4QUCA

Crystal structure of chromodomain of rhino
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
56
structure length
56
Chain Sequence
EYVVEKILGKRFVNGRPQVLVKWSGFPNENNTWEPLENVGNCMKLVSDFESEVFRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RE36324p
publication title Transgenerationally inherited piRNAs trigger piRNA biogenesis by changing the chromatin of piRNA clusters and inducing precursor processing.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Protein binding
total genus 12
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2014-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4qucA00
4IUTA 2KUMA 2J7ZA 2X6LA 2B2YA 1HUNA 1PFMA 4QUCA 2K05A 5JJZA 1MGSA 1U4MA 3F2UA 4CJ1B 1WTPA 1LV9A 2H1EA 4IUQA 1WTRA 2K03A 1BBXC 1BO0A 4MN3A 1JICA 2KVMA 4HEDA 2FJ2A 2IL8A 2D9UA 1ILPA 2EPBA 1J8IA 1WTVA 1MI2A 1HFNA 3GV6A 4IURA 2NYZD 1DONA 2L1BA 4X3KA 4ZK9B 3UI2A 5D65A 2NZ1D 3FDTA 3FPUB 3Q6SA 2L9HA 1AP0A 1GUWA 1IL8A 1U4RA 1PDQA 2B2UC 1RTNA 2X6GA 3IFDA 4RAUC 4X3SA 3TZDA 1DZ1A 1F9SA 2RA4A 1QE6A 2VXWA 1B2TA 2B2YC 1S4ZA 2KEDA 1RTOA 2B2WA 1WD1A 2KEEA 3HP3A 4NW2A 1U4LA 2RSNA 2KECA 1BF4A 1HRJA 1PFNA 5T1GA 1M8AA 2EE1A 3N52A 1DOKA 1X32A 3D6WA 1SAPA 2HUGA 2DY7A 1EQTA 1B3AA 5EPKA 2RSOA 4DN4M 1C8CA 3ONAB 2HCIA 2HCCA 4RA8A 1RODA 2MP1A 4IUPA 4XDXA 2B2VA 1AZQA 4IUUA 1CM9A 1E0BA 1MSGA 1WTOA 2JP1A 2N55A 1F9RA 2L11A 5D14A 1SSOA 1DOLA 2B2TA 1RJTA 2HDLA 4ZKCB 2B2WC 1X3PA 2XIWA 1TVXA 2K1BA 1EIGA 2K01A 3I3CA 4HCSA 5CBAE 1IKMA 1G91A 3I91A 4OIKA 1EIHA 4QUFA 4HAEA 1SDFA 1B4OA 3KUPA 1XYIA 2K28A 1MSHA 4ZAIA 5E4XA 1BNZA 3TN2A 1G2SA 3DEOA 4XT3B 1J9OA 2B2VC 4XT1B 4R8IA 1NR4A 2L12A 4LMQD 4OIJA 5EKIA 4CJ0B 3I90A 4ZLTF 2B2TC 5CMDA 1ESRA 5EPLA 4X3TA 1RHPA 2DY8A 1KNEA 2SDFA 3I8ZA 2FMMA 2MJ8A 1HUMA 2BDNA 2CVRA 3MWYW 2FFKB 1NAPA 3P7JA 5EJWA 1B50A 1NR2A 1VMPA 4O42A 1Q3LA 4ZKBB 1B53A 2EOTA 3R93A 1IKLA 1NCVA 1EL0A 1HHVA 1EOTA 1ML0D 4X3UA 1QG7A 2RVLA 3IL8A 3G7LA 2Q8TA 1WTWA 2FHTA 2K04A 2N88A 2MGSA 2MPMA 1WTXA 1PLFA 1VMCA 1X3QA 4RWSC 1G2TA 3GV3A 1WD0A 2FINB 1PFBA 3DEPA 5T1IA 1KNAA 2HDMA 4IUVA 1U4PA 2L4NA 2X69A 5CBEE 1ICWA 1F9QA 1G6ZA 1XX8A 5EPJA 1O7YA 1HFGA 1WVLA 1ILQA 5EQ0A 1WTQA 1CA6A 3KBXA 1JE4A 5CORA 1A15A 3SVMA 1CA5A 1F2LA 5E4WC 2Q8RE 1HA6A 4HSVA 1QNKA 4U68A 2M2LA 1ZXTA 1DOMA 1O7ZA 2NWGA 4MHEA 5AFWA 3DM1A 1AZPA 3H91A 3LWEA 1F9PA 4CJ2C 3MTSA 2R3ZA 5DNFA 2JYOA 4UAIA 2B2UA 4R9WA 2KOLA 1O80A 5COYA 3QO2A
chains in the Genus database with same CATH superfamily
4EX5A 2B2YA 3CC7A 1F77A 3KDFA 4LF4Q 2NTTA 4C1NI 3H15A 3NP8A 1EY6A 1SJHD 3K81C 2F0UA 2BOSA 2PI2A 5BN5A 4G7HC 5CR3A 4K0KL 2R7FA 5IP9G 4JI7L 2HT1A 4IFDJ 3FPUB 1W6KA 1HR0W 3TMEA 1E24A 4GLVB 4YCVA 4YHHQ 3URYA 1EY9A 1RTOA 1GUNA 2WACA 5JEAJ 2EY1A 5IODA 3AFQA 1AH9A 3N52A 3GD7A 4LFAL 1V1OA 1CSPA 2A73B 3PSIA 1LTLA 4X64L 5K36H 4RH6A 4DNIA 5I9PA 4NXNL 5FO9B 4GNXB 1D8LA 5JAVA 1QWYA 2Q2IA 4IFDG 4UP8A 3HKZG 1K0SA 3CHBD 2UU9L 1EIGA 2ZT9C 4B3SQ 5JEAG 4QGUA 3HOXB 3I55A 2ID0A 1PH4A 2A5HA 4FF4A 3SK6A 1EIYB 1MSHA 2ICIA 4ZAIA 3PV0A 3TN2A 1IW7C 1G2SA 4KN7C 5IGFA 4OIJA 3F8TA 1EWCA 3W5OA 4JOIA 2UXDL 1Y1WH 3OMCA 4K5WA 2CVRA 4C3IH 1QVCA 1I4PA 1AFPA 1IBKL 3P1HA 3X3NA 4K8JA 1TY2A 4RGMA 4B3TQ 2KCMA 3HOZB 1D5ZC 3CC4A 1XNRQ 1TQOA 4H7BA 4JI1Q 1WYDA 1VQ7A 1VQPA 1I3QB 1N36Q 1H9KA 3CP0A 3DM3A 4A93G 1J6QA 4NP5A 4RGNA 2AQ3B 4IUVA 3W1BA 1S72A 3GTPH 4L5TA 3Q22A 2B29A 2BE5C 3D3RA 5IGDA 3PO3B 5C4HA 1WVLA 2PPBC 1J5EQ 3EA6A 1N9WA 1XWEA 3TSSA 1Z47A 4V190 1HNXQ 4TSSA 5LMUQ 1YVCA 1IBLQ 3GTMH 4CJ2C 1F9PA 5H1SE 3SK4A 1V1PB 4B9XA 1K0RA 3L7ZC 4F87A 4QUCA 4TRDA 3U4ZA 1X65A 2JA8G 1G8ZD 2Z0SA 2Z9HA 2UXCQ 1FNWA 2A69C 1E2VA 2IL8A 1J8IA 1UEAB 2Z8LA 3S17H 1I5FA 1C9OA 2UUBL 2NYZD 4C3JG 4DR6L 4C3IB 4X3KA 1LABA 3I70A 3FDTA 2RHQB 1RF2D 3K6OA 4RG1A 2UUAQ 2R7ZH 4QB4A 3GTGH 5C4XH 1QZGA 4F8MA 1PRTD 3SR1A 3S14H 2PQAA 4K2KA 2WIIB 4A3EH 2I5MX 5T1GA 4CGYB 2OT2A 4YWMA 4FDBA 2HUGA 3KF8B 1STGA 2NZHA 1PHJA 2MP1A 4DK6C 1QB5D 1SBBB 4QY7A 4DR1L 1E0BA 1OXVA 2OTJA 1SNCA 1B9NA 3IAYA 1F2ZA 4JI6L 2E74C 4P2CB 3GTKH 4A3JG 1G91A 1PZKD 5IT9L 1EYAA 1NMFA 4DV6L 3A56A 3OWFA 4HIKA 2YV5A 5I6YA 3EQLC 3ZYYX 5E7NA 2R93B 3I90A 3ZJYC 4NB3A 4LUZA 5IYDG 4DV2L 1Y14B 1R4PB 1K28A 4A3KH 4A3KG 4ALPA 2ZJPA 4IO9A 2K32A 3OWEB 3Q24A 2F52A 5AJ3L 3GTQB 4X66L 3GTGB 1CT1D 1D5MC 1SXTA 4X3UA 4JI4L 3BVMA 1H95A 3EROA 3H09A 3C2PA 2I5LX 4PMBA 4G7OC 4A3EB 1LACA 3EVQA 1Q1EA 2A6HC 4DAYB 4PZ7A 1ESFA 1PYWD 1Q46A 2L4NA 4DV1Q 1ICWA 4DNRB 2A6EC 1ILQA 2D5DA 4DV7L 3S1MH 2K33A 3TREA 3JAMc 4YCWA 1A3VA 4KKSA 1SYFA 4K6DA 5M3FH 1WOCA 3GTKB 2NWGA 1PTOB 1NUCA 4IJHA 1CQVA 5KGUA 2MUYA 4L63B 4JC0A 4R8NA 1PZJD 5IWAQ 2Z4HA 4DAMA 1YIJA 3I4MB 1ENFA 1HZCA 2EJMA 2Y0SB 3HOYG 1N32L 4I7AA 2K03A 1JOQA 1BDOA 2FJ2A 1DXMA 4JI8L 2AQ1B 1B3QA 1CKOA 3E9HA 3TP7A 1SNPA 5FJ8H 3UDIA 4DV5L 2WP8J 3FKIB 2L9HA 4A3CG 1ENCA 2F0HA 3A8JE 4A3DB 4L5SA 4JBWA 3PIO3 2AWOA 1SROA 2Q8IB 5BN3A 1S5ED 2F3VA 3A55A 2CW0C 3VYUA 1Y1VH 1GM5A 1SAPA 3R8BA 4XQQA 3PO2B 2WKCA 2ZTCA 4K2LA 1KAAA 3H3VI 2JP1A 5CYUA 1YHBA 1JT8A 1SSOA 5CV8A 2B2WC 1TVXA 4BBRG 4BBRH 3A54A 4QCLA 4DF7A 4RGTA 5FKAC 2K50A 1GOZA 1EIHA 1EY4A 1HH2P 3MXPA 5C3EB 4DNTB 4AIMA 2CWPA 3HG9A 3FPPA 1MIUA 1BNZA 4JI5L 1B70B 2F0WA 4HN7A 4BXXG 4BXXH 4R8IA 3K5NA 1KRTA 4ODGA 5CV7A 2MQHA 5EKIA 1E1TA 3G6EA 4ZLTF 4RFBA 4IPGA 1KNEA 3TRZA 2SNSA 1BCPC 4KJOA 2PZWA 1WJJA 1D6EC 4XXEA 4ZKBB 1YITA 1NCVA 3NHHA 4POGA 2B39A 4L6TB 4GLAC 1NMGA 3E3XA 4DR4Q 1VQ6A 1LT3D 5A2QL 4RWSC 2EDGA 4IJLA 3KLSA 1HZ9A 2R92G 1Y1VB 3DEPA 5T1IA 1HZBA 1P8LA 3TBIB 1XJVA 3JAME 5KNCA 4MTNA 3T1YQ 3CRLC 1BQQT 4B3RQ 2E2HH 2ZM6Q 4TVAB 3SVMA 1HNWL 1F2LA 2LFNA 2A19A 3HFZB 1PYSB 3A5ZB 3BDLA 1X56A 2LY7A 5AFWA 4EGVA 4R9WA 3K59A 1DYQA 1JQYD 1JCKB 2PQEA 4XQJA 4L8JA 3H3VC 3M7GA 3F2UA 4DUZQ 4OO1H 1L2FA 1HR0Q 3BJUA 5C4JB 5EBCA 1PA6A 2VL6A 1OXXK 2Z4IA 4CKBA 1I4RA 1PDQA 4BY1H 3CD6A 3ITPA 1LTBD 1PMRA 4JCVE 1L0XB 3QIAA 5ELEA 2Y0SE 3UE1A 1PH6A 5IYBG 2KECA 2JA7G 3CQZH 1M8AA 1VQJA 1TIID 4QF4A 4LF8L 1BBWA 1KC8C 1H9SA 4IUNA 3VR4A 1CSQA 2XSCA 3KYHC 1PH3A 2A8VA 3TS0A 5BR8Q 4DUYL 5KIXA 4BA1I 3J7AV 4AYBB 1SR3A 2EYPA 3RR5A 1E7ZA 1BR9A 1QOHA 2LKVA 4MZ9A 3NSWA 3OPOA 1ICFB 1ZYRD 1XPRA 4LFBQ 2QEXA 1STAA 5CV9A 2IHFA 1QCBD 1GUGA 2B2VC 4A3MH 3J81i 3SE0A 1TWFH 1I6VC 4C3HG 2DY8A 3I8ZA 3BDCA 4LF7L 1HUMA 2NVQB 1N34Q 5BN4A 4DU9A 1Q82C 4BY7H 1K8GA 2Q2TA 3W3AA 1E22A 4JV5L 4BY1B 2ATWA 4NXMQ 4JBMA 1QG7A 2JE6I 2DUDA 1S5DD 4DPGA 2VUMB 2F0SA 3H0GG 5M3MB 4O2DA 1QVFA 4QQBX 1L0WA 2R6GA 3CXCA 3D8GA 5D3DA 1HFGA 2MO1A 4K6LA 1JE4A 3A5UA 1YEZA 5C44H 1HTPA 1ZXTA 4FXDA 1EEFD 2Z6BA 3NTIA 4E6IA 3WOEA 2O5JC 4KMUC 1U0LA 2K52A 3MTSA 4YHHL 3SEBA 4WJ4A 5M5XH 4JK1C 3QO2A 3KF6B 1M90C 5ELNA 1JC7A 1Y8NB 4A3BB 1W6JA 2PO4A 4PZ8A 1S5BD 3NBHB 4JI2L 3K57A 5DM63 5M5WH 4GN4B 1BO0A 1TWFB 1D1IA 1ILPA 2EPBA 1LTID 4UP7A 1OXUA 4GOPA 3ULJA 3D4WA 1UUPA 5DEHA 2BH8A 3VA5A 1U4RA 4BY7B 1EYCA 3D4DA 4BBSH 1CKNA 2KENA 1QUQB 4B3SL 5JJIA 3UE0A 1SJED 3C1EA 2KEEA 4GLXA 3LGJA 1VQFA 4A3IH 2LXKA 2JA6G 3RZDH 3K8AA 4ZRZA 3NTHA 2EYJA 1WCMG 4DN4M 3HOUB 3JAML 3RLFA 1SMYC 1B9MA 2K5WA 3S1NB 3BS1A 4TKOB 4WORA 1KAWA 4CDFC 3MXUA 4GNXA 5I2YA 3F2CA 3KUPA 1XNRL 2IY5B 2O2LD 5M5XB 4HCEA 5C0XH 2K5VA 2SNMA 5HGTA 4JBKA 3VR6A 3ER0A 4XT1B 2KCCA 4KY5A 3S1QB 4A3LG 2EZVA 4AYBE 1T5XD 4FVMA 2IHEA 1R4QB 2QDLA 1DD2A 2D0OA 2BCOA 1AE3A 2E2DC 3R2IA 2EOTA 1HNXL 3IRBA 5LMUL 2F0PA 2AUJD 2FMCA 3RMHA 5ELCA 3GO5A 1W3SA 3M4QA 5LL6S 2PNRC 1F2YA 1YNJD 3T51B 4CBVA 4A3IB 3CCLA 1TXYA 2D62A 5IP7H 1CUKA 2QCPX 2YU9B 3TQYA 4DR3Q 4RHSA 4NPSA 1O7YA 4H13C 1EUJA 3AFPA 4APVA 1SE8A 5E4WC 4GNXC 1QNKA 2RHSB 4YWLA 2UUAL 3S2HB 3N6RA 3J80c 2E8GA 5GROA 2KHSA 4JYAQ 3J81L 2QILA 5HGQA 1A8VA 4IOCA 1MGSA 2N8NA 2F0LA 3F1ZA 4IUQA 1WTRA 2MFIA 2GVBA 3WDNA 3I4NG 2GA4B 2CWAA 4LJZC 2RDGA 2CFMA 1HPCA 4HSPA 2UUCL 1KABA 2OQKA 3UI2A 1TWGB 3CPWA 2B63H 1DZ1A 5IYCG 1BCPF 5JPMC 4ZCKA 1VQAA 4KHZA 3HOXG 4C56C 4EQOA 2RKSA 1A63A 4NW2A 2DJFC 3SK5A 2KCNA 4P75A 3O13A 4XYQA 3S1RH 1NTGA 3OMGA 4QL5A 2O4XA 4OX9L 3PIPA 3PCOB 1G6PA 1Y8PB 3NK9A 3EFXD 2AHOB 3HOZH 4LF6Q 4RCOA 2XN9C 1KQSA 3ULLA 4PNYA 5E4XA 1I3QH 1UAPA 1GHJA 1S40A 4OGQC 1STYA 2VY3A 1L1OB 3MA2B 5CMDA 4LUOA 5K36G 1PRTB 3PO3G 2VB2X 3PO3H 2NVTB 2EXDA 4OL7A 4LFCL 2BDNA 2CHBD 2MO0A 3Q23A 4OEMB 4Z9CB 5JOBA 1VMPA 2B63B 1I94L 4A4IA 2PNHA 4L5QA 1MHWC 2N78A 1SYCA 2N88A 3I73A 2JA5B 3SHLA 3DMUA 3ULPA 2K5HA 2F0JA 3HEJA 1XMOL 2HHHQ 1EU4A 1CHPD 4UHVA 1Y69U 1U9RA 2I07B 1MBYA 3NPPA 3S1RB 1PZID 1Y1WG 3UDGA 3J80E 1A15A 1GD7A 4C3IG 3CMEA 3MC0B 4DAYA 5ISRA 4DV3Q 1XNQQ 5DLQE 2YTYA 1VDZA 