2GA4B

Stx2 with adenine
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
70
structure length
70
Chain Sequence
ADCAKGKIEFSKYNEDDTFTVKVDGKEYWTSRWNLQPLLQSAQLTGMTVTIKSSTCESGSGFAEVQFNND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords Shiga-like toxin II subunit A
publication title Binding of adenine to Stx2, the protein toxin from Escherichia coli O157:H7.
pubmed doi rcsb
total genus 19
structure length 70
sequence length 70
chains with identical sequence C, D, E, F
ec nomenclature
pdb deposition date 2006-03-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.70 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2ga4B00
1C4QA 2BOSA 1C48A 1DM0B 1D1IA 1CZGA 1QOHA 1D1KA 1BOSA 4ULLA 1QNUA 2C5CA 3MXGA 1CQFA 1CZWA 4P2CB 2GA4B 4M1UB 1R4PB 1R4QB 2XSCA
chains in the Genus database with same CATH superfamily
2N3SA 5J3BA 5HGTA 2NUCA 1Z47A 4LFBQ 3QOJA 3EBEA 2PNHA 3CP0A 4K6DA 5EKKA 1SYDA 2N55A 2QEJC 3PIPA 3OTOL 2Q2UA 2J4XA 1ET9A 3I4NB 3M7GA 1CUKA 1VQGA 4GN4B 2PW5A 3TZUA 1IKMA 4LK1C 3D3RA 4BBSH 1YITA 1STAA 2F0KA 2B63H 2ZTDA 2WFWA 2KBNA 2FXQA 4I7ZC 2EPBA 1HNZL 1PH4A 2OTLA 3L7ZC 4BY7B 1TWGB 1A15A 3URYA 1D6EC 2FJ2A 4LF4L 3PO3H 4CHTB 1II3A 3WOFA 1W2BA 1O7IA 3C2PA 1D5MC 2R7ZB 1AH9A 4RG1A 3GTPB 1WCMH 5FK9C 4GS3A 4DV3L 3C1EA 1N34Q 2HT1A 5IWAL 4ID6A 5GAEC 1SYBA 4HJ5A 3K58A 3I91A 1UEBA 3A5UA 3PMFA 3UDGA 1YJNA 2KCTA 1DCZA 1GUOA 1ILQA 4DV7Q 1BOSA 2NVYH 5IGBA 4KY7A 3K5MA 2K6AA 1RHPA 1O78A 2KHIA 1WYDA 1H9SA 1KHIA 2WAQG 4P2CB 3BZDB 4A4IA 1ESFA 3S2HB 4HIMA 2O4XA 3MEHA 2O5JC 3OOCA 1EWIA 3HFZB 1JOKA 1XTCD 1K28A 1ENAA 4OONA 1A6XA 1H9MA 1GO3E 2LSSA 2SNSA 2XIWA 3S15H 2EDGA 1A2TA 5J39A 2O5IC 2WKCA 2LFNA 4HAEA 5C4JH 1JOQA 4MHEA 3J81E 3H0GB 1PFSA 5DNFA 3OMGA 3STBC 3MFYA 4APVA 3ICEA 2LXKA 3OHXC 1HCZA 1EWCA 2D5DA 4IQZA 4YHHQ 2JA7H 4EQNA 3PF5A 3U9OA 4NP5A 4DNIA 4A3DB 1D1IA 3RR5A 4DNTB 3U58A 2VXWA 3ND8A 2RQXA 2JA8G 4A3FH 1I50B 4HIKA 1MI2A 1EQTA 4FF1A 2LMCB 5CBAE 3M7NA 4A3BH 1SE3A 2F0JA 1OTCA 3T16A 3BZKA 3K7AH 4KKUA 2VUMG 4A3EG 3SE0A 1B4OA 1LT3D 1PV4A 5FOBB 4GKJL 1FD7D 2GVAA 5AJ3L 5M5YH 3PIOA 4FXKC 1GHKA 3BYYB 2Z6KA 3M3YB 5EPLA 3MEFA 1I4HA 1D7QA 4H13C 2CWPA 4IALA 2A68D 4LAAA 5ISRA 1SMYC 2MO1A 1KQSA 1RJTA 4G7HC 1B50A 1SYEA 2E2JB 4KKSA 2B2YA 1XWEA 3J81c 4O2DA 4RWSC 4C3JB 2XVSA 4K14A 4R4CA 2Q2TA 1PTOC 1I6HB 4C1NI 2VW9A 2Z9HA 2E2HB 1TU2B 1F9RA 2EYFA 2UU9Q 4QL5A 1E2VA 2JA8H 4DAYA 3CCJA 3SGIA 5ELOA 3R8BA 1KIXA 4IPHA 4BXXH 3V2TA 3VR4A 1LTAD 1EYAA 3GTQH 1MHWC 2ICEC 1NMGA 5E4XA 2A19A 1OXVA 1UWVA 2PO4A 1HRJA 3QO2A 4IPDA 3GTGB 4JOIA 1I94L 3S1QB 2QDBA 3BDOA 3W1BA 4EGVA 2R93G 4C3IG 3KUPA 2CKZB 4IOAA 5D3DA 1QG7A 2L12A 2RCFA 2ID0A 2F3WA 1D1KA 4JBWA 4YY3L 5A2QE 5C44G 1S5CD 4DR5Q 2MHVA 1HZAA 2X69A 1JJ2A 3CAMA 2JE6I 1GUTA 4KJOA 5M3MH 1K0SA 3KBXA 3AFPA 5FO9B 2PPBC 1GUGA 3BVZA 3EN2A 4XDXA 4GKKL 1XMOL 2K01A 2BE5D 2D0OA 2JA6G 1MBYA 1IBLL 3CCEA 2K5DA 1N33Q 4HMJA 3BDLA 2WAQE 3X3MA 3CKIB 4HJAA 2XGTA 3A7LA 1OO9B 2J0TD 5FO8B 1AZQA 1AE3A 5EGTA 3FPUB 5D65A 4KI0A 2DJGC 5LL6S 3UI2A 4JBKA 2L11A 2WP8J 4DV0L 3T4AC 4LFCL 3BU2A 2A73B 1IYVA 3MC0B 3S1RB 1WVLA 5GADC 3HOXB 1YBYA 2JJQA 5J22A 3HOVG 3TP8A 1QVFA 1EFWA 2O2LD 3S2DH 2VY3A 5BN3A 1NJIC 5C44H 4KHPL 3H94A 1LT4D 2F3VA 2NVTH 3OWFA 2KQ3A 1WTHA 1SFOB 4C2MH 2OQ0A 3KDFA 3O13A 1SMXA 4GZYC 2A69C 4C3HB 3K80C 4JI3Q 3E5SA 4MN3A 5D3IB 5DM73 4JG2A 2Y0SB 1T5EA 1FGUA 4CDEC 1JC7A 1AEXA 4DV1L 3D31A 4NMZA 1DYQA 2M00A 5ELEA 1X32A 2F0FA 3ZJYC 2UXCQ 2KEDA 5CV5A 2PQEA 3FVQA 4IUNA 4L6TB 5T1GA 4GNXC 1CT1D 2A6EC 1F2LA 2EJGC 1QNUA 3F2UA 3KLSA 3RLNA 3T53B 4RGNA 2R7DA 4BY1B 4WORA 1OXTA 4P75A 2CH4W 2B2VA 2FFKB 4M1UB 4A3GB 2NZOA 4LNQA 1LYLA 1QILA 4POGA 2B2WC 2B3GA 3I70A 3IAYA 4JI8Q 2N49A 3ONAB 2F0WA 1X65A 3DEPA 4B3RQ 1EWHA 3W2DA 4H44C 4DR6L 2HIVA 4DU9A 2VB3X 5L37A 1I5FA 1B3QA 2EE1A 4FF3A 1Q12A 2F0TA 4IUTA 5FLMG 1UUPA 3PSIA 2FMCA 1LTTD 2HCCA 4OWTB 4JI7L 1QUQB 4IFDG 5C0XJ 2EZVA 2K32A 4B08A 1HFGA 1I4QA 4XIGS 5CORA 3PUZA 1CKOA 3HKSA 4DAPA 1RODA 5CV6A 1UE5A 4EQ5A 4UY8C 4H0LC 3AB9A 1U5KA 3I4MG 3MTSA 4KN7C 3I73A 5C6AA 3JC66 1FJGQ 3CPFA 2EYHA 1VQ4A 5IYBG 2QW7A 3NE5B 3RMHA 3DUZA 1PXUA 4QY7A 1HXYD 3CW2C 4NXMQ 1TWFH 4LFAL 1EU4A 1HR0L 3N52A 4CDFC 1VQBA 1K3BC 2BOSA 1E3PA 4OL7A 4CKCA 4KJNA 2F0IA 1Y1VB 4YCWA 3T51B 4ZYSA 3GO5A 5C4XH 4ZAIA 3CXCA 5I2YA 1Y1WG 2HQEA 4HN7A 1JICA 2JP1A 5C3XA 4A3LG 1WTPA 3L0OA 3HOYB 2IX1A 4N9PA 5C0XH 2ZTCA 1Y14B 5JPMC 3S1NH 5FLMH 1VQMA 1H9KA 1LTBD 2QA4A 1GM5A 1U4RA 1WI5A 3GV6A 5A35A 1HTPA 3M4OB 2H1EA 3D6WA 1EYGA 5JJZA 3P1HA 4DV4Q 4ZK9B 1VQEA 2F0MA 4J8QA 2E74C 1SNOA 3QWNA 5KIXA 4X64Q 3VA5A 1V1QA 5C4ZA 2UXDL 5JVG3 4DR7Q 2DY8A 3HGBA 4ABNA 1OXXK 3HS0C 3GTLB 3PUWA 2Z8LA 1JWSD 3EFXD 3D4RA 4A3JB 1QVCA 2ATWA 3OIPA 3HOZB 3H09A 5I6WA 1XNQL 4DUYL 3TP5A 4OXPA 1EYDA 1SBBB 2A6HC 4PNYA 1CSPA 3HOWH 1SJED 1L0XB 1JOOA 1LV9A 4A3IH 1XJVA 4MIUA 4A3LH 3G48A 4QUFA 2CQOA 1PVOA 1TWHB 1BCPC 2ENBA 2R7FA 4K5XA 4X65Q 5JVH3 1A63A 1PA6A 1X6OA 5IGDA 5IY0A 3RZDH 1N36L 1TY2A 4S3SA 4A93H 3RZOH 1YEZA 1K8OA 4AIMA 1BBWA 2CHBD 2OT2A 4R8NA 1VQ8A 3DEOA 4ZUJA 3IKJA 2LKVA 4PMCA 5LL6X 2NN6H 4PG3A 4LFBL 2RCNA 5I9OA 1YI2A 3BVGA 4AYBE 1Q1BA 2KCMA 3KYHC 1WTOA 3KLRA 2WB1G 1XMQL 1Y69U 1G2TA 1XYIA 2PCFB 5ELDA 5EKIA 4L5SA 1R9TH 2F0PA 2TMPA 4X62Q 2CVRA 2MQHA 4OX9L 3VYRA 1L1OA 4GN3B 4ILWA 4DR2L 1YJ9A 4PV1C 1DM0B 1VS0A 2CW0C 1BBXC 2IX0A 2E2DC 2JA9A 3I4NG 4XT1B 3CF5A 5EQ0A 2HIXA 1CA5A 5FO7B 4P72A 1EY4A 4B3ML 2EY6A 3GTKH 1KNAA 2M9VA 4ODGA 3OW7A 4L5TA 5IGEA 4QMGA 2XSCA 2ZJQA 1G2SA 1L0WA 4BY7G 2Q8IB 1Z7TA 2F0UA 4YWLA 2JQOA 4YCVA 1VQJA 2A8VA 2R7ZG 1SAPA 1K8GA 2QEXA 1IBMQ 4BBRG 3K81C 1I4PA 3HZXA 3NWSA 4DAMA 1X56A 1TS5A 2N8NA 4K5WA 3FKIH 3H15A 3DWAA 1PFNA 2QDLA 4JI6L 1ONLA 2AWNA 5DAUA 3VR6A 1SE2A 4A76A 1PMRA 5M9OA 1H95A 3EJIA 3P7JA 1DGSA 5C0XI 2B2YC 2Z4HA 5JEAG 2E2IB 4ALPA 3CD6A 5FJ8G 4CKBA 2B2UC 1I4RA 1KRTA 3MXNA 5M5WH 2ICIA 3AFQA 4WFN3 1W6KA 3CCUA 3K59A 5EBCA 4X3UA 4ZQ3A 3FDTA 1FGBD 1IYJB 2EYLA 5JJIA 4XXEA 2XWJB 5CBEE 4YHHL 4PZ8A 1Q7YC 3E0JA 2C35B 4JV5L 1V1PB 4FYDA 1E24A 3H0GG 4RKBA 4GOPA 2F0QA 2UUBQ 4N8X1 1LT6D 1FVIA 3AU7A 3DWPA 1K83H 4BBRH 1NR4A 1S5ED 4JOIC 2QKIC 2KOLA 3J80c 2RBMA 4OIJA 3KF8B 1PYWD 5I6YA 1ZXTA 4EVOA 2K4KA 3PO2B 4QIWB 3S1MB 4NKLA 1AZPA 5JAVA 5IYCH 4A3DG 3L9AX 5M3FB 1PYSB 1XNRQ 4TVAB 3T1HQ 3A56A 1PTOB 4IPGA 3KJPA 2EY1A 3I90A 4JI0Q 1S72A 2VQFQ 3S17H 2JSOA 1QWYA 3NELA 5CV8A 4LF5Q 2DN8A 4K0KQ 4QGUA 5ELBA 2KVMA 2F0HA 1I4XA 2B8GA 2XWBB 3TS0A 2WB1E 5LMUL 4P74A 3CRKC 3STBD 2NN6I 1A3UA 2R92H 1JJCB 1PLFA 2D0PA 5TSSA 3HOUB 2F0OA 2JEAI 3P75A 3GTJB 1SE8A 4C3JG 3NUCA 3FEWX 4JI4Q 1CK1A 3OWEB 3NBHB 1GHJA 2K03A 2PMZE 1V9PA 1I6VC 2RDGA 2CCZA 4JVZA 1PRTF 1LLRD 3OSOA 2K33A 1I50H 3BG3A 5C3EB 3K6OA 2KECA 4L5QA 4K6LA 5HY6A 2E5LL 2JA5G 1XPUA 4A3KB 1XTDA 2H5XA 3UE1A 1SMYD 2LXJA 1JJGA 1D5ZC 2QCPX 1PH5A 2NWGA 3JAME 1N33L 4YWMA 2HQLA 1PZKD 4DV6Q 4UPAA 3C3LA 3A8KE 3CQZH 1Q8KA 1YIJA 1EIFA 1A2UA 1PTOD 4HSVA 2Q2IA 1VQKA 1MKHA 1SROA 2E2JH 1IBKQ 3SEBA 1ENCA 1PFMA 1TIID 2JYOA 2L15A 3E0EA 4JK1C 3TEHB 2RHQB 1BUVT 1EEID 3A8IE 3D4DA 1UE6A 4HJ9A 2JN4A 1BDOA 2MUYA 2PI2A 4POFA 2B63B 4FF4A 1KC8C 4RKLA 2L9HA 4ZUIA 5LHY1 1G6ZA 2B8FA 4KTAA 4PQXA 5LMNQ 3I56A 2ZM6L 4JYAQ 2K5WA 1B8AA 4DK3C 2JA5H 3J81i 3PO3B 1QUQA 1KAWA 2FHTA 3L2PA 1G6PA 3HOXG 4GNXB 4DK6C 3Q23A 3GTMH 2KENA 2VQEQ 2PYKA 1WCMB 3CCRA 3V96A 1XXGA 3J7YW 2F0GA 4NDXA 4TSSA 1QB5D 4HTHA 3JAMc 1P8LA 3GTOH 4N8FA 5C4HA 3PIP3 4U673 1SR3A 4M8AA 5EPJA 4KKTA 2CQAA 4DGZA 5LMNW 1VMCA 5HURA 2F0LA 1DOLA 2NVYB 4C3HG 3ULJA 3DWQA 4X66Q 1YHQA 2OWOA 2BA0A 2DJFC 2Y0SG 3KLSX 4HJ7A 1SEBD 4DV2L 4Y52H 2IJ0A 5HGQA 1YHAA 2ZXOA 4FP5D 1WTQA 4JI8L 4N9TA 2MP1A 3CHBD 4B3RL 2UUAL 3S16H 3F2CA 4NXNQ 3GQBA 4GN5A 4BY1G 4G57A 4DR4L 3ERSX 2OCEA 1N32Q 2ZJRA 4A3GG 2SDFA 4B3SL 1B2TA 2K14A 4J15A 1O7LA 2NBFA 4CJ1B 1QNKA 2L1BA 1STEA 1NBWA 2YYZA 3TZDA 2VUMH 4A3EH 1TS3A 3S24A 4EQOA 5K36G 2K50A 2A69D 4UP9A 1JWUD 4TKOB 5CYUA 3Q8DA 2JA7B 1SRUA 5IT9L 1QOHA 2OEOA 1ASYA 1X3EA 2EQSA 1PH8A 3K8AA 2KHSA 1NE3A 4R4OA 2MJ8A 3RD4A 