1MJCA

Crystal structure of cspa, the major cold shock protein of escherichia coli
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
69
structure length
69
Chain Sequence
b'SGKMTGIVKWFNADKGFGFITPDDGSKDVFVHFSAIQNDGYKSLDEGQKVSFTIESGAKGPAAGNVTSL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MAJOR COLD-SHOCK PROTEIN 7.4
publication title Crystal structure of CspA, the major cold shock protein of Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription regulation
total genus 12
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 1994-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1mjcA00
3CAMA 3M9BA 1FGUA 1HNXL 4DV0L 2UUBQ 4JI1L 2JA6G 3TS2A 3S2HH 4O2DA 1WJJA 4OWTB 2ZM6L 2A8VA 3HOVG 3DM3A 2GVBA 2VUMH 5M5XH 4YHHL 1Q86C 4P73A 1BVSA 4GNXA 4C2MH 1VQAA 4DV3L 1UE6A 4HIMA 2OTLA 3STBC 5IYBG 3M7NA 1NY4A 1L1OA 3CPWA 2E2HH 4A3BG 4YWKA 3RN2A 4HJ9A 4OONA 3FKIG 2NVTH 4B3RL 4BBRG 3GTPH 5C4XG 1TXYA 3PO3H 3RZOH 3HKZE 4P72A 3RLNA 5M5WH 4A3KH 4BXXH 3GTKH 1GKHA 1X54A 1YEZA 3T1YQ 3ICEA 1NMGA 4JBMA 3I4NG 4LF8L 5E7NA 1WOCA 3STBD 3T1HL 1Q1EA 4NXML 4GOPA 1N8RC 2LXJA 1D8LA 3HOWH 1JJGA 2Y0SE 3GTGH 4PZ6A 2QEXA 3M85A 2AKWB 4YWMA 2Q2HA 5BR8Q 3RN5A 3HOYG 3J7A5 4ALPA 2ZTCA 3TEHB 1A8VA 3ULPA 3IRBA 1B70B 4MZ9A 2MO0A 4OWXB 3WWVA 4DAYB 3CCSA 3L7ZC 1Z47A 3J81c 3G4SA 4DV1Q 2ES2A 1FJGQ 4BA1I 4J15A 1E1OA 4DK3C 2R7ZH 2VNUD 3CXCA 3KJOA 4UY8C 2R92H 1V1QA 3K81C 2YU9H 1PYSB 2K4KA 1I5FA 2C35B 3W5OA 3DLLA 4GNXB 1TWCH 1LM0A 4AQYL 1U0LA 2YV5A 3F2CA 3KF8B 4DR1L 1X3EA 2PMZE 2HQLA 5IP9G 4X64L 1L1OB 3ZJYC 4IJLA 4JI0L 4DR7L 2DGYA 3KDFA 4LFBL 1B7YB 4DUZL 1PH4A 5FLXc 1XMOL 2RCNA 1AE2A 1NMFA 1SR3A 1BBWA 3KLWA 3NEMA 2PQAA 3D31A 5IE8A 3GTLH 4A3DG 4ME3A 2CWPA 5LMNW 1OXTA 3HOUG 2D0OA 1HZBA 2KCTA 3CCJA 4NXNL 2GVAA 1EQQA 2NZOA 1HNXQ 5AJ3L 4JI1Q 1YJWA 4IJHA 3J81i 4JG2A 1K8AC 4A3MG 4LF5Q 1TWFH 4AIMA 4POGA 4GOPB 4YHHQ 3PO2H 1A0IA 2EXDA 1SN8A 2A19A 1K73C 4L5RC 4OWWB 5IYDH 3OW2A 3PCOB 2R6GA 2UXBQ 2OTJA 1N32L 3G71A 2JQOA 5C3EG 2JA8G 1CSPA 1VQLA 2UXCL 1KHIA 2UU9L 2OCEA 4YY3L 4B3RQ 4GLAC 4R1JA 2IT1A 2CQOA 3PUVA 2PI2A 2K75A 1PH2A 4IOAA 2R93G 3UDFA 3PUYA 5J3BA 4JI6Q 5LMNL 2AHOB 4AYBG 1IBLQ 2QA4A 4X62L 3UDGA 4LF8Q 1QUQB 3T1HQ 1TWGH 1PH6A 1TWHH 2QGQA 1FL0A 1WYDA 4DUYL 1PH3A 1B8AA 4A93G 5LMUL 1YI2A 1EFWA 4WJ3M 4DV2L 1QVCA 2PQAB 1A63A 2YTVA 5M3MH 1XMQQ 1JJCB 1GM5A 3RZDH 2CCZA 2OQKA 1J5EQ 1YNXA 1PHJA 2HHHQ 1HZCA 2VQFL 1E7ZA 3I2ZA 2E2JH 2JA5H 4B3SL 1XNQQ 2FXQA 3A5UA 3CCUA 4JI3Q 1OXUA 3H0GH 3GTJH 2F4VL 2YTYA 3M3YH 1N9WA 4AQYQ 1R9TH 2B3GA 5H1SE 1M90C 1WI5A 1A62A 1W3SA 2I5HA 1Y1WH 4UP7A 1VQKA 3KJPA 3JAMi 1Q81C 4DR7Q 3S1RH 1VQ8A 1K83H 5FLMG 1DGSA 3I7FA 1PH9A 1XMOQ 3BZKA 3J80c 2Q2UA 1N33L 2E5LQ 3UDXA 4BBSH 1N34L 2UUAL 3I4MH 3PSIA 4A3LG 2VW9A 2E8GA 4X66L 4GKJL 4BY1H 4JI4L 4NXNQ 4JI2Q 1ASYA 5AJ3Q 3MEFA 3NBHB 4DV6L 4A3EG 4A3IG 2NN6G 4OXPA 4RMFA 3PIPA 1C0AA 3G48A 1Y14B 1ASZA 4DV5Q 5IT9c 2OWOA 4LUZA 3ULJA 4OO1G 4LF9L 4WJ4A 3OYYA 1WCMH 4JI5L 1N32Q 1VCIA 3HOXH 3I56A 1M1KC 3M4QA 5GADC 1JB7A 2ID0A 3A5ZB 2BH2A 1I94L 2JJQA 4PG3A 1EWIA 1XTDA 2F52A 4BA2I 3RR5A 1Z9FA 2R7FA 3PUWA 1KD1C 4DK6C 3S2DH 4A76A 2V1CC 1Y1VG 4HIOA 4JI8L 1HNWL 4JYAL 1RIPA 2WFWA 1VQEA 2N3SA 2D62A 1UE1A 3H3VH 3LGJA 1VQCA 2KHIA 4YWLA 5C44H 4HJAA 2D0PA 2JA6H 4DR2Q 4JC0A 3I4OA 3HOVH 1BKBA 4IFDI 1VQIA 3HOZG 1PH5A 2VUMG 1Q46A 2WB1G 1XJVA 1SFOH 3HOWG 1PFSA 4QGUA 5LMUQ 2DUDA 3F2BA 4DV2Q 1HR0W 1YHAA 3L0OA 4JBJA 4JOIA 4LFCL 1VQFA 4C3IH 4QQBX 2KHJA 3ERSX 3OTOL 5C4XH 5FJ8G 4APVA 2VQFQ 4XTCS 1JJ2A 4B3SQ 4R4TA 1JMCA 5GROA 5C0XG 4A3KG 2F4VQ 1VQGA 3NENA 4B3MQ 4L5TA 3PF5A 1MJEA 3AEVA 3G6EA 4GS3A 2Z6KC 4FDBA 4KHPL 2Q2TA 2K5NA 1YHBA 3I4NH 4IPGA 4DR4Q 5K36G 4DR5L 1V9PA 3ULLA 4DKAC 1E22A 4XIGS 3PUXA 3F8TA 4A3FG 1HNZQ 1QZHA 4IPHA 1K0RA 2VQEL 4JV5L 1N33Q 3BJUA 1PH1A 3KYHC 4A3GH 1N34Q 2IY5B 2UUAQ 1X6OA 1XNRL 2H5XA 1VQNA 1GD7A 4X66Q 1HR0L 4R4OA 2JK8A 3Q8DA 1IBML 3CC2A 1NE3A 4DV6Q 3PF4A 3CQZH 1CSQA 2K5VA 4TQUS 2VY3A 2Y0SG 4DV7L 1HJPA 2EQSA 1X9NA 1N36L 2R92G 4BY7G 1D7QA 1C9OA 5GAGC 1YIJA 1E1TA 3EIVA 5JJKA 3KOJA 1I3QH 1CKMA 2UXDL 4QY7A 2JA7G 4DR6L 4DV0Q 2ZJRA 2MFIA 4GN5A 1HZ9A 4GNXC 2ZM6Q 4HIDA 1UEBA 3D0FA 3K7AH 3GDEA 1S40A 1PH8A 1L1OC 1XPUA 3K8AA 3H3VI 1SRUA 3UE0A 4JI8Q 3F1ZA 5IWAL 4LW1A 4DV3Q 1EIFA 1HH2P 3E9HA 3S24A 1U5KA 3S17H 4K0KL 4LF7L 3PO2G 4PZ8A 5IYDG 3U58A 4H02A 3W1BA 1MKHA 4AYBE 5M3FH 2Q2IA 4GOPC 4LFCQ 2NVXH 3RLFA 3OTOQ 3BU2A 1AE3A 4NXMQ 2B63H 1NJIC 1IYJB 3FHWA 3KDFB 5IYCH 4YCVA 1XPRA 4HIKA 2BA1A 2MQHA 4LUOA 4LUVA 3GO5A 1KRTA 1OTCA 3CCLA 4B3TL 4UP9A 4GKKL 4RG1A 4DR5Q 2CWAA 4JBWA 2E2IH 1EYGA 1VQ5A 2IX1A 1EOVA 2VQEQ 4JV5Q 3HFZB 1X56A 3S14H 5IP7H 3H15A 3UDIA 1Q12A 3CP0A 4MTNA 1HR0Q 1NBWA 4A3CH 5GQOA 4DR1Q 2KBNA 1MIUA 4KHZA 3K0XA 4X64Q 1IBMQ 1FVIA 1PVOA 4JI0Q 2NVYH 3EN2A 1I6HH 2AMCB 1T9HA 4X6AH 4HJ7A 4LFBQ 5GAEC 5ELOA 4DUZQ 4DV7Q 4P71A 3NELA 3GD7A 4C3JH 5ELNA 2ZJQA 2XTIA 2CKZB 4DNIA 4JCVE 1KXLA 3AYHB 2N78A 4TVAB 2UXDQ 1UWVA 1Y1WG 4JI7L 1H95A 3FP9A 2YYZA 1JT8A 4C3HH 5C4JH 4DR3L 3S16H 1O7IA 4QL5A 3GTMH 1BBUA 2YTXA 4DPGA 5BR8L 5JEAJ 4BBSG 4A3LH 2I5LX 3I4MG 5IWAQ 3S1MH 3CD6A 3VDYA 4IO9A 1PA6A 4R4IA 1EIYB 4X65L 1PYBA 4NPSA 2I0QA 4IOCA 1X3GA 4A3IH 1E3PA 4GLXA 2UXCQ 1YHQA 2UU9Q 2VL6A 2IHFA 4YY3Q 1GVPA 1QVGA 3J80i 3E0EA 2BH8A 3A0JA 5JJLA 4KLKA 4A3JH 1I50H 2JA9A 2KENA 5LMNQ 2ZTDA 4P74A 4NB3A 4X62Q 1OXSC 3CCEA 2F3IA 1KL9A 2ZTEA 2WB1E 4DUYQ 1Y1VH 4LWCA 2WAQG 1X3FA 4B3TQ 2WP8J 3MXNB 2K52A 5IYBH 4A3BH 3J81j 1YZ6A 1YITA 4LFAL 5C44G 3S1QH 1OXVA 2AWNA 1G51A 1RL2A 4LF5L 2L15A 3FKIH 2K5HA 1K9MC 3HOZH 4BBRH 2R7DA 2MNAA 1YJ9A 4LF4L 1KIXA 2ALYB 3BZCA 3PO3G 2AWOA 1GO3E 2UXBL 4BXXG 4GLVB 4A4IA 3I55A 1J6QA 3L2PA 2ZJPA 1KAWA 5HY6A 2RF4A 2ATWA 3RLOA 1X65A 1E24A 5FJ8H 4UPAA 3CC4A 1YVCA 1CUKA 3AFPA 4L5QA 1LYLA 2HIVA 3K7UC 2OQ0A 3HKZG 4YCUA 3CCRA 1VQMA 1C7YA 4LF6L 4LNQA 3K80C 3HOYH 2LSSA 4JI6L 2JEAI 2I5MX 2KCMA 1IBLL 3CCVA 4GKJQ 3JC66 2IX0A 3UE1A 5JEAG 4JI4Q 4JI7Q 4IFDJ 4DR3Q 3E9IA 2ASBA 3U4VA 4A3FH 2B29A 1PH7A 4GN3B 2R7ZG 4Y52H 1S3OA 4A3GG 2VZAA 1Q1BA 1OXXK 2HIXA 3U50C 5HGQA 4LF9Q 1XMQL 2NN6I 4JI5Q 4JBKA 5EAYA 1V43A 1K3RA 4PMWA 5IP9H 1J5EL 4X65Q 3CMEA 4HJ5A 1P16A 2K14A 2HHHL 3GTQH 2N49A 1K8GA 3PIOA 1I94Q 1X55A 4OO1I 1Q7YC 1XNQL 1CKNA 2NZHA 4JI3L 4BY7H 4KI0A 3KF6A 4A3DH 4QIWE 4Y7NH 3TS0A 1LUZA 2RHSB 3HOUH 1HNWQ 4JYAQ 4OX9L 1QUQA 2XGTA 3W1GA 2JA7H 3CMAA 1KQSA 3EBEA 2N8NA 2NVQH 4A3MH 4L5SA 2VS1A 1VQPA 2E5LL 2HT1A 4JOIC 1KC8C 1S72A 5IY0A 1SROA 1SMXA 3M4PA 5C3EH 4EX5A 2JA8H 4JI2L 1JE5A 4DAMA 1YBYA 1XPOA 1G6PA 4LFAQ 3RNUA 2MO1A 3TRZA 3CW2C 4A3JG 3ER0A 4DV4L 4PZ7A 3PUZA 4IPDA 1IBKL 1EUJA 3B6YA 3HKSA 2UUCL 4LF4Q 4DV5L 1NTGA 4MNOA 2IHEA 2R93H 3TREA 1VQ6A 1VQ7A 3CCQA 1IZ6A 4GN4B 2UUBL 5M3FG 3GTOH 4KHPQ 1PV4A 2K50A 1QVFA 5C0XI 1HZAA 2RHQB 4HJ8A 4R4QA 2JE6I 2PNHA 3CF5A 4P75A 2B63G 5DLQE 1IXRA 5JJIA 4LF6Q 1QZGA 5IYCG 4A93H 1VQOA 1CKNB 1MJCA 1W2BA 1VQDA 2CFMA 4IFDG 1VS0A 3KF6B 4IPCA 1XNRQ 3M4OH 5M3MG 2BA0A 1AH9A 4DR2L 3JAMc 1VQJA 3CC7A 1VQ4A 3J7ZC 1L2FA 1UE7A 1VQHA 2LXKA 4UP8A 2JA5G 1N36Q 1EQRA 3AFQA 3T1YL 3H0GG 3S15H 5IP7G 3CCMA 4QJFA 1VQ9A 3A74A 5GAHC 1L0WA 2PI2E 4A3CG 2JEBI 2GN5A 3TQYA 3F2DA 1YJNA 3KFUA 4DR6Q 1Q8KA 2Z0SA 4EQ5A 3AQQA 5FLMH 4A75A 4GKKQ 3S1NH 1TWAH 4B3ML 1P8LA 1IL2A 1WFQA 1G291 1CKOA 4DR4L 4OX9Q 1KRSA 1SE8A 1Q82C 5C0XJ 4BY1G 2Z6KA 4A3EH 4DV1L 3PV0A 1HNZL 1FJGL 2EIFA 1LTLA 4R4CA 3CPFA 4O0AA 4LF7Q 4K0KQ 2A1AA 4AH6A 1WCMG 1VQBA 3HOXG 3SGIA 5M5YH 4DV4Q 1UE5A 1IBKQ 2UUCQ 3U4ZA 3PGZA 2WAQE 1SLJA 4POFA 4YCWA
chains in the Genus database with same CATH superfamily
1HUMA 3CAMA 4DAYA 2L4NA 3TS2A 3S2HH 1EY5A 1STGA 3DM3A 5J1ZA 1Q86C 1Y1VB 4V0BA 4GNXA 1STAA 4C2MH 1VQAA 5IYBG 3KUPA 3CPWA 4A3BG 3RN2A 4HJ9A 3FKIG 3LX0A 3PO3H 3HKZE 3IKJA 3ICEA 1NMGA 5K36H 5EQ0A 3KLSX 3E5SA 5JVH3 1Q1EA 4PMCA 4GOPA 2LXJA 5ELDA 5LL6X 3M85A 2Q2HA 5BR8Q 3HOYG 2XRSD 2K01A 3DWAA 1WTVA 1I4HA 4MZ9A 1B70B 2MO0A 1FNVA 2NB0A 3CRKC 4DV1Q 4WRDA 4B9XA 4BA1I 2R7ZH 2NZ1D 1PYSB 1I5FA 4H0LC 2K5WA 3W5OA 1TWCH 1LM0A 3KF8B 2AUJD 2PMZE 1TVXA 2HQLA 4DR7L 1L1OB 4IJLA 4FF4A 2DGYA 4K8JA 1S5DD 4DUZL 2M9VA 4N9PA 1WD0A 1NMFA 1SR3A 3NEMA 2PQAA 3D31A 4Y7NB 3HOUB 2CWPA 2WIIB 2KCTA 2Z6BA 2Z8LA 3CCJA 1NCVA 4IJHA 1O80A 3J81i 2NVQB 1NNXA 2F0TA 2MP1A 1JE4A 4AIMA 4QIWB 2F0JA 2A19A 3T16A 5IYDH 2JA8B 5C3EG 4NDXA 4YY3L 1BUVT 3PUVA 2R93B 1V8QA 3VA5A 5FOBB 5J3BA 1F9RA 4LF8Q 3T1HQ 4OIKA 1FL0A 2ZT9C 5D65A 1B8AA 5LMUL 4DV2L 2FMMA 1JOOA 4ZAIA 5M3MH 1GM5A 2OQKA 4ZK9B 2P5ZX 3MHBA 1D2BA 1EY8A 2JA5H 1E7ZA 1F9QA 3I2ZA 4JI3Q 2F4VL 3S15B 1U4LA 3M3YH 2CW0C 4AQYQ 1R9TH 4CGYB 2B3GA 1SNCA 1A62A 1NR4A 1Y1WH 2PW7A 3MEHA 3MA2B 1Q81C 3BS1A 1TS2A 1SE2A 5FO7B 5EBDA 2XVSA 3MXNA 2ENBA 2UUAL 1M4VA 1R9TB 2RQXA 2E8GA 2RKSA 4JI4L 4JI2Q 4KV6A 3MEFA 5KNBA 4OXPA 3PIPA 5TSSA 2A6HD 1Y14B 2CVRA 3OPOA 4DV5Q 3ULJA 4WJ4A 4LF9L 3HOXH 3VR2A 3A7AB 2BH2A 2ID0A 3C2PA 1EWIA 3OIPA 3K0YA 3PUWA 1CFMA 4DK6C 1HNWL 4X6AH 4JYAL 2N3SA 1RHPA 3I90A 2JA6H 4YWLA 5NUCA 1RTNA 3I4OA 1RJTA 3HOVH 4IFDI 4CDCC 1XJVA 3LWEA 2K33A 2OT2A 3L0OA 4JBJA 1H9KA 2EYJA 1VQFA 4C3IH 4QQBX 1G8ZD 4Q5VA 3D4DA 3ERSX 3OTOL 3GTPB 4APVA 2F0PA 1FNWA 1G2SA 3NK9A 5M5WB 1JMCA 4Q0FA 2JSOA 4A3KG 1VQGA 3NENA 4L5TA 3QO2A 1RDPD 1BO0A 4RKLA 4GS3A 3AEVA 4KHPL 3I4NH 1V9PA 3GTGB 3PUXA 2VQEL 2F0QA 4JV5L 3BJUA 3KYHC 2EPBA 2IY5B 1XNRL 1HR0L 3D6WA 1KLUD 2JK8A 1IBML 1NE3A 3NPPA 5E3FA 2Y0SB 4K5XA 3C46A 2R3ZA 2I46A 