2PZTA

Crystal structure of staphylococcal nuclease variant v66q/p117g/h124l/s128a at 100 k
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
135
structure length
130
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKVEKYGPEASAFTKKMQENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic study of hydration of an internal cavity in engineered proteins with buried polar or ionizable groups.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 37
structure length 130
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2007-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2pztA00
5KIXA 2EYJA 5CGKA 2NUCA 2F0MA 5IGBA 2SOBA 3RUZA 3QOJA 3DHQA 3OMGA 5C6AA 5DEHA 5KYIA 2PW7A 3D4WA 5E3FA 5I9OA 2F0LA 3BDLA 4I65A 2ENBA 4N9TA 4QMGA 3VA5A 1EYDA 4K2KA 5CV6A 3SR1A 1JOQA 4MIUA 3EROA 5JAVA 1IHZA 3DMUA 4IALA 2LKVA 2O4XA 4H7BA 3SK6A 3D8GA 3R3OA 2EY6A 3HEJA 3E5SA 4K5VA 3ITPA 5KGUA 2PZWA 2EYPA 4HMJA 5CV9A 4ZQ3A 1A2TA 5IODA 3MVVA 3EJIA 4K8IA 4OL7A 5JOBA 2EXZA 4NMZA 4DFAA 4NP5A 4B9XA 3P75A 4EQPA 4EQOA 3TP6A 5C3WA 4PNYA 3TP5A 1STHA 4KTAA 1TQOA 5M9OA 2F0UA 1U9RA 4KV6A 4E6IA 5CC4A 3SXHA 3C1FA 4QF4A 3OSOA 2F3VA 1KDBA 3NK9A 4K8JA 3NP8A 2RDFA 4TRDA 4KY5A 5C5LA 2F0FA 1STYA 2PW5A 1STBA 1EZ8A 1EY0A 4ZUIA 1EY8A 5IGEA 2SNMA 3OWFA 1F2ZA 4HMIA 1SYDA 4N9PA 2PQEA 4NKLA 1KDAA 1NSNS 1EZ6A 4K5XA 4WORA 2KHSA 5CR3A 5CV8A 4K6DA 4ODGA 4EVOA 4G57A 4F8MA 5I6YA 3TP7A 4R8NA 3OMCA 3QB3A 5F2DA 1STAA 5CV4A 5NUCA 4DU9A 1SYEA 4S3SA 3D6CA 5IIFA 3BDCA 1ENCA 4EQNA 5HURA 2RKSA 3P1HA 4F7XA 2F0VA 3SK5A 3LX0A 4J1MA 2M00A 4B9WA 5CV7A 4DGZA 5J39A 1SNPA 1EY5A 2OXPA 2SNSA 5IGDA 1STNA 3C1EA 5EKKA 5KEEA 3MXPA 1EYCA 2F0JA 3MEHA 5C5MA 1KABA 5DAUA 2F0QA 1F2YA 1ENAA 1NUCA 2F0HA 4KJOA 2PZTA 5E1FA 2F0PA 2HQEA 2OF1A 3T16A 1SYFA 3U9OA 5KYLA 1EY6A 1SNQA 1A3TA 1JOOA 2QDBA 1RKNA 1SNOA 2WACA 4KHVA 4PMCA 4RKBA 3TP8A 4LAAA 4QB4A 5CV5A 3T13A 1SYCA 3SK8A 3ERQA 1TR5A 3QOLA 4IUNA 1II3A 2EYFA 3EVQA 4RKLA 3TMEA 2F0SA 4KD4A 4ME5A 5I6WA 1SNCA 5HGTA 3S9WA 1A3UA 1KDCA 1KAAA 1TT2A 5IOCA 4KJNA 5ISRA 3PMFA 3NUCA 4PMBA 5C3XA 3NHHA 4KD3A 1EYAA 2F0TA 2F0WA 2F0DA 1EY9A 4HTHA 2F0EA 5IGGA 5K5PA 3HZXA 2F0KA 2OEOA 3MHBA 2EY5A 4IZ8A 5EGTA 1SNDA 1JORA 3NQTA 4ZUJA 2EYMA 2F3WA 1JOKA 4YIJA 1SYGA 4KY6A 5C4HA 2PZUA 1A2UA 4K14A 4NDXA 2EY2A 5I9PA 2EYOA 5IGFA 5KRUA 4WRDA 2PYKA 2EY1A 2KQ3A 3V2TA 5J22A 1EY4A 2F0OA 4J6HA 3SHLA 3D4DA 2F0GA 1AEXA 1EQVA 1F2MA 4K2LA 4KY7A 5J1ZA 1EY7A 4DF7A 1A3VA 4ID6A 3MZ5A 5IGCA 2F0IA 4K5WA 3NXWA 2RBMA 2F0NA 2EYHA 1STGA 5EKLA 1SYBA 3SK4A 5C4ZA 2EYLA 3H6MA 1SNMA
chains in the Genus database with same CATH superfamily
1GM5A 5CGKA 3L0OA 1RODA 4A3GH 2UUAL 1HRJA 1TS2A 3OTOQ 1C4QA 3BDLA 2B63B 4K2KA 1HH2P 4GN5A 4DV0L 1CA6A 4XT3B 4JBJA 2K5NA 4CGYB 1LUZA 3T51B 1M1KC 4DR7Q 1A0IA 1DXMA 2E74C 2R7ZH 4A93G 4HJ9A 1X6OA 1WOCA 2JK8A 1TKWB 3HOYH 1LTBD 2GVBA 5JJIA 1XNQQ 4QY7A 3NP8A 1VQFA 2CQOA 3M7NA 3S17B 1NR2A 4MNOA 4IO9A 4A3IG 4BY1G 1VQAA 3S2DH 3GO5A 5FOBB 4R8NA 3BZKA 3J81E 4YHHL 1C7YA 4DU9A 1SN8A 1PA6A 2H4OA 2R92H 1ENCA 2K04A 3NBHB 3I91A 1YZ6A 1PTOC 4JI7Q 2A19A 1NAPA 1STNA 3Q6SA 1O7IA 2CFMA 5DAUA 1OO9B 4LNQA 5EPLA 3VYRA 3I72A 2NN6H 2Z9HA 2K5DA 1KRTA 3K80C 4PMCA 3K81C 5A2QE 5CV5A 2EJGC 1K28A 3MEFA 2I5MX 3H91A 2K33A 4ME3A 1IKMA 2XNAC 4JV5Q 3QJYA 3CHBD 2R7DA 2UU9Q 3NHHA 1Y8PB 4X3UA 4PMWA 4DV4Q 3PUXA 2D0OA 2KBNA 1O7ZA 1EIFA 1M4VA 4IPHA 1ESRA 4XYOA 3V96A 4KHPL 2QDLA 1JWUD 1EY4A 5C4JH 2YTXA 1X32A 2VL6A 5IYCH 4CKEA 1M8AA 2EVBA 1JE5A 1STGA 1Q1BA 3H6MA 5KIXA 1D6EC 4LK1C 3K5MA 3DWPA 2OTLA 3RUZA 1NMFA 1LO5D 3PV0A 1ASZA 1AZPA 1AFPA 2QW7A 1I4QA 2A69D 2J4XA 3K0XA 1XYIA 4R4OA 3EQLC 3CCLA 3D8GA 1WD1A 5G3LD 1BCPD 2EYPA 3VYTA 2KEEA 3MVVA 1ENFA 3HOUH 5JPMC 4A3BG 2WIIB 2Z1CA 3HFZB 1TQOA 3EN2A 4AYBB 4A76A 1EUJA 4MHEA 3OSOA 4PZ7A 2FFKB 4OO1I 2EPBA 5FLXL 5C0XJ 3J80i 3NWSA 2OQ0A 2SEBD 3AEVA 2CCZA 5BN4A 2KCCA 4GLAC 2WAQE 2B3GA 4DF7A 1HFGA 1NBWA 4ODGA 3U4ZA 3K5NA 3TP7A 1U4LA 1L0YB 1YHAA 3CAMA 5NUCA 1X65A 2DJGC 1K9MC 4DR2L 2NBFA 2SNSA 1D8LA 1VQ8A 4OHJA 4KKUA 4IFDJ 2F0JA 3RLNA 1S5BD 2Z0SA 3GTMH 4EX5A 4TVAB 4BY1B 4GLVB 4CKBA 4H44C 1ILPA 2N8NA 5C0XI 2CWAA 4OELB 5FLXE 3HOYB 3U50C 4Q0FA 1KAAA 5IOCA 3S14H 3CMAA 2AUJD 1K83B 2K7VA 4ZK9B 4LF9L 4HTHA 1HNWL 1F9QA 3K8AA 1XWEA 4C1NI 1JORA 2BE5D 3NQTA 5M3FB 1WTOA 1A2UA 1HZCA 2RDGA 3OTOL 1B1ZA 2JQOA 1KNEA 4B3TL 3AB9A 1I4RA 2KHJA 4J6HA 3TBIB 3GTGH 3SHLA 3J81L 3E6ZX 4JI4L 2Z6KA 3SE0A 4BS9A 2IHEA 1IXRA 2AWNA 4RWSC 4Q5VA 3BJUA 1O7LA 3CP0A 1ASYA 5E3FA 1LTRD 2A6HD 2ENBA 1S5ED 3SR1A 4HJ5A 3FKIG 2D5DA 4IALA 5H1SE 2VQEQ 5EAYA 1PTOF 1ET9A 4JI0Q 4UPAA 3UDIA 5CV9A 1U4RA 5IY0A 2JA5H 1KRSA 2EJFC 2B2WA 3N52A 4KTAA 2B2TC 1YNND 1L0WA 1CA5A 2F03A 3GTLB 2XSCA 1WCMG 4BY1H 2ZJQA 1KDBA 3GV3A 1YJNA 3PF4A 1EZ8A 3NTIA 5IGEA 1F2ZA 4KKSA 1KDAA 3KOJA 3TREA 4EVOA 1YIJA 2JXMB 1I94L 4A3KB 4IN3A 1V1PA 3RD4A 1JC7A 1OXVA 3X3NA 2NVXB 1LT6D 1GOZA 3DM1A 1XXGA 5LMNW 2PI2A 2G5DA 5J39A 5IYDH 2OXPA 4UAIA 1TWFH 5C5MA 4DK6C 2HQEA 4OEMB 3SGIA 1QZGA 1RDPD 3U9OA 4YWMA 1SMXA 1JOOA 2X6GA 3S16B 1CZWA 1Q12A 1XPUA 2VQFL 4DV6Q 3J81j 4BBSH 3A8JE 2IW3A 2Z6KC 4KJNA 3DEPA 1B2TA 1Q46A 2Q8RE 1NR4A 2VQEL 5KNDA 3VYUA 2F0EA 1MGSA 4DV3L 5IWAQ 3OPOA 2CKZB 3KFUA 2PO4A 1AW7A 2F3WA 3UDGA 1X3FA 2A8VA 3BVGA 3FKIB 2OQKA 2EY2A 1HQRD 2PYKA 5LL6S 4NPSA 1RJTA 3M4OH 4HJAA 1EQVA 5J1ZA 1FL0A 4A3CH 1SE2A 1V1OA 1YEZA 4A3BH 4K5WA 2K28A 1HHVA 2XRSD 2WAQB 5D65A 1VQBA 2E2JH 2OWOA 4YWLA 2TMPA 2B63H 4BBRH 1BBUA 2B2YA 1AE2A 1X54A 5DEHA 1QUQA 2N3SA 3GTOB 3KJPA 2NVYB 5C3EG 2K1BA 1GD7A 1XNQL 2IT1A 2ES2A 4DXGA 2R6GA 1GVPA 1QE6A 4APVA 2PZWA 3M3YH 1FD7D 3IFDA 3A74A 1PRTD 3GDEA 5IP9H 2B39A 3S17H 3I4MG 2WV6D 4BY7H 1JWMD 4HCEA 1PVOA 2X69A 1LTAD 5FJ8H 2RVLA 4LUVA 1Q8KA 2NZOA 2SNMA 2ZTEA 3RZOH 4BBSB 1KTKA 5I6YA 2XRQD 2UXBL 5EBCA 3ND9A 1SLJA 4OWXB 1HZAA 5M5YB 3NE5B 3D6CA 1CHPD 5HURA 4QL5A 4GOPC 4JI3Q 4CDCC 1N36Q 1TWHB 1IW7D 3CPFA 1NTGA 4L6TB 3KBGA 1Y1VH 2DY8A 3W1GA 5GADC 1EQRA 1HTLD 4JW0A 2F4IA 5E1FA 4C56C 1PFNA 1QZHA 2L55A 1QB5D 2OF1A 3T16A 4DV3Q 3FDTA 3M4OB 4UHVA 1O7YA 1A3TA 2QDBA 4F87A 4GKKL 1PDQA 1XNRQ 3T13A 4IUNA 1GUGA 3EVQA 3I2ZA 4GN3B 3D0FA 4KD4A 2VQFQ 1NCVA 4DV6L 2F3IA 1PYWD 1TY2A 3C3LA 5C4XB 4HJ7A 3T1HQ 4XTCS 3NUCA 5ELBA 4NB3A 4LF4Q 3ULPA 1NY4A 3I73A 4OO1H 2KVMA 2VZAA 1C0AA 4YIJA 1YNJD 4GKJQ 3OW2A 5ELEA 5I9PA 2PNRC 4WRDA 4U68A 3M3YB 2V1CC 1G91A 2JN4A 3J80E 3RNUA 2J7ZA 1Y1WG 3J80L 2QEXA 1SYBA 3HOVH 2F52A 2EYLA 3M7GA 3HG9A 4Y7NH 1E2VA 1ZYRD 2K14A 4MZ9A 2IX1A 1QVFA 3F2DA 1H9JA 1I4GA 1B4OA 1M90C 5EJWA 5FJ8G 1G2SA 3CXCA 2HHHQ 4KHZA 1TIID 2GN5A 1CFMA 5C0XG 3CQZH 4TQUS 1Z9FA 1Y14B 4A3GG 3PSIA 4C3JB 1IBML 1S40A 2FJ2A 1TWHH 4HMJA 3LWEA 1HUNA 1CSQA 1X3QA 5ELFA 4DFAA 3P75A 1D5MC 2HT1A 1PTOH 1B9NA 2ICEC 4C3IB 4JPBW 4P71A 4TRDA 4KY5A 1YHBA 4DR5Q 3DUZA 2F0FA 2IWHA 3JAML 1LLRD 4IFDI 4KK7A 3N6RA 3SK5A 3S1QH 1SYDA 3GD7A 2Q8TA 4JI5Q 1JJGA 4DR6Q 3BDOA 2JA5B 2JYOA 4K6DA 4BA2I 2ZM6L 4GS3A 1SYEA 4X66L 4IFDH 3Q0AA 1B9MA 3H09A 3KUPA 3OW7A 4AH6A 3I90A 3LX0A 5LMUQ 4L63B 1A62A 2WB1E 2RF4A 4FXGC 4JK1C 2UXCQ 1KNAA 2RHSB 4LFBQ 4BXXH 1GKHA 3PO2G 4NW2A 3FRPB 4R8IA 4HIOA 4RA8A 1HA5A 2LY7A 4Y7NB 3TDQA 1CKNA 1L2FA 4A4IA 1SSOA 1QG7A 1S5FD 1BVSA 3VR5A 3T1YQ 1EL0A 3F8TA 3J7A5 2F0DA 2B2VC 1HTPA 2ZM6Q 1DOLA 5C44H 3ONAB 3D3RA 1I4PA 5E7NA 1LACA 3Q22A 5BR8L 4FF3A 3OHXC 5ELDA 4LF7L 1VMPA 3UI2A 4N8X1 4LF8L 1YNNC 3Q24A 1PRTC 1VS0A 1R9TB 1PFMA 3F1ZA 1ICWA 1Y1VB 4C3IH 3E9HA 1G6PA 2VY3A 1FGBD 4J15A 2XGTA 1VQOA 1EWHA 4RGOS 3EFXD 2JEBI 2ZXOA 5KYIA 3S15B 1SE4A 4RFBA 4OONA 1SDFA 3HOXG 2F4VL 3EROA 5JAVA 3CCJA 1PH1A 2UXDL 4Y52H 3MA2B 1LV9A 4RMFA 1V9PA 1VQHA 3L7ZC 4NMZA 4BBRB 4A93H 3FMCA 4XQQA 1MHWC 2CH4W 1A6XA 2A68D 4CDEC 1KHIA 3SXHA 3TN2A 3C2PA 3HGBA 4L5SA 2JA9A 2ZXPA 2OTJA 4FF2A 1PH3A 1OXXK 3K5LA 4ZUIA 3W1BA 2VUMB 1B70B 1F9SA 4KN4C 2Z4HA 4LFCQ 3OMCA 3QB3A 4AQYQ 2D62A 2X6LA 1PH4A 4JI6Q 2BH2A 2AMCB 3E0EA 4DV1L 4IPDA 2F0VA 2WKDA 1I6HB 5IGDA 3F2BA 1Q1EA 3T4AC 3EIVA 3NBHA 3AU7A 5ELCA 5D3DA 4GNXC 1K73C 2KEDA 1HXYD 3I55A 4A3MG 4A3IB 4ZLTF 4A3FB 2XIWA 4RKBA 1MD2D 4LAAA 3M85A 5ELNA 4DR3L 2EIFA 1TWAH 1II3A 2ICIA 4HN7A 5I6WA 3MFYA 1WTVA 4LF8Q 3VR4A 5ISRA 3PO3H 2EDGA 5D14A 4LUZA 1GUSA 1K3RA 4B08A 2R93G 4YHHQ 3VR6A 2O5JC 3MC0B 2EY5A 1YNJC 5K36H 1EFID 2IPKD 4RGTA 4DR6L 1EQTA 2QCPX 4IURA 2I46A 4DV2Q 2QEJC 3EA6A 5EPKA 2HDMA 1FNVA 3ND8A 4CHTB 5IGFA 2LXJA 2JA8B 5IGCA 2F0IA 3S1RH 2R93B 3K7UC 1RTNA 4RHRA 4TSSA 2YTYA 3D31A 3PGZA 4A3JG 1LT3D 3OMGA 2WB1B 1DONA 3H94A 1XMOL 4YCVA 2IY5B 1KD1C 4L5QA 3DMUA 2CW0C 4XIGS 1S4ZA 3J81c 4A3KG 1TS4A 1NE3A 4JYAL 3HOWH 1E1OA 1JR0D 3A8KE 