1MJCA

Crystal structure of cspa, the major cold shock protein of escherichia coli
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
69
structure length
69
Chain Sequence
SGKMTGIVKWFNADKGFGFITPDDGSKDVFVHFSAIQNDGYKSLDEGQKVSFTIESGAKGPAAGNVTSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulation
molecule keywords MAJOR COLD-SHOCK PROTEIN 7.4
publication title Crystal structure of CspA, the major cold shock protein of Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
total genus 12
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 1994-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1mjcA00
3RLOA 5LMNQ 2HHHQ 4P73A 4DR7L 4LFBQ 2K5HA 1K3RA 1P16A 4KHZA 4PMWA 3JAMi 4GKJQ 2KHJA 3FKIH 2VS1A 4JI2L 1WCMH 3NELA 2ASBA 4A3BG 1I3QH 1D8LA 4LUVA 5C0XI 2Z0SA 3CXCA 5GROA 2ZJQA 3I55A 1N34L 4AYBE 2QA4A 2ZJRA 3STBC 4DAYB 1CUKA 4LFCQ 1H95A 3I4OA 3M4QA 4NXNL 2ZTCA 1NY4A 2R6GA 1YHQA 1EIFA 2K14A 4OWTB 3PIOA 4DR4Q 2VW9A 4A3JH 3S14H 2DUDA 2Q2TA 1L1OA 2VL6A 2R7ZG 1G51A 5C44G 2RHQB 1PA6A 2E2IH 2K5NA 3RLNA 1XPRA 3CD6A 1SN8A 1GD7A 3CMEA 4JBKA 4DR6L 1VS0A 1JJGA 1OXUA 2V1CC 4R1JA 5IT9c 3F2DA 1K0RA 4DV3Q 2UXBQ 1TXYA 2UUBQ 3CCQA 1JJ2A 4JI3Q 5JJLA 4UP8A 4A3EH 1QUQA 4UP7A 5BR8L 2GVAA 2A8VA 4JI4Q 1KXLA 3ZJYC 1V9PA 3K7UC 1A63A 1E22A 4OONA 1YIJA 4POGA 2Q2HA 2IX0A 1L2FA 1K83H 3UE1A 1L1OB 1N32Q 3ERSX 1GKHA 5C0XJ 3S17H 3AFPA 2CKZB 5ELNA 2KENA 1N36L 1A62A 1K8AC 3PO2G 4XTCS 4R4QA 5JJIA 4KHPL 1B8AA 1PH9A 2QGQA 3E9HA 2PI2A 3FKIG 5GADC 3CF5A 1NTGA 1PH4A 3K8AA 4PZ7A 1WCMG 1VQDA 2NZOA 2IX1A 2OTLA 2ALYB 1HNWL 4A3GH 4AQYQ 3NEMA 4R4IA 3A5UA 3F2CA 5IE8A 2YU9H 2WB1G 1Q7YC 4B3RQ 2HIXA 2XTIA 5AJ3L 5LMUQ 2JA9A 4JI0L 4OO1I 2B3GA 1R9TH 1EQQA 4IPDA 1SRUA 2JQOA 2A1AA 4A3JG 4GLXA 1KRSA 1HZCA 1EOVA 3AEVA 1DGSA 4JI1L 5C4JH 1HR0W 5IYBG 2LXKA 3M85A 4A3MH 2YTXA 4DV1Q 1XNRQ 1G6PA 4DUYL 1XPUA 1BKBA 1QVCA 4IJHA 4QIWE 3CC4A 1VQ9A 4LF7L 4JBWA 2MNAA 1I94Q 3RZDH 3K81C 4A3EG 4R4OA 3STBD 5FLXc 2RHSB 1W3SA 4DV6Q 1EWIA 3L7ZC 3M4OH 1SR3A 2EXDA 3G4SA 3CP0A 3KFUA 1YITA 1FJGQ 4IO9A 4UPAA 1S3OA 2OWOA 4DR7Q 3CAMA 4A4IA 1IBML 4C2MH 3KOJA 2D62A 1XNQQ 1YZ6A 3KF8B 3GTPH 5IYDH 4X64L 1RIPA 4DKAC 5JJKA 1VQEA 4OWXB 2UUCL 2OTJA 3CPFA 2D0PA 3CCRA 3I2ZA 1VQCA 1XMQL 4IFDG 2EIFA 4DV7L 3D0FA 2R93H 2VQEQ 4L5RC 1VQLA 5C44H 1Q8KA 4NXNQ 4A3GG 4X6AH 4OO1G 1Y14B 4R4TA 4DV0L 2C35B 1YHBA 4P71A 5C4XH 4YCVA 4K0KQ 4YCWA 3PO3H 4JYAL 2NVQH 4NPSA 1S72A 4DUZL 1VQAA 2JJQA 5M5XH 5IWAQ 3CW2C 1PFSA 4OX9L 5EAYA 1S40A 4H02A 5GAHC 3ICEA 3S15H 3M7NA 2HT1A 4WJ4A 1K8GA 4ALPA 2VZAA 1J5EQ 4DR3Q 4JI7Q 1C9OA 2PNHA 3K7AH 1I5FA 1PV4A 3CCLA 4KI0A 5BR8Q 3HOZH 4DR1L 1IZ6A 2E2HH 4A3MG 3PUZA 1K73C 1K9MC 3H3VI 4PG3A 5E7NA 2H5XA 4BY1H 2MQHA 5J3BA 2K50A 2R7FA 3W1GA 2UXCQ 3OTOL 1GO3E 3KLWA 3L0OA 3CC7A 3H15A 3BZCA 1UE5A 4JBJA 4JCVE 1O7IA 1HZAA 4APVA 2F4VL 1AH9A 2PQAA 2UU9L 3I4NH 3GD7A 1ASZA 4B3SL 1VQ5A 1CKNB 2JK8A 3BZKA 5M3MG 2RF4A 4X66L 4X62Q 4A3DH 3I56A 3UDFA 1PH2A 1SMXA 4A3IH 4LFAL 4KHPQ 1MKHA 3G71A 1E1OA 4GOPA 4A76A 3W1BA 5IYDG 1KD1C 1HNWQ 4LF5L 4IPHA 1X56A 2K52A 3NENA 1SLJA 5IP7H 1YJ9A 3AFQA 2R93G 1X65A 4DR2L 1Q1EA 2D0OA 2PQAB 4JG2A 3CC2A 3TREA 3B6YA 3LGJA 3F8TA 5IYBH 5C3EG 3J81c 1X54A 1HNZL 2MFIA 1OXXK 1QVGA 1KQSA 5C4XG 4GKKL 2N78A 2Y0SG 1L0WA 1BBWA 3PO3G 3OW2A 3TS0A 2BH2A 2JA6H 4GOPB 5GQOA 3NBHB 4HJ8A 4O0AA 4GN5A 5GAGC 3JC66 3KJOA 3M3YH 1L1OC 1NMGA 5FLMH 2QEXA 5LMNW 4BBRG 4GNXA 1JB7A 4DUYQ 4C3HH 4DPGA 2ZJPA 2ATWA 4TVAB 2N3SA 1X55A 4OXPA 4A3KH 4YY3L 3HOZG 2F3IA 1TWGH 4Y7NH 4BY1G 4JI6L 1YJNA 4LF6Q 1A0IA 2N8NA 4B3TL 2B63G 1LTLA 3UDXA 1WYDA 1VQ4A 3F2BA 3UE0A 1B70B 3M4PA 1AE3A 1PH6A 1IBMQ 4QQBX 4BXXH 1KIXA 1NMFA 3Q8DA 3I4NG 3GTJH 4GNXB 4X64Q 3GTGH 2VQFL 4A3DG 5LMNL 2AWOA 4IFDI 4DV5Q 1KL9A 3HKSA 4A3IG 1BVSA 2JA5H 5IYCH 4LFBL 2KBNA 1XMQQ 1QVFA 4DAMA 2HIVA 1LYLA 2OQ0A 2WAQG 2E2JH 4LF8Q 3PUVA 3RZOH 2PI2E 2IY5B 2N49A 1NJIC 3CCMA 4ME3A 4DV0Q 4HIOA 4DR5L 1J6QA 2Q2UA 4BA1I 3CCEA 4HJ9A 2MO0A 5IP7G 4JYAQ 1N9WA 2JEAI 2YYZA 2BA1A 2CFMA 4JI5Q 3CCUA 3HFZB 5M3FH 4DV2L 1IBKQ 4OX9Q 4IPGA 2JA8H 3S2DH 4MNOA 4NB3A 4YHHL 3KJPA 2K5VA 3HOYH 2NZHA 4UY8C 1B7YB 2L15A 3AQQA 3CQZH 2JA6G 3ULPA 2E5LQ 4P74A 4NXML 1Q86C 4DR1Q 1E1TA 3A0JA 1KRTA 3HKZG 5FLMG 2K75A 1WJJA 2ZM6L 4HJ5A 5M3MH 3GTQH 3F1ZA 4DV3L 3PSIA 1PH1A 1VQBA 2UXBL 3IRBA 4JI3L 4L5QA 3OTOQ 3ULJA 3GTMH 4A3KG 4IFDJ 1XMOL 4JI2Q 1PH8A 1HR0L 1EFWA 2F4VQ 5IP9G 3CPWA 1LM0A 4B3SQ 3HOXH 3S2HH 1X9NA 4X66Q 4LUOA 1M90C 3ULLA 1N34Q 3SGIA 1HZBA 2JEBI 4L5SA 4BXXG 3FP9A 4JOIA 1HNXL 5C3EH 4LF4L 1NE3A 3WWVA 5ELOA 4LF5Q 5HY6A 2UUAL 3U50C 2JA5G 4UP9A 1Y1WG 2LXJA 5IYCG 2NVYH 1FGUA 4PZ8A 1VQHA 4LUZA 3TQYA 1NBWA 3H0GG 4EX5A 1VQ7A 2A19A 2YV5A 3KYHC 4DR2Q 3OYYA 2OCEA 1QZGA 1V43A 1U0LA 1JE5A 4IPCA 4AQYL 3M9BA 3J7A5 1HNZQ 4DR6Q 4POFA 4BBRH 3ER0A 1CKNA 4GKKQ 3CCSA 4DNIA 3T1HL 4LNQA 4B3RL 1Q12A 5LMUL 5M3FG 2JE6I 3KDFB 1YJWA 4X65L 2K4KA 2JA8G 3HOWH 1KAWA 1OTCA 3HOYG 4GLAC 1MJCA 3J80c 2PMZE 3CCJA 2B63H 2R92H 4TQUS 3PF5A 4JBMA 4HJAA 1M1KC 4R4CA 1JJCB 1PVOA 2YTVA 4PZ6A 3I4MH 4P72A 3JAMc 4YY3Q 4JI8L 1G291 3K0XA 4J15A 4DK6C 3S16H 4A93H 1IL2A 4MTNA 1N36Q 4A3FG 1PH5A 1HH2P 4JV5L 1Y1VH 2CCZA 1X3EA 3PUYA 1HJPA 4GN3B 3S24A 4B3TQ 2AWNA 3TRZA 4KLKA 2BH8A 2E8GA 3J80i 5GAEC 2ID0A 1QZHA 2WFWA 3PF4A 5DLQE 1BBUA 3HOXG 4AYBG 2VQFQ 1FJGL 1XTDA 1CKOA 1UEBA 4RG1A 4C3IH 1EIYB 1PH3A 3I7FA 4O2DA 2UXDL 1GVPA 1XNQL 2WP8J 5AJ3Q 1D7QA 4JI0Q 1LUZA 1IXRA 2XGTA 1KC8C 3G48A 1SFOH 1JT8A 1FVIA 4HIMA 4QL5A 4GOPC 4LF9L 3GTKH 2MO1A 4DR5Q 4BBSH 4HIKA 3RN5A 2Q2IA 4DK3C 1RL2A 1VQOA 2VQEL 1N8RC 3PIPA 3T1YL 1VCIA 4JI1Q 3TEHB 4QGUA 4DV2Q 4IOCA 3BU2A 1PH7A 1IYJB 2BA0A 2YTYA 1VQNA 1WI5A 4YHHQ 1AE2A 1IBLL 4K0KL 1YHAA 4LF7Q 4GLVB 4QJFA 5IY0A 1OXSC 3VDYA 1TWAH 4QY7A 2GVBA 4AH6A 2Y0SE 5IWAL 4HJ7A 3S1RH 3J81i 5FJ8G 1VQMA 1VQFA 1YBYA 2IHEA 5IP9H 3PUXA 4NXMQ 2JA7H 3HOWG 3AYHB 4L5TA 2ZM6Q 1CKMA 1C0AA 1J5EL 4DR3L 3U58A 2R92G 1XJVA 4JI7L 2I0QA 4BY7H 4B3ML 2VY3A 4YWLA 4GNXC 3MEFA 4A75A 3GO5A 5H1SE 4DV4L 2GN5A 3I4MG 1PHJA 1XMOQ 2IHFA 5JEAJ 1VQPA 1HR0Q 1X3GA 2FXQA 4A93G 1P8LA 1TWFH 2ZTDA 4LW1A 1N33L 2UUCQ 2VUMH 1Y1VG 2RCNA 2HHHL 2UXCL 1Y1WH 1Z9FA 2ZTEA 1OXTA 5JEAG 4GKJL 3H0GH 4DV7Q 4MZ9A 3GDEA 1HNXQ 4LF4Q 1JMCA 1UE7A 2I5LX 4X62L 1VQIA 2UUAQ 3HOVH 5C0XG 4LFCL 1QUQB 3J81j 3S1QH 3E9IA 4DUZQ 1EYGA 1VQ6A 1E24A 2WB1E 2NVTH 3S1NH 3E0EA 1E3PA 2WAQE 2Z6KA 3PV0A 5M5WH 3K80C 3CCVA 4DR4L 3GTLH 3DLLA 4BBSG 1I50H 1T9HA 1PYSB 3EIVA 4Y52H 1KHIA 2IT1A 3T1HQ 1X3FA 1I6HH 4JC0A 1W2BA 1Q1BA 4FDBA 4OWWB 4A3LH 3KF6A 4X65Q 4A3FH 3A5ZB 1TWHH 2R7DA 4EQ5A 1WFQA 2UUBL 2AKWB 3A74A 3EBEA 3RR5A 2Z6KC 3HOUH 3FHWA 3DM3A 4A3CH 2NN6I 3MXNB 3U4ZA 2AMCB 4JI4L 4JI8Q 2AHOB 2UU9Q 1VQ8A 2JA7G 1Q46A 4YWKA 4YCUA 4BA2I 3UDGA 4JV5Q 3HKZE 4LFAQ 4LWCA 4BY7G 1N32L 1Z47A 1U5KA 4C3JH 3G6EA 2F52A 2KCMA 3KF6B 2I5HA 1CSPA 3U4VA 2HQLA 3KDFA 5HGQA 4A3BH 3CMAA 1V1QA 2VUMG 4LF6L 5M5YH 2I5MX 1WOCA 1HZ9A 1YEZA 3UDIA 1UE1A 1MIUA 1VQJA 3PGZA 2UXDQ 2EQSA 3D31A 1YI2A 1SROA 4GS3A 2ES2A 1CSQA 4JOIC 3RNUA 1E7ZA 3PCOB 4DV5L 4P75A 4IOAA 4LF9Q 1C7YA 1YVCA 3HOVG 3RN2A 3PUWA 2KCTA 1SE8A 2CWPA 4IJLA 5FJ8H 1TWCH 1Q81C 4LF8L 2R7ZH 4RMFA 1VQGA 3T1YQ 3GTOH 2VNUD 1PYBA 4HIDA 1A8VA 1OXVA 2CQOA 3L2PA 1ASYA 1IBLQ 1MJEA 3RLFA 2LSSA 2DGYA 2OQKA 4XIGS 3S1MH 4JI5L 3EN2A 1Q82C 1IBKL 2NVXH 4A3LG 1FL0A 2B29A 1YNXA 3J7ZC 2KHIA 3TS2A 2NN6G 3W5OA 1X6OA 4AIMA 4DV1L 1XNRL 1XPOA 4JI6Q 4GN4B 1GM5A 4WJ3M 3H3VH 1I94L 3HOUG 1UWVA 3BJUA 4B3MQ 2E5LL 1VQKA 4A3CG 4YWMA 4DV4Q 1EUJA 1EQRA 2CWAA 5K36G 4DV6L 1UE6A 3PO2H 1N33Q
chains in the Genus database with same CATH superfamily
2QCPX 2K5HA 1K3RA 4PMWA 3FKIH 4Q0FA 4A3FB 2K04A 1WCMH 3NELA 2HCCA 5CR3A 5I9PA 3HOUB 2Z0SA 2ZJQA 5CGKA 1IW7C 2C5CA 3I55A 2QA4A 1DJRD 3STBC 4DAYB 1SSOA 4LFCQ 3SK5A 4FF2A 4RKLA 3I72A 1NY4A 1TS5A 2R6GA 1YHQA 1WTQA 1B3AA 3H94A 3Q22A 4C3JB 4OWTB 3R93A 1IL8A 3BVGA 2R7ZG 2RHQB 2ICEC 2RQXA 4XDXA 1WD0A 2ENBA 3CD6A 4DR6L 5CV9A 1JJGA 2V1CC 2K6AA 4R1JA 4X3TA 3X3NA 4UP7A 1B2TA 4MHEA 2GVAA 1SXTA 3MHBA 2A8VA 3K7UC 1PRTB 3VYRA 4OONA 4POGA 1L2FA 3UE1A 2O2LD 3DWAA 1L1OB 2F0NA 1N32Q 3N52A 5C0XJ 1TS3A 4RAUC 3IAYA 3NUCA 3JAML 2PZTA 1HFGA 1D1KA 4R4QA 2F0LA 4K8IA 1A3VA 2OT2A 1PH4A 1VQDA 3A5UA 1Q7YC 1Q90A 3PO2B 2XTIA 5LMUQ 2JA9A 4X3KA 1MSHA 2LFNA 1S4ZA 2B39A 1HA6A 3W2DA 2NWGA 4IUUA 2RA4A 1EOVA 1HR0W 1JWUD 4IURA 4R9WA 4DV1Q 1F9RA 1XNRQ 1BKBA 1QVCA 1XPUA 1G6PA 1GUNA 3T56B 2CVRA 4FVMA 1I94Q 4A3EG 1TR5A 3I73A 4BWGB 2SOBA 1IW7D 3STBD 2K32A 2RHSB 4A3JB 3M4OH 4FP5D 3G4SA 1H9KA 3CP0A 1YITA 3TN2A 1TIID 4IO9A 1OO9B 4UPAA 2OWOA 3DWPA 4DR7Q 3R2IA 1Q3LA 4C2MH 1A2UA 1XNQQ 4KJOA 4DFAA 1RIPA 1VQEA 2D0PA 5TSSA 1XMQL 4DA2A 4IFDG 4FO2A 1DOLA 2KQ3A 2SNSA 3D0FA 4L5RC 1VQLA 1W6JA 1EYCA 5FO7B 3V05A 1Y14B 4R4TA 4DV0L 2C35B 2RDHA 3T51B 3PO3H 4DUZL 2JJQA 5KNCA 5GAHC 4LK1C 3S15H 2KUMA 1TVXA 2CH4W 2VZAA 1J5EQ 4JI7Q 3NTHA 3LWUA 4A3GB 4CDEC 1QOHA 1GUGA 4KI0A 5BR8Q 4RH6A 3SE0A 1IZ6A 2E2HH 3HOZH 3H3VI 4PG3A 2BOSA 4EQOA 3IKJA 5J1ZA 3OTOL 3F2UA 1R9TB 1UE5A 4MN3A 1AH9A 2QDBA 4B3SL 2M00A 1VQ5A 4X62Q 2RF4A 3UDFA 4L6TB 4A3IH 5C4JB 1E1OA 4CJ2C 1TY0A 1ENCA 3W1BA 3NBHA 5JJZA 1HNWQ 3KK7A 1AZPA 1E0BA 5EBCA 4BS9A 1FGBD 4K5WA 1Q1EA 2D0OA 3GQBA 5IYBH 3F8TA 5JVH3 1LT3D 2MFIA 1GUTA 4GKKL 2N78A 2X6GA 5GQOA 1L0YB 4KV6A 3JC66 3NSWA 1O80A 3KJOA 3M3YH 2HQEA 4BBRG 1JB7A 2B2VC 4DUYQ 3WDNA 4C3HH 5T1IA 2ZJPA 2ATWA 3OHXC 2WINB 3NWSA 4HN7A 2Z4HA 4IN3A 1X55A 4A3KH 