2EQSA 2R92G 1DOKA 4CDFC 5JJKA 5CBAE 4QY7A 2B8GA 5JOBA 2JA7G 1QNKA 2K6AA 1S40A 3UE0A 3F1ZA 5EPLA 1WTPA 1HH2P 3D8GA 2PQEA 4HCSA 2EJMA 2F0VA 4K0KL 4N9TA 1F2LA 1HPCA 4ABNA 4LFCQ 4TSSA 4U68A 3RLFA 2B63H 4NXMQ 1NJIC 2B2WC 3KDFB 4DK1A 4HIKA 1LABA 4LUVA 1OTCA 3GO5A 4UP9A 3T13A 1GJXA 4DR5Q 5D3DA 2CWAA 1FR3A 3MWYW 4JBWA 3TZUA 4CHTB 1H9RA 5FK9C 2SOBA 1EOVA 2XSCA 3HFZB 3IFTA 1LTTD 3H15A 1Q12A 3CP0A 2QDBA 4CJ0B 4RKBA 1MIUA 4KHZA 4DFAA 1PVOA 4HJ7A 4LFBQ 4DV7Q 3GD7A 2FFKB 4C3JH 1A3VA 4DNIA 3SXHA 2DY8A 2L1BA 2CW0D 4FXDA 2J7ZA 3S16H 1E2ZA 3R2TA 2X6GA 4C3JB 1KDAA 3K6OA 5IWAQ 3CD6A 3OWEB 4X65L 4OL7A 5KNCA 4IOCA 2UXCQ 5CV4A 1MGSA 2IHFA 1OO9B 1EZ6A 1GVPA 1QVGA 3X3NA 2BH8A 3BDLA 3A0JA 5KEEA 3A56A 5LMNQ 4ID6A 2ZTDA 2F3IA 2WB1E 4DUYQ 1XX8A 4LWCA 5BN5A 5IYBH 1U9RA 2K52A 4ZKCB 4A3BH 3S1QH 1YZ6A 1YITA 5C44G 2KA7A 2L15A 3FKIH 3HOZH 3QJYA 3J80E 2R7DA 3SDZA 3ITPA 4LF4L 1SFOB 4EGVA 3PO3G 4A4IA 3I55A 2A69D 3E3XA 2F1MA 2KOLA 3MXPA 3FKIB 3RLOA 1X65A 1Q8IA 3M4YA 5FJ8H 4UPAA 4K2LA 4L5QA 1MD2D 3HKZG 3CCRA 5IT9E 1VQMA 3NWTA 5KNDA 4LNQA 3HOYH 1QWYA 4JI6L 2F0SA 2F3VA 3JC66 4IFDJ 4DR3Q 2EVBA 4A3FH 3NTIA 2B29A 2R7ZG 3HOYB 4A3GB 4RFBA 4ZLTF 2HIXA 5HGQA 4WJWA 2NN6I 4JBKA 1V43A 1K3RA 1F2ZA 1P16A 4HJ5A 3CQZB 1I94Q 1Q7YC 2F3WA 1F2YA 3HEJA 1XNQL 1QJOA 5G3LD 3OOCA 4I7AA 1DXMA 3K57A 2RHSB 1KQSA 1SNQA 1RD9D 2N8NA 4L5SA 4IUTA 1KABA 3SK4A 3K7AB 1KC8C 3J80L 4X3UA 1SMXA 5C3EH 2N55A 4EX5A 4ZKBB 4DAMA 1V1PA 4MTKA 4LFAQ 2K1BA 3TRZA 2HUGA 1EUJA 1X3PA 5CORA 4UHVA 3P75A 1NTGA 1STNA 5JVG3 4B08A 5M3FB 1IZ6A 1SJED 5I4DA 3GTOH 1Z7TA 3K5LA 5C0XI 1HZAA 5C4HA 5DLQE 1B3QA 1CKNB 1MJCA 2GA4B 2FINB 1CM9A 3KF6B 1BXTA 3TP8A 4HR7B 3H6MA 4NMZA 2F0LA 5M3MG 1AH9A 4DR2L 4ZCKA 3OSOA 2E2IB 1A6XA 1PTOB 3P7JA 3HS0C 1UE7A 2LXKA 2JA5G 1CTMA 2D9UA 1I6VC 3VR5A 2EDGA 1RODA 3F2DA 1YJNA 3KFUA 3Q23A 2AQ3B 2Z0SA 3TP6A 1ICFB 1TWAH 1S5ED 1IL2A 1IHZA 4UDUC 1SE8A 1Q82C 2J0TD 5IODA 4CJ2C 1HNZL 3TN2A 2EIFA 3X3MA 1LTLA 4R4CA 1HTPA 2K03A 3FVQA 4O0AA 4N8X1 4R8IA 4RHSA 1E0BA 4AH6A 3S1MB 2E76C 1LTSD 3HOXG 1CA5A 1BDOA 1IBKQ 3I91A 2UUCQ 3OW7A 1K28A 2WAQE 3U50C 1YNJD 3G6EA 4A3JB 3M9BA 4DV0L 1II3A 2JA6G 1WJJA 4HTHA 4OWTB 2ZM6L 1PDQA 3J7YW 3HOVG 4OHJA 2GVBA 4YHHL 2K5QA 1UE6A 4C3IG 1TKWB 2WKDA 4OONA 1YNNC 2NVTH 4BBRG 3SHLA 2XWBB 2H4OA 4A3KH 1ML0D 5CGKA 1BQQT 5FO8B 1EL0A 1LTBD 3GP7A 4JBMA 3I4NG 4UAIA 5E7NA 1WOCA 3STBD 1N8RC 1M8AA 1B4OA 4PZ6A 2AQ1B 1G6ZA 2I07B 2DJGC 2AKWB 3BDOA 4O1NA 1RCVD 2B2WA 2ZTCA 3TEHB 1A8VA 1TS4A 3QOJA 3NWSA 1SAPA 4DAYB 2OF1A 3G4SA 1E1OA 4IUVA 1IYVA 2R92H 1NUCA 2YU9H 4H13C 2C35B 3MTSA 5AFWA 4GNXB 2YV5A 4DR1L 1BF4A 3ZJYC 3GTQB 1B7YB 5FLXc 1XMOL 2RCNA 1S4ZA 2YU9B 1AE2A 4A3DB 1BBWA 5T1GA 1I4RA 5LMNW 1OXTA 5IGBA 2JA7B 4NXNL 3UI2A 1K3BC 4RA8A 5M9OA 4JG2A 1K8AC 1BCPF 1TWFH 4GOPB 4OWWB 2EY5A 5DM73 2R6GA 4I65A 4R9WA 2UXBQ 4KKUA 1XWEA 1PRTB 3EFXD 2IT1A 3MZ5A 4AYBB 1S5BD 1QUQB 1TWGH 1PH6A 1HA5A 1TWHH 2QGQA 4BS9A 1PH3A 1EOTA 4A93G 1DM0B 3U9SA 1QVCA 2PQAB 1JJCB 1PZID 1EQVA 2RSNA 1J5EQ 2HHHQ 1HZCA 2VQFL 5EKIA 4RGMA 3H0GH 1HFNA 5H1SE 1W3SA 1K8MA 2KEDA 1VQKA 4UP7A 3QIAA 2A6HC 4DR7Q 4TKOB 1VQ8A 1K83H 1ZXTA 3FRPB 3I7FA 3S1NB 3BZKA 1C48A 3UDXA 1LO5D 2K05A 1LTRD 1N34L 1EIGA 1PFMA 2SDFA 1ET9A 1UEAB 3IFDA 4KY5A 4X66L 1ENAA 1MSHA 4K6DA 4GKJL 4BY1H 3MAQA 1EY6A 3FEWX 3OIQA 1F77A 4A3EG 1D1KA 1QOHA 5ELFA 2NYZD 1ASZA 4ZRZA 4LUZA 2HCCA 1WCMH 1QCBD 5IIFA 4IUNA 3JAME 1JB7A 3A5ZB 5M5YB 4HSPA 4PG3A 5I2XA 1XTDA 1EY0A 5E1FA 4FYDA 1KD1C 1AEXA 4A76A 4HIOA 4RAUC 2WFWA 3I4LA 2QILA 2D62A 3H3VH 2RDGA 1VQCA 4EQOA 5C44H 3S2HB 3IL8A 2D0PA 2EY1A 3D4WA 4JC0A 1JWUD 1VQIA 3HOZG 1VMPA 2VUMG 2WB1G 3T53B 2LMCB 4C2MB 5LMUQ 1NR2A 2DUDA 4DV2Q 2ICEC 4XQQA 5FJ8G 4XTCS 1A2UA 3PO3B 5GROA 1JOQA 1YNND 3DWPA 2F4VQ 5CC4A 2Z6KC 5EPJA 4DR4Q 3ULLA 2H1EA 1DJRD 1E22A 1U4PA 2WKCA 3HKZB 4A3FG 4IPHA 1EY9A 5EJWA 1U4MA 1SNDA 1VF7A 2UUAQ 1STYA 2H5XA 3I3CA 4L8JA 3CC2A 1D1IA 3JAML 2R7ZB 2Q8RE 1CZGA 4FNFA 1JQYD 2QW7A 4CBVA 1YIJA 1TWCB 3EVQA 4RWSC 2UXDL 2KVMA 2QCPX 4ULLA 2FMCA 3NTKA 2ZJRA 1HZ9A 1K8OA 5EBCA 4XT3B 2JP1A 3O13A 1PH8A 4QUFA 4DV3Q 1JORA 2KCNA 1H9SA 4J8QA 4QB4A 1U5KA 2ZXOA 2B8FA 1ZEQX 1PFBA 3PO2G 1NSNS 3NUCA 3T51B 1D6EC 1HFGA 2R61A 2NVXH 3OTOQ 1O7YA 1SYFA 4YCVA 1XPRA 2MQHA 4B3TL 3CCLA 1LTID 4KN4C 2IW3A 1EYGA 2VQEQ 4JV5Q 1CHPD 3EJIA 3S14H 3P20A 4MTNA 4R8NA 5M3MB 1HR0Q 4CKEA 5I6YA 5GQOA 2KBNA 1JR0D 1TS3A 3K0XA 4X64Q 4KJNA 1IBMQ 4JI0Q 2NVYH 2IPKD 2EYMA 2AMCB 1T9HA 1B44D 2RBMA 3EN2A 1B9MA 2JA5B 4P71A 3S14B 3M3YB 2C9OA 2M00A 4WFN3 2XTIA 1PZKD 3GV3A 2PCFB 4K8IA 2N78A 4TVAB 1Y1WB 3DMUA 2NVYB 3TBIB 4C3HH 2F03A 3GTMH 3SK6A 3EROA 1BR9A 5BR8L 4BBSG 5ISRA 4A3LH 1F9SA 3BYYB 1PZJD 3BG3A 3DWQA 1EIYB 3Q0AA 1YHQA 1Q3LA 2UU9Q 4XT1B 4K5VA 3J80i 1WTXA 4OO1H 1UUPA 4KLKA 4FO2A 5KRUA 4X3SA 1I50H 3HOXB 3QOLA 4C56C 4P74A 3QG1A 4NB3A 4X62Q 2QEJC 1KL9A 1TS5A 2A69C 2G5DA 2MHVA 4LK1C 2WAQG 1X3FA 4JK1C 3AB9A 4YIJA 2LKVA 2JA6B 1OXVA 2AWNA 1G51A 1RL2A 3HOVB 5CMDA 4BBRH 2RA4A 2ALYB 2AWOA 1CQVA 1GO3E 3SEBA 3SK5A 4EVOA 1J6QA 4C3IB 3R3OA 1PYWD 3L2PA 2RF4A 3NHHA 1E24A 3F2UA 1YVCA 3Q24A 4YCUA 3K7UC 2OQ0A 2EJFC 1C7YA 1EU3A 2KCMA 5JJZA 3I4NB 4RCNA 3HP3A 5JEAG 4IUQA 1VMCA 3E9IA 2RDFA 1A3TA 3NSWA 4GN3B 3ND9A 1OXXK 4JI5Q 4X65Q 3CMEA 2K14A 5L37A 3PIOA 1X55A 4JI3L 1LT5D 4BY7H 3TS0A 2WACA 1LUZA 4OX9L 2XGTA 3CMAA 4ZUJA 1CT1D 3ZYYX 2VS1A 2KECA 3TP5A 4ZQ3A 1SSOA 2TMPA 1S72A 3LNNA 4JI2L 3SE0A 1TU2B 1O7LA 1G6PA 1A2TA 3KBXA 4PZ7A 3PUZA 3PMFA 4HAEA 3HKSA 4LF4Q 4DV5L 4MNOA 1ZYRC 4KY6A 1VQ7A 2UUBL 4GN4B 5JPNC 1QVFA 2FHTA 2B63B 4R4QA 3CF5A 4KD3A 1IKMA 1Q90A 4A93H 1VQDA 1VS0A 3M4OH 2IX3A 2KJXA 1SYEA 3J7ZC 1EYCA 1N36Q 2K32A 3H0GG 3T1YL 3A74A 2PI2E 1R4PB 1T5XD 4DR6Q 1Q8KA 1ONLA 4A75A 3ND8A 1P8LA 3FPUB 1STHA 2G9DA 1KRSA 4BY1G 1XYIA 3S16B 2Z6KA 3A54A 4A3EH 1LLRD 1JB3A 1FJGL 2L12A 1YNJC 1ZKOA 4LF7Q 2O4XA 4K6LA 1BNZA 4DXGA 4HN7A 4DXFA 1WCMG 2X6LA 1VQBA 3QB3A 3SGIA 1RKNA 4ME5A 2KEEA 1SYDA 1BBXC 1QNUA 3U4ZA 1JC7A 1SLJA 3GTKH 4GKKQ 1FGUA 1HNXL 1EYDA 4JI1L 4O2DA 2LY7A 1VF5C 2VUMH 1HRJA 1EZ8A 2IJ0A 1SYCA 3GTKB 2OTLA 3STBC 4A3BB 3S1QB 4ZUIA 5K5PA 3HOZB 1IW7D 4B3RL 4MIUA 5G3LF 2VUMB 2WB1B 1G91A 1TXYA 5LHY1 3BDCA 4LMQD 3RZOH 2CQAA 4BXXH 1DD2A 1YEZA 2O5IC 1DOMA 3GV6A 4KY7A 1SNPA 2B2UC 3MFYA 4S3SA 1MI2A 4NXML 3N6RA 3V96A 1D8LA 3HOWH 3TZDA 1LT4D 4YWMA 2BOSA 5C5LA 4RGNA 3BVGA 3WWVA 3CCSA 3ULPA 3S9WA 1GUGA 3J81c 1EFID 4A3FB 4J15A 1AW7A 4UY8C 3KJOA 5KYLA 1V1QA 3K81C 2B2YC 4HEDA 4M1UB 2A68C 1U0LA 3F2CA 5E4XA 1EYAA 5IP9G 1S5CD 3KDFA 4LFBL 1ICWA 3K5OA 2J4XA 2PPBC 2LS01 3KLWA 3GTLH 1SNOA 3HOUG 1HZBA 3C1EA 1EY7A 1L0XB 2GVAA 2NZOA 1EQQA 5AJ3L 1YJWA 4IN3A 4A3MG 2EXZA 4LF5Q 4L63B 4POGA 4YHHQ 3PO2H 1A0IA 2EXDA 1SN8A 2Z4HA 2SNMA 3PCOB 2OTJA 4G7HC 1N32L 5C3EB 4OEMB 2KQ3A 1LT3D 3G71A 1EWHA 2JA8G 1MBYA 2UXCL 2E74C 1MHWC 3A8IE 1KAAA 3PO2B 4H7BA 2O5JC 2PI2A 4IOAA 1PH2A 2R93G 2PZUA 1HQMC 3PUYA 3DEPA 5LMNL 3L3OC 1IBLQ 3GTOB 1ZYRD 2QA4A 3UDGA 2EYFA 1WYDA 3G7LA 4DUYL 2HDLA 3DM1A 1YI2A 1PRTC 3A7LA 4WJ3M 1A63A 2YTVA 4PNYA 4FP5D 1XMQQ 3RZDH 5EKLA 3R2IA 4KD4A 4B3SL 2FXQA 1OXUA 3GTJH 1S5FD 2YTYA 1N9WA 2V4DA 3A55A 1GUWA 4DAVA 3RZDB 1M90C 1WI5A 2I5HA 3JAMi 4XDXA 1JCKB 2EYPA 5IGDA 4C3HG 1DGSA 5DEHA 1PH9A 1TWAB 3J80c 1XMOQ 1N33L 3AU7A 1PMRA 2EOTA 3ONAB 3SR1A 1EY4A 2E5LQ 4BBSH 4DNTB 4A3LG 2BE5C 4F87A 1C4QA 1AZPA 4NXNQ 1PTOD 3NBHB 4DV6L 1C0AA 4RMFA 4P2CB 1PXUA 4KK7A 3FDTA 4BBSB 1I4QA 3H09A 5IT9c 2B2VC 2OWOA 4OO1G 4RHRA 3OYYA 4DU9A 2QDLA 1VCIA 2BDNA 1M1KC 3NQIA 1I94L 4DF7A 1CA6A 4BA2I 2A74C 2R7FA 3I72A 3S2DH 2V1CC 4JI8L 3MXGA 5BN4A 3LGJA 2KHIA 4HJAA 1KLGD 4CKCA 3CU7A 3S2DB 3HG9A 2WAQB 1LV9A 1PFSA 3FMCA 4QGUA 3VR3A 2F4IA 4I7ZC 3RD4A 2RSOA 2SEBD 1WTWA 2KHJA 2NVTB 5C4XH 2VQFQ 4R4TA 4A3KB 1UAPA 3VR6A 3TDQA 1C8CA 4B3MQ 1JWMD 5CV8A 4FDBA 2Q2TA 2K5NA 4IPGA 5JEAH 3K5NA 1L0YB 1SBBB 4DKAC 4XIGS 1QZHA 1K0RA 5KIXA 1PH1A 1N34Q 1X6OA 1W6KA 4X66Q 3D3RA 4R4OA 1J8IA 3VA7A 3Q8DA 4U673 2AUKA 1PFNA 4TQUS 1CSQA 2K5VA 2VY3A 2Y0SG 1HJPA 4JVZA 2R92B 4BY7G 1D7QA 4KKTA 4XXEA 5JPMC 1E1TA 2L55A 3EIVA 4FXKC 1EEID 1I3QH 4QMGA 3TP7A 2VB2X 2D2CC 4RGOS 1F2MA 2A68D 2Z9HA 3OMGA 2MFIA 4K2KA 4HIDA 5ELBA 1UEBA 3D0FA 1NAPA 3GDEA 5I2YA 1L1OC 3K8AA 1SRUA 4MN3A 4LW1A 1EIFA 1CHQD 1E2WA 3E9HA 4H44C 3S24A 1TWFB 3QWNA 3S17H 4PZ8A 3HZXA 1PRTF 1BCPB 1MKHA 4AYBE 3MFGA 3BU2A 2EY6A 1IYJB 4TRDA 2BA1A 1KRTA 4LUOA 5COYA 1WTQA 1UNSA 5A2QL 4RG1A 3T4AC 1TWGB 1GUNA 1TWHB 1VQ5A 1SDFA 2L11A 5C4ZA 1EEFD 4DA2A 1X56A 2NTTA 1NBWA 1PRTD 4K5WA 1FVIA 1B53A 3VYRA 4DUZQ 3A8KE 3AMUA 3H0GB 3NELA 4JPBW 2F0DA 2MJ8A 5A35A 1FYCA 2CKZB 4FF1A 2UXDQ 5C3WA 4JI7L 1JT8A 1K83B 5C4JH 1O7IA 4QL5A 1BBUA 3M7GA 1ESRA 2B2UA 1V1OA 5BN3A 4O42A 3I4MG 3NE5B 4IO9A 4BY1B 5I9OA 1PYBA 3NTHA 4A3IH 1E3PA 2BE5D 2NN6H 4GLXA 2VL6A 3DUZA 4YY3Q 5KYIA 3IAYA 3E0EA 5JJLA 1WCMB 4XQJA 1O78A 1CQFA 2B2YA 1Y1VH 2OXPA 2EJGC 4B3TQ 3WDNA 3MXNB 4FF3A 4FXGC 5C44B 2XN9C 3RUZA 1K9MC 2K5HA 2NUCA 2X69A 1YJ9A 2M2LA 3P1HA 3BZCA 5DAUA 2UXBL 2F0OA 4BXXG 2EE1A 4GLVB 2ZJPA 4KN7C 2L0CA 3CC4A 3AFPA 1LYLA 2HIVA 5C0XH 4LF6L 3HOWG 4KJOA 3SK8A 3K80C 2LSSA 1HQRD 2JEAI 3UE1A 2HD3A 2XNAC 3KK7A 4JI4Q 4HMJA 3DEOA 1GHJA 1S3OA 4A3GG 2VZAA 1EU4A 1QB5D 4LF9Q 3FPPA 1KNEA 4RH6A 5IP9H 1J5EL 1HTLD 3LWUA 2HHHL 1K8GA 3NBIA 5C5MA 3G6JB 2NZHA 1H9MA 4KI0A 1JOKA 4QIWE 4Y7NH 1HNWQ 3HOUH 4JYAQ 2PMZB 1QUQA 3WOEA 3W1GA 3BYTB 3EBEA 1TQOA 1HHVA 2NVQH 4A3MH 1TY0A 1MSGA 4JOIC 1SROA 5JAVA 