1MJCA

Crystal structure of cspa, the major cold shock protein of escherichia coli
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
69
structure length
69
Chain Sequence
SGKMTGIVKWFNADKGFGFITPDDGSKDVFVHFSAIQNDGYKSLDEGQKVSFTIESGAKGPAAGNVTSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of CspA, the major cold shock protein of Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription regulation
molecule keywords MAJOR COLD-SHOCK PROTEIN 7.4
total genus 12
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 1994-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1mjcA00
2F52A 5J3BA 3S17H 3RLNA 2Q2UA 3UDFA 3UDGA 3M4QA 1QVFA 1HZ9A 3ULLA 2EIFA 1QZGA 1FJGQ 4YWKA 3GD7A 3GTKH 1NMFA 1WFQA 4IJLA 2UU9L 3PSIA 1JE5A 3HOZG 1T9HA 4GKJL 3CCLA 4JOIA 3LGJA 3NELA 1K8GA 1WJJA 2DGYA 4DKAC 4JI3Q 2OTJA 4A3KH 3HKZG 1LTLA 2L15A 4EQ5A 3PIPA 2CCZA 2Y0SE 4BA1I 4J15A 4DV2Q 3HOYG 2QGQA 1C9OA 3TQYA 4UY8C 2CWPA 3KF6A 3JAMi 5C44H 2B63G 2UXCL 1VQGA 3UE0A 3A74A 3GTQH 1WYDA 3K7AH 1X65A 4DR7Q 3U58A 3I55A 4DV4L 1IBKQ 5AJ3Q 3CCJA 3CPFA 4LF6L 2F3IA 2PQAB 5C0XG 1S72A 2HHHL 2UXBL 2KHIA 5LMUL 1W2BA 3G4SA 2NVXH 1YJ9A 1N36Q 5EAYA 1HZCA 1X56A 3JC66 1L2FA 1O7IA 3ULJA 3CCUA 4HIKA 1N32Q 1CKOA 4LF5L 2H5XA 4JOIC 1PH8A 2E2IH 3CQZH 5ELOA 1XNRQ 1HNWQ 4A3KG 1VQ6A 3K0XA 3W1BA 1L1OC 1R9TH 4YWLA 2V1CC 3G6EA 3KOJA 3NBHB 1N36L 1Z47A 1V9PA 1X6OA 4B3MQ 2VZAA 3TS2A 3BJUA 1KD1C 3S2DH 3CW2C 2HHHQ 5GAEC 3J80c 4LFAQ 1Q1EA 2N78A 3A5ZB 1X9NA 1IZ6A 5AJ3L 4DR4Q 2LSSA 3T1HL 4YHHQ 3FKIH 4B3ML 3CCSA 4LW1A 5C4XG 1VQEA 2XTIA 1X3FA 4A76A 5C0XI 3IRBA 4DR1L 2R7ZH 3H3VH 4JBJA 3OTOL 4DV6Q 2KBNA 2JK8A 4LFCL 4LF5Q 2K52A 4QGUA 5FLXc 1N8RC 1TWGH 1C7YA 4JBKA 4BY1G 1J5EQ 4YY3L 1Q81C 1MJEA 3L2PA 3CMEA 2VY3A 4B3TQ 3GDEA 3OTOQ 4DV6L 3PUXA 3S1QH 3S24A 4IFDI 3HFZB 4BBRH 1JJGA 2VQEL 4BBSH 4GLVB 1B8AA 2LXJA 1VQMA 2RCNA 3J81c 4QQBX 2IX0A 1SLJA 5C44G 2B63H 1MJCA 4JG2A 1L0WA 2HIXA 3U4VA 5HY6A 4Y52H 3A5UA 1YITA 4MNOA 1Q12A 3I4OA 2R92G 4DK3C 4DK6C 5IP7G 1Y1WG 1Y1VH 2XGTA 1JJ2A 4AH6A 4LUZA 4GKKL 1J6QA 2VQFL 3PO3G 2UXDQ 3CC2A 4WJ3M 2ZJPA 5E7NA 3K7UC 1XMOQ 3M4OH 4P73A 3STBC 3HKZE 4X62Q 4ALPA 2AWNA 3PO2G 2VQFQ 2Y0SG 2ALYB 3Q8DA 4L5TA 4YY3Q 4LWCA 2WAQE 1UE6A 4POGA 1X54A 3ERSX 1K0RA 3VDYA 3J81i 1UE7A 3CC4A 3GTMH 2E8GA 3HOUG 1KC8C 4B3RQ 1I94Q 2R92H 4JV5L 5M3FH 3AEVA 5IP7H 3CCMA 1KAWA 1XJVA 2D0PA 1NE3A 1FGUA 1A8VA 3PUWA 1PH2A 1AE3A 4NB3A 5GQOA 2A1AA 4RMFA 3PUYA 4A3FG 5C0XJ 1HR0W 4LF7L 1QUQA 5BR8Q 1Q86C 3KYHC 4GLAC 2AWOA 4HJ8A 4B3TL 1K3RA 3KFUA 1PVOA 4DR3Q 1B70B 3CCVA 4XIGS 4DPGA 4DV7Q 2ZJQA 1XNQQ 4GKKQ 4LF7Q 1GO3E 1YIJA 2NVTH 1KXLA 4A3DG 1G51A 1N9WA 5LMUQ 3F8TA 4DNIA 4HIMA 4GLXA 1CKMA 4IFDJ 3CXCA 5JEAJ 2AMCB 4JI1L 4X65L 4AYBG 1X3EA 3RR5A 4C3IH 3S2HH 4JV5Q 1OXUA 4B3RL 2PQAA 1A63A 3ULPA 2EXDA 5IE8A 4C3JH 1TWAH 4HIDA 4JYAL 2IT1A 4QY7A 4IOAA 3FP9A 4P71A 5FLMH 1SRUA 1YNXA 4DR5L 1XMOL 3PIOA 1TWFH 1YHAA 2C35B 1YEZA 3PO3H 1IBML 3AFPA 4X62L 1WCMH 3G48A 4LF4L 3HOWH 4HJ7A 1IL2A 5IYBG 3M85A 2VQEQ 4PZ7A 1VS0A 5K36G 2MO1A 1K9MC 1HNZQ 1BVSA 3S1MH 1PHJA 2MNAA 3CMAA 5HGQA 4LFCQ 4IFDG 5M3MH 3CAMA 4NXNQ 1X55A 4A3JH 3W5OA 4AIMA 4KHZA 3DLLA 1M1KC 1WOCA 4IPCA 4DV4Q 3RNUA 3HOYH 2VUMG 1XPRA 1FJGL 4A3GH 3I4NG 4GN5A 1JMCA 1GD7A 1OXXK 4APVA 5M3FG 3SGIA 4DV5L 4MTNA 3PCOB 1YHQA 2ZTCA 4OO1G 1VQKA 2E2HH 2RF4A 4DV7L 1QVGA 1XNQL 1MKHA 5C3EG 3U50C 4NXMQ 1OXVA 1WCMG 4JI3L 2YV5A 1VQ4A 5M5XH 3NENA 3H15A 1EYGA 1OTCA 2JA5H 1HNWL 4IJHA 2E5LQ 1HR0L 1NBWA 1HH2P 2JE6I 3AQQA 4YCUA 4C2MH 1UE5A 5IWAQ 4DR1Q 1PH3A 2NZHA 4A3DH 1VQ8A 2WB1G 1U5KA 2UXDL 3F1ZA 3KLWA 4LUVA 4XTCS 4DR4L 5M5WH 1VQHA 4L5QA 1BKBA 4YHHL 1PH7A 1XPOA 1E24A 1RIPA 5M5YH 2UXBQ 4JBMA 4O2DA 3J80i 1Q7YC 4UP9A 1JB7A 2I5HA 5GADC 1G291 3HOXH 3OW2A 1I3QH 3BU2A 1SE8A 2GVBA 4JI2L 2D0OA 2A8VA 2FXQA 4QIWE 5IT9c 3CCRA 1S40A 3D31A 2PI2A 3EBEA 4NPSA 1E22A 4POFA 4HJ5A 1HNXL 4JI4Q 3HOWG 2HQLA 4JI7L 2R7ZG 1YZ6A 4JI0Q 3CD6A 1SMXA 4L5RC 5IY0A 4A3BG 4DR6Q 1IYJB 4LFBQ 2NN6I 1PH4A 4B3SL 1I6HH 2ATWA 1PYSB 1P16A 1KRSA 2E5LL 5IYDH 4GKJQ 1W3SA 2UUCL 3BZKA 3ER0A 2YTVA 1VQDA 3AYHB 2R7FA 4YWMA 4A3MH 3TS0A 3M4PA 4DV5Q 4DV2L 1G6PA 2NVYH 4JI6Q 2GN5A 1L1OB 4JI1Q 4X65Q 4JI0L 4DR6L 2RHQB 1OXSC 4HJ9A 1HZBA 3CP0A 4H02A 2PMZE 1TXYA 1KL9A 1J5EL 3M3YH 1RL2A 1UE1A 2JA9A 5IWAL 1VQIA 3TEHB 5C3EH 4LF8L 3E9IA 2IX1A 1YI2A 3ICEA 1EQRA 1CKNB 3PF4A 3K8AA 3MEFA 4DR5Q 5BR8L 2N3SA 4DAMA 4DR3L 2PNHA 3K80C 4JI6L 3GO5A 2K14A 4OO1I 4DV3Q 3UE1A 1ASYA 1PFSA 4GOPC 1AH9A 3L7ZC 2UUCQ 5GAHC 4OONA 4QL5A 4DV0Q 1TWCH 4JCVE 1NMGA 2CFMA 1Q82C 2ZTDA 1H95A 4LFAL 4IO9A 3HKSA 2QA4A 5IYCH 5JEAG 2K4KA 5GROA 4LFBL 2ID0A 1MIUA 1AE2A 4EX5A 2ASBA 4JI5Q 3BZCA 4BXXH 3RN5A 2ES2A 1EIFA 1X3GA 4JI4L 2OCEA 2KCTA 4OX9L 2JEAI 4A3CH 5LMNW 1VQ5A 4K0KL 3KJOA 4NXML 3D0FA 1V1QA 2WP8J 1CKNA 2MFIA 4LUOA 1EWIA 4R4CA 3F2DA 1E1OA 2B3GA 4R4TA 1BBWA 4AQYL 3RLOA 4JYAQ 4A3LH 4TQUS 5C4XH 4X64Q 1K8AC 3GTJH 2OWOA 3KDFB 1K83H 3STBD 1SR3A 4DV1Q 4PZ6A 3NEMA 3W1GA 4GNXC 4R4OA 4P72A 1YJNA 2UUBQ 3OYYA 5H1SE 4LF4Q 2Q2TA 4K0KQ 1XNRL 5IYCG 1XMQQ 1VQFA 4X66Q 1SROA 2JA8H 2R7DA 4UP7A 5ELNA 4WJ4A 4BBSG 1QZHA 2I5LX 4PZ8A 4YCWA 4A3CG 1XMQL 1IXRA 1Y14B 3CCEA 3ZJYC 1EOVA 3KF6B 3KF8B 1N33Q 3I4MH 2NN6G 1HZAA 4PG3A 4DR2L 1CSPA 4O0AA 1KHIA 2NVQH 2R6GA 5M3MG 1Y1WH 1NY4A 1Y1VG 3M9BA 1HR0Q 3GTPH 3EN2A 1PH1A 2UUAL 1N34L 4R4QA 1B7YB 3I56A 2NZOA 2N8NA 5IP9H 1VQPA 2AKWB 1WI5A 4GOPB 2DUDA 3KJPA 5LMNQ 1EFWA 1E1TA 3I4NH 3HOZH 1A0IA 2K75A 2PI2E 1TWHH 1HNZL 4A3IH 3S1NH 2AHOB 2A19A 1PYBA 2IHEA 5JJLA 1EIYB 3S15H 3S1RH 4IPDA 3RZDH 2R93H 4Y7NH 1HNXQ 1VQBA 1VQJA 3G71A 4OWWB 4AYBE 4TVAB 3PO2H 4OXPA 3I4MG 4BA2I 3FHWA 2ZJRA 3F2BA 4DV0L 3K81C 1VQ7A 1UEBA 3H0GG 2JA7H 1VQNA 2YTXA 3HOVG 4QJFA 4FDBA 4AQYQ 2UUBL 2UXCQ 2I0QA 3B6YA 3JAMc 2K5HA 1U0LA 1QVCA 1YHBA 1E7ZA 2JJQA 3U4ZA 4IPGA 5IP9G 4DV3L 1IBLL 3HOUH 4BY7G 1BBUA 4JI5L 1S3OA 3I7FA 2MQHA 1KIXA 4A93H 1PH5A 1CSQA 4GOPA 4A3EH 4B3SQ 2Z6KA 4GNXB 3H3VI 5DLQE 4JI8Q 1VQOA 3S14H 4R4IA 1XPUA 1FL0A 2I5MX 4KLKA 5JJIA 1IBMQ 2YU9H 3J7A5 1YBYA 4HIOA 3I2ZA 1XTDA 4JC0A 2Q2HA 3UDIA 2WAQG 4IOCA 2YTYA 2LXKA 2Z6KC 3H0GH 1N34Q 5GAGC 1PA6A 2UUAQ 2JA7G 2IY5B 3RLFA 2F4VQ 5JJKA 2JA6H 2JA8G 2B29A 5FJ8G 2CWAA 4BY7H 1LUZA 1NTGA 4KHPL 1UWVA 2IHFA 2K5NA 2Z0SA 4BY1H 3UDXA 3S16H 4X6AH 1CUKA 4A3EG 2ZM6Q 3T1YQ 1VCIA 2OTLA 4A3IG 4BBRG 4A3JG 3WWVA 2BH8A 1SFOH 4GNXA 4OWXB 1VQLA 2R93G 3MXNB 5IYBH 2VW9A 2ZM6L 2HIVA 3T1YL 4DUYL 4UP8A 4A3GG 1Q8KA 2OQ0A 1VQCA 2CKZB 4P75A 1IBKL 3E9HA 4KHPQ 1IBLQ 1D8LA 4UPAA 4ME3A 3F2CA 1GVPA 3L0OA 4L5SA 4A3MG 4DUYQ 4YCVA 1N33L 1JT8A 1N32L 1L1OA 4RG1A 3EIVA 2VUMH 1JJCB 1EUJA 1GM5A 1C0AA 2ZTEA 4X64L 4GN4B 1KRTA 4JI8L 3TREA 3J81j 1KQSA 2RHSB 4P74A 2F4VL 4C3HH 4A93G 2VNUD 4OX9Q 2MO0A 4LF9L 1M90C 4DAYB 1Q1BA 2UU9Q 4JI2Q 2YYZA 1LM0A 1V43A 2K50A 1P8LA 1LYLA 2KHJA 2BA0A 3PUVA 2GVAA 4OWTB 4X66L 2JA5G 3M7NA 4BXXG 3GTLH 3T1HQ 2JQOA 4JI7Q 2BH2A 4DUZL 3CC7A 1A62A 3DM3A 3GTOH 2OQKA 3A0JA 3PGZA 4MZ9A 3GTGH 2Q2IA 1EQQA 3HOXG 1PH6A 1SN8A 3AFQA 1PH9A 1YJWA 2JEBI 4A3FH 1PV4A 4LF6Q 1I5FA 3KDFA 2K5VA 2JA6G 5FJ8H 1OXTA 3RN2A 2VS1A 2N49A 1K73C 4LNQA 4A3LG 4DR2Q 2KCMA 3PUZA 2KENA 4DR7L 1YVCA 1HJPA 4PMWA 2BA1A 2E2JH 3PF5A 1VQAA 1QUQB 1I50H 4KI0A 3CF5A 3PV0A 4LF9Q 4HJAA 4GN3B 4DUZQ 3J7ZC 5IYDG 1ASZA 3RZOH 5LMNL 3HOVH 3E0EA 4LF8Q 3CPWA 2HT1A 1Q46A 1D7QA 4A3BH 3TRZA 2WB1E 2CQOA 1I94L 2WFWA 5C4JH 1FVIA 4A75A 2QEXA 4IPHA 4DV1L 4NXNL 1VQ9A 3CCQA 1E3PA 2D62A 4GS3A 1NJIC 1DGSA 1Z9FA 3FKIG 2VL6A 1GKHA 4JBWA 4R1JA 2EQSA 4A4IA 5FLMG
chains in the Genus database with same CATH superfamily
4O42A 4ZUJA 1QZGA 4YWKA 5JOBA 2L5TA 1X3PA 1SNOA 3PSIA 5ELCA 3HOZG 2ENBA 4GKJL 1SE2A 3LGJA 3NELA 2OTJA 1CHPD 1JWUD 2F0IA 3HKZG 3BVMA 1ENFA 4J1MA 2CWPA 5CR3A 3JAMi 5C44H 2LMCB 3Q23A 2MP1A 5CV9A 3GTQH 2PZUA 1PFBA 1X65A 4OO1H 3I55A 4DV4L 3R8BA 4LF6L 1LT6D 2F3IA 2UXBL 2HHHL 3C46A 3FKIB 3S16B 1D1KA 1BCPD 5DAUA 1CTMA 1N36Q 1Q90A 1X56A 3JC66 3NSWA 3CCUA 4HIKA 4LF5L 2AQ1B 4JOIC 4FP5D 3RUZA 1HNWQ 3W1BA 1R9TH 3G6EA 1E2ZA 1N36L 2FJ2A 2VZAA 3DUZA 2MPMA 2I07B 3EJIA 4YHHQ 4B3ML 5C4XG 4DGZA 2XTIA 4JBJA 4KJOA 3OTOL 2KBNA 3N52A 4LF5Q 1HQRD 1PDQA 5BN4A 1N8RC 2PMZB 4BY1G 1Q81C 1KTKA 3L2PA 2VY3A 1Y1VB 4DV6L 3S1QH 4OHJA 4Q5VA 1XX8A 4UHVA 1SLJA 4BY1B 2B63H 4C3IG 1F9PA 2F0PA 4JG2A 4G7ZC 1DCZA 3D8GA 5HY6A 5I6YA 3A5UA 2A6ED 1Q12A 3I4OA 1DOMA 1K0SA 1JJ2A 1J6QA 5G3LD 3DEOA 2VQFL 2ZJPA 1XMOQ 3M4OH 4XQQA 4P73A 4X3UA 4X62Q 1PRTF 2Y0SG 1C4QA 2ALYB 4LWCA 2WAQE 1DXMA 4RKLA 4HSPA 3NWSA 5K5PA 3D3RA 1GHKA 1JOKA 3VDYA 1SNMA 1SBBB 2QDLA 4B3RQ 3NQTA 1I94Q 2H1EA 1B9MA 5IP7H 3KFUA 2DNEA 4MHEA 3W2DA 1AE3A 1HR0W 1R4PB 2A1AA 3OPOA 5C0XJ 4FXKC 1K3RA 3EFXD 1CT1D 3PO3B 4DPGA 1XNQQ 3KBXA 1YIJA 1HPCA 1N9WA 3Q22A 3GTLB 3HKZB 5C5LA 3S1QB 3ND8A 1X3EA 3RR5A 5JVG3 4B3RL 1A63A 3I70A 3ULPA 5IE8A 1TWAH 2MUYA 4IOAA 3NPPA 3FP9A 3OWEB 1JWSD 1I4RA 3G48A 1WTVA 1FD7D 1E2VA 1MHWC 3S17B 5HGQA 1EFID 3CAMA 1X55A 3W5OA 5ELDA 4AIMA 3DLLA 5FOBB 1MSGA 2VUMG 1DZ1A 1SYDA 1XPRA 4A3GH 4RGOS 1JMCA 1GD7A 1F2YA 1OXXK 5T1IA 2N55A 1TS4A 3PCOB 3D4DA 1VQKA 1K3BC 4M1UB 2O5JC 1QVGA 1B1ZA 1MKHA 2EYFA 4NXMQ 1OXVA 1WCMG 2YV5A 5M5XH 2E5LQ 1CK1A 4C2MH 2XN9C 1UE5A 5IWAQ 3SK4A 2WB1G 2XWBB 4KN7C 2XRQD 1STEA 4H13C 1H9KA 2J7ZA 1PH7A 1E24A 1RIPA 5GADC 1G291 3OW2A 1I3QH 3BU2A 5DNFA 2GVBA 1IHZA 2EYJA 4B3SQ 4GKKQ 4DXGA 2SNSA 1E22A 1HNXL 5JAVA 2VXWA 1ML0D 1V1PB 1YZ6A 5IY0A 1IYJB 2NN6I 2O2LD 2ATWA 4Y7NB 