4QUCA

Crystal structure of chromodomain of rhino
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
56
structure length
56
Chain Sequence
b'EYVVEKILGKRFVNGRPQVLVKWSGFPNENNTWEPLENVGNCMKLVSDFESEVFRL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RE36324p
molecule tags Protein binding
source organism Drosophila melanogaster
publication title Transgenerationally inherited piRNAs trigger piRNA biogenesis by changing the chromatin of piRNA clusters and inducing precursor processing.
pubmed doi rcsb
total genus 12
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2014-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4qucA00
1J9OA 4IUVA 1WD0A 1ICWA 5CMDA 1B3AA 1ILPA 1PFMA 1JICA 2K1BA 2RSOA 2M2LA 5T1GA 3I8ZA 2EPBA 2H1EA 4U68A 1WTPA 2EOTA 3H91A 2KECA 4X3TA 5COYA 1RTNA 2D9UA 1BF4A 4QUFA 2J7ZA 4XDXA 1F9RA 2FINB 2B2TC 3FPUB 2B2UC 2KOLA 1B50A 1NR4A 1O7YA 3LWEA 1BO0A 2IL8A 1KNAA 1AZQA 1VMPA 1CM9A 4HCSA 2EE1A 2X6LA 4UAIA 1RODA 4XT3B 2KEEA 1HFNA 5T1IA 1RTOA 1X3PA 1F9PA 1LV9A 1WTQA 2HCCA 5DNFA 3I90A 1MI2A 1BNZA 1AP0A 3F2UA 5E4XA 2B2WC 2XIWA 3DM1A 1MGSA 5JJZA 2MGSA 1PFBA 3R93A 1G2TA 1DZ1A 2MPMA 4DN4M 1PDQA 1X3QA 2RA4A 1HUMA 2L11A 3I91A 1SAPA 3UI2A 2L9HA 1EQTA 1VMCA 2KEDA 4ZLTF 2B2VA 2HCIA 5EKIA 1QE6A 3ONAB 4ZKCB 4NW2A 2NZ1D 2Q8RE 3GV3A 1HUNA 2SDFA 1F2LA 2JYOA 2B2TA 5E4WC 2MJ8A 4HSVA 4LMQD 4CJ0B 1WTXA 1F9QA 1PLFA 1NAPA 1WTWA 3KBXA 3P7JA 4HEDA 1NR2A 1XX8A 1IKLA 4X3UA 1M8AA 1SSOA 2N55A 1EIGA 4O42A 3SVMA 2NWGA 1C8CA 1B2TA 1QNKA 2B2YC 1IKMA 2FHTA 1PFNA 4OIJA 3MWYW 2HUGA 3KUPA 3QO2A 4IUPA 2HDLA 2NYZD 4ZK9B 5EPJA 1HA6A 1U4RA 2B2WA 1A15A 1EL0A 3IL8A 4IUQA 1O80A 1J8IA 2L12A 1HRJA 1B53A 4HAEA 2B2YA 5D14A 1BBXC 1ZXTA 2MP1A 2RVLA 2L4NA 3N52A 2Q8TA 2BDNA 3FDTA 2DY8A 1U4PA 4ZKBB 4X3SA 1WD1A 1MSHA 2K28A 1RJTA 1EIHA 1U4LA 1RHPA 1TVXA 1G2SA 1G91A 1EOTA 3TN2A 5AFWA 2HDMA 1Q3LA 2KVMA 5CORA 2L1BA 2X6GA 4X3KA 2CVRA 2JP1A 3D6WA 3HP3A 2K05A 1QG7A 2DY7A 4OIKA 1WVLA 1U4MA 4CJ2C 1GUWA 4RAUC 2FMMA 2X69A 1XYIA 1MSGA 4XT1B 1DOLA 4R9WA 1G6ZA 1ESRA 3GV6A 5D65A 1F9SA 4MN3A 5CBAE 2FJ2A 5EPKA 1ILQA 4IURA 3G7LA 1KNEA 1S4ZA 1E0BA 4RA8A 5EQ0A 2K03A 5CBEE 4R8IA 2R3ZA 3DEOA 4ZAIA 4MHEA 3Q6SA 1HFGA 2N88A 4IUUA 3TZDA 1CA5A 1O7ZA 1IL8A 4IUTA 3MTSA 1WTVA 1HHVA 4QUCA 4RWSC 1CA6A 1ML0D 2B2VC 2K04A 2RSNA 1DOKA 1SDFA 1DOMA 5EJWA 1WTOA 1AZPA 3IFDA 2B2UA 2FFKB 5EPLA 2VXWA 4CJ1B 1DONA 3I3CA 2K01A 1JE4A 2KUMA 3DEPA 1NCVA 1WTRA 1X32A 1B4OA
chains in the Genus database with same CATH superfamily
5C4XH 2PO4A 3LX0A 1J9OA 4RGOS 2E76C 3G6EA 4A3DH 2D5DA 2M2LA 1WTPA 1UE5A 2F0KA 4TVAB 5EBDA 3FKIG 2PI2E 2F3IA 2B2TC 4A3EB 1EY5A 3F2DA 4A3CH 4P2CB 3DMUA 3IFTA 4ILWA 5KNDA 1Y69U 5D3IB 1K0RA 3RZOB 5ELDA 2JA5G 4DV7Q 4DV1Q 1IHZA 4DK3C 2PW7A 1R9TB 1YNJD 4OWWB 3ER0A 1E2WA 4A3KH 3GTOH 4IUNA 2ZJQA 4OEMB 1RD9D 4A3DB 1AP0A 5C44G 1B9NA 1L1OA 2ZXRA 3HRZC 5KGUA 2MGSA 3S1NB 1SNDA 3KDFA 1ZEQX 5K36H 4K6DA 1JJGA 2NN6H 4DAYA 1VCIA 2B2VA 3F1ZA 3T1YQ 1PH9A 3EIVA 2PMZE 1PH7A 1MHWC 1UE7A 1K8GA 2F52A 2NZOA 4UP7A 2NZHA 1M8AA 3SVMA 2NWGA 1JC7A 3CCRA 4JI8Q 3KUPA 4IUPA 4DR3L 1MBYA 1PH1A 5GQOA 1L1OB 3J80i 5LMUL 3L2PA 1XMQL 2QW7A 4LF7Q 2XWJB 2TMPA 2KHIA 4DF7A 1BBXC 2F0FA 1Q82C 2Y0SB 5M9OA 4JI3Q 1WD1A 2QCPX 4PMCA 4K5XA 1E7ZA 5FLXE 2KCTA 3M4QA 1EY9A 3GTJH 2K75A 1VF7A 1U4MA 4EQOA 4K14A 3QB3A 4BBSH 1C9OA 2LY7A 3DEOA 3EFXD 3SR1A 4AIMA 4DV0L 1EQVA 3HOWH 1VQ5A 4OONA 3I73A 4DV0Q 1CA6A 1OXSC 3W3AA 3TSSA 2ASBA 2VB3X 4UY8C 1Z6HA 5I2XA 1CKMA 3KJPA 3I3CA 1V43A 4LF6Q 4C3JB 1KQSA 3G48A 3T51B 2K5DA 3BVZA 2JSOA 4IUVA 4P73A 2B39A 3BU2A 1SYGA 1K28A 2CWPA 2UXBL 4DGZA 3N6RA 3ND8A 1AN8A 2VS1A 1FL0A 3K7AB 4IALA 5BR8Q 4EQ5A 3S2HH 4IFDJ 3H3VI 2K6AA 4B3TL 1G51A 4POGA 2JA8B 5M3MB 4YCWA 1RODA 5KNCA 4J1MA 3FP9A 1DYQA 3GP7A 4TQUS 4DR6L 3SK6A 1V1OA 1STHA 1GKHA 1TWAH 1Y8PB 2CQAA 4A3BB 1M4VA 4YHHL 1PRTC 2IWHA 1VQFA 1B3QA 4JI4L 4ZKCB 3SK5A 3GV3A 4Y7NH 4LF6L 2JYOA 1PTOH 4CJ0B 1NR2A 5FO7B 1N33L 1I6HH 4IOAA 4L5RC 5IYBG 4HJAA 2HUGA 2OWOA 4FYDA 5BN3A 2HIXA 4H02A 2CH4A 5M5XB 3T56B 1X3EA 3U4VA 1E22A 1KIXA 3TP8A 1SN8A 3BYYB 3N52A 3GTGH 1KRSA 1LTTD 2BDNA 2DY8A 5IP9G 1IBML 3BJUA 1LT4D 3PSIA 1MJEA 1CHQD 5K5PA 4NXML 1IYVA 5I6YA 1L0WA 4LFCQ 4C2MB 1IXRA 2K50A 1TVXA 3CC4A 2LXKA 1KD1C 2XWBB 2HDMA 3S24A 2EY1A 3URYA 1T9HA 1QVFA 4A75A 3J7ZC 2Y0SE 3VR4A 3KLSX 2PQEA 2PYKA 4GOPB 4L5TA 1G6ZA 2F0PA 5EAYA 5EPKA 3LWUA 2F0QA 5FLXc 4LF4Q 5BN5A 4JI8L 3NWTA 1W6KA 3MTSA 1WTVA 4RWSC 2K04A 2ZT9C 3K7AH 5M3FG 2ZTEA 2ZM6L 3CCMA 4B3MQ 4JI5Q 2RBMA 1KXLA 5KYLA 5M3MG 2Z9HA 5H1SE 1PA6A 2MO0A 1EQQA 3S1NH 3C46A 2UUBQ 3GTJB 1ICWA 1B3AA 2A69D 2AHOB 1JWUD 3I2ZA 1SE8A 1BF4A 1A0IA 1CKNB 1R9TH 2R7ZB 3L3OC 4AH6A 2MFIA 2K32A 2OCEA 5J39A 3STBD 3A56A 1U9RA 1RL2A 1Y1WG 1FNWA 3VYRA 1F9PA 4J8QA 1VQDA 3M7GA 1HNZL 3QOLA 1MIUA 1Q81C 3PO2G 1IYJB 1DGSA 3S1MH 4DN4M 4LJZC 1SNOA 4ZLTF 3K57A 1QE6A 2E8GA 2ZTCA 4A3KB 1HUNA 1F2LA 3Q24A 5E4WC 4FF2A 2WB1G 4X6AH 1L2FA 2QDLA 2YU9B 3QWNA 2EXZA 4HMIA 1SSOA 1XXGA 1WJJA 5IGDA 3L0OA 4R4CA 2WKCA 3WOEA 3JAMi 1B1ZA 1U4RA 4HN7A 4B3TQ 1DD2A 4X64Q 1B9MA 3OPOA 5JAVA 4ZQ3A 3OOCA 3CXCA 3VR6A 3H3VH 1FYCA 3E9IA 3D8GA 1EFWA 2K28A 1EFID 3GTMH 5KRUA 3U9OA 3TP7A 1G2SA 4U673 1TT2A 3U9SA 4POFA 2AWOA 5C4JH 2KVMA 4DK1A 3JAME 4LFBQ 4GN5A 1TS5A 2A74C 2C9OA 3HG9A 1YEZA 1MJCA 2X69A 5JVH3 2RHSB 4R9WA 1BUVT 1YHAA 3NP8A 4MN3A 3K8AA 4JI7Q 1FD7D 3CCUA 2RDFA 2R3ZA 4Q0FA 4OO1I 3RLOA 3MEHA 1YNXA 1PTOC 4XXEA 3R2IA 4CDCC 4FF4A 1Z9FA 3CMAA 5JOBA 3NEMA 4K2LA 4F87A 5C44B 3H09A 2IX1A 3KF6B 1CT1D 2OT2A 3PV0A 5M5WB 1N33Q 1LO5D 1A3TA 2VW9A 4A3DG 1IYUA 1AZPA 3I4NB 2FFKB 4BY1G 4BS9A 3CCSA 3DEPA 4NMZA 1WTRA 2KQ3A 4OL7A 3S16B 1B4OA 1JOQA 4L6TB 3CC7A 2B8GA 3MFYA 3E3XA 1BKBA 3K5MA 3F8TA 1IBLQ 1QUQA 1Q8KA 1SRUA 3H91A 1Y1VH 1Q90A 1XMOL 4K0KL 4C3HH 2F0SA 2ID0A 2B2UC 5E1FA 4IN3A 1GM5A 3OTOL 1JB7A 4J6HA 1Q86C 1VQ8A 3FVQA 3PMFA 2UXDL 3CU7A 3I4NG 1TKWB 5T1IA 2J0TD 4LW1A 1LUZA 4FP5D 3PQIA 2I07B 5CGKA 2NTTA 5DAUA 4GNXC 2ENBA 1SXTA 1V9PA 4DUYQ 1ENAA 3ZJYC 2Q8RE 1JMCA 2KA7A 1SFOH 1TR5A 1ET6A 4DR7L 3CCVA 1YITA 4HEDA 1K0SA 4CKBA 2ES2A 1IZ6A 4C2MH 1I4QA 2EYLA 1WCMB 4JBJA 1HZBA 1K9MC 3MXUA 5FK9C 1AW7A 3LGJA 3V05A 1ZXTA 1L0XB 1JCKB 1X3GA 3GQBA 3A8KE 1VS0A 3VYSA 1PYSB 1YZ6A 2V4DA 3RN5A 2JA6H 4K6LA 1A6XA 2YU9H 1I4RA 3KLSA 1XNRL 3NUCA 3D6WA 4NPSA 2DY7A 4NXNL 3M9BA 1BBUA 1FJGQ 1S5FD 3I55A 4OO1G 1XYIA 1A8VA 3HOYG 5ELFA 4XQNA 2EDGA 4G7HC 1XTCD 4ODGA 1JT8A 3DWAA 3I70A 5EGTA 1TU2B 1N32Q 1V8QA 2A68D 4PZ6A 4A3JB 2F3WA 4QUCA 1UNSA 3ERSX 4XTCS 1XJVA 1EY6A 1PRTD 4A3MB 1S5CD 4LFCL 3BVGA 2PQAB 1GJXA 2JJQA 1Y14B 1BCPD 2EY5A 2L5TA 1YJWA 2R7ZH 2K1BA 4DUZQ 5G3LD 2RHQB 3CP0A 3NWSA 3DXJC 5FKAC 4XDXA 4A3IG 2VL6A 2JA5H 1HR0L 1HQMC 5JJKA 4P75A 4YY3L 4QF4A 3RR5A 4GN4B 2L0CA 1TWCH 3QR8A 2UUCQ 3HS0C 2LMCB 1YNJC 2KEEA 3K80C 3H0GB 4AQYL 5EKKA 1WOCA 4JOIC 1VQOA 3W1BA 3NK9A 2XIWA 3VA5A 4JI6Q 3X3MA 1I50H 2QF7A 1PH8A 3ONAB 2VY3A 4R4TA 2VNUD 1JOKA 1TWCB 1PV4A 1WTXA 1QVCA 1D1IA 1N34Q 1E24A 2Z1CA 2SNMA 5ISRA 5I9PA 4FVMA 1QNKA 2B2YC 3DLLA 3DUZA 4OHJA 5DLQE 1A62A 1EYCA 1T5EA 3TS0A 1QNUA 3ITPA 1PXUA 2AMCB 4ZK9B 3T16A 1STBA 2G9HD 4YWKA 2XGTA 1VQIA 4QGUA 5IT9L 3HOVH 2MP1A 3PGZA 2E2HH 3ERQA 4X65L 2N78A 5DM73 2GVAA 3MA2B 1MSHA 1VQ9A 3SGIA 2KENA 2I5LX 2G5DA 4A3MG 2A1AA 4NDXA 4XT1B 1NNXA 1I3QB 5DM63 5AJ3Q 2R7FA 1ONLA 5C6AA 1PH4A 3HOWG 1SMYC 3SE0A 2N88A 1CA5A 5EBCA 3VYUA 4IUTA 3S2DH 1HHVA 4C3IB 3PO2B 1NY4A 1D6EC 1BR9A 2OXPA 4JPBW 4NKLA 4CJ1B 4A76A 2K01A 2A5HA 4BA2I 1R4PB 3KF6A 2Z4HA 3FPPA 2QGQA 5CMDA 4IOCA 2H1EA 4U68A 1WCMG 3OIQA 3RD4A 1XWEA 3CCLA 4PNYA 2KOLA 2Z6KC 2DNCA 2F4IA 4L63B 4B3SL 2BCOA 1N36Q 2GN5A 1STEA 1VMPA 2XNAC 4DV5Q 5IGEA 3PO3B 1CSPA 4ALPA 4UDUC 5C0XH 5M5YB 4DR1L 2OTLA 4LWCA 2HD3A 4K5WA 1MGSA 2EZVA 4J15A 1S5DD 1DZ1A 4P71A 1EIYB 2BOSA 2KJXA 2NUCA 2HCIA 3FHWA 4AQYQ 4WFN3 2E2JH 2K5HA 2MJ8A 1V1PB 3NBHB 2PI2A 2VQFL 1OTCA 2PNRC 4XYQA 4DR4Q 4IFDG 5GROA 1H9JA 5JJLA 4DR5Q 4GNXA 4A3BG 1QOHA 1LACA 3P1HA 1FNVA 4DKAC 5JPNC 1F2MA 1I5FA 2Z0SA 4XQQA 1N9WA 1LYLA 4ZUIA 1JOOA 4IUQA 1PVOA 2VQFQ 1HRJA 2AWNA 2AQ1B 1VQ6A 1XPRA 1ESFA 1P8LA 3KBGA 3GTKB 3VR2A 3CCJA 2JE6I 4RKBA 4F88A 3AQQA 1T5XD 1TQOA 5IP7H 5FO9B 1H9RA 1AE3A 2CW0C 2MQHA 3D4RA 1S5ED 2ZJRA 3GTLB 3E9HA 5J22A 1VQAA 5CBAE 4OO1H 4BBRB 1J5EQ 2A6ED 4CHTB 3T13A 4A93G 1YJNA 3U58A 3TZDA 1UEAB 1HTPA 3ND9A 5C4ZA 1IBKL 2JXMB 3IAYA 3L7ZC 2OQKA 1EZ6A 2JA6B 3MXGA 4QIWB 4JOIA 4A3FH 4A3GB 1D5ZC 4XYOA 2IX0A 1H9MA 1TWFH 2KCMA 2XRSD 4PV1C 4TRDA 2RSOA 4G7OC 5T1GA 3I8ZA 2R92G 2VUMG 1LTSD 1CSQA 2E75C 3QG1A 2D9UA 2F0GA 2R93B 