4QUCA

Crystal structure of chromodomain of rhino
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
56
structure length
56
Chain Sequence
EYVVEKILGKRFVNGRPQVLVKWSGFPNENNTWEPLENVGNCMKLVSDFESEVFRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Transgenerationally inherited piRNAs trigger piRNA biogenesis by changing the chromatin of piRNA clusters and inducing precursor processing.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Protein binding
molecule keywords RE36324p
total genus 12
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2014-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4qucA00
1AP0A 2N88A 1HRJA 3IL8A 1O7YA 4X3SA 1EIHA 5D14A 5AFWA 1WTVA 2B2VC 3KBXA 2JP1A 1ML0D 5E4XA 2M2LA 4MHEA 2RA4A 4NW2A 1PDQA 2NZ1D 1GUWA 4XT3B 1DONA 4HAEA 1WTXA 2FHTA 1HFGA 4OIKA 2B2WA 2HCIA 2KVMA 5EKIA 1AZPA 2X6GA 1NR2A 3N52A 5EQ0A 1QE6A 1HHVA 3LWEA 2VXWA 1EOTA 2R3ZA 1JE4A 1WTRA 2MP1A 2EPBA 4R9WA 2B2VA 2K1BA 1DOMA 3G7LA 1CA6A 2FMMA 1U4RA 1WTPA 4IURA 5JJZA 1MI2A 3FPUB 2B2YC 2L9HA 1EL0A 1SAPA 1KNEA 4IUQA 2L4NA 3I90A 4HSVA 1RJTA 1ZXTA 2X6LA 2XIWA 1B2TA 1G2TA 1ILQA 2NYZD 4CJ0B 1ESRA 2K03A 3H91A 1X3QA 2L12A 4X3UA 3QO2A 1XX8A 1HUNA 1J9OA 1O80A 2H1EA 5EPKA 1WTQA 2KEDA 2KECA 5E4WC 2KEEA 4ZKBB 2EOTA 2RSNA 1WD0A 5EPLA 4LMQD 1RTOA 1F9QA 1F2LA 1CA5A 1KNAA 3D6WA 3GV3A 1HUMA 1G6ZA 1QG7A 1G2SA 1BBXC 4XDXA 3I91A 4ZK9B 1X3PA 1RHPA 2DY8A 1PLFA 3IFDA 2N55A 3Q6SA 4ZAIA 3R93A 4UAIA 1WTWA 1IL8A 1BO0A 3KUPA 4ZKCB 4MN3A 5CORA 3FDTA 4IUVA 4QUFA 4R8IA 1XYIA 5DNFA 2B2WC 3P7JA 4RA8A 2MPMA 4OIJA 2D9UA 1MSGA 4O42A 1TVXA 2HCCA 1JICA 4XT1B 4CJ1B 2L11A 2X69A 5CBEE 1PFBA 2JYOA 2CVRA 2HUGA 5EPJA 2L1BA 1A15A 5D65A 1B3AA 2K01A 1U4MA 4IUUA 4U68A 1M8AA 1ICWA 1IKMA 1F9PA 4HEDA 1IKLA 2SDFA 1J8IA 1HA6A 4QUCA 4ZLTF 1PFNA 2J7ZA 4IUTA 5T1IA 1E0BA 2NWGA 2KOLA 1ILPA 1DZ1A 2BDNA 1RTNA 1EIGA 1F9SA 1X32A 1MSHA 1NAPA 1SDFA 3ONAB 1O7ZA 1F9RA 1U4PA 2DY7A 2B2UC 3GV6A 1QNKA 1AZQA 3TZDA 1DOKA 2MJ8A 2RVLA 5T1GA 2Q8TA 2FINB 1WVLA 3UI2A 4DN4M 5CBAE 2K28A 2B2TC 1HFNA 3MWYW 3DEOA 1SSOA 2RSOA 1BF4A 4RAUC 2FJ2A 3I3CA 1DOLA 1MGSA 1CM9A 2Q8RE 2IL8A 2B2TA 1WTOA 3MTSA 2MGSA 3F2UA 1C8CA 4RWSC 1VMCA 3SVMA 1Q3LA 1B50A 2B2YA 1EQTA 1PFMA 2B2UA 3I8ZA 2FFKB 1NR4A 1BNZA 1NCVA 4X3TA 2HDLA 4HCSA 5CMDA 1B53A 1VMPA 2KUMA 1LV9A 3DM1A 5COYA 5EJWA 4IUPA 1B4OA 3TN2A 1RODA 1U4LA 2EE1A 3DEPA 1S4ZA 3HP3A 4X3KA 1WD1A 1G91A 2K05A 2K04A 4CJ2C 2HDMA
chains in the Genus database with same CATH superfamily
3BYTB 4IPGA 4ILWA 2K5DA 4A3MG 1LABA 1EY8A 2BOSA 1NNXA 1IYVA 4MHEA 1FYCA 1XMQL 3A7LA 3BZKA 4XT3B 3HS0C 2KVMA 3S1QB 3S14B 4B3RQ 3P20A 3T51B 4ID6A 4JI0L 1WTRA 4M1UB 4F87A 2K1BA 1DOMA 4JBKA 3DUZA 4DV1Q 4XXEA 1JR0D 3CRKC 1EWIA 2J0TD 4X65Q 3I2ZA 2L9HA 1SAPA 4ALPA 1UUPA 1ZXTA 2XIWA 3WOFA 2WKCA 3MC0B 1STGA 3KOJA 2E2HB 3VDYA 1SYBA 2L12A 1KDAA 4DV4L 2DN8A 2F3VA 1R9TH 5E4WC 2NB0A 4DAYA 2EOTA 5LMNW 4DR6Q 4DV1L 5J39A 1BCPC 4Y7NH 2N55A 5KNDA 1MJEA 3BDOA 2UXCL 3KUPA 4ZKCB 4AYBE 2A68D 3FDTA 3AFPA 1VQPA 3K59A 2L11A 3R2TA 3VYRA 4JOIA 1IBKL 1IBLL 5D65A 1SYFA 4EQ5A 1VQ7A 3GP7A 3T1YL 1HXYD 3OYYA 2L0CA 4HMJA 4JVZA 4DR5Q 2IPKD 1PTOH 1ONLA 4JI7Q 1LTLA 2K4KA 3U9OA 3CCRA 2B29A 3CD6A 2P5ZX 3W1BA 3EA6A 2FJ2A 1N32Q 4DU9A 3I3CA 5EKKA 5BR8Q 2JQOA 3D31A 4XIGS 1WTOA 4LF5L 3HOZG 1GJXA 2JEBI 3F1ZA 1SJHD 1H9JA 1I5FA 1NR4A 1OXUA 1VQEA 1U0LA 1VF7A 3R2IA 5M5XH 4DXFA 3RLNA 1VS0A 4IUPA 3I4OA 1U4LA 2F0HA 3TEHB 1BBUA 1TS3A 1JOQA 5ELEA 4ME5A 4EGVA 1LT4D 4A3MB 3SEBA 1HNZL 2F0QA 4X3SA 1WOCA 4A3IG 1EQRA 2JN4A 2NVQH 2M2LA 4H44C 2E2JB 1YNJC 2LMCB 4DK0A 1HFGA 3H0GH 4R4CA 1TKWB 5EKIA 2GA4B 4CBVA 5IT9E 5I6WA 3KF6A 1A8VA 3PIOA 4DAPA 1N34Q 3S1NH 3SE0A 4IURA 4BY7H 3HOUH 3S1RH 2RDFA 1PH2A 3G71A 3K5MA 1SNQA 4A3GH 1OXSC 3HZXA 3GTKH 1NJIC 4FF4A 1ESRA 4K0KQ 4YCVA 1K83H 1HUNA 3S2HB 5EPKA 1TWAH 5C4JB 1XPOA 1HPCA 4QIWB 4DR3L 3SXHA 4A3FH 4BY7G 2YV5A 1EYDA 1VQNA 3HKSA 5EGTA 1KAAA 3VR5A 3K7AH 2YTYA 1DXMA 5C3XA 1LTRD 3TS0A 3S9WA 5IT9c 5C4ZA 4AH6A 3JAML 2PNHA 1CKNA 2HUGA 1QNUA 2JK8A 2EYOA 4JV5Q 1HH2P 3I4NH 3DWAA 1G6PA 4QUCA 4AQYL 3GTJB 3J80i 2CHBD 4B9WA 4A3IH 2E75C 3GDEA 4V0BA 1IW7C 2O5JC 1SROA 3A54A 3HOVG 3BDLA 2UXBQ 1SE8A 2RVLA 2NN6H 5IOCA 2TMPA 3HOXH 4JV5L 1V9PA 2B2TC 1BF4A 4RAUC 1Q12A 1BVSA 2K52A 4GS3A 4FXKC 4BY1B 4GLXA 3OIPA 1SYGA 4G7ZC 2NVXH 1S3OA 4DR7L 3H09A 1TQOA 4MNOA 4QY7A 3GTPH 4IZ8A 1JOOA 1UE1A 2FFKB 3C3LA 1VQOA 1N34L 3TBIB 4OL7A 1Q86C 3KF8A 1SNDA 3KK7A 2Z0SA 4X3KA 5FK9C 3VR6A 3E6ZX 4X65L 1JB7A 3H3VC 2HDMA 1LT5D 4V190 3MXPA 1ASYA 5JPNC 2PO4A 3PIP3 5M5XB 3KDFB 1L0YB 3U50C 2RDGA 2EXDA 4CHTB 5C44B 4JI5L 1PH4A 4ZQ3A 2EIFA 4J6HA 4KD3A 2NZOA 4N9PA 3RLOA 4QQBX 4TKOB 4B3RL 3A56A 4LUZA 3OMCA 2H5XA 5EQ0A 1I6HH 3I4MB 3SK6A 2HT1A 1H9KA 4R9WA 2Y0SE 3J81L 2ZTDA 3RLFA 4LUVA 1B7YB 3D4DA 1WTPA 3T16A 1I4PA 1VQ5A 3BVZA 1JMCA 1STHA 5JEAJ 1PFSA 3HKZB 1J5EL 2JA5H 1V1PB 1IBKQ 3S2DH 1CUKA 3FEWX 2EDGA 4A3JG 1S40A 3K80C 5CR3A 2Z6KC 5EPLA 4QMGA 3GQBA 4ZRZA 2K5NA 1YNXA 4OWXB 4OX9L 1HZCA 5C0XG 1T5EA 5J22A 3H0GG 3TSSA 4LF4Q 3H0GB 1YZ6A 3VYUA 1YJNA 4IUVA 4RA8A 3S16H 4R4OA 4BBRG 1YBYA 1R4PB 2RF4A 4JI6Q 1SE2A 1CHQD 4Z9CB 2MHVA 2L1BA 2YTVA 4PMBA 1F9PA 4HEDA 1PH9A 1I6HB 2M9VA 3PMFA 3CC2A 2NVYH 1H95A 2KBNA 3KJOA 3KLSA 3BZDB 1CQVA 1MSHA 4A93G 1NAPA 1F9RA 1PRTB 1WJJA 3I70A 3F2BA 4WJWA 1Q90A 1TWGB 2DJFC 2FINB 2J4XA 1I4GA 4BBRB 3K6OA 4N9TA 2RSOA 1K73C 1MGSA 2DJGC 2AUJD 4CGYB 4BBSG 1KXLA 2EY5A 1Y8PB 1Z7TA 1XPRA 1B50A 2JA7B 2SOBA 5IYCH 4X62L 4A3BG 3S24A 3QIAA 3UE1A 1JJ2A 4BY7B 4E6IA 1QVFA 5CMDA 1VMPA 1Y1VB 3GTQH 2EY2A 4DF7A 2NVXB 3J81E 1MBYA 4OXPA 4RG1A 2N88A 5LHY1 4LFBL 4XQNA 1JQYD 3PGZA 2F0MA 2WKDA 3MA2B 3HOZH 4J15A 3KYHC 2OXPA 4LAAA 1QUQA 4IJLA 2VUMH 2LSSA 1HHVA 2WB1B 1EQVA 5M5WH 4YIJA 4Y52H 4JOIC 2B2VA 1X55A 3ERSX 1MHWC 3BVMA 5M3MH 1EFID 5C0XI 4LFAL 1MI2A 4HJ5A 1R9TB 1AE2A 3M85A 2L4NA 3RZDB 2NYZD 2K03A 3I55A 5IP9H 1EEFD 1X3QA 2KENA 1QVCA 3DWPA 4IFDH 1BKBA 3PO2H 3STBD 4DR6L 3MZ5A 5ELNA 4GNXC 1UE5A 2JA7G 4ODGA 4IALA 3PF4A 1G6ZA 1LTID 4IFDG 3CCQA 3QOJA 3NEMA 2QDBA 3PUVA 5AJ3L 4K5XA 4G7HC 5BN4A 4DGZA 1N36L 1CSPA 4KJOA 1IL2A 4RKBA 4TVAB 4O42A 2PI2A 4A3GB 5IP7H 3DHQA 1HA6A 1ICFB 4KLKA 2F0EA 1GUGA 3ULPA 1X32A 3OW7A 3IAYA 1WYDA 2RDHA 1PRTC 3TQYA 2ASBA 3TZUA 4N8FA 3WOEA 2L5TA 4JPBW 5IGFA 5CBAE 5FJ8G 2NTSA 4O0AA 4NB3A 2VZAA 3D4WA 4F8MA 2OWOA 2B63H 1ENFA 3NXWA 1H9SA 4TRDA 4C3JG 3RN2A 3AFQA 3ULJA 4HJ8A 1D8LA 2K5HA 3K0XA 3VA5A 4DV5Q 2MQHA 4JI2Q 2CWAA 1LV9A 1SFOB 2K32A 1SMYC 3M7GA 3Q8DA 2A1AA 2VW9A 4A3FB 3CXCA 3PUWA 1AFPA 2OCEA 1FNVA 3STBC 1PTOD 1LT3D 5C6AA 3D0FA 1N9WA 3TREA 1WCMG 1EY5A 3OOCA 1VQIA 1GM5A 1GD7A 5KNBA 4RCOA 1K8GA 1LTBD 1TWHH 2Z4IA 4JC0A 3V96A 4JI1Q 4HSPA 4HMIA 1YIJA 3C1EA 1J5EQ 2F0LA 1KLUD 5C0XH 2X6LA 1STNA 2PZWA 1W6KA 3NE5B 1P8LA 3VR2A 2RSNA 4J1MA 1E2VA 2LXJA 1QG7A 1G2SA 2EVBA 1YHAA 3EQLC 3EROA 4KV6A 1RHPA 2GVAA 1PLFA 2Y0SG 2F0TA 5L37A 1A2UA 1HCZA 2B8GA 5IIFA 4R8IA 4ZUIA 1EQQA 1VQLA 2E5LL 4LUOA 5CC4A 1HR0L 5M3MB 1U4MA 4XQQA 3EVQA 4U68A 1ICWA 1H9SB 1F2MA 2RHSB 4DR1Q 1QJOA 1E0BA 1SLJA 3E3XA 3VR3A 1PH6A 4A3DG 1SMYD 1B70B 2OEOA 1SDFA 1SRUA 3CP0A 1PH5A 1DOKA 3KF8B 4A3CH 1PYWD 1TWGH 1GHJA 4G57A 2HQEA 2WV6D 3B6YA 4RMFA 2WAQE 3PO3B 1N32L 1Q1EA 3U4VA 4JI5Q 3J81i 3L9AX 4A3DH 4LF6Q 2IX1A 2F0WA 1WI5A 4CKCA 3SDZA 1KABA 1A6XA 3OSOA 2CH4A 3MXNA 1Y69U 4DR5L 2O5IC 1PYBA 3T4AC 3UDGA 3HOXG 1LM0A 3NWTA 2K04A 2JJQA 3H94A 4POFA 4A3KG 4GKJQ 4H13C 1D5XC 4X6AH 2AQ3B 4LK1C 2SNSA 4R4IA 4LF6L 4R8NA 2NVTH 3KBXA 4MTKA 3I4MH 2NZ1D 3V05A 3J7AF 3C1FA 5GQOA 1XMOL 2FHTA 1KDBA 4NXML 2QA4A 3N52A 3D8GA 4RH6A 4P2CB 4FP5D 3TP7A 2YU9B 4GN3B 4YWKA 3G7LA 1CA6A 4XQJA 2FMMA 1U4RA 2QEXA 4DV6L 4IPHA 3RN5A 1I94Q 3HOWB 1KNEA 3NTIA 1JWSD 1CFMA 4HSVA 2R92B 5KIXA 2YTXA 3MXGA 2N49A 5ELBA 1G51A 1EY7A 1T5XD 2ZXPA 1GUNA 1O7IA 3V2TA 2XGTA 5FOBB 2BH8A 3I73A 3S1RB 1VQ6A 1S5CD 1HJPA 3D6WA 2ZJQA 1SYDA 1SE4A 2E76C 2WP8J 1FL0A 2HD3A 3IFDA 1Y1VG 1GOZA 2UXDL 2NVTB 1XTDA 1IW7D 4UAIA 4XYOA 3R93A 4MN3A 1XNRL 3HOUG 1XYIA 1TIID 2RHQB 3F2CA 3QB3A 5CBEE 3H6MA 5J3BA 1VQHA 4A3JH 4CDCC 4K0KL 4PZ8A 3M3YB 5GAGC 3J7ZC 1V1QA 5HY6A 5IYDH 1N33L 4NXNQ 3A0JA 5IYBH 2NTTA 1CQFA 2NUCA 1O7LA 3OMGA 2NWGA 4DR4L 1B1ZA 2IHEA 4BA1I 1D1KA 3M4OB 2PW7A 1HTPA 1E2WA 5T1GA 1RD9D 4P71A 4JI1L 1X65A 3NELA 4DN4M 4KTAA 2JSOA 3DEOA 4NMZA 1YI2A 5GADC 2Z1CA 1GUSA 1AE3A 2XWJB 2IL8A 3SK4A 4LF8Q 1D2BA 4RWSC 2BA1A 3K58A 4F7XA 3VYSA 4X64L 3WWVA 4UY8C 3BJUA 2RCNA 3Q0AA 3A7AB 4P72A 3J7A5 1XXGA 4IN3A 2GN5A 5D3DA 1EIYB 3M4QA 1NBWA 1RODA 5FLXL 1ASZA 3HRZC 4DNTB 4BY1H 1VQKA 4WRDA 