4MHEA 1JB3A 3H91A 4ZUJA 3NWTA 4GKKL 3DWAA 2KOLA 3FVQA 3JC66 4IUTA 5GADC 3CCUA 1EZ6A 4X62Q 3CCEA 1SNQA 3OSOA 2LSSA 2Z6KC 2Z1CA 1N33Q 3I4LA 3V2TA 3VR2A 1E2ZA 2ES2A 5LL6X 4LUVA 5ELOA 3FP9A 1H9JA 2B2UC 2XWBB 3G6JB 5FLXL 1YZ6A 3IFTA 4LF5Q 3PIP3 3TEHB 1HRJA 4KHVA 3S24A 3E0JA 2B8GA 4FF2A 2XWJB 3U9SA 3CCSA 1C8CA 2R93H 4M1UB 1HQRD 1K3BC 1K9MC 1KHIA 3V96A 4DR7Q 5FK9C 2L5TA 3HKZB 4X65Q 5GAHC 1KD1C 5D14A 4JG2A 1X3PA 3PF4A 2R7ZG 1A2UA 2WINB 4DK0A 3E5SA 3GTQH 3OIQA 5C4XG 1T9HA 1TR5A 1UE7A 3OYYA 4IOAA 1O7IA 1PTOC 1EQQA 4UY8C 2WAQB 4A3FH 4KHPL 5M9OA 4A3EG 3T4AC 2F4IA 2R61A 1NR4A 4OELB 4BWGB 1QVGA 4Q0FA 1PH8A 5E3FA 4CKCA 3K80C 3D31A 4UDUC 4X3TA 3KLWA 3BG3A 1RDPD 1UWVA 3T1YL 5CGKA 2EY2A 1SYGA 4WRDA 1JOKA 3KDFB 4DR2Q 3BYYB 3CCQA 2QGQA 4QIWB 1PTOH 4KTAA 3IKJA 2NN6H 4EQPA 3RNUA 3MFYA 4DV0Q 1C4QA 4A93B 1KLUD 3I4MH 4QMGA 1ET6A 2Y0SG 1SE3A 2AWNA 3K7AH 3F2BA 1F9QA 2G5DA 4OXPA 4RKBA 4R4CA 3OTOQ 1LT5D 1TWAH 3BVZA 3STBD 5CORA 1V9PA 3FKIH 4AH6A 3CCJA 5IOCA 2M2LA 4DGZA 1PXUA 4A3DH 1TKWB 2EY6A 3CMAA 3RD4A 2HQLA 4A3FB 4LF9Q 3FMCA 3WOFA 2DN8A 1WTPA 3ND9A 3PO2H 2G9HD 2OF1A 2J4XA 4K0KQ 4JI7Q 1TWHH 4WFN3 1VQBA 3C3LA 3EIVA 2HQEA 5CV5A 3S9WA 5M3FG 4J1MA 1ZYRC 5JPNC 2VXWA 3M9BA 2I46A 2E2IH 2B2WA 5C3EH 2XGTA 3QJYA 2E5LQ 4LFAQ 1A6XA 3EBEA 4JI0L 3QG1A 1CI3M 1G6ZA 4NXNQ 2QA4A 3K7AB 1EOVA 1WTHA 2IX1A 1TWAB 3NUCA 1HTLD 4EQNA 2UU9Q 1N34L 1KDAA 5FJ8G 2CH4A 2JN4A 3X3MA 1A0IA 3UDFA 2KJXA 3P75A 4NXML 4OO1I 3NQTA 3J7YW 1VQMA 1XYIA 1UE5A 1ENAA 4MIUA 1Q8KA 1YJ9A 5LMNL 3BU2A 1Y1VG 3F2DA 3VR3A 3TZUA 1IW7D 2UXDQ 1G291 1H9MA 1SN8A 1IBKQ 1TWHB 1K83H 2EY5A 1ZEQX 1NAPA 2FFKB 3L0OA 2OEOA 1YJWA 2WAQE 1TS2A 5J1ZA 1HHVA 2EYOA 1LT6D 2E2IB 2QDBA 5A35A 2D0PA 3G7LA 4ME5A 2Q8TA 2CQAA 1TS5A 2IPKD 1HQMC 1B1ZA 1WTXA 3C1FA 2ZXOA 1YHQA 5J39A 3M4YA 2ZJRA 4IALA 4P74A 2F4VL 3QB3A 4P71A 2JEAI 1I50B 5C4JH 1XXGA 4LK1C 1Q7YC 3DUZA 2PQAB 4C2MH 4FP5D 2BE5D 4NKLA 1XMQL 1II3A 2M9VA 3GDEA 3SXHA 4L5RC 3H94A 2DNEA 2F0KA 2R3ZA 4YIJA 2WV6D 1FJGL 1RL2A 1O80A 1CK1A 5C3WA 5GAEC 3J7ZC 3CCMA 5KYIA 2JSOA 2KCTA 3E0EA 3FRPB 3HOYB 1AEXA 4MN3A 1ASYA 1VQ8A 1HFNA 1DCZA 5HY6A 4GN3B 1N8RC 4ZK9B 1YNXA 1K83B 2R7DA 1GKHA 4XIGS 1AP0A 1PVOA 1JB7A 1RTNA 1K3RA 3JAMi 4KKUA 1WD1A 3EJIA 5C6AA 2HIVA 2OQ0A 3D6WA 4X6AH 3MEFA 3GP7A 5EPKA 4DR1Q 3KJOA 4AQYL 4OO1G 1Y8OB 3A0JA 4XDXA 2B2VA 1MSGA 1I6HB 2N55A 2NVQH 5EKLA 4C2MB 1JMCA 2A68C 4ZKCB 1IHZA 4FXKC 3AEVA 2K1BA 3I3CA 1JJ2A 4RKLA 2YTXA 4B3ML 1YNJC 4DV4L 4BY1G 4CDEC 1GHKA 5KRUA 4DV6Q 4A75A 3CKIB 1JJGA 4OWWB 2VUMH 5ELDA 3DEOA 1TWCB 4IPDA 2F0NA 4PV1C 5J3BA 5M3MH 3RZOH 4LMQD 3HOWH 4CDDC 3ERSX 4DV2Q 3HGBA 4DR3L 1XPUA 3S2DB 1FR3A 3BZDB 3BYTB 4DKAC 1X9NA 2ZTEA 5C5MA 1CKMA 4LAAA 2RDHA 3RN2A 4O0AA 4LWCA 2NUCA 2YYZA 1VS0A 1B8AA 3MFGA 2FHTA 2K04A 3MZ5A 2K14A 4HJ5A 2ALYB 2I0QA 2MPMA 3K5MA 4A3BH 2UXBQ 2R92B 1PFSA 1Q1BA 3I72A 2E75C 2HDMA 4A3MG 4DV7Q 1ONLA 1XX8A 4MTKA 2QKIC 3Q8DA 1RD9D 2CQOA 1VQLA 1X54A 2A6HD 4JI3Q 3RLOA 3MVVA 4OHJA 1CA5A 1SYDA 1YNND 5C0XI 4HIOA 1VF7A 2BA1A 2A6ED 2WFWA 4BY7G 3LWUA 1O7ZA 2VZAA 4R4QA 3CU7A 3UDXA 5DNFA 3AB9A 2GVAA 4HJAA 4XTCS 1N32Q 3RZOB 1PTOF 4LF4L 4P72A 3HOWB 3LX0A 2F1MA 4JI8Q 1D7QA 1PH5A 3QWNA 3HOUH 1WTVA 3HOUG 1LM0A 4JBJA 2KHIA 5D65A 2NZ1D 3S1NH 3Q6SA 1GUWA 3U50C 5C44G 3TZDA 5I9OA 2KEDA 3RUZA 1LYLA 4N8FA 3MAQA 4F7XA 2EJFC 4LF6L 1S5CD 3CF5A 1VF5C 2JA7B 1U4LA 5EKKA 2A74C 1XPOA 1PFNA 3TDQA 2VQFQ 3NTKA 1X32A 2VQEQ 1IYVA 1B3AA 2CW0D 4GN5A 3S1QH 1X3GA 4IUPA 5JVG3 2Q2HA 1Q8IA 3I4OA 1WTOA 1DOLA 2M00A 3J81j 2KQ3A 1LT4D 1A2TA 3M3YH 4BBSG 2ICEC 1NE3A 1VCIA 1RIPA 2JXMB 3QOJA 2K7VA 4JI5Q 1VQ5A 2AMCB 2K28A 1Q81C 2K4KA 3AYHB 3TP6A 4A3IG 1KRSA 5C0XJ 2NZOA 2BA0A 2EXZA 3L3OC 2HHHL 2YU9H 4A76A 3GTJH 2B2TC 5G3LD 1SFOH 2SDFA 1I4HA 3P20A 5IGGA 4I7ZC 2PZUA 3U9OA 4O42A 1Q3LA 3S2HH 1BCPD 4FNFA 4B3TL 5IT9c 3B6YA 3A8KE 4OWXB 4JI1L 4H02A 5KNDA 5C0XG 3KFUA 1VMCA 2JQOA 2NBFA 3OHXC 1WD0A 1N36L 2FINB 1PFBA 1V1QA 4HR7B 1KNAA 1EY7A 5CBEE 3KK7A 5E1FA 1E2WA 1N33L 2F0OA 4DFAA 1HNWQ 3KBXA 3L2PA 2DJGC 4O1NA 1J5EL 2FXQA 1CFMA 1TWGH 3GTOB 1DOMA 4KI0A 3M3YB 1AZPA 1JWUD 1H9SB 4R4TA 1IBLL 4DR5Q 4LF5L 4UP9A 2KUMA 2X6LA 4H44C 3FEWX 2P5ZX 4YWKA 3QOLA 1VQNA 5IP7G 3D4RA 2CH4W 3GTJB 2UXCL 1TY0A 1L1OC 1SFOB 3EN2A 4IURA 4DR7L 3I7FA 4X65L 4IN3A 5IGBA 1PRTC 1V8QA 4FF3A 1S4ZA 2G9DA 5L37A 1K8AC 2XNAC 3AU7A 5IIFA 2F0DA 2JA6B 1EEID 3NELA 1MJEA 1DM0B 1EQTA 2RSOA 3ONAB 1SE2A 5G3LF 4N8X1 1V1PA 2NVTH 4DUYQ 2PW7A 3OW2A 2EIFA 4DA2A 2WB1B 3M85A 2B63G 4DR2L 3LNNA 3S15B 3I91A 1VQOA 4HAEA 3CCRA 1W2BA 3E9IA 1SDFA 3NBIA 2JA5H 3WWVA 3PUYA 4DV0L 4HIDA 3T1HQ 3TP5A 4GZYC 2TMPA 2MNAA 4A3GH 3HS0C 1E1OA 1UEBA 4KJNA 3HOVB 2F0FA 3P7JA 4JV5Q 3PGZA 5IT9E 3R93A 3KF8A 1EQRA 3PQIA 3PUZA 2RVLA 3HOZG 1HNZQ 4ZQ3A 1S5FD 4GOPB 2XRSD 1LTAD 3GV3A 4LF9L 3MXNB 3SGIA 3G48A 3VA7A 1CKNB 1U4PA 2QW7A 2EYFA 4DV1L 1BUVT 5KEEA 2CCZA 5IP9H 2WKDA 4LNQA 2Z6KA 3GQBA 5TSSA 4J8QA 5FOBB 1LLRD 1NY4A 3LWEA 1XTDA 3T56B 1IBMQ 5EGTA 2PCFB 2B2UA 4KK7A 1KTKA 3AQQA 4R1JA 4PQXA 4MNOA 4JI2Q 5IWAL 2E5LL 3C46A 1HUNA 2IT1A 1PFMA 4DK3C 3I4NB 1FVIA 4A3GB 1FNVA 2NVYB 2NN6I 4IFDH 1UE1A 2K6AA 3M4OH 4ULLA 4Y7NB 4I65A 1IL8A 3G4SA 2IW3A 5JEAH 2B2YC 3HKSA 4IQZA 3SK8A 2QEJC 3J80i 1BF4A 1K8OA 2WAQG 4K8IA 1Z6HA 1XTCD 2JA9A 1GUOA 2RBMA 2OTLA 4K14A 4RHRA 1EIFA 2MHVA 2C35B 1CHQD 1F9RA 4ID6A 1RJTA 4FXGC 4YCUA 1SMYD 5CBAE 1K73C 2K01A 4HTHA 1RKNA 1FYCA 1B4OA 3CRKC 1SRUA 2KHJA 4A93H 3R2TA 3MEHA 3NENA 4PZ6A 3ERQA 1EY5A 1VQKA 4GKJQ 4KV6A 2WB1E 2R93G 5LMNW 2E2JH 5KNBA 2MJ8A 4F88A 2V1CC 1FNUA 3VYSA 3M4OB 1JR0D 1SEBD 1B50A 1JJCB 1SLJA 2EYHA 1B53A 4PMCA 1PV4A 2C5CA 1X3EA 1MJCA 2JJQA 2ENBA 3IL8A 3V05A 1CTMA 3MHBA 2F0TA 1R9TH 4A3FG 1VQIA 2JA8H 4JOIC 4DR4L 1PH1A 1C7YA 2LXJA 2RCNA 1X55A 4ABNA 5EPJA 1EY8A 2OWOA 3KLSX 1Y1WB 3A74A 4C3JH 1HA5A 4HMIA 4H0LC 1X6OA 4B3RL 4HSVA 2F3IA 4U68A 4JPBW 2ZM6L 1SNOA 2JEBI 3NXWA 1VQ4A 1STBA 1SYBA 2EVBA 2NN6G 5A2QE 5JJZA 1YHAA 3I4MG 1L0YB 1S3OA 3K5OA 2B8FA 1OO9B 3DXJC 3GTPB 2HIXA 3T13A 1A62A 4DUZL 1HR0L 2UUCQ 2E2JB 4YY3Q 3PIOA 3KBGA 3TS2A 4A3JH 3GTLH 4RAUC 2X6GA 3FKIG 1VQ9A 5C3XA 2KBNA 2SEBD 1JOOA 3GTMB 1B7YB 4A3DG 4IPCA 1EQVA 2VNUD 3HP3A 1AN8A 1R9TB 1JORA 2ZTDA 2EE1A 3ND8A 2JA8B 1Q90A 4NMZA 3HRZC 1F2MA 5JJLA 1STNA 2IX0A 3A8IE 5IYDH 3PO2G 1RODA 3S17B 3W1GA 3K0XA 4OX9Q 4C3JB 2L11A 4HIMA 1EU3A 3PUXA 1M4VA 2HDLA 2R7ZB 2L55A 1C0AA 1YBYA 1SMXA 5BR8L 2L0CA 3BVGA 2SOBA 5IGEA 4OIKA 2F0QA 5C4XB 2K5QA 1STHA 3S14B 5C3EG 1EFWA 4XT3B 1HCZA 1J9OA 1KDBA 2UXBL 4LFBL 3PMFA 4X64Q 3A7LA 2F0IA 1YNNC 2DGYA 4B08A 3K5LA 3H6MA 3NQIA 3TP8A 4LFCQ 1FL0A 2K5NA 2K75A 1I50H 2FMMA 1RCVD 2N49A 1LTGD 4JI3L 1I94Q 3J7AF 3J80L 3DWQA 4A3JB 5FO7B 1EL0A 3GTLB 1IKLA 1EOTA 3NEMA 1JWSD 2OXPA 1PRTF 4EQ5A 5HURA 2H4OA 4JVZA 1XMOQ 4UPAA 2EQSA 1X3QA 2AUKA 1G2TA 3R3OA 1OTCA 3HOYH 3HKZE 3MXGA 1DGSA 3RN5A 4K5VA 2B3GA 5EQ0A 1QNUA 2DNCA 4A3KB 1M1KC 3PF5A 2LMCB 1PH2A 5FO8B 1HA6A 1GJXA 4A3CH 4GKKQ 2XRQD 4R4IA 1D2BA 2YTVA 4Q5VA 4KD4A 4J6HA 2LS01 5GAGC 1UNSA 3U4VA 2J7ZA 1MKHA 1NBWA 2K05A 4CDCC 2VQFL 4CJ1B 4OONA 3I2ZA 1GUTA 2VQEL 2JK8A 1OXTA 2KVMA 2K5DA 3BZKA 4KD3A 3S1MB 4QIWE 3BZCA 4N9TA 1HZAA 2L1BA 1I6HH 4WJ3M 5M3FB 4IZ8A 2PI2E 1DJRD 2RF4A 1F9SA 3E6ZX 1QE6A 4P73A 2F0VA 2F3WA 1KL9A 4G57A 1JE5A 1I4XA 1IYJB 3J81c 2RSNA 4POFA 2QF7A 1Z7TA 1DOKA 1TWCH 2PYKA 1BOSA 3OW7A 3DWPA 1YJNA 2HCIA 3I56A 3D6CA 3S2DH 2UUBQ 4IUUA 2IWHA 1HXYD 2PZTA 3KF6A 4DR6Q 2RCFA 2EYLA 2A69D 1GUSA 3NBHA 2XIWA 4M8AA 1WFQA 4AYBG 2PW5A 1VQDA 1Q12A 2ZXPA 2HD3A 1G51A 4KHPQ 4JW0A 2R92H 2L12A 1PTOD 4FF1A 1QUQA 1TS3A 1TS4A 4LW1A 1BXTA 2C9OA 3KLRA 5EPLA 4KN4C 2GN5A 2N3SA 3QR8A 4WJWA 2VW9A 3U58A 4JI6Q 4RCNA 1AE2A 5CV4A 3OIPA 4BBRB 1ET9A 3AMUA 1IL2A 1IXRA 4RGOS 1ML0D 1CQFA 1LTRD 1LO5D 1WTWA 4DR5L 1PH7A 2VUMG 5D3IB 4BA2I 3VDYA 1ASZA 5M3MG 3CPFA 3A7AB 3HOWG 1WI5A 3KOJA 1E3PA 1EZ8A 4CKEA 2Q8RE 3RLNA 3J7A5 1VQEA 5AJ3Q 4X66Q 4JI4Q 4DAPA 4DAVA 4XYOA 2BDOA 5IYBH 2JYOA 4UAIA 2F0GA 3H3VH 1SYEA 2ZXRA 5M5YH 4JYAL 1SNDA 4HCSA 3W2DA 2JA7H 1I4GA 3M4PA 4ME3A 1KIXA 4A3BG 1K8MA 3VR5A 1U4MA 1BCPB 1D5XC 4Y52H 1GXDC 1EY0A 1JICA 4HEDA 1MI2A 3L9AX 1A3UA 2H5XA 3GV6A 1D1KA 2E2HB 1HJPA 4X3SA 2RQXA 2RA4A 1KLGD 3J81E 1B2TA 3PUWA 4JI0Q 3VYTA 4OWTB 2ASBA 4K5XA 1CZWA 1JWMD 4V0BA 3T1HL 1P16A 1V43A 1VQGA 2HCCA 4RA8A 4C3HH 5F2DA 1SE4A 1AZQA 3CAMA 2PMZB 3BDOA 5ELBA 2XVSA 4DV5Q 1BKBA 2B2TA 1A3TA 4QJFA 5EBDA 2J0TD 5C4ZA 1EWHA 4C1NK 1IKMA 5FLXc 3T53B 1KDCA 2I5HA 5M5YB 5LMNQ 3H0GH 1UE6A 1ZKOA 4IPHA 1HNZL 3CQZB 1H9RA 5I2XA 5DAUA 1QJOA 2F03A 2E76C 1C48A 4U673 2ZJQA 2D2CC 3MWYW 3Q0AA 3D0FA 1NR2A 