1FJGQ

Structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotics streptomycin, spectinomycin, and paromomycin
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Functional insights from the structure of the 30S ribosomal subunit and its interactions with antibiotics
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 21
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2000-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1fjgQ00
4RMFA 1Y1VH 1HZAA 4JI1L 1M1KC 4LF6L 1Q1EA 3EN2A 1VQJA 3I2ZA 1GM5A 4L5RC 2PI2E 1YJNA 1R9TH 1FGUA 2CQOA 2A1AA 3G6EA 3CCMA 3GTLH 3S17H 2VNUD 4HIDA 1PH9A 2ZJQA 4UP7A 1VQNA 2K5VA 3CQZH 4DV7L 4YY3Q 4A3MG 5C4JH 2VUMH 5JJKA 3BJUA 1KRSA 1KIXA 4OO1I 3ULJA 1YZ6A 3CCRA 4OONA 1IBKL 1PVOA 3GTOH 4GN5A 1XMQQ 3PUWA 2OQ0A 2BH8A 1MJEA 1UEBA 5IWAL 3PIPA 3L0OA 4LF4Q 1WFQA 5C0XJ 5BR8L 4A75A 2ATWA 3I4MH 4A3GG 4A93G 4LFAL 3U4ZA 1CKNB 3CPWA 4TVAB 1PH3A 3J7A5 4GN3B 4A3CH 5JEAJ 4B3ML 2R92H 3WWVA 3FKIH 5LMNW 2YTVA 2UU9L 1XMOQ 4LFBL 3KF6B 4LW1A 1NY4A 4JI7Q 4DNIA 1HR0Q 1EUJA 2LXJA 2R6GA 1NTGA 3FHWA 3E9HA 1M90C 1SFOH 1IL2A 3K81C 1N36L 3S1RH 3PUVA 1L0WA 3HOVG 1J6QA 3ULLA 2Y0SE 2WAQE 5IP7H 4APVA 2Z6KC 5GAHC 5AJ3L 4GKJQ 4GKKL 2Z6KA 4DV4Q 1KC8C 1N32Q 1Q46A 1YHQA 4X6AH 3PF5A 1O7IA 3KYHC 1GKHA 4JV5Q 2YTXA 4O2DA 5M3MG 2R7ZG 3HOXH 3K8AA 2N78A 3GTQH 3K7AH 2N49A 3M4QA 1XNRQ 1VQFA 4X64L 1PH8A 5IY0A 5M3FG 4BXXH 3ULPA 4B3TQ 3IRBA 4L5QA 4MNOA 4R4OA 3STBC 1KL9A 4P71A 3G48A 4DUZL 3GTJH 3HOUH 3J81j 2AMCB 1N8RC 2GVAA 1E1OA 4A4IA 4JI2L 1JJCB 4TQUS 1G51A 3M4OH 4DR7L 3PO3H 3HKZG 1NE3A 3NEMA 4AYBE 3G4SA 4JYAL 2A19A 4GNXA 3OTOQ 4YWLA 1VQIA 3M7NA 3CCVA 4QJFA 1Q86C 2B63G 3I4OA 3D0FA 2ZTDA 4GS3A 1HZBA 3LGJA 1MIUA 1Y14B 3CPFA 5C0XI 4AQYQ 2F3IA 1JB7A 4DR5Q 4BA1I 2NN6G 2IX1A 4BY1H 3FP9A 1TWHH 1B7YB 2KHJA 1CKOA 2H5XA 4JOIC 1EQRA 4LF9Q 3ICEA 4A3LG 4R1JA 2EXDA 2K5HA 2D62A 4BBRH 3GTGH 3PO2H 1EIFA 5C44G 3JAMc 3CMEA 1X55A 2Q2TA 1E7ZA 2R93G 4YCWA 1YIJA 4B3SQ 2K52A 4X66L 1TWFH 1FJGQ 1TWAH 1A0IA 2E2IH 1VQAA 2LSSA 3T1YL 1OXVA 3F2BA 3W5OA 3PIOA 1JE5A 1GVPA 3HKSA 4YCUA 1VQ6A 4JI5L 1J5EQ 1I3QH 3J80c 3M3YH 1PH2A 2JE6I 1PH1A 3SGIA 4C3IH 4UP9A 2NZHA 1VQ7A 1PYSB 1HNXQ 2VL6A 1VQEA 4GN4B 4DV2Q 3AYHB 2ID0A 4A3FH 3I56A 2CCZA 4DV5Q 2FXQA 2AWNA 2KENA 5IYBG 3CMAA 2VW9A 5JJIA 1UE6A 1D7QA 3JC66 1YHAA 4X62Q 3J80i 3S2DH 1GO3E 1N34Q 5HGQA 3HOWH 2PMZE 1IZ6A 4PG3A 1J5EL 2VZAA 4JBMA 4GOPB 1EIYB 4JI5Q 5C4XG 4JI4L 1X3FA 4PZ6A 1PFSA 1VQKA 2I5LX 2IHEA 1NBWA 5E7NA 2HHHQ 3CCLA 3TS2A 2UXDL 1S40A 1FJGL 1P8LA 4JCVE 1C7YA 1L1OC 2KCTA 3CP0A 4DR6Q 2KHIA 2JEAI 2RF4A 2A8VA 3K0XA 4WJ3M 3A0JA 3MEFA 5LMNQ 1NMFA 3W1GA 1JJGA 3U4VA 2YV5A 2VY3A 4XIGS 4GKKQ 1P16A 4DV0L 5LMUL 1CKMA 1PH6A 1OXTA 4DV2L 3H3VI 1KHIA 5IYCH 4GKJL 1W2BA 1HNXL 3H15A 4LF7Q 3AQQA 5M5WH 3PGZA 4BY7H 2UUCQ 2JA7H 3CD6A 3I4NH 4L5SA 1K0RA 3RN2A 4A3EG 2UUCL 4Y52H 2MNAA 5JJLA 4LF7L 2CWPA 2MQHA 1N33Q 1ASYA 2JA5G 4NB3A 3STBD 2AHOB 4JI7L 4DAMA 4A3KH 1Q82C 5FLXc 2RCNA 1BBUA 1SN8A 4DV1L 4OWTB 2UU9Q 1B70B 3K7UC 1YHBA 1EFWA 5LMNL 3HOZG 4JYAQ 2HIVA 1HJPA 1SR3A 4DUYL 3L7ZC 5IE8A 4PMWA 1Y1VG 2IHFA 3NELA 4L5TA 4JI3L 4LF4L 4YWKA 4LNQA 4DUZQ 4LUOA 2UXDQ 4ALPA 4B3RQ 3HKZE 1VQDA 2Q2HA 5GROA 2HT1A 3GDEA 2D0OA 1VQ4A 1L2FA 1K8AC 2VUMG 4QQBX 2OQKA 4OXPA 1FVIA 4JI3Q 1IBLQ 3GD7A 3NBHB 3G71A 1XNQQ 1G291 1K3RA 3BZKA 2LXKA 4PZ8A 3A74A 4NPSA 4QGUA 3J7ZC 1LYLA 1QUQB 3PUYA 4RG1A 4DK3C 4DV5L 1H95A 4EQ5A 1YBYA 4DR7Q 1KD1C 4P73A 4A3CG 1IBLL 1XNQL 3AFPA 4JI2Q 4IO9A 4AIMA 2BH2A 2ZJPA 4HJ9A 5IYDH 3H3VH 1Y1WG 1Q81C 4DR3L 4HIKA 2JA6G 5LMUQ 3PV0A 1XPRA 1SRUA 3W1BA 4X64Q 4UP8A 2XGTA 4GOPC 1PH7A 3UDFA 1E1TA 3ZJYC 1XPUA 5IP9H 3HOVH 1X65A 2WFWA 4X66Q 3TQYA 4BBSG 4B3RL 2K75A 1MKHA 3NENA 4JI6L 2ZM6L 1RIPA 1LUZA 4DPGA 5FLMG 4Y7NH 3H0GH 4LF9L 1E24A 1OTCA 2CKZB 2E2HH 1EQQA 4GNXC 4A3JG 3KDFB 1I6HH 1AE2A 1KQSA 5M3MH 4XTCS 5AJ3Q 3E9IA 4JI4Q 4DV6L 4DR5L 3K80C 1N33L 3AEVA 3KFUA 5J3BA 3GO5A 4HJ7A 3CCUA 2GN5A 1U0LA 4JBKA 4IOAA 3PUXA 2AWOA 2QGQA 5M3FH 3OW2A 4X62L 2JQOA 4KI0A 4QL5A 4KHZA 5H1SE 4A3DH 3CCSA 4BA2I 5EAYA 3OTOL 2OCEA 4A93H 4OWXB 4P75A 4OX9L 2VS1A 1Q12A 5GQOA 3HOYG 3FKIG 3RLOA 1PA6A 4DR6L 1BBWA 4MZ9A 1L1OB 1YI2A 3S1MH 1CKNA 4EX5A 1UE7A 1NJIC 1DGSA 3PF4A 4A3BH 2F52A 1IBKQ 2PQAA 2KCMA 4IPDA 1BVSA 4IFDG 2JA8G 1YJWA 2C35B 3HFZB 1N34L 4B3SL 1KXLA 3T1HL 1VQ9A 1HR0W 1CUKA 1TWCH 4DUYQ 4JI0Q 3D31A 1UE5A 4MTNA 4HIOA 4BBRG 4IOCA 5ELNA 4DV1Q 1VQLA 4A3IH 1QVGA 3M9BA 5GADC 3HOXG 2NVXH 3RN5A 2DUDA 4A3MH 1VQ5A 4NXML 3KJOA 3S2HH 1VQBA 1N36Q 2IY5B 2ZTEA 4GLAC 4LF8Q 3Q8DA 3S1QH 2HIXA 2WB1G 4DKAC 1Q8KA 3KJPA 4DV0Q 4LFBQ 3HOUG 4GOPA 3AFQA 3I55A 4JBJA 4AYBG 2UUBL 2EIFA 4B3MQ 4ME3A 3CC7A 1PHJA 2R92G 1HZ9A 3UDXA 4YHHL 2YYZA 3JAMi 3PCOB 4DR2L 1WJJA 1FL0A 1HZCA 4DK6C 1XMQL 1WCMH 3DLLA 1JJ2A 1B8AA 5C3EH 4QY7A 3UDIA 5FJ8G 1ASZA 2HHHL 2B63H 2BA0A 3B6YA 1V1QA 3RLNA 3RZDH 4R4IA 1XNRL 2F4VQ 2I5MX 4WJ4A 4AQYL 4C2MH 1QVFA 1VQCA 4BY1G 3UE0A 3S14H 4K0KL 3CCJA 1K9MC 1IXRA 1XTDA 4YCVA 4UY8C 4A3LH 1KAWA 3E0EA 4HJ8A 1IYJB 2R93H 4JI1Q 1LM0A 2NVYH 2MFIA 4LWCA 4AH6A 3UDGA 4LF6Q 2R7ZH 1C0AA 1VCIA 3TS0A 1IBMQ 3F8TA 4P74A 3TREA 1YNXA 3BZCA 1YEZA 2NN6I 1VQPA 2GVBA 4IPCA 2B3GA 2D0PA 2L15A 4BXXG 1HNWL 4LUZA 1A62A 4DV3Q 5IYCG 2E5LL 3I4NG 1XMOL 3T1YQ 4A3GH 1S3OA 3I4MG 4GNXB 1EWIA 4JI8L 2ALYB 1QZGA 3PO3G 2JA5H 3RR5A 1I94Q 2E2JH 4IFDJ 2PI2A 1G6PA 4A3FG 1A8VA 4LFAQ 1Q7YC 3L2PA 4IJLA 1YVCA 4GLVB 5IYBH 1V9PA 2IT1A 3CC2A 3RZOH 1X54A 1I5FA 5HY6A 4JI8Q 4DAYB 1JMCA 2RHSB 2VQFQ 3A5ZB 4NXNQ 4YY3L 5IP7G 5ELOA 3PUZA 4GLXA 4IJHA 3CAMA 3TEHB 1HR0L 1HH2P 3M85A 1Z9FA 1HNZQ 1VQMA 2VQEQ 4POFA 4LF5Q 1A63A 4LF5L 4DR4Q 2B29A 2VQEL 1X6OA 4H02A 2R7FA 2WP8J 1AE3A 1Q1BA 1SE8A 1SMXA 1YITA 4R4TA 4FDBA 3RNUA 4LFCL 4R4CA 3ER0A 2ZJRA 1X3GA 4B3TL 2Y0SG 4OWWB 1GD7A 1D8LA 2I5HA 2WB1E 2K14A 1LTLA 1C9OA 2JEBI 1SLJA 2UXCQ 3KDFA 4PZ7A 5GAEC 2KBNA 3CW2C 4DV7Q 1Y1WH 2OTLA 3S1NH 1KRTA 2OWOA 3TRZA 4HJ5A 1PH4A 4P72A 5DLQE 2HQLA 2NZOA 4YWMA 4YHHQ 2QEXA 4DR2Q 1PV4A 1PH5A 1AH9A 3HOZH 5IP9G 1MJCA 1E22A 3OYYA 1U5KA 3PSIA 4JOIA 4BBSH 4JV5L 2PQAB 1I94L 4JC0A 4X65L 3VDYA 1OXUA 4DV4L 1N32L 5IT9c 2WAQG 2V1CC 1SROA 1HNZL 2UUAL 5C4XH 4IFDI 4DV3L 1CSQA 2E8GA 3KF8B 4A3JH 5K36G 4J15A 4KHPL 2K5NA 3U58A 1EYGA 3CXCA 2VQFL 1L1OA 1WI5A 4POGA 3GTMH 2EQSA 3F2CA 3CF5A 3PO2G 1PYBA 5C44H 1VQHA 4X65Q 3S15H 2QA4A 2JJQA 1NMGA 4A3DG 1CSPA 2JA9A 4JI0L 5BR8Q 1I50H 4C3JH 1OXXK 5IWAQ 2CWAA 3T1HQ 4K0KQ 2K4KA 4IPGA 3DM3A 4BY7G 2N3SA 3BU2A 3KLWA 2MO0A 3HOYH 2JA7G 2UXCL 5JEAG 2ZTCA 3ERSX 4LUVA 4A3EH 2UXBQ 2UXBL 1TXYA 2DGYA 2Z0SA 5M5YH 2PNHA 4A76A 5C0XG 3RLFA 2JA6H 3EIVA 4A3KG 1UE1A 1QZHA 4UPAA 1K83H 1V43A 3F2DA 4LFCQ 2JA8H 1Z47A 2RHQB 2NVTH 4O0AA 1IBML 4OX9Q 3KF6A 1K73C 4DR4L 2UUBQ 1S72A 1BKBA 5FLMH 4HIMA 3HOWG 3H0GG 3J81c 2OTJA 1X56A 1VQ8A 4KLKA 1JT8A 1OXSC 1TWGH 2ES2A 1EOVA 4LF8L 3M4PA 4A3IG 1YJ9A 1K8GA 1VQOA 2AKWB 4NXNL 2F4VL 2UUAQ 1W3SA 4DV6Q 3MXNB 1E3PA 1T9HA 4DR1Q 2JK8A 2MO1A 3UE1A 1QUQA 2R7DA 1X9NA 3S24A 3U50C 3GTPH 5GAGC 1XPOA 4JBWA 2Q2IA 2XTIA 3J81i 4C3HH 1VS0A 2YU9H 2BA1A 4IPHA 2K50A 1X3EA 4JG2A 3A5UA 2ZM6Q 2IX0A 2N8NA 3KOJA 3CC4A 4JI6Q 3GTKH 5M5XH 1N9WA 1QVCA 1RL2A 2CFMA 1XJVA 2I0QA 3F1ZA 4QIWE 1VQGA 3CCEA 4DR1L 2ASBA 2Q2UA 5IYDG 4A3BG 4HJAA 1WCMG 4DR3Q 4R4QA 1WYDA 5C3EG 5FJ8H 2E5LQ 4OO1G 1HNWQ 4KHPQ 3CCQA 3EBEA 1WOCA 2YTYA 2NVQH 4NXMQ 3S16H 1UWVA 3I7FA
chains in the Genus database with same CATH superfamily
3L9AX 1WTHA 4JI1L 4WORA 3TZUA 4HMIA 3K0YA 1Q1EA 3EN2A 1STEA 3A56A 1K8OA 3QIAA 1IW7D 1YJNA 1FGUA 2CQOA 2A1AA 4C3HB 5IODA 3G6EA 1PH9A 3NTKA 2VUMH 4A3MG 5JJKA 3BJUA 1KIXA 4OO1I 2G9DA 2H4OA 1T5EA 1XMQQ 2PZUA 3L0OA 5C5LA 5BR8L 4A75A 4QUCA 3I4MH 3U4ZA 1CKNB 3CPWA 4A3CH 4KTAA 5EKKA 5JEAJ 2UU9L 2O4XA 4LW1A 2EZVA 5FK9C 4DFAA 4DNIA 5FKAC 2LXJA 4A3EB 2R6GA 3E9HA 1N36L 3S1RH 1RDPD 3DWQA 3PUVA 2EY5A 5A2QE 4GKJQ 2Z6KC 1EWCA 2RA4A 4ZYSA 1GKHA 2IX3A 4XXEA 3GTPB 1JWMD 1U4LA 2A69C 2N49A 1XNRQ 1LT3D 2Z9HA 1JOOA 1GUGA 5CV4A 4BXXH 2H1EA 3IRBA 4MNOA 2D2CC 2DNCA 3VYTA 1KL9A 3GTJH 3T13A 2AMCB 4MHEA 5JVH3 3KF8A 1WTRA 1JJCB 4TQUS 3M4OH 3DXJC 4B9WA 1J8IA 3G4SA 1VMCA 2EYHA 4ODGA 1W6KA 1A15A 1VQIA 5CR3A 4YWLA 3KUPA 2P5ZX 3MZ5A 1RCVD 4QJFA 3V05A 3I4OA 2PNRC 3D0FA 2A6HC 3OMCA 1MIUA 1Y14B 4AQYQ 2F3IA 1JB7A 1RTOA 2NN6G 3EFXD 3WOEA 2KHJA 1B7YB 4RWSC 4JOIC 2RBMA 4LF9Q 4L6TB 3HOVB 2D62A 4BBRH 1I4GA 1EIFA 5C44G 4B3SQ 3I4MB 2K52A 1FJGQ 2E2IH 4MN3A 3X3NA 1OXVA 1S5ED 3BVGA 3PIOA 2I46A 2PPBC 1JE5A 4YIJA 4ZLTF 5C4JB 1YNND 1VQ7A 4A93B 3SGIA 1RKNA 5C6AA 3R93A 5FO8B 4DV5Q 3SXHA 4NP5A 1H9RA 2KENA 3MVVA 1PRTF 5JAVA 1XX8A 5HGQA 1IZ6A 4JBMA 1B50A 2CW0D 3D6WA 5IT9L 4PZ6A 2I5LX 4UHVA 2EYOA 2UXDL 1FJGL 1LT4D 1L1OC 2EYMA 2XRQD 3QOLA 2XVSA 3NQTA 4DNTB 2L9HA 2RF4A 3K0XA 3Q0AA 3X3MA 3ITPA 5ELEA 1JJGA 4G57A 4HTHA 1EY7A 1TY2A 2NVXB 4XIGS 4L8JA 4DV0L 3H3VI 1NSNS 5M5WB 5IYCH 3URYA 3M7GA 4X3KA 1K0RA 4DK0A 4A3EG 1A3TA 4LF7L 2CWPA 2MQHA 3MHBA 3STBD 4N8FA 1HUNA 4DAMA 2RCNA 4OWTB 3NTIA 1B70B 1EFWA 1MBYA 5T1IA 4JI3L 1EOTA 4YWKA 4LNQA 2K5DA 2UXDQ 4DAPA 4J8QA 1LT5D 2KHSA 2XWJB 1VQ4A 2B8GA 3NP8A 1IBLQ 4DXFA 1K3RA 4C3HG 4IURA 1VF7A 4DK3C 1HPCA 3QOJA 4A3CG 1XNQL 5JEAH 5EKLA 1X32A 2BH2A 2ZT9C 4HJ9A 3H3VH 1Y1WG 2XNAC 1U9RA 1FNVA 1LV9A 3BG3A 5LMUQ 1SRUA 2KOLA 3UDFA 3HOVH 4X66Q 5LL6X 3J80E 2DJGC 1MKHA 4NDXA 2RSNA 3TBIB 1RIPA 2ZM6L 4CJ2C 1BOSA 2CKZB 3KDFB 4BBRB 1GUNA 4XTCS 5AJ3Q 3IAYA 3AEVA 3KFUA 