2JA8H 3RNUA 2JXMB 1TIID 1SEBD 4OIJA 3CW2C 4A3MB 3ER0A 4DV4L 3B6YA 4F7XA 2RDHA 2IHEA 4K14A 2R93H 3TREA 1O7ZA 4J6HA 1VQ6A 2ICIA 2E75C 3CCQA 2NBFA 4KHPQ 5M3FG 2B2VA 2NVXB 4JW0A 2IWHA 3VYSA 4EQNA 4HJ8A 2CH4A 2PNHA 4P75A 3C1FA 5JJIA 1IXRA 5IYCG 3PQIA 1VQOA 1W2BA 2CFMA 4IFDG 4IPCA 1XNRQ 1B50A 1X32A 4OELB 2BA0A 3MVVA 3JAMc 3CC7A 1EIHA 3KLRA 4L6TB 1IYUA 1L2FA 1VQHA 2F0GA 1EQRA 3AFQA 5CR3A 3S15H 2DNEA 5IP7G 3GQBA 1VQ9A 5GAHC 1A15A 2JEBI 4A3CG 2GN5A 3BZDB 5DNFA 4EQ5A 2O2LD 2PO4A 2F0IA 3BVZA 4DR4L 4OX9Q 1D5MC 2DJFC 3V2TA 4C3HB 4DV1L 3GTMB 5IGCA 5F2DA 3CPFA 4K0KQ 1F9PA 1AP0A 1A3UA 2A1AA 3VYTA 3EA6A 3E0JA 3I70A 1D5XC 2CH4W 1BOSA 4DGZA 1UE5A 1AN8A 1ILQA 2MUYA 3PGZA 1I50B 4POFA 4YCWA 4RGTA 1TT2A 2Z1CA 5GAEC 1IW7C 4A3JG 2UUBQ 2A8VA 1GUSA 2C5CA 5M5XH 5J39A 4P73A 1BVSA 2A6EC 3KF8A 4DV3L 4HIMA 3M7NA 1NY4A 4NKLA 1L1OA 2G9HD 2E2HH 1B1ZA 3J7AV 4YWKA 1SJHD 1FNUA 4BBRB 5M5XB 3GTPH 5C4XG 2F0HA 1GOZA 4P72A 3RLNA 5M5WH 4QF4A 1GKHA 1X54A 3T1YQ 4X3KA 2E2HB 1XTCD 1U4RA 4LF8L 3T1HL 1JJGA 2E2DC 2Y0SE 3GTGH 2QEXA 3J7A5 3RN5A 4ALPA 2MPMA 1CK1A 2FJ2A 2PZWA 1SYBA 2F0UA 3IRBA 4OWXB 1I4GA 5EGTA 3L7ZC 1Z47A 2ES2A 2VNUD 1FJGQ 4DK3C 3CXCA 2N88A 4J1MA 4F88A 2F0WA 2EY2A 2K7VA 5CV6A 2K4KA 4G7ZC 1GUOA 3DLLA 4WORA 2B2TC 4AQYL 1G2TA 3CRLC 1T5EA 1WTRA 1X3EA 2IL8A 1RTOA 2HDMA 4X64L 3KLSA 4JI0L 1R4QB 1PH4A 1CI3M 4BY7B 3SVMA 5IE8A 4A3DG 1STBA 1EQTA 4ME3A 4IURA 2D0OA 2MGSA 5T1IA 1HNXQ 4N8FA 4JI1Q 1AFPA 5FO9B 4GZYC 3K5MA 1K73C 4L5RC 1H9JA 3OW2A 2JQOA 1CSPA 4KKSA 1VQLA 4HSVA 1KHIA 2UU9L 2OCEA 3VR4A 4B3RQ 4GLAC 3A8JE 4G7OC 4R1JA 2CQOA 2K75A 1RF2D 3UDFA 1WTOA 2TSSA 3I8ZA 1EWCA 4JI6Q 2AHOB 4AYBG 4E6IA 4X62L 3J81E 4A93B 3N52A 1EFWA 3BVMA 4IQZA 4CKBA 3M4OB 1B2TA 3TMEA 1Y8OB 2CCZA 1YNXA 1PHJA 1V1PB 2E2JH 1XNQQ 3A5UA 3W3AA 3CCUA 2K5DA 2EYHA 1PTOC 5ELCA 3KJPA 3S1RH 2E2JB 5FLMG 3V05A 1QILA 2KCCA 2Q2UA 5CV5A 5I9PA 3I4MH 3PSIA 5IGGA 2VW9A 3ERQA 1DONA 2Z4IA 3S1RB 4X3TA 1ASYA 5AJ3Q 3PIP3 4A3EB 4A3IG 2F0FA 1SMYC 2NN6G 5CV9A 3G48A 3Q6SA 2EZVA 2EYLA 1HXYD 3I4MB 3HRZC 1N32Q 4JI5L 3I56A 2F0EA 3M4QA 5GADC 1WD1A 2JJQA 1GXDC 2F52A 3RR5A 1Z9FA 3J81L 1AZQA 1I4PA 1IKLA 1Y1VG 1RIPA 1VQEA 3R8BA 3D6CA 2SNSA 1UE1A 1SYGA 5I6WA 2JYOA 5HGTA 1LACA 4DR2Q 1BKBA 1I4XA 1PH5A 1Q46A 3H94A 1W6JA 1SFOH 1QE6A 5EKKA 2DY7A 3F2BA 1HR0W 1YHAA 4JOIA 4LFCL 2F0NA 2A6ED 2NTSA 4M8AA 1JJ2A 4B3SQ 3MXUA 3RZOB 5C0XG 1HUNA 4ODGA 3PF5A 5FKAC 1MJEA 4ILWA 1YHBA 3KBGA 5K36G 4DR5L 4FF2A 3HOWB 2KHSA 3F8TA 4BWGB 1HNZQ 1N33Q 4A3GH 3URYA 2A73B 1VQNA 3VYUA 1GD7A 2NWGA 1KDCA 2PW5A 4DV6Q 3PF4A 3CQZH 2HQEA 4DV7L 3DXJC 1X9NA 1N36L 2QF7A 1E2VA 1Y8PB 2CHBD 1ESFA 2PZTA 1C9OA 5GAGC 5D3IB 1KTKA 3KOJA 1WVLA 1CKMA 1DYQA 4DR6L 3PIO3 4DV0Q 4PV1C 4GN5A 3Q22A 4GNXC 2ZM6Q 2F0MA 2QKIC 3K7AH 3GTLB 1XPUA 3H3VI 4DN4M 4JI8Q 1HCZA 5IWAL 2B39A 1KNAA 4CJ1B 4DK0A 1DZ1A 3W2DA 1XXGA 4LF7L 3NP8A 5LL6S 4QCLA 5IYDG 1D5ZC 3U58A 2XWJB 4H02A 4OGQC 3W1BA 4HCEA 4GOPC 5M3FH 2Q2IA 3C3LA 4DAPA 4B9WA 2LFNA 1AE3A 1JICA 3FHWA 5IYCH 4DNRB 2XRQD 4IFDH 5C6AA 4GKKL 1PTOF 5IT9L 5CYUA 2E2IH 1BCPC 5FLXE 1PTOH 2IX1A 1B3AA 4EQPA 3K58A 5IP7H 3UDIA 4LJZC 4A3CH 4DR1Q 5D14A 1I6HH 3OWFA 3R93A 5ELOA 5IOCA 2ZXRA 3GTJB 5ELNA 2ZJQA 2VB3X 4XYQA 1TR5A 4KMUC 1FD7D 1PLFA 4JCVE 1KXLA 3AYHB 1UWVA 1Y1WG 1H95A 3FP9A 1DCZA 2YYZA 1I6HB 4DR3L 4XYOA 4IUUA 2YTXA 5IGFA 4KTAA 4DPGA 5JEAJ 3I73A 2I5LX 1K0SA 2VXWA 2WV6D 3S1MH 3VDYA 4IUPA 1Y69U 1PA6A 4R4IA 4NPSA 2I0QA 1X3GA 3OHXC 1JWSD 1LTAD 5DM63 3E6ZX 1SMYD 1Y8NB 4A3JH 2WINB 2JA9A 2KENA 2BDOA 5IGEA 2B2TA 2K28A 2RCFA 1OXSC 3CCEA 2L5TA 2ZTEA 4G4KA 5FLXL 2WP8J 2Q8IB 3J81j 4LFAL 4LF5L 1HA6A 2MNAA 1SE4A 1Z6HA 1KIXA 3L9AX 2XIWA 1GUTA 1SXTA 5HURA 1B9NA 1LTGD 2AQ2B 5EPKA 1KAWA 3NXWA 5HY6A 2ATWA 5C4XB 2A5HA 1CUKA 3H3VC 4PMBA 2EYOA 5A2QE 2I5MX 5ELEA 1IBLL 1ET6A 4G57A 3CCVA 4GKJQ 1ENFA 1SNMA 2IX0A 4JI7Q 2BCOA 2ASBA 3U4VA 4CDEC 1CZWA 2JN4A 1PH7A 4Y52H 1Q1BA 1XMQL 5EAYA 4PMWA 5CV7A 5J22A 3GTQH 2N49A 4OO1I 1CKNA 3U9OA 3KF6A 4A3DH 2F0KA 1I3QB 3QR8A 3DHQA 4LAAA 2JA7H 4PQXA 1QG7A 4V190 3T56B 1VQPA 2E5LL 2HT1A 1STEA 5IY0A 3M4PA 1GHKA 1JE5A 1XPOA 1YBYA 1WTHA 2MO1A 4IPDA 2D5DA 1IBKL 3S17B 2UUCL 2Q8TA 2PYKA 4RCOA 3HGBA 4XQNA 4HMIA 5CBEE 1VDZA 3EQLC 2HCIA 1KDBA 1PV4A 2K50A 3K59A 2RHQB 2RVLA 2JE6I 2B63G 2PNRC 4LF6Q 1QZGA 3OMCA 2DNCA 4IZ8A 4C1NI 5C3XA 3NBHA 4C1NK 1VQJA 1VQ4A 1H9SB 3D4RA 4UP8A 2KUMA 1FGBD 1BCPD 1TY2A 3CCMA 4QJFA 1SE3A 4Z9CB 1L0WA 3MC0B 5KGUA 1DOLA 3TQYA 3RMHA 2K04A 5FLMH 4MHEA 3AQQA 1ILPA 3TSSA 3S1NH 4B3ML 4C3JG 1WFQA 2ZXPA 1X3QA 2OEOA 1G291 1CKOA 4NW2A 3CHBD 5C0XJ 5C4JB 1IL8A 1J9OA 3PV0A 2L9HA 4F8MA 1ENCA 4IALA 4FVMA 3CKIB 4CDDC 5E4WC 4QUCA 3NQTA 1LT6D 4ZYSA 3WOFA 4A3IB 5M5YH 4DV4Q 4NP5A 3J7AF 2DN8A 4KHVA 3H91A
chains in the Genus database with same CATH topology
3CAMA 3M9BA 1FGUA 1HNXL 4DV0L 2UUBQ 4JI1L 2JA6G 3TS2A 3S2HH 4O2DA 1WJJA 4OWTB 2ZM6L 2A8VA 3HOVG 3DM3A 2GVBA 2VUMH 5M5XH 4YHHL 1Q86C 4P73A 1BVSA 4GNXA 4C2MH 1VQAA 4DV3L 1UE6A 4HIMA 2OTLA 3STBC 5IYBG 3M7NA 1NY4A 1L1OA 3CPWA 2E2HH 4A3BG 4YWKA 3RN2A 4HJ9A 4OONA 3FKIG 2NVTH 4B3RL 4BBRG 3GTPH 5C4XG 1TXYA 3PO3H 3RZOH 3HKZE 4P72A 3RLNA 5M5WH 4A3KH 4BXXH 3GTKH 1GKHA 1X54A 1YEZA 3T1YQ 3ICEA 1NMGA 4JBMA 3I4NG 4LF8L 5E7NA 1WOCA 3STBD 3T1HL 1Q1EA 4NXML 4GOPA 1N8RC 2LXJA 1D8LA 3HOWH 1JJGA 2Y0SE 3GTGH 4PZ6A 2QEXA 3M85A 2AKWB 4YWMA 2Q2HA 5BR8Q 3RN5A 3HOYG 3J7A5 4ALPA 2ZTCA 3TEHB 1A8VA 3ULPA 3IRBA 1B70B 4MZ9A 2MO0A 4OWXB 3WWVA 4DAYB 3CCSA 3L7ZC 1Z47A 3J81c 3G4SA 4DV1Q 2ES2A 1FJGQ 4BA1I 4J15A 1E1OA 4DK3C 2R7ZH 2VNUD 3CXCA 3KJOA 4UY8C 2R92H 1V1QA 3K81C 2YU9H 1PYSB 2K4KA 1I5FA 2C35B 3W5OA 3DLLA 4GNXB 1TWCH 1LM0A 4AQYL 1U0LA 2YV5A 3F2CA 3KF8B 4DR1L 1X3EA 2PMZE 2HQLA 5IP9G 4X64L 1L1OB 3ZJYC 4IJLA 4JI0L 4DR7L 2DGYA 3KDFA 4LFBL 1B7YB 4DUZL 1PH4A 5FLXc 1XMOL 2RCNA 1AE2A 1NMFA 1SR3A 1BBWA 3KLWA 3NEMA 2PQAA 3D31A 5IE8A 3GTLH 4A3DG 4ME3A 2CWPA 5LMNW 1OXTA 3HOUG 2D0OA 1HZBA 2KCTA 3CCJA 4NXNL 2GVAA 1EQQA 2NZOA 1HNXQ 5AJ3L 4JI1Q 1YJWA 4IJHA 3J81i 4JG2A 1K8AC 4A3MG 4LF5Q 1TWFH 4AIMA 4POGA 4GOPB 4YHHQ 3PO2H 1A0IA 2EXDA 1SN8A 2A19A 1K73C 4L5RC 4OWWB 5IYDH 3OW2A 3PCOB 2R6GA 2UXBQ 2OTJA 1N32L 3G71A 2JQOA 5C3EG 2JA8G 1CSPA 1VQLA 2UXCL 1KHIA 2UU9L 2OCEA 4YY3L 4B3RQ 4GLAC 4R1JA 2IT1A 2CQOA 3PUVA 2PI2A 2K75A 1PH2A 4IOAA 2R93G 3UDFA 3PUYA 5J3BA 4JI6Q 5LMNL 2AHOB 4AYBG 1IBLQ 2QA4A 4X62L 3UDGA 4LF8Q 1QUQB 3T1HQ 1TWGH 1PH6A 1TWHH 2QGQA 1FL0A 1WYDA 4DUYL 1PH3A 1B8AA 4A93G 5LMUL 1YI2A 1EFWA 4WJ3M 4DV2L 1QVCA 2PQAB 1A63A 2YTVA 5M3MH 1XMQQ 1JJCB 1GM5A 3RZDH 2CCZA 2OQKA 1J5EQ 1YNXA 1PHJA 2HHHQ 1HZCA 2VQFL 1E7ZA 3I2ZA 2E2JH 2JA5H 4B3SL 1XNQQ 2FXQA 3A5UA 3CCUA 4JI3Q 1OXUA 3H0GH 3GTJH 2F4VL 2YTYA 3M3YH 1N9WA 4AQYQ 1R9TH 2B3GA 5H1SE 1M90C 1WI5A 1A62A 1W3SA 2I5HA 1Y1WH 4UP7A 1VQKA 3KJPA 3JAMi 1Q81C 4DR7Q 3S1RH 1VQ8A 1K83H 5FLMG 1DGSA 3I7FA 1PH9A 1XMOQ 3BZKA 3J80c 2Q2UA 1N33L 2E5LQ 3UDXA 4BBSH 1N34L 2UUAL 3I4MH 3PSIA 4A3LG 2VW9A 2E8GA 4X66L 4GKJL 4BY1H 4JI4L 4NXNQ 4JI2Q 1ASYA 5AJ3Q 3MEFA 3NBHB 4DV6L 4A3EG 4A3IG 2NN6G 4OXPA 4RMFA 3PIPA 1C0AA 3G48A 1Y14B 1ASZA 4DV5Q 5IT9c 2OWOA 4LUZA 3ULJA 4OO1G 4LF9L 4WJ4A 3OYYA 1WCMH 4JI5L 1N32Q 1VCIA 3HOXH 3I56A 1M1KC 3M4QA 5GADC 1JB7A 2ID0A 3A5ZB 2BH2A 1I94L 2JJQA 4PG3A 1EWIA 1XTDA 2F52A 4BA2I 3RR5A 1Z9FA 2R7FA 3PUWA 1KD1C 4DK6C 3S2DH 4A76A 2V1CC 1Y1VG 4HIOA 4JI8L 1HNWL 4JYAL 1RIPA 2WFWA 1VQEA 2N3SA 2D62A 1UE1A 3H3VH 3LGJA 1VQCA 2KHIA 4YWLA 5C44H 4HJAA 2D0PA 2JA6H 4DR2Q 4JC0A 3I4OA 3HOVH 1BKBA 4IFDI 1VQIA 3HOZG 1PH5A 2VUMG 1Q46A 2WB1G 1XJVA 1SFOH 3HOWG 1PFSA 4QGUA 5LMUQ 2DUDA 3F2BA 4DV2Q 1HR0W 1YHAA 3L0OA 4JBJA 4JOIA 4LFCL 1VQFA 4C3IH 4QQBX 2KHJA 3ERSX 3OTOL 5C4XH 5FJ8G 4APVA 2VQFQ 4XTCS 1JJ2A 4B3SQ 4R4TA 1JMCA 5GROA 5C0XG 4A3KG 2F4VQ 1VQGA 3NENA 4B3MQ 4L5TA 3PF5A 1MJEA 3AEVA 3G6EA 4GS3A 2Z6KC 4FDBA 4KHPL 2Q2TA 2K5NA 1YHBA 3I4NH 4IPGA 4DR4Q 5K36G 4DR5L 1V9PA 3ULLA 4DKAC 1E22A 4XIGS 3PUXA 3F8TA 4A3FG 1HNZQ 1QZHA 4IPHA 1K0RA 2VQEL 4JV5L 1N33Q 3BJUA 1PH1A 3KYHC 4A3GH 1N34Q 2IY5B 2UUAQ 1X6OA 1XNRL 2H5XA 1VQNA 1GD7A 4X66Q 1HR0L 4R4OA 2JK8A 3Q8DA 1IBML 3CC2A 1NE3A 4DV6Q 3PF4A 3CQZH 1CSQA 2K5VA 4TQUS 2VY3A 2Y0SG 4DV7L 1HJPA 2EQSA 1X9NA 1N36L 2R92G 4BY7G 1D7QA 1C9OA 5GAGC 1YIJA 1E1TA 3EIVA 5JJKA 3KOJA 1I3QH 1CKMA 2UXDL 4QY7A 2JA7G 4DR6L 4DV0Q 2ZJRA 2MFIA 4GN5A 1HZ9A 4GNXC 2ZM6Q 4HIDA 1UEBA 3D0FA 3K7AH 3GDEA 1S40A 1PH8A 1L1OC 1XPUA 3K8AA 3H3VI 1SRUA 3UE0A 4JI8Q 3F1ZA 5IWAL 4LW1A 4DV3Q 1EIFA 1HH2P 3E9HA 3S24A 1U5KA 3S17H 4K0KL 4LF7L 3PO2G 4PZ8A 5IYDG 3U58A 4H02A 3W1BA 1MKHA 4AYBE 5M3FH 2Q2IA 4GOPC 4LFCQ 2NVXH 3RLFA 3OTOQ 3BU2A 1AE3A 4NXMQ 2B63H 1NJIC 1IYJB 3FHWA 3KDFB 5IYCH 4YCVA 1XPRA 4HIKA 2BA1A 2MQHA 4LUOA 4LUVA 3GO5A 1KRTA 1OTCA 3CCLA 4B3TL 4UP9A 4GKKL 4RG1A 4DR5Q 2CWAA 4JBWA 2E2IH 1EYGA 1VQ5A 2IX1A 1EOVA 2VQEQ 4JV5Q 3HFZB 1X56A 3S14H 5IP7H 3H15A 3UDIA 1Q12A 3CP0A 4MTNA 1HR0Q 1NBWA 4A3CH 5GQOA 4DR1Q 2KBNA 1MIUA 4KHZA 3K0XA 4X64Q 1IBMQ 1FVIA 1PVOA 4JI0Q 2NVYH 3EN2A 1I6HH 2AMCB 1T9HA 4X6AH 4HJ7A 4LFBQ 5GAEC 5ELOA 4DUZQ 4DV7Q 4P71A 3NELA 3GD7A 4C3JH 5ELNA 2ZJQA 2XTIA 2CKZB 4DNIA 4JCVE 1KXLA 3AYHB 2N78A 4TVAB 2UXDQ 1UWVA 1Y1WG 4JI7L 1H95A 3FP9A 2YYZA 1JT8A 4C3HH 5C4JH 4DR3L 3S16H 1O7IA 4QL5A 3GTMH 1BBUA 2YTXA 4DPGA 5BR8L 5JEAJ 4BBSG 4A3LH 2I5LX 3I4MG 5IWAQ 3S1MH 3CD6A 3VDYA 4IO9A 1PA6A 4R4IA 1EIYB 4X65L 1PYBA 4NPSA 2I0QA 4IOCA 1X3GA 4A3IH 1E3PA 4GLXA 2UXCQ 1YHQA 2UU9Q 2VL6A 2IHFA 4YY3Q 1GVPA 1QVGA 