3NSWA 4TRDA 2EVBA 4A3FB 1FJGL 1AN8A 5I9PA 1LUZA 5I2XA 2NVXH 2A6ED 4A3BB 1AFPA 4DV3Q 1ENFA 4O1NA 4NXML 3K7AB 5E4WC 4J1MA 2ZXRA 3VR2A 1D8LA 1F2MA 4RFBA 2LY7A 3LWUA 5M5YB 1EZ8A 2HHHQ 3GP7A 1EY0A 3Q24A 4BY1H 1CKNB 1CQFA 4HMIA 2PZUA 4QF4A 2F3IA 2KUMA 1CHQD 4QCLA 1TKWB 4X6AH 1YNNC 4WJWA 2Q2HA 1Y1VG 4OELB 3TSSA 3ITPA 4KK7A 3R2TA 5K36H 5BN4A 3QR8A 2R93H 4C3IH 1T5XD 1AP0A 3LX0A 4O42A 3H91A 3ERQA 3K7UC 1IXRA 1YNJC 4Y7NH 3HOYG 1BVSA 1LT5D 1LABA 2QGQA 4C1NK 5M5XH 4DR7L 2JA8B 1HFNA 1VQPA 5J1ZA 3T1YQ 1PFBA 1L1OC 4GLXA 4KY5A 3LNNA 3GTQB 3R93A 4DAVA 4P71A 4FNFA 2JA6H 1BCPB 1EU3A 3H3VH 3PIO3 1C4QA 1JE4A 2WV6D 4FF2A 2BH8A 4RH6A 3Q22A 4WRDA 4OO1G 2YTVA 2G9HD 1X55A 1RD9D 1L2FA 3SXHA 2K5NA 1QZHA 1E1OA 4KLKA 4X65L 2CFMA 3PGZA 1A3VA 3KLWA 4L5RC 4A3JG 1U4PA 4FO2A 3HOZG 1H9SB 4CJ2C 1K0RA 5M3MB 1E22A 1DJRD 2ALYB 4IUUA 4HEDA 1HJPA 5EBDA 4UP7A 3B6YA 5IT9E 3C1FA 3EIVA 2F0VA 4RMFA 3SHLA 1TXYA 3HOVH 1SE4A 1K73C 1HH2P 1PDQA 1MGSA 2UXBL 1ET6A 1HHVA 4C56C 4OEMB 1CQVA 5KYLA 2ZJPA 1B9NA 5CV4A 3FPPA 5IODA 3PUYA 4DN4M 5COYA 3MXPA 4X62L 1WTRA 1B9MA 1VQ5A 2IHEA 1J5EQ 3A5ZB 3OYYA 4PMWA 4KHZA 4OO1H 2EY2A 2NB0A 5IGGA 1TS2A 3S2DB 2A6HD 1KDBA 5IGCA 5C44B 1NNXA 1J9OA 5GQOA 4LUOA 4XYQA 2NVQH 4IFDJ 5IP9G 2PI2E 4LF7L 2NVTB 2I5HA 5GAHC 4C2MB 3TBIB 1EY5A 4NW2A 1I94Q 1A8VA 1BCPD 3CCLA 3TRZA 2GN5A 3PQIA 3KK7A 4ME5A 4QUCA 1YJWA 3LWEA 3SK8A 1KTKA 1V1PA 4GOPC 2MFIA 5BR8L 5F2DA 5GROA 1X9NA 4UHVA 2ZT9C 1I4GA 1M4VA 2PQAB 3KF8A 3K5OA 3NEMA 4JI5L 5DEHA 4V0BA 3CRLC 3FMCA 1N8RC 3J7A5 1EY7A 4LF8L 2AWOA 1IBLQ 4JI2L 1JWMD 4F88A 4A3MG 4PZ6A 1I3QH 4IFDH 2KA7A 1GOZA 4RGTA 4ZCKA 4QB4A 1M90C 5E7NA 1FL0A 2L5TA 1EQVA 4K8JA 3I2ZA 4QJFA 1XX8A 3MWYW 4FDBA 1WD0A 4HIOA 1Q1EA 1SYCA 4CDDC 2WACA 4DAYB 3I4MH 1FNVA 2CW0D 3TP7A 1JE5A 5IYBH 1ZYRC 4RCNA 1ZKOA 5CV7A 3QG1A 1U4MA 4LFCQ 1CHPD 1V43A 1LTGD 2VNUD 3T56B 2PZWA 4B3TQ 4ZLTF 4CGYB 4A3CG 4DUZL 3NK9A 1WD1A 3WWVA 1C9OA 2ES2A 2A1AA 3ER0A 2Z1CA 1Y1WH 4KHPQ 4JI1Q 1RL2A 1CTMA 4XQQA 2IWHA 1RDPD 4R9WA 1BKBA 1KD1C 4KD4A 1M8AA 4ZRZA 1BBUA 1HA5A 3GD7A 4F7XA 4R4IA 4XQJA 3H3VI 4A3MH 5IP7G 1VQFA 3J7ZC 3S9WA 1TWFB 1VQ9A 1IYUA 4KV6A 1W6JA 3VA7A 3MFGA 1SYGA 4AYBB 2EXZA 3RLFA 1PZJD 1VQOA 5C4XB 1PH6A 5C5LA 3VDYA 1VQHA 5JPNC 2I0QA 2V1CC 5G3LD 4KD3A 3M85A 4JI0L 2H4OA 2VQFL 1C8CA 1JT8A 4MTKA 3PO2G 4XQNA 3S1NB 1SNCA 2EJFC 1LTLA 2F4VQ 1G8ZD 1BNZA 2AQ2B 3TDQA 4WJ3M 1P16A 3UDFA 2AUKA 3IFTA 4DXGA 5GAGC 1EIYB 1HZBA 1EQRA 3T13A 1K9MC 4XYOA 2RA4A 3HKZB 2AHOB 1Q3LA 1HUNA 1HZCA 4BA1I 1TR5A 1TWCB 3D0FA 5EAYA 1Z9FA 3D6CA 4JI4L 2K7VA 1QJOA 3V05A 4JI7Q 4UP8A 3SK5A 4LF9Q 3R3OA 3G6JB 1CSQA 4IURA 4K8IA 4RAUC 1N34L 1E7ZA 2F4IA 4R4QA 3CMAA 1PRTC 4RCOA 3HOUG 3EROA 2X6LA 1PH1A 3S14H 1CZGA 3BZCA 1HNXQ 3HOWB 4DV7L 4A3IB 4OWWB 1G291 5IIFA 1ML0D 3H3VC 3A8JE 3HP3A 4DV5Q 1JQYD 1BQQT 4F8MA 2NTSA 2YU9H 3RZDB 2BH2A 1RIPA 3A55A 1J6QA 2Z6KC 4IUPA 4A93B 3RZOB 4JW0A 1EY6A 1VQ6A 5C3EG 1N9WA 1PTOH 4DV6L 1BR9A 1QCBD 2B2WA 4HCEA 4YWKA 3J81j 3ND9A 2C5CA 4JBJA 3I4NH 4A3KG 1EZ6A 3J80i 5IOCA 3NPPA 1ESRA 3N6RA 2AQ3B 3DMUA 1IKLA 1PZID 3D4WA 3IRBA 1WTXA 1HR0W 1Q81C 4IFDI 3NXWA 4LMQD 1R9TB 2D2CC 1TWAB 1EUJA 2D62A 5JEAJ 3VYSA 3ZYYX 3TREA 2AMCB 1HQMC 3HOUH 2KEEA 4BY7H 4LUZA 2HD3A 1TWGH 3HRZC 4CJ0B 2XN9C 2UXDQ 5E3FA 3GTJH 3DM1A 3NENA 5E1FA 2G5DA 5NUCA 3F8TA 5LMNL 2R7ZH 2VB2X 1STGA 3GTPH 3MVVA 2KHJA 3FRPB 2I5LX 3EA6A 2F0EA 3GTKB 2IW3A 2RVLA 4LF6Q 1VMPA 1Y8NB 1F2YA 4J6HA 2VQEL 2B63G 1VDZA 1H9RA 2B29A 2CH4A 3GDEA 1YVCA 1M1KC 1KLGD 5I4DA 4HCSA 3PF4A 1YNXA 2D9UA 3NHHA 3DM3A 1VQAA 5JEAH 3PO3G 3S2HH 1LACA 5FJ8H 3DLLA 2IX3A 1NY4A 1N36Q 4X66L 3M4QA 2N78A 1WCMG 2K5QA 4Q0FA 2OXPA 3AYHB 2MPMA 3G4SA 1AE2A 3FKIB 2UUCQ 1F9PA 4OGQC 3SK6A 4QIWE 3J7AF 4DR3Q 1UAPA 1CKNA 2UU9L 4EX5A 3PUVA 4V190 2L0CA 1XMQQ 3H0GH 4NXNL 4GLAC 4DR1Q 2PMZB 4LJZC 1N32L 2MNAA 2Z6BA 5K5PA 1E0BA 1STNA 4OX9Q 1S5FD 1K3RA 3WDNA 4EQPA 1K8AC 3AMUA 1X54A 5M5WB 1HA6A 3MA2B 3WOEA 3M9BA 4DR2Q 1EOTA 4A3DH 3NQIA 1X3GA 3CCQA 1HZ9A 4DNRB 4IZ8A 1SYFA 2L55A 2F03A 2EOTA 3F2DA 4GLVB 3KF6B 2M2LA 3X3NA 4DR5L 4BS9A 4B3MQ 1VF7A 2DNEA 2FMMA 1CM9A 2R61A 1K83B 4BBRB 5KYIA 1JR0D 4X3TA 1IW7C 2NTTA 4DXFA 3G7LA 3AEVA 1MJEA 3M3YH 2JA7G 1EFID 4ZKCB 2EJMA 1MSGA 2DGYA 5KNBA 2F0SA 3QB3A 2DUDA 1G51A 4A3FG 2HHHL 4O0AA 3NTHA 3CC2A 2B2VC 4A3BG 3BYTB 4DK0A 1Q46A 1Z6HA 4C3JH 1XPOA 2XRQD 1EOVA 1I6HH 1E2WA 1BXTA 3S17B 2E2HH 2YTYA 3NQTA 4RGMA 1CI3M 1SJHD 3OPOA 4JI6Q 1STBA 2DNCA 5CMDA 2RDHA 3JAMi 4L8JA 4AQYQ 5G3LF 1D5XC 2R3ZA 1L1OB 3L3OC 4BBSB 3E3XA 2R92B 2RF4A 2EY5A 3NTIA 1WOCA 3MXGA 1JORA 2K1BA 1HUMA 5A2QL 3U50C 3T1YL 3GTGH 3S1QH 1KRSA 4G7ZC 4JI3L 3VYUA 3M4YA 2G9DA 1HNWQ 3A54A 3K5LA 1UNSA 1ASZA 4K2LA 2NZ1D 2P5ZX 2EYJA 4JV5Q 1CFMA 4IUVA 3RN2A 1ILPA 2ZTEA 2UXCL 1A0IA 1C0AA 1LM0A 3W1GA 2R6GA 4PZ7A 4BXXG 1TS4A 5IYDG 2I5MX 1BO0A 1LTSD 4B9WA 3KFUA 3UDXA 2GVBA 1NTGA 2I46A 1DZ1A 4HSPA 2B2TA 1Y8PB 1X3PA 2IHFA 2DY7A 3P20A 3I8ZA 3TS2A 4DPGA 1JMCA 3BDCA 1EY8A 1T9HA 2PQAA 5EJWA 1YNND 3D8GA 4X3SA 3CQZB 3S15B 1PHJA 3OTOQ 2VL6A 4X3KA 4IO9A 1KXLA 3SVMA 1QZGA 5CGKA 5M3MG 1YNJD 3VYTA 5C4JB 1GD7A 1YZ6A 1JB7A 2HCIA 3HEJA 3J7AV 3S1RH 2IY5B 1O7YA 2B2UA 3MXNB 5LMUQ 4CKEA 3HOXH 1B53A 1VQIA 3PUXA 5JJLA 1KABA 2F52A 4IJHA 4NB3A 1HNZQ 4H02A 1VQCA 1J5EL 2ASBA 1UEAB 5C5MA 1SFOH 1TQOA 4A75A 3ULPA 2BDNA 4BA2I 4LF4Q 4DFAA 2RDFA 1JCKB 5IYDH 1STYA 4C3HH 4GOPB 4Z9CB 1BF4A 2VZAA 3U4VA 1D2BA 2JA5B 2WAQB 2A5HA 3M4PA 1VQ7A 5IWAQ 4I7AA 4PMBA 3G6EA 1EQQA 3GTMB 2HDMA 1HPCA 2E75C 3U9SA 4IN3A 1KDCA 2EXDA 1F9QA 1ZEQX 1Q86C 2NYZD 3GTOB 2VS1A 1EEFD 1TT2A 1FNWA 1NCVA 2E5LQ 1CZWA 1B3AA 2F1MA 1X3FA 4A3GH 1V8QA 3F2BA 5T1IA 3F1ZA 1MJCA 1SNDA 2YV5A 2HUGA 1MD2D 1LTID 1R4PB 3CCMA 2A68C 2E8GA 2BDOA 1GXDC 4R1JA 3EQLC 1VQLA 4DV4L 3A7AB 5IE8A 4X64L 4RGOS 3S16B 1S4ZA 2WKDA 4FVMA 3PV0A 2OTJA 3K5NA 4AH6A 1DD2A 4IPCA 1FNUA 1PH7A 1TVXA 1ICFB 2X6GA 4B3TL 2VUMB 1IZ6A 4A3EB 2EYPA 1S40A 1IHZA 2TSSA 1TY0A 4K5VA 4DKAC 3UDIA 3BS1A 2ZM6Q 2EIFA 4JI1L 2RSNA 2GA4B 4E6IA 3IL8A 2PZTA 4QQBX 2NVXB 2SOBA 1O80A 3NWTA 1C7YA 1Y1VH 4GKJQ 4Q5VA 5AJ3Q 2RSOA 4P73A 1NMFA 2F0NA 3NBIA 4JC0A 2L4NA 2Y0SE 2A74C 3H6MA 3HOYH 1EL0A 1ICWA 4BWGB 4ULLA 1GJXA 1STHA 1WFQA 1DOKA 1OXUA 2BE5C 2XRSD 2FINB 4G7OC 3E9IA 1NUCA 3RN5A 5KGUA 2Z4IA 4DV2Q 2Z0SA 3M4OH 3AQQA 2F4VL 1PTOF 1NR2A 4AYBG 1ZYRD 3UE0A 4RA8A 5KRUA 1PH9A 5CC4A 5KNDA 4OIKA 5C4XG 1SNQA 2K05A 2UUAQ 1VQNA 1MSHA 1SXTA 4C3IB 2R93B 3E6ZX 1CA6A 3CC4A 4Y7NB 4DR4Q 1GUNA 5C0XG 1OXSC 5FLXL 3FP9A 5M5XB 1S5BD 4B3SQ 1PRTB 3GTLH 1WTWA 1JB3A 1NAPA 3TP6A 1GVPA 4A3JH 3BJUA 3KOJA 3I55A 3HOZH 3HG9A 2AQ1B 2IT1A 4LF9L 4MTNA 3PCOB 2C9OA 3W5OA 2JA6B 1A3TA 1Q90A 3HKZG 2XNAC 4RHSA 5IT9c 1SN8A 3R2IA 4U68A 1B44D 5EPKA 1DOMA 1TWHH 1F9SA 4YY3Q 1F2ZA 1HNXL 2WIIB 1EYCA 3E9HA 3DXJC 1KLUD 5ELCA 3TQYA 4XTCS 3I4LA 3LGJA 1IBML 4GKKQ 2RKSA 4DV5L 1XMOQ 4LUVA 4KHVA 1K8MA 1RTNA 2JK8A 2QF7A 4CBVA 2OQKA 4HIDA 3NP8A 1PH2A 3HOWG 4NPSA 3MAQA 2OF1A 5ELNA 4A3IG 3C46A 3HOVB 1O7ZA 2B39A 2K5VA 4YIJA 2LS01 2BA1A 2IPKD 5IP9H 1KAAA 1RTOA 2XTIA 1DONA 4DV0Q 4DA2A 4A93G 1PYBA 1G91A 4MZ9A 1QE6A 4B9XA 5CR3A 2NN6G 1VQDA 1KDAA 5D14A 4IOCA 3QOLA 1TWCH 4L63B 5DLQE 1PRTD 3MZ5A 3BVMA 1S3OA 3NTKA 2SNMA 5FKAC 2UUBL 3NBHA 4IUQA 3G71A 3J80L 2NVQB 1GKHA 3QIAA 2Q8TA 3TMEA 1VCIA 4ME3A 3U4ZA 4LF6L 1Q8IA 4DV1Q 2PW7A 2AKWB 3QJYA 3KF6A 2KCNA 4DF7A 4DK1A 1DXMA 5FLXE 1Q82C 1LTRD 1XNRL 1CKMA 2CWAA 3T1HL 1RKNA 4KY6A 1E1TA 4JPBW 1IL2A 2IL8A 4OHJA 2MO0A 4JBMA 4LF5L 1H9JA 3SDZA 4K0KL 1RCVD 2WINB 1R4QB 1AW7A 1IL8A 1FYCA 4A3CH 1F77A 1X3QA 2UUCL 4UAIA 5M3FG 1EIHA 3KBGA 4YCUA 1E2ZA 3CPWA 1I3QB 3RNUA 3ULLA 4DR3L 4DR6Q 5DM63 3VR3A 2UXBQ 2E2IH 4UDUC 2I07B 5BN5A 4FXGC 4WJ4A 2SEBD 3RLOA 1SLJA 3I3CA 3FHWA 4DR1L 3I4OA 3OIQA 4RHRA 3I4MB 5ELFA 3CC7A 2JEBI 3SR1A 1TWAH 3FKIG 4CDCC 3KDFB 3GV3A 4I65A 5IP7H 3Q6SA 1UE7A 3MHBA 2K52A 1U0LA 5H1SE 1QVGA 4OO1I 1S5DD 1KNEA 1U4LA 1HTLD 2KCCA 1SSOA 5FLXc 1Y1WB 2PNRC 3RUZA 4LF7Q 3HKZE 1U9RA 3OMCA 4GNXA 3W3AA 5KEEA 1KL9A 4R8IA 3VR5A 3PO2H 3S1MH 5CV9A 4HR7B 4LFAQ 1SNMA 1SDFA 3K57A 1PH3A 1HR0Q 1W3SA 2RHSB 2YTXA 4A3MB 2V4DA 1MIUA 4G4KA 5BR8Q 5M3FH 2QILA 2F0DA 5EKLA 2NZHA 4IJLA 4JCVE 2E76C 4JI5Q 3J80E 4FXDA 1VF5C 3EVQA 1HQRD 2B2TC 2EYMA 1IBKL 4ZKBB 4LF8Q 2K75A 4H7BA 1WTVA 4JI2Q 5IGFA 2K5HA 1V1OA 1B7YB 5JOBA 2EYOA 1A62A 2Q8RE 5IYCG 2K04A 3A0JA 4TQUS 1GUSA 4LWCA 4AQYL 3DHQA 1NSNS 5JJKA 1EY9A 3CU7A 2BCOA 1EIGA 3CCSA 3K0XA 1GUWA 4XT3B 2N88A 1UE1A 3OW2A 4K2KA 4KN4C 2JXMB 2HDLA 3CCVA 5C3WA 4JYAL 1B1ZA 1LO5D 4MNOA 4R4TA 2J7ZA 2MGSA 4DUZQ 3CMEA 3Q0AA 1XNQQ 1B70B 1L0YB 4DUYQ 4BBSG 3IFDA 3SK4A 1HNWL 2AUJD 2R92G 1XPRA 5C3EH 1C48A 3K0YA 2ZXPA 1YHBA 5AFWA 1IW7D 4LW1A 1WJJA 3JAML 4KMUC 3S14B 3I7FA 3KJOA 1RF2D 4HJ8A 5KNCA 1BCPF 1J8IA 4F87A 4A3KH 3MXUA 3TN2A 3A74A 4OWXB 2WB1B 1Y8OB 2K28A 1SNPA 2KJXA 3J81L 3I72A 2YU9B 1FR3A
