4QUCA

Crystal structure of chromodomain of rhino
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
56
structure length
56
Chain Sequence
EYVVEKILGKRFVNGRPQVLVKWSGFPNENNTWEPLENVGNCMKLVSDFESEVFRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RE36324p
publication title Transgenerationally inherited piRNAs trigger piRNA biogenesis by changing the chromatin of piRNA clusters and inducing precursor processing.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Protein binding
total genus 12
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2014-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4qucA00
2EE1A 2NYZD 1SDFA 2JP1A 1IKLA 1JE4A 1PFMA 1QNKA 2MJ8A 3GV3A 4X3KA 2L9HA 1RHPA 1F2LA 1VMCA 3QO2A 5E4WC 2IL8A 1MSGA 3I8ZA 1QE6A 3DM1A 5D14A 2FHTA 2HDMA 4IUUA 5JJZA 1C8CA 4DN4M 1XYIA 1X3PA 4HCSA 2K05A 1JICA 1EQTA 5CORA 1A15A 4OIKA 1G2SA 1HA6A 1BNZA 4U68A 5EPLA 1B50A 1EIHA 3TN2A 1G6ZA 2R3ZA 2EPBA 2MP1A 1NAPA 3KUPA 4MHEA 1WTVA 4X3TA 1WTPA 3LWEA 1EL0A 1NCVA 2KECA 4IUVA 1WTQA 1WTRA 4XT1B 1M8AA 1X32A 2M2LA 3D6WA 2KEDA 3N52A 3F2UA 4NW2A 1U4LA 2RA4A 2B2VA 1MI2A 1O80A 2HUGA 2K1BA 2VXWA 2J7ZA 5T1IA 2FMMA 2MGSA 4X3SA 2CVRA 2N88A 4RAUC 2L4NA 2SDFA 3I91A 1BBXC 1U4RA 1S4ZA 2X69A 4O42A 1GUWA 2DY7A 2B2WA 2K04A 1NR2A 2BDNA 2B2YA 1E0BA 2D9UA 5EQ0A 1J9OA 2JYOA 1O7YA 4HSVA 2KEEA 1DOLA 5EJWA 1WD0A 2FINB 4X3UA 1WTOA 3FPUB 1VMPA 3UI2A 1B3AA 2H1EA 5CBAE 1KNEA 2K03A 2RVLA 1AP0A 2B2UA 4ZLTF 1WTXA 4UAIA 1X3QA 2HCIA 2RSNA 5CBEE 1QG7A 1CA6A 1G2TA 1BF4A 2HDLA 5E4XA 4RA8A 3TZDA 1IL8A 2B2TA 1HRJA 1BO0A 4CJ1B 2XIWA 1O7ZA 1SSOA 4QUCA 4CJ0B 2FFKB 2K01A 1RODA 4HEDA 1PFBA 2EOTA 4ZKBB 1CM9A 4XDXA 1ML0D 4MN3A 1U4PA 2B2UC 1RJTA 4R9WA 3MWYW 2NWGA 1G91A 1HHVA 5DNFA 1F9QA 1F9SA 4ZKCB 1EOTA 3IL8A 2KUMA 1WVLA 3R93A 1KNAA 1TVXA 2B2VC 1B4OA 1XX8A 1DOMA 4CJ2C 1ILPA 4HAEA 1F9RA 1F9PA 1AZPA 1B2TA 3FDTA 1J8IA 1RTOA 2KOLA 3ONAB 1EIGA 3DEOA 3IFDA 1DONA 1U4MA 3KBXA 2K28A 4IUPA 1Q3LA 3GV6A 4R8IA 2L11A 2NZ1D 3HP3A 5AFWA 2B2WC 2KVMA 4LMQD 2X6GA 2B2YC 4OIJA 5EPKA 2Q8TA 5CMDA 1PLFA 3SVMA 2L12A 2X6LA 5EKIA 3I90A 1SAPA 4RWSC 1WTWA 1AZQA 1DZ1A 3DEPA 3P7JA 1NR4A 2FJ2A 1MSHA 2MPMA 1ESRA 1ICWA 1LV9A 1PFNA 2L1BA 5D65A 4ZAIA 5T1GA 1HUMA 1PDQA 4IUTA 2Q8RE 3MTSA 1CA5A 1ZXTA 4XT3B 1WD1A 2B2TC 5COYA 1HFNA 2HCCA 3Q6SA 4ZK9B 1HFGA 1HUNA 1ILQA 2RSOA 1MGSA 3H91A 1B53A 1DOKA 4IURA 1IKMA 2DY8A 5EPJA 3G7LA 2N55A 3I3CA 4QUFA 4IUQA 1RTNA
chains in the Genus database with same CATH superfamily
3DWPA 3P1HA 3H3VH 2BCOA 1HH2P 1PFMA 3TEHB 4DV3L 4PMBA 1EY9A 1AW7A 2IX0A 4ZQ3A 4L5TA 4R8NA 5LMUQ 2Z6KC 1C8CA 3I4LA 1E2VA 2K05A 4HMJA 1K0RA 4C3HH 4IPCA 1SYGA 4OXPA 2UXDQ 2M9VA 2UXBL 1STHA 5C0XI 4RGMA 4YCVA 4DNRB 1EY4A 1TWCH 4N8X1 3S14B 2D0PA 3F2UA 5TSSA 4G4KA 3K5MA 1PH5A 4DV7Q 2GVBA 4H02A 3KJPA 4BY1B 1IBKL 2KENA 4PV1C 4YWLA 4ZCKA 2BDNA 1SNPA 3T4AC 4HSVA 4E6IA 2PPBC 4GKJQ 1KABA 2F0VA 4KTAA 3S2HB 4APVA 3QJYA 2UU9Q 4BBSG 1X3QA 1QG7A 3CP0A 3V05A 4A3EH 4A3DH 1IL8A 4GLAC 1WJJA 2Z4HA 2XIWA 1YZ6A 2IW3A 2E2HB 2AQ1B 5GAEC 3DWAA 1CQFA 5C4JB 3J80L 4HEDA 1PFBA 4XDXA 5CV8A 1LT5D 3D31A 2JN4A 3VR2A 3PO3G 3M4PA 5JPMC 4J1MA 4G57A 3BZCA 3KF8B 2F0IA 5FLXc 4UY8C 5JVH3 1VQKA 3DLLA 1FJGL 1IYJB 4DAPA 1SMYD 2UXBQ 4X66L 2K5VA 1DM0B 4A3EB 4DV5L 4A3DB 4DUYL 1VF7A 2RKSA 2WFWA 3DEPA 4RGNA 1NR4A 1L2FA 1VQMA 1D1IA 4P72A 2NZHA 2PNRC 5IP7G 2TSSA 4GN5A 3K57A 1IKMA 3CC4A 4WRDA 1X56A 2BA1A 2Q2IA 2Z9HA 3G7LA 3NTIA 5L37A 5JEAG 2VQEQ 2UXCL 1CUKA 4OX9L 4UDUC 5C4XG 3NSWA 2F0PA 1MJEA 1HTPA 2L9HA 1X3FA 2EYJA 1N8RC 4B3SQ 5E4WC 2ZM6Q 1B3QA 4NMZA 4LK1C 2BOSA 1NBWA 4C3JG 4A3LG 1CT1D 2CFMA 3E6ZX 5JVG3 4DN4M 1X3PA 4JYAL 2I46A 2UUBQ 3NE5B 2R92H 4GS3A 1B50A 5CV6A 4L8JA 1V1QA 4BWGB 1A6XA 1ZYRC 2KJXA 2PW5A 4DV0L 1JJGA 3TP7A 1I3QH 3NENA 1UNSA 2ZTEA 5GADC 1X32A 2EYOA 1KDAA 1MI2A 2KHJA 3OW2A 1MKHA 2VXWA 2NBFA 1A3TA 1L0XB 1IHZA 2A19A 2F3IA 4GNXB 2CVRA 4HN7A 2L4NA 1K73C 1GOZA 4Z9CB 3K0XA 4A3IB 2DY7A 3P20A 4N8FA 4A3GG 2D9UA 4A3KH 4YHHQ 2WB1G 1DOLA 3RLFA 2R92B 2BE5D 1TWAH 1VMPA 3D8GA 2F0TA 2K03A 3SHLA 3EVQA 1WTXA 4EQ5A 5GQOA 1JE5A 1B9NA 1TR5A 3BG3A 1VQGA 2JA8G 4P75A 1I3QB 4IFDG 1GKHA 4IOAA 2UXCQ 2MO0A 1GXDC 3V2TA 1XTCD 4IO9A 2J0TD 2B2UC 1BBUA 3MWYW 2IHFA 4IJHA 4RHSA 1HHVA 2RHSB 2Z1CA 1BCPB 2WB1E 4LFAQ 2QCPX 5JOBA 1CHQD 1EY8A 3R93A 4GOPB 1HZCA 2LXJA 1KNAA 5C4ZA 1LYLA 1NMFA 1SRUA 3SDZA 1PH2A 1D6EC 2N8NA 5KEEA 4A3KB 1J8IA 1SNCA 3CCEA 3O13A 1U4MA 4JBMA 4LFCQ 4KJOA 5C0XH 5IYBG 1CZGA 4LF7L 2HQLA 4KY5A 2WAQE 1JOKA 4DNTB 1ICWA 1PFNA 1PZID 3TREA 1EEFD 3MTSA 1HQRD 4K5XA 2Q8IB 2XWJB 3U9OA 3GTKH 2K14A 1WD1A 2EY1A 1YNND 4PZ8A 4QL5A 4ZK9B 1UE7A 1HUNA 2RDFA 4HSPA 4FDBA 3AU7A 1DCZA 3K7AH 4U673 4WORA 1CKNB 3SGIA 4DXGA 1SYDA 4TKOB 4M1UB 4HJ9A 2XRSD 2CQOA 4DR5Q 1KD1C 5M3MG 3SK4A 2G5DA 2MUYA 4LUZA 1J5EQ 1VQBA 4KHPQ 1HZ9A 2WACA 1C0AA 4C1NI 3BJUA 4GNXA 1CFMA 2A68D 1KAAA 1RIPA 2R6GA 5FOBB 1XJVA 3K5LA 4C3IH 4HIOA 1WTPA 1KAWA 3GTKB 1LTTD 2YV5A 3LNNA 3S24A 1EL0A 2HHHL 5ELNA 5I9OA 4XT1B 3D6WA 3M7GA 4DU9A 1GM5A 1EFID 1U4LA 4JPBW 3K7AB 1STEA 2RCNA 4DKAC 1ZKOA 1Q7YC 2C9OA 1T5EA 4GN3B 5IT9c 2XTIA 4DV4Q 3J7AV 3STBC 3H15A 4JC0A 2LMCB 1E0BA 2EY2A 2SNSA 4DK1A 4LF7Q 4XYQA 1PRTF 1SYEA 5FLMG 1XPRA 2B8FA 5EJWA 5AJ3Q 1AFPA 5CBAE 3E3XA 4GOPA 3OTOQ 1VQ7A 1V8QA 1WFQA 4DV1Q 1YHBA 4BY1G 1R9TH 1GHKA 5A35A 1SSOA 1DJRD 3OWFA 4ZKBB 3CCUA 3K59A 2AWOA 3OW7A 2YTVA 2H5XA 1EQRA 4A3BH 1MBYA 1JC7A 1B70B 2O5JC 3RR5A 1ESFA 2B3GA 5BN4A 3E0EA 3FDTA 3L2PA 1EIYB 1TWHH 5M3FB 4WJ4A 1B44D 1JWSD 2NZ1D 1UE5A 3SVMA 2HHHQ 3MZ5A 1N36L 2SNMA 3K58A 1R9TB 3MXNB 5CV5A 1RF2D 4I7AA 3TZUA 1HTLD 4ZAIA 1E3PA 4OWTB 3URYA 1ZXTA 5DEHA 4GKKL 2YYZA 1A2UA 3I2ZA 3NPPA 2HCCA 3Q6SA 4HIMA 1LT4D 1SFOH 4XXEA 2DY8A 1S3OA 5IE8A 4A3BB 1RTNA 2VQFQ 4A3EG 2AUJD 4A3DG 2K32A 4JI5L 3W3AA 1GD7A 2PO4A 3NHHA 1MIUA 1KC8C 4NXNL 2KCNA 1AN8A 4IZ8A 4JVZA 3HRZC 1K9MC 1I5FA 5LL6X 3T1HQ 1XPOA 5IYDH 3QOLA 2VZAA 3S1NH 4BBRH 4YY3Q 4OIKA 5KGUA 1HA6A 1C48A 2DGYA 1HQMC 4UHVA 1UAPA 1YBYA 3TMEA 4EQNA 3ULPA 1KHIA 1SFOB 1CI3M 2M2LA 4JV5L 5JEAJ 4UPAA 3VYUA 2LY7A 1Q46A 2A6EC 1ENFA 1O80A 1SXTA 2K1BA 2IY5B 1JT8A 4KKTA 1IW7D 4A93B 2PNHA 4B9XA 4IJLA 4O42A 1N9WA 2ZTDA 3S1NB 3PCOB 4BBRB 1WD0A 3DM3A 1H9RA 2MFIA 1A3VA 5FJ8H 1TQOA 1BF4A 2HDLA 3AB9A 4K6LA 3OYYA 4GNXC 2K50A 4JCVE 5I6YA 2NN6I 4A3IG 1IZ6A 1RODA 4DGZA 4BY7H 1LTRD 1L1OA 5DM73 1G91A 2GVAA 2R92G 1PYSB 1K28A 4CDCC 4UP8A 4POFA 4ZKCB 4DPGA 5ELCA 2K7VA 4DV6Q 3KJOA 1H9KA 3H3VI 4F7XA 2MHVA 2NTTA 2PI2A 5HURA 4V0BA 3ONAB 4RKLA 2F0MA 4QCLA 3KBXA 1YJ9A 4RCNA 4IPDA 1N32L 2L11A 1TXYA 5CC4A 2F0HA 1V43A 3I90A 1AZQA 1BCPC 2EQSA 2Y0SE 4GOPC 1IXRA 4IUTA 4BY7B 1STBA 3EIVA 2G9DA 3QOJA 3MFYA 4NB3A 4A3KG 1EIFA 3NQTA 3KF6A 4TRDA 1QVGA 1HFNA 3H6MA 1UE1A 3A0JA 1B53A 4XQQA 3IFTA 4Q0FA 1EZ8A 4JI0L 1PH4A 4Y52H 1J6QA 1G6PA 2JP1A 3A8KE 4JI8L 2Z4IA 1RHPA 2M00A 1CK1A 1S5FD 4B08A 2XRQD 1VMCA 2IL8A 3DM1A 4TSSA 5BN3A 2O5IC 1Y1WG 4JI3Q 2GN5A 4U68A 1HNZQ 2EPBA 5J1ZA 3UE0A 1LACA 1K8MA 4JI6L 1SNDA 3RD4A 1WTQA 1JWUD 2ATWA 1BOSA 1U0LA 1NMGA 4AH6A 3WWVA 3CU7A 1SE8A 2NTSA 2KQ3A 1LTGD 2K6AA 3UDGA 1H95A 1SROA 1KIXA 3I91A 4HIKA 4X62Q 1OXTA 5EQ0A 4NP5A 2P5ZX 1ENCA 3ITPA 2BH2A 3FPUB 4LF6Q 4ZLTF 3E0JA 3SE0A 1CA6A 5FLXE 5CBEE 3E9IA 3M3YH 4KD3A 4QUCA 1X3GA 3MEFA 5EBCA 4ZYSA 2E2JH 4JI0Q 4K2LA 4RG1A 5C44H 4EQPA 3F8TA 3PIOA 4JI8Q 1I6HH 4KY7A 5LMNL 1EOVA 5D3IB 5C3EH 2RF4A 2HQEA 3K80C 4DUZQ 1P16A 3S1MB 2K28A 4JI2Q 4ILWA 3HP3A 4AYBE 4Q5VA 4JI6Q 5M9OA 4LMQD 1VQLA 5EPKA 3M3YB 4B3MQ 3P7JA 1EQQA 2UXDL 2MPMA 4R4TA 2E2JB 5G3LF 3H0GH 2EVBA 3DMUA 4KN4C 5C44B 1I6HB 1QVFA 3F2CA 5M3FG 5GAHC 1MGSA 5CV9A 4RCOA 3PIO3 1N33Q 2N55A 4DV7L 1ZEQX 1YNJD 3PV0A 4KKSA 1MHWC 3NP8A 5KNBA 3L0OA 4XTCS 3U58A 2NN6H 5CORA 1EQTA 4GKJL 3BDCA 1G2SA 1K8GA 3BU2A 2L55A 4A3BG 4IOCA 1XNQL 5NUCA 4PG3A 3SXHA 3TN2A 1EYDA 1F2YA 3MC0B 1N34Q 1TKWB 4KV6A 3FRPB 3KDFB 3N52A 4O0AA 2RA4A 1TWFH 2KA7A 3J80c 2YTYA 2HD3A 3BDLA 3D0FA 4PZ6A 4BA2I 1KDCA 1I4HA 2F0WA 5E1FA 3NBIA 5CV7A 4A3CH 5J39A 4R4QA 4NPSA 4LF4L 5JJIA 5J3BA 2QEJC 1FNVA 4LW1A 2B2UA 5DM63 3JAMc 2QDBA 4A93G 2B2TA 3QWNA 4DV2L 1A2TA 3T13A 3LWUA 2FFKB 3A56A 3FP9A 1ML0D 4MN3A 1TWFB 4BBRG 4CDDC 3I4MH 1D5MC 1XTDA 1LLRD 3ER0A 3N6RA 2VQEL 3TBIB 1S5ED 3RN2A 3EJIA 1P8LA 5EKKA 4C3HB 2OXPA 4QQBX 1WCMH 2HIVA 1STGA 1XNQQ 2KHSA 2LFNA 4IUPA 2ZM6L 4B3SL 5GROA 5EGTA 2MQHA 5LMNW 1RKNA 1SMYC 1TWCB 4FXGC 4J15A 2JSOA 5CGKA 4A76A 2UUBL 4K14A 2RDHA 4MZ9A 3I56A 1CSQA 3HKZB 2L1BA 1Q1BA 1I4RA 4LF8L 4ZUIA 3K7UC 1EWCA 5K36H 3RZDH 2EIFA 5J22A 1HZBA 3I4MB 5C6AA 3HEJA 2F3VA 2KHIA 4KLKA 