4JBKA

Molecular basis for abrogation of activation of pro-inflammatory cytokines
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
197
structure length
192
Chain Sequence
TPKKNISKGAVLHEKPMTVMVLTATEPFNYKEGKENMFHATVATESQYYRVKVFNMDLKEKFTENKFITISKYFNSSGILEINETATVSEAAPNQMFEVPKNIIRSAKETLKISKIKELDSGTLIYGVFAVEKKKVNDKSITFKIKDNEDNIKVVWDKEQHNINKLQLFSFHLRKGNGKPILHSGNHSFIKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/dna
molecule keywords Interferon-activable protein 202
publication title Structural basis for termination of AIM2-mediated signaling by p202
pubmed doi rcsb
source organism Mus musculus
total genus 34
structure length 192
sequence length 197
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02760 HIN HIN-200/IF120x domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4jbkA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4jbkA01
4PZ6A 3G6EA 4PMWA 4X65L 5IT9c 4LF8Q 1FGUA 3I4NH 1PFSA 3F8TA 3I7FA 4LF6Q 4QY7A 1Q86C 1N34Q 5M5WH 4AYBG 1YIJA 3G4SA 4A3DG 1S40A 4DR1L 3M7NA 3FHWA 4DV2Q 1I6HH 1CSQA 5IYDH 4RMFA 1EQRA 1B8AA 1L1OC 1NY4A 2JA7G 3PCOB 3UE0A 2I5MX 2MFIA 2I5HA 1VQJA 1PH6A 1P8LA 2R6GA 1HJPA 3UDFA 4TVAB 3CCJA 1OXSC 4YCVA 5IYCH 3PIOA 2N78A 5H1SE 3HOXH 4LF7L 2VY3A 4JYAL 3PUVA 2ZM6Q 1IYJB 4JOIC 3OTOL 1X56A 1Y1VH 2NVTH 1PHJA 4HIKA 3H3VI 1PH8A 3S16H 2HT1A 4DV0L 3KF6A 4JI6L 1JJCB 1CKMA 1Z9FA 2F3IA 4L5SA 1E7ZA 3M4PA 1IZ6A 2YV5A 1PH1A 1HNWL 3CMEA 4DR2L 1SRUA 2OQ0A 4YY3L 4LFBL 5C44H 2HHHL 3F1ZA 2R7ZG 2OTLA 1XPUA 2JA8H 3PUXA 5IWAQ 4DR3L 2Z0SA 4BBRG 3AEVA 2OTJA 2VQEQ 2UUCQ 5ELOA 4A3CH 4C3IH 1K3RA 4LW1A 5GAHC 4DV6Q 3T1HL 1HR0W 3K80C 3H0GG 4KLKA 5HY6A 3H15A 1VQKA 4ME3A 3GTJH 3TEHB 2ZJPA 2AWOA 2A1AA 1G6PA 2Q2UA 3K0XA 3U58A 1HNZQ 2UUBL 1HZCA 5IY0A 3CCVA 1WOCA 4JI2L 3PV0A 1GKHA 1D8LA 5EAYA 4YCWA 2IY5B 1AH9A 2IHEA 1C9OA 1I3QH 5GADC 2NVXH 4GKKQ 4A3BH 4RG1A 1CUKA 4GN5A 2JA6G 4TQUS 3HOWG 2NZHA 4LFBQ 1WJJA 4DUYQ 4A93G 1CKNA 1YI2A 4DAYB 4R4CA 2WAQE 4XIGS 5FLMG 1VQPA 5FJ8G 4OX9Q 4BBSG 5GAEC 4MNOA 4OO1G 1NE3A 1KQSA 1FJGQ 4LF4L 2UXBL 1R9TH 2YTXA 1U0LA 3DM3A 1UWVA 2IX1A 3FKIG 4X62L 4DV4L 1JJ2A 4IJHA 2YTVA 4JI4L 1OXTA 2ZTCA 5IYBG 1EFWA 1W2BA 2BH8A 3KF8B 1TWAH 2AMCB 3HOZH 4P72A 2RCNA 1X3GA 2AHOB 4JI5L 1E1OA 1YJWA 1VQNA 1Y14B 4PZ8A 4JBJA 3TREA 1VQ9A 4LF9Q 3PO3H 4R4QA 1G51A 2VNUD 4YWMA 4MTNA 1K73C 3A0JA 1YHAA 1K8AC 3CP0A 4B3RQ 1N32L 1LTLA 3I56A 4JI3Q 3GDEA 2VW9A 4DK3C 2WB1E 3D0FA 4A3KG 2GN5A 3WWVA 4O0AA 1M90C 1HNXQ 4DR5L 3OW2A 4NXMQ 4YHHL 3KJPA 1AE2A 1JT8A 3NEMA 4KHZA 1VQ4A 1EWIA 4X62Q 4IOAA 3BJUA 3HOYG 1QVGA 4JI4Q 1VCIA 5JEAG 1MKHA 3CF5A 2F4VQ 1XTDA 4AQYQ 2JA7H 1GD7A 1A63A 1Y1WH 2R7FA 2JA5G 2N8NA 1GVPA 1DGSA 1HZBA 2Q2IA 1MJCA 4UP7A 2PMZE 3JAMi 4KI0A 1SLJA 2D0PA 4LFAL 5DLQE 1OXXK 2H5XA 2R7DA 4A3EH 4DV3Q 1XMOQ 2A19A 3CAMA 1X55A 4A3IG 1UEBA 4UPAA 4GOPC 3HOVH 1U5KA 4DV1Q 4X6AH 4NXNL 2R92G 1EYGA 1KRTA 5C4JH 1XMQL 3CD6A 5K36G 1SMXA 4A3LG 2IHFA 4JOIA 3GTLH 2CFMA 1N33Q 4JI7L 3NBHB 3CCMA 5C3EG 1VQEA 2IX0A 2HQLA 2ZTDA 4DV7Q 3W1BA 1J5EQ 1SROA 4B3MQ 1PV4A 3HOUH 2MO0A 1EQQA 2RHQB 4A3JG 4GN4B 5LMNQ 1YVCA 4A3MG 1Q8KA 2KHJA 4A3FG 3KLWA 2QGQA 3T1YL 2UXDL 3KDFB 2D0OA 1YITA 4GKJQ 1KHIA 4GOPB 1NJIC 4BY7G 2B29A 1S3OA 3NENA 2LSSA 2KENA 4LUZA 2UXCL 1YNXA 1Z47A 3HKZE 3JC66 3STBD 2ASBA 1EOVA 5J3BA 1E24A 1T9HA 2ZJRA 3BU2A 4POGA 4KHPL 2K5NA 3F2BA 1PYSB 2PI2E 3B6YA 1I5FA 1SFOH 1IBLQ 1EIYB 1K0RA 3CC2A 2ES2A 1YZ6A 4JI8L 4DUZL 4HIMA 3ULLA 5IP9H 4X65Q 5BR8L 4BA2I 3M9BA 4LFCL 1YJNA 4YWKA 4A93H 4IOCA 4LUVA 1X9NA 4PG3A 4NB3A 3W5OA 4DR1Q 3J7ZC 3UE1A 4A76A 4A3GG 1LYLA 3MXNB 1OTCA 3I4MG 4K0KL 3GTMH 1K9MC 2VUMH 3S2HH 2WFWA 1VQBA 3AQQA 2ZJQA 3TS2A 1BKBA 3JAMc 5GROA 2DUDA 3UDXA 3CW2C 1IXRA 4DR4L 1V43A 4EX5A 4X64L 4QGUA 3W1GA 4L5RC 3HKSA 3PO2H 4BXXG 4JV5L 5IE8A 4JYAQ 4LUOA 4LF7Q 1YHQA 2LXKA 3OTOQ 3I4OA 2IT1A 4JBWA 2E2IH 1MIUA 3L0OA 5FLXc 3KYHC 4XTCS 1VQOA 3CCQA 3PF4A 4DV0Q 2OQKA 4IFDJ 4JI6Q 2E8GA 1KC8C 3RN2A 3TRZA 3AFQA 2NN6I 4IPCA 1C7YA 3I4NG 1J6QA 1YHBA 1X3EA 2GVBA 4QQBX 2BA1A 2PQAB 1HNWQ 5C0XJ 2AWNA 4DR2Q 2R93H 3PIPA 3RN5A 4GN3B 4X66L 2KCMA 4YY3Q 4HJ7A 3CPWA 5IYDG 2HHHQ 2YU9H 4BY1H 3H3VH 3ICEA 4DR3Q 1RIPA 1VQIA 3S24A 2K14A 4QJFA 1FL0A 1MJEA 1IBKL 1QUQB 3L2PA 2C35B 2CWAA 3E9IA 3J81i 4A75A 3T1HQ 3GTKH 1X65A 4BA1I 1PH2A 4AH6A 2UU9L 1WCMH 1UE1A 3GO5A 4JCVE 4R4IA 4JI1L 5IYCG 4LF5L 2AKWB 1NMFA 4J15A 1CSPA 1TWFH 3HOXG 5LMNW 1IBML 1KAWA 5M3MG 3M3YH 1VQDA 2UUBQ 4YCUA 1Y1VG 2RHSB 1ASYA 2Y0SE 4JI2Q 4C3HH 4B3SL 2B63H 4JG2A 1Q82C 4UP9A 5GAGC 1E22A 4C2MH 4HJ8A 3PF5A 3TQYA 1XNRL 2A8VA 1I94L 4LNQA 1L2FA 2BA0A 3KDFA 2WAQG 4R4TA 2E5LL 4P74A 4GOPA 3J81j 4OWTB 3DLLA 3H0GH 4B3TL 1XJVA 5C3EH 5C44G 4DV5L 3EIVA 2JA8G 4P73A 1HZ9A 2MO1A 1VQ6A 2UXBQ 4L5QA 4LF4Q 2VZAA 4JBKA 3K7AH 2B3GA 4DR7L 1HR0L 3RR5A 4R1JA 3FP9A 1X6OA 4IPHA 2QA4A 4DV4Q 4A3DH 3ULJA 1WFQA 2QEXA 3PUZA 2JJQA 1IBMQ 4DR6L 2YTYA 3E0EA 3EBEA 1D7QA 3U4VA 2I5LX 3NELA 4R4OA 4P71A 2HIXA 4JI5Q 5IP7G 2JEAI 1PYBA 2Z6KC 2FXQA 1A0IA 1NTGA 4C3JH 3A5ZB 4HJ9A 1YEZA 2WB1G 4IFDI 1JE5A 3L7ZC 2XGTA 1N36L 1ASZA 3M4QA 1JMCA 1N32Q 1JJGA 4A3BG 5AJ3L 3HFZB 5LMUL 5C0XI 3PUYA 4NPSA 1AE3A 3J7A5 1BVSA 4DV5Q 4DR5Q 2EQSA 5HGQA 2F52A 3G71A 5C4XG 4YHHQ 2I0QA 4H02A 4IPGA 1V1QA 2ZTEA 5M5YH 3U50C 3M4OH 1VS0A 2OCEA 3KFUA 4HIDA 2K50A 3KJOA 4LF6L 3I4MH 3J81c 1N34L 3K8AA 1XPOA 4DV2L 2NN6G 4GNXB 2BH2A 4EQ5A 2R7ZH 4AYBE 3KOJA 1A8VA 4HJAA 4BBRH 2N49A 3HOZG 5M3FG 1CKNB 3S14H 4POFA 4LFAQ 3M85A 2NZOA 2PQAA 4QIWE 2EIFA 2D62A 3GTGH 3PO3G 3ER0A 3PSIA 1KRSA 2DGYA 4MZ9A 1IL2A 2JE6I 3J80i 1YBYA 4ALPA 3SGIA 4NXNQ 2ZM6L 1UE5A 4HJ5A 3S15H 2GVAA 1XMQQ 1QUQA 1BBUA 2CQOA 3OYYA 3RZDH 3S2DH 2VS1A 2KCTA 4LWCA 2YYZA 2VL6A 4JI7Q 1PH3A 4Y52H 2JA6H 3HOWH 3MEFA 3CCSA 1M1KC 1QZHA 2Q2HA 1JB7A 2E2JH 3GD7A 5FLMH 5FJ8H 1Y1WG 4BBSH 3BZCA 2K5HA 2KBNA 4APVA 5IWAL 3T1YQ 2UXDQ 3UDGA 1O7IA 2VQEL 2UUCL 1TXYA 3HKZG 3FKIH 1L0WA 4DV6L 4A3EG 3BZKA 2UXCQ 2CKZB 5E7NA 5M5XH 4GLXA 2N3SA 4OWWB 2NVYH 5M3MH 5IYBH 3A5UA 1VQ7A 2CCZA 5JJLA 3HOVG 2OWOA 2ALYB 1VQFA 4OXPA 1HNZL 4KHPQ 2NVQH 1K83H 3S1QH 2UU9Q 4JI8Q 2L15A 1E3PA 4DUZQ 1TWHH 1XNQL 1H95A 5BR8Q 2RF4A 1PVOA 3IRBA 4IJLA 1Q12A 4GKKL 1L1OB 3EN2A 4A3KH 3PGZA 4LFCQ 4IFDG 1P16A 3HOUG 3CXCA 1HH2P 5GQOA 4DUYL 1SE8A 3CPFA 4JC0A 3CC7A 2E2HH 3CCLA 1KL9A 4DK6C 5C0XG 4QL5A 4K0KQ 4OX9L 4JI0L 2ID0A 3RLOA 1FJGL 3HOYH 5JJKA 1Q81C 2UUAL 1SR3A 4LF5Q 4DR4Q 3S1NH 2JEBI 4X64Q 3LGJA 3D31A 3J80c 3S17H 4JV5Q 3Q8DA 3TS0A 4AIMA 1B7YB 5IP7H 1VQLA 2JA5H 1UE7A 1KXLA 4LF9L 4PZ7A 1WYDA 4DPGA 3ULPA 1VQ5A 1WI5A 1XNQQ 4A3IH 4GLVB 2K52A 1V9PA 4GLAC 1W3SA 1VQGA 2Z6KA 5IP9G 4GNXA 4B3RL 4HIOA 1CKOA 4JI3L 1VQMA 3CQZH 2R92H 1Q1BA 5C4XH 1E1TA 4IO9A 2LXJA 4A3LH 4X66Q 3RLFA 1HNXL 1VQHA 2JK8A 5ELNA 1GM5A 4JI0Q 4NXML 4YWLA 4DKAC 2VUMG 2UUAQ 1I50H 1IBKQ 1A62A 4OWXB 1LUZA 4DNIA 3K81C 4A3CG 1HZAA 4A3JH 1PH7A 3UDIA 3S1RH 3KF6B 1B70B 1X3FA 1X54A 1LM0A 4UP8A 4JI1Q 2MNAA 2CWPA 1UE6A 5M3FH 2Y0SG 4DAMA 4A3FH 1QZGA 3PO2G 2EXDA 3AFPA 2KHIA 2F4VL 3G48A 2WP8J 4BY7H 1N9WA 3ERSX 4B3SQ 1K8GA 5JJIA 2K4KA 1EUJA 3CCEA 4GNXC 1XMOL 4DV3L 1XPRA 1NMGA 1PH9A 1FVIA 2ATWA 3S1MH 1OXUA 1XNRQ 3I2ZA 2VQFL 1OXVA 1I94Q 2JQOA 4DV1L 2JA9A 2K75A 2XTIA 4UY8C 2E5LQ 3K7UC 1G291 1PH4A 1QVCA 2R93G 1EIFA 3CMAA 4B3TQ 1Q1EA 3VDYA 4BY1G 1VQ8A 3GTPH 3PUWA 3ZJYC 4JBMA 1N33L 4A3MH 3GTQH 3A74A 5JEAJ 4DV7L 4GS3A 4B3ML 2MQHA 1J5EL 4P75A 3F2CA 4FDBA 3RNUA 1HR0Q 4LF8L 4DR7Q 3CCRA 1GO3E 3GTOH 4IPDA 2PNHA 1VQAA 4A3GH 1C0AA 2PI2A 1NBWA 1WCMG 5LMNL 2V1CC 4DR6Q 1SN8A 1QVFA 1Q46A 1TWCH 3U4ZA 1PA6A 4L5TA 1L1OA 3I55A 1BBWA 3F2DA 4GKJL 1KD1C 4WJ3M 3CC4A 3CCUA 2K5VA 4A4IA 1YJ9A 2B63G 1VQCA 3RLNA 2VQFQ 2Q2TA 1N36Q 4BXXH 1TWGH 1Q7YC 3STBC 5AJ3Q 5LMUQ 2HIVA 1PH5A 3RZOH 1KIXA 4WJ4A 4AQYL 3E9HA 4O2DA 4Y7NH 1IBLL 4OO1I 4OONA 1N8RC 1S72A 1RL2A 3AYHB
chains in the Genus database with same CATH superfamily
4PZ6A 3PQIA 4EVOA 3EVQA 3G6EA 1SAPA 5AFWA 5IT9c 4LF8Q 2DY7A 4K8IA 1SYDA 4H13C 1N34Q 1YIJA 1EY0A 1ICWA 4RMFA 4EQPA 4R8NA 1L1OC 2JA7G 1LTID 3IAYA 3PCOB 5L37A 1IL8A 4B9WA 2I5MX 2I5HA 1VQJA 2R6GA 4C3JG 4TVAB 5JOBA 4YCVA 4K2KA 2N78A 3HOXH 3P7JA 2ZM6Q 2PW5A 1RODA 3HKZB 1HUNA 1LT5D 3BDOA 1NUCA 4FXDA 4K8JA 5EBCA 3TMEA 1PH8A 4DV0L 2A6HC 2XNAC 2NTSA 3J7YW 1E7ZA 1IZ6A 1SMYD 1HPCA 1LT3D 1PH1A 4TRDA 4LFBL 3F1ZA 2R7ZG 3NP8A 2EOTA 4BBRG 3AEVA 3SK8A 2QDBA 2OTJA 4C3IH 4LW1A 1QNKA 3T1HL 1HR0W 3K80C 4KLKA 5HY6A 3H15A 1D5MC 1G6PA 1MI2A 3OWFA 5IT9E 1HZCA 1A2TA 1BUVT 2MP1A 4Q5VA 2N88A 1GKHA 5EAYA 3P20A 2QW7A 2IHEA 1C9OA 2X6LA 4A3BH 4RG1A 1KNAA 3CHBD 4TQUS 2B2TA 3SEBA 1QJOA 4A93G 2CH4A 2F0FA 2Q8TA 1YI2A 1KDCA 4R4CA 1QOHA 5EKLA 5FJ8G 3J80L 1VQPA 4BBSG 5GAEC 1SJHD 3NTKA 3MXUA 1FJGQ 2YTXA 1UWVA 5JJZA 4X62L 5C4ZA 2ZTCA 2IL8A 3I73A 4EQOA 2AMCB 4P72A 2DJFC 5IGCA 4N8X1 1X3GA 1XX8A 1E1OA 1VQNA 4LF9Q 2O5IC 4OELB 4R4QA 1JWUD 3A0JA 1K8AC 2B2TC 2BCOA 4JI3Q 3D0FA 3X3MA 4J8QA 4A3KB 1VQ4A 1EWIA 4IOAA 1ILPA 2KECA 1T5EA 1EFID 2RKSA 1GD7A 2SEBD 4Q0FA 4PQXA 1BDOA 1OXXK 2H5XA 2A19A 1CM9A 1B9MA 1UEBA 4GOPC 4NXNL 1E2ZA 1KRTA 2K7VA 1II3A 1XMQL 3R93A 3D3RA 4JOIA 2R92B 2F0MA 2KVMA 4JVZA 1N33Q 2NYZD 3NBHB 1DJRD 1VQEA 5C3EG 1J5EQ 3W1BA 1SROA 4ID6A 3NPPA 2RHQB 3E5SA 2ZXPA 4GN4B 4OGQC 1CQFA 1GHJA 2HDMA 2QGQA 4KY6A 1KDAA 4J1MA 1W6JA 4GKJQ 2WACA 1KHIA 5ELEA 4GOPB 1NJIC 4A3FB 4KJOA 1CI3M 1EOVA 2Z9HA 4B08A 1EIYB 2PI2E 1IBLQ 4K14A 3DHQA 1K0RA 4WJWA 1YZ6A 3ULLA 4X65Q 2JP1A 4BA2I 1F2LA 3TBIB 4YWKA 4IOCA 2PZWA 4DR1Q 4DNTB 3UE1A 