1P16A 2E5LL 5IYDH 4GKJQ 1WTPA 2QILA 2B2TA 4N9TA 3ER0A 4PMCA 1QJOA 1CQVA 1EOTA 1UAPA 2F0EA 3S1NB 4YWMA 3DHQA 2F0VA 4DV5Q 3IAYA 2XRSD 5KGUA 4F8MA 1L1OB 1UUPA 1G91A 3HP3A 4KN4C 4HJ9A 4PNYA 3CP0A 3GQBA 2PMZE 1F77A 1KL9A 1STNA 2RQXA 3M3YH 1RL2A 5C3EH 1VQIA 2IX1A 3NTKA 2G9HD 3VA5A 2WKCA 1CKNB 3MEFA 2B2WA 2F0FA 2B39A 4FO2A 4JI6L 3GO5A 1PZKD 2K14A 1ASYA 1PFSA 5J39A 2MHVA 1WTOA 4QUFA 1PFMA 2F0TA 2M00A 2AQ2B 2PZTA 3EROA 3VR5A 2F1MA 2CFMA 2CW0D 3ND9A 1EEFD 5KYIA 3HKSA 2ID0A 1MIUA 1AE2A 4EX5A 4CJ0B 4BXXH 3V05A 4L8JA 2KVMA 3VYTA 5DM63 2ES2A 1TWAB 1NAPA 3C1FA 2KCTA 2RSOA 1VQ5A 1SNPA 4FF2A 1CKNA 2MFIA 4DAPA 2B3GA 4R4TA 4AQYL 4JYAQ 4ODGA 2X6GA 4TQUS 4A3LH 3O13A 4X64Q 2OWOA 2LKVA 3STBD 3KUPA 4DV1Q 3NEMA 3BYYB 2UUBQ 2Q2TA 1XNRL 2EJMA 1CZGA 1VQFA 1SROA 2D9UA 2B8FA 4WJ4A 1EY7A 1QZHA 2I5LX 1BXTA 4A3CG 2CH4A 3IKJA 1GOZA 2K05A 1HHVA 3HOWB 3ZJYC 2NVXB 3KF6B 3KF8B 3Q0AA 1HZAA 4O0AA 3QOLA 5M3MG 1Y1WH 3EN2A 2F0GA 2UUAL 1B7YB 2DUDA 2MGSA 4IUTA 5LMNQ 1EFWA 3I4NH 4RCOA 4EQNA 1TWHH 3E0JA 4A3IH 1II3A 2F4IA 3T4AC 3S1NH 3IFTA 2EY1A 3SK8A 1EIYB 1HTPA 3S15H 1EIHA 3RZDH 2KECA 2PQEA 1VQBA 2EYMA 1VQJA 4OWWB 4BA2I 5C5MA 3I4MG 5KRUA 1TIID 1JOOA 2E76C 4X3TA 4DV0L 1JICA 1GJXA 3CKIB 3H0GG 1TWHB 3KF8A 4AQYQ 4IUNA 1U0LA 1IBLL 1CM9A 2JJQA 5CBEE 5IP9G 5IODA 1BBUA 4JI5L 2RA4A 3I7FA 2MQHA 3MWYW 4A93H 1EWHA 4A3EH 1EWCA 2H4OA 1PTOF 3H3VI 4R4IA 1FL0A 1SYCA 2GA4B 3T13A 5J22A 3J7A5 4HIOA 1XTDA 5M3MB 2YTYA 1F2MA 5GAGC 5JJKA 1BCPB 4KY6A 2E2HB 1AW7A 4CKCA 1RHPA 2IW3A 1BR9A 1UWVA 2IHFA 3S16H 1LV9A 3M4YA 3MZ5A 5EKIA 1VCIA 2ZM6Q 4A3IG 1FNWA 2O5IC 2ZM6L 2NVYB 3S9WA 1H9SA 4UP8A 4A3GG 4P75A 2R7ZB 3QG1A 3QOJA 4KHPQ 1D8LA 2XWJB 1L0YB 3L0OA 1PRTD 1HFNA 3EIVA 1JJCB 1GM5A 3ZYYX 2ZTEA 4X64L 1IL8A 4GN4B 3C3LA 4C3HH 1A2TA 2EPBA 3K0YA 1A15A 1PXUA 2I46A 1LM0A 3PUVA 5E3FA 3HOXB 2F4VQ 4KMUC 2GVAA 1S5BD 1YNJC 3GTLH 4JI7Q 1F9SA 4HEDA 1A62A 3I8ZA 4RH6A 1SYBA 2OQKA 3PGZA 2L11A 2Q2IA 1EQQA 2JEBI 2ZXRA 2K5VA 3SK5A 5FJ8H 2EOTA 3AU7A 4LNQA 3MXGA 3PUZA 3H0GB 1AEXA 2BA1A 1AZQA 1VQAA 2Q8TA 1I50H 1IYUA 1SE3A 3LX0A 3GTMB 5C4HA 4DUZQ 2E74C 3NWTA 5IYDG 1F9RA 4A3FB 1ZXTA 3HOVH 1LTSD 2HT1A 4ID6A 1HUMA 3T51B 2CQOA 4HMJA 2SDFA 2WFWA 1ZYRC 4ME5A 4A75A 3PIP3 2VB3X 3DWQA 3MTSA 2D62A 1I4PA 1Z9FA 3FKIG 1GKHA 2F52A 1GUOA 5J3BA 2Q2UA 3UDFA 3UDGA 1QVFA 3ULLA 2EIFA 3WOEA 2JYOA 1HA6A 3GTKH 1NMFA 4V190 2UU9L 5KIXA 1XTCD 5D3IB 1YNNC 1WJJA 4C1NI 4A3KH 1LTLA 2L15A 4EQ5A 2CCZA 3CRLC 4DV2Q 3J80L 2QGQA 3HOYG 2B2TC 1C9OA 5HURA 2K5WA 3HOZB 3UE0A 1WYDA 3K7AH 4DR7Q 1F2LA 1AZPA 1EY8A 2PQAB 1S72A 5LMUL 4K5WA 1W2BA 3NXWA 1HZCA 3ERQA 1L2FA 3KK7A 3M3YB 1CKOA 5IOCA 2E2IH 3CQZH 4A3JB 1XNRQ 3J81L 1L1OC 1M4VA 3TP5A 4YWLA 3SEBA 1STBA 3KOJA 1Z47A 4FNFA 4Z9CB 1CHQD 5CV5A 1ET9A 3BJUA 1NR4A 3BZDB 4LFAQ 1LT5D 1X9NA 1GXDC 1CFMA 2PW7A 3G7LA 2LSSA 3T1HL 3FKIH 4A76A 1CI3M 5C0XI 3IRBA 2R7ZH 3H3VH 4TKOB 4CDEC 3E5SA 4QGUA 1HCZA 2NTTA 1C7YA 4JBKA 1J5EQ 3A8IE 1MJEA 2D5DA 3CMEA 4NMZA 4BS9A 3MXUA 5EKLA 4RGMA 3PUXA 2ICIA 3HFZB 4BBRH 4A3KB 1I4QA 1W6JA 2G9DA 3J81c 2IX0A 5C44G 4FYDA 4BY7B 3GTKB 1DOLA 1DONA 4MNOA 3TSSA 5I9OA 2R92G 4DK3C 1Y1WG 2AUJD 5CV4A 3PO3G 1O7LA 1KNAA 3CC2A 2UXDQ 3D4WA 1D5XC 5K36H 4R8IA 1WTQA 4ALPA 3E3XA 3Q8DA 4YY3Q 4RHSA 3QJYA 1UE6A 4A3GB 3TP6A 3J7AV 1X54A 3ERSX 1ICFB 3GTMH 3J81i 2EZVA 2E8GA 5FK9C 1KC8C 4JV5L 3A8KE 2EE1A 5M3FH 4I7AA 1XJVA 1NE3A 1FGUA 3PUWA 5GQOA 3I91A 4NB3A 4A3FG 3PUYA 3I3CA 3KYHC 4GLAC 2AWOA 1PVOA 3J81E 4DR3Q 4XIGS 4DV7Q 1BBXC 3NTHA 2R3ZA 2NVTH 1AP0A 1CKMA 4FVMA 5JEAJ 3VYUA 4ULLA 2KOLA 4N9PA 1A6XA 4C3IH 4Q0FA 1SFOB 3S2HH 1NSNS 2RCFA 3FPPA 4JYAL 2Z4HA 2IT1A 5M5YB 3WOFA 1CQFA 5IGBA 1WD1A 4LAAA 4P71A 5FLMH 4MN3A 1QCBD 2PW5A 4X62L 5KNCA 4MIUA 4PZ7A 5D65A 5K36G 2MO1A 1K9MC 3VR4A 1BVSA 3S1MH 1PHJA 5EBDA 1WOCA 4IPCA 3RNUA 5A2QE 3VYSA 1QWYA 1FJGL 4FXDA 3HEJA 5M3FG 1O78A 4DV5L 4P2CB 4OO1G 2E2HH 5TSSA 4JI3L 1M8AA 4JVZA 1HNWL 1F2ZA 1HR0L 3KLRA 1HH2P 2NWGA 2NZHA 1VMPA 3AMUA 1U5KA 3F1ZA 3KLWA 4XTCS 1IKMA 1BKBA 4YHHL 1VMCA 5FO8B 1V8QA 2F03A 2L1BA 2UXBQ 2DY8A 4O2DA 3J80i 4BBRB 1BCPC 1NR2A 2FXQA 1EY9A 1HR0Q 3EBEA 2JA7B 4C3HB 1TS5A 3TDQA 1SAPA 4LFBQ 4B3SL 1KRSA 1PTOD 2F3VA 1W3SA 3DWPA 2YTVA 3DEPA 3TS0A 3M4PA 1B3AA 4DV2L 2NVYH 1KDAA 2GN5A 4I65A 4X65Q 3IFDA 2A74C 2JA8B 2JA9A 4N8X1 3P20A 5E4WC 5JEAH 3K59A 3E9IA 4G7OC 3ICEA 3PF4A 1I4HA 2XSCA 3FMCA 3K8AA 5BR8L 4DR3L 2DNCA 1D6EC 2XNAC 1JCKB 4OO1I 5IGCA 3UE1A 3BVZA 5GAHC 5IGFA 4DV0Q 1TWCH 4JCVE 1Q82C 2KEEA 2NBFA 3K58A 4LFAL 4F87A 5I4DA 1SXTA 5IYCH 2K4KA 3GTJB 4LFBL 4A3EB 1PZJD 1DYQA 4G4KA 4JI5Q 3BZCA 1TWCB 1EIFA 2F0HA 4K0KL 3M7GA 3KJOA 4R8NA 2WP8J 4LUOA 1EWIA 3QR8A 1IW7C 1E1OA 2K7VA 1PRTB 4K5XA 1G2TA 2B2YA 2EVBA 1RKNA 2FHTA 2B2VA 3D4RA 2F0WA 1H9RA 4K8IA 4C1NK 1WTRA 2D2CC 4P72A 1YJNA 3OYYA 5I6WA 4UP7A 1H9JA 4KY7A 2L9HA 4XXEA 2PZWA 5AFWA 5DEHA 1N33Q 2NN6G 4PG3A 1CSPA 4IFDH 1KHIA 2R6GA 3C2PA 3VR3A 3H3VC 1MI2A 1Y8NB 2NZOA 5LL6S 4DK0A 1D5MC 1WI5A 1WTHA 1E1TA 2K75A 2RKSA 3KLSA 2A73B 4XT3B 5JJLA 5F2DA 2SOBA 4B08A 4Y7NH 5JPNC 4K14A 4AYBE 4TVAB 3F2BA 4DNRB 3K81C 4ZYSA 1VQNA 1L0XB 2FMMA 2I0QA 3B6YA 3JAMc 1QVCA 2M2LA 1X32A 2JA5B 1T5XD 2A6HC 5CORA 1ILPA 5I9PA 5HGTA 3NP8A 4AYBB 4GNXB 5DLQE 1SYFA 4KLKA 3K5OA 1ZEQX 4HN7A 4A3DB 2EY5A 2RSNA 4JC0A 2BOSA 2AUKA 2Z6KC 2JA7G 2UUAQ 3RLFA 5ELBA 1LT3D 3LWUA 4PV1C 4CKEA 2CWAA 2K6AA 4BY7H 1LUZA 4KHPL 4BY1H 2Z0SA 4RA8A 1BF4A 4X6AH 3T1YQ 1UEAB 2DN8A 1LTGD 1TY0A 2L0CA 1O7YA 1RTNA 3Q24A 4GNXA 1Z7TA 2F0MA 2F0KA 5IYBH 5EBCA 3JAME 1EYAA 2BCOA 2OQ0A 1VQCA 2CKZB 1A3VA 1GVPA 1VF7A 3I72A 2P5ZX 2IWHA 2B2UA 2LY7A 4DUYQ 1IKLA 4YCVA 5ELEA 1KDCA 4K2LA 3TREA 4TRDA 2RHSB 3L9AX 4A93G 1FYCA 1JQYD 1B9NA 2J4XA 4LF9L 4DAYB 1Q1BA 4JI2Q 2K50A 4X66L 2BA0A 4OWTB 2JA5G 4BXXG 2DY7A 2JQOA 1D5ZC 2F0UA 3HG9A 3A0JA 4IUQA 3KBGA 4MZ9A 3GTGH 4RWSC 3HOXG 1PH9A 1YJWA 1PV4A 1I5FA 3V96A 3RN2A 2N49A 3MVVA 4A3LG 1MD2D 2KENA 3DWAA 4PMWA 4C2MB 3PF5A 3OMGA 1QNUA 3CU7A 4LF9Q 1WTWA 4GN3B 1QILA 2Q8IB 1MBYA 2J0TD 1J9OA 5A35A 4KKSA 3P7JA 3GTGB 4UDUC 4EQPA 3CPWA 4LF8Q 2CW0C 2FFKB 4DAYA 2WB1E 4WFN3 1RTOA 4NXNL 1VQ9A 1XXGA 1DGSA 4A4IA 4RKBA 2EQSA 1OXUA 4WJWA 1TWGB 3S17H 3S1MB 3RLNA 3M4QA 1FJGQ 3H94A 2KQ3A 3J80E 3GD7A 2A69D 4IJLA 4IQZA 1JE5A 1T9HA 2B63B 4JOIA 5I2XA 3NBHA 4ZLTF 1K8GA 2DGYA 1SMYD 4JI3Q 1KLGD 1FNUA 1LTRD 3PIPA 2Y0SE 5FLXE 1KABA 2BDNA 1FR3A 2UXCL 4C3IB 3S2HB 2K33A 4OIKA 3H09A 3T16A 1IBKQ 5AJ3Q 3CCJA 5CV7A 5C0XG 1PLFA 2KHIA 4V0BA 4C56C 3G4SA 1WVLA 4QUCA 2NVXH 3MXNA 1O7IA 1N32Q 2H5XA 3K7AB 5ELOA 4A3KG 1VQ6A 2V1CC 1U4PA 3NBHB 2JXMB 1V9PA 3FRPB 4XT1B 3TS2A 3CW2C 4KK7A 5GAEC 3J80c 2NYZD 4XQJA 2LS01 5AJ3L 1B4OA 3CCSA 1X3FA 1SNCA 3PMFA 4DV6Q 3M4OB 3OSOA 2K52A 3GTQB 5FLXc 1TWGH 3QB3A 4DN4M 2HUGA 3U9OA 3OTOQ 5BN3A 3DM1A 4GLVB 1B8AA 2LXJA 2RCNA 4QQBX 5FO9B 2SNMA 3TP8A 1MJCA 2C9OA 1L0WA 2HIXA 1TU2B 3S1RB 1YITA 3EA6A 4KKTA 3T56B 1F9QA 4DK6C 1IYVA 5IP7G 1Y1VH 4AH6A 5EPJA 1K8OA 4WJ3M 2HDMA 1HA5A 5E7NA 1CZWA 1EZ6A 1TR5A 1Y8OB 2AWNA 4K5VA 4HSVA 4L5TA 3D6CA 4B9XA 1V1PA 3E6ZX 4POGA 1K0RA 2EY2A 2IPKD 3PQIA 3W3AA 2R92H 4CKBA 3NTIA 2IJ0A 3CCMA 1PH2A 1R9TB 2IX3A 4LF7L 4RMFA 4HJ8A 2OXPA 1B70B 3CCVA 2WAQB 1ONLA 5KYLA 2HD3A 4IUPA 2Q8RE 4DNIA 1EU4A 1HFGA 5IGEA 3CXCA 4JI1L 1JC7A 1RDPD 4HIDA 3OWFA 2F0QA 1WTXA 4QY7A 2NVQB 2K01A 3OIPA 1QB5D 1SRUA 1XMOL 1TT2A 4NW2A 1TWFH 2TSSA 2C35B 2XIWA 3PO3H 1ZKOA 1IBML 3HOWH 1WCMH 2X69A 5KNBA 4F7XA 4LF4L 1RODA 5IYBG 1PFNA 2VQEQ 1VS0A 2Z4IA 2MNAA 4B9WA 2RDGA 4A3MB 2M9VA 5M3MH 1NNXA 3OW7A 3GV6A 2QKIC 3Q6SA 4KHZA 1M1KC 1LABA 3HOYH 1O80A 2IL8A 3I4NG 1K83B 1K28A 4GN5A 4YIJA 1U4RA 4APVA 5C4XB 1I4GA 4IURA 4MTNA 4XYQA 1YHQA 4A93B 2RF4A 4DU9A 4DV7L 4CHTB 3U9SA 2PCFB 3U50C 3H15A 2JA5H 4XDXA 4IJHA 4GKKL 1NBWA 4YCUA 2F0NA 5IGDA 2YU9B 4H7BA 4HCSA 3HRZC 1GUWA 3VA7A 4LUVA 3N6RA 4RFBA 4DR4L 3S14B 1I6HB 1XPOA 5M5YH 2OF1A 1Q7YC 3CRKC 4UP9A 1B53A 3HOUB 3HOXH 2Z9HA 1I6VC 4ZRZA 2X6LA 3OIQA 3FPUB 3ONAB 2A8VA 3MEHA 4QIWE 2F0DA 2PI2A 4WRDA 3HOWG 4JI7L 1R4QB 3EVQA 4JI0Q 1SMXA 3CHBD 3PO2B 2VUMB 1I6HH 1PYSB 4DA2A 4QB4A 1WD0A 3SK6A 4XQNA 4CJ1B 1TY2A 3WDNA 2EYLA 2R7FA 2V4DA 1EQTA 5M3FB 1G6PA 2O4XA 4RGNA 2Z1CA 3NE5B 4OEMB 4JI1Q 2MJ8A 4DR6L 1HZBA 1EY6A 1TVXA 3VR6A 1TXYA 3F2UA 1J5EL 1UE1A 4QCLA 5IWAL 3TEHB 3K57A 3VR2A 3I4MB 1EY5A 5EKKA 4CDDC 2KUMA 3A54A 2F0SA 3SR1A 4IN3A 1E2WA 2N3SA 1XYIA 3MAQA 1YNJD 2F0LA 4RCNA 4GOPC 1AH9A 5IT9E 3L7ZC 1PTOB 4OONA 3NBIA 4QL5A 1NMGA 4FF1A 1H95A 4IO9A 2QA4A 5GROA 1Q8IA 4U673 1X3GA 5FLXL 2OCEA 1BO0A 2FMCA 3D0FA 1V1QA 4R4CA 4X3KA 3RLOA 3X3MA 2EYOA 3SHLA 5IT9L 4A3BB 1SE4A 1CA6A 4R4OA 3TP7A 1Q3LA 5H1SE 4K0KQ 1QOHA 5IYCG 1XMQQ 2R7DA 5ELNA 4BBSG 1STGA 2PPBC 3I4NB 2E2IB 2CVRA 2ZT9C 1Y14B 3LNNA 2SEBD 2K1BA 1BUVT 1RD9D 1BNZA 3MFGA 2AQ3B 3I4MH 3A56A 4QMGA 2HCCA 2KEDA 3GTOB 1Y1VG 1G6ZA 4FF3A 1N34L 4R4QA 3I56A 1VQPA 2N8NA 5IP9H 3KJPA 3HOZH 3RD4A 5C44B 4RAUC 2TMPA 2KCCA 5BN5A 1A0IA 3I73A 4G57A 1HNZL 2WB1B 1UNSA 1U9RA 2AHOB 1JORA 1PYBA 1JOQA 3S1RH 4IPDA 2WINB 2JP1A 3OMCA 2DJGC 1HNXQ 3SE0A 3G71A 1I4XA 3PO2H 3A7AB 3P75A 1VQ7A 1BDOA 2DJFC 1UEBA 1EU3A 1PYWD 4QJFA 2PNRC 4FDBA 4ZUIA 2UXCQ 1E7ZA 2LFNA 3U4ZA 4DV3L 4IPGA 3SDZA 1S3OA 3TZDA 1XWEA 3HS0C 1CSQA 5CYUA 2Z6KA 1X3QA 1SDFA 5M5WB 3QWNA 2I5MX 5JJIA 1IBMQ 1FNVA 2L12A 1YBYA 3MFYA 4OELB 3I2ZA 5FO7B 1I50B 3I90A 2Q2HA 2E2JB 2WAQG 2LXKA 3H0GH 5IGGA 1N34Q 1PA6A 1PZID 3SVMA 2JA8G 1S5CD 2B29A 4PMBA 1D1IA 2K28A 3JAML 5CGKA 2NB0A 4J6HA 1CUKA 