1DXMA

Reduced form of the h protein from glycine decarboxylase complex
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
131
structure length
131
Chain Sequence
SNVLDGLKYAPSHEWVKHEGSVATIGITDHAQDHLGEVVFVELPEPGVSVTKGKGFGAVESVKATSDVNSPISGEVIEVNTGLTGKPGLINSSPYEDGWMIKIKPTSPDELESLLGAKEYTKFCEEEDAAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H PROTEIN
publication title Interaction between the Lipoamide-Containing H-Protein and the Lipoamide Dehydrogenase (L-Protein) of the Glycine Decarboxylase Multienzyme System. 2. Crystal Structure of H- and L-Proteins
pubmed doi rcsb
source organism Pisum sativum
molecule tags Oxidoreductases(acting on ch-nh2 donor)
total genus 35
structure length 131
sequence length 131
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01597 GCV_H Glycine cleavage H-protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1dxmA00
3PUXA 1EWHA 3QG1A 1CI3M 2YYZA 4RCNA 3VA7A 2E74C 3LWUA 2DNCA 1E2VA 3PV0A 1OXUA 5A35A 3A8IE 5BN5A 1FR3A 2BA0A 4KN4C 3D31A 1GUTA 3VR3A 2LMCB 2JEAI 3MXUA 4KN7C 1HQMC 1T5EA 4XTCS 2BE5D 1ZYRC 2A6ED 4I7ZC 1IYUA 3SE0A 1Z6HA 1GHJA 2EDGA 2D5DA 1V43A 3GQBA 2QF7A 1Q12A 3T51B 3GD7A 4PV1C 5K36G 2PCFB 2AUKA 1GHKA 4DNRB 3ND8A 1GJXA 1GUOA 2AWOA 3T53B 3I73A 5BN4A 1K8OA 2L5TA 4GZYC 4KI0A 3IFTA 1H9MA 2PPBC 2F1MA 3M85A 1Q1EA 4H0LC 5K36H 2A68C 1B9MA 2K33A 3PUVA 4LJZC 4KKUA 1H9KA 3IKJA 4BA1I 1E2WA 2NN6I 1TU2B 2CW0C 3I72A 4IQZA 2O5IC 1HPCA 1CFMA 2JXMB 1IW7C 3ND9A 4XIGS 3P20A 2E75C 2D62A 1O7LA 1TKWB 1PMRA 4DNTB 2A68D 3VR6A 1DXMA 3CRKC 1LACA 4G7ZC 3H94A 5JEAG 4DK1A 4KHZA 3AB9A 1BDOA 1OXVA 4G7OC 3HGBA 3NE5B 3T56B 3M4YA 2V4DA 3W3AA 3A8JE 2K7VA 4H44C 3L7ZC 2EJMA 3VR2A 1IW7D 1H9SB 1HTPA 2BA1A 3WDNA 2K32A 2A6HC 5KNBA 5JEAH 3PUYA 2KA7A 3A8KE 3SDZA 3VR5A 1E2ZA 1HCZA 1OXSC 1CTMA 2NN6G 4OGQC 4TQUS 3M7NA 4KKSA 1GUGA 2EJGC 3BG3A 1GUSA 4KKTA 1DCZA 1H9RA 1H9SA 3FMCA 4JK1C 1VCIA 2B8FA 5KNDA 1VF5C 2JE6I 1Y8OB 4KMUC 4HR7B 1A6XA 2A6HD 3EQLC 4LK1C 3QJYA 4DK0A 1IYVA 2BDOA 1VDZA 3PUWA 5KNCA 1OXXK 1V8QA 2R6GA 1LABA 3A7AB 3LNNA 1Q1BA 1Y8NB 3DXJC 2JEBI 3BDOA 3A7LA 3FPPA 3VR4A 3KLRA 2DNEA 1ONLA 1Y8PB 2E76C 2DN8A 1Z7TA 1SMYC 1B9NA 1YNJC 2D2CC 2A69C 2IT1A 3QIAA 2EJFC 3TZUA 5C0XG 3PUZA 2ZT9C 1O78A 4IFDG 4OO1G 1YNNC 2EVBA 1I6VC 3OOCA 1QJOA 4H13C 3N6RA 2Q8IB 1FYCA 4G7HC 3I4LA 3U9SA 2O5JC 4BA2I 1H9JA 2B8GA 1Q90A 3CRLC 3D4RA 3MFYA 5C0XH 4IFDH 3OW7A 1VF7A 1GUNA 4OO1H 1DD2A 2KCCA 2NN6H 1G291 3OPOA 1Y69U 2PNRC 2A69D 1OXTA 1K8MA 4L8JA 2BE5C 2A6EC 4TKOB 3RLFA 5BN3A 2AUJD 4JBWA 1ZKOA
chains in the Genus database with same CATH superfamily
1BR9A 1GM5A 1SNMA 1A8VA 1SE8A 2VUMB 1CM9A 1FD7D 1GUTA 4OX9Q 3J81L 4ZAIA 4K14A 2V1CC 4A3DG 1HZCA 2ZXPA 1QZHA 2PO4A 1VQ8A 4JI2Q 4JYAQ 5GQOA 1J5EL 1UE7A 1MHWC 2SDFA 3UDGA 1H95A 2A73B 2QF7A 4A3EH 2UU9Q 2A74C 3AQQA 4O0AA 4FF3A 1S5FD 4X66L 2QDLA 4KHVA 3Q8DA 2IY5B 2NYZD 3MWYW 1D1KA 2NZOA 5ELFA 3I73A 3SGIA 4AH6A 3IFTA 2OTJA 1X32A 1S5CD 4CJ1B 1V1PA 2IW3A 3WOEA 2DUDA 1SJHD 4LF8L 4FXKC 1WVLA 5JJIA 1UUPA 2K5DA 2MGSA 3NEMA 1WD1A 1RD9D 3PO3B 1GO3E 3HOYG 3VR6A 2XVSA 4KLKA 1LACA 4A93G 3GTJH 3MEFA 1JR0D 2KENA 3B6YA 1X3EA 1YEZA 2WAQE 1E7ZA 3W5OA 3G6EA 3P1HA 2AKWB 4N9TA 4LWCA 4DAYA 5C0XI 5JAVA 1RDPD 5M3MB 2WACA 3BG3A 1AP0A 1W6JA 4A3CG 5JVG3 2G9HD 3M3YB 3DWQA 5KNDA 2NVQH 3I90A 1B1ZA 4PZ6A 5M5XH 5I6WA 5CC4A 1SBBB 3KJOA 3KBXA 4A3JB 4A3FH 3KLWA 2HIVA 1X55A 4IALA 1NMGA 1IXRA 2DN8A 1C7YA 1WYDA 2PYKA 1FNVA 2I5HA 2YV5A 1P8LA 2EVBA 1TWHH 1JJCB 4Q0FA 1CHQD 1Q90A 2UXDL 1KC8C 1SMXA 5C44H 3EBEA 1O7IA 4CDDC 4DV3L 3ITPA 1Y14B 1IBKQ 1TWGB 3QG1A 5D65A 4HN7A 4J15A 3M7GA 3PV0A 4M1UB 2ZJPA 4JVZA 4KN4C 3D31A 4R1JA 2CVRA 1EIFA 2JA8B 4X64L 2RBMA 3G7LA 1D5XC 2B2WC 2DY7A 3S17H 3NSWA 4I7ZC 1JE5A 1I6HH 1LM0A 3M4OB 3S1NH 2EDGA 2OTLA 1ZXTA 2C35B 1PH5A 2K50A 4DR3Q 1HRJA 5EBCA 4IZ8A 4S3SA 1Q82C 4L63B 4Y52H 4LFAL 5ELNA 2RDFA 1NR2A 2CWAA 1LO5D 2EYHA 2RDGA 4RGTA 1ZYRD 2NVXH 4A3GG 1NTGA 3CMEA 3H0GG 1KTKA 4O2DA 4GKKL 3M85A 2I5LX 5IE8A 3PUVA 4P2CB 1L1OB 3TP8A 3KYHC 5DAUA 1WCMH 1STBA 3S1RH 2F0UA 2CW0C 3LGJA 4DV1L 1TQOA 2EIFA 1HPCA 1Y1WB 3S2HB 4DNTB 5IGDA 2NWGA 3HOWH 3FP9A 4JCVE 4K2LA 5JEAG 5DM63 1X3GA 4KY5A 3NE5B 4MN3A 1JQYD 4LFBQ 4RAUC 3PIOA 1H9SB 1Y1VH 5IP7H 4AQYQ 2VB2X 5LMUQ 1J6QA 4OGQC 1JMCA 1GKHA 2AMCB 1II3A 2ZTEA 3F8TA 4BY1B 4C1NK 2IHEA 1ESRA 2OF1A 3CPFA 4DR1L 3J81c 3CC2A 4BY7G 1K83H 2XWBB 2N3SA 3EIVA 1LTGD 1SNDA 2Q8TA 3QJYA 2UUBL 2BDOA 1VDZA 1X6OA 3PUWA 3KK7A 3K5OA 4B3MQ 4AIMA 2ASBA 4C56C 4NW2A 1GOZA 1F77A 2VXWA 3T1YQ 1Y8PB 3GTMH 2WKCA 2A1AA 1PFSA 5M3FG 5C0XG 2F4VQ 4O42A 1TWAH 2F0VA 1VQFA 1LTSD 5C4ZA 1H9JA 1MKHA 5H1SE 2QA4A 3IL8A 2RQXA 1IL8A 2KJXA 4A3IH 3OPOA 1NBWA 2PNRC 3JAME 5FK9C 1RKNA 2EYLA 2BH8A 5BN3A 1Q46A 4JBWA 1CI3M 2EYOA 5LHY1 4A3KB 4JOIA 2ALYB 3L0OA 1PVOA 1JE4A 1ENFA 3CCQA 1IYJB 1N32Q 3CD6A 3CP0A 2FMMA 1RF2D 4JI4Q 3GV3A 1STYA 4GN5A 1AZQA 1NUCA 1SNQA 4OXPA 3G6JB 2RKSA 4OIKA 4CDEC 2AUKA 3HOXB 1VQAA 1EY4A 4DV2L 1QG7A 4JI0Q 5E7NA 4NB3A 4DR6Q 2PPBC 3QB3A 4LJZC 3X3MA 4BA1I 4ILWA 1E1OA 3S9WA 1XNRQ 5IGBA 3CU7A 2H5XA 1J9OA 4A3BB 4MHEA 3OWEB 4L5SA 1DYQA 3DLLA 3BS1A 5KIXA 4C3HG 1X54A 1PYSB 4K8IA 1PTOB 4MTKA 1IW7D 3T1HL 2RHSB 4K2KA 2OCEA 5IGFA 3M7NA 2LFNA 4RG1A 1B7YB 2HQEA 3FMCA 5IGGA 3ULJA 5KGUA 3R3OA 1ASYA 3CCMA 1Y8OB 1QVCA 3EJIA 1PV4A 3OMCA 5CGKA 1KAAA 4FNFA 1IBLQ 4PZ7A 4DNIA 3I4MH 1LABA 3GTQB 3RZDH 2BH2A 4DUZQ 1YIJA 3VR4A 2FXQA 3A74A 1CA5A 1HZAA 4I7AA 5HGTA 5L37A 4EVOA 1ICFB 3AFPA 2DGYA 3HKZE 4LFBL 2JA8H 4IFDH 1WOCA 3E6ZX 1WTWA 2AQ1B 4JI8Q 1CQVA 4GNXA 2Z0SA 4B9WA 3RMHA 4GOPA 2AUJD 1G6PA 3UI2A 2K03A 5IYDH 5E1FA 4H02A 1X9NA 1MD2D 2UXBQ 3KF6A 1O80A 3GTKH 3UE0A 2F0TA 3Q24A 2PW7A 3KDFB 1NNXA 4B3ML 4L5RC 1KAWA 3PMFA 3PF4A 2EY1A 2EZVA 3HOVH 2Z6BA 1QUQB 3T1YL 2I07B 3GD7A 1A15A 2D0OA 3C46A 3J80E 1WTOA 2QGQA 1JOKA 2ATWA 3J7ZC 2R92B 3E0JA 4KY7A 4JI6Q 3FKIG 4CGYB 5K36H 2F1MA 1Q1EA 2JA6B 4DR7L 4KKUA 1H9KA 1D8LA 4ALPA 1EZ6A 2HHHL 1STEA 3HKZB 3GDEA 4HCEA 4QCLA 1PFMA 3CCRA 1N33Q 2MFIA 2KEEA 1BF4A 4XQQA 4X6AH 2Y0SE 3ERQA 1LV9A 1E3PA 1LT4D 3D6CA 5A2QE 4R8NA 1G51A 1YZ6A 3IFDA 1IHZA 2KVMA 2NB0A 4G7OC 1N32L 4J1MA 4CHTB 4KJNA 2AWNA 4JI4L 4H44C 2CH4W 3R2TA 4ZK9B 3PUYA 4IUUA 2Q2IA 4BBRH 3HEJA 4A3EB 2HCIA 3OYYA 4JI0L 4LF4L 3NUCA 4DR6L 2EXDA 1EY6A 4IJHA 3CQZH 4JI7L 3URYA 2O4XA 4JI3Q 3EROA 4P75A 2SNSA 3HOYB 4A3LH 1HR0W 1VQCA 4P71A 4JV5L 3OW2A 1XNRL 1SYBA 5FLMH 1HNZQ 1B8AA 1Q1BA 3A54A 3FPPA 2K4KA 1B2TA 2WP8J 5CMDA 4PNYA 4JC0A 3RUZA 3QIAA 1K0RA 3KJPA 4XQNA 4A3KH 3SK6A 3KF8B 3DWAA 1HR0L 2WKDA 3OIPA 2Y0SB 1X65A 2QKIC 5AJ3Q 4ZUJA 3D4RA 4LF7Q 3GTJB 2XSCA 1Q3LA 2E2IH 4B3TL 1T5XD 1KHIA 3ULLA 3MXPA 2EE1A 1A2UA 3RLFA 2F0DA 3BZDB 3K7UC 1PH6A 3GTOH 4GLXA 4GKJQ 3NXWA 2G5DA 3MA2B 4U68A 2LS01 2JEAI 4LF9Q 1GD7A 5C4XH 3I2ZA 1VQGA 1HZBA 4QIWE 1XJVA 1XNQQ 1ZYRC 1QILA 5M5XB 2MO0A 4K5WA 1Z6HA 1SAPA 2D5DA 3BZKA 2RF4A 2N49A 4HJAA 2JN4A 2CH4A 1STAA 4TRDA 1EFWA 5FLXE 1PH2A 3SK8A 4OWTB 4DV0L 1EEID 2AWOA 4LUVA 1XTCD 1LTRD 2B63H 1H9MA 4H7BA 3SK5A 1KDCA 4H0LC 1EEFD 4C3IG 1TWHB 3TP7A 4JI8L 2MO1A 5LMNW 1SROA 3OTOQ 3HOZH 4JPBW 1TXYA 2J0TD 5C44B 1JICA 4K0KL 5D14A 2B3GA 3P20A 4WJ3M 1G6ZA 1O7LA 1IL2A 1LUZA 4G7ZC 3AB9A 3QO2A 1CK1A 1KNEA 5LMNL 5KRUA 4C3JG 2K01A 4HIOA 1I4GA 2QEXA 1TS5A 3KBGA 1I6HB 4QIWB 3S1NB 1QB5D 2UUCQ 1I4XA 2F0SA 1H9RA 4JK1C 4A3MH 4IPGA 1DZ1A 3G4SA 5FO9B 5I9OA 4GNXC 2ICIA 2R6GA 5C5MA 1ZEQX 3BDOA 1M8AA 3HS0C 1WCMB 3CCUA 3S1RB 1KLGD 1D7QA 1V9PA 3CPWA 1TWCH 4H13C 4DFAA 5EBDA 3HOWB 4IUVA 4OO1H 2NVYH 4NXMQ 2P5ZX 2L55A 4PMBA 1CSQA 4U673 1J8IA 1TY0A 1LLRD 1E0BA 1BOSA 2HD3A 4K6DA 2I46A 1Y1VB 1DOLA 1LTAD 4RCNA 1ILQA 1HXYD 4NXNQ 3U50C 1EY7A 1PFNA 3F2UA 5C3EG 4R4OA 4LUOA 4V190 3T16A 2FHTA 1YJNA 1F2ZA 4HTHA 5CYUA 1K83B 2F4IA 4P74A 3PO2G 4DPGA 3RLNA 3M4PA 4A3DH 3O13A 1JORA 1I4QA 4YIJA 2LXKA 2NVTH 3I4OA 1CKNB 1VQOA 3GTMB 3K7AH 1GUOA 5ELCA 1K8OA 3BDLA 1EQTA 4DU9A 2UXCQ 1XMQL 5AJ3L 4JBKA 5JJLA 1TWAB 5DNFA 1YHAA 3K5LA 1ENCA 1T9HA 2XNAC 1RHPA 1V1OA 2J7ZA 3ZYYX 3DM3A 4A3IB 1FJGL 2Q8RE 1IW7C 3DM1A 1LTTD 4TVAB 1X56A 3QOLA 3D8GA 5BR8L 2OQ0A 2IPKD 2A68D 3J7AF 3CXCA 1VQKA 1XNQL 1EY8A 1NMFA 3W3AA 1VQPA 2B2TC 3HOYH 1STHA 4A93H 1EQVA 2K32A 3MXNB 2EYFA 2KA7A 3CMAA 3RN2A 3S1QH 1F9PA 3K0YA 3D0FA 4C2MH 4KMUC 1A6XA 1DOKA 2Z1CA 2A6HD 3EQLC 4LF6Q 1K3BC 1N9WA 4K5VA 5HURA 4A3CH 1S5ED 2K5VA 1B3AA 2R7FA 1K73C 1S4ZA 3OWFA 1UE1A 4KK7A 3NWTA 4JI5Q 1V1QA 1GXDC 4HEDA 3PUZA 1ENAA 2ZTDA 4ZKBB 2VZAA 1QVGA 3RN5A 2D9UA 4L5QA 4F88A 3PIP3 1EY9A 4L8JA 2F0KA 3PSIA 1CSPA 2JA7B 3VA7A 4CBVA 3J81E 