2GA4B

Stx2 with adenine
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
70
structure length
70
Chain Sequence
ADCAKGKIEFSKYNEDDTFTVKVDGKEYWTSRWNLQPLLQSAQLTGMTVTIKSSTCESGSGFAEVQFNND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Shiga-like toxin II subunit A
publication title Binding of adenine to Stx2, the protein toxin from Escherichia coli O157:H7.
pubmed doi rcsb
molecule tags Toxin
total genus 19
structure length 70
sequence length 70
chains with identical sequence C, D, E, F
ec nomenclature
pdb deposition date 2006-03-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.70 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2ga4B00
2GA4B 1C4QA 1CZWA 1C48A 1QOHA 4P2CB 2BOSA 3MXGA 1CQFA 1BOSA 1R4QB 1D1IA 4M1UB 2C5CA 1QNUA 1D1KA 2XSCA 1CZGA 1DM0B 1R4PB 4ULLA
chains in the Genus database with same CATH superfamily
3GD7A 1PDQA 3RZOH 3X3NA 1JB3A 2PZTA 3ER0A 4F8MA 5ELEA 1AZQA 3S15H 1DONA 4ZUIA 4OIKA 2NZ1D 3KLWA 2C9OA 1DCZA 4LF4L 1JWSD 1I4RA 3U9OA 2K28A 3QB3A 2XVSA 4AIMA 4ZYSA 3IAYA 5IP9G 4OIJA 1X56A 2JJQA 5I6YA 4LF9L 5CBAE 2ZTDA 4XYOA 3IFTA 2PW5A 4ALPA 3NK9A 3AYHB 3A5UA 2R7FA 3DWQA 1WTQA 4IFDI 2JA6H 3CU7A 4TVAB 2WB1G 1N8RC 1IHZA 1TS3A 1F9RA 1KRSA 3LNNA 5KYIA 1TXYA 1U4PA 1F9PA 3VR6A 2RDHA 3WWVA 4IUNA 3HKSA 1GUNA 1V1QA 4LFBL 3GTMH 4AQYQ 3S2HB 1EY5A 1PZJD 3M7NA 1EU4A 1I50B 3J7ZC 3JAML 5C4XG 2KOLA 4C3JB 2QGQA 5M3MH 1Y1VH 4GS3A 2PNRC 3VR4A 5AJ3Q 3HOZB 5AFWA 2GVAA 3DUZA 4DR5L 4C3HH 5FO9B 4A3DG 2B2UC 4CDDC 4AYBG 5KGUA 1PV4A 1SAPA 4JI3L 1Q3LA 1CHQD 1NUCA 2PI2E 1DM0B 1H9JA 1ET6A 1RJTA 1HNZL 2E75C 1QJOA 3QO2A 1HFNA 3QIAA 2K05A 1BCPF 3I4OA 3KF6A 2L55A 4BY1H 1EIHA 1Q1BA 4K5XA 5FLMG 4Y7NH 4A3LG 5I2XA 1YJ9A 5IY0A 4K14A 5CGKA 4XT3B 5J1ZA 3KYHC 5JPMC 1HZCA 4KD3A 3J7AF 1AFPA 3KF8A 1Q12A 1WCMG 1PH8A 4A3MH 4B3TL 1PFSA 2AKWB 5IWAQ 2GA4B 1DOMA 1U0LA 3K7AH 1DJRD 3HOXB 3KF6B 3OPOA 1HTLD 3M4OB 4A3EH 4OX9L 3MXUA 3U58A 1E7ZA 1QWYA 4RA8A 4DV5Q 1MKHA 2JK8A 1EY4A 1PRTB 2B2WA 1VQ8A 3CXCA 4DR1Q 3SK5A 3E0JA 1K8OA 5KEEA 4POGA 2G9DA 5LMUL 1S5DD 2JA8H 4AH6A 2IY5B 4A3GH 5IP7H 4EQPA 4F88A 4R4OA 1YIJA 4IURA 1XWEA 4XTCS 4A3JB 4BXXG 2EE1A 2L4NA 2L12A 4P74A 1VQMA 4R8IA 1STHA 3KDFA 2BE5C 1BBUA 1OXVA 2UUAL 1ASYA 4BBSB 1KD1C 1SJED 3TEHB 4FF1A 1SE3A 2HDMA 1EOVA 1F2MA 4KKUA 3GTGH 5EKIA 1RODA 1LT4D 1VQIA 1TU2B 2ZXPA 3CKIB 3MHBA 3V96A 3GV6A 5IGDA 4K2KA 1EFID 1LTLA 1Q81C 4YCVA 2F0OA 5FJ8H 1RL2A 3K80C 3UDGA 3CC7A 1XMOQ 1WI5A 3KDFB 4BWGB 2J4XA 4QIWE 1TWGH 3E5SA 1L0YB 5CV4A 2YU9H 3WOFA 1VQNA 1Q8KA 3T1HL 5IT9c 1HNXL 4DV0Q 2Q2HA 4LFAL 4GN3B 1CKNB 1Q90A 3W2DA 2F0TA 1RTNA 2A74C 1WJJA 3TBIB 3K5MA 4YCUA 2UUCQ 4A76A 3PO2G 2IHEA 1VQOA 1TR5A 3T1YQ 3S1QH 4OEMB 1LABA 5E7NA 5C3XA 2MQHA 2EJGC 1LYLA 1I4HA 1ILPA 5JEAG 2F0GA 3BVGA 3WOEA 3HOWH 1JICA 4R4TA 5JEAJ 3GTJH 1ZEQX 4ZAIA 1L0WA 2X69A 1KDBA 2LFNA 2PMZB 1HZBA 2PMZE 3GTQB 4C2MB 3LX0A 4B3RQ 2IPKD 1OXXK 1EFWA 1WTVA 4K2LA 4BBRH 1B7YB 3TDQA 4B3SQ 3HS0C 2EVBA 1VF5C 2B3GA 3HOVH 1D5ZC 4PNYA 2Q8IB 2LSSA 4HTHA 2PO4A 2ZM6Q 2MGSA 1YNND 1MGSA 3CPFA 5LMNW 1KC8C 3I4MB 5KNBA 1Y8PB 2RA4A 4J1MA 4O0AA 1EU3A 5C3WA 1S40A 4KHVA 1CZWA 1HJPA 1P16A 1Q82C 1C0AA 2FJ2A 1FR3A 4X3TA 2JA6G 5DEHA 4ZKCB 4A93B 4R8NA 3MXNA 5C44B 1M90C 5KNDA 1PRTD 4V0BA 1SNDA 3Q23A 2VQFL 4JOIC 1TWFH 4X65L 2NYZD 2RDFA 3R3OA 1K8AC 2JA7G 1O7IA 1IBMQ 2F0QA 4C56C 5IYDH 1D7QA 2N8NA 5I4DA 2N55A 5C0XG 4FF4A 1I4XA 2HHHL 5M3MG 3FRPB 2A8VA 1Y1VG 4BS9A 1XPOA 5C0XJ 3SEBA 3RNUA 1BOSA 1E2VA 4BY7H 3C1FA 4RWSC 1H9SB 2A6HD 4C3HG 4YY3L 2KVMA 1LACA 1SRUA 2CH4A 5GAEC 4FXGC 4IZ8A 1SE4A 3EJIA 3AQQA 4JI0L 4L63B 1NCVA 1R4PB 3BZCA 5EKLA 4FF3A 4JI8Q 2OQKA 2H1EA 1EWIA 4LF8L 5CV7A 4ABNA 4OWTB 4C3JG 1V8QA 5CC4A 1F2ZA 3HOUH 2Y0SE 2I07B 4MHEA 2VW9A 4JI5Q 1FGBD 4XQJA 4FYDA 3TN2A 1VS0A 3OW2A 3HOZG 4IJHA 2K01A 3VYUA 4X6AH 2AHOB 4A3MG 2F0SA 5IGGA 1HR0Q 3AFPA 2MPMA 4LUVA 2NVQH 4LW1A 1KQSA 3UDFA 2WAQB 2WAQE 3GTKH 4DR4L 3TRZA 5ELOA 1VF7A 2DJGC 3ITPA 1TY2A 1JJGA 1CT1D 3I8ZA 1XNQL 5IGCA 1UEBA 3HEJA 1JT8A 5EPLA 4LF7Q 3A56A 1WVLA 1SFOB 5EPJA 3PF4A 3CCSA 4I65A 2FMCA 2JA8G 2FMMA 5IYBG 1Y8OB 2JA5H 1JCKB 3TP6A 5IP7G 3MC0B 1JWMD 4CHTB 3RZDB 3A55A 2R92H 3W1BA 2WV6D 1R9TB 3S1MH 2IX3A 4KY6A 2JN4A 1BQQT 3MAQA 4XT1B 5FOBB 1BCPD 5IYCG 2J0TD 4YHHL 3M85A 4P73A 1IZ6A 3ERQA 5C4XB 4C1NI 5IODA 3K7UC 2M00A 1K3BC 2JP1A 1U4RA 1TWAB 3RD4A 3VYRA 2EXDA 5FJ8G 1QUQA 3PO3B 4NXMQ 3M4PA 1LTSD 1B50A 4RMFA 1EIYB 3DWPA 1B1ZA 4RKBA 1KDCA 4CGYB 1YNXA 2QF7A 4H0LC 3J81L 3S14B 1IYUA 1N36L 1BR9A 2ZTEA 4A3DB 2KENA 1EY0A 3U4ZA 1AH9A 4IOAA 4OO1G 1SYBA 2C5CA 2NTTA 1H9MA 5D3IB 2IT1A 1OO9B 1P8LA 4X3UA 3OWEB 4BA2I 4NP5A 2YV5A 3J81E 5G3LF 3F2DA 3MEHA 5JOBA 4R4QA 3E9HA 4X66Q 1X3FA 1EQTA 2ZT9C 2K5VA 3H0GB 3PIO3 2OCEA 4QMGA 5IIFA 1QUQB 1HHVA 1Y14B 5CV6A 2GN5A 4Y52H 1G91A 1G51A 3PIP3 3G48A 1X55A 5FKAC 1RIPA 2EYHA 3SK8A 2XNAC 5D65A 4MIUA 4B9XA 2VL6A 1QZGA 2DNCA 1MSHA 3S1NH 3JAMc 1IBLQ 1G2TA 2N49A 2SNMA 2F3WA 1WCMB 2NB0A 1D8LA 3CPWA 2R93H 3PIOA 4ILWA 3S17H 2LXJA 3O13A 4KLKA 4JI1Q 4HN7A 2JEBI 5DAUA 1TKWB 1JOOA 1YBYA 1E0BA 2WINB 3MTSA 2AQ2B 1VMCA 4NMZA 4BBRG 2RSOA 1XMQQ 4X64Q 1V1OA 2F0VA 3KLRA 3R2TA 5DM73 2PZUA 4HCSA 5KIXA 3K0YA 4DV2Q 4RGTA 5DNFA 4DF7A 1OXTA 3A8JE 3BG3A 5LL6X 4A3FH 5LMNL 4DV6Q 5HY6A 1XNRL 4V190 3OTOQ 1L1OA 1PMRA 4K6LA 5EBDA 3BDCA 3CF5A 5JJKA 3S2DB 1DXMA 2F0EA 2NN6H 4JI6L 2B2TC 1KAAA 3NE5B 4DXFA 4HMJA 2N88A 1QVGA 4HEDA 3S1RB 5C3EB 3BDOA 1N33Q 1A0IA 3T4AC 4PMWA 5M5WH 3EIVA 5CMDA 1GOZA 5IYDG 4QF4A 3KUPA 3PQIA 4CJ1B 3CCUA 2NTSA 4FF2A 4DU9A 1CSQA 4ZCKA 4G7HC 1BDOA 2ICEC 3Q0AA 1CM9A 1O7YA 1JC7A 4HCEA 1PHJA 4Q5VA 2F4VL 1E2WA 5C44G 2ES2A 3C46A 3HP3A 2F0DA 3AB9A 3AFQA 4DUZQ 5CR3A 2B2YC 1HZAA 1SNOA 4DV7L 1V43A 1SYEA 3QWNA 2KECA 3I73A 4XQNA 5KNCA 4GLAC 5D3DA 3GTOB 1N32Q 4LNQA 2PZWA 1QZHA 4IPHA 4HJ7A 1NJIC 3HOUG 4R4CA 2EZVA 2Z6KC 2YTVA 3CP0A 3NWTA 2MJ8A 4JVZA 3OWFA 1B2TA 3DWAA 2QW7A 2HT1A 4DAPA 1FNVA 1IBKL 1Q46A 3K59A 3RZOB 2K5WA 5EPKA 1ILQA 2DN8A 1CZGA 4KKSA 4KY7A 3CCVA 4GKKL 1L0XB 1AN8A 4MTNA 3RN2A 4JI7L 3S15B 3OOCA 1EUJA 2XTIA 5M9OA 4B3ML 1QVCA 4L8JA 1EY7A 2L1BA 2UU9L 1EYAA 2FFKB 3HG9A 1JE4A 1M1KC 2B39A 1PTOD 2K4KA 1PH7A 4NXNL 1NMFA 2RF4A 1CA5A 4X3KA 3E0EA 1NAPA 3L3OC 4JYAL 3P1HA 2JA5G 4DR6L 2KHSA 2JSOA 4ULLA 2R92G 1KL9A 3GDEA 2PCFB 4LFCL 3VYSA 1C4QA 2OWOA 5NUCA 2JA6B 4JK1C 4Z9CB 1TWCH 4DK0A 3F2BA 4GN4B 4DK6C 4IPGA 4DNTB 4HJ9A 2WAQG 5CV8A 3TP5A 3GTMB 2H5XA 1I4PA 3FPUB 3QR8A 1Q86C 3FVQA 1LTRD 2JA7B 4JV5L 4GOPA 1GXDC 1IW7C 5AJ3L 3OMCA 5M3MB 1Y1VB 3TQYA 4IFDG 1HCZA 3I4NH 1EY6A 3CMEA 3K5LA 1UUPA 4IFDJ 2A1AA 1CA6A 1ZYRC 4C3HB 1QCBD 2BDNA 4DXGA 2UXDL 1SMYC 4FO2A 4O2DA 4JPBW 5CV5A 1WTWA 1N34L 2AQ3B 2A69C 2LMCB 3DLLA 4GOPB 1WTOA 5IE8A 3KLSA 2ZXRA 2A73B 5I2YA 4Y7NB 5J3BA 1TS2A 1TS4A 2HCIA 4QCLA 2BOSA 3PO3G 2RVLA 2C35B 3TP8A 1H9RA 4ODGA 4JBKA 4RGNA 2F0KA 1UNSA 1F9QA 1I94L 2E5LL 4A3MB 4A3BH 1HUMA 2R93G 3CW2C 1JOKA 3K7AB 4LF4Q 4GLXA 1EWHA 2I46A 4A3EB 1ESRA 4OELB 4P75A 3PUWA 1RD9D 3NQTA 3SE0A 3H0GG 1MBYA 4LF9Q 3F2UA 2I5LX 5EKKA 1FGUA 3U9SA 2VUMH 1ICFB 2UXBL 3IL8A 3G7LA 1I4QA 4QUCA 3PSIA 2JA8B 3BU2A 4A3GB 5FO8B 4LF6L 1C9OA 2EYFA 4G7OC 2B2VC 2R6GA 4CBVA 5LL6S 4DV4L 3L0OA 1CKOA 5FLXE 2CFMA 5G3LD 3L7ZC 3OYYA 3M3YH 3QOJA 2NN6G 1SXTA 3GO5A 4P71A 1KAWA 2HQEA 4JI2L 2G9HD 3GTGB 1D6EC 2NN6I 2QEXA 2OTLA 2VB3X 3GTPH 4K6DA 2XIWA 1MD2D 2KEDA 3CHBD 4DR5Q 2K75A 4LMQD 1ENFA 2B2YA 1KLGD 2E8GA 2CWAA 1S4ZA 1TWGB 4TSSA 4DV0L 5T1GA 2YU9B 4K8JA 4OGQC 4GKJL 2LKVA 3MVVA 4JI3Q 1EQRA 5ELDA 1STNA 1J9OA 3EBEA 2N3SA 1HNZQ 1H95A 2XWBB 2HDLA 4MZ9A 2GVBA 2Z6BA 2RQXA 4UP8A 1I3QH 4LF5L 5EAYA 3J7YW 5I6WA 4OXPA 1GVPA 3TSSA 1CKNA 1H9KA 1BXTA 5C3EG 3S1QB 3J80E 4HIOA 3R2IA 3ND8A 2ZJRA 4QIWB 5BN5A 1VDZA 4B3TQ 4MTKA 2O2LD 3OSOA 3HOWB 2MO0A 4JW0A 3GTJB 2YYZA 1J5EQ 1ENAA 4CDEC 1JMCA 4EX5A 2IL8A 4OX9Q 2VB2X 4B3SL 4EQOA 3D0FA 4LAAA 3TP7A 1X3EA 2I5HA 2BH2A 1GO3E 1STBA 2ZM6L 1VQ9A 1EY8A 2F1MA 2KHIA 4BBRB 3ZYYX 1EYCA 3FKIH 5LMUQ 1XTDA 2EY5A 3HOVB 4DAYB 3HOYH 4A75A 2E2JH 1VQGA 2BDOA 4A3CH 5CYUA 1DOLA 4C3IH 4DR2L 2IJ0A 