4QUCA

Crystal structure of chromodomain of rhino
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
56
structure length
56
Chain Sequence
EYVVEKILGKRFVNGRPQVLVKWSGFPNENNTWEPLENVGNCMKLVSDFESEVFRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords RE36324p
publication title Transgenerationally inherited piRNAs trigger piRNA biogenesis by changing the chromatin of piRNA clusters and inducing precursor processing.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 12
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2014-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4qucA00
5CBAE 4IUVA 3R93A 2RVLA 1AP0A 1VMCA 3IFDA 4RA8A 5CORA 1X3QA 1A15A 1HFGA 5E4WC 1CA6A 2FFKB 3Q6SA 3FPUB 1ILQA 1CA5A 1RTNA 1O80A 3D6WA 4IUPA 1JICA 1Q3LA 1J8IA 5T1GA 3DEPA 3F2UA 1ZXTA 5D14A 1BNZA 1G91A 2HDMA 2B2TC 1WTOA 4XT1B 1S4ZA 1DONA 4X3TA 3UI2A 1B2TA 1F9PA 1ILPA 2B2TA 2B2UC 1E0BA 4R8IA 1QNKA 1B3AA 1EIHA 1B53A 1LV9A 2BDNA 1IKLA 2B2UA 2DY7A 2K05A 2SDFA 4QUFA 1CM9A 5T1IA 3SVMA 4UAIA 3H91A 2KECA 1KNAA 4ZKCB 2NYZD 2X6LA 3GV6A 1DOKA 1KNEA 1PFMA 1DOLA 2RSOA 4RWSC 1G2TA 2IL8A 2MJ8A 4IUUA 3IL8A 5EPKA 1BF4A 1HA6A 5COYA 4MHEA 2N88A 3DM1A 2VXWA 3N52A 4RAUC 1RODA 2NWGA 5EJWA 4CJ1B 3G7LA 2EOTA 1VMPA 1WD1A 5EKIA 3MWYW 4IURA 2XIWA 1BBXC 1TVXA 2KVMA 2L12A 1PLFA 3I3CA 1F9RA 3TZDA 2M2LA 1PFBA 1XX8A 5JJZA 1RJTA 1NR2A 1U4PA 2L4NA 1HUMA 2EPBA 2NZ1D 5E4XA 2R3ZA 2N55A 1F2LA 4R9WA 1U4LA 1WTRA 4QUCA 2MPMA 3DEOA 5CMDA 1IKMA 4O42A 3LWEA 1PDQA 4NW2A 1B50A 2KOLA 1WD0A 1JE4A 2X6GA 5EQ0A 1HRJA 2HDLA 1QG7A 2JYOA 1NAPA 4DN4M 2HCCA 1SAPA 1WTXA 1F9SA 4IUQA 5AFWA 3KBXA 2EE1A 2FJ2A 4HCSA 1XYIA 4OIJA 3ONAB 3KUPA 1EL0A 4HSVA 2K1BA 3TN2A 1G2SA 1HHVA 4CJ2C 4X3KA 1O7YA 3MTSA 2K01A 5D65A 2Q8TA 4ZK9B 2H1EA 1X3PA 1F9QA 2B2YC 2K28A 2L9HA 2HUGA 2JP1A 4HAEA 2B2YA 1ICWA 2D9UA 2FMMA 5EPLA 5EPJA 1ML0D 1WTQA 4X3SA 4U68A 2K04A 1MSHA 1X32A 1RHPA 3I90A 1B4OA 4ZAIA 1WTWA 2KUMA 1AZPA 4LMQD 4MN3A 2K03A 1MSGA 1MI2A 3FDTA 4XDXA 1NR4A 1GUWA 4ZLTF 1WTVA 2L1BA 4XT3B 1WVLA 1WTPA 4HEDA 3GV3A 2L11A 1J9OA 1EOTA 2KEEA 1BO0A 5DNFA 1PFNA 4X3UA 4ZKBB 4CJ0B 2RA4A 5CBEE 1EIGA 1EQTA 1AZQA 3I8ZA 4IUTA 1DZ1A 1G6ZA 1SDFA 1O7ZA 2B2VC 2FINB 2J7ZA 3QO2A 1DOMA 1QE6A 1RTOA 2KEDA 2B2VA 2CVRA 1HFNA 3P7JA 2MP1A 2RSNA 1C8CA 2B2WC 1MGSA 1SSOA 2X69A 1NCVA 1ESRA 1M8AA 2DY8A 1HUNA 3HP3A 2MGSA 2HCIA 2B2WA 1U4MA 2Q8RE 4OIKA 2FHTA 3I91A 1IL8A 1U4RA
chains in the Genus database with same CATH superfamily
5K36G 1AH9A 3GTKH 3BYYB 1Q7YC 1A6XA 1BDOA 3PQIA 1DCZA 2FFKB 2L0CA 3MXUA 4KY7A 1H95A 3OHXC 1A8VA 1DD2A 5HGTA 4JI0L 1EY9A 3M4YA 3PF5A 4HTHA 1LO5D 5IP9G 1VQDA 3MXNA 3IKJA 4C3IG 4IFDH 2B2TA 5CV6A 3MHBA 3PMFA 1IKLA 2IY5B 1A3VA 4ZYSA 1CM9A 1X56A 2KECA 3J80i 3GTOB 1PTOD 2EY5A 3AYHB 3SE0A 1O78A 1SE4A 3CCSA 3E6ZX 1E2VA 2F0LA 2SNSA 3ULPA 2NWGA 5DEHA 3PO2G 2PW5A 2EIFA 3EJIA 2LXKA 1ONLA 2OTLA 2ZT9C 2AUKA 4APVA 2RDHA 4LFCQ 4L5SA 2OWOA 3S1RB 4PZ7A 1A2UA 1HJPA 2MO0A 1VF7A 5CMDA 1LM0A 5FLXc 1LABA 1FJGQ 3Q22A 2VL6A 4DR4Q 1Q81C 1B50A 2ENBA 4F7XA 1K8OA 3HKZB 1X3EA 4IUQA 1H9SB 1S5FD 2I07B 4A3MG 1JT8A 5CV8A 3HOZH 1AFPA 1VCIA 3OIQA 1PMRA 3VR5A 4I7ZC 1FNVA 2K28A 4K0KQ 1VQ6A 2JP1A 2AMCB 2UXDL 4P74A 3QR8A 3NQIA 2PCFB 3Q23A 3RNUA 2P5ZX 1GUWA 2F0NA 5GAHC 1KD1C 4H44C 1WTPA 3CC4A 1W3SA 4ZKBB 4NXMQ 1YIJA 1GOZA 1JC7A 1G6ZA 4GOPA 4IPCA 3BVMA 1TWFH 3D6CA 3R2TA 3HKSA 2F0EA 5JVH3 4CDDC 1FYCA 2YTXA 1XMQQ 1WFQA 5I2YA 4LF9Q 4OIKA 5CV4A 1IBKL 5CBAE 1HQRD 5C3XA 4ZUJA 3ULJA 3I4NB 4A3DH 4IUNA 2F4VL 1S5ED 5E4WC 2I5LX 1K3BC 4ZUIA 4C3JH 3Q6SA 3R8BA 3NE5B 1H9SA 4J6HA 2Z4HA 1N34L 4Q0FA 2F0KA 3S2DH 4KD4A 3X3MA 4DXFA 2ALYB 1ENFA 5FOBB 3BU2A 3S17B 2NN6H 1ESFA 1K8GA 3T16A 2L15A 5CC4A 3PO3B 2O4XA 1QNUA 2RHSB 1HA6A 1RODA 4CJ1B 1VMPA 3A7LA 3X3NA 2V4DA 3J7AV 2NBFA 3LX0A 3OW7A 2WINB 4XYQA 1U4PA 2C5CA 1WTRA 1STAA 3VA5A 2O5IC 2VUMH 4WFN3 4O1NA 4LK1C 2DGYA 1ZKOA 4OHJA 4H13C 5EQ0A 1M90C 4KKTA 4DV2L 3RN2A 4K14A 4LFBL 1H9KA 4RKBA 2UU9L 1VQHA 4Y52H 3TN2A 3HZXA 4A3KB 1SNMA 1Q1BA 3JAME 1SNCA 3GTQB 2EYOA 3J81L 3PGZA 4DR7Q 1IW7C 4JYAL 3GTPH 1VQ7A 4IFDI 1ENAA 2JA5G 3A8IE 4IPDA 4A3EH 1RL2A 1IHZA 1IZ6A 4B3TL 4CDCC 2L1BA 4RGNA 4LWCA 2F0WA 3I4MB 2F0VA 4QGUA 3EBEA 4A3IB 2R7ZG 1I6VC 2K7VA 5JVG3 1EFID 5C44B 1S5DD 2JA8G 1GJXA 4I65A 3SK8A 4H02A 5KYLA 2X69A 5GADC 4FP5D 4DF7A 4A93G 2BA0A 1I4PA 4RGTA 2EJGC 4QF4A 4L5RC 3TBIB 1SMYC 2PQEA 3M4OB 1TY2A 4A3GB 2OT2A 4OX9L 3D6WA 4UP8A 1KDAA 4RCOA 1MD2D 3JAMi 3NEMA 2A6HC 1SE8A 5AJ3Q 3TQYA 5C3EB 2OF1A 3GTOH 4R8IA 1EIHA 3J7YW 2SDFA 3OTOL 5EBDA 4BXXG 3AMUA 5KNDA 4N9PA 2NYZD 3I7FA 2ZTCA 1JWSD 4DNRB 2CH4A 4DR5L 5CGKA 1PRTB 2KCNA 4LF5Q 5IP7H 4MHEA 3G7LA 3RLOA 2C35B 3TREA 4JI8L 1STEA 2V1CC 3A56A 2A19A 1SYBA 2BCOA 2Y0SE 3GD7A 2KVMA 3WWVA 1M1KC 3PV0A 1ASZA 3TZDA 1KDBA 2K5WA 3S1RH 2M2LA 1LTBD 2QCPX 2CKZB 2I5MX 4DKAC 2N49A 1MJEA 1CKNB 2AUJD 5IGCA 1I94L 2A74C 3K5MA 1STBA 2PI2E 3HOUB 3SK5A 2DJGC 3VDYA 5KNBA 4JV5L 4OIJA 4CHTB 3AQQA 4XYOA 1PYSB 2JA7B 1PRTD 1PTOF 1TIID 3F2DA 2E76C 1YJNA 5IYDH 3CCEA 2WKCA 4P72A 1CHQD 3I4OA 4C2MB 1RDPD 1ICWA 2WB1G 1G6PA 3I73A 3G48A 5J3BA 3W2DA 4RMFA 3C46A 2KHIA 3RR5A 2AHOB 2A6ED 1MSGA 3HOZG 4GN4B 3OYYA 2KEEA 1SYGA 2TMPA 3W5OA 4ME5A 2G9HD 4HIKA 3Q0AA 5LMUQ 5ELOA 1TWHB 2AWNA 2K14A 5I6WA 4JI5L 1UE1A 1UEBA 1C8CA 1NCVA 1ESRA 3KLWA 2DY8A 5IT9E 4BY1B 3T1HL 2Z9HA 1LT5D 1D5XC 2LY7A 3A55A 4NKLA 5NUCA 3OMGA 1VMCA 3H6MA 2WP8J 1V43A 4DV1Q 3RN5A 1RTNA 4JC0A 4DAMA 5K36H 3TSSA 1BKBA 3GDEA 2M9VA 1E2WA 1EIFA 4B08A 2B2UC 1Q1EA 5M5WH 1B53A 1LV9A 4A3DG 1EY0A 3SK6A 3R3OA 3KDFB 5IP9H 4MTKA 4C3IH 1DOLA 4B3RL 1BXTA 4OL7A 1BF4A 4DFAA 1DM0B 2N88A 3N52A 3ER0A 1A3UA 2EXZA 1CSQA 5KRUA 1Q90A 1EY8A 1S72A 1GHKA 1HR0L 1TS4A 1YHAA 3CF5A 1TWGB 1NR2A 5GAEC 3PO2H 4TVAB 1I4QA 4JBKA 3SGIA 1Y8OB 3S1NH 3RLNA 5JPNC 1IKMA 5C6AA 2NVQB 1LT6D 1SRUA 4X64Q 4DV3Q 2PZWA 1QG7A 1QUQB 3NWTA 2ZXOA 4OO1H 3EFXD 3RUZA 1JWMD 1ZYRD 4J1MA 1EWHA 3GTQH 4DR1Q 1B70B 3J81j 1K0RA 2A1AA 1L1OB 1I50B 4A3MH 4R4QA 1CQVA 2D9UA 2FMMA 1KDCA 4WJ4A 1ML0D 1VQFA 4DA2A 2Z6KA 3NHHA 3I70A 4UP9A 2VY3A 3K81C 2Y0SB 1BUVT 1AZPA 3KDFA 2ICEC 4YY3Q 4KI0A 3D4RA 1CZWA 1D1IA 1EY5A 1EEFD 4A3IH 1LT4D 1UE5A 1K73C 1EQTA 5C44H 4Z9CB 3MFYA 2KENA 1UEAB 3UE0A 1GO3E 1SE3A 2KEDA 4CGYB 1XMOL 1B3QA 1EWIA 3C2PA 5CYUA 2NZHA 2B2WA 1W6KA 4HJ9A 3K5OA 4K6LA 1IL8A 4MNOA 3M4OH 4GKKL 4EVOA 1YJ9A 4A3GH 4G57A 4POFA 1CZGA 4OONA 2KBNA 1QUQA 1EU3A 1QZGA 1Y1VB 5CV9A 1SROA 2VQEL 1YBYA 1FD7D 1CHPD 4JPBW 3LWUA 1BCPC 2R93B 3DM3A 4NP5A 4XT1B 4LF8Q 3U4ZA 4ABNA 5IYBH 4R4TA 3T13A 4CDFC 1JCKB 4PZ8A 4FF3A 5T1IA 1NJIC 3OOCA 4J8QA 2EYFA 1PFMA 2UXBL 3H3VI 2F0OA 4RWSC 1R4QB 3LNNA 4FF4A 2VXWA 4RAUC 3CQZH 1WCMB 2SNMA 2F03A 4N8FA 2RCNA 3G71A 3K58A 4YHHL 4N8X1 1RJTA 2E8GA 4WRDA 3VR6A 3N6RA 3HGBA 1PH5A 1R4PB 1FGBD 4A3FB 5IE8A 4LF6L 5C5MA 1I6HB 5IP7G 1K0SA 2PI2A 4DAPA 1RD9D 5EBCA 5J22A 3GQBA 5BR8L 1O7LA 4LF4L 1HRJA 3RLFA 2CW0C 4ULLA 1HCZA 3ERSX 1E1TA 2PZTA 2NVYB 3J81c 5ELFA 1GM5A 5AFWA 3KBXA 4MTNA 2JE6I 2NVXB 5M3FB 3BS1A 2K6AA 3S2HH 5M3MB 4POGA 1EZ8A 1VQNA 3HKZG 2L55A 1UNSA 4DNTB 3BVZA 1GVPA 4DR3L 1VQBA 5EPJA 4IQZA 2UUAL 2B29A 5C0XJ 2E2DC 2Q2TA 5FLMH 4DK0A 3PUYA 1CK1A 1MI2A 4HSPA 1N32Q 4XXEA 1EIYB 4DGZA 1XNRL 5GQOA 5IYDG 4CJ0B 1CUKA 3NQTA 4KY6A 3TP8A 1SMXA 3MXNB 5FK9C 3F2BA 3A74A 4DV0L 2YTVA 2B63B 4BY1H 2Z8LA 1PYWD 3T51B 3T56B 1SYCA 3E9HA 1X3FA 3KFUA 3J80E 2QKIC 2F3VA 2R7FA 3DWQA 2JA8H 4HMJA 2RVLA 3IFDA 5ELDA 3GTMH 3QG1A 2OTJA 1A15A 1HFGA 1VQ4A 3FPUB 2JA6B 3VR2A 5BN3A 4A4IA 1A62A 3WOFA 5M5YB 3I4NG 3BDLA 1L0YB 2E2HH 4LFCL 4O2DA 4IPGA 4KJOA 4YWKA 3MFGA 4ODGA 5FO8B 1PH7A 2KJXA 4GNXB 3GTJH 3PF4A 1Y1WB 1FJGL 2IJ0A 3OWFA 1JB7A 4IUUA 1EQRA 4M8AA 5FO9B 2L5TA 1HPCA 4BXXH 4IALA 4V190 1TWGH 3CMEA 2L12A 4X62Q 5C0XH 4C3HB 1Q82C 5ELCA 1YI2A 1V1PA 2L4NA 1IL2A 3U58A 2A8VA 2ZXPA 2NVQH 1PZID 1N33Q 2GN5A 1F2ZA 1Z47A 3NTIA 3LWEA 3U50C 3U9OA 2RBMA 2EYJA 3H0GB 1S5BD 1A63A 2AWOA 2WAQE 1EYDA 5M5XB 2E2JB 3J7ZC 5A2QE 2JYOA 2SOBA 3PIO3 4A75A 4A3BH 3KLSA 4P73A 2F0UA 4X65Q 3GTLB 4DR2Q 2E75C 3T1YQ 5LL6S 5IGGA 4GOPB 3VYSA 2Z1CA 3BDOA 4NXML 2KA7A 1F9QA 2ZTDA 3D8GA 3MA2B 3KYHC 2F0MA 4KTAA 4M1UB 1WTQA 1GUTA 4OO1G 2EYPA 1QVGA 1XNQL 1XMQL 2KUMA 1JE5A 4GNXA 1D2BA 3FHWA 1N8RC 2CWPA 2K5DA 3OSOA 2WACA 4Y7NH 4A3JH 1STGA 1IXRA 4HEDA 1I3QB 4LF7L 1C48A 2RHQB 1YVCA 5GAGC 5E3FA 1WOCA 2J4XA 3EIVA 1TWAH 3FKIB 1Q8IA 4QB4A 2IX1A 4X6AH 2RQXA 2XTIA 3I2ZA 1MGSA 3HOWB 4G7OC 4KHVA 1S40A 3S14B 2MGSA 4LUOA 2A69D 4A3IG 4JCVE 2KCCA 3MZ5A 5C44G 1EY6A 2XNAC 3SK4A 4QY7A 1ET9A 2R93H 2UXCL 3SEBA 2MNAA 4GN5A 2ASBA 