1FJGQ

Structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotics streptomycin, spectinomycin, and paromomycin
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Functional insights from the structure of the 30S ribosomal subunit and its interactions with antibiotics
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 21
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2000-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1fjgQ00
3BJUA 4PZ7A 1XPUA 4LF7Q 2JA8G 1QUQB 1SROA 5LMNQ 4DV5L 1CKNA 3M4PA 4X6AH 3HOUG 1L0WA 1VQNA 1XNRQ 2MQHA 3F2CA 1PH9A 4A3GH 3CCJA 4JI3L 4A3KG 4NXNL 1KQSA 1ASZA 2E5LQ 4O2DA 3UDXA 2NVTH 5IYCH 2YU9H 3S2HH 4JCVE 1VQKA 5C44G 4AIMA 1IZ6A 3JAMi 1PA6A 4IPHA 2NVQH 4ME3A 4GOPB 1WYDA 4L5TA 1VQLA 1SFOH 3CAMA 2QGQA 4DV3Q 4IFDI 1K3RA 3RLNA 3CPWA 4HJ5A 4BBSH 1IBML 3I2ZA 2OCEA 1W3SA 3PIPA 1C9OA 5M3MH 4OWWB 1VCIA 3M4QA 4KHPL 4PG3A 2R93H 3M85A 5GAHC 1BVSA 1JJCB 1Y1VG 2WB1E 3TS0A 1PH7A 2VY3A 3K81C 3UDFA 3I55A 3D31A 3J81i 1M1KC 2E2IH 1EWIA 1QUQA 3HOVG 2K75A 4WJ4A 2JK8A 4AYBG 2WFWA 4LUOA 4P74A 1W2BA 1SMXA 4A93G 4TVAB 1YITA 3PF4A 3CC2A 2NN6I 3H0GH 3STBD 3J81c 3NELA 5HY6A 2IY5B 2UU9Q 2YTXA 4KI0A 2F4VQ 4BA2I 3RZOH 1YJ9A 2A19A 1J5EL 5FLXc 1HNWL 3K7UC 3L7ZC 1XJVA 1Q86C 1Q82C 1VQEA 3CCVA 4YWKA 1CUKA 3FKIG 2R7DA 4MTNA 1QVFA 1MJCA 5IYDH 4IJLA 2WAQE 4GLVB 3KOJA 4GLAC 2JA6H 3U50C 4B3TQ 3WWVA 2VUMG 3AFPA 1B70B 1PYSB 2JEAI 4GOPA 3S17H 2GN5A 3AFQA 3KYHC 5IE8A 4AQYL 1CKMA 2R7FA 4IJHA 3H0GG 4IO9A 1CSQA 3CQZH 1KXLA 1HR0L 3T1HQ 4A3KH 4BY1H 4NXNQ 3CCSA 5IYCG 5IY0A 4BBRH 2F3IA 4NPSA 4J15A 3I4NG 3H3VH 1TWAH 4O0AA 2CKZB 2OWOA 5C0XJ 1Q1EA 2IHEA 4HJ7A 4A3DG 2UXDQ 3CPFA 3BZCA 4L5QA 2Q2IA 1IBLQ 1KD1C 3E9HA 3PV0A 4KHPQ 1IXRA 2HHHL 1WFQA 1JJGA 4C2MH 1UE6A 2HIXA 2ATWA 4X64Q 3RR5A 3A5ZB 1EFWA 2N8NA 3VDYA 3JC66 3AEVA 3M4OH 4LF8L 1SRUA 1R9TH 4ALPA 4HJAA 3FKIH 4B3RL 1RIPA 3I7FA 1MJEA 2PI2E 4X64L 1YNXA 3I4NH 3UE1A 1KRTA 1EYGA 4IOCA 1TWGH 1FJGQ 1SLJA 2B29A 4KLKA 4A75A 1IBKQ 1K9MC 1J5EQ 4P71A 4JI1L 1HNZL 2ASBA 1KAWA 4LFAL 1K0RA 1OXSC 2OQKA 3GTJH 3CCQA 1VQOA 3HKZE 3J81j 3CCUA 1ASYA 3PSIA 1XMOQ 2XGTA 1YBYA 2XTIA 2E8GA 2B63H 4A4IA 2HT1A 3RLFA 2B3GA 1EQRA 1WCMG 3A0JA 1NY4A 4BBRG 1HR0W 2VUMH 1CKNB 4LFAQ 2Q2HA 4A3CH 1C7YA 2LXJA 1VQDA 1PHJA 5HGQA 3GO5A 1X3GA 4AQYQ 2UUBQ 1A63A 2PQAA 1I5FA 1L1OB 4P72A 2LSSA 3KF6A 3PCOB 4YCVA 5ELOA 2VQEL 1UEBA 1Y1WH 4BXXG 4DV0L 3GDEA 1I94L 2KENA 4BY7H 3A5UA 1TXYA 3F2DA 5IWAQ 2HQLA 5DLQE 1X65A 3U58A 1A62A 5C4XG 2I5LX 4QIWE 4A3FG 4DK6C 2N78A 2CFMA 3S15H 2IX0A 2UXBQ 4KHZA 4QJFA 2D0OA 1TWHH 1Z9FA 5EAYA 2OTLA 5M3MG 4LF8Q 3W1GA 1KL9A 4JBWA 4C3JH 1Y1WG 1MIUA 4DR2L 1JB7A 4R4QA 2CWPA 2GVBA 2IHFA 2MFIA 2ZTDA 4QL5A 4PMWA 4RG1A 5C44H 3OYYA 4LF9L 4GKKL 4QQBX 5JJLA 3HOVH 4OXPA 4GN3B 5IT9c 1VQMA 2RF4A 4P73A 4K0KQ 3PUYA 4DR6Q 1IBKL 2BA1A 5IP7H 1VQCA 2R93G 2V1CC 3EIVA 3J80i 4C3IH 4DR5L 1XNQL 1Y1VH 2RHSB 1N32Q 2YYZA 4K0KL 2Z0SA 2UUCQ 4JI2Q 3IRBA 3T1YQ 1N33L 1PVOA 3NENA 4DV7Q 5C4XH 4DR3L 1K8AC 1Q46A 5FLMH 3E9IA 3ER0A 1SE8A 2KHIA 4MNOA 3CMEA 4DUZL 5FJ8G 1YJWA 1N34Q 4IPDA 4Y7NH 3HOWH 4IFDG 4DAYB 1AH9A 2ZTEA 4DV3L 4LF5Q 5IYBG 4A3IH 3HOZH 4DV7L 4DR3Q 2R6GA 1U0LA 3RNUA 4DUYQ 1A8VA 1VQ7A 1I94Q 3GTMH 3K8AA 4DUZQ 1S72A 2Z6KA 3F8TA 4YCUA 4JBMA 2NZHA 2JA7G 5IWAL 3GTLH 3STBC 4LFCQ 1Q7YC 2WAQG 2KBNA 1X3FA 4JYAL 1PFSA 4OX9L 3CCMA 3PF5A 3SGIA 1EQQA 2ALYB 2UUAL 4DR7L 2JA6G 4DV1Q 1T9HA 1NTGA 1X55A 4LFCL 2MO0A 3ERSX 1RL2A 1N8RC 4B3SQ 5IP7G 4XIGS 3GTQH 2L15A 3CP0A 4A76A 1Q1BA 4R4IA 1N36Q 3HOXG 4X65Q 1U5KA 2KHJA 2K5HA 2K4KA 2PMZE 2JA8H 3OTOQ 4A3JG 1BBWA 5M5XH 4X65L 2WP8J 2ZJRA 4LF7L 4DV6Q 1I3QH 4X66L 3H3VI 4WJ3M 1HZ9A 4BA1I 4B3MQ 4LF4L 2OQ0A 3HKZG 3S1QH 2K5VA 3AYHB 1VQ9A 3ULJA 1WI5A 3KFUA 5IYBH 3CC4A 3FP9A 2ZTCA 1XNQQ 4R4CA 4LF6L 1JMCA 3ZJYC 1MKHA 1Q12A 4TQUS 5J3BA 1EOVA 1NMFA 4JI6Q 4H02A 3U4VA 3KJOA 1KC8C 3M9BA 4OO1G 2ID0A 5K36G 1P16A 3NEMA 3MEFA 1X3EA 4A3JH 1YJNA 1PH6A 4UP8A 1KIXA 5M5YH 4JI3Q 1PYBA 3AQQA 3CF5A 2ZM6Q 2AKWB 4UP9A 5C0XG 3GTGH 4JI5Q 4DK3C 3S14H 1Q81C 2AWNA 3I56A 4A3FH 2N49A 3HOXH 2VS1A 3PUZA 3HOYH 2LXKA 1X56A 1IBMQ 1QZHA 3KLWA 1VQPA 1BKBA 2AHOB 2R7ZG 3K0XA 3F1ZA 4OX9Q 2DUDA 1GM5A 3JAMc 3OW2A 1E24A 3CC7A 4OWXB 4NXML 4JOIC 4OWTB 1HNWQ 4X62L 4GN5A 5M3FG 2D62A 1FJGL 4GKJQ 3S1RH 4XTCS 4HIMA 2EIFA 3J7ZC 1UWVA 1A0IA 3NBHB 4X62Q 2RCNA 3W1BA 3I4MG 1HZCA 4HJ9A 4LUVA 4JV5Q 2UU9L 2F4VL 3HOYG 3FHWA 1VQJA 1YZ6A 3S1NH 3G48A 1AE2A 1YHQA 4JBKA 4POFA 1KRSA 4QY7A 4DKAC 1NBWA 2PNHA 3DLLA 3S2DH 2KCTA 2NN6G 2Q2TA 1HZAA 1HR0Q 3PO2G 4DV4Q 2K50A 4HIOA 2DGYA 1YI2A 4DR4L 3K7AH 2IT1A 5E7NA 4L5RC 5FLMG 2JA9A 4JG2A 5LMNL 4DV5Q 1IL2A 3ICEA 1UE5A 2BA0A 2C35B 2I5MX 1XTDA 1XNRL 5H1SE 4JI6L 2JE6I 4JI8L 4DR1L 2D0PA 2F52A 3KDFB 4LW1A 4YWLA 1GO3E 2K14A 4LWCA 3RZDH 2R7ZH 5C3EH 2JA5H 2JJQA 4AYBE 1X54A 4JOIA 5BR8L 1O7IA 2ZJPA 2EQSA 1L1OC 3Q8DA 4JI5L 3G71A 5M3FH 2UXBL 3RLOA 1PH8A 1HZBA 4B3RQ 1GVPA 5BR8Q 4YY3L 4HIDA 1K8GA 1HNXL 1M90C 3KF8B 1B8AA 2UXDL 4C3HH 1IBLL 1WJJA 1I6HH 2HHHQ 3GD7A 1K73C 1HH2P 3TEHB 1E7ZA 1VQFA 2JEBI 4LUZA 4YWMA 4DAMA 4YY3Q 2YV5A 1PH5A 3G6EA 4LF9Q 1OXVA 4NXMQ 1YHAA 5JEAG 1VQ6A 1XMQQ 4JC0A 4JI4Q 3J7A5 4A3LH 1G6PA 3LGJA 3ULLA 3HFZB 2QEXA 4A3IG 3HOZG 1NJIC 1SR3A 4GKJL 3MXNB 3TREA 1JJ2A 5JJKA 2NVXH 2VW9A 1H95A 1DGSA 1GKHA 2Z6KC 1QZGA 4A3MH 1E3PA 1XMQL 4DR5Q 4JI4L 2WB1G 1S40A 3I4OA 5GAEC 4DV2L 1CKOA 4EQ5A 2E2JH 4R1JA 4APVA 3T1YL 2UUBL 1N33Q 4BY7G 1V1QA 4JI1Q 1HNZQ 5C3EG 3GTKH 1N9WA 5IP9G 4B3TL 1X6OA 4OONA 3UDIA 1FVIA 5GQOA 2MNAA 3ULPA 1N34L 2JA5G 3GTPH 3M3YH 1E1TA 4IPCA 3S16H 4GNXB 1XMOL 3HOUH 4EX5A 4LF5L 3EBEA 2VQFL 3CCRA 1VQ5A 4HJ8A 4IFDJ 4UPAA 1E1OA 1LM0A 2YTVA 3B6YA 3CW2C 3T1HL 4GN4B 3DM3A 4JI8Q 4DR1Q 1YHBA 1FGUA 5AJ3Q 3PO3G 1TWCH 1G51A 4GNXC 3G4SA 3CCEA 4DV0Q 2GVAA 4GS3A 2VNUD 1NE3A 1OXXK 2N3SA 2H5XA 4R4TA 3KDFA 5JJIA 4YHHL 3S24A 3GTOH 1IYJB 1TWFH 2R92G 2MO1A 1SN8A 1VQHA 4GLXA 1I50H 1EIYB 1Z47A 4L5SA 2IX1A 1K83H 3RN2A 1HNXQ 3TRZA 1BBUA 3J80c 4A3MG 2Y0SE 1N36L 1PH3A 4GKKQ 2E2HH 4YHHQ 3M7NA 1WOCA 4BY1G 2AMCB 1VQ8A 1XPOA 4DR6L 1L1OA 2NZOA 4JI0Q 1D8LA 1PV4A 3EN2A 2ES2A 3L2PA 4AH6A 1XPRA 4Y52H 1JT8A 5IP9H 3PIOA 2UXCL 3H15A 1LUZA 1UE1A 1JE5A 4DPGA 1LTLA 4JI0L 4JI2L 3CD6A 4A3BG 5IYDG 2JQOA 3CCLA 1D7QA 4JBJA 1L2FA 2I5HA 5LMNW 3A74A 2B63G 3PUVA 1PH1A 2A1AA 4IOAA 3S1MH 2UXCQ 2BH8A 4QGUA 4DV2Q 3UDGA 1NMGA 5GAGC 3PO3H 3W5OA 2K52A 2E5LL 2I0QA 1VQAA 3BZKA 5LMUQ 4YCWA 4A3DH 4PZ8A 4DUYL 3TS2A 1N32L 2CWAA 1VQGA 1PH4A 2AWOA 3CXCA 2UUCL 1AE3A 2HIVA 1OXUA 4UP7A 3F2BA 1UE7A 2VQFQ 3RN5A 5LMUL 4MZ9A 5M5WH 1LYLA 5C0XI 2ZM6L 2VQEQ 1V9PA 5ELNA 4UY8C 2R92H 4P75A 2YTYA 4JYAQ 4OO1I 3L0OA 2PI2A 4NB3A 3HKSA 2CQOA 4RMFA 4DR7Q 3PUWA 4R4OA 1HJPA 1QVGA 3I4MH 5AJ3L 5FJ8H 1Q8KA 2K5NA 1G291 3HOWG 4A3EG 3BU2A 2Q2UA 4POGA 1WCMH 3D0FA 3E0EA 1OXTA 4FDBA 4LFBQ 1EUJA 1S3OA 5GADC 1E22A 2ZJQA 3PO2H 1EIFA 2EXDA 1KHIA 3PGZA 4JI7Q 4A3BH 2FXQA 2PQAB 5C4JH 2JA7H 1OTCA 3KF6B 4GNXA 1V43A 1PH2A 2UUAQ 4A3GG 1Y14B 3PUXA 2VL6A 4HIKA 1X9NA 4A3LG 4LFBL 3UE0A 2RHQB 2OTJA 4PZ6A 4DV6L 4GOPC 4X66Q 2NVYH 4DV1L 1YIJA 4B3SL 4DR2Q 1GD7A 4JI7L 4B3ML 4LF4Q 2Y0SG 1C0AA 1VQBA 1VQIA 1J6QA 3CMAA 4A3CG 2VZAA 5GROA 1B7YB 4JV5L 3K80C 3TQYA 2BH2A 4BBSG 4IPGA 1CSPA 2QA4A 4A93H 1FL0A 4LF6Q 4DNIA 1VQ4A 1P8LA 3U4ZA 4A3EH 4LNQA 2KCMA 1YVCA 4BXXH 3KJPA 4DV4L 1QVCA 2CCZA 2A8VA 4DR4Q 5JEAJ 3OTOL 1VS0A 1YEZA
chains in the Genus database with same CATH superfamily
1UEAB 5LMNQ 1CKNA 3H94A 1BR9A 3HOUG 1IW7C 4IURA 1VQNA 1EYAA 3OSOA 2MQHA 2DNCA 1GHKA 4JI3L 1ASZA 4WORA 5IYCH 4JCVE 4AIMA 1IZ6A 4ME3A 1WYDA 1IYUA 4L5TA 4U673 1SFOH 1VQLA 2QGQA 4IFDI 3N6RA 4HJ5A 1IBML 3BDCA 2JA5B 1AZPA 4FP5D 3HG9A 1EY6A 2XWBB 1EWIA 1EWCA 1GJXA 1NR2A 2DY7A 3KF8A 3VR3A 4EVOA 4LUOA 1SMXA 4XXEA 4TVAB 1YITA 3PF4A 4IUTA 4FNFA 2IY5B 1STGA 3OMGA 5K5PA 3S1NB 2KCCA 1FNVA 1Q86C 5DNFA 3CCVA 2R7DA 4MTNA 1Y8NB 2WAQE 1B4OA 3KBGA 1F2MA 3KOJA 3QR8A 3K5MA 1TWGB 2HDLA 2K6AA 3U50C 3WWVA 4B3TQ 3AFPA 1B70B 1SE2A 4IJHA 2NTSA 3AB9A 3HRZC 1SJHD 1V1PB 3CQZH 3T1HQ 1JOOA 4BY1H 5A2QL 2F0EA 5IYCG 3K5OA 2XRSD 4NPSA 5J1ZA 4N8X1 5HURA 1Q1EA 2IHEA 2QF7A 2XWJB 4KKUA 2CQAA 3E9HA 1IXRA 2DJFC 4DNTB 1O7ZA 2ATWA 5I2YA 4CJ2C 4DGZA 2N8NA 2F0TA 1Q3LA 1SRUA 1A6XA 2CW0D 4B3RL 3J7AV 4OO1H 4X64L 2B8FA 1YNJC 2F0LA 3ND8A 1QNKA 5KNDA 4GZYC 1IBKQ 2M9VA 1KAWA 1K0RA 2OQKA 3MEHA 1JOQA 3CCQA 1TU2B 1Y8PB 2X69A 3NP8A 3S1NH 1WCMG 3A0JA 1NY4A 1CKNB 2Q2HA 4NP5A 5JVH3 4UDUC 2LXJA 1VQDA 3KLSX 1YNNC 1A2UA 4IUNA 5KYLA 1L1OB 1NAPA 1S5DD 1KAAA 5C4HA 1M4VA 3GDEA 1I94L 2HD3A 1LT6D 4J6HA 3RMHA 4DA2A 5I6WA 3I8ZA 2HQLA 5DLQE 3SK6A 3U58A 4TRDA 4A3FG 3D8GA 4K8IA 1NCVA 3R2TA 2UXBQ 2X6LA 3D4DA 3FKIB 5EAYA 3OWEB 3R2IA 3W1GA 4C3JH 4OGQC 4R4QA 2CWPA 5CBAE 2MFIA 3OYYA 1Y1WB 5JJLA 1VQMA 5IT9c 3S14B 4K0KQ 5IP7H 2V1CC 2FINB 4C56C 1N32Q 5COYA 1I4RA 1G2TA 3GTJB 3NENA 4DV7Q 2B2YA 1AFPA 1K8AC 1QILA 1Q46A 5FLMH 3E9IA 3ER0A 1SE8A 2KHIA 4KY6A 3FEWX 2RCFA 1C48A 1GUGA 4A3IH 4DV7L 4DR3Q 2R6GA 1U0LA 1C4QA 5J39A 1I94Q 3GTMH 1AP0A 3A8KE 4JBMA 1LTAD 5ISRA 2JA8B 2KBNA 1H9SA 1ZXTA 3MXGA 5K36H 2ALYB 4XT3B 2HCCA 1X55A 2B2UC 1RL2A 1HPCA 1K28A 3CHBD 2L9HA 1KLGD 2VUMB 1U5KA 3TMEA 2KHJA 3SK5A 2EYOA 3P7JA 2PMZE 2TSSA 3OTOQ 4CJ0B 1CK1A 4LF7L 3H3VI 1X32A 4WJ3M 1STAA 4B3MQ 2WINB 1XYIA 2SDFA 3ULJA 1WI5A 2L0CA 3CC4A 1XNQQ 1KLUD 4R4CA 4LF6L 3I4NB 1JMCA 2O5IC 2IWHA 5J3BA 4WJWA 1NMFA 3VR2A 5C4XB 4JI6Q 3VR4A 2PQEA 2F0PA 3KJOA 1ZYRD 4LAAA 1JOKA 1P16A 3Q24A 4RH6A 1LT4D 2NZ1D 1X3EA 1PH6A 5T1GA 3AQQA 2LKVA 3H0GB 5EKLA 1BXTA 1I4PA 5D3IB 3A8JE 3EFXD 1Q81C 4FVMA 4KTAA 4KD3A 2B2VC 5CMDA 2R7ZG 2AHOB 4OX9Q 1UAPA 4I7ZC 3FMCA 1D1IA 1HNWQ 5EKIA 2K04A 4X62L 4V0BA 1SYBA 2D62A 2O2LD 1ZKOA 4KV6A 2G5DA 2SOBA 1FJGL 4GKJQ 4XTCS 1EIGA 1EU4A 3U9SA 1EQTA 2E2JB 4HIMA 1B53A 3KLRA 1SYCA 3HOWB 3I3CA 4X62Q 3W1BA 1HZCA 1NNXA 4JV5Q 2EY6A 3L3OC 4AYBB 2UU9L 1VQJA 4L8JA 3G48A 4CGYB 3J80L 1YHQA 2F0KA 4ZAIA 4ZLTF 2Q2TA 1HR0Q 4HIOA 3ITPA 5FLMG 1D6EC 5LMNL 4A3DB 4S3SA 1IL2A 2KJXA 2F03A 3E6ZX 3N52A 4JI6L 4DR1L 1I6HB 1IL8A 2Z1CA 3K59A 2QCPX 2A69D 5C3EH 2ZJPA 4N9PA 3VYUA 3NWTA 3GTKB 2QDBA 3MZ5A 1EY7A 2F4IA 5I4DA 1GVPA 4HIDA 2EVBA 1JR0D 1PZKD 4C3HH 5E4XA 4C1NK 5FKAC 1IKMA 3TSSA 5E3FA 2D5DA 1SYFA 4LUZA 1PH5A 3IL8A 1VQ6A 3G6EA 3J7A5 3D3RA 1ZEQX 4A3LH 4JI4Q 4KK7A 1DJRD 4DAYA 4DK0A 2F0JA 4A3IG 1HRJA 1E2VA 1JJ2A 4KY5A 4FYDA 2NVXH 1H95A 4ZCKA 2Z6KC 3Q23A 4JI4L 5GAEC 2E2JH 4R1JA 1FNWA 2PW7A 2NN6H 5D14A 4XYOA 1X6OA 5EBCA 4QF4A 1FVIA 5GQOA 2JA5G 1E1TA 3GP7A 1HTPA 2ZT9C 4HCSA 1PRTB 1DXMA 4LF5L 1GHJA 2VQFL 4BBSB 3CCRA 2MUYA 4HJ8A 2DY8A 1PTOD 1ET9A 2A6EC 4L6TB 5JJZA 1O7LA 1O78A 1YHBA 4ILWA 5AJ3Q 1G51A 4GNXC 1I4HA 5A35A 1R9TB 2GVAA 4GS3A 2VNUD 1NE3A 2N3SA 1IYVA 3KDFA 1B3AA 4XDXA 1TY0A 3GTOH 1HA6A 5KEEA 4GLXA 1I50H 3QOJA 1EIYB 4L5SA 1NUCA 1HNXQ 2RDFA 4A3MG 2Y0SE 4PMBA 4FF3A 2AMCB 4K2KA 1MSHA 2RKSA 1D8LA 2F0DA 1Q90A 4AH6A 3S1QB 4Y52H 3PIOA 4ID6A 1EQVA 2I5HA 3A74A 3FPUB 3PUVA 1PH1A 1XTCD 4DV2Q 5GAGC 2E5LL 3W3AA 3BZKA 4CKBA 4RFBA 4E6IA 4XQQA 3GTGB 3M7GA 2AWOA 2F0SA 5EKKA 1K0SA 2HIVA 2J4XA 3HP3A 3F2BA 4RCOA 1HQMC 2NYZD 2VQEQ 4OO1I 1V9PA 4JYAQ 3L0OA 3P75A 1SMYC 2PI2A 4NB3A 3HKSA 4M8AA 3PUWA 5IODA 5BN3A 3HOWG 4A3EG 1LTBD 4POGA 1H9JA 1CZGA 3G7LA 2JXMB 3IAYA 2EXDA 4A3BH 2AQ3B 3H91A 5C4JH 1OTCA 3KF6B 1PH2A 1LTGD 1Y14B 4A3LG 2VL6A 4PQXA 4LFBL 2R7ZB 1L0XB 4DV1L 4DR2Q 2Y0SG 1VQIA 1J6QA 5I6YA 3NTHA 3K80C 3TQYA 4BBSG 2QA4A 3CRLC 4LF6Q 1VQ4A 4A3EH 3U4ZA 3I4LA 5C5MA 2K05A 5IOCA 2F0UA 1SAPA 4DV4L 2CCZA 1SYDA 1T5EA 1TWFB 5KNCA 5JEAH 4PZ7A 4CDEC 4LF7Q 1SROA 1K3BC 1PFBA 3F2CA 3I70A 1EZ6A 3CCJA 1KQSA 1E0BA 1PRTC 2NVTH 3PO3B 4U68A 1VQKA 5C44G 2NVQH 3JAMi 5CV8A 4GOPB 2NVYB 4ME5A 4DV3Q 1K3RA 1PTOB 3RLNA 5EGTA 5FOBB 4KHPL 1BDOA 1VCIA 2R93H 3PQIA 5GAHC 1BVSA 1JJCB 1Y1VG 2JYOA 3TS0A 1PH7A 2HUGA 3D31A 4C1NI 5I2XA 2E2IH 3HOVG 2K75A 4WJ4A 2WFWA 3OOCA 4P74A 1HTLD 4Q5VA 4A93G 1ET6A 1BCPC 3NELA 1DOLA 1CI3M 4KKSA 4RCNA 2UU9Q 4BA2I 2HDMA 4EGVA 1FYCA 1YJ9A 1B9MA 3L7ZC 1XJVA 1Q82C 2PCFB 4YWKA 1W6KA 1S5FD 2D9UA 4K8JA 3A55A 3S1MB 3S1RB 3J80E 2JEAI 1BCPD 5C3WA 4GOPA 3S17H 3KYHC 1PDQA 1CSQA 3NTKA 5FO8B 1HR0L 1I4GA 2CVRA 3CCSA 4IUUA 4DAVA 2F3IA 4KN7C 4BY7B 1EY9A 5C0XJ 1C8CA 2LMCB 1KD1C 3PV0A 1TWAB 4LJZC 2HHHL 5DEHA 1JJGA 4X64Q 1L0YB 3NQTA 1AEXA 4O1NA 3JC66 4LF8L 1SE4A 4ZUIA 1RJTA 2PI2E 1D5ZC 3I4NH 1S5BD 1FJGQ 4KLKA 4A75A 4P71A 2ASBA 1UUPA 3VYSA 1OXSC 3GTJH 1WTPA 4FXDA 5G3LD 4C3JG 1ASYA 5LL6S 5IIFA 1YBYA 2XGTA 1XMOQ 2E8GA 4CDCC 5C3XA 2B3GA 1SNMA 4BBRG 2EYFA 2VUMH 1MSGA 1Y8OB 3RUZA 3GO5A 2I46A 1BUVT 2PQAA 1I5FA 1F9QA 3KF6A 4YCVA 5ELOA 4JVZA 2VQEL 1Y1WH 4BXXG 5CORA 2CH4A 1S5CD 3S2DB 5D65A 3Q6SA 2K32A 3TP6A 5IT9L 2K28A 1TY2A 3LX0A 4RWSC 1ICWA 3S17B 3S15H 4ODGA 4QJFA 5CV5A 3PMFA 1Z9FA 3JAML 5M3MG 1JE4A 1Y1WG 4JBWA 4DR2L 2G9DA 1JB7A 2GVBA 2IHFA 5FLXL 2B63H 4PV1C 5I9OA 1LABA 3HOXB 3WOFA 2RF4A 5IGBA 2BA1A 1VQCA 1JWSD 1RDPD 2KA7A 2Q8TA 4C3IH 4DR5L 1XNQL 1LTID 2Z0SA 3DUZA 4KJNA 2UUCQ 3IRBA 1HCZA 4G7ZC 5C4JB 1QCBD 1N34Q 2F0HA 4IPDA 5ELDA 1PTOH 1AH9A 1PYWD 3RNUA 4DUYQ 3AU7A 4DUZQ 1LACA 4XT1B 1Q8IA 2Z6KA 3HZXA 4X3UA 2NZHA 2JA7G 5EPLA 4K2LA 1X3FA 4JYAL 1PFSA 3SGIA 3H3VC 5FO9B 4DR7L 2A6ED 2JA6G 2KECA 3TP8A 3OWFA 3MWYW 4DV1Q 1T9HA 1N8RC 3GTQH 5JVG3 4XIGS 2B2YC 2L15A 3CP0A 1EZ8A 1I4QA 4R4IA 4X65Q 1EY4A 3S9WA 3FRPB 4K6DA 2JA8H 1XX8A 4A3JG 5M5XH 1EY8A 2ZXPA 4X65L 2ZJRA 1I3QH 3T4AC 4R8NA 1STYA 1HZ9A 1MI2A 1GUNA 3S1QH 3AYHB 2FMMA 2AUJD 1GUSA 3NHHA 1LV9A 2HQEA 2ZTCA 1HHVA 3SEBA 3TDQA 1Q12A 3NBHA 1A3VA 1U4MA 1EOVA 3U4VA 4MIUA 3M9BA 4ZYSA 4G57A 2ZXOA 5K36G 3NEMA 1QE6A 3MEFA 1YJNA 4A3JH 4JI3Q 2B2UA 3U9OA 1R4QB 5E1FA 2PNRC 1II3A 4DK3C 3S14H 2AWNA 2VS1A 3NE5B 3HOYH 1ENCA 2LXKA 1X56A 1IBMQ 1BKBA 4NMZA 1EFID 4WRDA 3SR1A 2RBMA 4NW2A 3FDTA 2LFNA 4NDXA 1CHQD 3CC7A 1VF7A 3DM1A 4NXML 3IKJA 1GOZA 4GN5A 2EIFA 4Y7NB 1LT5D 1ML0D 1A0IA 1RF2D 2NVTB 3DEOA 4A3MB 3X3MA 1RHPA 4LUVA 3FHWA 1YZ6A 1WD0A 1AE2A 2AQ2B 4DKAC 3DLLA 1VF5C 1YI2A 1SBBB 4HMJA 5E7NA 2JA9A 3ICEA 2Z4HA 5H1SE 2XNAC 2K1BA 2D0PA 4LW1A 4BBRB 3EVQA 2B63B 3UI2A 2B2TC 4DU9A 4C3JB 5CC4A 1X54A 4JOIA 1NR4A 4OEMB 1L1OC 4JI5L 3G71A 2EYJA 4IN3A 1PH8A 1HZBA 3S15B 3BYTB 3C46A 2XIWA 1K8GA 5IGCA 1M90C 1HNXL 3KF8B 1FR3A 1PZID 5JPNC 1A2TA 2WIIB 2HHHQ 3GD7A 3TEHB 2JEBI 4YY3Q 4LF9Q 4DAMA 4HCEA 2YV5A 1PRTF 1OXVA 1YHAA 5C6AA 5JEAG 2R92B 2M00A 1G6PA 4FO2A 3LGJA 2QEXA 1F9PA 3HOZG 3MXPA 3DWPA 3TREA 3P1HA 4HTHA 1TT2A 2IW3A 1K8MA 1CKOA 3MFYA 4LMQD 4BY7G 1V1QA 4EQNA 3BG3A 4WFN3 4OONA 1IKLA 3NPPA 3S16H 3HOUH 1WTXA 1ILPA 3EBEA 4XQNA 1S4ZA 5C3EB 1E1OA 1LM0A 3T1HL 4GN4B 4JI8Q 2O4XA 1Y69U 5DM73 5M5YB 1OXXK 2H5XA 3ERQA 3T56B 3CRKC 1SN8A 1Z47A 3BDLA 4RKLA 4RGMA 3SVMA 4DF7A 4A3EB 1BBUA 1N36L 1DZ1A 1VQ8A 2DN8A 5KRUA 1D5MC 2MGSA 4IZ8A 2ES2A 3Q22A 1G6ZA 3KLSA 1XPRA 3TZUA 2K5DA 1LTLA 2CW0C 3MFGA 3TP7A 4JI0L 4A3BG 4L63B 4JBJA 1L2FA 5LMNW 2H1EA 2A1AA 4BS9A 2J7ZA 1TIID 1AN8A 5LMUQ 4YCWA 4A3DH 4DUYL 2IJ0A 3GTQB 1PH4A 4C3IG 4UP7A 2VQFQ 4MZ9A 2YTYA 3MA2B 4RMFA 1DCZA 2CQOA 4F8MA 4DR7Q 4R4OA 1HJPA 3NWSA 3I4MH 1GXDC 5AJ3L 4KHVA 2K5NA 2VXWA 4OIJA 3MVVA 3HOZB 4ZQ3A 2EPBA 1EUJA 3DWAA 1S3OA 1SMYD 1KHIA 1ONLA 2A68D 4A3BB 2JA7H 4IUQA 1V43A 3NTIA 2P5ZX 3H6MA 3UE0A 2RHQB 4PZ6A 4XQJA 1YIJA 4X66Q 1SFOB 2A6HD 3BYYB 1GD7A 4JI7L 4B3ML 4NKLA 4CDFC 2VZAA 2IPKD 4DK1A 4C3HG 1SNOA 1FL0A 2NB0A 1P8LA 4K5WA 4LNQA 2O5JC 1PRTD 5G3LF 4BXXH 2A8VA 1QVCA 1VS0A 5FK9C 1IHZA 2JA8G 1QUQB 3C3LA 4DV5L 3M4PA 4X6AH 1ESRA 1PH9A 4A3GH 4A3KG 2RQXA 3S2HH 2YU9H 4KKTA 5KIXA 4KN4C 4X3KA 3CAMA 2FJ2A 3P20A 1JICA 2KVMA 3NQIA 3A7LA 3R3OA 1HUMA 1PMRA 2OCEA 1QOHA 3PIPA 4OWWB 5M3MH 3M4QA 3M85A 1BO0A 2VY3A 3K81C 2F3WA 2RVLA 3I55A 5F2DA 3J81i 2HCIA 1M1KC 1TS3A 3GV6A 1QUQA 4HSVA 2JK8A 3OHXC 4AYBG 3E5SA 4RGOS 3I4MB 1W2BA 3EJIA 1ESFA 2NN6I 3H0GH 3STBD 4N8FA 2F4VQ 2IX3A 1J5EL 1HNWL 2E74C 3J81L 1CUKA 3FKIG 5IYDH 1MJCA 4IJLA 5IGGA 5HGTA 4RAUC 1TS5A 5ELFA 1PYSB 2WV6D 3DHQA 2LY7A 4K6LA 5BN5A 5IE8A 4AQYL 1FD7D 4M1UB 1HFGA 2F0VA 3H0GG 4IO9A 1KXLA 2A74C 4A3KH 4NXNQ 5IY0A 4BBRH 2BE5D 4J15A 2MPMA 2RA4A 3GQBA 1TWAH 1D5XC 2OWOA 3VYRA 2UXDQ 3CPFA 2F0WA 3K7AB 4RHSA 4A3JB 4OL7A 3A56A 2FFKB 3K57A 3T51B 4C2MH 2HIXA 3RR5A 2OT2A 1PTOC 1HA5A 2Z4IA 3AEVA 3AMUA 1RD9D 4CKEA 3BDOA 1T5XD 2IL8A 1BCPF 5CR3A 1LTRD 3I7FA 3CKIB 1YNXA 3UE1A 4IOCA 2JA6B 4I65A 2B29A 1K9MC 1J5EQ 4JI1L 4LFAL 3GTPB 2G9HD 4IUPA 1KTKA 3DEPA 1VQOA 1EOTA 3HKZE 3J81j 3CCUA 3PSIA 4B9XA 4A4IA 1GUOA 1EQRA 1HR0W 3M4OH 1I6HH 3D4WA 2XRQD 1C7YA 1STEA 2EY5A 1PHJA 3TZDA 1X3GA 2UUBQ 3VA7A 1A63A 2NVXB 2LSSA 1UEBA 4DV0L 4BY7H 2KENA 3A5UA 1TQOA 1TXYA 3F2DA 1X65A 1A62A 2EJMA 2PW5A 4FXGC 4DK6C 2CFMA 2E2DC 3QB3A 2K33A 4X3TA 1SNCA 3C1FA 2WAQB 2D0OA 1TWHH 2OTLA 1ZYRC 2JP1A 2OEOA 2KUMA 2ZTDA 4LF9L 4GKKL 2WKDA 3HOVH 4OXPA 1TS4A 4P73A 1IW7D 2EYPA 2L55A 3J80i 1B2TA 2RHSB 3FPPA 2YYZA 3BVZA 3KUPA 4JI2Q 1TVXA 3T1YQ 4Z9CB 1PVOA 5C4XH 2F0FA 1RTNA 2JA7B 1LLRD 2K7VA 4MNOA 1STNA 5FJ8G 3HOWH 1EEID 5IYBG 1SSOA 1WCMB 1A8VA 3F2UA 1CQFA 3K8AA 3SXHA 1B9NA 4HEDA 4PNYA 1EEFD 4YCUA 2KCNA 2BDOA 3MAQA 5IWAL 3STBC 4RHRA 1S5ED 1EQQA 1HUNA 4C2MB 1KDBA 1MD2D 4A3FB 4LFCL 1NTGA 3V05A 4B3SQ 5JJIA 1M8AA 4HSPA 1F2ZA 4H7BA 1Q1BA 4OIKA 3HOXG 4XYQA 2K5HA 3A8IE 1PFNA 1KABA 4IALA 4F7XA 4IQZA 1BBWA 5M3MB 2WP8J 4DV6Q 2J0TD 4BA1I 4LF4L 3HKZG 3A54A 5EQ0A 1U4PA 3MXNA 3ZJYC 2VB2X 3MC0B 1MKHA 2NTTA 1K83B 4H02A 1BBXC 1W6JA 2L11A 4OO1G 4X3SA 4MTKA 2LS01 5IGFA 1Y1VB 4RKBA 1KIXA 4UP8A 1NSNS 1PYBA 5FO7B 1LTTD 2AKWB 3GTGH 3I91A 1F2YA 2XN9C 4A3FH 2F0OA 2EOTA 1QZHA 1RODA 3KLWA 5C44B 3K0XA 3F1ZA 2DUDA 4O42A 3MTSA 4OWXB 3QWNA 1H9MA 4OWTB 4ULLA 5M3FG 2F1MA 5LL6X 4QIWB 1WTWA 2CH4W 3S1RH 4QMGA 5CYUA 1CFMA 1E2ZA 4K5VA 3NBHB 2A68C 1JWMD 4HJ9A 5C4ZA 1I50B 4JBKA 4POFA 2BOSA 1KRSA 1NBWA 2PNHA 2KCTA 2NN6G 2FHTA 4DV4Q 2K50A 2Z9HA 2DGYA 4C3IB 1X3PA 4L5RC 4DV5Q 1WTHA 2BA0A 2I5MX 2B2VA 1XTDA 4JI8L 4YWLA 5T1IA 4RGTA 2K14A 3MHBA 4LWCA 2F0QA 1B3QA 2JJQA 4AYBE 1WTOA 3HOUB 1LTSD 1KNEA 3Q8DA 3D6CA 1H9SB 5KGUA 2RDHA 3RLOA 1RKNA 1FNUA 3RZDB 4B3RQ 3K6OA 2Y0SB 5LHY1 1EYCA 2QILA 1WTQA 1B8AA 3C2PA 2R61A 1IBLL 1VMPA 1PLFA 1E7ZA 4YWMA 3NUCA 4DNRB 2GA4B 1XMQQ 2F0IA 2EE1A 3HFZB 1A15A 1X3QA 1NJIC 2XVSA 5JAVA 5JJKA 2VW9A 1GKHA 1Z7TA 4A93B 4FF4A 3EA6A 4DR5Q 1S40A 3I4OA 1Z6HA 4DV2L 3BS1A 5CGKA 2RDGA 3W2DA 2UUBL 4APVA 1N33Q 1HNZQ 4CBVA 4BY1B 4B3TL 1H9RA 1MHWC 3UDIA 2MNAA 1N34L 3ULPA 3NXWA 2BDNA 2BCOA 3SK4A 1BCPB 4IFDJ 2AUKA 4UPAA 3B6YA 3CW2C 5E4WC 3DM3A 2YU9B 1FGUA 1KDAA 1YNJD 4A3GB 4DV0Q 4V190 1KNAA 2EJGC 2PMZB 2F3VA 3HS0C 1IYJB 1EWHA 4ABNA 4H0LC 2A73B 2EYMA 1RTOA 1VQHA 3TRZA 4GKKQ 1SXTA 3URYA 2Q8RE 4C3HB 4DR6L 1L1OA 2NZOA 2DNEA 1PV4A 3L2PA 2WB1B 3LNNA 3TP5A 5IP9H 1JB3A 5EBDA 1LUZA 1UE1A 4DPGA 1CQVA 3CD6A 1AZQA 2JQOA 2OXPA 2EXZA 3CCLA 2K5QA 5DAUA 4IOAA 2BH8A 5CV4A 5ELCA 3BVGA 3VR6A 3PO3H 2K52A 1VQAA 1BNZA 