3MXNB 1IHZA 4K6DA 3I4MG 4K0KL 1EYCA 2VUMH 3RD4A 2CW0D 3MA2B 3AQQA 3HZXA 1BKBA 1HFGA 2E2DC 4B9XA 4DR4L 1E0BA 4X64L 3W1GA 4JV5L 4XQQA 5IE8A 4LF7Q 3OTOQ 3I4OA 2E2IH 5E3FA 3VR3A 4KN7C 3FRPB 2TSSA 3RN2A 2IJ0A 3QOJA 4CJ2C 1CZGA 4M1UB 1YNJD 1TY2A 3PIPA 2KCMA 4HJ7A 1RIPA 3HOWB 4HSVA 2C35B 4A75A 1IKLA 2PZUA 4JI1L 3MAQA 1IBML 3NWSA 5M3MG 3M3YH 1VQDA 3OIPA 4EGVA 1ASYA 1TKWB 4JG2A 1K0SA 2RCFA 3UI2A 4HJ8A 1KDBA 1AW7A 1DZ1A 1Y1VB 5FOBB 2K5WA 4LNQA 3DXJC 3S16B 2WAQG 4E6IA 1GUSA 4P74A 2F0QA 2F1MA 3DLLA 1K8OA 5C44G 2K03A 4X3SA 5IODA 4P73A 2MO1A 1VQ6A 2BE5C 2B3GA 1Q90A 3I72A 2KUMA 4R1JA 3TP5A 4M8AA 5KNBA 4RAUC 2FMCA 2I5LX 4JI5Q 3HOYB 1CTMA 4IUQA 1A0IA 4QUFA 3A5ZB 2WB1G 3KLSX 2A5HA 3HFZB 5AJ3L 3PUYA 3J7A5 5IOCA 5BN4A 4DV5Q 5EJWA 2F52A 4A3IB 2I0QA 2FMMA 2LKVA 1B50A 3J81c 3K8AA 1XPOA 4DV2L 4GNXB 4ZKBB 2A73B 2P5ZX 2N49A 1CZWA 1HUMA 4CBVA 4LFAQ 2PQAA 3S1RB 4FF1A 4G4KA 1O7ZA 1GJXA 2JE6I 3HOZB 1JCKB 1YBYA 3SGIA 2DNEA 2EXZA 5JVH3 1FYCA 1QUQA 3L3OC 1K3BC 4CDEC 3OSOA 2GA4B 2VL6A 2E74C 1I4RA 2L9HA 2JA6H 3HOWH 3MEFA 1SMYC 4KKSA 1M1KC 4H0LC 2Q2HA 4FXGC 2E2JH 3GTPB 3NQIA 5FLMH 3BZCA 2UXDQ 4OO1H 3S9WA 3UDGA 1O7IA 5JPNC 1R4QB 2A74C 4DV6L 1NR4A 3VR5A 1ESFA 4JK1C 3DWPA 3IL8A 2OWOA 1VQFA 3WOEA 1HNZL 3S1QH 3J81E 1XNQL 1PVOA 4GKKL 2I07B 4IFDG 3GTLB 1PYWD 5ISRA 1B3QA 1HH2P 1YNND 2J0TD 1GXDC 4QL5A 3TZUA 3RLOA 5ELBA 3HOYH 4MIUA 5M5WB 5JJKA 2I46A 5JEAH 3TSSA 1NNXA 3SVMA 4C1NK 2WV6D 4RKLA 4XDXA 3J80c 4AIMA 4YIJA 5DM63 1S5ED 4HEDA 1WYDA 3ULPA 4KK7A 1WTHA 4A3IH 1SBBB 1SE4A 2DN8A 5F2DA 4B3RL 4HN7A 1VQMA 1PTOF 1FD7D 4IO9A 3K5LA 1V1PB 3BG3A 2EYLA 1HNXL 1VQHA 4JI0Q 4FXKC 3ONAB 2UUAQ 1RKNA 1JE4A 1BO0A 2A69C 4A3CG 1BOSA 3GTMB 3UDIA 3S1RH 3KF6B 1B70B 1PH4A 1VQ8A 4A3MH 4LF5Q 2CWPA 1UE6A 2Y0SG 4ZYSA 3SXHA 1JOQA 4H7BA 5COYA 2EYJA 1K8GA 4B3SQ 2K4KA 3CCEA 2ATWA 1Z7TA 1NMGA 1OXUA 1VMCA 2XVSA 2JQOA 4IN3A 5EKIA 2D2CC 1H9SA 3CMAA 3GTPH 1BCPD 1I3QB 4PMCA 3ZJYC 3J80E 4B3ML 4DV7L 2R93B 1HA5A 4QF4A 4P75A 3F2CA 4DR7Q 1HR0Q 1EY5A 4BY1B 3CCRA 1GO3E 1CHPD 1C0AA 1VQAA 4A3GH 1NBWA 5LMNL 1E2VA 1SYFA 5I2YA 1Q46A 3GTKB 3F2DA 1WCMB 3FMCA 5CR3A 3CC4A 4WJ3M 4C3HG 1YJ9A 3NSWA 3RLNA 3K59A 1N36Q 4BXXH 4BWGB 5ELCA 4KN4C 4RH6A 1TR5A 3A8JE 4WJ4A 3E9HA 2Z1CA 1JICA 1N8RC 3I4LA 3AYHB 2Z6BA 1FGUA 3I4NH 2ZT9C 3DWAA 3I7FA 3H0GB 4LF6Q 4QY7A 4ZRZA 4CDDC 5M5WH 1XYIA 4A3DG 1S40A 1B1ZA 5CORA 5IYDH 1NY4A 1S5DD 1RTNA 2L0CA 3UE0A 2F0HA 2CW0C 2MFIA 4QCLA 2JA7B 1HJPA 4HMJA 1Y1WB 1OXSC 2IX3A 5IYCH 4U68A 4JYAL 3PUVA 4C3JB 1X56A 3F2UA 3MFYA 2F0EA 4A3EB 1G2SA 1RHPA 1PHJA 3H3VI 2X6GA 1JB3A 5KIXA 2CVRA 3LX0A 4UDUC 1CKMA 1HXYD 1EEFD 1ET6A 4LK1C 1HNWL 5M5YB 4Z9CB 1YNJC 1CT1D 3NBIA 4DR2L 2HHHL 4HSPA 2JA8H 2SOBA 3PUXA 4F88A 5T1IA 2R7ZB 1F2MA 1BF4A 4BBRB 3GTJH 2ZJPA 2AWOA 2A1AA 1EWHA 2EE1A 2Q2UA 3K0XA 3U58A 3P1HA 1PRTB 5IY0A 2B8FA 3CCVA 4YCWA 3NQTA 2IY5B 1AH9A 1A6XA 5C6AA 1I3QH 5GADC 4DU9A 3LWEA 2EYOA 1SYBA 2NZ1D 2HQEA 3I91A 3OHXC 4IALA 4EQNA 4LFBQ 1WJJA 4DUYQ 1CKNA 4DAYB 2WAQE 5IGFA 4OX9Q 4MNOA 3PIP3 1NE3A 4O42A 4A93B 4DXGA 4LF4L 1R9TH 2UXBL 3HP3A 1GUNA 3BYYB 2IX1A 3FKIG 1G2TA 4BBSB 1EWCA 3FPUB 1Q3LA 1U4MA 5IGEA 4DV4L 2EY6A 4JI4L 3QO2A 4XT1B 1OXTA 2K5DA 1EFWA 1W2BA 4RGMA 1WTWA 1TWAH 5E4WC 2RCNA 3H3VC 5M5XB 3I8ZA 2K32A 4JBJA 3TREA 3PO3H 1JOOA 5FO7B 1K73C 2QF7A 3CP0A 1N32L 1LTLA 1PTOB 2VW9A 2XRSD 2WB1E 3HRZC 3URYA 1AZQA 1F9RA 1IW7D 1BCPF 1WTXA 5CV8A 4DR5L 4NXMQ 3CRLC 4YHHL 4ZLTF 4KHZA 3DEPA 4X62Q 2E2HB 1A3UA 3D4WA 1QVGA 1VCIA 1MKHA 1UUPA 3CF5A 1XTDA 3NTHA 4AQYQ 2JA7H 1A63A 1Y1WH 2JA5G 2N8NA 3S1NB 2Q2IA 4UP7A 2PMZE 3JAMi 2PCFB 4KI0A 2D0PA 5A2QL 4A3EH 1XMOQ 4MTKA 3CAMA 1ENAA 1X55A 1U4LA 3HOVH 1EU3A 2NUCA 3R3OA 1MGSA 1EYGA 2O2LD 4DK1A 4IURA 5K36G 1SMXA 4RKBA 1QNUA 1AN8A 2CHBD 4RA8A 4DF7A 4JI7L 3CCMA 2QCPX 2HQLA 2F0VA 1WD0A 3HOUH 1EQQA 5IIFA 1IYVA 4A3JG 5C3EB 1YVCA 5C0XH 1PZJD 2Z8LA 3KDFB 4ODGA 1VF5C 2KENA 3G7LA 2UXCL 1ICFB 2ASBA 3J7AV 5J3BA 1SSOA 2AQ2B 1E24A 1F77A 1T9HA 2D9UA 4IUVA 1D1IA 1PYSB 3CC2A 4OL7A 2ES2A 4DUZL 4RGOS 2MGSA 4G7ZC 1KLGD 3Q23A 4A93H 4FVMA 4PG3A 1YNNC 1JWSD 3R2TA 1LYLA 1FNUA 1LO5D 1U4PA 3GTOB 2WINB 2XN9C 2ZJQA 3DMUA 3I4MB 2DUDA 3UDXA 1IXRA 3T16A 4EX5A 3PO2H 3HKSA 1EL0A 4LUOA 3DEOA 1PTOH 2G5DA 2LXKA 1MIUA 5I6WA 1TWGB 5JAVA 2OQKA 4IFDJ 1UNSA 4IUPA 4JI6Q 1KC8C 1TS2A 3TRZA 1J6QA 5I9OA 1X3EA 4FF3A 2BA1A 1DCZA 3S2DB 1I4XA 2AWNA 4K5WA 1TS5A 5NUCA 4YY3Q 1B9NA 3QWNA 1B4OA 4K5VA 3A54A 3H3VH 4DR3Q 3NHHA 3S24A 4QJFA 4KTAA 1FL0A 3VYSA 1MJEA 1IBKL 3OMGA 3E9IA 1X65A 2UU9L 3GO5A 4R4IA 2MUYA 2AKWB 3MZ5A 4HAEA 4OHJA 1CSPA 3HOXG 2B2YC 3NBHA 1STGA 2UUBQ 4YCUA 1PXUA 2Y0SE 4JI2Q 4BS9A 5CV4A 2B63H 1Q82C 5GAGC 2F0UA 2NVYB 4C2MH 5M3MB 2A8VA 1I94L 3N52A 1L2FA 2BA0A 4CHTB 1GOZA 4R4TA 1I4PA 4GOPA 4OWTB 2EY5A 4B3TL 1TWHB 4WFN3 1BCPC 5C3EH 2WAQB 3EIVA 4RHRA 1HZ9A 1OO9B 4KD3A 4L5QA 1EYAA 5CBAE 4JBKA 4C3IG 5C44B 3FP9A 4IPHA 2QEXA 1IBMQ 1GUGA 3E0EA 4FO2A 1D7QA 3U4VA 4LAAA 3TN2A 4GZYC 3T51B 1NTGA 4IFDI 3S17B 1D5ZC 4ZUIA 2F0NA 3L7ZC 3MXNA 1ASZA 5DAUA 4A3BG 1M4VA 3T4AC 1ZKOA 1A15A 1SE3A 1BCPB 4NPSA 5D3DA 1AE3A 2X69A 1LTSD 2EQSA 4NKLA 3U50C 1JR0D 3ZYYX 1IKMA 1M8AA 3I4MH 1N34L 2KEDA 2NN6G 4EQ5A 1ZYRC 3OPOA 1I50B 3KOJA 5M3FG 4POFA 1F2YA 2PMZB 2EIFA 5KNCA 1IL2A 1VF7A 3VYUA 2QKIC 1BBXC 3U9SA 1X3QA 4ALPA 4RCOA 2ZM6L 5IGBA 4HJ5A 4BY7B 3M7GA 2GVAA 2CQOA 5KRUA 3NUCA 3S2DH 3K57A 3S1MB 5EPKA 2VS1A 2KCTA 4OIKA 2ICEC 2PNRC 3KBGA 2PZTA 3BS1A 1U9RA 2RSNA 1CA5A 3VYRA 3O13A 3ITPA 1Y8PB 3GTQB 3QB3A 3T1YQ 3HKZG 2CKZB 5E7NA 2L12A 4GLXA 2N3SA 2NVYH 5M3MH 5IYBH 2CCZA 2ALYB 3SK5A 4ZKCB 1EZ8A 4KHPQ 4KHVA 4MHEA 3NK9A 2B8GA 4JI8Q 3N6RA 1E3PA 1TWHH 4FF4A 5BR8Q 2RF4A 3IRBA 2A6ED 5C4JB 3QR8A 1PRTD 4A3KH 3PGZA 4LFCQ 1D1KA 5TSSA 2MJ8A 4PV1C 3JAML 1SE8A 2F4IA 3PMFA 3CC7A 1KL9A 1ESRA 4UHVA 3MWYW 2ID0A 1L0YB 2E75C 1FJGL 4NDXA 1ILQA 3TP6A 1DOLA 5FLXL 2JEBI 1WTRA 3LGJA 4C56C 3S17H 2JSOA 1B7YB 2CQAA 1H9RA 4K2LA 1PDQA 2RDGA 4FF2A 3Q6SA 1WTPA 4LF9L 1XNQQ 4RGNA 3M4YA 4GNXA 1W3SA 1VQGA 4ZUJA 1JC7A 4JI3L 2R92H 1SFOB 3SDZA 2NVTB 1IW7C 1E1TA 3TP7A 4PMBA 4A3LH 1EY7A 4X66Q 1PLFA 3RLFA 1GM5A 2JK8A 2XSCA 2L4NA 1PTOD 4DAPA 4DKAC 4DAVA 2VUMG 5FO8B 4CDFC 1I50H 1MD2D 1A62A 4IZ8A 2JXMB 3G6JB 1HZAA 2M2LA 2FJ2A 1X3FA 1LM0A 4UP8A 1QZGA 4RFBA 3I90A 4A3FH 5D14A 3V05A 1LV9A 2EXDA 1A3VA 2KHIA 5JJIA 4BY7H 5JVG3 1J9OA 2Y0SB 4GNXC 3S1MH 1XPRA 4K6LA 3BYTB 1QILA 2B2WA 1XNRQ 3I2ZA 5T1GA 3DM1A 2VQFL 1OXVA 2XTIA 4UY8C 1ML0D 5C5LA 4KJNA 2E5LQ 3K7UC 1G291 1S5BD 2FFKB 2Q8RE 3CKIB 3PUWA 2NVXB 1N33L 3GTQH 2F03A 1J5EL 2K5QA 3IKJA 4XT3B 4IPDA 2PI2A 4DR6Q 1SE2A 3I55A 1DONA 4GKJL 3A8IE 2B2WC 2F0PA 2K5VA 2SDFA 1PFBA 3CCUA 1RF2D 1TWFB 2O5JC 2KA7A 5CV9A 1Q7YC 5D3IB 5LMUQ 3L9AX 4C3HB 3W2DA 1IBLL 4OONA 2BDNA 3EA6A 5CGKA 4PMWA 4X65L 1S4ZA 1EYDA 1DD2A 1I4HA 1HQRD 4AYBG 4ABNA 4DR1L 3FHWA 1CSQA 4DNRB 1EQRA 1B8AA 4I7ZC 4A3DB 4OEMB 2N55A 1PH6A 1P8LA 1SNOA 3UDFA 5A2QE 1V1PA 2VB3X 1B53A 4LJZC 5H1SE 4G57A 4LF7L 2VY3A 1IYJB 1S5CD 1V8QA 3OTOL 1Y1VH 2NVTH 2M9VA 4HIKA 3S16H 2HT1A 1PRTF 3KF6A 4ZCKA 1Z9FA 2F3IA 4L5SA 2KOLA 4N9PA 2YV5A 3A55A 1SYGA 3CMEA 2EYHA 2PYKA 3AMUA 5IWAQ 2VQEQ 2UUCQ 4A3CH 1QE6A 2K01A 3IFDA 3TEHB 1PFMA 4IUNA 5HURA 3CRKC 3PV0A 1D8LA 3GV3A 2NVXH 3RZDB 4GN5A 4KMUC 4ZAIA 2JA6G 3HOWG 1F9QA 2PQEA 1TIID 3LWUA 3ND9A 1STHA 2HCIA 5M9OA 3Q22A 5FLMG 5DM73 5KYLA 3RMHA 4OO1G 1KQSA 1KLUD 1U0LA 3DM3A 1O7YA 2Z4HA 2K04A 1JJ2A 4IJHA 2L55A 3E3XA 2F0GA 4MN3A 3KF8B 1V1OA 3HOZH 4JI5L 1YJWA 3Q0AA 2ZXOA 1Y14B 4PZ8A 4MTNA 1SJED 1YHAA 3I56A 2NVQB 2IWHA 1NSNS 2EYMA 1C4QA 4JPBW 1AE2A 4KKTA 4C1NI 3H09A 1G91A 2L11A 3HOYG 4JI4Q 5JEAG 3VR4A 2F4VQ 2YU9B 1LLRD 1G8ZD 1Q8IA 4F87A 1MJCA 4LFAL 1SLJA 3FEWX 4DV3Q 2JA5B 4A3IG 4KY7A 3SK6A 1HCZA 4DV1Q 3IFTA 3CD6A 3GTLH 1KTKA 4PNYA 2R3ZA 2LY7A 3AB9A 1Z6HA 3OWEB 2ZTDA 3A56A 1LABA 2MO0A 5I2XA 4H44C 4A3MG 1TVXA 2KHJA 5FO9B 3KLWA 4NP5A 2UXDL 2F0OA 3SK4A 3K7AB 4A3JB 2D0OA 1YITA 1LT6D 2B39A 2B29A 1S3OA 3SR1A 1YNXA 3EROA 4DAYA 4S3SA 3HKZE 2F3VA 3JC66 3STBD 1WTQA 2ZJRA 4CKCA 4POGA 1E2WA 2J7ZA 4F7XA 1LTGD 5IP9H 2A6EC 1PRTC 2K6AA 5IGDA 1X9NA 3K5NA 1I4QA 4NB3A 3K5MA 3A7AB 4A3GG 1WVLA 3GTMH 1K9MC 1T5XD 4ULLA 3TS2A 3JAMc 2Z4IA 5GROA 1BXTA 3KLRA 2EYPA 4BXXG 2SNSA 3E0JA 3S14B 3BZDB 4JBWA 1EQTA 3L0OA 5FLXc 3GTGB 1A2UA 4XTCS 1VQOA 3CCQA 2E76C 4DV0Q 3RZOB 1HQMC 2E8GA 3AFQA 2NN6I 3I4NG 3S15B 2G9HD 1SDFA 2GVBA 3W3AA 5CV6A 2R93H 3RN5A 5KNDA 3CPWA 5IYDG 2YU9H 4BY1H 1PTOC 3ICEA 4OIJA 1JOKA 2K14A 3L2PA 2CWAA 1LTTD 2L5TA 5E4XA 3T1HQ 3GTKH 1PH2A 5KEEA 1WCMH 1UE1A 4LF5L 5IYCG 2OF1A 1EIHA 4J15A 5LMNW 1HTPA 1FNWA 1CQVA 4B3SL 1R4PB 3HOXB 4UP9A 3PF5A 3TQYA 1KNEA 2LFNA 2AQ3B 3KDFA 5G3LD 4ILWA 3J81j 3JAME 3H0GH 1RD9D 3RUZA 2JA8G 2RA4A 1ENCA 2C9OA 3K7AH 4DR7L 3FPPA 1HR0L 2QA4A 5FLXE 2F0IA 3PUZA 5CYUA 2YTYA 3EBEA 3WDNA 3NELA 4C3IB 2HDLA 4R4OA 2HIXA 5IP7G 2AUJD 1GUWA 1C8CA 2Z6KC 1O78A 2FXQA 4C3JH 4LMQD 4HJ9A 1PFNA 4ZQ3A 3NTIA 2XGTA 1N36L 3M4QA 4KKUA 1A3TA 2B2UA 5C4XG 5HGQA 4A3BB 3G71A 5KYIA 5M5YH 1ZEQX 1VS0A 3C46A 3MEHA 1DXMA 4LF6L 1HTLD 4N9TA 2BH2A 2K28A 2R7ZH 4AYBE 4BBRH 1AEXA 1CKNB 5EKKA 3S14H 1HHVA 2SNMA 2NZOA 4NMZA 4QIWE 4QUCA 3GTGH 3PO3G 3ER0A 3PSIA 2KCNA 5M3FB 1I4GA 4XQJA 1MBYA 2B2UC 4NXNQ 2EY2A 3ERQA 4FYDA 3S15H 1XMQQ 1BBUA 3OYYA 1BQQT 1F9SA 5EBDA 1UEAB 2BOSA 1PH3A 4Y52H 1DM0B 2F0WA 2G9DA 1WD1A 3CCSA 4TSSA 1QZHA 1NAPA 1O7LA 2BDOA 1SNCA 5FJ8H 4HR7B 4P2CB 1Y1WG 4BBSH 4APVA 2K5HA 2KBNA 1EY6A 4CKBA 3EQLC 1TXYA 2V4DA 3TP8A 4HTHA 1L0WA 3KUPA 