2PZTA

Crystal structure of staphylococcal nuclease variant v66q/p117g/h124l/s128a at 100 k
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
135
structure length
130
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKVEKYGPEASAFTKKMQENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystallographic study of hydration of an internal cavity in engineered proteins with buried polar or ionizable groups.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 37
structure length 130
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2007-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2pztA00
3NP8A 3QOJA 4IZ8A 2F0EA 4NKLA 1TR5A 4TRDA 1EY6A 4NDXA 5EKKA 3SK5A 2EYLA 4LAAA 5CGKA 1SNPA 3E5SA 2EYPA 2F3WA 1NUCA 3NXWA 3MVVA 2EYHA 2PYKA 4MIUA 4QB4A 4G57A 4K14A 5CV6A 3TP5A 2EY5A 3PMFA 4OL7A 5IGCA 1SNQA 5E3FA 1A2UA 1SYFA 1EQVA 4HMIA 5KGUA 2EY6A 5CV4A 2F0JA 5JAVA 4WRDA 2KQ3A 4KY7A 4B9WA 4K8JA 2PQEA 1EY7A 1SNDA 2OF1A 1EYAA 3D4WA 2EYOA 1JOQA 3D4DA 4HTHA 5IGDA 1EYDA 3HZXA 1SNCA 3EJIA 3R3OA 2RDFA 4HMJA 4NMZA 5CR3A 5CV5A 5C5MA 4I65A 1SYDA 5JOBA 3T16A 3ERQA 5DAUA 3TMEA 5C3WA 2F0PA 1IHZA 1JOOA 1ENCA 2EYJA 2F0VA 4PMBA 1A3UA 1KDBA 4K6DA 3T13A 1JOKA 4KV6A 4K5WA 3SHLA 4N9TA 4PNYA 2F0IA 3SK8A 5K5PA 4KHVA 5I9OA 1STAA 2RKSA 2SNSA 4KJNA 1KAAA 4E6IA 3DHQA 1EY0A 4K2KA 1TQOA 1KDAA 5NUCA 2EY1A 2F0OA 1F2MA 2SNMA 4S3SA 2KHSA 1EY4A 2F0DA 2PZWA 2EYFA 3SXHA 2PZTA 3EROA 3QB3A 4KTAA 4F7XA 1JORA 2F0WA 1STGA 5I6WA 4EQNA 5CV7A 5I6YA 4QMGA 1F2YA 4KY6A 4RKBA 3U9OA 3VA5A 5C3XA 5IGBA 3LX0A 5IGEA 1ENAA 4N9PA 2O4XA 4DFAA 4DF7A 5KRUA 4K5XA 5ISRA 2M00A 2OEOA 3P1HA 4PMCA 3RUZA 1RKNA 1U9RA 2OXPA 3MXPA 4KJOA 4DU9A 1F2ZA 1SYEA 2F0TA 4ZUJA 3C1EA 5C6AA 2NUCA 1STBA 1STNA 4EVOA 5C4HA 5EKLA 4IUNA 4B9XA 3C1FA 5IGFA 1SNOA 5J39A 2ENBA 1II3A 4YIJA 1STHA 1KABA 2F0QA 3OWFA 5DEHA 2HQEA 2F0SA 4EQPA 5IIFA 2EY2A 2LKVA 5E1FA 4EQOA 5IOCA 2RBMA 4K2LA 3OMGA 4WORA 3BDLA 3NHHA 5CC4A 4J6HA 4DGZA 2QDBA 5HGTA 1NSNS 1A3VA 1SYBA 4ZUIA 5J1ZA 3SK4A 4ODGA 2PW7A 2EXZA 2F0MA 3NUCA 1SNMA 2F0GA 2F0UA 1A3TA 2F0HA 4IALA 4NP5A 5EGTA 2WACA 3TP8A 3D6CA 1EY8A 5KIXA 5M9OA 1SYGA 4R8NA 5CV8A 2F0LA 2F0FA 1SYCA 2F0NA 1EYCA 4ID6A 2PZUA 4ME5A 5CV9A 4J1MA 2F0KA 1EZ8A 1STYA 3TP7A 1AEXA 3D8GA 4F8MA 4KY5A 4K5VA 5HURA 5IODA 3V2TA 5C5LA 5J22A 4QF4A 5F2DA 3H6MA 4K8IA 3HEJA 3MHBA 1EY5A 5KYLA 3TP6A 3S9WA 3SR1A 3SK6A 5IGGA 3QOLA 4KD4A 3P75A 5C4ZA 3OSOA 3OMCA 3ITPA 3NK9A 4KD3A 3BDCA 4H7BA 3EVQA 4ZQ3A 2EYMA 1TT2A 2SOBA 3MEHA 1A2TA 1EY9A 3DMUA 3MZ5A 4RKLA 2PW5A 3NQTA 1EZ6A 5KYIA 1KDCA 5I9PA 5KEEA 2F3VA
chains in the Genus database with same CATH superfamily
3PO3B 1ML0D 1ILPA 1TR5A 1A63A 1PZJD 3NBIA 4KHPL 3D4RA 1PYWD 1D8LA 5D3DA 1B9NA 4A3BB 1TWHH 5CV4A 2F0JA 4K8JA 1PA6A 2EYOA 2IWHA 3MC0B 4XT1B 1H95A 3PIOA 1JWSD 2E75C 3T51B 5BR8L 1VQLA 1U5KA 5JEAG 1B3AA 1AP0A 1JOOA 3OTOL 4PMBA 4DR6Q 1KDBA 4H13C 1QOHA 4OELB 2XWJB 3UE0A 2SNSA 1SE3A 3KF8A 3VYTA 4E6IA 2HHHL 1EY0A 2K4KA 2VQEL 2B63H 2ATWA 4HEDA 2X6GA 2B3GA 5HGQA 1C48A 1Q81C 4RFBA 1S40A 1Y1VH 1OXUA 2RDHA 5ISRA 3KJPA 2L5TA 5FLMH 1CA6A 3S1NH 5IGFA 1EEFD 4LUZA 4A3JB 3VYRA 1K8MA 2JYOA 5DEHA 4DAMA 1AN8A 4O2DA 1VQ4A 1E22A 4HN7A 2R93H 2C9OA 4DNRB 2RVLA 1RODA 4N8X1 4DV1Q 2KUMA 1G2SA 3ZJYC 3J80i 4HIOA 4I7AA 4X64Q 4B3TL 3FMCA 1BKBA 4BBSG 1WD1A 4K0KL 3KDFA 3J7AV 1JT8A 2VZAA 3OOCA 1WTRA 1N9WA 3ICEA 1YVCA 4PG3A 3JAMi 4OX9Q 1QG7A 2ID0A 2WIIB 1GM5A 4XQNA 2MO0A 3K7UC 1JQYD 4A3KG 1TT2A 3PUVA 1A2TA 2ZJQA 1HZ9A 2CH4W 1K73C 3HOUG 1OXVA 2B63B 3QJYA 2EXDA 3EA6A 4H0LC 3T4AC 3SK5A 2WAQE 1I3QH 1KHIA 1ENFA 1AFPA 1WTWA 2HIVA 1Y1VB 1D2BA 4L5QA 2F03A 2VUMH 3PIPA 5IE8A 1V8QA 5A35A 2AMCB 2KBNA 1FJGL 1VQ8A 1SYFA 4HMIA 2QW7A 1PMRA 1YEZA 1V1PB 2PQEA 3J81E 2NVYH 1BOSA 4DV7L 1CFMA 3QO2A 2R93B 4LF4L 1D5MC 3K81C 4DAYA 4GKKL 1RCVD 4BY7G 3CCSA 2DJGC 1JOKA 3M4PA 4UY8C 3J81L 4XXEA 2D0OA 3T1YL 2F0IA 1T5XD 2F4IA 2Q2TA 2KCMA 2BDOA 5FLXc 1U4LA 3GTJH 1N36Q 2IY5B 2J7ZA 1F2MA 3GD7A 4X65L 3EROA 2JA8H 2EE1A 4F7XA 1ILQA 2KCNA 4XQJA 2ZT9C 1HNXQ 4DUYQ 1IL2A 1B7YB 1K83H 4N9PA 2JN4A 4RG1A 5A2QE 2ZJRA 1X9NA 3FP9A 1EQQA 4KJOA 2E2HH 2WKDA 2F0TA 3HFZB 2JA6H 3JC66 1F9SA 3DWAA 3P20A 5M5XH 2K5HA 3GTPH 4JI4L 5A2QL 1AZPA 4KMUC 4LF5Q 1I3QB 2FMCA 2Q2UA 4TVAB 2OCEA 5C3EG 2VUMB 4JI6L 3D6CA 4DUZL 3S1QH 5C0XG 4ME5A 3L9AX 1LTBD 3FEWX 2RA4A 4FXGC 4DK6C 2JA7B 3LWUA 2ZTCA 1I5FA 5JVH3 1YHAA 2ICEC 1LLRD 4RAUC 3I4MG 4KD4A 4HSVA 3S1RH 4KD3A 4A3DG 1PZID 3GTJB 3NQTA 2CW0D 1C7YA 1NMFA 1VQMA 5DM73 4HCEA 3W1BA 1G6PA 1JCKB 1HNZQ 4LWCA 4LUVA 3ZYYX 1Y1WH 4AQYQ 1ASYA 4OO1G 3STBD 1GXDC 1HNWQ 1U4PA 4BBRH 3S14B 4X6AH 1HHVA 4MIUA 4YHHL 2Q8RE 4G7ZC 2A69D 4O42A 3A54A 4C1NI 2CCZA 1PLFA 3CU7A 2JA6B 1UEBA 5KNDA 4R4IA 5KGUA 2B2YC 3H0GG 3LGJA 1R9TH 4A93H 1EY7A 1H9RA 3D4DA 1EYDA 2QA4A 4LF6Q 2CHBD 5DLQE 1F2LA 2VXWA 1ENCA 2A19A 2K04A 3L2PA 1GUGA 4LFCL 2QEJC 1K9MC 2LSSA 2BH8A 2LMCB 4GLAC 4XTCS 3S1QB 4FP5D 1VQJA 1C4QA 4QY7A 2V4DA 1JC7A 1S5FD 4TQUS 2DNEA 5I6YA 5M3FG 5M5WB 1Q86C 3F1ZA 3LWEA 2KCTA 2OEOA 3P1HA 1SR3A 5C4JB 1RKNA 2BA0A 3HOXG 1TS3A 2HDLA 2UXBL 1IBLL 3K5LA 4B3SQ 3S15H 4DAVA 3DXJC 3OWFA 2HQEA 1SLJA 3GTOH 4UP7A 1X32A 1JICA 2PCFB 1VQOA 1UE6A 1T9HA 2WACA 3IRBA 2A5HA 1VQCA 3QWNA 5KIXA 1XJVA 1SYCA 3GTMB 1EYCA 5JVG3 1XPRA 5AJ3Q 1R9TB 1BNZA 4A93B 4Q5VA 4C3IG 4KY5A 3CC2A 2D5DA 2RQXA 2UUBQ 2B8FA 4IFDJ 1K0RA 4C3JH 3F8TA 1EY5A 3S9WA 1E1OA 3PF5A 1CUKA 4IN3A 2UXCQ 4R4OA 3FVQA 2L9HA 5BN4A 1YJNA 4LNQA 3R2IA 5JPNC 2JK8A 1LTGD 3MEHA 3I56A 2YTYA 1EWCA 3OW7A 5D3IB 3A8KE 3PV0A 3TBIB 4GN3B 1GJXA 1HFNA 3J81j 2NVTB 4MHEA 1NMGA 4GOPA 2PYKA 3TN2A 2Q8TA 2MQHA 1SXTA 5CV6A 2Z6KA 4DNTB 5IGCA 2K5NA 3URYA 4AYBB 1SNQA 2WV6D 1KL9A 3S24A 1O7LA 5JAVA 1NTGA 1FD7D 1LTSD 1VMCA 3AQQA 4X3SA 4GS3A 5IYDG 1EYAA 3EJIA 5JJLA 5K36H 1F9RA 1K0SA 2F0VA 4CBVA 3RN2A 4ME3A 3TREA 4LUOA 1YJWA 1BR9A 5I9OA 3K7AH 4AIMA 5JJIA 1KAAA 2NTTA 1MSGA 1PDQA 1PRTD 4BS9A 2F0DA 2WB1G 3K8AA 2O5JC 2EYFA 5FJ8H 4RGTA 4JI2Q 1JORA 1LTTD 4O0AA 1RHPA 5CMDA 3I8ZA 2XRSD 2CH4A 2O4XA 2IJ0A 3BVGA 1BBUA 1I50H 1U9RA 2ZM6L 1ICWA 2E76C 2XTIA 1SMYD 5LL6S 1TWCH 4OWWB 2I0QA 3VR3A 4B9XA 3C1FA 1WTOA 2YYZA 1WYDA 4LFAQ 5J3BA 5IP9G 3CCJA 1TWAH 2MFIA 2JA5G 1B70B 2IT1A 2MO1A 2PW7A 1DGSA 1P16A 1RJTA 2R7ZG 5BN3A 3GTLB 2E5LQ 4X62Q 4JI5Q 5JEAH 4RH6A 4F8MA 2KHIA 1Q46A 1NAPA 1RF2D 2A74C 1KC8C 2FINB 2ZXRA 3V05A 2WAQG 5C4XG 3F2CA 1IBML 5CBAE 3OSOA 1XNRL 2B2VA 2LXJA 1CSQA 3EVQA 2B39A 5CBEE 3K59A 2K05A 4DR2Q 2PW5A 1SJHD 1PFSA 4NXMQ 1ZYRC 1PFNA 4BXXG 2WFWA 4YY3L 2GVAA 1I50B 3KBXA 5E3FA 1Z6HA 4DV0Q 2EY6A 4B9WA 3RZOH 1TWGH 1NBWA 2I46A 2DN8A 1M90C 4HTHA 5EPJA 5IGDA 5CV5A 1G8ZD 5M5YB 4IPHA 4LF7Q 1BF4A 3TS2A 3AU7A 1HZCA 1JR0D 4BBSH 4K5WA 3CC4A 2KJXA 1J5EQ 2NBFA 3NTKA 3H15A 3GTKH 1TS5A 3SEBA 5LMNQ 1O78A 2AUJD 2OT2A 1N33L 3D0FA 3RLNA 4A3KH 1A8VA 1ZEQX 4X66Q 3Q0AA 1WTHA 5IGBA 2EJFC 5IP7H 3S2DB 4B3MQ 3AYHB 1VF5C 1X3FA 1XMQQ 2K5WA 4GLXA 2MP1A 2EOTA 5EKLA 4JV5L 3A74A 5M3MB 4IUUA 2AWOA 4EGVA 5EBCA 2E2IH 1DOMA 2EVBA 2DGYA 4KKUA 2BCOA 2PMZE 5E7NA 2LKVA 5C44H 3RLOA 1TWFH 4R4TA 2Z8LA 4LK1C 3OMGA 2QDBA 5EPKA 4ZUIA 1IYUA 1I4RA 3STBC 5I4DA 3VR4A 3GTGH 3AFPA 3MTSA 3SVMA 1JJGA 1MIUA 2AHOB 4Y52H 1SEBD 2K1BA 3UDXA 4DAPA 3ULPA 1LT3D 5FOBB 1Q8KA 2X6LA 5F2DA 5IWAQ 2K7VA 4LMQD 4HJ7A 1PYBA 2TMPA 1FGUA 4X3KA 3DM3A 2LS01 3VR6A 1WI5A 1A62A 3BDCA 1EZ6A 2ASBA 3BVMA 5I9PA 5JJKA 3KLRA 4KHPQ 4DAYB 5EKKA 2BDNA 3RD4A 2H1EA 3FHWA 2ZXPA 4LF9L 1D6EC 2XSCA 2XN9C 4APVA 5GAEC 3HOZB 2VS1A 3ERSX 1B2TA 1DZ1A 4IURA 1A2UA 2HCIA 1FNUA 1E7ZA 5C3EH 3QG1A 2E2IB 4DV2L 1UE1A 2XRQD 1JOQA 5BR8Q 1OXTA 4HMJA 5C44B 1SNCA 2FFKB 3OTOQ 3VDYA 1RDPD 2I5HA 2IHFA 1IW7C 1B53A 2PNHA 2HHHQ 1LTRD 2E8GA 2VQEQ 2B2TC 2I07B 1M1KC 5NUCA 1TXYA 2LXKA 3X3MA 4AH6A 3I4MH 3CCQA 4L5SA 3CF5A 1IXRA 3A8JE 5I6WA 4H02A 2BH2A 4A3DH 4RKBA 5IGEA 3LX0A 5L37A 1SMXA 1CHPD 5GAHC 1NR2A 1BDOA 1WTQA 1LO5D 2PI2E 3CCRA 5FO7B 1STNA 4OO1H 2Q2HA 2K14A 4GN4B 4HAEA 3RR5A 1EOVA 1SJED 1BCPD 4CKCA 3PUXA 5EAYA 5IOCA 2UXDL 4JI7L 1DONA 4MNOA 2Z1CA 1L0YB 4J6HA 4DGZA 1LTAD 3H0GH 1EIHA 3NSWA 2B2WA 4B3TQ 5M9OA 2F0NA 4DR5L 4K0KQ 5C3EB 3U4VA 1DOLA 2B2UC 5HURA 3V2TA 2QF7A 3FDTA 2WB1E 2A6HC 1YNJD 3HOYH 3NE5B 3HEJA 4WJWA 3BZDB 1DJRD 1Q12A 5T1IA 4DR3L 3SK6A 1STEA 1WCMH 1X65A 4BA2I 1YJ9A 1S3OA 1DCZA 2QILA 1PTOD 3MZ5A 5M3FH 3D31A 1QVGA 1L1OC 1L1OB 4DR4L 3I4MB 4JI1L 4HJ9A 1PRTC 2NVQH 1PRTB 1TWHB 3DLLA 1K8AC 5CGKA 1LTID 4H44C 5LL6X 4OHJA 1FJGQ 1S5DD 3A7LA 1Q7YC 4FF3A 4WJ4A 3HOWH 1YNND 4IO9A 4DV7Q 3RLFA 2YV5A 2AWNA 4LF4Q 1H9SA 1K3BC 3W1GA 2L15A 4A3EG 4GKKQ 3M7GA 4A3CG 1D7QA 3ERQA 3I2ZA 1AE3A 2FHTA 5C3WA 3T1YQ 3QR8A 