5CV8A 1ZYRC 1J9OA 1AZQA 5C4XB 2Y0SB 4BY1G 2Z8LA 1YJNA 3R2TA 5M5XB 1A0IA 2N8NA 5G3LF 2KA7A 3UE0A 1B70B 1I4XA 1IBMQ 2MPMA 1O7YA 3J7AV 1JR0D 2QF7A 1NMFA 3A55A 3GTGH 4A3DG 2AWOA 3K7AB 3URYA 3SEBA 1Z7TA 4QB4A 5IYCH 4FYDA 2E2JH 4LF8Q 3PUVA 2Z6BA 2IY5B 1BO0A 2N49A 3CCMA 4DR5L 2Q2UA 1QILA 3CCEA 2MO0A 4JYAQ 2Q8RE 2JEAI 3DHQA 2YYZA 2BA1A 2B2WA 2IL8A 3T16A 4XXEA 3LX0A 2LS01 3KF8A 4NB3A 3KJPA 1NCVA 2EZVA 3MZ5A 4K5VA 2EJFC 3ULPA 1G91A 1BUVT 5IIFA 4NXML 4DR1Q 2K75A 1WJJA 4HJ5A 2XSCA 3F1ZA 1A3TA 1U4PA 1VQBA 4F88A 2EYJA 3ULJA 4IFDJ 1G2TA 4JI2Q 1HR0L 1EFWA 1EYAA 2EY1A 3IFTA 1LM0A 3NWTA 3K0YA 3T53B 1H9JA 1HZBA 3FP9A 4JOIA 1HNXL 5C3EH 1NE3A 3SR1A 3QR8A 5ELOA 5HGTA 2JA5G 1Y1WG 3H0GG 3GP7A 1STAA 4DR2Q 1XX8A 3L3OC 1BOSA 4DK1A 1ZYRD 3CCSA 3T1HL 1CT1D 1CI3M 1Q12A 3NHHA 4PNYA 5EPKA 3X3MA 3M7GA 5LMUL 5I2YA 1SNPA 1OTCA 5JPMC 1IKMA 1EY4A 3PF5A 4DXGA 1JJCB 3I4MH 3JAMc 4J15A 4A93H 4MTNA 1N36Q 4FF1A 4B08A 2DJFC 2PCFB 2JA8B 2FJ2A 2JP1A 3TRZA 5D3IB 4KLKA 4H0LC 4B9WA 1EIYB 3I7FA 4O2DA 4RWSC 3GTQB 2UXDL 1XNQL 2WP8J 5M3MB 4JI0Q 3A54A 2XGTA 1KABA 1HRJA 3G48A 1JT8A 3MTSA 3TDQA 4HIMA 4GOPC 4BBSH 3RN5A 1PRTC 5EKKA 3PIPA 3MEHA 4QGUA 1PH7A 4AYBB 4DV2Q 4UY8C 3S2HB 3U9OA 3J81E 1LT5D 5DNFA 4GLVB 1ASZA 3BDCA 4RGOS 1FNUA 4QY7A 5IGDA 4RFBA 4AH6A 1F9SA 4XQNA 1ZXTA 2IX3A 3HOWG 5IP9H 1KDBA 1CKMA 3OOCA 2ZM6Q 1C0AA 1J5EL 4JI7L 4KY5A 3H3VC 2SDFA 3VA5A 4BY7H 4GNXC 4A75A 3GO5A 5ISRA 1PTOH 2K33A 5H1SE 4FXKC 5JEAJ 2NTSA 4P2CB 2FXQA 2K5QA 2VB3X 2J4XA 2K05A 4LW1A 3VR3A 2UUCQ 1Y1VG 2HCIA 3MA2B 1V1PA 1F2LA 3AB9A 1FNVA 2B63B 2R92B 4X62L 1BXTA 2UUAQ 1EYGA 4M1UB 1VQ6A 4L63B 2L55A 3E0EA 3MXNA 4DXFA 5LHY1 1I50H 1T9HA 5COYA 2G9DA 1T5EA 1B3QA 1X3FA 4JC0A 1W2BA 1A2TA 3Q23A 4X3UA 3KF6A 2NN6H 4A3FH 3A5ZB 4C3IB 2R7DA 4X3SA 3V96A 2UUBL 2F0VA 3RR5A 1SE4A 3HOUH 3FHWA 5KYIA 5CV4A 2F0MA 4JI8Q 2AHOB 1VQ8A 1ICFB 4BA2I 4JV5Q 4LWCA 4C3JH 2KCMA 2E76C 3T13A 2I5HA 5T1GA 1HTLD 1PRTD 4HR7B 3U4VA 5HGQA 3CMAA 4V190 3FMCA 1ILPA 1LTSD 2GA4B 1YEZA 1VQJA 3PGZA 4ZRZA 1LTBD 1K3BC 3SK8A 3TZDA 3FRPB 5JAVA 4P75A 2AQ1B 1TWFB 5FJ8H 4LF8L 2P5ZX 4V0BA 2VUMB 4HIDA 1OXVA 3L2PA 1IBLQ 5I2XA 2LSSA 2OQKA 4OEMB 4A3LG 2B29A 3J7ZC 1BBXC 2XWBB 2BDNA 3H3VH 1PXUA 2FMMA 2MHVA 1VQKA 4A3CG 1DOKA 5M5WB 2CWAA 1VF5C 1JOOA 3PO2H 3A8KE 5LMNQ 1VMCA 3Q6SA 4KHZA 4MTKA 1P16A 3JAMi 2QDLA 2KHJA 4JI2L 4IUPA 1AEXA 1HPCA 3DM1A 1K8MA 5FK9C 1QCBD 1DZ1A 2F0TA 5C0XI 1CFMA 3CXCA 5GROA 4CKEA 1H95A 1GHJA 3I4OA 4NXNL 2RKSA 4WRDA 3D6CA 1EIFA 4A3JH 3FPPA 4KK7A 4XQQA 1F9PA 2DUDA 2VL6A 4ZKCB 5M5YB 1XPRA 1F9QA 1SN8A 4K5XA 1OXUA 3F2DA 2EYFA 4DV3Q 4PMBA 1WTHA 4C1NI 1QUQA 1BCPC 2XRQD 4JI4Q 3V2TA 2Q2HA 1EWHA 2R7ZB 1CK1A 3GTOB 2KOLA 3ERSX 1SJED 2PZWA 1LTTD 1HHVA 1N36L 2LMCB 4XTCS 4KHPL 2K03A 2PI2A 3CF5A 1TY2A 1NTGA 2A68C 3K8AA 1EWCA 1Y8NB 2OTLA 2BCOA 4A3GH 4AQYQ 4R4IA 3OIQA 4ZCKA 2PZUA 4B3RQ 2HIXA 3EFXD 4JI0L 4OO1I 3VYUA 3SDZA 1R9TH 2H1EA 5CORA 3R3OA 4KD3A 2PYKA 3OMGA 1KRSA 2O4XA 2EJGC 5C4JH 5IYBG 4BBSB 4J6HA 1QE6A 4R8NA 4QIWE 3UI2A 4DN4M 3NTKA 1WTWA 1DCZA 1X3QA 1TT2A 5FO9B 2DJGC 1KNEA 3C3LA 3DXJC 4U673 1JB3A 3NXWA 4DU9A 4ZKBB 4DV6Q 3NPPA 2F0GA 3S14B 1SR3A 3KFUA 2QW7A 5ELBA 1RCVD 1SYBA 1S3OA 3CAMA 4A4IA 3I90A 5IT9L 2E2IB 2D62A 1K8OA 3KF8B 2LKVA 3ZYYX 5IYDH 5JJKA 2VXWA 2UUCL 4A3EB 4C56C 1JICA 1VQCA 2WIIB 2IW3A 3K5LA 2FHTA 5AFWA 1B1ZA 1U4MA 3BYYB 4OO1G 5KGUA 2A69C 1BCPD 5C4XH 5DEHA 2F0UA 4YCVA 1C8CA 1AFPA 5IGBA 1F77A 1VQAA 5M5XH 1PFSA 4ZYSA 4OX9L 2A6EC 1B9NA 4WJ4A 1HUNA 4DR3Q 3ITPA 5IGEA 3MVVA 1C9OA 4ZUJA 3K7AH 3TP7A 4A3MG 3PUZA 2A68D 1ILQA 2YU9B 1FD7D 1PTOF 2R7FA 3W1GA 5BN5A 5I6YA 2UXCQ 5EQ0A 1JC7A 1GO3E 3KLWA 4HSPA 3PMFA 1QNUA 2PMZB 3BZCA 1DD2A 1O7IA 4KMUC 2F4VL 2KJXA 2PQAA 3R8BA 5C6AA 1SNOA 2JK8A 3ND9A 3I56A 4HCEA 1SMXA 4KHVA 1A6XA 1MKHA 3QIAA 4LF5L 4S3SA 3ERQA 1EQTA 1SLJA 1S5ED 3BDOA 2R93G 2LY7A 2KECA 5C3EG 3B6YA 3J81c 2WV6D 3FEWX 1KQSA 1ESRA 1L0WA 1BBWA 4CHTB 3TS0A 2BH2A 3GTPB 4GOPB 4HJ8A 5GAGC 2NUCA 1SNDA 1NMGA 3BYTB 3DMUA 5C44B 4N9PA 2N3SA 1MHWC 3D6WA 4YY3L 2F3IA 3K58A 1KTKA 4KY7A 2NVQB 4B3TL 1WYDA 2A69D 3M4PA 1PH6A 2PW7A 3I4NG 4GNXB 4X64Q 2VQFL 5LMNL 4IFDI 1VDZA 3KLSX 2A6ED 1QVFA 4DAMA 1LYLA 4BY1B 1J8IA 2PI2E 1PRTF 4DAPA 4HJ9A 5IP7G 1G8ZD 2CH4A 4CGYB 1B53A 4JI5Q 4A3DB 1IBKQ 1X32A 4RA8A 4IPGA 4QUFA 4ZK9B 2JA8H 3HOYH 2F0IA 2FMCA 2XWJB 3AQQA 1EL0A 2F0DA 2JA6G 5EGTA 1PMRA 1E1TA 3A0JA 3N6RA 4QUCA 5FLMG 3GTQH 5M3MH 4DV3L 3PSIA 4HSVA 1I4HA 3BVZA 4KJNA 3M4YA 4OELB 1EY8A 5IP9G 1EZ6A 1I6VC 3S2HH 1B9MA 1X9NA 4X66Q 4LUOA 2JEBI 4L5SA 1VF7A 4BXXG 2JN4A 3EVQA 1CQFA 4ZLTF 2NBFA 3U50C 2DNEA 2BDOA 1D6EC 4EX5A 4LUZA 1VQ7A 4Y7NB 1HCZA 3I91A 2KEEA 2OCEA 1V43A 5D3DA 4IPCA 2AUJD 4AQYL 1HNZQ 1LLRD 4NP5A 4HEDA 1S5DD 5C3WA 4B3RL 3LNNA 3E5SA 5M3FG 2JA5B 1MJCA 5ELEA 3CCJA 2B63H 2R92H 1BQQT 4IUVA 4DK6C 1GUWA 4A3FG 3A8JE 1X3EA 4GN3B 3S24A 3S2DB 4OIKA 3QO2A 1ZKOA 1ONLA 3RMHA 1QZHA 2WFWA 1FYCA 3HOXG 3CQZB 3PF4A 4UHVA 1SEBD 3HG9A 1PDQA 1CKOA 1CM9A 2KHSA 5C0XH 1UEBA 4C3IH 1PH3A 5EBDA 1RJTA 1SYFA 4I65A 5FO8B 5AJ3Q 2O5JC 1LUZA 2D9UA 5LL6S 1D7QA 4KN4C 3GTMB 4QMGA 1IYVA 1QB5D 4DNTB 4HIKA 2B2UA 2Q2IA 3DEOA 3KBGA 1LTGD 2R3ZA 3BS1A 3T1YL 1VCIA 2JSOA 4JI1Q 4IOCA 2TMPA 1IYJB 2YTYA 1XXGA 4O1NA 1WI5A 1VQNA 4YHHQ 5E3FA 4LF7Q 3G7LA 5F2DA 2B2TA 5IY0A 2B8GA 1VQMA 4PQXA 3J81i 2EDGA 5C5LA 5FJ8G 1EU4A 1YBYA 3PUXA 2RSOA 4NW2A 1HA5A 4DR3L 4F7XA 1R4PB 3I70A 2QEJC 4RGNA 1XMOQ 2IHFA 3PQIA 1X3GA 1P8LA 1TWFH 4TKOB 4LMQD 2VUMH 2UXCL 4UDUC 1BCPB 3A7AB 1Z9FA 5ELDA 5JEAG 3J80L 3HOWB 1EEID 2EYMA 3GDEA 4MIUA 4LF4Q 3BZDB 1UE7A 3D4DA 3ND8A 4LFCL 1QUQB 3S16B 3E9IA 2NZ1D 3E0JA 1Y1VB 2L4NA 1MD2D 2WAQE 5M5WH 5EPLA 3OIPA 2AUKA 3VR5A 2AQ2B 4CKCA 3DLLA 4EGVA 1EOTA 3A7LA 1PYSB 1KHIA 1CQVA 4OWWB 4WJWA 4X65Q 2B2WC 1WFQA 1BCPF 4ZAIA 3VR6A 3EQLC 1SFOB 3NQTA 4IQZA 5CC4A 3GTKB 4I7AA 4ME5A 2UU9Q 2JA7G 5K36H 3ONAB 3RD4A 1Q46A 4YCUA 1C4QA 1SMYC 3MFYA 3HKZE 1SNMA 4LFAQ 1N32L 1Z47A 4TRDA 3KLRA 4IUTA 1AN8A 1CSPA 2L9HA 3KDFA 3S1RB 4HAEA 5M5YH 1WOCA 1HZ9A 5KEEA 4IUQA 1SROA 4N9TA 2L5TA 4JOIC 3FDTA 5M9OA 1O7ZA 4LF9Q 3HOVG 4IOAA 3RN2A 3PUWA 4IZ8A 1WTOA 4IJLA 1SE8A 1Q81C 2R7ZH 5DAUA 2EYLA 1U4LA 4RMFA 3K57A 3GTOH 2VNUD 4NDXA 1YNNC 1SNQA 1MJEA 3P1HA 4OIJA 2DGYA 1FR3A 4JI5L 3EN2A 1II3A 1IBKL 1FL0A 1YNXA 2F0KA 2KHIA 2N55A 4KD4A 3W5OA 1X6OA 3TZUA 4AIMA 4DV1L 1XNRL 2WKDA 1XPOA 4JI6Q 1WTXA 3S1QB 4OHJA 4XT3B 1I94L 3BJUA 4B3MQ 5J22A 4DV4Q 2SNMA 5KYLA 3HOYB 1S5BD 3GTLB 1UE6A 2IWHA 1N33Q 3GV6A 3RLOA 1K0SA 2HHHQ 4P73A 1Q8IA 4DR7L 1I6HB 4GKJQ 1B4OA 2XNAC 2E74C 2HD3A 2ASBA 4A3BG 1I3QH 1UUPA 1D8LA 5A2QL 2F4IA 4XYQA 1CUKA 1V1OA 5I9OA 4RKBA 3M4QA 3TSSA 3C1FA 3NQIA 1SYGA 2K14A 4DR4Q 5IODA 3S14H 1SMYD 1L1OA 2M2LA 3EROA 2E2IH 1GD7A 3CMEA 3VYSA 1VS0A 2UXBQ 1TXYA 1D2BA 1JWSD 3TP6A 1JJ2A 5JJLA 2EY2A 4A3EH 5BR8L 1WTPA 4N8FA 1H9MA 4QCLA 1V9PA 1AP0A 2IX0A 1TWCB 1SJHD 3PIP3 3AFPA 1ENAA 2CKZB 2F0WA 1NSNS 1A62A 2XN9C 3WOEA 5CMDA 5JJIA 2Z1CA 1RHPA 4DGZA 2NVXB 1B8AA 1CHPD 2QGQA 3E9HA 3FKIG 2F0FA 3EA6A 1K28A 1LACA 1QNKA 1WCMG 2IX1A 1HNWL 1F2YA 2A6HC 3F2CA 5IE8A 2YU9H 2WB1G 5AJ3L 1ICWA 3MXUA 4IPDA 2JQOA 1M8AA 2PO4A 4QF4A 1H9SA 4GLXA 3A56A 4RHRA 3AEVA 1DGSA 4JI1L 1H9RA 3M85A 4N8X1 2NTTA 4DUYL 4IJHA 3CC4A 1VQ9A 4LF7L 1NUCA 2MNAA 4K6DA 1EY5A 4F87A 1EWIA 2EXDA 5EPJA 1FJGQ 5D65A 2PW5A 1IBML 5E4WC 1STGA 3GTPH 1JORA 1IYUA 2OTJA 5C4HA 3CCRA 4EVOA 3QB3A 1KAAA 2EIFA 2K01A 2TSSA 3Q24A 1WTRA 5C44H 1Q8KA 2O5IC 4X6AH 1K83B 3S9WA 1YHBA 4P71A 4K0KQ 4YCWA 3S17B 4JYAL 2NVQH 1S72A 2VB2X 3CW2C 5EAYA 3K5MA 3QOLA 3I8ZA 4G7OC 1KDCA 1PZID 1SE2A 4ALPA 4Q5VA 2PNHA 2G9HD 4WORA 1TS2A 3CCLA 2EYOA 1EIHA 4DR1L 3OWFA 2EY6A 1K73C 2X6LA 4BY1H 3L0OA 3CC7A 3D4WA 3H15A 2A6HD 4APVA 1HZAA 2J0TD 4YIJA 3FPUB 2UU9L 3GD7A 1SE3A 3BZKA 4A3DH 5M3MG 4K14A 2F0JA 4LFAL 1SYDA 3MFGA 4RGTA 4A3MB 4A76A 4FXDA 3P20A 3RZDB 3I3CA 2KCCA 2K52A 1UNSA 1O7LA 3O13A 1LTID 4DR2L 3CC2A 3TREA 3LGJA 5C3XA 2DY8A 1OXXK 1QJOA 2PQEA 2L11A 1TS4A 3C1EA 5A35A 3PO3G 1PLFA 4GZYC 3VR2A 3NBHB 3KLSA 2NB0A 2QEXA 5LMNW 2R93B 5IT9E 1IKLA 4DPGA 4IUNA 4TVAB 4RGMA 2D5DA 4OXPA 1RTNA 3HOZG 4Y7NH 2F03A 4JI6L 4LF6Q 2F1MA 2B63G 1AE3A 4QQBX 1KIXA 3Q8DA 2MGSA 2EPBA 4DV5Q 1KL9A 2JA5H 4G57A 4A3IG 1XMQQ 1EY9A 2D2CC 1D5XC 2WAQG 5CV5A 1FNWA 1NJIC 1EEFD 2F3VA 1XTCD 4ME3A 4DV0Q 4HIOA 1LT4D 4JK1C 1I3QB 3I4NB 2CFMA 3CCUA 3HFZB 4DV2L 3S2DH 3HRZC 1CA6A 4J1MA 4J8QA 1B7YB 2L15A 2CHBD 2K7VA 3CQZH 2E5LQ 1RTOA 5KRUA 4NKLA 4KTAA 4P74A 2FINB 1G2SA 3HKZG 2ZM6L 4C3HG 2UXBL 5L37A 4OGQC 3OTOQ 3GTMH 4A3KG 5FOBB 1PH8A 4B3SQ 2JA6B 2EE1A 1N34Q 3HS0C 4FF4A 2R61A 1I4RA 1KLUD 4I7ZC 3WWVA 1DM0B 4TSSA 2UUAL 1PH5A 2LXJA 5IYCG 2NVYH 1FGUA 1ENFA 1TWGB 1NBWA 4Z9CB 1WTVA 2A19A 2YV5A 2DNCA 3OYYA 1RDPD 1GOZA 1JE5A 1U0LA 2E75C 3DUZA 1EU3A 3J7A5 4ZUIA 3K6OA 4FF3A 1CKNA 4GKKQ 4LNQA 2F0OA 3GTJB 2JE6I 2RDFA 3KDFB 1YJWA 2K4KA 3HOWH 1KAWA 3VYTA 4CJ1B 4TQUS 4HJAA 1MGSA 2YTVA 4PZ6A 3MXGA 1T5XD 4P72A 4O42A 4ODGA 4JI8L 3K0XA 5LL6X 3S16H 1IL2A 4JV5L 1Y1VH 2CCZA 3C46A 3PUYA 5M3FB 1BDOA 5ELFA 2CQAA 4ZQ3A 2B8FA 1V8QA 2E8GA 3J80i 5IGGA 1BBUA 5FLXL 1FJGL 2A74C 1XTDA 4RG1A 4CDDC 5E4XA 1IXRA 4C1NK 1SFOH 2K5DA 4QL5A 3GTKH 4DR5Q 4HMJA 4DK3C 2K28A 5C4ZA 3HOXB 3TEHB 1S5CD 3BU2A 1SNCA 2BA0A 3IFDA 1EZ8A 5CV7A 1IBLL 4JVZA 1STEA 3TMEA 4K0KL 4QJFA 3VDYA 1TWAH 3S1RH 2GVBA 2Y0SE 3FVQA 1HQMC 2V4DA 4NXMQ 1ML0D 4G7ZC 1CA5A 3U58A 1AW7A 1XJVA 3HEJA 1E2ZA 4YWLA 5KIXA 2K5WA 3I4MG 3OSOA 2C9OA 4H7BA 5EKIA 4BBRB 