1S5BD

Cholera holotoxin with an a-subunit y30s mutation form 3
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
103
structure length
103
Chain Sequence
TPQNITDLCAEYHNTQIHTLNDKIFSYTESLAGKREMAIITFKNGATFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase,toxin
molecule keywords Cholera enterotoxin, A chain precursor
publication title Crystal structures of an intrinsically active cholera toxin mutant yield insight into the toxin activation mechanism
pubmed doi rcsb
source organism Vibrio cholerae
total genus 25
structure length 103
sequence length 103
chains with identical sequence E, F, G, H
ec nomenclature
pdb deposition date 2004-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1s5bD00
4RGTA 1LTAD 2TSSA 5TSSA 4BWGB 5ELBA 3DWPA 5FKAC 1S5CD 1LT5D 1TS2A 1AN8A 1SEBD 1FNWA 2ICIA 3DWQA 1PRTB 1RD9D 4L63B 2IJ0A 4Z9CB 4DXGA 1EEID 1BCPF 1FD7D 5FK9C 1CHPD 1PRTC 2QEJC 1LTGD 1GOZA 4L6TB 4TSSA 4O1NA 1KLGD 1T5XD 1KLUD 1HTLD 1LTRD 5I4DA 1ET6A 1PRTD 1XTCD 3BYYB 1SBBB 1DJRD 1S5ED 1KTKA 3KLSX 5ELCA 1S5FD 3DWAA 5ELDA 1JWMD 1S5DD 1LO5D 1HXYD 1V1OA 1JCKB 1FGBD 1SE2A 1PTOB 1G8ZD 2AQ2B 1L0XB 5ELEA 1M4VA 1EFID 3BVMA 1UNSA 4RGMA 1PRTF 1EU3A 1I4XA 4RFBA 1EU4A 1I4GA 1PTOC 1V1PB 1UUPA 1XXGA 1JQYD 1TS5A 1I4RA 2WV6D 3R2IA 2Z8LA 2RDGA 3SEBA 2NTSA 1MD2D 1L0YB 1AW7A 1D6EC 1JWSD 1PTOD 3URYA 1EEFD 1LTSD 2XRQD 2QILA 3CHBD 2G9HD 1SXTA 1JWUD 2AQ1B 1D5XC 3EA6A 4RHSA 1I4PA 1I4QA 5D3DA 3W2DA 1EWCA 3V05A 1FNVA 3BVGA 1LT3D 3EFXD 1PTOF 5D3IB 4UDUC 1TS4A 2IPKD 1JR0D 2O2LD 1HQRD 1BXTA 1QILA 3R8BA 1D5MC 4K6LA 1B1ZA 4RGOS 4RGNA 3MC0B 2SEBD 3OWEB 1CT1D 1ET9A 1PZKD 4DXFA 1CHQD 1LT4D 1PTOH 2NTTA 1TS3A 1CK1A 3BVZA 4C56C 2R61A 1LTBD 1LLRD 1D5ZC 1PYWD 1S5BD 1I4HA 1F77A 1RDPD 4OHJA 1SJED 1LT6D 1RF2D 1TY2A 3MFGA 3O13A 4RHRA 2J4XA 1BCPB 1B44D 1LTID 1FNUA 1DYQA 1PZJD 2RDHA 4RH6A 3BYTB 1RCVD 1BCPC 2XRSD 4RCOA 1ENFA 5ELFA 2XN9C 1SE3A 3TSSA 4ZYSA 1V1PA 1STEA 1SJHD 3GP7A 2AQ3B 1ESFA 2CHBD 1CQVA 1BCPD 1HA5A 2XNAC 1LTTD 1TY0A 3BZDB 3R2TA 1PZID 1SE4A
chains in the Genus database with same CATH superfamily
2A6HC 4ABNA 3J80L 1YHAA 1IBML 1STNA 4CKCA 1VQEA 1N9WA 1XPUA 2KCTA 4Z9CB 3U50C 4DR5Q 2WAQG 2UXDL 2PZTA 2IX0A 2K52A 4IOCA 1SMYD 4OO1G 2KCNA 4A3LH 1BUVT 2PQAA 1L1OB 4N9TA 2Z6KC 2F0KA 3PO2G 1KLGD 3A5UA 4A3BB 2OT2A 1ET6A 3I4MB 5HGQA 4ZUIA 1RTNA 3BZKA 3JAMi 1E24A 5DM63 1L0XB 3J81E 2SNMA 3OPOA 4A3BH 3J7AF 4Q5VA 3I4MH 3RN5A 1B7YB 4JI2L 3HOUG 1YITA 4OIJA 1DXMA 3UE1A 3UDFA 5M3MB 3PUZA 2H4OA 4KD4A 4LF5Q 2NYZD 2WB1G 1QUQA 5EJWA 1XMQQ 5IT9c 5JEAJ 2DY8A 2R92G 2IT1A 3T16A 4YWLA 3ER0A 1E2WA 2KUMA 4GN5A 5M3MH 4QCLA 1K0SA 2JQOA 4DR3Q 1JR0D 1U4MA 3I2ZA 1SNPA 2VUMG 4JI3Q 3QOJA 3RLFA 2RCNA 2R7ZG 1VQHA 1HTPA 2SEBD 3ZYYX 1KDAA 1X3GA 4NXML 4OO1I 3S1NB 1K3RA 1B50A 1MHWC 1FL0A 4KHPQ 2V1CC 3K81C 1HNZQ 4JV5L 2LMCB 3HOZH 2F0LA 2F4VQ 1H9SA 4KKTA 4DNRB 3S2DB 3TZUA 4KTAA 1DOKA 5CC4A 2VY3A 1SNMA 4JI6Q 3S1NH 3HOYH 1QJOA 2UXBQ 3BYTB 1U0LA 5EQ0A 2WB1B 4B3TQ 1R4PB 4ZRZA 5JAVA 2D0PA 5LMUL 3CKIB 2F0DA 4DA2A 2KENA 3S2DH 4MN3A 1T9HA 5IYBH 1EY7A 1HUMA 1LYLA 1E1OA 2F3VA 3BU2A 4CKEA 2VUMB 1FNWA 2SNSA 1E2ZA 3UDXA 4A3EB 1GUGA 4DV3L 4GLXA 2AWNA 3CP0A 5EPLA 2EDGA 3AYHB 3K57A 1Z47A 5EBCA 4DV1Q 4A3EH 1X3PA 1XTDA 1K8AC 4H13C 1EQVA 1OXVA 4JI4L 1SBBB 2EYHA 3K5NA 4X66L 5LMNL 3I91A 4OWWB 4I7AA 4YHHL 3T13A 1VQMA 2WB1E 1FGBD 4KD3A 4QB4A 5JJLA 2JN4A 2K4KA 2A6EC 2Z6BA 1G6ZA 3HKZG 1AE2A 5A35A 4G57A 5IOCA 1SYFA 3R2IA 4X3SA 3RZDB 5FLXL 3OHXC 2CQAA 3MAQA 4NMZA 2QILA 1K8GA 3FDTA 2NB0A 3J7ZC 1XJVA 4HEDA 3GTLH 3M7GA 1SNDA 1KD1C 4PZ8A 2ZTDA 1S3OA 2CW0D 3K6OA 2KOLA 3IL8A 4FNFA 5DNFA 3RZDH 4R4TA 2LKVA 3CMAA 4DAYB 5D3IB 4A3MG 3U9OA 4R1JA 3Q0AA 1QOHA 2L4NA 2MNAA 5CBAE 3QB3A 3I90A 2OF1A 3VR6A 2Y0SB 4OWTB 1GHJA 3QWNA 1IBLL 4IFDJ 1V1QA 3K0YA 3NTIA 1KRTA 2H1EA 2F0IA 1N34L 1QNUA 2A5HA 3H3VC 3HOVB 3BS1A 3KF6B 1UAPA 3VA5A 1NMGA 2RDHA 3HOVH 3C1FA 4PZ7A 2Z0SA 3S9WA 1J5EL 2A73B 3F8TA 4R4OA 3IAYA 1ICFB 2VB2X 3TS2A 3HOXG 2RA4A 1LTTD 3OIQA 5A2QE 3J81i 3S24A 4KJOA 1WOCA 1AP0A 1VQ8A 3C46A 1OXSC 3HZXA 4CJ2C 4BY1G 3MEFA 1XNRL 1PRTC 3S1RB 1ESRA 3VDYA 3PIPA 4A4IA 4C3JB 4JVZA 3V2TA 1KC8C 2EXZA 1KTKA 2C5CA 1E0BA 4RKLA 3CCVA 1PH6A 2UUAL 3D31A 3A8IE 4BBSG 1M4VA 1GJXA 4C3JH 1TXYA 2EJGC 1WVLA 3GV3A 5I6WA 4P73A 4CJ1B 3JC66 2NUCA 4KKUA 2E5LL 4ZKBB 4A3CG 2WKCA 1TKWB 4B3RL 3A0JA 1UE7A 4GNXC 4PZ6A 3GTJB 1E3PA 2ENBA 1TWGB 4FXDA 2EYOA 5C4JB 3OTOQ 2JXMB 2RSNA 4DR6L 1SXTA 1YNNC 3N6RA 3PUYA 4DV6L 3NBHA 4R9WA 2Q2HA 4K5XA 4OX9L 3GTJH 3WOEA 2E2IB 1TWGH 1WTOA 3ERQA 5C4JH 2O2LD 2XIWA 1VMPA 3S15B 1B1ZA 1ENAA 4LF4Q 1Q8IA 1IYVA 1IXRA 5K36H 1VF7A 4KY6A 2ZXOA 4LNQA 3QO2A 1BO0A 4UPAA 1R9TB 2VL6A 4C56C 1IBKL 2E2IH 1GUWA 4X3UA 4IUVA 4LF6Q 3I72A 4ZKCB 5C5MA 2PQEA 4FO2A 4ME5A 3GTOB 1F77A 4LFBQ 2JA8B 3S15H 1LT6D 1RF2D 2PCFB 4MTNA 1GHKA 4HN7A 4F88A 2PI2A 2JA7B 1R9TH 5ELOA 1NTGA 4O0AA 1ZEQX 3GTOH 2JA8H 5C0XG 4GOPB 4RWSC 1J8IA 2QKIC 3OWFA 2WIIB 1VCIA 3R2TA 3AQQA 4LFCQ 4DR7L 2PNHA 3HG9A 2JA7H 3T56B 5T1IA 3DWPA 1EY6A 4FF3A 2ICIA 1EIFA 4WRDA 2K50A 4POGA 2MHVA 4CDFC 2PZUA 3DHQA 2L11A 2HHHL 3DM1A 3CF5A 2D0OA 2MQHA 4CDEC 2BDOA 4YCVA 4JBJA 4IN3A 1B9MA 3L2PA 1B9NA 2KHSA 3T1HL 4J1MA 3PIOA 1IBMQ 1SLJA 4C3HB 1KLUD 1HTLD 2F03A 2HQLA 1WD1A 5ELCA 3DEPA 2JE6I 3A8KE 3Q8DA 4AYBB 5C44G 2UXDQ 4IQZA 3A7AB 1F2LA 4BXXG 3Q6SA 4X62L 1PTOB 1YNND 3G4SA 3S2HB 4C3HH 1EOTA 5KGUA 1IW7D 3CCSA 1JJCB 1PFSA 2EYJA 3KK7A 4DV5L 3TP6A 4AQYL 4R4IA 4JYAL 3RUZA 1JWSD 1IL2A 2FXQA 3S2HH 3PO3B 2AUKA 2N8NA 2B63G 3S1MB 1MGSA 2A68C 3A8JE 5C0XI 4JI2Q 2L1BA 1ML0D 3CCMA 5IP9H 1D1KA 1SAPA 5IODA 1ZYRD 2M2LA 3EFXD 3PO3H 1EYCA 4LMQD 4MHEA 3S1MH 5KRUA 3CCUA 1QILA 3QR8A 3R8BA 4K6LA 1Y1WG 5C44B 1E22A 3EJIA 2Z1CA 1GKHA 1KNEA 4YWMA 4V190 4R8IA 3H15A 1Q3LA 1XYIA 3LNNA 3D4DA 3E0EA 2XVSA 1OXUA 3BVZA 5CORA 1QCBD 3W5OA 3WOFA 2PW7A 2ZT9C 4NPSA 4EGVA 4KY5A 3CD6A 4R4QA 1A8VA 2I0QA 3D4WA 4NXMQ 1AEXA 1YEZA 1HFGA 5ELFA 2DUDA 4JV5Q 1RL2A 2E75C 3D3RA 1L0WA 1Q8KA 1Y8NB 4DK3C 2JA6G 2BCOA 2IJ0A 1C9OA 2HDMA 2TSSA 1B8AA 1K83B 1Y1WB 1AN8A 1JJGA 3GO5A 2NN6G 3PSIA 5LMUQ 4DR2L 1TU2B 4GLAC 2K28A 1TT2A 2ICEC 2Q2UA 2EYMA 2K04A 1Z6HA 5I9OA 2P5ZX 3IKJA 1FGUA 4A3IB 1K83H 2EVBA 3KLWA 4HIOA 1XTCD 2RVLA 2OXPA 5C4XB 5FLMG 1L1OC 1UE1A 2OEOA 4DV3Q 1AFPA 3DWAA 1JWMD 1XMOL 4A3IH 2A68D 3TRZA 3KJOA 2DJGC 2NZ1D 4B3ML 1CSQA 3CPWA 1I6VC 1OXTA 5C4XH 5IYCH 1EU3A 1K8OA 4JI4Q 2KCCA 5IGGA 3F2UA 1HZAA 3VR2A 4X66Q 1UUPA 2N88A 4YIJA 2NBFA 4JBWA 1N32L 1EIYB 1O7IA 2AMCB 2BA0A 5CR3A 4YHHQ 1RJTA 2JA9A 1U5KA 2UUCL 1H9KA 4FF1A 2XRQD 2Q8IB 2B2WA 1HHVA 3Q24A 3I4NB 2HT1A 3PMFA 2VS1A 3GTMB 2AQ1B 4DV2L 4L5TA 3GQBA 2EY5A 2FHTA 3PF4A 4BA2I 3HOWG 4DV0L 5IWAL 2JA5G 3VA7A 5FLXc 1TS4A 2IHFA 4RAUC 1KIXA 2K5NA 2YTYA 3I4NH 2PQAB 4A93B 3GTMH 2NN6I 5C6AA 3TZDA 3GTGB 4DXFA 3CC7A 4F8MA 4LUVA 2WP8J 2LFNA 4IUTA 2FJ2A 2EXDA 2BE5C 3H0GH 4JC0A 2KCMA 1I4HA 3CCJA 3TS0A 4A3KH 4A93H 2QEXA 1PV4A 1PXUA 3AFPA 4HSPA 3MFGA 1X3QA 1X65A 3CCRA 4QF4A 2RKSA 3D6CA 1B44D 3CRKC 1KAAA 2UUBL 1IBLQ 5COYA 4DGZA 5M3FB 4FXGC 1RCVD 4JI7L 2TMPA 1N34Q 4HJ5A 5JOBA 1O7ZA 1H95A 4XYQA 1M8AA 2F0JA 2KA7A 1TY0A 3CAMA 3V05A 1GD7A 2N3SA 1VS0A 1SE4A 1QUQB 3NTHA 5M3FH 5EPKA 3TP8A 1HNXL 2J7ZA 2M00A 4EQOA 1J5EQ 1UE5A 2RQXA 1I5FA 3DMUA 1S72A 3E9HA 5CV5A 3RD4A 4C3IB 5FK9C 1NNXA 4ZCKA 1M90C 4XTCS 1PFBA 4A3GB 4GKJL 1PH2A 5M5WB 2ALYB 4DNTB 1DCZA 1WTRA 1DJRD 5IGFA 1K3BC 5AFWA 2VZAA 4C3IH 4OGQC 4DUZL 3NE5B 2CFMA 4OXPA 1XNRQ 1IHZA 2KQ3A 4A3GH 1H9SB 1BBUA 1JCKB 4G7ZC 1G8ZD 5M5WH 4H44C 4MZ9A 3J80E 4DKAC 2K33A 1G2SA 1R4QB 3I56A 5M5YB 4P71A 3IFTA 4UAIA 3QOLA 1I4GA 1H9RA 1B70B 2F0FA 2LY7A 2F0QA 2UUAQ 5C3WA 3F1ZA 1LTSD 1KQSA 5M5YH 4NW2A 2FMCA 5C4ZA 3ERSX 3I70A 5BN5A 4OONA 5CV8A 1LTLA 1UEAB 2QDLA 2E5LQ 1X9NA 2EYLA 2JEAI 3CQZB 2GN5A 4B3RQ 5IGEA 2MO1A 2IHEA 3FKIG 3A54A 4DR6Q 3H6MA 1QZGA 4HIDA 1DGSA 4B3SL 5I9PA 1IKMA 1SNQA 1ET9A 1KNAA 2XTIA 2NVYB 3CQZH 5E7NA 4DV6Q 1EWIA 4OX9Q 2WAQB 2E76C 2HIXA 5CYUA 1U4LA 1RDPD 3BDCA 3TP7A 3VR4A 1A6XA 3PO2B 4F7XA 2NVYH 3BZCA 2L9HA 1IBKQ 1STHA 1W3SA 4ZYSA 4OO1H 2HIVA 4Q0FA 3K58A 1BCPD 1J9OA 2EY2A 2XNAC 3PO2H 1ONLA 4CDCC 1Y8PB 2AWOA 3EVQA 1A3UA 3P20A 3VR3A 2ZJPA 1SEBD 2Q8TA 5NUCA 3OMCA 3HOUB 2A6HD 4XQJA 3A7LA 1EL0A 4DXGA 2FMMA 2EPBA 2K7VA 3D6WA 4A75A 4JI8Q 1BCPF 1FD7D 2D62A 3SK5A 4A3JG 4DR7Q 