1UNSA 1J8IA 4PZ8A 3OMCA 3TS2A 1N32L 3ONAB 1I6VC 4DN4M 3CXCA 1OXUA 1UE7A 5LMUL 4UY8C 1LYLA 2ZM6L 3SHLA 2R92H 5ELNA 1HFNA 4P75A 4TKOB 2CHBD 3BVMA 1QVGA 4KMUC 3WDNA 5FJ8H 3QJYA 1D1KA 3BU2A 1QB5D 2E2IB 4G4KA 4A3IB 4FDBA 4H44C 5GADC 1E22A 1CA6A 1EIFA 3PGZA 2C9OA 2L1BA 4HN7A 2UUAQ 2KOLA 4QUFA 3PUXA 4HIKA 3PO2B 2OTJA 4GOPC 2NVYH 3IFTA 2NVQB 1VQBA 5GROA 4JV5L 1B7YB 4CHTB 2BH2A 1TS2A 4IPGA 4DNIA 1YVCA 5M5WB 5JEAJ 3OTOL 3BJUA 1QWYA 1STBA 5KNBA 1XPUA 2A6HC 3J81E 3J7YW 1L0WA 5D3DA 1XNRQ 4NXNL 2E5LQ 4O2DA 3UDXA 5L37A 2QEJC 1PA6A 2B8GA 4IPHA 1U4RA 3SE0A 2FMCA 3HKZB 4EQOA 1J9OA 3D4RA 3CPWA 1BF4A 5EJWA 4BBSH 3I2ZA 4YIJA 2NBFA 1W3SA 2RSOA 4G7OC 1C9OA 4PG3A 2EYHA 4PMCA 2WB1E 1DOKA 3UDFA 4MN3A 3H09A 2EY1A 4OHJA 3HOYB 1XXGA 1PZJD 5C5LA 2ENBA 3CC2A 4IFDH 3J81c 2KEDA 5HY6A 2YTXA 3I90A 4KI0A 3RZOH 5CV7A 4G7HC 2A19A 5FLXc 3K7UC 1VQEA 1QVFA 1TWHB 1CHPD 4F88A 1WVLA 4LK1C 4GLVB 1PFMA 4F87A 4GLAC 2JA6H 2VUMG 4QCLA 3GV3A 3QO2A 2D2CC 2GN5A 3AFQA 1VMCA 1CKMA 1BQQT 2R7FA 1E2WA 1I3QB 3S16B 5NUCA 1QG7A 2PZUA 2QW7A 3K0YA 1SYGA 3I4NG 3H3VH 5TSSA 1KDCA 4O0AA 2CKZB 1WD1A 2KHSA 4HJ7A 4A3DG 3BZCA 4L5QA 2Q2IA 1IBLQ 4KHPQ 3ND9A 1WFQA 1UE6A 3DXJC 3NK9A 3A5ZB 3NSWA 2A5HA 1EFWA 3VDYA 5CV9A 3BZDB 3T53B 3GTLB 2NUCA 2PYKA 4HJAA 4ALPA 1R9TH 3FKIH 1G8ZD 1RIPA 1MJEA 1KRTA 1EYGA 1TWGH 1SLJA 3K58A 1HNZL 1DOMA 5IGEA 1V8QA 1WTRA 4KJOA 5BN4A 2HT1A 2XTIA 4ZK9B 3RLFA 2QDLA 5M9OA 3QOLA 4LFAQ 1EYDA 4A3CH 2OF1A 5HGQA 2DJGC 3V96A 4AQYQ 4RGNA 3JAME 4P72A 3PCOB 4TSSA 3SDZA 1RCVD 5IGDA 2PPBC 1STHA 3D6WA 4MHEA 4QB4A 3CQZB 5IWAQ 4DXGA 5C4XG 2I5LX 4QIWE 3GTMB 1TR5A 2N78A 4HMIA 1XWEA 4J8QA 2IX0A 2ZXRA 3I73A 3R93A 4KHZA 5A2QE 2B39A 4IUVA 3NBIA 2JN4A 3VR5A 4LF8Q 1KL9A 1MIUA 1WTVA 2X6GA 2PZTA 4PMWA 4QL5A 5C44H 4RG1A 4QQBX 4GN3B 3PIO3 2I07B 3PUYA 4DR6Q 1IBKL 4UAIA 2R93G 3HGBA 3EIVA 1Y1VH 3M4OB 3QIAA 2M2LA 4K0KL 2Z8LA 2E76C 1N33L 3I72A 3OIPA 2R93B 1G2SA 4DR3L 2PZWA 3Q0AA 3CMEA 1YJWA 4DUZL 3SK8A 4Y7NH 5FLXE 4DAYB 4IFDG 2ZTEA 4DV3L 4LF5Q 3HEJA 3HOZH 2AQ1B 2PO4A 1VQ7A 1S72A 5J22A 3F8TA 2EDGA 3GTLH 5IT9E 4LFCQ 2N55A 1Q7YC 2WAQG 1HQRD 4OX9L 3CCMA 3PF5A 2UUAL 3OPOA 2QKIC 2C5CA 2MO0A 3ERSX 2JSOA 5IP7G 4R8IA 4DXFA 4A76A 3K5NA 1HXYD 1YNND 3E3XA 1N36Q 3HOVB 1QNUA 1DM0B 1CZWA 2K4KA 4KY7A 3EQLC 1B1ZA 5AFWA 4I7AA 3C1EA 1DYQA 2WACA 4X66L 2XSCA 2OQ0A 2K5VA 1VQ9A 1MBYA 3KFUA 1R4PB 5IYBH 3FP9A 2EYLA 3VA5A 2K01A 2V4DA 2L5TA 1LO5D 4FF2A 4TQUS 1KC8C 2ID0A 2SNMA 1DONA 4R9WA 4N9TA 2MJ8A 5M5YH 3CF5A 2ZM6Q 4UP9A 5C0XG 4JI5Q 4B9WA 4CJ1B 3I56A 2EZVA 2N49A 5JOBA 3PUZA 3HOXH 3ZYYX 2L12A 4OELB 3A7AB 3CU7A 1VQPA 4FF1A 1MGSA 1GM5A 3JAMc 3OW2A 2BE5C 1E24A 4H13C 5ELBA 1V1PA 4JOIC 1U4LA 2L4NA 2RSNA 3KK7A 3EROA 1O7YA 3DWQA 4QUCA 2EJFC 5ELEA 2WKCA 3J7ZC 1UWVA 1CT1D 2RCNA 3I4MG 3RD4A 4UHVA 2ICIA 2F4VL 1JORA 3HOYG 1O80A 2H4OA 4QY7A 3S2DH 2ICEC 3GTOB 1HZAA 3L9AX 3PO2G 4DR4L 3V2TA 3K7AH 3TBIB 2IT1A 4BWGB 1ENAA 1PTOF 4JG2A 4HR7B 1TWCB 1UE5A 1JCKB 1F2LA 2C35B 1XNRL 1CA5A 2JE6I 3TN2A 2VB3X 2F52A 1A3UA 2K5WA 3KDFB 1GO3E 3RZDH 2R7ZH 1OO9B 4A3KB 2JA5H 1D2BA 5BR8L 1G91A 3T13A 1O7IA 1ENFA 1AW7A 1H9KA 2EQSA 3E0JA 3X3NA 4RA8A 3T16A 5M3FH 2UXBL 1CM9A 1K8OA 5BR8Q 4YY3L 2UXDL 1WJJA 3MXUA 5CBEE 2MP1A 1HH2P 3LWUA 3PIP3 1K73C 4FXKC 1SNPA 1VQFA 3FVQA 4NXMQ 1DD2A 4JC0A 5I9PA 3ULLA 1I4XA 2F0NA 1SR3A 2KEEA 4GKJL 1B50A 3MXNB 1DGSA 3OW7A 4CDDC 1QZGA 4A3MH 1E3PA 1XMQL 2WB1G 3J7AF 4JK1C 3WOEA 3KBXA 4EQ5A 3T1YL 3G6JB 4K5XA 4KD4A 4JI1Q 1PXUA 5C3EG 3GTKH 4ZRZA 1N9WA 5IP9G 2NWGA 3M3YH 5EPJA 1U9RA 3GTPH 4EQPA 2SNSA 4IPCA 5DM63 1F9SA 4GNXB 1XMOL 4EX5A 2KQ3A 2F0GA 5JPMC 1VQ5A 1V1OA 2YTVA 4DR1Q 1SDFA 3VYTA 1LT3D 3PO3G 1TWCH 4DFAA 3G4SA 3CCEA 2TMPA 4R4TA 4YHHL 3S24A 3RZOB 1TWFH 2R92G 2MO1A 1ILQA 1EY5A 2B2WA 3DMUA 2IX1A 1K83H 3RN2A 3J80c 1PH3A 2E2HH 4YHHQ 3LWEA 3M7NA 1WOCA 4BY1G 1EL0A 2Z6BA 1XPOA 4JI0Q 3EN2A 5EPKA 5M3FB 1JC7A 1JT8A 4DAPA 2SEBD 4ZKBB 2UXCL 3H15A 2A69C 1ICFB 1JE5A 4JI2L 5C0XH 5IYDG 3M3YB 3M4YA 1D7QA 1EIHA 2EY2A 2MHVA 2B63G 3S1MH 1SYEA 2UXCQ 4QGUA 3UDGA 1NMGA 2N88A 3S2HB 3W5OA 2I0QA 1JWUD 1FGBD 1SNDA 2CWAA 3QG1A 4P2CB 1VQGA 2UUCL 1AE3A 2F0MA 4ZUJA 3RN5A 2B2WC 5M5WH 5C0XI 5KYIA 3OIQA 1SE3A 2E75C 1QJOA 3R8BA 2K03A 1GUWA 1F9RA 4Q0FA 1JQYD 2R3ZA 1Q8KA 4HAEA 1G291 4CKCA 3K5LA 2Q2UA 1WCMH 3D0FA 3E0EA 1F77A 1OXTA 1A3TA 1EU3A 1VDZA 1EY0A 1GUTA 4LFBQ 4K14A 2ZJQA 3PO2H 5CV6A 4JI7Q 2FXQA 2PQAB 4B08A 5M5XB 4J1MA 1SNQA 4GNXA 4A3GG 1TKWB 1X9NA 4ZKCB 4DV6L 4B3SL 3IFDA 4LF4Q 1C0AA 3CMAA 4A3CG 1CTMA 2B2TA 4JW0A 4JPBW 2E2HB 1CSPA 2Q8IB 1BOSA 4A93H 1SEBD 1SJED 2KCMA 3KJPA 4DR4Q 3O13A 1B44D 1YEZA
chains in the Genus database with same CATH topology
3BJUA 4PZ7A 1XPUA 4LF7Q 2JA8G 1QUQB 1SROA 5LMNQ 4DV5L 1CKNA 3M4PA 4X6AH 3HOUG 1L0WA 1VQNA 1XNRQ 2MQHA 3F2CA 1PH9A 4A3GH 3CCJA 4JI3L 4A3KG 4NXNL 1KQSA 1ASZA 2E5LQ 4O2DA 3UDXA 2NVTH 5IYCH 2YU9H 3S2HH 4JCVE 1VQKA 5C44G 4AIMA 1IZ6A 3JAMi 1PA6A 4IPHA 2NVQH 4ME3A 4GOPB 1WYDA 4L5TA 1VQLA 1SFOH 3CAMA 2QGQA 4DV3Q 4IFDI 1K3RA 3RLNA 3CPWA 4HJ5A 4BBSH 1IBML 3I2ZA 2OCEA 1W3SA 3PIPA 1C9OA 5M3MH 4OWWB 1VCIA 3M4QA 4KHPL 4PG3A 2R93H 3M85A 5GAHC 1BVSA 1JJCB 1Y1VG 2WB1E 3TS0A 1PH7A 2VY3A 3K81C 3UDFA 3I55A 3D31A 3J81i 1M1KC 2E2IH 1EWIA 1QUQA 3HOVG 2K75A 4WJ4A 2JK8A 4AYBG 2WFWA 4LUOA 4P74A 1W2BA 1SMXA 4A93G 4TVAB 1YITA 3PF4A 3CC2A 2NN6I 3H0GH 3STBD 3J81c 3NELA 5HY6A 2IY5B 2UU9Q 2YTXA 4KI0A 2F4VQ 4BA2I 3RZOH 1YJ9A 2A19A 1J5EL 5FLXc 1HNWL 3K7UC 3L7ZC 1XJVA 1Q86C 1Q82C 1VQEA 3CCVA 4YWKA 1CUKA 3FKIG 2R7DA 4MTNA 1QVFA 1MJCA 5IYDH 4IJLA 2WAQE 4GLVB 3KOJA 4GLAC 2JA6H 3U50C 4B3TQ 3WWVA 2VUMG 3AFPA 1B70B 1PYSB 2JEAI 4GOPA 3S17H 2GN5A 3AFQA 3KYHC 5IE8A 4AQYL 1CKMA 2R7FA 4IJHA 3H0GG 4IO9A 1CSQA 3CQZH 1KXLA 1HR0L 3T1HQ 4A3KH 4BY1H 4NXNQ 3CCSA 5IYCG 5IY0A 4BBRH 2F3IA 4NPSA 4J15A 3I4NG 3H3VH 1TWAH 4O0AA 2CKZB 2OWOA 5C0XJ 1Q1EA 2IHEA 4HJ7A 4A3DG 2UXDQ 3CPFA 3BZCA 4L5QA 2Q2IA 1IBLQ 1KD1C 3E9HA 3PV0A 4KHPQ 1IXRA 2HHHL 1WFQA 1JJGA 4C2MH 1UE6A 2HIXA 2ATWA 4X64Q 3RR5A 3A5ZB 1EFWA 2N8NA 3VDYA 3JC66 3AEVA 3M4OH 4LF8L 1SRUA 1R9TH 4ALPA 4HJAA 3FKIH 4B3RL 1RIPA 3I7FA 1MJEA 2PI2E 4X64L 1YNXA 3I4NH 3UE1A 1KRTA 1EYGA 4IOCA 1TWGH 1FJGQ 1SLJA 2B29A 4KLKA 4A75A 1IBKQ 1K9MC 1J5EQ 4P71A 4JI1L 1HNZL 2ASBA 1KAWA 4LFAL 1K0RA 1OXSC 2OQKA 3GTJH 3CCQA 1VQOA 3HKZE 3J81j 3CCUA 1ASYA 3PSIA 1XMOQ 2XGTA 1YBYA 2XTIA 2E8GA 2B63H 4A4IA 2HT1A 3RLFA 2B3GA 1EQRA 1WCMG 3A0JA 1NY4A 4BBRG 1HR0W 2VUMH 1CKNB 4LFAQ 2Q2HA 4A3CH 1C7YA 2LXJA 1VQDA 1PHJA 5HGQA 3GO5A 1X3GA 4AQYQ 2UUBQ 1A63A 2PQAA 1I5FA 1L1OB 4P72A 2LSSA 3KF6A 3PCOB 4YCVA 5ELOA 2VQEL 1UEBA 1Y1WH 4BXXG 4DV0L 3GDEA 1I94L 2KENA 4BY7H 3A5UA 1TXYA 3F2DA 5IWAQ 2HQLA 5DLQE 1X65A 3U58A 1A62A 5C4XG 2I5LX 4QIWE 4A3FG 4DK6C 2N78A 2CFMA 3S15H 2IX0A 2UXBQ 4KHZA 4QJFA 2D0OA 1TWHH 1Z9FA 5EAYA 2OTLA 5M3MG 4LF8Q 3W1GA 1KL9A 4JBWA 4C3JH 1Y1WG 1MIUA 4DR2L 1JB7A 4R4QA 2CWPA 2GVBA 2IHFA 2MFIA 2ZTDA 4QL5A 4PMWA 4RG1A 5C44H 3OYYA 4LF9L 4GKKL 4QQBX 5JJLA 3HOVH 4OXPA 4GN3B 5IT9c 1VQMA 2RF4A 4P73A 4K0KQ 3PUYA 4DR6Q 1IBKL 2BA1A 5IP7H 1VQCA 2R93G 2V1CC 3EIVA 3J80i 4C3IH 4DR5L 1XNQL 1Y1VH 2RHSB 1N32Q 2YYZA 4K0KL 2Z0SA 2UUCQ 4JI2Q 3IRBA 3T1YQ 1N33L 1PVOA 3NENA 4DV7Q 5C4XH 4DR3L 1K8AC 1Q46A 5FLMH 3E9IA 3ER0A 1SE8A 2KHIA 4MNOA 3CMEA 4DUZL 5FJ8G 1YJWA 1N34Q 4IPDA 4Y7NH 3HOWH 4IFDG 4DAYB 1AH9A 2ZTEA 4DV3L 4LF5Q 5IYBG 4A3IH 3HOZH 4DV7L 4DR3Q 2R6GA 1U0LA 3RNUA 4DUYQ 1A8VA 1VQ7A 1I94Q 3GTMH 3K8AA 4DUZQ 1S72A 2Z6KA 3F8TA 4YCUA 4JBMA 2NZHA 2JA7G 5IWAL 3GTLH 3STBC 4LFCQ 1Q7YC 2WAQG 2KBNA 1X3FA 4JYAL 1PFSA 4OX9L 3CCMA 3PF5A 3SGIA 1EQQA 2ALYB 2UUAL 4DR7L 2JA6G 4DV1Q 1T9HA 1NTGA 1X55A 4LFCL 2MO0A 3ERSX 1RL2A 1N8RC 4B3SQ 5IP7G 4XIGS 3GTQH 2L15A 3CP0A 4A76A 1Q1BA 4R4IA 1N36Q 3HOXG 4X65Q 1U5KA 2KHJA 2K5HA 2K4KA 2PMZE 2JA8H 3OTOQ 4A3JG 1BBWA 5M5XH 4X65L 2WP8J 2ZJRA 4LF7L 4DV6Q 1I3QH 4X66L 3H3VI 4WJ3M 1HZ9A 4BA1I 4B3MQ 4LF4L 2OQ0A 3HKZG 3S1QH 2K5VA 3AYHB 1VQ9A 3ULJA 1WI5A 3KFUA 5IYBH 3CC4A 3FP9A 2ZTCA 1XNQQ 4R4CA 4LF6L 1JMCA 3ZJYC 1MKHA 1Q12A 4TQUS 5J3BA 1EOVA 1NMFA 4JI6Q 4H02A 3U4VA 3KJOA 1KC8C 3M9BA 4OO1G 2ID0A 5K36G 1P16A 3NEMA 3MEFA 1X3EA 4A3JH 1YJNA 1PH6A 4UP8A 1KIXA 5M5YH 4JI3Q 1PYBA 3AQQA 3CF5A 2ZM6Q 2AKWB 4UP9A 5C0XG 3GTGH 4JI5Q 4DK3C 3S14H 1Q81C 2AWNA 3I56A 4A3FH 2N49A 3HOXH 2VS1A 3PUZA 3HOYH 2LXKA 1X56A 1IBMQ 1QZHA 3KLWA 1VQPA 1BKBA 2AHOB 2R7ZG 3K0XA 3F1ZA 4OX9Q 2DUDA 1GM5A 3JAMc 3OW2A 1E24A 3CC7A 4OWXB 4NXML 4JOIC 4OWTB 1HNWQ 4X62L 4GN5A 5M3FG 2D62A 1FJGL 4GKJQ 3S1RH 4XTCS 4HIMA 2EIFA 3J7ZC 1UWVA 1A0IA 3NBHB 4X62Q 2RCNA 3W1BA 3I4MG 1HZCA 4HJ9A 4LUVA 4JV5Q 2UU9L 2F4VL 3HOYG 3FHWA 1VQJA 1YZ6A 3S1NH 3G48A 1AE2A 1YHQA 4JBKA 4POFA 1KRSA 4QY7A 4DKAC 1NBWA 2PNHA 3DLLA 3S2DH 2KCTA 2NN6G 2Q2TA 1HZAA 1HR0Q 3PO2G 4DV4Q 2K50A 4HIOA 2DGYA 1YI2A 4DR4L 3K7AH 2IT1A 5E7NA 4L5RC 5FLMG 2JA9A 4JG2A 5LMNL 4DV5Q 1IL2A 3ICEA 1UE5A 2BA0A 2C35B 2I5MX 1XTDA 1XNRL 5H1SE 4JI6L 2JE6I 4JI8L 4DR1L 2D0PA 2F52A 3KDFB 4LW1A 4YWLA 1GO3E 2K14A 4LWCA 3RZDH 2R7ZH 5C3EH 2JA5H 2JJQA 4AYBE 1X54A 4JOIA 5BR8L 1O7IA 2ZJPA 2EQSA 1L1OC 3Q8DA 4JI5L 3G71A 5M3FH 2UXBL 3RLOA 1PH8A 1HZBA 4B3RQ 1GVPA 5BR8Q 4YY3L 4HIDA 1K8GA 1HNXL 1M90C 3KF8B 1B8AA 2UXDL 4C3HH 1IBLL 1WJJA 1I6HH 2HHHQ 3GD7A 1K73C 1HH2P 3TEHB 1E7ZA 1VQFA 2JEBI 4LUZA 4YWMA 4DAMA 4YY3Q 2YV5A 1PH5A 3G6EA 4LF9Q 1OXVA 4NXMQ 1YHAA 5JEAG 1VQ6A 1XMQQ 4JC0A 4JI4Q 3J7A5 4A3LH 1G6PA 3LGJA 3ULLA 3HFZB 2QEXA 4A3IG 3HOZG 