2GA4B

Stx2 with adenine
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
70
structure length
70
Chain Sequence
b'ADCAKGKIEFSKYNEDDTFTVKVDGKEYWTSRWNLQPLLQSAQLTGMTVTIKSSTCESGSGFAEVQFNND'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Shiga-like toxin II subunit A
publication title Binding of adenine to Stx2, the protein toxin from Escherichia coli O157:H7.
pubmed doi rcsb
molecule tags Toxin
total genus 19
structure length 70
sequence length 70
chains with identical sequence C, D, E, F
ec nomenclature
pdb deposition date 2006-03-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.70 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2ga4B00
1R4QB 4P2CB 1CZGA 1QNUA 1D1KA 2XSCA 1CQFA 2C5CA 1BOSA 1DM0B 1C4QA 4M1UB 1D1IA 4ULLA 2GA4B 1QOHA 1C48A 2BOSA 1R4PB 3MXGA 1CZWA
chains in the Genus database with same CATH superfamily
3PGZA 1EQQA 3RN5A 2A69D 1HZAA 4JI8L 1Y1VG 3PO2G 1KABA 2B2VC 2Z4IA 3R93A 1YHQA 2Q2IA 3J81i 1DM0B 1Q1EA 4RWSC 1AZPA 1LTSD 5M3FB 5GADC 3NTHA 4ZYSA 4QIWB 2DJGC 3NQIA 1YI2A 4RHSA 5I9OA 1RODA 5IYDG 1TWCB 1K83H 4N8X1 5KNBA 1QVGA 3S1RB 2K5NA 2IHFA 3HKZG 3KJOA 4EQNA 1FJGL 4ZUIA 1AE3A 4IUPA 3M9BA 3P1HA 4LFBL 5FO8B 2DGYA 1V8QA 4B3MQ 4J1MA 2ALYB 2YYZA 4X66L 1TXYA 4A3CG 1SE3A 3GTMH 1OXTA 2NZOA 4U673 1GHJA 2L1BA 1UE6A 3A7LA 2AWNA 1V1QA 2RHSB 1R9TH 4WJ3M 3CP0A 2F0VA 3FP9A 2VUMG 1KNAA 1U5KA 1LT6D 3M4YA 4XIGS 4LUZA 2JA7B 3UDIA 2F52A 4A3DB 1CKOA 4DR3Q 4X3SA 3O13A 3HOXB 1Y8PB 3MA2B 3GTOB 4C3HG 1ZKOA 5I2YA 4DUZQ 1G8ZD 1IBLQ 1VQFA 2F0MA 1G2SA 4X64L 1K8AC 4JI5L 3V05A 5LMUL 2IJ0A 2UUCQ 5DM63 4HJAA 3EFXD 1ZYRD 3LX0A 4A3KB 5E3FA 1VQ5A 4IN3A 1SRUA 1S5DD 4XTCS 3GTQH 3SK6A 3DLLA 1VQCA 2I5LX 2D62A 1DONA 1U4PA 4A3FG 3EN2A 1VQHA 1L1OA 3GTGH 4HJ7A 1NSNS 1X9NA 1MHWC 1G51A 2PI2E 2OWOA 1LTTD 1XX8A 1SLJA 3QG1A 4O0AA 3I7FA 3TBIB 5GAEC 4JI0Q 3S2DB 3PIPA 2E5LQ 2EYOA 3VR3A 3U4ZA 3OYYA 5J3BA 4CJ2C 1C7YA 2K5WA 2EIFA 1CQFA 2NVYB 1JJ2A 1K0SA 1Q90A 1XJVA 1A3UA 2J7ZA 3HOVB 5FO7B 5HGTA 3HOYH 1HJPA 3CQZH 2IW3A 3NSWA 3SK5A 3GTKB 2MO0A 1SXTA 2R92B 3TSSA 4DV5L 1SYFA 1QVFA 2F0TA 2F4VL 1B44D 1PTOB 5IY0A 1NUCA 5C6AA 3QOLA 4A3MG 4PMWA 4B3SQ 1N9WA 3HZXA 5GAHC 1PTOF 2R93B 2AQ3B 4KN7C 2RSOA 1STEA 2VW9A 1D5ZC 3A8JE 5J22A 2ZXRA 1YNJC 4DR6Q 4A3JB 2KCNA 4ZLTF 1V9PA 2EXZA 1WCMH 3A54A 5CV9A 3TEHB 3GTLB 1MJCA 5DLQE 3BG3A 2QA4A 2Z6KA 1Z47A 3MXGA 3Q24A 1F9QA 3AQQA 1EFWA 2QKIC 4OELB 1MJEA 2K28A 2QCPX 4DF7A 4XYQA 4QUCA 3KF6A 3P7JA 2KA7A 2ASBA 1QUQB 3KLSA 3U4VA 2KJXA 4UP8A 1N32L 1J8IA 1KDBA 4LWCA 3U50C 2XTIA 4K6LA 4HMJA 3HOWB 1ZYRC 3K6OA 4LFAQ 4O42A 5ELNA 1HNZL 1G291 3K80C 4TRDA 1VQBA 1PRTD 2LY7A 3S17B 5DM73 5IP9G 1YNXA 1V1OA 2FJ2A 3ER0A 4YCWA 3HOUH 4JI4Q 1Z9FA 1K83B 3QB3A 2Q8TA 1J9OA 3E0JA 1KC8C 2A1AA 3VA7A 1Q8IA 1TQOA 4HSPA 3N6RA 4HCSA 1R4QB 4YCUA 3FKIG 1SSOA 2QW7A 4HJ5A 4OX9Q 1NJIC 4CKEA 4XT1B 4BBSH 1UEAB 1J5EQ 4QF4A 3GTMB 4ODGA 4TKOB 2Q2TA 4UDUC 1IL2A 3J7ZC 3EA6A 2B29A 2R7ZG 1B50A 3CRLC 1STBA 4GOPA 1SNCA 3I72A 4C3IB 1VQ8A 1TR5A 1J6QA 1UUPA 3OHXC 1C8CA 3J7AV 5JVG3 4B3RL 2F3VA 1E0BA 3TZUA 5AJ3Q 4EX5A 3PV0A 2EYJA 4IO9A 4HTHA 3C2PA 5K36H 3S1NH 1CUKA 1HRJA 3NEMA 1HQMC 4O2DA 3JC66 2ICIA 2M2LA 3K5NA 3F8TA 4QY7A 2L12A 3MXNA 2HDLA 3BU2A 1D8LA 3KJPA 2CFMA 5JJKA 3CF5A 3TP7A 2VB3X 2RA4A 2RBMA 3T4AC 5JPMC 4BA1I 4A4IA 1AH9A 3S14H 2QILA 2OQ0A 1JWMD 5CMDA 3T1HL 3I56A 4FYDA 5IWAQ 4WFN3 3D6CA 4JI3L 2XNAC 3H09A 2DJFC 1Y1VH 3I55A 3PO2H 1Q86C 5EPJA 2PQAA 2VQFQ 1E24A 4RFBA 1Z7TA 2DNCA 5IT9c 4DV4L 3I91A 1SNPA 4IOAA 3U9SA 2ZTCA 3CCJA 3Q8DA 1EWIA 4EGVA 1KTKA 2QF7A 2GVBA 3SXHA 1RHPA 1K28A 1K8GA 1D6EC 5IYDH 1LTGD 1QJOA 3AU7A 4HSVA 4JI8Q 4GKKL 1EU4A 4JCVE 4RCNA 5E1FA 3HGBA 1S5CD 4R1JA 2F0OA 2JN4A 3VR5A 3HOYB 5ELFA 1PYSB 2EY5A 3B6YA 4CDEC 2OTLA 1EUJA 3MWYW 5I9PA 4LF7L 3KOJA 1I5FA 3G4SA 1XPOA 2JA8B 4Q5VA 3PUZA 4TVAB 1H9KA 1IHZA 1K8MA 4A3CH 2PZUA 1BOSA 3E9IA 4JOIC 4MZ9A 5G3LF 5J39A 4LF5Q 2UXDQ 4RGOS 3L0OA 3V96A 2Z6BA 3CC2A 1JQYD 1S5BD 4WRDA 2K14A 3A8IE 2UXBL 2Q8IB 3C46A 4DAMA 1FJGQ 4LFBQ 2EXDA 3ERQA 1G6ZA 4X66Q 2WIIB 1TWFB 4DNTB 4RHRA 4J8QA 3ICEA 2RSNA 5IYCG 1F2YA 1SNQA 5EBDA 3T51B 1JOQA 4H13C 2B3GA 2B2YC 3S1MB 4DV7Q 3HG9A 3TS2A 4JI1Q 1U4RA 1LO5D 2HIXA 1E3PA 3CMEA 2EYHA 2JYOA 1EYCA 1Q3LA 3A7AB 2WKDA 2CW0D 2KQ3A 2QDBA 4A3FH 5JAVA 3RN2A 5C0XJ 1SROA 4BWGB 2CHBD 1FNWA 2ID0A 1UE7A 1E1TA 1EIHA 4C3JG 4JI5Q 1KAAA 5LMUQ 2PW7A 5ELDA 4FF2A 4N9TA 3D4DA 2LXKA 4YWLA 3NK9A 4A3BG 2PCFB 4AYBE 4G4KA 2L55A 2ZXOA 1UEBA 3G71A 3HP3A 4LFCQ 1PVOA 4V190 2R6GA 4WORA 4JK1C 3J80L 4X6AH 1NY4A 4U68A 3HOUB 1MSHA 5JEAG 3CCRA 1SMXA 1X65A 1NR4A 1WTWA 3BVMA 2UUAL 3J7A5 5KRUA 5EKIA 1FGUA 1BBXC 4F88A 1HFGA 2EY6A 3HRZC 5EKLA 2Q2HA 1QCBD 5CV7A 3C1FA 2Z1CA 3ERSX 1WJJA 2Q2UA 4KY5A 2PNHA 3BZCA 1PH1A 3R2IA 1RCVD 2IHEA 4L8JA 3NE5B 1SR3A 1I94L 4GKJL 4AYBB 3CCLA 3RZDH 4DV5Q 3OWFA 1IW7D 2P5ZX 2F4VQ 1PH7A 1C4QA 4KHVA 2K32A 2JA5H 3S1NB 3GD7A 4KY7A 4K6DA 4QGUA 2EYLA 4NXNL 3PUYA 2BA1A 4BA2I 2MP1A 2I5MX 3HKZE 2C9OA 1GD7A 5IT9E 2K50A 5LMNL 1O78A 4R4OA 3S14B 2G5DA 3M7GA 3NP8A 3HKSA 2XSCA 5C3EH 1UWVA 5FJ8H 3J80i 4IPHA 4ZQ3A 1TIID 1DOLA 2GA4B 2F0WA 4MNOA 1X3PA 2CW0C 4A3IG 4NXML 1A62A 1LTRD 4JI7L 4IOCA 1VDZA 4X65L 4DAYA 1SN8A 2A6ED 4A3GG 1MIUA 1BDOA 1PYWD 5IGDA 3NBHA 1AEXA 2SDFA 5IP9H 3BS1A 1JJCB 3NUCA 3TP6A 1N32Q 3SVMA 1IBML 2SNMA 4CDFC 3H6MA 1G91A 2JQOA 2SOBA 1HNZQ 3HKZB 5C4JH 2B2TC 2MO1A 4OONA 4GZYC 1I6HH 3BJUA 2G9DA 3G7LA 4BBRB 3FKIH 1XTDA 4QMGA 2XWJB 1TWAH 4KTAA 2F0UA 2RDFA 1KD1C 2B63G 1D2BA 2OF1A 2ZJRA 2B2WA 4IPGA 1P16A 3HOZG 1TT2A 4NPSA 2C35B 2FHTA 5DNFA 1NBWA 2K5HA 4E6IA 2A6HC 1HQRD 1F9RA 2V4DA 5M5WH 4Y7NB 4A93G 1W2BA 1VQKA 1AFPA 1JE5A 5C4XH 5I6YA 5D14A 3CCMA 3AMUA 4CDDC 1DOMA 1DYQA 3I4NG 2XWBB 3NELA 2QDLA 2WINB 1HH2P 3PF5A 1SYDA 2EQSA 4RAUC 4J6HA 1WTXA 1WD0A 1ET9A 1I3QB 2O2LD 4B3RQ 2CH4A 3PQIA 4DGZA 4RCOA 5IP7G 1PH6A 1X3EA 1LABA 2BH8A 5BR8L 1BCPD 1KHIA 4XYOA 4DV6Q 1V1PA 2UUBL 3GV3A 3PF4A 4JG2A 3G48A 1WOCA 5COYA 5FLXc 2M9VA 3JAMc 5D3IB 3KLSX 4XQQA 2CWPA 2N8NA 4JI6L 2K6AA 1I50H 2Z8LA 4P2CB 4QL5A 2EZVA 2A68D 4YHHL 1M1KC 1GJXA 4PMCA 4RGNA 1ENCA 1E22A 4XQJA 5H1SE 5L37A 3T1HQ 1MKHA 2O5JC 1C0AA 1B2TA 4JI3Q 4AQYL 4OIKA 2O5IC 5CYUA 4GS3A 1EY6A 5JPNC 4R4CA 2KOLA 1E7ZA 1QOHA 1I4GA 4A76A 2EY1A 3H94A 1PA6A 1EY9A 4LMQD 5I6WA 1O7YA 1LT5D 3MHBA 4DV4Q 1ONLA 1JICA 4A75A 4IURA 2I5HA 2L15A 1CKNA 1KNEA 1VMCA 5A35A 4V0BA 4GKKQ 5CBEE 2N88A 1L0YB 1A63A 3BDOA 3UDXA 2OTJA 3DHQA 2EPBA 1H9MA 1CFMA 2NWGA 4BY1B 2F1MA 1RIPA 1ENFA 3VDYA 5HURA 1VQ9A 4B08A 4LF7Q 1LV9A 1MSGA 1SE4A 3KF8B 5IT9L 5JJZA 2WB1G 2Z9HA 3J7AF 1YBYA 1VQMA 5IYCH 2D2CC 2JA5B 2L0CA 4OO1G 2BE5D 3S1QH 2LFNA 1L1OB 3M4OB 2GVAA 2K4KA 5M3MH 2UU9L 4C56C 1CT1D 1IKMA 3FHWA 2FXQA 2O4XA 5C3EB 2JA6B 4AH6A 2KENA 4QB4A 4F8MA 2CQAA 1VCIA 5DEHA 5M5YH 1HXYD 2BA0A 4XXEA 4LF4L 5KNDA 4B9XA 2JK8A 5F2DA 4C3JH 3NXWA 4F7XA 3OWEB 2X6GA 5BN4A 2PNRC 1GUTA 1X56A 3KDFB 4HJ9A 3CHBD 2AHOB 3K0XA 4IUVA 3UE0A 3E5SA 4JI2L 2Z0SA 1JT8A 2VZAA 1EOVA 5IGBA 2E2JB 4YWKA 1ZEQX 5KIXA 1ET6A 4P73A 4DR2L 1PRTF 1KAWA 1EZ6A 5JEAH 5CV4A 3OOCA 3I90A 2B2UA 5IGFA 1U9RA 4GN5A 1Y1WG 4OGQC 4L5SA 1HTLD 4H7BA 3F2CA 2ICEC 4PNYA 2ZJPA 3C3LA 3DMUA 3U58A 1L0XB 1PFNA 1TWAB 2CH4W 2WAQE 2L4NA 3RD4A 4HCEA 3HS0C 2ENBA 1TY2A 4YY3L 5LL6S 4ZUJA 3IRBA 2HHHL 2A69C 1HPCA 2F4IA 2RKSA 1EQVA 3KK7A 2UUAQ 2YV5A 4OIJA 1RTOA 5KNCA 2JJQA 1G6PA 4DPGA 3I2ZA 5C4XB 1XTCD 2XRSD 1FYCA 1PZKD 5FLXE 4A3EG 3D8GA 2MNAA 4R4IA 1A6XA 2ATWA 4LF9Q 3JAME 3FPPA 3OW2A 2BDOA 3GTJB 1SBBB 1I94Q 2J4XA 3SE0A 4IPDA 4EVOA 1RTNA 1HR0L 4MN3A 4K0KL 3PO3G 4OO1I 1QZHA 1SE8A 1D1KA 2BE5C 4KY6A 3BDCA 1E2VA 2WAQB 1KLGD 2C5CA 3EROA 1PMRA 1YITA 1EYDA 4NXNQ 3KLRA 3URYA 1UNSA 1Y8NB 2F0GA 2EE1A 4APVA 2WV6D 2KUMA 5LMNQ 4OHJA 2KCTA 3I8ZA 4A3GH 3CW2C 2RDGA 3VA5A 1GUWA 2H4OA 4EQPA 1C9OA 5JJLA 3AEVA 4L6TB 1Q82C 3BVGA 4B9WA 4CKCA 4DR7L 1STGA 2RQXA 4OL7A 5M3FG 1LUZA 3A56A 4FNFA 1EWHA 1LACA 2D9UA 5ELOA 4JBWA 1JWSD 2AUKA 4NXMQ 3G6EA 4M1UB 1LTID 4X65Q 3L3OC 3FPUB 1VMPA 2NUCA 1QB5D 5ISRA 4UP9A 2A74C 3H0GG 4Q0FA 2NN6G 1HUNA 1SYBA 