3CCSA 1XMOQ 2UUAL 1NY4A 3NBHA 3D4WA 5IWAL 3SEBA 1L1OA 1S72A 2K52A 2MQHA 3ERSX 4DR4Q 3I4MB 4Z9CB 3IRBA 3RZDB 5JJKA 5J39A 2YU9B 2WAQB 3ND8A 3FVQA 3STBD 1PDQA 4KI0A 2HT1A 2EYMA 5FO7B 2K33A 3NENA 4YWMA 4DV4L 1SLJA 2EY6A 4RA8A 3VA5A 4KTAA 5CBEE 1IBMQ 4NXNL 4LFCL 2B2UC 1F9RA 3L3OC 1ASZA 1YHBA 3RD4A 3F2DA 3AYHB 1Q86C 4LUZA 3GTKB 2FINB 1HQRD 1VQIA 4FO2A 5KNBA 5JEAH 1OTCA 4MTNA 4A76A 2GVAA 4XYQA 4G4KA 3HOVB 4TQUS 1I3QH 3W1GA 1EQRA 1PZKD 4KKTA 2L4NA 1G2SA 3OSOA 3V05A 4UY8C 3T13A 1JC7A 2B2VA 1R4PB 4B08A 3BU2A 4OX9L 3J81j 1UE5A 4G57A 3I3CA 4JI2L 4JYAL 2VQEQ 1ONLA 1WTPA 3T4AC 1NSNS 4B3SQ 4X62Q 2UU9L 2IT1A 1L0XB 2F0IA 3AFQA 2E2HB 3NK9A 3TP6A 3UDFA 4B3RQ 1FYCA 2PW5A 1E24A 5M3FH 3MFYA 5C0XH 4K6LA 1LYLA 2KEDA 4X3UA 4CKEA 4MNOA 2KECA 2WB1E 3NQTA 2NTTA 4OHJA 3J7AV 1QNUA 1N34Q 1PZID 4ABNA 4WRDA 4FXDA 3SHLA 1M4VA 5EKIA 3MTSA 2DJFC 1PH3A 1RJTA 4BBRB 4YY3Q 4HCSA 2R7ZB 1SEBD 3E9IA 3K5NA 1QZGA 2PMZE 5GROA 5CV9A 1IYUA 3CQZB 4HJ8A 2L11A 2R93B 1JJGA 2K5WA 3N52A 1SSOA 2MPMA 2GA4B 2N88A 1VQEA 4R8IA 4N8FA 5CR3A 1TIID 3SVMA 4CJ0B 2VY3A 5I4DA 4DUYQ 5IIFA 4ZQ3A 1MSGA 1D5ZC 1ESFA 4EGVA 3HOUG 1SDFA 4IOAA 2E2IB 2C9OA 1BUVT 3ND9A 2WB1B 4PQXA 1HNXQ 4A75A 1OO9B 1E1TA 4DAPA 3GTOB 4DV6Q 1XPRA 5J3BA 3D4DA 3LWEA 2VUMG 1WTQA 5M9OA 2B39A 1KRTA 3TN2A 3SK4A 3UDXA 5C4XB 2K05A 2M2LA 3S24A 1UEAB 3HG9A 4C3HH 4DR4L 1JWSD 1S5DD 2NTSA 5IT9L 4POGA 5FJ8G 4ZUIA 5IGCA 1PH4A 4XDXA 5CV5A 1HH2P 2E8GA 3I7FA 3PQIA 3I91A 1GUSA 3WWVA 1IBKL 3TQYA 1F2YA 2A5HA 4JG2A 5IP9G 2PI2A 3U9OA 1STNA 5HGQA 2ES2A 1IZ6A 3CHBD 4I65A 2B63B 1JCKB 1V8QA 3H3VI 2M00A 3M9BA 2CKZB 1BBXC 2K75A 3KLSX 3H09A 3FRPB 1CT1D 1Z7TA 4DR3L 3HOZB 2D2CC 4RGMA 2JA7H 5TSSA 3PCOB 5GADC 1FNUA 1SE2A 2VQFQ 3M4QA 3DHQA 1DOMA 2B8GA 3PO3G 3G71A 1SN8A 2F0QA 1PH8A 3CAMA 4NPSA 1QUQA 1YNND 1ILPA 4HSPA 1AE2A 5DLQE 5G3LD 4XXEA 2DNCA 2YU9H 1R9TB 3RZOH 5E3FA 5C3XA 5M3MG 1NAPA 2F0HA 1I4HA 3MVVA 3MXUA 1HQMC 4A3MB 1IKMA 2KHIA 2K5QA 1KDBA 2FJ2A 3FDTA 5EQ0A 3GQBA 1WTXA 3TS2A 4X62L 4A3JG 4X65Q 4AQYL 3U4ZA 1S5BD 4X3TA 3H15A 5LMUL 2KCTA 4B3RL 5A2QL 3GV6A 5I2XA 2A68C 2R3ZA 4DA2A 1TWCB 2MJ8A 3OIQA 4JI1Q 2A19A 1L0YB 5G3LF 1HFGA 3FKIH 4F87A 3NTHA 3BYYB 4IQZA 2NVYB 1YBYA 4XIGS 4HMJA 3E5SA 4YY3L 1SR3A 3CRKC 5LL6S 1Q8KA 2F4VL 2QDBA 1G8ZD 3CW2C 2K7VA 1FGBD 3WOFA 4DV7Q 2A6HC 2JA8G 4QGUA 3MAQA 5JVH3 3CCEA 1DONA 4POFA 3K80C 4CDCC 2HDLA 2EJGC 2ID0A 2Z6KA 4HSVA 1C0AA 4A3DB 4BXXG 3K8AA 1VCIA 2E2HH 1C48A 1Q7YC 3A55A 2JE6I 2PZUA 3DEPA 3QWNA 3KF8A 5IODA 4QUFA 4Y7NH 2NVTB 1QCBD 3K7AB 3I4NG 2HIXA 1I4RA 3S15H 2Z4HA 1B50A 2MUYA 3JAMi 4EQ5A 5NUCA 5IYBG 2HUGA 1HNXL 3NTKA 1UNSA 1A3VA 2RDHA 1EZ8A 1SYFA 2HQLA 2B2YA 4PMWA 1Q81C 4GNXB 4ULLA 2RSOA 2E2JH 2QEJC 2R7ZH 4C1NI 1Y1WG 1N36Q 4EQPA 4WJWA 1MBYA 2PNHA 3HZXA 2R93H 4A93B 1VQ5A 1EWHA 3SXHA 4QMGA 5C3WA 1G2TA 4R4CA 2WV6D 1R4QB 4LAAA 4JOIC 3LX0A 3UDIA 1VQNA 3S1QB 4V0BA 1QOHA 1SRUA 2ENBA 1UE6A 4BY1G 2A6ED 3C2PA 4C2MB 3STBC 5CV4A 1GHJA 4OWXB 5IT9c 2R61A 1JB7A 1F9SA 2N78A 1HNWQ 5FOBB 3K5MA 2F0NA 3GTPH 2MP1A 3GTLH 3UE1A 1AH9A 3T53B 2VQFL 4DR5Q 2E5LQ 1SYDA 4IUPA 5KEEA 3BVZA 4KHPQ 5EPJA 4ZKCB 1A62A 4LNQA 1BNZA 4A3LG 1IBLL 3D6WA 2OEOA 3DEOA 1WJJA 3TS0A 4C3IH 4DUZL 3NBIA 1CKOA 2D0PA 2FMCA 2H4OA 2KHSA 3TZDA 4FF2A 1WFQA 1B44D 1AE3A 3JC66 1XWEA 3HRZC 2WINB 1OXVA 2RHQB 1J5EQ 1KABA 4ZYSA 3A8JE 1JT8A 1K8AC 3L7ZC 1KDAA 1PYWD 1BBUA 1VQDA 4K8JA 2F3IA 2JK8A 4X3KA 4XQJA 3VR5A 5T1IA 4X65L 1HA5A 1GUGA 5ELDA 1EUJA 3G48A 4EQNA 5JJZA 1CKMA 3X3NA 5M5WH 2MHVA 3HOXG 2UXBL 1SE3A 5IYCG 1IYVA 1W2BA 4JI1L 3AMUA 2JP1A 3I55A 1KL9A 3AEVA 2PQAB 4APVA 1KRSA 4UAIA 4IURA 4A3GB 2E76C 3H0GB 1K0SA 1SMYC 1YNJC 1BBWA 4HJ5A 3S14B 1O78A 1LT6D 2IX3A 2ZXRA 1R9TH 1VQMA 4A3BG 3OOCA 1VQ7A 2OT2A 3PGZA 3I4LA 1PYBA 1BXTA 1CZGA 4JI6L 1NE3A 2KHJA 3K58A 1L2FA 4UHVA 2J4XA 2NN6H 1G291 2CWPA 2IL8A 1VQ9A 2HDMA 4JBMA 2IX1A 4GZYC 4KD3A 2JQOA 1ZKOA 3W1BA 4GOPC 2YYZA 1YITA 4KJOA 3J80i 4DK3C 2OQKA 1N33L 1VMCA 2BCOA 3NTIA 1I3QB 2LMCB 1JWUD 1CKNA 3R93A 2B2WA 1JJ2A 4XTCS 1EQQA 1I50H 1GUWA 5C3EH 1YVCA 2L9HA 4WORA 1FL0A 1Q12A 3K59A 5FKAC 1PRTC 4NP5A 2ICEC 1VQLA 4OONA 4BY7B 4FXGC 3PO2H 4HJ9A 2F3VA 3BJUA 1K28A 4FYDA 3F2BA 5EKKA 1GVPA 2K28A 5KYIA 5BN4A 2UXDQ 4DR2Q 1SYEA 2XRQD 5D3DA 4DF7A 3S16H 4JI3L 4HMIA 3DUZA 4DXGA 1I4PA 4DV3Q 2Q2TA 5M3FB 5E4XA 2VS1A 1HJPA 1HNZL 1I94Q 2B29A 2N8NA 4UDUC 4HIKA 5IGEA 4X64Q 2F0GA 2Z9HA 3CC7A 3TSSA 3M4YA 4YCUA 3GTGB 3MXGA 3L9AX 3MZ5A 4LF7L 3L2PA 5GAGC 1VQ6A 4LFAQ 2N55A 3CCJA 3NQIA 4KV6A 1TVXA 2B2YC 5IY0A 3QR8A 3VYUA 4GKKQ 4DR5L 4CJ2C 2F0LA 4BBSG 4GKJL 1BQQT 4RKLA 1KD1C 4L6TB 4WFN3 2CQAA 4LF9L 1EOVA 2R92G 5KYLA 3LNNA 4ODGA 1HZ9A 4DV1Q 1Y8NB 3DXJC 1SNCA 2JA6G 2TSSA 4QUCA 3PF5A 4RMFA 3HKZG 4MIUA 5COYA 3BVGA 2LKVA 4RWSC 1RTOA 1Z47A 3TP5A 4ZLTF 2JA5G 4QY7A 1C4QA 1YNNC 1I6VC 1EU3A 5C6AA 1EL0A 3CKIB 1U9RA 1CA6A 4HIMA 2GN5A 1DM0B 1D2BA 1Y69U 3J7A5 3RR5A 4DGZA 4MZ9A 4C3HB 3H91A 1CUKA 3ZJYC 1YJ9A 4DXFA 3OTOL 4DR1Q 2E74C 3LWUA 1E2VA 1FR3A 4R4QA 1PA6A 3VR3A 2UUBQ 5I2YA 1KXLA 1PZJD 4FVMA 4A3EG 1X3PA 2BE5D 4R4IA 4RHRA 4OWWB 2TMPA 2A8VA 2R7DA 5EPLA 1ET6A 3U4VA 4GN3B 1KNAA 1SYCA 4HJ7A 1XXGA 1AW7A 4RFBA 2ZXOA 3KOJA 2CCZA 3E3XA 4DNRB 1XPUA 2UUCL 4E6IA 1WTHA 4QL5A 3S2DB 1GJXA 1G91A 1AZPA 4DAMA 1EYDA 4IUTA 2QCPX 3VYSA 1TS4A 2Y0SG 2CHBD 5E4WC 4K5XA 1QVFA 3I72A 2EOTA 1O7YA 3A56A 4Q5VA 1QNKA 3HFZB 3TEHB 1BDOA 3RZOB 1W3SA 1V1PB 5HY6A 1PTOD 5GAHC 2JSOA 1HTPA 5ELBA 1A63A 3K0XA 1HUMA 3SDZA 3S1MH 3BDCA 4NXML 1W6KA 2ZTCA 4A3GH 2KBNA 4N8X1 4YHHQ 1BCPD 3A5ZB 3H0GH 4J6HA 4DV2Q 1JOOA 4GLAC 4CDFC 1H9SA 4A3FG 4DR2L 3BYTB 4ZCKA 3S14H 5K5PA 1JWMD 2VL6A 1F2LA 4LK1C 4DK0A 5M5YH 5CBAE 5D3IB 1B4OA 1LTBD 4GLVB 4DV5Q 2VNUD 4DAYB 4DAVA 1SFOH 4IPDA 4FF4A 1I94L 4AYBG 1TS2A 4OELB 3MFGA 4DK6C 3FKIB 2JYOA 3K81C 1K8GA 2RCNA 5C4JB 1PTOF 5C44G 2IX0A 5GAEC 1PXUA 1VQ4A 2UXCL 3T1HQ 1B70B 1BCPF 1TS3A 2F0OA 2KCCA 3C1FA 3FHWA 3CC4A 1U4RA 2A69D 3I4NB 1JB3A 2A6EC 2LY7A 3Q22A 3NBHB 2EQSA 3JAML 4BY7H 1EY0A 3KFUA 1EOTA 4LMQD 1RTNA 4Y7NB 4BWGB 5C5LA 1U4MA 2WFWA 3S15B 1PLFA 1NJIC 2ZM6Q 1SMYD 1YNJD 4F8MA 1F2MA 2L12A 1WCMG 2G9DA 3HP3A 5EKLA 3VYRA 2E2DC 2FFKB 3FPUB 3TREA 2E2JB 1E2WA 1QWYA 3MHBA 4ID6A 4LF6L 3GTGH 1S40A 3E0EA 4P73A 3HOWG 4J8QA 2MNAA 2JXMB 4IJLA 2CQOA 4JI5L 3HOUH 1U4LA 3H94A 4RH6A 1YNXA 2XIWA 1Y1VG 4JBJA 5IP7G 3A5UA 1LT5D 1B53A 1I5FA 1O7ZA 1VQBA 2GVBA 2IJ0A 1U5KA 4UP8A 2BA1A 3NELA 1FVIA 5DEHA 2VUMH 1PRTD 4IFDI 1B3QA 1OXSC 2XGTA 5ISRA 4KKSA 5C4HA 5AFWA 2IWHA 2EXZA 5FJ8H 4DR7Q 3GTPB 3KUPA 1S3OA 4HR7B 3GTLB 1XMOL 2HHHQ 2KCNA 2YTVA 4LW1A 4L5TA 4IPHA 4O1NA 5CV7A 2F0JA 5IP9H 1U0LA 2M9VA 3A7LA 3IAYA 1CZWA 5CORA 3C3LA 3KLRA 2SNMA 2PMZB 4IOCA 3J81i 2EJFC 1ICWA 3K57A 4C3IB 4FP5D 1TR5A 4EQOA 4A3IG 1XYIA 1EIYB 1EU4A 2Q8IB 3AU7A 2C5CA 2BOSA 4F7XA 3A0JA 1RL2A 3CRLC 4R4TA 1EYCA 1BO0A 1PRTF 2BDNA 4XT3B 4BS9A 3CCVA 3OW7A 1VF7A 1GUNA 3DWPA 5EPKA 1DD2A 1SXTA 1K8MA 2YTXA 4TKOB 3PO3H 4YHHL 1TU2B 2O5JC 3PUXA 4LF4Q 1UAPA 1L0WA 3H6MA 1P16A 4ZRZA 4C3JB 4NKLA 5A35A 3A8IE 4JI7Q 1IBML 2BA0A 3S2DH 4JV5Q 1U4PA 1SYGA 2F3WA 1LTLA 4DV5L 2PI2E 5J22A 1SNOA 5M5WB 2QILA 5M3MH 1Q8IA 1HFNA 1L1OC 4FF1A 1DGSA 2AQ3B 3T51B 1TY2A 4PV1C 3KDFA 3M3YH 3E9HA 3R8BA 1HR0Q 5ELEA 3V2TA 1WTRA 1K9MC 3QOJA 2K5NA 4PZ8A 2LSSA 3NP8A 4NDXA 3J80L 4A3JH 4B3TQ 1BKBA 4GN4B 2PZWA 4N9PA 1C9OA 3EA6A 1SJED 2KUMA 2KCMA 4PMCA 1BCPB 2F0WA 3OHXC 4R9WA 5F2DA 1A0IA 3H3VC 1D1IA 2OXPA 5JPNC 1D6EC 2XTIA 3K6OA 2EY2A 2D62A 2RCFA 2VQEL 4YWLA 1AEXA 4B3SL 2RSNA 4PG3A 2SEBD 4DK1A 3RNUA 4KHZA 5EGTA 4FDBA 1MIUA 2JA7G 3HGBA 1XPOA 5IT9E 3EFXD 1WI5A 2XWJB 1DJRD 2K1BA 2EYPA 3WDNA 3TMEA 1YHQA 1FNWA 1TWGH 1I50B 5LL6X 3D3RA 1E2ZA 2ZM6L 1HCZA 5C3EB 3JAMc 2EY5A 4LF5Q 3VYTA 1TWFB 1N34L 4DV0Q 2Z8LA 2I0QA 1N8RC 2B8FA 3I4MG 1X3FA 4ME3A 1VF5C 5C4JH 1LT3D 3CF5A 3PO2B 3MEHA 2B2VC 4IN3A 1EIGA 3M4OH 2WAQG 2PQEA 4XYOA 3HKSA 4BXXH 4K0KQ 2JEBI 4UPAA 3S16B 2JJQA 3EVQA 3I4NH 2X6LA 1M1KC 1FGUA 2EPBA 4IFDG 5LMNQ 4ME5A 4EX5A 5IYBH 1A2TA 1PH1A 4G7HC 2DJGC 4BA2I 5IOCA 2XRSD 1VQHA 4BBSB 4DUYL 5IYDG 4TSSA 1MJEA 3TRZA 3DMUA 2BE5C 1Y1WH 3S2HH 5JEAJ 1NCVA 3OMGA 2OWOA 4WJ4A 3EN2A 4XT1B 5JPMC 2XN9C 2F0PA 5BN5A 2L1BA 3PIPA 2VB3X 3HOVG 4KY6A 3NWSA 3H3VH 2RVLA 4DV6L 2JA5B 1MI2A 4UP9A 5EAYA 4JW0A 3SE0A 2F52A 5EJWA 4GOPB 2KOLA 4IUNA 1V43A 4DKAC 1WTVA 1MJCA 1C8CA 1AN8A 4BY1H 3F1ZA 5K36G 2PCFB 1RODA 2L15A 1GHKA 2AQ2B 2PZTA 3KF6B 4GS3A 5DM73 1Z9FA 1XTDA 1A3TA 5FLXL 2DY8A 1EIHA 4YCVA 1B9MA 1EYAA 3Q6SA 2HCCA 1WD0A 1PRTB 4IPCA 2NN6I 5C0XJ 1K3RA 2F0MA 1KLUD 1PTOC 1CFMA 2I5MX 2E75C 1MSHA 1DXMA 1EWIA 5J1ZA 4RCOA 