1X65A 1TWHH 1G6PA 3QJYA 4N9TA 1RTOA 1VCIA 3H91A 5GROA 1F2YA 1CKMA 1CHPD 3T16A 5BN3A 5L37A 1Y1WH 3NBIA 4DAMA 5K36H 5FK9C 4DN4M 4NB3A 1UWVA 3UI2A 4JBWA 2EPBA 4CKBA 1R4QB 3QOLA 3D6CA 2KBNA 3P20A 4DV3L 1TWFB 1KABA 4EQNA 1LT3D 4APVA 3UE1A 3FPPA 4IN3A 3G4SA 3T1HQ 2WFWA 1YITA 4DR3L 2VS1A 3Q6SA 2HUGA 3I4NG 2PQAB 2HQLA 4LFAQ 4BY7B 4XXEA 4HSPA 4H13C 1UE7A 4WFN3 1E2ZA 3ULLA 1A8VA 3H6MA 3J81j 1H9SA 1K83H 5GAGC 3I56A 3NENA 3NEMA 4R1JA 1Z7TA 3K8AA 1SMXA 2ZJQA 3PUXA 3CCRA 4G4KA 3TMEA 1XPRA 3Q22A 1FYCA 1JR0D 2B2UA 1X3PA 3GTLH 2Q2IA 4KHPQ 4MN3A 1VQ4A 4RCNA 5D14A 2V4DA 4ZRZA 3HOUB 1K0RA 1OXUA 1SYGA 1HNWL 1E1OA 4DKAC 1OXSC 3K0XA 2O4XA 2WP8J 3DMUA 5I9OA 2CW0D 3A5ZB 1YJNA 3P75A 5T1IA 2EOTA 2ENBA 4OONA 4H02A 5M5XH 1SE2A 1RF2D 5C6AA 2NVQB 2XRQD 3NELA 3TZUA 2KCMA 4LF7L 3GTKB 1I6VC 3AMUA 4IQZA 2RBMA 4BY1G 1QOHA 5IGEA 4C1NK 2EY1A 1XYIA 2Z4IA 1X3QA 1Y8NB 5CBEE 2OTJA 3RUZA 2Y0SB 1G8ZD 1STEA 1TY0A 3BYYB 3H3VH 2JA5B 3K58A 4KHZA 4QY7A 2KCTA 3A0JA 1LM0A 2R92B 3T56B 4X62Q 3I72A 4XQQA 5J22A 2L9HA 4PG3A 4A3KH 4L5RC 3S1MB 2XWJB 1XTCD 2VQFQ 4IUUA 4L6TB 4GN5A 4ME5A 4BA1I 3CMAA 4WORA 2K50A 2ASBA 4X65Q 3J80i 4A3EG 1L2FA 1WTRA 4DR7L 5ISRA 1VQ7A 4L5TA 3IKJA 2E2IH 3HFZB 5ELNA 2Q8RE 2VZAA 3P7JA 3RR5A 1AW7A 2QA4A 3I4LA 1D2BA 4RCOA 3ICEA 4A3GG 1KDAA 3F8TA 4YY3Q 1G6ZA 4FXKC 2TMPA 4CKEA 2L5TA 2NBFA 3MWYW 3I91A 3E3XA 4GNXC 1FNWA 3EROA 1MSGA 1IXRA 3HKZE 5M5YH 4O1NA 2CCZA 1D5MC 2FHTA 4A3IH 2UUBL 4LF8Q 4UHVA 2WIIB 4JC0A 5C4JH 4K5VA 3PUZA 2R7ZH 1K8GA 4DK1A 2P5ZX 1JJCB 1STGA 4H7BA 1IW7D 3L9AX 4IOCA 1B44D 1IBLL 1FVIA 2WB1E 3S1NB 1VQEA 2K32A 1QNKA 3NTIA 4CDFC 4JI1L 3R8BA 3OIQA 1A2UA 1NNXA 1ZYRD 2HIVA 4DUYL 1A63A 1PZID 4L5QA 1KLUD 3PMFA 4PZ8A 5IP9H 2R93B 2Z0SA 3S17B 3K81C 2VXWA 3RMHA 1MJEA 3TZDA 1CI3M 4DR4Q 4F87A 4X64L 3C1EA 1Q7YC 2VQEL 2X6LA 1ENCA 1XNQQ 3TREA 1TIID 3RLNA 2K33A 1FNUA 3M7GA 3STBC 5HURA 1KNEA 2A6EC 4PMCA 3FKIG 4G7ZC 4DV6L 1ICWA 4IUPA 4AYBE 1W6JA 3G6EA 1YJWA 2Z8LA 4M1UB 4C3IG 1S5FD 4A3FB 1SYFA 4KV6A 3HOWG 2RHQB 4KY5A 4WJ4A 2E74C 1WD1A 1WTHA 5C4HA 5K36G 5J39A 1M8AA 2F0WA 1Q1EA 3PIPA 1X9NA 4YHHQ 4E6IA 1C48A 5JJIA 1UE5A 2K5HA 4UY8C 1YNJC 3NSWA 3CCEA 4ZK9B 1IKMA 3URYA 3CC2A 3CQZH 1VQPA 3HOVG 4HMIA 4QB4A 5M5WB 5A2QE 1A3TA 3K6OA 4J6HA 1QG7A 1AZPA 4JI4L 4KN7C 3U50C 1N36Q 4JBJA 5GQOA 4UAIA 2HD3A 4JOIA 1EWCA 4RKLA 3SHLA 1EEID 1S3OA 3SK6A 4K0KL 4L5SA 1HA6A 3NTHA 1YNNC 2NVTH 1TQOA 1STAA 1V1PB 3R93A 5IGFA 1PTOH 3FHWA 1JQYD 1RCVD 1KNAA 2F0LA 2QKIC 3QG1A 2MNAA 4DV1L 3DXJC 1E22A 3PGZA 2M9VA 2LS01 1NBWA 1B3QA 2BH8A 2ATWA 1I6HH 2AMCB 2E2HH 1UE1A 4BY7G 1A2TA 2KUMA 3VR2A 1HFGA 2BE5D 3E9IA 1W3SA 2RCFA 1VQHA 5C4ZA 2ZJPA 5JJLA 1PVOA 5M3FH 5BR8L 2OQ0A 5BN4A 3SVMA 1PFMA 1VQDA 2B63H 3MFGA 1X6OA 1YHAA 2CWPA 4UP9A 1GHJA 3VDYA 1FJGL 4GZYC 4BXXH 3F2CA 4FDBA 2A6HC 2JYOA 5LMNQ 4DK3C 1XNRQ 2B2WC 3M4QA 2B8FA 1AP0A 1VQFA 2LY7A 3W1GA 1EQVA 1HRJA 1GUOA 1LLRD 3S1RH 5GAHC 3H3VI 3HRZC 4JI6Q 5JPNC 2MO1A 3SGIA 4XIGS 1TWCB 2NWGA 2F0FA 3N6RA 4QGUA 1VQCA 4XDXA 4P2CB 1SYCA 1UE6A 2AWOA 2KEEA 1JWUD 2E2DC 1WD0A 2Z1CA 1LO5D 2K5NA 3NHHA 1JOQA 2R7DA 4UDUC 1STYA 3LWEA 1K28A 1JJ2A 2NVXH 1QILA 2Y0SG 1QNUA 2EYOA 4KK7A 1HQMC 2L11A 3A7LA 4A4IA 1SE8A 2E76C 1BKBA 2XSCA 3I4NB 1GKHA 4IALA 2F4VQ 1EIFA 1ZXTA 3PO2H 1O7LA 2R61A 2IW3A 2MP1A 4YIJA 5KRUA 4GNXB 1EZ8A 4AQYL 2DY8A 4DV7Q 4YWLA 1SJHD 1K0SA 2F0JA 4CJ0B 1ESFA 4FP5D 3DM3A 4RAUC 3J7AV 2CQAA 3FMCA 2UXCQ 3NXWA 3D31A 2NZOA 2YTYA 2JEAI 3AU7A 3UDIA 3D8GA 5E3FA 3H94A 1IBKQ 4RH6A 1BCPC 3C3LA 4GKKQ 2PYKA 4JI7Q 4NKLA 3CCMA 3HKZG 4A3BB 2A68C 4B3MQ 4DGZA 2MFIA 1EZ6A 2NVYH 4DA2A 1SDFA 3M9BA 4NW2A 2UU9Q 3MA2B 1PH5A 3BZKA 3KBGA 4N9PA 3S16H 4NXNQ 2PI2A 2RDGA 5COYA 2KA7A 4BY1B 3CD6A 4JYAQ 2DY7A 1EEFD 2F0IA 2VUMB 1VQ5A 1LTGD 1RKNA 2D0PA 2EY2A 4DR6Q 3H3VC 2NZHA 1HUNA 3FP9A 1C8CA 1NTGA 1HR0W 2AQ1B 1EOTA 2RHSB 5IWAL 4ZLTF 3MZ5A 3BS1A 3RLFA 4LFCQ 2D2CC 1SR3A 1YHBA 5JVH3 1TS5A 2IHFA 3MFYA 4N8X1 2JA7H 2BA0A 1PYWD 1SNQA 4DV5L 4KJOA 3M3YB 4TQUS 3VR5A 4DR1L 4MNOA 3SDZA 3WDNA 5C0XH 5ELBA 3BVZA 1DGSA 4JV5Q 1KRTA 1DZ1A 3I55A 2VY3A 4B9WA 3E6ZX 1LT6D 2Z9HA 4S3SA 3JAME 4P72A 3GTPB 3A8KE 4R9WA 1PFNA 1CTMA 2B2TA 4I7ZC 1SBBB 5FLXL 3KJOA 2DNEA 2Z4HA 3BVMA 3N52A 3T51B 4A3FG 1PH2A 1BF4A 2UXDQ 4ZUJA 1SNPA 3K5NA 2AWNA 2SOBA 3S2HH 2CH4W 3KFUA 1JORA 1FD7D 2EYJA 1N34Q 4HR7B 1M4VA 1QB5D 1I50H 1HTPA 1EYGA 3LGJA 2F03A 4C3JH 4LFBQ 3W3AA 1PH9A 1I3QB 2RKSA 3KOJA 1SEBD 5C5MA 3OMGA 1NMGA 2B8GA 3NWSA 3HOZH 1T5EA 4FVMA 2RCNA 3HZXA 3S24A 1E24A 1PH3A 1K8MA 1XMOL 2OT2A 3W5OA 5GADC 1XXGA 4F7XA 3NTKA 4G57A 1PZKD 2F0NA 2OXPA 4EGVA 1J5EL 3UDXA 1I94Q 4XYQA 1K3RA 4DAVA 1B8AA 2WKCA 2E5LQ 1GM5A 2F3IA 1IKLA 2KQ3A 2KJXA 3FDTA 1PH4A 2BCOA 2UUCL 4POFA 1GUSA 3J80L 3T1YL 1HQRD 1YVCA 4OWWB 2Z6KA 3KF8B 5M3FG 5CV9A 5IYBH 1D1KA 1A3VA 5JAVA 1U4MA 1BNZA 1VQLA 1Y69U 2UXBQ 1X54A 1WTXA 2B63G 3FKIB 4YWMA 4HJ5A 4KMUC 4HJAA 4RGOS 2JE6I 1LV9A 3HOYB 4LF6Q 2E2JB 1KIXA 3V2TA 3HOXH 4HSVA 4C3IB 4NPSA 4DAYA 3M4OH 1TWHB 2L0CA 3I3CA 2ICIA 3EA6A 4R4IA 3MXPA 4DV4Q 1B4OA 4LK1C 5IYCH 2YTXA 4RFBA 2AUKA 3CAMA 4B3RL 4KI0A 1Y1WB 1KHIA 3SK4A 1ONLA 1N9WA 2I0QA 3J81c 1BUVT 3M4YA 4JI2Q 2XN9C 4UPAA 5HGTA 3U4VA 4YCWA 2ALYB 1S5BD 1RDPD 2EYLA 1LT5D 3TS2A 4OL7A 1UAPA 4HAEA 3STBD 4A3JH 2A6ED 1D5XC 4LJZC 3I7FA 1Q8IA 1LTBD 4OO1H 4GKJQ 4U68A 2CHBD 4BBSH 1V9PA 2F0MA 1XPUA 4KTAA 2UUAQ 1WFQA 3EN2A 1A6XA 4RG1A 1XX8A 4LF5Q 1X32A 1PTOC 4EQ5A 1WTPA 2AUJD 2R3ZA 2PQAA 2SNSA 1E3PA 4QJFA 3GQBA 1K83B 3HGBA 4UP7A 1O78A 5IOCA 4KHPL 1BBWA 1IBML 1D1IA 4IJLA 4Q0FA 4TKOB 1YNJD 1IYJB 1B53A 4M8AA 3GTLB 1K9MC 2A19A 3CCJA 1AE3A 2L15A 4ZQ3A 1U5KA 1LTAD 2K03A 3OIPA 4H44C 1HA5A 3VYTA 1GUGA 2QDBA 1HNXQ 2EYMA 1A3UA 3T53B 1ET9A 3A54A 3D4RA 1VQAA 3KBXA 4NDXA 3BZDB 1BCPB 1J6QA 4O42A 2DGYA 2D62A 4JI8L 4DNIA 4EVOA 3JAMi 5M5XB 3D6WA 3EFXD 5TSSA 1B3AA 2O5IC 1IL8A 1F2LA 3H15A 1GJXA 2PQEA 3OHXC 4JI5L 4DR2Q 4CJ2C 2Q2TA 2JXMB 1O7ZA 1G291 3GTQH 4C2MH 3ND9A 2ZXOA 1S72A 4X62L 4LUOA 4YWKA 2F0PA 1EL0A 2SEBD 2EDGA 1NR4A 3BYTB 3PF5A 1HR0L 2K04A 3PCOB 1PYSB 5H1SE 5DLQE 1Z47A 3KJPA 1L1OC 5EQ0A 4A3BG 4HJ8A 4A3KB 2QEJC 4U673 1II3A 5IGBA 1PH1A 2KHJA 2Q2UA 1PTOF 3V05A 4DV3Q 2XRSD 1Z9FA 3I4MH 1NY4A 4WJWA 3H09A 3SXHA 2B2VA 1C7YA 3G71A 5K5PA 2K6AA 3MXNB 2VNUD 2PPBC 1CQVA 5C0XI 2VUMG 4DR3Q 2E2IB 2V1CC 1HH2P 2EYPA 2MUYA 2EQSA 4ME3A 4A93H 3BDLA 4IUQA 3AEVA 5C44H 1J8IA 4JG2A 1EQQA 1BVSA 4B08A 1X3GA 2J7ZA 4J8QA 1BBXC 1QE6A 3VR3A 5M5YB 1TT2A 1FL0A 3ONAB 1CFMA 1EYDA 4A3IB 3K57A 1VQBA 3LWUA 5C4JB 4PZ6A 3NQIA 5HGQA 2JA9A 2PW7A 2R7ZB 1HNWQ 1WOCA 3I70A 1CK1A 4NXML 2HHHQ 1MHWC 3ULJA 1PXUA 1PA6A 4DNRB 2RSNA 2A5HA 4PQXA 1OTCA 4CDCC 1IL2A 3X3MA 5ELCA 1CSPA 5EJWA 2H4OA 1JE5A 3JC66 3HKZB 4QL5A 4JI0Q 4LWCA 4X66L 4FXDA 1GUWA 1ML0D 3F1ZA 2TSSA 3Q24A 2F0UA 2IX1A 1SLJA 1TVXA 2F3VA 4JCVE 2QCPX 1CUKA 1IYVA 3A8IE 1NE3A 3I90A 3BJUA 1VQJA 1A62A 2X6GA 2ID0A 2PNHA 1SYDA 2FINB 2WB1B 3HOXG 4IUTA 3L2PA 4HIDA 3SR1A 4OHJA 1I5FA 1MI2A 1SMYD 3NP8A 2EXZA 2LXKA 2A68D 4KJNA 4DR7Q 1SFOH 1B9MA 1XMQL 3J7A5 4IPCA 2EY6A 1BO0A 2A69D 5C5LA 1LUZA 5IT9L 4IFDH 4DV2L 2EIFA 1U4LA 3RZDH 4A3JG 3CQZB 2CKZB 4N8FA 4PZ7A 4KKTA 3I2ZA 3HOYG 1S5CD 1R9TH 4AYBB 3OTOL 5IT9E 5E4XA 4GOPC 4A3CG 2IX0A 2Q8TA 1B9NA 1DOKA 1F9SA 4BBSG 4OO1I 4OWXB 3RN5A 2ZTCA 3GP7A 1EY9A 2D0OA 1Y1WG 2JQOA 4HIKA 2UUBQ 1SSOA 1UEAB 1GHKA 5C4XH 3NUCA 2NVTB 4QQBX 4FNFA 1PTOB 1PYBA 3UE0A 5A2QL 1N33L 1TWAH 3K5OA 2HCCA 3MXGA 3PO3H 2F0HA 2OF1A 4RHRA 3PV0A 1HPCA 1T9HA 2CVRA 5F2DA 2N78A 1V1PA 3CCLA 4K5WA 3S14H 4IO9A 3EVQA 5E1FA 1SN8A 4IUVA 3KK7A 4WJ3M 4A3DH 1YZ6A 3D4WA 1AE2A 4QUFA 5CORA 2KCNA 1I4GA 3TS0A 2K1BA 1SNMA 1S5ED 1I6HB 1DD2A 1JB7A 1HZ9A 4DUYQ 2WACA 2E2HB 2F52A 2K52A 3B6YA 3H0GH 1YHQA 4ZKBB 5FLXc 3VA5A 5KYLA 1ASZA 2VQEQ 1NSNS 2K5QA 4DUZL 3EQLC 4DFAA 5FLMH 4A3LH 5JJZA 1KTKA 3DM1A 2EJMA 4KD4A 3CRKC 5M3FB 5A35A 3A74A 4RHSA 2KCCA 2F4IA 2FXQA 1N32L 3NBHA 2B63B 1WCMH 3ERSX 2EJFC 3IFDA 1QVFA 1MIUA 2NUCA 3A7AB 4GLVB 2D5DA 4ID6A 1YI2A 2BA1A 1YEZA 1PH6A 1SROA 1MJCA 5JVG3 1PRTC 3CC4A 2G5DA 4K8IA 1O80A 1DYQA 3NBHB 3KLSX 3Q8DA 4HIMA 4CKCA 4J15A 1L1OB 3PUVA 2IWHA 3I4MG 3OW7A 2DJFC 4IPDA 5E4WC 1XJVA 2DUDA 2QDLA 3J80c 2CW0C 1SNCA 2B29A 1LTID 4JI4Q 3D4DA 3PUYA 3GV3A 4X3SA 1CQFA 3S2DH 3FEWX 2NVXB 1W6KA 2HIXA 4I7AA 2OEOA 1HXYD 1PLFA 1K73C 4A93G 3RLOA 4K0KQ 3DEOA 4PMBA 2K5DA 3T13A 3PO2B 1U9RA 1VMPA 5EBCA 5C3EH 5DM63 2MHVA 2D9UA 4A3KG 1NR2A 3IRBA 1LTTD 5EGTA 1B70B 4DV1Q 3MEFA 4LUZA 4KN4C 1Z6HA 1GD7A 1EIGA 2M2LA 1PFBA 2UXCL 2XGTA 4JBMA 3ZJYC 1A15A 4GNXA 4DPGA 4TRDA 1E1TA 1ZKOA 1AEXA 3VA7A 2I5MX 2K7VA 4WRDA 1VQKA 3CCQA 3C2PA 1WYDA 5ELFA 3D3RA 5I9PA 3DHQA 3ULPA 3DEPA 2SDFA 1PRTF 1RHPA 4PV1C 2WKDA 5BR8Q 4RGMA 3GTOH 5LHY1 2QILA 2NVYB 1W2BA 1KXLA 1FJGQ 3S9WA 1T5XD 4A3IG 1GUTA 5JEAH 3CRLC 3G6JB 5FO7B 2K14A 3S16B 1VQ6A 2R7ZG 2O5JC 2CQOA 1G2SA 3J81i 3NPPA 1F77A