4RMFA 2RDFA 1BBUA 4PG3A 2IJ0A 3GTOH 1NSNS 2A1AA 2F0MA 1O7LA 2O5IC 1EWIA 5IGCA 1TT2A 3K58A 1IBML 1QZHA 1X3FA 5GQOA 1SNMA 2MGSA 3CCVA 1NJIC 4BS9A 2F4VQ 1Q86C 3K7UC 4A3MB 5JVH3 2F0EA 1MD2D 1VQCA 3DHQA 4C3HB 3K0YA 4KLKA 4HJ9A 1KXLA 1XMQQ 3MXNA 4HMJA 2NTSA 1L1OA 1TU2B 4HJ8A 3DLLA 1STEA 5IY0A 4DV3L 3DM1A 5KYLA 1FJGQ 1XNQL 4ZUIA 2NB0A 3NWSA 4KKTA 1LUZA 1PYBA 3H0GB 2JA6H 1FGBD 4ZYSA 4X62L 4KY6A 5I4DA 2VS1A 1WCMH 1LV9A 2H1EA 1BBXC 2EYMA 4DXFA 1CZGA 1IYUA 5EAYA 3VYRA 2D9UA 1LTTD 3NE5B 5C5LA 3S16H 5I6WA 1DONA 1LTSD 3T16A 5C44B 1VQHA 2WB1G 3IFDA 3S15H 4XQNA 1OXSC 4ILWA 2XTIA 5K5PA 1PH9A 3M7NA 1T5EA 1B44D 5M5WB 1U5KA 4AQYQ 5LHY1 4A3LH 2DY7A 4GOPC 4GKJL 1GVPA 2L15A 1CM9A 4N9PA 4R4OA 1IZ6A 3HOVG 3HOVH 4B3MQ 5CV6A 5FLXE 4DV4Q 2NVXH 1NNXA 4BBSB 4FYDA 3PUVA 4QUFA 2A68D 4G7ZC 4NDXA 1BVSA 4CHTB 5J22A 2BH2A 4B9WA 4IFDI 5JJKA 3G71A 2PMZE 2AKWB 3RZDB 4LF8Q 4GS3A 1WCMB 4CJ0B 1Z9FA 3FHWA 3ICEA 1ESRA 1RHPA 3S16B 4G4KA 1EYGA 1EFID 5EJWA 1FD7D 2V4DA 3SDZA 1FGUA 1O78A 4DXGA 4EVOA 5FLMG 5FLMH 4PMWA 2Q2UA 2TSSA 3KJPA 2JA5G 1PLFA 4FO2A 5NUCA 2EJGC 2OCEA 4S3SA 3STBC 2AQ2B 4TQUS 3I4NH 2X69A 1GO3E 5CC4A 4A3GG 4LF7Q 1WTQA 5DM73 1I4QA 2CKZB 1CA6A 3OTOL 3CW2C 1EYDA 2NVYH 4J15A 3OOCA 3HZXA 4DK1A 4YY3L 1QILA 4HJ7A 1AW7A 2VB3X 5IYCH 4Y7NH 2IX3A 2NVXB 3CC2A 1YI2A 3HOXH 5IE8A 5COYA 4KY7A 5ELFA 2KA7A
chains in the Genus database with same CATH topology
2B2YA 1F77A 2NTTA 4C1NI 3NP8A 1EY6A 1SJHD 2F0UA 2BOSA 5BN5A 4G7HC 5CR3A 4IFDJ 3FPUB 1W6KA 3TMEA 3URYA 1EY9A 1RTOA 1GUNA 2WACA 5JEAJ 2EY1A 5IODA 3N52A 3GD7A 1V1OA 2A73B 5K36H 4RH6A 5I9PA 5FO9B 5JAVA 1QWYA 4IFDG 3CHBD 1EIGA 2ZT9C 5JEAG 3HOXB 2ID0A 2A5HA 4FF4A 3SK6A 1MSHA 2ICIA 4ZAIA 3PV0A 3TN2A 1IW7C 1G2SA 4KN7C 5IGFA 4OIJA 1EWCA 3OMCA 4K5WA 2CVRA 1I4PA 1AFPA 3P1HA 3X3NA 4K8JA 1TY2A 4RGMA 3HOZB 1D5ZC 1TQOA 4H7BA 1I3QB 1H9KA 4NP5A 4RGNA 2AQ3B 4IUVA 3Q22A 2BE5C 3D3RA 5IGDA 3PO3B 5C4HA 1WVLA 2PPBC 3EA6A 1XWEA 3TSSA 1Z47A 4V190 4TSSA 4CJ2C 1F9PA 3SK4A 1V1PB 4B9XA 3L7ZC 4F87A 4QUCA 4TRDA 1G8ZD 1FNWA 2A69C 1E2VA 2IL8A 1J8IA 1UEAB 2Z8LA 2NYZD 4C3JG 4C3IB 4X3KA 1LABA 3I70A 3FDTA 1RF2D 3K6OA 4QB4A 4F8MA 1PRTD 3SR1A 4K2KA 2WIIB 5T1GA 4CGYB 2OT2A 2HUGA 1STGA 2MP1A 1QB5D 1SBBB 1E0BA 1OXVA 1SNCA 1B9NA 3IAYA 1F2ZA 2E74C 4P2CB 1G91A 1PZKD 5IT9L 1EYAA 3A56A 3OWFA 5I6YA 3EQLC 3ZYYX 2R93B 3I90A 1R4PB 2K32A 3OWEB 3Q24A 3GTQB 3GTGB 1CT1D 1D5MC 1SXTA 4X3UA 3BVMA 3EROA 3H09A 3C2PA 4PMBA 4G7OC 4A3EB 1LACA 3EVQA 1Q1EA 2A6HC 1ESFA 1PYWD 2L4NA 1ICWA 4DNRB 2A6EC 1ILQA 2D5DA 2K33A 1A3VA 4KKSA 1SYFA 4K6DA 3GTKB 2NWGA 1PTOB 1NUCA 1CQVA 5KGUA 2MUYA 4L63B 4R8NA 1PZJD 2Z4HA 3I4MB 1ENFA 2EJMA 2Y0SB 2K03A 1JOQA 1BDOA 2FJ2A 1DXMA 2AQ1B 3TP7A 1SNPA 2WP8J 3FKIB 2L9HA 1ENCA 2F0HA 3A8JE 4A3DB 4JBWA 3PIO3 2AWOA 2Q8IB 5BN3A 1S5ED 2F3VA 3A55A 2CW0C 3VYUA 1SAPA 3R8BA 4XQQA 3PO2B 2WKCA 4K2LA 1KAAA 2JP1A 5CYUA 1SSOA 5CV8A 2B2WC 1TVXA 4QCLA 3A54A 4DF7A 4RGTA 5FKAC 1GOZA 1EIHA 1EY4A 3MXPA 5C3EB 4DNTB 3HG9A 3FPPA 1BNZA 2F0WA 4HN7A 4R8IA 3K5NA 4ODGA 5CV7A 5EKIA 4ZLTF 4RFBA 1KNEA 2SNSA 1BCPC 4KJOA 2PZWA 1D6EC 4XXEA 4ZKBB 1NCVA 3NHHA 2B39A 4L6TB 1LT3D 5A2QL 4RWSC 2EDGA 3KLSA 1Y1VB 3DEPA 5T1IA 3TBIB 3JAME 5KNCA 3CRLC 1BQQT 3SVMA 1F2LA 2LFNA 3BDLA 2LY7A 5AFWA 4EGVA 4R9WA 3K59A 1DYQA 1JQYD 1JCKB 2PQEA 4XQJA 4L8JA 3H3VC 3M7GA 3F2UA 4OO1H 5C4JB 5EBCA 1OXXK 2Z4IA 4CKBA 1I4RA 1PDQA 3ITPA 1LTBD 1PMRA 5ELEA 1L0XB 3QIAA 2KECA 1M8AA 1TIID 4QF4A 1H9SA 4IUNA 3VR4A 2XSCA 5KIXA 4BA1I 3J7AV 4AYBB 2EYPA 1BR9A 1QOHA 2LKVA 3NSWA 3OPOA 1ZYRD 1STAA 5CV9A 1QCBD 1GUGA 2B2VC 3SE0A 1I6VC 4C3HG 2DY8A 3I8ZA 3BDCA 1HUMA 2NVQB 5BN4A 4DU9A 3W3AA 4BY1B 1QG7A 2JE6I 1S5DD 2VUMB 2F0SA 5M3MB 2R6GA 3D8GA 5D3DA 1HFGA 4K6LA 1JE4A 1HTPA 1ZXTA 4FXDA 1EEFD 3NTIA 4E6IA 3WOEA 2O5JC 4KMUC 3MTSA 3SEBA 4JK1C 3QO2A 1JC7A 1Y8NB 4A3BB 1W6JA 2PO4A 1S5BD 3K57A 5DM63 1BO0A 1TWFB 1D1IA 1ILPA 2EPBA 1LTID 1OXUA 3D4WA 1UUPA 5DEHA 4BY7B 3VA5A 1U4RA 1EYCA 3D4DA 1SJED 3C1EA 2KEEA 4ZRZA 3NTHA 2EYJA 4DN4M 3HOUB 3JAML 3RLFA 1SMYC 1B9MA 2K5WA 3S1NB 3BS1A 4TKOB 4WORA 3MXUA 5I2YA 3KUPA 2O2LD 5M5XB 4HCEA 5C0XH 2SNMA 5HGTA 3VR6A 4XT1B 2KCCA 4KY5A 3S1QB 2EZVA 1T5XD 4FVMA 1R4QB 1DD2A 2BCOA 2E2DC 3R2IA 2EOTA 2F0PA 2AUJD 2FMCA 3RMHA 5ELCA 3GO5A 5LL6S 2PNRC 1F2YA 1YNJD 3T51B 4CBVA 4A3IB 2D62A 2QCPX 2YU9B 4RHSA 1O7YA 4H13C 5E4WC 1QNKA 3S2HB 3N6RA 2KHSA 3J81L 2QILA 1MGSA 2F0LA 4IUQA 1WTRA 3WDNA 2GA4B 4LJZC 2RDGA 1HPCA 4HSPA 1KABA 3UI2A 1TWGB 1DZ1A 1BCPF 5JPMC 4KHZA 4C56C 4EQOA 2RKSA 4NW2A 3SK5A 2KCNA 3O13A 4XYQA 3OMGA 2O4XA 1Y8PB 3NK9A 3EFXD 4RCOA 2XN9C 4PNYA 5E4XA 1UAPA 1GHJA 4OGQC 1STYA 3MA2B 5CMDA 5K36G 1PRTB 2VB2X 2NVTB 4OL7A 2BDNA 2CHBD 3Q23A 4Z9CB 5JOBA 1VMPA 2B63B 1SYCA 2N88A 3I73A 2JA5B 3SHLA 3DMUA 2F0JA 3HEJA 1EU4A 1CHPD 1Y69U 1U9RA 2I07B 1MBYA 3NPPA 3S1RB 1PZID 3J80E 1A15A 4C3IG 3MC0B 4DAYA 5ISRA 1VDZA 4MHEA 1JB3A 3H91A 4ZUJA 3NWTA 3DWAA 2KOLA 3FVQA 4IUTA 1EZ6A 1SNQA 3OSOA 2Z1CA 3I4LA 3V2TA 3VR2A 1E2ZA 5LL6X 1H9JA 2B2UC 2XWBB 3G6JB 5FLXL 3IFTA 3PIP3 1HRJA 4KHVA 3E0JA 2B8GA 4FF2A 2XWJB 3U9SA 1C8CA 4M1UB 1HQRD 3V96A 5FK9C 2L5TA 3HKZB 5D14A 1X3PA 1A2UA 2WINB 4DK0A 3E5SA 3OIQA 1TR5A 1PTOC 2WAQB 5M9OA 3T4AC 2F4IA 2R61A 1NR4A 4BWGB 4Q0FA 5E3FA 4CKCA 3D31A 4UDUC 4X3TA 3BG3A 1RDPD 5CGKA 2EY2A 1SYGA 4WRDA 1JOKA 3BYYB 4QIWB 1PTOH 4KTAA 3IKJA 2NN6H 4EQPA 3MFYA 4A93B 1C4QA 1KLUD 4QMGA 1ET6A 1SE3A 2AWNA 1F9QA 4RKBA 1LT5D 3BVZA 5CORA 5IOCA 2M2LA 4DGZA 1PXUA 1TKWB 2EY6A 3RD4A 4A3FB 3FMCA 3WOFA 2DN8A 1WTPA 3ND9A 2G9HD 2OF1A 2J4XA 4WFN3 3C3LA 2HQEA 5CV5A 3S9WA 4J1MA 1ZYRC 5JPNC 2VXWA 2I46A 2B2WA 3QJYA 1A6XA 3QG1A 1CI3M 1G6ZA 3K7AB 2IX1A 1TWAB 3NUCA 1HTLD 4EQNA 1KDAA 3X3MA 2KJXA 3P75A 4OO1I 3NQTA 3J7YW 1XYIA 1ENAA 4MIUA 3VR3A 3TZUA 1IW7D 1G291 1H9MA 1TWHB 2EY5A 1ZEQX 1NAPA 2FFKB 2OEOA 1TS2A 5J1ZA 1HHVA 2EYOA 1LT6D 2E2IB 2QDBA 5A35A 3G7LA 4ME5A 2Q8TA 2CQAA 1TS5A 2IPKD 1HQMC 1B1ZA 1WTXA 3C1FA 2ZXOA 5J39A 3M4YA 4IALA 3QB3A 2JEAI 1I50B 1XXGA 4LK1C 3DUZA 4FP5D 2BE5D 4NKLA 1II3A 2M9VA 3SXHA 3H94A 2DNEA 2F0KA 2R3ZA 4YIJA 2WV6D 1O80A 5C3WA 1CK1A 5KYIA 2JSOA 3FRPB 3HOYB 1AEXA 4MN3A 1HFNA 1DCZA 4ZK9B 1K83B 4XIGS 1AP0A 1RTNA 4KKUA 1WD1A 3EJIA 5C6AA 3D6WA 3GP7A 5EPKA 4OO1G 1Y8OB 4XDXA 2B2VA 1MSGA 1I6HB 2N55A 5EKLA 4C2MB 2A68C 4ZKCB 1IHZA 4FXKC 2K1BA 3I3CA 4RKLA 1YNJC 1GHKA 5KRUA 3CKIB 5ELDA 3DEOA 1TWCB 2F0NA 4PV1C 4LMQD 3HGBA 3S2DB 1FR3A 3BZDB 3BYTB 5C5MA 4LAAA 2RDHA 2NUCA 2YYZA 3MFGA 2FHTA 2K04A 3MZ5A 2MPMA 3K5MA 2R92B 1Q1BA 3I72A 2E75C 2HDMA 1ONLA 1XX8A 2QKIC 1RD9D 2A6HD 3MVVA 4OHJA 1CA5A 1SYDA 1YNND 5C0XI 1VF7A 2BA1A 2A6ED 3LWUA 1O7ZA 3CU7A 5DNFA 3AB9A 4XTCS 3RZOB 1PTOF 3HOWB 3LX0A 2F1MA 3QWNA 1WTVA 5D65A 2NZ1D 3Q6SA 1GUWA 3TZDA 5I9OA 2KEDA 3RUZA 3MAQA 4F7XA 2EJFC 1S5CD 1VF5C 2JA7B 1U4LA 5EKKA 2A74C 1PFNA 3TDQA 3NTKA 1X32A 1IYVA 1B3AA 2CW0D 4IUPA 5JVG3 1Q8IA 1WTOA 1DOLA 2M00A 2KQ3A 1LT4D 1A2TA 2ICEC 1VCIA 2JXMB 3QOJA 2K7VA 2K28A 3TP6A 5C0XJ 2BA0A 2EXZA 3L3OC 2B2TC 5G3LD 2SDFA 1I4HA 3P20A 5IGGA 4I7ZC 2PZUA 3U9OA 4O42A 1Q3LA 1BCPD 4FNFA 3A8KE 5KNDA 5C0XG 1VMCA 2NBFA 3OHXC 1WD0A 2FINB 1PFBA 4HR7B 1KNAA 1EY7A 5CBEE 3KK7A 5E1FA 1E2WA 2F0OA 4DFAA 3KBXA 4O1NA 1CFMA 3GTOB 1DOMA 4KI0A 3M3YB 1AZPA 1JWUD 1H9SB 2KUMA 2X6LA 4H44C 3FEWX 3QOLA 3D4RA 3GTJB 1TY0A 1SFOB 4IURA 4IN3A 5IGBA 1PRTC 1V8QA 4FF3A 1S4ZA 2G9DA 2XNAC 3AU7A 5IIFA 2F0DA 2JA6B 1EEID 1DM0B 1EQTA 2RSOA 3ONAB 1SE2A 5G3LF 1V1PA 2PW7A 4DA2A 2WB1B 3M85A 3LNNA 3S15B 3I91A 4HAEA 1SDFA 3NBIA 3PUYA 3TP5A 4GZYC 2TMPA 3HS0C 4KJNA 3HOVB 2F0FA 3P7JA 5IT9E 3R93A 3KF8A 3PUZA 2RVLA 4ZQ3A 1S5FD 2XRSD 1LTAD 3GV3A 3VA7A 1U4PA 2EYFA 1BUVT 5KEEA 2WKDA 3GQBA 5TSSA 4J8QA 5FOBB 1LLRD 3LWEA 3T56B 5EGTA 2PCFB 2B2UA 4KK7A 1KTKA 4PQXA 3C46A 1HUNA 2IT1A 1PFMA 3I4NB 4A3GB 1FNVA 2NVYB 2NN6I 4IFDH 2K6AA 4ULLA 4Y7NB 4I65A 1IL8A 2IW3A 5JEAH 2B2YC 4IQZA 3SK8A 2QEJC 1BF4A 1K8OA 4K8IA 1Z6HA 1XTCD 1GUOA 2RBMA 4K14A 4RHRA 2MHVA 1CHQD 1F9RA 4ID6A 1RJTA 4FXGC 1SMYD 5CBAE 2K01A 4HTHA 1RKNA 1FYCA 1B4OA 3CRKC 3R2TA 3MEHA 3ERQA 1EY5A 4KV6A 5KNBA 2MJ8A 4F88A 1FNUA 3VYSA 3M4OB 1JR0D 1SEBD 1B50A 2EYHA 1B53A 4PMCA 2C5CA 2ENBA 3IL8A 3V05A 1CTMA 3MHBA 2F0TA 4ABNA 5EPJA 1EY8A 3KLSX 1Y1WB 1HA5A 4HMIA 4H0LC 4HSVA 4U68A 1SNOA 2JEBI 3NXWA 1STBA 1SYBA 2EVBA 2NN6G 5A2QE 5JJZA 1L0YB 3K5OA 2B8FA 1OO9B 3DXJC 3GTPB 3T13A 2E2JB 3KBGA 4RAUC 2X6GA 5C3XA 2SEBD 3GTMB 1JOOA 1EQVA 2VNUD 3HP3A 1AN8A 1R9TB 1JORA 2EE1A 3ND8A 2JA8B 1Q90A 4NMZA 3HRZC 1F2MA 1STNA 2IX0A 3A8IE 1RODA 3S17B 4C3JB 2L11A 1EU3A 3PUXA 1M4VA 2HDLA 2R7ZB 2L55A 2L0CA 3BVGA 2SOBA 