2GN5A 2AWOA 5M3FH 1SJED 1ZEQX 1F2ZA 3CCSA 4JW0A 1T5XD 4P75A 4OX9L 1TWGB 5GQOA 1UE7A 3PF4A 2F52A 4PNYA 1D5ZC 1O78A 5C3WA 1TS3A 3T1HL 2SEBD 1UEAB 4RKBA 3MXPA 4JI0Q 1O7YA 1SMYD 2QILA 4MTNA 5EGTA 4ZK9B 4BBRG 4IOCA 2SDFA 1SXTA 1RJTA 1QVGA 4KD4A 1G6ZA 3A7LA 4A3MH 4TSSA 3KJOA 1VQBA 3EA6A 4X3UA 4J1MA 4GLAC 3HEJA 3Q8DA 3E6ZX 2O5IC 1RD9D 5C44B 4R9WA 3SEBA 4S3SA 4DV0Q 4DF7A 2HDMA 3T16A 4GOPA 3H6MA 3GTMB 2EJFC 3GP7A 4JBJA 1B9NA 2F0SA 2EIFA 1R4PB 3CC7A 3DEPA 4YHHL 4DR2L 4FXKC 4QY7A 5FJ8G 1ASZA 3IKJA 1V1QA 3RZDH 4R4IA 3NE5B 2I5MX 2A68C 2GA4B 2WKDA 1RF2D 4FYDA 3CCJA 5KNDA 1IXRA 1IL8A 1XTDA 4A3LH 3DHQA 4IUNA 1BCPC 1KLGD 3E0EA 4ZKBB 1IYJB 1EZ6A 3SK5A 4HJ8A 2R93H 1LM0A 3MXNA 1HRJA 1LTRD 3OWEB 3F8TA 3TREA 1WTPA 1B9MA 4G7ZC 2GVBA 3BDOA 4BXXG 5IYCG 3I4NG 1LLRD 3T1YQ 4A3GH 4JI8L 3S2HB 1IHZA 3PO3G 2ZXPA 2L1BA 4PMCA 4XQQA 1Q7YC 3L2PA 2ENBA 1KAAA 5CBEE 5IYBH 2EYLA 5HY6A 3I90A 1LTGD 4Z9CB 2VQFQ 4FXDA 5IP7G 4K8IA 4K2KA 5I9PA 3CAMA 4IZ8A 1VDZA 5KYIA 1HR0L 1Z9FA 1HNZQ 1EY5A 5J1ZA 4LF5Q 1E2WA 1K83B 3R2IA 2VQEL 1YITA 1Q1BA 1SMXA 3HZXA 3J80L 4HSVA 2PW7A 3AU7A 2I5HA 2WB1E 3LX0A 2F4IA 2EVBA 2HCIA 1SLJA 2BDOA 2UXCQ 3C1FA 5E4WC 4P72A 3EVQA 5DLQE 4ZUJA 1PH5A 3OYYA 1U5KA 4BBSH 2PQAB 2CVRA 5CV7A 4CDFC 1WCMB 1SE2A 2Y0SB 4LAAA 1HNZL 5C4XH 4IFDI 2CHBD 2E8GA 2Z6BA 4KHPL 4IN3A 2K5NA 1STAA 3HOXB 1WI5A 4X3SA 3GTMH 3CF5A 1DOMA 1JOQA 1SDFA 1ZKOA 4XQJA 1VQHA 1EEID 3D4RA 1WTXA 3AMUA 1NMGA 2JA9A 5BR8Q 3SK6A 3J81E 1OXXK 3T1HQ 3BVMA 1CQFA 2K4KA 4IPGA 2N3SA 4JK1C 3TN2A 2ZTCA 3QWNA 2UXBL 1PLFA 2EJGC 2B2UC 4H44C 3RLFA 2JA6H 2X6LA 3S9WA 3EIVA 2PMZB 4UPAA 3RD4A 4LFCQ 2JA8H 2NVTH 4OX9Q 1DZ1A 1B53A 3FKIB 3HOWG 3A54A 5EBCA 3DWPA 3GQBA 4IQZA 1OXSC 1TWGH 1LABA 3NUCA 2AKWB 4KKUA 4NXNL 3BS1A 1W3SA 4DV6Q 3PMFA 1YNJC 2XIWA 3HOZB 1T9HA 3H09A 1X9NA 3J81i 2Q2IA 1B2TA 4C3HH 2F0DA 5D3DA 3C3LA 3FPPA 4CBVA 3CC4A 4QF4A 1VMPA 4IUVA 5ISRA 3GTKH 2CH4A 2RDFA 5M5XH 2I0QA 1RL2A 2K6AA 4XT3B 5I4DA 2Q2UA 1FNUA 4R4QA 2A69D 4KHPQ 4A3GB 2ICEC 3CCQA 2YTYA 2NVQH 2EYFA 2SNMA 3S16B 1BQQT 3NBIA 3I7FA 4V0BA 2HCCA 1Y1VH 1HZAA 2C9OA 4E6IA 3GTKB 2B2VA 4AYBB 1VQJA 1GM5A 1R9TH 4ZKCB 4K5VA 3CCMA 5IOCA 2VUMB 2QEJC 4A3KB 1HCZA 2K5VA 1F9SA 4DV7L 3I4NB 5C4JH 1KRSA 1JE4A 1YZ6A 3VA7A 3CCRA 4OONA 3GTOH 4KMUC 4FF3A 1MGSA 1MSHA 2BH8A 5KGUA 1UEBA 5IWAL 4DN4M 2F0TA 4A3GG 4A93G 1M8AA 4LFAL 3J7A5 2F0IA 4B3ML 3WWVA 3FKIH 3LWEA 1STBA 5LMNW 1XMOQ 1LTID 4LFBL 4BWGB 2F0EA 1QB5D 1GJXA 1HXYD 3FHWA 3K81C 3E5SA 5GAHC 3ULLA 1L0YB 2LKVA 4PQXA 2YTXA 2JA7B 5M3MG 2R7ZG 3JAML 4C3JB 3K8AA 3GTJB 2B2UA 2FMCA 3Q23A 3GTQH 3K7AH 3M4QA 3J7AF 1VQFA 2WB1B 2F0GA 3ULPA 4B3TQ 3HOUB 4P71A 3G48A 1JICA 4CDEC 4F8MA 3J81j 1PYWD 3Q24A 4A4IA 4JI2L 4GZYC 4L63B 3HKZG 1NE3A 4AYBE 2A5HA 5CV9A 3OTOQ 4GNXA 1AP0A 2B2YA 1XXGA 1K3BC 2NB0A 4GS3A 1HZBA 3S1NB 3S1RB 2B39A 4BA1I 3MAQA 1VF5C 2AUKA 2IX1A 1TWHH 3FP9A 2FMMA 1SFOB 3HS0C 2K5HA 3PO2H 3JAMc 2X69A 1E7ZA 3V96A 4X66L 1TWFH 3E3XA 1TWAH 1A0IA 5EJWA 1VQAA 4IUTA 2OT2A 3F2BA 3SVMA 3M3YH 2NBFA 1V1PB 1I3QH 3J80c 1QNKA 5DM63 1YNNC 4UP9A 2VL6A 2B2VC 3KK7A 3I56A 2CCZA 5NUCA 2AWNA 4B08A 1S5FD 1UE6A 5EKIA 3JC66 1YHAA 5ELFA 2R3ZA 3T4AC 1GO3E 1CM9A 2VZAA 1VQKA 1PFSA 2K7VA 2IHEA 2XN9C 1SMYC 3TMEA 4JCVE 4OIJA 4CHTB 1QJOA 3H91A 4QUFA 2A8VA 3A0JA 3W1GA 1K28A 1H9JA 3U4VA 1P16A 5LMUL 4IUPA 1OXTA 4GKJL 1W2BA 1HNXL 1GHKA 1JWUD 3PGZA 2UUCQ 2MNAA 5A35A 4A3KH 1Q82C 5FLXc 1TT2A 2L12A 3HOZG 2Q8IB 1SR3A 2B63B 5IE8A 4PMWA 1EYCA 1PTOC 3NELA 1V1PA 1Y1VB 1IKMA 4DUZQ 4ALPA 3HKZE 1J9OA 2X6GA 3P1HA 2F0OA 2PCFB 5GROA 3VR4A 1A6XA 1DONA 1K8AC 4A3MB 1LACA 4JI3Q 4DGZA 1XNQQ 3NBHB 3G71A 1CK1A 2KEEA 3J7ZC 4DAVA 1LYLA 4DV5L 4RAUC 4EQ5A 1H95A 3IFDA 2ZJPA 1H9MA 5E4XA 2JA6G 4HIKA 1EIGA 4IUQA 4X64Q 1C48A 4GOPC 2XGTA 1E1TA 4QIWB 4C1NI 1FD7D 1X65A 1ML0D 1EU4A 2WFWA 3QR8A 4JI6L 4FF4A 1E0BA 4C1NK 1LUZA 4DPGA 4Y7NH 2K03A 2QF7A 3H0GH 2B2YC 3TZDA 1EQQA 4GNXC 1KNEA 1I6HH 3KLSA 1KQSA 1LTSD 3E9IA 1ZYRC 4DV6L 3K80C 1N33L 5J3BA 1G8ZD 3S15B 3PUXA 4X62L 4KI0A 4QL5A 5H1SE 1TWCB 1G2TA 1PFMA 1Q3LA 3OTOL 1HQMC 4U68A 2SNSA 1UNSA 2A6ED 2VS1A 3HOYG 2E75C 3RLOA 1PA6A 2WINB 4DR6L 1BBWA 4MZ9A 1YI2A 3P20A 5C0XH 3BDLA 3C1EA 1IYVA 4IFDG 5LHY1 3OOCA 3IFTA 4OHJA 3HFZB 3NTHA 1PRTD 1C4QA 4EGVA 1UE5A 1BUVT 1RODA 4HIOA 5HURA 2E2JB 4DV1Q 4A3DB 1R9TB 1AFPA 5GADC 3HOXG 3D6CA 3RN5A 2RQXA 3OMGA 1A2UA 1D2BA 1N36Q 1UAPA 3VR3A 5IGEA 1QNUA 2WB1G 3TP7A 2IPKD 4DKAC 3VR6A 3HOUG 1PZJD 3NQIA 1ILPA 3MFYA 2NTSA 4EQNA 5JPNC 5E3FA 2UUBL 4B3MQ 4ME3A 1PHJA 2MUYA 1PTOD 2R92B 3H94A 3PCOB 3S14B 5DEHA 1FYCA 5C3EH 2B63H 3KBGA 3ND8A 4KJNA 2F03A 1GHJA 1BF4A 4O1NA 1D6EC 4KK7A 3UE0A 3F2UA 1BDOA 1K9MC 1U4MA 2HDLA 1KAWA 4HEDA 2B2TC 2NVYH 4LWCA 1TR5A 2OF1A 2Z4IA 2L5TA 3BZCA 5FO7B 1B4OA 2AQ3B 3OPOA 2Q8TA 2B3GA 1A62A 2WIIB 1HTLD 1Y8NB 3I4MG 3Q22A 2L4NA 3RR5A 1I94Q 1TVXA 3MC0B 2PI2A 4GLVB 1D5MC 3J7YW 1V9PA 3CC2A 5KEEA 3RZOH 1X54A 5C4HA 1I5FA 1Y69U 2KVMA 3K59A 3A5ZB 4YY3L 1F9PA 5G3LD 1BR9A 1EEFD 3TEHB 1HH2P 1ZXTA 2BE5D 2DJFC 1VQMA 3AB9A 4FNFA 3D4WA 4LF5L 4DR4Q 1EY9A 2R7FA 3C46A 2WP8J 4XYQA 2L0CA 2V4DA 4KN7C 1TWFB 3RNUA 1QG7A 4K5XA 1JB3A 1Z6HA 1W6JA 4UAIA 4OWWB 1D8LA 2JEBI 5A2QL 1SNCA 4DV7Q 1GUTA 3D3RA 2OTLA 1KRTA 2NZOA 4YHHQ 4DR2Q 1E22A 4JV5L 4OELB 1OXUA 2K1BA 2D9UA 5IT9c 4EQOA 2WAQG 1TS4A 1TKWB 4KJOA 4DK1A 4DV3L 5IT9E 1SE3A 4A3JH 4J15A 4H13C 3PO3B 2R61A 5IGCA 3U58A 3CXCA 4POGA 1EU3A 5BN5A 4XYOA 3ND9A 1PYBA 2IW3A 1WTQA 4X65Q 5E1FA 4FXGC 1CSPA 3FVQA 4JI0L 2BOSA 4C3JH 2DNEA 3DM3A 1JORA 3N6RA 1B3AA 2JA7G 3BDCA 4LUVA 5I9OA 1BCPB 4R8NA 1IYUA 1X3PA 3HKZB 4Q5VA 2Z0SA 5C0XG 2Z8LA 1ICFB 1V43A 2QDLA 1ESRA 1XWEA 2JN4A 4NMZA 3SHLA 3M4OB 2J0TD 2EE1A 4CDCC 5FLMH 1S72A 2RKSA 4C56C 3SDZA 1X56A 1VQ8A 2QDBA 3K58A 2DY7A 5J39A 1EOVA 1K8GA 3FPUB 3VR5A 1VQOA 4N8X1 2UUAQ 2YU9B 2PQEA 3MXNB 3UE1A 2F0JA 2JXMB 3IL8A 3GTPH 2CW0C 5HGTA 3GTLB 4DA2A 2JA5B 2BA1A 2F0HA 2LS01 3A5UA 4JI6Q 2A68D 1DYQA 3NPPA 3F1ZA 1E2ZA 2ASBA 4MTKA 4A3BG 1WCMG 4PV1C 3EROA 3FDTA 4LMQD 2B2WA 4XQNA 3S16H 4NXMQ 2AQ1B 4I65A 3I70A 2M2LA 4RMFA 3OIQA 1UUPA 4LF6L 4P2CB 2E74C 3CRLC 4RGTA 4EVOA 2L55A 4HIDA 4UP7A 1VQNA 3CQZH 4YY3Q 1F9QA 4BY7B 5FLXE 3ULJA 1PVOA 4GN5A 3QJYA 2TSSA 3PUWA 1MJEA 1ENCA 4LF4Q 3PIP3 5C0XJ 1Q8IA 5KIXA 1PH3A 4TVAB 4GN3B 2ZXRA 4A3JB 2YTVA 2N88A 4JI7Q 3HOWB 2RDHA 1HR0Q 1SNQA 1SFOH 2J4XA 3HOVG 1L0WA 1J6QA 2Q8RE 2Y0SE 1DJRD 2WAQE 3MFGA 4APVA 5AJ3L 2JA6B 4GKKL 2Z6KA 4DV4Q 3R8BA 1N32Q 4CGYB 4X6AH 3PF5A 3KYHC 4JV5Q 3A55A 2K28A 4O2DA 2Z1CA 1HUMA 1SNOA 2K01A 5CORA 4CKCA 3HOXH 4HAEA 1SNMA 3SK8A 2EJMA 1KNAA 2OXPA 4X64L 5IY0A 1PH8A 5M3FG 4R4OA 3HOUH 3SK4A 3LWUA 1N8RC 2GVAA 3DEOA 4DR7L 1AN8A 3PO3H 3I4LA 4H0LC 3NEMA 4JYAL 1I6VC 3KLRA 1BCPF 5M5YB 1Q86C 5EPKA 2B63G 4K8JA 2WV6D 5C0XI 4DR5Q 3J81L 1AEXA 1JC7A 1WD1A 4Q0FA 4BY1H 2H5XA 4WFN3 1SBBB 3ICEA 3VYSA 2EXDA 3GTGH 2JP1A 5CV8A 3CMEA 2Q2TA 4YCWA 4NKLA 3K5MA 1EQVA 4F88A 1I4RA 5C3XA 3W5OA 1CTMA 2VB3X 4DNRB 3HKSA 4YCUA 4K5WA 1J5EQ 1VQ6A 4CKEA 2M00A 1PH2A 2WACA 3FEWX 4IALA 1PYSB 1VQEA 4DV2Q 3WDNA 2ID0A 3AYHB 3CQZB 4A3FH 4N9TA 1TIID 2FXQA 3CMAA 1D7QA 3J80i 3S2DH 1N34Q 2PMZE 4PG3A 1I6HB 3BZDB 1J5EL 1SYEA 1EY0A 5C4XG 3CU7A 3DWAA 4JI4L 1X3FA 1ONLA 3U9SA 1WTOA 2HD3A 5E7NA 3CCLA 4N9PA 5D14A 3TS2A 1QILA 1NR2A 1P8LA 1PFNA 2KCTA 3CP0A 4DR6Q 2KHIA 2JEAI 1G2SA 1S4ZA 1NMFA 1CA5A 4RA8A 1NNXA 3WOFA 5IGDA 4G7HC 2VY3A 3GTOB 4GKKQ 4DV2L 1B3QA 1G6PA 1KHIA 5EPLA 4C2MB 4BY7H 4LF7Q 1D1IA 3I4NH 5JJLA 3RN2A 3SE0A 2UUCL 1N33Q 2JA5G 3TP5A 1I4QA 2RVLA 2PO4A 1BBUA 4DV1L 3K7UC 1YHBA 4JYAQ 1B44D 5LMNL 4KD3A 3T56B 2HIVA 3G7LA 4DUYL 3L7ZC 5IGBA 3M4YA 1STYA 4LF4L 4B3RQ 4RGMA 3P7JA 5K36H 1VQDA 4WJWA 3LNNA 2HT1A 2D0OA 1L2FA 2VUMG 4QQBX 1U4PA 2OQKA 4OXPA 1FVIA 4K6DA 4B9XA 3GD7A 4PZ8A 5BN3A 1PDQA 3OSOA 3BYYB 3A74A 4QGUA 1D5XC 1QUQB 3PUYA 4RG1A 4C3JG 1YBYA 1I3QB 1I4HA 4P73A 4JI2Q 3MA2B 2E2HB 1HFGA 2IL8A 4FP5D 4TKOB 4C3IB 2XSCA 3W1BA 4UP8A 3VYUA 1PH7A 2KCNA 1XPUA 3GTGB 4B3RL 4BBSG 3TQYA 4RCOA 5FLMG 1M4VA 2CH4W 2F0VA 4CJ1B 4LF9L 1OTCA 2E2HH 4BBSB 2NVTB 1SNPA 1HHVA 1Y1WB 3I73A 4X3TA 1SEBD 4JI4Q 4DR5L 2VB2X 4JBKA 5EBDA 2HQEA 2QGQA 2JQOA 1STGA 4KHZA 4A3DH 5EAYA 4KV6A 4A93H 5KNBA 2B2TA 1Q12A 3FKIG 1HFNA 4ZAIA 3S1MH 4EX5A 1NJIC 1DGSA 4A3BH 4Y7NB 4ZCKA 1IBKQ 2PQAA 1BVSA 5D3IB 4QB4A 2JA8G 1YJWA 5CC4A 2C35B 1VQ9A 1PMRA 1HR0W 1CUKA 4DUYQ 2F0QA 4K6LA 3H3VC 5ELNA 5CBAE 1K0SA 1VQ5A 1FR3A 2M9VA 2IY5B 3GV6A 3S1QH 2XWBB 2RDGA 4RCNA 1SJHD 2K04A 2MHVA 1KDCA 4LFBQ 2F0MA 3T51B 2KJXA 3AFQA 2EPBA 5FOBB 1HZ9A 5I6WA 1FNWA 4IUUA 3K6OA 3JAMi 1FL0A 4WJ3M 1XMQL 3UDIA 2HHHL 3B6YA 1XNRL 4ZRZA 4KY5A 2F4VQ 4WJ4A 1GXDC 1SYGA 1D1KA 4I7AA 5K5PA 1SAPA 1O80A 4FVMA 1VQCA 4C2MH 3OIPA 2EY2A 4J6HA 2EYJA 5CMDA 3S17B 1ET6A 4LF6Q 3UDGA 1X3QA 5EQ0A 1C0AA 1VCIA 2FINB 4HN7A 3TS0A 2BDNA 2K5QA 3MEHA 1YNXA 1A3VA 1TY0A 5CV6A 1A2TA 4IPCA 1KDAA 4FF1A 2TMPA 2D0PA 1HNWL 3I91A 2R7ZB 4LUZA 4DV3Q 4GNXB 1EWIA 1O7LA 2ALYB 5J22A 2JA5H 4RGOS 4IFDJ 3S2DB 1CFMA 5KYLA 5I6YA 2R93B 2IT1A 2IWHA 1KDBA 4DAYB 4HCEA 4NXNQ 1KABA 2N55A 1S5CD 4DAYA 3PUZA 5C3EB 4RKLA 3S1MB 5F2DA 1Z7TA 3MXUA 2VQEQ 4POFA 1WVLA 1B1ZA 1A63A 5CGKA 5M9OA 2CQAA 1X6OA 5BN4A 3K7AB 4HCSA 4R4TA 4FDBA 1CI3M 5JPMC 1PTOB 2MGSA 4B3TL 2Y0SG 1PRTB 1GD7A 4HR7B 4PMBA 2K14A 1C9OA 4ID6A 3KDFA 4PZ7A 5GAEC 2KBNA 3CW2C 1Y1WH 2O2LD 3ERQA 1PH4A 3A8IE 2QEXA 5IGGA 1CT1D 1V8QA 1PRTC 2KA7A 3HOZH 4JOIA 4JPBW 2F3VA 3W2DA 4JC0A 4X65L 3G6JB 4DV4L 