chains in the Genus database with same CATH topology
3GD7A 1PDQA 3X3NA 1JB3A 2PZTA 4F8MA 5ELEA 1AZQA 1DONA 4ZUIA 4OIKA 2NZ1D 2C9OA 1DCZA 1JWSD 1I4RA 3U9OA 2K28A 3QB3A 2XVSA 4ZYSA 3IAYA 4OIJA 5I6YA 5CBAE 4XYOA 3IFTA 2PW5A 3NK9A 3DWQA 1WTQA 4IFDI 3CU7A 1IHZA 1TS3A 1F9RA 3LNNA 5KYIA 1U4PA 1F9PA 3VR6A 2RDHA 4IUNA 1GUNA 3S2HB 1EY5A 1PZJD 3M7NA 1EU4A 1I50B 3JAML 2KOLA 4C3JB 2PNRC 3VR4A 3HOZB 5AFWA 3DUZA 5FO9B 2B2UC 5KGUA 1SAPA 1Q3LA 1CHQD 1NUCA 1DM0B 1H9JA 1ET6A 1RJTA 2E75C 1QJOA 3QO2A 1HFNA 3QIAA 2K05A 1BCPF 2L55A 1EIHA 1Q1BA 4K5XA 5I2XA 4K14A 5CGKA 4XT3B 5J1ZA 5JPMC 4KD3A 3J7AF 1AFPA 3KF8A 1Q12A 2GA4B 1DOMA 1DJRD 3HOXB 3OPOA 1HTLD 3M4OB 3MXUA 1QWYA 4RA8A 1EY4A 1PRTB 2B2WA 3SK5A 3E0JA 1K8OA 5KEEA 2G9DA 1S5DD 4EQPA 4F88A 4IURA 1XWEA 4XTCS 4A3JB 2EE1A 2L4NA 2L12A 4R8IA 1STHA 2BE5C 1OXVA 4BBSB 1SJED 4FF1A 1SE3A 2HDMA 1F2MA 4KKUA 5EKIA 1RODA 1LT4D 2ZXPA 1TU2B 3CKIB 3MHBA 3V96A 3GV6A 5IGDA 4K2KA 1EFID 2F0OA 4BWGB 2J4XA 3E5SA 1L0YB 5CV4A 3WOFA 3W2DA 1Q90A 2F0TA 1RTNA 2A74C 3TBIB 3K5MA 1TR5A 1LABA 5C3XA 2EJGC 1I4HA 1ILPA 5JEAG 2F0GA 3BVGA 3WOEA 1JICA 5JEAJ 1ZEQX 4ZAIA 2X69A 1KDBA 2LFNA 2PMZB 3GTQB 4C2MB 3LX0A 2IPKD 1OXXK 1WTVA 4K2LA 3TDQA 3HS0C 2EVBA 1VF5C 1D5ZC 4PNYA 2Q8IB 4HTHA 2PO4A 2MGSA 1YNND 1MGSA 3I4MB 5KNBA 1Y8PB 2RA4A 4J1MA 1EU3A 5C3WA 4KHVA 1CZWA 2FJ2A 1FR3A 4X3TA 5DEHA 4ZKCB 4A93B 4R8NA 3MXNA 5C44B 5KNDA 1PRTD 4V0BA 1SNDA 3Q23A 2NYZD 2RDFA 3R3OA 2F0QA 4C56C 5I4DA 2N55A 5C0XG 4FF4A 1I4XA 3FRPB 4BS9A 5C0XJ 3SEBA 1BOSA 1E2VA 3C1FA 4RWSC 1H9SB 2A6HD 4C3HG 2KVMA 1LACA 4FXGC 4IZ8A 1SE4A 3EJIA 4L63B 1NCVA 1R4PB 5EKLA 4FF3A 2H1EA 5CV7A 4ABNA 4C3JG 1V8QA 5CC4A 1F2ZA 4MHEA 2I07B 1FGBD 4XQJA 4FYDA 3TN2A 2K01A 3VYUA 2F0SA 5IGGA 2MPMA 2WAQB 1VF7A 3ITPA 1TY2A 1CT1D 3I8ZA 5IGCA 3HEJA 5EPLA 3A56A 1WVLA 1SFOB 5EPJA 4I65A 2FMCA 2FMMA 1Y8OB 1JCKB 3TP6A 3MC0B 1JWMD 4CHTB 3RZDB 3A55A 2WV6D 1R9TB 2IX3A 4KY6A 1BQQT 3MAQA 4XT1B 5FOBB 1BCPD 2J0TD 3M85A 3ERQA 5C4XB 4C1NI 5IODA 2M00A 2JP1A 3VYRA 1U4RA 1TWAB 3RD4A 3PO3B 1LTSD 1B50A 3DWPA 1B1ZA 4RKBA 1KDCA 4CGYB 2QF7A 4H0LC 3J81L 3S14B 1IYUA 1BR9A 4A3DB 1EY0A 4OO1G 1SYBA 2C5CA 2NTTA 1H9MA 5D3IB 2IT1A 1OO9B 4X3UA 3OWEB 4BA2I 4NP5A 3J81E 5G3LF 3MEHA 5JOBA 1EQTA 2ZT9C 3H0GB 3PIO3 4QMGA 5IIFA 1HHVA 5CV6A 1G91A 3PIP3 5FKAC 2EYHA 3SK8A 2XNAC 5D65A 4MIUA 4B9XA 2DNCA 1MSHA 1G2TA 2SNMA 2F3WA 1WCMB 2NB0A 4ILWA 3O13A 5DAUA 4HN7A 2JEBI 1TKWB 1JOOA 1E0BA 2WINB 3MTSA 2AQ2B 1VMCA 4NMZA 2RSOA 1V1OA 2F0VA 3KLRA 3R2TA 5DM73 2PZUA 4HCSA 5KIXA 3K0YA 4RGTA 5DNFA 4DF7A 1OXTA 3A8JE 3BG3A 5LL6X 4V190 1PMRA 4K6LA 5EBDA 3BDCA 3S2DB 1DXMA 2F0EA 2NN6H 2B2TC 1KAAA 3NE5B 4DXFA 4HMJA 2N88A 4HEDA 3S1RB 5C3EB 3BDOA 3T4AC 4PMWA 5CMDA 1GOZA 4QF4A 3KUPA 4CJ1B 2NTSA 4FF2A 4DU9A 4G7HC 1BDOA 2ICEC 3Q0AA 1CM9A 1O7YA 1JC7A 4HCEA 4Q5VA 1E2WA 3C46A 3HP3A 2F0DA 3AB9A 5CR3A 2B2YC 1SNOA 1V43A 1SYEA 3QWNA 2KECA 3I73A 4XQNA 5KNCA 5D3DA 3GTOB 2PZWA 2EZVA 3NWTA 2MJ8A 3OWFA 1B2TA 3DWAA 4DAPA 1FNVA 3RZOB 3K59A 2K5WA 5EPKA 1ILQA 2DN8A 1CZGA 4KKSA 4KY7A 1L0XB 1AN8A 3S15B 3OOCA 5M9OA 4L8JA 1EY7A 2L1BA 1EYAA 2FFKB 3HG9A 1JE4A 2B39A 1PTOD 1CA5A 4X3KA 1NAPA 3L3OC 3P1HA 2KHSA 2JSOA 4ULLA 2PCFB 3VYSA 1C4QA 5NUCA 2JA6B 4JK1C 4Z9CB 4DK0A 4DNTB 5CV8A 3TP5A 3GTMB 1I4PA 3FPUB 3FVQA 1LTRD 2JA7B 1GXDC 1IW7C 3OMCA 5M3MB 1Y1VB 4IFDG 1HCZA 1EY6A 3K5LA 1UUPA 4IFDJ 1CA6A 1ZYRC 4C3HB 1QCBD 2BDNA 4DXGA 1SMYC 4FO2A 5CV5A 1WTWA 2AQ3B 2A69C 2LMCB 1WTOA 3KLSA 2ZXRA 2A73B 5I2YA 4Y7NB 1TS2A 1TS4A 2HCIA 4QCLA 2BOSA 2RVLA 3TP8A 1H9RA 4ODGA 4RGNA 2F0KA 1UNSA 1F9QA 4A3MB 1HUMA 1JOKA 3K7AB 1EWHA 2I46A 4A3EB 1ESRA 3PUWA 1RD9D 3NQTA 3SE0A 1MBYA 3F2UA 5EKKA 3U9SA 3IL8A 3G7LA 1I4QA 4QUCA 2JA8B 4A3GB 5FO8B 4G7OC 2EYFA 2B2VC 2R6GA 4CBVA 5LL6S 5FLXE 5G3LD 3L7ZC 3QOJA 2NN6G 1SXTA 3GO5A 2HQEA 2G9HD 3GTGB 1D6EC 2NN6I 2VB3X 4K6DA 2XIWA 1MD2D 2KEDA 3CHBD 4LMQD 1ENFA 2B2YA 1KLGD 1S4ZA 1TWGB 4TSSA 5T1GA 2YU9B 4K8JA 4OGQC 2LKVA 3MVVA 5ELDA 1STNA 1J9OA 2XWBB 2HDLA 2RQXA 3J7YW 5I6WA 3TSSA 1H9KA 1BXTA 3S1QB 3J80E 3R2IA 3ND8A 4QIWB 5BN5A 1VDZA 2O2LD 3OSOA 3HOWB 3GTJB 2YYZA 3NPPA 1ENAA 2IL8A 2VB2X 4EQOA 4LAAA 3TP7A 1STBA 1EY8A 2F1MA 4BBRB 3ZYYX 1EYCA 2EY5A 3HOVB 2BDOA 5CYUA 1DOLA 2IJ0A 3QJYA 4N9TA 1RTOA 1VCIA 3H91A 1F2YA 3T16A 1CHPD 5BN3A 3NBIA 5K36H 5FK9C 4DN4M 3UI2A 4JBWA 2EPBA 4CKBA 1R4QB 3QOLA 3D6CA 3P20A 1TWFB 1KABA 4EQNA 1LT3D 3FPPA 4IN3A 3Q6SA 2HUGA 4BY7B 4XXEA 4HSPA 4H13C 4WFN3 1E2ZA 3H6MA 1H9SA 1Z7TA 3PUXA 4G4KA 3TMEA 3Q22A 1FYCA 1JR0D 2B2UA 1X3PA 4MN3A 4RCNA 5D14A 2V4DA 4ZRZA 3HOUB 1OXUA 1SYGA 1OXSC 2O4XA 2WP8J 3DMUA 5I9OA 2CW0D 3P75A 5T1IA 2EOTA 2ENBA 1SE2A 1RF2D 5C6AA 2NVQB 2XRQD 3TZUA 3GTKB 1I6VC 3AMUA 4IQZA 2RBMA 5IGEA 1QOHA 4C1NK 2EY1A 1XYIA 2Z4IA 1X3QA 1Y8NB 5CBEE 3RUZA 2Y0SB 1G8ZD 1STEA 1TY0A 3BYYB 2JA5B 3K58A 4KHZA 2R92B 3T56B 3I72A 4XQQA 5J22A 2L9HA 3S1MB 2XWJB 1XTCD 4IUUA 4L6TB 4ME5A 4BA1I 4WORA 1WTRA 5ISRA 3IKJA 2Q8RE 3P7JA 1AW7A 3I4LA 1D2BA 4RCOA 1KDAA 1G6ZA 4FXKC 2TMPA 4CKEA 2L5TA 2NBFA 3MWYW 3I91A 1FNWA 3EROA 1MSGA 4O1NA 1D5MC 2FHTA 2WIIB 4K5VA 3PUZA 4DK1A 1STGA 4H7BA 1IW7D 3L9AX 1B44D 3S1NB 2K32A 1QNKA 3NTIA 3R8BA 3OIQA 1A2UA 1ZYRD 1PZID 1KLUD 3PMFA 2R93B 3S17B 2VXWA 3RMHA 3TZDA 1CI3M 4F87A 3C1EA 2X6LA 1ENCA 1TIID 2K33A 1FNUA 3M7GA 5HURA 1KNEA 2A6EC 4PMCA 4G7ZC 1ICWA 4IUPA 1W6JA 2Z8LA 4M1UB 4C3IG 1S5FD 4A3FB 1SYFA 4KV6A 4KY5A 2E74C 1WD1A 5C4HA 5K36G 5J39A 1M8AA 2F0WA 1Q1EA 4E6IA 1C48A 1YNJC 3NSWA 4ZK9B 1IKMA 3URYA 4HMIA 4QB4A 5M5WB 5A2QE 1A3TA 3K6OA 4J6HA 1QG7A 1AZPA 4KN7C 4UAIA 1EWCA 4RKLA 3SHLA 1EEID 3SK6A 1HA6A 3NTHA 1YNNC 1TQOA 1STAA 1V1PB 3R93A 5IGFA 1PTOH 1JQYD 1RCVD 1KNAA 2F0LA 2QKIC 3QG1A 3DXJC 2M9VA 2LS01 1A2TA 2KUMA 3VR2A 1HFGA 2BE5D 5C4ZA 5BN4A 3SVMA 1PFMA 3MFGA 1GHJA 4GZYC 2A6HC 2JYOA 2B2WC 2B8FA 1AP0A 2LY7A 1EQVA 1HRJA 1GUOA 1LLRD 3HRZC 5JPNC 4XIGS 1TWCB 2NWGA 2F0FA 3N6RA 4XDXA 4P2CB 1SYCA 2AWOA 2KEEA 1JWUD 2E2DC 1WD0A 2Z1CA 1LO5D 3NHHA 1JOQA 4UDUC 1STYA 3LWEA 1QILA 1QNUA 2EYOA 4KK7A 1HQMC 2L11A 3A7LA 2E76C 2XSCA 3I4NB 4IALA 1ZXTA 1O7LA 2R61A 2IW3A 2MP1A 4YIJA 5KRUA 1EZ8A 2DY8A 1SJHD 2F0JA 4CJ0B 1ESFA 4FP5D 4RAUC 3J7AV 2CQAA 3FMCA 3NXWA 3D31A 2JEAI 3AU7A 3D8GA 5E3FA 3H94A 4RH6A 1BCPC 3C3LA 2PYKA 4NKLA 4A3BB 2A68C 4DGZA 1EZ6A 4DA2A 1SDFA 4NW2A 3MA2B 3KBGA 4N9PA 2RDGA 5COYA 2KA7A 4BY1B 2DY7A 1EEFD 2F0IA 2VUMB 1LTGD 1RKNA 2EY2A 1HUNA 3H3VC 1C8CA 2AQ1B 1EOTA 4ZLTF 3MZ5A 3BS1A 3RLFA 2D2CC 5JVH3 1TS5A 3MFYA 2BA0A 1PYWD 1SNQA 4KJOA 3M3YB 4TQUS 3VR5A 3SDZA 3WDNA 5C0XH 5ELBA 3BVZA 1DZ1A 4B9WA 3E6ZX 1LT6D 4S3SA 3JAME 3GTPB 3A8KE 4R9WA 1PFNA 1CTMA 2B2TA 4I7ZC 1SBBB 5FLXL 2DNEA 2Z4HA 3BVMA 3N52A 3T51B 1BF4A 4ZUJA 1SNPA 3K5NA 2AWNA 2SOBA 1JORA 1FD7D 2EYJA 4HR7B 1M4VA 1QB5D 1HTPA 2F03A 3W3AA 1I3QB 2RKSA 5C5MA 1SEBD 3OMGA 2B8GA 3NWSA 1T5EA 3HZXA 4FVMA 1K8MA 2OT2A 1XXGA 4F7XA 3NTKA 4G57A 1PZKD 2F0NA 2OXPA 4EGVA 4XYQA 4DAVA 2WKCA 1IKLA 2KQ3A 2KJXA 3FDTA 2BCOA 1GUSA 3J80L 1HQRD 5CV9A 1A3VA 1D1KA 5JAVA 1U4MA 1BNZA 1Y69U 1WTXA 3FKIB 4KMUC 4RGOS 2JE6I 1LV9A 3HOYB 2E2JB 3V2TA 4HSVA 4C3IB 4DAYA 1TWHB 2L0CA 3I3CA 2ICIA 3EA6A 3MXPA 1B4OA 4LK1C 4RFBA 2AUKA 4KI0A 1Y1WB 3SK4A 1ONLA 1BUVT 3M4YA 2XN9C 5HGTA 1S5BD 1RDPD 2EYLA 1LT5D 4OL7A 1UAPA 4HAEA 2A6ED 1D5XC 4LJZC 1Q8IA 1LTBD 4OO1H 