4XYOA 1LTTD 5EQ0A 4A3EG 3G6JB 5C3EB 4BBRG 2BDOA 1ICWA 2EJFC 3WWVA 1EZ8A 1SFOH 4OWXB 1VQLA 1ENAA 2VW9A 2HIVA 2B2UC 5COYA 1KAAA 2QCPX 1IBKL 2RDFA 4FXGC 1IBLQ 4UPAA 3F2CA 4L6TB 3K5NA 3V2TA 3PIO3 2F0OA 1JT8A 1L1OA 1EUJA 1PTOC 2Z6BA 1KRTA 1KQSA 3J81j 1PTOH 5CV8A 5G3LF 4OX9Q 1LTID 1M90C 3HOVG 3BS1A 1LYLA 2KHJA 4DXFA 1C48A 3T1HQ 2BH2A 4DK1A 1H9MA 3GTPB 3H91A 4TSSA 4A3FH 3KDFA 2JA8H 2VS1A 2KCMA 4JW0A 4DR7L 1LTBD 4ABNA 1GUSA 2A68D 4C3HG 5JPMC 3PV0A 2E2DC 4UAIA 4HJAA 5CV6A 3J7ZC 3NHHA 1ASZA 3RZOH 5LMNL 3BDLA 1SNDA 5C4JH 3GP7A 4GS3A 2CHBD 1NJIC 4I7ZC 2HCIA 5FLMG 2VL6A 4JBWA 2PYKA 4R1JA 1IL2A 1HZ9A 4K6DA 2K04A 1WFQA 1BCPF 2ZXPA 3CCLA 4M8AA 2C5CA 4DKAC 3A55A 4BBSB 3HGBA 3A7LA 4ZKBB 4A3IB 4BA1I 1STHA 4J15A 4IZ8A 1NUCA 3TQYA 4UY8C 2B63G 3KF6A 2KCNA 1E0BA 3C1EA 1VQGA 1GHJA 3A74A 3OOCA 5EPLA 1SEBD 3U58A 4KY5A 3R93A 1SYGA 2NTSA 4KKUA 4JPBW 3CPFA 4DNTB 1YJ9A 5EAYA 4DAVA 3ULJA 3S2DB 1PH8A 4L63B 1KDBA 3K0XA 2ICEC 4MTKA 1B3QA 1X6OA 4B3MQ 1B50A 1KD1C 3S2DH 2EYPA 1ESRA 1A2UA 2HHHQ 1ILQA 1Q1EA 2N78A 3A5ZB 1IZ6A 2CH4W 5LL6X 1CA5A 4DR4Q 1VF5C 4FF4A 1FGBD 1LTAD 1V1OA 1SYEA 4LW1A 1LT4D 3BG3A 1VQEA 1S5DD 4DR1L 2OEOA 2JK8A 4LFCL 1C8CA 1A3UA 5E4XA 4K2KA 4ZK9B 1STAA 4YY3L 4IUVA 5E1FA 1PMRA 4B3TQ 1EIGA 3GDEA 1JJGA 4IFDI 3S24A 5L37A 2VQEL 4BBSH 1VQMA 1YNND 2RVLA 4KV6A 4DFAA 1EY4A 3U4VA 4Y52H 3S15B 4ZAIA 2WIIB 4IUUA 1GUTA 2JA6B 2XGTA 2N88A 4LUZA 3BDOA 1RCVD 1AN8A 5JJZA 4CDFC 3K7UC 1RJTA 3H6MA 3STBC 1HTLD 3HKZE 3PO2G 1Y1WB 2VQFQ 3NUCA 2XVSA 4KD4A 1QG7A 2Z8LA 2HDLA 2QEJC 5LHY1 5JVH3 2VB2X 1H9SB 5D14A 3RZOB 4QIWB 1PRTC 3CC4A 3HOUG 1UE7A 2QDBA 4OL7A 3EQLC 2RDHA 2JN4A 3AEVA 1VDZA 1KAWA 2D0PA 1A8VA 5IIFA 3TBIB 1QUQA 5BR8Q 1Q86C 4B3TL 1WCMB 5A2QL 2R93B 3VYRA 1KLUD 5C4ZA 2ZJQA 4LF7Q 1GO3E 1KXLA 4A3DG 1G51A 5LMUQ 4GLXA 1JWMD 3F8TA 4HIMA 2EDGA 2B2WC 3J7YW 4NKLA 1EQVA 5KNDA 4IFDJ 2AMCB 4X65L 1SJHD 4AYBG 4JV5Q 2PQAA 4H0LC 2EXDA 4H44C 5EPKA 4C3JH 2A68C 4LJZC 4RHRA 4HTHA 1YNXA 4DR5L 3PIOA 1YHAA 1YEZA 3AFPA 1QE6A 1J8IA 4HJ7A 3L3OC 3M85A 1HNZQ 5C6AA 1T5EA 2RBMA 3CMAA 4LFCQ 4IFDG 5D3DA 4NXNQ 3CQZB 4A3JH 3QO2A 4DV4Q 1TS2A 4IALA 1HUNA 2F0JA 3SGIA 1Z6HA 2A69C 4OIJA 5NUCA 2B8GA 2ZTCA 4QF4A 1XNQL 5C3EG 2A5HA 1VQ4A 1EYDA 4LMQD 1EYGA 3NENA 5C0XH 1Y8PB 1TQOA 3TZUA 2JE6I 1S5ED 3AQQA 4NDXA 4ZQ3A 4DR1Q 1PH3A 4A3DH 1U4MA 1VQ8A 1K8MA 2UXDL 3BYTB 1B2TA 4OGQC 2CQAA 5ELFA 5M5WH 1VQHA 4L5QA 2JSOA 3AB9A 4JBMA 1MGSA 4C3JB 1AFPA 1JB7A 2I5HA 4LK1C 5CBAE 1SE8A 4JI2L 2D0OA 1I3QB 1S40A 5IT9c 3CCRA 3D31A 4NPSA 4POFA 3RMHA 4HJ5A 4JI4Q 3GV3A 2HQLA 2R7ZG 3K6OA 3CD6A 4DR6Q 4L5RC 4A3BG 1EYCA 2EY6A 3HZXA 1PH4A 2L55A 2OT2A 1LO5D 2UUCL 1SNQA 3BZKA 4R9WA 1VQDA 3AYHB 4S3SA 3BDCA 4HMIA 4JI6Q 1D2BA 4JI0L 2FINB 1OXSC 2RHQB 4ILWA 4H02A 1DM0B 5J1ZA 4LF8L 1YI2A 1EQRA 5KEEA 1ESFA 4DR5Q 4DAMA 3QIAA 2PNHA 3K80C 1SSOA 1QNKA 4DV3Q 2UUCQ 3I4LA 5CMDA 2ZTDA 1JB3A 3IL8A 4KD3A 4E6IA 1TS3A 5JEAG 4K8JA 4K6LA 2ASBA 3RN5A 4KJNA 2KA7A 4JI4L 4OX9L 3ITPA 2JEAI 5T1GA 5LMNW 3A8JE 4A3CH 1B44D 4NXML 2EYHA 2K5DA 4EVOA 3DXJC 3F2DA 1BBWA 1STYA 4WORA 1Y69U 5C4JB 5C4XH 1K8AC 3GTJH 2K03A 1SMYC 3KDFB 1K83H 1SJED 1ZYRD 4F88A 1SR3A 2KHSA 4PZ6A 3W1GA 4GNXC 4LF4Q 3KLSX 4X66Q 1MSHA 2Y0SB 4PZ8A 4YCWA 4X3SA 5I2YA 1IXRA 1XMQL 5EGTA 3TN2A 1GUNA 2EJGC 3CCEA 3MXPA 1EOVA 4J8QA 1TWFB 4ZCKA 2A6HD 3BVGA 4DR2L 4EGVA 2NVQH 3GTPH 1NY4A 2QW7A 3M9BA 1ENCA 1PH1A 2K32A 3FDTA 2AKWB 5DM73 4GOPB 4CBVA 2PI2E 2A19A 2IHEA 1HXYD 1GUGA 1ET6A 2R93H 4EQOA 3RZDB 2F3WA 4OXPA 3FHWA 2ZJRA 2NN6H 1HQMC 4O1NA 2JA7H 2YTXA 3DMUA 1IW7D 4RGTA 2R92B 5M9OA 2UUBL 2B2VC 2NUCA 1YHBA 2K5HA 2WV6D 5M5XB 3HOUH 4BY7G 1RF2D 1LLRD 3NQIA 1KIXA 4HR7B 4KTAA 3T53B 4GOPA 4HCEA 1PH5A 2A6EC 4JI8Q 1G8ZD 1VQOA 3S14H 2ZXOA 2BE5D 1XPUA 4PQXA 1EY0A 3NK9A 3X3NA 4HAEA 2YU9H 3MHBA 1EL0A 4N8FA 3J7AF 3UDIA 2EXZA 4IOCA 1OO9B 2IY5B 2JA6H 2WACA 5FJ8G 1NTGA 4C3JG 2KJXA 2K5NA 2E75C 3UDXA 4G7HC 3R2IA 1BOSA 4U68A 4DF7A 2OTLA 4KHVA 3FVQA 4A3JG 2BH8A 1EEID 3MXNB 2R93G 3T1YL 4DUYL 4GZYC 1Q8KA 5FKAC 1JR0D 3FEWX 4ZKCB 1A3TA 5C3WA 3E9HA 2B2YC 4ME3A 4L5SA 3SXHA 4CJ2C 4A3MG 1DOKA 1N33L 1N32L 4JK1C 4RG1A 3MA2B 2VUMH 1C0AA 1BQQT 1JE4A 1O7ZA 4JI8L 4P74A 2F4VL 2VNUD 2HQEA 2NZ1D 3TMEA 2MO0A 1DD2A 2UU9Q 2YYZA 1V43A 4NP5A 5C3XA 1P8LA 1OTCA 3M7NA 3K5LA 2BE5C 2WKDA 4DUZL 2NVTB 3CC7A 3DM3A 1LACA 1S4ZA 3GTOH 3K5MA 4CGYB 1KNEA 1PH6A 1SN8A 3AFQA 3MC0B 1W6KA 1NCVA 4LF6Q 3HOVB 2JA6G 1OXTA 1K73C 4DR2Q 3R2TA 1YVCA 1HJPA 2E2JH 3R3OA 3OHXC 1QUQB 4KI0A 5EJWA 3CF5A 1HRJA 2QF7A 1S5FD 3UI2A 4BWGB 5CC4A 2K5QA 3D6WA 3E0EA 4CDCC 5ISRA 3LWEA 1Q46A 1D7QA 4A3BH 3TRZA 1U4LA 1I94L 3P1HA 2R61A 3HOYB 1FVIA 2PO4A 1G2SA 1DJRD 4IPHA 2QEXA 4DV1L 3CCQA 1E3PA 1TKWB 2G5DA 3URYA 4A3MH 2L4NA
chains in the Genus database with same CATH topology
2F52A 5J3BA 3S17H 3RLNA 2Q2UA 3UDFA 3UDGA 3M4QA 1QVFA 1HZ9A 3ULLA 2EIFA 1QZGA 1FJGQ 4YWKA 3GD7A 3GTKH 1NMFA 1WFQA 4IJLA 2UU9L 3PSIA 1JE5A 3HOZG 1T9HA 4GKJL 3CCLA 4JOIA 3LGJA 3NELA 1K8GA 1WJJA 2DGYA 4DKAC 4JI3Q 2OTJA 4A3KH 3HKZG 1LTLA 2L15A 4EQ5A 3PIPA 2CCZA 2Y0SE 4BA1I 4J15A 4DV2Q 3HOYG 2QGQA 1C9OA 3TQYA 4UY8C 2CWPA 3KF6A 3JAMi 5C44H 2B63G 2UXCL 1VQGA 3UE0A 3A74A 3GTQH 1WYDA 3K7AH 1X65A 4DR7Q 3U58A 3I55A 4DV4L 1IBKQ 5AJ3Q 3CCJA 3CPFA 4LF6L 2F3IA 2PQAB 5C0XG 1S72A 2HHHL 2UXBL 2KHIA 5LMUL 1W2BA 3G4SA 2NVXH 1YJ9A 1N36Q 5EAYA 1HZCA 1X56A 3JC66 1L2FA 1O7IA 3ULJA 3CCUA 4HIKA 1N32Q 1CKOA 4LF5L 2H5XA 4JOIC 1PH8A 2E2IH 3CQZH 5ELOA 1XNRQ 1HNWQ 4A3KG 1VQ6A 3K0XA 3W1BA 1L1OC 1R9TH 4YWLA 2V1CC 3G6EA 3KOJA 3NBHB 1N36L 1Z47A 1V9PA 1X6OA 4B3MQ 2VZAA 3TS2A 3BJUA 1KD1C 3S2DH 3CW2C 2HHHQ 5GAEC 3J80c 4LFAQ 1Q1EA 2N78A 3A5ZB 1X9NA 1IZ6A 5AJ3L 4DR4Q 2LSSA 3T1HL 4YHHQ 3FKIH 4B3ML 3CCSA 4LW1A 5C4XG 1VQEA 2XTIA 1X3FA 4A76A 5C0XI 3IRBA 4DR1L 2R7ZH 3H3VH 4JBJA 3OTOL 4DV6Q 2KBNA 2JK8A 4LFCL 4LF5Q 2K52A 4QGUA 5FLXc 1N8RC 1TWGH 1C7YA 4JBKA 4BY1G 1J5EQ 4YY3L 1Q81C 1MJEA 3L2PA 3CMEA 2VY3A 4B3TQ 3GDEA 3OTOQ 4DV6L 3PUXA 3S1QH 3S24A 4IFDI 3HFZB 4BBRH 1JJGA 2VQEL 4BBSH 4GLVB 1B8AA 2LXJA 1VQMA 2RCNA 3J81c 4QQBX 2IX0A 1SLJA 5C44G 2B63H 1MJCA 4JG2A 1L0WA 2HIXA 3U4VA 5HY6A 4Y52H 3A5UA 1YITA 4MNOA 1Q12A 3I4OA 2R92G 4DK3C 4DK6C 5IP7G 1Y1WG 1Y1VH 2XGTA 1JJ2A 4AH6A 4LUZA 4GKKL 1J6QA 2VQFL 3PO3G 2UXDQ 3CC2A 4WJ3M 2ZJPA 5E7NA 3K7UC 1XMOQ 3M4OH 4P73A 3STBC 3HKZE 4X62Q 4ALPA 2AWNA 3PO2G 2VQFQ 2Y0SG 2ALYB 3Q8DA 4L5TA 4YY3Q 4LWCA 2WAQE 1UE6A 4POGA 1X54A 3ERSX 1K0RA 3VDYA 3J81i 1UE7A 3CC4A 3GTMH 2E8GA 3HOUG 1KC8C 4B3RQ 1I94Q 2R92H 4JV5L 5M3FH 3AEVA 5IP7H 3CCMA 1KAWA 1XJVA 2D0PA 1NE3A 1FGUA 1A8VA 3PUWA 1PH2A 1AE3A 4NB3A 5GQOA 2A1AA 4RMFA 3PUYA 4A3FG 5C0XJ 1HR0W 4LF7L 1QUQA 5BR8Q 1Q86C 3KYHC 4GLAC 2AWOA 4HJ8A 4B3TL 1K3RA 3KFUA 1PVOA 4DR3Q 1B70B 3CCVA 4XIGS 4DPGA 4DV7Q 2ZJQA 1XNQQ 4GKKQ 4LF7Q 1GO3E 1YIJA 2NVTH 1KXLA 4A3DG 1G51A 1N9WA 5LMUQ 3F8TA 4DNIA 4HIMA 4GLXA 1CKMA 4IFDJ 3CXCA 5JEAJ 2AMCB 4JI1L 4X65L 4AYBG 1X3EA 3RR5A 4C3IH 3S2HH 4JV5Q 1OXUA 4B3RL 2PQAA 1A63A 3ULPA 2EXDA 5IE8A 4C3JH 1TWAH 4HIDA 4JYAL 2IT1A 4QY7A 4IOAA 3FP9A 4P71A 5FLMH 1SRUA 1YNXA 4DR5L 1XMOL 3PIOA 1TWFH 1YHAA 2C35B 1YEZA 3PO3H 1IBML 3AFPA 4X62L 1WCMH 3G48A 4LF4L 3HOWH 4HJ7A 1IL2A 5IYBG 3M85A 2VQEQ 4PZ7A 1VS0A 5K36G 2MO1A 1K9MC 1HNZQ 1BVSA 3S1MH 1PHJA 2MNAA 3CMAA 5HGQA 4LFCQ 4IFDG 5M3MH 3CAMA 4NXNQ 1X55A 4A3JH 3W5OA 4AIMA 4KHZA 3DLLA 1M1KC 1WOCA 4IPCA 4DV4Q 3RNUA 3HOYH 2VUMG 1XPRA 1FJGL 4A3GH 3I4NG 4GN5A 1JMCA 1GD7A 1OXXK 4APVA 5M3FG 3SGIA 4DV5L 4MTNA 3PCOB 1YHQA 2ZTCA 4OO1G 1VQKA 2E2HH 2RF4A 4DV7L 1QVGA 1XNQL 1MKHA 5C3EG 3U50C 4NXMQ 1OXVA 1WCMG 4JI3L 2YV5A 1VQ4A 5M5XH 3NENA 3H15A 1EYGA 1OTCA 2JA5H 1HNWL 4IJHA 2E5LQ 1HR0L 1NBWA 1HH2P 2JE6I 3AQQA 4YCUA 4C2MH 1UE5A 5IWAQ 4DR1Q 1PH3A 2NZHA 4A3DH 1VQ8A 2WB1G 1U5KA 2UXDL 3F1ZA 3KLWA 4LUVA 4XTCS 4DR4L 5M5WH 1VQHA 4L5QA 1BKBA 4YHHL 1PH7A 1XPOA 1E24A 1RIPA 5M5YH 2UXBQ 4JBMA 4O2DA 3J80i 1Q7YC 4UP9A 1JB7A 2I5HA 5GADC 1G291 3HOXH 3OW2A 1I3QH 3BU2A 1SE8A 2GVBA 4JI2L 2D0OA 2A8VA 2FXQA 4QIWE 5IT9c 3CCRA 1S40A 3D31A 2PI2A 3EBEA 4NPSA 1E22A 4POFA 4HJ5A 1HNXL 4JI4Q 3HOWG 2HQLA 4JI7L 2R7ZG 1YZ6A 4JI0Q 3CD6A 1SMXA 4L5RC 5IY0A 4A3BG 4DR6Q 1IYJB 4LFBQ 2NN6I 1PH4A 4B3SL 1I6HH 2ATWA 1PYSB 1P16A 1KRSA 2E5LL 5IYDH 4GKJQ 1W3SA 2UUCL 3BZKA 3ER0A 2YTVA 1VQDA 3AYHB 2R7FA 4YWMA 4A3MH 3TS0A 3M4PA 4DV5Q 4DV2L 1G6PA 2NVYH 4JI6Q 2GN5A 1L1OB 4JI1Q 4X65Q 4JI0L 4DR6L 2RHQB 1OXSC 4HJ9A 1HZBA 3CP0A 4H02A 2PMZE 1TXYA 1KL9A 1J5EL 3M3YH 1RL2A 1UE1A 2JA9A 5IWAL 1VQIA 3TEHB 5C3EH 4LF8L 3E9IA 2IX1A 1YI2A 3ICEA 1EQRA 1CKNB 3PF4A 3K8AA 3MEFA 4DR5Q 5BR8L 2N3SA 4DAMA 4DR3L 2PNHA 3K80C 4JI6L 3GO5A 2K14A 4OO1I 4DV3Q 3UE1A 1ASYA 1PFSA 4GOPC 1AH9A 3L7ZC 2UUCQ 5GAHC 4OONA 4QL5A 4DV0Q 1TWCH 4JCVE 1NMGA 2CFMA 1Q82C 2ZTDA 1H95A 4LFAL 4IO9A 3HKSA 2QA4A 5IYCH 5JEAG 2K4KA 5GROA 4LFBL 2ID0A 1MIUA 1AE2A 4EX5A 2ASBA 4JI5Q 3BZCA 4BXXH 3RN5A 2ES2A 1EIFA 1X3GA 4JI4L 2OCEA 2KCTA 4OX9L 2JEAI 4A3CH 5LMNW 1VQ5A 4K0KL 3KJOA 4NXML 3D0FA 1V1QA 2WP8J 1CKNA 2MFIA 4LUOA 1EWIA 4R4CA 3F2DA 1E1OA 2B3GA 4R4TA 1BBWA 4AQYL 3RLOA 4JYAQ 4A3LH 4TQUS 5C4XH 4X64Q 1K8AC 3GTJH 2OWOA 3KDFB 1K83H 3STBD 1SR3A 4DV1Q 4PZ6A 3NEMA 3W1GA 4GNXC 4R4OA 4P72A 1YJNA 2UUBQ 3OYYA 5H1SE 4LF4Q 2Q2TA 4K0KQ 1XNRL 5IYCG 1XMQQ 1VQFA 4X66Q 1SROA 2JA8H 2R7DA 4UP7A 5ELNA 4WJ4A 4BBSG 1QZHA 2I5LX 4PZ8A 4YCWA 4A3CG 1XMQL 1IXRA 1Y14B 3CCEA 3ZJYC 1EOVA 3KF6B 3KF8B 1N33Q 3I4MH 2NN6G 1HZAA 4PG3A 4DR2L 1CSPA 4O0AA 1KHIA 2NVQH 2R6GA 