1FJGQ

Structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotics streptomycin, spectinomycin, and paromomycin
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Functional insights from the structure of the 30S ribosomal subunit and its interactions with antibiotics
pubmed doi rcsb
molecule keywords 16S RIBOSOMAL RNA
molecule tags Ribosome
total genus 21
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2000-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1fjgQ00
1WYDA 3PUYA 4DV2L 1VQ7A 2Z0SA 3K7AH 2H5XA 2DGYA 4IPGA 4UY8C 4BA1I 4A3KH 5GQOA 2AKWB 4DV2Q 1E3PA 1QUQA 1CKNA 4IPCA 4MTNA 4A3MG 3GTOH 3AYHB 2I5HA 1VQHA 3HOXH 3D31A 4A3DH 1KD1C 1SLJA 1SROA 3UDGA 1X3GA 2KHIA 1XPRA 3GTMH 2D62A 4JG2A 3PUVA 2QGQA 1VQOA 3H0GH 2KCMA 4LF4L 1X3FA 4QL5A 4A75A 3KOJA 3MXNB 5LMNW 1PH8A 4DV5L 4JC0A 1WJJA 3S1QH 2Q2UA 4R4QA 1JT8A 4DK3C 4LF4Q 3AEVA 1NMFA 2UUAL 4L5TA 1U0LA 3S14H 2B3GA 1VQ9A 1VQGA 4DV5Q 1S40A 2I5MX 4DPGA 5GAHC 1NY4A 2CCZA 4DR7L 3FKIG 5IYBG 4R4TA 2KENA 4P75A 3I4MH 2UUAQ 4POFA 3HKZG 2OQKA 4GN3B 4A3GH 1YIJA 1M1KC 4BA2I 4DR7Q 3VDYA 2OQ0A 1HNZL 2R6GA 3HOUG 4A3FG 1NMGA 2WB1G 2NVTH 1HNWL 2CFMA 3K7UC 2BA1A 1IXRA 2R92H 4WJ4A 4R4OA 4BBRH 1HNZQ 5LMNQ 1N33L 1WCMG 5DLQE 4EQ5A 3S15H 1HNWQ 4XIGS 4A3CG 4HIOA 1L0WA 4QGUA 4OO1G 4RMFA 4LF6L 3K8AA 3PV0A 2JA5H 3CMAA 2N49A 1N33Q 4C3JH 5K36G 2E2JH 2CKZB 1UEBA 3K80C 4HJ7A 2JEBI 1AH9A 1Q12A 2K50A 2B63G 4LFCL 2GVBA 3CCMA 4HJ8A 3STBD 3PCOB 1PH2A 3FHWA 1PH6A 4Y52H 4K0KL 1OXTA 1NTGA 2HT1A 2VUMH 4LFCQ 3K81C 3PUZA 3GDEA 3U4VA 1KRTA 1IYJB 2LXJA 5C0XJ 1VQ4A 4OO1I 5JEAJ 4A3LG 1VQAA 4K0KQ 4MZ9A 1SFOH 2R93H 2NN6I 1HZCA 3KFUA 1GKHA 1KC8C 2UXDQ 4YWLA 1X65A 1W3SA 1XPOA 3KYHC 1O7IA 4UP8A 5E7NA 1P16A 2VQFL 3E9HA 4KHZA 3CCEA 4A3EG 2RHQB 2VZAA 4KI0A 2ES2A 4IOAA 3HFZB 4PZ6A 2GN5A 1V1QA 4X64L 2Y0SG 4OONA 4DUZL 4QQBX 4DV7L 2BH2A 3CCJA 1X54A 3PGZA 1Q7YC 2Z6KA 4JV5L 2VQFQ 4LF8L 1X56A 2A19A 3W1BA 4X64Q 4DUZQ 4DR4L 1HZAA 4DV7Q 4DUYL 2EQSA 1PV4A 1Q8KA 3S1MH 4JV5Q 4DR1L 1FL0A 4LF8Q 1U5KA 2ZTEA 3UE0A 3S2HH 3GTPH 4LF9L 1TWFH 1LUZA 1VQ6A 3S2DH 2IX0A 4DR4Q 3CXCA 1YHQA 4PZ8A 4DUYQ 2F4VL 5IYCH 4BY7G 3TEHB 4L5RC 4DR1Q 1FJGL 5M3MH 5IP7G 1VQNA 2UUBL 1N34L 1HR0L 4LF9Q 2IX1A 3B6YA 4HIKA 1SRUA 4TQUS 4JBKA 2F4VQ 4JI5L 2BH8A 2A1AA 2ID0A 2I5LX 1FJGQ 2CQOA 1E1TA 2UUBQ 4JI2L 3S24A 1HR0Q 3NELA 1UE5A 1K8AC 4BBSG 4YHHL 4JI5Q 1E22A 3HOYH 3GTKH 2K75A 4JI2Q 4A3IH 5AJ3L 4A4IA 2WAQE 3U58A 4IJLA 1PHJA 4AQYL 2R7FA 4YHHQ 1YJWA 1VQBA 1KIXA 1SN8A 4GKJL 4EX5A 1Y14B 1LTLA 4DV6L 2OWOA 5AJ3Q 3S16H 4AQYQ 1Y1VG 2JA8G 4J15A 4LFAL 2NVQH 4GKJQ 4DV6Q 1N8RC 1OXUA 2C35B 4UPAA 3HOWH 4LNQA 2UXBL 1JB7A 4LFAQ 3JC66 1OTCA 1WFQA 1I3QH 4Y7NH 2E8GA 2Q2HA 5M3FH 1YJNA 1VQ5A 4OX9L 2UXBQ 2ASBA 4YWMA 3NBHB 3U50C 5IWAL 1EFWA 2B63H 3RLOA 1YZ6A 5GROA 1VQPA 1N32L 3UDIA 4JI6L 4DV0L 1D7QA 4OX9Q 2JA6G 5FJ8G 1BKBA 4IJHA 3RN2A 5IWAQ 1TWGH 3MEFA 1N32Q 5IYDG 1PA6A 4JI6Q 3FP9A 4DV0Q 1GD7A 3OYYA 4YCUA 2B29A 3CP0A 5IE8A 1XTDA 1I50H 4X62Q 3HOVG 3E0EA 3OW2A 1X3EA 5GAEC 4DV3L 1EUJA 4HJ9A 3TREA 4AIMA 3F2CA 1YJ9A 1XJVA 4A3BH 4DR3L 1CSPA 3CCSA 2D0OA 5C44H 4HJ5A 1K8GA 2AMCB 2ZJRA 2PI2E 4DV3Q 1NE3A 5JJLA 4KLKA 4DR3Q 2MNAA 3CC4A 3CW2C 2AWOA 1W2BA 3J80i 5FLMG 1VCIA 1NJIC 1KL9A 2ATWA 1AE3A 4KHPL 4IFDJ 3D0FA 5JJIA 4L5SA 3J81c 1RIPA 5M5YH 2UUCL 2VW9A 4X65L 1EQRA 2DUDA 2IHEA 1VQKA 4YCVA 1VQFA 3CC2A 2R7ZG 5H1SE 2Q2IA 4KHPQ 4P72A 5LMNL 1EOVA 2WP8J 1GVPA 2EXDA 3CCUA 2UUCQ 3I4NG 2CWAA 1BBUA 4X65Q 3GTJH 2KBNA 1S72A 4JI4Q 3TS2A 4BXXH 1MKHA 3ULJA 4BY7H 4JBWA 1DGSA 3NEMA 4GLVB 4GN4B 4PG3A 4DK6C 1IBML 2E2IH 3M7NA 5C4XG 4QY7A 1JJGA 4GN5A 4TVAB 1Q86C 3UDXA 1HJPA 5IP9H 3PIOA 1IBMQ 4C2MH 2A8VA 3HOZG 4GOPC 3CAMA 1K0RA 3PO2H 1MJCA 1KAWA 1YBYA 4OXPA 1YITA 1RL2A 2JA7G 1T9HA 4P71A 3RR5A 4BBSH 3PF5A 3M4PA 3UDFA 5M5WH 3L2PA 2HIXA 2I0QA 4A3JG 3A0JA 1JJ2A 2VNUD 1ASZA 2NVXH 4WJ3M 2LXKA 4A93H 3CCLA 2E5LL 3H3VI 2K5VA 3J81j 4XTCS 1SR3A 3T1HL 1A62A 4LWCA 1SMXA 4NB3A 4HJAA 1A0IA 4DR2L 2E5LQ 4B3RQ 4GNXC 1B70B 4YWKA 3T1HQ 3ZJYC 1CKOA 4DR6L 5C3EH 1QZGA 1L1OC 1TXYA 1OXVA 4LF5L 4OWWB 4DKAC 4DR2Q 1C7YA 4GOPA 3ICEA 3GTGH 1Q1BA 4APVA 4YY3L 3F2BA 4LFBL 1PVOA 4GKKL 2IT1A 2QA4A 3PO3G 2N8NA 4IPDA 4DR6Q 3F2DA 2N78A 4LF5Q 4JI8L 1HH2P 5BR8Q 1Q46A 4YY3Q 2AHOB 3S17H 4LFBQ 4LW1A 4B3ML 3HOXG 2JA6H 4GKKQ 5FJ8H 4A3DG 2NZOA 2IHFA 1XMQL 1C0AA 4GLAC 1PYSB 3PSIA 1G291 4JI8Q 2ZTDA 3A5UA 4A3MH 5IYDH 2OCEA 1Q1EA 3KDFB 1IBKL 2PMZE 4B3MQ 3H0GG 2Q2TA 1XMQQ 1K83H 4OWTB 4X6AH 2JJQA 1IBKQ 4GNXA 3I2ZA 2GVAA 4FDBA 3DM3A 5ELNA 1TWCH 3S1NH 1L1OA 4LUVA 2K52A 3STBC 2ZM6Q 3H15A 4JI1L 1V43A 4P73A 3I4MG 1PH9A 3F1ZA 2MFIA 3AFPA 4AYBG 4A3GG 3SGIA 3FKIH 2V1CC 1E7ZA 5IYBH 3CCRA 3RZOH 3GTLH 1HZBA 4JI1Q 2YTYA 2NZHA 2R7ZH 4B3TL 2R92G 1YHAA 1X9NA 3RN5A 3HOUH 4A3FH 2NVYH 2RF4A 2XTIA 4BBRG 1NBWA 2UU9L 4BY1G 3KDFA 1EIYB 1J6QA 4B3TQ 3W5OA 2XGTA 3H3VH 1WCMH 5LMUL 4RG1A 1D8LA 4OWXB 1UWVA 2JA5G 2UU9Q 5C0XG 4A3CH 3J7A5 2MQHA 5JEAG 1WI5A 3U4ZA 3L7ZC 3BZKA 3CQZH 5LMUQ 2VS1A 2YU9H 4JI3L 1K9MC 3RLFA 1Y1WG 1FVIA 3TQYA 1N9WA 1PH3A 3G71A 4HIMA 1Z47A 2ZTCA 3HKZE 3I56A 4UP7A 4H02A 1XMOL 2VUMG 4JI3Q 1XNRL 2YYZA 4JCVE 3CD6A 5GAGC 5GADC 1PH1A 1KQSA 4X62L 2F3IA 3AQQA 2WB1E 3LGJA 1AE2A 2WFWA 2R93G 4AH6A 5C0XI 1XMOQ 1XNRQ 1PH4A 3WWVA 4IOCA 4A3LH 1KRSA 1YNXA 1X55A 4C3HH 1JE5A 3S1RH 5JJKA 3TRZA 4GS3A 4QIWE 3ULPA 3L0OA 1FGUA 3NENA 4A3EH 2ZJQA 3KJOA 1CUKA 2YV5A 4HIDA 2PQAA 1G51A 2MO0A 1CSQA 3PO3H 1GO3E 3E9IA 4DV4L 2WAQG 2JEAI 1E24A 1P8LA 2KHJA 4JI4L 1QVFA 1JMCA 1JJCB 1I5FA 3I4OA 1HZ9A 4DV4Q 1VQEA 1VS0A 1LM0A 5IYCG 5M3MG 1TWAH 4R1JA 4ME3A 4B3SL 4X66L 3M4OH 2JA9A 3IRBA 4JBJA 5IP7H 3CPFA 3EN2A 3GD7A 3I55A 1BVSA 3G48A 2CWPA 4GOPB 4B3SQ 3Q8DA 4X66Q 1BBWA 2KCTA 1ASYA 1YVCA 4PMWA 3J7ZC 2Y0SE 4MNOA 3HOYG 2BA0A 3G6EA 3KF8B 2JQOA 4DV1L 1VQ8A 4A3IG 2K4KA 3TS0A 1M90C 3KF6B 3JAMc 3UE1A 1VQJA 4R4IA 1UE6A 2ALYB 5IY0A 4POGA 4DV1Q 2HHHL 4NPSA 1YEZA 2FXQA 3PUWA 4B3RL 2UXDL 2UXCL 2QEXA 2OTLA 4NXNL 1VQDA 1EWIA 2HQLA 3A5ZB 4BY1H 2HHHQ 1Y1VH 1IBLL 2JA8H 2JK8A 3HOWG 1HNXL 3F8TA 4ALPA 1QVCA 1X6OA 4R4CA 4DAMA 3CCVA 4GNXB 4NXNQ 1Q81C 2UXCQ 2NN6G 3M4QA 1PYBA 1L1OB 3RNUA 1VQMA 4JBMA 4YCWA 1IBLQ 1IL2A 1G6PA 4C3IH 5M3FG 1QVGA 1HNXQ 4O2DA 4LF6Q 5BR8L 2OTJA 1J5EL 2HIVA 2Z6KC 4A3KG 3ER0A 4AYBE 1Y1WH 1EQQA 2EIFA 3PF4A 3KF6A 2AWNA 1J5EQ 3CF5A 2L15A 1S3OA 1Q82C 4IFDG 4QJFA 1XPUA 4P74A 1R9TH 5C4JH 2PNHA 1YI2A 1E1OA 4A3BG 1VQCA 2ZM6L 3CPWA 3HOVH 2JE6I 2LSSA 5ELOA 3GTQH 1Z9FA 5C44G 2K14A 3J81i 3BZCA 1EIFA 4JYAL 1B8AA 3W1GA 1OXSC 1MJEA 4IPHA 4IO9A 3PUXA 5HGQA 3OTOL 1OXXK 2VL6A 1KHIA 1K73C 1I94L 3BU2A 1WOCA 1HR0W 1C9OA 2VY3A 4JYAQ 3ERSX 4IFDI 1XNQL 1A8VA 2RHSB 5FLMH 3PIPA 3OTOQ 1K3RA 4L5QA 4DAYB 4DNIA 5M5XH 1H95A 1PFSA 3A74A 1I94Q 2R7DA 4O0AA 4JI7L 2IY5B 2D0PA 3I7FA 1IZ6A 3DLLA 1XNQQ 1L2FA 2K5HA 3KJPA 3GO5A 4JOIC 4GLXA 4BXXG 4PZ7A 3J80c 4DR5L 3I4NH 1EYGA 4JI7Q 3EIVA 4LUOA 3BJUA 3JAMi 3RLNA 2YTVA 1YHBA 4DR5Q 5C4XH 5IP9G 1QZHA 1LYLA 2VQEL 5J3BA 1PH7A 3PO2G 2F52A 1N34Q 1A63A 3HOZH 1CKMA 3EBEA 5HY6A 2N3SA 2PQAB 2VQEQ 2ZJPA 2E2HH 2JA7H 1SE8A 3HKSA 3CCQA 1QUQB 4LF7L 3M3YH 1CKNB 3T1YL 5IT9c 3M85A 3ULLA 4A3JH 4A93G 3K0XA 4LUZA 1MIUA 1VQLA 1UE1A 5EAYA 3CMEA 3RZDH 2K5NA 4LF7Q 4JOIA 1GM5A 3T1YQ 1N36L 1I6HH 3M9BA 4NXML 3AFQA 2PI2A 1B7YB 4UP9A 5FLXc 1UE7A 1KXLA 2YTXA 4JI0L 3KLWA 1TWHH 1VQIA 1PH5A 1N36Q 4A76A 2MO1A 2RCNA 5C3EG 1V9PA 4NXMQ 3G4SA 3CC7A 4JI0Q
chains in the Genus database with same CATH superfamily
2E76C 2F0JA 2BDOA 2DGYA 4X3KA 3GTJB 1WTHA 4BA1I 2NTTA 2AKWB 2KOLA 3BVGA 1MI2A 1D6EC 1CKNA 5KEEA 3QG1A 1PFBA 2I5HA 3HOXH 5J1ZA 3A8KE 3PO2B 4QCLA 3P1HA 4UDUC 4CJ2C 2QGQA 1VQOA 2JSOA 4LF4L 4XYOA 2RSOA 1HPCA 3KOJA 2F0SA 3MXNB 4P2CB 3LWEA 4A75A 2B2TC 4DV5L 1JT8A 4LF4Q 3DUZA 2KCCA 2HDMA 1U0LA 4DXFA 2VUMB 1VQGA 4DV5Q 5GAHC 3MVVA 1NY4A 5COYA 4DR7L 3FKIG 3I90A 2M9VA 4R4TA 2EY2A 2F0PA 2OQKA 1Y8NB 3BVZA 5IGDA 4DR7Q 1JOKA 3HOUG 1SJHD 3T13A 1B4OA 3K7UC 5EPLA 2BA1A 4ZCKA 1NCVA 5E4XA 2QDBA 4R4OA 2K5WA 5DLQE 4EQ5A 1PYWD 1BO0A 4QGUA 3ONAB 4RMFA 5CBEE 3CMAA 3FRPB 1EOTA 3TP5A 5JEAH 1S5FD 1BOSA 1WTRA 3IAYA 3GTPB 3FMCA 1AH9A 3CCMA 5C6AA 2K28A 1H9RA 1PH6A 1NTGA 3TP8A 1VMCA 4LJZC 2RKSA 3PUZA 3U4VA 1KRTA 1IYJB 2EYMA 1VQAA 3OSOA 1SFOH 1HRJA 2R93H 2EY6A 1HZCA 3NQIA 1GKHA 4L63B 2Z8LA 4C3HG 1TS4A 2ICIA 3NPPA 4A3EG 4TKOB 4X64L 2GN5A 5E1FA 2Y0SG 3QOJA 4OONA 3VYUA 4QQBX 1Q7YC 1X54A 2Z6KA 3MZ5A 3W1BA 4X64Q 1WCMB 1WTVA 2EQSA 2A68D 3S1MH 2IJ0A 4KKUA 1TWFH 2B2VA 1JICA 1HTPA 4Y7NB 4BY7G 5A2QE 5IP7G 2F3WA 4PMBA 3OIQA 4H0LC 3HOYH 1SYCA 3EFXD 1I50B 4K6LA 4ZKBB 4A4IA 2LFNA 2WAQE 4QUFA 2E75C 2JP1A 1YJWA 1KIXA 1Z6HA 1EZ8A 3H94A 2IPKD 1SEBD 5ELCA 3S16H 4LFAL 1N8RC 1K8MA 2OXPA 2JXMB 3Q0AA 3HOWH 4LFAQ 1EY8A 2NN6H 1OTCA 1I3QH 2E8GA 2F0MA 2Q2HA 1YJNA 1UNSA 4OX9L 4XQNA 2F3VA 4O42A 4YWMA 1W6JA 4HN7A 5CBAE 4JI6L 1HA5A 3M4OB 4G7OC 4OX9Q 5FJ8G 3E5SA 3QJYA 2B39A 5BN5A 5IYDG 4JI6Q 2IX3A 3CP0A 1NR2A 1NUCA 2QDLA 3HOVG 3E0EA 4DNRB 3OW2A 4HJ9A 1EUJA 2DNCA 1CHPD 1T5EA 2IWHA 3SK6A 5D14A 1S5ED 3SXHA 1SYGA 5CR3A 2B2WC 3D4WA 1JWSD 3D0FA 1JOOA 3J81c 1W6KA 2VW9A 1EQRA 1VQKA 1HXYD 1ENFA 4K5XA 4IUNA 1SBBB 2Q2IA 1EOVA 4NMZA 3CCUA 3T51B 1A15A 1BBUA 1S72A 1LLRD 4JBWA 1Y8OB 2O5JC 2EYOA 2MJ8A 5C4ZA 2VB3X 5C4XG 4QY7A 2XSCA 2JA6B 2A8VA 3HOZG 1YBYA 3QR8A 4OXPA 5C4JB 2JA7G 4BBSH 3PF5A 3UDFA 2X6GA 3L2PA 2HIXA 1JJ2A 2NVXH 2PZWA 1A2TA 2LXKA 3I91A 4A93H 3CCLA 2E5LL 3SHLA 