CJ1B 2JEAI 2NN6G 3E0JA 1MGSA 3M4YA 2F0IA 4QCLA 1SMYC 1S5ED 1PTOD 1PZID 2CW0C 2F0KA 2EXZA 3VYUA 5C4JB 4TSSA 1PXUA 2R7ZB 2IJ0A 3U9OA 3K0YA 2JP1A 1LO5D 4C3HB 2WKCA 1MSGA 3I8ZA 4FF1A 1DM0B 3R2IA 5C4ZA 1ZYRD 1Q3LA 3T51B 1OXSC 4DGZA 5JVG3 1JC7A 3HOWB 3VR5A 3A8IE 1JOKA 2B2VC 2OF1A 3MWYW 3U9SA 1S5BD 5CV6A 2Q8RE 1SNDA 2IWHA 3SEBA 1WTPA 3SK4A 5KIXA 2NTTA 4JBWA 1VMPA 4A3FB 1EZ6A 2NVTB 2CQAA 3Q0AA 5IGFA 1CZWA 4B9XA 2K04A 2RDFA 3N52A 5D65A 3S16B 5F2DA 1I3QB 2R3ZA 1RODA 4RKLA 5C5MA 1BO0A 1GHKA 4R8NA 4KD4A 4R9WA 2A6HC 2EOTA 1HRJA 1KABA 1IHZA 2NZ1D 1BOSA 5ELCA 1ILPA 3I3CA 4N9TA 3HKZB 1TR5A 3I90A 2ZXPA 4XT3B 4K5WA 2JA8B 1FNUA 4N9PA 1IKMA 5C6AA 2ZXRA 1JORA 4ZKBB 2K33A 5T1IA 3SXHA 2WP8J 3NHHA 2ICEC 2XIWA 2PZTA 2X69A 3OIQA 1UUPA 3IL8A 3HOZB 5EKLA 1SAPA 3OWEB 1PTOF 4KV6A 4K8JA 3NP8A 1QG7A 3I4NB 1B53A 3GTPB 1Y8PB 4HMIA 1WTQA 1X32A 4PMCA 1T5XD 2NVQB 3DWQA 4DNTB 3CRKC 4V0BA 5JEAG 1GUSA 2AWOA 5FOBB 4KKSA 4KJOA 4CBVA 4RGMA 3TZUA 1Z47A 4K2LA 4ZYSA 4MIUA 2N88A 3VYTA 2KEDA 5KRUA 2A73B 1XTCD 4G57A 2DY7A 3KK7A 1U4PA 3W2DA 2PMZB 2DNEA 2AQ1B 2ICIA 1PFBA 4H44C 1B2TA 2BA1A 3J81E 3M4OB 1FNWA 5JEAH 1F2MA 3GQBA 1EYCA 1SBBB 1TQOA 1A2UA 4IN3A 2A6ED 2KVMA 1JB3A 2JEBI 1PFNA 3TSSA 4FNFA 1Q12A 5IGEA 5FLXE 5IIFA 1LTSD 4J6HA 2PQEA 4A3JB 3GTLB 1LT4D 2R61A 1I4GA 5NUCA 1AN8A 2B2UA 5C3EB 4FVMA 1DZ1A 2I46A 3H09A 1CTMA 1KDCA 1Y8OB 4DXGA 2FINB 4XTCS 4A3MB 1QE6A 4C1NK 3MVVA 2A69C 5I6WA 1D6EC 1FYCA 5D14A 1GOZA 3AMUA 3MXPA 5BN5A 4OL7A 5CBEE 2F0DA 5C5LA 1LTAD 1A6XA 3I4MB 2V4DA 3P20A 4C56C 1ESRA 1I4HA 5KNCA 3RUZA 3H91A 3PMFA 5LL6X 4KJNA 1LTRD 3SDZA 3Q22A 3LX0A 1WVLA 1I50B 1TIID 3SVMA 3ZYYX 1QNKA 5ELFA 1PMRA 4U673 1F2YA 2IPKD 4QF4A 5EQ0A 4DXFA 3KLSX 1RKNA 4O1NA 2J0TD 2R93B 1EEID 4F8MA 1DOMA 4DK1A 5M3MB 1ET9A 2B39A 1O7ZA 3JAME 1Y1VB 1Y69U 5CGKA 1M4VA 4C3JB 1BR9A 1UAPA 2M00A 5D3IB 1EY6A 3M7GA 1KDBA 4NKLA 1Y8NB 4EGVA 2SNSA 4KY5A 5KEEA 4OHJA 3HEJA 1B9MA 5C3XA 3X3MA 5C0XJ 2BDNA 2JSOA 5J1ZA 2LFNA 1V1OA 3T16A 3K5LA 3OPOA 3PO2B 5I9OA 1YNJD 3GTQB 1EY7A 4C1NI 1JCKB 1J8IA 1C8CA 1O78A 3HOYB 3EA6A 2WINB 1DYQA 1C48A 5ELBA 3I4LA 1YNNC 2HDMA 4TQUS 5CR3A 3GV6A 3NBIA 2IX3A 5IGGA 2BDOA 1IKLA 1I4RA 1EYAA 1TS5A 4F7XA 3FPUB 1V43A 1D5XC 1CQVA 1ENFA 1SE4A 4G4KA 2B63B 3J7AF 4BBRB 3NPPA 4IUQA 3K5MA 5J39A 1SNOA 3OWFA 2F0JA 2IT1A 1EFID 4ZAIA 3A55A 3CRLC 3DEPA 2E76C 1T5EA 2A68D 2NB0A 2HCIA 2Q8TA 2F1MA 2B2WA 4I7ZC 3EJIA 1STHA 3MZ5A 4DA2A 3J80L 3A7AB 4DK0A 3GTOB 4ULLA 3DHQA 3R3OA 1SNQA 2C9OA 3RD4A 3MFGA 1DJRD 1EWHA 1ET6A 2LKVA 4DN4M 1JWSD 3SR1A 1E0BA 3GTGB 4A3DB 4K2KA 1ZKOA 2XNAC 2X6GA 5E4XA 3OW7A 1NSNS 3MTSA 4ZKCB 3H6MA 2PW7A 1D5MC 1NCVA 3HG9A 2M9VA 1QJOA 2B2TC 4BA1I 3OMGA 4FF2A 1J9OA 1SXTA 1KLGD 1EIHA 1CM9A 1TT2A 4HCSA 4HMJA 5CV5A 3K5OA 4HTHA 1SYFA 5DAUA 3AU7A 5CORA 2OXPA 3E6ZX 3V2TA 1ZEQX 3QO2A 1ZYRC 2Z4IA 1BCPB 2PPBC 2H4OA 4IZ8A 2NN6I 2B8GA 5C4HA 2PW5A 4ABNA 3BYTB 1D2BA 4U68A 1VF7A 3I72A 5IGBA 2KEEA 1RJTA 1B50A 3Q24A 1GUOA 2WAQB 5ELDA 2K5WA 3C2PA 1FNVA 1GHJA 2FHTA 3GTJB 1STEA 1JOOA 5K36G 4Q5VA 3PUWA 1SDFA 2K6AA 3S1RB 3ND8A 2F0SA 4KTAA 3DXJC 4QB4A 5LHY1 1DOKA 1U4MA 3QOJA 1F9PA 1PTOH 4X3TA 2QILA 1F9RA 4K8IA 3J7YW 3WOFA 2SNMA 2JYOA 3ONAB 2L55A 3BDCA 2EY1A 1ENAA 1DOLA 1LABA 2MHVA 4WORA 4XQNA 2RSNA 2LMCB 2NN6H 5K36H 2K05A 3OSOA 4KKUA 1WTOA 3IFTA 4KN7C 2RQXA 4UAIA 1G91A 1B9NA 2D2CC 1SNMA 1CA5A 1TVXA 2WB1B 2B8FA 3TDQA 4IFDJ 1ZXTA 1OXTA 3KUPA 2XWBB 3OHXC 1WTVA 2VB2X 2IW3A 1WTWA 3BYYB 5CYUA 2F03A 1EZ8A 3LNNA 2BE5D 1LT6D 1BNZA 3V05A 5E3FA 2KQ3A 3S2DB 2HQEA 3DM1A 4C3IG 3NK9A 4CJ0B 4L6TB 4I65A 2RSOA 3KLSA 5M5WB 4ILWA 4P2CB 1LTBD 5FLXL 3VR4A 2EDGA 1GUGA 4ZLTF 1JICA 1B4OA 3HGBA 3NXWA 2NBFA 4MN3A 2A6EC 4XQQA 1LT5D 1OXVA 3TP7A 1D1IA 2CW0D 4FF3A 2F0LA 3HS0C 4H13C 4KI0A 3G7LA 3VA5A 1TWCB 1LTTD 3KBXA 5EKIA 2E2IB 4MHEA 1SE3A 1CZGA 3TP6A 4KHVA 2EJGC 1AZQA 3HOUB 2IX1A 1KTKA 1G6ZA 1NR4A 2XWJB 1SEBD 5EBDA 5I2YA 1SNCA 1SYCA 2GA4B 1RHPA 3S15B 3A54A 4IQZA 1RTOA 2KJXA 1WD1A 3P1HA 4RH6A 2VB3X 3QIAA 3FDTA 3BG3A 4BY7B 1O80A 4EQNA 2EJFC 3L3OC 5C44B 2NUCA 4HN7A 4OO1I 2EPBA 5M9OA 2K7VA 3EQLC 5IT9L 2O5IC 1DXMA 1SFOB 4XQJA 2QEJC 1SYGA 4RGTA 1LTID 3NTKA 3SE0A 1E2VA 1RD9D 2F0OA 5K5PA 2EY5A 2XRSD 3MXUA 2KCNA 4KK7A 4H7BA 2A6HD 3FVQA 2SDFA 4L8JA 4JK1C 3IAYA 2EYMA 3IFDA 2TMPA 3HZXA 1I6HB 4OO1G 2YU9B 4M1UB 1Z6HA 3NTIA 1HFNA 1LLRD 3R93A 2E75C 4PNYA 1S4ZA 1W6KA 1HFGA 4KHZA 3O13A 3BVGA 2F3WA 5EJWA 1X3PA 3EVQA 3OIPA 1YNJC 3TN2A 1NAPA 2VNUD 4NW2A 1IYVA 4CHTB 3S1MB 1D5ZC 5T1GA 2XSCA 2F0VA 2YYZA 1PRTD 4A3KB 3K59A 5FKAC 1BCPC 3UI2A 4F87A 2CVRA 2PZUA 2NVYB 1EY8A 4X3KA 3BVZA 3QG1A 3K6OA 1O7LA 2ZT9C 3BVMA 2K1BA 3M85A 2A68C 2HUGA 4G7OC 4ID6A 2NTSA 3VYSA 1SJED 2F0PA 4B9WA 5A2QE 1A2TA 2DNCA 4RGOS 2EVBA 2EE1A 5JPNC 1H9SB 1F2LA 1LTGD 5EPJA 1FR3A 4ZQ3A 4HCEA 1RF2D 3FRPB 4X3UA 4QMGA 5CC4A 5C3WA 1CFMA 1H9MA 1VF5C 1CQFA 2BA0A 3CU7A 3GTKB 3P75A 1ENCA 2F0UA 3D3RA 2H1EA 1PFMA 3FEWX 1G291 5DEHA 2A69D 2R6GA 5KYIA 4CGYB 1ICWA 2X6LA 3H94A 4NDXA 2PYKA 2F0WA 4FXGC 3SK6A 2D62A 5DM73 2CHBD 1JWUD 2G9HD 3QJYA 2K5QA 2EYLA 1EYDA 2K5DA 1GUNA 4ZK9B 3NUCA 3M7NA 1GUWA 1NUCA 2XVSA 4KMUC 2F0NA 2EZVA 1VMCA 2PZWA 1DCZA 3K57A 3DWAA 2EY2A 5JEAJ 2O5JC 4J8QA 1PRTF 2B2VA 1AEXA 1UEAB 4RCNA 5CBAE 3VA7A 4C2MB 3RZDB 4M8AA 3PUYA 3BZDB 3K58A 4XDXA 1EIGA 1TKWB 1HA5A 4CKBA 5FO9B 3MAQA 4RCOA 4FXKC 4O42A 2PNRC 2B2UC 2EY6A 3PV0A 3K5NA 1JQYD 2RVLA 2I07B 4RA8A 4DFAA 4C3HG 1G2SA 4BY1B 1G2TA 2F0MA 1R4QB 1IW7D 5ELEA 1Q1BA 4WFN3 1HPCA 2AQ3B 5D3DA 1HUNA 1B3AA 1JWMD 1PTOC 4F88A 4NMZA 1SSOA 1K8MA 2F0QA 2QKIC 1AFPA 1CHPD 1OXUA 2XRQD 1PDQA 4FF4A 1KLUD 5FK9C 2IL8A 1QCBD 1TU2B 2EJMA 2ENBA 5BN4A 3T13A 3RZOB 1HUMA 2AUJD 1YNND 1ESFA 3V96A 2K28A 2O2LD 3DWPA 1NR2A 1AW7A 4K14A 1F77A 1CT1D 1IL8A 1Q90A 3X3NA 4KY7A 3PIO3 4ZUJA 3OOCA 2C5CA 2KCCA 1CI3M 5JAVA 4BS9A 1F2ZA 2TSSA 1STBA 1C4QA 5EPLA 4A3GB 1QOHA 4FYDA 2BE5C 2HCCA 5JJZA 1SYBA 1V8QA 3QWNA 4H0LC 4WRDA 3W3AA 4BBSB 2FFKB 