1DXMA

Reduced form of the h protein from glycine decarboxylase complex
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
131
structure length
131
Chain Sequence
SNVLDGLKYAPSHEWVKHEGSVATIGITDHAQDHLGEVVFVELPEPGVSVTKGKGFGAVESVKATSDVNSPISGEVIEVNTGLTGKPGLINSSPYEDGWMIKIKPTSPDELESLLGAKEYTKFCEEEDAAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductases(acting on ch-nh2 donor)
molecule keywords H PROTEIN
publication title Interaction between the Lipoamide-Containing H-Protein and the Lipoamide Dehydrogenase (L-Protein) of the Glycine Decarboxylase Multienzyme System. 2. Crystal Structure of H- and L-Proteins
pubmed doi rcsb
source organism Pisum sativum
total genus 35
structure length 131
sequence length 131
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01597 GCV_H Glycine cleavage H-protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1dxmA00
4KN7C 2KCCA 3BG3A 2O5IC 1IW7C 1K8MA 2O5JC 2E75C 2Q8IB 4GZYC 4KN4C 4DNRB 4TKOB 3A7AB 1OXVA 1H9RA 2A6HD 3T51B 1VF5C 2E76C 2KA7A 4XTCS 1DD2A 3PUWA 4DK1A 4H0LC 2BE5C 3M7NA 1O7LA 1V8QA 5KNDA 4G7HC 2F1MA 3OW7A 4RCNA 1Z7TA 2A68D 2PCFB 1DXMA 2JE6I 4XIGS 1V43A 1LABA 3PUVA 3RLFA 1H9JA 1GUOA 5K36H 2YYZA 1E2ZA 4L8JA 4JK1C 2E74C 2A6ED 1H9SB 5BN3A 3T56B 5JEAH 1QJOA 3A7LA 3DXJC 1Q12A 1Z6HA 3FPPA 2EDGA 2B8FA 2JXMB 3KLRA 4KMUC 1TKWB 2LMCB 4KKUA 2JEBI 2K33A 3ND9A 3SE0A 3VR4A 4LJZC 1CI3M 3FMCA 2NN6I 2PNRC 2K32A 4TQUS 3PUZA 1Q90A 3CRLC 2AUKA 1T5EA 2BA0A 2A69D 2ZT9C 3U9SA 1OXSC 3QIAA 1GHJA 1G291 2NN6G 1SMYC 1VF7A 2BDOA 2EJFC 2QF7A 5K36G 1PMRA 2L5TA 2PPBC 3QG1A 1FYCA 1ZKOA 2NN6H 3PUXA 1Y8PB 5BN4A 4BA2I 2EVBA 2D62A 4LK1C 1IYUA 2A6HC 3IKJA 3MXUA 5JEAG 3M85A 1Q1EA 1E2VA 1H9KA 3PUYA 4IFDH 2JEAI 3LWUA 3A8JE 3IFTA 4IQZA 1EWHA 1Y69U 1GHKA 1OXUA 4JBWA 2DNCA 1GJXA 3EQLC 5KNCA 3WDNA 2R6GA 3SDZA 1E2WA 2A68C 3VA7A 2BA1A 4KKTA 3QJYA 3TZUA 1Q1BA 1HTPA 1OXTA 3GD7A 4G7OC 4KKSA 1GUTA 3I4LA 3OOCA 1HCZA 3VR2A 3L7ZC 1IW7D 1H9SA 1OXXK 1BDOA 1ZYRC 3H94A 2DN8A 2A6EC 4DK0A 5C0XH 4OO1H 4KHZA 1LACA 1Y8OB 1I6VC 3D4RA 1HPCA 2D5DA 2AWOA 5A35A 3HGBA 4H13C 4IFDG 4G7ZC 1DCZA 2BE5D 2DNEA 1O78A 3LNNA 1B9NA 1ONLA 5KNBA 4I7ZC 2A69C 3I73A 3BDOA 3GQBA 4OGQC 3N6RA 1GUSA 1Y8NB 1CFMA 3NE5B 3W3AA 1GUNA 1VCIA 1K8OA 3VR3A 2EJMA 3MFYA 2AUJD 3CRKC 1B9MA 3PV0A 1H9MA 5C0XG 4OO1G 2K7VA 3P20A 3D31A 1A6XA 1GUGA 2V4DA 1VDZA 3OPOA 4DNTB 3VR5A 1YNNC 1FR3A 3VR6A 1CTMA 2IT1A 3I72A 4KI0A 2D2CC 3A8KE 3A8IE 3AB9A 4H44C 1HQMC 3ND8A 5BN5A 4BA1I 3T53B 1TU2B 1YNJC 4HR7B 2EJGC 4PV1C 3M4YA 2CW0C 1IYVA 2B8GA
chains in the Genus database with same CATH superfamily
4CKBA 1PH5A 4RA8A 3K5MA 1B8AA 4PMBA 2OWOA 3STBC 4DAPA 4A3MH 4DFAA 3JAMc 4X3KA 3NENA 1D5MC 1TWCH 1C7YA 5D3IB 1K83H 1O7ZA 5K5PA 4JI5Q 3PUWA 2WAQG 1O7LA 2F0KA 2WAQE 1SROA 4X66L 2XWJB 1Q3LA 5T1IA 1PH6A 3G6EA 3PUVA 2HUGA 2N55A 3S14B 2XIWA 3ICEA 2XGTA 2KCNA 2PZWA 1MGSA 2RBMA 4QUFA 1QOHA 5ELFA 4HJAA 3HOUH 3G71A 2WKDA 2GA4B 4DUZL 4FYDA 1A8VA 2JEBI 3CKIB 3RD4A 2LKVA 1QB5D 1STEA 4DAYB 3FMCA 1IKMA 2GN5A 2KEDA 3PUZA 4GLVB 4BBRB 2A69D 1VQFA 1OXSC 2K03A 4YY3Q 2QF7A 4ME5A 4JPBW 1KHIA 4NPSA 1ZKOA 3PSIA 1TWAB 1U4LA 1XYIA 1VQEA 5IGEA 3M85A 2QEJC 1L0YB 1NBWA 2MP1A 4IFDH 2B63H 3CCJA 3NTKA 4UAIA 4DV4L 1PXUA 2OT2A 3T4AC 5FJ8H 4J15A 3LWEA 3SK5A 4HMIA 3QJYA 1KRSA 4A3KH 2IPKD 1EFID 1EY0A 3OOCA 4FF1A 3WOFA 4DK0A 5FLXL 1JOOA 4IOCA 1R4QB 3D6CA 5DLQE 5EKLA 1UEAB 2K14A 1PFMA 3JC66 3I55A 3F8TA 5E7NA 1B4OA 1K0SA 1ONLA 1CUKA 3I4MG 5JJIA 2IW3A 2YV5A 3ITPA 1P16A 4PNYA 3FP9A 3S14H 3DWAA 1VQCA 1JE4A 5GROA 4OO1I 4QUCA 1UAPA 3MFYA 5I2XA 4OO1G 2KHJA 4YCWA 2B2VC 5ELBA 1U9RA 5CORA 1FJGQ 4H44C 4DN4M 2I5MX 5IYDH 3FKIG 5IP9H 2R7ZG 5IGGA 1YNJC 4BBRH 1D2BA 4JI1L 3HEJA 4WJWA 1SE3A 1HA6A 2MQHA 2SNSA 2Z6KC 4FF3A 2E5LQ 2KCCA 2L9HA 2OXPA 4DV0Q 2Q8RE 1IW7C 1TWAH 3J81L 3T1YQ 1SXTA 1OXVA 3R93A 2K6AA 4AYBG 4AYBE 2A74C 1SE2A 4JI7L 3M7NA 1L0WA 4I65A 4R4QA 4G7HC 1J9OA 2IHFA 1ENFA 5FK9C 3CCUA 1AP0A 1SYBA 2MHVA 4OIJA 3N52A 5K36H 4DR2L 2A19A 3IFDA 4Z9CB 3SK8A 4LFBQ 1A3UA 1TS2A 3OW2A 1I4PA 1XNQQ 2WB1G 2WB1E 1AW7A 1MHWC 2CH4A 4A3JG 3VR4A 2FINB 4X62Q 3ZJYC 4X3SA 1Q90A 3CCQA 1VQDA 4DV3L 5C44G 1HFNA 1D7QA 1KDBA 1SMYC 4QY7A 4X65L 4RG1A 4L6TB 1PMRA 2QILA 5C4ZA 1EWCA 1GXDC 2KUMA 1Q8KA 2VL6A 2Z4HA 3O13A 5I6YA 1WD1A 1AE2A 1E2VA 4DV1Q 4POFA 4DF7A 1WTPA 2B2YA 3KFUA 4RGMA 1HZCA 1EY8A 3HOZG 5C5LA 5EPLA 3I4OA 3Q8DA 1MJEA 3G6JB 2UUCQ 5ELCA 1PYBA 3VR2A 2KENA 2EE1A 2DN8A 1TR5A 1I3QB 1LLRD 4RWSC 2LXKA 3KBGA 5I6WA 4H13C 4A75A 3Q0AA 4A3EG 1DZ1A 4IPGA 4QIWB 2KHIA 5M9OA 5M5XB 1G6ZA 3D0FA 1GO3E 4OL7A 2YTVA 4DGZA 3EIVA 3I4MH 1KXLA 1PHJA 1K8GA 1H9MA 4NXNQ 1IBKQ 3VYRA 1ESRA 1CTMA 1JCKB 3I72A 5LMUL 3A8IE 1HNZQ 3A55A 3CPFA 3HOXB 3HP3A 3K0XA 4XQQA 1YHBA 2PI2A 2EJGC 4CBVA 2NVTB 4IUPA 4RKBA 1RTNA 1QWYA 2ICIA 1EFWA 1YJ9A 3X3NA 2FMMA 5C5MA 1VQHA 2RF4A 1BO0A 5I9OA 4B3TL 5M3MG 3H3VI 1B53A 4IPHA 2F1MA 2MFIA 4RCNA 1I5FA 2A68D 3R2TA 4JBJA 3H15A 4A3DB 4JI0Q 2RCNA 3GTOB 4HTHA 1G91A 2BOSA 4DV5L 3GTLB 4R4IA 4HIKA 3PIO3 4DV2Q 5ELOA 2CWAA 2MUYA 2PMZE 5AJ3L 1QJOA 1I3QH 1L1OC 1RCVD 2A5HA 2F0NA 3FPPA 1KLGD 2JXMB 1B3QA 3EVQA 4UP9A 3HKZB 4FF2A 3W5OA 5M5XH 2YTXA 1E22A 3BYTB 3Q23A 3BZCA 2VXWA 3MWYW 2L5TA 4KK7A 1AZPA 1TWHB 3HZXA 1PTOB 2NYZD 3DUZA 3T13A 2EPBA 3HOXH 1OXUA 2OTLA 1DM0B 1NE3A 4PG3A 4G57A 3PIOA 4EVOA 4IPCA 2SEBD 5KRUA 4DV6Q 2NVTH 3IAYA 1BBXC 4O42A 2OTJA 4X66Q 1XMOQ 3BYYB 4L5TA 3Q6SA 1CZWA 2B2UA 2C9OA 4DK3C 2NBFA 4YHHL 3STBD 1SMXA 3L2PA 3E6ZX 1YZ6A 3KDFB 3S2DB 2G9HD 4RGOS 2FJ2A 1KRTA 1X65A 1EIYB 3I73A 4R1JA 4LF7L 4A3DH 2LXJA 4DUZQ 3J7ZC 3GTOH 1Y8NB 4DR6L 2EIFA 2MO1A 3GTLH 3TQYA 3HOWB 2F4IA 4BY7B 5GADC 5IYBH 2B2TA 4A3CH 3AB9A 2OCEA 1HQMC 4OWXB 3S1QB 3TDQA 1ZXTA 3J81c 3RUZA 2H4OA 2B8GA 2Y0SB 1FVIA 1VQLA 3DEPA 4BY1B 1TWHH 2E75C 1X9NA 1PTOH 4B3RL 4L5QA 2F4VL 4H7BA 2R61A 1MI2A 3KLWA 4HCSA 2NB0A 2JA7B 5EPKA 4IUVA 2BH8A 3JAMi 3RLFA 1E0BA 3TMEA 5GAHC 2UXBL 4DV7L 1ENAA 1VQJA 3GTQB 3VYTA 4IJLA 3RR5A 4JI4L 4JI3L 3DEOA 3K0YA 4N8FA 4C3HB 1C4QA 2F0JA 4KHVA 1SRUA 4GNXC 2F0DA 4LJZC 4WRDA 4AH6A 1SLJA 3VYUA 2NN6I 1PVOA 4XDXA 3A5ZB 3TBIB 1S5CD 4GN5A 1IYJB 2NN6G 5EAYA 4LF6Q 3TSSA 4DR1Q 3Q22A 4JI1Q 1Y8PB 1SDFA 2F0LA 2MNAA 4BA2I 4K6DA 4DR3L 3IKJA 4BY7H 5E4WC 4K0KQ 1L2FA 1YHQA 1UE6A 2NVYB 2XNAC 1EWHA 4LUOA 1SJED 1AZQA 4JV5Q 1JOQA 4GN4B 5EKKA 2IWHA 3PO2G 1YNJD 1N32L 2HQEA 1KABA 4JI7Q 1SSOA 4LUVA 4P74A 1SNDA 4MZ9A 4BY1H 1HCZA 2JN4A 1IW7D 2D9UA 1BDOA 2VW9A 4A3FG 1UNSA 1SYGA 1XNRQ 3C3LA 1I6VC 3I7FA 1HUMA 1JWSD 2L15A 4LF9L 2EQSA 3E9IA 4GLXA 2EY2A 2JA7H 4C3IG 1PH2A 5IE8A 1N8RC 3J80L 1N34Q 4U673 1F9PA 3OIPA 1S5BD 1TWGB 2EJMA 2CKZB 4DV3Q 3DWPA 2ZXPA 3CQZB 4C3HH 4PMWA 1B7YB 3RZDB 4UP7A 5BN5A 2F3WA 5IP7H 2HT1A 4CKEA 2NTSA 3S17H 1KAAA 1VQ5A 5CBEE 4DR5L 1HNXL 4DU9A 1RL2A 4DAMA 3BS1A 3P7JA 2JA8B 1CQVA 4JVZA 4DR4Q 5FO8B 2QW7A 2VQEQ 3L0OA 2MO0A 1QZGA 1SNOA 3URYA 1DD2A 2NVYH 1MBYA 4H0LC 4DUYQ 3KUPA 4KD3A 1O7YA 4CDFC 1FD7D 2F0WA 4A93B 1KNEA 5LMNW 1SBBB 5TSSA 5COYA 1YI2A 2ES2A 1GUOA 1E2ZA 3OWFA 1BUVT 4A3MG 2B29A 5IGDA 5JJLA 1RODA 1XMQL 1LO5D 3D4DA 2MGSA 5LMUQ 3OTOQ 5NUCA 4Y52H 4BWGB 1TWGH 2PPBC 2NN6H 1V9PA 2LY7A 2EVBA 2D62A 3CQZH 3IL8A 1I94Q 3HOUG 1AFPA 4LF8Q 1N33L 4RHRA 4LF5Q 2F0SA 4JBWA 1BCPC 1SJHD 1J6QA 1BCPF 4J1MA 1N36L 3CXCA 1A0IA 1YVCA 4NP5A 1KL9A 4GKKL 2BA1A 2R92B 2TSSA 4G7OC 2DJGC 4LNQA 2JA8H 5CV4A 4QGUA 4LF4L 2Q8TA 4ZKCB 3UDGA 2HDMA 1GOZA 3U4VA 2B3GA 4RGNA 4YCVA 2D5DA 2ZTEA 3MTSA 4IFDG 2B63G 3K7AB 5EPJA 2L11A 3J7AV 5IT9c 5FJ8G 3A56A 4A93H 1GUSA 2WFWA 3S1NB 3NE5B 1WTOA 4XT1B 3UI2A 4A3KG 4IN3A 4KHPL 1EY5A 1HFGA 3WOEA 2F0PA 4CHTB 3I70A 3D31A 1A6XA 3OPOA 3KOJA 2AQ3B 3C46A 1I4RA 2FXQA 2UUAL 4OX9Q 1NR4A 2BCOA 3UE0A 4DA2A 1NTGA 4IJHA 4AQYL 1FNWA 3NP8A 1YIJA 2K5WA 4GS3A 2FMCA 4KN4C 3DLLA 1Z47A 2L0CA 1VS0A 2ALYB 1BKBA 1EWIA 3TREA 3T1HL 1VQAA 2E76C 2KA7A 5FO9B 4YHHQ 4V190 5KNDA 5IYDG 2UXCQ 1EU4A 3I90A 5IP9G 1F2ZA 4BBRG 2JA6G 2KQ3A 3CC4A 1V43A 3S9WA 3E3XA 5C3EB 2ZM6Q 1VQKA 4S3SA 1Q8IA 1ASZA 2K4KA 3MZ5A 3S2HB 1EYAA 3K7AH 4F8MA 1SAPA 1WD0A 1RD9D 3I91A 3AEVA 3KLSA 5JPMC 3M4QA 3G4SA 3CRLC 1T5EA 2RSNA 1NNXA 4JOIC 1IBMQ 3S1NH 4LFAL 3OHXC 5K36G 1DOMA 1FYCA 3NUCA 1QVFA 3SEBA 1WVLA 1QNUA 1X3EA 4LAAA 1UE5A 1H9KA 3DM1A 2K01A 1B50A 2K04A 1GJXA 5IOCA 2F4VQ 2RCFA 3GV6A 4P75A 3TZDA 3RZOB 4ZCKA 4UDUC 3NQTA 2PQAA 2JA6B 2JP1A 4FXKC 3H94A 3PO3B 2NUCA 3SXHA 2UXBQ 4DV7Q 1D6EC 3J80c 5JVH3 4OIKA 1PLFA 3ERSX 1KLUD 3OMGA 1LTAD 1SYDA 3F2BA 4YWLA 2RHSB 2F3VA 5J22A 2IX3A 1YEZA 2KJXA 5C3EH 1BF4A 1B3AA 4WORA 4KY5A 5C4XB 1GKHA 4WJ4A 