1BCPC 3VDYA 1PFBA 2B2TA 3T56B 4BBRG 2R7ZG 2CW0D 3Q0AA 2EJMA 3VR2A 4RGOS 4QQBX 4NMZA 4OL7A 2F03A 4AYBE 4OO1I 2PQAA 4OEMB 1CTMA 2ZJQA 2AHOB 2R93G 1UEBA 3NHHA 3NPPA 1DCZA 1XMQQ 4RGNA 5FLMG 1EY5A 2F0FA 4RHSA 3ULPA 1SE4A 3U58A 3V96A 4UP7A 1CHPD 4HIDA 2X6GA 3TDQA 1HA6A 3PIO3 1OXXK 3A7AB 1JOQA 1FJGQ 4A3KG 2F0EA 2Q2HA 3R2IA 5BR8Q 3HOXH 5IYCH 2DNEA 1VQJA 1EWCA 1B9NA 2KQ3A 4X66Q 2A69C 1KQSA 1XX8A 1NR4A 2K04A 1UWVA 2ZT9C 4C3JH 2NVQB 4OIJA 3J80c 1QJOA 3N6RA 2WB1G 1HHVA 2WIIB 3U9SA 4QJFA 1EFID 4A3FB 3BVMA 4A3BH 3FEWX 5JOBA 1OXTA 2YTYA 2NUCA 4IO9A 4LF5L 3F2CA 3ICEA 2NBFA 3BZCA 5C4XG 1IKLA 2O2LD 4LF8Q 3S1MB 4AYBB 1OXUA 5I6YA 4QF4A 3TBIB 2JA9A 4KN7C 1PTOH 4QB4A 1T5EA 1A3UA 4IUQA 5CV8A 1D5MC 4CKCA 4DN4M 5M5YB 4A4IA 1VS0A 2B63G 1STGA 4YCWA 4DV7L 1YI2A 1SFOB 1YJWA 2LXJA 1X3QA 1HTLD 3SR1A 1TT2A 2IHFA 4HAEA 2L5TA 4X3SA 3HOZG 3GTQH 3S17B 5FO8B 1BVSA 3IKJA 1ML0D 1VMPA 5T1GA 4B9XA 3I8ZA 3RLOA 3P7JA 2O5IC 1RCVD 3W2DA 2UUAQ 2L0CA 1TWFH 2B2UA 1TKWB 2NVXB 1PMRA 1ET9A 1M90C 2RA4A 3P75A 1MGSA 5IWAQ 1QE6A 4CKBA 1AFPA 2V4DA 1PHJA 1E22A 4P72A 3ONAB 1N36L 5CV6A 2Q2UA 4A3MG 1CQFA 3A8KE 2EYJA 2K5HA 2Z4IA 4KD4A 3C1EA 1RIPA 2NN6G 2ZJRA 3Q23A 4IFDJ 3GP7A 3J7YW 1PH9A 2Z6KC 3MXNA 1LTID 2NZ1D 2VW9A 4DV4Q 3KLSA 2QW7A 2NZHA 3I56A 5KNCA 1SNPA 4BBSH 2H1EA 3GO5A 1HUNA 4LFCQ 2K6AA 3I70A 4M8AA 3MC0B 5I9PA 2CFMA 2R92H 2SOBA 4YWKA 1HNWL 3TZUA 1F9QA 4RKBA 5ELOA 4OO1G 5FLXc 2JA6H 2X69A 3HOUB 3ER0A 2K14A 1PH7A 3CCLA 2JA5H 2E5LL 1EYGA 4KHPL 1KIXA
chains in the Genus database with same CATH topology
1BR9A 1SNMA 2VUMB 1CM9A 1FD7D 1GUTA 3J81L 4ZAIA 4K14A 2ZXPA 2PO4A 2SDFA 2A73B 2QF7A 2A74C 4FF3A 1S5FD 4KHVA 2NYZD 3MWYW 1D1KA 5ELFA 3I73A 3IFTA 1X32A 1S5CD 4CJ1B 1V1PA 2IW3A 3WOEA 1SJHD 4FXKC 1WVLA 1UUPA 2K5DA 2MGSA 1WD1A 1RD9D 3PO3B 3VR6A 2XVSA 1LACA 1JR0D 3P1HA 4N9TA 4DAYA 5C0XI 5JAVA 1RDPD 5M3MB 2WACA 3BG3A 1AP0A 1W6JA 5JVG3 2G9HD 3M3YB 3DWQA 5KNDA 3I90A 1B1ZA 5I6WA 5CC4A 1SBBB 3KBXA 4A3JB 4IALA 2DN8A 2PYKA 1FNVA 2EVBA 4Q0FA 1CHQD 1Q90A 3ITPA 1TWGB 3QG1A 5D65A 4M1UB 4HN7A 3M7GA 3PV0A 4KN4C 3D31A 2CVRA 2JA8B 2RBMA 3G7LA 1D5XC 2B2WC 2DY7A 3NSWA 4I7ZC 3M4OB 2EDGA 1ZXTA 1HRJA 5EBCA 4IZ8A 4S3SA 4L63B 2RDFA 1NR2A 2EYHA 1LO5D 2RDGA 4RGTA 1ZYRD 1KTKA 3M85A 3PUVA 4P2CB 3TP8A 5DAUA 1STBA 2F0UA 2CW0C 1TQOA 1HPCA 1Y1WB 3S2HB 4DNTB 5IGDA 2NWGA 4K2LA 5JEAG 5DM63 4KY5A 3NE5B 4MN3A 1JQYD 4RAUC 1H9SB 2VB2X 4OGQC 1II3A 4BY1B 4C1NK 1ESRA 2OF1A 2XWBB 1LTGD 1SNDA 2Q8TA 3QJYA 2BDOA 1VDZA 3PUWA 3KK7A 3K5OA 4C56C 4NW2A 1GOZA 1F77A 2VXWA 1Y8PB 2WKCA 5C0XG 4O42A 2F0VA 1LTSD 5C4ZA 1H9JA 3IL8A 2RQXA 1IL8A 2KJXA 3OPOA 2PNRC 3JAME 5FK9C 1RKNA 2EYLA 5BN3A 4JBWA 1CI3M 2EYOA 5LHY1 4A3KB 1JE4A 1ENFA 2FMMA 1RF2D 3GV3A 1STYA 1AZQA 1NUCA 1SNQA 3G6JB 2RKSA 4OIKA 2AUKA 3HOXB 1EY4A 1QG7A 2PPBC 3QB3A 3X3MA 4LJZC 4BA1I 4ILWA 3S9WA 5IGBA 3CU7A 1J9OA 4A3BB 4MHEA 3OWEB 1DYQA 3BS1A 5KIXA 4C3HG 4K8IA 1PTOB 1IW7D 4K2KA 5IGFA 3M7NA 2LFNA 2HQEA 3FMCA 5IGGA 5KGUA 3R3OA 1Y8OB 3EJIA 3OMCA 5CGKA 1KAAA 4FNFA 1LABA 3GTQB 3VR4A 1CA5A 5HGTA 4EVOA 4IFDH 3E6ZX 1WTWA 2AQ1B 1CQVA 4B9WA 3RMHA 2AUJD 3UI2A 2K03A 5E1FA 1MD2D 1O80A 2F0TA 3Q24A 2PW7A 3PMFA 2EY1A 2EZVA 2I07B 3GD7A 1A15A 3C46A 3J80E 1WTOA 1JOKA 2R92B 3E0JA 4KY7A 4CGYB 5K36H 2F1MA 1Q1EA 2JA6B 4KKUA 1H9KA 1EZ6A 1STEA 3HKZB 4HCEA 4QCLA 1PFMA 2KEEA 1BF4A 4XQQA 3ERQA 1LV9A 1LT4D 3D6CA 5A2QE 4R8NA 4G7OC 3IFDA 1IHZA 2KVMA 2NB0A 4J1MA 4CHTB 4KJNA 2AWNA 4H44C 3R2TA 4ZK9B 3PUYA 4IUUA 3HEJA 4A3EB 2HCIA 3NUCA 1EY6A 3URYA 2O4XA 3EROA 2SNSA 3HOYB 1SYBA 1Q1BA 3A54A 3FPPA 1B2TA 2WP8J 5CMDA 4PNYA 3RUZA 3QIAA 4XQNA 3SK6A 3DWAA 2WKDA 3OIPA 2Y0SB 2QKIC 4ZUJA 3D4RA 3GTJB 2XSCA 1Q3LA 1T5XD 3MXPA 2EE1A 1A2UA 3RLFA 2F0DA 3BZDB 3NXWA 3MA2B 4U68A 2LS01 2JEAI 1ZYRC 1QILA 5M5XB 4K5WA 1Z6HA 1SAPA 2D5DA 1STAA 4TRDA 5FLXE 3SK8A 1EEID 2AWOA 1XTCD 1LTRD 1H9MA 4H7BA 3SK5A 1KDCA 4H0LC 1EEFD 4C3IG 1TWHB 3TP7A 2J0TD 5C44B 1JICA 5D14A 3P20A 1G6ZA 1O7LA 4G7ZC 3AB9A 3QO2A 1CK1A 1KNEA 5KRUA 4C3JG 2K01A 1I4GA 1TS5A 3KBGA 1I6HB 4QIWB 3S1NB 1QB5D 1I4XA 2F0SA 1H9RA 4JK1C 1DZ1A 5FO9B 5I9OA 2ICIA 2R6GA 5C5MA 1ZEQX 3BDOA 1M8AA 3HS0C 1WCMB 3S1RB 1KLGD 4H13C 4DFAA 5EBDA 3HOWB 4IUVA 4OO1H 2L55A 4PMBA 4U673 1J8IA 1TY0A 1LLRD 1E0BA 1BOSA 4K6DA 2I46A 1Y1VB 1DOLA 1LTAD 4RCNA 1ILQA 1HXYD 1EY7A 1PFNA 3F2UA 4V190 3T16A 2FHTA 1F2ZA 4HTHA 5CYUA 1K83B 2F4IA 3O13A 1JORA 1I4QA 4YIJA 3GTMB 1GUOA 5ELCA 1K8OA 3BDLA 1EQTA 4DU9A 1TWAB 5DNFA 3K5LA 1ENCA 2XNAC 1RHPA 1V1OA 2J7ZA 3ZYYX 4A3IB 2Q8RE 1IW7C 3DM1A 1LTTD 3QOLA 3D8GA 2IPKD 2A68D 3J7AF 1EY8A 3W3AA 2B2TC 1STHA 1EQVA 2K32A 2EYFA 2KA7A 1F9PA 3K0YA 4KMUC 1A6XA 1DOKA 2Z1CA 2A6HD 3EQLC 4K5VA 5HURA 1S5ED 1B3AA 1S4ZA 3OWFA 4KK7A 3NWTA 1GXDC 4HEDA 3PUZA 1ENAA 4ZKBB 2D9UA 4F88A 3PIP3 1EY9A 4L8JA 2F0KA 2JA7B 3VA7A 4CBVA 3J81E 3NBHA 3D4WA 3SEBA 3I4MB 4Z9CB 3RZDB 5J39A 2YU9B 2WAQB 3ND8A 3FVQA 1PDQA 4KI0A 2EYMA 5FO7B 2K33A 2EY6A 4RA8A 3VA5A 4KTAA 5CBEE 2B2UC 1F9RA 3L3OC 3RD4A 3GTKB 2FINB 1HQRD 5JEAH 4FO2A 5KNBA 4XYQA 4G4KA 3HOVB 4TQUS 1PZKD 4KKTA 3V05A 2L4NA 1G2SA 3OSOA 3T13A 1JC7A 2B2VA 1R4PB 4B08A 4G57A 3I3CA 1ONLA 1WTPA 3T4AC 1NSNS 2IT1A 1L0XB 2F0IA 2E2HB 3NK9A 3TP6A 1FYCA 2PW5A 3MFYA 5C0XH 4K6LA 2KEDA 4X3UA 4CKEA 2KECA 3NQTA 2NTTA 4OHJA 3J7AV 1QNUA 1PZID 4ABNA 4WRDA 4FXDA 3SHLA 1M4VA 5EKIA 3MTSA 1RJTA 4BBRB 4HCSA 2R7ZB 1SEBD 3K5NA 5CV9A 1IYUA 3CQZB 2L11A 2R93B 2K5WA 3N52A 1SSOA 2MPMA 2GA4B 2N88A 4R8IA 5CR3A 1TIID 3SVMA 4CJ0B 5I4DA 5IIFA 4ZQ3A 1MSGA 1D5ZC 1ESFA 4EGVA 1SDFA 2E2IB 2C9OA 1BUVT 3ND9A 2WB1B 4PQXA 1OO9B 4DAPA 3GTOB 3D4DA 3LWEA 1WTQA 5M9OA 2B39A 3TN2A 3SK4A 5C4XB 2K05A 2M2LA 1UEAB 3HG9A 1JWSD 1S5DD 2NTSA 5IT9L 4ZUIA 5IGCA 4XDXA 5CV5A 3I91A 1GUSA 1F2YA 2A5HA 3U9OA 1STNA 3CHBD 4I65A 2B63B 1JCKB 1V8QA 2M00A 1BBXC 3KLSX 3H09A 3FRPB 1CT1D 1Z7TA 3HOZB 2D2CC 4RGMA 5TSSA 1FNUA 1SE2A 3DHQA 1DOMA 2B8GA 2F0QA 1YNND 1ILPA 4HSPA 5G3LD 4XXEA 2DNCA 1R9TB 5E3FA 5C3XA 1NAPA 2F0HA 1I4HA 3MVVA 3MXUA 1HQMC 4A3MB 1IKMA 2K5QA 1KDBA 2FJ2A 3FDTA 5EQ0A 3GQBA 1WTXA 1S5BD 4X3TA 5A2QL 3GV6A 5I2XA 2A68C 2R3ZA 4DA2A 1TWCB 2MJ8A 3OIQA 1L0YB 5G3LF 1HFGA 4F87A 3NTHA 3BYYB 4IQZA 2NVYB 4XIGS 4HMJA 3E5SA 3CRKC 5LL6S 2QDBA 1G8ZD 2K7VA 1FGBD 3WOFA 2A6HC 3MAQA 5JVH3 1DONA 2HDLA 2EJGC 2ID0A 4HSVA 4A3DB 1VCIA 1C48A 3A55A 2JE6I 2PZUA 3DEPA 3QWNA 3KF8A 5IODA 4QUFA 2NVTB 1QCBD 3K7AB 1I4RA 2Z4HA 1B50A 2MUYA 5NUCA 2HUGA 3NTKA 1UNSA 1A3VA 2RDHA 1EZ8A 1SYFA 2B2YA 4PMWA 4ULLA 2RSOA 2QEJC 4C1NI 4EQPA 4WJWA 1MBYA 3HZXA 4A93B 1EWHA 3SXHA 4QMGA 5C3WA 1G2TA 2WV6D 1R4QB 4LAAA 3LX0A 3S1QB 4V0BA 1QOHA 2ENBA 2A6ED 3C2PA 4C2MB 5CV4A 1GHJA 2R61A 1F9SA 5FOBB 3K5MA 2F0NA 2MP1A 3T53B 1SYDA 4IUPA 5KEEA 3BVZA 5EPJA 4ZKCB 1BNZA 3D6WA 2OEOA 3DEOA 3NBIA 2H4OA 2FMCA 3TZDA 2KHSA 4FF2A 1B44D 1XWEA 3HRZC 2WINB 1OXVA 1KABA 4ZYSA 3A8JE 3L7ZC 1KDAA 1PYWD 4K8JA 4X3KA 4XQJA 3VR5A 5T1IA 1HA5A 1GUGA 5ELDA 4EQNA 5JJZA 3X3NA 2MHVA 1SE3A 1IYVA 3AMUA 2JP1A 4UAIA 4IURA 4A3GB 2E76C 3H0GB 1SMYC 1YNJC 3S14B 1O78A 1LT6D 2IX3A 2ZXRA 3OOCA 2OT2A 3I4LA 1BXTA 1CZGA 3K58A 2J4XA 2NN6H 1G291 2IL8A 2HDMA 2IX1A 4GZYC 4KD3A 1ZKOA 2YYZA 4KJOA 1VMCA 2BCOA 3NTIA 1I3QB 2LMCB 1JWUD 3R93A 2B2WA 4XTCS 1GUWA 2L9HA 4WORA 3K59A 1Q12A 5FKAC 1PRTC 4NP5A 2ICEC 4BY7B 4FXGC 2F3VA 4FYDA 5EKKA 2K28A 5KYIA 5BN4A 1SYEA 2XRQD 5D3DA 4DF7A 4HMIA 3DUZA 4DXGA 1I4PA 5M3FB 5E4XA 4UDUC 5IGEA 2F0GA 3TSSA 3M4YA 3GTGB 3MXGA 3L9AX 3MZ5A 2N55A 3NQIA 4KV6A 1TVXA 2B2YC 3VYUA 4CJ2C 2F0LA 1BQQT 4RKLA 4L6TB 4WFN3 2CQAA 5KYLA 3LNNA 4ODGA 1Y8NB 3DXJC 1SNCA 2TSSA 4QUCA 5COYA 4MIUA 4RWSC 2LKVA 3TP5A 1RTOA 1Z47A 3BVGA 4ZLTF 1C4QA 1YNNC 1I6VC 1EU3A 5C6AA 1EL0A 3CKIB 1U9RA 1CA6A 1DM0B 1D2BA 1Y69U 4DGZA 4C3HB 3H91A 4DXFA 2E74C 3LWUA 1E2VA 1FR3A 3VR3A 5I2YA 1PZJD 4FVMA 1X3PA 2BE5D 4RHRA 2TMPA 5EPLA 1ET6A 1KNAA 1SYCA 1XXGA 1AW7A 4RFBA 2ZXOA 4DNRB 4E6IA 3S2DB 1GJXA 1G91A 1AZPA 1EYDA 4IUTA 2QCPX 3VYSA 1TS4A 2CHBD 5E4WC 4K5XA 3I72A 2EOTA 1O7YA 3A56A 4Q5VA 1QNKA 1BDOA 3RZOB 1V1PB 1PTOD 2JSOA 1HTPA 5ELBA 1HUMA 3SDZA 3BDCA 1W6KA 1BCPD 4J6HA 1JOOA 1H9SA 3BYTB 5K5PA 1JWMD 1F2LA 4LK1C 4DK0A 5CBAE 5D3IB 1B4OA 1LTBD 2VNUD 4DAVA 4FF4A 1TS2A 3MFGA 3FKIB 2JYOA 5C4JB 1PTOF 2IX0A 1PXUA 1BCPF 1TS3A 2F0OA 2KCCA 3C1FA 1U4RA 2A69D 3I4NB 1JB3A 2A6EC 2LY7A 3Q22A 3JAML 1EY0A 1EOTA 4LMQD 1RTNA 4Y7NB 4BWGB 5C5LA 1U4MA 3S15B 1PLFA 1SMYD 1YNJD 4F8MA 1F2MA 2L12A 2G9DA 3HP3A 5EKLA 3VYRA 2E2DC 2FFKB 3FPUB 2E2JB 1E2WA 1QWYA 3MHBA 4ID6A 4J8QA 2JXMB 1U4LA 3H94A 4RH6A 2XIWA 1LT5D 1B53A 1O7ZA 2IJ0A 2BA1A 5DEHA 1PRTD 4IFDI 1OXSC 