1N32L 2EDGA 2V1CC 4A3BB 1CSQA 3KF8B 1AZPA 1EY8A 2D5DA 3NHHA 1NCVA 1U4RA 2A6EC 1JCKB 1L1OA 2E2DC 2VQFL 3C2PA 1EL0A 3PO2G 1DOLA 2L11A 3NWTA 4V190 4ULLA 3S1QB 5L37A 2JJQA 3GTQB 4A3DG 3EJIA 3HG9A 1I50H 4K0KQ 2CWAA 4BY7G 3KLWA 3ERSX 4A3EH 3SR1A 1EY6A 2DGYA 5FLXL 5M5YH 4A76A 4NW2A 1K83H 3F2DA 1Z47A 2RHQB 4O0AA 1IBML 1K73C 4DR4L 2UUBQ 1BKBA 4HIMA 1CZWA 3H0GG 5T1GA 2A73B 2OTJA 2F0UA 4KLKA 4OEMB 2ES2A 2A6HD 1YJ9A 2FHTA 1OO9B 2K05A 3N52A 2F4VL 3W3AA 1GOZA 1KTKA 4K14A 4DR1Q 1TS5A 3S24A 3TSSA 4M1UB 3U50C 1XPOA 1QCBD 3VYRA 4ZUIA 1Y8OB 2YU9H 4R8IA 2K50A 2ZM6Q 4JG2A 5TSSA 3KOJA 2FJ2A 2N8NA 1IW7C 1TS2A 2KUMA 5IGFA 3I3CA 2CFMA 3CCEA 4QIWE 4KHVA 1SYCA 2WAQB 4OO1G 1WYDA 3UI2A 5FJ8H 1DXMA 1FGBD 1I4PA 1JR0D 1RTNA 1R4QB 1M1KC 3I2ZA 4L5RC 2PI2E 1F2YA 1PXUA 3GTLH 2VNUD 3S17H 2FFKB 2ZJQA 1G91A 4I7ZC 4H7BA 5CV5A 2O5JC 1IBKL 2OQ0A 2QCPX 3PIPA 1HA5A 1WFQA 2ATWA 1ENFA 2KEDA 3DUZA 4U673 1TWAB 2R92H 1BNZA 3A8KE 3KF6B 1NY4A 1EUJA 1NTGA 1IL2A 1M90C 3HOYB 1GUSA 5IP7H 1KC8C 5COYA 2VXWA 1Q46A 1YHQA 1O7IA 3T53B 5M3MB 5DM73 1EYDA 1K8MA 1TU2B 2EYPA 4BS9A 2KCCA 4QMGA 1ZYRD 2N78A 5IIFA 1ILQA 1WD0A 4L5QA 3STBC 4DUZL 3OWFA 5DAUA 1E1OA 2E76C 1G51A 1ET9A 2E2IB 2A19A 2MPMA 1STHA 3M7NA 2WKCA 3CCVA 3QB3A 4CDDC 1F2MA 2JYOA 1CA6A 2PZTA 2ZTDA 3LGJA 4IFDH 3CPFA 3PIO3 4DU9A 1JQYD 4TRDA 2QW7A 1A3UA 2EOTA 1HTPA 1CKOA 3NWSA 3JAME 1EQRA 3A7AB 4A3LG 4R1JA 2OEOA 2R93G 5KNCA 1X55A 2F0KA 1YIJA 1ICWA 1AW7A 3BYTB 3I8ZA 2LSSA 1SYFA 2EY1A 5G3LF 3T1YL 3A8JE 3MXGA 2NVYB 1PZID 2K33A 1EZ8A 1GVPA 4JI5L 4XT1B 2JSOA 3K57A 3U9OA 2ICIA 2JE6I 1E2VA 4C3IH 5FO9B 1PH1A 2NZHA 1HNXQ 4GN4B 1TWHB 1KLUD 3R2TA 4ILWA 5IYBG 5JJIA 2VW9A 4X62Q 3HOWH 2F3WA 2RSOA 3O13A 1MHWC 1SYBA 4JI5Q 4GOPB 1EIYB 5LL6S 1DM0B 4O42A 1NBWA 2HHHQ 1LTBD 1S40A 1C7YA 3K5NA 4QCLA 3TP8A 1NUCA 2C5CA 4KY6A 3MEFA 5LMNQ 4OGQC 2YV5A 3NK9A 1PH6A 1CKMA 2NYZD 4F87A 5JVG3 3H15A 3AQQA 5M5WH 2JA7H 3CD6A 4L5SA 4Y52H 3K5LA 3EQLC 1ASYA 4NB3A 2AHOB 4UDUC 2SOBA 4JI7L 1DD2A 1QE6A 1SN8A 2UU9Q 4XDXA 4JVZA 1CZGA 1HJPA 2ZXOA 1Y1VG 2IHFA 4L5TA 2LMCB 2G9HD 4LUOA 2Q2HA 2JA8B 1EYAA 3GDEA 1Y8PB 1I4XA 4BY1B 1II3A 4DXGA 4CJ0B 3NSWA 3ZYYX 1G291 3BZKA 4OIKA 2LXKA 1H9KA 4NPSA 1EFID 2RCFA 1HQRD 4LK1C 1F9RA 1YNJD 3R3OA 3HRZC 1KD1C 4DR7Q 1IBLL 3AFPA 4IO9A 4AIMA 4CKBA 5IYDH 3DMUA 3RZDB 1Q81C 4DR3L 3PV0A 1XPRA 1F2LA 2F0PA 5C4XB 1AZQA 3ZJYC 5IP9H 1Q90A 3NXWA 1EY4A 2K75A 3NENA 3QG1A 3CRKC 2NWGA 1EQTA 1E24A 2I07B 4A3JG 1CQVA 4M8AA 5M5XB 1H9SB 1AE2A 3RUZA 5M3MH 1CHQD 4RHSA 3GO5A 1BXTA 4HJ7A 3CCUA 1U0LA 4IOAA 3L3OC 3OW2A 1H9SA 2NZ1D 3MTSA 4BA2I 1JWSD 2OCEA 2XRSD 4OWXB 1PTOF 4FO2A 4F7XA 2KECA 4ME5A 3VR2A 4ABNA 1L1OB 1CKNA 2AQ2B 3TP6A 3QO2A 4OO1H 1V1OA 4ZQ3A 2KCMA 4IPDA 2DN8A 4EQPA 1N34L 4B3SL 5C4ZA 1RHPA 1KXLA 1DCZA 1TWCH 3D31A 1QWYA 1NAPA 1VQLA 4A3IH 1PTOH 3M9BA 2F0LA 2NVXH 5D65A 2DUDA 3P75A 4NXML 3S2HH 3D4DA 2ZTEA 2K32A 5I2YA 4LF8Q 3HGBA 1EIHA 2G5DA 5ELDA 2HIXA 4WRDA 1WTWA 1Q8KA 3KJPA 1F77A 4C3IG 3I55A 4LJZC 1PFBA 4AYBG 1HA6A 2R92G 4RHRA 3UDXA 2YYZA 1NR4A 1WJJA 1HZCA 4DK6C 1JJ2A 1WCMH 3DLLA 3KLSX 1B8AA 2F1MA 4KKTA 5CYUA 2BA0A 3RLNA 3FMCA 3MWYW 2EXZA 1STNA 5DNFA 4KN4C 2NN6H 4AQYL 1QVFA 4BY1G 3D8GA 3S14H 4K0KL 4FF2A 1QOHA 4MIUA 4YCVA 4UY8C 3PQIA 4JI1Q 2MFIA 4AH6A 2R7ZH 3OW7A 3GV3A 1IBMQ 4HMJA 4P74A 1SNDA 1YEZA 2NN6I 1VQPA 1BBXC 2L15A 2J7ZA 2PW5A 3NBHA 2E5LL 3PO2B 2NVQB 1XMOL 1S3OA 3DM1A 1LT6D 1ESFA 1QZGA 2E2JH 5ELCA 4A3FG 1A8VA 2Z4HA 1PZKD 2MP1A 4LFAQ 4IJLA 1TQOA 1YVCA 1LO5D 4JI8Q 4A3FB 1JMCA 1MI2A 1EWHA 5ELBA 2RHSB 2BE5C 4KKSA 5ELOA 4GLXA 3M3YB 4IJHA 3M85A 2IJ0A 2LFNA 4OL7A 4G4KA 2F0NA 1XTCD 2B29A 2KQ3A 4H02A 4RH6A 1AE3A 1SE8A 3E0JA 4LFCL 1LTAD 4R4CA 5M3FB 3ER0A 2ZJRA 1X3GA 1MSGA 5EPJA 1LTLA 1O7ZA 4A3IB 3S1NH 3TRZA 2OWOA 4HJ5A 3BVZA 2HQLA 1S5BD 2NUCA 4YWMA 1PV4A 3H0GB 5I2XA 1AH9A 5IP9G 1MJCA 3PSIA 4K2LA 1I94L 3VDYA 1BO0A 1SYDA 1SROA 1L0XB 2UUAL 1IKLA 3KBXA 5K36G 2A74C 1EYGA 3V2TA 2B2WC 1MD2D 2EQSA 1SSOA 2NTTA 3F2CA 1SE4A 2AUJD 5C44H 3CKIB 1ENAA 2QKIC 3S15H 4RFBA 2QA4A 3Q6SA 4RGNA 3TDQA 5IWAQ 1GUOA 5JOBA 1WTVA 3RMHA 3BU2A 2MO0A 3HOYH 2UXCL 1DOKA 5JEAG 2UXBQ 1I50B 1LTTD 1TXYA 3I72A 2PNHA 5AFWA 4A3KG 1UE1A 1QZHA 3HP3A 3J7AV 4G7OC 3KF6A 4HSPA 1XYIA 1JOKA 3FRPB 3OHXC 3J81c 2EY6A 2F0FA 2BCOA 2B8FA 1JT8A 4LF8L 3M4PA 5C5MA 4A3IG 5KRUA 3ONAB 1S5DD 2F0WA 2PZWA 1E3PA 2JK8A 2MO1A 1QUQA 2R7DA 1BCPD 5GAGC 5JJZA 4JBWA 2XTIA 1VS0A 2LY7A 2DY8A 3CHBD 4IPHA 1X3EA 1GUWA 3RZOB 2IX0A 2MJ8A 1C8CA 1N9WA 1QVCA 2HUGA 1XJVA 4DR1L 1VQGA 3VA5A 3K5OA 4KY7A 5IYDG 4HJAA 4DR3Q 2PYKA 2K5WA 5C3EG 2E5LQ 1HNWQ 3EBEA 1WOCA 1UWVA 1CHPD
chains in the Genus database with same CATH topology
4RMFA 1Y1VH 1HZAA 4JI1L 1M1KC 4LF6L 1Q1EA 3EN2A 1VQJA 3I2ZA 1GM5A 4L5RC 2PI2E 1YJNA 1R9TH 1FGUA 2CQOA 2A1AA 3G6EA 3CCMA 3GTLH 3S17H 2VNUD 4HIDA 1PH9A 2ZJQA 4UP7A 1VQNA 2K5VA 3CQZH 4DV7L 4YY3Q 4A3MG 5C4JH 2VUMH 5JJKA 3BJUA 1KRSA 1KIXA 4OO1I 3ULJA 1YZ6A 3CCRA 4OONA 1IBKL 1PVOA 3GTOH 4GN5A 1XMQQ 3PUWA 2OQ0A 2BH8A 1MJEA 1UEBA 5IWAL 3PIPA 3L0OA 4LF4Q 1WFQA 5C0XJ 5BR8L 4A75A 2ATWA 3I4MH 4A3GG 4A93G 4LFAL 3U4ZA 1CKNB 3CPWA 4TVAB 1PH3A 3J7A5 4GN3B 4A3CH 5JEAJ 4B3ML 2R92H 3WWVA 3FKIH 5LMNW 2YTVA 2UU9L 1XMOQ 4LFBL 3KF6B 4LW1A 1NY4A 4JI7Q 4DNIA 1HR0Q 1EUJA 2LXJA 2R6GA 1NTGA 3FHWA 3E9HA 1M90C 1SFOH 1IL2A 3K81C 1N36L 3S1RH 3PUVA 1L0WA 3HOVG 1J6QA 3ULLA 2Y0SE 2WAQE 5IP7H 4APVA 2Z6KC 5GAHC 5AJ3L 4GKJQ 4GKKL 2Z6KA 4DV4Q 1KC8C 1N32Q 1Q46A 1YHQA 4X6AH 3PF5A 1O7IA 3KYHC 1GKHA 4JV5Q 2YTXA 4O2DA 5M3MG 2R7ZG 3HOXH 3K8AA 2N78A 3GTQH 3K7AH 2N49A 3M4QA 1XNRQ 1VQFA 4X64L 1PH8A 5IY0A 5M3FG 4BXXH 3ULPA 4B3TQ 3IRBA 4L5QA 4MNOA 4R4OA 3STBC 1KL9A 4P71A 3G48A 4DUZL 3GTJH 3HOUH 3J81j 2AMCB 1N8RC 2GVAA 1E1OA 4A4IA 4JI2L 1JJCB 4TQUS 1G51A 3M4OH 4DR7L 3PO3H 3HKZG 1NE3A 3NEMA 4AYBE 3G4SA 4JYAL 2A19A 4GNXA 3OTOQ 4YWLA 1VQIA 3M7NA 3CCVA 4QJFA 1Q86C 2B63G 3I4OA 3D0FA 2ZTDA 4GS3A 1HZBA 3LGJA 1MIUA 1Y14B 3CPFA 5C0XI 4AQYQ 2F3IA 1JB7A 4DR5Q 4BA1I 2NN6G 2IX1A 4BY1H 3FP9A 1TWHH 1B7YB 2KHJA 1CKOA 2H5XA 4JOIC 1EQRA 4LF9Q 3ICEA 4A3LG 4R1JA 2EXDA 2K5HA 2D62A 4BBRH 3GTGH 3PO2H 1EIFA 5C44G 3JAMc 3CMEA 1X55A 2Q2TA 1E7ZA 2R93G 4YCWA 1YIJA 4B3SQ 2K52A 4X66L 1TWFH 1FJGQ 1TWAH 1A0IA 2E2IH 1VQAA 2LSSA 3T1YL 1OXVA 3F2BA 3W5OA 3PIOA 1JE5A 1GVPA 3HKSA 4YCUA 1VQ6A 4JI5L 1J5EQ 1I3QH 3J80c 3M3YH 1PH2A 2JE6I 1PH1A 3SGIA 4C3IH 4UP9A 2NZHA 1VQ7A 1PYSB 1HNXQ 2VL6A 1VQEA 4GN4B 4DV2Q 3AYHB 2ID0A 4A3FH 3I56A 2CCZA 4DV5Q 2FXQA 2AWNA 2KENA 5IYBG 3CMAA 2VW9A 5JJIA 1UE6A 1D7QA 3JC66 1YHAA 4X62Q 3J80i 3S2DH 1GO3E 1N34Q 5HGQA 3HOWH 2PMZE 1IZ6A 4PG3A 1J5EL 2VZAA 4JBMA 4GOPB 1EIYB 4JI5Q 5C4XG 4JI4L 1X3FA 4PZ6A 1PFSA 1VQKA 2I5LX 2IHEA 1NBWA 5E7NA 2HHHQ 3CCLA 3TS2A 2UXDL 1S40A 1FJGL 1P8LA 4JCVE 1C7YA 1L1OC 2KCTA 3CP0A 4DR6Q 2KHIA 2JEAI 2RF4A 2A8VA 3K0XA 4WJ3M 3A0JA 3MEFA 5LMNQ 1NMFA 3W1GA 1JJGA 3U4VA 2YV5A 2VY3A 4XIGS 4GKKQ 1P16A 4DV0L 5LMUL 1CKMA 1PH6A 1OXTA 4DV2L 3H3VI 1KHIA 5IYCH 4GKJL 1W2BA 1HNXL 3H15A 4LF7Q 3AQQA 5M5WH 3PGZA 4BY7H 2UUCQ 2JA7H 3CD6A 3I4NH 4L5SA 1K0RA 3RN2A 4A3EG 2UUCL 4Y52H 2MNAA 5JJLA 4LF7L 2CWPA 2MQHA 1N33Q 1ASYA 2JA5G 4NB3A 3STBD 2AHOB 4JI7L 4DAMA 4A3KH 1Q82C 5FLXc 2RCNA 1BBUA 1SN8A 4DV1L 4OWTB 2UU9Q 1B70B 3K7UC 1YHBA 1EFWA 5LMNL 3HOZG 4JYAQ 2HIVA 1HJPA 1SR3A 4DUYL 3L7ZC 5IE8A 4PMWA 1Y1VG 2IHFA 3NELA 4L5TA 4JI3L 4LF4L 4YWKA 4LNQA 4DUZQ 4LUOA 2UXDQ 4ALPA 4B3RQ 3HKZE 1VQDA 2Q2HA 5GROA 2HT1A 3GDEA 2D0OA 1VQ4A 1L2FA 1K8AC 2VUMG 4QQBX 2OQKA 4OXPA 1FVIA 4JI3Q 1IBLQ 3GD7A 3NBHB 3G71A 1XNQQ 1G291 1K3RA 3BZKA 2LXKA 4PZ8A 3A74A 4NPSA 4QGUA 3J7ZC 1LYLA 1QUQB 3PUYA 4RG1A 4DK3C 4DV5L 1H95A 4EQ5A 1YBYA 4DR7Q 1KD1C 4P73A 4A3CG 1IBLL 1XNQL 3AFPA 4JI2Q 4IO9A 4AIMA 2BH2A 2ZJPA 4HJ9A 5IYDH 3H3VH 1Y1WG 1Q81C 4DR3L 4HIKA 2JA6G 5LMUQ 3PV0A 1XPRA 1SRUA 3W1BA 4X64Q 4UP8A 2XGTA 4GOPC 1PH7A 3UDFA 1E1TA 3ZJYC 1XPUA 5IP9H 3HOVH 1X65A 2WFWA 4X66Q 3TQYA 4BBSG 4B3RL 2K75A 1MKHA 3NENA 4JI6L 2ZM6L 1RIPA 1LUZA 4DPGA 5FLMG 4Y7NH 3H0GH 4LF9L 1E24A 1OTCA 2CKZB 2E2HH 1EQQA 4GNXC 4A3JG 3KDFB 1I6HH 1AE2A 1KQSA 5M3MH 4XTCS 5AJ3Q 3E9IA 4JI4Q 4DV6L 4DR5L 3K80C 1N33L 3AEVA 3KFUA 5J3BA 3GO5A 4HJ7A 3CCUA 2GN5A 1U0LA 4JBKA 4IOAA 3PUXA 2AWOA 2QGQA 5M3FH 3OW2A 4X62L 2JQOA 4KI0A 4QL5A 4KHZA 5H1SE 4A3DH 3CCSA 4BA2I 5EAYA 3OTOL 2OCEA 4A93H 4OWXB 4P75A 4OX9L 2VS1A 1Q12A 5GQOA 3HOYG 3FKIG 3RLOA 1PA6A 4DR6L 1BBWA 4MZ9A 1L1OB 1YI2A 3S1MH 1CKNA 4EX5A 1UE7A 1NJIC 1DGSA 3PF4A 4A3BH 2F52A 1IBKQ 2PQAA 2KCMA 4IPDA 1BVSA 4IFDG 2JA8G 1YJWA 2C35B 3HFZB 1N34L 4B3SL 1KXLA 3T1HL 1VQ9A 1HR0W 1CUKA 1TWCH 4DUYQ 4JI0Q 3D31A 1UE5A 4MTNA 4HIOA 4BBRG 4IOCA 5ELNA 4DV1Q 1VQLA 4A3IH 1QVGA 3M9BA 5GADC 3HOXG 2NVXH 3RN5A 2DUDA 4A3MH 1VQ5A 4NXML 3KJOA 3S2HH 1VQBA 1N36Q 2IY5B 2ZTEA 4GLAC 4LF8Q 3Q8DA 3S1QH 2HIXA 2WB1G 4DKAC 1Q8KA 3KJPA 4DV0Q 4LFBQ 3HOUG 4GOPA 3AFQA 3I55A 4JBJA 4AYBG 2UUBL 2EIFA 4B3MQ 4ME3A 3CC7A 1PHJA 2R92G 1HZ9A 3UDXA 4YHHL 2YYZA 3JAMi 3PCOB 4DR2L 1WJJA 1FL0A 1HZCA 4DK6C 1XMQL 1WCMH 3DLLA 1JJ2A 1B8AA 5C3EH 4QY7A 3UDIA 5FJ8G 1ASZA 2HHHL 2B63H 2BA0A 3B6YA 1V1QA 3RLNA 3RZDH 4R4IA 1XNRL 2F4VQ 2I5MX 4WJ4A 4AQYL 4C2MH 1QVFA 1VQCA 4BY1G 3UE0A 3S14H 4K0KL 3CCJA 1K9MC 1IXRA 1XTDA 4YCVA 4UY8C 4A3LH 1KAWA 3E0EA 4HJ8A 1IYJB 2R93H 4JI1Q 1LM0A 2NVYH 2MFIA 4LWCA 4AH6A 3UDGA 4LF6Q 2R7ZH 1C0AA 1VCIA 3TS0A 1IBMQ 3F8TA 4P74A 3TREA 1YNXA 3BZCA 1YEZA 2NN6I 1VQPA 2GVBA 4IPCA 2B3GA 2D0PA 2L15A 4BXXG 1HNWL 4LUZA 