4U68A 2CHBD 2F0MA 4KTAA 1A6XA 1XX8A 1X32A 1PTOC 1WTPA 2AUJD 2R3ZA 2SNSA 3GQBA 1K83B 3HGBA 1O78A 5IOCA 1D1IA 4Q0FA 4TKOB 1YNJD 1B53A 4M8AA 3GTLB 4ZQ3A 2K03A 1LTAD 3OIPA 4H44C 1HA5A 3VYTA 1GUGA 2QDBA 2EYMA 1A3UA 3T53B 1ET9A 3A54A 3D4RA 3KBXA 4NDXA 3BZDB 1BCPB 4O42A 2D62A 4EVOA 5M5XB 3D6WA 3EFXD 5TSSA 1B3AA 2O5IC 1IL8A 1F2LA 1GJXA 2PQEA 3OHXC 4CJ2C 2JXMB 1O7ZA 1G291 3ND9A 2ZXOA 2F0PA 1EL0A 2SEBD 2EDGA 1NR4A 3BYTB 2K04A 1Z47A 5EQ0A 4A3KB 2QEJC 4U673 1II3A 5IGBA 1PTOF 3V05A 2XRSD 4WJWA 3H09A 3SXHA 2B2VA 5K5PA 2K6AA 2VNUD 2PPBC 1CQVA 5C0XI 2E2IB 2EYPA 2MUYA 3BDLA 1J8IA 4B08A 2J7ZA 4J8QA 1BBXC 1QE6A 3VR3A 5M5YB 1TT2A 3ONAB 1CFMA 1EYDA 4A3IB 3K57A 3LWUA 5C4JB 3NQIA 2PW7A 2R7ZB 3I70A 1CK1A 1PXUA 4DNRB 2RSNA 2A5HA 4PQXA 3X3MA 5ELCA 5EJWA 2H4OA 3HKZB 4FXDA 1GUWA 1ML0D 2TSSA 3Q24A 2F0UA 2IX1A 1TVXA 2F3VA 2QCPX 1IYVA 3A8IE 3I90A 2X6GA 2ID0A 1SYDA 2FINB 2WB1B 4IUTA 3SR1A 4OHJA 1MI2A 1SMYD 3NP8A 2EXZA 2A68D 4KJNA 1B9MA 2EY6A 1BO0A 2A69D 5C5LA 5IT9L 4IFDH 1U4LA 3CQZB 4KKTA 1S5CD 4AYBB 5IT9E 5E4XA 2IX0A 2Q8TA 1B9NA 1DOKA 1F9SA 4OO1I 3GP7A 1EY9A 1GHKA 1SSOA 1UEAB 3NUCA 2NVTB 4FNFA 1PTOB 5A2QL 3K5OA 2HCCA 3MXGA 2F0HA 2OF1A 4RHRA 3PV0A 1HPCA 2CVRA 5F2DA 1V1PA 4K5WA 3EVQA 5E1FA 4IUVA 3KK7A 3D4WA 4QUFA 5CORA 2KCNA 1I4GA 2K1BA 1SNMA 1S5ED 1I6HB 1DD2A 2WACA 2E2HB 4ZKBB 3VA5A 5KYLA 1NSNS 2K5QA 3EQLC 4DFAA 5JJZA 1KTKA 3DM1A 2EJMA 4KD4A 3CRKC 5M3FB 5A35A 4RHSA 2KCCA 2F4IA 3NBHA 2B63B 2EJFC 3IFDA 2NUCA 3A7AB 2D5DA 4ID6A 2BA1A 5JVG3 1PRTC 4K8IA 1O80A 1DYQA 3KLSX 4CKCA 3PUVA 2IWHA 3OW7A 5E4WC 2CW0C 1SNCA 1LTID 3D4DA 3PUYA 3GV3A 4X3SA 1CQFA 3FEWX 2NVXB 1W6KA 2OEOA 1HXYD 1PLFA 3DEOA 4PMBA 2K5DA 3T13A 3PO2B 1U9RA 1VMPA 5EBCA 5DM63 2MHVA 2D9UA 1NR2A 1LTTD 5EGTA 4KN4C 1Z6HA 1EIGA 2M2LA 1PFBA 1A15A 4TRDA 1ZKOA 1AEXA 3VA7A 2K7VA 4WRDA 3C2PA 5ELFA 3D3RA 5I9PA 3DHQA 3DEPA 2SDFA 1PRTF 1RHPA 4PV1C 2WKDA 4RGMA 5LHY1 2QILA 2NVYB 3S9WA 1T5XD 1GUTA 5JEAH 3CRLC 3G6JB 5FO7B 3S16B 2O5JC 1G2SA 4IUQA 1F77A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GA4 B;  1C4Q A;  1CZW A;  1C48 A;  1QOH A;  4P2C B;  2BOS A;  3MXG A;  1CQF A;  1BOS A;  1R4Q B;  1D1I A;  4M1U B;  2C5C A;  1QNU A;  1D1K A;  2XSC A;  1CZG A;  1DM0 B;  1R4P B;  4ULL A; 
#chains in the Genus database with same CATH topology
 3GD7 A;  1PDQ A;  3RZO H;  3X3N A;  1JB3 A;  2PZT A;  3ER0 A;  4F8M A;  5ELE A;  1AZQ A;  3S15 H;  1DON A;  4ZUI A;  4OIK A;  2NZ1 D;  3KLW A;  2C9O A;  1DCZ A;  4LF4 L;  1JWS D;  1I4R A;  3U9O A;  2K28 A;  3QB3 A;  2XVS A;  4AIM A;  4ZYS A;  3IAY A;  5IP9 G;  4OIJ A;  1X56 A;  2JJQ A;  5I6Y A;  4LF9 L;  5CBA E;  2ZTD A;  4XYO A;  3IFT A;  2PW5 A;  4ALP A;  3NK9 A;  3AYH B;  3A5U A;  2R7F A;  3DWQ A;  1WTQ A;  4IFD I;  2JA6 H;  3CU7 A;  4TVA B;  2WB1 G;  1N8R C;  1IHZ A;  1TS3 A;  1F9R A;  1KRS A;  3LNN A;  5KYI A;  1TXY A;  1U4P A;  1F9P A;  3VR6 A;  2RDH A;  3WWV A;  4IUN A;  3HKS A;  1GUN A;  1V1Q A;  4LFB L;  3GTM H;  4AQY Q;  3S2H B;  1EY5 A;  1PZJ D;  3M7N A;  1EU4 A;  1I50 B;  3J7Z C;  3JAM L;  5C4X G;  2KOL A;  4C3J B;  2QGQ A;  5M3M H;  1Y1V H;  4GS3 A;  2PNR C;  3VR4 A;  5AJ3 Q;  3HOZ B;  5AFW A;  2GVA A;  3DUZ A;  4DR5 L;  4C3H H;  5FO9 B;  4A3D G;  2B2U C;  4CDD C;  4AYB G;  5KGU A;  1PV4 A;  1SAP A;  4JI3 L;  1Q3L A;  1CHQ D;  1NUC A;  2PI2 E;  1DM0 B;  1H9J A;  1ET6 A;  1RJT A;  1HNZ L;  2E75 C;  1QJO A;  3QO2 A;  1HFN A;  3QIA A;  2K05 A;  1BCP F;  3I4O A;  3KF6 A;  2L55 A;  4BY1 H;  1EIH A;  1Q1B A;  4K5X A;  5FLM G;  4Y7N H;  4A3L G;  5I2X A;  1YJ9 A;  5IY0 A;  4K14 A;  5CGK A;  4XT3 B;  5J1Z A;  3KYH C;  5JPM C;  1HZC A;  4KD3 A;  3J7A F;  1AFP A;  3KF8 A;  1Q12 A;  1WCM G;  1PH8 A;  4A3M H;  4B3T L;  1PFS A;  2AKW B;  5IWA Q;  2GA4 B;  1DOM A;  1U0L A;  3K7A H;  1DJR D;  3HOX B;  3KF6 B;  3OPO A;  1HTL D;  3M4O B;  4A3E H;  4OX9 L;  3MXU A;  3U58 A;  1E7Z A;  1QWY A;  4RA8 A;  4DV5 Q;  1MKH A;  2JK8 A;  1EY4 A;  1PRT B;  2B2W A;  1VQ8 A;  3CXC A;  4DR1 Q;  3SK5 A;  3E0J A;  1K8O A;  5KEE A;  4POG A;  2G9D A;  5LMU L;  1S5D D;  2JA8 H;  4AH6 A;  2IY5 B;  4A3G H;  5IP7 H;  4EQP A;  4F88 A;  4R4O A;  1YIJ A;  4IUR A;  1XWE A;  4XTC S;  4A3J B;  4BXX G;  2EE1 A;  2L4N A;  2L12 A;  4P74 A;  1VQM A;  4R8I A;  1STH A;  3KDF A;  2BE5 C;  1BBU A;  1OXV A;  2UUA L;  1ASY A;  4BBS B;  1KD1 C;  1SJE D;  3TEH B;  4FF1 A;  1SE3 A;  2HDM A;  1EOV A;  1F2M A;  4KKU A;  3GTG H;  5EKI A;  1ROD A;  1LT4 D;  1VQI A;  1TU2 B;  2ZXP A;  3CKI B;  3MHB A;  3V96 A;  3GV6 A;  5IGD A;  4K2K A;  1EFI D;  1LTL A;  1Q81 C;  4YCV A;  2F0O A;  5FJ8 H;  1RL2 A;  3K80 C;  3UDG A;  3CC7 A;  1XMO Q;  1WI5 A;  3KDF B;  4BWG B;  2J4X A;  4QIW E;  1TWG H;  3E5S A;  1L0Y B;  5CV4 A;  2YU9 H;  3WOF A;  1VQN A;  1Q8K A;  3T1H L;  5IT9 c;  1HNX L;  4DV0 Q;  2Q2H A;  4LFA L;  4GN3 B;  1CKN B;  1Q90 A;  3W2D A;  2F0T A;  1RTN A;  2A74 C;  1WJJ A;  3TBI B;  3K5M A;  4YCU A;  2UUC Q;  4A76 A;  3PO2 G;  2IHE A;  1VQO A;  1TR5 A;  3T1Y Q;  3S1Q H;  4OEM B;  1LAB A;  5E7N A;  5C3X A;  2MQH A;  2EJG C;  1LYL A;  1I4H A;  1ILP A;  5JEA G;  2F0G A;  3BVG A;  3WOE A;  3HOW H;  1JIC A;  4R4T A;  5JEA J;  3GTJ H;  1ZEQ X;  4ZAI A;  1L0W A;  2X69 A;  1KDB A;  2LFN A;  2PMZ B;  1HZB A;  2PMZ E;  3GTQ B;  4C2M B;  3LX0 A;  4B3R Q;  2IPK D;  1OXX K;  1EFW A;  1WTV A;  4K2L A;  4BBR H;  1B7Y B;  3TDQ A;  4B3S Q;  3HS0 C;  2EVB A;  1VF5 C;  2B3G A;  3HOV H;  1D5Z C;  4PNY A;  2Q8I B;  2LSS A;  4HTH A;  2PO4 A;  2ZM6 Q;  2MGS A;  1YNN D;  1MGS A;  3CPF A;  5LMN W;  1KC8 C;  3I4M B;  5KNB A;  1Y8P B;  2RA4 A;  4J1M A;  4O0A A;  1EU3 A;  5C3W A;  1S40 A;  4KHV A;  1CZW A;  1HJP A;  1P16 A;  1Q82 C;  1C0A A;  2FJ2 A;  1FR3 A;  4X3T A;  2JA6 G;  5DEH A;  4ZKC B;  4A93 B;  4R8N A;  3MXN A;  5C44 B;  1M90 C;  5KND A;  1PRT D;  4V0B A;  1SND A;  3Q23 A;  2VQF L;  4JOI C;  1TWF H;  4X65 L;  2NYZ D;  2RDF A;  3R3O A;  1K8A C;  2JA7 G;  1O7I A;  1IBM Q;  2F0Q A;  4C56 C;  5IYD H;  1D7Q A;  2N8N A;  5I4D A;  2N55 A;  5C0X G;  4FF4 A;  1I4X A;  2HHH L;  5M3M G;  3FRP B;  2A8V A;  1Y1V G;  4BS9 A;  1XPO A;  5C0X J;  3SEB A;  3RNU A;  1BOS A;  1E2V A;  4BY7 H;  3C1F A;  4RWS C;  1H9S B;  2A6H D;  4C3H G;  4YY3 L;  2KVM A;  1LAC A;  1SRU A;  2CH4 A;  5GAE C;  4FXG C;  4IZ8 A;  1SE4 A;  3EJI A;  3AQQ A;  4JI0 L;  4L63 B;  1NCV A;  1R4P B;  3BZC A;  5EKL A;  4FF3 A;  4JI8 Q;  2OQK A;  2H1E A;  1EWI A;  4LF8 L;  5CV7 A;  4ABN A;  4OWT B;  4C3J G;  1V8Q A;  5CC4 A;  1F2Z A;  3HOU H;  2Y0S E;  2I07 B;  4MHE A;  2VW9 A;  4JI5 Q;  1FGB D;  4XQJ A;  4FYD A;  3TN2 A;  1VS0 A;  3OW2 A;  3HOZ G;  4IJH A;  2K01 A;  3VYU A;  4X6A H;  2AHO B;  4A3M G;  2F0S A;  5IGG A;  1HR0 Q;  3AFP A;  2MPM A;  4LUV A;  2NVQ H;  4LW1 A;  1KQS A;  3UDF A;  2WAQ B;  2WAQ E;  3GTK H;  4DR4 L;  3TRZ A;  5ELO A;  1VF7 A;  2DJG C;  3ITP A;  1TY2 A;  1JJG A;  1CT1 D;  3I8Z A;  1XNQ L;  5IGC A;  1UEB A;  3HEJ A;  1JT8 A;  5EPL A;  4LF7 Q;  3A56 A;  1WVL A;  1SFO B;  5EPJ A;  3PF4 A;  3CCS A;  4I65 A;  2FMC A;  2JA8 G;  2FMM A;  5IYB G;  1Y8O B;  2JA5 H;  1JCK B;  3TP6 A;  5IP7 G;  3MC0 B;  1JWM D;  4CHT B;  3RZD B;  3A55 A;  2R92 H;  3W1B A;  2WV6 D;  1R9T B;  3S1M H;  2IX3 A;  4KY6 A;  2JN4 A;  1BQQ T;  3MAQ A;  4XT1 B;  5FOB B;  1BCP D;  5IYC G;  2J0T D;  4YHH L;  3M85 A;  4P73 A;  1IZ6 A;  3ERQ A;  5C4X B;  4C1N I;  5IOD A;  3K7U C;  2M00 A;  1K3B C;  2JP1 A;  1U4R A;  1TWA B;  3RD4 A;  3VYR A;  2EXD A;  5FJ8 G;  1QUQ A;  3PO3 B;  4NXM Q;  3M4P A;  1LTS D;  1B50 A;  4RMF A;  1EIY B;  3DWP A;  1B1Z A;  4RKB A;  1KDC A;  4CGY B;  1YNX A;  2QF7 A;  4H0L C;  3J81 L;  3S14 B;  1IYU A;  1N36 L;  1BR9 A;  2ZTE A;  4A3D B;  2KEN A;  1EY0 A;  3U4Z A;  1AH9 A;  4IOA A;  4OO1 G;  1SYB A;  2C5C A;  2NTT A;  1H9M A;  5D3I B;  2IT1 A;  1OO9 B;  1P8L A;  4X3U A;  3OWE B;  4BA2 I;  4NP5 A;  2YV5 A;  3J81 E;  5G3L F;  3F2D A;  3MEH A;  5JOB A;  4R4Q A;  3E9H A;  4X66 Q;  1X3F A;  1EQT