1G91A 4JI4Q 4FXDA 1VQLA 3HOVH 1GUOA 5DM63 4RG1A 2AQ3B 4A3GG 4RGOS 4FNFA 4UHVA 1KNAA 3GV6A 1WYDA 4LNQA 2XVSA 2RF4A 2K4KA 4K5VA 4JK1C 3J81i 4OWTB 4NXNQ 1GXDC 1FNWA 4KHPQ 2XRQD 2YTYA 2WKDA 5IGBA 5IYBG 1PLFA 1F9RA 2OCEA 1IBLQ 1Y8NB 5JJZA 1HUMA 1BR9A 4BA2I 4FYDA 1Y14B 1HNZL 4F8MA 3ZYYX 3VYRA 3WDNA 5D3DA 1VQGA 1GUSA 4DR6L 3CHBD 1PDQA 4DR7L 1J6QA 3CC2A 2NVYH 3KBGA 1GD7A 4GLAC 3HOYB 1JE4A 2X6GA 1D5ZC 4I7AA 1XXGA 1PH6A 1NAPA 2PMZB 2NVXH 5M3FH 1SAPA 2G9DA 4BBRB 3BZCA 4DV4Q 3DLLA 2F0TA 2E74C 4DV6L 3PUWA 4RHSA 5HY6A 2B39A 1X3PA 1KL9A 2YU9H 3AU7A 3HOUG 4HAEA 2ATWA 1PH1A 3IFTA 1B9NA 3QWNA 3HOXB 3S9WA 1F77A 3K57A 4DUYQ 2JA7G 4ZAIA 3TP6A 4NMZA 3RZDH 3S1QH 1NR4A 4ZLTF 1XPRA 2KCMA 1PFNA 2RA4A 4DV7Q 1NUCA 2F0GA 2MFIA 4JOIC 4TQUS 4TRDA 1TWCB 1TQOA 2B2VC 2D0PA 4R4CA 2WAQB 2IX3A 1KLGD 4Q5VA 5FLMG 2VW9A 5AJ3L 4B3MQ 1XTCD 4YWLA 3TMEA 5FLXE 1VQOA 3S15B 2EJFC 3FEWX 1VQKA 3S1MH 4JI3Q 2IX0A 4JBMA 1AP0A 3DUZA 4PV1C 4LF5L 3P20A 2MUYA 4GN3B 1CA6A 2A5HA 3G4SA 5M5YH 2Q2HA 4BY1G 2RDFA 1VQMA 5CR3A 3CCLA 1PTOH 5T1GA 1K83H 3MXPA 4P75A 1ILPA 1T5XD 1B3AA 2EVBA 3DXJC 2DY7A 3VR3A 2K5QA 1VS0A 3CAMA 1VQEA 1VQ8A 1YHBA 2K52A 3SHLA 5EPKA 2R92B 2FMCA 3PCOB 5COYA 3HS0C 1F2YA 4C3HH 5EKIA 3TS0A 1HNWQ 2PYKA 1JJGA 3I3CA 3URYA 3GTGB 1DJRD 4JG2A 1YNXA 2NZ1D 1RF2D 3STBD 2R3ZA 3U9SA 5M5XH 3DEOA 3EVQA 4RFBA 4LFAQ 3K5NA 2HHHQ 3NP8A 1WD0A 3RZOB 2DNCA 3M7NA 4XIGS 3CU7A 5C0XG 4LFBQ 2Q2IA 4TKOB 1B1ZA 4HCSA 2HIXA 3W1GA 2VNUD 1YNNC 1Q86C 4RKLA 2G5DA 3MTSA 5D65A 2Q8TA 5LMUL 1HZCA 5JJLA 2BH8A 1AE2A 1EQVA 4K8JA 1STYA 2B2YA 3KF8B 1MIUA 2QW7A 4A3BG 1Q46A 1LTTD 1EU4A 1ZEQX 2CQAA 2NTTA 5J39A 4B3TQ 2H4OA 3BZDB 1WTVA 5FO7B 3OWEB 5LMNL 5IGEA 5I4DA 1L2FA 2EYHA 1SE2A 4R1JA 3ICEA 2HQEA 2M00A 3FKIH 4DV1L 2Y0SG 1VQJA 5EGTA 4GLXA 2J7ZA 1BBUA 3I56A 4NDXA 2LKVA 1SSOA 2I5HA 1L0XB 1FGUA 2QILA 3HP3A 4X66Q 4A3JG 4JI7Q 2PNRC 2E5LL 2D0OA 3K8AA 1LTGD 1LTRD 2IHEA 4PMCA 1IBML 1JWUD 2H5XA 4R4IA 2NN6I 4FVMA 1UAPA 4GKJQ 4IUPA 1J8IA 1LLRD 3F2UA 2HDMA 2B2TC 1WTOA 1B2TA 3SR1A 1KIXA 4DUZQ 2EZVA 2E2IB 1Y1VG 2BDNA 4QUFA 3H94A 3KF8A 4EGVA 3I4NH 5FKAC 2X6LA 1KXLA 2R93G 4X64L 2NVTB 4DK1A 2MJ8A 4YCUA 2EYMA 3JAML 4JI8Q 4CKCA 1DONA 3IRBA 4RCNA 1HZBA 3HOVG 2XIWA 3NBHA 5JJKA 1HZAA 1MBYA 3MAQA 2GVBA 4ID6A 4DR1L 4IJHA 1S3OA 3T53B 1PTOC 1X3GA 2NUCA 3S17H 1WCMG 5KYIA 3AEVA 1Y8PB 3NWSA 2ZJRA 4BY7B 3PO3H 4OWXB 3NSWA 4BBRH 1OXVA 3SDZA 2HCCA 5IWAL 2N8NA 2B3GA 2LXJA 3TP5A 4AQYL 4YY3L 1NE3A 4A3FG 2ZM6L 2CCZA 3K7AB 1YHQA 1XYIA 4HJ5A 3IAYA 2K1BA 1B44D 2ZJPA 4R8NA 4CJ2C 5LL6X 3CMAA 3NELA 5HURA 4K2KA 3D0FA 1N36Q 5FJ8G 1JMCA 5M9OA 2AQ2B 2R61A 1HA5A 4OXPA 4QCLA 4HJ7A 5HGQA 5M3FG 2K04A 1D1KA 1W6JA 5M3MG 1TS5A 5JOBA 3FVQA 4HIDA 3AFPA 3B6YA 3H15A 1T9HA 2OQ0A 4A3KH 3F1ZA 4GS3A 2YYZA 3WOEA 4GOPC 1AZQA 5IGDA 2K5VA 1V1OA 4DV5Q 4G7HC 3TP7A 3P7JA 4C1NK 4LF8L 2K5NA 1NBWA 4KY5A 2F0SA 4UY8C 2WV6D 1H9RA 2F1MA 1VQAA 2B63G 5CV5A 3I4MH 1FL0A 2D62A 1MKHA 3MEFA 2K50A 1C9OA 2PW7A 1YZ6A 3CC7A 1BNZA 4IN3A 5D14A 4L5QA 4X3TA 1F9PA 3OMCA 3KLRA 3J80c 2JA6G 4B3RQ 4PQXA 1DOKA 2K33A 3ND9A 4EQ5A 1W2BA 1AE3A 1TS3A 1OXXK 4L5TA 3GTGH 1KAWA 1TVXA 1U0LA 2QDBA 5BN5A 4MIUA 2LSSA 3PSIA 5C3EH 2EDGA 2BA1A 2MPMA 4C3HG 2VQFQ 3A5ZB 4NW2A 5IODA 4NPSA 4JI6L 4J15A 1XPOA 3PIOA 5I6YA 3G6EA 1JOQA 1SNQA 3D31A 3G6JB 3E9IA 3ONAB 4P2CB 3H0GG 1UE7A 5IT9L 4PMBA 4FF2A 1E1OA 2K01A 2QEJC 3GO5A 4IPHA 2L9HA 5C3WA 3F2CA 1TWFB 4EQNA 4WJ3M 2EXDA 1WTWA 1WJJA 3BDCA 3EA6A 3HOUH 4AH6A 3FDTA 4ME3A 5CV7A 1X9NA 4K6DA 5TSSA 2EY1A 4ZQ3A 2JA7H 4F87A 4V0BA 1J9OA 2BH2A 1BO0A 3AFQA 4F88A 1NMGA 3HKZE 4C3JB 2UUCQ 1SMYD 4C2MH 4LUVA 4FF1A 1RTOA 4ZRZA 1NSNS 1CFMA 4JI2Q 5I9PA 3S2DB 4IJLA 1K9MC 1EQQA 5KEEA 4P71A 1KLUD 4GKKQ 4GLVB 5JPMC 2A6HD 4LJZC 1TS2A 3K7UC 3FKIG 4H0LC 1EYAA 4BBSB 3J7A5 1TXYA 3HOWG 4AYBE 4B9XA 5IYCH 4IOCA 3HEJA 1HNXQ 1TWHH 1Q3LA 1V1PB 4X62L 1STNA 5EKLA 5JEAJ 1XPUA 2JK8A 2JSOA 4EX5A 4B9WA 2O5JC 3SXHA 1N33L 1SR3A 3PUZA 2VUMB 2LMCB 3CCRA 4PNYA 5LMNW 1PRTF 1KQSA 4XQJA 3CPWA 4IFDJ 1SLJA 1K8AC 3STBC 2VS1A 1VDZA 5ELBA 5D3IB 4X65L 4DR2L 3T1YL 2EY2A 4OO1I 1XX8A 3OPOA 2OEOA 5E4XA 1U4LA 5E7NA 2XRSD 1JR0D 1OTCA 4KKSA 1GKHA 1ICFB 4WJWA 3CCMA 3GTPB 4CDEC 2D2CC 3BG3A 4DR4L 1J5EQ 4JI1Q 4CKEA 4A3EB 2EE1A 4JBJA 4HJ8A 2F4IA 2QF7A 4CBVA 2EYLA 3K6OA 4XQNA 1A0IA 2EY6A 2BE5D 1JJ2A 4B3SQ 2HT1A 4ZK9B 2H1EA 4FXKC 1ASYA 3PO3G 4BBRG 2VZAA 2UUBQ 4K0KL 1SBBB 5EPLA 4FO2A 4X3SA 1X32A 5C4HA 1X54A 1HQMC 1PRTC 1TU2B 4DU9A 1SYEA 5JEAH 1XNRQ 2IT1A 1DYQA 1QB5D 2QGQA 3GV3A 1EUJA 4UDUC 3HOXG 1DZ1A 4DV0Q 1I50H 1G51A 4JI4L 3LGJA 4RH6A 3S16B 2MP1A 2A6EC 4TSSA 1R9TB 3W1BA 5KGUA 4DXGA 1XJVA 2CQOA 1SFOB 5C4XB 4K8IA 2D5DA 1SNOA 2GA4B 3CP0A 4A3KG 2A68D 2WAQG 4LF9L 2JEBI 2A73B 5J1ZA 2R6GA 3A7AB 1HR0W 3J81E 5CORA 1O7IA 2RDGA 1VQPA 2XWJB 4NXNL 4PG3A 4KHPL 5DM73 4DAVA 5G3LD 3JAMc 2IHFA 1IBLL 4IO9A 1PZKD 1S4ZA 1I5FA 1KTKA 2WIIB 2EQSA 2B2UA 3I4MG 1EOVA 1BVSA 3L2PA 2C9OA 5GROA 3I72A 4FDBA 1Y1VH 1G8ZD 5ELEA 4DV4L 5C4ZA 4EQOA 4OELB 4RHRA 1EYCA 3W3AA 4JI0Q 2R92G 4DK6C 5EKKA 1TT2A 3K0XA 1F2LA 5ISRA 1QZHA 3PIP3 2I46A 3C1EA 4AYBB 4DUYL 2KOLA 1NMFA 2HDLA 2PZUA 1CTMA 1WCMH 1NY4A 1WTXA 5C3EG 2FJ2A 4HR7B 1BQQT 1H9MA 3TS2A 3KUPA 3E0JA 4G4KA 1EL0A 4HSVA 1XTDA 1G2SA 3NPPA 4JVZA 4DV7L 4X3KA 4QJFA 3J80L 4YIJA 1BCPB 4A3FH 1I6HH 2IPKD 2XSCA 1HTPA 2KCTA 5EAYA 2Z6KC 1XNQQ 4B3ML 4R4OA 1UE6A 3UDXA 4U68A 1V1QA 1MSHA 3I90A 1RHPA 1B4OA 1ZYRC 1CSPA 5FJ8H 4LMQD 3QIAA 3DWAA 3GP7A 4JI3L 4JBWA 1B9MA 4LF7Q 4BWGB 1VF5C 3L3OC 1PH2A 3AB9A 5M3MH 5IIFA 4X3UA 1MJCA 1VQCA 2F0JA 2JQOA 5CBEE 3I8ZA 3ULLA 1SDFA 4OEMB 1X6OA 2FINB 1SYDA 1VQ9A 1U9RA 3M4QA 3QO2A 4ZCKA 2UXDQ 3CD6A 1JB3A 3BZKA 2B2WC 2ICIA 1M8AA 2EJMA 1PYBA 1HUNA 1BCPD 2HCIA 3DWPA 5M5WB 1E3PA 4BBSH 3CCUA 1YJWA 4IUVA 3CRKC 4C3IB 1V9PA 2UXCQ 5BN4A 1C4QA 3M9BA 5KIXA 1CA5A 1HNWL 4UP7A 5E1FA 1JICA 2PQAB 2B63H 4C56C 3VR4A 1IYVA 5A2QL 1L1OC 3I4LA 2AKWB 1QWYA 1AEXA 5C4JB 5C0XI 2B8FA 3PO2B 3SVMA 2Q8IB 3TZUA 2QEXA 3S1NB 4S3SA 1IBKQ 3C3LA 4LFAL 5IYCG 2HHHL 2IL8A 2JN4A 2LS01 2F4VQ 4LAAA 1CI3M 1I4XA 1PXUA 4DK3C 4OGQC 2JA6H 4IZ8A 1LTID 4IURA 1BBXC 1A3TA 1N34Q 3PUXA 1VQ5A 2CW0D 5DAUA 3P75A 1PFBA 2QA4A 1HNZQ 2BDOA 2FXQA 3C1FA 1Q8KA 4DR6Q 3E3XA 1YNJD 1PHJA 1B8AA 5IT9c 5H1SE 1A2TA 4A3MB 3CRLC 1Y1WH 1E22A 2JEAI 2JXMB 4DN4M 1QVFA 5IOCA 4DV6Q 1EFWA 1NNXA 5JAVA 1HH2P 4BY7G 3A8JE 1GHJA 1O7YA 2F52A 1PH3A 3QB3A 2PQAA 3KJPA 1QVCA 2N3SA 1EWCA 1VQIA 3CXCA 1RCVD 1D6EC 1E24A 1HTLD 2F3IA 3H0GH 2E2JH 1KAAA 2HQLA 2MO1A 3FPPA 1PZJD 4X66L 4JI7L 2ES2A 2GVAA 1RIPA 3BVGA 4DV2Q 1LTAD 1SN8A 3GTLH 5I9OA 2UU9Q 1CKOA 1SXTA 3RMHA 2L11A 1LT3D 3E5SA 5DNFA 1H9JA 1EIGA 4GKJL 3S16H 1R9TH 1IYUA 2ZTEA 1SFOH 3TEHB 3UDFA 4MZ9A 5C4XH 2CVRA 3NTHA 5LHY1 4DUZL 3L9AX 5JEAG 4A76A 4JYAQ 4A3LH 1PA6A 4CKBA 2DNEA 5JJIA 1U4MA 2OQKA 4BA1I 2FHTA 3T4AC 3KK7A 2QDLA 3E0EA 1I3QH 4KN4C 5IGFA 4YCWA 4FXGC 3NBHB 4IFDG 1EZ6A 1T5EA 2N78A 1ILQA 3CQZB 1O80A 4HIMA 2SEBD 5DLQE 3MXGA 3DEPA 4A3CH 3HOWH 4H7BA 3UI2A 1E7ZA 4PZ6A 2WB1E 3UDGA 3S14H 1E0BA 1LUZA 3S24A 3QJYA 3HRZC 4UAIA 4ZKCB 3NTKA 4KMUC 1G2TA 3IL8A 2K75A 2EOTA 4OWWB 1UUPA 3A8KE 4OX9Q 3MWYW 4K5WA 2CHBD 1QILA 3S2HB 1N36L 3H3VH 4UPAA 4R9WA 3OTOQ 1P16A 3K80C 3K0YA 4O42A 3A54A 5F2DA 1CQFA 5G3LF 4NB3A 1PH9A 4DR5Q 3L0OA 4DPGA 1K28A 2BE5C 2K32A 4DV3L 1OXUA 3DMUA 3DHQA 1F2MA 5FLXL 2JA5B 3ZJYC 3CCJA 4DV5L 2HUGA 1FVIA 3EROA 1I94Q 1CKNA 1TR5A 1P8LA 3ITPA 1CKMA 2WFWA 1I4HA 3HOYH 4GNXC 1LACA 3K59A 1B7YB 4MN3A 3M3YB 2R7ZB 5LMNQ 2JA8B 4JV5Q 4XT3B 4HIOA 1WVLA 3GTMB 1TKWB 4A93B 3CCQA 1XWEA 1TY0A 2A68C 1QE6A 1HFNA 3HOXH 3D4DA 2RSNA 1JQYD 5L37A 1SNDA 3NXWA 4JW0A 2E2HB 1OXTA 2E5LQ 2RKSA 1Z7TA 3M4PA 1NTGA 4C3JG 4LUZA 3UE1A 1IBMQ 1U4RA 2F3WA 4QUCA 3GTJB 1LYLA 4L63B 4HJAA 1D7QA 3FMCA 4RA8A 1EY7A 4L6TB 1X65A 3V96A 1PV4A 1RKNA 1C7YA 3VYUA 1TWCH 1QCBD 4QMGA 5C5LA 3GTKB 2DUDA 4GZYC 2F0IA 4L8JA 1ZXTA 5C4JH 3EQLC 2MQHA 2NN6G 2F0DA 4JI5Q 4BBSG 2A69C 1HXYD 2OXPA 2JJQA 3S15H 4QQBX 3T1HQ 2K05A 4G7ZC 2F0HA 2I0QA 2MHVA 2YV5A 3H91A 3K5LA 2PPBC 3VYTA 2VQFL 3QOJA 4U673 1D8LA 3DM1A 3RD4A 3NENA 1UWVA 1WD1A 4A3BB 3BJUA 2J0TD 2VUMG 1BCPF 1GUGA 2NTSA 1EY4A 4HCEA 5A35A 1X55A 2XWBB 2EPBA 3EN2A 3O13A 2N55A 1ENCA 4QIWE 2PNHA 4N9TA 2DJFC 3CKIB 1DGSA 1Z6HA 4KJNA 1KABA 3NK9A 2R92H 3KLSX 5IWAQ 4AQYQ 1OXSC 2VB2X 4DNIA 1V8QA 2ZM6Q 1KRSA 1F9SA 1G291 2ZXRA 1SYFA 4DAYB 2WB1B 1HR0Q 3A5UA 4Y7NB 4A3JB 1PFSA 2KHJA 2NB0A 1U5KA 3M85A 1Y1WG 1LTLA 3FP9A 3HFZB 2UUCL 3HOZB 2CH4W 4E6IA 5IY0A 4KLKA 4A3EG 3NBIA 4JI2L 1TWAB 3H3VC 3TDQA 3KJOA 3RZOH 3MEHA 2NZOA 2DN8A 1LTSD 2BOSA 1M4VA 2K03A 3TRZA 3I55A 