2F0VA 1WD0A 3VR5A 4DAVA 3GDEA 3CCQA 2WAQE 4WJWA 4NKLA 3HOUH 2R92B 2HHHQ 3NQIA 1VQLA 2OCEA 5IE8A 3LWEA 1VF5C 1VQAA 5LMNW 1SE2A 4XYOA 4HJ9A 2R7ZB 1E2VA 4OIKA 3T1HQ 1EFID 5KYIA 2R92H 3OW7A 4RGMA 5FJ8G 2BOSA 1RHPA 5IGDA 2K14A 5BN3A 5IGCA 3G71A 1X55A 2VUMH 3SEBA 1PA6A 1X3FA 2R7ZH 4X62Q 2QW7A 4JI5L 3M7NA 2R6GA 4UP9A 4R4CA 1DM0B 3DM3A 4DV5Q 5I6YA 4JYAQ 2KHJA 2KBNA 1JMCA 2VQFL 1KABA 3E3XA 4CGYB 1YNXA 3MXUA 1CSPA 4IPCA 4JK1C 3MC0B 3OMGA 1EQTA 2SDFA 3TEHB 2O4XA 3G7LA 5HY6A 1TS3A 5LHY1 4Y52H 5CMDA 2DJFC 3EIVA 4A3DG 5FLXE 1S5BD 3J7A5 1PDQA 1TY2A 2CVRA 3CCEA 3SHLA 1D2BA 2B8GA 4CHTB 3G6JB 1TWHB 3DEOA 1I50B 4MIUA 3W1BA 4RH6A 4K14A 5FJ8H 3RN2A 1Q7YC 1G291 3GTPB 2XRSD 2XN9C 5CGKA 3J7YW 3PIP3 1Y14B 1VMCA 2OQKA 4H02A 4I65A 2AQ3B 4QL5A 3NPPA 1S40A 3LGJA 2L12A 1WTHA 3DUZA 1PZID 2GA4B 4GOPC 1IYJB 1TWHH 1LTAD 1I50H 3HKZB 3R3OA 2NVQB 3J80i 1JOOA 3GTPH 3NBHB 5JVH3 1P8LA 1F2ZA 5M5XB 4WORA 1PH4A 2BA1A 4IUPA 2NVQH 2QEJC 2E74C 5JVG3 1LM0A 2Q8RE 1TIID 3JAMc 3AFQA 3TBIB 1K73C 1M1KC 1Y69U 2B29A 5M5XH 4C1NK 1HA6A 1XPRA 4PMWA 4DR2Q 3M4QA 4PV1C 4G7HC 4A3MB 3M3YB 1NAPA 1EY4A 4DR4L 4PQXA 4B9XA 2BH2A 1CKMA 2AQ2B 5ELEA 5CV9A 2MPMA 1EQQA 4IPDA 2IWHA 1BKBA 3J7AV 1PTOC 3OW2A 2MO0A 4LK1C 5IYDG 4A3MH 2A6ED 2CWPA 3STBC 1VQJA 3HKZE 4EQPA 1HJPA 4LAAA 5GAHC 3KDFA 3DXJC 3M85A 1XMOQ 4R8NA 3Q23A 1SN8A 4B3MQ 5GROA 3SGIA 4DV4L 1EQRA 1CI3M 1J6QA 1BDOA 4KN7C 1SNCA 4HMJA 5D14A 3T53B 3EA6A 4MTKA 1AE3A 3CPFA 4RHSA 2VB3X 2DNEA 3NENA 4HJ7A 4LF8L 5IIFA 4BY7G 3RR5A 1SNOA 1EWCA 3S1RH 1N32Q 1VQGA 2GVBA 1MKHA 1HCZA 2UUCQ 2MJ8A 3HOXB 3ULJA 2B2VA 3NXWA 2WFWA 5EPJA 4DV2Q 4WJ3M 1ZXTA 1OTCA 1N33L 1CFMA 1P16A 1PYSB 4YWKA 2R93G 2NTTA 2PI2E 4DV0Q 1AZPA 5IWAQ 1LTBD 2ZXRA 1Q12A 3HOXH 1AH9A 2IW3A 4BY1B 1WFQA 2C9OA 4OHJA 4L5SA 2B2WC 5ELNA 1MIUA 2B2YA 4RHRA 1NCVA 4BBRG 1BBXC 4KHVA 2EJFC 3MA2B 2QDBA 1ILPA 1PZJD 5FO7B 1Q82C 1YZ6A 3K7UC 4BY1H 5E4WC 1DONA 1G51A 5L37A 3PIO3 1SROA 5IT9E 4BY7B 2X69A 1F9QA 1EYAA 2B3GA 4BBSB 4WFN3 1EUJA 2UUBQ 4RKBA 3PQIA 3K80C 1Y1VG 1YJ9A 3KBXA 4JBKA 2H5XA 3HRZC 4JI7Q 3HGBA 1JT8A 1C4QA 4X64L 4V0BA 4LWCA 1QG7A 4BBSH 2KVMA 3NP8A 3KLSA 3UDIA 1WTXA 4OWXB 4O1NA 1D8LA 3WWVA 5E1FA 1HNXQ 1T5XD 4A3CH 4PG3A 3CU7A 1PRTD 1RTOA 2F0MA 5HURA 4N8FA 3BDLA 3KLSX 4DF7A 3NBIA 5C3XA 3U58A 4GKJQ 2F3WA 3M4OB 3H94A 4N9PA 1BVSA 1PRTF 2XWBB 4IUQA 2AUJD 1EU4A 1JJ2A 1FYCA 1JC7A 2PYKA 1JQYD 1I4RA 4OELB 4DUZQ 5J22A 1DZ1A 2OWOA 1BF4A 2HUGA 3L9AX 4P2CB 3PUWA 2VW9A 4PMBA 5F2DA 2A1AA 2F0EA 3PF5A 1I4PA 5IP7G 3BVGA 4L5RC 2D2CC 3SK6A 3TREA 2CKZB 1G6PA 1C0AA 1CKOA 3H3VI 4Y7NB 1HUNA 4ME3A 2LXJA 1CZWA 1V9PA 1NY4A 1YNJC 4AH6A 4OEMB 5C0XH 1LT4D 1PTOH 1PH9A 1G91A 2R61A 3VYTA 1PH1A 1LLRD 2KECA 5DAUA 3T4AC 1PYWD 3ITPA 4X65L 3KF8A 4Y7NH 3FPPA 1E7ZA 2A74C 4B3SQ 1LTID 4JOIA 3FEWX 1ILQA 3OYYA 1C7YA 2K6AA 3I7FA 2EYFA 3GTQB 3D0FA 1Q1EA 2I46A 1SJHD 3J81c 3GP7A 1I6HB 5JEAG 4I7ZC 4U68A 4LF9L 4A3FG 3TMEA 2ES2A 1ENCA 1FR3A 4B08A 4GZYC 5C44H 1QVFA 1I6HH 4FVMA 4BXXH 2MGSA 3U9SA 2PMZB 1MI2A 5C3EG 2B63B 4KHZA 1CKNA 2VQEL 3KFUA 1LTGD 1GOZA 3E9IA 4DAMA 3K5LA 3MZ5A 4KK7A 4K8JA 4QJFA 3BYYB 4FP5D 1VQKA 2G5DA 1N8RC 3SVMA 2GVAA 4FDBA 2B63H 2PZWA 5ELDA 3JAML 4S3SA 1LO5D 1HXYD 2DN8A 2PW5A 4EQNA 3TP5A 5JJKA 4K8IA 3BVMA 4HCSA 4RFBA 3S16B 1I4XA 2LSSA 4LF7L 4QY7A 5HGTA 2ATWA 4J6HA 2D9UA 3ND9A 1Y1WH 4JI0L 3K7AB 2JJQA 3HS0C 2K5VA 3S16H 2A69C 5C4HA 1CQFA 3D8GA 2PMZE 2LXKA 1EZ8A 3K7AH 5EAYA 1LT3D 4CDDC 5JJIA 3P1HA 3HFZB 1FJGL 2JA6B 2F0SA 4JI5Q 1PHJA 1JOKA 4ID6A 3QG1A 3T51B 5LMNQ 1B2TA 1HPCA 1MBYA 4DUYL 3L0OA 4XIGS 4ZK9B 1JB3A 2QA4A 2VQFQ 2JA6H 3GV6A 3MEHA 4XQNA 4RG1A 2NVXB 2OTLA 1W2BA 1X32A 1KXLA 4TVAB 4P75A 5CV4A 2NN6H 2JK8A 4IUUA 4GNXA 1U9RA 4GS3A 4H7BA 1HR0L 2J0TD 5E4XA 1V1PA 4G7OC 5KNBA 1K9MC 2PO4A 4ZLTF 1Q81C 1WCMG 2NVXH 1CQVA 2RCFA 2R3ZA 4HCEA 3W1GA 5CV6A 5FLMH 1LT5D 3CXCA 5KNCA 5FOBB 2Z9HA 1MJEA 1SMYC 3DWQA 5ISRA 4L63B 2E2HB 4QQBX 1HZCA 4QUCA 4IFDG 4GLVB 2ZM6L 4A76A 5FO8B 3GTGH 3G48A 1Y8OB 1PFNA 4C1NI 4NB3A 1HZBA 2Q2TA 1PVOA 2ZJQA 2ID0A 4TSSA 5FO9B 1EY8A 3CMEA 1LTRD 3OSOA 2Z4HA 2E2HH 1YJWA 3HOWB 1ICWA 1EOVA 1VQ7A 3MVVA 2JA5B 1S5FD 2XSCA 4ZAIA 2R7FA 3TN2A 3ND8A 1WJJA 2JSOA 1QE6A 2DGYA 2YV5A 4DN4M 5KNDA 2YU9B 2EIFA 1GUSA 1I94L 4HIMA 4IALA 2Q2IA 4A3LG 1O7YA 2MFIA 1X56A 1RODA 3HOWH 2QGQA 3U4VA 2JA5H 1A63A 2F0PA 1F9PA 1K0RA 4DR4Q 1D6EC 2YTXA 4J15A 1V8QA 5IY0A 4IO9A 2EYPA 2YU9H 2EQSA 1LV9A 4RMFA 2ASBA 1NR4A 2ZTCA 1B3QA 1JE4A 5J3BA 2F1MA 2K1BA 4GKKL 4NP5A 5D3DA 4A3BG 2Z4IA 4LFCL 3I4MG 2E2JB 3KOJA 4LJZC 4IJHA 1ZKOA 3E0JA 2KEEA 3NSWA 3M4PA 4DV4Q 4RGOS 4RGNA 4XT1B 4IFDI 3OWEB 4LF8Q 4E6IA 2E2JH 1PLFA 5J1ZA 2F0WA 4JPBW 4KI0A 2NZHA 5M9OA 4JW0A 1PH5A 1CA5A 1EYGA 5M3MG 2BE5D 1STYA 1EYDA 1WYDA 3HEJA 5EGTA 3MXNA 3RMHA 1N33Q 1YHQA 3BJUA 4RCOA 1ENFA 2UU9L 1B3AA 4DV7L 1GUTA 1U4PA 1N36L 2B2VC 2B2TA 2V4DA 1CUKA 3QJYA 4RA8A 3MFYA 4WJ4A 1HA5A 2IX1A 3H09A 1VQBA 2UXCL 4IPGA 4RGTA 3HOZG 3AU7A 3J81L 1TR5A 3V96A 1S5CD 4X3TA 3ZJYC 3MWYW 4IJLA 2O5JC 5CV7A 1PYBA 3I8ZA 3HOYG 5GQOA 2B2YC 2FFKB 1TVXA 2QF7A 3KBGA 1HNWL 4LFAL 5LL6S 1XX8A 3NELA 3SE0A 5KEEA 2NWGA 5LL6X 4H0LC 4ZUJA 1PMRA 2HD3A 4ALPA 2BDNA 3A74A 3T1YL 1LABA 2CH4W 5IYBG 3EN2A 1PH8A 3FRPB 5I4DA 2K5QA 3SR1A 3KUPA 4X64Q 2F0HA 1MSGA 3UDGA 3FKIB 2R7DA 5AJ3L 1OXXK 3EROA 1HZ9A 1V1OA 2MUYA 5JJZA 1KAWA 4QGUA 1STGA 4K5WA 2K75A 1GO3E 4M8AA 4DFAA 3HOZB 1TQOA 3K5OA 1VQ4A 2WV6D 3FKIH 4A3EG 5DLQE 4YY3L 3URYA 2XGTA 1F9RA 3I73A 3GD7A 3HOYB 1EEFD 1CM9A 2CW0C 1QVGA 1I3QB 2X6GA 1PH3A 3L3OC 1HH2P 2F0UA 4HAEA 1BR9A 4IOAA 3X3MA 1I4QA 3M9BA 4EVOA 4TQUS 4JI1L 1XPOA 4IPHA 3C2PA 5EKLA 1BOSA 4ODGA 4OL7A 1YIJA 3VYUA 4CKBA 1A0IA 1IKLA 4UDUC 1GUNA 4GN3B 3RLOA 2F0OA 3E6ZX 2QCPX 2VXWA 1I3QH 4QIWB 1QNKA 3R93A 2JEBI 1JB7A 1CA6A 3SXHA 1L1OA 2IL8A 1KDBA 1PZKD 2HCIA 2K32A 3Q22A 1O7LA 1IZ6A 1EY5A 5E3FA 1E1TA 4A3JB 2KJXA 2OTJA 4DR1L 3PUVA 1YI2A 3O13A 2F0NA 1JICA 1XNQL 1BCPB 4AQYQ 4UHVA 1UE6A 2F3IA 1RIPA 2RDFA 4DK0A 2CH4A 1Q86C 1Z7TA 4P72A 3TQYA 4BS9A 3TSSA 4X65Q 5EBDA 4A3JH 1HFNA 3KDFB 1STEA 4KN4C 1BQQT 1ESFA 3CC2A 2CHBD 1OO9B 2EE1A 3NEMA 1GM5A 3BZDB 2RF4A 4K2LA 1DOMA 1II3A 4BWGB 4UP7A 3SK4A 5FKAC 2Y0SG 3VYSA 4QIWE 4HJAA 4DK6C 3KYHC 2B2UA 1QZHA 5BR8L 2YTVA 3LX0A 4LF9Q 4O2DA 3HOVG 1ASYA 4JOIC 3GTLB 4K0KL 2EOTA 3K8AA 5BN4A 3FHWA 1KRSA 3EQLC 3A56A 4L6TB 5I2YA 2CQOA 3KLRA 2CWAA 1Q90A 4X3KA 4AIMA 2VQEQ 1S5DD 3PUXA 1L2FA 4EQ5A 3ONAB 4FF2A 1SYDA 4TRDA 1A2TA 2I5MX 1VQPA 1RKNA 1JE5A 3MXPA 1XXGA 4A3DB 1TS5A 2Z8LA 4CBVA 1FVIA 1MD2D 4YCWA 3MTSA 2K01A 1A62A 2G9HD 4PNYA 1SR3A 3A5ZB 3S1QB 2RBMA 1D5XC 2EY1A 1PFMA 3CC4A 4LF7Q 1F2MA 4A3DH 1K8MA 3W2DA 3X3NA 3EBEA 4C3JG 1O80A 5T1GA 4JI0Q 1D7QA 4XQQA 3E5SA 4FF4A 4DPGA 3NTKA 4NXNL 2E8GA 3ULPA 1QVCA 4P74A 3S1QH 4POFA 4K2KA 2PPBC 3M3YH 4IURA 2I5LX 5C5LA 1C8CA 5A2QL 2HQEA 3F2DA 1CHQD 1GUOA 2E2DC 4HIKA 1QWYA 1FJGQ 1SJED 1SYBA 1WTVA 2Y0SE 5GAEC 2N78A 2OQ0A 4DUYQ 1VQ6A 2Z6KA 2KEDA 1WTWA 1NJIC 4MNOA 5K36G 1MJCA 1YJNA 3S17B 4EX5A 3PGZA 1VQOA 4DR5L 4DAPA 2HCCA 5EKKA 1EFWA 1F9SA 2N55A 1LACA 2HDLA 5ELBA 3ULLA 1VQIA 1U4RA 3S14B 3S17H 1HR0Q 3D4RA 5I2XA 1STBA 4BA1I 2RHQB 4JCVE 4DAYA 1CHPD 5K5PA 2JA8G 5KYLA 3S14H 5IYDH 2JA7G 1SYEA 4GN4B 5G3LD 1S5ED 3MXGA 1UWVA 3KF8B 4KLKA 4APVA 2ZM6Q 1NBWA 3UI2A 2K05A 2IX3A 2WKDA 3FMCA 1IW7C 2K5HA 4L8JA 3KF6A 1H9MA 4LF5L 3KJPA 3ICEA 4BY7H 1A3TA 5IT9L 3PV0A 1EIGA 2YYZA 1XMQL 2B8FA 2R93B 5G3LF 4K6DA 1B4OA 4QMGA 1SYCA 3UE0A 2RDGA 2ZXPA 1CTMA 1PTOD 5H1SE 3N52A 4BBRB 4DR3L 3STBD 1I94Q 4JI3L 3HKSA 2R93H 3M4YA 4LUOA 1ZYRC 2DNCA 4C3HG 3L7ZC 1QB5D 1NSNS 4KHPL 4BBRH 1PTOF 3MHBA 2ZJRA 1HNZL 4AYBG 2IPKD 1CKNB 2L55A 4LW1A 1HQRD 4HSVA 1SDFA 4G4KA 2F4VL 1Y1VB 4KKSA 3CW2C 3SK8A 1WI5A 2WINB 4JI8L 4GKKQ 2L0CA 1CZGA 4JI6L 2F52A 3IFDA 3LWUA 1KL9A 2UXBL 2VNUD 3M4OH 1D5ZC 4B3TL 1BNZA 5CBEE 5IP9G 1TWAB 1Y1VH 2DY7A 3PO3G 3H3VH 1TWFB 5JPMC 2NVTB 1SYGA 1NR2A 1YHBA 1SE3A 2I5HA 3J80c 1TWAH 3I4OA 1A15A 2CCZA 2K5DA 1C48A 1TWFH 2AKWB 2NVTH 3P7JA 4XXEA 3NK9A 1G2TA 4DV1L 2O5IC 3GTKB 1TS2A 1JORA 1YVCA 2UU9Q 4DV7Q 1N36Q 1PRTB 4HMIA 4UP8A 1F2YA 3A55A 2UXCQ 1EY0A 2FINB 2L15A 3I55A 5GADC 3GTKH 5IGBA 4KY7A 2MP1A 1TWCB 4YCUA 5J39A 4TKOB 4F87A 2JP1A 3IRBA 1SRUA 2RHSB 2B2TC 4JG2A 1VQCA 2BH8A 1HNWQ 3GTQH 4LFAQ 1SFOB 3RNUA 3C3LA 1A2UA 5DM73 1DD2A 2F0TA 1TWCH 3NQTA 3T1YQ 5IP7H 2AHOB 1WTQA 