chains in the Genus database with same CATH topology
5HGTA 2NUCA 1Z47A 3QOJA 4K6DA 5EKKA 1SYDA 2N55A 2QEJC 2J4XA 1ET9A 3I4NB 3M7GA 2PW5A 3TZUA 1IKMA 4LK1C 3D3RA 1STAA 2F0KA 4I7ZC 2EPBA 3L7ZC 4BY7B 1TWGB 1A15A 3URYA 1D6EC 2FJ2A 4CHTB 1II3A 3WOFA 3C2PA 1D5MC 2R7ZB 3GTPB 5FK9C 3C1EA 4ID6A 1SYBA 3K58A 3I91A 3PMFA 1DCZA 1GUOA 1ILQA 1BOSA 5IGBA 4KY7A 3K5MA 2K6AA 1RHPA 1O78A 1H9SA 4P2CB 3BZDB 3S2HB 1ESFA 2O4XA 3MEHA 2O5JC 3OOCA 1JOKA 1XTCD 1ENAA 1A6XA 1H9MA 2SNSA 2XIWA 2EDGA 1A2TA 5J39A 2O5IC 2WKCA 2LFNA 4HAEA 1JOQA 4MHEA 3J81E 3H0GB 5DNFA 3OMGA 3MFYA 3OHXC 1HCZA 1EWCA 2D5DA 4IQZA 4EQNA 3U9OA 4NP5A 4A3DB 1D1IA 4DNTB 2VXWA 3ND8A 2RQXA 1I50B 1MI2A 1EQTA 4FF1A 2LMCB 5CBAE 3M7NA 1SE3A 2F0JA 3T16A 4KKUA 3SE0A 1B4OA 1LT3D 5FOBB 1FD7D 1GHKA 4FXKC 3BYYB 3M3YB 5EPLA 1I4HA 4H13C 4IALA 2A68D 4LAAA 5ISRA 1SMYC 1RJTA 4G7HC 1B50A 1SYEA 2E2JB 4KKSA 2B2YA 1XWEA 4RWSC 4C3JB 2XVSA 4K14A 1PTOC 1I6HB 4C1NI 2E2HB 1TU2B 1F9RA 2EYFA 1E2VA 4DAYA 3R8BA 3V2TA 3VR4A 1LTAD 1EYAA 2ICEC 5E4XA 1HRJA 1OXVA 2PO4A 3QO2A 3GTGB 3S1QB 2QDBA 3BDOA 4EGVA 4C3IG 3KUPA 5D3DA 1QG7A 2L12A 2ID0A 2F3WA 1D1KA 4JBWA 5A2QE 1S5CD 2MHVA 2X69A 2JE6I 1GUTA 4KJOA 3KBXA 2PPBC 5FO9B 1GUGA 3BVZA 4XDXA 2K01A 2BE5D 1MBYA 2K5DA 4HMJA 3BDLA 3X3MA 3CKIB 3A7LA 1OO9B 2J0TD 5FO8B 1AZQA 5EGTA 3FPUB 5D65A 4KI0A 5LL6S 3UI2A 2L11A 2WP8J 3T4AC 2A73B 1IYVA 3MC0B 3S1RB 1WVLA 3HOXB 5J22A 3TP8A 2O2LD 5BN3A 3H94A 1LT4D 2F3VA 2KQ3A 3OWFA 1SFOB 3O13A 4GZYC 2A69C 4C3HB 3E5SA 4MN3A 5D3IB 5DM73 2Y0SB 1T5EA 1JC7A 1AEXA 3D31A 4NMZA 1DYQA 2M00A 5ELEA 1X32A 2F0FA 2KEDA 5CV5A 2PQEA 3FVQA 4IUNA 4L6TB 5T1GA 1CT1D 2A6EC 1F2LA 2EJGC 1QNUA 3F2UA 3KLSA 3T53B 4RGNA 4BY1B 4WORA 1OXTA 2B2VA 2FFKB 4M1UB 4A3GB 1QILA 2B2WC 3I70A 3IAYA 3ONAB 2F0WA 3DEPA 1EWHA 3W2DA 4H44C 4DU9A 2VB3X 2EE1A 4FF3A 1Q12A 2F0TA 4IUTA 1UUPA 2FMCA 1LTTD 2HCCA 4IFDG 5C0XJ 2EZVA 2K32A 4B08A 1HFGA 5CORA 1I4QA 4XIGS 3PUZA 4DAPA 1RODA 5CV6A 4H0LC 3AB9A 3MTSA 4KN7C 3I73A 5C6AA 2EYHA 3NE5B 3RMHA 3DUZA 1PXUA 1HXYD 1EU4A 3N52A 2BOSA 4OL7A 4CKCA 4KJNA 2F0IA 1Y1VB 3T51B 4ZYSA 3GO5A 4ZAIA 5I2YA 2HQEA 4HN7A 1JICA 2JP1A 5C3XA 1WTPA 3HOYB 2IX1A 4N9PA 5C0XH 5JPMC 1H9KA 1LTBD 1U4RA 3GV6A 5A35A 1HTPA 3M4OB 2H1EA 3D6WA 5JJZA 3P1HA 4ZK9B 2F0MA 4J8QA 2E74C 1SNOA 3QWNA 5KIXA 3VA5A 5C4ZA 5JVG3 2DY8A 3HGBA 4ABNA 1OXXK 3HS0C 3GTLB 3PUWA 2Z8LA 1JWSD 3EFXD 3D4RA 4A3JB 3OIPA 3HOZB 3H09A 5I6WA 3TP5A 1EYDA 1SBBB 2A6HC 4PNYA 1SJED 1L0XB 1JOOA 1LV9A 4MIUA 4QUFA 1TWHB 1BCPC 2ENBA 4K5XA 5JVH3 5IGDA 1TY2A 4S3SA 1K8OA 2CHBD 2OT2A 4R8NA 3DEOA 4ZUJA 3IKJA 2LKVA 4PMCA 5LL6X 2NN6H 5I9OA 3BVGA 1Q1BA 1WTOA 3KLRA 1Y69U 1G2TA 1XYIA 2PCFB 5ELDA 5EKIA 2F0PA 2TMPA 2CVRA 3VYRA 4ILWA 4PV1C 1DM0B 2CW0C 1BBXC 2IX0A 2E2DC 4XT1B 5EQ0A 1CA5A 5FO7B 1EY4A 2EY6A 1KNAA 2M9VA 4ODGA 3OW7A 5IGEA 4QMGA 2XSCA 1G2SA 2Q8IB 1Z7TA 2F0UA 1SAPA 1I4PA 3HZXA 3NWSA 1TS5A 4K5WA 3DWAA 1PFNA 1ONLA 2AWNA 5DAUA 3VR6A 1SE2A 1PMRA 5M9OA 3EJIA 3P7JA 5C0XI 2B2YC 2Z4HA 5JEAG 2E2IB 4CKBA 2B2UC 1I4RA 3MXNA 2ICIA 4WFN3 1W6KA 3K59A 5EBCA 4X3UA 4ZQ3A 3FDTA 1FGBD 2EYLA 4XXEA 2XWJB 5CBEE 3E0JA 1V1PB 4FYDA 4RKBA 2F0QA 1LT6D 3AU7A 3DWPA 1NR4A 1S5ED 2QKIC 2KOLA 2RBMA 4OIJA 1PYWD 5I6YA 1ZXTA 4EVOA 3PO2B 4QIWB 3S1MB 4NKLA 1AZPA 5JAVA 3L9AX 5M3FB 3A56A 1PTOB 2EY1A 3I90A 2JSOA 1QWYA 5CV8A 2DN8A 5ELBA 2KVMA 2F0HA 1I4XA 2B8GA 2XWBB 3CRKC 2NN6I 1A3UA 1PLFA 5TSSA 3HOUB 2F0OA 2JEAI 3P75A 3GTJB 4C3JG 3NUCA 3FEWX 1CK1A 3OWEB 1GHJA 2K03A 1I6VC 2RDGA 1PRTF 1LLRD 3OSOA 2K33A 3BG3A 5C3EB 3K6OA 2KECA 4K6LA 4A3KB 1SMYD 1D5ZC 2QCPX 2NWGA 3JAME 1PZKD 3C3LA 3A8KE 1PTOD 1A2UA 4HSVA 3SEBA 1ENCA 1PFMA 1TIID 2JYOA 4JK1C 1BUVT 1EEID 3A8IE 3D4DA 1BDOA 2MUYA 2B63B 4FF4A 4RKLA 2L9HA 4ZUIA 5LHY1 1G6ZA 2B8FA 4KTAA 4PQXA 2K5WA 3PO3B 2FHTA 3Q23A 2PYKA 1WCMB 3V96A 1XXGA 3J7YW 2F0GA 4NDXA 4TSSA 1QB5D 4HTHA 5C4HA 3PIP3 4U673 4M8AA 5EPJA 4KKTA 2CQAA 4DGZA 1VMCA 5HURA 2F0LA 1DOLA 2NVYB 4C3HG 3DWQA 2BA0A 3KLSX 1SEBD 2IJ0A 2ZXOA 4FP5D 1WTQA 4N9TA 2MP1A 3CHBD 3GQBA 4G57A 2SDFA 1B2TA 1O7LA 2NBFA 4CJ1B 1QNKA 2L1BA 1STEA 2YYZA 3TZDA 1TS3A 4EQOA 5K36G 2A69D 1JWUD 4TKOB 5CYUA 2JA7B 5IT9L 1QOHA 2OEOA 2KHSA 2MJ8A 3RD4A 3NSWA 4TRDA 2EVBA 4A3FB 1AN8A 5I9PA 5I2XA 2A6ED 4A3BB 1AFPA 1ENFA 4O1NA 3K7AB 5E4WC 4J1MA 2ZXRA 3VR2A 1F2MA 4RFBA 2LY7A 3LWUA 5M5YB 1EZ8A 3GP7A 1EY0A 3Q24A 1CQFA 4HMIA 2PZUA 4QF4A 2KUMA 1CHQD 4QCLA 1TKWB 1YNNC 4WJWA 3TSSA 3ITPA 4KK7A 3R2TA 5K36H 5BN4A 1T5XD 1AP0A 3LX0A 4O42A 3H91A 3ERQA 1YNJC 1LT5D 1LABA 4C1NK 2JA8B 1HFNA 5J1ZA 1PFBA 4KY5A 3LNNA 3GTQB 3R93A 4DAVA 4FNFA 1BCPB 1EU3A 3PIO3 1C4QA 1JE4A 2WV6D 4FF2A 4RH6A 3Q22A 4WRDA 4OO1G 2G9HD 1RD9D 3SXHA 1A3VA 1U4PA 4FO2A 1H9SB 4CJ2C 5M3MB 1DJRD 4IUUA 4HEDA 5EBDA 5IT9E 3C1FA 2F0VA 3SHLA 1SE4A 1PDQA 1MGSA 1HHVA 1ET6A 4C56C 1CQVA 5KYLA 1B9NA 5CV4A 3FPPA 5IODA 3PUYA 4DN4M 5COYA 3MXPA 1WTRA 1B9MA 4PMWA 4KHZA 4OO1H 2EY2A 2NB0A 5IGGA 1TS2A 3S2DB 2A6HD 1KDBA 5IGCA 5C44B 1J9OA 4XYQA 4IFDJ 2NVTB 4C2MB 3TBIB 1EY5A 4NW2A 1BCPD 3KK7A 4ME5A 4QUCA 3LWEA 3SK8A 1KTKA 1V1PA 5F2DA 2ZT9C 1I4GA 1M4VA 3KF8A 3K5OA 5DEHA 4V0BA 3CRLC 3FMCA 1EY7A 2AWOA 1JWMD 4F88A 4IFDH 2KA7A 1GOZA 4RGTA 4QB4A 2L5TA 1EQVA 4K8JA 1XX8A 3MWYW 1WD0A 1Q1EA 1SYCA 2WACA 1FNVA 2CW0D 3TP7A 1ZYRC 4RCNA 1ZKOA 5CV7A 3QG1A 1U4MA 1CHPD 1V43A 1LTGD 2VNUD 3T56B 2PZWA 4ZLTF 4CGYB 3NK9A 1WD1A 2Z1CA 1CTMA 4XQQA 2IWHA 1RDPD 4R9WA 4KD4A 1M8AA 4ZRZA 1HA5A 3GD7A 4F7XA 4XQJA 3S9WA 1TWFB 1IYUA 4KV6A 1W6JA 3VA7A 3MFGA 1SYGA 4AYBB 2EXZA 3RLFA 1PZJD 5C4XB 5C5LA 5JPNC 5G3LD 4KD3A 3M85A 2H4OA 1C8CA 4XQNA 3S1NB 1SNCA 2EJFC 1G8ZD 1BNZA 2AQ2B 3TDQA 2AUKA 3IFTA 4DXGA 3T13A 4XYOA 2RA4A 3HKZB 1Q3LA 1HUNA 4BA1I 1TR5A 1TWCB 3D6CA 2K7VA 1QJOA 3V05A 3SK5A 3R3OA 3G6JB 4IURA 4K8IA 4RAUC 2F4IA 1PRTC 4RCOA 3EROA 2X6LA 1CZGA 3HOWB 4A3IB 1G291 5IIFA 1ML0D 3H3VC 3A8JE 3HP3A 1JQYD 1BQQT 4F8MA 2NTSA 3RZDB 3A55A 4IUPA 4A93B 3RZOB 1EY6A 1PTOH 1BR9A 1QCBD 2B2WA 4HCEA 3ND9A 2C5CA 1EZ6A 5IOCA 3NPPA 1ESRA 3N6RA 2AQ3B 3DMUA 1IKLA 1PZID 3D4WA 1WTXA 4IFDI 3NXWA 4LMQD 1R9TB 2D2CC 1TWAB 2D62A 5JEAJ 3VYSA 3ZYYX 1HQMC 2KEEA 3HRZC 4CJ0B 2XN9C 5E3FA 3DM1A 5E1FA 5NUCA 2VB2X 1STGA 3MVVA 3FRPB 3EA6A 2F0EA 3GTKB 2IW3A 2RVLA 1VMPA 1Y8NB 1F2YA 4J6HA 1VDZA 1H9RA 1KLGD 5I4DA 4HCSA 2D9UA 3NHHA 5JEAH 1LACA 2IX3A 2K5QA 4Q0FA 2OXPA 2MPMA 3FKIB 1F9PA 4OGQC 3SK6A 3J7AF 1UAPA 3PUVA 4V190 2L0CA 2PMZB 4LJZC 5K5PA 1E0BA 1STNA 1S5FD 1HA6A 3WDNA 4EQPA 3AMUA 5M5WB 3MA2B 3WOEA 1EOTA 3NQIA 4DNRB 4IZ8A 1SYFA 2L55A 2F03A 2EOTA 2M2LA 3X3NA 4BS9A 1VF7A 2DNEA 2FMMA 1CM9A 2R61A 1K83B 4BBRB 5KYIA 1JR0D 4X3TA 1IW7C 2NTTA 4DXFA 3G7LA 1EFID 4ZKCB 2EJMA 1MSGA 5KNBA 2F0SA 3QB3A 3NTHA 2B2VC 3BYTB 4DK0A 1Z6HA 2XRQD 1E2WA 1BXTA 3S17B 3NQTA 4RGMA 1CI3M 1SJHD 3OPOA 1STBA 2DNCA 5CMDA 2RDHA 4L8JA 5G3LF 1D5XC 2R3ZA 3L3OC 4BBSB 2R92B 2EY5A 3NTIA 3MXGA 1JORA 2K1BA 1HUMA 5A2QL 4G7ZC 3VYUA 3M4YA 2G9DA 3A54A 3K5LA 1UNSA 4K2LA 2NZ1D 2EYJA 1CFMA 4IUVA 1ILPA 2R6GA 1TS4A 1BO0A 1LTSD 4B9WA 2I46A 1DZ1A 4HSPA 2B2TA 1Y8PB 1X3PA 2DY7A 3P20A 3I8ZA 3BDCA 1EY8A 5EJWA 1YNND 3D8GA 4X3SA 3CQZB 3S15B 4X3KA 3SVMA 5CGKA 1YNJD 3VYTA 5C4JB 2HCIA 3HEJA 3J7AV 1O7YA 2B2UA 4CKEA 1B53A 3PUXA 1KABA 1UEAB 5C5MA 1TQOA 2BDNA 4BA2I 4DFAA 2RDFA 1JCKB 1STYA 4Z9CB 1BF4A 1D2BA 2JA5B 2WAQB 2A5HA 4PMBA 3GTMB 