1TWGB 3A7LA 3LWUA 3D6CA 1F9QA 3ITPA 3WOEA 3BS1A 3T56B 1WD0A 1PLFA 4RWSC 1Z7TA 1HTPA 1ONLA 5A35A 3H0GB 1AZPA 1K8OA 3WDNA 1I6VC 5CMDA 3RLFA 2AQ2B 1CK1A 1KNEA 3E5SA 4QUCA 3CKIB 3NTHA 3NQTA 5BN3A 1BQQT 4KD3A 4A93B 2D9UA 1CHQD 4FP5D 4DF7A 1XYIA 5IGDA 3FPPA 2RDGA 1TWHB 3J80E 4V190 1QILA 1QWYA 1SJHD 5G3LD 3F2UA 1W6JA 1B1ZA 5J22A 3GO5A 4PMBA 2J4XA 4DAYA 4A3BB 4E6IA 2KHSA 1LT3D 1H9KA 4OGQC 1EU3A 1BBXC 2L12A 5E1FA 1HQMC 5EBCA 3G6JB 3EFXD 4R8IA 2OEOA 5CV7A 1XX8A 1SNPA 4OIJA 1STYA 2SEBD 1E2WA 3FKIB 1RCVD 2B2WC 2MPMA 3VR2A 4PQXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2SNS A;  3SK5 A;  1NSN S;  4KY5 A;  1KDC A;  2F0P A;  4B9W A;  5I9P A;  2EYO A;  4TRD A;  3C1E A;  5KEE A;  1SYE A;  4H7B A;  4KV6 A;  2F0S A;  4KTA A;  5EKK A;  3HEJ A;  5C3X A;  1SYB A;  1A2T A;  3H6M A;  4K8J A;  2PW7 A;  5C4Z A;  4WRD A;  5J1Z A;  4QB4 A;  2EYM A;  3NP8 A;  3NXW A;  3QOJ A;  5HGT A;  3D6C A;  2QDB A;  4EQO A;  1A3T A;  3MVV A;  3ITP A;  3TP5 A;  3OMC A;  3T16 A;  4DGZ A;  5KGU A;  5I6W A;  4K8I A;  3ERO A;  1EQV A;  3HZX A;  5I9O A;  4HMI A;  3TP7 A;  3TME A;  1EY7 A;  1JOK A;  2OF1 A;  4NKL A;  2F0L A;  2EY6 A;  3OMG A;  2SNM A;  5CV6 A;  1SND A;  4ZQ3 A;  3MXP A;  3VA5 A;  3SHL A;  4OL7 A;  3BDC A;  3BDL A;  4PMC A;  2EY1 A;  1ENA A;  2F0D A;  5C5L A;  3SK4 A;  3QB3 A;  4K5X A;  4ODG A;  4WOR A;  1TT2 A;  5CR3 A;  4DFA A;  2F0M A;  1A3U A;  2RBM A;  1KAA A;  3E5S A;  4HMJ A;  4QMG A;  5CV5 A;  3NQT A;  5CC4 A;  5IGG A;  1EY5 A;  5C3W A;  2O4X A;  4KD3 A;  4PNY A;  3PMF A;  1EYA A;  3RUZ A;  3OSO A;  1SYF A;  4HTH A;  5DAU A;  4F7X A;  5KIX A;  4KJN A;  3TP6 A;  4LAA A;  5KYL A;  4KHV A;  4KY6 A;  5HUR A;  2EYJ A;  5CV9 A;  4DF7 A;  2F0G A;  4NMZ A;  2OXP A;  5IGD A;  3LX0 A;  1KDA A;  3P75 A;  2F3V A;  4KJO A;  1SNM A;  1EZ6 A;  2F0Q A;  4ME5 A;  3SK8 A;  1EY9 A;  3D4D A;  3V2T A;  5I6Y A;  2EYH A;  1A3V A;  1ENC A;  2F3W A;  4K2L A;  2F0U A;  3D8G A;  1SNC A;  5JOB A;  5IGF A;  4IZ8 A;  3EVQ A;  1SYC A;  4MIU A;  5J39 A;  1SNO A;  5DEH A;  4B9X A;  4YIJ A;  2RDF A;  1JOQ A;  2WAC A;  3OWF A;  4IUN A;  5F2D A;  4S3S A;  1EY4 A;  2F0J A;  5KYI A;  5KRU A;  1EY0 A;  4G57 A;  3TP8 A;  3S9W A;  3P1H A;  1F2Y A;  4IAL A;  2PW5 A;  4RKL A;  5C4H A;  5C5M A;  2ENB A;  5J22 A;  4EVO A;  2F0E A;  4NDX A;  2PYK A;  4PMB A;  4QF4 A;  3T13 A;  2F0W A;  4K6D A;  4ZUI A;  3QOL A;  2F0V A;  5CV8 A;  3SK6 A;  1RKN A;  1U9R A;  1EZ8 A;  4EQP A;  2EYP A;  4J1M A;  4R8N A;  5IGB A;  1STG A;  4KD4 A;  4EQN A;  5IOD A;  4E6I A;  3MEH A;  2NUC A;  2KHS A;  5EKL A;  4NP5 A;  5CV4 A;  5E3F A;  2KQ3 A;  2HQE A;  4K14 A;  2F0T A;  1F2M A;  1IHZ A;  1KAB A;  5M9O A;  2EYL A;  3EJI A;  1EYC A;  1TQO A;  1EYD A;  1STH A;  1A2U A;  1SYD A;  1STN A;  3NUC A;  3MZ5 A;  2F0I A;  4N9T A;  4F8M A;  2PZU A;  1NUC A;  3DMU A;  1EY8 A;  2EYF A;  4K5V A;  5ISR A;  5IGE A;  3NK9 A;  2F0K A;  2F0N A;  1SYG A;  4KY7 A;  2F0H A;  5IIF A;  5E1F A;  1TR5 A;  4ZUJ A;  4DU9 A;  2EXZ A;  2SOB A;  4I65 A;  2F0F A;  2PZW A;  4K5W A;  3DHQ A;  4J6H A;  3R3O A;  2OEO A;  4N9P A;  4RKB A;  5CV7 A;  1SNQ A;  5EGT A;  1II3 A;  1SNP A;  2EY2 A;  5C6A A;  5JAV A;  2PQE A;  3U9O A;  5IOC A;  1F2Z A;  5CGK A;  1JOR A;  1STY A;  3D4W A;  3SXH A;  5NUC A;  1STA A;  2LKV A;  2M00 A;  1STB A;  2RKS A;  3ERQ A;  1AEX A;  1EY6 A;  3MHB A;  2F0O A;  3NHH A;  3SR1 A;  5K5P A;  1JOO A;  2PZT A;  2EY5 A;  5IGC A;  1KDB A;  4K2K A;  4ID6 A;  3C1F A; 
#chains in the Genus database with same CATH topology
 1FVI A;  3SK5 A;  2MFI A;  3J81 L;  1GVP A;  4LJZ C;  1H9R A;  1IYU A;  4GLV B;  4HAE A;  3VDY A;  5EPK A;  1ICF B;  2FJ2 A;  2MUY A;  5C0X I;  4EQO A;  2QDB A;  1A3T A;  2CCZ A;  2MP1 A;  1KAW A;  4RFB A;  1EIF A;  3OMC A;  3FMC A;  3NQI A;  4A3I G;  4A3C H;  1TWF B;  3ERO A;  3OTO Q;  3NSW A;  3TME A;  4B3T Q;  3D4R A;  3I70 A;  2HDL A;  3R2T A;  3BJU A;  4CJ2 C;  4NXN Q;  1BXT A;  4A3J G;  4CKC A;  4LF4 L;  3MFY A;  4RHS A;  2Y0S E;  1Q1E A;  1S5D D;  3SHL A;  2RDH A;  3KFU A;  1K83 B;  1CSP A;  1KRS A;  5C3E G;  3CPW A;  3GD7 A;  2K5H A;  1V1P A;  3M4O H;  3JC6 6;  4A3M G;  4KY6 A;  4OWW B;  1HA6 A;  2EYJ A;  3T53 B;  1IBK Q;  3C46 A;  4RMF A;  1AP0 A;  1DD2 A;  3CC4 A;  2F4V L;  1SMY D;  4QQB X;  3SK8 A;  1PTO B;  3D4D A;  2DN8 A;  2JA5 H;  1YZ6 A;  2Z8L A;  4A3I H;  4YIJ A;  3F2B A;  2IX0 A;  4LF6 Q;  2WAC A;  4DV0 Q;  4BXX G;  3A56 A;  1KD1 C;  4R4T A;  3S9W A;  5C0X G;  1W3S A;  4A3J H;  1JB7 A;  3GTL H;  3NE5 B;  3KF8 A;  5KNB A;  2B2Y A;  2JXM B;  2QF7 A;  5C3E H;  1U9R A;  3I4M G;  4JI0 Q;  4J1M A;  2Z9H A;  4AYB B;  3RR5 A;  1MI2 A;  3NEN A;  1NBW A;  2L11 A;  2F0T A;  1WTR A;  1U5K A;  1MSH A;  1MHW C;  5G3L F;  5M5X H;  4BWG B;  1BVS A;  1VQP A;  3FP9 A;  1HHV A;  1N36 L;  1S3O A;  3KYH C;  4QUF A;  1WTX A;  4FO2 A;  3VYR A;  5ISR A;  2D5D A;  2Z0S A;  1NMG A;  2L5T A;  1PH5 A;  2KHI A;  4BXX H;  4KN4 C;  4HED A;  1GXD C;  4IUR A;  2N8N A;  5C0X H;  3PUV A;  1HNW L;  1E22 A;  4LK1 C;  2FXQ A;  1BUV T;  1D1K A;  3KDF B;  2Z6K A;  4DV5 Q;  3EBE A;  3I4M H;  4YWL A;  2GVB A;  3CQZ H;  3I2Z A;  1PRT C;  4IOC A;  2R92 B;  1Q86 C;  5M5Y B;  4DNR B;  2R93 G;  4X62 L;  1VQA A;  2G9D A;  4K0K L;  4IO9 A;  1E1O A;  5HGT A;  1M8A A;  4JI4 L;  1X56 A;  1EQR A;  5M3M G;  1PFS A;  1Q7Y C;  2E2J B;  1I50 H;  1A15 A;  3A74 A;  2F4I A;  4JI5 L;  5A2Q L;  4B3R L;  1GUT A;  3H15 A;  2WFW A;  1A62 A;  1VCI A;  1Y1V G;  3HOX H;  2Z1C A;  1LAC A;  3JAM L;  1M1K C;  4C3J G;  3P7J A;  3S1Q H;  1XMO L;  4DAV A;  3QB3 A;  4K5X A;  2PO4 A;  5IYD G;  1N9W A;  3CCV A;  1EY5 A;  1QVG A;  4P74 A;  3KLR A;  1HH2 P;  4B3M Q;  1UEB A;  2KA7 A;  2KCM A;  3VR3 A;  4LF8 L;  2HQL A;  2HHH L;  3NEL A;  1S5C D;  4GKK Q;  2R93 H;  4GNX C;  4WJW A;  5IYC G;  2FMM A;  1EOT A;  4CDF