1L2FA 1ET6A 4A3KH 2UXBL 1BCPB 2VQEQ 3VYTA 4L8JA 2E2IB 2R7ZB 2B39A 3GTGB 4HIKA 2K50A 1M4VA 1CSQA 3TP5A 4DV7L 5IP9G 1RDPD 1LTSD 3LWUA 3GTJH 2K75A 4RGNA 3RMHA 3LWEA 2VXWA 4ZYSA 2XNAC 1VQ4A 3SK8A 1XPUA 1K8MA 4JI2L 2Q2UA 2F0DA 2YU9H 2KA7A 4N8X1 1JC7A 3QR8A 1S5DD 1TY0A 1XNRQ 4GNXA 2KQ3A 4JK1C 2ZTCA 5KYIA 3GTMH 1LT6D 2ZJPA 5C44G 5KYLA 1TWFH 1A62A 4ZKBB 5JJLA 1RTOA 1VQBA 3H15A 2VUMG 2F0OA 3JAMc 4DUZL 3OPOA 2V1CC 4UHVA 2ZJRA 4DV3Q 2QDLA 4LJZC 2E2DC 4DR1L 1GHKA 4ZUJA 5BN5A 4OEMB 3W5OA 3CRLC 1X9NA 4A3FG 1IYUA 1EY0A 2MPMA 4OIJA 1L0XB 1TVXA 1AW7A 3NBHB 3CCUA 4DUZQ 1B3AA 2K01A 1M8AA 3G6EA 1T9HA 5I6YA 3KLRA 3U4ZA 4JI4Q 1XMOQ 4NXMQ 1HNWL 4UP9A 1Y8NB 3NENA 5C3EH 1YJWA 2B2UC 2RBMA 2WB1E 4RGTA 2MO0A 5IWAQ 2BCOA 2PQEA 5CV7A 3HOWG 2E2JH 2NVQB 5I4DA 1EY4A 1XMQQ 4YCUA 1HNWQ 1YNND 3DXJC 1CTMA 3OTOQ 2F0NA 3GD7A 4WJ4A 3I4MG 1CKNB 3S17H 3I8ZA 2E2HH 2ENBA 1B53A 4KJNA 1FGUA 2R93H 2F0GA 4IFDJ 1QB5D 1LTGD 4IPDA 1Q82C 4FF3A 3SK5A 1A0IA 4AIMA 1ENAA 4DAYB 1M90C 1WTVA 2A5HA 2B2VC 2JP1A 4LWCA 3NHHA 1STBA 4YY3Q 5A2QL 3D3RA 2Z8LA 4JI8L 4IQZA 2B2WA 4OIKA 4TQUS 4GOPA 4JW0A 2K7VA 3MFYA 1EOTA 1BCPF 3P1HA 2UU9L 1B8AA 5JEAG 3EN2A 1HQMC 3MVVA 5F2DA 3S1NB 2D5DA 2ZT9C 4CKEA 3CF5A 2OT2A 4S3SA 3VA7A 4P75A 2B2YC 4GN5A 1Q8IA 4QJFA 3HOYB 4CJ0B 3H91A 2Q2HA 2R61A 1V1OA 2DUDA 1OXVA 5CV4A 2F3IA 1S5FD 3PV0A 4KHVA 4XDXA 3I91A 3BG3A 3Q6SA 3P75A 1SMXA 1V1PA 1IL8A 2VQFL 4K5WA 5LL6S 2ZTEA 4DUYQ 2D9UA 1MSGA 3W2DA 1FD7D 1I50B 3NBIA 1EYAA 5C4XH 1MKHA 3HKZE 4YHHQ 4RCNA 2SDFA 5CYUA 3FRPB 4L6TB 1LO5D 1K8OA 2J7ZA 5EBCA 3Q22A 1O7ZA 5JVH3 4R4TA 1PZID 4G4KA 3QWNA 4QIWE 5C4HA 3F2DA 2MJ8A 3IFTA 1DYQA 4C3IG 4L5SA 3UI2A 3NUCA 4Q0FA 3M7NA 2Q8IB 1SSOA 1X6OA 2JXMB 3J7AV 1JB3A 5JEAH 2BH2A 2B8FA 4YY3L 2B2TA 4H0LC 3RD4A 2TSSA 4DXGA 2CW0C 3HG9A 4K5VA 4B3ML 4KY7A 1ET9A 1S5BD 1VQCA 1N33Q 2FMCA 2RCFA 1QWYA 1BNZA 2R7FA 4X3TA 4Y7NB 1A3VA 2IHFA 4C3HG 1YITA 5AJ3Q 1X54A 4FVMA 4DV6Q 3PUZA 4C3IB 5CV8A 1VQ9A 5HURA 3U58A 4FNFA 2B63G 2JA6B 4PMWA 3HOZB 4DNRB 1VQAA 3RZDH 3ZYYX 5FKAC 3FHWA 1QE6A 3CMEA 2LS01 1STAA 2XWBB 3NSWA 1JE5A 1TWCB 1K0RA 3CC7A 1L1OB 1NSNS 4JI4L 1A2TA 1BCPD 2AMCB 2I5HA 5C3WA 3M3YH 2JA5B 4QB4A 5JJKA 1DGSA 1X56A 4A3IB 2AKWB 4C2MB 2EYJA 3OWEB 1PZJD 4I65A 1WFQA 1XX8A 1WTQA 2KEDA 5M3FH 1Q7YC 4UP8A 1PH1A 1QCBD 4POGA 3EBEA 2F0IA 2IT1A 1HUMA 5CV5A 1MIUA 2V4DA 2UUCQ 2CH4W 3DM3A 2KJXA 4A3EG 1JORA 2A73B 1RKNA 4KHPQ 2D0PA 3DMUA 1WTWA 4ZCKA 1LTAD 2VS1A 3W1GA 1PTOF 2IJ0A 3E5SA 1D5MC 1G8ZD 1I4RA 5I9PA 4KY5A 1S5ED 4OGQC 4CJ1B 4U673 2CVRA 1F2ZA 1Z9FA 1A15A 2NN6G 4AQYQ 1N8RC 4IUUA 1ZYRD 4LF8L 5A2QE 3FMCA 4A3EH 2EYLA 1BR9A 5EAYA 3CCMA 1C7YA 1PHJA 3CCVA 2WAQB 1EIGA 3Q24A 5LL6X 1QNKA 3HOUB 4ABNA 1SNCA 3M9BA 4YWMA 1S72A 4FXDA 2KHJA 2MUYA 3N6RA 3CCEA 5C5MA 2WFWA 4EQOA 1ZEQX 4GOPB 1C8CA 2C5CA 3BYYB 1GKHA 2B2YA 1V43A 1P16A 1TWAB 4DPGA 4J8QA 4X62Q 3S2DB 4B3TQ 4RGOS 4A76A 4GZYC 5IODA 1PYSB 1G291 4KHZA 3VR4A 2XVSA 2QKIC 1I50H 2I5LX 3CHBD 3L7ZC 4LF4L 1G91A 3LGJA 1EZ8A 5IWAL 1NMFA 4L63B 4ULLA 1HR0Q 4RKLA 4A3BH 1Y1WH 1LYLA 4NW2A 3FKIB 3FKIG 4BBSH 1TR5A 2RQXA 2M00A 2JA6H 3HGBA 2R3ZA 3UE0A 2MP1A 2EPBA 2UUCL 1BQQT 4FO2A 4P74A 3TDQA 1OXXK 4PZ6A 4A3LH 5CV6A 1OXTA 4IJHA 4AYBG 1Q8KA 1XNQL 3NQTA 3BVGA 2K5VA 3AU7A 4MTNA 3SHLA 1RJTA 3LNNA 2F0PA 3HOYH 1QZHA 2F52A 1EWHA 5KEEA 3BZCA 1Y8OB 2KECA 1CHPD 2NZHA 2KEEA 1B3QA 1EU3A 1WD0A 4KI0A 4LMQD 5GAHC 1F2LA 1BXTA 5M3FB 3I4NG 2L15A 1D1IA 1HNXL 3EIVA 1UEAB 2OTLA 2UU9Q 5D3IB 4ZAIA 2PCFB 4LW1A 4IO9A 2O4XA 3GTPB 4GKJL 3L0OA 1VQ8A 1OO9B 5ELOA 4OO1H 4XT1B 5E7NA 5FO9B 2ZXRA 2X69A 4DV4Q 4DAMA 4YWLA 2K14A 3E9HA 5BN3A 4DAVA 4B3TL 1E3PA 1SFOH 1C9OA 4BA2I 3JC66 1K28A 4JYAL 1TXYA 2EYPA 2SEBD 1C48A 4DK1A 3KBGA 1E1OA 4DV2Q 2B63B 1PMRA 2HIXA 2BDOA 1NMGA 1SXTA 4K2KA 1TS5A 2N8NA 3MTSA 1V8QA 1BDOA 1JWUD 4LNQA 5IP7G 3QOLA 3AB9A 3S1MH 5M9OA 3PUYA 5C3EB 3G48A 2B2UA 2LY7A 2I46A 4A3DB 2CWPA 4BXXG 5DM63 3KJPA 3DM1A 5K5PA 1VQDA 4WFN3 2G5DA 2K05A 2EY6A 2PQAA 3A5ZB 3S15B 3CMAA 3IL8A 3I72A 4HIDA 2N3SA 1YJ9A 1KD1C 5E4XA 5E1FA 2RA4A 4RHRA 1HNZQ 2JA7H 3GTKB 2UUBL 1D7QA 3OW2A 2X6GA 2EJMA 3S15H 2A19A 4A4IA 1IYJB 3HFZB 1U5KA 1XJVA 1SEBD 3OWFA 4JBWA 1RCVD 3T56B 2A69C 1TWFB 5IE8A 2XRQD 5IYCG 3GTLB 1EU4A 2A8VA 2EY1A 3CW2C 3HOYG 3T1HL 2DGYA 1LACA 3H3VH 5M3MG 2A6ED 3PIPA 5G3LF 3S1MB 2EJGC 2F0KA 2K6AA 1SNOA 4OWTB 4IOAA 3IRBA 1PTOB 4NKLA 4RFBA 2LXKA 3RZOH 1SJED 4X66L 4DK3C 2CCZA 4DUYL 1FJGQ 4Q5VA 1CI3M 3CCLA 1EYGA 4QUFA 1CT1D 3PO2B 4XYQA 1VDZA 4QL5A 3PF5A 1EZ6A 2QF7A 1BBWA 1NE3A 1FR3A 4IOCA 2KCMA 2OQ0A 1FNUA 1GO3E 1KHIA 1KIXA 2LFNA 2F4VL 2QGQA 1DJRD 5T1IA 4HIOA 4GN4B 3MEFA 3J81j 2R92H 1DD2A 2XN9C 1K3RA 1TT2A 1VQGA 1F9SA 2JA9A 2XSCA 2DY7A 3G4SA 3S1QH 4EQNA 3QG1A 4K2LA 4JI7L 4X66Q 2XRSD 1FJGL 3LX0A 1IBLQ 2IW3A 4OHJA 5FLXc 3IKJA 1DOLA 2Q8RE 3T1YQ 4A3CG 2AWNA 4K6LA 4LF9Q 3CQZB 1IXRA 4EX5A 4DKAC 3WDNA 4PQXA 1WCMH 1UWVA 3E0EA 2F4VQ 2WINB 4A3EB 2F4IA 2N78A 4KY6A 4NP5A 4C3IH 5I2XA 2UXCQ 1WD1A 1KTKA 3AQQA 4L5TA 1AP0A 1X3FA 1C0AA 3S14H 2LKVA 4KN7C 1I4QA 2D62A 3PQIA 2VY3A 3W3AA 5M5YH 4GKKQ 1PDQA 2JA6G 1GUWA 4BY1G 4BBSB 4DK6C 5C4XG 4HCEA 3GTGH 1JE4A 2VB3X 1STYA 4H7BA 4I7AA 2PNRC 1EY6A 5IGDA 5FLXE 1PRTF 4HJ9A 3CU7A 1LLRD 2JA5G 4RGMA 1LTTD 1TS4A 4C1NK 1SE3A 5ELFA 2Q2TA 2IX0A 5GAEC 2D2CC 2R7ZG 1SYEA 3ERQA 1O80A 2DNCA 2H1EA 3J81c 2EYHA 2Z9HA 4LF9L 3E0JA 3OTOL 1L1OA 2RKSA 4PV1C 4WORA 2PPBC 1UNSA 1CA5A 1KNAA 5G3LD 2EQSA 2F0JA 3MAQA 2R93B 5C44H 1QZGA 5A35A 3G6JB 3FPPA 4HTHA 4BWGB 5I2YA 1BO0A 4B9XA 5TSSA 1AEXA 1JOKA 3MHBA 2KCNA 2CQAA 2QCPX 4KKSA 4A75A 2UUAQ 2A68C 3HEJA 2HCCA 4GNXB 1Z6HA 3QJYA 5EPJA 4M8AA 3OHXC 2VQEL 1JJCB 2R6GA 1B9NA 2YYZA 4OELB 5M5WB 1IKLA 3S2HH 4L5QA 1GUOA 1K3BC 1YNNC 3ER0A 3NK9A 3E9IA 1CZWA 2KOLA 4YCWA 2R93G 5FO8B 5FLMH 1Y1WB 3NP8A 1YEZA 2EYFA 2VQFQ 3K5OA 2E2IH 4FDBA 2ZXOA 2Q8TA 2F3WA 3J80c 2GVBA 3MWYW 1J6QA 1LUZA 2K5QA 4HIMA 3CPFA 3BS1A 1VMCA 4OONA 3SR1A 3SGIA 4JBJA 2ZM6L 2HQLA 4DV7Q 3K5NA 1OTCA 5M3FG 3I4NB 3BDCA 4DV5L 3M4PA 4C3HH 4A3MH 5EJWA 1B4OA 1S4ZA 1SBBB 1QILA 5KGUA 5EBDA 2F0FA 2MNAA 5IGBA 4H02A 2CFMA 1PTOC 2VB2X 2G9HD 5IGCA 1F77A 3TP8A 4DR2L 4B08A 1VQFA 2JEAI 3AYHB 1I3QH 1GVPA 2BA0A 5KNCA 1Q81C 1IBMQ 5IGEA 1E2ZA 2KHSA 3J80E 4DR4Q 1VCIA 1TU2B 1K83B 2PZTA 4JG2A 4EQPA 5C4JH 3PO2G 2NBFA 1SNPA 1EL0A 4IUQA 3A55A 1B2TA 3FKIH 1ILQA 2EZVA 4X3UA 3CAMA 1X3EA 3NWSA 1PH8A 4DR7Q 4KD4A 4JCVE 2ALYB 1BOSA 2L55A 1H9RA 4HN7A 2CQOA 3PCOB 4LF5Q 3K0YA 4C3JH 4ZK9B 1X3PA 4XTCS 3ICEA 3OIQA 4OX9Q 3NPPA 1CKOA 4HJ7A 3BU2A 1Z47A 2I07B 3HKZG 1B9MA 3P7JA 3DLLA 3JAMi 4HJAA 3UDIA 4LF7L 2EYMA 1SNMA 4R1JA 4PNYA 3PIO3 3C46A 1WCMB 3J80L 5C4XB 4LFCQ 3TRZA 3ZJYC 3CPWA 1PFNA 4JI8Q 4CDDC 3AMUA 1DZ1A 1SN8A 2BDNA 5LMUL 1QOHA 1Y1WG 2PQAB 1U4PA 4A93B 2PI2E 3TS2A 4CDFC 3TZDA 1IZ6A 4JYAQ 1WVLA 3RZOB 5CV9A 2JE6I 2F0UA 2K28A 4FYDA 1R4QB 4A3JB 3ULLA 4DA2A 1NTGA 3A8IE 3A5UA 1W6JA 1Q3LA 1EQTA 5C3EG 3EJIA 3CQZH 3K8AA 1GUTA 2WB1G 3X3MA 2QEJC 1NCVA 4DV3L 4IUNA 2R7ZH 1VQJA 2PYKA 2KUMA 2A69D 5COYA 1HR0W 5KRUA 4CJ2C 5IYDG 4AYBB 4B3SQ 1O7YA 1STEA 2EXZA 5D14A 4DV2L 1ZKOA 3ND8A 1EEID 3PO3G 2IX3A 3D6CA 4HAEA 1IHZA 1F2YA 5JAVA 1AZPA 1NR2A 3HOWH 2D0OA 2Q2IA 4K8IA 1EFWA 3GTOB 1FGBD 4NXNL 1TWCH 1FVIA 1Q1BA 3MFGA 1TS2A 2PZUA 1A3UA 1SYCA 3RNUA 3CKIB 1RIPA 1HZAA 1HZBA 3R3OA 4LF7Q 5M5YB 3K7UC 1K9MC 4B3MQ 4DR3Q 4F88A 1F9QA 4JI0Q 5IY0A 5IGGA 2VUMB 5ISRA 2C35B 4BS9A 4NPSA 1BBXC 4ME3A 1HNXQ 1DM0B 4RHSA 2F0VA 1E7ZA 3DWQA 3S16B 5FO7B 2O2LD 1B44D 4MZ9A 1D6EC 3ND9A 3NTKA 3KF6B 5JOBA 2JA8G 4A3LG 1XNQQ 2A6HC 4B3SL 2B2WC 5JPMC 2R92G 1EYCA 1TWHB 2JYOA 1ZYRC 1SR3A 1WTHA 4YHHL 4GOPC 1J8IA 4OWWB 1AN8A 2E8GA 4PZ7A 1ILPA 2IWHA 4MIUA 4KMUC 1E1TA 2PMZE 1IBML 3ONAB 3K57A 1W3SA 3TP6A 4BBRH 4JI3Q 4CDEC 4DR2Q 2QW7A 3C2PA 1HFNA 1YNJD 1TY2A 2EJFC 2ICEC 3GTMB 3GO5A 4K8JA 2MGSA 2E74C 3SVMA 5H1SE 2NVYB 3S17B 1K0SA 4X64Q 4WJ3M 1AH9A 4DV0Q 1I4XA 1PFMA 2UXDQ 1D5ZC 4FXGC 3AEVA 4UPAA 4IPCA 2HDLA 2ICIA 2AQ1B 1KRSA 1YHQA 5HGTA 3X3NA 3TN2A 3URYA 2EE1A 1KRTA 5FJ8H 4IFDI 4KHPL 3JAME 2A6EC 1FNWA 5AFWA 4I7ZC 1ML0D 4JI6L 1PH7A 1KAWA 4O1NA 1JJGA 3M4YA 1WTXA 3PSIA 4C3JB 2HCIA 5GROA 3L3OC 2CKZB 3MXNB 5DLQE 4A3BB 2K33A 2XTIA 4K6DA 1ESFA 3NQIA 3HOXB 3CC4A 3A8KE 2R7DA 1JCKB 2WIIB 2A6HD 5JJZA 1L1OC 3I90A 1NUCA 1KLGD 2Z6KA 3NBHA 1PXUA 4JBMA 3UDFA 4BXXH 4A3GG 1A63A 5K36H 2CW0D 2AQ2B 1W2BA 1J9OA 1I4HA 1L0WA 2JA8H 1UAPA 1PV4A 3GV3A 2HHHQ 1C4QA 1I3QB 3A74A 4A93H 5LMUQ 1KC8C 4O2DA 3I7FA 3J7YW 2UUAL 3O13A 3NTHA 1I94L 5CORA 4NDXA 5DNFA 1JT8A 3T13A 1X3GA 3FP9A 3UDXA 4PMCA 2PMZB 5IT9L 1K8AC 3HOVH 2B3GA 2OF1A 4LFBQ 1E24A 4GLVB 