5IGEA 4OIKA 2F0QA 5C4XB 2K5QA 1STHA 3S14B 4XT3B 1HCZA 1J9OA 1KDBA 3PMFA 3A7LA 2F0IA 1YNNC 4B08A 3K5LA 3H6MA 3NQIA 3TP8A 2FMMA 1RCVD 1LTGD 3J7AF 3J80L 3DWQA 4A3JB 5FO7B 1EL0A 3GTLB 1IKLA 1EOTA 1JWSD 2OXPA 1PRTF 5HURA 2H4OA 1X3QA 2AUKA 1G2TA 3R3OA 3MXGA 4K5VA 5EQ0A 1QNUA 2DNCA 4A3KB 2LMCB 5FO8B 1HA6A 1GJXA 2XRQD 1D2BA 4Q5VA 4KD4A 4J6HA 2LS01 1UNSA 2J7ZA 2K05A 4CJ1B 1GUTA 1OXTA 2KVMA 2K5DA 4KD3A 3S1MB 4N9TA 2L1BA 5M3FB 4IZ8A 1DJRD 1F9SA 3E6ZX 1QE6A 2F0VA 2F3WA 4G57A 1I4XA 2RSNA 2QF7A 1Z7TA 1DOKA 2PYKA 1BOSA 3OW7A 3DWPA 2HCIA 3D6CA 4IUUA 2IWHA 1HXYD 2PZTA 2EYLA 2A69D 1GUSA 3NBHA 2XIWA 4M8AA 2PW5A 1Q12A 2ZXPA 2L12A 1PTOD 4FF1A 1TS3A 1TS4A 1BXTA 2C9OA 3KLRA 5EPLA 4KN4C 4WJWA 4RCNA 5CV4A 3OIPA 4BBRB 1ET9A 3AMUA 4RGOS 1ML0D 1CQFA 1LTRD 1LO5D 1WTWA 5D3IB 4BA2I 3A7AB 1EZ8A 4CKEA 2Q8RE 4DAPA 4DAVA 4XYOA 2BDOA 2JYOA 4UAIA 2F0GA 1SYEA 2ZXRA 1SNDA 4HCSA 3W2DA 1I4GA 1K8MA 3VR5A 1U4MA 1BCPB 1D5XC 1GXDC 1EY0A 1JICA 4HEDA 1MI2A 3L9AX 1A3UA 3GV6A 1D1KA 2E2HB 4X3SA 2RQXA 2RA4A 1KLGD 3J81E 1B2TA 3PUWA 3VYTA 4K5XA 1CZWA 1JWMD 4V0BA 1V43A 4RA8A 2HCCA 5F2DA 1SE4A 1AZQA 2PMZB 3BDOA 5ELBA 2XVSA 2B2TA 1A3TA 5EBDA 2J0TD 5C4ZA 1EWHA 4C1NK 1IKMA 3T53B 1KDCA 5M5YB 1ZKOA 3CQZB 1H9RA 5I2XA 5DAUA 1QJOA 2F03A 2E76C 1C48A 4U673 2D2CC 3MWYW 3Q0AA 1NR2A 2RDFA 2IJ0A 1NSNS 2F0MA 1O7LA 2O5IC 5IGCA 1TT2A 3K58A 1SNMA 2MGSA 4BS9A 4A3MB 5JVH3 2F0EA 1MD2D 3DHQA 4C3HB 3K0YA 3MXNA 4HMJA 2NTSA 1TU2B 1STEA 3DM1A 5KYLA 4ZUIA 2NB0A 3NWSA 4KKTA 3H0GB 1FGBD 4ZYSA 4KY6A 5I4DA 1LV9A 2H1EA 1BBXC 2EYMA 4DXFA 1CZGA 1IYUA 3VYRA 2D9UA 1LTTD 3NE5B 5C5LA 5I6WA 1DONA 1LTSD 3T16A 5C44B 3IFDA 4XQNA 1OXSC 4ILWA 5K5PA 3M7NA 1T5EA 1B44D 5M5WB 5LHY1 2DY7A 1CM9A 4N9PA 5CV6A 5FLXE 4BBSB 4FYDA 3PUVA 4QUFA 2A68D 4G7ZC 4NDXA 4CHTB 5J22A 4B9WA 4IFDI 3RZDB 1WCMB 4CJ0B 1ESRA 1RHPA 3S16B 4G4KA 1EFID 5EJWA 1FD7D 2V4DA 3SDZA 1O78A 4DXGA 4EVOA 4PMWA 2TSSA 1PLFA 4FO2A 5NUCA 2EJGC 4S3SA 2AQ2B 4TQUS 2X69A 5CC4A 1WTQA 5DM73 1I4QA 1CA6A 1EYDA 3OOCA 3HZXA 4DK1A 1QILA 1AW7A 2VB3X 2NVXB 2IX3A 5COYA 4KY7A 5ELFA 2KA7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IUT A;  2KUM A;  2J7Z A;  2X6L A;  2B2Y A;  1HUN A;  1PFM A;  4QUC A;  2K05 A;  5JJZ A;  1MGS A;  1U4M A;  3F2U A;  4CJ1 B;  1WTP A;  1LV9 A;  2H1E A;  4IUQ A;  1WTR A;  2K03 A;  1BBX C;  1BO0 A;  4MN3 A;  1JIC A;  2KVM A;  4HED A;  2FJ2 A;  2IL8 A;  2D9U A;  1ILP A;  2EPB A;  1J8I A;  1WTV A;  1MI2 A;  1HFN A;  3GV6 A;  4IUR A;  2NYZ D;  1DON A;  2L1B A;  4X3K A;  4ZK9 B;  3UI2 A;  5D65 A;  2NZ1 D;  3FDT A;  3FPU B;  3Q6S A;  2L9H A;  1AP0 A;  1GUW A;  1IL8 A;  1U4R A;  1PDQ A;  2B2U C;  1RTN A;  2X6G A;  3IFD A;  4RAU C;  4X3S A;  3TZD A;  1DZ1 A;  1F9S A;  2RA4 A;  1QE6 A;  2VXW A;  1B2T A;  2B2Y C;  1S4Z A;  2KED A;  1RTO A;  2B2W A;  1WD1 A;  2KEE A;  3HP3 A;  4NW2 A;  1U4L A;  2RSN A;  2KEC A;  1BF4 A;  1HRJ A;  1PFN A;  5T1G A;  1M8A A;  2EE1 A;  3N52 A;  1DOK A;  1X32 A;  3D6W A;  1SAP A;  2HUG A;  2DY7 A;  1EQT A;  1B3A A;  5EPK A;  2RSO A;  4DN4 M;  1C8C A;  3ONA B;  2HCI A;  2HCC A;  4RA8 A;  1ROD A;  2MP1 A;  4IUP A;  4XDX A;  2B2V A;  1AZQ A;  4IUU A;  1CM9 A;  1E0B A;  1MSG A;  1WTO A;  2JP1 A;  2N55 A;  1F9R A;  2L11 A;  5D14 A;  1SSO A;  1DOL A;  2B2T A;  1RJT A;  2HDL A;  4ZKC B;  2B2W C;  1X3P A;  2XIW A;  1TVX A;  2K1B A;  1EIG A;  2K01 A;  3I3C A;  4HCS A;  5CBA E;  1IKM A;  1G91 A;  3I91 A;  4OIK A;  1EIH A;  4QUF A;  4HAE A;  1SDF A;  1B4O A;  3KUP A;  1XYI A;  2K28 A;  1MSH A;  4ZAI A;  5E4X A;  1BNZ A;  3TN2 A;  1G2S A;  3DEO A;  4XT3 B;  1J9O A;  2B2V C;  4XT1 B;  4R8I A;  1NR4 A;  2L12 A;  4LMQ D;  4OIJ A;  5EKI A;  4CJ0 B;  3I90 A;  4ZLT F;  2B2T C;  5CMD A;  1ESR A;  5EPL A;  4X3T A;  1RHP A;  2DY8 A;  1KNE A;  2SDF A;  3I8Z A;  2FMM A;  2MJ8 A;  1HUM A;  2BDN A;  2CVR A;  3MWY W;  2FFK B;  1NAP A;  3P7J A;  5EJW A;  1B50 A;  1NR2 A;  1VMP A;  4O42 A;  1Q3L A;  4ZKB B;  1B53 A;  2EOT A;  3R93 A;  1IKL A;  1NCV A;  1EL0 A;  1HHV A;  1EOT A;  1ML0 D;  4X3U A;  1QG7 A;  2RVL A;  3IL8 A;  3G7L A;  2Q8T A;  1WTW A;  2FHT A;  2K04 A;  2N88 A;  2MGS A;  2MPM A;  1WTX A;  1PLF A;  1VMC A;  1X3Q A;  4RWS C;  1G2T A;  3GV3 A;  1WD0 A;  2FIN B;  1PFB A;  3DEP A;  5T1I A;  1KNA A;  2HDM A;  4IUV A;  1U4P A;  2L4N A;  2X69 A;  5CBE E;  1ICW A;  1F9Q A;  1G6Z A;  1XX8 A;  5EPJ A;  1O7Y A;  1HFG A;  1WVL A;  1ILQ A;  5EQ0 A;  1WTQ A;  1CA6 A;  3KBX A;  1JE4 A;  5COR A;  1A15 A;  3SVM A;  1CA5 A;  1F2L A;  5E4W C;  2Q8R E;  1HA6 A;  4HSV A;  1QNK A;  4U68 A;  2M2L A;  1ZXT A;  1DOM A;  1O7Z A;  2NWG A;  4MHE A;  5AFW A;  3DM1 A;  1AZP A;  3H91 A;  3LWE A;  1F9P A;  4CJ2 C;  3MTS A;  2R3Z A;  5DNF A;  2JYO A;  4UAI A;  2B2U A;  4R9W A;  2KOL A;  1O80 A;  5COY A;  3QO2 A; 
#chains in the Genus database with same CATH topology
 4EX5 A;  2B2Y A;  3CC7 A;  1F77 A;  3KDF A;  4LF4 Q;  2NTT A;  4C1N I;  3H15 A;  3NP8 A;  1EY6 A;  1SJH D;  3K81 C;  2F0U A;  2BOS A;  2PI2 A;  5BN5 A;  4G7H C;  5CR3 A;  4K0K L;  2R7F A;  5IP9 G;  4JI7 L;  2HT1 A;  4IFD J;  3FPU B;  1W6K A;  1HR0 W;  3TME A;  1E24 A;  4GLV B;  4YCV A;  4YHH Q;  3URY A;  1EY9 A;  1RTO A;  1GUN A;  2WAC A;  5JEA J;  2EY1 A;  5IOD A;  3AFQ A;  1AH9 A;  3N52 A;  3GD7 A;  4LFA L;  1V1O A;  1CSP A;  2A73 B;  3PSI A;  1LTL A;  4X64 L;  5K36 H;  4RH6 A;  4DNI A;  5I9P A;  4NXN L;  5FO9 B;  4GNX B;  1D8L A;  5JAV A;  1QWY A;  2Q2I A;  4IFD G;  4UP8 A;  3HKZ G;  1K0S A;  3CHB D;  2UU9 L;  1EIG A;  2ZT9 C;  4B3S Q;  5JEA G;  4QGU A;  3HOX B;  3I55 A;  2ID0 A;  1PH4 A;  2A5H A;  4FF4 A;  3SK6 A;  1EIY B;  1MSH A;  2ICI A;  4ZAI A;  3PV0 A;  3TN2 A;  1IW7 C;  1G2S A;  4KN7 C;  5IGF A;  4OIJ A;  3F8T A;  1EWC A;  3W5O A;  4JOI A;  2UXD L;  1Y1W H;  3OMC A;  4K5W A;  2CVR A;  4C3I H;  1QVC A;  1I4P A;  1AFP A;  1IBK L;  3P1H A;  3X3N A;  4K8J A;  1TY2 A;  4RGM A;  4B3T Q;  2KCM A;  3HOZ B;  1D5Z C;  3CC4 A;  1XNR Q;  1TQO A;  4H7B A;  4JI1 Q;  1WYD A;  1VQ7 A;  1VQP A;  1I3Q B;  1N36 Q;  1H9K A;  3CP0 A;  3DM3 A;  4A93 G;  1J6Q A;  4NP5 A;  4RGN A;  2AQ3 B;  4IUV A;  3W1B A;  1S72 A;  3GTP H;  4L5T A;  3Q22 A;  2B29 A;  2BE5 C;  3D3R A;  5IGD A;  3PO3 B;  5C4H A;  1WVL A;  2PPB C;  1J5E Q;  3EA6 A;  1N9W A;  1XWE A;  3TSS A;  1Z47 A;  4V19 0;  1HNX Q;  4TSS A;  5LMU Q;  1YVC A;  1IBL Q;  3GTM H;  4CJ2 C;  1F9P A;  5H1S E;  3SK4 A;  1V1P B;  4B9X A;  1K0R A;  3L7Z C;  4F87 A;  4QUC A;  4TRD A;  3U4Z A;  1X65 A;  2JA8 G;  1G8Z D;  2Z0S A;  2Z9H A;  2UXC Q;  1FNW A;  2A69 C;  1E2V A;  2IL8 A;  1J8I A;  1UEA B;  2Z8L A;  3S17 H;  1I5F A;  1C9O A;  2UUB L;  2NYZ D;  4C3J G;  4DR6 L;  4C3I B;  4X3K A;  1LAB A;  3I70 A;  3FDT A;  2RHQ B;  1RF2 D;  3K6O A;  4RG1 A;  2UUA Q;  2R7Z H;  4QB4 A;  3GTG H;  5C4X H;  1QZG A;  4F8M A;  1PRT D;  3SR1 A;  3S14 H;  2PQA A;  4K2K A;  2WII B;  4A3E H;  2I5M X;  5T1G A;  4CGY B;  2OT2 A;  4YWM A;  4FDB A;  2HUG A;  3KF8 B;  1STG A;  2NZH A;  1PHJ A;  2MP1 A;  4DK6 C;  1QB5 D;  1SBB B;  4QY7 A;  4DR1 L;  1E0B A;  1OXV A;  2OTJ A;  1SNC A;  1B9N A;  3IAY A;  1F2Z A;  4JI6 L;  2E74 C;  4P2C B;  3GTK H;  4A3J G;  1G91 A;  1PZK D;  5IT9 L;  1EYA A;  1NMF A;  4DV6 L;  3A56 A;  3OWF A;  4HIK A;  2YV5 A;  5I6Y A;  3EQL C;  3ZYY X;  5E7N A;  2R93 B;  3I90 A;  3ZJY C;  4NB3 A;  4LUZ A;  5IYD G;  4DV2 L;  1Y14 B;  1R4P B;  1K28 A;  4A3K H;  4A3K G;  4ALP A;  2ZJP A;  4IO9 A;  2K32 A;  3OWE B;  3Q24 A;  2F52 A;  5AJ3 L;  3GTQ B;  4X66 L;  3GTG B;  1CT1 D;  1D5M C;  1SXT A;  4X3U A;  4JI4 L;  3BVM A;  1H95 A;  3ERO A;  3H09 A;  3C2P A;  2I5L X;  4PMB A;  4G7O C;  4A3E B;  1LAC A;  3EVQ A;  1Q1E A;  2A6H C;  4DAY B;  4PZ7 A;  1ESF A;  1PYW D;  1Q46 A;  2L4N A;  4DV1 Q;  1ICW A;  4DNR B;  2A6E C;  1ILQ A;  2D5D A;  4DV7 L;  3S1M H;  2K33 A;  3TRE A;  3JAM c;  4YCW A;  1A3V A;  4KKS A;  1SYF A;  4K6D A;  5M3F H;  1WOC A;  3GTK B;  2NWG A;  1PTO B;  1NUC A;  4IJH A;  1CQV A;  5KGU A;  2MUY A;  4L63 B;  4JC0 A;  4R8N A;  1PZJ D;  5IWA Q;  2Z4H A;  4DAM A;  1YIJ A;  3I4M B;  1ENF A;  1HZC A;  2EJM A;  2Y0S B;  3HOY G;  1N32 L;  4I7A A;  2K03 A;  1JOQ A;  1BDO A;  2FJ2 A;  1DXM A;  4JI8 L;  2AQ1 B;  1B3Q A;  1CKO A;  3E9H A;  3TP7 A;  1SNP A;  5FJ8 H;  3UDI A;  4DV5 L;  2WP8 J;  3FKI B;  2L9H A;  4A3C G;  1ENC A;  2F0H A;  3A8J E;  4A3D B;  4L5S A;  4JBW A;  3PIO 3;  2AWO A;  1SRO A;  2Q8I B;  5BN3 A;  1S5E D;  2F3V A;  3A55 A;  2CW0 C;  3VYU A;  1Y1V H;  