2PZTA

Crystal structure of staphylococcal nuclease variant v66q/p117g/h124l/s128a at 100 k
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
135
structure length
130
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKVEKYGPEASAFTKKMQENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Crystallographic study of hydration of an internal cavity in engineered proteins with buried polar or ionizable groups.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 37
structure length 130
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2007-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2pztA00
2F0QA 4OL7A 2F0PA 2EY1A 2RDFA 4NDXA 3SK4A 5C3WA 5KYIA 5CV8A 4J6HA 4K8JA 1EQVA 1A2UA 4QF4A 2LKVA 3OWFA 3P1HA 4KHVA 1JOOA 4HMJA 1STNA 4ZUIA 4K5VA 3V2TA 3H6MA 2F0NA 3D4WA 3SK6A 3MZ5A 3TP5A 5C3XA 1KDBA 5CV7A 4DU9A 5F2DA 1JOQA 3SR1A 1KABA 3SHLA 4KTAA 4B9WA 1SYBA 4NP5A 4WRDA 5CV6A 4E6IA 3T16A 5CC4A 2RKSA 4ZUJA 4LAAA 2M00A 3NK9A 5J22A 5CR3A 2KQ3A 3R3OA 2NUCA 1F2YA 5ISRA 2EY5A 3SK5A 5KEEA 3C1EA 1F2MA 1AEXA 2PW7A 3QOJA 3NQTA 1EZ8A 4EVOA 1STBA 3LX0A 1SYDA 1SNPA 1STHA 2HQEA 4HTHA 2F0FA 1A2TA 3MEHA 5EKKA 5IIFA 2F0EA 4IZ8A 4HMIA 4R8NA 2F0TA 3OSOA 1STAA 1U9RA 3HZXA 2QDBA 4KY5A 5IODA 1JOKA 2ENBA 1EYCA 1EYAA 1SNDA 2EY2A 2EYJA 3DHQA 2SNSA 4K2KA 4B9XA 5JAVA 5CV5A 3SXHA 5IGCA 5EKLA 4K14A 1IHZA 3NUCA 2F0OA 2EXZA 3MXPA 3OMCA 1JORA 4EQPA 5C6AA 1A3VA 2O4XA 4KY7A 4NMZA 2SNMA 5HURA 3HEJA 3D6CA 5C4ZA 3EVQA 1RKNA 2OEOA 4QB4A 1EYDA 5E1FA 1ENAA 4KD3A 2F0WA 4KY6A 4PMBA 4J1MA 5C5LA 3E5SA 3ERQA 4RKBA 1ENCA 4F7XA 4YIJA 5I6WA 5IGDA 3OMGA 3QOLA 4H7BA 4RKLA 1STYA 1KAAA 3EJIA 3TP6A 4DF7A 5C5MA 3DMUA 4F8MA 5KRUA 4DFAA 3TMEA 1A3UA 3TP8A 5IGBA 1NSNS 1EY0A 1A3TA 2PQEA 1F2ZA 5EGTA 2F0VA 2EYMA 3NXWA 3SK8A 2EYPA 2F0MA 2F3VA 3ITPA 4K6DA 3RUZA 1EY4A 4MIUA 4K5WA 1EY6A 2F0GA 5CGKA 3T13A 2F0IA 2F0DA 4I65A 5K5PA 5DEHA 1SYFA 2RBMA 3QB3A 3D4DA 5CV9A 4PMCA 5IGFA 2F3WA 3BDCA 1KDAA 5IGGA 3TP7A 3S9WA 5E3FA 4EQOA 4IUNA 3P75A 3MVVA 4ME5A 5JOBA 5KYLA 3EROA 4KV6A 4N9TA 1TR5A 2F0HA 3BDLA 1SNMA 3NHHA 2F0KA 4NKLA 2F0JA 5HGTA 1SYCA 2EYOA 3MHBA 4EQNA 2WACA 5C4HA 5IOCA 2KHSA 1EY7A 1TQOA 2EYFA 1SNOA 2OXPA 5CV4A 5IGEA 2PZUA 5M9OA 2PZWA 1STGA 2EYLA 2PZTA 4K5XA 5I9OA 2F0LA 4IALA 3C1FA 1NUCA 4G57A 5KIXA 1EY9A 5I9PA 2PW5A 2PYKA 3U9OA 5J39A 4KD4A 2OF1A 3PMFA 4ODGA 1KDCA 4PNYA 4DGZA 4N9PA 3VA5A 4KJOA 2EYHA 1EY8A 1SNCA 1II3A 5I6YA 5KGUA 4TRDA 4S3SA 4KJNA 4ID6A 2SOBA 5J1ZA 4WORA 5DAUA 3D8GA 4K2LA 4K8IA 1SYEA 1EY5A 1TT2A 1SYGA 2F0SA 5NUCA 3NP8A 1SNQA 4ZQ3A 2EY6A 4QMGA 1EZ6A 2F0UA
chains in the Genus database with same CATH superfamily
1HJPA 3GO5A 2EY1A 2O5IC 2ZTDA 3K7UC 1DD2A 1EQVA 3NBIA 3STBD 3TZDA 4JK1C 3KBXA 3H6MA 2E2JB 2VZAA 3D4WA 4JI2L 1CZGA 4B3RL 4DV7L 1ZYRC 4I7ZC 1QUQA 4H44C 2B2YC 1SLJA 4WRDA 5EJWA 5CC4A 1B50A 4JI1Q 3I4MG 4G7ZC 3R3OA 1QNUA 3S1QB 2XWBB 1GUOA 4RGNA 5KEEA 1CK1A 3WOFA 4BY7G 1SYDA 4AIMA 4DR1L 1AP0A 1LLRD 3NPPA 2F0TA 1WTHA 2MO0A 4HJ5A 3FPPA 4RCOA 1IBLL 2WAQE 5JPMC 2DJGC 3OTOQ 4EGVA 1Y1VB 1BKBA 1A3VA 1D8LA 1S5BD 3HEJA 4A3MB 3RN5A 2JA6G 1ZEQX 4HR7B 4ZLTF 3PO3H 5E1FA 2EZVA 1ENAA 2FJ2A 4J1MA 4A3KB 1PTOD 5FO9B 1C4QA 3QOLA 4H7BA 4KK7A 5J39A 3NTHA 2Z4IA 1EEFD 1OXTA 1Z9FA 3TMEA 4DFAA 5FJ8G 2JA7B 3T56B 3BZKA 4IPGA 1RHPA 4B3MQ 3SK8A 5GAHC 4X3UA 3J80c 2LSSA 2JA8B 4IOCA 2N8NA 3HOYB 5E4XA 2F0DA 2JP1A 4IO9A 1G6PA 2R6GA 1YI2A 3E9IA 3GTOB 2AWNA 2L9HA 1BQQT 4PZ6A 1I4QA 1VQJA 4A3BG 2FINB 4B3SL 3F2UA 5IYDG 2N55A 3HOVG 4ZKBB 4C3IB 2YV5A 2B2VC 4LFCL 4G7HC 5M5WH 4A3IH 1PH3A 1LO5D 4YHHL 2F0LA 2VQFL 4G57A 5M5YH 1LTBD 1VQMA 4NXNL 3M4QA 4XYQA 5DM73 1ENFA 4DR5Q 4O2DA 5ELDA 1ASZA 1L0WA 1Y8NB 5ELCA 2EE1A 4X62Q 2A68D 1YBYA 1PFNA 2RDHA 1PZJD 1U4RA 1LTAD 2Q8TA 4NDXA 3HOZB 4OWWB 4GOPA 1K3BC 3K0YA 1K0SA 2HD3A 1QUQB 2UXBL 1NJIC 2WAQB 1DGSA 4HAEA 2WFWA 4DK6C 1I6VC 2CQAA 4RWSC 4P72A 4JBJA 2EY5A 1MHWC 3AYHB 4ZCKA 1XX8A 3U4ZA 5ELEA 2E2HB 4IJHA 4KN7C 1STBA 3LX0A 4FF2A 1SNPA 1I3QH 1KLGD 1AW7A 1E2ZA 1HCZA 1L0YB 3SE0A 2B63G 4LFBQ 4BXXG 2ENBA 4DKAC 4DV0Q 2HDMA 1YNJD 4LF6Q 1FVIA 2EXZA 3I91A 4KY7A 3GTGB 3Q8DA 2EPBA 2KA7A 5T1GA 3K59A 1EYDA 3S2HH 3S14B 2RF4A 3ERQA 3R2TA 3HOUH 3HGBA 1KAAA 2Z8LA 4ZAIA 1EOTA 4P2CB 2L15A 1H9KA 1V1QA 1YJ9A 4DV3L 5JPNC 1YHAA 1HNWQ 4K6DA 4MIUA 1RCVD 3F2CA 4I65A 4DK3C 4GNXA 2UXDL 1B1ZA 1I4PA 2AQ2B 5CV9A 4FDBA 4QL5A 2O2LD 1JWMD 3TP7A 3DLLA 1FNWA 3I4NH 3GTLH 4ME5A 4A75A 1OXXK 1AZQA 1D5XC 1WTRA 4N9TA 1C8CA 2G9HD 1S5CD 1T9HA 3CD6A 2FHTA 3VR2A 1PH9A 4ULLA 1I94L 1OXUA 1FNUA 1F9RA 2B3GA 4A3CH 5LMNL 3F8TA 1GJXA 2DNCA 1S72A 2RSOA 1SNCA 1SROA 2NTSA 4DR2L 1DOMA 1O7LA 1CHQD 3DM1A 4MHEA 3GTPB 2E5LL 1LTID 1T5XD 4A3GB 2R93H 3D31A 3GTQH 2F0SA 4B3TL 2NYZD 1V8QA 4GOPB 1HR0L 2Q2UA 2LKVA 4KHVA 4C3JH 1BVSA 3J80L 4C3HB 5M5XB 3A54A 3MEFA 1I94Q 4QF4A 3ERSX 1L2FA 1JOOA 4HMJA 1IYJB 1STNA 2TSSA 2CCZA 1LTGD 1SN8A 4BS9A 1ESFA 4XXEA 4CGYB 2ZTCA 3PUWA 4DR2Q 2ICIA 1L0XB 3NQIA 2GN5A 3VYTA 1TKWB 1EQTA 2IJ0A 2KQ3A 2VL6A 1OTCA 2JA5G 2RHSB 3GV3A 3GTMH 4OO1I 1B9MA 1UAPA 3C1EA 1RTOA 2PW7A 1AEXA 4XYOA 2KEEA 4ZYSA 4GN5A 1ESRA 3VR4A 1CM9A 3MEHA 2XN9C 3KF8A 1QNKA 5C3EH 1CA6A 1GUGA 1TWAH 1PMRA 3HZXA 5ELOA 3K5MA 1JOKA 3I56A 3K5NA 2NB0A 1JCKB 3SGIA 2JE6I 5I4DA 2Q2TA 2VB3X 1XMOQ 5LL6S 3BU2A 1Z47A 5EPLA 1SAPA 2HCCA 2I07B 4BBRB 1JT8A 3FP9A 1QVGA 1X3QA 3KBGA 4HJ8A 5BR8L 4LMQD 1EY0A 3J81E 4GNXB 5IYCG 2F3VA 3VA7A 2R93B 1ONLA 3HOWH 4RG1A 1LT4D 1BCPF 3HP3A 4OO1G 3VYRA 4PQXA 4L5TA 1EWHA 1CQVA 3MFYA 2BH2A 2K14A 4A93G 1FGBD 4BY1G 1N34Q 3JAML 2XWJB 1Q12A 3V05A 4ABNA 1RDPD 2K52A 3I7FA 4KV6A 4CDFC 1PRTC 1TVXA 2L11A 4A3DB 4OEMB 3KLSX 1GXDC 2RVLA 2L5TA 1YNXA 3GTMB 4RHSA 3U9OA 1VQOA 1RODA 3VA5A 3W1GA 2VW9A 4KJNA 2R92G 1PTOB 1IW7C 4J8QA 2R7ZH 1JJ2A 2UU9L 1CA5A 3ER0A 3PV0A 2FMCA 2E2DC 2K05A 4JI8L 3AU7A 4QMGA 1TWFH 2IHEA 3T4AC 1EZ6A 1PH2A 3BYTB 2YYZA 3MXGA 4HCSA 4NXML 3LNNA 1VQKA 1R9TB 1S5ED 3RZDH 1SDFA 3HKZE 2B8FA 4GKJQ 1GD7A 5C3XA 3VR5A 1GO3E 2NVQH 4RA8A 3RLOA 3EA6A 3J81c 5CV6A 4HIOA 3CCJA 2MGSA 4CKEA 3KF8B 1D5MC 3J7ZC 3ULJA 5C44G 3CCEA 4HTHA 1AE2A 2A6HD 2YU9H 1VQPA 4KY5A 5A2QE 2B2WC 4MTKA 4P73A 4O42A 1SNDA 1BBUA 1TS4A 3MC0B 2HDLA 4CDEC 1FGUA 2RSNA 4JI4Q 2E76C 3U4VA 1SE8A 4AQYL 3I8ZA 5FK9C 3GTJB 3GP7A 1WI5A 1DOLA 3DEPA 2K01A 1VQ9A 2LFNA 1STYA 2F1MA 3UDGA 3BVMA 3H3VC 1LUZA 3TP8A 3UDXA 3K5OA 4QQBX 2EYPA 3ITPA 3RUZA 4R4CA 2B2TA 2UUCL 4FP5D 2A6ED 4DUZQ 2RBMA 1I4XA 4A3EB 3I4MH 5IGGA 4JI5L 1EIGA 3UDIA 5IP7G 1SR3A 4KN4C 4LFAQ 4BY7H 1B9NA 5M3FG 1P16A 1D2BA 2GVBA 4IURA 4JI0L 4BA2I 4BBSB 2EYFA 1YVCA 5IWAQ 3BZCA 3DXJC 4L5RC 2XVSA 1MJCA 3BVGA 4KD4A 2OF1A 2JA6H 2WP8J 5D3IB 2K1BA 1W3SA 3HKZB 1Y1WG 2VUMB 3KJPA 1LT6D 3NTIA 2YTXA 1YJWA 3S15B 4PMWA 5NUCA 5FJ8H 2NZHA 4OGQC 1KXLA 5LMUQ 1HNZQ 1Q1EA 3PO2G 2DNEA 2RDFA 3D3RA 4P74A 1XMQQ 2BE5C 3OWFA 4DAVA 1SE2A 3V2TA 3CRLC 1VQEA 1PLFA 2F0NA 4DXFA 1EFID 1KDBA 1EYGA 5FLXc 3FPUB 4KTAA 1PZKD 4E6IA 3I4OA 2N78A 4A3BH 4LWCA 1Y14B 2MNAA 5IT9E 2NVTH 5IYDH 3UE0A 3HOVH 3I3CA 1YZ6A 5LHY1 1BCPD 2VY3A 1SE3A 5EKKA 2CH4W 2J4XA 2C9OA 3A5UA 3ULPA 3S2DB 1AZPA 1U9RA 3K80C 1LACA 3DWAA 4FXKC 2DY8A 5EKLA 4OX9Q 1D1KA 2F0OA 3VYSA 1JORA 2O4XA 1FL0A 2UUAQ 3L3OC 1Q82C 4LF7Q 1L1OC 3BS1A 1GKHA 4O1NA 1PZID 1K3RA 4DR3L 2ZJQA 1KRSA 1MKHA 5C0XI 4DR7Q 1IXRA 1JJCB 3QIAA 1Q90A 4QUFA 3VR6A 1SMYC 1X3PA 2KCTA 2GVAA 1EY6A 2CFMA 5K5PA 1TWHH 2D5DA 2DGYA 5J3BA 3A7AB 4DNRB 2EQSA 4N8FA 2LY7A 1TR5A 4DR3Q 2Q8IB 3IKJA 4MN3A 1TY2A 1F9PA 2VB2X 4OELB 2B63H 4BXXH 5C4HA 1O7YA 1CKNA 1ILQA 4X6AH 1HQMC 2LXKA 2WB1G 2A69D 2RHQB 5I9OA 4QJFA 4OIKA 3W1BA 1H95A 4DGZA 4H02A 4GKKL 1HRJA 1VQGA 2FMMA 5C0XG 3ICEA 1I50B 1IBKQ 1VQ8A 3D4RA 2JYOA 3CP0A 3OHXC 4ILWA 4A3FG 3KYHC 2V1CC 3NBHA 2QEXA 1AFPA 4UP7A 3CU7A 5JVH3 4R4TA 4KMUC 3P1HA 3CMAA 2YTVA 3K58A 1M4VA 4LF5Q 2D0OA 2E74C 4GKKQ 1N8RC 5CBAE 1N36L 1KHIA 4X66Q 1FD7D 2AMCB 2IX0A 4Z9CB 2RKSA 2OQKA 3NK9A 2QF7A 1F2YA 3BJUA 4DV2Q 4PG3A 3AFQA 1IL2A 4EVOA 2KBNA 5M3MB 2Y0SE 3M4OB 2K03A 1IKLA 1I4RA 1STAA 4IN3A 3TEHB 4L5SA 2EY2A 4JI6L 2SNSA 3KJOA 3SVMA 1MBYA 3QG1A 1KNEA 1BXTA 4WJWA 1YHBA 3NUCA 4HIDA 5HURA 3RZOH 1W6KA 3UE1A 2F0WA 4PMBA 3G6JB 1WCMB 4CKCA 4PV1C 3H0GG 3TP6A 3STBC 4XIGS 4FXGC 3FKIG 5GQOA 1S4ZA 2PQEA 2VNUD 2EJMA 3CCVA 1ICFB 4DN4M 2EYMA 3S1MB 4JI6Q 5CGKA 2IW3A 2N88A 5FLXL 2VQEL 1WVLA 2UUBL 4JI2Q 1E1OA 4B3RQ 4DV7Q 3KLSA 2JSOA 1VQLA 1IKMA 1LT3D 1WYDA 3HOXG 2JA5H 1WTWA 2BDOA 1JICA 3A8IE 3CQZB 1CKNB 3PUXA 3BDLA 1SNMA 2F0KA 5C4XB 1WJJA 1WTQA 2NVYH 3S1RB 3ULLA 4DR1Q 3A8JE 2NVXB 3S1NH 4K5XA 2B2UA 3IL8A 5JEAG 1IBLQ 4MTNA 1HZ9A 1WD0A 1PTOC 3S16B 1JWUD 4DR6L 4M1UB 3OW7A 1CKMA 2SOBA 