1A62A 4DV3Q 5IYCG 2E5LL 3I4NG 1XMOL 3T1YQ 4A3GH 1S3OA 3I4MG 4GNXB 1EWIA 4JI8L 2ALYB 1QZGA 3PO3G 2JA5H 3RR5A 1I94Q 2E2JH 4IFDJ 2PI2A 1G6PA 4A3FG 1A8VA 4LFAQ 1Q7YC 3L2PA 4IJLA 1YVCA 4GLVB 5IYBH 1V9PA 2IT1A 3CC2A 3RZOH 1X54A 1I5FA 5HY6A 4JI8Q 4DAYB 1JMCA 2RHSB 2VQFQ 3A5ZB 4NXNQ 4YY3L 5IP7G 5ELOA 3PUZA 4GLXA 4IJHA 3CAMA 3TEHB 1HR0L 1HH2P 3M85A 1Z9FA 1HNZQ 1VQMA 2VQEQ 4POFA 4LF5Q 1A63A 4LF5L 4DR4Q 2B29A 2VQEL 1X6OA 4H02A 2R7FA 2WP8J 1AE3A 1Q1BA 1SE8A 1SMXA 1YITA 4R4TA 4FDBA 3RNUA 4LFCL 4R4CA 3ER0A 2ZJRA 1X3GA 4B3TL 2Y0SG 4OWWB 1GD7A 1D8LA 2I5HA 2WB1E 2K14A 1LTLA 1C9OA 2JEBI 1SLJA 2UXCQ 3KDFA 4PZ7A 5GAEC 2KBNA 3CW2C 4DV7Q 1Y1WH 2OTLA 3S1NH 1KRTA 2OWOA 3TRZA 4HJ5A 1PH4A 4P72A 5DLQE 2HQLA 2NZOA 4YWMA 4YHHQ 2QEXA 4DR2Q 1PV4A 1PH5A 1AH9A 3HOZH 5IP9G 1MJCA 1E22A 3OYYA 1U5KA 3PSIA 4JOIA 4BBSH 4JV5L 2PQAB 1I94L 4JC0A 4X65L 3VDYA 1OXUA 4DV4L 1N32L 5IT9c 2WAQG 2V1CC 1SROA 1HNZL 2UUAL 5C4XH 4IFDI 4DV3L 1CSQA 2E8GA 3KF8B 4A3JH 5K36G 4J15A 4KHPL 2K5NA 3U58A 1EYGA 3CXCA 2VQFL 1L1OA 1WI5A 4POGA 3GTMH 2EQSA 3F2CA 3CF5A 3PO2G 1PYBA 5C44H 1VQHA 4X65Q 3S15H 2QA4A 2JJQA 1NMGA 4A3DG 1CSPA 2JA9A 4JI0L 5BR8Q 1I50H 4C3JH 1OXXK 5IWAQ 2CWAA 3T1HQ 4K0KQ 2K4KA 4IPGA 3DM3A 4BY7G 2N3SA 3BU2A 3KLWA 2MO0A 3HOYH 2JA7G 2UXCL 5JEAG 2ZTCA 3ERSX 4LUVA 4A3EH 2UXBQ 2UXBL 1TXYA 2DGYA 2Z0SA 5M5YH 2PNHA 4A76A 5C0XG 3RLFA 2JA6H 3EIVA 4A3KG 1UE1A 1QZHA 4UPAA 1K83H 1V43A 3F2DA 4LFCQ 2JA8H 1Z47A 2RHQB 2NVTH 4O0AA 1IBML 4OX9Q 3KF6A 1K73C 4DR4L 2UUBQ 1S72A 1BKBA 5FLMH 4HIMA 3HOWG 3H0GG 3J81c 2OTJA 1X56A 1VQ8A 4KLKA 1JT8A 1OXSC 1TWGH 2ES2A 1EOVA 4LF8L 3M4PA 4A3IG 1YJ9A 1K8GA 1VQOA 2AKWB 4NXNL 2F4VL 2UUAQ 1W3SA 4DV6Q 3MXNB 1E3PA 1T9HA 4DR1Q 2JK8A 2MO1A 3UE1A 1QUQA 2R7DA 1X9NA 3S24A 3U50C 3GTPH 5GAGC 1XPOA 4JBWA 2Q2IA 2XTIA 3J81i 4C3HH 1VS0A 2YU9H 2BA1A 4IPHA 2K50A 1X3EA 4JG2A 3A5UA 2ZM6Q 2IX0A 2N8NA 3KOJA 3CC4A 4JI6Q 3GTKH 5M5XH 1N9WA 1QVCA 1RL2A 2CFMA 1XJVA 2I0QA 3F1ZA 4QIWE 1VQGA 3CCEA 4DR1L 2ASBA 2Q2UA 5IYDG 4A3BG 4HJAA 1WCMG 4DR3Q 4R4QA 1WYDA 5C3EG 5FJ8H 2E5LQ 4OO1G 1HNWQ 4KHPQ 3CCQA 3EBEA 1WOCA 2YTYA 2NVQH 4NXMQ 3S16H 1UWVA 3I7FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RMF A;  1Y1V H;  1HZA A;  4JI1 L;  1M1K C;  4LF6 L;  1Q1E A;  3EN2 A;  1VQJ A;  3I2Z A;  1GM5 A;  4L5R C;  2PI2 E;  1YJN A;  1R9T H;  1FGU A;  2CQO A;  2A1A A;  3G6E A;  3CCM A;  3GTL H;  3S17 H;  2VNU D;  4HID A;  1PH9 A;  2ZJQ A;  4UP7 A;  1VQN A;  2K5V A;  3CQZ H;  4DV7 L;  4YY3 Q;  4A3M G;  5C4J H;  2VUM H;  5JJK A;  3BJU A;  1KRS A;  1KIX A;  4OO1 I;  3ULJ A;  1YZ6 A;  3CCR A;  4OON A;  1IBK L;  1PVO A;  3GTO H;  4GN5 A;  1XMQ Q;  3PUW A;  2OQ0 A;  2BH8 A;  1MJE A;  1UEB A;  5IWA L;  3PIP A;  3L0O A;  4LF4 Q;  1WFQ A;  5C0X J;  5BR8 L;  4A75 A;  2ATW A;  3I4M H;  4A3G G;  4A93 G;  4LFA L;  3U4Z A;  1CKN B;  3CPW A;  4TVA B;  1PH3 A;  3J7A 5;  4GN3 B;  4A3C H;  5JEA J;  4B3M L;  2R92 H;  3WWV A;  3FKI H;  5LMN W;  2YTV A;  2UU9 L;  1XMO Q;  4LFB L;  3KF6 B;  4LW1 A;  1NY4 A;  4JI7 Q;  4DNI A;  1HR0 Q;  1EUJ A;  2LXJ A;  2R6G A;  1NTG A;  3FHW A;  3E9H A;  1M90 C;  1SFO H;  1IL2 A;  3K81 C;  1N36 L;  3S1R H;  3PUV A;  1L0W A;  3HOV G;  1J6Q A;  3ULL A;  2Y0S E;  2WAQ E;  5IP7 H;  4APV A;  2Z6K C;  5GAH C;  5AJ3 L;  4GKJ Q;  4GKK L;  2Z6K A;  4DV4 Q;  1KC8 C;  1N32 Q;  1Q46 A;  1YHQ A;  4X6A H;  3PF5 A;  1O7I A;  3KYH C;  1GKH A;  4JV5 Q;  2YTX A;  4O2D A;  5M3M G;  2R7Z G;  3HOX H;  3K8A A;  2N78 A;  3GTQ H;  3K7A H;  2N49 A;  3M4Q A;  1XNR Q;  1VQF A;  4X64 L;  1PH8 A;  5IY0 A;  5M3F G;  4BXX H;  3ULP A;  4B3T Q;  3IRB A;  4L5Q A;  4MNO A;  4R4O A;  3STB C;  1KL9 A;  4P71 A;  3G48 A;  4DUZ L;  3GTJ H;  3HOU H;  3J81 j;  2AMC B;  1N8R C;  2GVA A;  1E1O A;  4A4I A;  4JI2 L;  1JJC B;  4TQU S;  1G51 A;  3M4O H;  4DR7 L;  3PO3 H;  3HKZ G;  1NE3 A;  3NEM A;  4AYB E;  3G4S A;  4JYA L;  2A19 A;  4GNX A;  3OTO Q;  4YWL A;  1VQI A;  3M7N A;  3CCV A;  4QJF A;  1Q86 C;  2B63 G;  3I4O A;  3D0F A;  2ZTD A;  4GS3 A;  1HZB A;  3LGJ A;  1MIU A;  1Y14 B;  3CPF A;  5C0X I;  4AQY Q;  2F3I A;  1JB7 A;  4DR5 Q;  4BA1 I;  2NN6 G;  2IX1 A;  4BY1 H;  3FP9 A;  1TWH H;  1B7Y B;  2KHJ A;  1CKO A;  2H5X A;  4JOI C;  1EQR A;  4LF9 Q;  3ICE A;  4A3L G;  4R1J A;  2EXD A;  2K5H A;  2D62 A;  4BBR H;  3GTG H;  3PO2 H;  1EIF A;  5C44 G;  3JAM c;  3CME A;  1X55 A;  2Q2T A;  1E7Z A;  2R93 G;  4YCW A;  1YIJ A;  4B3S Q;  2K52 A;  4X66 L;  1TWF H;  1FJG Q;  1TWA H;  1A0I A;  2E2I H;  1VQA A;  2LSS A;  3T1Y L;  1OXV A;  3F2B A;  3W5O A;  3PIO A;  1JE5 A;  1GVP A;  3HKS A;  4YCU A;  1VQ6 A;  4JI5 L;  1J5E Q;  1I3Q H;  3J80 c;  3M3Y H;  1PH2 A;  2JE6 I;  1PH1 A;  3SGI A;  4C3I H;  4UP9 A;  2NZH A;  1VQ7 A;  1PYS B;  1HNX Q;  2VL6 A;  1VQE A;  4GN4 B;  4DV2 Q;  3AYH B;  2ID0 A;  4A3F H;  3I56 A;  2CCZ A;  4DV5 Q;  2FXQ A;  2AWN A;  2KEN A;  5IYB G;  3CMA A;  2VW9 A;  5JJI A;  1UE6 A;  1D7Q A;  3JC6 6;  1YHA A;  4X62 Q;  3J80 i;  3S2D H;  1GO3 E;  1N34 Q;  5HGQ A;  3HOW H;  2PMZ E;  1IZ6 A;  4PG3 A;  1J5E L;  2VZA A;  4JBM A;  4GOP B;  1EIY B;  4JI5 Q;  5C4X G;  4JI4 L;  1X3F A;  4PZ6 A;  1PFS A;  1VQK A;  2I5L X;  2IHE A;  1NBW A;  5E7N A;  2HHH Q;  3CCL A;  3TS2 A;  2UXD L;  1S40 A;  1FJG L;  1P8L A;  4JCV E;  1C7Y A;  1L1O C;  2KCT A;  3CP0 A;  4DR6 Q;  2KHI A;  2JEA I;  2RF4 A;  2A8V A;  3K0X A;  4WJ3 M;  3A0J A;  3MEF A;  5LMN Q;  1NMF A;  3W1G A;  1JJG A;  3U4V A;  2YV5 A;  2VY3 A;  4XIG S;  4GKK Q;  1P16 A;  4DV0 L;  5LMU L;  1CKM A;  1PH6 A;  1OXT A;  4DV2 L;  3H3V I;  1KHI A;  5IYC H;  4GKJ L;  1W2B A;  1HNX L;  3H15 A;  4LF7 Q;  3AQQ A;  5M5W H;  3PGZ A;  4BY7 H;  2UUC Q;  2JA7 H;  3CD6 A;  3I4N H;  4L5S A;  1K0R A;  3RN2 A;  4A3E G;  2UUC L;  4Y52 H;  2MNA A;  5JJL A;  4LF7 L;  2CWP A;  2MQH A;  1N33 Q;  1ASY A;  2JA5 G;  4NB3 A;  3STB D;  2AHO B;  4JI7 L;  4DAM A;  4A3K H;  1Q82 C;  5FLX c;  2RCN A;  1BBU A;  1SN8 A;  4DV1 L;  4OWT B;  2UU9 Q;  1B70 B;  3K7U C;  1YHB A;  1EFW A;  5LMN L;  3HOZ G;  4JYA Q;  2HIV A;  1HJP A;  1SR3 A;  4DUY L;  3L7Z C;  5IE8 A;  4PMW A;  1Y1V G;  2IHF A;  3NEL A;  4L5T A;  4JI3 L;  4LF4 L;  4YWK A;  4LNQ A;  4DUZ Q;  4LUO A;  2UXD Q;  4ALP A;  4B3R Q;  3HKZ E;  1VQD A;  2Q2H A;  5GRO A;  2HT1 A;  3GDE A;  2D0O A;  1VQ4 A;  1L2F A;  1K8A C;  2VUM G;  4QQB X;  2OQK A;  4OXP A;  1FVI A;  4JI3 Q;  1IBL Q;  3GD7 A;  3NBH B;  3G71 A;  1XNQ Q;  1G29 1;  1K3R A;  3BZK A;  2LXK A;  4PZ8 A;  3A74 A;  4NPS A;  4QGU A;  3J7Z C;  1LYL A;  1QUQ B;  3PUY A;  4RG1 A;  4DK3 C;  4DV5 L;  1H95 A;  4EQ5 A;  1YBY A;  4DR7 Q;  1KD1 C;  4P73 A;  4A3C G;  1IBL L;  1XNQ L;  3AFP A;  4JI2 Q;  4IO9 A;  4AIM A;  2BH2 A;  2ZJP A;  4HJ9 A;  5IYD H;  3H3V H;  1Y1W G;  1Q81 C;  4DR3 L;  4HIK A;  2JA6 G;  5LMU Q;  3PV0 A;  1XPR A;  1SRU A;  3W1B A;  4X64 Q;  4UP8 A;  2XGT A;  4GOP C;  1PH7 A;  3UDF A;  1E1T A;  3ZJY C;  1XPU A;  5IP9 H;  3HOV H;  1X65 A;  2WFW A;  4X66 Q;  3TQY A;  4BBS G;  4B3R L;  2K75 A;  1MKH A;  3NEN A;  4JI6 L;  2ZM6 L;  1RIP A;  1LUZ A;  4DPG A;  5FLM G;  4Y7N H;  3H0G H;  4LF9 L;  1E24 A;  1OTC A;  2CKZ B;  2E2H H;  1EQQ A;  4GNX C;  4A3J G;  3KDF B;  1I6H H;  1AE2 A;  1KQS A;  5M3M H;  4XTC S;  5AJ3 Q;  3E9I A;  4JI4 Q;  4DV6 L;  4DR5 L;  3K80 C;  1N33 L;  3AEV A;  3KFU A;  5J3B A;  3GO5 A;  4HJ7 A;  3CCU A;  2GN5 A;  1U0L A;  4JBK A;  4IOA A;  3PUX A;  2AWO A;  2QGQ A;  5M3F H;  3OW2 A;  4X62 L;  2JQO A;  4KI0 A;  4QL5 A;  4KHZ A;  5H1S E;  4A3D H;  3CCS A;  4BA2 I;  5EAY A;  3OTO L;  2OCE A;  4A93 H;  4OWX B;  4P75 A;  4OX9 L;  2VS1 A;  1Q12 A;  5GQO A;  3HOY G;  3FKI G;  3RLO A;  1PA6 A;  4DR6 L;  1BBW A;  4MZ9 A;  1L1O B;  1YI2 A;  3S1M H;  1CKN A;  4EX5 A;  1UE7 A;  1NJI C;  1DGS A;  3PF4 A;  4A3B H;  2F52 A;  1IBK Q;  2PQA A;  2KCM A;  4IPD A;  1BVS A;  4IFD G;  2JA8 G;  1YJW A;  2C35 B;  3HFZ B;  1N34 L;  4B3S L;  1KXL A;  3T1H L;  1VQ9 A;  1HR0 W;  1CUK A;  1TWC H;  4DUY Q;  4JI0 Q;  3D31 A;  1UE5 A;  4MTN A;  4HIO A;  4BBR G;  4IOC A;  5ELN A;  4DV1 Q;  1VQL A;  4A3I H;  1QVG A;  3M9B A;  5GAD C;  3HOX G;  2NVX H;  3RN5 A;  2DUD A;  4A3M H;  1VQ5 A;  4NXM L;  3KJO A;  3S2H H;  1VQB A;  1N36 Q;  2IY5 B;  2ZTE A;  4GLA C;  4LF8 Q;  3Q8D A;  3S1Q H;  2HIX A;  2WB1 G;  4DKA C;  1Q8K A;  3KJP A;  4DV0 Q;  4LFB Q;  3HOU G;  4GOP A;  3AFQ A;  3I55 A;  4JBJ A;  4AYB G;  2UUB L;  2EIF A;  4B3M Q;  4ME3 A;  3CC7 A;  1PHJ A;  2R92 G;  1HZ9 A;  3UDX A;  4YHH L;  2YYZ A;  3JAM i;  3PCO B;  4DR2 L;  1WJJ A;  1FL0 A;  1HZC A;  4DK6 C;  1XMQ L;  1WCM H;  3DLL A;  1JJ2 A;  1B8A A;  5C3E H;  4QY7 A;  3UDI A;  5FJ8 G;  1ASZ A;  2HHH L;  2B63 H;  2BA0 A;  3B6Y A;  1V1Q A;  3RLN A;  3RZD H;  4R4I A;  1XNR L;  2F4V Q;  2I5M X;  4WJ4 A;  4AQY L;  4C2M H;  1QVF A;  1VQC A;  4BY1 G;  3UE0 A;  3S14 H;  4K0K L;  3CCJ A;  1K9M C;  1IXR A;  1XTD A;  4YCV A;  4UY8 C;  4A3L H;  1KAW A;  3E0E A;  4HJ8 A;  1IYJ B;  2R93 H;  4JI1 Q;  1LM0 A;  2NVY H;  2MFI A;  4LWC A;  4AH6 A;  3UDG A;  4LF6 Q;  2R7Z H;  1C0A A;  1VCI A;  3TS0 A;  1IBM Q;  3F8T A;  4P74 A;  3TRE A;  1YNX A;  3BZC A;  1YEZ A;  2NN6 I;  1VQP A;  2GVB A;  4IPC A;  2B3G A;  2D0P A;  2L15 A;  4BXX G;  1HNW L;  4LUZ A;  1A62 A;  4DV3 Q;  5IYC G;  2E5L L;  3I4N G;  1XMO L;  3T1Y Q;  4A3G H;  1S3O A;  