3UDIA 5LL6X 1WI5A 3M4YA 3RZDH 2IX3A 1ENFA 3S2DB 2D62A 1TXYA 3NSWA 5C0XG 4YY3Q 2I5MX 3I4MG 1O78A 4KHZA 4N8FA 2ALYB 5LMNW 1WTQA 1LV9A 1E3PA 1G291 2HCCA 5DNFA 3WOFA 1PTOB 1I3QH 1G8ZD 2B3GA 4KY5A 4KN7C 3RMHA 4O2DA 3EA6A 2JN4A 2LS01 3WDNA 1C7YA 3K0YA 4DUZL 4HIDA 1SNMA 1X3QA 2L11A 1JORA 3HOWB 4DR6Q 5EKIA 4YIJA 3NHHA 3GD7A 3K81C 1GHKA 2EYFA 1F9QA 1PLFA 2N49A 5JEAJ 4YHHQ 3J7AF 3M3YB 4ZRZA 2A6HD 1GXDC 5E3FA 4GS3A 5C4HA 1C8CA 1IW7D 3PO3H 2YTVA 5D3DA 3SEBA 5FOBB 3H0GH 5EPJA 1KRTA 4FF1A 4DV5L 2JA9A 4JV5L 1QB5D 1LTGD 4IPDA 2A8VA 3NELA 1K8MA 1QILA 3FDTA 3K5NA 4ME5A 1QZGA 2PZUA 3CCQA 4X3SA 3DM3A 1EIHA 3TDQA 1IW7C 4NXMQ 3O13A 3ZYYX 1EYAA 1EIFA 1HNZQ 3HP3A 3KDFB 1GUWA 3BYTB 4CKCA 1ASZA 2Z6BA 4C3IH 2B63G 3M7NA 1TS3A 3HOZB 5A2QE 3EN2A 4O0AA 1PZKD 4LFBL 3HOXG 4MZ9A 3W1GA 1BCPF 3M85A 2B2VC 5CV5A 1DOMA 1KHIA 3VR5A 4Y7NB 5IGBA 2MUYA 3IFDA 2F4VQ 5C4XG 5C4JB 3AEVA 1HJPA 1VQCA 4HJ7A 1X32A 2WFWA 1RIPA 3BZDB 2VUMH 3K7UC 3CHBD 1Y8OB 2UXCL 3E0JA 3SK4A 3JC66 5FLMH 3FKIB 4JW0A 1ICFB 2D2CC 1SNPA 1EWHA 2OEOA 2E2IB 2D0PA 5IYCG 1M1KC 4R4QA 2IL8A 2CH4W 4RGNA 4HJ8A 4B3RL 4A3LH 5JVG3 1CUKA 4XT3B 1SFOB 2R61A 1I4XA 2EJMA 4KI0A 1Q1BA 1SE3A 2WAQE 1NBWA 2RA4A 1F2YA 3Q23A 4LNQA 2RCFA 3BDCA 3I4NH 2NZ1D 1YNND 3E5SA 1LM0A 2SDFA 5M5WH 5CV4A 5GAEC 3D31A 1TS4A 2F0VA 4KKUA 3HOVG 2BE5D 4DXGA 4DAYB 4RCOA 2JEAI 1PZJD 3C1FA 1EY8A 1B7YB 1PFNA 1X6OA 3EROA 4GKKQ 1DCZA 5DEHA 4YWLA 5IWAQ 1O80A 1XPUA 3NENA 3CCEA 1LTLA 1QWYA 4HJ9A 2L4NA 2RDGA 2CFMA 3D0FA 4UP8A 1EWIA 2NVXH 4K2KA 2E2JB 3T1HQ 5C3EH 1QVGA 4N9TA 4CKEA 5AFWA 4BY7B 2N3SA 2DJGC 3CQZH 2DJFC 1TWHH 1SJED 4DFAA 1DOLA 5HGTA 2XTIA 1IL2A 5LHY1 3AU7A 2RKSA 1KNEA 5F2DA 3H15A 2A6EC 2IHFA 3NTIA 3HOXH 3OW7A 2BA0A 3S1RB 4DPGA 3ULPA 1SEBD 1PTOF 1DOKA 1SDFA 1TWHB 5FJ8G 2IY5B 1WTOA 1LTBD 3VDYA 1FNUA 4LFAQ 3I4MB 2NVQB 2F0WA 1HCZA 2BH2A 2YYZA 3HEJA 1HA5A 4QL5A 1EU3A 2Y0SG 5NUCA 1C48A 1ILPA 1FVIA 5C5LA 2EPBA 4AYBB 1W3SA 2NB0A 3S14H 2F1MA 4JI2L 4QUFA 2Q8IB 4RHRA 1NUCA 4L8JA 4RFBA 2HHHQ 4A3GH 1SR3A 2BA1A 1G6PA 4FF3A 1J6QA 5ELNA 2X6LA 4UAIA 3Q8DA 1HZCA 1EOVA 4H44C 1PRTF 1Z47A 1ZKOA 3GTPH 1Z7TA 3DM1A 4X62L 4HIMA 5JJZA 1VQHA 3KOJA 3OYYA 2FMCA 4QMGA 3J80c 1EU4A 1FGUA 1SAPA 3UE1A 4PQXA 1VMCA 1LTID 1C4QA 1UWVA 2WV6D 3AYHB 4MTNA 4C3JG 2LXJA 5HURA 2A19A 1VQ4A 2F0MA 4O1NA 4WJ3M 4DV3L 4KKTA 5M5YH 4FXDA 2EY6A 3IRBA 4I7AA 3TMEA 4R4IA 3UDXA 2NVXB 2IW3A 4QIWE 3KYHC 3TP5A 3K59A 1XNQQ 3LNNA 3B6YA 2QKIC 1EL0A 1J8IA 4ZUJA 2L12A 1SYDA 4HAEA 4QJFA 5IP9H 2B2YA 3JAML 1Q46A 2BDOA 1BCPC 1TWGH 1FJGL 1GUNA 4FNFA 2AQ3B 1KL9A 1BBWA 3IKJA 1RJTA 2MNAA 1GD7A 1IBLL 2Z4IA 4A93H 1YJ9A 3NTHA 3OIPA 4OWXB 1HXYD 1OXTA 4CJ2C 3CPFA 2E74C 2EY2A 1ESRA 2PW5A 2F0IA 1F9SA 4DV4L 1S72A 1DJRD 1PH6A 4F7XA 4N9PA 3J80E 4A3MH 2ICIA 4CDEC 2E5LL 3TRZA 3RNUA 1VQNA 2B63H 1EZ8A 5FJ8H 3UE0A 2SNSA 4Y52H 4OX9L 2F0OA 1ML0D 3HOZG 2TSSA 2EYHA 1W2BA 5A35A 4ABNA 1LT3D 4A93B 1JE4A 2OTJA 1VQGA 1I94Q 3W5OA 4P74A 1JJCB 2EQSA 4EVOA 4DNRB 3A0JA 2NN6I 1F77A 2F0DA 2EXDA 5M3MH 4Z9CB 1CKOA 1F9RA 4LK1C 1YHBA 1JR0D 2NVYB 3K0XA 3QOJA 1NR4A 1H9SA 1O7YA 4DV2L 2IT1A 5E7NA 1BO0A 1EQRA 4JC0A 4LF9Q 2MO1A 4A3CG 1X9NA 2HQLA 3VA7A 2EE1A 4YCVA 5LMUQ 4EQPA 1HFNA 2WB1E 2XN9C 2XRQD 3PO2H 4B9XA 4RCNA 1BNZA 4LAAA 3F2UA 3R93A 2WP8J 4JBWA 2C5CA 1KDBA 4C3JH 1HUMA 5G3LF 1KAWA 1Y1WH 1I94L 2R6GA 4MNOA 3T1YL 3S1QB 3AMUA 1PH3A 4RMFA 4BXXG 1OXUA 1VF5C 4A3BH 4ID6A 1CFMA 3GDEA 1HNXQ 1ASYA 3MXNA 4OX9Q 3BG3A 4O42A 1QUQB 1YVCA 3NBHA 2L55A 3QO2A 1LTRD 5KYIA 1HH2P 5CV8A 3I4OA 1UAPA 1BOSA 3HOVB 4IZ8A 4MIUA 4HMJA 4DR4L 4DV7L 3J81L 1K3BC 2RVLA 1EY4A 1B70B 3R8BA 2NBFA 2I5HA 3M4OH 1UE6A 1A3VA 4DNTB 1G91A 3HOUB 1CKNA 3CF5A 1TY2A 4X65Q 1UUPA 5C3EG 1KDCA 5GAHC 4KJNA 1RF2D 2WIIB 3A5ZB 4DA2A 3G7LA 4JI5L 2ZM6Q 4B3ML 4C1NI 4MHEA 1AE2A 1CZWA 1XNQL 1WTHA 3TREA 1II3A 3H94A 4OELB 2CKZB 1JE5A 1QJOA 4QB4A 2K5NA 3K5LA 2R7ZG 1N32L 2EJGC 5CV9A 4LF4L 4R8NA 4C3HB 1U0LA 1J5EL 4A3FG 2Z6KA 3FRPB 1CQFA 1MKHA 2GA4B 4KV6A 3KK7A 3TBIB 1GHJA 4V190 4NXNQ 2UUAL 3L9AX 4A3LG 1CZGA 1PHJA 4JBMA 4C3HG 1OXXK 2EOTA 3CMEA 2KECA 4X3TA 5M3FB 1X54A 3GTMB 2BH8A 2V1CC 1Y1VB 4IPHA 1TY0A 2F0TA 2QA4A 2PZWA 1HTLD 2K5QA 2B63B 2KCCA 2VZAA 4RGTA 4H0LC 3PUZA 4LF5L 3S15H 1Y1VG 3S14B 1RTOA 2ZJPA 3BDLA 2N8NA 4DR2Q 2B2WC 1B44D 3A5UA 4HIKA 1MD2D 1EY7A 4K8JA 1PDQA 2LFNA 3QIAA 2KEDA 4B08A 4DR1Q 3I4MH 4IFDI 2AUKA 4NW2A 1DM0B 4I65A 1KLUD 2CWAA 4N8X1 1PYBA 4JI4Q 4HSVA 4JK1C 4JYAQ 1EYGA 2QDBA 3J7A5 4X3UA 3TQYA 5K36G 5I6WA 2NN6G 2I0QA 2FHTA 1SYEA 3MZ5A 3OWEB 5A2QL 2NYZD 3G6JB 1K8AC 2UXDQ 5IE8A 2YTXA 5BN4A 1KABA 3CPWA 4K5VA 3T4AC 2G9DA 2MHVA 1STGA 3OWFA 1U4PA 2J4XA 4A3EH 1XNRQ 3G4SA 3S17H 4K0KQ 4ZKBB 4Q5VA 2LKVA 4IPCA 5C3WA 4G7ZC 3HOUG 3ULJA 3MHBA 3GO5A 4X62Q 5IT9E 5CORA 3SK8A 4GKJQ 4S3SA 3DHQA 2K5VA 2CHBD 4DXFA 1CQVA 1EY0A 3M4PA 1Q8IA 4HSPA 5I2YA 4DK0A 4IURA 4KTAA 4ULLA 4IO9A 1XPOA 1YIJA 2UU9Q 1HR0W 2ZXPA 2PCFB 2CCZA 4BBSG 4IJLA 2Q2TA 1PH5A 4H13C 5M3FH 5TSSA 3EQLC 2O4XA 4A3GG 2EVBA 4BA1I 2A6HC 1EEFD 1XTDA 5KNBA 4AYBG 4DR3Q 2F0EA 3E0EA 5J3BA 1VDZA 4L5QA 3I56A 4LF8Q 3GTGB 2F0HA 1A3UA 1N34L 1KTKA 5M5XH 4B3SQ 2K7VA 5IT9c 5FLMG 4PMBA 3UDFA 3I90A 1MI2A 2VQEL 1K73C 3D4WA 2A68C 4CDFC 3J81i 4UHVA 5IYCH 2R92B 3X3NA 4OWTB 1D8LA 1EUJA 3UI2A 1U5KA 4M8AA 1IBMQ 3SDZA 3NQIA 1O7LA 4YCUA 1NAPA 1IKLA 2DGYA 1B2TA 1ET9A 4BXXH 3RUZA 4B9WA 4PZ8A 3PF5A 3MXPA 3S17B 3CD6A 1CI3M 1OO9B 3ULLA 5IGCA 1A15A 1VQMA 2Q2IA 4R1JA 4BY1B 3WWVA 3Q0AA 4QQBX 4BWGB 4P72A 2E2IH 3T53B 1HR0Q 4A3IB 1I6VC 4OXPA 1HNWQ 2F3VA 3AFPA 4WJ4A 4GZYC 4HIOA 1TWAB 2WB1B 5KIXA 1H95A 1SBBB 1P16A 3HOZH 4V0BA 4PZ7A 5GAGC 1HFGA 5BR8L 1A2TA 1NE3A 1O7ZA 2WKDA 4ZYSA 4KJOA 2JA7H 3I7FA 2C35B 2AUJD 1PYWD 3J7AV 1EYDA 3E6ZX 3S15B 3VR3A 2NVYH 4G57A 2EYOA 3J80L 3FKIH 1BVSA 1SYBA 1NCVA 4BY7H 4KHVA 3HKZG 2PZTA 2F0JA 1WD0A 1OXVA 1DXMA 4DNIA 3D6CA 1JICA 2F4VL 5IWAL 2Q2HA 4JI6L 1C0AA 4M1UB 5COYA 3J81E 3TEHB 5EKLA 3C2PA 1AFPA 1K83H 3NPPA 2SOBA 1CK1A 1E1OA 3PCOB 1VQPA 4AYBE 1AZQA 1CM9A 4HCSA 4LUZA 3HKSA 3K6OA 2NVTB 4DR7Q 4QY7A 3A7AB 2EYMA 2QILA 1X3PA 1JQYD 1RCVD 1CTMA 2F0LA 5ELBA 4DR5L 4CDDC 3FEWX 4K8IA 1KC8C 4JI0L 1GO3E 2MPMA 3I91A 1Y1WB 3PO3G 4ME3A 3PF4A 2VQEQ 3TZUA 2NVTH 3H0GG 3EVQA 3CRLC 4LFAL 4DUYL 5CV7A 3BZKA 3KBXA 3P7JA 4A3JH 2NTSA 1S40A 2K14A 4RG1A 4LF8L 2YTYA 3OMGA 1IKMA 3MWYW 4DV6Q 4JI1Q 1XMOQ 5ELOA 3EBEA 2HIVA 1RKNA 1BXTA 5C0XJ 4IFDH 3DWPA 1UE1A 5D14A 1EWCA 4A3FB 3P20A 3RZDB 4E6IA 2JEBI 2YV5A 3PUWA 5HGQA 4GN3B 2H4OA 3GTKH 3MAQA 3HOYH 1BQQT 1A2UA 4C3IG 1EOTA 3P75A 3U4ZA 2UXCQ 3KLRA 4JI0Q 3TP6A 3PIPA 1LABA 2JA7B 1WVLA 1NTGA 2JK8A 4FDBA 3GTPB 1B8AA 5JEAG 4L5SA 1ILQA 3R2TA 1E0BA 1D1KA 5IIFA 1VQBA 2JA7G 4KD3A 3SXHA 4GLVB 1SYFA 1QCBD 4IUUA 1SE4A 2P5ZX 4PG3A 2UU9L 2RSNA 1X65A 5ELEA 5EJWA 4GOPC 1X3FA 1A63A 5EPLA 2M00A 2PQAA 3QJYA 4DV4Q 4X66Q 4A3IH 1YNNC 2UUBL 4I7ZC 3C3LA 3D4DA 5IY0A 2R92H 1V1PA 1TWFB 4GLAC 1K3RA 3CQZB 1HZAA 2WAQB 1TS2A 4JVZA 2RDHA 2R93G 5C3EB 4JI3L 5CV6A 2D0OA 1ZYRC 2FINB 3FPUB 1LT5D 1SE2A 3RLFA 1ZYRD 1B50A 3K58A 4C56C 5GADC 3LWEA 1KDAA 2CW0D 4X64L 4DV3Q 3OHXC 4B3RQ 1E2ZA 1STNA 3H3VC 3EJIA 2DN8A 3GTQB 3J81c 3KF8A 4JI1L 2SEBD 3NXWA 1PTOD 2NVQH 3M3YH 1YBYA 5E4XA 3AFQA 3V2TA 3GTLH 2EYPA 2F0UA 2UXBQ 4G4KA 2RQXA 3T1HL 2IHEA 1I4GA 3CW2C 2AKWB 1I50B 3HZXA 2GVBA 4HR7B 4IJHA 5J1ZA 4A3KG 1E2VA 4KY7A 2E2DC 2QEJC 3C1EA 2B2TA 4LF5Q 4LMQD 5C44H 2BE5C 1PZID 1D5MC 1XX8A 3GTOB 1VQJA 2QEXA 4DR2L 4A3EG 1UEBA 2I46A 2KHJA 5CYUA 4HJ5A 2HDLA 3HOUH 2L15A 3V96A 5ELCA 1Y8NB 5IYBH 1KLGD 4LUVA 3U50C 1VQLA 3M4OB 3MEFA 3A54A 1B53A 3KF8B 1HZ9A 3PUVA 4KHPL 2UUAQ 2HHHL 2Q8TA 4PMWA 2O5JC 4IPGA 4TKOB 2K33A 1TIID 4KY6A 4GLXA 2IJ0A 1CHPD 3HGBA 1IBKQ 1JJ2A 4EQNA 3S9WA 3JAMc 1GOZA 2X6GA 4X3KA 2DUDA 3HKZE 4OIKA 5CC4A 5JEAH 3FMCA 2KCNA 1WYDA 2DNEA 2FJ2A 3STBC 4RA8A 1S4ZA 3S1QH 4JBKA 4ZAIA 2JA6G 3S1MB 1SROA 4XIGS 1JB3A 2R7DA 3HOXB 1SMXA 3TS2A 4DAVA 4DAPA 3KFUA 5IGGA 5FO8B 3HFZB 2B2UA 1DONA 2VXWA 3G71A 1JWSD 4HTHA 2HT1A 2IPKD 2WACA 1KAAA 4R4OA 5JPMC 1K8OA 1D7QA 1ENCA 2AQ2B 1HNWL 1RTNA 1V1QA 5I9OA 1NMGA 1S5BD 1VQ7A 1GVPA 3H6MA 4KHPQ 2E2HB 2E5LQ 1KNAA 2XVSA 1HQRD 5FLXL 3PIOA 5AJ3L 3HKZB 5LMNQ 1X55A 4WRDA 1Q12A 4YWMA 2PMZB 4FO2A 1H9SB 3NBIA 1WFQA 1NSNS 1PFBA 3CAMA 4RKLA 1GUGA 1HNXL 4WJWA 3RLNA 1FGBD 1E1TA 3MVVA 2L9HA 1EQTA 4MTKA 2EJFC 2CQOA 2VB2X 3HOYB 1D5XC 3CC2A 1WTWA 3PIO3 4BBSB 1N36L 3UDGA 1VQKA 4A4IA 3OMCA 1I4HA 4GNXB 1M90C 2JA8H 5C3XA 5KEEA 3Q22A 1NMFA 4OIJA 2FXQA 4C1NK 4DAMA 4KK7A 2O2LD 2LSSA 1EEID 4NP5A 4IQZA 1NJIC 5IP7G 1TWGB 1S3OA 3BZCA 4DV2Q 3BS1A 2JQOA 1GUTA 5CR3A 5C5MA 2JA5B 3OSOA 