1F9RA 5CGKA 3J81j 2K05A 4HCSA 1DOLA 2E5LQ 3MXGA 3BDCA 3D3RA 3ICEA 4YY3L 1O80A 4KY5A 3I4NB 2WB1B 3OWEB 5FO8B 5C3XA 1I4GA 4YY3Q 3HOXG 2IHFA 4GLAC 4JVZA 4KD4A 1PYSB 2EY1A 3DEOA 4MIUA 2CW0D 1BXTA 1D5ZC 2ZTDA 3A5UA 4A3MH 3KDFB 1HFNA 2PMZE 3N6RA 4B9WA 1FD7D 3LNNA 1WTWA 3C46A 2JJQA 2QCPX 3STBC 2M00A 3LWUA 4HEDA 5IYBH 4HSVA 4FXGC 5EKLA 2YTYA 2HDLA 2NZHA 1ML0D 3S1RB 3K0YA 2RF4A 2XTIA 4R9WA 1NBWA 3EQLC 2UU9L 1PMRA 4ZYSA 2L55A 1IYUA 2L9HA 1EQTA 1D8LA 2UU9Q 4OO1H 5JEAG 2E2DC 4I65A 3K5LA 4C1NK 5K36H 2YU9H 3H6MA 4JI3L 1K9MC 3GTMB 3TQYA 5BN4A 1N9WA 4XYQA 1TWAB 3I56A 4XXEA 4DK1A 3NTIA 4JI3Q 1XNRL 2E74C 1PH1A 4KY6A 3AQQA 4CBVA 5CV6A 4IUTA 2R93G 1A3VA 2NWGA 1XNRQ 3R2TA 3G7LA 1KRSA 3D4RA 5EQ0A 1BDOA 4V0BA 1JE5A 1H9KA 2Z9HA 4QIWE 1STBA 3L0OA 5IGGA 1JWMD 3KJOA 2YV5A 2NZ1D 3PO3H 3F2UA 4BY1B 4DV4L 1H9SA 1CZWA 1EY5A 1I5FA 3HGBA 5I2XA 1PTOD 4DV4Q 3C2PA 1CK1A 4C3IB 1F2ZA 3MEHA 4ME3A 2JA9A 2F0HA 3EN2A 5JAVA 1LO5D 1F9QA 4KV6A 4EVOA 4GOPB 1ASYA 1F2YA 2Y0SE 2MPMA 1R9TB 3HOYG 4DV1L 2JQOA 3TS0A 5LL6S 3JAMc 2ALYB 1QOHA 4Z9CB 1D1IA 4DV1Q 2B2UA 5HGTA 4NPSA 1IHZA 1IW7D 5FOBB 2UXCL 5DAUA 4IZ8A 1EWIA 2HQLA 1Y8PB 1Y1VH 4OEMB 2JK8A 3HRZC 3HOWG 1HNXL 3F8TA 2UXCQ 1QVCA 4R4CA 4CDFC 1ILPA 2NN6G 1L1OB 2WAQB 3FEWX 1VQMA 1VF7A 3Q23A 1IL2A 1QVGA 1HNXQ 3DEPA 3S2DB 4U68A 5IGCA 2HIVA 5KIXA 3G6JB 2F0WA 4AYBE 1Y1WH 2EIFA 3KF8A 5D3DA 1CTMA 1FNWA 5I9OA 4IFDG 5IT9E 2K5DA 3KLSA 3K6OA 5A2QL 2K33A 2ZM6L 3CPWA 2A69D 3M3YB 2GA4B 4S3SA 4JYAL 3W1GA 3AU7A 1OXSC 1EYDA 2O5IC 3NSWA 1RDPD 3OW7A 2FMMA 1RHPA 4N9TA 4U673 2EYHA 1WOCA 2K5QA 1K73C 1HR0W 4JYAQ 5CORA 3ERSX 2NVQB 5FLMH 5IGBA 1K3RA 4XQQA 4DNIA 1FGBD 3ND9A 4KHVA 2D0PA 1IZ6A 1L2FA 2K5HA 4HMIA 4DNTB 1EL0A 2PW5A 3V2TA 3SK4A 1EYGA 3K7AB 4RGMA 4V190 1J9OA 4A3KB 3RLNA 1SYBA 4RGNA 1EZ6A 2ZXPA 4KK7A 1MSHA 1HUNA 2N3SA 2K1BA 1SE8A 3HKSA 1JWUD 1CKNB 3H0GB 4A3JH 4A93G 2C9OA 4DAYA 1UE1A 1Q3LA 1GM5A 3TDQA 1N36L 4G7ZC 1I6HH 3M9BA 2WINB 5FLXc 2PI2A 2KA7A 4UP9A 1UE7A 1I4QA 4RGTA 4XDXA 2KVMA 1N36Q 5M5YB 4A76A 1E2ZA 4A3GB 4MTKA 4IPGA 2F1MA 4UY8C 5EKKA 2FHTA 4BBRB 2QILA 2EXZA 1QUQA 3S15B 2KUMA 4IPCA 1HQMC 4A3MG 2XWBB 1VQHA 1SNCA 3UDGA 1X3GA 2KHIA 1XPRA 2D62A 1U4RA 3PUVA 4QL5A 1QNUA 4YIJA 5LMNW 1PH8A 1Y69U 5ELBA 3S1QH 4RKLA 3TSSA 3AEVA 2XIWA 1SNDA 1VQ9A 2WV6D 3BDOA 4DPGA 5FK9C 2CCZA 3TZDA 1D2BA 5IYBG 4POFA 3HKZG 1YIJA 1M1KC 3VDYA 2OQ0A 1HNZL 2R6GA 2ENBA 5C3EB 2CFMA 2R92H 1IXRA 1X3QA 4Q0FA 1HNZQ 2V4DA 5LMNQ 1N33L 4XIGS 1L0WA 2B2TA 4OO1G 3A55A 3OMCA 1SYFA 4LF6L 2EY5A 5JVH3 2JA5H 3VR2A 1N33Q 5K36G 2E2JH 1XTCD 4OGQC 4PNYA 2CKZB 1UEBA 4HJ7A 1SAPA 1UAPA 4M8AA 5EGTA 3DWPA 1Q12A 2FINB 2K50A 2B63G 4LFCL 3HG9A 4HJ8A 5M3MB 1PH2A 1STEA 3EA6A 1TWCB 2HT1A 2VUMH 4LFCQ 3K81C 2LXJA 5JEAJ 3W3AA 2SNMA 3KFUA 1GUWA 1STAA 1BCPC 1KC8C 5NUCA 3FKIB 1EY9A 4MHEA 1EQVA 2VQFL 3MAQA 3E9HA 4IOAA 3HFZB 4PZ6A 1DM0B 3HOUB 2BH2A 2VQFQ 1O7YA 4LF8L 1X56A 3NUCA 5DM73 4RGOS 4CKEA 4LF8Q 1U5KA 3UE0A 3PIO3 3GTPH 1LUZA 3VR5A 5KYLA 1JCKB 3BYYB 4Q5VA 1DONA 5IYCH 3TEHB 1FJGL 3HS0C 2UUBL 1LTBD 2B2YC 4HIKA 3NTHA 2A1AA 2ID0A 1FJGQ 2CQOA 1E1TA 2UUBQ 4JI2L 5I6WA 1A2UA 4YHHL 2DY7A 1E22A 2DN8A 3GTKH 2K75A 5AFWA 4JI2Q 1AZQA 5AJ3L 1PHJA 1ESRA 4C3HB 4YHHQ 4GKJL 3J81E 4EX5A 5BN3A 4KMUC 1CA6A 2OWOA 3GV6A 5AJ3Q 1ET9A 1Y1VG 4OELB 3DM1A 2Y0SB 4GKJQ 1LTRD 1Q8IA 2AQ1B 2C35B 4K8JA 1JB7A 4K2LA 4F87A 5C4HA 3BZDB 1GUSA 1QB5D 2ICEC 4Y7NH 1VQ5A 2NYZD 2ASBA 5IWAL 4BY7B 2PNRC 3RLOA 1N32L 2EVBA 3H91A 1EIHA 2E2IB 1JR0D 1AW7A 5IWAQ 1HCZA 2EYLA 2KEEA 3MEFA 4CDEC 1N32Q 1PA6A 3FP9A 3ZYYX 3OYYA 1DZ1A 2B29A 1I50H 3K58A 5M9OA 3K5NA 4AIMA 5M5WB 3F2CA 2PPBC 4DR3L 1CSPA 2ZT9C 1X3PA 2F0GA 5C44H 1R4PB 5FO7B 1K8GA 4JK1C 3BDLA 2PI2E 3VYRA 1NE3A 5C3WA 4KLKA 4DR3Q 1NJIC 1AN8A 3J80i 5FLMG 4IFDJ 1KL9A 1AE3A 3C1EA 4KHPL 3LX0A 5JJIA 4L5SA 1J8IA 1RIPA 3NBHA 2IHEA 1CFMA 3OPOA 3NTKA 2R7ZG 2NTSA 4KHPQ 4EGVA 2WP8J 2Z4HA 5K5PA 4JI4Q 1SMYD 3TS2A 1MKHA 3ULJA 4ZRZA 4GN4B 4PG3A 1E2VA 4DK0A 4E6IA 1JJGA 4GN5A 3S17B 5IP9H 3PIOA 3V05A 3CAMA 1K0RA 4GOPC 1MJCA 1KAWA 1PTOB 1YITA 1RL2A 1T9HA 2B2WA 4RHRA 4A3JG 3HOVB 3GTQB 1H9MA 2HUGA 4WJ3M 2Z4IA 1NR4A 4RKBA 3FPPA 5IT9L 4JPBW 2A6HC 2D9UA 3H3VI 3T1HL 3C1FA 4R8IA 4HJAA 4LWCA 4B3RQ 3P7JA 5E3FA 1A0IA 4DR2L 3A7AB 4YWKA 3T1HQ 1CKOA 2B8FA 1TKWB 1L1OC 1TXYA 1OXVA 2F4IA 4DR2Q 1C7YA 1DCZA 1B44D 1Q1BA 3X3NA 4APVA 3F2BA 5JOBA 2NVYB 2QA4A 4A3FB 3HP3A 3F2DA 1HH2P 3K5MA 4LW1A 2JA6H 1C0AA 1O7LA 2OCEA 3I4LA 1Q1EA 1IBKL 4ID6A 2LMCB 3R8BA 1K83H 2E2HB 2JA7B 1KNEA 1IBKQ 1LABA 2GVAA 3I2ZA 2F0OA 3S1NH 1PRTD 1WTQA 5ELFA 3PMFA 3T53B 1PTOF 3A8IE 2QKIC 4P73A 1PH9A 3AFPA 2F03A 4AYBG 3CCRA 1E7ZA 1TWHB 2DJFC 1AEXA 4B3TL 2R92G 1K28A 2PQEA 1EY6A 3RN5A 4OL7A 2F0IA 1EIYB 1J6QA 4B3TQ 1PZID 2XGTA 2L11A 1ICFB 5LMUL 4OWXB 1UWVA 2JA5G 5C0XG 3J7A5 1YNJD 2L1BA 3L7ZC 4B08A 1LTTD 3CQZH 5LMUQ 1K0SA 4KKSA 2MGSA 3G71A 4HIMA 1H9SB 3K57A 3HKZE 4UP7A 1G8ZD 1XMOL 2VUMG 1OO9B 2JN4A 2YYZA 3EJIA 5GADC 3JAME 2WFWA 1XMOQ 3PQIA 1PH4A 3E3XA 3WWVA 4IOCA 4FNFA 4IUUA 1YNXA 4H7BA 3PIP3 3M7GA 3S1RH 3TRZA 4QMGA 2ZJQA 1ONLA 1CUKA 2M2LA 1CSQA 1F2LA 3O13A 4KN4C 1GO3E 5DEHA 1JB3A 3WDNA 1P8LA 2KHJA 1JJCB 4L8JA 1RF2D 5IYCG 1TWAH 4ODGA 4R1JA 4X66L 3J80L 1ILQA 1SNOA 3GD7A 1BVSA 4J6HA 5KNCA 3Q8DA 4X66Q 2MP1A 1BBWA 2KQ3A 3IKJA 1QCBD 2B8GA 3ND8A 2BA0A 3KF8B 2R93B 2EZVA 4K5WA 1IL8A 1ICWA 1UE6A 2ZXOA 4R4IA 1IKLA 5JPMC 2QF7A 2HHHL 3NK9A 1EU4A 1V8QA 2FXQA 2UXDL 4X3TA 2RSNA 4BY1H 3A5ZB 2HHHQ 2JA8H 5D65A 2UXDQ 4ALPA 4GNXB 3MXNA 1Q81C 5M5XB 1PYBA 3RNUA 4JBMA 4IN3A 4C3IH 1TWFB 1J5EL 2Z6KC 2RDHA 3K5OA 2CQAA 1DOKA 3SR1A 1J5EQ 4RA8A 1QE6A 1WTPA 4EQNA 4QJFA 1EYCA 4P74A 1R9TH 3WOFA 4DGZA 2XNAC 3AB9A 1VQCA 2EDGA 1S4ZA 3HOYB 3U9OA 5J39A 2JE6I 4CDDC 2X69A 5FLXE 5C44G 1WD1A 4FVMA 3M4YA 2DJGC 1EIFA 1GXDC 5HGQA 2A73B 4RWSC 1KHIA 1SNMA 5JVG3 4IFDI 1A8VA 3PIPA 4DAYB 3HOWB 3J81L 4O0AA 3DLLA 3KJPA 2G5DA 3DHQA 1LTID 4JOIC 1I3QB 4PZ7A 4DR5L 2RQXA 1C4QA 4OIJA 3JAMi 1AFPA 2PZTA 4DR5Q 2FFKB 5IP9G 1LYLA 2PZUA 1JOQA 3RMHA 1N34Q 2Q8TA 3J7YW 5HY6A 2PQAB 3KLSX 3NP8A 1CM9A 1QUQB 3M3YH 3M85A 1SXTA 1PDQA 1MIUA 2EE1A 4RCNA 5EAYA 3K59A 3RZDH 3BVMA 2VB2X 2F0DA 3S14B 1I4XA 1ZXTA 1RKNA 1VQIA 1PH5A 2TMPA 3AMUA 2MO1A 4ZUIA 4NKLA 2NBFA 3G4SA 1TR5A 3CC7A 2F0TA 1WYDA 3PUYA 1DOMA 3K7AH 4O1NA 3RUZA 4A3KH 5GQOA 1KAAA 1FNVA 4DFAA 1E3PA 4IUPA 3A56A 3EROA 3T56B 3QIAA 5JJZA 3GTOH 4BWGB 3AYHB 3D31A 4A3DH 1O78A 5CC4A 3HEJA 3H0GH 1X3FA 2FJ2A 4QUCA 4JC0A 2Q2UA 4R4QA 2A6EC 2NVXB 4A93B 1BR9A 1B9NA 1ESFA 2R3ZA 1ZKOA 2XVSA 1KLUD 5I9PA 3N52A 3DWQA 1A6XA 5LL6X 2KENA 3I4MH 1V1PB 2QEJC 4GN3B 3UI2A 4F8MA 4A3GH 4BA2I 4GZYC 1NMGA 2WB1G 2NVTH 4WJ4A 5IGFA 5CV9A 4BBRH 4DF7A 3S15H 4FXDA 2RDFA 4HIOA 3K8AA 2N88A 3PV0A 3VA7A 4C3JH 1KDAA 5EPJA 4A3MB 2JEBI 2G9HD 2J7ZA 2GVBA 1MD2D 1ENAA 3PCOB 2SOBA 1CI3M 1EY0A 1G2SA 4Y52H 1OXTA 1PZKD 5C0XJ 4OO1I 1STHA 2RVLA 3A8JE 3IL8A 1X65A 1XPOA 4DAPA 1O7IA 5E7NA 1P16A 2XRQD 4KHZA 4N8FA 2RA4A 2RHQB 1EIGA 2VZAA 4RFBA 1H9JA 2ES2A 4DUZL 1V1QA 4DV7L 2F0KA 3CCJA 3PGZA 1S5BD 4JV5L 1L0YB 4DR4L 1SE3A 4DUZQ 4M1UB 1YNNC 3KBGA 4DV7Q 4DUYL 1KDBA 3R3OA 1PV4A 1Q8KA 3H3VC 4JV5Q 4IALA 2ZTEA 3S2HH 5ISRA 4LF9L 4DR4Q 2IX0A 4J1MA 4DUYQ 1II3A 5M3FB 4L5RC 5FKAC 5M3MH 3MXUA 1VQNA 1HR0L 5C5LA 4LF9Q 3B6YA 2IX1A 2B63B 4TQUS 4CKCA 3S24A 1UEAB 3KLRA 3NELA 4IQZA 1HR0Q 5DM63 1K8AC 2KJXA 4BBSG 4A3IH 2Q8IB 4A3BB 5TSSA 4N9PA 1VQBA 3JAML 1JORA 1LTLA 1B1ZA 3L3OC 1PRTB 2PCFB 2JA8G 2FMCA 1JC7A 1HTLD 4I7ZC 1HHVA 3MHBA 1OXUA 2B2YA 1U9RA 4LK1C 3JC66 4C3IG 2XN9C 3MWYW 1NAPA 3NBHB 1EFWA 4CDCC 3D6WA 4G4KA 1VQPA 1HUMA 1D7QA 2X6LA 4PQXA 1BKBA 4IJHA 3RN2A 3TBIB 1TWGH 2BDNA 4C2MB 1GD7A 2K32A 4FF1A 2EPBA 4X62Q 1C48A 5EKIA 1X3EA 5KNDA 5GAEC 1V1OA 3TREA 1ENCA 4KY7A 3TP6A 1QILA 2D0OA 3CCSA 2ZJRA 1U4PA 1TS2A 3OWFA 2MNAA 3CC4A 1W2BA 1PFNA 1VCIA 2PMZB 1Y1VB 4R8NA 2UUCL 2O4XA 4X65L 2DUDA 3S9WA 4YCVA 1VQFA 3CC2A 5LMNL 1GVPA 3VYSA 2UUCQ 1PRTF 2CWAA 4X65Q 1WD0A 3GTJH 3GTGB 4BXXH 4BY7H 1DGSA 1IBML 1QWYA 3URYA 3A54A 2E2IH 1C8CA 3CKIB 3M7NA 1EY4A 1MSGA 4TVAB 1Q86C 3UDXA 2K7VA 3OIPA 1IBMQ 1BCPD 3PO2H 2F0LA 2R61A 5M5WH 3D8GA 1XX8A 2EYPA 3A0JA 1WTXA 3QB3A 1GUGA 2EJMA 1LT3D 2K5VA 3I3CA 2D2CC 4FXKC 1E2WA 1F2MA 4CHTB 4NB3A 1SMXA 5C5MA 5FLXL 4GNXC 1B70B 3ZJYC 3RZOB 3GTLB 3GQBA 1QZGA 1KABA 4GOPA 2R7ZB 1G91A 4LFBL 1PVOA 2EYFA 3PO3G 2N8NA 3DWAA 1ZYRC 4FO2A 4KKTA 4JI8L 5BR8Q 1F9SA 3E0JA 2AHOB 3S17H 4LFBQ 4B3ML 5FJ8H 4A3DG 1PXUA 1G291 4JI8Q 4ILWA 5IYDH 4QIWB 4B3MQ 3H0GG 1SNQA 4FP5D 2Q2TA 4NW2A 1MBYA 1B3AA 4X6AH 2HCCA 4K2KA 4A3JB 3DM3A 1S5CD 5I6YA 1L1OA 4LUVA 2K52A 1I4HA 1TVXA 3H15A 4JI1L 1JQYD 1I6HB 1V43A 3I4MG 3F1ZA 2MFIA 1WTOA 2BCOA 4A3GG 3SGIA 4H13C 3D6CA 1HZBA 4JI1Q 3KK7A 1CHQD 1YHAA 4A3FH 2NVYH 4BBRG 1TS5A 5CV7A 3SK5A 4A3EB 2J4XA 4H44C 4DXGA 3W5OA 3NQTA 3CHBD 3H3VH 1WCMH 4A3CH 3T4AC 4C3JG 4ME5A 2MQHA 1WI5A 3U4ZA 1HA6A 2ZXRA 4NDXA 1LT4D 5L37A 1QJOA 4PMCA 3T16A 1FVIA 1Y1WG 3U9SA 1Z47A 2ZTCA 3S1QB 1TIID 1S5DD 5GAGC 3W2DA 2WB1E 1AE2A 2HD3A 2KCNA 5C0XI 3R2IA 4I7AA 4A3LH 1LV9A 3X3MA 5I4DA 4AYBB 5EBDA 5JJKA 4GS3A 3ULPA 5IOCA 5KGUA 2R92B 2MO0A 2BE5C 1B2TA 2JEAI 1TY0A 4WJWA 4JI4L 1D1KA 1JMCA 5IODA 3CRLC 2JA5B 1HZ9A 3GV3A 2E2JB 4ZUJA 1VQEA 5T1GA 2HQEA 1FR3A 1X32A 5M3MG 3SVMA 5CV8A 1BUVT 4B3SL 4J8QA 5EPKA 2A6HD 3IRBA 3M4OH 4UHVA 4FF2A 3G48A 2CWPA 1Q90A 4B3SQ 1B3QA 2EJGC 4PMWA 3J7ZC 2WKDA 4MNOA 3G6EA 4HSPA 4A3IG 4F7XA 5JPNC 2SDFA 1U4LA 5IY0A 4WFN3 