C;  5E4W C;  1U4R A;  1EY9 A;  1PHJ A;  2WV6 D;  2VXW A;  4C3I B;  3BDO A;  1JR0 D;  2HIX A;  4N8F A;  5JOB A;  3D0F A;  5M3M H;  3PO2 G;  1VQL A;  1EQT A;  1R4P B;  2JA5 B;  1PVO A;  4JV5 Q;  4FXD A;  3HOY G;  1Y1V H;  4A3I B;  4XXE A;  3DM3 A;  4K6L A;  4EVO A;  4C3J H;  2CH4 A;  2Y0S B;  3I91 A;  2AUK A;  1L1O A;  3I73 A;  4ZUI A;  3QOL A;  3UDX A;  1EU4 A;  5IYD H;  3OTO L;  1FD7 D;  4G7H C;  4DR7 Q;  4NXN L;  2MJ8 A;  4HSV A;  4NP5 A;  2WKD A;  5LL6 S;  3TZD A;  3ICE A;  3E9I A;  3TRZ A;  3D31 A;  3ULJ A;  1X9N A;  2B63 G;  5IYC H;  5I4D A;  1B44 D;  1PZJ D;  1WTH A;  2AWN A;  3J81 c;  4OO1 H;  2IY5 B;  4L63 B;  4BBR G;  5COY A;  1VQJ A;  5M5X B;  2MGS A;  4DU9 A;  4XYO A;  4IOA A;  2F0F A;  1EOV A;  1HCZ A;  3GTQ H;  3PSI A;  1B7Y B;  5EGT A;  4RKB A;  1K0S A;  1R9T B;  4CDE C;  4Y7N B;  5LMN W;  5IOC A;  3HOY H;  3NBH A;  2B2T A;  2D0O A;  5FLX c;  1PH1 A;  1UE1 A;  3K7A B;  2UU9 L;  4KLK A;  3TS0 A;  4RGN A;  3RMH A;  5IGC A;  4HR7 B;  3NWT A;  4POG A;  1I4P A;  1X65 A;  2WII B;  2BOS A;  4Z9C B;  2RHS B;  1BF4 A;  3H3V C;  1PZK D;  4TRD A;  1TY0 A;  3C1E A;  2L9H A;  4GLA C;  2ASB A;  2E2D C;  4PMW A;  2ZXO A;  3CQZ B;  4DPG A;  4HSP A;  1HQR D;  1Q8I A;  2B63 H;  1BDO A;  4JBK A;  1I4X A;  3TP5 A;  5KGU A;  4BBR H;  2NVX B;  1O7Y A;  3L0O A;  1EQV A;  2M2L A;  4KHP L;  3J7A V;  5JVH 3;  3W1G A;  1XWE A;  1LYL A;  1U4L A;  3T1Y Q;  2E74 C;  4N8X 1;  3HOX B;  4IUP A;  4A3D G;  3S1Q B;  5KND A;  1A3U A;  2RBM A;  1VQM A;  5C4X H;  1HTL D;  1HNZ L;  2O4X A;  3I56 A;  4YHH L;  3PIP 3;  2JA7 G;  2ID0 A;  2Z4H A;  5IT9 E;  2K5N A;  4LAA A;  2A1A A;  2EYH A;  4DV5 L;  2AMC B;  2RA4 A;  3MXG A;  1TY2 A;  1FJG Q;  3GTO H;  1GJX A;  1TS3 A;  2NYZ D;  4IUN A;  4OX9 Q;  4IFD I;  4IUV A;  1EY0 A;  3TP8 A;  2L4N A;  2RHQ B;  5AFW A;  4GKJ L;  2BCO A;  2B2Y C;  2F0E A;  1BBU A;  4K6D A;  4KKT A;  4G7Z C;  5CV8 A;  2EYP A;  2A74 C;  3GTG H;  1HR0 Q;  4A3D H;  1STG A;  3M4P A;  1Y1W H;  1ILQ A;  2OT2 A;  3MEH A;  1IW7 C;  1LV9 A;  1OXX K;  4DKA C;  5IWA L;  4A76 A;  3J81 j;  3PUX A;  5CV4 A;  1I4Q A;  2JA7 H;  3GTM B;  3HOV H;  2LY7 A;  1HXY D;  4X65 Q;  4HJ7 A;  4UY8 C;  5IT9 c;  1STN A;  1SYD A;  1MD2 D;  2D0P A;  4BA2 I;  2EYF A;  3URY A;  2F0H A;  1ML0 D;  3A5Z B;  1NJI C;  4XIG S;  4B3S Q;  4B3M L;  4DV1 L;  2YV5 A;  5FO8 B;  1II3 A;  5FO7 B;  4GKK L;  1A0I A;  3D4W A;  2XN9 C;  1STA A;  3R8B A;  1V1Q A;  2RKS A;  5I2X A;  1TS4 A;  3MHB A;  2E2H H;  4DAP A;  2K14 A;  3JAM c;  3GP7 A;  2L1B A;  4IFD G;  1EWC A;  4UDU C;  3J81 i;  5I9P A;  3S14 B;  4JW0 A;  1SYE A;  4Q0F A;  5EKK A;  1X3F A;  4IUT A;  1PRT B;  2FMC A;  3Q23 A;  1BCP D;  4IUU A;  4JG2 A;  3PO3 B;  2I5H A;  1CUK A;  3CHB D;  2JA6 B;  2JA9 A;  1S5F D;  1QB5 D;  2QCP X;  1EEF D;  1RDP D;  1WCM B;  3MXN A;  4QIW E;  3U50 C;  1VQD A;  2WAQ G;  1VQI A;  2ZTD A;  1RTN A;  2CWA A;  1JE4 A;  2K03 A;  4DR5 Q;  3J7Z C;  3BDL A;  3I55 A;  1L0Y B;  4DV2 Q;  4DR6 Q;  4ODG A;  1G6P A;  1TWA B;  2BH8 A;  5DNF A;  4OIK A;  1SE2 A;  4LMQ D;  4IFD H;  1E24 A;  1QNU A;  3A8K E;  5C4X B;  1UNS A;  1N32 Q;  3GV3 A;  2KUM A;  2F3V A;  1EL0 A;  2JE6 I;  4GNX B;  1A3V A;  1HZA A;  1SE8 A;  1TS2 A;  3DUZ A;  1G8Z D;  1E2Z A;  2L0C A;  2NWG A;  1FGB D;  1VQ8 A;  2GVA A;  1EY4 A;  3N6R A;  3RLN A;  5DM6 3;  2KEC A;  4XYQ A;  3CME A;  4DR2 Q;  3GTJ H;  2KBN A;  4EQP A;  2J7Z A;  3L7Z C;  2VS1 A;  4JI1 Q;  3WWV A;  5IOD A;  3MA2 B;  2Q8I B;  3ND9 A;  3S2H B;  2K01 A;  3S1R H;  1CA6 A;  1Y1W B;  3T1Y L;  1H95 A;  5IP7 G;  2VUM B;  2JA7 B;  2WB1 G;  2R7F A;  3DMU A;  3HOV B;  4K5V A;  3KOJ A;  2SOB A;  1XXG A;  1KNA A;  3MC0 B;  3CAM A;  1H9S A;  1EWI A;  4CKE A;  3IKJ A;  4J15 A;  4IPG A;  2LS0 1;  1L0X B;  3VR6 A;  3ERQ A;  3HP3 A;  2PCF B;  2K32 A;  1NTG A;  2A5H A;  3AB9 A;  4PV1 C;  4GZY C;  3T4A C;  3DEO A;  4RAU C;  5IY0 A;  4DUZ L;  1IBL Q;  2YTV A;  3C1F A;  3M3Y B;  2E2H B;  2EYO A;  2I0Q A;  2B3G A;  3Q6S A;  4AH6 A;  3HRZ C;  5IP7 H;  4ZRZ A;  1XNQ Q;  2K5V A;  3LWE A;  4A3E B;  1F9S A;  4B08 A;  5BR8 Q;  4DAM A;  3AFQ A;  1YVC A;  5GAH C;  2F4V Q;  1PV4 A;  5JPM C;  2A19 A;  1Q46 A;  3K80 C;  3JAM i;  5M3F B;  4X65 L;  1PYW D;  5TSS A;  1OO9 B;  1B70 B;  2DGY A;  3TBI B;  5AJ3 L;  3A8J E;  3PUZ A;  4GOP C;  1KAA A;  5FLM G;  1BCP F;  1V1P B;  4B3S L;  2QGQ A;  2HD3 A;  3S17 B;  2DY8 A;  2AHO B;  5ELN A;  5KYL A;  3S2D H;  1H9J A;  5HUR A;  5GAE C;  5CV9 A;  1VDZ A;  2F0G A;  1MBY A;  1KDA A;  5I6Y A;  4ME5 A;  4PZ6 A;  2JA8 G;  2KOL A;  3KBG A;  4X6A H;  3D8G A;  2LXJ A;  3D6W A;  3C3L A;  1N33 L;  4GN5 A;  4XT1 B;  1JOQ A;  4OON A;  4RHR A;  4S3S A;  4TKO B;  1DON A;  4QIW B;  1N36 Q;  2N55 A;  3S1N B;  4IAL A;  4DNI A;  3L9A X;  1Q8K A;  3NWS A;  4X3S A;  2NZO A;  4JC0 A;  1X3Q A;  4CJ1 B;  2JEA I;  5FLM H;  2NN6 G;  3E0J A;  5E7N A;  3A0J A;  1GD7 A;  3ZJY C;  3HOU G;  1MGS A;  3EIV A;  3M4Y A;  4DV2 L;  2F0I A;  3PIP A;  4QCL A;  1SMY C;  3STB C;  1S5E D;  1PTO D;  2JA8 H;  1PZI D;  2CW0 C;  2F0K A;  4LNQ A;  1X55 A;  1WYD A;  2EXZ A;  3VYU A;  4UP7 A;  2ZJR A;  4R4O A;  4K0K Q;  5C4J B;  4TSS A;  1PXU A;  2R7Z B;  2IJ0 A;  3U9O A;  4JI4 Q;  1N32 L;  3K0Y A;  1QZH A;  4JI5 Q;  3HOZ H;  1TWC H;  4BY7 G;  4DR4 L;  2JP1 A;  4YWM A;  1N34 L;  1LO5 D;  4C3H B;  2WKC A;  2N49 A;  2Q2U A;  2KCT A;  5C44 G;  1MSG A;  1GO3 E;  3I8Z A;  2OCE A;  2NZH A;  4FF1 A;  1DM0 B;  3R2I A;  5C4Z A;  1ZYR D;  1Q3L A;  4HID A;  3T51 B;  1OXS C;  4DGZ A;  5JVG 3;  1JC7 A;  4JI1 L;  4LF8 Q;  3VR5 A;  2HHH Q;  3HOW B;  3A8I E;  1JOK A;  2B2V C;  2OF1 A;  3MWY W;  3U9S A;  3S15 H;  3GDE A;  3CW2 C;  3K81 C;  1S5B D;  5CV6 A;  2Q8R E;  1SND A;  2PMZ E;  2IWH A;  3SEB A;  1WTP A;  1L2F A;  3F8T A;  3SK4 A;  4UPA A;  4BY7 H;  3LGJ A;  4LWC A;  1C9O