4GNXB 3WDNA 4X6AH 1V1PB 5D65A 4AYBE 1SFOH 5GAGC 3F2BA 5AJ3Q 1L0YB 1AW7A 4GOPA 3I4LA 4DK1A 1S4ZA 3OIPA 4RCNA 3CHBD 3FVQA 2G9DA 4A3IG 1JWUD 4CJ0B 3CCLA 4B9WA 5IYCG 5C4XG 4M1UB 2A8VA 3NWSA 4YY3Q 3K0XA 3JAME 4A3FB 4KV6A 1JOQA 1EY9A 1VQ5A 3H91A 4KMUC 1BXTA 3TDQA 1SE8A 2WACA 1V43A 4XT3B 3FPUB 1B53A 1K28A 1WTPA 4L5QA 4HR7B 4JI1Q 4JBMA 1VDZA 3RZOB 5JEAH 1A3VA 2EJMA 1CK1A 4A3FH 4QUFA 2KHIA 1YNJD 4N8X1 1EIHA 1X54A 3HP3A 5C3EB 3AEVA 1VQNA 3W3AA 1HRJA 4HTHA 2J4XA 3RLNA 3RZOH 2A19A 1FNUA 4FYDA 3I4NG 1X6OA 1DYQA 5C3EH 4UY8C 1HR0W 3K59A 1EZ6A 4DR1Q 2JYOA 3FP9A 1XNQQ 1KHIA 3H0GG 4A3KG 1IYUA 1NE3A 4A93G 5TSSA 2I07B 2IY5B 1UEBA 3PCOB 1O78A 1RD9D 2K03A 4K5VA 4O42A 1EEID 3C1EA 4U673 1VQDA 4IZ8A 2F0GA 4FXKC 3P75A 2M9VA 2B39A 1Z9FA 1GXDC 5M3FG 5JPNC 5BR8Q 1VQ9A 3J81j 3QIAA 4K0KQ 1STAA 2N49A 2XWJB 3K5MA 3U4ZA 1KDCA 3CRLC 3OTOL 3BDOA 2PNRC 3MXNB 5DEHA 1UNSA 2B2UC 1DOLA 2K5WA 3H0GB 4A3KB 3OOCA 3AB9A 1XWEA 2ZTEA 2X6LA 1PH7A 4DU9A 4ZQ3A 1GVPA 2NTSA 1BBWA 2SOBA 3VYRA 4C3IG 3NHHA 1VQFA 4A3GG 4LF4L 1SMXA 4ULLA 4XDXA 5KIXA 1IL8A 1X3EA 1SSOA 2A69D 1FNVA 3I3CA 4PMCA 4HJ8A 1AZQA 2F4IA 1WCMB 4LF6L 4ILWA 4LUZA 4LFBL 1D5MC 2NZOA 1NMFA 1NUCA 1CT1D 1LUZA 1W6JA 4DNIA 4C2MB 1WCMH 4KJNA 4NDXA 1EWHA 2L5TA 4IUNA 1YBYA 4J8QA 5C0XJ 4NXNQ 3G6EA 2RSOA 3AMUA 1H9JA 1Q1BA 1HQMC 3SDZA 3DLLA 2LS01 4C2MH 2EZVA 4IFDH 1T5EA 1ASZA 1BCPC 1W6KA 3NUCA 2C35B 3BG3A 3B6YA 3F2CA 1Q46A 5EKIA 1D1IA 3NWTA 2EY6A 2D5DA 1MSHA
chains in the Genus database with same CATH topology
2A6HC 4ABNA 3J80L 1STNA 4CKCA 4Z9CB 2PZTA 2IX0A 4OO1G 1SMYD 2KCNA 1BUVT 4N9TA 2F0KA 1KLGD 4A3BB 2OT2A 1ET6A 3I4MB 4ZUIA 1RTNA 5DM63 1L0XB 3J81E 2SNMA 3OPOA 3J7AF 4Q5VA 4OIJA 1DXMA 5M3MB 3PUZA 2H4OA 4KD4A 2NYZD 5EJWA 5JEAJ 2DY8A 2IT1A 3T16A 1E2WA 2KUMA 4QCLA 1JR0D 1U4MA 1SNPA 3QOJA 3RLFA 1HTPA 2SEBD 3ZYYX 1KDAA 4OO1I 3S1NB 1B50A 2LMCB 2F0LA 1H9SA 4KKTA 4DNRB 3S2DB 3TZUA 4KTAA 1DOKA 5CC4A 1SNMA 1QJOA 3BYTB 5EQ0A 2WB1B 1R4PB 4ZRZA 5JAVA 3CKIB 2F0DA 4DA2A 4MN3A 1EY7A 1HUMA 2F3VA 4CKEA 2VUMB 1FNWA 2SNSA 1E2ZA 4A3EB 1GUGA 2AWNA 5EPLA 2EDGA 3K57A 1Z47A 5EBCA 1X3PA 4H13C 1EQVA 1OXVA 1SBBB 2EYHA 3K5NA 3I91A 3T13A 1FGBD 4KD3A 4QB4A 2A6EC 1G6ZA 5A35A 4G57A 5IOCA 1SYFA 3R2IA 4X3SA 3RZDB 5FLXL 3OHXC 2CQAA 3MAQA 4NMZA 2QILA 3FDTA 2NB0A 4HEDA 3M7GA 1SNDA 2CW0D 3K6OA 2KOLA 3IL8A 4FNFA 5DNFA 2LKVA 5D3IB 3U9OA 3Q0AA 1QOHA 2L4NA 5CBAE 3QB3A 3I90A 2OF1A 3VR6A 2Y0SB 1GHJA 3QWNA 4IFDJ 3K0YA 3NTIA 2H1EA 2F0IA 3HOVB 1QNUA 2A5HA 3H3VC 3BS1A 1UAPA 3VA5A 2RDHA 3C1FA 3S9WA 2A73B 3IAYA 2VB2X 2RA4A 1LTTD 3OIQA 5A2QE 4KJOA 1AP0A 3C46A 1OXSC 3HZXA 4CJ2C 1PRTC 3S1RB 1ESRA 4C3JB 3V2TA 2EXZA 1KTKA 2C5CA 1E0BA 4RKLA 3D31A 3A8IE 1M4VA 1GJXA 2EJGC 1WVLA 3GV3A 5I6WA 4CJ1B 2NUCA 4KKUA 4ZKBB 2WKCA 1TKWB 3GTJB 2ENBA 1TWGB 4FXDA 2EYOA 5C4JB 2JXMB 2RSNA 1SXTA 1YNNC 3N6RA 3PUYA 3NBHA 4R9WA 4K5XA 3WOEA 2E2IB 1WTOA 3ERQA 2O2LD 2XIWA 1VMPA 3S15B 1B1ZA 1ENAA 1Q8IA 1IYVA 5K36H 1VF7A 4KY6A 2ZXOA 3QO2A 1BO0A 1R9TB 4C56C 1GUWA 4X3UA 4IUVA 3I72A 4ZKCB 5C5MA 2PQEA 4FO2A 4ME5A 3GTOB 1F77A 2JA8B 1LT6D 1RF2D 2PCFB 1GHKA 4HN7A 4F88A 2JA7B 1ZEQX 5C0XG 4RWSC 1J8IA 2QKIC 3OWFA 2WIIB 1VCIA 3R2TA 3HG9A 3T56B 5T1IA 3DWPA 1EY6A 4FF3A 2ICIA 4WRDA 2MHVA 2PZUA 3DHQA 2L11A 3DM1A 2BDOA 4IN3A 1B9MA 1B9NA 2KHSA 4J1MA 4C3HB 1KLUD 1HTLD 2F03A 1WD1A 5ELCA 3DEPA 2JE6I 3A8KE 4AYBB 4IQZA 3A7AB 1F2LA 3Q6SA 1PTOB 1YNND 3S2HB 1EOTA 5KGUA 1IW7D 2EYJA 3KK7A 3TP6A 3RUZA 1JWSD 3PO3B 2AUKA 3S1MB 1MGSA 2A68C 3A8JE 5C0XI 2L1BA 1ML0D 1D1KA 5IODA 1SAPA 1ZYRD 2M2LA 3EFXD 1EYCA 4LMQD 4MHEA 5KRUA 1QILA 3R8BA 4K6LA 5C44B 3EJIA 2Z1CA 1KNEA 4V190 4R8IA 1Q3LA 1XYIA 3LNNA 3D4DA 2XVSA 1OXUA 3BVZA 5CORA 1QCBD 3WOFA 2PW7A 2ZT9C 4EGVA 4KY5A 3D4WA 1AEXA 1HFGA 5ELFA 2E75C 3D3RA 1Y8NB 2BCOA 2IJ0A 2HDMA 2TSSA 1K83B 1Y1WB 1AN8A 3GO5A 2NN6G 1TU2B 2K28A 1TT2A 2ICEC 2EYMA 2K04A 1Z6HA 5I9OA 3IKJA 4A3IB 2EVBA 1XTCD 2RVLA 2OXPA 5C4XB 2OEOA 1AFPA 3DWAA 1JWMD 2A68D 2NZ1D 1I6VC 1OXTA 1EU3A 1K8OA 2KCCA 5IGGA 3F2UA 3VR2A 1UUPA 2N88A 4YIJA 2NBFA 4JBWA 2BA0A 5CR3A 1RJTA 1H9KA 4FF1A 2XRQD 2Q8IB 2B2WA 1HHVA 3Q24A 3I4NB 3PMFA 3GTMB 2AQ1B 3GQBA 2EY5A 2FHTA 4BA2I 3VA7A 1TS4A 4RAUC 4A93B 2NN6I 5C6AA 3TZDA 3GTGB 4DXFA 4F8MA 2WP8J 2LFNA 4IUTA 2FJ2A 2BE5C 1I4HA 1PXUA 4HSPA 3MFGA 1X3QA 4QF4A 2RKSA 3D6CA 1B44D 3CRKC 1KAAA 5COYA 4DGZA 5M3FB 4FXGC 1RCVD 2TMPA 5JOBA 1O7ZA 4XYQA 1M8AA 2F0JA 2KA7A 1TY0A 3V05A 1SE4A 3NTHA 5EPKA 3TP8A 2J7ZA 2M00A 4EQOA 2RQXA 3DMUA 5CV5A 3RD4A 4C3IB 5FK9C 4XTCS 1PFBA 4A3GB 5M5WB 4DNTB 1DCZA 1WTRA 1DJRD 5IGFA 5AFWA 4OGQC 3NE5B 1IHZA 2KQ3A 1H9SB 1JCKB 4G7ZC 1G8ZD 4H44C 3J80E 2K33A 1G2SA 1R4QB 5M5YB 3IFTA 4UAIA 3QOLA 1I4GA 1H9RA 2F0FA 2LY7A 2F0QA 5C3WA 1LTSD 4NW2A 2FMCA 5C4ZA 3I70A 5BN5A 5CV8A 1UEAB 2EYLA 2JEAI 3CQZB 5IGEA 3A54A 3H6MA 5I9PA 1IKMA 1SNQA 1ET9A 1KNAA 2NVYB 2WAQB 2E76C 5CYUA 1U4LA 1RDPD 3BDCA 3TP7A 3VR4A 1A6XA 3PO2B 4F7XA 2L9HA 1STHA 4ZYSA 4OO1H 4Q0FA 3K58A 1BCPD 1J9OA 2EY2A 2XNAC 1ONLA 1Y8PB 2AWOA 3EVQA 1A3UA 3P20A 3VR3A 1SEBD 2Q8TA 5NUCA 3OMCA 3HOUB 2A6HD 4XQJA 3A7LA 1EL0A 4DXGA 2FMMA 2EPBA 2K7VA 3D6WA 1BCPF 1FD7D 2D62A 3SK5A 2F0VA 1WD0A 3VR5A 4DAVA 4WJWA 4NKLA 2R92B 3NQIA 3LWEA 1VF5C 1SE2A 4XYOA 2R7ZB 1E2VA 4OIKA 1EFID 5KYIA 3OW7A 4RGMA 2BOSA 1RHPA 5IGDA 5BN3A 5IGCA 3SEBA 3M7NA 2R6GA 1DM0B 5I6YA 1KABA 4CGYB 3MXUA 4JK1C 3MC0B 3OMGA 1EQTA 2SDFA 2O4XA 3G7LA 5LHY1 1TS3A 5CMDA 5FLXE 1S5BD 1PDQA 1TY2A 2CVRA 3SHLA 1D2BA 2B8GA 4CHTB 3G6JB 1TWHB 3DEOA 1I50B 4MIUA 4RH6A 4K14A 1G291 3GTPB 2XRSD 2XN9C 5CGKA 3J7YW 3PIP3 1VMCA 4I65A 2AQ3B 3NPPA 2L12A 2GA4B 1PZID 3DUZA 1LTAD 3HKZB 3R3OA 2NVQB 1JOOA 5JVH3 1F2ZA 5M5XB 4WORA 2BA1A 4IUPA 2QEJC 2E74C 5JVG3 2Q8RE 1TIID 3TBIB 1Y69U 4C1NK 1HA6A 4PMWA 4PV1C 4G7HC 4A3MB 3M3YB 1NAPA 1EY4A 4PQXA 4B9XA 2AQ2B 5ELEA 5CV9A 2MPMA 2IWHA 3J7AV 1PTOC 4LK1C 2A6ED 4EQPA 3M85A 4LAAA 3DXJC 4R8NA 3Q23A 5D14A 1CI3M 1BDOA 4KN7C 1SNCA 4HMJA 3T53B 3EA6A 4RHSA 2VB3X 2DNEA 5IIFA 1SNOA 1EWCA 1HCZA 2MJ8A 3HOXB 2B2VA 3NXWA 5EPJA 1ZXTA 1CFMA 2NTTA 1AZPA 1LTBD 2ZXRA 1Q12A 2IW3A 4BY1B 2C9OA 4OHJA 2B2WC 2B2YA 4RHRA 1NCVA 1BBXC 4KHVA 2EJFC 3MA2B 2QDBA 1ILPA 1PZJD 5FO7B 5E4WC 1DONA 3PIO3 5IT9E 4BY7B 2X69A 1F9QA 1EYAA 4BBSB 4WFN3 4RKBA 3KBXA 3HRZC 3HGBA 1C4QA 4V0BA 1QG7A 2KVMA 3NP8A 3KLSA 1WTXA 4O1NA 5E1FA 1T5XD 3CU7A 1PRTD 1RTOA 2F0MA 5HURA 3BDLA 3KLSX 4DF7A 3NBIA 5C3XA 2F3WA 3M4OB 3H94A 4N9PA 2XWBB 1PRTF 4IUQA 2AUJD 1EU4A 1FYCA 1JC7A 2PYKA 1JQYD 1I4RA 5J22A 1DZ1A 1BF4A 2HUGA 3L9AX 4P2CB 3PUWA 4PMBA 5F2DA 2F0EA 1I4PA 3BVGA 2D2CC 3SK6A 4Y7NB 1HUNA 1CZWA 1YNJC 5C0XH 1LT4D 1PTOH 1G91A 2R61A 3VYTA 1LLRD 2KECA 5DAUA 3T4AC 1PYWD 3ITPA 3KF8A 3FPPA 2A74C 1LTID 3FEWX 1ILQA 2K6AA 2EYFA 3GTQB 1Q1EA 2I46A 1SJHD 3GP7A 1I6HB 5JEAG 4I7ZC 4U68A 3TMEA 1ENCA 1FR3A 4B08A 4GZYC 4FVMA 2MGSA 3U9SA 2PMZB 1MI2A 2B63B 4KHZA 1LTGD 1GOZA 3K5LA 3MZ5A 4KK7A 4K8JA 3BYYB 4FP5D 3SVMA 2PZWA 5ELDA 3JAML 4S3SA 1LO5D 1HXYD 2DN8A 2PW5A 4EQNA 3TP5A 4K8IA 3BVMA 4HCSA 4RFBA 3S16B 1I4XA 5HGTA 4J6HA 2D9UA 3ND9A 3K7AB 3HS0C 2A69C 5C4HA 1CQFA 3D8GA 1EZ8A 1LT3D 3P1HA 2JA6B 2F0SA 1JOKA 4ID6A 3QG1A 3T51B 1B2TA 1HPCA 1MBYA 4XIGS 4ZK9B 1JB3A 3GV6A 3MEHA 4XQNA 2NVXB 1X32A 5CV4A 2NN6H 4IUUA 1U9RA 4H7BA 2J0TD 5E4XA 1V1PA 4G7OC 5KNBA 2PO4A 4ZLTF 1CQVA 2R3ZA 4HCEA 5CV6A 1LT5D 5KNCA 5FOBB 1SMYC 3DWQA 5ISRA 4L63B 2E2HB 4QUCA 4IFDG 5FO8B 1Y8OB 1PFNA 4C1NI 2ID0A 4TSSA 5FO9B 1EY8A 1LTRD 3OSOA 2Z4HA 3HOWB 1ICWA 3MVVA 2JA5B 1S5FD 2XSCA 4ZAIA 3TN2A 3ND8A 2JSOA 1QE6A 4DN4M 5KNDA 2YU9B 1GUSA 4IALA 1O7YA 1RODA 2F0PA 1F9PA 1D6EC 1V8QA 2EYPA 1LV9A 1NR4A 1JE4A 2F1MA 2K1BA 4NP5A 5D3DA 2Z4IA 2E2JB 4LJZC 1ZKOA 3E0JA 2KEEA 3NSWA 4RGOS 4RGNA 4XT1B 4IFDI 3OWEB 4E6IA 1PLFA 5J1ZA 2F0WA 4KI0A 5M9OA 1CA5A 2BE5D 1STYA 1EYDA 3HEJA 5EGTA 3MXNA 3RMHA 4RCOA 1ENFA 1B3AA 1GUTA 1U4PA 2B2VC 2B2TA 2V4DA 3QJYA 4RA8A 3MFYA 1HA5A 2IX1A 3H09A 4RGTA 3AU7A 3J81L 1TR5A 3V96A 1S5CD 4X3TA 3MWYW 2O5JC 5CV7A 3I8ZA 2B2YC 2FFKB 1TVXA 2QF7A 3KBGA 5LL6S 1XX8A 3SE0A 5KEEA 2NWGA 5LL6X 4H0LC 4ZUJA 1PMRA 2BDNA 1LABA 3FRPB 5I4DA 2K5QA 3SR1A 3KUPA 2F0HA 1MSGA 3FKIB 1OXXK 3EROA 1V1OA 2MUYA 5JJZA 1STGA 4K5WA 4M8AA 4DFAA 3HOZB 1TQOA 3K5OA 2WV6D 3URYA 1F9RA 3I73A 3GD7A 3HOYB 1EEFD 1CM9A 2CW0C 1I3QB 2X6GA 3L3OC 2F0UA 4HAEA 1BR9A 3X3MA 1I4QA 4EVOA 4TQUS 3C2PA 5EKLA 