3J80i 3E0EA 2BH8A 3A0JA 5JJLA 4KLKA 4A3JH 1I50H 2JA9A 2KENA 5LMNQ 2ZTDA 4P74A 4NB3A 4X62Q 1OXSC 3CCEA 2F3IA 1KL9A 2ZTEA 2WB1E 4DUYQ 1Y1VH 4LWCA 2WAQG 1X3FA 4B3TQ 2WP8J 3MXNB 2K52A 5IYBH 4A3BH 3J81j 1YZ6A 1YITA 4LFAL 5C44G 3S1QH 1OXVA 2AWNA 1G51A 1RL2A 4LF5L 2L15A 3FKIH 2K5HA 1K9MC 3HOZH 4BBRH 2R7DA 2MNAA 1YJ9A 4LF4L 1KIXA 2ALYB 3BZCA 3PO3G 2AWOA 1GO3E 2UXBL 4BXXG 4GLVB 4A4IA 3I55A 1J6QA 3L2PA 2ZJPA 1KAWA 5HY6A 2RF4A 2ATWA 3RLOA 1X65A 1E24A 5FJ8H 4UPAA 3CC4A 1YVCA 1CUKA 3AFPA 4L5QA 1LYLA 2HIVA 3K7UC 2OQ0A 3HKZG 4YCUA 3CCRA 1VQMA 1C7YA 4LF6L 4LNQA 3K80C 3HOYH 2LSSA 4JI6L 2JEAI 2I5MX 2KCMA 1IBLL 3CCVA 4GKJQ 3JC66 2IX0A 3UE1A 5JEAG 4JI4Q 4JI7Q 4IFDJ 4DR3Q 3E9IA 2ASBA 3U4VA 4A3FH 2B29A 1PH7A 4GN3B 2R7ZG 4Y52H 1S3OA 4A3GG 2VZAA 1Q1BA 1OXXK 2HIXA 3U50C 5HGQA 4LF9Q 1XMQL 2NN6I 4JI5Q 4JBKA 5EAYA 1V43A 1K3RA 4PMWA 5IP9H 1J5EL 4X65Q 3CMEA 4HJ5A 1P16A 2K14A 2HHHL 3GTQH 2N49A 1K8GA 3PIOA 1I94Q 1X55A 4OO1I 1Q7YC 1XNQL 1CKNA 2NZHA 4JI3L 4BY7H 4KI0A 3KF6A 4A3DH 4QIWE 4Y7NH 3TS0A 1LUZA 2RHSB 3HOUH 1HNWQ 4JYAQ 4OX9L 1QUQA 2XGTA 3W1GA 2JA7H 3CMAA 1KQSA 3EBEA 2N8NA 2NVQH 4A3MH 4L5SA 2VS1A 1VQPA 2E5LL 2HT1A 4JOIC 1KC8C 1S72A 5IY0A 1SROA 1SMXA 3M4PA 5C3EH 4EX5A 2JA8H 4JI2L 1JE5A 4DAMA 1YBYA 1XPOA 1G6PA 4LFAQ 3RNUA 2MO1A 3TRZA 3CW2C 4A3JG 3ER0A 4DV4L 4PZ7A 3PUZA 4IPDA 1IBKL 1EUJA 3B6YA 3HKSA 2UUCL 4LF4Q 4DV5L 1NTGA 4MNOA 2IHEA 2R93H 3TREA 1VQ6A 1VQ7A 3CCQA 1IZ6A 4GN4B 2UUBL 5M3FG 3GTOH 4KHPQ 1PV4A 2K50A 1QVFA 5C0XI 1HZAA 2RHQB 4HJ8A 4R4QA 2JE6I 2PNHA 3CF5A 4P75A 2B63G 5DLQE 1IXRA 5JJIA 4LF6Q 1QZGA 5IYCG 4A93H 1VQOA 1CKNB 1MJCA 1W2BA 1VQDA 2CFMA 4IFDG 1VS0A 3KF6B 4IPCA 1XNRQ 3M4OH 5M3MG 2BA0A 1AH9A 4DR2L 3JAMc 1VQJA 3CC7A 1VQ4A 3J7ZC 1L2FA 1UE7A 1VQHA 2LXKA 4UP8A 2JA5G 1N36Q 1EQRA 3AFQA 3T1YL 3H0GG 3S15H 5IP7G 3CCMA 4QJFA 1VQ9A 3A74A 5GAHC 1L0WA 2PI2E 4A3CG 2JEBI 2GN5A 3TQYA 3F2DA 1YJNA 3KFUA 4DR6Q 1Q8KA 2Z0SA 4EQ5A 3AQQA 5FLMH 4A75A 4GKKQ 3S1NH 1TWAH 4B3ML 1P8LA 1IL2A 1WFQA 1G291 1CKOA 4DR4L 4OX9Q 1KRSA 1SE8A 1Q82C 5C0XJ 4BY1G 2Z6KA 4A3EH 4DV1L 3PV0A 1HNZL 1FJGL 2EIFA 1LTLA 4R4CA 3CPFA 4O0AA 4LF7Q 4K0KQ 2A1AA 4AH6A 1WCMG 1VQBA 3HOXG 3SGIA 5M5YH 4DV4Q 1UE5A 1IBKQ 2UUCQ 3U4ZA 3PGZA 2WAQE 1SLJA 4POFA 4YCWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CAM A;  3M9B A;  1FGU A;  1HNX L;  4DV0 L;  2UUB Q;  4JI1 L;  2JA6 G;  3TS2 A;  3S2H H;  4O2D A;  1WJJ A;  4OWT B;  2ZM6 L;  2A8V A;  3HOV G;  3DM3 A;  2GVB A;  2VUM H;  5M5X H;  4YHH L;  1Q86 C;  4P73 A;  1BVS A;  4GNX A;  4C2M H;  1VQA A;  4DV3 L;  1UE6 A;  4HIM A;  2OTL A;  3STB C;  5IYB G;  3M7N A;  1NY4 A;  1L1O A;  3CPW A;  2E2H H;  4A3B G;  4YWK A;  3RN2 A;  4HJ9 A;  4OON A;  3FKI G;  2NVT H;  4B3R L;  4BBR G;  3GTP H;  5C4X G;  1TXY A;  3PO3 H;  3RZO H;  3HKZ E;  4P72 A;  3RLN A;  5M5W H;  4A3K H;  4BXX H;  3GTK H;  1GKH A;  1X54 A;  1YEZ A;  3T1Y Q;  3ICE A;  1NMG A;  4JBM A;  3I4N G;  4LF8 L;  5E7N A;  1WOC A;  3STB D;  3T1H L;  1Q1E A;  4NXM L;  4GOP A;  1N8R C;  2LXJ A;  1D8L A;  3HOW H;  1JJG A;  2Y0S E;  3GTG H;  4PZ6 A;  2QEX A;  3M85 A;  2AKW B;  4YWM A;  2Q2H A;  5BR8 Q;  3RN5 A;  3HOY G;  3J7A 5;  4ALP A;  2ZTC A;  3TEH B;  1A8V A;  3ULP A;  3IRB A;  1B70 B;  4MZ9 A;  2MO0 A;  4OWX B;  3WWV A;  4DAY B;  3CCS A;  3L7Z C;  1Z47 A;  3J81 c;  3G4S A;  4DV1 Q;  2ES2 A;  1FJG Q;  4BA1 I;  4J15 A;  1E1O A;  4DK3 C;  2R7Z H;  2VNU D;  3CXC A;  3KJO A;  4UY8 C;  2R92 H;  1V1Q A;  3K81 C;  2YU9 H;  1PYS B;  2K4K A;  1I5F A;  2C35 B;  3W5O A;  3DLL A;  4GNX B;  1TWC H;  1LM0 A;  4AQY L;  1U0L A;  2YV5 A;  3F2C A;  3KF8 B;  4DR1 L;  1X3E A;  2PMZ E;  2HQL A;  5IP9 G;  4X64 L;  1L1O B;  3ZJY C;  4IJL A;  4JI0 L;  4DR7 L;  2DGY A;  3KDF A;  4LFB L;  1B7Y B;  4DUZ L;  1PH4 A;  5FLX c;  1XMO L;  2RCN A;  1AE2 A;  1NMF A;  1SR3 A;  1BBW A;  3KLW A;  3NEM A;  2PQA A;  3D31 A;  5IE8 A;  3GTL H;  4A3D G;  4ME3 A;  2CWP A;  5LMN W;  1OXT A;  3HOU G;  2D0O A;  1HZB A;  2KCT A;  3CCJ A;  4NXN L;  2GVA A;  1EQQ A;  2NZO A;  1HNX Q;  5AJ3 L;  4JI1 Q;  1YJW A;  4IJH A;  3J81 i;  4JG2 A;  1K8A C;  4A3M G;  4LF5 Q;  1TWF H;  4AIM A;  4POG A;  4GOP B;  4YHH Q;  3PO2 H;  1A0I A;  2EXD A;  1SN8 A;  2A19 A;  1K73 C;  4L5R C;  4OWW B;  5IYD H;  3OW2 A;  3PCO B;  2R6G A;  2UXB Q;  2OTJ A;  1N32 L;  3G71 A;  2JQO A;  5C3E G;  2JA8 G;  1CSP A;  1VQL A;  2UXC L;  1KHI A;  2UU9 L;  2OCE A;  4YY3 L;  4B3R Q;  4GLA C;  4R1J A;  2IT1 A;  2CQO A;  3PUV A;  2PI2 A;  2K75 A;  1PH2 A;  4IOA A;  2R93 G;  3UDF A;  3PUY A;  5J3B A;  4JI6 Q;  5LMN L;  2AHO B;  4AYB G;  1IBL Q;  2QA4 A;  4X62 L;  3UDG A;  4LF8 Q;  1QUQ B;  3T1H Q;  1TWG H;  1PH6 A;  1TWH H;  2QGQ A;  1FL0 A;  1WYD A;  4DUY L;  1PH3 A;  1B8A A;  4A93 G;  5LMU L;  1YI2 A;  1EFW A;  4WJ3 M;  4DV2 L;  1QVC A;  2PQA B;  1A63 A;  2YTV A;  5M3M H;  1XMQ Q;  1JJC B;  1GM5 A;  3RZD H;  2CCZ A;  2OQK A;  1J5E Q;  1YNX A;  1PHJ A;  2HHH Q;  1HZC A;  2VQF L;  1E7Z A;  3I2Z A;  2E2J H;  2JA5 H;  4B3S L;  1XNQ Q;  2FXQ A;  3A5U A;  3CCU A;  4JI3 Q;  1OXU A;  3H0G H;  3GTJ H;  2F4V L;  2YTY A;  3M3Y H;  1N9W A;  4AQY Q;  1R9T H;  2B3G A;  5H1S E;  1M90 C;  1WI5 A;  1A62 A;  1W3S A;  2I5H A;  1Y1W H;  4UP7 A;  1VQK A;  3KJP A;  3JAM i;  1Q81 C;  4DR7 Q;  3S1R H;  1VQ8 A;  1K83 H;  5FLM G;  1DGS A;  3I7F A;  1PH9 A;  1XMO Q;  3BZK A;  3J80 c;  2Q2U A;  1N33 L;  2E5L Q;  3UDX A;  4BBS H;  1N34 L;  2UUA L;  3I4M H;  3PSI A;  4A3L G;  2VW9 A;  2E8G A;  4X66 L;  4GKJ L;  4BY1 H;  4JI4 L;  4NXN Q;  4JI2 Q;  1ASY A;  5AJ3 Q;  3MEF A;  3NBH B;  4DV6 L;  4A3E G;  4A3I G;  2NN6 G;  4OXP A;  4RMF A;  3PIP A;  1C0A A;  3G48 A;  1Y14 B;  1ASZ A;  4DV5 Q;  5IT9 c;  2OWO A;  4LUZ A;  3ULJ A;  4OO1 G;  4LF9 L;  4WJ4 A;  3OYY A;  1WCM H;  4JI5 L;  1N32 Q;  1VCI A;  3HOX H;  3I56 A;  1M1K C;  3M4Q A;  5GAD C;  1JB7 A;  2ID0 A;  3A5Z B;  2BH2 A;  1I94 L;  2JJQ A;  4PG3 A;  1EWI A;  1XTD A;  2F52 A;  4BA2 I;  3RR5 A;  1Z9F A;  2R7F A;  3PUW A;  1KD1 C;  4DK6 C;  3S2D H;  4A76 A;  2V1C C;  1Y1V G;  4HIO A;  4JI8 L;  1HNW L;  4JYA L;  1RIP A;  2WFW A;  1VQE A;  2N3S A;  2D62 A;  1UE1 A;  3H3V H;  3LGJ A;  1VQC A;  2KHI A;  4YWL A;  5C44 H;  4HJA A;  2D0P A;  2JA6 H;  4DR2 Q;  4JC0 A;  3I4O A;  3HOV H;  1BKB A;  4IFD I;  1VQI A;  3HOZ G;  1PH5 A;  2VUM G;  1Q46 A;  2WB1 G;  1XJV A;  1SFO H;  3HOW G;  1PFS A;  4QGU A;  5LMU Q;  2DUD A;  3F2B A;  4DV2 Q;  1HR0 W;  1YHA A;  3L0O A;  4JBJ A;  4JOI A;  4LFC L;  1VQF A;  4C3I H;  4QQB X;  2KHJ A;  3ERS X;  3OTO L;  5C4X H;  5FJ8 G;  4APV A;  2VQF Q;  4XTC S;  1JJ2 A;  4B3S Q;  4R4T A;  1JMC A;  5GRO A;  5C0X G;  4A3K G;  2F4V Q;  1VQG A;  3NEN A;  4B3M Q;  4L5T A;  3PF5 A;  1MJE A;  3AEV A;  3G6E A;  4GS3 A;  2Z6K C;  4FDB A;  4KHP L;  2Q2T A;  2K5N A;  1YHB A;  3I4N H;  4IPG A;  4DR4 Q;  5K36 G;  4DR5 L;  1V9P A;  3ULL A;  4DKA C;  1E22 A;  4XIG S;  3PUX A;  3F8T A;  4A3F G;  1HNZ Q;  1QZH A;  4IPH A;  1K0R A;  2VQE L;  4JV5 L;  1N33 Q;  3BJU A;  1PH1 A;  3KYH C;  4A3G H;  1N34 Q;  2IY5 B;  2UUA Q;  1X6O A;  1XNR L;  2H5X A;  1VQN A;  1GD7 A;  4X66 Q;  1HR0 L;  4R4O A;  2JK8 A;  3Q8D A;  1IBM L;  3CC2 A;  1NE3 A;  4DV6 Q;  3PF4 A;  3CQZ H;  1CSQ A;  2K5V A;  4TQU S;  2VY3 A;  2Y0S G;  4DV7 L;  1HJP A;  2EQS A;  1X9N A;  1N36 L;  2R92 G;  4BY7 G;  1D7Q A;  1C9O A;  5GAG C;  1YIJ A;  1E1T A;  3EIV A;  5JJK A;  3KOJ A;  1I3Q H;  1CKM A;  2UXD L;  4QY7 A;  2JA7 G;  4DR6 L;  4DV0 Q;  2ZJR A;  2MFI A;  4GN5 A;  1HZ9 A;  4GNX C;  2ZM6 Q;  4HID A;  1UEB A;  3D0F A;  3K7A H;  3GDE A;  1S40 A;  1PH8 A;  1L1O C;  1XPU A;  3K8A A;  3H3V I;  1SRU A;  3UE0 A;  4JI8 Q;  3F1Z A;  5IWA L;  4LW1 A;  4DV3 Q;  1EIF A;  1HH2 P;  3E9H A;  3S24 A;  1U5K A;  3S17 H;  4K0K L;  4LF7 L;  3PO2 G;  4PZ8 A;  5IYD G;  3U58 A;  4H02 A;  3W1B A;  1MKH A;  4AYB E;  5M3F H;  2Q2I A;  4GOP C;  4LFC Q;  2NVX H;  3RLF A;  3OTO Q;  3BU2 A;  1AE3 A;  4NXM Q;  2B63 H;  1NJI C;  1IYJ B;  3FHW A;  3KDF B;  5IYC H;  4YCV A;  1XPR A;  4HIK A;  2BA1 A;  2MQH A;  4LUO A;  4LUV A;  3GO5 A;  1KRT A;  1OTC A;  3CCL A;  4B3T L;  4UP9 A;  4GKK L;  4RG1 A;  4DR5 Q;  2CWA A;  4JBW A;  2E2I H;  1EYG A;  1VQ5 A;  2IX1 A;  1EOV A;  2VQE Q;  4JV5 Q;  3HFZ B;  1X56 A;  3S14 H;  5IP7 H;  3H15 A;  3UDI A;  1Q12 A;  3CP0 A;  4MTN A;  1HR0 Q;  1NBW A;  4A3C H;  5GQO A;  4DR1 Q;  2KBN A;  1MIU A;  4KHZ A;  3K0X A;  4X64 Q;  1IBM Q;  1FVI A;  1PVO A;  4JI0 Q;  2NVY H;  3EN2 A;  1I6H H;  2AMC B;  1T9H A;  4X6A H;  4HJ7 A;  4LFB Q;  5GAE C;  5ELO A;  4DUZ Q;  4DV7 Q;  4P71 A;  3NEL A;  3GD7 A;  4C3J H;  5ELN A;  2ZJQ A;  2XTI A;  2CKZ B;  4DNI A;  4JCV E;  1KXL A;  3AYH B;  2N78 A;  4TVA B;  2UXD Q;  1UWV A;  1Y1W G;  4JI7 L;  1H95 A;  3FP9 A;  2YYZ A;  1JT8 A;  4C3H H;  5C4J H;  4DR3 L;  3S16 H;  1O7I A;  4QL5 A;  3GTM H;  1BBU A;  2YTX A;  4DPG A;  5BR8 L;  5JEA J;  4BBS G;  4A3L H;  2I5L X;  3I4M G;  5IWA Q;  3S1M H;  3CD6 A;  3VDY A;  4IO9 A;  1PA6 A;  4R4I A;  1EIY B;  4X65 L;  1PYB A;  4NPS A;  2I0Q A;  4IOC A;  1X3G A;  4A3I H;  1E3P A;  4GLX A;  2UXC Q;  1YHQ A;  2UU9 Q;  2VL6 A;  2IHF A;  4YY3 Q;  1GVP A;  1QVG A;  3J80 i;  3E0E A;  2BH8 A;  3A0J A;  5JJL A;  4KLK A;  4A3J H;  1I50 H;  2JA9 A;  2KEN A;  5LMN Q;  2ZTD A;  4P74 A;  4NB3 A;  4X62 Q;  1OXS C;  3CCE A;  2F3I