1STHA 4XDXA 3FRPB 1GUNA 2PO4A 3KF6B 4LW1A 1KRTA 3HG9A 3OW2A 1PH8A 2CWAA 1IW7D 1N32L 3J7AF 1EOTA 3OIPA 1KC8C 2F0PA 1HNXL 2IW3A 2KQ3A 1JJCB 4JOIA 4HMIA 4KKUA 1DOMA 2B2VA 1L1OA 2AQ1B 4YWMA 3HOVB 2HIVA 1MHWC 1K3RA 1DXMA 2CFMA 3I91A 3D4WA 3Q8DA 2B8GA 3R93A 2IWHA 1Y69U 2Z6BA 1X3QA 1L0WA 1N9WA 5C4XG 4A3DB 1YEZA 3BYTB 4DAYA 2LFNA 3CCVA 4A3LG 1HZ9A 4XTCS 1XMOQ 5ELNA 2XN9C 1WTHA 4KK7A 3MVVA 3V05A 1QNKA 1Z9FA 1WI5A 2ID0A 3ERQA 1AN8A 1E2ZA 1KNEA 2RSOA 4O0AA 2JA9A 1C0AA 4IOAA 5EJWA 4ALPA 3JC66 1J5EL 4A3CG 2Z0SA 4JI1L 3KF6A 2VQEQ 4K5XA 1YNJC 2HD3A 1FR3A 1IYJB 1EEID 3QOLA 2XGTA 2E2IH 4B3SL 2O2LD 1YNND 1SJED 2VB3X 1CT1D 3NUCA 2Z4IA 4EQPA 2UUBL 2YU9B 4C1NI 4KV6A 4KD3A 1II3A 2NVTH 3PIPA 4K2LA 2UXBQ 4JI6Q 1YITA 3M7GA 4QL5A 1BOSA 2ZJQA 1JOKA 4XQQA 1K8MA 4YCVA 3RZDB 2JA5H 3S1QB 1JOOA 4AYBG 4BS9A 3UDIA 1PH4A 1I4GA 3VA7A 1PVOA 1HHVA 2K5HA 1ET6A 1S5CD 2TSSA 5K5PA 4YHHQ 3Q24A 1SJHD 3MC0B 2B2YC 4KN7C 4RGMA 2R7DA 3A0JA 4LF6Q 4BY7H 3CPFA 3R2IA 2RCFA 3L7ZC 3KOJA 3M3YH 2R7ZH 4AIMA 5BR8Q 1QJOA 3F8TA 4LF4Q 1SEBD 1I4RA 3CW2C 1AW7A 4HN7A 1BBWA 3K7AH 4A93H 3S1MB 5KNCA 1KHIA 4WORA 1OO9B 3D3RA 1EYGA 2KHSA 3H09A 4QIWB 5I2XA 3P1HA 2PMZE 4IUTA 3U4VA 3V2TA 2F0FA 1FNUA 3HOYG 1O7ZA 4ILWA 1PTOB 1D5MC 1K83B 4DR3Q 2UUAQ 2F0QA 3ND8A 4KHZA 1SNPA 3PUVA 4PMWA 2Q8RE 1Q12A 2Q2UA 1QOHA 1JORA
chains in the Genus database with same CATH topology
5K36G 3BYYB 1A6XA 1BDOA 1DCZA 2FFKB 2L0CA 3MXUA 4KY7A 3OHXC 1DD2A 5HGTA 1EY9A 3M4YA 4HTHA 1LO5D 3MXNA 4C3IG 3IKJA 4IFDH 2B2TA 5CV6A 3MHBA 3PMFA 1IKLA 1A3VA 4ZYSA 1CM9A 2KECA 3GTOB 1PTOD 2EY5A 3SE0A 1O78A 1SE4A 3E6ZX 1E2VA 2F0LA 2SNSA 2NWGA 5DEHA 2PW5A 3EJIA 1ONLA 2ZT9C 2AUKA 2RDHA 3S1RB 1A2UA 1VF7A 5CMDA 1LABA 3Q22A 1B50A 2ENBA 4F7XA 1K8OA 3HKZB 4IUQA 1H9SB 1S5FD 2I07B 5CV8A 1AFPA 1VCIA 3OIQA 1PMRA 3VR5A 4I7ZC 1FNVA 2K28A 2JP1A 3NQIA 2PCFB 3Q23A 1GUWA 2F0NA 4H44C 1WTPA 4ZKBB 1GOZA 1JC7A 1G6ZA 3BVMA 3D6CA 3R2TA 2F0EA 5JVH3 1FYCA 5I2YA 4OIKA 5CV4A 5CBAE 1HQRD 5C3XA 4ZUJA 3I4NB 4IUNA 1S5ED 5E4WC 4ZUIA 3Q6SA 3R8BA 3NE5B 1H9SA 4J6HA 2Z4HA 4Q0FA 2F0KA 4KD4A 3X3MA 4DXFA 1ENFA 5FOBB 3S17B 2NN6H 1ESFA 3T16A 5CC4A 3PO3B 2O4XA 1QNUA 1HA6A 1RODA 4CJ1B 1VMPA 3A7LA 3X3NA 2V4DA 3J7AV 2NBFA 3LX0A 3OW7A 2WINB 4XYQA 1U4PA 2C5CA 1WTRA 1STAA 3VA5A 2O5IC 4WFN3 4O1NA 1ZKOA 4OHJA 4H13C 5EQ0A 4KKTA 4K14A 1H9KA 4RKBA 3TN2A 3HZXA 4A3KB 1SNMA 1Q1BA 3JAME 1SNCA 3GTQB 2EYOA 3J81L 1IW7C 4IFDI 1ENAA 3A8IE 1IHZA 2L1BA 4RGNA 2F0WA 3I4MB 2F0VA 4A3IB 1I6VC 2K7VA 5JVG3 1EFID 5C44B 1S5DD 1GJXA 4I65A 3SK8A 5KYLA 2X69A 4FP5D 4DF7A 2BA0A 1I4PA 4RGTA 2EJGC 4QF4A 3TBIB 1SMYC 2PQEA 3M4OB 1TY2A 4A3GB 2OT2A 3D6WA 1KDAA 4RCOA 1MD2D 2A6HC 5C3EB 2OF1A 4R8IA 1EIHA 3J7YW 2SDFA 5EBDA 3AMUA 5KNDA 4N9PA 2NYZD 1JWSD 4DNRB 5CGKA 1PRTB 2KCNA 4MHEA 3G7LA 1STEA 3A56A 1SYBA 2BCOA 3GD7A 2KVMA 3PV0A 3TZDA 1KDBA 2K5WA 2M2LA 1LTBD 2QCPX 2AUJD 5IGCA 2A74C 3K5MA 1STBA 3HOUB 3SK5A 5KNBA 4OIJA 4CHTB 4XYOA 2JA7B 1PRTD 1PTOF 1TIID 2E76C 2WKCA 1CHQD 4C2MB 1RDPD 1ICWA 3I73A 3W2DA 3C46A 2A6ED 1MSGA 2KEEA 1SYGA 2TMPA 4ME5A 2G9HD 3Q0AA 1TWHB 2AWNA 5I6WA 1C8CA 1NCVA 1ESRA 2DY8A 5IT9E 4BY1B 1LT5D 1D5XC 2LY7A 3A55A 4NKLA 5NUCA 3OMGA 1VMCA 3H6MA 2WP8J 1V43A 1RTNA 5K36H 3TSSA 2M9VA 1E2WA 4B08A 2B2UC 1Q1EA 1B53A 1LV9A 1EY0A 3SK6A 3R3OA 1DOLA 1BXTA 4OL7A 1BF4A 4DFAA 1DM0B 2N88A 3N52A 1A3UA 2EXZA 5KRUA 1Q90A 1EY8A 1GHKA 1TS4A 1TWGB 1NR2A 1I4QA 1Y8OB 5JPNC 1IKMA 5C6AA 2NVQB 1LT6D 2PZWA 1QG7A 2ZXOA 3NWTA 4OO1H 3EFXD 3RUZA 1JWMD 1ZYRD 4J1MA 1EWHA 1I50B 1CQVA 2D9UA 2FMMA 1KDCA 1ML0D 4DA2A 3I70A 3NHHA 2Y0SB 1BUVT 1AZPA 2ICEC 4KI0A 3D4RA 1CZWA 1D1IA 1EY5A 1EEFD 1LT4D 1EQTA 4Z9CB 3MFYA 1UEAB 1SE3A 2KEDA 4CGYB 3C2PA 5CYUA 2B2WA 1W6KA 3K5OA 4K6LA 1IL8A 4EVOA 4G57A 1CZGA 1EU3A 1Y1VB 5CV9A 1FD7D 1CHPD 3LWUA 1BCPC 2R93B 4NP5A 4XT1B 4ABNA 3T13A 1JCKB 4FF3A 5T1IA 3OOCA 4J8QA 2EYFA 1PFMA 2F0OA 4RWSC 1R4QB 3LNNA 4FF4A 2VXWA 4RAUC 1WCMB 2SNMA 2F03A 3K58A 1RJTA 4WRDA 3VR6A 3N6RA 3HGBA 1R4PB 1FGBD 4A3FB 5C5MA 1I6HB 4DAPA 1RD9D 5EBCA 5J22A 3GQBA 1O7LA 1HRJA 3RLFA 2CW0C 4ULLA 1HCZA 2PZTA 2NVYB 5ELFA 5AFWA 3KBXA 2JE6I 2NVXB 5M3FB 3BS1A 2K6AA 5M3MB 1EZ8A 2L55A 1UNSA 4DNTB 3BVZA 5EPJA 4IQZA 5C0XJ 2E2DC 4DK0A 3PUYA 1CK1A 1MI2A 4HSPA 4XXEA 4DGZA 4CJ0B 3NQTA 4KY6A 3TP8A 5FK9C 2B63B 2Z8LA 1PYWD 3T51B 3T56B 1SYCA 3J80E 2QKIC 2F3VA 3DWQA 4HMJA 2RVLA 3IFDA 5ELDA 3QG1A 1A15A 1HFGA 3FPUB 2JA6B 3VR2A 5BN3A 3WOFA 5M5YB 3BDLA 1L0YB 4KJOA 3MFGA 4ODGA 5FO8B 2KJXA 1Y1WB 2IJ0A 3OWFA 4IUUA 4M8AA 5FO9B 2L5TA 1HPCA 4IALA 4V190 2L12A 5C0XH 4C3HB 5ELCA 1V1PA 2L4NA 2ZXPA 1PZID 1F2ZA 1Z47A 3NTIA 3LWEA 3U9OA 2RBMA 2EYJA 3H0GB 1S5BD 2AWOA 1EYDA 5M5XB 2E2JB 5A2QE 2JYOA 2SOBA 3PIO3 3KLSA 2F0UA 3GTLB 2E75C 5LL6S 5IGGA 3VYSA 2Z1CA 3BDOA 2KA7A 1F9QA 3D8GA 3MA2B 4M1UB 2F0MA 4KTAA 1WTQA 1GUTA 4OO1G 2EYPA 2KUMA 1D2BA 2K5DA 3OSOA 2WACA 1STGA 4HEDA 1I3QB 1C48A 5E3FA 2J4XA 3FKIB 1Q8IA 4QB4A 2IX1A 2RQXA 1MGSA 3HOWB 4G7OC 4KHVA 3S14B 2MGSA 2A69D 2KCCA 3MZ5A 1EY6A 2XNAC 3SK4A 1ET9A 3SEBA 1G91A 4FXDA 1GUOA 5DM63 2AQ3B 4RGOS 4FNFA 1KNAA 3GV6A 2XVSA 4K5VA 4JK1C 1GXDC 1FNWA 2XRQD 2WKDA 5IGBA 1PLFA 1F9RA 1Y8NB 5JJZA 1HUMA 1BR9A 4BA2I 4FYDA 4F8MA 3ZYYX 3VYRA 3WDNA 5D3DA 1GUSA 3CHBD 1PDQA 3KBGA 3HOYB 1JE4A 2X6GA 1D5ZC 1XXGA 1NAPA 2PMZB 1SAPA 2G9DA 4BBRB 2F0TA 2E74C 3PUWA 4RHSA 2B39A 1X3PA 3AU7A 4HAEA 3IFTA 1B9NA 3QWNA 3HOXB 3S9WA 1F77A 3K57A 4ZAIA 3TP6A 4NMZA 1NR4A 4ZLTF 1PFNA 2RA4A 1NUCA 2F0GA 4TRDA 4TQUS 1TWCB 1TQOA 2B2VC 2IX3A 2WAQB 1KLGD 4Q5VA 1XTCD 3TMEA 5FLXE 3S15B 2EJFC 3FEWX 2IX0A 1AP0A 3DUZA 4PV1C 3P20A 2MUYA 1CA6A 2A5HA 2RDFA 5CR3A 1PTOH 5T1GA 3MXPA 1ILPA 1T5XD 1B3AA 2EVBA 3DXJC 2DY7A 3VR3A 2K5QA 3SHLA 5EPKA 2R92B 2FMCA 5COYA 3HS0C 1F2YA 5EKIA 2PYKA 3I3CA 3URYA 3GTGB 1DJRD 2NZ1D 1RF2D 2R3ZA 3U9SA 3DEOA 3EVQA 4RFBA 3K5NA 3NP8A 1WD0A 3RZOB 2DNCA 3M7NA 4XIGS 3CU7A 5C0XG 4TKOB 1B1ZA 4HCSA 2VNUD 1YNNC 4RKLA 3MTSA 5D65A 2Q8TA 1EQVA 4K8JA 1STYA 2B2YA 1LTTD 1EU4A 1ZEQX 2CQAA 2NTTA 5J39A 2H4OA 3BZDB 1WTVA 5FO7B 3OWEB 5IGEA 5I4DA 2EYHA 1SE2A 2HQEA 2M00A 5EGTA 2J7ZA 4NDXA 2LKVA 1SSOA 1L0XB 2QILA 3HP3A 2PNRC 1LTGD 1LTRD 4PMCA 1JWUD 2NN6I 4FVMA 1UAPA 4IUPA 1J8IA 1LLRD 3F2UA 2HDMA 2B2TC 1WTOA 1B2TA 3SR1A 2EZVA 2E2IB 2BDNA 4QUFA 3H94A 3KF8A 4EGVA 5FKAC 2X6LA 2NVTB 4DK1A 2MJ8A 3JAML 2EYMA 4CKCA 1DONA 4RCNA 2XIWA 3NBHA 1MBYA 3MAQA 4ID6A 3T53B 1PTOC 2NUCA 5KYIA 1Y8PB 3NWSA 4BY7B 3NSWA 1OXVA 3SDZA 2HCCA 3TP5A 3K7AB 1XYIA 3IAYA 2K1BA 1B44D 4R8NA 4CJ2C 5LL6X 5HURA 4K2KA 5M9OA 2AQ2B 2R61A 1HA5A 4QCLA 2K04A 1D1KA 1W6JA 1TS5A 5JOBA 3FVQA 2YYZA 3WOEA 1AZQA 5IGDA 1V1OA 4G7HC 3TP7A 3P7JA 4C1NK 4KY5A 2F0SA 2WV6D 1H9RA 2F1MA 5CV5A 2D62A 2PW7A 1BNZA 4IN3A 5D14A 4X3TA 1F9PA 3OMCA 3KLRA 4PQXA 1DOKA 2K33A 3ND9A 1TS3A 1OXXK 1TVXA 2QDBA 5BN5A 4MIUA 2EDGA 2BA1A 2MPMA 4C3HG 4NW2A 5IODA 5I6YA 1JOQA 1SNQA 3D31A 3G6JB 3ONAB 4P2CB 5IT9L 4PMBA 4FF2A 2K01A 2QEJC 3GO5A 2L9HA 5C3WA 1TWFB 4EQNA 1WTWA 3BDCA 3EA6A 3FDTA 5CV7A 4K6DA 5TSSA 2EY1A 4ZQ3A 4F87A 4V0BA 1J9OA 1BO0A 4F88A 4C3JB 1SMYD 4FF1A 1RTOA 4ZRZA 1NSNS 1CFMA 5I9PA 3S2DB 5KEEA 1KLUD 5JPMC 2A6HD 4LJZC 1TS2A 4H0LC 1EYAA 4BBSB 4B9XA 3HEJA 1Q3LA 1V1PB 1STNA 5EKLA 5JEAJ 2JSOA 4B9WA 2O5JC 3SXHA 3PUZA 2VUMB 2LMCB 4PNYA 1PRTF 4XQJA 4IFDJ 1VDZA 5ELBA 5D3IB 2EY2A 4OO1I 1XX8A 3OPOA 2OEOA 5E4XA 1U4LA 2XRSD 1JR0D 4KKSA 4WJWA 3GTPB 2D2CC 3BG3A 4CKEA 4A3EB 2EE1A 2F4IA 2QF7A 4CBVA 2EYLA 3K6OA 4XQNA 2EY6A 2BE5D 4ZK9B 2H1EA 4FXKC 1SBBB 5EPLA 4FO2A 4X3SA 1X32A 5C4HA 1HQMC 1PRTC 1TU2B 4DU9A 1SYEA 5JEAH 2IT1A 1DYQA 1QB5D 3GV3A 4UDUC 1DZ1A 4RH6A 3S16B 2MP1A 2A6EC 4TSSA 1R9TB 5KGUA 4DXGA 1SFOB 5C4XB 4K8IA 2D5DA 1SNOA 2GA4B 2A68D 2JEBI 2A73B 5J1ZA 2R6GA 3A7AB 3J81E 5CORA 2RDGA 2XWJB 5DM73 4DAVA 5G3LD 1PZKD 1S4ZA 1KTKA 2WIIB 2B2UA 2C9OA 3I72A 1G8ZD 5ELEA 5C4ZA 4EQOA 4RHRA 1EYCA 3W3AA 5EKKA 1TT2A 1F2LA 5ISRA 1QOHA 3PIP3 2I46A 3C1EA 4AYBB 2KOLA 2HDLA 2PZUA 1CTMA 1WTXA 2FJ2A 4HR7B 1BQQT 1H9MA 3KUPA 3E0JA 4G4KA 1EL0A 4HSVA 1G2SA 3NPPA 4X3KA 3J80L 4YIJA 1BCPB 2IPKD 2XSCA 1HTPA 4U68A 1MSHA 3I90A 1RHPA 1B4OA 1ZYRC 4LMQD 3QIAA 3DWAA 3GP7A 4JBWA 1B9MA 4BWGB 1VF5C 3L3OC 3AB9A 5IIFA 4X3UA 2F0JA 5CBEE 3I8ZA 1SDFA 2FINB 1SYDA 1U9RA 3QO2A 1JB3A 2B2WC 2ICIA 1M8AA 2EJMA 1HUNA 1BCPD 2HCIA 3DWPA 5M5WB 4IUVA 3CRKC 4C3IB 5BN4A 1C4QA 5KIXA 1CA5A 5E1FA 1JICA 4C56C 3VR4A 1IYVA 5A2QL 3I4LA 1QWYA 1AEXA 5C4JB 5C0XI 2B8FA 3PO2B 3SVMA 2Q8IB 3TZUA 3S1NB 4S3SA 3C3LA 2IL8A 2LS01 4LAAA 1CI3M 1I4XA 1PXUA 4OGQC 4IZ8A 1LTID 4IURA 1BBXC 1A3TA 3PUXA 2CW0D 5DAUA 3P75A 1PFBA 2BDOA 3C1FA 