5KNDA 3B6YA 5DAUA 3HS0C 3PUZA 1HXYD 2Z6BA 4JBKA 3NBHB 1JB3A 5TSSA 3CKIB 3ND8A 3J7A5 5IYCH 1D1IA 4OL7A 3MXUA 2Y0SB 5JVG3 4OO1H 1CT1D 1LTLA 1SFOH 1M90C 1PH6A 1EU3A 4DU9A 1TY0A 4A93H 4BY1H 3PSIA 3PIPA 4DR6Q 3C46A 3FEWX 3AFPA 3SK5A 4B3SQ 2E8GA 4C2MH 5IIFA 1DOKA 4MZ9A 2F0EA 2XSCA 4X3KA 5IODA 4DUYL 4FF3A 3PO3B 3AEVA 4LFCQ 1EWIA 1K9MC 4YHHQ 2I5LX 2VQFQ 1NY4A 2NN6I 4LUOA 1C48A 1DONA 2A68C 2R92H 4DV5L 5KYIA 4NXNQ 4CDCC 2SNMA 2A8VA 3CCLA 2BH8A 4DV1L 1CZWA 2XIWA 4RKBA 5I6WA 1HH2P 4RKLA 1GUSA 3CAMA 1V1OA 3E0EA 4YCVA 1BO0A 1Y8OB 1X3FA 1LV9A 2F0GA 1K0RA 2JN4A 3CW2C 2UXBQ 3FDTA 2KUMA 4A3JG 2MUYA 2IL8A 4POFA 2K5NA 2R61A 1BCPB 5M5WB 4A3IB 4HSVA 1PH8A 5C44H 2IY5B 1XPRA 3NHHA 4DNIA 3KOJA 1G91A 2NN6G 5M5YB 4EQNA 4OWXB 1VQIA 1YNJC 4LF8L 3H3VI 4A93B 3E0JA 3KLWA 3T1YL 4UDUC 5M9OA 1QWYA 1STGA 4OHJA 4O0AA 1EIHA 4AYBE 4ODGA 4PNYA 1DM0B 5GADC 1C9OA 4XQNA 3CF5A 2EYHA 3GTKH 1II3A 2FXQA 2P5ZX 5GROA 4JI7L 1EY5A 2EJGC 4RHRA 2J7ZA 5K36G 2HCIA 1VQ4A 4LW1A 1EEID 1Y1VG 4A3MG 1EUJA 1R4QB 1I4GA 4J6HA 4QY7A 4DV3Q 1A2UA 1VQ7A 4QGUA 2K7VA 1SJED 1Y8PB 1K8OA 4HN7A 2OWOA 3N6RA 5E4WC 5IP7H 2UXDQ 4IUTA 1GUWA 2JA7G 1Q8KA 1I3QB 2KCNA 3T16A 4LAAA 4JOIA 1K28A 5M3FH 2R3ZA 2JA8G 5A35A 3RMHA 1N33L 3HOYG 4CHTB 2PPBC 2I5HA 3I90A 3I72A 2F4VL 3J80i 1XPUA 3BYYB 1STHA 4BWGB 1VF7A 1ET6A 2QDBA 4GLXA 1RIPA 3Q23A 1EYCA 2K04A 2IWHA 1IBML 3S2HB 1Y1WH 3D6WA 5LMNQ 3HOUB 1V43A 1E2VA 1HTPA 4C3IG 3ONAB 4LF4L 4KD3A 3OOCA 3UI2A 2E5LQ 5C5LA 1VQCA 4B3TQ 4JW0A 3PO2H 2B2TC 4X65L 5KRUA 1VMPA 4RGOS 3CPFA 1HR0Q 3HKSA 1PDQA 4R9WA 3KUPA 3OWEB 5KNCA 2I5MX 2MQHA 1X65A 1JWSD 3I4NB 3CRKC 5FO7B 4JPBW 4YWLA 3GTLB 1ET9A 1BR9A 2QGQA 1O78A 3NSWA 2IX3A 4AYBB 3TBIB 1A62A 3HOZG 1VQ6A 2KJXA 3MVVA 2NBFA 3K7AH 3PCOB 2J0TD 3R93A 1CFMA 5HGTA 1KTKA 1UEAB 1SYCA 4UY8C 4DXGA 2WAQG 3TS0A 1FYCA 5IGEA 1H9JA 1I4HA 3O13A 1NUCA 5KIXA 4L8JA 5BN5A 4HJAA 3WWVA 3GTQB 3T1HL 3A8KE 1F2LA 4N9PA 5FKAC 3JAMi 4JI3L 1V9PA 1UE6A 4C3JB 1PFSA 4K2LA 3MFGA 2ES2A 4P75A 1NR2A 4ALPA 4FF4A 1LTSD 2E2IH 3M4YA 1XTCD 1QB5D 3TSSA 2R7DA 2F0QA 2Z6KA 4HIMA 3T51B 5I2XA 5BR8Q 1EFWA 4JG2A 2ZM6L 1YITA 4JYAL 1XXGA 2K4KA 3C3LA 2JK8A 2JJQA 3PUVA 1G6ZA 1PA6A 1KABA 5G3LF 4DV6L 4L63B 1ML0D 4ZUJA 4LF9L 5C3EB 1TWAB 1C7YA 2IHFA 1F2MA 4DV4L 3QOJA 1CI3M 5IYBG 3I55A 3M3YH 4XT3B 2ALYB 2F0FA 1B2TA 2KHJA 4IZ8A 3J7YW 2Q2IA 4JYAQ 1IYVA 3A5ZB 1HHVA 1TU2B 4R4OA 5C0XH 1A8VA 5AFWA 4IPDA 3CPWA 1VQDA 2UXCL 5FO8B 4DV6Q 2Q8RE 2SDFA 1RKNA 5DNFA 4FO2A 1M1KC 3E5SA 4LUZA 4A3FH 2UU9Q 3HOWB 1QOHA 1CSQA 3J81j 1B4OA 1CQFA 3KF6A 4JI8Q 5IGBA 5C0XJ 1A3TA 2OQ0A 4CDDC 4A3GG 2F0MA 3MXNA 4NXMQ 1DJRD 4LJZC 1TWGH 5GAGC 1EU4A 1ICWA 1D5ZC 2GA4B 3PF4A 5IGFA 3BDCA 2PQAA 5E3FA 4C3HG 1G2SA 4QIWB 2ZXPA 1PYBA 1EOVA 3EROA 1I5FA 2A6HC 2PNHA 4JV5L 1RF2D 1VS0A 1QCBD 1XNQL 2WACA 4H13C 1UEBA 1H9MA 1TQOA 1ZKOA 1K8MA 2R7ZB 4DK0A 3X3MA 3NTKA 3L0OA 4DAYA 3F1ZA 4S3SA 4K0KL 1TWFB 4AQYQ 4YY3L 1SYEA 1KAWA 3H0GH 1TT2A 3I4LA 1J5EL 3HG9A 3FKIH 1BUVT 3TZUA 4JV5Q 5EBDA 2VXWA 3NP8A 1D6EC 3RZDB 1OXSC 2EY6A 4C1NI 2NVQB 3MA2B 3F2BA 2A6EC 2X69A 4POGA 5D14A 1IL8A 1F9SA 5ELNA 1QG7A 1MI2A 1A15A 1OO9B 4OXPA 2K50A 1JE4A 4BBRG 2QCPX 2UUCQ 3HOXH 2L0CA 2X6LA 1WOCA 1EQQA 4MNOA 4NP5A 2OTLA 4K0KQ 4JI5Q 5J22A 3EN2A 2YU9B 1JC7A 2R93G 3TREA 4R1JA 3PQIA 3PGZA 3R8BA 4YWKA 2AHOB 3G48A 4CBVA 5IE8A 1XJVA 1E2WA 2IX1A 2D62A 3CC7A 2HHHL 3DEOA 1A2TA 4TSSA 4JI0Q 2KEDA 3OIQA 3PIOA 4GS3A 5JEAH 2CKZB 4XTCS 4K2KA 1PV4A 2CW0D 5JAVA 1I6HH 3SXHA 4HEDA 1IHZA 4Y52H 1LTRD 3JC66 1LTTD 4A3DG 1QILA 2KVMA 1SEBD 1JR0D 4QB4A 3DWQA 2IPKD 3KF6B 5JEAJ 4YIJA 5ELFA 2RDGA 3RLFA 3EJIA 1CTMA 1LYLA 2AQ3B 4F88A 4NPSA 1IZ6A 3MXNB 2E75C 3PUYA 2K5WA 3I4MB 2NTTA 3E9HA 2AQ1B 4P71A 2PQAB 4BY7B 1SYFA 1FNVA 4FF1A 1HZAA 3P7JA 1XNRL 4A3LG 1AH9A 1BCPC 1BNZA 4M8AA 1YIJA 2A1AA 2F0JA 1XWEA 1CHPD 2JA6B 1BBWA 2QEJC 2QDLA 2VS1A 3J7AV 5G3LD 1EY7A 1G51A 3U9SA 4DAYB 2OXPA 3S17H 2C35B 5AJ3L 2EYLA 3CCQA 4ZRZA 1X55A 1TS3A 3J81L 2Q2HA 4CJ2C 2NZOA 3U58A 1X9NA 2O5JC 3I2ZA 2BA1A 5C4JH 2V4DA 1TWCH 4HJ7A 1SNQA 4ZQ3A 2DN8A 2ZJRA 4U68A 2F0PA 2QKIC 2KHIA 5CV8A 4OIJA 4K8JA 1HFNA 3Q6SA 1K83H 1U4PA 4DPGA 1YJNA 4A3BB 4K5VA 5IT9c 4A3JH 1Q81C 1W6JA 3MZ5A 4RGTA 1WTPA 1N32L 2IT1A 2NVTB 1HNXL 3E6ZX 3HOVB 3CC4A 2B2WA 3RN2A 3NWSA 3NEMA 5E7NA 2E2JH 2NN6H 3RLNA 2K28A 2A69C 4GOPC 2KECA 3E3XA 1AE3A 4X64L 4A3EG 3EBEA 1JQYD 4HMIA 3S1QH 1X32A 2CHBD 4JBWA 1EYAA 3QJYA 3DHQA 4RFBA 3IAYA 4KHPL 1J8IA 1Q7YC 2HIXA 4K14A 1MSHA 4WJ4A 4KLKA 1Q1BA 2K33A 1C0AA 2L1BA 1FJGL 5K36H 4BBSG 3K8AA 1GM5A 1Y1VH 1YNND 1HA6A 2Z4HA 4DF7A 3PIP3 4A3MH 2L4NA 2WIIB 1TWHB 3W2DA 4X64Q 3G71A 3HKZG 2JEAI 1X56A 2VUMG 1HQRD 4AH6A 2F0VA 1HUMA 3FRPB 2LXJA 1WTVA 4IFDI 1VQHA 3K6OA 3H3VH 3QB3A 2JA7H 1F9QA 3PF5A 5A2QL 4JI1L 2JA8H 2B63B 3H94A 4Q0FA 1N36Q 4IPHA 3J80E 3HOYH 2F03A 1ZYRD 2SEBD 5KYLA 1Z6HA 4X3SA 1VF5C 3GTOH 2WINB 1VQ5A 4KKUA 5IOCA 4GNXC 3HRZC 1SNOA 2K5HA 4XT1B 2K5VA 3FVQA 3C1FA 3OTOL 3CMEA 4LK1C 3PMFA 1UE7A 3A55A 1KDCA 5CYUA 4C3IH 4KJOA 2EVBA 2EOTA 1UE1A 2DJFC 3BG3A 1U5KA 3TRZA 1SYGA 4KI0A 1Z7TA 4IFDG 2AUKA 4TVAB 1X6OA 3EIVA 2NWGA 3SDZA 4B3ML 3DM3A 5C3WA 3T53B 1WD1A 1PHJA 4JBMA 4UP8A 2HUGA 4V0BA 3UDFA 1DZ1A 4JOIC 3SK6A 1HPCA 2A73B 3GV6A 3TN2A 3WOEA 2VQEQ 3HOZH 2UUBQ 1FR3A 1SYBA 3A7LA 1BOSA 1SMXA 1K8AC 4R8IA 1S40A 4IUPA 2ZT9C 3EQLC 1NBWA 1H9SA 4DAMA 3TDQA 1L1OA 2CH4A 5EPKA 5EBCA 3V96A 4R8NA 2D9UA 5IP9G 4KHZA 3RZOB 3NE5B 2HT1A 3JAME 1KL9A 4CKBA 2E2HH 1VQBA 2BOSA 1GVPA 4EQPA 4DR5L 5ELBA 1MIUA 1PH4A 4X62L 2MO1A 1PH7A 3CC2A 3GTGH 1QVCA 3DWPA 1MGSA 1NNXA 3K5LA 1F2ZA 1QZGA 3S14H 1G2TA 5IT9L 2JA5B 4NB3A 1EY4A 3DUZA 5JJIA 4K6LA 4PMCA 4LUVA 1KDAA 2EIFA 1K73C 2K5DA 1PRTF 1B3QA 3IFTA 2NVYB 3Q0AA 2EDGA 1CSPA 4XDXA 1HTLD 1S3OA 5IYBH 3S1NB 2EXDA 4DNTB 3CCUA 2B29A 4LFBL 3I70A 4XQJA 5CV4A 4DV0L 2PZUA 5FLMG 3K81C 4LF6L 2PZTA 2QW7A 4DUYQ 4IPCA 2PW5A 5EPJA 5KGUA 1A63A 3G7LA 5M3MG 1UWVA 4DV5Q 3L7ZC 1PYSB 3CCSA 1D7QA 2Z6KC 1P8LA 4JVZA 3JAMc 1SE4A 4DV1Q 2G9DA 4IJLA 3ZJYC 1SFOB 3KK7A 3NENA 2BA0A 3GTPH 2C5CA 4A3GH 4WFN3 4BY1B 1HNWL 3I73A 3AB9A 1DCZA 1XYIA 3EFXD 1U4LA 3D0FA 2M2LA 1WCMG 2MHVA 3TP5A 4G7OC 2FFKB 5F2DA 4C3HH 3SR1A 5M5XH 1H9RA 4F87A 4C2MB 3H15A 3CHBD 4C1NK 5CR3A 2F52A 4L6TB 1H9SB 2NUCA 3RD4A 3X3NA 2RCNA 1KC8C 1L1OB 1BF4A 1ASYA 1EL0A 3A56A 1K8GA 4QCLA 2B2YA 2L55A 2MPMA 3SEBA 3Q24A 2R92B 4LF8Q 2CVRA 1WFQA 4RAUC 1SJHD 3T1YQ 3VYUA 2RQXA 1VQFA 2CWAA 5CV5A 4A3KG 1MJEA 5EAYA 1F77A 3A74A 5C4XG 1NR4A 1J9OA 2EJFC 2OEOA 2K32A 4JI7Q 1MD2D 2Z9HA 3QO2A 5IGDA 2RA4A 5CORA 2KOLA 1SSOA 2F3IA 2JXMB 4LNQA 3QWNA 3NXWA 1NTGA 4BBRH 2ZTEA 1X54A 2BCOA 5C44B 4C56C 2F3WA 5IY0A 3W3AA 1UUPA 3P75A 2Y0SG 4KKTA 2KCMA 3M4PA 2PI2A 1LABA 1N33Q 2LS01 2EYOA 1A0IA 4FNFA 1O7ZA 1PVOA 2F4VQ 2D2CC 1NAPA 5JJLA 3MAQA 1E22A 3GTKB 1X3EA 4GN3B 1ZXTA 4DAPA 4GLVB 1HZCA 2PZWA 1DYQA 3F2DA 1EY9A 3RR5A 1BDOA 4A3DH 1IBMQ 4IQZA 4ZKCB 1XMOL 1EIFA 2PI2E 2B2VA 4R4QA 4ID6A 5J1ZA 4YWMA 3BZDB 3M7GA 2WKDA 1NCVA 3D8GA 1RTNA 4GN4B 4LF4Q 3PO3G 2OTJA 2JA9A 3RNUA 2Z0SA 1TIID 4ME3A 5FOBB 1PTOH 4GLAC 1STEA 4X65Q 1PFBA 1HUNA 3SK4A 1Q3LA 4JC0A 4ZUIA 1IYUA 1JJGA 5M3FB 1JMCA 3K0XA 5KNBA 5CV7A 4A3LH 1JOQA 5COYA 1HFGA 3SHLA 4QIWE 3G6EA 1N34L 5H1SE 1R9TH 5CMDA 4UAIA 5ISRA 4YCWA 3J7AF 3MWYW 1EZ8A 3L9AX 1JE5A 1Y1WB 2HIVA 2ATWA 1GUNA 4A76A 1X3GA 4R4IA 3NELA 3OSOA 1PRTD 1E7ZA 2EYJA 4B9XA 4PZ7A 1TXYA 4HIKA 4A3IG 5IGCA 1O7IA 1PXUA 2KENA 4X3TA 4GZYC 1KIXA 2WB1E 3OMCA 5C6AA 3T1HQ 3PO2B 4NMZA 1EIYB 4QUCA 2A74C 2XRQD 1B3AA 1M8AA 1A6XA 4JI3Q 4UHVA 1B7YB 4KY6A 1ENCA 3OW2A 1IW7D 1NMFA 4F8MA 3CCMA 4Q5VA 4YCUA 3GTJH 1JB7A 1BBXC 4RCNA 2I0QA 3M9BA 2A19A 2ZM6Q 1E0BA 3Q22A 4GKJL 4DA2A 3K7AB 3S24A 2DY7A 2B8GA 3TQYA 1E3PA 1TS5A 3PIO3 3S9WA 1S5FD 5DLQE 4WJ3M 5LL6X 1Q86C 4FVMA 4LF9Q 2I46A 4G4KA 4NKLA 4A3EH 1G291 4DV4Q 1Y69U 5BN3A 1GHJA 3OIPA 5JJZA 1T5EA 2AWOA 2OCEA 4OONA 1N9WA 4RH6A 2ZJPA 4TQUS 1KD1C 1TS2A 4JI4L 2PYKA 1W2BA 3H91A 5I6YA 1SXTA 4BBSH 3CXCA 2E2IB 4V190 5HY6A 2UXCQ 3P20A 1R4PB 4K8IA 5CBEE 2ASBA 1B44D 1RL2A 1B53A 4L5QA 3HOUG 2VUMH 3TS2A 3LGJA 2MJ8A 3ZYYX 2NZ1D 3S15H 3GDEA 1KLUD 2PNRC 5DM63 1HZBA 1QVFA 5LMNW 4DUZL 2X6GA 3OPOA 1EWCA 2PCFB 1XPOA 1VQAA 3OYYA 3M3YB 4UPAA 1QZHA 2WB1B 2LMCB 1PH5A 2H5XA 4IOAA 2XGTA 4LFAL 1WTOA 3I4NG 3M7NA 3NQTA 1HR0W 1Q46A 5FLXE 2AKWB 2HQEA 2QILA 4U673 3KDFA 1XNQQ 1B70B 4FYDA 4AYBG 5IWAL 2QA4A 2JEBI 4UP9A 2M9VA 4NW2A 2XRSD 1LM0A 1RJTA 4A3FB 4A3CG 2PMZE 1QE6A 3MXPA 5I2YA 3S2DH 3D6CA 1AN8A 1V1PA 1Q8IA 2DUDA 1E24A 4IFDH 2R7FA 4YY3Q 4F7XA 3L2PA 4DR4L 4ZK9B 1J5EQ 1O80A 4JCVE 5LMUL 1HNZL 1TWGB 3DMUA 1NMGA 2OT2A 4PZ8A 1YHQA 2B39A 2H1EA 2WV6D 2MP1A 1VDZA 1XMQL 