1DXMA

Reduced form of the h protein from glycine decarboxylase complex
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
131
structure length
131
Chain Sequence
SNVLDGLKYAPSHEWVKHEGSVATIGITDHAQDHLGEVVFVELPEPGVSVTKGKGFGAVESVKATSDVNSPISGEVIEVNTGLTGKPGLINSSPYEDGWMIKIKPTSPDELESLLGAKEYTKFCEEEDAAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interaction between the Lipoamide-Containing H-Protein and the Lipoamide Dehydrogenase (L-Protein) of the Glycine Decarboxylase Multienzyme System. 2. Crystal Structure of H- and L-Proteins
pubmed doi rcsb
source organism Pisum sativum
molecule tags Oxidoreductases(acting on ch-nh2 donor)
molecule keywords H PROTEIN
total genus 35
structure length 131
sequence length 131
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01597 GCV_H Glycine cleavage H-protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1dxmA00
3OPOA 5KNCA 1ZKOA 3A8KE 1YNNC 3MFYA 4H44C 4XIGS 1DCZA 2YYZA 1VCIA 2BE5C 4OGQC 4DNRB 5JEAH 2DN8A 5C0XG 1T5EA 3BDOA 1IYUA 1QJOA 1I6VC 1OXTA 1V43A 4IFDG 1Q1BA 1GUGA 4RCNA 1H9SA 2Q8IB 3I4LA 1TU2B 2E75C 2PCFB 5BN5A 3BG3A 1LACA 1SMYC 1GJXA 4KN4C 2L5TA 4LK1C 1B9MA 3PV0A 3GD7A 3PUYA 3VA7A 3D4RA 3PUWA 3FPPA 2NN6I 4L8JA 1OXVA 3H94A 1H9MA 1DXMA 1V8QA 2KCCA 4BA1I 1FR3A 5BN3A 2PNRC 2E76C 3A7LA 3U9SA 3KLRA 3TZUA 1LABA 1E2WA 1G291 3A7AB 3QG1A 4H13C 1GUTA 2F1MA 1HPCA 1EWHA 5A35A 3I73A 3NE5B 1PMRA 4KKUA 4JK1C 1IW7C 3M7NA 4KMUC 1Y8PB 3VR4A 1E2VA 1VDZA 3D31A 3I72A 4G7ZC 4GZYC 3VR5A 4DK1A 1Q1EA 2A6HC 3OOCA 3VR3A 1IW7D 3DXJC 2A69D 3RLFA 1Y69U 3A8IE 1GUSA 2A68C 1VF5C 4TKOB 2AUKA 3MXUA 2O5IC 2A6HD 3T51B 3OW7A 4KI0A 1A6XA 3VR6A 2A6EC 1GHKA 4OO1G 1VF7A 3A8JE 4DNTB 1ZYRC 2LMCB 3P20A 2K32A 1K8MA 2BDOA 3CRLC 3IFTA 3PUXA 1CTMA 1CFMA 4LJZC 1Y8NB 3QJYA 4PV1C 2CW0C 1HCZA 2JE6I 3SE0A 2EJFC 1K8OA 2QF7A 4TQUS 3ND8A 5KNBA 4G7HC 1IYVA 1Q90A 3ND9A 1BDOA 2K7VA 3QIAA 1CI3M 1HTPA 2E74C 3LWUA 1OXUA 2D5DA 3GQBA 3L7ZC 4KKSA 2O5JC 1HQMC 1TKWB 2A69C 2BA0A 4DK0A 2B8GA 5C0XH 2NN6H 1GUNA 2JEBI 2NN6G 2AUJD 4XTCS 1Z7TA 4KN7C 3T53B 2BE5D 1OXSC 3PUVA 2ZT9C 1GHJA 3CRKC 2JXMB 3SDZA 4HR7B 2IT1A 2AWOA 3W3AA 4KKTA 4KHZA 4BA2I 2A6ED 2DNEA 3IKJA 3FMCA 1Z6HA 2D2CC 2K33A 3AB9A 5JEAG 2EVBA 4IQZA 5KNDA 1E2ZA 3PUZA 1OXXK 3HGBA 4IFDH 3T56B 2EJMA 4OO1H 1H9KA 1YNJC 2V4DA 2D62A 3M4YA 4H0LC 2B8FA 1H9JA 3EQLC 2KA7A 1DD2A 1GUOA 1Y8OB 2R6GA 3VR2A 4JBWA 2JEAI 2PPBC 1O7LA 4G7OC 1B9NA 2A68D 2EDGA 5K36H 5K36G 2DNCA 1H9RA 2EJGC 1O78A 4I7ZC 5BN4A 1FYCA 1ONLA 3WDNA 3M85A 3N6RA 2BA1A 1H9SB 1Q12A 3LNNA
chains in the Genus database with same CATH superfamily
3L0OA 4QL5A 1VQGA 3HKSA 3OPOA 1KTKA 3URYA 3MFYA 1SBBB 1DCZA 2LY7A 5AFWA 5EKIA 3HOYB 3BJUA 1K9MC 1EFWA 4UPAA 1HXYD 2RA4A 4DV1Q 1XPUA 3KOJA 4RCNA 3JAME 3TREA 1Y1VH 4CKEA 4A3LH 4CDEC 3H15A 5JJZA 4YWLA 3I4NG 1XTDA 4O0AA 3AEVA 2UUBQ 2I5HA 3UDFA 4OXPA 1I5FA 1RHPA 2QILA 2SOBA 4OO1I 4B3RQ 2PNHA 4NP5A 2E2DC 1YJWA 1C8CA 4LF5L 3HOVB 2NVTB 4KKUA 4QMGA 5KYIA 1WCMH 3EROA 3GDEA 1L0YB 3GTQH 1LT3D 1U0LA 3C1FA 3RLNA 4POGA 1Y69U 1L1OB 1XNQL 3KFUA 1QUQA 4C3IB 1TS2A 5ISRA 4OO1G 1YI2A 1ESFA 5EKLA 1R4QB 1PH6A 2HT1A 2LMCB 1SLJA 3IFTA 1NNXA 1XWEA 3N52A 3U4ZA 2K5QA 5JEAJ 1SMYD 1K8GA 3FEWX 1I4HA 3QIAA 3HOVH 1JORA 4KKSA 1VQ6A 4B3TQ 4A3JB 1X6OA 4XQJA 3S1QB 1A3VA 1VQ8A 3W3AA 3OYYA 3T1HQ 2UU9L 5IGEA 2JN4A 4JBJA 2QKIC 3UDIA 1UE7A 2D2CC 3KF6A 1IHZA 2RQXA 4DAYB 2CWPA 3GTGB 1JCKB 2RSOA 1PRTF 5DNFA 1XXGA 2B8FA 1UNSA 1P16A 3PGZA 1WTQA 3S1MB 2Q8RE 1SYBA 2F0TA 1TS4A 1BKBA 5G3LD 1CA5A 5BN4A 1FYCA 3G4SA 4TSSA 4LF7L 2IL8A 4RGMA 1S5DD 1H9SB 1YNJD 4FXGC 2KENA 2XWJB 4C3HG 1A3TA 2L0CA 4FYDA 2JA7B 3OIPA 2Y0SE 2ZXRA 4JC0A 1QE6A 4RGOS 3PO2H 4DV2L 3K80C 4OHJA 4R1JA 2WP8J 5IYDG 4YY3Q 3Q0AA 2G9HD 2F0HA 2F0QA 5NUCA 1FVIA 1K0SA 2B63H 2AMCB 1Y1WB 2ICEC 2Z4HA 2JA6G 1LTAD 4MZ9A 1AZQA 3CCQA 4LW1A 4CDFC 4X3TA 1LABA 2R7ZH 4H02A 1EFID 2WAQB 2VQFL 1LM0A 3J81i 3NE5B 3A55A 3PIP3 2J0TD 3T13A 1I4GA 1PRTD 1UE6A 3VR5A 4C3HH 1RL2A 2UUCL 4FO2A 1G91A 2GA4B 2K6AA 4RH6A 2DGYA 4GOPC 3A8IE 4DR5L 5EPKA 1XX8A 4UAIA 2P5ZX 1S40A 3ZJYC 2L9HA 1XMOQ 3A8JE 4M1UB 2PI2E 1D2BA 1HNZQ 3MXNB 1DOLA 4GS3A 3KLWA 3EBEA 3BYYB 1TWAH 1CTMA 4CJ2C 2LXJA 4DUYL 4AYBE 1EEID 4Q5VA 4O2DA 2EJFC 3PF5A 3ND8A 2CVRA 2RHSB 1VQ7A 5CBAE 1B2TA 3RZOH 2WAQG 1XPOA 5GQOA 4JI8L 1J8IA 4JI3Q 2A74C 1IBLQ 2AUJD 3EA6A 3PUVA 1YHQA 4QCLA 1HQRD 1FL0A 5ELDA 4MN3A 2EYFA 2FHTA 4HEDA 2AWOA 4DAYA 2K52A 3CCJA 4GKKL 1ASZA 1Y1WG 2AHOB 4AH6A 5I6YA 2C5CA 4JI7L 1Q3LA 1JJCB 2K03A 4JI0Q 4LFAQ 3ERSX 1NMFA 1EY0A 4IJLA 1K83H 3HGBA 4PQXA 2EJMA 1S5FD 1YNJC 2N49A 2NVXH 5M9OA 3EQLC 4C3IG 4N9PA 3BDLA 2R6GA 4Y7NB 1LUZA 3HOYH 3UDGA 1PH2A 4FVMA 3GTOH 4C3HB 3ITPA 4OWXB 4MHEA 3NBHB 5E7NA 1Q7YC 1XTCD 1IBKL 1I4XA 1F9SA 3G71A 4HCEA 4LF9Q 1B7YB 4CDCC 1VQMA 5JEAH 3IAYA 2CQAA 3S2DH 2KUMA 4QB4A 1WI5A 1Q1BA 3OMGA 4RHSA 5M3MH 2RDGA 3SGIA 4C1NI 1HZBA 2PW5A 2KHIA 5E4XA 2B2UA 1ET9A 4DNIA 5AJ3Q 2E2IB 1JJGA 2YU9H 1VMPA 1JB3A 3MC0B 3G6JB 5M3FG 2F0IA 1I6HB 1PH8A 1DYQA 1H9MA 2KCCA 4J8QA 1KRTA 3VA5A 3J80L 5HURA 1G2SA 1L1OA 2F0JA 2R7ZG 3RR5A 4IOAA 1EWHA 3E3XA 4DFAA 2DUDA 2CQOA 2L1BA 3JC66 1E2VA 1EYAA 1F9QA 1Q1EA 3DXJC 3V05A 1F9RA 4EQPA 3E6ZX 3R3OA 1DOKA 3S24A 1GKHA 3S9WA 1HFNA 2R92H 3CQZH 1NMGA 4RG1A 1WTHA 1MJCA 4ILWA 4A3DB 4A3IH 4CJ0B 4DNTB 2VQEQ 4UDUC 1Z9FA 3SXHA 1V1OA 3A5UA 2JE6I 4P73A 4POFA 1BVSA 1XYIA 1QB5D 1C48A 4YWKA 2H5XA 4K14A 2N78A 1RKNA 4M8AA 4B3TL 4IUVA 4JYAL 2RDHA 2YV5A 1NR4A 3VYTA 4GNXC 4BY7H 1PFNA 4ZKCB 4HR7B 4GNXB 5IYDH 3W1GA 4APVA 1I4QA 2WB1G 1Z6HA 3I4NB 4A3BH 3JAMi 1GO3E 4IQZA 4X64L 1A2TA 5J3BA 4CHTB 5I9PA 3M9BA 2MO1A 2V4DA 4X6AH 1JT8A 1OO9B 1Y8OB 1EOTA 1V9PA 1TWCB 1EU3A 5C4JH 3CCSA 1O78A 3C3LA 1ONLA 3CCUA 3SK6A 4A3FH 1W6JA 1Q12A 3FDTA 1BNZA 1PRTB 1SMXA 1SN8A 2AQ1B 3J7AF 4DNRB 3W1BA 1E3PA 3J80E 1U5KA 1QJOA 4KD3A 4DV6L 1RODA 1V43A 4IFDG 2I0QA 5DAUA 4JI1Q 3I4LA 2NVXB 1HRJA 2WFWA 2Q8TA 3NTIA 4A3DH 1A15A 1WOCA 2JA5G 4KN4C 5C4ZA 3NWSA 4DPGA 1IBML 2ZTEA 4LFBQ 2XIWA 4KTAA 1HNXQ 3VA7A 3JAMc 3PO2B 2L15A 4KJOA 4V190 2R93B 3EVQA 3KLRA 1SE8A 3QG1A 5C44B 3BVMA 3WOFA 2GVAA 4ME5A 1Y8PB 2KOLA 1IW7D 1B3QA 2CH4W 3RLFA 4PZ6A 1SJHD 2MNAA 5JVH3 1EQRA 2A6HD 1BUVT 4DR7Q 5C4HA 1KC8C 1MSHA 3P1HA 1CM9A 2Q2TA 2FJ2A 1WTVA 1F2MA 4GN3B 2CKZB 3BZKA 3CRLC 1VQCA 3DWPA 3PF4A 4GN4B 4L5QA 1JMCA 3HOZG 1EU4A 1BBWA 3CCRA 4OL7A 4LF6Q 1TR5A 5FLXL 1Q8IA 1EIHA 1E7ZA 3SEBA 2R93G 4RMFA 4ZUIA 3MXNA 1GUNA 5CV9A 1EWIA 3PO2G 1NY4A 5J39A 1C7YA 4KY6A 1IYJB 2IT1A 4B3SL 1PZKD 2DNEA 3H0GH 4HAEA 3FMCA 5IGDA 2QA4A 2D9UA 4IURA 4C2MB 1CHPD 3F1ZA 2EPBA 1BF4A 4AYBG 5K5PA 2PO4A 3DEPA 4IUQA 4TVAB 2EYOA 4J6HA 2PMZB 1B9NA 1BO0A 3STBD 2HCIA 2Z6KA 1A63A 1VQNA 1QVGA 4X3UA 5KNCA 3A8KE 1NR2A 3HG9A 2NVTH 1VQ4A 1EL0A 3KF8B 4OGQC 4P74A 1EY9A 2Z4IA 3HKZB 1MHWC 4L6TB 1W3SA 2E75C 3M3YH 5FJ8G 4OELB 2MHVA 4HJ9A 1UEBA 4RHRA 1LACA 4LK1C 3H09A 1S4ZA 2VXWA 1U4LA 2EY5A 3KK7A 1GM5A 2IW3A 2EYHA 2PI2A 4IOCA 3GTPB 3S15H 1R9TH 5EQ0A 3PIPA 2BH8A 5C3EB 3E9IA 2E76C 1CSQA 5E4WC 4DR1L 2MPMA 4O1NA 1E2WA 1RCVD 2F1MA 3K7AH 1XMQQ 4J15A 5I6WA 5A35A 1IW7C 1HUNA 4X66Q 1SNPA 1JWSD 1AEXA 1TWHB 3FP9A 5EBCA 3HOUG 5JJKA 5I4DA 1NE3A 4DF7A 1X32A 4B08A 2D0PA 3D6CA 1GUSA 1N36L 3NTKA 3FKIB 1STEA 2VQEL 2A6EC 4IUUA 4A3DG 4C3IH 1ZYRC 4KK7A 1YEZA 3CC7A 3IL8A 2AQ3B 2SDFA 1HUMA 1KD1C 1BR9A 4A3CG 5CV6A 2CW0C 2K28A 4X62L 3ND9A 2K7VA 1X54A 1HTPA 2O5JC 4A3MG 4R4OA 3NSWA 2ZXPA 4N8X1 1N32L 3MHBA 1QNKA 4E6IA 1QOHA 4WFN3 4DR3Q 3RN2A 3KBGA 1K8AC 1AE3A 1FJGL 5M3FB 2HD3A 1Q81C 2N3SA 1QILA 4DV0L 2YTXA 1MBYA 3RUZA 2K5NA 4C2MH 2A6ED 1JC7A 2N55A 1BCPF 2EYPA 1W2BA 1E2ZA 2OCEA 1I4PA 3T56B 1XMOL 4F7XA 5CV5A 1VQKA 1K83B 1QCBD 2KA7A 2GVBA 3NPPA 3CQZB 3G48A 3QOJA 4LF9L 1TY0A 4EVOA 5FO9B 1B44D 1H95A 3U9OA 3LNNA 1VMCA 4X3KA 2F3IA 2R7DA 3GTOB 5I2YA 2CFMA 1TWCH 4DR6Q 5C4XG 1J5EL 2MGSA 4K5XA 2OQKA 2RCNA 2R61A 3MFGA 3A54A 2VUMH 4A3KB 1V1QA 1D8LA 2NBFA 1GJXA 1ENCA 4JI7Q 3ICEA 1EQTA 2FXQA 3OHXC 2JA6H 4K2KA 3W5OA 5FK9C 1GOZA 2NN6I 1A2UA 4HJ8A 2KHJA 4A93B 4DV2Q 4ZK9B 4IFDJ 1K3RA 1G6PA 4DR3L 3OWEB 3GTKB 3NK9A 2A5HA 5LMNW 1PTOF 3RLOA 4ZYSA 1EY5A 1WTRA 3K59A 2R3ZA 4PMCA 1KXLA 5IY0A 3OOCA 3VR3A 2KQ3A 2EYMA 2GN5A 3ERQA 3D4WA 4DUYQ 4JBKA 3MZ5A 2A68C 1RDPD 4A3GH 1I3QB 3T51B 1R9TB 1HNWL 3GTPH 3T1YQ 1ILPA 5M3MB 4EQOA 2VUMG 3C2PA 1D1KA 4DV5L 2KVMA 3HRZC 2K32A 3S2HB 1A62A 1N36Q 2WIIB 1UE1A 1PH9A 1Y8NB 2JA9A 3QJYA 3CC4A 4TRDA 1X9NA 2BDNA 4JV5L 2Q2HA 2NVQH 1MI2A 2YTYA 3I4MH 3H3VC 3GQBA 4HIMA 3TEHB 5C4JB 1LTBD 3M4OB 2NN6G 2L55A 3DUZA 4KN7C 3NBHA 2ZT9C 4A3IG 