5ISRA 4KKSA 5C4HA 5AFWA 2IWHA 2EXZA 3GTPB 3KUPA 4HR7B 3GTLB 2KCNA 4O1NA 5CV7A 2F0JA 2M9VA 3A7LA 3IAYA 1CZWA 5CORA 3C3LA 3KLRA 2SNMA 2PMZB 2EJFC 1ICWA 3K57A 4C3IB 4FP5D 1TR5A 4EQOA 1XYIA 1EU4A 2Q8IB 3AU7A 2C5CA 2BOSA 4F7XA 3CRLC 1EYCA 1BO0A 1PRTF 2BDNA 4XT3B 4BS9A 3OW7A 1VF7A 1GUNA 3DWPA 5EPKA 1DD2A 1SXTA 1K8MA 4TKOB 1TU2B 2O5JC 3PUXA 1UAPA 4C3JB 3H6MA 4ZRZA 4NKLA 5A35A 3A8IE 2BA0A 1U4PA 1SYGA 2F3WA 5J22A 1SNOA 5M5WB 2QILA 1Q8IA 1HFNA 4FF1A 2AQ3B 3T51B 1TY2A 4PV1C 3R8BA 5ELEA 3V2TA 1WTRA 3QOJA 3NP8A 4NDXA 3J80L 2PZWA 4N9PA 3EA6A 1SJED 2KUMA 4PMCA 1BCPB 2F0WA 3OHXC 4R9WA 5F2DA 3H3VC 1D1IA 2OXPA 5JPNC 1D6EC 3K6OA 2EY2A 2D62A 1AEXA 2RSNA 2SEBD 4DK1A 4KHZA 5EGTA 3HGBA 5IT9E 3EFXD 2XWJB 1DJRD 2K1BA 2EYPA 3WDNA 3TMEA 1FNWA 1I50B 5LL6X 3D3RA 1E2ZA 1HCZA 5C3EB 2EY5A 3VYTA 1TWFB 2Z8LA 2B8FA 1VF5C 1LT3D 3PO2B 3MEHA 2B2VC 4IN3A 1EIGA 2PQEA 4XYOA 2JEBI 3S16B 3EVQA 2X6LA 2EPBA 4IFDG 4ME5A 1A2TA 4G7HC 4BA2I 5IOCA 2XRSD 4BBSB 4TSSA 3DMUA 2BE5C 5JEAJ 1NCVA 3OMGA 4XT1B 5JPMC 2XN9C 2F0PA 5BN5A 2L1BA 2VB3X 4KY6A 3NWSA 2RVLA 2JA5B 1MI2A 3SE0A 5EJWA 2KOLA 4IUNA 1V43A 1WTVA 1C8CA 1AN8A 5K36G 2PCFB 1RODA 1GHKA 2AQ2B 2PZTA 5DM73 1A3TA 5FLXL 2DY8A 1EIHA 1B9MA 1EYAA 3Q6SA 2HCCA 1WD0A 1PRTB 2NN6I 5C0XJ 2F0MA 1KLUD 1PTOC 1CFMA 2E75C 1MSHA 1DXMA 5J1ZA 4RCOA 1BCPC 1PFBA 2B2TA 3T56B 2CW0D 3Q0AA 2EJMA 3VR2A 4RGOS 4NMZA 4OL7A 2F03A 4OO1I 1CTMA 3NHHA 3NPPA 1DCZA 4RGNA 1EY5A 2F0FA 4RHSA 1SE4A 3V96A 1CHPD 2X6GA 3TDQA 1HA6A 3PIO3 1OXXK 3A7AB 1JOQA 2F0EA 3R2IA 2DNEA 1EWCA 1B9NA 2KQ3A 2A69C 1XX8A 1NR4A 2K04A 2ZT9C 2NVQB 4OIJA 1QJOA 3N6RA 1HHVA 2WIIB 3U9SA 1EFID 4A3FB 3BVMA 3FEWX 5JOBA 1OXTA 2NUCA 2NBFA 1IKLA 2O2LD 3S1MB 4AYBB 1OXUA 5I6YA 4QF4A 3TBIB 4KN7C 1PTOH 4QB4A 1T5EA 1A3UA 4IUQA 5CV8A 1D5MC 4CKCA 4DN4M 5M5YB 1STGA 1SFOB 1X3QA 1HTLD 3SR1A 1TT2A 4HAEA 2L5TA 4X3SA 3S17B 5FO8B 3IKJA 1ML0D 1VMPA 5T1GA 4B9XA 3I8ZA 3P7JA 2O5IC 1RCVD 3W2DA 2L0CA 2B2UA 1TKWB 2NVXB 1PMRA 1ET9A 2RA4A 3P75A 1MGSA 1QE6A 4CKBA 1AFPA 2V4DA 3ONAB 5CV6A 1CQFA 3A8KE 2EYJA 2Z4IA 4KD4A 3C1EA 2NN6G 3Q23A 4IFDJ 3GP7A 3J7YW 3MXNA 1LTID 2NZ1D 3KLSA 5KNCA 1SNPA 2H1EA 3GO5A 1HUNA 2K6AA 3I70A 4M8AA 3MC0B 5I9PA 2SOBA 3TZUA 1F9QA 4RKBA 4OO1G 2X69A 3HOUB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PUX A;  1EWH A;  3QG1 A;  1CI3 M;  2YYZ A;  4RCN A;  3VA7 A;  2E74 C;  3LWU A;  2DNC A;  1E2V A;  3PV0 A;  1OXU A;  5A35 A;  3A8I E;  5BN5 A;  1FR3 A;  2BA0 A;  4KN4 C;  3D31 A;  1GUT A;  3VR3 A;  2LMC B;  2JEA I;  3MXU A;  4KN7 C;  1HQM C;  1T5E A;  4XTC S;  2BE5 D;  1ZYR C;  2A6E D;  4I7Z C;  1IYU A;  3SE0 A;  1Z6H A;  1GHJ A;  2EDG A;  2D5D A;  1V43 A;  3GQB A;  2QF7 A;  1Q12 A;  3T51 B;  3GD7 A;  4PV1 C;  5K36 G;  2PCF B;  2AUK A;  1GHK A;  4DNR B;  3ND8 A;  1GJX A;  1GUO A;  2AWO A;  3T53 B;  3I73 A;  5BN4 A;  1K8O A;  2L5T A;  4GZY C;  4KI0 A;  3IFT A;  1H9M A;  2PPB C;  2F1M A;  3M85 A;  1Q1E A;  4H0L C;  5K36 H;  2A68 C;  1B9M A;  2K33 A;  3PUV A;  4LJZ C;  4KKU A;  1H9K A;  3IKJ A;  4BA1 I;  1E2W A;  2NN6 I;  1TU2 B;  2CW0 C;  3I72 A;  4IQZ A;  2O5I C;  1HPC A;  1CFM A;  2JXM B;  1IW7 C;  3ND9 A;  4XIG S;  3P20 A;  2E75 C;  2D62 A;  1O7L A;  1TKW B;  1PMR A;  4DNT B;  2A68 D;  3VR6 A;  1DXM A;  3CRK C;  1LAC A;  4G7Z C;  3H94 A;  5JEA G;  4DK1 A;  4KHZ A;  3AB9 A;  1BDO A;  1OXV A;  4G7O C;  3HGB A;  3NE5 B;  3T56 B;  3M4Y A;  2V4D A;  3W3A A;  3A8J E;  2K7V A;  4H44 C;  3L7Z C;  2EJM A;  3VR2 A;  1IW7 D;  1H9S B;  1HTP A;  2BA1 A;  3WDN A;  2K32 A;  2A6H C;  5KNB A;  5JEA H;  3PUY A;  2KA7 A;  3A8K E;  3SDZ A;  3VR5 A;  1E2Z A;  1HCZ A;  1OXS C;  1CTM A;  2NN6 G;  4OGQ C;  4TQU S;  3M7N A;  4KKS A;  1GUG A;  2EJG C;  3BG3 A;  1GUS A;  4KKT A;  1DCZ A;  1H9R A;  1H9S A;  3FMC A;  4JK1 C;  1VCI A;  2B8F A;  5KND A;  1VF5 C;  2JE6 I;  1Y8O B;  4KMU C;  4HR7 B;  1A6X A;  2A6H D;  3EQL C;  4LK1 C;  3QJY A;  4DK0 A;  1IYV A;  2BDO A;  1VDZ A;  3PUW A;  5KNC A;  1OXX K;  1V8Q A;  2R6G A;  1LAB A;  3A7A B;  3LNN A;  1Q1B A;  1Y8N B;  3DXJ C;  2JEB I;  3BDO A;  3A7L A;  3FPP A;  3VR4 A;  3KLR A;  2DNE A;  1ONL A;  1Y8P B;  2E76 C;  2DN8 A;  1Z7T A;  1SMY C;  1B9N A;  1YNJ C;  2D2C C;  2A69 C;  2IT1 A;  3QIA A;  2EJF C;  3TZU A;  5C0X G;  3PUZ A;  2ZT9 C;  1O78 A;  4IFD G;  4OO1 G;  1YNN C;  2EVB A;  1I6V C;  3OOC A;  1QJO A;  4H13 C;  3N6R A;  2Q8I B;  1FYC A;  4G7H C;  3I4L A;  3U9S A;  2O5J C;  4BA2 I;  1H9J A;  2B8G A;  1Q90 A;  3CRL C;  3D4R A;  3MFY A;  5C0X H;  4IFD H;  3OW7 A;  1VF7 A;  1GUN A;  4OO1 H;  1DD2 A;  2KCC A;  2NN6 H;  1G29 1;  3OPO A;  1Y69 U;  2PNR C;  2A69 D;  1OXT A;  1K8M A;  4L8J A;  2BE5 C;  2A6E C;  4TKO B;  3RLF A;  5BN3 A;  2AUJ D;  4JBW A;  1ZKO A; 
#chains in the Genus database with same CATH topology
 1BR9 A;  1GM5 A;  1SNM A;  1A8V A;  1SE8 A;  2VUM B;  1CM9 A;  1FD7 D;  1GUT A;  4OX9 Q;  3J81 L;  4ZAI A;  4K14 A;  2V1C C;  4A3D G;  1HZC A;  2ZXP A;  1QZH A;  2PO4 A;  1VQ8 A;  4JI2 Q;  4JYA Q;  5GQO A;  1J5E L;  1UE7 A;  1MHW C;  2SDF A;  3UDG A;  1H95 A;  2A73 B;  2QF7 A;  4A3E H;  2UU9 Q;  2A74 C;  3AQQ A;  4O0A A;  4FF3 A;  1S5F D;  4X66 L;  2QDL A;  4KHV A;  3Q8D A;  2IY5 B;  2NYZ D;  3MWY W;  1D1K A;  2NZO A;  5ELF A;  3I73 A;  3SGI A;  4AH6 A;  3IFT A;  2OTJ A;  1X32 A;  1S5C D;  4CJ1 B;  1V1P A;  2IW3 A;  3WOE A;  2DUD A;  1SJH D;  4LF8 L;  4FXK C;  1WVL A;  5JJI A;  1UUP A;  2K5D A;  2MGS A;  3NEM A;  1WD1 A;  1RD9 D;  3PO3 B;  1GO3 E;  3HOY G;  3VR6 A;  2XVS A;  4KLK A;  1LAC A;  4A93 G;  3GTJ H;  3MEF A;  1JR0 D;  2KEN A;  3B6Y A;  1X3E A;  1YEZ A;  2WAQ E;  1E7Z A;  3W5O A;  3G6E A;  3P1H A;  2AKW B;  4N9T A;  4LWC A;  4DAY A;  5C0X I;  5JAV A;  1RDP D;  5M3M B;  2WAC A;  3BG3 A;  1AP0 A;  1W6J A;  4A3C G;  5JVG 3;  2G9H D;  3M3Y B;  3DWQ A;  5KND A;  2NVQ H;  3I90 A;  1B1Z A;  4PZ6 A;  5M5X H;  5I6W A;  5CC4 A;  1SBB B;  3KJO A;  3KBX A;  4A3J B;  4A3F H;  3KLW A;  2HIV A;  1X55 A;  4IAL A;  1NMG A;  1IXR A;  2DN8 A;  1C7Y A;  1WYD A;  2PYK A;  1FNV A;  2I5H A;  2YV5 A;  1P8L A;  2EVB A;  1TWH H;  1JJC B;  4Q0F A;  1CHQ D;  1Q90 A;  2UXD L;  1KC8 C;  1SMX A;  5C44 H;  3EBE A;  1O7I A;  4CDD C;  4DV3 L;  3ITP A;  1Y14 B;  1IBK Q;  1TWG B;  3QG1 A;  5D65 A;  4HN7 A;  4J15 A;  3M7G A;  3PV0 A;  4M1U B;  2ZJP A;  4JVZ A;  4KN4 C;  3D31 A;  4R1J A;  2CVR A;  1EIF A;  2JA8 B;  4X64 L;  2RBM A;  3G7L A;  1D5X C;  2B2W C;  2DY7 A;  3S17 H;  3NSW A;  4I7Z C;  1JE5 A;  1I6H H;  1LM0 A;  3M4O B;  3S1N H;  2EDG A;  2OTL A;  1ZXT A;  2C35 B;  1PH5 A;  2K50 A;  4DR3 Q;  1HRJ A;  5EBC A;  4IZ8 A;  4S3S A;  1Q82 C;  4L63 B;  4Y52 H;  4LFA L;  5ELN A;  2RDF A;  1NR2 A;  2CWA A;  1LO5 D;  2EYH A;  2RDG A;  4RGT A;  1ZYR D;  2NVX H;  4A3G G;  1NTG A;  3CME A;  3H0G G;  1KTK A;  4O2D A;  4GKK L;  3M85 A;  2I5L X;  5IE8 A;  3PUV A;  4P2C B;  1L1O B;  3TP8 A;  3KYH C;  5DAU A;  1WCM H;  1STB A;  3S1R H;  2F0U A;  2CW0 C;  3LGJ A;  4DV1 L;  1TQO A;  2EIF A;  1HPC A;  1Y1W B;  3S2H B;  4DNT B;  5IGD A;  2NWG A;  3HOW H;  3FP9 A;  4JCV E;  4K2L A;  5JEA G;  5DM6 3;  1X3G A;  4KY5 A;  3NE5 B;  4MN3 A;  1JQY D;  4LFB Q;  4RAU C;  3PIO A;  1H9S B;  1Y1V H;  5IP7 H;  4AQY Q;  2VB2 X;  5LMU Q;  1J6Q A;  4OGQ C;  1JMC A;  1GKH A;  2AMC B;  1II3 A;  2ZTE A;  3F8T A;  4BY1 B;  4C1N K;  2IHE A;  1ESR A;  2OF1 A;  3CPF A;  4DR1 L;  3J81 c;  3CC2 A;  4BY7 G;  1K83 H;  2XWB B;  2N3S A;  3EIV A;  1LTG D;  1SND A;  2Q8T A;  3QJY A;  2UUB L;  2BDO A;  1VDZ A;  1X6O A;  3PUW A;  3KK7 A;  3K5O A;  4B3M Q;  4AIM A;  2ASB A;  4C56 C;  4NW2 A;  1GOZ A;  1F77 A;  2VXW A;  3T1Y Q;  1Y8P B;  3GTM H;  2WKC A;  2A1A A;  1PFS A;  5M3F G;  5C0X G;  2F4V Q;  4O42 A;  1TWA H;  2F0V A;  1VQF A;  1LTS D;  5C4Z A;  1H9J A;  1MKH A;  5H1S E;  2QA4 A;  3IL8 A;  2RQX A;  1IL8 A;  2KJX A;  4A3I H;  3OPO A;  1NBW A;  2PNR C;  3JAM E;  5FK9 C;  1RKN A;  2EYL A;  2BH8 A;  5BN3 A;  1Q46 A;  4JBW A;  1CI3 M;  2EYO A;  5LHY 1;  4A3K B;  4JOI A;  2ALY B;  3L0O A;  1PVO A;  1JE4 A;  1ENF A;  3CCQ A;  1IYJ B;  1N32 Q;  3CD6 A;  3CP0 A;  2FMM A;  1RF2 D;  4JI4 Q;  3GV3 A;  1STY A;  4GN5 A;  1AZQ A;  1NUC A;  1SNQ A;  4OXP A;  3G6J B;  2RKS A;  4OIK A;  4CDE C;  2AUK A;  3HOX B;  1VQA A;  1EY4 A;  4DV2 L;  1QG7 A;  4JI0 Q;  5E7N A;  4NB3 A;  4DR6 Q;  2PPB C;  3QB3 A;  4LJZ C;  3X3M A;  4BA1 I;  4ILW A;  1E1O A;  3S9W A;  1XNR Q;  5IGB A;  3CU7 A;  2H5X A;  1J9O A;  4A3B B;  4MHE A;  3OWE