2HHHL 1EOVA 4KKTA 1IKMA 3K81C 4ZLTF 2ZM6Q 1EY9A 4IUTA 5DAUA 1EIFA 1HTLD 3Q23A 4C1NI 4UDUC 1Y14B 2KHIA 1AZQA 5ELCA 2WACA 2VL6A 5C0XJ 1HA5A 2AWOA 1PRTD 4A3KB 2ID0A 4KKUA 2ATWA 3PO3H 4QF4A 4FF2A 1PZKD 1Y1VH 3GTQB 1CM9A 4OO1I 2FXQA 3TMEA 3D4RA 1KL9A 4LFCL 1GXDC 4C2MH 5HGQA 2Y0SB 5LMNQ 3A8JE 3HOVB 3DEPA 1KDCA 1UE7A 3HP3A 4APVA 4TSSA 4DFAA 2HIVA 2E5LQ 1KQSA 3H3VI 1HRJA 5BR8L 1N36Q 4LFAQ 2H4OA 1EIHA 3T53B 1NY4A 4GKKL 2MFIA 1VF5C 1DONA 5JVG3 3MXUA 5DEHA 1XWEA 3M4OH 5I9OA 3K7AB 1M1KC 1EWCA 5JJIA 3L2PA 1HZ9A 4R4QA 4DNIA 5K36G 3MEHA 2ES2A 1DCZA 1U9RA 4HR7B 3U9SA 1CZGA 4QGUA 3FPUB 5LMNL 5DM73 2C9OA 5NUCA 2OTJA 4L5RC 1G2TA 1CKMA 3FVQA 1MJCA 3I4LA 3QO2A 5FLMG 2AHOB 2A74C 4C56C 1II3A 3ITPA 2AUKA 1XTCD 1QUQB 1EUJA 5ELDA 4UP7A 2DY8A 3KLSX 4C3HB 3K5LA 2SNMA 3PUXA 2KCCA 2JA8B 1BUVT 3KLWA 1I6VC 4K14A 4EVOA 2IY5B 4KN4C 5CGKA 1PVOA 1E22A 1JICA 2PW5A 1HQRD 1PFBA 1YHBA 3RUZA 2BE5D 2F1MA 2Z4HA 5EKLA 1CK1A 4DV0L 4G7OC 1O78A 3R8BA 1PA6A 2MO1A 2QILA 2F03A 3KFUA 3I56A 2I0QA 4CKBA 1RTNA 4KK7A 5C5LA 2WAQG 2Z6BA 3EFXD 1MD2D 1QVGA 3F8TA 3GV6A 1Q46A 1ENCA 1JWMD 1RL2A 2KCTA 5J1ZA 3KDFA 1H9MA 4JI3L 5E3FA 5IYBG 4P73A 3GTOH 2UUBQ 4GLAC 4FF1A 2NN6I 3T1HQ 3F2UA 1PH3A 2BE5C 1RF2D 1UE6A 4OO1G 4PG3A 1VQMA 2VNUD 4QCLA 2I5MX 2K5WA 2G9DA 3CCJA 3RR5A 1UEBA 4HCSA 1A3TA 1YVCA 2OQKA 3CCSA 3GTLH 2DNEA 2F0SA
chains in the Genus database with same CATH topology
3BYTB 4ILWA 2K5DA 1LABA 1EY8A 2BOSA 1IYVA 4MHEA 1FYCA 3A7LA 4XT3B 3HS0C 2KVMA 3S1QB 3S14B 3P20A 3T51B 4ID6A 1WTRA 4M1UB 4F87A 2K1BA 1DOMA 3DUZA 4XXEA 1JR0D 3CRKC 2J0TD 2L9HA 1SAPA 1UUPA 1ZXTA 2XIWA 3WOFA 2WKCA 3MC0B 1STGA 2E2HB 1SYBA 2L12A 1KDAA 2DN8A 2F3VA 5E4WC 2NB0A 4DAYA 2EOTA 5J39A 1BCPC 2N55A 5KNDA 3BDOA 3KUPA 4ZKCB 2A68D 3FDTA 3K59A 2L11A 3R2TA 3VYRA 5D65A 1SYFA 3GP7A 1HXYD 2L0CA 4HMJA 2IPKD 1PTOH 1ONLA 3U9OA 3EA6A 2FJ2A 4DU9A 3I3CA 5EKKA 3D31A 4XIGS 1WTOA 1GJXA 2JEBI 1SJHD 1H9JA 1OXUA 1NR4A 3R2IA 1VF7A 4DXFA 4IUPA 1U4LA 2F0HA 1TS3A 1JOQA 5ELEA 4ME5A 4EGVA 1LT4D 4A3MB 3SEBA 2F0QA 4X3SA 2M2LA 4H44C 2E2JB 1YNJC 2LMCB 4DK0A 1HFGA 1TKWB 5EKIA 2GA4B 4CBVA 5IT9E 5I6WA 4DAPA 3SE0A 4IURA 2RDFA 3K5MA 1SNQA 1OXSC 3HZXA 4FF4A 1ESRA 1HUNA 3S2HB 5EPKA 5C4JB 1HPCA 4QIWB 3SXHA 1EYDA 5EGTA 1KAAA 3VR5A 1DXMA 5C3XA 1LTRD 3S9WA 5C4ZA 3JAML 2HUGA 1QNUA 2EYOA 3DWAA 4QUCA 3GTJB 2CHBD 4B9WA 2E75C 4V0BA 1IW7C 2O5JC 3A54A 3BDLA 2RVLA 2NN6H 5IOCA 2TMPA 2B2TC 1BF4A 4RAUC 1Q12A 4FXKC 4BY1B 3OIPA 1SYGA 4G7ZC 3H09A 1TQOA 2FFKB 1JOOA 4IZ8A 3C3LA 3TBIB 4OL7A 3KF8A 1SNDA 3KK7A 3VR6A 4X3KA 5FK9C 3E6ZX 3H3VC 2HDMA 1LT5D 4V190 3MXPA 5JPNC 2PO4A 3PIP3 5M5XB 1L0YB 2RDGA 4CHTB 5C44B 4ZQ3A 4J6HA 4KD3A 4N9PA 4TKOB 3A56A 3OMCA 5EQ0A 3I4MB 3SK6A 1H9KA 4R9WA 3J81L 3RLFA 3D4DA 1WTPA 3T16A 1I4PA 3BVZA 1STHA 5JEAJ 3HKZB 1V1PB 3FEWX 2EDGA 5CR3A 5EPLA 4QMGA 3GQBA 4ZRZA 5C0XG 1T5EA 5J22A 3TSSA 3H0GB 3VYUA 4IUVA 4RA8A 1R4PB 1SE2A 1CHQD 4Z9CB 2MHVA 2L1BA 4PMBA 1F9PA 4HEDA 1I6HB 2M9VA 3PMFA 3KLSA 3BZDB 1CQVA 1MSHA 1NAPA 1F9RA 1PRTB 3I70A 4WJWA 1Q90A 1TWGB 2FINB 2J4XA 1I4GA 4BBRB 3K6OA 4N9TA 2RSOA 1MGSA 2AUJD 4CGYB 2EY5A 1Y8PB 1Z7TA 1B50A 2JA7B 2SOBA 3QIAA 4BY7B 4E6IA 5CMDA 1VMPA 1Y1VB 2EY2A 4DF7A 2NVXB 3J81E 1MBYA 2N88A 5LHY1 4XQNA 1JQYD 2F0MA 2WKDA 3MA2B 2OXPA 4LAAA 1HHVA 2WB1B 1EQVA 4YIJA 2B2VA 3BVMA 1EFID 5C0XI 1MI2A 1R9TB 3M85A 2L4NA 3RZDB 2NYZD 2K03A 1EEFD 1X3QA 3DWPA 4IFDH 3MZ5A 4ODGA 4IALA 1G6ZA 1LTID 4IFDG 3QOJA 2QDBA 3PUVA 4K5XA 4G7HC 5BN4A 4DGZA 4KJOA 4RKBA 4O42A 4A3GB 3DHQA 1HA6A 2F0EA 1GUGA 1X32A 3OW7A 3IAYA 2RDHA 1PRTC 3TZUA 3WOEA 2L5TA 5IGFA 5CBAE 2NTSA 3D4WA 4F8MA 1ENFA 3NXWA 1H9SA 4TRDA 4C3JG 3VA5A 1LV9A 1SFOB 2K32A 1SMYC 3M7GA 4A3FB 3PUWA 1AFPA 1FNVA 1PTOD 1LT3D 5C6AA 1EY5A 3OOCA 5KNBA 4RCOA 1LTBD 2Z4IA 3V96A 4HSPA 4HMIA 3C1EA 2F0LA 1KLUD 5C0XH 2X6LA 1STNA 2PZWA 1W6KA 3NE5B 3VR2A 2RSNA 4J1MA 1E2VA 1QG7A 1G2SA 2EVBA 3EQLC 3EROA 4KV6A 1RHPA 1PLFA 2F0TA 1A2UA 1HCZA 2B8GA 5IIFA 4R8IA 4ZUIA 5CC4A 5M3MB 1U4MA 4XQQA 3EVQA 4U68A 1ICWA 1H9SB 1F2MA 1QJOA 1E0BA 3VR3A 1SMYD 2OEOA 1SDFA 1DOKA 1PYWD 1GHJA 4G57A 2HQEA 2WV6D 3PO3B 1Q1EA 3L9AX 2IX1A 2F0WA 4CKCA 3SDZA 1KABA 1A6XA 3OSOA 3MXNA 1Y69U 2O5IC 3T4AC 3NWTA 2K04A 3H94A 4H13C 1D5XC 2AQ3B 4LK1C 2SNSA 4R8NA 3KBXA 2NZ1D 3V05A 3J7AF 3C1FA 2FHTA 1KDBA 3N52A 3D8GA 4RH6A 4P2CB 4FP5D 3TP7A 2YU9B 3G7LA 1CA6A 4XQJA 2FMMA 1U4RA 3HOWB 1KNEA 3NTIA 1JWSD 1CFMA 4HSVA 2R92B 5KIXA 3MXGA 5ELBA 1T5XD 1EY7A 2ZXPA 1GUNA 3V2TA 3S1RB 5FOBB 3I73A 1S5CD 3D6WA 1SYDA 1SE4A 2E76C 2WP8J 3IFDA 1GOZA 2NVTB 3R93A 1IW7D 4UAIA 4XYOA 4MN3A 1XYIA 1TIID 3QB3A 5CBEE 3H6MA 3M3YB 2NTTA 1CQFA 2NUCA 1O7LA 3OMGA 2NWGA 1B1ZA 4BA1I 1D1KA 3M4OB 2PW7A 1HTPA 1E2WA 5T1GA 1RD9D 4DN4M 4KTAA 2JSOA 3DEOA 4NMZA 2Z1CA 1GUSA 2XWJB 2IL8A 3SK4A 1D2BA 4RWSC 2BA1A 3K58A 4F7XA 3VYSA 3Q0AA 3A7AB 1XXGA 4IN3A 5D3DA 1RODA 5FLXL 3HRZC 4DNTB 4WRDA 1ET6A 1BCPB 2E2IB 3VYTA 4L8JA 2R7ZB 2B39A 3GTGB 1M4VA 3TP5A 1RDPD 1LTSD 3LWUA 4RGNA 3RMHA 3LWEA 2VXWA 4ZYSA 2XNAC 3SK8A 1K8MA 2F0DA 2KA7A 1JC7A 1S5DD 1TY0A 2KQ3A 4JK1C 5KYIA 1LT6D 5KYLA 4ZKBB 1RTOA 2F0OA 3OPOA 4LJZC 2E2DC 1GHKA 4ZUJA 5BN5A 3CRLC 1IYUA 1EY0A 2MPMA 4OIJA 1L0XB 1TVXA 1AW7A 1B3AA 2K01A 1M8AA 5I6YA 3KLRA 1Y8NB 2B2UC 2RBMA 4RGTA 2BCOA 2PQEA 5CV7A 2NVQB 5I4DA 1EY4A 1YNND 3DXJC 1CTMA 2F0NA 3GD7A 3I8ZA 2ENBA 1B53A 4KJNA 2F0GA 4IFDJ 1QB5D 1LTGD 4FF3A 3SK5A 1ENAA 1WTVA 2A5HA 2B2VC 2JP1A 3NHHA 1STBA 5A2QL 3D3RA 2Z8LA 4IQZA 2B2WA 4OIKA 4TQUS 2K7VA 3MFYA 1EOTA 1BCPF 3P1HA 5JEAG 1HQMC 3MVVA 5F2DA 3S1NB 2D5DA 2ZT9C 4CKEA 2OT2A 4S3SA 3VA7A 2B2YC 1Q8IA 3HOYB 4CJ0B 3H91A 2R61A 1V1OA 1OXVA 5CV4A 1S5FD 3PV0A 4KHVA 4XDXA 3I91A 3BG3A 3Q6SA 3P75A 1V1PA 1IL8A 4K5WA 5LL6S 2D9UA 1MSGA 3W2DA 1FD7D 1I50B 3NBIA 1EYAA 4RCNA 2SDFA 5CYUA 3FRPB 1LO5D 4L6TB 1K8OA 2J7ZA 5EBCA 3Q22A 1O7ZA 5JVH3 1PZID 4G4KA 3QWNA 5C4HA 2MJ8A 3IFTA 1DYQA 4C3IG 3UI2A 3NUCA 4Q0FA 3M7NA 2Q8IB 1SSOA 2JXMB 3J7AV 1JB3A 5JEAH 2B8FA 2B2TA 4H0LC 3RD4A 2TSSA 4DXGA 2CW0C 3HG9A 4K5VA 4KY7A 1ET9A 1S5BD 2FMCA 1QWYA 1BNZA 4X3TA 4Y7NB 1A3VA 4C3HG 4FVMA 3PUZA 4C3IB 5CV8A 5HURA 4FNFA 2JA6B 4PMWA 3HOZB 4DNRB 3ZYYX 5FKAC 1QE6A 2LS01 1STAA 2XWBB 3NSWA 1TWCB 1NSNS 1A2TA 1BCPD 5C3WA 2JA5B 4QB4A 4A3IB 4C2MB 2EYJA 3OWEB 1PZJD 4I65A 1XX8A 1WTQA 2KEDA 1QCBD 2F0IA 2IT1A 1HUMA 5CV5A 2V4DA 2KJXA 1JORA 2A73B 1RKNA 3DMUA 1WTWA 1LTAD 1PTOF 2IJ0A 3E5SA 1D5MC 1G8ZD 1I4RA 5I9PA 4KY5A 1S5ED 4OGQC 4CJ1B 4U673 2CVRA 1F2ZA 1A15A 2NN6G 4IUUA 1ZYRD 5A2QE 3FMCA 2EYLA 1BR9A 2WAQB 1EIGA 3Q24A 5LL6X 1QNKA 3HOUB 4ABNA 1SNCA 4FXDA 2MUYA 3N6RA 5C5MA 4EQOA 1ZEQX 1C8CA 2C5CA 3BYYB 2B2YA 1V43A 3S2DB 1TWAB 4J8QA 4RGOS 4GZYC 5IODA 1G291 4KHZA 3VR4A 2XVSA 2QKIC 3CHBD 3L7ZC 1G91A 1EZ8A 4L63B 4ULLA 4RKLA 4NW2A 3FKIB 1TR5A 2RQXA 2M00A 3HGBA 2R3ZA 2MP1A 2EPBA 1BQQT 4FO2A 3TDQA 1OXXK 5CV6A 1OXTA 3NQTA 3BVGA 3SHLA 3AU7A 1RJTA 3LNNA 2F0PA 1EWHA 5KEEA 1Y8OB 2KECA 1CHPD 2KEEA 1EU3A 1WD0A 4KI0A 4LMQD 1F2LA 1BXTA 5M3FB 1D1IA 1UEAB 5D3IB 4ZAIA 2PCFB 2O4XA 3GTPB 1OO9B 4OO1H 4XT1B 5FO9B 2ZXRA 2X69A 4DAVA 5BN3A 4BA2I 2EYPA 2SEBD 1C48A 4DK1A 3KBGA 2B63B 1PMRA 2BDOA 1SXTA 1TS5A 3MTSA 4K2KA 1V8QA 1BDOA 1JWUD 3QOLA 3AB9A 5M9OA 3PUYA 5C3EB 2B2UA 2LY7A 2I46A 4A3DB 5DM63 3DM1A 5K5PA 4WFN3 2K05A 2EY6A 3S15B 3IL8A 3I72A 5E4XA 5E1FA 2RA4A 4RHRA 3GTKB 2X6GA 2EJMA 1SEBD 3OWFA 4JBWA 1RCVD 3T56B 2A69C 1TWFB 2XRQD 3GTLB 1EU4A 2EY1A 1LACA 2A6ED 5G3LF 3S1MB 2EJGC 2F0KA 2K6AA 1SNOA 1PTOB 4NKLA 4RFBA 1SJED 4Q5VA 1CI3M 4QUFA 1CT1D 3PO2B 4XYQA 1VDZA 1EZ6A 2QF7A 1FR3A 1FNUA 2LFNA 1DJRD 5T1IA 1DD2A 2XN9C 1TT2A 2XSCA 1F9SA 2DY7A 4EQNA 3QG1A 4K2LA 2XRSD 3LX0A 2IW3A 4OHJA 3IKJA 1DOLA 2Q8RE 2AWNA 4K6LA 3CQZB 3WDNA 4PQXA 2WINB 4A3EB 2F4IA 4KY6A 4NP5A 5I2XA 1WD1A 1KTKA 1AP0A 2LKVA 4KN7C 1I4QA 2D62A 3W3AA 1PDQA 1GUWA 4BBSB 4HCEA 1JE4A 2VB3X 1STYA 4H7BA 2PNRC 1EY6A 5IGDA 5FLXE 1PRTF 3CU7A 1LLRD 4RGMA 1LTTD 1TS4A 4C1NK 1SE3A 5ELFA 2IX0A 2D2CC 1SYEA 3ERQA 1O80A 2DNCA 2H1EA 2EYHA 3E0JA 2RKSA 4PV1C 4WORA 2PPBC 1UNSA 1CA5A 1KNAA 5G3LD 2F0JA 3MAQA 2R93B 5A35A 3G6JB 3FPPA 4HTHA 4BWGB 5I2YA 1BO0A 4B9XA 5TSSA 1AEXA 1JOKA 3MHBA 2KCNA 2CQAA 2QCPX 4KKSA 2A68C 3HEJA 2HCCA 1Z6HA 3QJYA 5EPJA 4M8AA 3OHXC 2R6GA 1B9NA 2YYZA 5M5WB 1IKLA 1YNNC 1GUOA 3NK9A 1CZWA 2KOLA 5FO8B 1Y1WB 3NP8A 2EYFA 3K5OA 2Q8TA 2ZXOA 2F3WA 3MWYW 2K5QA 3BS1A 1VMCA 3SR1A 3K5NA 3I4NB 3BDCA 5EJWA 1B4OA 1S4ZA 1SBBB 1QILA 5KGUA 5EBDA 2F0FA 5IGBA 1PTOC 2VB2X 2G9HD 5IGCA 1F77A 3TP8A 4B08A 2JEAI 2BA0A 5KNCA 5IGEA 1E2ZA 2KHSA 3J80E 1VCIA 1TU2B 1K83B 2PZTA 4EQPA 2NBFA 1SNPA 1EL0A 4IUQA 3A55A 