3H0GB 2I5LX 4C3IH 4OWXB 4KHVA 3DWPA 3SGIA 1YHQA 4X65Q 1SE4A 4IUVA 5IYBH 4MZ9A 4ZYSA 1VQ6A 4RA8A 1K3RA 3S1NB 3PGZA 1LYLA 1D1IA 1I4XA 1KD1C 3HOYB 3VA5A 2Z6BA 2GA4B 4IFDG 4IOCA 1WCMB 3TZDA 3D6WA 1HQRD 2AQ3B 4X64L 3KUPA 2J4XA 1IKMA 2NUCA 2XIWA 4EVOA 4JI4Q 1GOZA 3BZKA 1B8AA 1XMOQ 3J7A5 3MXGA 1II3A 3W5OA 4JG2A 2Z4HA 2NVQB 2RBMA 3PO3G 1HPCA 4JI6Q 1CKNB 5GQOA 5ELDA 4CKBA 4RMFA 1S72A 5ELEA 3F2BA 3VR2A 2DUDA 1N32L 2VW9A 4DUZQ 3HOWB 2G9DA 3KLSA 3B6YA 2NN6H 4KKSA 3J80E 4HJAA 1XNQQ 4RGOS 2PZUA 4JBMA 1YHBA 4LW1A 3S17H 1MD2D 2AUKA 1Q1BA 2PQAB 2B2TA 4GOPC 1MI2A 4GOPB 4IUPA 3J80L 1QZGA 4RHRA 3JAME 4QUCA 1KNAA 2Z6KC 4OIJA 4CHTB 4EX5A 1L0XB 5BN5A 2Z4IA 4XQQA 1XYIA 4C3IB 4JC0A 1IKLA 4FO2A 2EYMA 4A3GG 3DM1A 4FXDA 5KYIA 2NZOA 1Q8IA 2MUYA 4NKLA 1PV4A 4YHHQ 3S2HH 4PZ7A 1QILA 1CI3M 1OO9B 2NVYB 3E5SA 5GROA 2VB3X 4B3RL 2A1AA 4CJ2C 4DV3Q 2D2CC 3KF6B 1UAPA 1CQFA 1EQRA 1XXGA 4RGMA 1G6ZA 1JJ2A 2G5DA 1X3QA 1JJCB 3BS1A 1VCIA 3PO2H 3A7AB 2O5IC 4A3JG 1LT4D 3M4YA 1DYQA 1HNXL 4CGYB 1CZGA 2R7ZH 5JOBA 3T16A 4LFCQ 1CK1A 3A0JA 1TU2B 1TS2A 1CHQD 1IHZA 3I73A 2JA8B 4MTKA 2Z9HA 3DUZA 2B2UA 3NEMA 2F4VL 1FNWA 3SK8A 1STAA 4KHZA 1K83B 4KJNA 1FYCA 2K33A 1KDAA 3CC7A 4YCWA 2F0OA 2E2HB 5C4XH 1MBYA 4LF8L 2JXMB 3QB3A 4TSSA 4HIMA 4IPCA 5CV7A 5M5XB 1I4GA 2IL8A 5C3XA 3GTPB 1L1OA 4ALPA 3U50C 3R93A 2C35B 4P2CB 5IT9E 3OYYA 3G7LA 2OXPA 3BU2A 1J8IA 2UXBQ 3I4NG 3GDEA 5KNCA 5J39A 1WFQA 1D5XC 4YIJA 4CDFC 4GNXC 4GNXB 2JA9A 5IT9L 4JPBW 3HKZE 2B63G 2DY7A 4K2LA 1GO3E 4ZLTF 3M4OH 2K5DA 3EIVA 1PRTF 1EIYB 1Y69U 2B2VC 2F0UA 2QCPX 2F0HA 2NVXH 2WKCA 3NELA 3P7JA 3K57A 1AZQA 1YZ6A 1SYGA 3MXUA 2A6ED 1D5ZC 2HUGA 1EU4A 4ID6A 4J1MA 3S1RB 3J7AF 3PO2B 3PUZA 4JYAQ 4AQYL 2CVRA 2IPKD 2JQOA 5DNFA 5C5LA 2ES2A 1EL0A 2R93G 4DXGA 3FKIG 1KQSA 1Y1WB 1W6KA 2K75A 3NK9A 3I7FA 4BBRB 4OGQC 2WAQB 1PTOH 4LF6L 4A3MH 5LMUL 2ZJPA 1Q1EA 1SNPA 4KKTA 4DNIA 2F3WA 1W2BA 4DKAC 4M8AA 4A3LG 4OONA 3TP5A 4IPGA 3T1HL 1SFOH 3IFDA 1YBYA 2K28A 1CKNA 4KY7A 2R3ZA 3CCUA 1Y8PB 4YWKA 1LABA 4LJZC 4DK1A 3HZXA 2CFMA 4ABNA 5C5MA 3K0XA 2L12A 1HA6A 1BCPC 3DWQA 1BCPB 3H09A 3K80C 2K6AA 2VUMG 4OO1I 2PQAA 1Y14B 2NVXB 2IX0A 4YWLA 4Q0FA 1WVLA 1HUMA 3H3VH 2CWAA 2D0PA 1M4VA 4I7ZC 1EIGA 3J81c 3DEOA 2L55A 3HRZC 3G71A 1EY4A 3ONAB 1KLGD 4KTAA 3RMHA 2JA7G 2F0WA 4P71A 1FGBD 3S15B 1HR0L 2ZM6Q 1ENAA 1YNJC 1ZXTA 3SE0A 5FKAC 3GTOB 1UE7A 5IYCG 4R9WA 3K5OA 1F2ZA 4A75A 1STBA 5FO9B 5C4HA 3UDFA 3UDGA 3G48A 2A73B 4F87A 2EQSA 1SNOA 3AMUA 2CQOA 2NB0A 3KF6A 4V190 1PTOC 2F0QA 1PTOB 1GUTA 2ALYB 4A3MB 2RHSB 2DNCA 3Q23A 3BDLA 3MA2B 1TKWB 3ULJA 3CPFA 3UE1A 1A3TA 4NP5A 4C3JB 3EBEA 2Y0SB 1SFOB 4DV5L 2RDGA 2JA6G 4L5TA 1YNNC 1G291 3RZDH 1H9MA 1AEXA 2J0TD 5AFWA 1PH6A 3M4QA 4DV4Q 1LUZA 4RWSC 3NTIA 1QNKA 5EPLA 1HTLD 4K8IA 1N34Q 1XNRQ 3CCVA 1O80A 5IGGA 1ET9A 1X56A 2KENA 3VR5A 1Q82C 1E2WA 3NTHA 5HY6A 1K8GA 4G4KA 1BBXC 5ELFA 3H3VC 2HCCA 3V96A 2SOBA 1I6HH 1IL8A 2RHQB 1OTCA 3T56B 4YY3Q 3A8IE 4QIWE 3AEVA 1X54A 4NDXA 1HR0W 1BVSA 2KOLA 1E24A 3CMEA 2EYPA 1NUCA 2EZVA 3E0EA 4GNXA 3L7ZC 2IHEA 3PMFA 1PH2A 5FK9C 1NR4A 2R92G 1ASZA 5G3LF 1W3SA 2RSNA 1B1ZA 2KQ3A 2PPBC 1CKMA 3K7AB 4V0BA 2UUCL 1X3GA 1SBBB 4FDBA 4JI3L 4I65A 1SYDA 1BQQT 2JE6I 2KHJA 3I4LA 2B29A 2HDMA 4ZRZA 1XPUA 3NQIA 4KV6A 1Q90A 4DV6L 4GKJL 3H91A 4YWMA 1I6VC 3U4ZA 4BA1I 2VQFL 1L0WA 1T5EA 1XX8A 1N33Q 2KHSA 4GN5A 1TWCB 1GHJA 3TZUA 4DR7L 4NB3A 4QL5A 1NY4A 1LV9A 1RD9D 2B2WC 4DFAA 2NN6I 4HSPA 4JBWA 1N8RC 3W2DA 5ELCA 1TWAB 2BE5D 3RUZA 4JV5Q 4JI8L 5E4XA 2CWPA 4IUNA 1S5ED 1I6HB 1SROA 1E2ZA 2NWGA 3K0YA 4RCOA 5IIFA 2O2LD 4JI0L 2A8VA 1BXTA 1CTMA 2JJQA 3HP3A 3KLWA 1MGSA 2C5CA 1X3EA 2VB2X 2E74C 3GV6A 2WINB 1EY8A 4WFN3 5JJZA 4A3CH 4IQZA 4FF4A 1M8AA 4KN4C 3HOUH 3NWTA 2F0KA 1VQ5A 3TQYA 1IYVA 1VQAA 4LFBL 2D9UA 3WOEA 1CKOA 5J22A 1YIJA 1ESRA 2X69A 2AKWB 5KNBA 2CW0C 3MAQA 1GUWA 4ZK9B 2HT1A 3P75A 1A6XA 1BCPF 4H7BA 1CA5A 1QUQA 4PZ8A 1V1QA 1H9SB 1VQBA 2IX3A 4IFDH 2A69C 4IZ8A 4LF9Q 4BY7H 2QGQA 3RZOB 1TWGB 3I90A 2EDGA 2D62A 1YI2A 3NXWA 2R7DA 3GV3A 2L0CA 4NXNL 1QZHA 1CQVA 1EFWA 1EEID 1SE2A 3G6EA 4R8IA 1TY0A 5G3LD 4OL7A 3EN2A 2YU9H 1VDZA 3CMAA 3BG3A 4F88A 4DV2Q 1EQVA 5FLXE 4BBSB 4XIGS 2N78A 3D4WA 1E1TA 3L0OA 5JPMC 3UDIA 1H9JA 4WJ3M 3GTKB 1VQDA 1TIID 2K5VA 1PTOF 2F0PA 4DR1L 5LHY1 5TSSA 1A3UA 4K6DA 4KK7A 2RCNA 4A3KB 2K50A 4N9TA 2MJ8A 5EJWA 1FR3A 1O7ZA 4PZ6A 4IUTA 3HOUB 2OWOA 1CZWA 4XT3B 3S16H 3NENA 3IL8A 1S5BD 1QCBD 3GP7A 1SRUA 3I3CA 5COYA 4C56C 1DD2A 1ZKOA 3HKZG 3CCMA 4A3GH 3U9OA 3U9SA 1VMPA 2HD3A 5K36G 2R6GA 4DF7A 1TWFB 2UU9L 1NCVA 1IBKL 1EFID 2HIXA 5GADC 2HQLA 3C1EA 4OXPA 4KLKA 5C0XH 2NZ1D 4DA2A 3GTGB 2UXDQ 1WTPA 4JI7Q 2ICIA 4QJFA 1EUJA 5FJ8G 1G91A 4BY7B 4WORA 3PF4A 5CORA 4DXFA 1PH3A 1AE2A 2F0MA 4DR5Q 4A3JH 3M7NA 2YU9B 1QWYA 4R8NA 3CKIB 2UUAL 3TP7A 1CSPA 3D8GA 3AFQA 1UEAB 1R4PB 4RHSA 4DR3Q 1I94L 1VQ9A 2L1BA 1GVPA 3AB9A 1VQFA 3DEPA 1FL0A 2IW3A 3KOJA 3W3AA 4YCVA 1F9QA 2PO4A 4DR4Q 1UE5A 2QEXA 3NPPA 4JI1Q 2QKIC 1Q3LA 3S16B 3KK7A 1XWEA 3WDNA 5KEEA 1VQ7A 1B4OA 4JOIC 4A3FG 1E2VA 1V9PA 3I4NH 4A3GB 2EYHA 4G7OC 3H3VI 4R4QA 4R4CA 2DY8A 3R8BA 2EY5A 3HOVG 3RNUA 2KEDA 4WRDA 5M3MG 4UP8A 2K32A 3J81i 1A0IA 3WOFA 2FJ2A 1KLUD 4JCVE 5CR3A 1QNUA 4ILWA 1EWIA 4TKOB 3WWVA 2R7FA 3N6RA 2A68D 4CJ1B 1VQKA 3PUYA 1Z47A 3IFTA 1X55A 2K5QA 4JK1C 4A3DB 3HOXH 5K5PA 4DR6L 2RKSA 4PMWA 4C3HG 1QB5D 4S3SA 3FKIH 1B44D 4GZYC 3RN5A 3FRPB 1I4QA 1HQMC 4EQNA 1SMYC 2YTVA 1JB7A 1KTKA 3CW2C 4IPDA 2VNUD 4KN7C 2OQKA 4PV1C 1QVFA 4K5XA 1GUOA 1R4QB 4DU9A 3CD6A 1TVXA 2PMZB 4P75A 1X6OA 1HA5A 4A3LH 4EQPA 3UI2A 1D1KA 3TDQA 4BY1G 1S4ZA 3MFGA 2N8NA 4NW2A 5HGTA 3E9IA 3I4NB 1N32Q 3NBHB 2NYZD 3NUCA 4O1NA 4IALA 5IP7G 2NZHA 2BOSA 1A15A 4DV1L 3HOZG 2RSOA 1VQIA 4RGNA 3MWYW 1BBWA 3KFUA 3CP0A 4NPSA 4A3IG 1WTVA 2YTXA 4QCLA 1P8LA 1TS4A 5M3FB 4QF4A 5C44G 4HIDA 3MHBA 5KYLA 2FMMA 4MN3A 4QGUA 3LNNA 4IJHA 4M1UB 2M9VA 4OX9L 4L5RC 2K01A 3HOXB 2JA7H 1ET6A 1MSHA 1GUNA 1QJOA 2F52A 3Q22A 5IYDH 3FKIB 1SN8A 3QOJA 4FVMA 4A3BG 1RIPA 4TRDA 1EY6A 4B3RQ 5IYCH 2EYLA 3ND8A 4LAAA 4CDEC 4P74A 2EPBA 1ZYRD 1PFMA 4X3UA 3KJOA 1DOKA 1ESFA 2Q8IB 1B50A 3J7YW 1F77A 3H94A 4CDDC 2BE5C 2VL6A 1W6JA 3FPPA 2JEAI 4AYBE 1NJIC 3A5UA 3S14H 2MGSA 2XNAC 4ULLA 3E9HA 3CQZH 3R3OA 4NMZA 1GUSA 3GTQH 1AH9A 1GHKA 3JAML 1LACA 2F4VQ 1RTNA 1EU3A 2EYJA 1C0AA 3S1MH 3C3LA 5IY0A 1SE8A 1LTLA 3SHLA 1XMOL 5FO8B 3DHQA 4LF8Q 1TQOA 1LT6D 4POFA 3OHXC 5IP9H 2PZTA 1E3PA 3CCEA 1N36L 5DM63 2JA5H 3BDOA 3HGBA 3O13A 3MEFA 4JOIA 2LFNA 4DUYL 3I4OA 1KRSA 2Y0SE 2XVSA 4ZUJA 5C6AA 1XNQL 2KCCA 1VQHA 2ENBA 5M5WH 1STHA 1MJEA 5JEAJ 1HUNA 5CYUA 4QQBX 4EQOA 2K52A 3G4SA 1VQNA 1H9KA 3EQLC 5C4JH 2R92H 4KI0A 1PH9A 1NSNS 1PH4A 4LF5L 3S17B 1GD7A 1OXXK 2EXZA 1HXYD 4U673 2I5MX 4OIKA 1J6QA 2SDFA 2B8GA 2H4OA 4G7HC 2F0LA 4IFDI 3CPWA 4ZCKA 2WB1B 1STYA 4BXXH 1X3PA 3Q24A 5ELNA 4UAIA 2XWBB 1IBLQ 2K03A 3IAYA 1GKHA 5ELOA 3CQZB 3CRKC 3H6MA 3GTQB 3OPOA 4P73A 4DV3L 3M85A 2F1MA 2ZTDA 1ICFB 3GTMH 3S1MB 3S2HB 3ITPA 4ZQ3A 1Y1VG 1TY2A 3BYYB 3IKJA 1EYGA 3SDZA 1KAWA 1HJPA 5LMUQ 5EBDA 1EOTA 2MHVA 1Y8NB 2F0EA 2JA5B 5FLMG 4HIKA 2FXQA 1PZKD 2AQ1B 3U58A 1QVCA 4QB4A 1HNZL 3HOYG 3MFYA 1EWHA 3T1HQ 3A5ZB 1HNWL 3MXNB 2R7ZB 4XYQA 4YCUA 1WCMG 4L6TB 4J15A 1SDFA 3L3OC 3NBHA 2NVTH 3K58A 1CT1D 3CAMA 2OF1A 2MPMA 1WJJA 3ND9A 3FPUB 2R92B 5C4XB 4IJLA 1MKHA 3T13A 1PFBA 3PQIA 5C0XI 3VYUA 3Q8DA 4PNYA 1U4RA 2CQAA 3A56A 4JVZA 3HOWG 3Q6SA 3BZCA 2CKZB 4C1NK 1JE5A 1IW7D 2EIFA 4JW0A 1KXLA 3E3XA 1V1PA 2JEBI 1HR0Q 1STGA 4DK3C 1IZ6A 1V1OA 4BWGB 4HJ5A 4XYOA 4PMCA 1PH8A 3M4OB 2KECA 1KNEA 2IX1A 4IUQA 1EIFA 1C8CA 3PIO3 3KBGA 4JYAL 5IYBG 3C46A 4K6LA 3GQBA 3PCOB 4B3SL 2LY7A 2SEBD 5CC4A 1A3VA 1SYBA 5D14A 3K5MA 3SK4A 1Y8OB 4DV5Q 5EGTA 3HKSA 4FNFA 3K6OA 1QUQB 4CDCC 3ULLA 2EJMA 5CV8A 2F0FA 1VF7A 4HJ8A 4ZKBB 2OTLA 2XGTA 2QDLA 1I4PA 1JWUD 5AJ3L 1Z9FA 2UUBL 3TP6A 3GTLH 3T53B 1VS0A 2A68C 1MJCA 1WOCA 2JA8G 1ONLA 3BVZA 1WTXA 2A6HD 3J80c 2MNAA 1YNXA 2UXCL 3I91A 2NN6G 2PI2A 4EQ5A 3GO5A 1SAPA 1RTOA 3NP8A 3TS0A 1K28A 1HZAA 3C2PA 3NWSA 2BA1A 3CCLA 3JAMc 3VYSA 3MVVA 4K14A 3QIAA 3BYTB 1IBMQ 2ZTEA 1O7YA 5C0XJ 2EJGC 3X3NA 1B9MA 4Z9CB 3F2DA 2UUCQ 3M9BA 4JI3Q 1SNDA 1UNSA 3D3RA 3I70A 1HRJA 1XPOA 3TMEA 2G9HD 4DV6Q 4GKJQ 4IOAA 1LM0A 2M2LA 2VQFQ 1E0BA 1PXUA 3PSIA 1C9OA 4K2KA 3F2UA 1OXSC 5M5YH 3E6ZX 2SNMA 3TRZA 2PZWA 4DR7Q 2B2YA 3PO2G 2KEEA 3PIP3 2NTSA 4UHVA 2RF4A 4B08A 2H5XA 2OTJA 1F2YA 4KY6A 5I2YA 4JI2L 2E2JH 1KIXA 2AQ2B 4JI8Q 3MXPA 1S5CD 1Y1WG 4A3FH 1AW7A 1SYEA 4JBKA 2GN5A 4BBRG 3HKZB 2GVBA 4JI0Q 1IYJB 5I2XA 4GLVB 3MXNA 1RL2A 1KABA 2Z0SA 4X3TA 4ZKCB 4DV4L 4Y7NH 1PHJA 4DPGA 2EY2A 5E1FA 4J8QA 3S2DH 1N34L 3CHBD 3RZDB 4LFAL 