1BOSA 4ODGA 4OL7A 3VYUA 4CKBA 1IKLA 4UDUC 1GUNA 2F0OA 3E6ZX 2QCPX 2VXWA 4QIWB 3R93A 1QNKA 2JEBI 1CA6A 3SXHA 2IL8A 1PZKD 1KDBA 2HCIA 2K32A 3Q22A 1O7LA 1EY5A 5E3FA 4A3JB 2KJXA 3PUVA 3O13A 2F0NA 1JICA 1BCPB 2RDFA 4DK0A 1Z7TA 4BS9A 3TSSA 1HFNA 5EBDA 4KN4C 1STEA 1BQQT 1ESFA 2CHBD 1OO9B 2EE1A 3BZDB 4K2LA 1DOMA 1II3A 4BWGB 3SK4A 5FKAC 3VYSA 2B2UA 3LX0A 3GTLB 2EOTA 5BN4A 3EQLC 4L6TB 3A56A 5I2YA 3KLRA 1Q90A 4X3KA 1S5DD 3PUXA 3ONAB 4FF2A 1SYDA 4TRDA 1A2TA 1RKNA 3MXPA 1XXGA 4A3DB 1TS5A 2Z8LA 4CBVA 1MD2D 3MTSA 2K01A 2G9HD 4PNYA 3S1QB 2RBMA 1D5XC 2EY1A 1PFMA 1F2MA 1K8MA 3W2DA 3X3NA 4C3JG 1O80A 5T1GA 4XQQA 3E5SA 4FF4A 3NTKA 4K2KA 2PPBC 4IURA 5C5LA 1C8CA 5A2QL 2HQEA 1CHQD 1GUOA 2E2DC 1QWYA 1SJED 1SYBA 1WTVA 2KEDA 1WTWA 5K36G 3S17B 4DAPA 2HCCA 5EKKA 1F9SA 2N55A 1LACA 2HDLA 5ELBA 1U4RA 3S14B 3D4RA 5I2XA 1STBA 4BA1I 4DAYA 1CHPD 5K5PA 5KYLA 1SYEA 5G3LD 1S5ED 3MXGA 3UI2A 2K05A 2IX3A 2WKDA 3FMCA 1IW7C 4L8JA 1H9MA 1A3TA 5IT9L 3PV0A 1EIGA 2YYZA 2B8FA 2R93B 5G3LF 4K6DA 1B4OA 4QMGA 1SYCA 2RDGA 2ZXPA 1CTMA 1PTOD 3N52A 4BBRB 3M4YA 1ZYRC 2DNCA 4C3HG 3L7ZC 1QB5D 1NSNS 1PTOF 3MHBA 2IPKD 2L55A 1HQRD 4HSVA 1SDFA 4G4KA 1Y1VB 4KKSA 3SK8A 2WINB 2L0CA 1CZGA 3IFDA 3LWUA 2VNUD 1D5ZC 1BNZA 5CBEE 1TWAB 2DY7A 1TWFB 5JPMC 2NVTB 1SYGA 1NR2A 1SE3A 1A15A 2K5DA 1C48A 3P7JA 4XXEA 3NK9A 1G2TA 2O5IC 3GTKB 1TS2A 1JORA 1PRTB 4HMIA 1F2YA 3A55A 1EY0A 2FINB 5IGBA 4KY7A 2MP1A 1TWCB 5J39A 4TKOB 4F87A 2JP1A 2B2TC 1SFOB 3C3LA 1A2UA 5DM73 1DD2A 2F0TA 3NQTA 1WTQA 3WDNA 1V1PB 5D65A 1L0YB 1AW7A 3I4LA 4DK1A 1S4ZA 3OIPA 4RCNA 3CHBD 3FVQA 2G9DA 1JWUD 4CJ0B 4B9WA 4M1UB 3NWSA 4A3FB 3JAME 1JOQA 4KV6A 1EY9A 3H91A 4KMUC 1BXTA 3TDQA 2WACA 1V43A 4XT3B 3FPUB 1B53A 1WTPA 3RZOB 4HR7B 1VDZA 5JEAH 1A3VA 2EJMA 1CK1A 4QUFA 1YNJD 1EIHA 3HP3A 5C3EB 3W3AA 1HRJA 4HTHA 2J4XA 4FYDA 1FNUA 1DYQA 3K59A 1EZ6A 2JYOA 1IYUA 5TSSA 2I07B 1O78A 1RD9D 2K03A 4K5VA 4O42A 1EEID 3C1EA 4U673 4IZ8A 2F0GA 4FXKC 3P75A 2M9VA 2B39A 1GXDC 5JPNC 3QIAA 1STAA 2XWJB 3K5MA 1KDCA 3CRLC 3BDOA 2PNRC 5DEHA 1UNSA 2B2UC 1DOLA 2K5WA 3H0GB 4A3KB 3OOCA 3AB9A 1XWEA 2X6LA 4DU9A 4ZQ3A 2NTSA 2SOBA 3VYRA 4C3IG 3NHHA 4ULLA 4XDXA 5KIXA 1IL8A 1SSOA 2A69D 1FNVA 3I3CA 4PMCA 1AZQA 2F4IA 1WCMB 4ILWA 1D5MC 1NUCA 1CT1D 1W6JA 4C2MB 4KJNA 4NDXA 1EWHA 2L5TA 4IUNA 4J8QA 5C0XJ 2RSOA 3AMUA 1H9JA 1Q1BA 1HQMC 3SDZA 2LS01 2EZVA 4IFDH 1T5EA 1BCPC 1W6KA 3NUCA 3BG3A 5EKIA 1D1IA 3NWTA 2EY6A 2D5DA 1MSHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RGT A;  1LTA D;  2TSS A;  5TSS A;  4BWG B;  5ELB A;  3DWP A;  5FKA C;  1S5C D;  1LT5 D;  1TS2 A;  1AN8 A;  1SEB D;  1FNW A;  2ICI A;  3DWQ A;  1PRT B;  1RD9 D;  4L63 B;  2IJ0 A;  4Z9C B;  4DXG A;  1EEI D;  1BCP F;  1FD7 D;  5FK9 C;  1CHP D;  1PRT C;  2QEJ C;  1LTG D;  1GOZ A;  4L6T B;  4TSS A;  4O1N A;  1KLG D;  1T5X D;  1KLU D;  1HTL D;  1LTR D;  5I4D A;  1ET6 A;  1PRT D;  1XTC D;  3BYY B;  1SBB B;  1DJR D;  1S5E D;  1KTK A;  3KLS X;  5ELC A;  1S5F D;  3DWA A;  5ELD A;  1JWM D;  1S5D D;  1LO5 D;  1HXY D;  1V1O A;  1JCK B;  1FGB D;  1SE2 A;  1PTO B;  1G8Z D;  2AQ2 B;  1L0X B;  5ELE A;  1M4V A;  1EFI D;  3BVM A;  1UNS A;  4RGM A;  1PRT F;  1EU3 A;  1I4X A;  4RFB A;  1EU4 A;  1I4G A;  1PTO C;  1V1P B;  1UUP A;  1XXG A;  1JQY D;  1TS5 A;  1I4R A;  2WV6 D;  3R2I A;  2Z8L A;  2RDG A;  3SEB A;  2NTS A;  1MD2 D;  1L0Y B;  1AW7 A;  1D6E C;  1JWS D;  1PTO D;  3URY A;  1EEF D;  1LTS D;  2XRQ D;  2QIL A;  3CHB D;  2G9H D;  1SXT A;  1JWU D;  2AQ1 B;  1D5X C;  3EA6 A;  4RHS A;  1I4P A;  1I4Q A;  5D3D A;  3W2D A;  1EWC A;  3V05 A;  1FNV A;  3BVG A;  1LT3 D;  3EFX D;  1PTO F;  5D3I B;  4UDU C;  1TS4 A;  2IPK D;  1JR0 D;  2O2L D;  1HQR D;  1BXT A;  1QIL A;  3R8B A;  1D5M C;  4K6L A;  1B1Z A;  4RGO S;  4RGN A;  3MC0 B;  2SEB D;  3OWE B;  1CT1 D;  1ET9 A;  1PZK D;  4DXF A;  1CHQ D;  1LT4 D;  1PTO H;  2NTT A;  1TS3 A;  1CK1 A;  3BVZ A;  4C56 C;  2R61 A;  1LTB D;  1LLR D;  1D5Z C;  1PYW D;  1S5B D;  1I4H A;  1F77 A;  1RDP D;  4OHJ A;  1SJE D;  1LT6 D;  1RF2 D;  1TY2 A;  3MFG A;  3O13 A;  4RHR A;  2J4X A;  1BCP B;  1B44 D;  1LTI D;  1FNU A;  1DYQ A;  1PZJ D;  2RDH A;  4RH6 A;  3BYT B;  1RCV D;  1BCP C;  2XRS D;  4RCO A;  1ENF A;  5ELF A;  2XN9 C;  1SE3 A;  3TSS A;  4ZYS A;  1V1P A;  1STE A;  1SJH D;  3GP7 A;  2AQ3 B;  1ESF A;  2CHB D;  1CQV A;  1BCP D;  1HA5 A;  2XNA C;  1LTT D;  1TY0 A;  3BZD B;  3R2T A;  1PZI D;  1SE4 A; 
#chains in the Genus database with same CATH topology
 2A6H C;  4ABN A;  3J80 L;  1YHA A;  1IBM L;  1STN A;  4CKC A;  1VQE A;  1N9W A;  1XPU A;  2KCT A;  4Z9C B;  3U50 C;  4DR5 Q;  2WAQ G;  2UXD L;  2PZT A;  2IX0 A;  2K52 A;  4IOC A;  1SMY D;  4OO1 G;  2KCN A;  4A3L H;  1BUV T;  2PQA A;  1L1O B;  4N9T A;  2Z6K C;  2F0K A;  3PO2 G;  1KLG D;  3A5U A;  4A3B B;  2OT2 A;  1ET6 A;  3I4M B;  5HGQ A;  4ZUI A;  1RTN A;  3BZK A;  3JAM i;  1E24 A;  5DM6 3;  1L0X B;  3J81 E;  2SNM A;  3OPO A;  4A3B H;  3J7A F;  4Q5V A;  3I4M H;  3RN5 A;  1B7Y B;  4JI2 L;  3HOU G;  1YIT A;  4OIJ A;  1DXM A;  3UE1 A;  3UDF A;  5M3M B;  3PUZ A;  2H4O A;  4KD4 A;  4LF5 Q;  2NYZ D;  2WB1 G;  1QUQ A;  5EJW A;  1XMQ Q;  5IT9 c;  5JEA J;  2DY8 A;  2R92 G;  2IT1 A;  3T16 A;  4YWL A;  3ER0 A;  1E2W A;  2KUM A;  4GN5 A;  5M3M H;  4QCL A;  1K0S A;  2JQO A;  4DR3 Q;  1JR0 D;  1U4M A;  3I2Z A;  1SNP A;  2VUM G;  4JI3 Q;  3QOJ A;  3RLF A;  2RCN A;  2R7Z G;  1VQH A;  1HTP A;  2SEB D;  3ZYY X;  1KDA A;  1X3G A;  4NXM L;  4OO1 I;  3S1N B;  1K3R A;  1B50 A;  1MHW C;  1FL0 A;  4KHP Q;  2V1C C;  3K81 C;  1HNZ Q;  4JV5 L;  2LMC B;  3HOZ H;  2F0L A;  2F4V Q;  1H9S A;  4KKT A;  4DNR B;  3S2D B;  3TZU A;  4KTA A;  1DOK A;  5CC4 A;  2VY3 A;  1SNM A;  4JI6 Q;  3S1N H;  3HOY H;  1QJO A;  2UXB Q;  3BYT B;  1U0L A;  5EQ0 A;  2WB1 B;  4B3T Q;  1R4P B;  4ZRZ A;  5JAV A;  2D0P A;  5LMU L;  3CKI B;  2F0D A;  4DA2 A;  2KEN A;  3S2D H;  4MN3 A;  1T9H A;  5IYB H;  1EY7 A;  1HUM A;  1LYL A;  1E1O A;  2F3V A;  3BU2 A;  4CKE A;  2VUM B;  1FNW A;  2SNS A;  1E2Z A;  3UDX A;  4A3E B;  1GUG A;  4DV3 L;  4GLX A;  2AWN A;  3CP0 A;  5EPL A;  2EDG A;  3AYH B;  3K57 A;  1Z47 A;  5EBC A;  4DV1 Q;  4A3E H;  1X3P A;  1XTD A;  1K8A C;  4H13 C;  1EQV A;  1OXV A;  4JI4 L;  1SBB B;  2EYH A;  3K5N A;  4X66 L;  5LMN L;  3I91 A;  4OWW B;  4I7A A;  4YHH L;  3T13 A;  1VQM A;  2WB1 E;  1FGB D;  4KD3 A;  4QB4 A;  5JJL A;  2JN4 A;  2K4K A;  2A6E C;  2Z6B A;  1G6Z A;  3HKZ G;  1AE2 A;  5A35 A;  4G57 A;  5IOC A;  1SYF A;  3R2I A;  4X3S A;  3RZD B;  5FLX L;  3OHX C;  2CQA A;  3MAQ A;  4NMZ A;  2QIL A;  1K8G A;  3FDT A;  2NB0 A;  3J7Z C;  1XJV A;  4HED A;  3GTL H;  3M7G A;  1SND A;  1KD1 C;  4PZ8 A;  2ZTD A;  1S3O A;  2CW0 D;  3K6O A;  2KOL A;  3IL8 A;  4FNF A;  5DNF A;  3RZD H;  4R4T A;  2LKV A;  3CMA A;  4DAY B;  5D3I B;  4A3M G;  3U9O A;  4R1J A;  3Q0A A;  1QOH A;  2L4N A;  2MNA A;  5CBA E;  3QB3 A;  3I90 A;  2OF1 A;  3VR6 A;  2Y0S B;  4OWT B;  1GHJ A;  3QWN A;  1IBL L;  4IFD J;  1V1Q A;  3K0Y A;  3NTI A;  1KRT A;  2H1E A;  2F0I A;  1N34 L;  1QNU A;  2A5H A;  3H3V C;  3HOV B;  3BS1 A;  3KF6 B;  1UAP A;  3VA5 A;  1NMG A;  2RDH A;  3HOV H;  3C1F A;  4PZ7 A;  2Z0S A;  3S9W A;  1J5E L;  2A73 B;  3F8T A;  4R4O A;  3IAY A;  1ICF B;  2VB2 X;  3TS2 A;  3HOX G;  2RA4 A;  1LTT D;  3OIQ A;  5A2Q E;  3J81 i;  3S24 A;  4KJO A;  1WOC A;  1AP0 A;  1VQ8 A;  3C46 A;  1OXS C;  3HZX A;  4CJ2 C;  4BY1 G;  3MEF A;  1XNR L;  1PRT C;  3S1R B;  1ESR A;  3VDY A;  3PIP A;  4A4I A;  4C3J B;  4JVZ A;  3V2T A;  1KC8 C;  2EXZ A;  1KTK A;  2C5C A;  1E0B A;  4RKL A;  3CCV A;  1PH6 A;  2UUA L;  3D31 A;  3A8I E;  4BBS G;  1M4V A;  1GJX A;  4C3J H;  1TXY A;  2EJG C;  1WVL A;  3GV3 A;  5I6W A;  4P73 A;  4CJ1 B;  3JC6 6;  2NUC A;  4KKU A;  2E5L L;  4ZKB B;  4A3C G;  2WKC A;  1TKW B;  4B3R L;  3A0J A;  1UE7 A;  4GNX C;  4PZ6 A;  3GTJ B;  1E3P A;  2ENB A;  1TWG B;  4FXD A;  2EYO A;  5C4J B;  3OTO Q;  2JXM B;  2RSN A;  4DR6 L;  1SXT A;  1YNN C;  3N6R A;  3PUY A;  4DV6 L;  3NBH A;  4R9W A;  2Q2H A;  4K5X A;  4OX9 L;  3GTJ H;  3WOE A;  2E2I B;  1TWG H;  1WTO A;  3ERQ A;  5C4J H;  2O2L D;  2XIW A;  1VMP A;  3S15 B;  1B1Z A;  1ENA A;  4LF4 Q;  1Q8I A;  1IYV A;  1IXR A;  5K36 H;  1VF7 A;  4KY6 