1B2TA 1ILQA 2EZVA 4X3UA 3NWSA 4KD4A 1BOSA 2L55A 1H9RA 4HN7A 3K0YA 4ZK9B 1X3PA 4XTCS 3OIQA 3NPPA 1Z47A 2I07B 3P7JA 1B9MA 2EYMA 1SNMA 3PIO3 4PNYA 3C46A 1WCMB 3J80L 5C4XB 1PFNA 3AMUA 1DZ1A 2BDNA 1QOHA 4A93B 1U4PA 3TZDA 1WVLA 3RZOB 5CV9A 2JE6I 2F0UA 2K28A 4FYDA 1R4QB 4A3JB 4DA2A 3A8IE 1W6JA 1Q3LA 1EQTA 3EJIA 1GUTA 3X3MA 2QEJC 1NCVA 4IUNA 2PYKA 2KUMA 2A69D 5COYA 5KRUA 4CJ2C 4AYBB 1O7YA 1STEA 2EXZA 5D14A 1ZKOA 3ND8A 1EEID 2IX3A 3D6CA 4HAEA 1IHZA 1F2YA 5JAVA 1AZPA 1NR2A 4K8IA 3GTOB 1FGBD 1Q1BA 3MFGA 1TS2A 2PZUA 1A3UA 1SYCA 3CKIB 3R3OA 5M5YB 4F88A 1F9QA 5IGGA 2VUMB 5ISRA 4BS9A 1BBXC 1DM0B 4RHSA 2F0VA 3DWQA 3S16B 5FO7B 2O2LD 1B44D 5JOBA 1D6EC 3ND9A 3NTKA 2A6HC 2B2WC 5JPMC 1EYCA 1TWHB 2JYOA 1ZYRC 1J8IA 1AN8A 1ILPA 2IWHA 4MIUA 4KMUC 3ONAB 3K57A 3TP6A 1HFNA 3C2PA 1YNJD 1TY2A 2EJFC 2ICEC 3GTMB 3GO5A 2MGSA 4K8JA 2E74C 3SVMA 2NVYB 3S17B 1I4XA 1PFMA 1D5ZC 4FXGC 2HDLA 2ICIA 2AQ1B 5HGTA 3X3NA 3TN2A 3URYA 2EE1A 4IFDI 3JAME 2A6EC 1FNWA 5AFWA 4I7ZC 1ML0D 4O1NA 3M4YA 1WTXA 4C3JB 2HCIA 3L3OC 4A3BB 2K33A 4K6DA 1ESFA 3NQIA 3HOXB 3A8KE 1JCKB 2WIIB 2A6HD 5JJZA 3I90A 1NUCA 1KLGD 3NBHA 1PXUA 5K36H 2CW0D 2AQ2B 1J9OA 1I4HA 1UAPA 3GV3A 1C4QA 1I3QB 3J7YW 3O13A 3NTHA 5CORA 4NDXA 5DNFA 3T13A 4PMCA 2PMZB 5IT9L 2OF1A 4KKTA 1IKMA 4ZLTF 1EY9A 4IUTA 5DAUA 1HTLD 3Q23A 4C1NI 4UDUC 1AZQA 5ELCA 2WACA 5C0XJ 1HA5A 2AWOA 1PRTD 4A3KB 2ID0A 4KKUA 4QF4A 4FF2A 1PZKD 3GTQB 1CM9A 4OO1I 3TMEA 3D4RA 1GXDC 2Y0SB 3A8JE 3HOVB 3DEPA 1KDCA 3HP3A 4DFAA 4TSSA 1HRJA 2H4OA 1EIHA 3T53B 1VF5C 1DONA 5JVG3 3MXUA 5DEHA 1XWEA 5I9OA 3K7AB 1EWCA 5K36G 3MEHA 1DCZA 1U9RA 4HR7B 3U9SA 1CZGA 3FPUB 5DM73 2C9OA 5NUCA 1G2TA 3FVQA 3I4LA 3QO2A 2A74C 4C56C 1II3A 3ITPA 2AUKA 1XTCD 5ELDA 2DY8A 3KLSX 4C3HB 3K5LA 2SNMA 3PUXA 2KCCA 2JA8B 1BUVT 1I6VC 4K14A 4EVOA 4KN4C 5CGKA 1JICA 2PW5A 1HQRD 1PFBA 3RUZA 2BE5D 2F1MA 2Z4HA 5EKLA 1CK1A 4G7OC 1O78A 3R8BA 2QILA 2F03A 4CKBA 1RTNA 4KK7A 5C5LA 3EFXD 1MD2D 3GV6A 1ENCA 1JWMD 5J1ZA 1H9MA 5E3FA 4FF1A 2NN6I 3F2UA 2BE5C 1RF2D 4OO1G 2VNUD 4QCLA 2K5WA 2G9DA 4HCSA 1A3TA 2DNEA 2F0SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AP0 A;  2N88 A;  1HRJ A;  3IL8 A;  1O7Y A;  4X3S A;  1EIH A;  5D14 A;  5AFW A;  1WTV A;  2B2V C;  3KBX A;  2JP1 A;  1ML0 D;  5E4X A;  2M2L A;  4MHE A;  2RA4 A;  4NW2 A;  1PDQ A;  2NZ1 D;  1GUW A;  4XT3 B;  1DON A;  4HAE A;  1WTX A;  2FHT A;  1HFG A;  4OIK A;  2B2W A;  2HCI A;  2KVM A;  5EKI A;  1AZP A;  2X6G A;  1NR2 A;  3N52 A;  5EQ0 A;  1QE6 A;  1HHV A;  3LWE A;  2VXW A;  1EOT A;  2R3Z A;  1JE4 A;  1WTR A;  2MP1 A;  2EPB A;  4R9W A;  2B2V A;  2K1B A;  1DOM A;  3G7L A;  1CA6 A;  2FMM A;  1U4R A;  1WTP A;  4IUR A;  5JJZ A;  1MI2 A;  3FPU B;  2B2Y C;  2L9H A;  1EL0 A;  1SAP A;  1KNE A;  4IUQ A;  2L4N A;  3I90 A;  4HSV A;  1RJT A;  1ZXT A;  2X6L A;  2XIW A;  1B2T A;  1G2T A;  1ILQ A;  2NYZ D;  4CJ0 B;  1ESR A;  2K03 A;  3H91 A;  1X3Q A;  2L12 A;  4X3U A;  3QO2 A;  1XX8 A;  1HUN A;  1J9O A;  1O80 A;  2H1E A;  5EPK A;  1WTQ A;  2KED A;  2KEC A;  5E4W C;  2KEE A;  4ZKB B;  2EOT A;  2RSN A;  1WD0 A;  5EPL A;  4LMQ D;  1RTO A;  1F9Q A;  1F2L A;  1CA5 A;  1KNA A;  3D6W A;  3GV3 A;  1HUM A;  1G6Z A;  1QG7 A;  1G2S A;  1BBX C;  4XDX A;  3I91 A;  4ZK9 B;  1X3P A;  1RHP A;  2DY8 A;  1PLF A;  3IFD A;  2N55 A;  3Q6S A;  4ZAI A;  3R93 A;  4UAI A;  1WTW A;  1IL8 A;  1BO0 A;  3KUP A;  4ZKC B;  4MN3 A;  5COR A;  3FDT A;  4IUV A;  4QUF A;  4R8I A;  1XYI A;  5DNF A;  2B2W C;  3P7J A;  4RA8 A;  2MPM A;  4OIJ A;  2D9U A;  1MSG A;  4O42 A;  1TVX A;  2HCC A;  1JIC A;  4XT1 B;  4CJ1 B;  2L11 A;  2X69 A;  5CBE E;  1PFB A;  2JYO A;  2CVR A;  2HUG A;  5EPJ A;  2L1B A;  1A15 A;  5D65 A;  1B3A A;  2K01 A;  1U4M A;  4IUU A;  4U68 A;  1M8A A;  1ICW A;  1IKM A;  1F9P A;  4HED A;  1IKL A;  2SDF A;  1J8I A;  1HA6 A;  4QUC A;  4ZLT F;  1PFN A;  2J7Z A;  4IUT A;  5T1I A;  1E0B A;  2NWG A;  2KOL A;  1ILP A;  1DZ1 A;  2BDN A;  1RTN A;  1EIG A;  1F9S A;  1X32 A;  1MSH A;  1NAP A;  1SDF A;  3ONA B;  1O7Z A;  1F9R A;  1U4P A;  2DY7 A;  2B2U C;  3GV6 A;  1QNK A;  1AZQ A;  3TZD A;  1DOK A;  2MJ8 A;  2RVL A;  5T1G A;  2Q8T A;  2FIN B;  1WVL A;  3UI2 A;  4DN4 M;  5CBA E;  2K28 A;  2B2T C;  1HFN A;  3MWY W;  3DEO A;  1SSO A;  2RSO A;  1BF4 A;  4RAU C;  2FJ2 A;  3I3C A;  1DOL A;  1MGS A;  1CM9 A;  2Q8R E;  2IL8 A;  2B2T A;  1WTO A;  3MTS A;  2MGS A;  3F2U A;  1C8C A;  4RWS C;  1VMC A;  3SVM A;  1Q3L A;  1B50 A;  2B2Y A;  1EQT A;  1PFM A;  2B2U A;  3I8Z A;  2FFK B;  1NR4 A;  1BNZ A;  1NCV A;  4X3T A;  2HDL A;  4HCS A;  5CMD A;  1B53 A;  1VMP A;  2KUM A;  1LV9 A;  3DM1 A;  5COY A;  5EJW A;  4IUP A;  1B4O A;  3TN2 A;  1ROD A;  1U4L A;  2EE1 A;  3DEP A;  1S4Z A;  3HP3 A;  4X3K A;  1WD1 A;  1G91 A;  2K05 A;  2K04 A;  4CJ2 C;  2HDM A; 
#chains in the Genus database with same CATH topology
 3BYT B;  4IPG A;  4ILW A;  2K5D A;  4A3M G;  1LAB A;  1EY8 A;  2BOS A;  1NNX A;  1IYV A;  4MHE A;  1FYC A;  1XMQ L;  3A7L A;  3BZK A;  4XT3 B;  3HS0 C;  2KVM A;  3S1Q B;  3S14 B;  4B3R Q;  3P20 A;  3T51 B;  4ID6 A;  4JI0 L;  1WTR A;  4M1U B;  4F87 A;  2K1B A;  1DOM A;  4JBK A;  3DUZ A;  4DV1 Q;  4XXE A;  1JR0 D;  3CRK C;  1EWI A;  2J0T D;  4X65 Q;  3I2Z A;  2L9H A;  1SAP A;  4ALP A;  1UUP A;  1ZXT A;  2XIW A;  3WOF A;  2WKC A;  3MC0 B;  1STG A;  3KOJ A;  2E2H B;  3VDY A;  1SYB A;  2L12 A;  1KDA A;  4DV4 L;  2DN8 A;  2F3V A;  1R9T H;  5E4W C;  2NB0 A;  4DAY A;  2EOT A;  5LMN W;  4DR6 Q;  4DV1 L;  5J39 A;  1BCP C;  4Y7N H;  2N55 A;  5KND A;  1MJE A;  3BDO A;  2UXC L;  3KUP A;  4ZKC B;  4AYB E;  2A68 D;  3FDT A;  3AFP A;  1VQP A;  3K59 A;  2L11 A;  3R2T A;  3VYR A;  4JOI A;  1IBK L;  1IBL L;  5D65 A;  1SYF A;  4EQ5 A;  1VQ7 A;  3GP7 A;  3T1Y L;  1HXY D;  3OYY A;  2L0C A;  4HMJ A;  4JVZ A;  4DR5 Q;  2IPK D;  1PTO H;  1ONL A;  4JI7 Q;  1LTL A;  2K4K A;  3U9O A;  3CCR A;  2B29 A;  3CD6 A;  2P5Z X;  3W1B A;  3EA6 A;  2FJ2 A;  1N32 Q;  4DU9 A;  3I3C A;  5EKK A;  5BR8 Q;  2JQO A;  3D31 A;  4XIG S;  1WTO A;  4LF5 L;  3HOZ G;  1GJX A;  2JEB I;  3F1Z A;  1SJH D;  1H9J A;  1I5F A;  1NR4 A;  1OXU A;  1VQE A;  1U0L A;  1VF7 A;  3R2I A;  5M5X H;  4DXF A;  3RLN A;  1VS0 A;  4IUP A;  3I4O A;  1U4L A;  2F0H A;  3TEH B;  1BBU A;  1TS3 A;  1JOQ A;  5ELE A;  4ME5 A;  4EGV A;  1LT4 D;  4A3M B;  3SEB A;  1HNZ L;  2F0Q A;  4X3S A;  1WOC A;  4A3I G;  1EQR A;  2JN4 A;  2NVQ H;  2M2L A;  4H44 C;  2E2J B;  1YNJ C;  2LMC B;  4DK0 A;  1HFG A;  3H0G H;  4R4C A;  1TKW B;  5EKI A;  2GA4 B;  4CBV A;  5IT9 E;  5I6W A;  3KF6 A;  1A8V A;  3PIO A;  4DAP A;  1N34 Q;  3S1N H;  3SE0 A;  4IUR A;  4BY7 H;  3HOU H;  3S1R H;  2RDF A;  1PH2 A;  3G71 A;  3K5M A;  1SNQ A;  4A3G H;  1OXS C;  3HZX A;  3GTK H;  1NJI C;  4FF4 A;  1ESR A;  4K0K Q;  4YCV A;  1K83 H;  1HUN A;  3S2H B;  5EPK A;  1TWA H;  5C4J B;  1XPO A;  1HPC A;  4QIW B;  4DR3 L;  3SXH A;  4A3F H;  4BY7 G;  2YV5 A;  1EYD A;  1VQN A;  3HKS A;  5EGT A;  1KAA A;  3VR5 A;  3K7A H;  2YTY A;  1DXM A;  5C3X A;  1LTR D;  3TS0 A;  3S9W A;  5IT9 c;  5C4Z A;  4AH6 A;  3JAM L;  2PNH A;  1CKN A;  2HUG A;  1QNU A;  2JK8 A;  2EYO A;  4JV5 Q;  1HH2 P;  3I4N H;  3DWA A;  1G6P A;  4QUC A;  4AQY L;  3GTJ B;  3J80 i;  2CHB D;  4B9W A;  4A3I H;  2E75 C;  3GDE A;  4V0B A;  1IW7 C;  2O5J C;  1SRO A;  3A54 A;  3HOV G;  3BDL A;  2UXB Q;  1SE8 A;  2RVL A;  2NN6 H;  5IOC A;  2TMP A;  3HOX H;  4JV5 L;  1V9P A;  2B2T C;  1BF4 A;  4RAU C;  1Q12 A;  1BVS A;  2K52 A;  4GS3 A;  4FXK C;  4BY1 B;  4GLX A;  3OIP A;  1SYG A;  4G7Z C;  2NVX H;  1S3O A;  4DR7 L;  3H09 A;  1TQO A;  4MNO A;  4QY7 A;  3GTP H;  4IZ8 A;  1JOO A;  1UE1 A;  2FFK B;  3C3L A;  1VQO A;  1N34 L;  3TBI B;  4OL7 A;  1Q86 C;  3KF8 A;  1SND A;  3KK7 A;  2Z0S A;  4X3K A;  5FK9 C;  3VR6 A;  3E6Z X;  4X65 L;  1JB7 A;  3H3V C;  2HDM A;  1LT5 D;  4V19 0;  3MXP A;  1ASY A;  5JPN C;  2PO4 A;  3PIP 3;  5M5X B;  3KDF B;  1L0Y B;  3U50 C;  2RDG A;  2EXD A;  4CHT B;  5C44 B;  4JI5 L;  1PH4 A;  4ZQ3 A;  2EIF A;  4J6H A;  4KD3 A;  2NZO A;  4N9P A;  3RLO A;  4QQB X;  4TKO B;  4B3R L;  3A56 A;  4LUZ A;  3OMC A;  2H5X A;  5EQ0 A;  1I6H H;  3I4M B;  3SK6 A;  2HT1 A;  1H9K A;  4R9W A;  2Y0S E;  3J81 L;  2ZTD A;  3RLF A;  4LUV A;  1B7Y B;  3D4D A;  1WTP A;  3T16 A;  1I4P A;  1VQ5 A;  3BVZ A;  1JMC A;  1STH A;  5JEA J;  1PFS A;  3HKZ B;  1J5E L;  2JA5 H;  1V1P B;  1IBK Q;  3S2D H;  1CUK A;  3FEW X;  2EDG A;  4A3J G;  1S40 A;  3K80 C;  5CR3 A;  2Z6K C;  5EPL A;  