4X66L 2PNHA 3S16H 1SLJA 4APVA 2VUMB 1RHPA 1I6HB 1Q3LA 4LUOA 2L1BA 2Z8LA 2EYJA 2F03A 2CVRA 1AEXA 3F2CA 1QG7A 4QCLA 4RAUC 3NQTA 1STAA 3A55A 3DWQA 1O7IA 4JCVE 5C0XI 4ZCKA 2ICEC 2WAQG 5D65A 2UUCL 4RHSA 5EQ0A 5CBEE 4R8IA 1HPCA 4BY7G 4GKKL 3PUXA 1IL8A 3R3OA 2Q2UA 4GKJL 4JI2Q 2HQEA 5IYDG 1PRTB 2H5XA 3RN2A 4HCEA 4BBRG 1K83B 3PIP3 3NE5B 2KUMA 1SNQA 3W2DA 3KJOA 1BCPB 4BY1H 1LLRD 1PFMA 1SMYD 4KD4A 4JV5Q 2ATWA 1GUOA 2WINB 4OGQC 1N8RC 3SHLA 1PMRA 1JWMD 2J7ZA 4DV6L 1FR3A 3KLWA 2R93H 4RH6A 3PUYA 5LL6S 3J81j 4JYAL 2KBNA 4LF9L 3I72A 5C4XB 1WCMH 3OTOQ 3CKIB 3J7YW 1Q1EA 3NTKA 4A3JG 1D2BA 1G2TA 5L37A 1Q7YC 1AH9A 4CGYB 2RF4A 3VYTA 3MC0B 2B29A 2K5WA 3MFGA 1SNCA 4FXKC 2JA8G 1PFSA 4RGMA 2PPBC 1R4QB 4DV1L 2K4KA 3S2HB 2A69C 2N55A 1EIGA 1SJHD 2OF1A 3K5OA 2ZXOA 1F2ZA 1X56A 4JG2A 2KHSA 3A7LA 5I4DA 3RZOH 5HY6A 1HA6A 5LMNL 2A73B 2B2WA 3IL8A 3GTQH 4JI7L 3F2BA 1QZHA 4H7BA 4DK6C 3AB9A 1H9KA 2OQ0A 1PH2A 3A8JE 1W6JA 4EGVA 1SYCA 4NB3A 4XQJA 4GOPA 4UP9A 1VQEA 3BVMA 4CBVA 1U4LA 1RDPD 2ZTDA 3TN2A 2F0NA 2O5IC 5IGFA 1L0YB 1BDOA 1L1OC 1LTAD 2JP1A 2K05A 1YHQA 4FXGC 4KMUC 2FMMA 4EX5A 1MSGA 1STYA 2XSCA 3GV6A 3S1RH 3I4LA 4DU9A 1YI2A 3ICEA 5IODA 4LF7L 1XMQQ 2K03A 1GUSA 3BDOA 3Q6SA 4KLKA 4WORA 2EIFA 1LT6D 4TSSA 2M9VA 4KN4C 3OW2A 2K52A 5IYDH 4F8MA 4BBRH 1I4PA 3A8IE 5IOCA 5JJIA 3D3RA 2B8FA 4UPAA 3A74A 3CRKC 3MXNB 2RCNA 4KKSA
chains in the Genus database with same CATH topology
2PO4A 3LX0A 1J9OA 4RGOS 2E76C 2D5DA 2M2LA 1WTPA 2F0KA 5EBDA 2B2TC 4A3EB 1EY5A 4P2CB 3DMUA 3IFTA 4ILWA 5KNDA 1Y69U 5D3IB 3RZOB 5ELDA 1IHZA 2PW7A 1R9TB 1YNJD 1E2WA 4IUNA 1RD9D 4A3DB 1AP0A 1B9NA 2ZXRA 3HRZC 5KGUA 2MGSA 3S1NB 1SNDA 1ZEQX 5K36H 4K6DA 2NN6H 4DAYA 1VCIA 2B2VA 1M8AA 3SVMA 2NWGA 1JC7A 3KUPA 4IUPA 1MBYA 2XWJB 2TMPA 4DF7A 1BBXC 2F0FA 2Y0SB 5M9OA 1WD1A 2QCPX 4PMCA 4K5XA 5FLXE 1EY9A 1VF7A 1U4MA 4EQOA 4K14A 3QB3A 2LY7A 3DEOA 3EFXD 3SR1A 1EQVA 3I73A 1CA6A 1OXSC 3W3AA 3TSSA 2VB3X 1Z6HA 5I2XA 3I3CA 1V43A 4C3JB 3T51B 2K5DA 3BVZA 2JSOA 4IUVA 2B39A 1SYGA 4DGZA 3N6RA 3ND8A 1AN8A 3K7AB 4IALA 4IFDJ 2K6AA 2JA8B 5M3MB 1RODA 5KNCA 4J1MA 1DYQA 3GP7A 4TQUS 3SK6A 1V1OA 1STHA 1Y8PB 2CQAA 4A3BB 1M4VA 1PRTC 2IWHA 4ZKCB 3SK5A 3GV3A 2JYOA 1PTOH 4CJ0B 1NR2A 5FO7B 2HUGA 4FYDA 5BN3A 5M5XB 3T56B 3TP8A 3BYYB 3N52A 1LTTD 2BDNA 2DY8A 1LT4D 1CHQD 5K5PA 1IYVA 5I6YA 4C2MB 1TVXA 2XWBB 2HDMA 3URYA 2EY1A 3VR4A 3KLSX 2PQEA 2PYKA 1G6ZA 2F0PA 5EPKA 3LWUA 2F0QA 5BN5A 3NWTA 1W6KA 3MTSA 1WTVA 4RWSC 2K04A 2ZT9C 2RBMA 5KYLA 3C46A 3GTJB 1ICWA 1B3AA 2A69D 1JWUD 1BF4A 2R7ZB 3L3OC 2K32A 5J39A 3A56A 1U9RA 1FNWA 3VYRA 1F9PA 4J8QA 3M7GA 3QOLA 4DN4M 4LJZC 1SNOA 4ZLTF 3K57A 1QE6A 4A3KB 1HUNA 1F2LA 3Q24A 5E4WC 4FF2A 2YU9B 3QWNA 2EXZA 4HMIA 1SSOA 1XXGA 5IGDA 2WKCA 3WOEA 1B1ZA 1U4RA 4HN7A 1DD2A 1B9MA 3OPOA 5JAVA 4ZQ3A 3OOCA 3VR6A 1FYCA 3D8GA 2K28A 1EFID 5KRUA 3U9OA 3TP7A 1G2SA 4U673 1TT2A 3U9SA 2AWOA 2KVMA 4DK1A 3JAME 1TS5A 2A74C 2C9OA 3HG9A 2X69A 5JVH3 4R9WA 1BUVT 3NP8A 4MN3A 1FD7D 2RDFA 2R3ZA 4Q0FA 4OO1I 3MEHA 4XXEA 1PTOC 3R2IA 4FF4A 5JOBA 4K2LA 4F87A 5C44B 3H09A 2IX1A 1CT1D 2OT2A 5M5WB 3PV0A 1LO5D 1A3TA 1IYUA 1AZPA 3I4NB 2FFKB 4BS9A 3DEPA 4NMZA 1WTRA 2KQ3A 4OL7A 3S16B 1B4OA 1JOQA 4L6TB 2B8GA 3MFYA 3K5MA 3H91A 1Q90A 2F0SA 2ID0A 2B2UC 5E1FA 4IN3A 4J6HA 3FVQA 3PMFA 3CU7A 1TKWB 5T1IA 2J0TD 4FP5D 2I07B 5CGKA 2NTTA 5DAUA 2ENBA 1SXTA 1ENAA 2Q8RE 2KA7A 1TR5A 1ET6A 4HEDA 4CKBA 1I4QA 2EYLA 1WCMB 3MXUA 5FK9C 1AW7A 3V05A 1ZXTA 1L0XB 1JCKB 3GQBA 3A8KE 3VYSA 2V4DA 4K6LA 1A6XA 1I4RA 3KLSA 3NUCA 3D6WA 2DY7A 1S5FD 4OO1G 1XYIA 5ELFA 4G7HC 2EDGA 4XQNA 1XTCD 4ODGA 3DWAA 3I70A 5EGTA 1TU2B 1V8QA 2A68D 4A3JB 2F3WA 4QUCA 1UNSA 4XTCS 1EY6A 1PRTD 4A3MB 1S5CD 3BVGA 1GJXA 1BCPD 2EY5A 2L5TA 2K1BA 5G3LD 3NWSA 3DXJC 5FKAC 4XDXA 1HQMC 4QF4A 2L0CA 3HS0C 2LMCB 1YNJC 2KEEA 3H0GB 5EKKA 3NK9A 2XIWA 3VA5A 3X3MA 2QF7A 3ONAB 2VNUD 1JOKA 1TWCB 1WTXA 1D1IA 2Z1CA 2SNMA 5ISRA 5I9PA 4FVMA 1QNKA 2B2YC 3DUZA 4OHJA 1EYCA 1T5EA 1QNUA 3ITPA 1PXUA 4ZK9B 3T16A 1STBA 2G9HD 5IT9L 2MP1A 3ERQA 5DM73 3MA2B 1MSHA 4NDXA 4XT1B 1I3QB 5DM63 1ONLA 5C6AA 1SMYC 3SE0A 2N88A 1CA5A 5EBCA 3VYUA 4IUTA 1HHVA 4C3IB 3PO2B 1D6EC 1BR9A 2OXPA 4NKLA 4CJ1B 2K01A 2A5HA 4BA2I 1R4PB 2Z4HA 3FPPA 5CMDA 2H1EA 4U68A 3OIQA 3RD4A 1XWEA 4PNYA 2KOLA 2DNCA 2F4IA 4L63B 2BCOA 1STEA 1VMPA 2XNAC 5IGEA 3PO3B 4UDUC 5C0XH 5M5YB 4K5WA 1MGSA 2EZVA 1S5DD 1DZ1A 2BOSA 2KJXA 2NUCA 2HCIA 4WFN3 2MJ8A 1V1PB 2PNRC 4XYQA 4IFDG 1H9JA 1QOHA 1LACA 3P1HA 1FNVA 5JPNC 1F2MA 4XQQA 4ZUIA 1JOOA 4IUQA 1HRJA 2AWNA 2AQ1B 1ESFA 3KBGA 3GTKB 3VR2A 2JE6I 4RKBA 4F88A 1T5XD 1TQOA 5FO9B 1H9RA 2CW0C 3D4RA 1S5ED 3GTLB 5J22A 5CBAE 4OO1H 4BBRB 2A6ED 4CHTB 3T13A 3TZDA 1UEAB 1HTPA 3ND9A 5C4ZA 2JXMB 3IAYA 3L7ZC 1EZ6A 2JA6B 3MXGA 4QIWB 4A3GB 1D5ZC 4XYOA 2IX0A 1H9MA 2XRSD 4PV1C 4TRDA 2RSOA 4G7OC 5T1GA 3I8ZA 1LTSD 2E75C 3QG1A 2D9UA 2F0GA 2R93B 5LL6X 3M4YA 2IX3A 1ENFA 3S2DB 2D62A 3NSWA 5C0XG 1O78A 4KHZA 1WTQA 1LV9A 2HCCA 1G291 5DNFA 3WOFA 1PTOB 1G8ZD 4KY5A 4KN7C 3RMHA 3EA6A 2LS01 3WDNA 3K0YA 1SNMA 1X3QA 2L11A 1JORA 3HOWB 5EKIA 4YIJA 3NHHA 3GD7A 1GHKA 2EYFA 1F9QA 1PLFA 5JEAJ 3J7AF 3M3YB 4ZRZA 2A6HD 1GXDC 5E3FA 5C4HA 1C8CA 1IW7D 5D3DA 3SEBA 5FOBB 5EPJA 4FF1A 1QB5D 1LTGD 1K8MA 1QILA 3FDTA 3K5NA 4ME5A 2PZUA 4X3SA 1EIHA 3TDQA 1IW7C 3O13A 3ZYYX 1EYAA 3HP3A 1GUWA 3BYTB 4CKCA 3M7NA 1TS3A 3HOZB 5A2QE 1PZKD 1BCPF 3M85A 2B2VC 5CV5A 1DOMA 3VR5A 4Y7NB 5IGBA 2MUYA 3IFDA 5C4JB 1X32A 3BZDB 3CHBD 1Y8OB 3E0JA 3SK4A 3FKIB 2D2CC 1SNPA 1EWHA 2OEOA 2E2IB 2IL8A 4RGNA 5JVG3 4XT3B 1SFOB 2R61A 1I4XA 2EJMA 4KI0A 1Q1BA 1SE3A 2RA4A 1F2YA 3Q23A 3BDCA 2NZ1D 1YNND 3E5SA 2SDFA 5CV4A 3D31A 1TS4A 2F0VA 4KKUA 2BE5D 4DXGA 4RCOA 2JEAI 1PZJD 3C1FA 1EY8A 1PFNA 3EROA 1DCZA 5DEHA 1O80A 1QWYA 2L4NA 2RDGA 4K2KA 2E2JB 4N9TA 4CKEA 5AFWA 4BY7B 1SJED 4DFAA 1DOLA 5HGTA 5LHY1 3AU7A 2RKSA 1KNEA 5F2DA 2A6EC 3NTIA 3OW7A 2BA0A 3S1RB 1SEBD 1PTOF 1TWHB 1SDFA 1DOKA 1WTOA 1LTBD 1FNUA 3I4MB 2NVQB 2F0WA 1HCZA 2YYZA 3HEJA 1HA5A 1EU3A 5NUCA 1C48A 1ILPA 5C5LA 2EPBA 4AYBB 2NB0A 2F1MA 4QUFA 2Q8IB 4RHRA 1NUCA 4L8JA 4RFBA 2BA1A 4FF3A 2X6LA 4UAIA 4H44C 1PRTF 1Z47A 1ZKOA 1Z7TA 3DM1A 5JJZA 2FMCA 4QMGA 1EU4A 1SAPA 4PQXA 1VMCA 1LTID 1C4QA 2WV6D 4C3JG 5HURA 2F0MA 4O1NA 4KKTA 4FXDA 2EY6A 3TMEA 2NVXB 2IW3A 3K59A 3TP5A 3LNNA 2QKIC 1EL0A 1J8IA 4ZUJA 2L12A 1SYDA 4HAEA 2B2YA 3JAML 2BDOA 1BCPC 1GUNA 4FNFA 2AQ3B 3IKJA 1RJTA 2Z4IA 3NTHA 3OIPA 1HXYD 1OXTA 4CJ2C 2E74C 2EY2A 1ESRA 2PW5A 2F0IA 1F9SA 1DJRD 4F7XA 4N9PA 3J80E 2ICIA 1EZ8A 2SNSA 2F0OA 1ML0D 2TSSA 2EYHA 5A35A 4ABNA 1LT3D 4A93B 1JE4A 4EVOA 4DNRB 2NN6I 1F77A 2F0DA 4Z9CB 1F9RA 2NVYB 4LK1C 1JR0D 3QOJA 1NR4A 1H9SA 1O7YA 2IT1A 1BO0A 3VA7A 2EE1A 4EQPA 1HFNA 2XN9C 2XRQD 4B9XA 4RCNA 1BNZA 4LAAA 3F2UA 3R93A 2WP8J 4JBWA 2C5CA 1KDBA 1HUMA 5G3LF 2R6GA 3S1QB 3AMUA 1OXUA 1VF5C 4ID6A 1CFMA 3MXNA 3BG3A 4O42A 3NBHA 2L55A 3QO2A 1LTRD 5KYIA 5CV8A 1UAPA 1BOSA 3HOVB 4IZ8A 4MIUA 4HMJA 3J81L 2RVLA 1EY4A 3R8BA 2NBFA 1A3VA 4DNTB 1G91A 3HOUB 1TY2A 1UUPA 1KDCA 4KJNA 1RF2D 2WIIB 4DA2A 3G7LA 4C1NI 4MHEA 1CZWA 1II3A 3H94A 1QJOA 4QB4A 3K5LA 2EJGC 5CV9A 4R8NA 4C3HB 3FRPB 1CQFA 2GA4B 4KV6A 3KK7A 3TBIB 1GHJA 4V190 3L9AX 1CZGA 4C3HG 1OXXK 2EOTA 2KECA 4X3TA 5M3FB 3GTMB 1Y1VB 1TY0A 2F0TA 2PZWA 1HTLD 2K5QA 2B63B 2KCCA 4RGTA 4H0LC 3PUZA 3S14B 1RTOA 3BDLA 2B2WC 1B44D 1MD2D 1EY7A 4K8JA 1PDQA 2LFNA 3QIAA 2KEDA 4B08A 4IFDI 2AUKA 4NW2A 1DM0B 4I65A 1KLUD 4HSVA 4JK1C 2QDBA 4X3UA 5K36G 5I6WA 2NN6G 2FHTA 1SYEA 3MZ5A 3OWEB 5A2QL 2NYZD 3G6JB 5BN4A 1KABA 4K5VA 3T4AC 2G9DA 2MHVA 1STGA 3OWFA 1U4PA 2J4XA 4ZKBB 4Q5VA 2LKVA 5C3WA 4G7ZC 3MHBA 3GO5A 5IT9E 5CORA 3SK8A 4S3SA 3DHQA 2CHBD 4DXFA 1CQVA 1EY0A 1Q8IA 4HSPA 5I2YA 4DK0A 4IURA 4KTAA 4ULLA 2ZXPA 2PCFB 4H13C 5TSSA 3EQLC 2O4XA 2EVBA 4BA1I 2A6HC 1EEFD 5KNBA 2F0EA 1VDZA 3GTGB 2F0HA 1A3UA 1KTKA 2K7VA 4PMBA 3I90A 1MI2A 3D4WA 2A68C 2R92B 3X3NA 3UI2A 4M8AA 3SDZA 3NQIA 1O7LA 1NAPA 1IKLA 1B2TA 1ET9A 3RUZA 4B9WA 3MXPA 3S17B 1CI3M 1OO9B 5IGCA 1A15A 4BY1B 3Q0AA 4BWGB 3T53B 4A3IB 1I6VC 2F3VA 4GZYC 1TWAB 2WB1B 5KIXA 1SBBB 4V0BA 1HFGA 1A2TA 1O7ZA 2WKDA 4ZYSA 4KJOA 2AUJD 1PYWD 3J7AV 1EYDA 3E6ZX 3S15B 3VR3A 4G57A 2EYOA 3J80L 1SYBA 1NCVA 4KHVA 2PZTA 2F0JA 1WD0A 1DXMA 1OXVA 3D6CA 1JICA 4M1UB 5COYA 3J81E 5EKLA 3C2PA 1AFPA 3NPPA 2SOBA 1CK1A 1AZQA 1CM9A 4HCSA 3K6OA 2NVTB 3A7AB 2EYMA 2QILA 1X3PA 1JQYD 1RCVD 1CTMA 2F0LA 5ELBA 3FEWX 4K8IA 2MPMA 3I91A 1Y1WB 3TZUA 3EVQA 3CRLC 5CV7A 3KBXA 3P7JA 2NTSA 3OMGA 1IKMA 3MWYW 1RKNA 1BXTA 5C0XJ 4IFDH 3DWPA 5D14A 1EWCA 4A3FB 3P20A 3RZDB 4E6IA 2JEBI 3PUWA 2H4OA 3MAQA 1BQQT 