4N9PA 2IJ0A 3CC7A 3EA6A 3JAME 3S2HH 5HGTA 1VQNA 2ENBA 1FNVA 1JOKA 1SE8A 1TU2B 1UE7A 2ZTCA 4IO9A 3G7LA 4YIJA 4DR3Q 1P8LA 1L1OA 1BBWA 1IZ6A 5D65A 2K1BA 1SNMA 3I56A 1A63A 1H95A 1SR3A 2Z8LA 3I8ZA 3KBXA 4A76A 4B3SL 1X32A 1AE3A 3A74A 3CW2C 4ZRZA 3J81i 5JJKA 3KJOA 3GV3A 1X55A 1U4PA 3OMCA 2JA5B 2EXDA 4CKCA 3ULPA 2Z9HA 1JJCB 1TY0A 4QCLA 1V1PA 4CGYB 2KCMA 3GTPB 3M3YB 2Q2HA 5ELEA 4LF9Q 2YYZA 2L1BA 2JA6H 3X3MA 2ZJRA 1SYCA 4DKAC 3PQIA 1EUJA 4JK1C 3PO3H 2O2LD 1UEBA 5CGKA 3KLRA 1K3RA 2RDFA 4XYOA 5EGTA 2ZT9C 2RKSA 2NWGA 2WINB 1GHJA 4OHJA 5C4XH 3P75A 3QG1A 1CT1D 4HAEA 3H0GB 4LK1C 1Y1VB 1IYUA 2A6HC 1VQIA 2BDNA 4K5WA 3J7A5 5IODA 3PUYA 2Z4IA 3ONAB 5DNFA 4FP5D 2DNCA 1PH8A 3WDNA 2R6GA 1E2WA 5IYCH 4KKTA 3NTHA 1BNZA 4QIWE 3BVMA 2KCTA 2NVXB 2VUMB 4F87A 3D8GA 4BBSB 3K5OA 4LMQD 2A6EC 4K2LA 3C1EA 3H6MA 1KDCA 5D3DA 3UDIA 1Y8OB 4NDXA 2M2LA 2JA5H 5ELNA 2I0QA 3HOXG 3TP6A 5KNBA 3GTPH 3BVZA 3GTMB 3M3YH 1HRJA 2ZXRA 2ZJQA 3GTGB 1SE4A 2CCZA 4R4TA 1XMQQ 4JI6L 1RKNA 3EJIA 1WTXA 3EROA 3CCRA 2F0VA 3P1HA 1HZ9A 3A5UA 1EY7A 3ND8A 2B2WC 5T1GA 3TRZA 4PV1C 1HNWL 4A3DG 3U50C 4GNXA 2A73B 2F0IA 4MTKA 1K8AC 3C2PA 3H0GH 4DNRB 1XJVA 4QJFA 1Y1VH 1EQQA 3FDTA 4MN3A 5IYBG 2F03A 4LF4Q 3FEWX 2WIIB 2CHBD 2K5NA 4A3CG 3MXPA 4DK1A 1BCPD 1K73C 3W1GA 3HKZG 5A2QE 3HKZE 1YJWA 1WTQA 1S40A 3HS0C 2NVXH 2VUMH 2E2DC 4B08A 1F2YA 1MJCA 4BBSH 2PQAB 1X6OA 2KBNA 1M8AA 4JI8L 2OQ0A 3HFZB 2EDGA 3S16B 3K8AA 4JYAL 2C35B 1WI5A 2I46A 1EZ6A 1DOLA 1J5EL 5FO7B 1X3FA 3SK6A 3GTMH 4EQ5A 1AN8A 3GTGH 2UUAQ 1W3SA 5CR3A 3D4WA 5HURA 1HH2P 3CCVA 2MPMA 3OYYA 3PUXA 1HZBA 4C2MB 2G5DA 1GHKA 3KF8A 1A3TA 4NXMQ 3D6WA 3HOVB 2A1AA 4IOAA 2AQ1B 1ET9A 1STYA 1L1OB 3TZUA 2OEOA 4UHVA 4DR7L 3ER0A 4K8IA 1SNPA 3HOWG 3QOJA 4HIMA 3V96A 1KDAA 1LACA 2RDHA 3UDFA 4BY7G 2PO4A 4CJ0B 1DCZA 2EY6A 1LTRD 4GKJQ 1V1PB 5J3BA 3I4NG 4OGQC 2E2HB 3TEHB 5E3FA 3S1MB 2Y0SG 2Y0SE 5FLXc 2F0UA 4BY1G 3CRKC 4IPDA 5C4HA 5BR8L 1LM0A 1CSQA 4DNTB 1EQVA 5CC4A 3MC0B 4B3ML 3S16H 2R7DA 1JC7A 1CSPA 4ZKBB 1S72A 1WTHA 2JA7G 4ZUJA 3J7YW 1PV4A 4A3GB 2C5CA 1PFSA 4KN7C 2NZ1D 1I4HA 1NR2A 3CCMA 1FGUA 1RJTA 1WCMB 1PFBA 4C2MH 3H3VC 1JORA 4C3HG 1HR0W 4J6HA 2EYJA 4LWCA 1NSNS 3HOVH 4FXDA 4PZ7A 1STNA 5IP7G 5IGFA 1IBLL 5EKIA 3OWEB 1VMCA 2XN9C 4IUQA 4RMFA 3I4NB 1JB7A 1PZJD 2F0FA 5JOBA 4DV4Q 1TS3A 4ZK9B 1F9SA 1PRTC 1Q12A 2G9DA 1HZAA 3CMEA 1PRTF 4KJOA 1I6HB 2E8GA 2F0HA 4POGA 1NY4A 2KOLA 1QVGA 2OQKA 1B44D 1UUPA 2EY1A 2H1EA 4JI5L 4A3IB 2E2HH 4RH6A 5KGUA 2PI2E 2RDGA 3S1MH 4IZ8A 1EU3A 1DONA 1EIFA 3K5LA 3NWTA 1Q1EA 2PW5A 2GVBA 3G48A 4B3SQ 2KECA 1PYSB 1TQOA 2DUDA 3S2DH 1C8CA 1X54A 2WACA 2CQOA 3SDZA 4GOPC 4JBMA 2BH2A 3LX0A 3ULLA 4A3GH 2E2IB 3QOLA 1STAA 1F2LA 2RVLA 4GNXB 1TS4A 1PH3A 1WCMH 3L9AX 1NAPA 2VY3A 4RKLA 4IUNA 5A35A 3GP7A 3HOWH 1PA6A 4R4OA 1EEID 5I2YA 2WP8J 2IL8A 1PZKD 4ODGA 3NPPA 1ZEQX 5IY0A 2HIXA 3S1QH 3J80i 2JA8G 3I4NH 3VR3A 4MIUA 1JE5A 5ISRA 2NZHA 3JAML 1FL0A 2EOTA 1I6HH 1WOCA 4X3UA 3F2CA 2JK8A 3H09A 4DR2Q 4X3TA 4A3IH 2N49A 4A93G 1CKNA 1WTRA 4NMZA 2CWPA 2LS01 4C3JB 2N8NA 2RSOA 1A2TA 2Q8IB 4A3BB 3CHBD 3NQIA 3E0JA 1EZ8A 5CMDA 2A6HD 3GTQH 2O4XA 4QB4A 3KK7A 1Y14B 1B1ZA 3KF8B 1EOTA 2I07B 1BQQT 1X3PA 4X65Q 4X6AH 2E2IH 1K3BC 4X64L 3CAMA 2EXZA 4HIOA 1A62A 4K6LA 2HHHL 4A3LG 2A6ED 1JWUD 3F2UA 3R3OA 3A7LA 4JCVE 1PH1A 3DXJC 2E5LL 5LMNL 1Z6HA 4JI6Q 3UDXA 1FNUA 2B8FA 1II3A 5I9PA 3E9HA 2PW7A 5CV6A 3T1YL 1CI3M 2I5HA 2EYPA 3DWQA 1XWEA 1BOSA 1HHVA 2R92G 3L3OC 1VF7A 5GAEC 2F0TA 1PFNA 1C48A 5IGCA 1SYFA 1LTID 2SNMA 2VNUD 1HNWQ 2R93B 3H91A 5GAGC 3ZYYX 5FKAC 1YJNA 3U58A 1XTDA 2JEAI 1Y69U 3RMHA 1E24A 4LFBL 1BBUA 2GVAA 4G4KA 1T9HA 1SN8A 3MFGA 4KV6A 4PZ8A 4E6IA 4K14A 1TS5A 1Q1BA 1JWMD 1PH7A 4KKSA 3PF4A 1ZYRC 1TY2A 4TRDA 1KIXA 5DAUA 2VZAA 3PMFA 2XWBB 2EYHA 3NBHA 1B9NA 4OXPA 2ATWA 3ULJA 4ZLTF 3RZDH 4JYAQ 2RA4A 2IHEA 1IKLA 2B2VA 5DM73 5JPNC 1BCPB 3MAQA 4B3TQ 1SYEA 2HDLA 1S5DD 3P20A 2D0OA 1WJJA 4PQXA 2UUCL 4XT3B 4HJ5A 1DJRD 5IIFA 2F0QA 1T5XD 4QQBX 3T53B 1UE1A 4HR7B 2N78A 2Z6KA 4ABNA 4DV5Q 3HRZC 3K7UC 2PQEA 3K6OA 4C1NI 5AJ3Q 5C3EG 2O5IC 2M9VA 2OF1A 1S3OA 1K8MA 1C9OA 3I3CA 2UU9L 2R93H 1WYDA 2E2JB 4TKOB 1M4VA 4DR7Q 2ICEC 3Q24A 3NHHA 2PZTA 1Y1WB 4NXNL 3KJPA 2L55A 5A2QL 1PDQA 1U4RA 2D0PA 2PCFB 2VB3X 4IALA 1HNZL 4BXXH 3C1FA 1LABA 3K81C 4OONA 2K5VA 2F0OA 1HXYD 1WTVA 5JEAH 1SEBD 5L37A 1TWFB 4A3LH 4Y7NB 1UWVA 3CCLA 1ENCA 1LTTD 1W6JA 3CPWA 4YWMA 4FDBA 1Z9FA 4TSSA 3QIAA 5H1SE 1G291 4OWTB 2F0GA 2R92H 4O2DA 1F2MA 4JI0L 2P5ZX 1JQYD 3PO3G 2JJQA 2JA9A 4LF7Q 1K8OA 1QG7A 3EQLC 4DR6Q 2N88A 2ZXOA 2X6LA 5IT9E 4CDDC 3I2ZA 1CKNB 2QEXA 1A15A 5C4XG 1TXYA 4KY6A 5C0XH 2E2JH 4DXGA 4I7AA 2HCIA 5I4DA 4LFCL 4FO2A 3D4RA 1E1TA 3K5NA 1SFOB 3HGBA 1F9QA 2EZVA 3A0JA 2DNEA 2DGYA 2HQLA 3BDOA 5M5WB 5IYCG 4JW0A 3BJUA 4B3RQ 4LUZA 3V05A 5J39A 1TVXA 1CA5A 1I4QA 4DV6L 1Q82C 1EYCA 2HCCA 1XMOL 1PRTD 1TWFH 2CH4W 4Y7NH 4HN7A 1JMCA 2QA4A 2JA5G 1QE6A 2V1CC 4BA1I 3HOYB 5M3FB 1CKMA 4J8QA 5IGBA 4IUTA 5KYIA 2JYOA 1RDPD 4JI3Q 4JI4Q 3NSWA 3M4YA 4Q5VA 3NEMA 3TP5A 5LL6S 5E4XA 2O5JC 4PZ6A 3GTKB 5CV7A 1TT2A 4CDCC 1PH4A 2QCPX 3U4ZA 2Q2IA 1NJIC 1NCVA 1DXMA 3S15B 4XIGS 3NBIA 4P73A 3MXGA 1LTSD 1EIHA 1MD2D 1ML0D 1M1KC 4GN3B 3H0GG 1QUQA 5E1FA 2ID0A 1Y1VG 4K2KA 3CC2A 1N32Q 1SFOH 1TKWB 4XXEA 2WAQB 1AH9A 3ND9A 2IX0A 3SK4A 3SR1A 4YWKA 1BXTA 1CQFA 1XPUA 2K28A 3NBHB 1LT5D 1SNCA 1KNAA 3LGJA 1EEFD 5M5WH 3RLNA 2VUMG 5J1ZA 4BBSG 3RZOH 1CHPD 5M5YB 1S4ZA 1S5FD 1GUWA 5BN4A 4K5VA 4JI2L 3MXUA 1DGSA 1V1OA 3A8JE 4HCEA 4IQZA 1G51A 2K5HA 4RHSA 3J80E 4ID6A 3HOYH 5M3FH 2QDLA 4CJ2C 2DY7A 1U4MA 5CBAE 2VB2X 4HIDA 3A54A 3RLOA 1OXTA 4KY7A 2ZJPA 1YNXA 3RN5A 3KLSX 1EYDA 1IYVA 1OXXK 4JC0A 2Z0SA 5G3LD 3GTKH 4X64Q 4LF6L 1RF2D 4DR1L 1EQRA 1HPCA 4FVMA 4DR5Q 1HNXQ 2HHHQ 2R7FA 4K0KL 1EOVA 2EYFA 3QR8A 1EYGA 5LMNQ 5FLMH 3J81j 2CQAA 3S15H 4JV5L 1CA6A 4WFN3 2QKIC 3S1RB 3KDFA 4ZAIA 1GM5A 1VCIA 1LYLA 3PV0A 2K7VA 1ILPA 1O80A 4YCUA 1XNRL 4ZUIA 2KHSA 4ZQ3A 3I4MB 1E3PA 3SGIA 2NVQB 2FHTA 1XPOA 1RTOA 2QDBA 3NXWA 3NWSA 1A3VA 2YU9B 1NMGA 2EYOA 4Q0FA 5M5YH 1N34L 1S5ED 5CYUA 1A2UA 2J7ZA 4F7XA 1QZHA 1H9RA 1K9MC 3T51B 3TP8A 4IURA 3FKIB 4L5RC 2R7ZB 3GDEA 3UE1A 2PYKA 1DYQA 3MHBA 5D14A 3PIP3 2F3IA 2UUBL 4PMCA 1JB3A 4U68A 4EX5A 4HSPA 1N33Q 1ZYRD 5JVG3 2E74C 3PF5A 1ICFB 1CKOA 4AYBB 4GOPA 1MKHA 1N36Q 1MSGA 1C0AA 4GKKQ 2LMCB 3IRBA 3BU2A 1EY4A 4KKUA 3KF6A 4DR4L 3SE0A 4L63B 1IXRA 4APVA 1I4XA 1VQ4A 1PH9A 3HOVG 2VQEL 4JG2A 1LUZA 3M4OB 2PZUA 2AKWB 4DUYL 1AEXA 3S1RH 2AWNA 2EJFC 1U5KA 3KYHC 1KQSA 1XXGA 1D8LA 1X3QA 2M00A 2WB1B 5KYLA 3PIPA 4A3JB 3AMUA 1LT4D 3R8BA 1K28A 2UU9Q 2NZOA 1HJPA 1CK1A 2DY8A 4KHPQ 5C44B 2NVQH 5FOBB 5EBDA 3TN2A 1I50B 2F0MA 4EQOA 4DNIA 2YU9H 1QVCA 2IX1A 5KIXA 2YTYA 4OO1H 2RHQB 3OTOL 1LTBD 4AQYQ 1JT8A 3EFXD 4KJNA 3FKIH 4G7ZC 1I94L 4K5XA 2R7ZH 5DM63 3TS2A 3GO5A 3HOZB 3ERQA 4LF8L 4RAUC 4LF5L 3N6RA 3K59A 4F88A 2K5QA 4A3GG 1CFMA 3AFPA 3W3AA 1RIPA 4HEDA 4N8X1 3T16A 2AUJD 3T1HQ 1OTCA 3TP7A 1WCMG 4ME3A 1QUQB 1YNNC 3OSOA 4QL5A 4A3EB 1ET6A 3M4OH 4GLAC 2SOBA 2WKCA 4CJ1B 3F1ZA 2CW0C 3E5SA 3BG3A 3VA5A 4MHEA 2AQ2B 3SVMA 5HGQA 3CD6A 1XPRA 3A7AB 4O0AA 2HIVA 4A3JH 1VF5C 3QO2A 3HG9A 3V2TA 2BE5C 1V8QA 2XRQD 3OW7A 1PTOC 4JBKA 4LFAQ 4LFCQ 1PTOF 2N3SA 1Z7TA 4DXFA 5C44H 2R3ZA 4A3IG 4OX9L 1I50H 3GTJB 1HR0L 2J0TD 1H9JA 1YHAA 4ALPA 1VQ8A 4ILWA 3TS0A 2J4XA 5LL6X 3FHWA 1W6KA 3RN2A 2KVMA 5M3MB 4A4IA 1D5ZC 2Q2UA 1OO9B 3HOZH 3CCSA 1HA5A 1EQTA 2SDFA 3CU7A 2NTTA 5IWAL 1R4PB 2UXDL 1QCBD 1SNQA 4C56C 2UXCL 1JJGA 2LSSA 4EQPA 2TMPA 3PCOB 4O1NA 2PMZB 2VQFL 5C4JB 2ZM6L 1VQ6A 1BVSA 4A3EH 1GVPA 3MA2B 2K75A 1ASYA 3AQQA 1VQGA 5IT9L 3DM3A 1PRTB 1ESFA 1H9SA 2WV6D 1XX8A 1IBML 1JR0D 3AYHB 2PNHA 5FLXE 3FPUB 4EGVA 1DOKA 5EQ0A 3NK9A 3BZDB 1Q81C 3VYSA 4QMGA 5ELDA 3LNNA 4I7ZC 2A69C 3GQBA 3BZKA 3GTJH 1MIUA 4K8JA 1K0RA 2XVSA 5EJWA 4C3JG 2F52A 1Q86C 2B2YC 1V1QA 4A3BG 1LTLA 4M1UB 1GUGA 4DK6C 5DEHA 4GOPB 3SHLA 1IHZA 4KI0A 1E7ZA 5M3MH 4YY3L 4XYQA 1M90C 3KF6B 1EY6A 4JI2Q 1MSHA 4UY8C 3W1BA 1KTKA 3MXNA 3H3VH 1D5XC 1Q46A 3MEHA 3MVVA 3FRPB 1PYWD 1VQ9A 2XRSD 5KEEA 1VQBA 1G2TA 4V0BA 3M9BA 4GZYC 1N9WA 3J81E 2ZTDA 3FVQA 5C6AA 5C4JH 3S17B 2X69A 2X6GA 2CFMA 3S24A 1YITA 1G6PA 1CZGA 3DMUA 3D3RA 1G8ZD 1CM9A 4B9WA 1LT6D 2K05A 4KD4A 5CV9A 1KC8C 4RCOA 3T56B 1HQRD 2EYMA 1O7IA 5C3XA 2R93G 4DPGA 1LV9A 5G3LF 4NB3A 1ILQA 1B70B 1Q7YC 1KAWA 1B2TA 4JOIA 2PNRC 2K32A 4KTAA 5JEAJ 3R2IA 2AUKA 1EY9A 3U9SA 4BXXG 3K58A 5LHY1 1FJGL 4C1NK 2K50A 3AFQA 1EIGA 5CV8A 2H5XA 5JEAG 2K52A 1HUNA 1VQPA 2Z1CA 4HJ9A 1F77A 2VS1A 1L0XB 4DV0L 3EN2A 5KNCA 4TVAB 4OEMB 1IL2A 1X3GA 1EL0A 4P2CB 