2GA4B

Stx2 with adenine
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
70
structure length
70
Chain Sequence
ADCAKGKIEFSKYNEDDTFTVKVDGKEYWTSRWNLQPLLQSAQLTGMTVTIKSSTCESGSGFAEVQFNND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Binding of adenine to Stx2, the protein toxin from Escherichia coli O157:H7.
pubmed doi rcsb
molecule tags Toxin
molecule keywords Shiga-like toxin II subunit A
total genus 19
structure length 70
sequence length 70
chains with identical sequence C, D, E, F
ec nomenclature
pdb deposition date 2006-03-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.70 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2ga4B00
4P2CB 2GA4B 2BOSA 1CQFA 2XSCA 1BOSA 1CZWA 3MXGA 1R4QB 1DM0B 4M1UB 1QNUA 1CZGA 2C5CA 1D1KA 4ULLA 1R4PB 1C48A 1C4QA 1QOHA 1D1IA
chains in the Genus database with same CATH superfamily
1O7LA 2BH8A 2JQOA 3PIOA 2DY8A 2J7ZA 4CKBA 2Z8LA 3L3OC 3C3LA 5CV9A 2Z6BA 5DLQE 1SR3A 3MFGA 3HOUH 4J6HA 5D14A 3RNUA 3EFXD 3GTQH 1QVFA 3OWEB 3OW2A 3K80C 4DR5Q 3TQYA 1VQMA 1X3PA 2D0OA 1EOTA 1CHPD 5C44H 5IGDA 2Q8IB 4DV3L 3Q6SA 5FLXL 3EROA 5C4JH 3HOYG 4I7ZC 2RKSA 2CWAA 1Q82C 1AEXA 3D8GA 2BH2A 4C3JG 3K7AH 3FRPB 5IOCA 1JWSD 1G91A 1XNQL 4KKSA 4DAPA 1G6ZA 2MNAA 1WTOA 2F0DA 4J1MA 1WI5A 2EYFA 5AJ3Q 4RHRA 2SNSA 1JB7A 3MTSA 1PFMA 4PZ7A 2UUBL 1GD7A 1WTWA 4B3RQ 5HY6A 4ALPA 1Q81C 4LF7Q 4DR2Q 4YY3Q 3GD7A 2M9VA 3TS2A 1T5EA 2ZTEA 4A4IA 4P75A 1GKHA 3KF6A 2AMCB 3J80i 2NVTB 1ENCA 2NWGA 3QWNA 4TRDA 4Q5VA 4GN5A 2BOSA 2NVQB 1IYVA 1BCPD 1I50H 4IN3A 2WAQE 2F03A 3CMEA 2EIFA 1TU2B 2JA5H 1KAAA 1C0AA 4ZUJA 4C1NI 4MHEA 1D1KA 3MXUA 5T1GA 4K8JA 3UDFA 4L5SA 3I72A 1PA6A 1J9OA 3I73A 3OMCA 1TWAB 3G48A 3R8BA 4BY1G 4CGYB 3GTPB 5IY0A 1XX8A 1O7YA 1VQOA 4LF9Q 1L0YB 2X69A 2F4VQ 2ZT9C 2CVRA 1XPUA 4A3DG 2NN6H 3Q24A 3ULJA 3RLNA 3UI2A 1N8RC 1CZGA 3MHBA 4AYBB 1QB5D 4G7ZC 1C48A 3GTGH 4MNOA 3SK8A 3NBHB 2ZXPA 4K2KA 3F2DA 1E2VA 1LTGD 5CV6A 4K5XA 4XYQA 4F7XA 4HTHA 4HEDA 1PH9A 1HNWQ 2N8NA 2RSOA 2MFIA 4A3KH 2KCNA 1Y8NB 3Q23A 3KJPA 1NJIC 5C44G 2RDHA 2KHSA 2EDGA 3D0FA 1CKNB 1SE8A 3I2ZA 1YJWA 2UU9L 1PDQA 1MJEA 4PQXA 1FD7D 3JAMi 4ZQ3A 1VQ6A 2Z0SA 3S2HH 3U50C 2V1CC 3CCVA 1FNVA 1I4XA 5CV5A 4DR5L 3MVVA 4DA2A 4FXDA 4LAAA 2TMPA 4KI0A 1RCVD 1CTMA 1KHIA 2XIWA 4IUTA 1BUVT 3M4QA 1YNXA 2O4XA 2WB1B 4IZ8A 2JA9A 3S17B 2D0PA 4QL5A 2N78A 3T16A 3QB3A 3S2HB 1VQCA 2XTIA 5BR8Q 3CCMA 4IPGA 4P71A 5IYBG 4DV0Q 1PTOD 4FVMA 2F1MA 2K4KA 4XTCS 4CKEA 5C3EB 2D9UA 3BYYB 4LFAL 3OW7A 4G7HC 2XWJB 3K8AA 1O78A 1MSHA 4JW0A 3VYTA 2YYZA 2R92B 4K5WA 2D62A 2RBMA 1Q8KA 2B8GA 5IT9L 4O0AA 4NDXA 5KEEA 5C5LA 1ESRA 2RF4A 3DWPA 4OIJA 5E1FA 4N8FA 1EQQA 4A3FH 3P20A 4HMJA 1U4RA 2E2DC 1ZYRC 2L15A 4YWMA 3VR4A 4PMCA 1PH3A 2Z4HA 1LTSD 4RMFA 1YVCA 3A8KE 1O80A 3HOZG 1TS4A 2QKIC 4IJLA 3RN2A 4JI3Q 2SOBA 4JI4L 4JI3L 1D5ZC 3CD6A 1VQ5A 2I5LX 3IAYA 5LMUL 5I2XA 3BS1A 1PYWD 2NVTH 2MJ8A 4GLXA 4JI0Q 1WTQA 1B9NA 1FR3A 2KCCA 1S3OA 1JICA 4BY7G 4OWWB 1RTOA 5JEAG 2PQAB 1VQGA 1HQRD 1FJGQ 1SEBD 1SXTA 2HUGA 4A3EG 4QMGA 1K8MA 2XSCA 1ASYA 1TXYA 2BDOA 2JSOA 3W3AA 3EN2A 2NTSA 2M2LA 3ER0A 1L0WA 3SK4A 3HP3A 1B3QA 3I91A 4CDCC 3FEWX 2E2IB 1DJRD 3SK5A 3NBIA 1JE5A 5AJ3L 1SYBA 3DEPA 3MXNA 1XXGA 3PCOB 3DM1A 2C9OA 3CCJA 2JA5G 3KJOA 2BDNA 1G2TA 1IXRA 2L12A 1BNZA 4WFN3 4EQNA 2R7ZG 5EKKA 2F0MA 4NP5A 4X65L 1T5XD 1WCMG 4KY7A 5IYDG 2GVBA 2MHVA 1N33Q 3QOJA 1A63A 2D5DA 3S15B 2R7ZB 5FKAC 4O42A 1IL8A 1HNZQ 1NR2A 3VA7A 3A54A 5C0XI 4GKJQ 2AQ2B 1F9RA 4XT1B 1X65A 2F0LA 2PI2A 4QUCA 3S16H 2CH4W 4C3HG 5M5WB 4DV2Q 1KQSA 5J22A 4HR7B 4H02A 2EQSA 1G291 1I6VC 2A6ED 2XN9C 1CSQA 3KLSA 3ULPA 1WFQA 1CQVA 1PRTD 2KBNA 4DAYB 1YIJA 2C5CA 1HZ9A 3E5SA 4HJAA 4C1NK 5I9OA 2NN6I 3KOJA 3CCQA 1Q12A 1QOHA 4P73A 1SLJA 1STNA 1K0RA 1PH2A 4YCWA 2O5IC 3J80c 3TEHB 3KF6B 4HIKA 4RGOS 2HT1A 3TZDA 2H4OA 1QZGA 2L4NA 4DNTB 3E9HA 5LMNW 2WFWA 1Y1WB 4O2DA 3LX0A 3GP7A 5IT9E 3J81L 2B2WC 3S14H 4GS3A 4LF5Q 3WOFA 4P74A 1PV4A 2MQHA 2HD3A 5CV8A 3M4OB 1N9WA 1GXDC 3P1HA 3RUZA 1TY0A 4N8X1 1HA5A 4YIJA 1SAPA 5F2DA 1C8CA 3EVQA 4EQ5A 3G7LA 2B2UA 2LS01 3X3MA 1ET6A 1STAA 4A93B 4UAIA 3UDGA 1S5CD 2RA4A 4QY7A 4LFCL 1EZ8A 4BBSB 3RZOB 4A3FG 3A55A 3TN2A 4Y7NB 2B63G 4CKCA 3CCUA 1JCKB 4RKBA 4IOAA 2NN6G 4HIMA 1KIXA 4JI4Q 1ZEQX 3CCSA 1NUCA 1AW7A 1MGSA 1GOZA 2XWBB 3A56A 3PO2H 3HOVG 1PH6A 2AKWB 2FJ2A 4KKUA 2CWPA 4KKTA 4A3IB 4RCNA 1PH4A 1SROA 1Q46A 3PUYA 2PQAA 2Z1CA 4YHHL 2EJGC 1SNQA 2ZJRA 1DONA 4KHPQ 4POGA 4LNQA 2KEEA 1BBUA 3NEMA 1D5MC 4RHSA 4BA2I 1LLRD 2YU9H 5DAUA 4QIWE 1YNNC 4OO1H 1VQFA 4XT3B 4X66L 1Y1WH 1X3EA 5J39A 4LUOA 3CHBD 4V0BA 2E74C 4OL7A 1ZYRD 3HFZB 1F77A 2MO0A 1IHZA 1PVOA 1M4VA 3CPWA 4BBRB 4K0KQ 2QEJC 3F2UA 5JPNC 4YCVA 4BY7B 3NWTA 4K2LA 1PZJD 3T4AC 4DV5Q 4DV5L 2RHSB 3R2IA 4QF4A 5D3DA 1K73C 4A3DB 2LSSA 4PG3A 4B3SQ 4JI7Q 1Q1BA 3P75A 5KYLA 2VUMB 5IODA 3V05A 5IP7H 4DUYQ 2DN8A 2PNRC 4DUYL 4TVAB 3UDIA 3OPOA 1BCPB 1STHA 3PO3B 1CZWA 3IL8A 3MXGA 1QNUA 2DNCA 3T51B 4NMZA 3KBXA 5CYUA 4LF4L 3K0XA 4JOIA 4KN4C 2H1EA 4ZKBB 4DU9A 1HUNA 1F9SA 2I07B 2R7DA 4C3IB 5C4HA 3J7YW 1PFSA 2M00A 4OO1I 1AH9A 1IYUA 2I0QA 1B8AA 2JE6I 3F2BA 2AHOB 2DNEA 3K6OA 4QJFA 1OXTA 1IBMQ 4IUQA 4B3RL 1B2TA 3PGZA 2CW0C 4C3HH 3HKSA 5HGTA 1VCIA 3MFYA 2CKZB 3X3NA 1XMQQ 2RDFA 3VDYA 4OX9L 1SMXA 4X3KA 4DXFA 1EQRA 3L2PA 1QG7A 3EJIA 2OQ0A 1E24A 1EQVA 2HCCA 5C3WA 3J80E 1VDZA 3OYYA 1I6HB 1TIID 2EY6A 3HOYB 5C4XB 2QEXA 4DV6Q 1XYIA 1D8LA 1HFNA 1SYEA 1QE6A 2PNHA 3A7AB 2F0PA 3QO2A 5IT9c 4DKAC 4FF3A 3URYA 4H13C 2VQEQ 3Q0AA 2L5TA 2F0HA 4P2CB 1BF4A 4QB4A 1E3PA 1LO5D 4DNIA 3HEJA 4JV5Q 4DV7Q 1EFID 2ALYB 2A68C 2JYOA 3SXHA 1U4PA 3SGIA 3RR5A 1I6HH 4TKOB 4X62Q 3H3VI 1D5XC 1FVIA 4HJ7A 3IFDA 3QJYA 4DNRB 3VR5A 3ND9A 1CKMA 3T1HL 1CSPA 3K59A 1EY7A 3K5LA 3PQIA 3AMUA 3W5OA 2GA4B 1TQOA 1W3SA 2HHHL 1K8OA 4R4OA 5ELCA 4AYBG 3S1MH 2RCFA 1X56A 4C56C 2OQKA 1R4QB 5COYA 5JPMC 1HNXL 3R3OA 4MIUA 2PMZB 4JI8L 3ZYYX 1SDFA 4GZYC 2Z6KC 3EBEA 3Q8DA 3F2CA 4PMBA 4ZK9B 1XMOL 4NXNL 4A3LH 1FL0A 2ZM6Q 1XPOA 5M5YH 2FXQA 4KN7C 5EPLA 5IYCG 4G7OC 4U68A 1W6KA 1ILQA 1JWMD 5CBEE 2XRSD 2IX1A 3TP7A 2B2YA 4A3GB 3AQQA 2OCEA 1S40A 5TSSA 3WDNA 3MXNB 2YU9B 3D6WA 3M7NA 1EOVA 4C3IG 1LT4D 1L1OA 4JBJA 4XYOA 1MD2D 3FPUB 2HDMA 4JBKA 4A3MB 2B2YC 1ICWA 1H9KA 1YNJC 1TWCB 1QCBD 4A3IH 1Y14B 3P7JA 2RQXA 4O1NA 3JAMc 4GN4B 4HSPA 4MTKA 1VQ9A 1VQLA 3PO2B 1OXUA 1XMQL 3I4OA 1FNUA 4DR1L 1SJHD 3GTLH 3OOCA 3NUCA 5C5MA 4L63B 3GTKH 2OXPA 1GUNA 1NSNS 3L7ZC 2Q8RE 4QUFA 4R4CA 1S5FD 2KHJA 3DM3A 3PUXA 2QA4A 1LTRD 4IFDH 3C1FA 1WCMH 2UXBQ 1RDPD 2J4XA 3ULLA 4GN3B 2Y0SB 1A3TA 1GVPA 4C2MB 2ZTCA 1CA6A 3D4DA 5C3EG 5EPKA 2K75A 1A8VA 5JVG3 3FKIH 3GTOB 2AWOA 3HKZG 1R9TB 4G57A 1AFPA 1F9PA 3AFQA 2K52A 3JAML 3TS0A 5K36H 1A3UA 1ESFA 4DR7Q 1KLUD 2JXMB 3DWAA 2ZJPA 1HR0L 4JBMA 1HTLD 4RGTA 2EXDA 1LT6D 5JVH3 4GKKQ 3PUVA 4RH6A 3GTPH 3AFPA 2L11A 3PUZA 4OIKA 3VYRA 2KHIA 2RDGA 1JJCB 1H95A 1EY9A 4IPCA 1B53A 5CGKA 2JA8G 1U5KA 4TQUS 5DNFA 1ET9A 3I70A 4JCVE 4DR3L 2IWHA 3KK7A 4EGVA 2JA8B 2K5DA 3KDFB 4AIMA 2PZWA 4GLAC 3RZDH 1YI2A 1UE6A 1YNJD 2OWOA 3I4LA 2I46A 2IJ0A 4ZRZA 3J7A5 3S1RH 1SE3A 2EY5A 1DZ1A 3KYHC 2LMCB 2F0SA 1GJXA 5M3MH 4HJ8A 3PF5A 1TWFB 4RCOA 1WTXA 4CJ1B 1E0BA 3NSWA 2B2UC 1PH1A 3VR6A 2DJGC 4XIGS 3NQTA 4OGQC 3ZJYC 1RTNA 1LTBD 1PFBA 2K05A 4BXXG 1JMCA 2KQ3A 4JI1L 2VL6A 3PO2G 4A3GG 1F2ZA 3S16B 2FHTA 2F0FA 1Y8PB 1A2TA 1DOLA 3BZKA 4DF7A 1MSGA 1M90C 3OIQA 1XNRQ 1AE2A 4PZ8A 5M5XB 1HR0Q 1WJJA 2QDBA 4GNXC 2NVYH 5I6WA 2A74C 4DK1A 3E0EA 3IFTA 1N36L 1K9MC 3H6MA 1SMYD 4M1UB 2TSSA 3B6YA 4ZUIA 4YY3L 1K83H 2SNMA 2ATWA 3RZDB 2GVAA 1BVSA 5JOBA 2K03A 2ZXOA 1HR0W 4A3LG 5CR3A 5GAEC 4OO1G 3HG9A 1N33L 4DN4M 1L1OB 1ONLA 5A2QL 1KXLA 1HNXQ 5LMNL 2BA0A 1FJGL 2X6GA 4LJZC 4DK3C 1UE7A 3PF4A 3S1NH 1R9TH 1PTOH 2A8VA 3NHHA 4R8NA 1M1KC 4N9PA 3NBHA 2F4VL 3KF8B 1S5DD 1PMRA 1S5ED 3EQLC 5EBCA 4UP9A 4A76A 4JI6Q 4DR3Q 1AE3A 1FNWA 5CV4A 4DXGA 4EQPA 1FGUA 1XTDA 1TWHB 1KRSA 1L1OC 2IT1A 2JA6B 3I4MH 3H15A 2NYZD 5EBDA 2CCZA 1QZHA 3WOEA 4HSVA 2EY2A 1XTCD 1E2WA 2C35B 4MZ9A 2F4IA 2MO1A 5L37A 4OHJA 4FP5D 4A3BH 1BDOA 