2ZM6L 1ICWA 4NW2A 4XQQA 4BBSG 1PZJD 2B2VC 2JA6B 1NJIC 1Y1WH 2ZTDA 2O2LD 1U4MA 2Z8LA 5JPMC 3BS1A 4DV5Q 3SK4A 3S16H 4K6LA 1GUOA 4CJ1B 1KAWA 4YHHL 5K36H 3K5NA 3D8GA 3HEJA 3DM3A 4JCVE 2WKCA 3GTMB 3K8AA 2ATWA 3RZOB 1HR0W 3U58A 5TSSA 3KJOA 4HSPA 2AQ2B 1ZEQX 4XIGS 4LF5Q 3H6MA 4DAPA 2IHFA 3DWQA 4B3RL 3SK5A 3KDFB 3QR8A 4HIOA 1GUGA 4FXDA 2K5WA 2B2YA 2FINB 2O4XA 1S5BD 4ZLTF 1YZ6A 3HOZH 5EBDA 1KNAA 5C0XJ 3T4AC 3MA2B 5M3FH 3MVVA 5CV8A 2F0VA 4RAUC 1B50A 1HA5A 4Z9CB 3A7LA 4DR6L 4A3JG 2MUYA 4DXFA 1EQQA 2M2LA 4DAMA 4B3MQ 5IT9L 1O7IA 4BY1G 1D1IA 2DY8A 3WOEA 3BZDB 3VR4A 1PYWD 4LF6L 4G7ZC 1VDZA 5FKAC 1SYFA 3K5LA 5GAHC 3TN2A 3TRZA 2HHHQ 4HIDA 5HY6A 2F4VQ 1VF5C 4AQYL 1TWAB 2LXKA 1Y14B 2UUAQ 4F88A 4A3GG 2VS1A 2VNUD 4N9TA 3OW7A 5ELBA 3RZDH 1F2ZA 5DEHA 3PIO3 1YJNA 2BOSA 1K8MA 5HGQA 2JA7H 3QB3A 2HIVA 1HCZA 4QIWB 1ENAA 5JJIA 1LTGD 1HHVA 1Y1VB 4G7HC 1ET6A 4V0BA 4U673 1BCPD 3L7ZC 4A3MH 2DJFC 1X56A 5ELOA 3J81j 1PHJA 5IGGA 2UXCQ 4UP8A 4X3SA 5C3EH 3MAQA 4BY7G 2PQEA 1HNXL 5IGFA 5BR8Q 3E9HA 4K5WA 4OWWB 1IXRA 3IKJA 5JAVA 4LFCQ 1WJJA 5LL6S 5D65A 3C46A 2YTVA 1HR0L 3CMAA 2I5MX 3Q6SA 4IO9A 4MIUA 2EE1A 4K2LA 3HOYG 5K36G 2OTLA 1IKMA 1C4QA 3M85A 2C35B 4XT1B 4QUCA 4IZ8A 2XNAC 1MIUA 3CCMA 4RFBA 1D6EC 2DY7A 4QUFA 1VQAA 1VQ9A 2ID0A 2QEJC 1QWYA 1G6ZA 1T5EA 2OT2A 3BDOA 2F0FA 2K04A 2Q8IB 1UE5A 1PTOH 2F0EA 4DV3Q 3S1NH 1S3OA 5GAEC 1STGA 1LTLA 1SMYC 4DK6C 1CSPA 1SJED 4KHPQ 4DV7L 2JA8G 3H0GB 3U50C 4QY7A 4KHPL 1SNQA 4X65L 3KJPA 2VZAA 3FPPA 4FP5D 5IP9G 1SDFA 2OEOA 1WVLA 2HQEA 1C9OA 3JAML 3TS0A 1GUTA 5LMUQ 1MSGA 4GKJL 5J22A 1N33L 4XYQA 3S15B 5COYA 4KMUC 1HZCA 1HJPA 3NENA 2QCPX 3W2DA 4TKOB 3MTSA 4JPBW 3TS2A 1DM0B 4OONA 4DV4L 2EYLA 3E5SA 1HA6A 3D0FA 3F2BA 5M5YB 2WAQE 1JICA 1GD7A 4UHVA 3AFQA 3X3MA 4IPGA 2EZVA 1ZYRD 2RVLA 1WTXA 1PFSA 3I56A 3K58A 3DLLA 5BR8L 1JE5A 1Q46A 1Q8KA 4TQUS 2KBNA 2XGTA 3DEOA 4OIKA 2RCFA 5C5MA 4BY7B 2E74C 1OXUA 1CKNB 1KLUD 4AIMA 1O80A 2NN6H 3S1MH 3RD4A 4XTCS 4B9WA 3SVMA 1Z7TA 2MJ8A 2NVYB 5C0XI 1O7YA 5IODA 1PDQA 3CRKC 1BCPB 5CV7A 5JOBA 1B3AA 1QVFA 1Y1VG 2J4XA 5D3DA 2ZTCA 1B8AA 3K5OA 5LMNQ 4A3BG 3ULJA 4ALPA 5KNDA 1XNRL 1PTOC 1I50H 2MP1A 3J80i 4MTNA 1PRTC 4G57A 4HTHA 1KNEA 4LMQD 1VQPA 1F2YA 4JBWA 2PPBC 1O7LA 2JEAI 4A3GB 5M5WB 2DNCA 3MXPA 2CCZA 2HHHL 3QOLA 3K6OA 2XVSA 1IBKQ 3O13A 4DR2L 1BBUA 3SK8A 1K3BC 2E5LQ 2H1EA 3NQTA 2BE5C 3NHHA 3GV3A 2EXZA 5CORA 2JP1A 3KF6B 5KEEA 5C0XG 4QJFA 1JQYD 3KF8A 3L2PA 2Y0SG 4A76A 3CPWA 4NXNQ 1B1ZA 1WD1A 1SEBD 1ZXTA 5FO7B 1IBMQ 2E8GA 4JI0L 1VQBA 2F0LA 3UI2A 2RSNA 4A3EH 2EIFA 2KCMA 3PUWA 5IGBA 4DN4M 1V8QA 4JI5L 5BN3A 1I3QH 3ZYYX 2WINB 1RTOA 2R92B 1MD2D 2R7FA 1TWFB 4PNYA 1IZ6A 4JI8Q 2HCCA 1LYLA 4BY1H 1WYDA 5C3WA 4JK1C 1TXYA 5CR3A 5ELCA 2NVQB 1I6HH 5LL6X 4UP9A 1OTCA 1SYGA 4MNOA 3OIQA 2JQOA 3GTMH 4MTKA 1PYBA 4F87A 1SYCA 5IWAL 1N9WA 2K5HA 4DUZQ 4HN7A 2PMZE 4DKAC 4IUTA 3CF5A 2E2JB 2F0SA 1NUCA 3S2DB 4AQYQ 4RCOA 3P75A 1SNCA 3E0JA 4GNXA 2UUCQ 3S17H 2QF7A 4NB3A 1KABA 2EXDA 1HZ9A 3EN2A 3BZCA 5EPLA 2K14A 1HQMC 1M90C 2B8GA 5JPNC 4BBRG 3TP7A 3I4MB 1KHIA 4R9WA 4L5SA 1KDBA 1EOVA 4R8IA 1QZHA 1A3UA 2PW7A 3DWAA 4NXML 2EY1A 2Z9HA 2X6GA 1SE4A 2J7ZA 3NWTA 3TMEA 1X3FA 4HMJA 2VUMB 3E0EA 5M3MG 3T1YL 1KIXA 3HOWB 3LWEA 1EIGA 2KEEA 2SEBD 3PIOA 2FFKB 1E1OA 1LTID 3HOXB 1YNXA 1E1TA 1WTOA 4IPDA 4U68A 3S1QH 3I90A 4LUOA 1TS3A 1U4RA 1VCIA 2ICIA 3GTKH 1EIYB 2V1CC 3FRPB 1PXUA 1K0RA 1FNWA 1FD7D 1EYCA 4A93G 5BN5A 1PH7A 4FNFA 1JB7A 4DU9A 3BG3A 2QEXA 3A0JA 2B63B 4JI2Q 4A3FG 3T1HL 3TP6A 4G4KA 4LF4L 1N34Q 4BXXH 2IX0A 3TZUA 4IFDI 1G291 2K1BA 3CHBD 3IFDA 1HPCA 5IOCA 3G7LA 1TWHH 1X65A 1PH1A 3AU7A 2KECA 2IWHA 4FF3A 3HOUH 3Q23A 5KRUA 2PYKA 3HOXG 1KL9A 4A3EB 1STBA 5DM73 4FF2A 5M5WH 5E1FA 4LUZA 1WTPA 4LF8L 4A75A 1ASYA 3U4VA 2ZJPA 1BBXC 1PH4A 2F3VA 1WFQA 1VS0A 1GHKA 2XRSD 2ENBA 5IWAQ 2XRQD 3PCOB 1SE3A 3MEFA 1TVXA 5M5XH 1CFMA 4A3EG 4LJZC 4PV1C 4GKKQ 1CZGA 3BYTB 1X3EA 4XXEA 3OSOA 2IX3A 3CAMA 5EPJA 3V2TA 3I4MG 3I7FA 1JR0D 4BXXG 3VYUA 4LAAA 1OXSC 4NKLA 2QW7A 4X62Q 3J7YW 3BDCA 1TT2A 2XTIA 2NTTA 4FXKC 5ELNA 2B63G 2Z6KC 2K4KA 1I94Q 3I70A 2EVBA 1HNZL 1FGUA 4IJHA 5DM63 1H9KA 5IP9H 2IJ0A 2NVYH 2KEDA 3GP7A 1BXTA 1VQFA 3CKIB 4DR5Q 3RNUA 2HUGA 4YWMA 5JJLA 2N8NA 1EWCA 3K7UC 3ER0A 1TWGH 1YHAA 1YNNC 2UXDQ 3D6WA 1S72A 2PQAA 2K5VA 4WJWA 3HOWG 4CGYB 2VL6A 2HIXA 4NPSA 1U4PA 2B2TC 1IL8A 2UXBL 1XNRQ 4R4TA 2CHBD 2L5TA 1LT6D 2F0WA 3GD7A 4EX5A 2JYOA 5IIFA 4YY3L 1RD9D 4L8JA 1VQOA 4DGZA 3I3CA 2F0UA 4OIJA 1K73C 3HKZG 1FJGQ 3NELA 2PNRC 4PMBA 3J7ZC 1HZAA 1QNUA 3NTHA 1N32Q 4QGUA 3CU7A 1YNND 3KBXA 1BCPC 1SFOB 4WJ3M 1SYEA 4C3JG 5IP7G 2B2YC 2D0OA 1JWUD 2JK8A 5EGTA 4R4CA 2IPKD 1C0AA 2AUKA 3MXUA 5EAYA 1A6XA 1VQJA 1VF7A 1V1PA 1D5ZC 4R4QA 2CH4A 2YU9B 3NEMA 1EYDA 3CCEA 3HS0C 3DMUA 2UU9Q 1SE2A 3SR1A 1ML0D 1K8OA 4KHVA 2ZJQA 5KNBA 1D7QA 1IYVA 1Q90A 2B29A 1CT1D 1VQ5A 3EJIA 2B2WA 1SFOH 2NZHA 1XMQL 3M4OH 5C44H 2JEBI 5C3XA 2FMMA 5C5LA 1GHJA 3OTOL 2G9DA 2L11A 4X65Q 1VQHA 2B3GA 3HOZB 1B4OA 2B2UC 4GLAC 2K33A 2PQAB 1CKOA 4K0KL 3OWFA 1PZID 2NTSA 3S1NB 1YHBA 1SAPA 1GVPA 4DUZL 2RHQB 2I46A 2D62A 4YCUA 3L3OC 1M8AA 1XNQQ 3M4QA 3H3VH 5IT9c 3TSSA 2EDGA 1RJTA 2KHSA 4IALA 4I7ZC 1EY4A 1NCVA 2F0NA 3VDYA 2C9OA 3WWVA 1PV4A 4HJ7A 4LNQA 3PO3H 4UY8C 4B9XA 1F2LA 5C44G 1UWVA 3NQIA 1NSNS 2DN8A 3NP8A 5C6AA 1I6VC 1OXTA 1MKHA 2MO0A 4A93H 4NDXA 4HIKA 2E2IH 4RKLA 2UUBL 3M4PA 4LFCL 1LO5D 1STHA 4A3BB 3B6YA 2JA5B 1WCMB 2A73B 3QWNA 3RN5A 3A5ZB 4NXNL 1DGSA 1A8VA 4ZKBB 1JE4A 4BA1I 4FF4A 4DV6Q 4DAVA 3F2DA 4OEMB 1YBYA 3AQQA 3I91A 2F0DA 4JG2A 3J81c 4KJNA 4BS9A 5I9OA 1AP0A 1JOOA 4A3CH 1IL2A 2F52A 1VQIA 4CDDC 4P71A 4DR2Q 2WACA 2VB3X 1EQVA 2AWNA 3MEHA 4FF1A 4JI6L 1NTGA 2H4OA 2F3WA 5M5XB 1I4RA 1NBWA 2NZ1D 1X3PA 2Z0SA 3VR6A 3CCVA 2IY5B 3GTJB 4X64Q 3CW2C 1VQLA 1FNUA 4OX9L 4K0KQ 1ESRA 2WB1B 1PA6A 1L1OC 2WV6D 1GXDC 4XT3B 2L12A 5D3IB 2HDMA 1BDOA 4JYAQ 4WRDA 4DK0A 3L9AX 4K8JA 3R2IA 2ZXOA 5FJ8H 3Q24A 1WCMG 1U9RA 1KRSA 3VYSA 4IN3A 2EY6A 4BWGB 3PUZA 3GTJH 4JOIA 4JI1L 3BVGA 4H0LC 2I07B 3G6EA 4RKBA 1R4PB 4DV4Q 3VR2A 3F2CA 2K5DA 4ZAIA 2WKDA 4LWCA 3J7AV 3WDNA 3UDXA 5FO8B 1SXTA 1N33Q 4K6DA 4BY1B 2OF1A 4H44C 2KJXA 2R7ZB 1MGSA 2K50A 4YHHQ 4Y7NH 3S16B 4JVZA 2DJGC 4S3SA 4ABNA 2PZTA 3Q22A 3GV6A 1TS5A 5AJ3L 1ICFB 1O7ZA 4IUNA 4PMWA 4DK3C 1B9MA 1EIFA 1CZWA 4WJ4A 1LTSD 1TY2A 4DV3L 5E3FA 2NUCA 2SNSA 2E2HH 2LS01 1N8RC 2RF4A 3BU2A 2JSOA 1SROA 5T1GA 2N88A 3I73A 2NB0A 1K28A 1X3QA 3F2UA 4JV5Q 2B2TA 2B39A 1A0IA 2I5LX 4A3LG 2Q2IA 2JA5H 3GTLB 2OTJA 4DXGA 4BBRH 4R8NA 2E2JH 2VY3A 4QF4A 4QQBX 2ALYB 1HNWQ 3TZDA 3F8TA 3CD6A 3PUXA 1I94L 4ZRZA 1LTTD 4ODGA 3SHLA 5F2DA 5GADC 5DLQE 1B53A 4BBSB 4C3JB 1EEFD 4ZQ3A 3HOXH 3LWUA 4DA2A 3J7A5 1JWMD 1IBLL 3AYHB 2A69C 5FLMG 4JI4Q 1DJRD 3J81E 2UXCL 3OW2A 1MJEA 3HP3A 1M1KC 5HGTA 2JXMB 4IUPA 2NWGA 4RGTA 4HMIA 4KKTA 4BA2I 1NAPA 4RA8A 1G2TA 1UAPA 2OQ0A 2IX1A 1QVCA 1P8LA 1OXXK 3R93A 4A3KH 4IFDH 3CCLA 2RKSA 4WORA 2F0MA 2LFNA 2UUAL 3D4DA 5D14A 1SRUA 2UXDL 1WTWA 4NMZA 5ELEA 1LT5D 2F4IA 5I2XA 1ILQA 1ZKOA 1F77A 4J1MA 2ASBA 4EGVA 2VQFQ 3S1RH 5FLMH 1CQVA 3EFXD 4B3ML 1QG7A 1PYSB 1IYUA 2MQHA 4LF4Q 1HH2P 3K0YA 2HQLA 1TU2B 4JOIC 2K05A 2WB1E 1DOMA 4F8MA 2EYJA 4LFAL 3FPUB 2LKVA 3PV0A 2PZUA 3CPFA 4A3KG 3H94A 4A3IB 5IYBH 1DXMA 1EY6A 3K7AB 3A74A 1CA6A 4JI3L 3S14H 5FOBB 1J9OA 3S1RB 2JA7G 1RTNA 1TIID 2LSSA 3I55A 2F0OA 1SYDA 3D31A 4GZYC 3FHWA 1J6QA 3TDQA 4DK1A 4LF7Q 1CKMA 1KQSA 5J1ZA 2EQSA 4ZCKA 1BOSA 2EOTA 4I7AA 3KLSX 5KIXA 1L2FA 2K01A 3C1EA 3R8BA 4K8IA 2ES2A 4A4IA 3J81L 1G8ZD 2F03A 1UUPA 4KY5A 3PMFA 5IT9E 3D3RA 4XYOA 3ULPA 5G3LF 4LF8Q 3I4NH 1CQFA 3LX0A 5GAGC 3SE0A 1CKNA 3HFZB 2XSCA 2ZJRA 1EZ8A 2ZM6Q 4L5TA 1PH5A 1TKWB 4IPHA 2BA0A 5JVG3 2CWAA 1E24A 4C56C 5C0XH 1N34L 4A3MB 4XDXA 3OMCA 1EUJA 3GTGH 2JJQA 4KY7A 4A3FB 4JI2L 1CHQD 3T16A 1SR3A 3K5MA 2QDBA 1L0XB 3J80c 5CC4A 4GOPB 1RF2D 4RGNA 3UE0A 4Q0FA 3K57A 4OO1H 1B70B 4R4IA 1H9JA 4LUVA 1DD2A 1JOQA 1LT4D 2CW0D 5C4XB 3PQIA 5FLXE 4A3JH 1FGBD 3K81C 2EJGC 2JA8H 3GTLH 2BH2A 3EIVA 5EJWA 3GTQB 1PFMA 1TWGB 3NXWA 3HOUB 3AMUA 3TQYA 4O42A 3KDFA 1PLFA 3KYHC 1AZPA 3HOVG 4KV6A 2AKWB 4P75A 1FNVA 3FVQA 3X3NA 4JBMA 2TSSA 1S5CD 4PG3A 1SSOA 5C3EG 4JI5Q 2X6LA 3PSIA 1QUQB 4C3JH 2PCFB 4BBSH 3S17B 4JW0A 3LGJA 1ENFA 2VW9A 1KLGD 3K0XA 4NXMQ 4P72A 1HFGA 3TP5A 4ME3A 2F0GA 3PUYA 3H91A 4B3SQ 1Q82C 3D4RA 1YIJA 1OXVA 3H3VI 5EKKA 1QZGA 1FR3A 4BBRB 4H7BA 4DV1L 1DZ1A 1J5EQ 2XN9C 3AFPA 4IPCA 1T5XD 4ULLA 1LTRD 3U9SA 1X55A 2X69A 3A7AB 1LV9A 2L4NA 3M7GA 3M7NA 2NYZD 1PMRA 5IYCG 3HZXA 1V1PB 2SNMA 3I72A 3MWYW 3R2TA 3Q8DA 2QGQA 3S2HH 1SNDA 4EQNA 5GROA 