1BBWA 4FXDA 1MJEA 2AWOA 1Q86C 5JVH3 4NP5A 2IJ0A 3K7AB 2F1MA 5M5XB 2HUGA 3U58A 3R93A 4MN3A 3CC7A 3RZOB 4A3MH 1TY0A 3PO2H 4YY3L 4OIJA 4A3LH 4CDDC 1EZ6A 2KHSA 2L12A 5M3MB 1D7QA 1IBLQ 1FNUA 2B2TA 3CPWA 4RH6A 5CV4A 3G4SA 2MNAA 1WJJA 2A74C 4ZCKA 1I50H 4DNTB 2KECA 3ER0A 1EY5A 3CW2C 5EKKA 4IUUA 3MEHA 4DR1L 4QQBX 1JICA 1MJCA 2QGQA 4LF9Q 3P7JA 5JEAH 1EY6A 1VQ5A 4JI2L 1XTDA 2L15A 3HKZG 3H0GB 1HNZQ 4DV1Q 1SYCA 2RQXA 4RKLA 2EYFA 2P5ZX 2D2CC 3I4MB 4AQYL 3PQIA 4DXFA 1QJOA 2EZVA 1TXYA 4DPGA 3QG1A 1SBBB 1QNKA 3A5UA 4JI4Q 5GAHC 3G6EA 3T53B 1JOKA 3W3AA 3F2CA 4QCLA 1J5EL 3AFQA 3PIP3 1X3PA 3OYYA 2BOSA 2A6HC 2BA0A 3HOYG 2N78A 4X65L 2VB3X 1AEXA 2M9VA 4DAVA 2FHTA 3NXWA 1ZYRC 4H0LC 3T1HL 1UE6A 3ITPA 3HOZG 1SNMA 1N9WA 4OX9Q 3KBXA 1ESFA 2K5VA 4RCNA 4XDXA 3DHQA 4RAUC 5C6AA 1XPRA 1SFOB 3PCOB 2UUCL 4GKKQ 4DV5L 3O13A 1JOQA 2WINB 5CV6A 1JT8A 3RR5A 4F88A 2MO0A 3S1NH 1BO0A 4A3FG 2UUBQ 4H7BA 3LNNA 3GTKH 1B50A 1C8CA 4B3SQ 1JE4A 2EXDA 4V0BA 4JI1L 1IBKL 2N88A 2UUAQ 1PH8A 1IBLL 1CUKA 4DUZQ 1H9SB 1KL9A 2Q2TA 3S2HH 4IOAA 3ZYYX 4DAPA 2MHVA 5A2QL 1N33L 4JC0A 1V8QA 2B2UC 3G48A 4K8JA 4FDBA 3J81i 2ID0A 3J7ZC 1U0LA 4DAMA 2M2LA 4J8QA 2Q2UA 1MBYA 3MXGA 1HR0Q 1L1OA 3PUWA 2EQSA 1J9OA 2PQEA 5CV8A 4M1UB 4WORA 2KA7A 4G57A 1Y1VG 1HNWQ 1SMYD 5AJ3L 5F2DA 5E4WC 2I0QA 5IWAL 3AFPA 2JSOA 1OTCA 1WFQA 5IIFA 4OWWB 3KYHC 2RKSA 4A3EG 2ZJPA 1Y8OB 5IYCG 1UUPA 4FP5D 1AE3A 1LT5D 2NTTA 1BNZA 1HA6A 2PNHA 1BDOA 1CQFA 5IP7H 3OWEB 4V190 4A75A 1K83H 1A8VA 1HNXL 5CORA 1SNQA 1AN8A 2LXKA 4O1NA 3DWQA 2ZXRA 1I4XA 3IL8A 2DUDA 5JJKA 4ME5A 4X66Q 2V4DA 4KMUC 1AZQA 5M5XH 1BOSA 1SE8A 1E22A 1KDCA 1VQ7A 1BCPC 3HOUB 2JA7G 4UDUC 4P75A 5IGGA 4JOIC 1Y1WB 1I94Q 2OEOA 4POGA 1DOMA 3HOXH 1ICFB 2D0PA 3GTJB 1W3SA 1DGSA 3TEHB 4L5TA 5BN5A 5E4XA 1BXTA 3R8BA 4KY6A 1UNSA 5KRUA 3BVZA 1NMGA 1VQKA 5J22A 4B3MQ 1F2LA 3CC2A 1DOKA 2A6EC 4UP7A 4IUQA 1A3VA 4JI1Q 1IBKQ 3I8ZA 4B3SL 1N8RC 1PH6A 1JB3A 3QR8A 3BU2A 2B29A 3ULLA 3L3OC 2SOBA 3A5ZB 3I4NG 3H15A 5EQ0A 4DV5Q 2EJMA 2JA6H 3OOCA 4B3ML 3H0GH 1FGUA 4CKCA 4MIUA 2Y0SB 2AKWB 1U4PA 3VDYA 5IP7G 4RG1A 1YHQA 3GTOH 1X56A 2R93H 3HEJA 3STBC 3J80c 1WI5A 3FEWX 3RLOA 4BA1I 4AIMA 4DV7L 4G7HC 1A63A 4A3EB 1EIYB 4X64L 3NEMA 2BH8A 1YJ9A 3G6JB 3OIQA 1RD9D 2RDFA 1D5XC 4KHPQ 3R2IA 1W6JA 1OXSC 1JJCB 1GO3E 1BUVT 2G9DA 3HOZB 1EIHA 5M3FH 2NZHA 5EBDA 4LFBL 2PQAB 1VF5C 3DM3A 3FPPA 1GUWA 1VQNA 2ZTDA 3K7AH 3S16H 1AP0A 4DK1A 3HOWG 1GUNA 1YITA 1Y1WH 1CI3M 3HOXB 3GV6A 3KF6B 3GTJH 2JEAI 2LS01 3C1EA 3MXPA 4WJ3M 3I56A 3RLFA 2A5HA 2CVRA 2F0QA 1F2YA 4A3FH 1WD0A 1PYSB 3AMUA 4GOPA 1PMRA 2KCNA 4X3SA 1IKLA 4OX9L 1DZ1A 1K3BC 2FMMA 3S24A 4QB4A 4G7ZC 3PO3B 2SDFA 2L5TA 1N32L 1PH9A 2KOLA 4A3BB 4PQXA 1PV4A 2CQAA 5C4XH 4R9WA 4KN7C 2HIVA 1Q7YC 2KUMA 4H02A 4JVZA 1I4HA 1PXUA 1DYQA 1BBXC 2A73B 2B2VA 3S1RB 1YJWA 2EY1A 5IT9c 2HHHL 3G71A 1YVCA 3KLRA 3A55A 1PZKD 4KY7A 3S1MH 1EY7A 2Z8LA 1Z6HA 2F0NA 1H9MA 4JI0L 5C4ZA 1J6QA 4JI2Q 3KF6A 2B2YC 2NUCA 3CCEA 3URYA 4QIWE 1SJED 3PUVA 1VQDA 5FK9C 2HDLA 3H0GG 3HKZB 3TSSA 4ZYSA 2E2HH 2NVTH 3K59A 1LTGD 3K58A 3AQQA 3I4NH 3IAYA 3CF5A 4X3TA 1UAPA 5IODA 1PRTF 4IQZA 2JA5G 2KCMA 4LF4L 3HP3A 3K5OA 2R7ZG 1D2BA 2C9OA 4ZRZA 1D1KA 5LHY1 3A7AB 1LTSD 4KV6A 4E6IA 4M8AA 5CMDA 1Q81C 5EKIA 1PLFA 2PW5A 2UXDQ 1V1QA 1EY0A 2VB2X 4JBKA 3OWFA 3ERSX 5HY6A 5CR3A 1E7ZA 3PUZA 4F8MA 1HR0W 2JA7H 1TWCB 3MAQA 4WJ4A 2JA8G 1OXUA 2YYZA 3VA7A 2RCNA 1UE7A 2TSSA 3OIPA 2R92G 3A8IE 2Y0SG 4JOIA 1D1IA 4DK3C 3IRBA 1SEBD 4IUTA 2NB0A 1KC8C 4X65Q 4LW1A 4K0KL 4KJOA 1J8IA 2F0PA 1PH2A 3WDNA 1WTRA 3S1MB 4X64Q 3I4MH 4BY7G 1PZID 2MQHA 5IYBG 3CRLC 3VR2A 2BA1A 1K8AC 3BZDB 1G8ZD 3I7FA 5FO8B 3SVMA 1EYGA 2K05A 1E3PA 2DNCA 3CCMA 4XYQA 3H3VI 1UEBA 1A3UA 4Z9CB 4YCWA 1RTOA 4KD3A 3W2DA 1VQ6A 4JYAQ 4C2MB 1YI2A 1A15A 1SYGA 3CCSA 5C4HA 5C4XG 2AQ1B 3W5OA 2HQLA 3K57A 2NWGA 2ZJRA 2E2IH 3MZ5A 3U9SA 3IKJA 1FR3A 3RN2A 2EYHA 4C3JH 1QWYA 3UDFA 1G291 3D6WA 5C3XA 2EYJA 1F9RA 3EBEA 5M5YH 4X6AH 1K8MA 1QNUA 2RDHA 2QILA 3Q23A 4GNXB 4X3KA 1JCKB 1O80A 2XWJB 4YCUA 2Q8IB 3G7LA 4PG3A 5AJ3Q 1EFWA 3TS2A 2VXWA 1W2BA 4C3HH 1EWCA 2K50A 2E8GA 1QVCA 4OWTB 3VA5A 3CCVA 1VQMA 3WWVA 3KLSX 2LKVA 4FF4A 1S5CD 4K5VA 3BVMA 2Z4IA 2DY7A 5I4DA 3T1YL 3HOUG 3TZDA 2VW9A 2HCCA 4HSPA 2JA6B 2F0UA 5JVG3 1LT4D 1HZBA 3L2PA 1IYUA 2L9HA 2ZTCA 1K0RA 1VMCA 2NYZD 5C4JB 4X62Q 1SR3A 1HUMA 2KHIA 5HGQA 1U4MA 4LWCA 2UXCL 2DJFC 2J0TD 2VS1A 1PHJA 4POFA 3J7AV 1Q3LA 1GJXA 2PMZE 2JP1A 1XNRL 5LMNL 4DR4Q 1PYBA 4IOCA 2AQ3B 5TSSA 4F7XA 2M00A 4G7OC 3UE1A 4EQ5A 1KQSA 1KABA 2WB1G 3TZUA 5DNFA 2PZTA 4LFCL 1LTTD 2E5LQ 1SYFA 3NQIA 2QF7A 2PQAA 1HR0L 3CMEA 2WAQG 4KHVA 1WVLA 1QILA 1SNOA 2RHQB 4CJ0B 4DKAC 1HQMC 2XVSA 4R4CA 4DUZL 5C3WA 4UP8A 2YTVA 3GP7A 3NWTA 3CCRA 2BDNA 4B3TQ 1TT2A 4O0AA 2Q2IA 1XPOA 2UUBL 1SE3A 5M3FG 1MSGA 2E5LL 1EY9A 3TQYA 4P74A 3AYHB 3STBD 1Q90A 1F9PA 3SDZA 2K52A 3RMHA 1H9KA 2H1EA 4I7AA 1EOVA 5EPJA 1MKHA 2F0OA 2K03A 4QUCA 1PFSA 4JG2A 4A3JB 1FJGQ 3GTPB 2RBMA 1IBMQ 4R4QA 1R4QB 1IL8A 1XJVA 2Z6BA 1XMQL 2F0MA 4HCSA 3GTMB 3MXNB 2UXBQ 5FO7B 4I65A 4N9TA 1EYDA 5GROA 1EU4A 2K01A 2WP8J 5L37A 2YV5A 3QIAA 3KDFA 4HSVA 1VQCA 2NVXH 4IJLA 1Z47A 4A3EH 5M3MG 1LABA 4CJ2C 1K8OA 4C3JG 1PH5A 3CRKC 1WTXA 2XN9C 1WTPA 5M9OA 1C9OA 2L4NA 2HCIA 1FYCA 2O2LD 2NVTB 1R4PB 3BYTB 1STYA 4DR1Q 1EU3A 3JC66 1FNWA 1ZEQX 4BBRG 4QGUA 3A56A 2GVAA 3QWNA 4LFAL 4NXMQ 3H3VC 1MI2A 1XMOQ 2B2WC 2L11A 3CQZB 5JPNC 2IX0A 2R7FA 1CTMA 4GNXA 5LMUL 1R9TH 4DGZA 4J1MA 2Q2HA 1D5ZC 5CV7A 1KLUD 1SNPA 3D4RA 5DLQE 4KLKA 1H9RA 2F0HA 1B44D 4UY8C 4BXXG 2MO1A 2JA7B 3DXJC 3HRZC 1VQEA 2WACA 4DV7Q 2MP1A 3HS0C 3ERQA 1N34L 1PTOD 2F0SA 3P20A 5D3IB 5CBEE 5IE8A 3GTLH 3HOVG 2WFWA 2XTIA 4IFDG 3X3MA 3J7YW 2K5HA 2JA8H 3PMFA 2B8FA 2NVYH 3BG3A 1BR9A 4HEDA 2F0TA 1IL2A 4HAEA 2RA4A 4DV4L 1RF2D 4P2CB 3RZDH 4N8FA 5FLMG 1S5DD 3LGJA 3KDFB 1V1PB 2EYOA 2KQ3A 5J3BA 1I3QH 2MUYA 2ALYB 1FJGL 2N49A 3NENA 2L0CA 4DNIA 1Y69U 3GTQB 4DK0A 4BY7B 3MXNA 1VQ9A 4FF1A 1OXTA 1BF4A 5IYBH 1MSHA 1SXTA 3T56B 5JEAG 4NXNL 4DUYQ 2JJQA 3HKSA 2IX3A 2ASBA 3KJOA 1SFOH 1N36L 2E2IB 2O4XA 1CKNB 3Q8DA 4DR2Q 3PO2B 4JBMA 1E24A 3E5SA 1T5XD 4I7ZC 4LF5Q 3S1NB 2RSNA 3NTHA 4ZQ3A 4G4KA 1A2TA 1X55A 4K8IA 1ZXTA 3GTKB 1JWSD 2MPMA 4ZKBB 5M3MH 2UU9L 1XMQQ 1HFNA 4EQPA 4DR3Q 1ILQA 1B8AA 3UDXA 4PNYA 2GA4B 3TP5A 2R3ZA 3H3VH 3A54A 5CC4A 2MGSA 1VQ4A 1CM9A 4L5RC 4A3LG 1I50B 2A69C 5C5LA 2UUCQ 1GUOA 2FXQA 1DM0B 2PMZB 4AYBG 1E0BA 2I07B 3S15H 1EY8A 1TWCH 2A1AA 4HMIA 4NKLA 4A3DG 4A3DB 5K36G 1NSNS 3KLSA 2ZT9C 4HIDA 1I5FA 1CK1A 1ET6A 3NSWA 1UWVA 4LUOA 4LMQD 5GQOA 4JI6L 3BS1A 1SRUA 3PIOA 2WKCA 3ICEA 4A93B 1EYCA 1LM0A 1CHQD 3NTKA 4U673 3KF8A 1BQQT 1I3QB 5M5WH 4GKJL 1SJHD 1B3QA 1TWGB 3I3CA 5CBAE 1PH7A 1FVIA 1Y8NB 3HOVB 1BKBA 3SK8A 2RCFA 4KKTA 1TR5A 2IHFA 5C3EB 2B63G 3TMEA 3S14B 1N34Q 2JE6I 2VUMH 3A0JA 1SNCA 5HGTA 2CH4A 3NBIA 1TWFB 3IFTA 2FMCA 4C2MH 1RIPA 1GHKA 5CYUA 4TKOB 1SAPA 3HZXA 2F0KA 1B7YB 4XQNA 1SNDA 4PV1C 4JI8L 2EYMA 1G2TA 3VYSA 2K75A 4ULLA 1BCPF 2PZUA 1CT1D 4FVMA 3V2TA 2K5WA 2MFIA 1ONLA 3CCUA 2AHOB 2HD3A 3M4QA 3SK4A 1P16A 3BYYB 2NZ1D 4C3HB 1NJIC 1HZ9A 5BR8Q 3FP9A 1X3GA 1VCIA 5I9OA 4LF7Q 1B3AA 5FLXc 5IT9L 1V43A 4A3JH 1E2ZA 4CBVA 1G51A 5KGUA 4GN4B 1Q8IA 1HNZL 4BBSG 4WJWA 3CD6A 4A3CG 1EIGA 1STHA 2KCTA 3RZDB 1JQYD 4RGNA 1GUTA 5JJLA 4HJ8A 2PCFB 2YU9B 2DNEA 3PIO3 1L1OC 1XTCD 3A7LA 2NN6G 1PFBA 3J7AF 4X62L 2R61A 4GLXA 2BCOA 1QCBD 3PF5A 3NPPA 2RSOA 4DR7L 4S3SA 2K6AA 3S2DB 4XT1B 5ELOA 1WCMB 3RN5A 1CZGA 2QKIC 3HOWB 1WTQA 1TU2B 3KK7A 5KEEA 5T1IA 4HIMA 1H95A 4O2DA 4ALPA 1E2WA 3E0JA 4JI5L 4DR5L 4KI0A 4UP9A 5FLMH 3K6OA 5G3LF 1RL2A 2C35B 1RKNA 1N33Q 3NELA 4ILWA 1T9HA 1O78A 1VF7A 4DAYB 5IYDG 3PUYA 2A68C 3QOLA 1P8LA 5KNBA 4C3IG 1SMYC 3DLLA 1VQPA 4DNRB 1RCVD 1X9NA 2DN8A 2FINB 1GXDC 1EEFD 1STEA 1QUQB 5K5PA 3M4PA 3FKIH 4JI8Q 1HCZA 3S1QB 4FXKC 1YBYA 3I4OA 2DGYA 4A3GB 2HIXA 2PPBC 4K14A 5JEAJ 4NDXA 3C46A 2OCEA 3PIPA 1MIUA 4CDFC 5IT9E 3GTPH 4FNFA 4CJ1B 4DR4L 4OGQC 1KXLA 1SROA 1EOTA 5FKAC 2F0GA 4K2LA 4L8JA 1F2MA 1WTHA 4QJFA 5COYA 1Q82C 2E2JB 5EKLA 1X3EA 1JJ2A 3JAME 4JI3L 5IGBA 1B53A 2EOTA 1J5EQ 3QOJA 5M5WB 1LTID 1TWGH 2PW7A 3D4WA 2NVQH 3MTSA 1BCPB 3HKZE 4QMGA 4ZKCB 4LJZC 3DWAA 4YWKA 2KJXA 3SK6A 3GTQH 5LL6X 4AYBE 4IPGA 1L1OB 1TVXA 3I70A 3L9AX 3HOZH 4OL7A 5JOBA 1LTLA 1HJPA 4B9XA 3CU7A 1QOHA 1VQLA 1VDZA 5C44B 4K6LA 5LMNQ 2R92B 4QF4A 5JJZA 4A3IH 1ML0D 2VNUD 1U5KA 2PI2E 2LFNA 4PZ8A 1XX8A 4GZYC 1STBA 1CKOA 2F4VQ 1T5EA 3E9IA 4N9PA 1UE1A 2B2UA 2E2DC 1IYJB 4K5XA 3U4VA 2K4KA 1STAA 1Z7TA 4HIKA 1PZJD 3BZCA 4FYDA 1PTOB 3BDCA 1YNXA 5FO9B 1E1TA 2K32A 4B9WA 2Y0SE 2G9HD 2NN6I 1N32Q 4MTNA 1HPCA 4R4TA 4YY3Q 4LF5L 3S2HB 