A;  2ZT9 C;  2K5V A;  3H0G B;  3PIO 3;  2OCE A;  4QMG A;  5IIF A;  1QUQ B;  1HHV A;  1Y14 B;  5CV6 A;  2GN5 A;  4Y52 H;  1G91 A;  1G51 A;  3PIP 3;  3G48 A;  1X55 A;  5FKA C;  1RIP A;  2EYH A;  3SK8 A;  2XNA C;  5D65 A;  4MIU A;  4B9X A;  2VL6 A;  1QZG A;  2DNC A;  1MSH A;  3S1N H;  3JAM c;  1IBL Q;  1G2T A;  2N49 A;  2SNM A;  2F3W A;  1WCM B;  2NB0 A;  1D8L A;  3CPW A;  2R93 H;  3PIO A;  4ILW A;  3S17 H;  2LXJ A;  3O13 A;  4KLK A;  4JI1 Q;  4HN7 A;  2JEB I;  5DAU A;  1TKW B;  1JOO A;  1YBY A;  1E0B A;  2WIN B;  3MTS A;  2AQ2 B;  1VMC A;  4NMZ A;  4BBR G;  2RSO A;  1XMQ Q;  4X64 Q;  1V1O A;  2F0V A;  3KLR A;  3R2T A;  5DM7 3;  2PZU A;  4HCS A;  5KIX A;  3K0Y A;  4DV2 Q;  4RGT A;  5DNF A;  4DF7 A;  1OXT A;  3A8J E;  3BG3 A;  5LL6 X;  4A3F H;  5LMN L;  4DV6 Q;  5HY6 A;  1XNR L;  4V19 0;  3OTO Q;  1L1O A;  1PMR A;  4K6L A;  5EBD A;  3BDC A;  3CF5 A;  5JJK A;  3S2D B;  1DXM A;  2F0E A;  2NN6 H;  4JI6 L;  2B2T C;  1KAA A;  3NE5 B;  4DXF A;  4HMJ A;  2N88 A;  1QVG A;  4HED A;  3S1R B;  5C3E B;  3BDO A;  1N33 Q;  1A0I A;  3T4A C;  4PMW A;  5M5W H;  3EIV A;  5CMD A;  1GOZ A;  5IYD G;  4QF4 A;  3KUP A;  3PQI A;  4CJ1 B;  3CCU A;  2NTS A;  4FF2 A;  4DU9 A;  1CSQ A;  4ZCK A;  4G7H C;  1BDO A;  2ICE C;  3Q0A A;  1CM9 A;  1O7Y A;  1JC7 A;  4HCE A;  1PHJ A;  4Q5V A;  2F4V L;  1E2W A;  5C44 G;  2ES2 A;  3C46 A;  3HP3 A;  2F0D A;  3AB9 A;  3AFQ A;  4DUZ Q;  5CR3 A;  2B2Y C;  1HZA A;  1SNO A;  4DV7 L;  1V43 A;  1SYE A;  3QWN A;  2KEC A;  3I73 A;  4XQN A;  5KNC A;  4GLA C;  5D3D A;  3GTO B;  1N32 Q;  4LNQ A;  2PZW A;  1QZH A;  4IPH A;  4HJ7 A;  1NJI C;  3HOU G;  4R4C A;  2EZV A;  2Z6K C;  2YTV A;  3CP0 A;  3NWT A;  2MJ8 A;  4JVZ A;  3OWF A;  1B2T A;  3DWA A;  2QW7 A;  2HT1 A;  4DAP A;  1FNV A;  1IBK L;  1Q46 A;  3K59 A;  3RZO B;  2K5W A;  5EPK A;  1ILQ A;  2DN8 A;  1CZG A;  4KKS A;  4KY7 A;  3CCV A;  4GKK L;  1L0X B;  1AN8 A;  4MTN A;  3RN2 A;  4JI7 L;  3S15 B;  3OOC A;  1EUJ A;  2XTI A;  5M9O A;  4B3M L;  1QVC A;  4L8J A;  1EY7 A;  2L1B A;  2UU9 L;  1EYA A;  2FFK B;  3HG9 A;  1JE4 A;  1M1K C;  2B39 A;  1PTO D;  2K4K A;  1PH7 A;  4NXN L;  1NMF A;  2RF4 A;  1CA5 A;  4X3K A;  3E0E A;  1NAP A;  3L3O C;  4JYA L;  3P1H A;  2JA5 G;  4DR6 L;  2KHS A;  2JSO A;  4ULL A;  2R92 G;  1KL9 A;  3GDE A;  2PCF B;  4LFC L;  3VYS A;  1C4Q A;  2OWO A;  5NUC A;  2JA6 B;  4JK1 C;  4Z9C B;  1TWC H;  4DK0 A;  3F2B A;  4GN4 B;  4DK6 C;  4IPG A;  4DNT B;  4HJ9 A;  2WAQ G;  5CV8 A;  3TP5 A;  3GTM B;  2H5X A;  1I4P A;  3FPU B;  3QR8 A;  1Q86 C;  3FVQ A;  1LTR D;  2JA7 B;  4JV5 L;  4GOP A;  1GXD C;  1IW7 C;  5AJ3 L;  3OMC A;  5M3M B;  1Y1V B;  3TQY A;  4IFD G;  1HCZ A;  3I4N H;  1EY6 A;  3CME A;  3K5L A;  1UUP A;  4IFD J;  2A1A A;  1CA6 A;  1ZYR C;  4C3H B;  1QCB D;  2BDN A;  4DXG A;  2UXD L;  1SMY C;  4FO2 A;  4O2D A;  4JPB W;  5CV5 A;  1WTW A;  1N34 L;  2AQ3 B;  2A69 C;  2LMC B;  3DLL A;  4GOP B;  1WTO A;  5IE8 A;  3KLS A;  2ZXR A;  2A73 B;  5I2Y A;  4Y7N B;  5J3B A;  1TS2 A;  1TS4 A;  2HCI A;  4QCL A;  2BOS A;  3PO3 G;  2RVL A;  2C35 B;  3TP8 A;  1H9R A;  4ODG A;  4JBK A;  4RGN A;  2F0K A;  1UNS A;  1F9Q A;  1I94 L;  2E5L L;  4A3M B;  4A3B H;  1HUM A;  2R93 G;  3CW2 C;  1JOK A;  3K7A B;  4LF4 Q;  4GLX A;  1EWH A;  2I46 A;  4A3E B;  1ESR A;  4OEL B;  4P75 A;  3PUW A;  1RD9 D;  3NQT A;  3SE0 A;  3H0G G;  1MBY A;  4LF9 Q;  3F2U A;  2I5L X;  5EKK A;  1FGU A;  3U9S A;  2VUM H;  1ICF B;  2UXB L;  3IL8 A;  3G7L A;  1I4Q A;  4QUC A;  3PSI A;  2JA8 B;  3BU2 A;  4A3G B;  5FO8 B;  4LF6 L;  1C9O A;  2EYF A;  4G7O C;  2B2V C;  2R6G A;  4CBV A;  5LL6 S;  4DV4 L;  3L0O A;  1CKO A;  5FLX E;  2CFM A;  5G3L D;  3L7Z C;  3OYY A;  3M3Y H;  3QOJ A;  2NN6 G;  1SXT A;  3GO5 A;  4P71 A;  1KAW A;  2HQE A;  4JI2 L;  2G9H D;  3GTG B;  1D6E C;  2NN6 I;  2QEX A;  2OTL A;  2VB3 X;  3GTP H;  4K6D A;  2XIW A;  1MD2 D;  2KED A;  3CHB D;  4DR5 Q;  2K75 A;  4LMQ D;  1ENF A;  2B2Y A;  1KLG D;  2E8G A;  2CWA A;  1S4Z A;  1TWG B;  4TSS A;  4DV0 L;  5T1G A;  2YU9 B;  4K8J A;  4OGQ C;  4GKJ L;  2LKV A;  3MVV A;  4JI3 Q;  1EQR A;  5ELD A;  1STN A;  1J9O A;  3EBE A;  2N3S A;  1HNZ Q;  1H95 A;  2XWB B;  2HDL A;  4MZ9 A;  2GVB A;  2Z6B A;  2RQX A;  4UP8 A;  1I3Q H;  4LF5 L;  5EAY A;  3J7Y W;  5I6W A;  4OXP A;  1GVP A;  3TSS A;  1CKN A;  1H9K A;  1BXT A;  5C3E G;  3S1Q B;  3J80 E;  4HIO A;  3R2I A;  3ND8 A;  2ZJR A;  4QIW B;  5BN5 A;  1VDZ A;  4B3T Q;  4MTK A;  2O2L D;  3OSO A;  3HOW B;  2MO0 A;  4JW0 A;  3GTJ B;  2YYZ A;  1J5E Q;  1ENA A;  4CDE C;  1JMC A;  4EX5 A;  2IL8 A;  4OX9 Q;  2VB2 X;  4B3S L;  4EQO A;  3D0F A;  4LAA A;  3TP7 A;  1X3E A;  2I5H A;  2BH2 A;  1GO3 E;  1STB A;  2ZM6 L;  1VQ9 A;  1EY8 A;  2F1M A;  2KHI A;  4BBR B;  3ZYY X;  1EYC A;  3FKI H;  5LMU Q;  1XTD A;  2EY5 A;  3HOV B;  4DAY B;  3HOY H;  4A75 A;  2E2J H;  1VQG A;  2BDO A;  4A3C H;  5CYU A;  1DOL A;  4C3I H;  4DR2 L;  2IJ0 A;  1X65 A;  1TWH H;  1G6P A;  3QJY A;  4N9T A;  1RTO A;  1VCI A;  3H91 A;  5GRO A;  1F2Y A;  1CKM A;  1CHP D;  3T16 A;  5BN3 A;  5L37 A;  1Y1W H;  3NBI A;  4DAM A;  5K36 H;  5FK9 C;  4DN4 M;  4NB3 A;  1UWV A;  3UI2 A;  4JBW A;  2EPB A;  4CKB A;  1R4Q B;  3QOL A;  3D6C A;  2KBN A;  3P20 A;  4DV3 L;  1TWF B;  1KAB A;  4EQN A;  1LT3 D;  4APV A;  3UE1 A;  3FPP A;  4IN3 A;  3G4S A;  3T1H Q;  2WFW A;  1YIT A;  4DR3 L;  2VS1 A;  3Q6S A;  2HUG A;  3I4N G;  2PQA B;  2HQL A;  4LFA Q;  4BY7 B;  4XXE A;  4HSP A;  4H13 C;  1UE7 A;  4WFN 3;  1E2Z A;  3ULL A;  1A8V A;  3H6M A;  3J81 j;  1H9S A;  1K83 H;  5GAG C;  3I56 A;  3NEN A;  3NEM A;  4R1J A;  1Z7T A;  3K8A A;  1SMX A;  2ZJQ A;  3PUX A;  3CCR A;  4G4K A;  3TME A;  1XPR A;  3Q22 A;  1FYC A;  1JR0 D;  2B2U A;  1X3P A;  3GTL H;  2Q2I A;  4KHP Q;  4MN3 A;  1VQ4 A;  4RCN A;  5D14 A;  2V4D A;  4ZRZ A;  3HOU B;  1K0R A;  1OXU A;  1SYG A;  1HNW L;  1E1O A;  4DKA C;  1OXS C;  3K0X A;  2O4X A;  2WP8 J;  3DMU A;  5I9O A;  2CW0 D;  3A5Z B;  1YJN A;  3P75 A;  5T1I A;  2EOT A;  2ENB A;  4OON A;  4H02 A;  5M5X H;  1SE2 A;  1RF2 D;  5C6A A;  2NVQ B;  2XRQ D;  3NEL A;  3TZU A;  2KCM A;  4LF7 L;  3GTK B;  1I6V C;  3AMU A;  4IQZ A;  2RBM A;  4BY1 G;  1QOH A;  5IGE A;  4C1N K;  2EY1 A;  1XYI A;  2Z4I A;  1X3Q A;  1Y8N B;  5CBE E;  2OTJ A;  3RUZ A;  2Y0S B;  1G8Z D;  1STE A;  1TY0 A;  3BYY B;  3H3V H;  2JA5 B;  3K58 A;  4KHZ A;  4QY7 A;  2KCT A;  3A0J A;  1LM0 A;  2R92 B;  3T56 B;  4X62 Q;  3I72 A;  4XQQ A;  5J22 A;  2L9H A;  4PG3 A;  4A3K H;  4L5R C;  3S1M B;  2XWJ B;  1XTC D;  2VQF Q;  4IUU A;  4L6T B;  4GN5 A;  4ME5 A;  4BA1 I;  3CMA A;  4WOR A;  2K50 A;  2ASB A;  4X65 Q;  3J80 i;  4A3E G;  1L2F A;  1WTR A;  4DR7 L;  5ISR A;  1VQ7 A;  4L5T A;  3IKJ A;  2E2I H;  3HFZ B;  5ELN A;  2Q8R E;  2VZA A;  3P7J A;  3RR5 A;  1AW7 A;  2QA4 A;  3I4L A;  1D2B A;  4RCO A;  3ICE A;  4A3G G;  1KDA A;  3F8T A;  4YY3 Q;  1G6Z A;  4FXK C;  2TMP A;  4CKE A;  2L5T A;  2NBF A;  3MWY W;  3I91 A;  3E3X A;  4GNX C;  1FNW A;  3ERO A;  1MSG A;  1IXR A;  3HKZ E;  5M5Y H;  4O1N A;  2CCZ A;  1D5M C;  2FHT A;  4A3I H;  2UUB L;  4LF8 Q;  4UHV A;  2WII B;  4JC0 A;  5C4J H;  4K5V A;  3PUZ A;  2R7Z H;  1K8G A;  4DK1 A;  2P5Z X;  1JJC B;  1STG A;  4H7B A;  1IW7 D;  3L9A X;  4IOC A;  1B44 D;  1IBL L;  1FVI A;  2WB1 E;  3S1N B;  1VQE A;  2K32 A;  1QNK A;  3NTI A;  4CDF C;  4JI1 L;  3R8B A;  3OIQ A;  1A2U A;  1NNX A;  1ZYR D;  2HIV A;  4DUY L;  1A63 A;  1PZI D;  4L5Q A;  1KLU D;  3PMF A;  4PZ8 A;  5IP9 H;  2R93 B;  2Z0S A;  3S17 B;  3K81 C;  2VXW A;  3RMH A;  1MJE A;  3TZD A;  1CI3 M;  4DR4 Q;  4F87 A;  4X64 L;  3C1E A;  1Q7Y C;  2VQE L;  2X6L A;  1ENC A;  1XNQ Q;  3TRE A;  1TII D;  3RLN A;  2K33 A;  1FNU A;  3M7G A;  3STB C;  5HUR A;  1KNE A;  2A6E C;  4PMC A;  3FKI G;  4G7Z C;  4DV6 L;  1ICW A;  4IUP A;  4AYB E;  1W6J A;  3G6E A;  1YJW A;  2Z8L A;  4M1U B;  4C3I G;  1S5F D;  4A3F B;  1SYF A;  4KV6 A;  3HOW G;  2RHQ B;  4KY5 A;  