3I4M G;  4GNX B;  1EWI A;  4JI8 L;  2ALY B;  1QZG A;  3PO3 G;  2JA5 H;  3RR5 A;  1I94 Q;  2E2J H;  4IFD J;  2PI2 A;  1G6P A;  4A3F G;  1A8V A;  4LFA Q;  1Q7Y C;  3L2P A;  4IJL A;  1YVC A;  4GLV B;  5IYB H;  1V9P A;  2IT1 A;  3CC2 A;  3RZO H;  1X54 A;  1I5F A;  5HY6 A;  4JI8 Q;  4DAY B;  1JMC A;  2RHS B;  2VQF Q;  3A5Z B;  4NXN Q;  4YY3 L;  5IP7 G;  5ELO A;  3PUZ A;  4GLX A;  4IJH A;  3CAM A;  3TEH B;  1HR0 L;  1HH2 P;  3M85 A;  1Z9F A;  1HNZ Q;  1VQM A;  2VQE Q;  4POF A;  4LF5 Q;  1A63 A;  4LF5 L;  4DR4 Q;  2B29 A;  2VQE L;  1X6O A;  4H02 A;  2R7F A;  2WP8 J;  1AE3 A;  1Q1B A;  1SE8 A;  1SMX A;  1YIT A;  4R4T A;  4FDB A;  3RNU A;  4LFC L;  4R4C A;  3ER0 A;  2ZJR A;  1X3G A;  4B3T L;  2Y0S G;  4OWW B;  1GD7 A;  1D8L A;  2I5H A;  2WB1 E;  2K14 A;  1LTL A;  1C9O A;  2JEB I;  1SLJ A;  2UXC Q;  3KDF A;  4PZ7 A;  5GAE C;  2KBN A;  3CW2 C;  4DV7 Q;  1Y1W H;  2OTL A;  3S1N H;  1KRT A;  2OWO A;  3TRZ A;  4HJ5 A;  1PH4 A;  4P72 A;  5DLQ E;  2HQL A;  2NZO A;  4YWM A;  4YHH Q;  2QEX A;  4DR2 Q;  1PV4 A;  1PH5 A;  1AH9 A;  3HOZ H;  5IP9 G;  1MJC A;  1E22 A;  3OYY A;  1U5K A;  3PSI A;  4JOI A;  4BBS H;  4JV5 L;  2PQA B;  1I94 L;  4JC0 A;  4X65 L;  3VDY A;  1OXU A;  4DV4 L;  1N32 L;  5IT9 c;  2WAQ G;  2V1C C;  1SRO A;  1HNZ L;  2UUA L;  5C4X H;  4IFD I;  4DV3 L;  1CSQ A;  2E8G A;  3KF8 B;  4A3J H;  5K36 G;  4J15 A;  4KHP L;  2K5N A;  3U58 A;  1EYG A;  3CXC A;  2VQF L;  1L1O A;  1WI5 A;  4POG A;  3GTM H;  2EQS A;  3F2C A;  3CF5 A;  3PO2 G;  1PYB A;  5C44 H;  1VQH A;  4X65 Q;  3S15 H;  2QA4 A;  2JJQ A;  1NMG A;  4A3D G;  1CSP A;  2JA9 A;  4JI0 L;  5BR8 Q;  1I50 H;  4C3J H;  1OXX K;  5IWA Q;  2CWA A;  3T1H Q;  4K0K Q;  2K4K A;  4IPG A;  3DM3 A;  4BY7 G;  2N3S A;  3BU2 A;  3KLW A;  2MO0 A;  3HOY H;  2JA7 G;  2UXC L;  5JEA G;  2ZTC A;  3ERS X;  4LUV A;  4A3E H;  2UXB Q;  2UXB L;  1TXY A;  2DGY A;  2Z0S A;  5M5Y H;  2PNH A;  4A76 A;  5C0X G;  3RLF A;  2JA6 H;  3EIV A;  4A3K G;  1UE1 A;  1QZH A;  4UPA A;  1K83 H;  1V43 A;  3F2D A;  4LFC Q;  2JA8 H;  1Z47 A;  2RHQ B;  2NVT H;  4O0A A;  1IBM L;  4OX9 Q;  3KF6 A;  1K73 C;  4DR4 L;  2UUB Q;  1S72 A;  1BKB A;  5FLM H;  4HIM A;  3HOW G;  3H0G G;  3J81 c;  2OTJ A;  1X56 A;  1VQ8 A;  4KLK A;  1JT8 A;  1OXS C;  1TWG H;  2ES2 A;  1EOV A;  4LF8 L;  3M4P A;  4A3I G;  1YJ9 A;  1K8G A;  1VQO A;  2AKW B;  4NXN L;  2F4V L;  2UUA Q;  1W3S A;  4DV6 Q;  3MXN B;  1E3P A;  1T9H A;  4DR1 Q;  2JK8 A;  2MO1 A;  3UE1 A;  1QUQ A;  2R7D A;  1X9N A;  3S24 A;  3U50 C;  3GTP H;  5GAG C;  1XPO A;  4JBW A;  2Q2I A;  2XTI A;  3J81 i;  4C3H H;  1VS0 A;  2YU9 H;  2BA1 A;  4IPH A;  2K50 A;  1X3E A;  4JG2 A;  3A5U A;  2ZM6 Q;  2IX0 A;  2N8N A;  3KOJ A;  3CC4 A;  4JI6 Q;  3GTK H;  5M5X H;  1N9W A;  1QVC A;  1RL2 A;  2CFM A;  1XJV A;  2I0Q A;  3F1Z A;  4QIW E;  1VQG A;  3CCE A;  4DR1 L;  2ASB A;  2Q2U A;  5IYD G;  4A3B G;  4HJA A;  1WCM G;  4DR3 Q;  4R4Q A;  1WYD A;  5C3E G;  5FJ8 H;  2E5L Q;  4OO1 G;  1HNW Q;  4KHP Q;  3CCQ A;  3EBE A;  1WOC A;  2YTY A;  2NVQ H;  4NXM Q;  3S16 H;  1UWV A;  3I7F A; 
#chains in the Genus database with same CATH topology
 3L9A X;  1WTH A;  4JI1 L;  4WOR A;  3TZU A;  4HMI A;  3K0Y A;  1Q1E A;  3EN2 A;  1STE A;  3A56 A;  1K8O A;  3QIA A;  1IW7 D;  1YJN A;  1FGU A;  2CQO A;  2A1A A;  4C3H B;  5IOD A;  3G6E A;  1PH9 A;  3NTK A;  2VUM H;  4A3M G;  5JJK A;  3BJU A;  1KIX A;  4OO1 I;  2G9D A;  2H4O A;  1T5E A;  1XMQ Q;  2PZU A;  3L0O A;  5C5L A;  5BR8 L;  4A75 A;  4QUC A;  3I4M H;  3U4Z A;  1CKN B;  3CPW A;  4A3C H;  4KTA A;  5EKK A;  5JEA J;  2UU9 L;  2O4X A;  4LW1 A;  2EZV A;  5FK9 C;  4DFA A;  4DNI A;  5FKA C;  2LXJ A;  4A3E B;  2R6G A;  3E9H A;  1N36 L;  3S1R H;  1RDP D;  3DWQ A;  3PUV A;  2EY5 A;  5A2Q E;  4GKJ Q;  2Z6K C;  1EWC A;  2RA4 A;  4ZYS A;  1GKH A;  2IX3 A;  4XXE A;  3GTP B;  1JWM D;  1U4L A;  2A69 C;  2N49 A;  1XNR Q;  1LT3 D;  2Z9H A;  1JOO A;  1GUG A;  5CV4 A;  4BXX H;  2H1E A;  3IRB A;  4MNO A;  2D2C C;  2DNC A;  3VYT A;  1KL9 A;  3GTJ H;  3T13 A;  2AMC B;  4MHE A;  5JVH 3;  3KF8 A;  1WTR A;  1JJC B;  4TQU S;  3M4O H;  3DXJ C;  4B9W A;  1J8I A;  3G4S A;  1VMC A;  2EYH A;  4ODG A;  1W6K A;  1A15 A;  1VQI A;  5CR3 A;  4YWL A;  3KUP A;  2P5Z X;  3MZ5 A;  1RCV D;  4QJF A;  3V05 A;  3I4O A;  2PNR C;  3D0F A;  2A6H C;  3OMC A;  1MIU A;  1Y14 B;  4AQY Q;  2F3I A;  1JB7 A;  1RTO A;  2NN6 G;  3EFX D;  3WOE A;  2KHJ A;  1B7Y B;  4RWS C;  4JOI C;  2RBM A;  4LF9 Q;  4L6T B;  3HOV B;  2D62 A;  4BBR H;  1I4G A;  1EIF A;  5C44 G;  4B3S Q;  3I4M B;  2K52 A;  1FJG Q;  2E2I H;  4MN3 A;  3X3N A;  1OXV A;  1S5E D;  3BVG A;  3PIO A;  2I46 A;  2PPB C;  1JE5 A;  4YIJ A;  4ZLT F;  5C4J B;  1YNN D;  1VQ7 A;  4A93 B;  3SGI A;  1RKN A;  5C6A A;  3R93 A;  5FO8 B;  4DV5 Q;  3SXH A;  4NP5 A;  1H9R A;  2KEN A;  3MVV A;  1PRT F;  5JAV A;  1XX8 A;  5HGQ A;  1IZ6 A;  4JBM A;  1B50 A;  2CW0 D;  3D6W A;  5IT9 L;  4PZ6 A;  2I5L X;  4UHV A;  2EYO A;  2UXD L;  1FJG L;  1LT4 D;  1L1O C;  2EYM A;  2XRQ D;  3QOL A;  2XVS A;  3NQT A;  4DNT B;  2L9H A;  2RF4 A;  3K0X A;  3Q0A A;  3X3M A;  3ITP A;  5ELE A;  1JJG A;  4G57 A;  4HTH A;  1EY7 A;  1TY2 A;  2NVX B;  4XIG S;  4L8J A;  4DV0 L;  3H3V I;  1NSN S;  5M5W B;  5IYC H;  3URY A;  3M7G A;  4X3K A;  1K0R A;  4DK0 A;  4A3E G;  1A3T A;  4LF7 L;  2CWP A;  2MQH A;  3MHB A;  3STB D;  4N8F A;  1HUN A;  4DAM A;  2RCN A;  4OWT B;  3NTI A;  1B70 B;  1EFW A;  1MBY A;  5T1I A;  4JI3 L;  1EOT A;  4YWK A;  4LNQ A;  2K5D A;  2UXD Q;  4DAP A;  4J8Q A;  1LT5 D;  2KHS A;  2XWJ B;  1VQ4 A;  2B8G A;  3NP8 A;  1IBL Q;  4DXF A;  1K3R A;  4C3H G;  4IUR A;  1VF7 A;  4DK3 C;  1HPC A;  3QOJ A;  4A3C G;  1XNQ L;  5JEA H;  5EKL A;  1X32 A;  2BH2 A;  2ZT9 C;  4HJ9 A;  3H3V H;  1Y1W G;  2XNA C;  1U9R A;  1FNV A;  1LV9 A;  3BG3 A;  5LMU Q;  1SRU A;  2KOL A;  3UDF A;  3HOV H;  4X66 Q;  5LL6 X;  3J80 E;  2DJG C;  1MKH A;  4NDX A;  2RSN A;  3TBI B;  1RIP A;  2ZM6 L;  4CJ2 C;  1BOS A;  2CKZ B;  3KDF B;  4BBR B;  1GUN A;  4XTC S;  5AJ3 Q;  3IAY A;  3AEV A;  3KFU A;  2GN5 A;  2AWO A;  5M3F H;  1SJE D;  1ZEQ X;  1F2Z A;  3CCS A;  4JW0 A;  1T5X D;  4P75 A;  4OX9 L;  1TWG B;  5GQO A;  1UE7 A;  3PF4 A;  2F52 A;  4PNY A;  1D5Z C;  1O78 A;  5C3W A;  1TS3 A;  3T1H L;  2SEB D;  1UEA B;  4RKB A;  3MXP A;  4JI0 Q;  1O7Y A;  1SMY D;  2QIL A;  4MTN A;  5EGT A;  4ZK9 B;  4BBR G;  4IOC A;  2SDF A;  1SXT A;  1RJT A;  1QVG A;  4KD4 A;  1G6Z A;  3A7L A;  4A3M H;  4TSS A;  3KJO A;  1VQB A;  3EA6 A;  4X3U A;  4J1M A;  4GLA C;  3HEJ A;  3Q8D A;  3E6Z X;  2O5I C;  1RD9 D;  5C44 B;  4R9W A;  3SEB A;  4S3S A;  4DV0 Q;  4DF7 A;  2HDM A;  3T16 A;  4GOP A;  3H6M A;  3GTM B;  2EJF C;  3GP7 A;  4JBJ A;  1B9N A;  2F0S A;  2EIF A;  1R4P B;  3CC7 A;  3DEP A;  4YHH L;  4DR2 L;  4FXK C;  4QY7 A;  5FJ8 G;  1ASZ A;  3IKJ A;  1V1Q A;  3RZD H;  4R4I A;  3NE5 B;  2I5M X;  2A68 C;  2GA4 B;  2WKD A;  1RF2 D;  4FYD A;  3CCJ A;  5KND A;  1IXR A;  1IL8 A;  1XTD A;  4A3L H;  3DHQ A;  4IUN A;  1BCP C;  1KLG D;  3E0E A;  4ZKB B;  1IYJ B;  1EZ6 A;  3SK5 A;  4HJ8 A;  2R93 H;  1LM0 A;  3MXN A;  1HRJ A;  1LTR D;  3OWE B;  3F8T A;  3TRE A;  1WTP A;  1B9M A;  4G7Z C;  2GVB A;  3BDO A;  4BXX G;  5IYC G;  3I4N G;  1LLR D;  3T1Y Q;  4A3G H;  4JI8 L;  3S2H B;  1IHZ A;  3PO3 G;  2ZXP A;  2L1B A;  4PMC A;  4XQQ A;  1Q7Y C;  3L2P A;  2ENB A;  1KAA A;  5CBE E;  5IYB H;  2EYL A;  5HY6 A;  3I90 A;  1LTG D;  4Z9C B;  2VQF Q;  4FXD A;  5IP7 G;  4K8I A;  4K2K A;  5I9P A;  3CAM A;  4IZ8 A;  1VDZ A;  5KYI A;  1HR0 L;  1Z9F A;  1HNZ Q;  1EY5 A;  5J1Z A;  4LF5 Q;  1E2W A;  1K83 B;  3R2I A;  2VQE L;  1YIT A;  1Q1B A;  1SMX A;  3HZX A;  3J80 L;  4HSV A;  2PW7 A;  3AU7 A;  2I5H A;  2WB1 E;  3LX0 A;  2F4I A;  2EVB A;  2HCI A;  1SLJ A;  2BDO A;  2UXC Q;  3C1F A;  5E4W C;  4P72 A;  3EVQ A;  5DLQ E;  4ZUJ A;  1PH5 A;  3OYY A;  1U5K A;  4BBS H;  2PQA B;  2CVR A;  5CV7 A;  4CDF C;  1WCM B;  1SE2 A;  2Y0S B;  4LAA A;  1HNZ L;  5C4X H;  4IFD I;  2CHB D;  2E8G A;  2Z6B A;  4KHP L;  4IN3 A;  2K5N A;  1STA A;  3HOX B;  1WI5 A;  4X3S A;  3GTM H;  3CF5 A;  1DOM A;  1JOQ A;  1SDF A;  1ZKO A;  4XQJ A;  1VQH A;  1EEI D;  3D4R A;  1WTX A;  3AMU A;  1NMG A;  2JA9 A;  5BR8 Q;  3SK6 A;  3J81 E;  1OXX K;  3T1H Q;  3BVM A;  1CQF A;  2K4K A;  4IPG A;  2N3S A;  4JK1 C;  3TN2 A;  2ZTC A;  3QWN A;  2UXB L;  1PLF A;  2EJG C;  2B2U C;  4H44 C;  3RLF A;  2JA6 H;  2X6L A;  3S9W A;  3EIV A;  2PMZ B;  4UPA A;  3RD4 A;  4LFC Q;  2JA8 H;  2NVT H;  4OX9 Q;  1DZ1 A;  1B53 A;  3FKI B;  3HOW G;  3A54 A;  5EBC A;  3DWP A;  3GQB A;  4IQZ A;  1OXS C;  1TWG H;  1LAB A;  3NUC A;  2AKW B;  4KKU A;  4NXN L;  3BS1 A;  1W3S A;  4DV6 Q;  3PMF A;  1YNJ C;  2XIW A;  3HOZ B;  1T9H A;  3H09 A;  1X9N A;  3J81 i;  2Q2I A;  1B2T A;  4C3H H;  2F0D A;  5D3D A;  3C3L A;  3FPP A;  4CBV A;  3CC4 A;  4QF4 A;  1VMP A;  4IUV A;  5ISR A;  3GTK H;  2CH4 A;  2RDF A;  5M5X H;  2I0Q A;  1RL2 A;  2K6A A;  4XT3 B;  5I4D A;  2Q2U A;  1FNU A;  4R4Q A;  2A69 D;  4KHP Q;  4A3G B;  2ICE C;  3CCQ A;  2YTY A;  2NVQ H;  2EYF A;  2SNM A;  3S16 B;  1BQQ T;  3NBI A;  3I7F A;  4V0B A;  2HCC A;  1Y1V H;  1HZA A;  2C9O A;  4E6I A;  3GTK B;  2B2V A;  4AYB B;  1VQJ A;  1GM5 A;  1R9T H;  4ZKC B;  4K5V A;  3CCM A;  