2IL8A 4RGMA 2CW0D 4A3DH 2C5CA 1WTWA 1EEID 4XXEA 3FHWA 2I5LX 1UE5A 1VQIA 1VQGA 4DUYL 1DCZA 4NXNQ 1IYVA 2KENA 1C48A 5T1GA 2AUKA 1EQQA 1IW7C 4OIKA 2D9UA 3ZJYC 4OXPA 3ULJA 3S9WA 2YU9H 1WYDA 3KF8B 4EGVA 1EWIA 1EYAA 3B6YA 1IZ6A 1HNXQ 3MHBA 4IZ8A 4K0KQ 2XWBB 3FVQA 3MXUA 4OO1G 1TS5A 2N55A 2L1BA 1WCMH 4BWGB 5IP9G 3GQBA 1RHPA 3CCQA 1I6HH 4IJHA 4FO2A 3GTGB 2BDOA 4O42A 1DD2A 5KNCA 4A3MB 3SEBA 1I6VC 4WFN3 2E76C 3R2TA 4DV2L 4ZAIA 2E75C 2F0LA 5DM73 2CHBD 4ABNA 5GAEC 1IHZA 4RHSA 3R3OA 1KLGD 2EY6A 2I5HA 4DAYA 4LF6Q 4IUVA 3EJIA 4R4IA 2MJ8A 2EXZA 2VUMG 3MWYW 2B8GA 4LFAQ 3TP6A 4EQOA 3CC4A 4NXML 1U9RA 3C1FA 1ZKOA 2F3VA 3NK9A 3FPUB 4C1NK 4XQJA 1K0SA 4IUPA 1AH9A 2JA6G 5C44G 3TS0A 4C3HG 1S72A 2EE1A 4QUFA 5I2YA 3JAMc 5I2XA 3M4YA 4P73A 2AQ2B 2LSSA 1CQVA 3E3XA 3DEOA 4P72A 4EQNA 4B3RQ 3P1HA 2QA4A 4DV0Q 2A6ED 1TS3A 1QVGA 2NVQB 4A3KH 3I4LA 1CKMA 2R7ZB 1JMCA 1NUCA 1CSPA 1ENAA 1PRTB 1F77A 4QIWB 2NTSA 5C0XH 5BN3A 3WOFA 5KYLA 1LYLA 5C3EH 4RCOA 3QO2A 4JBWA 4JCVE 3TP8A 2O5IC 5GAGC 1NNXA 3F2UA 1GHJA 4B3RL 1W6KA 2E2HB 3LWUA 4MTKA 2OT2A 3I4NB 4DA2A 4PZ6A 4H13C 4JV5L 5A35A 1JB7A 4HR7B 1L0XB 3JAMi 4PMBA 3UE0A 1VQJA 3K0YA 2F0WA 1UEAB 1KAWA 1H9SA 3WOEA 2H5XA 5EGTA 3KLWA 4ZUJA 3VR3A 4IPCA 5DM63 1G6ZA 2BE5C 1DJRD 1TWAB 1K8GA 1S3OA 2CWPA 3M9BA 3D4DA 2LMCB 3MFGA 4GOPB 3PO3G 1KIXA 5AFWA 4ID6A 4JI7L 4R1JA 3V05A 3CKIB 4DN4M 4LF6L 3TRZA 2ATWA 2K5QA
chains in the Genus database with same CATH topology
5CGKA 1RODA 1HRJA 1TS2A 1C4QA 3BDLA 2B63B 4K2KA 1CA6A 4XT3B 4CGYB 3T51B 1DXMA 2E74C 1TKWB 1LTBD 3NP8A 3M7NA 3S17B 1NR2A 3GO5A 5FOBB 4R8NA 3J81E 4DU9A 2H4OA 1ENCA 2K04A 3I91A 1PTOC 1NAPA 1STNA 3Q6SA 5DAUA 1OO9B 5EPLA 3VYRA 3I72A 2NN6H 2K5DA 4PMCA 5A2QE 5CV5A 2EJGC 3H91A 2K33A 1IKMA 2XNAC 3QJYA 3CHBD 3NHHA 1Y8PB 4X3UA 4PMWA 3PUXA 1O7ZA 1M4VA 1ESRA 4XYOA 3V96A 1JWUD 1EY4A 1X32A 4CKEA 1M8AA 2EVBA 1STGA 1Q1BA 3H6MA 5KIXA 1D6EC 4LK1C 3K5MA 3DWPA 3RUZA 1LO5D 3PV0A 1AZPA 1AFPA 1I4QA 2A69D 2J4XA 1XYIA 3EQLC 3D8GA 1WD1A 5G3LD 1BCPD 2EYPA 3VYTA 2KEEA 3MVVA 1ENFA 5JPMC 2WIIB 2Z1CA 1TQOA 4AYBB 4MHEA 3OSOA 2FFKB 4OO1I 2EPBA 5FLXL 5C0XJ 3NWSA 2SEBD 5BN4A 2KCCA 4DF7A 1HFGA 4ODGA 3K5NA 3TP7A 1U4LA 1L0YB 5NUCA 2NBFA 2SNSA 4OHJA 4KKUA 4IFDJ 2F0JA 1S5BD 4BY1B 4CKBA 4H44C 1ILPA 5C0XI 5FLXE 3HOYB 4Q0FA 1KAAA 5IOCA 2AUJD 1K83B 2K7VA 4ZK9B 4HTHA 1F9QA 1XWEA 4C1NI 1JORA 2BE5D 3NQTA 5M3FB 1WTOA 1A2UA 2RDGA 1B1ZA 1KNEA 3AB9A 1I4RA 4J6HA 3TBIB 3SHLA 3J81L 3E6ZX 3SE0A 4BS9A 2AWNA 4RWSC 4Q5VA 1O7LA 5E3FA 1LTRD 2A6HD 2ENBA 1S5ED 3SR1A 2D5DA 4IALA 1PTOF 1ET9A 5CV9A 1U4RA 2EJFC 2B2WA 3N52A 4KTAA 2B2TC 1YNND 1CA5A 2F03A 3GTLB 2XSCA 1KDBA 3GV3A 1EZ8A 3NTIA 5IGEA 1F2ZA 4KKSA 1KDAA 4EVOA 2JXMB 4A3KB 4IN3A 1V1PA 3RD4A 1JC7A 1OXVA 3X3NA 2NVXB 1LT6D 1GOZA 3DM1A 1XXGA 5J39A 2OXPA 4UAIA 5C5MA 2HQEA 1RDPD 3U9OA 1JOOA 2X6GA 3S16B 1CZWA 1Q12A 3A8JE 2IW3A 4KJNA 3DEPA 1B2TA 2Q8RE 1NR4A 5KNDA 3VYUA 2F0EA 1MGSA 3OPOA 2PO4A 1AW7A 2F3WA 3BVGA 3FKIB 2EY2A 1HQRD 2PYKA 5LL6S 1RJTA 1EQVA 5J1ZA 1SE2A 1V1OA 4K5WA 2K28A 1HHVA 2XRSD 2WAQB 5D65A 2TMPA 2B2YA 5DEHA 3GTOB 2NVYB 2K1BA 2IT1A 4DXGA 2R6GA 1QE6A 2PZWA 1FD7D 3IFDA 1PRTD 2B39A 2WV6D 1JWMD 4HCEA 2X69A 1LTAD 2RVLA 2SNMA 4BBSB 1KTKA 5I6YA 2XRQD 5EBCA 3ND9A 5M5YB 3NE5B 3D6CA 1CHPD 5HURA 1TWHB 1IW7D 4L6TB 3KBGA 2DY8A 1HTLD 2F4IA 5E1FA 4C56C 1PFNA 2L55A 1QB5D 2OF1A 3T16A 3FDTA 3M4OB 1O7YA 1A3TA 2QDBA 4F87A 1PDQA 3T13A 4IUNA 1GUGA 3EVQA 4KD4A 1NCVA 1PYWD 1TY2A 3C3LA 5C4XB 4XTCS 3NUCA 5ELBA 3I73A 4OO1H 2KVMA 4YIJA 1YNJD 5ELEA 5I9PA 2PNRC 4WRDA 4U68A 3M3YB 1G91A 3J80E 2J7ZA 3J80L 1SYBA 2EYLA 3M7GA 3HG9A 1E2VA 1ZYRD 2IX1A 1H9JA 1I4GA 1B4OA 5EJWA 1G2SA 4KHZA 1TIID 1CFMA 5C0XG 4TQUS 4C3JB 2FJ2A 4HMJA 1HUNA 3LWEA 1X3QA 5ELFA 4DFAA 3P75A 1D5MC 1PTOH 1B9NA 2ICEC 4C3IB 4TRDA 4KY5A 3DUZA 2F0FA 2IWHA 3JAML 1LLRD 4IFDI 4KK7A 3N6RA 3SK5A 1SYDA 3GD7A 2Q8TA 3BDOA 2JA5B 2JYOA 4K6DA 4BA2I 1SYEA 4IFDH 3Q0AA 1B9MA 3H09A 3KUPA 3OW7A 3I90A 3LX0A 4L63B 4FXGC 4JK1C 1KNAA 4NW2A 3FRPB 4R8IA 4RA8A 1HA5A 2LY7A 4Y7NB 3TDQA 1SSOA 1QG7A 1S5FD 3VR5A 1EL0A 2F0DA 2B2VC 1HTPA 1DOLA 3ONAB 3D3RA 1I4PA 1LACA 3Q22A 4FF3A 3OHXC 5ELDA 1VMPA 3UI2A 1YNNC 3Q24A 1PRTC 1R9TB 1PFMA 1ICWA 1Y1VB 1FGBD 1EWHA 4RGOS 3EFXD 2JEBI 2ZXOA 5KYIA 3S15B 1SE4A 4RFBA 1SDFA 3EROA 5JAVA 3MA2B 1LV9A 3L7ZC 4NMZA 4BBRB 3FMCA 4XQQA 1A6XA 2A68D 3SXHA 3TN2A 3C2PA 3HGBA 2ZXPA 4FF2A 1OXXK 3K5LA 4ZUIA 2VUMB 1F9SA 4KN4C 2Z4HA 3OMCA 3QB3A 2D62A 2X6LA 2F0VA 2WKDA 1I6HB 5IGDA 1Q1EA 3T4AC 3NBHA 3AU7A 5ELCA 5D3DA 2KEDA 1HXYD 4A3IB 4ZLTF 4A3FB 2XIWA 4RKBA 1MD2D 4LAAA 3M85A 1II3A 2ICIA 4HN7A 5I6WA 3MFYA 1WTVA 3VR4A 5ISRA 2EDGA 5D14A 1GUSA 4B08A 3VR6A 2O5JC 3MC0B 2EY5A 1YNJC 5K36H 1EFID 2IPKD 4RGTA 1EQTA 2QCPX 4IURA 2I46A 2QEJC 3EA6A 5EPKA 2HDMA 1FNVA 3ND8A 4CHTB 5IGFA 2JA8B 5IGCA 2F0IA 2R93B 1RTNA 4RHRA 4TSSA 3D31A 1LT3D 3OMGA 2WB1B 1DONA 3H94A 3DMUA 2CW0C 4XIGS 1S4ZA 1TS4A 1JR0D 3A8KE 4FXDA 2AWOA 5JVH3 4NP5A 2IJ0A 3K7AB 2F1MA 5M5XB 2HUGA 3R93A 4MN3A 3RZOB 1TY0A 4OIJA 1EZ6A 2KHSA 2L12A 5M3MB 1FNUA 2B2TA 4RH6A 5CV4A 2A74C 4DNTB 2KECA 1EY5A 5EKKA 4IUUA 3MEHA 1JICA 3P7JA 5JEAH 1EY6A 3H0GB 1SYCA 2RQXA 4RKLA 2EYFA 2D2CC 3I4MB 4DXFA 1QJOA 2EZVA 3QG1A 1SBBB 1QNKA 3T53B 1JOKA 3W3AA 4QCLA 3PIP3 1X3PA 2BOSA 2A6HC 2BA0A 2VB3X 1AEXA 2M9VA 4DAVA 2FHTA 3NXWA 1ZYRC 4H0LC 3ITPA 1SNMA 3KBXA 1ESFA 4RCNA 4XDXA 3DHQA 4RAUC 5C6AA 1SFOB 3O13A 1JOQA 2WINB 5CV6A 4F88A 1BO0A 4H7BA 3LNNA 1B50A 1C8CA 1JE4A 4V0BA 2N88A 1H9SB 3ZYYX 4DAPA 2MHVA 5A2QL 1V8QA 2B2UC 4K8JA 2ID0A 2M2LA 4J8QA 1MBYA 3MXGA 3PUWA 1J9OA 2PQEA 5CV8A 4M1UB 4WORA 2KA7A 4G57A 1SMYD 5F2DA 5E4WC 2JSOA 5IIFA 2RKSA 1Y8OB 1UUPA 4FP5D 1LT5D 2NTTA 1BNZA 1HA6A 1BDOA 1CQFA 3OWEB 4V190 5CORA 1SNQA 1AN8A 4O1NA 3DWQA 2ZXRA 1I4XA 3IL8A 4ME5A 2V4DA 4KMUC 1AZQA 1BOSA 1KDCA 1BCPC 3HOUB 4UDUC 5IGGA 1Y1WB 2OEOA 1DOMA 3GTJB 5BN5A 5E4XA 1BXTA 3R8BA 4KY6A 1UNSA 5KRUA 3BVZA 5J22A 1F2LA 1DOKA 2A6EC 4IUQA 1A3VA 3I8ZA 1JB3A 3L3OC 2SOBA 5EQ0A 2EJMA 3OOCA 4CKCA 4MIUA 2Y0SB 1U4PA 3HEJA 3FEWX 4BA1I 4G7HC 4A3EB 3G6JB 3OIQA 1RD9D 2RDFA 1D5XC 3R2IA 1W6JA 1OXSC 1BUVT 2G9DA 3HOZB 1EIHA 5EBDA 1VF5C 3FPPA 1GUWA 1AP0A 4DK1A 1GUNA 1CI3M 3HOXB 3GV6A 2JEAI 2LS01 3C1EA 3MXPA 3RLFA 2A5HA 2CVRA 2F0QA 1F2YA 1WD0A 3AMUA 1PMRA 2KCNA 4X3SA 1IKLA 1DZ1A 2FMMA 4QB4A 4G7ZC 3PO3B 2SDFA 2L5TA 2KOLA 4A3BB 4PQXA 2CQAA 4R9WA 4KN7C 2KUMA 1I4HA 1PXUA 1DYQA 1BBXC 2A73B 2B2VA 3S1RB 2EY1A 3KLRA 3A55A 1PZKD 4KY7A 1EY7A 2Z8LA 1Z6HA 2F0NA 1H9MA 5C4ZA 2B2YC 2NUCA 3URYA 1SJED 3PUVA 5FK9C 2HDLA 3HKZB 3TSSA 4ZYSA 3K59A 1LTGD 3K58A 3IAYA 4X3TA 1UAPA 5IODA 1PRTF 4IQZA 3HP3A 3K5OA 1D2BA 2C9OA 4ZRZA 1D1KA 5LHY1 3A7AB 1LTSD 4KV6A 4E6IA 4M8AA 5CMDA 5EKIA 1PLFA 2PW5A 1EY0A 2VB2X 3OWFA 5CR3A 3PUZA 4F8MA 1TWCB 3MAQA 1OXUA 2YYZA 3VA7A 3OIPA 2TSSA 3A8IE 1D1IA 1SEBD 4IUTA 2NB0A 4KJOA 1J8IA 2F0PA 3WDNA 1WTRA 3S1MB 1PZID 3CRLC 3VR2A 2BA1A 3BZDB 1G8ZD 5FO8B 3SVMA 2K05A 2DNCA 4XYQA 1A3UA 4Z9CB 1RTOA 4KD3A 3W2DA 4C2MB 1A15A 1SYGA 5C4HA 2AQ1B 3K57A 2NWGA 3MZ5A 3U9SA 3IKJA 1FR3A 2EYHA 1QWYA 1G291 3D6WA 5C3XA 2EYJA 1F9RA 1K8MA 1QNUA 2RDHA 2QILA 3Q23A 4X3KA 1JCKB 1O80A 2XWJB 2Q8IB 3G7LA 2VXWA 1EWCA 3VA5A 3KLSX 2LKVA 4FF4A 1S5CD 4K5VA 3BVMA 2Z4IA 2DY7A 5I4DA 3TZDA 2HCCA 4HSPA 2JA6B 2F0UA 5JVG3 1LT4D 1IYUA 2L9HA 1VMCA 2NYZD 5C4JB 1HUMA 1U4MA 2J0TD 3J7AV 1Q3LA 1GJXA 2JP1A 2AQ3B 5TSSA 4F7XA 2M00A 4G7OC 1KABA 3TZUA 5DNFA 2PZTA 1LTTD 1SYFA 3NQIA 2QF7A 4KHVA 1WVLA 1QILA 1SNOA 4CJ0B 1HQMC 2XVSA 5C3WA 3GP7A 3NWTA 2BDNA 1TT2A 1SE3A 1MSGA 1EY9A 1Q90A 1F9PA 3SDZA 3RMHA 1H9KA 2H1EA 5EPJA 2K03A 2F0OA 4QUCA 4A3JB 3GTPB 2RBMA 1R4QB 1IL8A 2F0MA 4HCSA 3GTMB 5FO7B 4I65A 4N9TA 1EYDA 1EU4A 2K01A 2WP8J 3QIAA 4HSVA 1Z47A 1LABA 4CJ2C 1K8OA 4C3JG 3CRKC 1WTXA 2XN9C 1WTPA 5M9OA 2L4NA 2HCIA 1FYCA 2O2LD 2NVTB 1R4PB 3BYTB 1STYA 1EU3A 1FNWA 1ZEQX 3A56A 3QWNA 3H3VC 1MI2A 2B2WC 2L11A 3CQZB 5JPNC 2IX0A 1CTMA 4DGZA 4J1MA 1D5ZC 5CV7A 1KLUD 1SNPA 3D4RA 1H9RA 2F0HA 1B44D 2JA7B 3DXJC 3HRZC 2WACA 2MP1A 3HS0C 3ERQA 1PTOD 2F0SA 3P20A 5D3IB 5CBEE 4IFDG 3X3MA 3J7YW 3PMFA 2B8FA 3BG3A 1BR9A 4HEDA 2F0TA 4HAEA 2RA4A 1RF2D 4P2CB 1S5DD 1V1PB 2EYOA 2KQ3A 2MUYA 2L0CA 1Y69U 3GTQB 4DK0A 4BY7B 3MXNA 4FF1A 1BF4A 1OXTA 1MSHA 1SXTA 3T56B 5JEAG 2IX3A 2E2IB 2O4XA 3PO2B 3E5SA 1T5XD 4I7ZC 3S1NB 2RSNA 3NTHA 4ZQ3A 4G4KA 1A2TA 4K8IA 1ZXTA 3GTKB 1JWSD 2MPMA 4ZKBB 1HFNA 4EQPA 1ILQA 4PNYA 2GA4B 3TP5A 2R3ZA 3A54A 5CC4A 2MGSA 1CM9A 1I50B 2A69C 5C5LA 1GUOA 1DM0B 2PMZB 1E0BA 2I07B 1EY8A 4HMIA 4NKLA 4A3DB 5K36G 1NSNS 3KLSA 2ZT9C 1ET6A 1CK1A 3NSWA 4LMQD 3BS1A 2WKCA 4A93B 1EYCA 3NTKA 1CHQD 4U673 3KF8A 