4KI0A 4YCWA 1PTOB 5T1IA 1YVCA 3IRBA 2A1AA 5CBEE 3FKIG 1AFPA 5LMNL 2BCOA 3STBC 1SNMA 3ONAB 4EQ5A 1HTLD 2IHEA 2Z6BA 1DONA 2M9VA 5KYLA 1EYGA 4DV0Q 1KDCA 4KLKA 4PZ8A 3KUPA 1WD0A 1YITA 1PVOA 4N8FA 4GOPA 2R93H 3CP0A 2Q2UA 2R92G 4JI4L 3DM1A 2KCNA 1KDAA 3TBIB 2RDFA 3T53B 1D5XC 3HOWH 3I2ZA 2E2HB 1STNA 1EY8A 5KGUA 1PH3A 2EY2A 5LHY1 4YCVA 4LFBL 4KHZA 1G51A 2QDLA 2F0PA 4PZ7A 5JEAG 5CYUA 1CK1A 3AB9A 3QO2A 4CKCA 4UP7A 5C4XH 4FDBA 3RMHA 4KD4A 1II3A 2RBMA 1AW7A 3M4YA 2Y0SB 1BQQT 4OWTB 4DR4L 3MXGA 3FKIH 4HSVA 4G7OC 2A68D 1TQOA 1XJVA 1Q86C 2Z1CA 2E5LL 3N6RA 3P7JA 2BA1A 5A2QL 1KAAA 4X66L 5L37A 3CMEA 5LMUL 3PO3G 1Z47A 2B2VA 2YYZA 5CGKA 4DR1Q 1TWFH 4HJAA 1H9SA 2HDLA 4I65A 3TP8A 4AYBB 3RZDB 2FMCA 2M00A 4HCSA 4L63B 1D5MC 1STAA 3KLSA 5FLXc 3V96A 4Y52H 1CUKA 1GUWA 2F0KA 4QIWE 3UE1A 3OTOQ 3M3YB 2K75A 3DHQA 1JOKA 1SNOA 1AE2A 4P2CB 2MFIA 1VQEA 5ELFA 1X3GA 4H13C 1S5ED 4XQNA 3PO3B 5IE8A 2A19A 5IYCH 1YJ9A 2OXPA 2A8VA 3I8ZA 1VQDA 2A6HC 1STYA 4GN5A 4HJ5A 2A69D 4C1NK 1IKLA 3S14B 4GLVB 2O5IC 5CMDA 1M4VA 4DR4Q 3HKZE 3VYRA 5M5YH 1I50B 1HR0Q 3GO5A 3P20A 1AN8A 2BDOA 3BVZA 3I4OA 3CC2A 4GLXA 2XWBB 4CBVA 1L0WA 2G5DA 4K5VA 1JJ2A 1F9PA 1E0BA 4RWSC 1XPRA 1EZ6A 1CI3M 2OWOA 4GKJQ 2D5DA 4CKBA 5IGCA 1PFBA 2VB2X 2NZOA 2BE5D 3SDZA 2PZWA 5A2QE 3H0GG 2JA8B 4DV7Q 1E22A 4OX9Q 4YIJA 3CXCA 5CV4A 2TMPA 3NBIA 2UXBQ 5IYBG 1T9HA 3A56A 1W6KA 2B2WC 3ULLA 4DR7L 1LLRD 5H1SE 1UEAB 1PTOD 2F4VL 3NUCA 1H9RA 1EY7A 4L5RC 4JI6Q 1AH9A 1RIPA 2KCTA 4ID6A 4ZUJA 5IP7H
chains in the Genus database with same CATH topology
3OPOA 1KTKA 3URYA 3MFYA 1SBBB 1DCZA 2LY7A 5AFWA 5EKIA 3HOYB 1HXYD 2RA4A 4RCNA 3JAME 4CKEA 5JJZA 1RHPA 2QILA 2SOBA 4OO1I 4NP5A 2E2DC 1C8CA 2NVTB 3HOVB 4KKUA 4QMGA 5KYIA 3EROA 1L0YB 1LT3D 3C1FA 1Y69U 4C3IB 1TS2A 5ISRA 4OO1G 1ESFA 5EKLA 1R4QB 2LMCB 3IFTA 1XWEA 3N52A 2K5QA 5JEAJ 1SMYD 3FEWX 1I4HA 3QIAA 1JORA 4KKSA 4A3JB 4XQJA 3S1QB 1A3VA 3W3AA 5IGEA 2QKIC 2D2CC 1IHZA 2RQXA 3GTGB 1JCKB 2RSOA 1PRTF 5DNFA 1XXGA 2B8FA 1UNSA 1WTQA 3S1MB 2Q8RE 1SYBA 2F0TA 1TS4A 5G3LD 1CA5A 5BN4A 1FYCA 4TSSA 2IL8A 4RGMA 1S5DD 1H9SB 1YNJD 4FXGC 2XWJB 4C3HG 1A3TA 2L0CA 4FYDA 2JA7B 3OIPA 2ZXRA 1QE6A 4RGOS 4OHJA 2WP8J 3Q0AA 2G9HD 2F0HA 2F0QA 5NUCA 1Y1WB 2ICEC 2Z4HA 1LTAD 1AZQA 4X3TA 1LABA 1EFID 2WAQB 3NE5B 3A55A 3PIP3 2J0TD 3T13A 1I4GA 1PRTD 3VR5A 4FO2A 1G91A 2GA4B 2K6AA 4RH6A 3A8IE 5EPKA 1XX8A 4UAIA 2L9HA 3A8JE 4M1UB 1D2BA 1DOLA 3BYYB 1CTMA 4CJ2C 1EEID 4Q5VA 2EJFC 3ND8A 2CVRA 5CBAE 1B2TA 1J8IA 2A74C 2AUJD 3EA6A 3PUVA 4QCLA 1HQRD 5ELDA 4MN3A 2EYFA 2FHTA 4HEDA 2AWOA 4DAYA 5I6YA 2C5CA 1Q3LA 2K03A 1EY0A 3HGBA 4PQXA 2EJMA 1S5FD 1YNJC 5M9OA 3EQLC 4C3IG 4N9PA 3BDLA 2R6GA 4Y7NB 4FVMA 4C3HB 3ITPA 4MHEA 1XTCD 1I4XA 1F9SA 4HCEA 5JEAH 3IAYA 2CQAA 2KUMA 4QB4A 1Q1BA 3OMGA 4RHSA 2RDGA 4C1NI 2PW5A 5E4XA 2B2UA 1ET9A 2E2IB 1VMPA 1JB3A 3MC0B 3G6JB 1I6HB 2F0IA 1DYQA 1H9MA 2KCCA 4J8QA 3VA5A 3J80L 5HURA 1G2SA 2F0JA 1EWHA 4DFAA 2L1BA 1E2VA 1EYAA 1F9QA 1Q1EA 3DXJC 3V05A 1F9RA 4EQPA 3E6ZX 3R3OA 1DOKA 3S9WA 1HFNA 4ILWA 4A3DB 4CJ0B 4DNTB 4UDUC 3SXHA 1V1OA 2JE6I 1XYIA 1QB5D 1C48A 4K14A 1RKNA 4M8AA 4IUVA 2RDHA 1NR4A 3VYTA 1PFNA 4ZKCB 4HR7B 1I4QA 1Z6HA 3I4NB 4IQZA 1A2TA 4CHTB 5I9PA 2V4DA 1OO9B 1Y8OB 1EOTA 1TWCB 1EU3A 1O78A 3C3LA 1ONLA 3SK6A 1W6JA 1Q12A 3FDTA 1BNZA 1PRTB 2AQ1B 3J7AF 4DNRB 3J80E 1QJOA 4KD3A 1RODA 1V43A 4IFDG 5DAUA 3I4LA 2NVXB 1HRJA 2Q8TA 3NTIA 1A15A 4KN4C 5C4ZA 3NWSA 2XIWA 4KTAA 3VA7A 3PO2B 4KJOA 4V190 2R93B 3EVQA 3KLRA 3QG1A 5C44B 3BVMA 3WOFA 4ME5A 1Y8PB 2KOLA 1IW7D 3RLFA 1SJHD 5JVH3 2A6HD 1BUVT 5C4HA 1MSHA 3P1HA 1CM9A 2FJ2A 1WTVA 1F2MA 3CRLC 3DWPA 1EU4A 4OL7A 1TR5A 5FLXL 1Q8IA 1EIHA 3SEBA 4ZUIA 3MXNA 1GUNA 5CV9A 5J39A 4KY6A 2IT1A 1PZKD 2DNEA 4HAEA 3FMCA 5IGDA 2D9UA 4IURA 4C2MB 1CHPD 2EPBA 1BF4A 5K5PA 2PO4A 3DEPA 4IUQA 2EYOA 4J6HA 2PMZB 1B9NA 1BO0A 2HCIA 4X3UA 5KNCA 3A8KE 1NR2A 3HG9A 1EL0A 4OGQC 1EY9A 2Z4IA 3HKZB 4L6TB 2E75C 2MHVA 4RHRA 1LACA 4LK1C 3H09A 1S4ZA 2VXWA 1U4LA 2EY5A 3KK7A 2IW3A 2EYHA 3GTPB 5EQ0A 5C3EB 2E76C 5E4WC 2MPMA 4O1NA 1E2WA 1RCVD 2F1MA 5I6WA 5A35A 1IW7C 1HUNA 1SNPA 1JWSD 1AEXA 1TWHB 5EBCA 5I4DA 4DF7A 1X32A 4B08A 3D6CA 1GUSA 3NTKA 3FKIB 1STEA 2A6EC 4IUUA 1ZYRC 4KK7A 3IL8A 2AQ3B 2SDFA 1HUMA 1BR9A 5CV6A 2CW0C 2K28A 3ND9A 2K7VA 1HTPA 2O5JC 3NSWA 2ZXPA 3MHBA 1QNKA 4E6IA 1QOHA 4WFN3 3KBGA 5M3FB 1QILA 1MBYA 3RUZA 2A6ED 1JC7A 2N55A 1BCPF 2EYPA 1E2ZA 1I4PA 3T56B 4F7XA 5CV5A 1K83B 1QCBD 2KA7A 3NPPA 3CQZB 3QOJA 1TY0A 4EVOA 5FO9B 1B44D 3U9OA 3LNNA 1VMCA 4X3KA 3GTOB 5I2YA 2MGSA 4K5XA 3MFGA 2R61A 3A54A 4A3KB 2NBFA 1GJXA 1ENCA 1EQTA 3OHXC 4K2KA 5FK9C 1GOZA 2NN6I 1A2UA 4A93B 4IFDJ 4ZK9B 3OWEB 3GTKB 3NK9A 2A5HA 1PTOF 4ZYSA 1EY5A 1WTRA 3K59A 2R3ZA 4PMCA 3OOCA 3VR3A 2KQ3A 2EYMA 3ERQA 3D4WA 3MZ5A 2A68C 1RDPD 1I3QB 3T51B 1R9TB 1ILPA 5M3MB 4EQOA 3C2PA 1D1KA 2KVMA 3HRZC 2K32A 3S2HB 2WIIB 1Y8NB 3QJYA 4TRDA 2BDNA 1MI2A 3H3VC 3GQBA 5C4JB 1LTBD 3M4OB 2NN6G 2L55A 3DUZA 4KN7C 3NBHA 2ZT9C 1ICWA 4NW2A 4XQQA 1PZJD 2B2VC 2JA6B 2O2LD 1U4MA 2Z8LA 5JPMC 3BS1A 3SK4A 4K6LA 1GUOA 4CJ1B 5K36H 3K5NA 3D8GA 3HEJA 3GTMB 2WKCA 3RZOB 5TSSA 4HSPA 2AQ2B 1ZEQX 4XIGS 3H6MA 4DAPA 3DWQA 3SK5A 1GUGA 4FXDA 2K5WA 2B2YA 2FINB 2O4XA 1S5BD 4ZLTF 5EBDA 1KNAA 5C0XJ 3T4AC 3MA2B 3MVVA 5CV8A 2F0VA 4RAUC 1B50A 1HA5A 4Z9CB 3A7LA 2MUYA 4DXFA 2M2LA 5IT9L 1D1IA 2DY8A 3WOEA 3BZDB 3VR4A 1PYWD 4G7ZC 1VDZA 5FKAC 1SYFA 3K5LA 3TN2A 1VF5C 1TWAB 4F88A 2VNUD 4N9TA 3OW7A 5ELBA 1F2ZA 5DEHA 3PIO3 2BOSA 1K8MA 3QB3A 1HCZA 4QIWB 1ENAA 1HHVA 1LTGD 1Y1VB 4G7HC 1ET6A 4V0BA 4U673 1BCPD 3L7ZC 5IGGA 4X3SA 3MAQA 2PQEA 5IGFA 4K5WA 3IKJA 5JAVA 5LL6S 5D65A 3C46A 3Q6SA 4MIUA 2EE1A 4K2LA 5K36G 1IKMA 1C4QA 3M85A 4XT1B 4QUCA 4IZ8A 2XNAC 4RFBA 1D6EC 2DY7A 4QUFA 2ID0A 2QEJC 1QWYA 1G6ZA 1T5EA 2OT2A 3BDOA 2F0FA 2K04A 2Q8IB 1PTOH 2F0EA 1STGA 1SMYC 1SJED 3H0GB 1SNQA 3FPPA 4FP5D 1SDFA 2OEOA 1WVLA 2HQEA 3JAML 1GUTA 1MSGA 5J22A 4XYQA 3S15B 5COYA 4KMUC 2QCPX 3W2DA 4TKOB 3MTSA 1DM0B 2EYLA 3E5SA 1HA6A 5M5YB 1JICA 3X3MA 2EZVA 1WTXA 1ZYRD 2RVLA 3K58A 4TQUS 3DEOA 4OIKA 5C5MA 4BY7B 2E74C 1OXUA 1KLUD 1O80A 2NN6H 3RD4A 4XTCS 4B9WA 3SVMA 1Z7TA 2MJ8A 2NVYB 5C0XI 1O7YA 5IODA 1PDQA 3CRKC 1BCPB 5CV7A 5JOBA 1B3AA 2J4XA 5D3DA 3K5OA 5KNDA 1PTOC 2MP1A 1PRTC 4G57A 4HTHA 1KNEA 4LMQD 1F2YA 2JEAI 2PPBC 4JBWA 1O7LA 4A3GB 5M5WB 2DNCA 3MXPA 3QOLA 3K6OA 2XVSA 3O13A 3SK8A 2H1EA 3NQTA 2BE5C 3NHHA 3GV3A 2EXZA 5CORA 2JP1A 5KEEA 5C0XG 1JQYD 3KF8A 1B1ZA 1WD1A 1SEBD 1ZXTA 5FO7B 2F0LA 3UI2A 2RSNA 3PUWA 5IGBA 4DN4M 1V8QA 5BN3A 3ZYYX 2WINB 1RTOA 2R92B 1MD2D 1TWFB 4PNYA 2HCCA 5C3WA 4JK1C 5CR3A 5ELCA 2NVQB 5LL6X 1SYGA 3OIQA 4F87A 1SYCA 4HN7A 4IUTA 2E2JB 2F0SA 1NUCA 3S2DB 4RCOA 3P75A 1SNCA 3E0JA 2QF7A 1KABA 5EPLA 1HQMC 2B8GA 5JPNC 3TP7A 3I4MB 4R9WA 1KDBA 4R8IA 1A3UA 2PW7A 3DWAA 2EY1A 2X6GA 1SE4A 2J7ZA 3NWTA 3TMEA 4HMJA 2VUMB 3HOWB 3LWEA 1EIGA 2KEEA 2SEBD 2FFKB 1LTID 3HOXB 1WTOA 4U68A 3I90A 1TS3A 1U4RA 1VCIA 2ICIA 3FRPB 1PXUA 1FNWA 1FD7D 1EYCA 5BN5A 4FNFA 4DU9A 3BG3A 2B63B 3TP6A 4G4KA 2IX0A 3TZUA 4IFDI 1G291 2K1BA 3CHBD 3IFDA 1HPCA 5IOCA 3G7LA 3AU7A 2KECA 2IWHA 4FF3A 3Q23A 5KRUA 2PYKA 4A3EB 1STBA 5DM73 4FF2A 5E1FA 1WTPA 1BBXC 2F3VA 1GHKA 2XRSD 2ENBA 2XRQD 1SE3A 1TVXA 1CFMA 4LJZC 4PV1C 1CZGA 3BYTB 4XXEA 3OSOA 2IX3A 5EPJA 3V2TA 1JR0D 3VYUA 4LAAA 1OXSC 4NKLA 3J7YW 3BDCA 1TT2A 2NTTA 4FXKC 3I70A 2EVBA 5DM63 1H9KA 2IJ0A 2KEDA 3GP7A 1BXTA 3CKIB 2HUGA 1EWCA 1YNNC 3D6WA 4WJWA 4CGYB 1U4PA 2B2TC 1IL8A 2CHBD 2L5TA 1LT6D 2F0WA 3GD7A 2JYOA 5IIFA 1RD9D 4L8JA 4DGZA 3I3CA 2F0UA 4OIJA 2PNRC 4PMBA 1QNUA 3NTHA 3CU7A 1YNND 3KBXA 1BCPC 1SFOB 1SYEA 4C3JG 2B2YC 1JWUD 5EGTA 2IPKD 2AUKA 3MXUA 1A6XA 1VF7A 1V1PA 1D5ZC 2YU9B 1EYDA 3HS0C 3DMUA 1SE2A 3SR1A 1ML0D 1K8OA 4KHVA 5KNBA 1IYVA 1Q90A 1CT1D 3EJIA 2B2WA 2JEBI 5C3XA 2FMMA 5C5LA 1GHJA 2G9DA 2L11A 3HOZB 1B4OA 2B2UC 2K33A 3OWFA 1PZID 2NTSA 3S1NB 1SAPA 2I46A 2D62A 3L3OC 1M8AA 3TSSA 2EDGA 1RJTA 2KHSA 4IALA 4I7ZC 1EY4A 1NCVA 2F0NA 2C9OA 4B9XA 1F2LA 3NQIA 1NSNS 2DN8A 3NP8A 5C6AA 1I6VC 1OXTA 4NDXA 4RKLA 1LO5D 1STHA 4A3BB 2JA5B 1WCMB 2A73B 3QWNA 4ZKBB 1JE4A 4BA1I 4FF4A 4DAVA 3I91A 2F0DA 4KJNA 4BS9A 5I9OA 1AP0A 1JOOA 2WACA 2VB3X 1EQVA 2AWNA 3MEHA 4FF1A 2H4OA 2F3WA 5M5XB 1I4RA 2NZ1D 1X3PA 3VR6A 3GTJB 1FNUA 1ESRA 2WB1B 2WV6D 1GXDC 4XT3B 2L12A 5D3IB 2HDMA 1BDOA 4WRDA 4DK0A 3L9AX 4K8JA 3R2IA 2ZXOA 3Q24A 1U9RA 3VYSA 4IN3A 2EY6A 4BWGB 3PUZA 3BVGA 4H0LC 2I07B 4RKBA 1R4PB 3VR2A 2K5DA 4ZAIA 2WKDA 3J7AV 3WDNA 5FO8B 1SXTA 4K6DA 4BY1B 2OF1A 4H44C 2KJXA 2R7ZB 1MGSA 3S16B 4S3SA 4ABNA 2PZTA 3Q22A 3GV6A 1TS5A 