5M3MG 1Y1WH 1NY4A 1Y1VG 3M9BA 1HR0Q 3GTPH 3EN2A 1PH1A 2UUAL 1N34L 4R4QA 1B7YB 3I56A 2NZOA 2N8NA 5IP9H 1VQPA 2AKWB 1WI5A 4GOPB 2DUDA 3KJPA 5LMNQ 1EFWA 1E1TA 3I4NH 3HOZH 1A0IA 2K75A 2PI2E 1TWHH 1HNZL 4A3IH 3S1NH 2AHOB 2A19A 1PYBA 2IHEA 5JJLA 1EIYB 3S15H 3S1RH 4IPDA 3RZDH 2R93H 4Y7NH 1HNXQ 1VQBA 1VQJA 3G71A 4OWWB 4AYBE 4TVAB 3PO2H 4OXPA 3I4MG 4BA2I 3FHWA 2ZJRA 3F2BA 4DV0L 3K81C 1VQ7A 1UEBA 3H0GG 2JA7H 1VQNA 2YTXA 3HOVG 4QJFA 4FDBA 4AQYQ 2UUBL 2UXCQ 2I0QA 3B6YA 3JAMc 2K5HA 1U0LA 1QVCA 1YHBA 1E7ZA 2JJQA 3U4ZA 4IPGA 5IP9G 4DV3L 1IBLL 3HOUH 4BY7G 1BBUA 4JI5L 1S3OA 3I7FA 2MQHA 1KIXA 4A93H 1PH5A 1CSQA 4GOPA 4A3EH 4B3SQ 2Z6KA 4GNXB 3H3VI 5DLQE 4JI8Q 1VQOA 3S14H 4R4IA 1XPUA 1FL0A 2I5MX 4KLKA 5JJIA 1IBMQ 2YU9H 3J7A5 1YBYA 4HIOA 3I2ZA 1XTDA 4JC0A 2Q2HA 3UDIA 2WAQG 4IOCA 2YTYA 2LXKA 2Z6KC 3H0GH 1N34Q 5GAGC 1PA6A 2UUAQ 2JA7G 2IY5B 3RLFA 2F4VQ 5JJKA 2JA6H 2JA8G 2B29A 5FJ8G 2CWAA 4BY7H 1LUZA 1NTGA 4KHPL 1UWVA 2IHFA 2K5NA 2Z0SA 4BY1H 3UDXA 3S16H 4X6AH 1CUKA 4A3EG 2ZM6Q 3T1YQ 1VCIA 2OTLA 4A3IG 4BBRG 4A3JG 3WWVA 2BH8A 1SFOH 4GNXA 4OWXB 1VQLA 2R93G 3MXNB 5IYBH 2VW9A 2ZM6L 2HIVA 3T1YL 4DUYL 4UP8A 4A3GG 1Q8KA 2OQ0A 1VQCA 2CKZB 4P75A 1IBKL 3E9HA 4KHPQ 1IBLQ 1D8LA 4UPAA 4ME3A 3F2CA 1GVPA 3L0OA 4L5SA 4A3MG 4DUYQ 4YCVA 1N33L 1JT8A 1N32L 1L1OA 4RG1A 3EIVA 2VUMH 1JJCB 1EUJA 1GM5A 1C0AA 2ZTEA 4X64L 4GN4B 1KRTA 4JI8L 3TREA 3J81j 1KQSA 2RHSB 4P74A 2F4VL 4C3HH 4A93G 2VNUD 4OX9Q 2MO0A 4LF9L 1M90C 4DAYB 1Q1BA 2UU9Q 4JI2Q 2YYZA 1LM0A 1V43A 2K50A 1P8LA 1LYLA 2KHJA 2BA0A 3PUVA 2GVAA 4OWTB 4X66L 2JA5G 3M7NA 4BXXG 3GTLH 3T1HQ 2JQOA 4JI7Q 2BH2A 4DUZL 3CC7A 1A62A 3DM3A 3GTOH 2OQKA 3A0JA 3PGZA 4MZ9A 3GTGH 2Q2IA 1EQQA 3HOXG 1PH6A 1SN8A 3AFQA 1PH9A 1YJWA 2JEBI 4A3FH 1PV4A 4LF6Q 1I5FA 3KDFA 2K5VA 2JA6G 5FJ8H 1OXTA 3RN2A 2VS1A 2N49A 1K73C 4LNQA 4A3LG 4DR2Q 2KCMA 3PUZA 2KENA 4DR7L 1YVCA 1HJPA 4PMWA 2BA1A 2E2JH 3PF5A 1VQAA 1QUQB 1I50H 4KI0A 3CF5A 3PV0A 4LF9Q 4HJAA 4GN3B 4DUZQ 3J7ZC 5IYDG 1ASZA 3RZOH 5LMNL 3HOVH 3E0EA 4LF8Q 3CPWA 2HT1A 1Q46A 1D7QA 4A3BH 3TRZA 2WB1E 2CQOA 1I94L 2WFWA 5C4JH 1FVIA 4A75A 2QEXA 4IPHA 4DV1L 4NXNL 1VQ9A 3CCQA 1E3PA 2D62A 4GS3A 1NJIC 1DGSA 1Z9FA 3FKIG 2VL6A 1GKHA 4JBWA 4R1JA 2EQSA 4A4IA 5FLMG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F52 A;  5J3B A;  3S17 H;  3RLN A;  2Q2U A;  3UDF A;  3UDG A;  3M4Q A;  1QVF A;  1HZ9 A;  3ULL A;  2EIF A;  1QZG A;  1FJG Q;  4YWK A;  3GD7 A;  3GTK H;  1NMF A;  1WFQ A;  4IJL A;  2UU9 L;  3PSI A;  1JE5 A;  3HOZ G;  1T9H A;  4GKJ L;  3CCL A;  4JOI A;  3LGJ A;  3NEL A;  1K8G A;  1WJJ A;  2DGY A;  4DKA C;  4JI3 Q;  2OTJ A;  4A3K H;  3HKZ G;  1LTL A;  2L15 A;  4EQ5 A;  3PIP A;  2CCZ A;  2Y0S E;  4BA1 I;  4J15 A;  4DV2 Q;  3HOY G;  2QGQ A;  1C9O A;  3TQY A;  4UY8 C;  2CWP A;  3KF6 A;  3JAM i;  5C44 H;  2B63 G;  2UXC L;  1VQG A;  3UE0 A;  3A74 A;  3GTQ H;  1WYD A;  3K7A H;  1X65 A;  4DR7 Q;  3U58 A;  3I55 A;  4DV4 L;  1IBK Q;  5AJ3 Q;  3CCJ A;  3CPF A;  4LF6 L;  2F3I A;  2PQA B;  5C0X G;  1S72 A;  2HHH L;  2UXB L;  2KHI A;  5LMU L;  1W2B A;  3G4S A;  2NVX H;  1YJ9 A;  1N36 Q;  5EAY A;  1HZC A;  1X56 A;  3JC6 6;  1L2F A;  1O7I A;  3ULJ A;  3CCU A;  4HIK A;  1N32 Q;  1CKO A;  4LF5 L;  2H5X A;  4JOI C;  1PH8 A;  2E2I H;  3CQZ H;  5ELO A;  1XNR Q;  1HNW Q;  4A3K G;  1VQ6 A;  3K0X A;  3W1B A;  1L1O C;  1R9T H;  4YWL A;  2V1C C;  3G6E A;  3KOJ A;  3NBH B;  1N36 L;  1Z47 A;  1V9P A;  1X6O A;  4B3M Q;  2VZA A;  3TS2 A;  3BJU A;  1KD1 C;  3S2D H;  3CW2 C;  2HHH Q;  5GAE C;  3J80 c;  4LFA Q;  1Q1E A;  2N78 A;  3A5Z B;  1X9N A;  1IZ6 A;  5AJ3 L;  4DR4 Q;  2LSS A;  3T1H L;  4YHH Q;  3FKI H;  4B3M L;  3CCS A;  4LW1 A;  5C4X G;  1VQE A;  2XTI A;  1X3F A;  4A76 A;  5C0X I;  3IRB A;  4DR1 L;  2R7Z H;  3H3V H;  4JBJ A;  3OTO L;  4DV6 Q;  2KBN A;  2JK8 A;  4LFC L;  4LF5 Q;  2K52 A;  4QGU A;  5FLX c;  1N8R C;  1TWG H;  1C7Y A;  4JBK A;  4BY1 G;  1J5E Q;  4YY3 L;  1Q81 C;  1MJE A;  3L2P A;  3CME A;  2VY3 A;  4B3T Q;  3GDE A;  3OTO Q;  4DV6 L;  3PUX A;  3S1Q H;  3S24 A;  4IFD I;  3HFZ B;  4BBR H;  1JJG A;  2VQE L;  4BBS H;  4GLV B;  1B8A A;  2LXJ A;  1VQM A;  2RCN A;  3J81 c;  4QQB X;  2IX0 A;  1SLJ A;  5C44 G;  2B63 H;  1MJC A;  4JG2 A;  1L0W A;  2HIX A;  3U4V A;  5HY6 A;  4Y52 H;  3A5U A;  1YIT A;  4MNO A;  1Q12 A;  3I4O A;  2R92 G;  4DK3 C;  4DK6 C;  5IP7 G;  1Y1W G;  1Y1V H;  2XGT A;  1JJ2 A;  4AH6 A;  4LUZ A;  4GKK L;  1J6Q A;  2VQF L;  3PO3 G;  2UXD Q;  3CC2 A;  4WJ3 M;  2ZJP A;  5E7N A;  3K7U C;  1XMO Q;  3M4O H;  4P73 A;  3STB C;  3HKZ E;  4X62 Q;  4ALP A;  2AWN A;  3PO2 G;  2VQF Q;  2Y0S G;  2ALY B;  3Q8D A;  4L5T A;  4YY3 Q;  4LWC A;  2WAQ E;  1UE6 A;  4POG A;  1X54 A;  3ERS X;  1K0R A;  3VDY A;  3J81 i;  1UE7 A;  3CC4 A;  3GTM H;  2E8G A;  3HOU G;  1KC8 C;  4B3R Q;  1I94 Q;  2R92 H;  4JV5 L;  5M3F H;  3AEV A;  5IP7 H;  3CCM A;  1KAW A;  1XJV A;  2D0P A;  1NE3 A;  1FGU A;  1A8V A;  3PUW A;  1PH2 A;  1AE3 A;  4NB3 A;  5GQO A;  2A1A A;  4RMF A;  3PUY A;  4A3F G;  5C0X J;  1HR0 W;  4LF7 L;  1QUQ A;  5BR8 Q;  1Q86 C;  3KYH C;  4GLA C;  2AWO A;  4HJ8 A;  4B3T L;  1K3R A;  3KFU A;  1PVO A;  4DR3 Q;  1B70 B;  3CCV A;  4XIG S;  4DPG A;  4DV7 Q;  2ZJQ A;  1XNQ Q;  4GKK Q;  4LF7 Q;  1GO3 E;  1YIJ A;  2NVT H;  1KXL A;  4A3D G;  1G51 A;  1N9W A;  5LMU Q;  3F8T A;  4DNI A;  4HIM A;  4GLX A;  1CKM A;  4IFD J;  3CXC A;  5JEA J;  2AMC B;  4JI1 L;  4X65 L;  4AYB G;  1X3E A;  3RR5 A;  4C3I H;  3S2H H;  4JV5 Q;  1OXU A;  4B3R L;  2PQA A;  1A63 A;  3ULP A;  2EXD A;  5IE8 A;  4C3J H;  1TWA H;  4HID A;  4JYA L;  2IT1 A;  4QY7 A;  4IOA A;  3FP9 A;  4P71 A;  5FLM H;  1SRU A;  1YNX A;  4DR5 L;  1XMO L;  3PIO A;  1TWF H;  1YHA A;  2C35 B;  1YEZ A;  3PO3 H;  1IBM L;  3AFP A;  4X62 L;  1WCM H;  3G48 A;  4LF4 L;  3HOW H;  4HJ7 A;  1IL2 A;  5IYB G;  3M85 A;  2VQE Q;  4PZ7 A;  1VS0 A;  5K36 G;  2MO1 A;  1K9M C;  1HNZ Q;  1BVS A;  3S1M H;  1PHJ A;  2MNA A;  3CMA A;  5HGQ A;  4LFC Q;  4IFD G;  5M3M H;  3CAM A;  4NXN Q;  1X55 A;  4A3J H;  3W5O A;  4AIM A;  4KHZ A;  3DLL A;  1M1K C;  1WOC A;  4IPC A;  4DV4 Q;  3RNU A;  3HOY H;  2VUM G;  1XPR A;  1FJG L;  4A3G H;  3I4N G;  4GN5 A;  1JMC A;  1GD7 A;  1OXX K;  4APV A;  5M3F G;  3SGI A;  4DV5 L;  4MTN A;  3PCO B;  1YHQ A;  2ZTC A;  4OO1 G;  1VQK A;  2E2H H;  2RF4 A;  4DV7 L;  1QVG A;  1XNQ L;  1MKH A;  5C3E G;  3U50 C;  4NXM Q;  1OXV A;  1WCM G;  4JI3 L;  2YV5 A;  1VQ4 A;  5M5X H;  3NEN A;  3H15 A;  1EYG A;  1OTC A;  2JA5 H;  1HNW L;  4IJH A;  2E5L Q;  1HR0 L;  1NBW A;  1HH2 P;  2JE6 I;  3AQQ A;  4YCU A;  4C2M H;  1UE5 A;  5IWA Q;  4DR1 Q;  1PH3 A;  2NZH A;  4A3D H;  1VQ8 A;  2WB1 G;  1U5K A;  2UXD L;  3F1Z A;  3KLW A;  4LUV A;  4XTC S;  4DR4 L;  5M5W H;  1VQH A;  4L5Q A;  1BKB A;  4YHH L;  1PH7 A;  1XPO A;  1E24 A;  1RIP A;  5M5Y H;  2UXB Q;  4JBM A;  4O2D A;  3J80 i;  1Q7Y C;  4UP9 A;  1JB7 A;  2I5H A;  5GAD C;  1G29 1;  3HOX H;  3OW2 A;  1I3Q H;  3BU2 A;  1SE8 A;  2GVB A;  4JI2 L;  2D0O A;  2A8V A;  2FXQ A;  4QIW E;  5IT9 c;  3CCR A;  1S40 A;  3D31 A;  2PI2 A;  3EBE A;  4NPS A;  1E22 A;  4POF A;  4HJ5 A;  1HNX L;  4JI4 Q;  3HOW G;  2HQL A;  4JI7 L;  2R7Z G;  1YZ6 A;  4JI0 Q;  3CD6 A;  1SMX A;  4L5R C;  5IY0 A;  4A3B G;  4DR6 Q;  1IYJ B;  4LFB Q;  2NN6 I;  1PH4 A;  4B3S L;  1I6H H;  2ATW A;  1PYS B;  1P16 A;  1KRS A;  2E5L L;  5IYD H;  4GKJ Q;  1W3S A;  2UUC L;  3BZK A;  3ER0 A;  2YTV A;  1VQD A;  3AYH B;  2R7F A;  4YWM A;  4A3M H;  3TS0 A;  3M4P A;  4DV5 Q;  4DV2 L;  1G6P A;  2NVY H;  4JI6 Q;  2GN5 A;  1L1O B;  4JI1 Q;  4X65 Q;  4JI0 L;  4DR6 L;  2RHQ B;  1OXS C;  4HJ9 A;  1HZB A;  3CP0 A;  4H02 A;  2PMZ E;  1TXY A;  1KL9 A;  1J5E L;  3M3Y H;  1RL2 A;  1UE1 A;  2JA9 A;  5IWA L;  1VQI A;  3TEH B;  5C3E H;  4LF8 L;  3E9I A;  2IX1 A;  1YI2 A;  3ICE A;  1EQR A;  1CKN B;  3PF4 A;  3K8A A;  3MEF A;  4DR5 Q;  5BR8 L;  2N3S A;  4DAM A;  4DR3 L;  2PNH A;  3K80 C;  4JI6 L;  3GO5 A;  2K14 A;  4OO1 I;  4DV3 Q;  3UE1 A;  1ASY A;  1PFS A;  4GOP C;  1AH9 A;  3L7Z C;  2UUC Q;  5GAH C;  4OON A;  4QL5 A;  4DV0 Q;  1TWC H;  4JCV E;  1NMG A;  2CFM A;  1Q82 C;  2ZTD A;  1H95 A;  4LFA L;  4IO9 A;  3HKS A;  2QA4 A;  5IYC H;  5JEA G;  2K4K A;  5GRO A;  4LFB L;  2ID0 A;  1MIU A;  1AE2 A;  4EX5 A;  2ASB A;  4JI5 Q;  3BZC A;  4BXX H;  3RN5 A;  2ES2 A;  1EIF A;  1X3G A;  4JI4 L;  2OCE A;  2KCT A;  4OX9 L;  2JEA I;  4A3C H;  5LMN W;  1VQ5 A;  4K0K L;  3KJO A;  4NXM L;  3D0F A;  1V1Q A;  2WP8 J;  1CKN A;  2MFI A;  4LUO A;  1EWI A;  4R4C A;  3F2D A;  1E1O A;  2B3G A;  4R4T A;  1BBW A;  4AQY L;  3RLO A;  4JYA Q;  4A3L H;  4TQU S;  5C4X H;  4X64 Q;  1K8A C;  3GTJ H;  2OWO A;  3KDF B;  1K83 H;  3STB D;  1SR3 A;  4DV1 Q;  4PZ6 A;  3NEM A;  3W1G A;  4GNX C;  4R4O A;  4P72 A;  1YJN A;  2UUB Q;  3OYY A;  5H1S E;  4LF4 Q;  2Q2T A;  4K0K Q;  1XNR L;  5IYC G;  1XMQ Q;  1VQF A;  4X66 Q;  1SRO A;  2JA8 H;  2R7D A;  4UP7 A;  5ELN A;  4WJ4 A;  4BBS G;  1QZH A;  2I5L X;  4PZ8 A;  4YCW A;  4A3C G;  1XMQ L;  1IXR A;  1Y14 B;  3CCE A;  3ZJY C;  1EOV A;  3KF6 B;  3KF8 B;  1N33 Q;  3I4M H;  2NN6 G;  1HZA A;  4PG3 A;  4DR2 L;  1CSP A;  4O0A A;  1KHI A;  2NVQ H;  2R6G A;  5M3M G;  1Y1W H;  1NY4 A;  1Y1V G;  3M9B A;  1HR0 Q;  3GTP H;  3EN2 A;  1PH1 A;  2UUA L;  1N34 L;  4R4Q A;  1B7Y B;  3I56 A;  2NZO A;  2N8N A;  5IP9 