5EGTA 1CUKA 4C3JG 3C2PA 3CCRA 3NWTA 3T13A 4IFDJ 3AQQA 4N8X1 2BE5D 2WKCA 3K57A 1KRTA 4EQOA 4IUNA 3G4SA 5JOBA 1UE5A 1NE3A 4DR4Q 2F0HA 2L12A 3W5OA 3MHBA 4HCEA 2H4OA 5IP9H 2CW0C 1MSGA 1GOZA 4J15A 2F4IA 2HHHQ 1PTOF 1XTDA 2K6AA 4RMFA 5C3EG 4IALA 3AMUA 4OX9L 2BDNA 3H0GB 1VCIA 3FKIB 3ND9A 3BDOA 2UUAL 4TRDA 3H09A 4FXDA 1PFMA 1LT5D 4LF7L 2JQOA 2ZXOA 4Y7NH 1G8ZD 1GHKA 1VMCA 4TKOB 4EX5A 2MFIA 4DR7L 2B2UC 3IRBA 1I50H 2F0UA 3HOXB 2XTIA 3VR3A 1KQSA 4IUQA 3BVZA 4OWTB 3J81i 3HOWG 1SMYD 3IFDA 4B9WA 2PO4A 2AUJD 4KKSA 3GD7A 2PMZB 4HJ9A 3MTSA 2N49A 1XNRQ 2ZXRA 2M00A 1S5DD 4IUVA 1VQNA 1ILPA 1SBBB 4A4IA 3KDFB 5EKIA 1I6HB 5BN4A 1QJOA 3M85A 2XNAC 5FLMH 1UNSA 1WTXA 2CQOA 1PYWD 5T1IA 4BA1I 4APVA 5GAEC 2K5QA 5AJ3Q 1U0LA 1B8AA 2G5DA 5M3MH 2TMPA 1V1PB 3M4OH 3N52A 4DK1A 5C4ZA 1E1TA 3EVQA 3LWUA 1IBKL 1EQRA 1CKOA 4H0LC 1U4MA 4IUUA 2R7ZG 3OMGA 2YTYA 5C5MA 1YEZA 2Z1CA 1A3UA 1NSNS 1OXVA 4CJ1B 2RCFA 3A0JA 1WCMH 3FHWA 1PH1A 2A5HA 2ID0A 4LF5L 4K5WA 3FMCA 3HFZB 4Y7NB 2F0IA 2D0PA 5DEHA 3LWEA 3WDNA 3D4DA 4X66L 1HA5A 4EQ5A 1N32Q 1HNXQ 3S1MH 5D3DA 2HQLA 4RGMA 5D65A 3URYA 4DV2L 3S17B 2N3SA 2CWPA 4CJ0B 2KCCA 1PRTB 3U50C 2KHSA 3QR8A 3CQZH 1GUTA 4A3KH 1J6QA 3KLRA 5HGQA 5I9PA 5C4XH 3S1RH 4KHPQ 2ICEC 3GQBA 4XQQA 5C4JB 1EY8A 1TWCB 1YNNC 4I7AA 2NVXH 4WORA 5EQ0A 1FJGQ 1RD9D 1DXMA 2K75A 1K83B 1SRUA 5L37A 3S16H 4HSPA 4B08A 4A3JB 3VDYA 1KNAA 5JJKA 3KFUA 3R2IA
chains in the Genus database with same CATH topology
3GO5A 2EY1A 2O5IC 1DD2A 1EQVA 3NBIA 3TZDA 4JK1C 3KBXA 3H6MA 2E2JB 3D4WA 1CZGA 1ZYRC 4I7ZC 4H44C 2B2YC 4WRDA 5EJWA 5CC4A 1B50A 4G7ZC 3R3OA 1QNUA 3S1QB 2XWBB 1GUOA 4RGNA 5KEEA 1CK1A 3WOFA 1SYDA 1AP0A 1LLRD 3NPPA 2F0TA 3FPPA 4RCOA 5JPMC 4EGVA 1Y1VB 1A3VA 1S5BD 3HEJA 4A3MB 1ZEQX 4HR7B 4ZLTF 5E1FA 2EZVA 1ENAA 2FJ2A 4J1MA 4A3KB 1PTOD 5FO9B 1C4QA 3QOLA 4H7BA 4KK7A 5J39A 3NTHA 2Z4IA 1EEFD 1OXTA 4DFAA 3TMEA 2JA7B 3T56B 1RHPA 3SK8A 2JA8B 4X3UA 3HOYB 5E4XA 2F0DA 2JP1A 2R6GA 3GTOB 2AWNA 2L9HA 1BQQT 1I4QA 2FINB 3F2UA 2N55A 4ZKBB 4C3IB 2B2VC 4G7HC 1LO5D 2F0LA 4G57A 1LTBD 4XYQA 5DM73 1ENFA 5ELDA 1Y8NB 5ELCA 2EE1A 2A68D 1PFNA 2RDHA 1PZJD 1U4RA 1LTAD 2Q8TA 4NDXA 3HOZB 3K0YA 2WAQB 4HAEA 1I6VC 2CQAA 4RWSC 2EY5A 1XX8A 5ELEA 2E2HB 4KN7C 1STBA 3LX0A 4FF2A 1SNPA 1KLGD 1AW7A 1E2ZA 1HCZA 1L0YB 3SE0A 2ENBA 2HDMA 1YNJD 2EXZA 3I91A 4KY7A 3GTGB 2EPBA 2KA7A 5T1GA 3K59A 1EYDA 3S14B 3ERQA 3R2TA 3HGBA 1KAAA 2Z8LA 4ZAIA 1EOTA 4P2CB 1H9KA 5JPNC 4K6DA 4MIUA 1RCVD 4I65A 1B1ZA 1I4PA 2AQ2B 5CV9A 2O2LD 1JWMD 3TP7A 1FNWA 4ME5A 1OXXK 1AZQA 1D5XC 1WTRA 4N9TA 1C8CA 2G9HD 1S5CD 2FHTA 3VR2A 4ULLA 1OXUA 1FNUA 1F9RA 1GJXA 2DNCA 2RSOA 1SNCA 2NTSA 1DOMA 1O7LA 1CHQD 3DM1A 4MHEA 3GTPB 1LTID 1T5XD 4A3GB 3D31A 2F0SA 2NYZD 1V8QA 2LKVA 4KHVA 3J80L 4C3HB 5M5XB 3A54A 4QF4A 1JOOA 4HMJA 1STNA 2TSSA 1LTGD 4BS9A 1ESFA 4XXEA 4CGYB 3PUWA 2ICIA 1L0XB 3NQIA 3VYTA 1TKWB 1EQTA 2IJ0A 2KQ3A 3GV3A 4OO1I 1B9MA 1UAPA 3C1EA 1RTOA 2PW7A 1AEXA 4XYOA 2KEEA 4ZYSA 1ESRA 3VR4A 1CM9A 2XN9C 3KF8A 3MEHA 1QNKA 1CA6A 1GUGA 1PMRA 3HZXA 3K5MA 1JOKA 3K5NA 2NB0A 1JCKB 2JE6I 5I4DA 2VB3X 5LL6S 1Z47A 5EPLA 1SAPA 2HCCA 2I07B 4BBRB 1X3QA 3KBGA 4LMQD 1EY0A 3J81E 2F3VA 3VA7A 2R93B 1ONLA 1LT4D 1BCPF 3HP3A 4OO1G 3VYRA 4PQXA 1EWHA 1CQVA 3MFYA 1FGBD 3JAML 2XWJB 1Q12A 3V05A 4ABNA 1RDPD 4KV6A 1PRTC 1TVXA 2L11A 4A3DB 3KLSX 1GXDC 2RVLA 2L5TA 3GTMB 4RHSA 3U9OA 1RODA 3VA5A 4KJNA 1PTOB 1IW7C 4J8QA 1CA5A 3PV0A 2FMCA 2E2DC 2K05A 3AU7A 4QMGA 3T4AC 1EZ6A 3BYTB 2YYZA 3MXGA 4HCSA 3LNNA 1R9TB 1S5ED 1SDFA 2B8FA 5C3XA 3VR5A 4RA8A 3EA6A 5CV6A 2MGSA 4CKEA 1D5MC 4HTHA 2A6HD 4KY5A 5A2QE 2B2WC 4O42A 1SNDA 1TS4A 3MC0B 2HDLA 2RSNA 2E76C 3I8ZA 5FK9C 3GTJB 3GP7A 1DOLA 3DEPA 2K01A 2LFNA 1STYA 2F1MA 3H3VC 3BVMA 3TP8A 3K5OA 2EYPA 3ITPA 3RUZA 2B2TA 4FP5D 2A6ED 2RBMA 1I4XA 4A3EB 5IGGA 1EIGA 4KN4C 1B9NA 1D2BA 4IURA 4BA2I 4BBSB 2EYFA 3DXJC 2XVSA 3BVGA 4KD4A 2OF1A 2WP8J 5D3IB 2K1BA 3HKZB 2VUMB 1LT6D 3NTIA 3S15B 4PMWA 5NUCA 4OGQC 1Q1EA 2DNEA 2RDFA 3D3RA 2BE5C 3OWFA 4DAVA 1SE2A 3V2TA 3CRLC 1PLFA 2F0NA 4DXFA 1EFID 1KDBA 3FPUB 4KTAA 1PZKD 4E6IA 5IT9E 3I3CA 5LHY1 1BCPD 1SE3A 5EKKA 2J4XA 2C9OA 3S2DB 1AZPA 1U9RA 1LACA 3DWAA 4FXKC 2DY8A 5EKLA 1D1KA 2F0OA 3VYSA 1JORA 2O4XA 3L3OC 3BS1A 4O1NA 1PZID 5C0XI 3QIAA 1Q90A 4QUFA 3VR6A 1SMYC 1X3PA 1EY6A 5K5PA 2D5DA 3A7AB 4DNRB 2LY7A 1TR5A 2Q8IB 3IKJA 4MN3A 1TY2A 1F9PA 2VB2X 5C4HA 1O7YA 1ILQA 1HQMC 2A69D 5I9OA 4OIKA 4DGZA 1HRJA 2FMMA 5C0XG 1I50B 3D4RA 2JYOA 3OHXC 4ILWA 3NBHA 1AFPA 3CU7A 5JVH3 4KMUC 3P1HA 3K58A 1M4VA 2E74C 5CBAE 1FD7D 2IX0A 4Z9CB 2RKSA 3NK9A 2QF7A 1F2YA 4EVOA 5M3MB 3M4OB 2K03A 1IKLA 1I4RA 1STAA 4IN3A 2EY2A 2SNSA 3SVMA 1MBYA 3QG1A 1KNEA 1BXTA 4WJWA 3NUCA 5HURA 1W6KA 2F0WA 4PMBA 3G6JB 1WCMB 4CKCA 4PV1C 3TP6A 4XIGS 4FXGC 1S4ZA 2PQEA 2VNUD 2EJMA 4DN4M 2EYMA 3S1MB 5CGKA 2IW3A 2N88A 5FLXL 1WVLA 3KLSA 2JSOA 1IKMA 1LT3D 1WTWA 2BDOA 1JICA 3A8IE 3CQZB 3PUXA 3BDLA 1SNMA 2F0KA 5C4XB 1WTQA 3S1RB 3A8JE 2NVXB 4K5XA 2B2UA 3IL8A 5JEAG 1WD0A 1PTOC 3S16B 1JWUD 4M1UB 3OW7A 2SOBA 5KNDA 5DAUA 3HS0C 3PUZA 1HXYD 5TSSA 1JB3A 3CKIB 3ND8A 1D1IA 4OL7A 3MXUA 2Y0SB 5JVG3 4OO1H 1CT1D 1EU3A 4DU9A 1TY0A 3C46A 3FEWX 3SK5A 5IIFA 1DOKA 2F0EA 2XSCA 4X3KA 5IODA 4FF3A 3PO3B 2NN6I 1C48A 1DONA 2A68C 5KYIA 2SNMA 1CZWA 2XIWA 4RKBA 5I6WA 4RKLA 1GUSA 1V1OA 1BO0A 1Y8OB 1LV9A 2F0GA 3FDTA 2KUMA 2MUYA 2IL8A 2R61A 1BCPB 5M5WB 4A3IB 4HSVA 3NHHA 1G91A 2NN6G 5M5YB 4EQNA 4A93B 1YNJC 3E0JA 4UDUC 5M9OA 1QWYA 1STGA 4OHJA 1EIHA 4ODGA 4PNYA 1DM0B 4XQNA 2EYHA 1II3A 1EY5A 2EJGC 4RHRA 2J7ZA 5K36G 2HCIA 1EEID 1R4QB 1I4GA 4J6HA 1A2UA 2K7VA 1SJED 1Y8PB 1K8OA 4HN7A 3N6RA 5E4WC 4IUTA 1GUWA 2KCNA 1I3QB 3T16A 4LAAA 2R3ZA 5A35A 3RMHA 4CHTB 2PPBC 3I90A 3I72A 3BYYB 1STHA 4BWGB 1VF7A 1ET6A 2QDBA 3Q23A 1EYCA 2K04A 2IWHA 3S2HB 3D6WA 3HOUB 1V43A 1E2VA 1HTPA 4C3IG 3ONAB 4KD3A 3OOCA 3UI2A 5C5LA 2B2TC 5KRUA 1VMPA 4RGOS 1PDQA 4R9WA 3KUPA 3OWEB 5KNCA 3I4NB 1JWSD 3CRKC 5FO7B 3GTLB 1ET9A 1BR9A 1O78A 3NSWA 2IX3A 4AYBB 3TBIB 2KJXA 3MVVA 2NBFA 2J0TD 3R93A 1CFMA 5HGTA 1KTKA 1UEAB 1SYCA 4DXGA 1FYCA 5IGEA 1H9JA 1I4HA 3O13A 1NUCA 5KIXA 4L8JA 5BN5A 3GTQB 3A8KE 1F2LA 4N9PA 5FKAC 4C3JB 4K2LA 3MFGA 1NR2A 4FF4A 1LTSD 3M4YA 1XTCD 3TSSA 1QB5D 2F0QA 3T51B 5I2XA 1XXGA 3C3LA 3PUVA 1G6ZA 1KABA 5G3LF 4L63B 1ML0D 4ZUJA 5C3EB 1TWAB 1F2MA 3QOJA 1CI3M 4XT3B 2F0FA 1B2TA 4IZ8A 3J7YW 1IYVA 1HHVA 1TU2B 5C0XH 5AFWA 5FO8B 2Q8RE 2SDFA 1RKNA 5DNFA 4FO2A 3E5SA 3HOWB 1QOHA 1B4OA 1CQFA 5IGBA 5C0XJ 1A3TA 2F0MA 3MXNA 1DJRD 4LJZC 1EU4A 1ICWA 1D5ZC 2GA4B 5IGFA 3BDCA 5E3FA 4C3HG 1G2SA 4QIWB 2ZXPA 3EROA 2A6HC 1RF2D 1QCBD 2WACA 4H13C 1H9MA 1TQOA 1ZKOA 1K8MA 2R7ZB 4DK0A 3X3MA 3NTKA 4DAYA 4S3SA 1TWFB 1SYEA 1TT2A 3I4LA 3HG9A 1BUVT 3TZUA 5EBDA 2VXWA 3NP8A 1D6EC 3RZDB 1OXSC 2EY6A 4C1NI 2NVQB 3MA2B 2A6EC 2X69A 5D14A 1IL8A 1F9SA 1QG7A 1MI2A 1A15A 1OO9B 1JE4A 2QCPX 2L0CA 2X6LA 4NP5A 5J22A 2YU9B 1JC7A 3R8BA 4CBVA 1E2WA 2IX1A 2D62A 3DEOA 1A2TA 4TSSA 2KEDA 3OIQA 5JEAH 4XTCS 4K2KA 2CW0D 5JAVA 3SXHA 4HEDA 1IHZA 1LTRD 1LTTD 1QILA 2KVMA 1SEBD 1JR0D 4QB4A 3DWQA 2IPKD 5JEAJ 4YIJA 5ELFA 2RDGA 3RLFA 3EJIA 1CTMA 2AQ3B 4F88A 2E75C 3PUYA 2K5WA 3I4MB 2NTTA 2AQ1B 4BY7B 1SYFA 1FNVA 4FF1A 3P7JA 1BCPC 1BNZA 4M8AA 2F0JA 1XWEA 1CHPD 2JA6B 2QEJC 3J7AV 5G3LD 1EY7A 3U9SA 2OXPA 2EYLA 4ZRZA 1TS3A 3J81L 4CJ2C 2O5JC 2BA1A 2V4DA 1SNQA 4ZQ3A 2DN8A 4U68A 2F0PA 2QKIC 5CV8A 4OIJA 4K8JA 1HFNA 3Q6SA 1U4PA 4A3BB 4K5VA 1W6JA 3MZ5A 4RGTA 1WTPA 2IT1A 2NVTB 3E6ZX 3HOVB 2B2WA 3NWSA 2NN6H 2K28A 2A69C 2KECA 1JQYD 4HMIA 1X32A 2CHBD 4JBWA 1EYAA 3QJYA 3DHQA 4RFBA 3IAYA 1J8IA 4K14A 1MSHA 1Q1BA 2K33A 2L1BA 5K36H 1YNND 1HA6A 2Z4HA 4DF7A 3PIP3 2L4NA 2WIIB 1TWHB 3W2DA 2JEAI 1HQRD 2F0VA 1HUMA 3FRPB 1WTVA 4IFDI 3K6OA 3QB3A 1F9QA 5A2QL 2B63B 3H94A 4Q0FA 3J80E 2F03A 1ZYRD 2SEBD 5KYLA 1Z6HA 4X3SA 1VF5C 2WINB 4KKUA 5IOCA 3HRZC 1SNOA 4XT1B 3FVQA 3C1FA 4LK1C 3PMFA 5CYUA 3A55A 1KDCA 4KJOA 2EVBA 2EOTA 3BG3A 1SYGA 4KI0A 1Z7TA 4IFDG 2AUKA 2NWGA 3SDZA 5C3WA 3T53B 1WD1A 2HUGA 4V0BA 1DZ1A 3SK6A 1HPCA 2A73B 3GV6A 3TN2A 3WOEA 1FR3A 1SYBA 3A7LA 1BOSA 4R8IA 4IUPA 2ZT9C 3EQLC 1H9SA 3TDQA 5EPKA 5EBCA 3V96A 4R8NA 2D9UA 4KHZA 3RZOB 3NE5B 3JAME 4CKBA 2BOSA 4EQPA 5ELBA 3DWPA 1MGSA 3K5LA 1F2ZA 1G2TA 5IT9L 2JA5B 1EY4A 3DUZA 4K6LA 4PMCA 1KDAA 2K5DA 1PRTF 3IFTA 2NVYB 3Q0AA 2EDGA 4XDXA 1HTLD 3S1NB 4DNTB 3I70A 4XQJA 5CV4A 2PZUA 2PZTA 2PW5A 5EPJA 5KGUA 3G7LA 3L7ZC 1SE4A 2G9DA 1SFOB 3KK7A 2BA0A 2C5CA 4WFN3 4BY1B 3I73A 3AB9A 1DCZA 1XYIA 3EFXD 1U4LA 2M2LA 2MHVA 3TP5A 4G7OC 2FFKB 5F2DA 3SR1A 1H9RA 4F87A 4C2MB 3CHBD 4C1NK 5CR3A 4L6TB 3X3NA 1H9SB 2NUCA 3RD4A 1BF4A 1EL0A 3A56A 4QCLA 