1O7ZA 4IUNA 4PMWA 1B9MA 1CZWA 1LTSD 1TY2A 5E3FA 2NUCA 2SNSA 2LS01 2JSOA 5T1GA 2N88A 3I73A 2NB0A 1X3QA 3F2UA 2B2TA 2B39A 3GTLB 4DXGA 4R8NA 4QF4A 3TZDA 3PUXA 4ZRZA 1LTTD 4ODGA 3SHLA 5F2DA 1B53A 4BBSB 4C3JB 1EEFD 4ZQ3A 3LWUA 4DA2A 1JWMD 2A69C 1DJRD 3J81E 3HP3A 5HGTA 2JXMB 4IUPA 2NWGA 4RGTA 4HMIA 4KKTA 4BA2I 1NAPA 4RA8A 1G2TA 1UAPA 2IX1A 1OXXK 3R93A 4IFDH 2RKSA 4WORA 2F0MA 2LFNA 3D4DA 5D14A 1WTWA 4NMZA 5ELEA 1LT5D 2F4IA 5I2XA 1ILQA 1ZKOA 1F77A 4J1MA 4EGVA 1CQVA 3EFXD 1QG7A 1IYUA 3K0YA 1TU2B 2K05A 1DOMA 4F8MA 2EYJA 3FPUB 2LKVA 3PV0A 2PZUA 3H94A 4A3IB 1DXMA 1EY6A 3K7AB 1CA6A 5FOBB 1J9OA 3S1RB 1RTNA 1TIID 2F0OA 1SYDA 3D31A 4GZYC 3TDQA 4DK1A 5J1ZA 1BOSA 2EOTA 3KLSX 5KIXA 2K01A 3C1EA 3R8BA 4K8IA 3J81L 1G8ZD 2F03A 1UUPA 4KY5A 3PMFA 5IT9E 3D3RA 4XYOA 5G3LF 1CQFA 3LX0A 3SE0A 2XSCA 1EZ8A 1TKWB 2BA0A 5JVG3 4C56C 5C0XH 4A3MB 4XDXA 3OMCA 4KY7A 4A3FB 1CHQD 3T16A 3K5MA 2QDBA 1L0XB 5CC4A 1RF2D 4RGNA 4Q0FA 3K57A 4OO1H 1H9JA 1DD2A 1JOQA 1LT4D 2CW0D 5C4XB 5FLXE 1FGBD 2EJGC 5EJWA 3GTQB 1PFMA 1TWGB 3NXWA 3HOUB 3AMUA 4O42A 1PLFA 1AZPA 4KV6A 1FNVA 3FVQA 3X3NA 2TSSA 1S5CD 1SSOA 2X6LA 2PCFB 3S17B 1ENFA 1KLGD 1HFGA 3TP5A 2F0GA 3PUYA 3H91A 3D4RA 1OXVA 5EKKA 1FR3A 4BBRB 4H7BA 1DZ1A 2XN9C 1T5XD 4ULLA 1LTRD 3U9SA 2X69A 3A7AB 1LV9A 2L4NA 3M7GA 3M7NA 2NYZD 1PMRA 3HZXA 1V1PB 2SNMA 3I72A 3MWYW 3R2TA 1SNDA 4EQNA 4KI0A 1PTOB 5T1IA 5CBEE 1AFPA 2BCOA 1SNMA 3ONAB 1HTLD 1DONA 2M9VA 5KYLA 1KDCA 3KUPA 1WD0A 3DM1A 2KCNA 1KDAA 3TBIB 2RDFA 3T53B 1D5XC 2E2HB 1STNA 1EY8A 5KGUA 2EY2A 5LHY1 4KHZA 2F0PA 5JEAG 5CYUA 1CK1A 3AB9A 3QO2A 4CKCA 3RMHA 4KD4A 1II3A 2RBMA 1AW7A 3M4YA 2Y0SB 1BQQT 3MXGA 4HSVA 4G7OC 2A68D 1TQOA 2Z1CA 3N6RA 3P7JA 2BA1A 5A2QL 1KAAA 1Z47A 2B2VA 2YYZA 5CGKA 1H9SA 2HDLA 4I65A 3TP8A 4AYBB 3RZDB 2FMCA 2M00A 4HCSA 4L63B 1D5MC 1STAA 3KLSA 3V96A 1GUWA 2F0KA 3M3YB 3DHQA 1JOKA 1SNOA 4P2CB 5ELFA 4H13C 1S5ED 4XQNA 3PO3B 2OXPA 3I8ZA 2A6HC 1STYA 2A69D 4C1NK 1IKLA 3S14B 2O5IC 5CMDA 1M4VA 3VYRA 1I50B 3GO5A 3P20A 1AN8A 2BDOA 3BVZA 2XWBB 4CBVA 4K5VA 1F9PA 1E0BA 4RWSC 1EZ6A 1CI3M 2D5DA 4CKBA 5IGCA 1PFBA 2VB2X 2BE5D 3SDZA 2PZWA 5A2QE 2JA8B 4YIJA 5CV4A 2TMPA 3NBIA 3A56A 1W6KA 2B2WC 1LLRD 1UEAB 1PTOD 3NUCA 1H9RA 1EY7A 4ID6A 4ZUJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OPO A;  5KNC A;  1ZKO A;  3A8K E;  1YNN C;  3MFY A;  4H44 C;  4XIG S;  1DCZ A;  2YYZ A;  1VCI A;  2BE5 C;  4OGQ C;  4DNR B;  5JEA H;  2DN8 A;  5C0X G;  1T5E A;  3BDO A;  1IYU A;  1QJO A;  1I6V C;  1OXT A;  1V43 A;  4IFD G;  1Q1B A;  1GUG A;  4RCN A;  1H9S A;  2Q8I B;  3I4L A;  1TU2 B;  2E75 C;  2PCF B;  5BN5 A;  3BG3 A;  1LAC A;  1SMY C;  1GJX A;  4KN4 C;  2L5T A;  4LK1 C;  1B9M A;  3PV0 A;  3GD7 A;  3PUY A;  3VA7 A;  3D4R A;  3PUW A;  3FPP A;  2NN6 I;  4L8J A;  1OXV A;  3H94 A;  1H9M A;  1DXM A;  1V8Q A;  2KCC A;  4BA1 I;  1FR3 A;  5BN3 A;  2PNR C;  2E76 C;  3A7L A;  3U9S A;  3KLR A;  3TZU A;  1LAB A;  1E2W A;  1G29 1;  3A7A B;  3QG1 A;  4H13 C;  1GUT A;  2F1M A;  1HPC A;  1EWH A;  5A35 A;  3I73 A;  3NE5 B;  1PMR A;  4KKU A;  4JK1 C;  1IW7 C;  3M7N A;  4KMU C;  1Y8P B;  3VR4 A;  1E2V A;  1VDZ A;  3D31 A;  3I72 A;  4G7Z C;  4GZY C;  3VR5 A;  4DK1 A;  1Q1E A;  2A6H C;  3OOC A;  3VR3 A;  1IW7 D;  3DXJ C;  2A69 D;  3RLF A;  1Y69 U;  3A8I E;  1GUS A;  2A68 C;  1VF5 C;  4TKO B;  2AUK A;  3MXU A;  2O5I C;  2A6H D;  3T51 B;  3OW7 A;  4KI0 A;  1A6X A;  3VR6 A;  2A6E C;  1GHK A;  4OO1 G;  1VF7 A;  3A8J E;  4DNT B;  1ZYR C;  2LMC B;  3P20 A;  2K32 A;  1K8M A;  2BDO A;  3CRL C;  3IFT A;  3PUX A;  1CTM A;  1CFM A;  4LJZ C;  1Y8N B;  3QJY A;  4PV1 C;  2CW0 C;  1HCZ A;  2JE6 I;  3SE0 A;  2EJF C;  1K8O A;  2QF7 A;  4TQU S;  3ND8 A;  5KNB A;  4G7H C;  1IYV A;  1Q90 A;  3ND9 A;  1BDO A;  2K7V A;  3QIA A;  1CI3 M;  1HTP A;  2E74 C;  3LWU A;  1OXU A;  2D5D A;  3GQB A;  3L7Z C;  4KKS A;  2O5J C;  1HQM C;  1TKW B;  2A69 C;  2BA0 A;  4DK0 A;  2B8G A;  5C0X H;  2NN6 H;  1GUN A;  2JEB I;  2NN6 G;  2AUJ D;  4XTC S;  1Z7T A;  4KN7 C;  3T53 B;  2BE5 D;  1OXS C;  3PUV A;  2ZT9 C;  1GHJ A;  3CRK C;  2JXM B;  3SDZ A;  4HR7 B;  2IT1 A;  2AWO A;  3W3A A;  4KKT A;  4KHZ A;  4BA2 I;  2A6E D;  2DNE A;  3IKJ A;  3FMC A;  1Z6H A;  2D2C C;  2K33 A;  3AB9 A;  5JEA G;  2EVB A;  4IQZ A;  5KND A;  1E2Z A;  3PUZ A;  1OXX K;  3HGB A;  4IFD H;  3T56 B;  2EJM A;  4OO1 H;  1H9K A;  1YNJ C;  2V4D A;  2D62 A;  3M4Y A;  4H0L C;  2B8F A;  1H9J A;  3EQL C;  2KA7 A;  1DD2 A;  1GUO A;  1Y8O B;  2R6G A;  3VR2 A;  4JBW A;  2JEA I;  2PPB C;  1O7L A;  4G7O C;  1B9N A;  2A68 D;  2EDG A;  5K36 H;  5K36 G;  2DNC A;  1H9R A;  2EJG C;  1O78 A;  4I7Z C;  5BN4 A;  1FYC A;  1ONL A;  3WDN A;  3M85 A;  3N6R A;  2BA1 A;  1H9S B;  1Q12 A;  3LNN A; 
#chains in the Genus database with same CATH topology
 3L0O A;  4QL5 A;  1VQG A;  3HKS A;  3OPO A;  1KTK A;  3URY A;  3MFY A;  1SBB B;  1DCZ A;  2LY7 A;  5AFW A;  5EKI A;  3HOY B;  3BJU A;  1K9M C;  1EFW A;  4UPA A;  1HXY D;  2RA4 A;  4DV1 Q;  1XPU A;  3KOJ A;  4RCN A;  3JAM E;  3TRE A;  1Y1V H;  4CKE A;  4A3L H;  4CDE C;  3H15 A;  5JJZ A;  4YWL A;  3I4N G;  1XTD A;  4O0A A;  3AEV A;  2UUB Q;  2I5H A;  3UDF A;  4OXP A;  1I5F A;  1RHP A;  2QIL A;  2SOB A;  4OO1 I;  4B3R Q;  2PNH A;  4NP5 A;  2E2D C;  1YJW A;  1C8C A;  4LF5 L;  3HOV B;  2NVT B;  4KKU A;  4QMG A;  5KYI A;  1WCM H;  3ERO A;  3GDE A;  1L0Y B;  3GTQ H;  1LT3 D;  1U0L A;  3C1F A;  3RLN A;  4POG A;  1Y69 U;  1L1O B;  1XNQ L;  3KFU A;  1QUQ A;  4C3I B;  1TS2 A;  5ISR A;  4OO1 G;  1YI2 A;  1ESF A;  5EKL A;  1R4Q B;  1PH6 A;  2HT1 A;  2LMC B;  1SLJ A;  3IFT A;  1NNX A;  1XWE A;  3N52 A;  3U4Z A;  2K5Q A;  5JEA J;  1SMY D;  1K8G A;  3FEW X;  1I4H A;  3QIA A;  3HOV H;  1JOR A;  4KKS A;  1VQ6 A;  4B3T Q;  4A3J B;  1X6O A;  4XQJ A;  3S1Q B;  1A3V A;  1VQ8 A;  3W3A A;  3OYY A;  3T1H Q;  2UU9 L;  5IGE A;  2JN4 A;  4JBJ A;  2QKI C;  3UDI A;  1UE7 A;  2D2C C;  3KF6 A;  1IHZ A;  2RQX A;  4DAY B;  2CWP A;  3GTG B;  1JCK B;  2RSO A;  1PRT F;  5DNF A;  1XXG A;  2B8F A;  1UNS A;  1P16 A;  3PGZ A;  1WTQ A;  3S1M B;  2Q8R E;  1SYB A;  2F0T A;  1TS4 A;  1BKB A;  5G3L D;  1CA5 A;  5BN4 A;  1FYC A;  3G4S A;  4TSS A;  4LF7 L;  2IL8 A;  4RGM A;  1S5D D;  1H9S B;  1YNJ D;  4FXG C;  2KEN A;  2XWJ B;  4C3H G;  1A3T A;  2L0C A;  4FYD A;  2JA7 B;  3OIP A;  2Y0S E;  2ZXR A;  4JC0 A;  1QE6 A;  4RGO S;  3PO2 H;  4DV2 L;  3K80 C;  4OHJ A;  4R1J A;  2WP8 J;  5IYD G;  4YY3 Q;  3Q0A A;  2G9H D;  2F0H A;  2F0Q A;  5NUC A;  1FVI A;  1K0S A;  2B63 H;  2AMC B;  1Y1W B;  2ICE C;  2Z4H A;  2JA6 G;  1LTA D;  4MZ9 A;  1AZQ A;  3CCQ A;  4LW1 A;  4CDF C;  4X3T A;  1LAB A;  2R7Z H;  4H02 A;  1EFI D;  2WAQ B;  2VQF L;  1LM0 A;  3J81 i;  3NE5 B;  3A55 A;  3PIP 3;  2J0T D;  3T13 A;  1I4G A;  1PRT D;  1UE6 A;  3VR5 A;  4C3H H;  1RL2 A;  2UUC L;  4FO2 A;  1G91 A;  2GA4 B;  2K6A A;  4RH6 A;  2DGY A;  4GOP C;  3A8I E;  4DR5 L;  5EPK A;  1XX8 A;  4UAI A;  2P5Z X;  1S40 A;  3ZJY C;  2L9H A;  1XMO Q;  3A8J E;  4M1U B;  2PI2 E;  1D2B A;  1HNZ Q;  3MXN B;  1DOL A;  4GS3 A;  3KLW A;  3EBE A;  3BYY B;  1TWA H;  1CTM A;  4CJ2 C;  2LXJ A;  4DUY L;  4AYB E;  1EEI D;  4Q5V A;  4O2D A;  2EJF C;  3PF5 A;  3ND8 A;  2CVR A;  2RHS B;  1VQ7 A;  5CBA E;  1B2T A;  3RZO H;  2WAQ G;  1XPO A;  5GQO A;  4JI8 L;  1J8I A;  4JI3 Q;  2A74 C;  1IBL Q;  2AUJ D;  3EA6 A;  3PUV A;  1YHQ A;  4QCL A;  1HQR D;  1FL0 A;  5ELD A;  4MN3 A;  2EYF A;  2FHT A;  4HED A;  2AWO A;  4DAY A;  2K52 A;  3CCJ A;  4GKK L;  1ASZ A;  1Y1W G;  2AHO B;  4AH6 A;  5I6Y A;  2C5C A;  4JI7 L;  1Q3L A;  1JJC B;  2K03 A;  4JI0 Q;  4LFA Q;  3ERS X;  1NMF A;  1EY0 A;  4IJL A;  1K83 H;  3HGB A;  4PQX A;  2EJM A;  1S5F D;  1YNJ C;  2N49 A;  2NVX H;  5M9O A;  3EQL C;  4C3I G;  4N9P A;  3BDL A;  2R6G A;  4Y7N B;  1LUZ A;  3HOY H;  3UDG A;  1PH2 A;  4FVM A;  3GTO H;  4C3H B;  3ITP A;  4OWX B;  4MHE A;  3NBH B;  5E7N A;  1Q7Y C;  1XTC D;  1IBK L;  1I4X A;  1F9S A;  3G71 A;  4HCE A;  4LF9 Q;  1B7Y B;  4CDC C;  1VQM A;  5JEA H;  3IAY A;  2CQA A;  3S2D H;  2KUM A;  4QB4 A;  1WI5 A;  1Q1B A;  3OMG A;  4RHS A;  5M3M H;  2RDG A;  3SGI A;  4C1N I;  1HZB A;  2PW5 A;  2KHI A;  5E4X A;  2B2U A;  1ET9 A;  4DNI A;  5AJ3 Q;  2E2I B;  1JJG A;  2YU9 H;  1VMP A;  1JB3 A;  3MC0 B;  3G6J B;  5M3F G;  2F0I A;  1I6H B;  1PH8 A;  1DYQ A;  1H9M A;  2KCC A;  4J8Q A;  1KRT A;  3VA5 A;  3J80 L;  5HUR A;  1G2S A;  1L1O A;  2F0J A;  2R7Z G;  3RR5 A;  4IOA A;  1EWH A;  3E3X