4QMG A;  3GQB A;  4ZRZ A;  2K5N A;  1YNX A;  4OWX B;  4OX9 L;  1HZC A;  5C0X G;  1T5E A;  5J22 A;  3H0G G;  3TSS A;  4LF4 Q;  3H0G B;  1YZ6 A;  3VYU A;  1YJN A;  4IUV A;  4RA8 A;  3S16 H;  4R4O A;  4BBR G;  1YBY A;  1R4P B;  2RF4 A;  4JI6 Q;  1SE2 A;  1CHQ D;  4Z9C B;  2MHV A;  2L1B A;  2YTV A;  4PMB A;  1F9P A;  4HED A;  1PH9 A;  1I6H B;  2M9V A;  3PMF A;  3CC2 A;  2NVY H;  1H95 A;  2KBN A;  3KJO A;  3KLS A;  3BZD B;  1CQV A;  1MSH A;  4A93 G;  1NAP A;  1F9R A;  1PRT B;  1WJJ A;  3I70 A;  3F2B A;  4WJW A;  1Q90 A;  1TWG B;  2DJF C;  2FIN B;  2J4X A;  1I4G A;  4BBR B;  3K6O A;  4N9T A;  2RSO A;  1K73 C;  1MGS A;  2DJG C;  2AUJ D;  4CGY B;  4BBS G;  1KXL A;  2EY5 A;  1Y8P B;  1Z7T A;  1XPR A;  1B50 A;  2JA7 B;  2SOB A;  5IYC H;  4X62 L;  4A3B G;  3S24 A;  3QIA A;  3UE1 A;  1JJ2 A;  4BY7 B;  4E6I A;  1QVF A;  5CMD A;  1VMP A;  1Y1V B;  3GTQ H;  2EY2 A;  4DF7 A;  2NVX B;  3J81 E;  1MBY A;  4OXP A;  4RG1 A;  2N88 A;  5LHY 1;  4LFB L;  4XQN A;  1JQY D;  3PGZ A;  2F0M A;  2WKD A;  3MA2 B;  3HOZ H;  4J15 A;  3KYH C;  2OXP A;  4LAA A;  1QUQ A;  4IJL A;  2VUM H;  2LSS A;  1HHV A;  2WB1 B;  1EQV A;  5M5W H;  4YIJ A;  4Y52 H;  4JOI C;  2B2V A;  1X55 A;  3ERS X;  1MHW C;  3BVM A;  5M3M H;  1EFI D;  5C0X I;  4LFA L;  1MI2 A;  4HJ5 A;  1R9T B;  1AE2 A;  3M85 A;  2L4N A;  3RZD B;  2NYZ D;  2K03 A;  3I55 A;  5IP9 H;  1EEF D;  1X3Q A;  2KEN A;  1QVC A;  3DWP A;  4IFD H;  1BKB A;  3PO2 H;  3STB D;  4DR6 L;  3MZ5 A;  5ELN A;  4GNX C;  1UE5 A;  2JA7 G;  4ODG A;  4IAL A;  3PF4 A;  1G6Z A;  1LTI D;  4IFD G;  3CCQ A;  3QOJ A;  3NEM A;  2QDB A;  3PUV A;  5AJ3 L;  4K5X A;  4G7H C;  5BN4 A;  4DGZ A;  1N36 L;  1CSP A;  4KJO A;  1IL2 A;  4RKB A;  4TVA B;  4O42 A;  2PI2 A;  4A3G B;  5IP7 H;  3DHQ A;  1HA6 A;  1ICF B;  4KLK A;  2F0E A;  1GUG A;  3ULP A;  1X32 A;  3OW7 A;  3IAY A;  1WYD A;  2RDH A;  1PRT C;  3TQY A;  2ASB A;  3TZU A;  4N8F A;  3WOE A;  2L5T A;  4JPB W;  5IGF A;  5CBA E;  5FJ8 G;  2NTS A;  4O0A A;  4NB3 A;  2VZA A;  3D4W A;  4F8M A;  2OWO A;  2B63 H;  1ENF A;  3NXW A;  1H9S A;  4TRD A;  4C3J G;  3RN2 A;  3AFQ A;  3ULJ A;  4HJ8 A;  1D8L A;  2K5H A;  3K0X A;  3VA5 A;  4DV5 Q;  2MQH A;  4JI2 Q;  2CWA A;  1LV9 A;  1SFO B;  2K32 A;  1SMY C;  3M7G A;  3Q8D A;  2A1A A;  2VW9 A;  4A3F B;  3CXC A;  3PUW A;  1AFP A;  2OCE A;  1FNV A;  3STB C;  1PTO D;  1LT3 D;  5C6A A;  3D0F A;  1N9W A;  3TRE A;  1WCM G;  1EY5 A;  3OOC A;  1VQI A;  1GM5 A;  1GD7 A;  5KNB A;  4RCO A;  1K8G A;  1LTB D;  1TWH H;  2Z4I A;  4JC0 A;  3V96 A;  4JI1 Q;  4HSP A;  4HMI A;  1YIJ A;  3C1E A;  1J5E Q;  2F0L A;  1KLU D;  5C0X H;  2X6L A;  1STN A;  2PZW A;  1W6K A;  3NE5 B;  1P8L A;  3VR2 A;  2RSN A;  4J1M A;  1E2V A;  2LXJ A;  1QG7 A;  1G2S A;  2EVB A;  1YHA A;  3EQL C;  3ERO A;  4KV6 A;  1RHP A;  2GVA A;  1PLF A;  2Y0S G;  2F0T A;  5L37 A;  1A2U A;  1HCZ A;  2B8G A;  5IIF A;  4R8I A;  4ZUI A;  1EQQ A;  1VQL A;  2E5L L;  4LUO A;  5CC4 A;  1HR0 L;  5M3M B;  1U4M A;  4XQQ A;  3EVQ A;  4U68 A;  1ICW A;  1H9S B;  1F2M A;  2RHS B;  4DR1 Q;  1QJO A;  1E0B A;  1SLJ A;  3E3X A;  3VR3 A;  1PH6 A;  4A3D G;  1SMY D;  1B70 B;  2OEO A;  1SDF A;  1SRU A;  3CP0 A;  1PH5 A;  1DOK A;  3KF8 B;  4A3C H;  1PYW D;  1TWG H;  1GHJ A;  4G57 A;  2HQE A;  2WV6 D;  3B6Y A;  4RMF A;  2WAQ E;  3PO3 B;  1N32 L;  1Q1E A;  3U4V A;  4JI5 Q;  3J81 i;  3L9A X;  4A3D H;  4LF6 Q;  2IX1 A;  2F0W A;  1WI5 A;  4CKC A;  3SDZ A;  1KAB A;  1A6X A;  3OSO A;  2CH4 A;  3MXN A;  1Y69 U;  4DR5 L;  2O5I C;  1PYB A;  3T4A C;  3UDG A;  3HOX G;  1LM0 A;  3NWT A;  2K04 A;  2JJQ A;  3H94 A;  4POF A;  4A3K G;  4GKJ Q;  4H13 C;  1D5X C;  4X6A H;  2AQ3 B;  4LK1 C;  2SNS A;  4R4I A;  4LF6 L;  4R8N A;  2NVT H;  3KBX A;  4MTK A;  3I4M H;  2NZ1 D;  3V05 A;  3J7A F;  3C1F A;  5GQO A;  1XMO L;  2FHT A;  1KDB A;  4NXM L;  2QA4 A;  3N52 A;  3D8G A;  4RH6 A;  4P2C B;  4FP5 D;  3TP7 A;  2YU9 B;  4GN3 B;  4YWK A;  3G7L A;  1CA6 A;  4XQJ A;  2FMM A;  1U4R A;  2QEX A;  4DV6 L;  4IPH A;  3RN5 A;  1I94 Q;  3HOW B;  1KNE A;  3NTI A;  1JWS D;  1CFM A;  4HSV A;  2R92 B;  5KIX A;  2YTX A;  3MXG A;  2N49 A;  5ELB A;  1G51 A;  1EY7 A;  1T5X D;  2ZXP A;  1GUN A;  1O7I A;  3V2T A;  2XGT A;  5FOB B;  2BH8 A;  3I73 A;  3S1R B;  1VQ6 A;  1S5C D;  1HJP A;  3D6W A;  2ZJQ A;  1SYD A;  1SE4 A;  2E76 C;  2WP8 J;  1FL0 A;  2HD3 A;  3IFD A;  1Y1V G;  1GOZ A;  2UXD L;  2NVT B;  1XTD A;  1IW7 D;  4UAI A;  4XYO A;  3R93 A;  4MN3 A;  1XNR L;  3HOU G;  1XYI A;  1TII D;  2RHQ B;  3F2C A;  3QB3 A;  5CBE E;  3H6M A;  5J3B A;  1VQH A;  4A3J H;  4CDC C;  4K0K L;  4PZ8 A;  3M3Y B;  5GAG C;  3J7Z C;  1V1Q A;  5HY6 A;  5IYD H;  1N33 L;  4NXN Q;  3A0J A;  5IYB H;  2NTT A;  1CQF A;  2NUC A;  1O7L A;  3OMG A;  2NWG A;  4DR4 L;  1B1Z A;  2IHE A;  4BA1 I;  1D1K A;  3M4O B;  2PW7 A;  1HTP A;  1E2W A;  5T1G A;  1RD9 D;  4P71 A;  4JI1 L;  1X65 A;  3NEL A;  4DN4 M;  4KTA A;  2JSO A;  3DEO A;  4NMZ A;  1YI2 A;  5GAD C;  2Z1C A;  1GUS A;  1AE3 A;  2XWJ B;  2IL8 A;  3SK4 A;  4LF8 Q;  1D2B A;  4RWS C;  2BA1 A;  3K58 A;  4F7X A;  3VYS A;  4X64 L;  3WWV A;  4UY8 C;  3BJU A;  2RCN A;  3Q0A A;  3A7A B;  4P72 A;  3J7A 5;  1XXG A;  4IN3 A;  2GN5 A;  5D3D A;  1EIY B;  3M4Q A;  1NBW A;  1ROD A;  5FLX L;  1ASZ A;  3HRZ C;  4DNT B;  4BY1 H;  1VQK A;  4WRD A;  1L2F A;  1ET6 A;  4A3K H;  2UXB L;  1BCP B;  2VQE Q;  3VYT A;  4L8J A;  2E2I B;  2R7Z B;  2B39 A;  3GTG B;  4HIK A;  2K50 A;  1M4V A;  1CSQ A;  3TP5 A;  4DV7 L;  5IP9 G;  1RDP D;  1LTS D;  3LWU A;  3GTJ H;  2K75 A;  4RGN A;  3RMH A;  3LWE A;  2VXW A;  4ZYS A;  2XNA C;  1VQ4 A;  3SK8 A;  1XPU A;  1K8M A;  4JI2 L;  2Q2U A;  2F0D A;  2YU9 H;  2KA7 A;  4N8X 1;  1JC7 A;  3QR8 A;  1S5D D;  1TY0 A;  1XNR Q;  4GNX A;  2KQ3 A;  4JK1 C;  2ZTC A;  5KYI A;  3GTM H;  1LT6 D;  2ZJP A;  5C44 G;  5KYL A;  1TWF H;  1A62 A;  4ZKB B;  5JJL A;  1RTO A;  1VQB A;  3H15 A;  2VUM G;  2F0O A;  3JAM c;  4DUZ L;  3OPO A;  2V1C C;  4UHV A;  2ZJR A;  4DV3 Q;  2QDL A;  4LJZ C;  2E2D C;  4DR1 L;  1GHK A;  4ZUJ A;  5BN5 A;  4OEM B;  3W5O A;  3CRL C;  1X9N A;  4A3F G;  1IYU A;  1EY0 A;  2MPM A;  4OIJ A;  1L0X B;  1TVX A;  1AW7 A;  3NBH B;  3CCU A;  4DUZ Q;  1B3A A;  2K01 A;  1M8A A;  3G6E A;  1T9H A;  5I6Y A;  3KLR A;  3U4Z A;  4JI4 Q;  1XMO Q;  4NXM Q;  1HNW L;  4UP9 A;  1Y8N B;  3NEN A;  5C3E H;  1YJW A;  2B2U C;  2RBM A;  2WB1 E;  4RGT A;  2MO0 A;  5IWA Q;  2BCO A;  2PQE A;  5CV7 A;  3HOW G;  2E2J H;  2NVQ B;  5I4D A;  1EY4 A;  1XMQ Q;  4YCU A;  1HNW Q;  1YNN D;  3DXJ C;  1CTM A;  3OTO Q;  2F0N A;  3GD7 A;  4WJ4 A;  3I4M G;  1CKN B;  3S17 H;  3I8Z A;  2E2H H;  2ENB A;  1B53 A;  4KJN A;  1FGU A;  2R93 H;  2F0G A;  4IFD J;  1QB5 D;  1LTG D;  4IPD A;  1Q82 C;  4FF3 A;  3SK5 A;  1A0I A;  4AIM A;  1ENA A;  4DAY B;  1M90 C;  1WTV A;  2A5H A;  2B2V C;  2JP1 A;  4LWC A;  3NHH A;  1STB A;  4YY3 Q;  5A2Q L;  3D3R A;  2Z8L A;  4JI8 L;  4IQZ A;  2B2W A;  4OIK A;  4TQU S;  4GOP A;  4JW0 A;  2K7V A;  3MFY A;  1EOT A;  1BCP F;  3P1H A;  2UU9 L;  1B8A A;  5JEA G;  3EN2 A;  1HQM C;  3MVV A;  5F2D A;  3S1N B;  2D5D A;  2ZT9 C;  4CKE A;  3CF5 A;  2OT2 A;  4S3S A;  3VA7 A;  4P75 A;  2B2Y C;  4GN5 A;  1Q8I A;  4QJF A;  3HOY B;  4CJ0 B;  3H91 A;  2Q2H A;  2R61 A;  1V1O A;  2DUD A;  1OXV A;  5CV4 A;  2F3I A;  1S5F D;  3PV0 A;  4KHV A;  4XDX A;  3I91 A;  3BG3 A;  3Q6S A;  3P75 A;  1SMX A;  1V1P A;  1IL8 A;  2VQF L;  4K5W A;  5LL6 S;  2ZTE A;  4DUY Q;  2D9U A;  1MSG A;  3W2D A;  1FD7 D;  1I50 B;  3NBI A;  1EYA A;  5C4X H;  1MKH A;  3HKZ E;  4YHH Q;  4RCN A;  2SDF A;  5CYU A;  3FRP B;  4L6T B;  1LO5 D;  1K8O A;  2J7Z A;  5EBC A;  3Q22 A;  1O7Z A;  5JVH 3;  4R4T A;  1PZI D;  4G4K A;  3QWN A;  4QIW E;  5C4H A;  3F2D A;  2MJ8 A;  3IFT A;  1DYQ A;  4C3I G;  4L5S A;  3UI2 A;  3NUC A;  4Q0F A;  3M7N A;  2Q8I B;  1SSO A;  1X6O A;  2JXM B;  3J7A V;  1JB3 A;  5JEA H;  2BH2 A;  2B8F A;  4YY3 L;  2B2T A;  4H0L C;  3RD4 A;  2TSS A;  4DXG A;  2CW0 C;  3HG9 A;  4K5V A;  4B3M L;  4KY7 A;  1ET9 A;  1S5B D;  1VQC A;  1N33 Q;  2FMC A;  2RCF A;  1QWY A;  1BNZ A;  2R7F A;  4X3T A;  4Y7N B;  1A3V A;  2IHF A;  4C3H G;  1YIT A;  5AJ3 Q;  1X54 A;  4FVM A;  4DV6 Q;  3PUZ A;  4C3I B;  5CV8 A;  1VQ9 A;  5HUR A;  3U58 A;  4FNF A;  2B63 G;  2JA6 B;  4PMW A;  3HOZ B;  4DNR B;  1VQA A;  3RZD H;  3ZYY X;  5FKA C;  3FHW A;  1QE6 A;  3CME A;  2LS0 1;  1STA A;  2XWB B;  3NSW A;  1JE5 A;  1TWC B;  1K0R A;  