2PZTA

Crystal structure of staphylococcal nuclease variant v66q/p117g/h124l/s128a at 100 k
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
135
structure length
130
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKVEKYGPEASAFTKKMQENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystallographic study of hydration of an internal cavity in engineered proteins with buried polar or ionizable groups.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 37
structure length 130
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2007-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2pztA00
3NHHA 4PMCA 4S3SA 5I6WA 4J1MA 1STHA 1TR5A 4K2KA 4EVOA 5E3FA 2F0UA 4KV6A 4NDXA 4QF4A 1A2TA 3T16A 3TP7A 2NUCA 1EYCA 2EXZA 4K5WA 2EYMA 4K6DA 4QMGA 2F0SA 2OEOA 3EJIA 3T13A 2EY5A 4F8MA 5C4HA 1STGA 4J6HA 5K5PA 3OWFA 4LAAA 1TT2A 2EYJA 2F0HA 3LX0A 5DEHA 1AEXA 2ENBA 3DMUA 3SXHA 5JOBA 2PW7A 4ZQ3A 5I9OA 2EY1A 2F0DA 4EQPA 2F0EA 1JOQA 3NP8A 5KYLA 1KAAA 1RKNA 1U9RA 4PMBA 4RKBA 5EGTA 4IALA 2RKSA 1SNOA 5JAVA 1TQOA 5I9PA 1KDAA 1II3A 2PQEA 3SK4A 2F0TA 1SNMA 1STBA 2F0GA 2SNMA 3BDLA 3MHBA 3OMCA 4ZUJA 3TMEA 2F0PA 2EY2A 4HMIA 3SHLA 4KY7A 4N9TA 4K8IA 2OXPA 1JOKA 2EY6A 4G57A 5IOCA 3MEHA 3PMFA 5HGTA 5IGDA 3D8GA 1EQVA 5ISRA 1SNDA 4DU9A 3S9WA 4IUNA 2RDFA 5F2DA 1STYA 5M9OA 5IGBA 2F0VA 3NXWA 2EYOA 2PZTA 1EY0A 4YIJA 2KQ3A 4E6IA 3OSOA 4KD3A 5IGCA 3P1HA 5E1FA 5J39A 5EKKA 5IIFA 5KGUA 3EVQA 1EY7A 4KJOA 5CV9A 1IHZA 1SNQA 2F3WA 1A3TA 4B9WA 4DGZA 5CGKA 1KDCA 2PYKA 4K2LA 2WACA 1F2ZA 3ERQA 4HTHA 4KY6A 2RBMA 4KJNA 4NMZA 4PNYA 1EY6A 1F2YA 3TP6A 4ID6A 3R3OA 4KHVA 1ENAA 2F0MA 2PW5A 3C1FA 2EYPA 5IGGA 1STAA 2QDBA 5CV7A 1EZ6A 4DF7A 1SYCA 2PZUA 3QOJA 3H6MA 1EY4A 5J1ZA 1ENCA 5C5LA 5KYIA 4MIUA 1NUCA 4K5VA 2EYHA 3QB3A 1STNA 4EQNA 1A2UA 3D4DA 2F0QA 4OL7A 1F2MA 4NP5A 5C3XA 2O4XA 1A3UA 5CV4A 5KEEA 2EYFA 3QOLA 4K8JA 1EYDA 2F0FA 3DHQA 3HZXA 5CV8A 5CC4A 5IGFA 4ME5A 1A3VA 1SYEA 2F0JA 3E5SA 4QB4A 4ODGA 4KD4A 4NKLA 2LKVA 3C1EA 2F0NA 3MVVA 1SYFA 4HMJA 3D4WA 2HQEA 1SYDA 2SOBA 3MXPA 3OMGA 5NUCA 2F0IA 5C3WA 3VA5A 4TRDA 2F0WA 3BDCA 3SK6A 3MZ5A 3NQTA 3P75A 1SNCA 3ITPA 1EZ8A 4KY5A 5CV5A 5J22A 1KDBA 2F0KA 5C6AA 1JORA 3NUCA 1JOOA 3D6CA 5IGEA 4WORA 2F0LA 2F3VA 4N9PA 4RKLA 1EY5A 3U9OA 4IZ8A 1EY9A 4K14A 5I6YA 4KTAA 5EKLA 2EYLA 4R8NA 3SK8A 4EQOA 5KRUA 1SNPA 5DAUA 5C4ZA 4ZUIA 3RUZA 5IODA 1EY8A 1EYAA 3NK9A 3HEJA 2SNSA 5KIXA 1KABA 3TP8A 1NSNS 3V2TA 5C5MA 5HURA 2KHSA 4F7XA 2PZWA 3EROA 2F0OA 4I65A 5CR3A 4WRDA 3TP5A 4H7BA 2OF1A 2M00A 4K5XA 4DFAA 4B9XA 3SK5A 3SR1A 1SYBA 5CV6A 1SYGA
chains in the Genus database with same CATH superfamily
3HKZB 2CWAA 2MO0A 1J5EQ 2X6GA 1SE8A 3VYRA 4DV6Q 4FYDA 3L2PA 3T16A 3S1NB 1SE4A 4DV3Q 4JI1L 2C35B 3GTJH 2N88A 1VQOA 2KCMA 3URYA 3T4AC 1CZWA 3OWFA 4LAAA 2CCZA 2JXMB 3LX0A 3PGZA 4A3KB 1MSGA 3KLSX 1JOQA 2V4DA 3F2BA 4L8JA 5FLXE 3HGBA 3F1ZA 5DM63 2N3SA 1VQKA 3S1QH 4XQJA 2LY7A 4OWXB 2JJQA 1DD2A 5GAGC 2B3GA 3DWPA 4RA8A 2MQHA 4OGQC 4M1UB 1L1OA 2NVYB 5JEAH 1RIPA 4KD3A 1XYIA 1HR0Q 2WAQB 4B3TQ 1TXYA 2NYZD 2E2HH 3OOCA 1X3QA 3A5UA 4IUVA 4B9WA 3T1HL 1M90C 3I7FA 3OPOA 4HJAA 1ASZA 4HSPA 1HZ9A 1LTBD 3BVGA 1SYCA 1H9SA 3S1RB 2Z8LA 1B8AA 2AQ1B 3NQIA 4DR4Q 3PO2B 1CUKA 3L3OC 5GROA 3N6RA 4JI2L 4K8JA 1YJNA 4CDEC 1VS0A 1FGBD 1CA5A 2F0JA 1JCKB 4ODGA 2KCNA 2N78A 2BDNA 2RSNA 2MUYA 1MJCA 2AWOA 4KK7A 5IT9c 1D5MC 3DUZA 1SEBD 3ITPA 2R7ZB 1DOKA 4O1NA 3D4RA 2M9VA 1WTQA 1KNAA 5A35A 4R4OA 5I6YA 2D9UA 4DV2L 3KLRA 1KD1C 5C4ZA 1CKNB 4DR1Q 1KABA 5CMDA 4H02A 3I55A 1R9TH 4OWTB 1TWFH 5CBEE 4WJ4A 1EOVA 5EQ0A 4JI0L 1V1QA 3CKIB 3OIQA 2UXDQ 3S2DB 1PA6A 2XIWA 4XT3B 1CKMA 3KDFB 1A2TA 4DR5L 1Q1EA 3I8ZA 2KVMA 3HP3A 2EYMA 1ASYA 4DR7L 2OEOA 3E3XA 1RF2D 3H0GH 5C4HA 2VQFL 1VQHA 2IW3A 2B2YA 4CKEA 2WAQE 3BZKA 1MKHA 3DMUA 5GAHC 1QVFA 5DM73 3FRPB 4DV1Q 4JBKA 3SK4A 2GN5A 3DEOA 2SNMA 4IURA 4JI4Q 4A3GB 2EY2A 4A4IA 1KNEA 1UUPA 4G57A 5IOCA 1TWGB 2K32A 2BDOA 4RMFA 4HN7A 3S9WA 2YTYA 1STYA 2A5HA 4J8QA 2VQEL 2RQXA 3BZCA 1V8QA 1I4RA 4YY3L 4N8X1 1SXTA 3VYTA 3VR2A 4BA2I 1VQGA 2JA8H 3VA7A 1F2ZA 1X55A 3P7JA 3J7AV 3SGIA 1CKNA 3ND9A 4X66Q 2F0MA 2O5JC 5CV7A 1ICWA 5HY6A 3QOJA 1WTRA 1EY4A 3I90A 4AQYL 2ZXOA 3TREA 2AUJD 1U5KA 1ET9A 3A0JA 3CMEA 1HNWQ 1VF7A 2L12A 4C3JB 4Z9CB 5IGFA 1XPOA 1SYEA 1VQCA 1DXMA 3MXGA 2B2UA 1CHQD 1CZGA 5LMUL 3NBHB 3MVVA 3HKSA 2IPKD 1TWAH 1DZ1A 4X64L 3MXPA 2B2UC 2K04A 4FF2A 3U50C 1N36Q 3Q22A 1HNZQ 2MNAA 3RZDH 2MO1A 1RTNA 3MC0B 4IFDG 3G4SA 3J7AF 2EYLA 2UXBL 3WOFA 1DJRD 1DOMA 1KQSA 4EQOA 4LK1C 4R1JA 2R93H 5A2QE 1KC8C 2BOSA 1IKMA 1NSNS 2O5IC 4A93G 3M4OH 2PZWA 1BCPD 4H13C 5CR3A 3TP5A 1X3GA 4KHPL 5K36H 3CC2A 1STAA 4TSSA 4UAIA 2ZTDA 4IOAA 3RN5A 1VMCA 3EQLC 4UDUC 4LF5L 3ULLA 3TP7A 1EYCA 4NXML 4JG2A 3JAML 1LT3D 4DAPA 1J9OA 5JOBA 2EXDA 3GTQH 3H3VH 3NP8A 4QIWB 3QO2A 1RKNA 4IFDI 3PO3B 2UUBL 4BBSH 4DV5L 2UU9L 3BYYB 1TQOA 2KENA 1X32A 1S3OA 3TS0A 1STBA 1O80A 4ZUJA 4HMIA 1GKHA 2B39A 1RDPD 2UXCQ 1N34Q 3FMCA 3NBHA 1S72A 5M9OA 1LUZA 2ICIA 1CI3M 2XSCA 4E6IA 2SEBD 1FGUA 2NZ1D 3CC7A 3T1YQ 3K7UC 3RLFA 3UDXA 1G51A 4UP8A 4RG1A 4K2LA 2WACA 3GTGH 4ZAIA 4UPAA 1ZYRC 2FMCA 1E1OA 2MHVA 3HOWH 4LF4Q 1S5DD 3H6MA 4DV7L 1BOSA 4DK6C 1NUCA 4Y7NH 1QNUA 3H94A 2L55A 4A3MH 2F0QA 4DR6L 2N49A 4YCUA 5KEEA 3CQZH 4BY7B 4DR3L 4FNFA 1TU2B 4GKJQ 2FJ2A 1IYJB 2NZHA 3TS2A 4OONA 4MN3A 3J80c 4BWGB 1ILPA 1GUOA 3EBEA 3HOXG 2F4IA 3SK6A 1PMRA 3GTPB 3OYYA 1EZ8A 4POGA 4KHZA 5KNDA 4A3EH 3TDQA 1I94L 2JE6I 4A3IG 4LFCQ 5ELFA 4I7ZC 4QIWE 3TRZA 1MJEA 4O42A 3S14B 3K0XA 4P75A 1XMQQ 3V2TA 2ZM6L 4F7XA 1Q82C 2EJGC 2HT1A 5I6WA 3H0GB 4G4KA 4X3UA 4GLXA 3W3AA 5LMNW 4HIDA 4I7AA 3K5NA 2OWOA 5K5PA 4JI3L 4U673 4GZYC 3OTOQ 3GTLH 2K5DA 2NVQB 2RCFA 1CKOA 1YI2A 2YU9B 5KYLA 5KNCA 1KAAA 2J0TD 5IP7G 1HNXQ 4IJLA 5BR8L 2HDLA 1II3A 3MHBA 1F77A 2L11A 3OMCA 4DXGA 5M3FB 1AW7A 1S5ED 4LUZA 1GUTA 5JPNC 1WD0A 3J81E 3MEHA 4NPSA 3PMFA 4A3JB 5IGDA 4R8IA 1LYLA 1TS4A 4IUNA 4U68A 3M4PA 2F4VQ 4V190 4IO9A 4DNTB 1NR4A 5M3MB 4JW0A 4HSVA 4RGMA 4CJ2C 2AMCB 1K83H 1AFPA 5E1FA 4YCVA 1Y1VH 5T1GA 1NAPA 1LTGD 3S2HH 4X65L 4DR2Q 1IHZA 2R92B 1UE1A 4JI7L 2YV5A 4NB3A 4KY6A 4KJNA 1ICFB 4NMZA 5JVG3 2LXJA 4LWCA 2JK8A 1F2YA 4PNYA 3MEFA 4B3SL 1WD1A 3Q0AA 4GOPB 2DJGC 1QZGA 1HTPA 2ZJQA 3P20A 2EYHA 1FD7D 1STNA 2OQ0A 4BY1G 1HQRD 4GLAC 1LTTD 4DKAC 4C2MB 3LGJA 3CC4A 3PF4A 2ZTEA 3FP9A 4C3IB 1TWAB 1Y8OB 3M3YB 4IFDJ 2PMZE 1UE5A 1YJ9A 1I3QB 2LMCB 2NWGA 3D4WA 3DXJC 1WI5A 1N9WA 1SNCA 3G6EA 1BR9A 3M4QA 5FK9C 4JI6Q 5CORA 5GAEC 4PQXA 4N9PA 1IBKL 4FXDA 1SFOH 1TKWB 2XRQD 2KOLA 1VQ5A 3SK8A 3M4OB 4OIKA 5KRUA 1K9MC 1AE2A 5GADC 2A6HD 5H1SE 5HURA 4FF4A 3K8AA 3MXNB 1PZID 3S15B 1FVIA 1HCZA 4S3SA 2VUMG 2K03A 2BA1A 2VB2X 3CXCA 4LFAL 1CSQA 1HUNA 2EXZA 1V1PB 1V1OA 4QMGA 3CU7A 3RLOA 4F8MA 5M5WH 1JJ2A 1TS3A 1H95A 2PW7A 4GOPA 2EE1A 5IYDH 1U9RA 4BXXG 1YEZA 2RKSA 4PMWA 4CDCC 1VQLA 5I9PA 1KDAA 1PH6A 4YWLA 4GOPC 4BA1I 1Y1WB 3S1MB 4DK3C 4UP9A 3HOUG 1FR3A 3OW2A 2NVTH 2VY3A 4B3RQ 4G7HC 4A3CG 1KHIA 2K5VA 1XTDA 3OIPA 1I4HA 5F2DA 2C9OA 4EQ5A 2JYOA 1TY2A 2A68D 1KXLA 4FO2A 3PIP3 3VR4A 4JI5L 4LF7Q 4OELB 2YTVA 3P1HA 1QB5D 3A5ZB 3H15A 4DAMA 1EY7A 4LF6L 1PRTF 4PZ7A 3BS1A 3ERQA 3KBXA 4A3FB 3E9HA 5DLQE 2BE5C 3PIPA 3R3OA 4L5TA 3T53B 4L5SA 2A73B 1STEA 3CPWA 3MXNA 1IL2A 1CM9A 1VQFA 4A3BG 3GD7A 4A93H 1E7ZA 1JE4A 3QR8A 5C4JH 1VMPA 2XGTA 3KFUA 3GDEA 4GN5A 5C44B 3DM1A 4HR7B 1Q7YC 2OCEA 4MHEA 1XNRQ 4A3EB 1I6HH 2D0OA 2Z0SA 3VA5A 1JJCB 4PV1C 2PCFB 3P75A 3NQTA 2WB1B 1I6VC 2KA7A 1L0WA 2KJXA 3H91A 2WIIB 4A3LG 1JORA 1K8AC 2P5ZX 3AFQA 5G3LD 3GTOH 5J3BA 4LFBQ 4JV5Q 5ELDA 1WCMB 1LTID 5DAUA 2WKCA 2ZT9C 2B8GA 5LMNQ 1N33Q 3TP8A 1YNNC 3CHBD 2EPBA 1AZQA 1P8LA 2UUAL 3GTMH 2QF7A 1TWHB 3RNUA 1JT8A 4DN4M 4BBRG 1ET6A 1TR5A 1L1OB 1BBXC 1MHWC 5AFWA 3M7NA 2F0UA 3UDGA 2IJ0A 1ESFA 3AU7A 4K5WA 1E2WA 4K6DA 1EIFA 1BF4A 3UE0A 5BN5A 2MPMA 2ENBA 4G7OC 3FEWX 1PFMA 3X3NA 4EQPA 3K5MA 4RKBA 2CQAA 1LLRD 1PRTB 2A69D 2F0GA 1EYGA 3ULJA 3I4NB 1RODA 4EX5A 1PH1A 2QILA 2EIFA 2OTLA 1U0LA 1R4QB 2IT1A 3K0YA 4CBVA 5ELBA 2ZXPA 1ZXTA 5IGBA 1PTOH 1Y1VB 5CBAE 4YIJA 3I4MB 3S2HB 1SJHD 1MGSA 2XVSA 3A8KE 1TVXA 5IIFA 3QWNA 4LF8L 3QIAA 1SNQA 3BG3A 3HOXH 2M2LA 5M5YB 4WJWA 3PIO3 1ZEQX 4ULLA 1TWCH 2K5WA 4KHVA 2B63G 1LT5D 1RHPA 2WB1E 1Q86C 2JA7G 4A3IH 2PNRC 5C4XG 3CCVA 3GTKH 5IT9E 3OW7A 3V05A 2PPBC 2HCCA 1YNJC 3OWEB 3D4DA 1JMCA 1X56A 1PTOD 4P2CB 3PIOA 4IPHA 2EYFA 3QOLA 4DPGA 2ZJPA 3T56B 2JA5G 4KKTA 3KF8B 1L1OC 1Y14B 3IFDA 3HG9A 1X54A 1SYDA 5NUCA 2JA6G 1F9SA 2VXWA 1W3SA 4JI1Q 4B3ML 3HOZB 5IGEA 4R4QA 4J15A 4RGOS 1NTGA 1IBLL 1Q90A 2JA9A 1PRTC 1O7IA 5IP7H 1EOTA 1JJGA 1D7QA 3R2IA 