4CGYB 4A3EG 5M5XH 3QG1A 4OWWB 3A5UA 1EZ6A 5EPJA 4XQNA 1STYA 1TWCB 3HOVG 4R9WA 4TKOB 3HGBA 1AZPA 5ELDA 2OXPA 2B2YA 2L15A 3QIAA 3MVVA 4IQZA 5BN5A 4IJLA 1L1OB 2PPBC 1P16A 4Y7NB 5DNFA 3HOUG 2MPMA 3CXCA 4DUYL 3CPFA 2E2HH 3CCLA 4DK6C 5C0XG 4K0KQ 4OX9L 3OIQA 5LHY1 1STBA 1Q81C 1I6HB 1SR3A 4DR4Q 3S1NH 4X64Q 5ELFA 3D31A 4JV5Q 1EOTA 3Q8DA 3TS0A 4G7OC 1VQLA 1VDZA 5E1FA 1UE7A 1KXLA 2NWGA 3D8GA 4PZ7A 3U9OA 2K52A 5G3LF 2NBFA 1Q1BA 2LXJA 5ELNA 4NXML 4YWLA 1C48A 5BN3A 4X3TA 1EIGA 4DNIA 2NN6H 1GHKA 4IUTA 2VUMB 1SEBD 1X54A 4JI1Q 4AQYL 1XXGA 3PO2G 5M3FH 4DAMA 3C3LA 4FP5D 3AFPA 1LT4D 4KD4A 1N9WA 3ERSX 2EZVA 1XMOL 1PH9A 1MSGA 1FVIA 4L6TB 2E2IB 1K28A 3HS0C 2DNCA 2JA9A 5I6YA 3QOLA 1CA6A 2WB1B 1QVCA 3GP7A 1Q1EA 4JBMA 2A69D 3A74A 5D65A 5JEAJ 4GS3A 2MQHA 4DA2A 4LF8L 1SNPA 4FDBA 3RNUA 1STNA 3GTOH 5A35A 4ME5A 3R8BA 4JW0A 2V1CC 1SN8A 3HEJA 1TWCH 1RDPD 1PA6A 3LNNA 3GQBA 3ND8A 1LACA 1KD1C 3BVZA 4A4IA 2PW7A 2B63G 2VQFQ 2Q2TA 2WIIB 1SNDA 3M3YB 4HMIA 2KQ3A 1TWGH 3KLSA 3STBC 5AJ3Q 2RSOA 1PH5A 4RGTA 2F3WA 4N8FA 4Y7NH 4V0BA 4OO1I 2XWJB 1ENFA 4CDCC 1RL2A 1JORA 1PFSA 3F8TA 3J7AF 5IGGA 5C3XA 1NR2A 4KV6A 1Q86C 3OMCA 1I6HH 5KGUA 3G4SA 3M7NA 1DOKA 4DV2Q 2PO4A 1CFMA 4AYBB 2A68D 4RWSC 3C2PA 1QWYA 1TT2A 4QIWB 1ET9A 2D5DA 2OT2A 3CCJA 3PIOA 3MXGA 4JOIC 4V190 2HD3A 1D5XC 5CV5A 4L63B 4JI6L 4RHSA 1JJCB 3VR6A 3M4PA 4J6HA 2EY1A 4O1NA 1SRUA 1JWMD 2OQ0A 4YY3L 5C44H 4HCEA 2OTLA 1XPUA 4CJ0B 4DR3L 2Z0SA 5FK9C 5ELOA 1K3RA 5GAHC 3NWTA 4DV6Q 3VA7A 3GV6A 1VQKA 4ME3A 4DK0A 4WRDA 1HNZQ 2JN4A 5JPMC 2UUBL 1UAPA 2QILA 1WOCA 4JI2L 1QB5D 1EQVA 2JYOA 3I70A 4GKKQ 1CUKA 2NZHA 4X3UA 2JA6B 3K5OA 4XIGS 4K5XA 5J22A 2L1BA 2E2JB 2RDHA 3MHBA 5CC4A 2YTVA 4CJ1B 1XWEA 5IYBG 3S2HB 2BH8A 3K6OA 4RCNA 2AHOB 1BNZA 1FNVA 2HCCA 4QB4A 5I4DA 1VQ9A 2VNUD 1G51A 1PMRA 4YWMA 3R2IA 4B3RQ 3GDEA 2F0TA 4DK3C 4A3KG 2RVLA 3S1QB 2GN5A 3WWVA 5C4HA 1AFPA 1SNMA 1RTOA 4O0AA 1M90C 1HNXQ 5J1ZA 3OW2A 2EPBA 3KJPA 1JT8A 3MFGA 3TDQA 3NEMA 2EJMA 2QEJC 3BJUA 1DYQA 5CBEE 2KJXA 2R7FA 1GVPA 1DGSA 1HZBA 2IPKD 5DLQE 2R7DA 1TS4A 1FGBD 4UPAA 4X6AH 1U5KA 2R92G 1BR9A 5C4JH 3D6CA 1STEA 4A3LG 1ONLA 2IHFA 2CFMA 3VA5A 1LTBD 2EVBA 3AU7A 4B3MQ 2IX0A 4DV7Q 5C3WA 4IFDH 1FR3A 1PV4A 1STAA 1U4RA 4NW2A 2ENBA 5LMNQ 1B3AA 3VR2A 1Q8KA 4R8IA 4A3FG 2F0LA 1L0XB 1ZXTA 3C1EA 3T1YL 1TQOA 4BY7G 4A3MB 3NENA 1QCBD 3QJYA 2LSSA 4LUZA 1Z47A 4HCSA 1KABA 1SYCA 5IT9L 3BU2A 4KHPL 2K5NA 2CH4W 3B6YA 5EGTA 3F2BA 1I5FA 1SFOH 4XYOA 4JI8L 2LS01 4HIMA 5BR8L 2Q8IB 1GUTA 3M9BA 4LFCL 3KF8A 1YJNA 2C5CA 4LUVA 1AP0A 2ICIA 3W5OA 3J7ZC 4A76A 1OTCA 3M4OB 3S2HH 2WFWA 1VQBA 4X3KA 2EDGA 4A3GB 2RQXA 2FHTA 3CW2C 3H91A 1TS3A 1V43A 4QGUA 3CU7A 4L5RC 2M00A 4JYAQ 1SXTA 1YHQA 5FKAC 2IT1A 2XRQD 1F9PA 4FNFA 3KYHC 3BVGA 3PF4A 3D4RA 2A6HD 1JQYD 1C7YA 4IPCA 2VXWA 1YHBA 2DJGC 4QQBX 2PQAB 1HNWQ 5C0XJ 2AUKA 4DR2Q 3BVMA 4I7AA 4GN3B 1DOMA 4X66L 5CMDA 3I4NB 2HHHQ 3D6WA 1VQIA 1QUQB 3BDCA 4UAIA 1SNQA 3T56B 3J81i 4BA1I 2EJFC 3KBXA 4AH6A 4JCVE 1QG7A 3MTSA 1NMFA 2F0JA 1WTOA 1TWFH 1KAWA 2J4XA 1Y1VG 3FKIB 2RHSB 4C3HH 4DN4M 3NXWA 3K0YA 1E22A 1XNRL 3A8KE 1LTRD 1K83B 3T53B 2E5LL 4G7HC 1CHQD 2KCCA 1XJVA 3EJIA 3FDTA 2AQ1B 3MC0B 4DV5L 2ZXRA 3MXPA 2UXBQ 4LF4Q 2VZAA 3OOCA 3RR5A 2RDFA 4DV4Q 1X6OA 2JA8B 4A3DH 3ULJA 1WFQA 2JJQA 4DR6L 2VB2X 3T13A 3KK7A 4P71A 2JEAI 1PYBA 1RCVD 3GTJB 1YEZA 1JE5A 5LL6X 1N32Q 1JJGA 1JMCA 5LMUL 2EYFA 5C0XI 4WORA 4ZK9B 5J39A 1BVSA 4DR5Q 1PZID 4YHHQ 4H02A 4IPGA 1V1QA 2ZTEA 4XYQA 1WTVA 1LTAD 3CQZB 2OCEA 3M4OH 3KFUA 4HIDA 5C4XB 2K50A 3KJOA 2LMCB 5CV7A 4KY5A 1G6ZA 1R9TB 1A8VA 4HJAA 3HOZG 2A68C 3Q24A 1NCVA 2NTTA 2R61A 3M85A 1RJTA 4CKEA 1H9KA 2D62A 1KRSA 2DGYA 3H6MA 3DUZA 1TWAB 4MZ9A 3J80i 1B44D 2QDLA 3PO3B 1PZKD 1UE5A 2MHVA 3FVQA 3RZDH 3OW7A 2O4XA 4LWCA 2YYZA 4JI7Q 1Y69U 3V2TA 5C5MA 1HA6A 3SHLA 2NB0A 3I3CA 4DXFA 2RBMA 4IUUA 1JB7A 1ZYRD 2XIWA 3GD7A 1EY8A 1K8MA 1O80A 5IWAL 1H9SB 2VQEL 2UUCL 1B2TA 2TMPA 3FKIH 1H9MA 3BZKA 2F0SA 2UXCQ 4DFAA 3V96A 3BDLA 1VQ7A 1H9JA 5JJLA 1EEID 4OXPA 1MHWC 1CK1A 2NVQH 1GUOA 1XTCD 1K83H 3A7LA 4I65A 5DEHA 3PIO3 3HOVB 3C1FA 4DUZQ 1H95A 3H94A 1Q12A 1Y8NB 3EN2A 5HGTA 2DY8A 3TZDA 3SE0A 4QMGA 5GQOA 4JC0A 3NE5B 2WKCA 1EY9A 2KEEA 4JI0L 3HOUB 1X32A 5K5PA 1KAAA 2HUGA 2UUAL 2EJGC 1D2BA 1TU2B 1I6VC 2OEOA 5IP7H 2JA5H 4DPGA 1VQ5A 3EFXD 1WI5A 2XWBB 4GLVB 1V9PA 4GLAC 5IP9G 1EY4A 2Z6KA 4HIOA 1CKOA 3CQZH 2B2VA 5C4XH 5K36H 2F0KA 1F2ZA 2K05A 3P75A 1S72A 4XXEA 2IW3A 4DGZA 1IBKQ 4OWXB 1LUZA 2F0DA 4L8JA 3K81C 4A3JH 1PH7A 2UU9Q 2F4VL 2MNAA 4F8MA 1VMPA 3G48A 2WP8J 3PO2B 2K33A 1EUJA 4DV3L 1X3PA 4U673 1Y8OB 5EPLA 2B2VC 5LL6S 3DWQA 3X3NA 1I94Q 4DV1L 2H4OA 2K75A 1MSHA 2R93G 1EIFA 4B3TQ 5EQ0A 3VDYA 3D4DA 4BY1G 2H1EA 1J8IA 2BE5D 1D6EC 3E6ZX 2KHSA 5I9PA 2PNHA 2FINB 1WCMG 1SYEA 1HRJA 1QVFA 3U4ZA 4L5TA 1L1OA 1EU4A 1BBWA 1S5FD 3VYTA 1IYUA 1VQCA 1HFNA 2HIVA 2WKDA 3RZOH 1KIXA 2K1BA 2B63B 4O2DA 4C2MB 3WOFA 3J81L 3K58A 1W6KA 3HG9A 3H0GG 1TY0A
chains in the Genus database with same CATH topology
4PZ6A 3G6EA 4PMWA 4X65L 5IT9c 4LF8Q 1FGUA 3I4NH 1PFSA 3F8TA 3I7FA 4LF6Q 4QY7A 1Q86C 1N34Q 5M5WH 4AYBG 1YIJA 3G4SA 4A3DG 1S40A 4DR1L 3M7NA 3FHWA 4DV2Q 1I6HH 1CSQA 5IYDH 4RMFA 1EQRA 1B8AA 1L1OC 1NY4A 2JA7G 3PCOB 3UE0A 2I5MX 2MFIA 2I5HA 1VQJA 1PH6A 1P8LA 2R6GA 1HJPA 3UDFA 4TVAB 3CCJA 1OXSC 4YCVA 5IYCH 3PIOA 2N78A 5H1SE 3HOXH 4LF7L 2VY3A 4JYAL 3PUVA 2ZM6Q 1IYJB 4JOIC 3OTOL 1X56A 1Y1VH 2NVTH 1PHJA 4HIKA 3H3VI 1PH8A 3S16H 2HT1A 4DV0L 3KF6A 4JI6L 1JJCB 1CKMA 1Z9FA 2F3IA 4L5SA 1E7ZA 3M4PA 1IZ6A 2YV5A 1PH1A 1HNWL 3CMEA 4DR2L 1SRUA 2OQ0A 4YY3L 4LFBL 5C44H 2HHHL 3F1ZA 2R7ZG 2OTLA 1XPUA 2JA8H 3PUXA 5IWAQ 4DR3L 2Z0SA 4BBRG 3AEVA 2OTJA 2VQEQ 2UUCQ 5ELOA 4A3CH 4C3IH 1K3RA 4LW1A 5GAHC 4DV6Q 3T1HL 1HR0W 3K80C 3H0GG 4KLKA 5HY6A 3H15A 1VQKA 4ME3A 3GTJH 3TEHB 2ZJPA 2AWOA 2A1AA 1G6PA 2Q2UA 3K0XA 3U58A 1HNZQ 2UUBL 1HZCA 5IY0A 3CCVA 1WOCA 4JI2L 3PV0A 1GKHA 1D8LA 5EAYA 4YCWA 2IY5B 1AH9A 2IHEA 1C9OA 1I3QH 5GADC 2NVXH 4GKKQ 4A3BH 4RG1A 1CUKA 4GN5A 2JA6G 4TQUS 3HOWG 2NZHA 4LFBQ 1WJJA 4DUYQ 4A93G 1CKNA 1YI2A 4DAYB 4R4CA 2WAQE 4XIGS 5FLMG 1VQPA 5FJ8G 4OX9Q 4BBSG 5GAEC 4MNOA 4OO1G 1NE3A 1KQSA 1FJGQ 4LF4L 2UXBL 1R9TH 2YTXA 1U0LA 3DM3A 1UWVA 2IX1A 3FKIG 4X62L 4DV4L 1JJ2A 4IJHA 2YTVA 4JI4L 1OXTA 2ZTCA 5IYBG 1EFWA 1W2BA 2BH8A 3KF8B 1TWAH 2AMCB 3HOZH 4P72A 2RCNA 1X3GA 2AHOB 4JI5L 1E1OA 1YJWA 1VQNA 1Y14B 4PZ8A 4JBJA 3TREA 1VQ9A 4LF9Q 3PO3H 4R4QA 1G51A 2VNUD 4YWMA 4MTNA 1K73C 3A0JA 1YHAA 1K8AC 3CP0A 4B3RQ 1N32L 1LTLA 3I56A 4JI3Q 3GDEA 2VW9A 4DK3C 2WB1E 3D0FA 4A3KG 2GN5A 3WWVA 4O0AA 1M90C 1HNXQ 4DR5L 3OW2A 4NXMQ 4YHHL 3KJPA 1AE2A 1JT8A 3NEMA 4KHZA 1VQ4A 1EWIA 4X62Q 4IOAA 3BJUA 3HOYG 1QVGA 4JI4Q 1VCIA 5JEAG 1MKHA 3CF5A 2F4VQ 1XTDA 4AQYQ 2JA7H 1GD7A 1A63A 1Y1WH 2R7FA 2JA5G 2N8NA 1GVPA 1DGSA 1HZBA 2Q2IA 1MJCA 4UP7A 2PMZE 3JAMi 4KI0A 1SLJA 2D0PA 4LFAL 5DLQE 1OXXK 2H5XA 2R7DA 4A3EH 4DV3Q 1XMOQ 2A19A 3CAMA 1X55A 4A3IG 1UEBA 4UPAA 4GOPC 3HOVH 1U5KA 4DV1Q 4X6AH 4NXNL 2R92G 1EYGA 1KRTA 5C4JH 1XMQL 3CD6A 5K36G 1SMXA 4A3LG 2IHFA 4JOIA 3GTLH 2CFMA 1N33Q 4JI7L 3NBHB 3CCMA 5C3EG 1VQEA 2IX0A 2HQLA 2ZTDA 4DV7Q 3W1BA 1J5EQ 1SROA 4B3MQ 1PV4A 3HOUH 2MO0A 1EQQA 2RHQB 4A3JG 4GN4B 5LMNQ 1YVCA 4A3MG 1Q8KA 2KHJA 4A3FG 3KLWA 2QGQA 3T1YL 2UXDL 3KDFB 2D0OA 1YITA 4GKJQ 1KHIA 4GOPB 1NJIC 4BY7G 2B29A 1S3OA 3NENA 2LSSA 2KENA 4LUZA 2UXCL 1YNXA 1Z47A 3HKZE 3JC66 3STBD 2ASBA 1EOVA 5J3BA 1E24A 1T9HA 2ZJRA 3BU2A 4POGA 4KHPL 2K5NA 3F2BA 1PYSB 2PI2E 3B6YA 1I5FA 1SFOH 1IBLQ 1EIYB 1K0RA 3CC2A 2ES2A 1YZ6A 4JI8L 4DUZL 4HIMA 3ULLA 5IP9H 4X65Q 5BR8L 4BA2I 3M9BA 4LFCL 1YJNA 4YWKA 4A93H 4IOCA 4LUVA 1X9NA 4PG3A 4NB3A 3W5OA 4DR1Q 3J7ZC 3UE1A 4A76A 4A3GG 1LYLA 3MXNB 1OTCA 3I4MG 4K0KL 3GTMH 1K9MC 2VUMH 3S2HH 2WFWA 1VQBA 3AQQA 2ZJQA 3TS2A 1BKBA 3JAMc 5GROA 2DUDA 3UDXA 3CW2C 1IXRA 4DR4L 1V43A 4EX5A 4X64L 4QGUA 3W1GA 4L5RC 3HKSA 3PO2H 4BXXG 4JV5L 5IE8A 4JYAQ 4LUOA 4LF7Q 1YHQA 2LXKA 3OTOQ 3I4OA 2IT1A 4JBWA 2E2IH 1MIUA 3L0OA 5FLXc 3KYHC 4XTCS 1VQOA 3CCQA 3PF4A 4DV0Q 2OQKA 4IFDJ 4JI6Q 2E8GA 1KC8C 3RN2A 3TRZA 3AFQA 2NN6I 4IPCA 1C7YA 3I4NG 1J6QA 1YHBA 1X3EA 2GVBA 4QQBX 2BA1A 2PQAB 1HNWQ 5C0XJ 2AWNA 4DR2Q 2R93H 3PIPA 3RN5A 4GN3B 4X66L 2KCMA 4YY3Q 4HJ7A 3CPWA 5IYDG 2HHHQ 2YU9H 4BY1H 3H3VH 3ICEA 4DR3Q 1RIPA 1VQIA 3S24A 2K14A 4QJFA 1FL0A 1MJEA 1IBKL 1QUQB 3L2PA 2C35B 2CWAA 3E9IA 3J81i 4A75A 3T1HQ 3GTKH 1X65A 4BA1I 1PH2A 4AH6A 2UU9L 1WCMH 1UE1A 3GO5A 4JCVE 4R4IA 4JI1L 5IYCG 4LF5L 2AKWB 1NMFA 4J15A 1CSPA 1TWFH 3HOXG 5LMNW 1IBML 1KAWA 5M3MG 3M3YH 1VQDA 2UUBQ 4YCUA 1Y1VG 2RHSB 1ASYA 2Y0SE 4JI2Q 4C3HH 4B3SL 2B63H 4JG2A 1Q82C 4UP9A 5GAGC 1E22A 4C2MH 4HJ8A 3PF5A 3TQYA 1XNRL 2A8VA 1I94L 4LNQA 1L2FA 2BA0A 3KDFA 2WAQG 4R4TA 2E5LL 4P74A 4GOPA 3J81j 4OWTB 3DLLA 3H0GH 4B3TL 1XJVA 5C3EH 5C44G 4DV5L 3EIVA 2JA8G 4P73A 1HZ9A 2MO1A 1VQ6A 2UXBQ 4L5QA 4LF4Q 2VZAA 4JBKA 3K7AH 2B3GA 4DR7L 1HR0L 3RR5A 4R1JA 3FP9A 1X6OA 4IPHA 2QA4A 4DV4Q 4A3DH 3ULJA 1WFQA 2QEXA 3PUZA 2JJQA 1IBMQ 4DR6L 2YTYA 3E0EA 3EBEA 1D7QA 3U4VA 2I5LX 3NELA 4R4OA 4P71A 2HIXA 4JI5Q 5IP7G 2JEAI 1PYBA 2Z6KC 2FXQA 1A0IA 1NTGA 4C3JH 3A5ZB 4HJ9A 1YEZA 2WB1G 4IFDI 1JE5A 3L7ZC 2XGTA 1N36L 1ASZA 3M4QA 1JMCA 1N32Q 1JJGA 4A3BG 5AJ3L 3HFZB 5LMUL 5C0XI 3PUYA 4NPSA 1AE3A 3J7A5 1BVSA 4DV5Q 4DR5Q 2EQSA 5HGQA 2F52A 3G71A 5C4XG 4YHHQ 2I0QA 4H02A 4IPGA 1V1QA 2ZTEA 5M5YH 3U50C 3M4OH 1VS0A 2OCEA 3KFUA 4HIDA 2K50A 3KJOA 4LF6L 3I4MH 3J81c 1N34L 3K8AA 1XPOA 4DV2L 2NN6G 4GNXB 2BH2A 4EQ5A 2R7ZH 