1GM5 A;  1SAP A;  3R8B A;  4XQQ A;  3PO2 B;  2WKC A;  2ZTC A;  4K2L A;  1KAA A;  3H3V I;  2JP1 A;  5CYU A;  1YHB A;  1JT8 A;  1SSO A;  5CV8 A;  2B2W C;  1TVX A;  4BBR G;  4BBR H;  3A54 A;  4QCL A;  4DF7 A;  4RGT A;  5FKA C;  2K50 A;  1GOZ A;  1EIH A;  1EY4 A;  1HH2 P;  3MXP A;  5C3E B;  4DNT B;  4AIM A;  2CWP A;  3HG9 A;  3FPP A;  1MIU A;  1BNZ A;  4JI5 L;  1B70 B;  2F0W A;  4HN7 A;  4BXX G;  4BXX H;  4R8I A;  3K5N A;  1KRT A;  4ODG A;  5CV7 A;  2MQH A;  5EKI A;  1E1T A;  3G6E A;  4ZLT F;  4RFB A;  4IPG A;  1KNE A;  3TRZ A;  2SNS A;  1BCP C;  4KJO A;  2PZW A;  1WJJ A;  1D6E C;  4XXE A;  4ZKB B;  1YIT A;  1NCV A;  3NHH A;  4POG A;  2B39 A;  4L6T B;  4GLA C;  1NMG A;  3E3X A;  4DR4 Q;  1VQ6 A;  1LT3 D;  5A2Q L;  4RWS C;  2EDG A;  4IJL A;  3KLS A;  1HZ9 A;  2R92 G;  1Y1V B;  3DEP A;  5T1I A;  1HZB A;  1P8L A;  3TBI B;  1XJV A;  3JAM E;  5KNC A;  4MTN A;  3T1Y Q;  3CRL C;  1BQQ T;  4B3R Q;  2E2H H;  2ZM6 Q;  4TVA B;  3SVM A;  1HNW L;  1F2L A;  2LFN A;  2A19 A;  3HFZ B;  1PYS B;  3A5Z B;  3BDL A;  1X56 A;  2LY7 A;  5AFW A;  4EGV A;  4R9W A;  3K59 A;  1DYQ A;  1JQY D;  1JCK B;  2PQE A;  4XQJ A;  4L8J A;  3H3V C;  3M7G A;  3F2U A;  4DUZ Q;  4OO1 H;  1L2F A;  1HR0 Q;  3BJU A;  5C4J B;  5EBC A;  1PA6 A;  2VL6 A;  1OXX K;  2Z4I A;  4CKB A;  1I4R A;  1PDQ A;  4BY1 H;  3CD6 A;  3ITP A;  1LTB D;  1PMR A;  4JCV E;  1L0X B;  3QIA A;  5ELE A;  2Y0S E;  3UE1 A;  1PH6 A;  5IYB G;  2KEC A;  2JA7 G;  3CQZ H;  1M8A A;  1VQJ A;  1TII D;  4QF4 A;  4LF8 L;  1BBW A;  1KC8 C;  1H9S A;  4IUN A;  3VR4 A;  1CSQ A;  2XSC A;  3KYH C;  1PH3 A;  2A8V A;  3TS0 A;  5BR8 Q;  4DUY L;  5KIX A;  4BA1 I;  3J7A V;  4AYB B;  1SR3 A;  2EYP A;  3RR5 A;  1E7Z A;  1BR9 A;  1QOH A;  2LKV A;  4MZ9 A;  3NSW A;  3OPO A;  1ICF B;  1ZYR D;  1XPR A;  4LFB Q;  2QEX A;  1STA A;  5CV9 A;  2IHF A;  1QCB D;  1GUG A;  2B2V C;  4A3M H;  3J81 i;  3SE0 A;  1TWF H;  1I6V C;  4C3H G;  2DY8 A;  3I8Z A;  3BDC A;  4LF7 L;  1HUM A;  2NVQ B;  1N34 Q;  5BN4 A;  4DU9 A;  1Q82 C;  4BY7 H;  1K8G A;  2Q2T A;  3W3A A;  1E22 A;  4JV5 L;  4BY1 B;  2ATW A;  4NXM Q;  4JBM A;  1QG7 A;  2JE6 I;  2DUD A;  1S5D D;  4DPG A;  2VUM B;  2F0S A;  3H0G G;  5M3M B;  4O2D A;  1QVF A;  4QQB X;  1L0W A;  2R6G A;  3CXC A;  3D8G A;  5D3D A;  1HFG A;  2MO1 A;  4K6L A;  1JE4 A;  3A5U A;  1YEZ A;  5C44 H;  1HTP A;  1ZXT A;  4FXD A;  1EEF D;  2Z6B A;  3NTI A;  4E6I A;  3WOE A;  2O5J C;  4KMU C;  1U0L A;  2K52 A;  3MTS A;  4YHH L;  3SEB A;  4WJ4 A;  5M5X H;  4JK1 C;  3QO2 A;  3KF6 B;  1M90 C;  5ELN A;  1JC7 A;  1Y8N B;  4A3B B;  1W6J A;  2PO4 A;  4PZ8 A;  1S5B D;  3NBH B;  4JI2 L;  3K57 A;  5DM6 3;  5M5W H;  4GN4 B;  1BO0 A;  1TWF B;  1D1I A;  1ILP A;  2EPB A;  1LTI D;  4UP7 A;  1OXU A;  4GOP A;  3ULJ A;  3D4W A;  1UUP A;  5DEH A;  2BH8 A;  3VA5 A;  1U4R A;  4BY7 B;  1EYC A;  3D4D A;  4BBS H;  1CKN A;  2KEN A;  1QUQ B;  4B3S L;  5JJI A;  3UE0 A;  1SJE D;  3C1E A;  2KEE A;  4GLX A;  3LGJ A;  1VQF A;  4A3I H;  2LXK A;  2JA6 G;  3RZD H;  3K8A A;  4ZRZ A;  3NTH A;  2EYJ A;  1WCM G;  4DN4 M;  3HOU B;  3JAM L;  3RLF A;  1SMY C;  1B9M A;  2K5W A;  3S1N B;  3BS1 A;  4TKO B;  4WOR A;  1KAW A;  4CDF C;  3MXU A;  4GNX A;  5I2Y A;  3F2C A;  3KUP A;  1XNR L;  2IY5 B;  2O2L D;  5M5X B;  4HCE A;  5C0X H;  2K5V A;  2SNM A;  5HGT A;  4JBK A;  3VR6 A;  3ER0 A;  4XT1 B;  2KCC A;  4KY5 A;  3S1Q B;  4A3L G;  2EZV A;  4AYB E;  1T5X D;  4FVM A;  2IHE A;  1R4Q B;  2QDL A;  1DD2 A;  2D0O A;  2BCO A;  1AE3 A;  2E2D C;  3R2I A;  2EOT A;  1HNX L;  3IRB A;  5LMU L;  2F0P A;  2AUJ D;  2FMC A;  3RMH A;  5ELC A;  3GO5 A;  1W3S A;  3M4Q A;  5LL6 S;  2PNR C;  1F2Y A;  1YNJ D;  3T51 B;  4CBV A;  4A3I B;  3CCL A;  1TXY A;  2D62 A;  5IP7 H;  1CUK A;  2QCP X;  2YU9 B;  3TQY A;  4DR3 Q;  4RHS A;  4NPS A;  1O7Y A;  4H13 C;  1EUJ A;  3AFP A;  4APV A;  1SE8 A;  5E4W C;  4GNX C;  1QNK A;  2RHS B;  4YWL A;  2UUA L;  3S2H B;  3N6R A;  3J80 c;  2E8G A;  5GRO A;  2KHS A;  4JYA Q;  3J81 L;  2QIL A;  5HGQ A;  1A8V A;  4IOC A;  1MGS A;  2N8N A;  2F0L A;  3F1Z A;  4IUQ A;  1WTR A;  2MFI A;  2GVB A;  3WDN A;  3I4N G;  2GA4 B;  2CWA A;  4LJZ C;  2RDG A;  2CFM A;  1HPC A;  4HSP A;  2UUC L;  1KAB A;  2OQK A;  3UI2 A;  1TWG B;  3CPW A;  2B63 H;  1DZ1 A;  5IYC G;  1BCP F;  5JPM C;  4ZCK A;  1VQA A;  4KHZ A;  3HOX G;  4C56 C;  4EQO A;  2RKS A;  1A63 A;  4NW2 A;  2DJF C;  3SK5 A;  2KCN A;  4P75 A;  3O13 A;  4XYQ A;  3S1R H;  1NTG A;  3OMG A;  4QL5 A;  2O4X A;  4OX9 L;  3PIP A;  3PCO B;  1G6P A;  1Y8P B;  3NK9 A;  3EFX D;  2AHO B;  3HOZ H;  4LF6 Q;  4RCO A;  2XN9 C;  1KQS A;  3ULL A;  4PNY A;  5E4X A;  1I3Q H;  1UAP A;  1GHJ A;  1S40 A;  4OGQ C;  1STY A;  2VY3 A;  1L1O B;  3MA2 B;  5CMD A;  4LUO A;  5K36 G;  1PRT B;  3PO3 G;  2VB2 X;  3PO3 H;  2NVT B;  2EXD A;  4OL7 A;  4LFC L;  2BDN A;  2CHB D;  2MO0 A;  3Q23 A;  4OEM B;  4Z9C B;  5JOB A;  1VMP A;  2B63 B;  1I94 L;  4A4I A;  2PNH A;  4L5Q A;  1MHW C;  2N78 A;  1SYC A;  2N88 A;  3I73 A;  2JA5 B;  3SHL A;  3DMU A;  3ULP A;  2K5H A;  2F0J A;  3HEJ A;  1XMO L;  2HHH Q;  1EU4 A;  1CHP D;  4UHV A;  1Y69 U;  1U9R A;  2I07 B;  1MBY A;  3NPP A;  3S1R B;  1PZI D;  1Y1W G;  3UDG A;  3J80 E;  1A15 A;  1GD7 A;  4C3I G;  3CME A;  3MC0 B;  4DAY A;  5ISR A;  4DV3 Q;  1XNQ Q;  5DLQ E;  2YTY A;  1VDZ A;  4MHE A;  1JB3 A;  3H91 A;  4ZUJ A;  3NWT A;  4GKK L;  3DWA A;  2KOL A;  3FVQ A;  3JC6 6;  4IUT A;  5GAD C;  3CCU A;  1EZ6 A;  4X62 Q;  3CCE A;  1SNQ A;  3OSO A;  2LSS A;  2Z6K C;  2Z1C A;  1N33 Q;  3I4L A;  3V2T A;  3VR2 A;  1E2Z A;  2ES2 A;  5LL6 X;  4LUV A;  5ELO A;  3FP9 A;  1H9J A;  2B2U C;  2XWB B;  3G6J B;  5FLX L;  1YZ6 A;  3IFT A;  4LF5 Q;  3PIP 3;  3TEH B;  1HRJ A;  4KHV A;  3S24 A;  3E0J A;  2B8G A;  4FF2 A;  2XWJ B;  3U9S A;  3CCS A;  1C8C A;  2R93 H;  4M1U B;  1HQR D;  1K3B C;  1K9M C;  1KHI A;  3V96 A;  4DR7 Q;  5FK9 C;  2L5T A;  3HKZ B;  4X65 Q;  5GAH C;  1KD1 C;  5D14 A;  4JG2 A;  1X3P A;  3PF4 A;  2R7Z G;  1A2U A;  2WIN B;  4DK0 A;  3E5S A;  3GTQ H;  3OIQ A;  5C4X G;  1T9H A;  1TR5 A;  1UE7 A;  3OYY A;  4IOA A;  1O7I A;  1PTO C;  1EQQ A;  4UY8 C;  2WAQ B;  4A3F H;  4KHP L;  5M9O A;  4A3E G;  3T4A C;  2F4I A;  2R61 A;  1NR4 A;  4OEL B;  4BWG B;  1QVG A;  4Q0F A;  1PH8 A;  5E3F A;  4CKC A;  3K80 C;  3D31 A;  4UDU C;  4X3T A;  3KLW A;  3BG3 A;  1RDP D;  1UWV A;  3T1Y L;  5CGK A;  2EY2 A;  1SYG A;  4WRD A;  1JOK A;  3KDF B;  4DR2 Q;  3BYY B;  3CCQ A;  2QGQ A;  4QIW B;  1PTO H;  4KTA A;  3IKJ A;  2NN6 H;  4EQP A;  3RNU A;  3MFY A;  4DV0 Q;  1C4Q A;  4A93 B;  1KLU D;  3I4M H;  4QMG A;  1ET6 A;  2Y0S G;  1SE3 A;  2AWN A;  3K7A H;  3F2B A;  1F9Q A;  2G5D A;  4OXP A;  4RKB A;  4R4C A;  3OTO Q;  1LT5 D;  1TWA H;  3BVZ A;  3STB D;  5COR A;  1V9P A;  3FKI H;  4AH6 A;  3CCJ A;  5IOC A;  2M2L A;  4DGZ A;  1PXU A;  4A3D H;  1TKW B;  2EY6 A;  3CMA A;  3RD4 A;  2HQL A;  4A3F B;  4LF9 Q;  3FMC A;  3WOF A;  2DN8 A;  1WTP A;  3ND9 A;  3PO2 H;  2G9H D;  2OF1 A;  2J4X A;  4K0K Q;  4JI7 Q;  1TWH H;  4WFN 3;  1VQB A;  3C3L A;  3EIV A;  2HQE A;  5CV5 A;  3S9W A;  5M3F G;  4J1M A;  1ZYR C;  5JPN C;  2VXW A;  3M9B A;  2I46 A;  2E2I H;  2B2W A;  5C3E H;  2XGT A;  3QJY A;  2E5L Q;  4LFA Q;  1A6X A;  3EBE A;  4JI0 L;  3QG1 A;  1CI3 M;  1G6Z A;  4NXN Q;  2QA4 A;  3K7A B;  1EOV A;  1WTH A;  2IX1 A;  1TWA B;  3NUC A;  1HTL D;  4EQN A;  2UU9 Q;  1N34 L;  1KDA A;  5FJ8 G;  2CH4 A;  2JN4 A;  3X3M A;  1A0I A;  3UDF A;  2KJX A;  3P75 A;  4NXM L;  4OO1 I;  3NQT A;  3J7Y W;  1VQM A;  1XYI A;  1UE5 A;  1ENA A;  4MIU A;  1Q8K A;  1YJ9 A;  5LMN L;  3BU2 A;  1Y1V G;  3F2D A;  3VR3 A;  3TZU A;  1IW7 D;  2UXD Q;  1G29 1;  1H9M A;  1SN8 A;  1IBK Q;  1TWH B;  1K83 H;  2EY5 A;  1ZEQ X;  1NAP A;  2FFK B;  3L0O A;  2OEO A;  1YJW A;  2WAQ E;  1TS2 A;  5J1Z A;  1HHV A;  2EYO A;  1LT6 D;  2E2I B;  2QDB A;  5A35 A;  2D0P A;  3G7L A;  4ME5 A;  2Q8T A;  2CQA A;  1TS5 A;  2IPK D;  1HQM C;  1B1Z A;  1WTX A;  3C1F A;  2ZXO A;  1YHQ A;  5J39 A;  3M4Y A;  2ZJR A;  4IAL A;  4P74 A;  2F4V L;  3QB3 A;  4P71 A;  2JEA I;  1I50 B;  5C4J H;  1XXG A;  4LK1 C;  1Q7Y C;  3DUZ A;  2PQA B;  4C2M H;  4FP5 D;  2BE5 D;  4NKL A;  1XMQ L;  1II3 A;  2M9V A;  3GDE A;  3SXH A;  4L5R C;  3H94 A;  2DNE A;  2F0K A;  2R3Z A;  4YIJ A;  2WV6 D;  1FJG L;  1RL2 A;  1O80 A;  1CK1 A;  5C3W A;  5GAE C;  3J7Z C;  3CCM A;  5KYI A;  2JSO A;  2KCT A;  3E0E A;  3FRP B;  3HOY B;  1AEX A;  4MN3 A;  