3M7GA 2L4NA 1GUTA 3AU7A 3BDLA 3VA7A 2Z6BA 3L7ZC 1JICA 1STBA 1VMPA 1QNKA 4P71A 2UUBQ 4B9XA 1X56A 2AWOA 3NTIA 4DAYA 1O78A 1G2SA 4HSVA 4R8NA 5C0XJ 1SMYD 3CF5A 3PO2B 3RNUA 4FF4A 3W2DA 1IL8A 2IY5B 1J8IA 3U9OA 2DJFC 3K80C 5C0XI 1XNQL 1YBYA 1VQOA 2MJ8A 5JJZA 1B9MA 4A3FB 3HKSA 5C0XG 4X62L 2EY5A 3K57A 4QF4A 2V4DA 4RFBA 3PGZA 4RGTA 4C3JH 4FNFA 2Q2TA 1FR3A 4BS9A 2AHOB 2IT1A 4A3BH 2XTIA 1HTLD 4C3IB 2B2UC 1Y1WG 1JJ2A 2RQXA 1LT3D 2QGQA 3B6YA 1D1KA 1W2BA 5F2DA 4JI8Q 1NMFA 4L5SA 3MEFA 4DV1L 1VQ7A 4MTNA 2F0EA 3E0EA 3CCEA 2EYLA 4M8AA 5EBCA 4XQJA 2L12A 1I4GA 2FFKB 1J5EQ 4R4CA 4WJ3M 1F9RA 4XTCS 4UP8A 4MNOA 4EQNA 2XSCA 4ZYSA 2JE6I 3M4PA 5C3WA 2ASBA 4UPAA 2B2TC 1BR9A 3VDYA 4L8JA 1STHA 3WWVA 1H9SB 5BN3A 1KD1C 1QILA 1FGBD 3OIQA 4KLKA 4KMUC 1WTWA 3CMAA 4IUUA 3F2DA 1NUCA 2K33A 3NELA 4IFDJ 3PO2H 2I5LX 4TQUS 2A8VA 3BVGA 2BA0A 2JSOA 5GQOA 4OWWB 1WFQA 4IFDI 2BDOA 4OELB 1IBKL 1R9TB 2K5DA 4HMJA 4NKLA 4N9TA 5HY6A 4A3FH 2CVRA 4A3MB 1STGA 1TWCB 1K83B 1YNND 2KEEA 3LWUA 5JAVA 3IFTA 5CV5A 1PZID 4C3IH 2JQOA 2A68C 1TIID 3MXNB 1RHPA 3QB3A 1HTPA 3GD7A 5BR8Q 4XQNA 2CW0D 3BDCA 1GD7A 3I4LA 4B3MQ 1LTGD 4CDEC 1VQMA 4FXGC 3HOUB 1HR0Q 4KHZA 5AFWA 4LW1A 2B39A 1XTCD 1E1OA 3DHQA 4ULLA 2BE5D 4H02A 4HJ8A 1PTOD 3HOYG 5M3FG 4DV2L 4NXML 4P72A 1CHQD 1GUNA 4DAVA 4AIMA 5IWAQ 3CP0A 3QWNA 2UXDQ 1ICWA 1D1IA 1VDZA 4R8IA 2B2WA 3VR5A 1U0LA 3VR6A 2B63B 2D2CC 3A8KE 1IBLQ 2AMCB 2VQFQ 2HD3A 3J7AF 4NW2A 5FLMG 2LFNA 4HJ7A 1Y1WH 4GKJL 4R9WA 1R9TH 4A3KB 3EBEA
chains in the Genus database with same CATH topology
4CKBA 4RA8A 3K5MA 4PMBA 4DAPA 4DFAA 4X3KA 1D5MC 5D3IB 1O7ZA 5K5PA 3PUWA 1O7LA 2F0KA 2XWJB 1Q3LA 5T1IA 3PUVA 2HUGA 2N55A 3S14B 2XIWA 2KCNA 2PZWA 1MGSA 2RBMA 4QUFA 1QOHA 5ELFA 2WKDA 2GA4B 4FYDA 2JEBI 3CKIB 3RD4A 2LKVA 1QB5D 1STEA 3FMCA 1IKMA 2KEDA 3PUZA 4BBRB 2A69D 1OXSC 2K03A 2QF7A 4ME5A 1ZKOA 1TWAB 1U4LA 1XYIA 5IGEA 3M85A 2QEJC 1L0YB 2MP1A 4IFDH 3NTKA 4UAIA 1PXUA 2OT2A 3T4AC 3LWEA 3SK5A 4HMIA 3QJYA 2IPKD 1EFID 1EY0A 3OOCA 4FF1A 3WOFA 4DK0A 5FLXL 1JOOA 1R4QB 3D6CA 5EKLA 1UEAB 1PFMA 1B4OA 1ONLA 2IW3A 3ITPA 4PNYA 3DWAA 1JE4A 4OO1I 4QUCA 1UAPA 3MFYA 5I2XA 4OO1G 2B2VC 5ELBA 1U9RA 5CORA 4H44C 4DN4M 5IGGA 1YNJC 1D2BA 3HEJA 4WJWA 1SE3A 1HA6A 2SNSA 4FF3A 2KCCA 2L9HA 2OXPA 2Q8RE 1IW7C 3J81L 1SXTA 1OXVA 3R93A 2K6AA 2A74C 1SE2A 3M7NA 4I65A 4G7HC 1J9OA 1ENFA 5FK9C 1AP0A 1SYBA 2MHVA 4OIJA 3N52A 5K36H 3IFDA 4Z9CB 3SK8A 1A3UA 1TS2A 1I4PA 1AW7A 3VR4A 2FINB 4X3SA 1Q90A 1HFNA 1KDBA 1SMYC 4L6TB 1PMRA 2QILA 5C4ZA 1EWCA 1GXDC 2KUMA 2Z4HA 3O13A 5I6YA 1WD1A 1E2VA 4DF7A 1WTPA 2B2YA 4RGMA 1EY8A 5C5LA 5EPLA 3G6JB 5ELCA 3VR2A 2EE1A 2DN8A 1TR5A 1I3QB 1LLRD 4RWSC 3KBGA 5I6WA 4H13C 3Q0AA 1DZ1A 4QIWB 5M9OA 5M5XB 1G6ZA 4OL7A 4DGZA 1H9MA 3VYRA 1ESRA 1CTMA 1JCKB 3I72A 3A8IE 3A55A 3HOXB 3HP3A 4XQQA 2EJGC 4CBVA 2NVTB 4IUPA 4RKBA 1RTNA 1QWYA 2ICIA 3X3NA 2FMMA 5C5MA 1BO0A 5I9OA 1B53A 2F1MA 4RCNA 2A68D 3R2TA 4A3DB 3GTOB 4HTHA 1G91A 2BOSA 3GTLB 3PIO3 2MUYA 1QJOA 1RCVD 2A5HA 2F0NA 3FPPA 1KLGD 2JXMB 3EVQA 3HKZB 4FF2A 3BYTB 3Q23A 2VXWA 3MWYW 2L5TA 4KK7A 1AZPA 1TWHB 3HZXA 1PTOB 2NYZD 3DUZA 3T13A 2EPBA 1OXUA 1DM0B 4G57A 4EVOA 2SEBD 5KRUA 3IAYA 1BBXC 4O42A 3BYYB 1CZWA 2B2UA 3Q6SA 2C9OA 2NBFA 3E6ZX 3S2DB 2G9HD 4RGOS 2FJ2A 3I73A 1Y8NB 3HOWB 2F4IA 4BY7B 2B2TA 3AB9A 1HQMC 3S1QB 3TDQA 1ZXTA 3RUZA 2H4OA 2B8GA 2Y0SB 3DEPA 4BY1B 2E75C 1PTOH 4H7BA 2R61A 1MI2A 4HCSA 2NB0A 2JA7B 5EPKA 4IUVA 3RLFA 1E0BA 3TMEA 1ENAA 3GTQB 3VYTA 3DEOA 3K0YA 4C3HB 1C4QA 2F0JA 4KHVA 2F0DA 4LJZC 4WRDA 3VYUA 2NN6I 4XDXA 3TBIB 1S5CD 2NN6G 3TSSA 3Q22A 1Y8PB 1SDFA 2F0LA 4BA2I 4K6DA 3IKJA 5E4WC 2NVYB 2XNAC 1EWHA 1SJED 1AZQA 1JOQA 5EKKA 2IWHA 1YNJD 2HQEA 1KABA 1SSOA 1SNDA 1HCZA 1IW7D 2D9UA 1BDOA 1UNSA 1SYGA 3C3LA 1I6VC 1HUMA 1JWSD 2EY2A 4C3IG 3J80L 4U673 1F9PA 3OIPA 1S5BD 1TWGB 2EJMA 3DWPA 2ZXPA 3CQZB 4PMWA 3RZDB 5BN5A 2F3WA 4CKEA 2NTSA 1KAAA 5CBEE 4DU9A 3BS1A 2JA8B 3P7JA 1CQVA 5FO8B 1SNOA 3URYA 1DD2A 1MBYA 4H0LC 3KUPA 4KD3A 1O7YA 1FD7D 2F0WA 4A93B 1KNEA 5TSSA 1SBBB 5COYA 1GUOA 1E2ZA 3OWFA 1BUVT 5IGDA 1RODA 1LO5D 3D4DA 2MGSA 5NUCA 4BWGB 2PPBC 2NN6H 2LY7A 2EVBA 2D62A 3IL8A 1AFPA 4RHRA 2F0SA 4JBWA 1BCPC 1SJHD 1BCPF 4J1MA 4NP5A 2BA1A 2R92B 2TSSA 4G7OC 5CV4A 2Q8TA 4ZKCB 2HDMA 1GOZA 4RGNA 2D5DA 3MTSA 4IFDG 3K7AB 5EPJA 2L11A 3J7AV 3A56A 1GUSA 3S1NB 3NE5B 1WTOA 4XT1B 3UI2A 4IN3A 1EY5A 1HFGA 3WOEA 2F0PA 4CHTB 3I70A 3D31A 1A6XA 3OPOA 2AQ3B 3C46A 1I4RA 1NR4A 2BCOA 4DA2A 1FNWA 3NP8A 2K5WA 2FMCA 4KN4C 1Z47A 2L0CA 2E76C 2KA7A 5FO9B 4V190 5KNDA 1EU4A 3I90A 1F2ZA 2KQ3A 1V43A 3S9WA 5C3EB 4S3SA 1Q8IA 3MZ5A 3S2HB 1EYAA 4F8MA 1SAPA 1WD0A 1RD9D 3I91A 3KLSA 5JPMC 3CRLC 1T5EA 2RSNA 3OHXC 5K36G 1DOMA 1FYCA 3NUCA 3SEBA 1WVLA 1QNUA 4LAAA 1H9KA 3DM1A 2K01A 1B50A 2K04A 1GJXA 5IOCA 3GV6A 3TZDA 3RZOB 4UDUC 3NQTA 2JA6B 2JP1A 4FXKC 3H94A 3PO3B 2NUCA 3SXHA 1D6EC 5JVH3 4OIKA 1PLFA 1KLUD 3OMGA 1LTAD 1SYDA 2F3VA 5J22A 2IX3A 2KJXA 1BF4A 1B3AA 4WORA 4KY5A 5C4XB 4N9PA 2IJ0A 3EA6A 3JAME 5HGTA 2ENBA 1FNVA 1JOKA 1TU2B 3G7LA 4YIJA 5D65A 2K1BA 1SNMA 2Z8LA 3I8ZA 3KBXA 1X32A 4ZRZA 3GV3A 3OMCA 1U4PA 2JA5B 4CKCA 1TY0A 4QCLA 1V1PA 4CGYB 3GTPB 3M3YB 5ELEA 2YYZA 2L1BA 3X3MA 1SYCA 4JK1C 2O2LD 5CGKA 3KLRA 2RDFA 4XYOA 5EGTA 2ZT9C 2RKSA 2NWGA 2WINB 1GHJA 4OHJA 3P75A 3QG1A 1CT1D 4HAEA 3H0GB 4LK1C 1Y1VB 1IYUA 2A6HC 2BDNA 4K5WA 5IODA 3PUYA 2Z4IA 3ONAB 5DNFA 4FP5D 2DNCA 3WDNA 2R6GA 1E2WA 4KKTA 3NTHA 1BNZA 3BVMA 2NVXB 2VUMB 4F87A 3D8GA 4BBSB 3K5OA 4LMQD 2A6EC 4K2LA 3C1EA 3H6MA 1KDCA 5D3DA 1Y8OB 4NDXA 2M2LA 3TP6A 5KNBA 3BVZA 3GTMB 1HRJA 2ZXRA 3GTGB 1SE4A 1RKNA 3EJIA 1WTXA 3EROA 2F0VA 3P1HA 1EY7A 3ND8A 2B2WC 5T1GA 4PV1C 2A73B 2F0IA 3C2PA 4DNRB 3FDTA 4MN3A 2F03A 3FEWX 2WIIB 2CHBD 3MXPA 4DK1A 1BCPD 5A2QE 1WTQA 3HS0C 2E2DC 4B08A 1F2YA 1M8AA 2EDGA 3S16B 2I46A 1EZ6A 1DOLA 5FO7B 3SK6A 1AN8A 5CR3A 3D4WA 5HURA 2MPMA 3PUXA 4C2MB 1GHKA 3KF8A 1A3TA 3D6WA 3HOVB 2AQ1B 1ET9A 1STYA 3TZUA 2OEOA 4K8IA 1SNPA 3QOJA 3V96A 1KDAA 1LACA 2RDHA 2PO4A 4CJ0B 1DCZA 2EY6A 1LTRD 1V1PB 4OGQC 2E2HB 5E3FA 3S1MB 2F0UA 3CRKC 5C4HA 4DNTB 1EQVA 5CC4A 3MC0B 1JC7A 4ZKBB 4ZUJA 3J7YW 4A3GB 2C5CA 4KN7C 2NZ1D 1I4HA 1NR2A 1RJTA 1WCMB 1PFBA 3H3VC 1JORA 4C3HG 4J6HA 2EYJA 1NSNS 4FXDA 1STNA 5IGFA 5EKIA 3OWEB 1VMCA 2XN9C 4IUQA 3I4NB 1PZJD 2F0FA 5JOBA 1TS3A 4ZK9B 1F9SA 1PRTC 1Q12A 2G9DA 1PRTF 4KJOA 1I6HB 2F0HA 2KOLA 1B44D 1UUPA 2EY1A 2H1EA 4A3IB 4RH6A 5KGUA 2RDGA 4IZ8A 1EU3A 1DONA 3K5LA 3NWTA 1Q1EA 2PW5A 2KECA 1TQOA 1C8CA 2WACA 3SDZA 2E2IB 3LX0A 3QOLA 1STAA 1F2LA 2RVLA 1TS4A 3L9AX 1NAPA 4RKLA 4IUNA 5A35A 3GP7A 1EEID 5I2YA 2WP8J 2IL8A 1PZKD 4ODGA 3NPPA 1ZEQX 3VR3A 4MIUA 5ISRA 3JAML 2EOTA 4X3UA 3H09A 4X3TA 1WTRA 4NMZA 2LS01 4C3JB 2RSOA 1A2TA 2Q8IB 4A3BB 3CHBD 3NQIA 3E0JA 1EZ8A 5CMDA 2A6HD 2O4XA 4QB4A 3KK7A 1B1ZA 1EOTA 2I07B 1BQQT 1X3PA 2EXZA 4K6LA 2A6ED 1JWUD 3F2UA 3R3OA 3A7LA 3DXJC 1Z6HA 1FNUA 2B8FA 1II3A 5I9PA 2PW7A 5CV6A 1CI3M 2EYPA 3DWQA 1XWEA 1BOSA 1HHVA 3L3OC 1VF7A 2F0TA 1PFNA 1C48A 5IGCA 1SYFA 1LTID 2SNMA 2VNUD 2R93B 3H91A 3ZYYX 5FKAC 2JEAI 1Y69U 3RMHA 4G4KA 3MFGA 4KV6A 4E6IA 4K14A 1TS5A 1Q1BA 1JWMD 4KKSA 1ZYRC 1TY2A 4TRDA 5DAUA 3PMFA 2XWBB 2EYHA 3NBHA 1B9NA 4ZLTF 2RA4A 1IKLA 2B2VA 5DM73 5JPNC 1BCPB 3MAQA 1SYEA 2HDLA 1S5DD 3P20A 4PQXA 4XT3B 1DJRD 5IIFA 2F0QA 1T5XD 3T53B 4HR7B 4ABNA 3HRZC 2PQEA 3K6OA 4C1NI 2O5IC 2M9VA 2OF1A 1K8MA 3I3CA 2E2JB 4TKOB 1M4VA 2ICEC 3Q24A 3NHHA 2PZTA 1Y1WB 2L55A 5A2QL 1PDQA 1U4RA 4IALA 2PCFB 2VB3X 3C1FA 1LABA 2F0OA 1HXYD 1WTVA 5JEAH 1SEBD 1TWFB 4Y7NB 1ENCA 1LTTD 1W6JA 4TSSA 3QIAA 1G291 2F0GA 1F2MA 1JQYD 1K8OA 1QG7A 3EQLC 2N88A 2ZXOA 2X6LA 5IT9E 1A15A 4KY6A 5C0XH 4DXGA 5I4DA 2HCIA 4FO2A 3D4RA 3K5NA 1SFOB 3HGBA 1F9QA 2EZVA 2DNEA 3BDOA 5M5WB 3V05A 5J39A 1TVXA 1CA5A 1I4QA 1EYCA 2HCCA 1PRTD 4HN7A 1QE6A 4BA1I 3HOYB 5M3FB 4J8QA 5IGBA 4IUTA 5KYIA 2JYOA 1RDPD 3NSWA 3M4YA 4Q5VA 3TP5A 5LL6S 5E4XA 2O5JC 3GTKB 5CV7A 1TT2A 2QCPX 1NCVA 1DXMA 3S15B 4XIGS 3NBIA 3MXGA 1LTSD 1EIHA 1MD2D 1ML0D 5E1FA 2ID0A 4K2KA 1TKWB 4XXEA 2WAQB 3ND9A 2IX0A 3SK4A 3SR1A 1BXTA 1CQFA 2K28A 1LT5D 1SNCA 1KNAA 1EEFD 5J1ZA 5M5YB 1CHPD 1GUWA 1S4ZA 1S5FD 5BN4A 4K5VA 3MXUA 1V1OA 4IQZA 4HCEA 3A8JE 4RHSA 3J80E 4ID6A 4CJ2C 2DY7A 1U4MA 5CBAE 2VB2X 3A54A 1OXTA 4KY7A 3KLSX 1EYDA 1IYVA 1OXXK 5G3LD 1RF2D 1HPCA 4FVMA 2EYFA 2CQAA 1CA6A 4WFN3 2QKIC 3S1RB 4ZAIA 1VCIA 3PV0A 2K7VA 1ILPA 1O80A 4ZUIA 2KHSA 4ZQ3A 3I4MB 2NVQB 2FHTA 1RTOA 2QDBA 3NXWA 3NWSA 1A3VA 2YU9B 2EYOA 4Q0FA 1S5ED 5CYUA 1A2UA 2J7ZA 4F7XA 1H9RA 3T51B 3TP8A 4IURA 3FKIB 2R7ZB 2PYKA 1DYQA 3MHBA 5D14A 3PIP3 