2B2YA 2L55A 2MPMA 3SEBA 3Q24A 2R92B 2CVRA 4RAUC 1SJHD 3VYUA 2RQXA 5CV5A 1F77A 1NR4A 1J9OA 2EJFC 2OEOA 2K32A 1MD2D 3QO2A 5IGDA 2RA4A 5CORA 2KOLA 1SSOA 2JXMB 3QWNA 3NXWA 2BCOA 5C44B 4C56C 2F3WA 3W3AA 1UUPA 3P75A 4KKTA 1LABA 2LS01 2EYOA 4FNFA 1O7ZA 2D2CC 1NAPA 3MAQA 3GTKB 1ZXTA 4DAPA 2PZWA 1DYQA 1EY9A 1BDOA 4IQZA 4ZKCB 2B2VA 4ID6A 5J1ZA 3BZDB 3M7GA 2WKDA 1NCVA 3D8GA 1RTNA 1TIID 5FOBB 1PTOH 1STEA 1PFBA 1HUNA 3SK4A 1Q3LA 4ZUIA 1IYUA 5M3FB 5KNBA 5CV7A 1JOQA 5COYA 1HFGA 3SHLA 5CMDA 4UAIA 5ISRA 3J7AF 3MWYW 1EZ8A 3L9AX 1Y1WB 1GUNA 3OSOA 1PRTD 2EYJA 4B9XA 5IGCA 1PXUA 4X3TA 4GZYC 3OMCA 5C6AA 3PO2B 4NMZA 4QUCA 2A74C 2XRQD 1B3AA 1M8AA 1A6XA 4KY6A 1ENCA 1IW7D 4F8MA 4Q5VA 1BBXC 4RCNA 1E0BA 3Q22A 4DA2A 3K7AB 2DY7A 2B8GA 1TS5A 3PIO3 3S9WA 1S5FD 5LL6X 4FVMA 2I46A 4G4KA 4NKLA 1G291 1Y69U 5BN3A 1GHJA 3OIPA 5JJZA 1T5EA 2AWOA 4RH6A 4TQUS 1TS2A 2PYKA 3H91A 5I6YA 1SXTA 2E2IB 4V190 3P20A 1R4PB 4K8IA 5CBEE 1B44D 1B53A 2MJ8A 3ZYYX 2NZ1D 1KLUD 2PNRC 5DM63 2X6GA 3OPOA 1EWCA 2PCFB 3M3YB 2WB1B 2LMCB 1WTOA 3M7NA 3NQTA 5FLXE 2HQEA 2QILA 4U673 4FYDA 2JEBI 2M9VA 4NW2A 2XRSD 1RJTA 4A3FB 1QE6A 3MXPA 5I2YA 3D6CA 1AN8A 1V1PA 1Q8IA 4IFDH 4F7XA 4ZK9B 1O80A 1TWGB 3DMUA 2OT2A 2B39A 2H1EA 2WV6D 2MP1A 1VDZA 5EGTA 4C3JG 3C2PA 3NWTA 3T13A 4IFDJ 2BE5D 2WKCA 3K57A 4EQOA 4IUNA 5JOBA 2F0HA 2L12A 3MHBA 4HCEA 2H4OA 2CW0C 1MSGA 1GOZA 2F4IA 1PTOF 2K6AA 4IALA 3AMUA 2BDNA 3H0GB 1VCIA 3FKIB 3ND9A 3BDOA 4TRDA 3H09A 4FXDA 1PFMA 1LT5D 2ZXOA 1G8ZD 1GHKA 1VMCA 4TKOB 2B2UC 2F0UA 3HOXB 3VR3A 4IUQA 3BVZA 1SMYD 3IFDA 4B9WA 2PO4A 2AUJD 4KKSA 3GD7A 2PMZB 3MTSA 2ZXRA 2M00A 1S5DD 4IUVA 1ILPA 1SBBB 5EKIA 1I6HB 5BN4A 1QJOA 3M85A 2XNAC 1UNSA 1WTXA 1PYWD 5T1IA 4BA1I 2K5QA 2TMPA 1V1PB 3N52A 4DK1A 5C4ZA 3EVQA 3LWUA 4H0LC 1U4MA 4IUUA 3OMGA 5C5MA 2Z1CA 1A3UA 1NSNS 1OXVA 4CJ1B 2A5HA 2ID0A 4K5WA 3FMCA 4Y7NB 2F0IA 5DEHA 3LWEA 3WDNA 3D4DA 1HA5A 5D3DA 4RGMA 5D65A 3URYA 3S17B 4CJ0B 2KCCA 1PRTB 2KHSA 1GUTA 3KLRA 5I9PA 2ICEC 4XQQA 3GQBA 5C4JB 1EY8A 1TWCB 1YNNC 4WORA 5EQ0A 1RD9D 1DXMA 1K83B 4HSPA 4B08A 4A3JB 1KNAA 3R2IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F0Q A;  4OL7 A;  2F0P A;  2EY1 A;  2RDF A;  4NDX A;  3SK4 A;  5C3W A;  5KYI A;  5CV8 A;  4J6H A;  4K8J A;  1EQV A;  1A2U A;  4QF4 A;  2LKV A;  3OWF A;  3P1H A;  4KHV A;  1JOO A;  4HMJ A;  1STN A;  4ZUI A;  4K5V A;  3V2T A;  3H6M A;  2F0N A;  3D4W A;  3SK6 A;  3MZ5 A;  3TP5 A;  5C3X A;  1KDB A;  5CV7 A;  4DU9 A;  5F2D A;  1JOQ A;  3SR1 A;  1KAB A;  3SHL A;  4KTA A;  4B9W A;  1SYB A;  4NP5 A;  4WRD A;  5CV6 A;  4E6I A;  3T16 A;  5CC4 A;  2RKS A;  4ZUJ A;  4LAA A;  2M00 A;  3NK9 A;  5J22 A;  5CR3 A;  2KQ3 A;  3R3O A;  2NUC A;  1F2Y A;  5ISR A;  2EY5 A;  3SK5 A;  5KEE A;  3C1E A;  1F2M A;  1AEX A;  2PW7 A;  3QOJ A;  3NQT A;  1EZ8 A;  4EVO A;  1STB A;  3LX0 A;  1SYD A;  1SNP A;  1STH A;  2HQE A;  4HTH A;  2F0F A;  1A2T A;  3MEH A;  5EKK A;  5IIF A;  2F0E A;  4IZ8 A;  4HMI A;  4R8N A;  2F0T A;  3OSO A;  1STA A;  1U9R A;  3HZX A;  2QDB A;  4KY5 A;  5IOD A;  1JOK A;  2ENB A;  1EYC A;  1EYA A;  1SND A;  2EY2 A;  2EYJ A;  3DHQ A;  2SNS A;  4K2K A;  4B9X A;  5JAV A;  5CV5 A;  3SXH A;  5IGC A;  5EKL A;  4K14 A;  1IHZ A;  3NUC A;  2F0O A;  2EXZ A;  3MXP A;  3OMC A;  1JOR A;  4EQP A;  5C6A A;  1A3V A;  2O4X A;  4KY7 A;  4NMZ A;  2SNM A;  5HUR A;  3HEJ A;  3D6C A;  5C4Z A;  3EVQ A;  1RKN A;  2OEO A;  4QB4 A;  1EYD A;  5E1F A;  1ENA A;  4KD3 A;  2F0W A;  4KY6 A;  4PMB A;  4J1M A;  5C5L A;  3E5S A;  3ERQ A;  4RKB A;  1ENC A;  4F7X A;  4YIJ A;  5I6W A;  5IGD A;  3OMG A;  3QOL A;  4H7B A;  4RKL A;  1STY A;  1KAA A;  3EJI A;  3TP6 A;  4DF7 A;  5C5M A;  3DMU A;  4F8M A;  5KRU A;  4DFA A;  3TME A;  1A3U A;  3TP8 A;  5IGB A;  1NSN S;  1EY0 A;  1A3T A;  2PQE A;  1F2Z A;  5EGT A;  2F0V A;  2EYM A;  3NXW A;  3SK8 A;  2EYP A;  2F0M A;  2F3V A;  3ITP A;  4K6D A;  3RUZ A;  1EY4 A;  4MIU A;  4K5W A;  1EY6 A;  2F0G A;  5CGK A;  3T13 A;  2F0I A;  2F0D A;  4I65 A;  5K5P A;  5DEH A;  1SYF A;  2RBM A;  3QB3 A;  3D4D A;  5CV9 A;  4PMC A;  5IGF A;  2F3W A;  3BDC A;  1KDA A;  5IGG A;  3TP7 A;  3S9W A;  5E3F A;  4EQO A;  4IUN A;  3P75 A;  3MVV A;  4ME5 A;  5JOB A;  5KYL A;  3ERO A;  4KV6 A;  4N9T A;  1TR5 A;  2F0H A;  3BDL A;  1SNM A;  3NHH A;  2F0K A;  4NKL A;  2F0J A;  5HGT A;  1SYC A;  2EYO A;  3MHB A;  4EQN A;  2WAC A;  5C4H A;  5IOC A;  2KHS A;  1EY7 A;  1TQO A;  2EYF A;  1SNO A;  2OXP A;  5CV4 A;  5IGE A;  2PZU A;  5M9O A;  2PZW A;  1STG A;  2EYL A;  2PZT A;  4K5X A;  5I9O A;  2F0L A;  4IAL A;  3C1F A;  1NUC A;  4G57 A;  5KIX A;  1EY9 A;  5I9P A;  2PW5 A;  2PYK A;  3U9O A;  5J39 A;  4KD4 A;  2OF1 A;  3PMF A;  4ODG A;  1KDC A;  4PNY A;  4DGZ A;  4N9P A;  3VA5 A;  4KJO A;  2EYH A;  1EY8 A;  1SNC A;  1II3 A;  5I6Y A;  5KGU A;  4TRD A;  4S3S A;  4KJN A;  4ID6 A;  2SOB A;  5J1Z A;  4WOR A;  5DAU A;  3D8G A;  4K2L A;  4K8I A;  1SYE A;  1EY5 A;  1TT2 A;  1SYG A;  2F0S A;  5NUC A;  3NP8 A;  1SNQ A;  4ZQ3 A;  2EY6 A;  4QMG A;  1EZ6 A;  2F0U A; 
#chains in the Genus database with same CATH topology
 1HJP A;  3GO5 A;  2EY1 A;  2O5I C;  2ZTD A;  3K7U C;  1DD2 A;  1EQV A;  3NBI A;  3STB D;  3TZD A;  4JK1 C;  3KBX A;  3H6M A;  2E2J B;  2VZA A;  3D4W A;  4JI2 L;  1CZG A;  4B3R L;  4DV7 L;  1ZYR C;  4I7Z C;  1QUQ A;  4H44 C;  2B2Y C;  1SLJ A;  4WRD A;  5EJW A;  5CC4 A;  1B50 A;  4JI1 Q;  3I4M G;  4G7Z C;  3R3O A;  1QNU A;  3S1Q B;  2XWB B;  1GUO A;  4RGN A;  5KEE A;  1CK1 A;  3WOF A;  4BY7 G;  1SYD A;  4AIM A;  4DR1 L;  1AP0 A;  1LLR D;  3NPP A;  2F0T A;  1WTH A;  2MO0 A;  4HJ5 A;  3FPP A;  4RCO A;  1IBL L;  2WAQ E;  5JPM C;  2DJG C;  3OTO Q;  4EGV A;  1Y1V B;  1BKB A;  1A3V A;  1D8L A;  1S5B D;  3HEJ A;  4A3M B;  3RN5 A;  2JA6 G;  1ZEQ X;  4HR7 B;  4ZLT F;  3PO3 H;  5E1F A;  2EZV A;  1ENA A;  2FJ2 A;  4J1M A;  4A3K B;  1PTO D;  5FO9 B;  1C4Q A;  3QOL A;  4H7B A;  4KK7 A;  5J39 A;  3NTH A;  2Z4I A;  1EEF D;  1OXT A;  1Z9F A;  3TME A;  4DFA A;  5FJ8 G;  2JA7 B;  3T56 B;  3BZK A;  4IPG A;  1RHP A;  4B3M Q;  3SK8 A;  5GAH C;  4X3U A;  3J80 c;  2LSS A;  2JA8 B;  4IOC A;  2N8N A;  3HOY B;  5E4X A;  2F0D A;  2JP1 A;  4IO9 A;  1G6P A;  2R6G A;  1YI2 A;  3E9I A;  3GTO B;  2AWN A;  2L9H A;  1BQQ T;  4PZ6 A;  1I4Q A;  1VQJ A;  4A3B G;  2FIN B;  4B3S L;  3F2U A;  5IYD G;  2N55 A;  3HOV G;  4ZKB B;  4C3I B;  2YV5 A;  2B2V C;  4LFC L;  4G7H C;  5M5W H;  4A3I H;  1PH3 A;  1LO5 D;  4YHH L;  2F0L A;  2VQF L;  4G57 A;  5M5Y H;  1LTB D;  1VQM A;  4NXN L;  3M4Q A;  4XYQ A;  5DM7 3;  1ENF A;  4DR5 Q;  4O2D A;  5ELD A;  1ASZ A;  1L0W A;  1Y8N B;  5ELC A;  2EE1 A;  4X62 Q;  2A68 D;  1YBY A;  1PFN A;  2RDH A;  1PZJ D;  1U4R A;  1LTA D;  2Q8T A;  4NDX A;  3HOZ B;  4OWW B;  4GOP A;  1K3B C;  3K0Y A;  1K0S A;  2HD3 A;  1QUQ B;  2UXB L;  1NJI C;  2WAQ B;  1DGS A;  4HAE A;  2WFW A;  4DK6 C;  1I6V C;  2CQA A;  4RWS C;  4P72 A;  4JBJ A;  2EY5 A;  1MHW C;  3AYH B;  4ZCK A;  1XX8 A;  3U4Z A;  5ELE A;  2E2H B;  4IJH A;  4KN7 C;  1STB A;  3LX0 A;  4FF2 A;  1SNP A;  1I3Q H;  1KLG D;  1AW7 A;  1E2Z A;  1HCZ A;  1L0Y B;  3SE0 A;  2B63 G;  4LFB Q;  4BXX G;  2ENB A;  4DKA C;  4DV0 Q;  2HDM A;  1YNJ D;  4LF6 Q;  1FVI A;  2EXZ A;  3I91 A;  4KY7 A;  3GTG B;  3Q8D A;  2EPB A;  2KA7 A;  5T1G A;  3K59 A;  1EYD A;  3S2H H;  3S14 B;  2RF4 A;  3ERQ A;  3R2T A;  3HOU H;  3HGB A;  1KAA A;  2Z8L A;  4ZAI A;  1EOT A;  4P2C B;  2L15 A;  1H9K A;  1V1Q A;  1YJ9 A;  4DV3 L;  5JPN C;  1YHA A;  1HNW Q;  4K6D A;  4MIU A;  1RCV D;  3F2C A;  4I65 A;  4DK3 C;  4GNX A;  2UXD L;  1B1Z A;  1I4P A;  2AQ2 B;  5CV9 A;  4FDB A;  4QL5 A;  2O2L D;  1JWM D;  3TP7 A;  3DLL A;  1FNW A;  3I4N H;  3GTL H;  4ME5 A;  4A75 A;  1OXX K;  1AZQ A;  1D5X C;  1WTR A;  4N9T A;  1C8C A;  2G9H D;  1S5C D;  1T9H A;  3CD6 A;  2FHT A;  3VR2 A;  1PH9 A;  4ULL A;  1I94 L;  1OXU A;  1FNU A;  1F9R A;  2B3G A;  4A3C H;  5LMN L;  3F8T A;  1GJX A;  2DNC A;  1S72 A;  2RSO A;  1SNC A;  1SRO A;  2NTS A;  4DR2 L;  1DOM A;  1O7L A;  1CHQ D;  3DM1 A;  4MHE A;  3GTP B;  2E5L L;  1LTI D;  1T5X D;  4A3G B;  2R93 H;  3D31 A;  3GTQ H;  2F0S A;  4B3T L;  2NYZ D;  1V8Q A;  4GOP B;  1HR0 L;  2Q2U A;  2LKV A;  4KHV A;  4C3J H;  1BVS A;  3J80 L;  4C3H B;  5M5X B;  3A54 A;  3MEF A;  1I94 Q;  4QF4 A;  3ERS X;  1L2F A;  1JOO A;  4HMJ A;  1IYJ B;  1STN A;  2TSS A;  2CCZ A;  1LTG D;  1SN8 A;  4BS9 A;  1ESF A;  4XXE A;  4CGY B;  2ZTC A;  3PUW A;  4DR2 Q;  2ICI A;  1L0X B;  3NQI A;  2GN5 A;  3VYT A;  1TKW B;  1EQT A;  2IJ0 A;  