2B63H 3I4MH 3S16H 4R8IA 1IBMQ 1TWHH 2LXJA 3T16A 2CCZA 5TSSA 3HOZH 4N8FA 1BBWA 3LGJA 1MBYA 1YIJA 2ZTDA 3LNNA 2NVQH 3MXNB 3S24A 1FVIA 4A93H 1HA5A 3ZYYX 3MC0B 5FK9C 3RLOA 2JA7G 4G7ZC 4GNXA 4A3DG 3I4NH 1F2ZA 4GN3B 4QQBX 2VY3A 4PZ8A 1IL8A 4R8NA 3HOXG 1JJGA 1SNDA 2BOSA 4KN4C 2EY2A 5A2QE 3M4QA 3ULJA 3M3YH 2B8FA 1ENAA 1N8RC 2E74C 2PI2A 1O7LA 5M3MB 1PZJD 3J81c 1M4VA 3A74A 5C3WA 2NBFA 2D5DA 4HIOA 4I7ZC 4Z9CB 2OEOA 1X6OA 1R9TB 5JOBA 4ZRZA 4KHZA 4NB3A 1B8AA 2ZT9C 4JV5L 4C3JB 1HR0W 3MTSA 1GUNA 3WWVA 2H1EA 4LAAA 2KEDA 3UDFA 2KHIA 1DZ1A 2X69A 5BR8Q 1H9SB 1X54A 3A0JA 2BH2A 2UUBQ 2DY8A 1QUQA 3VR2A 4POFA 1HHVA 3CC7A 2GN5A 1EY7A 4GN4B 2JA9A 1TKWB 4JI6Q 5C44H 4MTKA 3TP8A 4YHHQ 3GTQB 2DY7A 3VYSA 1L2FA 1W6JA 4RH6A 3MVVA 2EYMA 3GV6A 4EQ5A 4N9PA 3HOVG 2F0HA 3R3OA 1L1OC 2RCNA 5KYLA 3GTGB 4IALA 4AQYQ 1AW7A 4DV2L 1ASZA 5FKAC 4LF6L 1A3VA 4L5TA 2R92G 4HJ8A 1I4XA 3KUPA 4F87A 1QE6A 3JAML 5D65A 3T53B 2HUGA 5C0XG 1JB7A 2NN6I 3GQBA 2KHSA 1B3AA 2B8GA 2K05A 3F2DA 3DUZA 4KV6A 1PLFA 2R93G 1CZWA 1PRTC 2G9HD 2RDHA 3K7AH 2LKVA 4OO1H 1CZGA 2HIVA 3MAQA 3CQZB 4A3JG 1CSPA 2F3WA 4LUOA 1Q46A 2K04A 2RF4A 3CU7A 4HIKA 3KYHC 1X3FA 1VQDA 2A8VA 2VB2X 3RLFA 2QGQA 1B4OA 4UAIA 1E2ZA 4LW1A 3OMGA 2VUMH 1VQLA 2TMPA 2MJ8A 1U4LA 1TWGH 3PUWA 2XIWA 1VQPA 1VQ6A 3N52A 2CVRA 1DJRD 1X32A 3CCVA 1B53A 2UU9Q 3HOWG 2IX3A 3EVQA 4DKAC 4C3HH 5C5MA 1YJNA 1SFOH 3IFTA 2FFKB 1WCMB 3L9AX 5C5LA 2VNUD 1BR9A 2RHQB 1LT4D 2CQOA 1GUSA 4G7HC 3OPOA 1ILQA 2Z6KC 1PH9A 5D3DA 3VYUA 4LF4Q 1B1ZA 1Y1WH 1NNXA 1HNWL 1PH4A 2XRQD 3VR4A 2MPMA 1CSQA 1XNRL 1I4QA 4I7AA 1LTBD 4DNIA 1VF7A 4JI2Q 2SNSA 5IODA 3F2BA 3D31A 1K8OA 1BF4A 3WOEA 1BQQT 2AQ2B 4X64Q 1RF2D 3W1GA 1EFID 1HZBA 4KK7A 3STBD 4DR2Q 1T5XD 3F2UA 3I4MB 3S16B 1EL0A 1TWHB 3Q23A 1N36L 2K7VA 2F0QA 1PH5A 3CCSA 4UP7A 3H3VI 2F0DA 4K8IA 3W1BA 5A2QL 3K59A 1JR0D 2N55A 2NVQB 4DK1A 1XPRA 3KFUA 3J81E 2E76C 4A93B 2K5QA 4C3IG 2F0NA 2E2IH 1GOZA 3RR5A 4DR4L 4IFDG 4A3EH 2PMZE 1EY4A 2AWOA 5IOCA 1EIGA 1VQIA 1S5ED 5C0XI 1I4RA 3CPWA 4YY3Q 4JW0A 1Q81C 2HHHQ 3LWUA 4A3LG 3BYTB 3FRPB 2XN9C 1IXRA 4WJWA 5M5XH 2VS1A 4L63B 1HFNA 4BBSB 2F0FA 4A3MH 4Y52H 1EY0A 2FMMA 3GTPH 2CWAA 3Q6SA 2K1BA 2K5VA 4GOPC 1DOKA 1BUVT 4K2LA 1WFQA 3UI2A 1S3OA 5KEEA 5CV5A 5EKKA 3T1YL 1BO0A 3PIP3 4RG1A 1STYA 3RMHA 5I4DA 2B2VA 1HR0Q 4DXGA 1SNOA 4RGMA 3ITPA 1ESFA 1STAA 2NVTH 1MD2D 1SMYD 5KYIA 1NR2A 2PMZB 4K5VA 5M3FH 2DUDA 5C44B 1BXTA 3E0EA 4KKSA 3E9HA 1OXUA 2HDMA 1TWCH 4P74A 3H0GH 1KIXA 1Y1VB 3PO2B 1U4MA 3HOYG 1WI5A 3SR1A 1X55A 4LJZC 4DAVA 2JA8G 3FVQA 1R4PB 4XQNA 1DD2A 1JE4A 4KJNA 3R2TA 5C4HA 1HZ9A 3CXCA 1ASYA 1E1OA 2JA7H 2OT2A 1YHAA 2AMCB 1RL2A 4A3DH 4DV0L 3GP7A 2PPBC 3K7AB 5JEAJ 3NTIA 2X6LA 4L5QA 5JJIA 1HNXL 3DXJC 4NMZA 5IE8A 4OWTB 4ABNA 1TU2B 4PG3A 1HCZA 3AYHB 4XT3B 4IFDI 1QNUA 2OXPA 1A2TA 3CRKC 2R7ZH 2EYFA 1SDFA 1EYGA 2VUMB 1N34L 1PFSA 1FD7D 1W3SA 4BY7G 2I0QA 2ZM6L 4DUYL 3FDTA 1WTVA 1TWGB 5HGQA 3V2TA 1EYAA 3CCEA 3CPFA 3X3NA 1IYJB 1FGBD 1VQOA 2UXCL 2ZTEA 4YIJA 1EEID 2I46A 3K5LA 4C3HB 4GLVB 1QWYA 2EJGC 3LWEA 4LNQA 1HUMA 4O1NA 4HR7B 4ZAIA 2IL8A 3S2DH 1IW7C 4QCLA 5KGUA 2WP8J 1CHPD 1KQSA 1LM0A 1X3QA 2NZHA 2PYKA 1N33L 1G2TA 1B3QA 3NHHA 3HOUG 2NVYH 2HCCA 5EGTA 4A3FB 1CM9A 4RA8A 3I73A 3ZJYC 1PV4A 3EBEA 5BN5A 1QG7A 2QEXA 3S2HH 1PH8A 1I4HA 5LMNW 3J81L 3DWAA 2R92H 2F0SA 3UDGA 1S4ZA 2NZ1D 1CTMA 4P72A 4G57A 1F9SA 2A73B 4S3SA 1VQEA 3P75A 1JORA 4ZCKA 3FMCA 2ZJQA 5EPKA 4R4TA 2R93H 4OWWB 3IL8A 2A6EC 4DV2Q 4LF6Q 4JBKA 4HMIA 1SYGA 1D7QA 4IZ8A 1BBUA 1VS0A 2F3IA 1WTPA 1BVSA 5DAUA 1ZXTA 3SK8A 1SYCA 5I2XA 1XPUA 4M8AA 4ME3A 4A3MB 4RGTA 2HQEA 4FVMA 5FLMG 3GTPB 1CQVA 1X3GA 3A55A 3BDLA 4QJFA 2Q8RE 1SJHD 1EIYB 1D5XC 4H02A 1PFMA 1XXGA 4X62L 1WTRA 2VL6A 1VQGA 4GLAC 1ML0D 3TDQA 1K3RA 3CKIB 5CR3A 3KBXA 3PMFA 3RZDB 5CC4A 2HT1A 3A8KE 1WYDA 3HOWH 1RDPD 1YVCA 3DEOA 3W5OA 3K57A 1S40A 3TMEA 1SAPA 5IYBG 1FNUA 4OWXB 3R8BA 4AIMA 2NVTB 3D4WA 3Q0AA 4DU9A 4UPAA 1K0RA 4H44C 2Y0SG 1DCZA 2UXBQ 1EOTA 1LTAD 4R4QA 1FNVA 5LL6X 1L0WA 4NW2A 3S17H 1C48A 2IPKD 3EQLC 1PZID 1KLUD 2E2DC 4LF5L 2UXDL 1AN8A 4YWMA 4IQZA 5CGKA 4K8JA 1WTHA 2OQKA 3K8AA 4GLXA 5E7NA 2PQEA 3H0GB 1JOKA 4I65A 1YJ9A 2K5DA 1BCPC 5IGGA 4A3BH 1PRTB 4BBRG 4WJ4A 1HNWQ 4DXFA 3H15A 1KL9A 2MFIA 4H0LC 1XNRQ 3MFGA 1YNJD 4PZ7A 3CC4A 2FINB 4C3IH 3BZKA 2H5XA 3RLNA 2A68C 1DGSA 1LYLA 4DV7L 4JI1L 5CV6A 3W2DA 4PZ6A 2B39A 2I07B 4LF8L 4IFDH 5T1GA 3EIVA 2R7FA 1SYEA 5GROA 3J80c 5C4JB 3CCQA 1N36Q 4A3LH 1I6HB 2WKCA 1JOOA 2PW5A 2R7DA 2FMCA 1JWUD 2A19A 4FDBA 3PSIA 3FKIB 3CAMA 1B9MA 1LLRD 1STHA 1HZCA 1EY8A 3TZDA 3VYTA 3TREA 2KBNA 1PH3A 2VXWA 3KF8A 3D4RA 3PUVA 3PUXA 1IBKL 2R7ZB 1OXXK 1FL0A 4DR4Q 3KBGA 3VR6A 1EQRA 2B2WC 2EYPA 4LUVA 4TQUS 2IX0A 4DR1L 1WVLA 4KKUA 5E4XA 1K3BC 4LFCL 1BNZA 2MQHA 4HEDA 5M5WB 4FF4A 1GHKA 1STNA 1SJED 3KF6B 4DAPA 5EBCA 3M4PA 3KLWA 1XNQL 1SE2A 3K7UC 4PV1C 3CCUA 2HD3A 1GO3E 2K33A 3QO2A 4GKJQ 3T1YQ 3I4OA 3MZ5A 1XWEA 4DV3L 3KDFA 1H9JA 2NYZD 4ME5A 3S2HB 1VQ4A 1I50B 5FO9B 1Q7YC 3ND9A 5GQOA 4A3IH 2JA8H 3DM3A 4GNXB 1PDQA 4JOIA 4EQOA 3QIAA 1YNND 3TS0A 4NDXA 1XMQL 1MI2A 3S9WA 1IZ6A 3TQYA 3BVZA 2L5TA 2WFWA 4R9WA 4JYAL 1NTGA 4BY1G 5CORA 3AFQA 4KI0A 1FR3A 3SHLA 4K5WA 3OTOL 4GOPB 1TWFH 2IT1A 4X3UA 2VQEL 4JI7Q 1B7YB 2BCOA 4ULLA 2JA5G 2B2YA 3DWQA 3D0FA 4JBMA 4DNRB 1EU3A 1UE5A 3S1MH 3ULPA 4B3TL 1RKNA 2MGSA 3F1ZA 4MIUA 3TRZA 3SDZA 4BXXG 2WACA 2ZXPA 3M7NA 4BY7H 4DV0Q 4C1NI 3Q22A 1UE1A 2QEJC 1PHJA 1MGSA 1HNXQ 2JA6G 5C3EG 1F77A 2AKWB 5FJ8G 3TN2A 2K03A 1KRTA 2YU9H 1QNKA 1K9MC 1OXSC 4KD3A 5C4ZA 1N34Q 2MUYA 3S1QB 3AFPA 1GM5A 1CA6A 2Z4HA 3FEWX 2ZM6Q 1II3A 1EEFD 4IUNA 4DUYQ 2F0PA 2DNEA 2PQAB 3MXUA 1HTPA 5IP7H 1XMOL 1QZGA 2UXCQ 1O80A 3EJIA 4UHVA 4KHPL 1UAPA 3RZOH 3BYYB 1M8AA 3IAYA 4A3KG 5M5YB 1YEZA 4RMFA 3PIOA 4ILWA 4BS9A 2E8GA 3SGIA 1TS2A 3I3CA 4J15A 4A3BB 3CMAA 3J80E 1E2WA 1N33Q 1Z6HA 4HAEA 5JVH3 4DR5L 4XDXA 3DWPA 1V43A 4LK1C 4FXDA 3ND8A 2F0LA 1YNNC 1TVXA 2B2UC 3DEPA 1GUGA 4DV6L 5C4XG 3QJYA 4DA2A 2YTXA 1RJTA 4IUUA 3C1EA 3SEBA 5EJWA 2N78A 2KVMA 3NTKA 5EQ0A 3OIPA 5FLMH 1LTLA 4ID6A 3I4LA 1TS3A 2J0TD 5FLXL 4HIMA 2MHVA 1A8VA 4IUQA 2YTYA 5HY6A 4MHEA 2NVXH 1PTOD 2HCIA 2NB0A 1A15A 4IJHA 1GVPA 1TS5A 1ICWA 4NKLA 2WAQG 4DV1L 1PXUA 5IYBH 5E4WC 3SK4A 3ULLA 1A2UA 4OEMB 2AQ1B 2IWHA 1O7ZA 1EY5A 3RNUA 2EOTA 1IKLA 4K5XA 4PMBA 4X62Q 4DN4M 1KXLA 3D6WA 3E6ZX 4X3KA 1M90C 4RKLA 4JBJA 3IKJA 4DK0A 2D0PA 3K0YA 3TP5A 4POGA 4ZK9B 2B2TA 2K52A 2LS01 3GO5A 4KMUC 1H9SA 4KLKA 2E2HH 3K5MA 1PFBA 1H9RA 1CI3M 2RCFA 4P75A 4BBRH 2N3SA 5EPLA 5CBAE 4A3IB 4FP5D 2LMCB 1JC7A 2EJMA 4A3GB 3DM1A 4KKTA 4TSSA 1F9PA 3MEFA 5FOBB 1LT3D 2JEAI 1I6VC 4P71A 2R3ZA 2HQLA 4B3ML 2JP1A 2JE6I 3JAMi 1S72A 1Y14B 4Y7NH 1H95A 1IYVA 2F0IA 2ES2A 1Q12A 1D5MC 1AE2A 3QWNA 1SNMA 3A5ZB 4JVZA 2N49A 3K81C 2A5HA 1NE3A 1A0IA 4DR3L 2B63B 3G6JB 3S15H 1GXDC 1S5FD 2YTVA 3MXPA 4LF8Q 1I3QH 2M00A 3OIQA 3WOFA 5M3MG 3HOZB 4BY7B 2EJFC 4X3TA 3NWSA 4DUZL 1IBLL 3H3VC 4FF1A 2KEEA 2UUCL 4PQXA 5IGEA 4GNXC 3I4NB 2YU9B 1QILA 1IBKQ 4C2MH 3OSOA 1PTOC 3M85A 1VQAA 4KD4A 3M3YB 1PYBA 4DR1Q 1BCPB 2XVSA 1JMCA 1O7IA 3PO3H 3D3RA 3IFDA 3X3MA 1K73C 1T5EA 1VQ7A 2LSSA 3RZOB 5ELBA 2EVBA 4DAYB 1ESRA 4JI0L 1TY0A 1BCPF 5GAGC 2E5LL 1XNQQ 3NBHB 2F03A 1EIFA 4YCVA 1I4PA 1NMFA 1Q1BA 5AFWA 1D1IA 3I70A 1NAPA 4K0KQ 4CBVA 2WB1E 2A6HD 4LF9L 1AZQA 4DV3Q 5ELCA 4ALPA 1U0LA 1HA6A 3CD6A 4MTNA 1KDAA 4BY1H 2IY5B 2Y0SE 1IYUA 1YHBA 4CGYB 1GKHA 4CKBA 3MFYA 1EWCA 2PO4A 4FF3A 5IIFA 4IJLA 5NUCA 4ZKBB 3HEJA 1PH2A 4B3SL 1XMQQ 3S1RH 2L9HA 2NN6H 3UE1A 3L7ZC 2K01A 1ICFB 1KDCA 3MEHA 4CJ0B 1XYIA 4JYAQ 3M4OH 5G3LD 4BXXH 4DR7Q 2JXMB 4DR6L 4FXKC 5J1ZA 3ONAB 4CHTB 3QR8A 4OXPA 3OTOQ 1QVCA 2JA6H 2VQEQ 2NVXB 3STBC 1JB3A 3P20A 5K5PA 2SEBD 1AP0A 1CK1A 1EQTA 3U9OA 2WB1B 1OTCA 1VF5C 1WTOA 4B3TQ 2IX1A 3PCOB 3GDEA 3HOXH 4IFDJ 4FO2A 1V1PB 2K75A 2Y0SB 5EAYA 1YJWA 3NBIA 3GTOH 4IUTA 1NMGA 1WCMG 2CKZB 2E2JH 4LFAL 1TS4A 4DFAA 1EZ8A 5M9OA 1OXVA 2JEBI 2OCEA 4A3KH 1Y8OB 1P8LA 5C3XA 1B70B 5IGCA 4ZKCB 3K58A 2E2HB 1WD1A 1WTQA 3A5UA 2D0OA 3QOJA 2F0KA 2BDNA 1Y69U 4HIDA 4JI4L 1SFOB 1XMOQ 1NCVA 2R61A 4NP5A 3T56B 3L2PA 1SEBD 4KHPQ 1BKBA 3I4MG 3T13A 2PZTA 3AB9A 3NQTA 4K14A 1ILPA 3E3XA 2PZWA 2L11A 4JV5Q 4IPCA 1CKNB 5ELEA 4OX9L 4UY8C 1Y1WB 4HN7A 1RD9D 4DK3C 1OO9B 1J5EL 1SMYC 3WDNA 1A3TA 2KCMA 1KRSA 5CV8A 4DK6C 3H3VH 2AUJD 5BN3A 3HOVH 2F0EA 4L5RC 3BZDB 4DR5Q 4JPBW 2NTSA 3GTKH 3GTJH 1VQJA 5AJ3L 3S15B 4G7OC 1W6KA 2EDGA 1Q8KA 3PIO3 3K5OA 1PTOH 4BBSG 3NPPA 3W3AA 1GUOA 1CA5A 2E75C 2KHJA 4RKBA 5C0XH 4QUFA 3J7YW 2XGTA 1DXMA 1T9HA 2TSSA 3H91A 4FXGC 2E2IB 1CHQD 1VQNA 1F2LA 4A3EB 3NWTA 4C1NK 4AYBG 4CJ1B 3NENA 4K2KA 4C2MB 4A3JH 4QIWE 5IWAL 2DN8A 2JSOA 3VYRA 4JC0A 3GTLH 5K36G 3J81j 5M5XB 1YZ6A 2KCCA 4CDCC 3OW7A 3PO3B 5T1IA 4DV1Q 5LHY1 2VQFL 2KECA 4KJOA 2NTTA 1JCKB 5C44G 3OMCA 1F2MA 2RVLA 3RUZA 2F0JA 3HFZB 2V1CC 1B9NA 1CKMA