4PMCA 1JB3A 4U68A 4HSPA 1ZYRD 5JVG3 2E74C 4AYBB 1MSGA 2LMCB 1EY4A 4KKUA 3SE0A 4L63B 1I4XA 3M4OB 2PZUA 1AEXA 2AWNA 2EJFC 1XXGA 1X3QA 2M00A 2WB1B 5KYLA 4A3JB 3AMUA 1LT4D 3R8BA 1CK1A 2DY8A 5C44B 5FOBB 5EBDA 3TN2A 1I50B 2F0MA 4EQOA 2IX1A 5KIXA 4OO1H 1LTBD 3EFXD 4KJNA 4G7ZC 4K5XA 5DM63 3GO5A 3HOZB 3ERQA 4RAUC 3N6RA 3K59A 4F88A 2K5QA 1CFMA 3W3AA 4HEDA 3T16A 2AUJD 3TP7A 1YNNC 3OSOA 4A3EB 1ET6A 2SOBA 2WKCA 4CJ1B 2CW0C 3E5SA 3BG3A 3VA5A 4MHEA 2AQ2B 3SVMA 3A7AB 1VF5C 3QO2A 3HG9A 3V2TA 2BE5C 1V8QA 2XRQD 3OW7A 1PTOC 1PTOF 1Z7TA 4DXFA 2R3ZA 3GTJB 2J0TD 1H9JA 4ILWA 2J4XA 5LL6X 1W6KA 2KVMA 5M3MB 1D5ZC 1OO9B 1HA5A 1EQTA 2SDFA 3CU7A 2NTTA 1R4PB 1QCBD 1SNQA 4C56C 4EQPA 2TMPA 4O1NA 2PMZB 5C4JB 3MA2B 5IT9L 1PRTB 1ESFA 1H9SA 2WV6D 1XX8A 1JR0D 5FLXE 3FPUB 4EGVA 1DOKA 5EQ0A 3NK9A 3BZDB 3VYSA 4QMGA 5ELDA 3LNNA 4I7ZC 2A69C 3GQBA 4K8JA 2XVSA 5EJWA 4C3JG 2B2YC 4M1UB 1GUGA 5DEHA 3SHLA 1IHZA 4KI0A 4XYQA 1EY6A 1MSHA 1KTKA 3MXNA 1D5XC 3MEHA 3MVVA 3FRPB 1PYWD 2XRSD 5KEEA 1G2TA 4V0BA 4GZYC 3J81E 3FVQA 5C6AA 3S17B 2X69A 2X6GA 1CZGA 3DMUA 3D3RA 1G8ZD 1CM9A 4B9WA 1LT6D 2K05A 4KD4A 5CV9A 4RCOA 3T56B 1HQRD 2EYMA 5C3XA 1LV9A 5G3LF 1ILQA 1B2TA 2PNRC 2K32A 4KTAA 5JEAJ 3R2IA 2AUKA 1EY9A 3U9SA 3K58A 5LHY1 4C1NK 1EIGA 5CV8A 5JEAG 1HUNA 2Z1CA 1F77A 1L0XB 5KNCA 1EL0A 4P2CB 3M7GA 2L4NA 1GUTA 3AU7A 3BDLA 3VA7A 3L7ZC 1JICA 1STBA 1VMPA 1QNKA 4B9XA 2AWOA 3NTIA 4DAYA 1O78A 1G2SA 4HSVA 4R8NA 5C0XJ 1SMYD 3PO2B 4FF4A 3W2DA 1IL8A 1J8IA 3U9OA 5C0XI 2MJ8A 5JJZA 1B9MA 4A3FB 5C0XG 2EY5A 3K57A 4QF4A 2V4DA 4RFBA 4RGTA 4FNFA 1FR3A 4BS9A 2IT1A 1HTLD 4C3IB 2B2UC 2RQXA 1LT3D 1D1KA 5F2DA 2F0EA 2EYLA 4M8AA 5EBCA 4XQJA 2L12A 1I4GA 2FFKB 1F9RA 4XTCS 4EQNA 2XSCA 4ZYSA 2JE6I 5C3WA 2B2TC 1BR9A 4L8JA 1STHA 1H9SB 5BN3A 1QILA 1FGBD 3OIQA 4KMUC 1WTWA 4IUUA 1NUCA 2K33A 4IFDJ 4TQUS 3BVGA 2BA0A 2JSOA 4IFDI 2BDOA 1R9TB 2K5DA 4HMJA 4NKLA 4N9TA 2CVRA 4A3MB 1STGA 1TWCB 1K83B 1YNND 2KEEA 3LWUA 5JAVA 3IFTA 5CV5A 1PZID 2A68C 1TIID 1RHPA 3QB3A 1HTPA 3GD7A 4XQNA 2CW0D 3BDCA 3I4LA 1LTGD 4FXGC 3HOUB 4KHZA 5AFWA 2B39A 1XTCD 3DHQA 4ULLA 2BE5D 1PTOD 1CHQD 1GUNA 4DAVA 3QWNA 1ICWA 1D1IA 1VDZA 4R8IA 2B2WA 3VR5A 3VR6A 2B63B 2D2CC 3A8KE 3J7AF 4NW2A 2LFNA 4R9WA 4A3KB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KN7 C;  2KCC A;  3BG3 A;  2O5I C;  1IW7 C;  1K8M A;  2O5J C;  2E75 C;  2Q8I B;  4GZY C;  4KN4 C;  4DNR B;  4TKO B;  3A7A B;  1OXV A;  1H9R A;  2A6H D;  3T51 B;  1VF5 C;  2E76 C;  2KA7 A;  4XTC S;  1DD2 A;  3PUW A;  4DK1 A;  4H0L C;  2BE5 C;  3M7N A;  1O7L A;  1V8Q A;  5KND A;  4G7H C;  2F1M A;  3OW7 A;  4RCN A;  1Z7T A;  2A68 D;  2PCF B;  1DXM A;  2JE6 I;  4XIG S;  1V43 A;  1LAB A;  3PUV A;  3RLF A;  1H9J A;  1GUO A;  5K36 H;  2YYZ A;  1E2Z A;  4L8J A;  4JK1 C;  2E74 C;  2A6E D;  1H9S B;  5BN3 A;  3T56 B;  5JEA H;  1QJO A;  3A7L A;  3DXJ C;  1Q12 A;  1Z6H A;  3FPP A;  2EDG A;  2B8F A;  2JXM B;  3KLR A;  4KMU C;  1TKW B;  2LMC B;  4KKU A;  2JEB I;  2K33 A;  3ND9 A;  3SE0 A;  3VR4 A;  4LJZ C;  1CI3 M;  3FMC A;  2NN6 I;  2PNR C;  2K32 A;  4TQU S;  3PUZ A;  1Q90 A;  3CRL C;  2AUK A;  1T5E A;  2BA0 A;  2A69 D;  2ZT9 C;  3U9S A;  1OXS C;  3QIA A;  1GHJ A;  1G29 1;  2NN6 G;  1SMY C;  1VF7 A;  2BDO A;  2EJF C;  2QF7 A;  5K36 G;  1PMR A;  2L5T A;  2PPB C;  3QG1 A;  1FYC A;  1ZKO A;  2NN6 H;  3PUX A;  1Y8P B;  5BN4 A;  4BA2 I;  2EVB A;  2D62 A;  4LK1 C;  1IYU A;  2A6H C;  3IKJ A;  3MXU A;  5JEA G;  3M85 A;  1Q1E A;  1E2V A;  1H9K A;  3PUY A;  4IFD H;  2JEA I;  3LWU A;  3A8J E;  3IFT A;  4IQZ A;  1EWH A;  1Y69 U;  1GHK A;  1OXU A;  4JBW A;  2DNC A;  1GJX A;  3EQL C;  5KNC A;  3WDN A;  2R6G A;  3SDZ A;  1E2W A;  2A68 C;  3VA7 A;  2BA1 A;  4KKT A;  3QJY A;  3TZU A;  1Q1B A;  1HTP A;  1OXT A;  3GD7 A;  4G7O C;  4KKS A;  1GUT A;  3I4L A;  3OOC A;  1HCZ A;  3VR2 A;  3L7Z C;  1IW7 D;  1H9S A;  1OXX K;  1BDO A;  1ZYR C;  3H94 A;  2DN8 A;  2A6E C;  4DK0 A;  5C0X H;  4OO1 H;  4KHZ A;  1LAC A;  1Y8O B;  1I6V C;  3D4R A;  1HPC A;  2D5D A;  2AWO A;  5A35 A;  3HGB A;  4H13 C;  4IFD G;  4G7Z C;  1DCZ A;  2BE5 D;  2DNE A;  1O78 A;  3LNN A;  1B9N A;  1ONL A;  5KNB A;  4I7Z C;  2A69 C;  3I73 A;  3BDO A;  3GQB A;  4OGQ C;  3N6R A;  1GUS A;  1Y8N B;  1CFM A;  3NE5 B;  3W3A A;  1GUN A;  1VCI A;  1K8O A;  3VR3 A;  2EJM A;  3MFY A;  2AUJ D;  3CRK C;  1B9M A;  3PV0 A;  1H9M A;  5C0X G;  4OO1 G;  2K7V A;  3P20 A;  3D31 A;  1A6X A;  1GUG A;  2V4D A;  1VDZ A;  3OPO A;  4DNT B;  3VR5 A;  1YNN C;  1FR3 A;  3VR6 A;  1CTM A;  2IT1 A;  3I72 A;  4KI0 A;  2D2C C;  3A8K E;  3A8I E;  3AB9 A;  4H44 C;  1HQM C;  3ND8 A;  5BN5 A;  4BA1 I;  3T53 B;  1TU2 B;  1YNJ C;  4HR7 B;  2EJG C;  4PV1 C;  3M4Y A;  2CW0 C;  1IYV A;  2B8G A; 
#chains in the Genus database with same CATH topology
 4CKB A;  1PH5 A;  4RA8 A;  3K5M A;  1B8A A;  4PMB A;  2OWO A;  3STB C;  4DAP A;  4A3M H;  4DFA A;  3JAM c;  4X3K A;  3NEN A;  1D5M C;  1TWC H;  1C7Y A;  5D3I B;  1K83 H;  1O7Z A;  5K5P A;  4JI5 Q;  3PUW A;  2WAQ G;  1O7L A;  2F0K A;  2WAQ E;  1SRO A;  4X66 L;  2XWJ B;  1Q3L A;  5T1I A;  1PH6 A;  3G6E A;  3PUV A;  2HUG A;  2N55 A;  3S14 B;  2XIW A;  3ICE A;  2XGT A;  2KCN A;  2PZW A;  1MGS A;  2RBM A;  4QUF A;  1QOH A;  5ELF A;  4HJA A;  3HOU H;  3G71 A;  2WKD A;  2GA4 B;  4DUZ L;  4FYD A;  1A8V A;  2JEB I;  3CKI B;  3RD4 A;  2LKV A;  1QB5 D;  1STE A;  4DAY B;  3FMC A;  1IKM A;  2GN5 A;  2KED A;  3PUZ A;  4GLV B;  4BBR B;  2A69 D;  1VQF A;  1OXS C;  2K03 A;  4YY3 Q;  2QF7 A;  4ME5 A;  4JPB W;  1KHI A;  4NPS A;  1ZKO A;  3PSI A;  1TWA B;  1U4L A;  1XYI A;  1VQE A;  5IGE A;  3M85 A;  2QEJ C;  1L0Y B;  1NBW A;  2MP1 A;  4IFD H;  2B63 H;  3CCJ A;  3NTK A;  4UAI A;  4DV4 L;  1PXU A;  2OT2 A;  3T4A C;  5FJ8 H;  4J15 A;  3LWE A;  3SK5 A;  4HMI A;  3QJY A;  1KRS A;  4A3K H;  2IPK D;  1EFI D;  1EY0 A;  3OOC A;  4FF1 A;  3WOF A;  4DK0 A;  5FLX L;  1JOO A;  4IOC A;  1R4Q B;  3D6C A;  5DLQ E;  5EKL A;  1UEA B;  2K14 A;  1PFM A;  3JC6 6;  3I55 A;  3F8T A;  5E7N A;  1B4O A;  1K0S A;  1ONL A;  1CUK A;  3I4M G;  5JJI A;  2IW3 A;  2YV5 A;  3ITP A;  1P16 A;  4PNY A;  3FP9 A;  3S14 H;  3DWA A;  1VQC A;  1JE4 A;  5GRO A;  4OO1 I;  4QUC A;  1UAP A;  3MFY A;  5I2X A;  4OO1 G;  2KHJ A;  4YCW A;  2B2V C;  5ELB A;  1U9R A;  5COR A;  1FJG Q;  4H44 C;  4DN4 M;  2I5M X;  5IYD H;  3FKI G;  5IP9 H;  2R7Z G;  5IGG A;  1YNJ C;  4BBR H;  1D2B A;  4JI1 L;  3HEJ A;  4WJW A;  1SE3 A;  1HA6 A;  2MQH A;  2SNS A;  2Z6K C;  4FF3 A;  2E5L Q;  2KCC A;  2L9H A;  2OXP A;  4DV0 Q;  2Q8R E;  1IW7 C;  1TWA H;  3J81 L;  3T1Y Q;  1SXT A;  1OXV A;  3R93 A;  2K6A A;  4AYB G;  4AYB E;  2A74 C;  1SE2 A;  4JI7 L;  3M7N A;  1L0W A;  4I65 A;  4R4Q A;  4G7H C;  1J9O A;  2IHF A;  1ENF A;  5FK9 C;  3CCU A;  1AP0 A;  1SYB A;  2MHV A;  4OIJ A;  3N52 A;  5K36 H;  4DR2 L;  2A19 A;  3IFD A;  4Z9C B;  3SK8 A;  4LFB Q;  1A3U A;  1TS2 A;  3OW2 A;  1I4P A;  1XNQ Q;  2WB1 G;  2WB1 E;  1AW7 A;  1MHW C;  2CH4 A;  4A3J G;  3VR4 A;  2FIN B;  4X62 Q;  3ZJY C;  4X3S A;  1Q90 A;  3CCQ A;  1VQD A;  4DV3 L;  5C44 G;  1HFN A;  1D7Q A;  1KDB A;  1SMY C;  4QY7 A;  4X65 L;  4RG1 A;  4L6T B;  1PMR A;  2QIL A;  5C4Z A;  1EWC A;  1GXD C;  2KUM A;  1Q8K A;  2VL6 A;  2Z4H A;  3O13 A;  5I6Y A;  1WD1 A;  1AE2 A;  1E2V A;  4DV1 Q;  4POF A;  4DF7 A;  1WTP A;  2B2Y A;  3KFU A;  4RGM A;  1HZC A;  1EY8 A;  3HOZ G;  5C5L A;  5EPL A;  3I4O A;  3Q8D A;  1MJE A;  3G6J B;  2UUC Q;  5ELC A;  1PYB A;  3VR2 A;  2KEN A;  2EE1 A;  2DN8 A;  1TR5 A;  1I3Q B;  1LLR D;  4RWS C;  2LXK A;  3KBG A;  5I6W A;  4H13 C;  4A75 A;  3Q0A A;  4A3E G;  1DZ1 A;  4IPG A;  4QIW B;  2KHI A;  5M9O A;  5M5X B;  1G6Z A;  3D0F A;  1GO3 E;  4OL7 A;  2YTV A;  4DGZ A;  3EIV A;  3I4M H;  1KXL A;  1PHJ A;  1K8G A;  1H9M A;  4NXN Q;  1IBK Q;  3VYR A;  1ESR A;  1CTM A;  1JCK B;  3I72 A;  5LMU L;  3A8I E;  1HNZ Q;  3A55 A;  3CPF A;  3HOX B;  3HP3 A;  3K0X A;  4XQQ A;  1YHB A;  2PI2 A;  2EJG C;  4CBV A;  2NVT B;  4IUP A;  4RKB A;  1RTN A;  1QWY A;  2ICI A;  1EFW A;  1YJ9 A;  3X3N A;  2FMM A;  5C5M A;  1VQH A;  2RF4 A;  1BO0 A;  5I9O A;  4B3T L;  5M3M G;  3H3V I;  1B53 A;  4IPH A;  2F1M A;  2MFI A;  4RCN A;  1I5F A;  2A68 D;  3R2T A;  4JBJ A;  3H15 A;  4A3D B;  4JI0 Q;  2RCN A;  3GTO B;  4HTH A;  1G91 A;  2BOS A;  4DV5 L;  3GTL B;  4R4I A;  4HIK A;  3PIO 3;  4DV2 Q;  5ELO A;  2CWA A;  2MUY A;  2PMZ E;  5AJ3 L;  1QJO A;  1I3Q H;  1L1O C;  1RCV D;  2A5H A;  2F0N A;  3FPP