2KQ3 A;  2VL6 A;  1OTC A;  2JA5 G;  2RHS B;  3GV3 A;  3GTM H;  4OO1 I;  1B9M A;  1UAP A;  3C1E A;  1RTO A;  2PW7 A;  1AEX A;  4XYO A;  2KEE A;  4ZYS A;  4GN5 A;  1ESR A;  3VR4 A;  1CM9 A;  3MEH A;  2XN9 C;  3KF8 A;  1QNK A;  5C3E H;  1CA6 A;  1GUG A;  1TWA H;  1PMR A;  3HZX A;  5ELO A;  3K5M A;  1JOK A;  3I56 A;  3K5N A;  2NB0 A;  1JCK B;  3SGI A;  2JE6 I;  5I4D A;  2Q2T A;  2VB3 X;  1XMO Q;  5LL6 S;  3BU2 A;  1Z47 A;  5EPL A;  1SAP A;  2HCC A;  2I07 B;  4BBR B;  1JT8 A;  3FP9 A;  1QVG A;  1X3Q A;  3KBG A;  4HJ8 A;  5BR8 L;  4LMQ D;  1EY0 A;  3J81 E;  4GNX B;  5IYC G;  2F3V A;  3VA7 A;  2R93 B;  1ONL A;  3HOW H;  4RG1 A;  1LT4 D;  1BCP F;  3HP3 A;  4OO1 G;  3VYR A;  4PQX A;  4L5T A;  1EWH A;  1CQV A;  3MFY A;  2BH2 A;  2K14 A;  4A93 G;  1FGB D;  4BY1 G;  1N34 Q;  3JAM L;  2XWJ B;  1Q12 A;  3V05 A;  4ABN A;  1RDP D;  2K52 A;  3I7F A;  4KV6 A;  4CDF C;  1PRT C;  1TVX A;  2L11 A;  4A3D B;  4OEM B;  3KLS X;  1GXD C;  2RVL A;  2L5T A;  1YNX A;  3GTM B;  4RHS A;  3U9O A;  1VQO A;  1ROD A;  3VA5 A;  3W1G A;  2VW9 A;  4KJN A;  2R92 G;  1PTO B;  1IW7 C;  4J8Q A;  2R7Z H;  1JJ2 A;  2UU9 L;  1CA5 A;  3ER0 A;  3PV0 A;  2FMC A;  2E2D C;  2K05 A;  4JI8 L;  3AU7 A;  4QMG A;  1TWF H;  2IHE A;  3T4A C;  1EZ6 A;  1PH2 A;  3BYT B;  2YYZ A;  3MXG A;  4HCS A;  4NXM L;  3LNN A;  1VQK A;  1R9T B;  1S5E D;  3RZD H;  1SDF A;  3HKZ E;  2B8F A;  4GKJ Q;  1GD7 A;  5C3X A;  3VR5 A;  1GO3 E;  2NVQ H;  4RA8 A;  3RLO A;  3EA6 A;  3J81 c;  5CV6 A;  4HIO A;  3CCJ A;  2MGS A;  4CKE A;  3KF8 B;  1D5M C;  3J7Z C;  3ULJ A;  5C44 G;  3CCE A;  4HTH A;  1AE2 A;  2A6H D;  2YU9 H;  1VQP A;  4KY5 A;  5A2Q E;  2B2W C;  4MTK A;  4P73 A;  4O42 A;  1SND A;  1BBU A;  1TS4 A;  3MC0 B;  2HDL A;  4CDE C;  1FGU A;  2RSN A;  4JI4 Q;  2E76 C;  3U4V A;  1SE8 A;  4AQY L;  3I8Z A;  5FK9 C;  3GTJ B;  3GP7 A;  1WI5 A;  1DOL A;  3DEP A;  2K01 A;  1VQ9 A;  2LFN A;  1STY A;  2F1M A;  3UDG A;  3BVM A;  3H3V C;  1LUZ A;  3TP8 A;  3UDX A;  3K5O A;  4QQB X;  2EYP A;  3ITP A;  3RUZ A;  4R4C A;  2B2T A;  2UUC L;  4FP5 D;  2A6E D;  4DUZ Q;  2RBM A;  1I4X A;  4A3E B;  3I4M H;  5IGG A;  4JI5 L;  1EIG A;  3UDI A;  5IP7 G;  1SR3 A;  4KN4 C;  4LFA Q;  4BY7 H;  1B9N A;  5M3F G;  1P16 A;  1D2B A;  2GVB A;  4IUR A;  4JI0 L;  4BA2 I;  4BBS B;  2EYF A;  1YVC A;  5IWA Q;  3BZC A;  3DXJ C;  4L5R C;  2XVS A;  1MJC A;  3BVG A;  4KD4 A;  2OF1 A;  2JA6 H;  2WP8 J;  5D3I B;  2K1B A;  1W3S A;  3HKZ B;  1Y1W G;  2VUM B;  3KJP A;  1LT6 D;  3NTI A;  2YTX A;  1YJW A;  3S15 B;  4PMW A;  5NUC A;  5FJ8 H;  2NZH A;  4OGQ C;  1KXL A;  5LMU Q;  1HNZ Q;  1Q1E A;  3PO2 G;  2DNE A;  2RDF A;  3D3R A;  4P74 A;  1XMQ Q;  2BE5 C;  3OWF A;  4DAV A;  1SE2 A;  3V2T A;  3CRL C;  1VQE A;  1PLF A;  2F0N A;  4DXF A;  1EFI D;  1KDB A;  1EYG A;  5FLX c;  3FPU B;  4KTA A;  1PZK D;  4E6I A;  3I4O A;  2N78 A;  4A3B H;  4LWC A;  1Y14 B;  2MNA A;  5IT9 E;  2NVT H;  5IYD H;  3UE0 A;  3HOV H;  3I3C A;  1YZ6 A;  5LHY 1;  1BCP D;  2VY3 A;  1SE3 A;  5EKK A;  2CH4 W;  2J4X A;  2C9O A;  3A5U A;  3ULP A;  3S2D B;  1AZP A;  1U9R A;  3K80 C;  1LAC A;  3DWA A;  4FXK C;  2DY8 A;  5EKL A;  4OX9 Q;  1D1K A;  2F0O A;  3VYS A;  1JOR A;  2O4X A;  1FL0 A;  2UUA Q;  3L3O C;  1Q82 C;  4LF7 Q;  1L1O C;  3BS1 A;  1GKH A;  4O1N A;  1PZI D;  1K3R A;  4DR3 L;  2ZJQ A;  1KRS A;  1MKH A;  5C0X I;  4DR7 Q;  1IXR A;  1JJC B;  3QIA A;  1Q90 A;  4QUF A;  3VR6 A;  1SMY C;  1X3P A;  2KCT A;  2GVA A;  1EY6 A;  2CFM A;  5K5P A;  1TWH H;  2D5D A;  2DGY A;  5J3B A;  3A7A B;  4DNR B;  2EQS A;  4N8F A;  2LY7 A;  1TR5 A;  4DR3 Q;  2Q8I B;  3IKJ A;  4MN3 A;  1TY2 A;  1F9P A;  2VB2 X;  4OEL B;  2B63 H;  4BXX H;  5C4H A;  1O7Y A;  1CKN A;  1ILQ A;  4X6A H;  1HQM C;  2LXK A;  2WB1 G;  2A69 D;  2RHQ B;  5I9O A;  4QJF A;  4OIK A;  3W1B A;  1H95 A;  4DGZ A;  4H02 A;  4GKK L;  1HRJ A;  1VQG A;  2FMM A;  5C0X G;  3ICE A;  1I50 B;  1IBK Q;  1VQ8 A;  3D4R A;  2JYO A;  3CP0 A;  3OHX C;  4ILW A;  4A3F G;  3KYH C;  2V1C C;  3NBH A;  2QEX A;  1AFP A;  4UP7 A;  3CU7 A;  5JVH 3;  4R4T A;  4KMU C;  3P1H A;  3CMA A;  2YTV A;  3K58 A;  1M4V A;  4LF5 Q;  2D0O A;  2E74 C;  4GKK Q;  1N8R C;  5CBA E;  1N36 L;  1KHI A;  4X66 Q;  1FD7 D;  2AMC B;  2IX0 A;  4Z9C B;  2RKS A;  2OQK A;  3NK9 A;  2QF7 A;  1F2Y A;  3BJU A;  4DV2 Q;  4PG3 A;  3AFQ A;  1IL2 A;  4EVO A;  2KBN A;  5M3M B;  2Y0S E;  3M4O B;  2K03 A;  1IKL A;  1I4R A;  1STA A;  4IN3 A;  3TEH B;  4L5S A;  2EY2 A;  4JI6 L;  2SNS A;  3KJO A;  3SVM A;  1MBY A;  3QG1 A;  1KNE A;  1BXT A;  4WJW A;  1YHB A;  3NUC A;  4HID A;  5HUR A;  3RZO H;  1W6K A;  3UE1 A;  2F0W A;  4PMB A;  3G6J B;  1WCM B;  4CKC A;  4PV1 C;  3H0G G;  3TP6 A;  3STB C;  4XIG S;  4FXG C;  3FKI G;  5GQO A;  1S4Z A;  2PQE A;  2VNU D;  2EJM A;  3CCV A;  1ICF B;  4DN4 M;  2EYM A;  3S1M B;  4JI6 Q;  5CGK A;  2IW3 A;  2N88 A;  5FLX L;  2VQE L;  1WVL A;  2UUB L;  4JI2 Q;  1E1O A;  4B3R Q;  4DV7 Q;  3KLS A;  2JSO A;  1VQL A;  1IKM A;  1LT3 D;  1WYD A;  3HOX G;  2JA5 H;  1WTW A;  2BDO A;  1JIC A;  3A8I E;  3CQZ B;  1CKN B;  3PUX A;  3BDL A;  1SNM A;  2F0K A;  5C4X B;  1WJJ A;  1WTQ A;  2NVY H;  3S1R B;  3ULL A;  4DR1 Q;  3A8J E;  2NVX B;  3S1N H;  4K5X A;  2B2U A;  3IL8 A;  5JEA G;  1IBL Q;  4MTN A;  1HZ9 A;  1WD0 A;  1PTO C;  3S16 B;  1JWU D;  4DR6 L;  4M1U B;  3OW7 A;  1CKM A;  2SOB A;  5KND A;  3B6Y A;  5DAU A;  3HS0 C;  3PUZ A;  1HXY D;  2Z6B A;  4JBK A;  3NBH B;  1JB3 A;  5TSS A;  3CKI B;  3ND8 A;  3J7A 5;  5IYC H;  1D1I A;  4OL7 A;  3MXU A;  2Y0S B;  5JVG 3;  4OO1 H;  1CT1 D;  1LTL A;  1SFO H;  1M90 C;  1PH6 A;  1EU3 A;  4DU9 A;  1TY0 A;  4A93 H;  4BY1 H;  3PSI A;  3PIP A;  4DR6 Q;  3C46 A;  3FEW X;  3AFP A;  3SK5 A;  4B3S Q;  2E8G A;  4C2M H;  5IIF A;  1DOK A;  4MZ9 A;  2F0E A;  2XSC A;  4X3K A;  5IOD A;  4DUY L;  4FF3 A;  3PO3 B;  3AEV A;  4LFC Q;  1EWI A;  1K9M C;  4YHH Q;  2I5L X;  2VQF Q;  1NY4 A;  2NN6 I;  4LUO A;  1C48 A;  1DON A;  2A68 C;  2R92 H;  4DV5 L;  5KYI A;  4NXN Q;  4CDC C;  2SNM A;  2A8V A;  3CCL A;  2BH8 A;  4DV1 L;  1CZW A;  2XIW A;  4RKB A;  5I6W A;  1HH2 P;  4RKL A;  1GUS A;  3CAM A;  1V1O A;  3E0E A;  4YCV A;  1BO0 A;  1Y8O B;  1X3F A;  1LV9 A;  2F0G A;  1K0R A;  2JN4 A;  3CW2 C;  2UXB Q;  3FDT A;  2KUM A;  4A3J G;  2MUY A;  2IL8 A;  4POF A;  2K5N A;  2R61 A;  1BCP B;  5M5W B;  4A3I B;  4HSV A;  1PH8 A;  5C44 H;  2IY5 B;  1XPR A;  3NHH A;  4DNI A;  3KOJ A;  1G91 A;  2NN6 G;  5M5Y B;  4EQN A;  4OWX B;  1VQI A;  1YNJ C;  4LF8 L;  3H3V I;  4A93 B;  3E0J A;  3KLW A;  3T1Y L;  4UDU C;  5M9O A;  1QWY A;  1STG A;  4OHJ A;  4O0A A;  1EIH A;  4AYB E;  4ODG A;  4PNY A;  1DM0 B;  5GAD C;  1C9O A;  4XQN A;  3CF5 A;  2EYH A;  3GTK H;  1II3 A;  2FXQ A;  2P5Z X;  5GRO A;  4JI7 L;  1EY5 A;  2EJG C;  4RHR A;  2J7Z A;  5K36 G;  2HCI A;  1VQ4 A;  4LW1 A;  1EEI D;  1Y1V G;  4A3M G;  1EUJ A;  1R4Q B;  1I4G A;  4J6H A;  4QY7 A;  4DV3 Q;  1A2U A;  1VQ7 A;  4QGU A;  2K7V A;  1SJE D;  1Y8P B;  1K8O A;  4HN7 A;  2OWO A;  3N6R A;  5E4W C;  5IP7 H;  2UXD Q;  4IUT A;  1GUW A;  2JA7 G;  1Q8K A;  1I3Q B;  2KCN A;  3T16 A;  4LAA A;  4JOI A;  1K28 A;  5M3F H;  2R3Z A;  2JA8 G;  5A35 A;  3RMH A;  1N33 L;  3HOY G;  4CHT B;  2PPB C;  2I5H A;  3I90 A;  3I72 A;  2F4V L;  3J80 i;  1XPU A;  3BYY B;  1STH A;  4BWG B;  1VF7 A;  1ET6 A;  2QDB A;  4GLX A;  1RIP A;  3Q23 A;  1EYC A;  2K04 A;  2IWH A;  1IBM L;  3S2H B;  1Y1W H;  3D6W A;  5LMN Q;  3HOU B;  1V43 A;  1E2V A;  1HTP A;  4C3I G;  3ONA B;  4LF4 L;  4KD3 A;  3OOC A;  3UI2 A;  2E5L Q;  5C5L A;  1VQC A;  4B3T Q;  4JW0 A;  3PO2 H;  2B2T C;  4X65 L;  5KRU A;  1VMP A;  4RGO S;  3CPF A;  1HR0 Q;  3HKS A;  1PDQ A;  4R9W A;  3KUP A;  3OWE B;  5KNC A;  2I5M X;  2MQH A;  1X65 A;  1JWS D;  3I4N B;  3CRK C;  5FO7 B;  4JPB W;  4YWL A;  3GTL B;  1ET9 A;  1BR9 A;  2QGQ A;  1O78 A;  3NSW A;  2IX3 A;  4AYB B;  3TBI B;  1A62 A;  3HOZ G;  1VQ6 A;  2KJX A;  3MVV A;  2NBF A;  3K7A H;  3PCO B;  2J0T D;  3R93 A;  1CFM A;  5HGT A;  1KTK A;  1UEA B;  1SYC A;  4UY8 C;  4DXG A;  2WAQ G;  3TS0 A;  1FYC A;  5IGE A;  1H9J A;  1I4H A;  3O13 A;  1NUC A;  5KIX A;  4L8J A;  5BN5 A;  4HJA A;  3WWV A;  3GTQ B;  3T1H L;  3A8K E;  1F2L A;  4N9P A;  5FKA C;  3JAM i;  4JI3 L;  1V9P A;  1UE6 A;  4C3J B;  1PFS A;  4K2L A;  3MFG A;  2ES2 A;  4P75 A;  1NR2 A;  4ALP A;  4FF4 A;  1LTS D;  2E2I H;  3M4Y A;  1XTC D;  1QB5 D;  3TSS A;  2R7D A;  2F0Q A;  2Z6K A;  4HIM A;  3T51 B;  5I2X A;  5BR8 Q;  1EFW A;  4JG2 A;  