4WJ4 A;  2E74 C;  1WD1 A;  1WTH A;  5C4H A;  5K36 G;  5J39 A;  1M8A A;  2F0W A;  1Q1E A;  3PIP A;  1X9N A;  4YHH Q;  4E6I A;  1C48 A;  5JJI A;  1UE5 A;  2K5H A;  4UY8 C;  1YNJ C;  3NSW A;  3CCE A;  4ZK9 B;  1IKM A;  3URY A;  3CC2 A;  3CQZ H;  1VQP A;  3HOV G;  4HMI A;  4QB4 A;  5M5W B;  5A2Q E;  1A3T A;  3K6O A;  4J6H A;  1QG7 A;  1AZP A;  4JI4 L;  4KN7 C;  3U50 C;  1N36 Q;  4JBJ A;  5GQO A;  4UAI A;  2HD3 A;  4JOI A;  1EWC A;  4RKL A;  3SHL A;  1EEI D;  1S3O A;  3SK6 A;  4K0K L;  4L5S A;  1HA6 A;  3NTH A;  1YNN C;  2NVT H;  1TQO A;  1STA A;  1V1P B;  3R93 A;  5IGF A;  1PTO H;  3FHW A;  1JQY D;  1RCV D;  1KNA A;  2F0L A;  2QKI C;  3QG1 A;  2MNA A;  4DV1 L;  3DXJ C;  1E22 A;  3PGZ A;  2M9V A;  2LS0 1;  1NBW A;  1B3Q A;  2BH8 A;  2ATW A;  1I6H H;  2AMC B;  2E2H H;  1UE1 A;  4BY7 G;  1A2T A;  2KUM A;  3VR2 A;  1HFG A;  2BE5 D;  3E9I A;  1W3S A;  2RCF A;  1VQH A;  5C4Z A;  2ZJP A;  5JJL A;  1PVO A;  5M3F H;  5BR8 L;  2OQ0 A;  5BN4 A;  3SVM A;  1PFM A;  1VQD A;  2B63 H;  3MFG A;  1X6O A;  1YHA A;  2CWP A;  4UP9 A;  1GHJ A;  3VDY A;  1FJG L;  4GZY C;  4BXX H;  3F2C A;  4FDB A;  2A6H C;  2JYO A;  5LMN Q;  4DK3 C;  1XNR Q;  2B2W C;  3M4Q A;  2B8F A;  1AP0 A;  1VQF A;  2LY7 A;  3W1G A;  1EQV A;  1HRJ A;  1GUO A;  1LLR D;  3S1R H;  5GAH C;  3H3V I;  3HRZ C;  4JI6 Q;  5JPN C;  2MO1 A;  3SGI A;  4XIG S;  1TWC B;  2NWG A;  2F0F A;  3N6R A;  4QGU A;  1VQC A;  4XDX A;  4P2C B;  1SYC A;  1UE6 A;  2AWO A;  2KEE A;  1JWU D;  2E2D C;  1WD0 A;  2Z1C A;  1LO5 D;  2K5N A;  3NHH A;  1JOQ A;  2R7D A;  4UDU C;  1STY A;  3LWE A;  1K28 A;  1JJ2 A;  2NVX H;  1QIL A;  2Y0S G;  1QNU A;  2EYO A;  4KK7 A;  1HQM C;  2L11 A;  3A7L A;  4A4I A;  1SE8 A;  2E76 C;  1BKB A;  2XSC A;  3I4N B;  1GKH A;  4IAL A;  2F4V Q;  1EIF A;  1ZXT A;  3PO2 H;  1O7L A;  2R61 A;  2IW3 A;  2MP1 A;  4YIJ A;  5KRU A;  4GNX B;  1EZ8 A;  4AQY L;  2DY8 A;  4DV7 Q;  4YWL A;  1SJH D;  1K0S A;  2F0J A;  4CJ0 B;  1ESF A;  4FP5 D;  3DM3 A;  4RAU C;  3J7A V;  2CQA A;  3FMC A;  2UXC Q;  3NXW A;  3D31 A;  2NZO A;  2YTY A;  2JEA I;  3AU7 A;  3UDI A;  3D8G A;  5E3F A;  3H94 A;  1IBK Q;  4RH6 A;  1BCP C;  3C3L A;  4GKK Q;  2PYK A;  4JI7 Q;  4NKL A;  3CCM A;  3HKZ G;  4A3B B;  2A68 C;  4B3M Q;  4DGZ A;  2MFI A;  1EZ6 A;  2NVY H;  4DA2 A;  1SDF A;  3M9B A;  4NW2 A;  2UU9 Q;  3MA2 B;  1PH5 A;  3BZK A;  3KBG A;  4N9P A;  3S16 H;  4NXN Q;  2PI2 A;  2RDG A;  5COY A;  2KA7 A;  4BY1 B;  3CD6 A;  4JYA Q;  2DY7 A;  1EEF D;  2F0I A;  2VUM B;  1VQ5 A;  1LTG D;  1RKN A;  2D0P A;  2EY2 A;  4DR6 Q;  3H3V C;  2NZH A;  1HUN A;  3FP9 A;  1C8C A;  1NTG A;  1HR0 W;  2AQ1 B;  1EOT A;  2RHS B;  5IWA L;  4ZLT F;  3MZ5 A;  3BS1 A;  3RLF A;  4LFC Q;  2D2C C;  1SR3 A;  1YHB A;  5JVH 3;  1TS5 A;  2IHF A;  3MFY A;  4N8X 1;  2JA7 H;  2BA0 A;  1PYW D;  1SNQ A;  4DV5 L;  4KJO A;  3M3Y B;  4TQU S;  3VR5 A;  4DR1 L;  4MNO A;  3SDZ A;  3WDN A;  5C0X H;  5ELB A;  3BVZ A;  1DGS A;  4JV5 Q;  1KRT A;  1DZ1 A;  3I55 A;  2VY3 A;  4B9W A;  3E6Z X;  1LT6 D;  2Z9H A;  4S3S A;  3JAM E;  4P72 A;  3GTP B;  3A8K E;  4R9W A;  1PFN A;  1CTM A;  2B2T A;  4I7Z C;  1SBB B;  5FLX L;  3KJO A;  2DNE A;  2Z4H A;  3BVM A;  3N52 A;  3T51 B;  4A3F G;  1PH2 A;  1BF4 A;  2UXD Q;  4ZUJ A;  1SNP A;  3K5N A;  2AWN A;  2SOB A;  3S2H H;  2CH4 W;  3KFU A;  1JOR A;  1FD7 D;  2EYJ A;  1N34 Q;  4HR7 B;  1M4V A;  1QB5 D;  1I50 H;  1HTP A;  1EYG A;  3LGJ A;  2F03 A;  4C3J H;  4LFB Q;  3W3A A;  1PH9 A;  1I3Q B;  2RKS A;  3KOJ A;  1SEB D;  5C5M A;  3OMG A;  1NMG A;  2B8G A;  3NWS A;  3HOZ H;  1T5E A;  4FVM A;  2RCN A;  3HZX A;  3S24 A;  1E24 A;  1PH3 A;  1K8M A;  1XMO L;  2OT2 A;  3W5O A;  5GAD C;  1XXG A;  4F7X A;  3NTK A;  4G57 A;  1PZK D;  2F0N A;  2OXP A;  4EGV A;  1J5E L;  3UDX A;  1I94 Q;  4XYQ A;  1K3R A;  4DAV A;  1B8A A;  2WKC A;  2E5L Q;  1GM5 A;  2F3I A;  1IKL A;  2KQ3 A;  2KJX A;  3FDT A;  1PH4 A;  2BCO A;  2UUC L;  4POF A;  1GUS A;  3J80 L;  3T1Y L;  1HQR D;  1YVC A;  4OWW B;  2Z6K A;  3KF8 B;  5M3F G;  5CV9 A;  5IYB H;  1D1K A;  1A3V A;  5JAV A;  1U4M A;  1BNZ A;  1VQL A;  1Y69 U;  2UXB Q;  1X54 A;  1WTX A;  2B63 G;  3FKI B;  4YWM A;  4HJ5 A;  4KMU C;  4HJA A;  4RGO S;  2JE6 I;  1LV9 A;  3HOY B;  4LF6 Q;  2E2J B;  1KIX A;  3V2T A;  3HOX H;  4HSV A;  4C3I B;  4NPS A;  4DAY A;  3M4O H;  1TWH B;  2L0C A;  3I3C A;  2ICI A;  3EA6 A;  4R4I A;  3MXP A;  4DV4 Q;  1B4O A;  4LK1 C;  5IYC H;  2YTX A;  4RFB A;  2AUK A;  3CAM A;  4B3R L;  4KI0 A;  1Y1W B;  1KHI A;  3SK4 A;  1ONL A;  1N9W A;  2I0Q A;  3J81 c;  1BUV T;  3M4Y A;  4JI2 Q;  2XN9 C;  4UPA A;  5HGT A;  3U4V A;  4YCW A;  2ALY B;  1S5B D;  1RDP D;  2EYL A;  1LT5 D;  3TS2 A;  4OL7 A;  1UAP A;  4HAE A;  3STB D;  4A3J H;  2A6E D;  1D5X C;  4LJZ C;  3I7F A;  1Q8I A;  1LTB D;  4OO1 H;  4GKJ Q;  4U68 A;  2CHB D;  4BBS H;  1V9P A;  2F0M A;  1XPU A;  4KTA A;  2UUA Q;  1WFQ A;  3EN2 A;  1A6X A;  4RG1 A;  1XX8 A;  4LF5 Q;  1X32 A;  1PTO C;  4EQ5 A;  1WTP A;  2AUJ D;  2R3Z A;  2PQA A;  2SNS A;  1E3P A;  4QJF A;  3GQB A;  1K83 B;  3HGB A;  4UP7 A;  1O78 A;  5IOC A;  4KHP L;  1BBW A;  1IBM L;  1D1I A;  4IJL A;  4Q0F A;  4TKO B;  1YNJ D;  1IYJ B;  1B53 A;  4M8A A;  3GTL B;  1K9M C;  2A19 A;  3CCJ A;  1AE3 A;  2L15 A;  4ZQ3 A;  1U5K A;  1LTA D;  2K03 A;  3OIP A;  4H44 C;  1HA5 A;  3VYT A;  1GUG A;  2QDB A;  1HNX Q;  2EYM A;  1A3U A;  3T53 B;  1ET9 A;  3A54 A;  3D4R A;  1VQA A;  3KBX A;  4NDX A;  3BZD B;  1BCP B;  1J6Q A;  4O42 A;  2DGY A;  2D62 A;  4JI8 L;  4DNI A;  4EVO A;  3JAM i;  5M5X B;  3D6W A;  3EFX D;  5TSS A;  1B3A A;  2O5I C;  1IL8 A;  1F2L A;  3H15 A;  1GJX A;  2PQE A;  3OHX C;  4JI5 L;  4DR2 Q;  4CJ2 C;  2Q2T A;  2JXM B;  1O7Z A;  1G29 1;  3GTQ H;  4C2M H;  3ND9 A;  2ZXO A;  1S72 A;  4X62 L;  4LUO A;  4YWK A;  2F0P A;  1EL0 A;  2SEB D;  2EDG A;  1NR4 A;  3BYT B;  3PF5 A;  1HR0 L;  2K04 A;  3PCO B;  1PYS B;  5H1S E;  5DLQ E;  1Z47 A;  3KJP A;  1L1O C;  5EQ0 A;  4A3B G;  4HJ8 A;  4A3K B;  2QEJ C;  4U67 3;  1II3 A;  5IGB A;  1PH1 A;  2KHJ A;  2Q2U A;  1PTO F;  3V05 A;  4DV3 Q;  2XRS D;  1Z9F A;  3I4M H;  1NY4 A;  4WJW A;  3H09 A;  3SXH A;  2B2V A;  1C7Y A;  3G71 A;  5K5P A;  2K6A A;  3MXN B;  2VNU D;  2PPB C;  1CQV A;  5C0X I;  2VUM G;  4DR3 Q;  2E2I B;  2V1C C;  1HH2 P;  2EYP A;  2MUY A;  2EQS A;  4ME3 A;  4A93 H;  3BDL A;  4IUQ A;  3AEV A;  5C44 H;  1J8I A;  4JG2 A;  1EQQ A;  1BVS A;  4B08 A;  1X3G A;  2J7Z A;  4J8Q A;  1BBX C;  1QE6 A;  3VR3 A;  5M5Y B;  1TT2 A;  1FL0 A;  3ONA B;  1CFM A;  1EYD A;  4A3I B;  3K57 A;  1VQB A;  3LWU A;  5C4J B;  4PZ6 A;  3NQI A;  5HGQ A;  2JA9 A;  2PW7 A;  2R7Z B;  1HNW Q;  1WOC A;  3I70 A;  1CK1 A;  4NXM L;  2HHH Q;  1MHW C;  3ULJ A;  1PXU A;  1PA6 A;  4DNR B;  2RSN A;  2A5H A;  4PQX A;  1OTC A;  4CDC C;  1IL2 A;  3X3M A;  5ELC A;  1CSP A;  5EJW A;  2H4O A;  1JE5 A;  3JC6 6;  3HKZ B;  4QL5 A;  4JI0 Q;  4LWC A;  4X66 L;  4FXD A;  1GUW A;  1ML0 D;  3F1Z A;  2TSS A;  3Q24 A;  2F0U A;  2IX1 A;  1SLJ A;  1TVX A;  2F3V A;  4JCV E;  2QCP X;  1CUK A;  1IYV A;  3A8I E;  1NE3 A;  3I90 A;  3BJU A;  1VQJ A;  1A62 A;  2X6G A;  2ID0 A;  2PNH A;  1SYD A;  2FIN B;  2WB1 B;  3HOX G;  4IUT A;  3L2P A;  4HID A;  3SR1 A;  4OHJ A;  1I5F A;  1MI2 A;  1SMY D;  3NP8 A;  2EXZ A;  2LXK A;  2A68 D;  4KJN A;  4DR7 Q;  1SFO H;  1B9M A;  1XMQ L;  3J7A 5;  4IPC A;  2EY6 A;  1BO0 A;  2A69 D;  5C5L A;  1LUZ A;  5IT9 L;  4IFD H;  4DV2 L;  2EIF A;  1U4L A;  3RZD H;  4A3J G;  3CQZ B;  2CKZ B;  4N8F A;  4PZ7 A;  4KKT A;  3I2Z A;  3HOY G;  1S5C D;  1R9T H;  4AYB B;  3OTO L;  5IT9 E;  5E4X A;  4GOP C;  4A3C G;  2IX0 A;  2Q8T A;  1B9N A;  1DOK A;  1F9S A;  4BBS G;  4OO1 I;  4OWX B;  3RN5 A;  2ZTC A;  3GP7 A;  1EY9 A;  2D0O A;  1Y1W G;  2JQO A;  4HIK A;  2UUB Q;  1SSO A;  1UEA B;  1GHK A;  5C4X H;  3NUC A;  2NVT B;  4QQB X;  4FNF A;  1PTO B;  1PYB A;  3UE0 A;  5A2Q L;  1N33 L;  1TWA H;  3K5O A;  2HCC A;  3MXG A;  3PO3 