4AYBE 3KOJA 1A8VA 4HJAA 4BBRH 2N49A 3HOZG 5M3FG 1CKNB 3S14H 4POFA 4LFAQ 3M85A 2NZOA 2PQAA 4QIWE 2EIFA 2D62A 3GTGH 3PO3G 3ER0A 3PSIA 1KRSA 2DGYA 4MZ9A 1IL2A 2JE6I 3J80i 1YBYA 4ALPA 3SGIA 4NXNQ 2ZM6L 1UE5A 4HJ5A 3S15H 2GVAA 1XMQQ 1QUQA 1BBUA 2CQOA 3OYYA 3RZDH 3S2DH 2VS1A 2KCTA 4LWCA 2YYZA 2VL6A 4JI7Q 1PH3A 4Y52H 2JA6H 3HOWH 3MEFA 3CCSA 1M1KC 1QZHA 2Q2HA 1JB7A 2E2JH 3GD7A 5FLMH 5FJ8H 1Y1WG 4BBSH 3BZCA 2K5HA 2KBNA 4APVA 5IWAL 3T1YQ 2UXDQ 3UDGA 1O7IA 2VQEL 2UUCL 1TXYA 3HKZG 3FKIH 1L0WA 4DV6L 4A3EG 3BZKA 2UXCQ 2CKZB 5E7NA 5M5XH 4GLXA 2N3SA 4OWWB 2NVYH 5M3MH 5IYBH 3A5UA 1VQ7A 2CCZA 5JJLA 3HOVG 2OWOA 2ALYB 1VQFA 4OXPA 1HNZL 4KHPQ 2NVQH 1K83H 3S1QH 2UU9Q 4JI8Q 2L15A 1E3PA 4DUZQ 1TWHH 1XNQL 1H95A 5BR8Q 2RF4A 1PVOA 3IRBA 4IJLA 1Q12A 4GKKL 1L1OB 3EN2A 4A3KH 3PGZA 4LFCQ 4IFDG 1P16A 3HOUG 3CXCA 1HH2P 5GQOA 4DUYL 1SE8A 3CPFA 4JC0A 3CC7A 2E2HH 3CCLA 1KL9A 4DK6C 5C0XG 4QL5A 4K0KQ 4OX9L 4JI0L 2ID0A 3RLOA 1FJGL 3HOYH 5JJKA 1Q81C 2UUAL 1SR3A 4LF5Q 4DR4Q 3S1NH 2JEBI 4X64Q 3LGJA 3D31A 3J80c 3S17H 4JV5Q 3Q8DA 3TS0A 4AIMA 1B7YB 5IP7H 1VQLA 2JA5H 1UE7A 1KXLA 4LF9L 4PZ7A 1WYDA 4DPGA 3ULPA 1VQ5A 1WI5A 1XNQQ 4A3IH 4GLVB 2K52A 1V9PA 4GLAC 1W3SA 1VQGA 2Z6KA 5IP9G 4GNXA 4B3RL 4HIOA 1CKOA 4JI3L 1VQMA 3CQZH 2R92H 1Q1BA 5C4XH 1E1TA 4IO9A 2LXJA 4A3LH 4X66Q 3RLFA 1HNXL 1VQHA 2JK8A 5ELNA 1GM5A 4JI0Q 4NXML 4YWLA 4DKAC 2VUMG 2UUAQ 1I50H 1IBKQ 1A62A 4OWXB 1LUZA 4DNIA 3K81C 4A3CG 1HZAA 4A3JH 1PH7A 3UDIA 3S1RH 3KF6B 1B70B 1X3FA 1X54A 1LM0A 4UP8A 4JI1Q 2MNAA 2CWPA 1UE6A 5M3FH 2Y0SG 4DAMA 4A3FH 1QZGA 3PO2G 2EXDA 3AFPA 2KHIA 2F4VL 3G48A 2WP8J 4BY7H 1N9WA 3ERSX 4B3SQ 1K8GA 5JJIA 2K4KA 1EUJA 3CCEA 4GNXC 1XMOL 4DV3L 1XPRA 1NMGA 1PH9A 1FVIA 2ATWA 3S1MH 1OXUA 1XNRQ 3I2ZA 2VQFL 1OXVA 1I94Q 2JQOA 4DV1L 2JA9A 2K75A 2XTIA 4UY8C 2E5LQ 3K7UC 1G291 1PH4A 1QVCA 2R93G 1EIFA 3CMAA 4B3TQ 1Q1EA 3VDYA 4BY1G 1VQ8A 3GTPH 3PUWA 3ZJYC 4JBMA 1N33L 4A3MH 3GTQH 3A74A 5JEAJ 4DV7L 4GS3A 4B3ML 2MQHA 1J5EL 4P75A 3F2CA 4FDBA 3RNUA 1HR0Q 4LF8L 4DR7Q 3CCRA 1GO3E 3GTOH 4IPDA 2PNHA 1VQAA 4A3GH 1C0AA 2PI2A 1NBWA 1WCMG 5LMNL 2V1CC 4DR6Q 1SN8A 1QVFA 1Q46A 1TWCH 3U4ZA 1PA6A 4L5TA 1L1OA 3I55A 1BBWA 3F2DA 4GKJL 1KD1C 4WJ3M 3CC4A 3CCUA 2K5VA 4A4IA 1YJ9A 2B63G 1VQCA 3RLNA 2VQFQ 2Q2TA 1N36Q 4BXXH 1TWGH 1Q7YC 3STBC 5AJ3Q 5LMUQ 2HIVA 1PH5A 3RZOH 1KIXA 4WJ4A 4AQYL 3E9HA 4O2DA 4Y7NH 1IBLL 4OO1I 4OONA 1N8RC 1S72A 1RL2A 3AYHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PZ6 A;  3G6E A;  4PMW A;  4X65 L;  5IT9 c;  4LF8 Q;  1FGU A;  3I4N H;  1PFS A;  3F8T A;  3I7F A;  4LF6 Q;  4QY7 A;  1Q86 C;  1N34 Q;  5M5W H;  4AYB G;  1YIJ A;  3G4S A;  4A3D G;  1S40 A;  4DR1 L;  3M7N A;  3FHW A;  4DV2 Q;  1I6H H;  1CSQ A;  5IYD H;  4RMF A;  1EQR A;  1B8A A;  1L1O C;  1NY4 A;  2JA7 G;  3PCO B;  3UE0 A;  2I5M X;  2MFI A;  2I5H A;  1VQJ A;  1PH6 A;  1P8L A;  2R6G A;  1HJP A;  3UDF A;  4TVA B;  3CCJ A;  1OXS C;  4YCV A;  5IYC H;  3PIO A;  2N78 A;  5H1S E;  3HOX H;  4LF7 L;  2VY3 A;  4JYA L;  3PUV A;  2ZM6 Q;  1IYJ B;  4JOI C;  3OTO L;  1X56 A;  1Y1V H;  2NVT H;  1PHJ A;  4HIK A;  3H3V I;  1PH8 A;  3S16 H;  2HT1 A;  4DV0 L;  3KF6 A;  4JI6 L;  1JJC B;  1CKM A;  1Z9F A;  2F3I A;  4L5S A;  1E7Z A;  3M4P A;  1IZ6 A;  2YV5 A;  1PH1 A;  1HNW L;  3CME A;  4DR2 L;  1SRU A;  2OQ0 A;  4YY3 L;  4LFB L;  5C44 H;  2HHH L;  3F1Z A;  2R7Z G;  2OTL A;  1XPU A;  2JA8 H;  3PUX A;  5IWA Q;  4DR3 L;  2Z0S A;  4BBR G;  3AEV A;  2OTJ A;  2VQE Q;  2UUC Q;  5ELO A;  4A3C H;  4C3I H;  1K3R A;  4LW1 A;  5GAH C;  4DV6 Q;  3T1H L;  1HR0 W;  3K80 C;  3H0G G;  4KLK A;  5HY6 A;  3H15 A;  1VQK A;  4ME3 A;  3GTJ H;  3TEH B;  2ZJP A;  2AWO A;  2A1A A;  1G6P A;  2Q2U A;  3K0X A;  3U58 A;  1HNZ Q;  2UUB L;  1HZC A;  5IY0 A;  3CCV A;  1WOC A;  4JI2 L;  3PV0 A;  1GKH A;  1D8L A;  5EAY A;  4YCW A;  2IY5 B;  1AH9 A;  2IHE A;  1C9O A;  1I3Q H;  5GAD C;  2NVX H;  4GKK Q;  4A3B H;  4RG1 A;  1CUK A;  4GN5 A;  2JA6 G;  4TQU S;  3HOW G;  2NZH A;  4LFB Q;  1WJJ A;  4DUY Q;  4A93 G;  1CKN A;  1YI2 A;  4DAY B;  4R4C A;  2WAQ E;  4XIG S;  5FLM G;  1VQP A;  5FJ8 G;  4OX9 Q;  4BBS G;  5GAE C;  4MNO A;  4OO1 G;  1NE3 A;  1KQS A;  1FJG Q;  4LF4 L;  2UXB L;  1R9T H;  2YTX A;  1U0L A;  3DM3 A;  1UWV A;  2IX1 A;  3FKI G;  4X62 L;  4DV4 L;  1JJ2 A;  4IJH A;  2YTV A;  4JI4 L;  1OXT A;  2ZTC A;  5IYB G;  1EFW A;  1W2B A;  2BH8 A;  3KF8 B;  1TWA H;  2AMC B;  3HOZ H;  4P72 A;  2RCN A;  1X3G A;  2AHO B;  4JI5 L;  1E1O A;  1YJW A;  1VQN A;  1Y14 B;  4PZ8 A;  4JBJ A;  3TRE A;  1VQ9 A;  4LF9 Q;  3PO3 H;  4R4Q A;  1G51 A;  2VNU D;  4YWM A;  4MTN A;  1K73 C;  3A0J A;  1YHA A;  1K8A C;  3CP0 A;  4B3R Q;  1N32 L;  1LTL A;  3I56 A;  4JI3 Q;  3GDE A;  2VW9 A;  4DK3 C;  2WB1 E;  3D0F A;  4A3K G;  2GN5 A;  3WWV A;  4O0A A;  1M90 C;  1HNX Q;  4DR5 L;  3OW2 A;  4NXM Q;  4YHH L;  3KJP A;  1AE2 A;  1JT8 A;  3NEM A;  4KHZ A;  1VQ4 A;  1EWI A;  4X62 Q;  4IOA A;  3BJU A;  3HOY G;  1QVG A;  4JI4 Q;  1VCI A;  5JEA G;  1MKH A;  3CF5 A;  2F4V Q;  1XTD A;  4AQY Q;  2JA7 H;  1GD7 A;  1A63 A;  1Y1W H;  2R7F A;  2JA5 G;  2N8N A;  1GVP A;  1DGS A;  1HZB A;  2Q2I A;  1MJC A;  4UP7 A;  2PMZ E;  3JAM i;  4KI0 A;  1SLJ A;  2D0P A;  4LFA L;  5DLQ E;  1OXX K;  2H5X A;  2R7D A;  4A3E H;  4DV3 Q;  1XMO Q;  2A19 A;  3CAM A;  1X55 A;  4A3I G;  1UEB A;  4UPA A;  4GOP C;  3HOV H;  1U5K A;  4DV1 Q;  4X6A H;  4NXN L;  2R92 G;  1EYG A;  1KRT A;  5C4J H;  1XMQ L;  3CD6 A;  5K36 G;  1SMX A;  4A3L G;  2IHF A;  4JOI A;  3GTL H;  2CFM A;  1N33 Q;  4JI7 L;  3NBH B;  3CCM A;  5C3E G;  1VQE A;  2IX0 A;  2HQL A;  2ZTD A;  4DV7 Q;  3W1B A;  1J5E Q;  1SRO A;  4B3M Q;  1PV4 A;  3HOU H;  2MO0 A;  1EQQ A;  2RHQ B;  4A3J G;  4GN4 B;  5LMN Q;  1YVC A;  4A3M G;  1Q8K A;  2KHJ A;  4A3F G;  3KLW A;  2QGQ A;  3T1Y L;  2UXD L;  3KDF B;  2D0O A;  1YIT A;  4GKJ Q;  1KHI A;  4GOP B;  1NJI C;  4BY7 G;  2B29 A;  1S3O A;  3NEN A;  2LSS A;  2KEN A;  4LUZ A;  2UXC L;  1YNX A;  1Z47 A;  3HKZ E;  3JC6 6;  3STB D;  2ASB A;  1EOV A;  5J3B A;  1E24 A;  1T9H A;  2ZJR A;  3BU2 A;  4POG A;  4KHP L;  2K5N A;  3F2B A;  1PYS B;  2PI2 E;  3B6Y A;  1I5F A;  1SFO H;  1IBL Q;  1EIY B;  1K0R A;  3CC2 A;  2ES2 A;  1YZ6 A;  4JI8 L;  4DUZ L;  4HIM A;  3ULL A;  5IP9 H;  4X65 Q;  5BR8 L;  4BA2 I;  3M9B A;  4LFC L;  1YJN A;  4YWK A;  4A93 H;  4IOC A;  4LUV A;  1X9N A;  4PG3 A;  4NB3 A;  3W5O A;  4DR1 Q;  3J7Z C;  3UE1 A;  4A76 A;  4A3G G;  1LYL A;  3MXN B;  1OTC A;  3I4M G;  4K0K L;  3GTM H;  1K9M C;  2VUM H;  3S2H H;  2WFW A;  1VQB A;  3AQQ A;  2ZJQ A;  3TS2 A;  1BKB A;  3JAM c;  5GRO A;  2DUD A;  3UDX A;  3CW2 C;  1IXR A;  4DR4 L;  1V43 A;  4EX5 A;  4X64 L;  4QGU A;  3W1G A;  4L5R C;  3HKS A;  3PO2 H;  4BXX G;  4JV5 L;  5IE8 A;  4JYA Q;  4LUO A;  4LF7 Q;  1YHQ A;  2LXK A;  3OTO Q;  3I4O A;  2IT1 A;  4JBW A;  2E2I H;  1MIU A;  3L0O A;  5FLX c;  3KYH C;  4XTC S;  1VQO A;  3CCQ A;  3PF4 A;  4DV0 Q;  2OQK A;  4IFD J;  4JI6 Q;  2E8G A;  1KC8 C;  3RN2 A;  3TRZ A;  3AFQ A;  2NN6 I;  4IPC A;  1C7Y A;  3I4N G;  1J6Q A;  1YHB A;  1X3E A;  2GVB A;  4QQB X;  2BA1 A;  2PQA B;  1HNW Q;  5C0X J;  2AWN A;  4DR2 Q;  2R93 H;  3PIP A;  3RN5 A;  4GN3 B;  4X66 L;  2KCM A;  4YY3 Q;  4HJ7 A;  3CPW A;  5IYD G;  2HHH Q;  2YU9 H;  4BY1 H;  3H3V H;  3ICE A;  4DR3 Q;  1RIP A;  1VQI A;  3S24 A;  2K14 A;  4QJF A;  1FL0 A;  1MJE A;  1IBK L;  1QUQ B;  3L2P A;  2C35 B;  2CWA A;  3E9I A;  3J81 i;  4A75 A;  3T1H Q;  3GTK H;  1X65 A;  4BA1 I;  1PH2 A;  4AH6 A;  2UU9 L;  1WCM H;  1UE1 A;  3GO5 A;  4JCV E;  4R4I A;  4JI1 L;  5IYC G;  4LF5 L;  2AKW B;  1NMF A;  4J15 A;  1CSP A;  1TWF H;  3HOX G;  5LMN W;  1IBM L;  1KAW A;  5M3M G;  3M3Y H;  1VQD A;  2UUB Q;  4YCU A;  1Y1V G;  2RHS B;  1ASY A;  2Y0S E;  4JI2 Q;  4C3H H;  4B3S L;  2B63 H;  4JG2 A;  1Q82 C;  4UP9 A;  5GAG C;  1E22 A;  4C2M H;  4HJ8 A;  3PF5 A;  3TQY A;  1XNR L;  2A8V A;  1I94 L;  4LNQ A;  1L2F A;  2BA0 A;  3KDF A;  2WAQ G;  4R4T A;  2E5L L;  4P74 A;  4GOP A;  3J81 j;  4OWT B;  3DLL A;  3H0G H;  4B3T L;  1XJV A;  5C3E H;  5C44 G;  4DV5 L;  3EIV A;  2JA8 G;  4P73 A;  1HZ9 A;  2MO1 A;  1VQ6 A;  2UXB Q;  4L5Q A;  4LF4 Q;  2VZA A;  4JBK A;  3K7A H;  2B3G A;  4DR7 L;  1HR0 L;  3RR5 A;  4R1J A;  3FP9 A;  1X6O A;  4IPH A;  2QA4 A;  4DV4 Q;  4A3D H;  3ULJ A;  1WFQ A;  2QEX A;  3PUZ A;  2JJQ A;  1IBM Q;  4DR6 L;  2YTY A;  3E0E A;  3EBE A;  1D7Q A;  3U4V A;  2I5L X;  3NEL A;  4R4O A;  4P71 A;  2HIX A;  4JI5 Q;  5IP7 G;  2JEA I;  1PYB A;  2Z6K C;  2FXQ A;  1A0I A;  1NTG A;  4C3J H;  3A5Z B;  4HJ9 A;  1YEZ A;  2WB1 G;  4IFD I;  1JE5 A;  3L7Z C;  2XGT A;  1N36 L;  1ASZ A;  3M4Q A;  1JMC A;  1N32 Q;  1JJG A;  4A3B G;  5AJ3 L;  3HFZ B;  5LMU L;  5C0X I;  3PUY A;  4NPS A;  1AE3 A;  3J7A 5;  1BVS A;  4DV5 Q;  4DR5 Q;  2EQS A;  5HGQ A;  2F52 A;  3G71 A;  5C4X G;  4YHH Q;  2I0Q A;  4H02 A;  4IPG A;  1V1Q A;  2ZTE A;  5M5Y H;  3U50 C;  3M4O H;  1VS0 A;  2OCE A;  3KFU A;  4HID A;  2K50 A;  3KJO A;  4LF6 L;  3I4M H;  3J81 c;  1N34 L;  3K8A A;  1XPO A;  4DV2 L;  2NN6 G;  4GNX B;  2BH2 A;  4EQ5 A;  2R7Z H;  4AYB E;  3KOJ A;  1A8V A;  4HJA A;  4BBR H;  2N49 A;  3HOZ G;  5M3F G;  1CKN B;  3S14 H;  4POF A;  4LFA Q;  3M85 A;  2NZO A;  2PQA A;  4QIW E;  2EIF A;  2D62 A;  3GTG H;  3PO3 G;  3ER0 A;  3PSI A;  1KRS A;  2DGY A;  4MZ9 A;  1IL2 A;  2JE6 I;  3J80 i;  1YBY A;  4ALP