2ZM6 L;  1YIT A;  4JYA L;  1XXG A;  2K4K A;  3C3L A;  2JK8 A;  2JJQ A;  3PUV A;  1G6Z A;  1PA6 A;  1KAB A;  5G3L F;  4DV6 L;  4L63 B;  1ML0 D;  4ZUJ A;  4LF9 L;  5C3E B;  1TWA B;  1C7Y A;  2IHF A;  1F2M A;  4DV4 L;  3QOJ A;  1CI3 M;  5IYB G;  3I55 A;  3M3Y H;  4XT3 B;  2ALY B;  2F0F A;  1B2T A;  2KHJ A;  4IZ8 A;  3J7Y W;  2Q2I A;  4JYA Q;  1IYV A;  3A5Z B;  1HHV A;  1TU2 B;  4R4O A;  5C0X H;  1A8V A;  5AFW A;  4IPD A;  3CPW A;  1VQD A;  2UXC L;  5FO8 B;  4DV6 Q;  2Q8R E;  2SDF A;  1RKN A;  5DNF A;  4FO2 A;  1M1K C;  3E5S A;  4LUZ A;  4A3F H;  2UU9 Q;  3HOW B;  1QOH A;  1CSQ A;  3J81 j;  1B4O A;  1CQF A;  3KF6 A;  4JI8 Q;  5IGB A;  5C0X J;  1A3T A;  2OQ0 A;  4CDD C;  4A3G G;  2F0M A;  3MXN A;  4NXM Q;  1DJR D;  4LJZ C;  1TWG H;  5GAG C;  1EU4 A;  1ICW A;  1D5Z C;  2GA4 B;  3PF4 A;  5IGF A;  3BDC A;  2PQA A;  5E3F A;  4C3H G;  1G2S A;  4QIW B;  2ZXP A;  1PYB A;  1EOV A;  3ERO A;  1I5F A;  2A6H C;  2PNH A;  4JV5 L;  1RF2 D;  1VS0 A;  1QCB D;  1XNQ L;  2WAC A;  4H13 C;  1UEB A;  1H9M A;  1TQO A;  1ZKO A;  1K8M A;  2R7Z B;  4DK0 A;  3X3M A;  3NTK A;  3L0O A;  4DAY A;  3F1Z A;  4S3S A;  4K0K L;  1TWF B;  4AQY Q;  4YY3 L;  1SYE A;  1KAW A;  3H0G H;  1TT2 A;  3I4L A;  1J5E L;  3HG9 A;  3FKI H;  1BUV T;  3TZU A;  4JV5 Q;  5EBD A;  2VXW A;  3NP8 A;  1D6E C;  3RZD B;  1OXS C;  2EY6 A;  4C1N I;  2NVQ B;  3MA2 B;  3F2B A;  2A6E C;  2X69 A;  4POG A;  5D14 A;  1IL8 A;  1F9S A;  5ELN A;  1QG7 A;  1MI2 A;  1A15 A;  1OO9 B;  4OXP A;  2K50 A;  1JE4 A;  4BBR G;  2QCP X;  2UUC Q;  3HOX H;  2L0C A;  2X6L A;  1WOC A;  1EQQ A;  4MNO A;  4NP5 A;  2OTL A;  4K0K Q;  4JI5 Q;  5J22 A;  3EN2 A;  2YU9 B;  1JC7 A;  2R93 G;  3TRE A;  4R1J A;  3PQI A;  3PGZ A;  3R8B A;  4YWK A;  2AHO B;  3G48 A;  4CBV A;  5IE8 A;  1XJV A;  1E2W A;  2IX1 A;  2D62 A;  3CC7 A;  2HHH L;  3DEO A;  1A2T A;  4TSS A;  4JI0 Q;  2KED A;  3OIQ A;  3PIO A;  4GS3 A;  5JEA H;  2CKZ B;  4XTC S;  4K2K A;  1PV4 A;  2CW0 D;  5JAV A;  1I6H H;  3SXH A;  4HED A;  1IHZ A;  4Y52 H;  1LTR D;  3JC6 6;  1LTT D;  4A3D G;  1QIL A;  2KVM A;  1SEB D;  1JR0 D;  4QB4 A;  3DWQ A;  2IPK D;  3KF6 B;  5JEA J;  4YIJ A;  5ELF A;  2RDG A;  3RLF A;  3EJI A;  1CTM A;  1LYL A;  2AQ3 B;  4F88 A;  4NPS A;  1IZ6 A;  3MXN B;  2E75 C;  3PUY A;  2K5W A;  3I4M B;  2NTT A;  3E9H A;  2AQ1 B;  4P71 A;  2PQA B;  4BY7 B;  1SYF A;  1FNV A;  4FF1 A;  1HZA A;  3P7J A;  1XNR L;  4A3L G;  1AH9 A;  1BCP C;  1BNZ A;  4M8A A;  1YIJ A;  2A1A A;  2F0J A;  1XWE A;  1CHP D;  2JA6 B;  1BBW A;  2QEJ C;  2QDL A;  2VS1 A;  3J7A V;  5G3L D;  1EY7 A;  1G51 A;  3U9S A;  4DAY B;  2OXP A;  3S17 H;  2C35 B;  5AJ3 L;  2EYL A;  3CCQ A;  4ZRZ A;  1X55 A;  1TS3 A;  3J81 L;  2Q2H A;  4CJ2 C;  2NZO A;  3U58 A;  1X9N A;  2O5J C;  3I2Z A;  2BA1 A;  5C4J H;  2V4D A;  1TWC H;  4HJ7 A;  1SNQ A;  4ZQ3 A;  2DN8 A;  2ZJR A;  4U68 A;  2F0P A;  2QKI C;  2KHI A;  5CV8 A;  4OIJ A;  4K8J A;  1HFN A;  3Q6S A;  1K83 H;  1U4P A;  4DPG A;  1YJN A;  4A3B B;  4K5V A;  5IT9 c;  4A3J H;  1Q81 C;  1W6J A;  3MZ5 A;  4RGT A;  1WTP A;  1N32 L;  2IT1 A;  2NVT B;  1HNX L;  3E6Z X;  3HOV B;  3CC4 A;  2B2W A;  3RN2 A;  3NWS A;  3NEM A;  5E7N A;  2E2J H;  2NN6 H;  3RLN A;  2K28 A;  2A69 C;  4GOP C;  2KEC A;  3E3X A;  1AE3 A;  4X64 L;  4A3E G;  3EBE A;  1JQY D;  4HMI A;  3S1Q H;  1X32 A;  2CHB D;  4JBW A;  1EYA A;  3QJY A;  3DHQ A;  4RFB A;  3IAY A;  4KHP L;  1J8I A;  1Q7Y C;  2HIX A;  4K14 A;  1MSH A;  4WJ4 A;  4KLK A;  1Q1B A;  2K33 A;  1C0A A;  2L1B A;  1FJG L;  5K36 H;  4BBS G;  3K8A A;  1GM5 A;  1Y1V H;  1YNN D;  1HA6 A;  2Z4H A;  4DF7 A;  3PIP 3;  4A3M H;  2L4N A;  2WII B;  1TWH B;  3W2D A;  4X64 Q;  3G71 A;  3HKZ G;  2JEA I;  1X56 A;  2VUM G;  1HQR D;  4AH6 A;  2F0V A;  1HUM A;  3FRP B;  2LXJ A;  1WTV A;  4IFD I;  1VQH A;  3K6O A;  3H3V H;  3QB3 A;  2JA7 H;  1F9Q A;  3PF5 A;  5A2Q L;  4JI1 L;  2JA8 H;  2B63 B;  3H94 A;  4Q0F A;  1N36 Q;  4IPH A;  3J80 E;  3HOY H;  2F03 A;  1ZYR D;  2SEB D;  5KYL A;  1Z6H A;  4X3S A;  1VF5 C;  3GTO H;  2WIN B;  1VQ5 A;  4KKU A;  5IOC A;  4GNX C;  3HRZ C;  1SNO A;  2K5H A;  4XT1 B;  2K5V A;  3FVQ A;  3C1F A;  3OTO L;  3CME A;  4LK1 C;  3PMF A;  1UE7 A;  3A55 A;  1KDC A;  5CYU A;  4C3I H;  4KJO A;  2EVB A;  2EOT A;  1UE1 A;  2DJF C;  3BG3 A;  1U5K A;  3TRZ A;  1SYG A;  4KI0 A;  1Z7T A;  4IFD G;  2AUK A;  4TVA B;  1X6O A;  3EIV A;  2NWG A;  3SDZ A;  4B3M L;  3DM3 A;  5C3W A;  3T53 B;  1WD1 A;  1PHJ A;  4JBM A;  4UP8 A;  2HUG A;  4V0B A;  3UDF A;  1DZ1 A;  4JOI C;  3SK6 A;  1HPC A;  2A73 B;  3GV6 A;  3TN2 A;  3WOE A;  2VQE Q;  3HOZ H;  2UUB Q;  1FR3 A;  1SYB A;  3A7L A;  1BOS A;  1SMX A;  1K8A C;  4R8I A;  1S40 A;  4IUP A;  2ZT9 C;  3EQL C;  1NBW A;  1H9S A;  4DAM A;  3TDQ A;  1L1O A;  2CH4 A;  5EPK A;  5EBC A;  3V96 A;  4R8N A;  2D9U A;  5IP9 G;  4KHZ A;  3RZO B;  3NE5 B;  2HT1 A;  3JAM E;  1KL9 A;  4CKB A;  2E2H H;  1VQB A;  2BOS A;  1GVP A;  4EQP A;  4DR5 L;  5ELB A;  1MIU A;  1PH4 A;  4X62 L;  2MO1 A;  1PH7 A;  3CC2 A;  3GTG H;  1QVC A;  3DWP A;  1MGS A;  1NNX A;  3K5L A;  1F2Z A;  1QZG A;  3S14 H;  1G2T A;  5IT9 L;  2JA5 B;  4NB3 A;  1EY4 A;  3DUZ A;  5JJI A;  4K6L A;  4PMC A;  4LUV A;  1KDA A;  2EIF A;  1K73 C;  2K5D A;  1PRT F;  1B3Q A;  3IFT A;  2NVY B;  3Q0A A;  2EDG A;  1CSP A;  4XDX A;  1HTL D;  1S3O A;  5IYB H;  3S1N B;  2EXD A;  4DNT B;  3CCU A;  2B29 A;  4LFB L;  3I70 A;  4XQJ A;  5CV4 A;  4DV0 L;  2PZU A;  5FLM G;  3K81 C;  4LF6 L;  2PZT A;  2QW7 A;  4DUY Q;  4IPC A;  2PW5 A;  5EPJ A;  5KGU A;  1A63 A;  3G7L A;  5M3M G;  1UWV A;  4DV5 Q;  3L7Z C;  1PYS B;  3CCS A;  1D7Q A;  2Z6K C;  1P8L A;  4JVZ A;  3JAM c;  1SE4 A;  4DV1 Q;  2G9D A;  4IJL A;  3ZJY C;  1SFO B;  3KK7 A;  3NEN A;  2BA0 A;  3GTP H;  2C5C A;  4A3G H;  4WFN 3;  4BY1 B;  1HNW L;  3I73 A;  3AB9 A;  1DCZ A;  1XYI A;  3EFX D;  1U4L A;  3D0F A;  2M2L A;  1WCM G;  2MHV A;  3TP5 A;  4G7O C;  2FFK B;  5F2D A;  4C3H H;  3SR1 A;  5M5X H;  1H9R A;  4F87 A;  4C2M B;  3H15 A;  3CHB D;  4C1N K;  5CR3 A;  2F52 A;  4L6T B;  1H9S B;  2NUC A;  3RD4 A;  3X3N A;  2RCN A;  1KC8 C;  1L1O B;  1BF4 A;  1ASY A;  1EL0 A;  3A56 A;  1K8G A;  4QCL A;  2B2Y A;  2L55 A;  2MPM A;  3SEB A;  3Q24 A;  2R92 B;  4LF8 Q;  2CVR A;  1WFQ A;  4RAU C;  1SJH D;  3T1Y Q;  3VYU A;  2RQX A;  1VQF A;  2CWA A;  5CV5 A;  4A3K G;  1MJE A;  5EAY A;  1F77 A;  3A74 A;  5C4X G;  1NR4 A;  1J9O A;  2EJF C;  2OEO A;  2K32 A;  4JI7 Q;  1MD2 D;  2Z9H A;  3QO2 A;  5IGD A;  2RA4 A;  5COR A;  2KOL A;  1SSO A;  2F3I A;  2JXM B;  4LNQ A;  3QWN A;  3NXW A;  1NTG A;  4BBR H;  2ZTE A;  1X54 A;  2BCO A;  5C44 B;  4C56 C;  2F3W A;  5IY0 A;  3W3A A;  1UUP A;  3P75 A;  2Y0S G;  4KKT A;  2KCM A;  3M4P A;  2PI2 A;  1LAB A;  1N33 Q;  2LS0 1;  2EYO A;  1A0I A;  4FNF A;  1O7Z A;  1PVO A;  2F4V Q;  2D2C C;  1NAP A;  5JJL A;  3MAQ A;  1E22 A;  3GTK B;  1X3E A;  4GN3 B;  1ZXT A;  4DAP A;  4GLV B;  1HZC A;  2PZW A;  1DYQ A;  3F2D A;  1EY9 A;  3RR5 A;  1BDO A;  4A3D H;  1IBM Q;  4IQZ A;  4ZKC B;  1XMO L;  1EIF A;  2PI2 E;  2B2V A;  4R4Q A;  4ID6 A;  5J1Z A;  4YWM A;  3BZD B;  3M7G A;  2WKD A;  1NCV A;  3D8G A;  1RTN A;  4GN4 B;  4LF4 Q;  3PO3 G;  2OTJ A;  2JA9 A;  3RNU A;  2Z0S A;  1TII D;  4ME3 A;  5FOB B;  1PTO H;  4GLA C;  1STE A;  4X65 Q;  1PFB A;  1HUN A;  3SK4 A;  1Q3L A;  4JC0 A;  4ZUI A;  1IYU A;  1JJG A;  5M3F B;  1JMC A;  3K0X A;  5KNB A;  5CV7 A;  4A3L H;  1JOQ A;  5COY A;  1HFG A;  3SHL A;  4QIW E;  3G6E A;  1N34 L;  5H1S E;  1R9T H;  5CMD A;  4UAI A;  5ISR A;  4YCW A;  3J7A F;  3MWY W;  1EZ8 A;  3L9A X;  1JE5 A;  1Y1W B;  2HIV A;  2ATW A;  1GUN A;  4A76 A;  1X3G A;  4R4I A;  3NEL A;  3OSO A;  1PRT D;  1E7Z A;  2EYJ A;  4B9X A;  4PZ7 A;  1TXY A;  4HIK A;  4A3I G;  5IGC A;  1O7I A;  1PXU A;  2KEN A;  4X3T A;  4GZY C;  1KIX A;  2WB1 E;  3OMC A;  5C6A A;  3T1H Q;  3PO2 B;  4NMZ A;  1EIY B;  4QUC A;  2A74 C;  2XRQ D;  1B3A A;  1M8A A;  1A6X A;  4JI3 Q;  4UHV A;  1B7Y B;  4KY6 A;  1ENC A;  3OW2 A;  1IW7 D;  1NMF A;  4F8M A;  3CCM A;  4Q5V A;  4YCU A;  3GTJ H;  1JB7 A;  1BBX C;  4RCN A;  2I0Q A;  3M9B A;  2A19 A;  2ZM6 Q;  1E0B A;  3Q22 A;  4GKJ L;  4DA2 A;  3K7A B;  3S24 A;  2DY7 A;  2B8G A;  3TQY A;  1E3P A;  1TS5 A;  3PIO 3;  3S9W A;  1S5F D;  5DLQ E;  4WJ3 M;  5LL6 X;  1Q86 C;  4FVM A;  4LF9 Q;  2I46 A;  4G4K A;  4NKL A;  4A3E H;  1G29 1;  4DV4 Q;  1Y69 U;  5BN3 A;  1GHJ A;  3OIP A;  5JJZ A;  1T5E A;  2AWO A;  2OCE A;  4OON A;  1N9W A;  4RH6 A;  2ZJP A;  