H;  1VQP A;  2AKW B;  1WI5 A;  4GOP B;  2DUD A;  3KJP A;  5LMN Q;  1EFW A;  1E1T A;  3I4N H;  3HOZ H;  1A0I A;  2K75 A;  2PI2 E;  1TWH H;  1HNZ L;  4A3I H;  3S1N H;  2AHO B;  2A19 A;  1PYB A;  2IHE A;  5JJL A;  1EIY B;  3S15 H;  3S1R H;  4IPD A;  3RZD H;  2R93 H;  4Y7N H;  1HNX Q;  1VQB A;  1VQJ A;  3G71 A;  4OWW B;  4AYB E;  4TVA B;  3PO2 H;  4OXP A;  3I4M G;  4BA2 I;  3FHW A;  2ZJR A;  3F2B A;  4DV0 L;  3K81 C;  1VQ7 A;  1UEB A;  3H0G G;  2JA7 H;  1VQN A;  2YTX A;  3HOV G;  4QJF A;  4FDB A;  4AQY Q;  2UUB L;  2UXC Q;  2I0Q A;  3B6Y A;  3JAM c;  2K5H A;  1U0L A;  1QVC A;  1YHB A;  1E7Z A;  2JJQ A;  3U4Z A;  4IPG A;  5IP9 G;  4DV3 L;  1IBL L;  3HOU H;  4BY7 G;  1BBU A;  4JI5 L;  1S3O A;  3I7F A;  2MQH A;  1KIX A;  4A93 H;  1PH5 A;  1CSQ A;  4GOP A;  4A3E H;  4B3S Q;  2Z6K A;  4GNX B;  3H3V I;  5DLQ E;  4JI8 Q;  1VQO A;  3S14 H;  4R4I A;  1XPU A;  1FL0 A;  2I5M X;  4KLK A;  5JJI A;  1IBM Q;  2YU9 H;  3J7A 5;  1YBY A;  4HIO A;  3I2Z A;  1XTD A;  4JC0 A;  2Q2H A;  3UDI A;  2WAQ G;  4IOC A;  2YTY A;  2LXK A;  2Z6K C;  3H0G H;  1N34 Q;  5GAG C;  1PA6 A;  2UUA Q;  2JA7 G;  2IY5 B;  3RLF A;  2F4V Q;  5JJK A;  2JA6 H;  2JA8 G;  2B29 A;  5FJ8 G;  2CWA A;  4BY7 H;  1LUZ A;  1NTG A;  4KHP L;  1UWV A;  2IHF A;  2K5N A;  2Z0S A;  4BY1 H;  3UDX A;  3S16 H;  4X6A H;  1CUK A;  4A3E G;  2ZM6 Q;  3T1Y Q;  1VCI A;  2OTL A;  4A3I G;  4BBR G;  4A3J G;  3WWV A;  2BH8 A;  1SFO H;  4GNX A;  4OWX B;  1VQL A;  2R93 G;  3MXN B;  5IYB H;  2VW9 A;  2ZM6 L;  2HIV A;  3T1Y L;  4DUY L;  4UP8 A;  4A3G G;  1Q8K A;  2OQ0 A;  1VQC A;  2CKZ B;  4P75 A;  1IBK L;  3E9H A;  4KHP Q;  1IBL Q;  1D8L A;  4UPA A;  4ME3 A;  3F2C A;  1GVP A;  3L0O A;  4L5S A;  4A3M G;  4DUY Q;  4YCV A;  1N33 L;  1JT8 A;  1N32 L;  1L1O A;  4RG1 A;  3EIV A;  2VUM H;  1JJC B;  1EUJ A;  1GM5 A;  1C0A A;  2ZTE A;  4X64 L;  4GN4 B;  1KRT A;  4JI8 L;  3TRE A;  3J81 j;  1KQS A;  2RHS B;  4P74 A;  2F4V L;  4C3H H;  4A93 G;  2VNU D;  4OX9 Q;  2MO0 A;  4LF9 L;  1M90 C;  4DAY B;  1Q1B A;  2UU9 Q;  4JI2 Q;  2YYZ A;  1LM0 A;  1V43 A;  2K50 A;  1P8L A;  1LYL A;  2KHJ A;  2BA0 A;  3PUV A;  2GVA A;  4OWT B;  4X66 L;  2JA5 G;  3M7N A;  4BXX G;  3GTL H;  3T1H Q;  2JQO A;  4JI7 Q;  2BH2 A;  4DUZ L;  3CC7 A;  1A62 A;  3DM3 A;  3GTO H;  2OQK A;  3A0J A;  3PGZ A;  4MZ9 A;  3GTG H;  2Q2I A;  1EQQ A;  3HOX G;  1PH6 A;  1SN8 A;  3AFQ A;  1PH9 A;  1YJW A;  2JEB I;  4A3F H;  1PV4 A;  4LF6 Q;  1I5F A;  3KDF A;  2K5V A;  2JA6 G;  5FJ8 H;  1OXT A;  3RN2 A;  2VS1 A;  2N49 A;  1K73 C;  4LNQ A;  4A3L G;  4DR2 Q;  2KCM A;  3PUZ A;  2KEN A;  4DR7 L;  1YVC A;  1HJP A;  4PMW A;  2BA1 A;  2E2J H;  3PF5 A;  1VQA A;  1QUQ B;  1I50 H;  4KI0 A;  3CF5 A;  3PV0 A;  4LF9 Q;  4HJA A;  4GN3 B;  4DUZ Q;  3J7Z C;  5IYD G;  1ASZ A;  3RZO H;  5LMN L;  3HOV H;  3E0E A;  4LF8 Q;  3CPW A;  2HT1 A;  1Q46 A;  1D7Q A;  4A3B H;  3TRZ A;  2WB1 E;  2CQO A;  1I94 L;  2WFW A;  5C4J H;  1FVI A;  4A75 A;  2QEX A;  4IPH A;  4DV1 L;  4NXN L;  1VQ9 A;  3CCQ A;  1E3P A;  2D62 A;  4GS3 A;  1NJI C;  1DGS A;  1Z9F A;  3FKI G;  2VL6 A;  1GKH A;  4JBW A;  4R1J A;  2EQS A;  4A4I A;  5FLM G; 
#chains in the Genus database with same CATH topology
 4O42 A;  4ZUJ A;  1QZG A;  4YWK A;  5JOB A;  2L5T A;  1X3P A;  1SNO A;  3PSI A;  5ELC A;  3HOZ G;  2ENB A;  4GKJ L;  1SE2 A;  3LGJ A;  3NEL A;  2OTJ A;  1CHP D;  1JWU D;  2F0I A;  3HKZ G;  3BVM A;  1ENF A;  4J1M A;  2CWP A;  5CR3 A;  3JAM i;  5C44 H;  2LMC B;  3Q23 A;  2MP1 A;  5CV9 A;  3GTQ H;  2PZU A;  1PFB A;  1X65 A;  4OO1 H;  3I55 A;  4DV4 L;  3R8B A;  4LF6 L;  1LT6 D;  2F3I A;  2UXB L;  2HHH L;  3C46 A;  3FKI B;  3S16 B;  1D1K A;  1BCP D;  5DAU A;  1CTM A;  1N36 Q;  1Q90 A;  1X56 A;  3JC6 6;  3NSW A;  3CCU A;  4HIK A;  4LF5 L;  2AQ1 B;  4JOI C;  4FP5 D;  3RUZ A;  1HNW Q;  3W1B A;  1R9T H;  3G6E A;  1E2Z A;  1N36 L;  2FJ2 A;  2VZA A;  3DUZ A;  2MPM A;  2I07 B;  3EJI A;  4YHH Q;  4B3M L;  5C4X G;  4DGZ A;  2XTI A;  4JBJ A;  4KJO A;  3OTO L;  2KBN A;  3N52 A;  4LF5 Q;  1HQR D;  1PDQ A;  5BN4 A;  1N8R C;  2PMZ B;  4BY1 G;  1Q81 C;  1KTK A;  3L2P A;  2VY3 A;  1Y1V B;  4DV6 L;  3S1Q H;  4OHJ A;  4Q5V A;  1XX8 A;  4UHV A;  1SLJ A;  4BY1 B;  2B63 H;  4C3I G;  1F9P A;  2F0P A;  4JG2 A;  4G7Z C;  1DCZ A;  3D8G A;  5HY6 A;  5I6Y A;  3A5U A;  2A6E D;  1Q12 A;  3I4O A;  1DOM A;  1K0S A;  1JJ2 A;  1J6Q A;  5G3L D;  3DEO A;  2VQF L;  2ZJP A;  1XMO Q;  3M4O H;  4XQQ A;  4P73 A;  4X3U A;  4X62 Q;  1PRT F;  2Y0S G;  1C4Q A;  2ALY B;  4LWC A;  2WAQ E;  1DXM A;  4RKL A;  4HSP A;  3NWS A;  5K5P A;  3D3R A;  1GHK A;  1JOK A;  3VDY A;  1SNM A;  1SBB B;  2QDL A;  4B3R Q;  3NQT A;  1I94 Q;  2H1E A;  1B9M A;  5IP7 H;  3KFU A;  2DNE A;  4MHE A;  3W2D A;  1AE3 A;  1HR0 W;  1R4P B;  2A1A A;  3OPO A;  5C0X J;  4FXK C;  1K3R A;  3EFX D;  1CT1 D;  3PO3 B;  4DPG A;  1XNQ Q;  3KBX A;  1YIJ A;  1HPC A;  1N9W A;  3Q22 A;  3GTL B;  3HKZ B;  5C5L A;  3S1Q B;  3ND8 A;  1X3E A;  3RR5 A;  5JVG 3;  4B3R L;  1A63 A;  3I70 A;  3ULP A;  5IE8 A;  1TWA H;  2MUY A;  4IOA A;  3NPP A;  3FP9 A;  3OWE B;  1JWS D;  1I4R A;  3G48 A;  1WTV A;  1FD7 D;  1E2V A;  1MHW C;  3S17 B;  5HGQ A;  1EFI D;  3CAM A;  1X55 A;  3W5O A;  5ELD A;  4AIM A;  3DLL A;  5FOB B;  1MSG A;  2VUM G;  1DZ1 A;  1SYD A;  1XPR A;  4A3G H;  4RGO S;  1JMC A;  1GD7 A;  1F2Y A;  1OXX K;  5T1I A;  2N55 A;  1TS4 A;  3PCO B;  3D4D A;  1VQK A;  1K3B C;  4M1U B;  2O5J C;  1QVG A;  1B1Z A;  1MKH A;  2EYF A;  4NXM Q;  1OXV A;  1WCM G;  2YV5 A;  5M5X H;  2E5L Q;  1CK1 A;  4C2M H;  2XN9 C;  1UE5 A;  5IWA Q;  3SK4 A;  2WB1 G;  2XWB B;  4KN7 C;  2XRQ D;  1STE A;  4H13 C;  1H9K A;  2J7Z A;  1PH7 A;  1E24 A;  1RIP A;  5GAD C;  1G29 1;  3OW2 A;  1I3Q H;  3BU2 A;  5DNF A;  2GVB A;  1IHZ A;  2EYJ A;  4B3S Q;  4GKK Q;  4DXG A;  2SNS A;  1E22 A;  1HNX L;  5JAV A;  2VXW A;  1ML0 D;  1V1P B;  1YZ6 A;  5IY0 A;  1IYJ B;  2NN6 I;  2O2L D;  2ATW A;  4Y7N B;  1P16 A;  2E5L L;  5IYD H;  4GKJ Q;  1WTP A;  2QIL A;  2B2T A;  4N9T A;  3ER0 A;  4PMC A;  1QJO A;  1CQV A;  1EOT A;  1UAP A;  2F0E A;  3S1N B;  4YWM A;  3DHQ A;  2F0V A;  4DV5 Q;  3IAY A;  2XRS D;  5KGU A;  4F8M A;  1L1O B;  1UUP A;  1G91 A;  3HP3 A;  4KN4 C;  4HJ9 A;  4PNY A;  3CP0 A;  3GQB A;  2PMZ E;  1F77 A;  1KL9 A;  1STN A;  2RQX A;  3M3Y H;  1RL2 A;  5C3E H;  1VQI A;  2IX1 A;  3NTK A;  2G9H D;  3VA5 A;  2WKC A;  1CKN B;  3MEF A;  2B2W A;  2F0F A;  2B39 A;  4FO2 A;  4JI6 L;  3GO5 A;  1PZK D;  2K14 A;  1ASY A;  1PFS A;  5J39 A;  2MHV A;  1WTO A;  4QUF A;  1PFM A;  2F0T A;  2M00 A;  2AQ2 B;  2PZT A;  3ERO A;  3VR5 A;  2F1M A;  2CFM A;  2CW0 D;  3ND9 A;  1EEF D;  5KYI A;  3HKS A;  2ID0 A;  1MIU A;  1AE2 A;  4EX5 A;  4CJ0 B;  4BXX H;  3V05 A;  4L8J A;  2KVM A;  3VYT A;  5DM6 3;  2ES2 A;  1TWA B;  1NAP A;  3C1F A;  2KCT A;  2RSO A;  1VQ5 A;  1SNP A;  4FF2 A;  1CKN A;  2MFI A;  4DAP A;  2B3G A;  4R4T A;  4AQY L;  4JYA Q;  4ODG A;  2X6G A;  4TQU S;  4A3L H;  3O13 A;  4X64 Q;  2OWO A;  2LKV A;  3STB D;  3KUP A;  4DV1 Q;  3NEM A;  3BYY B;  2UUB Q;  2Q2T A;  1XNR L;  2EJM A;  1CZG A;  1VQF A;  1SRO A;  2D9U A;  2B8F A;  4WJ4 A;  1EY7 A;  1QZH A;  2I5L X;  1BXT A;  4A3C G;  2CH4 A;  3IKJ A;  1GOZ A;  2K05 A;  1HHV A;  3HOW B;  3ZJY C;  2NVX B;  3KF6 B;  3KF8 B;  3Q0A A;  1HZA A;  4O0A A;  3QOL A;  5M3M G;  1Y1W H;  3EN2 A;  2F0G A;  2UUA L;  1B7Y B;  2DUD A;  2MGS A;  4IUT A;  5LMN Q;  1EFW A;  3I4N H;  4RCO A;  4EQN A;  1TWH H;  3E0J A;  4A3I H;  1II3 A;  2F4I A;  3T4A C;  3S1N H;  3IFT A;  2EY1 A;  3SK8 A;  1EIY B;  1HTP A;  3S15 H;  1EIH A;  3RZD H;  2KEC A;  2PQE A;  1VQB A;  2EYM A;  1VQJ A;  4OWW B;  4BA2 I;  5C5M A;  3I4M G;  5KRU A;  1TII D;  1JOO A;  2E76 C;  4X3T A;  4DV0 L;  1JIC A;  1GJX A;  3CKI B;  3H0G G;  1TWH B;  3KF8 A;  4AQY Q;  4IUN A;  1U0L A;  1IBL L;  1CM9 A;  2JJQ A;  5CBE E;  5IP9 G;  5IOD A;  1BBU A;  4JI5 L;  2RA4 A;  3I7F A;  2MQH A;  3MWY W;  4A93 H;  1EWH A;  4A3E H;  1EWC A;  2H4O A;  1PTO F;  3H3V I;  4R4I A;  1FL0 A;  1SYC A;  2GA4 B;  3T13 A;  5J22 A;  3J7A 5;  4HIO A;  1XTD A;  5M3M B;  2YTY A;  1F2M A;  5GAG C;  5JJK A;  1BCP B;  4KY6 A;  2E2H B;  1AW7 A;  4CKC A;  1RHP A;  2IW3 A;  1BR9 A;  1UWV A;  2IHF A;  3S16 H;  1LV9 A;  3M4Y A;  3MZ5 A;  5EKI A;  1VCI A;  2ZM6 Q;  4A3I G;  1FNW A;  2O5I C;  2ZM6 L;  2NVY B;  3S9W A;  1H9S A;  4UP8 A;  4A3G G;  4P75 A;  2R7Z B;  3QG1 A;  3QOJ A;  4KHP Q;  1D8L A;  2XWJ B;  1L0Y B;  3L0O A;  1PRT D;  1HFN A;  3EIV A;  1JJC B;  1GM5 A;  3ZYY X;  2ZTE A;  4X64 L;  1IL8 A;  4GN4 B;  3C3L A;  4C3H H;  1A2T A;  2EPB A;  3K0Y A;  1A15 A;  1PXU A;  2I46 A;  1LM0 A;  3PUV A;  5E3F A;  3HOX B;  2F4V Q;  4KMU C;  2GVA A;  1S5B D;  1YNJ C;  3GTL H;  4JI7 Q;  1F9S A;  4HED A;  1A62 A;  3I8Z A;  4RH6 A;  1SYB A;  2OQK A;  3PGZ A;  2L11 A;  2Q2I A;  1EQQ A;  2JEB I;  2ZXR A;  2K5V A;  3SK5 A;  5FJ8 H;  2EOT A;  3AU7 A;  4LNQ A;  3MXG A;  3PUZ A;  3H0G B;  1AEX A;  2BA1 A;  1AZQ A;  1VQA A;  2Q8T A;  1I50 H;  1IYU A;  1SE3 A;  3LX0 A;  3GTM B;  5C4H A;  4DUZ Q;  2E74 C;  3NWT A;  5IYD G;  1F9R A;  4A3F B;  1ZXT A;  3HOV H;  1LTS D;  2HT1 A;  4ID6 A;  1HUM A;  3T51 B;  2CQO A;  4HMJ A;  2SDF A;  2WFW A;  1ZYR C;  4ME5 A;  4A75 A;  3PIP 3;  2VB3 X;  3DWQ A;  3MTS A;  2D62 