1BQQT 1I3QB 1SJHD 1TWGB 3I3CA 5CBAE 1Y8NB 3HOVB 3SK8A 5C3EB 4KKTA 3S14B 1TR5A 3TMEA 2JE6I 1SNCA 5HGTA 3NBIA 1TWFB 3IFTA 2FMCA 1GHKA 5CYUA 4TKOB 1SAPA 3HZXA 2F0KA 4XQNA 1SNDA 4PV1C 2EYMA 1G2TA 3VYSA 4ULLA 1BCPF 2PZUA 1CT1D 4FVMA 3V2TA 2K5WA 1ONLA 3SK4A 3BYYB 2NZ1D 4C3HB 1VCIA 5I9OA 1B3AA 5IT9L 1V43A 1E2ZA 4CBVA 5KGUA 1Q8IA 4WJWA 1EIGA 1STHA 3RZDB 1JQYD 4RGNA 1GUTA 2YU9B 2PCFB 2DNEA 3PIO3 1XTCD 3A7LA 2NN6G 1PFBA 3J7AF 2R61A 2BCOA 1QCBD 3NPPA 2RSOA 4S3SA 2K6AA 3S2DB 4XT1B 1WCMB 1CZGA 2QKIC 3HOWB 1WTQA 1TU2B 3KK7A 5KEEA 5T1IA 1E2WA 3E0JA 4KI0A 3K6OA 5G3LF 1RKNA 4ILWA 1O78A 1VF7A 3PUYA 2A68C 3QOLA 5KNBA 4C3IG 1SMYC 4DNRB 1RCVD 2DN8A 2FINB 1GXDC 1EEFD 1STEA 5K5PA 3S1QB 1HCZA 4FXKC 4A3GB 2PPBC 5JEAJ 3C46A 4K14A 4NDXA 5IT9E 4FNFA 4CJ1B 4OGQC 1EOTA 5FKAC 2F0GA 4K2LA 4L8JA 1F2MA 5COYA 2E2JB 5EKLA 3JAME 5IGBA 1B53A 2EOTA 3QOJA 5M5WB 1LTID 2PW7A 3D4WA 3MTSA 1BCPB 4QMGA 4ZKCB 4LJZC 3DWAA 2KJXA 3SK6A 5LL6X 1TVXA 3I70A 3L9AX 4OL7A 5JOBA 4B9XA 3CU7A 1QOHA 1VDZA 5C44B 4K6LA 2R92B 4QF4A 5JJZA 1ML0D 2VNUD 4GZYC 2LFNA 1XX8A 1STBA 1T5EA 4N9PA 2B2UA 2E2DC 4K5XA 1STAA 1Z7TA 1PZJD 4FYDA 1PTOB 3BDCA 5FO9B 2K32A 4B9WA 2G9HD 2NN6I 1HPCA 3S2HB 2IL8A 4RGMA 2CW0D 2C5CA 1WTWA 1EEID 4XXEA 1DCZA 1IYVA 1C48A 5T1GA 2AUKA 1IW7C 4OIKA 2D9UA 3S9WA 4EGVA 1EYAA 3MHBA 4IZ8A 2XWBB 3FVQA 3MXUA 4OO1G 1TS5A 2N55A 2L1BA 4BWGB 3GQBA 1RHPA 4FO2A 3GTGB 2BDOA 4O42A 1DD2A 5KNCA 4A3MB 3SEBA 1I6VC 4WFN3 2E76C 3R2TA 4ZAIA 2E75C 2F0LA 5DM73 2CHBD 4ABNA 1IHZA 4RHSA 3R3OA 1KLGD 2EY6A 4DAYA 4IUVA 3EJIA 2MJ8A 2EXZA 3MWYW 2B8GA 3TP6A 4EQOA 1U9RA 3C1FA 1ZKOA 2F3VA 3NK9A 3FPUB 4C1NK 4XQJA 4IUPA 4C3HG 2EE1A 4QUFA 5I2YA 5I2XA 3M4YA 2AQ2B 1CQVA 3DEOA 4EQNA 3P1HA 2A6ED 1TS3A 2NVQB 3I4LA 2R7ZB 1NUCA 1ENAA 1PRTB 1F77A 4QIWB 2NTSA 5C0XH 5BN3A 3WOFA 5KYLA 4RCOA 3QO2A 4JBWA 3TP8A 2O5IC 3F2UA 1GHJA 2E2HB 1W6KA 3LWUA 2OT2A 3I4NB 4DA2A 4H13C 5A35A 4HR7B 1L0XB 4PMBA 3K0YA 2F0WA 1UEAB 1H9SA 3WOEA 5EGTA 4ZUJA 3VR3A 5DM63 1G6ZA 2BE5C 1DJRD 1TWAB 3D4DA 2LMCB 3MFGA 5AFWA 4ID6A 3V05A 3CKIB 4DN4M 2K5QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KIX A;  2EYJ A;  5CGK A;  2NUC A;  2F0M A;  5IGB A;  2SOB A;  3RUZ A;  3QOJ A;  3DHQ A;  3OMG A;  5C6A A;  5DEH A;  5KYI A;  2PW7 A;  3D4W A;  5E3F A;  5I9O A;  2F0L A;  3BDL A;  4I65 A;  2ENB A;  4N9T A;  4QMG A;  3VA5 A;  1EYD A;  4K2K A;  5CV6 A;  3SR1 A;  1JOQ A;  4MIU A;  3ERO A;  5JAV A;  1IHZ A;  3DMU A;  4IAL A;  2LKV A;  2O4X A;  4H7B A;  3SK6 A;  3D8G A;  3R3O A;  2EY6 A;  3HEJ A;  3E5S A;  4K5V A;  3ITP A;  5KGU A;  2PZW A;  2EYP A;  4HMJ A;  5CV9 A;  4ZQ3 A;  1A2T A;  5IOD A;  3MVV A;  3EJI A;  4K8I A;  4OL7 A;  5JOB A;  2EXZ A;  4NMZ A;  4DFA A;  4NP5 A;  4B9X A;  3P75 A;  4EQP A;  4EQO A;  3TP6 A;  5C3W A;  4PNY A;  3TP5 A;  1STH A;  4KTA A;  1TQO A;  5M9O A;  2F0U A;  1U9R A;  4KV6 A;  4E6I A;  5CC4 A;  3SXH A;  3C1F A;  4QF4 A;  3OSO A;  2F3V A;  1KDB A;  3NK9 A;  4K8J A;  3NP8 A;  2RDF A;  4TRD A;  4KY5 A;  5C5L A;  2F0F A;  1STY A;  2PW5 A;  1STB A;  1EZ8 A;  1EY0 A;  4ZUI A;  1EY8 A;  5IGE A;  2SNM A;  3OWF A;  1F2Z A;  4HMI A;  1SYD A;  4N9P A;  2PQE A;  4NKL A;  1KDA A;  1NSN S;  1EZ6 A;  4K5X A;  4WOR A;  2KHS A;  5CR3 A;  5CV8 A;  4K6D A;  4ODG A;  4EVO A;  4G57 A;  4F8M A;  5I6Y A;  3TP7 A;  4R8N A;  3OMC A;  3QB3 A;  5F2D A;  1STA A;  5CV4 A;  5NUC A;  4DU9 A;  1SYE A;  4S3S A;  3D6C A;  5IIF A;  3BDC A;  1ENC A;  4EQN A;  5HUR A;  2RKS A;  3P1H A;  4F7X A;  2F0V A;  3SK5 A;  3LX0 A;  4J1M A;  2M00 A;  4B9W A;  5CV7 A;  4DGZ A;  5J39 A;  1SNP A;  1EY5 A;  2OXP A;  2SNS A;  5IGD A;  1STN A;  3C1E A;  5EKK A;  5KEE A;  3MXP A;  1EYC A;  2F0J A;  3MEH A;  5C5M A;  1KAB A;  5DAU A;  2F0Q A;  1F2Y A;  1ENA A;  1NUC A;  2F0H A;  4KJO A;  2PZT A;  5E1F A;  2F0P A;  2HQE A;  2OF1 A;  3T16 A;  1SYF A;  3U9O A;  5KYL A;  1EY6 A;  1SNQ A;  1A3T A;  1JOO A;  2QDB A;  1RKN A;  1SNO A;  2WAC A;  4KHV A;  4PMC A;  4RKB A;  3TP8 A;  4LAA A;  4QB4 A;  5CV5 A;  3T13 A;  1SYC A;  3SK8 A;  3ERQ A;  1TR5 A;  3QOL A;  4IUN A;  1II3 A;  2EYF A;  3EVQ A;  4RKL A;  3TME A;  2F0S A;  4KD4 A;  4ME5 A;  5I6W A;  1SNC A;  5HGT A;  3S9W A;  1A3U A;  1KDC A;  1KAA A;  1TT2 A;  5IOC A;  4KJN A;  5ISR A;  3PMF A;  3NUC A;  4PMB A;  5C3X A;  3NHH A;  4KD3 A;  1EYA A;  2F0T A;  2F0W A;  2F0D A;  1EY9 A;  4HTH A;  2F0E A;  5IGG A;  5K5P A;  3HZX A;  2F0K A;  2OEO A;  3MHB A;  2EY5 A;  4IZ8 A;  5EGT A;  1SND A;  1JOR A;  3NQT A;  4ZUJ A;  2EYM A;  2F3W A;  1JOK A;  4YIJ A;  1SYG A;  4KY6 A;  5C4H A;  2PZU A;  1A2U A;  4K14 A;  4NDX A;  2EY2 A;  5I9P A;  2EYO A;  5IGF A;  5KRU A;  4WRD A;  2PYK A;  2EY1 A;  2KQ3 A;  3V2T A;  5J22 A;  1EY4 A;  2F0O A;  4J6H A;  3SHL A;  3D4D A;  2F0G A;  1AEX A;  1EQV A;  1F2M A;  4K2L A;  4KY7 A;  5J1Z A;  1EY7 A;  4DF7 A;  1A3V A;  4ID6 A;  3MZ5 A;  5IGC A;  2F0I A;  4K5W A;  3NXW A;  2RBM A;  2F0N A;  2EYH A;  1STG A;  5EKL A;  1SYB A;  3SK4 A;  5C4Z A;  2EYL A;  3H6M A;  1SNM A; 
#chains in the Genus database with same CATH topology
 1GM5 A;  5CGK A;  3L0O A;  1ROD A;  4A3G H;  2UUA L;  1HRJ A;  1TS2 A;  3OTO Q;  1C4Q A;  3BDL A;  2B63 B;  4K2K A;  1HH2 P;  4GN5 A;  4DV0 L;  1CA6 A;  4XT3 B;  4JBJ A;  2K5N A;  4CGY B;  1LUZ A;  3T51 B;  1M1K C;  4DR7 Q;  1A0I A;  1DXM A;  2E74 C;  2R7Z H;  4A93 G;  4HJ9 A;  1X6O A;  1WOC A;  2JK8 A;  1TKW B;  3HOY H;  1LTB D;  2GVB A;  5JJI A;  1XNQ Q;  4QY7 A;  3NP8 A;  1VQF A;  2CQO A;  3M7N A;  3S17 B;  1NR2 A;  4MNO A;  4IO9 A;  4A3I G;  4BY1 G;  1VQA A;  3S2D H;  3GO5 A;  5FOB B;  4R8N A;  3BZK A;  3J81 E;  4YHH L;  1C7Y A;  4DU9 A;  1SN8 A;  1PA6 A;  2H4O A;  2R92 H;  1ENC A;  2K04 A;  3NBH B;  3I91 A;  1YZ6 A;  1PTO C;  4JI7 Q;  2A19 A;  1NAP A;  1STN A;  3Q6S A;  1O7I A;  2CFM A;  5DAU A;  1OO9 B;  4LNQ A;  5EPL A;  3VYR A;  3I72 A;  2NN6 H;  2Z9H A;  2K5D A;  1KRT A;  3K80 C;  4PMC A;  3K81 C;  5A2Q E;  5CV5 A;  2EJG C;  1K28 A;  3MEF A;  2I5M X;  3H91 A;  2K33 A;  4ME3 A;  1IKM A;  2XNA C;  4JV5 Q;  3QJY A;  3CHB D;  2R7D A;  2UU9 Q;  3NHH A;  1Y8P B;  4X3U A;  4PMW A;  4DV4 Q;  3PUX A;  2D0O A;  2KBN A;  1O7Z A;  1EIF A;  1M4V A;  4IPH A;  1ESR A;  4XYO A;  3V96 A;  4KHP L;  2QDL A;  1JWU D;  1EY4 A;  5C4J H;  2YTX A;  1X32 A;  2VL6 A;  5IYC H;  4CKE A;  1M8A A;  2EVB A;  1JE5 A;  1STG A;  1Q1B A;  3H6M A;  5KIX A;  1D6E C;  4LK1 C;  3K5M A;  3DWP A;  2OTL A;  3RUZ A;  1NMF A;  1LO5 D;  3PV0 A;  1ASZ A;  1AZP A;  1AFP A;  2QW7 A;  1I4Q A;  2A69 D;  2J4X A;  3K0X A;  1XYI A;  4R4O A;  3EQL C;  3CCL A;  3D8G A;  1WD1 A;  5G3L D;  1BCP D;  2EYP A;  3VYT A;  2KEE A;  3MVV A;  1ENF A;  3HOU H;  5JPM C;  4A3B G;  2WII B;  2Z1C A;  3HFZ B;  1TQO A;  3EN2 A;  4AYB B;  4A76 A;  1EUJ A;  4MHE A;  3OSO A;  4PZ7 A;  2FFK B;  4OO1 I;  2EPB A;  5FLX L;  5C0X J;  3J80 i;  3NWS A;  2OQ0 A;  2SEB D;  3AEV A;  2CCZ A;  5BN4 A;  2KCC A;  4GLA C;  2WAQ E;  2B3G A;  4DF7 A;  1HFG A;  1NBW A;  4ODG A;  3U4Z A;  3K5N A;  3TP7 A;  1U4L A;  1L0Y B;  1YHA A;  3CAM A;  5NUC A;  1X65 A;  2DJG C;  1K9M C;  4DR2 L;  2NBF A;  2SNS A;  1D8L A;  1VQ8 A;  4OHJ A;  4KKU A;  4IFD J;  2F0J A;  3RLN A;  1S5B D;  2Z0S A;  3GTM H;  4EX5 A;  4TVA B;  4BY1 B;  4GLV B;  4CKB A;  4H44 C;  1ILP A;  2N8N A;  5C0X I;  2CWA A;  4OEL B;  5FLX E;  3HOY B;  3U50 C;  4Q0F A;  1KAA A;  5IOC A;  3S14 H;  3CMA A;  2AUJ D;  1K83 B;  2K7V A;  4ZK9 B;  4LF9 L;  4HTH A;  1HNW L;  1F9Q A;  3K8A A;  1XWE A;  4C1N I;  1JOR A;  2BE5 D;  3NQT A;  5M3F B;  1WTO A;  1A2U A;  1HZC A;  2RDG A;  3OTO L;  1B1Z A;  2JQO A;  1KNE A;  4B3T L;  3AB9 A;  1I4R A;  2KHJ A;  4J6H A;  3TBI B;  3GTG H;  3SHL A;  3J81 L;  3E6Z X;  4JI4 L;  2Z6K A;  3SE0 A;  4BS9 A;  2IHE A;  1IXR A;  2AWN A;  4RWS C;  4Q5V A;  3BJU A;  1O7L A;  3CP0 A;  1ASY A;  5E3F A;  1LTR D;  2A6H D;  2ENB A;  1S5E D;  3SR1 A;  4HJ5 A;  3FKI G;  2D5D A;  4IAL A;  5H1S E;  2VQE Q;  5EAY A;  1PTO F;  1ET9 A;  4JI0 Q;  4UPA A;  3UDI A;  5CV9 A;  1U4R A;  5IY0 A;  2JA5 H;  1KRS A;  2EJF C;  2B2W A;  3N52 A;  4KTA A;  2B2T C;  1YNN D;  1L0W A;  1CA5 A;  2F03 A;  3GTL B;  2XSC A;  1WCM G;  4BY1 H;  2ZJQ A;  1KDB A;  3GV3 A;  1YJN A;  3PF4 A;  1EZ8 A;  3NTI A;  5IGE A;  1F2Z A;  4KKS A;  1KDA A;  3KOJ A;  3TRE A;  4EVO A;  1YIJ A;  2JXM B;  1I94 L;  4A3K B;  4IN3 A;  1V1P A;  3RD4 A;  1JC7 A;  1OXV A;  3X3N A;  2NVX B;  1LT6 D;  1GOZ A;  3DM1 A;  1XXG A;  5LMN W;  2PI2 A;  2G5D A;  5J39 A;  5IYD H;  2OXP A;  4UAI