A;  1KL9 A;  2ZTE A;  2WB1 E;  4DUY Q;  1Y1V H;  4LWC A;  2WAQ G;  1X3F A;  4B3T Q;  2WP8 J;  3MXN B;  2K52 A;  5IYB H;  4A3B H;  3J81 j;  1YZ6 A;  1YIT A;  4LFA L;  5C44 G;  3S1Q H;  1OXV A;  2AWN A;  1G51 A;  1RL2 A;  4LF5 L;  2L15 A;  3FKI H;  2K5H A;  1K9M C;  3HOZ H;  4BBR H;  2R7D A;  2MNA A;  1YJ9 A;  4LF4 L;  1KIX A;  2ALY B;  3BZC A;  3PO3 G;  2AWO A;  1GO3 E;  2UXB L;  4BXX G;  4GLV B;  4A4I A;  3I55 A;  1J6Q A;  3L2P A;  2ZJP A;  1KAW A;  5HY6 A;  2RF4 A;  2ATW A;  3RLO A;  1X65 A;  1E24 A;  5FJ8 H;  4UPA A;  3CC4 A;  1YVC A;  1CUK A;  3AFP A;  4L5Q A;  1LYL A;  2HIV A;  3K7U C;  2OQ0 A;  3HKZ G;  4YCU A;  3CCR A;  1VQM A;  1C7Y A;  4LF6 L;  4LNQ A;  3K80 C;  3HOY H;  2LSS A;  4JI6 L;  2JEA I;  2I5M X;  2KCM A;  1IBL L;  3CCV A;  4GKJ Q;  3JC6 6;  2IX0 A;  3UE1 A;  5JEA G;  4JI4 Q;  4JI7 Q;  4IFD J;  4DR3 Q;  3E9I A;  2ASB A;  3U4V A;  4A3F H;  2B29 A;  1PH7 A;  4GN3 B;  2R7Z G;  4Y52 H;  1S3O A;  4A3G G;  2VZA A;  1Q1B A;  1OXX K;  2HIX A;  3U50 C;  5HGQ A;  4LF9 Q;  1XMQ L;  2NN6 I;  4JI5 Q;  4JBK A;  5EAY A;  1V43 A;  1K3R A;  4PMW A;  5IP9 H;  1J5E L;  4X65 Q;  3CME A;  4HJ5 A;  1P16 A;  2K14 A;  2HHH L;  3GTQ H;  2N49 A;  1K8G A;  3PIO A;  1I94 Q;  1X55 A;  4OO1 I;  1Q7Y C;  1XNQ L;  1CKN A;  2NZH A;  4JI3 L;  4BY7 H;  4KI0 A;  3KF6 A;  4A3D H;  4QIW E;  4Y7N H;  3TS0 A;  1LUZ A;  2RHS B;  3HOU H;  1HNW Q;  4JYA Q;  4OX9 L;  1QUQ A;  2XGT A;  3W1G A;  2JA7 H;  3CMA A;  1KQS A;  3EBE A;  2N8N A;  2NVQ H;  4A3M H;  4L5S A;  2VS1 A;  1VQP A;  2E5L L;  2HT1 A;  4JOI C;  1KC8 C;  1S72 A;  5IY0 A;  1SRO A;  1SMX A;  3M4P A;  5C3E H;  4EX5 A;  2JA8 H;  4JI2 L;  1JE5 A;  4DAM A;  1YBY A;  1XPO A;  1G6P A;  4LFA Q;  3RNU A;  2MO1 A;  3TRZ A;  3CW2 C;  4A3J G;  3ER0 A;  4DV4 L;  4PZ7 A;  3PUZ A;  4IPD A;  1IBK L;  1EUJ A;  3B6Y A;  3HKS A;  2UUC L;  4LF4 Q;  4DV5 L;  1NTG A;  4MNO A;  2IHE A;  2R93 H;  3TRE A;  1VQ6 A;  1VQ7 A;  3CCQ A;  1IZ6 A;  4GN4 B;  2UUB L;  5M3F G;  3GTO H;  4KHP Q;  1PV4 A;  2K50 A;  1QVF A;  5C0X I;  1HZA A;  2RHQ B;  4HJ8 A;  4R4Q A;  2JE6 I;  2PNH A;  3CF5 A;  4P75 A;  2B63 G;  5DLQ E;  1IXR A;  5JJI A;  4LF6 Q;  1QZG A;  5IYC G;  4A93 H;  1VQO A;  1CKN B;  1MJC A;  1W2B A;  1VQD A;  2CFM A;  4IFD G;  1VS0 A;  3KF6 B;  4IPC A;  1XNR Q;  3M4O H;  5M3M G;  2BA0 A;  1AH9 A;  4DR2 L;  3JAM c;  1VQJ A;  3CC7 A;  1VQ4 A;  3J7Z C;  1L2F A;  1UE7 A;  1VQH A;  2LXK A;  4UP8 A;  2JA5 G;  1N36 Q;  1EQR A;  3AFQ A;  3T1Y L;  3H0G G;  3S15 H;  5IP7 G;  3CCM A;  4QJF A;  1VQ9 A;  3A74 A;  5GAH C;  1L0W A;  2PI2 E;  4A3C G;  2JEB I;  2GN5 A;  3TQY A;  3F2D A;  1YJN A;  3KFU A;  4DR6 Q;  1Q8K A;  2Z0S A;  4EQ5 A;  3AQQ A;  5FLM H;  4A75 A;  4GKK Q;  3S1N H;  1TWA H;  4B3M L;  1P8L A;  1IL2 A;  1WFQ A;  1G29 1;  1CKO A;  4DR4 L;  4OX9 Q;  1KRS A;  1SE8 A;  1Q82 C;  5C0X J;  4BY1 G;  2Z6K A;  4A3E H;  4DV1 L;  3PV0 A;  1HNZ L;  1FJG L;  2EIF A;  1LTL A;  4R4C A;  3CPF A;  4O0A A;  4LF7 Q;  4K0K Q;  2A1A A;  4AH6 A;  1WCM G;  1VQB A;  3HOX G;  3SGI A;  5M5Y H;  4DV4 Q;  1UE5 A;  1IBK Q;  2UUC Q;  3U4Z A;  3PGZ A;  2WAQ E;  1SLJ A;  4POF A;  4YCW A; 
#chains in the Genus database with same CATH topology
 1HUM A;  3CAM A;  4DAY A;  2L4N A;  3TS2 A;  3S2H H;  1EY5 A;  1STG A;  3DM3 A;  5J1Z A;  1Q86 C;  1Y1V B;  4V0B A;  4GNX A;  1STA A;  4C2M H;  1VQA A;  5IYB G;  3KUP A;  3CPW A;  4A3B G;  3RN2 A;  4HJ9 A;  3FKI G;  3LX0 A;  3PO3 H;  3HKZ E;  3IKJ A;  3ICE A;  1NMG A;  5K36 H;  5EQ0 A;  3KLS X;  3E5S A;  5JVH 3;  1Q1E A;  4PMC A;  4GOP A;  2LXJ A;  5ELD A;  5LL6 X;  3M85 A;  2Q2H A;  5BR8 Q;  3HOY G;  2XRS D;  2K01 A;  3DWA A;  1WTV A;  1I4H A;  4MZ9 A;  1B70 B;  2MO0 A;  1FNV A;  2NB0 A;  3CRK C;  4DV1 Q;  4WRD A;  4B9X A;  4BA1 I;  2R7Z H;  2NZ1 D;  1PYS B;  1I5F A;  4H0L C;  2K5W A;  3W5O A;  1TWC H;  1LM0 A;  3KF8 B;  2AUJ D;  2PMZ E;  1TVX A;  2HQL A;  4DR7 L;  1L1O B;  4IJL A;  4FF4 A;  2DGY A;  4K8J A;  1S5D D;  4DUZ L;  2M9V A;  4N9P A;  1WD0 A;  1NMF A;  1SR3 A;  3NEM A;  2PQA A;  3D31 A;  4Y7N B;  3HOU B;  2CWP A;  2WII B;  2KCT A;  2Z6B A;  2Z8L A;  3CCJ A;  1NCV A;  4IJH A;  1O80 A;  3J81 i;  2NVQ B;  1NNX A;  2F0T A;  2MP1 A;  1JE4 A;  4AIM A;  4QIW B;  2F0J A;  2A19 A;  3T16 A;  5IYD H;  2JA8 B;  5C3E G;  4NDX A;  4YY3 L;  1BUV T;  3PUV A;  2R93 B;  1V8Q A;  3VA5 A;  5FOB B;  5J3B A;  1F9R A;  4LF8 Q;  3T1H Q;  4OIK A;  1FL0 A;  2ZT9 C;  5D65 A;  1B8A A;  5LMU L;  4DV2 L;  2FMM A;  1JOO A;  4ZAI A;  5M3M H;  1GM5 A;  2OQK A;  4ZK9 B;  2P5Z X;  3MHB A;  1D2B A;  1EY8 A;  2JA5 H;  1E7Z A;  1F9Q A;  3I2Z A;  4JI3 Q;  2F4V L;  3S15 B;  1U4L A;  3M3Y H;  2CW0 C;  4AQY Q;  1R9T H;  4CGY B;  2B3G A;  1SNC A;  1A62 A;  1NR4 A;  1Y1W H;  2PW7 A;  3MEH A;  3MA2 B;  1Q81 C;  3BS1 A;  1TS2 A;  1SE2 A;  5FO7 B;  5EBD A;  2XVS A;  3MXN A;  2ENB A;  2UUA L;  1M4V A;  1R9T B;  2RQX A;  2E8G A;  2RKS A;  4JI4 L;  4JI2 Q;  4KV6 A;  3MEF A;  5KNB A;  4OXP A;  3PIP A;  5TSS A;  2A6H D;  1Y14 B;  2CVR A;  3OPO A;  4DV5 Q;  3ULJ A;  4WJ4 A;  4LF9 L;  3HOX H;  3VR2 A;  3A7A B;  2BH2 A;  2ID0 A;  3C2P A;  1EWI A;  3OIP A;  3K0Y A;  3PUW A;  1CFM A;  4DK6 C;  1HNW L;  4X6A H;  4JYA L;  2N3S A;  1RHP A;  3I90 A;  2JA6 H;  4YWL A;  5NUC A;  1RTN A;  3I4O A;  1RJT A;  3HOV H;  4IFD I;  4CDC C;  1XJV A;  3LWE A;  2K33 A;  2OT2 A;  3L0O A;  4JBJ A;  1H9K A;  2EYJ A;  1VQF A;  4C3I H;  4QQB X;  1G8Z D;  4Q5V A;  3D4D A;  3ERS X;  3OTO L;  3GTP B;  4APV A;  2F0P A;  1FNW A;  1G2S A;  3NK9 A;  5M5W B;  1JMC A;  4Q0F A;  2JSO A;  4A3K G;  1VQG A;  3NEN A;  4L5T A;  3QO2 A;  1RDP D;  1BO0 A;  4RKL A;  4GS3 A;  3AEV A;  4KHP L;  3I4N H;  1V9P A;  3GTG B;  3PUX A;  2VQE L;  2F0Q A;  4JV5 L;  3BJU A;  3KYH C;  2EPB A;  2IY5 B;  1XNR L;  1HR0 L;  3D6W A;  1KLU D;  2JK8 A;  1IBM L;  1NE3 A;  3NPP A;  5E3F A;  2Y0S B;  4K5X A;  3C46 A;  2R3Z A;  2I46 A;  2EQS A;  2R92 G;  1DOK A;  4CDF C;  5JJK A;  5CBA E;  4QY7 A;  2B8G A;  5JOB A;  2JA7 G;  1QNK A;  2K6A A;  1S40 A;  3UE0 A;  3F1Z A;  5EPL A;  1WTP A;  1HH2 P;  3D8G A;  2PQE A;  4HCS A;  2EJM A;  2F0V A;  4K0K L;  4N9T A;  1F2L A;  1HPC A;  4ABN A;  4LFC Q;  4TSS A;  4U68 A;  3RLF A;  2B63 H;  4NXM Q;  1NJI C;  2B2W C;  3KDF B;  4DK1 A;  4HIK A;  1LAB A;  4LUV A;  1OTC A;  3GO5 A;  4UP9 A;  3T13 A;  1GJX A;  4DR5 Q;  5D3D A;  2CWA A;  1FR3 A;  3MWY W;  4JBW A;  3TZU A;  4CHT B;  1H9R A;  5FK9 C;  2SOB A;  1EOV A;  2XSC A;  3HFZ B;  3IFT A;  1LTT D;  3H15 A;  1Q12 A;  3CP0 A;  2QDB A;  4CJ0 B;  4RKB A;  1MIU A;  4KHZ A;  4DFA A;  1PVO A;  4HJ7 A;  4LFB Q;  4DV7 Q;  3GD7 A;  2FFK B;  4C3J H;  1A3V A;  4DNI A;  3SXH A;  2DY8 A;  2L1B A;  2CW0 D;  4FXD A;  2J7Z A;  3S16 H;  1E2Z A;  3R2T A;  2X6G A;  4C3J B;  1KDA A;  3K6O A;  5IWA Q;  3CD6 A;  3OWE B;  4X65 L;  4OL7 A;  5KNC A;  4IOC A;  2UXC Q;  5CV4 A;  1MGS A;  2IHF A;  1OO9 B;  1EZ6 A;  1GVP A;  1QVG A;  3X3N A;  2BH8 A;  3BDL A;  3A0J A;  5KEE A;  3A56 A;  5LMN Q;  4ID6 A;  2ZTD A;  2F3I A;  2WB1 E;  4DUY Q;  1XX8 A;  4LWC A;  5BN5 A;  5IYB H;  1U9R A;  2K52 A;  4ZKC B;  4A3B H;  3S1Q H;  1YZ6 A;  1YIT A;  5C44 G;  2KA7 A;  2L15 A;  3FKI H;  3HOZ H;  3QJY A;  3J80 E;  2R7D A;  3SDZ A;  3ITP A;  4LF4 L;  1SFO B;  4EGV A;  3PO3 G;  4A4I A;  3I55 A;  2A69 D;  3E3X A;  2F1M A;  2KOL A;  3MXP A;  3FKI B;  3RLO A;  1X65 A;  1Q8I A;  3M4Y A;  5FJ8 H;  4UPA A;  4K2L A;  4L5Q A;  1MD2 D;  3HKZ G;  3CCR A;  5IT9 E;  1VQM A;  3NWT A;  5KND A;  4LNQ A;  3HOY H;  1QWY A;  4JI6 L;  2F0S A;  2F3V A;  3JC6 6;  4IFD J;  4DR3 Q;  2EVB A;  4A3F H;  3NTI A;  2B29 A;  2R7Z G;  3HOY B;  4A3G B;  4RFB A;  4ZLT F;  2HIX A;  5HGQ A;  4WJW A;  2NN6 I;  4JBK A;  1V43 A;  1K3R A;  1F2Z A;  1P16 A;  4HJ5 A;  3CQZ B;  1I94 Q;  1Q7Y C;  2F3W A;  1F2Y A;  3HEJ A;  1XNQ L;  1QJO A;  5G3L D;  3OOC A;  4I7A A;  1DXM A;  3K57 A;  2RHS B;  1KQS A;  1SNQ A;  1RD9 D;  2N8N A;  4L5S A;  4IUT A;  1KAB A;  3SK4 A;  3K7A B;  1KC8 C;  3J80 L;  4X3U A;  1SMX A;  5C3E H;  2N55 A;  4EX5 A;  4ZKB B;  4DAM A;  1V1P A;  4MTK A;  4LFA Q;  2K1B A;  3TRZ A;  2HUG A;  1EUJ A;  1X3P A;  5COR A;  4UHV A;  3P75 A;  1NTG A;  1STN A;  5JVG 3;  4B08 A;  5M3F B;  1IZ6 A;  1SJE D;  5I4D A;  3GTO H;  1Z7T A;  3K5L A;  5C0X I;  1HZA A;  5C4H A;  5DLQ E;  1B3Q A;  1CKN B;  1MJC A;  2GA4 B;  2FIN B;  1CM9 A;  3KF6 B;  1BXT A;  3TP8 A;  4HR7 B;  3H6M A;  4NMZ A;  2F0L A;  5M3M G;  1AH9 A;  4DR2 L;  4ZCK A;  3OSO A;  2E2I B;  1A6X A;  1PTO B;  3P7J A;  3HS0 C;  1UE7 A;  2LXK A;  2JA5 G;  1CTM A;  2D9U A;  1I6V C;  3VR5 A;  2EDG A;  1ROD A;  3F2D A;  1YJN A;  3KFU A;  3Q23 A;  2AQ3 B;  2Z0S A;  3TP6 A;  1ICF B;  1TWA H;  1S5E D;  1IL2 A;  1IHZ A;  4UDU C;  1SE8 A;  1Q82 C;  2J0T D;  5IOD A;  4CJ2 C;  1HNZ L;  3TN2 A;  2EIF A;  3X3M A;  1LTL A;  4R4C A;  1HTP A;  2K03 A;  3FVQ A;  4O0A A;  4N8X 1;  4R8I A;  4RHS A;  1E0B A;  4AH6 A;  3S1M B;  2E76 C;  1LTS D;  3HOX G;  1CA5 A;  1BDO A;  1IBK Q;  3I91 A;  2UUC Q;  3OW7 A;  1K28 A;  2WAQ E;  3U50 C;  1YNJ D;  3G6E A;  4A3J B;  3M9B A;  4DV0 L;  1II3 A;  2JA6 G;  1WJJ A;  4HTH A;  4OWT B;  2ZM6 L;  1PDQ A;  3J7Y W;  3HOV G;  4OHJ A;  2GVB A;  4YHH L;  2K5Q A;  1UE6 A;  4C3I G;  1TKW B;  2WKD A;  4OON A;  1YNN