A;  1I4P A;  1Z9F A;  3FKI G;  1GKH A;  2F52 A;  1GUO A;  5J3B A;  2Q2U A;  3UDF A;  3UDG A;  1QVF A;  3ULL A;  2EIF A;  3WOE A;  2JYO A;  1HA6 A;  3GTK H;  1NMF A;  4V19 0;  2UU9 L;  5KIX A;  1XTC D;  5D3I B;  1YNN C;  1WJJ A;  4C1N I;  4A3K H;  1LTL A;  2L15 A;  4EQ5 A;  2CCZ A;  3CRL C;  4DV2 Q;  3J80 L;  2QGQ A;  3HOY G;  2B2T C;  1C9O A;  5HUR A;  2K5W A;  3HOZ B;  3UE0 A;  1WYD A;  3K7A H;  4DR7 Q;  1F2L A;  1AZP A;  1EY8 A;  2PQA B;  1S72 A;  5LMU L;  4K5W A;  1W2B A;  3NXW A;  1HZC A;  3ERQ A;  1L2F A;  3KK7 A;  3M3Y B;  1CKO A;  5IOC A;  2E2I H;  3CQZ H;  4A3J B;  1XNR Q;  3J81 L;  1L1O C;  1M4V A;  3TP5 A;  4YWL A;  3SEB A;  1STB A;  3KOJ A;  1Z47 A;  4FNF A;  4Z9C B;  1CHQ D;  5CV5 A;  1ET9 A;  3BJU A;  1NR4 A;  3BZD B;  4LFA Q;  1LT5 D;  1X9N A;  1GXD C;  1CFM A;  2PW7 A;  3G7L A;  2LSS A;  3T1H L;  3FKI H;  4A76 A;  1CI3 M;  5C0X I;  3IRB A;  2R7Z H;  3H3V H;  4TKO B;  4CDE C;  3E5S A;  4QGU A;  1HCZ A;  2NTT A;  1C7Y A;  4JBK A;  1J5E Q;  3A8I E;  1MJE A;  2D5D A;  3CME A;  4NMZ A;  4BS9 A;  3MXU A;  5EKL A;  4RGM A;  3PUX A;  2ICI A;  3HFZ B;  4BBR H;  4A3K B;  1I4Q A;  1W6J A;  2G9D A;  3J81 c;  2IX0 A;  5C44 G;  4FYD A;  4BY7 B;  3GTK B;  1DOL A;  1DON A;  4MNO A;  3TSS A;  5I9O A;  2R92 G;  4DK3 C;  1Y1W G;  2AUJ D;  5CV4 A;  3PO3 G;  1O7L A;  1KNA A;  3CC2 A;  2UXD Q;  3D4W A;  1D5X C;  5K36 H;  4R8I A;  1WTQ A;  4ALP A;  3E3X A;  3Q8D A;  4YY3 Q;  4RHS A;  3QJY A;  1UE6 A;  4A3G B;  3TP6 A;  3J7A V;  1X54 A;  3ERS X;  1ICF B;  3GTM H;  3J81 i;  2EZV A;  2E8G A;  5FK9 C;  1KC8 C;  4JV5 L;  3A8K E;  2EE1 A;  5M3F H;  4I7A A;  1XJV A;  1NE3 A;  1FGU A;  3PUW A;  5GQO A;  3I91 A;  4NB3 A;  4A3F G;  3PUY A;  3I3C A;  3KYH C;  4GLA C;  2AWO A;  1PVO A;  3J81 E;  4DR3 Q;  4XIG S;  4DV7 Q;  1BBX C;  3NTH A;  2R3Z A;  2NVT H;  1AP0 A;  1CKM A;  4FVM A;  5JEA J;  3VYU A;  4ULL A;  2KOL A;  4N9P A;  1A6X A;  4C3I H;  4Q0F A;  1SFO B;  3S2H H;  1NSN S;  2RCF A;  3FPP A;  4JYA L;  2Z4H A;  2IT1 A;  5M5Y B;  3WOF A;  1CQF A;  5IGB A;  1WD1 A;  4LAA A;  4P71 A;  5FLM H;  4MN3 A;  1QCB D;  2PW5 A;  4X62 L;  5KNC A;  4MIU A;  4PZ7 A;  5D65 A;  5K36 G;  2MO1 A;  1K9M C;  3VR4 A;  1BVS A;  3S1M H;  1PHJ A;  5EBD A;  1WOC A;  4IPC A;  3RNU A;  5A2Q E;  3VYS A;  1QWY A;  1FJG L;  4FXD A;  3HEJ A;  5M3F G;  1O78 A;  4DV5 L;  4P2C B;  4OO1 G;  2E2H H;  5TSS A;  4JI3 L;  1M8A A;  4JVZ A;  1HNW L;  1F2Z A;  1HR0 L;  3KLR A;  1HH2 P;  2NWG A;  2NZH A;  1VMP A;  3AMU A;  1U5K A;  3F1Z A;  3KLW A;  4XTC S;  1IKM A;  1BKB A;  4YHH L;  1VMC A;  5FO8 B;  1V8Q A;  2F03 A;  2L1B A;  2UXB Q;  2DY8 A;  4O2D A;  3J80 i;  4BBR B;  1BCP C;  1NR2 A;  2FXQ A;  1EY9 A;  1HR0 Q;  3EBE A;  2JA7 B;  4C3H B;  1TS5 A;  3TDQ A;  1SAP A;  4LFB Q;  4B3S L;  1KRS A;  1PTO D;  2F3V A;  1W3S A;  3DWP A;  2YTV A;  3DEP A;  3TS0 A;  3M4P A;  1B3A A;  4DV2 L;  2NVY H;  1KDA A;  2GN5 A;  4I65 A;  4X65 Q;  3IFD A;  2A74 C;  2JA8 B;  2JA9 A;  4N8X 1;  3P20 A;  5E4W C;  5JEA H;  3K59 A;  3E9I A;  4G7O C;  3ICE A;  3PF4 A;  1I4H A;  2XSC A;  3FMC A;  3K8A A;  5BR8 L;  4DR3 L;  2DNC A;  1D6E C;  2XNA C;  1JCK B;  4OO1 I;  5IGC A;  3UE1 A;  3BVZ A;  5GAH C;  5IGF A;  4DV0 Q;  1TWC H;  4JCV E;  1Q82 C;  2KEE A;  2NBF A;  3K58 A;  4LFA L;  4F87 A;  5I4D A;  1SXT A;  5IYC H;  2K4K A;  3GTJ B;  4LFB L;  4A3E B;  1PZJ D;  1DYQ A;  4G4K A;  4JI5 Q;  3BZC A;  1TWC B;  1EIF A;  2F0H A;  4K0K L;  3M7G A;  3KJO A;  4R8N A;  2WP8 J;  4LUO A;  1EWI A;  3QR8 A;  1IW7 C;  1E1O A;  2K7V A;  1PRT B;  4K5X A;  1G2T A;  2B2Y A;  2EVB A;  1RKN A;  2FHT A;  2B2V A;  3D4R A;  2F0W A;  1H9R A;  4K8I A;  4C1N K;  1WTR A;  2D2C C;  4P72 A;  1YJN A;  3OYY A;  5I6W A;  4UP7 A;  1H9J A;  4KY7 A;  2L9H A;  4XXE A;  2PZW A;  5AFW A;  5DEH A;  1N33 Q;  2NN6 G;  4PG3 A;  1CSP A;  4IFD H;  1KHI A;  2R6G A;  3C2P A;  3VR3 A;  3H3V C;  1MI2 A;  1Y8N B;  2NZO A;  5LL6 S;  4DK0 A;  1D5M C;  1WI5 A;  1WTH A;  1E1T A;  2K75 A;  2RKS A;  3KLS A;  2A73 B;  4XT3 B;  5JJL A;  5F2D A;  2SOB A;  4B08 A;  4Y7N H;  5JPN C;  4K14 A;  4AYB E;  4TVA B;  3F2B A;  4DNR B;  3K81 C;  4ZYS A;  1VQN A;  1L0X B;  2FMM A;  2I0Q A;  3B6Y A;  3JAM c;  1QVC A;  2M2L A;  1X32 A;  2JA5 B;  1T5X D;  2A6H C;  5COR A;  1ILP A;  5I9P A;  5HGT A;  3NP8 A;  4AYB B;  4GNX B;  5DLQ E;  1SYF A;  4KLK A;  3K5O A;  1ZEQ X;  4HN7 A;  4A3D B;  2EY5 A;  2RSN A;  4JC0 A;  2BOS A;  2AUK A;  2Z6K C;  2JA7 G;  2UUA Q;  3RLF A;  5ELB A;  1LT3 D;  3LWU A;  4PV1 C;  4CKE A;  2CWA A;  2K6A A;  4BY7 H;  1LUZ A;  4KHP L;  4BY1 H;  2Z0S A;  4RA8 A;  1BF4 A;  4X6A H;  3T1Y Q;  1UEA B;  2DN8 A;  1LTG D;  1TY0 A;  2L0C A;  1O7Y A;  1RTN A;  3Q24 A;  4GNX A;  1Z7T A;  2F0M A;  2F0K A;  5IYB H;  5EBC A;  3JAM E;  1EYA A;  2BCO A;  2OQ0 A;  1VQC A;  2CKZ B;  1A3V A;  1GVP A;  1VF7 A;  3I72 A;  2P5Z X;  2IWH A;  2B2U A;  2LY7 A;  4DUY Q;  1IKL A;  4YCV A;  5ELE A;  1KDC A;  4K2L A;  3TRE A;  4TRD A;  2RHS B;  3L9A X;  4A93 G;  1FYC A;  1JQY D;  1B9N A;  2J4X A;  4LF9 L;  4DAY B;  1Q1B A;  4JI2 Q;  2K50 A;  4X66 L;  2BA0 A;  4OWT B;  2JA5 G;  4BXX G;  2DY7 A;  2JQO A;  1D5Z C;  2F0U A;  3HG9 A;  3A0J A;  4IUQ A;  3KBG A;  4MZ9 A;  3GTG H;  4RWS C;  3HOX G;  1PH9 A;  1YJW A;  1PV4 A;  1I5F A;  3V96 A;  3RN2 A;  2N49 A;  3MVV A;  4A3L G;  1MD2 D;  2KEN A;  3DWA A;  4PMW A;  4C2M B;  3PF5 A;  3OMG A;  1QNU A;  3CU7 A;  4LF9 Q;  1WTW A;  4GN3 B;  1QIL A;  2Q8I B;  1MBY A;  2J0T D;  1J9O A;  5A35 A;  4KKS A;  3P7J A;  3GTG B;  4UDU C;  4EQP A;  3CPW A;  4LF8 Q;  2CW0 C;  2FFK B;  4DAY A;  2WB1 E;  4WFN 3;  1RTO A;  4NXN L;  1VQ9 A;  1XXG A;  1DGS A;  4A4I A;  4RKB A;  2EQS A;  1OXU A;  4WJW A;  1TWG B;  3S17 H;  3S1M B;  3RLN A;  3M4Q A;  1FJG Q;  3H94 A;  2KQ3 A;  3J80 E;  3GD7 A;  2A69 D;  4IJL A;  4IQZ A;  1JE5 A;  1T9H A;  2B63 B;  4JOI A;  5I2X A;  3NBH A;  4ZLT F;  1K8G A;  2DGY A;  1SMY D;  4JI3 Q;  1KLG D;  1FNU A;  1LTR D;  3PIP A;  2Y0S E;  5FLX E;  1KAB A;  2BDN A;  1FR3 A;  2UXC L;  4C3I B;  3S2H B;  2K33 A;  4OIK A;  3H09 A;  3T16 A;  1IBK Q;  5AJ3 Q;  3CCJ A;  5CV7 A;  5C0X G;  1PLF A;  2KHI A;  4V0B A;  4C56 C;  3G4S A;  1WVL A;  4QUC A;  2NVX H;  3MXN A;  1O7I A;  1N32 Q;  2H5X A;  3K7A B;  5ELO A;  4A3K G;  1VQ6 A;  2V1C C;  1U4P A;  3NBH B;  2JXM B;  1V9P A;  3FRP B;  4XT1 B;  3TS2 A;  3CW2 C;  4KK7 A;  5GAE C;  3J80 c;  2NYZ D;  4XQJ A;  2LS0 1;  5AJ3 L;  1B4O A;  3CCS A;  1X3F A;  1SNC A;  3PMF A;  4DV6 Q;  3M4O B;  3OSO A;  2K52 A;  3GTQ B;  5FLX c;  1TWG H;  3QB3 A;  4DN4 M;  2HUG A;  3U9O A;  3OTO Q;  5BN3 A;  3DM1 A;  4GLV B;  1B8A A;  2LXJ A;  2RCN A;  4QQB X;  5FO9 B;  2SNM A;  3TP8 A;  1MJC A;  2C9O A;  1L0W A;  2HIX A;  1TU2 B;  3S1R B;  1YIT A;  3EA6 A;  4KKT A;  3T56 B;  1F9Q A;  4DK6 C;  1IYV A;  5IP7 G;  1Y1V H;  4AH6 A;  5EPJ A;  1K8O A;  4WJ3 M;  2HDM A;  1HA5 A;  5E7N A;  1CZW A;  1EZ6 A;  1TR5 A;  1Y8O B;  2AWN A;  4K5V A;  4HSV A;  4L5T A;  3D6C A;  4B9X A;  1V1P A;  3E6Z X;  4POG A;  1K0R A;  2EY2 A;  2IPK D;  3PQI A;  3W3A A;  2R92 H;  4CKB A;  3NTI A;  2IJ0 A;  3CCM A;  1PH2 A;  1R9T B;  2IX3 A;  4LF7 L;  4RMF A;  4HJ8 A;  2OXP A;  1B70 B;  3CCV A;  2WAQ B;  1ONL A;  5KYL A;  2HD3 A;  4IUP A;  2Q8R E;  4DNI A;  1EU4 A;  1HFG A;  5IGE A;  3CXC A;  4JI1 L;  1JC7 A;  1RDP D;  4HID A;  3OWF A;  2F0Q A;  1WTX A;  4QY7 A;  2NVQ B;  2K01 A;  3OIP A;  1QB5 D;  1SRU A;  1XMO L;  1TT2 A;  4NW2 A;  1TWF H;  2TSS A;  2C35 B;  2XIW A;  3PO3 H;  1ZKO A;  1IBM L;  3HOW H;  1WCM H;  2X69 A;  5KNB A;  4F7X A;  4LF4 L;  1ROD A;  5IYB G;  1PFN A;  2VQE Q;  1VS0 A;  2Z4I A;  2MNA A;  4B9W A;  2RDG A;  4A3M B;  2M9V A;  5M3M H;  1NNX A;  3OW7 A;  3GV6 A;  2QKI C;  3Q6S A;  4KHZ A;  1M1K C;  1LAB A;  3HOY H;  1O80 A;  2IL8 A;  3I4N G;  1K83 B;  1K28 A;  4GN5 A;  4YIJ A;  1U4R A;  4APV A;  5C4X B;  1I4G A;  4IUR A;  4MTN A;  4XYQ A;  1YHQ A;  4A93 B;  2RF4 A;  4DU9 A;  4DV7 L;  4CHT B;  3U9S A;  2PCF B;  3U50 C;  3H15 A;  2JA5 H;  4XDX A;  4IJH A;  4GKK L;  1NBW A;  4YCU A;  2F0N A;  5IGD A;  2YU9 B;  4H7B A;  4HCS A;  3HRZ C;  1GUW A;  3VA7 A;  4LUV A;  3N6R A;  4RFB A;  4DR4 L;  3S14 B;  1I6H B;  1XPO A;  5M5Y H;  2OF1 A;  1Q7Y C;  3CRK C;  4UP9 A;  1B53 A;  3HOU B;  3HOX H;  2Z9H A;  1I6V C;  4ZRZ A;  2X6L A;  3OIQ A;  3FPU B;  3ONA B;  2A8V A;  3MEH A;  4QIW E;  2F0D A;  2PI2 A;  4WRD A;  3HOW G;  4JI7 L;  1R4Q B;  3EVQ A;  4JI0 Q;  1SMX A;  3CHB D;  3PO2 B;  2VUM B;  1I6H H;  1PYS B;  4DA2 A;  4QB4 A;  1WD0 A;  3SK6 A;  4XQN A;  4CJ1 B;  1TY2 A;  3WDN A;  2EYL A;  2R7F A;  2V4D A;  1EQT A;  5M3F B;  1G6P A;  2O4X A;  4RGN A;  2Z1C A;  3NE5 B;  4OEM B;  4JI1 Q;  2MJ8 A;  4DR6 L;  1HZB A;  1EY6 A;  1TVX A;  3VR6 A;  1TXY A;  3F2U A;  1J5E L;  1UE1 A;  4QCL A;  5IWA L;  3TEH B;  3K57 A;  3VR2 A;  3I4M B;  1EY5 A;  5EKK A;  4CDD C;  2KUM A;  3A54 A;  2F0S A;  3SR1 A;  4IN3 A;  1E2W A;  2N3S A;  1XYI A;  3MAQ A;  1YNJ D;  2F0L A;  4RCN A;  4GOP C;  1AH9 A;  5IT9 E;  3L7Z C;  1PTO B;  4OON A;  3NBI A;  4QL5 A;  1NMG A;  4FF1 A;  1H95 A;  4IO9 A;  2QA4 A;  5GRO A;  1Q8I A;  4U67 3;  1X3G A;  5FLX L;  2OCE A;  1BO0 A;  2FMC A;  3D0F A;  1V1Q A;  4R4C A;  4X3K A;  3RLO A;  3X3M A;  2EYO A;  3SHL A;  