A;  5KIX A;  2NTT A;  4JBW A;  1P8L A;  1M90 C;  1EQQ A;  1VMP A;  1DGS A;  4A3F B;  1EZ6 A;  1L0W A;  3ERS X;  2NVT B;  2CQA A;  4A4I A;  1X54 A;  3Q0A A;  5IGF A;  1IBL L;  4DK3 C;  1CZW A;  4B9X A;  2K04 A;  2RDF A;  3N52 A;  5D65 A;  3S16 B;  5F2D A;  1I3Q B;  1SRO A;  1K8A C;  4ZCK A;  2R3Z A;  1ROD A;  4RKL A;  1J5E L;  5C5M A;  1BO0 A;  1QZG A;  4JI7 L;  1XNQ L;  1YBY A;  4JBJ A;  1KIX A;  4R4C A;  1GHK A;  5BR8 L;  4R8N A;  4KD4 A;  4R9W A;  2A6H C;  1B3Q A;  2EOT A;  2UU9 Q;  1HRJ A;  1KAB A;  1IHZ A;  2NZ1 D;  1BOS A;  1YJW A;  5ELC A;  4O0A A;  1ILP A;  3I3C A;  3CP0 A;  4N9T A;  3AFP A;  3RLO A;  3HKZ B;  3KF6 B;  1TR5 A;  3I90 A;  1I6H H;  2ZXP A;  4XT3 B;  4K5W A;  2JA8 B;  1FNU A;  4N9P A;  1IKM A;  5C6A A;  2ZXR A;  2YU9 H;  1JOR A;  4ZKB B;  2K33 A;  5T1I A;  3SXH A;  2WP8 J;  3NBH B;  3NHH A;  4KHP Q;  2ICE C;  2XIW A;  1PA6 A;  2PZT A;  2X69 A;  3OIQ A;  1UUP A;  2CWP A;  3IL8 A;  3HOZ B;  4A3M H;  5EKL A;  4A3K G;  1SAP A;  3OWE B;  1PTO F;  4KV6 A;  4GLX A;  4K8J A;  1CKN A;  2QDL A;  2UXB L;  3NP8 A;  1HNZ Q;  1QG7 A;  4YHH Q;  3I4N B;  1AH9 A;  2IHE A;  1B53 A;  3GTP B;  3UDG A;  1Y8P B;  4HMI A;  1WTQ A;  4HIM A;  1X32 A;  4JBM A;  1YIT A;  4O2D A;  2YTY A;  2F3I A;  3QR8 A;  1T5X D;  4PMC A;  3ULP A;  3S1M H;  2NVQ B;  3DWQ A;  5IP9 G;  3Q8D A;  4DNT B;  4JI6 Q;  3A5U A;  1Q82 C;  2PQA B;  3CRK C;  4V0B A;  3M9B A;  4GKJ Q;  4GOP B;  1K3R A;  4A3K H;  1PYS B;  1GUS A;  2AWO A;  5JEA G;  5FOB B;  4KKS A;  1VQ9 A;  1VQO A;  2E5L Q;  4KJO A;  4CBV A;  4RGM A;  3TZU A;  1Z47 A;  2OTJ A;  5IWA Q;  4K2L A;  1YEZ A;  2NVY H;  4ZYS A;  2ZTE A;  4MIU A;  2N88 A;  3VYT A;  2KED A;  5KRU A;  1JE5 A;  4QJF A;  2A73 B;  1XTC D;  4G57 A;  2DY7 A;  1WI5 A;  3KK7 A;  1U4P A;  3W2D A;  2PMZ B;  2LXK A;  2DNE A;  2AQ1 B;  1K8G A;  4DV1 Q;  2ICI A;  1PFB A;  4H44 C;  4PZ7 A;  1B2T A;  2BA1 A;  3J81 E;  3M4O B;  1FNW A;  3KLW A;  5JEA H;  1F2M A;  1AE2 A;  3GQB A;  4DV4 L;  1EYC A;  1SBB B;  1TQO A;  1A2U A;  4IN3 A;  5JJL A;  2A6E D;  2KVM A;  1JB3 A;  2JEB I;  1PFN A;  3TSS A;  1BKB A;  4FDB A;  4FNF A;  1Q12 A;  3K8A A;  1SRU A;  2UUC Q;  5IGE A;  5FLX E;  5IIF A;  1LTS D;  1LTL A;  2VZA A;  4J6H A;  3W5O A;  2PQE A;  4A3J B;  3GTL B;  1LT4 D;  2R61 A;  1I4G A;  5NUC A;  1AN8 A;  2B2U A;  5C3E B;  1Y14 B;  4FVM A;  1V9P A;  1DZ1 A;  2I46 A;  4JVZ A;  3H09 A;  1CTM A;  1KDC A;  1Y8O B;  1VQC A;  4DXG A;  2FIN B;  4XTC S;  4A3M B;  1QE6 A;  2ZM6 L;  3GTK H;  3PO2 H;  4C1N K;  2OQK A;  1NMF A;  3MVV A;  2A69 C;  3PF5 A;  5I6W A;  1D6E C;  1FYC A;  5D14 A;  3J7A 5;  1GOZ A;  3AMU A;  4LFA Q;  4DR1 Q;  5GQO A;  3MXP A;  5DLQ E;  5BN5 A;  4IJH A;  4OL7 A;  5CBE E;  4R1J A;  3TEH B;  2F0D A;  5C5L A;  1LTA D;  1A6X A;  3F2C A;  3I4M B;  2V4D A;  3P20 A;  1LUZ A;  4C56 C;  1ESR A;  1I4H A;  5KNC A;  3RUZ A;  2MO1 A;  3H91 A;  3PMF A;  5LL6 X;  3K0X A;  4KJN A;  3M4Q A;  4LF7 L;  1LTR D;  3SDZ A;  4IPD A;  3Q22 A;  1JT8 A;  3LX0 A;  1WVL A;  1I50 B;  1TII D;  3SVM A;  3ZYY X;  1QNK A;  2QA4 A;  5ELF A;  1PMR A;  4U67 3;  4JYA L;  1F2Y A;  2IPK D;  4JOI A;  4QF4 A;  4QGU A;  5EQ0 A;  1GM5 A;  1QUQ A;  4DXF A;  4BY1 G;  3KLS X;  1RKN A;  4ALP A;  4DV6 Q;  3KDF A;  4O1N A;  5ELO A;  2J0T D;  2L15 A;  3UDF A;  2R93 B;  2C35 B;  1EEI D;  1P16 A;  4DUZ Q;  4F8M A;  1IL2 A;  1CKO A;  1DOM A;  1QVF A;  4DK1 A;  4JI6 L;  5M3M B;  3BZC A;  1ET9 A;  3CCL A;  2B39 A;  1O7Z A;  3JAM E;  2F52 A;  1Y1V B;  1Y69 U;  5CGK A;  1M4V A;  4C3J B;  1BR9 A;  1UAP A;  2E5L L;  2M00 A;  5D3I B;  1EY6 A;  3M7G A;  4BY1 H;  1KDB A;  2N3S A;  1Y8N B;  4NKL A;  1RIP A;  4EGV A;  2SNS A;  4KY5 A;  1A63 A;  2CKZ B;  5KEE A;  4OHJ A;  4OWX B;  5AJ3 Q;  2MO0 A;  1B9M A;  3HEJ A;  4EX5 A;  5C3X A;  1IBM Q;  3X3M A;  2K4K A;  5C0X J;  2BDN A;  2JSO A;  5J1Z A;  1YJN A;  5FJ8 G;  3KJP A;  2LFN A;  1V1O A;  4YY3 Q;  1UE7 A;  3T16 A;  3K5L A;  4GN3 B;  3OPO A;  3PO2 B;  5I9O A;  1YNJ D;  3GTQ B;  1EY7 A;  2VQE L;  4C1N I;  1JCK B;  1J8I A;  1C8C A;  4DUY L;  2Z6K C;  1O78 A;  3HOY B;  3EA6 A;  5L37 A;  1VQF A;  2WIN B;  1DYQ A;  1C48 A;  5ELB A;  3I4L A;  1YNN C;  2HDM A;  2DJF C;  1N33 Q;  4TQU S;  1PYB A;  2UUC L;  4AQY Q;  3TRE A;  5CR3 A;  2CQO A;  3GV6 A;  3NBI A;  2IX3 A;  5IGG A;  4A3G G;  2BDO A;  1E3P A;  1IKL A;  1I4R A;  1EYA A;  1TS5 A;  4F7X A;  4NXM L;  3FPU B;  1V43 A;  3RNU A;  1D5X C;  1CQV A;  4BBS G;  1KXL A;  1ENF A;  1YIJ A;  1SE4 A;  4G4K A;  2B63 B;  3J7A F;  5FJ8 H;  4X64 Q;  4BBR B;  3NPP A;  4IUQ A;  2QEX A;  3K5M A;  5J39 A;  2WAQ E;  1SNO A;  1VQ5 A;  3OWF A;  2F0J A;  4UP8 A;  3H0G G;  2IT1 A;  1EFI D;  4ZAI A;  4NB3 A;  3G6E A;  3A55 A;  5LMN L;  3HFZ B;  3CRL C;  3DEP A;  2E76 C;  1T5E A;  2A68 D;  2NB0 A;  4A3G H;  5J3B A;  1XJV A;  2HCI A;  2Q8T A;  2F1M A;  4A93 G;  4OEM B;  4LFA L;  4DR1 L;  2B2W A;  4I7Z C;  4DR4 Q;  3EJI A;  1N34 Q;  1STH A;  3MZ5 A;  4BBS H;  1TWG H;  4DA2 A;  2V1C C;  3J80 L;  1KRT A;  3A7A B;  1EFW A;  4DK0 A;  3GTO B;  4ULL A;  1U0L A;  1L1O C;  3DHQ A;  3R3O A;  2VL6 A;  1SNQ A;  2C9O A;  3RD4 A;  3MFG A;  3H0G H;  2EXD A;  5LMU L;  1DJR D;  4DAY B;  1EWH A;  1ET6 A;  2LKV A;  4DN4 M;  4L5R C;  1JWS D;  3SR1 A;  1Q81 C;  4A3B G;  1E0B A;  3GTG B;  4A3D B;  4K2K A;  1ZKO A;  2XNA C;  4DK6 C;  2X6G A;  5E4X A;  3OW7 A;  4HJ8 A;  1K0R A;  1NSN S;  2ZTC A;  1FL0 A;  3MTS A;  4ZKC B;  3H6M A;  2PW7 A;  2WB1 E;  1D5M C;  1NCV A;  3HG9 A;  2M9V A;  3CCU A;  1QJO A;  4DV6 L;  2PI2 A;  2B2T C;  4BA1 I;  2VQF Q;  5EAY A;  3OMG A;  4FF2 A;  1J9O A;  1SXT A;  3FKI G;  1KLG D;  1EIH A;  1CM9 A;  2UXC Q;  1TT2 A;  4CDD C;  3UE0 A;  4A3B H;  4HCS A;  4HMJ A;  5CV5 A;  2N78 A;  1J5E Q;  3K5O A;  4HTH A;  1SYF A;  5DAU A;  4JI7 Q;  1MKH A;  3AU7 A;  4DV3 L;  5COR A;  