3CC7 A;  1L1O B;  1NSN S;  4JI4 L;  1A2T A;  1BCP D;  2AMC B;  2I5H A;  5C3W A;  3M3Y H;  2JA5 B;  4QB4 A;  5JJK A;  1DGS A;  1X56 A;  4A3I B;  2AKW B;  4C2M B;  2EYJ A;  3OWE B;  1PZJ D;  4I65 A;  1WFQ A;  1XX8 A;  1WTQ A;  2KED A;  5M3F H;  1Q7Y C;  4UP8 A;  1PH1 A;  1QCB D;  4POG A;  3EBE A;  2F0I A;  2IT1 A;  1HUM A;  5CV5 A;  1MIU A;  2V4D A;  2UUC Q;  2CH4 W;  3DM3 A;  2KJX A;  4A3E G;  1JOR A;  2A73 B;  1RKN A;  4KHP Q;  2D0P A;  3DMU A;  1WTW A;  4ZCK A;  1LTA D;  2VS1 A;  3W1G A;  1PTO F;  2IJ0 A;  3E5S A;  1D5M C;  1G8Z D;  1I4R A;  5I9P A;  4KY5 A;  1S5E D;  4OGQ C;  4CJ1 B;  4U67 3;  2CVR A;  1F2Z A;  1Z9F A;  1A15 A;  2NN6 G;  4AQY Q;  1N8R C;  4IUU A;  1ZYR D;  4LF8 L;  5A2Q E;  3FMC A;  4A3E H;  2EYL A;  1BR9 A;  5EAY A;  3CCM A;  1C7Y A;  1PHJ A;  3CCV A;  2WAQ B;  1EIG A;  3Q24 A;  5LL6 X;  1QNK A;  3HOU B;  4ABN A;  1SNC A;  3M9B A;  4YWM A;  1S72 A;  4FXD A;  2KHJ A;  2MUY A;  3N6R A;  3CCE A;  5C5M A;  2WFW A;  4EQO A;  1ZEQ X;  4GOP B;  1C8C A;  2C5C A;  3BYY B;  1GKH A;  2B2Y A;  1V43 A;  1P16 A;  1TWA B;  4DPG A;  4J8Q A;  4X62 Q;  3S2D B;  4B3T Q;  4RGO S;  4A76 A;  4GZY C;  5IOD A;  1PYS B;  1G29 1;  4KHZ A;  3VR4 A;  2XVS A;  2QKI C;  1I50 H;  2I5L X;  3CHB D;  3L7Z C;  4LF4 L;  1G91 A;  3LGJ A;  1EZ8 A;  5IWA L;  1NMF A;  4L63 B;  4ULL A;  1HR0 Q;  4RKL A;  4A3B H;  1Y1W H;  1LYL A;  4NW2 A;  3FKI B;  3FKI G;  4BBS H;  1TR5 A;  2RQX A;  2M00 A;  2JA6 H;  3HGB A;  2R3Z A;  3UE0 A;  2MP1 A;  2EPB A;  2UUC L;  1BQQ T;  4FO2 A;  4P74 A;  3TDQ A;  1OXX K;  4PZ6 A;  4A3L H;  5CV6 A;  1OXT A;  4IJH A;  4AYB G;  1Q8K A;  1XNQ L;  3NQT A;  3BVG A;  2K5V A;  3AU7 A;  4MTN A;  3SHL A;  1RJT A;  3LNN A;  2F0P A;  3HOY H;  1QZH A;  2F52 A;  1EWH A;  5KEE A;  3BZC A;  1Y8O B;  2KEC A;  1CHP D;  2NZH A;  2KEE A;  1B3Q A;  1EU3 A;  1WD0 A;  4KI0 A;  4LMQ D;  5GAH C;  1F2L A;  1BXT A;  5M3F B;  3I4N G;  2L15 A;  1D1I A;  1HNX L;  3EIV A;  1UEA B;  2OTL A;  2UU9 Q;  5D3I B;  4ZAI A;  2PCF B;  4LW1 A;  4IO9 A;  2O4X A;  3GTP B;  4GKJ L;  3L0O A;  1VQ8 A;  1OO9 B;  5ELO A;  4OO1 H;  4XT1 B;  5E7N A;  5FO9 B;  2ZXR A;  2X69 A;  4DV4 Q;  4DAM A;  4YWL A;  2K14 A;  3E9H A;  5BN3 A;  4DAV A;  4B3T L;  1E3P A;  1SFO H;  1C9O A;  4BA2 I;  3JC6 6;  1K28 A;  4JYA L;  1TXY A;  2EYP A;  2SEB D;  1C48 A;  4DK1 A;  3KBG A;  1E1O A;  4DV2 Q;  2B63 B;  1PMR A;  2HIX A;  2BDO A;  1NMG A;  1SXT A;  4K2K A;  1TS5 A;  2N8N A;  3MTS A;  1V8Q A;  1BDO A;  1JWU D;  4LNQ A;  5IP7 G;  3QOL A;  3AB9 A;  3S1M H;  5M9O A;  3PUY A;  5C3E B;  3G48 A;  2B2U A;  2LY7 A;  2I46 A;  4A3D B;  2CWP A;  4BXX G;  5DM6 3;  3KJP A;  3DM1 A;  5K5P A;  1VQD A;  4WFN 3;  2G5D A;  2K05 A;  2EY6 A;  2PQA A;  3A5Z B;  3S15 B;  3CMA A;  3IL8 A;  3I72 A;  4HID A;  2N3S A;  1YJ9 A;  1KD1 C;  5E4X A;  5E1F A;  2RA4 A;  4RHR A;  1HNZ Q;  2JA7 H;  3GTK B;  2UUB L;  1D7Q A;  3OW2 A;  2X6G A;  2EJM A;  3S15 H;  2A19 A;  4A4I A;  1IYJ B;  3HFZ B;  1U5K A;  1XJV A;  1SEB D;  3OWF A;  4JBW A;  1RCV D;  3T56 B;  2A69 C;  1TWF B;  5IE8 A;  2XRQ D;  5IYC G;  3GTL B;  1EU4 A;  2A8V A;  2EY1 A;  3CW2 C;  3HOY G;  3T1H L;  2DGY A;  1LAC A;  3H3V H;  5M3M G;  2A6E D;  3PIP A;  5G3L F;  3S1M B;  2EJG C;  2F0K A;  2K6A A;  1SNO A;  4OWT B;  4IOA A;  3IRB A;  1PTO B;  4NKL A;  4RFB A;  2LXK A;  3RZO H;  1SJE D;  4X66 L;  4DK3 C;  2CCZ A;  4DUY L;  1FJG Q;  4Q5V A;  1CI3 M;  3CCL A;  1EYG A;  4QUF A;  1CT1 D;  3PO2 B;  4XYQ A;  1VDZ A;  4QL5 A;  3PF5 A;  1EZ6 A;  2QF7 A;  1BBW A;  1NE3 A;  1FR3 A;  4IOC A;  2KCM A;  2OQ0 A;  1FNU A;  1GO3 E;  1KHI A;  1KIX A;  2LFN A;  2F4V L;  2QGQ A;  1DJR D;  5T1I A;  4HIO A;  4GN4 B;  3MEF A;  3J81 j;  2R92 H;  1DD2 A;  2XN9 C;  1K3R A;  1TT2 A;  1VQG A;  1F9S A;  2JA9 A;  2XSC A;  2DY7 A;  3G4S A;  3S1Q H;  4EQN A;  3QG1 A;  4K2L A;  4JI7 L;  4X66 Q;  2XRS D;  1FJG L;  3LX0 A;  1IBL Q;  2IW3 A;  4OHJ A;  5FLX c;  3IKJ A;  1DOL A;  2Q8R E;  3T1Y Q;  4A3C G;  2AWN A;  4K6L A;  4LF9 Q;  3CQZ B;  1IXR A;  4EX5 A;  4DKA C;  3WDN A;  4PQX A;  1WCM H;  1UWV A;  3E0E A;  2F4V Q;  2WIN B;  4A3E B;  2F4I A;  2N78 A;  4KY6 A;  4NP5 A;  4C3I H;  5I2X A;  2UXC Q;  1WD1 A;  1KTK A;  3AQQ A;  4L5T A;  1AP0 A;  1X3F A;  1C0A A;  3S14 H;  2LKV A;  4KN7 C;  1I4Q A;  2D62 A;  3PQI A;  2VY3 A;  3W3A A;  5M5Y H;  4GKK Q;  1PDQ A;  2JA6 G;  1GUW A;  4BY1 G;  4BBS B;  4DK6 C;  5C4X G;  4HCE A;  3GTG H;  1JE4 A;  2VB3 X;  1STY A;  4H7B A;  4I7A A;  2PNR C;  1EY6 A;  5IGD A;  5FLX E;  1PRT F;  4HJ9 A;  3CU7 A;  1LLR D;  2JA5 G;  4RGM A;  1LTT D;  1TS4 A;  4C1N K;  1SE3 A;  5ELF A;  2Q2T A;  2IX0 A;  5GAE C;  2D2C C;  2R7Z G;  1SYE A;  3ERQ A;  1O80 A;  2DNC A;  2H1E A;  3J81 c;  2EYH A;  2Z9H A;  4LF9 L;  3E0J A;  3OTO L;  1L1O A;  2RKS A;  4PV1 C;  4WOR A;  2PPB C;  1UNS A;  1CA5 A;  1KNA A;  5G3L D;  2EQS A;  2F0J A;  3MAQ A;  2R93 B;  5C44 H;  1QZG A;  5A35 A;  3G6J B;  3FPP A;  4HTH A;  4BWG B;  5I2Y A;  1BO0 A;  4B9X A;  5TSS A;  1AEX A;  1JOK A;  3MHB A;  2KCN A;  2CQA A;  2QCP X;  4KKS A;  4A75 A;  2UUA Q;  2A68 C;  3HEJ A;  2HCC A;  4GNX B;  1Z6H A;  3QJY A;  5EPJ A;  4M8A A;  3OHX C;  2VQE L;  1JJC B;  2R6G A;  1B9N A;  2YYZ A;  4OEL B;  5M5W B;  1IKL A;  3S2H H;  4L5Q A;  1GUO A;  1K3B C;  1YNN C;  3ER0 A;  3NK9 A;  3E9I A;  1CZW A;  2KOL A;  4YCW A;  2R93 G;  5FO8 B;  5FLM H;  1Y1W B;  3NP8 A;  1YEZ A;  2EYF A;  2VQF Q;  3K5O A;  2E2I H;  4FDB A;  2ZXO A;  2Q8T A;  2F3W A;  3J80 c;  2GVB A;  3MWY W;  1J6Q A;  1LUZ A;  2K5Q A;  4HIM A;  3CPF A;  3BS1 A;  1VMC A;  4OON A;  3SR1 A;  3SGI A;  4JBJ A;  2ZM6 L;  2HQL A;  4DV7 Q;  3K5N A;  1OTC A;  5M3F G;  3I4N B;  3BDC A;  4DV5 L;  3M4P A;  4C3H H;  4A3M H;  5EJW A;  1B4O A;  1S4Z A;  1SBB B;  1QIL A;  5KGU A;  5EBD A;  2F0F A;  2MNA A;  5IGB A;  4H02 A;  2CFM A;  1PTO C;  2VB2 X;  2G9H D;  5IGC A;  1F77 A;  3TP8 A;  4DR2 L;  4B08 A;  1VQF A;  2JEA I;  3AYH B;  1I3Q H;  1GVP A;  2BA0 A;  5KNC A;  1Q81 C;  1IBM Q;  5IGE A;  1E2Z A;  2KHS A;  3J80 E;  4DR4 Q;  1VCI A;  1TU2 B;  1K83 B;  2PZT A;  4JG2 A;  4EQP A;  5C4J H;  3PO2 G;  2NBF A;  1SNP A;  1EL0 A;  4IUQ A;  3A55 A;  1B2T A;  3FKI H;  1ILQ A;  2EZV A;  4X3U A;  3CAM A;  1X3E A;  3NWS A;  1PH8 A;  4DR7 Q;  4KD4 A;  4JCV E;  2ALY B;  1BOS A;  2L55 A;  1H9R A;  4HN7 A;  2CQO A;  3PCO B;  4LF5 Q;  3K0Y A;  4C3J H;  4ZK9 B;  1X3P A;  4XTC S;  3ICE A;  3OIQ A;  4OX9 Q;  3NPP A;  1CKO A;  4HJ7 A;  3BU2 A;  1Z47 A;  2I07 B;  3HKZ G;  1B9M A;  3P7J A;  3DLL A;  3JAM i;  4HJA A;  3UDI A;  4LF7 L;  2EYM A;  1SNM A;  4R1J A;  4PNY A;  3PIO 3;  3C46 A;  1WCM B;  3J80 L;  5C4X B;  4LFC Q;  3TRZ A;  3ZJY C;  3CPW A;  1PFN A;  4JI8 Q;  4CDD C;  3AMU A;  1DZ1 A;  1SN8 A;  2BDN A;  5LMU L;  1QOH A;  1Y1W G;  2PQA B;  1U4P A;  4A93 B;  2PI2 E;  3TS2 A;  4CDF C;  3TZD A;  1IZ6 A;  4JYA Q;  1WVL A;  3RZO B;  5CV9 A;  2JE6 I;  2F0U A;  2K28 A;  4FYD A;  1R4Q B;  4A3J B;  3ULL A;  4DA2 A;  1NTG A;  3A8I E;  3A5U A;  1W6J A;  1Q3L A;  1EQT A;  5C3E G;  3EJI A;  3CQZ H;  3K8A A;  1GUT A;  2WB1 G;  3X3M A;  2QEJ C;  1NCV A;  4DV3 L;  4IUN A;  2R7Z H;  1VQJ A;  2PYK A;  2KUM A;  2A69 D;  5COY A;  1HR0 W;  5KRU A;  4CJ2 C;  5IYD G;  4AYB B;  4B3S Q;  1O7Y A;  1STE A;  2EXZ A;  5D14 A;  4DV2 L;  1ZKO A;  3ND8 A;  1EEI D;  3PO3 G;  2IX3 A;  3D6C A;  4HAE A;  1IHZ A;  1F2Y A;  5JAV A;  1AZP A;  1NR2 A;  3HOW H;  2D0O A;  2Q2I A;  4K8I A;  1EFW A;  3GTO B;  1FGB D;  4NXN L;  1TWC H;  1FVI A;  1Q1B A;  3MFG A;  1TS2 A;  2PZU A;  1A3U A;  1SYC A;  3RNU A;  3CKI B;  1RIP A;  1HZA A;  1HZB A;  3R3O A;  4LF7 Q;  5M5Y B;  3K7U C;  1K9M C;  4B3M Q;  4DR3 Q;  4F88 A;  1F9Q A;  4JI0 Q;  5IY0 A;  5IGG A;  2VUM B;  5ISR A;  2C35 B;  4BS9 A;  4NPS A;  1BBX C;  4ME3 A;  1HNX Q;  1DM0 B;  4RHS A;  2F0V A;  1E7Z A;  3DWQ A;  3S16 B;  5FO7 B;  2O2L D;  1B44 D;  4MZ9 A;  1D6E C;  3ND9 A;  3NTK A;  3KF6 B;  5JOB A;  2JA8 G;  4A3L G;  1XNQ Q;  2A6H C;  4B3S L;  2B2W C;  5JPM C;  2R92 G;  1EYC A;  1TWH B;  2JYO A;  1ZYR C;  1SR3 A;  1WTH A;  4YHH L;  4GOP C;  1J8I A;  4OWW B;  1AN8 A;  2E8G A;  4PZ7 A;  1ILP A;  2IWH A;  4MIU A;  4KMU C;  1E1T A;  2PMZ E;  1IBM L;  3ONA B;  3K57 A;  1W3S A;  3TP6 A;  4BBR H;  4JI3 Q;  4CDE C;  4DR2 Q;  2QW7 A;  3C2P A;  1HFN A;  1YNJ D;  1TY2 A;  2EJF C;  2ICE C;  3GTM B;  3GO5 A;  4K8J A;  2MGS A;  2E74 C;  3SVM A;  5H1S E;  2NVY B;  3S17 B;  