chains in the Genus database with same CATH topology
2A69D 1KABA 2B2VC 2Z4IA 3R93A 1DM0B 1Q1EA 4RWSC 1AZPA 1LTSD 5M3FB 3NTHA 4ZYSA 4QIWB 3NQIA 4RHSA 5I9OA 1RODA 1TWCB 5KNBA 3S1RB 4EQNA 4ZUIA 4IUPA 3P1HA 5FO8B 1V8QA 4J1MA 2YYZA 1SE3A 1OXTA 4U673 1GHJA 2L1BA 3A7LA 2AWNA 2F0VA 1KNAA 3M4YA 1LT6D 4XIGS 2JA7B 4A3DB 4X3SA 3O13A 3HOXB 1Y8PB 3MA2B 3GTOB 4C3HG 1ZKOA 5I2YA 1G8ZD 2F0MA 1G2SA 3V05A 2IJ0A 5DM63 3EFXD 1ZYRD 3LX0A 4A3KB 5E3FA 4IN3A 1S5DD 4XTCS 3SK6A 2D62A 1DONA 1U4PA 1NSNS 1LTTD 1XX8A 3QG1A 3TBIB 3S2DB 2EYOA 3VR3A 4CJ2C 2K5WA 1CQFA 2NVYB 1Q90A 1A3UA 2J7ZA 3HOVB 5FO7B 5HGTA 2IW3A 3NSWA 3SK5A 3GTKB 1SXTA 2R92B 3TSSA 1SYFA 2F0TA 1B44D 1PTOB 1NUCA 5C6AA 3QOLA 4PMWA 3HZXA 1PTOF 2R93B 2AQ3B 4KN7C 2RSOA 1STEA 1D5ZC 3A8JE 5J22A 2ZXRA 1YNJC 4A3JB 2KCNA 4ZLTF 2EXZA 3A54A 5CV9A 3GTLB 3BG3A 1Z47A 3MXGA 3Q24A 1F9QA 2QKIC 2K28A 2QCPX 4DF7A 4XYQA 4QUCA 3P7JA 2KA7A 3KLSA 2KJXA 1J8IA 1KDBA 4K6LA 4HMJA 3HOWB 1ZYRC 3K6OA 4O42A 1G291 4TRDA 1PRTD 2LY7A 3S17B 5DM73 1V1OA 2FJ2A 1K83B 3QB3A 2Q8TA 1J9OA 3E0JA 3VA7A 1Q8IA 1TQOA 4HSPA 3N6RA 4HCSA 1R4QB 1SSOA 4CKEA 4XT1B 1UEAB 3GTMB 4QF4A 4ODGA 4TKOB 4UDUC 3EA6A 1B50A 3CRLC 1STBA 1SNCA 3I72A 4C3IB 1TR5A 1UUPA 3OHXC 1C8CA 3J7AV 5JVG3 2F3VA 1E0BA 3TZUA 3PV0A 2EYJA 4HTHA 3C2PA 5K36H 1HRJA 1HQMC 2ICIA 2M2LA 3K5NA 2L12A 3MXNA 2HDLA 3TP7A 2VB3X 2RA4A 2RBMA 3T4AC 5JPMC 4BA1I 2QILA 1JWMD 5CMDA 4FYDA 4WFN3 3D6CA 2XNAC 3H09A 5EPJA 4RFBA 1Z7TA 2DNCA 3I91A 1SNPA 3U9SA 4EGVA 1KTKA 2QF7A 3SXHA 1RHPA 1D6EC 1LTGD 1QJOA 3AU7A 4HSVA 1EU4A 4RCNA 5E1FA 3HGBA 1S5CD 2F0OA 3VR5A 3HOYB 5ELFA 2EY5A 5I9PA 3MWYW 2JA8B 4Q5VA 3PUZA 1H9KA 1IHZA 1K8MA 2PZUA 1BOSA 5G3LF 5J39A 4RGOS 3V96A 1JQYD 1S5BD 4WRDA 3A8IE 2Q8IB 3C46A 3ERQA 1G6ZA 2WIIB 1TWFB 4DNTB 4RHRA 4J8QA 2RSNA 1F2YA 1SNQA 5EBDA 3T51B 1JOQA 4H13C 2B2YC 3S1MB 3HG9A 1U4RA 1LO5D 2EYHA 2JYOA 1EYCA 1Q3LA 3A7AB 2WKDA 2CW0D 2KQ3A 2QDBA 5JAVA 5C0XJ 4BWGB 2CHBD 1FNWA 2ID0A 1EIHA 4C3JG 1KAAA 2PW7A 5ELDA 4FF2A 4N9TA 3D4DA 3NK9A 2PCFB 4G4KA 2L55A 2ZXOA 3HP3A 4V190 2R6GA 4WORA 4JK1C 3J80L 4U68A 3HOUB 1MSHA 5JEAG 1NR4A 1WTWA 3BVMA 5KRUA 5EKIA 1BBXC 4F88A 1HFGA 2EY6A 3HRZC 5EKLA 1QCBD 5CV7A 3C1FA 2Z1CA 4KY5A 3R2IA 1RCVD 4L8JA 3NE5B 4AYBB 3OWFA 1IW7D 1C4QA 4KHVA 2K32A 3S1NB 3GD7A 4KY7A 4K6DA 2EYLA 3PUYA 2BA1A 4BA2I 2MP1A 2C9OA 5IT9E 1O78A 3S14B 3M7GA 3NP8A 2XSCA 4ZQ3A 1TIID 1DOLA 2GA4B 2F0WA 1X3PA 2CW0C 1LTRD 1VDZA 4DAYA 2A6ED 1BDOA 1PYWD 5IGDA 3NBHA 1AEXA 2SDFA 3BS1A 3NUCA 3TP6A 3SVMA 2SNMA 3H6MA 1G91A 2SOBA 3HKZB 2B2TC 4GZYC 2G9DA 3G7LA 4BBRB 4QMGA 2XWJB 4KTAA 2F0UA 2RDFA 1D2BA 2OF1A 2B2WA 1TT2A 2FHTA 5DNFA 4E6IA 2A6HC 1HQRD 1F9RA 2V4DA 4Y7NB 1AFPA 5I6YA 5D14A 3AMUA 1DOMA 1DYQA 2XWBB 2WINB 1SYDA 4RAUC 4J6HA 1WTXA 1WD0A 1ET9A 1I3QB 2O2LD 4DGZA 4RCOA 1LABA 1BCPD 4XYOA 1V1PA 3GV3A 5COYA 2M9VA 5D3IB 3KLSX 4XQQA 2K6AA 2Z8LA 4P2CB 2EZVA 2A68D 1GJXA 4PMCA 4RGNA 1ENCA 4XQJA 2O5JC 1B2TA 4OIKA 2O5IC 5CYUA 1EY6A 5JPNC 2KOLA 1QOHA 1I4GA 2EY1A 3H94A 1EY9A 4LMQD 5I6WA 1O7YA 1LT5D 3MHBA 1ONLA 1JICA 4IURA 1KNEA 1VMCA 5A35A 4V0BA 5CBEE 2N88A 1L0YB 3BDOA 3DHQA 2EPBA 1H9MA 1CFMA 2NWGA 4BY1B 2F1MA 1ENFA 5HURA 4B08A 1LV9A 1MSGA 1SE4A 5IT9L 5JJZA 3J7AF 2D2CC 2JA5B 2L0CA 4OO1G 2BE5D 2LFNA 3M4OB 4C56C 1CT1D 1IKMA 2JA6B 2O4XA 5C3EB 4QB4A 4F8MA 2CQAA 1VCIA 5DEHA 1HXYD 2BA0A 4XXEA 5KNDA 4B9XA 5F2DA 3NXWA 4F7XA 3OWEB 2X6GA 5BN4A 2PNRC 1GUTA 3CHBD 4IUVA 3E5SA 5IGBA 2E2JB 1ZEQX 5KIXA 1ET6A 1PRTF 1EZ6A 5JEAH 5CV4A 3OOCA 3I90A 2B2UA 5IGFA 1U9RA 4OGQC 1HTLD 4H7BA 2ICEC 4PNYA 3C3LA 3DMUA 1L0XB 1PFNA 1TWAB 2L4NA 3RD4A 4HCEA 3HS0C 2ENBA 1TY2A 5LL6S 4ZUJA 2A69C 1HPCA 2F4IA 2RKSA 1EQVA 3KK7A 4OIJA 1RTOA 5KNCA 5C4XB 1XTCD 2XRSD 1FYCA 1PZKD 5FLXE 1A6XA 3D8GA 3JAME 3FPPA 2BDOA 3GTJB 1SBBB 2J4XA 3SE0A 4EVOA 1RTNA 4MN3A 4OO1I 1D1KA 2BE5C 4KY6A 3BDCA 1E2VA 2WAQB 1KLGD 2C5CA 3EROA 1PMRA 1EYDA 3KLRA 3URYA 1UNSA 1Y8NB 2F0GA 2EE1A 2WV6D 2KUMA 4OHJA 3I8ZA 2RDGA 3VA5A 1GUWA 2H4OA 4EQPA 4L6TB 3BVGA 4B9WA 4CKCA 1STGA 2RQXA 4OL7A 3A56A 4FNFA 1EWHA 1LACA 2D9UA 4JBWA 1JWSD 2AUKA 4M1UB 1LTID 3L3OC 3FPUB 1VMPA 2NUCA 1QB5D 5ISRA 2A74C 4Q0FA 2NN6G 1HUNA 1SYBA 4R8IA 3T16A 5TSSA 1MBYA 3LNNA 1HA5A 3ZYYX 3MC0B 5FK9C 4G7ZC 1F2ZA 1IL8A 4R8NA 1SNDA 2BOSA 4KN4C 2EY2A 5A2QE 2B8FA 1ENAA 2E74C 5M3MB 1O7LA 1PZJD 1M4VA 5C3WA 2NBFA 2D5DA 4I7ZC 4Z9CB 2OEOA 1R9TB 5JOBA 4ZRZA 4KHZA 2ZT9C 4C3JB 3MTSA 1GUNA 2H1EA 4LAAA 2KEDA 1DZ1A 2X69A 1H9SB 2DY8A 3VR2A 1HHVA 1EY7A 1TKWB 3TP8A 3GTQB 2DY7A 3VYSA 1W6JA 4RH6A 3MVVA 2EYMA 3GV6A 4N9PA 2F0HA 3R3OA 5KYLA 3GTGB 4IALA 1AW7A 5FKAC 1A3VA 1I4XA 3KUPA 4F87A 1QE6A 3JAML 5D65A 3T53B 2HUGA 5C0XG 2NN6I 3GQBA 2KHSA 1B3AA 2B8GA 2K05A 3DUZA 4KV6A 1PLFA 1CZWA 1PRTC 2G9HD 2RDHA 4OO1H 2LKVA 1CZGA 3MAQA 3CQZB 2F3WA 2K04A 3CU7A 2VB2X 3RLFA 1B4OA 4UAIA 1E2ZA 3OMGA 2TMPA 2MJ8A 1U4LA 3PUWA 2XIWA 3N52A 2CVRA 1DJRD 1X32A 1B53A 2IX3A 3EVQA 5C5MA 3IFTA 2FFKB 1WCMB 3L9AX 5C5LA 2VNUD 1BR9A 1LT4D 1GUSA 4G7HC 3OPOA 1ILQA 5D3DA 3VYUA 1B1ZA 2XRQD 3VR4A 2MPMA 1I4QA 1LTBD 1VF7A 2SNSA 5IODA 1K8OA 3D31A 1BF4A 3WOEA 1BQQT 2AQ2B 1RF2D 1EFID 4KK7A 1T5XD 3F2UA 3I4MB 3S16B 1EL0A 1TWHB 3Q23A 2K7VA 2F0QA 2F0DA 4K8IA 5A2QL 3K59A 2NVQB 1JR0D 2N55A 4DK1A 3J81E 2E76C 4A93B 2K5QA 4C3IG 2F0NA 1GOZA 4IFDG 1EY4A 2AWOA 5IOCA 1EIGA 1S5ED 5C0XI 1I4RA 3LWUA 3BYTB 3FRPB 2XN9C 4WJWA 4L63B 1HFNA 4BBSB 2F0FA 1EY0A 2FMMA 3Q6SA 2K1BA 1DOKA 1BUVT 4K2LA 3UI2A 5KEEA 5CV5A 5EKKA 1BO0A 3PIP3 1STYA 3RMHA 5I4DA 2B2VA 4DXGA 1SNOA 4RGMA 3ITPA 1ESFA 1STAA 1MD2D 1SMYD 5KYIA 1NR2A 2PMZB 4K5VA 5C44B 1BXTA 4KKSA 1OXUA 2HDMA 1Y1VB 3PO2B 1U4MA 3SR1A 4LJZC 4DAVA 3FVQA 1R4PB 4XQNA 1DD2A 1JE4A 4KJNA 3R2TA 5C4HA 2OT2A 3GP7A 2PPBC 3K7AB 5JEAJ 3NTIA 2X6LA 3DXJC 4NMZA 4ABNA 1TU2B 1HCZA 4XT3B 4IFDI 1QNUA 2OXPA 1A2TA 3CRKC 2EYFA 1SDFA 2VUMB 1FD7D 3FDTA 1WTVA 1TWGB 3V2TA 1EYAA 3X3NA 1FGBD 4YIJA 1EEID 2I46A 3K5LA 4C3HB 1QWYA 2EJGC 3LWEA 1HUMA 4O1NA 4HR7B 4ZAIA 2IL8A 4QCLA 1IW7C 5KGUA 2WP8J 1CHPD 1X3QA 2PYKA 1G2TA 3NHHA 2HCCA 5EGTA 4A3FB 1CM9A 4RA8A 3I73A 5BN5A 1QG7A 1I4HA 3J81L 3DWAA 2F0SA 1S4ZA 2NZ1D 1CTMA 4G57A 1F9SA 2A73B 4S3SA 3P75A 1JORA 3FMCA 5EPKA 3IL8A 2A6EC 4HMIA 1SYGA 4IZ8A 1WTPA 5DAUA 1ZXTA 3SK8A 1SYCA 5I2XA 4M8AA 4A3MB 4RGTA 2HQEA 4FVMA 3GTPB 1CQVA 3A55A 3BDLA 2Q8RE 1SJHD 1D5XC 1WTRA 1PFMA 1XXGA 1ML0D 3TDQA 5CR3A 3CKIB 3RZDB 3KBXA 3PMFA 5CC4A 3A8KE 1RDPD 3DEOA 3K57A 3TMEA 1SAPA 1FNUA 3R8BA 2NVTB 3D4WA 3Q0AA 4DU9A 4H44C 1DCZA 1EOTA 1LTAD 1FNVA 5LL6X 4NW2A 1C48A 2IPKD 3EQLC 1PZID 1KLUD 2E2DC 1AN8A 4IQZA 5CGKA 4K8JA 2PQEA 3H0GB 1JOKA 4I65A 2K5DA 1BCPC 5IGGA 1PRTB 4DXFA 4H0LC 3MFGA 1YNJD 2FINB 2A68C 3W2DA 5CV6A 4IFDH 2B39A 2I07B 5T1GA 1SYEA 5C4JB 1I6HB 2WKCA 1JOOA 2PW5A 2FMCA 1JWUD 3FKIB 1B9MA 1LLRD 1STHA 1EY8A 3TZDA 3VYTA 2VXWA 3KF8A 3D4RA 3PUVA 3PUXA 2R7ZB 1OXXK 3KBGA 3VR6A 2B2WC 2EYPA 4TQUS 2IX0A 1WVLA 4KKUA 5E4XA 1BNZA 4HEDA 5M5WB 4FF4A 1GHKA 1STNA 1SJED 4DAPA 5EBCA 1SE2A 4PV1C 3QO2A 2K33A 3MZ5A 1XWEA 1H9JA 2NYZD 4ME5A 3S2HB 1I50B 5FO9B 3ND9A 1PDQA 4EQOA 3QIAA 1YNND 4NDXA 1MI2A 3S9WA 3BVZA 2L5TA 4R9WA 5CORA 4KI0A 1FR3A 3SHLA 4K5WA 2IT1A 4X3UA 2BCOA 4ULLA 2B2YA 3DWQA 4DNRB 1EU3A 1RKNA 2MGSA 4MIUA 3SDZA 2WACA 2ZXPA 3M7NA 4C1NI 3Q22A 2QEJC 1MGSA 1F77A 3TN2A 2K03A 1QNKA 1OXSC 4KD3A 