1YNJD 1A2TA 4A3MB 3CRLC 2JEAI 2JXMB 4DN4M 5IOCA 5JAVA 3A8JE 1GHJA 1O7YA 3QB3A 1EWCA 1RCVD 1D6EC 1HTLD 1KAAA 3FPPA 1PZJD 3BVGA 1LTAD 5I9OA 1SXTA 3RMHA 2L11A 1LT3D 3E5SA 5DNFA 1H9JA 1EIGA 1IYUA 2CVRA 3NTHA 5LHY1 3L9AX 5JEAG 4CKBA 2DNEA 1U4MA 4BA1I 2FHTA 3T4AC 3KK7A 4KN4C 5IGFA 4FXGC 4IFDG 1EZ6A 1T5EA 1ILQA 3CQZB 1O80A 2SEBD 3MXGA 3DEPA 4H7BA 3UI2A 1E0BA 3QJYA 3HRZC 4UAIA 4ZKCB 3NTKA 4KMUC 1G2TA 3IL8A 2EOTA 1UUPA 3A8KE 3MWYW 4K5WA 2CHBD 1QILA 3S2HB 4R9WA 3K0YA 4O42A 3A54A 5F2DA 1CQFA 5G3LF 2BE5C 2K32A 1OXUA 3DMUA 3DHQA 1F2MA 5FLXL 2JA5B 2HUGA 3EROA 1TR5A 3ITPA 1I4HA 1LACA 3K59A 4MN3A 3M3YB 2R7ZB 2JA8B 4XT3B 1WVLA 3GTMB 1TKWB 4A93B 1XWEA 1TY0A 2A68C 1QE6A 1HFNA 3D4DA 2RSNA 1JQYD 1SNDA 3NXWA 2E2HB 1OXTA 2RKSA 1Z7TA 4C3JG 1U4RA 2F3WA 4QUCA 3GTJB 4L63B 3FMCA 4RA8A 1EY7A 4L6TB 3V96A 1RKNA 3VYUA 1QCBD 4QMGA 5C5LA 3GTKB 4GZYC 2F0IA 4L8JA 1ZXTA 3EQLC 2NN6G 2F0DA 2A69C 1HXYD 2OXPA 2K05A 4G7ZC 2F0HA 2MHVA 3H91A 3K5LA 2PPBC 3VYTA 3QOJA 4U673 3DM1A 3RD4A 1WD1A 4A3BB 2J0TD 1BCPF 1GUGA 2NTSA 1EY4A 4HCEA 5A35A 2XWBB 2EPBA 3O13A 2N55A 1ENCA 4N9TA 3CKIB 1Z6HA 4KJNA 1KABA 3NK9A 3KLSX 1OXSC 2VB2X 1V8QA 1F9SA 1G291 2ZXRA 1SYFA 2WB1B 4Y7NB 4A3JB 2NB0A 3M85A 3HOZB 4E6IA 3NBIA 1TWAB 3H3VC 3TDQA 3MEHA 2DN8A 1LTSD 2BOSA 1M4VA 2K03A 1STHA 4XDXA 3FRPB 1GUNA 2PO4A 3HG9A 1IW7D 3J7AF 1EOTA 3OIPA 2F0PA 2IW3A 2KQ3A 4HMIA 4KKUA 1DOMA 2B2VA 2AQ1B 3HOVB 1DXMA 3I91A 3D4WA 3R93A 2B8GA 2IWHA 1Y69U 1X3QA 4A3DB 3BYTB 4DAYA 2LFNA 4XTCS 2XN9C 4KK7A 3MVVA 3V05A 1QNKA 2ID0A 3ERQA 1AN8A 1E2ZA 1KNEA 2RSOA 5EJWA 4K5XA 1YNJC 1FR3A 1EEID 3QOLA 2O2LD 1YNND 1SJED 2VB3X 1CT1D 3NUCA 2Z4IA 4EQPA 2YU9B 4C1NI 4KV6A 4KD3A 1II3A 4K2LA 3M7GA 1BOSA 1JOKA 4XQQA 1K8MA 3RZDB 3S1QB 1JOOA 4BS9A 1I4GA 3VA7A 1HHVA 2TSSA 1ET6A 1S5CD 5K5PA 3Q24A 1SJHD 3MC0B 2B2YC 4KN7C 4RGMA 3R2IA 3L7ZC 1QJOA 1SEBD 1I4RA 4HN7A 1AW7A 3S1MB 5KNCA 4WORA 1OO9B 3D3RA 5I2XA 2KHSA 3H09A 4QIWB 3P1HA 4IUTA 3V2TA 2F0FA 1FNUA 1O7ZA 4ILWA 1PTOB 1D5MC 1K83B 2F0QA 3ND8A 4KHZA 1SNPA 3PUVA 4PMWA 2Q8RE 1Q12A 4LK1C 1JORA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CBA E;  4IUV A;  3R93 A;  2RVL A;  1AP0 A;  1VMC A;  3IFD A;  4RA8 A;  5COR A;  1X3Q A;  1A15 A;  1HFG A;  5E4W C;  1CA6 A;  2FFK B;  3Q6S A;  3FPU B;  1ILQ A;  1CA5 A;  1RTN A;  1O80 A;  3D6W A;  4IUP A;  1JIC A;  1Q3L A;  1J8I A;  5T1G A;  3DEP A;  3F2U A;  1ZXT A;  5D14 A;  1BNZ A;  1G91 A;  2HDM A;  2B2T C;  1WTO A;  4XT1 B;  1S4Z A;  1DON A;  4X3T A;  3UI2 A;  1B2T A;  1F9P A;  1ILP A;  2B2T A;  2B2U C;  1E0B A;  4R8I A;  1QNK A;  1B3A A;  1EIH A;  1B53 A;  1LV9 A;  2BDN A;  1IKL A;  2B2U A;  2DY7 A;  2K05 A;  2SDF A;  4QUF A;  1CM9 A;  5T1I A;  3SVM A;  4UAI A;  3H91 A;  2KEC A;  1KNA A;  4ZKC B;  2NYZ D;  2X6L A;  3GV6 A;  1DOK A;  1KNE A;  1PFM A;  1DOL A;  2RSO A;  4RWS C;  1G2T A;  2IL8 A;  2MJ8 A;  4IUU A;  3IL8 A;  5EPK A;  1BF4 A;  1HA6 A;  5COY A;  4MHE A;  2N88 A;  3DM1 A;  2VXW A;  3N52 A;  4RAU C;  1ROD A;  2NWG A;  5EJW A;  4CJ1 B;  3G7L A;  2EOT A;  1VMP A;  1WD1 A;  5EKI A;  3MWY W;  4IUR A;  2XIW A;  1BBX C;  1TVX A;  2KVM A;  2L12 A;  1PLF A;  3I3C A;  1F9R A;  3TZD A;  2M2L A;  1PFB A;  1XX8 A;  5JJZ A;  1RJT A;  1NR2 A;  1U4P A;  2L4N A;  1HUM A;  2EPB A;  2NZ1 D;  5E4X A;  2R3Z A;  2N55 A;  1F2L A;  4R9W A;  1U4L A;  1WTR A;  4QUC A;  2MPM A;  3DEO A;  5CMD A;  1IKM A;  4O42 A;  3LWE A;  1PDQ A;  4NW2 A;  1B50 A;  2KOL A;  1WD0 A;  1JE4 A;  2X6G A;  5EQ0 A;  1HRJ A;  2HDL A;  1QG7 A;  2JYO A;  1NAP A;  4DN4 M;  2HCC A;  1SAP A;  1WTX A;  1F9S A;  4IUQ A;  5AFW A;  3KBX A;  2EE1 A;  2FJ2 A;  4HCS A;  1XYI A;  4OIJ A;  3ONA B;  3KUP A;  1EL0 A;  4HSV A;  2K1B A;  3TN2 A;  1G2S A;  1HHV A;  4CJ2 C;  4X3K A;  1O7Y A;  3MTS A;  2K01 A;  5D65 A;  2Q8T A;  4ZK9 B;  2H1E A;  1X3P A;  1F9Q A;  2B2Y C;  2K28 A;  2L9H A;  2HUG A;  2JP1 A;  4HAE A;  2B2Y A;  1ICW A;  2D9U A;  2FMM A;  5EPL A;  5EPJ A;  1ML0 D;  1WTQ A;  4X3S A;  4U68 A;  2K04 A;  1MSH A;  1X32 A;  1RHP A;  3I90 A;  1B4O A;  4ZAI A;  1WTW A;  2KUM A;  1AZP A;  4LMQ D;  4MN3 A;  2K03 A;  1MSG A;  1MI2 A;  3FDT A;  4XDX A;  1NR4 A;  1GUW A;  4ZLT F;  1WTV A;  2L1B A;  4XT3 B;  1WVL A;  1WTP A;  4HED A;  3GV3 A;  2L11 A;  1J9O A;  1EOT A;  2KEE A;  1BO0 A;  5DNF A;  1PFN A;  4X3U A;  4ZKB B;  4CJ0 B;  2RA4 A;  5CBE E;  1EIG A;  1EQT A;  1AZQ A;  3I8Z A;  4IUT A;  1DZ1 A;  1G6Z A;  1SDF A;  1O7Z A;  2B2V C;  2FIN B;  2J7Z A;  3QO2 A;  1DOM A;  1QE6 A;  1RTO A;  2KED A;  2B2V A;  2CVR A;  1HFN A;  3P7J A;  2MP1 A;  2RSN A;  1C8C A;  2B2W C;  1MGS A;  1SSO A;  2X69 A;  1NCV A;  1ESR A;  1M8A A;  2DY8 A;  1HUN A;  3HP3 A;  2MGS A;  2HCI A;  2B2W A;  1U4M A;  2Q8R E;  4OIK A;  2FHT A;  3I91 A;  1IL8 A;  1U4R A; 
#chains in the Genus database with same CATH topology
 5K36 G;  1AH9 A;  3GTK H;  3BYY B;  1Q7Y C;  1A6X A;  1BDO A;  3PQI A;  1DCZ A;  2FFK B;  2L0C A;  3MXU A;  4KY7 A;  1H95 A;  3OHX C;  1A8V A;  1DD2 A;  5HGT A;  4JI0 L;  1EY9 A;  3M4Y A;  3PF5 A;  4HTH A;  1LO5 D;  5IP9 G;  1VQD A;  3MXN A;  3IKJ A;  4C3I G;  4IFD H;  2B2T A;  5CV6 A;  3MHB A;  3PMF A;  1IKL A;  2IY5 B;  1A3V A;  4ZYS A;  1CM9 A;  1X56 A;  2KEC A;  3J80 i;  3GTO B;  1PTO D;  2EY5 A;  3AYH B;  3SE0 A;  1O78 A;  1SE4 A;  3CCS A;  3E6Z X;  1E2V A;  2F0L A;  2SNS A;  3ULP A;  2NWG A;  5DEH A;  3PO2 G;  2PW5 A;  2EIF A;  3EJI A;  2LXK A;  1ONL A;  2OTL A;  2ZT9 C;  2AUK A;  4APV A;  2RDH A;  4LFC Q;  4L5S A;  2OWO A;  3S1R B;  4PZ7 A;  1A2U A;  1HJP A;  2MO0 A;  1VF7 A;  5CMD A;  1LM0 A;  5FLX c;  1LAB A;  1FJG Q;  3Q22 A;  2VL6 A;  4DR4 Q;  1Q81 C;  1B50 A;  2ENB A;  4F7X A;  1K8O A;  3HKZ B;  1X3E A;  4IUQ A;  1H9S B;  1S5F D;  2I07 B;  4A3M G;  1JT8 A;  5CV8 A;  3HOZ H;  1AFP A;  1VCI A;  3OIQ A;  1PMR A;  3VR5 A;  4I7Z C;  1FNV A;  2K28 A;  4K0K Q;  1VQ6 A;  2JP1 A;  2AMC B;  2UXD L;  4P74 A;  3QR8 A;  3NQI A;  2PCF B;  3Q23 A;  3RNU A;  2P5Z X;  1GUW A;  2F0N A;  5GAH C;  1KD1 C;  4H44 C;  1WTP A;  3CC4 A;  1W3S A;  4ZKB B;  4NXM Q;  1YIJ A;  1GOZ A;  1JC7 A;  1G6Z A;  4GOP A;  4IPC A;  3BVM A;  1TWF H;  3D6C A;  3R2T A;  3HKS A;  2F0E A;  5JVH 3;  4CDD C;  1FYC A;  2YTX A;  1XMQ Q;  1WFQ A;  5I2Y A;  4LF9 Q;  4OIK A;  5CV4 A;  1IBK L;  5CBA E;  1HQR D;  5C3X A;  4ZUJ A;  3ULJ A;  3I4N B;  4A3D H;  4IUN A;  2F4V L;  1S5E D;  5E4W C;  2I5L X;  1K3B C;  4ZUI A;  4C3J H;  3Q6S A;  3R8B A;  3NE5 B;  1H9S A;  4J6H A;  2Z4H A;  1N34 L;  4Q0F A;  2F0K A;  3S2D H;  4KD4 A;  3X3M A;  4DXF A;  2ALY B;  1ENF A;  5FOB B;  3BU2 A;  3S17 B;  2NN6 H;  1ESF A;  1K8G A;  3T16 A;  2L15 A;  5CC4 A;  3PO3 B;  2O4X A;  1QNU A;  2RHS B;  1HA6 A;  1ROD A;  4CJ1 B;  1VMP A;  3A7L A;  3X3N A;  2V4D A;  3J7A V;  2NBF A;  3LX0 A;  3OW7 A;  2WIN B;  4XYQ A;  1U4P A;  2C5C A;  1WTR A;  1STA A;  3VA5 A;  2O5I C;  2VUM H;  4WFN 3;  4O1N A;  4LK1 C;  2DGY A;  1ZKO A;  4OHJ A;  4H13 C;  5EQ0 A;  1M90 C;  4KKT A;  4DV2 L;  3RN2 A;  4K14 A;  4LFB L;  1H9K A;  4RKB A;  2UU9 L;  1VQH A;  4Y52 H;  3TN2 A;  3HZX A;  4A3K B;  1SNM A;  1Q1B A;  3JAM E;  1SNC A;  3GTQ B;  2EYO A;  3J81 L;  3PGZ A;  4DR7 Q;  1IW7 C;  4JYA L;  3GTP H;  1VQ7 A;  4IFD I;  1ENA A;  2JA5 G;  3A8I E;  4IPD A;  4A3E H;  1RL2 A;  1IHZ A;  1IZ6 A;  4B3T L;  4CDC C;  2L1B A;  4RGN A;  4LWC A;  2F0W A;  3I4M B;  2F0V A;  4QGU A;  3EBE A;  4A3I B;  2R7Z G;  1I6V C;  2K7V A;  5JVG 3;  1EFI D;  5C44 B;  1S5D D;  2JA8 G;  1GJX A;  4I65 A;  3SK8 A;  4H02 A;  5KYL A;  2X69 A;  5GAD C;  4FP5 D;  4DF7 A;  4A93 G;  2BA0 A;  1I4P A;  4RGT A;  2EJG C;  4QF4 A;  4L5R C;  3TBI B;  1SMY C;  2PQE A;  3M4O B;  1TY2 A;  4A3G B;  2OT2 A;  4OX9 L;  3D6W A;  4UP8 A;  1KDA A;  4RCO A;  1MD2 D;  3JAM i;  3NEM A;  2A6H C;  1SE8 A;  5AJ3 Q;  3TQY A;  5C3E B;  2OF1 A;  3GTO H;  4R8I A;  1EIH A;  3J7Y W;  2SDF A;  3OTO L;  5EBD A;  4BXX G;  3AMU A;  5KND A;  4N9P A;  2NYZ D;  3I7F A;  2ZTC A;  1JWS D;  4DNR B;  2CH4 A;  4DR5 L;  5CGK A;  1PRT B;  2KCN A;  4LF5 Q;  5IP7 H;  4MHE A;  3G7L A;  3RLO A;  2C35 B;  3TRE A;  4JI8 L;  1STE A;  2V1C C;  3A56 A;  2A19 A;  1SYB A;  2BCO A;  2Y0S E;  3GD7 A;  2KVM A;  3WWV A;  1M1K C;  3PV0 A;  1ASZ A;  3TZD A;  1KDB A;  2K5W A;  3S1R H;  2M2L A;  1LTB D;  2QCP X;  2CKZ B;  2I5M X;  4DKA C;  2N49 A;  1MJE A;  1CKN B;  2AUJ D;  5IGC A;  1I94 L;  2A74 C;  3K5M A;  1STB A;  2PI2 E;  3HOU B;  3SK5 A;  2DJG C;  3VDY A;  5KNB A;  4JV5 L;  4OIJ A;  4CHT B;  3AQQ A;  4XYO A;  1PYS B;  2JA7 B;  1PRT D;  1PTO F;  1TII D;  3F2D A;  2E76 C;  1YJN A;  5IYD H;  3CCE A;  2WKC A;  4P72 A;  1CHQ D;  3I4O A;  4C2M B;  1RDP D;  1ICW A;  2WB1 G;  1G6P A;  3I73 A;  3G48 A;  5J3B A;  3W2D A;  4RMF A;  3C46 A;  2KHI A;  3RR5 A;  2AHO B;  2A6E D;  1MSG A;  3HOZ G;  4GN4 B;  3OYY A;  2KEE A;  1SYG A;  2TMP A;  3W5O A;  4ME5 A;  2G9H D;  4HIK A;  3Q0A A;  5LMU Q;  5ELO A;  1TWH B;  2AWN A;  2K14 A;  5I6W A;  4JI5 L;  1UE1 A;  1UEB A;  1C8C A;  1NCV A;  1ESR A;  3KLW A;  2DY8 A;  5IT9 E;  4BY1 B;  3T1H L;  2Z9H A;  1LT5 D;  1D5X C;  2LY7 A;  3A55 A;  4NKL A;  5NUC A;  3OMG A;  1VMC A;  3H6M A;  2WP8 J;  1V43 A;  4DV1 Q;  3RN5 A;  1RTN A;  4JC0 A;  4DAM A;  5K36 H;  3TSS A;  1BKB A;  3GDE A;  2M9V A;  1E2W A;  1EIF A;  4B08 A;  2B2U C;  1Q1E A;  5M5W H;  1B53 A;  1LV9 A;  4A3D G;  1EY0 A;  3SK6 A;  3R3O A;  3KDF B;  5IP9 H;  4MTK A;  4C3I H;  1DOL A;  4B3R L;  1BXT A;  4OL7 A;  1BF4 A;  4DFA A;  1DM0 B;  2N88 A;  3N52 A;  3ER0 A;  1A3U A;  2EXZ A;  1CSQ A;  5KRU A;  1Q90 A;  1EY8 A;  1S72 A;  1GHK A;  1HR0 L;  1TS4 A;  1YHA A;  3CF5 A;  1TWG B;  1NR2 A;  5GAE C;  3PO2 H;  4TVA B;  1I4Q A;  4JBK A;  3SGI A;  1Y8O B;  3S1N H;  3RLN A;  5JPN C;  1IKM A;  5C6A A;  2NVQ B;  1LT6 D;  1SRU A;  4X64 Q;  4DV3 Q;  2PZW A;  1QG7 A;  1QUQ B;  3NWT A;  2ZXO A;  4OO1 H;  3EFX D;  3RUZ A;  1JWM D;  1ZYR D;  4J1M A;  1EWH A;  3GTQ H;  4DR1 Q;  1B70 B;  3J81 j;  1K0R A;  2A1A A;  1L1O B;  1I50 B;  4A3M H;  4R4Q A;  1CQV A;  2D9U A;  2FMM A;  1KDC A;  4WJ4 A;  1ML0 D;  1VQF A;  4DA2 A;  2Z6K A;  3NHH A;  3I70 A;  4UP9 A;  2VY3 A;  3K81 C;  2Y0S B;  1BUV T;  1AZP A;  3KDF A;  2ICE C;  4YY3 Q;  4KI0 A;  3D4R A;  1CZW A;  1D1I A;  1EY5 A;  1EEF D;  4A3I H;  1LT4 D;  1UE5 A;  1K73 C;  1EQT A;  5C44 H;  4Z9C B;  3MFY A;  2KEN A;  1UEA B;  3UE0 A;  1GO3 E;  1SE3 A;  2KED A;  4CGY B;  1XMO L;  1B3Q A;  1EWI A;  3C2P A;  5CYU A;  2NZH A;  2B2W A;  1W6K A;  4HJ9 A;  3K5O A;  4K6L A;  1IL8 A;  4MNO A;  3M4O H;  4GKK L;  4EVO A;  1YJ9 A;  4A3G H;  4G57 A;  4POF A;  1CZG A;  4OON A;  2KBN A;  1QUQ A;  1EU3 A;  1QZG A;  1Y1V B;  5CV9 A;  1SRO A;  2VQE L;  1YBY A;  1FD7 D;  1CHP D;  4JPB W;  3LWU A;  1BCP C;  2R93 B;  3DM3 A;  4NP5 A;  4XT1 B;  4LF8 Q;  3U4Z A;  4ABN A;  5IYB H;  4R4T A;  3T13 A;  4CDF C;  1JCK B;  4PZ8 A;  4FF3 A;  5T1I A;  1NJI C;  3OOC A;  4J8Q A;  2EYF A;  1PFM A;  2UXB L;  3H3V I;  2F0O A;  4RWS C;  1R4Q B;  3LNN A;  4FF4 A;  2VXW A;  4RAU C;  3CQZ H;  1WCM B;  2SNM A;  2F03 A;  4N8F A;  2RCN A;  3G71 A;  3K58 A;  4YHH L;  4N8X 1;  1RJT A;  2E8G A;  4WRD A;  3VR6 A;  3N6R A;  3HGB A;  1PH5 A;  1R4P B;  1FGB D;  4A3F B;  5IE8 A;  4LF6 L;  5C5M A;  1I6H B;  5IP7 G;  1K0S A;  2PI2 A;  4DAP A;  1RD9 D;  5EBC A;  5J22 A;  3GQB A;  5BR8 L;  1O7L A;  4LF4 L;  1HRJ A;  3RLF A;  2CW0 C;  4ULL A;  1HCZ A;  3ERS X;  1E1T A;  2PZT A;  2NVY B;  3J81 c;  5ELF A;  1GM5 A;  5AFW A;  3KBX A;  4MTN A;  2JE6 I;  2NVX B;  5M3F B;  3BS1 A;  2K6A A;  3S2H H;  5M3M B;  4POG A;  1EZ8 A;  1VQN A;  3HKZ G;  2L55 A;  1UNS A;  4DNT B;  3BVZ A;  1GVP A;  4DR3 L;  1VQB A;  5EPJ A;  4IQZ A;  2UUA L;  2B29 A;  5C0X J;  2E2D C;  2Q2T A;  5FLM H;  4DK0 A;  3PUY A;  1CK1 A;  1MI2 A;  4HSP A;  1N32 Q;  4XXE A;  1EIY B;  4DGZ A;  1XNR L;  5GQO A;  5IYD G;  4CJ0 B;  1CUK A;  3NQT A;  4KY6 A;  3TP8 A;  1SMX A;  3MXN B;  5FK9 C;  3F2B A;  3A74 A;  4DV0 L;  2YTV A;  2B63 B;  4BY1 H;  2Z8L A;  1PYW D;  3T51 B;  3T56 B;  1SYC A;  3E9H A;  1X3F A;  3KFU A;  3J80 E;  2QKI C;  2F3V A;  2R7F A;  3DWQ A;  2JA8 H;  4HMJ A;  2RVL A;  3IFD A;  5ELD A;  3GTM H;  3QG1 A;  2OTJ A;  1A15 A;  1HFG A;  1VQ4 A;  3FPU B;  2JA6 B;  3VR2 A;  5BN3 A;  4A4I A;  1A62 A;  3WOF A;  5M5Y B;  3I4N G;  3BDL A;  1L0Y B;  2E2H H;  4LFC L;  4O2D A;  4IPG A;  4KJO A;  4YWK A;  3MFG A;  4ODG A;  5FO8 B;  1PH7 A;  2KJX A;  4GNX B;  3GTJ H;  3PF4 A;  1Y1W B;  1FJG L;  2IJ0 A;  3OWF A;  1JB7 A;  4IUU A;  1EQR A;  4M8A A;  5FO9 B;  2L5T A;  1HPC A;  4BXX H;  4IAL A;  4V19 0;  1TWG H;  3CME A;  2L12 A;  4X62 Q;  5C0X H;  4C3H B;  1Q82 C;  5ELC A;  1YI2 A;  1V1P A;  2L4N A;  1IL2 A;  3U58 A;  2A8V A;  2ZXP A;  2NVQ H;  1PZI D;  1N33 Q;  2GN5 A;  1F2Z A;  1Z47 A;  3NTI A;  3LWE A;  3U50 C;  3U9O A;  2RBM A;  2EYJ A;  3H0G B;  1S5B D;  1A63 A;  2AWO A;  2WAQ E;  1EYD A;  5M5X B;  2E2J B;  3J7Z C;  5A2Q E;  2JYO A;  2SOB A;  3PIO 3;  4A75 A;  4A3B H;  3KLS A;  4P73 A;  2F0U A;  4X65 Q;  3GTL B;  4DR2 Q;  2E75 C;  3T1Y Q;  5LL6 S;  5IGG A;  4GOP B;  3VYS A;  2Z1C A;  3BDO A;  4NXM L;  2KA7 A;  1F9Q A;  2ZTD A;  3D8G A;  3MA2 B;  3KYH C;  2F0M A;  4KTA A;  4M1U B;  1WTQ A;  1GUT A;  4OO1 G;  2EYP A;  1QVG A;  1XNQ L;  1XMQ L;  2KUM A;  1JE5 A;  4GNX A;  1D2B A;  3FHW A;  1N8R C;  2CWP A;  2K5D A;  3OSO A;  2WAC A;  4Y7N H;  4A3J H;  1STG A;  1IXR A;  4HED A;  1I3Q B;  4LF7 L;  1C48 A;  2RHQ B;  1YVC A;  5GAG C;  5E3F A;  1WOC A;  2J4X A;  3EIV A;  1TWA H;  3FKI B;  1Q8I A;  4QB4 A;  2IX1 A;  4X6A H;  2RQX A;  2XTI A;  3I2Z A;  1MGS A;  3HOW B;  4G7O C;  4KHV A;  1S40 A;  3S14 B;  2MGS A;  4LUO A;  2A69 D;  4A3I G;  4JCV E;  2KCC A;  3MZ5 A;  5C44 G;  1EY6 A;  2XNA C;  3SK4 A;  4QY7 A;  1ET9 A;  2R93 H;  2UXC L;  3SEB A;  2MNA A;  4GN5 A;  2ASB A;  1G91 A;  4JI4 Q;  4FXD A;  1VQL A;  3HOV H;  1GUO A;  5DM6 3;  4RG1 A;  2AQ3 B;  4A3G G;  4RGO S;  4FNF A;  4UHV A;  1KNA A;  3GV6 A;  1WYD A;  4LNQ A;  2XVS A;  2RF4 A;  2K4K A;  4K5V A;  4JK1 C;  3J81 i;  4OWT B;  4NXN Q;  1GXD C;  1FNW A;  4KHP Q;  2XRQ D;  2YTY A;  2WKD A;  5IGB A;  5IYB G;  1PLF A;  1F9R A;  2OCE A;  1IBL Q;  1Y8N B;  5JJZ A;  1HUM A;  1BR9 A;  4BA2 I;  4FYD A;  1Y14 B;  1HNZ L;  4F8M A;  3ZYY X;  3VYR A;  3WDN A;  5D3D A;  1VQG A;  1GUS A;  4DR6 L;  3CHB D;  1PDQ A;  4DR7 L;  1J6Q A;  3CC2 A;  2NVY H;  3KBG A;  1GD7 A;  4GLA C;  3HOY B;  1JE4 A;  2X6G A;  1D5Z C;  4I7A A;  1XXG A;  1PH6 A;  1NAP A;  2PMZ B;  2NVX H;  5M3F H;  1SAP A;  2G9D A;  4BBR B;  3BZC A;  4DV4 Q;  3DLL A;  2F0T A;  2E74 C;  4DV6 L;  3PUW A;  4RHS A;  5HY6 A;  2B39 A;  1X3P A;  1KL9 A;  2YU9 H;  3AU7 A;  3HOU G;  4HAE A;  2ATW A;  1PH1 A;  3IFT A;  1B9N A;  3QWN A;  3HOX B;  3S9W A;  1F77 A;  3K57 A;  4DUY Q;  2JA7 G;  4ZAI A;  3TP6 A;  4NMZ A;  3RZD H;  3S1Q H;  1NR4 A;  4ZLT F;  1XPR A;  2KCM A;  1PFN A;  2RA4 A;  4DV7 Q;  1NUC A;  2F0G A;  2MFI A;  4JOI C;  4TQU S;  4TRD A;  1TWC B;  1TQO A;  2B2V C;  2D0P A;  4R4C A;  2WAQ B;  2IX3 A;  1KLG D;  4Q5V A;  5FLM G;  2VW9 A;  5AJ3 L;  4B3M Q;  1XTC D;  4YWL A;  3TME A;  5FLX E;  1VQO A;  3S15 B;  2EJF C;  3FEW X;  1VQK A;  3S1M H;  4JI3 Q;  2IX0 A;  4JBM A;  1AP0 A;  3DUZ A;  4PV1 C;  4LF5 L;  3P20 A;  2MUY A;  4GN3 B;  1CA6 A;  2A5H A;  3G4S A;  5M5Y H;  2Q2H A;  4BY1 G;  2RDF A;  1VQM A;  5CR3 A;  3CCL A;  1PTO H;  5T1G A;  1K83 H;  3MXP A;  4P75 A;  1ILP A;  1T5X D;  1B3A A;  2EVB A;  3DXJ C;  2DY7 A;  3VR3 A;  2K5Q A;  1VS0 A;  3CAM A;  1VQE A;  1VQ8 A;  1YHB A;  2K52 A;  3SHL A;  5EPK A;  2R92 B;  2FMC A;  3PCO B;  5COY A;  3HS0 C;  1F2Y A;  4C3H H;  5EKI A;  3TS0 A;  1HNW Q;  2PYK A;  1JJG A;  3I3C A;  3URY A;  3GTG B;  1DJR D;  4JG2 A;  1YNX A;  2NZ1 D;  1RF2 D;  3STB D;  2R3Z A;  3U9S A;  5M5X H;  3DEO A;  3EVQ A;  4RFB A;  4LFA Q;  3K5N A;  2HHH Q;  3NP8 A;  1WD0 A;  3RZO B;  2DNC A;  3M7N A;  4XIG S;  3CU7 A;  5C0X G;  4LFB Q;  2Q2I A;  4TKO B;  1B1Z A;  4HCS A;  2HIX A;  3W1G A;  2VNU D;  1YNN C;  1Q86 C;  4RKL A;  2G5D A;  3MTS A;  5D65 A;  2Q8T A;  5LMU L;  1HZC A;  5JJL A;  2BH8 A;  1AE2 A;  1EQV A;  4K8J A;  1STY A;  2B2Y A;  3KF8 B;  1MIU A;  2QW7 A;  4A3B G;  1Q46 A;  1LTT D;  1EU4 A;  1ZEQ X;  2CQA A;  2NTT A;  5J39 A;  4B3T Q;  2H4O A;  3BZD B;  1WTV A;  5FO7 B;  3OWE B;  5LMN L;  5IGE A;  5I4D A;  1L2F A;  2EYH A;  1SE2 A;  4R1J A;  3ICE A;  2HQE A;  2M00 A;  3FKI H;  4DV1 L;  2Y0S G;  1VQJ A;  5EGT A;  4GLX A;  2J7Z A;  1BBU A;  3I56 A;  4NDX A;  2LKV A;  1SSO A;  2I5H A;  1L0X B;  1FGU A;  2QIL A;  3HP3 A;  4X66 Q;  4A3J G;  4JI7 Q;  2PNR C;  2E5L L;  2D0O A;  3K8A A;  1LTG D;  1LTR D;  2IHE A;  4PMC A;  1IBM L;  1JWU D;  2H5X A;  4R4I A;  2NN6 I;  4FVM A;  1UAP A;  4GKJ Q;  4IUP A;  1J8I A;  1LLR D;  3F2U A;  2HDM A;  2B2T C;  1WTO A;  1B2T A;  3SR1 A;  1KIX A;  4DUZ Q;  2EZV A;  2E2I B;  1Y1V G;  2BDN A;  4QUF A;  3H94 A;  3KF8 A;  