1K0S A;  4X64 Q;  4WJ3 M;  1AH9 A;  4DV0 Q;  1I4X A;  1PFM A;  2UXD Q;  1D5Z C;  4FXG C;  3AEV A;  4UPA A;  4IPC A;  2HDL A;  2ICI A;  2AQ1 B;  1KRS A;  1YHQ A;  5HGT A;  3X3N A;  3TN2 A;  3URY A;  2EE1 A;  1KRT A;  5FJ8 H;  4IFD I;  4KHP L;  3JAM E;  2A6E C;  1FNW A;  5AFW A;  4I7Z C;  1ML0 D;  4JI6 L;  1PH7 A;  1KAW A;  4O1N A;  1JJG A;  3M4Y A;  1WTX A;  3PSI A;  4C3J B;  2HCI A;  5GRO A;  3L3O C;  2CKZ B;  3MXN B;  5DLQ E;  4A3B B;  2K33 A;  2XTI A;  4K6D A;  1ESF A;  3NQI A;  3HOX B;  3CC4 A;  3A8K E;  2R7D A;  1JCK B;  2WII B;  2A6H D;  5JJZ A;  1L1O C;  3I90 A;  1NUC A;  1KLG D;  2Z6K A;  3NBH A;  1PXU A;  4JBM A;  3UDF A;  4BXX H;  4A3G G;  1A63 A;  5K36 H;  2CW0 D;  2AQ2 B;  1W2B A;  1J9O A;  1I4H A;  1L0W A;  2JA8 H;  1UAP A;  1PV4 A;  3GV3 A;  2HHH Q;  1C4Q A;  1I3Q B;  3A74 A;  4A93 H;  5LMU Q;  1KC8 C;  4O2D A;  3I7F A;  3J7Y W;  2UUA L;  3O13 A;  3NTH A;  1I94 L;  5COR A;  4NDX A;  5DNF A;  1JT8 A;  3T13 A;  1X3G A;  3FP9 A;  3UDX A;  4PMC A;  2PMZ B;  5IT9 L;  1K8A C;  3HOV H;  2B3G A;  2OF1 A;  4LFB Q;  1E24 A;  4GLV B;  2HHH L;  1EOV A;  4KKT A;  1IKM A;  3K81 C;  4ZLT F;  2ZM6 Q;  1EY9 A;  4IUT A;  5DAU A;  1EIF A;  1HTL D;  3Q23 A;  4C1N I;  4UDU C;  1Y14 B;  2KHI A;  1AZQ A;  5ELC A;  2WAC A;  2VL6 A;  5C0X J;  1HA5 A;  2AWO A;  1PRT D;  4A3K B;  2ID0 A;  4KKU A;  2ATW A;  3PO3 H;  4QF4 A;  4FF2 A;  1PZK D;  1Y1V H;  3GTQ B;  1CM9 A;  4OO1 I;  2FXQ A;  3TME A;  3D4R A;  1KL9 A;  4LFC L;  1GXD C;  4C2M H;  5HGQ A;  2Y0S B;  5LMN Q;  3A8J E;  3HOV B;  3DEP A;  1KDC A;  1UE7 A;  3HP3 A;  4APV A;  4TSS A;  4DFA A;  2HIV A;  2E5L Q;  1KQS A;  3H3V I;  1HRJ A;  5BR8 L;  1N36 Q;  4LFA Q;  2H4O A;  1EIH A;  3T53 B;  1NY4 A;  4GKK L;  2MFI A;  1VF5 C;  1DON A;  5JVG 3;  3MXU A;  5DEH A;  1XWE A;  3M4O H;  5I9O A;  3K7A B;  1M1K C;  1EWC A;  5JJI A;  3L2P A;  1HZ9 A;  4R4Q A;  4DNI A;  5K36 G;  3MEH A;  2ES2 A;  1DCZ A;  1U9R A;  4HR7 B;  3U9S A;  1CZG A;  4QGU A;  3FPU B;  5LMN L;  5DM7 3;  2C9O A;  5NUC A;  2OTJ A;  4L5R C;  1G2T A;  1CKM A;  3FVQ A;  1MJC A;  3I4L A;  3QO2 A;  5FLM G;  2AHO B;  2A74 C;  4C56 C;  1II3 A;  3ITP A;  2AUK A;  1XTC D;  1QUQ B;  1EUJ A;  5ELD A;  4UP7 A;  2DY8 A;  3KLS X;  4C3H B;  3K5L A;  2SNM A;  3PUX A;  2KCC A;  2JA8 B;  1BUV T;  3KLW A;  1I6V C;  4K14 A;  4EVO A;  2IY5 B;  4KN4 C;  5CGK A;  1PVO A;  1E22 A;  1JIC A;  2PW5 A;  1HQR D;  1PFB A;  1YHB A;  3RUZ A;  2BE5 D;  2F1M A;  2Z4H A;  5EKL A;  1CK1 A;  4DV0 L;  4G7O C;  1O78 A;  3R8B A;  1PA6 A;  2MO1 A;  2QIL A;  2F03 A;  3KFU A;  3I56 A;  2I0Q A;  4CKB A;  1RTN A;  4KK7 A;  5C5L A;  2WAQ G;  2Z6B A;  3EFX D;  1MD2 D;  1QVG A;  3F8T A;  3GV6 A;  1Q46 A;  1ENC A;  1JWM D;  1RL2 A;  2KCT A;  5J1Z A;  3KDF A;  1H9M A;  4JI3 L;  5E3F A;  5IYB G;  4P73 A;  3GTO H;  2UUB Q;  4GLA C;  4FF1 A;  2NN6 I;  3T1H Q;  3F2U A;  1PH3 A;  2BE5 C;  1RF2 D;  1UE6 A;  4OO1 G;  4PG3 A;  1VQM A;  2VNU D;  4QCL A;  2I5M X;  2K5W A;  2G9D A;  3CCJ A;  3RR5 A;  1UEB A;  4HCS A;  1A3T A;  1YVC A;  2OQK A;  3CCS A;  3GTL H;  2DNE A;  2F0S A; 
#chains in the Genus database with same CATH homology
 3BYT B;  4ILW A;  2K5D A;  1LAB A;  1EY8 A;  2BOS A;  1IYV A;  4MHE A;  1FYC A;  3A7L A;  4XT3 B;  3HS0 C;  2KVM A;  3S1Q B;  3S14 B;  3P20 A;  3T51 B;  4ID6 A;  1WTR A;  4M1U B;  4F87 A;  2K1B A;  1DOM A;  3DUZ A;  4XXE A;  1JR0 D;  3CRK C;  2J0T D;  2L9H A;  1SAP A;  1UUP A;  1ZXT A;  2XIW A;  3WOF A;  2WKC A;  3MC0 B;  1STG A;  2E2H B;  1SYB A;  2L12 A;  1KDA A;  2DN8 A;  2F3V A;  5E4W C;  2NB0 A;  4DAY A;  2EOT A;  5J39 A;  1BCP C;  2N55 A;  5KND A;  3BDO A;  3KUP A;  4ZKC B;  2A68 D;  3FDT A;  3K59 A;  2L11 A;  3R2T A;  3VYR A;  5D65 A;  1SYF A;  3GP7 A;  1HXY D;  2L0C A;  4HMJ A;  2IPK D;  1PTO H;  1ONL A;  3U9O A;  3EA6 A;  2FJ2 A;  4DU9 A;  3I3C A;  5EKK A;  3D31 A;  4XIG S;  1WTO A;  1GJX A;  2JEB I;  1SJH D;  1H9J A;  1OXU A;  1NR4 A;  3R2I A;  1VF7 A;  4DXF A;  4IUP A;  1U4L A;  2F0H A;  1TS3 A;  1JOQ A;  5ELE A;  4ME5 A;  4EGV A;  1LT4 D;  4A3M B;  3SEB A;  2F0Q A;  4X3S A;  2M2L A;  4H44 C;  2E2J B;  1YNJ C;  2LMC B;  4DK0 A;  1HFG A;  1TKW B;  5EKI A;  2GA4 B;  4CBV A;  5IT9 E;  5I6W A;  4DAP A;  3SE0 A;  4IUR A;  2RDF A;  3K5M A;  1SNQ A;  1OXS C;  3HZX A;  4FF4 A;  1ESR A;  1HUN A;  3S2H B;  5EPK A;  5C4J B;  1HPC A;  4QIW B;  3SXH A;  1EYD A;  5EGT A;  1KAA A;  3VR5 A;  1DXM A;  5C3X A;  1LTR D;  3S9W A;  5C4Z A;  3JAM L;  2HUG A;  1QNU A;  2EYO A;  3DWA A;  4QUC A;  3GTJ B;  2CHB D;  4B9W A;  2E75 C;  4V0B A;  1IW7 C;  2O5J C;  3A54 A;  3BDL A;  2RVL A;  2NN6 H;  5IOC A;  2TMP A;  2B2T C;  1BF4 A;  4RAU C;  1Q12 A;  4FXK C;  4BY1 B;  3OIP A;  1SYG A;  4G7Z C;  3H09 A;  1TQO A;  2FFK B;  1JOO A;  4IZ8 A;  3C3L A;  3TBI B;  4OL7 A;  3KF8 A;  1SND A;  3KK7 A;  3VR6 A;  4X3K A;  5FK9 C;  3E6Z X;  3H3V C;  2HDM A;  1LT5 D;  4V19 0;  3MXP A;  5JPN C;  2PO4 A;  3PIP 3;  5M5X B;  1L0Y B;  2RDG A;  4CHT B;  5C44 B;  4ZQ3 A;  4J6H A;  4KD3 A;  4N9P A;  4TKO B;  3A56 A;  3OMC A;  5EQ0 A;  3I4M B;  3SK6 A;  1H9K A;  4R9W A;  3J81 L;  3RLF A;  3D4D A;  1WTP A;  3T16 A;  1I4P A;  3BVZ A;  1STH A;  5JEA J;  3HKZ B;  1V1P B;  3FEW X;  2EDG A;  5CR3 A;  5EPL A;  4QMG A;  3GQB A;  4ZRZ A;  5C0X G;  1T5E A;  5J22 A;  3TSS A;  3H0G B;  3VYU A;  4IUV A;  4RA8 A;  1R4P B;  1SE2 A;  1CHQ D;  4Z9C B;  2MHV A;  2L1B A;  4PMB A;  1F9P A;  4HED A;  1I6H B;  2M9V A;  3PMF A;  3KLS A;  3BZD B;  1CQV A;  1MSH A;  1NAP A;  1F9R A;  1PRT B;  3I70 A;  4WJW A;  1Q90 A;  1TWG B;  2FIN B;  2J4X A;  1I4G A;  4BBR B;  3K6O A;  4N9T A;  2RSO A;  1MGS A;  2AUJ D;  4CGY B;  2EY5 A;  1Y8P B;  1Z7T A;  1B50 A;  2JA7 B;  2SOB A;  3QIA A;  4BY7 B;  4E6I A;  5CMD A;  1VMP A;  1Y1V B;  2EY2 A;  4DF7 A;  2NVX B;  3J81 E;  1MBY A;  2N88 A;  5LHY 1;  4XQN A;  1JQY D;  2F0M A;  2WKD A;  3MA2 B;  2OXP A;  4LAA A;  1HHV A;  2WB1 B;  1EQV A;  4YIJ A;  2B2V A;  3BVM A;  1EFI D;  5C0X I;  1MI2 A;  1R9T B;  3M85 A;  2L4N A;  3RZD B;  2NYZ D;  2K03 A;  1EEF D;  1X3Q A;  3DWP A;  4IFD H;  3MZ5 A;  4ODG A;  4IAL A;  1G6Z A;  1LTI D;  4IFD G;  3QOJ A;  2QDB A;  3PUV A;  4K5X A;  4G7H C;  5BN4 A;  4DGZ A;  4KJO A;  4RKB A;  4O42 A;  4A3G B;  3DHQ A;  1HA6 A;  2F0E A;  1GUG A;  1X32 A;  3OW7 A;  3IAY A;  2RDH A;  1PRT C;  3TZU A;  3WOE A;  2L5T A;  5IGF A;  5CBA E;  2NTS A;  3D4W A;  4F8M A;  1ENF A;  3NXW A;  1H9S A;  4TRD A;  4C3J G;  3VA5 A;  1LV9 A;  1SFO B;  2K32 A;  1SMY C;  3M7G A;  4A3F B;  3PUW A;  1AFP A;  1FNV A;  1PTO D;  1LT3 D;  5C6A A;  1EY5 A;  3OOC A;  5KNB A;  4RCO A;  1LTB D;  2Z4I A;  3V96 A;  4HSP A;  4HMI A;  3C1E A;  2F0L A;  1KLU D;  5C0X H;  2X6L A;  1STN A;  2PZW A;  1W6K A;  3NE5 B;  3VR2 A;  2RSN A;  4J1M A;  1E2V A;  1QG7 A;  1G2S A;  2EVB A;  3EQL C;  3ERO A;  4KV6 A;  1RHP A;  1PLF A;  2F0T A;  1A2U A;  1HCZ A;  2B8G A;  5IIF A;  4R8I A;  4ZUI A;  5CC4 A;  5M3M B;  1U4M A;  4XQQ A;  3EVQ A;  4U68 A;  1ICW A;  1H9S B;  1F2M A;  1QJO A;  1E0B A;  3VR3 A;  1SMY D;  2OEO A;  1SDF A;  1DOK A;  1PYW D;  1GHJ A;  4G57 A;  2HQE A;  2WV6 D;  3PO3 B;  1Q1E A;  3L9A X;  2IX1 A;  2F0W A;  4CKC A;  3SDZ A;  1KAB A;  1A6X A;  3OSO A;  3MXN A;  1Y69 U;  2O5I C;  3T4A C;  3NWT A;  2K04 A;  3H94 A;  4H13 C;  1D5X C;  2AQ3 B;  4LK1 C;  2SNS A;  4R8N A;  3KBX A;  2NZ1 D;  3V05 A;  3J7A F;  3C1F A;  2FHT A;  1KDB A;  3N52 A;  3D8G A;  4RH6 A;  4P2C B;  4FP5 D;  3TP7 A;  2YU9 B;  3G7L A;  1CA6 A;  4XQJ A;  2FMM A;  1U4R A;  3HOW B;  1KNE A;  3NTI A;  1JWS D;  1CFM A;  4HSV A;  2R92 B;  5KIX A;  3MXG A;  5ELB A;  1T5X D;  1EY7 A;  2ZXP A;  1GUN A;  3V2T A;  3S1R B;  5FOB B;  3I73 A;  1S5C D;  3D6W A;  1SYD A;  1SE4 A;  2E76 C;  2WP8 J;  3IFD A;  1GOZ A;  2NVT B;  3R93 A;  1IW7 D;  4UAI A;  4XYO A;  4MN3 A;  1XYI A;  1TII D;  3QB3 A;  5CBE E;  3H6M A;  3M3Y B;  2NTT A;  1CQF A;  2NUC A;  1O7L A;  3OMG A;  2NWG A;  1B1Z A;  4BA1 I;  1D1K A;  3M4O B;  2PW7 A;  1HTP A;  1E2W A;  5T1G A;  1RD9 D;  4DN4 M;  4KTA A;  2JSO A;  3DEO A;  4NMZ A;  2Z1C A;  1GUS A;  2XWJ B;  2IL8 A;  3SK4 A;  1D2B A;  4RWS C;  2BA1 A;  3K58 A;  4F7X A;  3VYS A;  3Q0A A;  3A7A B;  1XXG A;  4IN3 A;  5D3D A;  1ROD A;  5FLX L;  3HRZ C;  4DNT B;  4WRD A;  1ET6 A;  1BCP B;  2E2I B;  3VYT A;  4L8J A;  2R7Z B;  2B39 A;  3GTG B;  1M4V A;  3TP5 A;  1RDP D;  1LTS D;  3LWU A;  4RGN A;  3RMH A;  3LWE