4POGA 2SNSA 4L6TB 1YEZA 3PUWA 5CYUA 4CJ1B 4B3RL 1LT6D 1GUTA 2QEXA 1VQDA 4CJ0B 4KD3A 3VYTA 4DAMA 3CCVA 2L5TA 3M4QA 4K6DA 2CVRA 4YCWA 2HCIA 1G6PA 4O2DA 2OTJA 1RJTA 1EQQA 2KEDA 3PF4A 1SMYC 3KF6A 3CF5A 4KJNA 1S3OA 5C4XB 3R93A 3VR3A 1XPUA 5C4JH 2RCFA 4IUQA 2PNHA 1YI2A 3HOZB 1GJXA 3GTKB 1HQRD 1EWHA 5ELOA 1Z9FA 3J81i 2K14A 1JE4A 4UAIA 3ERQA 2K01A 1B8AA 3NE5B 4EQPA 4IO9A 1ZEQX 4K14A 2BOSA 1I94L 1C9OA 2VY3A 1XNQL 2RHSB 1H95A 4EQOA 5M5XH 4WRDA 1I94Q 2R7DA 2SEBD 1KDCA 1XNQQ 3I7FA 4QB4A 2IY5B 2TSSA 4GLXA 4BXXG 3GP7A 3J80c 4RAUC 3I4NH 4LMQD 1KNAA 4LUOA 4LAAA 1AZPA 3A7LA 2YTVA 1YHBA 4K5VA 1QZHA 1EEFD 3BYTB 2VQEL 3VR4A 3PO2G 1DXMA 5I2YA 1D5MC 3HOXB 1CKMA 2A68C 2JYOA 4FF3A 2VQEQ 2ZJPA 3CCQA 4XQJA 1GOZA 1GUNA 1QNKA 3HZXA 3T1YL 3ULLA 4G57A 2F0UA 3K0XA 2L0CA 5C44B 3CMEA 4JOIA 3BS1A 3T1YQ 1G2TA 1PRTC 4NXML 3AFQA 1RODA 1KXLA 2YTXA 4DAVA 1RTOA 1V9PA 4NXMQ 1G6ZA 2A5HA 2RDGA 1LTAD 4DV2L 1I6VC 3CRKC 2F0VA 1T5XD 1KTKA 2H5XA 2Z0SA 5G3LD 1CZGA 1VQ7A 3FVQA 3IFTA 1I4RA 3SEBA 2AQ2B 4DV2Q 2AQ3B 4MTNA 4X3SA 5DNFA 4IFDH 3WOEA 1KD1C 1YNJC 1SLJA 1SROA 4DA2A 3MXPA 1NSNS 3GTMH 1U4MA 4JG2A 5HURA 1EEID 2KCMA 1O7ZA 1LTGD 1LT5D 2LKVA 3RD4A 2F0NA 1WJJA 3QO2A 2NUCA 4DK3C 2EJFC 2KECA 1NMFA 2UUAL 2Z6BA 4L5TA 3TP7A 3S14H 2B3GA 3D4DA 1S40A 2I5MX 4RH6A 1SNPA 1LTSD 1SFOB 1R4QB 4P75A 4QF4A 5CV5A 2UUAQ 2KHSA 2LS01 4A3FG 1HNWL 4RHSA 3P20A 2MUYA 1WCMG 1HNWQ 3Q24A 4A3CG 3V96A 1MGSA 2IW3A 3I8ZA 1STYA 1WVLA 2N49A 3P75A 4F88A 3S1MB 3K80C 1K83B 3NBIA 3STBD 3FHWA 1K3BC 3SDZA 4K0KL 3S1NB 3TN2A 3GDEA 2B2VC 1EU3A 1VQ4A 1B9MA 4A3LG 1BCPB 4K0KQ 2Q8RE 4MZ9A 2NN6I 2L4NA 4YWLA 1W3SA 3KYHC 3VR6A 1TT2A 4ULLA 3QOLA 4UP8A 5KYIA 3CCEA 4KI0A 4HR7B 3ITPA 3FPUB 3S16B 4CKBA 4KN7C 2A19A 1HZAA 1IYVA 3OOCA 1FNUA 4DR1L 1FL0A 2AUJD 3S2DH 1VQ6A 3CQZB 3CXCA 2CHBD 3KUPA 4PZ8A 1YHQA 2F4VL 3OMGA 1PFMA 4DR1Q 3I72A 1BQQT 1N34L 1SRUA 4JBKA 2F4VQ 4JI5L 1SYDA 2BH8A 2I5LX 2F0FA 1K8OA 1UE5A 2H1EA 3NWSA 1EYAA 4JI5Q 2CW0C 3KBXA 5T1IA 3U58A 4IJLA 4AQYL 2R7FA 1SN8A 4DV6L 1Y14B 1Z7TA 2I07B 1BCPF 4AQYQ 1SJED 2IL8A 4J15A 2NVQH 4ABNA 4DV6Q 1B53A 2OEOA 4UPAA 4LNQA 2UXBL 2CH4W 1HFGA 1WFQA 4KTAA 5M3FH 2UXBQ 1I4PA 1CQFA 2A6ED 3U50C 2B63H 1YZ6A 5GROA 3UDIA 4DV0L 2JA6G 3IFDA 2DY8A 4IUVA 4DV0Q 4WORA 1L0XB 4YCUA 1VMPA 2C5CA 5IE8A 1XTDA 4JW0A 5LHY1 4BBSB 4ZQ3A 5EBCA 4DV3L 1YJ9A 3MC0B 4A3BH 1XJVA 1KLGD 3DXJC 1FYCA 4HJ5A 2AMCB 3NXWA 4DV3Q 5JJLA 1BBXC 3CW2C 2AWOA 2ATWA 4BS9A 3DMUA 2JA8B 5M5YH 5ELEA 1NNXA 4G7HC 5H1SE 4IURA 4P72A 5ELDA 3VA5A 3MFYA 2EXDA 3I4NG 2KBNA 1CQVA 1DJRD 1SE4A 3NEMA 4GLVB 4DK6C 2OT2A 2L12A 1SDFA 2Z1CA 1HJPA 4ZAIA 4C2MH 3MTSA 4HTHA 2RBMA 4P71A 3RR5A 1PTOC 3I70A 3M4PA 5E4WC 3I73A 2I0QA 2VNUD 1ASZA 3J7AF 4DU9A 1M8AA 4KJOA 3L9AX 4XTCS 1SR3A 4PV1C 2WACA 1YNND 1D5XC 1A62A 1B50A 3BG3A 1GHKA 4DR6L 5C3EH 3HKZB 4LF5L 4OWWB 4DKAC 3GTGH 4GKKL 2IT1A 3EVQA 1IW7C 4IPDA 4DN4M 4DR6Q 2N78A 4LF5Q 1Q46A 1MHWC 4GKKQ 2NZOA 1XMQL 1DD2A 3PSIA 1SSOA 1VF5C 4NP5A 2WIIB 1XMQQ 4OWTB 2YU9B 4C56C 5EJWA 4GNXA 4FDBA 3MA2B 5ELNA 1TWCH 2ZM6Q 1CT1D 1RCVD 3RZDB 2A74C 2EYJA 1ET6A 2K04A 2WKCA 3FKIH 4K8IA 2V1CC 2PO4A 1BNZA 3GTLH 3RZOH 3FDTA 2R7ZH 1X9NA 3H09A 2A69C 3HOUH 1A3UA 1QG7A 4BY1G 3KDFA 4X3UA 3J7AV 4B9XA 3PO3B 3CU7A 4RCOA 4RG1A 1LACA 3GTOB 4A3DB 1F9PA 3BZKA 2VS1A 3RLFA 1PH3A 3MFGA 1DYQA 2CH4A 4H02A 4JCVE 3CD6A 1KQSA 4X62L 2F3IA 3LGJA 2J0TD 4AH6A 4OHJA 2EOTA 3I4MB 1X55A 4C3HH 4FF4A 5IGEA 1FGUA 3NENA 4A3EH 2NVTB 1TY2A 4HIDA 2PQAA 1G51A 3E9IA 5D3IB 5FO9B 2WAQG 1SYEA 1E24A 1QVFA 2B2UC 3I4OA 4C3JB 1A3TA 2VXWA 1F77A 1LM0A 1VS0A 4N8X1 4ZKCB 2F0QA 1Y1WB 4JBJA 4ZLTF 5IP7H 3CPFA 1SE2A 3I55A 2KCTA 1YVCA 4XT3B 1VQ8A 1E0BA 2K4KA 2K03A 3Q6SA 3KF6B 1M90C 3UE1A 1VQJA 5IIFA 1UUPA 1XYIA 1ZYRD 2XWJB 1TS3A 2PYKA 2OTLA 2D5DA 4NXNL 1STGA 4OIKA 1IBLL 3J80E 1X6OA 2NB0A 4NXNQ 5C0XH 1IBLQ 5M3FG 3S2HB 4ZK9B 1BF4A 2I46A 5BR8L 4LF6Q 4FYDA 1VDZA 5KNBA 4A3KG 3ER0A 1EFID 1V1PA 4HMJA 2AWNA 3NWTA 3SK8A 2L15A 2MHVA 1STNA 2DNEA 4XT1B 1Q82C 3OHXC 2N55A 4HAEA 1XWEA 1PTOH 2G9DA 2K6AA 1E1OA 5G3LF 4A3BG 1PLFA 3TMEA 3HOVH 3GTQH 2LSSA 4A3IB 3BZCA 1EY7A 2XRSD 4CGYB 1MJEA 4IPHA 3E6ZX 3PUXA 3OTOL 1OXXK 2VL6A 3BU2A 3QWNA 2PW7A 3OTOQ 4L5QA 5J22A 1PFSA 3A74A 4JI7L 5KRUA 3GO5A 2OF1A 1RTNA 3SE0A 2QW7A 1PZJD 4JI7Q 3EIVA 4TRDA 1GHJA 3BJUA 5F2DA 1IKMA 4MN3A 3TZUA 5A35A 5C4XH 3Q22A 1TQOA 4C1NI 5J3BA 1PH7A 2P5ZX 1EWCA 2F52A 1TWGB 1TU2B 1A63A 3HOZH 3NHHA 3EBEA 1GUOA 4TSSA 2LY7A 2E2HH 2JA7H 5CMDA 4LF7L 2H4OA 2F0EA 5IT9c 1AP0A 4LUZA 2O2LD 1VQLA 2K5NA 4LF7Q 2BE5D 1B7YB 1RD9D 5CV4A 1CA5A 2AUKA 4JI0L 1XXGA 3KLWA 1TWHH 2RCNA 5C3EG 3C3LA 4HCEA 4JI0Q 1M4VA
chains in the Genus database with same CATH topology
1WYDA 3PUYA 4DV2L 1VQ7A 2Z0SA 3K7AH 2H5XA 2DGYA 4IPGA 4UY8C 4BA1I 4A3KH 5GQOA 2AKWB 4DV2Q 1E3PA 1QUQA 1CKNA 4IPCA 4MTNA 4A3MG 3GTOH 3AYHB 2I5HA 1VQHA 3HOXH 3D31A 4A3DH 1KD1C 1SLJA 1SROA 3UDGA 1X3GA 2KHIA 1XPRA 3GTMH 2D62A 4JG2A 3PUVA 2QGQA 1VQOA 3H0GH 2KCMA 4LF4L 1X3FA 4QL5A 4A75A 3KOJA 3MXNB 5LMNW 1PH8A 4DV5L 4JC0A 1WJJA 3S1QH 2Q2UA 4R4QA 1JT8A 4DK3C 4LF4Q 3AEVA 1NMFA 2UUAL 4L5TA 1U0LA 3S14H 2B3GA 1VQ9A 1VQGA 4DV5Q 1S40A 2I5MX 4DPGA 5GAHC 1NY4A 2CCZA 4DR7L 3FKIG 5IYBG 4R4TA 2KENA 4P75A 3I4MH 2UUAQ 4POFA 3HKZG 2OQKA 4GN3B 4A3GH 1YIJA 1M1KC 4BA2I 4DR7Q 3VDYA 2OQ0A 1HNZL 2R6GA 3HOUG 4A3FG 1NMGA 2WB1G 2NVTH 1HNWL 2CFMA 3K7UC 2BA1A 1IXRA 2R92H 4WJ4A 4R4OA 4BBRH 1HNZQ 5LMNQ 1N33L 1WCMG 5DLQE 4EQ5A 3S15H 1HNWQ 4XIGS 4A3CG 4HIOA 1L0WA 4QGUA 4OO1G 4RMFA 4LF6L 3K8AA 3PV0A 2JA5H 3CMAA 2N49A 1N33Q 4C3JH 5K36G 2E2JH 2CKZB 1UEBA 3K80C 4HJ7A 2JEBI 1AH9A 1Q12A 2K50A 2B63G 4LFCL 2GVBA 3CCMA 4HJ8A 3STBD 3PCOB 1PH2A 3FHWA 1PH6A 4Y52H 4K0KL 1OXTA 1NTGA 2HT1A 2VUMH 4LFCQ 3K81C 3PUZA 3GDEA 3U4VA 1KRTA 1IYJB 2LXJA 5C0XJ 1VQ4A 4OO1I 5JEAJ 4A3LG 1VQAA 4K0KQ 4MZ9A 1SFOH 2R93H 2NN6I 1HZCA 3KFUA 1GKHA 1KC8C 2UXDQ 4YWLA 1X65A 1W3SA 1XPOA 3KYHC 1O7IA 4UP8A 5E7NA 1P16A 2VQFL 3E9HA 4KHZA 3CCEA 4A3EG 2RHQB 2VZAA 4KI0A 2ES2A 4IOAA 3HFZB 4PZ6A 2GN5A 1V1QA 4X64L 2Y0SG 4OONA 4DUZL 4QQBX 4DV7L 2BH2A 3CCJA 1X54A 3PGZA 1Q7YC 2Z6KA 4JV5L 2VQFQ 4LF8L 1X56A 2A19A 3W1BA 4X64Q 4DUZQ 4DR4L 1HZAA 4DV7Q 4DUYL 2EQSA 1PV4A 1Q8KA 3S1MH 4JV5Q 4DR1L 1FL0A 4LF8Q 1U5KA 2ZTEA 3UE0A 3S2HH 3GTPH 4LF9L 1TWFH 1LUZA 1VQ6A 3S2DH 2IX0A 4DR4Q 3CXCA 1YHQA 4PZ8A 4DUYQ 2F4VL 5IYCH 4BY7G 3TEHB 4L5RC 4DR1Q 1FJGL 5M3MH 5IP7G 1VQNA 2UUBL 1N34L 1HR0L 4LF9Q 2IX1A 3B6YA 4HIKA 1SRUA 4TQUS 4JBKA 2F4VQ 4JI5L 2BH8A 2A1AA 2ID0A 2I5LX 1FJGQ 2CQOA 1E1TA 2UUBQ 4JI2L 3S24A 1HR0Q 3NELA 1UE5A 1K8AC 4BBSG 4YHHL 4JI5Q 1E22A 3HOYH 3GTKH 2K75A 4JI2Q 4A3IH 5AJ3L 4A4IA 2WAQE 3U58A 4IJLA 1PHJA 4AQYL 2R7FA 4YHHQ 1YJWA 1VQBA 1KIXA 1SN8A 4GKJL 4EX5A 1Y14B 1LTLA 4DV6L 2OWOA 5AJ3Q 3S16H 4AQYQ 1Y1VG 2JA8G 4J15A 4LFAL 2NVQH 4GKJQ 4DV6Q 1N8RC 1OXUA 2C35B 4UPAA 3HOWH 4LNQA 2UXBL 1JB7A 4LFAQ 3JC66 1OTCA 1WFQA 1I3QH 4Y7NH 2E8GA 2Q2HA 5M3FH 1YJNA 1VQ5A 4OX9L 2UXBQ 2ASBA 4YWMA 3NBHB 3U50C 5IWAL 1EFWA 2B63H 3RLOA 1YZ6A 5GROA 1VQPA 1N32L 3UDIA 4JI6L 4DV0L 1D7QA 4OX9Q 2JA6G 5FJ8G 1BKBA 4IJHA 3RN2A 5IWAQ 1TWGH 3MEFA 1N32Q 5IYDG 1PA6A 4JI6Q 3FP9A 4DV0Q 1GD7A 3OYYA 4YCUA 2B29A 3CP0A 5IE8A 1XTDA 1I50H 4X62Q 3HOVG 3E0EA 3OW2A 1X3EA 5GAEC 4DV3L 1EUJA 4HJ9A 3TREA 4AIMA 3F2CA 1YJ9A 1XJVA 4A3BH 4DR3L 1CSPA 3CCSA 2D0OA 5C44H 4HJ5A 1K8GA 2AMCB 2ZJRA 2PI2E 4DV3Q 1NE3A 5JJLA 4KLKA 4DR3Q 2MNAA 3CC4A 3CW2C 2AWOA 1W2BA 3J80i 5FLMG 1VCIA 1NJIC 1KL9A 2ATWA 1AE3A 4KHPL 4IFDJ 3D0FA 5JJIA 4L5SA 3J81c 1RIPA 5M5YH 2UUCL 2VW9A 4X65L 1EQRA 2DUDA 2IHEA 1VQKA 4YCVA 1VQFA 3CC2A 2R7ZG 5H1SE 2Q2IA 4KHPQ 4P72A 5LMNL 1EOVA 2WP8J 1GVPA 2EXDA 3CCUA 2UUCQ 3I4NG 2CWAA 1BBUA 4X65Q 3GTJH 2KBNA 1S72A 4JI4Q 3TS2A 4BXXH 1MKHA 3ULJA 4BY7H 4JBWA 1DGSA 3NEMA 4GLVB 4GN4B 4PG3A 4DK6C 1IBML 2E2IH 3M7NA 5C4XG 4QY7A 1JJGA 4GN5A 4TVAB 1Q86C 3UDXA 1HJPA 5IP9H 3PIOA 1IBMQ 4C2MH 2A8VA 3HOZG 4GOPC 3CAMA 1K0RA 3PO2H 1MJCA 1KAWA 1YBYA 4OXPA 1YITA 1RL2A 2JA7G 1T9HA 4P71A 3RR5A 4BBSH 3PF5A 3M4PA 3UDFA 5M5WH 3L2PA 2HIXA 2I0QA 4A3JG 3A0JA 1JJ2A 2VNUD 1ASZA 2NVXH 4WJ3M 2LXKA 4A93H 3CCLA 2E5LL 3H3VI 2K5VA 3J81j 4XTCS 1SR3A 3T1HL 1A62A 4LWCA 1SMXA 4NB3A 4HJAA 1A0IA 4DR2L 2E5LQ 4B3RQ 4GNXC 1B70B 4YWKA 3T1HQ 3ZJYC 1CKOA 4DR6L 5C3EH 1QZGA 1L1OC 1TXYA 1OXVA 4LF5L 4OWWB 4DKAC 4DR2Q 1C7YA 4GOPA 3ICEA 3GTGH 1Q1BA 4APVA 4YY3L 3F2BA 4LFBL 1PVOA 4GKKL 2IT1A 2QA4A 3PO3G 2N8NA 4IPDA 4DR6Q 3F2DA 2N78A 4LF5Q 4JI8L 1HH2P 5BR8Q 1Q46A 4YY3Q 2AHOB 3S17H 4LFBQ 4LW1A 4B3ML 3HOXG 2JA6H 4GKKQ 5FJ8H 4A3DG 2NZOA 2IHFA 1XMQL 1C0AA 4GLAC 1PYSB 3PSIA 1G291 4JI8Q 2ZTDA 3A5UA 4A3MH 5IYDH 2OCEA 1Q1EA 3KDFB 1IBKL 2PMZE 4B3MQ 3H0GG 2Q2TA 1XMQQ 1K83H 4OWTB 4X6AH 2JJQA 1IBKQ 4GNXA 3I2ZA 2GVAA 4FDBA 3DM3A 5ELNA 1TWCH 3S1NH 1L1OA 4LUVA 2K52A 3STBC 2ZM6Q 3H15A 4JI1L 1V43A 4P73A 3I4MG 1PH9A 3F1ZA 2MFIA 3AFPA 4AYBG 4A3GG 3SGIA 3FKIH 2V1CC 1E7ZA 5IYBH 3CCRA 3RZOH 3GTLH 1HZBA 4JI1Q 2YTYA 2NZHA 2R7ZH 4B3TL 2R92G 1YHAA 1X9NA 3RN5A 3HOUH 4A3FH 2NVYH 2RF4A 2XTIA 4BBRG 1NBWA 2UU9L 4BY1G 3KDFA 1EIYB 1J6QA 4B3TQ 3W5OA 2XGTA 3H3VH 1WCMH 5LMUL 4RG1A 1D8LA 4OWXB 1UWVA 2JA5G 2UU9Q 5C0XG 4A3CH 3J7A5 2MQHA 5JEAG 1WI5A 3U4ZA 3L7ZC 3BZKA 3CQZH 5LMUQ 2VS1A 2YU9H 4JI3L 1K9MC 3RLFA 1Y1WG 1FVIA 3TQYA 1N9WA 1PH3A 3G71A 4HIMA 1Z47A 2ZTCA 3HKZE 3I56A 4UP7A 4H02A 1XMOL 2VUMG 4JI3Q 1XNRL 2YYZA 4JCVE 3CD6A 5GAGC 5GADC 1PH1A 1KQSA 4X62L 2F3IA 3AQQA 2WB1E 3LGJA 1AE2A 2WFWA 2R93G 