1DONA 1SBBB 1VQPA 1HR0Q 4A93G 2ZTDA 4JW0A 4KN7C 1M4VA 2ZTEA 1OXTA 4DV7Q 4MZ9A 4E6IA 1HNXQ 1CTMA 2I5LX 5JVG3 1VQIA 3HGBA 3S1QH 5IGFA 2EXZA 1E24A 2KCNA 2WB1E 3MC0B 1TU2B 1E3PA 1O78A 3PV0A 4RHSA 3K80C 1V1PB 3GTLH 4BBSG 3EIVA 4Y52H 5I4DA 2IT1A 3MWYW 3T1HQ 4CDFC 4KY6A 4DK0A 1I6HH 1Q1BA 4A3LH 2F0HA 3NTIA 3KBXA 4ULLA 1WVLA 4EQ5A 2AKWB 2EJMA 3VA7A 2OEOA 3DM3A 4A3CH 2NN6I 3MXNB 4JI4L 4PV1C 4NMZA 3UDGA 1CZWA 4BY7G 1U5KA 3G6EA 4QIWB 2F52A 3KF6B 4CBVA 4LF6L 4K6LA 2ZXPA 1H9SB 1QWYA 3UDIA 1MIUA 2F0SA 2JA7B 3BG3A 2UXDQ 2EQSA 1YI2A 2ES2A 1CSQA 4B9XA 1E7ZA 3PCOB 4DV5L 1C7YA 1YVCA 2KCTA 4JPBW 1TWCH 1VMPA 3G6JB 1Y1WB 1F2MA 3HP3A 3SK4A 2CQOA 3H0GB 1ASYA 5EKLA 1XYIA 3NE5B 2NVXH 1I4PA 1NAPA 2NN6G 3HOVB 1GXDC 3J80E 4WJ3M 3HOUG 1UWVA 3S1NB 2NVTB 4ID6A 1I4GA 2E5LL 4H13C 3QG1A 4DV6L 4OL7A 2RDGA 3SVMA 4M8AA 4LFBQ 2SEBD 4C3JG 1HQRD 2VS1A 3CRLC 1TWHB 4L8JA 3D4RA 1NNXA 4LUVA 1RF2D 5CBEE 1N34L 4AYBE 2ZJRA 3MXPA 2ZTCA 1R4QB 2X69A 3CHBD 4DNRB 2H4OA 3PIOA 2VW9A 2OXPA 3RUZA 2Q2TA 1JOKA 4A3BB 2B2UC 1G51A 5C44G 5J39A 2B2VA 1PA6A 2K5NA 2NVYB 3RLNA 3WOFA 4JBKA 4FXGC 5IT9c 2EYPA 1K0RA 2AQ3B 2UUBQ 2ICIA 3CCQA 1F2ZA 4JI3Q 4UP8A 4LAAA 2B2TC 4LJZC 1KXLA 3ZJYC 2ZT9C 2F3WA 1A63A 1E22A 1JE4A 5IOCA 1YIJA 2RVLA 1K83H 1SAPA 4CDCC 1PFNA 1GKHA 2ZXOA 3S17H 1EY7A 5ELNA 1GHKA 2KENA 3PO2G 1K8AC 4HTHA 3PIO3 3S1MB 3NBIA 2HDMA 1S5FD 2OF1A 1PH9A 5GADC 3J7YW 1DYQA 2QKIC 4PZ7A 2NZOA 5BN4A 1PFBA 2ALYB 4KKSA 4OO1H 2K1BA 2L1BA 3NEMA 1U9RA 3AMUA 2B3GA 1EQQA 1SRUA 2Z9HA 4CJ0B 3FKIB 2Z4IA 2A1AA 4A3JG 1WCMB 2I07B 2J7ZA 1GUOA 3KUPA 1CHQD 2L0CA 1HZCA 1RD9D 2LXKA 3W3AA 1X3PA 3E3XA 4A3MH 2YTXA 1A15A 2WB1B 2IJ0A 5JPNC 1PZKD 4JBWA 3RZDH 1A3UA 3K81C 1RKNA 4R4OA 5A2QE 5FLXc 4ABNA 3VR4A 1W3SA 2QILA 5FKAC 3L7ZC 1TWAB 3U9SA 3T4AC 3K5OA 3KOJA 1YZ6A 1PTOC 1EIGA 4X64L 4DKAC 4OWXB 3CPFA 3OW7A 3I2ZA 3C2PA 4DV7L 1SYCA 2R93H 3J7AF 2B2YA 2VQEQ 1LTAD 3TP8A 4KKTA 4NXNQ 1E2VA 4A3GG 1TKWB 1ET6A 4HCSA 1B44D 1BNZA 4NPSA 2F0QA 5IWAQ 2BE5C 1S40A 4H02A 2B2YC 3ICEA 3M7NA 2HT1A 1K8GA 4R8IA 1NR4A 2EVBA 1I5FA 4DAYA 1PV4A 5CV6A 4DAVA 3D8GA 3E6ZX 1K9MC 5E7NA 2H5XA 2MQHA 5J3BA 2K50A 3IL8A 4RCOA 5DM63 4JBJA 4JCVE 1D5ZC 3NP8A 3I4NH 1CKNB 4X66L 1WD1A 1PH2A 2EY5A 1CZGA 3D3RA 4KHPQ 1RODA 3G71A 4GOPA 1PYWD 5IYDG 1KD1C 4IPHA 1X56A 3NENA 1YJ9A 5IP7H 3AFQA 2DY7A 5KNDA 1X65A 3M4OB 2PQAB 4JG2A 1TQOA 5HURA 1X54A 1HNZL 1LO5D 4C2MB 1QVGA 5C4XG 2Y0SG 1LABA 1C48A 2KEDA 2MJ8A 3OW2A 2JA6H 3BDLA 1EY6A 4O0AA 4GN5A 1GJXA 4ILWA 3P7JA 1L1OC 5FLMH 1PTOD 1JWMD 4GNXA 4U68A 1XWEA 2HDLA 1TWGH 3PO3B 1YNND 1LTLA 3UDXA 1VQ4A 4IFDH 3F2BA 1ET9A 3TP5A 2EYHA 1KLGD 1STYA 2A73B 4BXXH 4F8MA 3S15B 3GTJH 1ZEQX 2BE5D 1DXMA 1ESFA 1HUMA 1PZJD 3HKSA 1BVSA 4LFBL 3HOZB 2E2HB 2KBNA 2E2DC 2HIVA 5E1FA 2WACA 2OQ0A 3MAQA 3RZOH 1JCKB 2NYZD 1J6QA 4BA1I 4G4KA 1N9WA 1QG7A 4OX9Q 1BR9A 5M3FH 4A3IB 1JOQA 4MNOA 4YHHL 2K5VA 2NZHA 2WAQB 2MP1A 5D14A 4FNFA 1PFMA 3TBIB 1SDFA 4IALA 1Q86C 3P75A 1KRTA 3J81L 3K5NA 1PH1A 3IRBA 4JI3L 4L5QA 1MI2A 1Y69U 3CRKC 1XMOL 4EQPA 2F4VQ 3CPWA 3HOXH 3HZXA 4RCNA 1SYEA 2JXMB 2F0EA 3DEPA 1M90C 1LT6D 3ULLA 3SGIA 3M3YB 3HKZB 4LF4L 3QJYA 4C3HB 1EQVA 4LF5Q 1LTRD 5HY6A 4A3KB 5BN3A 4UP9A 4PZ8A 1VQHA 3TQYA 2JYOA 3KYHC 1QZGA 1Y8OB 3EJIA 3M9BA 3SK6A 4DR6Q 4POFA 4BBRH 3ER0A 2XIWA 5ELCA 3OWEB 4DNIA 4K2KA 1STNA 4UAIA 3GTGB 1UEAB 5JOBA 4X65L 1I4QA 2RBMA 2JA8G 3HOYG 4GLAC 3J80c 2PMZE 4JBMA 1D5MC 2E2JB 1M1KC 5CYUA 4R4CA 2I46A 1PVOA 1Y8PB 4YY3Q 1G291 4XT1B 1HH2P 1NR2A 4XYOA 5IGCA 1HJPA 4B3TQ 5JEAH 3SHLA 2AWNA 4XQJA 2BH8A 5GAEC 2ID0A 5DLQE 5NUCA 2VQFQ 4AYBG 5I6WA 5K5PA 4H44C 1GVPA 2Q8TA 1KC8C 1FVIA 4LF9L 2MO1A 1E2WA 3K59A 3H91A 1RL2A 4CKBA 1VQOA 1EFID 2VQEL 1N8RC 1BF4A 2PNRC 1KDAA 1YNJC 1AE2A 5EJWA 2M9VA 1YHAA 4K2LA 1OXSC 5C3EB 2RCFA 5IWAL 4HJ7A 1MBYA 1VQFA 2F0PA 2IHEA 3H6MA 1GUSA 2JA7H 2CW0C 2HUGA 2EOTA 3AYHB 4L5TA 2R92G 2I0QA 1JQYD 1W6KA 4B3ML 2VY3A 3MEFA 3CKIB 4DV4L 2GN5A 3AU7A 1PHJA 1N33L 2RCNA 2HHHL 1Y1WH 3Q0AA 4GKJL 3H0GH 1HFNA 4HMIA 4EQNA 3BVMA 2XRSD 3NK9A 1JMCA 1EYDA 4PMCA 3I4MB 3HOVH 1DOMA 5CBAE 5C0XG 2RSNA 4C3IG 3J81j 4A93B 4DUZQ 2MUYA 2NVTH 3S1NH 2Z6KA 3CCVA 4DR4L 3DWQA 1L0XB 3LWEA 1G6ZA 3A8IE 1STBA 4FDBA 2A5HA 3OMCA 4G7HC 1B50A 1TWHH 4DF7A 5G3LD 4K8JA 3A74A 3EBEA 2Z6KC 3I4LA 3U4ZA 2AMCB 5FLXE 2KVMA 4YWKA 3CU7A 2PPBC 1KNAA 2HQLA 4A3BH 1V1QA 4WFN3 2VUMG 2I5MX 2G5DA 1YNJD 3QWNA 2XVSA 1UE1A 2WKCA 2FFKB 3D31A 5C5MA 3OPOA 4GS3A 1EY0A 3RNUA 4BY7B 1PTOB 2CW0D 3H09A 5DM73 3GV3A 2CWPA 1UAPA 2Q8IB 1Z6HA 3QOJA 1VQGA 3T1YQ 5KNBA 1IHZA 1PYBA 1A8VA 1U4RA 1STHA 2N88A 1D1IA 2ZXRA 3RLFA 1HXYD 4XIGS 3RZOB 3S1MH 1Q82C 2L12A 3TS2A 1HTPA 4KKUA 4GN4B 2IPKD 1GM5A 1LV9A 1MSGA 4YWMA 1EUJA 1EQRA 3JAME 5K36G 1I50B 3L9AX 3SXHA 2DN8A
chains in the Genus database with same CATH topology
3RLOA 5LMNQ 2HHHQ 4P73A 4DR7L 4LFBQ 2K5HA 1K3RA 1P16A 4KHZA 4PMWA 3JAMi 4GKJQ 2KHJA 3FKIH 2VS1A 4JI2L 1WCMH 3NELA 2ASBA 4A3BG 1I3QH 1D8LA 4LUVA 5C0XI 2Z0SA 3CXCA 5GROA 2ZJQA 3I55A 1N34L 4AYBE 2QA4A 2ZJRA 3STBC 4DAYB 1CUKA 4LFCQ 1H95A 3I4OA 3M4QA 4NXNL 2ZTCA 1NY4A 2R6GA 1YHQA 1EIFA 2K14A 4OWTB 3PIOA 4DR4Q 2VW9A 4A3JH 3S14H 2DUDA 2Q2TA 1L1OA 2VL6A 2R7ZG 1G51A 5C44G 2RHQB 1PA6A 2E2IH 2K5NA 3RLNA 1XPRA 3CD6A 1SN8A 1GD7A 3CMEA 4JBKA 4DR6L 1VS0A 1JJGA 1OXUA 2V1CC 4R1JA 5IT9c 3F2DA 1K0RA 4DV3Q 2UXBQ 1TXYA 2UUBQ 3CCQA 1JJ2A 4JI3Q 5JJLA 4UP8A 4A3EH 1QUQA 4UP7A 5BR8L 2GVAA 2A8VA 4JI4Q 1KXLA 3ZJYC 1V9PA 3K7UC 1A63A 1E22A 4OONA 1YIJA 4POGA 2Q2HA 2IX0A 1L2FA 1K83H 3UE1A 1L1OB 1N32Q 3ERSX 1GKHA 5C0XJ 3S17H 3AFPA 2CKZB 5ELNA 2KENA 1N36L 1A62A 1K8AC 3PO2G 4XTCS 4R4QA 5JJIA 4KHPL 1B8AA 1PH9A 2QGQA 3E9HA 2PI2A 3FKIG 5GADC 3CF5A 1NTGA 1PH4A 3K8AA 4PZ7A 1WCMG 1VQDA 2NZOA 2IX1A 2OTLA 2ALYB 1HNWL 4A3GH 4AQYQ 3NEMA 4R4IA 3A5UA 3F2CA 5IE8A 2YU9H 2WB1G 1Q7YC 4B3RQ 2HIXA 2XTIA 5AJ3L 5LMUQ 2JA9A 4JI0L 4OO1I 2B3GA 1R9TH 1EQQA 4IPDA 1SRUA 2JQOA 2A1AA 4A3JG 4GLXA 1KRSA 1HZCA 1EOVA 3AEVA 1DGSA 4JI1L 5C4JH 1HR0W 5IYBG 2LXKA 3M85A 4A3MH 2YTXA 4DV1Q 1XNRQ 1G6PA 4DUYL 1XPUA 1BKBA 1QVCA 4IJHA 4QIWE 3CC4A 1VQ9A 4LF7L 4JBWA 2MNAA 1I94Q 3RZDH 3K81C 4A3EG 4R4OA 3STBD 5FLXc 2RHSB 1W3SA 4DV6Q 1EWIA 3L7ZC 3M4OH 1SR3A 2EXDA 3G4SA 3CP0A 3KFUA 1YITA 1FJGQ 4IO9A 4UPAA 1S3OA 2OWOA 4DR7Q 3CAMA 4A4IA 1IBML 4C2MH 3KOJA 2D62A 1XNQQ 1YZ6A 3KF8B 3GTPH 5IYDH 4X64L 1RIPA 4DKAC 5JJKA 1VQEA 4OWXB 2UUCL 2OTJA 3CPFA 2D0PA 3CCRA 3I2ZA 1VQCA 1XMQL 4IFDG 2EIFA 4DV7L 3D0FA 2R93H 2VQEQ 4L5RC 1VQLA 5C44H 1Q8KA 4NXNQ 4A3GG 4X6AH 4OO1G 1Y14B 4R4TA 4DV0L 2C35B 1YHBA 4P71A 5C4XH 4YCVA 4K0KQ 4YCWA 3PO3H 4JYAL 2NVQH 4NPSA 1S72A 4DUZL 1VQAA 2JJQA 5M5XH 5IWAQ 3CW2C 1PFSA 4OX9L 5EAYA 1S40A 4H02A 5GAHC 3ICEA 3S15H 3M7NA 2HT1A 4WJ4A 1K8GA 4ALPA 2VZAA 1J5EQ 4DR3Q 4JI7Q 1C9OA 2PNHA 3K7AH 1I5FA 1PV4A 3CCLA 4KI0A 5BR8Q 3HOZH 4DR1L 1IZ6A 2E2HH 4A3MG 3PUZA 1K73C 1K9MC 3H3VI 4PG3A 5E7NA 2H5XA 4BY1H 2MQHA 5J3BA 2K50A 2R7FA 3W1GA 2UXCQ 3OTOL 1GO3E 3KLWA 3L0OA 3CC7A 3H15A 3BZCA 1UE5A 4JBJA 4JCVE 1O7IA 1HZAA 4APVA 2F4VL 1AH9A 2PQAA 2UU9L 3I4NH 3GD7A 1ASZA 4B3SL 1VQ5A 1CKNB 2JK8A 3BZKA 5M3MG 2RF4A 4X66L 4X62Q 4A3DH 3I56A 3UDFA 1PH2A 1SMXA 4A3IH 4LFAL 4KHPQ 1MKHA 3G71A 1E1OA 4GOPA 4A76A 3W1BA 5IYDG 1KD1C 1HNWQ 4LF5L 4IPHA 1X56A 2K52A 3NENA 1SLJA 5IP7H 1YJ9A 3AFQA 2R93G 1X65A 4DR2L 1Q1EA 2D0OA 2PQAB 4JG2A 3CC2A 3TREA 3B6YA 3LGJA 3F8TA 5IYBH 5C3EG 3J81c 1X54A 1HNZL 2MFIA 1OXXK 1QVGA 1KQSA 5C4XG 4GKKL 2N78A 2Y0SG 1L0WA 1BBWA 3PO3G 3OW2A 3TS0A 2BH2A 2JA6H 4GOPB 5GQOA 3NBHB 4HJ8A 4O0AA 4GN5A 5GAGC 3JC66 3KJOA 3M3YH 1L1OC 1NMGA 5FLMH 2QEXA 5LMNW 4BBRG 4GNXA 1JB7A 4DUYQ 4C3HH 4DPGA 2ZJPA 2ATWA 4TVAB 2N3SA 1X55A 4OXPA 4A3KH 4YY3L 3HOZG 2F3IA 1TWGH 4Y7NH 4BY1G 4JI6L 1YJNA 4LF6Q 1A0IA 2N8NA 4B3TL 2B63G 1LTLA 3UDXA 1WYDA 1VQ4A 3F2BA 3UE0A 1B70B 3M4PA 1AE3A 1PH6A 1IBMQ 4QQBX 4BXXH 1KIXA 1NMFA 3Q8DA 3I4NG 3GTJH 4GNXB 4X64Q 3GTGH 2VQFL 4A3DG 5LMNL 2AWOA 4IFDI 4DV5Q 1KL9A 3HKSA 4A3IG 1BVSA 2JA5H 5IYCH 4LFBL 2KBNA 1XMQQ 1QVFA 4DAMA 2HIVA 1LYLA 2OQ0A 2WAQG 2E2JH 4LF8Q 3PUVA 3RZOH 2PI2E 2IY5B 2N49A 1NJIC 3CCMA 4ME3A 4DV0Q 4HIOA 4DR5L 1J6QA 2Q2UA 4BA1I 3CCEA 4HJ9A 2MO0A 5IP7G 4JYAQ 1N9WA 2JEAI 2YYZA 2BA1A 2CFMA 4JI5Q 3CCUA 3HFZB 5M3FH 4DV2L 1IBKQ 4OX9Q 4IPGA 2JA8H 3S2DH 4MNOA 4NB3A 4YHHL 3KJPA 2K5VA 3HOYH 2NZHA 4UY8C 1B7YB 2L15A 3AQQA 3CQZH 2JA6G 3ULPA 2E5LQ 4P74A 4NXML 1Q86C 4DR1Q 1E1TA 3A0JA 1KRTA 3HKZG 5FLMG 2K75A 1WJJA 2ZM6L 4HJ5A 5M3MH 3GTQH 3F1ZA 4DV3L 3PSIA 1PH1A 1VQBA 2UXBL 3IRBA 4JI3L 4L5QA 3OTOQ 3ULJA 3GTMH 4A3KG 4IFDJ 1XMOL 4JI2Q 1PH8A 1HR0L 1EFWA 2F4VQ 5IP9G 3CPWA 1LM0A 4B3SQ 3HOXH 3S2HH 1X9NA 4X66Q 4LUOA 1M90C 3ULLA 1N34Q 3SGIA 1HZBA 2JEBI 4L5SA 4BXXG 3FP9A 4JOIA 1HNXL 5C3EH 4LF4L 1NE3A 3WWVA 5ELOA 4LF5Q 5HY6A 2UUAL 3U50C 2JA5G 4UP9A 1Y1WG 2LXJA 5IYCG 2NVYH 1FGUA 4PZ8A 1VQHA 4LUZA 3TQYA 1NBWA 3H0GG 4EX5A 1VQ7A 2A19A 2YV5A 3KYHC 4DR2Q 3OYYA 2OCEA 1QZGA 1V43A 1U0LA 1JE5A 4IPCA 4AQYL 3M9BA 3J7A5 1HNZQ 4DR6Q 4POFA 4BBRH 3ER0A 1CKNA 4GKKQ 3CCSA 4DNIA 3T1HL 4LNQA 4B3RL 1Q12A 5LMUL 5M3FG 2JE6I 3KDFB 1YJWA 4X65L 2K4KA 2JA8G 3HOWH 1KAWA 1OTCA 3HOYG 4GLAC 1MJCA 3J80c 2PMZE 3CCJA 2B63H 2R92H 4TQUS 3PF5A 4JBMA 4HJAA 1M1KC 4R4CA 1JJCB 1PVOA 2YTVA 4PZ6A 3I4MH 4P72A 3JAMc 4YY3Q 4JI8L 1G291 3K0XA 4J15A 4DK6C 3S16H 4A93H 1IL2A 4MTNA 1N36Q 4A3FG 1PH5A 1HH2P 4JV5L 1Y1VH 2CCZA 1X3EA 3PUYA 1HJPA 4GN3B 3S24A 4B3TQ 2AWNA 3TRZA 4KLKA 2BH8A 2E8GA 3J80i 5GAEC 2ID0A 1QZHA 2WFWA 3PF4A 5DLQE 