2GA4B

Stx2 with adenine
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
70
structure length
70
Chain Sequence
ADCAKGKIEFSKYNEDDTFTVKVDGKEYWTSRWNLQPLLQSAQLTGMTVTIKSSTCESGSGFAEVQFNND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Binding of adenine to Stx2, the protein toxin from Escherichia coli O157:H7.
pubmed doi rcsb
molecule tags Toxin
molecule keywords Shiga-like toxin II subunit A
total genus 19
structure length 70
sequence length 70
chains with identical sequence C, D, E, F
ec nomenclature
pdb deposition date 2006-03-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.70 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2ga4B00
2GA4B 1QNUA 1BOSA 4P2CB 2XSCA 1CZGA 1CQFA 1C48A 1QOHA 1DM0B 2BOSA 4ULLA 1C4QA 1D1IA 1CZWA 3MXGA 4M1UB 1D1KA 2C5CA 1R4PB 1R4QB
chains in the Genus database with same CATH superfamily
3KJOA 1EQTA 4R4OA 4XTCS 2VUMG 2YTXA 4DR4Q 2ZM6L 3K5LA 4OWTB 4R4IA 4QIWB 1JJGA 5JEAJ 1KIXA 3S2HH 1OXUA 4LJZC 3TN2A 1DGSA 3DM3A 3VR6A 1EY5A 4IFDG 4K2KA 1IBKL 1XMOL 3S16B 1KRTA 3KBGA 2NVXB 1QUQA 3H3VI 2N55A 3A74A 4RHRA 3FRPB 3K0YA 3PO3H 4JBMA 1E2ZA 1VQGA 3BU2A 4DV1L 3PUWA 1VQJA 2IT1A 1O7LA 5EPKA 1W2BA 1V1OA 1IKMA 1PTOF 3JAML 5D65A 5HGQA 2K14A 1I4RA 3CCSA 2E2JH 1EY7A 4DXGA 5CGKA 5M9OA 3C1EA 2R92G 1LACA 4GKJL 1CI3M 4K5WA 4RGNA 3G7LA 2VQFQ 1QVFA 4DF7A 3WWVA 3R8BA 3SK5A 2B39A 2CQOA 4GNXC 2OWOA 1SROA 2HQEA 2B3GA 2UUCL 4OXPA 3NTKA 4JC0A 4I65A 1GHJA 5HGTA 2JEBI 4KK7A 3CC7A 3E5SA 1TT2A 3EA6A 5ELFA 5IP7G 3I4LA 1E2WA 1SXTA 3K6OA 4IFDJ 5M5XH 5M3FH 2KHSA 4XXEA 1GO3E 1CTMA 4AYBB 5LMUQ 4MTNA 2EYLA 3K59A 2QW7A 4DV7L 3FHWA 5JEAG 2UUBL 1I4QA 3I73A 2X6LA 4X62L 4B3SL 5IGFA 5FO7B 1GJXA 3GTJH 1YIJA 4C3IB 1A62A 4DXFA 4LF7Q 4RGMA 5I2XA 2CW0D 1HZBA 2NUCA 3LNNA 1Y69U 4IUUA 2Q2UA 2XTIA 1C7YA 1DOLA 1SE2A 3GTKH 1BCPB 4IZ8A 3T1HL 1IHZA 4ME3A 4Z9CB 1PH5A 2E2IB 4PG3A 4J1MA 2UXDL 3S1RB 3S1NB 5J39A 3EIVA 1VF7A 1RODA 2PO4A 3U50C 4RGOS 3PF4A 4V190 3ICEA 2AQ3B 5EPJA 4A3EG 1H9RA 4JI6L 4A3IB 4TVAB 1B50A 5BN4A 1D8LA 4H0LC 1PYWD 1U5KA 4A3CG 3E3XA 1U4PA 2EE1A 3F2UA 4A93B 4KJOA 1Z47A 1HZAA 4B3RQ 2RVLA 1N33L 1HFNA 1U9RA 1TS5A 3S1QB 2UUAQ 1JICA 2RDHA 1PH4A 4G7ZC 4OWXB 4A76A 4YHHQ 4Y52H 5EBCA 1CKNA 4B08A 1LTBD 2KCMA 1XNRL 2EJGC 3A56A 1YNJD 5CV7A 1FGUA 3MVVA 3HOVH 3I4NB 2B63H 4POFA 1W6KA 1H9MA 4F8MA 3JAMi 2JA5B 4DFAA 4OO1H 2XSCA 1RD9D 1BKBA 4L6TB 3VA5A 1NJIC 3E0JA 2IL8A 2EOTA 2BOSA 3NE5B 5I4DA 1XWEA 1Q46A 3NTHA 4HIOA 1LO5D 1NAPA 1Y1WG 2Z9HA 2K28A 2R6GA 5LMNW 2LY7A 5CV4A 5E7NA 2F0LA 1BO0A 4QUFA 2NB0A 1ESFA 3IL8A 1JCKB 4HR7B 1V1PA 1VDZA 1AFPA 3S16H 2SOBA 4K2LA 5IT9L 4FF4A 3CF5A 2A6EC 3ND9A 5C5LA 3HOVB 1LTGD 4LF4Q 1ET6A 4FXKC 4K14A 1DD2A 1S5ED 1HQMC 2G9HD 2AMCB 2XVSA 2F0KA 2HT1A 5GAEC 1PH8A 4AQYL 5JVG3 3M4OB 1CT1D 1HXYD 1Q1BA 1IYVA 2K5VA 4DV6Q 4IN3A 2DGYA 3QIAA 4GOPB 3DUZA 2AHOB 4ZKBB 3L2PA 3I4NH 3HFZB 1YJWA 4RKBA 2F0DA 3B6YA 1TWFH 3S17H 4IO9A 1Q12A 1GXDC 1BBWA 4CDDC 1HNXQ 3QWNA 5JJIA 1ZYRD 4R4QA 5I9PA 3CCQA 1PYSB 2PPBC 1CM9A 4FDBA 1PH7A 2TSSA 5I6YA 3KOJA 3HOUH 4A3GG 1PH3A 3OIPA 2X6GA 1ML0D 1EUJA 3GD7A 1XMQQ 4IUNA 1TWCH 3R3OA 3M3YB 3KYHC 2RF4A 5TSSA 3TDQA 1EOVA 4OHJA 3CCVA 1EYAA 4LW1A 1K83H 3I90A 5IGEA 4AIMA 4X3KA 2UUCQ 2JA5H 1BDOA 1J6QA 2BDNA 3LWEA 2RQXA 2K5NA 3AFQA 5CBAE 3GO5A 3T51B 4ZUJA 4XQQA 2PI2E 4A3JB 1N32L 2NN6G 2B2TA 1VS0A 2NN6H 1PHJA 1F9RA 3G48A 1JE4A 4C3JB 1IKLA 1I3QH 2JA7B 4NW2A 2L5TA 3U9SA 3GTQB 1VQAA 3Q6SA 1TY0A 2VW9A 4ABNA 5DAUA 1SFOH 1YHQA 1T5EA 2EYJA 2HHHQ 2K03A 1MBYA 2WB1G 3S9WA 1A6XA 2VB2X 5AJ3L 1EZ8A 4O1NA 4XDXA 1U4RA 3P7JA 3BVMA 4B3TL 4OGQC 4LF9L 3MTSA 3PO2B 3OOCA 1XPRA 2RDGA 1NCVA 3E0EA 4B3SQ 2UXCQ 1LM0A 3W1GA 4DAMA 1XMOQ 3I70A 1EIHA 2R92H 1W3SA 3H0GB 1U4LA 3P1HA 1IBLQ 2DNEA 1RJTA 1PZJD 4DV3L 4ZRZA 5ELDA 2Z4IA 2IX1A 2DN8A 1OXXK 3KBXA 2E76C 5J1ZA 1L0WA 2F0FA 2PMZB 1HQRD 2MQHA 4BA2I 4JI3Q 4IPCA 1U0LA 3HOZB 3TZUA 1J5EQ 4JI5Q 3FP9A 4UP9A 3K7AH 4A3IG 5C4XB 2RHSB 4KV6A 1IXRA 3VYUA 5CC4A 4A3EB 2RCNA 4DR1L 1I6HH 5E4WC 3VDYA 1EQQA 2HHHL 4JI6Q 4GLAC 1SLJA 1EZ6A 1PH9A 1T5XD 1VQ9A 1PZKD 5EKLA 3KF6A 3VA7A 3TREA 2BE5D 1OXSC 5KYIA 2AWOA 4DUZL 4JBWA 1JQYD 1QOHA 2IY5B 1QVCA 2B2WA 4APVA 3DEOA 5ELNA 4EGVA 1PTOH 4L5SA 5IODA 3KK7A 4A3MG 1KABA 2UUBQ 1WCMH 4JI7L 3M4PA 4YHHL 4R4CA 3S2HB 1MD2D 1QJOA 1D1KA 1EEID 3CRLC 1AE2A 1UUPA 3DHQA 1PRTF 1LT5D 1R9TH 1G91A 4JI1Q 2EJFC 4XT3B 4BBSB 1KAWA 1PTOC 4OX9Q 3NWSA 3BYTB 1Y8OB 3ND8A 3HP3A 4QMGA 1X32A 1EY4A 4HCEA 3T56B 2KVMA 3M3YH 4YCWA 3R2IA 1X54A 2KQ3A 3CKIB 4EVOA 5EKIA 1KL9A 1LABA 3J80c 3EFXD 5IYBH 1WTWA 2NZ1D 2GVAA 1X3FA 4RCOA 3LWUA 1S5CD 4FF1A 5KNBA 4P2CB 1XJVA 3DWPA 2DJGC 2MO0A 5GROA 4C3IG 4BBSH 2QCPX 2RCFA 3CC4A 3IFDA 4DPGA 3WOFA 1XTCD 5IGCA 3TSSA 1LLRD 3S15H 4DR6L 1GUGA 4GKJQ 4A3GB 4G57A 1LTAD 1XXGA 2SNMA 1S5BD 2F0WA 3I56A 1H9SA 3O13A 3OIQA 2DY8A 3DWAA 5T1GA 3FDTA 1K8GA 4A3DH 3RD4A 1V1PB 2JXMB 3A54A 2ES2A 3RMHA 3A8IE 1TY2A 2PQAA 5FOBB 4J15A 3H91A 2EJMA 2O5JC 2K75A 3KJPA 4NKLA 1M90C 3I3CA 5IGBA 3G71A 1E0BA 4UAIA 1R4QB 5C0XJ 3S1QH 1STEA 2F0QA 2LXKA 1X3GA 3RZDB 3KF8B 4JOIA 2VXWA 1CSPA 3GV3A 2OT2A 4KJNA 1C48A 2ENBA 1KXLA 3I7FA 4DA2A 3PMFA 3JAME 3H6MA 5C4ZA 1KC8C 3CRKC 2G5DA 2B2TC 5C4HA 1I94Q 4MIUA 1LT6D 3GTGB 3S14H 1MI2A 4HJ9A 4AYBG 1VMCA 3RNUA 3HG9A 2R7ZH 4BY7G 4NDXA 1TWAH 1BR9A 1GUTA 3VYTA 3CCEA 3TQYA 3SVMA 2K32A 3VR5A 3PUVA 3OSOA 3QOJA 1GM5A 1LT3D 2A19A 1KLGD 4AQYQ 2RBMA 1STYA 3SEBA 5FLXc 3K7AB 1TQOA 4CGYB 5M5XB 4EQOA 4G7OC 1VQCA 2IHEA 2WKDA 2ZTDA 5M5YH 1PXUA 1SNMA 3GV6A 4KD4A 3RN5A 3KLSX 1YHBA 1V8QA 2ICEC 4C3JG 3HKSA 3BZCA 3A8JE 2NZOA 1HRJA 2CFMA 4PNYA 4Q5VA 2F0SA 2BA0A 3ER0A 1YNND 5BR8L 1QB5D 3I4NG 2F0NA 2D0OA 5LL6S 5CV9A 2E5LQ 1HZ9A 2B2UC 1VF5C 5E4XA 4DGZA 3QR8A 1AZQA 1DOMA 4LF7L 1SE8A 1Q8KA 1G51A 1B9NA 1J5EL 4JV5L 1Q82C 3BDCA 3KF6B 3NHHA 4LWCA 2HCIA 3F2DA 1AZPA 1SNOA 3PO3B 3H0GH 1IW7D 2H4OA 1EQVA 3T1HQ 3VR3A 5IP9G 3J81i 4JPBW 2F0HA 3GTGH 3S14B 2VUMB 2LMCB 2R61A 4BS9A 4JG2A 3CD6A 2RKSA 4LMQD 3OWEB 5I9OA 1DYQA 1TS2A 1CHPD 3BVZA 4DUZQ 1EOTA 1K3RA 3GTLH 3RZOH 3IAYA 1F9PA 3I91A 4LAAA 2N49A 4C3HG 2NN6I 1TXYA 3LGJA 4BY1H 1A3TA 1A63A 1SE3A 5ISRA 1UEAB 4ZKCB 2HQLA 3MWYW 4GZYC 3BZKA 4A3KG 3W2DA 2E5LL 3K57A 2D2CC 2UUAL 4ZAIA 2UXCL 2L11A 4DV5Q 4DN4M 4X6AH 4IJLA 3N6RA 4JV5Q 2EYOA 1PRTC 4LFCQ 4HJ5A 4PMWA 1YBYA 1MHWC 4X64L 1I4GA 4IQZA 4YWMA 1V9PA 2O5IC 1MGSA 2D62A 1BBXC 1D5XC 4JI4Q 3MXUA 1SAPA 1VCIA 5CMDA 2MPMA 4C3HB 1WTPA 2JA8H 4MZ9A 5HURA 2K5QA 3D4WA 1L1OA 2KEDA 5IT9E 3J81j 2XWBB 2KECA 3RUZA 5I6WA 5A2QE 5L37A 3D8GA 2WACA 2F0IA 4R9WA 1HNWL 1PYBA 3ZYYX 3HOUG 1SR3A 2XRSD 1M8AA 3OMCA 3VR4A 1E22A 1HFGA 1D5ZC 3SK8A 1SYBA 1HUNA 1FJGL 2L12A 1CKOA 1K9MC 4M1UB 1RIPA 3H15A 4HIDA 3C46A 1CKMA 1D5MC 4YWLA 1HA6A 4DR5Q 1L0YB 3HOXH 4A3BG 3PO2G 1SYFA 1EIYB 4X64Q 3KLSA 1STBA 3U58A 3J7AF 2KENA 2QF7A 1S3OA 5T1IA 1XNQQ 5IYDH 1MKHA 1UE1A 2HIXA 3IKJA 3NENA 3DWQA 4LF5L 3FKIG 4H7BA 4KD3A 1I4PA 1K28A 2F1MA 2M2LA 2GN5A 2JK8A 4JI1L 4H13C 1UNSA 3J80E 2JA7G 2EPBA 2F03A 1Q8IA 5IGGA 2VUMH 1HCZA 1YEZA 5FLXE 4L5QA 1EYCA 2NVYB 4ALPA 3ULPA 2A68C 4KMUC 3H3VH 3NEMA 2F4VQ 5C0XI 1I50B 2GA4B 1QWYA 3NBHB 3T1YQ 5IYBG 2Q2IA 1FNUA 2LS01 4LFBL 5IYCG 1SJHD 3D31A 1ENCA 3PF5A 3AEVA 3KFUA 4ILWA 3HOYB 2CHBD 1HUMA 5ELEA 2LSSA 1KAAA 4UDUC 2KOLA 2PW7A 1DXMA 1Y1WH 4N8X1 2F0PA 1Z7TA 4DR2Q 3M7GA 5FO9B 4PMCA 4ZUIA 1EY9A 4IJHA 4L63B 3J7YW 2KCNA 4POGA 3JAMc 1M1KC 4GNXB 3RZOB 1I4HA 2OQKA 1G6PA 5FKAC 3S1RH 3S1NH 4R8IA 5EKKA 1JOOA 4LF5Q 1ZKOA 1LTLA 1Y1VG 5GADC 2BH8A 2KJXA 2B29A 2R7DA 1A3VA 4NXNL 3TZDA 1EU3A 1CFMA 3DXJC 1D6EC 4U673 1FL0A 1XX8A 1ZXTA 3V05A 3GTMB 3S2DB 4F87A 3QO2A 2R93G 4DNTB 4YWKA 1ET9A 2K01A 1SRUA 1TIID 1KQSA 2ZJRA 1VQ4A 3DLLA 5IOCA 1SE4A 2MFIA 1SN8A 4KY6A 4PZ8A 3MAQA 4IFDH 1EFID 1I6VC 3HKZG 4CDCC 2I5HA 2BH2A 2A68D 2LXJA 4DK3C 1GOZA 4P72A 3HOZH 1DONA 3E6ZX 5J22A 1QZGA 4DUYL 4JI7Q 5G3LF 1N34Q 1XTDA 3CQZB 1V43A 1G291 4HMIA 3A8KE 3PO2H 4J6HA 3ERSX 2HCCA 1TWCB 4KHVA 2RSNA 3GTOB 1BOSA 1J9OA 3DEPA 3R93A 3D6CA 4DV2L 2EY1A 2L15A 3M9BA 4KHPL 2MNAA 3FEWX 1B7YB 3F1ZA 