5IT9 L;  4A3B B;  1SE4 A;  1CA6 A;  4R4O A;  3TP7 A;  1Q3L A;  5H1S E;  4K0K Q;  1QOH A;  5IYC G;  1XMQ Q;  2R7D A;  5ELN A;  4BBS G;  1STG A;  2PPB C;  3I4N B;  2E2I B;  2CVR A;  2ZT9 C;  1Y14 B;  3LNN A;  2SEB D;  2K1B A;  1BUV T;  1RD9 D;  1BNZ A;  3MFG A;  2AQ3 B;  3I4M H;  3A56 A;  4QMG A;  2HCC A;  2KED A;  3GTO B;  1Y1V G;  1G6Z A;  4FF3 A;  1N34 L;  4R4Q A;  3I56 A;  1VQP A;  2N8N A;  5IP9 H;  3KJP A;  3HOZ H;  3RD4 A;  5C44 B;  4RAU C;  2TMP A;  2KCC A;  5BN5 A;  1A0I A;  3I73 A;  4G57 A;  1HNZ L;  2WB1 B;  1UNS A;  1U9R A;  2AHO B;  1JOR A;  1PYB A;  1JOQ A;  3S1R H;  4IPD A;  2WIN B;  2JP1 A;  3OMC A;  2DJG C;  1HNX Q;  3SE0 A;  3G71 A;  1I4X A;  3PO2 H;  3A7A B;  3P75 A;  1VQ7 A;  1BDO A;  2DJF C;  1UEB A;  1EU3 A;  1PYW D;  4QJF A;  2PNR C;  4FDB A;  4ZUI A;  2UXC Q;  1E7Z A;  2LFN A;  3U4Z A;  4DV3 L;  4IPG A;  3SDZ A;  1S3O A;  3TZD A;  1XWE A;  3HS0 C;  1CSQ A;  5CYU A;  2Z6K A;  1X3Q A;  1SDF A;  5M5W B;  3QWN A;  2I5M X;  5JJI A;  1IBM Q;  1FNV A;  2L12 A;  1YBY A;  3MFY A;  4OEL B;  3I2Z A;  5FO7 B;  1I50 B;  3I90 A;  2Q2H A;  2E2J B;  2WAQ G;  2LXK A;  3H0G H;  5IGG A;  1N34 Q;  1PA6 A;  1PZI D;  3SVM A;  2JA8 G;  1S5C D;  2B29 A;  4PMB A;  1D1I A;  2K28 A;  3JAM L;  5CGK A;  2NB0 A;  4J6H A;  1CUK A;  4XYO A;  1LTT D;  5EQ0 A;  4A3E G;  3G6J B;  5C3E B;  4BBR G;  2BDO A;  1ICW A;  2EJF C;  3WWV A;  1EZ8 A;  1SFO H;  4OWX B;  1VQL A;  1ENA A;  2VW9 A;  2HIV A;  2B2U C;  5COY A;  1KAA A;  2QCP X;  1IBK L;  2RDF A;  4FXG C;  1IBL Q;  4UPA A;  3F2C A;  4L6T B;  3K5N A;  3V2T A;  3PIO 3;  2F0O A;  1JT8 A;  1L1O A;  1EUJ A;  1PTO C;  2Z6B A;  1KRT A;  1KQS A;  3J81 j;  1PTO H;  5CV8 A;  5G3L F;  4OX9 Q;  1LTI D;  1M90 C;  3HOV G;  3BS1 A;  1LYL A;  2KHJ A;  4DXF A;  1C48 A;  3T1H Q;  2BH2 A;  4DK1 A;  1H9M A;  3GTP B;  3H91 A;  4TSS A;  4A3F H;  3KDF A;  2JA8 H;  2VS1 A;  2KCM A;  4JW0 A;  4DR7 L;  1LTB D;  4ABN A;  1GUS A;  2A68 D;  4C3H G;  5JPM C;  3PV0 A;  2E2D C;  4UAI A;  4HJA A;  5CV6 A;  3J7Z C;  3NHH A;  1ASZ A;  3RZO H;  5LMN L;  3BDL A;  1SND A;  5C4J H;  3GP7 A;  4GS3 A;  2CHB D;  1NJI C;  4I7Z C;  2HCI A;  5FLM G;  2VL6 A;  4JBW A;  2PYK A;  4R1J A;  1IL2 A;  1HZ9 A;  4K6D A;  2K04 A;  1WFQ A;  1BCP F;  2ZXP A;  3CCL A;  4M8A A;  2C5C A;  4DKA C;  3A55 A;  4BBS B;  3HGB A;  3A7L A;  4ZKB B;  4A3I B;  4BA1 I;  1STH A;  4J15 A;  4IZ8 A;  1NUC A;  3TQY A;  4UY8 C;  2B63 G;  3KF6 A;  2KCN A;  1E0B A;  3C1E A;  1VQG A;  1GHJ A;  3A74 A;  3OOC A;  5EPL A;  1SEB D;  3U58 A;  4KY5 A;  3R93 A;  1SYG A;  2NTS A;  4KKU A;  4JPB W;  3CPF A;  4DNT B;  1YJ9 A;  5EAY A;  4DAV A;  3ULJ A;  3S2D B;  1PH8 A;  4L63 B;  1KDB A;  3K0X A;  2ICE C;  4MTK A;  1B3Q A;  1X6O A;  4B3M Q;  1B50 A;  1KD1 C;  3S2D H;  2EYP A;  1ESR A;  1A2U A;  2HHH Q;  1ILQ A;  1Q1E A;  2N78 A;  3A5Z B;  1IZ6 A;  2CH4 W;  5LL6 X;  1CA5 A;  4DR4 Q;  1VF5 C;  4FF4 A;  1FGB D;  1LTA D;  1V1O A;  1SYE A;  4LW1 A;  1LT4 D;  3BG3 A;  1VQE A;  1S5D D;  4DR1 L;  2OEO A;  2JK8 A;  4LFC L;  1C8C A;  1A3U A;  5E4X A;  4K2K A;  4ZK9 B;  1STA A;  4YY3 L;  4IUV A;  5E1F A;  1PMR A;  4B3T Q;  1EIG A;  3GDE A;  1JJG A;  4IFD I;  3S24 A;  5L37 A;  2VQE L;  4BBS H;  1VQM A;  1YNN D;  2RVL A;  4KV6 A;  4DFA A;  1EY4 A;  3U4V A;  4Y52 H;  3S15 B;  4ZAI A;  2WII B;  4IUU A;  1GUT A;  2JA6 B;  2XGT A;  2N88 A;  4LUZ A;  3BDO A;  1RCV D;  1AN8 A;  5JJZ A;  4CDF C;  3K7U C;  1RJT A;  3H6M A;  3STB C;  1HTL D;  3HKZ E;  3PO2 G;  1Y1W B;  2VQF Q;  3NUC A;  2XVS A;  4KD4 A;  1QG7 A;  2Z8L A;  2HDL A;  2QEJ C;  5LHY 1;  5JVH 3;  2VB2 X;  1H9S B;  5D14 A;  3RZO B;  4QIW B;  1PRT C;  3CC4 A;  3HOU G;  1UE7 A;  2QDB A;  4OL7 A;  3EQL C;  2RDH A;  2JN4 A;  3AEV A;  1VDZ A;  1KAW A;  2D0P A;  1A8V A;  5IIF A;  3TBI B;  1QUQ A;  5BR8 Q;  1Q86 C;  4B3T L;  1WCM B;  5A2Q L;  2R93 B;  3VYR A;  1KLU D;  5C4Z A;  2ZJQ A;  4LF7 Q;  1GO3 E;  1KXL A;  4A3D G;  1G51 A;  5LMU Q;  4GLX A;  1JWM D;  3F8T A;  4HIM A;  2EDG A;  2B2W C;  3J7Y W;  4NKL A;  1EQV A;  5KND A;  4IFD J;  2AMC B;  4X65 L;  1SJH D;  4AYB G;  4JV5 Q;  2PQA A;  4H0L C;  2EXD A;  4H44 C;  5EPK A;  4C3J H;  2A68 C;  4LJZ C;  4RHR A;  4HTH A;  1YNX A;  4DR5 L;  3PIO A;  1YHA A;  1YEZ A;  3AFP A;  1QE6 A;  1J8I A;  4HJ7 A;  3L3O C;  3M85 A;  1HNZ Q;  5C6A A;  1T5E A;  2RBM A;  3CMA A;  4LFC Q;  4IFD G;  5D3D A;  4NXN Q;  3CQZ B;  4A3J H;  3QO2 A;  4DV4 Q;  1TS2 A;  4IAL A;  1HUN A;  2F0J A;  3SGI A;  1Z6H A;  2A69 C;  4OIJ A;  5NUC A;  2B8G A;  2ZTC A;  4QF4 A;  1XNQ L;  5C3E G;  2A5H A;  1VQ4 A;  1EYD A;  4LMQ D;  1EYG A;  3NEN A;  5C0X H;  1Y8P B;  1TQO A;  3TZU A;  2JE6 I;  1S5E D;  3AQQ A;  4NDX A;  4ZQ3 A;  4DR1 Q;  1PH3 A;  4A3D H;  1U4M A;  1VQ8 A;  1K8M A;  2UXD L;  3BYT B;  1B2T A;  4OGQ C;  2CQA A;  5ELF A;  5M5W H;  1VQH A;  4L5Q A;  2JSO A;  3AB9 A;  4JBM A;  1MGS A;  4C3J B;  1AFP A;  1JB7 A;  2I5H A;  4LK1 C;  5CBA E;  1SE8 A;  4JI2 L;  2D0O A;  1I3Q B;  1S40 A;  5IT9 c;  3CCR A;  3D31 A;  4NPS A;  4POF A;  3RMH A;  4HJ5 A;  4JI4 Q;  3GV3 A;  2HQL A;  2R7Z G;  3K6O A;  3CD6 A;  4DR6 Q;  4L5R C;  4A3B G;  1EYC A;  2EY6 A;  3HZX A;  1PH4 A;  2L55 A;  2OT2 A;  1LO5 D;  2UUC L;  1SNQ A;  3BZK A;  4R9W A;  1VQD A;  3AYH B;  4S3S A;  3BDC A;  4HMI A;  4JI6 Q;  1D2B A;  4JI0 L;  2FIN B;  1OXS C;  2RHQ B;  4ILW A;  4H02 A;  1DM0 B;  5J1Z A;  4LF8 L;  1YI2 A;  1EQR A;  5KEE A;  1ESF A;  4DR5 Q;  4DAM A;  3QIA A;  2PNH A;  3K80 C;  1SSO A;  1QNK A;  4DV3 Q;  2UUC Q;  3I4L A;  5CMD A;  2ZTD A;  1JB3 A;  3IL8 A;  4KD3 A;  4E6I A;  1TS3 A;  5JEA G;  4K8J A;  4K6L A;  2ASB A;  3RN5 A;  4KJN A;  2KA7 A;  4JI4 L;  4OX9 L;  3ITP A;  2JEA I;  5T1G A;  5LMN W;  3A8J E;  4A3C H;  1B44 D;  4NXM L;  2EYH A;  2K5D A;  4EVO A;  3DXJ C;  3F2D A;  1BBW A;  1STY A;  4WOR A;  1Y69 U;  5C4J B;  5C4X H;  1K8A C;  3GTJ H;  2K03 A;  1SMY C;  3KDF B;  1K83 H;  1SJE D;  1ZYR D;  4F88 A;  1SR3 A;  2KHS A;  4PZ6 A;  3W1G A;  4GNX C;  4LF4 Q;  3KLS X;  4X66 Q;  1MSH A;  2Y0S B;  4PZ8 A;  4YCW A;  4X3S A;  5I2Y A;  1IXR A;  1XMQ L;  5EGT A;  3TN2 A;  1GUN A;  2EJG C;  3CCE A;  3MXP A;  1EOV A;  4J8Q A;  1TWF B;  4ZCK A;  2A6H D;  3BVG A;  4DR2 L;  4EGV A;  2NVQ H;  3GTP H;  1NY4 A;  2QW7 A;  3M9B A;  1ENC A;  1PH1 A;  2K32 A;  3FDT A;  2AKW B;  5DM7 3;  4GOP B;  4CBV A;  2PI2 E;  2A19 A;  2IHE A;  1HXY D;  1GUG A;  1ET6 A;  2R93 H;  4EQO A;  3RZD B;  2F3W A;  4OXP A;  3FHW A;  2ZJR A;  2NN6 H;  1HQM C;  4O1N A;  2JA7 H;  2YTX A;  3DMU A;  1IW7 D;  4RGT A;  2R92 B;  5M9O A;  2UUB L;  2B2V C;  2NUC A;  1YHB A;  2K5H A;  2WV6 D;  5M5X B;  3HOU H;  4BY7 G;  1RF2 D;  1LLR D;  3NQI A;  1KIX A;  4HR7 B;  4KTA A;  3T53 B;  4GOP A;  4HCE A;  1PH5 A;  2A6E C;  4JI8 Q;  1G8Z D;  1VQO A;  3S14 H;  2ZXO A;  2BE5 D;  1XPU A;  4PQX A;  1EY0 A;  3NK9 A;  3X3N A;  4HAE A;  2YU9 H;  3MHB A;  1EL0 A;  4N8F A;  3J7A F;  3UDI A;  2EXZ A;  4IOC A;  1OO9 B;  2IY5 B;  2JA6 H;  2WAC A;  5FJ8 G;  1NTG A;  4C3J G;  2KJX A;  2K5N A;  2E75 C;  3UDX A;  4G7H C;  3R2I A;  1BOS A;  4U68 A;  4DF7 A;  2OTL A;  4KHV A;  3FVQ A;  4A3J G;  2BH8 A;  1EEI D;  3MXN B;  2R93 G;  3T1Y L;  4DUY L;  4GZY C;  1Q8K A;  5FKA C;  1JR0 D;  3FEW X;  4ZKC B;  1A3T A;  5C3W A;  3E9H A;  2B2Y C;  4ME3 A;  4L5S A;  3SXH A;  4CJ2 C;  4A3M G;  1DOK A;  1N33 L;  1N32 L;  4JK1 C;  4RG1 A;  3MA2 B;  2VUM H;  1C0A A;  1BQQ T;  1JE4 A;  1O7Z A;  4JI8 L;  4P74 A;  2F4V L;  2VNU D;  2HQE A;  2NZ1 D;  3TME A;  2MO0 A;  1DD2 A;  2UU9 Q;  2YYZ A;  1V43 A;  4NP5 A;  5C3X A;  1P8L A;  1OTC A;  3M7N A;  3K5L A;  2BE5 C;  2WKD A;  4DUZ L;  2NVT B;  3CC7 A;  3DM3 A;  1LAC A;  1S4Z A;  3GTO H;  3K5M A;  4CGY B;  1KNE A;  1PH6 A;  1SN8 A;  3AFQ A;  3MC0 B;  1W6K A;  1NCV A;  4LF6 Q;  3HOV B;  2JA6 G;  1OXT A;  1K73 C;  4DR2 Q;  3R2T A;  1YVC A;  1HJP A;  2E2J H;  3R3O A;  3OHX C;  1QUQ B;  4KI0 A;  5EJW A;  3CF5 A;  1HRJ A;  2QF7 A;  1S5F D;  3UI2 A;  4BWG B;  5CC4 A;  2K5Q A;  3D6W A;  3E0E A;  4CDC C;  5ISR A;  3LWE A;  1Q46 A;  1D7Q A;  4A3B H;  3TRZ A;  1U4L A;  1I94 L;  3P1H A;  2R61 A;  3HOY B;  1FVI A;  2PO4 A;  1G2S A;  1DJR D;  4IPH A;  2QEX A;  4DV1 L;  3CCQ A;  1E3P A;  1TKW B;  2G5D A;  3URY A;  4A3M H;  2L4N A; 
#chains in the Genus database with same CATH homology