1A2UA 4C3IG 1EOTA 3P75A 3KLRA 3TP6A 1LABA 2JA7B 1WVLA 3GTPB 5JEAG 1ILQA 3R2TA 1E0BA 1D1KA 5IIFA 4KD3A 3SXHA 1SYFA 1QCBD 4IUUA 1SE4A 2RSNA 5ELEA 5EJWA 5EPLA 2M00A 3QJYA 1YNNC 4I7ZC 3C3LA 3D4DA 1V1PA 1TWFB 3CQZB 2WAQB 1TS2A 2RDHA 5C3EB 5CV6A 1ZYRC 2FINB 3FPUB 3RLFA 1LT5D 1SE2A 1ZYRD 1B50A 3K58A 4C56C 3LWEA 1KDAA 2CW0D 3OHXC 1E2ZA 1STNA 3H3VC 3EJIA 2DN8A 3GTQB 3KF8A 2SEBD 3NXWA 1PTOD 5E4XA 3V2TA 2EYPA 2F0UA 4G4KA 2RQXA 1I4GA 1I50B 3HZXA 4HR7B 5J1ZA 1E2VA 4KY7A 2E2DC 2QEJC 3C1EA 2B2TA 4LMQD 2BE5C 1PZID 1D5MC 1XX8A 3GTOB 2I46A 5CYUA 2HDLA 3V96A 5ELCA 1Y8NB 1KLGD 3M4OB 3A54A 1B53A 3PUVA 2Q8TA 4PMWA 2O5JC 4TKOB 2K33A 1TIID 4KY6A 2IJ0A 1CHPD 3HGBA 4EQNA 3S9WA 1GOZA 2X6GA 4X3KA 4OIKA 5CC4A 5JEAH 3FMCA 2KCNA 2DNEA 2FJ2A 4RA8A 1S4ZA 4ZAIA 3S1MB 4XIGS 1JB3A 3HOXB 4DAVA 4DAPA 5IGGA 5FO8B 2B2UA 1DONA 2VXWA 1JWSD 4HTHA 2IPKD 2WACA 1KAAA 5JPMC 1K8OA 1ENCA 2AQ2B 1RTNA 5I9OA 1S5BD 3H6MA 2E2HB 1KNAA 2XVSA 1HQRD 5FLXL 3HKZB 4WRDA 1Q12A 2PMZB 4FO2A 1H9SB 3NBIA 1NSNS 1PFBA 4RKLA 1GUGA 4WJWA 1FGBD 3MVVA 2L9HA 1EQTA 2EJFC 2VB2X 3HOYB 1D5XC 1WTWA 3PIO3 4BBSB 3OMCA 1I4HA 5C3XA 5KEEA 3Q22A 4OIJA 4C1NK 4KK7A 2O2LD 4NP5A 1EEID 4IQZA 1TWGB 3BS1A 1GUTA 5CR3A 5C5MA 2JA5B 3OSOA 2VUMB 1RHPA 1I6HB 1Q3LA 2L1BA 2Z8LA 2EYJA 2F03A 2CVRA 1AEXA 1QG7A 4QCLA 4RAUC 1STAA 3NQTA 3A55A 3DWQA 5C0XI 2ICEC 5D65A 4RHSA 5EQ0A 5CBEE 4R8IA 1HPCA 3PUXA 1IL8A 3R3OA 2HQEA 1PRTB 4HCEA 1K83B 3PIP3 3NE5B 2KUMA 1SNQA 3W2DA 1BCPB 1LLRD 1PFMA 1SMYD 4KD4A 1GUOA 2WINB 4OGQC 3SHLA 1PMRA 1JWMD 2J7ZA 1FR3A 4RH6A 3PUYA 5LL6S 3I72A 5C4XB 3CKIB 3J7YW 1Q1EA 3NTKA 1D2BA 1G2TA 4CGYB 3VYTA 3MC0B 2K5WA 3MFGA 1SNCA 4FXKC 4RGMA 2PPBC 1R4QB 3S2HB 2A69C 2N55A 1EIGA 1SJHD 2OF1A 3K5OA 2ZXOA 1F2ZA 2KHSA 3A7LA 5I4DA 1HA6A 2A73B 2B2WA 3IL8A 4H7BA 3AB9A 1H9KA 3A8JE 1W6JA 4EGVA 1SYCA 4XQJA 3BVMA 4CBVA 1U4LA 1RDPD 3TN2A 2F0NA 2O5IC 5IGFA 1L0YB 1BDOA 1LTAD 2JP1A 2K05A 4FXGC 4KMUC 2FMMA 1MSGA 1STYA 2XSCA 3GV6A 3I4LA 4DU9A 5IODA 2K03A 1GUSA 3BDOA 3Q6SA 4WORA 1LT6D 4TSSA 2M9VA 4KN4C 4F8MA 1I4PA 3A8IE 5IOCA 3D3RA 2B8FA 3CRKC 4KKSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J9O A;  4IUV A;  1WD0 A;  1ICW A;  5CMD A;  1B3A A;  1ILP A;  1PFM A;  1JIC A;  2K1B A;  2RSO A;  2M2L A;  5T1G A;  3I8Z A;  2EPB A;  2H1E A;  4U68 A;  1WTP A;  2EOT A;  3H91 A;  2KEC A;  4X3T A;  5COY A;  1RTN A;  2D9U A;  1BF4 A;  4QUF A;  2J7Z A;  4XDX A;  1F9R A;  2FIN B;  2B2T C;  3FPU B;  2B2U C;  2KOL A;  1B50 A;  1NR4 A;  1O7Y A;  3LWE A;  1BO0 A;  2IL8 A;  1KNA A;  1AZQ A;  1VMP A;  1CM9 A;  4HCS A;  2EE1 A;  2X6L A;  4UAI A;  1ROD A;  4XT3 B;  2KEE A;  1HFN A;  5T1I A;  1RTO A;  1X3P A;  1F9P A;  1LV9 A;  1WTQ A;  2HCC A;  5DNF A;  3I90 A;  1MI2 A;  1BNZ A;  1AP0 A;  3F2U A;  5E4X A;  2B2W C;  2XIW A;  3DM1 A;  1MGS A;  5JJZ A;  2MGS A;  1PFB A;  3R93 A;  1G2T A;  1DZ1 A;  2MPM A;  4DN4 M;  1PDQ A;  1X3Q A;  2RA4 A;  1HUM A;  2L11 A;  3I91 A;  1SAP A;  3UI2 A;  2L9H A;  1EQT A;  1VMC A;  2KED A;  4ZLT F;  2B2V A;  2HCI A;  5EKI A;  1QE6 A;  3ONA B;  4ZKC B;  4NW2 A;  2NZ1 D;  2Q8R E;  3GV3 A;  1HUN A;  2SDF A;  1F2L A;  2JYO A;  2B2T A;  5E4W C;  2MJ8 A;  4HSV A;  4LMQ D;  4CJ0 B;  1WTX A;  1F9Q A;  1PLF A;  1NAP A;  1WTW A;  3KBX A;  3P7J A;  4HED A;  1NR2 A;  1XX8 A;  1IKL A;  4X3U A;  1M8A A;  1SSO A;  2N55 A;  1EIG A;  4O42 A;  3SVM A;  2NWG A;  1C8C A;  1B2T A;  1QNK A;  2B2Y C;  1IKM A;  2FHT A;  1PFN A;  4OIJ A;  3MWY W;  2HUG A;  3KUP A;  3QO2 A;  4IUP A;  2HDL A;  2NYZ D;  4ZK9 B;  5EPJ A;  1HA6 A;  1U4R A;  2B2W A;  1A15 A;  1EL0 A;  3IL8 A;  4IUQ A;  1O80 A;  1J8I A;  2L12 A;  1HRJ A;  1B53 A;  4HAE A;  2B2Y A;  5D14 A;  1BBX C;  1ZXT A;  2MP1 A;  2RVL A;  2L4N A;  3N52 A;  2Q8T A;  2BDN A;  3FDT A;  2DY8 A;  1U4P A;  4ZKB B;  4X3S A;  1WD1 A;  1MSH A;  2K28 A;  1RJT A;  1EIH A;  1U4L A;  1RHP A;  1TVX A;  1G2S A;  1G91 A;  1EOT A;  3TN2 A;  5AFW A;  2HDM A;  1Q3L A;  2KVM A;  5COR A;  2L1B A;  2X6G A;  4X3K A;  2CVR A;  2JP1 A;  3D6W A;  3HP3 A;  2K05 A;  1QG7 A;  2DY7 A;  4OIK A;  1WVL A;  1U4M A;  4CJ2 C;  1GUW A;  4RAU C;  2FMM A;  2X69 A;  1XYI A;  1MSG A;  4XT1 B;  1DOL A;  4R9W A;  1G6Z A;  1ESR A;  3GV6 A;  5D65 A;  1F9S A;  4MN3 A;  5CBA E;  2FJ2 A;  5EPK A;  1ILQ A;  4IUR A;  3G7L A;  1KNE A;  1S4Z A;  1E0B A;  4RA8 A;  5EQ0 A;  2K03 A;  5CBE E;  4R8I A;  2R3Z A;  3DEO A;  4ZAI A;  4MHE A;  3Q6S A;  1HFG A;  2N88 A;  4IUU A;  3TZD A;  1CA5 A;  1O7Z A;  1IL8 A;  4IUT A;  3MTS A;  1WTV A;  1HHV A;  4QUC A;  4RWS C;  1CA6 A;  1ML0 D;  2B2V C;  2K04 A;  2RSN A;  1DOK A;  1SDF A;  1DOM A;  5EJW A;  1WTO A;  1AZP A;  3IFD A;  2B2U A;  2FFK B;  5EPL A;  2VXW A;  4CJ1 B;  1DON A;  3I3C A;  2K01 A;  1JE4 A;  2KUM A;  3DEP A;  1NCV A;  1WTR A;  1X32 A;  1B4O A; 
#chains in the Genus database with same CATH topology
 5C4X H;  2PO4 A;  3LX0 A;  1J9O A;  4RGO S;  2E76 C;  3G6E A;  4A3D H;  2D5D A;  2M2L A;  1WTP A;  1UE5 A;  2F0K A;  4TVA B;  5EBD A;  3FKI G;  2PI2 E;  2F3I A;  2B2T C;  4A3E B;  1EY5 A;  3F2D A;  4A3C H;  4P2C B;  3DMU A;  3IFT A;  4ILW A;  5KND A;  1Y69 U;  5D3I B;  1K0R A;  3RZO B;  5ELD A;  2JA5 G;  4DV7 Q;  4DV1 Q;  1IHZ A;  4DK3 C;  2PW7 A;  1R9T B;  1YNJ D;  4OWW B;  3ER0 A;  1E2W A;  4A3K H;  3GTO H;  4IUN A;  2ZJQ A;  4OEM B;  1RD9 D;  4A3D B;  1AP0 A;  5C44 G;  1B9N A;  1L1O A;  2ZXR A;  3HRZ C;  5KGU A;  2MGS A;  3S1N B;  1SND A;  3KDF A;  1ZEQ X;  5K36 H;  4K6D A;  1JJG A;  2NN6 H;  4DAY A;  1VCI A;  2B2V A;  3F1Z A;  3T1Y Q;  1PH9 A;  3EIV A;  2PMZ E;  1PH7 A;  1MHW C;  1UE7 A;  1K8G A;  2F52 A;  2NZO A;  4UP7 A;  2NZH A;  1M8A A;  3SVM A;  2NWG A;  1JC7 A;  3CCR A;  4JI8 Q;  3KUP A;  4IUP A;  4DR3 L;  1MBY A;  1PH1 A;  5GQO A;  1L1O B;  3J80 i;  5LMU L;  3L2P A;  1XMQ L;  2QW7 A;  4LF7 Q;  2XWJ B;  2TMP A;  2KHI A;  4DF7 A;  1BBX C;  2F0F A;  1Q82 C;  2Y0S B;  5M9O A;  4JI3 Q;  1WD1 A;  2QCP X;  4PMC A;  4K5X A;  1E7Z A;  5FLX E;  2KCT A;  3M4Q A;  1EY9 A;  3GTJ H;  2K75 A;  1VF7 A;  1U4M A;  4EQO A;  4K14 A;  3QB3 A;  4BBS H;  1C9O A;  2LY7 A;  3DEO A;  3EFX D;  3SR1 A;  4AIM A;  4DV0 L;  1EQV A;  3HOW H;  1VQ5 A;  4OON A;  3I73 A;  4DV0 Q;  1CA6 A;  1OXS C;  3W3A A;  3TSS A;  2ASB A;  2VB3 X;  4UY8 C;  1Z6H A;  5I2X A;  1CKM A;  3KJP A;  3I3C A;  1V43 A;  4LF6 Q;  4C3J B;  1KQS A;  3G48 A;  3T51 B;  2K5D A;  3BVZ A;  2JSO A;  4IUV A;  4P73 A;  2B39 A;  3BU2 A;  1SYG A;  1K28 A;  2CWP A;  2UXB L;  4DGZ A;  3N6R A;  3ND8 A;  1AN8 A;  2VS1 A;  1FL0 A;  3K7A B;  4IAL A;  5BR8 Q;  4EQ5 A;  3S2H H;  4IFD J;  3H3V I;  2K6A A;  4B3T L;  1G51 A;  4POG A;  2JA8 B;  5M3M B;  4YCW A;  1ROD A;  5KNC A;  4J1M A;  3FP9 A;  1DYQ A;  3GP7 A;  4TQU S;  4DR6 L;  3SK6 A;  1V1O A;  1STH A;  1GKH A;  1TWA H;  1Y8P B;  2CQA A;  4A3B B;  1M4V A;  4YHH L;  1PRT C;  2IWH A;  1VQF A;  1B3Q A;  4JI4 L;  4ZKC B;  3SK5 A;  3GV3 A;  4Y7N H;  4LF6 L;  2JYO A;  1PTO H;  4CJ0 B;  1NR2 A;  5FO7 B;  1N33 L;  1I6H H;  4IOA A;  4L5R C;  5IYB G;  4HJA A;  2HUG A;  2OWO A;  4FYD A;  5BN3 A;  2HIX A;  4H02 A;  2CH4 A;  5M5X B;  3T56 B;  1X3E A;  3U4V A;  1E22 A;  1KIX A;  3TP8 A;  1SN8 A;  3BYY B;  3N52 A;  3GTG H;  1KRS A;  1LTT D;  2BDN A;  2DY8 A;  5IP9 G;  1IBM L;  3BJU A;  1LT4 D;  3PSI A;  1MJE A;  1CHQ D;  5K5P A;  4NXM L;  1IYV A;  5I6Y A;  1L0W A;  4LFC Q;  4C2M B;  1IXR A;  2K50 A;  1TVX A;  3CC4 A;  2LXK A;  1KD1 C;  2XWB B;  2HDM A;  3S24 A;  2EY1 A;  3URY A;  1T9H A;  1QVF A;  4A75 A;  3J7Z C;  2Y0S E;  3VR4 A;  3KLS X;  2PQE A;  2PYK A;  4GOP B;  4L5T A;  1G6Z A;  2F0P A;  5EAY A;  5EPK A;  3LWU A;  2F0Q A;  5FLX c;  4LF4 Q;  5BN5 A;  4JI8 L;  3NWT A;  1W6K A;  3MTS A;  1WTV A;  4RWS C;  2K04 A;  2ZT9 C;  3K7A H;  5M3F G;  2ZTE A;  2ZM6 L;  3CCM A;  4B3M Q;  4JI5 Q;  2RBM A;  1KXL A;  5KYL A;  5M3M G;  2Z9H A;  5H1S E;  1PA6 A;  2MO0 A;  1EQQ A;  3S1N H;  3C46 A;  2UUB Q;  3GTJ B;  1ICW A;  1B3A A;  2A69 D;  2AHO B;  1JWU D;  3I2Z A;  1SE8 A;  1BF4 A;  1A0I A;  1CKN B;  1R9T H;  2R7Z B;  3L3O C;  4AH6 A;  2MFI A;  2K32 A;  2OCE A;  5J39 A;  3STB D;  3A56 A;  1U9R A;  1RL2 A;  1Y1W G;  1FNW A;  3VYR A;  1F9P A;  4J8Q A;  1VQD A;  3M7G A;  1HNZ L;  3QOL A;  1MIU A;  1Q81 C;  3PO2 G;  1IYJ B;  1DGS A;  3S1M H;  4DN4 M;  4LJZ C;  1SNO A;  4ZLT F;  3K57 A;  1QE6 A;  2E8G A;  2ZTC A;  4A3K B;  1HUN A;  1F2L A;  3Q24 A;  5E4W C;  4FF2 A;  2WB1 G;  4X6A H;  1L2F A;  2QDL A;  2YU9 B;  3QWN A;  