3U4VA 5FJ8G 4DR3Q 2R7ZG 5KNCA 2QKIC 4DAVA 4LF4Q 1WCMB 1PYBA 3KDFA 1GO3E 1PTOF 3DXJC 1SNMA 4BY7G 2WKDA 3JC66 1QE6A 4K2KA 5IGEA 3J81j 3PO2H 1K8OA 2FHTA 3RLNA 4YHHL 5JJZA 5IT9E 4DV2Q 1JICA 1S5CD 1PH3A 1BVSA 4EGVA 3K81C 3CHBD 1PRTD 1Y1VH 2F0DA 3LWEA 5IWAL 5ISRA 5IGDA 2JA9A 4QIWB 5IP9G 2EJGC 1HNWL 2PZTA 3Q8DA 2XWBB 1EYAA 4LFAL 1R4QB 3J7A5 1D2BA 3TRZA 1M90C 2BDOA 4Y7NH 2VY3A 1HA5A 4B3TL 1YHAA 3PO2B 1BUVT 2D0OA 4ZUJA 1W3SA 1JMCA 4LFCL 4G7OC 4LF8Q 3UI2A 1QVCA 2BE5C 1DGSA 3CCVA 1Y1VB 4WFN3 1JORA 3HOUH 2JE6I 4RA8A 1PH6A 2ZJRA 2IHEA 1LTID 1SBBB 5C0XJ 1NTGA 4QJFA 3T51B 1VQHA 1CM9A 4RGTA 2R93H 2NWGA 4HJAA 5A2QE 1CTMA 3BYTB 1WI5A 3IKJA 1Q82C 4XIGS 1TVXA 4CKBA 4H0LC 3AFQA 1U5KA 1F9RA 3M85A 2KOLA 3EBEA 5I4DA 3IFDA 1Q3LA 4DR5L 2LS01 3GV6A 3MEHA 2OTLA 4L5RC 1PH9A 1O7LA 4OWWB 1C9OA 1J5EL 1A63A 3KF8A 4B3RQ 5IWAQ 4RHRA 3S15H 1TU2B 3HOUB 4KHPL 2L12A 4RWSC 4PMCA 4A3JG 4F87A 1HNWQ 1EUJA 1EWHA 2JJQA 3FHWA 3OWEB 4S3SA 4XT3B 3S2DH 4A75A 2B2TC 1HFGA 3VDYA 1YNNC 1QZGA 4FXKC 1AE2A 2YTXA 1I94Q 4B3TQ 1W6KA 1DXMA 3Q22A 3CC7A 1X54A 1IKLA 1TWAB 4JI1Q 3RZOH 3NTKA 1FNUA 5LHY1 2SEBD 4DV4L 1LUZA 4DAYB 5C44G 3S1RH 1PTOH 2L5TA 2JA7H 3PUWA 2D5DA 3S15B 5AJ3L 2I5MX 3HOZH 2WKCA 1ENAA 2QILA 3D4RA 5EPLA 3CPWA 2A68C 3OTOL 2PMZE 3A8JE 4BA1I 5JAVA 3L3OC 1FD7D 5E7NA 4EVOA 4DV1L 3S2DB 1HJPA 2OQKA 3CMEA 4R4CA 1LT3D 4JK1C 3A5ZB 3I4OA 3NTHA 3PUVA 1SJED 2J7ZA 2FMMA 4DXFA 1CZWA 3RZOB 5IODA 2R7DA 1D5XC 3F1ZA 4LJZC 5IGFA 2L15A 2EXDA 2JA7B 3U4ZA 4O2DA 4DF7A 3HOWG 3C46A 3HOZB 3OIQA 4P71A 1G51A 3PF5A 2ZJQA 4XYOA 3A8IE 1A0IA 4YIJA 2I5HA 3A74A 3J7ZC 4CJ0B 1IBMQ 2AMCB 3CPFA 3WOEA 5ELOA 4QMGA 1Q81C 1T9HA 3OIPA 2NN6G 3TSSA 1YITA 1OXUA 5JJLA 1YJNA 1JJ2A 5I2XA 1EOTA 2E5LQ 5DAUA 1Y8OB 2A6HD 5FO7B 2VQFL 2EYHA 4BXXH 4YCWA 2UUCQ 3S17H 4IALA 1FR3A 4C3IB 2AUKA 4R8IA 3H3VC 3T1HL 1YIJA 2VUMH 1I4XA 4YY3L 1SAPA 1EU4A 3CCSA 1XMQQ 2CH4W 5T1GA 5LL6S 2Q8RE 3FEWX 1SLJA 1VQEA 4C3HG 2QEXA 4PMWA 3VYRA 1PH8A 2SOBA 3K5NA 2B29A 4QY7A 1K3BC 3M7NA 4FYDA 2EE1A 1D8LA 3HS0C 1Y69U 3VYTA 4X3KA 1S5DD 2EJMA 1IL2A 1HR0Q 2VUMB 1CKNA 3I55A 3I4MG 4FNFA 4DFAA 1LO5D 3CCRA 1Z6HA 3KLSX 2A73B 2CW0D 2D62A 2LXKA 3J7AF 1BNZA 1QOHA 1EIHA 1BDOA 1H9JA 2AQ2B 3HZXA 1LTAD 3GO5A 1WCMG 2EY6A 4KHZA 4IFDI 1CHPD 4L5QA 2R7FA 2KEDA 3BZDB 3VR6A 4GLXA 1JWMD 4POGA 1SEBD 3QR8A 4PZ7A 1PH7A 4NW2A 1TWHB 1KLUD 2JK8A 1RL2A 1KRSA 1PVOA 1IW7C 4DV6L 3QIAA 2NVYH 1VDZA 5K36G 5IT9L 2X69A 4OHJA 4JBWA 2B2WA 1JB3A 1RDPD 2B63H 4AQYL 5ELBA 1FGBD 1Y8NB 4X3UA 3S16H 4FF2A 2PZWA 2IPKD 1ET6A 3W5OA 5E4XA 3HOVH 2PW7A 4CJ1B 5KIXA 3RUZA 3H09A 3PO2G 2OWOA 1O7IA 3C1EA 3UE1A 4N9TA 3WDNA 1E24A 1KXLA 3J7YW 1F9QA 4LF9Q 2V1CC 3IL8A 2OTJA 2KUMA 1Y1VG 2Z8LA 1Q12A 2NVTH 4DR6Q 1Q8IA 2UUAQ 2B63B 1V1PB 1FL0A 1RTOA 2WV6D 4K6DA 3DEOA 4L63B 4LUVA 4DR4Q 3J81c 4H44C 3S16B 3I4NH 3R2IA 3X3NA 2KVMA 3EA6A 1QB5D 4JI3L 4MNOA 3HOVB 1WTWA 1VQFA 1TWGH 3FKIH 3NEMA 4IPGA 1HNZL 1HUMA 5A2QL 1K3RA 2AQ3B 3BVGA 2B39A 3MXNA 1HZAA 4HCEA 3NELA 4PNYA 2F3WA 4LNQA 3HOUG 3PMFA 1YEZA 5KYIA 1PRTB 2NUCA 4AQYQ 3CD6A 2DUDA 1E22A 2JXMB 4ME5A 3J80E 3QO2A 4X62L 3I4NB 3J80i 1I4QA 1EZ6A 5IGCA 4UP9A 4CBVA 2ES2A 4MTNA 1TWGB 3FKIB 4LF6L 4QB4A 2VB3X 5IP7H 3KUPA 2K5HA 2EYLA 4X3TA 4H13C 1JOOA 2KECA 3JAME 2YU9H 2N3SA 5C4XH 4HMIA 2D2CC 1OTCA 3JAMi 1ET9A 2PQEA 1T5XD 3IRBA 1D5ZC 3VR5A 2EZVA 3I70A 2NVQH 4A3LH 3G6JB 1X9NA 1ASZA 3MA2B 1GVPA 1QUQB 5HGQA 4DUZL 3A7AB 2K04A 4DR2L 5E3FA 3U9SA 2JYOA 1VQ9A 1IBLL 4JI2L 1AE3A 1NE3A 3MAQA 2H1EA 3RNUA 3OMCA 2HCIA 4DR1Q 4B3ML 5C0XG 4YWMA 1HRJA 3OMGA 3Q24A 3T16A 4CDEC 2JA7G 2PZUA 4K5VA 4DAMA 1WTHA 2EOTA 2XGTA 2QA4A 3HOZG 3TQYA 1LT6D 1F2ZA 1F9SA 1VQDA 4A3GH 1N33L 1WVLA 4K8IA 1VQ4A 1C4QA 1SJHD 1G8ZD 2ENBA 4CJ2C 3OOCA 1NY4A 4OELB 1TS3A 5ELFA 1KLGD 3T53B 1SNOA 1Q90A 2E75C 4JOIA 2OF1A 2B2WC 4IFDH 2F0SA 1FVIA 4OIJA 1PLFA 2TMPA 5EKIA 3HOYH 5F2DA 2I07B 1PTOD 3RN5A 5IY0A 1SN8A 2F0NA 1SMXA 2XSCA 1N34L 4ZRZA 1BXTA 1PH1A 4C3IG 1MD2D 3U50C 2I0QA 2WB1B 3I3CA 4DR2Q 4IUQA 2NB0A 3VR4A 1IBLQ 2NYZD 4OL7A 5JJKA 2N49A 4GN4B 2ZXOA 1YNJC 2ZJPA 2A5HA 3GTQH 4LFBQ 3I8ZA 1SR3A 3R2TA 3L7ZC 4IUNA 5EKLA 3HOYB 4C56C 1VQ8A 4BXXG 2WAQB 5IGBA 5M5YH 1NAPA 2PQAB 5I2YA 1GUGA 5C3EB 1NCVA 1VCIA 4IUVA 1WTRA 2XVSA 2VUMG 1HCZA 1PZKD 3CXCA 1GHJA 3K6OA 1FGUA 4LF5Q 3PF4A 1I50H 3KLWA 5T1IA 5M3MH 3D6CA 2AHOB 1D7QA 5M5WH 3ERSX 2SDFA 3GTQB 2JQOA 1S4ZA 2EYMA 1Z9FA 4XQNA 4IPHA 1J9OA 2VL6A 2WINB 3GTLH 3H0GB 1EU3A 3HFZB 1EYGA 3R3OA 1HXYD 1B3AA 1E1OA 3LX0A 1K0SA 5M5YB 1X55A 2A69D 4UP7A 1PXUA 3KFUA 3CKIB 5BN5A 3TP8A 2PI2E 1I50B 1U4PA 1RJTA 1HNXQ 5M5WB 4X64Q 4OGQC 4C2MH 4DR3L 3S14H 3EN2A 2EDGA 1DOMA 1LM0A 2XNAC 3GTLB 3CRLC 3RLOA 2F4VQ 1G291 1EYCA 4F88A 3TP5A 1VS0A 4BY1H 3ICEA 1LTLA 1ICFB 2K33A 3A7LA 3ND8A 4I65A 1NJIC 3M4QA 5IYDG 4CGYB 1DZ1A 1E2ZA 2RBMA 2QGQA 4WJ3M 1LV9A 4CKCA 4P74A 3UDFA 2B63G 4O1NA 3UDIA 3S2HH 5I6WA 1DOKA 2FXQA 2F0FA 4C2MB 2A74C 2KBNA 2E2HH 2JA6H 5C4JH 3HOVG 3AMUA 2PQAA 3T1YL 1JE4A 2F52A 3DUZA 3D4DA 2IX1A 1BCPF 2CWPA 5D14A 1YHQA 1QCBD 1VQJA 3BZKA 1L0WA 3L9AX 1X6OA 4HCSA 2OQ0A 2LKVA 4DR7Q 1B7YB 4JOIC 2R3ZA 4WJWA 4MHEA 1PRTC 1SE4A 4X65Q 3K8AA 1NNXA 3UDXA 5H1SE 1M8AA 4OWXB 1NSNS 1VF5C 3I4NG 3A54A 2RHQB 3TS0A 2JA6B 1H9MA 2F0LA 3FKIG 1Y8PB 2OEOA 4OONA 2J4XA 3SK5A 1D1KA 1EY5A 1Y14B 4DV3Q 4HTHA 4FF4A 1U4RA 1GUWA 1II3A 1JJCB 1I4GA 4FP5D 5IOCA 1FYCA 2B2YA 4FXDA 1H9SB 2PYKA 3CRKC 3RZDB 3K5OA 4JI7L 2RVLA 3SK6A 3JAML 1VQOA 4B3RL 1UEBA 1AH9A 2RSNA 1A8VA 4R4OA 5KNDA 3D3RA 3AYHB 1PZJD 4DK3C 5C4HA 1FNWA 3PGZA 1KTKA 1STAA 3T1YQ 3F2BA 5DNFA 3CF5A 1I94L 4ME3A 5KRUA 1IBKQ 2KCMA 1M1KC 3I72A 2I5LX 1VQCA 2BA0A 5C5LA 4HAEA 3GQBA 1GJXA 4JI1L 1HPCA 3QB3A 4OO1I 4RKBA 4L5SA 2KCCA 1VQ6A 4QGUA 1I4PA 2X6GA 3E9HA 1Q86C 2ALYB 2A1AA 4A3IH 5M5XH 5BR8L 1KL9A 3NBHB 1CQVA 3HOXH 1C7YA 2G9HD 2DNEA 3PUXA 4FVMA 1OXSC 2EY5A 4Y7NB 4AIMA 1L0YB 2C35B 2NVXH 1A62A 3KLRA 5K5PA 2MGSA 4LWCA 4DK6C 2FMCA 5C5MA 5FLXL 1STYA 3G4SA 2JEAI 2MJ8A 2AKWB 4JI7Q 4JBJA 1F2LA 1QJOA 2K5NA 2EYPA 4LAAA 1FJGQ 1MSGA 4TQUS 3ULJA 1CKMA 2VB2X 5CV4A 4X66Q 1YNXA 5M5XB 2EYFA 4DV5Q 4RMFA 4DUYQ 5GAGC 3HOXB 2R93B 1M4VA 1TS5A 1SYBA 1G6ZA 1ZYRD 2RDGA 2Y0SB 3TS2A 1V1OA 3E5SA 2CWAA 2LSSA 3BVZA 1H9SA 3Q0AA 3CCJA 4NDXA 1IBML 4JBKA 2ASBA 4A3FH 2NVXB 3MHBA 3CC2A 2E2DC 3GP7A 2E8GA 3SR1A 1Z47A 2B2VA 3HOYG 3NK9A 2K5DA 4OX9Q 4ODGA 2E5LL 2WAQG 2QDLA 4EQOA 1Y1WH 4IQZA 2UUCL 2O4XA 5C3EG 2DJGC 5BR8Q 2DJFC 4JYAQ 1WTOA 1WOCA 1B9MA 1AP0A 3CMAA 1GUNA 4J6HA 4A3MH 2MO1A 3J81E 3PQIA 1E1TA 4DV0Q 1XMQL 1BO0A 4ID6A 2IJ0A 3J81i 2VW9A 2F0OA 4DK0A 4A3FB 1TS4A 3SK8A 4B9WA 4MTKA 1YVCA 1BR9A 1RCVD 1VQAA 5D3DA 1EFWA 3KYHC 4K8JA 2CCZA 3TP6A 4ALPA 3H0GG 2F0QA 4A4IA 3S1RB 1PTOB 3GDEA 3NBHA 2HIXA 1Y1WB 2A6HC 1ILPA 2JA5H 2Q2HA 1K8AC 3PIPA 1AZPA 1JR0D 1WYDA 1VQIA 5IGGA 1EIGA 1HR0L 3S9WA 1GUOA 3V96A 4KK7A 5AFWA 4A3MB 1TT2A 2B2YC 5CMDA 3KLSA 2E76C 2F1MA 5FO9B 2ZT9C 5ELDA 2Q2TA 1RD9D 4PQXA 3EFXD 2EJFC 1MJCA 4FF3A 5COYA 5FO8B 2PCFB 1S5BD 1S72A 3OHXC 3KBGA 2K52A 3VA7A 4QUFA 3CCMA 5HY6A 2GA4B 2Z6BA 1V9PA 1A3UA 2JA5B 4GLVB 2V4DA 3MXUA 3HG9A 4QF4A 2ICEC 1IYUA 3W2DA 3BVMA 4TVAB 4DA2A 4KI0A 2VNUD 3KOJA 3PIP3 3GTPH 4ABNA 1XMOL 4K0KL 4M8AA 3Q23A 1W2BA 3H94A 4AYBB 3AFPA 4KJNA 3M4OH 1IYVA 4DAYA 2CW0C 4L6TB 4A3CG 2R61A 3VYSA 5M3FH 2MP1A 1WTVA 3PUYA 3K0YA 3NXWA 1EQVA 1SE2A 4R4IA 2IX3A 2ZXPA 1UE6A 3S17B 2F03A 1R4PB 2C5CA 1LTBD 4HIDA 3HKZG 4LF9L 3RMHA 1AEXA 5IYCH 3KK7A 4OO1H 3G71A 4FF1A 4DR6L 1BBXC 3STBD 4CHTB 2DN8A 3M4YA 3B6YA 2UUAL 3GTPB 1STNA 1QNUA 2F0JA 1LABA 1QWYA 1Q8KA 3M4OB 4DR4L 2JA6G 2ICIA 4R1JA 1KNEA 3WOFA 1XWEA 1QILA 5FK9C 5FKAC 1KDBA 3MXGA 1L1OB 3HKZE 2H4OA 3T56B 2CH4A 2K01A 1CSPA 1F2MA 1PV4A 3LGJA 1BQQT 1TIID 4C1NK 1ONLA 4GZYC 1XMOQ 3CCLA 4K0KQ 3NQIA 2ZTCA 2B2VC 3EQLC 2MNAA 1X3EA 1X65A 2A8VA 4CKEA 1F9PA 4RGOS 3W1GA 1XNRL 2F0UA 1GUTA 4A93H 3VA5A 1U9RA 2Q8TA 1PMRA 3NWTA 3KF6B 1TS2A 2FJ2A 4RFBA 4I7ZC 1CKOA 1CA5A 3C3LA 4EX5A 2HT1A 5G3LD 1W6JA 1HR0W 2B8GA 2NVYB 1XPUA 1ILQA 2KCTA 3H91A 4QIWE 4IURA 2E74C 5EPJA 4HJ5A 1PFSA 4JI4L 4BBSH 4KKUA 3R8BA 2WP8J 3GV3A 2WIIB 3G48A 1LTSD 4G7HC 4CDFC 5C3WA 3IAYA 1K83H 4RH6A 4DNIA 3DHQA 4IUUA 1B1ZA 3ZYYX 5CR3A 1O78A 1XYIA 2Q2UA 1N36Q 3SEBA 3PO3H 3BDOA 4YCUA 2IT1A 3CAMA 4DR1L 1PA6A 5I9PA 1SYCA 3AEVA 4GKKQ 4P73A 2R7ZH 2NVTB 1I6VC 4HJ7A 4KY6A 2A6ED 3PUZA 4OEMB 3ULLA 4BBSB 5JPNC 1XNRQ 4KMUC 1NUCA 4JI5Q 3HOXG 2R93G 3BYYB 4KHVA 1EEID 2VS1A 2Y0SG 4NXNQ 1K83B 3CW2C 1NR2A 4KD4A 2L0CA 3GD7A 2KEEA 3HGBA 3W1BA 3PO3B 1BKBA 3C1FA 2CKZB 4UAIA 5JEAH 4P2CB 3TZDA 5IP9H 1O7ZA 3M9BA 2R7ZB 4IFDJ 3MVVA 4JI4Q 4MIUA 3GTOH 