4EGV A;  3I4N H;  5FKA C;  2X6L A;  1KXL A;  2R93 G;  4X64 L;  2NVT B;  4DK1 A;  2MJ8 A;  4YCU A;  2EYM A;  3JAM L;  4JI8 Q;  4CKC A;  1DON A;  3IRB A;  4RCN A;  1HZB A;  3HOV G;  2XIW A;  3NBH A;  5JJK A;  1HZA A;  1MBY A;  3MAQ A;  2GVB A;  4ID6 A;  4DR1 L;  4IJH A;  1S3O A;  3T53 B;  1PTO C;  1X3G A;  2NUC A;  3S17 H;  1WCM G;  5KYI A;  3AEV A;  1Y8P B;  3NWS A;  2ZJR A;  4BY7 B;  3PO3 H;  4OWX B;  3NSW A;  4BBR H;  1OXV A;  3SDZ A;  2HCC A;  5IWA L;  2N8N A;  2B3G A;  2LXJ A;  3TP5 A;  4AQY L;  4YY3 L;  1NE3 A;  4A3F G;  2ZM6 L;  2CCZ A;  3K7A B;  1YHQ A;  1XYI A;  4HJ5 A;  3IAY A;  2K1B A;  1B44 D;  2ZJP A;  4R8N A;  4CJ2 C;  5LL6 X;  3CMA A;  3NEL A;  5HUR A;  4K2K A;  3D0F A;  1N36 Q;  5FJ8 G;  1JMC A;  5M9O A;  2AQ2 B;  2R61 A;  1HA5 A;  4OXP A;  4QCL A;  4HJ7 A;  5HGQ A;  5M3F G;  2K04 A;  1D1K A;  1W6J A;  5M3M G;  1TS5 A;  5JOB A;  3FVQ A;  4HID A;  3AFP A;  3B6Y A;  3H15 A;  1T9H A;  2OQ0 A;  4A3K H;  3F1Z A;  4GS3 A;  2YYZ A;  3WOE A;  4GOP C;  1AZQ A;  5IGD A;  2K5V A;  1V1O A;  4DV5 Q;  4G7H C;  3TP7 A;  3P7J A;  4C1N K;  4LF8 L;  2K5N A;  1NBW A;  4KY5 A;  2F0S A;  4UY8 C;  2WV6 D;  1H9R A;  2F1M A;  1VQA A;  2B63 G;  5CV5 A;  3I4M H;  1FL0 A;  2D62 A;  1MKH A;  3MEF A;  2K50 A;  1C9O A;  2PW7 A;  1YZ6 A;  3CC7 A;  1BNZ A;  4IN3 A;  5D14 A;  4L5Q A;  4X3T A;  1F9P A;  3OMC A;  3KLR A;  3J80 c;  2JA6 G;  4B3R Q;  4PQX A;  1DOK A;  2K33 A;  3ND9 A;  4EQ5 A;  1W2B A;  1AE3 A;  1TS3 A;  1OXX K;  4L5T A;  3GTG H;  1KAW A;  1TVX A;  1U0L A;  2QDB A;  5BN5 A;  4MIU A;  2LSS A;  3PSI A;  5C3E H;  2EDG A;  2BA1 A;  2MPM A;  4C3H G;  2VQF Q;  3A5Z B;  4NW2 A;  5IOD A;  4NPS A;  4JI6 L;  4J15 A;  1XPO A;  3PIO A;  5I6Y A;  3G6E A;  1JOQ A;  1SNQ A;  3D31 A;  3G6J B;  3E9I A;  3ONA B;  4P2C B;  3H0G G;  1UE7 A;  5IT9 L;  4PMB A;  4FF2 A;  1E1O A;  2K01 A;  2QEJ C;  3GO5 A;  4IPH A;  2L9H A;  5C3W A;  3F2C A;  1TWF B;  4EQN A;  4WJ3 M;  2EXD A;  1WTW A;  1WJJ A;  3BDC A;  3EA6 A;  3HOU H;  4AH6 A;  3FDT A;  4ME3 A;  5CV7 A;  1X9N A;  4K6D A;  5TSS A;  2EY1 A;  4ZQ3 A;  2JA7 H;  4F87 A;  4V0B A;  1J9O A;  2BH2 A;  1BO0 A;  3AFQ A;  4F88 A;  1NMG A;  3HKZ E;  4C3J B;  2UUC Q;  1SMY D;  4C2M H;  4LUV A;  4FF1 A;  1RTO A;  4ZRZ A;  1NSN S;  1CFM A;  4JI2 Q;  5I9P A;  3S2D B;  4IJL A;  1K9M C;  1EQQ A;  5KEE A;  4P71 A;  1KLU D;  4GKK Q;  4GLV B;  5JPM C;  2A6H D;  4LJZ C;  1TS2 A;  3K7U C;  3FKI G;  4H0L C;  1EYA A;  4BBS B;  3J7A 5;  1TXY A;  3HOW G;  4AYB E;  4B9X A;  5IYC H;  4IOC A;  3HEJ A;  1HNX Q;  1TWH H;  1Q3L A;  1V1P B;  4X62 L;  1STN A;  5EKL A;  5JEA J;  1XPU A;  2JK8 A;  2JSO A;  4EX5 A;  4B9W A;  2O5J C;  3SXH A;  1N33 L;  1SR3 A;  3PUZ A;  2VUM B;  2LMC B;  3CCR A;  4PNY A;  5LMN W;  1PRT F;  1KQS A;  4XQJ A;  3CPW A;  4IFD J;  1SLJ A;  1K8A C;  3STB C;  2VS1 A;  1VDZ A;  5ELB A;  5D3I B;  4X65 L;  4DR2 L;  3T1Y L;  2EY2 A;  4OO1 I;  1XX8 A;  3OPO A;  2OEO A;  5E4X A;  1U4L A;  5E7N A;  2XRS D;  1JR0 D;  1OTC A;  4KKS A;  1GKH A;  1ICF B;  4WJW A;  3CCM A;  3GTP B;  4CDE C;  2D2C C;  3BG3 A;  4DR4 L;  1J5E Q;  4JI1 Q;  4CKE A;  4A3E B;  2EE1 A;  4JBJ A;  4HJ8 A;  2F4I A;  2QF7 A;  4CBV A;  2EYL A;  3K6O A;  4XQN A;  1A0I A;  2EY6 A;  2BE5 D;  1JJ2 A;  4B3S Q;  2HT1 A;  4ZK9 B;  2H1E A;  4FXK C;  1ASY A;  3PO3 G;  4BBR G;  2VZA A;  2UUB Q;  4K0K L;  1SBB B;  5EPL A;  4FO2 A;  4X3S A;  1X32 A;  5C4H A;  1X54 A;  1HQM C;  1PRT C;  1TU2 B;  4DU9 A;  1SYE A;  5JEA H;  1XNR Q;  2IT1 A;  1DYQ A;  1QB5 D;  2QGQ A;  3GV3 A;  1EUJ A;  4UDU C;  3HOX G;  1DZ1 A;  4DV0 Q;  1I50 H;  1G51 A;  4JI4 L;  3LGJ A;  4RH6 A;  3S16 B;  2MP1 A;  2A6E C;  4TSS A;  1R9T B;  3W1B A;  5KGU A;  4DXG A;  1XJV A;  2CQO A;  1SFO B;  5C4X B;  4K8I A;  2D5D A;  1SNO A;  2GA4 B;  3CP0 A;  4A3K G;  2A68 D;  2WAQ G;  4LF9 L;  2JEB I;  2A73 B;  5J1Z A;  2R6G A;  3A7A B;  1HR0 W;  3J81 E;  5COR A;  1O7I A;  2RDG A;  1VQP A;  2XWJ B;  4NXN L;  4PG3 A;  4KHP L;  5DM7 3;  4DAV A;  5G3L D;  3JAM c;  2IHF A;  1IBL L;  4IO9 A;  1PZK D;  1S4Z A;  1I5F A;  1KTK A;  2WII B;  2EQS A;  2B2U A;  3I4M G;  1EOV A;  1BVS A;  3L2P A;  2C9O A;  5GRO A;  3I72 A;  4FDB A;  1Y1V H;  1G8Z D;  5ELE A;  4DV4 L;  5C4Z A;  4EQO A;  4OEL B;  4RHR A;  1EYC A;  3W3A A;  4JI0 Q;  2R92 G;  4DK6 C;  5EKK A;  1TT2 A;  3K0X A;  1F2L A;  5ISR A;  1QZH A;  3PIP 3;  2I46 A;  3C1E A;  4AYB B;  4DUY L;  2KOL A;  1NMF A;  2HDL A;  2PZU A;  1CTM A;  1WCM H;  1NY4 A;  1WTX A;  5C3E G;  2FJ2 A;  4HR7 B;  1BQQ T;  1H9M A;  3TS2 A;  3KUP A;  3E0J A;  4G4K A;  1EL0 A;  4HSV A;  1XTD A;  1G2S A;  3NPP A;  4JVZ A;  4DV7 L;  4X3K A;  4QJF A;  3J80 L;  4YIJ A;  1BCP B;  4A3F H;  1I6H H;  2IPK D;  2XSC A;  1HTP A;  2KCT A;  5EAY A;  2Z6K C;  1XNQ Q;  4B3M L;  4R4O A;  1UE6 A;  3UDX A;  4U68 A;  1V1Q A;  1MSH A;  3I90 A;  1RHP A;  1B4O A;  1ZYR C;  1CSP A;  5FJ8 H;  4LMQ D;  3QIA A;  3DWA A;  3GP7 A;  4JI3 L;  4JBW A;  1B9M A;  4LF7 Q;  4BWG B;  1VF5 C;  3L3O C;  1PH2 A;  3AB9 A;  5M3M H;  5IIF A;  4X3U A;  1MJC A;  1VQC A;  2F0J A;  2JQO A;  5CBE E;  3I8Z A;  3ULL A;  1SDF A;  4OEM B;  1X6O A;  2FIN B;  1SYD A;  1VQ9 A;  1U9R A;  3M4Q A;  3QO2 A;  4ZCK A;  2UXD Q;  3CD6 A;  1JB3 A;  3BZK A;  2B2W C;  2ICI A;  1M8A A;  2EJM A;  1PYB A;  1HUN A;  1BCP D;  2HCI A;  3DWP A;  5M5W B;  1E3P A;  4BBS H;  3CCU A;  1YJW A;  4IUV A;  3CRK C;  4C3I B;  1V9P A;  2UXC Q;  5BN4 A;  1C4Q A;  3M9B A;  5KIX A;  1CA5 A;  1HNW L;  4UP7 A;  5E1F A;  1JIC A;  2PQA B;  2B63 H;  4C56 C;  3VR4 A;  1IYV A;  5A2Q L;  1L1O C;  3I4L A;  2AKW B;  1QWY A;  1AEX A;  5C4J B;  5C0X I;  2B8F A;  3PO2 B;  3SVM A;  2Q8I B;  3TZU A;  2QEX A;  3S1N B;  4S3S A;  1IBK Q;  3C3L A;  4LFA L;  5IYC G;  2HHH L;  2IL8 A;  2JN4 A;  2LS0 1;  2F4V Q;  4LAA A;  1CI3 M;  1I4X A;  1PXU A;  4DK3 C;  4OGQ C;  2JA6 H;  4IZ8 A;  1LTI D;  4IUR A;  1BBX C;  1A3T A;  1N34 Q;  3PUX A;  1VQ5 A;  2CW0 D;  5DAU A;  3P75 A;  1PFB A;  2QA4 A;  1HNZ Q;  2BDO A;  2FXQ A;  3C1F A;  1Q8K A;  4DR6 Q;  3E3X A;  1YNJ D;  1PHJ A;  1B8A A;  5IT9 c;  5H1S E;  1A2T A;  4A3M B;  3CRL C;  1Y1W H;  1E22 A;  2JEA I;  2JXM B;  4DN4 M;  1QVF A;  5IOC A;  4DV6 Q;  1EFW A;  1NNX A;  5JAV A;  1HH2 P;  4BY7 G;  3A8J E;  1GHJ A;  1O7Y A;  2F52 A;  1PH3 A;  3QB3 A;  2PQA A;  3KJP A;  1QVC A;  2N3S A;  1EWC A;  1VQI A;  3CXC A;  1RCV D;  1D6E C;  1E24 A;  1HTL D;  2F3I A;  3H0G H;  2E2J H;  1KAA A;  2HQL A;  2MO1 A;  3FPP A;  1PZJ D;  4X66 L;  4JI7 L;  2ES2 A;  2GVA A;  1RIP A;  3BVG A;  4DV2 Q;  1LTA D;  1SN8 A;  3GTL H;  5I9O A;  2UU9 Q;  1CKO A;  1SXT A;  3RMH A;  2L11 A;  1LT3 D;  3E5S A;  5DNF A;  1H9J A;  1EIG A;  4GKJ L;  3S16 H;  1R9T H;  1IYU A;  2ZTE A;  1SFO H;  3TEH B;  3UDF A;  4MZ9 A;  5C4X H;  2CVR A;  3NTH A;  5LHY 1;  4DUZ L;  3L9A X;  5JEA G;  4A76 A;  4JYA Q;  4A3L H;  1PA6 A;  4CKB A;  2DNE A;  5JJI A;  1U4M A;  2OQK A;  4BA1 I;  2FHT A;  3T4A C;  3KK7 A;  2QDL A;  3E0E A;  1I3Q H;  4KN4 C;  5IGF A;  4YCW A;  4FXG C;  3NBH B;  4IFD G;  1EZ6 A;  1T5E A;  2N78 A;  1ILQ A;  3CQZ B;  1O80 A;  4HIM A;  2SEB D;  5DLQ E;  3MXG A;  3DEP A;  4A3C H;  3HOW H;  4H7B A;  3UI2 A;  1E7Z A;  4PZ6 A;  2WB1 E;  3UDG A;  3S14 H;  1E0B A;  1LUZ A;  3S24 A;  3QJY A;  3HRZ C;  4UAI A;  4ZKC B;  3NTK A;  4KMU C;  1G2T A;  3IL8 A;  2K75 A;  2EOT A;  4OWW B;  1UUP A;  3A8K E;  4OX9 Q;  3MWY W;  4K5W A;  2CHB D;  1QIL A;  3S2H B;  1N36 L;  3H3V H;  4UPA A;  4R9W A;  3OTO Q;  1P16 A;  3K80 C;  3K0Y A;  4O42 A;  3A54 A;  5F2D A;  1CQF A;  5G3L F;  4NB3 A;  1PH9 A;  4DR5 Q;  3L0O A;  4DPG A;  1K28 A;  2BE5 C;  2K32 A;  4DV3 L;  1OXU A;  3DMU A;  3DHQ A;  1F2M A;  5FLX L;  2JA5 B;  3ZJY C;  3CCJ A;  4DV5 L;  2HUG A;  1FVI A;  3ERO A;  1I94 Q;  1CKN A;  1TR5 A;  1P8L A;  3ITP A;  1CKM A;  2WFW A;  1I4H A;  3HOY H;  4GNX C;  1LAC A;  3K59 A;  1B7Y B;  4MN3 A;  3M3Y B;  2R7Z B;  5LMN Q;  2JA8 B;  4JV5 Q;  4XT3 B;  4HIO A;  1WVL A;  3GTM B;  1TKW B;  4A93 B;  3CCQ A;  1XWE A;  1TY0 A;  2A68 C;  1QE6 A;  1HFN A;  3HOX H;  3D4D A;  2RSN A;  1JQY D;  5L37 A;  1SND A;  3NXW A;  4JW0 A;  2E2H B;  1OXT A;  2E5L Q;  2RKS A;  1Z7T A;  3M4P A;  1NTG A;  4C3J G;  4LUZ A;  3UE1 A;  1IBM Q;  1U4R A;  2F3W A;  4QUC A;  3GTJ B;  1LYL A;  4L63 B;  4HJA A;  1D7Q A;  3FMC A;  4RA8 A;  1EY7 A;  4L6T B;  1X65 A;  3V96 A;  1PV4 A;  1RKN A;  1C7Y A;  3VYU A;  1TWC H;  1QCB D;  4QMG