4RKLA 4O42A 1GKHA 4LNQA 2IX3A 1X9NA 3QB3A 5C4JB 4A3LH 2J0TD 2Y0SB 4JBJA 3J7ZC 3A0JA 2AWNA 1PDQA 3CAMA 1LYLA 5IYDG 3MXNA 4I7ZC 1EWHA 4HEDA 1Y8NB 4JI3L 1GD7A 3VR2A 3BG3A 3K81C 4C2MB 4FO2A 1F2ZA 2B2VA 3GTPH 2RHQB 3MEHA 4IPGA 3GP7A 1VQDA 4HJ7A 2F0UA 3W1BA 4XQNA 1QILA 1NR4A 5JEAH 4RAUC 4QL5A 3M85A 4X66Q 1LUZA 2ID0A 4N9TA 4K6DA 3K58A 1QZHA 4JI2Q 4HCSA 1EYGA 1TWFB 1N9WA 3TS2A 2DY7A 1Q90A 3G4SA 5M3FG 3P75A 2N3SA 5M5WB 4IPHA 2AQ2B 4DNIA 1SNPA 1YJNA 3PUXA 3M4OH 2NWGA 5EBDA 1SMXA 3HOUB 4F7XA 1KTKA 2WAQE 4BWGB 5GAGC 1X56A 4U68A 5JJLA 1BUVT 2CW0C 2QEJC 4C56C 2E2JB 1IZ6A 4H44C 2F0MA 1NNXA 5C3WA 2PYKA 1Y1VH 5CV8A 4CJ2C 1C9OA 3TP7A 2ZXRA 4IPDA 2K5HA 2EYMA 2K5WA 1IYJB 1HNZQ 2JYOA 3K5MA 2PNHA 4BA1I 2ZXOA 3EROA 1N36Q 4BXXG 2F3IA 3PGZA 4JI2L 3NELA 4IOAA 5C4XG 3I8ZA 2K52A 2ZM6Q 4A3MB 4A3DB 5GAHC 1F2MA 1WCMB 1I4XA 3ERQA 4ODGA 1O7IA 4WRDA 4AH6A 4XT1B 4MN3A 5C3XA 1MSGA 3PIOA 3L7ZC 3MEFA 2SNSA 4FP5D 2I5LX 2BDOA 2JP1A 4DK1A 1RTNA 1TS3A 4M8AA 4FVMA 2KUMA 4JBKA 2Q2HA 4WJ3M 1WJJA 4JI0Q 4CKBA 3CCRA 5IP9H 2KHIA 1X3QA 4BBRH 3BVGA 1SYEA 2TMPA 1C4QA 2JSOA 4A3IH 3OTOL 1FNVA 5A35A 2B2YA 2Z6KA 2WP8J 1VQLA 5K36H 3I4MB 2QGQA 3TEHB 4C2MH 3TP8A 5IWAL 1CQFA 1HTPA 4NMZA 4DAVA 1SEBD 3CCUA 4JI4L 3UE1A 4DNRB 1IL2A 1VQNA 1JORA 5KIXA 4K8IA 4BXXH 2AUJD 3OHXC 4X65Q 3NK9A 1A8VA 1NUCA 3G6JB 3T16A 3GTKB 1A15A 2H5XA 1UE7A 3N52A 5LMNL 2XIWA 3AFPA 1WD1A 3FVQA 4OO1G 4CJ0B 4K5XA 1JWMD 4BY7H 4IURA 4KKSA 2YTVA 1HH2P 1EWCA 3Q22A 5FK9C 4A75A 4LF4L 4IUQA 2OQ0A 4LUVA 4A3FB 2A6HD 4JI0L 2WINB 2NVQH 3ITPA 4OELB 3L9AX 3KDFB 4ZQ3A 1W6JA 4ZK9B 3J80L 1B4OA 3Q23A 4KY5A 2YU9B 3HRZC 2F4IA 3D0FA 1XYIA 1UEBA 4FYDA 3F2CA 4N9PA 1HR0Q 1JE5A 5CBEE 2C9OA 2DJFC 3K7UC 3FPPA 2EY5A 4EX5A 1RF2D 1MJCA 1DOKA 1E3PA 5EPLA 1PVOA 1KNAA 5JOBA 2EIFA 2K50A 1YNXA 3K80C 2AKWB 4TKOB 1MIUA 1B44D 1VQHA 4L5TA 1WYDA 3T1YL 3KDFA 2A6ED 2OTJA 3SR1A 5IE8A 4DUYQ 3FKIH 4LFBQ 1QVGA 3J80i 4QGUA 4B9WA 3Q24A 1N34L 2F0EA 1T9HA 1B3AA 4KHPQ 1X3EA 4B3RL 1QG7A 5BR8Q 1FD7D 1N33Q 2YU9H 4J8QA 4JW0A 1NMFA 4LFAQ 1L1OC 3GTQH 2IX0A 1EY6A 1OO9B 3SXHA 4A3KB 1EIFA 1LV9A 1Y14B 2N78A 3WDNA 5JJZA 1VQIA 2K6AA 4B3ML 2WKCA 2EVBA 3J7A5 1X55A 4HIMA 3MXPA 4HJ8A 1MJEA 1E1OA 4DV0Q 1FYCA 1KLUD 2OF1A 2NTSA 3PV0A 4FNFA 3AB9A 5AJ3Q 3H3VC 1OTCA 3CCJA 4WJWA 3HOYH 4P74A 4B3TQ 3S15B 1LTTD 3NBIA 1SSOA 4GNXA 3MC0B 1SYCA 2RSOA 4WFN3 2ZTCA 1JC7A 4KKTA 1AE3A 1RHPA 4UP7A 1JWSD 4KHZA 1D2BA 3A7LA 3HZXA 4LUOA 4FXDA 1XNRQ 2B2VC 1WCMG 2EY2A 4R8NA 1KHIA 2EYPA 3CC2A 4A3MH 1WTQA 2I07B 2VB3X 4OL7A 1Z9FA 2EDGA 2Z8LA 2WFWA 2XGTA 2QA4A 3ULJA 2A8VA 3KUPA 1CKNB 5DNFA 4JI5L 4BY1G 2E2HH 3H94A 3NWTA 3C1FA 4C3HH 5M3MH 1YITA 2JA8B 2JA6H 4QF4A 2R7ZG 1N36L 1K8AC 5ELBA 1HNZL 2K7VA 2UU9Q 5I2YA 1XPOA 2YTYA 4DK6C 2B2WC 4YY3Q 4CJ1B 1I5FA 2C35B 1JOKA 2IPKD 1SYGA 2JJQA 1K0RA 4A3JG 1NE3A 1STHA 5KNCA 3CU7A 2CQAA 3C2PA 2AQ1B 2K5DA 1VQFA 3IRBA 4L8JA 3FPUB 4KI0A 3NQIA 2A69C 1WD0A 4NXML 1TS4A 1IL8A 4MHEA 2O2LD 4X62Q 1LT4D 1WI5A 4GKKL 1B1ZA 3OTOQ 3V96A 1PTOB 4DV6L 5AFWA 4A3EH 1F2LA 5C4XH 1PLFA 2ZJPA 5K5PA 4IUVA 2VNUD 1KNEA 1PH1A 1Q3LA 3HOWH 2PW5A 4R1JA 4LF6Q 4UY8C 3J81L 2WV6D 3T13A 3L3OC 1YHAA 5COYA 3J7AV 1A2UA 3PQIA 4HMJA 3OW2A 4O0AA 2J4XA 2SDFA 2B63B 3CCLA 2UU9L 1GUSA 4H02A 1J8IA 1SYDA 1TWGB 5CR3A 1DJRD 5C44H 4RH6A 1ENAA 1SMYD 1A3UA 2CWAA 4GLXA 1FR3A 2HDLA 5LMNQ 2B2UA 3NTIA 4UHVA 5DEHA 3URYA 1PFSA 2JA8G 4C3IH 1R9TB 1CA6A 1WTOA 4HSVA 3FKIB 4QB4A 1V1QA 1HZCA 5FLMH 2XRQD 1CK1A 2Z1CA 2J7ZA 4RHSA 4KTAA 1EY8A 3CCMA 4LF9Q 1EQRA 1HPCA 4IFDI 4X3TA 2EQSA 1SNQA 1N32Q 3MHBA 3PCOB 1HR0L 1PMRA 2A69D 1VQKA 3GTPB 2Q2TA 3MXNB 5IP7H 4NP5A 3OYYA 3NSWA 2R7FA 2PZWA 2KHJA 3TP5A 1RL2A 1OXTA 3BDOA 2E74C 3CQZH 4UP8A 5IY0A 3D3RA 2R7ZB 3E9HA 3A5ZB 5KNDA 3D4RA 4DV4L 1CA5A 1I3QB 2R92B 3DM1A 1K83B 2FHTA 1VQ7A 4OIKA 2G9DA 3P20A 4X3UA 3GQBA 1WVLA 4DR7Q 4GS3A 1GUOA 3TP6A 1I94L 1AEXA 3MFYA 1ZYRC 4K6LA 1YI2A 1IBLL 4P73A 5C3EB 1JB3A 4KN7C 4AYBE 2XWJB 3PO3G 1ENFA 4KN4C 4BBRG 1FNWA 2B8GA 4LFAL 2EXDA 3SHLA 2A5HA 4LUZA 1S72A 4JOIC 2QEXA 1C8CA 3CXCA 3KF8A 4DV2Q 1H9SB 1Q81C 2A1AA 4K5VA 1AP0A 4A3FH 1VQMA 5IGDA 1QNUA 5E1FA 3JC66 2JA6G 4JYAQ 1SMYC 4DV0L 4B9XA 4K0KQ 1H9KA 1Q86C 1B3QA 1TR5A 1IYUA 3M4QA 3MZ5A 2R93H 4C3JH 2F3VA 1WFQA 3A55A 4DK0A 4QUCA 1OXVA 3TBIB 2I0QA 4GN4B 4KY7A 2I46A 1STNA 1S5DD 3EVQA 1STGA 4HTHA 3V2TA 1EY0A 5NUCA 3NXWA 5J3BA 2ZT9C 1D7QA 2X69A 4ZCKA 1QNKA 3HOVG 1CSQA 2A74C 1H95A 4NB3A 2LKVA 3R2TA 2CCZA 4OONA 4F88A 3VYSA 4ZLTF 4RGTA 4CDFC 5FLMG 1UWVA 1YZ6A 1G6ZA 1M4VA 4G4KA 1JT8A 1F9SA 1YNJC 2E8GA 3LX0A 4TRDA 4ID6A 4IOCA 4JI8Q 3I4MH 1F9QA 1HTLD 4MTKA 1KDAA 4A3FG 2NVYH 1FVIA 4DR6Q 2LFNA 1ASZA 1VQOA 5CV5A 2L55A 2UXBL 1BF4A 1IBML 1UE6A 3K5OA 1BXTA 1ILQA 1O7YA 2VY3A 4JVZA 2Z4HA 3RN2A 2P5ZX 2JA5G 2E75C 2QILA 2YV5A 3I72A 3IFTA 4FXGC 1BBUA 5ELCA 1BQQT 1K73C 3CHBD 2E2DC 2V4DA 1BCPC 2K33A 1Y8PB 3S1MH 2MO1A 1A0IA 5M3MB 3G6EA 2WAQG 3NP8A 1P8LA 1K0SA 3D4DA 2D5DA 5FLXL 1EU4A 4PQXA 4A3GH 1CHQD 2OTLA 2DNCA 4XQJA 1DCZA 3A7AB 1PFBA 4NXMQ 2B8FA 4HIKA 1EWIA 2EZVA 3Q0AA 1WTVA 2NZHA 1L1OB 4N8FA 1IW7C 3AYHB 4C1NK 5C6AA 3KLRA 3OWFA 2VQFL 5C3EH 2F0TA 5JPMC 5G3LD 2KA7A 5CYUA 4GOPC 4A93H 3M4YA 2WB1E 5ELOA 4LF8L 3GTOH 2PMZE 2EXZA 1ONLA 4HN7A 1GHKA 3KLWA 1HA5A 1E2VA 3W5OA 5EAYA 3I4MG 1PV4A 1H9JA 4PZ6A 1VQPA 2JEAI 1NTGA 3L0OA 5HY6A 1XPUA 1SNDA 1HNWQ 3W3AA 1WOCA 2KCCA 2ZTEA 4LK1C 2ASBA 4DR1Q 5M5WH 2QKIC 4X65L 1EFWA 4RCNA 5LL6X 2PQAB 4YY3L 1K3BC 1S4ZA 3J81c 4JCVE 1AH9A 4TSSA 3I55A 5IIFA 4QIWE 2RDFA 5KRUA 4WJ4A 2EY6A 5C4JH 4GN3B 3X3MA 5BN5A 1AN8A 1XNQL 2RA4A 4KKUA 3GTLB 1L0XB 3PUYA 1BVSA 4DV1Q 3OMGA 2Y0SE 2L9HA 3ULLA 3HOWG 1STAA 1EL0A 2HD3A 3MFGA 3AU7A 3ZJYC 1NMGA 4B3MQ 4LF8Q 1ZEQX 1PA6A 1JOQA 2OXPA 1RKNA 4Q0FA 1BCPD 2CVRA 1GVPA 2FJ2A 1SFOB 2VQEQ 4DV4Q 3S2DH 4PZ7A 2VS1A 2PQEA 2XNAC 5EJWA 1EIGA 2NYZD 4K8JA 3U4ZA 2PCFB 3CMEA 1NR2A 4P71A 3I4OA 4EQ5A 4A3JH 1LTID 2DUDA 5C0XH 3OW7A 4BY7B 1NY4A 1LTSD 3HOZG 4QJFA 2ALYB 2CWPA 4FF2A 4IUPA 4ZYSA 4CDEC 5C44B 4A3CH 2NBFA 4GLVB 4IALA 2JA9A 2EYHA 5A2QL 1D1IA 3STBC 5KEEA 3AQQA 4DV7Q 2QDBA 2Q8IB 3SGIA 4QY7A 3PUZA 1R4PB 3NPPA 4WORA 4OEMB 3HKZE 1VQ8A 4A3DG 1BCPF 1G8ZD 3BDLA 2WIIB 4JYAL 1BNZA 3HOWB 1K8OA 2IHFA 4DR3Q 1S40A 4DU9A 2NVXH 1CZGA 5C5MA 1YVCA 1PFNA 4EQNA 4RFBA 4DV5L 3RR5A 2OEOA 4LFCL 2BE5C 3D6WA 4DR4L 3F2BA 1TWGH 3TS0A 1U4MA 2F0VA 1X6OA 2MUYA 1O80A 4RG1A 2NVTH 2M00A 1CUKA 4O2DA 2F0OA 4BBSG 5D3DA 2PI2A 1RCVD 2D9UA 4ME5A 2Q8TA 3HOXB 1K8MA 2D0PA 1YNNC 4RMFA 3SK6A 2VL6A 1EYDA 2JE6I 3UDXA 1GUWA 3K5NA 1ILPA 3T53B 2B63G 3SDZA 4HAEA 3UDFA 1O7ZA 3PIPA 4DR7L 4CKCA 1AW7A 2IWHA 4A93G 1P16A 2C5CA 2V1CC 3UDIA 3CMAA 5C3EG 5JJKA 1PH2A 4P75A 2AUKA 2Z0SA 3CW2C 4DR3L 3BS1A 1A2TA 2SEBD 5D3IB 4QCLA 1FGBD 3PSIA 4A3BB 4S3SA 3HKZB 3MA2B 4KLKA 1DM0B 3NBHA 1JB7A 5EGTA 1IBMQ 2XN9C 2FINB 2ICIA 3S17B 4RA8A 1VQEA 5EQ0A 4E6IA 5C44G 1LTRD 5IT9c 5JAVA 2WB1B 1L2FA 3RLOA 1HR0W 1UAPA 3QG1A 1X65A 4A3LG 2FXQA 3UDGA 2CKZB 4DAYB 4K0KL 2JN4A 4XYQA 3HOXG 4FF3A 4A3BH 2L4NA 1ICWA 1JJ2A 1SBBB 4X66L 2K1BA 2IW3A 3QOLA 3S24A 2ZJQA 1Y1VB 1FJGQ 1RTOA 2F4VL 5DM63 3OPOA 4CKEA 1Q7YC 1HJPA 2A73B 3HGBA 3HS0C 3H0GG 1XMQL 2OCEA 2KEEA 2L1BA 2FMCA 3UE0A 2KCTA 4BY1B 2F52A 4C1NI 4XIGS 4X3SA 5BN3A 1IBKQ 3GDEA 3PIP3 1SDFA 3UI2A 3EJIA 4GKKQ 5M3MG 3J81E 4DR2L 4DAYA 4YCUA 1VQ5A 2BCOA 4IUTA 3TMEA 4GOPA 1PH6A 2FMMA 3U9OA 3X3NA 4NPSA 3Q8DA 4LF6L 1DZ1A 2KBNA 1C0AA 1E7ZA 2K4KA 1YJ9A 5CV6A 4Y7NB 4HJAA 2UXBQ 4A4IA 1E1TA 1S5FD 3SE0A 2JQOA 3RLNA 3EQLC 2PZTA 3EN2A 1MSHA 2K04A 1B53A 2QDLA 4A3KH 2BA1A 5FJ8G 2R93B 3K0XA 1CQVA 2O4XA 3EBEA 1I6HB 4ULLA 5FJ8H 5LMUL 1NBWA 2N8NA 1Z6HA 5M3FB 1JWUD 5D14A 3HEJA 3NUCA 4HSPA 3TRZA 3T4AC 5K36G 5IYCH 1KD1C 4YIJA 5FO8B 4NXNQ 4DV3Q 1GUNA 4OWWB 2VQEL 1QCBD 1F2YA 2VZAA 2CH4W 3VYRA 2HDMA 3DMUA 3FMCA 1B2TA 1G2TA 2ZXPA 4Y7NH 3HOYG 1VQBA 2JA7H 1NSNS 1CZWA 2UXDQ 4UPAA 2IJ0A 1B9MA 1JR0D 2Q8RE 5IWAQ 2NTTA 4G7HC 3WOEA 2L0CA 3ONAB 1TWAB 2PZUA 3AMUA 5DM73 2HUGA 2Y0SG 2E2IH 4CHTB 2YYZA 2Z6BA 1WTHA 2R3ZA 1B70B 2K05A 4OIJA 4L5RC 3GTMH 2F3WA 2PNRC 1PFMA 3GTJB 1VQ6A 4EQPA 3MXGA 1KDBA 3CPWA 1SNCA 4BBRB 4JK1C 2MP1A 5M5YB 1TU2B 1TKWB 1WTXA 2M9VA 4GN5A 3K8AA 2F0JA 4RWSC 3A5UA 2HIVA 3E9IA 4DR5L 1KRSA 1Q1EA 1Y1WB 4OX9L 4OO1I 2FFKB 3QJYA 1JMCA 2NVQB 5F2DA 4TQUS 1UE5A 3SK4A 1X3PA 3C3LA 1PZID 5LHY1 1TVXA 3RLFA 3M7NA 1HNXL 1JJCB 4MNOA 1E24A 2WAQB 2I5MX 3BJUA 5GQOA 1VMPA 2F0GA 3NQTA 4V0BA 3BZDB 1F77A 4PMBA 1RDPD 1TWHB 5KYLA 5JVH3 1ASYA 2MGSA 1O78A 5CORA 1EEFD 3H09A 3CP0A 2A6HC 2MHVA 1SJED 4R4TA 1I50H 3RZDH 5H1SE 2CH4A 4DAPA 1G2SA 3CPFA 4PV1C 1QE6A 1PRTD 4I7AA 1PTOD 2E2HB 1PRTB 1QUQB 1B8AA 4CBVA 2GVBA 3BYYB 3S1MB 5DLQE 4JI8L 5JPNC 3PIO3 4XYOA 1II3A 1HHVA 3I2ZA 2NVTB 3F8TA 2B2YC 2Z6KC 5KGUA 2MJ8A 1KDCA 1TWHH 1ICFB 4DKAC 1N8RC 2N88A 2ATWA 3STBD 1ESRA 5E3FA 3U4VA 1WTRA 4YCVA 2EYFA 2H1EA 5C0XG 4QQBX 2JA6B