4AH6A 5C0XI 1XMOQ 1XNRQ 1PH4A 3WWVA 4IOCA 4A3LH 1KRSA 1YNXA 1X55A 4C3HH 1JE5A 3S1RH 5JJKA 3TRZA 4GS3A 4QIWE 3ULPA 3L0OA 1FGUA 3NENA 4A3EH 2ZJQA 3KJOA 1CUKA 2YV5A 4HIDA 2PQAA 1G51A 2MO0A 1CSQA 3PO3H 1GO3E 3E9IA 4DV4L 2WAQG 2JEAI 1E24A 1P8LA 2KHJA 4JI4L 1QVFA 1JMCA 1JJCB 1I5FA 3I4OA 1HZ9A 4DV4Q 1VQEA 1VS0A 1LM0A 5IYCG 5M3MG 1TWAH 4R1JA 4ME3A 4B3SL 4X66L 3M4OH 2JA9A 3IRBA 4JBJA 5IP7H 3CPFA 3EN2A 3GD7A 3I55A 1BVSA 3G48A 2CWPA 4GOPB 4B3SQ 3Q8DA 4X66Q 1BBWA 2KCTA 1ASYA 1YVCA 4PMWA 3J7ZC 2Y0SE 4MNOA 3HOYG 2BA0A 3G6EA 3KF8B 2JQOA 4DV1L 1VQ8A 4A3IG 2K4KA 3TS0A 1M90C 3KF6B 3JAMc 3UE1A 1VQJA 4R4IA 1UE6A 2ALYB 5IY0A 4POGA 4DV1Q 2HHHL 4NPSA 1YEZA 2FXQA 3PUWA 4B3RL 2UXDL 2UXCL 2QEXA 2OTLA 4NXNL 1VQDA 1EWIA 2HQLA 3A5ZB 4BY1H 2HHHQ 1Y1VH 1IBLL 2JA8H 2JK8A 3HOWG 1HNXL 3F8TA 4ALPA 1QVCA 1X6OA 4R4CA 4DAMA 3CCVA 4GNXB 4NXNQ 1Q81C 2UXCQ 2NN6G 3M4QA 1PYBA 1L1OB 3RNUA 1VQMA 4JBMA 4YCWA 1IBLQ 1IL2A 1G6PA 4C3IH 5M3FG 1QVGA 1HNXQ 4O2DA 4LF6Q 5BR8L 2OTJA 1J5EL 2HIVA 2Z6KC 4A3KG 3ER0A 4AYBE 1Y1WH 1EQQA 2EIFA 3PF4A 3KF6A 2AWNA 1J5EQ 3CF5A 2L15A 1S3OA 1Q82C 4IFDG 4QJFA 1XPUA 4P74A 1R9TH 5C4JH 2PNHA 1YI2A 1E1OA 4A3BG 1VQCA 2ZM6L 3CPWA 3HOVH 2JE6I 2LSSA 5ELOA 3GTQH 1Z9FA 5C44G 2K14A 3J81i 3BZCA 1EIFA 4JYAL 1B8AA 3W1GA 1OXSC 1MJEA 4IPHA 4IO9A 3PUXA 5HGQA 3OTOL 1OXXK 2VL6A 1KHIA 1K73C 1I94L 3BU2A 1WOCA 1HR0W 1C9OA 2VY3A 4JYAQ 3ERSX 4IFDI 1XNQL 1A8VA 2RHSB 5FLMH 3PIPA 3OTOQ 1K3RA 4L5QA 4DAYB 4DNIA 5M5XH 1H95A 1PFSA 3A74A 1I94Q 2R7DA 4O0AA 4JI7L 2IY5B 2D0PA 3I7FA 1IZ6A 3DLLA 1XNQQ 1L2FA 2K5HA 3KJPA 3GO5A 4JOIC 4GLXA 4BXXG 4PZ7A 3J80c 4DR5L 3I4NH 1EYGA 4JI7Q 3EIVA 4LUOA 3BJUA 3JAMi 3RLNA 2YTVA 1YHBA 4DR5Q 5C4XH 5IP9G 1QZHA 1LYLA 2VQEL 5J3BA 1PH7A 3PO2G 2F52A 1N34Q 1A63A 3HOZH 1CKMA 3EBEA 5HY6A 2N3SA 2PQAB 2VQEQ 2ZJPA 2E2HH 2JA7H 1SE8A 3HKSA 3CCQA 1QUQB 4LF7L 3M3YH 1CKNB 3T1YL 5IT9c 3M85A 3ULLA 4A3JH 4A93G 3K0XA 4LUZA 1MIUA 1VQLA 1UE1A 5EAYA 3CMEA 3RZDH 2K5NA 4LF7Q 4JOIA 1GM5A 3T1YQ 1N36L 1I6HH 3M9BA 4NXML 3AFQA 2PI2A 1B7YB 4UP9A 5FLXc 1UE7A 1KXLA 2YTXA 4JI0L 3KLWA 1TWHH 1VQIA 1PH5A 1N36Q 4A76A 2MO1A 2RCNA 5C3EG 1V9PA 4NXMQ 3G4SA 3CC7A 4JI0Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WYD A;  3PUY A;  4DV2 L;  1VQ7 A;  2Z0S A;  3K7A H;  2H5X A;  2DGY A;  4IPG A;  4UY8 C;  4BA1 I;  4A3K H;  5GQO A;  2AKW B;  4DV2 Q;  1E3P A;  1QUQ A;  1CKN A;  4IPC A;  4MTN A;  4A3M G;  3GTO H;  3AYH B;  2I5H A;  1VQH A;  3HOX H;  3D31 A;  4A3D H;  1KD1 C;  1SLJ A;  1SRO A;  3UDG A;  1X3G A;  2KHI A;  1XPR A;  3GTM H;  2D62 A;  4JG2 A;  3PUV A;  2QGQ A;  1VQO A;  3H0G H;  2KCM A;  4LF4 L;  1X3F A;  4QL5 A;  4A75 A;  3KOJ A;  3MXN B;  5LMN W;  1PH8 A;  4DV5 L;  4JC0 A;  1WJJ A;  3S1Q H;  2Q2U A;  4R4Q A;  1JT8 A;  4DK3 C;  4LF4 Q;  3AEV A;  1NMF A;  2UUA L;  4L5T A;  1U0L A;  3S14 H;  2B3G A;  1VQ9 A;  1VQG A;  4DV5 Q;  1S40 A;  2I5M X;  4DPG A;  5GAH C;  1NY4 A;  2CCZ A;  4DR7 L;  3FKI G;  5IYB G;  4R4T A;  2KEN A;  4P75 A;  3I4M H;  2UUA Q;  4POF A;  3HKZ G;  2OQK A;  4GN3 B;  4A3G H;  1YIJ A;  1M1K C;  4BA2 I;  4DR7 Q;  3VDY A;  2OQ0 A;  1HNZ L;  2R6G A;  3HOU G;  4A3F G;  1NMG A;  2WB1 G;  2NVT H;  1HNW L;  2CFM A;  3K7U C;  2BA1 A;  1IXR A;  2R92 H;  4WJ4 A;  4R4O A;  4BBR H;  1HNZ Q;  5LMN Q;  1N33 L;  1WCM G;  5DLQ E;  4EQ5 A;  3S15 H;  1HNW Q;  4XIG S;  4A3C G;  4HIO A;  1L0W A;  4QGU A;  4OO1 G;  4RMF A;  4LF6 L;  3K8A A;  3PV0 A;  2JA5 H;  3CMA A;  2N49 A;  1N33 Q;  4C3J H;  5K36 G;  2E2J H;  2CKZ B;  1UEB A;  3K80 C;  4HJ7 A;  2JEB I;  1AH9 A;  1Q12 A;  2K50 A;  2B63 G;  4LFC L;  2GVB A;  3CCM A;  4HJ8 A;  3STB D;  3PCO B;  1PH2 A;  3FHW A;  1PH6 A;  4Y52 H;  4K0K L;  1OXT A;  1NTG A;  2HT1 A;  2VUM H;  4LFC Q;  3K81 C;  3PUZ A;  3GDE A;  3U4V A;  1KRT A;  1IYJ B;  2LXJ A;  5C0X J;  1VQ4 A;  4OO1 I;  5JEA J;  4A3L G;  1VQA A;  4K0K Q;  4MZ9 A;  1SFO H;  2R93 H;  2NN6 I;  1HZC A;  3KFU A;  1GKH A;  1KC8 C;  2UXD Q;  4YWL A;  1X65 A;  1W3S A;  1XPO A;  3KYH C;  1O7I A;  4UP8 A;  5E7N A;  1P16 A;  2VQF L;  3E9H A;  4KHZ A;  3CCE A;  4A3E G;  2RHQ B;  2VZA A;  4KI0 A;  2ES2 A;  4IOA A;  3HFZ B;  4PZ6 A;  2GN5 A;  1V1Q A;  4X64 L;  2Y0S G;  4OON A;  4DUZ L;  4QQB X;  4DV7 L;  2BH2 A;  3CCJ A;  1X54 A;  3PGZ A;  1Q7Y C;  2Z6K A;  4JV5 L;  2VQF Q;  4LF8 L;  1X56 A;  2A19 A;  3W1B A;  4X64 Q;  4DUZ Q;  4DR4 L;  1HZA A;  4DV7 Q;  4DUY L;  2EQS A;  1PV4 A;  1Q8K A;  3S1M H;  4JV5 Q;  4DR1 L;  1FL0 A;  4LF8 Q;  1U5K A;  2ZTE A;  3UE0 A;  3S2H H;  3GTP H;  4LF9 L;  1TWF H;  1LUZ A;  1VQ6 A;  3S2D H;  2IX0 A;  4DR4 Q;  3CXC A;  1YHQ A;  4PZ8 A;  4DUY Q;  2F4V L;  5IYC H;  4BY7 G;  3TEH B;  4L5R C;  4DR1 Q;  1FJG L;  5M3M H;  5IP7 G;  1VQN A;  2UUB L;  1N34 L;  1HR0 L;  4LF9 Q;  2IX1 A;  3B6Y A;  4HIK A;  1SRU A;  4TQU S;  4JBK A;  2F4V Q;  4JI5 L;  2BH8 A;  2A1A A;  2ID0 A;  2I5L X;  1FJG Q;  2CQO A;  1E1T A;  2UUB Q;  4JI2 L;  3S24 A;  1HR0 Q;  3NEL A;  1UE5 A;  1K8A C;  4BBS G;  4YHH L;  4JI5 Q;  1E22 A;  3HOY H;  3GTK H;  2K75 A;  4JI2 Q;  4A3I H;  5AJ3 L;  4A4I A;  2WAQ E;  3U58 A;  4IJL A;  1PHJ A;  4AQY L;  2R7F A;  4YHH Q;  1YJW A;  1VQB A;  1KIX A;  1SN8 A;  4GKJ L;  4EX5 A;  1Y14 B;  1LTL A;  4DV6 L;  2OWO A;  5AJ3 Q;  3S16 H;  4AQY Q;  1Y1V G;  2JA8 G;  4J15 A;  4LFA L;  2NVQ H;  4GKJ Q;  4DV6 Q;  1N8R C;  1OXU A;  2C35 B;  4UPA A;  3HOW H;  4LNQ A;  2UXB L;  1JB7 A;  4LFA Q;  3JC6 6;  1OTC A;  1WFQ A;  1I3Q H;  4Y7N H;  2E8G A;  2Q2H A;  5M3F H;  1YJN A;  1VQ5 A;  4OX9 L;  2UXB Q;  2ASB A;  4YWM A;  3NBH B;  3U50 C;  5IWA L;  1EFW A;  2B63 H;  3RLO A;  1YZ6 A;  5GRO A;  1VQP A;  1N32 L;  3UDI A;  4JI6 L;  4DV0 L;  1D7Q A;  4OX9 Q;  2JA6 G;  5FJ8 G;  1BKB A;  4IJH A;  3RN2 A;  5IWA Q;  1TWG H;  3MEF A;  1N32 Q;  5IYD G;  1PA6 A;  4JI6 Q;  3FP9 A;  4DV0 Q;  1GD7 A;  3OYY A;  4YCU A;  2B29 A;  3CP0 A;  5IE8 A;  1XTD A;  1I50 H;  4X62 Q;  3HOV G;  3E0E A;  3OW2 A;  1X3E A;  5GAE C;  4DV3 L;  1EUJ A;  4HJ9 A;  3TRE A;  4AIM A;  3F2C A;  1YJ9 A;  1XJV A;  4A3B H;  4DR3 L;  1CSP A;  3CCS A;  2D0O A;  5C44 H;  4HJ5 A;  1K8G A;  2AMC B;  2ZJR A;  2PI2 E;  4DV3 Q;  1NE3 A;  5JJL A;  4KLK A;  4DR3 Q;  2MNA A;  3CC4 A;  3CW2 C;  2AWO A;  1W2B A;  3J80 i;  5FLM G;  1VCI A;  1NJI C;  1KL9 A;  2ATW A;  1AE3 A;  4KHP L;  4IFD J;  3D0F A;  5JJI A;  4L5S A;  3J81 c;  1RIP A;  5M5Y H;  2UUC L;  2VW9 A;  4X65 L;  1EQR A;  2DUD A;  2IHE A;  1VQK A;  4YCV A;  1VQF A;  3CC2 A;  2R7Z G;  5H1S E;  2Q2I A;  4KHP Q;  4P72 A;  5LMN L;  1EOV A;  2WP8 J;  1GVP A;  2EXD A;  3CCU A;  2UUC Q;  3I4N G;  2CWA A;  1BBU A;  4X65 Q;  3GTJ H;  2KBN A;  1S72 A;  4JI4 Q;  3TS2 A;  4BXX H;  1MKH A;  3ULJ A;  4BY7 H;  4JBW A;  1DGS A;  3NEM A;  4GLV B;  4GN4 B;  4PG3 A;  4DK6 C;  1IBM L;  2E2I H;  3M7N A;  5C4X G;  4QY7 A;  1JJG A;  4GN5 A;  4TVA B;  1Q86 C;  3UDX A;  1HJP A;  5IP9 H;  3PIO A;  1IBM Q;  4C2M H;  2A8V A;  3HOZ G;  4GOP C;  3CAM A;  1K0R A;  3PO2 H;  1MJC A;  1KAW A;  1YBY A;  4OXP A;  1YIT A;  1RL2 A;  2JA7 G;  1T9H A;  4P71 A;  3RR5 A;  4BBS H;  3PF5 A;  3M4P A;  3UDF A;  5M5W H;  3L2P A;  2HIX A;  2I0Q A;  4A3J G;  3A0J A;  1JJ2 A;  2VNU D;  1ASZ A;  2NVX H;  4WJ3 M;  2LXK A;  4A93 H;  3CCL A;  2E5L L;  3H3V I;  2K5V A;  3J81 j;  4XTC S;  1SR3 A;  3T1H L;  1A62 A;  4LWC A;  1SMX A;  4NB3 A;  4HJA A;  1A0I A;  4DR2 L;  2E5L Q;  4B3R Q;  4GNX C;  1B70 B;  4YWK A;  3T1H Q;  3ZJY C;  1CKO A;  4DR6 L;  5C3E H;  1QZG A;  1L1O C;  1TXY A;  1OXV A;  4LF5 L;  4OWW B;  4DKA C;  4DR2 Q;  1C7Y A;  4GOP A;  3ICE A;  3GTG H;  1Q1B A;  4APV A;  4YY3 L;  3F2B A;  4LFB L;  1PVO A;  4GKK L;  2IT1 A;  2QA4 A;  3PO3 G;  2N8N A;  4IPD A;  4DR6 Q;  3F2D A;  2N78 A;  4LF5 Q;  4JI8 L;  1HH2 P;  5BR8 Q;  1Q46 A;  4YY3 Q;  2AHO B;  3S17 H;  4LFB Q;  4LW1 A;  4B3M L;  3HOX G;  2JA6 H;  4GKK Q;  5FJ8 H;  4A3D G;  2NZO A;  2IHF A;  1XMQ L;  1C0A A;  4GLA C;  1PYS B;  3PSI A;  1G29 1;  4JI8 Q;  2ZTD A;  3A5U A;  4A3M H;  5IYD H;  2OCE A;  1Q1E A;  3KDF B;  1IBK L;  2PMZ E;  4B3M Q;  3H0G G;  2Q2T A;  1XMQ Q;  1K83 H;  4OWT B;  4X6A H;  2JJQ A;  1IBK Q;  4GNX A;  3I2Z A;  2GVA A;  4FDB A;  3DM3 A;  5ELN A;  1TWC H;  3S1N H;  1L1O A;  4LUV A;  2K52 A;  3STB C;  2ZM6 Q;  3H15 A;  4JI1 L;  1V43 A;  4P73 A;  3I4M G;  1PH9 A;  3F1Z A;  2MFI A;  3AFP A;  4AYB G;  4A3G G;  3SGI A;  3FKI H;  2V1C C;  1E7Z A;  5IYB H;  3CCR A;  3RZO H;  3GTL H;  1HZB A;  4JI1 Q;  2YTY A;  2NZH A;  2R7Z H;  4B3T L;  2R92 G;  1YHA A;  1X9N A;  3RN5 A;  3HOU H;  4A3F H;  2NVY H;  2RF4 A;  2XTI A;  4BBR G;  1NBW A;  2UU9 L;  4BY1 G;  3KDF A;  1EIY B;  1J6Q A;  4B3T Q;  3W5O A;  2XGT A;  3H3V H;  1WCM H;  5LMU L;  4RG1 A;  1D8L A;  4OWX B;  1UWV A;  2JA5 G;  2UU9 Q;  5C0X G;  4A3C H;  3J7A 5;  2MQH A;  5JEA G;  1WI5 A;  3U4Z A;  3L7Z C;  3BZK A;  3CQZ H;  5LMU Q;  2VS1 A;  2YU9 H;  4JI3 L;  1K9M C;  3RLF A;  1Y1W G;  1FVI A;  3TQY A;  1N9W A;  1PH3 A;  3G71 A;  4HIM A;  1Z47 A;  2ZTC A;  3HKZ E;  3I56 A;  4UP7 A;  4H02 A;  1XMO L;  2VUM G;  4JI3 Q;  1XNR L;  2YYZ A;  4JCV E;  3CD6 A;  5GAG C;  5GAD C;  1PH1 A;  1KQS A;  4X62 L;  2F3I A;  3AQQ A;  2WB1 E;  3LGJ A;  1AE2 A;  2WFW A;  2R93 G;  4AH6 A;  5C0X I;  1XMO Q;  1XNR Q;  1PH4 A;  3WWV A;  4IOC A;  4A3L H;  1KRS A;  1YNX A;  1X55 A;  4C3H