A;  5C5L A;  3GTK B;  2DUD A;  4GZY C;  2F0I A;  4L8J A;  1ZXT A;  5C4J H;  3EQL C;  2MQH A;  2NN6 G;  2F0D A;  4JI5 Q;  4BBS G;  2A69 C;  1HXY D;  2OXP A;  2JJQ A;  3S15 H;  4QQB X;  3T1H Q;  2K05 A;  4G7Z C;  2F0H A;  2I0Q A;  2MHV A;  2YV5 A;  3H91 A;  3K5L A;  2PPB C;  3VYT A;  2VQF L;  3QOJ A;  4U67 3;  1D8L A;  3DM1 A;  3RD4 A;  3NEN A;  1UWV A;  1WD1 A;  4A3B B;  3BJU A;  2J0T D;  2VUM G;  1BCP F;  1GUG A;  2NTS A;  1EY4 A;  4HCE A;  5A35 A;  1X55 A;  2XWB B;  2EPB A;  3EN2 A;  3O13 A;  2N55 A;  1ENC A;  4QIW E;  2PNH A;  4N9T A;  2DJF C;  3CKI B;  1DGS A;  1Z6H A;  4KJN A;  1KAB A;  3NK9 A;  2R92 H;  3KLS X;  5IWA Q;  4AQY Q;  1OXS C;  2VB2 X;  4DNI A;  1V8Q A;  2ZM6 Q;  1KRS A;  1F9S A;  1G29 1;  2ZXR A;  1SYF A;  4DAY B;  2WB1 B;  1HR0 Q;  3A5U A;  4Y7N B;  4A3J B;  1PFS A;  2KHJ A;  2NB0 A;  1U5K A;  3M85 A;  1Y1W G;  1LTL A;  3FP9 A;  3HFZ B;  2UUC L;  3HOZ B;  2CH4 W;  4E6I A;  5IY0 A;  4KLK A;  4A3E G;  3NBI A;  4JI2 L;  1TWA B;  3H3V C;  3TDQ A;  3KJO A;  3RZO H;  3MEH A;  2NZO A;  2DN8 A;  1LTS D;  2BOS A;  1M4V A;  2K03 A;  3TRZ A;  3I55 A;  1STH A;  4XDX A;  3FRP B;  1GUN A;  2PO4 A;  3KF6 B;  4LW1 A;  1KRT A;  3HG9 A;  3OW2 A;  1PH8 A;  2CWA A;  1IW7 D;  1N32 L;  3J7A F;  1EOT A;  3OIP A;  1KC8 C;  2F0P A;  1HNX L;  2IW3 A;  2KQ3 A;  1JJC B;  4JOI A;  4HMI A;  4KKU A;  1DOM A;  2B2V A;  1L1O A;  2AQ1 B;  4YWM A;  3HOV B;  2HIV A;  1MHW C;  1K3R A;  1DXM A;  2CFM A;  3I91 A;  3D4W A;  3Q8D A;  2B8G A;  3R93 A;  2IWH A;  1Y69 U;  2Z6B A;  1X3Q A;  1L0W A;  1N9W A;  5C4X G;  4A3D B;  1YEZ A;  3BYT B;  4DAY A;  2LFN A;  3CCV A;  4A3L G;  1HZ9 A;  4XTC S;  1XMO Q;  5ELN A;  2XN9 C;  1WTH A;  4KK7 A;  3MVV A;  3V05 A;  1QNK A;  1Z9F A;  1WI5 A;  2ID0 A;  3ERQ A;  1AN8 A;  1E2Z A;  1KNE A;  2RSO A;  4O0A A;  2JA9 A;  1C0A A;  4IOA A;  5EJW A;  4ALP A;  3JC6 6;  1J5E L;  4A3C G;  2Z0S A;  4JI1 L;  3KF6 A;  2VQE Q;  4K5X A;  1YNJ C;  2HD3 A;  1FR3 A;  1IYJ B;  1EEI D;  3QOL A;  2XGT A;  2E2I H;  4B3S L;  2O2L D;  1YNN D;  1SJE D;  2VB3 X;  1CT1 D;  3NUC A;  2Z4I A;  4EQP A;  2UUB L;  2YU9 B;  4C1N I;  4KV6 A;  4KD3 A;  1II3 A;  2NVT H;  3PIP A;  4K2L A;  2UXB Q;  4JI6 Q;  1YIT A;  3M7G A;  4QL5 A;  1BOS A;  2ZJQ A;  1JOK A;  4XQQ A;  1K8M A;  4YCV A;  3RZD B;  2JA5 H;  3S1Q B;  1JOO A;  4AYB G;  4BS9 A;  3UDI A;  1PH4 A;  1I4G A;  3VA7 A;  1PVO A;  1HHV A;  2K5H A;  1ET6 A;  1S5C D;  2TSS A;  5K5P A;  4YHH Q;  3Q24 A;  1SJH D;  3MC0 B;  2B2Y C;  4KN7 C;  4RGM A;  2R7D A;  3A0J A;  4LF6 Q;  4BY7 H;  3CPF A;  3R2I A;  2RCF A;  3L7Z C;  3KOJ A;  3M3Y H;  2R7Z H;  4AIM A;  5BR8 Q;  1QJO A;  3F8T A;  4LF4 Q;  1SEB D;  1I4R A;  3CW2 C;  1AW7 A;  4HN7 A;  1BBW A;  3K7A H;  4A93 H;  3S1M B;  5KNC A;  1KHI A;  4WOR A;  1OO9 B;  3D3R A;  1EYG A;  2KHS A;  3H09 A;  4QIW B;  5I2X A;  3P1H A;  2PMZ E;  4IUT A;  3U4V A;  3V2T A;  2F0F A;  1FNU A;  3HOY G;  1O7Z A;  4ILW A;  1PTO B;  1D5M C;  1K83 B;  4DR3 Q;  2UUA Q;  2F0Q A;  3ND8 A;  4KHZ A;  1SNP A;  3PUV A;  4PMW A;  2Q8R E;  1Q12 A;  2Q2U A;  1QOH A;  1JOR A; 
#chains in the Genus database with same CATH homology
 5K36 G;  3BYY B;  1A6X A;  1BDO A;  1DCZ A;  2FFK B;  2L0C A;  3MXU A;  4KY7 A;  3OHX C;  1DD2 A;  5HGT A;  1EY9 A;  3M4Y A;  4HTH A;  1LO5 D;  3MXN A;  4C3I G;  3IKJ A;  4IFD H;  2B2T A;  5CV6 A;  3MHB A;  3PMF A;  1IKL A;  1A3V A;  4ZYS A;  1CM9 A;  2KEC A;  3GTO B;  1PTO D;  2EY5 A;  3SE0 A;  1O78 A;  1SE4 A;  3E6Z X;  1E2V A;  2F0L A;  2SNS A;  2NWG A;  5DEH A;  2PW5 A;  3EJI A;  1ONL A;  2ZT9 C;  2AUK A;  2RDH A;  3S1R B;  1A2U A;  1VF7 A;  5CMD A;  1LAB A;  3Q22 A;  1B50 A;  2ENB A;  4F7X A;  1K8O A;  3HKZ B;  4IUQ A;  1H9S B;  1S5F D;  2I07 B;  5CV8 A;  1AFP A;  1VCI A;  3OIQ A;  1PMR A;  3VR5 A;  4I7Z C;  1FNV A;  2K28 A;  2JP1 A;  3NQI A;  2PCF B;  3Q23 A;  1GUW A;  2F0N A;  4H44 C;  1WTP A;  4ZKB B;  1GOZ A;  1JC7 A;  1G6Z A;  3BVM A;  3D6C A;  3R2T A;  2F0E A;  5JVH 3;  1FYC A;  5I2Y A;  4OIK A;  5CV4 A;  5CBA E;  1HQR D;  5C3X A;  4ZUJ A;  3I4N B;  4IUN A;  1S5E D;  5E4W C;  4ZUI A;  3Q6S A;  3R8B A;  3NE5 B;  1H9S A;  4J6H A;  2Z4H A;  4Q0F A;  2F0K A;  4KD4 A;  3X3M A;  4DXF A;  1ENF A;  5FOB B;  3S17 B;  2NN6 H;  1ESF A;  3T16 A;  5CC4 A;  3PO3 B;  2O4X A;  1QNU A;  1HA6 A;  1ROD A;  4CJ1 B;  1VMP A;  3A7L A;  3X3N A;  2V4D A;  3J7A V;  2NBF A;  3LX0 A;  3OW7 A;  2WIN B;  4XYQ A;  1U4P A;  2C5C A;  1WTR A;  1STA A;  3VA5 A;  2O5I C;  4WFN 3;  4O1N A;  1ZKO A;  4OHJ A;  4H13 C;  5EQ0 A;  4KKT A;  4K14 A;  1H9K A;  4RKB A;  3TN2 A;  3HZX A;  4A3K B;  1SNM A;  1Q1B A;  3JAM E;  1SNC A;  3GTQ B;  2EYO A;  3J81 L;  1IW7 C;  4IFD I;  1ENA A;  3A8I E;  1IHZ A;  2L1B A;  4RGN A;  2F0W A;  3I4M B;  2F0V A;  4A3I B;  1I6V C;  2K7V A;  5JVG 3;  1EFI D;  5C44 B;  1S5D D;  1GJX A;  4I65 A;  3SK8 A;  5KYL A;  2X69 A;  4FP5 D;  4DF7 A;  2BA0 A;  1I4P A;  4RGT A;  2EJG C;  4QF4 A;  3TBI B;  1SMY C;  2PQE A;  3M4O B;  1TY2 A;  4A3G B;  2OT2 A;  3D6W A;  1KDA A;  4RCO A;  1MD2 D;  2A6H C;  5C3E B;  2OF1 A;  4R8I A;  1EIH A;  3J7Y W;  2SDF A;  5EBD A;  3AMU A;  5KND A;  4N9P A;  2NYZ D;  1JWS D;  4DNR B;  5CGK A;  1PRT B;  2KCN A;  4MHE A;  3G7L A;  1STE A;  3A56 A;  1SYB A;  2BCO A;  3GD7 A;  2KVM A;  3PV0 A;  3TZD A;  1KDB A;  2K5W A;  2M2L A;  1LTB D;  2QCP X;  2AUJ D;  5IGC A;  2A74 C;  3K5M A;  1STB A;  3HOU B;  3SK5 A;  5KNB A;  4OIJ A;  4CHT B;  4XYO A;  2JA7 B;  1PRT D;  1PTO F;  1TII D;  2E76 C;  2WKC A;  1CHQ D;  4C2M B;  1RDP D;  1ICW A;  3I73 A;  3W2D A;  3C46 A;  2A6E D;  1MSG A;  2KEE A;  1SYG A;  2TMP A;  4ME5 A;  2G9H D;  3Q0A A;  1TWH B;  2AWN A;  5I6W A;  1C8C A;  1NCV A;  1ESR A;  2DY8 A;  5IT9 E;  4BY1 B;  1LT5 D;  1D5X C;  2LY7 A;  3A55 A;  4NKL A;  5NUC A;  3OMG A;  1VMC A;  3H6M A;  2WP8 J;  1V43 A;  1RTN A;  5K36 H;  3TSS A;  2M9V A;  1E2W A;  4B08 A;  2B2U C;  1Q1E A;  1B53 A;  1LV9 A;  1EY0 A;  3SK6 A;  3R3O A;  1DOL A;  1BXT A;  4OL7 A;  1BF4 A;  4DFA A;  1DM0 B;  2N88 A;  3N52 A;  1A3U A;  2EXZ A;  5KRU A;  1Q90 A;  1EY8 A;  1GHK A;  1TS4 A;  1TWG B;  1NR2 A;  1I4Q A;  1Y8O B;  5JPN C;  1IKM A;  5C6A A;  2NVQ B;  1LT6 D;  2PZW A;  1QG7 A;  2ZXO A;  3NWT A;  4OO1 H;  3EFX D;  3RUZ A;  1JWM D;  1ZYR D;  4J1M A;  1EWH A;  1I50 B;  1CQV A;  2D9U A;  2FMM A;  1KDC A;  1ML0 D;  4DA2 A;  3I70 A;  3NHH A;  2Y0S B;  1BUV T;  1AZP A;  2ICE C;  4KI0 A;  3D4R A;  1CZW A;  1D1I A;  1EY5 A;  1EEF D;  1LT4 D;  1EQT A;  4Z9C B;  3MFY A;  1UEA B;  1SE3 A;  2KED A;  4CGY B;  3C2P A;  5CYU A;  2B2W A;  1W6K A;  3K5O A;  4K6L A;  1IL8 A;  4EVO A;  4G57 A;  1CZG A;  1EU3 A;  1Y1V B;  5CV9 A;  1FD7 D;  1CHP D;  3LWU A;  1BCP C;  2R93 B;  4NP5 A;  4XT1 B;  4ABN A;  3T13 A;  1JCK B;  4FF3 A;  5T1I A;  3OOC A;  4J8Q A;  2EYF A;  1PFM A;  2F0O A;  4RWS C;  1R4Q B;  3LNN A;  4FF4 A;  2VXW A;  4RAU C;  1WCM B;  2SNM A;  2F03 A;  3K58 A;  1RJT A;  4WRD A;  3VR6 A;  3N6R A;  3HGB A;  1R4P B;  1FGB D;  4A3F B;  5C5M A;  1I6H B;  4DAP A;  1RD9 D;  5EBC A;  5J22 A;  3GQB A;  1O7L A;  1HRJ A;  3RLF A;  2CW0 C;  4ULL A;  1HCZ A;  2PZT A;  2NVY B;  5ELF A;  5AFW A;  3KBX A;  2JE6 I;  2NVX B;  5M3F B;  3BS1 A;  2K6A A;  5M3M B;  1EZ8 A;  2L55 A;  1UNS A;  4DNT B;  3BVZ A;  5EPJ A;  4IQZ A;  5C0X J;  2E2D C;  4DK0 A;  3PUY A;  1CK1 A;  1MI2 A;  4HSP A;  4XXE A;  4DGZ A;  4CJ0 B;  3NQT A;  4KY6 A;  3TP8 A;  5FK9 C;  2B63 B;  2Z8L A;  1PYW D;  3T51 B;  3T56 B;  1SYC A;  3J80 E;  2QKI C;  2F3V A;  3DWQ A;  4HMJ A;  2RVL A;  3IFD A;  5ELD A;  3QG1 A;  1A15 A;  1HFG A;  3FPU B;  2JA6 B;  3VR2 A;  5BN3 A;  3WOF A;  5M5Y B;  3BDL A;  1L0Y B;  4KJO A;  3MFG A;  4ODG A;  5FO8 B;  2KJX A;  1Y1W B;  2IJ0 A;  3OWF A;  4IUU A;  4M8A A;  5FO9 B;  2L5T A;  1HPC A;  4IAL A;  4V19 0;  2L12 A;  5C0X H;  4C3H B;  5ELC A;  1V1P A;  2L4N A;  2ZXP A;  1PZI D;  1F2Z A;  1Z47 A;  3NTI A;  3LWE A;  3U9O A;  2RBM A;  2EYJ A;  3H0G B;  1S5B D;  2AWO A;  1EYD A;  5M5X B;  2E2J B;  5A2Q E;  2JYO A;  2SOB A;  3PIO 3;  3KLS A;  2F0U A;  3GTL B;  2E75 C;  5LL6 S;  5IGG A;  3VYS A;  2Z1C A;  3BDO A;  2KA7 A;  1F9Q A;  3D8G A;  3MA2 B;  4M1U B;  2F0M A;  4KTA A;  1WTQ A;  1GUT A;  4OO1 G;  2EYP A;  2KUM A;  1D2B A;  2K5D A;  3OSO A;  2WAC A;  1STG A;  4HED A;  1I3Q B;  1C48 A;  5E3F A;  2J4X A;  3FKI B;  1Q8I A;  4QB4 A;  2IX1 A;  2RQX A;  1MGS A;  3HOW B;  4G7O C;  4KHV A;  