chains in the Genus database with same CATH topology
1EQTA 4XTCS 3K5LA 4QIWB 5JEAJ 1OXUA 4LJZC 3TN2A 3VR6A 1EY5A 4IFDG 4K2KA 3S16B 3KBGA 2NVXB 2N55A 4RHRA 3FRPB 3K0YA 1E2ZA 3PUWA 5EPKA 2IT1A 1O7LA 1IKMA 1V1OA 1PTOF 3JAML 5D65A 1I4RA 1EY7A 4DXGA 5CGKA 5M9OA 3C1EA 1LACA 1CI3M 4K5WA 4RGNA 3G7LA 4DF7A 3R8BA 3SK5A 2B39A 2HQEA 3NTKA 4I65A 1GHJA 5HGTA 2JEBI 4KK7A 3E5SA 1TT2A 3EA6A 5ELFA 3I4LA 1E2WA 1SXTA 3K6OA 4IFDJ 2KHSA 4XXEA 1CTMA 4AYBB 2EYLA 3K59A 5JEAG 1I4QA 3I73A 2X6LA 5IGFA 5FO7B 1GJXA 4C3IB 4DXFA 4RGMA 5I2XA 2CW0D 3LNNA 2NUCA 1Y69U 4IUUA 1SE2A 1DOLA 1BCPB 4IZ8A 1IHZA 4Z9CB 2E2IB 4J1MA 3S1RB 3S1NB 5J39A 1VF7A 1RODA 2PO4A 4RGOS 4V190 2AQ3B 5EPJA 1H9RA 4A3IB 1B50A 5BN4A 4H0LC 1PYWD 1U4PA 2EE1A 3F2UA 4A93B 1Z47A 4KJOA 2RVLA 1HFNA 1U9RA 1TS5A 3S1QB 1JICA 2RDHA 4G7ZC 5EBCA 4B08A 1LTBD 2EJGC 3A56A 1YNJD 5CV7A 3MVVA 3I4NB 1W6KA 1H9MA 4F8MA 2JA5B 4DFAA 4OO1H 2XSCA 1RD9D 4L6TB 3VA5A 3E0JA 2IL8A 2EOTA 2BOSA 3NE5B 5I4DA 1XWEA 3NTHA 1LO5D 1NAPA 2K28A 2R6GA 2LY7A 5CV4A 2F0LA 1BO0A 4QUFA 2NB0A 1ESFA 3IL8A 1JCKB 4HR7B 1V1PA 1VDZA 1AFPA 2SOBA 4K2LA 5IT9L 4FF4A 2A6EC 3ND9A 5C5LA 3HOVB 1LTGD 1ET6A 4FXKC 4K14A 1DD2A 1S5ED 1HQMC 2G9HD 2XVSA 2F0KA 5JVG3 3M4OB 1CT1D 1HXYD 1Q1BA 1IYVA 4IN3A 3QIAA 3DUZA 4ZKBB 4RKBA 2F0DA 1Q12A 1GXDC 3QWNA 1ZYRD 5I9PA 2PPBC 1CM9A 2TSSA 5I6YA 3OIPA 2X6GA 1ML0D 3GD7A 4IUNA 3R3OA 3M3YB 5TSSA 3TDQA 4OHJA 1EYAA 3I90A 5IGEA 4X3KA 1BDOA 2BDNA 3LWEA 2RQXA 5CBAE 3GO5A 3T51B 4ZUJA 4XQQA 4A3JB 2NN6G 2B2TA 2NN6H 1F9RA 1JE4A 4C3JB 1IKLA 2JA7B 4NW2A 2L5TA 3U9SA 3GTQB 3Q6SA 1TY0A 4ABNA 5DAUA 1T5EA 2EYJA 2K03A 1MBYA 3S9WA 1A6XA 2VB2X 1EZ8A 4O1NA 4XDXA 1U4RA 3P7JA 3BVMA 4OGQC 3PO2B 3MTSA 3OOCA 2RDGA 1NCVA 3I70A 1EIHA 3H0GB 1U4LA 3P1HA 2DNEA 1RJTA 1PZJD 4ZRZA 5ELDA 2IX1A 2Z4IA 2DN8A 1OXXK 3KBXA 2E76C 5J1ZA 2F0FA 2PMZB 1HQRD 4BA2I 3HOZB 3TZUA 5C4XB 4KV6A 5CC4A 3VYUA 4A3EB 5E4WC 1EZ6A 1T5XD 1PZKD 5EKLA 3VA7A 2BE5D 1OXSC 5KYIA 2AWOA 4JBWA 1JQYD 1QOHA 2B2WA 3DEOA 4EGVA 1PTOH 5IODA 3KK7A 1KABA 3S2HB 1MD2D 1QJOA 1D1KA 1EEID 3CRLC 1UUPA 3DHQA 1PRTF 1LT5D 1G91A 2EJFC 4XT3B 4BBSB 1PTOC 3NWSA 3BYTB 1Y8OB 3ND8A 3HP3A 4QMGA 1X32A 1EY4A 4HCEA 3T56B 2KVMA 3R2IA 2KQ3A 3CKIB 4EVOA 5EKIA 1LABA 3EFXD 1WTWA 2NZ1D 4RCOA 3LWUA 1S5CD 4FF1A 5KNBA 4P2CB 3DWPA 4C3IG 2QCPX 3IFDA 3WOFA 1XTCD 5IGCA 3TSSA 1LLRD 4A3GB 1GUGA 4G57A 1LTAD 1XXGA 2SNMA 1S5BD 2F0WA 1H9SA 3O13A 3OIQA 2DY8A 3DWAA 5T1GA 3FDTA 3RD4A 1V1PB 2JXMB 3A54A 3RMHA 3A8IE 1TY2A 5FOBB 3H91A 2EJMA 2O5JC 4NKLA 3I3CA 5IGBA 1E0BA 4UAIA 1R4QB 5C0XJ 1STEA 2F0QA 3RZDB 2VXWA 3GV3A 2OT2A 4KJNA 1C48A 2ENBA 4DA2A 3PMFA 3JAME 3H6MA 5C4ZA 3CRKC 2B2TC 5C4HA 4MIUA 1LT6D 3GTGB 1MI2A 1VMCA 3HG9A 4NDXA 1BR9A 1GUTA 3VYTA 3SVMA 2K32A 3VR5A 3PUVA 3OSOA 3QOJA 1LT3D 1KLGD 2RBMA 1STYA 3SEBA 3K7AB 1TQOA 4CGYB 5M5XB 4EQOA 4G7OC 2WKDA 1PXUA 1SNMA 3GV6A 4KD4A 3KLSX 4C3JG 1V8QA 2ICEC 3A8JE 1HRJA 4PNYA 4Q5VA 2F0SA 2BA0A 1YNND 1QB5D 2F0NA 5LL6S 5CV9A 2B2UC 1VF5C 5E4XA 4DGZA 1AZQA 1DOMA 1B9NA 3BDCA 3NHHA 2HCIA 1AZPA 1SNOA 3PO3B 1IW7D 2H4OA 1EQVA 3VR3A 3S14B 2F0HA 2VUMB 2LMCB 2R61A 4BS9A 2RKSA 4LMQD 3OWEB 5I9OA 1DYQA 1TS2A 1CHPD 3BVZA 1EOTA 3IAYA 1F9PA 3I91A 4LAAA 4C3HG 2NN6I 1A3TA 1SE3A 5ISRA 1UEAB 4ZKCB 3MWYW 4GZYC 3W2DA 3K57A 2D2CC 4ZAIA 2L11A 4DN4M 3N6RA 2EYOA 1PRTC 4PMWA 1I4GA 4IQZA 2O5IC 1MGSA 2D62A 1BBXC 1D5XC 3MXUA 1SAPA 1VCIA 5CMDA 2MPMA 4C3HB 1WTPA 5HURA 2K5QA 3D4WA 2KEDA 5IT9E 2XWBB 2KECA 3RUZA 5I6WA 5A2QE 3D8GA 2WACA 2F0IA 4R9WA 3ZYYX 2XRSD 1M8AA 3OMCA 3VR4A 1HFGA 1D5ZC 3SK8A 1SYBA 1HUNA 2L12A 4M1UB 3C46A 1D5MC 1HA6A 1L0YB 1SYFA 3KLSA 1STBA 3J7AF 2QF7A 5T1IA 3IKJA 3DWQA 4H7BA 1I4PA 2F1MA 4KD3A 2M2LA 4H13C 1UNSA 3J80E 2EPBA 2F03A 1Q8IA 5IGGA 1HCZA 5FLXE 1EYCA 2NVYB 2A68C 4KMUC 5C0XI 1I50B 2GA4B 1QWYA 1FNUA 2LS01 1SJHD 3D31A 1ENCA 4ILWA 3HOYB 2CHBD 1HUMA 5ELEA 1KAAA 4UDUC 2KOLA 2PW7A 1DXMA 2F0PA 1Z7TA 3M7GA 5FO9B 4PMCA 4ZUIA 1EY9A 4L63B 3J7YW 2KCNA 3RZOB 1I4HA 5FKAC 4R8IA 5EKKA 1JOOA 1ZKOA 2KJXA 1A3VA 3TZDA 1EU3A 1CFMA 3DXJC 1D6EC 4U673 1XX8A 1ZXTA 3V05A 3GTMB 3S2DB 4F87A 3QO2A 4DNTB 1ET9A 2K01A 1TIID 5IOCA 1SE4A 4KY6A 3MAQA 4IFDH 1EFID 1I6VC 2A68D 1GOZA 1DONA 3E6ZX 5J22A 5G3LF 3CQZB 1V43A 1G291 4HMIA 3A8KE 4J6HA 2HCCA 1TWCB 4KHVA 2RSNA 3GTOB 1BOSA 1J9OA 3DEPA 3R93A 3D6CA 2EY1A 3FEWX 4RKLA 4O42A 2IX3A 3QB3A 5C4JB 2J0TD 2Y0SB 2AWNA 1PDQA 3MXNA 4I7ZC 1EWHA 4HEDA 1Y8NB 3VR2A 3BG3A 4C2MB 4FO2A 1F2ZA 2B2VA 3MEHA 3GP7A 2F0UA 4XQNA 1QILA 1NR4A 5JEAH 4RAUC 3M85A 2ID0A 4N9TA 4K6DA 3K58A 4HCSA 1TWFB 2DY7A 1Q90A 3P75A 5M5WB 2AQ2B 1SNPA 3PUXA 2NWGA 5EBDA 3HOUB 4F7XA 1KTKA 4BWGB 4U68A 1BUVT 2CW0C 2QEJC 4C56C 2E2JB 4H44C 2F0MA 5C3WA 2PYKA 5CV8A 4CJ2C 3TP7A 2ZXRA 2EYMA 2K5WA 2JYOA 3K5MA 4BA1I 2ZXOA 3EROA 3I8ZA 4A3MB 4A3DB 1F2MA 1WCMB 1I4XA 3ERQA 4ODGA 4WRDA 4XT1B 4MN3A 5C3XA 1MSGA 3L7ZC 2SNSA 4FP5D 2BDOA 2JP1A 4DK1A 1RTNA 1TS3A 4M8AA 4FVMA 2KUMA 4CKBA 1X3QA 3BVGA 1SYEA 2TMPA 1C4QA 2JSOA 1FNVA 5A35A 2B2YA 2WP8J 5K36H 3I4MB 3TP8A 1CQFA 1HTPA 4NMZA 4DAVA 1SEBD 4DNRB 1JORA 5KIXA 4K8IA 2AUJD 3OHXC 3NK9A 1NUCA 3G6JB 3T16A 3GTKB 1A15A 3N52A 2XIWA 1WD1A 3FVQA 4OO1G 4CJ0B 4K5XA 1JWMD 4IURA 4KKSA 1EWCA 3Q22A 5FK9C 4IUQA 4A3FB 2A6HD 2WINB 3ITPA 3L9AX 4ZQ3A 1W6JA 4ZK9B 3J80L 1B4OA 3Q23A 4KY5A 2YU9B 3HRZC 2F4IA 1XYIA 4FYDA 4N9PA 5CBEE 2C9OA 3FPPA 2EY5A 1RF2D 1DOKA 5EPLA 1KNAA 5JOBA 4TKOB 1B44D 2A6ED 3SR1A 3Q24A 4B9WA 2F0EA 1B3AA 1QG7A 1FD7D 4J8QA 2IX0A 1EY6A 1OO9B 4A3KB 3SXHA 1LV9A 3WDNA 5JJZA 2K6AA 2WKCA 2EVBA 3MXPA 1FYCA 1KLUD 2OF1A 2NTSA 3PV0A 4FNFA 3AB9A 3H3VC 4WJWA 3S15B 1LTTD 3NBIA 1SSOA 3MC0B 1SYCA 2RSOA 4WFN3 1JC7A 4KKTA 1RHPA 1JWSD 4KHZA 1D2BA 3A7LA 3HZXA 4FXDA 2B2VC 2EY2A 4R8NA 2EYPA 1WTQA 2I07B 2VB3X 4OL7A 2EDGA 2Z8LA 3KUPA 5DNFA 3H94A 3NWTA 3C1FA 2JA8B 4QF4A 5ELBA 2K7VA 5I2YA 2B2WC 4CJ1B 1JOKA 2IPKD 1SYGA 1STHA 5KNCA 3CU7A 2CQAA 3C2PA 2AQ1B 2K5DA 3FPUB 3NQIA 4KI0A 4L8JA 2A69C 1WD0A 1TS4A 1IL8A 4MHEA 2O2LD 1LT4D 1B1ZA 3V96A 1PTOB 5AFWA 1F2LA 1PLFA 5K5PA 4IUVA 2VNUD 1KNEA 1Q3LA 2PW5A 3J81L 2WV6D 3T13A 3L3OC 5COYA 3J7AV 1A2UA 4HMJA 2B63B 2J4XA 2SDFA 1GUSA 1J8IA 1SYDA 1TWGB 5CR3A 1DJRD 4RH6A 1ENAA 1SMYD 1A3UA 1FR3A 2HDLA 2B2UA 3NTIA 5DEHA 3URYA 1CA6A 1R9TB 1WTOA 4HSVA 3FKIB 4QB4A 2XRQD 1CK1A 2Z1CA 2J7ZA 4RHSA 4KTAA 1EY8A 1HPCA 4IFDI 4X3TA 1SNQA 3MHBA 1PMRA 2A69D 3GTPB 4NP5A 3NSWA 2PZWA 3TP5A 1OXTA 3BDOA 2E74C 3D3RA 2R7ZB 5KNDA 3D4RA 1CA5A 1I3QB 2R92B 3DM1A 1K83B 2FHTA 4OIKA 2G9DA 3P20A 4X3UA 1WVLA 3GQBA 1GUOA 3TP6A 1AEXA 3MFYA 1ZYRC 4K6LA 5C3EB 1JB3A 4KN7C 2XWJB 1ENFA 4KN4C 1FNWA 2B8GA 3SHLA 2A5HA 1C8CA 3KF8A 1H9SB 4K5VA 1AP0A 5IGDA 1QNUA 5E1FA 1SMYC 4B9XA 1H9KA 1TR5A 1IYUA 3MZ5A 4DK0A 2F3VA 3A55A 4QUCA 1OXVA 3TBIB 4KY7A 2I46A 1STNA 1S5DD 3V2TA 1STGA 4HTHA 3EVQA 1EY0A 5NUCA 3NXWA 2ZT9C 2X69A 1QNKA 2A74C 2LKVA 3R2TA 4F88A 4ZLTF 3VYSA 4RGTA 1G6ZA 1M4VA 4G4KA 1F9SA 1YNJC 3LX0A 4TRDA 4ID6A 1F9QA 1HTLD 1KDAA 2LFNA 5CV5A 2L55A 1BF4A 3K5OA 1BXTA 1ILQA 1O7YA 2Z4HA 2E75C 2QILA 3I72A 3IFTA 4FXGC 5ELCA 1BQQT 3CHBD 2E2DC 2V4DA 1BCPC 2K33A 1Y8PB 5M3MB 3NP8A 3D4DA 2D5DA 5FLXL 1EU4A 4PQXA 1CHQD 2DNCA 4XQJA 1DCZA 3A7AB 1PFBA 2B8FA 2EZVA 3Q0AA 1WTVA 1IW7C 4C1NK 5C6AA 3KLRA 3OWFA 2F0TA 5JPMC 5G3LD 2KA7A 5CYUA 3M4YA 2EXZA 1ONLA 4HN7A 1GHKA 1HA5A 