A;  2ZXO A;  4LNQ A;  3QO2 A;  1BO0 A;  4UPA A;  1R9T B;  2VL6 A;  4C56 C;  1IBK L;  2E2I H;  1GUW A;  4X3U A;  4IUV A;  4LF6 Q;  3I72 A;  4ZKC B;  5C5M A;  2PQE A;  4FO2 A;  4ME5 A;  3GTO B;  1F77 A;  4LFB Q;  2JA8 B;  3S15 H;  1LT6 D;  1RF2 D;  2PCF B;  4MTN A;  1GHK A;  4HN7 A;  4F88 A;  2PI2 A;  2JA7 B;  1R9T H;  5ELO A;  1NTG A;  4O0A A;  1ZEQ X;  3GTO H;  2JA8 H;  5C0X G;  4GOP B;  4RWS C;  1J8I A;  2QKI C;  3OWF A;  2WII B;  1VCI A;  3R2T A;  3AQQ A;  4LFC Q;  4DR7 L;  2PNH A;  3HG9 A;  2JA7 H;  3T56 B;  5T1I A;  3DWP A;  1EY6 A;  4FF3 A;  2ICI A;  1EIF A;  4WRD A;  2K50 A;  4POG A;  2MHV A;  4CDF C;  2PZU A;  3DHQ A;  2L11 A;  2HHH L;  3DM1 A;  3CF5 A;  2D0O A;  2MQH A;  4CDE C;  2BDO A;  4YCV A;  4JBJ A;  4IN3 A;  1B9M A;  3L2P A;  1B9N A;  2KHS A;  3T1H L;  4J1M A;  3PIO A;  1IBM Q;  1SLJ A;  4C3H B;  1KLU D;  1HTL D;  2F03 A;  2HQL A;  1WD1 A;  5ELC A;  3DEP A;  2JE6 I;  3A8K E;  3Q8D A;  4AYB B;  5C44 G;  2UXD Q;  4IQZ A;  3A7A B;  1F2L A;  4BXX G;  3Q6S A;  4X62 L;  1PTO B;  1YNN D;  3G4S A;  3S2H B;  4C3H H;  1EOT A;  5KGU A;  1IW7 D;  3CCS A;  1JJC B;  1PFS A;  2EYJ A;  3KK7 A;  4DV5 L;  3TP6 A;  4AQY L;  4R4I A;  4JYA L;  3RUZ A;  1JWS D;  1IL2 A;  2FXQ A;  3S2H H;  3PO3 B;  2AUK A;  2N8N A;  2B63 G;  3S1M B;  1MGS A;  2A68 C;  3A8J E;  5C0X I;  4JI2 Q;  2L1B A;  1ML0 D;  3CCM A;  5IP9 H;  1D1K A;  1SAP A;  5IOD A;  1ZYR D;  2M2L A;  3EFX D;  3PO3 H;  1EYC A;  4LMQ D;  4MHE A;  3S1M H;  5KRU A;  3CCU A;  1QIL A;  3QR8 A;  3R8B A;  4K6L A;  1Y1W G;  5C44 B;  1E22 A;  3EJI A;  2Z1C A;  1GKH A;  1KNE A;  4YWM A;  4V19 0;  4R8I A;  3H15 A;  1Q3L A;  1XYI A;  3LNN A;  3D4D A;  3E0E A;  2XVS A;  1OXU A;  3BVZ A;  5COR A;  1QCB D;  3W5O A;  3WOF A;  2PW7 A;  2ZT9 C;  4NPS A;  4EGV A;  4KY5 A;  3CD6 A;  4R4Q A;  1A8V A;  2I0Q A;  3D4W A;  4NXM Q;  1AEX A;  1YEZ A;  1HFG A;  5ELF A;  2DUD A;  4JV5 Q;  1RL2 A;  2E75 C;  3D3R A;  1L0W A;  1Q8K A;  1Y8N B;  4DK3 C;  2JA6 G;  2BCO A;  2IJ0 A;  1C9O A;  2HDM A;  2TSS A;  1B8A A;  1K83 B;  1Y1W B;  1AN8 A;  1JJG A;  3GO5 A;  2NN6 G;  3PSI A;  5LMU Q;  4DR2 L;  1TU2 B;  4GLA C;  2K28 A;  1TT2 A;  2ICE C;  2Q2U A;  2EYM A;  2K04 A;  1Z6H A;  5I9O A;  2P5Z X;  3IKJ A;  1FGU A;  4A3I B;  1K83 H;  2EVB A;  3KLW A;  4HIO A;  1XTC D;  2RVL A;  2OXP A;  5C4X B;  5FLM G;  1L1O C;  1UE1 A;  2OEO A;  4DV3 Q;  1AFP A;  3DWA A;  1JWM D;  1XMO L;  4A3I H;  2A68 D;  3TRZ A;  3KJO A;  2DJG C;  2NZ1 D;  4B3M L;  1CSQ A;  3CPW A;  1I6V C;  1OXT A;  5C4X H;  5IYC H;  1EU3 A;  1K8O A;  4JI4 Q;  2KCC A;  5IGG A;  3F2U A;  1HZA A;  3VR2 A;  4X66 Q;  1UUP A;  2N88 A;  4YIJ A;  2NBF A;  4JBW A;  1N32 L;  1EIY B;  1O7I A;  2AMC B;  2BA0 A;  5CR3 A;  4YHH Q;  1RJT A;  2JA9 A;  1U5K A;  2UUC L;  1H9K A;  4FF1 A;  2XRQ D;  2Q8I B;  2B2W A;  1HHV A;  3Q24 A;  3I4N B;  2HT1 A;  3PMF A;  2VS1 A;  3GTM B;  2AQ1 B;  4DV2 L;  4L5T A;  3GQB A;  2EY5 A;  2FHT A;  3PF4 A;  4BA2 I;  3HOW G;  4DV0 L;  5IWA L;  2JA5 G;  3VA7 A;  5FLX c;  1TS4 A;  2IHF A;  4RAU C;  1KIX A;  2K5N A;  2YTY A;  3I4N H;  2PQA B;  4A93 B;  3GTM H;  2NN6 I;  5C6A A;  3TZD A;  3GTG B;  4DXF A;  3CC7 A;  4F8M A;  4LUV A;  2WP8 J;  2LFN A;  4IUT A;  2FJ2 A;  2EXD A;  2BE5 C;  3H0G H;  4JC0 A;  2KCM A;  1I4H A;  3CCJ A;  3TS0 A;  4A3K H;  4A93 H;  2QEX A;  1PV4 A;  1PXU A;  3AFP A;  4HSP A;  3MFG A;  1X3Q A;  1X65 A;  3CCR A;  4QF4 A;  2RKS A;  3D6C A;  1B44 D;  3CRK C;  1KAA A;  2UUB L;  1IBL Q;  5COY A;  4DGZ A;  5M3F B;  4FXG C;  1RCV D;  4JI7 L;  2TMP A;  1N34 Q;  4HJ5 A;  5JOB A;  1O7Z A;  1H95 A;  4XYQ A;  1M8A A;  2F0J A;  2KA7 A;  1TY0 A;  3CAM A;  3V05 A;  1GD7 A;  2N3S A;  1VS0 A;  1SE4 A;  1QUQ B;  3NTH A;  5M3F H;  5EPK A;  3TP8 A;  1HNX L;  2J7Z A;  2M00 A;  4EQO A;  1J5E Q;  1UE5 A;  2RQX A;  1I5F A;  3DMU A;  1S72 A;  3E9H A;  5CV5 A;  3RD4 A;  4C3I B;  5FK9 C;  1NNX A;  4ZCK A;  1M90 C;  4XTC S;  1PFB A;  4A3G B;  4GKJ L;  1PH2 A;  5M5W B;  2ALY B;  4DNT B;  1DCZ A;  1WTR A;  1DJR D;  5IGF A;  1K3B C;  5AFW A;  2VZA A;  4C3I H;  4OGQ C;  4DUZ L;  3NE5 B;  2CFM A;  4OXP A;  1XNR Q;  1IHZ A;  2KQ3 A;  4A3G H;  1H9S B;  1BBU A;  1JCK B;  4G7Z C;  1G8Z D;  5M5W H;  4H44 C;  4MZ9 A;  3J80 E;  4DKA C;  2K33 A;  1G2S A;  1R4Q B;  3I56 A;  5M5Y B;  4P71 A;  3IFT A;  4UAI A;  3QOL A;  1I4G A;  1H9R A;  1B70 B;  2F0F A;  2LY7 A;  2F0Q A;  2UUA Q;  5C3W A;  3F1Z A;  1LTS D;  1KQS A;  5M5Y H;  4NW2 A;  2FMC A;  5C4Z A;  3ERS X;  3I70 A;  5BN5 A;  4OON A;  5CV8 A;  1LTL A;  1UEA B;  2QDL A;  2E5L Q;  1X9N A;  2EYL A;  2JEA I;  3CQZ B;  2GN5 A;  4B3R Q;  5IGE A;  2MO1 A;  2IHE A;  3FKI G;  3A54 A;  4DR6 Q;  3H6M A;  1QZG A;  4HID A;  1DGS A;  4B3S L;  5I9P A;  1IKM A;  1SNQ A;  1ET9 A;  1KNA A;  2XTI A;  2NVY B;  3CQZ H;  5E7N A;  4DV6 Q;  1EWI A;  4OX9 Q;  2WAQ B;  2E76 C;  2HIX A;  5CYU A;  1U4L A;  1RDP D;  3BDC A;  3TP7 A;  3VR4 A;  1A6X A;  3PO2 B;  4F7X A;  2NVY H;  3BZC A;  2L9H A;  1IBK Q;  1STH A;  1W3S A;  4ZYS A;  4OO1 H;  2HIV A;  4Q0F A;  3K58 A;  1BCP D;  1J9O A;  2EY2 A;  2XNA C;  3PO2 H;  1ONL A;  4CDC C;  1Y8P B;  2AWO A;  3EVQ A;  1A3U A;  3P20 A;  3VR3 A;  2ZJP A;  1SEB D;  2Q8T A;  5NUC A;  3OMC A;  3HOU B;  2A6H D;  4XQJ A;  3A7L A;  1EL0 A;  4DXG A;  2FMM A;  2EPB A;  2K7V A;  3D6W A;  4A75 A;  4JI8 Q;  1BCP F;  1FD7 D;  2D62 A;  3SK5 A;  4A3J G;  4DR7 Q;  2F0V A;  1WD0 A;  3VR5 A;  4DAV A;  3GDE A;  3CCQ A;  2WAQ E;  4WJW A;  4NKL A;  3HOU H;  2R92 B;  2HHH Q;  3NQI A;  1VQL A;  2OCE A;  5IE8 A;  3LWE A;  1VF5 C;  1VQA A;  5LMN W;  1SE2 A;  4XYO A;  4HJ9 A;  2R7Z B;  1E2V A;  4OIK A;  3T1H Q;  1EFI D;  5KYI A;  2R92 H;  3OW7 A;  4RGM A;  5FJ8 G;  2BOS A;  1RHP A;  5IGD A;  2K14 A;  5BN3 A;  5IGC A;  3G71 A;  1X55 A;  2VUM H;  3SEB A;  1PA6 A;  1X3F A;  2R7Z H;  4X62 Q;  2QW7 A;  4JI5 L;  3M7N A;  2R6G A;  4UP9 A;  4R4C A;  1DM0 B;  3DM3 A;  4DV5 Q;  5I6Y A;  4JYA Q;  2KHJ A;  2KBN A;  1JMC A;  2VQF L;  1KAB A;  3E3X A;  4CGY B;  1YNX A;  3MXU A;  1CSP A;  4IPC A;  4JK1 C;  3MC0 B;  3OMG A;  1EQT A;  2SDF A;  3TEH B;  2O4X A;  3G7L A;  5HY6 A;  1TS3 A;  5LHY 1;  4Y52 H;  5CMD A;  2DJF C;  3EIV A;  4A3D G;  5FLX E;  1S5B D;  3J7A 5;  1PDQ A;  1TY2 A;  2CVR A;  3CCE A;  3SHL A;  1D2B A;  2B8G A;  4CHT B;  3G6J B;  1TWH B;  3DEO A;  1I50 B;  4MIU A;  3W1B A;  4RH6 A;  4K14 A;  5FJ8 H;  3RN2 A;  1Q7Y C;  1G29 1;  3GTP B;  2XRS D;  2XN9 C;  5CGK A;  3J7Y W;  3PIP 3;  1Y14 B;  1VMC A;  2OQK A;  4H02 A;  4I65 A;  2AQ3 B;  4QL5 A;  3NPP A;  1S40 A;  3LGJ A;  2L12 A;  1WTH A;  3DUZ A;  1PZI D;  2GA4 B;  4GOP C;  1IYJ B;  1TWH H;  1LTA D;  1I50 H;  3HKZ B;  3R3O A;  2NVQ B;  3J80 i;  1JOO A;  3GTP H;  3NBH B;  5JVH 3;  1P8L A;  1F2Z A;  5M5X B;  4WOR A;  1PH4 A;  2BA1 A;  4IUP A;  2NVQ H;  2QEJ C;  2E74 C;  5JVG 3;  1LM0 A;  2Q8R E;  1TII D;  3JAM c;  3AFQ A;  3TBI B;  1K73 C;  1M1K C;  1Y69 U;  2B29 A;  5M5X H;  4C1N K;  1HA6 A;  1XPR A;  4PMW A;  4DR2 Q;  3M4Q A;  4PV1 C;  4G7H C;  4A3M B;  3M3Y B;  1NAP A;  1EY4 A;  4DR4 L;  4PQX A;  4B9X A;  2BH2 A;  1CKM A;  2AQ2 B;  5ELE A;  5CV9 A;  2MPM A;  1EQQ A;  4IPD A;  2IWH A;  1BKB A;  3J7A V;  1PTO C;  3OW2 A;  2MO0 A;  4LK1 C;  5IYD G;  4A3M H;  2A6E D;  2CWP A;  3STB C;  1VQJ A;  3HKZ E;  4EQP A;  1HJP A;  4LAA A;  5GAH C;  3KDF A;  3DXJ C;  3M85 A;  1XMO Q;  4R8N A;  3Q23 A;  1SN8 A;  4B3M Q;  5GRO A;  3SGI A;  4DV4 L;  1EQR A;  1CI3 M;  1J6Q A;  1BDO A;  4KN7 C;  1SNC A;  4HMJ A;  5D14 A;  3T53 B;  3EA6 A;  4MTK A;  1AE3 A;  3CPF A;  4RHS A;  2VB3 X;  2DNE A;  3NEN A;  4HJ7 A;  4LF8 L;  5IIF A;  4BY7 G;  3RR5 A;  1SNO A;  1EWC A;  3S1R H;  1N32 Q;  1VQG A;  2GVB A;  1MKH A;  1HCZ A;  2UUC Q;  2MJ8 A;  3HOX B;  3ULJ A;  2B2V A;  3NXW A;  2WFW A;  5EPJ A;  4DV2 Q;  4WJ3 M;  1ZXT A;  1OTC A;  1N33 L;  1CFM A;  1P16 A;  1PYS B;  4YWK A;  2R93 G;  2NTT A;  2PI2 E;  4DV0 Q;  1AZP A;  5IWA Q;  1LTB D;  2ZXR A;  1Q12 A;  3HOX H;  1AH9 A;  2IW3 A;  4BY1 B;  1WFQ A;  2C9O A;  4OHJ A;  4L5S A;  2B2W C;  5ELN A;  1MIU A;  2B2Y A;  4RHR A;  1NCV A;  4BBR G;  1BBX C;  4KHV A;  2EJF C;  3MA2 B;  2QDB A;  1ILP A;  1PZJ D;  