4A93G 3HOVH 5J1ZA 5IT9c 3HS0C 1B3QA 5M3MH 3R2TA 3TP8A 1HCZA 3CXCA 4LFBQ 3KYHC 3OIQA 5CV9A 3VA7A 4C2MH 2E5LL 2DJFC 4X62L 5GAGC 3ER0A 4JI5L 5IODA 2R61A 3EFXD 5H1SE 2L4NA 4FF1A 2RCFA 4L63B 4C3HH 3KF8B 3A55A 1YITA 4A76A 3SR1A 1JE4A 4FXKC 2L11A 1JB3A 4QUFA 3TSSA 4HCSA 1UUPA 1NNXA 3DMUA 5E4WC 2N3SA 1PYSB 1EQTA 3OWEB 4A3EH 4FF2A 1KDCA 1PH7A 2F3VA 1XTDA 3M3YH 4P72A 4CKEA 4DR2L 4AYBG 3HG9A 5EKIA 1PVOA 4NXNQ 1KRTA 2KVMA 1NE3A 4NXML 2N88A 3I72A 1SSOA 1Z7TA 5D65A 3OW2A 1VQGA 4L8JA 2E2JB 4G57A 2ZXOA 1QE6A 1G2TA 3BJUA 3KLSX 4A3FB 1WD0A 1UWVA 4BY1H 4CJ0B 1JMCA 4RCNA 2JP1A 5EQ0A 4DV0L 4Y7NB 1I4HA 4DK0A 4DR1Q 2RDFA 1VQPA 1HH2P 4A3MG 5DAUA 3HOZH 1DM0B 3HOVB 1U0LA 4MTNA 2KA7A 2VY3A 4PQXA 4LF7L 4A3IH 3KDFB 1G51A 4C3JG 2Y0SG 2PNRC 2EY1A 4C2MB 1L2FA 1J5EL 3SXHA 3G6JB 3PO3H 1F9PA 1BUVT 4UDUC 2N49A 4OWTB 1J9OA 5LMNL 4QMGA 4U68A 4C3HB 2UU9Q 1MHWC 1K8OA 5ELBA 4OEMB 1IBKQ 2JSOA 4X66L 5KRUA 2M00A 1O7IA 4A4IA 3E0JA 4A3BH 4XDXA 4B3ML 5FLXL 1HFGA 2Q2IA 3TEHB 4JBJA 1XMQL 4A3EB 4DN4M 4UPAA 4POGA 1BO0A 1CM9A 2N55A 2F0SA 3CRLC 3M3YB 4HR7B 2TSSA 1HZBA 3NHHA 5T1GA 1JWMD 1LT5D 4FYDA 2A6EC 3OIPA 4UP9A 1HTPA 4ODGA 1SNMA 2F0GA 3J7ZC 2UUAQ 4R1JA 3K5NA 4BY1B 1PH1A 3PUWA 1EZ8A 1DXMA 1FNVA 1I94Q 2V1CC 4K5VA 4N8FA 1V43A 1VQEA 4ZAIA 2WP8J 5IWAL 2E2DC 1PH5A 3QOLA 2F3IA 5C4ZA 4A3IB 3OMCA 2OQ0A 1FVIA 3I55A 1U4MA 3N52A 4QIWB 1EY9A 4RKLA 1XTCD 2P5ZX 5LMNW
chains in the Genus database with same CATH topology
3PO3B 1ML0D 1ILPA 1TR5A 1PZJD 3NBIA 3D4RA 1PYWD 5D3DA 1B9NA 4A3BB 5CV4A 2F0JA 4K8JA 2EYOA 2IWHA 3MC0B 4XT1B 1JWSD 2E75C 3T51B 5JEAG 1B3AA 1AP0A 1JOOA 4PMBA 1KDBA 4H13C 1QOHA 2XWJB 2SNSA 1SE3A 3KF8A 3VYTA 4E6IA 1EY0A 4HEDA 2X6GA 1C48A 4RFBA 1OXUA 2RDHA 5ISRA 2L5TA 1CA6A 5IGFA 1EEFD 4A3JB 3VYRA 1K8MA 2JYOA 5DEHA 1AN8A 4HN7A 2C9OA 4DNRB 2RVLA 1RODA 2KUMA 1G2SA 3FMCA 1WD1A 3J7AV 1WTRA 3OOCA 1QG7A 2ID0A 2WIIB 4XQNA 1JQYD 1TT2A 3PUVA 1A2TA 1OXVA 2B63B 3QJYA 3EA6A 4H0LC 3T4AC 3SK5A 1ENFA 1AFPA 1WTWA 1Y1VB 1D2BA 2F03A 1V8QA 5A35A 1SYFA 4HMIA 1PMRA 3J81E 1V1PB 2PQEA 1BOSA 1CFMA 3QO2A 2R93B 1D5MC 4DAYA 1RCVD 1JOKA 3J81L 4XXEA 2F0IA 1T5XD 2F4IA 2BDOA 1U4LA 2J7ZA 1F2MA 3GD7A 3EROA 2EE1A 4F7XA 1ILQA 2KCNA 4XQJA 2ZT9C 4N9PA 5A2QE 4KJOA 2WKDA 2F0TA 1F9SA 3DWAA 3P20A 5A2QL 1AZPA 4KMUC 1I3QB 2FMCA 2VUMB 3D6CA 5C0XG 4ME5A 3L9AX 1LTBD 3FEWX 2RA4A 4FXGC 2JA7B 3LWUA 5JVH3 2ICEC 1LLRD 4RAUC 4KD4A 4HSVA 4KD3A 1PZID 3GTJB 3NQTA 2CW0D 5DM73 4HCEA 1JCKB 3ZYYX 4OO1G 1GXDC 1U4PA 3S14B 1HHVA 4MIUA 2Q8RE 4G7ZC 2A69D 4O42A 3A54A 4C1NI 1PLFA 3CU7A 2JA6B 5KNDA 5KGUA 2B2YC 1EY7A 1H9RA 3D4DA 1EYDA 2CHBD 1F2LA 2VXWA 1ENCA 2K04A 1GUGA 2QEJC 2LMCB 4XTCS 3S1QB 4FP5D 1C4QA 2V4DA 1JC7A 1S5FD 4TQUS 2DNEA 5I6YA 5M5WB 3LWEA 2OEOA 3P1HA 5C4JB 1RKNA 2BA0A 1TS3A 2HDLA 3K5LA 4DAVA 3DXJC 3OWFA 2HQEA 1X32A 1JICA 2PCFB 2WACA 2A5HA 3QWNA 5KIXA 3GTMB 1SYCA 1EYCA 5JVG3 1R9TB 1BNZA 4A93B 4Q5VA 4C3IG 4KY5A 2D5DA 2RQXA 2B8FA 4IFDJ 1EY5A 3S9WA 4IN3A 3FVQA 2L9HA 5BN4A 3R2IA 5JPNC 1LTGD 3MEHA 1EWCA 3OW7A 5D3IB 3A8KE 3PV0A 3TBIB 1GJXA 1HFNA 2NVTB 4MHEA 2PYKA 3TN2A 2Q8TA 1SXTA 5CV6A 4DNTB 5IGCA 3URYA 4AYBB 1SNQA 2WV6D 1O7LA 5JAVA 1FD7D 1LTSD 1VMCA 4X3SA 1EYAA 3EJIA 5K36H 1F9RA 2F0VA 4CBVA 1BR9A 5I9OA 1KAAA 2NTTA 1MSGA 1PDQA 1PRTD 4BS9A 2F0DA 2O5JC 2EYFA 4RGTA 1JORA 1LTTD 1RHPA 5CMDA 3I8ZA 2XRSD 2O4XA 2IJ0A 3BVGA 1U9RA 1ICWA 2E76C 1SMYD 5LL6S 3VR3A 4B9XA 3C1FA 1WTOA 2YYZA 2IT1A 2PW7A 1RJTA 5BN3A 3GTLB 5JEAH 4RH6A 4F8MA 1NAPA 1RF2D 2A74C 2FINB 2ZXRA 3V05A 5CBAE 3OSOA 2B2VA 3EVQA 2B39A 5CBEE 3K59A 2K05A 2PW5A 1SJHD 1ZYRC 1PFNA 1I50B 3KBXA 5E3FA 1Z6HA 2EY6A 4B9WA 2I46A 2DN8A 4HTHA 5EPJA 5IGDA 5CV5A 1G8ZD 5M5YB 1BF4A 3AU7A 1JR0D 4K5WA 2KJXA 2NBFA 3NTKA 1TS5A 3SEBA 1O78A 2AUJD 2OT2A 1ZEQX 3Q0AA 5IGBA 2EJFC 3S2DB 1VF5C 2K5WA 2MP1A 2EOTA 5EKLA 5M3MB 4IUUA 2AWOA 4EGVA 5EBCA 1DOMA 2EVBA 4KKUA 2BCOA 2LKVA 2Z8LA 4LK1C 3OMGA 2QDBA 5EPKA 4ZUIA 1IYUA 1I4RA 5I4DA 3VR4A 3MTSA 3SVMA 1SEBD 2K1BA 4DAPA 1LT3D 5FOBB 2X6LA 5F2DA 2K7VA 4LMQD 2TMPA 4X3KA 2LS01 3VR6A 3BDCA 1EZ6A 3BVMA 5I9PA 3KLRA 5EKKA 2BDNA 3RD4A 2H1EA 2ZXPA 1D6EC 2XSCA 2XN9C 3HOZB 1B2TA 1DZ1A 4IURA 1A2UA 2HCIA 1FNUA 3QG1A 2E2IB 2XRQD 1JOQA 1OXTA 4HMJA 5C44B 1SNCA 2FFKB 1RDPD 1IW7C 1B53A 1LTRD 2B2TC 2I07B 5NUCA 3X3MA 3A8JE 5I6WA 4RKBA 5IGEA 3LX0A 1CHPD 1NR2A 1BDOA 1WTQA 1LO5D 5FO7B 1STNA 4OO1H 4HAEA 1SJED 1BCPD 4CKCA 3PUXA 5IOCA 1DONA 2Z1CA 1L0YB 4J6HA 4DGZA 1LTAD 1EIHA 3NSWA 2B2WA 5M9OA 2F0NA 5C3EB 1DOLA 2B2UC 5HURA 3V2TA 2QF7A 3FDTA 2A6HC 1YNJD 3NE5B 3HEJA 4WJWA 3BZDB 1DJRD 1Q12A 5T1IA 3SK6A 1STEA 4BA2I 1DCZA 2QILA 1PTOD 3MZ5A 3D31A 3I4MB 1PRTC 1PRTB 1TWHB 5CGKA 1LTID 4H44C 5LL6X 4OHJA 1S5DD 3A7LA 4FF3A 1YNND 3RLFA 2AWNA 1H9SA 3M7GA 3ERQA 2FHTA 5C3WA 3H0GB 4KHVA 3DWPA 1SE4A 4IUVA 4ZYSA 4RA8A 3S1NB 1D1IA 1I4XA 3HOYB 3VA5A 2GA4B 4IFDG 1WCMB 3TZDA 3D6WA 1HQRD 2AQ3B 3KUPA 2J4XA 1IKMA 2NUCA 2XIWA 4EVOA 1GOZA 3MXGA 1II3A 2Z4HA 2NVQB 2RBMA 1HPCA 5ELDA 4CKBA 5ELEA 3VR2A 3HOWB 2G9DA 3KLSA 2NN6H 4KKSA 3J80E 4RGOS 2PZUA 1MD2D 2AUKA 1Q1BA 2B2TA 1MI2A 4IUPA 3J80L 4RHRA 3JAME 4QUCA 1KNAA 4OIJA 4CHTB 1L0XB 5BN5A 2Z4IA 4XQQA 1XYIA 4C3IB 1IKLA 4FO2A 2EYMA 3DM1A 4FXDA 5KYIA 1Q8IA 2MUYA 4NKLA 1QILA 1CI3M 1OO9B 2NVYB 3E5SA 2VB3X 4CJ2C 2D2CC 1UAPA 1CQFA 1XXGA 4RGMA 1G6ZA 1X3QA 3BS1A 1VCIA 3A7AB 2O5IC 1LT4D 3M4YA 1DYQA 4CGYB 1CZGA 5JOBA 3T16A 1CK1A 1TU2B 1TS2A 1CHQD 1IHZA 3I73A 2JA8B 3DUZA 2B2UA 1FNWA 3SK8A 1STAA 4KHZA 1K83B 4KJNA 1FYCA 2K33A 1KDAA 2E2HB 2F0OA 1MBYA 2JXMB 3QB3A 4TSSA 5CV7A 5M5XB 1I4GA 2IL8A 5C3XA 3GTPB 3R93A 4P2CB 5IT9E 3G7LA 2OXPA 1J8IA 5KNCA 5J39A 1D5XC 4YIJA 5IT9L 2DY7A 4K2LA 4ZLTF 2K5DA 1PRTF 1Y69U 2B2VC 2F0UA 2QCPX 2F0HA 2WKCA 3P7JA 3K57A 1AZQA 1SYGA 3MXUA 2A6ED 1D5ZC 2HUGA 1EU4A 4ID6A 4J1MA 3S1RB 3J7AF 3PO2B 3PUZA 2CVRA 2IPKD 5C5LA 5DNFA 1EL0A 4DXGA 1Y1WB 1W6KA 3NK9A 4BBRB 4OGQC 2WAQB 1PTOH 1Q1EA 1SNPA 4KKTA 2F3WA 4M8AA 3TP5A 3IFDA 2K28A 4KY7A 2R3ZA 1Y8PB 1LABA 4LJZC 4DK1A 3HZXA 4ABNA 5C5MA 2L12A 1HA6A 1BCPC 3DWQA 1BCPB 3H09A 2K6AA 4OO1I 2NVXB 2IX0A 4Q0FA 1WVLA 1HUMA 1M4VA 4I7ZC 1EIGA 3DEOA 2L55A 3HRZC 1EY4A 3ONAB 1KLGD 4KTAA 3RMHA 2F0WA 1FGBD 3S15B 1ENAA 1YNJC 1ZXTA 3SE0A 5FKAC 3GTOB 4R9WA 3K5OA 1F2ZA 1STBA 5FO9B 5C4HA 2A73B 4F87A 1SNOA 3AMUA 2NB0A 4V190 1PTOC 2F0QA 1PTOB 1GUTA 4A3MB 2DNCA 3Q23A 3BDLA 3MA2B 1TKWB 1A3TA 4NP5A 4C3JB 2Y0SB 1SFOB 2RDGA 1YNNC 1G291 1H9MA 1AEXA 2J0TD 5AFWA 4RWSC 3NTIA 1QNKA 5EPLA 1HTLD 4K8IA 1O80A 5IGGA 1ET9A 3VR5A 1E2WA 3NTHA 4G4KA 1BBXC 5ELFA 3H3VC 2HCCA 3V96A 2SOBA 1IL8A 3T56B 3A8IE 4NDXA 2KOLA 2EYPA 1NUCA 2EZVA 3L7ZC 3PMFA 5FK9C 1NR4A 5G3LF 2RSNA 1B1ZA 2KQ3A 2PPBC 3K7AB 4V0BA 1SBBB 4I65A 1SYDA 1BQQT 2JE6I 3I4LA 2HDMA 4ZRZA 3NQIA 4KV6A 1Q90A 3H91A 1I6VC 4BA1I 1T5EA 1XX8A 2KHSA 1TWCB 1GHJA 3TZUA 1LV9A 1RD9D 2B2WC 4DFAA 2NN6I 4HSPA 4JBWA 3W2DA 5ELCA 1TWAB 2BE5D 3RUZA 5E4XA 4IUNA 1I6HB 1S5ED 1E2ZA 2NWGA 3K0YA 4RCOA 5IIFA 2O2LD 1BXTA 1CTMA 3HP3A 1MGSA 2C5CA 2VB2X 2E74C 3GV6A 2WINB 1EY8A 4WFN3 5JJZA 4IQZA 4FF4A 1M8AA 4KN4C 3NWTA 2F0KA 1IYVA 2D9UA 3WOEA 5J22A 1ESRA 2X69A 5KNBA 2CW0C 3MAQA 1GUWA 4ZK9B 3P75A 1A6XA 1BCPF 4H7BA 1CA5A 1H9SB 2IX3A 4IFDH 2A69C 4IZ8A 3RZOB 1TWGB 3I90A 2EDGA 2D62A 3NXWA 3GV3A 2L0CA 1CQVA 1EEID 1SE2A 4R8IA 1TY0A 5G3LD 4OL7A 1VDZA 3BG3A 4F88A 1EQVA 5FLXE 4BBSB 4XIGS 3D4WA 5JPMC 1H9JA 3GTKB 1TIID 1PTOF 2F0PA 5LHY1 5TSSA 1A3UA 4K6DA 4KK7A 4A3KB 4N9TA 2MJ8A 5EJWA 1FR3A 1O7ZA 4IUTA 3HOUB 1CZWA 4XT3B 3IL8A 1S5BD 1QCBD 3GP7A 3I3CA 5COYA 4C56C 1DD2A 1ZKOA 3U9OA 3U9SA 1VMPA 5K36G 2R6GA 4DF7A 1TWFB 1NCVA 1EFID 3C1EA 5C0XH 2NZ1D 4DA2A 3GTGB 1WTPA 2ICIA 1G91A 4BY7B 4WORA 5CORA 4DXFA 2F0MA 3M7NA 2YU9B 1QWYA 4R8NA 3CKIB 3TP7A 3D8GA 1UEAB 1R4PB 4RHSA 2L1BA 3AB9A 3DEPA 2IW3A 3W3AA 1F9QA 2PO4A 3NPPA 2QKIC 1Q3LA 3S16B 3KK7A 1XWEA 3WDNA 5KEEA 1B4OA 1E2VA 4A3GB 2EYHA 4G7OC 2DY8A 3R8BA 2EY5A 2KEDA 4WRDA 2K32A 3WOFA 2FJ2A 1KLUD 5CR3A 1QNUA 4ILWA 4TKOB 3N6RA 2A68D 4CJ1B 3PUYA 1Z47A 3IFTA 2K5QA 4JK1C 4A3DB 5K5PA 2RKSA 4PMWA 4C3HG 1QB5D 4S3SA 1B44D 4GZYC 3FRPB 4EQNA 1I4QA 1HQMC 1SMYC 1KTKA 2VNUD 4KN7C 4PV1C 4K5XA 1GUOA 1R4QB 4DU9A 1TVXA 2PMZB 1HA5A 4EQPA 3UI2A 1D1KA 3TDQA 1S4ZA 3MFGA 5HGTA 4NW2A 3I4NB 2NYZD 3NUCA 4O1NA 4IALA 2BOSA 1A15A 2RSOA 4RGNA 3MWYW 1WTVA 4QCLA 1TS4A 5M3FB 4QF4A 3MHBA 5KYLA 2FMMA 4MN3A 3LNNA 4M1UB 2M9VA 2K01A 3HOXB 1ET6A 1MSHA 1GUNA 1QJOA 3Q22A 3FKIB 3QOJA 4FVMA 4TRDA 1EY6A 2EYLA 3ND8A 4LAAA 2EPBA 1ZYRD 1PFMA 4X3UA 1DOKA 1ESFA 2Q8IB 1B50A 3J7YW 1F77A 3H94A 2BE5C 1W6JA 3FPPA 2JEAI 2MGSA 2XNAC 4ULLA 3R3OA 4NMZA 1GUSA 1GHKA 3JAML 1LACA 1RTNA 1EU3A 2EYJA 3C3LA 