B;  4L5S A;  1DYQ A;  3DLL A;  3BS1 A;  5KIX A;  4C3H G;  1X54 A;  1PYS B;  4K8I A;  1PTO B;  4MTK A;  1IW7 D;  3T1H L;  2RHS B;  4K2K A;  2OCE A;  5IGF A;  3M7N A;  2LFN A;  4RG1 A;  1B7Y B;  2HQE A;  3FMC A;  5IGG A;  3ULJ A;  5KGU A;  3R3O A;  1ASY A;  3CCM A;  1Y8O B;  1QVC A;  3EJI A;  1PV4 A;  3OMC A;  5CGK A;  1KAA A;  4FNF A;  1IBL Q;  4PZ7 A;  4DNI A;  3I4M H;  1LAB A;  3GTQ B;  3RZD H;  2BH2 A;  4DUZ Q;  1YIJ A;  3VR4 A;  2FXQ A;  3A74 A;  1CA5 A;  1HZA A;  4I7A A;  5HGT A;  5L37 A;  4EVO A;  1ICF B;  3AFP A;  2DGY A;  3HKZ E;  4LFB L;  2JA8 H;  4IFD H;  1WOC A;  3E6Z X;  1WTW A;  2AQ1 B;  4JI8 Q;  1CQV A;  4GNX A;  2Z0S A;  4B9W A;  3RMH A;  4GOP A;  2AUJ D;  1G6P A;  3UI2 A;  2K03 A;  5IYD H;  5E1F A;  4H02 A;  1X9N A;  1MD2 D;  2UXB Q;  3KF6 A;  1O80 A;  3GTK H;  3UE0 A;  2F0T A;  3Q24 A;  2PW7 A;  3KDF B;  1NNX A;  4B3M L;  4L5R C;  1KAW A;  3PMF A;  3PF4 A;  2EY1 A;  2EZV A;  3HOV H;  2Z6B A;  1QUQ B;  3T1Y L;  2I07 B;  3GD7 A;  1A15 A;  2D0O A;  3C46 A;  3J80 E;  1WTO A;  2QGQ A;  1JOK A;  2ATW A;  3J7Z C;  2R92 B;  3E0J A;  4KY7 A;  4JI6 Q;  3FKI G;  4CGY B;  5K36 H;  2F1M A;  1Q1E A;  2JA6 B;  4DR7 L;  4KKU A;  1H9K A;  1D8L A;  4ALP A;  1EZ6 A;  2HHH L;  1STE A;  3HKZ B;  3GDE A;  4HCE A;  4QCL A;  1PFM A;  3CCR A;  1N33 Q;  2MFI A;  2KEE A;  1BF4 A;  4XQQ A;  4X6A H;  2Y0S E;  3ERQ A;  1LV9 A;  1E3P A;  1LT4 D;  3D6C A;  5A2Q E;  4R8N A;  1G51 A;  1YZ6 A;  3IFD A;  1IHZ A;  2KVM A;  2NB0 A;  4G7O C;  1N32 L;  4J1M A;  4CHT B;  4KJN A;  2AWN A;  4JI4 L;  4H44 C;  2CH4 W;  3R2T A;  4ZK9 B;  3PUY A;  4IUU A;  2Q2I A;  4BBR H;  3HEJ A;  4A3E B;  2HCI A;  3OYY A;  4JI0 L;  4LF4 L;  3NUC A;  4DR6 L;  2EXD A;  1EY6 A;  4IJH A;  3CQZ H;  4JI7 L;  3URY A;  2O4X A;  4JI3 Q;  3ERO A;  4P75 A;  2SNS A;  3HOY B;  4A3L H;  1HR0 W;  1VQC A;  4P71 A;  4JV5 L;  3OW2 A;  1XNR L;  1SYB A;  5FLM H;  1HNZ Q;  1B8A A;  1Q1B A;  3A54 A;  3FPP A;  2K4K A;  1B2T A;  2WP8 J;  5CMD A;  4PNY A;  4JC0 A;  3RUZ A;  3QIA A;  1K0R A;  3KJP A;  4XQN A;  4A3K H;  3SK6 A;  3KF8 B;  3DWA A;  1HR0 L;  2WKD A;  3OIP A;  2Y0S B;  1X65 A;  2QKI C;  5AJ3 Q;  4ZUJ A;  3D4R A;  4LF7 Q;  3GTJ B;  2XSC A;  1Q3L A;  2E2I H;  4B3T L;  1T5X D;  1KHI A;  3ULL A;  3MXP A;  2EE1 A;  1A2U A;  3RLF A;  2F0D A;  3BZD B;  3K7U C;  1PH6 A;  3GTO H;  4GLX A;  4GKJ Q;  3NXW A;  2G5D A;  3MA2 B;  4U68 A;  2LS0 1;  2JEA I;  4LF9 Q;  1GD7 A;  5C4X H;  3I2Z A;  1VQG A;  1HZB A;  4QIW E;  1XJV A;  1XNQ Q;  1ZYR C;  1QIL A;  5M5X B;  2MO0 A;  4K5W A;  1Z6H A;  1SAP A;  2D5D A;  3BZK A;  2RF4 A;  2N49 A;  4HJA A;  2JN4 A;  2CH4 A;  1STA A;  4TRD A;  1EFW A;  5FLX E;  1PH2 A;  3SK8 A;  4OWT B;  4DV0 L;  1EEI D;  2AWO A;  4LUV A;  1XTC D;  1LTR D;  2B63 H;  1H9M A;  4H7B A;  3SK5 A;  1KDC A;  4H0L C;  1EEF D;  4C3I G;  1TWH B;  3TP7 A;  4JI8 L;  2MO1 A;  5LMN W;  1SRO A;  3OTO Q;  3HOZ H;  4JPB W;  1TXY A;  2J0T D;  5C44 B;  1JIC A;  4K0K L;  5D14 A;  2B3G A;  3P20 A;  4WJ3 M;  1G6Z A;  1O7L A;  1IL2 A;  1LUZ A;  4G7Z C;  3AB9 A;  3QO2 A;  1CK1 A;  1KNE A;  5LMN L;  5KRU A;  4C3J G;  2K01 A;  4HIO A;  1I4G A;  2QEX A;  1TS5 A;  3KBG A;  1I6H B;  4QIW B;  3S1N B;  1QB5 D;  2UUC Q;  1I4X A;  2F0S A;  1H9R A;  4JK1 C;  4A3M H;  4IPG A;  1DZ1 A;  3G4S A;  5FO9 B;  5I9O A;  4GNX C;  2ICI A;  2R6G A;  5C5M A;  1ZEQ X;  3BDO A;  1M8A A;  3HS0 C;  1WCM B;  3CCU A;  3S1R B;  1KLG D;  1D7Q A;  1V9P A;  3CPW A;  1TWC H;  4H13 C;  4DFA A;  5EBD A;  3HOW B;  4IUV A;  4OO1 H;  2NVY H;  4NXM Q;  2P5Z X;  2L55 A;  4PMB A;  1CSQ A;  4U67 3;  1J8I A;  1TY0 A;  1LLR D;  1E0B A;  1BOS A;  2HD3 A;  4K6D A;  2I46 A;  1Y1V B;  1DOL A;  1LTA D;  4RCN A;  1ILQ A;  1HXY D;  4NXN Q;  3U50 C;  1EY7 A;  1PFN A;  3F2U A;  5C3E G;  4R4O A;  4LUO A;  4V19 0;  3T16 A;  2FHT A;  1YJN A;  1F2Z A;  4HTH A;  5CYU A;  1K83 B;  2F4I A;  4P74 A;  3PO2 G;  4DPG A;  3RLN A;  3M4P A;  4A3D H;  3O13 A;  1JOR A;  1I4Q A;  4YIJ A;  2LXK A;  2NVT H;  3I4O A;  1CKN B;  1VQO A;  3GTM B;  3K7A H;  1GUO A;  5ELC A;  1K8O A;  3BDL A;  1EQT A;  4DU9 A;  2UXC Q;  1XMQ L;  5AJ3 L;  4JBK A;  5JJL A;  1TWA B;  5DNF A;  1YHA A;  3K5L A;  1ENC A;  1T9H A;  2XNA C;  1RHP A;  1V1O A;  2J7Z A;  3ZYY X;  3DM3 A;  4A3I B;  1FJG L;  2Q8R E;  1IW7 C;  3DM1 A;  1LTT D;  4TVA B;  1X56 A;  3QOL A;  3D8G A;  5BR8 L;  2OQ0 A;  2IPK D;  2A68 D;  3J7A F;  3CXC A;  1VQK A;  1XNQ L;  1EY8 A;  1NMF A;  3W3A A;  1VQP A;  2B2T C;  3HOY H;  1STH A;  4A93 H;  1EQV A;  2K32 A;  3MXN B;  2EYF A;  2KA7 A;  3CMA A;  3RN2 A;  3S1Q H;  1F9P A;  3K0Y A;  3D0F A;  4C2M H;  4KMU C;  1A6X A;  1DOK A;  2Z1C A;  2A6H D;  3EQL C;  4LF6 Q;  1K3B C;  1N9W A;  4K5V A;  5HUR A;  4A3C H;  1S5E D;  2K5V A;  1B3A A;  2R7F A;  1K73 C;  1S4Z A;  3OWF A;  1UE1 A;  4KK7 A;  3NWT A;  4JI5 Q;  1V1Q A;  1GXD C;  4HED A;  3PUZ A;  1ENA A;  2ZTD A;  4ZKB B;  2VZA A;  1QVG A;  3RN5 A;  2D9U A;  4L5Q A;  4F88 A;  3PIP 3;  1EY9 A;  4L8J A;  2F0K A;  3PSI A;  1CSP A;  2JA7 B;  3VA7 A;  4CBV A;  3J81 E;  3CCS A;  1XMO Q;  2UUA L;  1NY4 A;  3NBH A;  3D4W A;  5IWA L;  3SEB A;  1L1O A;  1S72 A;  2K52 A;  2MQH A;  3ERS X;  4DR4 Q;  3I4M B;  4Z9C B;  3IRB A;  3RZD B;  5JJK A;  5J39 A;  2YU9 B;  2WAQ B;  3ND8 A;  3FVQ A;  3STB D;  1PDQ A;  4KI0 A;  2HT1 A;  2EYM A;  5FO7 B;  2K33 A;  3NEN A;  4YWM A;  4DV4 L;  1SLJ A;  2EY6 A;  4RA8 A;  3VA5 A;  4KTA A;  5CBE E;  1IBM Q;  4NXN L;  4LFC L;  2B2U C;  1F9R A;  3L3O C;  1ASZ A;  1YHB A;  3RD4 A;  3F2D A;  3AYH B;  1Q86 C;  4LUZ A;  3GTK B;  2FIN B;  1HQR D;  1VQI A;  4FO2 A;  5KNB A;  5JEA H;  1OTC A;  4MTN A;  4A76 A;  2GVA A;  4XYQ A;  4G4K A;  3HOV B;  4TQU S;  1I3Q H;  3W1G A;  1EQR A;  1PZK D;  4KKT A;  2L4N A;  1G2S A;  3OSO A;  3V05 A;  4UY8 C;  3T13 A;  1JC7 A;  2B2V A;  1R4P B;  4B08 A;  3BU2 A;  4OX9 L;  3J81 j;  1UE5 A;  4G57 A;  3I3C A;  4JI2 L;  4JYA L;  2VQE Q;  1ONL A;  1WTP A;  3T4A C;  1NSN S;  4B3S Q;  4X62 Q;  2UU9 L;  2IT1 A;  1L0X B;  2F0I A;  3AFQ A;  2E2H B;  3NK9 A;  3TP6 A;  3UDF A;  4B3R Q;  1FYC A;  2PW5 A;  1E24 A;  5M3F H;  3MFY A;  5C0X H;  4K6L A;  1LYL A;  2KED A;  4X3U A;  4CKE A;  4MNO A;  2KEC A;  2WB1 E;  3NQT A;  2NTT A;  4OHJ A;  3J7A V;  1QNU A;  1N34 Q;  1PZI D;  4ABN A;  4WRD A;  4FXD A;  3SHL A;  1M4V A;  5EKI A;  3MTS A;  2DJF C;  1PH3 A;  1RJT A;  4BBR B;  4YY3 Q;  4HCS A;  2R7Z B;  1SEB D;  3E9I A;  3K5N A;  1QZG A;  2PMZ E;  5GRO A;  5CV9 A;  1IYU A;  3CQZ B;  4HJ8 A;  2L11 A;  2R93 B;  1JJG A;  2K5W A;  3N52 A;  1SSO A;  2MPM A;  2GA4 B;  2N88 A;  1VQE A;  4R8I A;  4N8F A;  5CR3 A;  1TII D;  3SVM A;  4CJ0 B;  2VY3 A;  5I4D A;  4DUY Q;  5IIF A;  4ZQ3 A;  1MSG A;  1D5Z C;  1ESF A;  4EGV A;  3HOU G;  1SDF A;  4IOA A;  2E2I B;  2C9O A;  1BUV T;  3ND9 A;  2WB1 B;  4PQX A;  1HNX Q;  4A75 A;  1OO9 B;  1E1T A;  4DAP A;  3GTO B;  4DV6 Q;  1XPR A;  5J3B A;  3D4D A;  3LWE A;  2VUM G;  1WTQ A;  5M9O A;  2B39 A;  1KRT A;  3TN2 A;  3SK4 A;  3UDX A;  5C4X B;  2K05 A;  2M2L A;  3S24 A;  1UEA B;  3HG9 A;  4C3H H;  4DR4 L;  1JWS D;  1S5D D;  2NTS A;  5IT9 L;  4POG A;  5FJ8 G;  4ZUI A;  5IGC A;  1PH4 A;  4XDX A;  5CV5 A;  1HH2 P;  2E8G A;  3I7F A;  3PQI A;  3I91 A;  1GUS A;  3WWV A;  1IBK L;  3TQY A;  1F2Y A;  2A5H A;  4JG2 A;  5IP9 G;  2PI2 A;  3U9O A;  1STN A;  5HGQ A;  2ES2 A;  1IZ6 A;  3CHB D;  4I65 A;  2B63 B;  1JCK B;  1V8Q A;  3H3V I;  2M00 A;  3M9B A;  2CKZ B;  1BBX C;  2K75 A;  3KLS X;  3H09 A;  3FRP B;  1CT1 D;  1Z7T A;  4DR3 L;  3HOZ B;  2D2C C;  4RGM A;  2JA7 H;  5TSS A;  3PCO B;  5GAD C;  1FNU A;  1SE2 A;  2VQF Q;  3M4Q A;  3DHQ A;  1DOM A;  2B8G A;  3PO3 G;  3G71 A;  1SN8 A;  2F0Q A;  1PH8 A;  3CAM A;  4NPS A;  1QUQ A;  1YNN D;  1ILP A;  4HSP A;  1AE2 A;  5DLQ E;  5G3L D;  4XXE A;  2DNC A;  2YU9 H;  1R9T B;  3RZO H;  5E3F A;  5C3X A;  5M3M G;  1NAP A;  2F0H A;  1I4H A;  3MVV A;  3MXU A;  1HQM C;  4A3M B;  1IKM A;  2KHI A;  2K5Q A;  1KDB A;  2FJ2 A;  3FDT A;  5EQ0 A;  3GQB A;  1WTX A;  3TS2 A;  4X62 L;  4A3J G;  4X65 Q;  4AQY L;  3U4Z A;  1S5B D;  4X3T A;  3H15 A;  5LMU L;  2KCT A;  4B3R L;  5A2Q L;  3GV6 A;  5I2X A;  2A68 C;  2R3Z A;  4DA2 A;  1TWC B;  2MJ8 A;  3OIQ A;  4JI1 Q;  2A19 A;  1L0Y B;  5G3L F;  1HFG A;  3FKI H;  4F87 A;  3NTH A;  3BYY B;  4IQZ A;  2NVY B;  1YBY A;  4XIG S;  4HMJ A;  3E5S A;  4YY3 L;  1SR3 A;  3CRK C;  5LL6 S;  1Q8K A;  2F4V L;  