2EXZ A;  4HMI A;  1SSO A;  1XXG A;  1WJJ A;  5IGD A;  3L0O A;  4R4C A;  2WKC A;  3WOE A;  3JAM i;  1B1Z A;  1U4R A;  4HN7 A;  4B3T Q;  1DD2 A;  4X64 Q;  1B9M A;  3OPO A;  5JAV A;  4ZQ3 A;  3OOC A;  3CXC A;  3VR6 A;  3H3V H;  1FYC A;  3E9I A;  3D8G A;  1EFW A;  2K28 A;  1EFI D;  3GTM H;  5KRU A;  3U9O A;  3TP7 A;  1G2S A;  4U67 3;  1TT2 A;  3U9S A;  4POF A;  2AWO A;  5C4J H;  2KVM A;  4DK1 A;  3JAM E;  4LFB Q;  4GN5 A;  1TS5 A;  2A74 C;  2C9O A;  3HG9 A;  1YEZ A;  1MJC A;  2X69 A;  5JVH 3;  2RHS B;  4R9W A;  1BUV T;  1YHA A;  3NP8 A;  4MN3 A;  3K8A A;  4JI7 Q;  1FD7 D;  3CCU A;  2RDF A;  2R3Z A;  4Q0F A;  4OO1 I;  3RLO A;  3MEH A;  1YNX A;  1PTO C;  4XXE A;  3R2I A;  4CDC C;  4FF4 A;  1Z9F A;  3CMA A;  5JOB A;  3NEM A;  4K2L A;  4F87 A;  5C44 B;  3H09 A;  2IX1 A;  3KF6 B;  1CT1 D;  2OT2 A;  3PV0 A;  5M5W B;  1N33 Q;  1LO5 D;  1A3T A;  2VW9 A;  4A3D G;  1IYU A;  1AZP A;  3I4N B;  2FFK B;  4BY1 G;  4BS9 A;  3CCS A;  3DEP A;  4NMZ A;  1WTR A;  2KQ3 A;  4OL7 A;  3S16 B;  1B4O A;  1JOQ A;  4L6T B;  3CC7 A;  2B8G A;  3MFY A;  3E3X A;  1BKB A;  3K5M A;  3F8T A;  1IBL Q;  1QUQ A;  1Q8K A;  1SRU A;  3H91 A;  1Y1V H;  1Q90 A;  1XMO L;  4K0K L;  4C3H H;  2F0S A;  2ID0 A;  2B2U C;  5E1F A;  4IN3 A;  1GM5 A;  3OTO L;  1JB7 A;  4J6H A;  1Q86 C;  1VQ8 A;  3FVQ A;  3PMF A;  2UXD L;  3CU7 A;  3I4N G;  1TKW B;  5T1I A;  2J0T D;  4LW1 A;  1LUZ A;  4FP5 D;  3PQI A;  2I07 B;  5CGK A;  2NTT A;  5DAU A;  4GNX C;  2ENB A;  1SXT A;  1V9P A;  4DUY Q;  1ENA A;  3ZJY C;  2Q8R E;  1JMC A;  2KA7 A;  1SFO H;  1TR5 A;  1ET6 A;  4DR7 L;  3CCV A;  1YIT A;  4HED A;  1K0S A;  4CKB A;  2ES2 A;  1IZ6 A;  4C2M H;  1I4Q A;  2EYL A;  1WCM B;  4JBJ A;  1HZB A;  1K9M C;  3MXU A;  5FK9 C;  1AW7 A;  3LGJ A;  3V05 A;  1ZXT A;  1L0X B;  1JCK B;  1X3G A;  3GQB A;  3A8K E;  1VS0 A;  3VYS A;  1PYS B;  1YZ6 A;  2V4D A;  3RN5 A;  2JA6 H;  4K6L A;  1A6X A;  2YU9 H;  1I4R A;  3KLS A;  1XNR L;  3NUC A;  3D6W A;  4NPS A;  2DY7 A;  4NXN L;  3M9B A;  1BBU A;  1FJG Q;  1S5F D;  3I55 A;  4OO1 G;  1XYI A;  1A8V A;  3HOY G;  5ELF A;  4XQN A;  2EDG A;  4G7H C;  1XTC D;  4ODG A;  1JT8 A;  3DWA A;  3I70 A;  5EGT A;  1TU2 B;  1N32 Q;  1V8Q A;  2A68 D;  4PZ6 A;  4A3J B;  2F3W A;  4QUC A;  1UNS A;  3ERS X;  4XTC S;  1XJV A;  1EY6 A;  1PRT D;  4A3M B;  1S5C D;  4LFC L;  3BVG A;  2PQA B;  1GJX A;  2JJQ A;  1Y14 B;  1BCP D;  2EY5 A;  2L5T A;  1YJW A;  2R7Z H;  2K1B A;  4DUZ Q;  5G3L D;  2RHQ B;  3CP0 A;  3NWS A;  3DXJ C;  5FKA C;  4XDX A;  4A3I G;  2VL6 A;  2JA5 H;  1HR0 L;  1HQM C;  5JJK A;  4P75 A;  4YY3 L;  4QF4 A;  3RR5 A;  4GN4 B;  2L0C A;  1TWC H;  3QR8 A;  2UUC Q;  3HS0 C;  2LMC B;  1YNJ C;  2KEE A;  3K80 C;  3H0G B;  4AQY L;  5EKK A;  1WOC A;  4JOI C;  1VQO A;  3W1B A;  3NK9 A;  2XIW A;  3VA5 A;  4JI6 Q;  3X3M A;  1I50 H;  2QF7 A;  1PH8 A;  3ONA B;  2VY3 A;  4R4T A;  2VNU D;  1JOK A;  1TWC B;  1PV4 A;  1WTX A;  1QVC A;  1D1I A;  1N34 Q;  1E24 A;  2Z1C A;  2SNM A;  5ISR A;  5I9P A;  4FVM A;  1QNK A;  2B2Y C;  3DLL A;  3DUZ A;  4OHJ A;  5DLQ E;  1A62 A;  1EYC A;  1T5E A;  3TS0 A;  1QNU A;  3ITP A;  1PXU A;  2AMC B;  4ZK9 B;  3T16 A;  1STB A;  2G9H D;  4YWK A;  2XGT A;  1VQI A;  4QGU A;  5IT9 L;  3HOV H;  2MP1 A;  3PGZ A;  2E2H H;  3ERQ A;  4X65 L;  2N78 A;  5DM7 3;  2GVA A;  3MA2 B;  1MSH A;  1VQ9 A;  3SGI A;  2KEN A;  2I5L X;  2G5D A;  4A3M G;  2A1A A;  4NDX A;  4XT1 B;  1NNX A;  1I3Q B;  5DM6 3;  5AJ3 Q;  2R7F A;  1ONL A;  5C6A A;  1PH4 A;  3HOW G;  1SMY C;  3SE0 A;  2N88 A;  1CA5 A;  5EBC A;  3VYU A;  4IUT A;  3S2D H;  1HHV A;  4C3I B;  3PO2 B;  1NY4 A;  1D6E C;  1BR9 A;  2OXP A;  4JPB W;  4NKL A;  4CJ1 B;  4A76 A;  2K01 A;  2A5H A;  4BA2 I;  1R4P B;  3KF6 A;  2Z4H A;  3FPP A;  2QGQ A;  5CMD A;  4IOC A;  2H1E A;  4U68 A;  1WCM G;  3OIQ A;  3RD4 A;  1XWE A;  3CCL A;  4PNY A;  2KOL A;  2Z6K C;  2DNC A;  2F4I A;  4L63 B;  4B3S L;  2BCO A;  1N36 Q;  2GN5 A;  1STE A;  1VMP A;  2XNA C;  4DV5 Q;  5IGE A;  3PO3 B;  1CSP A;  4ALP A;  4UDU C;  5C0X H;  5M5Y B;  4DR1 L;  2OTL A;  4LWC A;  2HD3 A;  4K5W A;  1MGS A;  2EZV A;  4J15 A;  1S5D D;  1DZ1 A;  4P71 A;  1EIY B;  2BOS A;  2KJX A;  2NUC A;  2HCI A;  3FHW A;  4AQY Q;  4WFN 3;  2E2J H;  2K5H A;  2MJ8 A;  1V1P B;  3NBH B;  2PI2 A;  2VQF L;  1OTC A;  2PNR C;  4XYQ A;  4DR4 Q;  4IFD G;  5GRO A;  1H9J A;  5JJL A;  4DR5 Q;  4GNX A;  4A3B G;  1QOH A;  1LAC A;  3P1H A;  1FNV A;  4DKA C;  5JPN C;  1F2M A;  1I5F A;  2Z0S A;  4XQQ A;  1N9W A;  1LYL A;  4ZUI A;  1JOO A;  4IUQ A;  1PVO A;  2VQF Q;  1HRJ A;  2AWN A;  2AQ1 B;  1VQ6 A;  1XPR A;  1ESF A;  1P8L A;  3KBG A;  3GTK B;  3VR2 A;  3CCJ A;  2JE6 I;  4RKB A;  4F88 A;  3AQQ A;  1T5X D;  1TQO A;  5IP7 H;  5FO9 B;  1H9R A;  1AE3 A;  2CW0 C;  2MQH A;  3D4R A;  1S5E D;  2ZJR A;  3GTL B;  3E9H A;  5J22 A;  1VQA A;  5CBA E;  4OO1 H;  4BBR B;  1J5E Q;  2A6E D;  4CHT B;  3T13 A;  4A93 G;  1YJN A;  3U58 A;  3TZD A;  1UEA B;  1HTP A;  3ND9 A;  5C4Z A;  1IBK L;  2JXM B;  3IAY A;  3L7Z C;  2OQK A;  1EZ6 A;  2JA6 B;  3MXG A;  4QIW B;  4JOI A;  4A3F H;  4A3G B;  1D5Z C;  4XYO A;  2IX0 A;  1H9M A;  1TWF H;  2KCM A;  2XRS D;  4PV1 C;  4TRD A;  2RSO A;  4G7O C;  5T1G A;  3I8Z A;  2R92 G;  2VUM G;  1LTS D;  1CSQ A;  2E75 C;  3QG1 A;  2D9U A;  2F0G A;  2R93 B;  3UDI A;  5LL6 X;  1WI5 A;  3M4Y A;  3RZD H;  2IX3 A;  1ENF A;  3S2D B;  2D62 A;  1TXY A;  3NSW A;  5C0X G;  4YY3 Q;  2I5M X;  3I4M G;  1O78 A;  4KHZ A;  4N8F A;  2ALY B;  5LMN W;  1WTQ A;  1LV9 A;  1E3P A;  1G29 1;  2HCC A;  5DNF A;  3WOF A;  1PTO B;  1I3Q H;  1G8Z D;  2B3G A;  4KY5 A;  4KN7 C;  3RMH A;  4O2D A;  3EA6 A;  2JN4 A;  2LS0 1;  3WDN A;  1C7Y A;  3K0Y A;  4DUZ L;  4HID A;  1SNM A;  1X3Q A;  2L11 A;  1JOR A;  3HOW B;  4DR6 Q;  5EKI A;  4YIJ A;  3NHH A;  3GD7 A;  3K81 C;  1GHK A;  2EYF A;  1F9Q A;  1PLF A;  2N49 A;  5JEA J;  4YHH Q;  3J7A F;  3M3Y B;  4ZRZ A;  2A6H D;  1GXD C;  5E3F A;  4GS3 A;  5C4H A;  1C8C A;  1IW7 D;  3PO3 H;  2YTV A;  5D3D A;  3SEB A;  5FOB B;  3H0G H;  5EPJ A;  1KRT A;  4FF1 A;  4DV5 L;  2JA9 A;  4JV5 L;  1QB5 D;  1LTG D;  4IPD A;  2A8V A;  3NEL A;  1K8M A;  1QIL A;  3FDT A;  3K5N A;  4ME5 A;  1QZG A;  2PZU A;  3CCQ A;  4X3S A;  3DM3 A;  1EIH A;  3TDQ A;  1IW7 C;  4NXM Q;  3O13 A;  3ZYY X;  1EYA A;  1EIF A;  1HNZ Q;  3HP3 A;  3KDF B;  1GUW A;  3BYT B;  4CKC A;  1ASZ A;  2Z6B A;  4C3I H;  2B63 G;  3M7N A;  1TS3 A;  3HOZ B;  5A2Q E;  3EN2 A;  4O0A A;  1PZK D;  4LFB L;  3HOX G;  4MZ9 A;  3W1G A;  1BCP F;  3M85 A;  2B2V C;  5CV5 A;  1DOM A;  1KHI A;  3VR5 A;  4Y7N B;  5IGB A;  2MUY A;  3IFD A;  2F4V Q;  5C4X G;  5C4J B;  3AEV A;  1HJP A;  1VQC A;  4HJ7 A;  1X32 A;  2WFW A;  1RIP A;  3BZD B;  2VUM H;  3K7U C;  3CHB D;  1Y8O B;  2UXC L;  3E0J A;  3SK4 A;  3JC6 6;  5FLM H;  3FKI B;  4JW0 A;  1ICF B;  2D2C C;  1SNP A;  1EWH A;  2OEO A;  2E2I B;  2D0P A;  5IYC G;  1M1K C;  4R4Q A;  2IL8 A;  2CH4 W;  4RGN A;  4HJ8 A;  4B3R L;  4A3L H;  5JVG 3;  1CUK A;  4XT3 B;  1SFO B;  2R61 A;  1I4X A;  2EJM A;  4KI0 A;  1Q1B A;  1SE3 A;  2WAQ E;  1NBW A;  2RA4 A;  1F2Y A;  3Q23 A;  4LNQ A;  2RCF A;  3BDC A;  3I4N H;  2NZ1 D;  1YNN D;  3E5S A;  1LM0 A;  2SDF A;  5M5W H;  5CV4 A;  5GAE C;  3D31 A;  1TS4 A;  2F0V A;  4KKU A;  3HOV G;  2BE5 D;  4DXG A;  4DAY B;  4RCO A;  2JEA I;  1PZJ D;  3C1F A;  1EY8 A;  1B7Y B;  1PFN A;  1X6O A;  3ERO A;  4GKK Q;  1DCZ A;  5DEH A;  4YWL A;  5IWA Q;  1O80 A;  1XPU A;  3NEN A;  3CCE A;  1LTL A;  1QWY A;  4HJ9 A;  2L4N A;  2RDG A;  2CFM A;  3D0F A;  4UP8 A;  1EWI A;  2NVX H;  4K2K A;  2E2J B;  3T1H Q;  5C3E H;  1QVG A;  4N9T A;  4CKE A;  5AFW A;  4BY7 B;  2N3S A;  2DJG C;  3CQZ H;  2DJF C;  1TWH H;  1SJE D;  4DFA A;  1DOL A;  5HGT A;  2XTI A;  1IL2 A;  5LHY 1;  3AU7 A;  2RKS A;  1KNE A;  5F2D A;  3H15 A;  2A6E C;  2IHF A;  3NTI A;  3HOX H;  3OW7 A;  2BA0 A;  3S1R B;  4DPG A;  3ULP A;  1SEB D;  1PTO F;  1DOK A;  1SDF A;  1TWH B;  5FJ8 G;  2IY5 B;  1WTO A;  1LTB D;  3VDY A;  1FNU A;  4LFA Q;  3I4M B;  2NVQ B;  2F0W A;  1HCZ A;  2BH2 A;  2YYZ A;  3HEJ A;  1HA5 A;  4QL5 A;  1EU3 A;  2Y0S G;  5NUC A;  1C48 A;  1ILP A;  1FVI A;  5C5L A;  2EPB A;  4AYB B;  1W3S A;  2NB0 A;  3S14 H;  2F1M A;  4JI2 L;  4QUF A;  2Q8I B;  4RHR A;  1NUC A;  4L8J A;  4RFB A;  2HHH Q;  4A3G H;  1SR3 A;  2BA1 A;  1G6P A;  4FF3 A;  1J6Q A;  5ELN A;  2X6L A;  4UAI A;  3Q8D A;  1HZC A;  1EOV A;  4H44 C;  1PRT F;  1Z47 A;  1ZKO A;  