1E2VA 1H9JA 2JEAI 1SNDA 3W3AA 4LK1C 2KCCA 2QKIC 4RCNA 5LL6X 1S4ZA 4TSSA 5IIFA 2RDFA 5KRUA 2EY6A 3X3MA 5BN5A 1AN8A 2RA4A 4KKUA 3GTLB 1L0XB 3PUYA 3OMGA 2L9HA 1STAA 1EL0A 3MFGA 3AU7A 1ZEQX 1JOQA 2OXPA 1RKNA 4Q0FA 1BCPD 2CVRA 2FJ2A 1SFOB 2PQEA 2XNAC 5EJWA 1EIGA 2NYZD 4K8JA 2PCFB 1NR2A 1LTID 5C0XH 3OW7A 4BY7B 1LTSD 4FF2A 4IUPA 4ZYSA 5C44B 2NBFA 4IALA 2EYHA 5A2QL 1D1IA 5KEEA 2QDBA 2Q8IB 3PUZA 1R4PB 3NPPA 4WORA 1BCPF 1G8ZD 3BDLA 2WIIB 1BNZA 3HOWB 1K8OA 4DU9A 1CZGA 5C5MA 1PFNA 4EQNA 4RFBA 2OEOA 2BE5C 3D6WA 1U4MA 2F0VA 2MUYA 1O80A 2M00A 2F0OA 5D3DA 1RCVD 3HOXB 2D9UA 4ME5A 2Q8TA 1K8MA 3SK6A 1YNNC 1EYDA 2JE6I 1GUWA 3K5NA 1ILPA 3T53B 3SDZA 4HAEA 1O7ZA 4CKCA 1AW7A 2IWHA 2C5CA 2AUKA 3BS1A 1A2TA 2SEBD 5D3IB 4QCLA 1FGBD 4A3BB 4S3SA 3HKZB 3MA2B 1DM0B 3NBHA 5EGTA 2XN9C 2FINB 2ICIA 3S17B 4RA8A 5EQ0A 4E6IA 1LTRD 5JAVA 2WB1B 1UAPA 3QG1A 4XYQA 4FF3A 2L4NA 1ICWA 1SBBB 2K1BA 2IW3A 3QOLA 1Y1VB 1RTOA 5DM63 3OPOA 4CKEA 2A73B 3HGBA 3HS0C 2KEEA 2L1BA 2FMCA 4BY1B 4C1NI 4XIGS 4X3SA 5BN3A 3PIP3 1SDFA 3UI2A 3EJIA 3J81E 4DAYA 2BCOA 4IUTA 3TMEA 2FMMA 3U9OA 3X3NA 1DZ1A 5CV6A 4Y7NB 1S5FD 3SE0A 3EQLC 2PZTA 1MSHA 2K04A 1B53A 2BA1A 2R93B 1CQVA 2O4XA 1I6HB 4ULLA 1Z6HA 5M3FB 1JWUD 5D14A 3HEJA 3NUCA 4HSPA 3T4AC 5K36G 4YIJA 5FO8B 1GUNA 1QCBD 1F2YA 3VYRA 2HDMA 3DMUA 3FMCA 1B2TA 1G2TA 2ZXPA 1NSNS 1CZWA 2IJ0A 1B9MA 1JR0D 2Q8RE 2NTTA 4G7HC 3WOEA 2L0CA 3ONAB 1TWAB 2PZUA 3AMUA 5DM73 2HUGA 4CHTB 2YYZA 2R3ZA 2K05A 4OIJA 2F3WA 2PNRC 1PFMA 3GTJB 4EQPA 3MXGA 1KDBA 1SNCA 4BBRB 4JK1C 2MP1A 5M5YB 1TU2B 1TKWB 1WTXA 2M9VA 2F0JA 4RWSC 1Q1EA 1Y1WB 4OO1I 2FFKB 3QJYA 2NVQB 5F2DA 4TQUS 3SK4A 1X3PA 3C3LA 1PZID 5LHY1 1TVXA 3RLFA 3M7NA 2WAQB 1VMPA 2F0GA 3NQTA 4V0BA 3BZDB 1F77A 4PMBA 1RDPD 1TWHB 5KYLA 5JVH3 2MGSA 1O78A 5CORA 1EEFD 3H09A 2A6HC 2MHVA 1SJED 4DAPA 1G2SA 4PV1C 1QE6A 1PRTD 1PTOD 2E2HB 1PRTB 4CBVA 3BYYB 3S1MB 5JPNC 3PIO3 4XYOA 1II3A 1HHVA 2NVTB 2B2YC 5KGUA 2MJ8A 1KDCA 2N88A 1ESRA 5E3FA 1WTRA 2EYFA 2H1EA 5C0XG 2JA6B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GA4 B;  1QNU A;  1BOS A;  4P2C B;  2XSC A;  1CZG A;  1CQF A;  1C48 A;  1QOH A;  1DM0 B;  2BOS A;  4ULL A;  1C4Q A;  1D1I A;  1CZW A;  3MXG A;  4M1U B;  1D1K A;  2C5C A;  1R4P B;  1R4Q B; 
#chains in the Genus database with same CATH topology
 3KJO A;  1EQT A;  4R4O A;  4XTC S;  2VUM G;  2YTX A;  4DR4 Q;  2ZM6 L;  3K5L A;  4OWT B;  4R4I A;  4QIW B;  1JJG A;  5JEA J;  1KIX A;  3S2H H;  1OXU A;  4LJZ C;  3TN2 A;  1DGS A;  3DM3 A;  3VR6 A;  1EY5 A;  4IFD G;  4K2K A;  1IBK L;  1XMO L;  3S16 B;  1KRT A;  3KBG A;  2NVX B;  1QUQ A;  3H3V I;  2N55 A;  3A74 A;  4RHR A;  3FRP B;  3K0Y A;  3PO3 H;  4JBM A;  1E2Z A;  1VQG A;  3BU2 A;  4DV1 L;  3PUW A;  1VQJ A;  2IT1 A;  1O7L A;  5EPK A;  1W2B A;  1V1O A;  1IKM A;  1PTO F;  3JAM L;  5D65 A;  5HGQ A;  2K14 A;  1I4R A;  3CCS A;  2E2J H;  1EY7 A;  4DXG A;  5CGK A;  5M9O A;  3C1E A;  2R92 G;  1LAC A;  4GKJ L;  1CI3 M;  4K5W A;  4RGN A;  3G7L A;  2VQF Q;  1QVF A;  4DF7 A;  3WWV A;  3R8B A;  3SK5 A;  2B39 A;  2CQO A;  4GNX C;  2OWO A;  1SRO A;  2HQE A;  2B3G A;  2UUC L;  4OXP A;  3NTK A;  4JC0 A;  4I65 A;  1GHJ A;  5HGT A;  2JEB I;  4KK7 A;  3CC7 A;  3E5S A;  1TT2 A;  3EA6 A;  5ELF A;  5IP7 G;  3I4L A;  1E2W A;  1SXT A;  3K6O A;  4IFD J;  5M5X H;  5M3F H;  2KHS A;  4XXE A;  1GO3 E;  1CTM A;  4AYB B;  5LMU Q;  4MTN A;  2EYL A;  3K59 A;  2QW7 A;  4DV7 L;  3FHW A;  5JEA G;  2UUB L;  1I4Q A;  3I73 A;  2X6L A;  4X62 L;  4B3S L;  5IGF A;  5FO7 B;  1GJX A;  3GTJ H;  1YIJ A;  4C3I B;  1A62 A;  4DXF A;  4LF7 Q;  4RGM A;  5I2X A;  2CW0 D;  1HZB A;  2NUC A;  3LNN A;  1Y69 U;  4IUU A;  2Q2U A;  2XTI A;  1C7Y A;  1DOL A;  1SE2 A;  3GTK H;  1BCP B;  4IZ8 A;  3T1H L;  1IHZ A;  4ME3 A;  4Z9C B;  1PH5 A;  2E2I B;  4PG3 A;  4J1M A;  2UXD L;  3S1R B;  3S1N B;  5J39 A;  3EIV A;  1VF7 A;  1ROD A;  2PO4 A;  3U50 C;  4RGO S;  3PF4 A;  4V19 0;  3ICE A;  2AQ3 B;  5EPJ A;  4A3E G;  1H9R A;  4JI6 L;  4A3I B;  4TVA B;  1B50 A;  5BN4 A;  1D8L A;  4H0L C;  1PYW D;  1U5K A;  4A3C G;  3E3X A;  1U4P A;  2EE1 A;  3F2U A;  4A93 B;  4KJO A;  1Z47 A;  1HZA A;  4B3R Q;  2RVL A;  1N33 L;  1HFN A;  1U9R A;  1TS5 A;  3S1Q B;  2UUA Q;  1JIC A;  2RDH A;  1PH4 A;  4G7Z C;  4OWX B;  4A76 A;  4YHH Q;  4Y52 H;  5EBC A;  1CKN A;  4B08 A;  1LTB D;  2KCM A;  1XNR L;  2EJG C;  3A56 A;  1YNJ D;  5CV7 A;  1FGU A;  3MVV A;  3HOV H;  3I4N B;  2B63 H;  4POF A;  1W6K A;  1H9M A;  4F8M A;  3JAM i;  2JA5 B;  4DFA A;  4OO1 H;  2XSC A;  1RD9 D;  1BKB A;  4L6T B;  3VA5 A;  1NJI C;  3E0J A;  2IL8 A;  2EOT A;  2BOS A;  3NE5 B;  5I4D A;  1XWE A;  1Q46 A;  3NTH A;  4HIO A;  1LO5 D;  1NAP A;  1Y1W G;  2Z9H A;  2K28 A;  2R6G A;  5LMN W;  2LY7 A;  5CV4 A;  5E7N A;  2F0L A;  1BO0 A;  4QUF A;  2NB0 A;  1ESF A;  3IL8 A;  1JCK B;  4HR7 B;  1V1P A;  1VDZ A;  1AFP A;  3S16 H;  2SOB A;  4K2L A;  5IT9 L;  4FF4 A;  3CF5 A;  2A6E C;  3ND9 A;  5C5L A;  3HOV B;  1LTG D;  4LF4 Q;  1ET6 A;  4FXK C;  4K14 A;  1DD2 A;  1S5E D;  1HQM C;  2G9H D;  2AMC B;  2XVS A;  2F0K A;  2HT1 A;  5GAE C;  1PH8 A;  4AQY L;  5JVG 3;  3M4O B;  1CT1 D;  1HXY D;  1Q1B A;  1IYV A;  2K5V A;  4DV6 Q;  4IN3 A;  2DGY A;  3QIA A;  4GOP B;  3DUZ A;  2AHO B;  4ZKB B;  3L2P A;  3I4N H;  3HFZ B;  1YJW A;  4RKB A;  2F0D A;  3B6Y A;  1TWF H;  3S17 H;  4IO9 A;  1Q12 A;  1GXD C;  1BBW A;  4CDD C;  1HNX Q;  3QWN A;  5JJI A;  1ZYR D;  4R4Q A;  5I9P A;  3CCQ A;  1PYS B;  2PPB C;  1CM9 A;  4FDB A;  1PH7 A;  2TSS A;  5I6Y A;  3KOJ A;  3HOU H;  4A3G G;  1PH3 A;  3OIP A;  2X6G A;  1ML0 D;  1EUJ A;  3GD7 A;  1XMQ Q;  4IUN A;  1TWC H;  3R3O A;  3M3Y B;  3KYH C;  2RF4 A;  5TSS A;  3TDQ A;  1EOV A;  4OHJ A;  3CCV A;  1EYA A;  4LW1 A;  1K83 H;  3I90 A;  5IGE A;  4AIM A;  4X3K A;  2UUC Q;  2JA5 H;  1BDO A;  1J6Q A;  2BDN A;  3LWE A;  2RQX A;  2K5N A;  3AFQ A;  5CBA E;  3GO5 A;  3T51 B;  4ZUJ A;  4XQQ A;  2PI2 E;  4A3J B;  1N32 L;  2NN6 G;  2B2T A;  1VS0 A;  2NN6 H;  1PHJ A;  1F9R A;  3G48 A;  1JE4 A;  4C3J B;  1IKL A;  1I3Q H;  2JA7 B;  4NW2 A;  2L5T A;  3U9S A;  3GTQ B;  1VQA A;  3Q6S A;  1TY0 A;  2VW9 A;  4ABN A;  5DAU A;  1SFO H;  1YHQ A;  1T5E A;  2EYJ A;  2HHH Q;  2K03 A;  1MBY A;  2WB1 G;  3S9W A;  1A6X A;  2VB2 X;  5AJ3 L;  1EZ8 A;  4O1N A;  4XDX A;  1U4R A;  3P7J A;  3BVM A;  4B3T L;  4OGQ C;  4LF9 L;  3MTS A;  3PO2 B;  3OOC A;  1XPR A;  2RDG A;  1NCV A;  3E0E A;  4B3S Q;  2UXC Q;  1LM0 A;  3W1G A;  4DAM A;  1XMO Q;  3I70 A;  1EIH A;  2R92 H;  1W3S A;  3H0G B;  1U4L A;  3P1H A;  1IBL Q;  2DNE A;  1RJT A;  1PZJ D;  4DV3 L;  4ZRZ A;  5ELD A;  2Z4I A;  2IX1 A;  2DN8 A;  1OXX K;  3KBX A;  2E76 C;  5J1Z A;  1L0W A;  2F0F A;  2PMZ B;  1HQR D;  2MQH A;  4BA2 I;  4JI3 Q;  4IPC A;  1U0L A;  3HOZ B;  3TZU A;  1J5E Q;  4JI5 Q;  3FP9 A;  4UP9 A;  3K7A H;  4A3I G;  5C4X B;  2RHS B;  4KV6 A;  1IXR A;  3VYU A;  5CC4 A;  4A3E B;  2RCN A;  4DR1 L;  1I6H H;  5E4W C;  3VDY A;  1EQQ A;  2HHH L;  4JI6 Q;  4GLA C;  1SLJ A;  1EZ6 A;  1PH9 A;  1T5X D;  1VQ9 A;  1PZK D;  5EKL A;  3KF6 A;  3VA7 A;  3TRE A;  2BE5 D;  1OXS C;  5KYI A;  2AWO A;  4DUZ L;  4JBW A;  1JQY D;  1QOH A;  2IY5 B;  1QVC A;  2B2W A;  4APV A;  3DEO A;  5ELN A;  4EGV A;  1PTO H;  4L5S A;  5IOD A;  3KK7 A;  4A3M G;  1KAB A;  2UUB Q;  1WCM H;  4JI7 L;  3M4P A;  4YHH L;  4R4C A;  3S2H B;  1MD2 D;  1QJO A;  1D1K A;  1EEI D;  3CRL C;  1AE2 A;  1UUP A;  3DHQ A;  1PRT F;  1LT5 D;  1R9T H;  1G91 A;  4JI1 Q;  2EJF C;  4XT3 B;  4BBS B;  1KAW A;  1PTO C;  4OX9 Q;  3NWS A;  3BYT B;  1Y8O B;  3ND8 A;  3HP3 A;  4QMG A;  1X32 A;  1EY4 A;  4HCE A;  3T56 B;  2KVM A;  3M3Y H;  4YCW A;  3R2I A;  1X54 A;  2KQ3 A;  3CKI B;  4EVO A;  5EKI A;  1KL9 A;  1LAB A;  3J80 c;  3EFX D;  5IYB H;  1WTW A;  2NZ1 D;  2GVA A;  1X3F A;  4RCO A;  3LWU A;  1S5C D;  4FF1 A;  5KNB A;  4P2C B;  1XJV A;  3DWP A;  2DJG C;  2MO0 A;  5GRO A;  4C3I G;  4BBS H;  2QCP X;  2RCF A;  3CC4 A;  3IFD A;  4DPG A;  3WOF