A;  4DFA A;  2DUD A;  2CQO A;  2L1B A;  3JC6 6;  1E2V A;  1EYA A;  1F9Q A;  1Q1E A;  3DXJ C;  3V05 A;  1F9R A;  4EQP A;  3E6Z X;  3R3O A;  1DOK A;  3S24 A;  1GKH A;  3S9W A;  1HFN A;  2R92 H;  3CQZ H;  1NMG A;  4RG1 A;  1WTH A;  1MJC A;  4ILW A;  4A3D B;  4A3I H;  4CJ0 B;  4DNT B;  2VQE Q;  4UDU C;  1Z9F A;  3SXH A;  1V1O A;  3A5U A;  2JE6 I;  4P73 A;  4POF A;  1BVS A;  1XYI A;  1QB5 D;  1C48 A;  4YWK A;  2H5X A;  4K14 A;  2N78 A;  1RKN A;  4M8A A;  4B3T L;  4IUV A;  4JYA L;  2RDH A;  2YV5 A;  1NR4 A;  3VYT A;  4GNX C;  4BY7 H;  1PFN A;  4ZKC B;  4HR7 B;  4GNX B;  5IYD H;  3W1G A;  4APV A;  1I4Q A;  2WB1 G;  1Z6H A;  3I4N B;  4A3B H;  3JAM i;  1GO3 E;  4IQZ A;  4X64 L;  1A2T A;  5J3B A;  4CHT B;  5I9P A;  3M9B A;  2MO1 A;  2V4D A;  4X6A H;  1JT8 A;  1OO9 B;  1Y8O B;  1EOT A;  1V9P A;  1TWC B;  1EU3 A;  5C4J H;  3CCS A;  1O78 A;  3C3L A;  1ONL A;  3CCU A;  3SK6 A;  4A3F H;  1W6J A;  1Q12 A;  3FDT A;  1BNZ A;  1PRT B;  1SMX A;  1SN8 A;  2AQ1 B;  3J7A F;  4DNR B;  3W1B A;  1E3P A;  3J80 E;  1U5K A;  1QJO A;  4KD3 A;  4DV6 L;  1ROD A;  1V43 A;  4IFD G;  2I0Q A;  5DAU A;  4JI1 Q;  3I4L A;  2NVX B;  1HRJ A;  2WFW A;  2Q8T A;  3NTI A;  4A3D H;  1A15 A;  1WOC A;  2JA5 G;  4KN4 C;  5C4Z A;  3NWS A;  4DPG A;  1IBM L;  2ZTE A;  4LFB Q;  2XIW A;  4KTA A;  1HNX Q;  3VA7 A;  3JAM c;  3PO2 B;  2L15 A;  4KJO A;  4V19 0;  2R93 B;  3EVQ A;  3KLR A;  1SE8 A;  3QG1 A;  5C44 B;  3BVM A;  3WOF A;  2GVA A;  4ME5 A;  1Y8P B;  2KOL A;  1IW7 D;  1B3Q A;  2CH4 W;  3RLF A;  4PZ6 A;  1SJH D;  2MNA A;  5JVH 3;  1EQR A;  2A6H D;  1BUV T;  4DR7 Q;  5C4H A;  1KC8 C;  1MSH A;  3P1H A;  1CM9 A;  2Q2T A;  2FJ2 A;  1WTV A;  1F2M A;  4GN3 B;  2CKZ B;  3BZK A;  3CRL C;  1VQC A;  3DWP A;  3PF4 A;  4GN4 B;  4L5Q A;  1JMC A;  3HOZ G;  1EU4 A;  1BBW A;  3CCR A;  4OL7 A;  4LF6 Q;  1TR5 A;  5FLX L;  1Q8I A;  1EIH A;  1E7Z A;  3SEB A;  2R93 G;  4RMF A;  4ZUI A;  3MXN A;  1GUN A;  5CV9 A;  1EWI A;  3PO2 G;  1NY4 A;  5J39 A;  1C7Y A;  4KY6 A;  1IYJ B;  2IT1 A;  4B3S L;  1PZK D;  2DNE A;  3H0G H;  4HAE A;  3FMC A;  5IGD A;  2QA4 A;  2D9U A;  4IUR A;  4C2M B;  1CHP D;  3F1Z A;  2EPB A;  1BF4 A;  4AYB G;  5K5P A;  2PO4 A;  3DEP A;  4IUQ A;  4TVA B;  2EYO A;  4J6H A;  2PMZ B;  1B9N A;  1BO0 A;  3STB D;  2HCI A;  2Z6K A;  1A63 A;  1VQN A;  1QVG A;  4X3U A;  5KNC A;  3A8K E;  1NR2 A;  3HG9 A;  2NVT H;  1VQ4 A;  1EL0 A;  3KF8 B;  4OGQ C;  4P74 A;  1EY9 A;  2Z4I A;  3HKZ B;  1MHW C;  4L6T B;  1W3S A;  2E75 C;  3M3Y H;  5FJ8 G;  4OEL B;  2MHV A;  4HJ9 A;  1UEB A;  4RHR A;  1LAC A;  4LK1 C;  3H09 A;  1S4Z A;  2VXW A;  1U4L A;  2EY5 A;  3KK7 A;  1GM5 A;  2IW3 A;  2EYH A;  2PI2 A;  4IOC A;  3GTP B;  3S15 H;  1R9T H;  5EQ0 A;  3PIP A;  2BH8 A;  5C3E B;  3E9I A;  2E76 C;  1CSQ A;  5E4W C;  4DR1 L;  2MPM A;  4O1N A;  1E2W A;  1RCV D;  2F1M A;  3K7A H;  1XMQ Q;  4J15 A;  5I6W A;  5A35 A;  1IW7 C;  1HUN A;  4X66 Q;  1SNP A;  1JWS D;  1AEX A;  1TWH B;  3FP9 A;  5EBC A;  3HOU G;  5JJK A;  5I4D A;  1NE3 A;  4DF7 A;  1X32 A;  4B08 A;  2D0P A;  3D6C A;  1GUS A;  1N36 L;  3NTK A;  3FKI B;  1STE A;  2VQE L;  2A6E C;  4IUU A;  4A3D G;  4C3I H;  1ZYR C;  4KK7 A;  1YEZ A;  3CC7 A;  3IL8 A;  2AQ3 B;  2SDF A;  1HUM A;  1KD1 C;  1BR9 A;  4A3C G;  5CV6 A;  2CW0 C;  2K28 A;  4X62 L;  3ND9 A;  2K7V A;  1X54 A;  1HTP A;  2O5J C;  4A3M G;  4R4O A;  3NSW A;  2ZXP A;  4N8X 1;  1N32 L;  3MHB A;  1QNK A;  4E6I A;  1QOH A;  4WFN 3;  4DR3 Q;  3RN2 A;  3KBG A;  1K8A C;  1AE3 A;  1FJG L;  5M3F B;  2HD3 A;  1Q81 C;  2N3S A;  1QIL A;  4DV0 L;  2YTX A;  1MBY A;  3RUZ A;  2K5N A;  4C2M H;  2A6E D;  1JC7 A;  2N55 A;  1BCP F;  2EYP A;  1W2B A;  1E2Z A;  2OCE A;  1I4P A;  3T56 B;  1XMO L;  4F7X A;  5CV5 A;  1VQK A;  1K83 B;  1QCB D;  2KA7 A;  2GVB A;  3NPP A;  3CQZ B;  3G48 A;  3QOJ A;  4LF9 L;  1TY0 A;  4EVO A;  5FO9 B;  1B44 D;  1H95 A;  3U9O A;  3LNN A;  1VMC A;  4X3K A;  2F3I A;  2R7D A;  3GTO B;  5I2Y A;  2CFM A;  1TWC H;  4DR6 Q;  5C4X G;  1J5E L;  2MGS A;  4K5X A;  2OQK A;  2RCN A;  2R61 A;  3MFG A;  3A54 A;  2VUM H;  4A3K B;  1V1Q A;  1D8L A;  2NBF A;  1GJX A;  1ENC A;  4JI7 Q;  3ICE A;  1EQT A;  2FXQ A;  3OHX C;  2JA6 H;  4K2K A;  3W5O A;  5FK9 C;  1GOZ A;  2NN6 I;  1A2U A;  4HJ8 A;  2KHJ A;  4A93 B;  4DV2 Q;  4ZK9 B;  4IFD J;  1K3R A;  1G6P A;  4DR3 L;  3OWE B;  3GTK B;  3NK9 A;  2A5H A;  5LMN W;  1PTO F;  3RLO A;  4ZYS A;  1EY5 A;  1WTR A;  3K59 A;  2R3Z A;  4PMC A;  1KXL A;  5IY0 A;  3OOC A;  3VR3 A;  2KQ3 A;  2EYM A;  2GN5 A;  3ERQ A;  3D4W A;  4DUY Q;  4JBK A;  3MZ5 A;  2A68 C;  1RDP D;  4A3G H;  1I3Q B;  3T51 B;  1R9T B;  1HNW L;  3GTP H;  3T1Y Q;  1ILP A;  5M3M B;  4EQO A;  2VUM G;  3C2P A;  1D1K A;  4DV5 L;  2KVM A;  3HRZ C;  2K32 A;  3S2H B;  1A62 A;  1N36 Q;  2WII B;  1UE1 A;  1PH9 A;  1Y8N B;  2JA9 A;  3QJY A;  3CC4 A;  4TRD A;  1X9N A;  2BDN A;  4JV5 L;  2Q2H A;  2NVQ H;  1MI2 A;  2YTY A;  3I4M H;  3H3V C;  3GQB A;  4HIM A;  3TEH B;  5C4J B;  1LTB D;  3M4O B;  2NN6 G;  2L55 A;  3DUZ A;  4KN7 C;  3NBH A;  2ZT9 C;  4A3I G;  2ZM6 L;  1ICW A;  4NW2 A;  4XQQ A;  4BBS G;  1PZJ D;  2B2V C;  2JA6 B;  1NJI C;  1Y1W H;  2ZTD A;  2O2L D;  1U4M A;  2Z8L A;  5JPM C;  3BS1 A;  4DV5 Q;  3SK4 A;  3S16 H;  4K6L A;  1GUO A;  4CJ1 B;  1KAW A;  4YHH L;  5K36 H;  3K5N A;  3D8G A;  3HEJ A;  3DM3 A;  4JCV E;  2WKC A;  3GTM B;  3K8A A;  2ATW A;  3RZO B;  1HR0 W;  3U58 A;  5TSS A;  3KJO A;  4HSP A;  2AQ2 B;  1ZEQ X;  4XIG S;  4LF5 Q;  3H6M A;  4DAP A;  2IHF A;  3DWQ A;  4B3R L;  3SK5 A;  3KDF B;  3QR8 A;  4HIO A;  1GUG A;  4FXD A;  2K5W A;  2B2Y A;  2FIN B;  2O4X A;  1S5B D;  4ZLT F;  1YZ6 A;  3HOZ H;  5EBD A;  1KNA A;  5C0X J;  3T4A C;  3MA2 B;  5M3F H;  3MVV A;  5CV8 A;  2F0V A;  4RAU C;  1B50 A;  1HA5 A;  4Z9C B;  3A7L A;  4DR6 L;  4A3J G;  2MUY A;  4DXF A;  1EQQ A;  2M2L A;  4DAM A;  4B3M Q;  5IT9 L;  1O7I A;  4BY1 G;  1D1I A;  2DY8 A;  3WOE A;  3BZD B;  3VR4 A;  1PYW D;  4LF6 L;  4G7Z C;  1VDZ A;  5FKA C;  1SYF A;  3K5L A;  5GAH C;  3TN2 A;  3TRZ A;  2HHH Q;  4HID A;  5HY6 A;  2F4V Q;  1VF5 C;  4AQY L;  1TWA B;  2LXK A;  1Y14 B;  2UUA Q;  4F88 A;  4A3G G;  2VS1 A;  2VNU D;  4N9T A;  3OW7 A;  5ELB A;  3RZD H;  1F2Z A;  5DEH A;  3PIO 3;  1YJN A;  2BOS A;  1K8M A;  5HGQ A;  2JA7 H;  3QB3 A;  2HIV A;  1HCZ A;  4QIW B;  1ENA A;  5JJI A;  1LTG D;  1HHV A;  1Y1V B;  4G7H C;  1ET6 A;  4V0B A;  4U67 3;  1BCP D;  3L7Z C;  4A3M H;  2DJF C;  1X56 A;  5ELO A;  3J81 j;  1PHJ A;  5IGG A;  2UXC Q;  4UP8 A;  4X3S A;  5C3E H;  3MAQ A;  4BY7 G;  2PQE A;  1HNX L;  5IGF A;  5BR8 Q;  3E9H A;  4K5W A;  4OWW B;  1IXR A;  3IKJ A;  5JAV A;  4LFC Q;  1WJJ A;  5LL6 S;  5D65 A;  3C46 A;  2YTV A;  1HR0 L;  3CMA A;  2I5M X;  3Q6S A;  4IO9 A;  4MIU A;  2EE1 A;  4K2L A;  3HOY G;  5K36 G;  2OTL A;  1IKM A;  1C4Q A;  3M85 A;  2C35 B;  4XT1 B;  4QUC A;  4IZ8 A;  2XNA C;  1MIU A;  3CCM A;  4RFB A;  1D6E C;  2DY7 A;  4QUF A;  1VQA A;  1VQ9 A;  2ID0 A;  2QEJ C;  1QWY A;  1G6Z A;  1T5E A;  2OT2 A;  3BDO A;  2F0F A;  2K04 A;  2Q8I B;  1UE5 A;  1PTO H;  2F0E A;  4DV3 Q;  3S1N H;  1S3O A;  5GAE C;  1STG A;  1LTL A;  1SMY C;  4DK6 C;  1CSP A;  1SJE D;  4KHP Q;  4DV7 L;  2JA8 G;  3H0G B;  3U50 C;  4QY7 A;  4KHP L;  1SNQ A;  4X65 L;  3KJP A;  2VZA A;  3FPP A;  4FP5 D;  5IP9 G;  1SDF A;  2OEO A;  1WVL A;  2HQE A;  1C9O A;  3JAM L;  3TS0 A;  1GUT A;  5LMU Q;  1MSG A;  4GKJ L;  5J22 A;  1N33 L;  4XYQ A;  3S15 B;  5COY A;  4KMU C;  1HZC A;  1HJP A;  3NEN A;  2QCP X;  3W2D A;  4TKO B;  3MTS A;  4JPB W;  3TS2 A;  1DM0 B;  4OON A;  4DV4 L;  2EYL A;  3E5S A;  1HA6 A;  3D0F A;  3F2B A;  5M5Y B;  2WAQ E;  1JIC A;  1GD7 A;  4UHV A;  3AFQ A;  3X3M A;  4IPG A;  2EZV A;  1ZYR D;  2RVL A;  1WTX A;  1PFS A;  3I56 A;  3K58 A;  3DLL A;  5BR8 L;  1JE5 A;  1Q46 A;  1Q8K A;  4TQU S;  2KBN A;  2XGT A;  3DEO A;  4OIK A;  2RCF A;  5C5M A;  4BY7 B;  2E74 C;  1OXU A;  1CKN B;  1KLU D;  4AIM A;  1O80 A;  2NN6 H;  3S1M H;  3RD4 A;  4XTC S;  4B9W A;  3SVM A;  1Z7T A;  2MJ8 A;  2NVY B;  5C0X I;  1O7Y A;  5IOD A;  1PDQ A;  3CRK C;  1BCP B;  5CV7 A;  5JOB A;  1B3A A;  1QVF A;  1Y1V G;  2J4X A;  5D3D A;  2ZTC A;  1B8A A;  3K5O A;  5LMN Q;  4A3B G;  3ULJ A;  4ALP A;  5KND A;  1XNR L;  1PTO C;  1I50 H;  2MP1 A;  3J80 i;  4MTN A;  1PRT C;  4G57 A;  4HTH A;  1KNE A;  4LMQ D;  1VQP A;  1F2Y A;  4JBW A;  2PPB C;  1O7L A;  2JEA I;  4A3G B;  5M5W B;  2DNC A;  