A;  2VXW A;  4ZYS A;  2XNA C;  3SK8 A;  1K8M A;  2F0D A;  2KA7 A;  1JC7 A;  1S5D D;  1TY0 A;  2KQ3 A;  4JK1 C;  5KYI A;  1LT6 D;  5KYL A;  4ZKB B;  1RTO A;  2F0O A;  3OPO A;  4LJZ C;  2E2D C;  1GHK A;  4ZUJ A;  5BN5 A;  3CRL C;  1IYU A;  1EY0 A;  2MPM A;  4OIJ A;  1L0X B;  1TVX A;  1AW7 A;  1B3A A;  2K01 A;  1M8A A;  5I6Y A;  3KLR A;  1Y8N B;  2B2U C;  2RBM A;  4RGT A;  2BCO A;  2PQE A;  5CV7 A;  2NVQ B;  5I4D A;  1EY4 A;  1YNN D;  3DXJ C;  1CTM A;  2F0N A;  3GD7 A;  3I8Z A;  2ENB A;  1B53 A;  4KJN A;  2F0G A;  4IFD J;  1QB5 D;  1LTG D;  4FF3 A;  3SK5 A;  1ENA A;  1WTV A;  2A5H A;  2B2V C;  2JP1 A;  3NHH A;  1STB A;  5A2Q L;  3D3R A;  2Z8L A;  4IQZ A;  2B2W A;  4OIK A;  4TQU S;  2K7V A;  3MFY A;  1EOT A;  1BCP F;  3P1H A;  5JEA G;  1HQM C;  3MVV A;  5F2D A;  3S1N B;  2D5D A;  2ZT9 C;  4CKE A;  2OT2 A;  4S3S A;  3VA7 A;  2B2Y C;  1Q8I A;  3HOY B;  4CJ0 B;  3H91 A;  2R61 A;  1V1O A;  1OXV A;  5CV4 A;  1S5F D;  3PV0 A;  4KHV A;  4XDX A;  3I91 A;  3BG3 A;  3Q6S A;  3P75 A;  1V1P A;  1IL8 A;  4K5W A;  5LL6 S;  2D9U A;  1MSG A;  3W2D A;  1FD7 D;  1I50 B;  3NBI A;  1EYA A;  4RCN A;  2SDF A;  5CYU A;  3FRP B;  1LO5 D;  4L6T B;  1K8O A;  2J7Z A;  5EBC A;  3Q22 A;  1O7Z A;  5JVH 3;  1PZI D;  4G4K A;  3QWN A;  5C4H A;  2MJ8 A;  3IFT A;  1DYQ A;  4C3I G;  3UI2 A;  3NUC A;  4Q0F A;  3M7N A;  2Q8I B;  1SSO A;  2JXM B;  3J7A V;  1JB3 A;  5JEA H;  2B8F A;  2B2T A;  4H0L C;  3RD4 A;  2TSS A;  4DXG A;  2CW0 C;  3HG9 A;  4K5V A;  4KY7 A;  1ET9 A;  1S5B D;  2FMC A;  1QWY A;  1BNZ A;  4X3T A;  4Y7N B;  1A3V A;  4C3H G;  4FVM A;  3PUZ A;  4C3I B;  5CV8 A;  5HUR A;  4FNF A;  2JA6 B;  4PMW A;  3HOZ B;  4DNR B;  3ZYY X;  5FKA C;  1QE6 A;  2LS0 1;  1STA A;  2XWB B;  3NSW A;  1TWC B;  1NSN S;  1A2T A;  1BCP D;  5C3W A;  2JA5 B;  4QB4 A;  4A3I B;  4C2M B;  2EYJ A;  3OWE B;  1PZJ D;  4I65 A;  1XX8 A;  1WTQ A;  2KED A;  1QCB D;  2F0I A;  2IT1 A;  1HUM A;  5CV5 A;  2V4D A;  2KJX A;  1JOR A;  2A73 B;  1RKN A;  3DMU A;  1WTW A;  1LTA D;  1PTO F;  2IJ0 A;  3E5S A;  1D5M C;  1G8Z D;  1I4R A;  5I9P A;  4KY5 A;  1S5E D;  4OGQ C;  4CJ1 B;  4U67 3;  2CVR A;  1F2Z A;  1A15 A;  2NN6 G;  4IUU A;  1ZYR D;  5A2Q E;  3FMC A;  2EYL A;  1BR9 A;  2WAQ B;  1EIG A;  3Q24 A;  5LL6 X;  1QNK A;  3HOU B;  4ABN A;  1SNC A;  4FXD A;  2MUY A;  3N6R A;  5C5M A;  4EQO A;  1ZEQ X;  1C8C A;  2C5C A;  3BYY B;  2B2Y A;  1V43 A;  3S2D B;  1TWA B;  4J8Q A;  4RGO S;  4GZY C;  5IOD A;  1G29 1;  4KHZ A;  3VR4 A;  2XVS A;  2QKI C;  3CHB D;  3L7Z C;  1G91 A;  1EZ8 A;  4L63 B;  4ULL A;  4RKL A;  4NW2 A;  3FKI B;  1TR5 A;  2RQX A;  2M00 A;  3HGB A;  2R3Z A;  2MP1 A;  2EPB A;  1BQQ T;  4FO2 A;  3TDQ A;  1OXX K;  5CV6 A;  1OXT A;  3NQT A;  3BVG A;  3SHL A;  3AU7 A;  1RJT A;  3LNN A;  2F0P A;  1EWH A;  5KEE A;  1Y8O B;  2KEC A;  1CHP D;  2KEE A;  1EU3 A;  1WD0 A;  4KI0 A;  4LMQ D;  1F2L A;  1BXT A;  5M3F B;  1D1I A;  1UEA B;  5D3I B;  4ZAI A;  2PCF B;  2O4X A;  3GTP B;  1OO9 B;  4OO1 H;  4XT1 B;  5FO9 B;  2ZXR A;  2X69 A;  4DAV A;  5BN3 A;  4BA2 I;  2EYP A;  2SEB D;  1C48 A;  4DK1 A;  3KBG A;  2B63 B;  1PMR A;  2BDO A;  1SXT A;  1TS5 A;  3MTS A;  4K2K A;  1V8Q A;  1BDO A;  1JWU D;  3QOL A;  3AB9 A;  5M9O A;  3PUY A;  5C3E B;  2B2U A;  2LY7 A;  2I46 A;  4A3D B;  5DM6 3;  3DM1 A;  5K5P A;  4WFN 3;  2K05 A;  2EY6 A;  3S15 B;  3IL8 A;  3I72 A;  5E4X A;  5E1F A;  2RA4 A;  4RHR A;  3GTK B;  2X6G A;  2EJM A;  1SEB D;  3OWF A;  4JBW A;  1RCV D;  3T56 B;  2A69 C;  1TWF B;  2XRQ D;  3GTL B;  1EU4 A;  2EY1 A;  1LAC A;  2A6E D;  5G3L F;  3S1M B;  2EJG C;  2F0K A;  2K6A A;  1SNO A;  1PTO B;  4NKL A;  4RFB A;  1SJE D;  4Q5V A;  1CI3 M;  4QUF A;  1CT1 D;  3PO2 B;  4XYQ A;  1VDZ A;  1EZ6 A;  2QF7 A;  1FR3 A;  1FNU A;  2LFN A;  1DJR D;  5T1I A;  1DD2 A;  2XN9 C;  1TT2 A;  2XSC A;  1F9S A;  2DY7 A;  4EQN A;  3QG1 A;  4K2L A;  2XRS D;  3LX0 A;  2IW3 A;  4OHJ A;  3IKJ A;  1DOL A;  2Q8R E;  2AWN A;  4K6L A;  3CQZ B;  3WDN A;  4PQX A;  2WIN B;  4A3E B;  2F4I A;  4KY6 A;  4NP5 A;  5I2X A;  1WD1 A;  1KTK A;  1AP0 A;  2LKV A;  4KN7 C;  1I4Q A;  2D62 A;  3W3A A;  1PDQ A;  1GUW A;  4BBS B;  4HCE A;  1JE4 A;  2VB3 X;  1STY A;  4H7B A;  2PNR C;  1EY6 A;  5IGD A;  5FLX E;  1PRT F;  3CU7 A;  1LLR D;  4RGM A;  1LTT D;  1TS4 A;  4C1N K;  1SE3 A;  5ELF A;  2IX0 A;  2D2C C;  1SYE A;  3ERQ A;  1O80 A;  2DNC A;  2H1E A;  2EYH A;  3E0J A;  2RKS A;  4PV1 C;  4WOR A;  2PPB C;  1UNS A;  1CA5 A;  1KNA A;  5G3L D;  2F0J A;  3MAQ A;  2R93 B;  5A35 A;  3G6J B;  3FPP A;  4HTH A;  4BWG B;  5I2Y A;  1BO0 A;  4B9X A;  5TSS A;  1AEX A;  1JOK A;  3MHB A;  2KCN A;  2CQA A;  2QCP X;  4KKS A;  2A68 C;  3HEJ A;  2HCC A;  1Z6H A;  3QJY A;  5EPJ A;  4M8A A;  3OHX C;  2R6G A;  1B9N A;  2YYZ A;  5M5W B;  1IKL A;  1YNN C;  1GUO A;  3NK9 A;  1CZW A;  2KOL A;  5FO8 B;  1Y1W B;  3NP8 A;  2EYF A;  3K5O A;  2Q8T A;  2ZXO A;  2F3W A;  3MWY W;  2K5Q A;  3BS1 A;  1VMC A;  3SR1 A;  3K5N A;  3I4N B;  3BDC A;  5EJW A;  1B4O A;  1S4Z A;  1SBB B;  1QIL A;  5KGU A;  5EBD A;  2F0F A;  5IGB A;  1PTO C;  2VB2 X;  2G9H D;  5IGC A;  1F77 A;  3TP8 A;  4B08 A;  2JEA I;  2BA0 A;  5KNC A;  5IGE A;  1E2Z A;  2KHS A;  3J80 E;  1VCI A;  1TU2 B;  1K83 B;  2PZT A;  4EQP A;  2NBF A;  1SNP A;  1EL0 A;  4IUQ A;  3A55 A;  1B2T A;  1ILQ A;  2EZV A;  4X3U A;  3NWS A;  4KD4 A;  1BOS A;  2L55 A;  1H9R A;  4HN7 A;  3K0Y A;  4ZK9 B;  1X3P A;  4XTC S;  3OIQ A;  3NPP A;  1Z47 A;  2I07 B;  3P7J A;  1B9M A;  2EYM A;  1SNM A;  3PIO 3;  4PNY A;  3C46 A;  1WCM B;  3J80 L;  5C4X B;  1PFN A;  3AMU A;  1DZ1 A;  2BDN A;  1QOH A;  4A93 B;  1U4P A;  3TZD A;  1WVL A;  3RZO B;  5CV9 A;  2JE6 I;  2F0U A;  2K28 A;  4FYD A;  1R4Q B;  4A3J B;  4DA2 A;  3A8I E;  1W6J A;  1Q3L A;  1EQT A;  3EJI A;  1GUT A;  3X3M A;  2QEJ C;  1NCV A;  4IUN A;  2PYK A;  2KUM A;  2A69 D;  5COY A;  5KRU A;  4CJ2 C;  4AYB B;  1O7Y A;  1STE A;  2EXZ A;  5D14 A;  1ZKO A;  3ND8 A;  1EEI D;  2IX3 A;  3D6C A;  4HAE A;  1IHZ A;  1F2Y A;  5JAV A;  1AZP A;  1NR2 A;  4K8I A;  3GTO B;  1FGB D;  1Q1B A;  3MFG A;  1TS2 A;  2PZU A;  1A3U A;  1SYC A;  3CKI B;  3R3O A;  5M5Y B;  4F88 A;  1F9Q A;  5IGG A;  2VUM B;  5ISR A;  4BS9 A;  1BBX C;  1DM0 B;  4RHS A;  2F0V A;  3DWQ A;  3S16 B;  5FO7 B;  2O2L D;  1B44 D;  5JOB A;  1D6E C;  3ND9 A;  3NTK A;  2A6H C;  2B2W C;  5JPM C;  1EYC A;  1TWH B;  2JYO A;  1ZYR C;  1J8I A;  1AN8 A;  1ILP A;  2IWH A;  4MIU A;  4KMU C;  3ONA B;  3K57 A;  3TP6 A;  1HFN A;  3C2P A;  1YNJ D;  1TY2 A;  2EJF C;  2ICE C;  3GTM B;  3GO5 A;  2MGS A;  4K8J A;  2E74 C;  3SVM A;  2NVY B;  3S17 B;  1I4X A;  1PFM A;  1D5Z C;  4FXG C;  2HDL A;  2ICI A;  2AQ1 B;  5HGT A;  3X3N A;  3TN2 A;  3URY A;  2EE1 A;  4IFD I;  3JAM E;  2A6E C;  1FNW A;  5AFW A;  4I7Z C;  1ML0 D;  4O1N A;  3M4Y A;  1WTX A;  4C3J B;  2HCI A;  3L3O C;  4A3B B;  2K33 A;  4K6D A;  1ESF A;  3NQI A;  3HOX B;  3A8K E;  1JCK B;  2WII B;  2A6H D;  5JJZ A;  3I90 A;  1NUC A;  1KLG D;  3NBH A;  1PXU A;  5K36 H;  2CW0 D;  2AQ2 B;  1J9O A;  1I4H A;  1UAP A;  3GV3 A;  1C4Q A;  1I3Q B;  3J7Y W;  3O13 A;  3NTH A;  5COR A;  4NDX A;  5DNF A;  3T13 A;  4PMC A;  2PMZ B;  5IT9 L;  2OF1 A;  4KKT A;  1IKM A;  4ZLT F;  1EY9 A;  4IUT A;  5DAU A;  1HTL D;  3Q23 A;  4C1N I;  4UDU C;  1AZQ A;  5ELC A;  2WAC A;  5C0X J;  1HA5 A;  2AWO A;  1PRT D;  4A3K B;  2ID0 A;  4KKU A;  4QF4 A;  4FF2 A;  1PZK D;  3GTQ B;  1CM9 A;  4OO1 I;  3TME A;  3D4R A;  1GXD C;  2Y0S B;  3A8J E;  3HOV B;  3DEP A;  1KDC A;  3HP3 A;  4DFA A;  4TSS A;  1HRJ A;  2H4O A;  1EIH A;  3T53 B;  1VF5 C;  1DON A;  5JVG 3;  3MXU A;  5DEH A;  1XWE A;  5I9O A;  3K7A B;  1EWC A;  5K36 G;  3MEH A;  1DCZ A;  1U9R A;  4HR7 B;  3U9S A;  1CZG A;  3FPU B;  5DM7 3;  2C9O A;  5NUC A;  1G2T A;  3FVQ A;  3I4L A;  3QO2 A;  2A74 C;  4C56 C;  1II3 A;  3ITP A;  2AUK A;  1XTC D;  5ELD A;  2DY8 A;  3KLS X;  4C3H B;  3K5L A;  2SNM A;  3PUX A;  2KCC A;  2JA8 B;  1BUV T;  1I6V C;  4K14 A;  4EVO A;  4KN4 C;  5CGK A;  1JIC A;  2PW5 A;  1HQR D;  1PFB A;  3RUZ A;  2BE5 D;  2F1M A;  2Z4H A;  5EKL A;  1CK1 A;  4G7O C;  1O78 A;  3R8B A;  2QIL A;  2F03 A;  4CKB A;  1RTN A;  4KK7 A;  5C5L A;  3EFX D;  1MD2 D;  3GV6 A;  1ENC A;  1JWM D;  5J1Z A;  1H9M A;  5E3F A;  4FF1 A;  2NN6 I;  3F2U A;  2BE5 C;  1RF2 D;  4OO1 G;  2VNU D;  4QCL A;  2K5W A;  2G9D A;  4HCS A;  1A3T A;  2DNE A;  2F0S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...