2HDMA 1HPCA 2E75C 3U9SA 4IN3A 1KDCA 1F9QA 1ZEQX 2NYZD 3GTOB 1EEFD 1TT2A 1FNWA 1NCVA 1CZWA 1B3AA 2F1MA 1V8QA 5T1IA 1SNDA 2HUGA 1MD2D 1LTID 1R4PB 2A68C 2BDOA 1GXDC 3EQLC 3A7AB 4RGOS 3S16B 1S4ZA 2WKDA 4FVMA 3PV0A 3K5NA 1DD2A 1FNUA 1TVXA 2X6GA 2VUMB 4A3EB 2EYPA 1IHZA 2TSSA 1TY0A 4K5VA 3BS1A 2RSNA 2GA4B 4E6IA 3IL8A 2PZTA 2NVXB 2SOBA 1O80A 3NWTA 4Q5VA 2RSOA 2F0NA 3NBIA 2L4NA 2A74C 3H6MA 1EL0A 1ICWA 4BWGB 4ULLA 1GJXA 1STHA 1DOKA 1OXUA 2BE5C 2XRSD 2FINB 4G7OC 1NUCA 5KGUA 2Z4IA 1PTOF 1NR2A 1ZYRD 4RA8A 5KRUA 5CC4A 5KNDA 4OIKA 1SNQA 2K05A 1MSHA 1SXTA 4C3IB 2R93B 3E6ZX 1CA6A 4Y7NB 1GUNA 5C0XG 1OXSC 5FLXL 5M5XB 1S5BD 1PRTB 1WTWA 1JB3A 1NAPA 3TP6A 3HG9A 2AQ1B 2IT1A 2C9OA 2JA6B 1A3TA 1Q90A 4RHSA 2XNAC 3R2IA 4U68A 1B44D 5EPKA 1DOMA 1F9SA 1F2ZA 2WIIB 1EYCA 3DXJC 1KLUD 5ELCA 4XTCS 3I4LA 2RKSA 4KHVA 1K8MA 1RTNA 2QF7A 4CBVA 3NP8A 3MAQA 2OF1A 3C46A 3HOVB 1O7ZA 2B39A 4YIJA 2LS01 2BA1A 2IPKD 1KAAA 1RTOA 1DONA 4DA2A 1G91A 1QE6A 4B9XA 5CR3A 2NN6G 1KDAA 5D14A 3QOLA 4L63B 1PRTD 3MZ5A 3BVMA 3NTKA 2SNMA 5FKAC 3NBHA 4IUQA 3J80L 2NVQB 3QIAA 2Q8TA 3TMEA 1VCIA 1Q8IA 2PW7A 3QJYA 2KCNA 4DF7A 4DK1A 1DXMA 5FLXE 1LTRD 1RKNA 4KY6A 2IL8A 4OHJA 1H9JA 3SDZA 1RCVD 2WINB 1R4QB 1AW7A 1IL8A 1FYCA 1F77A 1X3QA 4UAIA 1EIHA 3KBGA 1E2ZA 1I3QB 5DM63 3VR3A 4UDUC 2I07B 5BN5A 4FXGC 2SEBD 3I3CA 3OIQA 4RHRA 3I4MB 5ELFA 2JEBI 3SR1A 3GV3A 4I65A 3Q6SA 3MHBA 4OO1I 1S5DD 1KNEA 1U4LA 1HTLD 2KCCA 1SSOA 1Y1WB 2PNRC 3RUZA 1U9RA 3OMCA 3W3AA 5KEEA 4R8IA 3VR5A 5CV9A 4HR7B 1SNMA 1SDFA 3K57A 4A3MB 2V4DA 4G4KA 2QILA 2F0DA 5EKLA 2E76C 3J80E 4FXDA 1VF5C 3EVQA 1HQRD 2B2TC 2EYMA 4ZKBB 4H7BA 1WTVA 5IGFA 1V1OA 5JOBA 2EYOA 2Q8RE 2K04A 4TQUS 1GUSA 3DHQA 1NSNS 1EY9A 3CU7A 2BCOA 1EIGA 1GUWA 4XT3B 2N88A 4K2KA 4KN4C 2JXMB 2HDLA 5C3WA 1B1ZA 1LO5D 2J7ZA 2MGSA 3Q0AA 1L0YB 3IFDA 3SK4A 2AUJD 1C48A 3K0YA 2ZXPA 5AFWA 1IW7D 3JAML 4KMUC 3S14B 1RF2D 5KNCA 1BCPF 1J8IA 4F87A 3MXUA 3TN2A 2WB1B 1Y8OB 2K28A 1SNPA 2KJXA 3J81L 3I72A 2YU9B 1FR3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C4Q A;  2BOS A;  1C48 A;  1DM0 B;  1D1I A;  1CZG A;  1QOH A;  1D1K A;  1BOS A;  4ULL A;  1QNU A;  2C5C A;  3MXG A;  1CQF A;  1CZW A;  4P2C B;  2GA4 B;  4M1U B;  1R4P B;  1R4Q B;  2XSC A; 
#chains in the Genus database with same CATH topology
 2N3S A;  5J3B A;  5HGT A;  2NUC A;  1Z47 A;  4LFB Q;  3QOJ A;  3EBE A;  2PNH A;  3CP0 A;  4K6D A;  5EKK A;  1SYD A;  2N55 A;  2QEJ C;  3PIP A;  3OTO L;  2Q2U A;  2J4X A;  1ET9 A;  3I4N B;  3M7G A;  1CUK A;  1VQG A;  4GN4 B;  2PW5 A;  3TZU A;  1IKM A;  4LK1 C;  3D3R A;  4BBS H;  1YIT A;  1STA A;  2F0K A;  2B63 H;  2ZTD A;  2WFW A;  2KBN A;  2FXQ A;  4I7Z C;  2EPB A;  1HNZ L;  1PH4 A;  2OTL A;  3L7Z C;  4BY7 B;  1TWG B;  1A15 A;  3URY A;  1D6E C;  2FJ2 A;  4LF4 L;  3PO3 H;  4CHT B;  1II3 A;  3WOF A;  1W2B A;  1O7I A;  3C2P A;  1D5M C;  2R7Z B;  1AH9 A;  4RG1 A;  3GTP B;  1WCM H;  5FK9 C;  4GS3 A;  4DV3 L;  3C1E A;  1N34 Q;  2HT1 A;  5IWA L;  4ID6 A;  5GAE C;  1SYB A;  4HJ5 A;  3K58 A;  3I91 A;  1UEB A;  3A5U A;  3PMF A;  3UDG A;  1YJN A;  2KCT A;  1DCZ A;  1GUO A;  1ILQ A;  4DV7 Q;  1BOS A;  2NVY H;  5IGB A;  4KY7 A;  3K5M A;  2K6A A;  1RHP A;  1O78 A;  2KHI A;  1WYD A;  1H9S A;  1KHI A;  2WAQ G;  4P2C B;  3BZD B;  4A4I A;  1ESF A;  3S2H B;  4HIM A;  2O4X A;  3MEH A;  2O5J C;  3OOC A;  1EWI A;  3HFZ B;  1JOK A;  1XTC D;  1K28 A;  1ENA A;  4OON A;  1A6X A;  1H9M A;  1GO3 E;  2LSS A;  2SNS A;  2XIW A;  3S15 H;  2EDG A;  1A2T A;  5J39 A;  2O5I C;  2WKC A;  2LFN A;  4HAE A;  5C4J H;  1JOQ A;  4MHE A;  3J81 E;  3H0G B;  1PFS A;  5DNF A;  3OMG A;  3STB C;  3MFY A;  4APV A;  3ICE A;  2LXK A;  3OHX C;  1HCZ A;  1EWC A;  2D5D A;  4IQZ A;  4YHH Q;  2JA7 H;  4EQN A;  3PF5 A;  3U9O A;  4NP5 A;  4DNI A;  4A3D B;  1D1I A;  3RR5 A;  4DNT B;  3U58 A;  2VXW A;  3ND8 A;  2RQX A;  2JA8 G;  4A3F H;  1I50 B;  4HIK A;  1MI2 A;  1EQT A;  4FF1 A;  2LMC B;  5CBA E;  3M7N A;  4A3B H;  1SE3 A;  2F0J A;  1OTC A;  3T16 A;  3BZK A;  3K7A H;  4KKU A;  2VUM G;  4A3E G;  3SE0 A;  1B4O A;  1LT3 D;  1PV4 A;  5FOB B;  4GKJ L;  1FD7 D;  2GVA A;  5AJ3 L;  5M5Y H;  3PIO A;  4FXK C;  1GHK A;  3BYY B;  2Z6K A;  3M3Y B;  5EPL A;  3MEF A;  1I4H A;  1D7Q A;  4H13 C;  2CWP A;  4IAL A;  2A68 D;  4LAA A;  5ISR A;  1SMY C;  2MO1 A;  1KQS A;  1RJT A;  4G7H C;  1B50 A;  1SYE A;  2E2J B;  4KKS A;  2B2Y A;  1XWE A;  3J81 c;  4O2D A;  4RWS C;  4C3J B;  2XVS A;  4K14 A;  4R4C A;  2Q2T A;  1PTO C;  1I6H B;  4C1N I;  2VW9 A;  2Z9H A;  2E2H B;  1TU2 B;  1F9R A;  2EYF A;  2UU9 Q;  4QL5 A;  1E2V A;  2JA8 H;  4DAY A;  3CCJ A;  3SGI A;  5ELO A;  3R8B A;  1KIX A;  4IPH A;  4BXX H;  3V2T A;  3VR4 A;  1LTA D;  1EYA A;  3GTQ H;  1MHW C;  2ICE C;  1NMG A;  5E4X A;  2A19 A;  1OXV A;  1UWV A;  2PO4 A;  1HRJ A;  3QO2 A;  4IPD A;  3GTG B;  4JOI A;  1I94 L;  3S1Q B;  2QDB A;  3BDO A;  3W1B A;  4EGV A;  2R93 G;  4C3I G;  3KUP A;  2CKZ B;  4IOA A;  5D3D A;  1QG7 A;  2L12 A;  2RCF A;  2ID0 A;  2F3W A;  1D1K A;  4JBW A;  4YY3 L;  5A2Q E;  5C44 G;  1S5C D;  4DR5 Q;  2MHV A;  1HZA A;  2X69 A;  1JJ2 A;  3CAM A;  2JE6 I;  1GUT A;  4KJO A;  5M3M H;  1K0S A;  3KBX A;  3AFP A;  5FO9 B;  2PPB C;  1GUG A;  3BVZ A;  3EN2 A;  4XDX A;  4GKK L;  1XMO L;  2K01 A;  2BE5 D;  2D0O A;  2JA6 G;  1MBY A;  1IBL L;  3CCE A;  2K5D A;  1N33 Q;  4HMJ A;  3BDL A;  2WAQ E;  3X3M A;  3CKI B;  4HJA A;  2XGT A;  3A7L A;  1OO9 B;  2J0T D;  5FO8 B;  1AZQ A;  1AE3 A;  5EGT A;  3FPU B;  5D65 A;  4KI0 A;  2DJG C;  5LL6 S;  3UI2 A;  4JBK A;  2L11 A;  2WP8 J;  4DV0 L;  3T4A C;  4LFC L;  3BU2 A;  2A73 B;  1IYV A;  3MC0 B;  3S1R B;  1WVL A;  5GAD C;  3HOX B;  1YBY A;  2JJQ A;  5J22 A;  3HOV G;  3TP8 A;  1QVF A;  1EFW A;  2O2L D;  3S2D H;  2VY3 A;  5BN3 A;  1NJI C;  5C44 H;  4KHP L;  3H94 A;  1LT4 D;  2F3V A;  2NVT H;  3OWF A;  2KQ3 A;  1WTH A;  1SFO B;  4C2M H;  2OQ0 A;  3KDF A;  3O13 A;  1SMX A;  4GZY C;  2A69 C;  4C3H B;  3K80 C;  4JI3 Q;  3E5S A;  4MN3 A;  5D3I B;  5DM7 3;  4JG2 A;  2Y0S B;  1T5E A;  1FGU A;  4CDE C;  1JC7 A;  1AEX A;  4DV1 L;  3D31 A;  4NMZ A;  1DYQ A;  2M00 A;  5ELE A;  1X32 A;  2F0F A;  3ZJY C;  2UXC Q;  2KED A;  5CV5 A;  2PQE A;  3FVQ A;  4IUN A;  4L6T B;  5T1G A;  4GNX C;  1CT1 D;  2A6E C;  1F2L A;  2EJG C;  1QNU A;  3F2U A;  3KLS A;  3RLN A;  3T53 B;  4RGN A;  2R7D A;  4BY1 B;  4WOR A;  1OXT A;  4P75 A;  2CH4 W;  2B2V A;  2FFK B;  4M1U B;  4A3G B;  2NZO A;  4LNQ A;  1LYL A;  1QIL A;  4POG A;  2B2W C;  2B3G A;  3I70 A;  3IAY A;  4JI8 Q;  2N49 A;  3ONA B;  2F0W A;  1X65 A;  3DEP A;  4B3R Q;  1EWH A;  3W2D A;  4H44 C;  4DR6 L;  2HIV A;  4DU9 A;  2VB3 X;  5L37 A;  1I5F A;  1B3Q A;  2EE1 A;  4FF3 A;  1Q12 A;  2F0T A;  4IUT A;  5FLM G;  1UUP A;  3PSI A;  2FMC A;  1LTT D;  2HCC A;  4OWT B;  4JI7 L;  1QUQ B;  4IFD G;  5C0X J;  2EZV A;  2K32 A;  4B08 A;  1HFG A;  1I4Q A;  4XIG S;  5COR A;  3PUZ A;  1CKO A;  3HKS A;  4DAP A;  1ROD A;  5CV6 A;  1UE5 A;  4EQ5 A;  4UY8 C;  4H0L C;  3AB9 A;  1U5K A;  3I4M G;  3MTS A;  4KN7 C;  3I73 A;  5C6A A;  3JC6 6;  1FJG Q;  3CPF A;  2EYH A;  1VQ4 A;  5IYB G;  2QW7 A;  3NE5 B;  3RMH A;  3DUZ A;  1PXU A;  4QY7 A;  1HXY D;  3CW2 C;  4NXM Q;  1TWF H;  4LFA L;  1EU4 A;  1HR0 L;  3N52 A;  4CDF C;  1VQB A;  1K3B C;  2BOS A;  1E3P A;  4OL7 A;  4CKC A;  4KJN A;  2F0I A;  1Y1V B;  4YCW A;  3T51 B;  4ZYS A;  3GO5 A;  5C4X H;  4ZAI A;  3CXC A;  5I2Y A;  1Y1W G;  2HQE A;  4HN7 A;  1JIC A;  2JP1 A;  5C3X A;  4A3L G;  1WTP A;  3L0O A;  3HOY B;  2IX1 A;  4N9P A;  5C0X H;  2ZTC A;  1Y14 B;  5JPM C;  3S1N H;  5FLM H;  1VQM A;  1H9K A;  1LTB D;  2QA4 A;  1GM5 A;  1U4R A;  1WI5 A;  3GV6 A;  5A35 A;  1HTP A;  3M4O B;  2H1E A;  3D6W A;  1EYG A;  5JJZ A;  3P1H A;  4DV4 Q;  4ZK9 B;  1VQE A;  2F0M A;  4J8Q A;  2E74 C;  1SNO A;  3QWN A;  5KIX A;  4X64 Q;  3VA5 A;  1V1Q A;  5C4Z A;  2UXD L;  5JVG 3;  4DR7 Q;  2DY8 A;  3HGB A;  4ABN A;  1OXX K;  3HS0 C;  3GTL B;  3PUW A;  2Z8L