A;  1XTC D;  5IGC A;  3TSS A;  1LLR D;  3S15 H;  4DR6 L;  1GUG A;  4GKJ Q;  4A3G B;  4G57 A;  1LTA D;  1XXG A;  2SNM A;  1S5B D;  2F0W A;  3I56 A;  1H9S A;  3O13 A;  3OIQ A;  2DY8 A;  3DWA A;  5T1G A;  3FDT A;  1K8G A;  4A3D H;  3RD4 A;  1V1P B;  2JXM B;  3A54 A;  2ES2 A;  3RMH A;  3A8I E;  1TY2 A;  2PQA A;  5FOB B;  4J15 A;  3H91 A;  2EJM A;  2O5J C;  2K75 A;  3KJP A;  4NKL A;  1M90 C;  3I3C A;  5IGB A;  3G71 A;  1E0B A;  4UAI A;  1R4Q B;  5C0X J;  3S1Q H;  1STE A;  2F0Q A;  2LXK A;  1X3G A;  3RZD B;  3KF8 B;  4JOI A;  2VXW A;  1CSP A;  3GV3 A;  2OT2 A;  4KJN A;  1C48 A;  2ENB A;  1KXL A;  3I7F A;  4DA2 A;  3PMF A;  3JAM E;  3H6M A;  5C4Z A;  1KC8 C;  3CRK C;  2G5D A;  2B2T C;  5C4H A;  1I94 Q;  4MIU A;  1LT6 D;  3GTG B;  3S14 H;  1MI2 A;  4HJ9 A;  4AYB G;  1VMC A;  3RNU A;  3HG9 A;  2R7Z H;  4BY7 G;  4NDX A;  1TWA H;  1BR9 A;  1GUT A;  3VYT A;  3CCE A;  3TQY A;  3SVM A;  2K32 A;  3VR5 A;  3PUV A;  3OSO A;  3QOJ A;  1GM5 A;  1LT3 D;  2A19 A;  1KLG D;  4AQY Q;  2RBM A;  1STY A;  3SEB A;  5FLX c;  3K7A B;  1TQO A;  4CGY B;  5M5X B;  4EQO A;  4G7O C;  1VQC A;  2IHE A;  2WKD A;  2ZTD A;  5M5Y H;  1PXU A;  1SNM A;  3GV6 A;  4KD4 A;  3RN5 A;  3KLS X;  1YHB A;  1V8Q A;  2ICE C;  4C3J G;  3HKS A;  3BZC A;  3A8J E;  2NZO A;  1HRJ A;  2CFM A;  4PNY A;  4Q5V A;  2F0S A;  2BA0 A;  3ER0 A;  1YNN D;  5BR8 L;  1QB5 D;  3I4N G;  2F0N A;  2D0O A;  5LL6 S;  5CV9 A;  2E5L Q;  1HZ9 A;  2B2U C;  1VF5 C;  5E4X A;  4DGZ A;  3QR8 A;  1AZQ A;  1DOM A;  4LF7 L;  1SE8 A;  1Q8K A;  1G51 A;  1B9N A;  1J5E L;  4JV5 L;  1Q82 C;  3BDC A;  3KF6 B;  3NHH A;  4LWC A;  2HCI A;  3F2D A;  1AZP A;  1SNO A;  3PO3 B;  3H0G H;  1IW7 D;  2H4O A;  1EQV A;  3T1H Q;  3VR3 A;  5IP9 G;  3J81 i;  4JPB W;  2F0H A;  3GTG H;  3S14 B;  2VUM B;  2LMC B;  2R61 A;  4BS9 A;  4JG2 A;  3CD6 A;  2RKS A;  4LMQ D;  3OWE B;  5I9O A;  1DYQ A;  1TS2 A;  1CHP D;  3BVZ A;  4DUZ Q;  1EOT A;  1K3R A;  3GTL H;  3RZO H;  3IAY A;  1F9P A;  3I91 A;  4LAA A;  2N49 A;  4C3H G;  2NN6 I;  1TXY A;  3LGJ A;  4BY1 H;  1A3T A;  1A63 A;  1SE3 A;  5ISR A;  1UEA B;  4ZKC B;  2HQL A;  3MWY W;  4GZY C;  3BZK A;  4A3K G;  3W2D A;  2E5L L;  3K57 A;  2D2C C;  2UUA L;  4ZAI A;  2UXC L;  2L11 A;  4DV5 Q;  4DN4 M;  4X6A H;  4IJL A;  3N6R A;  4JV5 Q;  2EYO A;  1PRT C;  4LFC Q;  4HJ5 A;  4PMW A;  1YBY A;  1MHW C;  4X64 L;  1I4G A;  4IQZ A;  4YWM A;  1V9P A;  2O5I C;  1MGS A;  2D62 A;  1BBX C;  1D5X C;  4JI4 Q;  3MXU A;  1SAP A;  1VCI A;  5CMD A;  2MPM A;  4C3H B;  1WTP A;  2JA8 H;  4MZ9 A;  5HUR A;  2K5Q A;  3D4W A;  1L1O A;  2KED A;  5IT9 E;  3J81 j;  2XWB B;  2KEC A;  3RUZ A;  5I6W A;  5A2Q E;  5L37 A;  3D8G A;  2WAC A;  2F0I A;  4R9W A;  1HNW L;  1PYB A;  3ZYY X;  3HOU G;  1SR3 A;  2XRS D;  1M8A A;  3OMC A;  3VR4 A;  1E22 A;  1HFG A;  1D5Z C;  3SK8 A;  1SYB A;  1HUN A;  1FJG L;  2L12 A;  1CKO A;  1K9M C;  4M1U B;  1RIP A;  3H15 A;  4HID A;  3C46 A;  1CKM A;  1D5M C;  4YWL A;  1HA6 A;  4DR5 Q;  1L0Y B;  3HOX H;  4A3B G;  3PO2 G;  1SYF A;  1EIY B;  4X64 Q;  3KLS A;  1STB A;  3U58 A;  3J7A F;  2KEN A;  2QF7 A;  1S3O A;  5T1I A;  1XNQ Q;  5IYD H;  1MKH A;  1UE1 A;  2HIX A;  3IKJ A;  3NEN A;  3DWQ A;  4LF5 L;  3FKI G;  4H7B A;  4KD3 A;  1I4P A;  1K28 A;  2F1M A;  2M2L A;  2GN5 A;  2JK8 A;  4JI1 L;  4H13 C;  1UNS A;  3J80 E;  2JA7 G;  2EPB A;  2F03 A;  1Q8I A;  5IGG A;  2VUM H;  1HCZ A;  1YEZ A;  5FLX E;  4L5Q A;  1EYC A;  2NVY B;  4ALP A;  3ULP A;  2A68 C;  4KMU C;  3H3V H;  3NEM A;  2F4V Q;  5C0X I;  1I50 B;  2GA4 B;  1QWY A;  3NBH B;  3T1Y Q;  5IYB G;  2Q2I A;  1FNU A;  2LS0 1;  4LFB L;  5IYC G;  1SJH D;  3D31 A;  1ENC A;  3PF5 A;  3AEV A;  3KFU A;  4ILW A;  3HOY B;  2CHB D;  1HUM A;  5ELE A;  2LSS A;  1KAA A;  4UDU C;  2KOL A;  2PW7 A;  1DXM A;  1Y1W H;  4N8X 1;  2F0P A;  1Z7T A;  4DR2 Q;  3M7G A;  5FO9 B;  4PMC A;  4ZUI A;  1EY9 A;  4IJH A;  4L63 B;  3J7Y W;  2KCN A;  4POG A;  3JAM c;  1M1K C;  4GNX B;  3RZO B;  1I4H A;  2OQK A;  1G6P A;  5FKA C;  3S1R H;  3S1N H;  4R8I A;  5EKK A;  1JOO A;  4LF5 Q;  1ZKO A;  1LTL A;  1Y1V G;  5GAD C;  2BH8 A;  2KJX A;  2B29 A;  2R7D A;  1A3V A;  4NXN L;  3TZD A;  1EU3 A;  1CFM A;  3DXJ C;  1D6E C;  4U67 3;  1FL0 A;  1XX8 A;  1ZXT A;  3V05 A;  3GTM B;  3S2D B;  4F87 A;  3QO2 A;  2R93 G;  4DNT B;  4YWK A;  1ET9 A;  2K01 A;  1SRU A;  1TII D;  1KQS A;  2ZJR A;  1VQ4 A;  3DLL A;  5IOC A;  1SE4 A;  2MFI A;  1SN8 A;  4KY6 A;  4PZ8 A;  3MAQ A;  4IFD H;  1EFI D;  1I6V C;  3HKZ G;  4CDC C;  2I5H A;  2BH2 A;  2A68 D;  2LXJ A;  4DK3 C;  1GOZ A;  4P72 A;  3HOZ H;  1DON A;  3E6Z X;  5J22 A;  1QZG A;  4DUY L;  4JI7 Q;  5G3L F;  1N34 Q;  1XTD A;  3CQZ B;  1V43 A;  1G29 1;  4HMI A;  3A8K E;  3PO2 H;  4J6H A;  3ERS X;  2HCC A;  1TWC B;  4KHV A;  2RSN A;  3GTO B;  1BOS A;  1J9O A;  3DEP A;  3R93 A;  3D6C A;  4DV2 L;  2EY1 A;  2L15 A;  3M9B A;  4KHP L;  2MNA A;  3FEW X;  1B7Y B;  3F1Z A;  4RKL A;  4O42 A;  1GKH A;  4LNQ A;  2IX3 A;  1X9N A;  3QB3 A;  5C4J B;  4A3L H;  2J0T D;  2Y0S B;  4JBJ A;  3J7Z C;  3A0J A;  2AWN A;  1PDQ A;  3CAM A;  1LYL A;  5IYD G;  3MXN A;  4I7Z C;  1EWH A;  4HED A;  1Y8N B;  4JI3 L;  1GD7 A;  3VR2 A;  3BG3 A;  3K81 C;  4C2M B;  4FO2 A;  1F2Z A;  2B2V A;  3GTP H;  2RHQ B;  3MEH A;  4IPG A;  3GP7 A;  1VQD A;  4HJ7 A;  2F0U A;  3W1B A;  4XQN A;  1QIL A;  1NR4 A;  5JEA H;  4RAU C;  4QL5 A;  3M85 A;  4X66 Q;  1LUZ A;  2ID0 A;  4N9T A;  4K6D A;  3K58 A;  1QZH A;  4JI2 Q;  4HCS A;  1EYG A;  1TWF B;  1N9W A;  3TS2 A;  2DY7 A;  1Q90 A;  3G4S A;  5M3F G;  3P75 A;  2N3S A;  5M5W B;  4IPH A;  2AQ2 B;  4DNI A;  1SNP A;  1YJN A;  3PUX A;  3M4O H;  2NWG A;  5EBD A;  1SMX A;  3HOU B;  4F7X A;  1KTK A;  2WAQ E;  4BWG B;  5GAG C;  1X56 A;  4U68 A;  5JJL A;  1BUV T;  2CW0 C;  2QEJ C;  4C56 C;  2E2J B;  1IZ6 A;  4H44 C;  2F0M A;  1NNX A;  5C3W A;  2PYK A;  1Y1V H;  5CV8 A;  4CJ2 C;  1C9O A;  3TP7 A;  2ZXR A;  4IPD A;  2K5H A;  2EYM A;  2K5W A;  1IYJ B;  1HNZ Q;  2JYO A;  3K5M A;  2PNH A;  4BA1 I;  2ZXO A;  3ERO A;  1N36 Q;  4BXX G;  2F3I A;  3PGZ A;  4JI2 L;  3NEL A;  4IOA A;  5C4X G;  3I8Z A;  2K52 A;  2ZM6 Q;  4A3M B;  4A3D B;  5GAH C;  1F2M A;  1WCM B;  1I4X A;  3ERQ A;  4ODG A;  1O7I A;  4WRD A;  4AH6 A;  4XT1 B;  4MN3 A;  5C3X A;  1MSG A;  3PIO A;  3L7Z C;  3MEF A;  2SNS A;  4FP5 D;  2I5L X;  2BDO A;  2JP1 A;  4DK1 A;  1RTN A;  1TS3 A;  4M8A A;  4FVM A;  2KUM A;  4JBK A;  2Q2H A;  4WJ3 M;  1WJJ A;  4JI0 Q;  4CKB A;  3CCR A;  5IP9 H;  2KHI A;  1X3Q A;  4BBR H;  3BVG A;  1SYE A;  2TMP A;  1C4Q A;  2JSO A;  4A3I H;  3OTO L;  1FNV A;  5A35 A;  2B2Y A;  2Z6K A;  2WP8 J;  1VQL A;  5K36 H;  3I4M B;  2QGQ A;  3TEH B;  4C2M H;  3TP8 A;  5IWA L;  1CQF A;  1HTP A;  4NMZ A;  4DAV A;  1SEB D;  3CCU A;  4JI4 L;  3UE1 A;  4DNR B;  1IL2 A;  1VQN A;  1JOR A;  5KIX A;  4K8I A;  4BXX H;  2AUJ D;  3OHX C;  4X65 Q;  3NK9 A;  1A8V A;  1NUC A;  3G6J B;  3T16 A;  3GTK B;  1A15 A;  2H5X A;  1UE7 A;  3N52 A;  5LMN L;  2XIW A;  3AFP A;  1WD1 A;  3FVQ A;  4OO1 G;  4CJ0 B;  4K5X A;  1JWM D;  4BY7 H;  4IUR A;  4KKS A;  2YTV A;  1HH2 P;  1EWC A;  3Q22 A;  5FK9 C;  4A75 A;  4LF4 L;  4IUQ A;  2OQ0 A;  4LUV A;  4A3F B;  2A6H D;  4JI0 L;  2WIN B;  2NVQ H;  3ITP A;  4OEL B;  3L9A X;  3KDF B;  4ZQ3 A;  1W6J A;  4ZK9 B;  3J80 L;  1B4O A;  3Q23 A;  4KY5 A;  2YU9 B;  3HRZ C;  2F4I A;  3D0F A;  1XYI A;  1UEB A;  4FYD A;  3F2C A;  4N9P A;  1HR0 Q;  1JE5 A;  5CBE E;  2C9O A;  2DJF C;  3K7U C;  3FPP A;  2EY5 A;  4EX5 A;  1RF2 D;  1MJC A;  1DOK A;  1E3P A;  5EPL A;  1PVO A;  1KNA A;  5JOB A;  2EIF A;  2K50 A;  1YNX A;  3K80 C;  2AKW B;  4TKO B;  1MIU A;  1B44 D;  1VQH A;  4L5T A;  1WYD A;  3T1Y L;  3KDF A;  2A6E D;  2OTJ A;  3SR1 A;  5IE8 A;  4DUY Q;  3FKI H;  4LFB Q;  1QVG A;  3J80 i;  4QGU A;  4B9W A;  3Q24 A;  1N34 L;  2F0E A;  1T9H A;  1B3A A;  4KHP Q;  1X3E A;  4B3R L;  1QG7 A;  5BR8 Q;  1FD7 D;  1N33 Q;  2YU9 H;  4J8Q A;  