5C4ZA 2MUYA 3S1QB 1CA6A 2Z4HA 3FEWX 1II3A 1EEFD 4IUNA 2F0PA 2DNEA 3MXUA 1HTPA 1O80A 3EJIA 1UAPA 3BYYB 1M8AA 3IAYA 5M5YB 4ILWA 4BS9A 1TS2A 3I3CA 4A3BB 3J80E 1E2WA 1Z6HA 4HAEA 5JVH3 4XDXA 3DWPA 1V43A 4LK1C 4FXDA 3ND8A 2F0LA 1YNNC 1TVXA 2B2UC 3DEPA 1GUGA 3QJYA 4DA2A 1RJTA 4IUUA 3C1EA 3SEBA 5EJWA 2KVMA 3NTKA 5EQ0A 3OIPA 4ID6A 3I4LA 1TS3A 2J0TD 5FLXL 2MHVA 4IUQA 4MHEA 1PTOD 2HCIA 2NB0A 1A15A 1TS5A 1ICWA 4NKLA 1PXUA 5E4WC 3SK4A 1A2UA 2IWHA 2AQ1B 1O7ZA 1EY5A 2EOTA 1IKLA 4K5XA 4PMBA 4DN4M 3D6WA 3E6ZX 4X3KA 4RKLA 3IKJA 4DK0A 3K0YA 3TP5A 4ZK9B 2B2TA 2LS01 3GO5A 4KMUC 1H9SA 3K5MA 1PFBA 1H9RA 1CI3M 4A3IB 5EPLA 5CBAE 4FP5D 2LMCB 1JC7A 2EJMA 4A3GB 3DM1A 4KKTA 4TSSA 1F9PA 5FOBB 1LT3D 2JEAI 1I6VC 2R3ZA 2JP1A 2JE6I 1IYVA 2F0IA 1Q12A 1D5MC 3QWNA 1SNMA 2A5HA 2B63B 3G6JB 1GXDC 1S5FD 3MXPA 3HOZB 2M00A 3OIQA 3WOFA 4BY7B 2EJFC 4X3TA 3NWSA 3H3VC 4FF1A 2KEEA 4PQXA 5IGEA 3I4NB 2YU9B 1QILA 3OSOA 1PTOC 3M85A 4KD4A 3M3YB 1BCPB 2XVSA 3D3RA 3IFDA 3X3MA 1T5EA 3RZOB 5ELBA 2EVBA 1ESRA 1TY0A 1BCPF 2F03A 1I4PA 1Q1BA 5AFWA 1D1IA 3I70A 1NAPA 4CBVA 2A6HD 1AZQA 5ELCA 1HA6A 1KDAA 1IYUA 4CGYB 4CKBA 3MFYA 1EWCA 2PO4A 4FF3A 5IIFA 5NUCA 4ZKBB 3HEJA 2L9HA 2NN6H 3L7ZC 2K01A 3MEHA 1KDCA 4CJ0B 1XYIA 5G3LD 2JXMB 4FXKC 5J1ZA 3ONAB 4CHTB 2NVXB 1JB3A 3P20A 5K5PA 2SEBD 1AP0A 1CK1A 1EQTA 3U9OA 2WB1B 1VF5C 1WTOA 2IX1A 4IFDJ 4FO2A 1V1PB 2Y0SB 3NBIA 4IUTA 1TS4A 4DFAA 1EZ8A 5M9OA 1OXVA 2JEBI 1Y8OB 5C3XA 5IGCA 4ZKCB 3K58A 2E2HB 1WD1A 1WTQA 3QOJA 2F0KA 2BDNA 1Y69U 1SFOB 1NCVA 2R61A 4NP5A 3T56B 1SEBD 3T13A 2PZTA 3AB9A 3NQTA 4K14A 1ILPA 2PZWA 2L11A 5ELEA 1Y1WB 4HN7A 1RD9D 1OO9B 1SMYC 3WDNA 1A3TA 5CV8A 2AUJD 5BN3A 2F0EA 3BZDB 2NTSA 4G7OC 3S15B 1W6KA 2EDGA 3PIO3 3K5OA 1PTOH 3NPPA 3W3AA 1GUOA 1CA5A 2E75C 4RKBA 5C0XH 4QUFA 3J7YW 1DXMA 2TSSA 3H91A 4FXGC 2E2IB 1CHQD 1F2LA 4A3EB 3NWTA 4C1NK 4CJ1B 4K2KA 4C2MB 2DN8A 2JSOA 3VYRA 5K36G 5M5XB 2KCCA 3OW7A 3PO3B 5T1IA 5LHY1 2KECA 4KJOA 2NTTA 1JCKB 3OMCA 1F2MA 2RVLA 3RUZA 2F0JA 1B9NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R4Q B;  4P2C B;  1CZG A;  1QNU A;  1D1K A;  2XSC A;  1CQF A;  2C5C A;  1BOS A;  1DM0 B;  1C4Q A;  4M1U B;  1D1I A;  4ULL A;  2GA4 B;  1QOH A;  1C48 A;  2BOS A;  1R4P B;  3MXG A;  1CZW A; 
#chains in the Genus database with same CATH topology
 3PGZ A;  1EQQ A;  3RN5 A;  2A69 D;  1HZA A;  4JI8 L;  1Y1V G;  3PO2 G;  1KAB A;  2B2V C;  2Z4I A;  3R93 A;  1YHQ A;  2Q2I A;  3J81 i;  1DM0 B;  1Q1E A;  4RWS C;  1AZP A;  1LTS D;  5M3F B;  5GAD C;  3NTH A;  4ZYS A;  4QIW B;  2DJG C;  3NQI A;  1YI2 A;  4RHS A;  5I9O A;  1ROD A;  5IYD G;  1TWC B;  1K83 H;  4N8X 1;  5KNB A;  1QVG A;  3S1R B;  2K5N A;  2IHF A;  3HKZ G;  3KJO A;  4EQN A;  1FJG L;  4ZUI A;  1AE3 A;  4IUP A;  3M9B A;  3P1H A;  4LFB L;  5FO8 B;  2DGY A;  1V8Q A;  4B3M Q;  4J1M A;  2ALY B;  2YYZ A;  4X66 L;  1TXY A;  4A3C G;  1SE3 A;  3GTM H;  1OXT A;  2NZO A;  4U67 3;  1GHJ A;  2L1B A;  1UE6 A;  3A7L A;  2AWN A;  1V1Q A;  2RHS B;  1R9T H;  4WJ3 M;  3CP0 A;  2F0V A;  3FP9 A;  2VUM G;  1KNA A;  1U5K A;  1LT6 D;  3M4Y A;  4XIG S;  4LUZ A;  2JA7 B;  3UDI A;  2F52 A;  4A3D B;  1CKO A;  4DR3 Q;  4X3S A;  3O13 A;  3HOX B;  1Y8P B;  3MA2 B;  3GTO B;  4C3H G;  1ZKO A;  5I2Y A;  4DUZ Q;  1G8Z D;  1IBL Q;  1VQF A;  2F0M A;  1G2S A;  4X64 L;  1K8A C;  4JI5 L;  3V05 A;  5LMU L;  2IJ0 A;  2UUC Q;  5DM6 3;  4HJA A;  3EFX D;  1ZYR D;  3LX0 A;  4A3K B;  5E3F A;  1VQ5 A;  4IN3 A;  1SRU A;  1S5D D;  4XTC S;  3GTQ H;  3SK6 A;  3DLL A;  1VQC A;  2I5L X;  2D62 A;  1DON A;  1U4P A;  4A3F G;  3EN2 A;  1VQH A;  1L1O A;  3GTG H;  4HJ7 A;  1NSN S;  1X9N A;  1MHW C;  1G51 A;  2PI2 E;  2OWO A;  1LTT D;  1XX8 A;  1SLJ A;  3QG1 A;  4O0A A;  3I7F A;  3TBI B;  5GAE C;  4JI0 Q;  3S2D B;  3PIP A;  2E5L Q;  2EYO A;  3VR3 A;  3U4Z A;  3OYY A;  5J3B A;  4CJ2 C;  1C7Y A;  2K5W A;  2EIF A;  1CQF A;  2NVY B;  1JJ2 A;  1K0S A;  1Q90 A;  1XJV A;  1A3U A;  2J7Z A;  3HOV B;  5FO7 B;  5HGT A;  3HOY H;  1HJP A;  3CQZ H;  2IW3 A;  3NSW A;  3SK5 A;  3GTK B;  2MO0 A;  1SXT A;  2R92 B;  3TSS A;  4DV5 L;  1SYF A;  1QVF A;  2F0T A;  2F4V L;  1B44 D;  1PTO B;  5IY0 A;  1NUC A;  5C6A A;  3QOL A;  4A3M G;  4PMW A;  4B3S Q;  1N9W A;  3HZX A;  5GAH C;  1PTO F;  2R93 B;  2AQ3 B;  4KN7 C;  2RSO A;  1STE A;  2VW9 A;  1D5Z C;  3A8J E;  5J22 A;  2ZXR A;  1YNJ C;  4DR6 Q;  4A3J B;  2KCN A;  4ZLT F;  1V9P A;  2EXZ A;  1WCM H;  3A54 A;  5CV9 A;  3TEH B;  3GTL B;  1MJC A;  5DLQ E;  3BG3 A;  2QA4 A;  2Z6K A;  1Z47 A;  3MXG A;  3Q24 A;  1F9Q A;  3AQQ A;  1EFW A;  2QKI C;  4OEL B;  1MJE A;  2K28 A;  2QCP X;  4DF7 A;  4XYQ A;  4QUC A;  3KF6 A;  3P7J A;  2KA7 A;  2ASB A;  1QUQ B;  3KLS A;  3U4V A;  2KJX A;  4UP8 A;  1N32 L;  1J8I A;  1KDB A;  4LWC A;  3U50 C;  2XTI A;  4K6L A;  4HMJ A;  3HOW B;  1ZYR C;  3K6O A;  4LFA Q;  4O42 A;  5ELN A;  1HNZ L;  1G29 1;  3K80 C;  4TRD A;  1VQB A;  1PRT D;  2LY7 A;  3S17 B;  5DM7 3;  5IP9 G;  1YNX A;  1V1O A;  2FJ2 A;  3ER0 A;  4YCW A;  3HOU H;  4JI4 Q;  1Z9F A;  1K83 B;  3QB3 A;  2Q8T A;  1J9O A;  3E0J A;  1KC8 C;  2A1A A;  3VA7 A;  1Q8I A;  1TQO A;  4HSP A;  3N6R A;  4HCS A;  1R4Q B;  4YCU A;  3FKI G;  1SSO A;  2QW7 A;  4HJ5 A;  4OX9 Q;  1NJI C;  4CKE A;  4XT1 B;  4BBS H;  1UEA B;  1J5E Q;  4QF4 A;  3GTM B;  4ODG A;  4TKO B;  2Q2T A;  4UDU C;  1IL2 A;  3J7Z C;  3EA6 A;  2B29 A;  2R7Z G;  1B50 A;  3CRL C;  1STB A;  4GOP A;  1SNC A;  3I72 A;  4C3I B;  1VQ8 A;  1TR5 A;  1J6Q A;  1UUP A;  3OHX C;  1C8C A;  3J7A V;  5JVG 3;  4B3R L;  2F3V A;  1E0B A;  3TZU A;  5AJ3 Q;  4EX5 A;  3PV0 A;  2EYJ A;  4IO9 A;  4HTH A;  3C2P A;  5K36 H;  3S1N H;  1CUK A;  1HRJ A;  3NEM A;  1HQM C;  4O2D A;  3JC6 6;  2ICI A;  2M2L A;  3K5N A;  3F8T A;  4QY7 A;  2L12 A;  3MXN A;  2HDL A;  3BU2 A;  1D8L A;  3KJP A;  2CFM A;  5JJK A;  3CF5 A;  3TP7 A;  2VB3 X;  2RA4 A;  2RBM A;  3T4A C;  5JPM C;  4BA1 I;  4A4I A;  1AH9 A;  3S14 H;  2QIL A;  2OQ0 A;  1JWM D;  5CMD A;  3T1H L;  3I56 A;  4FYD A;  5IWA Q;  4WFN 3;  3D6C A;  4JI3 L;  2XNA C;  3H09 A;  2DJF C;  1Y1V H;  3I55 A;  3PO2 H;  1Q86 C;  5EPJ A;  2PQA A;  2VQF Q;  1E24 A;  4RFB A;  1Z7T A;  2DNC A;  5IT9 c;  4DV4 L;  3I91 A;  1SNP A;  4IOA A;  3U9S A;  2ZTC A;  3CCJ A;  3Q8D A;  1EWI A;  4EGV A;  1KTK A;  2QF7 A;  2GVB A;  3SXH A;  1RHP A;  1K28 A;  1K8G A;  1D6E C;  5IYD H;  1LTG D;  1QJO A;  3AU7 A;  4HSV A;  4JI8 Q;  4GKK L;  1EU4 A;  4JCV E;  4RCN A;  5E1F A;  3HGB A;  1S5C D;  4R1J A;  2F0O A;  2JN4 A;  3VR5 A;  3HOY B;  5ELF A;  1PYS B;  2EY5 A;  3B6Y A;  4CDE C;  2OTL A;  1EUJ A;  3MWY W;  5I9P A;  4LF7 L;  3KOJ A;  1I5F A;  3G4S A;  1XPO A;  2JA8 B;  4Q5V A;  3PUZ A;  4TVA B;  1H9K A;  1IHZ A;  1K8M A;  4A3C H;  2PZU A;  1BOS A;  3E9I A;  4JOI C;  4MZ9 A;  5G3L F;  5J39 A;  4LF5 Q;  2UXD Q;  4RGO S;  3L0O A;  3V96 A;  2Z6B A;  3CC2 A;  1JQY D;  1S5B D;  4WRD A;  2K14 A;  3A8I E;  2UXB L;  2Q8I B;  3C46 A;  4DAM A;  1FJG Q;  4LFB Q;  2EXD A;  3ERQ A;  1G6Z A;  4X66 Q;  2WII B;  1TWF B;  4DNT B;  4RHR A;  4J8Q A;  3ICE A;  2RSN A;  5IYC G;  1F2Y A;  1SNQ A;  5EBD A;  3T51 B;  1JOQ A;  4H13 C;  2B3G A;  2B2Y C;  3S1M B;  4DV7 Q;  3HG9 A;  3TS2 A;  4JI1 Q;  1U4R A;  1LO5 D;  2HIX A;  1E3P A;  3CME A;  2EYH A;  2JYO A;  1EYC A;  1Q3L A;  3A7A B;  2WKD A;  2CW0 D;  2KQ3 A;  2QDB A;  4A3F H;  5JAV A;  3RN2 A;  5C0X J;  1SRO A;  4BWG B;  2CHB D;  1FNW A;  2ID0 A;  1UE7 A;  1E1T A;  1EIH A;  4C3J G;  4JI5 Q;  1KAA A;  5LMU Q;  2PW7 A;  5ELD A;  4FF2 A;  4N9T A;  3D4D A;  2LXK A;  4YWL A;  3NK9 A;  4A3B G;  2PCF B;  4AYB E;  4G4K A;  2L55 A;  2ZXO A;  1UEB A;  3G71 A;  3HP3 A;  4LFC Q;  1PVO A;  4V19 0;  2R6G A;  4WOR A;  4JK1 C;  3J80 L;  4X6A H;  1NY4 A;  4U68 A;  3HOU B;  1MSH A;  5JEA G;  3CCR A;  1SMX A;  1X65 A;  1NR4 A;  1WTW A;  3BVM A;  2UUA L;  3J7A 5;  5KRU A;  5EKI A;  1FGU A;  1BBX C;  4F88 A;  1HFG A;  2EY6 A;  3HRZ C;  5EKL A;  2Q2H A;  1QCB D;  5CV7 A;  3C1F A;  2Z1C