3SHLA 5FO8B 3DHQA 1TQOA 1LT6D 3OHXC 2PZTA 5DM63 3BDOA 3HGBA 3O13A 2LFNA 2XVSA 4ZUJA 5C6AA 2KCCA 2ENBA 1STHA 1HUNA 5JEAJ 5CYUA 4EQOA 1H9KA 3EQLC 4KI0A 1NSNS 3S17B 1OXXK 2EXZA 1HXYD 4U673 4OIKA 2SDFA 2B8GA 2H4OA 4G7HC 2F0LA 4IFDI 2WB1B 1STYA 1X3PA 3Q24A 4UAIA 2XWBB 2K03A 3IAYA 3CQZB 3CRKC 3H6MA 3GTQB 3OPOA 3M85A 2F1MA 3S1MB 3S2HB 3ITPA 4ZQ3A 1TY2A 3BYYB 3IKJA 3SDZA 5EBDA 1EOTA 2MHVA 1Y8NB 2F0EA 2JA5B 1PZKD 2AQ1B 4QB4A 3MFYA 1EWHA 2R7ZB 4XYQA 4L6TB 1SDFA 3L3OC 3NBHA 3K58A 1CT1D 2OF1A 2MPMA 3ND9A 3FPUB 2R92B 5C4XB 3T13A 1PFBA 5C0XI 3VYUA 4PNYA 1U4RA 2CQAA 3A56A 3Q6SA 4C1NK 1IW7D 1V1PA 2JEBI 1STGA 1V1OA 4BWGB 4XYOA 4PMCA 3M4OB 2KECA 1KNEA 2IX1A 4IUQA 1C8CA 3PIO3 3KBGA 3C46A 4K6LA 3GQBA 2LY7A 2SEBD 5CC4A 1A3VA 1SYBA 5D14A 3K5MA 3SK4A 1Y8OB 5EGTA 4FNFA 3K6OA 2EJMA 5CV8A 2F0FA 1VF7A 4ZKBB 1I4PA 1JWUD 3TP6A 3T53B 2A68C 1ONLA 3BVZA 1WTXA 2A6HD 3I91A 2NN6G 3GO5A 1SAPA 1RTOA 3NP8A 3C2PA 3NWSA 2BA1A 3VYSA 3MVVA 4K14A 3QIAA 3BYTB 1O7YA 5C0XJ 2EJGC 3X3NA 1B9MA 4Z9CB 1SNDA 1UNSA 3D3RA 3I70A 1HRJA 3TMEA 2G9HD 2M2LA 1E0BA 1PXUA 4K2KA 3F2UA 1OXSC 3E6ZX 2SNMA 2PZWA 2B2YA 2KEEA 3PIP3 2NTSA 4B08A 1F2YA 4KY6A 5I2YA 2AQ2B 1S5CD 3MXPA 1AW7A 1SYEA 3HKZB 5I2XA 3MXNA 1KABA 4X3TA 4ZKCB 2EY2A 5E1FA 4J8QA 3CHBD 3RZDB 5J1ZA 3HS0C 3R2TA 3TP8A 1HCZA 3OIQA 5CV9A 3VA7A 5IODA 2R61A 3EFXD 2L4NA 4FF1A 4L63B 3A55A 3SR1A 1JE4A 4FXKC 2L11A 1JB3A 4QUFA 3TSSA 4HCSA 1UUPA 3DMUA 5E4WC 1EQTA 3OWEB 4FF2A 1KDCA 2F3VA 4CKEA 3HG9A 5EKIA 2KVMA 2N88A 3I72A 1SSOA 1Z7TA 5D65A 4L8JA 2E2JB 4G57A 2ZXOA 1QE6A 1G2TA 3KLSX 4A3FB 1WD0A 4CJ0B 4RCNA 2JP1A 5EQ0A 4Y7NB 4DK0A 1I4HA 2RDFA 5DAUA 1DM0B 3HOVB 2KA7A 4PQXA 4C3JG 2PNRC 2EY1A 4C2MB 3SXHA 3G6JB 1F9PA 1BUVT 4UDUC 1J9OA 4QMGA 4U68A 4C3HB 1K8OA 5ELBA 2JSOA 5KRUA 2M00A 3E0JA 4XDXA 5FLXL 1HFGA 4A3EB 4DN4M 1BO0A 1CM9A 2N55A 2F0SA 3CRLC 3M3YB 4HR7B 2TSSA 5T1GA 3NHHA 1JWMD 1LT5D 4FYDA 2A6EC 3OIPA 1HTPA 4ODGA 1SNMA 2F0GA 3K5NA 4BY1B 3PUWA 1EZ8A 1DXMA 1FNVA 4K5VA 1V43A 4ZAIA 2WP8J 2E2DC 3QOLA 5C4ZA 4A3IB 3OMCA 1U4MA 3N52A 4QIWB 1EY9A 4RKLA 1XTCD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NP8 A;  3QOJ A;  4IZ8 A;  2F0E A;  4NKL A;  1TR5 A;  4TRD A;  1EY6 A;  4NDX A;  5EKK A;  3SK5 A;  2EYL A;  4LAA A;  5CGK A;  1SNP A;  3E5S A;  2EYP A;  2F3W A;  1NUC A;  3NXW A;  3MVV A;  2EYH A;  2PYK A;  4MIU A;  4QB4 A;  4G57 A;  4K14 A;  5CV6 A;  3TP5 A;  2EY5 A;  3PMF A;  4OL7 A;  5IGC A;  1SNQ A;  5E3F A;  1A2U A;  1SYF A;  1EQV A;  4HMI A;  5KGU A;  2EY6 A;  5CV4 A;  2F0J A;  5JAV A;  4WRD A;  2KQ3 A;  4KY7 A;  4B9W A;  4K8J A;  2PQE A;  1EY7 A;  1SND A;  2OF1 A;  1EYA A;  3D4W A;  2EYO A;  1JOQ A;  3D4D A;  4HTH A;  5IGD A;  1EYD A;  3HZX A;  1SNC A;  3EJI A;  3R3O A;  2RDF A;  4HMJ A;  4NMZ A;  5CR3 A;  5CV5 A;  5C5M A;  4I65 A;  1SYD A;  5JOB A;  3T16 A;  3ERQ A;  5DAU A;  3TME A;  5C3W A;  2F0P A;  1IHZ A;  1JOO A;  1ENC A;  2EYJ A;  2F0V A;  4PMB A;  1A3U A;  1KDB A;  4K6D A;  3T13 A;  1JOK A;  4KV6 A;  4K5W A;  3SHL A;  4N9T A;  4PNY A;  2F0I A;  3SK8 A;  5K5P A;  4KHV A;  5I9O A;  1STA A;  2RKS A;  2SNS A;  4KJN A;  1KAA A;  4E6I A;  3DHQ A;  1EY0 A;  4K2K A;  1TQO A;  1KDA A;  5NUC A;  2EY1 A;  2F0O A;  1F2M A;  2SNM A;  4S3S A;  2KHS A;  1EY4 A;  2F0D A;  2PZW A;  2EYF A;  3SXH A;  2PZT A;  3ERO A;  3QB3 A;  4KTA A;  4F7X A;  1JOR A;  2F0W A;  1STG A;  5I6W A;  4EQN A;  5CV7 A;  5I6Y A;  4QMG A;  1F2Y A;  4KY6 A;  4RKB A;  3U9O A;  3VA5 A;  5C3X A;  5IGB A;  3LX0 A;  5IGE A;  1ENA A;  4N9P A;  2O4X A;  4DFA A;  4DF7 A;  5KRU A;  4K5X A;  5ISR A;  2M00 A;  2OEO A;  3P1H A;  4PMC A;  3RUZ A;  1RKN A;  1U9R A;  2OXP A;  3MXP A;  4KJO A;  4DU9 A;  1F2Z A;  1SYE A;  2F0T A;  4ZUJ A;  3C1E A;  5C6A A;  2NUC A;  1STB A;  1STN A;  4EVO A;  5C4H A;  5EKL A;  4IUN A;  4B9X A;  3C1F A;  5IGF A;  1SNO A;  5J39 A;  2ENB A;  1II3 A;  4YIJ A;  1STH A;  1KAB A;  2F0Q A;  3OWF A;  5DEH A;  2HQE A;  2F0S A;  4EQP A;  5IIF A;  2EY2 A;  2LKV A;  5E1F A;  4EQO A;  5IOC A;  2RBM A;  4K2L A;  3OMG A;  4WOR A;  3BDL A;  3NHH A;  5CC4 A;  4J6H A;  4DGZ A;  2QDB A;  5HGT A;  1NSN S;  1A3V A;  1SYB A;  4ZUI A;  5J1Z A;  3SK4 A;  4ODG A;  2PW7 A;  2EXZ A;  2F0M A;  3NUC A;  1SNM A;  2F0G A;  2F0U A;  1A3T A;  2F0H A;  4IAL A;  4NP5 A;  5EGT A;  2WAC A;  3TP8 A;  3D6C A;  1EY8 A;  5KIX A;  5M9O A;  1SYG A;  4R8N A;  5CV8 A;  2F0L A;  2F0F A;  1SYC A;  2F0N A;  1EYC A;  4ID6 A;  2PZU A;  4ME5 A;  5CV9 A;  4J1M A;  2F0K A;  1EZ8 A;  1STY A;  3TP7 A;  1AEX A;  3D8G A;  4F8M A;  4KY5 A;  4K5V A;  5HUR A;  5IOD A;  3V2T A;  5C5L A;  5J22 A;  4QF4 A;  5F2D A;  3H6M A;  4K8I A;  3HEJ A;  3MHB A;  1EY5 A;  5KYL A;  3TP6 A;  3S9W A;  3SR1 A;  3SK6 A;  5IGG A;  3QOL A;  4KD4 A;  3P75 A;  5C4Z A;  3OSO A;  3OMC A;  3ITP A;  3NK9 A;  4KD3 A;  3BDC A;  4H7B A;  3EVQ A;  4ZQ3 A;  2EYM A;  1TT2 A;  2SOB A;  3MEH A;  1A2T A;  1EY9 A;  3DMU A;  3MZ5 A;  4RKL A;  2PW5 A;  3NQT A;  1EZ6 A;  5KYI A;  1KDC A;  5I9P A;  5KEE A;  2F3V A; 
#chains in the Genus database with same CATH topology
 3PO3 B;  1ML0 D;  1ILP A;  1TR5 A;  1A63 A;  1PZJ D;  3NBI A;  4KHP L;  3D4R A;  1PYW D;  1D8L A;  5D3D A;  1B9N A;  4A3B B;  1TWH H;  5CV4 A;  2F0J A;  4K8J A;  1PA6 A;  2EYO A;  2IWH A;  3MC0 B;  4XT1 B;  1H95 A;  3PIO A;  1JWS D;  2E75 C;  3T51 B;  5BR8 L;  1VQL A;  1U5K A;  5JEA G;  1B3A A;  1AP0 A;  1JOO A;  3OTO L;  4PMB A;  4DR6 Q;  1KDB A;  4H13 C;  1QOH A;  4OEL B;  2XWJ B;  3UE0 A;  2SNS A;  1SE3 A;  3KF8 A;  3VYT A;  4E6I A;  2HHH L;  1EY0 A;  2K4K A;  2VQE L;  2B63 H;  2ATW A;  4HED A;  2X6G A;  2B3G A;  5HGQ A;  1C48 A;  1Q81 C;  4RFB A;  1S40 A;  1Y1V H;  1OXU A;  2RDH A;  5ISR A;  3KJP A;  2L5T A;  5FLM H;  1CA6 A;  3S1N H;  5IGF A;  1EEF D;  4LUZ A;  4A3J B;  3VYR A;  1K8M A;  2JYO A;  5DEH A;  4DAM A;  1AN8 A;  4O2D A;  1VQ4 A;  1E22 A;  4HN7 A;  2R93 H;  2C9O A;  4DNR B;  2RVL A;  1ROD A;  4N8X 1;  4DV1 Q;  2KUM A;  1G2S A;  3ZJY C;  3J80 i;  4HIO A;  4I7A A;  4X64 Q;  4B3T L;  3FMC A;  1BKB A;  4BBS G;  1WD1 A;  4K0K L;  3KDF A;  3J7A V;  1JT8 A;  2VZA A;  3OOC A;  1WTR A;  1N9W A;  3ICE A;  1YVC A;  4PG3 A;  3JAM i;  4OX9 Q;  1QG7 A;  2ID0 A;  2WII B;  1GM5 A;  4XQN A;  2MO0 A;  3K7U C;  1JQY D;  4A3K G;  1TT2 A;  3PUV A;  1A2T A;  2ZJQ A;  1HZ9 A;  2CH4 W;  1K73 C;  3HOU G;  1OXV A;  2B63 B;  3QJY A;  2EXD A;  3EA6 A;  4H0L C;  3T4A C;  3SK5 A;  2WAQ E;  1I3Q H;  1KHI A;  1ENF A;  1AFP A;  1WTW A;  2HIV A;  1Y1V B;  1D2B A;  4L5Q A;  2F03 A;  2VUM H;  3PIP A;  5IE8 A;  1V8Q A;  5A35 A;  2AMC B;  2KBN A;  1FJG L;  1VQ8 A;  1SYF A;  4HMI A;  2QW7 A;  1PMR A;  1YEZ A;  1V1P B;  2PQE A;  3J81 E;  2NVY H;  1BOS A;  4DV7 L;  1CFM A;  3QO2 A;  2R93 B;  4LF4 L;  1D5M C;  3K81 C;  4DAY A;  4GKK L;  1RCV D;  4BY7 G;  3CCS A;  2DJG C;  1JOK A;  3M4P A;  4UY8 C;  3J81 L;  4XXE A;  2D0O A;  3T1Y L;  2F0I A;  1T5X D;  2F4I A;  2Q2T A;  2KCM A;  2BDO A;  5FLX c;  1U4L A;  3GTJ H;  1N36 Q;  2IY5 B;  2J7Z A;  1F2M A;  3GD7 A;  4X65 L;  3ERO A;  2JA8 H;  2EE1 A;  4F7X A;  1ILQ A;  2KCN A;  4XQJ A;  2ZT9 C;  1HNX Q;  4DUY Q;  1IL2 A;  1B7Y B;  1K83 H;  4N9P A;  2JN4 A;  4RG1 A;  5A2Q E;  2ZJR A;  1X9N A;  3FP9 A;  1EQQ A;  4KJO A;  2E2H H;  2WKD A;  2F0T A;  3HFZ B;  2JA6 H;  3JC6 6;  1F9S A;  3DWA A;  3P20 A;  5M5X H;  2K5H A;  3GTP H;  4JI4 L;  5A2Q L;  1AZP A;  4KMU C;  4LF5 Q;  1I3Q B;  2FMC A;  2Q2U A;  4TVA B;  2OCE A;  5C3E G;  2VUM B;  4JI6 L;  3D6C A;  4DUZ L;  3S1Q H;  5C0X G;  4ME5 A;  3L9A X;  1LTB D;  3FEW X;  2RA4 A;  4FXG C;  4DK6 C;  2JA7 B;  3LWU A;  2ZTC A;  1I5F A;  5JVH 3;  1YHA A;  2ICE C;  1LLR D;  4RAU C;  3I4M G;  4KD4 A;  4HSV A;  3S1R H;  4KD3 A;  4A3D G;  1PZI D;  3GTJ B;  3NQT A;  2CW0 D;  1C7Y A;  1NMF A;  1VQM A;  5DM7 3;  4HCE A;  3W1B A;  1G6P A;  1JCK B;  1HNZ Q;  4LWC A;  4LUV A;  3ZYY X;  1Y1W H;  4AQY Q;  1ASY A;  4OO1 G;  3STB D;  1GXD C;  1HNW Q;  1U4P A;  4BBR H;  3S14 B;  4X6A H;  1HHV A;  4MIU A;  4YHH L;  2Q8R E;  4G7Z C;  2A69 D;  4O42 A;  3A54 A;  4C1N I;  2CCZ A;  1PLF A;  3CU7 A;  2JA6 B;  1UEB A;  5KND A;  4R4I A;  5KGU A;  2B2Y C;  3H0G G;  3LGJ A;  1R9T H;  4A93 H;  1EY7 A;  1H9R A;  3D4D A;  1EYD A;  2QA4 A;  4LF6 Q;  2CHB D;  5DLQ E;  1F2L A;  2VXW A;  1ENC A;  2A19 A;  2K04 A;  3L2P A;  1GUG A;  4LFC L;  2QEJ C;  1K9M C;  2LSS A;  2BH8 A;  2LMC B;  4GLA C;  4XTC S;  3S1Q B;  4FP5 D;  1VQJ A;  1C4Q A;  4QY7 A;  2V4D A;  1JC7 A;  1S5F D;  4TQU S;  2DNE A;  