4A3FB 2AQ3B 2NZOA 1SNCA 4P72A 4A3CG 2UU9Q 1II3A 3K57A 1KL9A 5E4XA 1ZKOA 1BQQT 1HPCA 4H44C 3KDFA 3PV0A 2HDLA 3GTLB 5FOBB 1GUGA 1K8GA 1GUTA 2K1BA 1PTOF 3KBGA 3HOZH 2KVMA 2AQ1B 1UEBA 1L0XB 3GO5A 2CQAA 2Q2TA 1C7YA 1B50A 4ILWA 4A3BB 2KENA 1SNDA 3G6EA 2PMZE 3MC0B 3D4WA 1GO3E 3K81C 2PYKA 2QILA 3M3YB 2LFNA 5M5YB 3AEVA 4C3JH 1X54A 3G6JB 3HZXA 2UXDQ 4DAVA 1KLGD 4RKLA 3FPPA 1HQMC 1HUMA 4LFAQ 3H3VH 1N34L 1E22A 2R93B 3CXCA 4BY1H 3DEOA 2R61A 1QVCA 1N32Q 3TSSA 4R8IA 1WVLA 1YNND 1NCVA 3LWEA 5DM73 1PTOB 1CA5A 1PYBA 2E5LQ 4JI8Q 2R92G 1TWGB 4ME3A 4X3SA 4FF2A 1KDCA 4CDFC 2K28A 4B3ML 3KUPA 1HRJA 3TP5A 4GNXB 1LT3D 1IL2A 2HHHQ 3S2DH 2MPMA 4JG2A 5C4XH 5KYIA 4PMWA 3K5NA 1JT8A 2CQOA 5EPJA 3W1BA 5C0XG 4UDUC 4IUNA 3GTGB 2O2LD 1K0SA 2EY1A 2YTYA 3GQBA 1SRUA 3L9AX 2NUCA 2EYMA 1QUQB 4UPAA 4MN3A 3K0YA 3NTIA 4CJ0B 2F3WA 5GAHC 4V190 4F88A 5IGCA 1EIHA 4FDBA 3H0GG 1DOKA 1I4PA 3UE0A 4BWGB 2NVYB 5LMNQ 2VB3X 4DV3Q 4OWTB 4LUZA 2F0EA 5C4ZA 4BA1I 1B4OA 2F0TA 2F3VA 5E7NA 2CH4A 3HGBA 3KF8A 3U9OA 1CM9A 1D7QA 3L0OA 1JORA 1DYQA 1O7ZA 4NKLA 2MP1A 4CBVA 4GKKL 3AU7A 1H9MA 4B3TQ 1B3AA 2NZ1D 1J5EL 1WTHA 3HOYH 1EZ6A 1J5EQ 4DV1Q 5M3FG 4X6AH 1VS0A 5M5XH 3H09A 4X64L 1A15A 3TMEA 2ES2A 1GUWA 3ERQA 1LTTD 2BE5C 1ENAA 4WORA 1VMCA 2B63B 1VQAA 4K6LA 3Q22A 1XJVA 5I6YA 3I7FA 2LY7A 5IP9G 1TS3A 2F0QA 3KLSX 4PV1C 1NTGA 5LL6X 1BKBA 1LTLA 2B39A 1LV9A 1HA6A 4LF6Q 3GTQB 4BY1B 4DUZQ 4JI2L 3E6ZX 4ULLA 4YCUA 1G51A 4XQQA 1IBLL 1FGBD 1PYSB 4L8JA 2DGYA 2A6EC 1KNAA 2F0UA 2F0IA 3FMCA 2ZTDA 1VQIA 3H91A 3S1RB 4CDDC 4DV6L 3PMFA 2VNUD 3QOLA 4Y52H 2BE5D 4DPGA 5A2QE 4LFBQ 1TS5A 3A5UA 3M3YH 3WWVA 1BOSA 1T9HA 2DJFC 2KA7A 3DXJC 5IGGA 1MIUA 1PRTF 4NXMQ 4JI6L 3STBC 4HN7A 2NZHA 2JA8H 3BZDB 5D3IB 5NUCA 3HOWG 3I4NB 3KLWA 4NPSA 3CRLC 3HOVB 4BY7H 5CC4A 1ICFB 2EJMA 2KJXA 1I94Q 2FMMA 3NENA 5K36G 3IKJA 1QVGA 3NTKA 1Z7TA 2K32A 3GV3A 5LL6S 2K6AA 3OIPA 3HOXH 4IUUA 1N34Q 4ABNA 4M8AA 1W2BA 3CPFA 2K14A 4IJHA 1UE1A 5G3LF 2VB2X 2KECA 4H7BA 2UUAQ 2UUBQ 1A6XA 4JI7L 3PO3G 1VQDA 2H5XA 2EJFC 2IX3A 2WACA 1JOQA 1Y1VG 1XMOQ 1VQPA 2FMCA 3I3CA 1EU4A 2A5HA 2WB1E 2OTJA 4X3UA 2NTTA 1S72A 1X3FA 2WINB 2KEDA 2HIXA 1D2BA 4I65A 2ASBA 5GAGC 2VQEL 1JE4A 1F2LA 2B3GA 3HOXB 4LFCQ 4NXNQ 1KDBA 1SE4A 5IGEA 3H94A 4AQYL 4DR6Q 4IQZA 4HIDA 2R93G 4K6DA 3NWSA 4Z9CB 4K14A 1LACA 4JVZA 4LW1A 1SMYC 4J8QA 3I56A 3RZOH 1SNPA 1D6EC 1C4QA 4LFBL 2I5MX 4FXGC 3S1QH 3GDEA 2A68D 1JOOA 1RF2D 3T1HQ 3S1QB 3DMUA 1LTAD 1VQHA 2L0CA 1ZXTA 2PZUA 4AYBE 2MGSA 1NMFA 1V43A 1STBA 2O5JC 4U673 5DEHA 4FF4A 1X55A 4OELB 3M4OH 2JA7B 3I8ZA 4QQBX 1CI3M 2UUCL 2K7VA 3J80L 3S14B 3ONAB 1VMPA 1TR5A 4X66Q 1S4ZA 4OX9Q 1CK1A 2F0JA 3J81i 2PO4A 2YV5A 2K01A 3TP8A 2JA6G 2PI2E 3K7UC 4WJ3M 5C0XH 3M4PA 4HJ9A 4BBSG 4LWCA 1B9MA 2ICIA 4X64Q 3I4NH 2J0TD 1DGSA 4XQJA 4LF5L 4K5VA 3D6CA 1KDAA 4WRDA 3ERSX 5FO9B 5IIFA 4FF1A 3PSIA 1EU3A 1LM0A 1H9SA 5CBAE 1MJCA 4Q0FA 2JEAI 4R1JA 4GOPC 3UE1A 3OHXC 1P16A 5ELEA 2A6HD 1RL2A 2A6HC 1KABA 3K5OA 2Z6KA 4F8MA 5C0XJ 3GTMH 2IL8A 1FYCA 4K8IA 2EZVA 1WD1A 2QDLA 1QJOA 4R9WA 4PZ6A 1Y8OB 5KNDA 3MXPA 3OTOQ 1XPRA 2A69D 5EKLA 4A3EB 1HHVA 2VY3A 4A3JG 1AZQA 1JQYD 2WAQG 3CCEA 3SEBA 3F8TA 4KHZA 2E76C 2RCNA 2K5WA 5KNBA 3CF5A 3HOWB 2IY5B 2UXCQ 4IALA 4A3JB 4DFAA 2L9HA 3SK6A 4GOPB 2D2CC 4L6TB 5FJ8H 2WAQB 1NNXA 1IBML 3HOUG 4KD3A 1AN8A 4KHPL 3FP9A 2XNAC 4GLVB 2EXZA 1WTRA 5FK9C 1SYCA 3W1GA 1IW7D 4CHTB 2E2IH 4UHVA 5KNCA 3PIPA 1PH8A 3F1ZA 2B63H 1NR4A 1QWYA 1VQNA 4DR4Q 2YTXA 3BDOA 5JEAJ 2ID0A 2UUAL 5HURA 1E1TA 3DUZA 4JPBW 2FINB 2PZTA 3DHQA 4HIOA 4N9TA 1EEID 2B2TA 1PH7A 1A3VA 3BVMA 2E2HH 1Q7YC 3U4ZA 1NBWA 2MUYA 3QIAA 1HFGA 2ENBA 2XVSA 1U9RA 4JI1Q 2IHFA 1SBBB 3HOWH 2NVXB 1DOMA 2F0VA 5A35A 1IYJB 5JEAH 2F0KA 3JC66 3LGJA 4C3IH 5IP7G 3AB9A 5M3FB 5T1IA 2LXKA 3S2DB 1N32L 1TT2A 4A3EH 3U9SA 1WD0A 1HNWL 5IGFA 4C2MH 4DK0A 5LHY1 2PCFB 2WIIB 1Y1VH 2R93H 3NXWA 1S5BD 1EY5A 2EYOA 2V4DA 1ML0D 1AP0A 1BXTA 1QUQA 1LABA 3DWQA 5GROA 2F0OA 3K58A 3PO3H 2VQFL 4WJWA 4GNXA 4LF7L 4K0KL 4JI0L 3A8IE 1ILPA 4IO9A 4RFBA 2R92H 1BO0A 1TWGH 2B2VA 4LMQD 4YWKA 1JB3A 2B2TC 1BBWA 1EYGA 3H0GB 4KD4A 1HNZL 4R4QA 3TBIB 1JWUD 4FXKC 4KY5A 1Q1EA 4JBWA 3BZCA 2A69C 3HOZB 3N52A 2OEOA 4A75A 1OTCA 1TWCH 3EA6A 1CKOA 3NK9A 2Y0SG 4IPDA 3I4MB 4A3KG 2UXDL 1X3GA 1ENFA 2B29A 3VA5A 1B70B 1EUJA 4G4KA 2N3SA 2P5ZX 3H0GH 1XNQQ 4YWLA 4BBRH 3BJUA 5BN4A 1HCZA 1NE3A 3S17H 1CUKA 1RD9D 5IYCH 3FKIG 1SFOH 4DR1Q 1LT5D 1LUZA 2ICEC 3M4YA 2EYHA 1TS2A 4JI5Q 1TWHH 2EVBA 3M9BA 4KMUC 3HS0C 3CC4A 1DXMA 1VQ4A 5GQOA 3TREA 1MKHA 1PFNA 2CHBD 1Y1VB 5ELBA 1KTKA 4R4IA 4Y7NH 1YHBA 3BU2A 4RGMA 3VR2A 2OT2A 1X6OA 2SEBD 4GKJL 5LMUQ 3MWYW 1KAWA 2NVXH 4IURA 1YHQA 1CT1D 1HTPA 3E9IA 1EY4A 3RLOA 3M85A 3E0JA 2ZM6L 2ZJQA 1TWAH 1E2ZA 3PIO3 1WYDA 1STGA 3CCLA 1VQ7A 4A93H 3GTJH 3S9WA 4DV4Q 3MZ5A 3TP6A 1BR9A 1SE2A 2KCMA 4EX5A 4DR7L 1J6QA 1RJTA 3NE5B 1XNRL 4IUVA 5JJIA 4KJNA 3CCRA 2Q8TA 2E2HB 1I4RA 3HOVH 5M3MG 4AH6A 1IBKL 1EWCA 2K33A 3NPPA 3S1NB 2BCOA 2QF7A 1CHQD 1YHAA 1KC8C 4APVA 3R93A 3ICEA 5G3LD 4OONA 3T56B 1F2YA 3CW2C 5ELDA 5M3MB 3BG3A 2I5HA 1YZ6A 5D65A 2JP1A 1I50B 2N88A 5JJLA 3HOXG 4C3HB 4OXPA 4JI5L 4B9XA 5M5WH 4HCSA 5M9OA 1E1OA 1Y1WG 1L2FA 2G9DA 1K3BC 3CMAA 2AUJD 1HXYD 3NTHA 5KIXA 1UWVA 5FO7B 2K50A 4DAYA 1GUSA 3J81E 1UE5A 4B3MQ 4RAUC 4IFDI 3CU7A 2F0NA 1DM0B 3K5MA 3O13A 5EAYA 1STEA 4TSSA 1Q86C 3GV6A 4KJOA 5C3XA 1JC7A 1Z9FA 3K7AB 1M8AA 1GHJA 3C2PA 4B9WA 1D1IA 4A3IG 2IX0A 3T53B 3A5ZB 4NXML 1A2UA 3GTMB 3HKZB 3VYUA 1JJGA 1SYDA 3FDTA 2QW7A 1PTOC 4UP8A 4LK1C 2EOTA 1EFWA 3NELA 1PHJA 2VUMH 3V2TA 4F87A 3D3RA 1I3QH 3HOUB 1R4PB 1RKNA 4IOCA 2E5LL 4RA8A 4XXEA 4A93G 3FKIB 3A0JA 1SN8A 2F3IA 2IHEA 3DLLA 1YBYA 1STYA 2SDFA 3I4NG 1OXXK 1I4GA 1PRTB 4DK6C 1SSOA 2Y0SE 2K5VA 3GTJB 3FHWA 5IGBA 3J7AV 5IYDH 3I4MG 4DR4L 3CP0A 4A3CH 5FLMH 4JYAQ 1IKLA 2IW3A 2X6LA 4RG1A 1EYDA 1I5FA 1RHPA 2WKDA 4XQNA 2JA7H 3V96A 1Z6HA 1UAPA 1EY0A 4JI2Q 4DUZL 2B2VC 1BBXC 4B08A 4ZAIA 4KHVA 1VQEA 2HIVA 4DAMA 1PH5A 5I9PA 1CQFA 3CRKC 2A73B 1H9SB 3A7LA 4EVOA 1G8ZD 2L1BA 2CW0D 2Q2UA 4LF4Q 3GTOH 1P8LA 4L5QA 2LXJA 2FFKB 4KV6A 1SFOB 1TKWB 4NW2A 3A8JE 2LKVA 3UDXA 1X9NA 2E2JB 4BS9A 2KUMA 3CAMA 2QGQA 1CKNA 1U0LA 4DR2L 4R4TA 1WCMB 1YJ9A 1EEFD 3CQZB 1PZID 4DV4L 3OSOA 3HKZE 1V9PA 2Q2HA 1EY6A 1EYAA 2B8FA 3CC7A 2L55A 3RLFA 3MAQA 3CC2A 2F0WA 1GHKA 4IPHA 1V1QA 1DCZA 2G9HD 3E3XA 3TZUA 1HZAA 3ND8A 5ELFA 1NMGA 4ID6A 5C3EH 1BCPC 3QR8A 2VZAA 1MI2A 1SJED 3IRBA 2GN5A 4L5TA 2PPBC 1EQTA 3BVGA 3LNNA 1EYCA 1UNSA 1X3QA 5HGQA 2Z9HA 4JC0A 2YTVA 3GTKB 5FLXc 2K5HA 3N6RA 4HCEA 3U4VA 3G71A 3QG1A 5FJ8G 4HAEA 3D31A 2PQEA 3G4SA 1H9JA 4LF6L 1Q3LA 3OMGA 4UP7A 2JEBI 4ZYSA 4X62L 4E6IA 4A3GH 4IFDJ 1CFMA 1NAPA 1UUPA 2OF1A 2K5NA 2KOLA 4OWXB 3S1MB 5C6AA 5J1ZA 3BDCA 4KTAA 2R6GA 3J81c 1LTID 3T1YQ 5CV7A 1Q90A 5IWAL 5IWAQ 2UUCQ 3LWUA 1F9QA 4JV5L 4B3TL 2K5QA 5FO8B 4XDXA 1I4HA 3S15H 1DD2A 1K8AC 1N36Q 4CJ2C 1GUOA 1V8QA 3SHLA 2WKCA 3C1EA 4ZCKA 1VQ8A 3SDZA 4ME5A 5K5PA 2K04A 1C9OA 4DGZA 4JYAL 5BN5A 1GM5A 5KGUA 2JA5B 2UXBL 5IP9H 5IE8A 3VR3A 5BR8L 5DM63 4IFDG 4RWSC 5M3FH 2PW5A 2WP8J 1B1ZA 4FNFA 1OXVA 5KRUA 2XGTA 1QNKA 3HRZC 4LF9L 1VQBA 1LYLA 4J15A 1PLFA 3TRZA 4A3JH 4A3MG 2VS1A 1EIFA 5E4WC 1K83B 1EY8A 3RN5A 4POFA 4DV7L 4S3SA 1JR0D 1IZ6A 1VQKA 4UY8C 4LF8L 3KLRA 4I7AA 4LF8Q 3STBD 2NVQH 2VUMG 4ODGA 1MHWC 4FYDA 2DUDA 2B2WA 4BBRG 2EYLA 4BXXH 1V1PA 5C4JB 3SVMA 3J7ZC 1RIPA 2Q2IA 3TDQA 1O7IA 1Y69U 2A1AA 2E8GA 4L5RC 2VQFQ 1HH2P 3PIP3 2R3ZA 1HJPA 3MEFA 2VW9A 2JN4A 1PRTC 1TWFH 1VF7A 1WTVA 5CORA 1EIYB 2IPKD 5AFWA 5EGTA 5C44B 1SNMA 3U58A 1MBYA 1Q8IA 5EKIA 5ELOA 2AWNA 3JAME 1NY4A 1EWHA 4DV2L 5E3FA 3SE0A 1IBLQ 4H0LC 2NB0A 4LUVA 2KCTA 1U4MA 3W2DA 1G2SA 3OTOL 5JAVA 2RSNA 4KY6A 4C3JB 1PXUA 4ZLTF 2EPBA 1ASZA 2G5DA 2Z4IA 2E75C 4FO2A 2XRQD 1QILA 5J3BA 1E7ZA 5BN3A 3RD4A 4A3DH 3AYHB 3J7AF 5IYBH 2N49A 1HZCA 1V1OA 1K28A 1XWEA 4JK1C 3ITPA 4QIWB 3NQIA 5FLXE 3R2TA 3MA2B 3CQZH 4GOPA 1KNEA 5H1SE 2EYPA 4KLKA 1WTPA 1VF5C 5I2YA 1YITA 1TVXA 1WOCA 2QCPX 4WJ4A 3A74A 5EQ0A 3CKIB 1Z47A 3S24A 1U4LA 3C46A 2E2JH 3FVQA 2HCIA 3BVZA 1G6PA 1A0IA 3H3VC 2JJQA 4QCLA 2JA6H 5GADC 2OTLA 5C4XG 2UXCL 2EYJA 2A19A 1RODA 3KFUA 2JK8A 5EJWA 2R7FA 2F0GA 2F52A 4A3KB 3J81j 1AZPA 4A3BG 1KD1C 4PNYA 2EE1A 1EIGA 2NBFA 4BBSH 2WV6D 1YEZA 4B3SL 1K3RA 3SR1A 2RVLA 4KK7A 1TY2A 4QGUA 1H9RA 1X32A 1SYFA 2HQLA 2PW7A 3BYTB 2RHQB 4AQYQ 4DR6L 2VXWA 1SNOA 4ZKCB 4MTNA 1JJ2A 1OXSC 3OWFA 1I94L 3RMHA 3M7GA 2AUKA 4DV0L 1F2MA 1HZBA 1IW7C 2HQEA 2CFMA 3T13A 4HJ5A 1IBKQ 1J8IA 5JJZA 3PUWA 1UEAB 3T1YL 1SYGA 1W6JA 4RGNA 5JJKA 3D4RA 1B44D 2BA1A 4NB3A 1B7YB 3I90A 5ISRA 4DV1L 1BCPF 4YHHQ 4A3MH 4X3TA 2N55A 5I4DA 1OO9B 4X65Q 2ZXRA 1KRTA 2DY7A 3VYSA 1IKMA 4HMIA 4JOIC 1JOKA 1YJNA 3EIVA 3I55A 4IUPA 4CDEC 1V1PB 1VQJA 1A62A 5FLMG 1I3QB 1EL0A 1EWIA 2JA7G 5CMDA 3NP8A 2R7ZH 5ELNA 4EQOA 3BDLA 4OEMB 3MEHA 2WB1G 1PZKD 1I4QA