C;  2NVT H;  4BBR G;  3SHL A;  2XWB B;  2H4O A;  4A3K H;  1ML0 D;  5CGK A;  1BQQ T;  5FO8 B;  1EL0 A;  1LTB D;  3GP7 A;  4JBM A;  3I4N G;  4UAI A;  5E7N A;  1WOC A;  3STB D;  1N8R C;  1M8A A;  1B4O A;  4PZ6 A;  2AQ1 B;  1G6Z A;  2I07 B;  2DJG C;  2AKW B;  3BDO A;  4O1N A;  1RCV D;  2B2W A;  2ZTC A;  3TEH B;  1A8V A;  1TS4 A;  3QOJ A;  3NWS A;  1SAP A;  4DAY B;  2OF1 A;  3G4S A;  1E1O A;  4IUV A;  1IYV A;  2R92 H;  1NUC A;  2YU9 H;  4H13 C;  2C35 B;  3MTS A;  5AFW A;  4GNX B;  2YV5 A;  4DR1 L;  1BF4 A;  3ZJY C;  3GTQ B;  1B7Y B;  5FLX c;  1XMO L;  2RCN A;  1S4Z A;  2YU9 B;  1AE2 A;  4A3D B;  1BBW A;  5T1G A;  1I4R A;  5LMN W;  1OXT A;  5IGB A;  2JA7 B;  4NXN L;  3UI2 A;  1K3B C;  4RA8 A;  5M9O A;  4JG2 A;  1K8A C;  1BCP F;  1TWF H;  4GOP B;  4OWW B;  2EY5 A;  5DM7 3;  2R6G A;  4I65 A;  4R9W A;  2UXB Q;  4KKU A;  1XWE A;  1PRT B;  3EFX D;  2IT1 A;  3MZ5 A;  4AYB B;  1S5B D;  1QUQ B;  1TWG H;  1PH6 A;  1HA5 A;  1TWH H;  2QGQ A;  4BS9 A;  1PH3 A;  1EOT A;  4A93 G;  1DM0 B;  3U9S A;  1QVC A;  2PQA B;  1JJC B;  1PZI D;  1EQV A;  2RSN A;  1J5E Q;  2HHH Q;  1HZC A;  2VQF L;  5EKI A;  4RGM A;  3H0G H;  1HFN A;  5H1S E;  1W3S A;  1K8M A;  2KED A;  1VQK A;  4UP7 A;  3QIA A;  2A6H C;  4DR7 Q;  4TKO B;  1VQ8 A;  1K83 H;  1ZXT A;  3FRP B;  3I7F A;  3S1N B;  3BZK A;  1C48 A;  3UDX A;  1LO5 D;  2K05 A;  1LTR D;  1N34 L;  1EIG A;  1PFM A;  2SDF A;  1ET9 A;  1UEA B;  3IFD A;  4KY5 A;  4X66 L;  1ENA A;  1MSH A;  4K6D A;  4GKJ L;  4BY1 H;  3MAQ A;  1EY6 A;  3FEW X;  3OIQ A;  1F77 A;  4A3E G;  1D1K A;  1QOH A;  5ELF A;  2NYZ D;  1ASZ A;  4ZRZ A;  4LUZ A;  2HCC A;  1WCM H;  1QCB D;  5IIF A;  4IUN A;  3JAM E;  1JB7 A;  3A5Z B;  5M5Y B;  4HSP A;  4PG3 A;  5I2X A;  1XTD A;  1EY0 A;  5E1F A;  4FYD A;  1KD1 C;  1AEX A;  4A76 A;  4HIO A;  4RAU C;  2WFW A;  3I4L A;  2QIL A;  2D62 A;  3H3V H;  2RDG A;  1VQC A;  4EQO A;  5C44 H;  3S2H B;  3IL8 A;  2D0P A;  2EY1 A;  3D4W A;  4JC0 A;  1JWU D;  1VQI A;  3HOZ G;  1VMP A;  2VUM G;  2WB1 G;  3T53 B;  2LMC B;  4C2M B;  5LMU Q;  1NR2 A;  2DUD A;  4DV2 Q;  2ICE C;  4XQQ A;  5FJ8 G;  4XTC S;  1A2U A;  3PO3 B;  5GRO A;  1JOQ A;  1YNN D;  3DWP A;  2F4V Q;  5CC4 A;  2Z6K C;  5EPJ A;  4DR4 Q;  3ULL A;  2H1E A;  1DJR D;  1E22 A;  1U4P A;  2WKC A;  3HKZ B;  4A3F G;  4IPH A;  1EY9 A;  5EJW A;  1U4M A;  1SND A;  1VF7 A;  2UUA Q;  1STY A;  2H5X A;  3I3C A;  4L8J A;  3CC2 A;  1D1I A;  3JAM L;  2R7Z B;  2Q8R E;  1CZG A;  4FNF A;  1JQY D;  2QW7 A;  4CBV A;  1YIJ A;  1TWC B;  3EVQ A;  4RWS C;  2UXD L;  2KVM A;  2QCP X;  4ULL A;  2FMC A;  3NTK A;  2ZJR A;  1HZ9 A;  1K8O A;  5EBC A;  4XT3 B;  2JP1 A;  3O13 A;  1PH8 A;  4QUF A;  4DV3 Q;  1JOR A;  2KCN A;  1H9S A;  4J8Q A;  4QB4 A;  1U5K A;  2ZXO A;  2B8F A;  1ZEQ X;  1PFB A;  3PO2 G;  1NSN S;  3NUC A;  3T51 B;  1D6E C;  1HFG A;  2R61 A;  2NVX H;  3OTO Q;  1O7Y A;  1SYF A;  4YCV A;  1XPR A;  2MQH A;  4B3T L;  3CCL A;  1LTI D;  4KN4 C;  2IW3 A;  1EYG A;  2VQE Q;  4JV5 Q;  1CHP D;  3EJI A;  3S14 H;  3P20 A;  4MTN A;  4R8N A;  5M3M B;  1HR0 Q;  4CKE A;  5I6Y A;  5GQO A;  2KBN A;  1JR0 D;  1TS3 A;  3K0X A;  4X64 Q;  4KJN A;  1IBM Q;  4JI0 Q;  2NVY H;  2IPK D;  2EYM A;  2AMC B;  1T9H A;  1B44 D;  2RBM A;  3EN2 A;  1B9M A;  2JA5 B;  4P71 A;  3S14 B;  3M3Y B;  2C9O A;  2M00 A;  4WFN 3;  2XTI A;  1PZK D;  3GV3 A;  2PCF B;  4K8I A;  2N78 A;  4TVA B;  1Y1W B;  3DMU A;  2NVY B;  3TBI B;  4C3H H;  2F03 A;  3GTM H;  3SK6 A;  3ERO A;  1BR9 A;  5BR8 L;  4BBS G;  5ISR A;  4A3L H;  1F9S A;  3BYY B;  1PZJ D;  3BG3 A;  3DWQ A;  1EIY B;  3Q0A A;  1YHQ A;  1Q3L A;  2UU9 Q;  4XT1 B;  4K5V A;  3J80 i;  1WTX A;  4OO1 H;  1UUP A;  4KLK A;  4FO2 A;  5KRU A;  4X3S A;  1I50 H;  3HOX B;  3QOL A;  4C56 C;  4P74 A;  3QG1 A;  4NB3 A;  4X62 Q;  2QEJ C;  1KL9 A;  1TS5 A;  2A69 C;  2G5D A;  2MHV A;  4LK1 C;  2WAQ G;  1X3F A;  4JK1 C;  3AB9 A;  4YIJ A;  2LKV A;  2JA6 B;  1OXV A;  2AWN A;  1G51 A;  1RL2 A;  3HOV B;  5CMD A;  4BBR H;  2RA4 A;  2ALY B;  2AWO A;  1CQV A;  1GO3 E;  3SEB A;  3SK5 A;  4EVO A;  1J6Q A;  4C3I B;  3R3O A;  1PYW D;  3L2P A;  2RF4 A;  3NHH A;  1E24 A;  3F2U A;  1YVC A;  3Q24 A;  4YCU A;  3K7U C;  2OQ0 A;  2EJF C;  1C7Y A;  1EU3 A;  2KCM A;  5JJZ A;  3I4N B;  4RCN A;  3HP3 A;  5JEA G;  4IUQ A;  1VMC A;  3E9I A;  2RDF A;  1A3T A;  3NSW A;  4GN3 B;  3ND9 A;  1OXX K;  4JI5 Q;  4X65 Q;  3CME A;  2K14 A;  5L37 A;  3PIO A;  1X55 A;  4JI3 L;  1LT5 D;  4BY7 H;  3TS0 A;  2WAC A;  1LUZ A;  4OX9 L;  2XGT A;  3CMA A;  4ZUJ A;  1CT1 D;  3ZYY X;  2VS1 A;  2KEC A;  3TP5 A;  4ZQ3 A;  1SSO A;  2TMP A;  1S72 A;  3LNN A;  4JI2 L;  3SE0 A;  1TU2 B;  1O7L A;  1G6P A;  1A2T A;  3KBX A;  4PZ7 A;  3PUZ A;  3PMF A;  4HAE A;  3HKS A;  4LF4 Q;  4DV5 L;  4MNO A;  1ZYR C;  4KY6 A;  1VQ7 A;  2UUB L;  4GN4 B;  5JPN C;  1QVF A;  2FHT A;  2B63 B;  4R4Q A;  3CF5 A;  4KD3 A;  1IKM A;  1Q90 A;  4A93 H;  1VQD A;  1VS0 A;  3M4O H;  2IX3 A;  2KJX A;  1SYE A;  3J7Z C;  1EYC A;  1N36 Q;  2K32 A;  3H0G G;  3T1Y L;  3A74 A;  2PI2 E;  1R4P B;  1T5X D;  4DR6 Q;  1Q8K A;  1ONL A;  4A75 A;  3ND8 A;  1P8L A;  3FPU B;  1STH A;  2G9D A;  1KRS A;  4BY1 G;  1XYI A;  3S16 B;  2Z6K A;  3A54 A;  4A3E H;  1LLR D;  1JB3 A;  1FJG L;  2L12 A;  1YNJ C;  1ZKO A;  4LF7 Q;  2O4X A;  4K6L A;  1BNZ A;  4DXG A;  4HN7 A;  4DXF A;  1WCM G;  2X6L A;  1VQB A;  3QB3 A;  3SGI A;  1RKN A;  4ME5 A;  2KEE A;  1SYD A;  1BBX C;  1QNU A;  3U4Z A;  1JC7 A;  1SLJ A;  3GTK H;  4GKK Q;  1FGU A;  1HNX L;  1EYD A;  4JI1 L;  4O2D A;  2LY7 A;  1VF5 C;  2VUM H;  1HRJ A;  1EZ8 A;  2IJ0 A;  1SYC A;  3GTK B;  2OTL A;  3STB C;  4A3B B;  3S1Q B;  4ZUI A;  5K5P A;  3HOZ B;  1IW7 D;  4B3R L;  4MIU A;  5G3L F;  2VUM B;  2WB1 B;  1G91 A;  1TXY A;  5LHY 1;  3BDC A;  4LMQ D;  3RZO H;  2CQA A;  4BXX H;  1DD2 A;  1YEZ A;  2O5I C;  1DOM A;  3GV6 A;  4KY7 A;  1SNP A;  2B2U C;  3MFY A;  4S3S A;  1MI2 A;  4NXM L;  3N6R A;  3V96 A;  1D8L A;  3HOW H;  3TZD A;  1LT4 D;  4YWM A;  2BOS A;  5C5L A;  4RGN A;  3BVG A;  3WWV A;  3CCS A;  3ULP A;  3S9W A;  1GUG A;  3J81 c;  1EFI D;  4A3F B;  4J15 A;  1AW7 A;  4UY8 C;  3KJO A;  5KYL A;  1V1Q A;  3K81 C;  2B2Y C;  4HED A;  4M1U B;  2A68 C;  1U0L A;  3F2C A;  5E4X A;  1EYA A;  5IP9 G;  1S5C D;  3KDF A;  4LFB L;  1ICW A;  3K5O A;  2J4X A;  2PPB C;  2LS0 1;  3KLW A;  3GTL H;  1SNO A;  3HOU G;  1HZB A;  3C1E A;  1EY7 A;  1L0X B;  2GVA A;  2NZO A;  1EQQ A;  5AJ3 L;  1YJW A;  4IN3 A;  4A3M G;  2EXZ A;  4LF5 Q;  4L63 B;  4POG A;  4YHH Q;  3PO2 H;  1A0I A;  2EXD A;  1SN8 A;  2Z4H A;  2SNM A;  3PCO B;  2OTJ A;  4G7H C;  1N32 L;  5C3E B;  4OEM B;  2KQ3 A;  1LT3 D;  3G71 A;  1EWH A;  2JA8 G;  1MBY A;  2UXC L;  2E74 C;  1MHW C;  3A8I E;  1KAA A;  3PO2 B;  4H7B A;  2O5J C;  2PI2 A;  4IOA A;  1PH2 A;  2R93 G;  2PZU A;  1HQM C;  3PUY A;  3DEP A;  5LMN L;  3L3O C;  1IBL Q;  3GTO B;  1ZYR D;  2QA4 A;  3UDG A;  2EYF A;  1WYD A;  3G7L A;  4DUY L;  2HDL A;  3DM1 A;  1YI2 A;  1PRT C;  3A7L A;  4WJ3 M;  1A63 A;  2YTV A;  4PNY A;  4FP5 D;  1XMQ Q;  3RZD H;  5EKL A;  3R2I A;  4KD4 A;  4B3S L;  2FXQ A;  1OXU A;  3GTJ H;  1S5F D;  2YTY A;  1N9W A;  2V4D A;  3A55 A;  1GUW A;  4DAV A;  3RZD B;  1M90 C;  1WI5 A;  2I5H A;  3JAM i;  4XDX A;  1JCK B;  2EYP A;  5IGD A;  4C3H G;  1DGS A;  5DEH A;  1PH9 A;  1TWA B;  3J80 c;  1XMO Q;  1N33 L;  3AU7 A;  1PMR A;  2EOT A;  3ONA B;  3SR1 A;  1EY4 A;  2E5L Q;  4BBS H;  4DNT B;  4A3L G;  2BE5 C;  4F87 A;  1C4Q A;  1AZP A;  4NXN Q;  1PTO D;  3NBH B;  4DV6 L;  1C0A A;  4RMF A;  4P2C B;  1PXU A;  4KK7 A;  3FDT A;  4BBS B;  1I4Q A;  3H09 A;  5IT9 c;  2B2V C;  2OWO A;  4OO1 G;  4RHR A;  3OYY A;  4DU9 A;  2QDL A;  1VCI A;  2BDN A;  1M1K C;  3NQI A;  1I94 L;  4DF7 A;  1CA6 A;  4BA2 I;  2A74 C;  2R7F A;  3I72 A;  3S2D H;  2V1C C;  4JI8 L;  3MXG A;  5BN4 A;  3LGJ A;  2KHI A;  4HJA A;  1KLG D;  4CKC A;  3CU7 A;  3S2D B;  3HG9 A;  2WAQ B;  1LV9 A;  1PFS A;  3FMC A;  4QGU A;  3VR3 A;  2F4I A;  4I7Z C;  3RD4 A;  2RSO A;  2SEB D;  1WTW A;  2KHJ A;  2NVT B;  5C4X H;  2VQF Q;  4R4T A;  4A3K B;  1UAP A;  3VR6 A;  3TDQ A;  1C8C A;  4B3M Q;  1JWM D;  5CV8 A;  4FDB A;  2Q2T A;  2K5N A;  4IPG A;  5JEA H;  3K5N A;  1L0Y B;  1SBB B;  4DKA C;  4XIG S;  1QZH A;  1K0R A;  5KIX A;  1PH1 A;  1N34 Q;  1X6O A;  1W6K A;  4X66 Q;  3D3R A;  4R4O A;  1J8I A;  3VA7 A;  3Q8D A;  4U67 3;  2AUK A;  1PFN A;  4TQU S;  1CSQ A;  2K5V A;  2VY3 A;  2Y0S G;  1HJP A;  4JVZ A;  2R92 B;  4BY7 G;  1D7Q A;  4KKT A;  4XXE A;  5JPM C;  1E1T A;  2L55 A;  3EIV A;  4FXK C;  1EEI D;  1I3Q H;  4QMG A;  3TP7 A;  2VB2 X;  2D2C C;  4RGO S;  1F2M A;  2A68 D;  2Z9H A;  3OMG A;  2MFI A;  4K2K A;  4HID A;  5ELB A;  1UEB A;  3D0F A;  1NAP A;  3GDE A;  5I2Y A;  1L1O C;  3K8A A;  1SRU A;  4MN3 A;  4LW1 A;  1EIF A;  1CHQ D;  1E2W A;  3E9H A;  4H44 C;  3S24 A;  1TWF B;  3QWN A;  3S17 H;  4PZ8 A;  3HZX A;  1PRT F;  1BCP B;  1MKH A;  4AYB E;  3MFG A;  3BU2 A;  2EY6 A;  1IYJ B;  4TRD A;  2BA1 A;  1KRT A;  4LUO A;  5COY A;  1WTQ A;  1UNS A;  5A2Q L;  4RG1 A;  3T4A C;  1TWG B;  1GUN A;  1TWH B;  1VQ5 A;  1SDF A;  2L11 A;  5C4Z A;  1EEF D;  4DA2 A;  1X56 A;  2NTT A;  1NBW A;  1PRT D;  4K5W A;  1FVI A;  1B53 A;  3VYR A;  4DUZ Q;  3A8K E;  3AMU A;  3H0G B;  3NEL A;  4JPB W;  2F0D