 2F52 A;  5J3B A;  3S17 H;  3RLN A;  2Q2U A;  3UDF A;  3UDG A;  3M4Q A;  1QVF A;  1HZ9 A;  3ULL A;  2EIF A;  1QZG A;  1FJG Q;  4YWK A;  3GD7 A;  3GTK H;  1NMF A;  1WFQ A;  4IJL A;  2UU9 L;  3PSI A;  1JE5 A;  3HOZ G;  1T9H A;  4GKJ L;  3CCL A;  4JOI A;  3LGJ A;  3NEL A;  1K8G A;  1WJJ A;  2DGY A;  4DKA C;  4JI3 Q;  2OTJ A;  4A3K H;  3HKZ G;  1LTL A;  2L15 A;  4EQ5 A;  3PIP A;  2CCZ A;  2Y0S E;  4BA1 I;  4J15 A;  4DV2 Q;  3HOY G;  2QGQ A;  1C9O A;  3TQY A;  4UY8 C;  2CWP A;  3KF6 A;  3JAM i;  5C44 H;  2B63 G;  2UXC L;  1VQG A;  3UE0 A;  3A74 A;  3GTQ H;  1WYD A;  3K7A H;  1X65 A;  4DR7 Q;  3U58 A;  3I55 A;  4DV4 L;  1IBK Q;  5AJ3 Q;  3CCJ A;  3CPF A;  4LF6 L;  2F3I A;  2PQA B;  5C0X G;  1S72 A;  2HHH L;  2UXB L;  2KHI A;  5LMU L;  1W2B A;  3G4S A;  2NVX H;  1YJ9 A;  1N36 Q;  5EAY A;  1HZC A;  1X56 A;  3JC6 6;  1L2F A;  1O7I A;  3ULJ A;  3CCU A;  4HIK A;  1N32 Q;  1CKO A;  4LF5 L;  2H5X A;  4JOI C;  1PH8 A;  2E2I H;  3CQZ H;  5ELO A;  1XNR Q;  1HNW Q;  4A3K G;  1VQ6 A;  3K0X A;  3W1B A;  1L1O C;  1R9T H;  4YWL A;  2V1C C;  3G6E A;  3KOJ A;  3NBH B;  1N36 L;  1Z47 A;  1V9P A;  1X6O A;  4B3M Q;  2VZA A;  3TS2 A;  3BJU A;  1KD1 C;  3S2D H;  3CW2 C;  2HHH Q;  5GAE C;  3J80 c;  4LFA Q;  1Q1E A;  2N78 A;  3A5Z B;  1X9N A;  1IZ6 A;  5AJ3 L;  4DR4 Q;  2LSS A;  3T1H L;  4YHH Q;  3FKI H;  4B3M L;  3CCS A;  4LW1 A;  5C4X G;  1VQE A;  2XTI A;  1X3F A;  4A76 A;  5C0X I;  3IRB A;  4DR1 L;  2R7Z H;  3H3V H;  4JBJ A;  3OTO L;  4DV6 Q;  2KBN A;  2JK8 A;  4LFC L;  4LF5 Q;  2K52 A;  4QGU A;  5FLX c;  1N8R C;  1TWG H;  1C7Y A;  4JBK A;  4BY1 G;  1J5E Q;  4YY3 L;  1Q81 C;  1MJE A;  3L2P A;  3CME A;  2VY3 A;  4B3T Q;  3GDE A;  3OTO Q;  4DV6 L;  3PUX A;  3S1Q H;  3S24 A;  4IFD I;  3HFZ B;  4BBR H;  1JJG A;  2VQE L;  4BBS H;  4GLV B;  1B8A A;  2LXJ A;  1VQM A;  2RCN A;  3J81 c;  4QQB X;  2IX0 A;  1SLJ A;  5C44 G;  2B63 H;  1MJC A;  4JG2 A;  1L0W A;  2HIX A;  3U4V A;  5HY6 A;  4Y52 H;  3A5U A;  1YIT A;  4MNO A;  1Q12 A;  3I4O A;  2R92 G;  4DK3 C;  4DK6 C;  5IP7 G;  1Y1W G;  1Y1V H;  2XGT A;  1JJ2 A;  4AH6 A;  4LUZ A;  4GKK L;  1J6Q A;  2VQF L;  3PO3 G;  2UXD Q;  3CC2 A;  4WJ3 M;  2ZJP A;  5E7N A;  3K7U C;  1XMO Q;  3M4O H;  4P73 A;  3STB C;  3HKZ E;  4X62 Q;  4ALP A;  2AWN A;  3PO2 G;  2VQF Q;  2Y0S G;  2ALY B;  3Q8D A;  4L5T A;  4YY3 Q;  4LWC A;  2WAQ E;  1UE6 A;  4POG A;  1X54 A;  3ERS X;  1K0R A;  3VDY A;  3J81 i;  1UE7 A;  3CC4 A;  3GTM H;  2E8G A;  3HOU G;  1KC8 C;  4B3R Q;  1I94 Q;  2R92 H;  4JV5 L;  5M3F H;  3AEV A;  5IP7 H;  3CCM A;  1KAW A;  1XJV A;  2D0P A;  1NE3 A;  1FGU A;  1A8V A;  3PUW A;  1PH2 A;  1AE3 A;  4NB3 A;  5GQO A;  2A1A A;  4RMF A;  3PUY A;  4A3F G;  5C0X J;  1HR0 W;  4LF7 L;  1QUQ A;  5BR8 Q;  1Q86 C;  3KYH C;  4GLA C;  2AWO A;  4HJ8 A;  4B3T L;  1K3R A;  3KFU A;  1PVO A;  4DR3 Q;  1B70 B;  3CCV A;  4XIG S;  4DPG A;  4DV7 Q;  2ZJQ A;  1XNQ Q;  4GKK Q;  4LF7 Q;  1GO3 E;  1YIJ A;  2NVT H;  1KXL A;  4A3D G;  1G51 A;  1N9W A;  5LMU Q;  3F8T A;  4DNI A;  4HIM A;  4GLX A;  1CKM A;  4IFD J;  3CXC A;  5JEA J;  2AMC B;  4JI1 L;  4X65 L;  4AYB G;  1X3E A;  3RR5 A;  4C3I H;  3S2H H;  4JV5 Q;  1OXU A;  4B3R L;  2PQA A;  1A63 A;  3ULP A;  2EXD A;  5IE8 A;  4C3J H;  1TWA H;  4HID A;  4JYA L;  2IT1 A;  4QY7 A;  4IOA A;  3FP9 A;  4P71 A;  5FLM H;  1SRU A;  1YNX A;  4DR5 L;  1XMO L;  3PIO A;  1TWF H;  1YHA A;  2C35 B;  1YEZ A;  3PO3 H;  1IBM L;  3AFP A;  4X62 L;  1WCM H;  3G48 A;  4LF4 L;  3HOW H;  4HJ7 A;  1IL2 A;  5IYB G;  3M85 A;  2VQE Q;  4PZ7 A;  1VS0 A;  5K36 G;  2MO1 A;  1K9M C;  1HNZ Q;  1BVS A;  3S1M H;  1PHJ A;  2MNA A;  3CMA A;  5HGQ A;  4LFC Q;  4IFD G;  5M3M H;  3CAM A;  4NXN Q;  1X55 A;  4A3J H;  3W5O A;  4AIM A;  4KHZ A;  3DLL A;  1M1K C;  1WOC A;  4IPC A;  4DV4 Q;  3RNU A;  3HOY H;  2VUM G;  1XPR A;  1FJG L;  4A3G H;  3I4N G;  4GN5 A;  1JMC A;  1GD7 A;  1OXX K;  4APV A;  5M3F G;  3SGI A;  4DV5 L;  4MTN A;  3PCO B;  1YHQ A;  2ZTC A;  4OO1 G;  1VQK A;  2E2H H;  2RF4 A;  4DV7 L;  1QVG A;  1XNQ L;  1MKH A;  5C3E G;  3U50 C;  4NXM Q;  1OXV A;  1WCM G;  4JI3 L;  2YV5 A;  1VQ4 A;  5M5X H;  3NEN A;  3H15 A;  1EYG A;  1OTC A;  2JA5 H;  1HNW L;  4IJH A;  2E5L Q;  1HR0 L;  1NBW A;  1HH2 P;  2JE6 I;  3AQQ A;  4YCU A;  4C2M H;  1UE5 A;  5IWA Q;  4DR1 Q;  1PH3 A;  2NZH A;  4A3D H;  1VQ8 A;  2WB1 G;  1U5K A;  2UXD L;  3F1Z A;  3KLW A;  4LUV A;  4XTC S;  4DR4 L;  5M5W H;  1VQH A;  4L5Q A;  1BKB A;  4YHH L;  1PH7 A;  1XPO A;  1E24 A;  1RIP A;  5M5Y H;  2UXB Q;  4JBM A;  4O2D A;  3J80 i;  1Q7Y C;  4UP9 A;  1JB7 A;  2I5H A;  5GAD C;  1G29 1;  3HOX H;  3OW2 A;  1I3Q H;  3BU2 A;  1SE8 A;  2GVB A;  4JI2 L;  2D0O A;  2A8V A;  2FXQ A;  4QIW E;  5IT9 c;  3CCR A;  1S40 A;  3D31 A;  2PI2 A;  3EBE A;  4NPS A;  1E22 A;  4POF A;  4HJ5 A;  1HNX L;  4JI4 Q;  3HOW G;  2HQL A;  4JI7 L;  2R7Z G;  1YZ6 A;  4JI0 Q;  3CD6 A;  1SMX A;  4L5R C;  5IY0 A;  4A3B G;  4DR6 Q;  1IYJ B;  4LFB Q;  2NN6 I;  1PH4 A;  4B3S L;  1I6H H;  2ATW A;  1PYS B;  1P16 A;  1KRS A;  2E5L L;  5IYD H;  4GKJ Q;  1W3S A;  2UUC L;  3BZK A;  3ER0 A;  2YTV A;  1VQD A;  3AYH B;  2R7F A;  4YWM A;  4A3M H;  3TS0 A;  3M4P A;  4DV5 Q;  4DV2 L;  1G6P A;  2NVY H;  4JI6 Q;  2GN5 A;  1L1O B;  4JI1 Q;  4X65 Q;  4JI0 L;  4DR6 L;  2RHQ B;  1OXS C;  4HJ9 A;  1HZB A;  3CP0 A;  4H02 A;  2PMZ E;  1TXY A;  1KL9 A;  1J5E L;  3M3Y H;  1RL2 A;  1UE1 A;  2JA9 A;  5IWA L;  1VQI A;  3TEH B;  5C3E H;  4LF8 L;  3E9I A;  2IX1 A;  1YI2 A;  3ICE A;  1EQR A;  1CKN B;  3PF4 A;  3K8A A;  3MEF A;  4DR5 Q;  5BR8 L;  2N3S A;  4DAM A;  4DR3 L;  2PNH A;  3K80 C;  4JI6 L;  3GO5 A;  2K14 A;  4OO1 I;  4DV3 Q;  3UE1 A;  1ASY A;  1PFS A;  4GOP C;  1AH9 A;  3L7Z C;  2UUC Q;  5GAH C;  4OON A;  4QL5 A;  4DV0 Q;  1TWC H;  4JCV E;  1NMG A;  2CFM A;  1Q82 C;  2ZTD A;  1H95 A;  4LFA L;  4IO9 A;  3HKS A;  2QA4 A;  5IYC H;  5JEA G;  2K4K A;  5GRO A;  4LFB L;  2ID0 A;  1MIU A;  1AE2 A;  4EX5 A;  2ASB A;  4JI5 Q;  3BZC A;  4BXX H;  3RN5 A;  2ES2 A;  1EIF A;  1X3G A;  4JI4 L;  2OCE A;  2KCT A;  4OX9 L;  2JEA I;  4A3C H;  5LMN W;  1VQ5 A;  4K0K L;  3KJO A;  4NXM L;  3D0F A;  1V1Q A;  2WP8 J;  1CKN A;  2MFI A;  4LUO A;  1EWI A;  4R4C A;  3F2D A;  1E1O A;  2B3G A;  4R4T A;  1BBW A;  4AQY L;  3RLO A;  4JYA Q;  4A3L H;  4TQU S;  5C4X H;  4X64 Q;  1K8A C;  3GTJ H;  2OWO A;  3KDF B;  1K83 H;  3STB D;  1SR3 A;  4DV1 Q;  4PZ6 A;  3NEM A;  3W1G A;  4GNX C;  4R4O A;  4P72 A;  1YJN A;  2UUB Q;  3OYY A;  5H1S E;  4LF4 Q;  2Q2T A;  4K0K Q;  1XNR L;  5IYC G;  1XMQ Q;  1VQF A;  4X66 Q;  1SRO A;  2JA8 H;  2R7D A;  4UP7 A;  5ELN A;  4WJ4 A;  4BBS G;  1QZH A;  2I5L X;  4PZ8 A;  4YCW A;  4A3C G;  1XMQ L;  1IXR A;  1Y14 B;  3CCE A;  3ZJY C;  1EOV A;  3KF6 B;  3KF8 B;  1N33 Q;  3I4M H;  2NN6 G;  1HZA A;  4PG3 A;  4DR2 L;  1CSP A;  4O0A A;  1KHI A;  2NVQ H;  2R6G A;  5M3M G;  1Y1W H;  1NY4 A;  1Y1V G;  3M9B A;  1HR0 Q;  3GTP H;  3EN2 A;  1PH1 A;  2UUA L;  1N34 L;  4R4Q A;  1B7Y B;  3I56 A;  2NZO A;  2N8N A;  5IP9 H;  1VQP A;  2AKW B;  1WI5 A;  4GOP B;  2DUD A;  3KJP A;  5LMN Q;  1EFW A;  1E1T A;  3I4N H;  3HOZ H;  1A0I A;  2K75 A;  2PI2 E;  1TWH H;  1HNZ L;  4A3I H;  3S1N H;  2AHO B;  2A19 A;  1PYB A;  2IHE A;  5JJL A;  1EIY B;  3S15 H;  3S1R H;  4IPD A;  3RZD H;  2R93 H;  4Y7N H;  1HNX Q;  1VQB A;  1VQJ A;  3G71 A;  4OWW B;  4AYB E;  4TVA B;  3PO2 H;  4OXP A;  3I4M G;  4BA2 I;  3FHW A;  2ZJR A;  3F2B A;  4DV0 L;  3K81 C;  1VQ7 A;  1UEB A;  3H0G G;  2JA7 H;  1VQN A;  2YTX A;  3HOV G;  4QJF A;  4FDB A;  4AQY Q;  2UUB L;  2UXC Q;  2I0Q A;  3B6Y A;  3JAM c;  2K5H A;  1U0L A;  1QVC A;  1YHB A;  1E7Z A;  2JJQ A;  3U4Z A;  4IPG A;  5IP9 G;  4DV3 L;  1IBL L;  3HOU H;  4BY7 G;  1BBU A;  4JI5 L;  1S3O A;  3I7F A;  2MQH A;  1KIX A;  4A93 H;  1PH5 A;  1CSQ A;  4GOP A;  4A3E H;  4B3S Q;  2Z6K A;  4GNX B;  3H3V I;  5DLQ E;  4JI8 Q;  1VQO A;  3S14 H;  4R4I A;  1XPU A;  1FL0 A;  2I5M X;  4KLK A;  5JJI A;  1IBM Q;  2YU9 H;  3J7A 5;  1YBY A;  4HIO A;  3I2Z A;  1XTD A;  4JC0 A;  2Q2H A;  3UDI A;  2WAQ G;  4IOC A;  2YTY A;  2LXK A;  2Z6K C;  3H0G H;  1N34 Q;  5GAG C;  1PA6 A;  2UUA Q;  2JA7 G;  2IY5 B;  3RLF A;  2F4V Q;  5JJK A;  2JA6 H;  2JA8 G;  2B29 A;  5FJ8 G;  2CWA A;  4BY7 H;  1LUZ A;  1NTG A;  4KHP L;  1UWV A;  2IHF A;  2K5N A;  2Z0S A;  4BY1 H;  3UDX A;  3S16 H;  4X6A H;  1CUK A;  4A3E G;  2ZM6 Q;  3T1Y Q;  1VCI A;  2OTL A;  4A3I G;  4BBR G;  4A3J G;  3WWV A;  2BH8 A;  1SFO H;  4GNX A;  4OWX B;  1VQL A;  2R93 G;  3MXN B;  5IYB H;  2VW9 A;  2ZM6 L;  2HIV A;  3T1Y L;  4DUY L;  4UP8 A;  4A3G G;  1Q8K A;  2OQ0 A;  1VQC A;  2CKZ B;  4P75 A;  1IBK L;  3E9H A;  4KHP Q;  1IBL Q;  1D8L A;  4UPA A;  4ME3 A;  3F2C A;  1GVP A;  3L0O A;  4L5S A;  4A3M G;  4DUY Q;  4YCV A;  1N33 L;  1JT8 A;  1N32 L;  1L1O A;  4RG1 A;  3EIV A;  2VUM H;  1JJC B;  1EUJ A;  1GM5 A;  1C0A A;  2ZTE A;  4X64 L;  4GN4 B;  1KRT A;  4JI8 L;  3TRE A;  3J81 j;  1KQS A;  2RHS B;  4P74 A;  2F4V L;  4C3H H;  4A93 G;  2VNU D;  4OX9 Q;  2MO0 A;  4LF9 L;  1M90 C;  4DAY B;  1Q1B A;  2UU9 Q;  4JI2 Q;  2YYZ A;  1LM0 A;  1V43 A;  2K50 A;  1P8L A;  1LYL A;  2KHJ A;  2BA0 A;  3PUV A;  2GVA A;  4OWT B;  4X66 L;  2JA5 G;  3M7N A;  4BXX G;  3GTL H;  3T1H Q;  2JQO A;  4JI7 Q;  2BH2 A;  4DUZ L;  3CC7 A;  1A62 A;  3DM3 A;  3GTO H;  2OQK A;  3A0J A;  3PGZ A;  4MZ9 A;  3GTG H;  2Q2I A;  1EQQ A;  3HOX G;  1PH6 A;  1SN8 A;  3AFQ A;  1PH9 A;  1YJW A;  2JEB I;  4A3F H;  1PV4 A;  4LF6 Q;  1I5F A;  3KDF A;  2K5V A;  2JA6 G;  5FJ8 H;  1OXT A;  3RN2 A;  2VS1 A;  2N49 A;  1K73 C;  4LNQ A;  4A3L G;  4DR2 Q;  2KCM A;  3PUZ A;  2KEN A;  4DR7 L;  1YVC A;  1HJP A;  4PMW A;  2BA1 A;  2E2J H;  3PF5 A;  1VQA A;  1QUQ B;  1I50 H;  4KI0 A;  3CF5 A;  3PV0 A;  4LF9 Q;  4HJA A;  4GN3 B;  4DUZ Q;  3J7Z C;  5IYD G;  1ASZ A;  3RZO H;  5LMN L;  3HOV H;  3E0E A;  4LF8 Q;  3CPW A;  2HT1 A;  1Q46 A;  1D7Q A;  4A3B H;  3TRZ A;  2WB1 E;  2CQO A;  1I94 L;  2WFW A;  5C4J H;  1FVI A;  4A75 A;  2QEX A;  4IPH A;  4DV1 L;  4NXN L;  1VQ9 A;  3CCQ A;  1E3P A;  2D62 A;  4GS3 A;  1NJI C;  1DGS A;  1Z9F A;  3FKI G;  2VL6 A;  1GKH A;  4JBW A;  4R1J A;  2EQS A;  4A4I A;  5FLM G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...