1NJIC 1SR3A 4GKJL 3MXNB 3TREA 1JJ2A 5JJKA 2NVXH 2VW9A 1H95A 1DGSA 1GKHA 2Z6KC 1QZGA 4A3MH 1E3PA 1XMQL 4DR5Q 4JI4L 2WB1G 1S40A 3I4OA 5GAEC 4DV2L 1CKOA 4EQ5A 2E2JH 4R1JA 4APVA 3T1YL 2UUBL 1N33Q 4BY7G 1V1QA 4JI1Q 1HNZQ 5C3EG 3GTKH 1N9WA 5IP9G 4B3TL 1X6OA 4OONA 3UDIA 1FVIA 5GQOA 2MNAA 3ULPA 1N34L 2JA5G 3GTPH 3M3YH 1E1TA 4IPCA 3S16H 4GNXB 1XMOL 3HOUH 4EX5A 4LF5L 3EBEA 2VQFL 3CCRA 1VQ5A 4HJ8A 4IFDJ 4UPAA 1E1OA 1LM0A 2YTVA 3B6YA 3CW2C 3T1HL 4GN4B 3DM3A 4JI8Q 4DR1Q 1YHBA 1FGUA 5AJ3Q 3PO3G 1TWCH 1G51A 4GNXC 3G4SA 3CCEA 4DV0Q 2GVAA 4GS3A 2VNUD 1NE3A 1OXXK 2N3SA 2H5XA 4R4TA 3KDFA 5JJIA 4YHHL 3S24A 3GTOH 1IYJB 1TWFH 2R92G 2MO1A 1SN8A 1VQHA 4GLXA 1I50H 1EIYB 1Z47A 4L5SA 2IX1A 1K83H 3RN2A 1HNXQ 3TRZA 1BBUA 3J80c 4A3MG 2Y0SE 1N36L 1PH3A 4GKKQ 2E2HH 4YHHQ 3M7NA 1WOCA 4BY1G 2AMCB 1VQ8A 1XPOA 4DR6L 1L1OA 2NZOA 4JI0Q 1D8LA 1PV4A 3EN2A 2ES2A 3L2PA 4AH6A 1XPRA 4Y52H 1JT8A 5IP9H 3PIOA 2UXCL 3H15A 1LUZA 1UE1A 1JE5A 4DPGA 1LTLA 4JI0L 4JI2L 3CD6A 4A3BG 5IYDG 2JQOA 3CCLA 1D7QA 4JBJA 1L2FA 2I5HA 5LMNW 3A74A 2B63G 3PUVA 1PH1A 2A1AA 4IOAA 3S1MH 2UXCQ 2BH8A 4QGUA 4DV2Q 3UDGA 1NMGA 5GAGC 3PO3H 3W5OA 2K52A 2E5LL 2I0QA 1VQAA 3BZKA 5LMUQ 4YCWA 4A3DH 4PZ8A 4DUYL 3TS2A 1N32L 2CWAA 1VQGA 1PH4A 2AWOA 3CXCA 2UUCL 1AE3A 2HIVA 1OXUA 4UP7A 3F2BA 1UE7A 2VQFQ 3RN5A 5LMUL 4MZ9A 5M5WH 1LYLA 5C0XI 2ZM6L 2VQEQ 1V9PA 5ELNA 4UY8C 2R92H 4P75A 2YTYA 4JYAQ 4OO1I 3L0OA 2PI2A 4NB3A 3HKSA 2CQOA 4RMFA 4DR7Q 3PUWA 4R4OA 1HJPA 1QVGA 3I4MH 5AJ3L 5FJ8H 1Q8KA 2K5NA 1G291 3HOWG 4A3EG 3BU2A 2Q2UA 4POGA 1WCMH 3D0FA 3E0EA 1OXTA 4FDBA 4LFBQ 1EUJA 1S3OA 5GADC 1E22A 2ZJQA 3PO2H 1EIFA 2EXDA 1KHIA 3PGZA 4JI7Q 4A3BH 2FXQA 2PQAB 5C4JH 2JA7H 1OTCA 3KF6B 4GNXA 1V43A 1PH2A 2UUAQ 4A3GG 1Y14B 3PUXA 2VL6A 4HIKA 1X9NA 4A3LG 4LFBL 3UE0A 2RHQB 2OTJA 4PZ6A 4DV6L 4GOPC 4X66Q 2NVYH 4DV1L 1YIJA 4B3SL 4DR2Q 1GD7A 4JI7L 4B3ML 4LF4Q 2Y0SG 1C0AA 1VQBA 1VQIA 1J6QA 3CMAA 4A3CG 2VZAA 5GROA 1B7YB 4JV5L 3K80C 3TQYA 2BH2A 4BBSG 4IPGA 1CSPA 2QA4A 4A93H 1FL0A 4LF6Q 4DNIA 1VQ4A 1P8LA 3U4ZA 4A3EH 4LNQA 2KCMA 1YVCA 4BXXH 3KJPA 4DV4L 1QVCA 2CCZA 2A8VA 4DR4Q 5JEAJ 3OTOL 1VS0A 1YEZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BJU A;  4PZ7 A;  1XPU A;  4LF7 Q;  2JA8 G;  1QUQ B;  1SRO A;  5LMN Q;  4DV5 L;  1CKN A;  3M4P A;  4X6A H;  3HOU G;  1L0W A;  1VQN A;  1XNR Q;  2MQH A;  3F2C A;  1PH9 A;  4A3G H;  3CCJ A;  4JI3 L;  4A3K G;  4NXN L;  1KQS A;  1ASZ A;  2E5L Q;  4O2D A;  3UDX A;  2NVT H;  5IYC H;  2YU9 H;  3S2H H;  4JCV E;  1VQK A;  5C44 G;  4AIM A;  1IZ6 A;  3JAM i;  1PA6 A;  4IPH A;  2NVQ H;  4ME3 A;  4GOP B;  1WYD A;  4L5T A;  1VQL A;  1SFO H;  3CAM A;  2QGQ A;  4DV3 Q;  4IFD I;  1K3R A;  3RLN A;  3CPW A;  4HJ5 A;  4BBS H;  1IBM L;  3I2Z A;  2OCE A;  1W3S A;  3PIP A;  1C9O A;  5M3M H;  4OWW B;  1VCI A;  3M4Q A;  4KHP L;  4PG3 A;  2R93 H;  3M85 A;  5GAH C;  1BVS A;  1JJC B;  1Y1V G;  2WB1 E;  3TS0 A;  1PH7 A;  2VY3 A;  3K81 C;  3UDF A;  3I55 A;  3D31 A;  3J81 i;  1M1K C;  2E2I H;  1EWI A;  1QUQ A;  3HOV G;  2K75 A;  4WJ4 A;  2JK8 A;  4AYB G;  2WFW A;  4LUO A;  4P74 A;  1W2B A;  1SMX A;  4A93 G;  4TVA B;  1YIT A;  3PF4 A;  3CC2 A;  2NN6 I;  3H0G H;  3STB D;  3J81 c;  3NEL A;  5HY6 A;  2IY5 B;  2UU9 Q;  2YTX A;  4KI0 A;  2F4V Q;  4BA2 I;  3RZO H;  1YJ9 A;  2A19 A;  1J5E L;  5FLX c;  1HNW L;  3K7U C;  3L7Z C;  1XJV A;  1Q86 C;  1Q82 C;  1VQE A;  3CCV A;  4YWK A;  1CUK A;  3FKI G;  2R7D A;  4MTN A;  1QVF A;  1MJC A;  5IYD H;  4IJL A;  2WAQ E;  4GLV B;  3KOJ A;  4GLA C;  2JA6 H;  3U50 C;  4B3T Q;  3WWV A;  2VUM G;  3AFP A;  1B70 B;  1PYS B;  2JEA I;  4GOP A;  3S17 H;  2GN5 A;  3AFQ A;  3KYH C;  5IE8 A;  4AQY L;  1CKM A;  2R7F A;  4IJH A;  3H0G G;  4IO9 A;  1CSQ A;  3CQZ H;  1KXL A;  1HR0 L;  3T1H Q;  4A3K H;  4BY1 H;  4NXN Q;  3CCS A;  5IYC G;  5IY0 A;  4BBR H;  2F3I A;  4NPS A;  4J15 A;  3I4N G;  3H3V H;  1TWA H;  4O0A A;  2CKZ B;  2OWO A;  5C0X J;  1Q1E A;  2IHE A;  4HJ7 A;  4A3D G;  2UXD Q;  3CPF A;  3BZC A;  4L5Q A;  2Q2I A;  1IBL Q;  1KD1 C;  3E9H A;  3PV0 A;  4KHP Q;  1IXR A;  2HHH L;  1WFQ A;  1JJG A;  4C2M H;  1UE6 A;  2HIX A;  2ATW A;  4X64 Q;  3RR5 A;  3A5Z B;  1EFW A;  2N8N A;  3VDY A;  3JC6 6;  3AEV A;  3M4O H;  4LF8 L;  1SRU A;  1R9T H;  4ALP A;  4HJA A;  3FKI H;  4B3R L;  1RIP A;  3I7F A;  1MJE A;  2PI2 E;  4X64 L;  1YNX A;  3I4N H;  3UE1 A;  1KRT A;  1EYG A;  4IOC A;  1TWG H;  1FJG Q;  1SLJ A;  2B29 A;  4KLK A;  4A75 A;  1IBK Q;  1K9M C;  1J5E Q;  4P71 A;  4JI1 L;  1HNZ L;  2ASB A;  1KAW A;  4LFA L;  1K0R A;  1OXS C;  2OQK A;  3GTJ H;  3CCQ A;  1VQO A;  3HKZ E;  3J81 j;  3CCU A;  1ASY A;  3PSI A;  1XMO Q;  2XGT A;  1YBY A;  2XTI A;  2E8G A;  2B63 H;  4A4I A;  2HT1 A;  3RLF A;  2B3G A;  1EQR A;  1WCM G;  3A0J A;  1NY4 A;  4BBR G;  1HR0 W;  2VUM H;  1CKN B;  4LFA Q;  2Q2H A;  4A3C H;  1C7Y A;  2LXJ A;  1VQD A;  1PHJ A;  5HGQ A;  3GO5 A;  1X3G A;  4AQY Q;  2UUB Q;  1A63 A;  2PQA A;  1I5F A;  1L1O B;  4P72 A;  2LSS A;  3KF6 A;  3PCO B;  4YCV A;  5ELO A;  2VQE L;  1UEB A;  1Y1W H;  4BXX G;  4DV0 L;  3GDE A;  1I94 L;  2KEN A;  4BY7 H;  3A5U A;  1TXY A;  3F2D A;  5IWA Q;  2HQL A;  5DLQ E;  1X65 A;  3U58 A;  1A62 A;  5C4X G;  2I5L X;  4QIW E;  4A3F G;  4DK6 C;  2N78 A;  2CFM A;  3S15 H;  2IX0 A;  2UXB Q;  4KHZ A;  4QJF A;  2D0O A;  1TWH H;  1Z9F A;  5EAY A;  2OTL A;  5M3M G;  4LF8 Q;  3W1G A;  1KL9 A;  4JBW A;  4C3J H;  1Y1W G;  1MIU A;  4DR2 L;  1JB7 A;  4R4Q A;  2CWP A;  2GVB A;  2IHF A;  2MFI A;  2ZTD A;  4QL5 A;  4PMW A;  4RG1 A;  5C44 H;  3OYY A;  4LF9 L;  4GKK L;  4QQB X;  5JJL A;  3HOV H;  4OXP A;  4GN3 B;  5IT9 c;  1VQM A;  2RF4 A;  4P73 A;  4K0K Q;  3PUY A;  4DR6 Q;  1IBK L;  2BA1 A;  5IP7 H;  1VQC A;  2R93 G;  2V1C C;  3EIV A;  3J80 i;  4C3I H;  4DR5 L;  1XNQ L;  1Y1V H;  2RHS B;  1N32 Q;  2YYZ A;  4K0K L;  2Z0S A;  2UUC Q;  4JI2 Q;  3IRB A;  3T1Y Q;  1N33 L;  1PVO A;  3NEN A;  4DV7 Q;  5C4X H;  4DR3 L;  1K8A C;  1Q46 A;  5FLM H;  3E9I A;  3ER0 A;  1SE8 A;  2KHI A;  4MNO A;  3CME A;  4DUZ L;  5FJ8 G;  1YJW A;  1N34 Q;  4IPD A;  4Y7N H;  3HOW H;  4IFD G;  4DAY B;  1AH9 A;  2ZTE A;  4DV3 L;  4LF5 Q;  5IYB G;  4A3I H;  3HOZ H;  4DV7 L;  4DR3 Q;  2R6G A;  1U0L A;  3RNU A;  4DUY Q;  1A8V A;  1VQ7 A;  1I94 Q;  3GTM H;  3K8A A;  4DUZ Q;  1S72 A;  2Z6K A;  3F8T A;  4YCU A;  4JBM A;  2NZH A;  2JA7 G;  5IWA L;  3GTL H;  3STB C;  4LFC Q;  1Q7Y C;  2WAQ G;  2KBN A;  1X3F A;  4JYA L;  1PFS A;  4OX9 L;  3CCM A;  3PF5 A;  3SGI A;  1EQQ A;  2ALY B;  2UUA L;  4DR7 L;  2JA6 G;  4DV1 Q;  1T9H A;  1NTG A;  1X55 A;  4LFC L;  2MO0 A;  3ERS X;  1RL2 A;  1N8R C;  4B3S Q;  5IP7 G;  4XIG S;  3GTQ H;  2L15 A;  3CP0 A;  4A76 A;  1Q1B A;  4R4I A;  1N36 Q;  3HOX G;  4X65 Q;  1U5K A;  2KHJ A;  2K5H A;  2K4K A;  2PMZ E;  2JA8 H;  3OTO Q;  4A3J G;  1BBW A;  5M5X H;  4X65 L;  2WP8 J;  2ZJR A;  4LF7 L;  4DV6 Q;  1I3Q H;  4X66 L;  3H3V I;  4WJ3 M;  1HZ9 A;  4BA1 I;  4B3M Q;  4LF4 L;  2OQ0 A;  3HKZ G;  3S1Q H;  2K5V A;  3AYH B;  1VQ9 A;  3ULJ A;  1WI5 A;  3KFU A;  5IYB H;  3CC4 A;  3FP9 A;  2ZTC A;  1XNQ Q;  4R4C A;  4LF6 L;  1JMC A;  3ZJY C;  1MKH A;  1Q12 A;  4TQU S;  5J3B A;  1EOV A;  1NMF A;  4JI6 Q;  4H02 A;  3U4V A;  3KJO A;  1KC8 C;  3M9B A;  4OO1 G;  2ID0 A;  5K36 G;  1P16 A;  3NEM A;  3MEF A;  1X3E A;  4A3J H;  1YJN A;  1PH6 A;  4UP8 A;  1KIX A;  5M5Y H;  4JI3 Q;  1PYB A;  3AQQ A;  3CF5 A;  2ZM6 Q;  2AKW B;  4UP9 A;  5C0X G;  3GTG H;  4JI5 Q;  4DK3 C;  3S14 H;  1Q81 C;  2AWN A;  3I56 A;  4A3F H;  2N49 A;  3HOX H;  2VS1 A;  3PUZ A;  3HOY H;  2LXK A;  1X56 A;  1IBM Q;  1QZH A;  3KLW A;  1VQP A;  1BKB A;  2AHO B;  2R7Z G;  3K0X A;  3F1Z A;  4OX9 Q;  2DUD A;  1GM5 A;  3JAM c;  3OW2 A;  1E24 A;  3CC7 A;  4OWX B;  4NXM L;  4JOI C;  4OWT B;  1HNW Q;  4X62 L;  4GN5 A;  5M3F G;  2D62 A;  1FJG L;  4GKJ Q;  3S1R H;  4XTC S;  4HIM A;  2EIF A;  3J7Z C;  1UWV A;  1A0I A;  3NBH B;  4X62 Q;  2RCN A;  3W1B A;  3I4M G;  1HZC A;  4HJ9 A;  4LUV A;  4JV5 Q;  2UU9 L;  2F4V L;  3HOY G;  3FHW A;  1VQJ A;  1YZ6 A;  3S1N H;  3G48 A;  1AE2 A;  1YHQ A;  4JBK A;  4POF A;  1KRS A;  4QY7 A;  4DKA C;  1NBW A;  2PNH A;  3DLL A;  3S2D H;  2KCT A;  2NN6 G;  2Q2T A;  1HZA A;  1HR0 Q;  3PO2 G;  4DV4 Q;  2K50 A;  4HIO A;  2DGY A;  1YI2 A;  4DR4 L;  3K7A H;  2IT1 A;  5E7N A;  4L5R C;  5FLM G;  2JA9 A;  4JG2 A;  5LMN L;  4DV5 Q;  1IL2 A;  3ICE A;  1UE5 A;  2BA0 A;  2C35 B;  2I5M X;  1XTD A;  1XNR L;  5H1S E;  4JI6 L;  2JE6 I;  4JI8 L;  4DR1 L;  2D0P A;  2F52 A;  3KDF B;  4LW1 A;  4YWL A;  1GO3 E;  2K14 A;  4LWC A;  3RZD H;  2R7Z H;  5C3E H;  2JA5 H;  2JJQ A;  4AYB E;  1X54 A;  4JOI A;  5BR8 L;  1O7I A;  2ZJP A;  2EQS A;  1L1O C;  3Q8D A;  4JI5 L;  3G71 A;  5M3F H;  2UXB L;  3RLO A;  1PH8 A;  1HZB A;  4B3R Q;  1GVP A;  5BR8 Q;  4YY3 L;  4HID A;  1K8G A;  1HNX L;  1M90 C;  3KF8 B;  1B8A A;  2UXD L;  4C3H H;  1IBL L;  1WJJ A;  1I6H H;  2HHH Q;  3GD7 A;  1K73 C;  1HH2 P;  3TEH B;  1E7Z A;  1VQF A;  2JEB I;  4LUZ A;  4YWM A;  4DAM A;  4YY3 Q;  2YV5 A;  1PH5 A;  3G6E A;  4LF9 Q;  1OXV A;  4NXM Q;  1YHA A;  5JEA G;  1VQ6 A;  1XMQ Q;  4JC0 A;  4JI4 Q;  3J7A 5;  4A3L H;  1G6P A;  3LGJ A;  3ULL A;  3HFZ B;  2QEX A;  4A3I G;  3HOZ G;  1NJI C;  1SR3 A;  4GKJ L;  3MXN B;  3TRE A;  1JJ2 A;  5JJK A;  2NVX H;  2VW9 A;  