A;  1KLG D;  2JXM B;  1B3Q A;  3EVQ A;  4UP9 A;  3HKZ B;  4FF2 A;  3W5O A;  5M5X H;  2YTX A;  1E22 A;  3BYT B;  3Q23 A;  3BZC A;  2VXW A;  3MWY W;  2L5T A;  4KK7 A;  1AZP A;  1TWH B;  3HZX A;  1PTO B;  2NYZ D;  3DUZ A;  3T13 A;  2EPB A;  3HOX H;  1OXU A;  2OTL A;  1DM0 B;  1NE3 A;  4PG3 A;  4G57 A;  3PIO A;  4EVO A;  4IPC A;  2SEB D;  5KRU A;  4DV6 Q;  2NVT H;  3IAY A;  1BBX C;  4O42 A;  2OTJ A;  4X66 Q;  1XMO Q;  3BYY B;  4L5T A;  3Q6S A;  1CZW A;  2B2U A;  2C9O A;  4DK3 C;  2NBF A;  4YHH L;  3STB D;  1SMX A;  3L2P A;  3E6Z X;  1YZ6 A;  3KDF B;  3S2D B;  2G9H D;  4RGO S;  2FJ2 A;  1KRT A;  1X65 A;  1EIY B;  3I73 A;  4R1J A;  4LF7 L;  4A3D H;  2LXJ A;  4DUZ Q;  3J7Z C;  3GTO H;  1Y8N B;  4DR6 L;  2EIF A;  2MO1 A;  3GTL H;  3TQY A;  3HOW B;  2F4I A;  4BY7 B;  5GAD C;  5IYB H;  2B2T A;  4A3C H;  3AB9 A;  2OCE A;  1HQM C;  4OWX B;  3S1Q B;  3TDQ A;  1ZXT A;  3J81 c;  3RUZ A;  2H4O A;  2B8G A;  2Y0S B;  1FVI A;  1VQL A;  3DEP A;  4BY1 B;  1TWH H;  2E75 C;  1X9N A;  1PTO H;  4B3R L;  4L5Q A;  2F4V L;  4H7B A;  2R61 A;  1MI2 A;  3KLW A;  4HCS A;  2NB0 A;  2JA7 B;  5EPK A;  4IUV A;  2BH8 A;  3JAM i;  3RLF A;  1E0B A;  3TME A;  5GAH C;  2UXB L;  4DV7 L;  1ENA A;  1VQJ A;  3GTQ B;  3VYT A;  4IJL A;  3RR5 A;  4JI4 L;  4JI3 L;  3DEO A;  3K0Y A;  4N8F A;  4C3H B;  1C4Q A;  2F0J A;  4KHV A;  1SRU A;  4GNX C;  2F0D A;  4LJZ C;  4WRD A;  4AH6 A;  1SLJ A;  3VYU A;  2NN6 I;  1PVO A;  4XDX A;  3A5Z B;  3TBI B;  1S5C D;  4GN5 A;  1IYJ B;  2NN6 G;  5EAY A;  4LF6 Q;  3TSS A;  4DR1 Q;  3Q22 A;  4JI1 Q;  1Y8P B;  1SDF A;  2F0L A;  2MNA A;  4BA2 I;  4K6D A;  4DR3 L;  3IKJ A;  4BY7 H;  5E4W C;  4K0K Q;  1L2F A;  1YHQ A;  1UE6 A;  2NVY B;  2XNA C;  1EWH A;  4LUO A;  1SJE D;  1AZQ A;  4JV5 Q;  1JOQ A;  4GN4 B;  5EKK A;  2IWH A;  3PO2 G;  1YNJ D;  1N32 L;  2HQE A;  1KAB A;  4JI7 Q;  1SSO A;  4LUV A;  4P74 A;  1SND A;  4MZ9 A;  4BY1 H;  1HCZ A;  2JN4 A;  1IW7 D;  2D9U A;  1BDO A;  2VW9 A;  4A3F G;  1UNS A;  1SYG A;  1XNR Q;  3C3L A;  1I6V C;  3I7F A;  1HUM A;  1JWS D;  2L15 A;  4LF9 L;  2EQS A;  3E9I A;  4GLX A;  2EY2 A;  2JA7 H;  4C3I G;  1PH2 A;  5IE8 A;  1N8R C;  3J80 L;  1N34 Q;  4U67 3;  1F9P A;  3OIP A;  1S5B D;  1TWG B;  2EJM A;  2CKZ B;  4DV3 Q;  3DWP A;  2ZXP A;  3CQZ B;  4C3H H;  4PMW A;  1B7Y B;  3RZD B;  4UP7 A;  5BN5 A;  2F3W A;  5IP7 H;  2HT1 A;  4CKE A;  2NTS A;  3S17 H;  1KAA A;  1VQ5 A;  5CBE E;  4DR5 L;  1HNX L;  4DU9 A;  1RL2 A;  4DAM A;  3BS1 A;  3P7J A;  2JA8 B;  1CQV A;  4JVZ A;  4DR4 Q;  5FO8 B;  2QW7 A;  2VQE Q;  3L0O A;  2MO0 A;  1QZG A;  1SNO A;  3URY A;  1DD2 A;  2NVY H;  1MBY A;  4H0L C;  4DUY Q;  3KUP A;  4KD3 A;  1O7Y A;  4CDF C;  1FD7 D;  2F0W A;  4A93 B;  1KNE A;  5LMN W;  1SBB B;  5TSS A;  5COY A;  1YI2 A;  2ES2 A;  1GUO A;  1E2Z A;  3OWF A;  1BUV T;  4A3M G;  2B29 A;  5IGD A;  5JJL A;  1ROD A;  1XMQ L;  1LO5 D;  3D4D A;  2MGS A;  5LMU Q;  3OTO Q;  5NUC A;  4Y52 H;  4BWG B;  1TWG H;  2PPB C;  2NN6 H;  1V9P A;  2LY7 A;  2EVB A;  2D62 A;  3CQZ H;  3IL8 A;  1I94 Q;  3HOU G;  1AFP A;  4LF8 Q;  1N33 L;  4RHR A;  4LF5 Q;  2F0S A;  4JBW A;  1BCP C;  1SJH D;  1J6Q A;  1BCP F;  4J1M A;  1N36 L;  3CXC A;  1A0I A;  1YVC A;  4NP5 A;  1KL9 A;  4GKK L;  2BA1 A;  2R92 B;  2TSS A;  4G7O C;  2DJG C;  4LNQ A;  2JA8 H;  5CV4 A;  4QGU A;  4LF4 L;  2Q8T A;  4ZKC B;  3UDG A;  2HDM A;  1GOZ A;  3U4V A;  2B3G A;  4RGN A;  4YCV A;  2D5D A;  2ZTE A;  3MTS A;  4IFD G;  2B63 G;  3K7A B;  5EPJ A;  2L11 A;  3J7A V;  5IT9 c;  5FJ8 G;  3A56 A;  4A93 H;  1GUS A;  2WFW A;  3S1N B;  3NE5 B;  1WTO A;  4XT1 B;  3UI2 A;  4A3K G;  4IN3 A;  4KHP L;  1EY5 A;  1HFG A;  3WOE A;  2F0P A;  4CHT B;  3I70 A;  3D31 A;  1A6X A;  3OPO A;  3KOJ A;  2AQ3 B;  3C46 A;  1I4R A;  2FXQ A;  2UUA L;  4OX9 Q;  1NR4 A;  2BCO A;  3UE0 A;  4DA2 A;  1NTG A;  4IJH A;  4AQY L;  1FNW A;  3NP8 A;  1YIJ A;  2K5W A;  4GS3 A;  2FMC A;  4KN4 C;  3DLL A;  1Z47 A;  2L0C A;  1VS0 A;  2ALY B;  1BKB A;  1EWI A;  3TRE A;  3T1H L;  1VQA A;  2E76 C;  2KA7 A;  5FO9 B;  4YHH Q;  4V19 0;  5KND A;  5IYD G;  2UXC Q;  1EU4 A;  3I90 A;  5IP9 G;  1F2Z A;  4BBR G;  2JA6 G;  2KQ3 A;  3CC4 A;  1V43 A;  3S9W A;  3E3X A;  5C3E B;  2ZM6 Q;  1VQK A;  4S3S A;  1Q8I A;  1ASZ A;  2K4K A;  3MZ5 A;  3S2H B;  1EYA A;  3K7A H;  4F8M A;  1SAP A;  1WD0 A;  1RD9 D;  3I91 A;  3AEV A;  3KLS A;  5JPM C;  3M4Q A;  3G4S A;  3CRL C;  1T5E A;  2RSN A;  1NNX A;  4JOI C;  1IBM Q;  3S1N H;  4LFA L;  3OHX C;  5K36 G;  1DOM A;  1FYC A;  3NUC A;  1QVF A;  3SEB A;  1WVL A;  1QNU A;  1X3E A;  4LAA A;  1UE5 A;  1H9K A;  3DM1 A;  2K01 A;  1B50 A;  2K04 A;  1GJX A;  5IOC A;  2F4V Q;  2RCF A;  3GV6 A;  4P75 A;  3TZD A;  3RZO B;  4ZCK A;  4UDU C;  3NQT A;  2PQA A;  2JA6 B;  2JP1 A;  4FXK C;  3H94 A;  3PO3 B;  2NUC A;  3SXH A;  2UXB Q;  4DV7 Q;  1D6E C;  3J80 c;  5JVH 3;  4OIK A;  1PLF A;  3ERS X;  1KLU D;  3OMG A;  1LTA D;  1SYD A;  3F2B A;  4YWL A;  2RHS B;  2F3V A;  5J22 A;  2IX3 A;  1YEZ A;  2KJX A;  5C3E H;  1BF4 A;  1B3A A;  4WOR A;  4KY5 A;  5C4X B;  1GKH A;  4WJ4 A;  4N9P A;  2IJ0 A;  3CC7 A;  3EA6 A;  3JAM E;  3S2H H;  5HGT A;  1VQN A;  2ENB A;  1FNV A;  1JOK A;  1SE8 A;  1TU2 B;  1UE7 A;  2ZTC A;  4IO9 A;  3G7L A;  4YIJ A;  4DR3 Q;  1P8L A;  1L1O A;  1BBW A;  1IZ6 A;  5D65 A;  2K1B A;  1SNM A;  3I56 A;  1A63 A;  1H95 A;  1SR3 A;  2Z8L A;  3I8Z A;  3KBX A;  4A76 A;  4B3S L;  1X32 A;  1AE3 A;  3A74 A;  3CW2 C;  4ZRZ A;  3J81 i;  5JJK A;  3KJO A;  3GV3 A;  1X55 A;  1U4P A;  3OMC A;  2JA5 B;  2EXD A;  4CKC A;  3ULP A;  2Z9H A;  1JJC B;  1TY0 A;  4QCL A;  1V1P A;  4CGY B;  2KCM A;  3GTP B;  3M3Y B;  2Q2H A;  5ELE A;  4LF9 Q;  2YYZ A;  2L1B A;  2JA6 H;  3X3M A;  2ZJR A;  1SYC A;  4DKA C;  3PQI A;  1EUJ A;  4JK1 C;  3PO3 H;  2O2L D;  1UEB A;  5CGK A;  3KLR A;  1K3R A;  2RDF A;  4XYO A;  5EGT A;  2ZT9 C;  2RKS A;  2NWG A;  2WIN B;  1GHJ A;  4OHJ A;  5C4X H;  3P75 A;  3QG1 A;  1CT1 D;  4HAE A;  3H0G B;  4LK1 C;  1Y1V B;  1IYU A;  2A6H C;  1VQI A;  2BDN A;  4K5W A;  3J7A 5;  5IOD A;  3PUY A;  2Z4I A;  3ONA B;  5DNF A;  4FP5 D;  2DNC A;  1PH8 A;  3WDN A;  2R6G A;  1E2W A;  5IYC H;  4KKT A;  3NTH A;  1BNZ A;  4QIW E;  3BVM A;  2KCT A;  2NVX B;  2VUM B;  4F87 A;  3D8G A;  4BBS B;  3K5O A;  4LMQ D;  2A6E C;  4K2L A;  3C1E A;  3H6M A;  1KDC A;  5D3D A;  3UDI A;  1Y8O B;  4NDX A;  2M2L A;  2JA5 H;  5ELN A;  2I0Q A;  3HOX G;  3TP6 A;  5KNB A;  3GTP H;  3BVZ A;  3GTM B;  3M3Y H;  1HRJ A;  2ZXR A;  2ZJQ A;  3GTG B;  1SE4 A;  2CCZ A;  4R4T A;  1XMQ Q;  4JI6 L;  1RKN A;  3EJI A;  1WTX A;  3ERO A;  3CCR A;  2F0V A;  3P1H A;  1HZ9 A;  3A5U A;  1EY7 A;  3ND8 A;  2B2W C;  5T1G A;  3TRZ A;  4PV1 C;  1HNW L;  4A3D G;  3U50 C;  4GNX A;  2A73 B;  2F0I A;  4MTK A;  1K8A C;  3C2P A;  3H0G H;  4DNR B;  1XJV A;  4QJF A;  1Y1V H;  1EQQ A;  3FDT A;  4MN3 A;  5IYB G;  2F03 A;  4LF4 Q;  3FEW X;  2WII B;  2CHB D;  2K5N A;  4A3C G;  3MXP A;  4DK1 A;  1BCP D;  1K73 C;  3W1G A;  3HKZ G;  5A2Q E;  3HKZ E;  1YJW A;  1WTQ A;  1S40 A;  3HS0 C;  2NVX H;  2VUM H;  2E2D C;  4B08 A;  1F2Y A;  1MJC A;  4BBS H;  2PQA B;  1X6O A;  2KBN A;  1M8A A;  4JI8 L;  2OQ0 A;  3HFZ B;  2EDG A;  3S16 B;  3K8A A;  4JYA L;  2C35 B;  1WI5 A;  2I46 A;  1EZ6 A;  1DOL A;  1J5E L;  5FO7 B;  1X3F A;  3SK6 A;  3GTM H;  4EQ5 A;  1AN8 A;  3GTG H;  2UUA Q;  1W3S A;  5CR3 A;  3D4W A;  5HUR A;  1HH2 P;  3CCV A;  2MPM A;  3OYY A;  3PUX A;  1HZB A;  4C2M B;  2G5D A;  1GHK A;  3KF8 A;  1A3T A;  4NXM Q;  3D6W A;  3HOV B;  2A1A A;  4IOA A;  2AQ1 B;  1ET9 A;  1STY A;  1L1O B;  3TZU A;  2OEO A;  4UHV A;  4DR7 L;  3ER0 A;  4K8I A;  1SNP A;  3HOW G;  3QOJ A;  4HIM A;  3V96 A;  1KDA A;  1LAC A;  2RDH A;  3UDF A;  4BY7 G;  2PO4 A;  4CJ0 B;  1DCZ A;  2EY6 A;  1LTR D;  4GKJ Q;  1V1P B;  5J3B A;  3I4N G;  4OGQ C;  2E2H B;  3TEH B;  5E3F A;  3S1M B;  2Y0S G;  2Y0S E;  5FLX c;  2F0U A;  4BY1 G;  3CRK C;  4IPD A;  5C4H A;  5BR8 L;  1LM0 A;  1CSQ A;  4DNT B;  1EQV A;  5CC4 A;  3MC0 B;  4B3M L;  3S16 H;  2R7D A;  1JC7 A;  1CSP A;  4ZKB B;  1S72 A;  1WTH A;  2JA7 G;  4ZUJ A;  3J7Y W;  1PV4 A;  4A3G B;  2C5C A;  1PFS A;  4KN7 C;  2NZ1 D;  1I4H A;  1NR2 A;  3CCM A;  1FGU A;  1RJT A;  1WCM B;  1PFB A;  4C2M H;  3H3V C;  1JOR A;  4C3H G;  1HR0 W;  4J6H A;  2EYJ A;  4LWC A;  1NSN S;  3HOV H;  4FXD A;  4PZ7 A;  1STN A;  5IP7 G;  5IGF A;  1IBL L;  5EKI A;  3OWE B;  1VMC A;  2XN9 C;  4IUQ A;  