chains in the Genus database with same CATH topology
1O7LA 2DY8A 2J7ZA 4CKBA 2Z8LA 3L3OC 3C3LA 5CV9A 3MFGA 4J6HA 5D14A 3EFXD 3OWEB 1X3PA 1EOTA 1CHPD 5IGDA 2Q8IB 3Q6SA 5FLXL 3EROA 4I7ZC 2RKSA 1AEXA 3D8GA 4C3JG 3FRPB 5IOCA 1JWSD 1G91A 4KKSA 4DAPA 1G6ZA 1WTOA 2F0DA 4J1MA 2EYFA 4RHRA 2SNSA 3MTSA 1PFMA 1WTWA 3GD7A 2M9VA 1T5EA 2NVTB 1ENCA 2NWGA 3QWNA 4TRDA 4Q5VA 2BOSA 2NVQB 1IYVA 1BCPD 4IN3A 2F03A 1TU2B 1KAAA 4ZUJA 4C1NI 4MHEA 1D1KA 3MXUA 5T1GA 4K8JA 3I72A 1J9OA 3I73A 3OMCA 1TWAB 3R8BA 4CGYB 3GTPB 1XX8A 1O7YA 1L0YB 2X69A 2ZT9C 2CVRA 2NN6H 3Q24A 3UI2A 1CZGA 3MHBA 4AYBB 1QB5D 4G7ZC 1C48A 3SK8A 2ZXPA 4K2KA 1E2VA 1LTGD 5CV6A 4K5XA 4XYQA 4F7XA 4HTHA 4HEDA 2RSOA 2KCNA 1Y8NB 3Q23A 2RDHA 2KHSA 2EDGA 1PDQA 4PQXA 1FD7D 4ZQ3A 1FNVA 1I4XA 5CV5A 3MVVA 4DA2A 4FXDA 4LAAA 2TMPA 4KI0A 1RCVD 1CTMA 2XIWA 4IUTA 1BUVT 2O4XA 2WB1B 4IZ8A 3S17B 3T16A 3S2HB 3QB3A 1PTOD 4FVMA 2F1MA 4XTCS 4CKEA 5C3EB 2D9UA 3BYYB 3OW7A 4G7HC 2XWJB 1O78A 1MSHA 3VYTA 2YYZA 2R92B 4K5WA 2D62A 2RBMA 2B8GA 5IT9L 4NDXA 5KEEA 5C5LA 1ESRA 3DWPA 4OIJA 5E1FA 3P20A 4HMJA 1U4RA 2E2DC 1ZYRC 3VR4A 4PMCA 2Z4HA 1LTSD 3A8KE 1O80A 1TS4A 2QKIC 2SOBA 1D5ZC 3IAYA 5I2XA 3BS1A 1PYWD 2MJ8A 1WTQA 1B9NA 1FR3A 2KCCA 1JICA 1RTOA 5JEAG 1HQRD 1SEBD 1SXTA 2HUGA 4QMGA 1K8MA 2XSCA 2BDOA 2JSOA 3W3AA 3SK4A 2NTSA 2M2LA 3HP3A 3I91A 3FEWX 2E2IB 1DJRD 3SK5A 3NBIA 1SYBA 3DEPA 3MXNA 1XXGA 3DM1A 2C9OA 2BDNA 1G2TA 2L12A 1BNZA 4WFN3 4EQNA 5EKKA 2F0MA 4NP5A 1T5XD 4KY7A 2MHVA 3QOJA 2D5DA 3S15B 2R7ZB 5FKAC 4O42A 1IL8A 1NR2A 3VA7A 3A54A 5C0XI 2AQ2B 1F9RA 4XT1B 2F0LA 4QUCA 4C3HG 5M5WB 5J22A 4HR7B 1G291 1I6VC 2A6ED 2XN9C 3KLSA 1CQVA 1PRTD 2C5CA 3E5SA 4C1NK 5I9OA 2NN6I 1Q12A 1QOHA 1STNA 2O5IC 4RGOS 3TZDA 2H4OA 2L4NA 4DNTB 1Y1WB 3LX0A 3GP7A 5IT9E 3J81L 2B2WC 3WOFA 3M4OB 5CV8A 1GXDC 3P1HA 3RUZA 1TY0A 1HA5A 4YIJA 1SAPA 5F2DA 1C8CA 3EVQA 3G7LA 2B2UA 2LS01 3X3MA 1ET6A 1STAA 4A93B 4UAIA 1S5CD 2RA4A 1EZ8A 4BBSB 3RZOB 3A55A 3TN2A 4Y7NB 4CKCA 1JCKB 4RKBA 2NN6G 1ZEQX 1NUCA 1AW7A 1MGSA 1GOZA 2XWBB 3A56A 2FJ2A 4KKUA 4KKTA 4A3IB 4RCNA 3PUYA 2Z1CA 2EJGC 1SNQA 1DONA 2KEEA 1D5MC 4RHSA 4BA2I 1LLRD 5DAUA 1YNNC 4OO1H 4XT3B 5J39A 3CHBD 4V0BA 2E74C 4OL7A 1ZYRD 1F77A 1IHZA 1M4VA 4BBRB 2QEJC 3F2UA 5JPNC 4BY7B 3NWTA 4K2LA 1PZJD 3T4AC 3R2IA 4QF4A 5D3DA 4A3DB 1Q1BA 3P75A 5KYLA 2VUMB 5IODA 3V05A 2DN8A 2PNRC 3OPOA 1BCPB 1STHA 3PO3B 1CZWA 3IL8A 3MXGA 1QNUA 2DNCA 3T51B 4NMZA 3KBXA 5CYUA 4KN4C 2H1EA 4ZKBB 4DU9A 1HUNA 1F9SA 2I07B 4C3IB 5C4HA 3J7YW 2M00A 4OO1I 1IYUA 2JE6I 2DNEA 3K6OA 1OXTA 4IUQA 1B2TA 2CW0C 5HGTA 1VCIA 3MFYA 3X3NA 2RDFA 4X3KA 4DXFA 1QG7A 3EJIA 1EQVA 2HCCA 5C3WA 3J80E 1VDZA 1I6HB 1TIID 2EY6A 3HOYB 5C4XB 1XYIA 1HFNA 1SYEA 1QE6A 3A7AB 2F0PA 3QO2A 4FF3A 3URYA 4H13C 3Q0AA 2L5TA 2F0HA 4P2CB 1BF4A 4QB4A 1LO5D 3HEJA 1EFID 2A68C 2JYOA 3SXHA 1U4PA 4TKOB 1D5XC 3IFDA 3QJYA 4DNRB 3VR5A 3ND9A 3K59A 1EY7A 3K5LA 3AMUA 2GA4B 1TQOA 1K8OA 5ELCA 4C56C 1R4QB 5COYA 5JPMC 3R3OA 4MIUA 2PMZB 3ZYYX 1SDFA 4GZYC 4PMBA 4ZK9B 4KN7C 5EPLA 4G7OC 4U68A 1W6KA 1ILQA 1JWMD 5CBEE 2XRSD 2IX1A 3TP7A 2B2YA 4A3GB 5TSSA 3WDNA 2YU9B 3D6WA 3M7NA 4C3IG 1LT4D 4XYOA 1MD2D 3FPUB 2HDMA 4A3MB 2B2YC 1ICWA 1H9KA 1YNJC 1TWCB 1QCBD 3P7JA 2RQXA 4O1NA 4HSPA 3PO2B 1OXUA 1FNUA 1SJHD 3OOCA 3NUCA 5C5MA 4L63B 2OXPA 1GUNA 1NSNS 3L7ZC 2Q8RE 4QUFA 1S5FD 3PUXA 4IFDH 1LTRD 3C1FA 1RDPD 2J4XA 2Y0SB 1A3TA 4C2MB 1CA6A 3D4DA 5EPKA 5JVG3 3GTOB 2AWOA 1R9TB 4G57A 1AFPA 1F9PA 3JAML 5K36H 1A3UA 1ESFA 1KLUD 2JXMB 3DWAA 1HTLD 4RGTA 1LT6D 5JVH3 3PUVA 4RH6A 2L11A 3PUZA 4OIKA 3VYRA 2RDGA 1EY9A 1B53A 5CGKA 4TQUS 5DNFA 1ET9A 3I70A 2IWHA 3KK7A 4EGVA 2JA8B 2K5DA 2PZWA 1YNJD 3I4LA 2I46A 2IJ0A 4ZRZA 1SE3A 2EY5A 1DZ1A 2LMCB 2F0SA 1GJXA 1TWFB 4RCOA 1WTXA 4CJ1B 1E0BA 3NSWA 2B2UC 3VR6A 4XIGS 3NQTA 4OGQC 1RTNA 1LTBD 1PFBA 2K05A 2KQ3A 1F2ZA 3S16B 2FHTA 2F0FA 1Y8PB 1A2TA 1DOLA 4DF7A 1MSGA 3OIQA 5M5XB 2QDBA 5I6WA 2A74C 4DK1A 3IFTA 3H6MA 1SMYD 4M1UB 2TSSA 4ZUIA 2SNMA 3RZDB 5JOBA 2K03A 2ZXOA 5CR3A 4OO1G 3HG9A 4DN4M 1ONLA 5A2QL 2BA0A 2X6GA 4LJZC 1PTOH 3NHHA 4R8NA 4N9PA 3NBHA 1S5DD 1PMRA 1S5ED 3EQLC 5EBCA 1FNWA 5CV4A 4DXGA 4EQPA 1TWHB 2IT1A 2JA6B 2NYZD 5EBDA 3WOEA 4HSVA 2EY2A 1XTCD 1E2WA 2F4IA 4OHJA 4FP5D 1BDOA 4A3FB 2AQ3B 1SNCA 1II3A 3K57A 5E4XA 1ZKOA 1BQQT 1HPCA 4H44C 3PV0A 2HDLA 3GTLB 5FOBB 1GUGA 1GUTA 2K1BA 1PTOF 3KBGA 2KVMA 2AQ1B 1L0XB 3GO5A 2CQAA 1B50A 4ILWA 4A3BB 1SNDA 3MC0B 3D4WA 2PYKA 2QILA 3M3YB 2LFNA 5M5YB 3G6JB 3HZXA 4DAVA 1KLGD 4RKLA 3FPPA 1HQMC 1HUMA 2R93B 3DEOA 2R61A 3TSSA 4R8IA 1WVLA 1YNND 1NCVA 3LWEA 5DM73 1PTOB 1CA5A 1TWGB 4X3SA 4FF2A 1KDCA 2K28A 3KUPA 1HRJA 3TP5A 1LT3D 2MPMA 5KYIA 4PMWA 3K5NA 5EPJA 3GTGB 5C0XG 4UDUC 4IUNA 2O2LD 2EY1A 3GQBA 3L9AX 2NUCA 2EYMA 4MN3A 3K0YA 3NTIA 4CJ0B 2F3WA 4V190 4F88A 5IGCA 1EIHA 1DOKA 1I4PA 4BWGB 2NVYB 2VB3X 2F0EA 5C4ZA 4BA1I 1B4OA 2F0TA 2F3VA 3HGBA 3KF8A 3U9OA 1CM9A 1JORA 1DYQA 1O7ZA 4NKLA 2MP1A 4CBVA 3AU7A 1H9MA 1B3AA 2NZ1D 1EZ6A 3H09A 1A15A 3TMEA 1GUWA 3ERQA 1LTTD 2BE5C 1ENAA 4WORA 1VMCA 2B63B 3Q22A 4K6LA 5I6YA 2LY7A 1TS3A 2F0QA 3KLSX 4PV1C 5LL6X 2B39A 1LV9A 1HA6A 3GTQB 4BY1B 3E6ZX 4ULLA 4XQQA 1FGBD 4L8JA 2A6EC 1KNAA 2F0UA 2F0IA 3FMCA 3H91A 3S1RB 3PMFA 2VNUD 3QOLA 2BE5D 5A2QE 1TS5A 1BOSA 2KA7A 3DXJC 5IGGA 1PRTF 4HN7A 3BZDB 5D3IB 5NUCA 3I4NB 3CRLC 3HOVB 5CC4A 2EJMA 2KJXA 2FMMA 5K36G 3IKJA 3NTKA 1Z7TA 2K32A 3GV3A 5LL6S 2K6AA 3OIPA 4IUUA 4ABNA 4M8AA 5G3LF 2VB2X 2KECA 4H7BA 1A6XA 2EJFC 2IX3A 2WACA 1JOQA 2FMCA 3I3CA 1EU4A 2A5HA 4X3UA 2NTTA 2WINB 2KEDA 1D2BA 4I65A 1JE4A 1F2LA 3HOXB 1KDBA 1SE4A 5IGEA 3H94A 4IQZA 4K6DA 3NWSA 4Z9CB 4K14A 1LACA 1SMYC 4J8QA 1SNPA 1D6EC 1C4QA 4FXGC 2A68D 1JOOA 1RF2D 3S1QB 3DMUA 1LTAD 2L0CA 1ZXTA 2PZUA 2MGSA 1V43A 1STBA 2O5JC 4U673 5DEHA 4FF4A 2JA7B 3I8ZA 1CI3M 2K7VA 3J80L 3S14B 3ONAB 1VMPA 1TR5A 1S4ZA 1CK1A 2F0JA 2PO4A 3TP8A 2K01A 5C0XH 1B9MA 2ICIA 2J0TD 4XQJA 4K5VA 3D6CA 1KDAA 4WRDA 5FO9B 5IIFA 4FF1A 1EU3A 5CBAE 1H9SA 4Q0FA 2JEAI 3OHXC 5ELEA 2A6HD 2A6HC 1KABA 5C0XJ 3K5OA 4F8MA 2IL8A 1FYCA 4K8IA 2EZVA 1WD1A 1QJOA 4R9WA 1Y8OB 5KNDA 3MXPA 2A69D 5EKLA 4A3EB 1HHVA 1AZQA 1JQYD 3SEBA 4KHZA 2E76C 2K5WA 5KNBA 3HOWB 4IALA 4A3JB 4DFAA 2L9HA 3SK6A 2D2CC 4L6TB 2WAQB 4KD3A 1AN8A 2XNAC 2EXZA 1WTRA 5FK9C 1SYCA 1IW7D 4CHTB 5KNCA 1NR4A 1QWYA 3BDOA 5JEAJ 2ID0A 5HURA 3DUZA 2FINB 2PZTA 3DHQA 4N9TA 1EEID 2B2TA 1A3VA 3BVMA 2MUYA 3QIAA 1HFGA 2ENBA 2XVSA 1U9RA 1SBBB 2NVXB 1DOMA 2F0VA 5A35A 5JEAH 2F0KA 3AB9A 5M3FB 5T1IA 3S2DB 1TT2A 3U9SA 1WD0A 5IGFA 4DK0A 5LHY1 2PCFB 2WIIB 3NXWA 1S5BD 1EY5A 2EYOA 2V4DA 1ML0D 1AP0A 1BXTA 1LABA 3DWQA 2F0OA 3K58A 4WJWA 1ILPA 3A8IE 4RFBA 1BO0A 2B2VA 4LMQD 1JB3A 2B2TC 3H0GB 4KD4A 3TBIB 1JWUD 4FXKC 4KY5A 1Q1EA 4JBWA 2A69C 3HOZB 3N52A 2OEOA 3EA6A 3NK9A 3I4MB 1ENFA 3VA5A 4G4KA 5BN4A 1HCZA 1RD9D 1LT5D 2ICEC 3M4YA 2EYHA 1TS2A 2EVBA 4KMUC 3HS0C 1DXMA 1PFNA 2CHBD 1Y1VB 5ELBA 1KTKA 4RGMA 3VR2A 2OT2A 2SEBD 3MWYW 4IURA 1CT1D 1HTPA 1EY4A 3M85A 3E0JA 1E2ZA 3PIO3 1STGA 3S9WA 3MZ5A 3TP6A 1SE2A 1BR9A 1RJTA 3NE5B 4IUVA 4KJNA 2Q8TA 2E2HB 1I4RA 1EWCA 2K33A 3NPPA 3S1NB 2BCOA 2QF7A 1CHQD 3R93A 5G3LD 3T56B 1F2YA 5ELDA 5M3MB 3BG3A 5D65A 2JP1A 1I50B 2N88A 4C3HB 4B9XA 4HCSA 5M9OA 2G9DA 2AUJD 1HXYD 3NTHA 5KIXA 5FO7B 4DAYA 1GUSA 3J81E 4RAUC 4IFDI 3CU7A 2F0NA 1DM0B 3K5MA 