1BBUA 3HOXG 4AYBG 2VQFQ 1FJGL 1XTDA 1CKOA 1UEBA 4RG1A 4C3IH 1EIYB 1PH3A 3I7FA 4O2DA 2UXDL 1GVPA 1XNQL 2WP8J 5AJ3Q 1D7QA 4JI0Q 1LUZA 1IXRA 2XGTA 1KC8C 3G48A 1SFOH 1JT8A 1FVIA 4HIMA 4QL5A 4GOPC 4LF9L 3GTKH 2MO1A 4DR5Q 4BBSH 4HIKA 3RN5A 2Q2IA 4DK3C 1RL2A 1VQOA 2VQEL 1N8RC 3PIPA 3T1YL 1VCIA 4JI1Q 3TEHB 4QGUA 4DV2Q 4IOCA 3BU2A 1PH7A 1IYJB 2BA0A 2YTYA 1VQNA 1WI5A 4YHHQ 1AE2A 1IBLL 4K0KL 1YHAA 4LF7Q 4GLVB 4QJFA 5IY0A 1OXSC 3VDYA 1TWAH 4QY7A 2GVBA 4AH6A 2Y0SE 5IWAL 4HJ7A 3S1RH 3J81i 5FJ8G 1VQMA 1VQFA 1YBYA 2IHEA 5IP9H 3PUXA 4NXMQ 2JA7H 3HOWG 3AYHB 4L5TA 2ZM6Q 1CKMA 1C0AA 1J5EL 4DR3L 3U58A 2R92G 1XJVA 4JI7L 2I0QA 4BY7H 4B3ML 2VY3A 4YWLA 4GNXC 3MEFA 4A75A 3GO5A 5H1SE 4DV4L 2GN5A 3I4MG 1PHJA 1XMOQ 2IHFA 5JEAJ 1VQPA 1HR0Q 1X3GA 2FXQA 4A93G 1P8LA 1TWFH 2ZTDA 4LW1A 1N33L 2UUCQ 2VUMH 1Y1VG 2RCNA 2HHHL 2UXCL 1Y1WH 1Z9FA 2ZTEA 1OXTA 5JEAG 4GKJL 3H0GH 4DV7Q 4MZ9A 3GDEA 1HNXQ 4LF4Q 1JMCA 1UE7A 2I5LX 4X62L 1VQIA 2UUAQ 3HOVH 5C0XG 4LFCL 1QUQB 3J81j 3S1QH 3E9IA 4DUZQ 1EYGA 1VQ6A 1E24A 2WB1E 2NVTH 3S1NH 3E0EA 1E3PA 2WAQE 2Z6KA 3PV0A 5M5WH 3K80C 3CCVA 4DR4L 3GTLH 3DLLA 4BBSG 1I50H 1T9HA 1PYSB 3EIVA 4Y52H 1KHIA 2IT1A 3T1HQ 1X3FA 1I6HH 4JC0A 1W2BA 1Q1BA 4FDBA 4OWWB 4A3LH 3KF6A 4X65Q 4A3FH 3A5ZB 1TWHH 2R7DA 4EQ5A 1WFQA 2UUBL 2AKWB 3A74A 3EBEA 3RR5A 2Z6KC 3HOUH 3FHWA 3DM3A 4A3CH 2NN6I 3MXNB 3U4ZA 2AMCB 4JI4L 4JI8Q 2AHOB 2UU9Q 1VQ8A 2JA7G 1Q46A 4YWKA 4YCUA 4BA2I 3UDGA 4JV5Q 3HKZE 4LFAQ 4LWCA 4BY7G 1N32L 1Z47A 1U5KA 4C3JH 3G6EA 2F52A 2KCMA 3KF6B 2I5HA 1CSPA 3U4VA 2HQLA 3KDFA 5HGQA 4A3BH 3CMAA 1V1QA 2VUMG 4LF6L 5M5YH 2I5MX 1WOCA 1HZ9A 1YEZA 3UDIA 1UE1A 1MIUA 1VQJA 3PGZA 2UXDQ 2EQSA 3D31A 1YI2A 1SROA 4GS3A 2ES2A 1CSQA 4JOIC 3RNUA 1E7ZA 3PCOB 4DV5L 4P75A 4IOAA 4LF9Q 1C7YA 1YVCA 3HOVG 3RN2A 3PUWA 2KCTA 1SE8A 2CWPA 4IJLA 5FJ8H 1TWCH 1Q81C 4LF8L 2R7ZH 4RMFA 1VQGA 3T1YQ 3GTOH 2VNUD 1PYBA 4HIDA 1A8VA 1OXVA 2CQOA 3L2PA 1ASYA 1IBLQ 1MJEA 3RLFA 2LSSA 2DGYA 2OQKA 4XIGS 3S1MH 4JI5L 3EN2A 1Q82C 1IBKL 2NVXH 4A3LG 1FL0A 2B29A 1YNXA 3J7ZC 2KHIA 3TS2A 2NN6G 3W5OA 1X6OA 4AIMA 4DV1L 1XNRL 1XPOA 4JI6Q 4GN4B 1GM5A 4WJ3M 3H3VH 1I94L 3HOUG 1UWVA 3BJUA 4B3MQ 2E5LL 1VQKA 4A3CG 4YWMA 4DV4Q 1EUJA 1EQRA 2CWAA 5K36G 4DV6L 1UE6A 3PO2H 1N33Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RLO A;  5LMN Q;  2HHH Q;  4P73 A;  4DR7 L;  4LFB Q;  2K5H A;  1K3R A;  1P16 A;  4KHZ A;  4PMW A;  3JAM i;  4GKJ Q;  2KHJ A;  3FKI H;  2VS1 A;  4JI2 L;  1WCM H;  3NEL A;  2ASB A;  4A3B G;  1I3Q H;  1D8L A;  4LUV A;  5C0X I;  2Z0S A;  3CXC A;  5GRO A;  2ZJQ A;  3I55 A;  1N34 L;  4AYB E;  2QA4 A;  2ZJR A;  3STB C;  4DAY B;  1CUK A;  4LFC Q;  1H95 A;  3I4O A;  3M4Q A;  4NXN L;  2ZTC A;  1NY4 A;  2R6G A;  1YHQ A;  1EIF A;  2K14 A;  4OWT B;  3PIO A;  4DR4 Q;  2VW9 A;  4A3J H;  3S14 H;  2DUD A;  2Q2T A;  1L1O A;  2VL6 A;  2R7Z G;  1G51 A;  5C44 G;  2RHQ B;  1PA6 A;  2E2I H;  2K5N A;  3RLN A;  1XPR A;  3CD6 A;  1SN8 A;  1GD7 A;  3CME A;  4JBK A;  4DR6 L;  1VS0 A;  1JJG A;  1OXU A;  2V1C C;  4R1J A;  5IT9 c;  3F2D A;  1K0R A;  4DV3 Q;  2UXB Q;  1TXY A;  2UUB Q;  3CCQ A;  1JJ2 A;  4JI3 Q;  5JJL A;  4UP8 A;  4A3E H;  1QUQ A;  4UP7 A;  5BR8 L;  2GVA A;  2A8V A;  4JI4 Q;  1KXL A;  3ZJY C;  1V9P A;  3K7U C;  1A63 A;  1E22 A;  4OON A;  1YIJ A;  4POG A;  2Q2H A;  2IX0 A;  1L2F A;  1K83 H;  3UE1 A;  1L1O B;  1N32 Q;  3ERS X;  1GKH A;  5C0X J;  3S17 H;  3AFP A;  2CKZ B;  5ELN A;  2KEN A;  1N36 L;  1A62 A;  1K8A C;  3PO2 G;  4XTC S;  4R4Q A;  5JJI A;  4KHP L;  1B8A A;  1PH9 A;  2QGQ A;  3E9H A;  2PI2 A;  3FKI G;  5GAD C;  3CF5 A;  1NTG A;  1PH4 A;  3K8A A;  4PZ7 A;  1WCM G;  1VQD A;  2NZO A;  2IX1 A;  2OTL A;  2ALY B;  1HNW L;  4A3G H;  4AQY Q;  3NEM A;  4R4I A;  3A5U A;  3F2C A;  5IE8 A;  2YU9 H;  2WB1 G;  1Q7Y C;  4B3R Q;  2HIX A;  2XTI A;  5AJ3 L;  5LMU Q;  2JA9 A;  4JI0 L;  4OO1 I;  2B3G A;  1R9T H;  1EQQ A;  4IPD A;  1SRU A;  2JQO A;  2A1A A;  4A3J G;  4GLX A;  1KRS A;  1HZC A;  1EOV A;  3AEV A;  1DGS A;  4JI1 L;  5C4J H;  1HR0 W;  5IYB G;  2LXK A;  3M85 A;  4A3M H;  2YTX A;  4DV1 Q;  1XNR Q;  1G6P A;  4DUY L;  1XPU A;  1BKB A;  1QVC A;  4IJH A;  4QIW E;  3CC4 A;  1VQ9 A;  4LF7 L;  4JBW A;  2MNA A;  1I94 Q;  3RZD H;  3K81 C;  4A3E G;  4R4O A;  3STB D;  5FLX c;  2RHS B;  1W3S A;  4DV6 Q;  1EWI A;  3L7Z C;  3M4O H;  1SR3 A;  2EXD A;  3G4S A;  3CP0 A;  3KFU A;  1YIT A;  1FJG Q;  4IO9 A;  4UPA A;  1S3O A;  2OWO A;  4DR7 Q;  3CAM A;  4A4I A;  1IBM L;  4C2M H;  3KOJ A;  2D62 A;  1XNQ Q;  1YZ6 A;  3KF8 B;  3GTP H;  5IYD H;  4X64 L;  1RIP A;  4DKA C;  5JJK A;  1VQE A;  4OWX B;  2UUC L;  2OTJ A;  3CPF A;  2D0P A;  3CCR A;  3I2Z A;  1VQC A;  1XMQ L;  4IFD G;  2EIF A;  4DV7 L;  3D0F A;  2R93 H;  2VQE Q;  4L5R C;  1VQL A;  5C44 H;  1Q8K A;  4NXN Q;  4A3G G;  4X6A H;  4OO1 G;  1Y14 B;  4R4T A;  4DV0 L;  2C35 B;  1YHB A;  4P71 A;  5C4X H;  4YCV A;  4K0K Q;  4YCW A;  3PO3 H;  4JYA L;  2NVQ H;  4NPS A;  1S72 A;  4DUZ L;  1VQA A;  2JJQ A;  5M5X H;  5IWA Q;  3CW2 C;  1PFS A;  4OX9 L;  5EAY A;  1S40 A;  4H02 A;  5GAH C;  3ICE A;  3S15 H;  3M7N A;  2HT1 A;  4WJ4 A;  1K8G A;  4ALP A;  2VZA A;  1J5E Q;  4DR3 Q;  4JI7 Q;  1C9O A;  2PNH A;  3K7A H;  1I5F A;  1PV4 A;  3CCL A;  4KI0 A;  5BR8 Q;  3HOZ H;  4DR1 L;  1IZ6 A;  2E2H H;  4A3M G;  3PUZ A;  1K73 C;  1K9M C;  3H3V I;  4PG3 A;  5E7N A;  2H5X A;  4BY1 H;  2MQH A;  5J3B A;  2K50 A;  2R7F A;  3W1G A;  2UXC Q;  3OTO L;  1GO3 E;  3KLW A;  3L0O A;  3CC7 A;  3H15 A;  3BZC A;  1UE5 A;  4JBJ A;  4JCV E;  1O7I A;  1HZA A;  4APV A;  2F4V L;  1AH9 A;  2PQA A;  2UU9 L;  3I4N H;  3GD7 A;  1ASZ A;  4B3S L;  1VQ5 A;  1CKN B;  2JK8 A;  3BZK A;  5M3M G;  2RF4 A;  4X66 L;  4X62 Q;  4A3D H;  3I56 A;  3UDF A;  1PH2 A;  1SMX A;  4A3I H;  4LFA L;  4KHP Q;  1MKH A;  3G71 A;  1E1O A;  4GOP A;  4A76 A;  3W1B A;  5IYD G;  1KD1 C;  1HNW Q;  4LF5 L;  4IPH A;  1X56 A;  2K52 A;  3NEN A;  1SLJ A;  5IP7 H;  1YJ9 A;  3AFQ A;  2R93 G;  1X65 A;  4DR2 L;  1Q1E A;  2D0O A;  2PQA B;  4JG2 A;  3CC2 A;  3TRE A;  3B6Y A;  3LGJ A;  3F8T A;  5IYB H;  5C3E G;  3J81 c;  1X54 A;  1HNZ L;  2MFI A;  1OXX K;  1QVG A;  1KQS A;  5C4X G;  4GKK L;  2N78 A;  2Y0S G;  1L0W A;  1BBW A;  3PO3 G;  3OW2 A;  3TS0 A;  2BH2 A;  2JA6 H;  4GOP B;  5GQO A;  3NBH B;  4HJ8 A;  4O0A A;  4GN5 A;  5GAG C;  3JC6 6;  3KJO A;  3M3Y H;  1L1O C;  1NMG A;  5FLM H;  2QEX A;  5LMN W;  4BBR G;  4GNX A;  1JB7 A;  4DUY Q;  4C3H H;  4DPG A;  2ZJP A;  2ATW A;  4TVA B;  2N3S A;  1X55 A;  4OXP A;  4A3K H;  4YY3 L;  3HOZ G;  2F3I A;  1TWG H;  4Y7N H;  4BY1 G;  4JI6 L;  1YJN A;  4LF6 Q;  1A0I A;  2N8N A;  4B3T L;  2B63 G;  1LTL A;  3UDX A;  1WYD A;  1VQ4 A;  3F2B A;  3UE0 A;  1B70 B;  3M4P A;  1AE3 A;  1PH6 A;  1IBM Q;  4QQB X;  4BXX H;  1KIX A;  1NMF A;  3Q8D A;  3I4N G;  3GTJ H;  4GNX B;  4X64 Q;  3GTG H;  2VQF L;  4A3D G;  5LMN L;  2AWO A;  4IFD I;  4DV5 Q;  1KL9 A;  3HKS A;  4A3I G;  1BVS A;  2JA5 H;  5IYC H;  4LFB L;  2KBN A;  1XMQ Q;  1QVF A;  4DAM A;  2HIV A;  1LYL A;  2OQ0 A;  2WAQ G;  2E2J H;  4LF8 Q;  3PUV A;  3RZO H;  2PI2 E;  2IY5 B;  2N49 A;  1NJI C;  3CCM A;  4ME3 A;  4DV0 Q;  4HIO A;  4DR5 L;  1J6Q A;  2Q2U A;  4BA1 I;  3CCE A;  4HJ9 A;  2MO0 A;  5IP7 G;  4JYA Q;  1N9W A;  2JEA I;  2YYZ A;  2BA1 A;  2CFM A;  4JI5 Q;  3CCU A;  3HFZ B;  5M3F H;  4DV2 L;  1IBK Q;  4OX9 Q;  4IPG A;  2JA8 H;  3S2D H;  4MNO A;  4NB3 A;  4YHH L;  3KJP A;  2K5V A;  3HOY H;  2NZH A;  4UY8 C;  1B7Y B;  2L15 A;  3AQQ A;  3CQZ H;  2JA6 G;  3ULP A;  2E5L Q;  4P74 A;  4NXM L;  1Q86 C;  4DR1 Q;  1E1T A;  3A0J A;  1KRT A;  3HKZ G;  5FLM G;  2K75 A;  1WJJ A;  2ZM6 L;  4HJ5 A;  5M3M H;  3GTQ H;  3F1Z A;  4DV3 L;  3PSI A;  1PH1 A;  1VQB A;  2UXB L;  3IRB A;  4JI3 L;  4L5Q A;  3OTO Q;  3ULJ A;  3GTM H;  4A3K G;  4IFD J;  1XMO L;  4JI2 Q;  1PH8 A;  1HR0 L;  1EFW A;  2F4V Q;  5IP9 G;  3CPW A;  1LM0 A;  4B3S Q;  3HOX H;  3S2H H;  1X9N A;  4X66 Q;  4LUO A;  1M90 C;  3ULL A;  1N34 Q;  3SGI A;  1HZB A;  2JEB I;  4L5S A;  4BXX G;  3FP9 A;  4JOI A;  1HNX L;  5C3E H;  4LF4 L;  1NE3 A;  3WWV A;  5ELO A;  4LF5 Q;  5HY6 A;  2UUA L;  3U50 C;  2JA5 G;  4UP9 A;  1Y1W G;  2LXJ A;  5IYC G;  2NVY H;  1FGU A;  4PZ8 A;  1VQH A;  4LUZ A;  3TQY A;  1NBW A;  3H0G G;  4EX5 A;  1VQ7 A;  2A19 A;  2YV5 A;  3KYH C;  4DR2 Q;  3OYY A;  2OCE A;  1QZG A;  1V43 A;  1U0L A;  1JE5 A;  4IPC A;  4AQY L;  3M9B A;  3J7A 5;  1HNZ Q;  4DR6 Q;  4POF A;  4BBR H;  3ER0 A;  1CKN A;  4GKK Q;  3CCS A;  4DNI A;  3T1H L;  4LNQ A;  4B3R L;  1Q12 A;  5LMU L;  5M3F G;  2JE6 I;  3KDF B;  1YJW A;  4X65 L;  2K4K A;  2JA8 G;  3HOW H;  1KAW A;  1OTC A;  3HOY G;  4GLA C;  1MJC A;  3J80 c;  2PMZ E;  3CCJ A;  2B63 H;  2R92 H;  4TQU S;  3PF5 A;  4JBM A;  4HJA A;  1M1K C;  4R4C A;  1JJC B;  1PVO A;  2YTV A;  4PZ6 A;  3I4M H;  4P72 A;  3JAM c;  4YY3 Q;  4JI8 L;  1G29 1;  3K0X A;  4J15 A;  4DK6 C;  3S16 H;  4A93 H;  1IL2 A;  4MTN A;  1N36 Q;  4A3F G;  1PH5 A;  1HH2 P;  4JV5 L;  1Y1V H;  2CCZ A;  1X3E A;  3PUY A;  1HJP A;  4GN3 B;  3S24 A;  4B3T Q;  2AWN A;  3TRZ A;  4KLK A;  2BH8 A;  2E8G A;  3J80 i;  5GAE C;  2ID0 A;  1QZH A;  2WFW A;  3PF4 A;  5DLQ E;  1BBU A;  3HOX G;  4AYB G;  2VQF Q;  1FJG L;  1XTD A;  1CKO A;  1UEB A;  4RG1 A;  4C3I H;  1EIY B;  1PH3 A;  3I7F A;  4O2D A;  2UXD L;  1GVP A;  1XNQ L;  