A;  1JWS D;  3EFX D;  3D4R A;  4A3J B;  1QVC A;  2ATW A;  3OIP A;  3HOZ B;  3H09 A;  5I6W A;  1XNQ L;  4DUY L;  3TP5 A;  4OXP A;  1EYD A;  1SBB B;  2A6H C;  4PNY A;  1CSP A;  3HOW H;  1SJE D;  1L0X B;  1JOO A;  1LV9 A;  4A3I H;  1XJV A;  4MIU A;  4A3L H;  3G48 A;  4QUF A;  2CQO A;  1PVO A;  1TWH B;  1BCP C;  2ENB A;  2R7F A;  4K5X A;  4X65 Q;  5JVH 3;  1A63 A;  1PA6 A;  1X6O A;  5IGD A;  5IY0 A;  3RZD H;  1N36 L;  1TY2 A;  4S3S A;  4A93 H;  3RZO H;  1YEZ A;  1K8O A;  4AIM A;  1BBW A;  2CHB D;  2OT2 A;  4R8N A;  1VQ8 A;  3DEO A;  4ZUJ A;  3IKJ A;  2LKV A;  4PMC A;  5LL6 X;  2NN6 H;  4PG3 A;  4LFB L;  2RCN A;  5I9O A;  1YI2 A;  3BVG A;  4AYB E;  1Q1B A;  2KCM A;  3KYH C;  1WTO A;  3KLR A;  2WB1 G;  1XMQ L;  1Y69 U;  1G2T A;  1XYI A;  2PCF B;  5ELD A;  5EKI A;  4L5S A;  1R9T H;  2F0P A;  2TMP A;  4X62 Q;  2CVR A;  2MQH A;  4OX9 L;  3VYR A;  1L1O A;  4GN3 B;  4ILW A;  4DR2 L;  1YJ9 A;  4PV1 C;  1DM0 B;  1VS0 A;  2CW0 C;  1BBX C;  2IX0 A;  2E2D C;  2JA9 A;  3I4N G;  4XT1 B;  3CF5 A;  5EQ0 A;  2HIX A;  1CA5 A;  5FO7 B;  4P72 A;  1EY4 A;  4B3M L;  2EY6 A;  3GTK H;  1KNA A;  2M9V A;  4ODG A;  3OW7 A;  4L5T A;  5IGE A;  4QMG A;  2XSC A;  2ZJQ A;  1G2S A;  1L0W A;  4BY7 G;  2Q8I B;  1Z7T A;  2F0U A;  4YWL A;  2JQO A;  4YCV A;  1VQJ A;  2A8V A;  2R7Z G;  1SAP A;  1K8G A;  2QEX A;  1IBM Q;  4BBR G;  3K81 C;  1I4P A;  3HZX A;  3NWS A;  4DAM A;  1X56 A;  1TS5 A;  2N8N A;  4K5W A;  3FKI H;  3H15 A;  3DWA A;  1PFN A;  2QDL A;  4JI6 L;  1ONL A;  2AWN A;  5DAU A;  3VR6 A;  1SE2 A;  4A76 A;  1PMR A;  5M9O A;  1H95 A;  3EJI A;  3P7J A;  1DGS A;  5C0X I;  2B2Y C;  2Z4H A;  5JEA G;  2E2I B;  4ALP A;  3CD6 A;  5FJ8 G;  4CKB A;  2B2U C;  1I4R A;  1KRT A;  3MXN A;  5M5W H;  2ICI A;  3AFQ A;  4WFN 3;  1W6K A;  3CCU A;  3K59 A;  5EBC A;  4X3U A;  4ZQ3 A;  3FDT A;  1FGB D;  1IYJ B;  2EYL A;  5JJI A;  4XXE A;  2XWJ B;  5CBE E;  4YHH L;  4PZ8 A;  1Q7Y C;  3E0J A;  2C35 B;  4JV5 L;  1V1P B;  4FYD A;  1E24 A;  3H0G G;  4RKB A;  4GOP A;  2F0Q A;  2UUB Q;  4N8X 1;  1LT6 D;  1FVI A;  3AU7 A;  3DWP A;  1K83 H;  4BBR H;  1NR4 A;  1S5E D;  4JOI C;  2QKI C;  2KOL A;  3J80 c;  2RBM A;  4OIJ A;  3KF8 B;  1PYW D;  5I6Y A;  1ZXT A;  4EVO A;  2K4K A;  3PO2 B;  4QIW B;  3S1M B;  4NKL A;  1AZP A;  5JAV A;  5IYC H;  4A3D G;  3L9A X;  5M3F B;  1PYS B;  1XNR Q;  4TVA B;  3T1H Q;  3A56 A;  1PTO B;  4IPG A;  3KJP A;  2EY1 A;  3I90 A;  4JI0 Q;  1S72 A;  2VQF Q;  3S17 H;  2JSO A;  1QWY A;  3NEL A;  5CV8 A;  4LF5 Q;  2DN8 A;  4K0K Q;  4QGU A;  5ELB A;  2KVM A;  2F0H A;  1I4X A;  2B8G A;  2XWB B;  3TS0 A;  2WB1 E;  5LMU L;  4P74 A;  3CRK C;  3STB D;  2NN6 I;  1A3U A;  2R92 H;  1JJC B;  1PLF A;  2D0P A;  5TSS A;  3HOU B;  2F0O A;  2JEA I;  3P75 A;  3GTJ B;  1SE8 A;  4C3J G;  3NUC A;  3FEW X;  4JI4 Q;  1CK1 A;  3OWE B;  3NBH B;  1GHJ A;  2K03 A;  2PMZ E;  1V9P A;  1I6V C;  2RDG A;  2CCZ A;  4JVZ A;  1PRT F;  1LLR D;  3OSO A;  2K33 A;  1I50 H;  3BG3 A;  5C3E B;  3K6O A;  2KEC A;  4L5Q A;  4K6L A;  5HY6 A;  2E5L L;  2JA5 G;  1XPU A;  4A3K B;  1XTD A;  2H5X A;  3UE1 A;  1SMY D;  2LXJ A;  1JJG A;  1D5Z C;  2QCP X;  1PH5 A;  2NWG A;  3JAM E;  1N33 L;  4YWM A;  2HQL A;  1PZK D;  4DV6 Q;  4UPA A;  3C3L A;  3A8K E;  3CQZ H;  1Q8K A;  1YIJ A;  1EIF A;  1A2U A;  1PTO D;  4HSV A;  2Q2I A;  1VQK A;  1MKH A;  1SRO A;  2E2J H;  1IBK Q;  3SEB A;  1ENC A;  1PFM A;  1TII D;  2JYO A;  2L15 A;  3E0E A;  4JK1 C;  3TEH B;  2RHQ B;  1BUV T;  1EEI D;  3A8I E;  3D4D A;  1UE6 A;  4HJ9 A;  2JN4 A;  1BDO A;  2MUY A;  2PI2 A;  4POF A;  2B63 B;  4FF4 A;  1KC8 C;  4RKL A;  2L9H A;  4ZUI A;  5LHY 1;  1G6Z A;  2B8F A;  4KTA A;  4PQX A;  5LMN Q;  3I56 A;  2ZM6 L;  4JYA Q;  2K5W A;  1B8A A;  4DK3 C;  2JA5 H;  3J81 i;  3PO3 B;  1QUQ A;  1KAW A;  2FHT A;  3L2P A;  1G6P A;  3HOX G;  4GNX B;  4DK6 C;  3Q23 A;  3GTM H;  2KEN A;  2VQE Q;  2PYK A;  1WCM B;  3CCR A;  3V96 A;  1XXG A;  3J7Y W;  2F0G A;  4NDX A;  4TSS A;  1QB5 D;  4HTH A;  3JAM c;  1P8L A;  3GTO H;  4N8F A;  5C4H A;  3PIP 3;  4U67 3;  1SR3 A;  4M8A A;  5EPJ A;  4KKT A;  2CQA A;  4DGZ A;  5LMN W;  1VMC A;  5HUR A;  2F0L A;  1DOL A;  2NVY B;  4C3H G;  3ULJ A;  3DWQ A;  4X66 Q;  1YHQ A;  2OWO A;  2BA0 A;  2DJF C;  2Y0S G;  3KLS X;  4HJ7 A;  1SEB D;  4DV2 L;  4Y52 H;  2IJ0 A;  5HGQ A;  1YHA A;  2ZXO A;  4FP5 D;  1WTQ A;  4JI8 L;  4N9T A;  2MP1 A;  3CHB D;  4B3R L;  2UUA L;  3S16 H;  3F2C A;  4NXN Q;  3GQB A;  4GN5 A;  4BY1 G;  4G57 A;  4DR4 L;  3ERS X;  2OCE A;  1N32 Q;  2ZJR A;  4A3G G;  2SDF A;  4B3S L;  1B2T A;  2K14 A;  4J15 A;  1O7L A;  2NBF A;  4CJ1 B;  1QNK A;  2L1B A;  1STE A;  1NBW A;  2YYZ A;  3TZD A;  2VUM H;  4A3E H;  1TS3 A;  3S24 A;  4EQO A;  5K36 G;  2K50 A;  2A69 D;  4UP9 A;  1JWU D;  4TKO B;  5CYU A;  3Q8D A;  2JA7 B;  1SRU A;  5IT9 L;  1QOH A;  2OEO A;  1ASY A;  1X3E A;  2EQS A;  1PH8 A;  3K8A A;  2KHS A;  1NE3 A;  4R4O A;  2MJ8 A;  3RD4 A;  3NSW A;  4TRD A;  2EVB A;  4A3F B;  1FJG L;  1AN8 A;  5I9P A;  1LUZ A;  5I2X A;  2NVX H;  2A6E D;  4A3B B;  1AFP A;  4DV3 Q;  1ENF A;  4O1N A;  4NXM L;  3K7A B;  5E4W C;  4J1M A;  2ZXR A;  3VR2 A;  1D8L A;  1F2M A;  4RFB A;  2LY7 A;  3LWU A;  5M5Y B;  1EZ8 A;  2HHH Q;  3GP7 A;  1EY0 A;  3Q24 A;  4BY1 H;  1CKN B;  1CQF A;  4HMI A;  2PZU A;  4QF4 A;  2F3I A;  2KUM A;  1CHQ D;  4QCL A;  1TKW B;  4X6A H;  1YNN C;  4WJW A;  2Q2H A;  1Y1V G;  4OEL B;  3TSS A;  3ITP A;  4KK7 A;  3R2T A;  5K36 H;  5BN4 A;  3QR8 A;  2R93 H;  4C3I H;  1T5X D;  1AP0 A;  3LX0 A;  4O42 A;  3H91 A;  3ERQ A;  3K7U C;  1IXR A;  1YNJ C;  4Y7N H;  3HOY G;  1BVS A;  1LT5 D;  1LAB A;  2QGQ A;  4C1N K;  5M5X H;  4DR7 L;  2JA8 B;  1HFN A;  1VQP A;  5J1Z A;  3T1Y Q;  1PFB A;  1L1O C;  4GLX A;  4KY5 A;  3LNN A;  3GTQ B;  3R93 A;  4DAV A;  4P71 A;  4FNF A;  2JA6 H;  1BCP B;  1EU3 A;  3H3V H;  3PIO 3;  1C4Q A;  1JE4 A;  2WV6 D;  4FF2 A;  2BH8 A;  4RH6 A;  3Q22 A;  4WRD A;  4OO1 G;  2YTV A;  2G9H D;  1X55 A;  1RD9 D;  1L2F A;  3SXH A;  2K5N A;  1QZH A;  1E1O A;  4KLK A;  4X65 L;  2CFM A;  3PGZ A;  1A3V A;  3KLW A;  4L5R C;  4A3J G;  1U4P A;  4FO2 A;  3HOZ G;  1H9S B;  4CJ2 C;  1K0R A;  5M3M B;  1E22 A;  1DJR D;  2ALY B;  4IUU A;  4HED A;  1HJP A;  5EBD A;  4UP7 A;  3B6Y A;  5IT9 E;  3C1F A;  3EIV A;  2F0V A;  4RMF A;  3SHL A;  1TXY A;  3HOV H;  1SE4 A;  1K73 C;  1HH2 P;  1PDQ A;  1MGS A;  2UXB L;  1ET6 A;  1HHV A;  4C56 C;  4OEM B;  1CQV A;  5KYL A;  2ZJP A;  1B9N A;  5CV4 A;  3FPP A;  5IOD A;  3PUY A;  4DN4 M;  5COY A;  3MXP A;  4X62 L;  1WTR A;  1B9M A;  1VQ5 A;  2IHE A;  1J5E Q;  3A5Z B;  3OYY A;  4PMW A;  4KHZ A;  4OO1 H;  2EY2 A;  2NB0 A;  5IGG A;  1TS2 A;  3S2D B;  2A6H D;  1KDB A;  5IGC A;  5C44 B;  1NNX A;  1J9O A;  5GQO A;  4LUO A;  4XYQ A;  2NVQ H;  4IFD J;  5IP9 G;  2PI2 E;  4LF7 L;  2NVT B;  2I5H A;  5GAH C;  4C2M B;  3TBI B;  1EY5 A;  4NW2 A;  1I94 Q;  1A8V A;  1BCP D;  3CCL A;  3TRZ A;  2GN5 A;  3PQI A;  3KK7 A;  4ME5 A;  4QUC A;  1YJW A;  3LWE A;  3SK8 A;  1KTK A;  1V1P A;  4GOP C;  2MFI A;  5BR8 L;  5F2D A;  5GRO A;  1X9N A;  4UHV A;  2ZT9 C;  1I4G A;  1M4V A;  2PQA B;  3KF8 A;  3K5O A;  3NEM A;  4JI5 L;  5DEH A;  4V0B A;  3CRL C;  3FMC A;  1N8R C;  3J7A 5;  1EY7 A;  4LF8 L;  2AWO A;  1IBL Q;  4JI2 L;  1JWM D;  4F88 A;  4A3M G;  4PZ6 A;  1I3Q H;  4IFD H;  2KA7 A;  1GOZ A;  4RGT A;  4ZCK A;  4QB4 A;  1M90 C;  5E7N A;  1FL0 A;  2L5T A;  1EQV A;  4K8J A;  3I2Z A;  4QJF A;  1XX8 A;  3MWY W;  4FDB A;  1WD0 A;  4HIO A;  1Q1E A;  1SYC A;  4CDD C;  2WAC A;  4DAY B;  3I4M H;  1FNV A;  2CW0 D;  3TP7 A;  1JE5 A;  5IYB H;  1ZYR C;  4RCN A;  1ZKO A;  5CV7 A;  3QG1 A;  1U4M A;  4LFC Q;  1CHP D;  1V43 A;  1LTG D;  2VNU D;  3T56 B;  2PZW A;  4B3T Q;  4ZLT F;  4CGY B;  4A3C G;  4DUZ L;  3NK9 A;  1WD1 A;  3WWV A;  1C9O A;  2ES2 A;  2A1A A;  3ER0 A;  2Z1C A;  1Y1W H;  4KHP Q;  4JI1 Q;  1RL2 A;  1CTM A;  4XQQ A;  2IWH A;  1RDP D;  4R9W A;  1BKB