4JV5Q 2NZOA 3G6EA 4C3JH 1SNQA 2EXZA 4R9WA 1VQPA 4JW0A 4ULLA 4H7BA 3EROA 1TY0A 1Q1EA 3D4WA 5KYLA 1XX8A 2Z6KA 4A3FG 1VQ5A 4LFBL 3J81L 1ASYA 2XN9C 1B8AA 1V1PA 3CQZH 1JCKB 3HKSA 1SE3A 2E2IH 2YU9B 2X6LA 5C4XB 1PYWD 1OXVA 2F0EA 1BCPD 2QF7A 1PTOC 4HJ8A 3FMCA 3GTOB 3F2DA 1KQSA 4C3JB 2F0GA 2NVQB 3ZJYC 2Z0SA 1KRTA 4X6AH 4IN3A 4LF5L 1BBWA 2OT2A 4A3MG 1Z7TA 4F8MA 5CYUA 4N9PA 3OSOA 1SDFA 3S1QH 1QNKA 3QG1A 2JA8H 3NUCA 2F4IA 4NXML 3GTJH 3CQZB 1N32Q 3TDQA 3CCQA 2HDMA 2E2IB 3X3MA 4A3JH 4KN7C 2N78A 3BS1A 3FPPA 1A15A 1E2WA 3MFGA 4NKLA 4XQJA 1EY0A 1OO9B 3S1MH 2CHBD 2JA5G 4JG2A 2ZXRA 4V190 4A3GB 2K5WA 4BS9A 2QW7A 1UEAB 1DYQA 4AYBG 3ERQA 2HUGA 3A55A 1HNXL 1JOQA 3PSIA 2IWHA 5IYBH 3S1QB 4X64L 2JA8B 4YWKA 4X3SA 5EBDA 2N88A 4RAUC 1XXGA 2K4KA 3GTGH 3GTJB 4A3JB 1SYFA 1O7YA 3FVQA 1EY6A 2F4VL 1QUQA 4HR7B 2FINB 4FO2A 5HGTA 2DNCA 4G7ZC 2K75A 2PMZB 1G2TA 2A69C 3I7FA 5LMUL 3AQQA 1JQYD 5IIFA 3GTMH 2ID0A 3I73A 2CQAA 3MXPA 1EWIA 4J8QA 4K5WA 5ELEA 5EAYA 4NXMQ 1S40A 1QZHA 3DWQA 2RQXA 3HOWH 3GTGB 1F77A 1B4OA 2AWNA 2RCFA 1PHJA 1B2TA 1YJWA 1EY7A 1L1OC 2K5QA 1GUSA 1YI2A 1DONA 3A5UA 3NWSA 2OCEA 2F0KA 3P75A 1UUPA 1DD2A 4LUOA 3VR3A 5IYCG 3ND9A 4OO1G 2O2LD 5DLQE 3C2PA 5C3XA 4DR7L 1MSHA 2JEBI 1JB7A 1ESRA 3GTMB 5D65A 1PDQA 4X65L 1TY2A 5M3MB 2UU9L 5LMNQ 1VQNA 2RSOA 5FLMH 1UWVA 3OPOA 1E7ZA 1OXXK 2BH8A 3HOWB
chains in the Genus database with same CATH topology
3DWPA 3P1HA 2BCOA 1PFMA 4PMBA 1EY9A 1AW7A 2IX0A 4ZQ3A 4R8NA 1C8CA 3I4LA 1E2VA 2K05A 4HMJA 1SYGA 2M9VA 1STHA 5C0XI 4RGMA 4DNRB 1EY4A 3S14B 3F2UA 5TSSA 4G4KA 3K5MA 4BY1B 4PV1C 2BDNA 1SNPA 3T4AC 4HSVA 4E6IA 2PPBC 1KABA 2F0VA 4KTAA 3S2HB 3QJYA 1X3QA 1QG7A 3V05A 1IL8A 2Z4HA 2XIWA 2IW3A 2E2HB 2AQ1B 3DWAA 1CQFA 5C4JB 3J80L 4HEDA 1PFBA 4XDXA 5CV8A 1LT5D 3D31A 3VR2A 5JPMC 4J1MA 4G57A 2F0IA 5JVH3 4DAPA 1SMYD 1DM0B 4A3EB 4A3DB 1VF7A 2RKSA 3DEPA 4RGNA 1NR4A 1D1IA 2PNRC 2TSSA 3K57A 1IKMA 4WRDA 2BA1A 5JEAG 3G7LA 3NTIA 4UDUC 3NSWA 2F0PA 1HTPA 2L9HA 2EYJA 5E4WC 4NMZA 4LK1C 2BOSA 4C3JG 1CT1D 5JVG3 3E6ZX 4DN4M 1X3PA 2I46A 3NE5B 1B50A 5CV6A 4L8JA 1A6XA 4BWGB 1ZYRC 2KJXA 2PW5A 3TP7A 1UNSA 1X32A 2EYOA 1KDAA 1MI2A 2VXWA 2NBFA 1A3TA 1L0XB 1IHZA 2CVRA 4HN7A 2L4NA 1GOZA 4Z9CB 4A3IB 2DY7A 3P20A 2D9UA 1DOLA 3RLFA 2R92B 2BE5D 1VMPA 3D8GA 2F0TA 2K03A 3SHLA 3EVQA 1WTXA 1B9NA 1TR5A 3BG3A 1I3QB 4IFDG 1GXDC 3V2TA 1XTCD 2J0TD 2B2UC 3MWYW 4RHSA 1HHVA 2Z1CA 1BCPB 2QCPX 5JOBA 1CHQD 1EY8A 3R93A 1KNAA 5C4ZA 3SDZA 1D6EC 5KEEA 4A3KB 1J8IA 1SNCA 3O13A 1U4MA 4KJOA 5C0XH 1CZGA 4KY5A 1JOKA 4DNTB 1ICWA 1PFNA 1PZID 1EEFD 3MTSA 1HQRD 4K5XA 2Q8IB 2XWJB 3U9OA 1WD1A 2EY1A 1YNND 4ZK9B 1HUNA 2RDFA 4HSPA 3AU7A 1DCZA 4U673 4WORA 4DXGA 1SYDA 4TKOB 4M1UB 2XRSD 3SK4A 2MUYA 2WACA 4C1NI 1CFMA 2A68D 1KAAA 2R6GA 5FOBB 3K5LA 1WTPA 3GTKB 1LTTD 1EL0A 3LNNA 5I9OA 4XT1B 3D6WA 3M7GA 4DU9A 1EFID 1U4LA 3K7AB 1STEA 1ZKOA 2C9OA 1T5EA 3J7AV 2LMCB 1E0BA 2EY2A 2SNSA 4DK1A 4XYQA 1PRTF 1SYEA 2B8FA 5EJWA 1AFPA 5CBAE 1V8QA 1GHKA 5A35A 1SSOA 1DJRD 3OWFA 4ZKBB 3K59A 2AWOA 3OW7A 1JC7A 1MBYA 2O5JC 1ESFA 5BN4A 3FDTA 5M3FB 1B44D 1JWSD 2NZ1D 3SVMA 3MZ5A 2SNMA 3K58A 1R9TB 5CV5A 1RF2D 3TZUA 1HTLD 4ZAIA 3URYA 1ZXTA 5DEHA 2YYZA 1A2UA 3NPPA 2HCCA 3Q6SA 1LT4D 4XXEA 2DY8A 4A3BB 1RTNA 2AUJD 2K32A 3W3AA 2PO4A 3NHHA 2KCNA 1AN8A 4IZ8A 3HRZC 5LL6X 3QOLA 4OIKA 5KGUA 1HA6A 1C48A 1HQMC 1UAPA 3TMEA 4EQNA 1SFOB 1CI3M 2M2LA 5JEAJ 3VYUA 2LY7A 2A6EC 1ENFA 1O80A 1SXTA 2K1BA 4KKTA 1IW7D 4A93B 4B9XA 4O42A 3S1NB 4BBRB 1WD0A 1H9RA 1A3VA 1TQOA 1BF4A 2HDLA 3AB9A 4K6LA 5I6YA 2NN6I 1RODA 4DGZA 1LTRD 5DM73 1G91A 4ZKCB 5ELCA 2K7VA 1H9KA 4F7XA 2MHVA 2NTTA 5HURA 4V0BA 3ONAB 4RKLA 2F0MA 4QCLA 3KBXA 4RCNA 2L11A 5CC4A 2F0HA 1V43A 3I90A 1AZQA 1BCPC 4IUTA 4BY7B 1STBA 2G9DA 3MFYA 3QOJA 3NQTA 4TRDA 1HFNA 3H6MA 4XQQA 1B53A 3IFTA 4Q0FA 1EZ8A 2JP1A 3A8KE 2Z4IA 1RHPA 2M00A 1CK1A 1S5FD 4B08A 2XRQD 1VMCA 2IL8A 3DM1A 4TSSA 5BN3A 2O5IC 4U68A 2EPBA 5J1ZA 1LACA 1K8MA 1SNDA 3RD4A 1WTQA 1JWUD 1BOSA 3CU7A 2NTSA 2KQ3A 1LTGD 2K6AA 3I91A 1OXTA 5EQ0A 4NP5A 1ENCA 3ITPA 3FPUB 4ZLTF 3E0JA 3SE0A 1CA6A 5FLXE 5CBEE 4KD3A 4QUCA 5EBCA 4ZYSA 4K2LA 4EQPA 4KY7A 5D3IB 2HQEA 3S1MB 2K28A 4ILWA 3HP3A 4Q5VA 5M9OA 4LMQD 5EPKA 3M3YB 3P7JA 2MPMA 2E2JB 5G3LF 2EVBA 3DMUA 4KN4C 5C44B 1I6HB 1MGSA 5CV9A 4RCOA 3PIO3 2N55A 1ZEQX 1YNJD 3PV0A 4KKSA 3NP8A 5KNBA 4XTCS 2NN6H 5CORA 1EQTA 3BDCA 1G2SA 2L55A 5NUCA 3SXHA 3TN2A 1EYDA 1F2YA 3MC0B 1TKWB 4KV6A 3FRPB 3N52A 2RA4A 2KA7A 3BDLA 4BA2I 1KDCA 1I4HA 2F0WA 5E1FA 3NBIA 5CV7A 5J39A 2QEJC 1FNVA 5DM63 2B2UA 2QDBA 2B2TA 3QWNA 1A2TA 3T13A 3LWUA 2FFKB 3A56A 1ML0D 4MN3A 1TWFB 1D5MC 1LLRD 3N6RA 3TBIB 1S5ED 3EJIA 5EKKA 4C3HB 2OXPA 1STGA 2KHSA 2LFNA 4IUPA 5EGTA 1RKNA 1SMYC 1TWCB 4FXGC 2JSOA 5CGKA 4K14A 2RDHA 3HKZB 2L1BA 1Q1BA 1I4RA 4ZUIA 1EWCA 5K36H 5J22A 3I4MB 5C6AA 3HEJA 2F3VA 5KNCA 2QKIC 4DAVA 1WCMB 3DXJC 1PTOF 1SNMA 2WKDA 4K2KA 1QE6A 5IGEA 1K8OA 2FHTA 5JJZA 5IT9E 1JICA 1S5CD 4EGVA 3CHBD 1PRTD 2F0DA 3LWEA 5ISRA 5IGDA 4QIWB 2EJGC 2PZTA 2XWBB 1EYAA 1R4QB 1D2BA 2BDOA 1HA5A 3PO2B 1BUVT 4ZUJA 4G7OC 3UI2A 2BE5C 1Y1VB 4WFN3 1JORA 2JE6I 4RA8A 1LTID 1SBBB 5C0XJ 3T51B 1CM9A 4RGTA 2NWGA 5A2QE 1CTMA 3BYTB 3IKJA 4XIGS 1TVXA 4CKBA 4H0LC 1F9RA 3M85A 2KOLA 5I4DA 3IFDA 1Q3LA 2LS01 3GV6A 3MEHA 1O7LA 3KF8A 4RHRA 3HOUB 1TU2B 2L12A 4RWSC 4PMCA 4F87A 1EWHA 3OWEB 4S3SA 4XT3B 2B2TC 1HFGA 1YNNC 4FXKC 1W6KA 1DXMA 3Q22A 1IKLA 1TWAB 3NTKA 1FNUA 5LHY1 2SEBD 1PTOH 2L5TA 3PUWA 2D5DA 3S15B 2WKCA 1ENAA 2QILA 3D4RA 5EPLA 2A68C 3A8JE 5JAVA 4BA1I 3L3OC 1FD7D 4EVOA 3S2DB 1LT3D 4JK1C 3NTHA 3PUVA 1SJED 2J7ZA 2FMMA 4DXFA 1CZWA 3RZOB 5IODA 1D5XC 4LJZC 5IGFA 2JA7B 4DF7A 3C46A 3HOZB 3OIQA 4XYOA 3A8IE 4YIJA 4CJ0B 3WOEA 4QMGA 3OIPA 2NN6G 3TSSA 1OXUA 5I2XA 1EOTA 5DAUA 1Y8OB 2A6HD 5FO7B 2EYHA 4IALA 1FR3A 4C3IB 2AUKA 4R8IA 3H3VC 1I4XA 1SAPA 1EU4A 5T1GA 5LL6S 2Q8RE 3FEWX 4C3HG 4PMWA 3VYRA 2SOBA 3K5NA 3M7NA 4FYDA 2EE1A 3HS0C 1Y69U 3VYTA 4X3KA 1S5DD 2EJMA 2VUMB 4FNFA 4DFAA 1LO5D 1Z6HA 3KLSX 2A73B 2CW0D 2D62A 3J7AF 1BNZA 1QOHA 1EIHA 1BDOA 1H9JA 2AQ2B 3HZXA 1LTAD 3GO5A 2EY6A 4KHZA 4IFDI 1CHPD 2KEDA 3BZDB 3VR6A 1JWMD 1SEBD 4NW2A 1TWHB 1KLUD 1IW7C 3QIAA 1VDZA 5K36G 5IT9L 2X69A 4OHJA 4JBWA 2B2WA 1JB3A 1RDPD 5ELBA 1FGBD 1Y8NB 4X3UA 4FF2A 2PZWA 2IPKD 1ET6A 5E4XA 2PW7A 4CJ1B 5KIXA 3RUZA 3H09A 3C1EA 4N9TA 3WDNA 3J7YW 1F9QA 3IL8A 2KUMA 2Z8LA 1Q12A 1Q8IA 2B63B 1V1PB 1RTOA 2WV6D 4K6DA 3DEOA 4L63B 4H44C 3S16B 3R2IA 3X3NA 2KVMA 3EA6A 1QB5D 3HOVB 1WTWA 1HUMA 5A2QL 2AQ3B 3BVGA 2B39A 3MXNA 4HCEA 4PNYA 2F3WA 3PMFA 5KYIA 1PRTB 2NUCA 2JXMB 4ME5A 3J80E 3QO2A 3I4NB 1I4QA 1EZ6A 5IGCA 4CBVA 1TWGB 3FKIB 4QB4A 2VB3X 3KUPA 2EYLA 4X3TA 4H13C 1JOOA 2KECA 3JAME 4HMIA 2D2CC 1ET9A 2PQEA 1T5XD 2EZVA 1D5ZC 3VR5A 3I70A 3G6JB 3MA2B 3A7AB 2K04A 5E3FA 3U9SA 2JYOA 3MAQA 2H1EA 3OMCA 2HCIA 5C0XG 1HRJA 3OMGA 3Q24A 3T16A 2PZUA 4K5VA 2EOTA 1LT6D 1F2ZA 1F9SA 1WVLA 4K8IA 1C4QA 1SJHD 1G8ZD 2ENBA 4CJ2C 3OOCA 5ELFA 1TS3A 1KLGD 3T53B 1SNOA 1Q90A 2E75C 4IFDH 2OF1A 2B2WC 2F0SA 4OIJA 1PLFA 2TMPA 5EKIA 5F2DA 2I07B 1PTOD 2F0NA 2XSCA 4ZRZA 1BXTA 4C3IG 1MD2D 2WB1B 3I3CA 4IUQA 2NB0A 3VR4A 2NYZD 4OL7A 2ZXOA 1YNJC 2A5HA 3I8ZA 3R2TA 3L7ZC 4IUNA 5EKLA 3HOYB 4C56C 2WAQB 5IGBA 1NAPA 5I2YA 1GUGA 5C3EB 1NCVA 1VCIA 4IUVA 1WTRA 2XVSA 1HCZA 1PZKD 1GHJA 3K6OA 5T1IA 3D6CA 2SDFA 3GTQB 1S4ZA 2EYMA 4XQNA 1J9OA 2WINB 3H0GB 1EU3A 3R3OA 1HXYD 1B3AA 3LX0A 5M5YB 2A69D 1PXUA 3CKIB 5BN5A 3TP8A 1I50B 1U4PA 1RJTA 5M5WB 4OGQC 2EDGA 1DOMA 2XNAC 3GTLB 3CRLC 1G291 1EYCA 4F88A 3TP5A 2K33A 3A7LA 3ND8A 4I65A 4CGYB 1DZ1A 1E2ZA 2RBMA 1LV9A 4CKCA 4O1NA 5I6WA 1DOKA 2F0FA 4C2MB 2A74C 3AMUA 1JE4A 3DUZA 3D4DA 2IX1A 1BCPF 5D14A 1QCBD 3L9AX 4HCSA 2LKVA 2R3ZA 4WJWA 4MHEA 1PRTC 1SE4A 1M8AA 1NSNS 1VF5C 3A54A 2JA6B 1H9MA 2F0LA 1Y8PB 2OEOA 2J4XA 3SK5A 1D1KA 1EY5A 4HTHA 4FF4A 1U4RA 1GUWA 1II3A 1I4GA 4FP5D 5IOCA 1FYCA 2B2YA 4FXDA 1H9SB 2PYKA 3CRKC 3RZDB 3K5OA 2RVLA 3SK6A 3JAML 2RSNA 5KNDA 3D3RA 1PZJD 5C4HA 1FNWA 1KTKA 1STAA 5DNFA 5KRUA 3I72A 2BA0A 5C5LA 4HAEA 3GQBA 1GJXA 1HPCA 3QB3A 4OO1I 4RKBA 2KCCA 1I4PA 2X6GA 1CQVA 2G9HD 2DNEA 3PUXA 4FVMA 1OXSC 2EY5A 4Y7NB 1L0YB 3KLRA 5K5PA 2MGSA 2FMCA 5C5MA 5FLXL 1STYA 2JEAI 2MJ8A 1F2LA 1QJOA 2EYPA 4LAAA 1MSGA 4TQUS 2VB2X 5CV4A 5M5XB 2EYFA 3HOXB 2R93B 1M4VA 1TS5A 1SYBA 1G6ZA 1ZYRD 2RDGA 2Y0SB 1V1OA 3E5SA 3BVZA 1H9SA 3Q0AA 4NDXA 2NVXB 3MHBA 2E2DC 3GP7A 3SR1A 1Z47A 2B2VA 3NK9A 2K5DA 4ODGA 4EQOA 4IQZA 2O4XA 1WTOA 1B9MA 1AP0A 1GUNA 4J6HA 3J81E 1BO0A 4ID6A 2IJ0A 2F0OA 4DK0A 4A3FB 1TS4A 3SK8A 4B9WA 1BR9A 1RCVD 5D3DA 4K8JA 3TP6A 2F0QA 3S1RB 