3GTP H;  1Z7T A;  3DM1 A;  4X62 L;  4HIM A;  5JJZ A;  1VQH A;  3KOJ A;  3OYY A;  2FMC A;  4QMG A;  3J80 c;  1EU4 A;  1FGU A;  1SAP A;  3UE1 A;  4PQX A;  1VMC A;  1LTI D;  1C4Q A;  1UWV A;  2WV6 D;  3AYH B;  4MTN A;  4C3J G;  2LXJ A;  5HUR A;  2A19 A;  1VQ4 A;  2F0M A;  4O1N A;  4WJ3 M;  4DV3 L;  4KKT A;  5M5Y H;  4FXD A;  2EY6 A;  3IRB A;  4I7A A;  3TME A;  4R4I A;  3UDX A;  2NVX B;  2IW3 A;  4QIW E;  3KYH C;  3TP5 A;  3K59 A;  1XNQ Q;  3LNN A;  3B6Y A;  2QKI C;  1EL0 A;  1J8I A;  4ZUJ A;  2L12 A;  1SYD A;  4HAE A;  4QJF A;  5IP9 H;  2B2Y A;  3JAM L;  1Q46 A;  2BDO A;  1BCP C;  1TWG H;  1FJG L;  1GUN A;  4FNF A;  2AQ3 B;  1KL9 A;  1BBW A;  3IKJ A;  1RJT A;  2MNA A;  1GD7 A;  1IBL L;  2Z4I A;  4A93 H;  1YJ9 A;  3NTH A;  3OIP A;  4OWX B;  1HXY D;  1OXT A;  4CJ2 C;  3CPF A;  2E74 C;  2EY2 A;  1ESR A;  2PW5 A;  2F0I A;  1F9S A;  4DV4 L;  1S72 A;  1DJR D;  1PH6 A;  4F7X A;  4N9P A;  3J80 E;  4A3M H;  2ICI A;  4CDE C;  2E5L L;  3TRZ A;  3RNU A;  1VQN A;  2B63 H;  1EZ8 A;  5FJ8 H;  3UE0 A;  2SNS A;  4Y52 H;  4OX9 L;  2F0O A;  1ML0 D;  3HOZ G;  2TSS A;  2EYH A;  1W2B A;  5A35 A;  4ABN A;  1LT3 D;  4A93 B;  1JE4 A;  2OTJ A;  1VQG A;  1I94 Q;  3W5O A;  4P74 A;  1JJC B;  2EQS A;  4EVO A;  4DNR B;  3A0J A;  2NN6 I;  1F77 A;  2F0D A;  2EXD A;  5M3M H;  4Z9C B;  1CKO A;  1F9R A;  4LK1 C;  1YHB A;  1JR0 D;  2NVY B;  3K0X A;  3QOJ A;  1NR4 A;  1H9S A;  1O7Y A;  4DV2 L;  2IT1 A;  5E7N A;  1BO0 A;  1EQR A;  4JC0 A;  4LF9 Q;  2MO1 A;  4A3C G;  1X9N A;  2HQL A;  3VA7 A;  2EE1 A;  4YCV A;  5LMU Q;  4EQP A;  1HFN A;  2WB1 E;  2XN9 C;  2XRQ D;  3PO2 H;  4B9X A;  4RCN A;  1BNZ A;  4LAA A;  3F2U A;  3R93 A;  2WP8 J;  4JBW A;  2C5C A;  1KDB A;  4C3J H;  1HUM A;  5G3L F;  1KAW A;  1Y1W H;  1I94 L;  2R6G A;  4MNO A;  3T1Y L;  3S1Q B;  3AMU A;  1PH3 A;  4RMF A;  4BXX G;  1OXU A;  1VF5 C;  4A3B H;  4ID6 A;  1CFM A;  3GDE A;  1HNX Q;  1ASY A;  3MXN A;  4OX9 Q;  3BG3 A;  4O42 A;  1QUQ B;  1YVC A;  3NBH A;  2L55 A;  3QO2 A;  1LTR D;  5KYI A;  1HH2 P;  5CV8 A;  3I4O A;  1UAP A;  1BOS A;  3HOV B;  4IZ8 A;  4MIU A;  4HMJ A;  4DR4 L;  4DV7 L;  3J81 L;  1K3B C;  2RVL A;  1EY4 A;  1B70 B;  3R8B A;  2NBF A;  2I5H A;  3M4O H;  1UE6 A;  1A3V A;  4DNT B;  1G91 A;  3HOU B;  1CKN A;  3CF5 A;  1TY2 A;  4X65 Q;  1UUP A;  5C3E G;  1KDC A;  5GAH C;  4KJN A;  1RF2 D;  2WII B;  3A5Z B;  4DA2 A;  3G7L A;  4JI5 L;  2ZM6 Q;  4B3M L;  4C1N I;  4MHE A;  1AE2 A;  1CZW A;  1XNQ L;  1WTH A;  3TRE A;  1II3 A;  3H94 A;  4OEL B;  2CKZ B;  1JE5 A;  1QJO A;  4QB4 A;  2K5N A;  3K5L A;  2R7Z G;  1N32 L;  2EJG C;  5CV9 A;  4LF4 L;  4R8N A;  4C3H B;  1U0L A;  1J5E L;  4A3F G;  2Z6K A;  3FRP B;  1CQF A;  1MKH A;  2GA4 B;  4KV6 A;  3KK7 A;  3TBI B;  1GHJ A;  4V19 0;  4NXN Q;  2UUA L;  3L9A X;  4A3L G;  1CZG A;  1PHJ A;  4JBM A;  4C3H G;  1OXX K;  2EOT A;  3CME A;  2KEC A;  4X3T A;  5M3F B;  1X54 A;  3GTM B;  2BH8 A;  2V1C C;  1Y1V B;  4IPH A;  1TY0 A;  2F0T A;  2QA4 A;  2PZW A;  1HTL D;  2K5Q A;  2B63 B;  2KCC A;  2VZA A;  4RGT A;  4H0L C;  3PUZ A;  4LF5 L;  3S15 H;  1Y1V G;  3S14 B;  1RTO A;  2ZJP A;  3BDL A;  2N8N A;  4DR2 Q;  2B2W C;  1B44 D;  3A5U A;  4HIK A;  1MD2 D;  1EY7 A;  4K8J A;  1PDQ A;  2LFN A;  3QIA A;  2KED A;  4B08 A;  4DR1 Q;  3I4M H;  4IFD I;  2AUK A;  4NW2 A;  1DM0 B;  4I65 A;  1KLU D;  2CWA A;  4N8X 1;  1PYB A;  4JI4 Q;  4HSV A;  4JK1 C;  4JYA Q;  1EYG A;  2QDB A;  3J7A 5;  4X3U A;  3TQY A;  5K36 G;  5I6W A;  2NN6 G;  2I0Q A;  2FHT A;  1SYE A;  3MZ5 A;  3OWE B;  5A2Q L;  2NYZ D;  3G6J B;  1K8A C;  2UXD Q;  5IE8 A;  2YTX A;  5BN4 A;  1KAB A;  3CPW A;  4K5V A;  3T4A C;  2G9D A;  2MHV A;  1STG A;  3OWF A;  1U4P A;  2J4X A;  4A3E H;  1XNR Q;  3G4S A;  3S17 H;  4K0K Q;  4ZKB B;  4Q5V A;  2LKV A;  4IPC A;  5C3W A;  4G7Z C;  3HOU G;  3ULJ A;  3MHB A;  3GO5 A;  4X62 Q;  5IT9 E;  5COR A;  3SK8 A;  4GKJ Q;  4S3S A;  3DHQ A;  2K5V A;  2CHB D;  4DXF A;  1CQV A;  1EY0 A;  3M4P A;  1Q8I A;  4HSP A;  5I2Y A;  4DK0 A;  4IUR A;  4KTA A;  4ULL A;  4IO9 A;  1XPO A;  1YIJ A;  2UU9 Q;  1HR0 W;  2ZXP A;  2PCF B;  2CCZ A;  4BBS G;  4IJL A;  2Q2T A;  1PH5 A;  4H13 C;  5M3F H;  5TSS A;  3EQL C;  2O4X A;  4A3G G;  2EVB A;  4BA1 I;  2A6H C;  1EEF D;  1XTD A;  5KNB A;  4AYB G;  4DR3 Q;  2F0E A;  3E0E A;  5J3B A;  1VDZ A;  4L5Q A;  3I56 A;  4LF8 Q;  3GTG B;  2F0H A;  1A3U A;  1N34 L;  1KTK A;  5M5X H;  4B3S Q;  2K7V A;  5IT9 c;  5FLM G;  4PMB A;  3UDF A;  3I90 A;  1MI2 A;  2VQE L;  1K73 C;  3D4W A;  2A68 C;  4CDF C;  3J81 i;  4UHV A;  5IYC H;  2R92 B;  3X3N A;  4OWT B;  1D8L A;  1EUJ A;  3UI2 A;  1U5K A;  4M8A A;  1IBM Q;  3SDZ A;  3NQI A;  1O7L A;  4YCU A;  1NAP A;  1IKL A;  2DGY A;  1B2T A;  1ET9 A;  4BXX H;  3RUZ A;  4B9W A;  4PZ8 A;  3PF5 A;  3MXP A;  3S17 B;  3CD6 A;  1CI3 M;  1OO9 B;  3ULL A;  5IGC A;  1A15 A;  1VQM A;  2Q2I A;  4R1J A;  4BY1 B;  3WWV A;  3Q0A A;  4QQB X;  4BWG B;  4P72 A;  2E2I H;  3T53 B;  1HR0 Q;  4A3I B;  1I6V C;  4OXP A;  1HNW Q;  2F3V A;  3AFP A;  4WJ4 A;  4GZY C;  4HIO A;  1TWA B;  2WB1 B;  5KIX A;  1H95 A;  1SBB B;  1P16 A;  3HOZ H;  4V0B A;  4PZ7 A;  5GAG C;  1HFG A;  5BR8 L;  1A2T A;  1NE3 A;  1O7Z A;  2WKD A;  4ZYS A;  4KJO A;  2JA7 H;  3I7F A;  2C35 B;  2AUJ D;  1PYW D;  3J7A V;  1EYD A;  3E6Z X;  3S15 B;  3VR3 A;  2NVY H;  4G57 A;  2EYO A;  3J80 L;  3FKI H;  1BVS A;  1SYB A;  1NCV A;  4BY7 H;  4KHV A;  3HKZ G;  2PZT A;  2F0J A;  1WD0 A;  1OXV A;  1DXM A;  4DNI A;  3D6C A;  1JIC A;  2F4V L;  5IWA L;  2Q2H A;  4JI6 L;  1C0A A;  4M1U B;  5COY A;  3J81 E;  3TEH B;  5EKL A;  3C2P A;  1AFP A;  1K83 H;  3NPP A;  2SOB A;  1CK1 A;  1E1O A;  3PCO B;  1VQP A;  4AYB E;  1AZQ A;  1CM9 A;  4HCS A;  4LUZ A;  3HKS A;  3K6O A;  2NVT B;  4DR7 Q;  4QY7 A;  3A7A B;  2EYM A;  2QIL A;  1X3P A;  1JQY D;  1RCV D;  1CTM A;  2F0L A;  5ELB A;  4DR5 L;  4CDD C;  3FEW X;  4K8I A;  1KC8 C;  4JI0 L;  1GO3 E;  2MPM A;  3I91 A;  1Y1W B;  3PO3 G;  4ME3 A;  3PF4 A;  2VQE Q;  3TZU A;  2NVT H;  3H0G G;  3EVQ A;  3CRL C;  4LFA L;  4DUY L;  5CV7 A;  3BZK A;  3KBX A;  3P7J A;  4A3J H;  2NTS A;  1S40 A;  2K14 A;  4RG1 A;  4LF8 L;  2YTY A;  3OMG A;  1IKM A;  3MWY W;  4DV6 Q;  4JI1 Q;  1XMO Q;  5ELO A;  3EBE A;  2HIV A;  1RKN A;  1BXT A;  5C0X J;  4IFD H;  3DWP A;  1UE1 A;  5D14 A;  1EWC A;  4A3F B;  3P20 A;  3RZD B;  4E6I A;  2JEB I;  2YV5 A;  3PUW A;  5HGQ A;  4GN3 B;  2H4O A;  3GTK H;  3MAQ A;  3HOY H;  1BQQ T;  1A2U A;  4C3I G;  1EOT A;  3P75 A;  3U4Z A;  2UXC Q;  3KLR A;  4JI0 Q;  3TP6 A;  3PIP A;  1LAB A;  2JA7 B;  1WVL A;  1NTG A;  2JK8 A;  4FDB A;  3GTP B;  1B8A A;  5JEA G;  4L5S A;  1ILQ A;  3R2T A;  1E0B A;  1D1K A;  5IIF A;  1VQB A;  2JA7 G;  4KD3 A;  3SXH A;  4GLV B;  1SYF A;  1QCB D;  4IUU A;  1SE4 A;  2P5Z X;  4PG3 A;  2UU9 L;  2RSN A;  1X65 A;  5ELE A;  5EJW A;  4GOP C;  1X3F A;  1A63 A;  5EPL A;  2M00 A;  2PQA A;  3QJY A;  4DV4 Q;  4X66 Q;  4A3I H;  1YNN C;  2UUB L;  4I7Z C;  3C3L A;  3D4D A;  5IY0 A;  2R92 H;  1V1P A;  1TWF B;  4GLA C;  1K3R A;  3CQZ B;  1HZA A;  2WAQ B;  1TS2 A;  4JVZ A;  2RDH A;  2R93 G;  5C3E B;  4JI3 L;  5CV6 A;  2D0O A;  1ZYR C;  2FIN B;  3FPU B;  1LT5 D;  1SE2 A;  3RLF A;  1ZYR D;  1B50 A;  3K58 A;  4C56 C;  5GAD C;  3LWE A;  1KDA A;  2CW0 D;  4X64 L;  4DV3 Q;  3OHX C;  4B3R Q;  1E2Z A;  1STN A;  3H3V C;  3EJI A;  2DN8 A;  3GTQ B;  3J81 c;  3KF8 A;  4JI1 L;  2SEB D;  3NXW A;  1PTO D;  2NVQ H;  3M3Y H;  1YBY A;  5E4X A;  3AFQ A;  3V2T A;  3GTL H;  2EYP A;  2F0U A;  2UXB Q;  4G4K A;  2RQX A;  3T1H L;  2IHE A;  1I4G A;  3CW2 C;  2AKW B;  1I50 B;  3HZX A;  2GVB A;  4HR7 B;  4IJH A;  5J1Z A;  4A3K G;  1E2V A;  4KY7 A;  2E2D C;  2QEJ C;  3C1E A;  2B2T A;  4LF5 Q;  4LMQ D;  5C44 H;  2BE5 C;  1PZI D;  1D5M C;  1XX8 A;  3GTO B;  1VQJ A;  2QEX A;  4DR2 L;  4A3E G;  1UEB A;  2I46 A;  2KHJ A;  5CYU A;  4HJ5 A;  2HDL A;  3HOU H;  2L15 A;  3V96 A;  5ELC A;  1Y8N B;  5IYB H;  1KLG D;  4LUV A;  3U50 C;  1VQL A;  3M4O B;  3MEF A;  3A54 A;  1B53 A;  3KF8 B;  1HZ9 A;  3PUV A;  4KHP L;  2UUA Q;  2HHH L;  2Q8T A;  4PMW A;  2O5J C;  4IPG A;  4TKO B;  2K33 A;  1TII D;  4KY6 A;  4GLX A;  2IJ0 A;  1CHP D;  3HGB A;  1IBK Q;  1JJ2 A;  4EQN A;  3S9W A;  3JAM c;  1GOZ A;  2X6G A;  4X3K A;  2DUD A;  3HKZ E;  4OIK A;  5CC4 A;  5JEA H;  3FMC A;  2KCN A;  1WYD A;  2DNE A;  2FJ2 A;  3STB C;  4RA8 A;  1S4Z A;  3S1Q H;  4JBK A;  4ZAI A;  2JA6 G;  3S1M B;  1SRO A;  4XIG S;  1JB3 