5FO7 B;  1Q82 C;  1YZ6 A;  3K7U C;  4BY1 H;  5E4W C;  1DON A;  1G51 A;  5L37 A;  3PIO 3;  1SRO A;  5IT9 E;  4BY7 B;  2X69 A;  1F9Q A;  1EYA A;  2B3G A;  4BBS B;  4WFN 3;  1EUJ A;  2UUB Q;  4RKB A;  3PQI A;  3K80 C;  1Y1V G;  1YJ9 A;  3KBX A;  4JBK A;  2H5X A;  3HRZ C;  4JI7 Q;  3HGB A;  1JT8 A;  1C4Q A;  4X64 L;  4V0B A;  4LWC A;  1QG7 A;  4BBS H;  2KVM A;  3NP8 A;  3KLS A;  3UDI A;  1WTX A;  4OWX B;  4O1N A;  1D8L A;  3WWV A;  5E1F A;  1HNX Q;  1T5X D;  4A3C H;  4PG3 A;  3CU7 A;  1PRT D;  1RTO A;  2F0M A;  5HUR A;  4N8F A;  3BDL A;  3KLS X;  4DF7 A;  3NBI A;  5C3X A;  3U58 A;  4GKJ Q;  2F3W A;  3M4O B;  3H94 A;  4N9P A;  1BVS A;  1PRT F;  2XWB B;  4IUQ A;  2AUJ D;  1EU4 A;  1JJ2 A;  1FYC A;  1JC7 A;  2PYK A;  1JQY D;  1I4R A;  4OEL B;  4DUZ Q;  5J22 A;  1DZ1 A;  2OWO A;  1BF4 A;  2HUG A;  3L9A X;  4P2C B;  3PUW A;  2VW9 A;  4PMB A;  5F2D A;  2A1A A;  2F0E A;  3PF5 A;  1I4P A;  5IP7 G;  3BVG A;  4L5R C;  2D2C C;  3SK6 A;  3TRE A;  2CKZ B;  1G6P A;  1C0A A;  1CKO A;  3H3V I;  4Y7N B;  1HUN A;  4ME3 A;  2LXJ A;  1CZW A;  1V9P A;  1NY4 A;  1YNJ C;  4AH6 A;  4OEM B;  5C0X H;  1LT4 D;  1PTO H;  1PH9 A;  1G91 A;  2R61 A;  3VYT A;  1PH1 A;  1LLR D;  2KEC A;  5DAU A;  3T4A C;  1PYW D;  3ITP A;  4X65 L;  3KF8 A;  4Y7N H;  3FPP A;  1E7Z A;  2A74 C;  4B3S Q;  1LTI D;  4JOI A;  3FEW X;  1ILQ A;  3OYY A;  1C7Y A;  2K6A A;  3I7F A;  2EYF A;  3GTQ B;  3D0F A;  1Q1E A;  2I46 A;  1SJH D;  3J81 c;  3GP7 A;  1I6H B;  5JEA G;  4I7Z C;  4U68 A;  4LF9 L;  4A3F G;  3TME A;  2ES2 A;  1ENC A;  1FR3 A;  4B08 A;  4GZY C;  5C44 H;  1QVF A;  1I6H H;  4FVM A;  4BXX H;  2MGS A;  3U9S A;  2PMZ B;  1MI2 A;  5C3E G;  2B63 B;  4KHZ A;  1CKN A;  2VQE L;  3KFU A;  1LTG D;  1GOZ A;  3E9I A;  4DAM A;  3K5L A;  3MZ5 A;  4KK7 A;  4K8J A;  4QJF A;  3BYY B;  4FP5 D;  1VQK A;  2G5D A;  1N8R C;  3SVM A;  2GVA A;  4FDB A;  2B63 H;  2PZW A;  5ELD A;  3JAM L;  4S3S A;  1LO5 D;  1HXY D;  2DN8 A;  2PW5 A;  4EQN A;  3TP5 A;  5JJK A;  4K8I A;  3BVM A;  4HCS A;  4RFB A;  3S16 B;  1I4X A;  2LSS A;  4LF7 L;  4QY7 A;  5HGT A;  2ATW A;  4J6H A;  2D9U A;  3ND9 A;  1Y1W H;  4JI0 L;  3K7A B;  2JJQ A;  3HS0 C;  2K5V A;  3S16 H;  2A69 C;  5C4H A;  1CQF A;  3D8G A;  2PMZ E;  2LXK A;  1EZ8 A;  3K7A H;  5EAY A;  1LT3 D;  4CDD C;  5JJI A;  3P1H A;  3HFZ B;  1FJG L;  2JA6 B;  2F0S A;  4JI5 Q;  1PHJ A;  1JOK A;  4ID6 A;  3QG1 A;  3T51 B;  5LMN Q;  1B2T A;  1HPC A;  1MBY A;  4DUY L;  3L0O A;  4XIG S;  4ZK9 B;  1JB3 A;  2QA4 A;  2VQF Q;  2JA6 H;  3GV6 A;  3MEH A;  4XQN A;  4RG1 A;  2NVX B;  2OTL A;  1W2B A;  1X32 A;  1KXL A;  4TVA B;  4P75 A;  5CV4 A;  2NN6 H;  2JK8 A;  4IUU A;  4GNX A;  1U9R A;  4GS3 A;  4H7B A;  1HR0 L;  2J0T D;  5E4X A;  1V1P A;  4G7O C;  5KNB A;  1K9M C;  2PO4 A;  4ZLT F;  1Q81 C;  1WCM G;  2NVX H;  1CQV A;  2RCF A;  2R3Z A;  4HCE A;  3W1G A;  5CV6 A;  5FLM H;  1LT5 D;  3CXC A;  5KNC A;  5FOB B;  2Z9H A;  1MJE A;  1SMY C;  3DWQ A;  5ISR A;  4L63 B;  2E2H B;  4QQB X;  1HZC A;  4QUC A;  4IFD G;  4GLV B;  2ZM6 L;  4A76 A;  5FO8 B;  3GTG H;  3G48 A;  1Y8O B;  1PFN A;  4C1N I;  4NB3 A;  1HZB A;  2Q2T A;  1PVO A;  2ZJQ A;  2ID0 A;  4TSS A;  5FO9 B;  1EY8 A;  3CME A;  1LTR D;  3OSO A;  2Z4H A;  2E2H H;  1YJW A;  3HOW B;  1ICW A;  1EOV A;  1VQ7 A;  3MVV A;  2JA5 B;  1S5F D;  2XSC A;  4ZAI A;  2R7F A;  3TN2 A;  3ND8 A;  1WJJ A;  2JSO A;  1QE6 A;  2DGY A;  2YV5 A;  4DN4 M;  5KND A;  2YU9 B;  2EIF A;  1GUS A;  1I94 L;  4HIM A;  4IAL A;  2Q2I A;  4A3L G;  1O7Y A;  2MFI A;  1X56 A;  1ROD A;  3HOW H;  2QGQ A;  3U4V A;  2JA5 H;  1A63 A;  2F0P A;  1F9P A;  1K0R A;  4DR4 Q;  1D6E C;  2YTX A;  4J15 A;  1V8Q A;  5IY0 A;  4IO9 A;  2EYP A;  2YU9 H;  2EQS A;  1LV9 A;  4RMF A;  2ASB A;  1NR4 A;  2ZTC A;  1B3Q A;  1JE4 A;  5J3B A;  2F1M A;  2K1B A;  4GKK L;  4NP5 A;  5D3D A;  4A3B G;  2Z4I A;  4LFC L;  3I4M G;  2E2J B;  3KOJ A;  4LJZ C;  4IJH A;  1ZKO A;  3E0J A;  2KEE A;  3NSW A;  3M4P A;  4DV4 Q;  4RGO S;  4RGN A;  4XT1 B;  4IFD I;  3OWE B;  4LF8 Q;  4E6I A;  2E2J H;  1PLF A;  5J1Z A;  2F0W A;  4JPB W;  4KI0 A;  2NZH A;  5M9O A;  4JW0 A;  1PH5 A;  1CA5 A;  1EYG A;  5M3M G;  2BE5 D;  1STY A;  1EYD A;  1WYD A;  3HEJ A;  5EGT A;  3MXN A;  3RMH A;  1N33 Q;  1YHQ A;  3BJU A;  4RCO A;  1ENF A;  2UU9 L;  1B3A A;  4DV7 L;  1GUT A;  1U4P A;  1N36 L;  2B2V C;  2B2T A;  2V4D A;  1CUK A;  3QJY A;  4RA8 A;  3MFY A;  4WJ4 A;  1HA5 A;  2IX1 A;  3H09 A;  1VQB A;  2UXC L;  4IPG A;  4RGT A;  3HOZ G;  3AU7 A;  3J81 L;  1TR5 A;  3V96 A;  1S5C D;  4X3T A;  3ZJY C;  3MWY W;  4IJL A;  2O5J C;  5CV7 A;  1PYB A;  3I8Z A;  3HOY G;  5GQO A;  2B2Y C;  2FFK B;  1TVX A;  2QF7 A;  3KBG A;  1HNW L;  4LFA L;  5LL6 S;  1XX8 A;  3NEL A;  3SE0 A;  5KEE A;  2NWG A;  5LL6 X;  4H0L C;  4ZUJ A;  1PMR A;  2HD3 A;  4ALP A;  2BDN A;  3A74 A;  3T1Y L;  1LAB A;  2CH4 W;  5IYB G;  3EN2 A;  1PH8 A;  3FRP B;  5I4D A;  2K5Q A;  3SR1 A;  3KUP A;  4X64 Q;  2F0H A;  1MSG A;  3UDG A;  3FKI B;  2R7D A;  5AJ3 L;  1OXX K;  3ERO A;  1HZ9 A;  1V1O A;  2MUY A;  5JJZ A;  1KAW A;  4QGU A;  1STG A;  4K5W A;  2K75 A;  1GO3 E;  4M8A A;  4DFA A;  3HOZ B;  1TQO A;  3K5O A;  1VQ4 A;  2WV6 D;  3FKI H;  4A3E G;  5DLQ E;  4YY3 L;  3URY A;  2XGT A;  1F9R A;  3I73 A;  3GD7 A;  3HOY B;  1EEF D;  1CM9 A;  2CW0 C;  1QVG A;  1I3Q B;  2X6G A;  1PH3 A;  3L3O C;  1HH2 P;  2F0U A;  4HAE A;  1BR9 A;  4IOA A;  3X3M A;  1I4Q A;  3M9B A;  4EVO A;  4TQU S;  4JI1 L;  1XPO A;  4IPH A;  3C2P A;  5EKL A;  1BOS A;  4ODG A;  4OL7 A;  1YIJ A;  3VYU A;  4CKB A;  1A0I A;  1IKL A;  4UDU C;  1GUN A;  4GN3 B;  3RLO A;  2F0O A;  3E6Z X;  2QCP X;  2VXW A;  1I3Q H;  4QIW B;  1QNK A;  3R93 A;  2JEB I;  1JB7 A;  1CA6 A;  3SXH A;  1L1O A;  2IL8 A;  1KDB A;  1PZK D;  2HCI A;  2K32 A;  3Q22 A;  1O7L A;  1IZ6 A;  1EY5 A;  5E3F A;  1E1T A;  4A3J B;  2KJX A;  2OTJ A;  4DR1 L;  3PUV A;  1YI2 A;  3O13 A;  2F0N A;  1JIC A;  1XNQ L;  1BCP B;  4AQY Q;  4UHV A;  1UE6 A;  2F3I A;  1RIP A;  2RDF A;  4DK0 A;  2CH4 A;  1Q86 C;  1Z7T A;  4P72 A;  3TQY A;  4BS9 A;  3TSS A;  4X65 Q;  5EBD A;  4A3J H;  1HFN A;  3KDF B;  1STE A;  4KN4 C;  1BQQ T;  1ESF A;  3CC2 A;  2CHB D;  1OO9 B;  2EE1 A;  3NEM A;  1GM5 A;  3BZD B;  2RF4 A;  4K2L A;  1DOM A;  1II3 A;  4BWG B;  4UP7 A;  3SK4 A;  5FKA C;  2Y0S G;  3VYS A;  4QIW E;  4HJA A;  4DK6 C;  3KYH C;  2B2U A;  1QZH A;  5BR8 L;  2YTV A;  3LX0 A;  4LF9 Q;  4O2D A;  3HOV G;  1ASY A;  4JOI C;  3GTL B;  4K0K L;  2EOT A;  3K8A A;  5BN4 A;  3FHW A;  1KRS A;  3EQL C;  3A56 A;  4L6T B;  5I2Y A;  2CQO A;  3KLR A;  2CWA A;  1Q90 A;  4X3K A;  4AIM A;  2VQE Q;  1S5D D;  3PUX A;  1L2F A;  4EQ5 A;  3ONA B;  4FF2 A;  1SYD A;  4TRD A;  1A2T A;  2I5M X;  1VQP A;  1RKN A;  1JE5 A;  3MXP A;  1XXG A;  4A3D B;  1TS5 A;  2Z8L A;  4CBV A;  1FVI A;  1MD2 D;  4YCW A;  3MTS A;  2K01 A;  1A62 A;  2G9H D;  4PNY A;  1SR3 A;  3A5Z B;  3S1Q B;  2RBM A;  1D5X C;  2EY1 A;  1PFM A;  3CC4 A;  4LF7 Q;  1F2M A;  4A3D H;  1K8M A;  3W2D A;  3X3N A;  3EBE A;  4C3J G;  1O80 A;  5T1G A;  4JI0 Q;  1D7Q A;  4XQQ A;  3E5S A;  4FF4 A;  4DPG A;  3NTK A;  4NXN L;  2E8G A;  3ULP A;  1QVC A;  4P74 A;  3S1Q H;  4POF A;  4K2K A;  2PPB C;  3M3Y H;  4IUR A;  2I5L X;  5C5L A;  1C8C A;  5A2Q L;  2HQE A;  3F2D A;  1CHQ D;  1GUO A;  2E2D C;  4HIK A;  1QWY A;  1FJG Q;  1SJE D;  1SYB A;  1WTV A;  2Y0S E;  5GAE C;  2N78 A;  2OQ0 A;  4DUY Q;  1VQ6 A;  2Z6K A;  2KED A;  1WTW A;  1NJI C;  4MNO A;  5K36 G;  1MJC A;  1YJN A;  3S17 B;  4EX5 A;  3PGZ A;  1VQO A;  4DR5 L;  4DAP A;  2HCC A;  5EKK A;  1EFW A;  1F9S A;  2N55 A;  1LAC A;  2HDL A;  5ELB A;  3ULL A;  1VQI A;  1U4R A;  3S14 B;  3S17 H;  1HR0 Q;  3D4R A;  5I2X A;  1STB A;  4BA1 I;  2RHQ B;  4JCV E;  4DAY A;  1CHP D;  5K5P A;  2JA8 G;  5KYL A;  3S14 H;  5IYD H;  2JA7 G;  1SYE A;  4GN4 B;  5G3L D;  1S5E D;  3MXG A;  1UWV A;  3KF8 B;  4KLK A;  4APV A;  2ZM6 Q;  1NBW A;  3UI2 A;  2K05 A;  2IX3 A;  2WKD A;  3FMC A;  1IW7 C;  2K5H A;  4L8J A;  3KF6 A;  1H9M A;  4LF5 L;  3KJP A;  3ICE A;  4BY7 H;  1A3T A;  5IT9 L;  3PV0 A;  1EIG A;  2YYZ A;  1XMQ L;  2B8F A;  2R93 B;  5G3L F;  4K6D A;  1B4O A;  4QMG A;  1SYC A;  3UE0 A;  2RDG