1C7YA 5KIXA 1NNXA 1VQEA 3OHXC 3AQQA 1O78A 4X3TA 2MJ8A 1UNSA 3KJPA 2Q8TA 2R7FA 4OIJA 3KUPA 1DGSA 1WFQA 3HKZE 5C3EB 4FXKC 1B9MA 2L4NA 4JC0A 4YHHL 2QEJC 3E0EA 4KV6A 3VR5A 5FOBB 1IZ6A 4IN3A 4B08A 4ZCKA 2GVAA 3HKZG 1UWVA 3BJUA 2EYJA 3PV0A 2Z4IA 2K5QA 1G8ZD 2QKIC 3N52A 4PMBA 2E2IB 1YBYA 3PSIA 3T1HQ 4JYAL 3FKIB 1FYCA 1PFBA 4L5QA 2F0TA 2KEDA 1GD7A 4A3KG 4LNQA 1I50H 1K3BC 4JCVE 2OXPA 2NVXB 3KF8A 1IBML 3U4ZA 4FVMA 4DK0A 1EIGA 1MD2D 1WYDA 3NPPA 2B8FA 5IE8A 2EDGA 2RDFA 5TSSA 4BY1H 5EPKA 3BZDB 4A3DB 2JN4A 1GUNA 4IUQA 1PHJA 2EVBA 4JI2Q 5D3DA 4HEDA 4HIOA 3JAMc 3EVQA 4R4IA 3QG1A 2XNAC 2EJFC 3RZOB 2B2YC 2VL6A 1NE3A 1VQ6A 3RR5A 2IHEA 3DM3A 5JVH3 1WTOA 2WAQG 3EA6A 4GS3A 2NZOA 1NBWA 2EYPA 4IPGA 3BVMA 2DY7A 5KYIA 1VQDA 1EIYB 1HH2P 1A63A 4MZ9A 3M85A 3F2UA 4DV2Q 1F2MA 3SEBA 4OX9L 1BBWA 4JYAQ 1Y8PB 1OO9B 1O7ZA 4RCNA 4TVAB 3PO2G 1I6HB 4JI0Q 3CCUA 2G9HD 2VUMH 4CDFC 1AN8A 3I73A 2HQEA 2SOBA 1NCVA 1SROA 2RDHA 2LS01 4RAUC 3DLLA 4DR5Q 1YHAA 1KDBA 3HOYB 2K05A 2Q2TA 3HOVB 4DR7Q 1VQPA 1EY5A 2VQFQ 3LNNA 4DV4L 2RHSB 1HUMA 4DUZL 4NW2A 2BH8A 1PH9A 3E9IA 2EQSA 1E22A 4ZUIA 3UE1A 3X3MA 2R7ZG 2L1BA 4C1NI 2FHTA 2K1BA 4RGNA 4HJ5A 1SDFA 4R4TA 3HOUH 2KHSA 4I65A 5EAYA 3E6ZX 1B3QA 4XYQA 1JE5A 4A3CH 5FLXL 1O7LA 3W5OA 2IX3A 4X3KA 1ILQA 4ZLTF 2CFMA 1A8VA 1PH7A 1OXUA 1N32L 2VQEQ 1UE7A 2FINB 4GKKL 2IL8A 4C3HB 1L2FA 4YY3Q 3FHWA 4M8AA 4LF9L 2QCPX 1B1ZA 5FJ8H 1IW7C 2HHHL 4RCOA 5IP9G 1CFMA 2JP1A 1B9NA 3UDIA 1VQAA 2F0PA 3IFTA 5AJ3L 4KY7A 3GTJB 2EJMA 1PH2A 1VQ4A 3LWEA 4AQYQ 1SNDA 4A3BH 4TKOB 4A3GG 3VR6A 1U4MA 4RHRA 1ML0D 3OSOA 1I4PA 1WJJA 1SBBB 3S1QB 4P71A 1F2LA 2KECA 2YYZA 4IJHA 1FNWA 1LTRD 5LMUQ 1A3TA 4DA2A 2PYKA 2E2JH 1YITA 2I5MX 1BDOA 4X64Q 2F1MA 2CH4W 4A3LH 2XTIA 3NTKA 1JC7A 1D8LA 1BQQT 3EFXD 4DF7A 3J80E 1QVCA 2CWPA 1PZJD 1CQFA 5I2XA 5KNBA 2UXBQ 4NP5A 2NB0A 3ULPA 2E2HB 2DGYA 1EYDA 5CC4A 3JAMi 3STBD 3UI2A 2I5LX 4BBRH 4KHPQ 2LKVA 4C3JG 1E24A 5C3WA 1YHQA 1S5BD 1H9JA 1ONLA 4LF5Q 3G71A 3MZ5A 2AQ3B 3PUVA 1TIID 2VNUD 2CW0D 4NXMQ 2ZTCA 3RN2A 3K58A 4HIKA 4KTAA 4QJFA 1LT6D 1VQ7A 4ABNA 2GVBA 1EL0A 2UUBQ 1R4PB 4DV5Q 2UU9Q 3NSWA 1Z7TA 3NEMA 3NELA 4H7BA 3UDFA 1YHBA 2E76C 1KLGD 3K5OA 1SYBA 4HMJA 3EIVA 4PMCA 3O13A 4O0AA 3KLSA 5EBDA 2K6AA 4NDXA 2MP1A 3BDOA 2H5XA 3T13A 1STGA 1BCPF 3ICEA 1SMYD 1QZHA 1BKBA 1R9TB 1TWFB 2A6ED 3DEPA 1VCIA 3R2TA 2RCNA 3CD6A 4DNRB 4IALA 2Y0SB 1HFNA 2N8NA 1BUVT 3FPUB 3CMAA 1XNQL 2JA7H 2LSSA 3I2ZA 3SHLA 2R7DA 4K0KL 2K52A 5C4XH 4DUYL 3PO3G 1WTXA 1YIJA 4HJ9A 3D8GA 2WV6D 4DU9A 4DV7Q 3TEHB 2UUCL 2D0PA 3J7YW 4DR6Q 2AHOB 1GM5A 2A1AA 3TQYA 2JA5H 3NTIA 1JB3A 4DR3Q 5FO8B 3D0FA 3QJYA 4LW1A 3M7GA 1QVGA 4FP5D 1K8OA 3K81C 3J81j 2JA6H 2K01A 5L37A 1V43A 4HTHA 4HCSA 3PCOB 2D5DA 4CHTB 2QDBA 1D6EC 2QW7A 3TZUA 3K7AH 4TQUS 5J1ZA 5C5LA 4AYBB 1I94Q 3MA2B 1GXDC 2B2VA 2Q2IA 1X3EA 4HJ7A 5CV4A 4R9WA 2IHFA 3PUYA 2JA8B 4ME5A 4L6TB 1XPUA 3ER0A 2V1CC 2ZM6Q 4KD4A 4XYOA 2H4OA 1XMOL 4NKLA 2F0NA 3VR3A 4YCWA 1HHVA 3CCJA 4BY7G 5ELEA 1BBUA 3V96A 5A2QL 2ZJRA 4HJ8A 4TRDA 3BDCA 2F3VA 4RKLA 2E5LL 1GUSA 4JI3Q 3S1NH 3ZYYX 4K14A 4DV0L 1VQMA 1S5FD 1BCPB 3C2PA 1SNPA 1C4QA 2Y0SE 2I5HA 5BR8Q 1SN8A 2L5TA 3EROA 2B29A 2OF1A 4ZK9B 3ZJYC 4B9XA 2EZVA 3NHHA 3RZDB 5EBCA 4K2KA 3A54A 2RSOA 4KN4C 5JJKA 1G2SA 2R93B 1M1KC 3A7AB 3KK7A 3H0GG 2F0DA 2HIVA 3K6OA 2NVYH 4JI8L 2PQAB 4UY8C 1PH8A 5EPJA 4X65Q 5HGQA 1B7YB 4RH6A 1PLFA 4JI7Q 1ENFA 2DJFC 2OQKA 3DWQA 2I07B 5CYUA 3GP7A 4B3SQ 4AYBE 1HZAA 4ALPA 1FJGL 4V0BA 4H44C 5M3FG 3GTQB 1QG7A 3NXWA 3S1RH 1EY0A 4RGTA 3NWTA 2R3ZA 1ZKOA 2A19A 4BBSB 3PO2H 3M9BA 2VW9A 4A3JG 2E2JB 5EKKA 1AH9A 4NXNL 5KGUA 3U4VA 4HCEA 2K4KA 1Z6HA 5COYA 5M3MG 2G5DA 1IXRA 4RFBA 1F9PA 4BS9A 1QOHA 3C1FA 1BCPC 5FKAC 2K5NA 1G2TA 2R92G 2K5HA 1V9PA 3Q24A 1JB7A 3MXUA 4K5VA 1IBKQ 3HRZC 2R7ZH 4OL7A 2LXKA 4F87A 5C3XA 2A8VA 1EEFD 1GHKA 2VB3X 2OTJA 1GJXA 1C8CA 3I72A 3KYHC 1Y8NB 1MIUA 3PF5A 3E5SA 3GTGB 5D14A 1A0IA 1SYFA 3RLNA 3HOWB 2PQAA 1DONA 5BN4A 2A74C 5T1IA 1OXTA 4C3IG 4Y7NB 3S2DH 4KY5A 5D65A 4LFAQ 5J22A 4Q5VA 4A3MB 4IFDH 4KKUA 3D6CA 2FMMA 2J7ZA 3CQZB 4KI0A 1AZPA 3NBIA 5IWAL 1PYBA 5FLMG 1E2ZA 1NMFA 3MAQA 5IP9H 3GQBA 3NK9A 2RA4A 3A55A 2SNSA 3HEJA 1JWUD 3GV3A 3RMHA 3BU2A 1MBYA 3PUZA 1EWCA 2RF4A 3GO5A 3H3VC 2K28A 4QF4A 1DM0B 4A3GH 4CJ1B 1YVCA 1D1KA 2QEXA 2LFNA 2AQ2B 3CCQA 2ASBA 4Y52H 2AWNA 1TWGH 3ERSX 4JI5Q 3ONAB 1EU4A 2G9DA 5D3IB 3J81L 3Q6SA 3KF6B 1KAWA 1KIXA 2F0EA 3SE0A 4LF6Q 1KL9A 4QUFA 1EFWA 2WKDA 2IY5B 2HUGA 2PQEA 1GUWA 4P74A 4X62L 4N9TA 2NBFA 4DNIA 1J5EL 4DV6L 2NTSA 2Z1CA 1EQVA 1Q1BA 3AMUA 4DV3L 1Y1WG 3GTLB 2YTXA 1JWSD 1YZ6A 2KHIA 3PUXA 4FF3A 3M4YA 4OEMB 3AB9A 3KBGA 4PG3A 4UP7A 3J81i 4KJOA 4C3JH 4LJZC 4XTCS 3MWYW 1S40A 1HA6A 5CGKA 3CCSA 2OT2A 1D1IA 3H3VI 2X69A 1KRTA 2K50A 3I4OA 1I5FA 4PZ8A 3IRBA 4YWKA 1PXUA 1O7YA 5FO9B 1X9NA 4A3FG 2K14A 3K59A 1K83B 1K28A 2WP8J 1A2UA 2XWJB 3VDYA 2D62A 4JVZA 2Z9HA 1I4QA 1HR0L 4B3TL 2B2TA 2AUKA 3B6YA 1LABA 3L9AX 3CCMA 3KLWA 3KF6A 2UUAQ 2B2TC 3G6JB 2MFIA 2PI2A 1RL2A 1LACA 1HPCA 2E8GA 1L0YB 5C44G 1SE3A 4WORA 4DR4L 3FPPA 3NWSA 1EY9A 1QCBD 3MFYA 1J8IA 4A3EG 5EKLA 1DCZA 4P73A 3W2DA 2L15A 2PI2E 2WB1G 3PUWA 1RJTA 1EYAA 1U4RA 4KLKA 1PFNA 3ND8A 2NN6G 1LM0A 1ZYRD 1JWMD 4WRDA 3PO3H 4ZKBB 1WCMG 2Q2UA 1X6OA 5G3LF 5IY0A 1QJOA 1I4GA 2SDFA 1Q81C 1SFOB 1UAPA 1B3AA 3CPFA 2KBNA 3CCLA 5M5XH 2F0SA 3EJIA 1TT2A 4OHJA 1VQ8A 1T5XD 4DR1L 4LF8Q 1PVOA 2JEAI 4P72A 1WTWA 1Q3LA 1VQ9A 2D2CC 5JAVA 4XIGS 4R4CA 3LWUA 5BN3A 2UXDL 3JAME 4PZ6A 1HJPA 2NN6I 3CW2C 1B50A 3CAMA 2WFWA 4FDBA 3EN2A 5M5WB 4O2DA 1U4PA 3TSSA 5FLXc 3I4NG 4HIMA 1C48A 1VF5C 2PZTA 4QY7A 4GN4B 5IYCG 1Z47A 1U4LA 4CKBA 4LUVA 1UEAB 1ESRA 4BY7H 1Y1VG 4DV1L 4DGZA 2NVTB 1M4VA 3KOJA 3TZDA 1Z9FA 3I4MG 2ZXRA 2RBMA 1EY6A 2A6HC 4JI4L 1QNKA 1N8RC 1GHJA 4B3MQ 1FL0A 2QDLA 5EKIA 4JK1C 1IBLQ 3Q8DA 3GTPH 2L0CA 4CDDC 4EQNA 1BXTA 4RWSC 2E75C 3S24A 2O2LD 1Q8IA 5I2YA 3CF5A 1C0AA 1MI2A 3R93A 3S14H 2HQLA 4APVA 3C1EA 4MNOA 5IYBG 4GN3B 4QGUA 4X66L 1HZBA 4YHHQ 3SDZA 1PTOF 2KCCA 2DNEA 2PNHA 4DK1A 5JPMC 4A93B 4XQNA 4IZ8A 4L5RC 5C4JB 4R8NA 2R61A 1HNWL 1BNZA 1K0RA 2JEBI 1EY8A 1F9RA 2A68C 3HOZG 2KHJA 2NVQH 1PYSB 2YU9H 1NMGA 2I46A 1G6PA 1IBMQ 1EIHA 5M3FH 5E7NA 5E3FA 1N36L 4GNXB 3GTOB 2NUCA 1SE2A 1HNZL 5E4WC 4XQQA 1S4ZA 2ALYB 5ELCA 4A3JH 5C3EG 1PFSA 4Q0FA 5M3MH 4BXXH 1PDQA 5JJLA 1MSHA 1K8GA 1EQQA 2TSSA 3GTMB 4IUTA 1D2BA 1SNOA 5IYDG 3VYUA 1SNMA 3BDLA 2I0QA 2HDMA 2FXQA 2R92H 2IWHA 3PQIA 5ELNA 2ID0A 4K8IA 4X6AH 4YWMA 2EY6A 4OO1G 1LV9A 2B2WA 1X3FA 4IPDA 5HGTA 4N8FA 3D31A 3FKIG 1D5ZC 3KDFA 4JPBW 3S16H 1QILA 2B2WC 2IX1A 4WJ3M 5EPLA 4QCLA 1B2TA 2R6GA 4OX9Q 1EEID 5IT9L 2Z4HA 4C2MH 1EUJA 4A3DG 1KDCA 4C3IH 3W1BA 4POFA 1YNXA 3CRLC 3M3YH 3TP6A 4ID6A 4EGVA 1E2VA 1PTOB 2C5CA 1I3QH 1LO5D 1WTHA 2UXCL 3VYSA 1N34L 5FLMH 4X3SA 1W2BA 4QQBX 4OO1I 1K0SA 5DNFA 4DV4Q 4HAEA 1GOZA 4DUZQ 1EWIA 2CH4A 1TS2A 4GNXA 4F88A 2F0FA 3DHQA 3HOXB 2EOTA 1XJVA 1W6KA 2DN8A 4KKSA 2RHQB 2X6LA 3T1YL 3CCRA 1JQYD 1TWCB 4FXGC 1JICA 5FO7B 4GNXC 1G291 3D3RA 3MTSA 1WOCA 1S5CD 4IUPA 2JSOA 4A3IB 3JC66 2A69C 3GTKB 3L0OA 3S15H 4LF4L 2E74C 1JOOA 1N32Q 1K73C 3U9OA 4GKKQ 1CSPA 1H9KA 1GO3E 2Q8IB 4LF9Q 3KJOA 4DAVA 3HOYG 2BE5D 1JR0D 2HHHQ 3HOVG 4GKJL 2DY8A 2HD3A 5C5MA 1XX8A 4FF1A 4K5XA 3R8BA 5JJZA 3SVMA 5AJ3Q 3A8IE 2XRSD 4J1MA 5M5XB 1STHA 1Y1WH 3S1MH 1A6XA 1XXGA 4JBWA 1RTOA 3AFPA 1IL8A 4IQZA 4CGYB 4ZKCB 3C46A 4LFCL 5DEHA 5C0XG 1QUQB 1BVSA 3A74A 4KMUC 5EGTA 1AE3A 1XMQL 1PTOC 4GLVB 4C3HG 2Q8RE 5JJIA 3F2DA 1Y69U 3FDTA 4A3FH 3J7A5 1HFGA 3IL8A 3NTHA 1X65A 2DNCA 1T5EA 1UEBA 1YNND 1P16A 1HQMC 3S17H 3OTOL 2ES2A 3G7LA 3L7ZC 3FVQA 1HNXL 5C0XI 2F3WA 2MGSA 1I50B 2NTTA 3RD4A 1RCVD 2QA4A 2B63H 1KRSA 4IUUA 5C44H 1WTVA 2PW5A 1SJED 3I70A 4BY1B 3IKJA 1ENCA 1PV4A 2F4VL 1GVPA 2JQOA 4A76A 1PYWD 1PH3A 2NN6H 1EQRA 3I56A 5JEAG 3J7ZC 1HTLD 1LTLA 4QB4A 1OXXK 1WCMH 4LUOA 4DR2L 2PMZB 2QGQA 4MTNA 3A8JE 1QUQA 4JBMA 1B44D 4LMQD 2HIXA 3F8TA 1TWHH 2FFKB 1F9QA 5C6AA 4QL5A 1H9MA 2F0LA 1OXVA 2L9HA 5IODA 4G7ZC 2N55A 1IYVA 2HCIA 2VUMB 2KUMA 2B2VC 2F0OA 1XNQQ 1M8AA 4QUCA 3SK5A 2Q2HA 5CV6A 4K0KQ 1SYGA 3NENA 4DUYQ 2XWBB 1YNJD 3I4NH 4EVOA 4OWWB 4RHSA 2UUCQ 4JI6L 1GUGA 1TY0A 3TN2A 5IYCH 2F03A 4H0LC 1L0XB 4J6HA 1WTPA 1AEXA 1NY4A 3SXHA 1HA5A 4ZQ3A 3HOUB 2EY1A 3CRKC 4C56C 3I4MH 2F3IA 1T9HA 3A56A 3E0JA 3I3CA 4A3KH 2K33A 1DYQA 1W6JA 3TMEA 1NJIC 1VQBA 1BO0A 5M5YH 1FNVA 3G48A 3S16B 1EQTA 2Y0SG 1PRTD 1CHPD 1J6QA 1K8MA 3MFGA 2DUDA 2K75A 4DAYB 2EYOA 4DXFA 2KQ3A 5IGCA 3J80L 2XN9C 1QWYA 4A75A 1CTMA 2VZAA 3BYTB 5CV9A 5IYBH 3J81c 3HFZB 1XMOQ 3W1GA 2AKWB 1IKLA 1KLUD 3WDNA 4IPCA 1A15A 4ME3A 5IGGA 2CKZB 4A3BB 5EJWA 1B70B 1EZ6A 1HR0W 