A;  2MJ8 A;  5A35 A;  1FYC A;  2CKZ B;  4FF1 A;  2UXD Q;  5C3W A;  4JI7 L;  1JT8 A;  1K83 B;  5C4J H;  1O7I A;  4QL5 A;  1BBU A;  3M7G A;  1ESR A;  2B2U A;  1V1O A;  5BN3 A;  4O42 A;  3I4M G;  3NE5 B;  4IO9 A;  4BY1 B;  5I9O A;  1PYB A;  3NTH A;  4A3I H;  1E3P A;  2BE5 D;  2NN6 H;  4GLX A;  2VL6 A;  3DUZ A;  4YY3 Q;  5KYI A;  3IAY A;  3E0E A;  5JJL A;  1WCM B;  4XQJ A;  1O78 A;  1CQF A;  2B2Y A;  1Y1V H;  2OXP A;  2EJG C;  4B3T Q;  3WDN A;  3MXN B;  4FF3 A;  4FXG C;  5C44 B;  2XN9 C;  3RUZ A;  1K9M C;  2K5H A;  2NUC A;  2X69 A;  1YJ9 A;  2M2L A;  3P1H A;  3BZC A;  5DAU A;  2UXB L;  2F0O A;  4BXX G;  2EE1 A;  4GLV B;  2ZJP A;  4KN7 C;  2L0C A;  3CC4 A;  3AFP A;  1LYL A;  2HIV A;  5C0X H;  4LF6 L;  3HOW G;  4KJO A;  3SK8 A;  3K80 C;  2LSS A;  1HQR D;  2JEA I;  3UE1 A;  2HD3 A;  2XNA C;  3KK7 A;  4JI4 Q;  4HMJ A;  3DEO A;  1GHJ A;  1S3O A;  4A3G G;  2VZA A;  1EU4 A;  1QB5 D;  4LF9 Q;  3FPP A;  1KNE A;  4RH6 A;  5IP9 H;  1J5E L;  1HTL D;  3LWU A;  2HHH L;  1K8G A;  3NBI A;  5C5M A;  3G6J B;  2NZH A;  1H9M A;  4KI0 A;  1JOK A;  4QIW E;  4Y7N H;  1HNW Q;  3HOU H;  4JYA Q;  2PMZ B;  1QUQ A;  3WOE A;  3W1G A;  3BYT B;  3EBE A;  1TQO A;  1HHV A;  2NVQ H;  4A3M H;  1TY0 A;  1MSG A;  4JOI C;  1SRO A;  5JAV A;  2JA8 H;  3RNU A;  2JXM B;  1TII D;  1SEB D;  4OIJ A;  3CW2 C;  4A3M B;  3ER0 A;  4DV4 L;  3B6Y A;  4F7X A;  2RDH A;  2IHE A;  4K14 A;  2R93 H;  3TRE A;  1O7Z A;  4J6H A;  1VQ6 A;  2ICI A;  2E75 C;  3CCQ A;  2NBF A;  4KHP Q;  5M3F G;  2B2V A;  2NVX B;  4JW0 A;  2IWH A;  3VYS A;  4EQN A;  4HJ8 A;  2CH4 A;  2PNH A;  4P75 A;  3C1F A;  5JJI A;  1IXR A;  5IYC G;  3PQI A;  1VQO A;  1W2B A;  2CFM A;  4IFD G;  4IPC A;  1XNR Q;  1B50 A;  1X32 A;  4OEL B;  2BA0 A;  3MVV A;  3JAM c;  3CC7 A;  1EIH A;  3KLR A;  4L6T B;  1IYU A;  1L2F A;  1VQH A;  2F0G A;  1EQR A;  3AFQ A;  5CR3 A;  3S15 H;  2DNE A;  5IP7 G;  3GQB A;  1VQ9 A;  5GAH C;  1A15 A;  2JEB I;  4A3C G;  2GN5 A;  3BZD B;  5DNF A;  4EQ5 A;  2O2L D;  2PO4 A;  2F0I A;  3BVZ A;  4DR4 L;  4OX9 Q;  1D5M C;  2DJF C;  3V2T A;  4C3H B;  4DV1 L;  3GTM B;  5IGC A;  5F2D A;  3CPF A;  4K0K Q;  1F9P A;  1AP0 A;  1A3U A;  2A1A A;  3VYT A;  3EA6 A;  3E0J A;  3I70 A;  1D5X C;  2CH4 W;  1BOS A;  4DGZ A;  1UE5 A;  1AN8 A;  1ILQ A;  2MUY A;  3PGZ A;  1I50 B;  4POF A;  4YCW A;  4RGT A;  1TT2 A;  2Z1C A;  5GAE C;  1IW7 C;  4A3J G;  2UUB Q;  2A8V A;  1GUS A;  2C5C A;  5M5X H;  5J39 A;  4P73 A;  1BVS A;  2A6E C;  3KF8 A;  4DV3 L;  4HIM A;  3M7N A;  1NY4 A;  4NKL A;  1L1O A;  2G9H D;  2E2H H;  1B1Z A;  3J7A V;  4YWK A;  1SJH D;  1FNU A;  4BBR B;  5M5X B;  3GTP H;  5C4X G;  2F0H A;  1GOZ A;  4P72 A;  3RLN A;  5M5W H;  4QF4 A;  1GKH A;  1X54 A;  3T1Y Q;  4X3K A;  2E2H B;  1XTC D;  1U4R A;  4LF8 L;  3T1H L;  1JJG A;  2E2D C;  2Y0S E;  3GTG H;  2QEX A;  3J7A 5;  3RN5 A;  4ALP A;  2MPM A;  1CK1 A;  2FJ2 A;  2PZW A;  1SYB A;  2F0U A;  3IRB A;  4OWX B;  1I4G A;  5EGT A;  3L7Z C;  1Z47 A;  2ES2 A;  2VNU D;  1FJG Q;  4DK3 C;  3CXC A;  2N88 A;  4J1M A;  4F88 A;  2F0W A;  2EY2 A;  2K7V A;  5CV6 A;  2K4K A;  4G7Z C;  1GUO A;  3DLL A;  4WOR A;  2B2T C;  4AQY L;  1G2T A;  3CRL C;  1T5E A;  1WTR A;  1X3E A;  2IL8 A;  1RTO A;  2HDM A;  4X64 L;  3KLS A;  4JI0 L;  1R4Q B;  1PH4 A;  1CI3 M;  4BY7 B;  3SVM A;  5IE8 A;  4A3D G;  1STB A;  1EQT A;  4ME3 A;  4IUR A;  2D0O A;  2MGS A;  5T1I A;  1HNX Q;  4N8F A;  4JI1 Q;  1AFP A;  5FO9 B;  4GZY C;  3K5M A;  1K73 C;  4L5R C;  1H9J A;  3OW2 A;  2JQO A;  1CSP A;  4KKS A;  1VQL A;  4HSV A;  1KHI A;  2UU9 L;  2OCE A;  3VR4 A;  4B3R Q;  4GLA C;  3A8J E;  4G7O C;  4R1J A;  2CQO A;  2K75 A;  1RF2 D;  3UDF A;  1WTO A;  2TSS A;  3I8Z A;  1EWC A;  4JI6 Q;  2AHO B;  4AYB G;  4E6I A;  4X62 L;  3J81 E;  4A93 B;  3N52 A;  1EFW A;  3BVM A;  4IQZ A;  4CKB A;  3M4O B;  1B2T A;  3TME A;  1Y8O B;  2CCZ A;  1YNX A;  1PHJ A;  1V1P B;  2E2J H;  1XNQ Q;  3A5U A;  3W3A A;  3CCU A;  2K5D A;  2EYH A;  1PTO C;  5ELC A;  3KJP A;  3S1R H;  2E2J B;  5FLM G;  3V05 A;  1QIL A;  2KCC A;  2Q2U A;  5CV5 A;  5I9P A;  3I4M H;  3PSI A;  5IGG A;  2VW9 A;  3ERQ A;  1DON A;  2Z4I A;  3S1R B;  4X3T A;  1ASY A;  5AJ3 Q;  3PIP 3;  4A3E B;  4A3I G;  2F0F A;  1SMY C;  2NN6 G;  5CV9 A;  3G48 A;  3Q6S A;  2EZV A;  2EYL A;  1HXY D;  3I4M B;  3HRZ C;  1N32 Q;  4JI5 L;  3I56 A;  2F0E A;  3M4Q A;  5GAD C;  1WD1 A;  2JJQ A;  1GXD C;  2F52 A;  3RR5 A;  1Z9F A;  3J81 L;  1AZQ A;  1I4P A;  1IKL A;  1Y1V G;  1RIP A;  1VQE A;  3R8B A;  3D6C A;  2SNS A;  1UE1 A;  1SYG A;  5I6W A;  2JYO A;  5HGT A;  1LAC A;  4DR2 Q;  1BKB A;  1I4X A;  1PH5 A;  1Q46 A;  3H94 A;  1W6J A;  1SFO H;  1QE6 A;  5EKK A;  2DY7 A;  3F2B A;  1HR0 W;  1YHA A;  4JOI A;  4LFC L;  2F0N A;  2A6E D;  2NTS A;  4M8A A;  1JJ2 A;  4B3S Q;  3MXU A;  3RZO B;  5C0X G;  1HUN A;  4ODG A;  3PF5 A;  5FKA C;  1MJE A;  4ILW A;  1YHB A;  3KBG A;  5K36 G;  4DR5 L;  4FF2 A;  3HOW B;  2KHS A;  3F8T A;  4BWG B;  1HNZ Q;  1N33 Q;  4A3G H;  3URY A;  2A73 B;  1VQN A;  3VYU A;  1GD7 A;  2NWG A;  1KDC A;  2PW5 A;  4DV6 Q;  3PF4 A;  3CQZ H;  2HQE A;  4DV7 L;  3DXJ C;  1X9N A;  1N36 L;  2QF7 A;  1E2V A;  1Y8P B;  2CHB D;  1ESF A;  2PZT A;  1C9O A;  5GAG C;  5D3I B;  1KTK A;  3KOJ A;  1WVL A;  1CKM A;  1DYQ A;  4DR6 L;  3PIO 3;  4DV0 Q;  4PV1 C;  4GN5 A;  3Q22 A;  4GNX C;  2ZM6 Q;  2F0M A;  2QKI C;  3K7A H;  3GTL B;  1XPU A;  3H3V I;  4DN4 M;  4JI8 Q;  1HCZ A;  5IWA L;  2B39 A;  1KNA A;  4CJ1 B;  4DK0 A;  1DZ1 A;  3W2D A;  1XXG A;  4LF7 L;  3NP8 A;  5LL6 S;  4QCL A;  5IYD G;  1D5Z C;  3U58 A;  2XWJ B;  4H02 A;  4OGQ C;  3W1B A;  4HCE A;  4GOP C;  5M3F H;  2Q2I A;  3C3L A;  4DAP A;  4B9W A;  2LFN A;  1AE3 A;  1JIC A;  3FHW A;  5IYC H;  4DNR B;  2XRQ D;  4IFD H;  5C6A A;  4GKK L;  1PTO F;  5IT9 L;  5CYU A;  2E2I H;  1BCP C;  5FLX E;  1PTO H;  2IX1 A;  1B3A A;  4EQP A;  3K58 A;  5IP7 H;  3UDI A;  4LJZ C;  4A3C H;  4DR1 Q;  5D14 A;  1I6H H;  3OWF A;  3R93 A;  5ELO A;  5IOC A;  2ZXR A;  3GTJ B;  5ELN A;  2ZJQ A;  2VB3 X;  4XYQ A;  1TR5 A;  4KMU C;  1FD7 D;  1PLF A;  4JCV E;  1KXL A;  3AYH B;  1UWV A;  1Y1W G;  1H95 A;  3FP9 A;  1DCZ A;  2YYZ A;  1I6H B;  4DR3 L;  4XYO A;  4IUU A;  2YTX A;  5IGF A;  4KTA A;  4DPG A;  5JEA J;  3I73 A;  2I5L X;  1K0S A;  2VXW A;  2WV6 D;  3S1M H;  3VDY A;  4IUP A;  1Y69 U;  1PA6 A;  4R4I A;  4NPS A;  2I0Q A;  1X3G A;  3OHX C;  1JWS D;  1LTA D;  5DM6 3;  3E6Z X;  1SMY D;  1Y8N B;  4A3J H;  2WIN B;  2JA9 A;  2KEN A;  2BDO A;  5IGE A;  2B2T A;  2K28 A;  2RCF A;  1OXS C;  3CCE A;  2L5T A;  2ZTE A;  4G4K A;  5FLX L;  2WP8 J;  2Q8I B;  3J81 j;  4LFA L;  4LF5 L;  1HA6 A;  2MNA A;  1SE4 A;  1Z6H A;  1KIX A;  3L9A X;  2XIW A;  1GUT A;  1SXT A;  5HUR A;  1B9N A;  1LTG D;  2AQ2 B;  5EPK A;  1KAW A;  3NXW A;  5HY6 A;  2ATW A;  5C4X B;  2A5H A;  1CUK A;  3H3V C;  4PMB A;  2EYO A;  5A2Q E;  2I5M X;  5ELE A;  1IBL L;  1ET6 A;  4G57 A;  3CCV A;  4GKJ Q;  1ENF A;  1SNM A;  2IX0 A;  4JI7 Q;  2BCO A;  2ASB A;  3U4V A;  4CDE C;  1CZW A;  2JN4 A;  1PH7 A;  4Y52 H;  1Q1B A;  1XMQ L;  5EAY A;  4PMW A;  5CV7 A;  5J22 A;  3GTQ H;  2N49 A;  4OO1 I;  1CKN A;  3U9O A;  3KF6 A;  4A3D H;  2F0K A;  1I3Q B;  3QR8 A;  3DHQ A;  4LAA A;  2JA7 H;  4PQX A;  1QG7 A;  4V19 0;  3T56 B;  1VQP A;  2E5L L;  2HT1 A;  1STE A;  5IY0 A;  3M4P A;  1GHK A;  1JE5 A;  1XPO A;  1YBY A;  1WTH A;  2MO1 A;  4IPD A;  2D5D A;  1IBK L;  3S17 B;  2UUC L;  2Q8T A;  2PYK A;  4RCO A;  3HGB A;  4XQN A;  4HMI A;  5CBE E;  1VDZ A;  3EQL C;  2HCI A;  1KDB A;  1PV4 A;  2K50 A;  3K59 A;  2RHQ B;  2RVL A;  2JE6 I;  2B63 G;  2PNR C;  4LF6 Q;  1QZG A;  3OMC A;  2DNC A;  4IZ8 A;  4C1N I;  5C3X A;  3NBH A;  4C1N K;  1VQJ A;  1VQ4 A;  1H9S B;  3D4R A;  4UP8 A;  2KUM A;  1FGB D;  1BCP D;  1TY2 A;  3CCM A;  4QJF A;  1SE3 A;  4Z9C B;  1L0W A;  3MC0 B;  5KGU A;  1DOL A;  3TQY A;  3RMH A;  2K04 A;  5FLM H;  4MHE A;  3AQQ A;  1ILP A;  3TSS A;  3S1N H;  4B3M L;  4C3J G;  1WFQ A;  2ZXP A;  1X3Q A;  2OEO A;  1G29 1;  1CKO A;  4NW2 A;  3CHB D;  5C0X J;  5C4J B;  1IL8 A;  1J9O A;  3PV0 A;  2L9H A;  4F8M A;  1ENC A;  4IAL A;  4FVM A;  3CKI B;  4CDD C;  5E4W C;  4QUC A;  3NQT A;  1LT6 D;  4ZYS A;  3WOF A;  4A3I B;  5M5Y H;  4DV4 Q;  4NP5 A;  3J7A F;  2DN8 A;  4KHV A;  3H91 A; 
#chains in the Genus database with same CATH homology