H;  1JE5 A;  3S1R H;  5JJK A;  3TRZ A;  4GS3 A;  4QIW E;  3ULP A;  3L0O A;  1FGU A;  3NEN A;  4A3E H;  2ZJQ A;  3KJO A;  1CUK A;  2YV5 A;  4HID A;  2PQA A;  1G51 A;  2MO0 A;  1CSQ A;  3PO3 H;  1GO3 E;  3E9I A;  4DV4 L;  2WAQ G;  2JEA I;  1E24 A;  1P8L A;  2KHJ A;  4JI4 L;  1QVF A;  1JMC A;  1JJC B;  1I5F A;  3I4O A;  1HZ9 A;  4DV4 Q;  1VQE A;  1VS0 A;  1LM0 A;  5IYC G;  5M3M G;  1TWA H;  4R1J A;  4ME3 A;  4B3S L;  4X66 L;  3M4O H;  2JA9 A;  3IRB A;  4JBJ A;  5IP7 H;  3CPF A;  3EN2 A;  3GD7 A;  3I55 A;  1BVS A;  3G48 A;  2CWP A;  4GOP B;  4B3S Q;  3Q8D A;  4X66 Q;  1BBW A;  2KCT A;  1ASY A;  1YVC A;  4PMW A;  3J7Z C;  2Y0S E;  4MNO A;  3HOY G;  2BA0 A;  3G6E A;  3KF8 B;  2JQO A;  4DV1 L;  1VQ8 A;  4A3I G;  2K4K A;  3TS0 A;  1M90 C;  3KF6 B;  3JAM c;  3UE1 A;  1VQJ A;  4R4I A;  1UE6 A;  2ALY B;  5IY0 A;  4POG A;  4DV1 Q;  2HHH L;  4NPS A;  1YEZ A;  2FXQ A;  3PUW A;  4B3R L;  2UXD L;  2UXC L;  2QEX A;  2OTL A;  4NXN L;  1VQD A;  1EWI A;  2HQL A;  3A5Z B;  4BY1 H;  2HHH Q;  1Y1V H;  1IBL L;  2JA8 H;  2JK8 A;  3HOW G;  1HNX L;  3F8T A;  4ALP A;  1QVC A;  1X6O A;  4R4C A;  4DAM A;  3CCV A;  4GNX B;  4NXN Q;  1Q81 C;  2UXC Q;  2NN6 G;  3M4Q A;  1PYB A;  1L1O B;  3RNU A;  1VQM A;  4JBM A;  4YCW A;  1IBL Q;  1IL2 A;  1G6P A;  4C3I H;  5M3F G;  1QVG A;  1HNX Q;  4O2D A;  4LF6 Q;  5BR8 L;  2OTJ A;  1J5E L;  2HIV A;  2Z6K C;  4A3K G;  3ER0 A;  4AYB E;  1Y1W H;  1EQQ A;  2EIF A;  3PF4 A;  3KF6 A;  2AWN A;  1J5E Q;  3CF5 A;  2L15 A;  1S3O A;  1Q82 C;  4IFD G;  4QJF A;  1XPU A;  4P74 A;  1R9T H;  5C4J H;  2PNH A;  1YI2 A;  1E1O A;  4A3B G;  1VQC A;  2ZM6 L;  3CPW A;  3HOV H;  2JE6 I;  2LSS A;  5ELO A;  3GTQ H;  1Z9F A;  5C44 G;  2K14 A;  3J81 i;  3BZC A;  1EIF A;  4JYA L;  1B8A A;  3W1G A;  1OXS C;  1MJE A;  4IPH A;  4IO9 A;  3PUX A;  5HGQ A;  3OTO L;  1OXX K;  2VL6 A;  1KHI A;  1K73 C;  1I94 L;  3BU2 A;  1WOC A;  1HR0 W;  1C9O A;  2VY3 A;  4JYA Q;  3ERS X;  4IFD I;  1XNQ L;  1A8V A;  2RHS B;  5FLM H;  3PIP A;  3OTO Q;  1K3R A;  4L5Q A;  4DAY B;  4DNI A;  5M5X H;  1H95 A;  1PFS A;  3A74 A;  1I94 Q;  2R7D A;  4O0A A;  4JI7 L;  2IY5 B;  2D0P A;  3I7F A;  1IZ6 A;  3DLL A;  1XNQ Q;  1L2F A;  2K5H A;  3KJP A;  3GO5 A;  4JOI C;  4GLX A;  4BXX G;  4PZ7 A;  3J80 c;  4DR5 L;  3I4N H;  1EYG A;  4JI7 Q;  3EIV A;  4LUO A;  3BJU A;  3JAM i;  3RLN A;  2YTV A;  1YHB A;  4DR5 Q;  5C4X H;  5IP9 G;  1QZH A;  1LYL A;  2VQE L;  5J3B A;  1PH7 A;  3PO2 G;  2F52 A;  1N34 Q;  1A63 A;  3HOZ H;  1CKM A;  3EBE A;  5HY6 A;  2N3S A;  2PQA B;  2VQE Q;  2ZJP A;  2E2H H;  2JA7 H;  1SE8 A;  3HKS A;  3CCQ A;  1QUQ B;  4LF7 L;  3M3Y H;  1CKN B;  3T1Y L;  5IT9 c;  3M85 A;  3ULL A;  4A3J H;  4A93 G;  3K0X A;  4LUZ A;  1MIU A;  1VQL A;  1UE1 A;  5EAY A;  3CME A;  3RZD H;  2K5N A;  4LF7 Q;  4JOI A;  1GM5 A;  3T1Y Q;  1N36 L;  1I6H H;  3M9B A;  4NXM L;  3AFQ A;  2PI2 A;  1B7Y B;  4UP9 A;  5FLX c;  1UE7 A;  1KXL A;  2YTX A;  4JI0 L;  3KLW A;  1TWH H;  1VQI A;  1PH5 A;  1N36 Q;  4A76 A;  2MO1 A;  2RCN A;  5C3E G;  1V9P A;  4NXM Q;  3G4S A;  3CC7 A;  4JI0 Q; 
#chains in the Genus database with same CATH topology
 2E76 C;  2F0J A;  2BDO A;  2DGY A;  4X3K A;  3GTJ B;  1WTH A;  4BA1 I;  2NTT A;  2AKW B;  2KOL A;  3BVG A;  1MI2 A;  1D6E C;  1CKN A;  5KEE A;  3QG1 A;  1PFB A;  2I5H A;  3HOX H;  5J1Z A;  3A8K E;  3PO2 B;  4QCL A;  3P1H A;  4UDU C;  4CJ2 C;  2QGQ A;  1VQO A;  2JSO A;  4LF4 L;  4XYO A;  2RSO A;  1HPC A;  3KOJ A;  2F0S A;  3MXN B;  4P2C B;  3LWE A;  4A75 A;  2B2T C;  4DV5 L;  1JT8 A;  4LF4 Q;  3DUZ A;  2KCC A;  2HDM A;  1U0L A;  4DXF A;  2VUM B;  1VQG A;  4DV5 Q;  5GAH C;  3MVV A;  1NY4 A;  5COY A;  4DR7 L;  3FKI G;  3I90 A;  2M9V A;  4R4T A;  2EY2 A;  2F0P A;  2OQK A;  1Y8N B;  3BVZ A;  5IGD A;  4DR7 Q;  1JOK A;  3HOU G;  1SJH D;  3T13 A;  1B4O A;  3K7U C;  5EPL A;  2BA1 A;  4ZCK A;  1NCV A;  5E4X A;  2QDB A;  4R4O A;  2K5W A;  5DLQ E;  4EQ5 A;  1PYW D;  1BO0 A;  4QGU A;  3ONA B;  4RMF A;  5CBE E;  3CMA A;  3FRP B;  1EOT A;  3TP5 A;  5JEA H;  1S5F D;  1BOS A;  1WTR A;  3IAY A;  3GTP B;  3FMC A;  1AH9 A;  3CCM A;  5C6A A;  2K28 A;  1H9R A;  1PH6 A;  1NTG A;  3TP8 A;  1VMC A;  4LJZ C;  2RKS A;  3PUZ A;  3U4V A;  1KRT A;  1IYJ B;  2EYM A;  1VQA A;  3OSO A;  1SFO H;  1HRJ A;  2R93 H;  2EY6 A;  1HZC A;  3NQI A;  1GKH A;  4L63 B;  2Z8L A;  4C3H G;  1TS4 A;  2ICI A;  3NPP A;  4A3E G;  4TKO B;  4X64 L;  2GN5 A;  5E1F A;  2Y0S G;  3QOJ A;  4OON A;  3VYU A;  4QQB X;  1Q7Y C;  1X54 A;  2Z6K A;  3MZ5 A;  3W1B A;  4X64 Q;  1WCM B;  1WTV A;  2EQS A;  2A68 D;  3S1M H;  2IJ0 A;  4KKU A;  1TWF H;  2B2V A;  1JIC A;  1HTP A;  4Y7N B;  4BY7 G;  5A2Q E;  5IP7 G;  2F3W A;  4PMB A;  3OIQ A;  4H0L C;  3HOY H;  1SYC A;  3EFX D;  1I50 B;  4K6L A;  4ZKB B;  4A4I A;  2LFN A;  2WAQ E;  4QUF A;  2E75 C;  2JP1 A;  1YJW A;  1KIX A;  1Z6H A;  1EZ8 A;  3H94 A;  2IPK D;  1SEB D;  5ELC A;  3S16 H;  4LFA L;  1N8R C;  1K8M A;  2OXP A;  2JXM B;  3Q0A A;  3HOW H;  4LFA Q;  1EY8 A;  2NN6 H;  1OTC A;  1I3Q H;  2E8G A;  2F0M A;  2Q2H A;  1YJN A;  1UNS A;  4OX9 L;  4XQN A;  2F3V A;  4O42 A;  4YWM A;  1W6J A;  4HN7 A;  5CBA E;  4JI6 L;  1HA5 A;  3M4O B;  4G7O C;  4OX9 Q;  5FJ8 G;  3E5S A;  3QJY A;  2B39 A;  5BN5 A;  5IYD G;  4JI6 Q;  2IX3 A;  3CP0 A;  1NR2 A;  1NUC A;  2QDL A;  3HOV G;  3E0E A;  4DNR B;  3OW2 A;  4HJ9 A;  1EUJ A;  2DNC A;  1CHP D;  1T5E A;  2IWH A;  3SK6 A;  5D14 A;  1S5E D;  3SXH A;  1SYG A;  5CR3 A;  2B2W C;  3D4W A;  1JWS D;  3D0F A;  1JOO A;  3J81 c;  1W6K A;  2VW9 A;  1EQR A;  1VQK A;  1HXY D;  1ENF A;  4K5X A;  4IUN A;  1SBB B;  2Q2I A;  1EOV A;  4NMZ A;  3CCU A;  3T51 B;  1A15 A;  1BBU A;  1S72 A;  1LLR D;  4JBW A;  1Y8O B;  2O5J C;  2EYO A;  2MJ8 A;  5C4Z A;  2VB3 X;  5C4X G;  4QY7 A;  2XSC A;  2JA6 B;  2A8V A;  3HOZ G;  1YBY A;  3QR8 A;  4OXP A;  5C4J B;  2JA7 G;  4BBS H;  3PF5 A;  3UDF A;  2X6G A;  3L2P A;  2HIX A;  1JJ2 A;  2NVX H;  2PZW A;  1A2T A;  2LXK A;  3I91 A;  4A93 H;  3CCL A;  2E5L L;  3SHL A;  1F9R A;  5CGK A;  3J81 j;  2K05 A;  4HCS A;  1DOL A;  2E5L Q;  3MXG A;  3BDC A;  3D3R A;  3ICE A;  4YY3 L;  1O80 A;  4KY5 A;  3I4N B;  2WB1 B;  3OWE B;  5FO8 B;  5C3X A;  1I4G A;  4YY3 Q;  3HOX G;  2IHF A;  4GLA C;  4JVZ A;  4KD4 A;  1PYS B;  2EY1 A;  3DEO A;  4MIU A;  2CW0 D;  1BXT A;  1D5Z C;  2ZTD A;  3A5U A;  4A3M H;  3KDF B;  1HFN A;  2PMZ E;  3N6R A;  4B9W A;  1FD7 D;  3LNN A;  1WTW A;  3C46 A;  2JJQ A;  2QCP X;  3STB C;  2M00 A;  3LWU A;  4HED A;  5IYB H;  4HSV A;  4FXG C;  5EKL A;  2YTY A;  2HDL A;  2NZH A;  1ML0 D;  3S1R B;  3K0Y A;  2RF4 A;  2XTI A;  4R9W A;  1NBW A;  3EQL C;  2UU9 L;  1PMR A;  4ZYS A;  2L55 A;  1IYU A;  2L9H A;  1EQT A;  1D8L A;  2UU9 Q;  4OO1 H;  5JEA G;  2E2D C;  4I65 A;  3K5L A;  4C1N K;  5K36 H;  2YU9 H;  3H6M A;  4JI3 L;  1K9M C;  3GTM B;  3TQY A;  5BN4 A;  1N9W A;  4XYQ A;  1TWA B;  3I56 A;  4XXE A;  4DK1 A;  3NTI A;  4JI3 Q;  1XNR L;  2E74 C;  1PH1 A;  4KY6 A;  3AQQ A;  4CBV A;  5CV6 A;  4IUT A;  2R93 G;  1A3V A;  2NWG A;  1XNR Q;  3R2T A;  3G7L A;  1KRS A;  3D4R A;  5EQ0 A;  1BDO A;  4V0B A;  1JE5 A;  1H9K A;  2Z9H A;  4QIW E;  1STB A;  3L0O A;  5IGG A;  1JWM D;  3KJO A;  2YV5 A;  2NZ1 D;  3PO3 H;  3F2U A;  4BY1 B;  4DV4 L;  1H9S A;  1CZW A;  1EY5 A;  1I5F A;  3HGB A;  5I2X A;  1PTO D;  4DV4 Q;  3C2P A;  1CK1 A;  4C3I B;  1F2Z A;  3MEH A;  4ME3 A;  2JA9 A;  2F0H A;  3EN2 A;  5JAV A;  1LO5 D;  1F9Q A;  4KV6 A;  4EVO A;  4GOP B;  1ASY A;  1F2Y A;  2Y0S E;  2MPM A;  1R9T B;  3HOY G;  4DV1 L;  2JQO A;  3TS0 A;  5LL6 S;  3JAM c;  2ALY B;  1QOH A;  4Z9C B;  1D1I A;  4DV1 Q;  2B2U A;  5HGT A;  4NPS A;  1IHZ A;  1IW7 D;  5FOB B;  2UXC L;  5DAU A;  4IZ8 A;  1EWI A;  2HQL A;  1Y8P B;  1Y1V H;  4OEM B;  2JK8 A;  3HRZ C;  3HOW G;  1HNX L;  3F8T A;  2UXC Q;  1QVC A;  4R4C A;  4CDF C;  1ILP A;  2NN6 G;  1L1O B;  2WAQ B;  3FEW X;  1VQM A;  1VF7 A;  3Q23 A;  1IL2 A;  1QVG A;  1HNX Q;  3DEP A;  3S2D B;  4U68 A;  5IGC A;  2HIV A;  5KIX A;  3G6J B;  2F0W A;  4AYB E;  1Y1W H;  2EIF A;  3KF8 A;  5D3D A;  1CTM A;  1FNW A;  5I9O A;  4IFD G;  5IT9 E;  2K5D A;  3KLS A;  3K6O A;  5A2Q L;  2K33 A;  2ZM6 L;  3CPW A;  2A69 D;  3M3Y B;  2GA4 B;  4S3S A;  4JYA L;  3W1G A;  3AU7 A;  1OXS C;  1EYD A;  2O5I C;  3NSW A;  1RDP D;  3OW7 A;  2FMM A;  1RHP A;  4N9T A;  4U67 3;  2EYH A;  1WOC A;  2K5Q A;  1K73 C;  1HR0 W;  4JYA Q;  5COR A;  3ERS X;  2NVQ B;  5FLM H;  5IGB A;  1K3R A;  4XQQ A;  4DNI A;  1FGB D;  3ND9 A;  4KHV A;  2D0P A;  1IZ6 A;  1L2F A;  2K5H A;  4HMI A;  4DNT B;  1EL0 A;  2PW5 A;  3V2T A;  3SK4 A;  1EYG A;  3K7A B;  4RGM A;  4V19 0;  1J9O A;  4A3K B;  3RLN A;  1SYB A;  4RGN A;  1EZ6 A;  2ZXP A;  4KK7 A;  1MSH A;  1HUN A;  2N3S A;  2K1B A;  1SE8 A;  3HKS A;  1JWU D;  1CKN B;  3H0G B;  4A3J H;  4A93 G;  2C9O A;  4DAY A;  1UE1 A;  1Q3L A;  1GM5 A;  3TDQ A;  1N36 L;  4G7Z C;  1I6H H;  3M9B A;  2WIN B;  5FLX c;  2PI2 A;  2KA7 A;  4UP9 A;  1UE7 A;  1I4Q A;  4RGT A;  4XDX A;  2KVM A;  1N36 Q;  5M5Y B;  4A76 A;  1E2Z A;  4A3G B;  4MTK A;  4IPG A;  2F1M A;  4UY8 C;  5EKK A;  2FHT A;  4BBR B;  2QIL A;  2EXZ A;  1QUQ A;  3S15 B;  2KUM A;  4IPC A;  1HQM C;  4A3M G;  2XWB B;  1VQH A;  1SNC A;  3UDG A;  1X3G A;  2KHI A;  1XPR