2WP8 J;  5AJ3 Q;  1D7Q A;  4JI0 Q;  1LUZ A;  1IXR A;  2XGT A;  1KC8 C;  3G48 A;  1SFO H;  1JT8 A;  1FVI A;  4HIM A;  4QL5 A;  4GOP C;  4LF9 L;  3GTK H;  2MO1 A;  4DR5 Q;  4BBS H;  4HIK A;  3RN5 A;  2Q2I A;  4DK3 C;  1RL2 A;  1VQO A;  2VQE L;  1N8R C;  3PIP A;  3T1Y L;  1VCI A;  4JI1 Q;  3TEH B;  4QGU A;  4DV2 Q;  4IOC A;  3BU2 A;  1PH7 A;  1IYJ B;  2BA0 A;  2YTY A;  1VQN A;  1WI5 A;  4YHH Q;  1AE2 A;  1IBL L;  4K0K L;  1YHA A;  4LF7 Q;  4GLV B;  4QJF A;  5IY0 A;  1OXS C;  3VDY A;  1TWA H;  4QY7 A;  2GVB A;  4AH6 A;  2Y0S E;  5IWA L;  4HJ7 A;  3S1R H;  3J81 i;  5FJ8 G;  1VQM A;  1VQF A;  1YBY A;  2IHE A;  5IP9 H;  3PUX A;  4NXM Q;  2JA7 H;  3HOW G;  3AYH B;  4L5T A;  2ZM6 Q;  1CKM A;  1C0A A;  1J5E L;  4DR3 L;  3U58 A;  2R92 G;  1XJV A;  4JI7 L;  2I0Q A;  4BY7 H;  4B3M L;  2VY3 A;  4YWL A;  4GNX C;  3MEF A;  4A75 A;  3GO5 A;  5H1S E;  4DV4 L;  2GN5 A;  3I4M G;  1PHJ A;  1XMO Q;  2IHF A;  5JEA J;  1VQP A;  1HR0 Q;  1X3G A;  2FXQ A;  4A93 G;  1P8L A;  1TWF H;  2ZTD A;  4LW1 A;  1N33 L;  2UUC Q;  2VUM H;  1Y1V G;  2RCN A;  2HHH L;  2UXC L;  1Y1W H;  1Z9F A;  2ZTE A;  1OXT A;  5JEA G;  4GKJ L;  3H0G H;  4DV7 Q;  4MZ9 A;  3GDE A;  1HNX Q;  4LF4 Q;  1JMC A;  1UE7 A;  2I5L X;  4X62 L;  1VQI A;  2UUA Q;  3HOV H;  5C0X G;  4LFC L;  1QUQ B;  3J81 j;  3S1Q H;  3E9I A;  4DUZ Q;  1EYG A;  1VQ6 A;  1E24 A;  2WB1 E;  2NVT H;  3S1N H;  3E0E A;  1E3P A;  2WAQ E;  2Z6K A;  3PV0 A;  5M5W H;  3K80 C;  3CCV A;  4DR4 L;  3GTL H;  3DLL A;  4BBS G;  1I50 H;  1T9H A;  1PYS B;  3EIV A;  4Y52 H;  1KHI A;  2IT1 A;  3T1H Q;  1X3F A;  1I6H H;  4JC0 A;  1W2B A;  1Q1B A;  4FDB A;  4OWW B;  4A3L H;  3KF6 A;  4X65 Q;  4A3F H;  3A5Z B;  1TWH H;  2R7D A;  4EQ5 A;  1WFQ A;  2UUB L;  2AKW B;  3A74 A;  3EBE A;  3RR5 A;  2Z6K C;  3HOU H;  3FHW A;  3DM3 A;  4A3C H;  2NN6 I;  3MXN B;  3U4Z A;  2AMC B;  4JI4 L;  4JI8 Q;  2AHO B;  2UU9 Q;  1VQ8 A;  2JA7 G;  1Q46 A;  4YWK A;  4YCU A;  4BA2 I;  3UDG A;  4JV5 Q;  3HKZ E;  4LFA Q;  4LWC A;  4BY7 G;  1N32 L;  1Z47 A;  1U5K A;  4C3J H;  3G6E A;  2F52 A;  2KCM A;  3KF6 B;  2I5H A;  1CSP A;  3U4V A;  2HQL A;  3KDF A;  5HGQ A;  4A3B H;  3CMA A;  1V1Q A;  2VUM G;  4LF6 L;  5M5Y H;  2I5M X;  1WOC A;  1HZ9 A;  1YEZ A;  3UDI A;  1UE1 A;  1MIU A;  1VQJ A;  3PGZ A;  2UXD Q;  2EQS A;  3D31 A;  1YI2 A;  1SRO A;  4GS3 A;  2ES2 A;  1CSQ A;  4JOI C;  3RNU A;  1E7Z A;  3PCO B;  4DV5 L;  4P75 A;  4IOA A;  4LF9 Q;  1C7Y A;  1YVC A;  3HOV G;  3RN2 A;  3PUW A;  2KCT A;  1SE8 A;  2CWP A;  4IJL A;  5FJ8 H;  1TWC H;  1Q81 C;  4LF8 L;  2R7Z H;  4RMF A;  1VQG A;  3T1Y Q;  3GTO H;  2VNU D;  1PYB A;  4HID A;  1A8V A;  1OXV A;  2CQO A;  3L2P A;  1ASY A;  1IBL Q;  1MJE A;  3RLF A;  2LSS A;  2DGY A;  2OQK A;  4XIG S;  3S1M H;  4JI5 L;  3EN2 A;  1Q82 C;  1IBK L;  2NVX H;  4A3L G;  1FL0 A;  2B29 A;  1YNX A;  3J7Z C;  2KHI A;  3TS2 A;  2NN6 G;  3W5O A;  1X6O A;  4AIM A;  4DV1 L;  1XNR L;  1XPO A;  4JI6 Q;  4GN4 B;  1GM5 A;  4WJ3 M;  3H3V H;  1I94 L;  3HOU G;  1UWV A;  3BJU A;  4B3M Q;  2E5L L;  1VQK A;  4A3C G;  4YWM A;  4DV4 Q;  1EUJ A;  1EQR A;  2CWA A;  5K36 G;  4DV6 L;  1UE6 A;  3PO2 H;  1N33 Q; 
#chains in the Genus database with same CATH topology
 2QCP X;  2K5H A;  1K3R A;  4PMW A;  3FKI H;  4Q0F A;  4A3F B;  2K04 A;  1WCM H;  3NEL A;  2HCC A;  5CR3 A;  5I9P A;  3HOU B;  2Z0S A;  2ZJQ A;  5CGK A;  1IW7 C;  2C5C A;  3I55 A;  2QA4 A;  1DJR D;  3STB C;  4DAY B;  1SSO A;  4LFC Q;  3SK5 A;  4FF2 A;  4RKL A;  3I72 A;  1NY4 A;  1TS5 A;  2R6G A;  1YHQ A;  1WTQ A;  1B3A A;  3H94 A;  3Q22 A;  4C3J B;  4OWT B;  3R93 A;  1IL8 A;  3BVG A;  2R7Z G;  2RHQ B;  2ICE C;  2RQX A;  4XDX A;  1WD0 A;  2ENB A;  3CD6 A;  4DR6 L;  5CV9 A;  1JJG A;  2V1C C;  2K6A A;  4R1J A;  4X3T A;  3X3N A;  4UP7 A;  1B2T A;  4MHE A;  2GVA A;  1SXT A;  3MHB A;  2A8V A;  3K7U C;  1PRT B;  3VYR A;  4OON A;  4POG A;  1L2F A;  3UE1 A;  2O2L D;  3DWA A;  1L1O B;  2F0N A;  1N32 Q;  3N52 A;  5C0X J;  1TS3 A;  4RAU C;  3IAY A;  3NUC A;  3JAM L;  2PZT A;  1HFG A;  1D1K A;  4R4Q A;  2F0L A;  4K8I A;  1A3V A;  2OT2 A;  1PH4 A;  1VQD A;  3A5U A;  1Q7Y C;  1Q90 A;  3PO2 B;  2XTI A;  5LMU Q;  2JA9 A;  4X3K A;  1MSH A;  2LFN A;  1S4Z A;  2B39 A;  1HA6 A;  3W2D A;  2NWG A;  4IUU A;  2RA4 A;  1EOV A;  1HR0 W;  1JWU D;  4IUR A;  4R9W A;  4DV1 Q;  1F9R A;  1XNR Q;  1BKB A;  1QVC A;  1XPU A;  1G6P A;  1GUN A;  3T56 B;  2CVR A;  4FVM A;  1I94 Q;  4A3E G;  1TR5 A;  3I73 A;  4BWG B;  2SOB A;  1IW7 D;  3STB D;  2K32 A;  2RHS B;  4A3J B;  3M4O H;  4FP5 D;  3G4S A;  1H9K A;  3CP0 A;  1YIT A;  3TN2 A;  1TII D;  4IO9 A;  1OO9 B;  4UPA A;  2OWO A;  3DWP A;  4DR7 Q;  3R2I A;  1Q3L A;  4C2M H;  1A2U A;  1XNQ Q;  4KJO A;  4DFA A;  1RIP A;  1VQE A;  2D0P A;  5TSS A;  1XMQ L;  4DA2 A;  4IFD G;  4FO2 A;  1DOL A;  2KQ3 A;  2SNS A;  3D0F A;  4L5R C;  1VQL A;  1W6J A;  1EYC A;  5FO7 B;  3V05 A;  1Y14 B;  4R4T A;  4DV0 L;  2C35 B;  2RDH A;  3T51 B;  3PO3 H;  4DUZ L;  2JJQ A;  5KNC A;  5GAH C;  4LK1 C;  3S15 H;  2KUM A;  1TVX A;  2CH4 W;  2VZA A;  1J5E Q;  4JI7 Q;  3NTH A;  3LWU A;  4A3G B;  4CDE C;  1QOH A;  1GUG A;  4KI0 A;  5BR8 Q;  4RH6 A;  3SE0 A;  1IZ6 A;  2E2H H;  3HOZ H;  3H3V I;  4PG3 A;  2BOS A;  4EQO A;  3IKJ A;  5J1Z A;  3OTO L;  3F2U A;  1R9T B;  1UE5 A;  4MN3 A;  1AH9 A;  2QDB A;  4B3S L;  2M00 A;  1VQ5 A;  4X62 Q;  2RF4 A;  3UDF A;  4L6T B;  4A3I H;  5C4J B;  1E1O A;  4CJ2 C;  1TY0 A;  1ENC A;  3W1B A;  3NBH A;  5JJZ A;  1HNW Q;  3KK7 A;  1AZP A;  1E0B A;  5EBC A;  4BS9 A;  1FGB D;  4K5W A;  1Q1E A;  2D0O A;  3GQB A;  5IYB H;  3F8T A;  5JVH 3;  1LT3 D;  2MFI A;  1GUT A;  4GKK L;  2N78 A;  2X6G A;  5GQO A;  1L0Y B;  4KV6 A;  3JC6 6;  3NSW A;  1O80 A;  3KJO A;  3M3Y H;  2HQE A;  4BBR G;  1JB7 A;  2B2V C;  4DUY Q;  3WDN A;  4C3H H;  5T1I A;  2ZJP A;  2ATW A;  3OHX C;  2WIN B;  3NWS A;  4HN7 A;  2Z4H A;  4IN3 A;  1X55 A;  4A3K H;  5CV8 A;  1ZYR C;  1J9O A;  1AZQ A;  5C4X B;  2Y0S B;  4BY1 G;  2Z8L A;  1YJN A;  3R2T A;  5M5X B;  1A0I A;  2N8N A;  5G3L F;  2KA7 A;  3UE0 A;  1B70 B;  1I4X A;  1IBM Q;  2MPM A;  1O7Y A;  3J7A V;  1JR0 D;  2QF7 A;  1NMF A;  3A55 A;  3GTG H;  4A3D G;  2AWO A;  3K7A B;  3URY A;  3SEB A;  1Z7T A;  4QB4 A;  5IYC H;  4FYD A;  2E2J H;  4LF8 Q;  3PUV A;  2Z6B A;  2IY5 B;  1BO0 A;  2N49 A;  3CCM A;  4DR5 L;  2Q2U A;  1QIL A;  3CCE A;  2MO0 A;  4JYA Q;  2Q8R E;  2JEA I;  3DHQ A;  2YYZ A;  2BA1 A;  2B2W A;  2IL8 A;  3T16 A;  4XXE A;  3LX0 A;  2LS0 1;  3KF8 A;  4NB3 A;  3KJP A;  1NCV A;  2EZV A;  3MZ5 A;  4K5V A;  2EJF C;  3ULP A;  1G91 A;  1BUV T;  5IIF A;  4NXM L;  4DR1 Q;  2K75 A;  1WJJ A;  4HJ5 A;  2XSC A;  3F1Z A;  1A3T A;  1U4P A;  1VQB A;  4F88 A;  2EYJ A;  3ULJ A;  4IFD J;  1G2T A;  4JI2 Q;  1HR0 L;  1EFW A;  1EYA A;  2EY1 A;  3IFT A;  1LM0 A;  3NWT A;  3K0Y A;  3T53 B;  1H9J A;  1HZB A;  3FP9 A;  4JOI A;  1HNX L;  5C3E H;  1NE3 A;  3SR1 A;  3QR8 A;  5ELO A;  5HGT A;  2JA5 G;  1Y1W G;  3H0G G;  3GP7 A;  1STA A;  4DR2 Q;  1XX8 A;  3L3O C;  1BOS A;  4DK1 A;  1ZYR D;  3CCS A;  3T1H L;  1CT1 D;  1CI3 M;  1Q12 A;  3NHH A;  4PNY A;  5EPK A;  3X3M A;  3M7G A;  5LMU L;  5I2Y A;  1SNP A;  1OTC A;  5JPM C;  1IKM A;  1EY4 A;  3PF5 A;  4DXG A;  1JJC B;  3I4M H;  3JAM c;  4J15 A;  4A93 H;  4MTN A;  1N36 Q;  4FF1 A;  4B08 A;  2DJF C;  2PCF B;  2JA8 B;  2FJ2 A;  2JP1 A;  3TRZ A;  5D3I B;  4KLK A;  4H0L C;  4B9W A;  1EIY B;  3I7F A;  4O2D A;  4RWS C;  3GTQ B;  2UXD L;  1XNQ L;  2WP8 J;  5M3M B;  4JI0 Q;  3A54 A;  2XGT A;  1KAB A;  1HRJ A;  3G48 A;  1JT8 A;  3MTS A;  3TDQ A;  4HIM A;  4GOP C;  4BBS H;  3RN5 A;  1PRT C;  5EKK A;  3PIP A;  3MEH A;  4QGU A;  1PH7 A;  4AYB B;  4DV2 Q;  4UY8 C;  3S2H B;  3U9O A;  3J81 E;  1LT5 D;  5DNF A;  4GLV B;  1ASZ A;  3BDC A;  4RGO S;  1FNU A;  4QY7 A;  5IGD A;  4RFB A;  4AH6 A;  1F9S A;  4XQN A;  1ZXT A;  2IX3 A;  3HOW G;  5IP9 H;  1KDB A;  1CKM A;  3OOC A;  2ZM6 Q;  1C0A A;  1J5E L;  4JI7 L;  4KY5 A;  3H3V C;  2SDF A;  3VA5 A;  4BY7 H;  4GNX C;  4A75 A;  3GO5 A;  5ISR A;  1PTO H;  2K33 A;  5H1S E;  4FXK C;  5JEA J;  2NTS A;  4P2C B;  2FXQ A;  2K5Q A;  2VB3 X;  2J4X A;  2K05 A;  4LW1 A;  3VR3 A;  2UUC Q;  1Y1V G;  2HCI A;  3MA2 B;  1V1P A;  1F2L A;  3AB9 A;  1FNV A;  2B63 B;  2R92 B;  4X62 L;  1BXT A;  2UUA Q;  1EYG A;  4M1U B;  1VQ6 A;  4L63 B;  2L55 A;  3E0E A;  3MXN A;  4DXF A;  5LHY 1;  1I50 H;  1T9H A;  5COY A;  2G9D A;  1T5E A;  1B3Q A;  1X3F A;  4JC0 A;  1W2B A;  1A2T A;  3Q23 A;  4X3U A;  3KF6 A;  2NN6 H;  4A3F H;  3A5Z B;  4C3I B;  2R7D A;  4X3S A;  3V96 A;  2UUB L;  2F0V A;  3RR5 A;  1SE4 A;  3HOU H;  3FHW A;  5KYI A;  5CV4 A;  2F0M A;  4JI8 Q;  2AHO B;  1VQ8 A;  1ICF B;  4BA2 I;  4JV5 Q;  4LWC A;  4C3J H;  2KCM A;  2E76 C;  3T13 A;  2I5H A;  5T1G A;  1HTL D;  1PRT D;  4HR7 B;  3U4V A;  5HGQ A;  3CMA A;  4V19 0;  3FMC A;  1ILP A;  1LTS D;  2GA4 B;  1YEZ A;  1VQJ A;  3PGZ A;  4ZRZ A;  1LTB D;  1K3B C;  3SK8 A;  3TZD A;  3FRP B;  5JAV A;  4P75 A;  2AQ1 B;  1TWF B;  5FJ8 H;  4LF8 L;  2P5Z X;  4V0B A;  2VUM B;  4HID A;  1OXV A;  3L2P A;  1IBL Q;  5I2X A;  2LSS A;  2OQK A;  4OEM B;  4A3L G;  2B29 A;  3J7Z C;  1BBX C;  2XWB B;  2BDN A;  3H3V H;  1PXU A;  2FMM A;  2MHV A;  1VQK A;  4A3C G;  1DOK A;  5M5W B;  2CWA A;  1VF5 C;  