3O13A 1STEA 4TSSA 3GV6A 4KJOA 5C3XA 1JC7A 3K7AB 1M8AA 1GHJA 3C2PA 4B9WA 1D1IA 2IX0A 3T53B 1A2UA 3GTMB 3HKZB 3VYUA 1SYDA 3FDTA 1PTOC 4LK1C 2EOTA 3V2TA 4F87A 3D3RA 3HOUB 1R4PB 1RKNA 4RA8A 4XXEA 3FKIB 1STYA 2SDFA 1OXXK 1I4GA 1PRTB 1SSOA 3GTJB 5IGBA 3J7AV 1IKLA 2IW3A 2X6LA 1EYDA 1RHPA 2WKDA 3V96A 1Z6HA 1UAPA 1EY0A 1BBXC 2B2VC 4B08A 4ZAIA 4KHVA 5I9PA 1CQFA 3CRKC 2A73B 1H9SB 3A7LA 4EVOA 1G8ZD 2L1BA 2CW0D 2FFKB 4KV6A 1SFOB 1TKWB 4NW2A 3A8JE 2LKVA 2E2JB 4BS9A 2KUMA 1WCMB 1EEFD 3CQZB 1PZID 3OSOA 1EY6A 1EYAA 2B8FA 2L55A 3RLFA 3MAQA 2F0WA 1GHKA 1DCZA 2G9HD 3TZUA 3ND8A 5ELFA 4ID6A 1BCPC 1MI2A 1SJED 2PPBC 1EQTA 3BVGA 3LNNA 1EYCA 1UNSA 1X3QA 3GTKB 3N6RA 4HCEA 3QG1A 4HAEA 3D31A 2PQEA 1H9JA 1Q3LA 3OMGA 2JEBI 4ZYSA 4E6IA 4IFDJ 1CFMA 1NAPA 1UUPA 2OF1A 2KOLA 3S1MB 5C6AA 5J1ZA 3BDCA 4KTAA 2R6GA 1LTID 5CV7A 1Q90A 3LWUA 1F9QA 2K5QA 5FO8B 4XDXA 1I4HA 1DD2A 4CJ2C 1GUOA 1V8QA 3SHLA 2WKCA 3C1EA 3SDZA 4ME5A 5K5PA 2K04A 4DGZA 5BN5A 5KGUA 2JA5B 3VR3A 5DM63 4IFDG 4RWSC 2PW5A 2WP8J 1B1ZA 4FNFA 1OXVA 5KRUA 1QNKA 3HRZC 1PLFA 5E4WC 1K83B 1EY8A 4S3SA 1JR0D 3KLRA 4ODGA 4FYDA 2B2WA 2EYLA 1V1PA 5C4JB 3SVMA 3TDQA 1Y69U 3PIP3 2R3ZA 1PRTC 1VF7A 1WTVA 5CORA 2IPKD 5AFWA 5EGTA 5C44B 1SNMA 1MBYA 1Q8IA 5EKIA 2AWNA 3JAME 1EWHA 5E3FA 3SE0A 4H0LC 2NB0A 1U4MA 3W2DA 1G2SA 5JAVA 2RSNA 4KY6A 4C3JB 1PXUA 4ZLTF 2EPBA 2Z4IA 2E75C 4FO2A 2XRQD 1QILA 5BN3A 3RD4A 3J7AF 1XWEA 1V1OA 4XQNA 3ITPA 4JK1C 5FLXE 4QIWB 3NQIA 3R2TA 3MA2B 1KNEA 2EYPA 1WTPA 1VF5C 5I2YA 1TVXA 2QCPX 5EQ0A 3CKIB 1Z47A 1U4LA 3C46A 3FVQA 2HCIA 3BVZA 3H3VC 4QCLA 2EYJA 1RODA 5EJWA 2F0GA 4A3KB 1AZPA 4PNYA 2EE1A 1EIGA 2NBFA 2WV6D 3SR1A 2RVLA 4KK7A 1TY2A 1H9RA 1X32A 1SYFA 2PW7A 3BYTB 2VXWA 1SNOA 4ZKCB 1OXSC 3OWFA 3RMHA 3M7GA 2AUKA 1F2MA 1IW7C 2HQEA 3T13A 1J8IA 5JJZA 3PUWA 1UEAB 1SYGA 1W6JA 4RGNA 3D4RA 1B44D 2BA1A 3I90A 5ISRA 1BCPF 4X3TA 2N55A 5I4DA 1OO9B 2ZXRA 2DY7A 3VYSA 1IKMA 4HMIA 1JOKA 4IUPA 1V1PB 1I3QB 1EL0A 5CMDA 3NP8A 4EQOA 3BDLA 3MEHA 1PZKD 1I4QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P2C B;  2GA4 B;  2BOS A;  1CQF A;  2XSC A;  1BOS A;  1CZW A;  3MXG A;  1R4Q B;  1DM0 B;  4M1U B;  1QNU A;  1CZG A;  2C5C A;  1D1K A;  4ULL A;  1R4P B;  1C48 A;  1C4Q A;  1QOH A;  1D1I A; 
#chains in the Genus database with same CATH topology
 1O7L A;  2BH8 A;  2JQO A;  3PIO A;  2DY8 A;  2J7Z A;  4CKB A;  2Z8L A;  3L3O C;  3C3L A;  5CV9 A;  2Z6B A;  5DLQ E;  1SR3 A;  3MFG A;  3HOU H;  4J6H A;  5D14 A;  3RNU A;  3EFX D;  3GTQ H;  1QVF A;  3OWE B;  3OW2 A;  3K80 C;  4DR5 Q;  3TQY A;  1VQM A;  1X3P A;  2D0O A;  1EOT A;  1CHP D;  5C44 H;  5IGD A;  2Q8I B;  4DV3 L;  3Q6S A;  5FLX L;  3ERO A;  5C4J H;  3HOY G;  4I7Z C;  2RKS A;  2CWA A;  1Q82 C;  1AEX A;  3D8G A;  2BH2 A;  4C3J G;  3K7A H;  3FRP B;  5IOC A;  1JWS D;  1G91 A;  1XNQ L;  4KKS A;  4DAP A;  1G6Z A;  2MNA A;  1WTO A;  2F0D A;  4J1M A;  1WI5 A;  2EYF A;  5AJ3 Q;  4RHR A;  2SNS A;  1JB7 A;  3MTS A;  1PFM A;  4PZ7 A;  2UUB L;  1GD7 A;  1WTW A;  4B3R Q;  5HY6 A;  4ALP A;  1Q81 C;  4LF7 Q;  4DR2 Q;  4YY3 Q;  3GD7 A;  2M9V A;  3TS2 A;  1T5E A;  2ZTE A;  4A4I A;  4P75 A;  1GKH A;  3KF6 A;  2AMC B;  3J80 i;  2NVT B;  1ENC A;  2NWG A;  3QWN A;  4TRD A;  4Q5V A;  4GN5 A;  2BOS A;  2NVQ B;  1IYV A;  1BCP D;  1I50 H;  4IN3 A;  2WAQ E;  2F03 A;  3CME A;  2EIF A;  1TU2 B;  2JA5 H;  1KAA A;  1C0A A;  4ZUJ A;  4C1N I;  4MHE A;  1D1K A;  3MXU A;  5T1G A;  4K8J A;  3UDF A;  4L5S A;  3I72 A;  1PA6 A;  1J9O A;  3I73 A;  3OMC A;  1TWA B;  3G48 A;  3R8B A;  4BY1 G;  4CGY B;  3GTP B;  5IY0 A;  1XX8 A;  1O7Y A;  1VQO A;  4LF9 Q;  1L0Y B;  2X69 A;  2F4V Q;  2ZT9 C;  2CVR A;  1XPU A;  4A3D G;  2NN6 H;  3Q24 A;  3ULJ A;  3RLN A;  3UI2 A;  1N8R C;  1CZG A;  3MHB A;  4AYB B;  1QB5 D;  4G7Z C;  1C48 A;  3GTG H;  4MNO A;  3SK8 A;  3NBH B;  2ZXP A;  4K2K A;  3F2D A;  1E2V A;  1LTG D;  5CV6 A;  4K5X A;  4XYQ A;  4F7X A;  4HTH A;  4HED A;  1PH9 A;  1HNW Q;  2N8N A;  2RSO A;  2MFI A;  4A3K H;  2KCN A;  1Y8N B;  3Q23 A;  3KJP A;  1NJI C;  5C44 G;  2RDH A;  2KHS A;  2EDG A;  3D0F A;  1CKN B;  1SE8 A;  3I2Z A;  1YJW A;  2UU9 L;  1PDQ A;  1MJE A;  4PQX A;  1FD7 D;  3JAM i;  4ZQ3 A;  1VQ6 A;  2Z0S A;  3S2H H;  3U50 C;  2V1C C;  3CCV A;  1FNV A;  1I4X A;  5CV5 A;  4DR5 L;  3MVV A;  4DA2 A;  4FXD A;  4LAA A;  2TMP A;  4KI0 A;  1RCV D;  1CTM A;  1KHI A;  2XIW A;  4IUT A;  1BUV T;  3M4Q A;  1YNX A;  2O4X A;  2WB1 B;  4IZ8 A;  2JA9 A;  3S17 B;  2D0P A;  4QL5 A;  2N78 A;  3T16 A;  3QB3 A;  3S2H B;  1VQC A;  2XTI A;  5BR8 Q;  3CCM A;  4IPG A;  4P71 A;  5IYB G;  4DV0 Q;  1PTO D;  4FVM A;  2F1M A;  2K4K A;  4XTC S;  4CKE A;  5C3E B;  2D9U A;  3BYY B;  4LFA L;  3OW7 A;  4G7H C;  2XWJ B;  3K8A A;  1O78 A;  1MSH A;  4JW0 A;  3VYT A;  2YYZ A;  2R92 B;  4K5W A;  2D62 A;  2RBM A;  1Q8K A;  2B8G A;  5IT9 L;  4O0A A;  4NDX A;  5KEE A;  5C5L A;  1ESR A;  2RF4 A;  3DWP A;  4OIJ A;  5E1F A;  4N8F A;  1EQQ A;  4A3F H;  3P20 A;  4HMJ A;  1U4R A;  2E2D C;  1ZYR C;  2L15 A;  4YWM A;  3VR4 A;  4PMC A;  1PH3 A;  2Z4H A;  1LTS D;  4RMF A;  1YVC A;  3A8K E;  1O80 A;  3HOZ G;  1TS4 A;  2QKI C;  4IJL A;  3RN2 A;  4JI3 Q;  2SOB A;  4JI4 L;  4JI3 L;  1D5Z C;  3CD6 A;  1VQ5 A;  2I5L X;  3IAY A;  5LMU L;  5I2X A;  3BS1 A;  1PYW D;  2NVT H;  2MJ8 A;  4GLX A;  4JI0 Q;  1WTQ A;  1B9N A;  1FR3 A;  2KCC A;  1S3O A;  1JIC A;  4BY7 G;  4OWW B;  1RTO A;  5JEA G;  2PQA B;  1VQG A;  1HQR D;  1FJG Q;  1SEB D;  1SXT A;  2HUG A;  4A3E G;  4QMG A;  1K8M A;  2XSC A;  1ASY A;  1TXY A;  2BDO A;  2JSO A;  3W3A A;  3EN2 A;  2NTS A;  2M2L A;  3ER0 A;  1L0W A;  3SK4 A;  3HP3 A;  1B3Q A;  3I91 A;  4CDC C;  3FEW X;  2E2I B;  1DJR D;  3SK5 A;  3NBI A;  1JE5 A;  5AJ3 L;  1SYB A;  3DEP A;  3MXN A;  1XXG A;  3PCO B;  3DM1 A;  2C9O A;  3CCJ A;  2JA5 G;  3KJO A;  2BDN A;  1G2T A;  1IXR A;  2L12 A;  1BNZ A;  4WFN 3;  4EQN A;  2R7Z G;  5EKK A;  2F0M A;  4NP5 A;  4X65 L;  1T5X D;  1WCM G;  4KY7 A;  5IYD G;  2GVB A;  2MHV A;  1N33 Q;  3QOJ A;  1A63 A;  2D5D A;  3S15 B;  2R7Z B;  5FKA C;  4O42 A;  1IL8 A;  1HNZ Q;  1NR2 A;  3VA7 A;  3A54 A;  5C0X I;  4GKJ Q;  2AQ2 B;  1F9R A;  4XT1 B;  1X65 A;  2F0L A;  2PI2 A;  4QUC A;  3S16 H;  2CH4 W;  4C3H G;  5M5W B;  4DV2 Q;  1KQS A;  5J22 A;  4HR7 B;  4H02 A;  2EQS A;  1G29 1;  1I6V C;  2A6E D;  2XN9 C;  1CSQ A;  3KLS A;  3ULP A;  1WFQ A;  1CQV A;  1PRT D;  2KBN A;  4DAY B;  1YIJ A;  2C5C A;  1HZ9 A;  3E5S A;  4HJA A;  4C1N K;  5I9O A;  2NN6 I;  3KOJ A;  3CCQ A;  1Q12 A;  1QOH A;  4P73 A;  1SLJ A;  1STN A;  1K0R A;  1PH2 A;  4YCW A;  2O5I C;  3J80 c;  3TEH B;  3KF6 B;  4HIK A;  4RGO S;  2HT1 A;  3TZD A;  2H4O A;  1QZG A;  2L4N A;  4DNT B;  3E9H A;  5LMN W;  2WFW A;  1Y1W B;  4O2D A;  3LX0 A;  3GP7 A;  5IT9 E;  3J81 L;  2B2W C;  3S14 H;  4GS3 A;  4LF5 Q;  3WOF A;  4P74 A;  1PV4 A;  2MQH A;  2HD3 A;  5CV8 A;  3M4O B;  1N9W A;  1GXD C;  3P1H A;  3RUZ A;  1TY0 A;  4N8X 1;  1HA5 A;  4YIJ A;  1SAP A;  5F2D A;  1C8C A;  3EVQ A;  4EQ5 A;  3G7L A;  2B2U A;  2LS0 1;  3X3M A;  1ET6 A;  1STA A;  4A93 B;  4UAI A;  3UDG A;  1S5C D;  2RA4 A;  4QY7 A;  4LFC L;  1EZ8 A;  4BBS B;  3RZO B;  4A3F G;  3A55 A;  3TN2 A;  4Y7N B;  2B63 G;  4CKC A;  3CCU A;  1JCK B;  4RKB A;  4IOA A;  2NN6 G;  4HIM A;  1KIX A;  4JI4 Q;  1ZEQ X;  3CCS A;  1NUC A;  1AW7 A;  1MGS A;  1GOZ A;  2XWB B;  3A56 A;  3PO2 H;  3HOV G;  1PH6 A;  2AKW B;  2FJ2 A;  4KKU A;  2CWP A;  4KKT A;  4A3I B;  4RCN A;  1PH4 A;  1SRO A;  1Q46 A;  3PUY A;  2PQA A;  2Z1C A;  4YHH L;  2EJG C;  1SNQ A;  2ZJR A;  1DON A;  4KHP Q;  4POG A;  4LNQ A;  2KEE A;  1BBU A;  3NEM A;  1D5M C;  4RHS A;  4BA2 I;  1LLR D;  2YU9 H;  5DAU A;  4QIW E;  1YNN C;  4OO1 H;  1VQF A;  4XT3 B;  4X66 L;  1Y1W H;  1X3E A;  5J39 A;  4LUO A;  3CHB D;  4V0B A;  2E74 C;  4OL7 A;  1ZYR D;  3HFZ B;  1F77 A;  2MO0 A;  1IHZ A;  1PVO A;  1M4V A;  3CPW A;  4BBR B;  4K0K Q;  2QEJ C;  3F2U A;  5JPN C;  4YCV A;  4BY7 B;  3NWT A;  4K2L