A;  3ERS X;  1WJJ A;  2Q2U A;  4KY5 A;  2PNH A;  3BZC A;  1PH1 A;  3R2I A;  1RCV D;  2IHE A;  4L8J A;  3NE5 B;  1SR3 A;  1I94 L;  4GKJ L;  4AYB B;  3CCL A;  3RZD H;  4DV5 Q;  3OWF A;  1IW7 D;  2P5Z X;  2F4V Q;  1PH7 A;  1C4Q A;  4KHV A;  2K32 A;  2JA5 H;  3S1N B;  3GD7 A;  4KY7 A;  4K6D A;  4QGU A;  2EYL A;  4NXN L;  3PUY A;  2BA1 A;  4BA2 I;  2MP1 A;  2I5M X;  3HKZ E;  2C9O A;  1GD7 A;  5IT9 E;  2K50 A;  5LMN L;  1O78 A;  4R4O A;  3S14 B;  2G5D A;  3M7G A;  3NP8 A;  3HKS A;  2XSC A;  5C3E H;  1UWV A;  5FJ8 H;  3J80 i;  4IPH A;  4ZQ3 A;  1TII D;  1DOL A;  2GA4 B;  2F0W A;  4MNO A;  1X3P A;  2CW0 C;  4A3I G;  4NXM L;  1A62 A;  1LTR D;  4JI7 L;  4IOC A;  1VDZ A;  4X65 L;  4DAY A;  1SN8 A;  2A6E D;  4A3G G;  1MIU A;  1BDO A;  1PYW D;  5IGD A;  3NBH A;  1AEX A;  2SDF A;  5IP9 H;  3BS1 A;  1JJC B;  3NUC A;  3TP6 A;  1N32 Q;  3SVM A;  1IBM L;  2SNM A;  4CDF C;  3H6M A;  1G91 A;  2JQO A;  2SOB A;  1HNZ Q;  3HKZ B;  5C4J H;  2B2T C;  2MO1 A;  4OON A;  4GZY C;  1I6H H;  3BJU A;  2G9D A;  3G7L A;  4BBR B;  3FKI H;  1XTD A;  4QMG A;  2XWJ B;  1TWA H;  4KTA A;  2F0U A;  2RDF A;  1KD1 C;  2B63 G;  1D2B A;  2OF1 A;  2ZJR A;  2B2W A;  4IPG A;  1P16 A;  3HOZ G;  1TT2 A;  4NPS A;  2C35 B;  2FHT A;  5DNF A;  1NBW A;  2K5H A;  4E6I A;  2A6H C;  1HQR D;  1F9R A;  2V4D A;  5M5W H;  4Y7N B;  4A93 G;  1W2B A;  1VQK A;  1AFP A;  1JE5 A;  5C4X H;  5I6Y A;  5D14 A;  3CCM A;  3AMU A;  4CDD C;  1DOM A;  1DYQ A;  3I4N G;  2XWB B;  3NEL A;  2QDL A;  2WIN B;  1HH2 P;  3PF5 A;  1SYD A;  2EQS A;  4RAU C;  4J6H A;  1WTX A;  1WD0 A;  1ET9 A;  1I3Q B;  2O2L D;  4B3R Q;  2CH4 A;  3PQI A;  4DGZ A;  4RCO A;  5IP7 G;  1PH6 A;  1X3E A;  1LAB A;  2BH8 A;  5BR8 L;  1BCP D;  1KHI A;  4XYO A;  4DV6 Q;  1V1P A;  2UUB L;  3GV3 A;  3PF4 A;  4JG2 A;  3G48 A;  1WOC A;  5COY A;  5FLX c;  2M9V A;  3JAM c;  5D3I B;  3KLS X;  4XQQ A;  2CWP A;  2N8N A;  4JI6 L;  2K6A A;  1I50 H;  2Z8L A;  4P2C B;  4QL5 A;  2EZV A;  2A68 D;  4YHH L;  1M1K C;  1GJX A;  4PMC A;  4RGN A;  1ENC A;  1E22 A;  4XQJ A;  5H1S E;  5L37 A;  3T1H Q;  1MKH A;  2O5J C;  1C0A A;  1B2T A;  4JI3 Q;  4AQY L;  4OIK A;  2O5I C;  5CYU A;  4GS3 A;  1EY6 A;  5JPN C;  4R4C A;  2KOL A;  1E7Z A;  1QOH A;  1I4G A;  4A76 A;  2EY1 A;  3H94 A;  1PA6 A;  1EY9 A;  4LMQ D;  5I6W A;  1O7Y A;  1LT5 D;  3MHB A;  4DV4 Q;  1ONL A;  1JIC A;  4A75 A;  4IUR A;  2I5H A;  2L15 A;  1CKN A;  1KNE A;  1VMC A;  5A35 A;  4V0B A;  4GKK Q;  5CBE E;  2N88 A;  1L0Y B;  1A63 A;  3BDO A;  3UDX A;  2OTJ A;  3DHQ A;  2EPB A;  1H9M A;  1CFM A;  2NWG A;  4BY1 B;  2F1M A;  1RIP A;  1ENF A;  3VDY A;  5HUR A;  1VQ9 A;  4B08 A;  4LF7 Q;  1LV9 A;  1MSG A;  1SE4 A;  3KF8 B;  5IT9 L;  5JJZ A;  2WB1 G;  2Z9H A;  3J7A F;  1YBY A;  1VQM A;  5IYC H;  2D2C C;  2JA5 B;  2L0C A;  4OO1 G;  2BE5 D;  3S1Q H;  2LFN A;  1L1O B;  3M4O B;  2GVA A;  2K4K A;  5M3M H;  2UU9 L;  4C56 C;  1CT1 D;  1IKM A;  3FHW A;  2FXQ A;  2O4X A;  5C3E B;  2JA6 B;  4AH6 A;  2KEN A;  4QB4 A;  4F8M A;  2CQA A;  1VCI A;  5DEH A;  5M5Y H;  1HXY D;  2BA0 A;  4XXE A;  4LF4 L;  5KND A;  4B9X A;  2JK8 A;  5F2D A;  4C3J H;  3NXW A;  4F7X A;  3OWE B;  2X6G A;  5BN4 A;  2PNR C;  1GUT A;  1X56 A;  3KDF B;  4HJ9 A;  3CHB D;  2AHO B;  3K0X A;  4IUV A;  3UE0 A;  3E5S A;  4JI2 L;  2Z0S A;  1JT8 A;  2VZA A;  1EOV A;  5IGB A;  2E2J B;  4YWK A;  1ZEQ X;  5KIX A;  1ET6 A;  4P73 A;  4DR2 L;  1PRT F;  1KAW A;  1EZ6 A;  5JEA H;  5CV4 A;  3OOC A;  3I90 A;  2B2U A;  5IGF A;  1U9R A;  4GN5 A;  1Y1W G;  4OGQ C;  4L5S A;  1HTL D;  4H7B A;  3F2C A;  2ICE C;  4PNY A;  2ZJP A;  3C3L A;  3DMU A;  3U58 A;  1L0X B;  1PFN A;  1TWA B;  2CH4 W;  2WAQ E;  2L4N A;  3RD4 A;  4HCE A;  3HS0 C;  2ENB A;  1TY2 A;  4YY3 L;  5LL6 S;  4ZUJ A;  3IRB A;  2HHH L;  2A69 C;  1HPC A;  2F4I A;  2RKS A;  1EQV A;  3KK7 A;  2UUA Q;  2YV5 A;  4OIJ A;  1RTO A;  5KNC A;  2JJQ A;  1G6P A;  4DPG A;  3I2Z A;  5C4X B;  1XTC D;  2XRS D;  1FYC A;  1PZK D;  5FLX E;  4A3E G;  3D8G A;  2MNA A;  4R4I A;  1A6X A;  2ATW A;  4LF9 Q;  3JAM E;  3FPP A;  3OW2 A;  2BDO A;  3GTJ B;  1SBB B;  1I94 Q;  2J4X A;  3SE0 A;  4IPD A;  4EVO A;  1RTN A;  1HR0 L;  4MN3 A;  4K0K L;  3PO3 G;  4OO1 I;  1QZH A;  1SE8 A;  1D1K A;  2BE5 C;  4KY6 A;  3BDC A;  1E2V A;  2WAQ B;  1KLG D;  2C5C A;  3ERO A;  1PMR A;  1YIT A;  1EYD A;  4NXN Q;  3KLR A;  3URY A;  1UNS A;  1Y8N B;  2F0G A;  2EE1 A;  4APV A;  2WV6 D;  2KUM A;  5LMN Q;  4OHJ A;  2KCT A;  3I8Z A;  4A3G H;  3CW2 C;  2RDG A;  3VA5 A;  1GUW A;  2H4O A;  4EQP A;  1C9O A;  5JJL A;  3AEV A;  4L6T B;  1Q82 C;  3BVG A;  4B9W A;  4CKC A;  4DR7 L;  1STG A;  2RQX A;  4OL7 A;  5M3F G;  1LUZ A;  3A56 A;  4FNF A;  1EWH A;  1LAC A;  2D9U A;  5ELO A;  4JBW A;  1JWS D;  2AUK A;  4NXM Q;  3G6E A;  4M1U B;  1LTI D;  4X65 Q;  3L3O C;  3FPU B;  1VMP A;  2NUC A;  1QB5 D;  5ISR A;  4UP9 A;  2A74 C;  3H0G G;  4Q0F A;  2NN6 G;  1HUN A;  1SYB A;  2B63 H;  3I4M H;  3S16 H;  4R8I A;  1IBM Q;  1TWH H;  2LXJ A;  3T16 A;  2CCZ A;  5TSS A;  3HOZ H;  4N8F A;  1BBW A;  3LGJ A;  1MBY A;  1YIJ A;  2ZTD A;  3LNN A;  2NVQ H;  3MXN B;  3S24 A;  1FVI A;  4A93 H;  1HA5 A;  3ZYY X;  3MC0 B;  5FK9 C;  3RLO A;  2JA7 G;  4G7Z C;  4GNX A;  4A3D G;  3I4N H;  1F2Z A;  4GN3 B;  4QQB X;  2VY3 A;  4PZ8 A;  1IL8 A;  4R8N A;  3HOX G;  1JJG A;  1SND A;  2BOS A;  4KN4 C;  2EY2 A;  5A2Q E;  3M4Q A;  3ULJ A;  3M3Y H;  2B8F A;  1ENA A;  1N8R C;  2E74 C;  2PI2 A;  1O7L A;  5M3M B;  1PZJ D;  3J81 c;  1M4V A;  3A74 A;  5C3W A;  2NBF A;  2D5D A;  4HIO A;  4I7Z C;  4Z9C B;  2OEO A;  1X6O A;  1R9T B;  5JOB A;  4ZRZ A;  4KHZ A;  4NB3 A;  1B8A A;  2ZT9 C;  4JV5 L;  4C3J B;  1HR0 W;  3MTS A;  1GUN A;  3WWV A;  2H1E A;  4LAA A;  2KED A;  3UDF A;  2KHI A;  1DZ1 A;  2X69 A;  5BR8 Q;  1H9S B;  1X54 A;  3A0J A;  2BH2 A;  2UUB Q;  2DY8 A;  1QUQ A;  3VR2 A;  4POF A;  1HHV A;  3CC7 A;  2GN5 A;  1EY7 A;  4GN4 B;  2JA9 A;  1TKW B;  4JI6 Q;  5C44 H;  4MTK A;  3TP8 A;  4YHH Q;  3GTQ B;  2DY7 A;  3VYS A;  1L2F A;  1W6J A;  4RH6 A;  3MVV A;  2EYM A;  3GV6 A;  4EQ5 A;  4N9P A;  3HOV G;  2F0H A;  3R3O A;  1L1O C;  2RCN A;  5KYL A;  3GTG B;  4IAL A;  4AQY Q;  1AW7 A;  4DV2 L;  1ASZ A;  5FKA C;  4LF6 L;  1A3V A;  4L5T A;  2R92 G;  4HJ8 A;  1I4X A;  3KUP A;  4F87 A;  1QE6 A;  3JAM L;  5D65 A;  3T53 B;  2HUG A;  5C0X G;  1JB7 A;  2NN6 I;  3GQB A;  2KHS A;  1B3A A;  2B8G A;  2K05 A;  3F2D A;  3DUZ A;  4KV6 A;  1PLF A;  2R93 G;  1CZW A;  1PRT C;  2G9H D;  2RDH A;  3K7A H;  2LKV A;  4OO1 H;  1CZG A;  2HIV A;  3MAQ A;  3CQZ B;  4A3J G;  1CSP A;  2F3W A;  4LUO A;  1Q46 A;  2K04 A;  2RF4 A;  3CU7 A;  4HIK A;  3KYH C;  1X3F A;  1VQD A;  2A8V A;  2VB2 X;  3RLF A;  2QGQ A;  1B4O A;  4UAI A;  1E2Z A;  4LW1 A;  3OMG A;  2VUM H;  1VQL A;  2TMP A;  2MJ8 A;  1U4L A;  1TWG H;  3PUW A;  2XIW A;  1VQP A;  1VQ6 A;  3N52 A;  2CVR A;  1DJR D;  1X32 A;  3CCV A;  1B53 A;  2UU9 Q;  3HOW G;  2IX3 A;  3EVQ A;  4DKA C;  4C3H H;  5C5M A;  1YJN A;  1SFO H;  3IFT A;  2FFK B;  1WCM B;  3L9A X;  5C5L A;  2VNU D;  1BR9 A;  2RHQ B;  1LT4 D;  2CQO A;  1GUS A;  4G7H C;  3OPO A;  1ILQ A;  2Z6K C;  1PH9 A;  5D3D A;  3VYU A;  4LF4 Q;  1B1Z A;  1Y1W H;  1NNX A;  1HNW L;  1PH4 A;  2XRQ D;  3VR4 A;  2MPM A;  1CSQ A;  1XNR L;  1I4Q A;  4I7A A;  1LTB D;  4DNI A;  1VF7 A;  4JI2 Q;  2SNS A;  5IOD A;  3F2B A;  3D31 A;  1K8O A;  1BF4 A;  3WOE A;  1BQQ T;  2AQ2 B;  4X64 Q;  1RF2 D;  3W1G A;  1EFI D;  1HZB A;  4KK7 A;  3STB D;  4DR2 Q;  1T5X D;  3F2U A;  3I4M B;  3S16 B;  1EL0 A;  1TWH B;  3Q23 A;  1N36 L;  2K7V A;  2F0Q A;  1PH5 A;  3CCS A;  4UP7 A;  3H3V I;  2F0D A;  4K8I A;  3W1B A;  5A2Q L;  3K59 A;  1JR0 D;  2N55 A;  2NVQ B;  4DK1 A;  1XPR A;  3KFU A;  3J81 E;  2E76 C;  4A93 B;  2K5Q A;  4C3I G;  2F0N A;  2E2I H;  1GOZ A;  3RR5 A;  4DR4 L;  4IFD G;  4A3E H;  2PMZ E;  1EY4 A;  2AWO A;  5IOC A;  1EIG A;  1VQI A;  1S5E D;  5C0X I;  1I4R A;  3CPW A;  4YY3 Q;  