1PTOB 3NBHA 1Y1WB 2A6HC 1ILPA 1AZPA 1JR0D 5IGGA 1EIGA 3S9WA 1GUOA 3V96A 4KK7A 5AFWA 4A3MB 1TT2A 2B2YC 5CMDA 3KLSA 2E76C 2F1MA 5FO9B 2ZT9C 5ELDA 1RD9D 4PQXA 3EFXD 2EJFC 4FF3A 5COYA 5FO8B 2PCFB 1S5BD 3OHXC 3KBGA 3VA7A 4QUFA 2GA4B 2JA5B 1A3UA 2V4DA 3MXUA 3HG9A 4QF4A 2ICEC 1IYUA 3W2DA 3BVMA 4DA2A 4KI0A 2VNUD 3PIP3 4ABNA 4M8AA 3Q23A 3H94A 4AYBB 4KJNA 1IYVA 4DAYA 2CW0C 4L6TB 2R61A 3VYSA 2MP1A 1WTVA 3PUYA 3K0YA 3NXWA 1EQVA 1SE2A 2IX3A 2ZXPA 3S17B 2F03A 1R4PB 2C5CA 1LTBD 3RMHA 1AEXA 4OO1H 3KK7A 4FF1A 1BBXC 4CHTB 2DN8A 3M4YA 3GTPB 1STNA 1QNUA 2F0JA 1LABA 1QWYA 3M4OB 2ICIA 1KNEA 3WOFA 1XWEA 1QILA 5FK9C 5FKAC 1KDBA 3MXGA 2H4OA 3T56B 2K01A 1F2MA 1BQQT 1TIID 4C1NK 1ONLA 4GZYC 3NQIA 2B2VC 3EQLC 4CKEA 1F9PA 4RGOS 2F0UA 1GUTA 3VA5A 1U9RA 2Q8TA 1PMRA 3NWTA 1TS2A 2FJ2A 4RFBA 4I7ZC 1CA5A 3C3LA 5G3LD 1W6JA 2B8GA 2NVYB 1ILQA 3H91A 4IURA 2E74C 5EPJA 4KKUA 3R8BA 2WP8J 3GV3A 2WIIB 1LTSD 4G7HC 5C3WA 3IAYA 4RH6A 3DHQA 4IUUA 1B1ZA 3ZYYX 5CR3A 1O78A 1XYIA 3SEBA 3BDOA 2IT1A 5I9PA 1SYCA 2NVTB 1I6VC 4KY6A 2A6ED 3PUZA 4BBSB 5JPNC 4KMUC 1NUCA 3BYYB 4KHVA 1EEID 1K83B 1NR2A 4KD4A 2L0CA 3GD7A 2KEEA 3HGBA 3PO3B 3C1FA 4UAIA 5JEAH 4P2CB 3TZDA 1O7ZA 2R7ZB 4IFDJ 3MVVA 4MIUA 1SNQA 2EXZA 4R9WA 4ULLA 4H7BA 3EROA 1TY0A 1Q1EA 3D4WA 5KYLA 1XX8A 3J81L 2XN9C 1V1PA 1JCKB 1SE3A 2YU9B 2X6LA 5C4XB 1PYWD 1OXVA 2F0EA 1BCPD 2QF7A 1PTOC 3FMCA 3GTOB 4C3JB 2F0GA 2NVQB 4IN3A 2OT2A 1Z7TA 4F8MA 5CYUA 4N9PA 3OSOA 1SDFA 1QNKA 3QG1A 3NUCA 2F4IA 3CQZB 3TDQA 2HDMA 2E2IB 3X3MA 4KN7C 3BS1A 3FPPA 1A15A 1E2WA 3MFGA 4NKLA 4XQJA 1EY0A 1OO9B 2CHBD 4V190 2ZXRA 4A3GB 2K5WA 4BS9A 1UEAB 1DYQA 3ERQA 2HUGA 3A55A 1JOQA 2IWHA 3S1QB 2JA8B 4X3SA 5EBDA 2N88A 4RAUC 1XXGA 3GTJB 4A3JB 1SYFA 1O7YA 3FVQA 1EY6A 4HR7B 2FINB 4FO2A 5HGTA 2DNCA 4G7ZC 2PMZB 1G2TA 2A69C 1JQYD 5IIFA 2ID0A 3I73A 2CQAA 3MXPA 4J8QA 4K5WA 5ELEA 3DWQA 2RQXA 3GTGB 1F77A 1B4OA 2AWNA 1B2TA 1EY7A 2K5QA 1GUSA 1DONA 3NWSA 2F0KA 3P75A 1UUPA 1DD2A 3VR3A 4OO1G 3ND9A 2O2LD 3C2PA 5C3XA 1MSHA 2JEBI 1ESRA 3GTMB 5D65A 1PDQA 1TY2A 5M3MB 2RSOA 3OPOA 1OXXK 3HOWB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EE1 A;  2NYZ D;  1SDF A;  2JP1 A;  1IKL A;  1JE4 A;  1PFM A;  1QNK A;  2MJ8 A;  3GV3 A;  4X3K A;  2L9H A;  1RHP A;  1F2L A;  1VMC A;  3QO2 A;  5E4W C;  2IL8 A;  1MSG A;  3I8Z A;  1QE6 A;  3DM1 A;  5D14 A;  2FHT A;  2HDM A;  4IUU A;  5JJZ A;  1C8C A;  4DN4 M;  1XYI A;  1X3P A;  4HCS A;  2K05 A;  1JIC A;  1EQT A;  5COR A;  1A15 A;  4OIK A;  1G2S A;  1HA6 A;  1BNZ A;  4U68 A;  5EPL A;  1B50 A;  1EIH A;  3TN2 A;  1G6Z A;  2R3Z A;  2EPB A;  2MP1 A;  1NAP A;  3KUP A;  4MHE A;  1WTV A;  4X3T A;  1WTP A;  3LWE A;  1EL0 A;  1NCV A;  2KEC A;  4IUV A;  1WTQ A;  1WTR A;  4XT1 B;  1M8A A;  1X32 A;  2M2L A;  3D6W A;  2KED A;  3N52 A;  3F2U A;  4NW2 A;  1U4L A;  2RA4 A;  2B2V A;  1MI2 A;  1O80 A;  2HUG A;  2K1B A;  2VXW A;  2J7Z A;  5T1I A;  2FMM A;  2MGS A;  4X3S A;  2CVR A;  2N88 A;  4RAU C;  2L4N A;  2SDF A;  3I91 A;  1BBX C;  1U4R A;  1S4Z A;  2X69 A;  4O42 A;  1GUW A;  2DY7 A;  2B2W A;  2K04 A;  1NR2 A;  2BDN A;  2B2Y A;  1E0B A;  2D9U A;  5EQ0 A;  1J9O A;  2JYO A;  1O7Y A;  4HSV A;  2KEE A;  1DOL A;  5EJW A;  1WD0 A;  2FIN B;  4X3U A;  1WTO A;  3FPU B;  1VMP A;  3UI2 A;  1B3A A;  2H1E A;  5CBA E;  1KNE A;  2K03 A;  2RVL A;  1AP0 A;  2B2U A;  4ZLT F;  1WTX A;  4UAI A;  1X3Q A;  2HCI A;  2RSN A;  5CBE E;  1QG7 A;  1CA6 A;  1G2T A;  1BF4 A;  2HDL A;  5E4X A;  4RA8 A;  3TZD A;  1IL8 A;  2B2T A;  1HRJ A;  1BO0 A;  4CJ1 B;  2XIW A;  1O7Z A;  1SSO A;  4QUC A;  4CJ0 B;  2FFK B;  2K01 A;  1ROD A;  4HED A;  1PFB A;  2EOT A;  4ZKB B;  1CM9 A;  4XDX A;  1ML0 D;  4MN3 A;  1U4P A;  2B2U C;  1RJT A;  4R9W A;  3MWY W;  2NWG A;  1G91 A;  1HHV A;  5DNF A;  1F9Q A;  1F9S A;  4ZKC B;  1EOT A;  3IL8 A;  2KUM A;  1WVL A;  3R93 A;  1KNA A;  1TVX A;  2B2V C;  1B4O A;  1XX8 A;  1DOM A;  4CJ2 C;  1ILP A;  4HAE A;  1F9R A;  1F9P A;  1AZP A;  1B2T A;  3FDT A;  1J8I A;  1RTO A;  2KOL A;  3ONA B;  1EIG A;  3DEO A;  3IFD A;  1DON A;  1U4M A;  3KBX A;  2K28 A;  4IUP A;  1Q3L A;  3GV6 A;  4R8I A;  2L11 A;  2NZ1 D;  3HP3 A;  5AFW A;  2B2W C;  2KVM A;  4LMQ D;  2X6G A;  2B2Y C;  4OIJ A;  5EPK A;  2Q8T A;  5CMD A;  1PLF A;  3SVM A;  2L12 A;  2X6L A;  5EKI A;  3I90 A;  1SAP A;  4RWS C;  1WTW A;  1AZQ A;  1DZ1 A;  3DEP A;  3P7J A;  1NR4 A;  2FJ2 A;  1MSH A;  2MPM A;  1ESR A;  1ICW A;  1LV9 A;  1PFN A;  2L1B A;  5D65 A;  4ZAI A;  5T1G A;  1HUM A;  1PDQ A;  4IUT A;  2Q8R E;  3MTS A;  1CA5 A;  1ZXT A;  4XT3 B;  1WD1 A;  2B2T C;  5COY A;  1HFN A;  2HCC A;  3Q6S A;  4ZK9 B;  1HFG A;  1HUN A;  1ILQ A;  2RSO A;  1MGS A;  3H91 A;  1B53 A;  1DOK A;  4IUR A;  1IKM A;  2DY8 A;  5EPJ A;  3G7L A;  2N55 A;  3I3C A;  4QUF A;  4IUQ A;  1RTN A; 
#chains in the Genus database with same CATH topology
 3DWP A;  3P1H A;  3H3V H;  2BCO A;  1HH2 P;  1PFM A;  3TEH B;  4DV3 L;  4PMB A;  1EY9 A;  1AW7 A;  2IX0 A;  4ZQ3 A;  4L5T A;  4R8N A;  5LMU Q;  2Z6K C;  1C8C A;  3I4L A;  1E2V A;  2K05 A;  4HMJ A;  1K0R A;  4C3H H;  4IPC A;  1SYG A;  4OXP A;  2UXD Q;  2M9V A;  2UXB L;  1STH A;  5C0X I;  4RGM A;  4YCV A;  4DNR B;  1EY4 A;  1TWC H;  4N8X 1;  3S14 B;  2D0P A;  3F2U A;  5TSS A;  4G4K A;  3K5M A;  1PH5 A;  4DV7 Q;  2GVB A;  4H02 A;  3KJP A;  4BY1 B;  1IBK L;  2KEN A;  4PV1 C;  4YWL A;  4ZCK A;  2BDN A;  1SNP A;  3T4A C;  4HSV A;  4E6I A;  2PPB C;  4GKJ Q;  1KAB A;  2F0V A;  4KTA A;  3S2H B;  4APV A;  3QJY A;  2UU9 Q;  4BBS G;  1X3Q A;  1QG7 A;  3CP0 A;  3V05 A;  4A3E H;  4A3D H;  1IL8 A;  4GLA C;  1WJJ A;  2Z4H A;  2XIW A;  1YZ6 A;  2IW3 A;  2E2H B;  2AQ1 B;  5GAE C;  3DWA A;  1CQF A;  5C4J B;  3J80 L;  4HED A;  1PFB A;  4XDX A;  5CV8 A;  1LT5 D;  3D31 A;  2JN4 A;  3VR2 A;  3PO3 G;  3M4P A;  5JPM C;  4J1M A;  4G57 A;  3BZC A;  3KF8 B;  2F0I A;  5FLX c;  4UY8 C;  5JVH 3;  1VQK A;  3DLL A;  1FJG L;  1IYJ B;  4DAP A;  1SMY D;  2UXB Q;  4X66 L;  2K5V A;  1DM0 B;  4A3E B;  4DV5 L;  4A3D B;  4DUY L;  1VF7 A;  2RKS A;  2WFW A;  3DEP A;  4RGN A;  1NR4 A;  1L2F A;  1VQM A;  1D1I A;  4P72 A;  2NZH A;  2PNR C;  5IP7 G;  2TSS A;  4GN5 A;  3K57 A;  1IKM A;  3CC4 A;  4WRD A;  1X56 A;  2BA1 A;  2Q2I A;  2Z9H A;  3G7L A;  3NTI A;  5L37 A;  5JEA G;  2VQE Q;  2UXC L;  1CUK A;  4OX9 L;  4UDU C;  5C4X G;  3NSW A;  2F0P A;  1MJE A;  1HTP A;  2L9H A;  1X3F A;  2EYJ A;  1N8R C;  4B3S Q;  5E4W C;  2ZM6 Q;  1B3Q A;  4NMZ A;  4LK1 C;  2BOS A;  1NBW A;  4C3J G;  4A3L G;  1CT1 D;  2CFM A;  3E6Z X;  5JVG 3;  4DN4 M;  1X3P A;  4JYA L;  2I46 A;  2UUB Q;  3NE5 B;  2R92 H;  4GS3 A;  1B50 A;  5CV6 A;  4L8J A;  1V1Q A;  4BWG B;  1A6X A;  1ZYR C;  2KJX A;  2PW5 A;  4DV0 L;  1JJG A;  3TP7 A;  1I3Q H;  3NEN A;  1UNS A;  2ZTE A;  5GAD C;  1X32 A;  2EYO A;  1KDA A;  1MI2 A;  2KHJ A;  3OW2 A;  1MKH A;  2VXW A;  2NBF A;  1A3T A;  1L0X B;  1IHZ A;  2A19 A;  2F3I A;  4GNX B;  2CVR A;  4HN7 A;  2L4N A;  1K73 C;  1GOZ A;  4Z9C B;  3K0X A;  4A3I B;  2DY7 A;  3P20 A;  4N8F A;  4A3G G;  2D9U A;  4A3K H;  4YHH Q;  2WB1 G;  1DOL A;  3RLF A;  2R92 B;  2BE5 D;  1TWA H;  1VMP A;  3D8G A;  2F0T A;  2K03 A;  3SHL A;  3EVQ A;  1WTX A;  4EQ5 A;  5GQO A;  1JE5 A;  1B9N A;  1TR5 A;  3BG3 A;  1VQG A;  2JA8 G;  4P75 A;  1I3Q B;  4IFD G;  1GKH A;  4IOA A;  2UXC Q;  2MO0 A;  1GXD C;  3V2T A;  1XTC D;  4IO9 A;  2J0T D;  2B2U C;  1BBU A;  3MWY W;  2IHF A;  4IJH A;  4RHS A;  1HHV A;  2RHS B;  2Z1C A;  1BCP B;  2WB1 E;  4LFA Q;  2QCP X;  5JOB A;  1CHQ D;  1EY8 A;  3R93 A;  4GOP B;  1HZC A;  2LXJ A;  1KNA A;  5C4Z A;  1LYL A;  1NMF A;  1SRU A;  3SDZ A;  1PH2 A;  1D6E C;  2N8N A;  5KEE A;  4A3K B;  1J8I A;  1SNC A;  3CCE A;  3O13 A;  1U4M A;  4JBM A;  4LFC Q;  4KJO A;  5C0X H;  5IYB G;  1CZG A;  4LF7 L;  2HQL A;  4KY5 A;  2WAQ E;  1JOK A;  4DNT B;  1ICW A;  1PFN A;  1PZI D;  3TRE A;  1EEF D;  3MTS A;  1HQR D;  4K5X A;  2Q8I B;  2XWJ B;  3U9O A;  3GTK H;  2K14 A;  1WD1 A;  2EY1 A;  1YNN D;  4PZ8 A;  4QL5 A;  4ZK9 B;  1UE7 A;  1HUN A;  2RDF A;  4HSP A;  4FDB A;  3AU7 A;  1DCZ A;  3K7A H;  4U67 3;  4WOR A;  1CKN B;  3SGI A;  4DXG A;  1SYD A;  4TKO B;  4M1U B;  4HJ9 A;  2XRS D;  2CQO A;  4DR5 Q;  1KD1 C;  5M3M G;  3SK4 A;  2G5D A;  2MUY A;  4LUZ A;  1J5E Q;  1VQB A;  4KHP Q;  1HZ9 A;  2WAC A;  1C0A A;  4C1N I;  3BJU A;  4GNX A;  1CFM A;  2A68 D;  1KAA A;  1RIP A;  2R6G A;  5FOB B;  1XJV A;  3K5L A;  4C3I H;  4HIO A;  1WTP A;  1KAW A;  3GTK B;  1LTT D;  2YV5 A;  