1CK1A 2PZUA 1Q46A 2VS1A 4B3RL 4MIUA 2E5LQ 2E2DC 1PH5A 1KTKA 2KCTA 1LTSD 4DV0Q 3HOZH 2RDGA 4LF7L 3DWAA 3IAYA 2O4XA 2H1EA 1PH4A 1C9OA 1SSOA 1A3VA 1SR3A 4AYBG 3J80i 3D6WA 1CA6A 3CP0A 1TS5A 5E4XA 1G91A 1OTCA 1HXYD 2IX0A 2JA8G 3I4LA 3OMGA 3AYHB 2F0IA 2WINB 5LHY1 1E1TA 4UHVA 1VDZA 2CQOA 2F0KA 5C3EH 1IYUA 3NUCA 4ZRZA 4CJ0B 1WVLA 1VQJA 2TMPA 1SRUA 1B4OA 3U58A 1DOLA 5LL6X 4JI8Q 3RUZA 1EU3A 4BBRB 5LL6S 3GV6A 4CKCA 1K3RA 4DAYA 1D5XC 4DFAA 1RD9D 2E2IH 2BH2A 4OO1H 2M00A 1QE6A 5C0XJ 3AEVA 5J39A 1XNRL 1OXSC 1B53A 1E0BA 3FKIH 1XWEA 1FJGQ 3BVZA 4JOIA 2ATWA 3H09A 3C3LA 2NVXH 2EY5A 2KEEA 4XDXA 2CVRA 4XXEA 2F0HA 4LFBL 4JOIC 4JV5L 5I9OA 4AH6A 4A3DH 4NXNQ 2Z6KA 2Z6BA 1I4XA 3WOEA 4L63B 5LMNL 1N33L 2R93G 5FJ8G 1NR2A 1AP0A 1Q12A 2Z6KC 2GA4B 3U9SA 3RZOH 1CQVA 3STBC 4XT1B 3K5LA 1JOKA 3I91A 5K36G 5ISRA 1XPRA 2F52A 4JBJA 1PZKD 1EFID 3S17B 1YJWA 1H9RA 2F0VA 2CW0C 1CT1D 1XTCD 1V1PA 2B63B 1G6ZA 1Q8KA 2BCOA 1SMXA 2JA7B 4C1NK 1VQIA 2CHBD 1HRJA 1LTAD 5C4XB 1A62A 1X3PA 4BBSG 1EWHA 2RVLA 4IOCA 5JEAJ 1ENAA 2ICEC 2BA0A 3Q23A 2JA5B 4AIMA 3QB3A 5IWAQ 3HOYH 1SAPA 1IW7D 3HOVH 1A3UA 4ILWA 3A7LA 3K57A 5CV8A 3HZXA 1E3PA 1HZCA 2JA6B 4WFN3 3NE5B 3F2CA 1SMYC 4K6LA 4MTKA 1LT4D 2A6EC 3WWVA 1SLJA 3K7AB 1FNUA 3HS0C 2F0WA 5CV5A 3CCEA 3K80C 4ZYSA 5C0XH 3HOWG 5ELOA 2PO4A 1VQNA 2J4XA 3T51B 5I4DA 4A3MG 2K7VA 4C3HH 4OXPA 1UE6A 1H9SB 5GQOA 4X62Q 3TBIB 4KN7C 3SR1A
chains in the Genus database with same CATH topology
3HKZB 4FYDA 2X6GA 3VYRA 3T16A 3S1NB 1SE4A 2N88A 3URYA 3T4AC 1CZWA 3OWFA 4LAAA 2JXMB 3LX0A 4A3KB 1MSGA 3KLSX 1JOQA 2V4DA 4L8JA 5FLXE 3HGBA 5DM63 4XQJA 2LY7A 1DD2A 3DWPA 4RA8A 4OGQC 4M1UB 2NVYB 5JEAH 4KD3A 1XYIA 2WAQB 2NYZD 3OOCA 1X3QA 4IUVA 4B9WA 3OPOA 4HSPA 1LTBD 3BVGA 1SYCA 1H9SA 3S1RB 2Z8LA 2AQ1B 3NQIA 3PO2B 3L3OC 3N6RA 4K8JA 1CA5A 1FGBD 2F0JA 1JCKB 4ODGA 2KCNA 2BDNA 2RSNA 2MUYA 2AWOA 4KK7A 1D5MC 3DUZA 1SEBD 3ITPA 2R7ZB 1DOKA 4O1NA 3D4RA 2M9VA 1WTQA 1KNAA 5A35A 5I6YA 2D9UA 3KLRA 5C4ZA 1KABA 5CMDA 5CBEE 5EQ0A 3CKIB 3OIQA 3S2DB 2XIWA 4XT3B 1A2TA 1Q1EA 3I8ZA 2KVMA 3HP3A 2EYMA 2OEOA 1RF2D 5C4HA 2IW3A 2B2YA 4CKEA 3DMUA 5DM73 3FRPB 3SK4A 3DEOA 2SNMA 4IURA 4A3GB 2EY2A 1KNEA 1UUPA 4G57A 5IOCA 1TWGB 2K32A 2BDOA 4HN7A 3S9WA 1STYA 2A5HA 4J8QA 2RQXA 1V8QA 1I4RA 1SXTA 3VYTA 3VR2A 4BA2I 3VA7A 1F2ZA 3P7JA 3J7AV 3ND9A 2F0MA 2O5JC 5CV7A 1ICWA 3QOJA 1WTRA 1EY4A 3I90A 2ZXOA 2AUJD 1ET9A 1VF7A 2L12A 4C3JB 4Z9CB 5IGFA 1SYEA 1DXMA 3MXGA 2B2UA 1CHQD 1CZGA 3MVVA 2IPKD 1DZ1A 3MXPA 2B2UC 2K04A 4FF2A 3Q22A 1RTNA 3MC0B 4IFDG 3J7AF 2EYLA 3WOFA 1DJRD 1DOMA 4EQOA 4LK1C 5A2QE 2BOSA 1IKMA 1NSNS 2O5IC 2PZWA 1BCPD 4H13C 5CR3A 3TP5A 5K36H 1STAA 4TSSA 4UAIA 1VMCA 3EQLC 4UDUC 3TP7A 1EYCA 3JAML 1LT3D 4DAPA 1J9OA 5JOBA 3NP8A 4QIWB 3QO2A 1RKNA 4IFDI 3PO3B 3BYYB 1TQOA 1X32A 1STBA 1O80A 4ZUJA 4HMIA 2B39A 1RDPD 3FMCA 3NBHA 5M9OA 2ICIA 1CI3M 2XSCA 4E6IA 2SEBD 2NZ1D 3RLFA 4K2LA 2WACA 4ZAIA 1ZYRC 2FMCA 2MHVA 1S5DD 3H6MA 1BOSA 1NUCA 1QNUA 3H94A 2L55A 2F0QA 5KEEA 4BY7B 1TU2B 4FNFA 2FJ2A 4MN3A 4BWGB 1ILPA 1GUOA 2F4IA 3SK6A 1PMRA 3GTPB 1EZ8A 4KHZA 5KNDA 3TDQA 2JE6I 5ELFA 4I7ZC 4O42A 3S14B 3V2TA 4F7XA 2EJGC 5I6WA 3H0GB 4G4KA 4X3UA 3W3AA 3K5NA 5K5PA 4U673 4GZYC 2K5DA 2NVQB 2YU9B 5KYLA 5KNCA 1KAAA 2J0TD 2HDLA 1II3A 3MHBA 1F77A 2L11A 3OMCA 4DXGA 5M3FB 1AW7A 1S5ED 1GUTA 5JPNC 1WD0A 3J81E 3MEHA 3PMFA 4A3JB 5IGDA 4R8IA 1TS4A 4IUNA 4U68A 4V190 4DNTB 1NR4A 5M3MB 4HSVA 4RGMA 4CJ2C 1AFPA 5E1FA 5T1GA 1NAPA 1LTGD 1IHZA 2R92B 4KY6A 4KJNA 5JVG3 4NMZA 4PNYA 1F2YA 1WD1A 3Q0AA 1HTPA 3P20A 2EYHA 1FD7D 1STNA 1HQRD 1LTTD 4C2MB 4C3IB 1TWAB 1Y8OB 3M3YB 4IFDJ 1I3QB 2LMCB 2NWGA 3D4WA 3DXJC 1SNCA 1BR9A 5FK9C 5CORA 4PQXA 4N9PA 4FXDA 1TKWB 2XRQD 2KOLA 3SK8A 3M4OB 4OIKA 5KRUA 2A6HD 5HURA 4FF4A 1PZID 3S15B 4S3SA 1HCZA 2K03A 2BA1A 2VB2X 1HUNA 2EXZA 1V1PB 1V1OA 4QMGA 3CU7A 4F8MA 1TS3A 2PW7A 2EE1A 1U9RA 2RKSA 4PMWA 5I9PA 1KDAA 1Y1WB 4BA1I 3S1MB 1FR3A 4G7HC 3OIPA 1I4HA 5F2DA 2C9OA 2JYOA 1TY2A 2A68D 4FO2A 3PIP3 3VR4A 3P1HA 1QB5D 1EY7A 1PRTF 3BS1A 3ERQA 3KBXA 4A3FB 2BE5C 3R3OA 3T53B 2A73B 1STEA 3MXNA 1CM9A 3GD7A 1JE4A 1VMPA 5C44B 3DM1A 4HR7B 4MHEA 4A3EB 3VA5A 4PV1C 2PCFB 3P75A 3NQTA 2WB1B 1I6VC 2KA7A 2KJXA 3H91A 2WIIB 1JORA 5G3LD 5ELDA 1WCMB 1LTID 5DAUA 2WKCA 2ZT9C 2B8GA 3TP8A 1YNNC 3CHBD 2EPBA 1AZQA 2QF7A 1TWHB 4DN4M 1ET6A 1TR5A 1BBXC 5AFWA 3M7NA 2F0UA 2IJ0A 1ESFA 3AU7A 4K5WA 1E2WA 4K6DA 1BF4A 5BN5A 2MPMA 2ENBA 4G7OC 3FEWX 1PFMA 3X3NA 4EQPA 3K5MA 4RKBA 2CQAA 1LLRD 1PRTB 2A69D 2F0GA 3I4NB 1RODA 2QILA 1R4QB 2IT1A 3K0YA 4CBVA 5ELBA 2ZXPA 1ZXTA 5IGBA 1PTOH 1Y1VB 5CBAE 4YIJA 3I4MB 3S2HB 1SJHD 1MGSA 2XVSA 3A8KE 1TVXA 5IIFA 3QWNA 3QIAA 1SNQA 3BG3A 2M2LA 5M5YB 4WJWA 3PIO3 1ZEQX 4ULLA 2K5WA 4KHVA 1LT5D 1RHPA 2PNRC 5IT9E 3OW7A 3V05A 2PPBC 2HCCA 1YNJC 3OWEB 3D4DA 1PTOD 4P2CB 2EYFA 3QOLA 3T56B 4KKTA 3IFDA 3HG9A 1SYDA 5NUCA 1F9SA 2VXWA 3HOZB 5IGEA 4RGOS 1Q90A 1PRTC 1EOTA 3R2IA 5KIXA 3OHXC 1O78A 4X3TA 2MJ8A 1UNSA 2Q8TA 4OIJA 3KUPA 5C3EB 4FXKC 1B9MA 2L4NA 2QEJC 4KV6A 3VR5A 5FOBB 4IN3A 4B08A 2EYJA 3PV0A 2Z4IA 2K5QA 1G8ZD 2QKIC 3N52A 4PMBA 2E2IB 3FKIB 1FYCA 1PFBA 2F0TA 2KEDA 2OXPA 2NVXB 3KF8A 4FVMA 4DK0A 1EIGA 1MD2D 3NPPA 2B8FA 2EDGA 2RDFA 5TSSA 5EPKA 3BZDB 4A3DB 1GUNA 4IUQA 2EVBA 5D3DA 4HEDA 3EVQA 3QG1A 2XNAC 2EJFC 3RZOB 2B2YC 5JVH3 1WTOA 3EA6A 2EYPA 3BVMA 2DY7A 5KYIA 3M85A 3F2UA 1F2MA 3SEBA 1Y8PB 1OO9B 1O7ZA 4RCNA 1I6HB 2G9HD 1AN8A 3I73A 2HQEA 2SOBA 1NCVA 2RDHA 2LS01 4RAUC 1KDBA 3HOYB 2K05A 3HOVB 1EY5A 3LNNA 1HUMA 4NW2A 4ZUIA 3X3MA 2L1BA 4C1NI 2FHTA 2K1BA 4RGNA 1SDFA 2KHSA 4I65A 3E6ZX 4XYQA 5FLXL 1O7LA 2IX3A 4X3KA 1ILQA 4ZLTF 1OXUA 2FINB 2IL8A 4C3HB 4M8AA 2QCPX 1B1ZA 1IW7C 4RCOA 1CFMA 2JP1A 1B9NA 2F0PA 3IFTA 4KY7A 3GTJB 2EJMA 3LWEA 1SNDA 4TKOB 3VR6A 1U4MA 4RHRA 1ML0D 3OSOA 1I4PA 1SBBB 3S1QB 1F2LA 2KECA 2YYZA 1FNWA 1LTRD 1A3TA 4DA2A 2PYKA 1BDOA 2F1MA 3NTKA 1JC7A 1BQQT 3EFXD 4DF7A 3J80E 1PZJD 1CQFA 5I2XA 5KNBA 2E2HB 4NP5A 2NB0A 1EYDA 5CC4A 3UI2A 2LKVA 4C3JG 5C3WA 1S5BD 1H9JA 1ONLA 3MZ5A 2AQ3B 3PUVA 1TIID 2VNUD 2CW0D 3K58A 4KTAA 1LT6D 4ABNA 1EL0A 1R4PB 3NSWA 1Z7TA 4H7BA 2E76C 1KLGD 3K5OA 1SYBA 4HMJA 4PMCA 3O13A 5EBDA 3KLSA 2K6AA 4NDXA 2MP1A 3BDOA 3T13A 1STGA 1BCPF 1SMYD 1R9TB 1TWFB 2A6ED 3DEPA 1VCIA 3R2TA 4DNRB 4IALA 2Y0SB 1HFNA 1BUVT 3FPUB 3SHLA 1WTXA 3D8GA 2WV6D 4DU9A 3J7YW 3NTIA 1JB3A 5FO8B 3QJYA 3M7GA 4FP5D 1K8OA 2K01A 1V43A 4HTHA 4HCSA 2D5DA 4CHTB 2QDBA 1D6EC 3TZUA 4TQUS 5J1ZA 5C5LA 4AYBB 3MA2B 1GXDC 2B2VA 5CV4A 4R9WA 3PUYA 2JA8B 4ME5A 4L6TB 4KD4A 4XYOA 2H4OA 4NKLA 2F0NA 3VR3A 1HHVA 5ELEA 3V96A 5A2QL 4TRDA 3BDCA 2F3VA 4RKLA 1GUSA 3ZYYX 4K14A 1S5FD 1BCPB 3C2PA 1SNPA 1C4QA 2L5TA 3EROA 2OF1A 4ZK9B 4B9XA 2EZVA 3NHHA 3RZDB 5EBCA 4K2KA 3A54A 2RSOA 4KN4C 1G2SA 2R93B 3A7AB 3KK7A 2F0DA 3K6OA 5EPJA 4RH6A 1PLFA 1ENFA 3DWQA 2I07B 5CYUA 3GP7A 4V0BA 4H44C 3GTQB 1QG7A 3NXWA 1EY0A 4RGTA 3NWTA 2R3ZA 1ZKOA 4BBSB 2E2JB 5EKKA 5KGUA 4HCEA 1Z6HA 5COYA 4RFBA 1F9PA 4BS9A 1QOHA 3C1FA 1BCPC 5FKAC 1G2TA 3Q24A 3MXUA 4K5VA 3HRZC 4OL7A 4F87A 5C3XA 1EEFD 1GHKA 2VB3X 1GJXA 1C8CA 3I72A 1Y8NB 3E5SA 3GTGB 5D14A 1SYFA 3HOWB 1DONA 5BN4A 2A74C 5T1IA 1OXTA 4C3IG 4Y7NB 4KY5A 5D65A 5J22A 4Q5VA 4A3MB 4IFDH 4KKUA 3D6CA 2FMMA 2J7ZA 3CQZB 4KI0A 1AZPA 3NBIA 1E2ZA 3MAQA 3GQBA 3NK9A 2RA4A 3A55A 2SNSA 3HEJA 1JWUD 3GV3A 3RMHA 1MBYA 3PUZA 1EWCA 3GO5A 3H3VC 2K28A 4QF4A 1DM0B 4CJ1B 1D1KA 2LFNA 2AQ2B 2AWNA 3ONAB 1EU4A 2G9DA 5D3IB 3J81L 3Q6SA 2F0EA 3SE0A 4QUFA 2WKDA 2HUGA 2PQEA 1GUWA 4N9TA 2NBFA 2NTSA 2Z1CA 1EQVA 1Q1BA 3AMUA 3GTLB 1JWSD 3PUXA 4FF3A 3M4YA 3AB9A 3KBGA 4KJOA 4LJZC 4XTCS 3MWYW 1HA6A 5CGKA 2OT2A 1D1IA 2X69A 1PXUA 1O7YA 5FO9B 3K59A 1K83B 2WP8J 1A2UA 2XWJB 2D62A 1I4QA 2B2TA 2AUKA 1LABA 3L9AX 2B2TC 3G6JB 1LACA 1HPCA 1L0YB 1SE3A 4WORA 3FPPA 3NWSA 1EY9A 1QCBD 3MFYA 1J8IA 5EKLA 1DCZA 3W2DA 3PUWA 1RJTA 1EYAA 1U4RA 1PFNA 3ND8A 2NN6G 1ZYRD 1JWMD 4WRDA 4ZKBB 5G3LF 1QJOA 1I4GA 2SDFA 1SFOB 1UAPA 1B3AA 2F0SA 3EJIA 1TT2A 4OHJA 1T5XD 2JEAI 1WTWA 1Q3LA 2D2CC 5JAVA 4XIGS 3LWUA 5BN3A 3JAME 1B50A 2NN6I 5M5WB 1U4PA 3TSSA 1C48A 1VF5C 2PZTA 1Z47A 1U4LA 4CKBA 1UEAB 1ESRA 4DGZA 2NVTB 1M4VA 3TZDA 2ZXRA 2RBMA 1EY6A 2A6HC 1QNKA 1GHJA 5EKIA 4JK1C 2L0CA 4EQNA 1BXTA 4RWSC 2E75C 2O2LD 1Q8IA 5I2YA 1MI2A 3R93A 3C1EA 3SDZA 1PTOF 2KCCA 2DNEA 4DK1A 5JPMC 4A93B 4XQNA 4IZ8A 5C4JB 4R8NA 2R61A 1BNZA 2JEBI 1EY8A 1F9RA 2A68C 2I46A 1EIHA 5E3FA 3GTOB 2NUCA 1SE2A 5E4WC 4XQQA 1S4ZA 5ELCA 4Q0FA 1PDQA 1MSHA 2TSSA 3GTMB 4IUTA 1D2BA 1SNOA 3VYUA 1SNMA 3BDLA 2HDMA 2IWHA 2ID0A 4K8IA 4OO1G 2EY6A 1LV9A 2B2WA 5HGTA 3D31A 1D5ZC 1QILA 2B2WC 2IX1A 5EPLA 4QCLA 1B2TA 2R6GA 1EEID 