4JW0 A;  1Q81 C;  2HHH Q;  3LWU A;  4A3L G;  3BYT B;  3FRP B;  2XN9 C;  1IXR A;  4WJW A;  5M5X H;  2VS1 A;  4L63 B;  1HFN A;  4BBS B;  2F0F A;  4A3M H;  4Y52 H;  1EY0 A;  2FMM A;  3GTP H;  2CWA A;  3Q6S A;  2K1B A;  2K5V A;  4GOP C;  1DOK A;  1BUV T;  4K2L A;  1WFQ A;  3UI2 A;  1S3O A;  5KEE A;  5CV5 A;  5EKK A;  3T1Y L;  1BO0 A;  3PIP 3;  4RG1 A;  1STY A;  3RMH A;  5I4D A;  2B2V A;  1HR0 Q;  4DXG A;  1SNO A;  4RGM A;  3ITP A;  1ESF A;  1STA A;  2NVT H;  1MD2 D;  1SMY D;  5KYI A;  1NR2 A;  2PMZ B;  4K5V A;  5M3F H;  2DUD A;  5C44 B;  1BXT A;  3E0E A;  4KKS A;  3E9H A;  1OXU A;  2HDM A;  1TWC H;  4P74 A;  3H0G H;  1KIX A;  1Y1V B;  3PO2 B;  1U4M A;  3HOY G;  1WI5 A;  3SR1 A;  1X55 A;  4LJZ C;  4DAV A;  2JA8 G;  3FVQ A;  1R4P B;  4XQN A;  1DD2 A;  1JE4 A;  4KJN A;  3R2T A;  5C4H A;  1HZ9 A;  3CXC A;  1ASY A;  1E1O A;  2JA7 H;  2OT2 A;  1YHA A;  2AMC B;  1RL2 A;  4A3D H;  4DV0 L;  3GP7 A;  2PPB C;  3K7A B;  5JEA J;  3NTI A;  2X6L A;  4L5Q A;  5JJI A;  1HNX L;  3DXJ C;  4NMZ A;  5IE8 A;  4OWT B;  4ABN A;  1TU2 B;  4PG3 A;  1HCZ A;  3AYH B;  4XT3 B;  4IFD I;  1QNU A;  2OXP A;  1A2T A;  3CRK C;  2R7Z H;  2EYF A;  1SDF A;  1EYG A;  2VUM B;  1N34 L;  1PFS A;  1FD7 D;  1W3S A;  4BY7 G;  2I0Q A;  2ZM6 L;  4DUY L;  3FDT A;  1WTV A;  1TWG B;  5HGQ A;  3V2T A;  1EYA A;  3CCE A;  3CPF A;  3X3N A;  1IYJ B;  1FGB D;  1VQO A;  2UXC L;  2ZTE A;  4YIJ A;  1EEI D;  2I46 A;  3K5L A;  4C3H B;  4GLV B;  1QWY A;  2EJG C;  3LWE A;  4LNQ A;  1HUM A;  4O1N A;  4HR7 B;  4ZAI A;  2IL8 A;  3S2D H;  1IW7 C;  4QCL A;  5KGU A;  2WP8 J;  1CHP D;  1KQS A;  1LM0 A;  1X3Q A;  2NZH A;  2PYK A;  1N33 L;  1G2T A;  1B3Q A;  3NHH A;  3HOU G;  2NVY H;  2HCC A;  5EGT A;  4A3F B;  1CM9 A;  4RA8 A;  3I73 A;  3ZJY C;  1PV4 A;  3EBE A;  5BN5 A;  1QG7 A;  2QEX A;  3S2H H;  1PH8 A;  1I4H A;  5LMN W;  3J81 L;  3DWA A;  2R92 H;  2F0S A;  3UDG A;  1S4Z A;  2NZ1 D;  1CTM A;  4P72 A;  4G57 A;  1F9S A;  2A73 B;  4S3S A;  1VQE A;  3P75 A;  1JOR A;  4ZCK A;  3FMC A;  2ZJQ A;  5EPK A;  4R4T A;  2R93 H;  4OWW B;  3IL8 A;  2A6E C;  4DV2 Q;  4LF6 Q;  4JBK A;  4HMI A;  1SYG A;  1D7Q A;  4IZ8 A;  1BBU A;  1VS0 A;  2F3I A;  1WTP A;  1BVS A;  5DAU A;  1ZXT A;  3SK8 A;  1SYC A;  5I2X A;  1XPU A;  4M8A A;  4ME3 A;  4A3M B;  4RGT A;  2HQE A;  4FVM A;  5FLM G;  3GTP B;  1CQV A;  1X3G A;  3A55 A;  3BDL A;  4QJF A;  2Q8R E;  1SJH D;  1EIY B;  1D5X C;  4H02 A;  1PFM A;  1XXG A;  4X62 L;  1WTR A;  2VL6 A;  1VQG A;  4GLA C;  1ML0 D;  3TDQ A;  1K3R A;  3CKI B;  5CR3 A;  3KBX A;  3PMF A;  3RZD B;  5CC4 A;  2HT1 A;  3A8K E;  1WYD A;  3HOW H;  1RDP D;  1YVC A;  3DEO A;  3W5O A;  3K57 A;  1S40 A;  3TME A;  1SAP A;  5IYB G;  1FNU A;  4OWX B;  3R8B A;  4AIM A;  2NVT B;  3D4W A;  3Q0A A;  4DU9 A;  4UPA A;  1K0R A;  4H44 C;  2Y0S G;  1DCZ A;  2UXB Q;  1EOT A;  1LTA D;  4R4Q A;  1FNV A;  5LL6 X;  1L0W A;  4NW2 A;  3S17 H;  1C48 A;  2IPK D;  3EQL C;  1PZI D;  1KLU D;  2E2D C;  4LF5 L;  2UXD L;  1AN8 A;  4YWM A;  4IQZ A;  5CGK A;  4K8J A;  1WTH A;  2OQK A;  3K8A A;  4GLX A;  5E7N A;  2PQE A;  3H0G B;  1JOK A;  4I65 A;  1YJ9 A;  2K5D A;  1BCP C;  5IGG A;  4A3B H;  1PRT B;  4BBR G;  4WJ4 A;  1HNW Q;  4DXF A;  3H15 A;  1KL9 A;  2MFI A;  4H0L C;  1XNR Q;  3MFG A;  1YNJ D;  4PZ7 A;  3CC4 A;  2FIN B;  4C3I H;  3BZK A;  2H5X A;  3RLN A;  2A68 C;  1DGS A;  1LYL A;  4DV7 L;  4JI1 L;  5CV6 A;  3W2D A;  4PZ6 A;  2B39 A;  2I07 B;  4LF8 L;  4IFD H;  5T1G A;  3EIV A;  2R7F A;  1SYE A;  5GRO A;  3J80 c;  5C4J B;  3CCQ A;  1N36 Q;  4A3L H;  1I6H B;  2WKC A;  1JOO A;  2PW5 A;  2R7D A;  2FMC A;  1JWU D;  2A19 A;  4FDB A;  3PSI A;  3FKI B;  3CAM A;  1B9M A;  1LLR D;  1STH A;  1HZC A;  1EY8 A;  3TZD A;  3VYT A;  3TRE A;  2KBN A;  1PH3 A;  2VXW A;  3KF8 A;  3D4R A;  3PUV A;  3PUX A;  1IBK L;  2R7Z B;  1OXX K;  1FL0 A;  4DR4 Q;  3KBG A;  3VR6 A;  1EQR A;  2B2W C;  2EYP A;  4LUV A;  4TQU S;  2IX0 A;  4DR1 L;  1WVL A;  4KKU A;  5E4X A;  1K3B C;  4LFC L;  1BNZ A;  2MQH A;  4HED A;  5M5W B;  4FF4 A;  1GHK A;  1STN A;  1SJE D;  3KF6 B;  4DAP A;  5EBC A;  3M4P A;  3KLW A;  1XNQ L;  1SE2 A;  3K7U C;  4PV1 C;  3CCU A;  2HD3 A;  1GO3 E;  2K33 A;  3QO2 A;  4GKJ Q;  3T1Y Q;  3I4O A;  3MZ5 A;  1XWE A;  4DV3 L;  3KDF A;  1H9J A;  2NYZ D;  4ME5 A;  3S2H B;  1VQ4 A;  1I50 B;  5FO9 B;  1Q7Y C;  3ND9 A;  5GQO A;  4A3I H;  2JA8 H;  3DM3 A;  4GNX B;  1PDQ A;  4JOI A;  4EQO A;  3QIA A;  1YNN D;  3TS0 A;  4NDX A;  1XMQ L;  1MI2 A;  3S9W A;  1IZ6 A;  3TQY A;  3BVZ A;  2L5T A;  2WFW A;  4R9W A;  4JYA L;  1NTG A;  4BY1 G;  5COR A;  3AFQ A;  4KI0 A;  1FR3 A;  3SHL A;  4K5W A;  3OTO L;  4GOP B;  1TWF H;  2IT1 A;  4X3U A;  2VQE L;  4JI7 Q;  1B7Y B;  2BCO A;  4ULL A;  2JA5 G;  2B2Y A;  3DWQ A;  3D0F A;  4JBM A;  4DNR B;  1EU3 A;  1UE5 A;  3S1M H;  3ULP A;  4B3T L;  1RKN A;  2MGS A;  3F1Z A;  4MIU A;  3TRZ A;  3SDZ A;  4BXX G;  2WAC A;  2ZXP A;  3M7N A;  4BY7 H;  4DV0 Q;  4C1N I;  3Q22 A;  1UE1 A;  2QEJ C;  1PHJ A;  1MGS A;  1HNX Q;  2JA6 G;  5C3E G;  1F77 A;  2AKW B;  5FJ8 G;  3TN2 A;  2K03 A;  1KRT A;  2YU9 H;  1QNK A;  1K9M C;  1OXS C;  4KD3 A;  5C4Z A;  1N34 Q;  2MUY A;  3S1Q B;  3AFP A;  1GM5 A;  1CA6 A;  2Z4H A;  3FEW X;  2ZM6 Q;  1II3 A;  1EEF D;  4IUN A;  4DUY Q;  2F0P A;  2DNE A;  2PQA B;  3MXU A;  1HTP A;  5IP7 H;  1XMO L;  1QZG A;  2UXC Q;  1O80 A;  3EJI A;  4UHV A;  4KHP L;  1UAP A;  3RZO H;  3BYY B;  1M8A A;  3IAY A;  4A3K G;  5M5Y B;  1YEZ A;  4RMF A;  3PIO A;  4ILW A;  4BS9 A;  2E8G A;  3SGI A;  1TS2 A;  3I3C A;  4J15 A;  4A3B B;  3CMA A;  3J80 E;  1E2W A;  1N33 Q;  1Z6H A;  4HAE A;  5JVH 3;  4DR5 L;  4XDX A;  3DWP A;  1V43 A;  4LK1 C;  4FXD A;  3ND8 A;  2F0L A;  1YNN C;  1TVX A;  2B2U C;  3DEP A;  1GUG A;  4DV6 L;  5C4X G;  3QJY A;  4DA2 A;  2YTX A;  1RJT A;  4IUU A;  3C1E A;  3SEB A;  5EJW A;  2N78 A;  2KVM A;  3NTK A;  5EQ0 A;  3OIP A;  5FLM H;  1LTL A;  4ID6 A;  3I4L A;  1TS3 A;  2J0T D;  5FLX L;  4HIM A;  2MHV A;  1A8V A;  4IUQ A;  2YTY A;  5HY6 A;  4MHE A;  2NVX H;  1PTO D;  2HCI A;  2NB0 A;  1A15 A;  4IJH A;  1GVP A;  1TS5 A;  1ICW A;  4NKL A;  2WAQ G;  4DV1 L;  1PXU A;  5IYB H;  5E4W C;  3SK4 A;  3ULL A;  1A2U A;  4OEM B;  2AQ1 B;  2IWH A;  1O7Z A;  1EY5 A;  3RNU A;  2EOT A;  1IKL A;  4K5X A;  4PMB A;  4X62 Q;  4DN4 M;  1KXL A;  3D6W A;  3E6Z X;  4X3K A;  1M90 C;  4RKL A;  4JBJ A;  3IKJ A;  4DK0 A;  2D0P A;  3K0Y A;  3TP5 A;  4POG A;  4ZK9 B;  2B2T A;  2K52 A;  2LS0 1;  3GO5 A;  4KMU C;  1H9S A;  4KLK A;  2E2H H;  3K5M A;  1PFB A;  1H9R A;  1CI3 M;  2RCF A;  4P75 A;  4BBR H;  2N3S A;  5EPL A;  5CBA E;  4A3I B;  4FP5 D;  2LMC B;  1JC7 A;  2EJM A;  4A3G B;  3DM1 A;  4KKT A;  4TSS A;  1F9P A;  3MEF A;  5FOB B;  1LT3 D;  2JEA I;  1I6V C;  4P71 A;  2R3Z A;  2HQL A;  4B3M L;  2JP1 A;  2JE6 I;  3JAM i;  1S72 A;  1Y14 B;  4Y7N H;  1H95 A;  1IYV A;  2F0I A;  2ES2 A;  1Q12 A;  1D5M C;  1AE2 A;  3QWN A;  1SNM A;  3A5Z B;  4JVZ A;  2N49 A;  3K81 C;  2A5H A;  1NE3 A;  1A0I A;  4DR3 L;  2B63 B;  3G6J B;  3S15 H;  1GXD C;  1S5F D;  2YTV A;  3MXP A;  4LF8 Q;  1I3Q H;  2M00 A;  3OIQ A;  3WOF A;  5M3M G;  3HOZ B;  4BY7 B;  2EJF C;  4X3T A;  3NWS A;  4DUZ L;  1IBL L;  3H3V C;  4FF1 A;  2KEE A;  2UUC L;  4PQX A;  5IGE A;  4GNX C;  3I4N B;  2YU9 B;  1QIL A;  1IBK Q;  4C2M H;  3OSO A;  1PTO C;  3M85 A;  1VQA A;  4KD4 A;  3M3Y B;  1PYB A;  4DR1 Q;  1BCP B;  2XVS A;  1JMC A;  1O7I A;  3PO3 H;  3D3R A;  3IFD A;  3X3M A;  1K73 C;  1T5E A;  1VQ7 A;  2LSS A;  3RZO B;  5ELB A;  2EVB A;  4DAY B;  1ESR A;  4JI0 L;  1TY0 A;  1BCP F;  5GAG C;  2E5L L;  1XNQ Q;  3NBH B;  2F03 A;  1EIF A;  4YCV A;  1I4P A;  1NMF A;  1Q1B A;  5AFW A;  1D1I A;  3I70 A;  1NAP A;  4K0K Q;  4CBV A;  2WB1 E;  2A6H D;  4LF9 L;  1AZQ A;  4DV3 Q;  5ELC A;  4ALP A;  1U0L A;  1HA6 A;  3CD6 A;  4MTN A;  1KDA A;  4BY1 H;  2IY5 B;  2Y0S E;  1IYU A;  1YHB A;  4CGY B;  1GKH A;  4CKB A;  3MFY A;  