3S14 B;  2MGS A;  2A69 D;  2KCC A;  3MZ5 A;  1EY6 A;  2XNA C;  3SK4 A;  1ET9 A;  3SEB A;  1G91 A;  4FXD A;  1GUO A;  5DM6 3;  2AQ3 B;  4RGO S;  4FNF A;  1KNA A;  3GV6 A;  2XVS A;  4K5V A;  4JK1 C;  1GXD C;  1FNW A;  2XRQ D;  2WKD A;  5IGB A;  1PLF A;  1F9R A;  1Y8N B;  5JJZ A;  1HUM A;  1BR9 A;  4BA2 I;  4FYD A;  4F8M A;  3ZYY X;  3VYR A;  3WDN A;  5D3D A;  1GUS A;  3CHB D;  1PDQ A;  3KBG A;  3HOY B;  1JE4 A;  2X6G A;  1D5Z C;  1XXG A;  1NAP A;  2PMZ B;  1SAP A;  2G9D A;  4BBR B;  2F0T A;  2E74 C;  3PUW A;  4RHS A;  2B39 A;  1X3P A;  3AU7 A;  4HAE A;  3IFT A;  1B9N A;  3QWN A;  3HOX B;  3S9W A;  1F77 A;  3K57 A;  4ZAI A;  3TP6 A;  4NMZ A;  1NR4 A;  4ZLT F;  1PFN A;  2RA4 A;  1NUC A;  2F0G A;  4TRD A;  4TQU S;  1TWC B;  1TQO A;  2B2V C;  2IX3 A;  2WAQ B;  1KLG D;  4Q5V A;  1XTC D;  3TME A;  5FLX E;  3S15 B;  2EJF C;  3FEW X;  2IX0 A;  1AP0 A;  3DUZ A;  4PV1 C;  3P20 A;  2MUY A;  1CA6 A;  2A5H A;  2RDF A;  5CR3 A;  1PTO H;  5T1G A;  3MXP A;  1ILP A;  1T5X D;  1B3A A;  2EVB A;  3DXJ C;  2DY7 A;  3VR3 A;  2K5Q A;  3SHL A;  5EPK A;  2R92 B;  2FMC A;  5COY A;  3HS0 C;  1F2Y A;  5EKI A;  2PYK A;  3I3C A;  3URY A;  3GTG B;  1DJR D;  2NZ1 D;  1RF2 D;  2R3Z A;  3U9S A;  3DEO A;  3EVQ A;  4RFB A;  3K5N A;  3NP8 A;  1WD0 A;  3RZO B;  2DNC A;  3M7N A;  4XIG S;  3CU7 A;  5C0X G;  4TKO B;  1B1Z A;  4HCS A;  2VNU D;  1YNN C;  4RKL A;  3MTS A;  5D65 A;  2Q8T A;  1EQV A;  4K8J A;  1STY A;  2B2Y A;  1LTT D;  1EU4 A;  1ZEQ X;  2CQA A;  2NTT A;  5J39 A;  2H4O A;  3BZD B;  1WTV A;  5FO7 B;  3OWE B;  5IGE A;  5I4D A;  2EYH A;  1SE2 A;  2HQE A;  2M00 A;  5EGT A;  2J7Z A;  4NDX A;  2LKV A;  1SSO A;  1L0X B;  2QIL A;  3HP3 A;  2PNR C;  1LTG D;  1LTR D;  4PMC A;  1JWU D;  2NN6 I;  4FVM A;  1UAP A;  4IUP A;  1J8I A;  1LLR D;  3F2U A;  2HDM A;  2B2T C;  1WTO A;  1B2T A;  3SR1 A;  2EZV A;  2E2I B;  2BDN A;  4QUF A;  3H94 A;  3KF8 A;  4EGV A;  5FKA C;  2X6L A;  2NVT B;  4DK1 A;  2MJ8 A;  3JAM L;  2EYM A;  4CKC A;  1DON A;  4RCN A;  2XIW A;  3NBH A;  1MBY A;  3MAQ A;  4ID6 A;  3T53 B;  1PTO C;  2NUC A;  5KYI A;  1Y8P B;  3NWS A;  4BY7 B;  3NSW A;  1OXV A;  3SDZ A;  2HCC A;  3TP5 A;  3K7A B;  1XYI A;  3IAY A;  2K1B A;  1B44 D;  4R8N A;  4CJ2 C;  5LL6 X;  5HUR A;  4K2K A;  5M9O A;  2AQ2 B;  2R61 A;  1HA5 A;  4QCL A;  2K04 A;  1D1K A;  1W6J A;  1TS5 A;  5JOB A;  3FVQ A;  2YYZ A;  3WOE A;  1AZQ A;  5IGD A;  1V1O A;  4G7H C;  3TP7 A;  3P7J A;  4C1N K;  4KY5 A;  2F0S A;  2WV6 D;  1H9R A;  2F1M A;  5CV5 A;  2D62 A;  2PW7 A;  1BNZ A;  4IN3 A;  5D14 A;  4X3T A;  1F9P A;  3OMC A;  3KLR A;  4PQX A;  1DOK A;  2K33 A;  3ND9 A;  1TS3 A;  1OXX K;  1TVX A;  2QDB A;  5BN5 A;  4MIU A;  2EDG A;  2BA1 A;  2MPM A;  4C3H G;  4NW2 A;  5IOD A;  5I6Y A;  1JOQ A;  1SNQ A;  3D31 A;  3G6J B;  3ONA B;  4P2C B;  5IT9 L;  4PMB A;  4FF2 A;  2K01 A;  2QEJ C;  3GO5 A;  2L9H A;  5C3W A;  1TWF B;  4EQN A;  1WTW A;  3BDC A;  3EA6 A;  3FDT A;  5CV7 A;  4K6D A;  5TSS A;  2EY1 A;  4ZQ3 A;  4F87 A;  4V0B A;  1J9O A;  1BO0 A;  4F88 A;  4C3J B;  1SMY D;  4FF1 A;  1RTO A;  4ZRZ A;  1NSN S;  1CFM A;  5I9P A;  3S2D B;  5KEE A;  1KLU D;  5JPM C;  2A6H D;  4LJZ C;  1TS2 A;  4H0L C;  1EYA A;  4BBS B;  4B9X A;  3HEJ A;  1Q3L A;  1V1P B;  1STN A;  5EKL A;  5JEA J;  2JSO A;  4B9W A;  2O5J C;  3SXH A;  3PUZ A;  2VUM B;  2LMC B;  4PNY A;  1PRT F;  4XQJ A;  4IFD J;  1VDZ A;  5ELB A;  5D3I B;  2EY2 A;  4OO1 I;  1XX8 A;  3OPO A;  2OEO A;  5E4X A;  1U4L A;  2XRS D;  1JR0 D;  4KKS A;  4WJW A;  3GTP B;  2D2C C;  3BG3 A;  4CKE A;  4A3E B;  2EE1 A;  2F4I A;  2QF7 A;  4CBV A;  2EYL A;  3K6O A;  4XQN A;  2EY6 A;  2BE5 D;  4ZK9 B;  2H1E A;  4FXK C;  1SBB B;  5EPL A;  4FO2 A;  4X3S A;  1X32 A;  5C4H A;  1HQM C;  1PRT C;  1TU2 B;  4DU9 A;  1SYE A;  5JEA H;  2IT1 A;  1DYQ A;  1QB5 D;  3GV3 A;  4UDU C;  1DZ1 A;  4RH6 A;  3S16 B;  2MP1 A;  2A6E C;  4TSS A;  1R9T B;  5KGU A;  4DXG A;  1SFO B;  5C4X B;  4K8I A;  2D5D A;  1SNO A;  2GA4 B;  2A68 D;  2JEB I;  2A73 B;  5J1Z A;  2R6G A;  3A7A B;  3J81 E;  5COR A;  2RDG A;  2XWJ B;  5DM7 3;  4DAV A;  5G3L D;  1PZK D;  1S4Z A;  1KTK A;  2WII B;  2B2U A;  2C9O A;  3I72 A;  1G8Z D;  5ELE A;  5C4Z A;  4EQO A;  4RHR A;  1EYC A;  3W3A A;  5EKK A;  1TT2 A;  1F2L A;  5ISR A;  1QOH A;  3PIP 3;  2I46 A;  3C1E A;  4AYB B;  2KOL A;  2HDL A;  2PZU A;  1CTM A;  1WTX A;  2FJ2 A;  4HR7 B;  1BQQ T;  1H9M A;  3KUP A;  3E0J A;  4G4K A;  1EL0 A;  4HSV A;  1G2S A;  3NPP A;  4X3K A;  3J80 L;  4YIJ A;  1BCP B;  2IPK D;  2XSC A;  1HTP A;  4U68 A;  1MSH A;  3I90 A;  1RHP A;  1B4O A;  1ZYR C;  4LMQ D;  3QIA A;  3DWA A;  3GP7 A;  4JBW A;  1B9M A;  4BWG B;  1VF5 C;  3L3O C;  3AB9 A;  5IIF A;  4X3U A;  2F0J A;  5CBE E;  3I8Z A;  1SDF A;  2FIN B;  1SYD A;  1U9R A;  3QO2 A;  1JB3 A;  2B2W C;  2ICI A;  1M8A A;  2EJM A;  1HUN A;  1BCP D;  2HCI A;  3DWP A;  5M5W B;  4IUV A;  3CRK C;  4C3I B;  5BN4 A;  1C4Q A;  5KIX A;  1CA5 A;  5E1F A;  1JIC A;  4C56 C;  3VR4 A;  1IYV A;  5A2Q L;  3I4L A;  1QWY A;  1AEX A;  5C4J B;  5C0X I;  2B8F A;  3PO2 B;  3SVM A;  2Q8I B;  3TZU A;  3S1N B;  4S3S A;  3C3L A;  2IL8 A;  2LS0 1;  4LAA A;  1CI3 M;  1I4X A;  1PXU A;  4OGQ C;  4IZ8 A;  1LTI D;  4IUR A;  1BBX C;  1A3T A;  3PUX A;  2CW0 D;  5DAU A;  3P75 A;  1PFB A;  2BDO A;  3C1F A;  1YNJ D;  1A2T A;  4A3M B;  3CRL C;  2JEA I;  2JXM B;  4DN4 M;  5IOC A;  5JAV A;  3A8J E;  1GHJ A;  1O7Y A;  3QB3 A;  1EWC A;  1RCV D;  1D6E C;  1HTL D;  1KAA A;  3FPP A;  1PZJ D;  3BVG A;  1LTA D;  5I9O A;  1SXT A;  3RMH A;  2L11 A;  1LT3 D;  3E5S A;  5DNF A;  1H9J A;  1EIG A;  1IYU A;  2CVR A;  3NTH A;  5LHY 1;  3L9A X;  5JEA G;  4CKB A;  2DNE A;  1U4M A;  4BA1 I;  2FHT A;  3T4A C;  3KK7 A;  4KN4 C;  5IGF A;  4FXG C;  4IFD G;  1EZ6 A;  1T5E A;  1ILQ A;  3CQZ B;  1O80 A;  2SEB D;  3MXG A;  3DEP A;  4H7B A;  3UI2 A;  1E0B A;  3QJY A;  3HRZ C;  4UAI A;  4ZKC B;  3NTK A;  4KMU C;  1G2T A;  3IL8 A;  2EOT A;  1UUP A;  3A8K E;  3MWY W;  4K5W A;  2CHB D;  1QIL A;  3S2H B;  4R9W A;  3K0Y A;  4O42 A;  3A54 A;  5F2D A;  1CQF A;  5G3L F;  2BE5 C;  2K32 A;  1OXU A;  3DMU A;  3DHQ A;  1F2M A;  5FLX L;  2JA5 B;  2HUG A;  3ERO A;  1TR5 A;  3ITP A;  1I4H A;  1LAC A;  3K59 A;  4MN3 A;  3M3Y B;  2R7Z B;  2JA8 B;  4XT3 B;  1WVL A;  3GTM B;  1TKW B;  4A93 B;  1XWE A;  1TY0 A;  2A68 C;  1QE6 A;  1HFN A;  3D4D A;  2RSN A;  1JQY D;  1SND A;  3NXW A;  2E2H B;  1OXT A;  2RKS A;  1Z7T A;  4C3J G;  1U4R A;  2F3W A;  4QUC A;  3GTJ B;  4L63 B;  3FMC A;  4RA8 A;  1EY7 A;  4L6T B;  3V96 A;  1RKN A;  3VYU A;  1QCB D;  4QMG A;  5C5L A;  3GTK B;  4GZY C;  2F0I A;  4L8J A;  1ZXT A;  3EQL C;  2NN6 G;  2F0D A;  2A69 C;  1HXY D;  2OXP A;  2K05 A;  4G7Z C;  2F0H A;  2MHV A;  3H91 A;  3K5L A;  2PPB C;  3VYT A;  3QOJ A;  4U67 3;  3DM1 A;  3RD4 A;  1WD1 A;  4A3B B;  2J0T D;  1BCP F;  1GUG A;  2NTS A;  1EY4 A;  4HCE A;  5A35 A;  2XWB B;  2EPB A;  3O13 A;  2N55 A;  1ENC A;  4N9T A;  3CKI B;  1Z6H A;  4KJN A;  1KAB A;  3NK9 A;  3KLS X;  1OXS C;  2VB2 X;  1V8Q A;  1F9S A;  1G29 1;  2ZXR A;  1SYF A;  2WB1 B;  4Y7N B;  4A3J B;  2NB0 A;  3M85 A;  3HOZ B;  4E6I A;  3NBI A;  1TWA B;  3H3V C;  3TDQ A;  3MEH A;  2DN8 A;  1LTS D;  2BOS A;  1M4V A;  2K03 A;  1STH A;  4XDX A;  3FRP B;  1GUN A;  2PO4 A;  3HG9 A;  1IW7 D;  3J7A F;  1EOT A;  3OIP A;  2F0P A;  2IW3 A;  2KQ3 A;  4HMI A;  4KKU A;  1DOM A;  2B2V A;  2AQ1 B;  3HOV B;  1DXM A;  3I91 A;  3D4W A;  3R93 A;  2B8G A;  2IWH A;  1Y69 U;  1X3Q A;  4A3D B;  3BYT B;  4DAY A;  2LFN A;  4XTC S;  2XN9 C;  4KK7 A;  3MVV A;  3V05 A;  1QNK A;  2ID0 A;  3ERQ A;  1AN8 A;  1E2Z A;  1KNE A;  2RSO A;  5EJW A;  4K5X A;  1YNJ C;  1FR3 A;  1EEI D;  3QOL A;  2O2L D;  1YNN D;  1SJE D;  2VB3 X;  1CT1 D;  3NUC A;  2Z4I A;  4EQP A;  2YU9 B;  4C1N I;  4KV6 A;  4KD3 A;  1II3 A;  4K2L A;  3M7G A;  1BOS A;  1JOK A;  4XQQ A;  1K8M A;  3RZD B;  3S1Q B;  1JOO A;  4BS9 A;  1I4G A;  3VA7 A;  1HHV A;  2TSS A;  1ET6 A;  1S5C D;  5K5P A;  3Q24 A;  1SJH D;  3MC0 B;  2B2Y C;  4KN7 C;  4RGM A;  3R2I A;  3L7Z C;  1QJO A;  1SEB D;  1I4R A;  4HN7 A;  1AW7 A;  3S1M B;  5KNC A;  4WOR A;  1OO9 B;  3D3R A;  5I2X A;  2KHS A;  3H09 A;  4QIW B;  3P1H A;  4IUT A;  3V2T A;  2F0F A;  1FNU A;  1O7Z A;  4ILW A;  1PTO B;  1D5M C;  1K83 B;  2F0Q A;  3ND8 A;  4KHZ A;  1SNP A;  3PUV A;  4PMW A;  2Q8R E;  1Q12 A;  4LK1 C;  1JOR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...