A;  1PZJ D;  3T4A C;  4DV5 Q;  4DV5 L;  2RHS B;  3R2I A;  4QF4 A;  5D3D A;  1K73 C;  4A3D B;  2LSS A;  4PG3 A;  4B3S Q;  4JI7 Q;  1Q1B A;  3P75 A;  5KYL A;  2VUM B;  5IOD A;  3V05 A;  5IP7 H;  4DUY Q;  2DN8 A;  2PNR C;  4DUY L;  4TVA B;  3UDI A;  3OPO A;  1BCP B;  1STH A;  3PO3 B;  1CZW A;  3IL8 A;  3MXG A;  1QNU A;  2DNC A;  3T51 B;  4NMZ A;  3KBX A;  5CYU A;  4LF4 L;  3K0X A;  4JOI A;  4KN4 C;  2H1E A;  4ZKB B;  4DU9 A;  1HUN A;  1F9S A;  2I07 B;  2R7D A;  4C3I B;  5C4H A;  3J7Y W;  1PFS A;  2M00 A;  4OO1 I;  1AH9 A;  1IYU A;  2I0Q A;  1B8A A;  2JE6 I;  3F2B A;  2AHO B;  2DNE A;  3K6O A;  4QJF A;  1OXT A;  1IBM Q;  4IUQ A;  4B3R L;  1B2T A;  3PGZ A;  2CW0 C;  4C3H H;  3HKS A;  5HGT A;  1VCI A;  3MFY A;  2CKZ B;  3X3N A;  1XMQ Q;  2RDF A;  3VDY A;  4OX9 L;  1SMX A;  4X3K A;  4DXF A;  1EQR A;  3L2P A;  1QG7 A;  3EJI A;  2OQ0 A;  1E24 A;  1EQV A;  2HCC A;  5C3W A;  3J80 E;  1VDZ A;  3OYY A;  1I6H B;  1TII D;  2EY6 A;  3HOY B;  5C4X B;  2QEX A;  4DV6 Q;  1XYI A;  1D8L A;  1HFN A;  1SYE A;  1QE6 A;  2PNH A;  3A7A B;  2F0P A;  3QO2 A;  5IT9 c;  4DKA C;  4FF3 A;  3URY A;  4H13 C;  2VQE Q;  3Q0A A;  2L5T A;  2F0H A;  4P2C B;  1BF4 A;  4QB4 A;  1E3P A;  1LO5 D;  4DNI A;  3HEJ A;  4JV5 Q;  4DV7 Q;  1EFI D;  2ALY B;  2A68 C;  2JYO A;  3SXH A;  1U4P A;  3SGI A;  3RR5 A;  1I6H H;  4TKO B;  4X62 Q;  3H3V I;  1D5X C;  1FVI A;  4HJ7 A;  3IFD A;  3QJY A;  4DNR B;  3VR5 A;  3ND9 A;  1CKM A;  3T1H L;  1CSP A;  3K59 A;  1EY7 A;  3K5L A;  3PQI A;  3AMU A;  3W5O A;  2GA4 B;  1TQO A;  1W3S A;  2HHH L;  1K8O A;  4R4O A;  5ELC A;  4AYB G;  3S1M H;  2RCF A;  1X56 A;  4C56 C;  2OQK A;  1R4Q B;  5COY A;  5JPM C;  1HNX L;  3R3O A;  4MIU A;  2PMZ B;  4JI8 L;  3ZYY X;  1SDF A;  4GZY C;  2Z6K C;  3EBE A;  3Q8D A;  3F2C A;  4PMB A;  4ZK9 B;  1XMO L;  4NXN L;  4A3L H;  1FL0 A;  2ZM6 Q;  1XPO A;  5M5Y H;  2FXQ A;  4KN7 C;  5EPL A;  5IYC G;  4G7O C;  4U68 A;  1W6K A;  1ILQ A;  1JWM D;  5CBE E;  2XRS D;  2IX1 A;  3TP7 A;  2B2Y A;  4A3G B;  3AQQ A;  2OCE A;  1S40 A;  5TSS A;  3WDN A;  3MXN B;  2YU9 B;  3D6W A;  3M7N A;  1EOV A;  4C3I G;  1LT4 D;  1L1O A;  4JBJ A;  4XYO A;  1MD2 D;  3FPU B;  2HDM A;  4JBK A;  4A3M B;  2B2Y C;  1ICW A;  1H9K A;  1YNJ C;  1TWC B;  1QCB D;  4A3I H;  1Y14 B;  3P7J A;  2RQX A;  4O1N A;  3JAM c;  4GN4 B;  4HSP A;  4MTK A;  1VQ9 A;  1VQL A;  3PO2 B;  1OXU A;  1XMQ L;  3I4O A;  1FNU A;  4DR1 L;  1SJH D;  3GTL H;  3OOC A;  3NUC A;  5C5M A;  4L63 B;  3GTK H;  2OXP A;  1GUN A;  1NSN S;  3L7Z C;  2Q8R E;  4QUF A;  4R4C A;  1S5F D;  2KHJ A;  3DM3 A;  3PUX A;  2QA4 A;  1LTR D;  4IFD H;  3C1F A;  1WCM H;  2UXB Q;  1RDP D;  2J4X A;  3ULL A;  4GN3 B;  2Y0S B;  1A3T A;  1GVP A;  4C2M B;  2ZTC A;  1CA6 A;  3D4D A;  5C3E G;  5EPK A;  2K75 A;  1A8V A;  5JVG 3;  3FKI H;  3GTO B;  2AWO A;  3HKZ G;  1R9T B;  4G57 A;  1AFP A;  1F9P A;  3AFQ A;  2K52 A;  3JAM L;  3TS0 A;  5K36 H;  1A3U A;  1ESF A;  4DR7 Q;  1KLU D;  2JXM B;  3DWA A;  2ZJP A;  1HR0 L;  4JBM A;  1HTL D;  4RGT A;  2EXD A;  1LT6 D;  5JVH 3;  4GKK Q;  3PUV A;  4RH6 A;  3GTP H;  3AFP A;  2L11 A;  3PUZ A;  4OIK A;  3VYR A;  2KHI A;  2RDG A;  1JJC B;  1H95 A;  1EY9 A;  4IPC A;  1B53 A;  5CGK A;  2JA8 G;  1U5K A;  4TQU S;  5DNF A;  1ET9 A;  3I70 A;  4JCV E;  4DR3 L;  2IWH A;  3KK7 A;  4EGV A;  2JA8 B;  2K5D A;  3KDF B;  4AIM A;  2PZW A;  4GLA C;  3RZD H;  1YI2 A;  1UE6 A;  1YNJ D;  2OWO A;  3I4L A;  2I46 A;  2IJ0 A;  4ZRZ A;  3J7A 5;  3S1R H;  1SE3 A;  2EY5 A;  1DZ1 A;  3KYH C;  2LMC B;  2F0S A;  1GJX A;  5M3M H;  4HJ8 A;  3PF5 A;  1TWF B;  4RCO A;  1WTX A;  4CJ1 B;  1E0B A;  3NSW A;  2B2U C;  1PH1 A;  3VR6 A;  2DJG C;  4XIG S;  3NQT A;  4OGQ C;  3ZJY C;  1RTN A;  1LTB D;  1PFB A;  2K05 A;  4BXX G;  1JMC A;  2KQ3 A;  4JI1 L;  2VL6 A;  3PO2 G;  4A3G G;  1F2Z A;  3S16 B;  2FHT A;  2F0F A;  1Y8P B;  1A2T A;  1DOL A;  3BZK A;  4DF7 A;  1MSG A;  1M90 C;  3OIQ A;  1XNR Q;  1AE2 A;  4PZ8 A;  5M5X B;  1HR0 Q;  1WJJ A;  2QDB A;  4GNX C;  2NVY H;  5I6W A;  2A74 C;  4DK1 A;  3E0E A;  3IFT A;  1N36 L;  1K9M C;  3H6M A;  1SMY D;  4M1U B;  2TSS A;  3B6Y A;  4ZUI A;  4YY3 L;  1K83 H;  2SNM A;  2ATW A;  3RZD B;  2GVA A;  1BVS A;  5JOB A;  2K03 A;  2ZXO A;  1HR0 W;  4A3L G;  5CR3 A;  5GAE C;  4OO1 G;  3HG9 A;  1N33 L;  4DN4 M;  1L1O B;  1ONL A;  5A2Q L;  1KXL A;  1HNX Q;  5LMN L;  2BA0 A;  1FJG L;  2X6G A;  4LJZ C;  4DK3 C;  1UE7 A;  3PF4 A;  3S1N H;  1R9T H;  1PTO H;  2A8V A;  3NHH A;  4R8N A;  1M1K C;  4N9P A;  3NBH A;  2F4V L;  3KF8 B;  1S5D D;  1PMR A;  1S5E D;  3EQL C;  5EBC A;  4UP9 A;  4A76 A;  4JI6 Q;  4DR3 Q;  1AE3 A;  1FNW A;  5CV4 A;  4DXG A;  4EQP A;  1FGU A;  1XTD A;  1TWH B;  1KRS A;  1L1O C;  2IT1 A;  2JA6 B;  3I4M H;  3H15 A;  2NYZ D;  5EBD A;  2CCZ A;  1QZH A;  3WOE A;  4HSV A;  2EY2 A;  1XTC D;  1E2W A;  2C35 B;  4MZ9 A;  2F4I A;  2MO1 A;  5L37 A;  4OHJ A;  4FP5 D;  4A3B H;  1BDO A;  4A3F B;  2AQ3 B;  2NZO A;  1SNC A;  4P72 A;  4A3C G;  2UU9 Q;  1II3 A;  3K57 A;  1KL9 A;  5E4X A;  1ZKO A;  1BQQ T;  1HPC A;  4H44 C;  3KDF A;  3PV0 A;  2HDL A;  3GTL B;  5FOB B;  1GUG A;  1K8G A;  1GUT A;  2K1B A;  1PTO F;  3KBG A;  3HOZ H;  2KVM A;  2AQ1 B;  1UEB A;  1L0X B;  3GO5 A;  2CQA A;  2Q2T A;  1C7Y A;  1B50 A;  4ILW A;  4A3B B;  2KEN A;  1SND A;  3G6E A;  2PMZ E;  3MC0 B;  3D4W A;  1GO3 E;  3K81 C;  2PYK A;  2QIL A;  3M3Y B;  2LFN A;  5M5Y B;  3AEV A;  4C3J H;  1X54 A;  3G6J B;  3HZX A;  2UXD Q;  4DAV A;  1KLG D;  4RKL A;  3FPP A;  1HQM C;  1HUM A;  4LFA Q;  3H3V H;  1N34 L;  1E22 A;  2R93 B;  3CXC A;  4BY1 H;  3DEO A;  2R61 A;  1QVC A;  1N32 Q;  3TSS A;  4R8I A;  1WVL A;  1YNN D;  1NCV A;  3LWE A;  5DM7 3;  1PTO B;  1CA5 A;  1PYB A;  2E5L Q;  4JI8 Q;  2R92 G;  1TWG B;  4ME3 A;  4X3S A;  4FF2 A;  1KDC A;  4CDF C;  2K28 A;  4B3M L;  3KUP A;  1HRJ A;  3TP5 A;  4GNX B;  1LT3 D;  1IL2 A;  2HHH Q;  3S2D H;  2MPM A;  4JG2 A;  5C4X H;  5KYI A;  4PMW A;  3K5N A;  1JT8 A;  2CQO A;  5EPJ A;  3W1B A;  5C0X G;  4UDU C;  4IUN A;  3GTG B;  2O2L D;  1K0S A;  2EY1 A;  2YTY A;  3GQB A;  1SRU A;  3L9A X;  2NUC A;  2EYM A;  1QUQ B;  4UPA A;  4MN3 A;  3K0Y A;  3NTI A;  4CJ0 B;  2F3W A;  5GAH C;  4V19 0;  4F88 A;  5IGC A;  1EIH A;  4FDB A;  3H0G G;  1DOK A;  1I4P A;  3UE0 A;  4BWG B;  2NVY B;  5LMN Q;  2VB3 X;  4DV3 Q;  4OWT B;  4LUZ A;  2F0E A;  5C4Z A;  4BA1 I;  1B4O A;  2F0T A;  2F3V A;  5E7N A;  2CH4 A;  3HGB A;  3KF8 A;  3U9O A;  1CM9 A;  1D7Q A;  3L0O A;  1JOR A;  1DYQ A;  1O7Z A;  4NKL A;  2MP1 A;  4CBV A;  4GKK L;  3AU7 A;  1H9M A;  4B3T Q;  1B3A A;  2NZ1 D;  1J5E L;  1WTH A;  3HOY H;  1EZ6 A;  1J5E Q;  4DV1 Q;  5M3F G;  4X6A H;  1VS0 A;  5M5X H;  3H09 A;  4X64 L;  1A15 A;  3TME A;  2ES2 A;  1GUW A;  3ERQ A;  1LTT D;  2BE5 C;  1ENA A;  4WOR A;  1VMC A;  2B63 B;  1VQA A;  4K6L A;  3Q22 A;  1XJV A;  5I6Y A;  3I7F A;  2LY7 A;  5IP9 G;  1TS3 A;  2F0Q A;  3KLS X;  4PV1 C;  1NTG A;  5LL6 X;  1BKB A;  1LTL A;  2B39 A;  1LV9 A;  1HA6 A;  4LF6 Q;  3GTQ B;  4BY1 B;  4DUZ Q;  4JI2 L;  3E6Z X;  4ULL A;  4YCU A;  1G51 A;  4XQQ A;  1IBL L;  1FGB D;  1PYS B;  4L8J A;  2DGY A;  2A6E C;  1KNA A;  2F0U A;  2F0I A;  3FMC A;  2ZTD A;  1VQI A;  3H91 A;  3S1R B;  4CDD C;  4DV6 L;  3PMF A;  2VNU D;  3QOL A;  4Y52 H;  2BE5 D;  4DPG A;  5A2Q E;  4LFB Q;  1TS5 A;  3A5U A;  3M3Y H;  3WWV A;  1BOS A;  1T9H A;  2DJF C;  2KA7 A;  3DXJ C;  5IGG A;  1MIU A;  1PRT F;  4NXM Q;  4JI6 L;  3STB C;  4HN7 A;  2NZH A;  2JA8 H;  3BZD B;  5D3I B;  5NUC A;  3HOW G;  3I4N B;  3KLW A;  4NPS A;  3CRL C;  3HOV B;  4BY7 H;  5CC4 A;  1ICF B;  2EJM A;  2KJX A;  1I94 Q;  2FMM A;  3NEN A;  5K36 G;  3IKJ A;  1QVG A;  3NTK A;  1Z7T A;  2K32 A;  3GV3 A;  5LL6 S;  2K6A A;  3OIP A;  3HOX H;  4IUU A;  1N34 Q;  4ABN A;  4M8A A;  1W2B A;  3CPF A;  2K14 A;  4IJH A;  1UE1 A;  5G3L F;  2VB2 X;  2KEC A;  4H7B A;  2UUA Q;  2UUB Q;  1A6X A;  4JI7 L;  3PO3 G;  1VQD A;  2H5X A;  