A;  2D62 A;  1U4R A;  3PUV A;  4QL5 A;  1QNU A;  4YIJ A;  5LMN W;  1PH8 A;  1Y69 U;  5ELB A;  3S1Q H;  4RKL A;  3TSS A;  3AEV A;  2XIW A;  1SND A;  1VQ9 A;  2WV6 D;  3BDO A;  4DPG A;  5FK9 C;  2CCZ A;  3TZD A;  1D2B A;  5IYB G;  4POF A;  3HKZ G;  1YIJ A;  1M1K C;  3VDY A;  2OQ0 A;  1HNZ L;  2R6G A;  2ENB A;  5C3E B;  2CFM A;  2R92 H;  1IXR A;  1X3Q A;  4Q0F A;  1HNZ Q;  2V4D A;  5LMN Q;  1N33 L;  4XIG S;  1L0W A;  2B2T A;  4OO1 G;  3A55 A;  3OMC A;  1SYF A;  4LF6 L;  2EY5 A;  5JVH 3;  2JA5 H;  3VR2 A;  1N33 Q;  5K36 G;  2E2J H;  1XTC D;  4OGQ C;  4PNY A;  2CKZ B;  1UEB A;  4HJ7 A;  1SAP A;  1UAP A;  4M8A A;  5EGT A;  3DWP A;  1Q12 A;  2FIN B;  2K50 A;  2B63 G;  4LFC L;  3HG9 A;  4HJ8 A;  5M3M B;  1PH2 A;  1STE A;  3EA6 A;  1TWC B;  2HT1 A;  2VUM H;  4LFC Q;  3K81 C;  2LXJ A;  5JEA J;  3W3A A;  2SNM A;  3KFU A;  1GUW A;  1STA A;  1BCP C;  1KC8 C;  5NUC A;  3FKI B;  1EY9 A;  4MHE A;  1EQV A;  2VQF L;  3MAQ A;  3E9H A;  4IOA A;  3HFZ B;  4PZ6 A;  1DM0 B;  3HOU B;  2BH2 A;  2VQF Q;  1O7Y A;  4LF8 L;  1X56 A;  3NUC A;  5DM7 3;  4RGO S;  4CKE A;  4LF8 Q;  1U5K A;  3UE0 A;  3PIO 3;  3GTP H;  1LUZ A;  3VR5 A;  5KYL A;  1JCK B;  3BYY B;  4Q5V A;  1DON A;  5IYC H;  3TEH B;  1FJG L;  3HS0 C;  2UUB L;  1LTB D;  2B2Y C;  4HIK A;  3NTH A;  2A1A A;  2ID0 A;  1FJG Q;  2CQO A;  1E1T A;  2UUB Q;  4JI2 L;  5I6W A;  1A2U A;  4YHH L;  2DY7 A;  1E22 A;  2DN8 A;  3GTK H;  2K75 A;  5AFW A;  4JI2 Q;  1AZQ A;  5AJ3 L;  1PHJ A;  1ESR A;  4C3H B;  4YHH Q;  4GKJ L;  3J81 E;  4EX5 A;  5BN3 A;  4KMU C;  1CA6 A;  2OWO A;  3GV6 A;  5AJ3 Q;  1ET9 A;  1Y1V G;  4OEL B;  3DM1 A;  2Y0S B;  4GKJ Q;  1LTR D;  1Q8I A;  2AQ1 B;  2C35 B;  4K8J A;  1JB7 A;  4K2L A;  4F87 A;  5C4H A;  3BZD B;  1GUS A;  1QB5 D;  2ICE C;  4Y7N H;  1VQ5 A;  2NYZ D;  2ASB A;  5IWA L;  4BY7 B;  2PNR C;  3RLO A;  1N32 L;  2EVB A;  3H91 A;  1EIH A;  2E2I B;  1JR0 D;  1AW7 A;  5IWA Q;  1HCZ A;  2EYL A;  2KEE A;  3MEF A;  4CDE C;  1N32 Q;  1PA6 A;  3FP9 A;  3ZYY X;  3OYY A;  1DZ1 A;  2B29 A;  1I50 H;  3K58 A;  5M9O A;  3K5N A;  4AIM A;  5M5W B;  3F2C A;  2PPB C;  4DR3 L;  1CSP A;  2ZT9 C;  1X3P A;  2F0G A;  5C44 H;  1R4P B;  5FO7 B;  1K8G A;  4JK1 C;  3BDL A;  2PI2 E;  3VYR A;  1NE3 A;  5C3W A;  4KLK A;  4DR3 Q;  1NJI C;  1AN8 A;  3J80 i;  5FLM G;  4IFD J;  1KL9 A;  1AE3 A;  3C1E A;  4KHP L;  3LX0 A;  5JJI A;  4L5S A;  1J8I A;  1RIP A;  3NBH A;  2IHE A;  1CFM A;  3OPO A;  3NTK A;  2R7Z G;  2NTS A;  4KHP Q;  4EGV A;  2WP8 J;  2Z4H A;  5K5P A;  4JI4 Q;  1SMY D;  3TS2 A;  1MKH A;  3ULJ A;  4ZRZ A;  4GN4 B;  4PG3 A;  1E2V A;  4DK0 A;  4E6I A;  1JJG A;  4GN5 A;  3S17 B;  5IP9 H;  3PIO A;  3V05 A;  3CAM A;  1K0R A;  4GOP C;  1MJC A;  1KAW A;  1PTO B;  1YIT A;  1RL2 A;  1T9H A;  2B2W A;  4RHR A;  4A3J G;  3HOV B;  3GTQ B;  1H9M A;  2HUG A;  4WJ3 M;  2Z4I A;  1NR4 A;  4RKB A;  3FPP A;  5IT9 L;  4JPB W;  2A6H C;  2D9U A;  3H3V I;  3T1H L;  3C1F A;  4R8I A;  4HJA A;  4LWC A;  4B3R Q;  3P7J A;  5E3F A;  1A0I A;  4DR2 L;  3A7A B;  4YWK A;  3T1H Q;  1CKO A;  2B8F A;  1TKW B;  1L1O C;  1TXY A;  1OXV A;  2F4I A;  4DR2 Q;  1C7Y A;  1DCZ A;  1B44 D;  1Q1B A;  3X3N A;  4APV A;  3F2B A;  5JOB A;  2NVY B;  2QA4 A;  4A3F B;  3HP3 A;  3F2D A;  1HH2 P;  3K5M A;  4LW1 A;  2JA6 H;  1C0A A;  1O7L A;  2OCE A;  3I4L A;  1Q1E A;  1IBK L;  4ID6 A;  2LMC B;  3R8B A;  1K83 H;  2E2H B;  2JA7 B;  1KNE A;  1IBK Q;  1LAB A;  2GVA A;  3I2Z A;  2F0O A;  3S1N H;  1PRT D;  1WTQ A;  5ELF A;  3PMF A;  3T53 B;  1PTO F;  3A8I E;  2QKI C;  4P73 A;  1PH9 A;  3AFP A;  2F03 A;  4AYB G;  3CCR A;  1E7Z A;  1TWH B;  2DJF C;  1AEX A;  4B3T L;  2R92 G;  1K28 A;  2PQE A;  1EY6 A;  3RN5 A;  4OL7 A;  2F0I A;  1EIY B;  1J6Q A;  4B3T Q;  1PZI D;  2XGT A;  2L11 A;  1ICF B;  5LMU L;  4OWX B;  1UWV A;  2JA5 G;  5C0X G;  3J7A 5;  1YNJ D;  2L1B A;  3L7Z C;  4B08 A;  1LTT D;  3CQZ H;  5LMU Q;  1K0S A;  4KKS A;  2MGS A;  3G71 A;  4HIM A;  1H9S B;  3K57 A;  3HKZ E;  4UP7 A;  1G8Z D;  1XMO L;  2VUM G;  1OO9 B;  2JN4 A;  2YYZ A;  3EJI A;  5GAD C;  3JAM E;  2WFW A;  1XMO Q;  3PQI A;  1PH4 A;  3E3X A;  3WWV A;  4IOC A;  4FNF A;  4IUU A;  1YNX A;  4H7B A;  3PIP 3;  3M7G A;  3S1R H;  3TRZ A;  4QMG A;  2ZJQ A;  1ONL A;  1CUK A;  2M2L A;  1CSQ A;  1F2L A;  3O13 A;  4KN4 C;  1GO3 E;  5DEH A;  1JB3 A;  3WDN A;  1P8L A;  2KHJ A;  1JJC B;  4L8J A;  1RF2 D;  5IYC G;  1TWA H;  4ODG A;  4R1J A;  4X66 L;  3J80 L;  1ILQ A;  1SNO A;  3GD7 A;  1BVS A;  4J6H A;  5KNC A;  3Q8D A;  4X66 Q;  2MP1 A;  1BBW A;  2KQ3 A;  3IKJ A;  1QCB D;  2B8G A;  3ND8 A;  2BA0 A;  3KF8 B;  2R93 B;  2EZV A;  4K5W A;  1IL8 A;  1ICW A;  1UE6 A;  2ZXO A;  4R4I A;  1IKL A;  5JPM C;  2QF7 A;  2HHH L;  3NK9 A;  1EU4 A;  1V8Q A;  2FXQ A;  2UXD L;  4X3T A;  2RSN A;  4BY1 H;  3A5Z B;  2HHH Q;  2JA8 H;  5D65 A;  2UXD Q;  4ALP A;  4GNX B;  3MXN A;  1Q81 C;  5M5X B;  1PYB A;  3RNU A;  4JBM A;  4IN3 A;  4C3I H;  1TWF B;  1J5E L;  2Z6K C;  2RDH A;  3K5O A;  2CQA A;  1DOK A;  3SR1 A;  1J5E Q;  4RA8 A;  1QE6 A;  1WTP A;  4EQN A;  4QJF A;  1EYC A;  4P74 A;  1R9T H;  3WOF A;  4DGZ A;  2XNA C;  3AB9 A;  1VQC A;  2EDG A;  1S4Z A;  3HOY B;  3U9O A;  5J39 A;  2JE6 I;  4CDD C;  2X69 A;  5FLX E;  5C44 G;  1WD1 A;  4FVM A;  3M4Y A;  2DJG C;  1EIF A;  1GXD C;  5HGQ A;  2A73 B;  4RWS C;  1KHI A;  1SNM A;  5JVG 3;  4IFD I;  1A8V A;  3PIP A;  4DAY B;  3HOW B;  3J81 L;  4O0A A;  3DLL A;  3KJP A;  2G5D A;  3DHQ A;  1LTI D;  4JOI C;  1I3Q B;  4PZ7 A;  4DR5 L;  2RQX A;  1C4Q A;  4OIJ A;  3JAM i;  1AFP A;  2PZT A;  4DR5 Q;  2FFK B;  5IP9 G;  1LYL A;  2PZU A;  1JOQ A;  3RMH A;  1N34 Q;  2Q8T A;  3J7Y W;  5HY6 A;  2PQA B;  3KLS X;  3NP8 A;  1CM9 A;  1QUQ B;  3M3Y H;  3M85 A;  1SXT A;  1PDQ A;  1MIU A;  2EE1 A;  4RCN A;  5EAY A;  3K59 A;  3RZD H;  3BVM A;  2VB2 X;  2F0D A;  3S14 B;  1I4X A;  1ZXT A;  1RKN A;  1VQI A;  1PH5 A;  2TMP A;  3AMU A;  2MO1 A;  4ZUI A;  4NKL A;  2NBF A;  3G4S A;  1TR5 A;  3CC7 A;  2F0T A;  1WYD A;  3PUY A;  1DOM A;  3K7A H;  4O1N A;  3RUZ A;  4A3K H;  5GQO A;  1KAA A;  1FNV A;  4DFA A;  1E3P A;  4IUP A;  3A56 A;  3ERO A;  3T56 B;  3QIA A;  5JJZ A;  3GTO H;  4BWG B;  3AYH B;  3D31 A;  4A3D H;  1O78 A;  5CC4 A;  3HEJ A;  3H0G H;  1X3F A;  2FJ2 A;  4QUC A;  4JC0 A;  2Q2U A;  4R4Q A;  2A6E C;  2NVX B;  4A93 B;  1BR9 A;  1B9N A;  1ESF A;  2R3Z A;  1ZKO A;  2XVS A;  1KLU D;  5I9P A;  3N52 A;  3DWQ A;  1A6X A;  5LL6 X;  2KEN A;  3I4M H;  1V1P B;  2QEJ C;  4GN3 B;  3UI2 A;  4F8M A;  4A3G H;  4BA2 I;  4GZY C;  1NMG A;  2WB1 G;  2NVT H;  4WJ4 A;  5IGF A;  5CV9 A;  4BBR H;  4DF7 A;  3S15 H;  4FXD A;  2RDF A;  4HIO A;  3K8A A;  2N88 A;  3PV0 A;  3VA7 A;  4C3J H;  1KDA A;  5EPJ A;  4A3M B;  2JEB I;  2G9H D;  2J7Z A;  2GVB A;  1MD2 D;  1ENA A;  3PCO B;  2SOB A;  1CI3 M;  1EY0 A;  1G2S A;  4Y52 H;  1OXT A;  1PZK D;  5C0X J;  4OO1 I;  1STH A;  2RVL A;  3A8J E;  3IL8 A;  1X65 A;  1XPO A;  4DAP A;  1O7I A;  5E7N A;  1P16 A;  2XRQ D;  4KHZ A;  4N8F A;  2RA4 A;  2RHQ B;  1EIG A;  2VZA A;  4RFB A;  1H9J A;  2ES2 A;  4DUZ L;  1V1Q A;  4DV7 L;  2F0K A;  3CCJ A;  3PGZ A;  1S5B D;  4JV5 L;  1L0Y B;  4DR4 L;  1SE3 A;  4DUZ Q;  4M1U B;  1YNN C;  3KBG A;  4DV7 Q;  4DUY L;  1KDB A;  3R3O A;  1PV4 A;  1Q8K A;  3H3V C;  4JV5 Q;  4IAL A;  2ZTE A;  3S2H H;  5ISR A;  4LF9 L;  4DR4 Q;  2IX0 A;  4J1M A;  4DUY Q;  1II3 A;  5M3F B;  4L5R C;  5FKA C;  5M3M H;  3MXU A;  1VQN A;  1HR0 L;  5C5L A;  4LF9 Q;  3B6Y A;  2IX1 A;  2B63 B;  4TQU S;  4CKC A;  3S24 A;  1UEA B;  3KLR A;  3NEL A;  4IQZ A;  1HR0 Q;  5DM6 3;  1K8A C;  2KJX A;  4BBS G;  4A3I H;  2Q8I B;  4A3B B;  5TSS A;  4N9P A;  1VQB A;  3JAM L;  1JOR A;  1LTL A;  1B1Z A;  3L3O C;  1PRT B;  2PCF B;  2JA8 G;  2FMC A;  1JC7 A;  1HTL D;  4I7Z C;  1HHV A;  3MHB A;  1OXU A;  2B2Y A;  1U9R A;  4LK1 C;  3JC6 6;  4C3I G;  2XN9 C;  3MWY W;  1NAP A;  3NBH B;  1EFW A;  4CDC C;  3D6W A;  4G4K A;  1VQP A;  1HUM A;  1D7Q A;  2X6L A;  4PQX A;  1BKB A;  4IJH A;  3RN2 A;  3TBI B;  1TWG H;  2BDN A;  4C2M B;  1GD7 A;  2K32 A;  4FF1 A;  2EPB A;  4X62 Q;  1C48 A;  5EKI A;  1X3E A;  5KND A;  5GAE C;  1V1O A;  3TRE A;  1ENC A;  4KY7 A;  3TP6 A;  1QIL A;  2D0O A;  3CCS A;  2ZJR A;  1U4P A;  1TS2 A;  3OWF A;  2MNA A;  3CC4 A;  1W2B A;  1PFN A;  1VCI A;  2PMZ B;  1Y1V B;  4R8N A;  2UUC L;  2O4X A;  4X65 L;  2DUD A;  3S9W A;  4YCV A;  1VQF A;  3CC2 A;  5LMN L;  1GVP A;  3VYS A;  2UUC Q;  1PRT F;  2CWA A;  4X65 Q;  1WD0 A;  3GTJ H;  3GTG B;  4BXX H;  4BY7 H;  1DGS A;  1IBM L;  1QWY A;  3URY A;  3A54 A;  2E2I H;  1C8C A;  3CKI B;  3M7N A;  1EY4 A;  1MSG A;  4TVA B;  1Q86 C;  3UDX A;  2K7V A;  3OIP A;  1IBM Q;  1BCP D;  3PO2 H;  2F0L A;  2R61 A;  5M5W H;  3D8G A;  1XX8 A;  2EYP A;  3A0J A;  1WTX A;  3QB3 A;  1GUG A;  2EJM A;  1LT3 D;  2K5V A;  3I3C A;  2D2C C;  4FXK C;  1E2W A;  1F2M A;  4CHT B;  4NB3 A;  1SMX A;  5C5M A;  5FLX L;  4GNX C;  1B70 B;  3ZJY C;  3RZO B;  3GTL B;  3GQB A;  1QZG A;  1KAB A;  4GOP A;  2R7Z B;  1G91 A;  4LFB L;  1PVO A;  2EYF A;  3PO3 G;  2N8N A;  3DWA A;  1ZYR C;  4FO2 A;  4KKT A;  4JI8 L;  5BR8 Q;  1F9S A;  3E0J A;  2AHO B;  3S17 H;  4LFB Q;  4B3M L;  5FJ8 H;  4A3D G;  1PXU A;  1G29 1;  4JI8 Q;  4ILW A;  5IYD H;  4QIW B;  4B3M Q;  3H0G G;  