5IOC A;  2VUM B;  2QEJ C;  4A3K B;  1HCZ A;  2K5V A;  1F9S A;  4DV7 L;  3I4N B;  5C4J H;  1KRS A;  1JE4 A;  1YZ6 A;  3VA7 A;  3CCR A;  4OON A;  3GTO H;  4KMU C;  4FF3 A;  1MGS A;  1MSH A;  2BH8 A;  5KGU A;  1UEB A;  5IWA L;  4DN4 M;  2F0T A;  4A3G G;  4A93 G;  1M8A A;  4LFA L;  3J7A 5;  2F0I A;  4B3M L;  3WWV A;  3FKI H;  3LWE A;  1STB A;  5LMN W;  1XMO Q;  1LTI D;  4LFB L;  4BWG B;  2F0E A;  1QB5 D;  1GJX A;  1HXY D;  3FHW A;  3K81 C;  3E5S A;  5GAH C;  3ULL A;  1L0Y B;  2LKV A;  4PQX A;  2YTX A;  2JA7 B;  5M3M G;  2R7Z G;  3JAM L;  4C3J B;  3K8A A;  3GTJ B;  2B2U A;  2FMC A;  3Q23 A;  3GTQ H;  3K7A H;  3M4Q A;  3J7A F;  1VQF A;  2WB1 B;  2F0G A;  3ULP A;  4B3T Q;  3HOU B;  4P71 A;  3G48 A;  1JIC A;  4CDE C;  4F8M A;  3J81 j;  1PYW D;  3Q24 A;  4A4I A;  4JI2 L;  4GZY C;  4L63 B;  3HKZ G;  1NE3 A;  4AYB E;  2A5H A;  5CV9 A;  3OTO Q;  4GNX A;  1AP0 A;  2B2Y A;  1XXG A;  1K3B C;  2NB0 A;  4GS3 A;  1HZB A;  3S1N B;  3S1R B;  2B39 A;  4BA1 I;  3MAQ A;  1VF5 C;  2AUK A;  2IX1 A;  1TWH H;  3FP9 A;  2FMM A;  1SFO B;  3HS0 C;  2K5H A;  3PO2 H;  3JAM c;  2X69 A;  1E7Z A;  3V96 A;  4X66 L;  1TWF H;  3E3X A;  1TWA H;  1A0I A;  5EJW A;  1VQA A;  4IUT A;  2OT2 A;  3F2B A;  3SVM A;  3M3Y H;  2NBF A;  1V1P B;  1I3Q H;  3J80 c;  1QNK A;  5DM6 3;  1YNN C;  4UP9 A;  2VL6 A;  2B2V C;  3KK7 A;  3I56 A;  2CCZ A;  5NUC A;  2AWN A;  4B08 A;  1S5F D;  1UE6 A;  5EKI A;  3JC6 6;  1YHA A;  5ELF A;  2R3Z A;  3T4A C;  1GO3 E;  1CM9 A;  2VZA A;  1VQK A;  1PFS A;  2K7V A;  2IHE A;  2XN9 C;  1SMY C;  3TME A;  4JCV E;  4OIJ A;  4CHT B;  1QJO A;  3H91 A;  4QUF A;  2A8V A;  3A0J A;  3W1G A;  1K28 A;  1H9J A;  3U4V A;  1P16 A;  5LMU L;  4IUP A;  1OXT A;  4GKJ L;  1W2B A;  1HNX L;  1GHK A;  1JWU D;  3PGZ A;  2UUC Q;  2MNA A;  5A35 A;  4A3K H;  1Q82 C;  5FLX c;  1TT2 A;  2L12 A;  3HOZ G;  2Q8I B;  1SR3 A;  2B63 B;  5IE8 A;  4PMW A;  1EYC A;  1PTO C;  3NEL A;  1V1P A;  1Y1V B;  1IKM A;  4DUZ Q;  4ALP A;  3HKZ E;  1J9O A;  2X6G A;  3P1H A;  2F0O A;  2PCF B;  5GRO A;  3VR4 A;  1A6X A;  1DON A;  1K8A C;  4A3M B;  1LAC A;  4JI3 Q;  4DGZ A;  1XNQ Q;  3NBH B;  3G71 A;  1CK1 A;  2KEE A;  3J7Z C;  4DAV A;  1LYL A;  4DV5 L;  4RAU C;  4EQ5 A;  1H95 A;  3IFD A;  2ZJP A;  1H9M A;  5E4X A;  2JA6 G;  4HIK A;  1EIG A;  4IUQ A;  4X64 Q;  1C48 A;  4GOP C;  2XGT A;  1E1T A;  4QIW B;  4C1N I;  1FD7 D;  1X65 A;  1ML0 D;  1EU4 A;  2WFW A;  3QR8 A;  4JI6 L;  4FF4 A;  1E0B A;  4C1N K;  1LUZ A;  4DPG A;  4Y7N H;  2K03 A;  2QF7 A;  3H0G H;  2B2Y C;  3TZD A;  1EQQ A;  4GNX C;  1KNE A;  1I6H H;  3KLS A;  1KQS A;  1LTS D;  3E9I A;  1ZYR C;  4DV6 L;  3K80 C;  1N33 L;  5J3B A;  1G8Z D;  3S15 B;  3PUX A;  4X62 L;  4KI0 A;  4QL5 A;  5H1S E;  1TWC B;  1G2T A;  1PFM A;  1Q3L A;  3OTO L;  1HQM C;  4U68 A;  2SNS A;  1UNS A;  2A6E D;  2VS1 A;  3HOY G;  2E75 C;  3RLO A;  1PA6 A;  2WIN B;  4DR6 L;  1BBW A;  4MZ9 A;  1YI2 A;  3P20 A;  5C0X H;  3BDL A;  3C1E A;  1IYV A;  4IFD G;  5LHY 1;  3OOC A;  3IFT A;  4OHJ A;  3HFZ B;  3NTH A;  1PRT D;  1C4Q A;  4EGV A;  1UE5 A;  1BUV T;  1ROD A;  4HIO A;  5HUR A;  2E2J B;  4DV1 Q;  4A3D B;  1R9T B;  1AFP A;  5GAD C;  3HOX G;  3D6C A;  3RN5 A;  2RQX A;  3OMG A;  1A2U A;  1D2B A;  1N36 Q;  1UAP A;  3VR3 A;  5IGE A;  1QNU A;  2WB1 G;  3TP7 A;  2IPK D;  4DKA C;  3VR6 A;  3HOU G;  1PZJ D;  3NQI A;  1ILP A;  3MFY A;  2NTS A;  4EQN A;  5JPN C;  5E3F A;  2UUB L;  4B3M Q;  4ME3 A;  1PHJ A;  2MUY A;  1PTO D;  2R92 B;  3H94 A;  3PCO B;  3S14 B;  5DEH A;  1FYC A;  5C3E H;  2B63 H;  3KBG A;  3ND8 A;  4KJN A;  2F03 A;  1GHJ A;  1BF4 A;  4O1N A;  1D6E C;  4KK7 A;  3UE0 A;  3F2U A;  1BDO A;  1K9M C;  1U4M A;  2HDL A;  1KAW A;  4HED A;  2B2T C;  2NVY H;  4LWC A;  1TR5 A;  2OF1 A;  2Z4I A;  2L5T A;  3BZC A;  5FO7 B;  1B4O A;  2AQ3 B;  3OPO A;  2Q8T A;  2B3G A;  1A62 A;  2WII B;  1HTL D;  1Y8N B;  3I4M G;  3Q22 A;  2L4N A;  3RR5 A;  1I94 Q;  1TVX A;  3MC0 B;  2PI2 A;  4GLV B;  1D5M C;  3J7Y W;  1V9P A;  3CC2 A;  5KEE A;  3RZO H;  1X54 A;  5C4H A;  1I5F A;  1Y69 U;  2KVM A;  3K59 A;  3A5Z B;  4YY3 L;  1F9P A;  5G3L D;  1BR9 A;  1EEF D;  3TEH B;  1HH2 P;  1ZXT A;  2BE5 D;  2DJF C;  1VQM A;  3AB9 A;  4FNF A;  3D4W A;  4LF5 L;  4DR4 Q;  1EY9 A;  2R7F A;  3C46 A;  2WP8 J;  4XYQ A;  2L0C A;  2V4D A;  4KN7 C;  1TWF B;  3RNU A;  1QG7 A;  4K5X A;  1JB3 A;  1Z6H A;  1W6J A;  4UAI A;  4OWW B;  1D8L A;  2JEB I;  5A2Q L;  1SNC A;  4DV7 Q;  1GUT A;  3D3R A;  2OTL A;  1KRT A;  2NZO A;  4YHH Q;  4DR2 Q;  1E22 A;  4JV5 L;  4OEL B;  1OXU A;  2K1B A;  2D9U A;  5IT9 c;  4EQO A;  2WAQ G;  1TS4 A;  1TKW B;  4KJO A;  4DK1 A;  4DV3 L;  5IT9 E;  1SE3 A;  4A3J H;  4J15 A;  4H13 C;  3PO3 B;  2R61 A;  5IGC A;  3U58 A;  3CXC A;  4POG A;  1EU3 A;  5BN5 A;  4XYO A;  3ND9 A;  1PYB A;  2IW3 A;  1WTQ A;  4X65 Q;  5E1F A;  4FXG C;  1CSP A;  3FVQ A;  4JI0 L;  2BOS A;  4C3J H;  2DNE A;  3DM3 A;  1JOR A;  3N6R A;  1B3A A;  2JA7 G;  3BDC A;  4LUV A;  5I9O A;  1BCP B;  4R8N A;  1IYU A;  1X3P A;  3HKZ B;  4Q5V A;  2Z0S A;  5C0X G;  2Z8L A;  1ICF B;  1V43 A;  2QDL A;  1ESR A;  1XWE A;  2JN4 A;  4NMZ A;  3SHL A;  3M4O B;  2J0T D;  2EE1 A;  4CDC C;  5FLM H;  1S72 A;  2RKS A;  4C56 C;  3SDZ A;  1X56 A;  1VQ8 A;  2QDB A;  3K58 A;  2DY7 A;  5J39 A;  1EOV A;  1K8G A;  3FPU B;  3VR5 A;  1VQO A;  4N8X 1;  2UUA Q;  2YU9 B;  2PQE A;  3MXN B;  3UE1 A;  2F0J A;  2JXM B;  3IL8 A;  3GTP H;  2CW0 C;  5HGT A;  3GTL B;  4DA2 A;  2JA5 B;  2BA1 A;  2F0H A;  2LS0 1;  3A5U A;  4JI6 Q;  2A68 D;  1DYQ A;  3NPP A;  3F1Z A;  1E2Z A;  2ASB A;  4MTK A;  4A3B G;  1WCM G;  4PV1 C;  3ERO A;  3FDT A;  4LMQ D;  2B2W A;  4XQN A;  3S16 H;  4NXM Q;  2AQ1 B;  4I65 A;  3I70 A;  2M2L A;  4RMF A;  3OIQ A;  1UUP A;  4LF6 L;  4P2C B;  2E74 C;  3CRL C;  4RGT A;  4EVO A;  2L55 A;  4HID A;  4UP7 A;  1VQN A;  3CQZ H;  4YY3 Q;  1F9Q A;  4BY7 B;  5FLX E;  3ULJ A;  1PVO A;  4GN5 A;  3QJY A;  2TSS A;  3PUW A;  1MJE A;  1ENC A;  4LF4 Q;  3PIP 3;  5C0X J;  1Q8I A;  5KIX A;  1PH3 A;  4TVA B;  4GN3 B;  2ZXR A;  4A3J B;  2YTV A;  2N88 A;  4JI7 Q;  3HOW B;  2RDH A;  1HR0 Q;  1SNQ A;  1SFO H;  2J4X A;  3HOV G;  1L0W A;  1J6Q A;  2Q8R E;  2Y0S E;  1DJR D;  2WAQ E;  3MFG A;  4APV A;  5AJ3 L;  2JA6 B;  4GKK L;  2Z6K A;  4DV4 Q;  3R8B A;  1N32 Q;  4CGY B;  4X6A H;  3PF5 A;  3KYH C;  4JV5 Q;  3A55 A;  2K28 A;  4O2D A;  2Z1C A;  1HUM A;  1SNO A;  2K01 A;  5COR A;  4CKC A;  3HOX H;  4HAE A;  1SNM A;  3SK8 A;  2EJM A;  1KNA A;  2OXP A;  4X64 L;  5IY0 A;  1PH8 A;  5M3F G;  4R4O A;  3HOU H;  3SK4 A;  3LWU A;  1N8R C;  2GVA A;  3DEO A;  4DR7 L;  1AN8 A;  3PO3 H;  3I4L A;  4H0L C;  3NEM A;  4JYA L;  1I6V C;  3KLR A;  1BCP F;  5M5Y B;  1Q86 C;  5EPK A;  2B63 G;  4K8J A;  2WV6 D;  5C0X I;  4DR5 Q;  3J81 L;  1AEX A;  1JC7 A;  1WD1 A;  4Q0F A;  4BY1 H;  2H5X A;  4WFN 3;  1SBB B;  3ICE A;  3VYS A;  2EXD A;  3GTG H;  2JP1 A;  5CV8 A;  3CME A;  2Q2T A;  4YCW A;  4NKL A;  3K5M A;  1EQV A;  4F88 A;  1I4R A;  5C3X A;  3W5O A;  1CTM A;  2VB3 X;  4DNR B;  3HKS A;  4YCU A;  4K5W A;  1J5E Q;  1VQ6 A;  4CKE A;  2M00 A;  1PH2 A;  2WAC A;  3FEW X;  4IAL A;  1PYS B;  1VQE A;  4DV2 Q;  3WDN A;  2ID0 A;  3AYH B;  3CQZ B;  4A3F H;  4N9T A;  1TII D;  2FXQ A;  3CMA A;  1D7Q A;  3J80 i;  3S2D H;  1N34 Q;  2PMZ E;  4PG3 A;  1I6H B;  3BZD B;  1J5E L;  1SYE A;  1EY0 A;  5C4X G;  3CU7 A;  3DWA A;  4JI4 L;  1X3F A;  1ONL A;  3U9S A;  1WTO A;  2HD3 A;  5E7N A;  3CCL A;  4N9P A;  5D14 A;  3TS2 A;  1QIL A;  1NR2 A;  1P8L A;  1PFN A;  2KCT A;  3CP0 A;  4DR6 Q;  2KHI A;  2JEA I;  1G2S A;  1S4Z A;  1NMF A;  1CA5 A;  4RA8 A;  1NNX A;  3WOF A;  5IGD A;  4G7H C;  2VY3 A;  3GTO B;  4GKK Q;  4DV2 L;  1B3Q A;  1G6P A;  1KHI A;  5EPL A;  4C2M B;  4BY7 H;  4LF7 Q;  1D1I A;  3I4N H;  5JJL A;  3RN2 A;  3SE0 A;  2UUC L;  1N33 Q;  2JA5 G;  3TP5 A;  1I4Q A;  2RVL A;  2PO4 A;  1BBU A;  4DV1 L;  3K7U C;  1YHB A;  4JYA Q;  1B44 D;  5LMN L;  4KD3 A;  3T56 B;  2HIV A;  3G7L A;  4DUY L;  3L7Z C;  5IGB A;  3M4Y A;  1STY A;  4LF4 L;  4B3R Q;  4RGM A;  3P7J A;  5K36 H;  1VQD A;  4WJW A;  3LNN A;  2HT1 A;  2D0O A;  1L2F A;  2VUM G;  4QQB X;  1U4P A;  2OQK A;  4OXP A;  1FVI A;  4K6D A;  4B9X A;  3GD7 A;  4PZ8 A;  5BN3 A;  1PDQ A;  3OSO A;  3BYY B;  3A74 A;  4QGU A;  1D5X C;  1QUQ B;  3PUY A;  4RG1 A;  4C3J G;  1YBY A;  1I3Q B;  1I4H A;  4P73 A;  4JI2 Q;  3MA2 B;  2E2H B;  1HFG A;  2IL8 A;  4FP5 D;  4TKO B;  4C3I B;  2XSC A;  3W1B A;  4UP8 A;  3VYU A;  1PH7 A;  2KCN A;  1XPU A;  3GTG B;  4B3R L;  4BBS G;  3TQY A;  4RCO A;  5FLM G;  1M4V A;  2CH4 W;  2F0V A;  4CJ1 B;  4LF9 L;  1OTC A;  2E2H H;  4BBS B;  2NVT B;  1SNP A;  1HHV A;  1Y1W B;  3I73 A;  4X3T A;  1SEB D;  4JI4 Q;  4DR5 L;  2VB2 X;  4JBK A;  5EBD A;  2HQE A;  2QGQ A;  2JQO A;  1STG A;  4KHZ A;  4A3D H;  5EAY A;  4KV6 A;  4A93 H;  5KNB A;  2B2T A;  1Q12 A;  3FKI G;  1HFN A;  4ZAI A;  3S1M H;  4EX5 A;  1NJI C;  1DGS A;  4A3B H;  4Y7N B;  4ZCK A;  1IBK Q;  2PQA A;  1BVS A;  5D3I B;  4QB4 A;  2JA8 G;  1YJW A;  5CC4 A;  2C35 B;  1VQ9 A;  1PMR A;  1HR0 W;  1CUK A;  4DUY Q;  2F0Q A;  4K6L A;  3H3V C;  5ELN A;  5CBA E;  1K0S A;  1VQ5 A;  1FR3 A;  2M9V A;  2IY5 B;  3GV6 A;  3S1Q H;  2XWB B;  2RDG A;  4RCN A;  1SJH D;  2K04 A;  2MHV A;  