2EJF C;  2IX3 A;  2WAC A;  1JOQ A;  1Y1V G;  1XMO Q;  1VQP A;  2FMC A;  3I3C A;  1EU4 A;  2A5H A;  2WB1 E;  2OTJ A;  4X3U A;  2NTT A;  1S72 A;  1X3F A;  2WIN B;  2KED A;  2HIX A;  1D2B A;  4I65 A;  2ASB A;  5GAG C;  2VQE L;  1JE4 A;  1F2L A;  2B3G A;  3HOX B;  4LFC Q;  4NXN Q;  1KDB A;  1SE4 A;  5IGE A;  3H94 A;  4AQY L;  4DR6 Q;  4IQZ A;  4HID A;  2R93 G;  4K6D A;  3NWS A;  4Z9C B;  4K14 A;  1LAC A;  4JVZ A;  4LW1 A;  1SMY C;  4J8Q A;  3I56 A;  3RZO H;  1SNP A;  1D6E C;  1C4Q A;  4LFB L;  2I5M X;  4FXG C;  3S1Q H;  3GDE A;  2A68 D;  1JOO A;  1RF2 D;  3T1H Q;  3S1Q B;  3DMU A;  1LTA D;  1VQH A;  2L0C A;  1ZXT A;  2PZU A;  4AYB E;  2MGS A;  1NMF A;  1V43 A;  1STB A;  2O5J C;  4U67 3;  5DEH A;  4FF4 A;  1X55 A;  4OEL B;  3M4O H;  2JA7 B;  3I8Z A;  4QQB X;  1CI3 M;  2UUC L;  2K7V A;  3J80 L;  3S14 B;  3ONA B;  1VMP A;  1TR5 A;  4X66 Q;  1S4Z A;  4OX9 Q;  1CK1 A;  2F0J A;  3J81 i;  2PO4 A;  2YV5 A;  2K01 A;  3TP8 A;  2JA6 G;  2PI2 E;  3K7U C;  4WJ3 M;  5C0X H;  3M4P A;  4HJ9 A;  4BBS G;  4LWC A;  1B9M A;  2ICI A;  4X64 Q;  3I4N H;  2J0T D;  1DGS A;  4XQJ A;  4LF5 L;  4K5V A;  3D6C A;  1KDA A;  4WRD A;  3ERS X;  5FO9 B;  5IIF A;  4FF1 A;  3PSI A;  1EU3 A;  1LM0 A;  1H9S A;  5CBA E;  1MJC A;  4Q0F A;  2JEA I;  4R1J A;  4GOP C;  3UE1 A;  3OHX C;  1P16 A;  5ELE A;  2A6H D;  1RL2 A;  2A6H C;  1KAB A;  3K5O A;  2Z6K A;  4F8M A;  5C0X J;  3GTM H;  2IL8 A;  1FYC A;  4K8I A;  2EZV A;  1WD1 A;  2QDL A;  1QJO A;  4R9W A;  4PZ6 A;  1Y8O B;  5KND A;  3MXP A;  3OTO Q;  1XPR A;  2A69 D;  5EKL A;  4A3E B;  1HHV A;  2VY3 A;  4A3J G;  1AZQ A;  1JQY D;  2WAQ G;  3CCE A;  3SEB A;  3F8T A;  4KHZ A;  2E76 C;  2RCN A;  2K5W A;  5KNB A;  3CF5 A;  3HOW B;  2IY5 B;  2UXC Q;  4IAL A;  4A3J B;  4DFA A;  2L9H A;  3SK6 A;  4GOP B;  2D2C C;  4L6T B;  5FJ8 H;  2WAQ B;  1NNX A;  1IBM L;  3HOU G;  4KD3 A;  1AN8 A;  4KHP L;  3FP9 A;  2XNA C;  4GLV B;  2EXZ A;  1WTR A;  5FK9 C;  1SYC A;  3W1G A;  1IW7 D;  4CHT B;  2E2I H;  4UHV A;  5KNC A;  3PIP A;  1PH8 A;  3F1Z A;  2B63 H;  1NR4 A;  1QWY A;  1VQN A;  4DR4 Q;  2YTX A;  3BDO A;  5JEA J;  2ID0 A;  2UUA L;  5HUR A;  1E1T A;  3DUZ A;  4JPB W;  2FIN B;  2PZT A;  3DHQ A;  4HIO A;  4N9T A;  1EEI D;  2B2T A;  1PH7 A;  1A3V A;  3BVM A;  2E2H H;  1Q7Y C;  3U4Z A;  1NBW A;  2MUY A;  3QIA A;  1HFG A;  2ENB A;  2XVS A;  1U9R A;  4JI1 Q;  2IHF A;  1SBB B;  3HOW H;  2NVX B;  1DOM A;  2F0V A;  5A35 A;  1IYJ B;  5JEA H;  2F0K A;  3JC6 6;  3LGJ A;  4C3I H;  5IP7 G;  3AB9 A;  5M3F B;  5T1I A;  2LXK A;  3S2D B;  1N32 L;  1TT2 A;  4A3E H;  3U9S A;  1WD0 A;  1HNW L;  5IGF A;  4C2M H;  4DK0 A;  5LHY 1;  2PCF B;  2WII B;  1Y1V H;  2R93 H;  3NXW A;  1S5B D;  1EY5 A;  2EYO A;  2V4D A;  1ML0 D;  1AP0 A;  1BXT A;  1QUQ A;  1LAB A;  3DWQ A;  5GRO A;  2F0O A;  3K58 A;  3PO3 H;  2VQF L;  4WJW A;  4GNX A;  4LF7 L;  4K0K L;  4JI0 L;  3A8I E;  1ILP A;  4IO9 A;  4RFB A;  2R92 H;  1BO0 A;  1TWG H;  2B2V A;  4LMQ D;  4YWK A;  1JB3 A;  2B2T C;  1BBW A;  1EYG A;  3H0G B;  4KD4 A;  1HNZ L;  4R4Q A;  3TBI B;  1JWU D;  4FXK C;  4KY5 A;  1Q1E A;  4JBW A;  3BZC A;  2A69 C;  3HOZ B;  3N52 A;  2OEO A;  4A75 A;  1OTC A;  1TWC H;  3EA6 A;  1CKO A;  3NK9 A;  2Y0S G;  4IPD A;  3I4M B;  4A3K G;  2UXD L;  1X3G A;  1ENF A;  2B29 A;  3VA5 A;  1B70 B;  1EUJ A;  4G4K A;  2N3S A;  2P5Z X;  3H0G H;  1XNQ Q;  4YWL A;  4BBR H;  3BJU A;  5BN4 A;  1HCZ A;  1NE3 A;  3S17 H;  1CUK A;  1RD9 D;  5IYC H;  3FKI G;  1SFO H;  4DR1 Q;  1LT5 D;  1LUZ A;  2ICE C;  3M4Y A;  2EYH A;  1TS2 A;  4JI5 Q;  1TWH H;  2EVB A;  3M9B A;  4KMU C;  3HS0 C;  3CC4 A;  1DXM A;  1VQ4 A;  5GQO A;  3TRE A;  1MKH A;  1PFN A;  2CHB D;  1Y1V B;  5ELB A;  1KTK A;  4R4I A;  4Y7N H;  1YHB A;  3BU2 A;  4RGM A;  3VR2 A;  2OT2 A;  1X6O A;  2SEB D;  4GKJ L;  5LMU Q;  3MWY W;  1KAW A;  2NVX H;  4IUR A;  1YHQ A;  1CT1 D;  1HTP A;  3E9I A;  1EY4 A;  3RLO A;  3M85 A;  3E0J A;  2ZM6 L;  2ZJQ A;  1TWA H;  1E2Z A;  3PIO 3;  1WYD A;  1STG A;  3CCL A;  1VQ7 A;  4A93 H;  3GTJ H;  3S9W A;  4DV4 Q;  3MZ5 A;  3TP6 A;  1BR9 A;  1SE2 A;  2KCM A;  4EX5 A;  4DR7 L;  1J6Q A;  1RJT A;  3NE5 B;  1XNR L;  4IUV A;  5JJI A;  4KJN A;  3CCR A;  2Q8T A;  2E2H B;  1I4R A;  3HOV H;  5M3M G;  4AH6 A;  1IBK L;  1EWC A;  2K33 A;  3NPP A;  3S1N B;  2BCO A;  2QF7 A;  1CHQ D;  1YHA A;  1KC8 C;  4APV A;  3R93 A;  3ICE A;  5G3L D;  4OON A;  3T56 B;  1F2Y A;  3CW2 C;  5ELD A;  5M3M B;  3BG3 A;  2I5H A;  1YZ6 A;  5D65 A;  2JP1 A;  1I50 B;  2N88 A;  5JJL A;  3HOX G;  4C3H B;  4OXP A;  4JI5 L;  4B9X A;  5M5W H;  4HCS A;  5M9O A;  1E1O A;  1Y1W G;  1L2F A;  2G9D A;  1K3B C;  3CMA A;  2AUJ D;  1HXY D;  3NTH A;  5KIX A;  1UWV A;  5FO7 B;  2K50 A;  4DAY A;  1GUS A;  3J81 E;  1UE5 A;  4B3M Q;  4RAU C;  4IFD I;  3CU7 A;  2F0N A;  1DM0 B;  3K5M A;  3O13 A;  5EAY A;  1STE A;  4TSS A;  1Q86 C;  3GV6 A;  4KJO A;  5C3X A;  1JC7 A;  1Z9F A;  3K7A B;  1M8A A;  1GHJ A;  3C2P A;  4B9W A;  1D1I A;  4A3I G;  2IX0 A;  3T53 B;  3A5Z B;  4NXM L;  1A2U A;  3GTM B;  3HKZ B;  3VYU A;  1JJG A;  1SYD A;  3FDT A;  2QW7 A;  1PTO C;  4UP8 A;  4LK1 C;  2EOT A;  1EFW A;  3NEL A;  1PHJ A;  2VUM H;  3V2T A;  4F87 A;  3D3R A;  1I3Q H;  3HOU B;  1R4P B;  1RKN A;  4IOC A;  2E5L L;  4RA8 A;  4XXE A;  4A93 G;  3FKI B;  3A0J A;  1SN8 A;  2F3I A;  2IHE A;  3DLL A;  1YBY A;  1STY A;  2SDF A;  3I4N G;  1OXX K;  1I4G A;  1PRT B;  4DK6 C;  1SSO A;  2Y0S E;  2K5V A;  3GTJ B;  3FHW A;  5IGB A;  3J7A V;  5IYD H;  3I4M G;  4DR4 L;  3CP0 A;  4A3C H;  5FLM H;  4JYA Q;  1IKL A;  2IW3 A;  2X6L A;  4RG1 A;  1EYD A;  1I5F A;  1RHP A;  2WKD A;  4XQN A;  2JA7 H;  3V96 A;  1Z6H A;  1UAP A;  1EY0 A;  4JI2 Q;  4DUZ L;  2B2V C;  1BBX C;  4B08 A;  4ZAI A;  4KHV A;  1VQE A;  2HIV A;  4DAM A;  1PH5 A;  5I9P A;  1CQF A;  3CRK C;  2A73 B;  1H9S B;  3A7L A;  4EVO A;  1G8Z D;  2L1B A;  2CW0 D;  2Q2U A;  4LF4 Q;  3GTO H;  1P8L A;  4L5Q A;  2LXJ A;  2FFK B;  4KV6 A;  1SFO B;  1TKW B;  4NW2 A;  3A8J E;  2LKV A;  3UDX A;  1X9N A;  2E2J B;  4BS9 A;  2KUM A;  3CAM A;  2QGQ A;  1CKN A;  1U0L A;  4DR2 L;  4R4T A;  1WCM B;  1YJ9 A;  1EEF D;  3CQZ B;  1PZI D;  4DV4 L;  3OSO A;  3HKZ E;  1V9P A;  2Q2H A;  1EY6 A;  1EYA A;  2B8F A;  3CC7 A;  2L55 A;  3RLF A;  3MAQ A;  3CC2 A;  2F0W A;  1GHK A;  4IPH A;  1V1Q A;  1DCZ A;  2G9H D;  3E3X A;  3TZU A;  1HZA A;  3ND8 A;  5ELF A;  1NMG A;  4ID6 A;  5C3E H;  1BCP C;  3QR8 A;  2VZA A;  1MI2 A;  1SJE D;  3IRB A;  2GN5 A;  4L5T A;  2PPB C;  1EQT A;  3BVG A;  3LNN A;  1EYC A;  1UNS A;  1X3Q A;  5HGQ A;  2Z9H A;  4JC0 A;  2YTV A;  3GTK B;  5FLX c;  2K5H A;  3N6R A;  4HCE A;  3U4V A;  3G71 A;  3QG1 A;  5FJ8 G;  4HAE A;  3D31 A;  2PQE A;  3G4S A;  1H9J A;  4LF6 L;  1Q3L A;  3OMG A;  4UP7 A;  2JEB I;  4ZYS A;  4X62 L;  4E6I A;  4A3G H;  4IFD J;  1CFM A;  1NAP A;  1UUP A;  2OF1 A;  2K5N A;  2KOL A;  4OWX B;  3S1M B;  5C6A A;  5J1Z A;  3BDC A;  4KTA A;  2R6G A;  3J81 c;  1LTI D;  3T1Y Q;  5CV7 A;  1Q90 A;  5IWA L;  5IWA Q;  2UUC Q;  3LWU A;  1F9Q A;  4JV5 L;  4B3T L;  2K5Q A;  5FO8 B;  4XDX A;  1I4H A;  3S15 H;  1DD2 A;  1K8A C;  1N36 Q;  4CJ2 C;  1GUO A;  1V8Q A;  3SHL A;  2WKC A;  3C1E A;  4ZCK A;  1VQ8 A;  3SDZ A;  4ME5 A;  5K5P A;  2K04 A;  1C9O A;  4DGZ A;  4JYA L;  5BN5 A;  1GM5 A;  5KGU A;  2JA5 B;  2UXB L;  5IP9 H;  5IE8 A;  3VR3 A;  5BR8 L;  5DM6 3;  4IFD G;  4RWS C;  5M3F H;  2PW5 A;  2WP8 J;  1B1Z A;  4FNF A;  1OXV A;  5KRU A;  2XGT A;  1QNK A;  3HRZ C;  4LF9 L;  1VQB A;  1LYL A;  4J15 A;  1PLF A;  3TRZ A;  4A3J H;  4A3M G;  2VS1 A;  1EIF A;  5E4W C;  1K83 B;  1EY8 A;  3RN5 A;  4POF A;  4DV7 L;  4S3S A;  1JR0 D;  1IZ6 A;  1VQK A;  4UY8 C;  4LF8 L;  3KLR A;  4I7A A;  4LF8 Q;  3STB D;  2NVQ H;  2VUM G;  4ODG A;  1MHW C;  4FYD A;  2DUD A;  2B2W A;  4BBR G;  2EYL A;  4BXX H;  1V1P A;  5C4J B;  3SVM A;  3J7Z C;  1RIP A;  2Q2I A;  3TDQ A;  1O7I A;  1Y69 U;  2A1A A;  2E8G A;  4L5R C;  