A;  3SGI A;  4NXN Q;  2ZM6 L;  1UE5 A;  4HJ5 A;  3S15 H;  2GVA A;  1XMQ Q;  1QUQ A;  1BBU A;  2CQO A;  3OYY A;  3RZD H;  3S2D H;  2VS1 A;  2KCT A;  4LWC A;  2YYZ A;  2VL6 A;  4JI7 Q;  1PH3 A;  4Y52 H;  2JA6 H;  3HOW H;  3MEF A;  3CCS A;  1M1K C;  1QZH A;  2Q2H A;  1JB7 A;  2E2J H;  3GD7 A;  5FLM H;  5FJ8 H;  1Y1W G;  4BBS H;  3BZC A;  2K5H A;  2KBN A;  4APV A;  5IWA L;  3T1Y Q;  2UXD Q;  3UDG A;  1O7I A;  2VQE L;  2UUC L;  1TXY A;  3HKZ G;  3FKI H;  1L0W A;  4DV6 L;  4A3E G;  3BZK A;  2UXC Q;  2CKZ B;  5E7N A;  5M5X H;  4GLX A;  2N3S A;  4OWW B;  2NVY H;  5M3M H;  5IYB H;  3A5U A;  1VQ7 A;  2CCZ A;  5JJL A;  3HOV G;  2OWO A;  2ALY B;  1VQF A;  4OXP A;  1HNZ L;  4KHP Q;  2NVQ H;  1K83 H;  3S1Q H;  2UU9 Q;  4JI8 Q;  2L15 A;  1E3P A;  4DUZ Q;  1TWH H;  1XNQ L;  1H95 A;  5BR8 Q;  2RF4 A;  1PVO A;  3IRB A;  4IJL A;  1Q12 A;  4GKK L;  1L1O B;  3EN2 A;  4A3K H;  3PGZ A;  4LFC Q;  4IFD G;  1P16 A;  3HOU G;  3CXC A;  1HH2 P;  5GQO A;  4DUY L;  1SE8 A;  3CPF A;  4JC0 A;  3CC7 A;  2E2H H;  3CCL A;  1KL9 A;  4DK6 C;  5C0X G;  4QL5 A;  4K0K Q;  4OX9 L;  4JI0 L;  2ID0 A;  3RLO A;  1FJG L;  3HOY H;  5JJK A;  1Q81 C;  2UUA L;  1SR3 A;  4LF5 Q;  4DR4 Q;  3S1N H;  2JEB I;  4X64 Q;  3LGJ A;  3D31 A;  3J80 c;  3S17 H;  4JV5 Q;  3Q8D A;  3TS0 A;  4AIM A;  1B7Y B;  5IP7 H;  1VQL A;  2JA5 H;  1UE7 A;  1KXL A;  4LF9 L;  4PZ7 A;  1WYD A;  4DPG A;  3ULP A;  1VQ5 A;  1WI5 A;  1XNQ Q;  4A3I H;  4GLV B;  2K52 A;  1V9P A;  4GLA C;  1W3S A;  1VQG A;  2Z6K A;  5IP9 G;  4GNX A;  4B3R L;  4HIO A;  1CKO A;  4JI3 L;  1VQM A;  3CQZ H;  2R92 H;  1Q1B A;  5C4X H;  1E1T A;  4IO9 A;  2LXJ A;  4A3L H;  4X66 Q;  3RLF A;  1HNX L;  1VQH A;  2JK8 A;  5ELN A;  1GM5 A;  4JI0 Q;  4NXM L;  4YWL A;  4DKA C;  2VUM G;  2UUA Q;  1I50 H;  1IBK Q;  1A62 A;  4OWX B;  1LUZ A;  4DNI A;  3K81 C;  4A3C G;  1HZA A;  4A3J H;  1PH7 A;  3UDI A;  3S1R H;  3KF6 B;  1B70 B;  1X3F A;  1X54 A;  1LM0 A;  4UP8 A;  4JI1 Q;  2MNA A;  2CWP A;  1UE6 A;  5M3F H;  2Y0S G;  4DAM A;  4A3F H;  1QZG A;  3PO2 G;  2EXD A;  3AFP A;  2KHI A;  2F4V L;  3G48 A;  2WP8 J;  4BY7 H;  1N9W A;  3ERS X;  4B3S Q;  1K8G A;  5JJI A;  2K4K A;  1EUJ A;  3CCE A;  4GNX C;  1XMO L;  4DV3 L;  1XPR A;  1NMG A;  1PH9 A;  1FVI A;  2ATW A;  3S1M H;  1OXU A;  1XNR Q;  3I2Z A;  2VQF L;  1OXV A;  1I94 Q;  2JQO A;  4DV1 L;  2JA9 A;  2K75 A;  2XTI A;  4UY8 C;  2E5L Q;  3K7U C;  1G29 1;  1PH4 A;  1QVC A;  2R93 G;  1EIF A;  3CMA A;  4B3T Q;  1Q1E A;  3VDY A;  4BY1 G;  1VQ8 A;  3GTP H;  3PUW A;  3ZJY C;  4JBM A;  1N33 L;  4A3M H;  3GTQ H;  3A74 A;  5JEA J;  4DV7 L;  4GS3 A;  4B3M L;  2MQH A;  1J5E L;  4P75 A;  3F2C A;  4FDB A;  3RNU A;  1HR0 Q;  4LF8 L;  4DR7 Q;  3CCR A;  1GO3 E;  3GTO H;  4IPD A;  2PNH A;  1VQA A;  4A3G H;  1C0A A;  2PI2 A;  1NBW A;  1WCM G;  5LMN L;  2V1C C;  4DR6 Q;  1SN8 A;  1QVF A;  1Q46 A;  1TWC H;  3U4Z A;  1PA6 A;  4L5T A;  1L1O A;  3I55 A;  1BBW A;  3F2D A;  4GKJ L;  1KD1 C;  4WJ3 M;  3CC4 A;  3CCU A;  2K5V A;  4A4I A;  1YJ9 A;  2B63 G;  1VQC A;  3RLN A;  2VQF Q;  2Q2T A;  1N36 Q;  4BXX H;  1TWG H;  1Q7Y C;  3STB C;  5AJ3 Q;  5LMU Q;  2HIV A;  1PH5 A;  3RZO H;  1KIX A;  4WJ4 A;  4AQY L;  3E9H A;  4O2D A;  4Y7N H;  1IBL L;  4OO1 I;  4OON A;  1N8R C;  1S72 A;  1RL2 A;  3AYH B; 
#chains in the Genus database with same CATH topology
 4PZ6 A;  3PQI A;  4EVO A;  3EVQ A;  3G6E A;  1SAP A;  5AFW A;  5IT9 c;  4LF8 Q;  2DY7 A;  4K8I A;  1SYD A;  4H13 C;  1N34 Q;  1YIJ A;  1EY0 A;  1ICW A;  4RMF A;  4EQP A;  4R8N A;  1L1O C;  2JA7 G;  1LTI D;  3IAY A;  3PCO B;  5L37 A;  1IL8 A;  4B9W A;  2I5M X;  2I5H A;  1VQJ A;  2R6G A;  4C3J G;  4TVA B;  5JOB A;  4YCV A;  4K2K A;  2N78 A;  3HOX H;  3P7J A;  2ZM6 Q;  2PW5 A;  1ROD A;  3HKZ B;  1HUN A;  1LT5 D;  3BDO A;  1NUC A;  4FXD A;  4K8J A;  5EBC A;  3TME A;  1PH8 A;  4DV0 L;  2A6H C;  2XNA C;  2NTS A;  3J7Y W;  1E7Z A;  1IZ6 A;  1SMY D;  1HPC A;  1LT3 D;  1PH1 A;  4TRD A;  4LFB L;  3F1Z A;  2R7Z G;  3NP8 A;  2EOT A;  4BBR G;  3AEV A;  3SK8 A;  2QDB A;  2OTJ A;  4C3I H;  4LW1 A;  1QNK A;  3T1H L;  1HR0 W;  3K80 C;  4KLK A;  5HY6 A;  3H15 A;  1D5M C;  1G6P A;  1MI2 A;  3OWF A;  5IT9 E;  1HZC A;  1A2T A;  1BUV T;  2MP1 A;  4Q5V A;  2N88 A;  1GKH A;  5EAY A;  3P20 A;  2QW7 A;  2IHE A;  1C9O A;  2X6L A;  4A3B H;  4RG1 A;  1KNA A;  3CHB D;  4TQU S;  2B2T A;  3SEB A;  1QJO A;  4A93 G;  2CH4 A;  2F0F A;  2Q8T A;  1YI2 A;  1KDC A;  4R4C A;  1QOH A;  5EKL A;  5FJ8 G;  3J80 L;  1VQP A;  4BBS G;  5GAE C;  1SJH D;  3NTK A;  3MXU A;  1FJG Q;  2YTX A;  1UWV A;  5JJZ A;  4X62 L;  5C4Z A;  2ZTC A;  2IL8 A;  3I73 A;  4EQO A;  2AMC B;  4P72 A;  2DJF C;  5IGC A;  4N8X 1;  1X3G A;  1XX8 A;  1E1O A;  1VQN A;  4LF9 Q;  2O5I C;  4OEL B;  4R4Q A;  1JWU D;  3A0J A;  1K8A C;  2B2T C;  2BCO A;  4JI3 Q;  3D0F A;  3X3M A;  4J8Q A;  4A3K B;  1VQ4 A;  1EWI A;  4IOA A;  1ILP A;  2KEC A;  1T5E A;  1EFI D;  2RKS A;  1GD7 A;  2SEB D;  4Q0F A;  4PQX A;  1BDO A;  1OXX K;  2H5X A;  2A19 A;  1CM9 A;  1B9M A;  1UEB A;  4GOP C;  4NXN L;  1E2Z A;  1KRT A;  2K7V A;  1II3 A;  1XMQ L;  3R93 A;  3D3R A;  4JOI A;  2R92 B;  2F0M A;  2KVM A;  4JVZ A;  1N33 Q;  2NYZ D;  3NBH B;  1DJR D;  1VQE A;  5C3E G;  1J5E Q;  3W1B A;  1SRO A;  4ID6 A;  3NPP A;  2RHQ B;  3E5S A;  2ZXP A;  4GN4 B;  4OGQ C;  1CQF A;  1GHJ A;  2HDM A;  2QGQ A;  4KY6 A;  1KDA A;  4J1M A;  1W6J A;  4GKJ Q;  2WAC A;  1KHI A;  5ELE A;  4GOP B;  1NJI C;  4A3F B;  4KJO A;  1CI3 M;  1EOV A;  2Z9H A;  4B08 A;  1EIY B;  2PI2 E;  1IBL Q;  4K14 A;  3DHQ A;  1K0R A;  4WJW A;  1YZ6 A;  3ULL A;  4X65 Q;  2JP1 A;  4BA2 I;  1F2L A;  3TBI B;  4YWK A;  4IOC A;  2PZW A;  4DR1 Q;  4DNT B;  3UE1 A;  3MXN B;  1IHZ A;  4K6D A;  3I4M G;  4K0K L;  1EYC A;  2VUM H;  3RD4 A;  2CW0 D;  3MA2 B;  3AQQ A;  3HZX A;  1BKB A;  1HFG A;  2E2D C;  4B9X A;  4DR4 L;  1E0B A;  4X64 L;  3W1G A;  4JV5 L;  4XQQ A;  5IE8 A;  4LF7 Q;  3OTO Q;  3I4O A;  2E2I H;  5E3F A;  3VR3 A;  4KN7 C;  3FRP B;  2TSS A;  3RN2 A;  2IJ0 A;  3QOJ A;  4CJ2 C;  1CZG A;  4M1U B;  1YNJ D;  1TY2 A;  3PIP A;  2KCM A;  4HJ7 A;  1RIP A;  3HOW B;  4HSV A;  2C35 B;  4A75 A;  1IKL A;  2PZU A;  4JI1 L;  3MAQ A;  1IBM L;  3NWS A;  5M3M G;  3M3Y H;  1VQD A;  3OIP A;  4EGV A;  1ASY A;  1TKW B;  4JG2 A;  1K0S A;  2RCF A;  3UI2 A;  4HJ8 A;  1KDB A;  1AW7 A;  1DZ1 A;  1Y1V B;  5FOB B;  2K5W A;  4LNQ A;  3DXJ C;  3S16 B;  2WAQ G;  4E6I A;  1GUS A;  4P74 A;  2F0Q A;  2F1M A;  3DLL A;  1K8O A;  5C44 G;  2K03 A;  4X3S A;  5IOD A;  4P73 A;  2MO1 A;  1VQ6 A;  2BE5 C;  2B3G A;  1Q90 A;  3I72 A;  2KUM A;  4R1J A;  3TP5 A;  4M8A A;  5KNB A;  4RAU C;  2FMC A;  2I5L X;  4JI5 Q;  3HOY B;  1CTM A;  4IUQ A;  1A0I A;  4QUF A;  3A5Z B;  2WB1 G;  3KLS X;  2A5H A;  3HFZ B;  5AJ3 L;  3PUY A;  3J7A 5;  5IOC A;  5BN4 A;  4DV5 Q;  5EJW A;  2F52 A;  4A3I B;  2I0Q A;  2FMM A;  2LKV A;  1B50 A;  3J81 c;  3K8A A;  1XPO A;  4DV2 L;  4GNX B;  4ZKB B;  2A73 B;  2P5Z X;  2N49 A;  1CZW A;  1HUM A;  4CBV A;  4LFA Q;  2PQA A;  3S1R B;  4FF1 A;  4G4K A;  1O7Z A;  1GJX A;  2JE6 I;  3HOZ B;  1JCK B;  1YBY A;  3SGI A;  2DNE A;  2EXZ A;  5JVH 3;  1FYC A;  1QUQ A;  3L3O C;  1K3B C;  4CDE C;  3OSO A;  2GA4 B;  2VL6 A;  2E74 C;  1I4R A;  2L9H A;  2JA6 H;  3HOW H;  3MEF A;  1SMY C;  4KKS A;  1M1K C;  4H0L C;  2Q2H A;  4FXG C;  2E2J H;  3GTP B;  3NQI A;  5FLM H;  3BZC A;  2UXD Q;  4OO1 H;  3S9W A;  3UDG A;  1O7I A;  5JPN C;  1R4Q B;  2A74 C;  4DV6 L;  1NR4 A;  3VR5 A;  1ESF A;  4JK1 C;  3DWP A;  3IL8 A;  2OWO A;  1VQF A;  3WOE A;  1HNZ L;  3S1Q H;  3J81 E;  1XNQ L;  1PVO A;  4GKK L;  2I07 B;  4IFD G;  3GTL B;  1PYW D;  5ISR A;  1B3Q A;  1HH2 P;  1YNN D;  2J0T D;  1GXD C;  4QL5 A;  3TZU A;  3RLO A;  5ELB A;  3HOY H;  4MIU A;  5M5W B;  5JJK A;  2I46 A;  5JEA H;  3TSS A;  1NNX A;  3SVM A;  4C1N K;  2WV6 D;  4RKL A;  4XDX A;  3J80 c;  4AIM A;  4YIJ A;  5DM6 3;  1S5E D;  4HED A;  1WYD A;  3ULP A;  4KK7 A;  1WTH A;  4A3I H;  1SBB B;  1SE4 A;  2DN8 A;  5F2D A;  4B3R L;  4HN7 A;  1VQM A;  1PTO F;  1FD7 D;  4IO9 A;  3K5L A;  1V1P B;  3BG3 A;  2EYL A;  1HNX L;  1VQH A;  4JI0 Q;  4FXK C;  3ONA B;  2UUA Q;  1RKN A;  1JE4 A;  1BO0 A;  2A69 C;  4A3C G;  1BOS A;  3GTM B;  3UDI A;  3S1R H;  3KF6 B;  1B70 B;  1PH4 A;  1VQ8 A;  4A3M H;  4LF5 Q;  2CWP A;  1UE6 A;  2Y0S G;  4ZYS A;  3SXH A;  1JOQ A;  4H7B A;  5COY A;  2EYJ A;  1K8G A;  4B3S Q;  2K4K A;  3CCE A;  2ATW A;  1Z7T A;  1NMG A;  1OXU A;  1VMC A;  2XVS A;  2JQO A;  4IN3 A;  5EKI A;  2D2C C;  1H9S A;  3CMA A;  3GTP H;  1BCP D;  1I3Q B;  4PMC A;  3ZJY C;  3J80 E;  4B3M L;  4DV7 L;  2R93 B;  1HA5 A;  4QF4 A;  4P75 A;  3F2C A;  4DR7 Q;  1HR0 Q;  1EY5 A;  4BY1 B;  3CCR A;  1GO3 E;  1CHP D;  1C0A A;  1VQA A;  4A3G H;  1NBW A;  5LMN L;  1E2V A;  1SYF A;  5I2Y A;  1Q46 A;  3GTK B;  3F2D A;  1WCM B;  3FMC A;  5CR3 A;  3CC4 A;  4WJ3 M;  4C3H G;  1YJ9 A;  3NSW A;  3RLN A;  3K59 A;  1N36 Q;  4BXX H;  4BWG B;  5ELC A;  4KN4 C;  4RH6 A;  1TR5 A;  3A8J E;  4WJ4 A;  3E9H A;  2Z1C A;  1JIC A;  1N8R C;  3I4L A;  3AYH B;  2Z6B A;  1FGU A;  3I4N H;  2ZT9 C;  3DWA A;  3I7F A;  3H0G B;  4LF6 Q;  4QY7 A;  4ZRZ A;  4CDD C;  5M5W H;  1XYI A;  4A3D G;  1S40 A;  1B1Z A;  5COR A;  5IYD H;  1NY4 A;  1S5D D;  1RTN A;  2L0C A;  3UE0 A;  2F0H A;  2CW0 C;  2MFI A;  