1SNQ A;  4FP5 D;  2Q2T A;  4NW2 A;  1MBY A;  1B3A A;  4X6A H;  2HCC A;  4K2K A;  4A3J B;  3DM3 A;  1S5C D;  5I6Y A;  1L1O A;  4LUV A;  2K52 A;  1I4H A;  1TVX A;  3H15 A;  4JI1 L;  1JQY D;  1I6H B;  1V43 A;  3I4M G;  3F1Z A;  2MFI A;  1WTO A;  2BCO A;  4A3G G;  3SGI A;  4H13 C;  3D6C A;  1HZB A;  4JI1 Q;  3KK7 A;  1CHQ D;  1YHA A;  4A3F H;  2NVY H;  4BBR G;  1TS5 A;  5CV7 A;  3SK5 A;  4A3E B;  2J4X A;  4H44 C;  4DXG A;  3W5O A;  3NQT A;  3CHB D;  3H3V H;  1WCM H;  4A3C H;  3T4A C;  4C3J G;  4ME5 A;  2MQH A;  1WI5 A;  3U4Z A;  1HA6 A;  2ZXR A;  4NDX A;  1LT4 D;  5L37 A;  1QJO A;  4PMC A;  3T16 A;  1FVI A;  1Y1W G;  3U9S A;  1Z47 A;  2ZTC A;  3S1Q B;  1TII D;  1S5D D;  5GAG C;  3W2D A;  2WB1 E;  1AE2 A;  2HD3 A;  2KCN A;  5C0X I;  3R2I A;  4I7A A;  4A3L H;  1LV9 A;  3X3M A;  5I4D A;  4AYB B;  5EBD A;  5JJK A;  4GS3 A;  3ULP A;  5IOC A;  5KGU A;  2R92 B;  2MO0 A;  2BE5 C;  1B2T A;  2JEA I;  1TY0 A;  4WJW A;  4JI4 L;  1D1K A;  1JMC A;  5IOD A;  3CRL C;  2JA5 B;  1HZ9 A;  3GV3 A;  2E2J B;  4ZUJ A;  1VQE A;  5T1G A;  2HQE A;  1FR3 A;  1X32 A;  5M3M G;  3SVM A;  5CV8 A;  1BUV T;  4B3S L;  4J8Q A;  5EPK A;  2A6H D;  3IRB A;  3M4O H;  4UHV A;  4FF2 A;  3G48 A;  2CWP A;  1Q90 A;  4B3S Q;  1B3Q A;  2EJG C;  4PMW A;  3J7Z C;  2WKD A;  4MNO A;  3G6E A;  4HSP A;  4A3I G;  4F7X A;  5JPN C;  2SDF A;  1U4L A;  5IY0 A;  4WFN 3;  4POG A;  2SNS A;  4L6T B;  1YEZ A;  3PUW A;  5CYU A;  4CJ1 B;  4B3R L;  1LT6 D;  1GUT A;  2QEX A;  1VQD A;  4CJ0 B;  4KD3 A;  3VYT A;  4DAM A;  3CCV A;  2L5T A;  3M4Q A;  4K6D A;  2CVR A;  4YCW A;  2HCI A;  1G6P A;  4O2D A;  2OTJ A;  1RJT A;  1EQQ A;  2KED A;  3PF4 A;  1SMY C;  3KF6 A;  3CF5 A;  4KJN A;  1S3O A;  5C4X B;  3R93 A;  3VR3 A;  1XPU A;  5C4J H;  2RCF A;  4IUQ A;  2PNH A;  1YI2 A;  3HOZ B;  1GJX A;  3GTK B;  1HQR D;  1EWH A;  5ELO A;  1Z9F A;  3J81 i;  2K14 A;  1JE4 A;  4UAI A;  3ERQ A;  2K01 A;  1B8A A;  3NE5 B;  4EQP A;  4IO9 A;  1ZEQ X;  4K14 A;  2BOS A;  1I94 L;  1C9O A;  2VY3 A;  1XNQ L;  2RHS B;  1H95 A;  4EQO A;  5M5X H;  4WRD A;  1I94 Q;  2R7D A;  2SEB D;  1KDC A;  1XNQ Q;  3I7F A;  4QB4 A;  2IY5 B;  2TSS A;  4GLX A;  4BXX G;  3GP7 A;  3J80 c;  4RAU C;  3I4N H;  4LMQ D;  1KNA A;  4LUO A;  4LAA A;  1AZP A;  3A7L A;  2YTV A;  1YHB A;  4K5V A;  1QZH A;  1EEF D;  3BYT B;  2VQE L;  3VR4 A;  3PO2 G;  1DXM A;  5I2Y A;  1D5M C;  3HOX B;  1CKM A;  2A68 C;  2JYO A;  4FF3 A;  2VQE Q;  2ZJP A;  3CCQ A;  4XQJ A;  1GOZ A;  1GUN A;  1QNK A;  3HZX A;  3T1Y L;  3ULL A;  4G57 A;  2F0U A;  3K0X A;  2L0C A;  5C44 B;  3CME A;  4JOI A;  3BS1 A;  3T1Y Q;  1G2T A;  1PRT C;  4NXM L;  3AFQ A;  1ROD A;  1KXL A;  2YTX A;  4DAV A;  1RTO A;  1V9P A;  4NXM Q;  1G6Z A;  2A5H A;  2RDG A;  1LTA D;  4DV2 L;  1I6V C;  3CRK C;  2F0V A;  1T5X D;  1KTK A;  2H5X A;  2Z0S A;  5G3L D;  1CZG A;  1VQ7 A;  3FVQ A;  3IFT A;  1I4R A;  3SEB A;  2AQ2 B;  4DV2 Q;  2AQ3 B;  4MTN A;  4X3S A;  5DNF A;  4IFD H;  3WOE A;  1KD1 C;  1YNJ C;  1SLJ A;  1SRO A;  4DA2 A;  3MXP A;  1NSN S;  3GTM H;  1U4M A;  4JG2 A;  5HUR A;  1EEI D;  2KCM A;  1O7Z A;  1LTG D;  1LT5 D;  2LKV A;  3RD4 A;  2F0N A;  1WJJ A;  3QO2 A;  2NUC A;  4DK3 C;  2EJF C;  2KEC A;  1NMF A;  2UUA L;  2Z6B A;  4L5T A;  3TP7 A;  3S14 H;  2B3G A;  3D4D A;  1S40 A;  2I5M X;  4RH6 A;  1SNP A;  1LTS D;  1SFO B;  1R4Q B;  4P75 A;  4QF4 A;  5CV5 A;  2UUA Q;  2KHS A;  2LS0 1;  4A3F G;  1HNW L;  4RHS A;  3P20 A;  2MUY A;  1WCM G;  1HNW Q;  3Q24 A;  4A3C G;  3V96 A;  1MGS A;  2IW3 A;  3I8Z A;  1STY A;  1WVL A;  2N49 A;  3P75 A;  4F88 A;  3S1M B;  3K80 C;  1K83 B;  3NBI A;  3STB D;  3FHW A;  1K3B C;  3SDZ A;  4K0K L;  3S1N B;  3TN2 A;  3GDE A;  2B2V C;  1EU3 A;  1VQ4 A;  1B9M A;  4A3L G;  1BCP B;  4K0K Q;  2Q8R E;  4MZ9 A;  2NN6 I;  2L4N A;  4YWL A;  1W3S A;  3KYH C;  3VR6 A;  1TT2 A;  4ULL A;  3QOL A;  4UP8 A;  5KYI A;  3CCE A;  4KI0 A;  4HR7 B;  3ITP A;  3FPU B;  3S16 B;  4CKB A;  4KN7 C;  2A19 A;  1HZA A;  1IYV A;  3OOC A;  1FNU A;  4DR1 L;  1FL0 A;  2AUJ D;  3S2D H;  1VQ6 A;  3CQZ B;  3CXC A;  2CHB D;  3KUP A;  4PZ8 A;  1YHQ A;  2F4V L;  3OMG A;  1PFM A;  4DR1 Q;  3I72 A;  1BQQ T;  1N34 L;  1SRU A;  4JBK A;  2F4V Q;  4JI5 L;  1SYD A;  2BH8 A;  2I5L X;  2F0F A;  1K8O A;  1UE5 A;  2H1E A;  3NWS A;  1EYA A;  4JI5 Q;  2CW0 C;  3KBX A;  5T1I A;  3U58 A;  4IJL A;  4AQY L;  2R7F A;  1SN8 A;  4DV6 L;  1Y14 B;  1Z7T A;  2I07 B;  1BCP F;  4AQY Q;  1SJE D;  2IL8 A;  4J15 A;  2NVQ H;  4ABN A;  4DV6 Q;  1B53 A;  2OEO A;  4UPA A;  4LNQ A;  2UXB L;  2CH4 W;  1HFG A;  1WFQ A;  4KTA A;  5M3F H;  2UXB Q;  1I4P A;  1CQF A;  2A6E D;  3U50 C;  2B63 H;  1YZ6 A;  5GRO A;  3UDI A;  4DV0 L;  2JA6 G;  3IFD A;  2DY8 A;  4IUV A;  4DV0 Q;  4WOR A;  1L0X B;  4YCU A;  1VMP A;  2C5C A;  5IE8 A;  1XTD A;  4JW0 A;  5LHY 1;  4BBS B;  4ZQ3 A;  5EBC A;  4DV3 L;  1YJ9 A;  3MC0 B;  4A3B H;  1XJV A;  1KLG D;  3DXJ C;  1FYC A;  4HJ5 A;  2AMC B;  3NXW A;  4DV3 Q;  5JJL A;  1BBX C;  3CW2 C;  2AWO A;  2ATW A;  4BS9 A;  3DMU A;  2JA8 B;  5M5Y H;  5ELE A;  1NNX A;  4G7H C;  5H1S E;  4IUR A;  4P72 A;  5ELD A;  3VA5 A;  3MFY A;  2EXD A;  3I4N G;  2KBN A;  1CQV A;  1DJR D;  1SE4 A;  3NEM A;  4GLV B;  4DK6 C;  2OT2 A;  2L12 A;  1SDF A;  2Z1C A;  1HJP A;  4ZAI A;  4C2M H;  3MTS A;  4HTH A;  2RBM A;  4P71 A;  3RR5 A;  1PTO C;  3I70 A;  3M4P A;  5E4W C;  3I73 A;  2I0Q A;  2VNU D;  1ASZ A;  3J7A F;  4DU9 A;  1M8A A;  4KJO A;  3L9A X;  4XTC S;  1SR3 A;  4PV1 C;  2WAC A;  1YNN D;  1D5X C;  1A62 A;  1B50 A;  3BG3 A;  1GHK A;  4DR6 L;  5C3E H;  3HKZ B;  4LF5 L;  4OWW B;  4DKA C;  3GTG H;  4GKK L;  2IT1 A;  3EVQ A;  1IW7 C;  4IPD A;  4DN4 M;  4DR6 Q;  2N78 A;  4LF5 Q;  1Q46 A;  1MHW C;  4GKK Q;  2NZO A;  1XMQ L;  1DD2 A;  3PSI A;  1SSO A;  1VF5 C;  4NP5 A;  2WII B;  1XMQ Q;  4OWT B;  2YU9 B;  4C56 C;  5EJW A;  4GNX A;  4FDB A;  3MA2 B;  5ELN A;  1TWC H;  2ZM6 Q;  1CT1 D;  1RCV D;  3RZD B;  2A74 C;  2EYJ A;  1ET6 A;  2K04 A;  2WKC A;  3FKI H;  4K8I A;  2V1C C;  2PO4 A;  1BNZ A;  3GTL H;  3RZO H;  3FDT A;  2R7Z H;  1X9N A;  3H09 A;  2A69 C;  3HOU H;  1A3U A;  1QG7 A;  4BY1 G;  3KDF A;  4X3U A;  3J7A V;  4B9X A;  3PO3 B;  3CU7 A;  4RCO A;  4RG1 A;  1LAC A;  3GTO B;  4A3D B;  1F9P A;  3BZK A;  2VS1 A;  3RLF A;  1PH3 A;  3MFG A;  1DYQ A;  2CH4 A;  4H02 A;  4JCV E;  3CD6 A;  1KQS A;  4X62 L;  2F3I A;  3LGJ A;  2J0T D;  4AH6 A;  4OHJ A;  2EOT A;  3I4M B;  1X55 A;  4C3H H;  4FF4 A;  5IGE A;  1FGU A;  3NEN A;  4A3E H;  2NVT B;  1TY2 A;  4HID A;  2PQA A;  1G51 A;  3E9I A;  5D3I B;  5FO9 B;  2WAQ G;  1SYE A;  1E24 A;  1QVF A;  2B2U C;  3I4O A;  4C3J B;  1A3T A;  2VXW A;  1F77 A;  1LM0 A;  1VS0 A;  4N8X 1;  4ZKC B;  2F0Q A;  1Y1W B;  4JBJ A;  4ZLT F;  5IP7 H;  3CPF A;  1SE2 A;  3I55 A;  2KCT A;  1YVC A;  4XT3 B;  1VQ8 A;  1E0B A;  2K4K A;  2K03 A;  3Q6S A;  3KF6 B;  1M90 C;  3UE1 A;  1VQJ A;  5IIF A;  1UUP A;  1XYI A;  1ZYR D;  2XWJ B;  1TS3 A;  2PYK A;  2OTL A;  2D5D A;  4NXN L;  1STG A;  4OIK A;  1IBL L;  3J80 E;  1X6O A;  2NB0 A;  4NXN Q;  5C0X H;  1IBL Q;  5M3F G;  3S2H B;  4ZK9 B;  1BF4 A;  2I46 A;  5BR8 L;  4LF6 Q;  4FYD A;  1VDZ A;  5KNB A;  4A3K G;  3ER0 A;  1EFI D;  1V1P A;  4HMJ A;  2AWN A;  3NWT A;  3SK8 A;  2L15 A;  2MHV A;  1STN A;  2DNE A;  4XT1 B;  1Q82 C;  3OHX C;  2N55 A;  4HAE A;  1XWE A;  1PTO H;  2G9D A;  2K6A A;  1E1O A;  5G3L F;  4A3B G;  1PLF A;  3TME A;  3HOV H;  3GTQ H;  2LSS A;  4A3I B;  3BZC A;  1EY7 A;  2XRS D;  4CGY B;  1MJE A;  4IPH A;  3E6Z X;  3PUX A;  3OTO L;  1OXX K;  2VL6 A;  3BU2 A;  3QWN A;  2PW7 A;  3OTO Q;  4L5Q A;  5J22 A;  1PFS A;  3A74 A;  4JI7 L;  5KRU A;  3GO5 A;  2OF1 A;  1RTN A;  3SE0 A;  2QW7 A;  1PZJ D;  4JI7 Q;  3EIV A;  4TRD A;  1GHJ A;  3BJU A;  5F2D A;  1IKM A;  4MN3 A;  3TZU A;  5A35 A;  5C4X H;  3Q22 A;  1TQO A;  4C1N I;  5J3B A;  1PH7 A;  2P5Z X;  1EWC A;  2F52 A;  1TWG B;  1TU2 B;  1A63 A;  3HOZ H;  3NHH A;  3EBE A;  1GUO A;  4TSS A;  2LY7 A;  2E2H H;  2JA7 H;  5CMD A;  4LF7 L;  2H4O A;  2F0E A;  5IT9 c;  1AP0 A;  4LUZ A;  2O2L D;  1VQL A;  2K5N A;  4LF7 Q;  2BE5 D;  1B7Y B;  1RD9 D;  5CV4 A;  1CA5 A;  2AUK A;  4JI0 L;  1XXG A;  3KLW A;  1TWH H;  2RCN A;  5C3E G;  3C3L A;  4HCE A;  4JI0 Q;  1M4V A; 
#chains in the Genus database with same CATH homology