1H95 A;  1DGS A;  1GKH A;  2Z6K C;  1QZG A;  4A3M H;  1E3P A;  1XMQ L;  4DR5 Q;  4JI4 L;  2WB1 G;  1S40 A;  3I4O A;  5GAE C;  4DV2 L;  1CKO A;  4EQ5 A;  2E2J H;  4R1J A;  4APV A;  3T1Y L;  2UUB L;  1N33 Q;  4BY7 G;  1V1Q A;  4JI1 Q;  1HNZ Q;  5C3E G;  3GTK H;  1N9W A;  5IP9 G;  4B3T L;  1X6O A;  4OON A;  3UDI A;  1FVI A;  5GQO A;  2MNA A;  3ULP A;  1N34 L;  2JA5 G;  3GTP H;  3M3Y H;  1E1T A;  4IPC A;  3S16 H;  4GNX B;  1XMO L;  3HOU H;  4EX5 A;  4LF5 L;  3EBE A;  2VQF L;  3CCR A;  1VQ5 A;  4HJ8 A;  4IFD J;  4UPA A;  1E1O A;  1LM0 A;  2YTV A;  3B6Y A;  3CW2 C;  3T1H L;  4GN4 B;  3DM3 A;  4JI8 Q;  4DR1 Q;  1YHB A;  1FGU A;  5AJ3 Q;  3PO3 G;  1TWC H;  1G51 A;  4GNX C;  3G4S A;  3CCE A;  4DV0 Q;  2GVA A;  4GS3 A;  2VNU D;  1NE3 A;  1OXX K;  2N3S A;  2H5X A;  4R4T A;  3KDF A;  5JJI A;  4YHH L;  3S24 A;  3GTO H;  1IYJ B;  1TWF H;  2R92 G;  2MO1 A;  1SN8 A;  1VQH A;  4GLX A;  1I50 H;  1EIY B;  1Z47 A;  4L5S A;  2IX1 A;  1K83 H;  3RN2 A;  1HNX Q;  3TRZ A;  1BBU A;  3J80 c;  4A3M G;  2Y0S E;  1N36 L;  1PH3 A;  4GKK Q;  2E2H H;  4YHH Q;  3M7N A;  1WOC A;  4BY1 G;  2AMC B;  1VQ8 A;  1XPO A;  4DR6 L;  1L1O A;  2NZO A;  4JI0 Q;  1D8L A;  1PV4 A;  3EN2 A;  2ES2 A;  3L2P A;  4AH6 A;  1XPR A;  4Y52 H;  1JT8 A;  5IP9 H;  3PIO A;  2UXC L;  3H15 A;  1LUZ A;  1UE1 A;  1JE5 A;  4DPG A;  1LTL A;  4JI0 L;  4JI2 L;  3CD6 A;  4A3B G;  5IYD G;  2JQO A;  3CCL A;  1D7Q A;  4JBJ A;  1L2F A;  2I5H A;  5LMN W;  3A74 A;  2B63 G;  3PUV A;  1PH1 A;  2A1A A;  4IOA A;  3S1M H;  2UXC Q;  2BH8 A;  4QGU A;  4DV2 Q;  3UDG A;  1NMG A;  5GAG C;  3PO3 H;  3W5O A;  2K52 A;  2E5L L;  2I0Q A;  1VQA A;  3BZK A;  5LMU Q;  4YCW A;  4A3D H;  4PZ8 A;  4DUY L;  3TS2 A;  1N32 L;  2CWA A;  1VQG A;  1PH4 A;  2AWO A;  3CXC A;  2UUC L;  1AE3 A;  2HIV A;  1OXU A;  4UP7 A;  3F2B A;  1UE7 A;  2VQF Q;  3RN5 A;  5LMU L;  4MZ9 A;  5M5W H;  1LYL A;  5C0X I;  2ZM6 L;  2VQE Q;  1V9P A;  5ELN A;  4UY8 C;  2R92 H;  4P75 A;  2YTY A;  4JYA Q;  4OO1 I;  3L0O A;  2PI2 A;  4NB3 A;  3HKS A;  2CQO A;  4RMF A;  4DR7 Q;  3PUW A;  4R4O A;  1HJP A;  1QVG A;  3I4M H;  5AJ3 L;  5FJ8 H;  1Q8K A;  2K5N A;  1G29 1;  3HOW G;  4A3E G;  3BU2 A;  2Q2U A;  4POG A;  1WCM H;  3D0F A;  3E0E A;  1OXT A;  4FDB A;  4LFB Q;  1EUJ A;  1S3O A;  5GAD C;  1E22 A;  2ZJQ A;  3PO2 H;  1EIF A;  2EXD A;  1KHI A;  3PGZ A;  4JI7 Q;  4A3B H;  2FXQ A;  2PQA B;  5C4J H;  2JA7 H;  1OTC A;  3KF6 B;  4GNX A;  1V43 A;  1PH2 A;  2UUA Q;  4A3G G;  1Y14 B;  3PUX A;  2VL6 A;  4HIK A;  1X9N A;  4A3L G;  4LFB L;  3UE0 A;  2RHQ B;  2OTJ A;  4PZ6 A;  4DV6 L;  4GOP C;  4X66 Q;  2NVY H;  4DV1 L;  1YIJ A;  4B3S L;  4DR2 Q;  1GD7 A;  4JI7 L;  4B3M L;  4LF4 Q;  2Y0S G;  1C0A A;  1VQB A;  1VQI A;  1J6Q A;  3CMA A;  4A3C G;  2VZA A;  5GRO A;  1B7Y B;  4JV5 L;  3K80 C;  3TQY A;  2BH2 A;  4BBS G;  4IPG A;  1CSP A;  2QA4 A;  4A93 H;  1FL0 A;  4LF6 Q;  4DNI A;  1VQ4 A;  1P8L A;  3U4Z A;  4A3E H;  4LNQ A;  2KCM A;  1YVC A;  4BXX H;  3KJP A;  4DV4 L;  1QVC A;  2CCZ A;  2A8V A;  4DR4 Q;  5JEA J;  3OTO L;  1VS0 A;  1YEZ A; 
#chains in the Genus database with same CATH topology
 1UEA B;  5LMN Q;  1CKN A;  3H94 A;  1BR9 A;  3HOU G;  1IW7 C;  4IUR A;  1VQN A;  1EYA A;  3OSO A;  2MQH A;  2DNC A;  1GHK A;  4JI3 L;  1ASZ A;  4WOR A;  5IYC H;  4JCV E;  4AIM A;  1IZ6 A;  4ME3 A;  1WYD A;  1IYU A;  4L5T A;  4U67 3;  1SFO H;  1VQL A;  2QGQ A;  4IFD I;  3N6R A;  4HJ5 A;  1IBM L;  3BDC A;  2JA5 B;  1AZP A;  4FP5 D;  3HG9 A;  1EY6 A;  2XWB B;  1EWI A;  1EWC A;  1GJX A;  1NR2 A;  2DY7 A;  3KF8 A;  3VR3 A;  4EVO A;  4LUO A;  1SMX A;  4XXE A;  4TVA B;  1YIT A;  3PF4 A;  4IUT A;  4FNF A;  2IY5 B;  1STG A;  3OMG A;  5K5P A;  3S1N B;  2KCC A;  1FNV A;  1Q86 C;  5DNF A;  3CCV A;  2R7D A;  4MTN A;  1Y8N B;  2WAQ E;  1B4O A;  3KBG A;  1F2M A;  3KOJ A;  3QR8 A;  3K5M A;  1TWG B;  2HDL A;  2K6A A;  3U50 C;  3WWV A;  4B3T Q;  3AFP A;  1B70 B;  1SE2 A;  4IJH A;  2NTS A;  3AB9 A;  3HRZ C;  1SJH D;  1V1P B;  3CQZ H;  3T1H Q;  1JOO A;  4BY1 H;  5A2Q L;  2F0E A;  5IYC G;  3K5O A;  2XRS D;  4NPS A;  5J1Z A;  4N8X 1;  5HUR A;  1Q1E A;  2IHE A;  2QF7 A;  2XWJ B;  4KKU A;  2CQA A;  3E9H A;  1IXR A;  2DJF C;  4DNT B;  1O7Z A;  2ATW A;  5I2Y A;  4CJ2 C;  4DGZ A;  2N8N A;  2F0T A;  1Q3L A;  1SRU A;  1A6X A;  2CW0 D;  4B3R L;  3J7A V;  4OO1 H;  4X64 L;  2B8F A;  1YNJ C;  2F0L A;  3ND8 A;  1QNK A;  5KND A;  4GZY C;  1IBK Q;  2M9V A;  1KAW A;  1K0R A;  2OQK A;  3MEH A;  1JOQ A;  3CCQ A;  1TU2 B;  1Y8P B;  2X69 A;  3NP8 A;  3S1N H;  1WCM G;  3A0J A;  1NY4 A;  1CKN B;  2Q2H A;  4NP5 A;  5JVH 3;  4UDU C;  2LXJ A;  1VQD A;  3KLS X;  1YNN C;  1A2U A;  4IUN A;  5KYL A;  1L1O B;  1NAP A;  1S5D D;  1KAA A;  5C4H A;  1M4V A;  3GDE A;  1I94 L;  2HD3 A;  1LT6 D;  4J6H A;  3RMH A;  4DA2 A;  5I6W A;  3I8Z A;  2HQL A;  5DLQ E;  3SK6 A;  3U58 A;  4TRD A;  4A3F G;  3D8G A;  4K8I A;  1NCV A;  3R2T A;  2UXB Q;  2X6L A;  3D4D A;  3FKI B;  5EAY A;  3OWE B;  3R2I A;  3W1G A;  4C3J H;  4OGQ C;  4R4Q A;  2CWP A;  5CBA E;  2MFI A;  3OYY A;  1Y1W B;  5JJL A;  1VQM A;  5IT9 c;  3S14 B;  4K0K Q;  5IP7 H;  2V1C C;  2FIN B;  4C56 C;  1N32 Q;  5COY A;  1I4R A;  1G2T A;  3GTJ B;  3NEN A;  4DV7 Q;  2B2Y A;  1AFP A;  1K8A C;  1QIL A;  1Q46 A;  5FLM H;  3E9I A;  3ER0 A;  1SE8 A;  2KHI A;  4KY6 A;  3FEW X;  2RCF A;  1C48 A;  1GUG A;  4A3I H;  4DV7 L;  4DR3 Q;  2R6G A;  1U0L A;  1C4Q A;  5J39 A;  1I94 Q;  3GTM H;  1AP0 A;  3A8K E;  4JBM A;  1LTA D;  5ISR A;  2JA8 B;  2KBN A;  1H9S A;  1ZXT A;  3MXG A;  5K36 H;  2ALY B;  4XT3 B;  2HCC A;  1X55 A;  2B2U C;  1RL2 A;  1HPC A;  1K28 A;  3CHB D;  2L9H A;  1KLG D;  2VUM B;  1U5K A;  3TME A;  2KHJ A;  3SK5 A;  2EYO A;  3P7J A;  2PMZ E;  2TSS A;  3OTO Q;  4CJ0 B;  1CK1 A;  4LF7 L;  3H3V I;  1X32 A;  4WJ3 M;  1STA A;  4B3M Q;  2WIN B;  1XYI A;  2SDF A;  3ULJ A;  1WI5 A;  2L0C A;  3CC4 A;  1XNQ Q;  1KLU D;  4R4C A;  4LF6 L;  3I4N B;  1JMC A;  2O5I C;  2IWH A;  5J3B A;  4WJW A;  1NMF A;  3VR2 A;  5C4X B;  4JI6 Q;  3VR4 A;  2PQE A;  2F0P A;  3KJO A;  1ZYR D;  4LAA A;  1JOK A;  1P16 A;  3Q24 A;  4RH6 A;  1LT4 D;  2NZ1 D;  1X3E A;  1PH6 A;  5T1G A;  3AQQ A;  2LKV A;  3H0G B;  5EKL A;  1BXT A;  1I4P A;  5D3I B;  3A8J E;  3EFX D;  1Q81 C;  4FVM A;  4KTA A;  4KD3 A;  2B2V C;  5CMD A;  2R7Z G;  2AHO B;  4OX9 Q;  1UAP A;  4I7Z C;  3FMC A;  1D1I A;  1HNW Q;  5EKI A;  2K04 A;  4X62 L;  4V0B A;  1SYB A;  2D62 A;  2O2L D;  1ZKO A;  4KV6 A;  2G5D A;  2SOB A;  1FJG L;  4GKJ Q;  4XTC S;  1EIG A;  1EU4 A;  3U9S A;  1EQT A;  2E2J B;  4HIM A;  1B53 A;  3KLR A;  1SYC A;  3HOW B;  3I3C A;  4X62 Q;  3W1B A;  1HZC A;  1NNX A;  4JV5 Q;  2EY6 A;  3L3O C;  4AYB B;  2UU9 L;  1VQJ A;  4L8J A;  3G48 A;  4CGY B;  3J80 L;  1YHQ A;  2F0K A;  4ZAI A;  4ZLT F;  2Q2T A;  1HR0 Q;  4HIO A;  3ITP A;  5FLM G;  1D6E C;  5LMN L;  4A3D B;  4S3S A;  1IL2 A;  2KJX A;  2F03 A;  3E6Z X;  3N52 A;  4JI6 L;  4DR1 L;  1I6H B;  1IL8 A;  2Z1C A;  3K59 A;  2QCP X;  2A69 D;  5C3E H;  2ZJP A;  4N9P A;  3VYU A;  3NWT A;  3GTK B;  2QDB A;  3MZ5 A;  1EY7 A;  2F4I A;  5I4D A;  1GVP A;  4HID A;  2EVB A;  1JR0 D;  1PZK D;  4C3H H;  5E4X A;  4C1N K;  5FKA C;  1IKM A;  3TSS A;  5E3F A;  2D5D A;  1SYF A;  4LUZ A;  1PH5 A;  3IL8 A;  1VQ6 A;  3G6E A;  3J7A 5;  3D3R A;  1ZEQ X;  4A3L H;  4JI4 Q;  4KK7 A;  1DJR D;  4DAY A;  4DK0 A;  2F0J A;  4A3I G;  1HRJ A;  1E2V A;  1JJ2 A;  4KY5 A;  4FYD A;  2NVX H;  1H95 A;  4ZCK A;  2Z6K C;  3Q23 A;  4JI4 L;  5GAE C;  2E2J H;  4R1J A;  1FNW A;  2PW7 A;  2NN6 H;  5D14 A;  4XYO A;  1X6O A;  5EBC A;  4QF4 A;  1FVI A;  5GQO A;  2JA5 G;  1E1T A;  3GP7 A;  1HTP A;  2ZT9 C;  4HCS A;  1PRT B;  1DXM A;  4LF5 L;  1GHJ A;  2VQF L;  4BBS B;  3CCR A;  2MUY A;  4HJ8 A;  2DY8 A;  1PTO D;  1ET9 A;  2A6E C;  4L6T B;  5JJZ A;  1O7L A;  1O78 A;  1YHB A;  4ILW A;  5AJ3 Q;  1G51 A;  4GNX C;  1I4H A;  5A35 A;  1R9T B;  2GVA A;  4GS3 A;  2VNU D;  1NE3 A;  2N3S A;  1IYV A;  3KDF A;  1B3A A;  4XDX A;  1TY0 A;  3GTO H;  1HA6 A;  5KEE A;  4GLX A;  1I50 H;  3QOJ A;  1EIY B;  4L5S A;  1NUC A;  1HNX Q;  2RDF A;  4A3M G;  2Y0S E;  4PMB A;  4FF3 A;  2AMC B;  4K2K A;  1MSH A;  2RKS A;  1D8L A;  2F0D A;  1Q90 A;  4AH6 A;  3S1Q B;  4Y52 H;  3PIO A;  4ID6 A;  1EQV A;  2I5H A;  3A74 A;  3FPU B;  3PUV A;  1PH1 A;  1XTC D;  4DV2 Q;  5GAG C;  2E5L L;  3W3A A;  3BZK A;  4CKB A;  4RFB A;  4E6I A;  4XQQ A;  3GTG B;  3M7G A;  2AWO A;  2F0S A;  5EKK A;  1K0S A;  2HIV A;  2J4X A;  3HP3 A;  3F2B A;  4RCO A;  1HQM C;  2NYZ D;  2VQE Q;  4OO1 I;  1V9P A;  4JYA Q;  3L0O A;  3P75 A;  1SMY C;  2PI2 A;  4NB3 A;  3HKS A;  4M8A A;  3PUW A;  5IOD A;  5BN3 A;  3HOW G;  4A3E G;  1LTB D;  4POG A;  1H9J A;  1CZG A;  3G7L A;  2JXM B;  3IAY A;  2EXD A;  4A3B H;  2AQ3 B;  3H91 A;  5C4J H;  1OTC A;  3KF6 B;  1PH2 A;  1LTG D;  1Y14 B;  4A3L G;  2VL6 A;  4PQX A;  4LFB L;  2R7Z B;  1L0X B;  4DV1 L;  4DR2 Q;  2Y0S G;  1VQI A;  1J6Q A;  5I6Y A;  3NTH A;  3K80 C;  3TQY A;  4BBS G;  2QA4 A;  3CRL C;  4LF6 Q;  1VQ4 A;  4A3E H;  3U4Z A;  3I4L A;  5C5M A;  2K05 A;  5IOC A;  2F0U A;  1SAP A;  4DV4 L;  2CCZ A;  1SYD A;  1T5E A;  1TWF B;  5KNC A;  5JEA H;  4PZ7 A;  4CDE C;  4LF7 Q;  1SRO A;  1K3B C;  1PFB A;  3F2C A;  3I70 A;  1EZ6 A;  