1KDC A;  4LFB Q;  2F0M A;  3T51 B;  2KJX A;  3AFQ A;  2EPB A;  5FOB B;  1HZ9 A;  5I6W A;  1FNW A;  4IUU A;  3K6O A;  3JAM i;  1FL0 A;  4WJ3 M;  1XMQ L;  3UDI A;  2HHH L;  3B6Y A;  1XNR L;  4ZRZ A;  4KY5 A;  2F4V Q;  4WJ4 A;  1GXD C;  1SYG A;  1D1K A;  4I7A A;  5K5P A;  1SAP A;  1O80 A;  4FVM A;  1VQC A;  4C2M H;  3OIP A;  2EY2 A;  4J6H A;  2EYJ A;  5CMD A;  3S17 B;  1ET6 A;  4LF6 Q;  3UDG A;  1X3Q A;  5EQ0 A;  1C0A A;  1VCI A;  2FIN B;  4HN7 A;  3TS0 A;  2BDN A;  2K5Q A;  3MEH A;  1YNX A;  1A3V A;  1TY0 A;  5CV6 A;  1A2T A;  4IPC A;  1KDA A;  4FF1 A;  2TMP A;  2D0P A;  1HNW L;  3I91 A;  2R7Z B;  4LUZ A;  4DV3 Q;  4GNX B;  1EWI A;  1O7L A;  2ALY B;  5J22 A;  2JA5 H;  4RGO S;  4IFD J;  3S2D B;  1CFM A;  5KYL A;  5I6Y A;  2R93 B;  2IT1 A;  2IWH A;  1KDB A;  4DAY B;  4HCE A;  4NXN Q;  1KAB A;  2N55 A;  1S5C D;  4DAY A;  3PUZ A;  5C3E B;  4RKL A;  3S1M B;  5F2D A;  1Z7T A;  3MXU A;  2VQE Q;  4POF A;  1WVL A;  1B1Z A;  1A63 A;  5CGK A;  5M9O A;  2CQA A;  1X6O A;  5BN4 A;  3K7A B;  4HCS A;  4R4T A;  4FDB A;  1CI3 M;  5JPM C;  1PTO B;  2MGS A;  4B3T L;  2Y0S G;  1PRT B;  1GD7 A;  4HR7 B;  4PMB A;  2K14 A;  1C9O A;  4ID6 A;  3KDF A;  4PZ7 A;  5GAE C;  2KBN A;  3CW2 C;  1Y1W H;  2O2L D;  3ERQ A;  1PH4 A;  3A8I E;  2QEX A;  5IGG A;  1CT1 D;  1V8Q A;  1PRT C;  2KA7 A;  3HOZ H;  4JOI A;  4JPB W;  2F3V A;  3W2D A;  4JC0 A;  4X65 L;  3G6J B;  4DV4 L;  1N32 L;  2EDG A;  2V1C C;  4A3B B;  1CSQ A;  3KF8 B;  1AZP A;  1EY8 A;  2D5D A;  3NHH A;  1NCV A;  1U4R A;  2A6E C;  1JCK B;  1L1O A;  2E2D C;  2VQF L;  3C2P A;  1EL0 A;  3PO2 G;  1DOL A;  2L11 A;  3NWT A;  4V19 0;  4ULL A;  3S1Q B;  5L37 A;  2JJQ A;  3GTQ B;  4A3D G;  3EJI A;  3HG9 A;  1I50 H;  4K0K Q;  2CWA A;  4BY7 G;  3KLW A;  3ERS X;  4A3E H;  3SR1 A;  1EY6 A;  2DGY A;  5FLX L;  5M5Y H;  4A76 A;  4NW2 A;  1K83 H;  3F2D A;  1Z47 A;  2RHQ B;  4O0A A;  1IBM L;  1K73 C;  4DR4 L;  2UUB Q;  1BKB A;  4HIM A;  1CZW A;  3H0G G;  5T1G A;  2A73 B;  2OTJ A;  2F0U A;  4KLK A;  4OEM B;  2ES2 A;  2A6H D;  1YJ9 A;  2FHT A;  1OO9 B;  2K05 A;  3N52 A;  2F4V L;  3W3A A;  1GOZ A;  1KTK A;  4K14 A;  4DR1 Q;  1TS5 A;  3S24 A;  3TSS A;  4M1U B;  3U50 C;  1XPO A;  1QCB D;  3VYR A;  4ZUI A;  1Y8O B;  2YU9 H;  4R8I A;  2K50 A;  2ZM6 Q;  4JG2 A;  5TSS A;  3KOJ A;  2FJ2 A;  2N8N A;  1IW7 C;  1TS2 A;  2KUM A;  5IGF A;  3I3C A;  2CFM A;  3CCE A;  4QIW E;  4KHV A;  1SYC A;  2WAQ B;  4OO1 G;  1WYD A;  3UI2 A;  5FJ8 H;  1DXM A;  1FGB D;  1I4P A;  1JR0 D;  1RTN A;  1R4Q B;  1M1K C;  3I2Z A;  4L5R C;  2PI2 E;  1F2Y A;  1PXU A;  3GTL H;  2VNU D;  3S17 H;  2FFK B;  2ZJQ A;  1G91 A;  4I7Z C;  4H7B A;  5CV5 A;  2O5J C;  1IBK L;  2OQ0 A;  2QCP X;  3PIP A;  1HA5 A;  1WFQ A;  2ATW A;  1ENF A;  2KED A;  3DUZ A;  4U67 3;  1TWA B;  2R92 H;  1BNZ A;  3A8K E;  3KF6 B;  1NY4 A;  1EUJ A;  1NTG A;  1IL2 A;  1M90 C;  3HOY B;  1GUS A;  5IP7 H;  1KC8 C;  5COY A;  2VXW A;  1Q46 A;  1YHQ A;  1O7I A;  3T53 B;  5M3M B;  5DM7 3;  1EYD A;  1K8M A;  1TU2 B;  2EYP A;  4BS9 A;  2KCC A;  4QMG A;  1ZYR D;  2N78 A;  5IIF A;  1ILQ A;  1WD0 A;  4L5Q A;  3STB C;  4DUZ L;  3OWF A;  5DAU A;  1E1O A;  2E76 C;  1G51 A;  1ET9 A;  2E2I B;  2A19 A;  2MPM A;  1STH A;  3M7N A;  2WKC A;  3CCV A;  3QB3 A;  4CDD C;  1F2M A;  2JYO A;  1CA6 A;  2PZT A;  2ZTD A;  3LGJ A;  4IFD H;  3CPF A;  3PIO 3;  4DU9 A;  1JQY D;  4TRD A;  2QW7 A;  1A3U A;  2EOT A;  1HTP A;  1CKO A;  3NWS A;  3JAM E;  1EQR A;  3A7A B;  4A3L G;  4R1J A;  2OEO A;  2R93 G;  5KNC A;  1X55 A;  2F0K A;  1YIJ A;  1ICW A;  1AW7 A;  3BYT B;  3I8Z A;  2LSS A;  1SYF A;  2EY1 A;  5G3L F;  3T1Y L;  3A8J E;  3MXG A;  2NVY B;  1PZI D;  2K33 A;  1EZ8 A;  1GVP A;  4JI5 L;  4XT1 B;  2JSO A;  3K57 A;  3U9O A;  2ICI A;  2JE6 I;  1E2V A;  4C3I H;  5FO9 B;  1PH1 A;  2NZH A;  1HNX Q;  4GN4 B;  1TWH B;  1KLU D;  3R2T A;  4ILW A;  5IYB G;  5JJI A;  2VW9 A;  4X62 Q;  3HOW H;  2F3W A;  2RSO A;  3O13 A;  1MHW C;  1SYB A;  4JI5 Q;  4GOP B;  1EIY B;  5LL6 S;  1DM0 B;  4O42 A;  1NBW A;  2HHH Q;  1LTB D;  1S40 A;  1C7Y A;  3K5N A;  4QCL A;  3TP8 A;  1NUC A;  2C5C A;  4KY6 A;  3MEF A;  5LMN Q;  4OGQ C;  2YV5 A;  3NK9 A;  1PH6 A;  1CKM A;  2NYZ D;  4F87 A;  5JVG 3;  3H15 A;  3AQQ A;  5M5W H;  2JA7 H;  3CD6 A;  4L5S A;  4Y52 H;  3K5L A;  3EQL C;  1ASY A;  4NB3 A;  2AHO B;  4UDU C;  2SOB A;  4JI7 L;  1DD2 A;  1QE6 A;  1SN8 A;  2UU9 Q;  4XDX A;  4JVZ A;  1CZG A;  1HJP A;  2ZXO A;  1Y1V G;  2IHF A;  4L5T A;  2LMC B;  2G9H D;  4LUO A;  2Q2H A;  2JA8 B;  1EYA A;  3GDE A;  1Y8P B;  1I4X A;  4BY1 B;  1II3 A;  4DXG A;  4CJ0 B;  3NSW A;  3ZYY X;  1G29 1;  3BZK A;  4OIK A;  2LXK A;  1H9K A;  4NPS A;  1EFI D;  2RCF A;  1HQR D;  4LK1 C;  1F9R A;  1YNJ D;  3R3O A;  3HRZ C;  1KD1 C;  4DR7 Q;  1IBL L;  3AFP A;  4IO9 A;  4AIM A;  4CKB A;  5IYD H;  3DMU A;  3RZD B;  1Q81 C;  4DR3 L;  3PV0 A;  1XPR A;  1F2L A;  2F0P A;  5C4X B;  1AZQ A;  3ZJY C;  5IP9 H;  1Q90 A;  3NXW A;  1EY4 A;  2K75 A;  3NEN A;  3QG1 A;  3CRK C;  2NWG A;  1EQT A;  1E24 A;  2I07 B;  4A3J G;  1CQV A;  4M8A A;  5M5X B;  1H9S B;  1AE2 A;  3RUZ A;  5M3M H;  1CHQ D;  4RHS A;  3GO5 A;  1BXT A;  4HJ7 A;  3CCU A;  1U0L A;  4IOA A;  3L3O C;  3OW2 A;  1H9S A;  2NZ1 D;  3MTS A;  4BA2 I;  1JWS D;  2OCE A;  2XRS D;  4OWX B;  1PTO F;  4FO2 A;  4F7X A;  2KEC A;  4ME5 A;  3VR2 A;  4ABN A;  1L1O B;  1CKN A;  2AQ2 B;  3TP6 A;  3QO2 A;  4OO1 H;  1V1O A;  4ZQ3 A;  2KCM A;  4IPD A;  2DN8 A;  4EQP A;  1N34 L;  4B3S L;  5C4Z A;  1RHP A;  1KXL A;  1DCZ A;  1TWC H;  3D31 A;  1QWY A;  1NAP A;  1VQL A;  4A3I H;  1PTO H;  3M9B A;  2F0L A;  2NVX H;  5D65 A;  2DUD A;  3P75 A;  4NXM L;  3S2H H;  3D4D A;  2ZTE A;  2K32 A;  5I2Y A;  4LF8 Q;  3HGB A;  1EIH A;  2G5D A;  5ELD A;  2HIX A;  4WRD A;  1WTW A;  1Q8K A;  3KJP A;  1F77 A;  4C3I G;  3I55 A;  4LJZ C;  1PFB A;  4AYB G;  1HA6 A;  2R92 G;  4RHR A;  3UDX A;  2YYZ A;  1NR4 A;  1WJJ A;  1HZC A;  4DK6 C;  1JJ2 A;  1WCM H;  3DLL A;  3KLS X;  1B8A A;  2F1M A;  4KKT A;  5CYU A;  2BA0 A;  3RLN A;  3FMC A;  3MWY W;  2EXZ A;  1STN A;  5DNF A;  4KN4 C;  2NN6 H;  4AQY L;  1QVF A;  4BY1 G;  3D8G A;  3S14 H;  4K0K L;  4FF2 A;  1QOH A;  4MIU A;  4YCV A;  4UY8 C;  3PQI A;  4JI1 Q;  2MFI A;  4AH6 A;  2R7Z H;  3OW7 A;  3GV3 A;  1IBM Q;  4HMJ A;  4P74 A;  1SND A;  1YEZ A;  2NN6 I;  1VQP A;  1BBX C;  2L15 A;  2J7Z A;  2PW5 A;  3NBH A;  2E5L L;  3PO2 B;  2NVQ B;  1XMO L;  1S3O A;  3DM1 A;  1LT6 D;  1ESF A;  1QZG A;  2E2J H;  5ELC A;  4A3F G;  1A8V A;  2Z4H A;  1PZK D;  2MP1 A;  4LFA Q;  4IJL A;  1TQO A;  1YVC A;  1LO5 D;  4JI8 Q;  4A3F B;  1JMC A;  1MI2 A;  1EWH A;  5ELB A;  2RHS B;  2BE5 C;  4KKS A;  5ELO A;  4GLX A;  3M3Y B;  4IJH A;  3M85 A;  2IJ0 A;  2LFN A;  4OL7 A;  4G4K A;  2F0N A;  1XTC D;  2B29 A;  2KQ3 A;  4H02 A;  4RH6 A;  1AE3 A;  1SE8 A;  3E0J A;  4LFC L;  1LTA D;  4R4C A;  5M3F B;  3ER0 A;  2ZJR A;  1X3G A;  1MSG A;  5EPJ A;  1LTL A;  1O7Z A;  4A3I B;  3S1N H;  3TRZ A;  2OWO A;  4HJ5 A;  3BVZ A;  2HQL A;  1S5B D;  2NUC A;  4YWM A;  1PV4 A;  3H0G B;  5I2X A;  1AH9 A;  5IP9 G;  1MJC A;  3PSI A;  4K2L A;  1I94 L;  3VDY A;  1BO0 A;  1SYD A;  1SRO A;  1L0X B;  2UUA L;  1IKL A;  3KBX A;  5K36 G;  2A74 C;  1EYG A;  3V2T A;  2B2W C;  1MD2 D;  2EQS A;  1SSO A;  2NTT A;  3F2C A;  1SE4 A;  2AUJ D;  5C44 H;  3CKI B;  1ENA A;  2QKI C;  3S15 H;  4RFB A;  2QA4 A;  3Q6S A;  4RGN A;  3TDQ A;  5IWA Q;  1GUO A;  5JOB A;  1WTV A;  3RMH A;  3BU2 A;  2MO0 A;  3HOY H;  2UXC L;  1DOK A;  5JEA G;  2UXB Q;  1I50 B;  1LTT D;  1TXY A;  3I72 A;  2PNH A;  5AFW A;  4A3K G;  1UE1 A;  1QZH A;  3HP3 A;  3J7A V;  4G7O C;  3KF6 A;  4HSP A;  1XYI A;  1JOK A;  3FRP B;  3OHX C;  3J81 c;  2EY6 A;  2F0F A;  2BCO A;  2B8F A;  1JT8 A;  4LF8 L;  3M4P A;  5C5M A;  4A3I G;  5KRU A;  3ONA B;  1S5D D;  2F0W A;  2PZW A;  1E3P A;  2JK8 A;  2MO1 A;  1QUQ A;  2R7D A;  1BCP D;  5GAG C;  5JJZ A;  4JBW A;  2XTI A;  1VS0 A;  2LY7 A;  2DY8 A;  3CHB D;  4IPH A;  1X3E A;  1GUW A;  3RZO B;  2IX0 A;  2MJ8 A;  1C8C A;  1N9W A;  1QVC A;  2HUG A;  1XJV A;  4DR1 L;  1VQG A;  3VA5 A;  3K5O A;  4KY7 A;  5IYD G;  4HJA A;  4DR3 Q;  2PYK A;  2K5W A;  5C3E G;  2E5L Q;  1HNW Q;  3EBE A;  1WOC A;  1UWV A;  1CHP D; 
#chains in the Genus database with same CATH homology