1SMX A;  2OXP A;  3E6Z X;  4HIO A;  1ASZ A;  3V2T A;  1ZEQ X;  3QO2 A;  1ZYR C;  1SLJ A;  1JJC B;  4POF A;  2Z4I A;  1BCP B;  1HJP A;  4LFC L;  2H4O A;  2PPB C;  4IZ8 A;  3G48 A;  2NN6 I;  1HZ9 A;  2I5M X;  1CKM A;  2B8G A;  2JK8 A;  5C4H A;  2PW5 A;  1BBW A;  1IBM L;  4OEL B;  4ABN A;  3BYT B;  1D2B A;  4U68 A;  1VF7 A;  4YY3 L;  3I72 A;  5IGB A;  1VQE A;  2KEE A;  3F2D A;  1RJT A;  1CSQ A;  2A8V A;  1B50 A;  4AIM A;  4AQY L;  3Q24 A;  3K7U C;  5M5W H;  3BZK A;  4JI2 L;  1GUO A;  4LUO A;  2WAQ B;  1A8V A;  2UXB Q;  1QVC A;  1E7Z A;  3KF8 B;  5ELD A;  2K5W A;  3C2P A;  1LM0 A;  1FNV A;  2Z6B A;  3CCR A;  1GHJ A;  2FHT A;  1K83 H;  3GTJ B;  5GAG C;  1STE A;  4X64 L;  1JOO A;  5K36 G;  4Q5V A;  3PUW A;  1SDF A;  1KL9 A;  4AYB G;  1YJ9 A;  2K6A A;  1UE6 A;  3IRB A;  3S1R B;  3ND8 A;  2F0S A;  4KTA A;  3DXJ C;  4QB4 A;  5LHY 1;  1DOK A;  1U4M A;  1K73 C;  3QOJ A;  1F9P A;  1PTO H;  4X3T A;  2QIL A;  1F9R A;  4K8I A;  1XNR L;  4GNX A;  3J7Y W;  1NNX A;  3WOF A;  1KC8 C;  2SNM A;  2JYO A;  1PH9 A;  3ONA B;  2L55 A;  2E2I H;  3BDC A;  2EY1 A;  1ENA A;  1DOL A;  4LFB Q;  1LAB A;  2MHV A;  4WOR A;  3HKS A;  4XQN A;  2RSN A;  2LMC B;  2NN6 H;  5K36 H;  2K05 A;  3HOU H;  2R92 G;  3OSO A;  4KKU A;  1VQB A;  1WTO A;  2AKW B;  3IFT A;  4P72 A;  4KN7 C;  2RQX A;  4UAI A;  1G91 A;  1B9N A;  2D2C C;  1SNM A;  2RCN A;  1TVX A;  1CA5 A;  2WB1 B;  2B8F A;  2IHF A;  3TDQ A;  4DV4 Q;  4IFD J;  4A3C G;  3ER0 A;  3J80 c;  3OYY A;  1ZXT A;  1OXT A;  3KUP A;  2XWB B;  3OHX C;  1WTV A;  2VB2 X;  1XMQ L;  2IW3 A;  1WTW A;  5C44 H;  3BYY B;  1EYG A;  4WJ4 A;  5CYU A;  2F03 A;  1EZ8 A;  3LNN A;  2BE5 D;  1LT6 D;  1BNZ A;  4LF5 Q;  1D8L A;  3V05 A;  1EUJ A;  2VQF L;  1MJC A;  5E3F A;  2KQ3 A;  1SFO H;  2HQE A;  2R92 H;  4LUZ A;  5M5Y H;  3S2D B;  1VQG A;  1S72 A;  3DM1 A;  5HGQ A;  2UXC L;  4C3I G;  5JJI A;  3NK9 A;  4CJ0 B;  4LF9 Q;  4L6T B;  2E2J H;  1S40 A;  4I65 A;  2RSO A;  2JA5 G;  3KLS A;  2ZM6 Q;  5M5W B;  4ILW A;  4P2C B;  1LTB D;  1L1O B;  1O7I A;  5FLX L;  2Y0S G;  3VR4 A;  1YHA A;  2EDG A;  4MTN A;  1GUG A;  4ZLT F;  1JIC A;  3U4Z A;  1B4O A;  3HGB A;  4MNO A;  1HNX L;  3KJO A;  3UE1 A;  3NXW A;  2NBF A;  4MN3 A;  2A6E C;  3CCQ A;  3TS2 A;  4XQQ A;  1LT5 D;  4C3I H;  4LF7 Q;  1OXV A;  3STB D;  3TP7 A;  1D1I A;  4APV A;  2CW0 D;  4FF3 A;  1JJ2 A;  2UXD Q;  2F0L A;  1D7Q A;  3CC7 A;  3HS0 C;  4H13 C;  3SGI A;  4KI0 A;  1ASY A;  3G7L A;  3VA5 A;  1TWC B;  1X3G A;  1LTT D;  3KBX A;  5EKI A;  2E2I B;  4MHE A;  4HIK A;  1Z9F A;  1SE3 A;  3TQY A;  4JYA Q;  1CZG A;  3TP6 A;  4KHV A;  2EJG C;  3CC2 A;  1AZQ A;  3HOU B;  2IX1 A;  1KTK A;  4QY7 A;  4JCV E;  1VQ7 A;  1G6Z A;  1NR4 A;  3ULL A;  2XWJ B;  1SEB D;  5EBD A;  5I2Y A;  1SNC A;  2ALY B;  1SYC A;  2GA4 B;  1RHP A;  4R4I A;  3S15 B;  3A54 A;  4Y52 H;  4IQZ A;  5IYB G;  1RTO A;  3G71 A;  2KJX A;  3CPF A;  1R9T H;  1WD1 A;  3P1H A;  4RH6 A;  4Y7N H;  2VB3 X;  4L5Q A;  3QIA A;  3HOX G;  3FDT A;  3K7A H;  1C0A A;  3BG3 A;  1OTC A;  4BY7 B;  1QUQ B;  4DV7 Q;  1N8R C;  1O80 A;  4EQN A;  2EJF C;  4WJ3 M;  3L3O C;  4JI3 Q;  5C44 B;  1TXY A;  2NUC A;  1YHB A;  4HN7 A;  4OO1 I;  2EPB A;  5M9O A;  2K7V A;  3EQL C;  5IT9 L;  2O5I C;  4LFB L;  1DXM A;  3E9H A;  1NE3 A;  1SFO B;  2DJG C;  4R4Q A;  4XQJ A;  2QEJ C;  3J80 i;  5GRO A;  2XGT A;  1SYG A;  4RGT A;  2PI2 E;  1LTI D;  2NVX H;  4YCW A;  1YI2 A;  3NTK A;  4OWT B;  3SE0 A;  5IYB H;  5IP9 H;  1E2V A;  1XPU A;  2EQS A;  1RD9 D;  1IZ6 A;  2F0O A;  4UP9 A;  5K5P A;  2VQE Q;  2EY5 A;  2XRS D;  3E3X A;  3PIO A;  4DUY Q;  3MXU A;  2KCN A;  2EIF A;  4KK7 A;  4H7B A;  2A6H D;  3FVQ A;  2SDF A;  4L8J A;  4JK1 C;  3IAY A;  1MIU A;  2EYM A;  3IFD A;  2TMP A;  3EN2 A;  2H5X A;  3RN2 A;  4NXM Q;  2E8G A;  2CH4 W;  4LF5 L;  3HZX A;  1I6H B;  4OO1 G;  4LUV A;  3PF4 A;  2YU9 B;  2UUB Q;  1HZB A;  4M1U B;  4YWK A;  1Z6H A;  3NTI A;  1HFN A;  1SN8 A;  1LLR D;  2KEN A;  3R93 A;  2E75 C;  4LF9 L;  1HZC A;  4PNY A;  1S4Z A;  1W6K A;  1HFG A;  5LMN Q;  1UWV A;  3GTM H;  1WFQ A;  4KHZ A;  3PO3 G;  3I7F A;  4B3T L;  3O13 A;  4YCU A;  3MXN B;  3BVG A;  4X66 Q;  2JA6 G;  2F3W A;  5EJW A;  1X6O A;  1X3P A;  1WCM G;  3EVQ A;  3OIP A;  1YNJ C;  3KF6 A;  3I4O A;  3TN2 A;  4RG1 A;  2VW9 A;  1NAP A;  4IPC A;  2VNU D;  4NW2 A;  2K52 A;  1SR3 A;  1IYV A;  4CHT B;  3S1M B;  1D5Z C;  5T1G A;  2XSC A;  2F0V A;  1IBK L;  2YYZ A;  1PH4 A;  5LMU Q;  1K3B C;  1PRT D;  4A3K B;  3K59 A;  5FKA C;  2UXD L;  1BCP C;  3S14 H;  5C4X G;  3W1B A;  3CCM A;  3CCJ A;  3UI2 A;  4LF6 L;  4DV0 L;  4F87 A;  3PO3 H;  2CVR A;  2PZU A;  2NVY B;  1EY8 A;  3CXC A;  2JA6 H;  1VQK A;  4JI8 Q;  3NEM A;  1K28 A;  4X3K A;  1WCM H;  3BVZ A;  3QG1 A;  4L5T A;  2OWO A;  3K6O A;  4JI0 L;  1O7L A;  2ZT9 C;  4P73 A;  3H3V I;  3BVM A;  2K1B A;  4NPS A;  4C2M H;  3M85 A;  3RZD H;  1TWA H;  2OQ0 A;  2A68 C;  2HUG A;  4G7O C;  4ID6 A;  2NTS A;  1XPR A;  3VYS A;  1SJE D;  2F0P A;  4B9W A;  2PQA A;  1Y1W G;  3AQQ A;  4GOP A;  5A2Q E;  1A2T A;  2DNC A;  1XPO A;  2VUM G;  4RGO S;  3HOV G;  1KHI A;  2EVB A;  2EE1 A;  5JPN C;  4DV3 Q;  4DV7 L;  1AE3 A;  1H9S B;  4JI3 L;  4UHV A;  1F2L A;  1LTG D;  5EPJ A;  1FR3 A;  4ZQ3 A;  1XTD A;  4A3L G;  4LFC Q;  4HCE A;  1T9H A;  4IJL A;  1RF2 D;  3FRP B;  4X3U A;  4OXP A;  4QMG A;  5CC4 A;  5C3W A;  1PH7 A;  1CFM A;  1H9M A;  2UUA Q;  1VF5 C;  1CQF A;  2XTI A;  3S2H H;  2BA0 A;  4MZ9 A;  1NY4 A;  3CU7 A;  3GTK B;  3P75 A;  1HR0 W;  2ES2 A;  3S24 A;  2VUM H;  1ENC A;  3AEV A;  2F0U A;  4A3E G;  3D3R A;  2H1E A;  1PFM A;  3FEW X;  4GS3 A;  1G29 1;  5DEH A;  4DR3 Q;  4MTK A;  2A69 D;  2R6G A;  5IE8 A;  5KYI A;  5M3F G;  3RZO H;  4CGY B;  1ICW A;  4A3L H;  2X6L A;  2BH2 A;  3H94 A;  4NDX A;  2PYK A;  1YNX A;  4JI2 Q;  2F0W A;  4FXG C;  3SK6 A;  