A;  1KD1 C;  4KD4 A;  1M8A A;  4ZRZ A;  1BBU A;  1HA5 A;  3GD7 A;  4F7X A;  4R4I A;  4XQJ A;  3H3V I;  4A3M H;  5IP7 G;  1VQF A;  3J7Z C;  3S9W A;  1TWF B;  1VQ9 A;  1IYU A;  4KV6 A;  1W6J A;  3VA7 A;  3MFG A;  1SYG A;  4AYB B;  2EXZ A;  3RLF A;  1PZJ D;  1VQO A;  5C4X B;  1PH6 A;  5C5L A;  3VDY A;  1VQH A;  5JPN C;  2I0Q A;  2V1C C;  5G3L D;  4KD3 A;  3M85 A;  4JI0 L;  2H4O A;  2VQF L;  1C8C A;  1JT8 A;  4MTK A;  3PO2 G;  4XQN A;  3S1N B;  1SNC A;  2EJF C;  1LTL A;  2F4V Q;  1G8Z D;  1BNZ A;  2AQ2 B;  3TDQ A;  4WJ3 M;  1P16 A;  3UDF A;  2AUK A;  3IFT A;  4DXG A;  5GAG C;  1EIY B;  1HZB A;  1EQR A;  3T13 A;  1K9M C;  4XYO A;  2RA4 A;  3HKZ B;  2AHO B;  1Q3L A;  1HUN A;  1HZC A;  4BA1 I;  1TR5 A;  1TWC B;  3D0F A;  5EAY A;  1Z9F A;  3D6C A;  4JI4 L;  2K7V A;  1QJO A;  3V05 A;  4JI7 Q;  4UP8 A;  3SK5 A;  4LF9 Q;  3R3O A;  3G6J B;  1CSQ A;  4IUR A;  4K8I A;  4RAU C;  1N34 L;  1E7Z A;  2F4I A;  4R4Q A;  3CMA A;  1PRT C;  4RCO A;  3HOU G;  3ERO A;  2X6L A;  1PH1 A;  3S14 H;  1CZG A;  3BZC A;  1HNX Q;  3HOW B;  4DV7 L;  4A3I B;  4OWW B;  1G29 1;  5IIF A;  1ML0 D;  3H3V C;  3A8J E;  3HP3 A;  4DV5 Q;  1JQY D;  1BQQ T;  4F8M A;  2NTS A;  2YU9 H;  3RZD B;  2BH2 A;  1RIP A;  3A55 A;  1J6Q A;  2Z6K C;  4IUP A;  4A93 B;  3RZO B;  4JW0 A;  1EY6 A;  1VQ6 A;  5C3E G;  1N9W A;  1PTO H;  4DV6 L;  1BR9 A;  1QCB D;  2B2W A;  4HCE A;  4YWK A;  3J81 j;  3ND9 A;  2C5C A;  4JBJ A;  3I4N H;  4A3K G;  1EZ6 A;  3J80 i;  5IOC A;  3NPP A;  1ESR A;  3N6R A;  2AQ3 B;  3DMU A;  1IKL A;  1PZI D;  3D4W A;  3IRB A;  1WTX A;  1HR0 W;  1Q81 C;  4IFD I;  3NXW A;  4LMQ D;  1R9T B;  2D2C C;  1TWA B;  1EUJ A;  2D62 A;  5JEA J;  3VYS A;  3ZYY X;  3TRE A;  2AMC B;  1HQM C;  3HOU H;  2KEE A;  4BY7 H;  4LUZ A;  2HD3 A;  1TWG H;  3HRZ C;  4CJ0 B;  2XN9 C;  2UXD Q;  5E3F A;  3GTJ H;  3DM1 A;  3NEN A;  5E1F A;  2G5D A;  5NUC A;  3F8T A;  5LMN L;  2R7Z H;  2VB2 X;  1STG A;  3GTP H;  3MVV A;  2KHJ A;  3FRP B;  2I5L X;  3EA6 A;  2F0E A;  3GTK B;  2IW3 A;  2RVL A;  4LF6 Q;  1VMP A;  1Y8N B;  1F2Y A;  4J6H A;  2VQE L;  2B63 G;  1VDZ A;  1H9R A;  2B29 A;  2CH4 A;  3GDE A;  1YVC A;  1M1K C;  1KLG D;  5I4D A;  4HCS A;  3PF4 A;  1YNX A;  2D9U A;  3NHH A;  3DM3 A;  1VQA A;  5JEA H;  3PO3 G;  3S2H H;  1LAC A;  5FJ8 H;  3DLL A;  2IX3 A;  1NY4 A;  1N36 Q;  4X66 L;  3M4Q A;  2N78 A;  1WCM G;  2K5Q A;  4Q0F A;  2OXP A;  3AYH B;  2MPM A;  3G4S A;  1AE2 A;  3FKI B;  2UUC Q;  1F9P A;  4OGQ C;  3SK6 A;  4QIW E;  3J7A F;  4DR3 Q;  1UAP A;  1CKN A;  2UU9 L;  4EX5 A;  3PUV A;  4V19 0;  2L0C A;  1XMQ Q;  3H0G H;  4NXN L;  4GLA C;  4DR1 Q;  2PMZ B;  4LJZ C;  1N32 L;  2MNA A;  2Z6B A;  5K5P A;  1E0B A;  1STN A;  4OX9 Q;  1S5F D;  1K3R A;  3WDN A;  4EQP A;  1K8A C;  3AMU A;  1X54 A;  5M5W B;  1HA6 A;  3MA2 B;  3WOE A;  3M9B A;  4DR2 Q;  1EOT A;  4A3D H;  3NQI A;  1X3G A;  3CCQ A;  1HZ9 A;  4DNR B;  4IZ8 A;  1SYF A;  2L55 A;  2F03 A;  2EOT A;  3F2D A;  4GLV B;  3KF6 B;  2M2L A;  3X3N A;  4DR5 L;  4BS9 A;  4B3M Q;  1VF7 A;  2DNE A;  2FMM A;  1CM9 A;  2R61 A;  1K83 B;  4BBR B;  5KYI A;  1JR0 D;  4X3T A;  1IW7 C;  2NTT A;  4DXF A;  3G7L A;  3AEV A;  1MJE A;  3M3Y H;  2JA7 G;  1EFI D;  4ZKC B;  2EJM A;  1MSG A;  2DGY A;  5KNB A;  2F0S A;  3QB3 A;  2DUD A;  1G51 A;  4A3F G;  2HHH L;  4O0A A;  3NTH A;  3CC2 A;  2B2V C;  4A3B G;  3BYT B;  4DK0 A;  1Q46 A;  1Z6H A;  4C3J H;  1XPO A;  2XRQ D;  1EOV A;  1I6H H;  1E2W A;  1BXT A;  3S17 B;  2E2H H;  2YTY A;  3NQT A;  4RGM A;  1CI3 M;  1SJH D;  3OPO A;  4JI6 Q;  1STB A;  2DNC A;  5CMD A;  2RDH A;  3JAM i;  4L8J A;  4AQY Q;  5G3L F;  1D5X C;  2R3Z A;  1L1O B;  3L3O C;  4BBS B;  3E3X A;  2R92 B;  2RF4 A;  2EY5 A;  3NTI A;  1WOC A;  3MXG A;  1JOR A;  2K1B A;  1HUM A;  5A2Q L;  3U50 C;  3T1Y L;  3GTG H;  3S1Q H;  1KRS A;  4G7Z C;  4JI3 L;  3VYU A;  3M4Y A;  2G9D A;  1HNW Q;  3A54 A;  3K5L A;  1UNS A;  1ASZ A;  4K2L A;  2NZ1 D;  2P5Z X;  2EYJ A;  4JV5 Q;  1CFM A;  4IUV A;  3RN2 A;  1ILP A;  2ZTE A;  2UXC L;  1A0I A;  1C0A A;  1LM0 A;  3W1G A;  2R6G A;  4PZ7 A;  4BXX G;  1TS4 A;  5IYD G;  2I5M X;  1BO0 A;  1LTS D;  4B9W A;  3KFU A;  3UDX A;  2GVB A;  1NTG A;  2I46 A;  1DZ1 A;  4HSP A;  2B2T A;  1Y8P B;  1X3P A;  2IHF A;  2DY7 A;  3P20 A;  3I8Z A;  3TS2 A;  4DPG A;  1JMC A;  3BDC A;  1EY8 A;  1T9H A;  2PQA A;  5EJW A;  1YNN D;  3D8G A;  4X3S A;  3CQZ B;  3S15 B;  1PHJ A;  3OTO Q;  2VL6 A;  4X3K A;  4IO9 A;  1KXL A;  3SVM A;  1QZG A;  5CGK A;  5M3M G;  1YNJ D;  3VYT A;  5C4J B;  1GD7 A;  1YZ6 A;  1JB7 A;  2HCI A;  3HEJ A;  3J7A V;  3S1R H;  2IY5 B;  1O7Y A;  2B2U A;  3MXN B;  5LMU Q;  4CKE A;  3HOX H;  1B53 A;  1VQI A;  3PUX A;  5JJL A;  1KAB A;  2F52 A;  4IJH A;  4NB3 A;  1HNZ Q;  4H02 A;  1VQC A;  1J5E L;  2ASB A;  1UEA B;  5C5M A;  1SFO H;  1TQO A;  4A75 A;  3ULP A;  2BDN A;  4BA2 I;  4LF4 Q;  4DFA A;  2RDF A;  1JCK B;  5IYD H;  1STY A;  4C3H H;  4GOP B;  4Z9C B;  1BF4 A;  2VZA A;  3U4V A;  1D2B A;  2JA5 B;  2WAQ B;  2A5H A;  3M4P A;  1VQ7 A;  5IWA Q;  4I7A A;  4PMB A;  3G6E A;  1EQQ A;  3GTM B;  2HDM A;  1HPC A;  2E75 C;  3U9S A;  4IN3 A;  1KDC A;  2EXD A;  1F9Q A;  1ZEQ X;  1Q86 C;  2NYZ D;  3GTO B;  2VS1 A;  1EEF D;  1TT2 A;  1FNW A;  1NCV A;  2E5L Q;  1CZW A;  1B3A A;  2F1M A;  1X3F A;  4A3G H;  1V8Q A;  3F2B A;  5T1I A;  3F1Z A;  1MJC A;  1SND A;  2YV5 A;  2HUG A;  1MD2 D;  1LTI D;  1R4P B;  3CCM A;  2A68 C;  2E8G A;  2BDO A;  1GXD C;  4R1J A;  3EQL C;  1VQL A;  4DV4 L;  3A7A B;  5IE8 A;  4X64 L;  4RGO S;  3S16 B;  1S4Z A;  2WKD A;  4FVM A;  3PV0 A;  2OTJ A;  3K5N A;  4AH6 A;  1DD2 A;  4IPC A;  1FNU A;  1PH7 A;  1TVX A;  1ICF B;  2X6G A;  4B3T L;  2VUM B;  1IZ6 A;  4A3E B;  2EYP A;  1S40 A;  1IHZ A;  2TSS A;  1TY0 A;  4K5V A;  4DKA C;  3UDI A;  3BS1 A;  2ZM6 Q;  2EIF A;  4JI1 L;  2RSN A;  2GA4 B;  4E6I A;  3IL8 A;  2PZT A;  4QQB X;  2NVX B;  2SOB A;  1O80 A;  3NWT A;  1C7Y A;  1Y1V H;  4GKJ Q;  4Q5V A;  5AJ3 Q;  2RSO A;  4P73 A;  1NMF A;  2F0N A;  3NBI A;  4JC0 A;  2L4N A;  2Y0S E;  2A74 C;  3H6M A;  3HOY H;  1EL0 A;  1ICW A;  4BWG B;  4ULL A;  1GJX A;  1STH A;  1WFQ A;  1DOK A;  1OXU A;  2BE5 C;  2XRS D;  2FIN B;  4G7O C;  3E9I A;  1NUC A;  3RN5 A;  5KGU A;  2Z4I A;  4DV2 Q;  2Z0S A;  3M4O H;  3AQQ A;  2F4V L;  1PTO F;  1NR2 A;  4AYB G;  1ZYR D;  3UE0 A;  4RA8 A;  5KRU A;  1PH9 A;  5CC4 A;  5KND A;  4OIK A;  5C4X G;  1SNQ A;  2K05 A;  2UUA Q;  1VQN A;  1MSH A;  1SXT A;  4C3I B;  2R93 B;  3E6Z X;  1CA6 A;  3CC4 A;  4Y7N B;  4DR4 Q;  1GUN A;  5C0X G;  1OXS C;  5FLX L;  3FP9 A;  5M5X B;  1S5B D;  4B3S Q;  1PRT B;  3GTL H;  1WTW A;  1JB3 A;  1NAP A;  3TP6 A;  1GVP A;  4A3J H;  3BJU A;  3KOJ A;  3I55 A;  3HOZ H;  3HG9 A;  2AQ1 B;  2IT1 A;  4LF9 L;  4MTN A;  3PCO B;  2C9O A;  3W5O A;  2JA6 B;  1A3T A;  1Q90 A;  3HKZ G;  2XNA C;  4RHS A;  5IT9 c;  1SN8 A;  3R2I A;  4U68 A;  1B44 D;  5EPK A;  1DOM A;  1TWH H;  1F9S A;  4YY3 Q;  1F2Z A;  1HNX L;  2WII B;  1EYC A;  3E9H A;  3DXJ C;  1KLU D;  5ELC A;  3TQY A;  4XTC S;  3I4L A;  3LGJ A;  1IBM L;  4GKK Q;  2RKS A;  4DV5 L;  1XMO Q;  4LUV A;  4KHV A;  1K8M A;  1RTN A;  2JK8 A;  2QF7 A;  4CBV A;  2OQK A;  4HID A;  3NP8 A;  1PH2 A;  3HOW G;  4NPS A;  3MAQ A;  2OF1 A;  5ELN A;  4A3I G;  3C46 A;  3HOV B;  1O7Z A;  2B39 A;  2K5V A;  4YIJ A;  2LS0 1;  2BA1 A;  2IPK D;  5IP9 H;  1KAA A;  1RTO A;  2XTI A;  1DON A;  4DV0 Q;  4DA2 A;  4A93 G;  1PYB A;  1G91 A;  4MZ9 A;  1QE6 A;  4B9X A;  5CR3 A;  2NN6 G;  1VQD A;  1KDA A;  5D14 A;  4IOC A;  3QOL A;  1TWC H;  4L63 B;  5DLQ E;  1PRT D;  3MZ5 A;  3BVM A;  1S3O A;  3NTK A;  2SNM A;  5FKA C;  2UUB L;  3NBH A;  4IUQ A;  3G71 A;  3J80 L;  2NVQ B;  1GKH A;  3QIA A;  2Q8T A;  3TME A;  1VCI A;  4ME3 A;  3U4Z A;  4LF6 L;  1Q8I A;  4DV1 Q;  2PW7 A;  2AKW B;  3QJY A;  3KF6 A;  2KCN A;  4DF7 A;  4DK1 A;  1DXM A;  5FLX E;  1Q82 C;  1LTR D;  1XNR L;  1CKM A;  2CWA A;  3T1H L;  1RKN A;  4KY6 