3MXP A;  2CCZ A;  2HHH L;  3QOL A;  3K6O A;  2XVS A;  1IBK Q;  3O13 A;  4DR2 L;  1BBU A;  3SK8 A;  1K3B C;  2E5L Q;  2H1E A;  3NQT A;  2BE5 C;  3NHH A;  3GV3 A;  2EXZ A;  5COR A;  2JP1 A;  3KF6 B;  5KEE A;  5C0X G;  4QJF A;  1JQY D;  3KF8 A;  3L2P A;  2Y0S G;  4A76 A;  3CPW A;  4NXN Q;  1B1Z A;  1WD1 A;  1SEB D;  1ZXT A;  5FO7 B;  1IBM Q;  2E8G A;  4JI0 L;  1VQB A;  2F0L A;  3UI2 A;  2RSN A;  4A3E H;  2EIF A;  2KCM A;  3PUW A;  5IGB A;  4DN4 M;  1V8Q A;  4JI5 L;  5BN3 A;  1I3Q H;  3ZYY X;  2WIN B;  1RTO A;  2R92 B;  1MD2 D;  2R7F A;  1TWF B;  4PNY A;  1IZ6 A;  4JI8 Q;  2HCC A;  1LYL A;  4BY1 H;  1WYD A;  5C3W A;  4JK1 C;  1TXY A;  5CR3 A;  5ELC A;  2NVQ B;  1I6H H;  5LL6 X;  4UP9 A;  1OTC A;  1SYG A;  4MNO A;  3OIQ A;  2JQO A;  3GTM H;  4MTK A;  1PYB A;  4F87 A;  1SYC A;  5IWA L;  1N9W A;  2K5H A;  4DUZ Q;  4HN7 A;  2PMZ E;  4DKA C;  4IUT A;  3CF5 A;  2E2J B;  2F0S A;  1NUC A;  3S2D B;  4AQY Q;  4RCO A;  3P75 A;  1SNC A;  3E0J A;  4GNX A;  2UUC Q;  3S17 H;  2QF7 A;  4NB3 A;  1KAB A;  2EXD A;  1HZ9 A;  3EN2 A;  3BZC A;  5EPL A;  2K14 A;  1HQM C;  1M90 C;  2B8G A;  5JPN C;  4BBR G;  3TP7 A;  3I4M B;  1KHI A;  4R9W A;  4L5S A;  1KDB A;  1EOV A;  4R8I A;  1QZH A;  1A3U A;  2PW7 A;  3DWA A;  4NXM L;  2EY1 A;  2Z9H A;  2X6G A;  1SE4 A;  2J7Z A;  3NWT A;  3TME A;  1X3F A;  4HMJ A;  2VUM B;  3E0E A;  5M3M G;  3T1Y L;  1KIX A;  3HOW B;  3LWE A;  1EIG A;  2KEE A;  2SEB D;  3PIO A;  2FFK B;  1E1O A;  1LTI D;  3HOX B;  1YNX A;  1E1T A;  1WTO A;  4IPD A;  4U68 A;  3S1Q H;  3I90 A;  4LUO A;  1TS3 A;  1U4R A;  1VCI A;  2ICI A;  3GTK H;  1EIY B;  2V1C C;  3FRP B;  1PXU A;  1K0R A;  1FNW A;  1FD7 D;  1EYC A;  4A93 G;  5BN5 A;  1PH7 A;  4FNF A;  1JB7 A;  4DU9 A;  3BG3 A;  2QEX A;  3A0J A;  2B63 B;  4JI2 Q;  4A3F G;  3T1H L;  3TP6 A;  4G4K A;  4LF4 L;  1N34 Q;  4BXX H;  2IX0 A;  3TZU A;  4IFD I;  1G29 1;  2K1B A;  3CHB D;  3IFD A;  1HPC A;  5IOC A;  3G7L A;  1TWH H;  1X65 A;  1PH1 A;  3AU7 A;  2KEC A;  2IWH A;  4FF3 A;  3HOU H;  3Q23 A;  5KRU A;  2PYK A;  3HOX G;  1KL9 A;  4A3E B;  1STB A;  5DM7 3;  4FF2 A;  5M5W H;  5E1F A;  4LUZ A;  1WTP A;  4LF8 L;  4A75 A;  1ASY A;  3U4V A;  2ZJP A;  1BBX C;  1PH4 A;  2F3V A;  1WFQ A;  1VS0 A;  1GHK A;  2XRS D;  2ENB A;  5IWA Q;  2XRQ D;  3PCO B;  1SE3 A;  3MEF A;  1TVX A;  5M5X H;  1CFM A;  4A3E G;  4LJZ C;  4PV1 C;  4GKK Q;  1CZG A;  3BYT B;  1X3E A;  4XXE A;  3OSO A;  2IX3 A;  3CAM A;  5EPJ A;  3V2T A;  3I4M G;  3I7F A;  1JR0 D;  4BXX G;  3VYU A;  4LAA A;  1OXS C;  4NKL A;  2QW7 A;  4X62 Q;  3J7Y W;  3BDC A;  1TT2 A;  2XTI A;  2NTT A;  4FXK C;  5ELN A;  2B63 G;  2Z6K C;  2K4K A;  1I94 Q;  3I70 A;  2EVB A;  1HNZ L;  1FGU A;  4IJH A;  5DM6 3;  1H9K A;  5IP9 H;  2IJ0 A;  2NVY H;  2KED A;  3GP7 A;  1BXT A;  1VQF A;  3CKI B;  4DR5 Q;  3RNU A;  2HUG A;  4YWM A;  5JJL A;  2N8N A;  1EWC A;  3K7U C;  3ER0 A;  1TWG H;  1YHA A;  1YNN C;  2UXD Q;  3D6W A;  1S72 A;  2PQA A;  2K5V A;  4WJW A;  3HOW G;  4CGY B;  2VL6 A;  2HIX A;  4NPS A;  1U4P A;  2B2T C;  1IL8 A;  2UXB L;  1XNR Q;  4R4T A;  2CHB D;  2L5T A;  1LT6 D;  2F0W A;  3GD7 A;  4EX5 A;  2JYO A;  5IIF A;  4YY3 L;  1RD9 D;  4L8J A;  1VQO A;  4DGZ A;  3I3C A;  2F0U A;  4OIJ A;  1K73 C;  3HKZ G;  1FJG Q;  3NEL A;  2PNR C;  4PMB A;  3J7Z C;  1HZA A;  1QNU A;  3NTH A;  1N32 Q;  4QGU A;  3CU7 A;  1YNN D;  3KBX A;  1BCP C;  1SFO B;  4WJ3 M;  1SYE A;  4C3J G;  5IP7 G;  2B2Y C;  2D0O A;  1JWU D;  2JK8 A;  5EGT A;  4R4C A;  2IPK D;  1C0A A;  2AUK A;  3MXU A;  5EAY A;  1A6X A;  1VQJ A;  1VF7 A;  1V1P A;  1D5Z C;  4R4Q A;  2CH4 A;  2YU9 B;  3NEM A;  1EYD A;  3CCE A;  3HS0 C;  3DMU A;  2UU9 Q;  1SE2 A;  3SR1 A;  1ML0 D;  1K8O A;  4KHV A;  2ZJQ A;  5KNB A;  1D7Q A;  1IYV A;  1Q90 A;  2B29 A;  1CT1 D;  1VQ5 A;  3EJI A;  2B2W A;  1SFO H;  2NZH A;  1XMQ L;  3M4O H;  5C44 H;  2JEB I;  5C3X A;  2FMM A;  5C5L A;  1GHJ A;  3OTO L;  2G9D A;  2L11 A;  4X65 Q;  1VQH A;  2B3G A;  3HOZ B;  1B4O A;  2B2U C;  4GLA C;  2K33 A;  2PQA B;  1CKO A;  4K0K L;  3OWF A;  1PZI D;  2NTS A;  3S1N B;  1YHB A;  1SAP A;  1GVP A;  4DUZ L;  2RHQ B;  2I46 A;  2D62 A;  4YCU A;  3L3O C;  1M8A A;  1XNQ Q;  3M4Q A;  3H3V H;  5IT9 c;  3TSS A;  2EDG A;  1RJT A;  2KHS A;  4IAL A;  4I7Z C;  1EY4 A;  1NCV A;  2F0N A;  3VDY A;  2C9O A;  3WWV A;  1PV4 A;  4HJ7 A;  4LNQ A;  3PO3 H;  4UY8 C;  4B9X A;  1F2L A;  5C44 G;  1UWV A;  3NQI A;  1NSN S;  2DN8 A;  3NP8 A;  5C6A A;  1I6V C;  1OXT A;  1MKH A;  2MO0 A;  4A93 H;  4NDX A;  4HIK A;  2E2I H;  4RKL A;  2UUB L;  3M4P A;  4LFC L;  1LO5 D;  1STH A;  4A3B B;  3B6Y A;  2JA5 B;  1WCM B;  2A73 B;  3QWN A;  3RN5 A;  3A5Z B;  4NXN L;  1DGS A;  1A8V A;  4ZKB B;  1JE4 A;  4BA1 I;  4FF4 A;  4DV6 Q;  4DAV A;  3F2D A;  4OEM B;  1YBY A;  3AQQ A;  3I91 A;  2F0D A;  4JG2 A;  3J81 c;  4KJN A;  4BS9 A;  5I9O A;  1AP0 A;  1JOO A;  4A3C H;  1IL2 A;  2F52 A;  1VQI A;  4CDD C;  4P71 A;  4DR2 Q;  2WAC A;  2VB3 X;  1EQV A;  2AWN A;  3MEH A;  4FF1 A;  4JI6 L;  1NTG A;  2H4O A;  2F3W A;  5M5X B;  1I4R A;  1NBW A;  2NZ1 D;  1X3P A;  2Z0S A;  3VR6 A;  3CCV A;  2IY5 B;  3GTJ B;  4X64 Q;  3CW2 C;  1VQL A;  1FNU A;  4OX9 L;  4K0K Q;  1ESR A;  2WB1 B;  1PA6 A;  1L1O C;  2WV6 D;  1GXD C;  4XT3 B;  2L12 A;  5D3I B;  2HDM A;  1BDO A;  4JYA Q;  4WRD A;  4DK0 A;  3L9A X;  4K8J A;  3R2I A;  2ZXO A;  5FJ8 H;  3Q24 A;  1WCM G;  1U9R A;  1KRS A;  3VYS A;  4IN3 A;  2EY6 A;  4BWG B;  3PUZ A;  3GTJ H;  4JOI A;  4JI1 L;  3BVG A;  4H0L C;  2I07 B;  3G6E A;  4RKB A;  1R4P B;  4DV4 Q;  3VR2 A;  3F2C A;  2K5D A;  4ZAI A;  2WKD A;  4LWC A;  3J7A V;  3WDN A;  3UDX A;  5FO8 B;  1SXT A;  1N33 Q;  4K6D A;  4BY1 B;  2OF1 A;  4H44 C;  2KJX A;  2R7Z B;  1MGS A;  2K50 A;  4YHH Q;  4Y7N H;  3S16 B;  4JVZ A;  2DJG C;  4S3S A;  4ABN A;  2PZT A;  3Q22 A;  3GV6 A;  1TS5 A;  5AJ3 L;  1ICF B;  1O7Z A;  4IUN A;  4PMW A;  4DK3 C;  1B9M A;  1EIF A;  1CZW A;  4WJ4 A;  1LTS D;  1TY2 A;  4DV3 L;  5E3F A;  2NUC A;  2SNS A;  2E2H H;  2LS0 1;  1N8R C;  2RF4 A;  3BU2 A;  2JSO A;  1SRO A;  5T1G A;  2N88 A;  3I73 A;  2NB0 A;  1K28 A;  1X3Q A;  3F2U A;  4JV5 Q;  2B2T A;  2B39 A;  1A0I A;  2I5L X;  4A3L G;  2Q2I A;  2JA5 H;  3GTL B;  2OTJ A;  4DXG A;  4BBR H;  4R8N A;  2E2J H;  2VY3 A;  4QF4 A;  4QQB X;  2ALY B;  1HNW Q;  3TZD A;  3F8T A;  3CD6 A;  3PUX A;  1I94 L;  4ZRZ A;  1LTT D;  4ODG A;  3SHL A;  5F2D A;  5GAD C;  5DLQ E;  1B53 A;  4BBS B;  4C3J B;  1EEF D;  4ZQ3 A;  3HOX H;  3LWU A;  4DA2 A;  3J7A 5;  1JWM D;  1IBL L;  3AYH B;  2A69 C;  5FLM G;  4JI4 Q;  1DJR D;  3J81 E;  2UXC L;  3OW2 A;  1MJE A;  3HP3 A;  1M1K C;  5HGT A;  2JXM B;  4IUP A;  2NWG A;  4RGT A;  4HMI A;  4KKT A;  4BA2 I;  1NAP A;  4RA8 A;  1G2T A;  1UAP A;  2OQ0 A;  2IX1 A;  1QVC A;  1P8L A;  1OXX K;  3R93 A;  4A3K H;  4IFD H;  3CCL A;  2RKS A;  4WOR A;  2F0M A;  2LFN A;  2UUA L;  3D4D A;  5D14 A;  1SRU A;  2UXD L;  1WTW A;  4NMZ A;  5ELE A;  1LT5 D;  2F4I A;  5I2X A;  1ILQ A;  1ZKO A;  1F77 A;  4J1M A;  2ASB A;  4EGV A;  2VQF Q;  3S1R H;  5FLM H;  1CQV A;  3EFX D;  4B3M L;  1QG7 A;  1PYS B;  1IYU A;  2MQH A;  4LF4 Q;  1HH2 P;  3K0Y A;  2HQL A;  1TU2 B;  4JOI C;  2K05 A;  2WB1 E;  1DOM A;  4F8M A;  2EYJ A;  4LFA L;  3FPU B;  2LKV A;  3PV0 A;  2PZU A;  3CPF A;  4A3K G;  3H94 A;  4A3I B;  5IYB H;  1DXM A;  1EY6 A;  3K7A B;  3A74 A;  1CA6 A;  4JI3 L;  3S14 H;  5FOB B;  1J9O A;  3S1R B;  2JA7 G;  1RTN A;  1TII D;  2LSS A;  3I55 A;  2F0O A;  1SYD A;  3D31 A;  4GZY C;  3FHW A;  1J6Q A;  3TDQ A;  4DK1 A;  4LF7 Q;  1CKM A;  1KQS A;  5J1Z A;  2EQS A;  4ZCK A;  1BOS A;  2EOT A;  4I7A A;  3KLS X;  5KIX A;  1L2F A;  2K01 A;  3C1E A;  3R8B A;  4K8I A;  2ES2 A;  4A4I A;  3J81 L;  1G8Z D;  2F03 A;  1UUP A;  4KY5 A;  3PMF A;  5IT9 E;  3D3R A;  4XYO A;  3ULP A;  5G3L F;  4LF8 Q;  3I4N H;  1CQF A;  3LX0 A;  5GAG C;  3SE0 A;  1CKN A;  3HFZ B;  2XSC A;  2ZJR A;  1EZ8 A;  2ZM6 Q;  4L5T A;  1PH5 A;  1TKW B;  4IPH A;  2BA0 A;  5JVG 3;  2CWA A;  1E24 A;  4C56 C;  5C0X H;  1N34 L;  4A3M B;  4XDX A;  3OMC A;  1EUJ A;  3GTG H;  2JJQ A;  4KY7 A;  4A3F B;  4JI2 L;  1CHQ D;  3T16 A;  1SR3 A;  3K5M A;  2QDB A;  1L0X B;  3J80 c;  5CC4 A;  4GOP B;  1RF2 D;  4RGN A;  3UE0 A;  4Q0F A;  3K57 A;  4OO1 H;  1B70 B;  4R4I A;  1H9J A;  4LUV A;  1DD2 A;  1JOQ A;  1LT4 D;  2CW0 D;  5C4X B;  3PQI A;  5FLX E;  4A3J H;  1FGB D;  3K81 C;  2EJG C;  2JA8 H;  3GTL H;  2BH2 A;  3EIV