H;  2F0H A;  2OF1 A;  4RHR A;  3PV0 A;  1HPC A;  1T9H A;  2CVR A;  5F2D A;  2N78 A;  1V1P A;  3CCL A;  4K5W A;  3S14 H;  4IO9 A;  3EVQ A;  5E1F A;  1SN8 A;  4IUV A;  3KK7 A;  4WJ3 M;  4A3D H;  1YZ6 A;  3D4W A;  1AE2 A;  4QUF A;  5COR A;  2KCN A;  1I4G A;  3TS0 A;  2K1B A;  1SNM A;  1S5E D;  1I6H B;  1DD2 A;  1JB7 A;  1HZ9 A;  4DUY Q;  2WAC A;  2E2H B;  2F52 A;  2K52 A;  3B6Y A;  3H0G H;  1YHQ A;  4ZKB B;  5FLX c;  3VA5 A;  5KYL A;  1ASZ A;  2VQE Q;  1NSN S;  2K5Q A;  4DUZ L;  3EQL C;  4DFA A;  5FLM H;  4A3L H;  5JJZ A;  1KTK A;  3DM1 A;  2EJM A;  4KD4 A;  3CRK C;  5M3F B;  5A35 A;  3A74 A;  4RHS A;  2KCC A;  2F4I A;  2FXQ A;  1N32 L;  3NBH A;  2B63 B;  1WCM H;  3ERS X;  2EJF C;  3IFD A;  1QVF A;  1MIU A;  2NUC A;  3A7A B;  4GLV B;  2D5D A;  4ID6 A;  1YI2 A;  2BA1 A;  1YEZ A;  1PH6 A;  1SRO A;  1MJC A;  5JVG 3;  1PRT C;  3CC4 A;  2G5D A;  4K8I A;  1O80 A;  1DYQ A;  3NBH B;  3KLS X;  3Q8D A;  4HIM A;  4CKC A;  4J15 A;  1L1O B;  3PUV A;  2IWH A;  3I4M G;  3OW7 A;  2DJF C;  4IPD A;  5E4W C;  1XJV A;  2DUD A;  2QDL A;  3J80 c;  2CW0 C;  1SNC A;  2B29 A;  1LTI D;  4JI4 Q;  3D4D A;  3PUY A;  3GV3 A;  4X3S A;  1CQF A;  3S2D H;  3FEW X;  2NVX B;  1W6K A;  2HIX A;  4I7A A;  2OEO A;  1HXY D;  1PLF A;  1K73 C;  4A93 G;  3RLO A;  4K0K Q;  3DEO A;  4PMB A;  2K5D A;  3T13 A;  3PO2 B;  1U9R A;  1VMP A;  5EBC A;  5C3E H;  5DM6 3;  2MHV A;  2D9U A;  4A3K G;  1NR2 A;  3IRB A;  1LTT D;  5EGT A;  1B70 B;  4DV1 Q;  3MEF A;  4LUZ A;  4KN4 C;  1Z6H A;  1GD7 A;  1EIG A;  2M2L A;  1PFB A;  2UXC L;  2XGT A;  4JBM A;  3ZJY C;  1A15 A;  4GNX A;  4DPG A;  4TRD A;  1E1T A;  1ZKO A;  1AEX A;  3VA7 A;  2I5M X;  2K7V A;  4WRD A;  1VQK A;  3CCQ A;  3C2P A;  1WYD A;  5ELF A;  3D3R A;  5I9P A;  3DHQ A;  3ULP A;  3DEP A;  2SDF A;  1PRT F;  1RHP A;  4PV1 C;  2WKD A;  5BR8 Q;  4RGM A;  3GTO H;  5LHY 1;  2QIL A;  2NVY B;  1W2B A;  1KXL A;  1FJG Q;  3S9W A;  1T5X D;  4A3I G;  1GUT A;  5JEA H;  3CRL C;  3G6J B;  5FO7 B;  2K14 A;  3S16 B;  1VQ6 A;  2R7Z G;  2O5J C;  2CQO A;  1G2S A;  3J81 i;  3NPP A;  1F77 A; 
#chains in the Genus database with same CATH homology
 3GD7 A;  1PDQ A;  3X3N A;  1JB3 A;  2PZT A;  4F8M A;  5ELE A;  1AZQ A;  1DON A;  4ZUI A;  4OIK A;  2NZ1 D;  2C9O A;  1DCZ A;  1JWS D;  1I4R A;  3U9O A;  2K28 A;  3QB3 A;  2XVS A;  4ZYS A;  3IAY A;  4OIJ A;  5I6Y A;  5CBA E;  4XYO A;  3IFT A;  2PW5 A;  3NK9 A;  3DWQ A;  1WTQ A;  4IFD I;  3CU7 A;  1IHZ A;  1TS3 A;  1F9R A;  3LNN A;  5KYI A;  1U4P A;  1F9P A;  3VR6 A;  2RDH A;  4IUN A;  1GUN A;  3S2H B;  1EY5 A;  1PZJ D;  3M7N A;  1EU4 A;  1I50 B;  3JAM L;  2KOL A;  4C3J B;  2PNR C;  3VR4 A;  3HOZ B;  5AFW A;  3DUZ A;  5FO9 B;  2B2U C;  5KGU A;  1SAP A;  1Q3L A;  1CHQ D;  1NUC A;  1DM0 B;  1H9J A;  1ET6 A;  1RJT A;  2E75 C;  1QJO A;  3QO2 A;  1HFN A;  3QIA A;  2K05 A;  1BCP F;  2L55 A;  1EIH A;  1Q1B A;  4K5X A;  5I2X A;  4K14 A;  5CGK A;  4XT3 B;  5J1Z A;  5JPM C;  4KD3 A;  3J7A F;  1AFP A;  3KF8 A;  1Q12 A;  2GA4 B;  1DOM A;  1DJR D;  3HOX B;  3OPO A;  1HTL D;  3M4O B;  3MXU A;  1QWY A;  4RA8 A;  1EY4 A;  1PRT B;  2B2W A;  3SK5 A;  3E0J A;  1K8O A;  5KEE A;  2G9D A;  1S5D D;  4EQP A;  4F88 A;  4IUR A;  1XWE A;  4XTC S;  4A3J B;  2EE1 A;  2L4N A;  2L12 A;  4R8I A;  1STH A;  2BE5 C;  1OXV A;  4BBS B;  1SJE D;  4FF1 A;  1SE3 A;  2HDM A;  1F2M A;  4KKU A;  5EKI A;  1ROD A;  1LT4 D;  2ZXP A;  1TU2 B;  3CKI B;  3MHB A;  3V96 A;  3GV6 A;  5IGD A;  4K2K A;  1EFI D;  2F0O A;  4BWG B;  2J4X A;  3E5S A;  1L0Y B;  5CV4 A;  3WOF A;  3W2D A;  1Q90 A;  2F0T A;  1RTN A;  2A74 C;  3TBI B;  3K5M A;  1TR5 A;  1LAB A;  5C3X A;  2EJG C;  1I4H A;  1ILP A;  5JEA G;  2F0G A;  3BVG A;  3WOE A;  1JIC A;  5JEA J;  1ZEQ X;  4ZAI A;  2X69 A;  1KDB A;  2LFN A;  2PMZ B;  3GTQ B;  4C2M B;  3LX0 A;  2IPK D;  1OXX K;  1WTV A;  4K2L A;  3TDQ A;  3HS0 C;  2EVB A;  1VF5 C;  1D5Z C;  4PNY A;  2Q8I B;  4HTH A;  2PO4 A;  2MGS A;  1YNN D;  1MGS A;  3I4M B;  5KNB A;  1Y8P B;  2RA4 A;  4J1M A;  1EU3 A;  5C3W A;  4KHV A;  1CZW A;  2FJ2 A;  1FR3 A;  4X3T A;  5DEH A;  4ZKC B;  4A93 B;  4R8N A;  3MXN A;  5C44 B;  5KND A;  1PRT D;  4V0B A;  1SND A;  3Q23 A;  2NYZ D;  2RDF A;  3R3O A;  2F0Q A;  4C56 C;  5I4D A;  2N55 A;  5C0X G;  4FF4 A;  1I4X A;  3FRP B;  4BS9 A;  5C0X J;  3SEB A;  1BOS A;  1E2V A;  3C1F A;  4RWS C;  1H9S B;  2A6H D;  4C3H G;  2KVM A;  1LAC A;  4FXG C;  4IZ8 A;  1SE4 A;  3EJI A;  4L63 B;  1NCV A;  1R4P B;  5EKL A;  4FF3 A;  2H1E A;  5CV7 A;  4ABN A;  4C3J G;  1V8Q A;  5CC4 A;  1F2Z A;  4MHE A;  2I07 B;  1FGB D;  4XQJ A;  4FYD A;  3TN2 A;  2K01 A;  3VYU A;  2F0S A;  5IGG A;  2MPM A;  2WAQ B;  1VF7 A;  3ITP A;  1TY2 A;  1CT1 D;  3I8Z A;  5IGC A;  3HEJ A;  5EPL A;  3A56 A;  1WVL A;  1SFO B;  5EPJ A;  4I65 A;  2FMC A;  2FMM A;  1Y8O B;  1JCK B;  3TP6 A;  3MC0 B;  1JWM D;  4CHT B;  3RZD B;  3A55 A;  2WV6 D;  1R9T B;  2IX3 A;  4KY6 A;  1BQQ T;  3MAQ A;  4XT1 B;  5FOB B;  1BCP D;  2J0T D;  3M85 A;  3ERQ A;  5C4X B;  4C1N I;  5IOD A;  2M00 A;  2JP1 A;  3VYR A;  1U4R A;  1TWA B;  3RD4 A;  3PO3 B;  1LTS D;  1B50 A;  3DWP A;  1B1Z A;  4RKB A;  1KDC A;  4CGY B;  2QF7 A;  4H0L C;  3J81 L;  3S14 B;  1IYU A;  1BR9 A;  4A3D B;  1EY0 A;  4OO1 G;  1SYB A;  2C5C A;  2NTT A;  1H9M A;  5D3I B;  2IT1 A;  1OO9 B;  4X3U A;  3OWE B;  4BA2 I;  4NP5 A;  3J81 E;  5G3L F;  3MEH A;  5JOB A;  1EQT A;  2ZT9 C;  3H0G B;  3PIO 3;  4QMG A;  5IIF A;  1HHV A;  5CV6 A;  1G91 A;  3PIP 3;  5FKA C;  2EYH A;  3SK8 A;  2XNA C;  5D65 A;  4MIU A;  4B9X A;  2DNC A;  1MSH A;  1G2T A;  2SNM A;  2F3W A;  1WCM B;  2NB0 A;  4ILW A;  3O13 A;  5DAU A;  4HN7 A;  2JEB I;  1TKW B;  1JOO A;  1E0B A;  2WIN B;  3MTS A;  2AQ2 B;  1VMC A;  4NMZ A;  2RSO A;  1V1O A;  2F0V A;  3KLR A;  3R2T A;  5DM7 3;  2PZU A;  4HCS A;  5KIX A;  3K0Y A;  4RGT A;  5DNF A;  4DF7 A;  1OXT A;  3A8J E;  3BG3 A;  5LL6 X;  4V19 0;  1PMR A;  4K6L A;  5EBD A;  3BDC A;  3S2D B;  1DXM A;  2F0E A;  2NN6 H;  2B2T C;  1KAA A;  3NE5 B;  4DXF A;  4HMJ A;  2N88 A;  4HED A;  3S1R B;  5C3E B;  3BDO A;  3T4A C;  4PMW A;  5CMD A;  1GOZ A;  4QF4 A;  3KUP A;  4CJ1 B;  2NTS A;  4FF2 A;  4DU9 A;  4G7H C;  1BDO A;  2ICE C;  3Q0A A;  1CM9 A;  1O7Y A;  1JC7 A;  4HCE A;  4Q5V A;  1E2W A;  3C46 A;  3HP3 A;  2F0D A;  3AB9 A;  5CR3 A;  2B2Y C;  1SNO A;  1V43 A;  1SYE A;  3QWN A;  2KEC A;  3I73 A;  4XQN A;  5KNC A;  5D3D A;  3GTO B;  2PZW A;  2EZV A;  3NWT A;  2MJ8 A;  3OWF A;  1B2T A;  3DWA A;  4DAP A;  1FNV A;  3RZO B;  3K59 A;  2K5W A;  5EPK A;  1ILQ A;  2DN8 A;  1CZG A;  4KKS A;  4KY7 A;  1L0X B;  1AN8 A;  3S15 B;  3OOC A;  5M9O A;  4L8J A;  1EY7 A;  2L1B A;  1EYA A;  2FFK B;  3HG9 A;  1JE4 A;  2B39 A;  1PTO D;  1CA5 A;  4X3K A;  1NAP A;  3L3O C;  3P1H A;  2KHS A;  2JSO A;  4ULL A;  2PCF B;  3VYS A;  1C4Q A;  5NUC A;  2JA6 B;  4JK1 C;  4Z9C B;  4DK0 A;  4DNT B;  5CV8 A;  3TP5 A;  3GTM B;  1I4P A;  3FPU B;  3FVQ A;  1LTR D;  2JA7 B;  1GXD C;  1IW7 C;  3OMC A;  5M3M B;  1Y1V B;  4IFD G;  1HCZ A;  1EY6 A;  3K5L A;  1UUP A;  4IFD J;  1CA6 A;  1ZYR C;  4C3H B;  1QCB D;  2BDN A;  4DXG A;  1SMY C;  4FO2 A;  5CV5 A;  1WTW A;  2AQ3 B;  2A69 C;  2LMC B;  1WTO A;  3KLS A;  2ZXR A;  2A73 B;  5I2Y A;  4Y7N B;  1TS2 A;  1TS4 A;  2HCI A;  4QCL A;  2BOS A;  2RVL A;  3TP8 A;  1H9R A;  4ODG A;  4RGN A;  2F0K A;  1UNS A;  1F9Q A;  4A3M B;  1HUM A;  1JOK A;  3K7A B;  1EWH A;  2I46 A;  4A3E B;  1ESR A;  3PUW A;  1RD9 D;  3NQT A;  3SE0 A;  1MBY A;  3F2U A;  5EKK A;  3U9S A;  3IL8 A;  3G7L A;  1I4Q A;  4QUC A;  2JA8 B;  4A3G B;  5FO8 B;  4G7O C;  2EYF A;  2B2V C;  2R6G A;  4CBV A;  5LL6 S;  5FLX E;  5G3L D;  3L7Z C;  3QOJ A;  2NN6 G;  1SXT A;  3GO5 A;  2HQE A;  2G9H D;  3GTG B;  1D6E C;  2NN6 I;  2VB3 X;  4K6D A;  2XIW A;  1MD2 D;  2KED A;  3CHB D;  4LMQ D;  1ENF A;  2B2Y A;  1KLG D;  1S4Z A;  1TWG B;  4TSS A;  5T1G A;  2YU9 B;  4K8J A;  4OGQ C;  2LKV A;  3MVV