4QCL A;  2JA7 B;  1HJP A;  4HMJ A;  1Y1W B;  1OXS C;  2IX3 A;  5IYC H;  4U68 A;  4JYA L;  3PUV A;  4C3J B;  1X56 A;  3F2U A;  3MFY A;  2F0E A;  4A3E B;  1G2S A;  1RHP A;  1PHJ A;  3H3V I;  2X6G A;  1JB3 A;  5KIX A;  2CVR A;  3LX0 A;  4UDU C;  1CKM A;  1HXY D;  1EEF D;  1ET6 A;  4LK1 C;  1HNW L;  5M5Y B;  4Z9C B;  1YNJ C;  1CT1 D;  3NBI A;  4DR2 L;  2HHH L;  4HSP A;  2JA8 H;  2SOB A;  3PUX A;  4F88 A;  5T1I A;  2R7Z B;  1F2M A;  1BF4 A;  4BBR B;  3GTJ H;  2ZJP A;  2AWO A;  2A1A A;  1EWH A;  2EE1 A;  2Q2U A;  3K0X A;  3U58 A;  3P1H A;  1PRT B;  5IY0 A;  2B8F A;  3CCV A;  4YCW A;  3NQT A;  2IY5 B;  1AH9 A;  1A6X A;  5C6A A;  1I3Q H;  5GAD C;  4DU9 A;  3LWE A;  2EYO A;  1SYB A;  2NZ1 D;  2HQE A;  3I91 A;  3OHX C;  4IAL A;  4EQN A;  4LFB Q;  1WJJ A;  4DUY Q;  1CKN A;  4DAY B;  2WAQ E;  5IGF A;  4OX9 Q;  4MNO A;  3PIP 3;  1NE3 A;  4O42 A;  4A93 B;  4DXG A;  4LF4 L;  1R9T H;  2UXB L;  3HP3 A;  1GUN A;  3BYY B;  2IX1 A;  3FKI G;  1G2T A;  4BBS B;  1EWC A;  3FPU B;  1Q3L A;  1U4M A;  5IGE A;  4DV4 L;  2EY6 A;  4JI4 L;  3QO2 A;  4XT1 B;  1OXT A;  2K5D A;  1EFW A;  1W2B A;  4RGM A;  1WTW A;  1TWA H;  5E4W C;  2RCN A;  3H3V C;  5M5X B;  3I8Z A;  2K32 A;  4JBJ A;  3TRE A;  3PO3 H;  1JOO A;  5FO7 B;  1K73 C;  2QF7 A;  3CP0 A;  1N32 L;  1LTL A;  1PTO B;  2VW9 A;  2XRS D;  2WB1 E;  3HRZ C;  3URY A;  1AZQ A;  1F9R A;  1IW7 D;  1BCP F;  1WTX A;  5CV8 A;  4DR5 L;  4NXM Q;  3CRL C;  4YHH L;  4ZLT F;  4KHZ A;  3DEP A;  4X62 Q;  2E2H B;  1A3U A;  3D4W A;  1QVG A;  1VCI A;  1MKH A;  1UUP A;  3CF5 A;  1XTD A;  3NTH A;  4AQY Q;  2JA7 H;  1A63 A;  1Y1W H;  2JA5 G;  2N8N A;  3S1N B;  2Q2I A;  4UP7 A;  2PMZ E;  3JAM i;  2PCF B;  4KI0 A;  2D0P A;  5A2Q L;  4A3E H;  1XMO Q;  4MTK A;  3CAM A;  1ENA A;  1X55 A;  1U4L A;  3HOV H;  1EU3 A;  2NUC A;  3R3O A;  1MGS A;  1EYG A;  2O2L D;  4DK1 A;  4IUR A;  5K36 G;  1SMX A;  4RKB A;  1QNU A;  1AN8 A;  2CHB D;  4RA8 A;  4DF7 A;  4JI7 L;  3CCM A;  2QCP X;  2HQL A;  2F0V A;  1WD0 A;  3HOU H;  1EQQ A;  5IIF A;  1IYV A;  4A3J G;  5C3E B;  1YVC A;  5C0X H;  1PZJ D;  2Z8L A;  3KDF B;  4ODG A;  1VF5 C;  2KEN A;  3G7L A;  2UXC L;  1ICF B;  2ASB A;  3J7A V;  5J3B A;  1SSO A;  2AQ2 B;  1E24 A;  1F77 A;  1T9H A;  2D9U A;  4IUV A;  1D1I A;  1PYS B;  3CC2 A;  4OL7 A;  2ES2 A;  4DUZ L;  4RGO S;  2MGS A;  4G7Z C;  1KLG D;  3Q23 A;  4A93 H;  4FVM A;  4PG3 A;  1YNN C;  1JWS D;  3R2T A;  1LYL A;  1FNU A;  1LO5 D;  1U4P A;  3GTO B;  2WIN B;  2XN9 C;  2ZJQ A;  3DMU A;  3I4M B;  2DUD A;  3UDX A;  1IXR A;  3T16 A;  4EX5 A;  3PO2 H;  3HKS A;  1EL0 A;  4LUO A;  3DEO A;  1PTO H;  2G5D A;  2LXK A;  1MIU A;  5I6W A;  1TWG B;  5JAV A;  2OQK A;  4IFD J;  1UNS A;  4IUP A;  4JI6 Q;  1KC8 C;  1TS2 A;  3TRZ A;  1J6Q A;  5I9O A;  1X3E A;  4FF3 A;  2BA1 A;  1DCZ A;  3S2D B;  1I4X A;  2AWN A;  4K5W A;  1TS5 A;  5NUC A;  4YY3 Q;  1B9N A;  3QWN A;  1B4O A;  4K5V A;  3A54 A;  3H3V H;  4DR3 Q;  3NHH A;  3S24 A;  4QJF A;  4KTA A;  1FL0 A;  3VYS A;  1MJE A;  1IBK L;  3OMG A;  3E9I A;  1X65 A;  2UU9 L;  3GO5 A;  4R4I A;  2MUY A;  2AKW B;  3MZ5 A;  4HAE A;  4OHJ A;  1CSP A;  3HOX G;  2B2Y C;  3NBH A;  1STG A;  2UUB Q;  4YCU A;  1PXU A;  2Y0S E;  4JI2 Q;  4BS9 A;  5CV4 A;  2B63 H;  1Q82 C;  5GAG C;  2F0U A;  2NVY B;  4C2M H;  5M3M B;  2A8V A;  1I94 L;  3N52 A;  1L2F A;  2BA0 A;  4CHT B;  1GOZ A;  4R4T A;  1I4P A;  4GOP A;  4OWT B;  2EY5 A;  4B3T L;  1TWH B;  4WFN 3;  1BCP C;  5C3E H;  2WAQ B;  3EIV A;  4RHR A;  1HZ9 A;  1OO9 B;  4KD3 A;  4L5Q A;  1EYA A;  5CBA E;  4JBK A;  4C3I G;  5C44 B;  3FP9 A;  4IPH A;  2QEX A;  1IBM Q;  1GUG A;  3E0E A;  4FO2 A;  1D7Q A;  3U4V A;  4LAA A;  3TN2 A;  4GZY C;  3T51 B;  1NTG A;  4IFD I;  3S17 B;  1D5Z C;  4ZUI A;  2F0N A;  3L7Z C;  3MXN A;  1ASZ A;  5DAU A;  4A3B G;  1M4V A;  3T4A C;  1ZKO A;  1A15 A;  1SE3 A;  1BCP B;  4NPS A;  5D3D A;  1AE3 A;  2X69 A;  1LTS D;  2EQS A;  4NKL A;  3U50 C;  1JR0 D;  3ZYY X;  1IKM A;  1M8A A;  3I4M H;  1N34 L;  2KED A;  2NN6 G;  4EQ5 A;  1ZYR C;  3OPO A;  1I50 B;  3KOJ A;  5M3F G;  4POF A;  1F2Y A;  2PMZ B;  2EIF A;  5KNC A;  1IL2 A;  1VF7 A;  3VYU A;  2QKI C;  1BBX C;  3U9S A;  1X3Q A;  4ALP A;  4RCO A;  2ZM6 L;  5IGB A;  4HJ5 A;  4BY7 B;  3M7G A;  2GVA A;  2CQO A;  5KRU A;  3NUC A;  3S2D H;  3K57 A;  3S1M B;  5EPK A;  2VS1 A;  2KCT A;  4OIK A;  2ICE C;  2PNR C;  3KBG A;  2PZT A;  3BS1 A;  1U9R A;  2RSN A;  1CA5 A;  3VYR A;  3O13 A;  3ITP A;  1Y8P B;  3GTQ B;  3QB3 A;  3T1Y Q;  3HKZ G;  2CKZ B;  5E7N A;  2L12 A;  4GLX A;  2N3S A;  2NVY H;  5M3M H;  5IYB H;  2CCZ A;  2ALY B;  3SK5 A;  4ZKC B;  1EZ8 A;  4KHP Q;  4KHV A;  4MHE A;  3NK9 A;  2B8G A;  4JI8 Q;  3N6R A;  1E3P A;  1TWH H;  4FF4 A;  5BR8 Q;  2RF4 A;  3IRB A;  2A6E D;  5C4J B;  3QR8 A;  1PRT D;  4A3K H;  3PGZ A;  4LFC Q;  1D1K A;  5TSS A;  2MJ8 A;  4PV1 C;  3JAM L;  1SE8 A;  2F4I A;  3PMF A;  3CC7 A;  1KL9 A;  1ESR A;  4UHV A;  3MWY W;  2ID0 A;  1L0Y B;  2E75 C;  1FJG L;  4NDX A;  1ILQ A;  3TP6 A;  1DOL A;  5FLX L;  2JEB I;  1WTR A;  3LGJ A;  4C56 C;  3S17 H;  2JSO A;  1B7Y B;  2CQA A;  1H9R A;  4K2L A;  1PDQ A;  2RDG A;  4FF2 A;  3Q6S A;  1WTP A;  4LF9 L;  1XNQ Q;  4RGN A;  3M4Y A;  4GNX A;  1W3S A;  1VQG A;  4ZUJ A;  1JC7 A;  4JI3 L;  2R92 H;  1SFO B;  3SDZ A;  2NVT B;  1IW7 C;  1E1T A;  3TP7 A;  4PMB A;  4A3L H;  1EY7 A;  4X66 Q;  1PLF A;  3RLF A;  1GM5 A;  2JK8 A;  2XSC A;  2L4N A;  1PTO D;  4DAP A;  4DKA C;  4DAV A;  2VUM G;  5FO8 B;  4CDF C;  1I50 H;  1MD2 D;  1A62 A;  4IZ8 A;  2JXM B;  3G6J B;  1HZA A;  2M2L A;  2FJ2 A;  1X3F A;  1LM0 A;  4UP8 A;  1QZG A;  4RFB A;  3I90 A;  4A3F H;  5D14 A;  3V05 A;  1LV9 A;  2EXD A;  1A3V A;  2KHI A;  5JJI A;  4BY7 H;  5JVG 3;  1J9O A;  2Y0S B;  4GNX C;  3S1M H;  1XPR A;  4K6L A;  3BYT B;  1QIL A;  2B2W A;  1XNR Q;  3I2Z A;  5T1G A;  3DM1 A;  2VQF L;  1OXV A;  2XTI A;  4UY8 C;  1ML0 D;  5C5L A;  4KJN A;  2E5L Q;  3K7U C;  1G29 1;  1S5B D;  2FFK B;  2Q8R E;  3CKI B;  3PUW A;  2NVX B;  1N33 L;  3GTQ H;  2F03 A;  1J5E L;  2K5Q A;  3IKJ A;  4XT3 B;  4IPD A;  2PI2 A;  4DR6 Q;  1SE2 A;  3I55 A;  1DON A;  4GKJ L;  3A8I E;  2B2W C;  2F0P A;  2K5V A;  2SDF A;  1PFB A;  3CCU A;  1RF2 D;  1TWF B;  2O5J C;  2KA7 A;  5CV9 A;  1Q7Y C;  5D3I B;  5LMU Q;  3L9A X;  4C3H B;  3W2D A;  1IBL L;  4OON A;  2BDN A;  3EA6 A;  5CGK A;  4PMW A;  4X65 L;  1S4Z A;  1EYD A;  1DD2 A;  1I4H A;  1HQR D;  4AYB G;  4ABN A;  4DR1 L;  3FHW A;  1CSQ A;  4DNR B;  1EQR A;  1B8A A;  4I7Z C;  4A3D B;  4OEM B;  2N55 A;  1PH6 A;  1P8L A;  1SNO A;  3UDF A;  5A2Q E;  1V1P A;  2VB3 X;  1B53 A;  4LJZ C;  5H1S E;  4G57 A;  4LF7 L;  2VY3 A;  1IYJ B;  1S5C D;  1V8Q A;  3OTO L;  1Y1V H;  2NVT H;  2M9V A;  4HIK A;  3S16 H;  2HT1 A;  1PRT F;  3KF6 A;  4ZCK A;  1Z9F A;  2F3I A;  4L5S A;  2KOL A;  4N9P A;  2YV5 A;  3A55 A;  1SYG A;  3CME A;  2EYH A;  2PYK A;  3AMU A;  5IWA Q;  2VQE Q;  2UUC Q;  4A3C H;  1QE6 A;  2K01 A;  3IFD A;  3TEH B;  1PFM A;  4IUN A;  5HUR A;  3CRK C;  3PV0 A;  1D8L A;  3GV3 A;  2NVX H;  3RZD B;  4GN5 A;  4KMU C;  4ZAI A;  2JA6 G;  3HOW G;  1F9Q A;  2PQE A;  1TII D;  3LWU A;  3ND9 A;  1STH A;  2HCI A;  5M9O A;  3Q22 A;  5FLM G;  5DM7 3;  5KYL A;  3RMH A;  4OO1 G;  1KQS A;  1KLU D;  1U0L A;  3DM3 A;  1O7Y A;  2Z4H A;  2K04 A;  1JJ2 A;  4IJH A;  2L55 A;  3E3X A;  2F0G A;  4MN3 A;  3KF8 B;  1V1O A;  3HOZ H;  4JI5 L;  1YJW A;  3Q0A A;  2ZXO A;  1Y14 B;  4PZ8 A;  4MTN A;  1SJE D;  1YHA A;  3I56 A;  2NVQ B;  2IWH A;  1NSN S;  2EYM A;  1C4Q A;  4JPB W;  1AE2 A;  4KKT A;  4C1N I;  3H09 A;  1G91 A;  2L11 A;  3HOY G;  4JI4 Q;  5JEA G;  3VR4 A;  2F4V Q;  2YU9 B;  1LLR D;  1G8Z D;  1Q8I A;  4F87 A;  1MJC A;  4LFA L;  1SLJ A;  3FEW X;  4DV3 Q;  2JA5 B;  4A3I G;  4KY7 A;  3SK6 A;  1HCZ A;  4DV1 Q;  3IFT A;  3CD6 A;  3GTL H;  1KTK A;  4PNY A;  2R3Z A;  2LY7 A;  3AB9 A;  1Z6H A;  3OWE B;  2ZTD A;  3A56 A;  1LAB A;  2MO0 A;  5I2X A;  4H44 C;  4A3M G;  1TVX A;  2KHJ A;  5FO9 B;  3KLW A;  4NP5 A;  2UXD L;  2F0O A;  3SK4 A;  3K7A B;  4A3J B;  2D0O A;  1YIT A;  1LT6 D;  2B39 A;  2B29 A;  1S3O A;  3SR1 A;  1YNX A;  3ERO A;  4DAY A;  4S3S A;  3HKZ E;  2F3V A;  3JC6 6;  3STB D;  1WTQ A;  2ZJR A;  4CKC A;  4POG A;  1E2W A;  2J7Z A;  4F7X A;  1LTG D;  5IP9 H;  2A6E C;  1PRT C;  2K6A A;  5IGD A;  1X9N A;  3K5N A;  1I4Q A;  4NB3 A;  3K5M A;  3A7A B;  4A3G G;  1WVL A;  3GTM H;  1K9M C;  1T5X D;  4ULL A;  3TS2 A;  3JAM c;  2Z4I A;  5GRO A;  1BXT A;  3KLR A;  2EYP A;  4BXX G;  2SNS A;  3E0J A;  3S14 B;  3BZD B;  4JBW A;  1EQT A;  3L0O A;  5FLX c;  3GTG B;  1A2U A;  4XTC S;  1VQO A;  3CCQ A;  2E76 C;  4DV0 Q;  3RZO B;  1HQM C;  2E8G A;  3AFQ A;  2NN6 I;  3I4N G;  3S15 B;  2G9H D;  1SDF A;  2GVB A;  3W3A A;  5CV6 A;  2R93 H;  3RN5 A;  5KND A;  3CPW A;  5IYD G;  2YU9 H;  4BY1 H;  1PTO C;  3ICE A;  4OIJ A;  1JOK A;  2K14 A;  3L2P A;  2CWA A;  1LTT D;  2L5T A;  5E4X A;  3T1H Q;  3GTK H;  1PH2 A;  5KEE A;  1WCM H;  1UE1 A;  4LF5 L;  5IYC G;  2OF1 A;  1EIH A;  4J15 A;  5LMN W;  1HTP A;  1FNW A;  1CQV A;  4B3S L;  1R4P B;  3HOX B;  4UP9 A;  3PF5 A;  3TQY A;  1KNE A;  2LFN A;  2AQ3 B;  3KDF A;  5G3L D;  4ILW A;  3J81 j;  3JAM E;  3H0G H;  1RD9 D;  3RUZ A;  2JA8 G;  2RA4 A;  1ENC A;  2C9O A;  3K7A H;  4DR7 L;  3FPP A;  1HR0 L;  2QA4 A;  5FLX E;  2F0I