2QDB A;  1G8Z D;  3CW2 C;  2K7V A;  1FGB D;  3WOF A;  4DV7 Q;  2A6H C;  2JA8 G;  4QGU A;  3MAQ A;  5JVH 3;  3CCE A;  1DON A;  4POF A;  3K80 C;  4CDC C;  2HDL A;  2EJG C;  2ID0 A;  2Z6K A;  4HSV A;  1C0A A;  4A3D B;  4BXX G;  3K8A A;  1VCI A;  2E2H H;  1C48 A;  1Q7Y C;  3A55 A;  2JE6 I;  2PZU A;  3DEP A;  3QWN A;  3KF8 A;  5IOD A;  4QUF A;  4Y7N H;  2NVT B;  1QCB D;  3K7A B;  3I4N G;  2HIX A;  1I4R A;  3S15 H;  2Z4H A;  1B50 A;  2MUY A;  3JAM i;  4EQ5 A;  5NUC A;  5IYB G;  2HUG A;  1HNX L;  3NTK A;  1UNS A;  1A3V A;  2RDH A;  1EZ8 A;  1SYF A;  2HQL A;  2B2Y A;  4PMW A;  1Q81 C;  4GNX B;  4ULL A;  2RSO A;  2E2J H;  2QEJ C;  2R7Z H;  4C1N I;  1Y1W G;  1N36 Q;  4EQP A;  4WJW A;  1MBY A;  2PNH A;  3HZX A;  2R93 H;  4A93 B;  1VQ5 A;  1EWH A;  3SXH A;  4QMG A;  5C3W A;  1G2T A;  4R4C A;  2WV6 D;  1R4Q B;  4LAA A;  4JOI C;  3LX0 A;  3UDI A;  1VQN A;  3S1Q B;  4V0B A;  1QOH A;  1SRU A;  2ENB A;  1UE6 A;  4BY1 G;  2A6E D;  3C2P A;  4C2M B;  3STB C;  5CV4 A;  1GHJ A;  4OWX B;  5IT9 c;  2R61 A;  1JB7 A;  1F9S A;  2N78 A;  1HNW Q;  5FOB B;  3K5M A;  2F0N A;  3GTP H;  2MP1 A;  3GTL H;  3UE1 A;  1AH9 A;  3T53 B;  2VQF L;  4DR5 Q;  2E5L Q;  1SYD A;  4IUP A;  5KEE A;  3BVZ A;  4KHP Q;  5EPJ A;  4ZKC B;  1A62 A;  4LNQ A;  1BNZ A;  4A3L G;  1IBL L;  3D6W A;  2OEO A;  3DEO A;  1WJJ A;  3TS0 A;  4C3I H;  4DUZ L;  3NBI A;  1CKO A;  2D0P A;  2FMC A;  2H4O A;  2KHS A;  3TZD A;  4FF2 A;  1WFQ A;  1B44 D;  1AE3 A;  3JC6 6;  1XWE A;  3HRZ C;  2WIN B;  1OXV A;  2RHQ B;  1J5E Q;  1KAB A;  4ZYS A;  3A8J E;  1JT8 A;  1K8A C;  3L7Z C;  1KDA A;  1PYW D;  1BBU A;  1VQD A;  4K8J A;  2F3I A;  2JK8 A;  4X3K A;  4XQJ A;  3VR5 A;  5T1I A;  4X65 L;  1HA5 A;  1GUG A;  5ELD A;  1EUJ A;  3G48 A;  4EQN A;  5JJZ A;  1CKM A;  3X3N A;  5M5W H;  2MHV A;  3HOX G;  2UXB L;  1SE3 A;  5IYC G;  1IYV A;  1W2B A;  4JI1 L;  3AMU A;  2JP1 A;  3I55 A;  1KL9 A;  3AEV A;  2PQA B;  4APV A;  1KRS A;  4UAI A;  4IUR A;  4A3G B;  2E76 C;  3H0G B;  1K0S A;  1SMY C;  1YNJ C;  1BBW A;  4HJ5 A;  3S14 B;  1O78 A;  1LT6 D;  2IX3 A;  2ZXR A;  1R9T H;  1VQM A;  4A3B G;  3OOC A;  1VQ7 A;  2OT2 A;  3PGZ A;  3I4L A;  1PYB A;  1BXT A;  1CZG A;  4JI6 L;  1NE3 A;  2KHJ A;  3K58 A;  1L2F A;  4UHV A;  2J4X A;  2NN6 H;  1G29 1;  2CWP A;  2IL8 A;  1VQ9 A;  2HDM A;  4JBM A;  2IX1 A;  4GZY C;  4KD3 A;  2JQO A;  1ZKO A;  3W1B A;  4GOP C;  2YYZ A;  1YIT A;  4KJO A;  3J80 i;  4DK3 C;  2OQK A;  1N33 L;  1VMC A;  2BCO A;  3NTI A;  1I3Q B;  2LMC B;  1JWU D;  1CKN A;  3R93 A;  2B2W A;  1JJ2 A;  4XTC S;  1EQQ A;  1I50 H;  1GUW A;  5C3E H;  1YVC A;  2L9H A;  4WOR A;  1FL0 A;  1Q12 A;  3K59 A;  5FKA C;  1PRT C;  4NP5 A;  2ICE C;  1VQL A;  4OON A;  4BY7 B;  4FXG C;  3PO2 H;  4HJ9 A;  2F3V A;  3BJU A;  1K28 A;  4FYD A;  3F2B A;  5EKK A;  1GVP A;  2K28 A;  5KYI A;  5BN4 A;  2UXD Q;  4DR2 Q;  1SYE A;  2XRQ D;  5D3D A;  4DF7 A;  3S16 H;  4JI3 L;  4HMI A;  3DUZ A;  4DXG A;  1I4P A;  4DV3 Q;  2Q2T A;  5M3F B;  5E4X A;  2VS1 A;  1HJP A;  1HNZ L;  1I94 Q;  2B29 A;  2N8N A;  4UDU C;  4HIK A;  5IGE A;  4X64 Q;  2F0G A;  2Z9H A;  3CC7 A;  3TSS A;  3M4Y A;  4YCU A;  3GTG B;  3MXG A;  3L9A X;  3MZ5 A;  4LF7 L;  3L2P A;  5GAG C;  1VQ6 A;  4LFA Q;  2N55 A;  3CCJ A;  3NQI A;  4KV6 A;  1TVX A;  2B2Y C;  5IY0 A;  3QR8 A;  3VYU A;  4GKK Q;  4DR5 L;  4CJ2 C;  2F0L A;  4BBS G;  4GKJ L;  1BQQ T;  4RKL A;  1KD1 C;  4L6T B;  4WFN 3;  2CQA A;  4LF9 L;  1EOV A;  2R92 G;  5KYL A;  3LNN A;  4ODG A;  1HZ9 A;  4DV1 Q;  1Y8N B;  3DXJ C;  1SNC A;  2JA6 G;  2TSS A;  4QUC A;  3PF5 A;  4RMF A;  3HKZ G;  4MIU A;  5COY A;  3BVG A;  2LKV A;  4RWS C;  1RTO A;  1Z47 A;  3TP5 A;  4ZLT F;  2JA5 G;  4QY7 A;  1C4Q A;  1YNN C;  1I6V C;  1EU3 A;  5C6A A;  1EL0 A;  3CKI B;  1U9R A;  1CA6 A;  4HIM A;  2GN5 A;  1DM0 B;  1D2B A;  1Y69 U;  3J7A 5;  3RR5 A;  4DGZ A;  4MZ9 A;  4C3H B;  3H91 A;  1CUK A;  3ZJY C;  1YJ9 A;  4DXF A;  3OTO L;  4DR1 Q;  2E74 C;  3LWU A;  1E2V A;  1FR3 A;  4R4Q A;  1PA6 A;  3VR3 A;  2UUB Q;  5I2Y A;  1KXL A;  1PZJ D;  4FVM A;  4A3E G;  1X3P A;  2BE5 D;  4R4I A;  4RHR A;  4OWW B;  2TMP A;  2A8V A;  2R7D A;  5EPL A;  1ET6 A;  3U4V A;  4GN3 B;  1KNA A;  1SYC A;  4HJ7 A;  1XXG A;  1AW7 A;  4RFB A;  2ZXO A;  3KOJ A;  2CCZ A;  3E3X A;  4DNR B;  1XPU A;  2UUC L;  4E6I A;  1WTH A;  4QL5 A;  3S2D B;  1GJX A;  1G91 A;  1AZP A;  4DAM A;  1EYD A;  4IUT A;  2QCP X;  3VYS A;  1TS4 A;  2Y0S G;  2CHB D;  5E4W C;  4K5X A;  1QVF A;  3I72 A;  2EOT A;  1O7Y A;  3A56 A;  4Q5V A;  1QNK A;  3HFZ B;  3TEH B;  1BDO A;  3RZO B;  1W3S A;  1V1P B;  5HY6 A;  1PTO D;  5GAH C;  2JSO A;  1HTP A;  5ELB A;  1A63 A;  3K0X A;  1HUM A;  3SDZ A;  3S1M H;  3BDC A;  4NXM L;  1W6K A;  2ZTC A;  4A3G H;  2KBN A;  4N8X 1;  4YHH Q;  1BCP D;  3A5Z B;  3H0G H;  4J6H A;  4DV2 Q;  1JOO A;  4GLA C;  4CDF C;  1H9S A;  4A3F G;  4DR2 L;  3BYT B;  4ZCK A;  3S14 H;  5K5P A;  1JWM D;  2VL6 A;  1F2L A;  4LK1 C;  4DK0 A;  5M5Y H;  5CBA E;  5D3I B;  1B4O A;  1LTB D;  4GLV B;  4DV5 Q;  2VNU D;  4DAY B;  4DAV A;  1SFO H;  4IPD A;  4FF4 A;  1I94 L;  4AYB G;  1TS2 A;  4OEL B;  3MFG A;  4DK6 C;  3FKI B;  2JYO A;  3K81 C;  1K8G A;  2RCN A;  5C4J B;  1PTO F;  5C44 G;  2IX0 A;  5GAE C;  1PXU A;  1VQ4 A;  2UXC L;  3T1H Q;  1B70 B;  1BCP F;  1TS3 A;  2F0O A;  2KCC A;  3C1F A;  3FHW A;  3CC4 A;  1U4R A;  2A69 D;  3I4N B;  1JB3 A;  2A6E C;  2LY7 A;  3Q22 A;  3NBH B;  2EQS A;  3JAM L;  4BY7 H;  1EY0 A;  3KFU A;  1EOT A;  4LMQ D;  1RTN A;  4Y7N B;  4BWG B;  5C5L A;  1U4M A;  2WFW A;  3S15 B;  1PLF A;  1NJI C;  2ZM6 Q;  1SMY D;  1YNJ D;  4F8M A;  1F2M A;  2L12 A;  1WCM G;  2G9D A;  3HP3 A;  5EKL A;  3VYR A;  2E2D C;  2FFK B;  3FPU B;  3TRE A;  2E2J B;  1E2W A;  1QWY A;  3MHB A;  4ID6 A;  4LF6 L;  3GTG H;  1S40 A;  3E0E A;  4P73 A;  3HOW G;  4J8Q A;  2MNA A;  2JXM B;  4IJL A;  2CQO A;  4JI5 L;  3HOU H;  1U4L A;  3H94 A;  4RH6 A;  1YNX A;  2XIW A;  1Y1V G;  4JBJ A;  5IP7 G;  3A5U A;  1LT5 D;  1B53 A;  1I5F A;  1O7Z A;  1VQB A;  2GVB A;  2IJ0 A;  1U5K A;  4UP8 A;  2BA1 A;  3NEL A;  1FVI A;  5DEH A;  2VUM H;  1PRT D;  4IFD I;  1B3Q A;  1OXS C;  2XGT A;  5ISR A;  4KKS A;  5C4H A;  5AFW A;  2IWH A;  2EXZ A;  5FJ8 H;  4DR7 Q;  3GTP B;  3KUP A;  1S3O A;  4HR7 B;  3GTL B;  1XMO L;  2HHH Q;  2KCN A;  2YTV A;  4LW1 A;  4L5T A;  4IPH A;  4O1N A;  5CV7 A;  2F0J A;  5IP9 H;  1U0L A;  2M9V A;  3A7L A;  3IAY A;  1CZW A;  5COR A;  3C3L A;  3KLR A;  2SNM A;  2PMZ B;  4IOC A;  3J81 i;  2EJF C;  1ICW A;  3K57 A;  4C3I B;  4FP5 D;  1TR5 A;  4EQO A;  4A3I G;  1XYI A;  1EIY B;  1EU4 A;  2Q8I B;  3AU7 A;  2C5C A;  2BOS A;  4F7X A;  3A0J A;  1RL2 A;  3CRL C;  4R4T A;  1EYC A;  1BO0 A;  1PRT F;  2BDN A;  4XT3 B;  4BS9 A;  3CCV A;  3OW7 A;  1VF7 A;  1GUN A;  3DWP A;  5EPK A;  1DD2 A;  1SXT A;  1K8M A;  2YTX A;  4TKO B;  3PO3 H;  4YHH L;  1TU2 B;  2O5J C;  3PUX A;  4LF4 Q;  1UAP A;  1L0W A;  3H6M A;  1P16 A;  4ZRZ A;  4C3J B;  4NKL A;  5A35 A;  3A8I E;  4JI7 Q;  1IBM L;  2BA0 A;  3S2D H;  4JV5 Q;  1U4P A;  1SYG A;  2F3W A;  1LTL A;  4DV5 L;  2PI2 E;  5J22 A;  1SNO A;  5M5W B;  2QIL A;  5M3M H;  1Q8I A;  1HFN A;  1L1O C;  4FF1 A;  1DGS A;  2AQ3 B;  3T51 B;  1TY2 A;  4PV1 C;  3KDF A;  3M3Y H;  3E9H A;  3R8B A;  1HR0 Q;  5ELE A;  3V2T A;  1WTR A;  1K9M C;  3QOJ A;  2K5N A;  4PZ8 A;  2LSS A;  3NP8 A;  4NDX A;  3J80 L;  4A3J H;  4B3T Q;  1BKB A;  4GN4 B;  2PZW A;  4N9P A;  1C9O A;  3EA6 A;  1SJE D;  2KUM A;  2KCM A;  4PMC A;  1BCP B;  2F0W A;  3OHX C;  4R9W A;  5F2D A;  1A0I A;  3H3V C;  1D1I A;  2OXP A;  5JPN C;  1D6E C;  2XTI A;  3K6O A;  2EY2 A;  2D62 A;  2RCF A;  2VQE L;  4YWL A;  1AEX A;  4B3S L;  2RSN A;  4PG3 A;  2SEB D;  4DK1 A;  3RNU A;  4KHZ A;  5EGT A;  4FDB A;  1MIU A;  2JA7 G;  3HGB A;  1XPO A;  5IT9 E;  3EFX D;  1WI5 A;  2XWJ B;  1DJR D;  2K1B A;  2EYP A;  3WDN A;  3TME A;  1YHQ A;  1FNW A;  1TWG H;  1I50 B;  5LL6 X;  3D3R A;  1E2Z A;  2ZM6 L;  1HCZ A;  5C3E B;  3JAM c;  2EY5 A;  4LF5 Q;  3VYT A;  1TWF B;  1N34 L;  4DV0 Q;  2Z8L A;  2I0Q A;  1N8R C;  2B8F A;  3I4M G;  1X3F A;  4ME3 A;  1VF5 C;  5C4J H;  1LT3 D;  3CF5 A;  3PO2 B;  3MEH A;  2B2V C;  4IN3 A;  1EIG A;  3M4O H;  2WAQ G;  2PQE A;  4XYO A;  3HKS A;  4BXX H;  4K0K Q;  2JEB I;  4UPA A;  3S16 B;  2JJQ A;  3EVQ A;  3I4N H;  2X6L A;  1M1K C;  1FGU A;  2EPB A;  4IFD G;  5LMN Q;  4ME5 A;  4EX5 A;  5IYB H;  1A2T A;  1PH1 A;  4G7H C;  2DJG