3LNN A;  3S24 A;  1EL0 A;  2HHH L;  5ELN A;  5I9O A;  4XT1 B;  3D6W A;  3M7G A;  4DU9 A;  1GM5 A;  1EFI D;  1U4L A;  4JPB W;  3K7A B;  1STE A;  2RCN A;  4DKA C;  1ZKO A;  1Q7Y C;  2C9O A;  1T5E A;  4GN3 B;  5IT9 c;  2XTI A;  4DV4 Q;  3J7A V;  3STB C;  3H15 A;  4JC0 A;  2LMC B;  1E0B A;  2EY2 A;  2SNS A;  4DK1 A;  4LF7 Q;  4XYQ A;  1PRT F;  1SYE A;  5FLM G;  1XPR A;  2B8F A;  5EJW A;  5AJ3 Q;  1AFP A;  5CBA E;  3E3X A;  4GOP A;  3OTO Q;  1VQ7 A;  1V8Q A;  1WFQ A;  4DV1 Q;  1YHB A;  4BY1 G;  1R9T H;  1GHK A;  5A35 A;  1SSO A;  1DJR D;  3OWF A;  4ZKB B;  3CCU A;  3K59 A;  2AWO A;  3OW7 A;  2YTV A;  2H5X A;  1EQR A;  4A3B H;  1MBY A;  1JC7 A;  1B70 B;  2O5J C;  3RR5 A;  1ESF A;  2B3G A;  5BN4 A;  3E0E A;  3FDT A;  3L2P A;  1EIY B;  1TWH H;  5M3F B;  4WJ4 A;  1B44 D;  1JWS D;  2NZ1 D;  1UE5 A;  3SVM A;  2HHH Q;  3MZ5 A;  1N36 L;  2SNM A;  3K58 A;  1R9T B;  3MXN B;  5CV5 A;  1RF2 D;  4I7A A;  3TZU A;  1HTL D;  4ZAI A;  1E3P A;  4OWT B;  3URY A;  1ZXT A;  5DEH A;  4GKK L;  2YYZ A;  1A2U A;  3I2Z A;  3NPP A;  2HCC A;  3Q6S A;  4HIM A;  1LT4 D;  1SFO H;  4XXE A;  2DY8 A;  1S3O A;  5IE8 A;  4A3B B;  1RTN A;  2VQF Q;  4A3E G;  2AUJ D;  4A3D G;  2K32 A;  4JI5 L;  3W3A A;  1GD7 A;  2PO4 A;  3NHH A;  1MIU A;  1KC8 C;  4NXN L;  2KCN A;  1AN8 A;  4IZ8 A;  4JVZ A;  3HRZ C;  1K9M C;  1I5F A;  5LL6 X;  3T1H Q;  1XPO A;  5IYD H;  3QOL A;  2VZA A;  3S1N H;  4BBR H;  4YY3 Q;  4OIK A;  5KGU A;  1HA6 A;  1C48 A;  2DGY A;  1HQM C;  4UHV A;  1UAP A;  1YBY A;  3TME A;  4EQN A;  3ULP A;  1KHI A;  1SFO B;  1CI3 M;  2M2L A;  4JV5 L;  5JEA J;  4UPA A;  3VYU A;  2LY7 A;  1Q46 A;  2A6E C;  1ENF A;  1O80 A;  1SXT A;  2K1B A;  2IY5 B;  1JT8 A;  4KKT A;  1IW7 D;  4A93 B;  2PNH A;  4B9X A;  4IJL A;  4O42 A;  1N9W A;  2ZTD A;  3S1N B;  3PCO B;  4BBR B;  1WD0 A;  3DM3 A;  1H9R A;  2MFI A;  1A3V A;  5FJ8 H;  1TQO A;  1BF4 A;  2HDL A;  3AB9 A;  4K6L A;  3OYY A;  4GNX C;  2K50 A;  4JCV E;  5I6Y A;  2NN6 I;  4A3I G;  1IZ6 A;  1ROD A;  4DGZ A;  4BY7 H;  1LTR D;  1L1O A;  5DM7 3;  1G91 A;  2GVA A;  2R92 G;  1PYS B;  1K28 A;  4CDC C;  4UP8 A;  4POF A;  4ZKC B;  4DPG A;  5ELC A;  2K7V A;  4DV6 Q;  3KJO A;  1H9K A;  3H3V I;  4F7X A;  2MHV A;  2NTT A;  2PI2 A;  5HUR A;  4V0B A;  3ONA B;  4RKL A;  2F0M A;  4QCL A;  3KBX A;  1YJ9 A;  4RCN A;  4IPD A;  1N32 L;  2L11 A;  1TXY A;  5CC4 A;  2F0H A;  1V43 A;  3I90 A;  1AZQ A;  1BCP C;  2EQS A;  2Y0S E;  4GOP C;  1IXR A;  4IUT A;  4BY7 B;  1STB A;  3EIV A;  2G9D A;  3QOJ A;  3MFY A;  4NB3 A;  4A3K G;  1EIF A;  3NQT A;  3KF6 A;  4TRD A;  1QVG A;  1HFN A;  3H6M A;  1UE1 A;  3A0J A;  1B53 A;  4XQQ A;  3IFT A;  4Q0F A;  1EZ8 A;  4JI0 L;  1PH4 A;  4Y52 H;  1J6Q A;  1G6P A;  2JP1 A;  3A8K E;  4JI8 L;  2Z4I A;  1RHP A;  2M00 A;  1CK1 A;  1S5F D;  4B08 A;  2XRQ D;  1VMC A;  2IL8 A;  3DM1 A;  4TSS A;  5BN3 A;  2O5I C;  1Y1W G;  4JI3 Q;  2GN5 A;  4U68 A;  1HNZ Q;  2EPB A;  5J1Z A;  3UE0 A;  1LAC A;  1K8M A;  4JI6 L;  1SND A;  3RD4 A;  1WTQ A;  1JWU D;  2ATW A;  1BOS A;  1U0L A;  1NMG A;  4AH6 A;  3WWV A;  3CU7 A;  1SE8 A;  2NTS A;  2KQ3 A;  1LTG D;  2K6A A;  3UDG A;  1H95 A;  1SRO A;  1KIX A;  3I91 A;  4HIK A;  4X62 Q;  1OXT A;  5EQ0 A;  4NP5 A;  2P5Z X;  1ENC A;  3ITP A;  2BH2 A;  3FPU B;  4LF6 Q;  4ZLT F;  3E0J A;  3SE0 A;  1CA6 A;  5FLX E;  5CBE E;  3E9I A;  3M3Y H;  4KD3 A;  4QUC A;  1X3G A;  3MEF A;  5EBC A;  4ZYS A;  2E2J H;  4JI0 Q;  4K2L A;  4RG1 A;  5C44 H;  4EQP A;  3F8T A;  3PIO A;  4JI8 Q;  1I6H H;  4KY7 A;  5LMN L;  1EOV A;  5D3I B;  5C3E H;  2RF4 A;  2HQE A;  3K80 C;  4DUZ Q;  1P16 A;  3S1M B;  2K28 A;  4JI2 Q;  4ILW A;  3HP3 A;  4AYB E;  4Q5V A;  4JI6 Q;  5M9O A;  4LMQ D;  1VQL A;  5EPK A;  3M3Y B;  4B3M Q;  3P7J A;  1EQQ A;  2UXD L;  2MPM A;  4R4T A;  2E2J B;  5G3L F;  3H0G H;  2EVB A;  3DMU A;  4KN4 C;  5C44 B;  1I6H B;  1QVF A;  3F2C A;  5M3F G;  5GAH C;  1MGS A;  5CV9 A;  4RCO A;  3PIO 3;  1N33 Q;  2N55 A;  4DV7 L;  1ZEQ X;  1YNJ D;  3PV0 A;  4KKS A;  1MHW C;  3NP8 A;  5KNB A;  3L0O A;  4XTC S;  3U58 A;  2NN6 H;  5COR A;  1EQT A;  4GKJ L;  3BDC A;  1G2S A;  1K8G A;  3BU2 A;  2L55 A;  4A3B G;  4IOC A;  1XNQ L;  5NUC A;  4PG3 A;  3SXH A;  3TN2 A;  1EYD A;  1F2Y A;  3MC0 B;  1N34 Q;  1TKW B;  4KV6 A;  3FRP B;  3KDF B;  3N52 A;  4O0A A;  2RA4 A;  1TWF H;  2KA7 A;  3J80 c;  2YTY A;  2HD3 A;  3BDL A;  3D0F A;  4PZ6 A;  4BA2 I;  1KDC A;  1I4H A;  2F0W A;  5E1F A;  3NBI A;  5CV7 A;  4A3C H;  5J39 A;  4R4Q A;  4NPS A;  4LF4 L;  5JJI A;  5J3B A;  2QEJ C;  1FNV A;  4LW1 A;  2B2U A;  5DM6 3;  3JAM c;  2QDB A;  4A93 G;  2B2T A;  3QWN A;  4DV2 L;  1A2T A;  3T13 A;  3LWU A;  2FFK B;  3A56 A;  3FP9 A;  1ML0 D;  4MN3 A;  1TWF B;  4BBR G;  4CDD C;  3I4M H;  1D5M C;  1XTD A;  1LLR D;  3ER0 A;  3N6R A;  2VQE L;  3TBI B;  1S5E D;  3RN2 A;  3EJI A;  1P8L A;  5EKK A;  4C3H B;  2OXP A;  4QQB X;  1WCM H;  2HIV A;  1STG A;  1XNQ Q;  2KHS A;  2LFN A;  4IUP A;  2ZM6 L;  4B3S L;  5GRO A;  5EGT A;  2MQH A;  5LMN W;  1RKN A;  1SMY C;  1TWC B;  4FXG C;  4J15 A;  2JSO A;  5CGK A;  4A76 A;  2UUB L;  4K14 A;  2RDH A;  4MZ9 A;  3I56 A;  1CSQ A;  3HKZ B;  2L1B A;  1Q1B A;  1I4R A;  4LF8 L;  4ZUI A;  3K7U C;  1EWC A;  5K36 H;  3RZD H;  2EIF A;  5J22 A;  1HZB A;  3I4M B;  5C6A A;  3HEJ A;  2F3V A;  2KHI A;  4KLK A;  3U4V A;  5FJ8 G;  4DR3 Q;  2R7Z G;  5KNC A;  2QKI C;  4DAV A;  4LF4 Q;  1WCM B;  1PYB A;  3KDF A;  1GO3 E;  1PTO F;  3DXJ C;  1SNM A;  4BY7 G;  2WKD A;  3JC6 6;  1QE6 A;  4K2K A;  5IGE A;  3J81 j;  3PO2 H;  1K8O A;  2FHT A;  3RLN A;  4YHH L;  5JJZ A;  5IT9 E;  4DV2 Q;  1JIC A;  1S5C D;  1PH3 A;  1BVS A;  4EGV A;  3K81 C;  3CHB D;  1PRT D;  1Y1V H;  2F0D A;  3LWE A;  5IWA L;  5ISR A;  5IGD A;  2JA9 A;  4QIW B;  5IP9 G;  2EJG C;  1HNW L;  2PZT A;  3Q8D A;  2XWB B;  1EYA A;  4LFA L;  1R4Q B;  3J7A 5;  1D2B A;  3TRZ A;  1M90 C;  2BDO A;  4Y7N H;  2VY3 A;  1HA5 A;  4B3T L;  1YHA A;  3PO2 B;  1BUV T;  2D0O A;  4ZUJ A;  1W3S A;  1JMC A;  4LFC L;  4G7O C;  4LF8 Q;  3UI2 A;  1QVC A;  2BE5 C;  1DGS A;  3CCV A;  1Y1V B;  4WFN 3;  1JOR A;  3HOU H;  2JE6 I;  4RA8 A;  1PH6 A;  2ZJR A;  2IHE A;  1LTI D;  1SBB B;  5C0X J;  1NTG A;  4QJF A;  3T51 B;  1VQH A;  1CM9 A;  4RGT A;  2R93 H;  2NWG A;  4HJA A;  5A2Q E;  1CTM A;  3BYT B;  1WI5 A;  3IKJ A;  1Q82 C;  4XIG S;  1TVX A;  4CKB A;  4H0L C;  3AFQ A;  1U5K A;  1F9R A;  3M85 A;  2KOL A;  3EBE A;  5I4D A;  3IFD A;  1Q3L A;  4DR5 L;  2LS0 1;  3GV6 A;  3MEH A;  2OTL A;  4L5R C;  1PH9 A;  1O7L A;  4OWW B;  1C9O A;  1J5E L;  1A63 A;  3KF8 A;  4B3R Q;  5IWA Q;  4RHR A;  3S15 H;  1TU2 B;  3HOU B;  4KHP L;  2L12 A;  4RWS C;  4PMC A;  4A3J G;  4F87 A;  1HNW Q;  1EUJ A;  1EWH A;  2JJQ A;  3FHW A;  3OWE B;  4S3S A;  4XT3 B;  3S2D H;  4A75 A;  2B2T C;  1HFG A;  3VDY A;  1YNN C;  1QZG A;  4FXK C;  1AE2 A;  2YTX A;  1I94 Q;  4B3T Q;  1W6K A;  1DXM A;  3Q22 A;  3CC7 A;  1X54 A;  1IKL A;  1TWA B;  4JI1 Q;  3RZO H;  3NTK A;  1FNU A;  5LHY 1;  2SEB D;  4DV4 L;  1LUZ A;  4DAY B;  5C44 G;  3S1R H;  1PTO H;  2L5T A;  2JA7 H;  3PUW A;  2D5D A;  3S15 B;  5AJ3 L;  2I5M X;  3HOZ H;  2WKC A;  1ENA A;  2QIL A;  3D4R A;  5EPL A;  3CPW A;  2A68 C;  3OTO L;  2PMZ E;  3A8J E;  4BA1 I;  5JAV A;  3L3O C;  1FD7 D;  5E7N A;  4EVO A;  4DV1 L;  3S2D B;  1HJP A;  2OQK A;  3CME A;  4R4C A;  1LT3 D;  4JK1 C;  3A5Z B;  3I4O A;  3NTH A;  3PUV A;  1SJE D;  2J7Z A;  2FMM A;  4DXF A;  1CZW A;  3RZO B;  5IOD A;  2R7D A;  1D5X C;  3F1Z A;  4LJZ C;  5IGF A;  2L15 A;  2EXD A;  2JA7 B;  3U4Z A;  4O2D A;  4DF7 A;  3HOW G;  3C46 A;  3HOZ B;  3OIQ A;  4P71 A;  1G51 A;  3PF5 A;  2ZJQ A;  4XYO A;  3A8I E;  1A0I A;  4YIJ A;  2I5H A;  3A74 A;  3J7Z C;  4CJ0 B;  1IBM Q;  2AMC B;  3CPF A;  3WOE A;  5ELO A;  4QMG A;  1Q81 C;  1T9H A;  3OIP A;  2NN6 G;  3TSS A;  1YIT A;  1OXU A;  5JJL A;  1YJN A;  1JJ2 A;  5I2X A;  1EOT A;  2E5L Q;  5DAU A;  1Y8O B;  2A6H D;  5FO7 B;  2VQF L;  2EYH A;  4BXX H;  4YCW A;  2UUC Q;  3S17 H;  4IAL A;  1FR3 A;  4C3I B;  2AUK A;  4R8I A;  3H3V C;  3T1H L;  1YIJ A;  2VUM H;  1I4X A;  4YY3 L;  1SAP A;  1EU4 A;  3CCS A;  1XMQ Q;  2CH4 W;  5T1G A;  5LL6 S;  2Q8R E;  3FEW X;  1SLJ A;  1VQE A;  4C3H G;  2QEX A;  4PMW A;  3VYR A;  1PH8 A;  2SOB A;  3K5N A;  2B29 A;  4QY7 A;  1K3B C;  3M7N A;  4FYD A;  2EE1 A;  1D8L A;  3HS0 C;  1Y69 U;  3VYT A;  4X3K A;  1S5D D;  2EJM A;  1IL2 A;  1HR0 Q;  2VUM B;  1CKN A;  3I55 A;  3I4M G;  