2D62 A;  2YTX A;  5DM7 3;  2CHB D;  1PH6 A;  2VY3 A;  1JWU D;  2G9H D;  4P71 A;  3M3Y H;  3QJY A;  2UUB L;  2K5Q A;  1MJE A;  3H3V H;  2EYL A;  1PH2 A;  1EYD A;  2K5D A;  1E1T A;  1GUN A;  4ZK9 B;  3NUC A;  3M7N A;  4JV5 L;  1GUW A;  1NUC A;  3B6Y A;  2XVS A;  4KMU C;  2F0N A;  1IXR A;  4A3E H;  2EZV A;  1VMC A;  2PZW A;  1I94 Q;  1DCZ A;  3K57 A;  3DWA A;  3PGZ A;  2EY2 A;  5JEA J;  5M3F H;  2B29 A;  2O5J C;  4DR7 L;  4J8Q A;  1PRT F;  1XNR Q;  4X66 L;  2B2V A;  2QW7 A;  1AEX A;  1UEA B;  4RCN A;  4EQ5 A;  5CBA E;  3CCS A;  3VA7 A;  4C2M B;  3CF5 A;  3RZD B;  4M8A A;  3S17 H;  1VS0 A;  3PUY A;  3BZD B;  3K58 A;  4XDX A;  1EIG A;  1TKW B;  1HA5 A;  2Q2I A;  4CKB A;  5FO9 B;  3MAQ A;  4I7A A;  1G51 A;  4RCO A;  4FXK C;  1W2B A;  1UE5 A;  1VQH A;  4O42 A;  2PNR C;  1GKH A;  2B2U C;  2EY6 A;  3PV0 A;  2R7Z G;  3K5N A;  3S1N H;  3T1H Q;  1JQY D;  1K9M C;  2RVL A;  1IYJ B;  3RN5 A;  2ATW A;  2I07 B;  4RA8 A;  2G5D A;  2LSS A;  2DUD A;  1WOC A;  4DFA A;  4C3H G;  1G2S A;  4BY1 B;  4A93 H;  2F0M A;  1R4Q B;  4JI8 L;  2I5L X;  3DLL A;  1G2T A;  4JPB W;  1IW7 D;  2GN5 A;  3G4S A;  5ELE A;  1Q1B A;  4WFN 3;  1HPC A;  2AQ3 B;  2P5Z X;  1XMQ Q;  5D3D A;  1TWH H;  4LW1 A;  1PH8 A;  1WJJ A;  1HUN A;  1B3A A;  1JWM D;  1PTO C;  4F88 A;  1EIY B;  4NMZ A;  2JN4 A;  3CCE A;  2HT1 A;  2JQO A;  1SSO A;  1K8M A;  2F0Q A;  4TVA B;  2QKI C;  4HJ5 A;  4HJA A;  1AFP A;  1CHP D;  3HOW G;  4GN4 B;  1OXU A;  1PH3 A;  3UDI A;  2XRQ D;  5JJK A;  1PDQ A;  4FF4 A;  1KLU D;  1X3E A;  5FK9 C;  5C4J H;  1JMC A;  1J6Q A;  2IL8 A;  3AYH B;  4CDC C;  2R7Z H;  1QCB D;  1TU2 B;  2EJM A;  2ENB A;  5BN4 A;  3T13 A;  2RF4 A;  3RZO B;  1JJG A;  1HUM A;  2AUJ D;  2Q2T A;  1YNN D;  4C3H H;  1ESF A;  3V96 A;  1RL2 A;  2K28 A;  2O2L D;  3DWP A;  1NR2 A;  1AW7 A;  4K14 A;  1FJG L;  4LF4 Q;  1F77 A;  1CT1 D;  4A3F G;  4QL5 A;  1IL8 A;  4OX9 L;  1Q90 A;  4PZ8 A;  3X3N A;  4KY7 A;  3PIO 3;  2CFM A;  4ZUJ A;  1HNX Q;  3OOC A;  3HOW H;  2Q2H A;  4JOI C;  2C5C A;  2K50 A;  2KCC A;  1CI3 M;  2UUA L;  5HY6 A;  5JAV A;  3FKI H;  4BS9 A;  1HR0 L;  1F2Z A;  2ZJP A;  4A75 A;  2R7D A;  1VQN A;  2TSS A;  3F1Z A;  1STB A;  1C4Q A;  2ZJQ A;  5EPL A;  4A3G B;  1QOH A;  4FYD A;  2BE5 C;  4DR3 L;  2HCC A;  3CD6 A;  4H02 A;  5JJZ A;  3L2P A;  2JJQ A;  1B8A A;  1SYB A;  1VQ4 A;  1V8Q A;  3QWN A;  4H0L C;  4WRD A;  1TWF H;  3W3A A;  4BBS B;  4A3F H;  2FFK B;  1TWG B;  3A7L A;  1YHQ A;  3LWU A;  3D6C A;  4P75 A;  2NVT H;  1F9Q A;  3HKZ G;  3ITP A;  3WOE A;  3BS1 A;  3T56 B;  3PQI A;  1WD0 A;  2PNH A;  2K75 A;  3HKZ E;  1PLF A;  3S16 H;  4RWS C;  2MNA A;  1Z7T A;  1I5F A;  1HTP A;  1I3Q H;  1ONL A;  5A35 A;  3H0G B;  1AZP A;  1K8O A;  2RCF A;  3WDN A;  1I6V C;  5CMD A;  3RLF A;  2AQ2 B;  1CK1 A;  1KNE A;  4AYB E;  3E5S A;  4QUC A;  3CKI B;  3NTH A;  3NQT A;  3HOZ G;  5BN3 A;  2OTL A;  3MEF A;  5GAD C;  1BQQ T;  4KD3 A;  4YCV A;  1I94 L;  4A93 B;  2D9U A;  1CHQ D;  1CKN B;  4FP5 D;  4DF7 A;  3BU2 A;  1XYI A;  5IGD A;  3FPP A;  2RDG A;  1HNW Q;  1TWH B;  3J80 E;  3CMA A;  3I4N G;  4V19 0;  3E0E A;  1QIL A;  4DR5 L;  1QWY A;  1SJH D;  5G3L D;  5H1S E;  4DR6 L;  3F2U A;  1W6J A;  3U58 A;  3OW2 A;  1B1Z A;  4X62 Q;  1FGU A;  5J22 A;  3GO5 A;  4PMB A;  1C7Y A;  2J4X A;  4DAY A;  4A3B B;  4E6I A;  1VQ6 A;  4B3R Q;  2KHS A;  1LT3 D;  1H9K A;  4OGQ C;  3T1H L;  4IPH A;  1XMO Q;  1EU3 A;  3I4N H;  1BBX C;  4L5S A;  4ME3 A;  2L12 A;  5E1F A;  1HQM C;  4DR2 L;  3GTP H;  5EBC A;  3G6J B;  3EFX D;  4R8I A;  4HJ9 A;  2KHJ A;  2OEO A;  5CV7 A;  1KQS A;  1XX8 A;  1SNP A;  4OIJ A;  1STY A;  4PG3 A;  3FHW A;  2SEB D;  3PCO B;  1E2W A;  3FKI B;  2NVQ H;  1RCV D;  3U4V A;  2B2W C;  2HIV A;  2MQH A;  2MPM A;  3VR2 A;  4PQX A; 
#chains in the Genus database with same CATH homology
 3SK5 A;  3J81 L;  4LJZ C;  1H9R A;  1IYU A;  4HAE A;  5EPK A;  2FJ2 A;  2MUY A;  5C0X I;  4EQO A;  2QDB A;  1A3T A;  2MP1 A;  4RFB A;  3OMC A;  3FMC A;  3NQI A;  1TWF B;  3ERO A;  3NSW A;  3TME A;  3D4R A;  3I70 A;  2HDL A;  3R2T A;  4CJ2 C;  1BXT A;  4CKC A;  3MFY A;  4RHS A;  1Q1E A;  1S5D D;  3SHL A;  2RDH A;  1K83 B;  3GD7 A;  1V1P A;  1HA6 A;  4KY6 A;  2EYJ A;  3T53 B;  3C46 A;  1AP0 A;  1DD2 A;  1SMY D;  3SK8 A;  1PTO B;  3D4D A;  2DN8 A;  2Z8L A;  4YIJ A;  2IX0 A;  2WAC A;  3A56 A;  3S9W A;  5C0X G;  3NE5 B;  3KF8 A;  5KNB A;  2B2Y A;  2JXM B;  2QF7 A;  1U9R A;  4J1M A;  4AYB B;  1MI2 A;  2L11 A;  2F0T A;  1WTR A;  1MSH A;  5G3L F;  4BWG B;  1HHV A;  4QUF A;  1WTX A;  4FO2 A;  3VYR A;  5ISR A;  2D5D A;  2L5T A;  4KN4 C;  4HED A;  1GXD C;  4IUR A;  5C0X H;  3PUV A;  4LK1 C;  1BUV T;  1D1K A;  1PRT C;  2R92 B;  5M5Y B;  4DNR B;  2G9D A;  5HGT A;  1M8A A;  2E2J B;  1A15 A;  2F4I A;  5A2Q L;  1GUT A;  1VCI A;  2Z1C A;  1LAC A;  3JAM L;  4C3J G;  3P7J A;  4DAV A;  3QB3 A;  4K5X A;  2PO4 A;  1EY5 A;  3KLR A;  2KA7 A;  3VR3 A;  1S5C D;  4WJW A;  2FMM A;  1EOT A;  5E4W C;  1U4R A;  1EY9 A;  2WV6 D;  2VXW A;  4C3I B;  3BDO A;  1JR0 D;  5JOB A;  1EQT A;  1R4P B;  2JA5 B;  4FXD A;  4A3I B;  4XXE A;  4K6L A;  4EVO A;  2Y0S B;  3I91 A;  2AUK A;  3I73 A;  4ZUI A;  3QOL A;  1EU4 A;  1FD7 D;  4G7H C;  2MJ8 A;  4HSV A;  4NP5 A;  2WKD A;  5LL6 S;  3TZD A;  3D31 A;  5I4D A;  1B44 D;  1PZJ D;  2AWN A;  4OO1 H;  4L63 B;  5COY A;  5M5X B;  2MGS A;  4DU9 A;  4XYO A;  2F0F A;  1HCZ A;  5EGT A;  4RKB A;  1R9T B;  4Y7N B;  5IOC A;  3NBH A;  2B2T A;  3K7A B;  4RGN A;  3RMH A;  5IGC A;  4HR7 B;  3NWT A;  1I4P A;  2WII B;  4Z9C B;  2BOS A;  1BF4 A;  3H3V C;  1PZK D;  4TRD A;  1TY0 A;  3C1E A;  2L9H A;  2E2D C;  4PMW A;  2ZXO A;  3CQZ B;  4HSP A;  1HQR D;  1Q8I A;  1BDO A;  1I4X A;  3TP5 A;  5KGU A;  2NVX B;  1O7Y A;  1EQV A;  2M2L A;  3J7A V;  5JVH 3;  1XWE A;  1U4L A;  2E74 C;  3HOX B;  4IUP A;  3S1Q B;  