A;  2R7D A;  3HOX B;  1SMX A;  3TS2 A;  4DAV A;  4DAP A;  3KFU A;  5IGG A;  5FO8 B;  3HFZ B;  2B2U A;  1DON A;  2VXW A;  3G71 A;  1JWS D;  4HTH A;  2HT1 A;  2IPK D;  2WAC A;  1KAA A;  4R4O A;  5JPM C;  1K8O A;  1D7Q A;  1ENC A;  2AQ2 B;  1HNW L;  1RTN A;  1V1Q A;  5I9O A;  1NMG A;  1S5B D;  1VQ7 A;  1GVP A;  3H6M A;  4KHP Q;  2E2H B;  2E5L Q;  1KNA A;  2XVS A;  1HQR D;  5FLX L;  3PIO A;  5AJ3 L;  3HKZ B;  5LMN Q;  1X55 A;  4WRD A;  1Q12 A;  4YWM A;  2PMZ B;  4FO2 A;  1H9S B;  3NBI A;  1WFQ A;  1NSN S;  1PFB A;  3CAM A;  4RKL A;  1GUG A;  1HNX L;  4WJW A;  3RLN A;  1FGB D;  1E1T A;  3MVV A;  2L9H A;  1EQT A;  4MTK A;  2EJF C;  2CQO A;  2VB2 X;  3HOY B;  1D5X C;  3CC2 A;  1WTW A;  3PIO 3;  4BBS B;  1N36 L;  3UDG A;  1VQK A;  4A4I A;  3OMC A;  1I4H A;  4GNX B;  1M90 C;  2JA8 H;  5C3X A;  5KEE A;  3Q22 A;  1NMF A;  4OIJ A;  2FXQ A;  4C1N K;  4DAM A;  4KK7 A;  2O2L D;  2LSS A;  1EEI D;  4NP5 A;  4IQZ A;  1NJI C;  5IP7 G;  1TWG B;  1S3O A;  3BZC A;  4DV2 Q;  3BS1 A;  2JQO A;  1GUT A;  5CR3 A;  5C5M A;  2JA5 B;  3OSO A;  4X66 L;  2PNH A;  3S16 H;  1SLJ A;  4APV A;  2VUM B;  1RHP A;  1I6H B;  1Q3L A;  4LUO A;  2L1B A;  2Z8L A;  2EYJ A;  2F03 A;  2CVR A;  1AEX A;  3F2C A;  1QG7 A;  4QCL A;  4RAU C;  3NQT A;  1STA A;  3A55 A;  3DWQ A;  1O7I A;  4JCV E;  5C0X I;  4ZCK A;  2ICE C;  2WAQ G;  5D65 A;  2UUC L;  4RHS A;  5EQ0 A;  5CBE E;  4R8I A;  1HPC A;  4BY7 G;  4GKK L;  3PUX A;  1IL8 A;  3R3O A;  2Q2U A;  4GKJ L;  4JI2 Q;  2HQE A;  5IYD G;  1PRT B;  2H5X A;  3RN2 A;  4HCE A;  4BBR G;  1K83 B;  3PIP 3;  3NE5 B;  2KUM A;  1SNQ A;  3W2D A;  3KJO A;  1BCP B;  4BY1 H;  1LLR D;  1PFM A;  1SMY D;  4KD4 A;  4JV5 Q;  2ATW A;  1GUO A;  2WIN B;  4OGQ C;  1N8R C;  3SHL A;  1PMR A;  1JWM D;  2J7Z A;  4DV6 L;  1FR3 A;  3KLW A;  2R93 H;  4RH6 A;  3PUY A;  5LL6 S;  3J81 j;  4JYA L;  2KBN A;  4LF9 L;  3I72 A;  5C4X B;  1WCM H;  3OTO Q;  3CKI B;  3J7Y W;  1Q1E A;  3NTK A;  4A3J G;  1D2B A;  1G2T A;  5L37 A;  1Q7Y C;  1AH9 A;  4CGY B;  2RF4 A;  3VYT A;  3MC0 B;  2B29 A;  2K5W A;  3MFG A;  1SNC A;  4FXK C;  2JA8 G;  1PFS A;  4RGM A;  2PPB C;  1R4Q B;  4DV1 L;  2K4K A;  3S2H B;  2A69 C;  2N55 A;  1EIG A;  1SJH D;  2OF1 A;  3K5O A;  2ZXO A;  1F2Z A;  1X56 A;  4JG2 A;  2KHS A;  3A7L A;  5I4D A;  3RZO H;  5HY6 A;  1HA6 A;  5LMN L;  2A73 B;  2B2W A;  3IL8 A;  3GTQ H;  4JI7 L;  3F2B A;  1QZH A;  4H7B A;  4DK6 C;  3AB9 A;  1H9K A;  2OQ0 A;  1PH2 A;  3A8J E;  1W6J A;  4EGV A;  1SYC A;  4NB3 A;  4XQJ A;  4GOP A;  4UP9 A;  1VQE A;  3BVM A;  4CBV A;  1U4L A;  1RDP D;  2ZTD A;  3TN2 A;  2F0N A;  2O5I C;  5IGF A;  1L0Y B;  1BDO A;  1L1O C;  1LTA D;  2JP1 A;  2K05 A;  1YHQ A;  4FXG C;  4KMU C;  2FMM A;  4EX5 A;  1MSG A;  1STY A;  2XSC A;  3GV6 A;  3S1R H;  3I4L A;  4DU9 A;  1YI2 A;  3ICE A;  5IOD A;  4LF7 L;  1XMQ Q;  2K03 A;  1GUS A;  3BDO A;  3Q6S A;  4KLK A;  4WOR A;  2EIF A;  1LT6 D;  4TSS A;  2M9V A;  4KN4 C;  3OW2 A;  2K52 A;  5IYD H;  4F8M A;  4BBR H;  1I4P A;  3A8I E;  5IOC A;  5JJI A;  3D3R A;  2B8F A;  4UPA A;  3A74 A;  3CRK C;  3MXN B;  2RCN A;  4KKS A; 
#chains in the Genus database with same CATH homology
 2PO4 A;  3LX0 A;  1J9O A;  4RGO S;  2E76 C;  2D5D A;  2M2L A;  1WTP A;  2F0K A;  5EBD A;  2B2T C;  4A3E B;  1EY5 A;  4P2C B;  3DMU A;  3IFT A;  4ILW A;  5KND A;  1Y69 U;  5D3I B;  3RZO B;  5ELD A;  1IHZ A;  2PW7 A;  1R9T B;  1YNJ D;  1E2W A;  4IUN A;  1RD9 D;  4A3D B;  1AP0 A;  1B9N A;  2ZXR A;  3HRZ C;  5KGU A;  2MGS A;  3S1N B;  1SND A;  1ZEQ X;  5K36 H;  4K6D A;  2NN6 H;  4DAY A;  1VCI A;  2B2V A;  1M8A A;  3SVM A;  2NWG A;  1JC7 A;  3KUP A;  4IUP A;  1MBY A;  2XWJ B;  2TMP A;  4DF7 A;  1BBX C;  2F0F A;  2Y0S B;  5M9O A;  1WD1 A;  2QCP X;  4PMC A;  4K5X A;  5FLX E;  1EY9 A;  1VF7 A;  1U4M A;  4EQO A;  4K14 A;  3QB3 A;  2LY7 A;  3DEO A;  3EFX D;  3SR1 A;  1EQV A;  3I73 A;  1CA6 A;  1OXS C;  3W3A A;  3TSS A;  2VB3 X;  1Z6H A;  5I2X A;  3I3C A;  1V43 A;  4C3J B;  3T51 B;  2K5D A;  3BVZ A;  2JSO A;  4IUV A;  2B39 A;  1SYG A;  4DGZ A;  3N6R A;  3ND8 A;  1AN8 A;  3K7A B;  4IAL A;  4IFD J;  2K6A A;  2JA8 B;  5M3M B;  1ROD A;  5KNC A;  4J1M A;  1DYQ A;  3GP7 A;  4TQU S;  3SK6 A;  1V1O A;  1STH A;  1Y8P B;  2CQA A;  4A3B B;  1M4V A;  1PRT C;  2IWH A;  4ZKC B;  3SK5 A;  3GV3 A;  2JYO A;  1PTO H;  4CJ0 B;  1NR2 A;  5FO7 B;  2HUG A;  4FYD A;  5BN3 A;  5M5X B;  3T56 B;  3TP8 A;  3BYY B;  3N52 A;  1LTT D;  2BDN A;  2DY8 A;  1LT4 D;  1CHQ D;  5K5P A;  1IYV A;  5I6Y A;  4C2M B;  1TVX A;  2XWB B;  2HDM A;  3URY A;  2EY1 A;  3VR4 A;  3KLS X;  2PQE A;  2PYK A;  1G6Z A;  2F0P A;  5EPK A;  3LWU A;  2F0Q A;  5BN5 A;  3NWT A;  1W6K A;  3MTS A;  1WTV A;  4RWS C;  2K04 A;  2ZT9 C;  2RBM A;  5KYL A;  3C46 A;  3GTJ B;  1ICW A;  1B3A A;  2A69 D;  1JWU D;  1BF4 A;  2R7Z B;  3L3O C;  2K32 A;  5J39 A;  3A56 A;  1U9R A;  1FNW A;  3VYR A;  1F9P A;  4J8Q A;  3M7G A;  3QOL A;  4DN4 M;  4LJZ C;  1SNO A;  4ZLT F;  3K57 A;  1QE6 A;  4A3K B;  1HUN A;  1F2L A;  3Q24 A;  5E4W C;  4FF2 A;  2YU9 B;  3QWN A;  2EXZ A;  4HMI A;  1SSO A;  1XXG A;  5IGD A;  2WKC A;  3WOE A;  1B1Z A;  1U4R A;  4HN7 A;  1DD2 A;  1B9M A;  3OPO A;  5JAV A;  4ZQ3 A;  3OOC A;  3VR6 A;  1FYC A;  3D8G A;  2K28 A;  1EFI D;  5KRU A;  3U9O A;  3TP7 A;  1G2S A;  4U67 3;  1TT2 A;  3U9S A;  2AWO A;  2KVM A;  4DK1 A;  3JAM E;  1TS5 A;  2A74 C;  2C9O A;  3HG9 A;  2X69 A;  5JVH 3;  4R9W A;  1BUV T;  3NP8 A;  4MN3 A;  1FD7 D;  2RDF A;  2R3Z A;  4Q0F A;  4OO1 I;  3MEH A;  4XXE A;  1PTO C;  3R2I A;  4FF4 A;  5JOB A;  4K2L A;  4F87 A;  5C44 B;  3H09 A;  2IX1 A;  1CT1 D;  2OT2 A;  5M5W B;  3PV0 A;  1LO5 D;  1A3T A;  1IYU A;  1AZP A;  3I4N B;  2FFK B;  4BS9 A;  3DEP A;  4NMZ A;  1WTR A;  2KQ3 A;  4OL7 A;  3S16 B;  1B4O A;  1JOQ A;  4L6T B;  2B8G A;  3MFY A;  3K5M A;  3H91 A;  1Q90 A;  2F0S A;  2ID0 A;  2B2U C;  5E1F A;  4IN3 A;  4J6H A;  3FVQ A;  3PMF A;  3CU7 A;  1TKW B;  5T1I A;  2J0T D;  4FP5 D;  2I07 B;  5CGK A;  2NTT A;  5DAU A;  2ENB A;  1SXT A;  1ENA A;  2Q8R E;  2KA7 A;  1TR5 A;  1ET6 A;  4HED A;  4CKB A;  1I4Q A;  2EYL A;  1WCM B;  3MXU A;  5FK9 C;  1AW7 A;  3V05 A;  1ZXT A;  1L0X B;  1JCK B;  3GQB A;  3A8K E;  3VYS A;  2V4D A;  4K6L A;  1A6X A;  1I4R A;  3KLS A;  3NUC A;  3D6W A;  2DY7 A;  1S5F D;  4OO1 G;  1XYI A;  5ELF A;  4G7H C;  2EDG A;  4XQN A;  1XTC D;  4ODG A;  3DWA A;  3I70 A;  5EGT A;  1TU2 B;  1V8Q A;  2A68 D;  4A3J B;  2F3W A;  4QUC A;  1UNS A;  4XTC S;  1EY6 A;  1PRT D;  4A3M B;  1S5C D;  3BVG A;  1GJX A;  1BCP D;  2EY5 A;  2L5T A;  2K1B A;  5G3L D;  3NWS A;  3DXJ C;  5FKA C;  4XDX A;  1HQM C;  4QF4 A;  2L0C A;  3HS0 C;  2LMC B;  1YNJ C;  2KEE A;  3H0G B;  5EKK A;  3NK9 A;  2XIW A;  3VA5 A;  3X3M A;  2QF7 A;  3ONA B;  2VNU D;  1JOK A;  1TWC B;  1WTX A;  1D1I A;  2Z1C A;  2SNM A;  5ISR A;  5I9P A;  4FVM A;  1QNK A;  2B2Y C;  3DUZ A;  4OHJ A;  1EYC A;  1T5E A;  1QNU A;  3ITP A;  1PXU A;  4ZK9 B;  3T16 A;  1STB A;  2G9H D;  5IT9 L;  2MP1 A;  3ERQ A;  5DM7 3;  3MA2 B;  1MSH A;  4NDX A;  4XT1 B;  1I3Q B;  5DM6 3;  1ONL A;  5C6A A;  1SMY C;  3SE0 A;  2N88 A;  1CA5 A;  5EBC A;  3VYU A;  4IUT A;  1HHV A;  4C3I B;  3PO2 B;  1D6E C;  1BR9 A;  2OXP A;  4NKL A;  4CJ1 B;  2K01 A;  2A5H A;  4BA2 I;  1R4P B;  2Z4H A;  3FPP A;  5CMD A;  2H1E A;  4U68 A;  3OIQ A;  3RD4 A;  1XWE A;  4PNY A;  2KOL A;  2DNC A;  2F4I A;  4L63 B;  2BCO A;  1STE A;  1VMP A;  2XNA C;  5IGE A;  3PO3 B;  4UDU C;  5C0X H;  5M5Y B;  4K5W A;  1MGS A;  2EZV A;  1S5D D;  1DZ1 A;  2BOS A;  2KJX A;  2NUC A;  2HCI A;  4WFN 3;  2MJ8 A;  1V1P B;  2PNR C;  4XYQ A;  4IFD G;  1H9J A;  1QOH A;  1LAC A;  3P1H A;  1FNV A;  5JPN C;  1F2M A;  4XQQ A;  4ZUI A;  1JOO A;  4IUQ A;  1HRJ A;  2AWN A;  2AQ1 B;  1ESF A;  3KBG A;  3GTK B;  3VR2 A;  2JE6 I;  4RKB A;  4F88 A;  1T5X D;  1TQO A;  5FO9 B;  1H9R A;  2CW0 C;  3D4R A;  1S5E D;  3GTL B;  5J22 A;  5CBA E;  4OO1 H;  4BBR B;  2A6E D;  4CHT B;  3T13 A;  3TZD A;  1UEA B;  1HTP A;  3ND9 A;  5C4Z A;  2JXM B;  3IAY A;  3L7Z C;  1EZ6 A;  2JA6 B;  3MXG A;  4QIW B;  4A3G B;  1D5Z C;  4XYO A;  2IX0 A;  1H9M A;  2XRS D;  4PV1 C;  4TRD A;  2RSO A;  4G7O C;  5T1G A;  3I8Z A;  1LTS D;  2E75 C;  3QG1 A;  2D9U A;  2F0G A;  2R93 B;  5LL6 X;  3M4Y A;  2IX3 A;  1ENF A;  3S2D B;  2D62 A;  3NSW A;  5C0X G;  1O78 A;  4KHZ A;  1WTQ A;  1LV9 A;  2HCC A;  1G29 1;  5DNF A;  3WOF A;  1PTO B;  1G8Z D;  4KY5 A;  4KN7 C;  3RMH