5I6Y A;  5M3F G;  5M5W B;  1Q86 C;  3F1Z A;  3LWE A;  2KCT A;  2OEO A;  3P1H A;  1SR3 A;  5C4J B;  1RKN A;  2BA0 A;  3HOX G;  1TS3 A;  2HDL A;  2UXB L;  1IBL L;  3K5L A;  4B3S Q;  3S15 H;  4DAV A;  3DXJ C;  3OWF A;  2HQE A;  1SLJ A;  3GTO H;  4UP7 A;  1X32 A;  1JIC A;  2PCF B;  1VQO A;  1UE6 A;  1T9H A;  2WAC A;  3IRB A;  2A5H A;  1VQC A;  3QWN A;  5KIX A;  1XJV A;  1SYC A;  3GTM B;  1EYC A;  5JVG 3;  1XPR A;  5AJ3 Q;  1R9T B;  1BNZ A;  4A93 B;  4Q5V A;  4C3I G;  4KY5 A;  3CC2 A;  2D5D A;  2RQX A;  2UUB Q;  2B8F A;  4IFD J;  1K0R A;  4C3J H;  3F8T A;  1EY5 A;  3S9W A;  1E1O A;  3PF5 A;  1CUK A;  4IN3 A;  2UXC Q;  4R4O A;  3FVQ A;  2L9H A;  5BN4 A;  1YJN A;  4LNQ A;  3R2I A;  5JPN C;  2JK8 A;  1LTG D;  3MEH A;  3I56 A;  2YTY A;  1EWC A;  3OW7 A;  5D3I B;  3A8K E;  3PV0 A;  3TBI B;  4GN3 B;  1GJX A;  1HFN A;  3J81 j;  2NVT B;  4MHE A;  1NMG A;  4GOP A;  2PYK A;  3TN2 A;  2Q8T A;  2MQH A;  1SXT A;  5CV6 A;  2Z6K A;  4DNT B;  5IGC A;  2K5N A;  3URY A;  4AYB B;  1SNQ A;  2WV6 D;  1KL9 A;  3S24 A;  1O7L A;  5JAV A;  1NTG A;  1FD7 D;  1LTS D;  1VMC A;  3AQQ A;  4X3S A;  4GS3 A;  5IYD G;  1EYA A;  3EJI A;  5JJL A;  5K36 H;  1F9R A;  1K0S A;  2F0V A;  4CBV A;  3RN2 A;  4ME3 A;  3TRE A;  4LUO A;  1YJW A;  1BR9 A;  5I9O A;  3K7A H;  4AIM A;  5JJI A;  1KAA A;  2NTT A;  1MSG A;  1PDQ A;  1PRT D;  4BS9 A;  2F0D A;  2WB1 G;  3K8A A;  2O5J C;  2EYF A;  5FJ8 H;  4RGT A;  4JI2 Q;  1JOR A;  1LTT D;  4O0A A;  1RHP A;  5CMD A;  3I8Z A;  2XRS D;  2CH4 A;  2O4X A;  2IJ0 A;  3BVG A;  1BBU A;  1I50 H;  1U9R A;  2ZM6 L;  1ICW A;  2E76 C;  2XTI A;  1SMY D;  5LL6 S;  1TWC H;  4OWW B;  2I0Q A;  3VR3 A;  4B9X A;  3C1F A;  1WTO A;  2YYZ A;  1WYD A;  4LFA Q;  5J3B A;  5IP9 G;  3CCJ A;  1TWA H;  2MFI A;  2JA5 G;  1B70 B;  2IT1 A;  2MO1 A;  2PW7 A;  1DGS A;  1P16 A;  1RJT A;  2R7Z G;  5BN3 A;  3GTL B;  2E5L Q;  4X62 Q;  4JI5 Q;  5JEA H;  4RH6 A;  4F8M A;  2KHI A;  1Q46 A;  1NAP A;  1RF2 D;  2A74 C;  1KC8 C;  2FIN B;  2ZXR A;  3V05 A;  2WAQ G;  5C4X G;  3F2C A;  1IBM L;  5CBA E;  3OSO A;  1XNR L;  2B2V A;  2LXJ A;  1CSQ A;  3EVQ A;  2B39 A;  5CBE E;  3K59 A;  2K05 A;  4DR2 Q;  2PW5 A;  1SJH D;  1PFS A;  4NXM Q;  1ZYR C;  1PFN A;  4BXX G;  2WFW A;  4YY3 L;  2GVA A;  1I50 B;  3KBX A;  5E3F A;  1Z6H A;  4DV0 Q;  2EY6 A;  4B9W A;  3RZO H;  1TWG H;  1NBW A;  2I46 A;  2DN8 A;  1M90 C;  4HTH A;  5EPJ A;  5IGD A;  5CV5 A;  1G8Z D;  5M5Y B;  4IPH A;  4LF7 Q;  1BF4 A;  3TS2 A;  3AU7 A;  1HZC A;  1JR0 D;  4BBS H;  4K5W A;  3CC4 A;  2KJX A;  1J5E Q;  2NBF A;  3NTK A;  3H15 A;  3GTK H;  1TS5 A;  3SEB A;  5LMN Q;  1O78 A;  2AUJ D;  2OT2 A;  1N33 L;  3D0F A;  3RLN A;  4A3K H;  1A8V A;  1ZEQ X;  4X66 Q;  3Q0A A;  1WTH A;  5IGB A;  2EJF C;  5IP7 H;  3S2D B;  4B3M Q;  3AYH B;  1VF5 C;  1X3F A;  1XMQ Q;  2K5W A;  4GLX A;  2MP1 A;  2EOT A;  5EKL A;  4JV5 L;  3A74 A;  5M3M B;  4IUU A;  2AWO A;  4EGV A;  5EBC A;  2E2I H;  1DOM A;  2EVB A;  2DGY A;  4KKU A;  2BCO A;  2PMZ E;  5E7N A;  2LKV A;  5C44 H;  3RLO A;  1TWF H;  4R4T A;  2Z8L A;  4LK1 C;  3OMG A;  2QDB A;  5EPK A;  4ZUI A;  1IYU A;  1I4R A;  3STB C;  5I4D A;  3VR4 A;  3GTG H;  3AFP A;  3MTS A;  3SVM A;  1JJG A;  1MIU A;  2AHO B;  4Y52 H;  1SEB D;  2K1B A;  3UDX A;  4DAP A;  3ULP A;  1LT3 D;  5FOB B;  1Q8K A;  2X6L A;  5F2D A;  5IWA Q;  2K7V A;  4LMQ D;  4HJ7 A;  1PYB A;  2TMP A;  1FGU A;  4X3K A;  3DM3 A;  2LS0 1;  3VR6 A;  1WI5 A;  1A62 A;  3BDC A;  1EZ6 A;  2ASB A;  3BVM A;  5I9P A;  5JJK A;  3KLR A;  4KHP Q;  4DAY B;  5EKK A;  2BDN A;  3RD4 A;  2H1E A;  3FHW A;  2ZXP A;  4LF9 L;  1D6E C;  2XSC A;  2XN9 C;  4APV A;  5GAE C;  3HOZ B;  2VS1 A;  3ERS X;  1B2T A;  1DZ1 A;  4IUR A;  1A2U A;  2HCI A;  1FNU A;  1E7Z A;  5C3E H;  3QG1 A;  2E2I B;  4DV2 L;  1UE1 A;  2XRQ D;  1JOQ A;  5BR8 Q;  1OXT A;  4HMJ A;  5C44 B;  1SNC A;  2FFK B;  3OTO Q;  3VDY A;  1RDP D;  2I5H A;  2IHF A;  1IW7 C;  1B53 A;  2PNH A;  2HHH Q;  1LTR D;  2E8G A;  2VQE Q;  2B2T C;  2I07 B;  1M1K C;  5NUC A;  1TXY A;  2LXK A;  3X3M A;  4AH6 A;  3I4M H;  3CCQ A;  4L5S A;  3CF5 A;  1IXR A;  3A8J E;  5I6W A;  4H02 A;  2BH2 A;  4A3D H;  4RKB A;  5IGE A;  3LX0 A;  5L37 A;  1SMX A;  1CHP D;  5GAH C;  1NR2 A;  1BDO A;  1WTQ A;  1LO5 D;  2PI2 E;  3CCR A;  5FO7 B;  1STN A;  4OO1 H;  2Q2H A;  2K14 A;  4GN4 B;  4HAE A;  3RR5 A;  1EOV A;  1SJE D;  1BCP D;  4CKC A;  3PUX A;  5EAY A;  5IOC A;  2UXD L;  4JI7 L;  1DON A;  4MNO A;  2Z1C A;  1L0Y B;  4J6H A;  4DGZ A;  1LTA D;  3H0G H;  1EIH A;  3NSW A;  2B2W A;  4B3T Q;  5M9O A;  2F0N A;  4DR5 L;  4K0K Q;  5C3E B;  3U4V A;  1DOL A;  2B2U C;  5HUR A;  3V2T A;  2QF7 A;  3FDT A;  2WB1 E;  2A6H C;  1YNJ D;  3HOY H;  3NE5 B;  3HEJ A;  4WJW A;  3BZD B;  1DJR D;  1Q12 A;  5T1I A;  4DR3 L;  3SK6 A;  1STE A;  1WCM H;  1X65 A;  4BA2 I;  1YJ9 A;  1S3O A;  1DCZ A;  2QIL A;  1PTO D;  3MZ5 A;  5M3F H;  3D31 A;  1QVG A;  1L1O C;  1L1O B;  4DR4 L;  3I4M B;  4JI1 L;  4HJ9 A;  1PRT C;  2NVQ H;  1PRT B;  1TWH B;  3DLL A;  1K8A C;  5CGK A;  1LTI D;  4H44 C;  5LL6 X;  4OHJ A;  1FJG Q;  1S5D D;  3A7L A;  1Q7Y C;  4FF3 A;  4WJ4 A;  3HOW H;  1YNN D;  4IO9 A;  4DV7 Q;  3RLF A;  2YV5 A;  2AWN A;  4LF4 Q;  1H9S A;  1K3B C;  3W1G A;  2L15 A;  4A3E G;  4GKK Q;  3M7G A;  4A3C G;  1D7Q A;  3ERQ A;  3I2Z A;  1AE3 A;  2FHT A;  5C3W A;  3T1Y Q;  3QR8 A;  3H0G B;  2I5L X;  4C3I H;  4OWX B;  4KHV A;  3DWP A;  3SGI A;  1YHQ A;  4X65 Q;  1SE4 A;  4IUV A;  5IYB H;  4MZ9 A;  4ZYS A;  1VQ6 A;  4RA8 A;  1K3R A;  3S1N B;  3PGZ A;  1LYL A;  1D1I A;  1I4X A;  1KD1 C;  3HOY B;  3VA5 A;  2Z6B A;  2GA4 B;  4IFD G;  4IOC A;  1WCM B;  3TZD A;  3D6W A;  1HQR D;  2AQ3 B;  4X64 L;  3KUP A;  2J4X A;  1IKM A;  2NUC A;  2XIW A;  4EVO A;  4JI4 Q;  1GOZ A;  3BZK A;  1B8A A;  1XMO Q;  3J7A 5;  3MXG A;  1II3 A;  3W5O A;  4JG2 A;  2Z4H A;  2NVQ B;  2RBM A;  3PO3 G;  1HPC A;  4JI6 Q;  1CKN B;  5GQO A;  5ELD A;  4CKB A;  4RMF A;  1S72 A;  5ELE A;  3F2B A;  3VR2 A;  2DUD A;  1N32 L;  2VW9 A;  4DUZ Q;  3HOW B;  2G9D A;  3KLS A;  3B6Y A;  2NN6 H;  4KKS A;  3J80 E;  4HJA A;  1XNQ Q;  4RGO S;  2PZU A;  4JBM A;  1YHB A;  4LW1 A;  3S17 H;  1MD2 D;  2AUK A;  1Q1B A;  2PQA B;  2B2T A;  4GOP C;  1MI2 A;  4GOP B;  4IUP A;  3J80 L;  1QZG A;  4RHR A;  3JAM E;  4QUC A;  1KNA A;  2Z6K C;  4OIJ A;  4CHT B;  4EX5 A;  1L0X B;  5BN5 A;  2Z4I A;  4XQQ A;  1XYI A;  4C3I B;  4JC0 A;  1IKL A;  4FO2 A;  2EYM A;  4A3G G;  3DM1 A;  4FXD A;  5KYI A;  2NZO A;  1Q8I A;  2MUY A;  4NKL A;  1PV4 A;  4YHH Q;  3S2H H;  4PZ7 A;  1QIL A;  1CI3 M;  1OO9 B;  2NVY B;  3E5S A;  5GRO A;  2VB3 X;  4B3R L;  2A1A A;  4CJ2 C;  4DV3 Q;  2D2C C;  3KF6 B;  1UAP A;  1CQF A;  1EQR A;  1XXG A;  4RGM A;  1G6Z A;  1JJ2 A;  2G5D A;  1X3Q A;  1JJC B;  3BS1 A;  1VCI A;  3PO2 H;  3A7A B;  2O5I C;  4A3J G;  1LT4 D;  3M4Y A;  1DYQ A;  1HNX L;  4CGY B;  1CZG A;  2R7Z H;  5JOB A;  3T16 A;  4LFC Q;  1CK1 A;  3A0J A;  1TU2 B;  1TS2 A;  1CHQ D;  1IHZ A;  3I73 A;  2JA8 B;  4MTK A;  2Z9H A;  3DUZ A;  2B2U A;  3NEM A;  2F4V L;  1FNW A;  3SK8 A;  1STA A;  4KHZ A;  1K83 B;  4KJN A;  1FYC A;  2K33 A;  1KDA A;  3CC7 A;  4YCW A;  2F0O A;  2E2H B;  5C4X H;  1MBY A;  4LF8 L;  2JXM B;  3QB3 A;  4TSS A;  4HIM A;  4IPC A;  5CV7 A;  5M5X B;  1I4G A;  2IL8 A;  5C3X A;  3GTP B;  1L1O A;  4ALP A;  3U50 C;  3R93 A;  2C35 B;  4P2C B;  5IT9 E;  3OYY A;  3G7L A;  2OXP A;  3BU2 A;  1J8I A;  2UXB Q;  3I4N G;  3GDE A;  5KNC A;  5J39 A;  1WFQ A;  1D5X C;  4YIJ A;  4CDF C;  4GNX C;  4GNX B;  2JA9 A;  5IT9 L;  4JPB W;  3HKZ E;  2B63 G;  2DY7 A;  4K2L A;  1GO3 E;  4ZLT F;  3M4O H;  2K5D A;  3EIV A;  1PRT F;  1EIY B;  1Y69 U;  2B2V C;  2F0U A;  2QCP X;  2F0H A;  2NVX H;  2WKC A;  3NEL A;  3P7J A;  3K57 A;  1AZQ A;  1YZ6 A;  1SYG A;  3MXU A;  2A6E D;  1D5Z C;  2HUG A;  1EU4 A;  4ID6 A;  4J1M A;  3S1R B;  3J7A F;  3PO2 B;  3PUZ A;  4JYA Q;  4AQY L;  2CVR A;  2IPK D;  2JQO A;  5DNF A;  5C5L A;  2ES2 A;  1EL0 A;  2R93 G;  4DXG A;  3FKI G;  1KQS A;  1Y1W B;  1W6K A;  2K75 A;  3NK9 A;  3I7F A;  4BBR B;  4OGQ C;  2WAQ B;  1PTO H;  4LF6 L;  4A3M H;  5LMU L;  2ZJP A;  1Q1E A;  1SNP A;  4KKT A;  4DNI A;  2F3W A;  1W2B A;  4DKA C;  4M8A A;  4A3L G;  4OON A;  3TP5 A;  4IPG A;  3T1H L;  1SFO H;  3IFD A;  1YBY A;  2K28 A;  1CKN A;  4KY7 A;  2R3Z A;  3CCU A;  1Y8P B;  4YWK A;  1LAB A;  4LJZ C;  4DK1 A;  3HZX A;  2CFM A;  4ABN A;  5C5M A;  3K0X A;  2L12 A;  1HA6 A;  1BCP C;  3DWQ A;  1BCP B;  3H09 A;  3K80 C;  