3CCJ A;  1KQS A;  1E0B A;  1PRT C;  2NVT H;  3PO3 B;  4U68 A;  1VQK A;  5C44 G;  2NVQ H;  3JAM i;  5CV8 A;  4GOP B;  2NVY B;  4ME5 A;  4DV3 Q;  1K3R A;  1PTO B;  3RLN A;  5EGT A;  5FOB B;  4KHP L;  1BDO A;  1VCI A;  2R93 H;  3PQI A;  5GAH C;  1BVS A;  1JJC B;  1Y1V G;  2JYO A;  3TS0 A;  1PH7 A;  2HUG A;  3D31 A;  4C1N I;  5I2X A;  2E2I H;  3HOV G;  2K75 A;  4WJ4 A;  2WFW A;  3OOC A;  4P74 A;  1HTL D;  4Q5V A;  4A93 G;  1ET6 A;  1BCP C;  3NEL A;  1DOL A;  1CI3 M;  4KKS A;  4RCN A;  2UU9 Q;  4BA2 I;  2HDM A;  4EGV A;  1FYC A;  1YJ9 A;  1B9M A;  3L7Z C;  1XJV A;  1Q82 C;  2PCF B;  4YWK A;  1W6K A;  1S5F D;  2D9U A;  4K8J A;  3A55 A;  3S1M B;  3S1R B;  3J80 E;  2JEA I;  1BCP D;  5C3W A;  4GOP A;  3S17 H;  3KYH C;  1PDQ A;  1CSQ A;  3NTK A;  5FO8 B;  1HR0 L;  1I4G A;  2CVR A;  3CCS A;  4IUU A;  4DAV A;  2F3I A;  4KN7 C;  4BY7 B;  1EY9 A;  5C0X J;  1C8C A;  2LMC B;  1KD1 C;  3PV0 A;  1TWA B;  4LJZ C;  2HHH L;  5DEH A;  1JJG A;  4X64 Q;  1L0Y B;  3NQT A;  1AEX A;  4O1N A;  3JC6 6;  4LF8 L;  1SE4 A;  4ZUI A;  1RJT A;  2PI2 E;  1D5Z C;  3I4N H;  1S5B D;  1FJG Q;  4KLK A;  4A75 A;  4P71 A;  2ASB A;  1UUP A;  3VYS A;  1OXS C;  3GTJ H;  1WTP A;  4FXD A;  5G3L D;  4C3J G;  1ASY A;  5LL6 S;  5IIF A;  1YBY A;  2XGT A;  1XMO Q;  2E8G A;  4CDC C;  5C3X A;  2B3G A;  1SNM A;  4BBR G;  2EYF A;  2VUM H;  1MSG A;  1Y8O B;  3RUZ A;  3GO5 A;  2I46 A;  1BUV T;  2PQA A;  1I5F A;  1F9Q A;  3KF6 A;  4YCV A;  5ELO A;  4JVZ A;  2VQE L;  1Y1W H;  4BXX G;  5COR A;  2CH4 A;  1S5C D;  3S2D B;  5D65 A;  3Q6S A;  2K32 A;  3TP6 A;  5IT9 L;  2K28 A;  1TY2 A;  3LX0 A;  4RWS C;  1ICW A;  3S17 B;  3S15 H;  4ODG A;  4QJF A;  5CV5 A;  3PMF A;  1Z9F A;  3JAM L;  5M3M G;  1JE4 A;  1Y1W G;  4JBW A;  4DR2 L;  2G9D A;  1JB7 A;  2GVB A;  2IHF A;  5FLX L;  2B63 H;  4PV1 C;  5I9O A;  1LAB A;  3HOX B;  3WOF A;  2RF4 A;  5IGB A;  2BA1 A;  1VQC A;  1JWS D;  1RDP D;  2KA7 A;  2Q8T A;  4C3I H;  4DR5 L;  1XNQ L;  1LTI D;  2Z0S A;  3DUZ A;  4KJN A;  2UUC Q;  3IRB A;  1HCZ A;  4G7Z C;  5C4J B;  1QCB D;  1N34 Q;  2F0H A;  4IPD A;  5ELD A;  1PTO H;  1AH9 A;  1PYW D;  3RNU A;  4DUY Q;  3AU7 A;  4DUZ Q;  1LAC A;  4XT1 B;  1Q8I A;  2Z6K A;  3HZX A;  4X3U A;  2NZH A;  2JA7 G;  5EPL A;  4K2L A;  1X3F A;  4JYA L;  1PFS A;  3SGI A;  3H3V C;  5FO9 B;  4DR7 L;  2A6E D;  2JA6 G;  2KEC A;  3TP8 A;  3OWF A;  3MWY W;  4DV1 Q;  1T9H A;  1N8R C;  3GTQ H;  5JVG 3;  4XIG S;  2B2Y C;  2L15 A;  3CP0 A;  1EZ8 A;  1I4Q A;  4R4I A;  4X65 Q;  1EY4 A;  3S9W A;  3FRP B;  4K6D A;  2JA8 H;  1XX8 A;  4A3J G;  5M5X H;  1EY8 A;  2ZXP A;  4X65 L;  2ZJR A;  1I3Q H;  3T4A C;  4R8N A;  1STY A;  1HZ9 A;  1MI2 A;  1GUN A;  3S1Q H;  3AYH B;  2FMM A;  2AUJ D;  1GUS A;  3NHH A;  1LV9 A;  2HQE A;  2ZTC A;  1HHV A;  3SEB A;  3TDQ A;  1Q12 A;  3NBH A;  1A3V A;  1U4M A;  1EOV A;  3U4V A;  4MIU A;  3M9B A;  4ZYS A;  4G57 A;  2ZXO A;  5K36 G;  3NEM A;  1QE6 A;  3MEF A;  1YJN A;  4A3J H;  4JI3 Q;  2B2U A;  3U9O A;  1R4Q B;  5E1F A;  2PNR C;  1II3 A;  4DK3 C;  3S14 H;  2AWN A;  2VS1 A;  3NE5 B;  3HOY H;  1ENC A;  2LXK A;  1X56 A;  1IBM Q;  1BKB A;  4NMZ A;  1EFI D;  4WRD A;  3SR1 A;  2RBM A;  4NW2 A;  3FDT A;  2LFN A;  4NDX A;  1CHQ D;  3CC7 A;  1VF7 A;  3DM1 A;  4NXM L;  3IKJ A;  1GOZ A;  4GN5 A;  2EIF A;  4Y7N B;  1LT5 D;  1ML0 D;  1A0I A;  1RF2 D;  2NVT B;  3DEO A;  4A3M B;  3X3M A;  1RHP A;  4LUV A;  3FHW A;  1YZ6 A;  1WD0 A;  1AE2 A;  2AQ2 B;  4DKA C;  3DLL A;  1VF5 C;  1YI2 A;  1SBB B;  4HMJ A;  5E7N A;  2JA9 A;  3ICE A;  2Z4H A;  5H1S E;  2XNA C;  2K1B A;  2D0P A;  4LW1 A;  4BBR B;  3EVQ A;  2B63 B;  3UI2 A;  2B2T C;  4DU9 A;  4C3J B;  5CC4 A;  1X54 A;  4JOI A;  1NR4 A;  4OEM B;  1L1O C;  4JI5 L;  3G71 A;  2EYJ A;  4IN3 A;  1PH8 A;  1HZB A;  3S15 B;  3BYT B;  3C46 A;  2XIW A;  1K8G A;  5IGC A;  1M90 C;  1HNX L;  3KF8 B;  1FR3 A;  1PZI D;  5JPN C;  1A2T A;  2WII B;  2HHH Q;  3GD7 A;  3TEH B;  2JEB I;  4YY3 Q;  4LF9 Q;  4DAM A;  4HCE A;  2YV5 A;  1PRT F;  1OXV A;  1YHA A;  5C6A A;  5JEA G;  2R92 B;  2M00 A;  1G6P A;  4FO2 A;  3LGJ A;  2QEX A;  1F9P A;  3HOZ G;  3MXP A;  3DWP A;  3TRE A;  3P1H A;  4HTH A;  1TT2 A;  2IW3 A;  1K8M A;  1CKO A;  3MFY A;  4LMQ D;  4BY7 G;  1V1Q A;  4EQN A;  3BG3 A;  4WFN 3;  4OON A;  1IKL A;  3NPP A;  3S16 H;  3HOU H;  1WTX A;  1ILP A;  3EBE A;  4XQN A;  1S4Z A;  5C3E B;  1E1O A;  1LM0 A;  3T1H L;  4GN4 B;  4JI8 Q;  2O4X A;  1Y69 U;  5DM7 3;  5M5Y B;  1OXX K;  2H5X A;  3ERQ A;  3T56 B;  3CRK C;  1SN8 A;  1Z47 A;  3BDL A;  4RKL A;  4RGM A;  3SVM A;  4DF7 A;  4A3E B;  1BBU A;  1N36 L;  1DZ1 A;  1VQ8 A;  2DN8 A;  5KRU A;  1D5M C;  2MGS A;  4IZ8 A;  2ES2 A;  3Q22 A;  1G6Z A;  3KLS A;  1XPR A;  3TZU A;  2K5D A;  1LTL A;  2CW0 C;  3MFG A;  3TP7 A;  4JI0 L;  4A3B G;  4L63 B;  4JBJ A;  1L2F A;  5LMN W;  2H1E A;  2A1A A;  4BS9 A;  2J7Z A;  1TII D;  1AN8 A;  5LMU Q;  4YCW A;  4A3D H;  4DUY L;  2IJ0 A;  3GTQ B;  1PH4 A;  4C3I G;  4UP7 A;  2VQF Q;  4MZ9 A;  2YTY A;  3MA2 B;  4RMF A;  1DCZ A;  2CQO A;  4F8M A;  4DR7 Q;  4R4O A;  1HJP A;  3NWS A;  3I4M H;  1GXD C;  5AJ3 L;  4KHV A;  2K5N A;  2VXW A;  4OIJ A;  3MVV A;  3HOZ B;  4ZQ3 A;  2EPB A;  1EUJ A;  3DWA A;  1S3O A;  1SMY D;  1KHI A;  1ONL A;  2A68 D;  4A3B B;  2JA7 H;  4IUQ A;  1V43 A;  3NTI A;  2P5Z X;  3H6M A;  3UE0 A;  2RHQ B;  4PZ6 A;  4XQJ A;  1YIJ A;  4X66 Q;  1SFO B;  2A6H D;  3BYY B;  1GD7 A;  4JI7 L;  4B3M L;  4NKL A;  4CDF C;  2VZA A;  2IPK D;  4DK1 A;  4C3H G;  1SNO A;  1FL0 A;  2NB0 A;  1P8L A;  4K5W A;  4LNQ A;  2O5J C;  1PRT D;  5G3L F;  4BXX H;  2A8V A;  1QVC A;  1VS0 A;  5FK9 C;  1IHZ A;  2JA8 G;  1QUQ B;  3C3L A;  4DV5 L;  3M4P A;  4X6A H;  1ESR A;  1PH9 A;  4A3G H;  4A3K G;  2RQX A;  3S2H H;  2YU9 H;  4KKT A;  5KIX A;  4KN4 C;  4X3K A;  3CAM A;  2FJ2 A;  3P20 A;  1JIC A;  2KVM A;  3NQI A;  3A7L A;  3R3O A;  1HUM A;  1PMR A;  2OCE A;  1QOH A;  3PIP A;  4OWW B;  5M3M H;  3M4Q A;  3M85 A;  1BO0 A;  2VY3 A;  3K81 C;  2F3W A;  2RVL A;  3I55 A;  5F2D A;  3J81 i;  2HCI A;  1M1K C;  1TS3 A;  3GV6 A;  1QUQ A;  4HSV A;  2JK8 A;  3OHX C;  4AYB G;  3E5S A;  4RGO S;  3I4M B;  1W2B A;  3EJI A;  1ESF A;  2NN6 I;  3H0G H;  3STB D;  4N8F A;  2F4V Q;  2IX3 A;  1J5E L;  1HNW L;  2E74 C;  3J81 L;  1CUK A;  3FKI G;  5IYD H;  1MJC A;  4IJL A;  5IGG A;  5HGT A;  4RAU C;  1TS5 A;  5ELF A;  1PYS B;  2WV6 D;  3DHQ A;  2LY7 A;  4K6L A;  5BN5 A;  5IE8 A;  4AQY L;  1FD7 D;  4M1U B;  1HFG A;  2F0V A;  3H0G G;  4IO9 A;  1KXL A;  2A74 C;  4A3K H;  4NXN Q;  5IY0 A;  4BBR H;  2BE5 D;  4J15 A;  2MPM A;  2RA4 A;  3GQB A;  1TWA H;  1D5X C;  2OWO A;  3VYR A;  2UXD Q;  3CPF A;  2F0W A;  3K7A B;  4RHS A;  4A3J B;  4OL7 A;  3A56 A;  2FFK B;  3K57 A;  3T51 B;  4C2M H;  2HIX A;  3RR5 A;  2OT2 A;  1PTO C;  1HA5 A;  2Z4I A;  3AEV A;  3AMU A;  1RD9 D;  4CKE A;  3BDO A;  1T5X D;  2IL8 A;  1BCP F;  5CR3 A;  1LTR D;  3I7F A;  3CKI B;  1YNX A;  3UE1 A;  4IOC A;  2JA6 B;  4I65 A;  2B29 A;  1K9M C;  1J5E Q;  4JI1 L;  4LFA L;  3GTP B;  2G9H D;  4IUP A;  1KTK A;  3DEP A;  1VQO A;  1EOT A;  3HKZ E;  3J81 j;  3CCU A;  3PSI A;  4B9X A;  4A4I A;  1GUO A;  1EQR A;  1HR0 W;  3M4O H;  1I6H H;  3D4W A;  2XRQ D;  1C7Y A;  1STE A;  2EY5 A;  1PHJ A;  3TZD A;  1X3G A;  2UUB Q;  3VA7 A;  1A63 A;  2NVX B;  2LSS A;  1UEB A;  4DV0 L;  4BY7 H;  2KEN A;  3A5U A;  1TQO A;  1TXY A;  3F2D A;  1X65 A;  1A62 A;  2EJM A;  2PW5 A;  4FXG C;  4DK6 C;  2CFM A;  2E2D C;  3QB3 A;  2K33 A;  4X3T A;  1SNC A;  3C1F A;  2WAQ B;  2D0O A;  1TWH H;  2OTL A;  1ZYR C;  2JP1 A;  2OEO A;  2KUM A;  2ZTD A;  4LF9 L;  4GKK L;  2WKD A;  3HOV H;  4OXP A;  1TS4 A;  4P73 A;  1IW7 D;  2EYP A;  2L55 A;  3J80 i;  1B2T A;  2RHS B;  3FPP A;  2YYZ A;  3BVZ A;  3KUP A;  4JI2 Q;  1TVX A;  3T1Y Q;  4Z9C B;  1PVO A;  5C4X H;  2F0F A;  1RTN A;  2JA7 B;  1LLR D;  2K7V A;  4MNO A;  1STN A;  5FJ8 G;  3HOW H;  1EEI D;  5IYB G;  1SSO A;  1WCM B;  1A8V A;  3F2U A;  1CQF A;  3K8A A;  3SXH A;  1B9N A;  4HED A;  4PNY A;  1EEF D;  4YCU A;  2KCN A;  2BDO A;  3MAQ A;  5IWA L;  3STB C;  4RHR A;  1S5E D;  1EQQ A;  1HUN A;  4C2M B;  1KDB A;  1MD2 D;  4A3F B;  4LFC L;  1NTG A;  3V05 A;  4B3S Q;  5JJI A;  1M8A A;  4HSP A;  1F2Z A;  4H7B A;  1Q1B A;  4OIK A;  3HOX G;  4XYQ A;  2K5H A;  3A8I E;  1PFN A;  1KAB A;  4IAL A;  4F7X A;  4IQZ A;  1BBW A;  5M3M B;  2WP8 J;  4DV6 Q;  2J0T D;  4BA1 I;  4LF4 L;  3HKZ G;  3A54 A;  5EQ0 A;  1U4P A;  3MXN A;  3ZJY C;  2VB2 X;  3MC0 B;  1MKH A;  2NTT A;  1K83 B;  4H02 A;  1BBX C;  1W6J A;  2L11 A;  4OO1 G;  4X3S A;  4MTK A;  2LS0 1;  5IGF A;  1Y1V B;  4RKB A;  1KIX A;  4UP8 A;  1NSN S;  1PYB A;  5FO7 B;  1LTT D;  2AKW B;  3GTG H;  3I91 A;  1F2Y A;  2XN9 C;  4A3F H;  2F0O A;  2EOT A;  1QZH A;  1ROD A;  3KLW A;  5C44 B;  3K0X A;  3F1Z A;  2DUD A;  4O42 A;  3MTS A;  4OWX B;  3QWN A;  1H9M A;  4OWT B;  4ULL A;  5M3F G;  2F1M A;  5LL6 X;  4QIW B;  1WTW A;  2CH4 W;  3S1R H;  4QMG A;  5CYU A;  1CFM A;  1E2Z A;  4K5V A;  3NBH B;  2A68 C;  1JWM D;  4HJ9 A;  5C4Z A;  1I50 B;  4JBK A;  4POF A;  2BOS A;  1KRS A;  1NBW A;  2PNH A;  2KCT A;  2NN6 G;  2FHT A;  4DV4 Q;  2K50 A;  2Z9H A;  2DGY A;  4C3I B;  1X3P A;  4L5R C;  4DV5 Q;  1WTH A;  2BA0 A;  2I5M X;  2B2V A;  1XTD A;  4JI8 L;  