1ASY A;  1VQ8 A;  1HFN A;  1DCZ A;  5HY6 A;  4GN3 B;  1N8R C;  4ZK9 B;  1YNX A;  1K83 B;  2R7D A;  1GKH A;  4XIG S;  1AP0 A;  1PVO A;  1JB7 A;  1RTN A;  1K3R A;  3JAM i;  4KKU A;  1WD1 A;  3EJI A;  5C6A A;  2HIV A;  2OQ0 A;  3D6W A;  4X6A H;  3MEF A;  3GP7 A;  5EPK A;  4DR1 Q;  3KJO A;  4AQY L;  4OO1 G;  1Y8O B;  3A0J A;  4XDX A;  2B2V A;  1MSG A;  1I6H B;  2N55 A;  2NVQ H;  5EKL A;  4C2M B;  1JMC A;  2A68 C;  4ZKC B;  1IHZ A;  4FXK C;  3AEV A;  2K1B A;  3I3C A;  1JJ2 A;  4RKL A;  2YTX A;  4B3M L;  1YNJ C;  4DV4 L;  4BY1 G;  4CDE C;  1GHK A;  5KRU A;  4DV6 Q;  4A75 A;  3CKI B;  1JJG A;  4OWW B;  2VUM H;  5ELD A;  3DEO A;  1TWC B;  4IPD A;  2F0N A;  4PV1 C;  5J3B A;  5M3M H;  3RZO H;  4LMQ D;  3HOW H;  4CDD C;  3ERS X;  4DV2 Q;  3HGB A;  4DR3 L;  1XPU A;  3S2D B;  1FR3 A;  3BZD B;  3BYT B;  4DKA C;  1X9N A;  2ZTE A;  5C5M A;  1CKM A;  4LAA A;  2RDH A;  3RN2 A;  4O0A A;  4LWC A;  2NUC A;  2YYZ A;  1VS0 A;  1B8A A;  3MFG A;  2FHT A;  2K04 A;  3MZ5 A;  2K14 A;  4HJ5 A;  2ALY B;  2I0Q A;  2MPM A;  3K5M A;  4A3B H;  2UXB Q;  2R92 B;  1PFS A;  1Q1B A;  3I72 A;  2E75 C;  2HDM A;  4A3M G;  4DV7 Q;  1ONL A;  1XX8 A;  4MTK A;  2QKI C;  3Q8D A;  1RD9 D;  2CQO A;  1VQL A;  1X54 A;  2A6H D;  4JI3 Q;  3RLO A;  3MVV A;  4OHJ A;  1CA5 A;  1SYD A;  1YNN D;  5C0X I;  4HIO A;  1VF7 A;  2BA1 A;  2A6E D;  2WFW A;  4BY7 G;  3LWU A;  1O7Z A;  2VZA A;  4R4Q A;  3CU7 A;  3UDX A;  5DNF A;  3AB9 A;  2GVA A;  4HJA A;  4XTC S;  1N32 Q;  3RZO B;  1PTO F;  4LF4 L;  4P72 A;  3HOW B;  3LX0 A;  2F1M A;  4JI8 Q;  1D7Q A;  1PH5 A;  3QWN A;  3HOU H;  1WTV A;  3HOU G;  1LM0 A;  4JBJ A;  2KHI A;  5D65 A;  2NZ1 D;  3S1N H;  3Q6S A;  1GUW A;  3U50 C;  5C44 G;  3TZD A;  5I9O A;  2KED A;  3RUZ A;  1LYL A;  4N8F A;  3MAQ A;  4F7X A;  2EJF C;  4LF6 L;  1S5C D;  3CF5 A;  1VF5 C;  2JA7 B;  1U4L A;  5EKK A;  2A74 C;  1XPO A;  1PFN A;  3TDQ A;  2VQF Q;  3NTK A;  1X32 A;  2VQE Q;  1IYV A;  1B3A A;  2CW0 D;  4GN5 A;  3S1Q H;  1X3G A;  4IUP A;  5JVG 3;  2Q2H A;  1Q8I A;  3I4O A;  1WTO A;  1DOL A;  2M00 A;  3J81 j;  2KQ3 A;  1LT4 D;  1A2T A;  3M3Y H;  4BBS G;  2ICE C;  1NE3 A;  1VCI A;  1RIP A;  2JXM B;  3QOJ A;  2K7V A;  4JI5 Q;  1VQ5 A;  2AMC B;  2K28 A;  1Q81 C;  2K4K A;  3AYH B;  3TP6 A;  4A3I G;  1KRS A;  5C0X J;  2NZO A;  2BA0 A;  2EXZ A;  3L3O C;  2HHH L;  2YU9 H;  4A76 A;  3GTJ H;  2B2T C;  5G3L D;  1SFO H;  2SDF A;  1I4H A;  3P20 A;  5IGG A;  4I7Z C;  2PZU A;  3U9O A;  4O42 A;  1Q3L A;  3S2H H;  1BCP D;  4FNF A;  4B3T L;  5IT9 c;  3B6Y A;  3A8K E;  4OWX B;  4JI1 L;  4H02 A;  5KND A;  5C0X G;  3KFU A;  1VMC A;  2JQO A;  2NBF A;  3OHX C;  1WD0 A;  1N36 L;  2FIN B;  1PFB A;  1V1Q A;  4HR7 B;  1KNA A;  1EY7 A;  5CBE E;  3KK7 A;  5E1F A;  1E2W A;  1N33 L;  2F0O A;  4DFA A;  1HNW Q;  3KBX A;  3L2P A;  2DJG C;  4O1N A;  1J5E L;  2FXQ A;  1CFM A;  1TWG H;  3GTO B;  1DOM A;  4KI0 A;  3M3Y B;  1AZP A;  1JWU D;  1H9S B;  4R4T A;  1IBL L;  4DR5 Q;  4LF5 L;  4UP9 A;  2KUM A;  2X6L A;  4H44 C;  3FEW X;  2P5Z X;  4YWK A;  3QOL A;  1VQN A;  5IP7 G;  3D4R A;  2CH4 W;  3GTJ B;  2UXC L;  1TY0 A;  1L1O C;  1SFO B;  3EN2 A;  4IUR A;  4DR7 L;  3I7F A;  4X65 L;  4IN3 A;  5IGB A;  1PRT C;  1V8Q A;  4FF3 A;  1S4Z A;  2G9D A;  5L37 A;  1K8A C;  2XNA C;  3AU7 A;  5IIF A;  2F0D A;  2JA6 B;  1EEI D;  3NEL A;  1MJE A;  1DM0 B;  1EQT A;  2RSO A;  3ONA B;  1SE2 A;  5G3L F;  4N8X 1;  1V1P A;  2NVT H;  4DUY Q;  2PW7 A;  3OW2 A;  2EIF A;  4DA2 A;  2WB1 B;  3M85 A;  2B63 G;  4DR2 L;  3LNN A;  3S15 B;  3I91 A;  1VQO A;  4HAE A;  3CCR A;  1W2B A;  3E9I A;  1SDF A;  3NBI A;  2JA5 H;  3WWV A;  3PUY A;  4DV0 L;  4HID A;  3T1H Q;  3TP5 A;  4GZY C;  2TMP A;  2MNA A;  4A3G H;  3HS0 C;  1E1O A;  1UEB A;  4KJN A;  3HOV B;  2F0F A;  3P7J A;  4JV5 Q;  3PGZ A;  5IT9 E;  3R93 A;  3KF8 A;  1EQR A;  3PQI A;  3PUZ A;  2RVL A;  3HOZ G;  1HNZ Q;  4ZQ3 A;  1S5F D;  4GOP B;  2XRS D;  1LTA D;  3GV3 A;  4LF9 L;  3MXN B;  3SGI A;  3G48 A;  3VA7 A;  1CKN B;  1U4P A;  2QW7 A;  2EYF A;  4DV1 L;  1BUV T;  5KEE A;  2CCZ A;  5IP9 H;  2WKD A;  4LNQ A;  2Z6K A;  3GQB A;  5TSS A;  4J8Q A;  5FOB B;  1LLR D;  1NY4 A;  3LWE A;  1XTD A;  3T56 B;  1IBM Q;  5EGT A;  2PCF B;  2B2U A;  4KK7 A;  1KTK A;  3AQQ A;  4R1J A;  4PQX A;  4MNO A;  4JI2 Q;  5IWA L;  2E5L L;  3C46 A;  1HUN A;  2IT1 A;  1PFM A;  4DK3 C;  3I4N B;  1FVI A;  4A3G B;  1FNV A;  2NVY B;  2NN6 I;  4IFD H;  1UE1 A;  2K6A A;  3M4O H;  4ULL A;  4Y7N B;  4I65 A;  1IL8 A;  3G4S A;  2IW3 A;  5JEA H;  2B2Y C;  3HKS A;  4IQZ A;  3SK8 A;  2QEJ C;  3J80 i;  1BF4 A;  1K8O A;  2WAQ G;  4K8I A;  1Z6H A;  1XTC D;  2JA9 A;  1GUO A;  2RBM A;  2OTL A;  4K14 A;  4RHR A;  1EIF A;  2MHV A;  2C35 B;  1CHQ D;  1F9R A;  4ID6 A;  1RJT A;  4FXG C;  4YCU A;  1SMY D;  5CBA E;  1K73 C;  2K01 A;  4HTH A;  1RKN A;  1FYC A;  1B4O A;  3CRK C;  1SRU A;  2KHJ A;  4A93 H;  3R2T A;  3MEH A;  3NEN A;  4PZ6 A;  3ERQ A;  1EY5 A;  1VQK A;  4GKJ Q;  4KV6 A;  2WB1 E;  2R93 G;  5LMN W;  2E2J H;  5KNB A;  2MJ8 A;  4F88 A;  2V1C C;  1FNU A;  3VYS A;  3M4O B;  1JR0 D;  1SEB D;  1B50 A;  1JJC B;  1SLJ A;  2EYH A;  1B53 A;  4PMC A;  1PV4 A;  2C5C A;  1X3E A;  1MJC A;  2JJQ A;  2ENB A;  3IL8 A;  3V05 A;  1CTM A;  3MHB A;  2F0T A;  1R9T H;  4A3F G;  1VQI A;  2JA8 H;  4JOI C;  4DR4 L;  1PH1 A;  1C7Y A;  2LXJ A;  2RCN A;  1X55 A;  4ABN A;  5EPJ A;  1EY8 A;  2OWO A;  3KLS X;  1Y1W B;  3A74 A;  4C3J H;  1HA5 A;  4HMI A;  4H0L C;  1X6O A;  4B3R L;  4HSV A;  2F3I A;  4U68 A;  4JPB W;  2ZM6 L;  1SNO A;  2JEB I;  3NXW A;  1VQ4 A;  1STB A;  1SYB A;  2EVB A;  2NN6 G;  5A2Q E;  5JJZ A;  1YHA A;  3I4M G;  1L0Y B;  1S3O A;  3K5O A;  2B8F A;  1OO9 B;  3DXJ C;  3GTP B;  2HIX A;  3T13 A;  1A62 A;  4DUZ L;  1HR0 L;  2UUC Q;  2E2J B;  4YY3 Q;  3PIO A;  3KBG A;  3TS2 A;  4A3J H;  3GTL H;  4RAU C;  2X6G A;  3FKI G;  1VQ9 A;  5C3X A;  2KBN A;  2SEB D;  1JOO A;  3GTM B;  1B7Y B;  4A3D G;  4IPC A;  1EQV A;  2VNU D;  3HP3 A;  1AN8 A;  1R9T B;  1JOR A;  2ZTD A;  2EE1 A;  3ND8 A;  2JA8 B;  1Q90 A;  4NMZ A;  3HRZ C;  1F2M A;  5JJL A;  1STN A;  2IX0 A;  3A8I E;  5IYD H;  3PO2 G;  1ROD A;  3S17 B;  3W1G A;  3K0X A;  4OX9 Q;  4C3J B;  2L11 A;  4HIM A;  1EU3 A;  3PUX A;  1M4V A;  2HDL A;  2R7Z B;  2L55 A;  1C0A A;  1YBY A;  1SMX A;  5BR8 L;  2L0C A;  3BVG A;  2SOB A;  5IGE A;  4OIK A;  2F0Q A;  5C4X B;  2K5Q A;  1STH A;  3S14 B;  5C3E G;  1EFW A;  4XT3 B;  1HCZ A;  1J9O A;  1KDB A;  2UXB L;  4LFB L;  3PMF A;  4X64 Q;  3A7L A;  2F0I A;  1YNN C;  2DGY A;  4B08 A;  3K5L A;  3H6M A;  3NQI A;  3TP8 A;  4LFC Q;  1FL0 A;  2K5N A;  2K75 A;  1I50 H;  2FMM A;  1RCV D;  2N49 A;  1LTG D;  4JI3 L;  1I94 Q;  3J7A F;  3J80 L;  3DWQ A;  4A3J B;  5FO7 B;  1EL0 A;  3GTL B;  1IKL A;  1EOT A;  3NEM A;  1JWS D;  2OXP A;  1PRT F;  4EQ5 A;  5HUR A;  2H4O A;  4JVZ A;  1XMO Q;  4UPA A;  2EQS A;  1X3Q A;  2AUK A;  1G2T A;  3R3O A;  1OTC A;  3HOY H;  3HKZ E;  3MXG A;  1DGS A;  3RN5 A;  4K5V A;  2B3G A;  5EQ0 A;  1QNU A;  2DNC A;  4A3K B;  1M1K C;  3PF5 A;  2LMC B;  1PH2 A;  5FO8 B;  1HA6 A;  1GJX A;  4A3C H;  4GKK Q;  2XRQ D;  4R4I A;  1D2B A;  2YTV A;  4Q5V A;  4KD4 A;  4J6H A;  2LS0 1;  5GAG C;  1UNS A;  3U4V A;  2J7Z A;  1MKH A;  1NBW A;  2K05 A;  4CDC C;  2VQF L;  4CJ1 B;  4OON A;  3I2Z A;  1GUT A;  2VQE L;  2JK8 A;  1OXT A;  2KVM A;  2K5D A;  3BZK A;  4KD3 A;  3S1M B;  4QIW E;  3BZC A;  4N9T A;  1HZA A;  2L1B A;  1I6H H;  4WJ3 M;  5M3F B;  4IZ8 A;  2PI2 E;  1DJR D;  2RF4 A;  1F9S A;  3E6Z X;  1QE6 A;  4P73 A;  2F0V A;  2F3W A;  1KL9 A;  4G57 A;  1JE5 A;  1I4X A;  1IYJ B;  3J81 c;  2RSN A;  4POF A;  2QF7 A;  1Z7T A;  1DOK A;  1TWC H;  2PYK A;  1BOS A;  3OW7 A;  3DWP A;  1YJN A;  2HCI A;  3I56 A;  3D6C A;  3S2D H;  2UUB Q;  4IUU A;  2IWH A;  1HXY D;  2PZT A;  3KF6 A;  4DR6 Q;  2RCF A;  2EYL A;  2A69 D;  1GUS A;  3NBH A;  2XIW A;  4M8A A;  1WFQ A;  4AYB G;  2PW5 A;  1VQD A;  1Q12 A;  2ZXP A;  2HD3 A;  1G51 A;  4KHP Q;  4JW0 A;  2R92 H;  2L12 A;  1PTO D;  4FF1 A;  1QUQ A;  1TS3 A;  1TS4 A;  4LW1 A;  1BXT A;  2C9O A;  3KLR A;  5EPL A;  4KN4 C;  2GN5 A;  2N3S A;  3QR8 A;  4WJW A;  2VW9 A;  3U58 A;  4JI6 Q;  4RCN A;  1AE2 A;  5CV4 A;  3OIP A;  4BBR B;  1ET9 A;  3AMU A;  1IL2 A;  1IXR A;  4RGO S;  1ML0 D;  1CQF A;  1LTR D;  1LO5 D;  1WTW A;  4DR5 L;  1PH7 A;  2VUM G;  5D3I B;  4BA2 I;  3VDY A;  1ASZ A;  5M3M G;  3CPF A;  3A7A B;  3HOW G;  1WI5 A;  3KOJ A;  