C;  4BA2 I;  5IOC A;  2XRS D;  1VQH A;  4BBS B;  4DUY L;  5IYD G;  4TSS A;  1MJE A;  3TRZ A;  3DMU A;  2BE5 C;  1Y1W H;  3S2H H;  5JEA J;  1NCV A;  3OMG A;  2OWO A;  4WJ4 A;  3EN2 A;  4XT1 B;  5JPM C;  2XN9 C;  2F0P A;  5BN5 A;  2L1B A;  3PIP A;  2VB3 X;  3HOV G;  4KY6 A;  3NWS A;  3H3V H;  2RVL A;  4DV6 L;  2JA5 B;  1MI2 A;  4UP9 A;  5EAY A;  4JW0 A;  3SE0 A;  2F52 A;  5EJW A;  4GOP B;  2KOL A;  4IUN A;  1V43 A;  4DKA C;  1WTV A;  1MJC A;  1C8C A;  1AN8 A;  4BY1 H;  3F1Z A;  5K36 G;  2PCF B;  1ROD A;  2L15 A;  1GHK A;  2AQ2 B;  2PZT A;  3KF6 B;  4GS3 A;  5DM7 3;  1Z9F A;  1XTD A;  1A3T A;  5FLX L;  2DY8 A;  1EIH A;  4YCV A;  1B9M A;  1EYA A;  3Q6S A;  2HCC A;  1WD0 A;  1PRT B;  4IPC A;  2NN6 I;  5C0X J;  1K3R A;  2F0M A;  1KLU D;  1PTO C;  1CFM A;  2I5M X;  2E75 C;  1MSH A;  1DXM A;  1EWI A;  5J1Z A;  4RCO A;  1BCP C;  3VDY A;  1PFB A;  2B2T A;  3T56 B;  4BBR G;  2R7Z G;  2CW0 D;  3Q0A A;  2EJM A;  3VR2 A;  4RGO S;  4QQB X;  4NMZ A;  4OL7 A;  2F03 A;  4AYB E;  4OO1 I;  2PQA A;  4OEM B;  1CTM A;  2ZJQ A;  2AHO B;  2R93 G;  1UEB A;  3NHH A;  3NPP A;  1DCZ A;  1XMQ Q;  4RGN A;  5FLM G;  1EY5 A;  2F0F A;  4RHS A;  3ULP A;  1SE4 A;  3U58 A;  3V96 A;  4UP7 A;  1CHP D;  4HID A;  2X6G A;  3TDQ A;  1HA6 A;  3PIO 3;  1OXX K;  3A7A B;  1JOQ A;  1FJG Q;  4A3K G;  2F0E A;  2Q2H A;  3R2I A;  5BR8 Q;  3HOX H;  5IYC H;  2DNE A;  1VQJ A;  1EWC A;  1B9N A;  2KQ3 A;  4X66 Q;  2A69 C;  1KQS A;  1XX8 A;  1NR4 A;  2K04 A;  1UWV A;  2ZT9 C;  4C3J H;  2NVQ B;  4OIJ A;  3J80 c;  1QJO A;  3N6R A;  2WB1 G;  1HHV A;  2WII B;  3U9S A;  4QJF A;  1EFI D;  4A3F B;  3BVM A;  4A3B H;  3FEW X;  5JOB A;  1OXT A;  2YTY A;  2NUC A;  4IO9 A;  4LF5 L;  3F2C A;  3ICE A;  2NBF A;  3BZC A;  5C4X G;  1IKL A;  2O2L D;  4LF8 Q;  3S1M B;  4AYB B;  1OXU A;  5I6Y A;  4QF4 A;  3TBI B;  2JA9 A;  4KN7 C;  1PTO H;  4QB4 A;  1T5E A;  1A3U A;  4IUQ A;  5CV8 A;  1D5M C;  4CKC A;  4DN4 M;  5M5Y B;  4A4I A;  1VS0 A;  2B63 G;  1STG A;  4YCW A;  4DV7 L;  1YI2 A;  1SFO B;  1YJW A;  2LXJ A;  1X3Q A;  1HTL D;  3SR1 A;  1TT2 A;  2IHF A;  4HAE A;  2L5T A;  4X3S A;  3HOZ G;  3GTQ H;  3S17 B;  5FO8 B;  1BVS A;  3IKJ A;  1ML0 D;  1VMP A;  5T1G A;  4B9X A;  3I8Z A;  3RLO A;  3P7J A;  2O5I C;  1RCV D;  3W2D A;  2UUA Q;  2L0C A;  1TWF H;  2B2U A;  1TKW B;  2NVX B;  1PMR A;  1ET9 A;  1M90 C;  2RA4 A;  3P75 A;  1MGS A;  5IWA Q;  1QE6 A;  4CKB A;  1AFP A;  2V4D A;  1PHJ A;  1E22 A;  4P72 A;  3ONA B;  1N36 L;  5CV6 A;  2Q2U A;  4A3M G;  1CQF A;  3A8K E;  2EYJ A;  2K5H A;  2Z4I A;  4KD4 A;  3C1E A;  1RIP A;  2NN6 G;  2ZJR A;  3Q23 A;  4IFD J;  3GP7 A;  3J7Y W;  1PH9 A;  2Z6K C;  3MXN A;  1LTI D;  2NZ1 D;  2VW9 A;  4DV4 Q;  3KLS A;  2QW7 A;  2NZH A;  3I56 A;  5KNC A;  1SNP A;  4BBS H;  2H1E A;  3GO5 A;  1HUN A;  4LFC Q;  2K6A A;  3I70 A;  4M8A A;  3MC0 B;  5I9P A;  2CFM A;  2R92 H;  2SOB A;  4YWK A;  1HNW L;  3TZU A;  1F9Q A;  4RKB A;  5ELO A;  4OO1 G;  5FLX c;  2JA6 H;  2X69 A;  3HOU B;  3ER0 A;  2K14 A;  1PH7 A;  3CCL A;  2JA5 H;  2E5L L;  1EYG A;  4KHP L;  1KIX A; 
#chains in the Genus database with same CATH homology
 1BR9 A;  1SNM A;  2VUM B;  1CM9 A;  1FD7 D;  1GUT A;  3J81 L;  4ZAI A;  4K14 A;  2ZXP A;  2PO4 A;  2SDF A;  2A73 B;  2QF7 A;  2A74 C;  4FF3 A;  1S5F D;  4KHV A;  2NYZ D;  3MWY W;  1D1K A;  5ELF A;  3I73 A;  3IFT A;  1X32 A;  1S5C D;  4CJ1 B;  1V1P A;  2IW3 A;  3WOE A;  1SJH D;  4FXK C;  1WVL A;  1UUP A;  2K5D A;  2MGS A;  1WD1 A;  1RD9 D;  3PO3 B;  3VR6 A;  2XVS A;  1LAC A;  1JR0 D;  3P1H A;  4N9T A;  4DAY A;  5C0X I;  5JAV A;  1RDP D;  5M3M B;  2WAC A;  3BG3 A;  1AP0 A;  1W6J A;  5JVG 3;  2G9H D;  3M3Y B;  3DWQ A;  5KND A;  3I90 A;  1B1Z A;  5I6W A;  5CC4 A;  1SBB B;  3KBX A;  4A3J B;  4IAL A;  2DN8 A;  2PYK A;  1FNV A;  2EVB A;  4Q0F A;  1CHQ D;  1Q90 A;  3ITP A;  1TWG B;  3QG1 A;  5D65 A;  4M1U B;  4HN7 A;  3M7G A;  3PV0 A;  4KN4 C;  3D31 A;  2CVR A;  2JA8 B;  2RBM A;  3G7L A;  1D5X C;  2B2W C;  2DY7 A;  3NSW A;  4I7Z C;  3M4O B;  2EDG A;  1ZXT A;  1HRJ A;  5EBC A;  4IZ8 A;  4S3S A;  4L63 B;  2RDF A;  1NR2 A;  2EYH A;  1LO5 D;  2RDG A;  4RGT A;  1ZYR D;  1KTK A;  3M85 A;  3PUV A;  4P2C B;  3TP8 A;  5DAU A;  1STB A;  2F0U A;  2CW0 C;  1TQO A;  1HPC A;  1Y1W B;  3S2H B;  4DNT B;  5IGD A;  2NWG A;  4K2L A;  5JEA G;  5DM6 3;  4KY5 A;  3NE5 B;  4MN3 A;  1JQY D;  4RAU C;  1H9S B;  2VB2 X;  4OGQ C;  1II3 A;  4BY1 B;  4C1N K;  1ESR A;  2OF1 A;  2XWB B;  1LTG D;  1SND A;  2Q8T A;  3QJY A;  2BDO A;  1VDZ A;  3PUW A;  3KK7 A;  3K5O A;  4C56 C;  4NW2 A;  1GOZ A;  1F77 A;  2VXW A;  1Y8P B;  2WKC A;  5C0X G;  4O42 A;  2F0V A;  1LTS D;  5C4Z A;  1H9J A;  3IL8 A;  2RQX A;  1IL8 A;  2KJX A;  3OPO A;  2PNR C;  3JAM E;  5FK9 C;  1RKN A;  2EYL A;  5BN3 A;  4JBW A;  1CI3 M;  2EYO A;  5LHY 1;  4A3K B;  1JE4 A;  1ENF A;  2FMM A;  1RF2 D;  3GV3 A;  1STY A;  1AZQ A;  1NUC A;  1SNQ A;  3G6J B;  2RKS A;  4OIK A;  2AUK A;  3HOX B;  1EY4 A;  1QG7 A;  2PPB C;  3QB3 A;  3X3M A;  4LJZ C;  4BA1 I;  4ILW A;  3S9W A;  5IGB A;  3CU7 A;  1J9O A;  4A3B B;  4MHE A;  3OWE B;  1DYQ A;  3BS1 A;  5KIX A;  4C3H G;  4K8I A;  1PTO B;  1IW7 D;  4K2K A;  5IGF A;  3M7N A;  2LFN A;  2HQE A;  3FMC A;  5IGG A;  5KGU A;  3R3O A;  1Y8O B;  3EJI A;  3OMC A;  5CGK A;  1KAA A;  4FNF A;  1LAB A;  3GTQ B;  3VR4 A;  1CA5 A;  5HGT A;  4EVO A;  4IFD H;  3E6Z X;  1WTW A;  2AQ1 B;  1CQV A;  4B9W A;  3RMH A;  2AUJ D;  3UI2 A;  2K03 A;  5E1F A;  1MD2 D;  1O80 A;  2F0T A;  3Q24 A;  2PW7 A;  3PMF A;  2EY1 A;  2EZV A;  2I07 B;  3GD7 A;  1A15 A;  3C46 A;  3J80 E;  1WTO A;  1JOK A;  2R92 B;  3E0J A;  4KY7 A;  4CGY B;  5K36 H;  2F1M A;  1Q1E A;  2JA6 B;  4KKU A;  1H9K A;  1EZ6 A;  1STE A;  3HKZ B;  4HCE A;  4QCL A;  1PFM A;  2KEE A;  1BF4 A;  4XQQ A;  3ERQ A;  1LV9 A;  1LT4 D;  3D6C A;  5A2Q E;  4R8N A;  4G7O C;  3IFD A;  1IHZ A;  2KVM A;  2NB0 A;  4J1M A;  4CHT B;  4KJN A;  2AWN A;  4H44 C;  3R2T A;  4ZK9 B;  3PUY A;  4IUU A;  3HEJ A;  4A3E B;  2HCI A;  3NUC A;  1EY6 A;  3URY A;  2O4X A;  3ERO A;  2SNS A;  3HOY B;  1SYB A;  1Q1B A;  3A54 A;  3FPP A;  1B2T A;  2WP8 J;  5CMD A;  4PNY A;  3RUZ A;  3QIA A;  4XQN A;  3SK6 A;  3DWA A;  2WKD A;  3OIP A;  2Y0S B;  2QKI C;  4ZUJ A;  3D4R A;  3GTJ B;  2XSC A;  1Q3L A;  1T5X D;  3MXP A;  2EE1 A;  1A2U A;  3RLF A;  2F0D A;  3BZD B;  3NXW A;  3MA2 B;  4U68 A;  2LS0 1;  2JEA I;  1ZYR C;  1QIL A;  5M5X B;  4K5W A;  1Z6H A;  1SAP A;  2D5D A;  1STA A;  4TRD A;  5FLX E;  3SK8 A;  1EEI D;  2AWO A;  1XTC D;  1LTR D;  1H9M A;  4H7B A;  3SK5 A;  1KDC A;  4H0L C;  1EEF D;  4C3I G;  1TWH B;  3TP7 A;  2J0T D;  5C44 B;  1JIC A;  5D14 A;  3P20 A;  1G6Z A;  1O7L A;  4G7Z C;  3AB9 A;  3QO2 A;  1CK1 A;  1KNE A;  5KRU A;  4C3J G;  2K01 A;  1I4G A;  1TS5 A;  3KBG A;  1I6H B;  4QIW B;  3S1N B;  1QB5 D;  1I4X A;  2F0S A;  1H9R A;  4JK1 C;  1DZ1 A;  5FO9 B;  5I9O A;  2ICI A;  2R6G A;  5C5M A;  1ZEQ X;  3BDO A;  1M8A A;  3HS0 C;  1WCM B;  3S1R B;  1KLG D;  4H13 C;  4DFA A;  5EBD A;  3HOW B;  4IUV A;  4OO1 H;  2L55 A;  4PMB A;  4U67 3;  1J8I A;  1TY0 A;  1LLR D;  1E0B A;  1BOS A;  4K6D A;  2I46 A;  1Y1V B;  1DOL A;  1LTA D;  4RCN A;  1ILQ A;  1HXY D;  1EY7 A;  1PFN A;  3F2U A;  4V19 0;  3T16 A;  2FHT A;  1F2Z A;  4HTH A;  5CYU A;  1K83 B;  2F4I A;  3O13 A;  1JOR A;  1I4Q A;  4YIJ A;  3GTM B;  1GUO A;  5ELC A;  1K8O A;  3BDL A;  1EQT A;  4DU9 A;  1TWA B;  5DNF A;  3K5L A;  1ENC A;  2XNA C;  1RHP A;  1V1O A;  2J7Z A;  3ZYY X;  4A3I B;  2Q8R E;  1IW7 C;  3DM1 A;  1LTT D;  3QOL A;  3D8G A;  2IPK D;  2A68 D;  3J7A F;  1EY8 A;  3W3A A;  2B2T C;  1STH A;  1EQV A;  2K32 A;  2EYF A;  2KA7 A;  1F9P A;  3K0Y A;  4KMU C;  1A6X A;  1DOK A;  2Z1C A;  2A6H D;  3EQL C;  4K5V A;  5HUR A;  1S5E D;  1B3A A;  1S4Z A;  3OWF A;  4KK7 A;  3NWT A;  1GXD C;  4HED A;  3PUZ A;  1ENA A;  4ZKB B;  2D9U A;  4F88 A;  3PIP 3;  1EY9 A;  4L8J A;  2F0K A;  2JA7 B;  3VA7 A;  4CBV A;  3J81 E;  3NBH A;  3D4W A;  3SEB A;  3I4M B;  4Z9C B;  3RZD B;  5J39 A;  2YU9 B;  2WAQ B;  3ND8 A;  3FVQ A;  1PDQ A;  4KI0 A;  2EYM A;  5FO7 B;  2K33 A;  2EY6 A;  4RA8 A;  3VA5 A;  4KTA A;  5CBE E;  2B2U C;  1F9R A;  3L3O C;  3RD4 A;  3GTK B;  2FIN B;  1HQR D;  5JEA H;  4FO2 A;  5KNB A;  4XYQ A;  4G4K A;  3HOV B;  4TQU S;  1PZK D;  4KKT A;  3V05 A;  2L4N A;  1G2S A;  3OSO A;  3T13 A;  1JC7 A;  2B2V A;  1R4P B;  4B08 A;  4G57 A;  3I3C A;  1ONL A;  