A;  3PUZ A;  5CYU A;  2YTY A;  3EBE A;  3WDN A;  3NEL A;  4C3I B;  2HDL A;  4R4O A;  2HIX A;  5IP7 G;  2AUJ D;  1GUW A;  1C8C A;  2Z6K C;  1O78 A;  2FXQ A;  4C3J H;  4LMQ D;  4HJ9 A;  1PFN A;  4ZQ3 A;  3NTI A;  2XGT A;  1N36 L;  3M4Q A;  4KKU A;  1A3T A;  2B2U A;  5C4X G;  5HGQ A;  4A3B B;  3G71 A;  5KYI A;  5M5Y H;  1ZEQ X;  1VS0 A;  3C46 A;  3MEH A;  1DXM A;  4LF6 L;  1HTL D;  4N9T A;  2BH2 A;  2K28 A;  2R7Z H;  4AYB E;  4BBR H;  1AEX A;  1CKN B;  5EKK A;  3S14 H;  1HHV A;  2SNM A;  2NZO A;  4NMZ A;  4QIW E;  4QUC A;  3GTG H;  3PO3 G;  3ER0 A;  3PSI A;  2KCN A;  5M3F B;  1I4G A;  4XQJ A;  1MBY A;  2B2U C;  4NXN Q;  2EY2 A;  3ERQ A;  4FYD A;  3S15 H;  1XMQ Q;  1BBU A;  3OYY A;  1BQQ T;  1F9S A;  5EBD A;  1UEA B;  2BOS A;  1PH3 A;  4Y52 H;  1DM0 B;  2F0W A;  2G9D A;  1WD1 A;  3CCS A;  4TSS A;  1QZH A;  1NAP A;  1O7L A;  2BDO A;  1SNC A;  5FJ8 H;  4HR7 B;  4P2C B;  1Y1W G;  4BBS H;  4APV A;  2K5H A;  2KBN A;  1EY6 A;  4CKB A;  3EQL C;  1TXY A;  2V4D A;  3TP8 A;  4HTH A;  1L0W A;  3KUP A;  4CGY B;  4A3E G;  5M5X H;  3QG1 A;  4OWW B;  3A5U A;  1EZ6 A;  5EPJ A;  4XQN A;  1STY A;  1TWC B;  3HOV G;  4R9W A;  4TKO B;  3HGB A;  1AZP A;  5ELD A;  2OXP A;  2B2Y A;  2L15 A;  3QIA A;  3MVV A;  4IQZ A;  5BN5 A;  4IJL A;  1L1O B;  2PPB C;  1P16 A;  4Y7N B;  5DNF A;  3HOU G;  2MPM A;  3CXC A;  4DUY L;  3CPF A;  2E2H H;  3CCL A;  4DK6 C;  5C0X G;  4K0K Q;  4OX9 L;  3OIQ A;  5LHY 1;  1STB A;  1Q81 C;  1I6H B;  1SR3 A;  4DR4 Q;  3S1N H;  4X64 Q;  5ELF A;  3D31 A;  4JV5 Q;  1EOT A;  3Q8D A;  3TS0 A;  4G7O C;  1VQL A;  1VDZ A;  5E1F A;  1UE7 A;  1KXL A;  2NWG A;  3D8G A;  4PZ7 A;  3U9O A;  2K52 A;  5G3L F;  2NBF A;  1Q1B A;  2LXJ A;  5ELN A;  4NXM L;  4YWL A;  1C48 A;  5BN3 A;  4X3T A;  1EIG A;  4DNI A;  2NN6 H;  1GHK A;  4IUT A;  2VUM B;  1SEB D;  1X54 A;  4JI1 Q;  4AQY L;  1XXG A;  3PO2 G;  5M3F H;  4DAM A;  3C3L A;  4FP5 D;  3AFP A;  1LT4 D;  4KD4 A;  1N9W A;  3ERS X;  2EZV A;  1XMO L;  1PH9 A;  1MSG A;  1FVI A;  4L6T B;  2E2I B;  1K28 A;  3HS0 C;  2DNC A;  2JA9 A;  5I6Y A;  3QOL A;  1CA6 A;  2WB1 B;  1QVC A;  3GP7 A;  1Q1E A;  4JBM A;  2A69 D;  3A74 A;  5D65 A;  5JEA J;  4GS3 A;  2MQH A;  4DA2 A;  4LF8 L;  1SNP A;  4FDB A;  3RNU A;  1STN A;  3GTO H;  5A35 A;  4ME5 A;  3R8B A;  4JW0 A;  2V1C C;  1SN8 A;  3HEJ A;  1TWC H;  1RDP D;  1PA6 A;  3LNN A;  3GQB A;  3ND8 A;  1LAC A;  1KD1 C;  3BVZ A;  4A4I A;  2PW7 A;  2B63 G;  2VQF Q;  2Q2T A;  2WII B;  1SND A;  3M3Y B;  4HMI A;  2KQ3 A;  1TWG H;  3KLS A;  3STB C;  5AJ3 Q;  2RSO A;  1PH5 A;  4RGT A;  2F3W A;  4N8F A;  4Y7N H;  4V0B A;  4OO1 I;  2XWJ B;  1ENF A;  4CDC C;  1RL2 A;  1JOR A;  1PFS A;  3F8T A;  3J7A F;  5IGG A;  5C3X A;  1NR2 A;  4KV6 A;  1Q86 C;  3OMC A;  1I6H H;  5KGU A;  3G4S A;  3M7N A;  1DOK A;  4DV2 Q;  2PO4 A;  1CFM A;  4AYB B;  2A68 D;  4RWS C;  3C2P A;  1QWY A;  1TT2 A;  4QIW B;  1ET9 A;  2D5D A;  2OT2 A;  3CCJ A;  3PIO A;  3MXG A;  4JOI C;  4V19 0;  2HD3 A;  1D5X C;  5CV5 A;  4L63 B;  4JI6 L;  4RHS A;  1JJC B;  3VR6 A;  3M4P A;  4J6H A;  2EY1 A;  4O1N A;  1SRU A;  1JWM D;  2OQ0 A;  4YY3 L;  5C44 H;  4HCE A;  2OTL A;  1XPU A;  4CJ0 B;  4DR3 L;  2Z0S A;  5FK9 C;  5ELO A;  1K3R A;  5GAH C;  3NWT A;  4DV6 Q;  3VA7 A;  3GV6 A;  1VQK A;  4ME3 A;  4DK0 A;  4WRD A;  1HNZ Q;  2JN4 A;  5JPM C;  2UUB L;  1UAP A;  2QIL A;  1WOC A;  4JI2 L;  1QB5 D;  1EQV A;  2JYO A;  3I70 A;  4GKK Q;  1CUK A;  2NZH A;  4X3U A;  2JA6 B;  3K5O A;  4XIG S;  4K5X A;  5J22 A;  2L1B A;  2E2J B;  2RDH A;  3MHB A;  5CC4 A;  2YTV A;  4CJ1 B;  1XWE A;  5IYB G;  3S2H B;  2BH8 A;  3K6O A;  4RCN A;  2AHO B;  1BNZ A;  1FNV A;  2HCC A;  4QB4 A;  5I4D A;  1VQ9 A;  2VNU D;  1G51 A;  1PMR A;  4YWM A;  3R2I A;  4B3R Q;  3GDE A;  2F0T A;  4DK3 C;  4A3K G;  2RVL A;  3S1Q B;  2GN5 A;  3WWV A;  5C4H A;  1AFP A;  1SNM A;  1RTO A;  4O0A A;  1M90 C;  1HNX Q;  5J1Z A;  3OW2 A;  2EPB A;  3KJP A;  1JT8 A;  3MFG A;  3TDQ A;  3NEM A;  2EJM A;  2QEJ C;  3BJU A;  1DYQ A;  5CBE E;  2KJX A;  2R7F A;  1GVP A;  1DGS A;  1HZB A;  2IPK D;  5DLQ E;  2R7D A;  1TS4 A;  1FGB D;  4UPA A;  4X6A H;  1U5K A;  2R92 G;  1BR9 A;  5C4J H;  3D6C A;  1STE A;  4A3L G;  1ONL A;  2IHF A;  2CFM A;  3VA5 A;  1LTB D;  2EVB A;  3AU7 A;  4B3M Q;  2IX0 A;  4DV7 Q;  5C3W A;  4IFD H;  1FR3 A;  1PV4 A;  1STA A;  1U4R A;  4NW2 A;  2ENB A;  5LMN Q;  1B3A A;  3VR2 A;  1Q8K A;  4R8I A;  4A3F G;  2F0L A;  1L0X B;  1ZXT A;  3C1E A;  3T1Y L;  1TQO A;  4BY7 G;  4A3M B;  3NEN A;  1QCB D;  3QJY A;  2LSS A;  4LUZ A;  1Z47 A;  4HCS A;  1KAB A;  1SYC A;  5IT9 L;  3BU2 A;  4KHP L;  2K5N A;  2CH4 W;  3B6Y A;  5EGT A;  3F2B A;  1I5F A;  1SFO H;  4XYO A;  4JI8 L;  2LS0 1;  4HIM A;  5BR8 L;  2Q8I B;  1GUT A;  3M9B A;  4LFC L;  3KF8 A;  1YJN A;  2C5C A;  4LUV A;  1AP0 A;  2ICI A;  3W5O A;  3J7Z C;  4A76 A;  1OTC A;  3M4O B;  3S2H H;  2WFW A;  1VQB A;  4X3K A;  2EDG A;  4A3G B;  2RQX A;  2FHT A;  3CW2 C;  3H91 A;  1TS3 A;  1V43 A;  4QGU A;  3CU7 A;  4L5R C;  2M00 A;  4JYA Q;  1SXT A;  1YHQ A;  5FKA C;  2IT1 A;  2XRQ D;  1F9P A;  4FNF A;  3KYH C;  3BVG A;  3PF4 A;  3D4R A;  2A6H D;  1JQY D;  1C7Y A;  4IPC A;  2VXW A;  1YHB A;  2DJG C;  4QQB X;  2PQA B;  1HNW Q;  5C0X J;  2AUK A;  4DR2 Q;  3BVM A;  4I7A A;  4GN3 B;  1DOM A;  4X66 L;  5CMD A;  3I4N B;  2HHH Q;  3D6W A;  1VQI A;  1QUQ B;  3BDC A;  4UAI A;  1SNQ A;  3T56 B;  3J81 i;  4BA1 I;  2EJF C;  3KBX A;  4AH6 A;  4JCV E;  1QG7 A;  3MTS A;  1NMF A;  2F0J A;  1WTO A;  1TWF H;  1KAW A;  2J4X A;  1Y1V G;  3FKI B;  2RHS B;  4C3H H;  4DN4 M;  3NXW A;  3K0Y A;  1E22 A;  1XNR L;  3A8K E;  1LTR D;  1K83 B;  3T53 B;  2E5L L;  4G7H C;  1CHQ D;  2KCC A;  1XJV A;  3EJI A;  3FDT A;  2AQ1 B;  3MC0 B;  4DV5 L;  2ZXR A;  3MXP A;  2UXB Q;  4LF4 Q;  2VZA A;  3OOC A;  3RR5 A;  2RDF A;  4DV4 Q;  1X6O A;  2JA8 B;  4A3D H;  3ULJ A;  1WFQ A;  2JJQ A;  4DR6 L;  2VB2 X;  3T13 A;  3KK7 A;  4P71 A;  2JEA I;  1PYB A;  1RCV D;  3GTJ B;  1YEZ A;  1JE5 A;  5LL6 X;  1N32 Q;  1JJG A;  1JMC A;  5LMU L;  2EYF A;  5C0X I;  4WOR A;  4ZK9 B;  5J39 A;  1BVS A;  4DR5 Q;  1PZI D;  4YHH Q;  4H02 A;  4IPG A;  1V1Q A;  2ZTE A;  4XYQ A;  1WTV A;  1LTA D;  3CQZ B;  2OCE A;  3M4O H;  3KFU A;  4HID A;  5C4X B;  2K50 A;  3KJO A;  2LMC B;  5CV7 A;  4KY5 A;  1G6Z A;  1R9T B;  1A8V A;  4HJA A;  3HOZ G;  2A68 C;  3Q24 A;  1NCV A;  2NTT A;  2R61 A;  3M85 A;  1RJT A;  4CKE A;  1H9K A;  2D62 A;  1KRS A;  2DGY A;  3H6M A;  3DUZ A;  1TWA B;  4MZ9 A;  3J80 i;  1B44 D;  2QDL A;  3PO3 B;  1PZK D;  1UE5 A;  2MHV A;  3FVQ A;  3RZD H;  3OW7 A;  2O4X A;  4LWC A;  2YYZ A;  4JI7 Q;  1Y69 U;  3V2T A;  5C5M A;  1HA6 A;  3SHL A;  2NB0 A;  3I3C A;  4DXF A;  2RBM A;  4IUU A;  1JB7 A;  1ZYR D;  2XIW A;  3GD7 A;  1EY8 A;  1K8M A;  1O80 A;  5IWA L;  1H9S B;  2VQE L;  2UUC L;  1B2T A;  2TMP A;  3FKI H;  1H9M A;  3BZK A;  2F0S A;  2UXC Q;  4DFA A;  3V96 A;  3BDL A;  1VQ7 A;  1H9J A;  5JJL A;  1EEI D;  4OXP A;  1MHW C;  1CK1 A;  2NVQ H;  1GUO A;  1XTC D;  1K83 H;  3A7L A;  4I65 A;  5DEH A;  3PIO 3;  3HOV B;  3C1F A;  4DUZ Q;  1H95 A;  3H94 A;  1Q12 A;  1Y8N B;  3EN2 A;  5HGT A;  2DY8 A;  3TZD A;  3SE0 A;  4QMG A;  5GQO A;  4JC0 A;  3NE5 B;  2WKC A;  1EY9 A;  2KEE A;  4JI0 L;  3HOU B;  1X32 A;  5K5P A;  1KAA A;  2HUG A;  2UUA L;  2EJG C;  1D2B A;  1TU2 B;  1I6V C;  2OEO A;  5IP7 H;  2JA5 H;  4DPG A;  1VQ5 A;  3EFX D;  1WI5 A;  2XWB B;  4GLV B;  1V9P A;  4GLA C;  5IP9 G;  1EY4 A;  2Z6K A;  4HIO A;  1CKO A;  3CQZ H;  2B2V A;  5C4X H;  5K36 H;  2F0K A;  1F2Z A;  2K05 A;  3P75 A;  1S72 A;  4XXE A;  2IW3 A;  4DGZ A;  1IBK Q;  4OWX B;  1LUZ A;  2F0D A;  4L8J A;  3K81 C;  4A3J H;  1PH7 A;  2UU9 Q;  2F4V L;  2MNA A;  4F8M A;  1VMP A;  3G48 A;  2WP8 J;  3PO2 B;  2K33 A;  1EUJ A;  4DV3 L;  1X3P A;  4U67 3;  1Y8O B;  5EPL A;  2B2V C;  5LL6 S;  3DWQ A;  3X3N A;  1I94 Q;  4DV1 L;  2H4O A;  2K75 A;  1MSH A;  2R93 G;  1EIF A;  4B3T Q;  5EQ0 A;  3VDY A;  3D4D A;  4BY1 G;  2H1E A;  1J8I A;  2BE5 D;  1D6E C;  3E6Z X;  2KHS A;  5I9P A;  2PNH A;  2FIN B;  1WCM G;  1SYE A;  1HRJ A;  1QVF A;  3U4Z A;  4L5T A;  1L1O A;  1EU4 A;  1BBW A;  1S5F D;  3VYT A;  1IYU A;  1VQC A;  1HFN A;  2HIV A;  2WKD A;  3RZO H;  1KIX A;  2K1B A;  2B63 B;  4O2D A;  4C2M B;  3WOF A;  3J81 L;  3K58 A;  1W6K A;  3HG9 A;  3H0G G;  1TY0 A; 
#chains in the Genus database with same CATH homology