2VQF Q;  1HH2 P;  3PIP 3;  2R3Z A;  1HJP A;  3MEF A;  2VW9 A;  2JN4 A;  1PRT C;  1TWF H;  1VF7 A;  1WTV A;  5COR A;  1EIY B;  2IPK D;  5AFW A;  5EGT A;  5C44 B;  1SNM A;  3U58 A;  1MBY A;  1Q8I A;  5EKI A;  5ELO A;  2AWN A;  3JAM E;  1NY4 A;  1EWH A;  4DV2 L;  5E3F A;  3SE0 A;  1IBL Q;  4H0L C;  2NB0 A;  4LUV A;  2KCT A;  1U4M A;  3W2D A;  1G2S A;  3OTO L;  5JAV A;  2RSN A;  4KY6 A;  4C3J B;  1PXU A;  4ZLT F;  2EPB A;  1ASZ A;  2G5D A;  2Z4I A;  2E75 C;  4FO2 A;  2XRQ D;  1QIL A;  5J3B A;  1E7Z A;  5BN3 A;  3RD4 A;  4A3D H;  3AYH B;  3J7A F;  5IYB H;  2N49 A;  1HZC A;  1V1O A;  1K28 A;  1XWE A;  4JK1 C;  3ITP A;  4QIW B;  3NQI A;  5FLX E;  3R2T A;  3MA2 B;  3CQZ H;  4GOP A;  1KNE A;  5H1S E;  2EYP A;  4KLK A;  1WTP A;  1VF5 C;  5I2Y A;  1YIT A;  1TVX A;  1WOC A;  2QCP X;  4WJ4 A;  3A74 A;  5EQ0 A;  3CKI B;  1Z47 A;  3S24 A;  1U4L A;  3C46 A;  2E2J H;  3FVQ A;  2HCI A;  3BVZ A;  1G6P A;  1A0I A;  3H3V C;  2JJQ A;  4QCL A;  2JA6 H;  5GAD C;  2OTL A;  5C4X G;  2UXC L;  2EYJ A;  2A19 A;  1ROD A;  3KFU A;  2JK8 A;  5EJW A;  2R7F A;  2F0G A;  2F52 A;  4A3K B;  3J81 j;  1AZP A;  4A3B G;  1KD1 C;  4PNY A;  2EE1 A;  1EIG A;  2NBF A;  4BBS H;  2WV6 D;  1YEZ A;  4B3S L;  1K3R A;  3SR1 A;  2RVL A;  4KK7 A;  1TY2 A;  4QGU A;  1H9R A;  1X32 A;  1SYF A;  2HQL A;  2PW7 A;  3BYT B;  2RHQ B;  4AQY Q;  4DR6 L;  2VXW A;  1SNO A;  4ZKC B;  4MTN A;  1JJ2 A;  1OXS C;  3OWF A;  1I94 L;  3RMH A;  3M7G A;  2AUK A;  4DV0 L;  1F2M A;  1HZB A;  1IW7 C;  2HQE A;  2CFM A;  3T13 A;  4HJ5 A;  1IBK Q;  1J8I A;  5JJZ A;  3PUW A;  1UEA B;  3T1Y L;  1SYG A;  1W6J A;  4RGN A;  5JJK A;  3D4R A;  1B44 D;  2BA1 A;  4NB3 A;  1B7Y B;  3I90 A;  5ISR A;  4DV1 L;  1BCP F;  4YHH Q;  4A3M H;  4X3T A;  2N55 A;  5I4D A;  1OO9 B;  4X65 Q;  2ZXR A;  1KRT A;  2DY7 A;  3VYS A;  1IKM A;  4HMI A;  4JOI C;  1JOK A;  1YJN A;  3EIV A;  3I55 A;  4IUP A;  4CDE C;  1V1P B;  1VQJ A;  1A62 A;  5FLM G;  1I3Q B;  1EL0 A;  1EWI A;  2JA7 G;  5CMD A;  3NP8 A;  2R7Z H;  5ELN A;  4EQO A;  3BDL A;  4OEM B;  3MEH A;  2WB1 G;  1PZK D;  1I4Q A; 
#chains in the Genus database with same CATH homology
 1O7L A;  2DY8 A;  2J7Z A;  4CKB A;  2Z8L A;  3L3O C;  3C3L A;  5CV9 A;  3MFG A;  4J6H A;  5D14 A;  3EFX D;  3OWE B;  1X3P A;  1EOT A;  1CHP D;  5IGD A;  2Q8I B;  3Q6S A;  5FLX L;  3ERO A;  4I7Z C;  2RKS A;  1AEX A;  3D8G A;  4C3J G;  3FRP B;  5IOC A;  1JWS D;  1G91 A;  4KKS A;  4DAP A;  1G6Z A;  1WTO A;  2F0D A;  4J1M A;  2EYF A;  4RHR A;  2SNS A;  3MTS A;  1PFM A;  1WTW A;  3GD7 A;  2M9V A;  1T5E A;  2NVT B;  1ENC A;  2NWG A;  3QWN A;  4TRD A;  4Q5V A;  2BOS A;  2NVQ B;  1IYV A;  1BCP D;  4IN3 A;  2F03 A;  1TU2 B;  1KAA A;  4ZUJ A;  4C1N I;  4MHE A;  1D1K A;  3MXU A;  5T1G A;  4K8J A;  3I72 A;  1J9O A;  3I73 A;  3OMC A;  1TWA B;  3R8B A;  4CGY B;  3GTP B;  1XX8 A;  1O7Y A;  1L0Y B;  2X69 A;  2ZT9 C;  2CVR A;  2NN6 H;  3Q24 A;  3UI2 A;  1CZG A;  3MHB A;  4AYB B;  1QB5 D;  4G7Z C;  1C48 A;  3SK8 A;  2ZXP A;  4K2K A;  1E2V A;  1LTG D;  5CV6 A;  4K5X A;  4XYQ A;  4F7X A;  4HTH A;  4HED A;  2RSO A;  2KCN A;  1Y8N B;  3Q23 A;  2RDH A;  2KHS A;  2EDG A;  1PDQ A;  4PQX A;  1FD7 D;  4ZQ3 A;  1FNV A;  1I4X A;  5CV5 A;  3MVV A;  4DA2 A;  4FXD A;  4LAA A;  2TMP A;  4KI0 A;  1RCV D;  1CTM A;  2XIW A;  4IUT A;  1BUV T;  2O4X A;  2WB1 B;  4IZ8 A;  3S17 B;  3T16 A;  3S2H B;  3QB3 A;  1PTO D;  4FVM A;  2F1M A;  4XTC S;  4CKE A;  5C3E B;  2D9U A;  3BYY B;  3OW7 A;  4G7H C;  2XWJ B;  1O78 A;  1MSH A;  3VYT A;  2YYZ A;  2R92 B;  4K5W A;  2D62 A;  2RBM A;  2B8G A;  5IT9 L;  4NDX A;  5KEE A;  5C5L A;  1ESR A;  3DWP A;  4OIJ A;  5E1F A;  3P20 A;  4HMJ A;  1U4R A;  2E2D C;  1ZYR C;  3VR4 A;  4PMC A;  2Z4H A;  1LTS D;  3A8K E;  1O80 A;  1TS4 A;  2QKI C;  2SOB A;  1D5Z C;  3IAY A;  5I2X A;  3BS1 A;  1PYW D;  2MJ8 A;  1WTQ A;  1B9N A;  1FR3 A;  2KCC A;  1JIC A;  1RTO A;  5JEA G;  1HQR D;  1SEB D;  1SXT A;  2HUG A;  4QMG A;  1K8M A;  2XSC A;  2BDO A;  2JSO A;  3W3A A;  3SK4 A;  2NTS A;  2M2L A;  3HP3 A;  3I91 A;  3FEW X;  2E2I B;  1DJR D;  3SK5 A;  3NBI A;  1SYB A;  3DEP A;  3MXN A;  1XXG A;  3DM1 A;  2C9O A;  2BDN A;  1G2T A;  2L12 A;  1BNZ A;  4WFN 3;  4EQN A;  5EKK A;  2F0M A;  4NP5 A;  1T5X D;  4KY7 A;  2MHV A;  3QOJ A;  2D5D A;  3S15 B;  2R7Z B;  5FKA C;  4O42 A;  1IL8 A;  1NR2 A;  3VA7 A;  3A54 A;  5C0X I;  2AQ2 B;  1F9R A;  4XT1 B;  2F0L A;  4QUC A;  4C3H G;  5M5W B;  5J22 A;  4HR7 B;  1G29 1;  1I6V C;  2A6E D;  2XN9 C;  3KLS A;  1CQV A;  1PRT D;  2C5C A;  3E5S A;  4C1N K;  5I9O A;  2NN6 I;  1Q12 A;  1QOH A;  1STN A;  2O5I C;  4RGO S;  3TZD A;  2H4O A;  2L4N A;  4DNT B;  1Y1W B;  3LX0 A;  3GP7 A;  5IT9 E;  3J81 L;  2B2W C;  3WOF A;  3M4O B;  5CV8 A;  1GXD C;  3P1H A;  3RUZ A;  1TY0 A;  1HA5 A;  4YIJ A;  1SAP A;  5F2D A;  1C8C A;  3EVQ A;  3G7L A;  2B2U A;  2LS0 1;  3X3M A;  1ET6 A;  1STA A;  4A93 B;  4UAI A;  1S5C D;  2RA4 A;  1EZ8 A;  4BBS B;  3RZO B;  3A55 A;  3TN2 A;  4Y7N B;  4CKC A;  1JCK B;  4RKB A;  2NN6 G;  1ZEQ X;  1NUC A;  1AW7 A;  1MGS A;  1GOZ A;  2XWB B;  3A56 A;  2FJ2 A;  4KKU A;  4KKT A;  4A3I B;  4RCN A;  3PUY A;  2Z1C A;  2EJG C;  1SNQ A;  1DON A;  2KEE A;  1D5M C;  4RHS A;  4BA2 I;  1LLR D;  5DAU A;  1YNN C;  4OO1 H;  4XT3 B;  5J39 A;  3CHB D;  4V0B A;  2E74 C;  4OL7 A;  1ZYR D;  1F77 A;  1IHZ A;  1M4V A;  4BBR B;  2QEJ C;  3F2U A;  5JPN C;  4BY7 B;  3NWT A;  4K2L A;  1PZJ D;  3T4A C;  3R2I A;  4QF4 A;  5D3D A;  4A3D B;  1Q1B A;  3P75 A;  5KYL A;  2VUM B;  5IOD A;  3V05 A;  2DN8 A;  2PNR C;  3OPO A;  1BCP B;  1STH A;  3PO3 B;  1CZW A;  3IL8 A;  3MXG A;  1QNU A;  2DNC A;  3T51 B;  4NMZ A;  3KBX A;  5CYU A;  4KN4 C;  2H1E A;  4ZKB B;  4DU9 A;  1HUN A;  1F9S A;  2I07 B;  4C3I B;  5C4H A;  3J7Y W;  2M00 A;  4OO1 I;  1IYU A;  2JE6 I;  2DNE A;  3K6O A;  1OXT A;  4IUQ A;  1B2T A;  2CW0 C;  5HGT A;  1VCI A;  3MFY A;  3X3N A;  2RDF A;  4X3K A;  4DXF A;  1QG7 A;  3EJI A;  1EQV A;  2HCC A;  5C3W A;  3J80 E;  1VDZ A;  1I6H B;  1TII D;  2EY6 A;  3HOY B;  5C4X B;  1XYI A;  1HFN A;  1SYE A;  1QE6 A;  3A7A B;  2F0P A;  3QO2 A;  4FF3 A;  3URY A;  4H13 C;  3Q0A A;  2L5T A;  2F0H A;  4P2C B;  1BF4 A;  4QB4 A;  1LO5 D;  3HEJ A;  1EFI D;  2A68 C;  2JYO A;  3SXH A;  1U4P A;  4TKO B;  1D5X C;  3IFD A;  3QJY A;  4DNR B;  3VR5 A;  3ND9 A;  3K59 A;  1EY7 A;  3K5L A;  3AMU A;  2GA4 B;  1TQO A;  1K8O A;  5ELC A;  4C56 C;  1R4Q B;  5COY A;  5JPM C;  3R3O A;  4MIU A;  2PMZ B;  3ZYY X;  1SDF A;  4GZY C;  4PMB A;  4ZK9 B;  4KN7 C;  5EPL A;  4G7O C;  4U68 A;  1W6K A;  1ILQ A;  1JWM D;  5CBE E;  2XRS D;  2IX1 A;  3TP7 A;  2B2Y A;  4A3G B;  5TSS A;  3WDN A;  2YU9 B;  3D6W A;  3M7N A;  4C3I G;  1LT4 D;  4XYO A;  1MD2 D;  3FPU B;  2HDM A;  4A3M B;  2B2Y C;  1ICW A;  1H9K A;  1YNJ C;  1TWC B;  1QCB D;  3P7J A;  2RQX A;  4O1N A;  4HSP A;  3PO2 B;  1OXU A;  1FNU A;  1SJH D;  3OOC A;  3NUC A;  5C5M A;  4L63 B;  2OXP A;  1GUN A;  1NSN S;  3L7Z C;  2Q8R E;  4QUF A;  1S5F D;  3PUX A;  4IFD H;  1LTR D;  3C1F A;  1RDP D;  2J4X A;  2Y0S B;  1A3T A;  4C2M B;  1CA6 A;  3D4D A;  5EPK A;  5JVG 3;  3GTO B;  2AWO A;  1R9T B;  4G57 A;  1AFP A;  1F9P A;  3JAM L;  5K36 H;  1A3U A;  1ESF A;  1KLU D;  2JXM B;  3DWA A;  1HTL D;  4RGT A;  1LT6 D;  5JVH 3;  3PUV A;  4RH6 A;  2L11 A;  3PUZ A;  4OIK A;  3VYR A;  2RDG A;  1EY9 A;  1B53 A;  5CGK A;  4TQU S;  5DNF A;  1ET9 A;  3I70 A;  2IWH A;  3KK7 A;  4EGV A;  2JA8 B;  2K5D A;  2PZW A;  1YNJ D;  3I4L A;  2I46 A;  2IJ0 A;  4ZRZ A;  1SE3 A;  2EY5 A;  1DZ1 A;  2LMC B;  2F0S A;  1GJX A;  1TWF B;  4RCO A;  1WTX A;  4CJ1 B;  1E0B A;  3NSW A;  2B2U C;  3VR6 A;  4XIG S;  3NQT A;  4OGQ C;  1RTN A;  1LTB D;  1PFB A;  2K05 A;  2KQ3 A;  1F2Z A;  3S16 B;  2FHT A;  2F0F A;  1Y8P B;  1A2T A;  1DOL A;  4DF7 A;  1MSG A;  3OIQ A;  5M5X B;  2QDB A;  5I6W A;  2A74 C;  4DK1 A;  3IFT A;  3H6M A;  1SMY D;  4M1U B;  2TSS A;  4ZUI A;  2SNM