A;  5EJW A;  3GTQ B;  1PFM A;  1TWG B;  3NXW A;  3HOU B;  3AMU A;  3TQY A;  4O42 A;  3KDF A;  1PLF A;  3KYH C;  1AZP A;  3HOV G;  4KV6 A;  2AKW B;  4P75 A;  1FNV A;  3FVQ A;  3X3N A;  4JBM A;  2TSS A;  1S5C D;  4PG3 A;  1SSO A;  5C3E G;  4JI5 Q;  2X6L A;  3PSI A;  1QUQ B;  4C3J H;  2PCF B;  4BBS H;  3S17 B;  4JW0 A;  3LGJ A;  1ENF A;  2VW9 A;  1KLG D;  3K0X A;  4NXM Q;  4P72 A;  1HFG A;  3TP5 A;  4ME3 A;  2F0G A;  3PUY A;  3H91 A;  4B3S Q;  1Q82 C;  3D4R A;  1YIJ A;  1OXV A;  3H3V I;  5EKK A;  1QZG A;  1FR3 A;  4BBR B;  4H7B A;  4DV1 L;  1DZ1 A;  1J5E Q;  2XN9 C;  3AFP A;  4IPC A;  1T5X D;  4ULL A;  1LTR D;  3U9S A;  1X55 A;  2X69 A;  3A7A B;  1LV9 A;  2L4N A;  3M7G A;  3M7N A;  2NYZ D;  1PMR A;  5IYC G;  3HZX A;  1V1P B;  2SNM A;  3I72 A;  3MWY W;  3R2T A;  3Q8D A;  2QGQ A;  3S2H H;  1SND A;  4EQN A;  5GRO A;  4KI0 A;  4YCW A;  1PTO B;  5T1I A;  1YVC A;  3IRB A;  2A1A A;  5CBE E;  3FKI G;  1AFP A;  5LMN L;  2BCO A;  3STB C;  1SNM A;  3ONA B;  4EQ5 A;  1HTL D;  2IHE A;  2Z6B A;  1DON A;  2M9V A;  5KYL A;  1EYG A;  4DV0 Q;  1KDC A;  4KLK A;  4PZ8 A;  3KUP A;  1WD0 A;  1YIT A;  1PVO A;  4N8F A;  4GOP A;  2R93 H;  3CP0 A;  2Q2U A;  2R92 G;  4JI4 L;  3DM1 A;  2KCN A;  1KDA A;  3TBI B;  2RDF A;  3T53 B;  1D5X C;  3HOW H;  3I2Z A;  2E2H B;  1STN A;  1EY8 A;  5KGU A;  1PH3 A;  2EY2 A;  5LHY 1;  4YCV A;  4LFB L;  4KHZ A;  1G51 A;  2QDL A;  2F0P A;  4PZ7 A;  5JEA G;  5CYU A;  1CK1 A;  3AB9 A;  3QO2 A;  4CKC A;  4UP7 A;  5C4X H;  4FDB A;  3RMH A;  4KD4 A;  1II3 A;  2RBM A;  1AW7 A;  3M4Y A;  2Y0S B;  1BQQ T;  4OWT B;  4DR4 L;  3MXG A;  3FKI H;  4HSV A;  4G7O C;  2A68 D;  1TQO A;  1XJV A;  1Q86 C;  2Z1C A;  2E5L L;  3N6R A;  3P7J A;  2BA1 A;  5A2Q L;  1KAA A;  4X66 L;  5L37 A;  3CME A;  5LMU L;  3PO3 G;  1Z47 A;  2B2V A;  2YYZ A;  5CGK A;  4DR1 Q;  1TWF H;  4HJA A;  1H9S A;  2HDL A;  4I65 A;  3TP8 A;  4AYB B;  3RZD B;  2FMC A;  2M00 A;  4HCS A;  4L63 B;  1D5M C;  1STA A;  3KLS A;  5FLX c;  3V96 A;  4Y52 H;  1CUK A;  1GUW A;  2F0K A;  4QIW E;  3UE1 A;  3OTO Q;  3M3Y B;  2K75 A;  3DHQ A;  1JOK A;  1SNO A;  1AE2 A;  4P2C B;  2MFI A;  1VQE A;  5ELF A;  1X3G A;  4H13 C;  1S5E D;  4XQN A;  3PO3 B;  5IE8 A;  2A19 A;  5IYC H;  1YJ9 A;  2OXP A;  2A8V A;  3I8Z A;  1VQD A;  2A6H C;  1STY A;  4GN5 A;  4HJ5 A;  2A69 D;  4C1N K;  1IKL A;  3S14 B;  4GLV B;  2O5I C;  5CMD A;  1M4V A;  4DR4 Q;  3HKZ E;  3VYR A;  5M5Y H;  1I50 B;  1HR0 Q;  3GO5 A;  3P20 A;  1AN8 A;  2BDO A;  3BVZ A;  3I4O A;  3CC2 A;  4GLX A;  2XWB B;  4CBV A;  1L0W A;  2G5D A;  4K5V A;  1JJ2 A;  1F9P A;  1E0B A;  4RWS C;  1XPR A;  1EZ6 A;  1CI3 M;  2OWO A;  4GKJ Q;  2D5D A;  4CKB A;  5IGC A;  1PFB A;  2VB2 X;  2NZO A;  2BE5 D;  3SDZ A;  2PZW A;  5A2Q E;  3H0G G;  2JA8 B;  4DV7 Q;  1E22 A;  4OX9 Q;  4YIJ A;  3CXC A;  5CV4 A;  2TMP A;  3NBI A;  2UXB Q;  5IYB G;  1T9H A;  3A56 A;  1W6K A;  2B2W C;  3ULL A;  4DR7 L;  1LLR D;  5H1S E;  1UEA B;  1PTO D;  2F4V L;  3NUC A;  1H9R A;  1EY7 A;  4L5R C;  4JI6 Q;  1AH9 A;  1RIP A;  2KCT A;  4ID6 A;  4ZUJ A;  5IP7 H; 
#chains in the Genus database with same CATH homology
 3OPO A;  1KTK A;  3URY A;  3MFY A;  1SBB B;  1DCZ A;  2LY7 A;  5AFW A;  5EKI A;  3HOY B;  1HXY D;  2RA4 A;  4RCN A;  3JAM E;  4CKE A;  5JJZ A;  1RHP A;  2QIL A;  2SOB A;  4OO1 I;  4NP5 A;  2E2D C;  1C8C A;  2NVT B;  3HOV B;  4KKU A;  4QMG A;  5KYI A;  3ERO A;  1L0Y B;  1LT3 D;  3C1F A;  1Y69 U;  4C3I B;  1TS2 A;  5ISR A;  4OO1 G;  1ESF A;  5EKL A;  1R4Q B;  2LMC B;  3IFT A;  1XWE A;  3N52 A;  2K5Q A;  5JEA J;  1SMY D;  3FEW X;  1I4H A;  3QIA A;  1JOR A;  4KKS A;  4A3J B;  4XQJ A;  3S1Q B;  1A3V A;  3W3A A;  5IGE A;  2QKI C;  2D2C C;  1IHZ A;  2RQX A;  3GTG B;  1JCK B;  2RSO A;  1PRT F;  5DNF A;  1XXG A;  2B8F A;  1UNS A;  1WTQ A;  3S1M B;  2Q8R E;  1SYB A;  2F0T A;  1TS4 A;  5G3L D;  1CA5 A;  5BN4 A;  1FYC A;  4TSS A;  2IL8 A;  4RGM A;  1S5D D;  1H9S B;  1YNJ D;  4FXG C;  2XWJ B;  4C3H G;  1A3T A;  2L0C A;  4FYD A;  2JA7 B;  3OIP A;  2ZXR A;  1QE6 A;  4RGO S;  4OHJ A;  2WP8 J;  3Q0A A;  2G9H D;  2F0H A;  2F0Q A;  5NUC A;  1Y1W B;  2ICE C;  2Z4H A;  1LTA D;  1AZQ A;  4X3T A;  1LAB A;  1EFI D;  2WAQ B;  3NE5 B;  3A55 A;  3PIP 3;  2J0T D;  3T13 A;  1I4G A;  1PRT D;  3VR5 A;  4FO2 A;  1G91 A;  2GA4 B;  2K6A A;  4RH6 A;  3A8I E;  5EPK A;  1XX8 A;  4UAI A;  2L9H A;  3A8J E;  4M1U B;  1D2B A;  1DOL A;  3BYY B;  1CTM A;  4CJ2 C;  1EEI D;  4Q5V A;  2EJF C;  3ND8 A;  2CVR A;  5CBA E;  1B2T A;  1J8I A;  2A74 C;  2AUJ D;  3EA6 A;  3PUV A;  4QCL A;  1HQR D;  5ELD A;  4MN3 A;  2EYF A;  2FHT A;  4HED A;  2AWO A;  4DAY A;  5I6Y A;  2C5C A;  1Q3L A;  2K03 A;  1EY0 A;  3HGB A;  4PQX A;  2EJM A;  1S5F D;  1YNJ C;  5M9O A;  3EQL C;  4C3I G;  4N9P A;  3BDL A;  2R6G A;  4Y7N B;  4FVM A;  4C3H B;  3ITP A;  4MHE A;  1XTC D;  1I4X A;  1F9S A;  4HCE A;  5JEA H;  3IAY A;  2CQA A;  2KUM A;  4QB4 A;  1Q1B A;  3OMG A;  4RHS A;  2RDG A;  4C1N I;  2PW5 A;  5E4X A;  2B2U A;  1ET9 A;  2E2I B;  1VMP A;  1JB3 A;  3MC0 B;  3G6J B;  1I6H B;  2F0I A;  1DYQ A;  1H9M A;  2KCC A;  4J8Q A;  3VA5 A;  3J80 L;  5HUR A;  1G2S A;  2F0J A;  1EWH A;  4DFA A;  2L1B A;  1E2V A;  1EYA A;  1F9Q A;  1Q1E A;  3DXJ C;  3V05 A;  1F9R A;  4EQP A;  3E6Z X;  3R3O A;  1DOK A;  3S9W A;  1HFN A;  4ILW A;  4A3D B;  4CJ0 B;  4DNT B;  4UDU C;  3SXH A;  1V1O A;  2JE6 I;  1XYI A;  1QB5 D;  1C48 A;  4K14 A;  1RKN A;  4M8A A;  4IUV A;  2RDH A;  1NR4 A;  3VYT A;  1PFN A;  4ZKC B;  4HR7 B;  1I4Q A;  1Z6H A;  3I4N B;  4IQZ A;  1A2T A;  4CHT B;  5I9P A;  2V4D A;  1OO9 B;  1Y8O B;  1EOT A;  1TWC B;  1EU3 A;  1O78 A;  3C3L A;  1ONL A;  3SK6 A;  1W6J A;  1Q12 A;  3FDT A;  1BNZ A;  1PRT B;  2AQ1 B;  3J7A F;  4DNR B;  3J80 E;  1QJO A;  4KD3 A;  1ROD A;  1V43 A;  4IFD G;  5DAU A;  3I4L A;  2NVX B;  1HRJ A;  2Q8T A;  3NTI A;  1A15 A;  4KN4 C;  5C4Z A;  3NWS A;  2XIW A;  4KTA A;  3VA7 A;  3PO2 B;  4KJO A;  4V19 0;  2R93 B;  3EVQ A;  3KLR A;  3QG1 A;  5C44 B;  3BVM A;  3WOF A;  4ME5 A;  1Y8P B;  2KOL A;  1IW7 D;  3RLF A;  1SJH D;  5JVH 3;  2A6H D;  1BUV T;  5C4H A;  1MSH A;  3P1H A;  1CM9 A;  2FJ2 A;  1WTV A;  1F2M A;  3CRL C;  3DWP A;  1EU4 A;  4OL7 A;  1TR5 A;  5FLX L;  1Q8I A;  1EIH A;  3SEB A;  4ZUI A;  3MXN A;  1GUN A;  5CV9 A;  5J39 A;  4KY6 A;  2IT1 A;  1PZK D;  2DNE A;  4HAE A;  3FMC A;  5IGD A;  2D9U A;  4IUR A;  4C2M B;  1CHP D;  2EPB A;  1BF4 A;  5K5P A;  2PO4 A;  3DEP A;  4IUQ A;  2EYO A;  4J6H A;  2PMZ B;  1B9N A;  1BO0 A;  2HCI A;  4X3U A;  5KNC A;  3A8K E;  1NR2 A;  3HG9 A;  1EL0 A;  4OGQ C;  1EY9 A;  2Z4I A;  3HKZ B;  4L6T B;  2E75 C;  2MHV A;  4RHR A;  1LAC A;  4LK1 C;  3H09 A;  1S4Z A;  2VXW A;  1U4L A;  2EY5 A;  3KK7 A;  2IW3 A;  2EYH A;  3GTP B;  5EQ0 A;  5C3E B;  2E76 C;  5E4W C;  2MPM A;  4O1N A;  1E2W A;  1RCV D;  2F1M A;  5I6W A;  5A35 A;  1IW7 C;  1HUN A;  1SNP A;  1JWS D;  1AEX A;  1TWH B;  5EBC A;  5I4D A;  4DF7 A;  1X32 A;  4B08 A;  3D6C A;  1GUS A;  3NTK A;  3FKI B;  1STE A;  2A6E C;  4IUU A;  1ZYR C;  4KK7 A;  3IL8 A;  2AQ3 B;  2SDF A;  1HUM A;  1BR9 A;  5CV6 A;  2CW0 C;  2K28 A;  3ND9 A;  2K7V A;  1HTP A;  2O5J C;  3NSW A;  2ZXP A;  3MHB A;  1QNK A;  4E6I A;  1QOH A;  4WFN 3;  3KBG A;  5M3F B;  1QIL A;  1MBY A;  3RUZ A;  2A6E D;  1JC7 A;  2N55 A;  1BCP F;  2EYP A;  1E2Z A;  1I4P A;  3T56 B;  4F7X A;  5CV5 A;  1K83 B;  1QCB D;  2KA7 A;  3NPP A;  3CQZ B;  3QOJ A;  1TY0 A;  4EVO A;  5FO9 B;  1B44 D;  3U9O A;  3LNN A;  1VMC A;  4X3K A;  3GTO B;  5I2Y A;  2MGS A;  4K5X A;  3MFG A;  2R61 A;  3A54 A;  4A3K B;  2NBF A;  1GJX A;  1ENC A;  1EQT A;  3OHX C;  4K2K A;  5FK9 C;  1GOZ A;  2NN6 I;  1A2U A;  4A93 B;  4IFD J;  4ZK9 B;  3OWE B;  3GTK B;  3NK9 A;  2A5H A;  1PTO F;  4ZYS A;  1EY5 A;  1WTR A;  3K59 A;  2R3Z A;  4PMC A;  3OOC A;  3VR3 A;  2KQ3 A;  2EYM A;  3ERQ A;  3D4W A;  3MZ5 A;  2A68 C;  1RDP D;  1I3Q B;  3T51 B;  1R9T B;  1ILP A;  5M3M B;  4EQO A;  3C2P A;  1D1K A;  2KVM A;  3HRZ C;  2K32 A;  3S2H B;  2WII B;  1Y8N B;  3QJY A;  4TRD A;  2BDN A;  1MI2 A;  3H3V C;  3GQB A;  5C4J B;  1LTB D;  3M4O B;  2NN6 G;  2L55 A;  3DUZ A;  4KN7 C;  3NBH A;  2ZT9 C;  1ICW A;  4NW2 A;  4XQQ A;  1PZJ D;  2B2V C;  2JA6 B;  2O2L D;  1U4M A;  2Z8L A;  5JPM C;  3BS1 A;  3SK4 A;  4K6L A;  1GUO A;  4CJ1 B;  5K36 H;  3K5N A;  3D8G A;  3HEJ A;  3GTM B;  2WKC A;  3RZO B;  5TSS A;  4HSP A;  2AQ2 B;  1ZEQ X;  4XIG S;  