1E3P A;  1EZ8 A;  4CKE A;  2Q8R E;  3RLN A;  3J7A 5;  1VQE A;  5AJ3 Q;  4X66 Q;  4JI4 Q;  4DAP A;  4DAV A;  4XYO A;  2BDO A;  5IYB H;  2JYO A;  4UAI A;  2F0G A;  3H3V H;  1SYE A;  2ZXR A;  5M5Y H;  4JYA L;  1SND A;  4HCS A;  3W2D A;  2JA7 H;  1I4G A;  3M4P A;  4ME3 A;  1KIX A;  4A3B G;  1K8M A;  3VR5 A;  1U4M A;  1BCP B;  1D5X C;  4Y52 H;  1GXD C;  1EY0 A;  1JIC A;  4HED A;  1MI2 A;  3L9A X;  1A3U A;  2H5X A;  3GV6 A;  1D1K A;  2E2H B;  1HJP A;  4X3S A;  2RQX A;  2RA4 A;  1KLG D;  3J81 E;  1B2T A;  3PUW A;  4JI0 Q;  3VYT A;  4OWT B;  2ASB A;  4K5X A;  1CZW A;  1JWM D;  4V0B A;  3T1H L;  1P16 A;  1V43 A;  1VQG A;  2HCC A;  4RA8 A;  4C3H H;  5F2D A;  1SE4 A;  1AZQ A;  3CAM A;  2PMZ B;  3BDO A;  5ELB A;  2XVS A;  4DV5 Q;  1BKB A;  2B2T A;  1A3T A;  4QJF A;  5EBD A;  2J0T D;  5C4Z A;  1EWH A;  4C1N K;  1IKM A;  5FLX c;  3T53 B;  1KDC A;  2I5H A;  5M5Y B;  5LMN Q;  3H0G H;  1UE6 A;  1ZKO A;  4IPH A;  1HNZ L;  3CQZ B;  1H9R A;  5I2X A;  5DAU A;  1QJO A;  2F03 A;  2E76 C;  1C48 A;  4U67 3;  2ZJQ A;  2D2C C;  3MWY W;  3Q0A A;  3D0F A;  1NR2 A;  4RMF A;  2RDF A;  1BBU A;  4PG3 A;  2IJ0 A;  3GTO H;  1NSN S;  2A1A A;  2F0M A;  1O7L A;  2O5I C;  1EWI A;  5IGC A;  1TT2 A;  3K58 A;  1IBM L;  1QZH A;  1X3F A;  5GQO A;  1SNM A;  2MGS A;  3CCV A;  1NJI C;  4BS9 A;  2F4V Q;  1Q86 C;  3K7U C;  4A3M B;  5JVH 3;  2F0E A;  1MD2 D;  1VQC A;  3DHQ A;  4C3H B;  3K0Y A;  4KLK A;  4HJ9 A;  1KXL A;  1XMQ Q;  3MXN A;  4HMJ A;  2NTS A;  1L1O A;  1TU2 B;  4HJ8 A;  3DLL A;  1STE A;  5IY0 A;  4DV3 L;  3DM1 A;  5KYL A;  1FJG Q;  1XNQ L;  4ZUI A;  2NB0 A;  3NWS A;  4KKT A;  1LUZ A;  1PYB A;  3H0G B;  2JA6 H;  1FGB D;  4ZYS A;  4X62 L;  4KY6 A;  5I4D A;  2VS1 A;  1WCM H;  1LV9 A;  2H1E A;  1BBX C;  2EYM A;  4DXF A;  1CZG A;  1IYU A;  5EAY A;  3VYR A;  2D9U A;  1LTT D;  3NE5 B;  5C5L A;  3S16 H;  5I6W A;  1DON A;  1LTS D;  3T16 A;  5C44 B;  1VQH A;  2WB1 G;  3IFD A;  3S15 H;  4XQN A;  1OXS C;  4ILW A;  2XTI A;  5K5P A;  1PH9 A;  3M7N A;  1T5E A;  1B44 D;  5M5W B;  1U5K A;  4AQY Q;  5LHY 1;  4A3L H;  2DY7 A;  4GOP C;  4GKJ L;  1GVP A;  2L15 A;  1CM9 A;  4N9P A;  4R4O A;  1IZ6 A;  3HOV G;  3HOV H;  4B3M Q;  5CV6 A;  5FLX E;  4DV4 Q;  2NVX H;  1NNX A;  4BBS B;  4FYD A;  3PUV A;  4QUF A;  2A68 D;  4G7Z C;  4NDX A;  1BVS A;  4CHT B;  5J22 A;  2BH2 A;  4B9W A;  4IFD I;  5JJK A;  3G71 A;  2PMZ E;  2AKW B;  3RZD B;  4LF8 Q;  4GS3 A;  1WCM B;  4CJ0 B;  1Z9F A;  3FHW A;  3ICE A;  1ESR A;  1RHP A;  3S16 B;  4G4K A;  1EYG A;  1EFI D;  5EJW A;  1FD7 D;  2V4D A;  3SDZ A;  1FGU A;  1O78 A;  4DXG A;  4EVO A;  5FLM G;  5FLM H;  4PMW A;  2Q2U A;  2TSS A;  3KJP A;  2JA5 G;  1PLF A;  4FO2 A;  5NUC A;  2EJG C;  2OCE A;  4S3S A;  3STB C;  2AQ2 B;  4TQU S;  3I4N H;  2X69 A;  1GO3 E;  5CC4 A;  4A3G G;  4LF7 Q;  1WTQ A;  5DM7 3;  1I4Q A;  2CKZ B;  1CA6 A;  3OTO L;  3CW2 C;  1EYD A;  2NVY H;  4J15 A;  3OOC A;  3HZX A;  4DK1 A;  4YY3 L;  1QIL A;  4HJ7 A;  1AW7 A;  2VB3 X;  5IYC H;  4Y7N H;  2IX3 A;  2NVX B;  3CC2 A;  1YI2 A;  3HOX H;  5IE8 A;  5COY A;  4KY7 A;  5ELF A;  2KA7 A; 
#chains in the Genus database with same CATH homology
 2B2Y A;  1F77 A;  2NTT A;  4C1N I;  3NP8 A;  1EY6 A;  1SJH D;  2F0U A;  2BOS A;  5BN5 A;  4G7H C;  5CR3 A;  4IFD J;  3FPU B;  1W6K A;  3TME A;  3URY A;  1EY9 A;  1RTO A;  1GUN A;  2WAC A;  5JEA J;  2EY1 A;  5IOD A;  3N52 A;  3GD7 A;  1V1O A;  2A73 B;  5K36 H;  4RH6 A;  5I9P A;  5FO9 B;  5JAV A;  1QWY A;  4IFD G;  3CHB D;  1EIG A;  2ZT9 C;  5JEA G;  3HOX B;  2ID0 A;  2A5H A;  4FF4 A;  3SK6 A;  1MSH A;  2ICI A;  4ZAI A;  3PV0 A;  3TN2 A;  1IW7 C;  1G2S A;  4KN7 C;  5IGF A;  4OIJ A;  1EWC A;  3OMC A;  4K5W A;  2CVR A;  1I4P A;  1AFP A;  3P1H A;  3X3N A;  4K8J A;  1TY2 A;  4RGM A;  3HOZ B;  1D5Z C;  1TQO A;  4H7B A;  1I3Q B;  1H9K A;  4NP5 A;  4RGN A;  2AQ3 B;  4IUV A;  3Q22 A;  2BE5 C;  3D3R A;  5IGD A;  3PO3 B;  5C4H A;  1WVL A;  2PPB C;  3EA6 A;  1XWE A;  3TSS A;  1Z47 A;  4V19 0;  4TSS A;  4CJ2 C;  1F9P A;  3SK4 A;  1V1P B;  4B9X A;  3L7Z C;  4F87 A;  4QUC A;  4TRD A;  1G8Z D;  1FNW A;  2A69 C;  1E2V A;  2IL8 A;  1J8I A;  1UEA B;  2Z8L A;  2NYZ D;  4C3J G;  4C3I B;  4X3K A;  1LAB A;  3I70 A;  3FDT A;  1RF2 D;  3K6O A;  4QB4 A;  4F8M A;  1PRT D;  3SR1 A;  4K2K A;  2WII B;  5T1G A;  4CGY B;  2OT2 A;  2HUG A;  1STG A;  2MP1 A;  1QB5 D;  1SBB B;  1E0B A;  1OXV A;  1SNC A;  1B9N A;  3IAY A;  1F2Z A;  2E74 C;  4P2C B;  1G91 A;  1PZK D;  5IT9 L;  1EYA A;  3A56 A;  3OWF A;  5I6Y A;  3EQL C;  3ZYY X;  2R93 B;  3I90 A;  1R4P B;  2K32 A;  3OWE B;  3Q24 A;  3GTQ B;  3GTG B;  1CT1 D;  1D5M C;  1SXT A;  4X3U A;  3BVM A;  3ERO A;  3H09 A;  3C2P A;  4PMB A;  4G7O C;  4A3E B;  1LAC A;  3EVQ A;  1Q1E A;  2A6H C;  1ESF A;  1PYW D;  2L4N A;  1ICW A;  4DNR B;  2A6E C;  1ILQ A;  2D5D A;  2K33 A;  1A3V A;  4KKS A;  1SYF A;  4K6D A;  3GTK B;  2NWG A;  1PTO B;  1NUC A;  1CQV A;  5KGU A;  2MUY A;  4L63 B;  4R8N A;  1PZJ D;  2Z4H A;  3I4M B;  1ENF A;  2EJM A;  2Y0S B;  2K03 A;  1JOQ A;  1BDO A;  2FJ2 A;  1DXM A;  2AQ1 B;  3TP7 A;  1SNP A;  2WP8 J;  3FKI B;  2L9H A;  1ENC A;  2F0H A;  3A8J E;  4A3D B;  4JBW A;  3PIO 3;  2AWO A;  2Q8I B;  5BN3 A;  1S5E D;  2F3V A;  3A55 A;  2CW0 C;  3VYU A;  1SAP A;  3R8B A;  4XQQ A;  3PO2 B;  2WKC A;  4K2L A;  1KAA A;  2JP1 A;  5CYU A;  1SSO A;  5CV8 A;  2B2W C;  1TVX A;  4QCL A;  3A54 A;  4DF7 A;  4RGT A;  5FKA C;  1GOZ A;  1EIH A;  1EY4 A;  3MXP A;  5C3E B;  4DNT B;  3HG9 A;  3FPP A;  1BNZ A;  2F0W A;  4HN7 A;  4R8I A;  3K5N A;  4ODG A;  5CV7 A;  5EKI A;  4ZLT F;  4RFB A;  1KNE A;  2SNS A;  1BCP C;  4KJO A;  2PZW A;  1D6E C;  4XXE A;  4ZKB B;  1NCV A;  3NHH A;  2B39 A;  4L6T B;  1LT3 D;  5A2Q L;  4RWS C;  2EDG A;  3KLS A;  1Y1V B;  3DEP A;  5T1I A;  3TBI B;  3JAM E;  5KNC A;  3CRL C;  1BQQ T;  3SVM A;  1F2L A;  2LFN A;  3BDL A;  2LY7 A;  5AFW A;  4EGV A;  4R9W A;  3K59 A;  1DYQ A;  1JQY D;  1JCK B;  2PQE A;  4XQJ A;  4L8J A;  3H3V C;  3M7G A;  3F2U A;  4OO1 H;  5C4J B;  5EBC A;  1OXX K;  2Z4I A;  4CKB A;  1I4R A;  1PDQ A;  3ITP A;  1LTB D;  1PMR A;  5ELE A;  1L0X B;  3QIA A;  2KEC A;  1M8A A;  1TII D;  4QF4 A;  1H9S A;  4IUN A;  3VR4 A;  2XSC A;  5KIX A;  4BA1 I;  3J7A V;  4AYB B;  2EYP A;  1BR9 A;  1QOH A;  2LKV A;  3NSW A;  3OPO A;  1ZYR D;  1STA A;  5CV9 A;  1QCB D;  1GUG A;  2B2V C;  3SE0 A;  1I6V C;  4C3H G;  2DY8 A;  3I8Z A;  3BDC A;  1HUM A;  2NVQ B;  5BN4 A;  4DU9 A;  3W3A A;  4BY1 B;  1QG7 A;  2JE6 I;  1S5D D;  2VUM B;  2F0S A;  5M3M B;  2R6G A;  3D8G A;  5D3D A;  1HFG A;  4K6L A;  1JE4 A;  1HTP A;  1ZXT A;  4FXD A;  1EEF D;  3NTI A;  4E6I A;  3WOE A;  2O5J C;  4KMU C;  3MTS A;  3SEB A;  4JK1 C;  3QO2 A;  1JC7 A;  1Y8N B;  4A3B B;  1W6J A;  2PO4 A;  1S5B D;  3K57 A;  5DM6 3;  1BO0 A;  1TWF B;  1D1I A;  1ILP A;  2EPB A;  1LTI D;  1OXU A;  3D4W A;  1UUP A;  5DEH A;  4BY7 B;  3VA5 A;  1U4R A;  1EYC A;  3D4D A;  1SJE D;  3C1E A;  2KEE A;  4ZRZ A;  3NTH A;  2EYJ A;  4DN4 M;  3HOU B;  3JAM L;  3RLF A;  1SMY C;  1B9M A;  2K5W A;  3S1N B;  3BS1 A;  4TKO B;  4WOR A;  3MXU A;  5I2Y A;  3KUP A;  2O2L D;  5M5X B;  4HCE A;  5C0X H;  2SNM A;  5HGT A;  3VR6 A;  4XT1 B;  2KCC A;  4KY5 A;  3S1Q B;  2EZV A;  1T5X D;  4FVM A;  1R4Q B;  1DD2 A;  2BCO A;  2E2D C;  3R2I A;  2EOT A;  2F0P A;  2AUJ D;  2FMC A;  3RMH A;  5ELC A;  3GO5 A;  5LL6 S;  2PNR C;  1F2Y A;  1YNJ D;  3T51 B;  4CBV A;  4A3I B;  2D62 A;  2QCP X;  2YU9 B;  4RHS A;  1O7Y A;  4H13 C;  5E4W C;  1QNK A;  3S2H B;  3N6R A;  2KHS A;  3J81 L;  2QIL A;  1MGS A;  2F0L A;  4IUQ A;  1WTR A;  3WDN A;  2GA4 B;  4LJZ C;  2RDG A;  1HPC A;  4HSP A;  1KAB A;  3UI2 A;  1TWG B;  1DZ1 A;  1BCP F;  5JPM C;  4KHZ A;  4C56 C;  4EQO A;  2RKS A;  4NW2 A;  3SK5 A;  2KCN A;  3O13 A;  4XYQ A;  3OMG A;  2O4X A;  1Y8P B;  3NK9 A;  3EFX D;  4RCO A;  2XN9 C;  4PNY A;  5E4X A;  1UAP A;  1GHJ A;  4OGQ C;  1STY A;  3MA2 B;  5CMD A;  5K36 G;  1PRT B;  2VB2 X;  2NVT B;  4OL7 A;  2BDN A;  2CHB D;  3Q23 A;  4Z9C B;  5JOB A;  1VMP A;  2B63 B;  1SYC A;  2N88 A;  3I73 A;  2JA5 B;  3SHL A;  3DMU A;  2F0J A;  3HEJ A;  1EU4 A;  1CHP D;  1Y69 U;  1U9R A;  2I07 B;  1MBY A;  3NPP A;  3S1R B;  1PZI D;  3J80 E;  1A15 A;  4C3I G;  3MC0 B;  4DAY A;  5ISR A;  1VDZ A;  4MHE A;  1JB3 A;  3H91 A;  4ZUJ A;  3NWT A;  3DWA A;  2KOL A;  3FVQ A;  4IUT A;  1EZ6 A;  1SNQ A;  3OSO A;  2Z1C A;  3I4L A;  3V2T A;  3VR2 A;  1E2Z