 4RMF A;  1Y1V H;  1HZA A;  4JI1 L;  1M1K C;  4LF6 L;  1Q1E A;  3EN2 A;  1VQJ A;  3I2Z A;  1GM5 A;  4L5R C;  2PI2 E;  1YJN A;  1R9T H;  1FGU A;  2CQO A;  2A1A A;  3G6E A;  3CCM A;  3GTL H;  3S17 H;  2VNU D;  4HID A;  1PH9 A;  2ZJQ A;  4UP7 A;  1VQN A;  2K5V A;  3CQZ H;  4DV7 L;  4YY3 Q;  4A3M G;  5C4J H;  2VUM H;  5JJK A;  3BJU A;  1KRS A;  1KIX A;  4OO1 I;  3ULJ A;  1YZ6 A;  3CCR A;  4OON A;  1IBK L;  1PVO A;  3GTO H;  4GN5 A;  1XMQ Q;  3PUW A;  2OQ0 A;  2BH8 A;  1MJE A;  1UEB A;  5IWA L;  3PIP A;  3L0O A;  4LF4 Q;  1WFQ A;  5C0X J;  5BR8 L;  4A75 A;  2ATW A;  3I4M H;  4A3G G;  4A93 G;  4LFA L;  3U4Z A;  1CKN B;  3CPW A;  4TVA B;  1PH3 A;  3J7A 5;  4GN3 B;  4A3C H;  5JEA J;  4B3M L;  2R92 H;  3WWV A;  3FKI H;  5LMN W;  2YTV A;  2UU9 L;  1XMO Q;  4LFB L;  3KF6 B;  4LW1 A;  1NY4 A;  4JI7 Q;  4DNI A;  1HR0 Q;  1EUJ A;  2LXJ A;  2R6G A;  1NTG A;  3FHW A;  3E9H A;  1M90 C;  1SFO H;  1IL2 A;  3K81 C;  1N36 L;  3S1R H;  3PUV A;  1L0W A;  3HOV G;  1J6Q A;  3ULL A;  2Y0S E;  2WAQ E;  5IP7 H;  4APV A;  2Z6K C;  5GAH C;  5AJ3 L;  4GKJ Q;  4GKK L;  2Z6K A;  4DV4 Q;  1KC8 C;  1N32 Q;  1Q46 A;  1YHQ A;  4X6A H;  3PF5 A;  1O7I A;  3KYH C;  1GKH A;  4JV5 Q;  2YTX A;  4O2D A;  5M3M G;  2R7Z G;  3HOX H;  3K8A A;  2N78 A;  3GTQ H;  3K7A H;  2N49 A;  3M4Q A;  1XNR Q;  1VQF A;  4X64 L;  1PH8 A;  5IY0 A;  5M3F G;  4BXX H;  3ULP A;  4B3T Q;  3IRB A;  4L5Q A;  4MNO A;  4R4O A;  3STB C;  1KL9 A;  4P71 A;  3G48 A;  4DUZ L;  3GTJ H;  3HOU H;  3J81 j;  2AMC B;  1N8R C;  2GVA A;  1E1O A;  4A4I A;  4JI2 L;  1JJC B;  4TQU S;  1G51 A;  3M4O H;  4DR7 L;  3PO3 H;  3HKZ G;  1NE3 A;  3NEM A;  4AYB E;  3G4S A;  4JYA L;  2A19 A;  4GNX A;  3OTO Q;  4YWL A;  1VQI A;  3M7N A;  3CCV A;  4QJF A;  1Q86 C;  2B63 G;  3I4O A;  3D0F A;  2ZTD A;  4GS3 A;  1HZB A;  3LGJ A;  1MIU A;  1Y14 B;  3CPF A;  5C0X I;  4AQY Q;  2F3I A;  1JB7 A;  4DR5 Q;  4BA1 I;  2NN6 G;  2IX1 A;  4BY1 H;  3FP9 A;  1TWH H;  1B7Y B;  2KHJ A;  1CKO A;  2H5X A;  4JOI C;  1EQR A;  4LF9 Q;  3ICE A;  4A3L G;  4R1J A;  2EXD A;  2K5H A;  2D62 A;  4BBR H;  3GTG H;  3PO2 H;  1EIF A;  5C44 G;  3JAM c;  3CME A;  1X55 A;  2Q2T A;  1E7Z A;  2R93 G;  4YCW A;  1YIJ A;  4B3S Q;  2K52 A;  4X66 L;  1TWF H;  1FJG Q;  1TWA H;  1A0I A;  2E2I H;  1VQA A;  2LSS A;  3T1Y L;  1OXV A;  3F2B A;  3W5O A;  3PIO A;  1JE5 A;  1GVP A;  3HKS A;  4YCU A;  1VQ6 A;  4JI5 L;  1J5E Q;  1I3Q H;  3J80 c;  3M3Y H;  1PH2 A;  2JE6 I;  1PH1 A;  3SGI A;  4C3I H;  4UP9 A;  2NZH A;  1VQ7 A;  1PYS B;  1HNX Q;  2VL6 A;  1VQE A;  4GN4 B;  4DV2 Q;  3AYH B;  2ID0 A;  4A3F H;  3I56 A;  2CCZ A;  4DV5 Q;  2FXQ A;  2AWN A;  2KEN A;  5IYB G;  3CMA A;  2VW9 A;  5JJI A;  1UE6 A;  1D7Q A;  3JC6 6;  1YHA A;  4X62 Q;  3J80 i;  3S2D H;  1GO3 E;  1N34 Q;  5HGQ A;  3HOW H;  2PMZ E;  1IZ6 A;  4PG3 A;  1J5E L;  2VZA A;  4JBM A;  4GOP B;  1EIY B;  4JI5 Q;  5C4X G;  4JI4 L;  1X3F A;  4PZ6 A;  1PFS A;  1VQK A;  2I5L X;  2IHE A;  1NBW A;  5E7N A;  2HHH Q;  3CCL A;  3TS2 A;  2UXD L;  1S40 A;  1FJG L;  1P8L A;  4JCV E;  1C7Y A;  1L1O C;  2KCT A;  3CP0 A;  4DR6 Q;  2KHI A;  2JEA I;  2RF4 A;  2A8V A;  3K0X A;  4WJ3 M;  3A0J A;  3MEF A;  5LMN Q;  1NMF A;  3W1G A;  1JJG A;  3U4V A;  2YV5 A;  2VY3 A;  4XIG S;  4GKK Q;  1P16 A;  4DV0 L;  5LMU L;  1CKM A;  1PH6 A;  1OXT A;  4DV2 L;  3H3V I;  1KHI A;  5IYC H;  4GKJ L;  1W2B A;  1HNX L;  3H15 A;  4LF7 Q;  3AQQ A;  5M5W H;  3PGZ A;  4BY7 H;  2UUC Q;  2JA7 H;  3CD6 A;  3I4N H;  4L5S A;  1K0R A;  3RN2 A;  4A3E G;  2UUC L;  4Y52 H;  2MNA A;  5JJL A;  4LF7 L;  2CWP A;  2MQH A;  1N33 Q;  1ASY A;  2JA5 G;  4NB3 A;  3STB D;  2AHO B;  4JI7 L;  4DAM A;  4A3K H;  1Q82 C;  5FLX c;  2RCN A;  1BBU A;  1SN8 A;  4DV1 L;  4OWT B;  2UU9 Q;  1B70 B;  3K7U C;  1YHB A;  1EFW A;  5LMN L;  3HOZ G;  4JYA Q;  2HIV A;  1HJP A;  1SR3 A;  4DUY L;  3L7Z C;  5IE8 A;  4PMW A;  1Y1V G;  2IHF A;  3NEL A;  4L5T A;  4JI3 L;  4LF4 L;  4YWK A;  4LNQ A;  4DUZ Q;  4LUO A;  2UXD Q;  4ALP A;  4B3R Q;  3HKZ E;  1VQD A;  2Q2H A;  5GRO A;  2HT1 A;  3GDE A;  2D0O A;  1VQ4 A;  1L2F A;  1K8A C;  2VUM G;  4QQB X;  2OQK A;  4OXP A;  1FVI A;  4JI3 Q;  1IBL Q;  3GD7 A;  3NBH B;  3G71 A;  1XNQ Q;  1G29 1;  1K3R A;  3BZK A;  2LXK A;  4PZ8 A;  3A74 A;  4NPS A;  4QGU A;  3J7Z C;  1LYL A;  1QUQ B;  3PUY A;  4RG1 A;  4DK3 C;  4DV5 L;  1H95 A;  4EQ5 A;  1YBY A;  4DR7 Q;  1KD1 C;  4P73 A;  4A3C G;  1IBL L;  1XNQ L;  3AFP A;  4JI2 Q;  4IO9 A;  4AIM A;  2BH2 A;  2ZJP A;  4HJ9 A;  5IYD H;  3H3V H;  1Y1W G;  1Q81 C;  4DR3 L;  4HIK A;  2JA6 G;  5LMU Q;  3PV0 A;  1XPR A;  1SRU A;  3W1B A;  4X64 Q;  4UP8 A;  2XGT A;  4GOP C;  1PH7 A;  3UDF A;  1E1T A;  3ZJY C;  1XPU A;  5IP9 H;  3HOV H;  1X65 A;  2WFW A;  4X66 Q;  3TQY A;  4BBS G;  4B3R L;  2K75 A;  1MKH A;  3NEN A;  4JI6 L;  2ZM6 L;  1RIP A;  1LUZ A;  4DPG A;  5FLM G;  4Y7N H;  3H0G H;  4LF9 L;  1E24 A;  1OTC A;  2CKZ B;  2E2H H;  1EQQ A;  4GNX C;  4A3J G;  3KDF B;  1I6H H;  1AE2 A;  1KQS A;  5M3M H;  4XTC S;  5AJ3 Q;  3E9I A;  4JI4 Q;  4DV6 L;  4DR5 L;  3K80 C;  1N33 L;  3AEV A;  3KFU A;  5J3B A;  3GO5 A;  4HJ7 A;  3CCU A;  2GN5 A;  1U0L A;  4JBK A;  4IOA A;  3PUX A;  2AWO A;  2QGQ A;  5M3F H;  3OW2 A;  4X62 L;  2JQO A;  4KI0 A;  4QL5 A;  4KHZ A;  5H1S E;  4A3D H;  3CCS A;  4BA2 I;  5EAY A;  3OTO L;  2OCE A;  4A93 H;  4OWX B;  4P75 A;  4OX9 L;  2VS1 A;  1Q12 A;  5GQO A;  3HOY G;  3FKI G;  3RLO A;  1PA6 A;  4DR6 L;  1BBW A;  4MZ9 A;  1L1O B;  1YI2 A;  3S1M H;  1CKN A;  4EX5 A;  1UE7 A;  1NJI C;  1DGS A;  3PF4 A;  4A3B H;  2F52 A;  1IBK Q;  2PQA A;  2KCM A;  4IPD A;  1BVS A;  4IFD G;  2JA8 G;  1YJW A;  2C35 B;  3HFZ B;  1N34 L;  4B3S L;  1KXL A;  3T1H L;  1VQ9 A;  1HR0 W;  1CUK A;  1TWC H;  4DUY Q;  4JI0 Q;  3D31 A;  1UE5 A;  4MTN A;  4HIO A;  4BBR G;  4IOC A;  5ELN A;  4DV1 Q;  1VQL A;  4A3I H;  1QVG A;  3M9B A;  5GAD C;  3HOX G;  2NVX H;  3RN5 A;  2DUD A;  4A3M H;  1VQ5 A;  4NXM L;  3KJO A;  3S2H H;  1VQB A;  1N36 Q;  2IY5 B;  2ZTE A;  4GLA C;  4LF8 Q;  3Q8D A;  3S1Q H;  2HIX A;  2WB1 G;  4DKA C;  1Q8K A;  3KJP A;  4DV0 Q;  4LFB Q;  3HOU G;  4GOP A;  3AFQ A;  3I55 A;  4JBJ A;  4AYB G;  2UUB L;  2EIF A;  4B3M Q;  4ME3 A;  3CC7 A;  1PHJ A;  2R92 G;  1HZ9 A;  3UDX A;  4YHH L;  2YYZ A;  3JAM i;  3PCO B;  4DR2 L;  1WJJ A;  1FL0 A;  1HZC A;  4DK6 C;  1XMQ L;  1WCM H;  3DLL A;  1JJ2 A;  1B8A A;  5C3E H;  4QY7 A;  3UDI A;  5FJ8 G;  1ASZ A;  2HHH L;  2B63 H;  2BA0 A;  3B6Y A;  1V1Q A;  3RLN A;  3RZD H;  4R4I A;  1XNR L;  2F4V Q;  2I5M X;  4WJ4 A;  4AQY L;  4C2M H;  1QVF A;  1VQC A;  4BY1 G;  3UE0 A;  3S14 H;  4K0K L;  3CCJ A;  1K9M C;  1IXR A;  1XTD A;  4YCV A;  4UY8 C;  4A3L H;  1KAW A;  3E0E A;  4HJ8 A;  1IYJ B;  2R93 H;  4JI1 Q;  1LM0 A;  2NVY H;  2MFI A;  4LWC A;  4AH6 A;  3UDG A;  4LF6 Q;  2R7Z H;  1C0A A;  1VCI A;  3TS0 A;  1IBM Q;  3F8T A;  4P74 A;  3TRE A;  1YNX A;  3BZC A;  1YEZ A;  2NN6 I;  1VQP A;  2GVB A;  4IPC A;  2B3G A;  2D0P A;  2L15 A;  4BXX G;  1HNW L;  4LUZ A;  1A62 A;  4DV3 Q;  5IYC G;  2E5L L;  3I4N G;  1XMO L;  3T1Y Q;  4A3G H;  1S3O A;  3I4M G;  4GNX B;  1EWI A;  4JI8 L;  2ALY B;  1QZG A;  3PO3 G;  2JA5 H;  3RR5 A;  1I94 Q;  2E2J H;  4IFD J;  2PI2 A;  1G6P A;  4A3F G;  1A8V A;  4LFA Q;  1Q7Y C;  3L2P A;  4IJL A;  1YVC A;  4GLV B;  5IYB H;  1V9P A;  2IT1 A;  3CC2 A;  3RZO H;  1X54 A;  1I5F A;  5HY6 A;  4JI8 Q;  4DAY B;  1JMC A;  2RHS B;  2VQF Q;  3A5Z B;  4NXN Q;  4YY3 L;  5IP7 G;  5ELO A;  3PUZ A;  4GLX A;  4IJH A;  3CAM A;  3TEH B;  1HR0 L;  1HH2 P;  3M85 A;  1Z9F A;  1HNZ Q;  1VQM A;  2VQE Q;  4POF A;  4LF5 Q;  1A63 A;  4LF5 L;  4DR4 Q;  2B29 A;  2VQE L;  1X6O A;  4H02 A;  2R7F A;  2WP8 J;  1AE3 A;  1Q1B A;  1SE8 A;  1SMX A;  1YIT A;  4R4T A;  4FDB A;  3RNU A;  4LFC L;  4R4C A;  3ER0 A;  2ZJR A;  1X3G A;  4B3T L;  2Y0S G;  4OWW B;  1GD7 A;  1D8L A;  2I5H A;  2WB1 E;  2K14 A;  1LTL A;  1C9O A;  2JEB I;  1SLJ A;  2UXC Q;  3KDF A;  4PZ7 A;  5GAE C;  2KBN A;  3CW2 C;  4DV7 Q;  1Y1W H;  2OTL A;  3S1N H;  1KRT A;  2OWO A;  3TRZ A;  4HJ5 A;  1PH4 A;  4P72 A;  5DLQ E;  2HQL A;  2NZO A;  4YWM A;  4YHH Q;  2QEX A;  4DR2 Q;  1PV4 A;  1PH5 A;  1AH9 A;  3HOZ H;  5IP9 G;  1MJC A;  1E22 A;  3OYY A;  1U5K A;  3PSI A;  4JOI A;  4BBS H;  4JV5 L;  2PQA B;  1I94 L;  4JC0 A;  4X65 L;  3VDY A;  1OXU A;  4DV4 L;  1N32 L;  5IT9 c;  2WAQ G;  2V1C C;  1SRO A;  1HNZ L;  2UUA L;  5C4X H;  4IFD I;  4DV3 L;  1CSQ A;  2E8G A;  3KF8 B;  4A3J H;  5K36 G;  4J15 A;  4KHP L;  2K5N A;  3U58 A;  1EYG A;  3CXC A;  2VQF L;  1L1O A;  1WI5 A;  4POG A;  3GTM H;  2EQS A;  3F2C A;  3CF5 A;  3PO2 G;  1PYB A;  5C44 H;  1VQH A;  4X65 Q;  3S15 H;  2QA4 A;  2JJQ A;  1NMG A;  4A3D G;  1CSP A;  2JA9 A;  4JI0 L;  5BR8 Q;  1I50 H;  4C3J H;  1OXX K;  5IWA Q;  2CWA A;  3T1H Q;  4K0K Q;  2K4K A;  4IPG A;  3DM3 A;  4BY7 G;  2N3S A;  3BU2 A;  3KLW A;  2MO0 A;  3HOY H;  2JA7 G;  2UXC L;  5JEA G;  2ZTC A;  3ERS X;  4LUV A;  4A3E H;  2UXB Q;  2UXB L;  1TXY A;  2DGY A;  2Z0S A;  5M5Y H;  2PNH A;  4A76 A;  5C0X G;  3RLF A;  2JA6 H;  3EIV A;  4A3K G;  1UE1 A;  1QZH A;  4UPA A;  1K83 H;  1V43 A;  3F2D A;  4LFC Q;  2JA8 H;  1Z47 A;  2RHQ B;  2NVT H;  4O0A A;  1IBM L;  4OX9 Q;  3KF6 A;  1K73 C;  4DR4 L;  2UUB Q;  1S72 A;  1BKB A;  5FLM H;  4HIM A;  3HOW G;  3H0G G;  3J81 c;  2OTJ A;  1X56 A;  1VQ8 A;  4KLK A;  1JT8 A;  1OXS C;  1TWG H;  2ES2 A;  1EOV A;  4LF8 L;  3M4P A;  4A3I G;  1YJ9 A;  1K8G A;  1VQO A;  2AKW B;  4NXN L;  2F4V L;  2UUA Q;  1W3S A;  4DV6 Q;  3MXN B;  1E3P A;  1T9H A;  4DR1 Q;  2JK8 A;  2MO1 A;  3UE1 A;  1QUQ A;  2R7D A;  1X9N A;  3S24 A;  3U50 C;  3GTP H;  5GAG C;  1XPO A;  4JBW A;  2Q2I A;  2XTI A;  3J81 i;  4C3H H;  1VS0 A;  2YU9 H;  2BA1 A;  4IPH A;  2K50 A;  1X3E A;  4JG2 A;  3A5U A;  2ZM6 Q;  2IX0 A;  2N8N A;  3KOJ A;  3CC4 A;  4JI6 Q;  3GTK H;  5M5X H;  1N9W A;  1QVC A;  1RL2 A;  2CFM A;  1XJV A;  2I0Q A;  3F1Z A;  4QIW E;  1VQG A;  3CCE A;  4DR1 L;  2ASB A;  2Q2U A;  5IYD G;  4A3B G;  4HJA A;  1WCM G;  4DR3 Q;  4R4Q A;  1WYD A;  5C3E G;  5FJ8 H;  2E5L Q;  4OO1 G;  1HNW Q;  4KHP Q;  3CCQ A;  3EBE A;  1WOC A;  2YTY A;  2NVQ H;  4NXM Q;  3S16 H;  1UWV A;  3I7F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...