1EWC A;  2PO4 A;  4FF3 A;  5IIF A;  4IJL A;  5NUC A;  4ZKB B;  3HEJ A;  1PH2 A;  4B3S L;  1XMQ Q;  3S1R H;  2L9H A;  2NN6 H;  3UE1 A;  3L7Z C;  2K01 A;  1ICF B;  1KDC A;  3MEH A;  4CJ0 B;  1XYI A;  4JYA Q;  3M4O H;  5G3L D;  4BXX H;  4DR7 Q;  2JXM B;  4DR6 L;  4FXK C;  5J1Z A;  3ONA B;  4CHT B;  3QR8 A;  4OXP A;  3OTO Q;  1QVC A;  2JA6 H;  2VQE Q;  2NVX B;  3STB C;  1JB3 A;  3P20 A;  5K5P A;  2SEB D;  1AP0 A;  1CK1 A;  1EQT A;  3U9O A;  2WB1 B;  1OTC A;  1VF5 C;  1WTO A;  4B3T Q;  2IX1 A;  3PCO B;  3GDE A;  3HOX H;  4IFD J;  4FO2 A;  1V1P B;  2K75 A;  2Y0S B;  5EAY A;  1YJW A;  3NBI A;  3GTO H;  4IUT A;  1NMG A;  1WCM G;  2CKZ B;  2E2J H;  4LFA L;  1TS4 A;  4DFA A;  1EZ8 A;  5M9O A;  1OXV A;  2JEB I;  2OCE A;  4A3K H;  1Y8O B;  1P8L A;  5C3X A;  1B70 B;  5IGC A;  4ZKC B;  3K58 A;  2E2H B;  1WD1 A;  1WTQ A;  3A5U A;  2D0O A;  3QOJ A;  2F0K A;  2BDN A;  1Y69 U;  4HID A;  4JI4 L;  1SFO B;  1XMO Q;  1NCV A;  2R61 A;  4NP5 A;  3T56 B;  3L2P A;  1SEB D;  4KHP Q;  1BKB A;  3I4M G;  3T13 A;  2PZT A;  3AB9 A;  3NQT A;  4K14 A;  1ILP A;  3E3X A;  2PZW A;  2L11 A;  4JV5 Q;  4IPC A;  1CKN B;  5ELE A;  4OX9 L;  4UY8 C;  1Y1W B;  4HN7 A;  1RD9 D;  4DK3 C;  1OO9 B;  1J5E L;  1SMY C;  3WDN A;  1A3T A;  2KCM A;  1KRS A;  5CV8 A;  4DK6 C;  3H3V H;  2AUJ D;  5BN3 A;  3HOV H;  2F0E A;  4L5R C;  3BZD B;  4DR5 Q;  4JPB W;  2NTS A;  3GTK H;  3GTJ H;  1VQJ A;  5AJ3 L;  3S15 B;  4G7O C;  1W6K A;  2EDG A;  1Q8K A;  3PIO 3;  3K5O A;  1PTO H;  4BBS G;  3NPP A;  3W3A A;  1GUO A;  1CA5 A;  2E75 C;  2KHJ A;  4RKB A;  5C0X H;  4QUF A;  3J7Y W;  2XGT A;  1DXM A;  1T9H A;  2TSS A;  3H91 A;  4FXG C;  2E2I B;  1CHQ D;  1VQN A;  1F2L A;  4A3E B;  3NWT A;  4C1N K;  4AYB G;  4CJ1 B;  3NEN A;  4K2K A;  4C2M B;  4A3J H;  4QIW E;  5IWA L;  2DN8 A;  2JSO A;  3VYR A;  4JC0 A;  3GTL H;  5K36 G;  3J81 j;  5M5X B;  1YZ6 A;  2KCC A;  4CDC C;  3OW7 A;  3PO3 B;  5T1I A;  4DV1 Q;  5LHY 1;  2VQF L;  2KEC A;  4KJO A;  2NTT A;  1JCK B;  5C44 G;  3OMC A;  1F2M A;  2RVL A;  3RUZ A;  2F0J A;  3HFZ B;  2V1C C;  1B9N A;  1CKM A; 
#chains in the Genus database with same CATH homology
 2A69 D;  1KAB A;  2B2V C;  2Z4I A;  3R93 A;  1DM0 B;  1Q1E A;  4RWS C;  1AZP A;  1LTS D;  5M3F B;  3NTH A;  4ZYS A;  4QIW B;  3NQI A;  4RHS A;  5I9O A;  1ROD A;  1TWC B;  5KNB A;  3S1R B;  4EQN A;  4ZUI A;  4IUP A;  3P1H A;  5FO8 B;  1V8Q A;  4J1M A;  2YYZ A;  1SE3 A;  1OXT A;  4U67 3;  1GHJ A;  2L1B A;  3A7L A;  2AWN A;  2F0V A;  1KNA A;  3M4Y A;  1LT6 D;  4XIG S;  2JA7 B;  4A3D B;  4X3S A;  3O13 A;  3HOX B;  1Y8P B;  3MA2 B;  3GTO B;  4C3H G;  1ZKO A;  5I2Y A;  1G8Z D;  2F0M A;  1G2S A;  3V05 A;  2IJ0 A;  5DM6 3;  3EFX D;  1ZYR D;  3LX0 A;  4A3K B;  5E3F A;  4IN3 A;  1S5D D;  4XTC S;  3SK6 A;  2D62 A;  1DON A;  1U4P A;  1NSN S;  1LTT D;  1XX8 A;  3QG1 A;  3TBI B;  3S2D B;  2EYO A;  3VR3 A;  4CJ2 C;  2K5W A;  1CQF A;  2NVY B;  1Q90 A;  1A3U A;  2J7Z A;  3HOV B;  5FO7 B;  5HGT A;  2IW3 A;  3NSW A;  3SK5 A;  3GTK B;  1SXT A;  2R92 B;  3TSS A;  1SYF A;  2F0T A;  1B44 D;  1PTO B;  1NUC A;  5C6A A;  3QOL A;  4PMW A;  3HZX A;  1PTO F;  2R93 B;  2AQ3 B;  4KN7 C;  2RSO A;  1STE A;  1D5Z C;  3A8J E;  5J22 A;  2ZXR A;  1YNJ C;  4A3J B;  2KCN A;  4ZLT F;  2EXZ A;  3A54 A;  5CV9 A;  3GTL B;  3BG3 A;  1Z47 A;  3MXG A;  3Q24 A;  1F9Q A;  2QKI C;  2K28 A;  2QCP X;  4DF7 A;  4XYQ A;  4QUC A;  3P7J A;  2KA7 A;  3KLS A;  2KJX A;  1J8I A;  1KDB A;  4K6L A;  4HMJ A;  3HOW B;  1ZYR C;  3K6O A;  4O42 A;  1G29 1;  4TRD A;  1PRT D;  2LY7 A;  3S17 B;  5DM7 3;  1V1O A;  2FJ2 A;  1K83 B;  3QB3 A;  2Q8T A;  1J9O A;  3E0J A;  3VA7 A;  1Q8I A;  1TQO A;  4HSP A;  3N6R A;  4HCS A;  1R4Q B;  1SSO A;  4CKE A;  4XT1 B;  1UEA B;  3GTM B;  4QF4 A;  4ODG A;  4TKO B;  4UDU C;  3EA6 A;  1B50 A;  3CRL C;  1STB A;  1SNC A;  3I72 A;  4C3I B;  1TR5 A;  1UUP A;  3OHX C;  1C8C A;  3J7A V;  5JVG 3;  2F3V A;  1E0B A;  3TZU A;  3PV0 A;  2EYJ A;  4HTH A;  3C2P A;  5K36 H;  1HRJ A;  1HQM C;  2ICI A;  2M2L A;  3K5N A;  2L12 A;  3MXN A;  2HDL A;  3TP7 A;  2VB3 X;  2RA4 A;  2RBM A;  3T4A C;  5JPM C;  4BA1 I;  2QIL A;  1JWM D;  5CMD A;  4FYD A;  4WFN 3;  3D6C A;  2XNA C;  3H09 A;  5EPJ A;  4RFB A;  1Z7T A;  2DNC A;  3I91 A;  1SNP A;  3U9S A;  4EGV A;  1KTK A;  2QF7 A;  3SXH A;  1RHP A;  1D6E C;  1LTG D;  1QJO A;  3AU7 A;  4HSV A;  1EU4 A;  4RCN A;  5E1F A;  3HGB A;  1S5C D;  2F0O A;  3VR5 A;  3HOY B;  5ELF A;  2EY5 A;  5I9P A;  3MWY W;  2JA8 B;  4Q5V A;  3PUZ A;  1H9K A;  1IHZ A;  1K8M A;  2PZU A;  1BOS A;  5G3L F;  5J39 A;  4RGO S;  3V96 A;  1JQY D;  1S5B D;  4WRD A;  3A8I E;  2Q8I B;  3C46 A;  3ERQ A;  1G6Z A;  2WII B;  1TWF B;  4DNT B;  4RHR A;  4J8Q A;  2RSN A;  1F2Y A;  1SNQ A;  5EBD A;  3T51 B;  1JOQ A;  4H13 C;  2B2Y C;  3S1M B;  3HG9 A;  1U4R A;  1LO5 D;  2EYH A;  2JYO A;  1EYC A;  1Q3L A;  3A7A B;  2WKD A;  2CW0 D;  2KQ3 A;  2QDB A;  5JAV A;  5C0X J;  4BWG B;  2CHB D;  1FNW A;  2ID0 A;  1EIH A;  4C3J G;  1KAA A;  2PW7 A;  5ELD A;  4FF2 A;  4N9T A;  3D4D A;  3NK9 A;  2PCF B;  4G4K A;  2L55 A;  2ZXO A;  3HP3 A;  4V19 0;  2R6G A;  4WOR A;  4JK1 C;  3J80 L;  4U68 A;  3HOU B;  1MSH A;  5JEA G;  1NR4 A;  1WTW A;  3BVM A;  5KRU A;  5EKI A;  1BBX C;  4F88 A;  1HFG A;  2EY6 A;  3HRZ C;  5EKL A;  1QCB D;  5CV7 A;  3C1F A;  2Z1C A;  4KY5 A;  3R2I A;  1RCV D;  4L8J A;  3NE5 B;  4AYB B;  3OWF A;  1IW7 D;  1C4Q A;  4KHV A;  2K32 A;  3S1N B;  3GD7 A;  4KY7 A;  4K6D A;  2EYL A;  3PUY A;  2BA1 A;  4BA2 I;  2MP1 A;  2C9O A;  5IT9 E;  1O78 A;  3S14 B;  3M7G A;  3NP8 A;  2XSC A;  4ZQ3 A;  1TII D;  1DOL A;  2GA4 B;  2F0W A;  1X3P A;  2CW0 C;  1LTR D;  1VDZ A;  4DAY A;  2A6E D;  1BDO A;  1PYW D;  5IGD A;  3NBH A;  1AEX A;  2SDF A;  3BS1 A;  3NUC A;  3TP6 A;  3SVM A;  2SNM A;  3H6M A;  1G91 A;  2SOB A;  3HKZ B;  2B2T C;  4GZY C;  2G9D A;  3G7L A;  4BBR B;  4QMG A;  2XWJ B;  4KTA A;  2F0U A;  2RDF A;  1D2B A;  2OF1 A;  2B2W A;  1TT2 A;  2FHT A;  5DNF A;  4E6I A;  2A6H C;  1HQR D;  1F9R A;  2V4D A;  4Y7N B;  1AFP A;  5I6Y A;  5D14 A;  3AMU A;  1DOM A;  1DYQ A;  2XWB B;  2WIN B;  1SYD A;  4RAU C;  4J6H A;  1WTX A;  1WD0 A;  1ET9 A;  1I3Q B;  2O2L D;  4DGZ A;  4RCO A;  1LAB A;  1BCP D;  4XYO A;  1V1P A;  3GV3 A;  5COY A;  2M9V A;  5D3I B;  3KLS X;  4XQQ A;  2K6A A;  2Z8L A;  4P2C B;  2EZV A;  2A68 D;  1GJX A;  4PMC A;  4RGN A;  1ENC A;  4XQJ A;  2O5J C;  1B2T A;  4OIK A;  2O5I C;  5CYU A;  1EY6 A;  5JPN C;  2KOL A;  1QOH A;  1I4G A;  2EY1 A;  3H94 A;  1EY9 A;  4LMQ D;  5I6W A;  1O7Y A;  1LT5 D;  3MHB A;  1ONL A;  1JIC A;  4IUR A;  1KNE A;  1VMC A;  5A35 A;  4V0B A;  5CBE E;  2N88 A;  1L0Y B;  3BDO A;  3DHQ A;  2EPB A;  1H9M A;  1CFM A;  2NWG A;  4BY1 B;  2F1M A;  1ENF A;  5HUR A;  4B08 A;  1LV9 A;  1MSG A;  1SE4 A;  5IT9 L;  5JJZ A;  3J7A F;  2D2C C;  2JA5 B;  2L0C A;  4OO1 G;  2BE5 D;  2LFN A;  3M4O B;  4C56 C;  1CT1 D;  1IKM A;  2JA6 B;  2O4X A;  5C3E B;  4QB4 A;  4F8M A;  2CQA A;  1VCI A;  5DEH A;  1HXY D;  2BA0 A;  4XXE A;  5KND A;  4B9X A;  5F2D A;  3NXW A;  4F7X A;  3OWE B;  2X6G A;  5BN4 A;  2PNR C;  1GUT A;  3CHB D;  4IUV A;  3E5S A;  5IGB A;  2E2J B;  1ZEQ X;  5KIX A;  1ET6 A;  1PRT F;  1EZ6 A;  5JEA H;  5CV4 A;  3OOC A;  3I90 A;  2B2U A;  5IGF A;  1U9R A;  4OGQ C;  1HTL D;  4H7B A;  2ICE C;  4PNY A;  3C3L A;  3DMU A;  1L0X B;  1PFN A;  1TWA B;  2L4N A;  3RD4 A;  4HCE A;  3HS0 C;  2ENB A;  1TY2 A;  5LL6 S;  4ZUJ A;  2A69 C;  1HPC A;  2F4I A;  2RKS A;  1EQV A;  3KK7 A;  4OIJ A;  1RTO A;  5KNC A;  5C4X B;  1XTC D;  2XRS D;  1FYC A;  1PZK D;  5FLX E;  1A6X A;  3D8G A;  3JAM E;  3FPP A;  2BDO A;  3GTJ B;  1SBB B;  2J4X A;  3SE0 A;  4EVO A;  1RTN A;  4MN3 A;  4OO1 I;  1D1K A;  2BE5 C;  4KY6 A;  3BDC A;  1E2V A;  2WAQ B;  1KLG D;  2C5C A;  3ERO A;  1PMR A;  1EYD A;  3KLR A;  3URY A;  1UNS A;  1Y8N B;  2F0G A;  2EE1 A;  2WV6 D;  2KUM A;  4OHJ A;  3I8Z A;  2RDG A;  3VA5 