A;  1E1T A;  4JPB W;  1IL2 A;  2IL8 A;  4OHJ A;  2MO0 A;  4JBM A;  4LF5 L;  1H9J A;  3SDZ A;  4K0K L;  1RCV D;  2WIN B;  1R4Q B;  1AW7 A;  1IL8 A;  1FYC A;  4A3C H;  1F77 A;  1X3Q A;  2UUC L;  4UAI A;  5M3F G;  1EIH A;  3KBG A;  4YCU A;  1E2Z A;  3CPW A;  1I3Q B;  3RNU A;  3ULL A;  4DR3 L;  4DR6 Q;  5DM6 3;  3VR3 A;  2UXB Q;  2E2I H;  4UDU C;  2I07 B;  5BN5 A;  4FXG C;  4WJ4 A;  2SEB D;  3RLO A;  1SLJ A;  3I3C A;  3FHW A;  4DR1 L;  3I4O A;  3OIQ A;  4RHR A;  3I4M B;  5ELF A;  3CC7 A;  2JEB I;  3SR1 A;  1TWA H;  3FKI G;  4CDC C;  3KDF B;  3GV3 A;  4I65 A;  5IP7 H;  3Q6S A;  1UE7 A;  3MHB A;  2K52 A;  1U0L A;  5H1S E;  1QVG A;  4OO1 I;  1S5D D;  1KNE A;  1U4L A;  1HTL D;  2KCC A;  1SSO A;  5FLX c;  1Y1W B;  2PNR C;  3RUZ A;  4LF7 Q;  3HKZ E;  1U9R A;  3OMC A;  4GNX A;  3W3A A;  5KEE A;  1KL9 A;  4R8I A;  3VR5 A;  3PO2 H;  3S1M H;  5CV9 A;  4HR7 B;  4LFA Q;  1SNM A;  1SDF A;  3K57 A;  1PH3 A;  1HR0 Q;  1W3S A;  2RHS B;  2YTX A;  4A3M B;  2V4D A;  1MIU A;  4G4K A;  5BR8 Q;  5M3F H;  2QIL A;  2F0D A;  5EKL A;  2NZH A;  4IJL A;  4JCV E;  2E76 C;  4JI5 Q;  3J80 E;  4FXD A;  1VF5 C;  3EVQ A;  1HQR D;  2B2T C;  2EYM A;  1IBK L;  4ZKB B;  4LF8 Q;  2K75 A;  4H7B A;  1WTV A;  4JI2 Q;  5IGF A;  2K5H A;  1V1O A;  1B7Y B;  5JOB A;  2EYO A;  1A62 A;  2Q8R E;  5IYC G;  2K04 A;  3A0J A;  4TQU S;  1GUS A;  4LWC A;  4AQY L;  3DHQ A;  1NSN S;  5JJK A;  1EY9 A;  3CU7 A;  2BCO A;  1EIG A;  3CCS A;  3K0X A;  1GUW A;  4XT3 B;  2N88 A;  1UE1 A;  3OW2 A;  4K2K A;  4KN4 C;  2JXM B;  2HDL A;  3CCV A;  5C3W A;  4JYA L;  1B1Z A;  1LO5 D;  4MNO A;  4R4T A;  2J7Z A;  2MGS A;  4DUZ Q;  3CME A;  3Q0A A;  1XNQ Q;  1B70 B;  1L0Y B;  4DUY Q;  4BBS G;  3IFD A;  3SK4 A;  1HNW L;  2AUJ D;  2R92 G;  1XPR A;  5C3E H;  1C48 A;  3K0Y A;  2ZXP A;  1YHB A;  5AFW A;  1IW7 D;  4LW1 A;  1WJJ A;  3JAM L;  4KMU C;  3S14 B;  3I7F A;  3KJO A;  1RF2 D;  4HJ8 A;  5KNC A;  1BCP F;  1J8I A;  4F87 A;  4A3K H;  3MXU A;  3TN2 A;  3A74 A;  4OWX B;  2WB1 B;  1Y8O B;  2K28 A;  1SNP A;  2KJX A;  3J81 L;  3I72 A;  2YU9 B;  1FR3 A; 
#chains in the Genus database with same CATH homology
 5HGT A;  2NUC A;  1Z47 A;  3QOJ A;  4K6D A;  5EKK A;  1SYD A;  2N55 A;  2QEJ C;  2J4X A;  1ET9 A;  3I4N B;  3M7G A;  2PW5 A;  3TZU A;  1IKM A;  4LK1 C;  3D3R A;  1STA A;  2F0K A;  4I7Z C;  2EPB A;  3L7Z C;  4BY7 B;  1TWG B;  1A15 A;  3URY A;  1D6E C;  2FJ2 A;  4CHT B;  1II3 A;  3WOF A;  3C2P A;  1D5M C;  2R7Z B;  3GTP B;  5FK9 C;  3C1E A;  4ID6 A;  1SYB A;  3K58 A;  3I91 A;  3PMF A;  1DCZ A;  1GUO A;  1ILQ A;  1BOS A;  5IGB A;  4KY7 A;  3K5M A;  2K6A A;  1RHP A;  1O78 A;  1H9S A;  4P2C B;  3BZD B;  3S2H B;  1ESF A;  2O4X A;  3MEH A;  2O5J C;  3OOC A;  1JOK A;  1XTC D;  1ENA A;  1A6X A;  1H9M A;  2SNS A;  2XIW A;  2EDG A;  1A2T A;  5J39 A;  2O5I C;  2WKC A;  2LFN A;  4HAE A;  1JOQ A;  4MHE A;  3J81 E;  3H0G B;  5DNF A;  3OMG A;  3MFY A;  3OHX C;  1HCZ A;  1EWC A;  2D5D A;  4IQZ A;  4EQN A;  3U9O A;  4NP5 A;  4A3D B;  1D1I A;  4DNT B;  2VXW A;  3ND8 A;  2RQX A;  1I50 B;  1MI2 A;  1EQT A;  4FF1 A;  2LMC B;  5CBA E;  3M7N A;  1SE3 A;  2F0J A;  3T16 A;  4KKU A;  3SE0 A;  1B4O A;  1LT3 D;  5FOB B;  1FD7 D;  1GHK A;  4FXK C;  3BYY B;  3M3Y B;  5EPL A;  1I4H A;  4H13 C;  4IAL A;  2A68 D;  4LAA A;  5ISR A;  1SMY C;  1RJT A;  4G7H C;  1B50 A;  1SYE A;  2E2J B;  4KKS A;  2B2Y A;  1XWE A;  4RWS C;  4C3J B;  2XVS A;  4K14 A;  1PTO C;  1I6H B;  4C1N I;  2E2H B;  1TU2 B;  1F9R A;  2EYF A;  1E2V A;  4DAY A;  3R8B A;  3V2T A;  3VR4 A;  1LTA D;  1EYA A;  2ICE C;  5E4X A;  1HRJ A;  1OXV A;  2PO4 A;  3QO2 A;  3GTG B;  3S1Q B;  2QDB A;  3BDO A;  4EGV A;  4C3I G;  3KUP A;  5D3D A;  1QG7 A;  2L12 A;  2ID0 A;  2F3W A;  1D1K A;  4JBW A;  5A2Q E;  1S5C D;  2MHV A;  2X69 A;  2JE6 I;  1GUT A;  4KJO A;  3KBX A;  2PPB C;  5FO9 B;  1GUG A;  3BVZ A;  4XDX A;  2K01 A;  2BE5 D;  1MBY A;  2K5D A;  4HMJ A;  3BDL A;  3X3M A;  3CKI B;  3A7L A;  1OO9 B;  2J0T D;  5FO8 B;  1AZQ A;  5EGT A;  3FPU B;  5D65 A;  4KI0 A;  5LL6 S;  3UI2 A;  2L11 A;  2WP8 J;  3T4A C;  2A73 B;  1IYV A;  3MC0 B;  3S1R B;  1WVL A;  3HOX B;  5J22 A;  3TP8 A;  2O2L D;  5BN3 A;  3H94 A;  1LT4 D;  2F3V A;  2KQ3 A;  3OWF A;  1SFO B;  3O13 A;  4GZY C;  2A69 C;  4C3H B;  3E5S A;  4MN3 A;  5D3I B;  5DM7 3;  2Y0S B;  1T5E A;  1JC7 A;  1AEX A;  3D31 A;  4NMZ A;  1DYQ A;  2M00 A;  5ELE A;  1X32 A;  2F0F A;  2KED A;  5CV5 A;  2PQE A;  3FVQ A;  4IUN A;  4L6T B;  5T1G A;  1CT1 D;  2A6E C;  1F2L A;  2EJG C;  1QNU A;  3F2U A;  3KLS A;  3T53 B;  4RGN A;  4BY1 B;  4WOR A;  1OXT A;  2B2V A;  2FFK B;  4M1U B;  4A3G B;  1QIL A;  2B2W C;  3I70 A;  3IAY A;  3ONA B;  2F0W A;  3DEP A;  1EWH A;  3W2D A;  4H44 C;  4DU9 A;  2VB3 X;  2EE1 A;  4FF3 A;  1Q12 A;  2F0T A;  4IUT A;  1UUP A;  2FMC A;  1LTT D;  2HCC A;  4IFD G;  5C0X J;  2EZV A;  2K32 A;  4B08 A;  1HFG A;  5COR A;  1I4Q A;  4XIG S;  3PUZ A;  4DAP A;  1ROD A;  5CV6 A;  4H0L C;  3AB9 A;  3MTS A;  4KN7 C;  3I73 A;  5C6A A;  2EYH A;  3NE5 B;  3RMH A;  3DUZ A;  1PXU A;  1HXY D;  1EU4 A;  3N52 A;  2BOS A;  4OL7 A;  4CKC A;  4KJN A;  2F0I A;  1Y1V B;  3T51 B;  4ZYS A;  3GO5 A;  4ZAI A;  5I2Y A;  2HQE A;  4HN7 A;  1JIC A;  2JP1 A;  5C3X A;  1WTP A;  3HOY B;  2IX1 A;  4N9P A;  5C0X H;  5JPM C;  1H9K A;  1LTB D;  1U4R A;  3GV6 A;  5A35 A;  1HTP A;  3M4O B;  2H1E A;  3D6W A;  5JJZ A;  3P1H A;  4ZK9 B;  2F0M A;  4J8Q A;  2E74 C;  1SNO A;  3QWN A;  5KIX A;  3VA5 A;  5C4Z A;  5JVG 3;  2DY8 A;  3HGB A;  4ABN A;  1OXX K;  3HS0 C;  3GTL B;  3PUW A;  2Z8L A;  1JWS D;  3EFX D;  3D4R A;  4A3J B;  3OIP A;  3HOZ B;  3H09 A;  5I6W A;  3TP5 A;  1EYD A;  1SBB B;  2A6H C;  4PNY A;  1SJE D;  1L0X B;  1JOO A;  1LV9 A;  4MIU A;  4QUF A;  1TWH B;  1BCP C;  2ENB A;  4K5X A;  5JVH 3;  5IGD A;  1TY2 A;  4S3S A;  1K8O A;  2CHB D;  2OT2 A;  4R8N A;  3DEO A;  4ZUJ A;  3IKJ A;  2LKV A;  4PMC A;  5LL6 X;  2NN6 H;  5I9O A;  3BVG A;  1Q1B A;  1WTO A;  3KLR A;  1Y69 U;  1G2T A;  1XYI A;  2PCF B;  5ELD A;  5EKI A;  2F0P A;  2TMP A;  2CVR A;  3VYR A;  4ILW A;  4PV1 C;  1DM0 B;  2CW0 C;  1BBX C;  2IX0 A;  2E2D C;  4XT1 B;  5EQ0 A;  1CA5 A;  5FO7 B;  1EY4 A;  2EY6 A;  1KNA A;  2M9V A;  4ODG A;  3OW7 A;  5IGE A;  4QMG A;  2XSC A;  1G2S A;  2Q8I B;  1Z7T A;  2F0U A;  1SAP A;  1I4P A;  3HZX A;  3NWS A;  1TS5 A;  4K5W A;  3DWA A;  1PFN A;  1ONL A;  2AWN A;  5DAU A;  3VR6 A;  1SE2 A;  1PMR A;  5M9O A;  3EJI A;  3P7J A;  5C0X I;  2B2Y C;  2Z4H A;  5JEA G;  2E2I B;  4CKB A;  2B2U C;  1I4R A;  3MXN A;  2ICI A;  4WFN 3;  1W6K A;  3K59 A;  5EBC A;  4X3U A;  4ZQ3 A;  3FDT A;  1FGB D;  2EYL A;  4XXE A;  2XWJ B;  5CBE E;  3E0J A;  1V1P B;  4FYD A;  4RKB A;  2F0Q A;  1LT6 D;  3AU7 A;  3DWP A;  1NR4 A;  1S5E D;  2QKI C;  2KOL A;  2RBM A;  4OIJ A;  1PYW D;  5I6Y A;  1ZXT A;  4EVO A;  3PO2 B;  4QIW B;  3S1M B;  4NKL A;  1AZP A;  5JAV A;  3L9A X;  5M3F B;  3A56 A;  1PTO B;  2EY1 A;  3I90 A;  2JSO A;  1QWY A;  5CV8 A;  2DN8 A;  5ELB A;  2KVM A;  2F0H A;  1I4X A;  2B8G A;  2XWB B;  3CRK C;  2NN6 I;  1A3U A;  1PLF A;  5TSS A;  3HOU B;  2F0O A;  2JEA I;  3P75 A;  3GTJ B;  4C3J G;  3NUC A;  3FEW X;  1CK1 A;  3OWE B;  1GHJ A;  2K03 A;  1I6V C;  2RDG A;  1PRT F;  1LLR D;  3OSO A;  2K33 A;  3BG3 A;  5C3E B;  3K6O A;  2KEC A;  4K6L A;  4A3K B;  1SMY D;  1D5Z C;  2QCP X;  2NWG A;  3JAM E;  1PZK D;  3C3L A;  3A8K E;  1PTO D;  1A2U A;  4HSV A;  3SEB A;  1ENC A;  1PFM A;  1TII D;  2JYO A;  4JK1 C;  1BUV T;  1EEI D;  3A8I E;  3D4D A;  1BDO A;  2MUY A;  2B63 B;  4FF4 A;  4RKL A;  2L9H A;  4ZUI A;  5LHY 1;  1G6Z A;  2B8F A;  4KTA A;  4PQX A;  2K5W A;  3PO3 B;  2FHT A;  3Q23 A;  2PYK A;  1WCM B;  3V96 A;  1XXG A;  3J7Y W;  2F0G A;  4NDX A;  4TSS A;  1QB5 D;  4HTH A;  5C4H A;  3PIP 3;  4U67 3;  4M8A A;  5EPJ A;  4KKT A;  2CQA A;  4DGZ A;  1VMC A;  5HUR A;  2F0L A;  1DOL A;  2NVY B;  4C3H G;  3DWQ A;  2BA0 A;  3KLS