A;  5LL6 X;  1H9J A;  2B2U C;  2XWB B;  3G6J B;  5FLX L;  3IFT A;  3PIP 3;  1HRJ A;  4KHV A;  3E0J A;  2B8G A;  4FF2 A;  2XWJ B;  3U9S A;  1C8C A;  4M1U B;  1HQR D;  3V96 A;  5FK9 C;  2L5T A;  3HKZ B;  5D14 A;  1X3P A;  1A2U A;  2WIN B;  4DK0 A;  3E5S A;  3OIQ A;  1TR5 A;  1PTO C;  2WAQ B;  5M9O A;  3T4A C;  2F4I A;  2R61 A;  1NR4 A;  4BWG B;  4Q0F A;  5E3F A;  4CKC A;  3D31 A;  4UDU C;  4X3T A;  3BG3 A;  1RDP D;  5CGK A;  2EY2 A;  1SYG A;  4WRD A;  1JOK A;  3BYY B;  4QIW B;  1PTO H;  4KTA A;  3IKJ A;  2NN6 H;  4EQP A;  3MFY A;  4A93 B;  1C4Q A;  1KLU D;  4QMG A;  1ET6 A;  1SE3 A;  2AWN A;  1F9Q A;  4RKB A;  1LT5 D;  3BVZ A;  5COR A;  5IOC A;  2M2L A;  4DGZ A;  1PXU A;  1TKW B;  2EY6 A;  3RD4 A;  4A3F B;  3FMC A;  3WOF A;  2DN8 A;  1WTP A;  3ND9 A;  2G9H D;  2OF1 A;  2J4X A;  4WFN 3;  3C3L A;  2HQE A;  5CV5 A;  3S9W A;  4J1M A;  1ZYR C;  5JPN C;  2VXW A;  2I46 A;  2B2W A;  3QJY A;  1A6X A;  3QG1 A;  1CI3 M;  1G6Z A;  3K7A B;  2IX1 A;  1TWA B;  3NUC A;  1HTL D;  4EQN A;  1KDA A;  3X3M A;  2KJX A;  3P75 A;  4OO1 I;  3NQT A;  3J7Y W;  1XYI A;  1ENA A;  4MIU A;  3VR3 A;  3TZU A;  1IW7 D;  1G29 1;  1H9M A;  1TWH B;  2EY5 A;  1ZEQ X;  1NAP A;  2FFK B;  2OEO A;  1TS2 A;  5J1Z A;  1HHV A;  2EYO A;  1LT6 D;  2E2I B;  2QDB A;  5A35 A;  3G7L A;  4ME5 A;  2Q8T A;  2CQA A;  1TS5 A;  2IPK D;  1HQM C;  1B1Z A;  1WTX A;  3C1F A;  2ZXO A;  5J39 A;  3M4Y A;  4IAL A;  3QB3 A;  2JEA I;  1I50 B;  1XXG A;  4LK1 C;  3DUZ A;  4FP5 D;  2BE5 D;  4NKL A;  1II3 A;  2M9V A;  3SXH A;  3H94 A;  2DNE A;  2F0K A;  2R3Z A;  4YIJ A;  2WV6 D;  1O80 A;  5C3W A;  1CK1 A;  5KYI A;  2JSO A;  3FRP B;  3HOY B;  1AEX A;  4MN3 A;  1HFN A;  1DCZ A;  4ZK9 B;  1K83 B;  4XIG S;  1AP0 A;  1RTN A;  4KKU A;  1WD1 A;  3EJI A;  5C6A A;  3D6W A;  3GP7 A;  5EPK A;  4OO1 G;  1Y8O B;  4XDX A;  2B2V A;  1MSG A;  1I6H B;  2N55 A;  5EKL A;  4C2M B;  2A68 C;  4ZKC B;  1IHZ A;  4FXK C;  2K1B A;  3I3C A;  4RKL A;  1YNJ C;  1GHK A;  5KRU A;  3CKI B;  5ELD A;  3DEO A;  1TWC B;  2F0N A;  4PV1 C;  4LMQ D;  3HGB A;  3S2D B;  1FR3 A;  3BZD B;  3BYT B;  5C5M A;  4LAA A;  2RDH A;  2NUC A;  2YYZ A;  3MFG A;  2FHT A;  2K04 A;  3MZ5 A;  2MPM A;  3K5M A;  2R92 B;  1Q1B A;  3I72 A;  2E75 C;  2HDM A;  1ONL A;  1XX8 A;  2QKI C;  1RD9 D;  2A6H D;  3MVV A;  4OHJ A;  1CA5 A;  1SYD A;  1YNN D;  5C0X I;  1VF7 A;  2BA1 A;  2A6E D;  3LWU A;  1O7Z A;  3CU7 A;  5DNF A;  3AB9 A;  4XTC S;  3RZO B;  1PTO F;  3HOW B;  3LX0 A;  2F1M A;  3QWN A;  1WTV A;  5D65 A;  2NZ1 D;  3Q6S A;  1GUW A;  3TZD A;  5I9O A;  2KED A;  3RUZ A;  3MAQ A;  4F7X A;  2EJF C;  1S5C D;  1VF5 C;  2JA7 B;  1U4L A;  5EKK A;  2A74 C;  1PFN A;  3TDQ A;  3NTK A;  1X32 A;  1IYV A;  1B3A A;  2CW0 D;  4IUP A;  5JVG 3;  1Q8I A;  1WTO A;  1DOL A;  2M00 A;  2KQ3 A;  1LT4 D;  1A2T A;  2ICE C;  1VCI A;  2JXM B;  3QOJ A;  2K7V A;  2K28 A;  3TP6 A;  5C0X J;  2BA0 A;  2EXZ A;  3L3O C;  2B2T C;  5G3L D;  2SDF A;  1I4H A;  3P20 A;  5IGG A;  4I7Z C;  2PZU A;  3U9O A;  4O42 A;  1Q3L A;  1BCP D;  4FNF A;  3A8K E;  5KND A;  5C0X G;  1VMC A;  2NBF A;  3OHX C;  1WD0 A;  2FIN B;  1PFB A;  4HR7 B;  1KNA A;  1EY7 A;  5CBE E;  3KK7 A;  5E1F A;  1E2W A;  2F0O A;  4DFA A;  3KBX A;  4O1N A;  1CFM A;  3GTO B;  1DOM A;  4KI0 A;  3M3Y B;  1AZP A;  1JWU D;  1H9S B;  2KUM A;  2X6L A;  4H44 C;  3FEW X;  3QOL A;  3D4R A;  3GTJ B;  1TY0 A;  1SFO B;  4IUR A;  4IN3 A;  5IGB A;  1PRT C;  1V8Q A;  4FF3 A;  1S4Z A;  2G9D A;  2XNA C;  3AU7 A;  5IIF A;  2F0D A;  2JA6 B;  1EEI D;  1DM0 B;  1EQT A;  2RSO A;  3ONA B;  1SE2 A;  5G3L F;  1V1P A;  2PW7 A;  4DA2 A;  2WB1 B;  3M85 A;  3LNN A;  3S15 B;  3I91 A;  4HAE A;  1SDF A;  3NBI A;  3PUY A;  3TP5 A;  4GZY C;  2TMP A;  3HS0 C;  4KJN A;  3HOV B;  2F0F A;  3P7J A;  5IT9 E;  3R93 A;  3KF8 A;  3PUZ A;  2RVL A;  4ZQ3 A;  1S5F D;  2XRS D;  1LTA D;  3GV3 A;  3VA7 A;  1U4P A;  2EYF A;  1BUV T;  5KEE A;  2WKD A;  3GQB A;  5TSS A;  4J8Q A;  5FOB B;  1LLR D;  3LWE A;  3T56 B;  5EGT A;  2PCF B;  2B2U A;  4KK7 A;  1KTK A;  4PQX A;  3C46 A;  1HUN A;  2IT1 A;  1PFM A;  3I4N B;  4A3G B;  1FNV A;  2NVY B;  2NN6 I;  4IFD H;  2K6A A;  4ULL A;  4Y7N B;  4I65 A;  1IL8 A;  2IW3 A;  5JEA H;  2B2Y C;  4IQZ A;  3SK8 A;  2QEJ C;  1BF4 A;  1K8O A;  4K8I A;  1Z6H A;  1XTC D;  1GUO A;  2RBM A;  4K14 A;  4RHR A;  2MHV A;  1CHQ D;  1F9R A;  4ID6 A;  1RJT A;  4FXG C;  1SMY D;  5CBA E;  2K01 A;  4HTH A;  1RKN A;  1FYC A;  1B4O A;  3CRK C;  3R2T A;  3MEH A;  3ERQ A;  1EY5 A;  4KV6 A;  5KNB A;  2MJ8 A;  4F88 A;  1FNU A;  3VYS A;  3M4O B;  1JR0 D;  1SEB D;  1B50 A;  2EYH A;  1B53 A;  4PMC A;  2C5C A;  2ENB A;  3IL8 A;  3V05 A;  1CTM A;  3MHB A;  2F0T A;  4ABN A;  5EPJ A;  1EY8 A;  3KLS X;  1Y1W B;  1HA5 A;  4HMI A;  4H0L C;  4HSV A;  4U68 A;  1SNO A;  2JEB I;  3NXW A;  1STB A;  1SYB A;  2EVB A;  2NN6 G;  5A2Q E;  5JJZ A;  1L0Y B;  3K5O A;  2B8F A;  1OO9 B;  3DXJ C;  3GTP B;  3T13 A;  2E2J B;  3KBG A;  4RAU C;  2X6G A;  5C3X A;  2SEB D;  3GTM B;  1JOO A;  1EQV A;  2VNU D;  3HP3 A;  1AN8 A;  1R9T B;  1JOR A;  2EE1 A;  3ND8 A;  2JA8 B;  1Q90 A;  4NMZ A;  3HRZ C;  1F2M A;  1STN A;  2IX0 A;  3A8I E;  1ROD A;  3S17 B;  4C3J B;  2L11 A;  1EU3 A;  3PUX A;  1M4V A;  2HDL A;  2R7Z B;  2L55 A;  2L0C A;  3BVG A;  2SOB A;  5IGE A;  4OIK A;  2F0Q A;  5C4X B;  2K5Q A;  1STH A;  3S14 B;  4XT3 B;  1HCZ A;  1J9O A;  1KDB A;  3PMF A;  3A7L A;  2F0I A;  1YNN C;  4B08 A;  3K5L A;  3H6M A;  3NQI A;  3TP8 A;  2FMM A;  1RCV D;  1LTG D;  3J7A F;  3J80 L;  3DWQ A;  4A3J B;  5FO7 B;  1EL0 A;  3GTL B;  1IKL A;  1EOT A;  1JWS D;  2OXP A;  1PRT F;  5HUR A;  2H4O A;  1X3Q A;  2AUK A;  1G2T A;  3R3O A;  3MXG A;  4K5V A;  5EQ0 A;  1QNU A;  2DNC A;  4A3K B;  2LMC B;  5FO8 B;  1HA6 A;  1GJX A;  2XRQ D;  1D2B A;  4Q5V A;  4KD4 A;  4J6H A;  2LS0 1;  1UNS A;  2J7Z A;  2K05 A;  4CJ1 B;  1GUT A;  1OXT A;  2KVM A;  2K5D A;  4KD3 A;  3S1M B;  4N9T A;  2L1B A;  5M3F B;  4IZ8 A;  1DJR D;  1F9S A;  3E6Z X;  1QE6 A;  2F0V A;  2F3W A;  4G57 A;  1I4X A;  2RSN A;  2QF7 A;  1Z7T A;  1DOK A;  2PYK A;  1BOS A;  3OW7 A;  3DWP A;  2HCI A;  3D6C A;  4IUU A;  2IWH A;  1HXY D;  2PZT A;  2EYL A;  2A69 D;  1GUS A;  3NBH A;  2XIW A;  4M8A A;  2PW5 A;  1Q12 A;  2ZXP A;  2L12 A;  1PTO D;  4FF1 A;  1TS3 A;  1TS4 A;  1BXT A;  2C9O A;  3KLR A;  5EPL A;  4KN4 C;  4WJW A;  4RCN A;  5CV4 A;  3OIP A;  4BBR B;  1ET9 A;  3AMU A;  4RGO S;  1ML0 D;  1CQF A;  1LTR D;  1LO5 D;  1WTW A;  5D3I B;  4BA2 I;  3A7A B;  1EZ8 A;  4CKE A;  2Q8R E;  4DAP A;  4DAV A;  4XYO A;  2BDO A;  2JYO A;  4UAI A;  2F0G A;  1SYE A;  2ZXR A;  1SND A;  4HCS A;  3W2D A;  1I4G A;  1K8M A;  3VR5 A;  1U4M A;  1BCP B;  1D5X C;  1GXD C;  1EY0 A;  1JIC A;  4HED A;  1MI2 A;  3L9A X;  1A3U A;  3GV6 A;  1D1K A;  2E2H B;  4X3S A;  2RQX A;  2RA4 A;  1KLG D;  3J81 E;  1B2T A;  3PUW A;  3VYT A;  4K5X A;  1CZW A;  1JWM D;  4V0B A;  1V43 A;  4RA8 A;  2HCC A;  5F2D A;  1SE4 A;  1AZQ A;  2PMZ B;  3BDO A;  5ELB A;  2XVS A;  2B2T A;  1A3T A;  5EBD A;  2J0T D;  5C4Z A;  1EWH A;  4C1N K;  1IKM A;  3T53 B;  1KDC A;  5M5Y B;  1ZKO A;  3CQZ B;  1H9R A;  5I2X A;  5DAU A;  1QJO A;  2F03 A;  2E76 C;  1C48 A;  4U67 3;  2D2C C;  3MWY W;  3Q0A A;  1NR2 A;  2RDF A;  2IJ0 A;  1NSN S;  2F0M A;  1O7L A;  2O5I C;  5IGC A;  1TT2 A;  3K58 A;  1SNM A;  2MGS A;  4BS9 A;  4A3M B;  5JVH 3;  2F0E A;  1MD2 D;  3DHQ A;  4C3H B;  3K0Y A;  3MXN A;  4HMJ A;  2NTS A;  1TU2 B;  1STE A;  3DM1 A;  5KYL A;  4ZUI A;  2NB0 A;  3NWS A;  4KKT A;  3H0G B;  1FGB D;  4ZYS A;  4KY6 A;  5I4D A;  1LV9 A;  2H1E A;  1BBX C;  2EYM A;  4DXF A;  1CZG A;  1IYU A;  3VYR A;  2D9U A;  1LTT D;  3NE5 B;  5C5L A;  5I6W A;  1DON A;  1LTS D;  3T16 A;  5C44 B;  3IFD A;  4XQN A;  1OXS C;  4ILW A;  5K5P A;  3M7N A;  1T5E A;  1B44 D;  5M5W B;  5LHY 1;  2DY7 A;  1CM9 A;  4N9P A;  5CV6 A;  5FLX E;  4BBS B;  4FYD A;  3PUV A;  4QUF A;  2A68 D;  4G7Z C;  4NDX A;  4CHT B;  5J22 A;  4B9W A;  4IFD I;  3RZD B;  1WCM B;  4CJ0 B;  1ESR A;  1RHP A;  3S16 B;  4G4K A;  1EFI D;  5EJW A;  1FD7 D;  2V4D A;  3SDZ A;  1O78 A;  4DXG A;  4EVO A;  4PMW A;  2TSS A;  1PLF A;  4FO2 A;  5NUC A;  2EJG C;  4S3S A;  2AQ2 B;  4TQU S;  2X69 A;  5CC4 A;  1WTQ A;  5DM7 3;  1I4Q A;  1CA6 A;  1EYD A;  3OOC A;  3HZX A;  4DK1 A;  1QIL A;  1AW7 A;  2VB3 X;  2NVX B;  2IX3 A;  5COY A;  4KY7 A;  5ELF A;  2KA7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...