A;  1GUW A;  2H4O A;  4EQP A;  4L6T B;  3BVG A;  4B9W A;  4CKC A;  1STG A;  2RQX A;  4OL7 A;  3A56 A;  4FNF A;  1EWH A;  1LAC A;  2D9U A;  4JBW A;  1JWS D;  2AUK A;  4M1U B;  1LTI D;  3L3O C;  3FPU B;  1VMP A;  2NUC A;  1QB5 D;  5ISR A;  2A74 C;  4Q0F A;  2NN6 G;  1HUN A;  1SYB A;  4R8I A;  3T16 A;  5TSS A;  1MBY A;  3LNN A;  1HA5 A;  3ZYY X;  3MC0 B;  5FK9 C;  4G7Z C;  1F2Z A;  1IL8 A;  4R8N A;  1SND A;  2BOS A;  4KN4 C;  2EY2 A;  5A2Q E;  2B8F A;  1ENA A;  2E74 C;  5M3M B;  1O7L A;  1PZJ D;  1M4V A;  5C3W A;  2NBF A;  2D5D A;  4I7Z C;  4Z9C B;  2OEO A;  1R9T B;  5JOB A;  4ZRZ A;  4KHZ A;  2ZT9 C;  4C3J B;  3MTS A;  1GUN A;  2H1E A;  4LAA A;  2KED A;  1DZ1 A;  2X69 A;  1H9S B;  2DY8 A;  3VR2 A;  1HHV A;  1EY7 A;  1TKW B;  3TP8 A;  3GTQ B;  2DY7 A;  3VYS A;  1W6J A;  4RH6 A;  3MVV A;  2EYM A;  3GV6 A;  4N9P A;  2F0H A;  3R3O A;  5KYL A;  3GTG B;  4IAL A;  1AW7 A;  5FKA C;  1A3V A;  1I4X A;  3KUP A;  4F87 A;  1QE6 A;  3JAM L;  5D65 A;  3T53 B;  2HUG A;  5C0X G;  2NN6 I;  3GQB A;  2KHS A;  1B3A A;  2B8G A;  2K05 A;  3DUZ A;  4KV6 A;  1PLF A;  1CZW A;  1PRT C;  2G9H D;  2RDH A;  4OO1 H;  2LKV A;  1CZG A;  3MAQ A;  3CQZ B;  2F3W A;  2K04 A;  3CU7 A;  2VB2 X;  3RLF A;  1B4O A;  4UAI A;  1E2Z A;  3OMG A;  2TMP A;  2MJ8 A;  1U4L A;  3PUW A;  2XIW A;  3N52 A;  2CVR A;  1DJR D;  1X32 A;  1B53 A;  2IX3 A;  3EVQ A;  5C5M A;  3IFT A;  2FFK B;  1WCM B;  3L9A X;  5C5L A;  2VNU D;  1BR9 A;  1LT4 D;  1GUS A;  4G7H C;  3OPO A;  1ILQ A;  5D3D A;  3VYU A;  1B1Z A;  2XRQ D;  3VR4 A;  2MPM A;  1I4Q A;  1LTB D;  1VF7 A;  2SNS A;  5IOD A;  1K8O A;  3D31 A;  1BF4 A;  3WOE A;  1BQQ T;  2AQ2 B;  1RF2 D;  1EFI D;  4KK7 A;  1T5X D;  3F2U A;  3I4M B;  3S16 B;  1EL0 A;  1TWH B;  3Q23 A;  2K7V A;  2F0Q A;  2F0D A;  4K8I A;  5A2Q L;  3K59 A;  2NVQ B;  1JR0 D;  2N55 A;  4DK1 A;  3J81 E;  2E76 C;  4A93 B;  2K5Q A;  4C3I G;  2F0N A;  1GOZ A;  4IFD G;  1EY4 A;  2AWO A;  5IOC A;  1EIG A;  1S5E D;  5C0X I;  1I4R A;  3LWU A;  3BYT B;  3FRP B;  2XN9 C;  4WJW A;  4L63 B;  1HFN A;  4BBS B;  2F0F A;  1EY0 A;  2FMM A;  3Q6S A;  2K1B A;  1DOK A;  1BUV T;  4K2L A;  3UI2 A;  5KEE A;  5CV5 A;  5EKK A;  1BO0 A;  3PIP 3;  1STY A;  3RMH A;  5I4D A;  2B2V A;  4DXG A;  1SNO A;  4RGM A;  3ITP A;  1ESF A;  1STA A;  1MD2 D;  1SMY D;  5KYI A;  1NR2 A;  2PMZ B;  4K5V A;  5C44 B;  1BXT A;  4KKS A;  1OXU A;  2HDM A;  1Y1V B;  3PO2 B;  1U4M A;  3SR1 A;  4LJZ C;  4DAV A;  3FVQ A;  1R4P B;  4XQN A;  1DD2 A;  1JE4 A;  4KJN A;  3R2T A;  5C4H A;  2OT2 A;  3GP7 A;  2PPB C;  3K7A B;  5JEA J;  3NTI A;  2X6L A;  3DXJ C;  4NMZ A;  4ABN A;  1TU2 B;  1HCZ A;  4XT3 B;  4IFD I;  1QNU A;  2OXP A;  1A2T A;  3CRK C;  2EYF A;  1SDF A;  2VUM B;  1FD7 D;  3FDT A;  1WTV A;  1TWG B;  3V2T A;  1EYA A;  3X3N A;  1FGB D;  4YIJ A;  1EEI D;  2I46 A;  3K5L A;  4C3H B;  1QWY A;  2EJG C;  3LWE A;  1HUM A;  4O1N A;  4HR7 B;  4ZAI A;  2IL8 A;  4QCL A;  1IW7 C;  5KGU A;  2WP8 J;  1CHP D;  1X3Q A;  2PYK A;  1G2T A;  3NHH A;  2HCC A;  5EGT A;  4A3F B;  1CM9 A;  4RA8 A;  3I73 A;  5BN5 A;  1QG7 A;  1I4H A;  3J81 L;  3DWA A;  2F0S A;  1S4Z A;  2NZ1 D;  1CTM A;  4G57 A;  1F9S A;  2A73 B;  4S3S A;  3P75 A;  1JOR A;  3FMC A;  5EPK A;  3IL8 A;  2A6E C;  4HMI A;  1SYG A;  4IZ8 A;  1WTP A;  5DAU A;  1ZXT A;  3SK8 A;  1SYC A;  5I2X A;  4M8A A;  4A3M B;  4RGT A;  2HQE A;  4FVM A;  3GTP B;  1CQV A;  3A55 A;  3BDL A;  2Q8R E;  1SJH D;  1D5X C;  1WTR A;  1PFM A;  1XXG A;  1ML0 D;  3TDQ A;  5CR3 A;  3CKI B;  3RZD B;  3KBX A;  3PMF A;  5CC4 A;  3A8K E;  1RDP D;  3DEO A;  3K57 A;  3TME A;  1SAP A;  1FNU A;  3R8B A;  2NVT B;  3D4W A;  3Q0A A;  4DU9 A;  4H44 C;  1DCZ A;  1EOT A;  1LTA D;  1FNV A;  5LL6 X;  4NW2 A;  1C48 A;  2IPK D;  3EQL C;  1PZI D;  1KLU D;  2E2D C;  1AN8 A;  4IQZ A;  5CGK A;  4K8J A;  2PQE A;  3H0G B;  1JOK A;  4I65 A;  2K5D A;  1BCP C;  5IGG A;  1PRT B;  4DXF A;  4H0L C;  3MFG A;  1YNJ D;  2FIN B;  2A68 C;  3W2D A;  5CV6 A;  4IFD H;  2B39 A;  2I07 B;  5T1G A;  1SYE A;  5C4J B;  1I6H B;  2WKC A;  1JOO A;  2PW5 A;  2FMC A;  1JWU D;  3FKI B;  1B9M A;  1LLR D;  1STH A;  1EY8 A;  3TZD A;  3VYT A;  2VXW A;  3KF8 A;  3D4R A;  3PUV A;  3PUX A;  2R7Z B;  1OXX K;  3KBG A;  3VR6 A;  2B2W C;  2EYP A;  4TQU S;  2IX0 A;  1WVL A;  4KKU A;  5E4X A;  1BNZ A;  4HED A;  5M5W B;  4FF4 A;  1GHK A;  1STN A;  1SJE D;  4DAP A;  5EBC A;  1SE2 A;  4PV1 C;  3QO2 A;  2K33 A;  3MZ5 A;  1XWE A;  1H9J A;  2NYZ D;  4ME5 A;  3S2H B;  1I50 B;  5FO9 B;  3ND9 A;  1PDQ A;  4EQO A;  3QIA A;  1YNN D;  4NDX A;  1MI2 A;  3S9W A;  3BVZ A;  2L5T A;  4R9W A;  5COR A;  4KI0 A;  1FR3 A;  3SHL A;  4K5W A;  2IT1 A;  4X3U A;  2BCO A;  4ULL A;  2B2Y A;  3DWQ A;  4DNR B;  1EU3 A;  1RKN A;  2MGS A;  4MIU A;  3SDZ A;  2WAC A;  2ZXP A;  3M7N A;  4C1N I;  3Q22 A;  2QEJ C;  1MGS A;  1F77 A;  3TN2 A;  2K03 A;  1QNK A;  1OXS C;  4KD3 A;  5C4Z A;  2MUY A;  3S1Q B;  1CA6 A;  2Z4H A;  3FEW X;  1II3 A;  1EEF D;  4IUN A;  2F0P A;  2DNE A;  3MXU A;  1HTP A;  1O80 A;  3EJI A;  1UAP A;  3BYY B;  1M8A A;  3IAY A;  5M5Y B;  4ILW A;  4BS9 A;  1TS2 A;  3I3C A;  4A3B B;  3J80 E;  1E2W A;  1Z6H A;  4HAE A;  5JVH 3;  4XDX A;  3DWP A;  1V43 A;  4LK1 C;  4FXD A;  3ND8 A;  2F0L A;  1YNN C;  1TVX A;  2B2U C;  3DEP A;  1GUG A;  3QJY A;  4DA2 A;  1RJT A;  4IUU A;  3C1E A;  3SEB A;  5EJW A;  2KVM A;  3NTK A;  5EQ0 A;  3OIP A;  4ID6 A;  3I4L A;  1TS3 A;  2J0T D;  5FLX L;  2MHV A;  4IUQ A;  4MHE A;  1PTO D;  2HCI A;  2NB0 A;  1A15 A;  1TS5 A;  1ICW A;  4NKL A;  1PXU A;  5E4W C;  3SK4 A;  1A2U A;  2IWH A;  2AQ1 B;  1O7Z A;  1EY5 A;  2EOT A;  1IKL A;  4K5X A;  4PMB A;  4DN4 M;  3D6W A;  3E6Z X;  4X3K A;  4RKL A;  3IKJ A;  4DK0 A;  3K0Y A;  3TP5 A;  4ZK9 B;  2B2T A;  2LS0 1;  3GO5 A;  4KMU C;  1H9S A;  3K5M A;  1PFB A;  1H9R A;  1CI3 M;  4A3I B;  5EPL A;  5CBA E;  4FP5 D;  2LMC B;  1JC7 A;  2EJM A;  4A3G B;  3DM1 A;  4KKT A;  4TSS A;  1F9P A;  5FOB B;  1LT3 D;  2JEA I;  1I6V C;  2R3Z A;  2JP1 A;  2JE6 I;  1IYV A;  2F0I A;  1Q12 A;  1D5M C;  3QWN A;  1SNM A;  2A5H A;  2B63 B;  3G6J B;  1GXD C;  1S5F D;  3MXP A;  3HOZ B;  2M00 A;  3OIQ A;  3WOF A;  4BY7 B;  2EJF C;  4X3T A;  3NWS A;  3H3V C;  4FF1 A;  2KEE A;  4PQX A;  5IGE A;  3I4N B;  2YU9 B;  1QIL A;  3OSO A;  1PTO C;  3M85 A;  4KD4 A;  3M3Y B;  1BCP B;  2XVS A;  3D3R A;  3IFD A;  3X3M A;  1T5E A;  3RZO B;  5ELB A;  2EVB A;  1ESR A;  1TY0 A;  1BCP F;  2F03 A;  1I4P A;  1Q1B A;  5AFW A;  1D1I A;  3I70 A;  1NAP A;  4CBV A;  2A6H D;  1AZQ A;  5ELC A;  1HA6 A;  1KDA A;  1IYU A;  4CGY B;  4CKB A;  3MFY A;  1EWC A;  2PO4 A;  4FF3 A;  5IIF A;  5NUC A;  4ZKB B;  3HEJ A;  2L9H A;  2NN6 H;  3L7Z C;  2K01 A;  3MEH A;  1KDC A;  4CJ0 B;  1XYI A;  5G3L D;  2JXM B;  4FXK C;  5J1Z A;  3ONA B;  4CHT B;  2NVX B;  1JB3 A;  3P20 A;  5K5P A;  2SEB D;  1AP0 A;  1CK1 A;  1EQT A;  3U9O A;  2WB1 B;  1VF5 C;  1WTO A;  2IX1 A;  4IFD J;  4FO2 A;  1V1P B;  2Y0S B;  3NBI A;  4IUT A;  1TS4 A;  4DFA A;  1EZ8 A;  5M9O A;  1OXV A;  2JEB I;  1Y8O B;  5C3X A;  5IGC A;  4ZKC B;  3K58 A;  2E2H B;  1WD1 A;  1WTQ A;  3QOJ A;  2F0K A;  2BDN A;  1Y69 U;  1SFO B;  1NCV A;  2R61 A;  4NP5 A;  3T56 B;  1SEB D;  3T13 A;  2PZT A;  3AB9 A;  3NQT A;  4K14 A;  1ILP A;  2PZW A;  2L11 A;  5ELE A;  1Y1W B;  4HN7 A;  1RD9 D;  1OO9 B;  1SMY C;  3WDN A;  1A3T A;  5CV8 A;  2AUJ D;  5BN3 A;  2F0E A;  3BZD B;  2NTS A;  4G7O C;  3S15 B;  1W6K A;  2EDG A;  3PIO 3;  3K5O A;  1PTO H;  3NPP A;  3W3A A;  1GUO A;  1CA5 A;  2E75 C;  4RKB A;  5C0X H;  4QUF A;  3J7Y W;  1DXM A;  2TSS A;  3H91 A;  4FXG C;  2E2I B;  1CHQ D;  1F2L A;  4A3E B;  3NWT A;  4C1N K;  4CJ1 B;  4K2K A;  4C2M B;  2DN8 A;  2JSO A;  3VYR A;  5K36 G;  5M5X B;  2KCC A;  3OW7 A;  3PO3 B;  5T1I A;  5LHY 1;  2KEC A;  4KJO A;  2NTT A;  1JCK B;  3OMC A;  1F2M A;  2RVL A;  3RUZ A;  2F0J A;  1B9N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...