 1WYD A;  3PUY A;  4DV2 L;  1VQ7 A;  2Z0S A;  3K7A H;  2H5X A;  2DGY A;  4IPG A;  4UY8 C;  4BA1 I;  4A3K H;  5GQO A;  2AKW B;  4DV2 Q;  1E3P A;  1QUQ A;  1CKN A;  4IPC A;  4MTN A;  4A3M G;  3GTO H;  3AYH B;  2I5H A;  1VQH A;  3HOX H;  3D31 A;  4A3D H;  1KD1 C;  1SLJ A;  1SRO A;  3UDG A;  1X3G A;  2KHI A;  1XPR A;  3GTM H;  2D62 A;  4JG2 A;  3PUV A;  2QGQ A;  1VQO A;  3H0G H;  2KCM A;  4LF4 L;  1X3F A;  4QL5 A;  4A75 A;  3KOJ A;  3MXN B;  5LMN W;  1PH8 A;  4DV5 L;  4JC0 A;  1WJJ A;  3S1Q H;  2Q2U A;  4R4Q A;  1JT8 A;  4DK3 C;  4LF4 Q;  3AEV A;  1NMF A;  2UUA L;  4L5T A;  1U0L A;  3S14 H;  2B3G A;  1VQ9 A;  1VQG A;  4DV5 Q;  1S40 A;  2I5M X;  4DPG A;  5GAH C;  1NY4 A;  2CCZ A;  4DR7 L;  3FKI G;  5IYB G;  4R4T A;  2KEN A;  4P75 A;  3I4M H;  2UUA Q;  4POF A;  3HKZ G;  2OQK A;  4GN3 B;  4A3G H;  1YIJ A;  1M1K C;  4BA2 I;  4DR7 Q;  3VDY A;  2OQ0 A;  1HNZ L;  2R6G A;  3HOU G;  4A3F G;  1NMG A;  2WB1 G;  2NVT H;  1HNW L;  2CFM A;  3K7U C;  2BA1 A;  1IXR A;  2R92 H;  4WJ4 A;  4R4O A;  4BBR H;  1HNZ Q;  5LMN Q;  1N33 L;  1WCM G;  5DLQ E;  4EQ5 A;  3S15 H;  1HNW Q;  4XIG S;  4A3C G;  4HIO A;  1L0W A;  4QGU A;  4OO1 G;  4RMF A;  4LF6 L;  3K8A A;  3PV0 A;  2JA5 H;  3CMA A;  2N49 A;  1N33 Q;  4C3J H;  5K36 G;  2E2J H;  2CKZ B;  1UEB A;  3K80 C;  4HJ7 A;  2JEB I;  1AH9 A;  1Q12 A;  2K50 A;  2B63 G;  4LFC L;  2GVB A;  3CCM A;  4HJ8 A;  3STB D;  3PCO B;  1PH2 A;  3FHW A;  1PH6 A;  4Y52 H;  4K0K L;  1OXT A;  1NTG A;  2HT1 A;  2VUM H;  4LFC Q;  3K81 C;  3PUZ A;  3GDE A;  3U4V A;  1KRT A;  1IYJ B;  2LXJ A;  5C0X J;  1VQ4 A;  4OO1 I;  5JEA J;  4A3L G;  1VQA A;  4K0K Q;  4MZ9 A;  1SFO H;  2R93 H;  2NN6 I;  1HZC A;  3KFU A;  1GKH A;  1KC8 C;  2UXD Q;  4YWL A;  1X65 A;  1W3S A;  1XPO A;  3KYH C;  1O7I A;  4UP8 A;  5E7N A;  1P16 A;  2VQF L;  3E9H A;  4KHZ A;  3CCE A;  4A3E G;  2RHQ B;  2VZA A;  4KI0 A;  2ES2 A;  4IOA A;  3HFZ B;  4PZ6 A;  2GN5 A;  1V1Q A;  4X64 L;  2Y0S G;  4OON A;  4DUZ L;  4QQB X;  4DV7 L;  2BH2 A;  3CCJ A;  1X54 A;  3PGZ A;  1Q7Y C;  2Z6K A;  4JV5 L;  2VQF Q;  4LF8 L;  1X56 A;  2A19 A;  3W1B A;  4X64 Q;  4DUZ Q;  4DR4 L;  1HZA A;  4DV7 Q;  4DUY L;  2EQS A;  1PV4 A;  1Q8K A;  3S1M H;  4JV5 Q;  4DR1 L;  1FL0 A;  4LF8 Q;  1U5K A;  2ZTE A;  3UE0 A;  3S2H H;  3GTP H;  4LF9 L;  1TWF H;  1LUZ A;  1VQ6 A;  3S2D H;  2IX0 A;  4DR4 Q;  3CXC A;  1YHQ A;  4PZ8 A;  4DUY Q;  2F4V L;  5IYC H;  4BY7 G;  3TEH B;  4L5R C;  4DR1 Q;  1FJG L;  5M3M H;  5IP7 G;  1VQN A;  2UUB L;  1N34 L;  1HR0 L;  4LF9 Q;  2IX1 A;  3B6Y A;  4HIK A;  1SRU A;  4TQU S;  4JBK A;  2F4V Q;  4JI5 L;  2BH8 A;  2A1A A;  2ID0 A;  2I5L X;  1FJG Q;  2CQO A;  1E1T A;  2UUB Q;  4JI2 L;  3S24 A;  1HR0 Q;  3NEL A;  1UE5 A;  1K8A C;  4BBS G;  4YHH L;  4JI5 Q;  1E22 A;  3HOY H;  3GTK H;  2K75 A;  4JI2 Q;  4A3I H;  5AJ3 L;  4A4I A;  2WAQ E;  3U58 A;  4IJL A;  1PHJ A;  4AQY L;  2R7F A;  4YHH Q;  1YJW A;  1VQB A;  1KIX A;  1SN8 A;  4GKJ L;  4EX5 A;  1Y14 B;  1LTL A;  4DV6 L;  2OWO A;  5AJ3 Q;  3S16 H;  4AQY Q;  1Y1V G;  2JA8 G;  4J15 A;  4LFA L;  2NVQ H;  4GKJ Q;  4DV6 Q;  1N8R C;  1OXU A;  2C35 B;  4UPA A;  3HOW H;  4LNQ A;  2UXB L;  1JB7 A;  4LFA Q;  3JC6 6;  1OTC A;  1WFQ A;  1I3Q H;  4Y7N H;  2E8G A;  2Q2H A;  5M3F H;  1YJN A;  1VQ5 A;  4OX9 L;  2UXB Q;  2ASB A;  4YWM A;  3NBH B;  3U50 C;  5IWA L;  1EFW A;  2B63 H;  3RLO A;  1YZ6 A;  5GRO A;  1VQP A;  1N32 L;  3UDI A;  4JI6 L;  4DV0 L;  1D7Q A;  4OX9 Q;  2JA6 G;  5FJ8 G;  1BKB A;  4IJH A;  3RN2 A;  5IWA Q;  1TWG H;  3MEF A;  1N32 Q;  5IYD G;  1PA6 A;  4JI6 Q;  3FP9 A;  4DV0 Q;  1GD7 A;  3OYY A;  4YCU A;  2B29 A;  3CP0 A;  5IE8 A;  1XTD A;  1I50 H;  4X62 Q;  3HOV G;  3E0E A;  3OW2 A;  1X3E A;  5GAE C;  4DV3 L;  1EUJ A;  4HJ9 A;  3TRE A;  4AIM A;  3F2C A;  1YJ9 A;  1XJV A;  4A3B H;  4DR3 L;  1CSP A;  3CCS A;  2D0O A;  5C44 H;  4HJ5 A;  1K8G A;  2AMC B;  2ZJR A;  2PI2 E;  4DV3 Q;  1NE3 A;  5JJL A;  4KLK A;  4DR3 Q;  2MNA A;  3CC4 A;  3CW2 C;  2AWO A;  1W2B A;  3J80 i;  5FLM G;  1VCI A;  1NJI C;  1KL9 A;  2ATW A;  1AE3 A;  4KHP L;  4IFD J;  3D0F A;  5JJI A;  4L5S A;  3J81 c;  1RIP A;  5M5Y H;  2UUC L;  2VW9 A;  4X65 L;  1EQR A;  2DUD A;  2IHE A;  1VQK A;  4YCV A;  1VQF A;  3CC2 A;  2R7Z G;  5H1S E;  2Q2I A;  4KHP Q;  4P72 A;  5LMN L;  1EOV A;  2WP8 J;  1GVP A;  2EXD A;  3CCU A;  2UUC Q;  3I4N G;  2CWA A;  1BBU A;  4X65 Q;  3GTJ H;  2KBN A;  1S72 A;  4JI4 Q;  3TS2 A;  4BXX H;  1MKH A;  3ULJ A;  4BY7 H;  4JBW A;  1DGS A;  3NEM A;  4GLV B;  4GN4 B;  4PG3 A;  4DK6 C;  1IBM L;  2E2I H;  3M7N A;  5C4X G;  4QY7 A;  1JJG A;  4GN5 A;  4TVA B;  1Q86 C;  3UDX A;  1HJP A;  5IP9 H;  3PIO A;  1IBM Q;  4C2M H;  2A8V A;  3HOZ G;  4GOP C;  3CAM A;  1K0R A;  3PO2 H;  1MJC A;  1KAW A;  1YBY A;  4OXP A;  1YIT A;  1RL2 A;  2JA7 G;  1T9H A;  4P71 A;  3RR5 A;  4BBS H;  3PF5 A;  3M4P A;  3UDF A;  5M5W H;  3L2P A;  2HIX A;  2I0Q A;  4A3J G;  3A0J A;  1JJ2 A;  2VNU D;  1ASZ A;  2NVX H;  4WJ3 M;  2LXK A;  4A93 H;  3CCL A;  2E5L L;  3H3V I;  2K5V A;  3J81 j;  4XTC S;  1SR3 A;  3T1H L;  1A62 A;  4LWC A;  1SMX A;  4NB3 A;  4HJA A;  1A0I A;  4DR2 L;  2E5L Q;  4B3R Q;  4GNX C;  1B70 B;  4YWK A;  3T1H Q;  3ZJY C;  1CKO A;  4DR6 L;  5C3E H;  1QZG A;  1L1O C;  1TXY A;  1OXV A;  4LF5 L;  4OWW B;  4DKA C;  4DR2 Q;  1C7Y A;  4GOP A;  3ICE A;  3GTG H;  1Q1B A;  4APV A;  4YY3 L;  3F2B A;  4LFB L;  1PVO A;  4GKK L;  2IT1 A;  2QA4 A;  3PO3 G;  2N8N A;  4IPD A;  4DR6 Q;  3F2D A;  2N78 A;  4LF5 Q;  4JI8 L;  1HH2 P;  5BR8 Q;  1Q46 A;  4YY3 Q;  2AHO B;  3S17 H;  4LFB Q;  4LW1 A;  4B3M L;  3HOX G;  2JA6 H;  4GKK Q;  5FJ8 H;  4A3D G;  2NZO A;  2IHF A;  1XMQ L;  1C0A A;  4GLA C;  1PYS B;  3PSI A;  1G29 1;  4JI8 Q;  2ZTD A;  3A5U A;  4A3M H;  5IYD H;  2OCE A;  1Q1E A;  3KDF B;  1IBK L;  2PMZ E;  4B3M Q;  3H0G G;  2Q2T A;  1XMQ Q;  1K83 H;  4OWT B;  4X6A H;  2JJQ A;  1IBK Q;  4GNX A;  3I2Z A;  2GVA A;  4FDB A;  3DM3 A;  5ELN A;  1TWC H;  3S1N H;  1L1O A;  4LUV A;  2K52 A;  3STB C;  2ZM6 Q;  3H15 A;  4JI1 L;  1V43 A;  4P73 A;  3I4M G;  1PH9 A;  3F1Z A;  2MFI A;  3AFP A;  4AYB G;  4A3G G;  3SGI A;  3FKI H;  2V1C C;  1E7Z A;  5IYB H;  3CCR A;  3RZO H;  3GTL H;  1HZB A;  4JI1 Q;  2YTY A;  2NZH A;  2R7Z H;  4B3T L;  2R92 G;  1YHA A;  1X9N A;  3RN5 A;  3HOU H;  4A3F H;  2NVY H;  2RF4 A;  2XTI A;  4BBR G;  1NBW A;  2UU9 L;  4BY1 G;  3KDF A;  1EIY B;  1J6Q A;  4B3T Q;  3W5O A;  2XGT A;  3H3V H;  1WCM H;  5LMU L;  4RG1 A;  1D8L A;  4OWX B;  1UWV A;  2JA5 G;  2UU9 Q;  5C0X G;  4A3C H;  3J7A 5;  2MQH A;  5JEA G;  1WI5 A;  3U4Z A;  3L7Z C;  3BZK A;  3CQZ H;  5LMU Q;  2VS1 A;  2YU9 H;  4JI3 L;  1K9M C;  3RLF A;  1Y1W G;  1FVI A;  3TQY A;  1N9W A;  1PH3 A;  3G71 A;  4HIM A;  1Z47 A;  2ZTC A;  3HKZ E;  3I56 A;  4UP7 A;  4H02 A;  1XMO L;  2VUM G;  4JI3 Q;  1XNR L;  2YYZ A;  4JCV E;  3CD6 A;  5GAG C;  5GAD C;  1PH1 A;  1KQS A;  4X62 L;  2F3I A;  3AQQ A;  2WB1 E;  3LGJ A;  1AE2 A;  2WFW A;  2R93 G;  4AH6 A;  5C0X I;  1XMO Q;  1XNR Q;  1PH4 A;  3WWV A;  4IOC A;  4A3L H;  1KRS A;  1YNX A;  1X55 A;  4C3H H;  1JE5 A;  3S1R H;  5JJK A;  3TRZ A;  4GS3 A;  4QIW E;  3ULP A;  3L0O A;  1FGU A;  3NEN A;  4A3E H;  2ZJQ A;  3KJO A;  1CUK A;  2YV5 A;  4HID A;  2PQA A;  1G51 A;  2MO0 A;  1CSQ A;  3PO3 H;  1GO3 E;  3E9I A;  4DV4 L;  2WAQ G;  2JEA I;  1E24 A;  1P8L A;  2KHJ A;  4JI4 L;  1QVF A;  1JMC A;  1JJC B;  1I5F A;  3I4O A;  1HZ9 A;  4DV4 Q;  1VQE A;  1VS0 A;  1LM0 A;  5IYC G;  5M3M G;  1TWA H;  4R1J A;  4ME3 A;  4B3S L;  4X66 L;  3M4O H;  2JA9 A;  3IRB A;  4JBJ A;  5IP7 H;  3CPF A;  3EN2 A;  3GD7 A;  3I55 A;  1BVS A;  3G48 A;  2CWP A;  4GOP B;  4B3S Q;  3Q8D A;  4X66 Q;  1BBW A;  2KCT A;  1ASY A;  1YVC A;  4PMW A;  3J7Z C;  2Y0S E;  4MNO A;  3HOY G;  2BA0 A;  3G6E A;  3KF8 B;  2JQO A;  4DV1 L;  1VQ8 A;  4A3I G;  2K4K A;  3TS0 A;  1M90 C;  3KF6 B;  3JAM c;  3UE1 A;  1VQJ A;  4R4I A;  1UE6 A;  2ALY B;  5IY0 A;  4POG A;  4DV1 Q;  2HHH L;  4NPS A;  1YEZ A;  2FXQ A;  3PUW A;  4B3R L;  2UXD L;  2UXC L;  2QEX A;  2OTL A;  4NXN L;  1VQD A;  1EWI A;  2HQL A;  3A5Z B;  4BY1 H;  2HHH Q;  1Y1V H;  1IBL L;  2JA8 H;  2JK8 A;  3HOW G;  1HNX L;  3F8T A;  4ALP A;  1QVC A;  1X6O A;  4R4C A;  4DAM A;  3CCV A;  4GNX B;  4NXN Q;  1Q81 C;  2UXC Q;  2NN6 G;  3M4Q A;  1PYB A;  1L1O B;  3RNU A;  1VQM A;  4JBM A;  4YCW A;  1IBL Q;  1IL2 A;  1G6P A;  4C3I H;  5M3F G;  1QVG A;  1HNX Q;  4O2D A;  4LF6 Q;  5BR8 L;  2OTJ A;  1J5E L;  2HIV A;  2Z6K C;  4A3K G;  3ER0 A;  4AYB E;  1Y1W H;  1EQQ A;  2EIF A;  3PF4 A;  3KF6 A;  2AWN A;  1J5E Q;  3CF5 A;  2L15 A;  1S3O A;  1Q82 C;  4IFD G;  4QJF A;  1XPU A;  4P74 A;  1R9T H;  5C4J H;  2PNH A;  1YI2 A;  1E1O A;  4A3B G;  1VQC A;  2ZM6 L;  3CPW A;  3HOV H;  2JE6 I;  2LSS A;  5ELO A;  3GTQ H;  1Z9F A;  5C44 G;  2K14 A;  3J81 i;  3BZC A;  1EIF A;  4JYA L;  1B8A A;  3W1G A;  1OXS C;  1MJE A;  4IPH A;  4IO9 A;  3PUX A;  5HGQ A;  3OTO L;  1OXX K;  2VL6 A;  1KHI A;  1K73 C;  1I94 L;  3BU2 A;  1WOC A;  1HR0 W;  1C9O A;  2VY3 A;  4JYA Q;  3ERS X;  4IFD I;  1XNQ L;  1A8V A;  2RHS B;  5FLM H;  3PIP A;  3OTO Q;  1K3R A;  4L5Q A;  4DAY B;  4DNI A;  5M5X H;  1H95 A;  1PFS A;  3A74 A;  1I94 Q;  2R7D A;  4O0A A;  4JI7 L;  2IY5 B;  2D0P A;  3I7F A;  1IZ6 A;  3DLL A;  1XNQ Q;  1L2F A;  2K5H A;  3KJP A;  3GO5 A;  4JOI C;  4GLX A;  4BXX G;  4PZ7 A;  3J80 c;  4DR5 L;  3I4N H;  1EYG A;  4JI7 Q;  3EIV A;  4LUO A;  3BJU A;  3JAM i;  3RLN A;  2YTV A;  1YHB A;  4DR5 Q;  5C4X H;  5IP9 G;  1QZH A;  1LYL A;  2VQE L;  5J3B A;  1PH7 A;  3PO2 G;  2F52 A;  1N34 Q;  1A63 A;  3HOZ H;  1CKM A;  3EBE A;  5HY6 A;  2N3S A;  2PQA B;  2VQE Q;  2ZJP A;  2E2H H;  2JA7 H;  1SE8 A;  3HKS A;  3CCQ A;  1QUQ B;  4LF7 L;  3M3Y H;  1CKN B;  3T1Y L;  5IT9 c;  3M85 A;  3ULL A;  4A3J H;  4A93 G;  3K0X A;  4LUZ A;  1MIU A;  1VQL A;  1UE1 A;  5EAY A;  3CME A;  3RZD H;  2K5N A;  4LF7 Q;  4JOI A;  1GM5 A;  3T1Y Q;  1N36 L;  1I6H H;  3M9B A;  4NXM L;  3AFQ A;  2PI2 A;  1B7Y B;  4UP9 A;  5FLX c;  1UE7 A;  1KXL A;  2YTX A;  4JI0 L;  3KLW A;  1TWH H;  1VQI A;  1PH5 A;  1N36 Q;  4A76 A;  2MO1 A;  2RCN A;  5C3E G;  1V9P A;  4NXM Q;  3G4S A;  3CC7 A;  4JI0 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...