A;  2ZXP A;  1CTM A;  1PTO D;  5H1S E;  3N52 A;  4BBR B;  4DR3 L;  3STB D;  1I94 Q;  4JI3 L;  3HKS A;  2R93 H;  3M4Y A;  4LUO A;  1ZYR C;  2DNC A;  4C3H G;  3L7Z C;  1QB5 D;  1NSN S;  4KHP L;  4BBR H;  1PTO F;  3MHB A;  2ZJR A;  1HNZ L;  4AYB G;  2IPK D;  1CKN B;  2L55 A;  4LW1 A;  1HQR D;  4HSV A;  1SDF A;  4G4K A;  2F4V L;  1Y1V B;  4KKS A;  3CW2 C;  3SK8 A;  1WI5 A;  2WIN B;  4JI8 L;  4GKK Q;  2L0C A;  1CZG A;  4JI6 L;  2F52 A;  3IFD A;  3LWU A;  1KL9 A;  2UXB L;  2VNU D;  3M4O H;  1D5Z C;  4B3T L;  1BNZ A;  5CBE E;  5IP9 G;  1TWA B;  1Y1V H;  2DY7 A;  3PO3 G;  3H3V H;  1TWF B;  5JPM C;  2NVT B;  1SYG A;  1NR2 A;  1YHB A;  1SE3 A;  2I5H A;  3J80 c;  1TWA H;  3I4O A;  1A15 A;  2CCZ A;  2K5D A;  1C48 A;  1TWF H;  2AKW B;  2NVT H;  3P7J A;  4XXE A;  3NK9 A;  1G2T A;  4DV1 L;  2O5I C;  3GTK B;  1TS2 A;  1JOR A;  1YVC A;  2UU9 Q;  4DV7 Q;  1N36 Q;  1PRT B;  4HMI A;  4UP8 A;  1F2Y A;  3A55 A;  2UXC Q;  1EY0 A;  2FIN B;  2L15 A;  3I55 A;  5GAD C;  3GTK H;  5IGB A;  4KY7 A;  2MP1 A;  1TWC B;  4YCU A;  5J39 A;  4TKO B;  4F87 A;  2JP1 A;  3IRB A;  1SRU A;  2RHS B;  2B2T C;  4JG2 A;  1VQC A;  2BH8 A;  1HNW Q;  3GTQ H;  4LFA Q;  1SFO B;  3RNU A;  3C3L A;  1A2U A;  5DM7 3;  1DD2 A;  2F0T A;  1TWC H;  3NQT A;  3T1Y Q;  5IP7 H;  2AHO B;  1WTQ A;  4GNX B;  3WDN A;  4X6A H;  1V1P B;  5D65 A;  4AYB E;  1SFO H;  5GAG C;  3F2B A;  5AJ3 Q;  1L0Y B;  1AW7 A;  4GOP A;  3I4L A;  4DK1 A;  1S4Z A;  3OIP A;  4RCN A;  3CHB D;  3FVQ A;  2G9D A;  4A3I G;  1JWU D;  4CJ0 B;  3CCL A;  4B9W A;  5IYC G;  5C4X G;  4M1U B;  2A8V A;  3NWS A;  4YY3 Q;  3K0X A;  3JAM E;  4A3F B;  4KV6 A;  1JOQ A;  1EY9 A;  1VQ5 A;  3H91 A;  4KMU C;  1BXT A;  3TDQ A;  1SE8 A;  2WAC A;  1V43 A;  4XT3 B;  3FPU B;  1B53 A;  1K28 A;  1WTP A;  4L5Q A;  4HR7 B;  4JI1 Q;  4JBM A;  1VDZ A;  3RZO B;  5JEA H;  1A3V A;  2EJM A;  1CK1 A;  4A3F H;  4QUF A;  2KHI A;  1YNJ D;  4N8X 1;  1EIH A;  1X54 A;  3HP3 A;  5C3E B;  3AEV A;  1VQN A;  3W3A A;  1HRJ A;  4HTH A;  2J4X A;  3RLN A;  3RZO H;  2A19 A;  1FNU A;  4FYD A;  3I4N G;  1X6O A;  1DYQ A;  5C3E H;  4UY8 C;  1HR0 W;  3K59 A;  1EZ6 A;  4DR1 Q;  2JYO A;  3FP9 A;  1XNQ Q;  1KHI A;  3H0G G;  4A3K G;  1IYU A;  1NE3 A;  4A93 G;  5TSS A;  2I07 B;  2IY5 B;  1UEB A;  3PCO B;  1O78 A;  1RD9 D;  2K03 A;  4K5V A;  4O42 A;  1EEI D;  3C1E A;  4U67 3;  1VQD A;  4IZ8 A;  2F0G A;  4FXK C;  3P75 A;  2M9V A;  2B39 A;  1Z9F A;  1GXD C;  5M3F G;  5JPN C;  5BR8 Q;  1VQ9 A;  3J81 j;  3QIA A;  4K0K Q;  1STA A;  2N49 A;  2XWJ B;  3K5M A;  3U4Z A;  1KDC A;  3CRL C;  3OTO L;  3BDO A;  2PNR C;  3MXN B;  5DEH A;  1UNS A;  2B2U C;  1DOL A;  2K5W A;  3H0G B;  4A3K B;  3OOC A;  3AB9 A;  1XWE A;  2ZTE A;  2X6L A;  1PH7 A;  4DU9 A;  4ZQ3 A;  1GVP A;  2NTS A;  1BBW A;  2SOB A;  3VYR A;  4C3I G;  3NHH A;  1VQF A;  4A3G G;  4LF4 L;  1SMX A;  4ULL A;  4XDX A;  5KIX A;  1IL8 A;  1X3E A;  1SSO A;  2A69 D;  1FNV A;  3I3C A;  4PMC A;  4HJ8 A;  1AZQ A;  2F4I A;  1WCM B;  4LF6 L;  4ILW A;  4LUZ A;  4LFB L;  1D5M C;  2NZO A;  1NMF A;  1NUC A;  1CT1 D;  1LUZ A;  1W6J A;  4DNI A;  4C2M B;  1WCM H;  4KJN A;  4NDX A;  1EWH A;  2L5T A;  4IUN A;  1YBY A;  4J8Q A;  5C0X J;  4NXN Q;  3G6E A;  2RSO A;  3AMU A;  1H9J A;  1Q1B A;  1HQM C;  3SDZ A;  3DLL A;  2LS0 1;  4C2M H;  2EZV A;  4IFD H;  1T5E A;  1ASZ A;  1BCP C;  1W6K A;  3NUC A;  2C35 B;  3BG3 A;  3B6Y A;  3F2C A;  1Q46 A;  5EKI A;  1D1I A;  3NWT A;  2EY6 A;  2D5D A;  1MSH A; 
#chains in the Genus database with same CATH homology
 2A6H C;  4ABN A;  3J80 L;  1STN A;  4CKC A;  4Z9C B;  2PZT A;  2IX0 A;  4OO1 G;  1SMY D;  2KCN A;  1BUV T;  4N9T A;  2F0K A;  1KLG D;  4A3B B;  2OT2 A;  1ET6 A;  3I4M B;  4ZUI A;  1RTN A;  5DM6 3;  1L0X B;  3J81 E;  2SNM A;  3OPO A;  3J7A F;  4Q5V A;  4OIJ A;  1DXM A;  5M3M B;  3PUZ A;  2H4O A;  4KD4 A;  2NYZ D;  5EJW A;  5JEA J;  2DY8 A;  2IT1 A;  3T16 A;  1E2W A;  2KUM A;  4QCL A;  1JR0 D;  1U4M A;  1SNP A;  3QOJ A;  3RLF A;  1HTP A;  2SEB D;  3ZYY X;  1KDA A;  4OO1 I;  3S1N B;  1B50 A;  2LMC B;  2F0L A;  1H9S A;  4KKT A;  4DNR B;  3S2D B;  3TZU A;  4KTA A;  1DOK A;  5CC4 A;  1SNM A;  1QJO A;  3BYT B;  5EQ0 A;  2WB1 B;  1R4P B;  4ZRZ A;  5JAV A;  3CKI B;  2F0D A;  4DA2 A;  4MN3 A;  1EY7 A;  1HUM A;  2F3V A;  4CKE A;  2VUM B;  1FNW A;  2SNS A;  1E2Z A;  4A3E B;  1GUG A;  2AWN A;  5EPL A;  2EDG A;  3K57 A;  1Z47 A;  5EBC A;  1X3P A;  4H13 C;  1EQV A;  1OXV A;  1SBB B;  2EYH A;  3K5N A;  3I91 A;  3T13 A;  1FGB D;  4KD3 A;  4QB4 A;  2A6E C;  1G6Z A;  5A35 A;  4G57 A;  5IOC A;  1SYF A;  3R2I A;  4X3S A;  3RZD B;  5FLX L;  3OHX C;  2CQA A;  3MAQ A;  4NMZ A;  2QIL A;  3FDT A;  2NB0 A;  4HED A;  3M7G A;  1SND A;  2CW0 D;  3K6O A;  2KOL A;  3IL8 A;  4FNF A;  5DNF A;  2LKV A;  5D3I B;  3U9O A;  3Q0A A;  1QOH A;  2L4N A;  5CBA E;  3QB3 A;  3I90 A;  2OF1 A;  3VR6 A;  2Y0S B;  1GHJ A;  3QWN A;  4IFD J;  3K0Y A;  3NTI A;  2H1E A;  2F0I A;  3HOV B;  1QNU A;  2A5H A;  3H3V C;  3BS1 A;  1UAP A;  3VA5 A;  2RDH A;  3C1F A;  3S9W A;  2A73 B;  3IAY A;  2VB2 X;  2RA4 A;  1LTT D;  3OIQ A;  5A2Q E;  4KJO A;  1AP0 A;  3C46 A;  1OXS C;  3HZX A;  4CJ2 C;  1PRT C;  3S1R B;  1ESR A;  4C3J B;  3V2T A;  2EXZ A;  1KTK A;  2C5C A;  1E0B A;  4RKL A;  3D31 A;  3A8I E;  1M4V A;  1GJX A;  2EJG C;  1WVL A;  3GV3 A;  5I6W A;  4CJ1 B;  2NUC A;  4KKU A;  4ZKB B;  2WKC A;  1TKW B;  3GTJ B;  2ENB A;  1TWG B;  4FXD A;  2EYO A;  5C4J B;  2JXM B;  2RSN A;  1SXT A;  1YNN C;  3N6R A;  3PUY A;  3NBH A;  4R9W A;  4K5X A;  3WOE A;  2E2I B;  1WTO A;  3ERQ A;  2O2L D;  2XIW A;  1VMP A;  3S15 B;  1B1Z A;  1ENA A;  1Q8I A;  1IYV A;  5K36 H;  1VF7 A;  4KY6 A;  2ZXO A;  3QO2 A;  1BO0 A;  1R9T B;  4C56 C;  1GUW A;  4X3U A;  4IUV A;  3I72 A;  4ZKC B;  5C5M A;  2PQE A;  4FO2 A;  4ME5 A;  3GTO B;  1F77 A;  2JA8 B;  1LT6 D;  1RF2 D;  2PCF B;  1GHK A;  4HN7 A;  4F88 A;  2JA7 B;  1ZEQ X;  5C0X G;  4RWS C;  1J8I A;  2QKI C;  3OWF A;  2WII B;  1VCI A;  3R2T A;  3HG9 A;  3T56 B;  5T1I A;  3DWP A;  1EY6 A;  4FF3 A;  2ICI A;  4WRD A;  2MHV A;  2PZU A;  3DHQ A;  2L11 A;  3DM1 A;  2BDO A;  4IN3 A;  1B9M A;  1B9N A;  2KHS A;  4J1M A;  4C3H B;  1KLU D;  1HTL D;  2F03 A;  1WD1 A;  5ELC A;  3DEP A;  2JE6 I;  3A8K E;  4AYB B;  4IQZ A;  3A7A B;  1F2L A;  3Q6S A;  1PTO B;  1YNN D;  3S2H B;  1EOT A;  5KGU A;  1IW7 D;  2EYJ A;  3KK7 A;  3TP6 A;  3RUZ A;  1JWS D;  3PO3 B;  2AUK A;  3S1M B;  1MGS A;  2A68 C;  3A8J E;  5C0X I;  2L1B A;  1ML0 D;  1D1K A;  5IOD A;  1SAP A;  1ZYR D;  2M2L A;  3EFX D;  1EYC A;  4LMQ D;  4MHE A;  5KRU A;  1QIL A;  3R8B A;  4K6L A;  5C44 B;  3EJI A;  2Z1C A;  1KNE A;  4V19 0;  4R8I A;  1Q3L A;  1XYI A;  3LNN A;  3D4D A;  2XVS A;  1OXU A;  3BVZ A;  5COR A;  1QCB D;  3WOF A;  2PW7 A;  2ZT9 C;  4EGV A;  4KY5 A;  3D4W A;  1AEX A;  1HFG A;  5ELF A;  2E75 C;  3D3R A;  1Y8N B;  2BCO A;  2IJ0 A;  2HDM A;  2TSS A;  1K83 B;  1Y1W B;  1AN8 A;  3GO5 A;  2NN6 G;  1TU2 B;  2K28 A;  1TT2 A;  2ICE C;  2EYM A;  2K04 A;  1Z6H A;  5I9O A;  3IKJ A;  4A3I B;  2EVB A;  1XTC D;  2RVL A;  2OXP A;  5C4X B;  2OEO A;  1AFP A;  3DWA A;  1JWM D;  2A68 D;  2NZ1 D;  1I6V C;  1OXT A;  1EU3 A;  1K8O A;  2KCC A;  5IGG A;  3F2U A;  3VR2 A;  1UUP A;  2N88 A;  4YIJ A;  2NBF A;  4JBW A;  2BA0 A;  5CR3 A;  1RJT A;  1H9K A;  4FF1 A;  2XRQ D;  2Q8I B;  2B2W A;  1HHV A;  3Q24 A;  3I4N B;  3PMF A;  3GTM B;  2AQ1 B;  3GQB A;  2EY5 A;  2FHT A;  4BA2 I;  3VA7 A;  1TS4 A;  4RAU C;  4A93 B;  2NN6 I;  5C6A A;  3TZD A;  3GTG B;  4DXF A;  4F8M A;  2WP8 J;  2LFN A;  4IUT A;  2FJ2 A;  2BE5 C;  1I4H A;  1PXU A;  4HSP A;  3MFG A;  1X3Q A;  4QF4 A;  2RKS A;  3D6C A;  1B44 D;  3CRK C;  1KAA A;  5COY A;  4DGZ A;  5M3F B;  4FXG C;  1RCV D;  2TMP A;  5JOB A;  1O7Z A;  4XYQ A;  1M8A A;  2F0J A;  2KA7 A;  1TY0 A;  3V05 A;  1SE4 A;  3NTH A;  5EPK A;  3TP8 A;  2J7Z A;  2M00 A;  4EQO A;  2RQX A;  3DMU A;  5CV5 A;  3RD4 A;  4C3I B;  5FK9 C;  4XTC S;  1PFB A;  4A3G B;  5M5W B;  4DNT B;  1DCZ A;  1WTR A;  1DJR D;  5IGF A;  5AFW A;  4OGQ C;  3NE5 B;  1IHZ A;  2KQ3 A;  1H9S B;  1JCK B;  4G7Z C;  1G8Z D;  4H44 C;  3J80 E;  2K33 A;  1G2S A;  1R4Q B;  5M5Y B;  3IFT A;  