5KND A;  1A3U A;  2RBM A;  1HTL D;  2O4X A;  3PIP 3;  2ID0 A;  2Z4H A;  5IT9 E;  4LAA A;  2EYH A;  2RA4 A;  3MXG A;  1TY2 A;  1GJX A;  1TS3 A;  2NYZ D;  4IUN A;  4IFD I;  4IUV A;  1EY0 A;  3TP8 A;  2L4N A;  5AFW A;  2BCO A;  2B2Y C;  2F0E A;  4K6D A;  4KKT A;  4G7Z C;  5CV8 A;  2EYP A;  2A74 C;  1STG A;  1ILQ A;  2OT2 A;  3MEH A;  1IW7 C;  1LV9 A;  1OXX K;  3PUX A;  5CV4 A;  1I4Q A;  3GTM B;  2LY7 A;  1HXY D;  1STN A;  1SYD A;  1MD2 D;  4BA2 I;  2EYF A;  3URY A;  2F0H A;  1ML0 D;  4XIG S;  5FO8 B;  1II3 A;  5FO7 B;  3D4W A;  2XN9 C;  1STA A;  3R8B A;  2RKS A;  5I2X A;  1TS4 A;  3MHB A;  4DAP A;  3GP7 A;  2L1B A;  4IFD G;  1EWC A;  4UDU C;  3S14 B;  5I9P A;  1SYE A;  4Q0F A;  5EKK A;  4IUT A;  1PRT B;  2FMC A;  3Q23 A;  1BCP D;  4IUU A;  3PO3 B;  3CHB D;  2JA6 B;  1S5F D;  1QB5 D;  2QCP X;  1EEF D;  1RDP D;  1WCM B;  3MXN A;  1RTN A;  1JE4 A;  2K03 A;  3BDL A;  1L0Y B;  4ODG A;  1TWA B;  5DNF A;  4OIK A;  1SE2 A;  4LMQ D;  4IFD H;  1QNU A;  3A8K E;  5C4X B;  1UNS A;  3GV3 A;  2KUM A;  2F3V A;  1EL0 A;  2JE6 I;  1A3V A;  1TS2 A;  1G8Z D;  3DUZ A;  1E2Z A;  2L0C A;  2NWG A;  1FGB D;  3N6R A;  1EY4 A;  5DM6 3;  2KEC A;  4XYQ A;  4EQP A;  2J7Z A;  3L7Z C;  5IOD A;  3MA2 B;  2Q8I B;  3ND9 A;  3S2H B;  2K01 A;  1CA6 A;  1Y1W B;  2VUM B;  2JA7 B;  3DMU A;  3HOV B;  4K5V A;  2SOB A;  1XXG A;  1KNA A;  3MC0 B;  1H9S A;  4CKE A;  3IKJ A;  2LS0 1;  1L0X B;  3VR6 A;  3ERQ A;  3HP3 A;  2PCF B;  2K32 A;  2A5H A;  3AB9 A;  4PV1 C;  4GZY C;  3T4A C;  4RAU C;  3DEO A;  3C1F A;  3M3Y B;  2E2H B;  2EYO A;  3Q6S A;  3HRZ C;  4ZRZ A;  3LWE A;  4A3E B;  1F9S A;  4B08 A;  5JPM C;  5M3F B;  1PYW D;  5TSS A;  1OO9 B;  3TBI B;  3A8J E;  3PUZ A;  1KAA A;  1BCP F;  1V1P B;  3S17 B;  2DY8 A;  5KYL A;  1H9J A;  5HUR A;  5CV9 A;  1VDZ A;  2F0G A;  1MBY A;  1KDA A;  5I6Y A;  4ME5 A;  2KOL A;  3KBG A;  3D8G A;  3D6W A;  3C3L A;  4XT1 B;  1JOQ A;  4RHR A;  4S3S A;  4TKO B;  1DON A;  4QIW B;  2N55 A;  3S1N B;  4IAL A;  3L9A X;  4X3S A;  3NWS A;  1X3Q A;  4CJ1 B;  2JEA I;  2NN6 G;  3E0J A;  1MGS A;  3M4Y A;  2F0I A;  4QCL A;  1SMY C;  1S5E D;  1PTO D;  1PZI D;  2CW0 C;  2F0K A;  2EXZ A;  3VYU A;  5C4J B;  4TSS A;  1PXU A;  2R7Z B;  2IJ0 A;  3U9O A;  3K0Y A;  2JP1 A;  1LO5 D;  4C3H B;  2WKC A;  1MSG A;  3I8Z A;  4FF1 A;  1DM0 B;  3R2I A;  5C4Z A;  1ZYR D;  1Q3L A;  3T51 B;  1OXS C;  4DGZ A;  5JVG 3;  1JC7 A;  3HOW B;  3VR5 A;  3A8I E;  1JOK A;  2B2V C;  2OF1 A;  3MWY W;  3U9S A;  1S5B D;  5CV6 A;  2Q8R E;  1SND A;  2IWH A;  3SEB A;  1WTP A;  3SK4 A;  5KIX A;  2NTT A;  4JBW A;  1VMP A;  4A3F B;  1EZ6 A;  2NVT B;  2CQA A;  3Q0A A;  5IGF A;  1CZW A;  4B9X A;  2K04 A;  2RDF A;  3N52 A;  5D65 A;  3S16 B;  5F2D A;  1I3Q B;  2R3Z A;  1ROD A;  4RKL A;  5C5M A;  1BO0 A;  1GHK A;  4R8N A;  4KD4 A;  4R9W A;  2A6H C;  2EOT A;  1HRJ A;  1KAB A;  1IHZ A;  2NZ1 D;  1BOS A;  5ELC A;  1ILP A;  3I3C A;  4N9T A;  3HKZ B;  1TR5 A;  3I90 A;  2ZXP A;  4XT3 B;  4K5W A;  2JA8 B;  1FNU A;  4N9P A;  1IKM A;  5C6A A;  2ZXR A;  1JOR A;  4ZKB B;  2K33 A;  5T1I A;  3SXH A;  2WP8 J;  3NHH A;  2ICE C;  2XIW A;  2PZT A;  2X69 A;  3OIQ A;  1UUP A;  3IL8 A;  3HOZ B;  5EKL A;  1SAP A;  3OWE B;  1PTO F;  4KV6 A;  4K8J A;  3NP8 A;  1QG7 A;  3I4N B;  1B53 A;  3GTP B;  1Y8P B;  4HMI A;  1WTQ A;  1X32 A;  4PMC A;  1T5X D;  2NVQ B;  3DWQ A;  4DNT B;  3CRK C;  4V0B A;  5JEA G;  1GUS A;  2AWO A;  5FOB B;  4KKS A;  4KJO A;  4CBV A;  4RGM A;  3TZU A;  1Z47 A;  4K2L A;  4ZYS A;  4MIU A;  2N88 A;  3VYT A;  2KED A;  5KRU A;  2A73 B;  1XTC D;  4G57 A;  2DY7 A;  3KK7 A;  1U4P A;  3W2D A;  2PMZ B;  2DNE A;  2AQ1 B;  2ICI A;  1PFB A;  4H44 C;  1B2T A;  2BA1 A;  3J81 E;  3M4O B;  1FNW A;  5JEA H;  1F2M A;  3GQB A;  1EYC A;  1SBB B;  1TQO A;  1A2U A;  4IN3 A;  2A6E D;  2KVM A;  1JB3 A;  2JEB I;  1PFN A;  3TSS A;  4FNF A;  1Q12 A;  5IGE A;  5FLX E;  5IIF A;  1LTS D;  4J6H A;  2PQE A;  4A3J B;  3GTL B;  1LT4 D;  2R61 A;  1I4G A;  5NUC A;  1AN8 A;  2B2U A;  5C3E B;  4FVM A;  1DZ1 A;  2I46 A;  3H09 A;  1CTM A;  1KDC A;  1Y8O B;  4DXG A;  2FIN B;  4XTC S;  4A3M B;  1QE6 A;  4C1N K;  3MVV A;  2A69 C;  5I6W A;  1D6E C;  1FYC A;  5D14 A;  1GOZ A;  3AMU A;  3MXP A;  5BN5 A;  4OL7 A;  5CBE E;  2F0D A;  5C5L A;  1LTA D;  1A6X A;  3I4M B;  2V4D A;  3P20 A;  4C56 C;  1ESR A;  1I4H A;  5KNC A;  3RUZ A;  3H91 A;  3PMF A;  5LL6 X;  4KJN A;  1LTR D;  3SDZ A;  3Q22 A;  3LX0 A;  1WVL A;  1I50 B;  1TII D;  3SVM A;  3ZYY X;  1QNK A;  5ELF A;  1PMR A;  4U67 3;  1F2Y A;  2IPK D;  4QF4 A;  5EQ0 A;  4DXF A;  3KLS X;  1RKN A;  4O1N A;  2J0T D;  2R93 B;  1EEI D;  4F8M A;  1DOM A;  4DK1 A;  5M3M B;  1ET9 A;  2B39 A;  1O7Z A;  3JAM E;  1Y1V B;  1Y69 U;  5CGK A;  1M4V A;  4C3J B;  1BR9 A;  1UAP A;  2M00 A;  5D3I B;  1EY6 A;  3M7G A;  1KDB A;  4NKL A;  1Y8N B;  4EGV A;  2SNS A;  4KY5 A;  5KEE A;  4OHJ A;  3HEJ A;  1B9M A;  5C3X A;  3X3M A;  5C0X J;  2BDN A;  2JSO A;  5J1Z A;  2LFN A;  1V1O A;  3T16 A;  3K5L A;  3OPO A;  3PO2 B;  5I9O A;  1YNJ D;  3GTQ B;  1EY7 A;  4C1N I;  1JCK B;  1J8I A;  1C8C A;  1O78 A;  3HOY B;  3EA6 A;  2WIN B;  1DYQ A;  1C48 A;  5ELB A;  3I4L A;  1YNN C;  2HDM A;  4TQU S;  5CR3 A;  3GV6 A;  3NBI A;  2IX3 A;  5IGG A;  2BDO A;  1IKL A;  1I4R A;  1EYA A;  1TS5 A;  4F7X A;  3FPU B;  1V43 A;  1D5X C;  1CQV A;  1ENF A;  1SE4 A;  4G4K A;  2B63 B;  3J7A F;  4BBR B;  3NPP A;  4IUQ A;  3K5M A;  5J39 A;  1SNO A;  3OWF A;  2F0J A;  2IT1 A;  1EFI D;  4ZAI A;  3A55 A;  3CRL C;  3DEP A;  2E76 C;  1T5E A;  2A68 D;  2NB0 A;  2HCI A;  2Q8T A;  2F1M A;  2B2W A;  4I7Z C;  3EJI A;  1STH A;  3MZ5 A;  4DA2 A;  3J80 L;  3A7A B;  4DK0 A;  3GTO B;  4ULL A;  3DHQ A;  3R3O A;  1SNQ A;  2C9O A;  3RD4 A;  3MFG A;  1DJR D;  1EWH A;  1ET6 A;  2LKV A;  4DN4 M;  1JWS D;  3SR1 A;  1E0B A;  3GTG B;  4A3D