3H6M A;  4DAP A;  3DWQ A;  3SK5 A;  1GUG A;  4FXD A;  2K5W A;  2B2Y A;  2FIN B;  2O4X A;  1S5B D;  4ZLT F;  5EBD A;  1KNA A;  5C0X J;  3T4A C;  3MA2 B;  3MVV A;  5CV8 A;  2F0V A;  4RAU C;  1B50 A;  1HA5 A;  4Z9C B;  3A7L A;  2MUY A;  4DXF A;  2M2L A;  5IT9 L;  1D1I A;  2DY8 A;  3WOE A;  3BZD B;  3VR4 A;  1PYW D;  4G7Z C;  1VDZ A;  5FKA C;  1SYF A;  3K5L A;  3TN2 A;  1VF5 C;  1TWA B;  4F88 A;  2VNU D;  4N9T A;  3OW7 A;  5ELB A;  1F2Z A;  5DEH A;  3PIO 3;  2BOS A;  1K8M A;  3QB3 A;  1HCZ A;  4QIW B;  1ENA A;  1HHV A;  1LTG D;  1Y1V B;  4G7H C;  1ET6 A;  4V0B A;  4U67 3;  1BCP D;  3L7Z C;  5IGG A;  4X3S A;  3MAQ A;  2PQE A;  5IGF A;  4K5W A;  3IKJ A;  5JAV A;  5LL6 S;  5D65 A;  3C46 A;  3Q6S A;  4MIU A;  2EE1 A;  4K2L A;  5K36 G;  1IKM A;  1C4Q A;  3M85 A;  4XT1 B;  4QUC A;  4IZ8 A;  2XNA C;  4RFB A;  1D6E C;  2DY7 A;  4QUF A;  2ID0 A;  2QEJ C;  1QWY A;  1G6Z A;  1T5E A;  2OT2 A;  3BDO A;  2F0F A;  2K04 A;  2Q8I B;  1PTO H;  2F0E A;  1STG A;  1SMY C;  1SJE D;  3H0G B;  1SNQ A;  3FPP A;  4FP5 D;  1SDF A;  2OEO A;  1WVL A;  2HQE A;  3JAM L;  1GUT A;  1MSG A;  5J22 A;  4XYQ A;  3S15 B;  5COY A;  4KMU C;  2QCP X;  3W2D A;  4TKO B;  3MTS A;  1DM0 B;  2EYL A;  3E5S A;  1HA6 A;  5M5Y B;  1JIC A;  3X3M A;  2EZV A;  1WTX A;  1ZYR D;  2RVL A;  3K58 A;  4TQU S;  3DEO A;  4OIK A;  5C5M A;  4BY7 B;  2E74 C;  1OXU A;  1KLU D;  1O80 A;  2NN6 H;  3RD4 A;  4XTC S;  4B9W A;  3SVM A;  1Z7T A;  2MJ8 A;  2NVY B;  5C0X I;  1O7Y A;  5IOD A;  1PDQ A;  3CRK C;  1BCP B;  5CV7 A;  5JOB A;  1B3A A;  2J4X A;  5D3D A;  3K5O A;  5KND A;  1PTO C;  2MP1 A;  1PRT C;  4G57 A;  4HTH A;  1KNE A;  4LMQ D;  1F2Y A;  2JEA I;  2PPB C;  4JBW A;  1O7L A;  4A3G B;  5M5W B;  2DNC A;  3MXP A;  3QOL A;  3K6O A;  2XVS A;  3O13 A;  3SK8 A;  2H1E A;  3NQT A;  2BE5 C;  3NHH A;  3GV3 A;  2EXZ A;  5COR A;  2JP1 A;  5KEE A;  5C0X G;  1JQY D;  3KF8 A;  1B1Z A;  1WD1 A;  1SEB D;  1ZXT A;  5FO7 B;  2F0L A;  3UI2 A;  2RSN A;  3PUW A;  5IGB A;  4DN4 M;  1V8Q A;  5BN3 A;  3ZYY X;  2WIN B;  1RTO A;  2R92 B;  1MD2 D;  1TWF B;  4PNY A;  2HCC A;  5C3W A;  4JK1 C;  5CR3 A;  5ELC A;  2NVQ B;  5LL6 X;  1SYG A;  3OIQ A;  4F87 A;  1SYC A;  4HN7 A;  4IUT A;  2E2J B;  2F0S A;  1NUC A;  3S2D B;  4RCO A;  3P75 A;  1SNC A;  3E0J A;  2QF7 A;  1KAB A;  5EPL A;  1HQM C;  2B8G A;  5JPN C;  3TP7 A;  3I4M B;  4R9W A;  1KDB A;  4R8I A;  1A3U A;  2PW7 A;  3DWA A;  2EY1 A;  2X6G A;  1SE4 A;  2J7Z A;  3NWT A;  3TME A;  4HMJ A;  2VUM B;  3HOW B;  3LWE A;  1EIG A;  2KEE A;  2SEB D;  2FFK B;  1LTI D;  3HOX B;  1WTO A;  4U68 A;  3I90 A;  1TS3 A;  1U4R A;  1VCI A;  2ICI A;  3FRP B;  1PXU A;  1FNW A;  1FD7 D;  1EYC A;  5BN5 A;  4FNF A;  4DU9 A;  3BG3 A;  2B63 B;  3TP6 A;  4G4K A;  2IX0 A;  3TZU A;  4IFD I;  1G29 1;  2K1B A;  3CHB D;  3IFD A;  1HPC A;  5IOC A;  3G7L A;  3AU7 A;  2KEC A;  2IWH A;  4FF3 A;  3Q23 A;  5KRU A;  2PYK A;  4A3E B;  1STB A;  5DM7 3;  4FF2 A;  5E1F A;  1WTP A;  1BBX C;  2F3V A;  1GHK A;  2XRS D;  2ENB A;  2XRQ D;  1SE3 A;  1TVX A;  1CFM A;  4LJZ C;  4PV1 C;  1CZG A;  3BYT B;  4XXE A;  3OSO A;  2IX3 A;  5EPJ A;  3V2T A;  1JR0 D;  3VYU A;  4LAA A;  1OXS C;  4NKL A;  3J7Y W;  3BDC A;  1TT2 A;  2NTT A;  4FXK C;  3I70 A;  2EVB A;  5DM6 3;  1H9K A;  2IJ0 A;  2KED A;  3GP7 A;  1BXT A;  3CKI B;  2HUG A;  1EWC A;  1YNN C;  3D6W A;  4WJW A;  4CGY B;  1U4P A;  2B2T C;  1IL8 A;  2CHB D;  2L5T A;  1LT6 D;  2F0W A;  3GD7 A;  2JYO A;  5IIF A;  1RD9 D;  4L8J A;  4DGZ A;  3I3C A;  2F0U A;  4OIJ A;  2PNR C;  4PMB A;  1QNU A;  3NTH A;  3CU7 A;  1YNN D;  3KBX A;  1BCP C;  1SFO B;  1SYE A;  4C3J G;  2B2Y C;  1JWU D;  5EGT A;  2IPK D;  2AUK A;  3MXU A;  1A6X A;  1VF7 A;  1V1P A;  1D5Z C;  2YU9 B;  1EYD A;  3HS0 C;  3DMU A;  1SE2 A;  3SR1 A;  1ML0 D;  1K8O A;  4KHV A;  5KNB A;  1IYV A;  1Q90 A;  1CT1 D;  3EJI A;  2B2W A;  2JEB I;  5C3X A;  2FMM A;  5C5L A;  1GHJ A;  2G9D A;  2L11 A;  3HOZ B;  1B4O A;  2B2U C;  2K33 A;  3OWF A;  1PZI D;  2NTS A;  3S1N B;  1SAP A;  2I46 A;  2D62 A;  3L3O C;  1M8A A;  3TSS A;  2EDG A;  1RJT A;  2KHS A;  4IAL A;  4I7Z C;  1EY4 A;  1NCV A;  2F0N A;  2C9O A;  4B9X A;  1F2L A;  3NQI A;  1NSN S;  2DN8 A;  3NP8 A;  5C6A A;  1I6V C;  1OXT A;  4NDX A;  4RKL A;  1LO5 D;  1STH A;  4A3B B;  2JA5 B;  1WCM B;  2A73 B;  3QWN A;  4ZKB B;  1JE4 A;  4BA1 I;  4FF4 A;  4DAV A;  3I91 A;  2F0D A;  4KJN A;  4BS9 A;  5I9O A;  1AP0 A;  1JOO A;  2WAC A;  2VB3 X;  1EQV A;  2AWN A;  3MEH A;  4FF1 A;  2H4O A;  2F3W A;  5M5X B;  1I4R A;  2NZ1 D;  1X3P A;  3VR6 A;  3GTJ B;  1FNU A;  1ESR A;  2WB1 B;  2WV6 D;  1GXD C;  4XT3 B;  2L12 A;  5D3I B;  2HDM A;  1BDO A;  4WRD A;  4DK0 A;  3L9A X;  4K8J A;  3R2I A;  2ZXO A;  3Q24 A;  1U9R A;  3VYS A;  4IN3 A;  2EY6 A;  4BWG B;  3PUZ A;  3BVG A;  4H0L C;  2I07 B;  4RKB A;  1R4P B;  3VR2 A;  2K5D A;  4ZAI A;  2WKD A;  3J7A V;  3WDN A;  5FO8 B;  1SXT A;  4K6D A;  4BY1 B;  2OF1 A;  4H44 C;  2KJX A;  2R7Z B;  1MGS A;  3S16 B;  4S3S A;  4ABN A;  2PZT A;  3Q22 A;  3GV6 A;  1TS5 A;  1O7Z A;  4IUN A;  4PMW A;  1B9M A;  1CZW A;  1LTS D;  1TY2 A;  5E3F A;  2NUC A;  2SNS A;  2LS0 1;  2JSO A;  5T1G A;  2N88 A;  3I73 A;  2NB0 A;  1X3Q A;  3F2U A;  2B2T A;  2B39 A;  3GTL B;  4DXG A;  4R8N A;  4QF4 A;  3TZD A;  3PUX A;  4ZRZ A;  1LTT D;  4ODG A;  3SHL A;  5F2D A;  1B53 A;  4BBS B;  4C3J B;  1EEF D;  4ZQ3 A;  3LWU A;  4DA2 A;  1JWM D;  2A69 C;  1DJR D;  3J81 E;  3HP3 A;  5HGT A;  2JXM B;  4IUP A;  2NWG A;  4RGT A;  4HMI A;  4KKT A;  4BA2 I;  1NAP A;  4RA8 A;  1G2T A;  1UAP A;  2IX1 A;  1OXX K;  3R93 A;  4IFD H;  2RKS A;  4WOR A;  2F0M A;  2LFN A;  3D4D A;  5D14 A;  1WTW A;  4NMZ A;  5ELE A;  1LT5 D;  2F4I A;  5I2X A;  1ILQ A;  1ZKO A;  1F77 A;  4J1M A;  4EGV A;  1CQV A;  3EFX D;  1QG7 A;  1IYU A;  3K0Y A;  1TU2 B;  2K05 A;  1DOM A;  4F8M A;  2EYJ A;  3FPU B;  2LKV A;  3PV0 A;  2PZU A;  3H94 A;  4A3I B;  1DXM A;  1EY6 A;  3K7A B;  1CA6 A;  5FOB B;  1J9O A;  3S1R B;  1RTN A;  1TII D;  2F0O A;  1SYD A;  3D31 A;  4GZY C;  3TDQ A;  4DK1 A;  5J1Z A;  1BOS A;  2EOT A;  3KLS X;  5KIX A;  2K01 A;  3C1E A;  3R8B A;  4K8I A;  3J81 L;  1G8Z D;  2F03 A;  1UUP A;  4KY5 A;  3PMF A;  5IT9 E;  3D3R A;  4XYO A;  5G3L F;  1CQF A;  3LX0 A;  3SE0 A;  2XSC A;  1EZ8 A;  1TKW B;  2BA0 A;  5JVG 3;  4C56 C;  5C0X H;  4A3M B;  4XDX A;  3OMC A;  4KY7 A;  4A3F B;  1CHQ D;  3T16 A;  3K5M A;  2QDB A;  1L0X B;  5CC4 A;  1RF2 D;  4RGN A;  4Q0F A;  3K57 A;  4OO1 H;  1H9J A;  1DD2 A;  1JOQ A;  1LT4 D;  2CW0 D;  5C4X B;  5FLX E;  1FGB D;  2EJG C;  5EJW A;  3GTQ B;  1PFM A;  1TWG B;  3NXW A;  3HOU B;  3AMU A;  4O42 A;  1PLF A;  1AZP A;  4KV6 A;  1FNV A;  3FVQ A;  3X3N A;  2TSS A;  1S5C D;  1SSO A;  2X6L A;  2PCF B;  3S17 B;  1ENF A;  1KLG D;  1HFG A;  3TP5 A;  2F0G A;  3PUY A;  3H91 A;  3D4R A;  1OXV A;  5EKK A;  1FR3 A;  4BBR B;  4H7B A;  1DZ1 A;  2XN9 C;  1T5X D;  4ULL A;  1LTR D;  3U9S A;  2X69 A;  3A7A B;  1LV9 A;  2L4N A;  3M7G A;  3M7N A;  2NYZ D;  1PMR A;  3HZX A;  1V1P B;  2SNM A;  3I72 A;  3MWY W;  3R2T A;  1SND A;  4EQN A;  4KI0 A;  1PTO B;  5T1I A;  5CBE E;  1AFP A;  2BCO A;  1SNM A;  3ONA B;  1HTL D;  1DON A;  2M9V A;  5KYL A;  1KDC A;  3KUP A;  1WD0 A;  3DM1 A;  2KCN A;  1KDA A;  3TBI B;  2RDF A;  3T53 B;  1D5X C;  2E2H B;  1STN A;  1EY8 A;  5KGU A;  2EY2 A;  5LHY 1;  4KHZ A;  2F0P A;  5JEA G;  5CYU A;  1CK1 A;  3AB9 A;  3QO2 A;  4CKC A;  3RMH A;  4KD4 A;  1II3 A;  2RBM A;  1AW7 A;  3M4Y A;  2Y0S B;  1BQQ T;  3MXG A;  4HSV A;  4G7O C;  2A68 D;  1TQO A;  2Z1C A;  3N6R A;  3P7J A;  2BA1 A;  5A2Q L;  1KAA A;  1Z47 A;  2B2V A;  2YYZ A;  5CGK A;  1H9S A;  2HDL A;  4I65 A;  3TP8 A;  4AYB B;  3RZD B;  2FMC A;  2M00 A;  4HCS A;  4L63 B;  1D5M C;  1STA A;  3KLS A;  3V96 A;  1GUW A;  2F0K A;  3M3Y B;  3DHQ A;  1JOK A;  1SNO A;  4P2C B;  5ELF A;  4H13 C;  1S5E D;  4XQN A;  3PO3 B;  2OXP A;  3I8Z A;  2A6H C;  1STY A;  2A69 D;  4C1N K;  1IKL A;  3S14 B;  2O5I C;  5CMD A;  1M4V A;  3VYR A;  1I50 B;  3GO5 A;  3P20 A;  1AN8 A;  2BDO A;  3BVZ A;  2XWB B;  4CBV A;  4K5V A;  1F9P A;  1E0B A;  4RWS C;  1EZ6 A;  1CI3 M;  2D5D A;  4CKB A;  5IGC A;  1PFB A;  2VB2 X;  2BE5 D;  3SDZ A;  2PZW A;  5A2Q E;  2JA8 B;  4YIJ A;  5CV4 A;  2TMP A;  3NBI A;  3A56 A;  1W6K A;  2B2W C;  1LLR D;  1UEA B;  1PTO D;  3NUC A;  1H9R A;  1EY7 A;  4ID6 A;  4ZUJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...