5IT9L 2Z4HA 1KDCA 3CRLC 3TP6A 4ID6A 4EGVA 1E2VA 1PTOB 2C5CA 1LO5D 3VYSA 4X3SA 4OO1I 5DNFA 4HAEA 1GOZA 1TS2A 4F88A 2F0FA 3DHQA 3HOXB 2EOTA 1W6KA 2DN8A 4KKSA 2X6LA 1JQYD 1TWCB 4FXGC 1JICA 5FO7B 1G291 3D3RA 3MTSA 1S5CD 4IUPA 2JSOA 4A3IB 2A69C 3GTKB 2E74C 1JOOA 3U9OA 1H9KA 2Q8IB 4DAVA 2BE5D 1JR0D 2DY8A 5C5MA 1XX8A 4FF1A 4K5XA 3R8BA 5JJZA 3SVMA 3A8IE 2XRSD 4J1MA 5M5XB 1STHA 1A6XA 1XXGA 4JBWA 1RTOA 1IL8A 4IQZA 4CGYB 4ZKCB 3C46A 5DEHA 5C0XG 4KMUC 5EGTA 1PTOC 4C3HG 2Q8RE 1Y69U 3FDTA 1HFGA 3IL8A 3NTHA 2DNCA 1T5EA 1YNND 1HQMC 3G7LA 3L7ZC 3FVQA 5C0XI 2F3WA 2MGSA 1I50B 2NTTA 3RD4A 1RCVD 4IUUA 1WTVA 2PW5A 1SJED 3I70A 4BY1B 3IKJA 1ENCA 1PYWD 2NN6H 5JEAG 1HTLD 4QB4A 1OXXK 2PMZB 3A8JE 1B44D 4LMQD 2FFKB 1F9QA 5C6AA 1H9MA 2F0LA 1OXVA 2L9HA 5IODA 4G7ZC 2N55A 1IYVA 2HCIA 2VUMB 2KUMA 2B2VC 2F0OA 1M8AA 4QUCA 3SK5A 5CV6A 1SYGA 2XWBB 1YNJD 4EVOA 4RHSA 1GUGA 1TY0A 3TN2A 2F03A 4H0LC 1L0XB 4J6HA 1WTPA 1AEXA 3SXHA 1HA5A 4ZQ3A 3HOUB 2EY1A 3CRKC 4C56C 3A56A 3E0JA 3I3CA 2K33A 1DYQA 1W6JA 3TMEA 1BO0A 1FNVA 3S16B 1EQTA 1PRTD 1CHPD 1K8MA 3MFGA 2EYOA 4DXFA 2KQ3A 5IGCA 3J80L 2XN9C 1QWYA 1CTMA 3BYTB 5CV9A 1IKLA 1KLUD 3WDNA 1A15A 5IGGA 4A3BB 5EJWA 1EZ6A 1CK1A 2PZUA 4MIUA 2E2DC 1KTKA 1LTSD 2RDGA 3DWAA 3IAYA 2O4XA 2H1EA 1SSOA 1A3VA 3D6WA 1CA6A 1TS5A 5E4XA 1G91A 1HXYD 2IX0A 3I4LA 3OMGA 2F0IA 2WINB 5LHY1 1VDZA 2F0KA 1IYUA 3NUCA 4ZRZA 4CJ0B 1WVLA 2TMPA 1B4OA 1DOLA 5LL6X 3RUZA 1EU3A 4BBRB 5LL6S 3GV6A 4CKCA 4DAYA 1D5XC 4DFAA 1RD9D 4OO1H 2M00A 1QE6A 5C0XJ 5J39A 1OXSC 1B53A 1E0BA 1XWEA 3BVZA 3H09A 3C3LA 2EY5A 2KEEA 4XDXA 2CVRA 4XXEA 2F0HA 5I9OA 1I4XA 3WOEA 4L63B 1NR2A 1AP0A 1Q12A 2GA4B 3U9SA 1CQVA 4XT1B 3K5LA 1JOKA 3I91A 5K36G 5ISRA 1PZKD 1EFID 3S17B 1H9RA 2F0VA 2CW0C 1CT1D 1XTCD 1V1PA 2B63B 1G6ZA 2BCOA 2JA7B 4C1NK 2CHBD 1HRJA 1LTAD 5C4XB 1X3PA 1EWHA 2RVLA 5JEAJ 1ENAA 2ICEC 2BA0A 3Q23A 2JA5B 3QB3A 1SAPA 1IW7D 1A3UA 4ILWA 3A7LA 3K57A 5CV8A 3HZXA 2JA6B 4WFN3 3NE5B 1SMYC 4K6LA 1LT4D 2A6EC 3K7AB 1FNUA 3HS0C 2F0WA 5CV5A 4ZYSA 5C0XH 2PO4A 2J4XA 3T51B 5I4DA 2K7VA 1H9SB 3TBIB 4KN7C 3SR1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NHH A;  4PMC A;  4S3S A;  5I6W A;  4J1M A;  1STH A;  1TR5 A;  4K2K A;  4EVO A;  5E3F A;  2F0U A;  4KV6 A;  4NDX A;  4QF4 A;  1A2T A;  3T16 A;  3TP7 A;  2NUC A;  1EYC A;  2EXZ A;  4K5W A;  2EYM A;  4K6D A;  4QMG A;  2F0S A;  2OEO A;  3EJI A;  3T13 A;  2EY5 A;  4F8M A;  5C4H A;  1STG A;  4J6H A;  5K5P A;  3OWF A;  4LAA A;  1TT2 A;  2EYJ A;  2F0H A;  3LX0 A;  5DEH A;  1AEX A;  2ENB A;  3DMU A;  3SXH A;  5JOB A;  2PW7 A;  4ZQ3 A;  5I9O A;  2EY1 A;  2F0D A;  4EQP A;  2F0E A;  1JOQ A;  3NP8 A;  5KYL A;  1KAA A;  1RKN A;  1U9R A;  4PMB A;  4RKB A;  5EGT A;  4IAL A;  2RKS A;  1SNO A;  5JAV A;  1TQO A;  5I9P A;  1KDA A;  1II3 A;  2PQE A;  3SK4 A;  2F0T A;  1SNM A;  1STB A;  2F0G A;  2SNM A;  3BDL A;  3MHB A;  3OMC A;  4ZUJ A;  3TME A;  2F0P A;  2EY2 A;  4HMI A;  3SHL A;  4KY7 A;  4N9T A;  4K8I A;  2OXP A;  1JOK A;  2EY6 A;  4G57 A;  5IOC A;  3MEH A;  3PMF A;  5HGT A;  5IGD A;  3D8G A;  1EQV A;  5ISR A;  1SND A;  4DU9 A;  3S9W A;  4IUN A;  2RDF A;  5F2D A;  1STY A;  5M9O A;  5IGB A;  2F0V A;  3NXW A;  2EYO A;  2PZT A;  1EY0 A;  4YIJ A;  2KQ3 A;  4E6I A;  3OSO A;  4KD3 A;  5IGC A;  3P1H A;  5E1F A;  5J39 A;  5EKK A;  5IIF A;  5KGU A;  3EVQ A;  1EY7 A;  4KJO A;  5CV9 A;  1IHZ A;  1SNQ A;  2F3W A;  1A3T A;  4B9W A;  4DGZ A;  5CGK A;  1KDC A;  2PYK A;  4K2L A;  2WAC A;  1F2Z A;  3ERQ A;  4HTH A;  4KY6 A;  2RBM A;  4KJN A;  4NMZ A;  4PNY A;  1EY6 A;  1F2Y A;  3TP6 A;  4ID6 A;  3R3O A;  4KHV A;  1ENA A;  2F0M A;  2PW5 A;  3C1F A;  2EYP A;  5IGG A;  1STA A;  2QDB A;  5CV7 A;  1EZ6 A;  4DF7 A;  1SYC A;  2PZU A;  3QOJ A;  3H6M A;  1EY4 A;  5J1Z A;  1ENC A;  5C5L A;  5KYI A;  4MIU A;  1NUC A;  4K5V A;  2EYH A;  3QB3 A;  1STN A;  4EQN A;  1A2U A;  3D4D A;  2F0Q A;  4OL7 A;  1F2M A;  4NP5 A;  5C3X A;  2O4X A;  1A3U A;  5CV4 A;  5KEE A;  2EYF A;  3QOL A;  4K8J A;  1EYD A;  2F0F A;  3DHQ A;  3HZX A;  5CV8 A;  5CC4 A;  5IGF A;  4ME5 A;  1A3V A;  1SYE A;  2F0J A;  3E5S A;  4QB4 A;  4ODG A;  4KD4 A;  4NKL A;  2LKV A;  3C1E A;  2F0N A;  3MVV A;  1SYF A;  4HMJ A;  3D4W A;  2HQE A;  1SYD A;  2SOB A;  3MXP A;  3OMG A;  5NUC A;  2F0I A;  5C3W A;  3VA5 A;  4TRD A;  2F0W A;  3BDC A;  3SK6 A;  3MZ5 A;  3NQT A;  3P75 A;  1SNC A;  3ITP A;  1EZ8 A;  4KY5 A;  5CV5 A;  5J22 A;  1KDB A;  2F0K A;  5C6A A;  1JOR A;  3NUC A;  1JOO A;  3D6C A;  5IGE A;  4WOR A;  2F0L A;  2F3V A;  4N9P A;  4RKL A;  1EY5 A;  3U9O A;  4IZ8 A;  1EY9 A;  4K14 A;  5I6Y A;  4KTA A;  5EKL A;  2EYL A;  4R8N A;  3SK8 A;  4EQO A;  5KRU A;  1SNP A;  5DAU A;  5C4Z A;  4ZUI A;  3RUZ A;  5IOD A;  1EY8 A;  1EYA A;  3NK9 A;  3HEJ A;  2SNS A;  5KIX A;  1KAB A;  3TP8 A;  1NSN S;  3V2T A;  5C5M A;  5HUR A;  2KHS A;  4F7X A;  2PZW A;  3ERO A;  2F0O A;  4I65 A;  5CR3 A;  4WRD A;  3TP5 A;  4H7B A;  2OF1 A;  2M00 A;  4K5X A;  4DFA A;  4B9X A;  3SK5 A;  3SR1 A;  1SYB A;  5CV6 A;  1SYG A; 
#chains in the Genus database with same CATH topology
 3HKZ B;  2CWA A;  2MO0 A;  1J5E Q;  2X6G A;  1SE8 A;  3VYR A;  4DV6 Q;  4FYD A;  3L2P A;  3T16 A;  3S1N B;  1SE4 A;  4DV3 Q;  4JI1 L;  2C35 B;  3GTJ H;  2N88 A;  1VQO A;  2KCM A;  3URY A;  3T4A C;  1CZW A;  3OWF A;  4LAA A;  2CCZ A;  2JXM B;  3LX0 A;  3PGZ A;  4A3K B;  1MSG A;  3KLS X;  1JOQ A;  2V4D A;  3F2B A;  4L8J A;  5FLX E;  3HGB A;  3F1Z A;  5DM6 3;  2N3S A;  1VQK A;  3S1Q H;  4XQJ A;  2LY7 A;  4OWX B;  2JJQ A;  1DD2 A;  5GAG C;  2B3G A;  3DWP A;  4RA8 A;  2MQH A;  4OGQ C;  4M1U B;  1L1O A;  2NVY B;  5JEA H;  1RIP A;  4KD3 A;  1XYI A;  1HR0 Q;  2WAQ B;  4B3T Q;  1TXY A;  2NYZ D;  2E2H H;  3OOC A;  1X3Q A;  3A5U A;  4IUV A;  4B9W A;  3T1H L;  1M90 C;  3I7F A;  3OPO A;  4HJA A;  1ASZ A;  4HSP A;  1HZ9 A;  1LTB D;  3BVG A;  1SYC A;  1H9S A;  3S1R B;  2Z8L A;  1B8A A;  2AQ1 B;  3NQI A;  4DR4 Q;  3PO2 B;  1CUK A;  3L3O C;  5GRO A;  3N6R A;  4JI2 L;  4K8J A;  1YJN A;  4CDE C;  1VS0 A;  1FGB D;  1CA5 A;  2F0J A;  1JCK B;  4ODG A;  2KCN A;  2N78 A;  2BDN A;  2RSN A;  2MUY A;  1MJC A;  2AWO A;  4KK7 A;  5IT9 c;  1D5M C;  3DUZ A;  1SEB D;  3ITP A;  2R7Z B;  1DOK A;  4O1N A;  3D4R A;  2M9V A;  1WTQ A;  1KNA A;  5A35 A;  4R4O A;  5I6Y A;  2D9U A;  4DV2 L;  3KLR A;  1KD1 C;  5C4Z A;  1CKN B;  4DR1 Q;  1KAB A;  5CMD A;  4H02 A;  3I55 A;  1R9T H;  4OWT B;  1TWF H;  5CBE E;  4WJ4 A;  1EOV A;  5EQ0 A;  4JI0 L;  1V1Q A;  3CKI B;  3OIQ A;  2UXD Q;  3S2D B;  1PA6 A;  2XIW A;  4XT3 B;  1CKM A;  3KDF B;  1A2T A;  4DR5 L;  1Q1E A;  3I8Z A;  2KVM A;  3HP3 A;  2EYM A;  1ASY A;  4DR7 L;  2OEO A;  3E3X A;  1RF2 D;  3H0G H;  5C4H A;  2VQF L;  1VQH A;  2IW3 A;  2B2Y A;  4CKE A;  2WAQ E;  3BZK A;  1MKH A;  3DMU A;  5GAH C;  1QVF A;  5DM7 3;  3FRP B;  4DV1 Q;  4JBK A;  3SK4 A;  2GN5 A;  3DEO A;  2SNM A;  4IUR A;  4JI4 Q;  4A3G B;  2EY2 A;  4A4I A;  1KNE A;  1UUP A;  4G57 A;  5IOC A;  1TWG B;  2K32 A;  2BDO A;  4RMF A;  4HN7 A;  3S9W A;  2YTY A;  1STY A;  2A5H A;  4J8Q A;  2VQE L;  2RQX A;  3BZC A;  1V8Q A;  1I4R A;  4YY3 L;  4N8X 1;  1SXT A;  3VYT A;  3VR2 A;  4BA2 I;  1VQG A;  2JA8 H;  3VA7 A;  1F2Z A;  1X55 A;  3P7J A;  3J7A V;  3SGI A;  1CKN A;  3ND9 A;  4X66 Q;  2F0M A;  2O5J C;  5CV7 A;  1ICW A;  5HY6 A;  3QOJ A;  1WTR A;  1EY4 A;  3I90 A;  4AQY L;  2ZXO A;  3TRE A;  2AUJ D;  1U5K A;  1ET9 A;  3A0J A;  3CME A;  1HNW Q;  1VF7 A;  2L12 A;  4C3J B;  4Z9C B;  5IGF A;  1XPO A;  1SYE A;  1VQC A;  1DXM A;  3MXG A;  2B2U A;  1CHQ D;  1CZG A;  5LMU L;  3NBH B;  3MVV A;  3HKS A;  2IPK D;  1TWA H;  1DZ1 A;  4X64 L;  3MXP A;  2B2U C;  2K04 A;  4FF2 A;  3U50 C;  1N36 Q;  3Q22 A;  1HNZ Q;  2MNA A;  3RZD H;  2MO1 A;  1RTN A;  3MC0 B;  4IFD G;  3G4S A;  3J7A F;  2EYL A;  2UXB L;  3WOF A;  1DJR D;  1DOM A;  1KQS A;  4EQO A;  4LK1 C;  4R1J A;  2R93 H;  5A2Q E;  1KC8 C;  2BOS A;  1IKM A;  1NSN S;  2O5I C;  4A93 G;  3M4O H;  2PZW A;  1BCP D;  4H13 C;  5CR3 A;  3TP5 A;  1X3G A;  4KHP L;  5K36 H;  3CC2 A;  1STA A;  4TSS A;  4UAI A;  2ZTD A;  4IOA A;  3RN5 A;  1VMC A;  3EQL C;  4UDU C;  4LF5 L;  3ULL A;  3TP7 A;  1EYC A;  4NXM L;  4JG2 A;  3JAM L;  1LT3 D;  4DAP A;  1J9O A;  5JOB A;  2EXD A;  3GTQ H;  3H3V H;  3NP8 A;  4QIW B;  3QO2 A;  1RKN A;  4IFD I;  3PO3 B;  2UUB L;  4BBS H;  4DV5 L;  2UU9 L;  3BYY B;  1TQO A;  2KEN A;  1X32 A;  1S3O A;  3TS0 A;  1STB A;  1O80 A;  4ZUJ A;  4HMI A;  1GKH A;  2B39 A;  1RDP D;  2UXC Q;  1N34 Q;  3FMC A;  3NBH A;  