4RMF A;  3I4N B;  1JB7 A;  1PZJ D;  2F0F A;  5JOB A;  4DV4 Q;  1TS3 A;  4ZK9 B;  1F9S A;  1PRT C;  1Q12 A;  2G9D A;  1HZA A;  3CME A;  1PRT F;  4KJO A;  1I6H B;  2E8G A;  2F0H A;  4POG A;  1NY4 A;  2KOL A;  1QVG A;  2OQK A;  1B44 D;  1UUP A;  2EY1 A;  2H1E A;  4JI5 L;  4A3I B;  2E2H H;  4RH6 A;  5KGU A;  2PI2 E;  2RDG A;  3S1M H;  4IZ8 A;  1EU3 A;  1DON A;  1EIF A;  3K5L A;  3NWT A;  1Q1E A;  2PW5 A;  2GVB A;  3G48 A;  4B3S Q;  2KEC A;  1PYS B;  1TQO A;  2DUD A;  3S2D H;  1C8C A;  1X54 A;  2WAC A;  2CQO A;  3SDZ A;  4GOP C;  4JBM A;  2BH2 A;  3LX0 A;  3ULL A;  4A3G H;  2E2I B;  3QOL A;  1STA A;  1F2L A;  2RVL A;  4GNX B;  1TS4 A;  1PH3 A;  1WCM H;  3L9A X;  1NAP A;  2VY3 A;  4RKL A;  4IUN A;  5A35 A;  3GP7 A;  3HOW H;  1PA6 A;  4R4O A;  1EEI D;  5I2Y A;  2WP8 J;  2IL8 A;  1PZK D;  4ODG A;  3NPP A;  1ZEQ X;  5IY0 A;  2HIX A;  3S1Q H;  3J80 i;  2JA8 G;  3I4N H;  3VR3 A;  4MIU A;  1JE5 A;  5ISR A;  2NZH A;  3JAM L;  1FL0 A;  2EOT A;  1I6H H;  1WOC A;  4X3U A;  3F2C A;  2JK8 A;  3H09 A;  4DR2 Q;  4X3T A;  4A3I H;  2N49 A;  4A93 G;  1CKN A;  1WTR A;  4NMZ A;  2CWP A;  2LS0 1;  4C3J B;  2N8N A;  2RSO A;  1A2T A;  2Q8I B;  4A3B B;  3CHB D;  3NQI A;  3E0J A;  1EZ8 A;  5CMD A;  2A6H D;  3GTQ H;  2O4X A;  4QB4 A;  3KK7 A;  1Y14 B;  1B1Z A;  3KF8 B;  1EOT A;  2I07 B;  1BQQ T;  1X3P A;  4X65 Q;  4X6A H;  2E2I H;  1K3B C;  4X64 L;  3CAM A;  2EXZ A;  4HIO A;  1A62 A;  4K6L A;  2HHH L;  4A3L G;  2A6E D;  1JWU D;  3F2U A;  3R3O A;  3A7L A;  4JCV E;  1PH1 A;  3DXJ C;  2E5L L;  5LMN L;  1Z6H A;  4JI6 Q;  3UDX A;  1FNU A;  2B8F A;  1II3 A;  5I9P A;  3E9H A;  2PW7 A;  5CV6 A;  3T1Y L;  1CI3 M;  2I5H A;  2EYP A;  3DWQ A;  1XWE A;  1BOS A;  1HHV A;  2R92 G;  3L3O C;  1VF7 A;  5GAE C;  2F0T A;  1PFN A;  1C48 A;  5IGC A;  1SYF A;  1LTI D;  2SNM A;  2VNU D;  1HNW Q;  2R93 B;  3H91 A;  5GAG C;  3ZYY X;  5FKA C;  1YJN A;  3U58 A;  1XTD A;  2JEA I;  1Y69 U;  3RMH A;  1E24 A;  4LFB L;  1BBU A;  2GVA A;  4G4K A;  1T9H A;  1SN8 A;  3MFG A;  4KV6 A;  4PZ8 A;  4E6I A;  4K14 A;  1TS5 A;  1Q1B A;  1JWM D;  1PH7 A;  4KKS A;  3PF4 A;  1ZYR C;  1TY2 A;  4TRD A;  1KIX A;  5DAU A;  2VZA A;  3PMF A;  2XWB B;  2EYH A;  3NBH A;  1B9N A;  4OXP A;  2ATW A;  3ULJ A;  4ZLT F;  3RZD H;  4JYA Q;  2RA4 A;  2IHE A;  1IKL A;  2B2V A;  5DM7 3;  5JPN C;  1BCP B;  3MAQ A;  4B3T Q;  1SYE A;  2HDL A;  1S5D D;  3P20 A;  2D0O A;  1WJJ A;  4PQX A;  2UUC L;  4XT3 B;  4HJ5 A;  1DJR D;  5IIF A;  2F0Q A;  1T5X D;  4QQB X;  3T53 B;  1UE1 A;  4HR7 B;  2N78 A;  2Z6K A;  4ABN A;  4DV5 Q;  3HRZ C;  3K7U C;  2PQE A;  3K6O A;  4C1N I;  5AJ3 Q;  5C3E G;  2O5I C;  2M9V A;  2OF1 A;  1S3O A;  1K8M A;  1C9O A;  3I3C A;  2UU9 L;  2R93 H;  1WYD A;  2E2J B;  4TKO B;  1M4V A;  4DR7 Q;  2ICE C;  3Q24 A;  3NHH A;  2PZT A;  1Y1W B;  4NXN L;  3KJP A;  2L55 A;  5A2Q L;  1PDQ A;  1U4R A;  2D0P A;  2PCF B;  2VB3 X;  4IAL A;  1HNZ L;  4BXX H;  3C1F A;  1LAB A;  3K81 C;  4OON A;  2K5V A;  2F0O A;  1HXY D;  1WTV A;  5JEA H;  1SEB D;  5L37 A;  1TWF B;  4A3L H;  4Y7N B;  1UWV A;  3CCL A;  1ENC A;  1LTT D;  1W6J A;  3CPW A;  4YWM A;  4FDB A;  1Z9F A;  4TSS A;  3QIA A;  5H1S E;  1G29 1;  4OWT B;  2F0G A;  2R92 H;  4O2D A;  1F2M A;  4JI0 L;  2P5Z X;  1JQY D;  3PO3 G;  2JJQ A;  2JA9 A;  4LF7 Q;  1K8O A;  1QG7 A;  3EQL C;  4DR6 Q;  2N88 A;  2ZXO A;  2X6L A;  5IT9 E;  4CDD C;  3I2Z A;  1CKN B;  2QEX A;  1A15 A;  5C4X G;  1TXY A;  4KY6 A;  5C0X H;  2E2J H;  4DXG A;  4I7A A;  2HCI A;  5I4D A;  4LFC L;  4FO2 A;  3D4R A;  1E1T A;  3K5N A;  1SFO B;  3HGB A;  1F9Q A;  2EZV A;  3A0J A;  2DNE A;  2DGY A;  2HQL A;  3BDO A;  5M5W B;  5IYC G;  4JW0 A;  3BJU A;  4B3R Q;  4LUZ A;  3V05 A;  5J39 A;  1TVX A;  1CA5 A;  1I4Q A;  4DV6 L;  1Q82 C;  1EYC A;  2HCC A;  1XMO L;  1PRT D;  1TWF H;  2CH4 W;  4Y7N H;  4HN7 A;  1JMC A;  2QA4 A;  2JA5 G;  1QE6 A;  2V1C C;  4BA1 I;  3HOY B;  5M3F B;  1CKM A;  4J8Q A;  5IGB A;  4IUT A;  5KYI A;  2JYO A;  1RDP D;  4JI3 Q;  4JI4 Q;  3NSW A;  3M4Y A;  4Q5V A;  3NEM A;  3TP5 A;  5LL6 S;  5E4X A;  2O5J C;  4PZ6 A;  3GTK B;  5CV7 A;  1TT2 A;  4CDC C;  1PH4 A;  2QCP X;  3U4Z A;  2Q2I A;  1NJI C;  1NCV A;  1DXM A;  3S15 B;  4XIG S;  3NBI A;  4P73 A;  3MXG A;  1LTS D;  1EIH A;  1MD2 D;  1ML0 D;  1M1K C;  4GN3 B;  3H0G G;  1QUQ A;  5E1F A;  2ID0 A;  1Y1V G;  4K2K A;  3CC2 A;  1N32 Q;  1SFO H;  1TKW B;  4XXE A;  2WAQ B;  1AH9 A;  3ND9 A;  2IX0 A;  3SK4 A;  3SR1 A;  4YWK A;  1BXT A;  1CQF A;  1XPU A;  2K28 A;  3NBH B;  1LT5 D;  1SNC A;  1KNA A;  3LGJ A;  1EEF D;  5M5W H;  3RLN A;  2VUM G;  5J1Z A;  4BBS G;  3RZO H;  1CHP D;  5M5Y B;  1S4Z A;  1S5F D;  1GUW A;  5BN4 A;  4K5V A;  4JI2 L;  3MXU A;  1DGS A;  1V1O A;  3A8J E;  4HCE A;  4IQZ A;  1G51 A;  2K5H A;  4RHS A;  3J80 E;  4ID6 A;  3HOY H;  5M3F H;  2QDL A;  4CJ2 C;  2DY7 A;  1U4M A;  5CBA E;  2VB2 X;  4HID A;  3A54 A;  3RLO A;  1OXT A;  4KY7 A;  2ZJP A;  1YNX A;  3RN5 A;  3KLS X;  1EYD A;  1IYV A;  1OXX K;  4JC0 A;  2Z0S A;  5G3L D;  3GTK H;  4X64 Q;  4LF6 L;  1RF2 D;  4DR1 L;  1EQR A;  1HPC A;  4FVM A;  4DR5 Q;  1HNX Q;  2HHH Q;  2R7F A;  4K0K L;  1EOV A;  2EYF A;  3QR8 A;  1EYG A;  5LMN Q;  5FLM H;  3J81 j;  2CQA A;  3S15 H;  4JV5 L;  1CA6 A;  4WFN 3;  2QKI C;  3S1R B;  3KDF A;  4ZAI A;  1GM5 A;  1VCI A;  1LYL A;  3PV0 A;  2K7V A;  1ILP A;  1O80 A;  4YCU A;  1XNR L;  4ZUI A;  2KHS A;  4ZQ3 A;  3I4M B;  1E3P A;  3SGI A;  2NVQ B;  2FHT A;  1XPO A;  1RTO A;  2QDB A;  3NXW A;  3NWS A;  1A3V A;  2YU9 B;  1NMG A;  2EYO A;  4Q0F A;  5M5Y H;  1N34 L;  1S5E D;  5CYU A;  1A2U A;  2J7Z A;  4F7X A;  1QZH A;  1H9R A;  1K9M C;  3T51 B;  3TP8 A;  4IUR A;  3FKI B;  4L5R C;  2R7Z B;  3GDE A;  3UE1 A;  2PYK A;  1DYQ A;  3MHB A;  5D14 A;  3PIP 3;  2F3I A;  2UUB L;  4PMC A;  1JB3 A;  4U68 A;  4EX5 A;  4HSP A;  1N33 Q;  1ZYR D;  5JVG 3;  2E74 C;  3PF5 A;  1ICF B;  1CKO A;  4AYB B;  4GOP A;  1MKH A;  1N36 Q;  1MSG A;  1C0A A;  4GKK Q;  2LMC B;  3IRB A;  3BU2 A;  1EY4 A;  4KKU A;  3KF6 A;  4DR4 L;  3SE0 A;  4L63 B;  1IXR A;  4APV A;  1I4X A;  1VQ4 A;  1PH9 A;  3HOV G;  2VQE L;  4JG2 A;  1LUZ A;  3M4O B;  2PZU A;  2AKW B;  4DUY L;  1AEX A;  3S1R H;  2AWN A;  2EJF C;  1U5K A;  3KYH C;  1KQS A;  1XXG A;  1D8L A;  1X3Q A;  2M00 A;  2WB1 B;  5KYL A;  3PIP A;  4A3J B;  3AMU A;  1LT4 D;  3R8B A;  1K28 A;  2UU9 Q;  2NZO A;  1HJP A;  1CK1 A;  2DY8 A;  4KHP Q;  5C44 B;  2NVQ H;  5FOB B;  5EBD A;  3TN2 A;  1I50 B;  2F0M A;  4EQO A;  4DNI A;  2YU9 H;  1QVC A;  2IX1 A;  5KIX A;  2YTY A;  4OO1 H;  2RHQ B;  3OTO L;  1LTB D;  4AQY Q;  1JT8 A;  3EFX D;  4KJN A;  3FKI H;  4G7Z C;  1I94 L;  4K5X A;  2R7Z H;  5DM6 3;  3TS2 A;  3GO5 A;  3HOZ B;  3ERQ A;  4LF8 L;  4RAU C;  4LF5 L;  3N6R A;  3K59 A;  4F88 A;  2K5Q A;  4A3G G;  1CFM A;  3AFP A;  3W3A A;  1RIP A;  4HED A;  4N8X 1;  3T16 A;  2AUJ D;  3T1H Q;  1OTC A;  3TP7 A;  1WCM G;  4ME3 A;  1QUQ B;  1YNN C;  3OSO A;  4QL5 A;  4A3E B;  1ET6 A;  3M4O H;  4GLA C;  2SOB A;  2WKC A;  4CJ1 B;  3F1Z A;  2CW0 C;  3E5S A;  3BG3 A;  3VA5 A;  4MHE A;  2AQ2 B;  3SVM A;  5HGQ A;  3CD6 A;  1XPR A;  3A7A B;  4O0A A;  2HIV A;  4A3J H;  1VF5 C;  3QO2 A;  3HG9 A;  3V2T A;  2BE5 C;  1V8Q A;  2XRQ D;  3OW7 A;  1PTO C;  4JBK A;  4LFA Q;  4LFC Q;  1PTO F;  2N3S A;  1Z7T A;  4DXF A;  5C44 H;  2R3Z A;  4A3I G;  4OX9 L;  1I50 H;  3GTJ B;  1HR0 L;  2J0T D;  1H9J A;  1YHA A;  4ALP A;  1VQ8 A;  4ILW A;  3TS0 A;  2J4X A;  5LL6 X;  3FHW A;  1W6K A;  3RN2 A;  2KVM A;  5M3M B;  4A4I A;  1D5Z C;  2Q2U A;  1OO9 B;  3HOZ H;  3CCS A;  1HA5 A;  1EQT A;  2SDF A;  3CU7 A;  2NTT A;  5IWA L;  1R4P B;  2UXD L;  1QCB D;  1SNQ A;  4C56 C;  2UXC L;  1JJG A;  2LSS A;  4EQP A;  2TMP A;  3PCO B;  4O1N A;  2PMZ B;  2VQF L;  5C4J B;  2ZM6 L;  1VQ6 A;  1BVS A;  4A3E H;  1GVP A;  3MA2 B;  2K75 A;  1ASY A;  3AQQ A;  1VQG A;  5IT9 L;  3DM3 A;  1PRT B;  1ESF A;  1H9S A;  2WV6 D;  1XX8 A;  1IBM L;  1JR0 D;  3AYH B;  2PNH A;  5FLX E;  3FPU B;  4EGV A;  1DOK A;  5EQ0 A;  3NK9 A;  3BZD B;  1Q81 C;  3VYS A;  4QMG A;  5ELD A;  3LNN A;  4I7Z C;  2A69 C;  3GQB A;  3BZK A;  3GTJ H;  1MIU A;  4K8J A;  1K0R A;  2XVS A;  5EJW A;  4C3J G;  2F52 A;  1Q86 C;  2B2Y C;  1V1Q A;  4A3B G;  1LTL A;  4M1U B;  1GUG A;  4DK6 C;  5DEH A;  4GOP B;  3SHL A;  1IHZ A;  4KI0 A;  1E7Z A;  5M3M H;  4YY3 L;  4XYQ A;  1M90 C;  3KF6 B;  1EY6 A;  4JI2 Q;  1MSH A;  4UY8 C;  3W1B A;  1KTK A;  3MXN A;  