4FNF A;  4DFA A;  1LO5 D;  3CCR A;  1Z6H A;  3KLS X;  2A73 B;  2CW0 D;  2D62 A;  2LXK A;  3J7A F;  1BNZ A;  1QOH A;  1EIH A;  1BDO A;  1H9J A;  2AQ2 B;  3HZX A;  1LTA D;  3GO5 A;  1WCM G;  2EY6 A;  4KHZ A;  4IFD I;  1CHP D;  4L5Q A;  2R7F A;  2KED A;  3BZD B;  3VR6 A;  4GLX A;  1JWM D;  4POG A;  1SEB D;  3QR8 A;  4PZ7 A;  1PH7 A;  4NW2 A;  1TWH B;  1KLU D;  2JK8 A;  1RL2 A;  1KRS A;  1PVO A;  1IW7 C;  4DV6 L;  3QIA A;  2NVY H;  1VDZ A;  5K36 G;  5IT9 L;  2X69 A;  4OHJ A;  4JBW A;  2B2W A;  1JB3 A;  1RDP D;  2B63 H;  4AQY L;  5ELB A;  1FGB D;  1Y8N B;  4X3U A;  3S16 H;  4FF2 A;  2PZW A;  2IPK D;  1ET6 A;  3W5O A;  5E4X A;  3HOV H;  2PW7 A;  4CJ1 B;  5KIX A;  3RUZ A;  3H09 A;  3PO2 G;  2OWO A;  1O7I A;  3C1E A;  3UE1 A;  4N9T A;  3WDN A;  1E24 A;  1KXL A;  3J7Y W;  1F9Q A;  4LF9 Q;  2V1C C;  3IL8 A;  2OTJ A;  2KUM A;  1Y1V G;  2Z8L A;  1Q12 A;  2NVT H;  4DR6 Q;  1Q8I A;  2UUA Q;  2B63 B;  1V1P B;  1FL0 A;  1RTO A;  2WV6 D;  4K6D A;  3DEO A;  4L63 B;  4LUV A;  4DR4 Q;  3J81 c;  4H44 C;  3S16 B;  3I4N H;  3R2I A;  3X3N A;  2KVM A;  3EA6 A;  1QB5 D;  4JI3 L;  4MNO A;  3HOV B;  1WTW A;  1VQF A;  1TWG H;  3FKI H;  3NEM A;  4IPG A;  1HNZ L;  1HUM A;  5A2Q L;  1K3R A;  2AQ3 B;  3BVG A;  2B39 A;  3MXN A;  1HZA A;  4HCE A;  3NEL A;  4PNY A;  2F3W A;  4LNQ A;  3HOU G;  3PMF A;  1YEZ A;  5KYI A;  1PRT B;  2NUC A;  4AQY Q;  3CD6 A;  2DUD A;  1E22 A;  2JXM B;  4ME5 A;  3J80 E;  3QO2 A;  4X62 L;  3I4N B;  3J80 i;  1I4Q A;  1EZ6 A;  5IGC A;  4UP9 A;  4CBV A;  2ES2 A;  4MTN A;  1TWG B;  3FKI B;  4LF6 L;  4QB4 A;  2VB3 X;  5IP7 H;  3KUP A;  2K5H A;  2EYL A;  4X3T A;  4H13 C;  1JOO A;  2KEC A;  3JAM E;  2YU9 H;  2N3S A;  5C4X H;  4HMI A;  2D2C C;  1OTC A;  3JAM i;  1ET9 A;  2PQE A;  1T5X D;  3IRB A;  1D5Z C;  3VR5 A;  2EZV A;  3I70 A;  2NVQ H;  4A3L H;  3G6J B;  1X9N A;  1ASZ A;  3MA2 B;  1GVP A;  1QUQ B;  5HGQ A;  4DUZ L;  3A7A B;  2K04 A;  4DR2 L;  5E3F A;  3U9S A;  2JYO A;  1VQ9 A;  1IBL L;  4JI2 L;  1AE3 A;  1NE3 A;  3MAQ A;  2H1E A;  3RNU A;  3OMC A;  2HCI A;  4DR1 Q;  4B3M L;  5C0X G;  4YWM A;  1HRJ A;  3OMG A;  3Q24 A;  3T16 A;  4CDE C;  2JA7 G;  2PZU A;  4K5V A;  4DAM A;  1WTH A;  2EOT A;  2XGT A;  2QA4 A;  3HOZ G;  3TQY A;  1LT6 D;  1F2Z A;  1F9S A;  1VQD A;  4A3G H;  1N33 L;  1WVL A;  4K8I A;  1VQ4 A;  1C4Q A;  1SJH D;  1G8Z D;  2ENB A;  4CJ2 C;  3OOC A;  1NY4 A;  4OEL B;  1TS3 A;  5ELF A;  1KLG D;  3T53 B;  1SNO A;  1Q90 A;  2E75 C;  4JOI A;  2OF1 A;  2B2W C;  4IFD H;  2F0S A;  1FVI A;  4OIJ A;  1PLF A;  2TMP A;  5EKI A;  3HOY H;  5F2D A;  2I07 B;  1PTO D;  3RN5 A;  5IY0 A;  1SN8 A;  2F0N A;  1SMX A;  2XSC A;  1N34 L;  4ZRZ A;  1BXT A;  1PH1 A;  4C3I G;  1MD2 D;  3U50 C;  2I0Q A;  2WB1 B;  3I3C A;  4DR2 Q;  4IUQ A;  2NB0 A;  3VR4 A;  1IBL Q;  2NYZ D;  4OL7 A;  5JJK A;  2N49 A;  4GN4 B;  2ZXO A;  1YNJ C;  2ZJP A;  2A5H A;  3GTQ H;  4LFB Q;  3I8Z A;  1SR3 A;  3R2T A;  3L7Z C;  4IUN A;  5EKL A;  3HOY B;  4C56 C;  1VQ8 A;  4BXX G;  2WAQ B;  5IGB A;  5M5Y H;  1NAP A;  2PQA B;  5I2Y A;  1GUG A;  5C3E B;  1NCV A;  1VCI A;  4IUV A;  1WTR A;  2XVS A;  2VUM G;  1HCZ A;  1PZK D;  3CXC A;  1GHJ A;  3K6O A;  1FGU A;  4LF5 Q;  3PF4 A;  1I50 H;  3KLW A;  5T1I A;  5M3M H;  3D6C A;  2AHO B;  1D7Q A;  5M5W H;  3ERS X;  2SDF A;  3GTQ B;  2JQO A;  1S4Z A;  2EYM A;  1Z9F A;  4XQN A;  4IPH A;  1J9O A;  2VL6 A;  2WIN B;  3GTL H;  3H0G B;  1EU3 A;  3HFZ B;  1EYG A;  3R3O A;  1HXY D;  1B3A A;  1E1O A;  3LX0 A;  1K0S A;  5M5Y B;  1X55 A;  2A69 D;  4UP7 A;  1PXU A;  3KFU A;  3CKI B;  5BN5 A;  3TP8 A;  2PI2 E;  1I50 B;  1U4P A;  1RJT A;  1HNX Q;  5M5W B;  4X64 Q;  4OGQ C;  4C2M H;  4DR3 L;  3S14 H;  3EN2 A;  2EDG A;  1DOM A;  1LM0 A;  2XNA C;  3GTL B;  3CRL C;  3RLO A;  2F4V Q;  1G29 1;  1EYC A;  4F88 A;  3TP5 A;  1VS0 A;  4BY1 H;  3ICE A;  1LTL A;  1ICF B;  2K33 A;  3A7L A;  3ND8 A;  4I65 A;  1NJI C;  3M4Q A;  5IYD G;  4CGY B;  1DZ1 A;  1E2Z A;  2RBM A;  2QGQ A;  4WJ3 M;  1LV9 A;  4CKC A;  4P74 A;  3UDF A;  2B63 G;  4O1N A;  3UDI A;  3S2H H;  5I6W A;  1DOK A;  2FXQ A;  2F0F A;  4C2M B;  2A74 C;  2KBN A;  2E2H H;  2JA6 H;  5C4J H;  3HOV G;  3AMU A;  2PQA A;  3T1Y L;  1JE4 A;  2F52 A;  3DUZ A;  3D4D A;  2IX1 A;  1BCP F;  2CWP A;  5D14 A;  1YHQ A;  1QCB D;  1VQJ A;  3BZK A;  1L0W A;  3L9A X;  1X6O A;  4HCS A;  2OQ0 A;  2LKV A;  4DR7 Q;  1B7Y B;  4JOI C;  2R3Z A;  4WJW A;  4MHE A;  1PRT C;  1SE4 A;  4X65 Q;  3K8A A;  1NNX A;  3UDX A;  5H1S E;  1M8A A;  4OWX B;  1NSN S;  1VF5 C;  3I4N G;  3A54 A;  2RHQ B;  3TS0 A;  2JA6 B;  1H9M A;  2F0L A;  3FKI G;  1Y8P B;  2OEO A;  4OON A;  2J4X A;  3SK5 A;  1D1K A;  1EY5 A;  1Y14 B;  4DV3 Q;  4HTH A;  4FF4 A;  1U4R A;  1GUW A;  1II3 A;  1JJC B;  1I4G A;  4FP5 D;  5IOC A;  1FYC A;  2B2Y A;  4FXD A;  1H9S B;  2PYK A;  3CRK C;  3RZD B;  3K5O A;  4JI7 L;  2RVL A;  3SK6 A;  3JAM L;  1VQO A;  4B3R L;  1UEB A;  1AH9 A;  2RSN A;  1A8V A;  4R4O A;  5KND A;  3D3R A;  3AYH B;  1PZJ D;  4DK3 C;  5C4H A;  1FNW A;  3PGZ A;  1KTK A;  1STA A;  3T1Y Q;  3F2B A;  5DNF A;  3CF5 A;  1I94 L;  4ME3 A;  5KRU A;  1IBK Q;  2KCM A;  1M1K C;  3I72 A;  2I5L X;  1VQC A;  2BA0 A;  5C5L A;  4HAE A;  3GQB A;  1GJX A;  4JI1 L;  1HPC A;  3QB3 A;  4OO1 I;  4RKB A;  4L5S A;  2KCC A;  1VQ6 A;  4QGU A;  1I4P A;  2X6G A;  3E9H A;  1Q86 C;  2ALY B;  2A1A A;  4A3I H;  5M5X H;  5BR8 L;  1KL9 A;  3NBH B;  1CQV A;  3HOX H;  1C7Y A;  2G9H D;  2DNE A;  3PUX A;  4FVM A;  1OXS C;  2EY5 A;  4Y7N B;  4AIM A;  1L0Y B;  2C35 B;  2NVX H;  1A62 A;  3KLR A;  5K5P A;  2MGS A;  4LWC A;  4DK6 C;  2FMC A;  5C5M A;  5FLX L;  1STY A;  3G4S A;  2JEA I;  2MJ8 A;  2AKW B;  4JI7 Q;  4JBJ A;  1F2L A;  1QJO A;  2K5N A;  2EYP A;  4LAA A;  1FJG Q;  1MSG A;  4TQU S;  3ULJ A;  1CKM A;  2VB2 X;  5CV4 A;  4X66 Q;  1YNX A;  5M5X B;  2EYF A;  4DV5 Q;  4RMF A;  4DUY Q;  5GAG C;  3HOX B;  2R93 B;  1M4V A;  1TS5 A;  1SYB A;  1G6Z A;  1ZYR D;  2RDG A;  2Y0S B;  3TS2 A;  1V1O A;  3E5S A;  2CWA A;  2LSS A;  3BVZ A;  1H9S A;  3Q0A A;  3CCJ A;  4NDX A;  1IBM L;  4JBK A;  2ASB A;  4A3F H;  2NVX B;  3MHB A;  3CC2 A;  2E2D C;  3GP7 A;  2E8G A;  3SR1 A;  1Z47 A;  2B2V A;  3HOY G;  3NK9 A;  2K5D A;  4OX9 Q;  4ODG A;  2E5L L;  2WAQ G;  2QDL A;  4EQO A;  1Y1W H;  4IQZ A;  2UUC L;  2O4X A;  5C3E G;  2DJG C;  5BR8 Q;  2DJF C;  4JYA Q;  1WTO A;  1WOC A;  1B9M A;  1AP0 A;  3CMA A;  1GUN A;  4J6H A;  4A3M H;  2MO1 A;  3J81 E;  3PQI A;  1E1T A;  4DV0 Q;  1XMQ L;  1BO0 A;  4ID6 A;  2IJ0 A;  3J81 i;  2VW9 A;  2F0O A;  4DK0 A;  4A3F B;  1TS4 A;  3SK8 A;  4B9W A;  4MTK A;  1YVC A;  1BR9 A;  1RCV D;  1VQA A;  5D3D A;  1EFW A;  3KYH C;  4K8J A;  2CCZ A;  3TP6 A;  4ALP A;  3H0G G;  2F0Q A;  4A4I A;  3S1R B;  1PTO B;  3GDE A;  3NBH A;  2HIX A;  1Y1W B;  2A6H C;  1ILP A;  2JA5 H;  2Q2H A;  1K8A C;  3PIP A;  1AZP A;  1JR0 D;  1WYD A;  1VQI A;  5IGG A;  1EIG A;  1HR0 L;  3S9W A;  1GUO A;  3V96 A;  4KK7 A;  5AFW A;  4A3M B;  1TT2 A;  2B2Y C;  5CMD A;  3KLS A;  2E76 C;  2F1M A;  5FO9 B;  2ZT9 C;  5ELD A;  2Q2T A;  1RD9 D;  4PQX A;  3EFX D;  2EJF C;  1MJC A;  4FF3 A;  5COY A;  5FO8 B;  2PCF B;  1S5B D;  1S72 A;  3OHX C;  3KBG A;  2K52 A;  3VA7 A;  4QUF A;  3CCM A;  5HY6 A;  2GA4 B;  2Z6B A;  1V9P A;  1A3U A;  2JA5 B;  4GLV B;  2V4D A;  3MXU A;  3HG9 A;  4QF4 A;  2ICE C;  1IYU A;  3W2D A;  3BVM A;  4TVA B;  4DA2 A;  4KI0 A;  2VNU D;  3KOJ A;  3PIP 3;  3GTP H;  4ABN A;  1XMO L;  4K0K L;  4M8A A;  3Q23 A;  1W2B A;  3H94 A;  4AYB B;  3AFP A;  4KJN A;  3M4O H;  1IYV A;  4DAY A;  2CW0 C;  4L6T B;  4A3C G;  2R61 A;  3VYS A;  5M3F H;  2MP1 A;  1WTV A;  3PUY A;  3K0Y A;  3NXW A;  1EQV A;  1SE2 A;  4R4I A;  2IX3 A;  2ZXP A;  1UE6 A;  3S17 B;  2F03 A;  1R4P B;  2C5C A;  1LTB D;  4HID A;  3HKZ G;  4LF9 L;  3RMH A;  1AEX A;  5IYC H;  3KK7 A;  4OO1 H;  3G71 A;  4FF1 A;  4DR6 L;  1BBX C;  3STB D;  4CHT B;  2DN8 A;  3M4Y A;  3B6Y A;  2UUA L;  3GTP B;  1STN A;  1QNU A;  2F0J A;  1LAB A;  1QWY A;  1Q8K A;  3M4O B;  4DR4 L;  2JA6 G;  2ICI A;  4R1J A;  1KNE A;  3WOF A;  1XWE A;  1QIL A;  5FK9 C;  5FKA C;  1KDB A;  3MXG A;  1L1O B;  3HKZ E;  2H4O A;  3T56 B;  2CH4 A;  2K01 A;  1CSP A;  1F2M A;  1PV4 A;  3LGJ A;  1BQQ T;  1TII D;  4C1N K;  1ONL A;  4GZY C;  1XMO Q;  3CCL A;  4K0K Q;  3NQI A;  2ZTC A;  2B2V C;  3EQL C;  2MNA A;  1X3E A;  1X65 A;  2A8V A;  4CKE A;  1F9P A;  4RGO S;  3W1G A;  1XNR L;  2F0U A;  1GUT A;  4A93 H;  