2K6A A;  2VUM G;  4OO1 I;  2PQA A;  1Y14 B;  2NVX B;  2IX0 A;  4YWL A;  4Q0F A;  1WVL A;  1HUM A;  3H3V H;  2CWA A;  2D0P A;  1M4V A;  4I7Z C;  1EIG A;  3J81 c;  3DEO A;  2L55 A;  3HRZ C;  3G71 A;  1EY4 A;  3ONA B;  1KLG D;  4KTA A;  3RMH A;  2JA7 G;  2F0W A;  4P71 A;  1FGB D;  3S15 B;  1HR0 L;  2ZM6 Q;  1ENA A;  1YNJ C;  1ZXT A;  3SE0 A;  5FKA C;  3GTO B;  1UE7 A;  5IYC G;  4R9W A;  3K5O A;  1F2Z A;  4A75 A;  1STB A;  5FO9 B;  5C4H A;  3UDF A;  3UDG A;  3G48 A;  2A73 B;  4F87 A;  2EQS A;  1SNO A;  3AMU A;  2CQO A;  2NB0 A;  3KF6 A;  4V19 0;  1PTO C;  2F0Q A;  1PTO B;  1GUT A;  2ALY B;  4A3M B;  2RHS B;  2DNC A;  3Q23 A;  3BDL A;  3MA2 B;  1TKW B;  3ULJ A;  3CPF A;  3UE1 A;  1A3T A;  4NP5 A;  4C3J B;  3EBE A;  2Y0S B;  1SFO B;  4DV5 L;  2RDG A;  2JA6 G;  4L5T A;  1YNN C;  1G29 1;  3RZD H;  1H9M A;  1AEX A;  2J0T D;  5AFW A;  1PH6 A;  3M4Q A;  4DV4 Q;  1LUZ A;  4RWS C;  3NTI A;  1QNK A;  5EPL A;  1HTL D;  4K8I A;  1N34 Q;  1XNR Q;  3CCV A;  1O80 A;  5IGG A;  1ET9 A;  1X56 A;  2KEN A;  3VR5 A;  1Q82 C;  1E2W A;  3NTH A;  5HY6 A;  1K8G A;  4G4K A;  1BBX C;  5ELF A;  3H3V C;  2HCC A;  3V96 A;  2SOB A;  1I6H H;  1IL8 A;  2RHQ B;  1OTC A;  3T56 B;  4YY3 Q;  3A8I E;  4QIW E;  3AEV A;  1X54 A;  4NDX A;  1HR0 W;  1BVS A;  2KOL A;  1E24 A;  3CME A;  2EYP A;  1NUC A;  2EZV A;  3E0E A;  4GNX A;  3L7Z C;  2IHE A;  3PMF A;  1PH2 A;  5FK9 C;  1NR4 A;  2R92 G;  1ASZ A;  5G3L F;  1W3S A;  2RSN A;  1B1Z A;  2KQ3 A;  2PPB C;  1CKM A;  3K7A B;  4V0B A;  2UUC L;  1X3G A;  1SBB B;  4FDB A;  4JI3 L;  4I65 A;  1SYD A;  1BQQ T;  2JE6 I;  2KHJ A;  3I4L A;  2B29 A;  2HDM A;  4ZRZ A;  1XPU A;  3NQI A;  4KV6 A;  1Q90 A;  4DV6 L;  4GKJ L;  3H91 A;  4YWM A;  1I6V C;  3U4Z A;  4BA1 I;  2VQF L;  1L0W A;  1T5E A;  1XX8 A;  1N33 Q;  2KHS A;  4GN5 A;  1TWC B;  1GHJ A;  3TZU A;  4DR7 L;  4NB3 A;  4QL5 A;  1NY4 A;  1LV9 A;  1RD9 D;  2B2W C;  4DFA A;  2NN6 I;  4HSP A;  4JBW A;  1N8R C;  3W2D A;  5ELC A;  1TWA B;  2BE5 D;  3RUZ A;  4JV5 Q;  4JI8 L;  5E4X A;  2CWP A;  4IUN A;  1S5E D;  1I6H B;  1SRO A;  1E2Z A;  2NWG A;  3K0Y A;  4RCO A;  5IIF A;  2O2L D;  4JI0 L;  2A8V A;  1BXT A;  1CTM A;  2JJQ A;  3HP3 A;  3KLW A;  1MGS A;  2C5C A;  1X3E A;  2VB2 X;  2E74 C;  3GV6 A;  2WIN B;  1EY8 A;  4WFN 3;  5JJZ A;  4A3C H;  4IQZ A;  4FF4 A;  1M8A A;  4KN4 C;  3HOU H;  3NWT A;  2F0K A;  1VQ5 A;  3TQY A;  1IYV A;  1VQA A;  4LFB L;  2D9U A;  3WOE A;  1CKO A;  5J22 A;  1YIJ A;  1ESR A;  2X69 A;  2AKW B;  5KNB A;  2CW0 C;  3MAQ A;  1GUW A;  4ZK9 B;  2HT1 A;  3P75 A;  1A6X A;  1BCP F;  4H7B A;  1CA5 A;  1QUQ A;  4PZ8 A;  1V1Q A;  1H9S B;  1VQB A;  2IX3 A;  4IFD H;  2A69 C;  4IZ8 A;  4LF9 Q;  4BY7 H;  2QGQ A;  3RZO B;  1TWG B;  3I90 A;  2EDG A;  2D62 A;  1YI2 A;  3NXW A;  2R7D A;  3GV3 A;  2L0C A;  4NXN L;  1QZH A;  1CQV A;  1EFW A;  1EEI D;  1SE2 A;  3G6E A;  4R8I A;  1TY0 A;  5G3L D;  4OL7 A;  3EN2 A;  2YU9 H;  1VDZ A;  3CMA A;  3BG3 A;  4F88 A;  4DV2 Q;  1EQV A;  5FLX E;  4BBS B;  4XIG S;  2N78 A;  3D4W A;  1E1T A;  3L0O A;  5JPM C;  3UDI A;  1H9J A;  4WJ3 M;  3GTK B;  1VQD A;  1TII D;  2K5V A;  1PTO F;  2F0P A;  4DR1 L;  5LHY 1;  5TSS A;  1A3U A;  4K6D A;  4KK7 A;  2RCN A;  4A3K B;  2K50 A;  4N9T A;  2MJ8 A;  5EJW A;  1FR3 A;  1O7Z A;  4PZ6 A;  4IUT A;  3HOU B;  2OWO A;  1CZW A;  4XT3 B;  3S16 H;  3NEN A;  3IL8 A;  1S5B D;  1QCB D;  3GP7 A;  1SRU A;  3I3C A;  5COY A;  4C56 C;  1DD2 A;  1ZKO A;  3HKZ G;  3CCM A;  4A3G H;  3U9O A;  3U9S A;  1VMP A;  2HD3 A;  5K36 G;  2R6G A;  4DF7 A;  1TWF B;  2UU9 L;  1NCV A;  1IBK L;  1EFI D;  2HIX A;  5GAD C;  2HQL A;  3C1E A;  4OXP A;  4KLK A;  5C0X H;  2NZ1 D;  4DA2 A;  3GTG B;  2UXD Q;  1WTP A;  4JI7 Q;  2ICI A;  4QJF A;  1EUJ A;  5FJ8 G;  1G91 A;  4BY7 B;  4WOR A;  3PF4 A;  5COR A;  4DXF A;  1PH3 A;  1AE2 A;  2F0M A;  4DR5 Q;  4A3J H;  3M7N A;  2YU9 B;  1QWY A;  4R8N A;  3CKI B;  2UUA L;  3TP7 A;  1CSP A;  3D8G A;  3AFQ A;  1UEA B;  1R4P B;  4RHS A;  4DR3 Q;  1I94 L;  1VQ9 A;  2L1B A;  1GVP A;  3AB9 A;  1VQF A;  3DEP A;  1FL0 A;  2IW3 A;  3KOJ A;  3W3A A;  4YCV A;  1F9Q A;  2PO4 A;  4DR4 Q;  1UE5 A;  2QEX A;  3NPP A;  4JI1 Q;  2QKI C;  1Q3L A;  3S16 B;  3KK7 A;  1XWE A;  3WDN A;  5KEE A;  1VQ7 A;  1B4O A;  4JOI C;  4A3F G;  1E2V A;  1V9P A;  3I4N H;  4A3G B;  2EYH A;  4G7O C;  3H3V I;  4R4Q A;  4R4C A;  2DY8 A;  3R8B A;  2EY5 A;  3HOV G;  3RNU A;  2KED A;  4WRD A;  5M3M G;  4UP8 A;  2K32 A;  3J81 i;  1A0I A;  3WOF A;  2FJ2 A;  1KLU D;  4JCV E;  5CR3 A;  1QNU A;  4ILW A;  1EWI A;  4TKO B;  3WWV A;  2R7F A;  3N6R A;  2A68 D;  4CJ1 B;  1VQK A;  3PUY A;  1Z47 A;  3IFT A;  1X55 A;  2K5Q A;  4JK1 C;  4A3D B;  3HOX H;  5K5P A;  4DR6 L;  2RKS A;  4PMW A;  4C3H G;  1QB5 D;  4S3S A;  3FKI H;  1B44 D;  4GZY C;  3RN5 A;  3FRP B;  1I4Q A;  1HQM C;  4EQN A;  1SMY C;  2YTV A;  1JB7 A;  1KTK A;  3CW2 C;  4IPD A;  2VNU D;  4KN7 C;  2OQK A;  4PV1 C;  1QVF A;  4K5X A;  1GUO A;  1R4Q B;  4DU9 A;  3CD6 A;  1TVX A;  2PMZ B;  4P75 A;  1X6O A;  1HA5 A;  4A3L H;  4EQP A;  3UI2 A;  1D1K A;  3TDQ A;  4BY1 G;  1S4Z A;  3MFG A;  2N8N A;  4NW2 A;  5HGT A;  3E9I A;  3I4N B;  1N32 Q;  3NBH B;  2NYZ D;  3NUC A;  4O1N A;  4IAL A;  5IP7 G;  2NZH A;  2BOS A;  1A15 A;  4DV1 L;  3HOZ G;  2RSO A;  1VQI A;  4RGN A;  3MWY W;  1BBW A;  3KFU A;  3CP0 A;  4NPS A;  4A3I G;  1WTV A;  2YTX A;  4QCL A;  1P8L A;  1TS4 A;  5M3F B;  4QF4 A;  5C44 G;  4HID A;  3MHB A;  5KYL A;  2FMM A;  4MN3 A;  4QGU A;  3LNN A;  4IJH A;  4M1U B;  2M9V A;  4OX9 L;  4L5R C;  2K01 A;  3HOX B;  2JA7 H;  1ET6 A;  1MSH A;  1GUN A;  1QJO A;  2F52 A;  3Q22 A;  5IYD H;  3FKI B;  1SN8 A;  3QOJ A;  4FVM A;  4A3B G;  1RIP A;  4TRD A;  1EY6 A;  4B3R Q;  5IYC H;  2EYL A;  3ND8 A;  4LAA A;  4CDE C;  4P74 A;  2EPB A;  1ZYR D;  1PFM A;  4X3U A;  3KJO A;  1DOK A;  1ESF A;  2Q8I B;  1B50 A;  3J7Y W;  1F77 A;  3H94 A;  4CDD C;  2BE5 C;  2VL6 A;  1W6J A;  3FPP A;  2JEA I;  4AYB E;  1NJI C;  3A5U A;  3S14 H;  2MGS A;  2XNA C;  4ULL A;  3E9H A;  3CQZ H;  3R3O A;  4NMZ A;  1GUS A;  3GTQ H;  1AH9 A;  1GHK A;  3JAM L;  1LAC A;  2F4V Q;  1RTN A;  1EU3 A;  2EYJ A;  1C0A A;  3S1M H;  3C3L A;  5IY0 A;  1SE8 A;  1LTL A;  3SHL A;  1XMO L;  5FO8 B;  3DHQ A;  4LF8 Q;  1TQO A;  1LT6 D;  4POF A;  3OHX C;  5IP9 H;  2PZT A;  1E3P A;  3CCE A;  1N36 L;  5DM6 3;  2JA5 H;  3BDO A;  3HGB A;  3O13 A;  3MEF A;  4JOI A;  2LFN A;  4DUY L;  3I4O A;  1KRS A;  2Y0S E;  2XVS A;  4ZUJ A;  5C6A A;  1XNQ L;  2KCC A;  1VQH A;  2ENB A;  5M5W H;  1STH A;  1MJE A;  5JEA J;  1HUN A;  5CYU A;  4QQB X;  4EQO A;  2K52 A;  3G4S A;  1VQN A;  1H9K A;  3EQL C;  5C4J H;  2R92 H;  4KI0 A;  1PH9 A;  1NSN S;  1PH4 A;  4LF5 L;  3S17 B;  1GD7 A;  1OXX K;  2EXZ A;  1HXY D;  4U67 3;  2I5M X;  4OIK A;  1J6Q A;  2SDF A;  2B8G A;  2H4O A;  4G7H C;  2F0L A;  4IFD I;  3CPW A;  4ZCK A;  2WB1 B;  1STY A;  4BXX H;  1X3P A;  3Q24 A;  5ELN A;  4UAI A;  2XWB B;  1IBL Q;  2K03 A;  3IAY A;  1GKH A;  5ELO A;  3CQZ B;  3CRK C;  3H6M A;  3GTQ B;  3OPO A;  4P73 A;  4DV3 L;  3M85 A;  2F1M A;  2ZTD A;  1ICF B;  3GTM H;  3S1M B;  3S2H B;  3ITP A;  4ZQ3 A;  1Y1V G;  1TY2 A;  3BYY B;  3IKJ A;  1EYG A;  3SDZ A;  1KAW A;  1HJP A;  5LMU Q;  5EBD A;  1EOT A;  2MHV A;  1Y8N B;  2F0E A;  2JA5 B;  5FLM G;  4HIK A;  2FXQ A;  1PZK D;  2AQ1 B;  3U58 A;  1QVC A;  4QB4 A;  1HNZ L;  3HOY G;  3MFY A;  1EWH A;  3T1H Q;  3A5Z B;  1HNW L;  3MXN B;  2R7Z B;  4XYQ A;  4YCU A;  1WCM G;  4L6T B;  4J15 A;  1SDF A;  3L3O C;  3NBH A;  2NVT H;  3K58 A;  1CT1 D;  3CAM A;  2OF1 A;  2MPM A;  1WJJ A;  3ND9 A;  3FPU B;  2R92 B;  5C4X B;  4IJL A;  1MKH A;  3T13 A;  1PFB A;  3PQI A;  5C0X I;  3VYU A;  3Q8D A;  4PNY A;  1U4R A;  2CQA A;  3A56 A;  4JVZ A;  3HOW G;  3Q6S A;  3BZC A;  2CKZ B;  4C1N K;  1JE5 A;  1IW7 D;  2EIF A;  4JW0 A;  1KXL A;  3E3X A;  1V1P A;  2JEB I;  1HR0 Q;  1STG A;  4DK3 C;  1IZ6 A;  1V1O A;  4BWG B;  4HJ5 A;  4XYO A;  4PMC A;  1PH8 A;  3M4O B;  2KEC A;  1KNE A;  2IX1 A;  4IUQ A;  1EIF A;  1C8C A;  3PIO 3;  3KBG A;  4JYA L;  5IYB G;  3C46 A;  4K6L A;  3GQB A;  3PCO B;  4B3S L;  2LY7 A;  2SEB D;  5CC4 A;  1A3V A;  1SYB A;  5D14 A;  3K5M A;  3SK4 A;  1Y8O B;  4DV5 Q;  5EGT A;  3HKS A;  4FNF A;  3K6O A;  1QUQ B;  4CDC C;  3ULL A;  2EJM A;  5CV8 A;  2F0F A;  1VF7 A;  4HJ8 A;  4ZKB B;  2OTL A;  2XGT A;  2QDL A;  1I4P A;  1JWU D;  5AJ3 L;  1Z9F A;  2UUB L;  3TP6 A;  3GTL H;  3T53 B;  1VS0 A;  2A68 C;  1MJC A;  1WOC A;  2JA8 G;  