4JW0 A;  1NMF A;  4LFA Q;  1L1O C;  3GTQ H;  2IX0 A;  1EY6 A;  1OO9 B;  3SXH A;  4A3K B;  1EIF A;  1LV9 A;  1Y14 B;  2N78 A;  3WDN A;  5JJZ A;  1VQI A;  2K6A A;  4B3M L;  2WKC A;  2EVB A;  3J7A 5;  1X55 A;  4HIM A;  3MXP A;  4HJ8 A;  1MJE A;  1E1O A;  4DV0 Q;  1FYC A;  1KLU D;  2OF1 A;  2NTS A;  3PV0 A;  4FNF A;  3AB9 A;  5AJ3 Q;  3H3V C;  1OTC A;  3CCJ A;  4WJW A;  3HOY H;  4P74 A;  4B3T Q;  3S15 B;  1LTT D;  3NBI A;  1SSO A;  4GNX A;  3MC0 B;  1SYC A;  2RSO A;  4WFN 3;  2ZTC A;  1JC7 A;  4KKT A;  1AE3 A;  1RHP A;  4UP7 A;  1JWS D;  4KHZ A;  1D2B A;  3A7L A;  3HZX A;  4LUO A;  4FXD A;  1XNR Q;  2B2V C;  1WCM G;  2EY2 A;  4R8N A;  1KHI A;  2EYP A;  3CC2 A;  4A3M H;  1WTQ A;  2I07 B;  2VB3 X;  4OL7 A;  1Z9F A;  2EDG A;  2Z8L A;  2WFW A;  2XGT A;  2QA4 A;  3ULJ A;  2A8V A;  3KUP A;  1CKN B;  5DNF A;  4JI5 L;  4BY1 G;  2E2H H;  3H94 A;  3NWT A;  3C1F A;  4C3H H;  5M3M H;  1YIT A;  2JA8 B;  2JA6 H;  4QF4 A;  2R7Z G;  1N36 L;  1K8A C;  5ELB A;  1HNZ L;  2K7V A;  2UU9 Q;  5I2Y A;  1XPO A;  2YTY A;  4DK6 C;  2B2W C;  4YY3 Q;  4CJ1 B;  1I5F A;  2C35 B;  1JOK A;  2IPK D;  1SYG A;  2JJQ A;  1K0R A;  4A3J G;  1NE3 A;  1STH A;  5KNC A;  3CU7 A;  2CQA A;  3C2P A;  2AQ1 B;  2K5D A;  1VQF A;  3IRB A;  4L8J A;  3FPU B;  4KI0 A;  3NQI A;  2A69 C;  1WD0 A;  4NXM L;  1TS4 A;  1IL8 A;  4MHE A;  2O2L D;  4X62 Q;  1LT4 D;  1WI5 A;  4GKK L;  1B1Z A;  3OTO Q;  3V96 A;  1PTO B;  4DV6 L;  5AFW A;  4A3E H;  1F2L A;  5C4X H;  1PLF A;  2ZJP A;  5K5P A;  4IUV A;  2VNU D;  1KNE A;  1PH1 A;  1Q3L A;  3HOW H;  2PW5 A;  4R1J A;  4LF6 Q;  4UY8 C;  3J81 L;  2WV6 D;  3T13 A;  3L3O C;  1YHA A;  5COY A;  3J7A V;  1A2U A;  3PQI A;  4HMJ A;  3OW2 A;  4O0A A;  2J4X A;  2SDF A;  2B63 B;  3CCL A;  2UU9 L;  1GUS A;  4H02 A;  1J8I A;  1SYD A;  1TWG B;  5CR3 A;  1DJR D;  5C44 H;  4RH6 A;  1ENA A;  1SMY D;  1A3U A;  2CWA A;  4GLX A;  1FR3 A;  2HDL A;  5LMN Q;  2B2U A;  3NTI A;  4UHV A;  5DEH A;  3URY A;  1PFS A;  2JA8 G;  4C3I H;  1R9T B;  1CA6 A;  1WTO A;  4HSV A;  3FKI B;  4QB4 A;  1V1Q A;  1HZC A;  5FLM H;  2XRQ D;  1CK1 A;  2Z1C A;  2J7Z A;  4RHS A;  4KTA A;  1EY8 A;  3CCM A;  4LF9 Q;  1EQR A;  1HPC A;  4IFD I;  4X3T A;  2EQS A;  1SNQ A;  1N32 Q;  3MHB A;  3PCO B;  1HR0 L;  1PMR A;  2A69 D;  1VQK A;  3GTP B;  2Q2T A;  3MXN B;  5IP7 H;  4NP5 A;  3OYY A;  3NSW A;  2R7F A;  2PZW A;  2KHJ A;  3TP5 A;  1RL2 A;  1OXT A;  3BDO A;  2E74 C;  3CQZ H;  4UP8 A;  5IY0 A;  3D3R A;  2R7Z B;  3E9H A;  3A5Z B;  5KND A;  3D4R A;  4DV4 L;  1CA5 A;  1I3Q B;  2R92 B;  3DM1 A;  1K83 B;  2FHT A;  1VQ7 A;  4OIK A;  2G9D A;  3P20 A;  4X3U A;  3GQB A;  1WVL A;  4DR7 Q;  4GS3 A;  1GUO A;  3TP6 A;  1I94 L;  1AEX A;  3MFY A;  1ZYR C;  4K6L A;  1YI2 A;  1IBL L;  4P73 A;  5C3E B;  1JB3 A;  4KN7 C;  4AYB E;  2XWJ B;  3PO3 G;  1ENF A;  4KN4 C;  4BBR G;  1FNW A;  2B8G A;  4LFA L;  2EXD A;  3SHL A;  2A5H A;  4LUZ A;  1S72 A;  4JOI C;  2QEX A;  1C8C A;  3CXC A;  3KF8 A;  4DV2 Q;  1H9S B;  1Q81 C;  2A1A A;  4K5V A;  1AP0 A;  4A3F H;  1VQM A;  5IGD A;  1QNU A;  5E1F A;  3JC6 6;  2JA6 G;  4JYA Q;  1SMY C;  4DV0 L;  4B9X A;  4K0K Q;  1H9K A;  1Q86 C;  1B3Q A;  1TR5 A;  1IYU A;  3M4Q A;  3MZ5 A;  2R93 H;  4C3J H;  2F3V A;  1WFQ A;  3A55 A;  4DK0 A;  4QUC A;  1OXV A;  3TBI B;  2I0Q A;  4GN4 B;  4KY7 A;  2I46 A;  1STN A;  1S5D D;  3EVQ A;  1STG A;  4HTH A;  3V2T A;  1EY0 A;  5NUC A;  3NXW A;  5J3B A;  2ZT9 C;  1D7Q A;  2X69 A;  4ZCK A;  1QNK A;  3HOV G;  1CSQ A;  2A74 C;  1H95 A;  4NB3 A;  2LKV A;  3R2T A;  2CCZ A;  4OON A;  4F88 A;  3VYS A;  4ZLT F;  4RGT A;  4CDF C;  5FLM G;  1UWV A;  1YZ6 A;  1G6Z A;  1M4V A;  4G4K A;  1JT8 A;  1F9S A;  1YNJ C;  2E8G A;  3LX0 A;  4TRD A;  4ID6 A;  4IOC A;  4JI8 Q;  3I4M H;  1F9Q A;  1HTL D;  4MTK A;  1KDA A;  4A3F G;  2NVY H;  1FVI A;  4DR6 Q;  2LFN A;  1ASZ A;  1VQO A;  5CV5 A;  2L55 A;  2UXB L;  1BF4 A;  1IBM L;  1UE6 A;  3K5O A;  1BXT A;  1ILQ A;  1O7Y A;  2VY3 A;  4JVZ A;  2Z4H A;  3RN2 A;  2P5Z X;  2JA5 G;  2E75 C;  2QIL A;  2YV5 A;  3I72 A;  3IFT A;  4FXG C;  1BBU A;  5ELC A;  1BQQ T;  1K73 C;  3CHB D;  2E2D C;  2V4D A;  1BCP C;  2K33 A;  1Y8P B;  3S1M H;  2MO1 A;  1A0I A;  5M3M B;  3G6E A;  2WAQ G;  3NP8 A;  1P8L A;  1K0S A;  3D4D A;  2D5D A;  5FLX L;  1EU4 A;  4PQX A;  4A3G H;  1CHQ D;  2OTL A;  2DNC A;  4XQJ A;  1DCZ A;  3A7A B;  1PFB A;  4NXM Q;  2B8F A;  4HIK A;  1EWI A;  2EZV A;  3Q0A A;  1WTV A;  2NZH A;  1L1O B;  4N8F A;  1IW7 C;  3AYH B;  4C1N K;  5C6A A;  3KLR A;  3OWF A;  2VQF L;  5C3E H;  2F0T A;  5JPM C;  5G3L D;  2KA7 A;  5CYU A;  4GOP C;  4A93 H;  3M4Y A;  2WB1 E;  5ELO A;  4LF8 L;  3GTO H;  2PMZ E;  2EXZ A;  1ONL A;  4HN7 A;  1GHK A;  3KLW A;  1HA5 A;  1E2V A;  3W5O A;  5EAY A;  3I4M G;  1PV4 A;  1H9J A;  4PZ6 A;  1VQP A;  2JEA I;  1NTG A;  3L0O A;  5HY6 A;  1XPU A;  1SND A;  1HNW Q;  3W3A A;  1WOC A;  2KCC A;  2ZTE A;  4LK1 C;  2ASB A;  4DR1 Q;  5M5W H;  2QKI C;  4X65 L;  1EFW A;  4RCN A;  5LL6 X;  2PQA B;  4YY3 L;  1K3B C;  1S4Z A;  3J81 c;  4JCV E;  1AH9 A;  4TSS A;  3I55 A;  5IIF A;  4QIW E;  2RDF A;  5KRU A;  4WJ4 A;  2EY6 A;  5C4J H;  4GN3 B;  3X3M A;  5BN5 A;  1AN8 A;  1XNQ L;  2RA4 A;  4KKU A;  3GTL B;  1L0X B;  3PUY A;  1BVS A;  4DV1 Q;  3OMG A;  2Y0S E;  2L9H A;  3ULL A;  3HOW G;  1STA A;  1EL0 A;  2HD3 A;  3MFG A;  3AU7 A;  3ZJY C;  1NMG A;  4B3M Q;  4LF8 Q;  1ZEQ X;  1PA6 A;  1JOQ A;  2OXP A;  1RKN A;  4Q0F A;  1BCP D;  2CVR A;  1GVP A;  2FJ2 A;  1SFO B;  2VQE Q;  4DV4 Q;  3S2D H;  4PZ7 A;  2VS1 A;  2PQE A;  2XNA C;  5EJW A;  1EIG A;  2NYZ D;  4K8J A;  3U4Z A;  2PCF B;  3CME A;  1NR2 A;  4P71 A;  3I4O A;  4EQ5 A;  4A3J H;  1LTI D;  2DUD A;  5C0X H;  3OW7 A;  4BY7 B;  1NY4 A;  1LTS D;  3HOZ G;  4QJF A;  2ALY B;  2CWP A;  4FF2 A;  4IUP A;  4ZYS A;  4CDE C;  5C44 B;  4A3C H;  2NBF A;  4GLV B;  4IAL A;  2JA9 A;  2EYH A;  5A2Q L;  1D1I A;  3STB C;  5KEE A;  3AQQ A;  4DV7 Q;  2QDB A;  2Q8I B;  3SGI A;  4QY7 A;  3PUZ A;  1R4P B;  3NPP A;  4WOR A;  4OEM B;  3HKZ E;  1VQ8 A;  4A3D G;  1BCP F;  1G8Z D;  3BDL A;  2WII B;  4JYA L;  1BNZ A;  3HOW B;  1K8O A;  2IHF A;  4DR3 Q;  1S40 A;  4DU9 A;  2NVX H;  1CZG A;  5C5M A;  1YVC A;  1PFN A;  4EQN A;  4RFB A;  4DV5 L;  3RR5 A;  2OEO A;  4LFC L;  2BE5 C;  3D6W A;  4DR4 L;  3F2B A;  1TWG H;  3TS0 A;  1U4M A;  2F0V A;  1X6O A;  2MUY A;  1O80 A;  4RG1 A;  2NVT H;  2M00 A;  1CUK A;  4O2D A;  2F0O A;  4BBS G;  5D3D A;  2PI2 A;  1RCV D;  2D9U A;  4ME5 A;  2Q8T A;  3HOX B;  1K8M A;  2D0P A;  1YNN C;  4RMF A;  3SK6 A;  2VL6 A;  1EYD A;  2JE6 I;  3UDX A;  1GUW A;  3K5N A;  1ILP A;  3T53 B;  2B63 G;  3SDZ A;  4HAE A;  3UDF A;  1O7Z A;  3PIP A;  4DR7 L;  4CKC A;  1AW7 A;  2IWH A;  4A93 G;  1P16 A;  2C5C A;  2V1C C;  3UDI A;  3CMA A;  5C3E G;  5JJK A;  1PH2 A;  4P75 A;  2AUK A;  2Z0S A;  3CW2 C;  4DR3 L;  3BS1 A;  1A2T A;  2SEB D;  5D3I B;  4QCL A;  1FGB D;  3PSI A;  4A3B B;  4S3S A;  3HKZ B;  3MA2 B;  4KLK A;  1DM0 B;  3NBH A;  1JB7 A;  5EGT A;  1IBM Q;  2XN9 C;  2FIN B;  2ICI A;  3S17 B;  4RA8 A;  1VQE A;  5EQ0 A;  4E6I A;  5C44 G;  1LTR D;  5IT9 c;  5JAV A;  2WB1 B;  1L2F A;  3RLO A;  1HR0 W;  1UAP A;  3QG1 A;  1X65 A;  4A3L G;  2FXQ A;  3UDG A;  2CKZ B;  4DAY B;  4K0K L;  2JN4 A;  4XYQ A;  3HOX G;  4FF3 A;  4A3B H;  2L4N A;  1ICW A;  1JJ2 A;  1SBB B;  4X66 L;  2K1B A;  2IW3 A;  3QOL A;  3S24 A;  2ZJQ A;  1Y1V B;  1FJG Q;  1RTO A;  2F4V L;  5DM6 3;  3OPO A;  4CKE A;  1Q7Y C;  1HJP A;  2A73 B;  3HGB A;  3HS0 C;  3H0G G;  1XMQ L;  2OCE A;  2KEE A;  2L1B A;  2FMC A;  3UE0 A;  2KCT A;  4BY1 B;  2F52 A;  4C1N I;  4XIG S;  4X3S A;  5BN3 A;  1IBK Q;  3GDE A;  3PIP 3;  1SDF A;  3UI2 A;  3EJI A;  4GKK Q;  5M3M G;  3J81 E;  4DR2 L;  4DAY A;  4YCU A;  1VQ5 A;  2BCO A;  4IUT A;  3TME A;  4GOP A;  1PH6 A;  2FMM A;  3U9O A;  3X3N A;  4NPS A;  3Q8D A;  4LF6 L;  1DZ1 A;  2KBN A;  1C0A A;  1E7Z A;  2K4K A;  1YJ9 A;  5CV6 A;  4Y7N