 4PZ6 A;  3G6E A;  4PMW A;  4X65 L;  5IT9 c;  4LF8 Q;  1FGU A;  3I4N H;  1PFS A;  3F8T A;  3I7F A;  4LF6 Q;  4QY7 A;  1Q86 C;  1N34 Q;  5M5W H;  4AYB G;  1YIJ A;  3G4S A;  4A3D G;  1S40 A;  4DR1 L;  3M7N A;  3FHW A;  4DV2 Q;  1I6H H;  1CSQ A;  5IYD H;  4RMF A;  1EQR A;  1B8A A;  1L1O C;  1NY4 A;  2JA7 G;  3PCO B;  3UE0 A;  2I5M X;  2MFI A;  2I5H A;  1VQJ A;  1PH6 A;  1P8L A;  2R6G A;  1HJP A;  3UDF A;  4TVA B;  3CCJ A;  1OXS C;  4YCV A;  5IYC H;  3PIO A;  2N78 A;  5H1S E;  3HOX H;  4LF7 L;  2VY3 A;  4JYA L;  3PUV A;  2ZM6 Q;  1IYJ B;  4JOI C;  3OTO L;  1X56 A;  1Y1V H;  2NVT H;  1PHJ A;  4HIK A;  3H3V I;  1PH8 A;  3S16 H;  2HT1 A;  4DV0 L;  3KF6 A;  4JI6 L;  1JJC B;  1CKM A;  1Z9F A;  2F3I A;  4L5S A;  1E7Z A;  3M4P A;  1IZ6 A;  2YV5 A;  1PH1 A;  1HNW L;  3CME A;  4DR2 L;  1SRU A;  2OQ0 A;  4YY3 L;  4LFB L;  5C44 H;  2HHH L;  3F1Z A;  2R7Z G;  2OTL A;  1XPU A;  2JA8 H;  3PUX A;  5IWA Q;  4DR3 L;  2Z0S A;  4BBR G;  3AEV A;  2OTJ A;  2VQE Q;  2UUC Q;  5ELO A;  4A3C H;  4C3I H;  1K3R A;  4LW1 A;  5GAH C;  4DV6 Q;  3T1H L;  1HR0 W;  3K80 C;  3H0G G;  4KLK A;  5HY6 A;  3H15 A;  1VQK A;  4ME3 A;  3GTJ H;  3TEH B;  2ZJP A;  2AWO A;  2A1A A;  1G6P A;  2Q2U A;  3K0X A;  3U58 A;  1HNZ Q;  2UUB L;  1HZC A;  5IY0 A;  3CCV A;  1WOC A;  4JI2 L;  3PV0 A;  1GKH A;  1D8L A;  5EAY A;  4YCW A;  2IY5 B;  1AH9 A;  2IHE A;  1C9O A;  1I3Q H;  5GAD C;  2NVX H;  4GKK Q;  4A3B H;  4RG1 A;  1CUK A;  4GN5 A;  2JA6 G;  4TQU S;  3HOW G;  2NZH A;  4LFB Q;  1WJJ A;  4DUY Q;  4A93 G;  1CKN A;  1YI2 A;  4DAY B;  4R4C A;  2WAQ E;  4XIG S;  5FLM G;  1VQP A;  5FJ8 G;  4OX9 Q;  4BBS G;  5GAE C;  4MNO A;  4OO1 G;  1NE3 A;  1KQS A;  1FJG Q;  4LF4 L;  2UXB L;  1R9T H;  2YTX A;  1U0L A;  3DM3 A;  1UWV A;  2IX1 A;  3FKI G;  4X62 L;  4DV4 L;  1JJ2 A;  4IJH A;  2YTV A;  4JI4 L;  1OXT A;  2ZTC A;  5IYB G;  1EFW A;  1W2B A;  2BH8 A;  3KF8 B;  1TWA H;  2AMC B;  3HOZ H;  4P72 A;  2RCN A;  1X3G A;  2AHO B;  4JI5 L;  1E1O A;  1YJW A;  1VQN A;  1Y14 B;  4PZ8 A;  4JBJ A;  3TRE A;  1VQ9 A;  4LF9 Q;  3PO3 H;  4R4Q A;  1G51 A;  2VNU D;  4YWM A;  4MTN A;  1K73 C;  3A0J A;  1YHA A;  1K8A C;  3CP0 A;  4B3R Q;  1N32 L;  1LTL A;  3I56 A;  4JI3 Q;  3GDE A;  2VW9 A;  4DK3 C;  2WB1 E;  3D0F A;  4A3K G;  2GN5 A;  3WWV A;  4O0A A;  1M90 C;  1HNX Q;  4DR5 L;  3OW2 A;  4NXM Q;  4YHH L;  3KJP A;  1AE2 A;  1JT8 A;  3NEM A;  4KHZ A;  1VQ4 A;  1EWI A;  4X62 Q;  4IOA A;  3BJU A;  3HOY G;  1QVG A;  4JI4 Q;  1VCI A;  5JEA G;  1MKH A;  3CF5 A;  2F4V Q;  1XTD A;  4AQY Q;  2JA7 H;  1GD7 A;  1A63 A;  1Y1W H;  2R7F A;  2JA5 G;  2N8N A;  1GVP A;  1DGS A;  1HZB A;  2Q2I A;  1MJC A;  4UP7 A;  2PMZ E;  3JAM i;  4KI0 A;  1SLJ A;  2D0P A;  4LFA L;  5DLQ E;  1OXX K;  2H5X A;  2R7D A;  4A3E H;  4DV3 Q;  1XMO Q;  2A19 A;  3CAM A;  1X55 A;  4A3I G;  1UEB A;  4UPA A;  4GOP C;  3HOV H;  1U5K A;  4DV1 Q;  4X6A H;  4NXN L;  2R92 G;  1EYG A;  1KRT A;  5C4J H;  1XMQ L;  3CD6 A;  5K36 G;  1SMX A;  4A3L G;  2IHF A;  4JOI A;  3GTL H;  2CFM A;  1N33 Q;  4JI7 L;  3NBH B;  3CCM A;  5C3E G;  1VQE A;  2IX0 A;  2HQL A;  2ZTD A;  4DV7 Q;  3W1B A;  1J5E Q;  1SRO A;  4B3M Q;  1PV4 A;  3HOU H;  2MO0 A;  1EQQ A;  2RHQ B;  4A3J G;  4GN4 B;  5LMN Q;  1YVC A;  4A3M G;  1Q8K A;  2KHJ A;  4A3F G;  3KLW A;  2QGQ A;  3T1Y L;  2UXD L;  3KDF B;  2D0O A;  1YIT A;  4GKJ Q;  1KHI A;  4GOP B;  1NJI C;  4BY7 G;  2B29 A;  1S3O A;  3NEN A;  2LSS A;  2KEN A;  4LUZ A;  2UXC L;  1YNX A;  1Z47 A;  3HKZ E;  3JC6 6;  3STB D;  2ASB A;  1EOV A;  5J3B A;  1E24 A;  1T9H A;  2ZJR A;  3BU2 A;  4POG A;  4KHP L;  2K5N A;  3F2B A;  1PYS B;  2PI2 E;  3B6Y A;  1I5F A;  1SFO H;  1IBL Q;  1EIY B;  1K0R A;  3CC2 A;  2ES2 A;  1YZ6 A;  4JI8 L;  4DUZ L;  4HIM A;  3ULL A;  5IP9 H;  4X65 Q;  5BR8 L;  4BA2 I;  3M9B A;  4LFC L;  1YJN A;  4YWK A;  4A93 H;  4IOC A;  4LUV A;  1X9N A;  4PG3 A;  4NB3 A;  3W5O A;  4DR1 Q;  3J7Z C;  3UE1 A;  4A76 A;  4A3G G;  1LYL A;  3MXN B;  1OTC A;  3I4M G;  4K0K L;  3GTM H;  1K9M C;  2VUM H;  3S2H H;  2WFW A;  1VQB A;  3AQQ A;  2ZJQ A;  3TS2 A;  1BKB A;  3JAM c;  5GRO A;  2DUD A;  3UDX A;  3CW2 C;  1IXR A;  4DR4 L;  1V43 A;  4EX5 A;  4X64 L;  4QGU A;  3W1G A;  4L5R C;  3HKS A;  3PO2 H;  4BXX G;  4JV5 L;  5IE8 A;  4JYA Q;  4LUO A;  4LF7 Q;  1YHQ A;  2LXK A;  3OTO Q;  3I4O A;  2IT1 A;  4JBW A;  2E2I H;  1MIU A;  3L0O A;  5FLX c;  3KYH C;  4XTC S;  1VQO A;  3CCQ A;  3PF4 A;  4DV0 Q;  2OQK A;  4IFD J;  4JI6 Q;  2E8G A;  1KC8 C;  3RN2 A;  3TRZ A;  3AFQ A;  2NN6 I;  4IPC A;  1C7Y A;  3I4N G;  1J6Q A;  1YHB A;  1X3E A;  2GVB A;  4QQB X;  2BA1 A;  2PQA B;  1HNW Q;  5C0X J;  2AWN A;  4DR2 Q;  2R93 H;  3PIP A;  3RN5 A;  4GN3 B;  4X66 L;  2KCM A;  4YY3 Q;  4HJ7 A;  3CPW A;  5IYD G;  2HHH Q;  2YU9 H;  4BY1 H;  3H3V H;  3ICE A;  4DR3 Q;  1RIP A;  1VQI A;  3S24 A;  2K14 A;  4QJF A;  1FL0 A;  1MJE A;  1IBK L;  1QUQ B;  3L2P A;  2C35 B;  2CWA A;  3E9I A;  3J81 i;  4A75 A;  3T1H Q;  3GTK H;  1X65 A;  4BA1 I;  1PH2 A;  4AH6 A;  2UU9 L;  1WCM H;  1UE1 A;  3GO5 A;  4JCV E;  4R4I A;  4JI1 L;  5IYC G;  4LF5 L;  2AKW B;  1NMF A;  4J15 A;  1CSP A;  1TWF H;  3HOX G;  5LMN W;  1IBM L;  1KAW A;  5M3M G;  3M3Y H;  1VQD A;  2UUB Q;  4YCU A;  1Y1V G;  2RHS B;  1ASY A;  2Y0S E;  4JI2 Q;  4C3H H;  4B3S L;  2B63 H;  4JG2 A;  1Q82 C;  4UP9 A;  5GAG C;  1E22 A;  4C2M H;  4HJ8 A;  3PF5 A;  3TQY A;  1XNR L;  2A8V A;  1I94 L;  4LNQ A;  1L2F A;  2BA0 A;  3KDF A;  2WAQ G;  4R4T A;  2E5L L;  4P74 A;  4GOP A;  3J81 j;  4OWT B;  3DLL A;  3H0G H;  4B3T L;  1XJV A;  5C3E H;  5C44 G;  4DV5 L;  3EIV A;  2JA8 G;  4P73 A;  1HZ9 A;  2MO1 A;  1VQ6 A;  2UXB Q;  4L5Q A;  4LF4 Q;  2VZA A;  4JBK A;  3K7A H;  2B3G A;  4DR7 L;  1HR0 L;  3RR5 A;  4R1J A;  3FP9 A;  1X6O A;  4IPH A;  2QA4 A;  4DV4 Q;  4A3D H;  3ULJ A;  1WFQ A;  2QEX A;  3PUZ A;  2JJQ A;  1IBM Q;  4DR6 L;  2YTY A;  3E0E A;  3EBE A;  1D7Q A;  3U4V A;  2I5L X;  3NEL A;  4R4O A;  4P71 A;  2HIX A;  4JI5 Q;  5IP7 G;  2JEA I;  1PYB A;  2Z6K C;  2FXQ A;  1A0I A;  1NTG A;  4C3J H;  3A5Z B;  4HJ9 A;  1YEZ A;  2WB1 G;  4IFD I;  1JE5 A;  3L7Z C;  2XGT A;  1N36 L;  1ASZ A;  3M4Q A;  1JMC A;  1N32 Q;  1JJG A;  4A3B G;  5AJ3 L;  3HFZ B;  5LMU L;  5C0X I;  3PUY A;  4NPS A;  1AE3 A;  3J7A 5;  1BVS A;  4DV5 Q;  4DR5 Q;  2EQS A;  5HGQ A;  2F52 A;  3G71 A;  5C4X G;  4YHH Q;  2I0Q A;  4H02 A;  4IPG A;  1V1Q A;  2ZTE A;  5M5Y H;  3U50 C;  3M4O H;  1VS0 A;  2OCE A;  3KFU A;  4HID A;  2K50 A;  3KJO A;  4LF6 L;  3I4M H;  3J81 c;  1N34 L;  3K8A A;  1XPO A;  4DV2 L;  2NN6 G;  4GNX B;  2BH2 A;  4EQ5 A;  2R7Z H;  4AYB E;  3KOJ A;  1A8V A;  4HJA A;  4BBR H;  2N49 A;  3HOZ G;  5M3F G;  1CKN B;  3S14 H;  4POF A;  4LFA Q;  3M85 A;  2NZO A;  2PQA A;  4QIW E;  2EIF A;  2D62 A;  3GTG H;  3PO3 G;  3ER0 A;  3PSI A;  1KRS A;  2DGY A;  4MZ9 A;  1IL2 A;  2JE6 I;  3J80 i;  1YBY A;  4ALP A;  3SGI A;  4NXN Q;  2ZM6 L;  1UE5 A;  4HJ5 A;  3S15 H;  2GVA A;  1XMQ Q;  1QUQ A;  1BBU A;  2CQO A;  3OYY A;  3RZD H;  3S2D H;  2VS1 A;  2KCT A;  4LWC A;  2YYZ A;  2VL6 A;  4JI7 Q;  1PH3 A;  4Y52 H;  2JA6 H;  3HOW H;  3MEF A;  3CCS A;  1M1K C;  1QZH A;  2Q2H A;  1JB7 A;  2E2J H;  3GD7 A;  5FLM H;  5FJ8 H;  1Y1W G;  4BBS H;  3BZC A;  2K5H A;  2KBN A;  4APV A;  5IWA L;  3T1Y Q;  2UXD Q;  3UDG A;  1O7I A;  2VQE L;  2UUC L;  1TXY A;  3HKZ G;  3FKI H;  1L0W A;  4DV6 L;  4A3E G;  3BZK A;  2UXC Q;  2CKZ B;  5E7N A;  5M5X H;  4GLX A;  2N3S A;  4OWW B;  2NVY H;  5M3M H;  5IYB H;  3A5U A;  1VQ7 A;  2CCZ A;  5JJL A;  3HOV G;  2OWO A;  2ALY B;  1VQF A;  4OXP A;  1HNZ L;  4KHP Q;  2NVQ H;  1K83 H;  3S1Q H;  2UU9 Q;  4JI8 Q;  2L15 A;  1E3P A;  4DUZ Q;  1TWH H;  1XNQ L;  1H95 A;  5BR8 Q;  2RF4 A;  1PVO A;  3IRB A;  4IJL A;  1Q12 A;  4GKK L;  1L1O B;  3EN2 A;  4A3K H;  3PGZ A;  4LFC Q;  4IFD G;  1P16 A;  3HOU G;  3CXC A;  1HH2 P;  5GQO A;  4DUY L;  1SE8 A;  3CPF A;  4JC0 A;  3CC7 A;  2E2H H;  3CCL A;  1KL9 A;  4DK6 C;  5C0X G;  4QL5 A;  4K0K Q;  4OX9 L;  4JI0 L;  2ID0 A;  3RLO A;  1FJG L;  3HOY H;  5JJK A;  1Q81 C;  2UUA L;  1SR3 A;  4LF5 Q;  4DR4 Q;  3S1N H;  2JEB I;  4X64 Q;  3LGJ A;  3D31 A;  3J80 c;  3S17 H;  4JV5 Q;  3Q8D A;  3TS0 A;  4AIM A;  1B7Y B;  5IP7 H;  1VQL A;  2JA5 H;  1UE7 A;  1KXL A;  4LF9 L;  4PZ7 A;  1WYD A;  4DPG A;  3ULP A;  1VQ5 A;  1WI5 A;  1XNQ Q;  4A3I H;  4GLV B;  2K52 A;  1V9P A;  4GLA C;  1W3S A;  1VQG A;  2Z6K A;  5IP9 G;  4GNX A;  4B3R L;  4HIO A;  1CKO A;  4JI3 L;  1VQM A;  3CQZ H;  2R92 H;  1Q1B A;  5C4X H;  1E1T A;  4IO9 A;  2LXJ A;  4A3L H;  4X66 Q;  3RLF A;  1HNX L;  1VQH A;  2JK8 A;  5ELN A;  1GM5 A;  4JI0 Q;  4NXM L;  4YWL A;  4DKA C;  2VUM G;  2UUA Q;  1I50 H;  1IBK Q;  1A62 A;  4OWX B;  1LUZ A;  4DNI A;  3K81 C;  4A3C G;  1HZA A;  4A3J H;  1PH7 A;  3UDI A;  3S1R H;  3KF6 B;  1B70 B;  1X3F A;  1X54 A;  1LM0 A;  4UP8 A;  4JI1 Q;  2MNA A;  2CWP A;  1UE6 A;  5M3F H;  2Y0S G;  4DAM A;  4A3F H;  1QZG A;  3PO2 G;  2EXD A;  3AFP A;  2KHI A;  2F4V L;  3G48 A;  2WP8 J;  4BY7 H;  1N9W A;  3ERS X;  4B3S Q;  1K8G A;  5JJI A;  2K4K A;  1EUJ A;  3CCE A;  4GNX C;  1XMO L;  4DV3 L;  1XPR A;  1NMG A;  1PH9 A;  1FVI A;  2ATW A;  3S1M H;  1OXU A;  1XNR Q;  3I2Z A;  2VQF L;  1OXV A;  1I94 Q;  2JQO A;  4DV1 L;  2JA9 A;  2K75 A;  2XTI A;  4UY8 C;  2E5L Q;  3K7U C;  1G29 1;  1PH4 A;  1QVC A;  2R93 G;  1EIF A;  3CMA A;  4B3T Q;  1Q1E A;  3VDY A;  4BY1 G;  1VQ8 A;  3GTP H;  3PUW A;  3ZJY C;  4JBM A;  1N33 L;  4A3M H;  3GTQ H;  3A74 A;  5JEA J;  4DV7 L;  4GS3 A;  4B3M L;  2MQH A;  1J5E L;  4P75 A;  3F2C A;  4FDB A;  3RNU A;  1HR0 Q;  4LF8 L;  4DR7 Q;  3CCR A;  1GO3 E;  3GTO H;  4IPD A;  2PNH A;  1VQA A;  4A3G H;  1C0A A;  2PI2 A;  1NBW A;  1WCM G;  5LMN L;  2V1C C;  4DR6 Q;  1SN8 A;  1QVF A;  1Q46 A;  1TWC H;  3U4Z A;  1PA6 A;  4L5T A;  1L1O A;  3I55 A;  1BBW A;  3F2D A;  4GKJ L;  1KD1 C;  4WJ3 M;  3CC4 A;  3CCU A;  2K5V A;  4A4I A;  1YJ9 A;  2B63 G;  1VQC A;  3RLN A;  2VQF Q;  2Q2T A;  1N36 Q;  4BXX H;  1TWG H;  1Q7Y C;  3STB C;  5AJ3 Q;  5LMU Q;  2HIV A;  1PH5 A;  3RZO H;  1KIX A;  4WJ4 A;  4AQY L;  3E9H A;  4O2D A;  4Y7N H;  1IBL L;  4OO1 I;  4OON A;  1N8R C;  1S72 A;  1RL2 A;  3AYH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...