1S72 A;  5M9O A;  1LUZ A;  2ICI A;  1CI3 M;  2XSC A;  4E6I A;  2SEB D;  1FGU A;  2NZ1 D;  3CC7 A;  3T1Y Q;  3K7U C;  3RLF A;  3UDX A;  1G51 A;  4UP8 A;  4RG1 A;  4K2L A;  2WAC A;  3GTG H;  4ZAI A;  4UPA A;  1ZYR C;  2FMC A;  1E1O A;  2MHV A;  3HOW H;  4LF4 Q;  1S5D D;  3H6M A;  4DV7 L;  1BOS A;  4DK6 C;  1NUC A;  4Y7N H;  1QNU A;  3H94 A;  2L55 A;  4A3M H;  2F0Q A;  4DR6 L;  2N49 A;  4YCU A;  5KEE A;  3CQZ H;  4BY7 B;  4DR3 L;  4FNF A;  1TU2 B;  4GKJ Q;  2FJ2 A;  1IYJ B;  2NZH A;  3TS2 A;  4OON A;  4MN3 A;  3J80 c;  4BWG B;  1ILP A;  1GUO A;  3EBE A;  3HOX G;  2F4I A;  3SK6 A;  1PMR A;  3GTP B;  3OYY A;  1EZ8 A;  4POG A;  4KHZ A;  5KND A;  4A3E H;  3TDQ A;  1I94 L;  2JE6 I;  4A3I G;  4LFC Q;  5ELF A;  4I7Z C;  4QIW E;  3TRZ A;  1MJE A;  4O42 A;  3S14 B;  3K0X A;  4P75 A;  1XMQ Q;  3V2T A;  2ZM6 L;  4F7X A;  1Q82 C;  2EJG C;  2HT1 A;  5I6W A;  3H0G B;  4G4K A;  4X3U A;  4GLX A;  3W3A A;  5LMN W;  4HID A;  4I7A A;  3K5N A;  2OWO A;  5K5P A;  4JI3 L;  4U67 3;  4GZY C;  3OTO Q;  3GTL H;  2K5D A;  2NVQ B;  2RCF A;  1CKO A;  1YI2 A;  2YU9 B;  5KYL A;  5KNC A;  1KAA A;  2J0T D;  5IP7 G;  1HNX Q;  4IJL A;  5BR8 L;  2HDL A;  1II3 A;  3MHB A;  1F77 A;  2L11 A;  3OMC A;  4DXG A;  5M3F B;  1AW7 A;  1S5E D;  4LUZ A;  1GUT A;  5JPN C;  1WD0 A;  3J81 E;  3MEH A;  4NPS A;  3PMF A;  4A3J B;  5IGD A;  4R8I A;  1LYL A;  1TS4 A;  4IUN A;  4U68 A;  3M4P A;  2F4V Q;  4V19 0;  4IO9 A;  4DNT B;  1NR4 A;  5M3M B;  4JW0 A;  4HSV A;  4RGM A;  4CJ2 C;  2AMC B;  1K83 H;  1AFP A;  5E1F A;  4YCV A;  1Y1V H;  5T1G A;  1NAP A;  1LTG D;  3S2H H;  4X65 L;  4DR2 Q;  1IHZ A;  2R92 B;  1UE1 A;  4JI7 L;  2YV5 A;  4NB3 A;  4KY6 A;  4KJN A;  1ICF B;  4NMZ A;  5JVG 3;  2LXJ A;  4LWC A;  2JK8 A;  1F2Y A;  4PNY A;  3MEF A;  4B3S L;  1WD1 A;  3Q0A A;  4GOP B;  2DJG C;  1QZG A;  1HTP A;  2ZJQ A;  3P20 A;  2EYH A;  1FD7 D;  1STN A;  2OQ0 A;  4BY1 G;  1HQR D;  4GLA C;  1LTT D;  4DKA C;  4C2M B;  3LGJ A;  3CC4 A;  3PF4 A;  2ZTE A;  3FP9 A;  4C3I B;  1TWA B;  1Y8O B;  3M3Y B;  4IFD J;  2PMZ E;  1UE5 A;  1YJ9 A;  1I3Q B;  2LMC B;  2NWG A;  3D4W A;  3DXJ C;  1WI5 A;  1N9W A;  1SNC A;  3G6E A;  1BR9 A;  3M4Q A;  5FK9 C;  4JI6 Q;  5COR A;  5GAE C;  4PQX A;  4N9P A;  1IBK L;  4FXD A;  1SFO H;  1TKW B;  2XRQ D;  2KOL A;  1VQ5 A;  3SK8 A;  3M4O B;  4OIK A;  5KRU A;  1K9M C;  1AE2 A;  5GAD C;  2A6H D;  5H1S E;  5HUR A;  4FF4 A;  3K8A A;  3MXN B;  1PZI D;  3S15 B;  1FVI A;  1HCZ A;  4S3S A;  2VUM G;  2K03 A;  2BA1 A;  2VB2 X;  3CXC A;  4LFA L;  1CSQ A;  1HUN A;  2EXZ A;  1V1P B;  1V1O A;  4QMG A;  3CU7 A;  3RLO A;  4F8M A;  5M5W H;  1JJ2 A;  1TS3 A;  1H95 A;  2PW7 A;  4GOP A;  2EE1 A;  5IYD H;  1U9R A;  4BXX G;  1YEZ A;  2RKS A;  4PMW A;  4CDC C;  1VQL A;  5I9P A;  1KDA A;  1PH6 A;  4YWL A;  4GOP C;  4BA1 I;  1Y1W B;  3S1M B;  4DK3 C;  4UP9 A;  3HOU G;  1FR3 A;  3OW2 A;  2NVT H;  2VY3 A;  4B3R Q;  4G7H C;  4A3C G;  1KHI A;  2K5V A;  1XTD A;  3OIP A;  1I4H A;  5F2D A;  2C9O A;  4EQ5 A;  2JYO A;  1TY2 A;  2A68 D;  1KXL A;  4FO2 A;  3PIP 3;  3VR4 A;  4JI5 L;  4LF7 Q;  4OEL B;  2YTV A;  3P1H A;  1QB5 D;  3A5Z B;  3H15 A;  4DAM A;  1EY7 A;  4LF6 L;  1PRT F;  4PZ7 A;  3BS1 A;  3ERQ A;  3KBX A;  4A3F B;  3E9H A;  5DLQ E;  2BE5 C;  3PIP A;  3R3O A;  4L5T A;  3T53 B;  4L5S A;  2A73 B;  1STE A;  3CPW A;  3MXN A;  1IL2 A;  1CM9 A;  1VQF A;  4A3B G;  3GD7 A;  4A93 H;  1E7Z A;  1JE4 A;  3QR8 A;  5C4J H;  1VMP A;  2XGT A;  3KFU A;  3GDE A;  4GN5 A;  5C44 B;  3DM1 A;  4HR7 B;  1Q7Y C;  2OCE A;  4MHE A;  1XNR Q;  4A3E B;  1I6H H;  2D0O A;  2Z0S A;  3VA5 A;  1JJC B;  4PV1 C;  2PCF B;  3P75 A;  3NQT A;  2WB1 B;  1I6V C;  2KA7 A;  1L0W A;  2KJX A;  3H91 A;  2WII B;  4A3L G;  1JOR A;  1K8A C;  2P5Z X;  3AFQ A;  5G3L D;  3GTO H;  5J3B A;  4LFB Q;  4JV5 Q;  5ELD A;  1WCM B;  1LTI D;  5DAU A;  2WKC A;  2ZT9 C;  2B8G A;  5LMN Q;  1N33 Q;  3TP8 A;  1YNN C;  3CHB D;  2EPB A;  1AZQ A;  1P8L A;  2UUA L;  3GTM H;  2QF7 A;  1TWH B;  3RNU A;  1JT8 A;  4DN4 M;  4BBR G;  1ET6 A;  1TR5 A;  1L1O B;  1BBX C;  1MHW C;  5AFW A;  3M7N A;  2F0U A;  3UDG A;  2IJ0 A;  1ESF A;  3AU7 A;  4K5W A;  1E2W A;  4K6D A;  1EIF A;  1BF4 A;  3UE0 A;  5BN5 A;  2MPM A;  2ENB A;  4G7O C;  3FEW X;  1PFM A;  3X3N A;  4EQP A;  3K5M A;  4RKB A;  2CQA A;  1LLR D;  1PRT B;  2A69 D;  2F0G A;  1EYG A;  3ULJ A;  3I4N B;  1ROD A;  4EX5 A;  1PH1 A;  2QIL A;  2EIF A;  2OTL A;  1U0L A;  1R4Q B;  2IT1 A;  3K0Y A;  4CBV A;  5ELB A;  2ZXP A;  1ZXT A;  5IGB A;  1PTO H;  1Y1V B;  5CBA E;  4YIJ A;  3I4M B;  3S2H B;  1SJH D;  1MGS A;  2XVS A;  3A8K E;  1TVX A;  5IIF A;  3QWN A;  4LF8 L;  3QIA A;  1SNQ A;  3BG3 A;  3HOX H;  2M2L A;  5M5Y B;  4WJW A;  3PIO 3;  1ZEQ X;  4ULL A;  1TWC H;  2K5W A;  4KHV A;  2B63 G;  1LT5 D;  1RHP A;  2WB1 E;  1Q86 C;  2JA7 G;  4A3I H;  2PNR C;  5C4X G;  3CCV A;  3GTK H;  5IT9 E;  3OW7 A;  3V05 A;  2PPB C;  2HCC A;  1YNJ C;  3OWE B;  3D4D A;  1JMC A;  1X56 A;  1PTO D;  4P2C B;  3PIO A;  4IPH A;  2EYF A;  3QOL A;  4DPG A;  2ZJP A;  3T56 B;  2JA5 G;  4KKT A;  3KF8 B;  1L1O C;  1Y14 B;  3IFD A;  3HG9 A;  1X54 A;  1SYD A;  5NUC A;  2JA6 G;  1F9S A;  2VXW A;  1W3S A;  4JI1 Q;  4B3M L;  3HOZ B;  5IGE A;  4R4Q A;  4J15 A;  4RGO S;  1NTG A;  1IBL L;  1Q90 A;  2JA9 A;  1PRT C;  1O7I A;  5IP7 H;  1EOT A;  1JJG A;  1D7Q A;  3R2I A;  1C7Y A;  5KIX A;  1NNX A;  1VQE A;  3OHX C;  3AQQ A;  1O78 A;  4X3T A;  2MJ8 A;  1UNS A;  3KJP A;  2Q8T A;  2R7F A;  4OIJ A;  3KUP A;  1DGS A;  1WFQ A;  3HKZ E;  5C3E B;  4FXK C;  1B9M A;  2L4N A;  4JC0 A;  4YHH L;  2QEJ C;  3E0E A;  4KV6 A;  3VR5 A;  5FOB B;  1IZ6 A;  4IN3 A;  4B08 A;  4ZCK A;  2GVA A;  3HKZ G;  1UWV A;  3BJU A;  2EYJ A;  3PV0 A;  2Z4I A;  2K5Q A;  1G8Z D;  2QKI C;  3N52 A;  4PMB A;  2E2I B;  1YBY A;  3PSI A;  3T1H Q;  4JYA L;  3FKI B;  1FYC A;  1PFB A;  4L5Q A;  2F0T A;  2KED A;  1GD7 A;  4A3K G;  4LNQ A;  1I50 H;  1K3B C;  4JCV E;  2OXP A;  2NVX B;  3KF8 A;  1IBM L;  3U4Z A;  4FVM A;  4DK0 A;  1EIG A;  1MD2 D;  1WYD A;  3NPP A;  2B8F A;  5IE8 A;  2EDG A;  2RDF A;  5TSS A;  4BY1 H;  5EPK A;  3BZD B;  4A3D B;  2JN4 A;  1GUN A;  4IUQ A;  1PHJ A;  2EVB A;  4JI2 Q;  5D3D A;  4HED A;  4HIO A;  3JAM c;  3EVQ A;  4R4I A;  3QG1 A;  2XNA C;  2EJF C;  3RZO B;  2B2Y C;  2VL6 A;  1NE3 A;  1VQ6 A;  3RR5 A;  2IHE A;  3DM3 A;  5JVH 3;  1WTO A;  2WAQ G;  3EA6 A;  4GS3 A;  2NZO A;  1NBW A;  2EYP A;  4IPG A;  3BVM A;  2DY7 A;  5KYI A;  1VQD A;  1EIY B;  1HH2 P;  1A63 A;  4MZ9 A;  3M85 A;  3F2U A;  4DV2 Q;  1F2M A;  3SEB A;  4OX9 L;  1BBW A;  4JYA Q;  1Y8P B;  1OO9 B;  1O7Z A;  4RCN A;  4TVA B;  3PO2 G;  1I6H B;  4JI0 Q;  3CCU A;  2G9H D;  2VUM H;  4CDF C;  1AN8 A;  3I73 A;  2HQE A;  2SOB A;  1NCV A;  1SRO A;  2RDH A;  2LS0 1;  4RAU C;  3DLL A;  4DR5 Q;  1YHA A;  1KDB A;  3HOY B;  2K05 A;  2Q2T A;  3HOV B;  4DR7 Q;  1VQP A;  1EY5 A;  2VQF Q;  3LNN A;  4DV4 L;  2RHS B;  1HUM A;  4DUZ L;  4NW2 A;  2BH8 A;  1PH9 A;  3E9I A;  2EQS A;  1E22 A;  4ZUI A;  3UE1 A;  3X3M A;  2R7Z G;  2L1B A;  4C1N I;  2FHT A;  2K1B A;  4RGN A;  4HJ5 A;  1SDF A;  4R4T A;  3HOU H;  2KHS A;  4I65 A;  5EAY A;  3E6Z X;  1B3Q A;  4XYQ A;  1JE5 A;  4A3C H;  5FLX L;  1O7L A;  3W5O A;  2IX3 A;  4X3K A;  1ILQ A;  4ZLT F;  2CFM A;  1A8V A;  1PH7 A;  1OXU A;  1N32 L;  2VQE Q;  1UE7 A;  2FIN B;  4GKK L;  2IL8 A;  4C3H B;  1L2F A;  4YY3 Q;  3FHW A;  4M8A A;  4LF9 L;  2QCP X;  1B1Z A;  5FJ8 H;  1IW7 C;  2HHH L;  4RCO A;  5IP9 G;  1CFM A;  2JP1 A;  1B9N A;  3UDI A;  1VQA A;  2F0P A;  3IFT A;  5AJ3 L;  4KY7 A;  3GTJ B;  2EJM A;  1PH2 A;  1VQ4 A;  3LWE A;  4AQY Q;  1SND A;  4A3B H;  4TKO B;  4A3G G;  3VR6 A;  1U4M A;  4RHR A;  1ML0 D;  3OSO A;  1I4P A;  1WJJ A;  1SBB B;  3S1Q B;  4P71 A;  1F2L A;  2KEC A;  2YYZ A;  4IJH A;  1FNW A;  1LTR D;  5LMU Q;  1A3T A;  4DA2 A;  2PYK A;  2E2J H;  1YIT A;  2I5M X;  1BDO A;  4X64 Q;  2F1M A;  2CH4 W;  4A3L H;  2XTI A;  3NTK A;  1JC7 A;  1D8L A;  1BQQ T;  3EFX D;  4DF7 A;  3J80 E;  1QVC A;  2CWP A;  1PZJ D;  1CQF A;  5I2X A;  5KNB A;  2UXB Q;  4NP5 A;  2NB0 A;  3ULP A;  2E2H B;  2DGY A;  1EYD A;  5CC4 A;  3JAM i;  3STB D;  3UI2 A;  2I5L X;  4BBR H;  4KHP Q;  2LKV A;  4C3J G;  1E24 A;  5C3W A;  1YHQ A;  1S5B D;  1H9J A;  1ONL A;  4LF5 Q;  3G71 A;  3MZ5 A;  2AQ3 B;  3PUV A;  1TII D;  2VNU D;  2CW0 D;  4NXM Q;  2ZTC A;  3RN2 A;  3K58 A;  4HIK A;  4KTA A;  4QJF A;  1LT6 D;  1VQ7 A;  4ABN A;  2GVB A;  1EL0 A;  2UUB Q;  1R4P B;  4DV5 Q;  