1JOO A;  3PO2 H;  3A8K E;  5LMN Q;  1VMC A;  3Q6S A;  4KHZ A;  4MTK A;  1P16 A;  3JAM i;  2QDL A;  2KHJ A;  4JI2 L;  4IUP A;  1AEX A;  1HPC A;  3DM1 A;  1K8M A;  5FK9 C;  1QCB D;  1DZ1 A;  2F0T A;  5C0X I;  1CFM A;  3CXC A;  5GRO A;  4CKE A;  1H95 A;  1GHJ A;  3I4O A;  4NXN L;  2RKS A;  4WRD A;  3D6C A;  1EIF A;  4A3J H;  3FPP A;  4KK7 A;  4XQQ A;  1F9P A;  2DUD A;  2VL6 A;  4ZKC B;  5M5Y B;  1XPR A;  1F9Q A;  1SN8 A;  4K5X A;  1OXU A;  3F2D A;  2EYF A;  4DV3 Q;  4PMB A;  1WTH A;  4C1N I;  1QUQ A;  1BCP C;  2XRQ D;  4JI4 Q;  3V2T A;  2Q2H A;  1EWH A;  2R7Z B;  1CK1 A;  3GTO B;  2KOL A;  3ERS X;  1SJE D;  2PZW A;  1LTT D;  1HHV A;  1N36 L;  2LMC B;  4XTC S;  4KHP L;  2K03 A;  2PI2 A;  3CF5 A;  1TY2 A;  1NTG A;  2A68 C;  3K8A A;  1EWC A;  1Y8N B;  2OTL A;  2BCO A;  4A3G H;  4AQY Q;  4R4I A;  3OIQ A;  4ZCK A;  2PZU A;  4B3R Q;  2HIX A;  3EFX D;  4JI0 L;  4OO1 I;  3VYU A;  3SDZ A;  1R9T H;  2H1E A;  5COR A;  3R3O A;  4KD3 A;  2PYK A;  3OMG A;  1KRS A;  2O4X A;  2EJG C;  5C4J H;  5IYB G;  4BBS B;  4J6H A;  1QE6 A;  4R8N A;  4QIW E;  3UI2 A;  4DN4 M;  3NTK A;  1WTW A;  1DCZ A;  1X3Q A;  1TT2 A;  5FO9 B;  2DJG C;  1KNE A;  3C3L A;  3DXJ C;  4U67 3;  1JB3 A;  3NXW A;  4DU9 A;  4ZKB B;  4DV6 Q;  3NPP A;  2F0G A;  3S14 B;  1SR3 A;  3KFU A;  2QW7 A;  5ELB A;  1RCV D;  1SYB A;  1S3O A;  3CAM A;  4A4I A;  3I90 A;  5IT9 L;  2E2I B;  2D62 A;  1K8O A;  3KF8 B;  2LKV A;  3ZYY X;  5IYD H;  5JJK A;  2VXW A;  2UUC L;  4A3E B;  4C56 C;  1JIC A;  1VQC A;  2WII B;  2IW3 A;  3K5L A;  2FHT A;  5AFW A;  1B1Z A;  1U4M A;  3BYY B;  4OO1 G;  5KGU A;  2A69 C;  1BCP D;  5C4X H;  5DEH A;  2F0U A;  4YCV A;  1C8C A;  1AFP A;  5IGB A;  1F77 A;  1VQA A;  5M5X H;  1PFS A;  4ZYS A;  4OX9 L;  2A6E C;  1B9N A;  4WJ4 A;  1HUN A;  4DR3 Q;  3ITP A;  5IGE A;  3MVV A;  1C9O A;  4ZUJ A;  3K7A H;  3TP7 A;  4A3M G;  3PUZ A;  2A68 D;  1ILQ A;  2YU9 B;  1FD7 D;  1PTO F;  2R7F A;  3W1G A;  5BN5 A;  5I6Y A;  2UXC Q;  5EQ0 A;  1JC7 A;  1GO3 E;  3KLW A;  4HSP A;  3PMF A;  1QNU A;  2PMZ B;  3BZC A;  1DD2 A;  1O7I A;  4KMU C;  2F4V L;  2KJX A;  2PQA A;  3R8B A;  5C6A A;  1SNO A;  2JK8 A;  3ND9 A;  3I56 A;  4HCE A;  1SMX A;  4KHV A;  1A6X A;  1MKH A;  3QIA A;  4LF5 L;  4S3S A;  3ERQ A;  1EQT A;  1SLJ A;  1S5E D;  3BDO A;  2R93 G;  2LY7 A;  2KEC A;  5C3E G;  3B6Y A;  3J81 c;  2WV6 D;  3FEW X;  1KQS A;  1ESR A;  1L0W A;  1BBW A;  4CHT B;  3TS0 A;  2BH2 A;  3GTP B;  4GOP B;  4HJ8 A;  5GAG C;  2NUC A;  1SND A;  1NMG A;  3BYT B;  3DMU A;  5C44 B;  4N9P A;  2N3S A;  1MHW C;  3D6W A;  4YY3 L;  2F3I A;  3K58 A;  1KTK A;  4KY7 A;  2NVQ B;  4B3T L;  1WYD A;  2A69 D;  3M4P A;  1PH6 A;  2PW7 A;  3I4N G;  4GNX B;  4X64 Q;  2VQF L;  5LMN L;  4IFD I;  1VDZ A;  3KLS X;  2A6E D;  1QVF A;  4DAM A;  1LYL A;  4BY1 B;  1J8I A;  2PI2 E;  1PRT F;  4DAP A;  4HJ9 A;  5IP7 G;  1G8Z D;  2CH4 A;  4CGY B;  1B53 A;  4JI5 Q;  4A3D B;  1IBK Q;  1X32 A;  4RA8 A;  4IPG A;  4QUF A;  4ZK9 B;  2JA8 H;  3HOY H;  2F0I A;  2FMC A;  2XWJ B;  3AQQ A;  1EL0 A;  2F0D A;  2JA6 G;  5EGT A;  1PMR A;  1E1T A;  3A0J A;  3N6R A;  4QUC A;  5FLM G;  3GTQ H;  5M3M H;  4DV3 L;  3PSI A;  4HSV A;  1I4H A;  3BVZ A;  4KJN A;  3M4Y A;  4OEL B;  1EY8 A;  5IP9 G;  1EZ6 A;  1I6V C;  3S2H H;  1B9M A;  1X9N A;  4X66 Q;  4LUO A;  2JEB I;  4L5S A;  1VF7 A;  4BXX G;  2JN4 A;  3EVQ A;  1CQF A;  4ZLT F;  2NBF A;  3U50 C;  2DNE A;  2BDO A;  1D6E C;  4EX5 A;  4LUZ A;  1VQ7 A;  4Y7N B;  1HCZ A;  3I91 A;  2KEE A;  2OCE A;  1V43 A;  5D3D A;  4IPC A;  2AUJ D;  4AQY L;  1HNZ Q;  1LLR D;  4NP5 A;  4HED A;  1S5D D;  5C3W A;  4B3R L;  3LNN A;  3E5S A;  5M3F G;  2JA5 B;  1MJC A;  5ELE A;  3CCJ A;  2B63 H;  2R92 H;  1BQQ T;  4IUV A;  4DK6 C;  1GUW A;  4A3F G;  3A8J E;  1X3E A;  4GN3 B;  3S24 A;  3S2D B;  4OIK A;  3QO2 A;  1ZKO A;  1ONL A;  3RMH A;  1QZH A;  2WFW A;  1FYC A;  3HOX G;  3CQZ B;  3PF4 A;  4UHV A;  1SEB D;  3HG9 A;  1PDQ A;  1CKO A;  1CM9 A;  2KHS A;  5C0X H;  1UEB A;  4C3I H;  1PH3 A;  5EBD A;  1RJT A;  1SYF A;  4I65 A;  5FO8 B;  5AJ3 Q;  2O5J C;  1LUZ A;  2D9U A;  5LL6 S;  1D7Q A;  4KN4 C;  3GTM B;  4QMG A;  1IYV A;  1QB5 D;  4DNT B;  4HIK A;  2B2U A;  2Q2I A;  3DEO A;  3KBG A;  1LTG D;  2R3Z A;  3BS1 A;  3T1Y L;  1VCI A;  2JSO A;  4JI1 Q;  4IOC A;  2TMP A;  1IYJ B;  2YTY A;  1XXG A;  4O1N A;  1WI5 A;  1VQN A;  4YHH Q;  5E3F A;  4LF7 Q;  3G7L A;  5F2D A;  2B2T A;  5IY0 A;  2B8G A;  1VQM A;  4PQX A;  3J81 i;  2EDG A;  5C5L A;  5FJ8 G;  1EU4 A;  1YBY A;  3PUX A;  2RSO A;  4NW2 A;  1HA5 A;  4DR3 L;  4F7X A;  1R4P B;  3I70 A;  2QEJ C;  4RGN A;  1XMO Q;  2IHF A;  3PQI A;  1X3G A;  1P8L A;  1TWF H;  4TKO B;  4LMQ D;  2VUM H;  2UXC L;  4UDU C;  1BCP B;  3A7A B;  1Z9F A;  5ELD A;  5JEA G;  3J80 L;  3HOW B;  1EEI D;  2EYM A;  3GDE A;  4MIU A;  4LF4 Q;  3BZD B;  1UE7 A;  3D4D A;  3ND8 A;  4LFC L;  1QUQ B;  3S16 B;  3E9I A;  2NZ1 D;  3E0J A;  1Y1V B;  2L4N A;  1MD2 D;  2WAQ E;  5M5W H;  5EPL A;  3OIP A;  2AUK A;  3VR5 A;  2AQ2 B;  4CKC A;  3DLL A;  4EGV A;  1EOT A;  3A7L A;  1PYS B;  1KHI A;  1CQV A;  4OWW B;  4WJW A;  4X65 Q;  2B2W C;  1WFQ A;  1BCP F;  4ZAI A;  3VR6 A;  3EQL C;  1SFO B;  3NQT A;  4IQZ A;  5CC4 A;  3GTK B;  4I7A A;  4ME5 A;  2UU9 Q;  2JA7 G;  5K36 H;  3ONA B;  3RD4 A;  1Q46 A;  4YCU A;  1C4Q A;  1SMY C;  3MFY A;  3HKZ E;  1SNM A;  4LFA Q;  1N32 L;  1Z47 A;  4TRD A;  3KLR A;  4IUT A;  1AN8 A;  1CSP A;  2L9H A;  3KDF A;  3S1R B;  4HAE A;  5M5Y H;  1WOC A;  1HZ9 A;  5KEE A;  4IUQ A;  1SRO A;  4N9T A;  2L5T A;  4JOI C;  3FDT A;  5M9O A;  1O7Z A;  4LF9 Q;  3HOV G;  4IOA A;  3RN2 A;  3PUW A;  4IZ8 A;  1WTO A;  4IJL A;  1SE8 A;  1Q81 C;  2R7Z H;  5DAU A;  2EYL A;  1U4L A;  4RMF A;  3K57 A;  3GTO H;  2VNU D;  4NDX A;  1YNN C;  1SNQ A;  1MJE A;  3P1H A;  4OIJ A;  2DGY A;  1FR3 A;  4JI5 L;  3EN2 A;  1II3 A;  1IBK L;  1FL0 A;  1YNX A;  2F0K A;  2KHI A;  2N55 A;  4KD4 A;  3W5O A;  1X6O A;  3TZU A;  4AIM A;  4DV1 L;  1XNR L;  2WKD A;  1XPO A;  4JI6 Q;  1WTX A;  3S1Q B;  4OHJ A;  4XT3 B;  1I94 L;  3BJU A;  4B3M Q;  5J22 A;  4DV4 Q;  2SNM A;  5KYL A;  3HOY B;  1S5B D;  3GTL B;  1UE6 A;  2IWH A;  1N33 Q;  3GV6 A;  3RLO A;  1K0S A;  2HHH Q;  4P73 A;  1Q8I A;  4DR7 L;  1I6H B;  4GKJ Q;  1B4O A;  2XNA C;  2E74 C;  2HD3 A;  2ASB A;  4A3B G;  1I3Q H;  1UUP A;  1D8L A;  5A2Q L;  2F4I A;  4XYQ A;  1CUK A;  1V1O A;  5I9O A;  4RKB A;  3M4Q A;  3TSS A;  3C1F A;  3NQI A;  1SYG A;  2K14 A;  4DR4 Q;  5IOD A;  3S14 H;  1SMY D;  1L1O A;  2M2L A;  3ERO A;  2E2I H;  1GD7 A;  3CME A;  3VYS A;  1VS0 A;  2UXB Q;  1TXY A;  1D2B A;  1JWS D;  3TP6 A;  1JJ2 A;  5JJL A;  2EY2 A;  4A3E H;  5BR8 L;  1WTP A;  4N8F A;  1H9M A;  4QCL A;  1V9P A;  1AP0 A;  2IX0 A;  1TWC B;  1SJH D;  3PIP 3;  3AFP A;  1ENA A;  2CKZ B;  2F0W A;  1NSN S;  1A62 A;  2XN9 C;  3WOE A;  5CMD A;  5JJI A;  2Z1C A;  1RHP A;  4DGZ A;  2NVX B;  1B8A A;  1CHP D;  2QGQ A;  3E9H A;  3FKI G;  2F0F A;  3EA6 A;  1K28 A;  1LAC A;  1QNK A;  1WCM G;  2IX1 A;  1HNW L;  1F2Y A;  2A6H C;  3F2C A;  5IE8 A;  2YU9 H;  2WB1 G;  5AJ3 L;  1ICW A;  3MXU A;  4IPD A;  2JQO A;  1M8A A;  2PO4 A;  4QF4 A;  1H9S A;  4GLX A;  3A56 A;  4RHR A;  3AEV A;  1DGS A;  4JI1 L;  1H9R A;  3M85 A;  4N8X 1;  2NTT A;  4DUY L;  4IJH A;  3CC4 A;  1VQ9 A;  4LF7 L;  1NUC A;  2MNA A;  4K6D A;  1EY5 A;  4F87 A;  1EWI A;  2EXD A;  5EPJ A;  1FJG Q;  5D65 A;  2PW5 A;  1IBM L;  5E4W C;  1STG A;  3GTP H;  1JOR A;  1IYU A;  2OTJ A;  5C4H A;  3CCR A;  4EVO A;  3QB3 A;  1KAA A;  2EIF A;  2K01 A;  2TSS A;  3Q24 A;  1WTR A;  5C44 H;  1Q8K A;  2O5I C;  4X6A H;  1K83 B;  3S9W A;  1YHB A;  4P71 A;  4K0K Q;  4YCW A;  3S17 B;  4JYA L;  2NVQ H;  1S72 A;  2VB2 X;  3CW2 C;  5EAY A;  3K5M A;  3QOL A;  3I8Z A;  4G7O C;  1KDC A;  1PZI D;  1SE2 A;  4ALP A;  4Q5V A;  2PNH A;  2G9H D;  4WOR A;  1TS2 A;  3CCL A;  2EYO A;  1EIH A;  4DR1 L;  3OWF A;  2EY6 A;  1K73 C;  2X6L A;  4BY1 H;  3L0O A;  3CC7 A;  3D4W A;  3H15 A;  2A6H D;  4APV A;  1HZA A;  2J0T D;  4YIJ A;  3FPU B;  2UU9 L;  3GD7 A;  1SE3 A;  3BZK A;  4A3D H;  5M3M G;  4K14 A;  2F0J A;  4LFA L;  1SYD A;  3MFG A;  4RGT A;  4A3M B;  4A76 A;  4FXD A;  3P20 A;  3RZD B;  3I3C A;  2KCC A;  2K52 A;  1UNS A;  1O7L A;  3O13 A;  1LTI D;  4DR2 L;  3CC2 A;  3TRE A;  3LGJ A;  5C3X A;  2DY8 A;  1OXX K;  1QJO A;  2PQE A;  2L11 A;  1TS4 A;  3C1E A;  5A35 A;  3PO3 G;  1PLF A;  4GZY C;  3VR2 A;  3NBH B;  3KLS A;  2NB0 A;  2QEX A;  5LMN W;  2R93 B;  5IT9 E;  1IKL A;  4DPG A;  4IUN A;  4TVA B;  4RGM A;  2D5D A;  4OXP A;  1RTN A;  3HOZ G;  4Y7N H;  2F03 A;  4JI6 L;  4LF6 Q;  2F1M A;  2B63 G;  1AE3 A;  4QQB X;  1KIX A;  3Q8D A;  2MGS A;  2EPB A;  4DV5 Q;  1KL9 A;  2JA5 H;  4G57 A;  4A3I G;  1XMQ Q;  1EY9 A;  2D2C C;  1D5X C;  2WAQ G;  5CV5 A;  1FNW A;  1NJI C;  1EEF D;  2F3V A;  1XTC D;  4ME3 A;  4DV0 Q;  4HIO A;  1LT4 D;  4JK1 C;  1I3Q B;  3I4N B;  2CFM A;  3CCU A;  3HFZ B;  4DV2 L;  3S2D H;  3HRZ C;  1CA6 A;  4J1M A;  4J8Q A;  1B7Y B;  2L15 A;  2CHB D;  2K7V A;  3CQZ H;  2E5L Q;  1RTO A;  5KRU A;  4NKL A;  4KTA A;  4P74 A;  2FIN B;  1G2S A;  3HKZ G;  2ZM6 L;  4C3H G;  2UXB L;  5L37 A;  4OGQ C;  3OTO Q;  3GTM H;  4A3K G;  5FOB B;  1PH8 A;  4B3S Q;  2JA6 B;  2EE1 A;  1N34 Q;  3HS0 C;  4FF4 A;  2R61 A;  1I4R