B;  4K2K A;  1ZKO A;  2XNA C;  2X6G A;  5E4X A;  3OW7 A;  1NSN S;  3MTS A;  4ZKC B;  3H6M A;  2PW7 A;  1D5M C;  1NCV A;  3HG9 A;  2M9V A;  1QJO A;  2B2T C;  4BA1 I;  3OMG A;  4FF2 A;  1J9O A;  1SXT A;  1KLG D;  1EIH A;  1CM9 A;  1TT2 A;  4HCS A;  4HMJ A;  5CV5 A;  3K5O A;  4HTH A;  1SYF A;  5DAU A;  3AU7 A;  5COR A;  2OXP A;  3E6Z X;  3V2T A;  1ZEQ X;  3QO2 A;  1ZYR C;  2Z4I A;  1BCP B;  2PPB C;  2H4O A;  4IZ8 A;  2NN6 I;  2B8G A;  5C4H A;  2PW5 A;  4ABN A;  3BYT B;  1D2B A;  4U68 A;  1VF7 A;  3I72 A;  5IGB A;  2KEE A;  1RJT A;  1B50 A;  3Q24 A;  1GUO A;  2WAQ B;  5ELD A;  2K5W A;  3C2P A;  1FNV A;  1GHJ A;  2FHT A;  3GTJ B;  1STE A;  1JOO A;  5K36 G;  4Q5V A;  3PUW A;  1SDF A;  2K6A A;  3S1R B;  3ND8 A;  2F0S A;  4KTA A;  3DXJ C;  4QB4 A;  5LHY 1;  1DOK A;  1U4M A;  3QOJ A;  1F9P A;  1PTO H;  4X3T A;  2QIL A;  1F9R A;  4K8I A;  3J7Y W;  3WOF A;  2SNM A;  2JYO A;  3ONA B;  2L55 A;  3BDC A;  2EY1 A;  1ENA A;  1DOL A;  1LAB A;  2MHV A;  4WOR A;  4XQN A;  2RSN A;  2LMC B;  2NN6 H;  5K36 H;  2K05 A;  3OSO A;  4KKU A;  1WTO A;  3IFT A;  4KN7 C;  2RQX A;  4UAI A;  1G91 A;  1B9N A;  2D2C C;  1SNM A;  1CA5 A;  1TVX A;  2WB1 B;  2B8F A;  3TDQ A;  4IFD J;  1ZXT A;  1OXT A;  3KUP A;  2XWB B;  3OHX C;  1WTV A;  2VB2 X;  2IW3 A;  1WTW A;  3BYY B;  5CYU A;  2F03 A;  1EZ8 A;  3LNN A;  2BE5 D;  1LT6 D;  1BNZ A;  3V05 A;  5E3F A;  2KQ3 A;  3S2D B;  2HQE A;  3DM1 A;  4C3I G;  3NK9 A;  4CJ0 B;  4L6T B;  4I65 A;  2RSO A;  3KLS A;  5M5W B;  4ILW A;  4P2C B;  1LTB D;  5FLX L;  3VR4 A;  2EDG A;  1GUG A;  4ZLT F;  1JIC A;  1B4O A;  3HGB A;  3NXW A;  2NBF A;  4MN3 A;  2A6E C;  4XQQ A;  1LT5 D;  1OXV A;  3TP7 A;  1D1I A;  2CW0 D;  4FF3 A;  2F0L A;  3HS0 C;  4H13 C;  4KI0 A;  3G7L A;  3VA5 A;  1TWC B;  1LTT D;  3KBX A;  5EKI A;  2E2I B;  4MHE A;  1SE3 A;  1CZG A;  3TP6 A;  4KHV A;  2EJG C;  1AZQ A;  3HOU B;  2IX1 A;  1KTK A;  1G6Z A;  1NR4 A;  2XWJ B;  1SEB D;  5EBD A;  5I2Y A;  1SNC A;  1SYC A;  2GA4 B;  1RHP A;  3S15 B;  3A54 A;  4IQZ A;  1RTO A;  2KJX A;  1WD1 A;  3P1H A;  4RH6 A;  2VB3 X;  3QIA A;  3FDT A;  3BG3 A;  4BY7 B;  1O80 A;  4EQN A;  2EJF C;  3L3O C;  5C44 B;  2NUC A;  4HN7 A;  4OO1 I;  2EPB A;  5M9O A;  2K7V A;  3EQL C;  5IT9 L;  2O5I C;  1DXM A;  1SFO B;  4XQJ A;  2QEJ C;  1SYG A;  4RGT A;  1LTI D;  3NTK A;  3SE0 A;  1E2V A;  1RD9 D;  2F0O A;  5K5P A;  2EY5 A;  2XRS D;  3MXU A;  2KCN A;  4KK7 A;  4H7B A;  2A6H D;  3FVQ A;  2SDF A;  4L8J A;  4JK1 C;  3IAY A;  2EYM A;  3IFD A;  2TMP A;  3HZX A;  1I6H B;  4OO1 G;  2YU9 B;  4M1U B;  1Z6H A;  3NTI A;  1HFN A;  1LLR D;  3R93 A;  2E75 C;  4PNY A;  1S4Z A;  1W6K A;  1HFG A;  4KHZ A;  3O13 A;  3BVG A;  2F3W A;  5EJW A;  1X3P A;  3EVQ A;  3OIP A;  1YNJ C;  3TN2 A;  1NAP A;  2VNU D;  4NW2 A;  1IYV A;  4CHT B;  3S1M B;  1D5Z C;  5T1G A;  2XSC A;  2F0V A;  2YYZ A;  1PRT D;  4A3K B;  3K59 A;  5FKA C;  1BCP C;  3UI2 A;  4F87 A;  2CVR A;  2PZU A;  2NVY B;  1EY8 A;  4X3K A;  3BVZ A;  3QG1 A;  3K6O A;  1O7L A;  2ZT9 C;  3BVM A;  2K1B A;  3M85 A;  2A68 C;  2HUG A;  4G7O C;  4ID6 A;  2NTS A;  3VYS A;  1SJE D;  2F0P A;  4B9W A;  5A2Q E;  1A2T A;  2DNC A;  4RGO S;  2EVB A;  2EE1 A;  5JPN C;  1H9S B;  1F2L A;  1LTG D;  5EPJ A;  1FR3 A;  4ZQ3 A;  4HCE A;  1RF2 D;  3FRP B;  4X3U A;  4QMG A;  5CC4 A;  5C3W A;  1CFM A;  1H9M A;  1VF5 C;  1CQF A;  2BA0 A;  3CU7 A;  3GTK B;  3P75 A;  1ENC A;  2F0U A;  3D3R A;  2H1E A;  1PFM A;  3FEW X;  1G29 1;  5DEH A;  2A69 D;  2R6G A;  5KYI A;  4CGY B;  1ICW A;  2X6L A;  3H94 A;  4NDX A;  2PYK A;  2F0W A;  4FXG C;  3SK6 A;  2D62 A;  5DM7 3;  2CHB D;  1JWU D;  2G9H D;  3QJY A;  2K5Q A;  2EYL A;  1EYD A;  2K5D A;  1GUN A;  4ZK9 B;  3NUC A;  3M7N A;  1GUW A;  1NUC A;  2XVS A;  4KMU C;  2F0N A;  2EZV A;  1VMC A;  2PZW A;  1DCZ A;  3K57 A;  3DWA A;  2EY2 A;  5JEA J;  2O5J C;  4J8Q A;  1PRT F;  2B2V A;  1AEX A;  1UEA B;  4RCN A;  5CBA E;  3VA7 A;  4C2M B;  3RZD B;  4M8A A;  3PUY A;  3BZD B;  3K58 A;  4XDX A;  1EIG A;  1TKW B;  1HA5 A;  4CKB A;  5FO9 B;  3MAQ A;  4RCO A;  4FXK C;  4O42 A;  2PNR C;  2B2U C;  2EY6 A;  3PV0 A;  3K5N A;  1JQY D;  2RVL A;  2I07 B;  4RA8 A;  4DFA A;  4C3H G;  1G2S A;  4BY1 B;  1G2T A;  2F0M A;  1R4Q B;  1IW7 D;  5ELE A;  1Q1B A;  4WFN 3;  1HPC A;  2AQ3 B;  5D3D A;  1HUN A;  1B3A A;  1JWM D;  1PTO C;  4F88 A;  4NMZ A;  1SSO A;  1K8M A;  2F0Q A;  2QKI C;  1AFP A;  1CHP D;  1OXU A;  2XRQ D;  1PDQ A;  4FF4 A;  1KLU D;  5FK9 C;  2IL8 A;  1QCB D;  1TU2 B;  2EJM A;  2ENB A;  5BN4 A;  3T13 A;  3RZO B;  1HUM A;  2AUJ D;  1YNN D;  1ESF A;  3V96 A;  2K28 A;  2O2L D;  3DWP A;  1NR2 A;  1AW7 A;  4K14 A;  1F77 A;  1CT1 D;  1IL8 A;  1Q90 A;  3X3N A;  4KY7 A;  3PIO 3;  4ZUJ A;  3OOC A;  2C5C A;  2KCC A;  1CI3 M;  5JAV A;  4BS9 A;  1F2Z A;  2TSS A;  1STB A;  1C4Q A;  5EPL A;  4A3G B;  1QOH A;  4FYD A;  2BE5 C;  2HCC A;  5JJZ A;  1SYB A;  1V8Q A;  3QWN A;  4H0L C;  4WRD A;  3W3A A;  4BBS B;  2FFK B;  1TWG B;  3A7L A;  3LWU A;  3D6C A;  1F9Q A;  3ITP A;  3WOE A;  3BS1 A;  3T56 B;  1WD0 A;  1PLF A;  4RWS C;  1Z7T A;  1HTP A;  1ONL A;  5A35 A;  3H0G B;  1AZP A;  1K8O A;  3WDN A;  1I6V C;  5CMD A;  3RLF A;  2AQ2 B;  1CK1 A;  1KNE A;  3E5S A;  4QUC A;  3CKI B;  3NTH A;  3NQT A;  5BN3 A;  1BQQ T;  4KD3 A;  4A93 B;  2D9U A;  1CHQ D;  4FP5 D;  4DF7 A;  1XYI A;  5IGD A;  3FPP A;  2RDG A;  1TWH B;  3J80 E;  4V19 0;  1QIL A;  1QWY A;  1SJH D;  5G3L D;  3F2U A;  1W6J A;  1B1Z A;  5J22 A;  3GO5 A;  4PMB A;  2J4X A;  4DAY A;  4A3B B;  4E6I A;  2KHS A;  1LT3 D;  1H9K A;  4OGQ C;  1EU3 A;  1BBX C;  2L12 A;  5E1F A;  1HQM C;  5EBC A;  3G6J B;  3EFX D;  4R8I A;  2OEO A;  5CV7 A;  1XX8 A;  1SNP A;  4OIJ A;  1STY A;  2SEB D;  1E2W A;  3FKI B;  1RCV D;  2B2W C;  2MPM A;  3VR2 A;  4PQX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...