2UU9 Q;  3NSW A;  1Z7T A;  3NEM A;  3NEL A;  4H7B A;  3UDF A;  1YHB A;  2E76 C;  1KLG D;  3K5O A;  1SYB A;  4HMJ A;  3EIV A;  4PMC A;  3O13 A;  4O0A A;  3KLS A;  5EBD A;  2K6A A;  4NDX A;  2MP1 A;  3BDO A;  2H5X A;  3T13 A;  1STG A;  1BCP F;  3ICE A;  1SMY D;  1QZH A;  1BKB A;  1R9T B;  1TWF B;  2A6E D;  3DEP A;  1VCI A;  3R2T A;  2RCN A;  3CD6 A;  4DNR B;  4IAL A;  2Y0S B;  1HFN A;  2N8N A;  1BUV T;  3FPU B;  3CMA A;  1XNQ L;  2JA7 H;  2LSS A;  3I2Z A;  3SHL A;  2R7D A;  4K0K L;  2K52 A;  5C4X H;  4DUY L;  3PO3 G;  1WTX A;  1YIJ A;  4HJ9 A;  3D8G A;  2WV6 D;  4DU9 A;  4DV7 Q;  3TEH B;  2UUC L;  2D0P A;  3J7Y W;  4DR6 Q;  2AHO B;  1GM5 A;  2A1A A;  3TQY A;  2JA5 H;  3NTI A;  1JB3 A;  4DR3 Q;  5FO8 B;  3D0F A;  3QJY A;  4LW1 A;  3M7G A;  1QVG A;  4FP5 D;  1K8O A;  3K81 C;  3J81 j;  2JA6 H;  2K01 A;  5L37 A;  1V43 A;  4HTH A;  4HCS A;  3PCO B;  2D5D A;  4CHT B;  2QDB A;  1D6E C;  2QW7 A;  3TZU A;  3K7A H;  4TQU S;  5J1Z A;  5C5L A;  4AYB B;  1I94 Q;  3MA2 B;  1GXD C;  2B2V A;  2Q2I A;  1X3E A;  4HJ7 A;  5CV4 A;  4R9W A;  2IHF A;  3PUY A;  2JA8 B;  4ME5 A;  4L6T B;  1XPU A;  3ER0 A;  2V1C C;  2ZM6 Q;  4KD4 A;  4XYO A;  2H4O A;  1XMO L;  4NKL A;  2F0N A;  3VR3 A;  4YCW A;  1HHV A;  3CCJ A;  4BY7 G;  5ELE A;  1BBU A;  3V96 A;  5A2Q L;  2ZJR A;  4HJ8 A;  4TRD A;  3BDC A;  2F3V A;  4RKL A;  2E5L L;  1GUS A;  4JI3 Q;  3S1N H;  3ZYY X;  4K14 A;  4DV0 L;  1VQM A;  1S5F D;  1BCP B;  3C2P A;  1SNP A;  1C4Q A;  2Y0S E;  2I5H A;  5BR8 Q;  1SN8 A;  2L5T A;  3ERO A;  2B29 A;  2OF1 A;  4ZK9 B;  3ZJY C;  4B9X A;  2EZV A;  3NHH A;  3RZD B;  5EBC A;  4K2K A;  3A54 A;  2RSO A;  4KN4 C;  5JJK A;  1G2S A;  2R93 B;  1M1K C;  3A7A B;  3KK7 A;  3H0G G;  2F0D A;  2HIV A;  3K6O A;  2NVY H;  4JI8 L;  2PQA B;  4UY8 C;  1PH8 A;  5EPJ A;  4X65 Q;  5HGQ A;  1B7Y B;  4RH6 A;  1PLF A;  4JI7 Q;  1ENF A;  2DJF C;  2OQK A;  3DWQ A;  2I07 B;  5CYU A;  3GP7 A;  4B3S Q;  4AYB E;  1HZA A;  4ALP A;  1FJG L;  4V0B A;  4H44 C;  5M3F G;  3GTQ B;  1QG7 A;  3NXW A;  3S1R H;  1EY0 A;  4RGT A;  3NWT A;  2R3Z A;  1ZKO A;  2A19 A;  4BBS B;  3PO2 H;  3M9B A;  2VW9 A;  4A3J G;  2E2J B;  5EKK A;  1AH9 A;  4NXN L;  5KGU A;  3U4V A;  4HCE A;  2K4K A;  1Z6H A;  5COY A;  5M3M G;  2G5D A;  1IXR A;  4RFB A;  1F9P A;  4BS9 A;  1QOH A;  3C1F A;  1BCP C;  5FKA C;  2K5N A;  1G2T A;  2R92 G;  2K5H A;  1V9P A;  3Q24 A;  1JB7 A;  3MXU A;  4K5V A;  1IBK Q;  3HRZ C;  2R7Z H;  4OL7 A;  2LXK A;  4F87 A;  5C3X A;  2A8V A;  1EEF D;  1GHK A;  2VB3 X;  2OTJ A;  1GJX A;  1C8C A;  3I72 A;  3KYH C;  1Y8N B;  1MIU A;  3PF5 A;  3E5S A;  3GTG B;  5D14 A;  1A0I A;  1SYF A;  3RLN A;  3HOW B;  2PQA A;  1DON A;  5BN4 A;  2A74 C;  5T1I A;  1OXT A;  4C3I G;  4Y7N B;  3S2D H;  4KY5 A;  5D65 A;  4LFA Q;  5J22 A;  4Q5V A;  4A3M B;  4IFD H;  4KKU A;  3D6C A;  2FMM A;  2J7Z A;  3CQZ B;  4KI0 A;  1AZP A;  3NBI A;  5IWA L;  1PYB A;  5FLM G;  1E2Z A;  1NMF A;  3MAQ A;  5IP9 H;  3GQB A;  3NK9 A;  2RA4 A;  3A55 A;  2SNS A;  3HEJ A;  1JWU D;  3GV3 A;  3RMH A;  3BU2 A;  1MBY A;  3PUZ A;  1EWC A;  2RF4 A;  3GO5 A;  3H3V C;  2K28 A;  4QF4 A;  1DM0 B;  4A3G H;  4CJ1 B;  1YVC A;  1D1K A;  2QEX A;  2LFN A;  2AQ2 B;  3CCQ A;  2ASB A;  4Y52 H;  2AWN A;  1TWG H;  3ERS X;  4JI5 Q;  3ONA B;  1EU4 A;  2G9D A;  5D3I B;  3J81 L;  3Q6S A;  3KF6 B;  1KAW A;  1KIX A;  2F0E A;  3SE0 A;  4LF6 Q;  1KL9 A;  4QUF A;  1EFW A;  2WKD A;  2IY5 B;  2HUG A;  2PQE A;  1GUW A;  4P74 A;  4X62 L;  4N9T A;  2NBF A;  4DNI A;  1J5E L;  4DV6 L;  2NTS A;  2Z1C A;  1EQV A;  1Q1B A;  3AMU A;  4DV3 L;  1Y1W G;  3GTL B;  2YTX A;  1JWS D;  1YZ6 A;  2KHI A;  3PUX A;  4FF3 A;  3M4Y A;  4OEM B;  3AB9 A;  3KBG A;  4PG3 A;  4UP7 A;  3J81 i;  4KJO A;  4C3J H;  4LJZ C;  4XTC S;  3MWY W;  1S40 A;  1HA6 A;  5CGK A;  3CCS A;  2OT2 A;  1D1I A;  3H3V I;  2X69 A;  1KRT A;  2K50 A;  3I4O A;  1I5F A;  4PZ8 A;  3IRB A;  4YWK A;  1PXU A;  1O7Y A;  5FO9 B;  1X9N A;  4A3F G;  2K14 A;  3K59 A;  1K83 B;  1K28 A;  2WP8 J;  1A2U A;  2XWJ B;  3VDY A;  2D62 A;  4JVZ A;  2Z9H A;  1I4Q A;  1HR0 L;  4B3T L;  2B2T A;  2AUK A;  3B6Y A;  1LAB A;  3L9A X;  3CCM A;  3KLW A;  3KF6 A;  2UUA Q;  2B2T C;  3G6J B;  2MFI A;  2PI2 A;  1RL2 A;  1LAC A;  1HPC A;  2E8G A;  1L0Y B;  5C44 G;  1SE3 A;  4WOR A;  4DR4 L;  3FPP A;  3NWS A;  1EY9 A;  1QCB D;  3MFY A;  1J8I A;  4A3E G;  5EKL A;  1DCZ A;  4P73 A;  3W2D A;  2L15 A;  2PI2 E;  2WB1 G;  3PUW A;  1RJT A;  1EYA A;  1U4R A;  4KLK A;  1PFN A;  3ND8 A;  2NN6 G;  1LM0 A;  1ZYR D;  1JWM D;  4WRD A;  3PO3 H;  4ZKB B;  1WCM G;  2Q2U A;  1X6O A;  5G3L F;  5IY0 A;  1QJO A;  1I4G A;  2SDF A;  1Q81 C;  1SFO B;  1UAP A;  1B3A A;  3CPF A;  2KBN A;  3CCL A;  5M5X H;  2F0S A;  3EJI A;  1TT2 A;  4OHJ A;  1VQ8 A;  1T5X D;  4DR1 L;  4LF8 Q;  1PVO A;  2JEA I;  4P72 A;  1WTW A;  1Q3L A;  1VQ9 A;  2D2C C;  5JAV A;  4XIG S;  4R4C A;  3LWU A;  5BN3 A;  2UXD L;  3JAM E;  4PZ6 A;  1HJP A;  2NN6 I;  3CW2 C;  1B50 A;  3CAM A;  2WFW A;  4FDB A;  3EN2 A;  5M5W B;  4O2D A;  1U4P A;  3TSS A;  5FLX c;  3I4N G;  4HIM A;  1C48 A;  1VF5 C;  2PZT A;  4QY7 A;  4GN4 B;  5IYC G;  1Z47 A;  1U4L A;  4CKB A;  4LUV A;  1UEA B;  1ESR A;  4BY7 H;  1Y1V G;  4DV1 L;  4DGZ A;  2NVT B;  1M4V A;  3KOJ A;  3TZD A;  1Z9F A;  3I4M G;  2ZXR A;  2RBM A;  1EY6 A;  2A6H C;  4JI4 L;  1QNK A;  1N8R C;  1GHJ A;  4B3M Q;  1FL0 A;  2QDL A;  5EKI A;  4JK1 C;  1IBL Q;  3Q8D A;  3GTP H;  2L0C A;  4CDD C;  4EQN A;  1BXT A;  4RWS C;  2E75 C;  3S24 A;  2O2L D;  1Q8I A;  5I2Y A;  3CF5 A;  1C0A A;  1MI2 A;  3R93 A;  3S14 H;  2HQL A;  4APV A;  3C1E A;  4MNO A;  5IYB G;  4GN3 B;  4QGU A;  4X66 L;  1HZB A;  4YHH Q;  3SDZ A;  1PTO F;  2KCC A;  2DNE A;  2PNH A;  4DK1 A;  5JPM C;  4A93 B;  4XQN A;  4IZ8 A;  4L5R C;  5C4J B;  4R8N A;  2R61 A;  1HNW L;  1BNZ A;  1K0R A;  2JEB I;  1EY8 A;  1F9R A;  2A68 C;  3HOZ G;  2KHJ A;  2NVQ H;  1PYS B;  2YU9 H;  1NMG A;  2I46 A;  1G6P A;  1IBM Q;  1EIH A;  5M3F H;  5E7N A;  5E3F A;  1N36 L;  4GNX B;  3GTO B;  2NUC A;  1SE2 A;  1HNZ L;  5E4W C;  4XQQ A;  1S4Z A;  2ALY B;  5ELC A;  4A3J H;  5C3E G;  1PFS A;  4Q0F A;  5M3M H;  4BXX H;  1PDQ A;  5JJL A;  1MSH A;  1K8G A;  1EQQ A;  2TSS A;  3GTM B;  4IUT A;  1D2B A;  1SNO A;  5IYD G;  3VYU A;  1SNM A;  3BDL A;  2I0Q A;  2HDM A;  2FXQ A;  2R92 H;  2IWH A;  3PQI A;  5ELN A;  2ID0 A;  4K8I A;  4X6A H;  4YWM A;  2EY6 A;  4OO1 G;  1LV9 A;  2B2W A;  1X3F A;  4IPD A;  5HGT A;  4N8F A;  3D31 A;  3FKI G;  1D5Z C;  3KDF A;  4JPB W;  3S16 H;  1QIL A;  2B2W C;  2IX1 A;  4WJ3 M;  5EPL A;  4QCL A;  1B2T A;  2R6G A;  4OX9 Q;  1EEI D;  5IT9 L;  2Z4H A;  4C2M H;  1EUJ A;  4A3D G;  1KDC A;  4C3I H;  3W1B A;  4POF A;  1YNX A;  3CRL C;  3M3Y H;  3TP6 A;  4ID6 A;  4EGV A;  1E2V A;  1PTO B;  2C5C A;  1I3Q H;  1LO5 D;  1WTH A;  2UXC L;  3VYS A;  1N34 L;  5FLM H;  4X3S A;  1W2B A;  4QQB X;  4OO1 I;  1K0S A;  5DNF A;  4DV4 Q;  4HAE A;  1GOZ A;  4DUZ Q;  1EWI A;  2CH4 A;  1TS2 A;  4GNX A;  4F88 A;  2F0F A;  3DHQ A;  3HOX B;  2EOT A;  1XJV A;  1W6K A;  2DN8 A;  4KKS A;  2RHQ B;  2X6L A;  3T1Y L;  3CCR A;  1JQY D;  1TWC B;  4FXG C;  1JIC A;  5FO7 B;  4GNX C;  1G29 1;  3D3R A;  3MTS A;  1WOC A;  1S5C D;  4IUP A;  2JSO A;  4A3I B;  3JC6 6;  2A69 C;  3GTK B;  3L0O A;  3S15 H;  4LF4 L;  2E74 C;  1JOO A;  1N32 Q;  1K73 C;  3U9O A;  4GKK Q;  1CSP A;  1H9K A;  1GO3 E;  2Q8I B;  4LF9 Q;  3KJO A;  4DAV A;  3HOY G;  2BE5 D;  1JR0 D;  2HHH Q;  3HOV G;  4GKJ L;  2DY8 A;  2HD3 A;  5C5M A;  1XX8 A;  4FF1 A;  4K5X A;  3R8B A;  5JJZ A;  3SVM A;  5AJ3 Q;  3A8I E;  2XRS D;  4J1M A;  5M5X B;  1STH A;  1Y1W H;  3S1M H;  1A6X A;  1XXG A;  4JBW A;  1RTO A;  3AFP A;  1IL8 A;  4IQZ A;  4CGY B;  4ZKC B;  3C46 A;  4LFC L;  5DEH A;  5C0X G;  1QUQ B;  1BVS A;  3A74 A;  4KMU C;  5EGT A;  1AE3 A;  1XMQ L;  1PTO C;  4GLV B;  4C3H G;  2Q8R E;  5JJI A;  3F2D A;  1Y69 U;  3FDT A;  4A3F H;  3J7A 5;  1HFG A;  3IL8 A;  3NTH A;  1X65 A;  2DNC A;  1T5E A;  1UEB A;  1YNN D;  1P16 A;  1HQM C;  3S17 H;  3OTO L;  2ES2 A;  3G7L A;  3L7Z C;  3FVQ A;  1HNX L;  5C0X I;  2F3W A;  2MGS A;  1I50 B;  2NTT A;  3RD4 A;  1RCV D;  2QA4 A;  2B63 H;  1KRS A;  4IUU A;  5C44 H;  1WTV A;  2PW5 A;  1SJE D;  3I70 A;  4BY1 B;  3IKJ A;  1ENC A;  1PV4 A;  2F4V L;  1GVP A;  2JQO A;  4A76 A;  1PYW D;  1PH3 A;  2NN6 H;  1EQR A;  3I56 A;  5JEA G;  3J7Z C;  1HTL D;  1LTL A;  4QB4 A;  1OXX K;  1WCM H;  4LUO A;  4DR2 L;  2PMZ B;  2QGQ A;  4MTN A;  3A8J E;  