A;  1TWF H;  5C5M A;  4DK6 C;  2HQE A;  4OEM B;  3SGI A;  1QZG A;  1RDP D;  3U9O A;  4YWM A;  1SMX A;  1JOO A;  2X6G A;  3S16 B;  1CZW A;  1Q12 A;  1XPU A;  2VQF L;  4DV6 Q;  3J81 j;  4BBS H;  3A8J E;  2IW3 A;  2Z6K C;  4KJN A;  3DEP A;  1B2T A;  1Q46 A;  2Q8R E;  1NR4 A;  2VQE L;  5KND A;  3VYU A;  2F0E A;  1MGS A;  4DV3 L;  5IWA Q;  3OPO A;  2CKZ B;  3KFU A;  2PO4 A;  1AW7 A;  2F3W A;  3UDG A;  1X3F A;  2A8V A;  3BVG A;  3FKI B;  2OQK A;  2EY2 A;  1HQR D;  2PYK A;  5LL6 S;  4NPS A;  1RJT A;  3M4O H;  4HJA A;  1EQV A;  5J1Z A;  1FL0 A;  4A3C H;  1SE2 A;  1V1O A;  1YEZ A;  4A3B H;  4K5W A;  2K28 A;  1HHV A;  2XRS D;  2WAQ B;  5D65 A;  1VQB A;  2E2J H;  2OWO A;  4YWL A;  2TMP A;  2B63 H;  4BBR H;  1BBU A;  2B2Y A;  1AE2 A;  1X54 A;  5DEH A;  1QUQ A;  2N3S A;  3GTO B;  3KJP A;  2NVY B;  5C3E G;  2K1B A;  1GD7 A;  1XNQ L;  2IT1 A;  2ES2 A;  4DXG A;  2R6G A;  1GVP A;  1QE6 A;  4APV A;  2PZW A;  3M3Y H;  1FD7 D;  3IFD A;  3A74 A;  1PRT D;  3GDE A;  5IP9 H;  2B39 A;  3S17 H;  3I4M G;  2WV6 D;  4BY7 H;  1JWM D;  4HCE A;  1PVO A;  2X69 A;  1LTA D;  5FJ8 H;  2RVL A;  4LUV A;  1Q8K A;  2NZO A;  2SNM A;  2ZTE A;  3RZO H;  4BBS B;  1KTK A;  5I6Y A;  2XRQ D;  2UXB L;  5EBC A;  3ND9 A;  1SLJ A;  4OWX B;  1HZA A;  5M5Y B;  3NE5 B;  3D6C A;  1CHP D;  5HUR A;  4QL5 A;  4GOP C;  4JI3 Q;  4CDC C;  1N36 Q;  1TWH B;  1IW7 D;  3CPF A;  1NTG A;  4L6T B;  3KBG A;  1Y1V H;  2DY8 A;  3W1G A;  5GAD C;  1EQR A;  1HTL D;  4JW0 A;  2F4I A;  5E1F A;  4C56 C;  1PFN A;  1QZH A;  2L55 A;  1QB5 D;  2OF1 A;  3T16 A;  4DV3 Q;  3FDT A;  3M4O B;  4UHV A;  1O7Y A;  1A3T A;  2QDB A;  4F87 A;  4GKK L;  1PDQ A;  1XNR Q;  3T13 A;  4IUN A;  1GUG A;  3EVQ A;  3I2Z A;  4GN3 B;  3D0F A;  4KD4 A;  2VQF Q;  1NCV A;  4DV6 L;  2F3I A;  1PYW D;  1TY2 A;  3C3L A;  5C4X B;  4HJ7 A;  3T1H Q;  4XTC S;  3NUC A;  5ELB A;  4NB3 A;  4LF4 Q;  3ULP A;  1NY4 A;  3I73 A;  4OO1 H;  2KVM A;  2VZA A;  1C0A A;  4YIJ A;  1YNJ D;  4GKJ Q;  3OW2 A;  5ELE A;  5I9P A;  2PNR C;  4WRD A;  4U68 A;  3M3Y B;  2V1C C;  1G91 A;  2JN4 A;  3J80 E;  3RNU A;  2J7Z A;  1Y1W G;  3J80 L;  2QEX A;  1SYB A;  3HOV H;  2F52 A;  2EYL A;  3M7G A;  3HG9 A;  4Y7N H;  1E2V A;  1ZYR D;  2K14 A;  4MZ9 A;  2IX1 A;  1QVF A;  3F2D A;  1H9J A;  1I4G A;  1B4O A;  1M90 C;  5EJW A;  5FJ8 G;  1G2S A;  3CXC A;  2HHH Q;  4KHZ A;  1TII D;  2GN5 A;  1CFM A;  5C0X G;  3CQZ H;  4TQU S;  1Z9F A;  1Y14 B;  4A3G G;  3PSI A;  4C3J B;  1IBM L;  1S40 A;  2FJ2 A;  1TWH H;  4HMJ A;  3LWE A;  1HUN A;  1CSQ A;  1X3Q A;  5ELF A;  4DFA A;  3P75 A;  1D5M C;  2HT1 A;  1PTO H;  1B9N A;  2ICE C;  4C3I B;  4JPB W;  4P71 A;  4TRD A;  4KY5 A;  1YHB A;  4DR5 Q;  3DUZ A;  2F0F A;  2IWH A;  3JAM L;  1LLR D;  4IFD I;  4KK7 A;  3N6R A;  3SK5 A;  3S1Q H;  1SYD A;  3GD7 A;  2Q8T A;  4JI5 Q;  1JJG A;  4DR6 Q;  3BDO A;  2JA5 B;  2JYO A;  4K6D A;  4BA2 I;  2ZM6 L;  4GS3 A;  1SYE A;  4X66 L;  4IFD H;  3Q0A A;  1B9M A;  3H09 A;  3KUP A;  3OW7 A;  4AH6 A;  3I90 A;  3LX0 A;  5LMU Q;  4L63 B;  1A62 A;  2WB1 E;  2RF4 A;  4FXG C;  4JK1 C;  2UXC Q;  1KNA A;  2RHS B;  4LFB Q;  4BXX H;  1GKH A;  3PO2 G;  4NW2 A;  3FRP B;  4R8I A;  4HIO A;  4RA8 A;  1HA5 A;  2LY7 A;  4Y7N B;  3TDQ A;  1CKN A;  1L2F A;  4A4I A;  1SSO A;  1QG7 A;  1S5F D;  1BVS A;  3VR5 A;  3T1Y Q;  1EL0 A;  3F8T A;  3J7A 5;  2F0D A;  2B2V C;  1HTP A;  2ZM6 Q;  1DOL A;  5C44 H;  3ONA B;  3D3R A;  1I4P A;  5E7N A;  1LAC A;  3Q22 A;  5BR8 L;  4FF3 A;  3OHX C;  5ELD A;  4LF7 L;  1VMP A;  3UI2 A;  4N8X 1;  4LF8 L;  1YNN C;  3Q24 A;  1PRT C;  1VS0 A;  1R9T B;  1PFM A;  3F1Z A;  1ICW A;  1Y1V B;  4C3I H;  3E9H A;  1G6P A;  2VY3 A;  1FGB D;  4J15 A;  2XGT A;  1VQO A;  1EWH A;  4RGO S;  3EFX D;  2JEB I;  2ZXO A;  5KYI A;  3S15 B;  1SE4 A;  4RFB A;  4OON A;  1SDF A;  3HOX G;  2F4V L;  3ERO A;  5JAV A;  3CCJ A;  1PH1 A;  2UXD L;  4Y52 H;  3MA2 B;  1LV9 A;  4RMF A;  1V9P A;  1VQH A;  3L7Z C;  4NMZ A;  4BBR B;  4A93 H;  3FMC A;  4XQQ A;  1MHW C;  2CH4 W;  1A6X A;  2A68 D;  4CDE C;  1KHI A;  3SXH A;  3TN2 A;  3C2P A;  3HGB A;  4L5S A;  2JA9 A;  2ZXP A;  2OTJ A;  4FF2 A;  1PH3 A;  1OXX K;  3K5L A;  4ZUI A;  3W1B A;  2VUM B;  1B70 B;  1F9S A;  4KN4 C;  2Z4H A;  4LFC Q;  3OMC A;  3QB3 A;  4AQY Q;  2D62 A;  2X6L A;  1PH4 A;  4JI6 Q;  2BH2 A;  2AMC B;  3E0E A;  4DV1 L;  4IPD A;  2F0V A;  2WKD A;  1I6H B;  5IGD A;  3F2B A;  1Q1E A;  3T4A C;  3EIV A;  3NBH A;  3AU7 A;  5ELC A;  5D3D A;  4GNX C;  1K73 C;  2KED A;  1HXY D;  3I55 A;  4A3M G;  4A3I B;  4ZLT F;  4A3F B;  2XIW A;  4RKB A;  1MD2 D;  4LAA A;  3M85 A;  5ELN A;  4DR3 L;  2EIF A;  1TWA H;  1II3 A;  2ICI A;  4HN7 A;  5I6W A;  3MFY A;  1WTV A;  4LF8 Q;  3VR4 A;  5ISR A;  3PO3 H;  2EDG A;  5D14 A;  4LUZ A;  1GUS A;  1K3R A;  4B08 A;  2R93 G;  4YHH Q;  3VR6 A;  2O5J C;  3MC0 B;  2EY5 A;  1YNJ C;  5K36 H;  1EFI D;  2IPK D;  4RGT A;  4DR6 L;  1EQT A;  2QCP X;  4IUR A;  2I46 A;  4DV2 Q;  2QEJ C;  3EA6 A;  5EPK A;  2HDM A;  1FNV A;  3ND8 A;  4CHT B;  5IGF A;  2LXJ A;  2JA8 B;  5IGC A;  2F0I A;  3S1R H;  2R93 B;  3K7U C;  1RTN A;  4RHR A;  4TSS A;  2YTY A;  3D31 A;  3PGZ A;  4A3J G;  1LT3 D;  3OMG A;  2WB1 B;  1DON A;  3H94 A;  1XMO L;  4YCV A;  2IY5 B;  1KD1 C;  4L5Q A;  3DMU A;  2CW0 C;  4XIG S;  1S4Z A;  3J81 c;  4A3K G;  1TS4 A;  1NE3 A;  4JYA L;  3HOW H;  1E1O A;  1JR0 D;  3A8K E;  1BBW A;  4FXD A;  1MJE A;  2AWO A;  1Q86 C;  5JVH 3;  4NP5 A;  2IJ0 A;  3K7A B;  2F1M A;  5M5X B;  2HUG A;  3U58 A;  3R93 A;  4MN3 A;  3CC7 A;  3RZO B;  4A3M H;  1TY0 A;  3PO2 H;  4YY3 L;  4OIJ A;  4A3L H;  4CDD C;  1EZ6 A;  2KHS A;  2L12 A;  5M3M B;  1D7Q A;  1IBL Q;  1FNU A;  2B2T A;  3CPW A;  4RH6 A;  5CV4 A;  3G4S A;  2MNA A;  1WJJ A;  2A74 C;  4ZCK A;  1I50 H;  4DNT B;  2KEC A;  3ER0 A;  1EY5 A;  3CW2 C;  5EKK A;  4IUU A;  3MEH A;  4DR1 L;  4QQB X;  1JIC A;  1MJC A;  2QGQ A;  4LF9 Q;  3P7J A;  5JEA H;  1EY6 A;  1VQ5 A;  4JI2 L;  1XTD A;  2L15 A;  3HKZ G;  3H0G B;  1HNZ Q;  4DV1 Q;  1SYC A;  2RQX A;  4RKL A;  2EYF A;  2P5Z X;  2D2C C;  3I4M B;  4AQY L;  3PQI A;  4DXF A;  1QJO A;  2EZV A;  1TXY A;  4DPG A;  3QG1 A;  1SBB B;  1QNK A;  3A5U A;  4JI4 Q;  5GAH C;  3G6E A;  3T53 B;  1JOK A;  3W3A A;  3F2C A;  4QCL A;  1J5E L;  3AFQ A;  3PIP 3;  1X3P A;  3OYY A;  2BOS A;  2A6H C;  2BA0 A;  3HOY G;  2N78 A;  4X65 L;  2VB3 X;  1AEX A;  2M9V A;  4DAV A;  2FHT A;  3NXW A;  1ZYR C;  4H0L C;  3T1H L;  1UE6 A;  3ITP A;  3HOZ G;  1SNM A;  1N9W A;  4OX9 Q;  3KBX A;  1ESF A;  2K5V A;  4RCN A;  4XDX A;  3DHQ A;  4RAU C;  5C6A A;  1XPR A;  1SFO B;  3PCO B;  2UUC L;  4GKK Q;  4DV5 L;  3O13 A;  1JOQ A;  2WIN B;  5CV6 A;  1JT8 A;  3RR5 A;  4F88 A;  2MO0 A;  3S1N H;  1BO0 A;  4A3F G;  2UUB Q;  4H7B A;  3LNN A;  3GTK H;  1B50 A;  1C8C A;  4B3S Q;  1JE4 A;  2EXD A;  4V0B A;  4JI1 L;  1IBK L;  2N88 A;  2UUA Q;  1PH8 A;  1IBL L;  1CUK A;  4DUZ Q;  1H9S B;  1KL9 A;  2Q2T A;  3S2H H;  4IOA A;  3ZYY X;  4DAP A;  2MHV A;  5A2Q L;  1N33 L;  4JC0 A;  1V8Q A;  2B2U C;  3G48 A;  4K8J A;  4FDB A;  3J81 i;  2ID0 A;  3J7Z C;  1U0L A;  4DAM A;  2M2L A;  4J8Q A;  2Q2U A;  1MBY A;  3MXG A;  1HR0 Q;  1L1O A;  3PUW A;  2EQS A;  1J9O A;  2PQE A;  5CV8 A;  4M1U B;  4WOR A;  2KA7 A;  4G57 A;  1Y1V G;  1HNW Q;  1SMY D;  5AJ3 L;  5F2D A;  5E4W C;  2I0Q A;  5IWA L;  3AFP A;  2JSO A;  1OTC A;  1WFQ A;  5IIF A;  4OWW B;  3KYH C;  2RKS A;  4A3E G;  2ZJP A;  1Y8O B;  5IYC G;  1UUP A;  4FP5 D;  1AE3 A;  1LT5 D;  2NTT A;  1BNZ A;  1HA6 A;  2PNH A;  1BDO A;  1CQF A;  5IP7 H;  3OWE B;  4V19 0;  4A75 A;  1K83 H;  1A8V A;  1HNX L;  5COR A;  1SNQ A;  1AN8 A;  2LXK A;  4O1N A;  3DWQ A;  2ZXR A;  1I4X A;  3IL8 A;  2DUD A;  5JJK A;  4ME5 A;  4X66 Q;  2V4D A;  4KMU C;  1AZQ A;  5M5X H;  1BOS A;  1SE8 A;  1E22 A;  1KDC A;  1VQ7 A;  1BCP C;  3HOU B;  2JA7 G;  4UDU C;  4P75 A;  5IGG A;  4JOI C;  1Y1W B;  1I94 Q;  2OEO A;  4POG A;  1DOM A;  3HOX H;  1ICF B;  2D0P A;  3GTJ B;  1W3S A;  1DGS A;  3TEH B;  4L5T A;  5BN5 A;  5E4X A;  1BXT A;  3R8B A;  4KY6 A;  1UNS A;  5KRU A;  3BVZ A;  1NMG A;  1VQK A;  5J22 A;  4B3M Q;  1F2L A;  3CC2 A;  1DOK A;  2A6E C;  4UP7 A;  4IUQ A;  1A3V A;  4JI1 Q;  1IBK Q;  3I8Z A;  4B3S L;  1N8R C;  1PH6 A;  1JB3 A;  3QR8 A;  3BU2 A;  2B29 A;  3ULL A;  3L3O C;  2SOB A;  3A5Z B;  3I4N G;  3H15 A;  5EQ0 A;  4DV5 Q;  2EJM A;  2JA6 H;  3OOC A;  4B3M L;  3H0G H;  1FGU A;  4CKC A;  4MIU A;  2Y0S B;  2AKW B;  1U4P A;  3VDY A;  5IP7 G;  4RG1 A;  1YHQ A;  3GTO