3VA5 A;  1U9R A;  2Q8T A;  1PMR A;  3NWT A;  3KF6 B;  1TS2 A;  2FJ2 A;  4RFB A;  4I7Z C;  1CKO A;  1CA5 A;  3C3L A;  4EX5 A;  2HT1 A;  5G3L D;  1W6J A;  1HR0 W;  2B8G A;  2NVY B;  1XPU A;  1ILQ A;  2KCT A;  3H91 A;  4QIW E;  4IUR A;  2E74 C;  5EPJ A;  4HJ5 A;  1PFS A;  4JI4 L;  4BBS H;  4KKU A;  3R8B A;  2WP8 J;  3GV3 A;  2WII B;  3G48 A;  1LTS D;  4G7H C;  4CDF C;  5C3W A;  3IAY A;  1K83 H;  4RH6 A;  4DNI A;  3DHQ A;  4IUU A;  1B1Z A;  3ZYY X;  5CR3 A;  1O78 A;  1XYI A;  2Q2U A;  1N36 Q;  3SEB A;  3PO3 H;  3BDO A;  4YCU A;  2IT1 A;  3CAM A;  4DR1 L;  1PA6 A;  5I9P A;  1SYC A;  3AEV A;  4GKK Q;  4P73 A;  2R7Z H;  2NVT B;  1I6V C;  4HJ7 A;  4KY6 A;  2A6E D;  3PUZ A;  4OEM B;  3ULL A;  4BBS B;  5JPN C;  1XNR Q;  4KMU C;  1NUC A;  4JI5 Q;  3HOX G;  2R93 G;  3BYY B;  4KHV A;  1EEI D;  2VS1 A;  2Y0S G;  4NXN Q;  1K83 B;  3CW2 C;  1NR2 A;  4KD4 A;  2L0C A;  3GD7 A;  2KEE A;  3HGB A;  3W1B A;  3PO3 B;  1BKB A;  3C1F A;  2CKZ B;  4UAI A;  5JEA H;  4P2C B;  3TZD A;  5IP9 H;  1O7Z A;  3M9B A;  2R7Z B;  4IFD J;  3MVV A;  4JI4 Q;  4MIU A;  3GTO H;  4JV5 Q;  2NZO A;  3G6E A;  4C3J H;  1SNQ A;  2EXZ A;  4R9W A;  1VQP A;  4JW0 A;  4ULL A;  4H7B A;  3ERO A;  1TY0 A;  1Q1E A;  3D4W A;  5KYL A;  1XX8 A;  2Z6K A;  4A3F G;  1VQ5 A;  4LFB L;  3J81 L;  1ASY A;  2XN9 C;  1B8A A;  1V1P A;  3CQZ H;  1JCK B;  3HKS A;  1SE3 A;  2E2I H;  2YU9 B;  2X6L A;  5C4X B;  1PYW D;  1OXV A;  2F0E A;  1BCP D;  2QF7 A;  1PTO C;  4HJ8 A;  3FMC A;  3GTO B;  3F2D A;  1KQS A;  4C3J B;  2F0G A;  2NVQ B;  3ZJY C;  2Z0S A;  1KRT A;  4X6A H;  4IN3 A;  4LF5 L;  1BBW A;  2OT2 A;  4A3M G;  1Z7T A;  4F8M A;  5CYU A;  4N9P A;  3OSO A;  1SDF A;  3S1Q H;  1QNK A;  3QG1 A;  2JA8 H;  3NUC A;  2F4I A;  4NXM L;  3GTJ H;  3CQZ B;  1N32 Q;  3TDQ A;  3CCQ A;  2HDM A;  2E2I B;  3X3M A;  4A3J H;  4KN7 C;  2N78 A;  3BS1 A;  3FPP A;  1A15 A;  1E2W A;  3MFG A;  4NKL A;  4XQJ A;  1EY0 A;  1OO9 B;  3S1M H;  2CHB D;  2JA5 G;  4JG2 A;  2ZXR A;  4V19 0;  4A3G B;  2K5W A;  4BS9 A;  2QW7 A;  1UEA B;  1DYQ A;  4AYB G;  3ERQ A;  2HUG A;  3A55 A;  1HNX L;  1JOQ A;  3PSI A;  2IWH A;  5IYB H;  3S1Q B;  4X64 L;  2JA8 B;  4YWK A;  4X3S A;  5EBD A;  2N88 A;  4RAU C;  1XXG A;  2K4K A;  3GTG H;  3GTJ B;  4A3J B;  1SYF A;  1O7Y A;  3FVQ A;  1EY6 A;  2F4V L;  1QUQ A;  4HR7 B;  2FIN B;  4FO2 A;  5HGT A;  2DNC A;  4G7Z C;  2K75 A;  2PMZ B;  1G2T A;  2A69 C;  3I7F A;  5LMU L;  3AQQ A;  1JQY D;  5IIF A;  3GTM H;  2ID0 A;  3I73 A;  2CQA A;  3MXP A;  1EWI A;  4J8Q A;  4K5W A;  5ELE A;  5EAY A;  4NXM Q;  1S40 A;  1QZH A;  3DWQ A;  2RQX A;  3HOW H;  3GTG B;  1F77 A;  1B4O A;  2AWN A;  2RCF A;  1PHJ A;  1B2T A;  1YJW A;  1EY7 A;  1L1O C;  2K5Q A;  1GUS A;  1YI2 A;  1DON A;  3A5U A;  3NWS A;  2OCE A;  2F0K A;  3P75 A;  1UUP A;  1DD2 A;  4LUO A;  3VR3 A;  5IYC G;  3ND9 A;  4OO1 G;  2O2L D;  5DLQ E;  3C2P A;  5C3X A;  4DR7 L;  1MSH A;  2JEB I;  1JB7 A;  1ESR A;  3GTM B;  5D65 A;  1PDQ A;  4X65 L;  1TY2 A;  5M3M B;  2UU9 L;  5LMN Q;  1VQN A;  2RSO A;  5FLM H;  1UWV A;  3OPO A;  1E7Z A;  1OXX K;  2BH8 A;  3HOW B; 
#chains in the Genus database with same CATH homology
 3DWP A;  3P1H A;  2BCO A;  1PFM A;  4PMB A;  1EY9 A;  1AW7 A;  2IX0 A;  4ZQ3 A;  4R8N A;  1C8C A;  3I4L A;  1E2V A;  2K05 A;  4HMJ A;  1SYG A;  2M9V A;  1STH A;  5C0X I;  4RGM A;  4DNR B;  1EY4 A;  3S14 B;  3F2U A;  5TSS A;  4G4K A;  3K5M A;  4BY1 B;  4PV1 C;  2BDN A;  1SNP A;  3T4A C;  4HSV A;  4E6I A;  2PPB C;  1KAB A;  2F0V A;  4KTA A;  3S2H B;  3QJY A;  1X3Q A;  1QG7 A;  3V05 A;  1IL8 A;  2Z4H A;  2XIW A;  2IW3 A;  2E2H B;  2AQ1 B;  3DWA A;  1CQF A;  5C4J B;  3J80 L;  4HED A;  1PFB A;  4XDX A;  5CV8 A;  1LT5 D;  3D31 A;  3VR2 A;  5JPM C;  4J1M A;  4G57 A;  2F0I A;  5JVH 3;  4DAP A;  1SMY D;  1DM0 B;  4A3E B;  4A3D B;  1VF7 A;  2RKS A;  3DEP A;  4RGN A;  1NR4 A;  1D1I A;  2PNR C;  2TSS A;  3K57 A;  1IKM A;  4WRD A;  2BA1 A;  5JEA G;  3G7L A;  3NTI A;  4UDU C;  3NSW A;  2F0P A;  1HTP A;  2L9H A;  2EYJ A;  5E4W C;  4NMZ A;  4LK1 C;  2BOS A;  4C3J G;  1CT1 D;  5JVG 3;  3E6Z X;  4DN4 M;  1X3P A;  2I46 A;  3NE5 B;  1B50 A;  5CV6 A;  4L8J A;  1A6X A;  4BWG B;  1ZYR C;  2KJX A;  2PW5 A;  3TP7 A;  1UNS A;  1X32 A;  2EYO A;  1KDA A;  1MI2 A;  2VXW A;  2NBF A;  1A3T A;  1L0X B;  1IHZ A;  2CVR A;  4HN7 A;  2L4N A;  1GOZ A;  4Z9C B;  4A3I B;  2DY7 A;  3P20 A;  2D9U A;  1DOL A;  3RLF A;  2R92 B;  2BE5 D;  1VMP A;  3D8G A;  2F0T A;  2K03 A;  3SHL A;  3EVQ A;  1WTX A;  1B9N A;  1TR5 A;  3BG3 A;  1I3Q B;  4IFD G;  1GXD C;  3V2T A;  1XTC D;  2J0T D;  2B2U C;  3MWY W;  4RHS A;  1HHV A;  2Z1C A;  1BCP B;  2QCP X;  5JOB A;  1CHQ D;  1EY8 A;  3R93 A;  1KNA A;  5C4Z A;  3SDZ A;  1D6E C;  5KEE A;  4A3K B;  1J8I A;  1SNC A;  3O13 A;  1U4M A;  4KJO A;  5C0X H;  1CZG A;  4KY5 A;  1JOK A;  4DNT B;  1ICW A;  1PFN A;  1PZI D;  1EEF D;  3MTS A;  1HQR D;  4K5X A;  2Q8I B;  2XWJ B;  3U9O A;  1WD1 A;  2EY1 A;  1YNN D;  4ZK9 B;  1HUN A;  2RDF A;  4HSP A;  3AU7 A;  1DCZ A;  4U67 3;  4WOR A;  4DXG A;  1SYD A;  4TKO B;  4M1U B;  2XRS D;  3SK4 A;  2MUY A;  2WAC A;  4C1N I;  1CFM A;  2A68 D;  1KAA A;  2R6G A;  5FOB B;  3K5L A;  1WTP A;  3GTK B;  1LTT D;  1EL0 A;  3LNN A;  5I9O A;  4XT1 B;  3D6W A;  3M7G A;  4DU9 A;  1EFI D;  1U4L A;  3K7A B;  1STE A;  1ZKO A;  2C9O A;  1T5E A;  3J7A V;  2LMC B;  1E0B A;  2EY2 A;  2SNS A;  4DK1 A;  4XYQ A;  1PRT F;  1SYE A;  2B8F A;  5EJW A;  1AFP A;  5CBA E;  1V8Q A;  1GHK A;  5A35 A;  1SSO A;  1DJR D;  3OWF A;  4ZKB B;  3K59 A;  2AWO A;  3OW7 A;  1JC7 A;  1MBY A;  2O5J C;  1ESF A;  5BN4 A;  3FDT A;  5M3F B;  1B44 D;  1JWS D;  2NZ1 D;  3SVM A;  3MZ5 A;  2SNM A;  3K58 A;  1R9T B;  5CV5 A;  1RF2 D;  3TZU A;  1HTL D;  4ZAI A;  3URY A;  1ZXT A;  5DEH A;  2YYZ A;  1A2U A;  3NPP A;  2HCC A;  3Q6S A;  1LT4 D;  4XXE A;  2DY8 A;  4A3B B;  1RTN A;  2AUJ D;  2K32 A;  3W3A A;  2PO4 A;  3NHH A;  2KCN A;  1AN8 A;  4IZ8 A;  3HRZ C;  5LL6 X;  3QOL A;  4OIK A;  5KGU A;  1HA6 A;  1C48 A;  1HQM C;  1UAP A;  3TME A;  4EQN A;  1SFO B;  1CI3 M;  2M2L A;  5JEA J;  3VYU A;  2LY7 A;  2A6E C;  1ENF A;  1O80 A;  1SXT A;  2K1B A;  4KKT A;  1IW7 D;  4A93 B;  4B9X A;  4O42 A;  3S1N B;  4BBR B;  1WD0 A;  1H9R A;  1A3V A;  1TQO A;  1BF4 A;  2HDL A;  3AB9 A;  4K6L A;  5I6Y A;  2NN6 I;  1ROD A;  4DGZ A;  1LTR D;  5DM7 3;  1G91 A;  4ZKC B;  5ELC A;  2K7V A;  1H9K A;  4F7X A;  2MHV A;  2NTT A;  5HUR A;  4V0B A;  3ONA B;  4RKL A;  2F0M A;  4QCL A;  3KBX A;  4RCN A;  2L11 A;  5CC4 A;  2F0H A;  1V43 A;  3I90 A;  1AZQ A;  1BCP C;  4IUT A;  4BY7 B;  1STB A;  2G9D A;  3MFY A;  3QOJ A;  3NQT A;  4TRD A;  1HFN A;  3H6M A;  4XQQ A;  1B53 A;  3IFT A;  4Q0F A;  1EZ8 A;  2JP1 A;  3A8K E;  2Z4I A;  1RHP A;  2M00 A;  1CK1 A;  1S5F D;  4B08 A;  2XRQ D;  1VMC A;  2IL8 A;  3DM1 A;  4TSS A;  5BN3 A;  2O5I C;  4U68 A;  2EPB A;  5J1Z A;  1LAC A;  1K8M A;  1SND A;  3RD4 A;  1WTQ A;  1JWU D;  1BOS A;  3CU7 A;  2NTS A;  2KQ3 A;  1LTG D;  2K6A A;  3I91 A;  1OXT A;  5EQ0 A;  4NP5 A;  1ENC A;  3ITP A;  3FPU B;  4ZLT F;  3E0J A;  3SE0 A;  1CA6 A;  5FLX E;  5CBE E;  4KD3 A;  4QUC A;  5EBC A;  4ZYS A;  4K2L A;  4EQP A;  4KY7 A;  5D3I B;  2HQE A;  3S1M B;  2K28 A;  4ILW A;  3HP3 A;  4Q5V A;  5M9O A;  4LMQ D;  5EPK A;  3M3Y B;  3P7J A;  2MPM A;  2E2J B;  5G3L F;  2EVB A;  3DMU A;  4KN4 C;  5C44 B;  1I6H B;  1MGS A;  5CV9 A;  4RCO A;  3PIO 3;  2N55 A;  1ZEQ X;  1YNJ D;  3PV0 A;  4KKS A;  3NP8 A;  5KNB A;  4XTC S;  2NN6 H;  5COR A;  1EQT A;  3BDC A;  1G2S A;  2L55 A;  5NUC A;  3SXH A;  3TN2 A;  1EYD A;  1F2Y A;  3MC0 B;  1TKW B;  4KV6 A;  3FRP B;  3N52 A;  2RA4 A;  2KA7 A;  3BDL A;  4BA2 I;  1KDC A;  1I4H A;  2F0W A;  5E1F A;  3NBI A;  5CV7 A;  5J39 A;  2QEJ C;  1FNV A;  5DM6 3;  2B2U A;  2QDB A;  2B2T A;  3QWN A;  1A2T A;  3T13 A;  3LWU A;  2FFK B;  3A56 A;  1ML0 D;  4MN3 A;  1TWF B;  1D5M C;  1LLR D;  3N6R A;  3TBI B;  1S5E D;  3EJI A;  5EKK A;  4C3H B;  2OXP A;  1STG A;  2KHS A;  2LFN A;  4IUP A;  5EGT A;  1RKN A;  1SMY C;  1TWC B;  4FXG C;  2JSO A;  5CGK A;  4K14 A;  2RDH A;  3HKZ B;  2L1B A;  1Q1B A;  1I4R A;  4ZUI A;  1EWC A;  5K36 H;  5J22 A;  3I4M B;  5C6A A;  3HEJ A;  2F3V A;  5KNC A;  2QKI C;  4DAV A;  1WCM B;  3DXJ C;  1PTO F;  1SNM A;  2WKD A;  4K2K A;  1QE6 A;  5IGE A;  1K8O A;  2FHT A;  5JJZ A;  5IT9 E;  1JIC A;  1S5C D;  4EGV A;  3CHB D;  1PRT D;  2F0D A;  3LWE A;  5ISR A;  5IGD A;  