1QUQ A;  4JBM A;  1B44 D;  4LMQ D;  2HIX A;  3F8T A;  1TWH H;  2FFK B;  1F9Q A;  5C6A A;  4QL5 A;  1H9M A;  2F0L A;  1OXV A;  2L9H A;  5IOD A;  4G7Z C;  2N55 A;  1IYV A;  2HCI A;  2VUM B;  2KUM A;  2B2V C;  2F0O A;  1XNQ Q;  1M8A A;  4QUC A;  3SK5 A;  2Q2H A;  5CV6 A;  4K0K Q;  1SYG A;  3NEN A;  4DUY Q;  2XWB B;  1YNJ D;  3I4N H;  4EVO A;  4OWW B;  4RHS A;  2UUC Q;  4JI6 L;  1GUG A;  1TY0 A;  3TN2 A;  5IYC H;  2F03 A;  4H0L C;  1L0X B;  4J6H A;  1WTP A;  1AEX A;  1NY4 A;  3SXH A;  1HA5 A;  4ZQ3 A;  3HOU B;  2EY1 A;  3CRK C;  4C56 C;  3I4M H;  2F3I A;  1T9H A;  3A56 A;  3E0J A;  3I3C A;  4A3K H;  2K33 A;  1DYQ A;  1W6J A;  3TME A;  1NJI C;  1VQB A;  1BO0 A;  5M5Y H;  1FNV A;  3G48 A;  3S16 B;  1EQT A;  2Y0S G;  1PRT D;  1CHP D;  1J6Q A;  1K8M A;  3MFG A;  2DUD A;  2K75 A;  4DAY B;  2EYO A;  4DXF A;  2KQ3 A;  5IGC A;  3J80 L;  2XN9 C;  1QWY A;  4A75 A;  1CTM A;  2VZA A;  3BYT B;  5CV9 A;  5IYB H;  3J81 c;  3HFZ B;  1XMO Q;  3W1G A;  2AKW B;  1IKL A;  1KLU D;  3WDN A;  4IPC A;  1A15 A;  4ME3 A;  5IGG A;  2CKZ B;  4A3B B;  5EJW A;  1B70 B;  1EZ6 A;  1HR0 W;  1CK1 A;  2PZU A;  1Q46 A;  2VS1 A;  4B3R L;  4MIU A;  2E5L Q;  2E2D C;  1PH5 A;  1KTK A;  2KCT A;  1LTS D;  4DV0 Q;  3HOZ H;  2RDG A;  4LF7 L;  3DWA A;  3IAY A;  2O4X A;  2H1E A;  1PH4 A;  1C9O A;  1SSO A;  1A3V A;  1SR3 A;  4AYB G;  3J80 i;  3D6W A;  1CA6 A;  3CP0 A;  1TS5 A;  5E4X A;  1G91 A;  1OTC A;  1HXY D;  2IX0 A;  2JA8 G;  3I4L A;  3OMG A;  3AYH B;  2F0I A;  2WIN B;  5LHY 1;  1E1T A;  4UHV A;  1VDZ A;  2CQO A;  2F0K A;  5C3E H;  1IYU A;  3NUC A;  4ZRZ A;  4CJ0 B;  1WVL A;  1VQJ A;  2TMP A;  1SRU A;  1B4O A;  3U58 A;  1DOL A;  5LL6 X;  4JI8 Q;  3RUZ A;  1EU3 A;  4BBR B;  5LL6 S;  3GV6 A;  4CKC A;  1K3R A;  4DAY A;  1D5X C;  4DFA A;  1RD9 D;  2E2I H;  2BH2 A;  4OO1 H;  2M00 A;  1QE6 A;  5C0X J;  3AEV A;  5J39 A;  1XNR L;  1OXS C;  1B53 A;  1E0B A;  3FKI H;  1XWE A;  1FJG Q;  3BVZ A;  4JOI A;  2ATW A;  3H09 A;  3C3L A;  2NVX H;  2EY5 A;  2KEE A;  4XDX A;  2CVR A;  4XXE A;  2F0H A;  4LFB L;  4JOI C;  4JV5 L;  5I9O A;  4AH6 A;  4A3D H;  4NXN Q;  2Z6K A;  2Z6B A;  1I4X A;  3WOE A;  4L63 B;  5LMN L;  1N33 L;  2R93 G;  5FJ8 G;  1NR2 A;  1AP0 A;  1Q12 A;  2Z6K C;  2GA4 B;  3U9S A;  3RZO H;  1CQV A;  3STB C;  4XT1 B;  3K5L A;  1JOK A;  3I91 A;  5K36 G;  5ISR A;  1XPR A;  2F52 A;  4JBJ A;  1PZK D;  1EFI D;  3S17 B;  1YJW A;  1H9R A;  2F0V A;  2CW0 C;  1CT1 D;  1XTC D;  1V1P A;  2B63 B;  1G6Z A;  1Q8K A;  2BCO A;  1SMX A;  2JA7 B;  4C1N K;  1VQI A;  2CHB D;  1HRJ A;  1LTA D;  5C4X B;  1A62 A;  1X3P A;  4BBS G;  1EWH A;  2RVL A;  4IOC A;  5JEA J;  1ENA A;  2ICE C;  2BA0 A;  3Q23 A;  2JA5 B;  4AIM A;  3QB3 A;  5IWA Q;  3HOY H;  1SAP A;  1IW7 D;  3HOV H;  1A3U A;  4ILW A;  3A7L A;  3K57 A;  5CV8 A;  3HZX A;  1E3P A;  1HZC A;  2JA6 B;  4WFN 3;  3NE5 B;  3F2C A;  1SMY C;  4K6L A;  4MTK A;  1LT4 D;  2A6E C;  3WWV A;  1SLJ A;  3K7A B;  1FNU A;  3HS0 C;  2F0W A;  5CV5 A;  3CCE A;  3K80 C;  4ZYS A;  5C0X H;  3HOW G;  5ELO A;  2PO4 A;  1VQN A;  2J4X A;  3T51 B;  5I4D A;  4A3M G;  2K7V A;  4C3H H;  4OXP A;  1UE6 A;  1H9S B;  5GQO A;  4X62 Q;  3TBI B;  4KN7 C;  3SR1 A; 
#chains in the Genus database with same CATH homology
 3HKZ B;  4FYD A;  2X6G A;  3VYR A;  3T16 A;  3S1N B;  1SE4 A;  2N88 A;  3URY A;  3T4A C;  1CZW A;  3OWF A;  4LAA A;  2JXM B;  3LX0 A;  4A3K B;  1MSG A;  3KLS X;  1JOQ A;  2V4D A;  4L8J A;  5FLX E;  3HGB A;  5DM6 3;  4XQJ A;  2LY7 A;  1DD2 A;  3DWP A;  4RA8 A;  4OGQ C;  4M1U B;  2NVY B;  5JEA H;  4KD3 A;  1XYI A;  2WAQ B;  2NYZ D;  3OOC A;  1X3Q A;  4IUV A;  4B9W A;  3OPO A;  4HSP A;  1LTB D;  3BVG A;  1SYC A;  1H9S A;  3S1R B;  2Z8L A;  2AQ1 B;  3NQI A;  3PO2 B;  3L3O C;  3N6R A;  4K8J A;  1CA5 A;  1FGB D;  2F0J A;  1JCK B;  4ODG A;  2KCN A;  2BDN A;  2RSN A;  2MUY A;  2AWO A;  4KK7 A;  1D5M C;  3DUZ A;  1SEB D;  3ITP A;  2R7Z B;  1DOK A;  4O1N A;  3D4R A;  2M9V A;  1WTQ A;  1KNA A;  5A35 A;  5I6Y A;  2D9U A;  3KLR A;  5C4Z A;  1KAB A;  5CMD A;  5CBE E;  5EQ0 A;  3CKI B;  3OIQ A;  3S2D B;  2XIW A;  4XT3 B;  1A2T A;  1Q1E A;  3I8Z A;  2KVM A;  3HP3 A;  2EYM A;  2OEO A;  1RF2 D;  5C4H A;  2IW3 A;  2B2Y A;  4CKE A;  3DMU A;  5DM7 3;  3FRP B;  3SK4 A;  3DEO A;  2SNM A;  4IUR A;  4A3G B;  2EY2 A;  1KNE A;  1UUP A;  4G57 A;  5IOC A;  1TWG B;  2K32 A;  2BDO A;  4HN7 A;  3S9W A;  1STY A;  2A5H A;  4J8Q A;  2RQX A;  1V8Q A;  1I4R A;  1SXT A;  3VYT A;  3VR2 A;  4BA2 I;  3VA7 A;  1F2Z A;  3P7J A;  3J7A V;  3ND9 A;  2F0M A;  2O5J C;  5CV7 A;  1ICW A;  3QOJ A;  1WTR A;  1EY4 A;  3I90 A;  2ZXO A;  2AUJ D;  1ET9 A;  1VF7 A;  2L12 A;  4C3J B;  4Z9C B;  5IGF A;  1SYE A;  1DXM A;  3MXG A;  2B2U A;  1CHQ D;  1CZG A;  3MVV A;  2IPK D;  1DZ1 A;  3MXP A;  2B2U C;  2K04 A;  4FF2 A;  3Q22 A;  1RTN A;  3MC0 B;  4IFD G;  3J7A F;  2EYL A;  3WOF A;  1DJR D;  1DOM A;  4EQO A;  4LK1 C;  5A2Q E;  2BOS A;  1IKM A;  1NSN S;  2O5I C;  2PZW A;  1BCP D;  4H13 C;  5CR3 A;  3TP5 A;  5K36 H;  1STA A;  4TSS A;  4UAI A;  1VMC A;  3EQL C;  4UDU C;  3TP7 A;  1EYC A;  3JAM L;  1LT3 D;  4DAP A;  1J9O A;  5JOB A;  3NP8 A;  4QIW B;  3QO2 A;  1RKN A;  4IFD I;  3PO3 B;  3BYY B;  1TQO A;  1X32 A;  1STB A;  1O80 A;  4ZUJ A;  4HMI A;  2B39 A;  1RDP D;  3FMC A;  3NBH A;  5M9O A;  2ICI A;  1CI3 M;  2XSC A;  4E6I A;  2SEB D;  2NZ1 D;  3RLF A;  4K2L A;  2WAC A;  4ZAI A;  1ZYR C;  2FMC A;  2MHV A;  1S5D D;  3H6M A;  1BOS A;  1NUC A;  1QNU A;  3H94 A;  2L55 A;  2F0Q A;  5KEE A;  4BY7 B;  1TU2 B;  4FNF A;  2FJ2 A;  4MN3 A;  4BWG B;  1ILP A;  1GUO A;  2F4I A;  3SK6 A;  1PMR A;  3GTP B;  1EZ8 A;  4KHZ A;  5KND A;  3TDQ A;  2JE6 I;  5ELF A;  4I7Z C;  4O42 A;  3S14 B;  3V2T A;  4F7X A;  2EJG C;  5I6W A;  3H0G B;  4G4K A;  4X3U A;  3W3A A;  3K5N A;  5K5P A;  4U67 3;  4GZY C;  2K5D A;  2NVQ B;  2YU9 B;  5KYL A;  5KNC A;  1KAA A;  2J0T D;  2HDL A;  1II3 A;  3MHB A;  1F77 A;  2L11 A;  3OMC A;  4DXG A;  5M3F B;  1AW7 A;  1S5E D;  1GUT A;  5JPN C;  1WD0 A;  3J81 E;  3MEH A;  3PMF A;  4A3J B;  5IGD A;  4R8I A;  1TS4 A;  4IUN A;  4U68 A;  4V19 0;  4DNT B;  1NR4 A;  5M3M B;  4HSV A;  4RGM A;  4CJ2 C;  1AFP A;  5E1F A;  5T1G A;  1NAP A;  1LTG D;  1IHZ A;  2R92 B;  4KY6 A;  4KJN A;  5JVG 3;  4NMZ A;  4PNY A;  1F2Y A;  1WD1 A;  3Q0A A;  1HTP A;  3P20 A;  2EYH A;  1FD7 D;  1STN A;  1HQR D;  1LTT D;  4C2M B;  4C3I B;  1TWA B;  1Y8O B;  3M3Y B;  4IFD J;  1I3Q B;  2LMC B;  2NWG A;  3D4W A;  3DXJ C;  1SNC A;  1BR9 A;  5FK9 C;  5COR A;  4PQX A;  4N9P A;  4FXD A;  1TKW B;  2XRQ D;  2KOL A;  3SK8 A;  3M4O B;  4OIK A;  5KRU A;  2A6H D;  5HUR A;  4FF4 A;  1PZI D;  3S15 B;  4S3S A;  1HCZ A;  2K03 A;  2BA1 A;  2VB2 X;  1HUN A;  2EXZ A;  1V1P B;  1V1O A;  4QMG A;  3CU7 A;  4F8M A;  1TS3 A;  2PW7 A;  2EE1 A;  1U9R A;  2RKS A;  4PMW A;  5I9P A;  1KDA A;  1Y1W B;  4BA1 I;  3S1M B;  1FR3 A;  4G7H C;  3OIP A;  1I4H A;  5F2D A;  2C9O A;  2JYO A;  1TY2 A;  2A68 D;  4FO2 A;  3PIP 3;  3VR4 A;  3P1H A;  1QB5 D;  1EY7 A;  1PRT F;  3BS1 A;  3ERQ A;  3KBX A;  4A3F B;  2BE5 C;  3R3O A;  3T53 B;  2A73 B;  1STE A;  3MXN A;  1CM9 A;  3GD7 A;  1JE4 A;  1VMP A;  5C44 B;  3DM1 A;  4HR7 B;  4MHE A;  4A3E B;  3VA5 A;  4PV1 C;  2PCF B;  3P75 A;  3NQT A;  2WB1 B;  1I6V C;  2KA7 A;  2KJX A;  3H91 A;  2WII B;  1JOR A;  5G3L D;  5ELD A;  1WCM B;  1LTI D;  5DAU A;  2WKC A;  2ZT9 C;  2B8G A;  3TP8 A;  1YNN C;  3CHB D;  2EPB A;  1AZQ A;  2QF7 A;  1TWH B;  4DN4 M;  1ET6 A;  1TR5 A;  1BBX C;  5AFW A;  3M7N A;  2F0U A;  2IJ0 A;  1ESF A;  3AU7 A;  4K5W A;  1E2W A;  4K6D A;  1BF4 A;  5BN5 A;  2MPM A;  2ENB A;  4G7O C;  3FEW X;  1PFM A;  3X3N A;  4EQP A;  3K5M A;  4RKB A;  2CQA A;  1LLR D;  1PRT B;  2A69 D;  2F0G A;  3I4N B;  1ROD A;  2QIL A;  1R4Q B;  2IT1 A;  3K0Y A;  4CBV A;  5ELB A;  2ZXP A;  1ZXT A;  5IGB A;  1PTO H;  1Y1V B;  5CBA E;  4YIJ A;  3I4M B;  3S2H B;  1SJH D;  1MGS A;  2XVS A;  3A8K E;  1TVX A;  5IIF A;  3QWN A;  3QIA A;  1SNQ A;  3BG3 A;  2M2L A;  5M5Y B;  4WJW A;  3PIO 3;  1ZEQ X;  4ULL A;  2K5W A;  4KHV A;  1LT5 D;  1RHP A;  2PNR C;  5IT9 E;  3OW7 A;  3V05 A;  2PPB C;  2HCC A;  1YNJ C;  3OWE B;  3D4D A;  1PTO D;  4P2C B;  2EYF A;  3QOL A;  3T56 B;  4KKT A;  3IFD A;  3HG9 A;  1SYD A;  5NUC A;  1F9S A;  2VXW A;  3HOZ B;  5IGE A;  4RGO S;  1Q90 A;  1PRT C;  1EOT A;  3R2I A;  5KIX A;  3OHX C;  1O78 A;  4X3T A;  2MJ8 A;  1UNS A;  2Q8T A;  4OIJ A;  3KUP A;  5C3E B;  4FXK C;  1B9M A;  2L4N