H;  1X56 A;  2R93 H;  3HEJ A;  3STB C;  3J80 c;  1WI5 A;  3FEW X;  3RLO A;  4BA1 I;  4AIM A;  4DV7 L;  4G7H C;  1A63 A;  4A3E B;  1EIY B;  4X64 L;  3NEM A;  2BH8 A;  1YJ9 A;  3G6J B;  3OIQ A;  1RD9 D;  2RDF A;  1D5X C;  4KHP Q;  3R2I A;  1W6J A;  1OXS C;  1JJC B;  1GO3 E;  1BUV T;  2G9D A;  3HOZ B;  1EIH A;  5M3F H;  2NZH A;  5EBD A;  4LFB L;  2PQA B;  1VF5 C;  3DM3 A;  3FPP A;  1GUW A;  1VQN A;  2ZTD A;  3K7A H;  3S16 H;  1AP0 A;  4DK1 A;  3HOW G;  1GUN A;  1YIT A;  1Y1W H;  1CI3 M;  3HOX B;  3GV6 A;  3KF6 B;  3GTJ H;  2JEA I;  2LS0 1;  3C1E A;  3MXP A;  4WJ3 M;  3I56 A;  3RLF A;  2A5H A;  2CVR A;  2F0Q A;  1F2Y A;  4A3F H;  1WD0 A;  1PYS B;  3AMU A;  4GOP A;  1PMR A;  2KCN A;  4X3S A;  1IKL A;  4OX9 L;  1DZ1 A;  1K3B C;  2FMM A;  3S24 A;  4QB4 A;  4G7Z C;  3PO3 B;  2SDF A;  2L5T A;  1N32 L;  1PH9 A;  2KOL A;  4A3B B;  4PQX A;  1PV4 A;  2CQA A;  5C4X H;  4R9W A;  4KN7 C;  2HIV A;  1Q7Y C;  2KUM A;  4H02 A;  4JVZ A;  1I4H A;  1PXU A;  1DYQ A;  1BBX C;  2A73 B;  2B2V A;  3S1R B;  1YJW A;  2EY1 A;  5IT9 c;  2HHH L;  3G71 A;  1YVC A;  3KLR A;  3A55 A;  1PZK D;  4KY7 A;  3S1M H;  1EY7 A;  2Z8L A;  1Z6H A;  2F0N A;  1H9M A;  4JI0 L;  5C4Z A;  1J6Q A;  4JI2 Q;  3KF6 A;  2B2Y C;  2NUC A;  3CCE A;  3URY A;  4QIW E;  1SJE D;  3PUV A;  1VQD A;  5FK9 C;  2HDL A;  3H0G G;  3HKZ B;  3TSS A;  4ZYS A;  2E2H H;  2NVT H;  3K59 A;  1LTG D;  3K58 A;  3AQQ A;  3I4N H;  3IAY A;  3CF5 A;  4X3T A;  1UAP A;  5IOD A;  1PRT F;  4IQZ A;  2JA5 G;  2KCM A;  4LF4 L;  3HP3 A;  3K5O A;  2R7Z G;  1D2B A;  2C9O A;  4ZRZ A;  1D1K A;  5LHY 1;  3A7A B;  1LTS D;  4KV6 A;  4E6I A;  4M8A A;  5CMD A;  1Q81 C;  5EKI A;  1PLF A;  2PW5 A;  2UXD Q;  1V1Q A;  1EY0 A;  2VB2 X;  4JBK A;  3OWF A;  3ERS X;  5HY6 A;  5CR3 A;  1E7Z A;  3PUZ A;  4F8M A;  1HR0 W;  2JA7 H;  1TWC B;  3MAQ A;  4WJ4 A;  2JA8 G;  1OXU A;  2YYZ A;  3VA7 A;  2RCN A;  1UE7 A;  2TSS A;  3OIP A;  2R92 G;  3A8I E;  2Y0S G;  4JOI A;  1D1I A;  4DK3 C;  3IRB A;  1SEB D;  4IUT A;  2NB0 A;  1KC8 C;  4X65 Q;  4LW1 A;  4K0K L;  4KJO A;  1J8I A;  2F0P A;  1PH2 A;  3WDN A;  1WTR A;  3S1M B;  4X64 Q;  3I4M H;  4BY7 G;  1PZI D;  2MQH A;  5IYB G;  3CRL C;  3VR2 A;  2BA1 A;  1K8A C;  3BZD B;  1G8Z D;  3I7F A;  5FO8 B;  3SVM A;  1EYG A;  2K05 A;  1E3P A;  2DNC A;  3CCM A;  4XYQ A;  3H3V I;  1UEB A;  1A3U A;  4Z9C B;  4YCW A;  1RTO A;  4KD3 A;  3W2D A;  1VQ6 A;  4JYA Q;  4C2M B;  1YI2 A;  1A15 A;  1SYG A;  3CCS A;  5C4H A;  5C4X G;  2AQ1 B;  3W5O A;  2HQL A;  3K57 A;  2NWG A;  2ZJR A;  2E2I H;  3MZ5 A;  3U9S A;  3IKJ A;  1FR3 A;  3RN2 A;  2EYH A;  4C3J H;  1QWY A;  3UDF A;  1G29 1;  3D6W A;  5C3X A;  2EYJ A;  1F9R A;  3EBE A;  5M5Y H;  4X6A H;  1K8M A;  1QNU A;  2RDH A;  2QIL A;  3Q23 A;  4GNX B;  4X3K A;  1JCK B;  1O80 A;  2XWJ B;  4YCU A;  2Q8I B;  3G7L A;  4PG3 A;  5AJ3 Q;  1EFW A;  3TS2 A;  2VXW A;  1W2B A;  4C3H H;  1EWC A;  2K50 A;  2E8G A;  1QVC A;  4OWT B;  3VA5 A;  3CCV A;  1VQM A;  3WWV A;  3KLS X;  2LKV A;  4FF4 A;  1S5C D;  4K5V A;  3BVM A;  2Z4I A;  2DY7 A;  5I4D A;  3T1Y L;  3HOU G;  3TZD A;  2VW9 A;  2HCC A;  4HSP A;  2JA6 B;  2F0U A;  5JVG 3;  1LT4 D;  1HZB A;  3L2P A;  1IYU A;  2L9H A;  2ZTC A;  1K0R A;  1VMC A;  2NYZ D;  5C4J B;  4X62 Q;  1SR3 A;  1HUM A;  2KHI A;  5HGQ A;  1U4M A;  4LWC A;  2UXC L;  2DJF C;  2J0T D;  2VS1 A;  1PHJ A;  4POF A;  3J7A V;  1Q3L A;  1GJX A;  2PMZ E;  2JP1 A;  1XNR L;  5LMN L;  4DR4 Q;  1PYB A;  4IOC A;  2AQ3 B;  5TSS A;  4F7X A;  2M00 A;  4G7O C;  3UE1 A;  4EQ5 A;  1KQS A;  1KAB A;  2WB1 G;  3TZU A;  5DNF A;  2PZT A;  4LFC L;  1LTT D;  2E5L Q;  1SYF A;  3NQI A;  2QF7 A;  2PQA A;  1HR0 L;  3CME A;  2WAQ G;  4KHV A;  1WVL A;  1QIL A;  1SNO A;  2RHQ B;  4CJ0 B;  4DKA C;  1HQM C;  2XVS A;  4R4C A;  4DUZ L;  5C3W A;  4UP8 A;  2YTV A;  3GP7 A;  3NWT A;  3CCR A;  2BDN A;  4B3T Q;  1TT2 A;  4O0A A;  2Q2I A;  1XPO A;  2UUB L;  1SE3 A;  5M3F G;  1MSG A;  2E5L L;  1EY9 A;  3TQY A;  4P74 A;  3AYH B;  3STB D;  1Q90 A;  1F9P A;  3SDZ A;  2K52 A;  3RMH A;  1H9K A;  2H1E A;  4I7A A;  1EOV A;  5EPJ A;  1MKH A;  2F0O A;  2K03 A;  4QUC A;  1PFS A;  4JG2 A;  4A3J B;  1FJG Q;  3GTP B;  2RBM A;  1IBM Q;  4R4Q A;  1R4Q B;  1IL8 A;  1XJV A;  2Z6B A;  1XMQ L;  2F0M A;  4HCS A;  3GTM B;  3MXN B;  2UXB Q;  5FO7 B;  4I65 A;  4N9T A;  1EYD A;  5GRO A;  1EU4 A;  2K01 A;  2WP8 J;  5L37 A;  2YV5 A;  3QIA A;  3KDF A;  4HSV A;  1VQC A;  2NVX H;  4IJL A;  1Z47 A;  4A3E H;  5M3M G;  1LAB A;  4CJ2 C;  1K8O A;  4C3J G;  1PH5 A;  3CRK C;  1WTX A;  2XN9 C;  1WTP A;  5M9O A;  1C9O A;  2L4N A;  2HCI A;  1FYC A;  2O2L D;  2NVT B;  1R4P B;  3BYT B;  1STY A;  4DR1 Q;  1EU3 A;  3JC6 6;  1FNW A;  1ZEQ X;  4BBR G;  4QGU A;  3A56 A;  2GVA A;  3QWN A;  4LFA L;  4NXM Q;  3H3V C;  1MI2 A;  1XMO Q;  2B2W C;  2L11 A;  3CQZ B;  5JPN C;  2IX0 A;  2R7F A;  1CTM A;  4GNX A;  5LMU L;  1R9T H;  4DGZ A;  4J1M A;  2Q2H A;  1D5Z C;  5CV7 A;  1KLU D;  1SNP A;  3D4R A;  5DLQ E;  4KLK A;  1H9R A;  2F0H A;  1B44 D;  4UY8 C;  4BXX G;  2MO1 A;  2JA7 B;  3DXJ C;  3HRZ C;  1VQE A;  2WAC A;  4DV7 Q;  2MP1 A;  3HS0 C;  3ERQ A;  1N34 L;  1PTO D;  2F0S A;  3P20 A;  5D3I B;  5CBE E;  5IE8 A;  3GTL H;  3HOV G;  2WFW A;  2XTI A;  4IFD G;  3X3M A;  3J7Y W;  2K5H A;  2JA8 H;  3PMF A;  2B8F A;  2NVY H;  3BG3 A;  1BR9 A;  4HED A;  2F0T A;  1IL2 A;  4HAE A;  2RA4 A;  4DV4 L;  1RF2 D;  4P2C B;  3RZD H;  4N8F A;  5FLM G;  1S5D D;  3LGJ A;  3KDF B;  1V1P B;  2EYO A;  2KQ3 A;  5J3B A;  1I3Q H;  2MUY A;  2ALY B;  1FJG L;  2N49 A;  3NEN A;  2L0C A;  4DNI A;  1Y69 U;  3GTQ B;  4DK0 A;  4BY7 B;  3MXN A;  1VQ9 A;  4FF1 A;  1OXT A;  1BF4 A;  5IYB H;  1MSH A;  1SXT A;  3T56 B;  5JEA G;  4NXN L;  4DUY Q;  2JJQ A;  3HKS A;  2IX3 A;  2ASB A;  3KJO A;  1SFO H;  1N36 L;  2E2I B;  2O4X A;  1CKN B;  3Q8D A;  4DR2 Q;  3PO2 B;  4JBM A;  1E24 A;  3E5S A;  1T5X D;  4I7Z C;  4LF5 Q;  3S1N B;  2RSN A;  3NTH A;  4ZQ3 A;  4G4K A;  1A2T A;  1X55 A;  4K8I A;  1ZXT A;  3GTK B;  1JWS D;  2MPM A;  4ZKB B;  5M3M H;  2UU9 L;  1XMQ Q;  1HFN A;  4EQP A;  4DR3 Q;  1ILQ A;  1B8A A;  3UDX A;  4PNY A;  2GA4 B;  3TP5 A;  2R3Z A;  3H3V H;  3A54 A;  5CC4 A;  2MGS A;  1VQ4 A;  1CM9 A;  4L5R C;  4A3L G;  1I50 B;  2A69 C;  5C5L A;  2UUC Q;  1GUO A;  2FXQ A;  1DM0 B;  2PMZ B;  4AYB G;  1E0B A;  2I07 B;  3S15 H;  1EY8 A;  1TWC H;  2A1A A;  4HMI A;  4NKL A;  4A3D G;  4A3D B;  5K36 G;  1NSN S;  3KLS A;  2ZT9 C;  4HID A;  1I5F A;  1CK1 A;  1ET6 A;  3NSW A;  1UWV A;  4LUO A;  4LMQ D;  5GQO A;  4JI6 L;  3BS1 A;  1SRU A;  3PIO A;  2WKC A;  3ICE A;  4A93 B;  1EYC A;  1LM0 A;  1CHQ D;  3NTK A;  4U67 3;  3KF8 A;  1BQQ T;  1I3Q B;  5M5W H;  4GKJ L;  1SJH D;  1B3Q A;  1TWG B;  3I3C A;  5CBA E;  1PH7 A;  1FVI A;  1Y8N B;  3HOV B;  1BKB A;  3SK8 A;  2RCF A;  4KKT A;  1TR5 A;  2IHF A;  5C3E B;  2B63 G;  3TME A;  3S14 B;  1N34 Q;  2JE6 I;  2VUM H;  3A0J A;  1SNC A;  5HGT A;  2CH4 A;  3NBI A;  1TWF B;  3IFT A;  2FMC A;  4C2M H;  1RIP A;  1GHK A;  5CYU A;  4TKO B;  1SAP A;  3HZX A;  2F0K A;  1B7Y B;  4XQN A;  1SND A;  4PV1 C;  4JI8 L;  2EYM A;  1G2T A;  3VYS A;  2K75 A;  4ULL A;  1BCP F;  2PZU A;  1CT1 D;  4FVM A;  3V2T A;  2K5W A;  2MFI A;  1ONL A;  3CCU A;  2AHO B;  2HD3 A;  3M4Q A;  3SK4 A;  1P16 A;  3BYY B;  2NZ1 D;  4C3H B;  1NJI C;  1HZ9 A;  5BR8 Q;  3FP9 A;  1X3G A;  1VCI A;  5I9O A;  4LF7 Q;  1B3A A;  5FLX c;  5IT9 L;  1V43 A;  4A3J H;  1E2Z A;  4CBV A;  1G51 A;  5KGU A;  4GN4 B;  1Q8I A;  1HNZ L;  4BBS G;  4WJW A;  3CD6 A;  4A3C G;  1EIG A;  1STH A;  2KCT A;  3RZD B;  1JQY D;  4RGN A;  1GUT A;  5JJL A;  4HJ8 A;  2PCF B;  2YU9 B;  2DNE A;  3PIO 3;  1L1O C;  1XTC D;  3A7L A;  2NN6 G;  1PFB A;  3J7A F;  4X62 L;  2R61 A;  4GLX A;  2BCO A;  1QCB D;  3PF5 A;  3NPP A;  2RSO A;  4DR7 L;  4S3S A;  2K6A A;  3S2D B;  4XT1 B;  5ELO A;  1WCM B;  3RN5 A;  1CZG A;  2QKI C;  3HOW B;  1WTQ A;  1TU2 B;  3KK7 A;  5KEE A;  5T1I A;  4HIM A;  1H95 A;  4O2D A;  4ALP A;  1E2W A;  3E0J A;  4JI5 L;  4DR5 L;  4KI0 A;  4UP9 A;  5FLM H;  3K6O A;  5G3L F;  1RL2 A;  2C35 B;  1RKN A;  1N33 Q;  3NEL A;  4ILW A;  1T9H A;  1O78 A;  1VF7 A;  4DAY B;  5IYD G;  3PUY A;  2A68 C;  3QOL A;  1P8L A;  5KNB A;  4C3I G;  1SMY C;  3DLL A;  1VQP A;  4DNR B;  1RCV D;  1X9N A;  2DN8 A;  2FIN B;  1GXD C;  1EEF D;  1STE A;  1QUQ B;  5K5P A;  3M4P A;  3FKI H;  4JI8 Q;  1HCZ A;  3S1Q B;  4FXK C;  1YBY A;  3I4O A;  2DGY A;  4A3G B;  2HIX A;  2PPB C;  4K14 A;  5JEA J;  