X;  1SEB D;  2IJ0 A;  2ZXO A;  4FP5 D;  1WTQ A;  4N9T A;  2MP1 A;  3CHB D;  3GQB A;  4G57 A;  2SDF A;  1B2T A;  1O7L A;  2NBF A;  4CJ1 B;  1QNK A;  2L1B A;  1STE A;  2YYZ A;  3TZD A;  1TS3 A;  4EQO A;  5K36 G;  2A69 D;  1JWU D;  4TKO B;  5CYU A;  2JA7 B;  5IT9 L;  1QOH A;  2OEO A;  2KHS A;  2MJ8 A;  3RD4 A;  3NSW A;  4TRD A;  2EVB A;  4A3F B;  1AN8 A;  5I9P A;  5I2X A;  2A6E D;  4A3B B;  1AFP A;  1ENF A;  4O1N A;  3K7A B;  5E4W C;  4J1M A;  2ZXR A;  3VR2 A;  1F2M A;  4RFB A;  2LY7 A;  3LWU A;  5M5Y B;  1EZ8 A;  3GP7 A;  1EY0 A;  3Q24 A;  1CQF A;  4HMI A;  2PZU A;  4QF4 A;  2KUM A;  1CHQ D;  4QCL A;  1TKW B;  1YNN C;  4WJW A;  3TSS A;  3ITP A;  4KK7 A;  3R2T A;  5K36 H;  5BN4 A;  1T5X D;  1AP0 A;  3LX0 A;  4O42 A;  3H91 A;  3ERQ A;  1YNJ C;  1LT5 D;  1LAB A;  4C1N K;  2JA8 B;  1HFN A;  5J1Z A;  1PFB A;  4KY5 A;  3LNN A;  3GTQ B;  3R93 A;  4DAV A;  4FNF A;  1BCP B;  1EU3 A;  3PIO 3;  1C4Q A;  1JE4 A;  2WV6 D;  4FF2 A;  4RH6 A;  3Q22 A;  4WRD A;  4OO1 G;  2G9H D;  1RD9 D;  3SXH A;  1A3V A;  1U4P A;  4FO2 A;  1H9S B;  4CJ2 C;  5M3M B;  1DJR D;  4IUU A;  4HED A;  5EBD A;  5IT9 E;  3C1F A;  2F0V A;  3SHL A;  1SE4 A;  1PDQ A;  1MGS A;  1HHV A;  1ET6 A;  4C56 C;  1CQV A;  5KYL A;  1B9N A;  5CV4 A;  3FPP A;  5IOD A;  3PUY A;  4DN4 M;  5COY A;  3MXP A;  1WTR A;  1B9M A;  4PMW A;  4KHZ A;  4OO1 H;  2EY2 A;  2NB0 A;  5IGG A;  1TS2 A;  3S2D B;  2A6H D;  1KDB A;  5IGC A;  5C44 B;  1J9O A;  4XYQ A;  4IFD J;  2NVT B;  4C2M B;  3TBI B;  1EY5 A;  4NW2 A;  1BCP D;  3KK7 A;  4ME5 A;  4QUC A;  3LWE A;  3SK8 A;  1KTK A;  1V1P A;  5F2D A;  2ZT9 C;  1I4G A;  1M4V A;  3KF8 A;  3K5O A;  5DEH A;  4V0B A;  3CRL C;  3FMC A;  1EY7 A;  2AWO A;  1JWM D;  4F88 A;  4IFD H;  2KA7 A;  1GOZ A;  4RGT A;  4QB4 A;  2L5T A;  1EQV A;  4K8J A;  1XX8 A;  3MWY W;  1WD0 A;  1Q1E A;  1SYC A;  2WAC A;  1FNV A;  2CW0 D;  3TP7 A;  1ZYR C;  4RCN A;  1ZKO A;  5CV7 A;  3QG1 A;  1U4M A;  1CHP D;  1V43 A;  1LTG D;  2VNU D;  3T56 B;  2PZW A;  4ZLT F;  4CGY B;  3NK9 A;  1WD1 A;  2Z1C A;  1CTM A;  4XQQ A;  2IWH A;  1RDP D;  4R9W A;  4KD4 A;  1M8A A;  4ZRZ A;  1HA5 A;  3GD7 A;  4F7X A;  4XQJ A;  3S9W A;  1TWF B;  1IYU A;  4KV6 A;  1W6J A;  3VA7 A;  3MFG A;  1SYG A;  4AYB B;  2EXZ A;  3RLF A;  1PZJ D;  5C4X B;  5C5L A;  5JPN C;  5G3L D;  4KD3 A;  3M85 A;  2H4O A;  1C8C A;  4XQN A;  3S1N B;  1SNC A;  2EJF C;  1G8Z D;  1BNZ A;  2AQ2 B;  3TDQ A;  2AUK A;  3IFT A;  4DXG A;  3T13 A;  4XYO A;  2RA4 A;  3HKZ B;  1Q3L A;  1HUN A;  4BA1 I;  1TR5 A;  1TWC B;  3D6C A;  2K7V A;  1QJO A;  3V05 A;  3SK5 A;  3R3O A;  3G6J B;  4IUR A;  4K8I A;  4RAU C;  2F4I A;  1PRT C;  4RCO A;  3ERO A;  2X6L A;  1CZG A;  3HOW B;  4A3I B;  1G29 1;  5IIF A;  1ML0 D;  3H3V C;  3A8J E;  3HP3 A;  1JQY D;  1BQQ T;  4F8M A;  2NTS A;  3RZD B;  3A55 A;  4IUP A;  4A93 B;  3RZO B;  1EY6 A;  1PTO H;  1BR9 A;  1QCB D;  2B2W A;  4HCE A;  3ND9 A;  2C5C A;  1EZ6 A;  5IOC A;  3NPP A;  1ESR A;  3N6R A;  2AQ3 B;  3DMU A;  1IKL A;  1PZI D;  3D4W A;  1WTX A;  4IFD I;  3NXW A;  4LMQ D;  1R9T B;  2D2C C;  1TWA B;  2D62 A;  5JEA J;  3VYS A;  3ZYY X;  1HQM C;  2KEE A;  3HRZ C;  4CJ0 B;  2XN9 C;  5E3F A;  3DM1 A;  5E1F A;  5NUC A;  2VB2 X;  1STG A;  3MVV A;  3FRP B;  3EA6 A;  2F0E A;  3GTK B;  2IW3 A;  2RVL A;  1VMP A;  1Y8N B;  1F2Y A;  4J6H A;  1VDZ A;  1H9R A;  1KLG D;  5I4D A;  4HCS A;  2D9U A;  3NHH A;  5JEA H;  1LAC A;  2IX3 A;  2K5Q A;  4Q0F A;  2OXP A;  2MPM A;  3FKI B;  1F9P A;  4OGQ C;  3SK6 A;  3J7A F;  1UAP A;  3PUV A;  4V19 0;  2L0C A;  2PMZ B;  4LJZ C;  5K5P A;  1E0B A;  1STN A;  1S5F D;  1HA6 A;  3WDN A;  4EQP A;  3AMU A;  5M5W B;  3MA2 B;  3WOE A;  1EOT A;  3NQI A;  4DNR B;  4IZ8 A;  1SYF A;  2L55 A;  2F03 A;  2EOT A;  2M2L A;  3X3N A;  4BS9 A;  1VF7 A;  2DNE A;  2FMM A;  1CM9 A;  2R61 A;  1K83 B;  4BBR B;  5KYI A;  1JR0 D;  4X3T A;  1IW7 C;  2NTT A;  4DXF A;  3G7L A;  1EFI D;  4ZKC B;  2EJM A;  1MSG A;  5KNB A;  2F0S A;  3QB3 A;  3NTH A;  2B2V C;  3BYT B;  4DK0 A;  1Z6H A;  2XRQ D;  1E2W A;  1BXT A;  3S17 B;  3NQT A;  4RGM A;  1CI3 M;  1SJH D;  3OPO A;  1STB A;  2DNC A;  5CMD A;  2RDH A;  4L8J A;  5G3L F;  1D5X C;  2R3Z A;  3L3O C;  4BBS B;  2R92 B;  2EY5 A;  3NTI A;  3MXG A;  1JOR A;  2K1B A;  1HUM A;  5A2Q L;  4G7Z C;  3VYU A;  3M4Y A;  2G9D A;  3A54 A;  3K5L A;  1UNS A;  4K2L A;  2NZ1 D;  2EYJ A;  1CFM A;  4IUV A;  1ILP A;  2R6G A;  1TS4 A;  1BO0 A;  1LTS D;  4B9W A;  2I46 A;  1DZ1 A;  4HSP A;  2B2T A;  1Y8P B;  1X3P A;  2DY7 A;  3P20 A;  3I8Z A;  3BDC A;  1EY8 A;  5EJW A;  1YNN D;  3D8G A;  4X3S A;  3CQZ B;  3S15 B;  4X3K A;  3SVM A;  5CGK A;  1YNJ D;  3VYT A;  5C4J B;  2HCI A;  3HEJ A;  3J7A V;  1O7Y A;  2B2U A;  4CKE A;  1B53 A;  3PUX A;  1KAB A;  1UEA B;  5C5M A;  1TQO A;  2BDN A;  4BA2 I;  4DFA A;  2RDF A;  1JCK B;  1STY A;  4Z9C B;  1BF4 A;  1D2B A;  2JA5 B;  2WAQ B;  2A5H A;  4PMB A;  3GTM B;  2HDM A;  1HPC A;  2E75 C;  3U9S A;  4IN3 A;  1KDC A;  1F9Q A;  1ZEQ X;  2NYZ D;  3GTO B;  1EEF D;  1TT2 A;  1FNW A;  1NCV A;  1CZW A;  1B3A A;  2F1M A;  1V8Q A;  5T1I A;  1SND A;  2HUG A;  1MD2 D;  1LTI D;  1R4P B;  2A68 C;  2BDO A;  1GXD C;  3EQL C;  3A7A B;  4RGO S;  3S16 B;  1S4Z A;  2WKD A;  4FVM A;  3PV0 A;  3K5N A;  1DD2 A;  1FNU A;  1TVX A;  2X6G A;  2VUM B;  4A3E B;  2EYP A;  1IHZ A;  2TSS A;  1TY0 A;  4K5V A;  3BS1 A;  2RSN A;  2GA4 B;  4E6I A;  3IL8 A;  2PZT A;  2NVX B;  2SOB A;  1O80 A;  3NWT A;  4Q5V A;  2RSO A;  2F0N A;  3NBI A;  2L4N A;  2A74 C;  3H6M A;  1EL0 A;  1ICW A;  4BWG B;  4ULL A;  1GJX A;  1STH A;  1DOK A;  1OXU A;  2BE5 C;  2XRS D;  2FIN B;  4G7O C;  1NUC A;  5KGU A;  2Z4I A;  1PTO F;  1NR2 A;  1ZYR D;  4RA8 A;  5KRU A;  5CC4 A;  5KND A;  4OIK A;  1SNQ A;  2K05 A;  1MSH A;  1SXT A;  4C3I B;  2R93 B;  3E6Z X;  1CA6 A;  4Y7N B;  1GUN A;  5C0X G;  1OXS C;  5FLX L;  5M5X B;  1S5B D;  1PRT B;  1WTW A;  1JB3 A;  1NAP A;  3TP6 A;  3HG9 A;  2AQ1 B;  2IT1 A;  2C9O A;  2JA6 B;  1A3T A;  1Q90 A;  4RHS A;  2XNA C;  3R2I A;  4U68 A;  1B44 D;  5EPK A;  1DOM A;  1F9S A;  1F2Z A;  2WII B;  1EYC A;  3DXJ C;  1KLU D;  5ELC A;  4XTC S;  3I4L A;  2RKS A;  4KHV A;  1K8M A;  1RTN A;  2QF7 A;  4CBV A;  3NP8 A;  3MAQ A;  2OF1 A;  3C46 A;  3HOV B;  1O7Z A;  2B39 A;  4YIJ A;  2LS0 1;  2BA1 A;  2IPK D;  1KAA A;  1RTO A;  1DON A;  4DA2 A;  1G91 A;  1QE6 A;  4B9X A;  5CR3 A;  2NN6 G;  1KDA A;  5D14 A;  3QOL A;  4L63 B;  1PRT D;  3MZ5 A;  3BVM A;  3NTK A;  2SNM A;  5FKA C;  3NBH A;  4IUQ A;  3J80 L;  2NVQ B;  3QIA A;  2Q8T A;  3TME A;  1VCI A;  1Q8I A;  2PW7 A;  3QJY A;  2KCN A;  4DF7 A;  4DK1 A;  1DXM A;  5FLX E;  1LTR D;  1RKN A;  4KY6 A;  2IL8 A;  4OHJ A;  1H9J A;  3SDZ A;  1RCV D;  2WIN B;  1R4Q B;  1AW7 A;  1IL8 A;  1FYC A;  1F77 A;  1X3Q A;  4UAI A;  1EIH A;  3KBG A;  1E2Z A;  1I3Q B;  5DM6 3;  3VR3 A;  4UDU C;  2I07 B;  5BN5 A;  4FXG C;  2SEB D;  3I3C A;  3OIQ A;  4RHR A;  3I4M B;  5ELF A;  2JEB I;  3SR1 A;  3GV3 A;  4I65 A;  3Q6S A;  3MHB A;  4OO1 I;  1S5D D;  1KNE A;  1U4L A;  1HTL D;  2KCC A;  1SSO A;  1Y1W B;  2PNR C;  3RUZ A;  1U9R A;  3OMC A;  3W3A A;  5KEE A;  4R8I A;  3VR5 A;  5CV9 A;  4HR7 B;  1SNM A;  1SDF A;  3K57 A;  4A3M B;  2V4D A;  4G4K A;  2QIL A;  2F0D A;  5EKL A;  2E76 C;  3J80 E;  4FXD A;  1VF5 C;  3EVQ A;  1HQR D;  2B2T C;  2EYM A;  4ZKB B;  4H7B A;  1WTV A;  5IGF A;  1V1O A;  5JOB A;  2EYO A;  2Q8R E;  2K04 A;  4TQU S;  1GUS A;  3DHQ A;  1NSN S;  1EY9 A;  3CU7 A;  2BCO A;  1EIG A;  1GUW A;  4XT3 B;  2N88 A;  4K2K A;  4KN4 C;  2JXM B;  2HDL A;  5C3W A;  1B1Z A;  1LO5 D;  2J7Z A;  2MGS A;  3Q0A A;  1L0Y B;  3IFD A;  3SK4 A;  2AUJ D;  1C48 A;  3K0Y A;  2ZXP A;  5AFW A;  1IW7 D;  3JAM L;  4KMU C;  3S14 B;  1RF2 D;  5KNC A;  1BCP F;  1J8I A;  4F87 A;  3MXU A;  3TN2 A;  2WB1 B;  1Y8O B;  2K28 A;  1SNP A;  2KJX A;  3J81 L;  3I72 A;  2YU9 B;  1FR3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...