A;  2QEJ C;  4KV6 A;  3VR5 A;  5FOB B;  4IN3 A;  4B08 A;  2EYJ A;  3PV0 A;  2Z4I A;  2K5Q A;  1G8Z D;  2QKI C;  3N52 A;  4PMB A;  2E2I B;  3FKI B;  1FYC A;  1PFB A;  2F0T A;  2KED A;  2OXP A;  2NVX B;  3KF8 A;  4FVM A;  4DK0 A;  1EIG A;  1MD2 D;  3NPP A;  2B8F A;  2EDG A;  2RDF A;  5TSS A;  5EPK A;  3BZD B;  4A3D B;  1GUN A;  4IUQ A;  2EVB A;  5D3D A;  4HED A;  3EVQ A;  3QG1 A;  2XNA C;  2EJF C;  3RZO B;  2B2Y C;  5JVH 3;  1WTO A;  3EA6 A;  2EYP A;  3BVM A;  2DY7 A;  5KYI A;  3M85 A;  3F2U A;  1F2M A;  3SEB A;  1Y8P B;  1OO9 B;  1O7Z A;  4RCN A;  1I6H B;  2G9H D;  1AN8 A;  3I73 A;  2HQE A;  2SOB A;  1NCV A;  2RDH A;  2LS0 1;  4RAU C;  1KDB A;  3HOY B;  2K05 A;  3HOV B;  1EY5 A;  3LNN A;  1HUM A;  4NW2 A;  4ZUI A;  3X3M A;  2L1B A;  4C1N I;  2FHT A;  2K1B A;  4RGN A;  1SDF A;  2KHS A;  4I65 A;  3E6Z X;  4XYQ A;  5FLX L;  1O7L A;  2IX3 A;  4X3K A;  1ILQ A;  4ZLT F;  1OXU A;  2FIN B;  2IL8 A;  4C3H B;  4M8A A;  2QCP X;  1B1Z A;  1IW7 C;  4RCO A;  1CFM A;  2JP1 A;  1B9N A;  2F0P A;  3IFT A;  4KY7 A;  3GTJ B;  2EJM A;  3LWE A;  1SND A;  4TKO B;  3VR6 A;  1U4M A;  4RHR A;  1ML0 D;  3OSO A;  1I4P A;  1SBB B;  3S1Q B;  1F2L A;  2KEC A;  2YYZ A;  1FNW A;  1LTR D;  1A3T A;  4DA2 A;  2PYK A;  1BDO A;  2F1M A;  3NTK A;  1JC7 A;  1BQQ T;  3EFX D;  4DF7 A;  3J80 E;  1PZJ D;  1CQF A;  5I2X A;  5KNB A;  2E2H B;  4NP5 A;  2NB0 A;  1EYD A;  5CC4 A;  3UI2 A;  2LKV A;  4C3J G;  5C3W A;  1S5B D;  1H9J A;  1ONL A;  3MZ5 A;  2AQ3 B;  3PUV A;  1TII D;  2VNU D;  2CW0 D;  3K58 A;  4KTA A;  1LT6 D;  4ABN A;  1EL0 A;  1R4P B;  3NSW A;  1Z7T A;  4H7B A;  2E76 C;  1KLG D;  3K5O A;  1SYB A;  4HMJ A;  4PMC A;  3O13 A;  5EBD A;  3KLS A;  2K6A A;  4NDX A;  2MP1 A;  3BDO A;  3T13 A;  1STG A;  1BCP F;  1SMY D;  1R9T B;  1TWF B;  2A6E D;  3DEP A;  1VCI A;  3R2T A;  4DNR B;  4IAL A;  2Y0S B;  1HFN A;  1BUV T;  3FPU B;  3SHL A;  1WTX A;  3D8G A;  2WV6 D;  4DU9 A;  3J7Y W;  3NTI A;  1JB3 A;  5FO8 B;  3QJY A;  3M7G A;  4FP5 D;  1K8O A;  2K01 A;  1V43 A;  4HTH A;  4HCS A;  2D5D A;  4CHT B;  2QDB A;  1D6E C;  3TZU A;  4TQU S;  5J1Z A;  5C5L A;  4AYB B;  3MA2 B;  1GXD C;  2B2V A;  5CV4 A;  4R9W A;  3PUY A;  2JA8 B;  4ME5 A;  4L6T B;  4KD4 A;  4XYO A;  2H4O A;  4NKL A;  2F0N A;  3VR3 A;  1HHV A;  5ELE A;  3V96 A;  5A2Q L;  4TRD A;  3BDC A;  2F3V A;  4RKL A;  1GUS A;  3ZYY X;  4K14 A;  1S5F D;  1BCP B;  3C2P A;  1SNP A;  1C4Q A;  2L5T A;  3ERO A;  2OF1 A;  4ZK9 B;  4B9X A;  2EZV A;  3NHH A;  3RZD B;  5EBC A;  4K2K A;  3A54 A;  2RSO A;  4KN4 C;  1G2S A;  2R93 B;  3A7A B;  3KK7 A;  2F0D A;  3K6O A;  5EPJ A;  4RH6 A;  1PLF A;  1ENF A;  3DWQ A;  2I07 B;  5CYU A;  3GP7 A;  4V0B A;  4H44 C;  3GTQ B;  1QG7 A;  3NXW A;  1EY0 A;  4RGT A;  3NWT A;  2R3Z A;  1ZKO A;  4BBS B;  2E2J B;  5EKK A;  5KGU A;  4HCE A;  1Z6H A;  5COY A;  4RFB A;  1F9P A;  4BS9 A;  1QOH A;  3C1F A;  1BCP C;  5FKA C;  1G2T A;  3Q24 A;  3MXU A;  4K5V A;  3HRZ C;  4OL7 A;  4F87 A;  5C3X A;  1EEF D;  1GHK A;  2VB3 X;  1GJX A;  1C8C A;  3I72 A;  1Y8N B;  3E5S A;  3GTG B;  5D14 A;  1SYF A;  3HOW B;  1DON A;  5BN4 A;  2A74 C;  5T1I A;  1OXT A;  4C3I G;  4Y7N B;  4KY5 A;  5D65 A;  5J22 A;  4Q5V A;  4A3M B;  4IFD H;  4KKU A;  3D6C A;  2FMM A;  2J7Z A;  3CQZ B;  4KI0 A;  1AZP A;  3NBI A;  1E2Z A;  3MAQ A;  3GQB A;  3NK9 A;  2RA4 A;  3A55 A;  2SNS A;  3HEJ A;  1JWU D;  3GV3 A;  3RMH A;  1MBY A;  3PUZ A;  1EWC A;  3GO5 A;  3H3V C;  2K28 A;  4QF4 A;  1DM0 B;  4CJ1 B;  1D1K A;  2LFN A;  2AQ2 B;  2AWN A;  3ONA B;  1EU4 A;  2G9D A;  5D3I B;  3J81 L;  3Q6S A;  2F0E A;  3SE0 A;  4QUF A;  2WKD A;  2HUG A;  2PQE A;  1GUW A;  4N9T A;  2NBF A;  2NTS A;  2Z1C A;  1EQV A;  1Q1B A;  3AMU A;  3GTL B;  1JWS D;  3PUX A;  4FF3 A;  3M4Y A;  3AB9 A;  3KBG A;  4KJO A;  4LJZ C;  4XTC S;  3MWY W;  1HA6 A;  5CGK A;  2OT2 A;  1D1I A;  2X69 A;  1PXU A;  1O7Y A;  5FO9 B;  3K59 A;  1K83 B;  2WP8 J;  1A2U A;  2XWJ B;  2D62 A;  1I4Q A;  2B2T A;  2AUK A;  1LAB A;  3L9A X;  2B2T C;  3G6J B;  1LAC A;  1HPC A;  1L0Y B;  1SE3 A;  4WOR A;  3FPP A;  3NWS A;  1EY9 A;  1QCB D;  3MFY A;  1J8I A;  5EKL A;  1DCZ A;  3W2D A;  3PUW A;  1RJT A;  1EYA A;  1U4R A;  1PFN A;  3ND8 A;  2NN6 G;  1ZYR D;  1JWM D;  4WRD A;  4ZKB B;  5G3L F;  1QJO A;  1I4G A;  2SDF A;  1SFO B;  1UAP A;  1B3A A;  2F0S A;  3EJI A;  1TT2 A;  4OHJ A;  1T5X D;  2JEA I;  1WTW A;  1Q3L A;  2D2C C;  5JAV A;  4XIG S;  3LWU A;  5BN3 A;  3JAM E;  1B50 A;  2NN6 I;  5M5W B;  1U4P A;  3TSS A;  1C48 A;  1VF5 C;  2PZT A;  1Z47 A;  1U4L A;  4CKB A;  1UEA B;  1ESR A;  4DGZ A;  2NVT B;  1M4V A;  3TZD A;  2ZXR A;  2RBM A;  1EY6 A;  2A6H C;  1QNK A;  1GHJ A;  5EKI A;  4JK1 C;  2L0C A;  4EQN A;  1BXT A;  4RWS C;  2E75 C;  2O2L D;  1Q8I A;  5I2Y A;  1MI2 A;  3R93 A;  3C1E A;  3SDZ A;  1PTO F;  2KCC A;  2DNE A;  4DK1 A;  5JPM C;  4A93 B;  4XQN A;  4IZ8 A;  5C4J B;  4R8N A;  2R61 A;  1BNZ A;  2JEB I;  1EY8 A;  1F9R A;  2A68 C;  2I46 A;  1EIH A;  5E3F A;  3GTO B;  2NUC A;  1SE2 A;  5E4W C;  4XQQ A;  1S4Z A;  5ELC A;  4Q0F A;  1PDQ A;  1MSH A;  2TSS A;  3GTM B;  4IUT A;  1D2B A;  1SNO A;  3VYU A;  1SNM A;  3BDL A;  2HDM A;  2IWH A;  2ID0 A;  4K8I A;  4OO1 G;  2EY6 A;  1LV9 A;  2B2W A;  5HGT A;  3D31 A;  1D5Z C;  1QIL A;  2B2W C;  2IX1 A;  5EPL A;  4QCL A;  1B2T A;  2R6G A;  1EEI D;  5IT9 L;  2Z4H A;  1KDC A;  3CRL C;  3TP6 A;  4ID6 A;  4EGV A;  1E2V A;  1PTO B;  2C5C A;  1LO5 D;  3VYS A;  4X3S A;  4OO1 I;  5DNF A;  4HAE A;  1GOZ A;  1TS2 A;  4F88 A;  2F0F A;  3DHQ A;  3HOX B;  2EOT A;  1W6K A;  2DN8 A;  4KKS A;  2X6L A;  1JQY D;  1TWC B;  4FXG C;  1JIC A;  5FO7 B;  1G29 1;  3D3R A;  3MTS A;  1S5C D;  4IUP A;  2JSO A;  4A3I B;  2A69 C;  3GTK B;  2E74 C;  1JOO A;  3U9O A;  1H9K A;  2Q8I B;  4DAV A;  2BE5 D;  1JR0 D;  2DY8 A;  5C5M A;  1XX8 A;  4FF1 A;  4K5X A;  3R8B A;  5JJZ A;  3SVM A;  3A8I E;  2XRS D;  4J1M A;  5M5X B;  1STH A;  1A6X A;  1XXG A;  4JBW A;  1RTO A;  1IL8 A;  4IQZ A;  4CGY B;  4ZKC B;  3C46 A;  5DEH A;  5C0X G;  4KMU C;  5EGT A;  1PTO C;  4C3H G;  2Q8R E;  1Y69 U;  3FDT A;  1HFG A;  3IL8 A;  3NTH A;  2DNC A;  1T5E A;  1YNN D;  1HQM C;  3G7L A;  3L7Z C;  3FVQ A;  5C0X I;  2F3W A;  2MGS A;  1I50 B;  2NTT A;  3RD4 A;  1RCV D;  4IUU A;  1WTV A;  2PW5 A;  1SJE D;  3I70 A;  4BY1 B;  3IKJ A;  1ENC A;  1PYW D;  2NN6 H;  5JEA G;  1HTL D;  4QB4 A;  1OXX K;  2PMZ B;  3A8J E;  1B44 D;  4LMQ D;  2FFK B;  1F9Q A;  5C6A A;  1H9M A;  2F0L A;  1OXV A;  2L9H A;  5IOD A;  4G7Z C;  2N55 A;  1IYV A;  2HCI A;  2VUM B;  2KUM A;  2B2V C;  2F0O A;  1M8A A;  4QUC A;  3SK5 A;  5CV6 A;  1SYG A;  2XWB B;  1YNJ D;  4EVO A;  4RHS A;  1GUG A;  1TY0 A;  3TN2 A;  2F03 A;  4H0L C;  1L0X B;  4J6H A;  1WTP A;  1AEX A;  3SXH A;  1HA5 A;  4ZQ3 A;  3HOU B;  2EY1 A;  3CRK C;  4C56 C;  3A56 A;  3E0J A;  3I3C A;  2K33 A;  1DYQ A;  1W6J A;  3TME A;  1BO0 A;  1FNV A;  3S16 B;  1EQT A;  1PRT D;  1CHP D;  1K8M A;  3MFG A;  2EYO A;  4DXF A;  2KQ3 A;  5IGC A;  3J80 L;  2XN9 C;  1QWY A;  1CTM A;  3BYT B;  5CV9 A;  1IKL A;  1KLU D;  3WDN A;  1A15 A;  5IGG A;  4A3B B;  5EJW A;  1EZ6 A;  1CK1 A;  2PZU A;  4MIU A;  2E2D C;  1KTK A;  1LTS D;  2RDG A;  3DWA A;  3IAY A;  2O4X A;  2H1E A;  1SSO A;  1A3V A;  3D6W A;  1CA6 A;  1TS5 A;  5E4X A;  1G91 A;  1HXY D;  2IX0 A;  3I4L A;  3OMG A;  2F0I A;  2WIN B;  5LHY 1;  1VDZ A;  2F0K A;  1IYU A;  3NUC A;  4ZRZ A;  4CJ0 B;  1WVL A;  2TMP A;  1B4O A;  1DOL A;  5LL6 X;  3RUZ A;  1EU3 A;  4BBR B;  5LL6 S;  3GV6 A;  4CKC A;  4DAY A;  1D5X C;  4DFA A;  1RD9 D;  4OO1 H;  2M00 A;  1QE6 A;  5C0X J;  5J39 A;  1OXS C;  1B53 A;  1E0B A;  1XWE A;  3BVZ A;  3H09 A;  3C3L A;  2EY5 A;  2KEE A;  4XDX A;  2CVR A;  4XXE A;  2F0H A;  5I9O A;  1I4X A;  3WOE A;  4L63 B;  1NR2 A;  1AP0 A;  1Q12 A;  2GA4 B;  3U9S A;  1CQV A;  4XT1 B;  3K5L A;  1JOK A;  3I91 A;  5K36 G;  5ISR A;  1PZK D;  1EFI D;  3S17 B;  1H9R A;  2F0V A;  2CW0 C;  1CT1 D;  1XTC D;  1V1P A;  2B63 B;  1G6Z A;  2BCO A;  2JA7 B;  4C1N K;  2CHB D;  1HRJ A;  1LTA D;  5C4X B;  1X3P A;  1EWH A;  2RVL A;  5JEA J;  1ENA A;  2ICE C;  2BA0 A;  3Q23 A;  2JA5 B;  3QB3 A;  1SAP A;  1IW7 D;  1A3U A;  4ILW A;  3A7L A;  3K57 A;  5CV8 A;  3HZX A;  2JA6 B;  4WFN 3;  3NE5 B;  1SMY C;  4K6L A;  1LT4 D;  2A6E C;  3K7A B;  1FNU A;  3HS0 C;  2F0W A;  5CV5 A;  4ZYS A;  5C0X H;  2PO4 A;  2J4X A;  3T51 B;  5I4D A;  2K7V A;  1H9S B;  3TBI B;  4KN7 C;  3SR1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...