B;  4HJA A;  2UXB Q;  4A4I A;  1E1T A;  1S5F D;  3SE0 A;  2JQO A;  3RLN A;  3EQL C;  2PZT A;  3EN2 A;  1MSH A;  2K04 A;  1B53 A;  2QDL A;  4A3K H;  2BA1 A;  5FJ8 G;  2R93 B;  3K0X A;  1CQV A;  2O4X A;  3EBE A;  1I6H B;  4ULL A;  5FJ8 H;  5LMU L;  1NBW A;  2N8N A;  1Z6H A;  5M3F B;  1JWU D;  5D14 A;  3HEJ A;  3NUC A;  4HSP A;  3TRZ A;  3T4A C;  5K36 G;  5IYC H;  1KD1 C;  4YIJ A;  5FO8 B;  4NXN Q;  4DV3 Q;  1GUN A;  4OWW B;  2VQE L;  1QCB D;  1F2Y A;  2VZA A;  2CH4 W;  3VYR A;  2HDM A;  3DMU A;  3FMC A;  1B2T A;  1G2T A;  2ZXP A;  4Y7N H;  3HOY G;  1VQB A;  2JA7 H;  1NSN S;  1CZW A;  2UXD Q;  4UPA A;  2IJ0 A;  1B9M A;  1JR0 D;  2Q8R E;  5IWA Q;  2NTT A;  4G7H C;  3WOE A;  2L0C A;  3ONA B;  1TWA B;  2PZU A;  3AMU A;  5DM7 3;  2HUG A;  2Y0S G;  2E2I H;  4CHT B;  2YYZ A;  2Z6B A;  1WTH A;  2R3Z A;  1B70 B;  2K05 A;  4OIJ A;  4L5R C;  3GTM H;  2F3W A;  2PNR C;  1PFM A;  3GTJ B;  1VQ6 A;  4EQP A;  3MXG A;  1KDB A;  3CPW A;  1SNC A;  4BBR B;  4JK1 C;  2MP1 A;  5M5Y B;  1TU2 B;  1TKW B;  1WTX A;  2M9V A;  4GN5 A;  3K8A A;  2F0J A;  4RWS C;  3A5U A;  2HIV A;  3E9I A;  4DR5 L;  1KRS A;  1Q1E A;  1Y1W B;  4OX9 L;  4OO1 I;  2FFK B;  3QJY A;  1JMC A;  2NVQ B;  5F2D A;  4TQU S;  1UE5 A;  3SK4 A;  1X3P A;  3C3L A;  1PZI D;  5LHY 1;  1TVX A;  3RLF A;  3M7N A;  1HNX L;  1JJC B;  4MNO A;  1E24 A;  2WAQ B;  2I5M X;  3BJU A;  5GQO A;  1VMP A;  2F0G A;  3NQT A;  4V0B A;  3BZD B;  1F77 A;  4PMB A;  1RDP D;  1TWH B;  5KYL A;  5JVH 3;  1ASY A;  2MGS A;  1O78 A;  5COR A;  1EEF D;  3H09 A;  3CP0 A;  2A6H C;  2MHV A;  1SJE D;  4R4T A;  1I50 H;  3RZD H;  5H1S E;  2CH4 A;  4DAP A;  1G2S A;  3CPF A;  4PV1 C;  1QE6 A;  1PRT D;  4I7A A;  1PTO D;  2E2H B;  1PRT B;  1QUQ B;  1B8A A;  4CBV A;  2GVB A;  3BYY B;  3S1M B;  5DLQ E;  4JI8 L;  5JPN C;  3PIO 3;  4XYO A;  1II3 A;  1HHV A;  3I2Z A;  2NVT B;  3F8T A;  2B2Y C;  2Z6K C;  5KGU A;  2MJ8 A;  1KDC A;  1TWH H;  1ICF B;  4DKA C;  1N8R C;  2N88 A;  2ATW A;  3STB D;  1ESR A;  5E3F A;  3U4V A;  1WTR A;  4YCV A;  2EYF A;  2H1E A;  5C0X G;  4QQB X;  2JA6 B; 
#chains in the Genus database with same CATH homology
 1EQT A;  4XTC S;  3K5L A;  4QIW B;  5JEA J;  1OXU A;  4LJZ C;  3TN2 A;  3VR6 A;  1EY5 A;  4IFD G;  4K2K A;  3S16 B;  3KBG A;  2NVX B;  2N55 A;  4RHR A;  3FRP B;  3K0Y A;  1E2Z A;  3PUW A;  5EPK A;  2IT1 A;  1O7L A;  1IKM A;  1V1O A;  1PTO F;  3JAM L;  5D65 A;  1I4R A;  1EY7 A;  4DXG A;  5CGK A;  5M9O A;  3C1E A;  1LAC A;  1CI3 M;  4K5W A;  4RGN A;  3G7L A;  4DF7 A;  3R8B A;  3SK5 A;  2B39 A;  2HQE A;  3NTK A;  4I65 A;  1GHJ A;  5HGT A;  2JEB I;  4KK7 A;  3E5S A;  1TT2 A;  3EA6 A;  5ELF A;  3I4L A;  1E2W A;  1SXT A;  3K6O A;  4IFD J;  2KHS A;  4XXE A;  1CTM A;  4AYB B;  2EYL A;  3K59 A;  5JEA G;  1I4Q A;  3I73 A;  2X6L A;  5IGF A;  5FO7 B;  1GJX A;  4C3I B;  4DXF A;  4RGM A;  5I2X A;  2CW0 D;  3LNN A;  2NUC A;  1Y69 U;  4IUU A;  1SE2 A;  1DOL A;  1BCP B;  4IZ8 A;  1IHZ A;  4Z9C B;  2E2I B;  4J1M A;  3S1R B;  3S1N B;  5J39 A;  1VF7 A;  1ROD A;  2PO4 A;  4RGO S;  4V19 0;  2AQ3 B;  5EPJ A;  1H9R A;  4A3I B;  1B50 A;  5BN4 A;  4H0L C;  1PYW D;  1U4P A;  2EE1 A;  3F2U A;  4A93 B;  1Z47 A;  4KJO A;  2RVL A;  1HFN A;  1U9R A;  1TS5 A;  3S1Q B;  1JIC A;  2RDH A;  4G7Z C;  5EBC A;  4B08 A;  1LTB D;  2EJG C;  3A56 A;  1YNJ D;  5CV7 A;  3MVV A;  3I4N B;  1W6K A;  1H9M A;  4F8M A;  2JA5 B;  4DFA A;  4OO1 H;  2XSC A;  1RD9 D;  4L6T B;  3VA5 A;  3E0J A;  2IL8 A;  2EOT A;  2BOS A;  3NE5 B;  5I4D A;  1XWE A;  3NTH A;  1LO5 D;  1NAP A;  2K28 A;  2R6G A;  2LY7 A;  5CV4 A;  2F0L A;  1BO0 A;  4QUF A;  2NB0 A;  1ESF A;  3IL8 A;  1JCK B;  4HR7 B;  1V1P A;  1VDZ A;  1AFP A;  2SOB A;  4K2L A;  5IT9 L;  4FF4 A;  2A6E C;  3ND9 A;  5C5L A;  3HOV B;  1LTG D;  1ET6 A;  4FXK C;  4K14 A;  1DD2 A;  1S5E D;  1HQM C;  2G9H D;  2XVS A;  2F0K A;  5JVG 3;  3M4O B;  1CT1 D;  1HXY D;  1Q1B A;  1IYV A;  4IN3 A;  3QIA A;  3DUZ A;  4ZKB B;  4RKB A;  2F0D A;  1Q12 A;  1GXD C;  3QWN A;  1ZYR D;  5I9P A;  2PPB C;  1CM9 A;  2TSS A;  5I6Y A;  3OIP A;  2X6G A;  1ML0 D;  3GD7 A;  4IUN A;  3R3O A;  3M3Y B;  5TSS A;  3TDQ A;  4OHJ A;  1EYA A;  3I90 A;  5IGE A;  4X3K A;  1BDO A;  2BDN A;  3LWE A;  2RQX A;  5CBA E;  3GO5 A;  3T51 B;  4ZUJ A;  4XQQ A;  4A3J B;  2NN6 G;  2B2T A;  2NN6 H;  1F9R A;  1JE4 A;  4C3J B;  1IKL A;  2JA7 B;  4NW2 A;  2L5T A;  3U9S A;  3GTQ B;  3Q6S A;  1TY0 A;  4ABN A;  5DAU A;  1T5E A;  2EYJ A;  2K03 A;  1MBY A;  3S9W A;  1A6X A;  2VB2 X;  1EZ8 A;  4O1N A;  4XDX A;  1U4R A;  3P7J A;  3BVM A;  4OGQ C;  3PO2 B;  3MTS A;  3OOC A;  2RDG A;  1NCV A;  3I70 A;  1EIH A;  3H0G B;  1U4L A;  3P1H A;  2DNE A;  1RJT A;  1PZJ D;  4ZRZ A;  5ELD A;  2IX1 A;  2Z4I A;  2DN8 A;  1OXX K;  3KBX A;  2E76 C;  5J1Z A;  2F0F A;  2PMZ B;  1HQR D;  4BA2 I;  3HOZ B;  3TZU A;  5C4X B;  4KV6 A;  5CC4 A;  3VYU A;  4A3E B;  5E4W C;  1EZ6 A;  1T5X D;  1PZK D;  5EKL A;  3VA7 A;  2BE5 D;  1OXS C;  5KYI A;  2AWO A;  4JBW A;  1JQY D;  1QOH A;  2B2W A;  3DEO A;  4EGV A;  1PTO H;  5IOD A;  3KK7 A;  1KAB A;  3S2H B;  1MD2 D;  1QJO A;  1D1K A;  1EEI D;  3CRL C;  1UUP A;  3DHQ A;  1PRT F;  1LT5 D;  1G91 A;  2EJF C;  4XT3 B;  4BBS B;  1PTO C;  3NWS A;  3BYT B;  1Y8O B;  3ND8 A;  3HP3 A;  4QMG A;  1X32 A;  1EY4 A;  4HCE A;  3T56 B;  2KVM A;  3R2I A;  2KQ3 A;  3CKI B;  4EVO A;  5EKI A;  1LAB A;  3EFX D;  1WTW A;  2NZ1 D;  4RCO A;  3LWU A;  1S5C D;  4FF1 A;  5KNB A;  4P2C B;  3DWP A;  4C3I G;  2QCP X;  3IFD A;  3WOF A;  1XTC D;  5IGC A;  3TSS A;  1LLR D;  4A3G B;  1GUG A;  4G57 A;  1LTA D;  1XXG A;  2SNM A;  1S5B D;  2F0W A;  1H9S A;  3O13 A;  3OIQ A;  2DY8 A;  3DWA A;  5T1G A;  3FDT A;  3RD4 A;  1V1P B;  2JXM B;  3A54 A;  3RMH A;  3A8I E;  1TY2 A;  5FOB B;  3H91 A;  2EJM A;  2O5J C;  4NKL A;  3I3C A;  5IGB A;  1E0B A;  4UAI A;  1R4Q B;  5C0X J;  1STE A;  2F0Q A;  3RZD B;  2VXW A;  3GV3 A;  2OT2 A;  4KJN A;  1C48 A;  2ENB A;  4DA2 A;  3PMF A;  3JAM E;  3H6M A;  5C4Z A;  3CRK C;  2B2T C;  5C4H A;  4MIU A;  1LT6 D;  3GTG B;  1MI2 A;  1VMC A;  3HG9 A;  4NDX A;  1BR9 A;  1GUT A;  3VYT A;  3SVM A;  2K32 A;  3VR5 A;  3PUV A;  3OSO A;  3QOJ A;  1LT3 D;  1KLG D;  2RBM A;  1STY A;  3SEB A;  3K7A B;  1TQO A;  4CGY B;  5M5X B;  4EQO A;  4G7O C;  2WKD A;  1PXU A;  1SNM A;  3GV6 A;  4KD4 A;  3KLS X;  4C3J G;  1V8Q A;  2ICE C;  3A8J E;  1HRJ A;  4PNY A;  4Q5V A;  2F0S A;  2BA0 A;  1YNN D;  1QB5 D;  2F0N A;  5LL6 S;  5CV9 A;  2B2U C;  1VF5 C;  5E4X A;  4DGZ A;  1AZQ A;  1DOM A;  1B9N A;  3BDC A;  3NHH A;  2HCI A;  1AZP A;  1SNO A;  3PO3 B;  1IW7 D;  2H4O A;  1EQV A;  3VR3 A;  3S14 B;  2F0H A;  2VUM B;  2LMC B;  2R61 A;  4BS9 A;  2RKS A;  4LMQ D;  3OWE B;  5I9O A;  1DYQ A;  1TS2 A;  1CHP D;  3BVZ A;  1EOT A;  3IAY A;  1F9P A;  3I91 A;  4LAA A;  4C3H G;  2NN6 I;  1A3T A;  1SE3 A;  5ISR A;  1UEA B;  4ZKC B;  3MWY W;  4GZY C;  3W2D A;  3K57 A;  2D2C C;  4ZAI A;  2L11 A;  4DN4 M;  3N6R A;  2EYO A;  1PRT C;  4PMW A;  1I4G A;  4IQZ A;  2O5I C;  1MGS A;  2D62 A;  1BBX C;  1D5X C;  3MXU A;  1SAP A;  1VCI A;  5CMD A;  2MPM A;  4C3H B;  1WTP A;  5HUR A;  2K5Q A;  3D4W A;  2KED A;  5IT9 E;  2XWB B;  2KEC A;  3RUZ A;  5I6W A;  5A2Q E;  3D8G A;  2WAC A;  2F0I A;  4R9W A;  3ZYY X;  2XRS D;  1M8A A;  3OMC A;  3VR4 A;  1HFG A;  1D5Z C;  3SK8 A;  1SYB A;  1HUN A;  2L12 A;  4M1U B;  3C46 A;  1D5M C;  1HA6 A;  1L0Y B;  1SYF A;  3KLS A;  1STB A;  3J7A F;  2QF7 A;  5T1I A;  3IKJ A;  3DWQ A;  4H7B A;  1I4P A;  2F1M A;  4KD3 A;  2M2L A;  4H13 C;  1UNS A;  3J80 E;  2EPB A;  2F03 A;  1Q8I A;  5IGG A;  1HCZ A;  5FLX E;  1EYC A;  2NVY B;  2A68 C;  4KMU C;  5C0X I;  1I50 B;  2GA4 B;  1QWY A;  1FNU A;  2LS0 1;  1SJH D;  3D31 A;  1ENC A;  4ILW A;  3HOY B;  2CHB D;  1HUM A;  5ELE A;  1KAA A;  4UDU C;  2KOL A;  2PW7 A;  1DXM A;  2F0P A;  1Z7T A;  3M7G A;  5FO9 B;  4PMC A;  4ZUI A;  1EY9 A;  4L63 B;  3J7Y W;  2KCN A;  3RZO