4NDX A;  3C46 A;  2OCE A;  3PIP A;  1MIU A;  4CDF C;  5IT9 E;  3GTP H;  4FNF A;  4CJ1 B;  4DR4 L;  4OGQ C;  1KXL A;  1SRO A;  1EOT A;  5FKA C;  2F0G A;  4K2L A;  4L8J A;  1F2M A;  1WTH A;  4QJF A;  5COY A;  1Q82 C;  2E2J B;  5EKL A;  1X3E A;  1JJ2 A;  3JAM E;  4JI3 L;  5IGB A;  1B53 A;  2EOT A;  1J5E Q;  3QOJ A;  5M5W B;  1LTI D;  1TWG H;  2PW7 A;  3D4W A;  2NVQ H;  3MTS A;  1BCP B;  3HKZ E;  4QMG A;  4ZKC B;  4LJZ C;  3DWA A;  4YWK A;  2KJX A;  3SK6 A;  3GTQ H;  5LL6 X;  4AYB E;  4IPG A;  1L1O B;  1TVX A;  3I70 A;  3L9A X;  3HOZ H;  4OL7 A;  5JOB A;  1LTL A;  1HJP A;  4B9X A;  3CU7 A;  1QOH A;  1VQL A;  1VDZ A;  5C44 B;  4K6L A;  5LMN Q;  2R92 B;  4QF4 A;  5JJZ A;  4A3I H;  1ML0 D;  2VNU D;  1U5K A;  2PI2 E;  2LFN A;  4PZ8 A;  1XX8 A;  4GZY C;  1STB A;  1CKO A;  2F4V Q;  1T5E A;  3E9I A;  4N9P A;  1UE1 A;  2B2U A;  2E2D C;  1IYJ B;  4K5X A;  3U4V A;  2K4K A;  1STA A;  1Z7T A;  4HIK A;  1PZJ D;  3BZC A;  4FYD A;  1PTO B;  3BDC A;  1YNX A;  5FO9 B;  1E1T A;  2K32 A;  4B9W A;  2Y0S E;  2G9H D;  2NN6 I;  1N32 Q;  4MTN A;  1HPC A;  4R4T A;  4YY3 Q;  4LF5 L;  3S2H B;  2IL8 A;  4RGM A;  2CW0 D;  4A3D H;  2C5C A;  1WTW A;  1EEI D;  4XXE A;  3FHW A;  2I5L X;  1UE5 A;  1VQI A;  1VQG A;  4DUY L;  1DCZ A;  4NXN Q;  1IYV A;  2KEN A;  1C48 A;  5T1G A;  2AUK A;  1EQQ A;  1IW7 C;  4OIK A;  2D9U A;  3ZJY C;  4OXP A;  3ULJ A;  3S9W A;  2YU9 H;  1WYD A;  3KF8 B;  4EGV A;  1EWI A;  1EYA A;  3B6Y A;  1IZ6 A;  1HNX Q;  3MHB A;  4IZ8 A;  4K0K Q;  2XWB B;  3FVQ A;  3MXU A;  4OO1 G;  1TS5 A;  2N55 A;  2L1B A;  1WCM H;  4BWG B;  5IP9 G;  3GQB A;  1RHP A;  3CCQ A;  1I6H H;  4IJH A;  4FO2 A;  3GTG B;  2BDO A;  4O42 A;  1DD2 A;  5KNC A;  4A3M B;  3SEB A;  1I6V C;  4WFN 3;  2E76 C;  3R2T A;  4DV2 L;  4ZAI A;  2E75 C;  2F0L A;  5DM7 3;  2CHB D;  4ABN A;  5GAE C;  1IHZ A;  4RHS A;  3R3O A;  1KLG D;  2EY6 A;  2I5H A;  4DAY A;  4LF6 Q;  4IUV A;  3EJI A;  4R4I A;  2MJ8 A;  2EXZ A;  2VUM G;  3MWY W;  2B8G A;  4LFA Q;  3TP6 A;  4EQO A;  3CC4 A;  4NXM L;  1U9R A;  3C1F A;  1ZKO A;  2F3V A;  3NK9 A;  3FPU B;  4C1N K;  4XQJ A;  1K0S A;  4IUP A;  1AH9 A;  2JA6 G;  5C44 G;  3TS0 A;  4C3H G;  1S72 A;  2EE1 A;  4QUF A;  5I2Y A;  3JAM c;  5I2X A;  3M4Y A;  4P73 A;  2AQ2 B;  2LSS A;  1CQV A;  3E3X A;  3DEO A;  4P72 A;  4EQN A;  4B3R Q;  3P1H A;  2QA4 A;  4DV0 Q;  2A6E D;  1TS3 A;  1QVG A;  2NVQ B;  4A3K H;  3I4L A;  1CKM A;  2R7Z B;  1JMC A;  1NUC A;  1CSP A;  1ENA A;  1PRT B;  1F77 A;  4QIW B;  2NTS A;  5C0X H;  5BN3 A;  3WOF A;  5KYL A;  1LYL A;  5C3E H;  4RCO A;  3QO2 A;  4JBW A;  4JCV E;  3TP8 A;  2O5I C;  5GAG C;  1NNX A;  3F2U A;  1GHJ A;  4B3R L;  1W6K A;  2E2H B;  3LWU A;  4MTK A;  2OT2 A;  3I4N B;  4DA2 A;  4PZ6 A;  4H13 C;  4JV5 L;  5A35 A;  1JB7 A;  4HR7 B;  1L0X B;  3JAM i;  4PMB A;  3UE0 A;  1VQJ A;  3K0Y A;  2F0W A;  1UEA B;  1KAW A;  1H9S A;  3WOE A;  2H5X A;  5EGT A;  3KLW A;  4ZUJ A;  3VR3 A;  4IPC A;  5DM6 3;  1G6Z A;  2BE5 C;  1DJR D;  1TWA B;  1K8G A;  1S3O A;  2CWP A;  3M9B A;  3D4D A;  2LMC B;  3MFG A;  4GOP B;  3PO3 G;  1KIX A;  5AFW A;  4ID6 A;  4JI7 L;  4R1J A;  3V05 A;  3CKI B;  4DN4 M;  4LF6 L;  3TRZ A;  2ATW A;  2K5Q A; 
#chains in the Genus database with same CATH homology
 5CGK A;  1ROD A;  1HRJ A;  1TS2 A;  1C4Q A;  3BDL A;  2B63 B;  4K2K A;  1CA6 A;  4XT3 B;  4CGY B;  3T51 B;  1DXM A;  2E74 C;  1TKW B;  1LTB D;  3NP8 A;  3M7N A;  3S17 B;  1NR2 A;  3GO5 A;  5FOB B;  4R8N A;  3J81 E;  4DU9 A;  2H4O A;  1ENC A;  2K04 A;  3I91 A;  1PTO C;  1NAP A;  1STN A;  3Q6S A;  5DAU A;  1OO9 B;  5EPL A;  3VYR A;  3I72 A;  2NN6 H;  2K5D A;  4PMC A;  5A2Q E;  5CV5 A;  2EJG C;  3H91 A;  2K33 A;  1IKM A;  2XNA C;  3QJY A;  3CHB D;  3NHH A;  1Y8P B;  4X3U A;  4PMW A;  3PUX A;  1O7Z A;  1M4V A;  1ESR A;  4XYO A;  3V96 A;  1JWU D;  1EY4 A;  1X32 A;  4CKE A;  1M8A A;  2EVB A;  1STG A;  1Q1B A;  3H6M A;  5KIX A;  1D6E C;  4LK1 C;  3K5M A;  3DWP A;  3RUZ A;  1LO5 D;  3PV0 A;  1AZP A;  1AFP A;  1I4Q A;  2A69 D;  2J4X A;  1XYI A;  3EQL C;  3D8G A;  1WD1 A;  5G3L D;  1BCP D;  2EYP A;  3VYT A;  2KEE A;  3MVV A;  1ENF A;  5JPM C;  2WII B;  2Z1C A;  1TQO A;  4AYB B;  4MHE A;  3OSO A;  2FFK B;  4OO1 I;  2EPB A;  5FLX L;  5C0X J;  3NWS A;  2SEB D;  5BN4 A;  2KCC A;  4DF7 A;  1HFG A;  4ODG A;  3K5N A;  3TP7 A;  1U4L A;  1L0Y B;  5NUC A;  2NBF A;  2SNS A;  4OHJ A;  4KKU A;  4IFD J;  2F0J A;  1S5B D;  4BY1 B;  4CKB A;  4H44 C;  1ILP A;  5C0X I;  5FLX E;  3HOY B;  4Q0F A;  1KAA A;  5IOC A;  2AUJ D;  1K83 B;  2K7V A;  4ZK9 B;  4HTH A;  1F9Q A;  1XWE A;  4C1N I;  1JOR A;  2BE5 D;  3NQT A;  5M3F B;  1WTO A;  1A2U A;  2RDG A;  1B1Z A;  1KNE A;  3AB9 A;  1I4R A;  4J6H A;  3TBI B;  3SHL A;  3J81 L;  3E6Z X;  3SE0 A;  4BS9 A;  2AWN A;  4RWS C;  4Q5V A;  1O7L A;  5E3F A;  1LTR D;  2A6H D;  2ENB A;  1S5E D;  3SR1 A;  2D5D A;  4IAL A;  1PTO F;  1ET9 A;  5CV9 A;  1U4R A;  2EJF C;  2B2W A;  3N52 A;  4KTA A;  2B2T C;  1YNN D;  1CA5 A;  2F03 A;  3GTL B;  2XSC A;  1KDB A;  3GV3 A;  1EZ8 A;  3NTI A;  5IGE A;  1F2Z A;  4KKS A;  1KDA A;  4EVO A;  2JXM B;  4A3K B;  4IN3 A;  1V1P A;  3RD4 A;  1JC7 A;  1OXV A;  3X3N A;  2NVX B;  1LT6 D;  1GOZ A;  3DM1 A;  1XXG A;  5J39 A;  2OXP A;  4UAI A;  5C5M A;  2HQE A;  1RDP D;  3U9O A;  1JOO A;  2X6G A;  3S16 B;  1CZW A;  1Q12 A;  3A8J E;  2IW3 A;  4KJN A;  3DEP A;  1B2T A;  2Q8R E;  1NR4 A;  5KND A;  3VYU A;  2F0E A;  1MGS A;  3OPO A;  2PO4 A;  1AW7 A;  2F3W A;  3BVG A;  3FKI B;  2EY2 A;  1HQR D;  2PYK A;  5LL6 S;  1RJT A;  1EQV A;  5J1Z A;  1SE2 A;  1V1O A;  4K5W A;  2K28 A;  1HHV A;  2XRS D;  2WAQ B;  5D65 A;  2TMP A;  2B2Y A;  5DEH A;  3GTO B;  2NVY B;  2K1B A;  2IT1 A;  4DXG A;  2R6G A;  1QE6 A;  2PZW A;  1FD7 D;  3IFD A;  1PRT D;  2B39 A;  2WV6 D;  1JWM D;  4HCE A;  2X69 A;  1LTA D;  2RVL A;  2SNM A;  4BBS B;  1KTK A;  5I6Y A;  2XRQ D;  5EBC A;  3ND9 A;  5M5Y B;  3NE5 B;  3D6C A;  1CHP D;  5HUR A;  1TWH B;  1IW7 D;  4L6T B;  3KBG A;  2DY8 A;  1HTL D;  2F4I A;  5E1F A;  4C56 C;  1PFN A;  2L55 A;  1QB5 D;  2OF1 A;  3T16 A;  3FDT A;  3M4O B;  1O7Y A;  1A3T A;  2QDB A;  4F87 A;  1PDQ A;  3T13 A;  4IUN A;  1GUG A;  3EVQ A;  4KD4 A;  1NCV A;  1PYW D;  1TY2 A;  3C3L A;  5C4X B;  4XTC S;  3NUC A;  5ELB A;  3I73 A;  4OO1 H;  2KVM A;  4YIJ A;  1YNJ D;  5ELE A;  5I9P A;  2PNR C;  4WRD A;  4U68 A;  3M3Y B;  1G91 A;  3J80 E;  2J7Z A;  3J80 L;  1SYB A;  2EYL A;  3M7G A;  3HG9 A;  1E2V A;  1ZYR D;  2IX1 A;  1H9J A;  1I4G A;  1B4O A;  5EJW A;  1G2S A;  4KHZ A;  1TII D;  1CFM A;  5C0X G;  4TQU S;  4C3J B;  2FJ2 A;  4HMJ A;  1HUN A;  3LWE A;  1X3Q A;  5ELF A;  4DFA A;  3P75 A;  1D5M C;  1PTO H;  1B9N A;  2ICE C;  4C3I B;  4TRD A;  4KY5 A;  3DUZ A;  2F0F A;  2IWH A;  3JAM L;  1LLR D;  4IFD I;  4KK7 A;  3N6R A;  3SK5 A;  1SYD A;  3GD7 A;  2Q8T A;  3BDO A;  2JA5 B;  2JYO A;  4K6D A;  4BA2 I;  1SYE A;  4IFD H;  3Q0A A;  1B9M A;  3H09 A;  3KUP A;  3OW7 A;  3I90 A;  3LX0 A;  4L63 B;  4FXG C;  4JK1 C;  1KNA A;  4NW2 A;  3FRP B;  4R8I A;  4RA8 A;  1HA5 A;  2LY7 A;  4Y7N B;  3TDQ A;  1SSO A;  1QG7 A;  1S5F D;  3VR5 A;  1EL0 A;  2F0D A;  2B2V C;  1HTP A;  1DOL A;  3ONA B;  3D3R A;  1I4P A;  1LAC A;  3Q22 A;  4FF3 A;  3OHX C;  5ELD A;  1VMP A;  3UI2 A;  1YNN C;  3Q24 A;  1PRT C;  1R9T B;  1PFM A;  1ICW A;  1Y1V B;  1FGB D;  1EWH A;  4RGO S;  3EFX D;  2JEB I;  2ZXO A;  5KYI A;  3S15 B;  1SE4 A;  4RFB A;  1SDF A;  3ERO A;  5JAV A;  3MA2 B;  1LV9 A;  3L7Z C;  4NMZ A;  4BBR B;  3FMC A;  4XQQ A;  1A6X A;  2A68 D;  3SXH A;  3TN2 A;  3C2P A;  3HGB A;  2ZXP A;  4FF2 A;  1OXX K;  3K5L A;  4ZUI A;  2VUM B;  1F9S A;  4KN4 C;  2Z4H A;  3OMC A;  3QB3 A;  2D62 A;  2X6L A;  2F0V A;  2WKD A;  1I6H B;  5IGD A;  1Q1E A;  3T4A C;  3NBH A;  3AU7 A;  5ELC A;  5D3D A;  2KED A;  1HXY D;  4A3I B;  4ZLT F;  4A3F B;  2XIW A;  4RKB A;  1MD2 D;  4LAA A;  3M85 A;  1II3 A;  2ICI A;  4HN7 A;  5I6W A;  3MFY A;  1WTV A;  3VR4 A;  5ISR A;  2EDG A;  5D14 A;  1GUS A;  4B08 A;  3VR6 A;  2O5J C;  3MC0 B;  2EY5 A;  1YNJ C;  5K36 H;  1EFI D;  2IPK D;  4RGT A;  1EQT A;  2QCP X;  4IUR A;  2I46 A;  2QEJ C;  3EA6 A;  5EPK A;  2HDM A;  1FNV A;  3ND8 A;  4CHT B;  5IGF A;  2JA8 B;  5IGC A;  2F0I A;  2R93 B;  1RTN A;  4RHR A;  4TSS A;  3D31 A;  1LT3 D;  3OMG A;  2WB1 B;  1DON A;  3H94 A;  3DMU A;  2CW0 C;  4XIG S;  1S4Z A;  1TS4 A;  1JR0 D;  3A8K E;  4FXD A;  2AWO A;  5JVH 3;  4NP5 A;  2IJ0 A;  3K7A B;  2F1M A;  5M5X B;  2HUG A;  3R93 