3H3V H;  1D5X C;  1Q46 A;  3MEH A;  3MVV A;  3FRP B;  1PYW D;  1VQ9 A;  2XRS D;  5KEE A;  1VQB A;  1G2T A;  4V0B A;  3M9B A;  4GZY C;  1N9W A;  3J81 E;  2ZTD A;  3FVQ A;  5C6A A;  5C4J H;  3S17 B;  2X69 A;  2X6G A;  2CFM A;  3S24 A;  1YIT A;  1G6P A;  1CZG A;  3DMU A;  3D3R A;  1G8Z D;  1CM9 A;  4B9W A;  1LT6 D;  2K05 A;  4KD4 A;  5CV9 A;  1KC8 C;  4RCO A;  3T56 B;  1HQR D;  2EYM A;  1O7I A;  5C3X A;  2R93 G;  4DPG A;  1LV9 A;  5G3L F;  4NB3 A;  1ILQ A;  1B70 B;  1Q7Y C;  1KAW A;  1B2T A;  4JOI A;  2PNR C;  2K32 A;  4KTA A;  5JEA J;  3R2I A;  2AUK A;  1EY9 A;  3U9S A;  4BXX G;  3K58 A;  5LHY 1;  1FJG L;  4C1N K;  2K50 A;  3AFQ A;  1EIG A;  5CV8 A;  2H5X A;  5JEA G;  2K52 A;  1HUN A;  1VQP A;  2Z1C A;  4HJ9 A;  1F77 A;  2VS1 A;  1L0X B;  4DV0 L;  3EN2 A;  5KNC A;  4TVA B;  4OEM B;  1IL2 A;  1X3G A;  1EL0 A;  4P2C B;  3M7G A;  2L4N A;  1GUT A;  3AU7 A;  3BDL A;  3VA7 A;  2Z6B A;  3L7Z C;  1JIC A;  1STB A;  1VMP A;  1QNK A;  4P71 A;  2UUB Q;  4B9X A;  1X56 A;  2AWO A;  3NTI A;  4DAY A;  1O78 A;  1G2S A;  4HSV A;  4R8N A;  5C0X J;  1SMY D;  3CF5 A;  3PO2 B;  3RNU A;  4FF4 A;  3W2D A;  1IL8 A;  2IY5 B;  1J8I A;  3U9O A;  2DJF C;  3K80 C;  5C0X I;  1XNQ L;  1YBY A;  1VQO A;  2MJ8 A;  5JJZ A;  1B9M A;  4A3F B;  3HKS A;  5C0X G;  4X62 L;  2EY5 A;  3K57 A;  4QF4 A;  2V4D A;  4RFB A;  3PGZ A;  4RGT A;  4C3J H;  4FNF A;  2Q2T A;  1FR3 A;  4BS9 A;  2AHO B;  2IT1 A;  4A3B H;  2XTI A;  1HTL D;  4C3I B;  2B2U C;  1Y1W G;  1JJ2 A;  2RQX A;  1LT3 D;  2QGQ A;  3B6Y A;  1D1K A;  1W2B A;  5F2D A;  4JI8 Q;  1NMF A;  4L5S A;  3MEF A;  4DV1 L;  1VQ7 A;  4MTN A;  2F0E A;  3E0E A;  3CCE A;  2EYL A;  4M8A A;  5EBC A;  4XQJ A;  2L12 A;  1I4G A;  2FFK B;  1J5E Q;  4R4C A;  4WJ3 M;  1F9R A;  4XTC S;  4UP8 A;  4MNO A;  4EQN A;  2XSC A;  4ZYS A;  2JE6 I;  3M4P A;  5C3W A;  2ASB A;  4UPA A;  2B2T C;  1BR9 A;  3VDY A;  4L8J A;  1STH A;  3WWV A;  1H9S B;  5BN3 A;  1KD1 C;  1QIL A;  1FGB D;  3OIQ A;  4KLK A;  4KMU C;  1WTW A;  3CMA A;  4IUU A;  3F2D A;  1NUC A;  2K33 A;  3NEL A;  4IFD J;  3PO2 H;  2I5L X;  4TQU S;  2A8V A;  3BVG A;  2BA0 A;  2JSO A;  5GQO A;  4OWW B;  1WFQ A;  4IFD I;  2BDO A;  4OEL B;  1IBK L;  1R9T B;  2K5D A;  4HMJ A;  4NKL A;  4N9T A;  5HY6 A;  4A3F H;  2CVR A;  4A3M B;  1STG A;  1TWC B;  1K83 B;  1YNN D;  2KEE A;  3LWU A;  5JAV A;  3IFT A;  5CV5 A;  1PZI D;  4C3I H;  2JQO A;  2A68 C;  1TII D;  3MXN B;  1RHP A;  3QB3 A;  1HTP A;  3GD7 A;  5BR8 Q;  4XQN A;  2CW0 D;  3BDC A;  1GD7 A;  3I4L A;  4B3M Q;  1LTG D;  4CDE C;  1VQM A;  4FXG C;  3HOU B;  1HR0 Q;  4KHZ A;  5AFW A;  4LW1 A;  2B39 A;  1XTC D;  1E1O A;  3DHQ A;  4ULL A;  2BE5 D;  4H02 A;  4HJ8 A;  1PTO D;  3HOY G;  5M3F G;  4DV2 L;  4NXM L;  4P72 A;  1CHQ D;  1GUN A;  4DAV A;  4AIM A;  5IWA Q;  3CP0 A;  3QWN A;  2UXD Q;  1ICW A;  1D1I A;  1VDZ A;  4R8I A;  2B2W A;  3VR5 A;  1U0L A;  3VR6 A;  2B63 B;  2D2C C;  3A8K E;  1IBL Q;  2AMC B;  2VQF Q;  2HD3 A;  3J7A F;  4NW2 A;  5FLM G;  2LFN A;  4HJ7 A;  1Y1W H;  4GKJ L;  4R9W A;  1R9T H;  4A3K B;  3EBE A; 
#chains in the Genus database with same CATH homology
 4CKB A;  4RA8 A;  3K5M A;  4PMB A;  4DAP A;  4DFA A;  4X3K A;  1D5M C;  5D3I B;  1O7Z A;  5K5P A;  3PUW A;  1O7L A;  2F0K A;  2XWJ B;  1Q3L A;  5T1I A;  3PUV A;  2HUG A;  2N55 A;  3S14 B;  2XIW A;  2KCN A;  2PZW A;  1MGS A;  2RBM A;  4QUF A;  1QOH A;  5ELF A;  2WKD A;  2GA4 B;  4FYD A;  2JEB I;  3CKI B;  3RD4 A;  2LKV A;  1QB5 D;  1STE A;  3FMC A;  1IKM A;  2KED A;  3PUZ A;  4BBR B;  2A69 D;  1OXS C;  2K03 A;  2QF7 A;  4ME5 A;  1ZKO A;  1TWA B;  1U4L A;  1XYI A;  5IGE A;  3M85 A;  2QEJ C;  1L0Y B;  2MP1 A;  4IFD H;  3NTK A;  4UAI A;  1PXU A;  2OT2 A;  3T4A C;  3LWE A;  3SK5 A;  4HMI A;  3QJY A;  2IPK D;  1EFI D;  1EY0 A;  3OOC A;  4FF1 A;  3WOF A;  4DK0 A;  5FLX L;  1JOO A;  1R4Q B;  3D6C A;  5EKL A;  1UEA B;  1PFM A;  1B4O A;  1ONL A;  2IW3 A;  3ITP A;  4PNY A;  3DWA A;  1JE4 A;  4OO1 I;  4QUC A;  1UAP A;  3MFY A;  5I2X A;  4OO1 G;  2B2V C;  5ELB A;  1U9R A;  5COR A;  4H44 C;  4DN4 M;  5IGG A;  1YNJ C;  1D2B A;  3HEJ A;  4WJW A;  1SE3 A;  1HA6 A;  2SNS A;  4FF3 A;  2KCC A;  2L9H A;  2OXP A;  2Q8R E;  1IW7 C;  3J81 L;  1SXT A;  1OXV A;  3R93 A;  2K6A A;  2A74 C;  1SE2 A;  3M7N A;  4I65 A;  4G7H C;  1J9O A;  1ENF A;  5FK9 C;  1AP0 A;  1SYB A;  2MHV A;  4OIJ A;  3N52 A;  5K36 H;  3IFD A;  4Z9C B;  3SK8 A;  1A3U A;  1TS2 A;  1I4P A;  1AW7 A;  3VR4 A;  2FIN B;  4X3S A;  1Q90 A;  1HFN A;  1KDB A;  1SMY C;  4L6T B;  1PMR A;  2QIL A;  5C4Z A;  1EWC A;  1GXD C;  2KUM A;  2Z4H A;  3O13 A;  5I6Y A;  1WD1 A;  1E2V A;  4DF7 A;  1WTP A;  2B2Y A;  4RGM A;  1EY8 A;  5C5L A;  5EPL A;  3G6J B;  5ELC A;  3VR2 A;  2EE1 A;  2DN8 A;  1TR5 A;  1I3Q B;  1LLR D;  4RWS C;  3KBG A;  5I6W A;  4H13 C;  3Q0A A;  1DZ1 A;  4QIW B;  5M9O A;  5M5X B;  1G6Z A;  4OL7 A;  4DGZ A;  1H9M A;  3VYR A;  1ESR A;  1CTM A;  1JCK B;  3I72 A;  3A8I E;  3A55 A;  3HOX B;  3HP3 A;  4XQQ A;  2EJG C;  4CBV A;  2NVT B;  4IUP A;  4RKB A;  1RTN A;  1QWY A;  2ICI A;  3X3N A;  2FMM A;  5C5M A;  1BO0 A;  5I9O A;  1B53 A;  2F1M A;  4RCN A;  2A68 D;  3R2T A;  4A3D B;  3GTO B;  4HTH A;  1G91 A;  2BOS A;  3GTL B;  3PIO 3;  2MUY A;  1QJO A;  1RCV D;  2A5H A;  2F0N A;  3FPP A;  1KLG D;  2JXM B;  3EVQ A;  3HKZ B;  4FF2 A;  3BYT B;  3Q23 A;  2VXW A;  3MWY W;  2L5T A;  4KK7 A;  1AZP A;  1TWH B;  3HZX A;  1PTO B;  2NYZ D;  3DUZ A;  3T13 A;  2EPB A;  1OXU A;  1DM0 B;  4G57 A;  4EVO A;  2SEB D;  5KRU A;  3IAY A;  1BBX C;  4O42 A;  3BYY B;  1CZW A;  2B2U A;  3Q6S A;  2C9O A;  2NBF A;  3E6Z X;  3S2D B;  2G9H D;  4RGO S;  2FJ2 A;  3I73 A;  1Y8N B;  3HOW B;  2F4I A;  4BY7 B;  2B2T A;  3AB9 A;  1HQM C;  3S1Q B;  3TDQ A;  1ZXT A;  3RUZ A;  2H4O A;  2B8G A;  2Y0S B;  3DEP A;  4BY1 B;  2E75 C;  1PTO H;  4H7B A;  2R61 A;  1MI2 A;  4HCS A;  2NB0 A;  2JA7 B;  5EPK A;  4IUV A;  3RLF A;  1E0B A;  3TME A;  1ENA A;  3GTQ B;  3VYT A;  3DEO A;  3K0Y A;  4C3H B;  1C4Q A;  2F0J A;  4KHV A;  2F0D A;  4LJZ C;  4WRD A;  3VYU A;  2NN6 I;  4XDX A;  3TBI B;  1S5C D;  2NN6 G;  3TSS A;  3Q22 A;  1Y8P B;  1SDF A;  2F0L A;  4BA2 I;  4K6D A;  3IKJ A;  5E4W C;  2NVY B;  2XNA C;  1EWH A;  1SJE D;  1AZQ A;  1JOQ A;  5EKK A;  2IWH A;  1YNJ D;  2HQE A;  1KAB A;  1SSO A;  1SND A;  1HCZ A;  1IW7 D;  2D9U A;  1BDO A;  1UNS A;  1SYG A;  3C3L A;  1I6V C;  1HUM A;  1JWS D;  2EY2 A;  4C3I G;  3J80 L;  4U67 3;  1F9P A;  3OIP A;  1S5B D;  1TWG B;  2EJM A;  3DWP A;  2ZXP A;  3CQZ B;  4PMW A;  3RZD B;  5BN5 A;  2F3W A;  4CKE A;  2NTS A;  1KAA A;  5CBE E;  4DU9 A;  3BS1 A;  2JA8 B;  3P7J A;  1CQV A;  5FO8 B;  1SNO A;  3URY A;  1DD2 A;  1MBY A;  4H0L C;  3KUP A;  4KD3 A;  1O7Y A;  1FD7 D;  2F0W A;  4A93 B;  1KNE A;  5TSS A;  1SBB B;  5COY A;  1GUO A;  1E2Z A;  3OWF A;  1BUV T;  5IGD A;  1ROD A;  1LO5 D;  3D4D A;  2MGS A;  5NUC A;  4BWG B;  2PPB C;  2NN6 H;  2LY7 A;  2EVB A;  2D62 A;  3IL8 A;  1AFP A;  4RHR A;  2F0S A;  4JBW A;  1BCP C;  1SJH D;  1BCP F;  4J1M A;  4NP5 A;  2BA1 A;  2R92 B;  2TSS A;  4G7O C;  5CV4 A;  2Q8T A;  4ZKC B;  2HDM A;  1GOZ A;  4RGN A;  2D5D A;  3MTS A;  4IFD G;  3K7A B;  5EPJ A;  2L11 A;  3J7A V;  3A56 A;  1GUS A;  3S1N B;  3NE5 B;  1WTO A;  4XT1 B;  3UI2 A;  4IN3 A;  1EY5 A;  1HFG A;  3WOE A;  2F0P A;  4CHT B;  3I70 A;  3D31 A;  1A6X A;  3OPO A;  2AQ3 B;  3C46 A;  1I4R A;  1NR4 A;  2BCO A;  4DA2 A;  1FNW A;  3NP8 A;  2K5W A;  2FMC A;  4KN4 C;  1Z47 A;  2L0C A;  2E76 C;  2KA7 A;  5FO9 B;  4V19 0;  5KND A;  1EU4 A;  3I90 A;  1F2Z A;  2KQ3 A;  1V43 A;  3S9W A;  5C3E B;  4S3S A;  1Q8I A;  3MZ5 A;  3S2H B;  1EYA A;  4F8M A;  1SAP A;  1WD0 A;  1RD9 D;  3I91 A;  3KLS A;  5JPM C;  3CRL C;  1T5E A;  2RSN A;  3OHX C;  5K36 G;  1DOM A;  1FYC A;  3NUC A;  3SEB A;  1WVL A;  1QNU A;  4LAA A;  1H9K A;  3DM1 A;  2K01 A;  1B50 A;  2K04 A;  1GJX A;  5IOC A;  3GV6 A;  3TZD A;  3RZO B;  4UDU C;  3NQT A;  2JA6 B;  2JP1 A;  4FXK C;  3H94 A;  3PO3 B;  2NUC A;  3SXH A;  1D6E C;  5JVH 3;  4OIK A;  1PLF A;  1KLU D;  3OMG A;  1LTA D;  1SYD A;  2F3V A;  5J22 A;  2IX3 A;  2KJX A;  1BF4 A;  1B3A A;  4WOR A;  4KY5 A;  5C4X B;  4N9P A;  2IJ0 A;  3EA6 A;  3JAM E;  5HGT A;  2ENB A;  1FNV A;  1JOK A;  1TU2 B;  3G7L A;  4YIJ A;  5D65 A;  2K1B A;  1SNM A;  2Z8L A;  3I8Z A;  3KBX A;  1X32 A;  4ZRZ A;  3GV3 A;  3OMC A;  1U4P A;  2JA5 B;  4CKC A;  1TY0 A;  4QCL A;  1V1P