1WTP A;  3T4A C;  1NSN S;  2IT1 A;  1L0X B;  2F0I A;  2E2H B;  3NK9 A;  3TP6 A;  1FYC A;  2PW5 A;  3MFY A;  5C0X H;  4K6L A;  2KED A;  4X3U A;  4CKE A;  2KEC A;  3NQT A;  2NTT A;  4OHJ A;  3J7A V;  1QNU A;  1PZI D;  4ABN A;  4WRD A;  4FXD A;  3SHL A;  1M4V A;  5EKI A;  3MTS A;  1RJT A;  4BBR B;  4HCS A;  2R7Z B;  1SEB D;  3K5N A;  5CV9 A;  1IYU A;  3CQZ B;  2L11 A;  2R93 B;  2K5W A;  3N52 A;  1SSO A;  2MPM A;  2GA4 B;  2N88 A;  4R8I A;  5CR3 A;  1TII D;  3SVM A;  4CJ0 B;  5I4D A;  5IIF A;  4ZQ3 A;  1MSG A;  1D5Z C;  1ESF A;  4EGV A;  1SDF A;  2E2I B;  2C9O A;  1BUV T;  3ND9 A;  2WB1 B;  4PQX A;  1OO9 B;  4DAP A;  3GTO B;  3D4D A;  3LWE A;  1WTQ A;  5M9O A;  2B39 A;  3TN2 A;  3SK4 A;  5C4X B;  2K05 A;  2M2L A;  1UEA B;  3HG9 A;  1JWS D;  1S5D D;  2NTS A;  5IT9 L;  4ZUI A;  5IGC A;  4XDX A;  5CV5 A;  3I91 A;  1GUS A;  1F2Y A;  2A5H A;  3U9O A;  1STN A;  3CHB D;  4I65 A;  2B63 B;  1JCK B;  1V8Q A;  2M00 A;  1BBX C;  3KLS X;  3H09 A;  3FRP B;  1CT1 D;  1Z7T A;  3HOZ B;  2D2C C;  4RGM A;  5TSS A;  1FNU A;  1SE2 A;  3DHQ A;  1DOM A;  2B8G A;  2F0Q A;  1YNN D;  1ILP A;  4HSP A;  5G3L D;  4XXE A;  2DNC A;  1R9T B;  5E3F A;  5C3X A;  1NAP A;  2F0H A;  1I4H A;  3MVV A;  3MXU A;  1HQM C;  4A3M B;  1IKM A;  2K5Q A;  1KDB A;  2FJ2 A;  3FDT A;  5EQ0 A;  3GQB A;  1WTX A;  1S5B D;  4X3T A;  5A2Q L;  3GV6 A;  5I2X A;  2A68 C;  2R3Z A;  4DA2 A;  1TWC B;  2MJ8 A;  3OIQ A;  1L0Y B;  5G3L F;  1HFG A;  4F87 A;  3NTH A;  3BYY B;  4IQZ A;  2NVY B;  4XIG S;  4HMJ A;  3E5S A;  3CRK C;  5LL6 S;  2QDB A;  1G8Z D;  2K7V A;  1FGB D;  3WOF A;  2A6H C;  3MAQ A;  5JVH 3;  1DON A;  2HDL A;  2EJG C;  2ID0 A;  4HSV A;  4A3D B;  1VCI A;  1C48 A;  3A55 A;  2JE6 I;  2PZU A;  3DEP A;  3QWN A;  3KF8 A;  5IOD A;  4QUF A;  2NVT B;  1QCB D;  3K7A B;  1I4R A;  2Z4H A;  1B50 A;  2MUY A;  5NUC A;  2HUG A;  3NTK A;  1UNS A;  1A3V A;  2RDH A;  1EZ8 A;  1SYF A;  2B2Y A;  4PMW A;  4ULL A;  2RSO A;  2QEJ C;  4C1N I;  4EQP A;  4WJW A;  1MBY A;  3HZX A;  4A93 B;  1EWH A;  3SXH A;  4QMG A;  5C3W A;  1G2T A;  2WV6 D;  1R4Q B;  4LAA A;  3LX0 A;  3S1Q B;  4V0B A;  1QOH A;  2ENB A;  2A6E D;  3C2P A;  4C2M B;  5CV4 A;  1GHJ A;  2R61 A;  1F9S A;  5FOB B;  3K5M A;  2F0N A;  2MP1 A;  3T53 B;  1SYD A;  4IUP A;  5KEE A;  3BVZ A;  5EPJ A;  4ZKC B;  1BNZ A;  3D6W A;  2OEO A;  3DEO A;  3NBI A;  2H4O A;  2FMC A;  3TZD A;  2KHS A;  4FF2 A;  1B44 D;  1XWE A;  3HRZ C;  2WIN B;  1OXV A;  1KAB A;  4ZYS A;  3A8J E;  3L7Z C;  1KDA A;  1PYW D;  4K8J A;  4X3K A;  4XQJ A;  3VR5 A;  5T1I A;  1HA5 A;  1GUG A;  5ELD A;  4EQN A;  5JJZ A;  3X3N A;  2MHV A;  1SE3 A;  1IYV A;  3AMU A;  2JP1 A;  4UAI A;  4IUR A;  4A3G B;  2E76 C;  3H0G B;  1SMY C;  1YNJ C;  3S14 B;  1O78 A;  1LT6 D;  2IX3 A;  2ZXR A;  3OOC A;  2OT2 A;  3I4L A;  1BXT A;  1CZG A;  3K58 A;  2J4X A;  2NN6 H;  1G29 1;  2IL8 A;  2HDM A;  2IX1 A;  4GZY C;  4KD3 A;  1ZKO A;  2YYZ A;  4KJO A;  1VMC A;  2BCO A;  3NTI A;  1I3Q B;  2LMC B;  1JWU D;  3R93 A;  2B2W A;  4XTC S;  1GUW A;  2L9H A;  4WOR A;  3K59 A;  1Q12 A;  5FKA C;  1PRT C;  4NP5 A;  2ICE C;  4BY7 B;  4FXG C;  2F3V A;  4FYD A;  5EKK A;  2K28 A;  5KYI A;  5BN4 A;  1SYE A;  2XRQ D;  5D3D A;  4DF7 A;  4HMI A;  3DUZ A;  4DXG A;  1I4P A;  5M3F B;  5E4X A;  4UDU C;  5IGE A;  2F0G A;  3TSS A;  3M4Y A;  3GTG B;  3MXG A;  3L9A X;  3MZ5 A;  2N55 A;  3NQI A;  4KV6 A;  1TVX A;  2B2Y C;  3VYU A;  4CJ2 C;  2F0L A;  1BQQ T;  4RKL A;  4L6T B;  4WFN 3;  2CQA A;  5KYL A;  3LNN A;  4ODG A;  1Y8N B;  3DXJ C;  1SNC A;  2TSS A;  4QUC A;  5COY A;  4MIU A;  4RWS C;  2LKV A;  3TP5 A;  1RTO A;  1Z47 A;  3BVG A;  4ZLT F;  1C4Q A;  1YNN C;  1I6V C;  1EU3 A;  5C6A A;  1EL0 A;  3CKI B;  1U9R A;  1CA6 A;  1DM0 B;  1D2B A;  1Y69 U;  4DGZ A;  4C3H B;  3H91 A;  4DXF A;  2E74 C;  3LWU A;  1E2V A;  1FR3 A;  3VR3 A;  5I2Y A;  1PZJ D;  4FVM A;  1X3P A;  2BE5 D;  4RHR A;  2TMP A;  5EPL A;  1ET6 A;  1KNA A;  1SYC A;  1XXG A;  1AW7 A;  4RFB A;  2ZXO A;  4DNR B;  4E6I A;  3S2D B;  1GJX A;  1G91 A;  1AZP A;  1EYD A;  4IUT A;  2QCP X;  3VYS A;  1TS4 A;  2CHB D;  5E4W C;  4K5X A;  3I72 A;  2EOT A;  1O7Y A;  3A56 A;  4Q5V A;  1QNK A;  1BDO A;  3RZO B;  1V1P B;  1PTO D;  2JSO A;  1HTP A;  5ELB A;  1HUM A;  3SDZ A;  3BDC A;  1W6K A;  1BCP D;  4J6H A;  1JOO A;  1H9S A;  3BYT B;  5K5P A;  1JWM D;  1F2L A;  4LK1 C;  4DK0 A;  5CBA E;  5D3I B;  1B4O A;  1LTB D;  2VNU D;  4DAV A;  4FF4 A;  1TS2 A;  3MFG A;  3FKI B;  2JYO A;  5C4J B;  1PTO F;  2IX0 A;  1PXU A;  1BCP F;  1TS3 A;  2F0O A;  2KCC A;  3C1F A;  1U4R A;  2A69 D;  3I4N B;  1JB3 A;  2A6E C;  2LY7 A;  3Q22 A;  3JAM L;  1EY0 A;  1EOT A;  4LMQ D;  1RTN A;  4Y7N B;  4BWG B;  5C5L A;  1U4M A;  3S15 B;  1PLF A;  1SMY D;  1YNJ D;  4F8M A;  1F2M A;  2L12 A;  2G9D A;  3HP3 A;  5EKL A;  3VYR A;  2E2D C;  2FFK B;  3FPU B;  2E2J B;  1E2W A;  1QWY A;  3MHB A;  4ID6 A;  4J8Q A;  2JXM B;  1U4L A;  3H94 A;  4RH6 A;  2XIW A;  1LT5 D;  1B53 A;  1O7Z A;  2IJ0 A;  2BA1 A;  5DEH A;  1PRT D;  4IFD I;  1OXS C;  5ISR A;  4KKS A;  5C4H A;  5AFW A;  2IWH A;  2EXZ A;  3GTP B;  3KUP A;  4HR7 B;  3GTL B;  2KCN A;  4O1N A;  5CV7 A;  2F0J A;  2M9V A;  3A7L A;  3IAY A;  1CZW A;  5COR A;  3C3L A;  3KLR A;  2SNM A;  2PMZ B;  2EJF C;  1ICW A;  3K57 A;  4C3I B;  4FP5 D;  1TR5 A;  4EQO A;  1XYI A;  1EU4 A;  2Q8I B;  3AU7 A;  2C5C A;  2BOS A;  4F7X A;  3CRL C;  1EYC A;  1BO0 A;  1PRT F;  2BDN A;  4XT3 B;  4BS9 A;  3OW7 A;  1VF7 A;  1GUN A;  3DWP A;  5EPK A;  1DD2 A;  1SXT A;  1K8M A;  4TKO B;  1TU2 B;  2O5J C;  3PUX A;  1UAP A;  4C3J B;  3H6M A;  4ZRZ A;  4NKL A;  5A35 A;  3A8I E;  2BA0 A;  1U4P A;  1SYG A;  2F3W A;  5J22 A;  1SNO A;  5M5W B;  2QIL A;  1Q8I A;  1HFN A;  4FF1 A;  2AQ3 B;  3T51 B;  1TY2 A;  4PV1 C;  3R8B A;  5ELE A;  3V2T A;  1WTR A;  3QOJ A;  3NP8 A;  4NDX A;  3J80 L;  2PZW A;  4N9P A;  3EA6 A;  1SJE D;  2KUM A;  4PMC A;  1BCP B;  2F0W A;  3OHX C;  4R9W A;  5F2D A;  3H3V C;  1D1I A;  2OXP A;  5JPN C;  1D6E C;  3K6O A;  2EY2 A;  2D62 A;  1AEX A;  2RSN A;  2SEB D;  4DK1 A;  4KHZ A;  5EGT A;  3HGB A;  5IT9 E;  3EFX D;  2XWJ B;  1DJR D;  2K1B A;  2EYP A;  3WDN A;  3TME A;  1FNW A;  1I50 B;  5LL6 X;  3D3R A;  1E2Z A;  1HCZ A;  5C3E B;  2EY5 A;  3VYT A;  1TWF B;  2Z8L A;  2B8F A;  1VF5 C;  1LT3 D;  3PO2 B;  3MEH A;  2B2V C;  4IN3 A;  1EIG A;  2PQE A;  4XYO A;  2JEB I;  3S16 B;  3EVQ A;  2X6L A;  2EPB A;  4IFD G;  4ME5 A;  1A2T A;  4G7H C;  4BA2 I;  5IOC A;  2XRS D;  4BBS B;  4TSS A;  3DMU A;  2BE5 C;  5JEA J;  1NCV A;  3OMG A;  4XT1 B;  5JPM C;  2XN9 C;  2F0P A;  5BN5 A;  2L1B A;  2VB3 X;  4KY6 A;  3NWS A;  2RVL A;  2JA5 B;  1MI2 A;  3SE0 A;  5EJW A;  2KOL A;  4IUN A;  1V43 A;  1WTV A;  1C8C A;  1AN8 A;  5K36 G;  2PCF B;  1ROD A;  1GHK A;  2AQ2 B;  2PZT A;  5DM7 3;  1A3T A;  5FLX L;  2DY8 A;  1EIH A;  1B9M A;  1EYA A;  3Q6S A;  2HCC A;  1WD0 A;  1PRT B;  2NN6 I;  5C0X J;  2F0M A;  1KLU D;  1PTO C;  1CFM A;  2E75 C;  1MSH A;  1DXM A;  5J1Z A;  4RCO A;  1BCP C;  1PFB A;  2B2T A;  3T56 B;  2CW0 D;  3Q0A A;  2EJM A;  3VR2 A;  4RGO S;  4NMZ A;  4OL7 A;  2F03 A;  4OO1 I;  1CTM A;  3NHH A;  3NPP A;  1DCZ A;  4RGN A;  1EY5 A;  2F0F A;  4RHS A;  1SE4 A;  3V96 A;  1CHP D;  2X6G A;  3TDQ A;  1HA6 A;  3PIO 3;  1OXX K;  3A7A B;  1JOQ A;  2F0E A;  3R2I A;  2DNE A;  1EWC A;  1B9N A;  2KQ3 A;  2A69 C;  1XX8 A;  1NR4 A;  2K04 A;  2ZT9 C;  2NVQ B;  4OIJ A;  1QJO A;  3N6R A;  1HHV A;  2WII B;  3U9S A;  1EFI D;  4A3F B;  3BVM A;  3FEW X;  5JOB A;  1OXT A;  2NUC A;  2NBF A;  1IKL A;  2O2L D;  3S1M B;  4AYB B;  1OXU A;  5I6Y A;  4QF4 A;  3TBI B;  4KN7 C;  1PTO H;  4QB4 A;  1T5E A;  1A3U A;  4IUQ A;  5CV8 A;  1D5M C;  4CKC A;  4DN4 M;  5M5Y B;  1STG A;  1SFO B;  1X3Q A;  1HTL D;  3SR1 A;  1TT2 A;  4HAE A;  2L5T A;  4X3S A;  3S17 B;  5FO8 B;  3IKJ A;  1ML0 D;  1VMP A;  5T1G A;  4B9X A;  3I8Z A;  3P7J A;  2O5I C;  1RCV D;  3W2D A;  2L0C A;  2B2U A;  1TKW B;  2NVX B;  1PMR A;  1ET9 A;  2RA4 A;  3P75 A;  1MGS A;  1QE6 A;  4CKB A;  1AFP A;  2V4D A;  3ONA B;  5CV6 A;  1CQF A;  3A8K E;  2EYJ A;  2Z4I A;  4KD4 A;  3C1E A;  2NN6 G;  3Q23 A;  4IFD J;  3GP7 A;  3J7Y W;  3MXN A;  1LTI D;  2NZ1 D;  3KLS A;  5KNC A;  1SNP A;  2H1E A;  3GO5 A;  1HUN A;  2K6A A;  3I70 A;  4M8A A;  3MC0 B;  5I9P A;  2SOB A;  3TZU A;  1F9Q A;  4RKB A;  4OO1 G;  2X69 A;  3HOU B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...