A;  5ELD A;  1STN A;  1J9O A;  2XWB B;  2HDL A;  2RQX A;  3J7Y W;  5I6W A;  3TSS A;  1H9K A;  1BXT A;  3S1Q B;  3J80 E;  3R2I A;  3ND8 A;  4QIW B;  5BN5 A;  1VDZ A;  2O2L D;  3OSO A;  3HOW B;  3GTJ B;  2YYZ A;  3NPP A;  1ENA A;  2IL8 A;  2VB2 X;  4EQO A;  4LAA A;  3TP7 A;  1STB A;  1EY8 A;  2F1M A;  4BBR B;  3ZYY X;  1EYC A;  2EY5 A;  3HOV B;  2BDO A;  5CYU A;  1DOL A;  2IJ0 A;  3QJY A;  4N9T A;  1RTO A;  1VCI A;  3H91 A;  1F2Y A;  3T16 A;  1CHP D;  5BN3 A;  3NBI A;  5K36 H;  5FK9 C;  4DN4 M;  3UI2 A;  4JBW A;  2EPB A;  4CKB A;  1R4Q B;  3QOL A;  3D6C A;  3P20 A;  1TWF B;  1KAB A;  4EQN A;  1LT3 D;  3FPP A;  4IN3 A;  3Q6S A;  2HUG A;  4BY7 B;  4XXE A;  4HSP A;  4H13 C;  4WFN 3;  1E2Z A;  3H6M A;  1H9S A;  1Z7T A;  3PUX A;  4G4K A;  3TME A;  3Q22 A;  1FYC A;  1JR0 D;  2B2U A;  1X3P A;  4MN3 A;  4RCN A;  5D14 A;  2V4D A;  4ZRZ A;  3HOU B;  1OXU A;  1SYG A;  1OXS C;  2O4X A;  2WP8 J;  3DMU A;  5I9O A;  2CW0 D;  3P75 A;  5T1I A;  2EOT A;  2ENB A;  1SE2 A;  1RF2 D;  5C6A A;  2NVQ B;  2XRQ D;  3TZU A;  3GTK B;  1I6V C;  3AMU A;  4IQZ A;  2RBM A;  5IGE A;  1QOH A;  4C1N K;  2EY1 A;  1XYI A;  2Z4I A;  1X3Q A;  1Y8N B;  5CBE E;  3RUZ A;  2Y0S B;  1G8Z D;  1STE A;  1TY0 A;  3BYY B;  2JA5 B;  3K58 A;  4KHZ A;  2R92 B;  3T56 B;  3I72 A;  4XQQ A;  5J22 A;  2L9H A;  3S1M B;  2XWJ B;  1XTC D;  4IUU A;  4L6T B;  4ME5 A;  4BA1 I;  4WOR A;  1WTR A;  5ISR A;  3IKJ A;  2Q8R E;  3P7J A;  1AW7 A;  3I4L A;  1D2B A;  4RCO A;  1KDA A;  1G6Z A;  4FXK C;  2TMP A;  4CKE A;  2L5T A;  2NBF A;  3MWY W;  3I91 A;  1FNW A;  3ERO A;  1MSG A;  4O1N A;  1D5M C;  2FHT A;  2WII B;  4K5V A;  3PUZ A;  4DK1 A;  1STG A;  4H7B A;  1IW7 D;  3L9A X;  1B44 D;  3S1N B;  2K32 A;  1QNK A;  3NTI A;  3R8B A;  3OIQ A;  1A2U A;  1ZYR D;  1PZI D;  1KLU D;  3PMF A;  2R93 B;  3S17 B;  2VXW A;  3RMH A;  3TZD A;  1CI3 M;  4F87 A;  3C1E A;  2X6L A;  1ENC A;  1TII D;  2K33 A;  1FNU A;  3M7G A;  5HUR A;  1KNE A;  2A6E C;  4PMC A;  4G7Z C;  1ICW A;  4IUP A;  1W6J A;  2Z8L A;  4M1U B;  4C3I G;  1S5F D;  4A3F B;  1SYF A;  4KV6 A;  4KY5 A;  2E74 C;  1WD1 A;  5C4H A;  5K36 G;  5J39 A;  1M8A A;  2F0W A;  1Q1E A;  4E6I A;  1C48 A;  1YNJ C;  3NSW A;  4ZK9 B;  1IKM A;  3URY A;  4HMI A;  4QB4 A;  5M5W B;  5A2Q E;  1A3T A;  3K6O A;  4J6H A;  1QG7 A;  1AZP A;  4KN7 C;  4UAI A;  1EWC A;  4RKL A;  3SHL A;  1EEI D;  3SK6 A;  1HA6 A;  3NTH A;  1YNN C;  1TQO A;  1STA A;  1V1P B;  3R93 A;  5IGF A;  1PTO H;  1JQY D;  1RCV D;  1KNA A;  2F0L A;  2QKI C;  3QG1 A;  3DXJ C;  2M9V A;  2LS0 1;  1A2T A;  2KUM A;  3VR2 A;  1HFG A;  2BE5 D;  5C4Z A;  5BN4 A;  3SVM A;  1PFM A;  3MFG A;  1GHJ A;  4GZY C;  2A6H C;  2JYO A;  2B2W C;  2B8F A;  1AP0 A;  2LY7 A;  1EQV A;  1HRJ A;  1GUO A;  1LLR D;  3HRZ C;  5JPN C;  4XIG S;  1TWC B;  2NWG A;  2F0F A;  3N6R A;  4XDX A;  4P2C B;  1SYC A;  2AWO A;  2KEE A;  1JWU D;  2E2D C;  1WD0 A;  2Z1C A;  1LO5 D;  3NHH A;  1JOQ A;  4UDU C;  1STY A;  3LWE A;  1QIL A;  1QNU A;  2EYO A;  4KK7 A;  1HQM C;  2L11 A;  3A7L A;  2E76 C;  2XSC A;  3I4N B;  4IAL A;  1ZXT A;  1O7L A;  2R61 A;  2IW3 A;  2MP1 A;  4YIJ A;  5KRU A;  1EZ8 A;  2DY8 A;  1SJH D;  2F0J A;  4CJ0 B;  1ESF A;  4FP5 D;  4RAU C;  3J7A V;  2CQA A;  3FMC A;  3NXW A;  3D31 A;  2JEA I;  3AU7 A;  3D8G A;  5E3F A;  3H94 A;  4RH6 A;  1BCP C;  3C3L A;  2PYK A;  4NKL A;  4A3B B;  2A68 C;  4DGZ A;  1EZ6 A;  4DA2 A;  1SDF A;  4NW2 A;  3MA2 B;  3KBG A;  4N9P A;  2RDG A;  5COY A;  2KA7 A;  4BY1 B;  2DY7 A;  1EEF D;  2F0I A;  2VUM B;  1LTG D;  1RKN A;  2EY2 A;  1HUN A;  3H3V C;  1C8C A;  2AQ1 B;  1EOT A;  4ZLT F;  3MZ5 A;  3BS1 A;  3RLF A;  2D2C C;  5JVH 3;  1TS5 A;  3MFY A;  2BA0 A;  1PYW D;  1SNQ A;  4KJO A;  3M3Y B;  4TQU S;  3VR5 A;  3SDZ A;  3WDN A;  5C0X H;  5ELB A;  3BVZ A;  1DZ1 A;  4B9W A;  3E6Z X;  1LT6 D;  4S3S A;  3JAM E;  3GTP B;  3A8K E;  4R9W A;  1PFN A;  1CTM A;  2B2T A;  4I7Z C;  1SBB B;  5FLX L;  2DNE A;  2Z4H A;  3BVM A;  3N52 A;  3T51 B;  1BF4 A;  4ZUJ A;  1SNP A;  3K5N A;  2AWN A;  2SOB A;  1JOR A;  1FD7 D;  2EYJ A;  4HR7 B;  1M4V A;  1QB5 D;  1HTP A;  2F03 A;  3W3A A;  1I3Q B;  2RKS A;  5C5M A;  1SEB D;  3OMG A;  2B8G A;  3NWS A;  1T5E A;  3HZX A;  4FVM A;  1K8M A;  2OT2 A;  1XXG A;  4F7X A;  3NTK A;  4G57 A;  1PZK D;  2F0N A;  2OXP A;  4EGV A;  4XYQ A;  4DAV A;  2WKC A;  1IKL A;  2KQ3 A;  2KJX A;  3FDT A;  2BCO A;  1GUS A;  3J80 L;  1HQR D;  5CV9 A;  1A3V A;  1D1K A;  5JAV A;  1U4M A;  1BNZ A;  1Y69 U;  1WTX A;  3FKI B;  4KMU C;  4RGO S;  2JE6 I;  1LV9 A;  3HOY B;  2E2J B;  3V2T A;  4HSV A;  4C3I B;  4DAY A;  1TWH B;  2L0C A;  3I3C A;  2ICI A;  3EA6 A;  3MXP A;  1B4O A;  4LK1 C;  4RFB A;  2AUK A;  4KI0 A;  1Y1W B;  3SK4 A;  1ONL A;  1BUV T;  3M4Y A;  2XN9 C;  5HGT A;  1S5B D;  1RDP D;  2EYL A;  1LT5 D;  4OL7 A;  1UAP A;  4HAE A;  2A6E D;  1D5X C;  4LJZ C;  1Q8I A;  1LTB D;  4OO1 H;  4U68 A;  2CHB D;  2F0M A;  4KTA A;  1A6X A;  1XX8 A;  1X32 A;  1PTO C;  1WTP A;  2AUJ D;  2R3Z A;  2SNS A;  3GQB A;  1K83 B;  3HGB A;  1O78 A;  5IOC A;  1D1I A;  4Q0F A;  4TKO B;  1YNJ D;  1B53 A;  4M8A A;  3GTL B;  4ZQ3 A;  2K03 A;  1LTA D;  3OIP A;  4H44 C;  1HA5 A;  3VYT A;  1GUG A;  2QDB A;  2EYM A;  1A3U A;  3T53 B;  1ET9 A;  3A54 A;  3D4R A;  3KBX A;  4NDX A;  3BZD B;  1BCP B;  4O42 A;  2D62 A;  4EVO A;  5M5X B;  3D6W A;  3EFX D;  5TSS A;  1B3A A;  2O5I C;  1IL8 A;  1F2L A;  1GJX A;  2PQE A;  3OHX C;  4CJ2 C;  2JXM B;  1O7Z A;  1G29 1;  3ND9 A;  2ZXO A;  2F0P A;  1EL0 A;  2SEB D;  2EDG A;  1NR4 A;  3BYT B;  2K04 A;  1Z47 A;  5EQ0 A;  4A3K B;  2QEJ C;  4U67 3;  1II3 A;  5IGB A;  1PTO F;  3V05 A;  2XRS D;  4WJW A;  3H09 A;  3SXH A;  2B2V A;  5K5P A;  2K6A A;  2VNU D;  2PPB C;  1CQV A;  5C0X I;  2E2I B;  2EYP A;  2MUY A;  3BDL A;  1J8I A;  4B08 A;  2J7Z A;  4J8Q A;  1BBX C;  1QE6 A;  3VR3 A;  5M5Y B;  1TT2 A;  3ONA B;  1CFM A;  1EYD A;  4A3I B;  3K57 A;  3LWU A;  5C4J B;  3NQI A;  2PW7 A;  2R7Z B;  3I70 A;  1CK1 A;  1PXU A;  4DNR B;  2RSN A;  2A5H A;  4PQX A;  3X3M A;  5ELC A;  5EJW A;  2H4O A;  3HKZ B;  4FXD A;  1GUW A;  1ML0 D;  2TSS A;  3Q24 A;  2F0U A;  2IX1 A;  1TVX A;  2F3V A;  2QCP X;  1IYV A;  3A8I E;  3I90 A;  2X6G A;  2ID0 A;  1SYD A;  2FIN B;  2WB1 B;  4IUT A;  3SR1 A;  4OHJ A;  1MI2 A;  1SMY D;  3NP8 A;  2EXZ A;  2A68 D;  4KJN A;  1B9M A;  2EY6 A;  1BO0 A;  2A69 D;  5C5L A;  5IT9 L;  4IFD H;  1U4L A;  3CQZ B;  4KKT A;  1S5C D;  4AYB B;  5IT9 E;  5E4X A;  2IX0 A;  2Q8T A;  1B9N A;  1DOK A;  1F9S A;  4OO1 I;  3GP7 A;  1EY9 A;  1GHK A;  1SSO A;  1UEA B;  3NUC A;  2NVT B;  4FNF A;  1PTO B;  5A2Q L;  3K5O A;  2HCC A;  3MXG A;  2F0H A;  2OF1 A;  4RHR A;  3PV0 A;  1HPC A;  2CVR A;  5F2D A;  1V1P A;  4K5W A;  3EVQ A;  5E1F A;  4IUV A;  3KK7 A;  3D4W A;  4QUF A;  5COR A;  2KCN A;  1I4G A;  2K1B A;  1SNM A;  1S5E D;  1I6H B;  1DD2 A;  2WAC A;  2E2H B;  4ZKB B;  3VA5 A;  5KYL A;  1NSN S;  2K5Q A;  3EQL C;  4DFA A;  5JJZ A;  1KTK A;  3DM1 A;  2EJM A;  4KD4 A;  3CRK C;  5M3F B;  5A35 A;  4RHS A;  2KCC A;  2F4I A;  3NBH A;  2B63 B;  2EJF C;  3IFD A;  2NUC A;  3A7A B;  2D5D A;  4ID6 A;  2BA1 A;  5JVG 3;  1PRT C;  4K8I A;  1O80 A;  1DYQ A;  3KLS X;  4CKC A;  3PUV A;  2IWH A;  3OW7 A;  5E4W C;  2CW0 C;  1SNC A;  1LTI D;  3D4D A;  3PUY A;  3GV3 A;  4X3S A;  1CQF A;  3FEW X;  2NVX B;  1W6K A;  2OEO A;  1HXY D;  1PLF A;  3DEO A;  4PMB A;  2K5D A;  3T13 A;  3PO2 B;  1U9R A;  1VMP A;  5EBC A;  5DM6 3;  2MHV A;  2D9U A;  1NR2 A;  1LTT D;  5EGT A;  4KN4 C;  1Z6H A;  1EIG A;  2M2L A;  1PFB A;  1A15 A;  4TRD A;  1ZKO A;  1AEX A;  3VA7 A;  2K7V A;  4WRD A;  3C2P A;  5ELF A;  3D3R A;  5I9P A;  3DHQ A;  3DEP A;  2SDF A;  1PRT F;  1RHP A;  4PV1 C;  2WKD A;  4RGM A;  5LHY 1;  2QIL A;  2NVY B;  3S9W A;  1T5X D;  1GUT A;  5JEA H;  3CRL C;  3G6J B;  5FO7 B;  3S16 B;  2O5J C;  1G2S A;  4IUQ A;  1F77 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...