4YWL A;  5T1I A;  4RGT A;  2K14 A;  3MHB A;  4LWC A;  2F0Q A;  1B3Q A;  2JJQ A;  4AYB E;  1WTO A;  3HOU B;  1LTS D;  1KNE A;  3Q8D A;  3D6C A;  1H9S B;  5KGU A;  2RDH A;  3RLO A;  1RKN A;  1FNU A;  3RZD B;  4B3R Q;  3K6O A;  2Y0S B;  5LHY 1;  1EYC A;  2QIL A;  1WTQ A;  1B8A A;  3C2P A;  2R61 A;  1IBL L;  1VMP A;  1PLF A;  1E7Z A;  4YWM A;  3NUC A;  4DNR B;  2GA4 B;  1XMQ Q;  2F0I A;  2EE1 A;  3HFZ B;  1A15 A;  1X3Q A;  1NJI C;  2XVS A;  5JAV A;  5JJK A;  2VW9 A;  1GKH A;  1Z7T A;  4A93 B;  4FF4 A;  3EA6 A;  4DR5 Q;  1S40 A;  3I4O A;  1Z6H A;  4DV2 L;  3BS1 A;  5CGK A;  2RDG A;  3W2D A;  2UUB L;  4APV A;  1N33 Q;  1HNZ Q;  4CBV A;  4BY1 B;  4B3T L;  1H9R A;  1MHW C;  3UDI A;  2MNA A;  1N34 L;  3ULP A;  3NXW A;  2BDN A;  2BCO A;  3SK4 A;  1BCP B;  4IFD J;  2AUK A;  4UPA A;  3B6Y A;  3CW2 C;  5E4W C;  3DM3 A;  2YU9 B;  1FGU A;  1KDA A;  1YNJ D;  4A3G B;  4DV0 Q;  4V19 0;  1KNA A;  2EJG C;  2PMZ B;  2F3V A;  3HS0 C;  1IYJ B;  1EWH A;  4ABN A;  4H0L C;  2A73 B;  2EYM A;  1RTO A;  1VQH A;  3TRZ A;  4GKK Q;  1SXT A;  3URY A;  2Q8R E;  4C3H B;  4DR6 L;  1L1O A;  2NZO A;  2DNE A;  1PV4 A;  3L2P A;  2WB1 B;  3LNN A;  3TP5 A;  5IP9 H;  1JB3 A;  5EBD A;  1LUZ A;  1UE1 A;  4DPG A;  1CQV A;  3CD6 A;  1AZQ A;  2JQO A;  2OXP A;  2EXZ A;  3CCL A;  2K5Q A;  5DAU A;  4IOA A;  2BH8 A;  5CV4 A;  5ELC A;  3BVG A;  3VR6 A;  3PO3 H;  2K52 A;  1VQA A;  1BNZ A;  1UNS A;  1J8I A;  4PZ8 A;  3OMC A;  3TS2 A;  1N32 L;  3ONA B;  1I6V C;  4DN4 M;  3CXC A;  1OXU A;  1UE7 A;  5LMU L;  4UY8 C;  1LYL A;  2ZM6 L;  3SHL A;  2R92 H;  5ELN A;  1HFN A;  4P75 A;  4TKO B;  2CHB D;  3BVM A;  1QVG A;  4KMU C;  3WDN A;  5FJ8 H;  3QJY A;  1D1K A;  3BU2 A;  1QB5 D;  2E2I B;  4G4K A;  4A3I B;  4FDB A;  4H44 C;  5GAD C;  1E22 A;  1CA6 A;  1EIF A;  3PGZ A;  2C9O A;  2L1B A;  4HN7 A;  2UUA Q;  2KOL A;  4QUF A;  3PUX A;  4HIK A;  3PO2 B;  2OTJ A;  4GOP C;  2NVY H;  3IFT A;  2NVQ B;  1VQB A;  5GRO A;  4JV5 L;  1B7Y B;  4CHT B;  2BH2 A;  1TS2 A;  4IPG A;  4DNI A;  1YVC A;  5M5W B;  5JEA J;  3OTO L;  3BJU A;  1QWY A;  1STB A;  5KNB A;  1XPU A;  2A6H C;  3J81 E;  3J7Y W;  1L0W A;  5D3D A;  1XNR Q;  4NXN L;  2E5L Q;  4O2D A;  3UDX A;  5L37 A;  2QEJ C;  1PA6 A;  2B8G A;  4IPH A;  1U4R A;  3SE0 A;  2FMC A;  3HKZ B;  4EQO A;  1J9O A;  3D4R A;  3CPW A;  1BF4 A;  5EJW A;  4BBS H;  3I2Z A;  4YIJ A;  2NBF A;  1W3S A;  2RSO A;  4G7O C;  1C9O A;  4PG3 A;  2EYH A;  4PMC A;  2WB1 E;  1DOK A;  3UDF A;  4MN3 A;  3H09 A;  2EY1 A;  4OHJ A;  3HOY B;  1XXG A;  1PZJ D;  5C5L A;  2ENB A;  3CC2 A;  4IFD H;  3J81 c;  2KED A;  5HY6 A;  2YTX A;  3I90 A;  4KI0 A;  3RZO H;  5CV7 A;  4G7H C;  2A19 A;  5FLX c;  3K7U C;  1VQE A;  1QVF A;  1TWH B;  1CHP D;  4F88 A;  1WVL A;  4LK1 C;  4GLV B;  1PFM A;  4F87 A;  4GLA C;  2JA6 H;  2VUM G;  4QCL A;  3GV3 A;  3QO2 A;  2D2C C;  2GN5 A;  3AFQ A;  1VMC A;  1CKM A;  1BQQ T;  2R7F A;  1E2W A;  1I3Q B;  3S16 B;  5NUC A;  1QG7 A;  2PZU A;  2QW7 A;  3K0Y A;  1SYG A;  3I4N G;  3H3V H;  5TSS A;  1KDC A;  4O0A A;  2CKZ B;  1WD1 A;  2KHS A;  4HJ7 A;  4A3D G;  3BZC A;  4L5Q A;  2Q2I A;  1IBL Q;  4KHP Q;  3ND9 A;  1WFQ A;  1UE6 A;  3DXJ C;  3NK9 A;  3A5Z B;  3NSW A;  2A5H A;  1EFW A;  3VDY A;  5CV9 A;  3BZD B;  3T53 B;  3GTL B;  2NUC A;  2PYK A;  4HJA A;  4ALP A;  1R9T H;  3FKI H;  1G8Z D;  1RIP A;  1MJE A;  1KRT A;  1EYG A;  1TWG H;  1SLJ A;  3K58 A;  1HNZ L;  1DOM A;  5IGE A;  1V8Q A;  1WTR A;  4KJO A;  5BN4 A;  2HT1 A;  2XTI A;  4ZK9 B;  3RLF A;  2QDL A;  5M9O A;  3QOL A;  4LFA Q;  1EYD A;  4A3C H;  2OF1 A;  5HGQ A;  2DJG C;  3V96 A;  4AQY Q;  4RGN A;  3JAM E;  4P72 A;  3PCO B;  4TSS A;  3SDZ A;  1RCV D;  5IGD A;  2PPB C;  1STH A;  3D6W A;  4MHE A;  4QB4 A;  3CQZ B;  5IWA Q;  4DXG A;  5C4X G;  2I5L X;  4QIW E;  3GTM B;  1TR5 A;  2N78 A;  4HMI A;  1XWE A;  4J8Q A;  2IX0 A;  2ZXR A;  3I73 A;  3R93 A;  4KHZ A;  5A2Q E;  2B39 A;  4IUV A;  3NBI A;  2JN4 A;  3VR5 A;  4LF8 Q;  1KL9 A;  1MIU A;  1WTV A;  2X6G A;  2PZT A;  4PMW A;  4QL5 A;  5C44 H;  4RG1 A;  4QQB X;  4GN3 B;  3PIO 3;  2I07 B;  3PUY A;  4DR6 Q;  1IBK L;  4UAI A;  2R93 G;  3HGB A;  3EIV A;  1Y1V H;  3M4O B;  3QIA A;  2M2L A;  4K0K L;  2Z8L A;  2E76 C;  1N33 L;  3I72 A;  3OIP A;  2R93 B;  1G2S A;  4DR3 L;  2PZW A;  3Q0A A;  3CME A;  1YJW A;  4DUZ L;  3SK8 A;  4Y7N H;  5FLX E;  4DAY B;  4IFD G;  2ZTE A;  4DV3 L;  4LF5 Q;  3HEJ A;  3HOZ H;  2AQ1 B;  2PO4 A;  1VQ7 A;  1S72 A;  5J22 A;  3F8T A;  2EDG A;  3GTL H;  5IT9 E;  4LFC Q;  2N55 A;  1Q7Y C;  2WAQ G;  1HQR D;  4OX9 L;  3CCM A;  3PF5 A;  2UUA L;  3OPO A;  2QKI C;  2C5C A;  2MO0 A;  3ERS X;  2JSO A;  5IP7 G;  4R8I A;  4DXF A;  4A76 A;  3K5N A;  1HXY D;  1YNN D;  3E3X A;  1N36 Q;  3HOV B;  1QNU A;  1DM0 B;  1CZW A;  2K4K A;  4KY7 A;  3EQL C;  1B1Z A;  5AFW A;  4I7A A;  3C1E A;  1DYQ A;  2WAC A;  4X66 L;  2XSC A;  2OQ0 A;  2K5V A;  1VQ9 A;  1MBY A;  3KFU A;  1R4P B;  5IYB H;  3FP9 A;  2EYL A;  3VA5 A;  2K01 A;  2V4D A;  2L5T A;  1LO5 D;  4FF2 A;  4TQU S;  1KC8 C;  2ID0 A;  2SNM A;  1DON A;  4R9W A;  4N9T A;  2MJ8 A;  5M5Y H;  3CF5 A;  2ZM6 Q;  4UP9 A;  5C0X G;  4JI5 Q;  4B9W A;  4CJ1 B;  3I56 A;  2EZV A;  2N49 A;  5JOB A;  3PUZ A;  3HOX H;  3ZYY X;  2L12 A;  4OEL B;  3A7A B;  3CU7 A;  1VQP A;  4FF1 A;  1MGS A;  1GM5 A;  3JAM c;  3OW2 A;  2BE5 C;  1E24 A;  4H13 C;  5ELB A;  1V1P A;  4JOI C;  1U4L A;  2L4N A;  2RSN A;  3KK7 A;  3ERO A;  1O7Y A;  3DWQ A;  4QUC A;  2EJF C;  5ELE A;  2WKC A;  3J7Z C;  1UWV A;  1CT1 D;  2RCN A;  3I4M G;  3RD4 A;  4UHV A;  2ICI A;  2F4V L;  1JOR A;  3HOY G;  1O80 A;  2H4O A;  4QY7 A;  3S2D H;  2ICE C;  3GTO B;  1HZA A;  3L9A X;  3PO2 G;  4DR4 L;  3V2T A;  3K7A H;  3TBI B;  2IT1 A;  4BWG B;  1ENA A;  1PTO F;  4JG2 A;  4HR7 B;  1TWC B;  1UE5 A;  1JCK B;  1F2L A;  2C35 B;  1XNR L;  1CA5 A;  2JE6 I;  3TN2 A;  2VB3 X;  2F52 A;  1A3U A;  2K5W A;  3KDF B;  1GO3 E;  3RZD H;  2R7Z H;  1OO9 B;  4A3K B;  2JA5 H;  1D2B A;  5BR8 L;  1G91 A;  3T13 A;  1O7I A;  1ENF A;  1AW7 A;  1H9K A;  2EQS A;  3E0J A;  3X3N A;  4RA8 A;  3T16 A;  5M3F H;  2UXB L;  1CM9 A;  1K8O A;  5BR8 Q;  4YY3 L;  2UXD L;  1WJJ A;  3MXU A;  5CBE E;  2MP1 A;  1HH2 P;  3LWU A;  3PIP 3;  1K73 C;  4FXK C;  1SNP A;  1VQF A;  3FVQ A;  4NXM Q;  1DD2 A;  4JC0 A;  5I9P A;  3ULL A;  1I4X A;  2F0N A;  1SR3 A;  2KEE A;  4GKJ L;  1B50 A;  3MXN B;  1DGS A;  3OW7 A;  4CDD C;  1QZG A;  4A3M H;  1E3P A;  1XMQ L;  2WB1 G;  3J7A F;  4JK1 C;  3WOE A;  3KBX A;  4EQ5 A;  3T1Y L;  3G6J B;  4K5X A;  4KD4 A;  4JI1 Q;  1PXU A;  5C3E G;  3GTK H;  4ZRZ A;  1N9W A;  5IP9 G;  2NWG A;  3M3Y H;  5EPJ A;  1U9R A;  3GTP H;  4EQP A;  2SNS A;  4IPC A;  5DM6 3;  1F9S A;  4GNX B;  1XMO L;  4EX5 A;  2KQ3 A;  2F0G A;  5JPM C;  1VQ5 A;  1V1O A;  2YTV A;  4DR1 Q;  1SDF A;  3VYT A;  1LT3 D;  3PO3 G;  1TWC H;  4DFA A;  3G4S A;  3CCE A;  2TMP A;  4R4T A;  4YHH L;  3S24 A;  3RZO B;  1TWF H;  2R92 G;  2MO1 A;  1ILQ A;  1EY5 A;  2B2W A;  3DMU A;  2IX1 A;  1K83 H;  3RN2 A;  3J80 c;  1PH3 A;  2E2H H;  4YHH Q;  3LWE A;  3M7N A;  1WOC A;  4BY1 G;  1EL0 A;  2Z6B A;  1XPO A;  4JI0 Q;  3EN2 A;  5EPK A;  5M3F B;  1JC7 A;  1JT8 A;  4DAP A;  2SEB D;  4ZKB B;  2UXC L;  3H15 A;  2A69 C;  1ICF B;  1JE5 A;  4JI2 L;  5C0X H;  5IYD G;  3M3Y B;  3M4Y A;  1D7Q A;  1EIH A;  2EY2 A;  2MHV A;  2B63 G;  3S1M H;  1SYE A;  2UXC Q;  4QGU A;  3UDG A;  1NMG A;  2N88 A;  3S2H B;  3W5O A;  2I0Q A;  1JWU D;  1FGB D;  1SND A;  2CWA A;  3QG1 A;  4P2C B;  1VQG A;  2UUC L;  1AE3 A;  2F0M A;  4ZUJ A;  3RN5 A;  2B2W C;  5M5W H;  5C0X I;  5KYI A;  3OIQ A;  1SE3 A;  2E75 C;  1QJO A;  3R8B A;  2K03 A;  1GUW A;  1F9R A;  4Q0F A;  1JQY D;  2R3Z A;  1Q8K A;  4HAE A;  1G29 1;  4CKC A;  3K5L A;  2Q2U A;  1WCM H;  3D0F A;  3E0E A;  1F77 A;  1OXT A;  1A3T A;  1EU3 A;  1VDZ A;  1EY0 A;  1GUT A;  4LFB Q;  4K14 A;  2ZJQ A;  3PO2 H;  5CV6 A;  4JI7 Q;  2FXQ A;  2PQA B;  4B08 A;  5M5X B;  4J1M A;  1SNQ A;  4GNX A;  4A3G G;  1TKW B;  1X9N A;  4ZKC B;  4DV6 L;  4B3S L;  3IFD A;  4LF4 Q;  1C0A A;  3CMA A;  4A3C G;  1CTM A;  2B2T A;  4JW0 A;  4JPB W;  2E2H B;  1CSP A;  2Q8I B;  1BOS A;  4A93 H;  1SEB D;  1SJE D;  2KCM A;  3KJP A;  4DR4 Q;  3O13 A;  1B44 D;  1YEZ A; 
#chains in the Genus database with same CATH homology