A;  3EA6 A;  2LS0 1;  3WDN A;  3K0Y A;  1SNM A;  1X3Q A;  2L11 A;  1JOR A;  3HOW B;  5EKI A;  4YIJ A;  3NHH A;  3GD7 A;  1GHK A;  2EYF A;  1F9Q A;  1PLF A;  5JEA J;  3J7A F;  3M3Y B;  4ZRZ A;  2A6H D;  1GXD C;  5E3F A;  5C4H A;  1C8C A;  1IW7 D;  5D3D A;  3SEB A;  5FOB B;  5EPJ A;  4FF1 A;  1QB5 D;  1LTG D;  1K8M A;  1QIL A;  3FDT A;  3K5N A;  4ME5 A;  2PZU A;  4X3S A;  1EIH A;  3TDQ A;  1IW7 C;  3O13 A;  3ZYY X;  1EYA A;  3HP3 A;  1GUW A;  3BYT B;  4CKC A;  3M7N A;  1TS3 A;  3HOZ B;  5A2Q E;  1PZK D;  1BCP F;  3M85 A;  2B2V C;  5CV5 A;  1DOM A;  3VR5 A;  4Y7N B;  5IGB A;  2MUY A;  3IFD A;  5C4J B;  1X32 A;  3BZD B;  3CHB D;  1Y8O B;  3E0J A;  3SK4 A;  3FKI B;  2D2C C;  1SNP A;  1EWH A;  2OEO A;  2E2I B;  2IL8 A;  4RGN A;  5JVG 3;  4XT3 B;  1SFO B;  2R61 A;  1I4X A;  2EJM A;  4KI0 A;  1Q1B A;  1SE3 A;  2RA4 A;  1F2Y A;  3Q23 A;  3BDC A;  2NZ1 D;  1YNN D;  3E5S A;  2SDF A;  5CV4 A;  3D31 A;  1TS4 A;  2F0V A;  4KKU A;  2BE5 D;  4DXG A;  4RCO A;  2JEA I;  1PZJ D;  3C1F A;  1EY8 A;  1PFN A;  3ERO A;  1DCZ A;  5DEH A;  1O80 A;  1QWY A;  2L4N A;  2RDG A;  4K2K A;  2E2J B;  4N9T A;  4CKE A;  5AFW A;  4BY7 B;  1SJE D;  4DFA A;  1DOL A;  5HGT A;  5LHY 1;  3AU7 A;  2RKS A;  1KNE A;  5F2D A;  2A6E C;  3NTI A;  3OW7 A;  2BA0 A;  3S1R B;  1SEB D;  1PTO F;  1TWH B;  1SDF A;  1DOK A;  1WTO A;  1LTB D;  1FNU A;  3I4M B;  2NVQ B;  2F0W A;  1HCZ A;  2YYZ A;  3HEJ A;  1HA5 A;  1EU3 A;  5NUC A;  1C48 A;  1ILP A;  5C5L A;  2EPB A;  4AYB B;  2NB0 A;  2F1M A;  4QUF A;  2Q8I B;  4RHR A;  1NUC A;  4L8J A;  4RFB A;  2BA1 A;  4FF3 A;  2X6L A;  4UAI A;  4H44 C;  1PRT F;  1Z47 A;  1ZKO A;  1Z7T A;  3DM1 A;  5JJZ A;  2FMC A;  4QMG A;  1EU4 A;  1SAP A;  4PQX A;  1VMC A;  1LTI D;  1C4Q A;  2WV6 D;  4C3J G;  5HUR A;  2F0M A;  4O1N A;  4KKT A;  4FXD A;  2EY6 A;  3TME A;  2NVX B;  2IW3 A;  3K59 A;  3TP5 A;  3LNN A;  2QKI C;  1EL0 A;  1J8I A;  4ZUJ A;  2L12 A;  1SYD A;  4HAE A;  2B2Y A;  3JAM L;  2BDO A;  1BCP C;  1GUN A;  4FNF A;  2AQ3 B;  3IKJ A;  1RJT A;  2Z4I A;  3NTH A;  3OIP A;  1HXY D;  1OXT A;  4CJ2 C;  2E74 C;  2EY2 A;  1ESR A;  2PW5 A;  2F0I A;  1F9S A;  1DJR D;  4F7X A;  4N9P A;  3J80 E;  2ICI A;  1EZ8 A;  2SNS A;  2F0O A;  1ML0 D;  2TSS A;  2EYH A;  5A35 A;  4ABN A;  1LT3 D;  4A93 B;  1JE4 A;  4EVO A;  4DNR B;  2NN6 I;  1F77 A;  2F0D A;  4Z9C B;  1F9R A;  2NVY B;  4LK1 C;  1JR0 D;  3QOJ A;  1NR4 A;  1H9S A;  1O7Y A;  2IT1 A;  1BO0 A;  3VA7 A;  2EE1 A;  4EQP A;  1HFN A;  2XN9 C;  2XRQ D;  4B9X A;  4RCN A;  1BNZ A;  4LAA A;  3F2U A;  3R93 A;  2WP8 J;  4JBW A;  2C5C A;  1KDB A;  1HUM A;  5G3L F;  2R6G A;  3S1Q B;  3AMU A;  1OXU A;  1VF5 C;  4ID6 A;  1CFM A;  3MXN A;  3BG3 A;  4O42 A;  3NBH A;  2L55 A;  3QO2 A;  1LTR D;  5KYI A;  5CV8 A;  1UAP A;  1BOS A;  3HOV B;  4IZ8 A;  4MIU A;  4HMJ A;  3J81 L;  2RVL A;  1EY4 A;  3R8B A;  2NBF A;  1A3V A;  4DNT B;  1G91 A;  3HOU B;  1TY2 A;  1UUP A;  1KDC A;  4KJN A;  1RF2 D;  2WII B;  4DA2 A;  3G7L A;  4C1N I;  4MHE A;  1CZW A;  1II3 A;  3H94 A;  1QJO A;  4QB4 A;  3K5L A;  2EJG C;  5CV9 A;  4R8N A;  4C3H B;  3FRP B;  1CQF A;  2GA4 B;  4KV6 A;  3KK7 A;  3TBI B;  1GHJ A;  4V19 0;  3L9A X;  1CZG A;  4C3H G;  1OXX K;  2EOT A;  2KEC A;  4X3T A;  5M3F B;  3GTM B;  1Y1V B;  1TY0 A;  2F0T A;  2PZW A;  1HTL D;  2K5Q A;  2B63 B;  2KCC A;  4RGT A;  4H0L C;  3PUZ A;  3S14 B;  1RTO A;  3BDL A;  2B2W C;  1B44 D;  1MD2 D;  1EY7 A;  4K8J A;  1PDQ A;  2LFN A;  3QIA A;  2KED A;  4B08 A;  4IFD I;  2AUK A;  4NW2 A;  1DM0 B;  4I65 A;  1KLU D;  4HSV A;  4JK1 C;  2QDB A;  4X3U A;  5K36 G;  5I6W A;  2NN6 G;  2FHT A;  1SYE A;  3MZ5 A;  3OWE B;  5A2Q L;  2NYZ D;  3G6J B;  5BN4 A;  1KAB A;  4K5V A;  3T4A C;  2G9D A;  2MHV A;  1STG A;  3OWF A;  1U4P A;  2J4X A;  4ZKB B;  4Q5V A;  2LKV A;  5C3W A;  4G7Z C;  3MHB A;  3GO5 A;  5IT9 E;  5COR A;  3SK8 A;  4S3S A;  3DHQ A;  2CHB D;  4DXF A;  1CQV A;  1EY0 A;  1Q8I A;  4HSP A;  5I2Y A;  4DK0 A;  4IUR A;  4KTA A;  4ULL A;  2ZXP A;  2PCF B;  4H13 C;  5TSS A;  3EQL C;  2O4X A;  2EVB A;  4BA1 I;  2A6H C;  1EEF D;  5KNB A;  2F0E A;  1VDZ A;  3GTG B;  2F0H A;  1A3U A;  1KTK A;  2K7V A;  4PMB A;  3I90 A;  1MI2 A;  3D4W A;  2A68 C;  2R92 B;  3X3N A;  3UI2 A;  4M8A A;  3SDZ A;  3NQI A;  1O7L A;  1NAP A;  1IKL A;  1B2T A;  1ET9 A;  3RUZ A;  4B9W A;  3MXP A;  3S17 B;  1CI3 M;  1OO9 B;  5IGC A;  1A15 A;  4BY1 B;  3Q0A A;  4BWG B;  3T53 B;  4A3I B;  1I6V C;  2F3V A;  4GZY C;  1TWA B;  2WB1 B;  5KIX A;  1SBB B;  4V0B A;  1HFG A;  1A2T A;  1O7Z A;  2WKD A;  4ZYS A;  4KJO A;  2AUJ D;  1PYW D;  3J7A V;  1EYD A;  3E6Z X;  3S15 B;  3VR3 A;  4G57 A;  2EYO A;  3J80 L;  1SYB A;  1NCV A;  4KHV A;  2PZT A;  2F0J A;  1WD0 A;  1DXM A;  1OXV A;  3D6C A;  1JIC A;  4M1U B;  5COY A;  3J81 E;  5EKL A;  3C2P A;  1AFP A;  3NPP A;  2SOB A;  1CK1 A;  1AZQ A;  1CM9 A;  4HCS A;  3K6O A;  2NVT B;  3A7A B;  2EYM A;  2QIL A;  1X3P A;  1JQY D;  1RCV D;  1CTM A;  2F0L A;  5ELB A;  3FEW X;  4K8I A;  2MPM A;  3I91 A;  1Y1W B;  3TZU A;  3EVQ A;  3CRL C;  5CV7 A;  3KBX A;  3P7J A;  2NTS A;  3OMG A;  1IKM A;  3MWY W;  1RKN A;  1BXT A;  5C0X J;  4IFD H;  3DWP A;  5D14 A;  1EWC A;  4A3F B;  3P20 A;  3RZD B;  4E6I A;  2JEB I;  3PUW A;  2H4O A;  3MAQ A;  1BQQ T;  1A2U A;  4C3I G;  1EOT A;  3P75 A;  3KLR A;  3TP6 A;  1LAB A;  2JA7 B;  1WVL A;  3GTP B;  5JEA G;  1ILQ A;  3R2T A;  1E0B A;  1D1K A;  5IIF A;  4KD3 A;  3SXH A;  1SYF A;  1QCB D;  4IUU A;  1SE4 A;  2RSN A;  5ELE A;  5EJW A;  5EPL A;  2M00 A;  3QJY A;  1YNN C;  4I7Z C;  3C3L A;  3D4D A;  1V1P A;  1TWF B;  3CQZ B;  2WAQ B;  1TS2 A;  2RDH A;  5C3E B;  5CV6 A;  1ZYR C;  2FIN B;  3FPU B;  3RLF A;  1LT5 D;  1SE2 A;  1ZYR D;  1B50 A;  3K58 A;  4C56 C;  3LWE A;  1KDA A;  2CW0 D;  3OHX C;  1E2Z A;  1STN A;  3H3V C;  3EJI A;  2DN8 A;  3GTQ B;  3KF8 A;  2SEB D;  3NXW A;  1PTO D;  5E4X A;  3V2T A;  2EYP A;  2F0U A;  4G4K A;  2RQX A;  1I4G A;  1I50 B;  3HZX A;  4HR7 B;  5J1Z A;  1E2V A;  4KY7 A;  2E2D C;  2QEJ C;  3C1E A;  2B2T A;  4LMQ D;  2BE5 C;  1PZI D;  1D5M C;  1XX8 A;  3GTO B;  2I46 A;  5CYU A;  2HDL A;  3V96 A;  5ELC A;  1Y8N B;  1KLG D;  3M4O B;  3A54 A;  1B53 A;  3PUV A;  2Q8T A;  4PMW A;  2O5J C;  4TKO B;  2K33 A;  1TII D;  4KY6 A;  2IJ0 A;  1CHP D;  3HGB A;  4EQN A;  3S9W A;  1GOZ A;  2X6G A;  4X3K A;  4OIK A;  5CC4 A;  5JEA H;  3FMC A;  2KCN A;  2DNE A;  2FJ2 A;  4RA8 A;  1S4Z A;  4ZAI A;  3S1M B;  4XIG S;  1JB3 A;  3HOX B;  4DAV A;  4DAP A;  5IGG A;  5FO8 B;  2B2U A;  1DON A;  2VXW A;  1JWS D;  4HTH A;  2IPK D;  2WAC A;  1KAA A;  5JPM C;  1K8O A;  1ENC A;  2AQ2 B;  1RTN A;  5I9O A;  1S5B D;  3H6M A;  2E2H B;  1KNA A;  2XVS A;  1HQR D;  5FLX L;  3HKZ B;  4WRD A;  1Q12 A;  2PMZ B;  4FO2 A;  1H9S B;  3NBI A;  1NSN S;  1PFB A;  4RKL A;  1GUG A;  4WJW A;  1FGB D;  3MVV A;  2L9H A;  1EQT A;  2EJF C;  2VB2 X;  3HOY B;  1D5X C;  1WTW A;  3PIO 3;  4BBS B;  3OMC A;  1I4H A;  5C3X A;  5KEE A;  3Q22 A;  4OIJ A;  4C1N K;  4KK7 A;  2O2L D;  4NP5 A;  1EEI D;  4IQZ A;  1TWG B;  3BS1 A;  1GUT A;  5CR3 A;  5C5M A;  2JA5 B;  3OSO A;  2VUM B;  1RHP A;  1I6H B;  1Q3L A;  2L1B A;  2Z8L A;  2EYJ A;  2F03 A;  2CVR A;  1AEX A;  1QG7 A;  4QCL A;  4RAU C;  1STA A;  3NQT A;  3A55 A;  3DWQ A;  5C0X I;  2ICE C;  5D65 A;  4RHS A;  5EQ0 A;  5CBE E;  4R8I A;  1HPC A;  3PUX A;  1IL8 A;  3R3O A;  2HQE A;  1PRT B;  4HCE A;  1K83 B;  3PIP 3;  3NE5 B;  2KUM A;  1SNQ A;  3W2D A;  1BCP B;  1LLR D;  1PFM A;  1SMY D;  4KD4 A;  1GUO A;  2WIN B;  4OGQ C;  3SHL A;  1PMR A;  1JWM D;  2J7Z A;  1FR3 A;  4RH6 A;  3PUY A;  5LL6 S;  3I72 A;  5C4X B;  3CKI B;  3J7Y W;  1Q1E A;  3NTK A;  1D2B A;  1G2T A;  4CGY B;  3VYT A;  3MC0 B;  2K5W A;  3MFG A;  1SNC A;  4FXK C;  4RGM A;  2PPB C;  1R4Q B;  3S2H B;  2A69 C;  2N55 A;  1EIG A;  1SJH D;  2OF1 A;  3K5O A;  2ZXO A;  1F2Z A;  2KHS A;  3A7L A;  5I4D A;  1HA6 A;  2A73 B;  2B2W A;  3IL8 A;  4H7B A;  3AB9 A;  1H9K A;  3A8J E;  1W6J A;  4EGV A;  1SYC A;  4XQJ A;  3BVM A;  4CBV A;  1U4L A;  1RDP D;  3TN2 A;  2F0N A;  2O5I C;  5IGF A;  1L0Y B;  1BDO A;  1LTA D;  2JP1 A;  2K05 A;  4FXG C;  4KMU C;  2FMM A;  1MSG A;  1STY A;  2XSC A;  3GV6 A;  3I4L A;  4DU9 A;  5IOD A;  2K03 A;  1GUS A;  3BDO A;  3Q6S A;  4WOR A;  1LT6 D;  4TSS A;  2M9V A;  4KN4 C;  4F8M A;  1I4P A;  3A8I E;  5IOC A;  3D3R A;  2B8F A;  3CRK C;  4KKS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...