4QIW B;  2EJG C;  2PZT A;  2XWB B;  1EYA A;  1R4Q B;  1D2B A;  2BDO A;  1HA5 A;  3PO2 B;  1BUV T;  4ZUJ A;  4G7O C;  3UI2 A;  2BE5 C;  1Y1V B;  4WFN 3;  1JOR A;  2JE6 I;  4RA8 A;  1LTI D;  1SBB B;  5C0X J;  3T51 B;  1CM9 A;  4RGT A;  2NWG A;  5A2Q E;  1CTM A;  3BYT B;  3IKJ A;  4XIG S;  1TVX A;  4CKB A;  4H0L C;  1F9R A;  3M85 A;  2KOL A;  5I4D A;  3IFD A;  1Q3L A;  2LS0 1;  3GV6 A;  3MEH A;  1O7L A;  3KF8 A;  4RHR A;  3HOU B;  1TU2 B;  2L12 A;  4RWS C;  4PMC A;  4F87 A;  1EWH A;  3OWE B;  4S3S A;  4XT3 B;  2B2T C;  1HFG A;  1YNN C;  4FXK C;  1W6K A;  1DXM A;  3Q22 A;  1IKL A;  1TWA B;  3NTK A;  1FNU A;  5LHY 1;  2SEB D;  1PTO H;  2L5T A;  3PUW A;  2D5D A;  3S15 B;  2WKC A;  1ENA A;  2QIL A;  3D4R A;  5EPL A;  2A68 C;  3A8J E;  5JAV A;  4BA1 I;  3L3O C;  1FD7 D;  4EVO A;  3S2D B;  1LT3 D;  4JK1 C;  3NTH A;  3PUV A;  1SJE D;  2J7Z A;  2FMM A;  4DXF A;  1CZW A;  3RZO B;  5IOD A;  1D5X C;  4LJZ C;  5IGF A;  2JA7 B;  4DF7 A;  3C46 A;  3HOZ B;  3OIQ A;  4XYO A;  3A8I E;  4YIJ A;  4CJ0 B;  3WOE A;  4QMG A;  3OIP A;  2NN6 G;  3TSS A;  1OXU A;  5I2X A;  1EOT A;  5DAU A;  1Y8O B;  2A6H D;  5FO7 B;  2EYH A;  4IAL A;  1FR3 A;  4C3I B;  2AUK A;  4R8I A;  3H3V C;  1I4X A;  1SAP A;  1EU4 A;  5T1G A;  5LL6 S;  2Q8R E;  3FEW X;  4C3H G;  4PMW A;  3VYR A;  2SOB A;  3K5N A;  3M7N A;  4FYD A;  2EE1 A;  3HS0 C;  1Y69 U;  3VYT A;  4X3K A;  1S5D D;  2EJM A;  2VUM B;  4FNF A;  4DFA A;  1LO5 D;  1Z6H A;  3KLS X;  2A73 B;  2CW0 D;  2D62 A;  3J7A F;  1BNZ A;  1QOH A;  1EIH A;  1BDO A;  1H9J A;  2AQ2 B;  3HZX A;  1LTA D;  3GO5 A;  2EY6 A;  4KHZ A;  4IFD I;  1CHP D;  2KED A;  3BZD B;  3VR6 A;  1JWM D;  1SEB D;  4NW2 A;  1TWH B;  1KLU D;  1IW7 C;  3QIA A;  1VDZ A;  5K36 G;  5IT9 L;  2X69 A;  4OHJ A;  4JBW A;  2B2W A;  1JB3 A;  1RDP D;  5ELB A;  1FGB D;  1Y8N B;  4X3U A;  4FF2 A;  2PZW A;  2IPK D;  1ET6 A;  5E4X A;  2PW7 A;  4CJ1 B;  5KIX A;  3RUZ A;  3H09 A;  3C1E A;  4N9T A;  3WDN A;  3J7Y W;  1F9Q A;  3IL8 A;  2KUM A;  2Z8L A;  1Q12 A;  1Q8I A;  2B63 B;  1V1P B;  1RTO A;  2WV6 D;  4K6D A;  3DEO A;  4L63 B;  4H44 C;  3S16 B;  3R2I A;  3X3N A;  2KVM A;  3EA6 A;  1QB5 D;  3HOV B;  1WTW A;  1HUM A;  5A2Q L;  2AQ3 B;  3BVG A;  2B39 A;  3MXN A;  4HCE A;  4PNY A;  2F3W A;  3PMF A;  5KYI A;  1PRT B;  2NUC A;  2JXM B;  4ME5 A;  3J80 E;  3QO2 A;  3I4N B;  1I4Q A;  1EZ6 A;  5IGC A;  4CBV A;  1TWG B;  3FKI B;  4QB4 A;  2VB3 X;  3KUP A;  2EYL A;  4X3T A;  4H13 C;  1JOO A;  2KEC A;  3JAM E;  4HMI A;  2D2C C;  1ET9 A;  2PQE A;  1T5X D;  2EZV A;  1D5Z C;  3VR5 A;  3I70 A;  3G6J B;  3MA2 B;  3A7A B;  2K04 A;  5E3F A;  3U9S A;  2JYO A;  3MAQ A;  2H1E A;  3OMC A;  2HCI A;  5C0X G;  1HRJ A;  3OMG A;  3Q24 A;  3T16 A;  2PZU A;  4K5V A;  2EOT A;  1LT6 D;  1F2Z A;  1F9S A;  1WVL A;  4K8I A;  1C4Q A;  1SJH D;  1G8Z D;  2ENB A;  4CJ2 C;  3OOC A;  5ELF A;  1TS3 A;  1KLG D;  3T53 B;  1SNO A;  1Q90 A;  2E75 C;  4IFD H;  2OF1 A;  2B2W C;  2F0S A;  4OIJ A;  1PLF A;  2TMP A;  5EKI A;  5F2D A;  2I07 B;  1PTO D;  2F0N A;  2XSC A;  4ZRZ A;  1BXT A;  4C3I G;  1MD2 D;  2WB1 B;  3I3C A;  4IUQ A;  2NB0 A;  3VR4 A;  2NYZ D;  4OL7 A;  2ZXO A;  1YNJ C;  2A5H A;  3I8Z A;  3R2T A;  3L7Z C;  4IUN A;  5EKL A;  3HOY B;  4C56 C;  2WAQ B;  5IGB A;  1NAP A;  5I2Y A;  1GUG A;  5C3E B;  1NCV A;  1VCI A;  4IUV A;  1WTR A;  2XVS A;  1HCZ A;  1PZK D;  1GHJ A;  3K6O A;  5T1I A;  3D6C A;  2SDF A;  3GTQ B;  1S4Z A;  2EYM A;  4XQN A;  1J9O A;  2WIN B;  3H0G B;  1EU3 A;  3R3O A;  1HXY D;  1B3A A;  3LX0 A;  5M5Y B;  2A69 D;  1PXU A;  3CKI B;  5BN5 A;  3TP8 A;  1I50 B;  1U4P A;  1RJT A;  5M5W B;  4OGQ C;  2EDG A;  1DOM A;  2XNA C;  3GTL B;  3CRL C;  1G29 1;  1EYC A;  4F88 A;  3TP5 A;  2K33 A;  3A7L A;  3ND8 A;  4I65 A;  4CGY B;  1DZ1 A;  1E2Z A;  2RBM A;  1LV9 A;  4CKC A;  4O1N A;  5I6W A;  1DOK A;  2F0F A;  4C2M B;  2A74 C;  3AMU A;  1JE4 A;  3DUZ A;  3D4D A;  2IX1 A;  1BCP F;  5D14 A;  1QCB D;  3L9A X;  4HCS A;  2LKV A;  2R3Z A;  4WJW A;  4MHE A;  1PRT C;  1SE4 A;  1M8A A;  1NSN S;  1VF5 C;  3A54 A;  2JA6 B;  1H9M A;  2F0L A;  1Y8P B;  2OEO A;  2J4X A;  3SK5 A;  1D1K A;  1EY5 A;  4HTH A;  4FF4 A;  1U4R A;  1GUW A;  1II3 A;  1I4G A;  4FP5 D;  5IOC A;  1FYC A;  2B2Y A;  4FXD A;  1H9S B;  2PYK A;  3CRK C;  3RZD B;  3K5O A;  2RVL A;  3SK6 A;  3JAM L;  2RSN A;  5KND A;  3D3R A;  1PZJ D;  5C4H A;  1FNW A;  1KTK A;  1STA A;  5DNF A;  5KRU A;  3I72 A;  2BA0 A;  5C5L A;  4HAE A;  3GQB A;  1GJX A;  1HPC A;  3QB3 A;  4OO1 I;  4RKB A;  2KCC A;  1I4P A;  2X6G A;  1CQV A;  2G9H D;  2DNE A;  3PUX A;  4FVM A;  1OXS C;  2EY5 A;  4Y7N B;  1L0Y B;  3KLR A;  5K5P A;  2MGS A;  2FMC A;  5C5M A;  5FLX L;  1STY A;  2JEA I;  2MJ8 A;  1F2L A;  1QJO A;  2EYP A;  4LAA A;  1MSG A;  4TQU S;  2VB2 X;  5CV4 A;  5M5X B;  2EYF A;  3HOX B;  2R93 B;  1M4V A;  1TS5 A;  1SYB A;  1G6Z A;  1ZYR D;  2RDG A;  2Y0S B;  1V1O A;  3E5S A;  3BVZ A;  1H9S A;  3Q0A A;  4NDX A;  2NVX B;  3MHB A;  2E2D C;  3GP7 A;  3SR1 A;  1Z47 A;  2B2V A;  3NK9 A;  2K5D A;  4ODG A;  4EQO A;  4IQZ A;  2O4X A;  1WTO A;  1B9M A;  1AP0 A;  1GUN A;  4J6H A;  3J81 E;  1BO0 A;  4ID6 A;  2IJ0 A;  2F0O A;  4DK0 A;  4A3F B;  1TS4 A;  3SK8 A;  4B9W A;  1BR9 A;  1RCV D;  5D3D A;  4K8J A;  3TP6 A;  2F0Q A;  3S1R B;  1PTO B;  3NBH A;  1Y1W B;  2A6H C;  1ILP A;  1AZP A;  1JR0 D;  5IGG A;  1EIG A;  3S9W A;  1GUO A;  3V96 A;  4KK7 A;  5AFW A;  4A3M B;  1TT2 A;  2B2Y C;  5CMD A;  3KLS A;  2E76 C;  2F1M A;  5FO9 B;  2ZT9 C;  5ELD A;  1RD9 D;  4PQX A;  3EFX D;  2EJF C;  4FF3 A;  5COY A;  5FO8 B;  2PCF B;  1S5B D;  3OHX C;  3KBG A;  3VA7 A;  4QUF A;  2GA4 B;  2JA5 B;  1A3U A;  2V4D A;  3MXU A;  3HG9 A;  4QF4 A;  2ICE C;  1IYU A;  3W2D A;  3BVM A;  4DA2 A;  4KI0 A;  2VNU D;  3PIP 3;  4ABN A;  4M8A A;  3Q23 A;  3H94 A;  4AYB B;  4KJN A;  1IYV A;  4DAY A;  2CW0 C;  4L6T B;  2R61 A;  3VYS A;  2MP1 A;  1WTV A;  3PUY A;  3K0Y A;  3NXW A;  1EQV A;  1SE2 A;  2IX3 A;  2ZXP A;  3S17 B;  2F03 A;  1R4P B;  2C5C A;  1LTB D;  3RMH A;  1AEX A;  4OO1 H;  3KK7 A;  4FF1 A;  1BBX C;  4CHT B;  2DN8 A;  3M4Y A;  3GTP B;  1STN A;  1QNU A;  2F0J A;  1LAB A;  1QWY A;  3M4O B;  2ICI A;  1KNE A;  3WOF A;  1XWE A;  1QIL A;  5FK9 C;  5FKA C;  1KDB A;  3MXG A;  2H4O A;  3T56 B;  2K01 A;  1F2M A;  1BQQ T;  1TII D;  4C1N K;  1ONL A;  4GZY C;  3NQI A;  2B2V C;  3EQL C;  4CKE A;  1F9P A;  4RGO S;  2F0U A;  1GUT A;  3VA5 A;  1U9R A;  2Q8T A;  1PMR A;  3NWT A;  1TS2 A;  2FJ2 A;  4RFB A;  4I7Z C;  1CA5 A;  3C3L A;  5G3L D;  1W6J A;  2B8G A;  2NVY B;  1ILQ A;  3H91 A;  4IUR A;  2E74 C;  5EPJ A;  4KKU A;  3R8B A;  2WP8 J;  3GV3 A;  2WII B;  1LTS D;  4G7H C;  5C3W A;  3IAY A;  4RH6 A;  3DHQ A;  4IUU A;  1B1Z A;  3ZYY X;  5CR3 A;  1O78 A;  1XYI A;  3SEB A;  3BDO A;  2IT1 A;  5I9P A;  1SYC A;  2NVT B;  1I6V C;  4KY6 A;  2A6E D;  3PUZ A;  4BBS B;  5JPN C;  4KMU C;  1NUC A;  3BYY B;  4KHV A;  1EEI D;  1K83 B;  1NR2 A;  4KD4 A;  2L0C A;  3GD7 A;  2KEE A;  3HGB A;  3PO3 B;  3C1F A;  4UAI A;  5JEA H;  4P2C B;  3TZD A;  1O7Z A;  2R7Z B;  4IFD J;  3MVV A;  4MIU A;  1SNQ A;  2EXZ A;  4R9W A;  4ULL A;  4H7B A;  3ERO A;  1TY0 A;  1Q1E A;  3D4W A;  5KYL A;  1XX8 A;  3J81 L;  2XN9 C;  1V1P A;  1JCK B;  1SE3 A;  2YU9 B;  2X6L A;  5C4X B;  1PYW D;  1OXV A;  2F0E A;  1BCP D;  2QF7 A;  1PTO C;  3FMC A;  3GTO B;  4C3J B;  2F0G A;  2NVQ B;  4IN3 A;  2OT2 A;  1Z7T A;  4F8M A;  5CYU A;  4N9P A;  3OSO A;  1SDF A;  1QNK A;  3QG1 A;  3NUC A;  2F4I A;  3CQZ B;  3TDQ A;  2HDM A;  2E2I B;  3X3M A;  4KN7 C;  3BS1 A;  3FPP A;  1A15 A;  1E2W A;  3MFG A;  4NKL A;  4XQJ A;  1EY0 A;  1OO9 B;  2CHB D;  4V19 0;  2ZXR A;  4A3G B;  2K5W A;  4BS9 A;  1UEA B;  1DYQ A;  3ERQ A;  2HUG A;  3A55 A;  1JOQ A;  2IWH A;  3S1Q B;  2JA8 B;  4X3S A;  5EBD A;  2N88 A;  4RAU C;  1XXG A;  3GTJ B;  4A3J B;  1SYF A;  1O7Y A;  3FVQ A;  1EY6 A;  4HR7 B;  2FIN B;  4FO2 A;  5HGT A;  2DNC A;  4G7Z C;  2PMZ B;  1G2T A;  2A69 C;  1JQY D;  5IIF A;  2ID0 A;  3I73 A;  2CQA A;  3MXP A;  4J8Q A;  4K5W A;  5ELE A;  3DWQ A;  2RQX A;  3GTG B;  1F77 A;  1B4O A;  2AWN A;  1B2T A;  1EY7 A;  2K5Q A;  1GUS A;  1DON A;  3NWS A;  2F0K A;  3P75 A;  1UUP A;  1DD2 A;  3VR3 A;  4OO1 G;  3ND9 A;  2O2L D;  3C2P A;  5C3X A;  1MSH A;  2JEB I;  1ESR A;  3GTM B;  5D65 A;  1PDQ A;  1TY2 A;  5M3M B;  2RSO A;  3OPO A;  1OXX K;  3HOW B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...