A;  4CGY B;  3GTP B;  3M3Y B;  5ELE A;  2YYZ A;  2L1B A;  3X3M A;  1SYC A;  4JK1 C;  2O2L D;  5CGK A;  3KLR A;  2RDF A;  4XYO A;  5EGT A;  2ZT9 C;  2RKS A;  2NWG A;  2WIN B;  1GHJ A;  4OHJ A;  3P75 A;  3QG1 A;  1CT1 D;  4HAE A;  3H0G B;  4LK1 C;  1Y1V B;  1IYU A;  2A6H C;  2BDN A;  4K5W A;  5IOD A;  3PUY A;  2Z4I A;  3ONA B;  5DNF A;  4FP5 D;  2DNC A;  3WDN A;  2R6G A;  1E2W A;  4KKT A;  3NTH A;  1BNZ A;  3BVM A;  2NVX B;  2VUM B;  4F87 A;  3D8G A;  4BBS B;  3K5O A;  4LMQ D;  2A6E C;  4K2L A;  3C1E A;  3H6M A;  1KDC A;  5D3D A;  1Y8O B;  4NDX A;  2M2L A;  3TP6 A;  5KNB A;  3BVZ A;  3GTM B;  1HRJ A;  2ZXR A;  3GTG B;  1SE4 A;  1RKN A;  3EJI A;  1WTX A;  3ERO A;  2F0V A;  3P1H A;  1EY7 A;  3ND8 A;  2B2W C;  5T1G A;  4PV1 C;  2A73 B;  2F0I A;  3C2P A;  4DNR B;  3FDT A;  4MN3 A;  2F03 A;  3FEW X;  2WII B;  2CHB D;  3MXP A;  4DK1 A;  1BCP D;  5A2Q E;  1WTQ A;  3HS0 C;  2E2D C;  4B08 A;  1F2Y A;  1M8A A;  2EDG A;  3S16 B;  2I46 A;  1EZ6 A;  1DOL A;  5FO7 B;  3SK6 A;  1AN8 A;  5CR3 A;  3D4W A;  5HUR A;  2MPM A;  3PUX A;  4C2M B;  1GHK A;  3KF8 A;  1A3T A;  3D6W A;  3HOV B;  2AQ1 B;  1ET9 A;  1STY A;  3TZU A;  2OEO A;  4K8I A;  1SNP A;  3QOJ A;  3V96 A;  1KDA A;  1LAC A;  2RDH A;  2PO4 A;  4CJ0 B;  1DCZ A;  2EY6 A;  1LTR D;  1V1P B;  4OGQ C;  2E2H B;  5E3F A;  3S1M B;  2F0U A;  3CRK C;  5C4H A;  4DNT B;  1EQV A;  5CC4 A;  3MC0 B;  1JC7 A;  4ZKB B;  4ZUJ A;  3J7Y W;  4A3G B;  2C5C A;  4KN7 C;  2NZ1 D;  1I4H A;  1NR2 A;  1RJT A;  1WCM B;  1PFB A;  3H3V C;  1JOR A;  4C3H G;  4J6H A;  2EYJ A;  1NSN S;  4FXD A;  1STN A;  5IGF A;  5EKI A;  3OWE B;  1VMC A;  2XN9 C;  4IUQ A;  3I4N B;  1PZJ D;  2F0F A;  5JOB A;  1TS3 A;  4ZK9 B;  1F9S A;  1PRT C;  1Q12 A;  2G9D A;  1PRT F;  4KJO A;  1I6H B;  2F0H A;  2KOL A;  1B44 D;  1UUP A;  2EY1 A;  2H1E A;  4A3I B;  4RH6 A;  5KGU A;  2RDG A;  4IZ8 A;  1EU3 A;  1DON A;  3K5L A;  3NWT A;  1Q1E A;  2PW5 A;  2KEC A;  1TQO A;  1C8C A;  2WAC A;  3SDZ A;  2E2I B;  3LX0 A;  3QOL A;  1STA A;  1F2L A;  2RVL A;  1TS4 A;  3L9A X;  1NAP A;  4RKL A;  4IUN A;  5A35 A;  3GP7 A;  1EEI D;  5I2Y A;  2WP8 J;  2IL8 A;  1PZK D;  4ODG A;  3NPP A;  1ZEQ X;  3VR3 A;  4MIU A;  5ISR A;  3JAM L;  2EOT A;  4X3U A;  3H09 A;  4X3T A;  1WTR A;  4NMZ A;  2LS0 1;  4C3J B;  2RSO A;  1A2T A;  2Q8I B;  4A3B B;  3CHB D;  3NQI A;  3E0J A;  1EZ8 A;  5CMD A;  2A6H D;  2O4X A;  4QB4 A;  3KK7 A;  1B1Z A;  1EOT A;  2I07 B;  1BQQ T;  1X3P A;  2EXZ A;  4K6L A;  2A6E D;  1JWU D;  3F2U A;  3R3O A;  3A7L A;  3DXJ C;  1Z6H A;  1FNU A;  2B8F A;  1II3 A;  5I9P A;  2PW7 A;  5CV6 A;  1CI3 M;  2EYP A;  3DWQ A;  1XWE A;  1BOS A;  1HHV A;  3L3O C;  1VF7 A;  2F0T A;  1PFN A;  1C48 A;  5IGC A;  1SYF A;  1LTI D;  2SNM A;  2VNU D;  2R93 B;  3H91 A;  3ZYY X;  5FKA C;  2JEA I;  1Y69 U;  3RMH A;  4G4K A;  3MFG A;  4KV6 A;  4E6I A;  4K14 A;  1TS5 A;  1Q1B A;  1JWM D;  4KKS A;  1ZYR C;  1TY2 A;  4TRD A;  5DAU A;  3PMF A;  2XWB B;  2EYH A;  3NBH A;  1B9N A;  4ZLT F;  2RA4 A;  1IKL A;  2B2V A;  5DM7 3;  5JPN C;  1BCP B;  3MAQ A;  1SYE A;  2HDL A;  1S5D D;  3P20 A;  4PQX A;  4XT3 B;  1DJR D;  5IIF A;  2F0Q A;  1T5X D;  3T53 B;  4HR7 B;  4ABN A;  3HRZ C;  2PQE A;  3K6O A;  4C1N I;  2O5I C;  2M9V A;  2OF1 A;  1K8M A;  3I3C A;  2E2J B;  4TKO B;  1M4V A;  2ICE C;  3Q24 A;  3NHH A;  2PZT A;  1Y1W B;  2L55 A;  5A2Q L;  1PDQ A;  1U4R A;  4IAL A;  2PCF B;  2VB3 X;  3C1F A;  1LAB A;  2F0O A;  1HXY D;  1WTV A;  5JEA H;  1SEB D;  1TWF B;  4Y7N B;  1ENC A;  1LTT D;  1W6J A;  4TSS A;  3QIA A;  1G29 1;  2F0G A;  1F2M A;  1JQY D;  1K8O A;  1QG7 A;  3EQL C;  2N88 A;  2ZXO A;  2X6L A;  5IT9 E;  1A15 A;  4KY6 A;  5C0X H;  4DXG A;  5I4D A;  2HCI A;  4FO2 A;  3D4R A;  3K5N A;  1SFO B;  3HGB A;  1F9Q A;  2EZV A;  2DNE A;  3BDO A;  5M5W B;  3V05 A;  5J39 A;  1TVX A;  1CA5 A;  1I4Q A;  1EYC A;  2HCC A;  1PRT D;  4HN7 A;  1QE6 A;  4BA1 I;  3HOY B;  5M3F B;  4J8Q A;  5IGB A;  4IUT A;  5KYI A;  2JYO A;  1RDP D;  3NSW A;  3M4Y A;  4Q5V A;  3TP5 A;  5LL6 S;  5E4X A;  2O5J C;  3GTK B;  5CV7 A;  1TT2 A;  2QCP X;  1NCV A;  1DXM A;  3S15 B;  4XIG S;  3NBI A;  3MXG A;  1LTS D;  1EIH A;  1MD2 D;  1ML0 D;  5E1F A;  2ID0 A;  4K2K A;  1TKW B;  4XXE A;  2WAQ B;  3ND9 A;  2IX0 A;  3SK4 A;  3SR1 A;  1BXT A;  1CQF A;  2K28 A;  1LT5 D;  1SNC A;  1KNA A;  1EEF D;  5J1Z A;  5M5Y B;  1CHP D;  1GUW A;  1S4Z A;  1S5F D;  5BN4 A;  4K5V A;  3MXU A;  1V1O A;  4IQZ A;  4HCE A;  3A8J E;  4RHS A;  3J80 E;  4ID6 A;  4CJ2 C;  2DY7 A;  1U4M A;  5CBA E;  2VB2 X;  3A54 A;  1OXT A;  4KY7 A;  3KLS X;  1EYD A;  1IYV A;  1OXX K;  5G3L D;  1RF2 D;  1HPC A;  4FVM A;  2EYF A;  2CQA A;  1CA6 A;  4WFN 3;  2QKI C;  3S1R B;  4ZAI A;  1VCI A;  3PV0 A;  2K7V A;  1ILP A;  1O80 A;  4ZUI A;  2KHS A;  4ZQ3 A;  3I4M B;  2NVQ B;  2FHT A;  1RTO A;  2QDB A;  3NXW A;  3NWS A;  1A3V A;  2YU9 B;  2EYO A;  4Q0F A;  1S5E D;  5CYU A;  1A2U A;  2J7Z A;  4F7X A;  1H9R A;  3T51 B;  3TP8 A;  4IUR A;  3FKI B;  2R7Z B;  2PYK A;  1DYQ A;  3MHB A;  5D14 A;  3PIP 3;  4PMC A;  1JB3 A;  4U68 A;  4HSP A;  1ZYR D;  5JVG 3;  2E74 C;  4AYB B;  1MSG A;  2LMC B;  1EY4 A;  4KKU A;  3SE0 A;  4L63 B;  1I4X A;  3M4O B;  2PZU A;  1AEX A;  2AWN A;  2EJF C;  1XXG A;  1X3Q A;  2M00 A;  2WB1 B;  5KYL A;  4A3J B;  3AMU A;  1LT4 D;  3R8B A;  1CK1 A;  2DY8 A;  5C44 B;  5FOB B;  5EBD A;  3TN2 A;  1I50 B;  2F0M A;  4EQO A;  2IX1 A;  5KIX A;  4OO1 H;  1LTB D;  3EFX D;  4KJN A;  4G7Z C;  4K5X A;  5DM6 3;  3GO5 A;  3HOZ B;  3ERQ A;  4RAU C;  3N6R A;  3K59 A;  4F88 A;  2K5Q A;  1CFM A;  3W3A A;  4HED A;  3T16 A;  2AUJ D;  3TP7 A;  1YNN C;  3OSO A;  4A3E B;  1ET6 A;  2SOB A;  2WKC A;  4CJ1 B;  2CW0 C;  3E5S A;  3BG3 A;  3VA5 A;  4MHE A;  2AQ2 B;  3SVM A;  3A7A B;  1VF5 C;  3QO2 A;  3HG9 A;  3V2T A;  2BE5 C;  1V8Q A;  2XRQ D;  3OW7 A;  1PTO C;  1PTO F;  1Z7T A;  4DXF A;  2R3Z A;  3GTJ B;  2J0T D;  1H9J A;  4ILW A;  2J4X A;  5LL6 X;  1W6K A;  2KVM A;  5M3M B;  1D5Z C;  1OO9 B;  1HA5 A;  1EQT A;  2SDF A;  3CU7 A;  2NTT A;  1R4P B;  1QCB D;  1SNQ A;  4C56 C;  4EQP A;  2TMP A;  4O1N A;  2PMZ B;  5C4J B;  3MA2 B;  5IT9 L;  1PRT B;  1ESF A;  1H9S A;  2WV6 D;  1XX8 A;  1JR0 D;  5FLX E;  3FPU B;  4EGV A;  1DOK A;  5EQ0 A;  3NK9 A;  3BZD B;  3VYS A;  4QMG A;  5ELD A;  3LNN A;  4I7Z C;  2A69 C;  3GQB A;  4K8J A;  2XVS A;  5EJW A;  4C3J G;  2B2Y C;  4M1U B;  1GUG A;  5DEH A;  3SHL A;  1IHZ A;  4KI0 A;  4XYQ A;  1EY6 A;  1MSH A;  1KTK A;  3MXN A;  1D5X C;  3MEH A;  3MVV A;  3FRP B;  1PYW D;  2XRS D;  5KEE A;  1G2T A;  4V0B A;  4GZY C;  3J81 E;  3FVQ A;  5C6A A;  3S17 B;  2X69 A;  2X6G A;  1CZG A;  3DMU A;  3D3R A;  1G8Z D;  1CM9 A;  4B9W A;  1LT6 D;  2K05 A;  4KD4 A;  5CV9 A;  4RCO A;  3T56 B;  1HQR D;  2EYM A;  5C3X A;  1LV9 A;  5G3L F;  1ILQ A;  1B2T A;  2PNR C;  2K32 A;  4KTA A;  5JEA J;  3R2I A;  2AUK A;  1EY9 A;  3U9S A;  3K58 A;  5LHY 1;  4C1N K;  1EIG A;  5CV8 A;  5JEA G;  1HUN A;  2Z1C A;  1F77 A;  1L0X B;  5KNC A;  1EL0 A;  4P2C B;  3M7G A;  2L4N A;  1GUT A;  3AU7 A;  3BDL A;  3VA7 A;  3L7Z C;  1JIC A;  1STB A;  1VMP A;  1QNK A;  4B9X A;  2AWO A;  3NTI A;  4DAY A;  1O78 A;  1G2S A;  4HSV A;  4R8N A;  5C0X J;  1SMY D;  3PO2 B;  4FF4 A;  3W2D A;  1IL8 A;  1J8I A;  3U9O A;  5C0X I;  2MJ8 A;  5JJZ A;  1B9M A;  4A3F B;  5C0X G;  2EY5 A;  3K57 A;  4QF4 A;  2V4D A;  4RFB A;  4RGT A;  4FNF A;  1FR3 A;  4BS9 A;  2IT1 A;  1HTL D;  4C3I B;  2B2U C;  2RQX A;  1LT3 D;  1D1K A;  5F2D A;  2F0E A;  2EYL A;  4M8A A;  5EBC A;  4XQJ A;  2L12 A;  1I4G A;  2FFK B;  1F9R A;  4XTC S;  4EQN A;  2XSC A;  4ZYS A;  2JE6 I;  5C3W A;  2B2T C;  1BR9 A;  4L8J A;  1STH A;  1H9S B;  5BN3 A;  1QIL A;  1FGB D;  3OIQ A;  4KMU C;  1WTW A;  4IUU A;  1NUC A;  2K33 A;  4IFD J;  4TQU S;  3BVG A;  2BA0 A;  2JSO A;  4IFD I;  2BDO A;  1R9T B;  2K5D A;  4HMJ A;  4NKL A;  4N9T A;  2CVR A;  4A3M B;  1STG A;  1TWC B;  1K83 B;  1YNN D;  2KEE A;  3LWU A;  5JAV A;  3IFT A;  5CV5 A;  1PZI D;  2A68 C;  1TII D;  1RHP A;  3QB3 A;  1HTP A;  3GD7 A;  4XQN A;  2CW0 D;  3BDC A;  3I4L A;  1LTG D;  4FXG C;  3HOU B;  4KHZ A;  5AFW A;  2B39 A;  1XTC D;  3DHQ A;  4ULL A;  2BE5 D;  1PTO D;  1CHQ D;  1GUN A;  4DAV A;  3QWN A;  1ICW A;  1D1I A;  1VDZ A;  4R8I A;  2B2W A;  3VR5 A;  3VR6 A;  2B63 B;  2D2C C;  3A8K E;  3J7A F;  4NW2 A;  2LFN A;  4R9W A;  4A3K B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...