A;  1KLU D;  4I7Z C;  3WWV A;  1DM0 B;  4TSS A;  2UUA L;  1PH5 A;  2LXJ A;  5IYC G;  2NVY H;  1FGU A;  1ENF A;  1TWG B;  1NBW A;  4Z9C B;  1WTV A;  2A19 A;  2YV5 A;  2DNC A;  3OYY A;  1RDP D;  1GOZ A;  1JE5 A;  1U0L A;  2E75 C;  3DUZ A;  1EU3 A;  3J7A 5;  4ZUI A;  3K6O A;  4FF3 A;  1CKN A;  4GKK Q;  4LNQ A;  2F0O A;  3GTJ B;  2JE6 I;  2RDF A;  3KDF B;  1YJW A;  2K4K A;  3HOW H;  1KAW A;  3VYT A;  4CJ1 B;  4TQU S;  4HJA A;  1MGS A;  2YTV A;  4PZ6 A;  3MXG A;  1T5X D;  4P72 A;  4O42 A;  4ODG A;  4JI8 L;  3K0X A;  5LL6 X;  3S16 H;  1IL2 A;  4JV5 L;  1Y1V H;  2CCZ A;  3C46 A;  3PUY A;  5M3F B;  1BDO A;  5ELF A;  2CQA A;  4ZQ3 A;  2B8F A;  1V8Q A;  2E8G A;  3J80 i;  5IGG A;  1BBU A;  5FLX L;  1FJG L;  2A74 C;  1XTD A;  4RG1 A;  4CDD C;  5E4X A;  1IXR A;  4C1N K;  1SFO H;  2K5D A;  4QL5 A;  3GTK H;  4DR5 Q;  4HMJ A;  4DK3 C;  2K28 A;  5C4Z A;  3HOX B;  3TEH B;  1S5C D;  3BU2 A;  1SNC A;  2BA0 A;  3IFD A;  1EZ8 A;  5CV7 A;  1IBL L;  4JVZ A;  1STE A;  3TME A;  4K0K L;  4QJF A;  3VDY A;  1TWA H;  3S1R H;  2GVB A;  2Y0S E;  3FVQ A;  1HQM C;  2V4D A;  4NXM Q;  1ML0 D;  4G7Z C;  1CA5 A;  3U58 A;  1AW7 A;  1XJV A;  3HEJ A;  1E2Z A;  4YWL A;  5KIX A;  2K5W A;  3I4M G;  3OSO A;  2C9O A;  4H7B A;  5EKI A;  4BBR B;  1DON A;  1SBB B;  1VQP A;  1HR0 Q;  4A93 G;  2ZTD A;  4JW0 A;  4KN7 C;  1M4V A;  2ZTE A;  1OXT A;  4DV7 Q;  4MZ9 A;  4E6I A;  1HNX Q;  1CTM A;  2I5L X;  5JVG 3;  1VQI A;  3HGB A;  3S1Q H;  5IGF A;  2EXZ A;  1E24 A;  2KCN A;  2WB1 E;  3MC0 B;  1TU2 B;  1E3P A;  1O78 A;  3PV0 A;  4RHS A;  3K80 C;  1V1P B;  3GTL H;  4BBS G;  3EIV A;  4Y52 H;  5I4D A;  2IT1 A;  3MWY W;  3T1H Q;  4CDF C;  4KY6 A;  4DK0 A;  1I6H H;  1Q1B A;  4A3L H;  2F0H A;  3NTI A;  3KBX A;  4ULL A;  1WVL A;  4EQ5 A;  2AKW B;  2EJM A;  3VA7 A;  2OEO A;  3DM3 A;  4A3C H;  2NN6 I;  3MXN B;  4JI4 L;  4PV1 C;  4NMZ A;  3UDG A;  1CZW A;  4BY7 G;  1U5K A;  3G6E A;  4QIW B;  2F52 A;  3KF6 B;  4CBV A;  4LF6 L;  4K6L A;  2ZXP A;  1H9S B;  1QWY A;  3UDI A;  1MIU A;  2F0S A;  2JA7 B;  3BG3 A;  2UXD Q;  2EQS A;  1YI2 A;  2ES2 A;  1CSQ A;  4B9X A;  1E7Z A;  3PCO B;  4DV5 L;  1C7Y A;  1YVC A;  2KCT A;  4JPB W;  1TWC H;  1VMP A;  3G6J B;  1Y1W B;  1F2M A;  3HP3 A;  3SK4 A;  2CQO A;  3H0G B;  1ASY A;  5EKL A;  1XYI A;  3NE5 B;  2NVX H;  1I4P A;  1NAP A;  2NN6 G;  3HOV B;  1GXD C;  3J80 E;  4WJ3 M;  3HOU G;  1UWV A;  3S1N B;  2NVT B;  4ID6 A;  1I4G A;  2E5L L;  4H13 C;  3QG1 A;  4DV6 L;  4OL7 A;  2RDG A;  3SVM A;  4M8A A;  4LFB Q;  2SEB D;  4C3J G;  1HQR D;  2VS1 A;  3CRL C;  1TWH B;  4L8J A;  3D4R A;  1NNX A;  4LUV A;  1RF2 D;  5CBE E;  1N34 L;  4AYB E;  2ZJR A;  3MXP A;  2ZTC A;  1R4Q B;  2X69 A;  3CHB D;  4DNR B;  2H4O A;  3PIO A;  2VW9 A;  2OXP A;  3RUZ A;  2Q2T A;  1JOK A;  4A3B B;  2B2U C;  1G51 A;  5C44 G;  5J39 A;  2B2V A;  1PA6 A;  2K5N A;  2NVY B;  3RLN A;  3WOF A;  4JBK A;  4FXG C;  5IT9 c;  2EYP A;  1K0R A;  2AQ3 B;  2UUB Q;  2ICI A;  3CCQ A;  1F2Z A;  4JI3 Q;  4UP8 A;  4LAA A;  2B2T C;  4LJZ C;  1KXL A;  3ZJY C;  2ZT9 C;  2F3W A;  1A63 A;  1E22 A;  1JE4 A;  5IOC A;  1YIJ A;  2RVL A;  1K83 H;  1SAP A;  4CDC C;  1PFN A;  1GKH A;  2ZXO A;  3S17 H;  1EY7 A;  5ELN A;  1GHK A;  2KEN A;  3PO2 G;  1K8A C;  4HTH A;  3PIO 3;  3S1M B;  3NBI A;  2HDM A;  1S5F D;  2OF1 A;  1PH9 A;  5GAD C;  3J7Y W;  1DYQ A;  2QKI C;  4PZ7 A;  2NZO A;  5BN4 A;  1PFB A;  2ALY B;  4KKS A;  4OO1 H;  2K1B A;  2L1B A;  3NEM A;  1U9R A;  3AMU A;  2B3G A;  1EQQ A;  1SRU A;  2Z9H A;  4CJ0 B;  3FKI B;  2Z4I A;  2A1A A;  4A3J G;  1WCM B;  2I07 B;  2J7Z A;  1GUO A;  3KUP A;  1CHQ D;  2L0C A;  1HZC A;  1RD9 D;  2LXK A;  3W3A A;  1X3P A;  3E3X A;  4A3M H;  2YTX A;  1A15 A;  2WB1 B;  2IJ0 A;  5JPN C;  1PZK D;  4JBW A;  3RZD H;  1A3U A;  3K81 C;  1RKN A;  4R4O A;  5A2Q E;  5FLX c;  4ABN A;  3VR4 A;  1W3S A;  2QIL A;  5FKA C;  3L7Z C;  1TWA B;  3U9S A;  3T4A C;  3K5O A;  3KOJ A;  1YZ6 A;  1PTO C;  1EIG A;  4X64 L;  4DKA C;  4OWX B;  3CPF A;  3OW7 A;  3I2Z A;  3C2P A;  4DV7 L;  1SYC A;  2R93 H;  3J7A F;  2B2Y A;  2VQE Q;  1LTA D;  3TP8 A;  4KKT A;  4NXN Q;  1E2V A;  4A3G G;  1TKW B;  1ET6 A;  4HCS A;  1B44 D;  1BNZ A;  4NPS A;  2F0Q A;  5IWA Q;  2BE5 C;  1S40 A;  4H02 A;  2B2Y C;  3ICE A;  3M7N A;  2HT1 A;  1K8G A;  4R8I A;  1NR4 A;  2EVB A;  1I5F A;  4DAY A;  1PV4 A;  5CV6 A;  4DAV A;  3D8G A;  3E6Z X;  1K9M C;  5E7N A;  2H5X A;  2MQH A;  5J3B A;  2K50 A;  3IL8 A;  4RCO A;  5DM6 3;  4JBJ A;  4JCV E;  1D5Z C;  3NP8 A;  3I4N H;  1CKN B;  4X66 L;  1WD1 A;  1PH2 A;  2EY5 A;  1CZG A;  3D3R A;  4KHP Q;  1ROD A;  3G71 A;  4GOP A;  1PYW D;  5IYD G;  1KD1 C;  4IPH A;  1X56 A;  3NEN A;  1YJ9 A;  5IP7 H;  3AFQ A;  2DY7 A;  5KND A;  1X65 A;  3M4O B;  2PQA B;  4JG2 A;  1TQO A;  5HUR A;  1X54 A;  1HNZ L;  1LO5 D;  4C2M B;  1QVG A;  5C4X G;  2Y0S G;  1LAB A;  1C48 A;  2KED A;  2MJ8 A;  3OW2 A;  2JA6 H;  3BDL A;  1EY6 A;  4O0A A;  4GN5 A;  1GJX A;  4ILW A;  3P7J A;  1L1O C;  5FLM H;  1PTO D;  1JWM D;  4GNX A;  4U68 A;  1XWE A;  2HDL A;  1TWG H;  3PO3 B;  1YNN D;  1LTL A;  3UDX A;  1VQ4 A;  4IFD H;  3F2B A;  1ET9 A;  3TP5 A;  2EYH A;  1KLG D;  1STY A;  2A73 B;  4BXX H;  4F8M A;  3S15 B;  3GTJ H;  1ZEQ X;  2BE5 D;  1DXM A;  1ESF A;  1HUM A;  1PZJ D;  3HKS A;  1BVS A;  4LFB L;  3HOZ B;  2E2H B;  2KBN A;  2E2D C;  2HIV A;  5E1F A;  2WAC A;  2OQ0 A;  3MAQ A;  3RZO H;  1JCK B;  2NYZ D;  1J6Q A;  4BA1 I;  4G4K A;  1N9W A;  1QG7 A;  4OX9 Q;  1BR9 A;  5M3F H;  4A3I B;  1JOQ A;  4MNO A;  4YHH L;  2K5V A;  2NZH A;  2WAQ B;  2MP1 A;  5D14 A;  4FNF A;  1PFM A;  3TBI B;  1SDF A;  4IAL A;  1Q86 C;  3P75 A;  1KRT A;  3J81 L;  3K5N A;  1PH1 A;  3IRB A;  4JI3 L;  4L5Q A;  1MI2 A;  1Y69 U;  3CRK C;  1XMO L;  4EQP A;  2F4V Q;  3CPW A;  3HOX H;  3HZX A;  4RCN A;  1SYE A;  2JXM B;  2F0E A;  3DEP A;  1M90 C;  1LT6 D;  3ULL A;  3SGI A;  3M3Y B;  3HKZ B;  4LF4 L;  3QJY A;  4C3H B;  1EQV A;  4LF5 Q;  1LTR D;  5HY6 A;  4A3K B;  5BN3 A;  4UP9 A;  4PZ8 A;  1VQH A;  3TQY A;  2JYO A;  3KYH C;  1QZG A;  1Y8O B;  3EJI A;  3M9B A;  3SK6 A;  4DR6 Q;  4POF A;  4BBR H;  3ER0 A;  2XIW A;  5ELC A;  3OWE B;  4DNI A;  4K2K A;  1STN A;  4UAI A;  3GTG B;  1UEA B;  5JOB A;  4X65 L;  1I4Q A;  2RBM A;  2JA8 G;  3HOY G;  4GLA C;  3J80 c;  2PMZ E;  4JBM A;  1D5M C;  2E2J B;  1M1K C;  5CYU A;  4R4C A;  2I46 A;  1PVO A;  1Y8P B;  4YY3 Q;  1G29 1;  4XT1 B;  1HH2 P;  1NR2 A;  4XYO A;  5IGC A;  1HJP A;  4B3T Q;  5JEA H;  3SHL A;  2AWN A;  4XQJ A;  2BH8 A;  5GAE C;  2ID0 A;  5DLQ E;  5NUC A;  2VQF Q;  4AYB G;  5I6W A;  5K5P A;  4H44 C;  1GVP A;  2Q8T A;  1KC8 C;  1FVI A;  4LF9 L;  2MO1 A;  1E2W A;  3K59 A;  3H91 A;  1RL2 A;  4CKB A;  1VQO A;  1EFI D;  2VQE L;  1N8R C;  1BF4 A;  2PNR C;  1KDA A;  1YNJ C;  1AE2 A;  5EJW A;  2M9V A;  1YHA A;  4K2L A;  1OXS C;  5C3E B;  2RCF A;  5IWA L;  4HJ7 A;  1MBY A;  1VQF A;  2F0P A;  2IHE A;  3H6M A;  1GUS A;  2JA7 H;  2CW0 C;  2HUG A;  2EOT A;  3AYH B;  4L5T A;  2R92 G;  2I0Q A;  1JQY D;  1W6K A;  4B3M L;  2VY3 A;  3MEF A;  3CKI B;  4DV4 L;  2GN5 A;  3AU7 A;  1PHJ A;  1N33 L;  2RCN A;  2HHH L;  1Y1W H;  3Q0A A;  4GKJ L;  3H0G H;  1HFN A;  4HMI A;  4EQN A;  3BVM A;  2XRS D;  3NK9 A;  1JMC A;  1EYD A;  4PMC A;  3I4M B;  3HOV H;  1DOM A;  5CBA E;  5C0X G;  2RSN A;  4C3I G;  3J81 j;  4A93 B;  4DUZ Q;  2MUY A;  2NVT H;  3S1N H;  2Z6K A;  3CCV A;  4DR4 L;  3DWQ A;  1L0X B;  3LWE A;  1G6Z A;  3A8I E;  1STB A;  4FDB A;  2A5H A;  3OMC A;  4G7H C;  1B50 A;  1TWH H;  4DF7 A;  5G3L D;  4K8J A;  3A74 A;  3EBE A;  2Z6K C;  3I4L A;  3U4Z A;  2AMC B;  5FLX E;  2KVM A;  4YWK A;  3CU7 A;  2PPB C;  1KNA A;  2HQL A;  4A3B H;  1V1Q A;  4WFN 3;  2VUM G;  2I5M X;  2G5D A;  1YNJ D;  3QWN A;  2XVS A;  1UE1 A;  2WKC A;  2FFK B;  3D31 A;  5C5M A;  3OPO A;  4GS3 A;  1EY0 A;  3RNU A;  4BY7 B;  1PTO B;  2CW0 D;  3H09 A;  5DM7 3;  3GV3 A;  2CWP A;  1UAP A;  2Q8I B;  1Z6H A;  3QOJ A;  1VQG A;  3T1Y Q;  5KNB A;  1IHZ A;  1PYB A;  1A8V A;  1U4R A;  1STH A;  2N88 A;  1D1I A;  2ZXR A;  3RLF A;  1HXY D;  4XIG S;  3RZO B;  3S1M H;  1Q82 C;  2L12 A;  3TS2 A;  1HTP A;  4KKU A;  4GN4 B;  2IPK D;  1GM5 A;  1LV9 A;  1MSG A;  4YWM A;  1EUJ A;  1EQR A;  3JAM E;  5K36 G;  1I50 B;  3L9A X;  3SXH A;  2DN8 A; 
#chains in the Genus database with same CATH homology