1ONL A;  3BVZ A;  1WTX A;  2A6H D;  3J80 c;  2MNA A;  1YNX A;  2UXC L;  3I91 A;  2NN6 G;  2PI2 A;  4EQ5 A;  3GO5 A;  1SAP A;  1RTO A;  3NP8 A;  3TS0 A;  1K28 A;  1HZA A;  3C2P A;  3NWS A;  2BA1 A;  3CCL A;  3JAM c;  3VYS A;  3MVV A;  4K14 A;  3QIA A;  3BYT B;  1IBM Q;  2ZTE A;  1O7Y A;  5C0X J;  2EJG C;  3X3N A;  1B9M A;  4Z9C B;  3F2D A;  2UUC Q;  3M9B A;  4JI3 Q;  1SND A;  1UNS A;  3D3R A;  3I70 A;  1HRJ A;  1XPO A;  3TME A;  2G9H D;  4DV6 Q;  4GKJ Q;  4IOA A;  1LM0 A;  2M2L A;  2VQF Q;  1E0B A;  1PXU A;  3PSI A;  1C9O A;  4K2K A;  3F2U A;  1OXS C;  5M5Y H;  3E6Z X;  2SNM A;  3TRZ A;  2PZW A;  4DR7 Q;  2B2Y A;  3PO2 G;  2KEE A;  3PIP 3;  2NTS A;  4UHV A;  2RF4 A;  4B08 A;  2H5X A;  2OTJ A;  1F2Y A;  4KY6 A;  5I2Y A;  4JI2 L;  2E2J H;  1KIX A;  2AQ2 B;  4JI8 Q;  3MXP A;  1S5C D;  1Y1W G;  4A3F H;  1AW7 A;  1SYE A;  4JBK A;  2GN5 A;  4BBR G;  3HKZ B;  2GVB A;  4JI0 Q;  1IYJ B;  5I2X A;  4GLV B;  3MXN A;  1RL2 A;  1KAB A;  2Z0S A;  4X3T A;  4ZKC B;  4DV4 L;  4Y7N H;  1PHJ A;  4DPG A;  2EY2 A;  5E1F A;  4J8Q A;  3S2D H;  1N34 L;  3CHB D;  3RZD B;  4LFA L;  4A93 G;  3HOV H;  5J1Z A;  5IT9 c;  3HS0 C;  1B3Q A;  5M3M H;  3R2T A;  3TP8 A;  1HCZ A;  3CXC A;  4LFB Q;  3KYH C;  3OIQ A;  5CV9 A;  3VA7 A;  4C2M H;  2E5L L;  2DJF C;  4X62 L;  5GAG C;  3ER0 A;  4JI5 L;  5IOD A;  2R61 A;  3EFX D;  5H1S E;  2L4N A;  4FF1 A;  2RCF A;  4L63 B;  4C3H H;  3KF8 B;  3A55 A;  1YIT A;  4A76 A;  3SR1 A;  1JE4 A;  4FXK C;  2L11 A;  1JB3 A;  4QUF A;  3TSS A;  4HCS A;  1UUP A;  1NNX A;  3DMU A;  5E4W C;  2N3S A;  1PYS B;  1EQT A;  3OWE B;  4A3E H;  4FF2 A;  1KDC A;  1PH7 A;  2F3V A;  1XTD A;  3M3Y H;  4P72 A;  4CKE A;  4DR2 L;  4AYB G;  3HG9 A;  5EKI A;  1PVO A;  4NXN Q;  1KRT A;  2KVM A;  1NE3 A;  4NXM L;  2N88 A;  3I72 A;  1SSO A;  1Z7T A;  5D65 A;  3OW2 A;  1VQG A;  4L8J A;  2E2J B;  4G57 A;  2ZXO A;  1QE6 A;  1G2T A;  3BJU A;  3KLS X;  4A3F B;  1WD0 A;  1UWV A;  4BY1 H;  4CJ0 B;  1JMC A;  4RCN A;  2JP1 A;  5EQ0 A;  4DV0 L;  4Y7N B;  1I4H A;  4DK0 A;  4DR1 Q;  2RDF A;  1VQP A;  1HH2 P;  4A3M G;  5DAU A;  3HOZ H;  1DM0 B;  3HOV B;  1U0L A;  4MTN A;  2KA7 A;  2VY3 A;  4PQX A;  4LF7 L;  4A3I H;  3KDF B;  1G51 A;  4C3J G;  2Y0S G;  2PNR C;  2EY1 A;  4C2M B;  1L2F A;  1J5E L;  3SXH A;  3G6J B;  3PO3 H;  1F9P A;  1BUV T;  4UDU C;  2N49 A;  4OWT B;  1J9O A;  5LMN L;  4QMG A;  4U68 A;  4C3H B;  2UU9 Q;  1MHW C;  1K8O A;  5ELB A;  4OEM B;  1IBK Q;  2JSO A;  4X66 L;  5KRU A;  2M00 A;  1O7I A;  4A4I A;  3E0J A;  4A3B H;  4XDX A;  4B3M L;  5FLX L;  1HFG A;  2Q2I A;  3TEH B;  4JBJ A;  1XMQ L;  4A3E B;  4DN4 M;  4UPA A;  4POG A;  1BO0 A;  1CM9 A;  2N55 A;  2F0S A;  3CRL C;  3M3Y B;  4HR7 B;  2TSS A;  1HZB A;  3NHH A;  5T1G A;  1JWM D;  1LT5 D;  4FYD A;  2A6E C;  3OIP A;  4UP9 A;  1HTP A;  4ODG A;  1SNM A;  2F0G A;  3J7Z C;  2UUA Q;  4R1J A;  3K5N A;  4BY1 B;  1PH1 A;  3PUW A;  1EZ8 A;  1DXM A;  1FNV A;  1I94 Q;  2V1C C;  4K5V A;  4N8F A;  1V43 A;  1VQE A;  4ZAI A;  2WP8 J;  5IWA L;  2E2D C;  1PH5 A;  3QOL A;  2F3I A;  5C4Z A;  4A3I B;  3OMC A;  2OQ0 A;  1FVI A;  3I55 A;  1U4M A;  3N52 A;  4QIW B;  1EY9 A;  4RKL A;  1XTC D;  2P5Z X;  5LMN W; 
#chains in the Genus database with same CATH homology
 3PO3 B;  1ML0 D;  1ILP A;  1TR5 A;  1PZJ D;  3NBI A;  3D4R A;  1PYW D;  5D3D A;  1B9N A;  4A3B B;  5CV4 A;  2F0J A;  4K8J A;  2EYO A;  2IWH A;  3MC0 B;  4XT1 B;  1JWS D;  2E75 C;  3T51 B;  5JEA G;  1B3A A;  1AP0 A;  1JOO A;  4PMB A;  1KDB A;  4H13 C;  1QOH A;  2XWJ B;  2SNS A;  1SE3 A;  3KF8 A;  3VYT A;  4E6I A;  1EY0 A;  4HED A;  2X6G A;  1C48 A;  4RFB A;  1OXU A;  2RDH A;  5ISR A;  2L5T A;  1CA6 A;  5IGF A;  1EEF D;  4A3J B;  3VYR A;  1K8M A;  2JYO A;  5DEH A;  1AN8 A;  4HN7 A;  2C9O A;  4DNR B;  2RVL A;  1ROD A;  2KUM A;  1G2S A;  3FMC A;  1WD1 A;  3J7A V;  1WTR A;  3OOC A;  1QG7 A;  2ID0 A;  2WII B;  4XQN A;  1JQY D;  1TT2 A;  3PUV A;  1A2T A;  1OXV A;  2B63 B;  3QJY A;  3EA6 A;  4H0L C;  3T4A C;  3SK5 A;  1ENF A;  1AFP A;  1WTW A;  1Y1V B;  1D2B A;  2F03 A;  1V8Q A;  5A35 A;  1SYF A;  4HMI A;  1PMR A;  3J81 E;  1V1P B;  2PQE A;  1BOS A;  1CFM A;  3QO2 A;  2R93 B;  1D5M C;  4DAY A;  1RCV D;  1JOK A;  3J81 L;  4XXE A;  2F0I A;  1T5X D;  2F4I A;  2BDO A;  1U4L A;  2J7Z A;  1F2M A;  3GD7 A;  3ERO A;  2EE1 A;  4F7X A;  1ILQ A;  2KCN A;  4XQJ A;  2ZT9 C;  4N9P A;  5A2Q E;  4KJO A;  2WKD A;  2F0T A;  1F9S A;  3DWA A;  3P20 A;  5A2Q L;  1AZP A;  4KMU C;  1I3Q B;  2FMC A;  2VUM B;  3D6C A;  5C0X G;  4ME5 A;  3L9A X;  1LTB D;  3FEW X;  2RA4 A;  4FXG C;  2JA7 B;  3LWU A;  5JVH 3;  2ICE C;  1LLR D;  4RAU C;  4KD4 A;  4HSV A;  4KD3 A;  1PZI D;  3GTJ B;  3NQT A;  2CW0 D;  5DM7 3;  4HCE A;  1JCK B;  3ZYY X;  4OO1 G;  1GXD C;  1U4P A;  3S14 B;  1HHV A;  4MIU A;  2Q8R E;  4G7Z C;  2A69 D;  4O42 A;  3A54 A;  4C1N I;  1PLF A;  3CU7 A;  2JA6 B;  5KND A;  5KGU A;  2B2Y C;  1EY7 A;  1H9R A;  3D4D A;  1EYD A;  2CHB D;  1F2L A;  2VXW A;  1ENC A;  2K04 A;  1GUG A;  2QEJ C;  2LMC B;  4XTC S;  3S1Q B;  4FP5 D;  1C4Q A;  2V4D A;  1JC7 A;  1S5F D;  4TQU S;  2DNE A;  5I6Y A;  5M5W B;  3LWE A;  2OEO A;  3P1H A;  5C4J B;  1RKN A;  2BA0 A;  1TS3 A;  2HDL A;  3K5L A;  4DAV A;  3DXJ C;  3OWF A;  2HQE A;  1X32 A;  1JIC A;  2PCF B;  2WAC A;  2A5H A;  3QWN A;  5KIX A;  3GTM B;  1SYC A;  1EYC A;  5JVG 3;  1R9T B;  1BNZ A;  4A93 B;  4Q5V A;  4C3I G;  4KY5 A;  2D5D A;  2RQX A;  2B8F A;  4IFD J;  1EY5 A;  3S9W A;  4IN3 A;  3FVQ A;  2L9H A;  5BN4 A;  3R2I A;  5JPN C;  1LTG D;  3MEH A;  1EWC A;  3OW7 A;  5D3I B;  3A8K E;  3PV0 A;  3TBI B;  1GJX A;  1HFN A;  2NVT B;  4MHE A;  2PYK A;  3TN2 A;  2Q8T A;  1SXT A;  5CV6 A;  4DNT B;  5IGC A;  3URY A;  4AYB B;  1SNQ A;  2WV6 D;  1O7L A;  5JAV A;  1FD7 D;  1LTS D;  1VMC A;  4X3S A;  1EYA A;  3EJI A;  5K36 H;  1F9R A;  2F0V A;  4CBV A;  1BR9 A;  5I9O A;  1KAA A;  2NTT A;  1MSG A;  1PDQ A;  1PRT D;  4BS9 A;  2F0D A;  2O5J C;  2EYF A;  4RGT A;  1JOR A;  1LTT D;  1RHP A;  5CMD A;  3I8Z A;  2XRS D;  2O4X A;  2IJ0 A;  3BVG A;  1U9R A;  1ICW A;  2E76 C;  1SMY D;  5LL6 S;  3VR3 A;  4B9X A;  3C1F A;  1WTO A;  2YYZ A;  2IT1 A;  2PW7 A;  1RJT A;  5BN3 A;  3GTL B;  5JEA H;  4RH6 A;  4F8M A;  1NAP A;  1RF2 D;  2A74 C;  2FIN B;  2ZXR A;  3V05 A;  5CBA E;  3OSO A;  2B2V A;  3EVQ A;  2B39 A;  5CBE E;  3K59 A;  2K05 A;  2PW5 A;  1SJH D;  1ZYR C;  1PFN A;  1I50 B;  3KBX A;  5E3F A;  1Z6H A;  2EY6 A;  4B9W A;  2I46 A;  2DN8 A;  4HTH A;  5EPJ A;  5IGD A;  5CV5 A;  1G8Z D;  5M5Y B;  1BF4 A;  3AU7 A;  1JR0 D;  4K5W A;  2KJX A;  2NBF A;  3NTK A;  1TS5 A;  3SEB A;  1O78 A;  2AUJ D;  2OT2 A;  1ZEQ X;  3Q0A A;  5IGB A;  2EJF C;  3S2D B;  1VF5 C;  2K5W A;  2MP1 A;  2EOT A;  5EKL A;  5M3M B;  4IUU A;  2AWO A;  4EGV A;  5EBC A;  1DOM A;  2EVB A;  4KKU A;  2BCO A;  2LKV A;  2Z8L A;  4LK1 C;  3OMG A;  2QDB A;  5EPK A;  4ZUI A;  1IYU A;  1I4R A;  5I4D A;  3VR4 A;  3MTS A;  3SVM A;  1SEB D;  2K1B A;  4DAP A;  1LT3 D;  5FOB B;  2X6L A;  5F2D A;  2K7V A;  4LMQ D;  2TMP A;  4X3K A;  2LS0 1;  3VR6 A;  3BDC A;  1EZ6 A;  3BVM A;  5I9P A;  3KLR A;  5EKK A;  2BDN A;  3RD4 A;  2H1E A;  2ZXP A;  1D6E C;  2XSC A;  2XN9 C;  3HOZ B;  1B2T A;  1DZ1 A;  4IUR A;  1A2U A;  2HCI A;  1FNU A;  3QG1 A;  2E2I B;  2XRQ D;  1JOQ A;  1OXT A;  4HMJ A;  5C44 B;  1SNC A;  2FFK B;  1RDP D;  1IW7 C;  1B53 A;  1LTR D;  2B2T C;  2I07 B;  5NUC A;  3X3M A;  3A8J E;  5I6W A;  4RKB A;  5IGE A;  3LX0 A;  1CHP D;  1NR2 A;  1BDO A;  1WTQ A;  1LO5 D;  5FO7 B;  1STN A;  4OO1 H;  4HAE A;  1SJE D;  1BCP D;  4CKC A;  3PUX A;  5IOC A;  1DON A;  2Z1C A;  1L0Y B;  4J6H A;  4DGZ A;  1LTA D;  1EIH A;  3NSW A;  2B2W A;  5M9O A;  2F0N A;  5C3E B;  1DOL A;  2B2U C;  5HUR A;  3V2T A;  2QF7 A;  3FDT A;  2A6H C;  1YNJ D;  3NE5 B;  3HEJ A;  4WJW A;  3BZD B;  1DJR D;  1Q12 A;  5T1I A;  3SK6 A;  1STE A;  4BA2 I;  1DCZ A;  2QIL A;  1PTO D;  3MZ5 A;  3D31 A;  3I4M B;  1PRT C;  1PRT B;  1TWH B;  5CGK A;  1LTI D;  4H44 C;  5LL6 X;  4OHJ A;  1S5D D;  3A7L A;  4FF3 A;  1YNN D;  3RLF A;  2AWN A;  1H9S A;  3M7G A;  3ERQ A;  2FHT A;  5C3W A;  3H0G B;  4KHV A;  3DWP A;  1SE4 A;  4IUV A;  4ZYS A;  4RA8 A;  3S1N B;  1D1I A;  1I4X A;  3HOY B;  3VA5 A;  2GA4 B;  4IFD G;  1WCM B;  3TZD A;  3D6W A;  1HQR D;  2AQ3 B;  3KUP A;  2J4X A;  1IKM A;  2NUC A;  2XIW A;  4EVO A;  1GOZ A;  3MXG A;  1II3 A;  2Z4H A;  2NVQ B;  2RBM A;  1HPC A;  5ELD A;  4CKB A;  5ELE A;  3VR2 A;  3HOW B;  2G9D A;  