4TQU S;  1KD1 C;  1TS2 A;  4JI4 L;  2PYK A;  1W2B A;  3H91 A;  5I6Y A;  1SXT A;  4BBS H;  3CXC A;  2E2I B;  4V19 0;  5HY6 A;  2UXC Q;  3P20 A;  1R4P B;  4K8I A;  5CBE E;  2ASB A;  1B44 D;  1RL2 A;  1B53 A;  4L5Q A;  3HOU G;  2VUM H;  3TS2 A;  3LGJ A;  2MJ8 A;  3ZYY X;  2NZ1 D;  3S15 H;  3GDE A;  1KLU D;  2PNR C;  5DM6 3;  1HZB A;  1QVF A;  5LMN W;  4DUZ L;  2X6G A;  3OPO A;  1EWC A;  2PCF B;  1XPO A;  1VQA A;  3OYY A;  3M3Y B;  4UPA A;  1QZH A;  2WB1 B;  2LMC B;  1PH5 A;  2H5X A;  4IOA A;  2XGT A;  4LFA L;  1WTO A;  3I4N G;  3M7N A;  3NQT A;  1HR0 W;  1Q46 A;  5FLX E;  2AKW B;  2HQE A;  2QIL A;  4U67 3;  3KDF A;  1XNQ Q;  1B70 B;  4FYD A;  4AYB G;  5IWA L;  2QA4 A;  2JEB I;  4UP9 A;  2M9V A;  4NW2 A;  2XRS D;  1LM0 A;  1RJT A;  4A3F B;  4A3C G;  2PMZ E;  1QE6 A;  3MXP A;  5I2Y A;  3S2D H;  3D6C A;  1AN8 A;  1V1P A;  1Q8I A;  2DUD A;  1E24 A;  4IFD H;  2R7F A;  4YY3 Q;  4F7X A;  3L2P A;  4DR4 L;  4ZK9 B;  1J5E Q;  1O80 A;  4JCV E;  5LMU L;  1HNZ L;  1TWG B;  3DMU A;  1NMG A;  2OT2 A;  4PZ8 A;  1YHQ A;  2B39 A;  2H1E A;  2WV6 D;  2MP1 A;  1VDZ A;  1XMQ L;  5EGT A;  1CUK A;  4C3J G;  3C2P A;  3CCR A;  3NWT A;  3T13 A;  4IFD J;  3AQQ A;  4N8X 1;  2BE5 D;  2WKC A;  3K57 A;  1KRT A;  4EQO A;  4IUN A;  3G4S A;  5JOB A;  1UE5 A;  1NE3 A;  4DR4 Q;  2F0H A;  2L12 A;  3W5O A;  3MHB A;  4HCE A;  2H4O A;  5IP9 H;  2CW0 C;  1MSG A;  1GOZ A;  4J15 A;  2F4I A;  2HHH Q;  1PTO F;  1XTD A;  2K6A A;  4RMF A;  5C3E G;  4IAL A;  3AMU A;  4OX9 L;  2BDN A;  3H0G B;  1VCI A;  3FKI B;  3ND9 A;  3BDO A;  2UUA L;  4TRD A;  3H09 A;  4FXD A;  1PFM A;  1LT5 D;  4LF7 L;  2JQO A;  2ZXO A;  4Y7N H;  1G8Z D;  1GHK A;  1VMC A;  4TKO B;  4EX5 A;  2MFI A;  4DR7 L;  2B2U C;  3IRB A;  1I50 H;  2F0U A;  3HOX B;  2XTI A;  3VR3 A;  1KQS A;  4IUQ A;  3BVZ A;  4OWT B;  3J81 i;  3HOW G;  1SMY D;  3IFD A;  4B9W A;  2PO4 A;  2AUJ D;  4KKS A;  3GD7 A;  2PMZ B;  4HJ9 A;  3MTS A;  2N49 A;  1XNR Q;  2ZXR A;  2M00 A;  1S5D D;  4IUV A;  1VQN A;  1ILP A;  1SBB B;  4A4I A;  3KDF B;  5EKI A;  1I6H B;  5BN4 A;  1QJO A;  3M85 A;  2XNA C;  5FLM H;  1UNS A;  1WTX A;  2CQO A;  1PYW D;  5T1I A;  4BA1 I;  4APV A;  5GAE C;  2K5Q A;  5AJ3 Q;  1U0L A;  1B8A A;  2G5D A;  5M3M H;  2TMP A;  1V1P B;  3M4O H;  3N52 A;  4DK1 A;  5C4Z A;  1E1T A;  3EVQ A;  3LWU A;  1IBK L;  1EQR A;  1CKO A;  4H0L C;  1U4M A;  4IUU A;  2R7Z G;  3OMG A;  2YTY A;  5C5M A;  1YEZ A;  2Z1C A;  1A3U A;  1NSN S;  1OXV A;  4CJ1 B;  2RCF A;  3A0J A;  1WCM H;  3FHW A;  1PH1 A;  2A5H A;  2ID0 A;  4LF5 L;  4K5W A;  3FMC A;  3HFZ B;  4Y7N B;  2F0I A;  2D0P A;  5DEH A;  3LWE A;  3WDN A;  3D4D A;  4X66 L;  1HA5 A;  4EQ5 A;  1N32 Q;  1HNX Q;  3S1M H;  5D3D A;  2HQL A;  4RGM A;  5D65 A;  3URY A;  4DV2 L;  3S17 B;  2N3S A;  2CWP A;  4CJ0 B;  2KCC A;  1PRT B;  3U50 C;  2KHS A;  3QR8 A;  3CQZ H;  1GUT A;  4A3K H;  1J6Q A;  3KLR A;  5HGQ A;  5I9P A;  5C4X H;  3S1R H;  4KHP Q;  2ICE C;  3GQB A;  4XQQ A;  5C4J B;  1EY8 A;  1TWC B;  1YNN C;  4I7A A;  2NVX H;  4WOR A;  5EQ0 A;  1FJG Q;  1RD9 D;  1DXM A;  2K75 A;  1K83 B;  1SRU A;  5L37 A;  3S16 H;  4HSP A;  4B08 A;  4A3J B;  3VDY A;  1KNA A;  5JJK A;  3KFU A;  3R2I A; 
#chains in the Genus database with same CATH homology
 3GO5 A;  2EY1 A;  2O5I C;  1DD2 A;  1EQV A;  3NBI A;  3TZD A;  4JK1 C;  3KBX A;  3H6M A;  2E2J B;  3D4W A;  1CZG A;  1ZYR C;  4I7Z C;  4H44 C;  2B2Y C;  4WRD A;  5EJW A;  5CC4 A;  1B50 A;  4G7Z C;  3R3O A;  1QNU A;  3S1Q B;  2XWB B;  1GUO A;  4RGN A;  5KEE A;  1CK1 A;  3WOF A;  1SYD A;  1AP0 A;  1LLR D;  3NPP A;  2F0T A;  3FPP A;  4RCO A;  5JPM C;  4EGV A;  1Y1V B;  1A3V A;  1S5B D;  3HEJ A;  4A3M B;  1ZEQ X;  4HR7 B;  4ZLT F;  5E1F A;  2EZV A;  1ENA A;  2FJ2 A;  4J1M A;  4A3K B;  1PTO D;  5FO9 B;  1C4Q A;  3QOL A;  4H7B A;  4KK7 A;  5J39 A;  3NTH A;  2Z4I A;  1EEF D;  1OXT A;  4DFA A;  3TME A;  2JA7 B;  3T56 B;  1RHP A;  3SK8 A;  2JA8 B;  4X3U A;  3HOY B;  5E4X A;  2F0D A;  2JP1 A;  2R6G A;  3GTO B;  2AWN A;  2L9H A;  1BQQ T;  1I4Q A;  2FIN B;  3F2U A;  2N55 A;  4ZKB B;  4C3I B;  2B2V C;  4G7H C;  1LO5 D;  2F0L A;  4G57 A;  1LTB D;  4XYQ A;  5DM7 3;  1ENF A;  5ELD A;  1Y8N B;  5ELC A;  2EE1 A;  2A68 D;  1PFN A;  2RDH A;  1PZJ D;  1U4R A;  1LTA D;  2Q8T A;  4NDX A;  3HOZ B;  3K0Y A;  2WAQ B;  4HAE A;  1I6V C;  2CQA A;  4RWS C;  2EY5 A;  1XX8 A;  5ELE A;  2E2H B;  4KN7 C;  1STB A;  3LX0 A;  4FF2 A;  1SNP A;  1KLG D;  1AW7 A;  1E2Z A;  1HCZ A;  1L0Y B;  3SE0 A;  2ENB A;  2HDM A;  1YNJ D;  2EXZ A;  3I91 A;  4KY7 A;  3GTG B;  2EPB A;  2KA7 A;  5T1G A;  3K59 A;  1EYD A;  3S14 B;  3ERQ A;  3R2T A;  3HGB A;  1KAA A;  2Z8L A;  4ZAI A;  1EOT A;  4P2C B;  1H9K A;  5JPN C;  4K6D A;  4MIU A;  1RCV D;  4I65 A;  1B1Z A;  1I4P A;  2AQ2 B;  5CV9 A;  2O2L D;  1JWM D;  3TP7 A;  1FNW A;  4ME5 A;  1OXX K;  1AZQ A;  1D5X C;  1WTR A;  4N9T A;  1C8C A;  2G9H D;  1S5C D;  2FHT A;  3VR2 A;  4ULL A;  1OXU A;  1FNU A;  1F9R A;  1GJX A;  2DNC A;  2RSO A;  1SNC A;  2NTS A;  1DOM A;  1O7L A;  1CHQ D;  3DM1 A;  4MHE A;  3GTP B;  1LTI D;  1T5X D;  4A3G B;  3D31 A;  2F0S A;  2NYZ D;  1V8Q A;  2LKV A;  4KHV A;  3J80 L;  4C3H B;  5M5X B;  3A54 A;  4QF4 A;  1JOO A;  4HMJ A;  1STN A;  2TSS A;  1LTG D;  4BS9 A;  1ESF A;  4XXE A;  4CGY B;  3PUW A;  2ICI A;  1L0X B;  3NQI A;  3VYT A;  1TKW B;  1EQT A;  2IJ0 A;  2KQ3 A;  3GV3 A;  4OO1 I;  1B9M A;  1UAP A;  3C1E A;  1RTO A;  2PW7 A;  1AEX A;  4XYO A;  2KEE A;  4ZYS A;  1ESR A;  3VR4 A;  1CM9 A;  2XN9 C;  3KF8 A;  3MEH A;  1QNK A;  1CA6 A;  1GUG A;  1PMR A;  3HZX A;  3K5M A;  1JOK A;  3K5N A;  2NB0 A;  1JCK B;  2JE6 I;  5I4D A;  2VB3 X;  5LL6 S;  1Z47 A;  5EPL A;  1SAP A;  2HCC A;  2I07 B;  4BBR B;  1X3Q A;  3KBG A;  4LMQ D;  1EY0 A;  3J81 E;  2F3V A;  3VA7 A;  2R93 B;  1ONL A;  1LT4 D;  1BCP F;  3HP3 A;  4OO1 G;  3VYR A;  4PQX A;  1EWH A;  1CQV A;  3MFY A;  1FGB D;  3JAM L;  2XWJ B;  1Q12 A;  3V05 A;  4ABN A;  1RDP D;  4KV6 A;  1PRT C;  1TVX A;  2L11 A;  4A3D B;  3KLS X;  1GXD C;  2RVL A;  2L5T A;  3GTM B;  4RHS A;  3U9O A;  1ROD A;  3VA5 A;  4KJN A;  1PTO B;  1IW7 C;  4J8Q A;  1CA5 A;  3PV0 A;  2FMC A;  2E2D C;  2K05 A;  3AU7 A;  4QMG A;  3T4A C;  1EZ6 A;  3BYT B;  2YYZ A;  3MXG A;  4HCS A;  3LNN A;  1R9T B;  1S5E D;  1SDF A;  2B8F A;  5C3X A;  3VR5 A;  4RA8 A;  3EA6 A;  5CV6 A;  2MGS A;  4CKE A;  1D5M C;  4HTH A;  2A6H D;  4KY5 A;  5A2Q E;  2B2W C;  4O42 A;  1SND A;  1TS4 A;  3MC0 B;  2HDL A;  2RSN A;  2E76 C;  3I8Z A;  5FK9 C;  3GTJ B;  3GP7 A;  1DOL A;  3DEP A;  2K01 A;  2LFN A;  1STY A;  2F1M A;  3H3V C;  3BVM A;  3TP8 A;  3K5O A;  2EYP A;  3ITP A;  3RUZ A;  2B2T A;  4FP5 D;  2A6E D;  2RBM A;  1I4X A;  4A3E B;  5IGG A;  1EIG A;  4KN4 C;  1B9N A;  1D2B A;  4IUR A;  4BA2 I;  4BBS B;  2EYF A;  3DXJ C;  2XVS A;  3BVG A;  4KD4 A;  2OF1 A;  2WP8 J;  5D3I B;  2K1B A;  3HKZ B;  2VUM B;  1LT6 D;  3NTI A;  3S15 B;  4PMW A;  5NUC A;  4OGQ C;  1Q1E A;  2DNE A;  2RDF A;  3D3R A;  2BE5 C;  3OWF A;  4DAV A;  1SE2 A;  3V2T A;  3CRL C;  1PLF A;  2F0N A;  4DXF A;  1EFI D;  1KDB A;  3FPU B;  4KTA A;  1PZK D;  4E6I A;  5IT9 E;  3I3C A;  5LHY 1;  1BCP D;  1SE3 A;  5EKK A;  2J4X A;  2C9O A;  3S2D B;  1AZP A;  1U9R A;  1LAC A;  3DWA A;  4FXK C;  2DY8 A;  5EKL A;  1D1K A;  2F0O A;  3VYS A;  1JOR A;  2O4X A;  3L3O C;  3BS1 A;  4O1N A;  1PZI D;  5C0X I;  3QIA A;  1Q90 A;  4QUF A;  3VR6 A;  1SMY C;  1X3P A;  1EY6 A;  5K5P A;  2D5D A;  3A7A B;  4DNR B;  2LY7 A;  1TR5 A;  2Q8I B;  3IKJ A;  4MN3 A;  1TY2 A;  1F9P A;  2VB2 X;  5C4H A;  1O7Y A;  1ILQ A;  1HQM C;  2A69 D;  5I9O A;  4OIK A;  4DGZ A;  1HRJ A;  2FMM A;  5C0X G;  1I50 B;  3D4R A;  2JYO A;  3OHX C;  4ILW A;  3NBH A;  1AFP A;  3CU7 A;  5JVH 3;  4KMU C;  3P1H A;  3K58 A;  1M4V A;  2E74 C;  5CBA E;  1FD7 D;  2IX0 A;  4Z9C B;  2RKS A;  3NK9 A;  2QF7 A;  1F2Y A;  4EVO A;  5M3M B;  3M4O B;  2K03 A;  1IKL A;  1I4R A;  1STA A;  4IN3 A;  2EY2 A;  2SNS A;  3SVM A;  1MBY A;  3QG1 A;  1KNE A;  1BXT A;  4WJW A;  3NUC A;  5HUR A;  1W6K A;  2F0W A;  4PMB A;  3G6J B;  1WCM B;  4CKC A;  4PV1 C;  3TP6 A;  4XIG S;  4FXG C;  1S4Z A;  2PQE A;  2VNU D;  2EJM A;  4DN4 M;  2EYM A;  3S1M B;  5CGK A;  2IW3 A;  2N88 A;  5FLX L;  1WVL A;  3KLS A;  2JSO A;  1IKM A;  1LT3 D;  1WTW A;  2BDO A;  1JIC A;  3A8I E;  3CQZ B;  3PUX A;  3BDL A;  1SNM A;  2F0K A;  5C4X B;  1WTQ A;  3S1R B;  3A8J E;  2NVX B;  4K5X A;  2B2U A;  3IL8 A;  5JEA G;  1WD0 A;  1PTO C;  3S16 B;  1JWU