A;  4MN3 A;  3RZO B;  1TY0 A;  4OIJ A;  1EZ6 A;  2KHS A;  2L12 A;  5M3M B;  1FNU A;  2B2T A;  4RH6 A;  5CV4 A;  2A74 C;  4DNT B;  2KEC A;  1EY5 A;  5EKK A;  4IUU A;  3MEH A;  1JIC A;  3P7J A;  5JEA H;  1EY6 A;  3H0G B;  1SYC A;  2RQX A;  4RKL A;  2EYF A;  2D2C C;  3I4M B;  4DXF A;  1QJO A;  2EZV A;  3QG1 A;  1SBB B;  1QNK A;  3T53 B;  1JOK A;  3W3A A;  4QCL A;  3PIP 3;  1X3P A;  2BOS A;  2A6H C;  2BA0 A;  2VB3 X;  1AEX A;  2M9V A;  4DAV A;  2FHT A;  3NXW A;  1ZYR C;  4H0L C;  3ITP A;  1SNM A;  3KBX A;  1ESF A;  4RCN A;  4XDX A;  3DHQ A;  4RAU C;  5C6A A;  1SFO B;  3O13 A;  1JOQ A;  2WIN B;  5CV6 A;  4F88 A;  1BO0 A;  4H7B A;  3LNN A;  1B50 A;  1C8C A;  1JE4 A;  4V0B A;  2N88 A;  1H9S B;  3ZYY X;  4DAP A;  2MHV A;  5A2Q L;  1V8Q A;  2B2U C;  4K8J A;  2ID0 A;  2M2L A;  4J8Q A;  1MBY A;  3MXG A;  3PUW A;  1J9O A;  2PQE A;  5CV8 A;  4M1U B;  4WOR A;  2KA7 A;  4G57 A;  1SMY D;  5F2D A;  5E4W C;  2JSO A;  5IIF A;  2RKS A;  1Y8O B;  1UUP A;  4FP5 D;  1LT5 D;  2NTT A;  1BNZ A;  1HA6 A;  1BDO A;  1CQF A;  3OWE B;  4V19 0;  5COR A;  1SNQ A;  1AN8 A;  4O1N A;  3DWQ A;  2ZXR A;  1I4X A;  3IL8 A;  4ME5 A;  2V4D A;  4KMU C;  1AZQ A;  1BOS A;  1KDC A;  1BCP C;  3HOU B;  4UDU C;  5IGG A;  1Y1W B;  2OEO A;  1DOM A;  3GTJ B;  5BN5 A;  5E4X A;  1BXT A;  3R8B A;  4KY6 A;  1UNS A;  5KRU A;  3BVZ A;  5J22 A;  1F2L A;  1DOK A;  2A6E C;  4IUQ A;  1A3V A;  3I8Z A;  1JB3 A;  3L3O C;  2SOB A;  5EQ0 A;  2EJM A;  3OOC A;  4CKC A;  4MIU A;  2Y0S B;  1U4P A;  3HEJ A;  3FEW X;  4BA1 I;  4G7H C;  4A3E B;  3G6J B;  3OIQ A;  1RD9 D;  2RDF A;  1D5X C;  3R2I A;  1W6J A;  1OXS C;  1BUV T;  2G9D A;  3HOZ B;  1EIH A;  5EBD A;  1VF5 C;  3FPP A;  1GUW A;  1AP0 A;  4DK1 A;  1GUN A;  1CI3 M;  3HOX B;  3GV6 A;  2JEA I;  2LS0 1;  3C1E A;  3MXP A;  3RLF A;  2A5H A;  2CVR A;  2F0Q A;  1F2Y A;  1WD0 A;  3AMU A;  1PMR A;  2KCN A;  4X3S A;  1IKL A;  1DZ1 A;  2FMM A;  4QB4 A;  4G7Z C;  3PO3 B;  2SDF A;  2L5T A;  2KOL A;  4A3B B;  4PQX A;  2CQA A;  4R9W A;  4KN7 C;  2KUM A;  1I4H A;  1PXU A;  1DYQ A;  1BBX C;  2A73 B;  2B2V A;  3S1R B;  2EY1 A;  3KLR A;  3A55 A;  1PZK D;  4KY7 A;  1EY7 A;  2Z8L A;  1Z6H A;  2F0N A;  1H9M A;  5C4Z A;  2B2Y C;  2NUC A;  3URY A;  1SJE D;  3PUV A;  5FK9 C;  2HDL A;  3HKZ B;  3TSS A;  4ZYS A;  3K59 A;  1LTG D;  3K58 A;  3IAY A;  4X3T A;  1UAP A;  5IOD A;  1PRT F;  4IQZ A;  3HP3 A;  3K5O A;  1D2B A;  2C9O A;  4ZRZ A;  1D1K A;  5LHY 1;  3A7A B;  1LTS D;  4KV6 A;  4E6I A;  4M8A A;  5CMD A;  5EKI A;  1PLF A;  2PW5 A;  1EY0 A;  2VB2 X;  3OWF A;  5CR3 A;  3PUZ A;  4F8M A;  1TWC B;  3MAQ A;  1OXU A;  2YYZ A;  3VA7 A;  3OIP A;  2TSS A;  3A8I E;  1D1I A;  1SEB D;  4IUT A;  2NB0 A;  4KJO A;  1J8I A;  2F0P A;  3WDN A;  1WTR A;  3S1M B;  1PZI D;  3CRL C;  3VR2 A;  2BA1 A;  3BZD B;  1G8Z D;  5FO8 B;  3SVM A;  2K05 A;  2DNC A;  4XYQ A;  1A3U A;  4Z9C B;  1RTO A;  4KD3 A;  3W2D A;  4C2M B;  1A15 A;  1SYG A;  5C4H A;  2AQ1 B;  3K57 A;  2NWG A;  3MZ5 A;  3U9S A;  3IKJ A;  1FR3 A;  2EYH A;  1QWY A;  1G29 1;  3D6W A;  5C3X A;  2EYJ A;  1F9R A;  1K8M A;  1QNU A;  2RDH A;  2QIL A;  3Q23 A;  4X3K A;  1JCK B;  1O80 A;  2XWJ B;  2Q8I B;  3G7L A;  2VXW A;  1EWC A;  3VA5 A;  3KLS X;  2LKV A;  4FF4 A;  1S5C D;  4K5V A;  3BVM A;  2Z4I A;  2DY7 A;  5I4D A;  3TZD A;  2HCC A;  4HSP A;  2JA6 B;  2F0U A;  5JVG 3;  1LT4 D;  1IYU A;  2L9H A;  1VMC A;  2NYZ D;  5C4J B;  1HUM A;  1U4M A;  2J0T D;  3J7A V;  1Q3L A;  1GJX A;  2JP1 A;  2AQ3 B;  5TSS A;  4F7X A;  2M00 A;  4G7O C;  1KAB A;  3TZU A;  5DNF A;  2PZT A;  1LTT D;  1SYF A;  3NQI A;  2QF7 A;  4KHV A;  1WVL A;  1QIL A;  1SNO A;  4CJ0 B;  1HQM C;  2XVS A;  5C3W A;  3GP7 A;  3NWT A;  2BDN A;  1TT2 A;  1SE3 A;  1MSG A;  1EY9 A;  1Q90 A;  1F9P A;  3SDZ A;  3RMH A;  1H9K A;  2H1E A;  5EPJ A;  2K03 A;  2F0O A;  4QUC A;  4A3J B;  3GTP B;  2RBM A;  1R4Q B;  1IL8 A;  2F0M A;  4HCS A;  3GTM B;  5FO7 B;  4I65 A;  4N9T A;  1EYD A;  1EU4 A;  2K01 A;  2WP8 J;  3QIA A;  4HSV A;  1Z47 A;  1LAB A;  4CJ2 C;  1K8O A;  4C3J G;  3CRK C;  1WTX A;  2XN9 C;  1WTP A;  5M9O A;  2L4N A;  2HCI A;  1FYC A;  2O2L D;  2NVT B;  1R4P B;  3BYT B;  1STY A;  1EU3 A;  1FNW A;  1ZEQ X;  3A56 A;  3QWN A;  3H3V C;  1MI2 A;  2B2W C;  2L11 A;  3CQZ B;  5JPN C;  2IX0 A;  1CTM A;  4DGZ A;  4J1M A;  1D5Z C;  5CV7 A;  1KLU D;  1SNP A;  3D4R A;  1H9R A;  2F0H A;  1B44 D;  2JA7 B;  3DXJ C;  3HRZ C;  2WAC A;  2MP1 A;  3HS0 C;  3ERQ A;  1PTO D;  2F0S A;  3P20 A;  5D3I B;  5CBE E;  4IFD G;  3X3M A;  3J7Y W;  3PMF A;  2B8F A;  3BG3 A;  1BR9 A;  4HED A;  2F0T A;  4HAE A;  2RA4 A;  1RF2 D;  4P2C B;  1S5D D;  1V1P B;  2EYO A;  2KQ3 A;  2MUY A;  2L0C A;  1Y69 U;  3GTQ B;  4DK0 A;  4BY7 B;  3MXN A;  4FF1 A;  1BF4 A;  1OXT A;  1MSH A;  1SXT A;  3T56 B;  5JEA G;  2IX3 A;  2E2I B;  2O4X A;  3PO2 B;  3E5S A;  1T5X D;  4I7Z C;  3S1N B;  2RSN A;  3NTH A;  4ZQ3 A;  4G4K A;  1A2T A;  4K8I A;  1ZXT A;  3GTK B;  1JWS D;  2MPM A;  4ZKB B;  1HFN A;  4EQP A;  1ILQ A;  4PNY A;  2GA4 B;  3TP5 A;  2R3Z A;  3A54 A;  5CC4 A;  2MGS A;  1CM9 A;  1I50 B;  2A69 C;  5C5L A;  1GUO A;  1DM0 B;  2PMZ B;  1E0B A;  2I07 B;  1EY8 A;  4HMI A;  4NKL A;  4A3D B;  5K36 G;  1NSN S;  3KLS A;  2ZT9 C;  1ET6 A;  1CK1 A;  3NSW A;  4LMQ D;  3BS1 A;  2WKC A;  4A93 B;  1EYC A;  3NTK A;  1CHQ D;  4U67 3;  3KF8 A;  1BQQ T;  1I3Q B;  1SJH D;  1TWG B;  3I3C A;  5CBA E;  1Y8N B;  3HOV B;  3SK8 A;  5C3E B;  4KKT A;  3S14 B;  1TR5 A;  3TME A;  2JE6 I;  1SNC A;  5HGT A;  3NBI A;  1TWF B;  3IFT A;  2FMC A;  1GHK A;  5CYU A;  4TKO B;  1SAP A;  3HZX A;  2F0K A;  4XQN A;  1SND A;  4PV1 C;  2EYM A;  1G2T A;  3VYS A;  4ULL A;  1BCP F;  2PZU A;  1CT1 D;  4FVM A;  3V2T A;  2K5W A;  1ONL A;  3SK4 A;  3BYY B;  2NZ1 D;  4C3H B;  1VCI A;  5I9O A;  1B3A A;  5IT9 L;  1V43 A;  1E2Z A;  4CBV A;  5KGU A;  1Q8I A;  4WJW A;  1EIG A;  1STH A;  3RZD B;  1JQY D;  4RGN A;  1GUT A;  2YU9 B;  2PCF B;  2DNE A;  3PIO 3;  1XTC D;  3A7L A;  2NN6 G;  1PFB A;  3J7A F;  2R61 A;  2BCO A;  1QCB D;  3NPP A;  2RSO A;  4S3S A;  2K6A A;  3S2D B;  4XT1 B;  1WCM B;  1CZG A;  2QKI C;  3HOW B;  1WTQ A;  1TU2 B;  3KK7 A;  5KEE A;  5T1I A;  1E2W A;  3E0J A;  4KI0 A;  3K6O A;  5G3L F;  1RKN A;  4ILW A;  1O78 A;  1VF7 A;  3PUY A;  2A68 C;  3QOL A;  5KNB A;  4C3I G;  1SMY C;  4DNR B;  1RCV D;  2DN8 A;  2FIN B;  1GXD C;  1EEF D;  1STE A;  5K5P A;  3S1Q B;  1HCZ A;  4FXK C;  4A3G B;  2PPB C;  5JEA J;  3C46 A;  4K14 A;  4NDX A;  5IT9 E;  4FNF A;  4CJ1 B;  4OGQ C;  1EOT A;  5FKA C;  2F0G A;  4K2L A;  4L8J A;  1F2M A;  5COY A;  2E2J B;  5EKL A;  3JAM E;  5IGB A;  1B53 A;  2EOT A;  3QOJ A;  5M5W B;  1LTI D;  2PW7 A;  3D4W A;  3MTS A;  1BCP B;  4QMG A;  4ZKC B;  4LJZ C;  3DWA A;  2KJX A;  3SK6 A;  5LL6 X;  1TVX A;  3I70 A;  3L9A X;  4OL7 A;  5JOB A;  4B9X A;  3CU7 A;  1QOH A;  1VDZ A;  5C44 B;  4K6L A;  2R92 B;  4QF4 A;  5JJZ A;  1ML0 D;  2VNU D;  4GZY C;  2LFN A;  1XX8 A;  1STB A;  1T5E A;  4N9P A;  2B2U A;  2E2D C;  4K5X A;  1STA A;  1Z7T A;  1PZJ D;  4FYD A;  1PTO B;  3BDC A;  5FO9 B;  2K32 A;  4B9W A;  2G9H D;  2NN6 I;  1HPC A;  3S2H B;  2IL8 A;  4RGM A;  2CW0 D;  2C5C A;  1WTW A;  1EEI D;  4XXE A;  1DCZ A;  1IYV A;  1C48 A;  5T1G A;  2AUK A;  1IW7 C;  4OIK A;  2D9U A;  3S9W A;  4EGV A;  1EYA A;  3MHB A;  4IZ8 A;  2XWB B;  3FVQ A;  3MXU A;  4OO1 G;  1TS5 A;  2N55 A;  2L1B A;  4BWG B;  3GQB A;  1RHP A;  4FO2 A;  3GTG B;  2BDO A;  4O42 A;  1DD2 A;  5KNC A;  4A3M B;  3SEB A;  1I6V C;  4WFN 3;  2E76 C;  3R2T A;  4ZAI A;  2E75 C;  2F0L A;  5DM7 3;  2CHB D;  4ABN A;  1IHZ A;  4RHS A;  3R3O A;  1KLG D;  2EY6 A;  4DAY A;  4IUV A;  3EJI A;  2MJ8 A;  2EXZ A;  3MWY W;  2B8G A;  3TP6 A;  4EQO A;  1U9R A;  3C1F A;  1ZKO A;  2F3V A;  3NK9 A;  3FPU B;  4C1N K;  4XQJ A;  4IUP A;  4C3H G;  2EE1 A;  4QUF A;  5I2Y A;  5I2X A;  3M4Y A;  2AQ2 B;  1CQV A;  3DEO A;  4EQN A;  3P1H A;  2A6E D;  1TS3 A;  2NVQ B;  3I4L A;  2R7Z B;  1NUC A;  1ENA A;  1PRT B;  1F77 A;  4QIW B;  2NTS A;  5C0X H;  5BN3 A;  3WOF A;  5KYL A;  4RCO A;  3QO2 A;  4JBW A;  3TP8 A;  2O5I C;  3F2U A;  1GHJ A;  2E2H B;  1W6K A;  3LWU A;  2OT2 A;  3I4N B;  4DA2 A;  4H13 C;  5A35 A;  4HR7 B;  1L0X B;  4PMB A;  3K0Y A;  2F0W A;  1UEA B;  1H9S A;  3WOE A;  5EGT A;  4ZUJ A;  3VR3 A;  5DM6 3;  1G6Z A;  2BE5 C;  1DJR D;  1TWA B;  3D4D A;  2LMC B;  3MFG A;  5AFW A;  4ID6 A;  3V05 A;  3CKI B;  4DN4 M;  2K5Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...