 3RLO A;  5LMN Q;  2HHH Q;  4P73 A;  4DR7 L;  4LFB Q;  2K5H A;  1K3R A;  1P16 A;  4KHZ A;  4PMW A;  3JAM i;  4GKJ Q;  2KHJ A;  3FKI H;  2VS1 A;  4JI2 L;  1WCM H;  3NEL A;  2ASB A;  4A3B G;  1I3Q H;  1D8L A;  4LUV A;  5C0X I;  2Z0S A;  3CXC A;  5GRO A;  2ZJQ A;  3I55 A;  1N34 L;  4AYB E;  2QA4 A;  2ZJR A;  3STB C;  4DAY B;  1CUK A;  4LFC Q;  1H95 A;  3I4O A;  3M4Q A;  4NXN L;  2ZTC A;  1NY4 A;  2R6G A;  1YHQ A;  1EIF A;  2K14 A;  4OWT B;  3PIO A;  4DR4 Q;  2VW9 A;  4A3J H;  3S14 H;  2DUD A;  2Q2T A;  1L1O A;  2VL6 A;  2R7Z G;  1G51 A;  5C44 G;  2RHQ B;  1PA6 A;  2E2I H;  2K5N A;  3RLN A;  1XPR A;  3CD6 A;  1SN8 A;  1GD7 A;  3CME A;  4JBK A;  4DR6 L;  1VS0 A;  1JJG A;  1OXU A;  2V1C C;  4R1J A;  5IT9 c;  3F2D A;  1K0R A;  4DV3 Q;  2UXB Q;  1TXY A;  2UUB Q;  3CCQ A;  1JJ2 A;  4JI3 Q;  5JJL A;  4UP8 A;  4A3E H;  1QUQ A;  4UP7 A;  5BR8 L;  2GVA A;  2A8V A;  4JI4 Q;  1KXL A;  3ZJY C;  1V9P A;  3K7U C;  1A63 A;  1E22 A;  4OON A;  1YIJ A;  4POG A;  2Q2H A;  2IX0 A;  1L2F A;  1K83 H;  3UE1 A;  1L1O B;  1N32 Q;  3ERS X;  1GKH A;  5C0X J;  3S17 H;  3AFP A;  2CKZ B;  5ELN A;  2KEN A;  1N36 L;  1A62 A;  1K8A C;  3PO2 G;  4XTC S;  4R4Q A;  5JJI A;  4KHP L;  1B8A A;  1PH9 A;  2QGQ A;  3E9H A;  2PI2 A;  3FKI G;  5GAD C;  3CF5 A;  1NTG A;  1PH4 A;  3K8A A;  4PZ7 A;  1WCM G;  1VQD A;  2NZO A;  2IX1 A;  2OTL A;  2ALY B;  1HNW L;  4A3G H;  4AQY Q;  3NEM A;  4R4I A;  3A5U A;  3F2C A;  5IE8 A;  2YU9 H;  2WB1 G;  1Q7Y C;  4B3R Q;  2HIX A;  2XTI A;  5AJ3 L;  5LMU Q;  2JA9 A;  4JI0 L;  4OO1 I;  2B3G A;  1R9T H;  1EQQ A;  4IPD A;  1SRU A;  2JQO A;  2A1A A;  4A3J G;  4GLX A;  1KRS A;  1HZC A;  1EOV A;  3AEV A;  1DGS A;  4JI1 L;  5C4J H;  1HR0 W;  5IYB G;  2LXK A;  3M85 A;  4A3M H;  2YTX A;  4DV1 Q;  1XNR Q;  1G6P A;  4DUY L;  1XPU A;  1BKB A;  1QVC A;  4IJH A;  4QIW E;  3CC4 A;  1VQ9 A;  4LF7 L;  4JBW A;  2MNA A;  1I94 Q;  3RZD H;  3K81 C;  4A3E G;  4R4O A;  3STB D;  5FLX c;  2RHS B;  1W3S A;  4DV6 Q;  1EWI A;  3L7Z C;  3M4O H;  1SR3 A;  2EXD A;  3G4S A;  3CP0 A;  3KFU A;  1YIT A;  1FJG Q;  4IO9 A;  4UPA A;  1S3O A;  2OWO A;  4DR7 Q;  3CAM A;  4A4I A;  1IBM L;  4C2M H;  3KOJ A;  2D62 A;  1XNQ Q;  1YZ6 A;  3KF8 B;  3GTP H;  5IYD H;  4X64 L;  1RIP A;  4DKA C;  5JJK A;  1VQE A;  4OWX B;  2UUC L;  2OTJ A;  3CPF A;  2D0P A;  3CCR A;  3I2Z A;  1VQC A;  1XMQ L;  4IFD G;  2EIF A;  4DV7 L;  3D0F A;  2R93 H;  2VQE Q;  4L5R C;  1VQL A;  5C44 H;  1Q8K A;  4NXN Q;  4A3G G;  4X6A H;  4OO1 G;  1Y14 B;  4R4T A;  4DV0 L;  2C35 B;  1YHB A;  4P71 A;  5C4X H;  4YCV A;  4K0K Q;  4YCW A;  3PO3 H;  4JYA L;  2NVQ H;  4NPS A;  1S72 A;  4DUZ L;  1VQA A;  2JJQ A;  5M5X H;  5IWA Q;  3CW2 C;  1PFS A;  4OX9 L;  5EAY A;  1S40 A;  4H02 A;  5GAH C;  3ICE A;  3S15 H;  3M7N A;  2HT1 A;  4WJ4 A;  1K8G A;  4ALP A;  2VZA A;  1J5E Q;  4DR3 Q;  4JI7 Q;  1C9O A;  2PNH A;  3K7A H;  1I5F A;  1PV4 A;  3CCL A;  4KI0 A;  5BR8 Q;  3HOZ H;  4DR1 L;  1IZ6 A;  2E2H H;  4A3M G;  3PUZ A;  1K73 C;  1K9M C;  3H3V I;  4PG3 A;  5E7N A;  2H5X A;  4BY1 H;  2MQH A;  5J3B A;  2K50 A;  2R7F A;  3W1G A;  2UXC Q;  3OTO L;  1GO3 E;  3KLW A;  3L0O A;  3CC7 A;  3H15 A;  3BZC A;  1UE5 A;  4JBJ A;  4JCV E;  1O7I A;  1HZA A;  4APV A;  2F4V L;  1AH9 A;  2PQA A;  2UU9 L;  3I4N H;  3GD7 A;  1ASZ A;  4B3S L;  1VQ5 A;  1CKN B;  2JK8 A;  3BZK A;  5M3M G;  2RF4 A;  4X66 L;  4X62 Q;  4A3D H;  3I56 A;  3UDF A;  1PH2 A;  1SMX A;  4A3I H;  4LFA L;  4KHP Q;  1MKH A;  3G71 A;  1E1O A;  4GOP A;  4A76 A;  3W1B A;  5IYD G;  1KD1 C;  1HNW Q;  4LF5 L;  4IPH A;  1X56 A;  2K52 A;  3NEN A;  1SLJ A;  5IP7 H;  1YJ9 A;  3AFQ A;  2R93 G;  1X65 A;  4DR2 L;  1Q1E A;  2D0O A;  2PQA B;  4JG2 A;  3CC2 A;  3TRE A;  3B6Y A;  3LGJ A;  3F8T A;  5IYB H;  5C3E G;  3J81 c;  1X54 A;  1HNZ L;  2MFI A;  1OXX K;  1QVG A;  1KQS A;  5C4X G;  4GKK L;  2N78 A;  2Y0S G;  1L0W A;  1BBW A;  3PO3 G;  3OW2 A;  3TS0 A;  2BH2 A;  2JA6 H;  4GOP B;  5GQO A;  3NBH B;  4HJ8 A;  4O0A A;  4GN5 A;  5GAG C;  3JC6 6;  3KJO A;  3M3Y H;  1L1O C;  1NMG A;  5FLM H;  2QEX A;  5LMN W;  4BBR G;  4GNX A;  1JB7 A;  4DUY Q;  4C3H H;  4DPG A;  2ZJP A;  2ATW A;  4TVA B;  2N3S A;  1X55 A;  4OXP A;  4A3K H;  4YY3 L;  3HOZ G;  2F3I A;  1TWG H;  4Y7N H;  4BY1 G;  4JI6 L;  1YJN A;  4LF6 Q;  1A0I A;  2N8N A;  4B3T L;  2B63 G;  1LTL A;  3UDX A;  1WYD A;  1VQ4 A;  3F2B A;  3UE0 A;  1B70 B;  3M4P A;  1AE3 A;  1PH6 A;  1IBM Q;  4QQB X;  4BXX H;  1KIX A;  1NMF A;  3Q8D A;  3I4N G;  3GTJ H;  4GNX B;  4X64 Q;  3GTG H;  2VQF L;  4A3D G;  5LMN L;  2AWO A;  4IFD I;  4DV5 Q;  1KL9 A;  3HKS A;  4A3I G;  1BVS A;  2JA5 H;  5IYC H;  4LFB L;  2KBN A;  1XMQ Q;  1QVF A;  4DAM A;  2HIV A;  1LYL A;  2OQ0 A;  2WAQ G;  2E2J H;  4LF8 Q;  3PUV A;  3RZO H;  2PI2 E;  2IY5 B;  2N49 A;  1NJI C;  3CCM A;  4ME3 A;  4DV0 Q;  4HIO A;  4DR5 L;  1J6Q A;  2Q2U A;  4BA1 I;  3CCE A;  4HJ9 A;  2MO0 A;  5IP7 G;  4JYA Q;  1N9W A;  2JEA I;  2YYZ A;  2BA1 A;  2CFM A;  4JI5 Q;  3CCU A;  3HFZ B;  5M3F H;  4DV2 L;  1IBK Q;  4OX9 Q;  4IPG A;  2JA8 H;  3S2D H;  4MNO A;  4NB3 A;  4YHH L;  3KJP A;  2K5V A;  3HOY H;  2NZH A;  4UY8 C;  1B7Y B;  2L15 A;  3AQQ A;  3CQZ H;  2JA6 G;  3ULP A;  2E5L Q;  4P74 A;  4NXM L;  1Q86 C;  4DR1 Q;  1E1T A;  3A0J A;  1KRT A;  3HKZ G;  5FLM G;  2K75 A;  1WJJ A;  2ZM6 L;  4HJ5 A;  5M3M H;  3GTQ H;  3F1Z A;  4DV3 L;  3PSI A;  1PH1 A;  1VQB A;  2UXB L;  3IRB A;  4JI3 L;  4L5Q A;  3OTO Q;  3ULJ A;  3GTM H;  4A3K G;  4IFD J;  1XMO L;  4JI2 Q;  1PH8 A;  1HR0 L;  1EFW A;  2F4V Q;  5IP9 G;  3CPW A;  1LM0 A;  4B3S Q;  3HOX H;  3S2H H;  1X9N A;  4X66 Q;  4LUO A;  1M90 C;  3ULL A;  1N34 Q;  3SGI A;  1HZB A;  2JEB I;  4L5S A;  4BXX G;  3FP9 A;  4JOI A;  1HNX L;  5C3E H;  4LF4 L;  1NE3 A;  3WWV A;  5ELO A;  4LF5 Q;  5HY6 A;  2UUA L;  3U50 C;  2JA5 G;  4UP9 A;  1Y1W G;  2LXJ A;  5IYC G;  2NVY H;  1FGU A;  4PZ8 A;  1VQH A;  4LUZ A;  3TQY A;  1NBW A;  3H0G G;  4EX5 A;  1VQ7 A;  2A19 A;  2YV5 A;  3KYH C;  4DR2 Q;  3OYY A;  2OCE A;  1QZG A;  1V43 A;  1U0L A;  1JE5 A;  4IPC A;  4AQY L;  3M9B A;  3J7A 5;  1HNZ Q;  4DR6 Q;  4POF A;  4BBR H;  3ER0 A;  1CKN A;  4GKK Q;  3CCS A;  4DNI A;  3T1H L;  4LNQ A;  4B3R L;  1Q12 A;  5LMU L;  5M3F G;  2JE6 I;  3KDF B;  1YJW A;  4X65 L;  2K4K A;  2JA8 G;  3HOW H;  1KAW A;  1OTC A;  3HOY G;  4GLA C;  1MJC A;  3J80 c;  2PMZ E;  3CCJ A;  2B63 H;  2R92 H;  4TQU S;  3PF5 A;  4JBM A;  4HJA A;  1M1K C;  4R4C A;  1JJC B;  1PVO A;  2YTV A;  4PZ6 A;  3I4M H;  4P72 A;  3JAM c;  4YY3 Q;  4JI8 L;  1G29 1;  3K0X A;  4J15 A;  4DK6 C;  3S16 H;  4A93 H;  1IL2 A;  4MTN A;  1N36 Q;  4A3F G;  1PH5 A;  1HH2 P;  4JV5 L;  1Y1V H;  2CCZ A;  1X3E A;  3PUY A;  1HJP A;  4GN3 B;  3S24 A;  4B3T Q;  2AWN A;  3TRZ A;  4KLK A;  2BH8 A;  2E8G A;  3J80 i;  5GAE C;  2ID0 A;  1QZH A;  2WFW A;  3PF4 A;  5DLQ E;  1BBU A;  3HOX G;  4AYB G;  2VQF Q;  1FJG L;  1XTD A;  1CKO A;  1UEB A;  4RG1 A;  4C3I H;  1EIY B;  1PH3 A;  3I7F A;  4O2D A;  2UXD L;  1GVP A;  1XNQ L;  2WP8 J;  5AJ3 Q;  1D7Q A;  4JI0 Q;  1LUZ A;  1IXR A;  2XGT A;  1KC8 C;  3G48 A;  1SFO H;  1JT8 A;  1FVI A;  4HIM A;  4QL5 A;  4GOP C;  4LF9 L;  3GTK H;  2MO1 A;  4DR5 Q;  4BBS H;  4HIK A;  3RN5 A;  2Q2I A;  4DK3 C;  1RL2 A;  1VQO A;  2VQE L;  1N8R C;  3PIP A;  3T1Y L;  1VCI A;  4JI1 Q;  3TEH B;  4QGU A;  4DV2 Q;  4IOC A;  3BU2 A;  1PH7 A;  1IYJ B;  2BA0 A;  2YTY A;  1VQN A;  1WI5 A;  4YHH Q;  1AE2 A;  1IBL L;  4K0K L;  1YHA A;  4LF7 Q;  4GLV B;  4QJF A;  5IY0 A;  1OXS C;  3VDY A;  1TWA H;  4QY7 A;  2GVB A;  4AH6 A;  2Y0S E;  5IWA L;  4HJ7 A;  3S1R H;  3J81 i;  5FJ8 G;  1VQM A;  1VQF A;  1YBY A;  2IHE A;  5IP9 H;  3PUX A;  4NXM Q;  2JA7 H;  3HOW G;  3AYH B;  4L5T A;  2ZM6 Q;  1CKM A;  1C0A A;  1J5E L;  4DR3 L;  3U58 A;  2R92 G;  1XJV A;  4JI7 L;  2I0Q A;  4BY7 H;  4B3M L;  2VY3 A;  4YWL A;  4GNX C;  3MEF A;  4A75 A;  3GO5 A;  5H1S E;  4DV4 L;  2GN5 A;  3I4M G;  1PHJ A;  1XMO Q;  2IHF A;  5JEA J;  1VQP A;  1HR0 Q;  1X3G A;  2FXQ A;  4A93 G;  1P8L A;  1TWF H;  2ZTD A;  4LW1 A;  1N33 L;  2UUC Q;  2VUM H;  1Y1V G;  2RCN A;  2HHH L;  2UXC L;  1Y1W H;  1Z9F A;  2ZTE A;  1OXT A;  5JEA G;  4GKJ L;  3H0G H;  4DV7 Q;  4MZ9 A;  3GDE A;  1HNX Q;  4LF4 Q;  1JMC A;  1UE7 A;  2I5L X;  4X62 L;  1VQI A;  2UUA Q;  3HOV H;  5C0X G;  4LFC L;  1QUQ B;  3J81 j;  3S1Q H;  3E9I A;  4DUZ Q;  1EYG A;  1VQ6 A;  1E24 A;  2WB1 E;  2NVT H;  3S1N H;  3E0E A;  1E3P A;  2WAQ E;  2Z6K A;  3PV0 A;  5M5W H;  3K80 C;  3CCV A;  4DR4 L;  3GTL H;  3DLL A;  4BBS G;  1I50 H;  1T9H A;  1PYS B;  3EIV A;  4Y52 H;  1KHI A;  2IT1 A;  3T1H Q;  1X3F A;  1I6H H;  4JC0 A;  1W2B A;  1Q1B A;  4FDB A;  4OWW B;  4A3L H;  3KF6 A;  4X65 Q;  4A3F H;  3A5Z B;  1TWH H;  2R7D A;  4EQ5 A;  1WFQ A;  2UUB L;  2AKW B;  3A74 A;  3EBE A;  3RR5 A;  2Z6K C;  3HOU H;  3FHW A;  3DM3 A;  4A3C H;  2NN6 I;  3MXN B;  3U4Z A;  2AMC B;  4JI4 L;  4JI8 Q;  2AHO B;  2UU9 Q;  1VQ8 A;  2JA7 G;  1Q46 A;  4YWK A;  4YCU A;  4BA2 I;  3UDG A;  4JV5 Q;  3HKZ E;  4LFA Q;  4LWC A;  4BY7 G;  1N32 L;  1Z47 A;  1U5K A;  4C3J H;  3G6E A;  2F52 A;  2KCM A;  3KF6 B;  2I5H A;  1CSP A;  3U4V A;  2HQL A;  3KDF A;  5HGQ A;  4A3B H;  3CMA A;  1V1Q A;  2VUM G;  4LF6 L;  5M5Y H;  2I5M X;  1WOC A;  1HZ9 A;  1YEZ A;  3UDI A;  1UE1 A;  1MIU A;  1VQJ A;  3PGZ A;  2UXD Q;  2EQS A;  3D31 A;  1YI2 A;  1SRO A;  4GS3 A;  2ES2 A;  1CSQ A;  4JOI C;  3RNU A;  1E7Z A;  3PCO B;  4DV5 L;  4P75 A;  4IOA A;  4LF9 Q;  1C7Y A;  1YVC A;  3HOV G;  3RN2 A;  3PUW A;  2KCT A;  1SE8 A;  2CWP A;  4IJL A;  5FJ8 H;  1TWC H;  1Q81 C;  4LF8 L;  2R7Z H;  4RMF A;  1VQG A;  3T1Y Q;  3GTO H;  2VNU D;  1PYB A;  4HID A;  1A8V A;  1OXV A;  2CQO A;  3L2P A;  1ASY A;  1IBL Q;  1MJE A;  3RLF A;  2LSS A;  2DGY A;  2OQK A;  4XIG S;  3S1M H;  4JI5 L;  3EN2 A;  1Q82 C;  1IBK L;  2NVX H;  4A3L G;  1FL0 A;  2B29 A;  1YNX A;  3J7Z C;  2KHI A;  3TS2 A;  2NN6 G;  3W5O A;  1X6O A;  4AIM A;  4DV1 L;  1XNR L;  1XPO A;  4JI6 Q;  4GN4 B;  1GM5 A;  4WJ3 M;  3H3V H;  1I94 L;  3HOU G;  1UWV A;  3BJU A;  4B3M Q;  2E5L L;  1VQK A;  4A3C G;  4YWM A;  4DV4 Q;  1EUJ A;  1EQR A;  2CWA A;  5K36 G;  4DV6 L;  1UE6 A;  3PO2 H;  1N33 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...