 3BJU A;  4PZ7 A;  1XPU A;  4LF7 Q;  2JA8 G;  1QUQ B;  1SRO A;  5LMN Q;  4DV5 L;  1CKN A;  3M4P A;  4X6A H;  3HOU G;  1L0W A;  1VQN A;  1XNR Q;  2MQH A;  3F2C A;  1PH9 A;  4A3G H;  3CCJ A;  4JI3 L;  4A3K G;  4NXN L;  1KQS A;  1ASZ A;  2E5L Q;  4O2D A;  3UDX A;  2NVT H;  5IYC H;  2YU9 H;  3S2H H;  4JCV E;  1VQK A;  5C44 G;  4AIM A;  1IZ6 A;  3JAM i;  1PA6 A;  4IPH A;  2NVQ H;  4ME3 A;  4GOP B;  1WYD A;  4L5T A;  1VQL A;  1SFO H;  3CAM A;  2QGQ A;  4DV3 Q;  4IFD I;  1K3R A;  3RLN A;  3CPW A;  4HJ5 A;  4BBS H;  1IBM L;  3I2Z A;  2OCE A;  1W3S A;  3PIP A;  1C9O A;  5M3M H;  4OWW B;  1VCI A;  3M4Q A;  4KHP L;  4PG3 A;  2R93 H;  3M85 A;  5GAH C;  1BVS A;  1JJC B;  1Y1V G;  2WB1 E;  3TS0 A;  1PH7 A;  2VY3 A;  3K81 C;  3UDF A;  3I55 A;  3D31 A;  3J81 i;  1M1K C;  2E2I H;  1EWI A;  1QUQ A;  3HOV G;  2K75 A;  4WJ4 A;  2JK8 A;  4AYB G;  2WFW A;  4LUO A;  4P74 A;  1W2B A;  1SMX A;  4A93 G;  4TVA B;  1YIT A;  3PF4 A;  3CC2 A;  2NN6 I;  3H0G H;  3STB D;  3J81 c;  3NEL A;  5HY6 A;  2IY5 B;  2UU9 Q;  2YTX A;  4KI0 A;  2F4V Q;  4BA2 I;  3RZO H;  1YJ9 A;  2A19 A;  1J5E L;  5FLX c;  1HNW L;  3K7U C;  3L7Z C;  1XJV A;  1Q86 C;  1Q82 C;  1VQE A;  3CCV A;  4YWK A;  1CUK A;  3FKI G;  2R7D A;  4MTN A;  1QVF A;  1MJC A;  5IYD H;  4IJL A;  2WAQ E;  4GLV B;  3KOJ A;  4GLA C;  2JA6 H;  3U50 C;  4B3T Q;  3WWV A;  2VUM G;  3AFP A;  1B70 B;  1PYS B;  2JEA I;  4GOP A;  3S17 H;  2GN5 A;  3AFQ A;  3KYH C;  5IE8 A;  4AQY L;  1CKM A;  2R7F A;  4IJH A;  3H0G G;  4IO9 A;  1CSQ A;  3CQZ H;  1KXL A;  1HR0 L;  3T1H Q;  4A3K H;  4BY1 H;  4NXN Q;  3CCS A;  5IYC G;  5IY0 A;  4BBR H;  2F3I A;  4NPS A;  4J15 A;  3I4N G;  3H3V H;  1TWA H;  4O0A A;  2CKZ B;  2OWO A;  5C0X J;  1Q1E A;  2IHE A;  4HJ7 A;  4A3D G;  2UXD Q;  3CPF A;  3BZC A;  4L5Q A;  2Q2I A;  1IBL Q;  1KD1 C;  3E9H A;  3PV0 A;  4KHP Q;  1IXR A;  2HHH L;  1WFQ A;  1JJG A;  4C2M H;  1UE6 A;  2HIX A;  2ATW A;  4X64 Q;  3RR5 A;  3A5Z B;  1EFW A;  2N8N A;  3VDY A;  3JC6 6;  3AEV A;  3M4O H;  4LF8 L;  1SRU A;  1R9T H;  4ALP A;  4HJA A;  3FKI H;  4B3R L;  1RIP A;  3I7F A;  1MJE A;  2PI2 E;  4X64 L;  1YNX A;  3I4N H;  3UE1 A;  1KRT A;  1EYG A;  4IOC A;  1TWG H;  1FJG Q;  1SLJ A;  2B29 A;  4KLK A;  4A75 A;  1IBK Q;  1K9M C;  1J5E Q;  4P71 A;  4JI1 L;  1HNZ L;  2ASB A;  1KAW A;  4LFA L;  1K0R A;  1OXS C;  2OQK A;  3GTJ H;  3CCQ A;  1VQO A;  3HKZ E;  3J81 j;  3CCU A;  1ASY A;  3PSI A;  1XMO Q;  2XGT A;  1YBY A;  2XTI A;  2E8G A;  2B63 H;  4A4I A;  2HT1 A;  3RLF A;  2B3G A;  1EQR A;  1WCM G;  3A0J A;  1NY4 A;  4BBR G;  1HR0 W;  2VUM H;  1CKN B;  4LFA Q;  2Q2H A;  4A3C H;  1C7Y A;  2LXJ A;  1VQD A;  1PHJ A;  5HGQ A;  3GO5 A;  1X3G A;  4AQY Q;  2UUB Q;  1A63 A;  2PQA A;  1I5F A;  1L1O B;  4P72 A;  2LSS A;  3KF6 A;  3PCO B;  4YCV A;  5ELO A;  2VQE L;  1UEB A;  1Y1W H;  4BXX G;  4DV0 L;  3GDE A;  1I94 L;  2KEN A;  4BY7 H;  3A5U A;  1TXY A;  3F2D A;  5IWA Q;  2HQL A;  5DLQ E;  1X65 A;  3U58 A;  1A62 A;  5C4X G;  2I5L X;  4QIW E;  4A3F G;  4DK6 C;  2N78 A;  2CFM A;  3S15 H;  2IX0 A;  2UXB Q;  4KHZ A;  4QJF A;  2D0O A;  1TWH H;  1Z9F A;  5EAY A;  2OTL A;  5M3M G;  4LF8 Q;  3W1G A;  1KL9 A;  4JBW A;  4C3J H;  1Y1W G;  1MIU A;  4DR2 L;  1JB7 A;  4R4Q A;  2CWP A;  2GVB A;  2IHF A;  2MFI A;  2ZTD A;  4QL5 A;  4PMW A;  4RG1 A;  5C44 H;  3OYY A;  4LF9 L;  4GKK L;  4QQB X;  5JJL A;  3HOV H;  4OXP A;  4GN3 B;  5IT9 c;  1VQM A;  2RF4 A;  4P73 A;  4K0K Q;  3PUY A;  4DR6 Q;  1IBK L;  2BA1 A;  5IP7 H;  1VQC A;  2R93 G;  2V1C C;  3EIV A;  3J80 i;  4C3I H;  4DR5 L;  1XNQ L;  1Y1V H;  2RHS B;  1N32 Q;  2YYZ A;  4K0K L;  2Z0S A;  2UUC Q;  4JI2 Q;  3IRB A;  3T1Y Q;  1N33 L;  1PVO A;  3NEN A;  4DV7 Q;  5C4X H;  4DR3 L;  1K8A C;  1Q46 A;  5FLM H;  3E9I A;  3ER0 A;  1SE8 A;  2KHI A;  4MNO A;  3CME A;  4DUZ L;  5FJ8 G;  1YJW A;  1N34 Q;  4IPD A;  4Y7N H;  3HOW H;  4IFD G;  4DAY B;  1AH9 A;  2ZTE A;  4DV3 L;  4LF5 Q;  5IYB G;  4A3I H;  3HOZ H;  4DV7 L;  4DR3 Q;  2R6G A;  1U0L A;  3RNU A;  4DUY Q;  1A8V A;  1VQ7 A;  1I94 Q;  3GTM H;  3K8A A;  4DUZ Q;  1S72 A;  2Z6K A;  3F8T A;  4YCU A;  4JBM A;  2NZH A;  2JA7 G;  5IWA L;  3GTL H;  3STB C;  4LFC Q;  1Q7Y C;  2WAQ G;  2KBN A;  1X3F A;  4JYA L;  1PFS A;  4OX9 L;  3CCM A;  3PF5 A;  3SGI A;  1EQQ A;  2ALY B;  2UUA L;  4DR7 L;  2JA6 G;  4DV1 Q;  1T9H A;  1NTG A;  1X55 A;  4LFC L;  2MO0 A;  3ERS X;  1RL2 A;  1N8R C;  4B3S Q;  5IP7 G;  4XIG S;  3GTQ H;  2L15 A;  3CP0 A;  4A76 A;  1Q1B A;  4R4I A;  1N36 Q;  3HOX G;  4X65 Q;  1U5K A;  2KHJ A;  2K5H A;  2K4K A;  2PMZ E;  2JA8 H;  3OTO Q;  4A3J G;  1BBW A;  5M5X H;  4X65 L;  2WP8 J;  2ZJR A;  4LF7 L;  4DV6 Q;  1I3Q H;  4X66 L;  3H3V I;  4WJ3 M;  1HZ9 A;  4BA1 I;  4B3M Q;  4LF4 L;  2OQ0 A;  3HKZ G;  3S1Q H;  2K5V A;  3AYH B;  1VQ9 A;  3ULJ A;  1WI5 A;  3KFU A;  5IYB H;  3CC4 A;  3FP9 A;  2ZTC A;  1XNQ Q;  4R4C A;  4LF6 L;  1JMC A;  3ZJY C;  1MKH A;  1Q12 A;  4TQU S;  5J3B A;  1EOV A;  1NMF A;  4JI6 Q;  4H02 A;  3U4V A;  3KJO A;  1KC8 C;  3M9B A;  4OO1 G;  2ID0 A;  5K36 G;  1P16 A;  3NEM A;  3MEF A;  1X3E A;  4A3J H;  1YJN A;  1PH6 A;  4UP8 A;  1KIX A;  5M5Y H;  4JI3 Q;  1PYB A;  3AQQ A;  3CF5 A;  2ZM6 Q;  2AKW B;  4UP9 A;  5C0X G;  3GTG H;  4JI5 Q;  4DK3 C;  3S14 H;  1Q81 C;  2AWN A;  3I56 A;  4A3F H;  2N49 A;  3HOX H;  2VS1 A;  3PUZ A;  3HOY H;  2LXK A;  1X56 A;  1IBM Q;  1QZH A;  3KLW A;  1VQP A;  1BKB A;  2AHO B;  2R7Z G;  3K0X A;  3F1Z A;  4OX9 Q;  2DUD A;  1GM5 A;  3JAM c;  3OW2 A;  1E24 A;  3CC7 A;  4OWX B;  4NXM L;  4JOI C;  4OWT B;  1HNW Q;  4X62 L;  4GN5 A;  5M3F G;  2D62 A;  1FJG L;  4GKJ Q;  3S1R H;  4XTC S;  4HIM A;  2EIF A;  3J7Z C;  1UWV A;  1A0I A;  3NBH B;  4X62 Q;  2RCN A;  3W1B A;  3I4M G;  1HZC A;  4HJ9 A;  4LUV A;  4JV5 Q;  2UU9 L;  2F4V L;  3HOY G;  3FHW A;  1VQJ A;  1YZ6 A;  3S1N H;  3G48 A;  1AE2 A;  1YHQ A;  4JBK A;  4POF A;  1KRS A;  4QY7 A;  4DKA C;  1NBW A;  2PNH A;  3DLL A;  3S2D H;  2KCT A;  2NN6 G;  2Q2T A;  1HZA A;  1HR0 Q;  3PO2 G;  4DV4 Q;  2K50 A;  4HIO A;  2DGY A;  1YI2 A;  4DR4 L;  3K7A H;  2IT1 A;  5E7N A;  4L5R C;  5FLM G;  2JA9 A;  4JG2 A;  5LMN L;  4DV5 Q;  1IL2 A;  3ICE A;  1UE5 A;  2BA0 A;  2C35 B;  2I5M X;  1XTD A;  1XNR L;  5H1S E;  4JI6 L;  2JE6 I;  4JI8 L;  4DR1 L;  2D0P A;  2F52 A;  3KDF B;  4LW1 A;  4YWL A;  1GO3 E;  2K14 A;  4LWC A;  3RZD H;  2R7Z H;  5C3E H;  2JA5 H;  2JJQ A;  4AYB E;  1X54 A;  4JOI A;  5BR8 L;  1O7I A;  2ZJP A;  2EQS A;  1L1O C;  3Q8D A;  4JI5 L;  3G71 A;  5M3F H;  2UXB L;  3RLO A;  1PH8 A;  1HZB A;  4B3R Q;  1GVP A;  5BR8 Q;  4YY3 L;  4HID A;  1K8G A;  1HNX L;  1M90 C;  3KF8 B;  1B8A A;  2UXD L;  4C3H H;  1IBL L;  1WJJ A;  1I6H H;  2HHH Q;  3GD7 A;  1K73 C;  1HH2 P;  3TEH B;  1E7Z A;  1VQF A;  2JEB I;  4LUZ A;  4YWM A;  4DAM A;  4YY3 Q;  2YV5 A;  1PH5 A;  3G6E A;  4LF9 Q;  1OXV A;  4NXM Q;  1YHA A;  5JEA G;  1VQ6 A;  1XMQ Q;  4JC0 A;  4JI4 Q;  3J7A 5;  4A3L H;  1G6P A;  3LGJ A;  3ULL A;  3HFZ B;  2QEX A;  4A3I G;  3HOZ G;  1NJI C;  1SR3 A;  4GKJ L;  3MXN B;  3TRE A;  1JJ2 A;  5JJK A;  2NVX H;  2VW9 A;  1H95 A;  1DGS A;  1GKH A;  2Z6K C;  1QZG A;  4A3M H;  1E3P A;  1XMQ L;  4DR5 Q;  4JI4 L;  2WB1 G;  1S40 A;  3I4O A;  5GAE C;  4DV2 L;  1CKO A;  4EQ5 A;  2E2J H;  4R1J A;  4APV A;  3T1Y L;  2UUB L;  1N33 Q;  4BY7 G;  1V1Q A;  4JI1 Q;  1HNZ Q;  5C3E G;  3GTK H;  1N9W A;  5IP9 G;  4B3T L;  1X6O A;  4OON A;  3UDI A;  1FVI A;  5GQO A;  2MNA A;  3ULP A;  1N34 L;  2JA5 G;  3GTP H;  3M3Y H;  1E1T A;  4IPC A;  3S16 H;  4GNX B;  1XMO L;  3HOU H;  4EX5 A;  4LF5 L;  3EBE A;  2VQF L;  3CCR A;  1VQ5 A;  4HJ8 A;  4IFD J;  4UPA A;  1E1O A;  1LM0 A;  2YTV A;  3B6Y A;  3CW2 C;  3T1H L;  4GN4 B;  3DM3 A;  4JI8 Q;  4DR1 Q;  1YHB A;  1FGU A;  5AJ3 Q;  3PO3 G;  1TWC H;  1G51 A;  4GNX C;  3G4S A;  3CCE A;  4DV0 Q;  2GVA A;  4GS3 A;  2VNU D;  1NE3 A;  1OXX K;  2N3S A;  2H5X A;  4R4T A;  3KDF A;  5JJI A;  4YHH L;  3S24 A;  3GTO H;  1IYJ B;  1TWF H;  2R92 G;  2MO1 A;  1SN8 A;  1VQH A;  4GLX A;  1I50 H;  1EIY B;  1Z47 A;  4L5S A;  2IX1 A;  1K83 H;  3RN2 A;  1HNX Q;  3TRZ A;  1BBU A;  3J80 c;  4A3M G;  2Y0S E;  1N36 L;  1PH3 A;  4GKK Q;  2E2H H;  4YHH Q;  3M7N A;  1WOC A;  4BY1 G;  2AMC B;  1VQ8 A;  1XPO A;  4DR6 L;  1L1O A;  2NZO A;  4JI0 Q;  1D8L A;  1PV4 A;  3EN2 A;  2ES2 A;  3L2P A;  4AH6 A;  1XPR A;  4Y52 H;  1JT8 A;  5IP9 H;  3PIO A;  2UXC L;  3H15 A;  1LUZ A;  1UE1 A;  1JE5 A;  4DPG A;  1LTL A;  4JI0 L;  4JI2 L;  3CD6 A;  4A3B G;  5IYD G;  2JQO A;  3CCL A;  1D7Q A;  4JBJ A;  1L2F A;  2I5H A;  5LMN W;  3A74 A;  2B63 G;  3PUV A;  1PH1 A;  2A1A A;  4IOA A;  3S1M H;  2UXC Q;  2BH8 A;  4QGU A;  4DV2 Q;  3UDG A;  1NMG A;  5GAG C;  3PO3 H;  3W5O A;  2K52 A;  2E5L L;  2I0Q A;  1VQA A;  3BZK A;  5LMU Q;  4YCW A;  4A3D H;  4PZ8 A;  4DUY L;  3TS2 A;  1N32 L;  2CWA A;  1VQG A;  1PH4 A;  2AWO A;  3CXC A;  2UUC L;  1AE3 A;  2HIV A;  1OXU A;  4UP7 A;  3F2B A;  1UE7 A;  2VQF Q;  3RN5 A;  5LMU L;  4MZ9 A;  5M5W H;  1LYL A;  5C0X I;  2ZM6 L;  2VQE Q;  1V9P A;  5ELN A;  4UY8 C;  2R92 H;  4P75 A;  2YTY A;  4JYA Q;  4OO1 I;  3L0O A;  2PI2 A;  4NB3 A;  3HKS A;  2CQO A;  4RMF A;  4DR7 Q;  3PUW A;  4R4O A;  1HJP A;  1QVG A;  3I4M H;  5AJ3 L;  5FJ8 H;  1Q8K A;  2K5N A;  1G29 1;  3HOW G;  4A3E G;  3BU2 A;  2Q2U A;  4POG A;  1WCM H;  3D0F A;  3E0E A;  1OXT A;  4FDB A;  4LFB Q;  1EUJ A;  1S3O A;  5GAD C;  1E22 A;  2ZJQ A;  3PO2 H;  1EIF A;  2EXD A;  1KHI A;  3PGZ A;  4JI7 Q;  4A3B H;  2FXQ A;  2PQA B;  5C4J H;  2JA7 H;  1OTC A;  3KF6 B;  4GNX A;  1V43 A;  1PH2 A;  2UUA Q;  4A3G G;  1Y14 B;  3PUX A;  2VL6 A;  4HIK A;  1X9N A;  4A3L G;  4LFB L;  3UE0 A;  2RHQ B;  2OTJ A;  4PZ6 A;  4DV6 L;  4GOP C;  4X66 Q;  2NVY H;  4DV1 L;  1YIJ A;  4B3S L;  4DR2 Q;  1GD7 A;  4JI7 L;  4B3M L;  4LF4 Q;  2Y0S G;  1C0A A;  1VQB A;  1VQI A;  1J6Q A;  3CMA A;  4A3C G;  2VZA A;  5GRO A;  1B7Y B;  4JV5 L;  3K80 C;  3TQY A;  2BH2 A;  4BBS G;  4IPG A;  1CSP A;  2QA4 A;  4A93 H;  1FL0 A;  4LF6 Q;  4DNI A;  1VQ4 A;  1P8L A;  3U4Z A;  4A3E H;  4LNQ A;  2KCM A;  1YVC A;  4BXX H;  3KJP A;  4DV4 L;  1QVC A;  2CCZ A;  2A8V A;  4DR4 Q;  5JEA J;  3OTO L;  1VS0 A;  1YEZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...