3KLS A;  2NN6 H;  4KKS A;  3J80 E;  4RGO S;  2PZU A;  1MD2 D;  2AUK A;  1Q1B A;  2B2T A;  1MI2 A;  4IUP A;  3J80 L;  4RHR A;  3JAM E;  4QUC A;  1KNA A;  4OIJ A;  4CHT B;  1L0X B;  5BN5 A;  2Z4I A;  4XQQ A;  1XYI A;  4C3I B;  1IKL A;  4FO2 A;  2EYM A;  3DM1 A;  4FXD A;  5KYI A;  1Q8I A;  2MUY A;  4NKL A;  1QIL A;  1CI3 M;  1OO9 B;  2NVY B;  3E5S A;  2VB3 X;  4CJ2 C;  2D2C C;  1UAP A;  1CQF A;  1XXG A;  4RGM A;  1G6Z A;  1X3Q A;  3BS1 A;  1VCI A;  3A7A B;  2O5I C;  1LT4 D;  3M4Y A;  1DYQ A;  4CGY B;  1CZG A;  5JOB A;  3T16 A;  1CK1 A;  1TU2 B;  1TS2 A;  1CHQ D;  1IHZ A;  3I73 A;  2JA8 B;  3DUZ A;  2B2U A;  1FNW A;  3SK8 A;  1STA A;  4KHZ A;  1K83 B;  4KJN A;  1FYC A;  2K33 A;  1KDA A;  2E2H B;  2F0O A;  1MBY A;  2JXM B;  3QB3 A;  4TSS A;  5CV7 A;  5M5X B;  1I4G A;  2IL8 A;  5C3X A;  3GTP B;  3R93 A;  4P2C B;  5IT9 E;  3G7L A;  2OXP A;  1J8I A;  5KNC A;  5J39 A;  1D5X C;  4YIJ A;  5IT9 L;  2DY7 A;  4K2L A;  4ZLT F;  2K5D A;  1PRT F;  1Y69 U;  2B2V C;  2F0U A;  2QCP X;  2F0H A;  2WKC A;  3P7J A;  3K57 A;  1AZQ A;  1SYG A;  3MXU A;  2A6E D;  1D5Z C;  2HUG A;  1EU4 A;  4ID6 A;  4J1M A;  3S1R B;  3J7A F;  3PO2 B;  3PUZ A;  2CVR A;  2IPK D;  5C5L A;  5DNF A;  1EL0 A;  4DXG A;  1Y1W B;  1W6K A;  3NK9 A;  4BBR B;  4OGQ C;  2WAQ B;  1PTO H;  1Q1E A;  1SNP A;  4KKT A;  2F3W A;  4M8A A;  3TP5 A;  3IFD A;  2K28 A;  4KY7 A;  2R3Z A;  1Y8P B;  1LAB A;  4LJZ C;  4DK1 A;  3HZX A;  4ABN A;  5C5M A;  2L12 A;  1HA6 A;  1BCP C;  3DWQ A;  1BCP B;  3H09 A;  2K6A A;  4OO1 I;  2NVX B;  2IX0 A;  4Q0F A;  1WVL A;  1HUM A;  1M4V A;  4I7Z C;  1EIG A;  3DEO A;  2L55 A;  3HRZ C;  1EY4 A;  3ONA B;  1KLG D;  4KTA A;  3RMH A;  2F0W A;  1FGB D;  3S15 B;  1ENA A;  1YNJ C;  1ZXT A;  3SE0 A;  5FKA C;  3GTO B;  4R9W A;  3K5O A;  1F2Z A;  1STB A;  5FO9 B;  5C4H A;  2A73 B;  4F87 A;  1SNO A;  3AMU A;  2NB0 A;  4V19 0;  1PTO C;  2F0Q A;  1PTO B;  1GUT A;  4A3M B;  2DNC A;  3Q23 A;  3BDL A;  3MA2 B;  1TKW B;  1A3T A;  4NP5 A;  4C3J B;  2Y0S B;  1SFO B;  2RDG A;  1YNN C;  1G29 1;  1H9M A;  1AEX A;  2J0T D;  5AFW A;  4RWS C;  3NTI A;  1QNK A;  5EPL A;  1HTL D;  4K8I A;  1O80 A;  5IGG A;  1ET9 A;  3VR5 A;  1E2W A;  3NTH A;  4G4K A;  1BBX C;  5ELF A;  3H3V C;  2HCC A;  3V96 A;  2SOB A;  1IL8 A;  3T56 B;  3A8I E;  4NDX A;  2KOL A;  2EYP A;  1NUC A;  2EZV A;  3L7Z C;  3PMF A;  5FK9 C;  1NR4 A;  5G3L F;  2RSN A;  1B1Z A;  2KQ3 A;  2PPB C;  3K7A B;  4V0B A;  1SBB B;  4I65 A;  1SYD A;  1BQQ T;  2JE6 I;  3I4L A;  2HDM A;  4ZRZ A;  3NQI A;  4KV6 A;  1Q90 A;  3H91 A;  1I6V C;  4BA1 I;  1T5E A;  1XX8 A;  2KHS A;  1TWC B;  1GHJ A;  3TZU A;  1LV9 A;  1RD9 D;  2B2W C;  4DFA A;  2NN6 I;  4HSP A;  4JBW A;  3W2D A;  5ELC A;  1TWA B;  2BE5 D;  3RUZ A;  5E4X A;  4IUN A;  1I6H B;  1S5E D;  1E2Z A;  2NWG A;  3K0Y A;  4RCO A;  5IIF A;  2O2L D;  1BXT A;  1CTM A;  3HP3 A;  1MGS A;  2C5C A;  2VB2 X;  2E74 C;  3GV6 A;  2WIN B;  1EY8 A;  4WFN 3;  5JJZ A;  4IQZ A;  4FF4 A;  1M8A A;  4KN4 C;  3NWT A;  2F0K A;  1IYV A;  2D9U A;  3WOE A;  5J22 A;  1ESR A;  2X69 A;  5KNB A;  2CW0 C;  3MAQ A;  1GUW A;  4ZK9 B;  3P75 A;  1A6X A;  1BCP F;  4H7B A;  1CA5 A;  1H9S B;  2IX3 A;  4IFD H;  2A69 C;  4IZ8 A;  3RZO B;  1TWG B;  3I90 A;  2EDG A;  2D62 A;  3NXW A;  3GV3 A;  2L0C A;  1CQV A;  1EEI D;  1SE2 A;  4R8I A;  1TY0 A;  5G3L D;  4OL7 A;  1VDZ A;  3BG3 A;  4F88 A;  1EQV A;  5FLX E;  4BBS B;  4XIG S;  3D4W A;  5JPM C;  1H9J A;  3GTK B;  1TII D;  1PTO F;  2F0P A;  5LHY 1;  5TSS A;  1A3U A;  4K6D A;  4KK7 A;  4A3K B;  4N9T A;  2MJ8 A;  5EJW A;  1FR3 A;  1O7Z A;  4IUT A;  3HOU B;  1CZW A;  4XT3 B;  3IL8 A;  1S5B D;  1QCB D;  3GP7 A;  3I3C A;  5COY A;  4C56 C;  1DD2 A;  1ZKO A;  3U9O A;  3U9S A;  1VMP A;  5K36 G;  2R6G A;  4DF7 A;  1TWF B;  1NCV A;  1EFI D;  3C1E A;  5C0X H;  2NZ1 D;  4DA2 A;  3GTG B;  1WTP A;  2ICI A;  1G91 A;  4BY7 B;  4WOR A;  5COR A;  4DXF A;  2F0M A;  3M7N A;  2YU9 B;  1QWY A;  4R8N A;  3CKI B;  3TP7 A;  3D8G A;  1UEA B;  1R4P B;  4RHS A;  2L1B A;  3AB9 A;  3DEP A;  2IW3 A;  3W3A A;  1F9Q A;  2PO4 A;  3NPP A;  2QKI C;  1Q3L A;  3S16 B;  3KK7 A;  1XWE A;  3WDN A;  5KEE A;  1B4O A;  1E2V A;  4A3G B;  2EYH A;  4G7O C;  2DY8 A;  3R8B A;  2EY5 A;  2KED A;  4WRD A;  2K32 A;  3WOF A;  2FJ2 A;  1KLU D;  5CR3 A;  1QNU A;  4ILW A;  4TKO B;  3N6R A;  2A68 D;  4CJ1 B;  3PUY A;  1Z47 A;  3IFT A;  2K5Q A;  4JK1 C;  4A3D B;  5K5P A;  2RKS A;  4PMW A;  4C3H G;  1QB5 D;  4S3S A;  1B44 D;  4GZY C;  3FRP B;  4EQN A;  1I4Q A;  1HQM C;  1SMY C;  1KTK A;  2VNU D;  4KN7 C;  4PV1 C;  4K5X A;  1GUO A;  1R4Q B;  4DU9 A;  1TVX A;  2PMZ B;  1HA5 A;  4EQP A;  3UI2 A;  1D1K A;  3TDQ A;  1S4Z A;  3MFG A;  5HGT A;  4NW2 A;  3I4N B;  2NYZ D;  3NUC A;  4O1N A;  4IAL A;  2BOS A;  1A15 A;  2RSO A;  4RGN A;  3MWY W;  1WTV A;  4QCL A;  1TS4 A;  5M3F B;  4QF4 A;  3MHB A;  5KYL A;  2FMM A;  4MN3 A;  3LNN A;  4M1U B;  2M9V A;  2K01 A;  3HOX B;  1ET6 A;  1MSH A;  1GUN A;  1QJO A;  3Q22 A;  3FKI B;  3QOJ A;  4FVM A;  4TRD A;  1EY6 A;  2EYL A;  3ND8 A;  4LAA A;  2EPB A;  1ZYR D;  1PFM A;  4X3U A;  1DOK A;  1ESF A;  2Q8I B;  1B50 A;  3J7Y W;  1F77 A;  3H94 A;  2BE5 C;  1W6J A;  3FPP A;  2JEA I;  2MGS A;  2XNA C;  4ULL A;  3R3O A;  4NMZ A;  1GUS A;  1GHK A;  3JAM L;  1LAC A;  1RTN A;  1EU3 A;  2EYJ A;  3C3L A;  3SHL A;  5FO8 B;  3DHQ A;  1TQO A;  1LT6 D;  3OHX C;  2PZT A;  5DM6 3;  3BDO A;  3HGB A;  3O13 A;  2LFN A;  2XVS A;  4ZUJ A;  5C6A A;  2KCC A;  2ENB A;  1STH A;  1HUN A;  5JEA J;  5CYU A;  4EQO A;  1H9K A;  3EQL C;  4KI0 A;  1NSN S;  3S17 B;  1OXX K;  2EXZ A;  1HXY D;  4U67 3;  4OIK A;  2SDF A;  2B8G A;  2H4O A;  4G7H C;  2F0L A;  4IFD I;  2WB1 B;  1STY A;  1X3P A;  3Q24 A;  4UAI A;  2XWB B;  2K03 A;  3IAY A;  3CQZ B;  3CRK C;  3H6M A;  3GTQ B;  3OPO A;  3M85 A;  2F1M A;  3S1M B;  3S2H B;  3ITP A;  4ZQ3 A;  1TY2 A;  3BYY B;  3IKJ A;  3SDZ A;  5EBD A;  1EOT A;  2MHV A;  1Y8N B;  2F0E A;  2JA5 B;  1PZK D;  2AQ1 B;  4QB4 A;  3MFY A;  1EWH A;  2R7Z B;  4XYQ A;  4L6T B;  1SDF A;  3L3O C;  3NBH A;  3K58 A;  1CT1 D;  2OF1 A;  2MPM A;  3ND9 A;  3FPU B;  2R92 B;  5C4X B;  3T13 A;  1PFB A;  5C0X I;  3VYU A;  4PNY A;  1U4R A;  2CQA A;  3A56 A;  3Q6S A;  4C1N K;  1IW7 D;  1V1P A;  2JEB I;  1STG A;  1V1O A;  4BWG B;  4XYO A;  4PMC A;  3M4O B;  2KEC A;  1KNE A;  2IX1 A;  4IUQ A;  1C8C A;  3PIO 3;  3KBG A;  3C46 A;  4K6L A;  3GQB A;  2LY7 A;  2SEB D;  5CC4 A;  1A3V A;  1SYB A;  5D14 A;  3K5M A;  3SK4 A;  1Y8O B;  5EGT A;  4FNF A;  3K6O A;  2EJM A;  5CV8 A;  2F0F A;  1VF7 A;  4ZKB B;  1I4P A;  1JWU D;  3TP6 A;  3T53 B;  2A68 C;  1ONL A;  3BVZ A;  1WTX A;  2A6H D;  3I91 A;  2NN6 G;  3GO5 A;  1SAP A;  1RTO A;  3NP8 A;  3C2P A;  3NWS A;  2BA1 A;  3VYS A;  3MVV A;  4K14 A;  3QIA A;  3BYT B;  1O7Y A;  5C0X J;  2EJG C;  3X3N A;  1B9M A;  4Z9C B;  1SND A;  1UNS A;  3D3R A;  3I70 A;  1HRJ A;  3TME A;  2G9H D;  2M2L A;  1E0B A;  1PXU A;  4K2K A;  3F2U A;  1OXS C;  3E6Z X;  2SNM A;  2PZW A;  2B2Y A;  2KEE A;  3PIP 3;  2NTS A;  4B08 A;  1F2Y A;  4KY6 A;  5I2Y A;  2AQ2 B;  1S5C D;  3MXP A;  1AW7 A;  1SYE A;  3HKZ B;  5I2X A;  3MXN A;  1KAB A;  4X3T A;  4ZKC B;  2EY2 A;  5E1F A;  4J8Q A;  3CHB D;  3RZD B;  5J1Z A;  3HS0 C;  3R2T A;  3TP8 A;  1HCZ A;  3OIQ A;  5CV9 A;  3VA7 A;  5IOD A;  2R61 A;  3EFX D;  2L4N A;  4FF1 A;  4L63 B;  3A55 A;  3SR1 A;  1JE4 A;  4FXK C;  2L11 A;  1JB3 A;  4QUF A;  3TSS A;  4HCS A;  1UUP A;  3DMU A;  5E4W C;  1EQT A;  3OWE B;  4FF2 A;  1KDC A;  2F3V A;  4CKE A;  3HG9 A;  5EKI A;  2KVM A;  2N88 A;  3I72 A;  1SSO A;  1Z7T A;  5D65 A;  4L8J A;  2E2J B;  4G57 A;  2ZXO A;  1QE6 A;  1G2T A;  3KLS X;  4A3F B;  1WD0 A;  4CJ0 B;  4RCN A;  2JP1 A;  5EQ0 A;  4Y7N B;  4DK0 A;  1I4H A;  2RDF A;  5DAU A;  1DM0 B;  3HOV B;  2KA7 A;  4PQX A;  4C3J G;  2PNR C;  2EY1 A;  4C2M B;  3SXH A;  3G6J B;  1F9P A;  1BUV T;  4UDU C;  1J9O A;  4QMG A;  4U68 A;  4C3H B;  1K8O A;  5ELB A;  2JSO A;  5KRU A;  2M00 A;  3E0J A;  4XDX A;  5FLX L;  1HFG A;  4A3E B;  4DN4 M;  1BO0 A;  1CM9 A;  2N55 A;  2F0S A;  3CRL C;  3M3Y B;  4HR7 B;  2TSS A;  5T1G A;  3NHH A;  1JWM D;  1LT5 D;  4FYD A;  2A6E C;  3OIP A;  1HTP A;  4ODG A;  1SNM A;  2F0G A;  3K5N A;  4BY1 B;  3PUW A;  1EZ8 A;  1DXM A;  1FNV A;  4K5V A;  1V43 A;  4ZAI A;  2WP8 J;  2E2D C;  3QOL A;  5C4Z A;  4A3I B;  3OMC A;  1U4M A;  3N52 A;  4QIW B;  1EY9 A;  4RKL A;  1XTC D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...