D;  4M1U B;  3OW7 A;  2SOB A;  5KND A;  5DAU A;  3HS0 C;  3PUZ A;  1HXY D;  5TSS A;  1JB3 A;  3CKI B;  3ND8 A;  1D1I A;  4OL7 A;  3MXU A;  2Y0S B;  5JVG 3;  4OO1 H;  1CT1 D;  1EU3 A;  4DU9 A;  1TY0 A;  3C46 A;  3FEW X;  3SK5 A;  5IIF A;  1DOK A;  2F0E A;  2XSC A;  4X3K A;  5IOD A;  4FF3 A;  3PO3 B;  2NN6 I;  1C48 A;  1DON A;  2A68 C;  5KYI A;  2SNM A;  1CZW A;  2XIW A;  4RKB A;  5I6W A;  4RKL A;  1GUS A;  1V1O A;  1BO0 A;  1Y8O B;  1LV9 A;  2F0G A;  3FDT A;  2KUM A;  2MUY A;  2IL8 A;  2R61 A;  1BCP B;  5M5W B;  4A3I B;  4HSV A;  3NHH A;  1G91 A;  2NN6 G;  5M5Y B;  4EQN A;  4A93 B;  1YNJ C;  3E0J A;  4UDU C;  5M9O A;  1QWY A;  1STG A;  4OHJ A;  1EIH A;  4ODG A;  4PNY A;  1DM0 B;  4XQN A;  2EYH A;  1II3 A;  1EY5 A;  2EJG C;  4RHR A;  2J7Z A;  5K36 G;  2HCI A;  1EEI D;  1R4Q B;  1I4G A;  4J6H A;  1A2U A;  2K7V A;  1SJE D;  1Y8P B;  1K8O A;  4HN7 A;  3N6R A;  5E4W C;  4IUT A;  1GUW A;  2KCN A;  1I3Q B;  3T16 A;  4LAA A;  2R3Z A;  5A35 A;  3RMH A;  4CHT B;  2PPB C;  3I90 A;  3I72 A;  3BYY B;  1STH A;  4BWG B;  1VF7 A;  1ET6 A;  2QDB A;  3Q23 A;  1EYC A;  2K04 A;  2IWH A;  3S2H B;  3D6W A;  3HOU B;  1V43 A;  1E2V A;  1HTP A;  4C3I G;  3ONA B;  4KD3 A;  3OOC A;  3UI2 A;  5C5L A;  2B2T C;  5KRU A;  1VMP A;  4RGO S;  1PDQ A;  4R9W A;  3KUP A;  3OWE B;  5KNC A;  3I4N B;  1JWS D;  3CRK C;  5FO7 B;  3GTL B;  1ET9 A;  1BR9 A;  1O78 A;  3NSW A;  2IX3 A;  4AYB B;  3TBI B;  2KJX A;  3MVV A;  2NBF A;  2J0T D;  3R93 A;  1CFM A;  5HGT A;  1KTK A;  1UEA B;  1SYC A;  4DXG A;  1FYC A;  5IGE A;  1H9J A;  1I4H A;  3O13 A;  1NUC A;  5KIX A;  4L8J A;  5BN5 A;  3GTQ B;  3A8K E;  1F2L A;  4N9P A;  5FKA C;  4C3J B;  4K2L A;  3MFG A;  1NR2 A;  4FF4 A;  1LTS D;  3M4Y A;  1XTC D;  3TSS A;  1QB5 D;  2F0Q A;  3T51 B;  5I2X A;  1XXG A;  3C3L A;  3PUV A;  1G6Z A;  1KAB A;  5G3L F;  4L63 B;  1ML0 D;  4ZUJ A;  5C3E B;  1TWA B;  1F2M A;  3QOJ A;  1CI3 M;  4XT3 B;  2F0F A;  1B2T A;  4IZ8 A;  3J7Y W;  1IYV A;  1HHV A;  1TU2 B;  5C0X H;  5AFW A;  5FO8 B;  2Q8R E;  2SDF A;  1RKN A;  5DNF A;  4FO2 A;  3E5S A;  3HOW B;  1QOH A;  1B4O A;  1CQF A;  5IGB A;  5C0X J;  1A3T A;  2F0M A;  3MXN A;  1DJR D;  4LJZ C;  1EU4 A;  1ICW A;  1D5Z C;  2GA4 B;  5IGF A;  3BDC A;  5E3F A;  4C3H G;  1G2S A;  4QIW B;  2ZXP A;  3ERO A;  2A6H C;  1RF2 D;  1QCB D;  2WAC A;  4H13 C;  1H9M A;  1TQO A;  1ZKO A;  1K8M A;  2R7Z B;  4DK0 A;  3X3M A;  3NTK A;  4DAY A;  4S3S A;  1TWF B;  1SYE A;  1TT2 A;  3I4L A;  3HG9 A;  1BUV T;  3TZU A;  5EBD A;  2VXW A;  3NP8 A;  1D6E C;  3RZD B;  1OXS C;  2EY6 A;  4C1N I;  2NVQ B;  3MA2 B;  2A6E C;  2X69 A;  5D14 A;  1IL8 A;  1F9S A;  1QG7 A;  1MI2 A;  1A15 A;  1OO9 B;  1JE4 A;  2QCP X;  2L0C A;  2X6L A;  4NP5 A;  5J22 A;  2YU9 B;  1JC7 A;  3R8B A;  4CBV A;  1E2W A;  2IX1 A;  2D62 A;  3DEO A;  1A2T A;  4TSS A;  2KED A;  3OIQ A;  5JEA H;  4XTC S;  4K2K A;  2CW0 D;  5JAV A;  3SXH A;  4HED A;  1IHZ A;  1LTR D;  1LTT D;  1QIL A;  2KVM A;  1SEB D;  1JR0 D;  4QB4 A;  3DWQ A;  2IPK D;  5JEA J;  4YIJ A;  5ELF A;  2RDG A;  3RLF A;  3EJI A;  1CTM A;  2AQ3 B;  4F88 A;  2E75 C;  3PUY A;  2K5W A;  3I4M B;  2NTT A;  2AQ1 B;  4BY7 B;  1SYF A;  1FNV A;  4FF1 A;  3P7J A;  1BCP C;  1BNZ A;  4M8A A;  2F0J A;  1XWE A;  1CHP D;  2JA6 B;  2QEJ C;  3J7A V;  5G3L D;  1EY7 A;  3U9S A;  2OXP A;  2EYL A;  4ZRZ A;  1TS3 A;  3J81 L;  4CJ2 C;  2O5J C;  2BA1 A;  2V4D A;  1SNQ A;  4ZQ3 A;  2DN8 A;  4U68 A;  2F0P A;  2QKI C;  5CV8 A;  4OIJ A;  4K8J A;  1HFN A;  3Q6S A;  1U4P A;  4A3B B;  4K5V A;  1W6J A;  3MZ5 A;  4RGT A;  1WTP A;  2IT1 A;  2NVT B;  3E6Z X;  3HOV B;  2B2W A;  3NWS A;  2NN6 H;  2K28 A;  2A69 C;  2KEC A;  1JQY D;  4HMI A;  1X32 A;  2CHB D;  4JBW A;  1EYA A;  3QJY A;  3DHQ A;  4RFB A;  3IAY A;  1J8I A;  4K14 A;  1MSH A;  1Q1B A;  2K33 A;  2L1B A;  5K36 H;  1YNN D;  1HA6 A;  2Z4H A;  4DF7 A;  3PIP 3;  2L4N A;  2WII B;  1TWH B;  3W2D A;  2JEA I;  1HQR D;  2F0V A;  1HUM A;  3FRP B;  1WTV A;  4IFD I;  3K6O A;  3QB3 A;  1F9Q A;  5A2Q L;  2B63 B;  3H94 A;  4Q0F A;  3J80 E;  2F03 A;  1ZYR D;  2SEB D;  5KYL A;  1Z6H A;  4X3S A;  1VF5 C;  2WIN B;  4KKU A;  5IOC A;  3HRZ C;  1SNO A;  4XT1 B;  3FVQ A;  3C1F A;  4LK1 C;  3PMF A;  5CYU A;  3A55 A;  1KDC A;  4KJO A;  2EVB A;  2EOT A;  3BG3 A;  1SYG A;  4KI0 A;  1Z7T A;  4IFD G;  2AUK A;  2NWG A;  3SDZ A;  5C3W A;  3T53 B;  1WD1 A;  2HUG A;  4V0B A;  1DZ1 A;  3SK6 A;  1HPC A;  2A73 B;  3GV6 A;  3TN2 A;  3WOE A;  1FR3 A;  1SYB A;  3A7L A;  1BOS A;  4R8I A;  4IUP A;  2ZT9 C;  3EQL C;  1H9S A;  3TDQ A;  5EPK A;  5EBC A;  3V96 A;  4R8N A;  2D9U A;  4KHZ A;  3RZO B;  3NE5 B;  3JAM E;  4CKB A;  2BOS A;  4EQP A;  5ELB A;  3DWP A;  1MGS A;  3K5L A;  1F2Z A;  1G2T A;  5IT9 L;  2JA5 B;  1EY4 A;  3DUZ A;  4K6L A;  4PMC A;  1KDA A;  2K5D A;  1PRT F;  3IFT A;  2NVY B;  3Q0A A;  2EDG A;  4XDX A;  1HTL D;  3S1N B;  4DNT B;  3I70 A;  4XQJ A;  5CV4 A;  2PZU A;  2PZT A;  2PW5 A;  5EPJ A;  5KGU A;  3G7L A;  3L7Z C;  1SE4 A;  2G9D A;  1SFO B;  3KK7 A;  2BA0 A;  2C5C A;  4WFN 3;  4BY1 B;  3I73 A;  3AB9 A;  1DCZ A;  1XYI A;  3EFX D;  1U4L A;  2M2L A;  2MHV A;  3TP5 A;  4G7O C;  2FFK B;  5F2D A;  3SR1 A;  1H9R A;  4F87 A;  4C2M B;  3CHB D;  4C1N K;  5CR3 A;  4L6T B;  3X3N A;  1H9S B;  2NUC A;  3RD4 A;  1BF4 A;  1EL0 A;  3A56 A;  4QCL A;  2B2Y A;  2L55 A;  2MPM A;  3SEB A;  3Q24 A;  2R92 B;  2CVR A;  4RAU C;  1SJH D;  3VYU A;  2RQX A;  5CV5 A;  1F77 A;  1NR4 A;  1J9O A;  2EJF C;  2OEO A;  2K32 A;  1MD2 D;  3QO2 A;  5IGD A;  2RA4 A;  5COR A;  2KOL A;  1SSO A;  2JXM B;  3QWN A;  3NXW A;  2BCO A;  5C44 B;  4C56 C;  2F3W A;  3W3A A;  1UUP A;  3P75 A;  4KKT A;  1LAB A;  2LS0 1;  2EYO A;  4FNF A;  1O7Z A;  2D2C C;  1NAP A;  3MAQ A;  3GTK B;  1ZXT A;  4DAP A;  2PZW A;  1DYQ A;  1EY9 A;  1BDO A;  4IQZ A;  4ZKC B;  2B2V A;  4ID6 A;  5J1Z A;  3BZD B;  3M7G A;  2WKD A;  1NCV A;  3D8G A;  1RTN A;  1TII D;  5FOB B;  1PTO H;  1STE A;  1PFB A;  1HUN A;  3SK4 A;  1Q3L A;  4ZUI A;  1IYU A;  5M3F B;  5KNB A;  5CV7 A;  1JOQ A;  5COY A;  1HFG A;  3SHL A;  5CMD A;  4UAI A;  5ISR A;  3J7A F;  3MWY W;  1EZ8 A;  3L9A X;  1Y1W B;  1GUN A;  3OSO A;  1PRT D;  2EYJ A;  4B9X A;  5IGC A;  1PXU A;  4X3T A;  4GZY C;  3OMC A;  5C6A A;  3PO2 B;  4NMZ A;  4QUC A;  2A74 C;  2XRQ D;  1B3A A;  1M8A A;  1A6X A;  4KY6 A;  1ENC A;  1IW7 D;  4F8M A;  4Q5V A;  1BBX C;  4RCN A;  1E0B A;  3Q22 A;  4DA2 A;  3K7A B;  2DY7 A;  2B8G A;  1TS5 A;  3PIO 3;  3S9W A;  1S5F D;  5LL6 X;  4FVM A;  2I46 A;  4G4K A;  4NKL A;  1G29 1;  1Y69 U;  5BN3 A;  1GHJ A;  3OIP A;  5JJZ A;  1T5E A;  2AWO A;  4RH6 A;  4TQU S;  1TS2 A;  2PYK A;  3H91 A;  5I6Y A;  1SXT A;  2E2I B;  4V19 0;  3P20 A;  1R4P B;  4K8I A;  5CBE E;  1B44 D;  1B53 A;  2MJ8 A;  3ZYY X;  2NZ1 D;  1KLU D;  2PNR C;  5DM6 3;  2X6G A;  3OPO A;  1EWC A;  2PCF B;  3M3Y B;  2WB1 B;  2LMC B;  1WTO A;  3M7N A;  3NQT A;  5FLX E;  2HQE A;  2QIL A;  4U67 3;  4FYD A;  2JEB I;  2M9V A;  4NW2 A;  2XRS D;  1RJT A;  4A3F B;  1QE6 A;  3MXP A;  5I2Y A;  3D6C A;  1AN8 A;  1V1P A;  1Q8I A;  4IFD H;  4F7X A;  4ZK9 B;  1O80 A;  1TWG B;  3DMU A;  2OT2 A;  2B39 A;  2H1E A;  2WV6 D;  2MP1 A;  1VDZ A;  5EGT A;  4C3J G;  3C2P A;  3NWT A;  3T13 A;  4IFD J;  2BE5 D;  2WKC A;  3K57 A;  4EQO A;  4IUN A;  5JOB A;  2F0H A;  2L12 A;  3MHB A;  4HCE A;  2H4O A;  2CW0 C;  1MSG A;  1GOZ A;  2F4I A;  1PTO F;  2K6A A;  4IAL A;  3AMU A;  2BDN A;  3H0G B;  1VCI A;  3FKI B;  3ND9 A;  3BDO A;  4TRD A;  3H09 A;  4FXD A;  1PFM A;  1LT5 D;  2ZXO A;  1G8Z D;  1GHK A;  1VMC A;  4TKO B;  2B2U C;  2F0U A;  3HOX B;  3VR3 A;  4IUQ A;  3BVZ A;  1SMY D;  3IFD A;  4B9W A;  2PO4 A;  2AUJ D;  4KKS A;  3GD7 A;  2PMZ B;  3MTS A;  2ZXR A;  2M00 A;  1S5D D;  4IUV A;  1ILP A;  1SBB B;  5EKI A;  1I6H B;  5BN4 A;  1QJO A;  3M85 A;  2XNA C;  1UNS A;  1WTX A;  1PYW D;  5T1I A;  4BA1 I;  2K5Q A;  2TMP A;  1V1P B;  3N52 A;  4DK1 A;  5C4Z A;  3EVQ A;  3LWU A;  4H0L C;  1U4M A;  4IUU A;  3OMG A;  5C5M A;  2Z1C A;  1A3U A;  1NSN S;  1OXV A;  4CJ1 B;  2A5H A;  2ID0 A;  4K5W A;  3FMC A;  4Y7N B;  2F0I A;  5DEH A;  3LWE A;  3WDN A;  3D4D A;  1HA5 A;  5D3D A;  4RGM A;  5D65 A;  3URY A;  3S17 B;  4CJ0 B;  2KCC A;  1PRT B;  2KHS A;  1GUT A;  3KLR A;  5I9P A;  2ICE C;  4XQQ A;  3GQB A;  5C4J B;  1EY8 A;  1TWC B;  1YNN C;  4WOR A;  5EQ0 A;  1RD9 D;  1DXM A;  1K83 B;  4HSP A;  4B08 A;  4A3J B;  1KNA A;  3R2I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...