B;  1I4H A;  5FKA C;  4R8I A;  5EKK A;  1JOO A;  1ZKO A;  2KJX A;  1A3V A;  3TZD A;  1EU3 A;  1CFM A;  3DXJ C;  1D6E C;  4U67 3;  1XX8 A;  1ZXT A;  3V05 A;  3GTM B;  3S2D B;  4F87 A;  3QO2 A;  4DNT B;  1ET9 A;  2K01 A;  1TII D;  5IOC A;  1SE4 A;  4KY6 A;  3MAQ A;  4IFD H;  1EFI D;  1I6V C;  2A68 D;  1GOZ A;  1DON A;  3E6Z X;  5J22 A;  5G3L F;  3CQZ B;  1V43 A;  1G29 1;  4HMI A;  3A8K E;  4J6H A;  2HCC A;  1TWC B;  4KHV A;  2RSN A;  3GTO B;  1BOS A;  1J9O A;  3DEP A;  3R93 A;  3D6C A;  2EY1 A;  3FEW X;  4RKL A;  4O42 A;  2IX3 A;  3QB3 A;  5C4J B;  2J0T D;  2Y0S B;  2AWN A;  1PDQ A;  3MXN A;  4I7Z C;  1EWH A;  4HED A;  1Y8N B;  3VR2 A;  3BG3 A;  4C2M B;  4FO2 A;  1F2Z A;  2B2V A;  3MEH A;  3GP7 A;  2F0U A;  4XQN A;  1QIL A;  1NR4 A;  5JEA H;  4RAU C;  3M85 A;  2ID0 A;  4N9T A;  4K6D A;  3K58 A;  4HCS A;  1TWF B;  2DY7 A;  1Q90 A;  3P75 A;  5M5W B;  2AQ2 B;  1SNP A;  3PUX A;  2NWG A;  5EBD A;  3HOU B;  4F7X A;  1KTK A;  4BWG B;  4U68 A;  1BUV T;  2CW0 C;  2QEJ C;  4C56 C;  2E2J B;  4H44 C;  2F0M A;  5C3W A;  2PYK A;  5CV8 A;  4CJ2 C;  3TP7 A;  2ZXR A;  2EYM A;  2K5W A;  2JYO A;  3K5M A;  4BA1 I;  2ZXO A;  3ERO A;  3I8Z A;  4A3M B;  4A3D B;  1F2M A;  1WCM B;  1I4X A;  3ERQ A;  4ODG A;  4WRD A;  4XT1 B;  4MN3 A;  5C3X A;  1MSG A;  3L7Z C;  2SNS A;  4FP5 D;  2BDO A;  2JP1 A;  4DK1 A;  1RTN A;  1TS3 A;  4M8A A;  4FVM A;  2KUM A;  4CKB A;  1X3Q A;  3BVG A;  1SYE A;  2TMP A;  1C4Q A;  2JSO A;  1FNV A;  5A35 A;  2B2Y A;  2WP8 J;  5K36 H;  3I4M B;  3TP8 A;  1CQF A;  1HTP A;  4NMZ A;  4DAV A;  1SEB D;  4DNR B;  1JOR A;  5KIX A;  4K8I A;  2AUJ D;  3OHX C;  3NK9 A;  1NUC A;  3G6J B;  3T16 A;  3GTK B;  1A15 A;  3N52 A;  2XIW A;  1WD1 A;  3FVQ A;  4OO1 G;  4CJ0 B;  4K5X A;  1JWM D;  4IUR A;  4KKS A;  1EWC A;  3Q22 A;  5FK9 C;  4IUQ A;  4A3F B;  2A6H D;  2WIN B;  3ITP A;  3L9A X;  4ZQ3 A;  1W6J A;  4ZK9 B;  3J80 L;  1B4O A;  3Q23 A;  4KY5 A;  2YU9 B;  3HRZ C;  2F4I A;  1XYI A;  4FYD A;  4N9P A;  5CBE E;  2C9O A;  3FPP A;  2EY5 A;  1RF2 D;  1DOK A;  5EPL A;  1KNA A;  5JOB A;  4TKO B;  1B44 D;  2A6E D;  3SR1 A;  3Q24 A;  4B9W A;  2F0E A;  1B3A A;  1QG7 A;  1FD7 D;  4J8Q A;  2IX0 A;  1EY6 A;  1OO9 B;  4A3K B;  3SXH A;  1LV9 A;  3WDN A;  5JJZ A;  2K6A A;  2WKC A;  2EVB A;  3MXP A;  1FYC A;  1KLU D;  2OF1 A;  2NTS A;  3PV0 A;  4FNF A;  3AB9 A;  3H3V C;  4WJW A;  3S15 B;  1LTT D;  3NBI A;  1SSO A;  3MC0 B;  1SYC A;  2RSO A;  4WFN 3;  1JC7 A;  4KKT A;  1RHP A;  1JWS D;  4KHZ A;  1D2B A;  3A7L A;  3HZX A;  4FXD A;  2B2V C;  2EY2 A;  4R8N A;  2EYP A;  1WTQ A;  2I07 B;  2VB3 X;  4OL7 A;  2EDG A;  2Z8L A;  3KUP A;  5DNF A;  3H94 A;  3NWT A;  3C1F A;  2JA8 B;  4QF4 A;  5ELB A;  2K7V A;  5I2Y A;  2B2W C;  4CJ1 B;  1JOK A;  2IPK D;  1SYG A;  1STH A;  5KNC A;  3CU7 A;  2CQA A;  3C2P A;  2AQ1 B;  2K5D A;  3FPU B;  3NQI A;  4KI0 A;  4L8J A;  2A69 C;  1WD0 A;  1TS4 A;  1IL8 A;  4MHE A;  2O2L D;  1LT4 D;  1B1Z A;  3V96 A;  1PTO B;  5AFW A;  1F2L A;  1PLF A;  5K5P A;  4IUV A;  2VNU D;  1KNE A;  1Q3L A;  2PW5 A;  3J81 L;  2WV6 D;  3T13 A;  3L3O C;  5COY A;  3J7A V;  1A2U A;  4HMJ A;  2B63 B;  2J4X A;  2SDF A;  1GUS A;  1J8I A;  1SYD A;  1TWG B;  5CR3 A;  1DJR D;  4RH6 A;  1ENA A;  1SMY D;  1A3U A;  1FR3 A;  2HDL A;  2B2U A;  3NTI A;  5DEH A;  3URY A;  1CA6 A;  1R9T B;  1WTO A;  4HSV A;  3FKI B;  4QB4 A;  2XRQ D;  1CK1 A;  2Z1C A;  2J7Z A;  4RHS A;  4KTA A;  1EY8 A;  1HPC A;  4IFD I;  4X3T A;  1SNQ A;  3MHB A;  1PMR A;  2A69 D;  3GTP B;  4NP5 A;  3NSW A;  2PZW A;  3TP5 A;  1OXT A;  3BDO A;  2E74 C;  3D3R A;  2R7Z B;  5KND A;  3D4R A;  1CA5 A;  1I3Q B;  2R92 B;  3DM1 A;  1K83 B;  2FHT A;  4OIK A;  2G9D A;  3P20 A;  4X3U A;  1WVL A;  3GQB A;  1GUO A;  3TP6 A;  1AEX A;  3MFY A;  1ZYR C;  4K6L A;  5C3E B;  1JB3 A;  4KN7 C;  2XWJ B;  1ENF A;  4KN4 C;  1FNW A;  2B8G A;  3SHL A;  2A5H A;  1C8C A;  3KF8 A;  1H9S B;  4K5V A;  1AP0 A;  5IGD A;  1QNU A;  5E1F A;  1SMY C;  4B9X A;  1H9K A;  1TR5 A;  1IYU A;  3MZ5 A;  4DK0 A;  2F3V A;  3A55 A;  4QUC A;  1OXV A;  3TBI B;  4KY7 A;  2I46 A;  1STN A;  1S5D D;  3V2T A;  1STG A;  4HTH A;  3EVQ A;  1EY0 A;  5NUC A;  3NXW A;  2ZT9 C;  2X69 A;  1QNK A;  2A74 C;  2LKV A;  3R2T A;  4F88 A;  4ZLT F;  3VYS A;  4RGT A;  1G6Z A;  1M4V A;  4G4K A;  1F9S A;  1YNJ C;  3LX0 A;  4TRD A;  4ID6 A;  1F9Q A;  1HTL D;  1KDA A;  2LFN A;  5CV5 A;  2L55 A;  1BF4 A;  3K5O A;  1BXT A;  1ILQ A;  1O7Y A;  2Z4H A;  2E75 C;  2QIL A;  3I72 A;  3IFT A;  4FXG C;  5ELC A;  1BQQ T;  3CHB D;  2E2D C;  2V4D A;  1BCP C;  2K33 A;  1Y8P B;  5M3M B;  3NP8 A;  3D4D A;  2D5D A;  5FLX L;  1EU4 A;  4PQX A;  1CHQ D;  2DNC A;  4XQJ A;  1DCZ A;  3A7A B;  1PFB A;  2B8F A;  2EZV A;  3Q0A A;  1WTV A;  1IW7 C;  4C1N K;  5C6A A;  3KLR A;  3OWF A;  2F0T A;  5JPM C;  5G3L D;  2KA7 A;  5CYU A;  3M4Y A;  2EXZ A;  1ONL A;  4HN7 A;  1GHK A;  1HA5 A;  1E2V A;  1H9J A;  2JEA I;  1SND A;  3W3A A;  4LK1 C;  2KCC A;  2QKI C;  4RCN A;  5LL6 X;  1S4Z A;  4TSS A;  5IIF A;  2RDF A;  5KRU A;  2EY6 A;  3X3M A;  5BN5 A;  1AN8 A;  2RA4 A;  4KKU A;  3GTL B;  1L0X B;  3PUY A;  3OMG A;  2L9H A;  1STA A;  1EL0 A;  3MFG A;  3AU7 A;  1ZEQ X;  1JOQ A;  2OXP A;  1RKN A;  4Q0F A;  1BCP D;  2CVR A;  2FJ2 A;  1SFO B;  2PQE A;  2XNA C;  5EJW A;  1EIG A;  2NYZ D;  4K8J A;  2PCF B;  1NR2 A;  1LTI D;  5C0X H;  3OW7 A;  4BY7 B;  1LTS D;  4FF2 A;  4IUP A;  4ZYS A;  5C44 B;  2NBF A;  4IAL A;  2EYH A;  5A2Q L;  1D1I A;  5KEE A;  2QDB A;  2Q8I B;  3PUZ A;  1R4P B;  3NPP A;  4WOR A;  1BCP F;  1G8Z D;  3BDL A;  2WII B;  1BNZ A;  3HOW B;  1K8O A;  4DU9 A;  1CZG A;  5C5M A;  1PFN A;  4EQN A;  4RFB A;  2OEO A;  2BE5 C;  3D6W A;  1U4M A;  2F0V A;  2MUY A;  1O80 A;  2M00 A;  2F0O A;  5D3D A;  1RCV D;  3HOX B;  2D9U A;  4ME5 A;  2Q8T A;  1K8M A;  3SK6 A;  1YNN C;  1EYD A;  2JE6 I;  1GUW A;  3K5N A;  1ILP A;  3T53 B;  3SDZ A;  4HAE A;  1O7Z A;  4CKC A;  1AW7 A;  2IWH A;  2C5C A;  2AUK A;  3BS1 A;  1A2T A;  2SEB D;  5D3I B;  4QCL A;  1FGB D;  4A3B B;  4S3S A;  3HKZ B;  3MA2 B;  1DM0 B;  3NBH A;  5EGT A;  2XN9 C;  2FIN B;  2ICI A;  3S17 B;  4RA8 A;  5EQ0 A;  4E6I A;  1LTR D;  5JAV A;  2WB1 B;  1UAP A;  3QG1 A;  4XYQ A;  4FF3 A;  2L4N A;  1ICW A;  1SBB B;  2K1B A;  2IW3 A;  3QOL A;  1Y1V B;  1RTO A;  5DM6 3;  3OPO A;  4CKE A;  2A73 B;  3HGB A;  3HS0 C;  2KEE A;  2L1B A;  2FMC A;  4BY1 B;  4C1N I;  4XIG S;  4X3S A;  5BN3 A;  3PIP 3;  1SDF A;  3UI2 A;  3EJI A;  3J81 E;  4DAY A;  2BCO A;  4IUT A;  3TME A;  2FMM A;  3U9O A;  3X3N A;  1DZ1 A;  5CV6 A;  4Y7N B;  1S5F D;  3SE0 A;  3EQL C;  2PZT A;  1MSH A;  2K04 A;  1B53 A;  2BA1 A;  2R93 B;  1CQV A;  2O4X A;  1I6H B;  4ULL A;  1Z6H A;  5M3F B;  1JWU D;  5D14 A;  3HEJ A;  3NUC A;  4HSP A;  3T4A C;  5K36 G;  4YIJ A;  5FO8 B;  1GUN A;  1QCB D;  1F2Y A;  3VYR A;  2HDM A;  3DMU A;  3FMC A;  1B2T A;  1G2T A;  2ZXP A;  1NSN S;  1CZW A;  2IJ0 A;  1B9M A;  1JR0 D;  2Q8R E;  2NTT A;  4G7H C;  3WOE A;  2L0C A;  3ONA B;  1TWA B;  2PZU A;  3AMU A;  5DM7 3;  2HUG A;  4CHT B;  2YYZ A;  2R3Z A;  2K05 A;  4OIJ A;  2F3W A;  2PNR C;  1PFM A;  3GTJ B;  4EQP A;  3MXG A;  1KDB A;  1SNC A;  4BBR B;  4JK1 C;  2MP1 A;  5M5Y B;  1TU2 B;  1TKW B;  1WTX A;  2M9V A;  2F0J A;  4RWS C;  1Q1E A;  1Y1W B;  4OO1 I;  2FFK B;  3QJY A;  2NVQ B;  5F2D A;  4TQU S;  3SK4 A;  1X3P A;  3C3L A;  1PZI D;  5LHY 1;  1TVX A;  3RLF A;  3M7N A;  2WAQ B;  1VMP A;  2F0G A;  3NQT A;  4V0B A;  3BZD B;  1F77 A;  4PMB A;  1RDP D;  1TWH B;  5KYL A;  5JVH 3;  2MGS A;  1O78 A;  5COR A;  1EEF D;  3H09 A;  2A6H C;  2MHV A;  1SJE D;  4DAP A;  1G2S A;  4PV1 C;  1QE6 A;  1PRT D;  1PTO D;  2E2H B;  1PRT B;  4CBV A;  3BYY B;  3S1M B;  5JPN C;  3PIO 3;  4XYO A;  1II3 A;  1HHV A;  2NVT B;  2B2Y C;  5KGU A;  2MJ8 A;  1KDC A;  2N88 A;  1ESR A;  5E3F A;  1WTR A;  2EYF A;  2H1E A;  5C0X G;  2JA6 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...