 3CAM A;  3M9B A;  1FGU A;  1HNX L;  4DV0 L;  2UUB Q;  4JI1 L;  2JA6 G;  3TS2 A;  3S2H H;  4O2D A;  1WJJ A;  4OWT B;  2ZM6 L;  2A8V A;  3HOV G;  3DM3 A;  2GVB A;  2VUM H;  5M5X H;  4YHH L;  1Q86 C;  4P73 A;  1BVS A;  4GNX A;  4C2M H;  1VQA A;  4DV3 L;  1UE6 A;  4HIM A;  2OTL A;  3STB C;  5IYB G;  3M7N A;  1NY4 A;  1L1O A;  3CPW A;  2E2H H;  4A3B G;  4YWK A;  3RN2 A;  4HJ9 A;  4OON A;  3FKI G;  2NVT H;  4B3R L;  4BBR G;  3GTP H;  5C4X G;  1TXY A;  3PO3 H;  3RZO H;  3HKZ E;  4P72 A;  3RLN A;  5M5W H;  4A3K H;  4BXX H;  3GTK H;  1GKH A;  1X54 A;  1YEZ A;  3T1Y Q;  3ICE A;  1NMG A;  4JBM A;  3I4N G;  4LF8 L;  5E7N A;  1WOC A;  3STB D;  3T1H L;  1Q1E A;  4NXM L;  4GOP A;  1N8R C;  2LXJ A;  1D8L A;  3HOW H;  1JJG A;  2Y0S E;  3GTG H;  4PZ6 A;  2QEX A;  3M85 A;  2AKW B;  4YWM A;  2Q2H A;  5BR8 Q;  3RN5 A;  3HOY G;  3J7A 5;  4ALP A;  2ZTC A;  3TEH B;  1A8V A;  3ULP A;  3IRB A;  1B70 B;  4MZ9 A;  2MO0 A;  4OWX B;  3WWV A;  4DAY B;  3CCS A;  3L7Z C;  1Z47 A;  3J81 c;  3G4S A;  4DV1 Q;  2ES2 A;  1FJG Q;  4BA1 I;  4J15 A;  1E1O A;  4DK3 C;  2R7Z H;  2VNU D;  3CXC A;  3KJO A;  4UY8 C;  2R92 H;  1V1Q A;  3K81 C;  2YU9 H;  1PYS B;  2K4K A;  1I5F A;  2C35 B;  3W5O A;  3DLL A;  4GNX B;  1TWC H;  1LM0 A;  4AQY L;  1U0L A;  2YV5 A;  3F2C A;  3KF8 B;  4DR1 L;  1X3E A;  2PMZ E;  2HQL A;  5IP9 G;  4X64 L;  1L1O B;  3ZJY C;  4IJL A;  4JI0 L;  4DR7 L;  2DGY A;  3KDF A;  4LFB L;  1B7Y B;  4DUZ L;  1PH4 A;  5FLX c;  1XMO L;  2RCN A;  1AE2 A;  1NMF A;  1SR3 A;  1BBW A;  3KLW A;  3NEM A;  2PQA A;  3D31 A;  5IE8 A;  3GTL H;  4A3D G;  4ME3 A;  2CWP A;  5LMN W;  1OXT A;  3HOU G;  2D0O A;  1HZB A;  2KCT A;  3CCJ A;  4NXN L;  2GVA A;  1EQQ A;  2NZO A;  1HNX Q;  5AJ3 L;  4JI1 Q;  1YJW A;  4IJH A;  3J81 i;  4JG2 A;  1K8A C;  4A3M G;  4LF5 Q;  1TWF H;  4AIM A;  4POG A;  4GOP B;  4YHH Q;  3PO2 H;  1A0I A;  2EXD A;  1SN8 A;  2A19 A;  1K73 C;  4L5R C;  4OWW B;  5IYD H;  3OW2 A;  3PCO B;  2R6G A;  2UXB Q;  2OTJ A;  1N32 L;  3G71 A;  2JQO A;  5C3E G;  2JA8 G;  1CSP A;  1VQL A;  2UXC L;  1KHI A;  2UU9 L;  2OCE A;  4YY3 L;  4B3R Q;  4GLA C;  4R1J A;  2IT1 A;  2CQO A;  3PUV A;  2PI2 A;  2K75 A;  1PH2 A;  4IOA A;  2R93 G;  3UDF A;  3PUY A;  5J3B A;  4JI6 Q;  5LMN L;  2AHO B;  4AYB G;  1IBL Q;  2QA4 A;  4X62 L;  3UDG A;  4LF8 Q;  1QUQ B;  3T1H Q;  1TWG H;  1PH6 A;  1TWH H;  2QGQ A;  1FL0 A;  1WYD A;  4DUY L;  1PH3 A;  1B8A A;  4A93 G;  5LMU L;  1YI2 A;  1EFW A;  4WJ3 M;  4DV2 L;  1QVC A;  2PQA B;  1A63 A;  2YTV A;  5M3M H;  1XMQ Q;  1JJC B;  1GM5 A;  3RZD H;  2CCZ A;  2OQK A;  1J5E Q;  1YNX A;  1PHJ A;  2HHH Q;  1HZC A;  2VQF L;  1E7Z A;  3I2Z A;  2E2J H;  2JA5 H;  4B3S L;  1XNQ Q;  2FXQ A;  3A5U A;  3CCU A;  4JI3 Q;  1OXU A;  3H0G H;  3GTJ H;  2F4V L;  2YTY A;  3M3Y H;  1N9W A;  4AQY Q;  1R9T H;  2B3G A;  5H1S E;  1M90 C;  1WI5 A;  1A62 A;  1W3S A;  2I5H A;  1Y1W H;  4UP7 A;  1VQK A;  3KJP A;  3JAM i;  1Q81 C;  4DR7 Q;  3S1R H;  1VQ8 A;  1K83 H;  5FLM G;  1DGS A;  3I7F A;  1PH9 A;  1XMO Q;  3BZK A;  3J80 c;  2Q2U A;  1N33 L;  2E5L Q;  3UDX A;  4BBS H;  1N34 L;  2UUA L;  3I4M H;  3PSI A;  4A3L G;  2VW9 A;  2E8G A;  4X66 L;  4GKJ L;  4BY1 H;  4JI4 L;  4NXN Q;  4JI2 Q;  1ASY A;  5AJ3 Q;  3MEF A;  3NBH B;  4DV6 L;  4A3E G;  4A3I G;  2NN6 G;  4OXP A;  4RMF A;  3PIP A;  1C0A A;  3G48 A;  1Y14 B;  1ASZ A;  4DV5 Q;  5IT9 c;  2OWO A;  4LUZ A;  3ULJ A;  4OO1 G;  4LF9 L;  4WJ4 A;  3OYY A;  1WCM H;  4JI5 L;  1N32 Q;  1VCI A;  3HOX H;  3I56 A;  1M1K C;  3M4Q A;  5GAD C;  1JB7 A;  2ID0 A;  3A5Z B;  2BH2 A;  1I94 L;  2JJQ A;  4PG3 A;  1EWI A;  1XTD A;  2F52 A;  4BA2 I;  3RR5 A;  1Z9F A;  2R7F A;  3PUW A;  1KD1 C;  4DK6 C;  3S2D H;  4A76 A;  2V1C C;  1Y1V G;  4HIO A;  4JI8 L;  1HNW L;  4JYA L;  1RIP A;  2WFW A;  1VQE A;  2N3S A;  2D62 A;  1UE1 A;  3H3V H;  3LGJ A;  1VQC A;  2KHI A;  4YWL A;  5C44 H;  4HJA A;  2D0P A;  2JA6 H;  4DR2 Q;  4JC0 A;  3I4O A;  3HOV H;  1BKB A;  4IFD I;  1VQI A;  3HOZ G;  1PH5 A;  2VUM G;  1Q46 A;  2WB1 G;  1XJV A;  1SFO H;  3HOW G;  1PFS A;  4QGU A;  5LMU Q;  2DUD A;  3F2B A;  4DV2 Q;  1HR0 W;  1YHA A;  3L0O A;  4JBJ A;  4JOI A;  4LFC L;  1VQF A;  4C3I H;  4QQB X;  2KHJ A;  3ERS X;  3OTO L;  5C4X H;  5FJ8 G;  4APV A;  2VQF Q;  4XTC S;  1JJ2 A;  4B3S Q;  4R4T A;  1JMC A;  5GRO A;  5C0X G;  4A3K G;  2F4V Q;  1VQG A;  3NEN A;  4B3M Q;  4L5T A;  3PF5 A;  1MJE A;  3AEV A;  3G6E A;  4GS3 A;  2Z6K C;  4FDB A;  4KHP L;  2Q2T A;  2K5N A;  1YHB A;  3I4N H;  4IPG A;  4DR4 Q;  5K36 G;  4DR5 L;  1V9P A;  3ULL A;  4DKA C;  1E22 A;  4XIG S;  3PUX A;  3F8T A;  4A3F G;  1HNZ Q;  1QZH A;  4IPH A;  1K0R A;  2VQE L;  4JV5 L;  1N33 Q;  3BJU A;  1PH1 A;  3KYH C;  4A3G H;  1N34 Q;  2IY5 B;  2UUA Q;  1X6O A;  1XNR L;  2H5X A;  1VQN A;  1GD7 A;  4X66 Q;  1HR0 L;  4R4O A;  2JK8 A;  3Q8D A;  1IBM L;  3CC2 A;  1NE3 A;  4DV6 Q;  3PF4 A;  3CQZ H;  1CSQ A;  2K5V A;  4TQU S;  2VY3 A;  2Y0S G;  4DV7 L;  1HJP A;  2EQS A;  1X9N A;  1N36 L;  2R92 G;  4BY7 G;  1D7Q A;  1C9O A;  5GAG C;  1YIJ A;  1E1T A;  3EIV A;  5JJK A;  3KOJ A;  1I3Q H;  1CKM A;  2UXD L;  4QY7 A;  2JA7 G;  4DR6 L;  4DV0 Q;  2ZJR A;  2MFI A;  4GN5 A;  1HZ9 A;  4GNX C;  2ZM6 Q;  4HID A;  1UEB A;  3D0F A;  3K7A H;  3GDE A;  1S40 A;  1PH8 A;  1L1O C;  1XPU A;  3K8A A;  3H3V I;  1SRU A;  3UE0 A;  4JI8 Q;  3F1Z A;  5IWA L;  4LW1 A;  4DV3 Q;  1EIF A;  1HH2 P;  3E9H A;  3S24 A;  1U5K A;  3S17 H;  4K0K L;  4LF7 L;  3PO2 G;  4PZ8 A;  5IYD G;  3U58 A;  4H02 A;  3W1B A;  1MKH A;  4AYB E;  5M3F H;  2Q2I A;  4GOP C;  4LFC Q;  2NVX H;  3RLF A;  3OTO Q;  3BU2 A;  1AE3 A;  4NXM Q;  2B63 H;  1NJI C;  1IYJ B;  3FHW A;  3KDF B;  5IYC H;  4YCV A;  1XPR A;  4HIK A;  2BA1 A;  2MQH A;  4LUO A;  4LUV A;  3GO5 A;  1KRT A;  1OTC A;  3CCL A;  4B3T L;  4UP9 A;  4GKK L;  4RG1 A;  4DR5 Q;  2CWA A;  4JBW A;  2E2I H;  1EYG A;  1VQ5 A;  2IX1 A;  1EOV A;  2VQE Q;  4JV5 Q;  3HFZ B;  1X56 A;  3S14 H;  5IP7 H;  3H15 A;  3UDI A;  1Q12 A;  3CP0 A;  4MTN A;  1HR0 Q;  1NBW A;  4A3C H;  5GQO A;  4DR1 Q;  2KBN A;  1MIU A;  4KHZ A;  3K0X A;  4X64 Q;  1IBM Q;  1FVI A;  1PVO A;  4JI0 Q;  2NVY H;  3EN2 A;  1I6H H;  2AMC B;  1T9H A;  4X6A H;  4HJ7 A;  4LFB Q;  5GAE C;  5ELO A;  4DUZ Q;  4DV7 Q;  4P71 A;  3NEL A;  3GD7 A;  4C3J H;  5ELN A;  2ZJQ A;  2XTI A;  2CKZ B;  4DNI A;  4JCV E;  1KXL A;  3AYH B;  2N78 A;  4TVA B;  2UXD Q;  1UWV A;  1Y1W G;  4JI7 L;  1H95 A;  3FP9 A;  2YYZ A;  1JT8 A;  4C3H H;  5C4J H;  4DR3 L;  3S16 H;  1O7I A;  4QL5 A;  3GTM H;  1BBU A;  2YTX A;  4DPG A;  5BR8 L;  5JEA J;  4BBS G;  4A3L H;  2I5L X;  3I4M G;  5IWA Q;  3S1M H;  3CD6 A;  3VDY A;  4IO9 A;  1PA6 A;  4R4I A;  1EIY B;  4X65 L;  1PYB A;  4NPS A;  2I0Q A;  4IOC A;  1X3G A;  4A3I H;  1E3P A;  4GLX A;  2UXC Q;  1YHQ A;  2UU9 Q;  2VL6 A;  2IHF A;  4YY3 Q;  1GVP A;  1QVG A;  3J80 i;  3E0E A;  2BH8 A;  3A0J A;  5JJL A;  4KLK A;  4A3J H;  1I50 H;  2JA9 A;  2KEN A;  5LMN Q;  2ZTD A;  4P74 A;  4NB3 A;  4X62 Q;  1OXS C;  3CCE A;  2F3I A;  1KL9 A;  2ZTE A;  2WB1 E;  4DUY Q;  1Y1V H;  4LWC A;  2WAQ G;  1X3F A;  4B3T Q;  2WP8 J;  3MXN B;  2K52 A;  5IYB H;  4A3B H;  3J81 j;  1YZ6 A;  1YIT A;  4LFA L;  5C44 G;  3S1Q H;  1OXV A;  2AWN A;  1G51 A;  1RL2 A;  4LF5 L;  2L15 A;  3FKI H;  2K5H A;  1K9M C;  3HOZ H;  4BBR H;  2R7D A;  2MNA A;  1YJ9 A;  4LF4 L;  1KIX A;  2ALY B;  3BZC A;  3PO3 G;  2AWO A;  1GO3 E;  2UXB L;  4BXX G;  4GLV B;  4A4I A;  3I55 A;  1J6Q A;  3L2P A;  2ZJP A;  1KAW A;  5HY6 A;  2RF4 A;  2ATW A;  3RLO A;  1X65 A;  1E24 A;  5FJ8 H;  4UPA A;  3CC4 A;  1YVC A;  1CUK A;  3AFP A;  4L5Q A;  1LYL A;  2HIV A;  3K7U C;  2OQ0 A;  3HKZ G;  4YCU A;  3CCR A;  1VQM A;  1C7Y A;  4LF6 L;  4LNQ A;  3K80 C;  3HOY H;  2LSS A;  4JI6 L;  2JEA I;  2I5M X;  2KCM A;  1IBL L;  3CCV A;  4GKJ Q;  3JC6 6;  2IX0 A;  3UE1 A;  5JEA G;  4JI4 Q;  4JI7 Q;  4IFD J;  4DR3 Q;  3E9I A;  2ASB A;  3U4V A;  4A3F H;  2B29 A;  1PH7 A;  4GN3 B;  2R7Z G;  4Y52 H;  1S3O A;  4A3G G;  2VZA A;  1Q1B A;  1OXX K;  2HIX A;  3U50 C;  5HGQ A;  4LF9 Q;  1XMQ L;  2NN6 I;  4JI5 Q;  4JBK A;  5EAY A;  1V43 A;  1K3R A;  4PMW A;  5IP9 H;  1J5E L;  4X65 Q;  3CME A;  4HJ5 A;  1P16 A;  2K14 A;  2HHH L;  3GTQ H;  2N49 A;  1K8G A;  3PIO A;  1I94 Q;  1X55 A;  4OO1 I;  1Q7Y C;  1XNQ L;  1CKN A;  2NZH A;  4JI3 L;  4BY7 H;  4KI0 A;  3KF6 A;  4A3D H;  4QIW E;  4Y7N H;  3TS0 A;  1LUZ A;  2RHS B;  3HOU H;  1HNW Q;  4JYA Q;  4OX9 L;  1QUQ A;  2XGT A;  3W1G A;  2JA7 H;  3CMA A;  1KQS A;  3EBE A;  2N8N A;  2NVQ H;  4A3M H;  4L5S A;  2VS1 A;  1VQP A;  2E5L L;  2HT1 A;  4JOI C;  1KC8 C;  1S72 A;  5IY0 A;  1SRO A;  1SMX A;  3M4P A;  5C3E H;  4EX5 A;  2JA8 H;  4JI2 L;  1JE5 A;  4DAM A;  1YBY A;  1XPO A;  1G6P A;  4LFA Q;  3RNU A;  2MO1 A;  3TRZ A;  3CW2 C;  4A3J G;  3ER0 A;  4DV4 L;  4PZ7 A;  3PUZ A;  4IPD A;  1IBK L;  1EUJ A;  3B6Y A;  3HKS A;  2UUC L;  4LF4 Q;  4DV5 L;  1NTG A;  4MNO A;  2IHE A;  2R93 H;  3TRE A;  1VQ6 A;  1VQ7 A;  3CCQ A;  1IZ6 A;  4GN4 B;  2UUB L;  5M3F G;  3GTO H;  4KHP Q;  1PV4 A;  2K50 A;  1QVF A;  5C0X I;  1HZA A;  2RHQ B;  4HJ8 A;  4R4Q A;  2JE6 I;  2PNH A;  3CF5 A;  4P75 A;  2B63 G;  5DLQ E;  1IXR A;  5JJI A;  4LF6 Q;  1QZG A;  5IYC G;  4A93 H;  1VQO A;  1CKN B;  1MJC A;  1W2B A;  1VQD A;  2CFM A;  4IFD G;  1VS0 A;  3KF6 B;  4IPC A;  1XNR Q;  3M4O H;  5M3M G;  2BA0 A;  1AH9 A;  4DR2 L;  3JAM c;  1VQJ A;  3CC7 A;  1VQ4 A;  3J7Z C;  1L2F A;  1UE7 A;  1VQH A;  2LXK A;  4UP8 A;  2JA5 G;  1N36 Q;  1EQR A;  3AFQ A;  3T1Y L;  3H0G G;  3S15 H;  5IP7 G;  3CCM A;  4QJF A;  1VQ9 A;  3A74 A;  5GAH C;  1L0W A;  2PI2 E;  4A3C G;  2JEB I;  2GN5 A;  3TQY A;  3F2D A;  1YJN A;  3KFU A;  4DR6 Q;  1Q8K A;  2Z0S A;  4EQ5 A;  3AQQ A;  5FLM H;  4A75 A;  4GKK Q;  3S1N H;  1TWA H;  4B3M L;  1P8L A;  1IL2 A;  1WFQ A;  1G29 1;  1CKO A;  4DR4 L;  4OX9 Q;  1KRS A;  1SE8 A;  1Q82 C;  5C0X J;  4BY1 G;  2Z6K A;  4A3E H;  4DV1 L;  3PV0 A;  1HNZ L;  1FJG L;  2EIF A;  1LTL A;  4R4C A;  3CPF A;  4O0A A;  4LF7 Q;  4K0K Q;  2A1A A;  4AH6 A;  1WCM G;  1VQB A;  3HOX G;  3SGI A;  5M5Y H;  4DV4 Q;  1UE5 A;  1IBK Q;  2UUC Q;  3U4Z A;  3PGZ A;  2WAQ E;  1SLJ A;  4POF A;  4YCW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...