A;  3RZD B;  5JOB A;  2K03 A;  2ZXO A;  5CR3 A;  4OO1 G;  3HG9 A;  4DN4 M;  1ONL A;  5A2Q L;  2BA0 A;  2X6G A;  4LJZ C;  1PTO H;  3NHH A;  4R8N A;  4N9P A;  3NBH A;  1S5D D;  1PMR A;  1S5E D;  3EQL C;  5EBC A;  1FNW A;  5CV4 A;  4DXG A;  4EQP A;  1TWH B;  2IT1 A;  2JA6 B;  2NYZ D;  5EBD A;  3WOE A;  4HSV A;  2EY2 A;  1XTC D;  1E2W A;  2F4I A;  4OHJ A;  4FP5 D;  1BDO A;  4A3F B;  2AQ3 B;  1SNC A;  1II3 A;  3K57 A;  5E4X A;  1ZKO A;  1BQQ T;  1HPC A;  4H44 C;  3PV0 A;  2HDL A;  3GTL B;  5FOB B;  1GUG A;  1GUT A;  2K1B A;  1PTO F;  3KBG A;  2KVM A;  2AQ1 B;  1L0X B;  3GO5 A;  2CQA A;  1B50 A;  4ILW A;  4A3B B;  1SND A;  3MC0 B;  3D4W A;  2PYK A;  2QIL A;  3M3Y B;  2LFN A;  5M5Y B;  3G6J B;  3HZX A;  4DAV A;  1KLG D;  4RKL A;  3FPP A;  1HQM C;  1HUM A;  2R93 B;  3DEO A;  2R61 A;  3TSS A;  4R8I A;  1WVL A;  1YNN D;  1NCV A;  3LWE A;  5DM7 3;  1PTO B;  1CA5 A;  1TWG B;  4X3S A;  4FF2 A;  1KDC A;  2K28 A;  3KUP A;  1HRJ A;  3TP5 A;  1LT3 D;  2MPM A;  5KYI A;  4PMW A;  3K5N A;  5EPJ A;  3GTG B;  5C0X G;  4UDU C;  4IUN A;  2O2L D;  2EY1 A;  3GQB A;  3L9A X;  2NUC A;  2EYM A;  4MN3 A;  3K0Y A;  3NTI A;  4CJ0 B;  2F3W A;  4V19 0;  4F88 A;  5IGC A;  1EIH A;  1DOK A;  1I4P A;  4BWG B;  2NVY B;  2VB3 X;  2F0E A;  5C4Z A;  4BA1 I;  1B4O A;  2F0T A;  2F3V A;  3HGB A;  3KF8 A;  3U9O A;  1CM9 A;  1JOR A;  1DYQ A;  1O7Z A;  4NKL A;  2MP1 A;  4CBV A;  3AU7 A;  1H9M A;  1B3A A;  2NZ1 D;  1EZ6 A;  3H09 A;  1A15 A;  3TME A;  1GUW A;  3ERQ A;  1LTT D;  2BE5 C;  1ENA A;  4WOR A;  1VMC A;  2B63 B;  3Q22 A;  4K6L A;  5I6Y A;  2LY7 A;  1TS3 A;  2F0Q A;  3KLS X;  4PV1 C;  5LL6 X;  2B39 A;  1LV9 A;  1HA6 A;  3GTQ B;  4BY1 B;  3E6Z X;  4ULL A;  4XQQ A;  1FGB D;  4L8J A;  2A6E C;  1KNA A;  2F0U A;  2F0I A;  3FMC A;  3H91 A;  3S1R B;  3PMF A;  2VNU D;  3QOL A;  2BE5 D;  5A2Q E;  1TS5 A;  1BOS A;  2KA7 A;  3DXJ C;  5IGG A;  1PRT F;  4HN7 A;  3BZD B;  5D3I B;  5NUC A;  3I4N B;  3CRL C;  3HOV B;  5CC4 A;  2EJM A;  2KJX A;  2FMM A;  5K36 G;  3IKJ A;  3NTK A;  1Z7T A;  2K32 A;  3GV3 A;  5LL6 S;  2K6A A;  3OIP A;  4IUU A;  4ABN A;  4M8A A;  5G3L F;  2VB2 X;  2KEC A;  4H7B A;  1A6X A;  2EJF C;  2IX3 A;  2WAC A;  1JOQ A;  2FMC A;  3I3C A;  1EU4 A;  2A5H A;  4X3U A;  2NTT A;  2WIN B;  2KED A;  1D2B A;  4I65 A;  1JE4 A;  1F2L A;  3HOX B;  1KDB A;  1SE4 A;  5IGE A;  3H94 A;  4IQZ A;  4K6D A;  3NWS A;  4Z9C B;  4K14 A;  1LAC A;  1SMY C;  4J8Q A;  1SNP A;  1D6E C;  1C4Q A;  4FXG C;  2A68 D;  1JOO A;  1RF2 D;  3S1Q B;  3DMU A;  1LTA D;  2L0C A;  1ZXT A;  2PZU A;  2MGS A;  1V43 A;  1STB A;  2O5J C;  4U67 3;  5DEH A;  4FF4 A;  2JA7 B;  3I8Z A;  1CI3 M;  2K7V A;  3J80 L;  3S14 B;  3ONA B;  1VMP A;  1TR5 A;  1S4Z A;  1CK1 A;  2F0J A;  2PO4 A;  3TP8 A;  2K01 A;  5C0X H;  1B9M A;  2ICI A;  2J0T D;  4XQJ A;  4K5V A;  3D6C A;  1KDA A;  4WRD A;  5FO9 B;  5IIF A;  4FF1 A;  1EU3 A;  5CBA E;  1H9S A;  4Q0F A;  2JEA I;  3OHX C;  5ELE A;  2A6H D;  2A6H C;  1KAB A;  5C0X J;  3K5O A;  4F8M A;  2IL8 A;  1FYC A;  4K8I A;  2EZV A;  1WD1 A;  1QJO A;  4R9W A;  1Y8O B;  5KND A;  3MXP A;  2A69 D;  5EKL A;  4A3E B;  1HHV A;  1AZQ A;  1JQY D;  3SEB A;  4KHZ A;  2E76 C;  2K5W A;  5KNB A;  3HOW B;  4IAL A;  4A3J B;  4DFA A;  2L9H A;  3SK6 A;  2D2C C;  4L6T B;  2WAQ B;  4KD3 A;  1AN8 A;  2XNA C;  2EXZ A;  1WTR A;  5FK9 C;  1SYC A;  1IW7 D;  4CHT B;  5KNC A;  1NR4 A;  1QWY A;  3BDO A;  5JEA J;  2ID0 A;  5HUR A;  3DUZ A;  2FIN B;  2PZT A;  3DHQ A;  4N9T A;  1EEI D;  2B2T A;  1A3V A;  3BVM A;  2MUY A;  3QIA A;  1HFG A;  2ENB A;  2XVS A;  1U9R A;  1SBB B;  2NVX B;  1DOM A;  2F0V A;  5A35 A;  5JEA H;  2F0K A;  3AB9 A;  5M3F B;  5T1I A;  3S2D B;  1TT2 A;  3U9S A;  1WD0 A;  5IGF A;  4DK0 A;  5LHY 1;  2PCF B;  2WII B;  3NXW A;  1S5B D;  1EY5 A;  2EYO A;  2V4D A;  1ML0 D;  1AP0 A;  1BXT A;  1LAB A;  3DWQ A;  2F0O A;  3K58 A;  4WJW A;  1ILP A;  3A8I E;  4RFB A;  1BO0 A;  2B2V A;  4LMQ D;  1JB3 A;  2B2T C;  3H0G B;  4KD4 A;  3TBI B;  1JWU D;  4FXK C;  4KY5 A;  1Q1E A;  4JBW A;  2A69 C;  3HOZ B;  3N52 A;  2OEO A;  3EA6 A;  3NK9 A;  3I4M B;  1ENF A;  3VA5 A;  4G4K A;  5BN4 A;  1HCZ A;  1RD9 D;  1LT5 D;  2ICE C;  3M4Y A;  2EYH A;  1TS2 A;  2EVB A;  4KMU C;  3HS0 C;  1DXM A;  1PFN A;  2CHB D;  1Y1V B;  5ELB A;  1KTK A;  4RGM A;  3VR2 A;  2OT2 A;  2SEB D;  3MWY W;  4IUR A;  1CT1 D;  1HTP A;  1EY4 A;  3M85 A;  3E0J A;  1E2Z A;  3PIO 3;  1STG A;  3S9W A;  3MZ5 A;  3TP6 A;  1SE2 A;  1BR9 A;  1RJT A;  3NE5 B;  4IUV A;  4KJN A;  2Q8T A;  2E2H B;  1I4R A;  1EWC A;  2K33 A;  3NPP A;  3S1N B;  2BCO A;  2QF7 A;  1CHQ D;  3R93 A;  5G3L D;  3T56 B;  1F2Y A;  5ELD A;  5M3M B;  3BG3 A;  5D65 A;  2JP1 A;  1I50 B;  2N88 A;  4C3H B;  4B9X A;  4HCS A;  5M9O A;  2G9D A;  2AUJ D;  1HXY D;  3NTH A;  5KIX A;  5FO7 B;  4DAY A;  1GUS A;  3J81 E;  4RAU C;  4IFD I;  3CU7 A;  2F0N A;  1DM0 B;  3K5M A;  3O13 A;  1STE A;  4TSS A;  3GV6 A;  4KJO A;  5C3X A;  1JC7 A;  3K7A B;  1M8A A;  1GHJ A;  3C2P A;  4B9W A;  1D1I A;  2IX0 A;  3T53 B;  1A2U A;  3GTM B;  3HKZ B;  3VYU A;  1SYD A;  3FDT A;  1PTO C;  4LK1 C;  2EOT A;  3V2T A;  4F87 A;  3D3R A;  3HOU B;  1R4P B;  1RKN A;  4RA8 A;  4XXE A;  3FKI B;  1STY A;  2SDF A;  1OXX K;  1I4G A;  1PRT B;  1SSO A;  3GTJ B;  5IGB A;  3J7A V;  1IKL A;  2IW3 A;  2X6L A;  1EYD A;  1RHP A;  2WKD A;  3V96 A;  1Z6H A;  1UAP A;  1EY0 A;  1BBX C;  2B2V C;  4B08 A;  4ZAI A;  4KHV A;  5I9P A;  1CQF A;  3CRK C;  2A73 B;  1H9S B;  3A7L A;  4EVO A;  1G8Z D;  2L1B A;  2CW0 D;  2FFK B;  4KV6 A;  1SFO B;  1TKW B;  4NW2 A;  3A8J E;  2LKV A;  2E2J B;  4BS9 A;  2KUM A;  1WCM B;  1EEF D;  3CQZ B;  1PZI D;  3OSO A;  1EY6 A;  1EYA A;  2B8F A;  2L55 A;  3RLF A;  3MAQ A;  2F0W A;  1GHK A;  1DCZ A;  2G9H D;  3TZU A;  3ND8 A;  5ELF A;  4ID6 A;  1BCP C;  1MI2 A;  1SJE D;  2PPB C;  1EQT A;  3BVG A;  3LNN A;  1EYC A;  1UNS A;  1X3Q A;  3GTK B;  3N6R A;  4HCE A;  3QG1 A;  4HAE A;  3D31 A;  2PQE A;  1H9J A;  1Q3L A;  3OMG A;  2JEB I;  4ZYS A;  4E6I A;  4IFD J;  1CFM A;  1NAP A;  1UUP A;  2OF1 A;  2KOL A;  3S1M B;  5C6A A;  5J1Z A;  3BDC A;  4KTA A;  2R6G A;  1LTI D;  5CV7 A;  1Q90 A;  3LWU A;  1F9Q A;  2K5Q A;  5FO8 B;  4XDX A;  1I4H A;  1DD2 A;  4CJ2 C;  1GUO A;  1V8Q A;  3SHL A;  2WKC A;  3C1E A;  3SDZ A;  4ME5 A;  5K5P A;  2K04 A;  4DGZ A;  5BN5 A;  5KGU A;  2JA5 B;  3VR3 A;  5DM6 3;  4IFD G;  4RWS C;  2PW5 A;  2WP8 J;  1B1Z A;  4FNF A;  1OXV A;  5KRU A;  1QNK A;  3HRZ C;  1PLF A;  5E4W C;  1K83 B;  1EY8 A;  4S3S A;  1JR0 D;  3KLR A;  4ODG A;  4FYD A;  2B2W A;  2EYL A;  1V1P A;  5C4J B;  3SVM A;  3TDQ A;  1Y69 U;  3PIP 3;  2R3Z A;  1PRT C;  1VF7 A;  1WTV A;  5COR A;  2IPK D;  5AFW A;  5EGT A;  5C44 B;  1SNM A;  1MBY A;  1Q8I A;  5EKI A;  2AWN A;  3JAM E;  1EWH A;  5E3F A;  3SE0 A;  4H0L C;  2NB0 A;  1U4M A;  3W2D A;  1G2S A;  5JAV A;  2RSN A;  4KY6 A;  4C3J B;  1PXU A;  4ZLT F;  2EPB A;  2Z4I A;  2E75 C;  4FO2 A;  2XRQ D;  1QIL A;  5BN3 A;  3RD4 A;  3J7A F;  1XWE A;  1V1O A;  4XQN A;  3ITP A;  4JK1 C;  5FLX E;  4QIW B;  3NQI A;  3R2T A;  3MA2 B;  1KNE A;  2EYP A;  1WTP A;  1VF5 C;  5I2Y A;  1TVX A;  2QCP X;  5EQ0 A;  3CKI B;  1Z47 A;  1U4L A;  3C46 A;  3FVQ A;  2HCI A;  3BVZ A;  3H3V C;  4QCL A;  2EYJ A;  1ROD A;  5EJW A;  2F0G A;  4A3K B;  1AZP A;  4PNY A;  2EE1 A;  1EIG A;  2NBF A;  2WV6 D;  3SR1 A;  2RVL A;  4KK7 A;  1TY2 A;  1H9R A;  1X32 A;  1SYF A;  2PW7 A;  3BYT B;  2VXW A;  1SNO A;  4ZKC B;  1OXS C;  3OWF A;  3RMH A;  3M7G A;  2AUK A;  1F2M A;  1IW7 C;  2HQE A;  3T13 A;  1J8I A;  5JJZ A;  3PUW A;  1UEA B;  1SYG A;  1W6J A;  4RGN A;  3D4R A;  1B44 D;  2BA1 A;  3I90 A;  5ISR A;  1BCP F;  4X3T A;  2N55 A;  5I4D A;  1OO9 B;  2ZXR A;  2DY7 A;  3VYS A;  1IKM A;  4HMI A;  1JOK A;  4IUP A;  1V1P B;  1I3Q B;  1EL0 A;  5CMD A;  3NP8 A;  4EQO A;  3BDL A;  3MEH A;  1PZK D;  1I4Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...