4UAI A;  3QOL A;  1I4G A;  1H9R A;  2F0F A;  2LY7 A;  2F0Q A;  5C3W A;  1LTS D;  4NW2 A;  2FMC A;  5C4Z A;  3I70 A;  5BN5 A;  5CV8 A;  1UEA B;  2EYL A;  2JEA I;  3CQZ B;  5IGE A;  3A54 A;  3H6M A;  5I9P A;  1IKM A;  1SNQ A;  1ET9 A;  1KNA A;  2NVY B;  2WAQ B;  2E76 C;  5CYU A;  1U4L A;  1RDP D;  3BDC A;  3TP7 A;  3VR4 A;  1A6X A;  3PO2 B;  4F7X A;  2L9H A;  1STH A;  4ZYS A;  4OO1 H;  4Q0F A;  3K58 A;  1BCP D;  1J9O A;  2EY2 A;  2XNA C;  1ONL A;  1Y8P B;  2AWO A;  3EVQ A;  1A3U A;  3P20 A;  3VR3 A;  1SEB D;  2Q8T A;  5NUC A;  3OMC A;  3HOU B;  2A6H D;  4XQJ A;  3A7L A;  1EL0 A;  4DXG A;  2FMM A;  2EPB A;  2K7V A;  3D6W A;  1BCP F;  1FD7 D;  2D62 A;  3SK5 A;  2F0V A;  1WD0 A;  3VR5 A;  4DAV A;  4WJW A;  4NKL A;  2R92 B;  3NQI A;  3LWE A;  1VF5 C;  1SE2 A;  4XYO A;  2R7Z B;  1E2V A;  4OIK A;  1EFI D;  5KYI A;  3OW7 A;  4RGM A;  2BOS A;  1RHP A;  5IGD A;  5BN3 A;  5IGC A;  3SEB A;  3M7N A;  2R6G A;  1DM0 B;  5I6Y A;  1KAB A;  4CGY B;  3MXU A;  4JK1 C;  3MC0 B;  3OMG A;  1EQT A;  2SDF A;  2O4X A;  3G7L A;  5LHY 1;  1TS3 A;  5CMD A;  5FLX E;  1S5B D;  1PDQ A;  1TY2 A;  2CVR A;  3SHL A;  1D2B A;  2B8G A;  4CHT B;  3G6J B;  1TWH B;  3DEO A;  1I50 B;  4MIU A;  4RH6 A;  4K14 A;  1G29 1;  3GTP B;  2XRS D;  2XN9 C;  5CGK A;  3J7Y W;  3PIP 3;  1VMC A;  4I65 A;  2AQ3 B;  3NPP A;  2L12 A;  2GA4 B;  1PZI D;  3DUZ A;  1LTA D;  3HKZ B;  3R3O A;  2NVQ B;  1JOO A;  5JVH 3;  1F2Z A;  5M5X B;  4WOR A;  2BA1 A;  4IUP A;  2QEJ C;  2E74 C;  5JVG 3;  2Q8R E;  1TII D;  3TBI B;  1Y69 U;  4C1N K;  1HA6 A;  4PMW A;  4PV1 C;  4G7H C;  4A3M B;  3M3Y B;  1NAP A;  1EY4 A;  4PQX A;  4B9X A;  2AQ2 B;  5ELE A;  5CV9 A;  2MPM A;  2IWH A;  3J7A V;  1PTO C;  4LK1 C;  2A6E D;  4EQP A;  3M85 A;  4LAA A;  3DXJ C;  4R8N A;  3Q23 A;  5D14 A;  1CI3 M;  1BDO A;  4KN7 C;  1SNC A;  4HMJ A;  3T53 B;  3EA6 A;  4RHS A;  2VB3 X;  2DNE A;  5IIF A;  1SNO A;  1EWC A;  1HCZ A;  2MJ8 A;  3HOX B;  2B2V A;  3NXW A;  5EPJ A;  1ZXT A;  1CFM A;  2NTT A;  1AZP A;  1LTB D;  2ZXR A;  1Q12 A;  2IW3 A;  4BY1 B;  2C9O A;  4OHJ A;  2B2W C;  2B2Y A;  4RHR A;  1NCV A;  1BBX C;  4KHV A;  2EJF C;  3MA2 B;  2QDB A;  1ILP A;  1PZJ D;  5FO7 B;  5E4W C;  1DON A;  3PIO 3;  5IT9 E;  4BY7 B;  2X69 A;  1F9Q A;  1EYA A;  4BBS B;  4WFN 3;  4RKB A;  3KBX A;  3HRZ C;  3HGB A;  1C4Q A;  4V0B A;  1QG7 A;  2KVM A;  3NP8 A;  3KLS A;  1WTX A;  4O1N A;  5E1F A;  1T5X D;  3CU7 A;  1PRT D;  1RTO A;  2F0M A;  5HUR A;  3BDL A;  3KLS X;  4DF7 A;  3NBI A;  5C3X A;  2F3W A;  3M4O B;  3H94 A;  4N9P A;  2XWB B;  1PRT F;  4IUQ A;  2AUJ D;  1EU4 A;  1FYC A;  1JC7 A;  2PYK A;  1JQY D;  1I4R A;  5J22 A;  1DZ1 A;  1BF4 A;  2HUG A;  3L9A X;  4P2C B;  3PUW A;  4PMB A;  5F2D A;  2F0E A;  1I4P A;  3BVG A;  2D2C C;  3SK6 A;  4Y7N B;  1HUN A;  1CZW A;  1YNJ C;  5C0X H;  1LT4 D;  1PTO H;  1G91 A;  2R61 A;  3VYT A;  1LLR D;  2KEC A;  5DAU A;  3T4A C;  1PYW D;  3ITP A;  3KF8 A;  3FPP A;  2A74 C;  1LTI D;  3FEW X;  1ILQ A;  2K6A A;  2EYF A;  3GTQ B;  1Q1E A;  2I46 A;  1SJH D;  3GP7 A;  1I6H B;  5JEA G;  4I7Z C;  4U68 A;  3TME A;  1ENC A;  1FR3 A;  4B08 A;  4GZY C;  4FVM A;  2MGS A;  3U9S A;  2PMZ B;  1MI2 A;  2B63 B;  4KHZ A;  1LTG D;  1GOZ A;  3K5L A;  3MZ5 A;  4KK7 A;  4K8J A;  3BYY B;  4FP5 D;  3SVM A;  2PZW A;  5ELD A;  3JAM L;  4S3S A;  1LO5 D;  1HXY D;  2DN8 A;  2PW5 A;  4EQN A;  3TP5 A;  4K8I A;  3BVM A;  4HCS A;  4RFB A;  3S16 B;  1I4X A;  5HGT A;  4J6H A;  2D9U A;  3ND9 A;  3K7A B;  3HS0 C;  2A69 C;  5C4H A;  1CQF A;  3D8G A;  1EZ8 A;  1LT3 D;  3P1H A;  2JA6 B;  2F0S A;  1JOK A;  4ID6 A;  3QG1 A;  3T51 B;  1B2T A;  1HPC A;  1MBY A;  4XIG S;  4ZK9 B;  1JB3 A;  3GV6 A;  3MEH A;  4XQN A;  2NVX B;  1X32 A;  5CV4 A;  2NN6 H;  4IUU A;  1U9R A;  4H7B A;  2J0T D;  5E4X A;  1V1P A;  4G7O C;  5KNB A;  2PO4 A;  4ZLT F;  1CQV A;  2R3Z A;  4HCE A;  5CV6 A;  1LT5 D;  5KNC A;  5FOB B;  1SMY C;  3DWQ A;  5ISR A;  4L63 B;  2E2H B;  4QUC A;  4IFD G;  5FO8 B;  1Y8O B;  1PFN A;  4C1N I;  2ID0 A;  4TSS A;  5FO9 B;  1EY8 A;  1LTR D;  3OSO A;  2Z4H A;  3HOW B;  1ICW A;  3MVV A;  2JA5 B;  1S5F D;  2XSC A;  4ZAI A;  3TN2 A;  3ND8 A;  2JSO A;  1QE6 A;  4DN4 M;  5KND A;  2YU9 B;  1GUS A;  4IAL A;  1O7Y A;  1ROD A;  2F0P A;  1F9P A;  1D6E C;  1V8Q A;  2EYP A;  1LV9 A;  1NR4 A;  1JE4 A;  2F1M A;  2K1B A;  4NP5 A;  5D3D A;  2Z4I A;  2E2J B;  4LJZ C;  1ZKO A;  3E0J A;  2KEE A;  3NSW A;  4RGO S;  4RGN A;  4XT1 B;  4IFD I;  3OWE B;  4E6I A;  1PLF A;  5J1Z A;  2F0W A;  4KI0 A;  5M9O A;  1CA5 A;  2BE5 D;  1STY A;  1EYD A;  3HEJ A;  5EGT A;  3MXN A;  3RMH A;  4RCO A;  1ENF A;  1B3A A;  1GUT A;  1U4P A;  2B2V C;  2B2T A;  2V4D A;  3QJY A;  4RA8 A;  3MFY A;  1HA5 A;  2IX1 A;  3H09 A;  4RGT A;  3AU7 A;  3J81 L;  1TR5 A;  3V96 A;  1S5C D;  4X3T A;  3MWY W;  2O5J C;  5CV7 A;  3I8Z A;  2B2Y C;  2FFK B;  1TVX A;  2QF7 A;  3KBG A;  5LL6 S;  1XX8 A;  3SE0 A;  5KEE A;  2NWG A;  5LL6 X;  4H0L C;  4ZUJ A;  1PMR A;  2BDN A;  1LAB A;  3FRP B;  5I4D A;  2K5Q A;  3SR1 A;  3KUP A;  2F0H A;  1MSG A;  3FKI B;  1OXX K;  3ERO A;  1V1O A;  2MUY A;  5JJZ A;  1STG A;  4K5W A;  4M8A A;  4DFA A;  3HOZ B;  1TQO A;  3K5O A;  2WV6 D;  3URY A;  1F9R A;  3I73 A;  3GD7 A;  3HOY B;  1EEF D;  1CM9 A;  2CW0 C;  1I3Q B;  2X6G A;  3L3O C;  2F0U A;  4HAE A;  1BR9 A;  3X3M A;  1I4Q A;  4EVO A;  4TQU S;  3C2P A;  5EKL A;  1BOS A;  4ODG A;  4OL7 A;  3VYU A;  4CKB A;  1IKL A;  4UDU C;  1GUN A;  2F0O A;  3E6Z X;  2QCP X;  2VXW A;  4QIW B;  3R93 A;  1QNK A;  2JEB I;  1CA6 A;  3SXH A;  2IL8 A;  1PZK D;  1KDB A;  2HCI A;  2K32 A;  3Q22 A;  1O7L A;  1EY5 A;  5E3F A;  4A3J B;  2KJX A;  3PUV A;  3O13 A;  2F0N A;  1JIC A;  1BCP B;  2RDF A;  4DK0 A;  1Z7T A;  4BS9 A;  3TSS A;  1HFN A;  5EBD A;  4KN4 C;  1STE A;  1BQQ T;  1ESF A;  2CHB D;  1OO9 B;  2EE1 A;  3BZD B;  4K2L A;  1DOM A;  1II3 A;  4BWG B;  3SK4 A;  5FKA C;  3VYS A;  2B2U A;  3LX0 A;  3GTL B;  2EOT A;  5BN4 A;  3EQL C;  4L6T B;  3A56 A;  5I2Y A;  3KLR A;  1Q90 A;  4X3K A;  1S5D D;  3PUX A;  3ONA B;  4FF2 A;  1SYD A;  4TRD A;  1A2T A;  1RKN A;  3MXP A;  1XXG A;  4A3D B;  1TS5 A;  2Z8L A;  4CBV A;  1MD2 D;  3MTS A;  2K01 A;  2G9H D;  4PNY A;  3S1Q B;  2RBM A;  1D5X C;  2EY1 A;  1PFM A;  1F2M A;  1K8M A;  3W2D A;  3X3N A;  4C3J G;  1O80 A;  5T1G A;  4XQQ A;  3E5S A;  4FF4 A;  3NTK A;  4K2K A;  2PPB C;  4IUR A;  5C5L A;  1C8C A;  5A2Q L;  2HQE A;  1CHQ D;  1GUO A;  2E2D C;  1QWY A;  1SJE D;  1SYB A;  1WTV A;  2KED A;  1WTW A;  5K36 G;  3S17 B;  4DAP A;  2HCC A;  5EKK A;  1F9S A;  2N55 A;  1LAC A;  2HDL A;  5ELB A;  1U4R A;  3S14 B;  3D4R A;  5I2X A;  1STB A;  4BA1 I;  4DAY A;  1CHP D;  5K5P A;  5KYL A;  1SYE A;  5G3L D;  1S5E D;  3MXG A;  3UI2 A;  2K05 A;  2IX3 A;  2WKD A;  3FMC A;  1IW7 C;  4L8J A;  1H9M A;  1A3T A;  5IT9 L;  3PV0 A;  1EIG A;  2YYZ A;  2B8F A;  2R93 B;  5G3L F;  4K6D A;  1B4O A;  4QMG A;  1SYC A;  2RDG A;  2ZXP A;  1CTM A;  1PTO D;  3N52 A;  4BBR B;  3M4Y A;  1ZYR C;  2DNC A;  4C3H G;  3L7Z C;  1QB5 D;  1NSN S;  1PTO F;  3MHB A;  2IPK D;  2L55 A;  1HQR D;  4HSV A;  1SDF A;  4G4K A;  1Y1V B;  4KKS A;  3SK8 A;  2WIN B;  2L0C A;  1CZG A;  3IFD A;  3LWU A;  2VNU D;  1D5Z C;  1BNZ A;  5CBE E;  1TWA B;  2DY7 A;  1TWF B;  5JPM C;  2NVT B;  1SYG A;  1NR2 A;  1SE3 A;  1A15 A;  2K5D A;  1C48 A;  3P7J A;  4XXE A;  3NK9 A;  1G2T A;  2O5I C;  3GTK B;  1TS2 A;  1JOR A;  1PRT B;  4HMI A;  1F2Y A;  3A55 A;  1EY0 A;  2FIN B;  5IGB A;  4KY7 A;  2MP1 A;  1TWC B;  5J39 A;  4TKO B;  4F87 A;  2JP1 A;  2B2T C;  1SFO B;  3C3L A;  1A2U A;  5DM7 3;  1DD2 A;  2F0T A;  3NQT A;  1WTQ A;  3WDN A;  1V1P B;  5D65 A;  1L0Y B;  1AW7 A;  3I4L A;  4DK1 A;  1S4Z A;  3OIP A;  4RCN A;  3CHB D;  3FVQ A;  2G9D A;  1JWU D;  4CJ0 B;  4B9W A;  4M1U B;  3NWS A;  4A3F B;  3JAM E;  1JOQ A;  4KV6 A;  1EY9 A;  3H91 A;  4KMU C;  1BXT A;  3TDQ A;  2WAC A;  1V43 A;  4XT3 B;  3FPU B;  1B53 A;  1WTP A;  3RZO B;  4HR7 B;  1VDZ A;  5JEA H;  1A3V A;  2EJM A;  1CK1 A;  4QUF A;  1YNJ D;  1EIH A;  3HP3 A;  5C3E B;  3W3A A;  1HRJ A;  4HTH A;  2J4X A;  4FYD A;  1FNU A;  1DYQ A;  3K59 A;  1EZ6 A;  2JYO A;  1IYU A;  5TSS A;  2I07 B;  1O78 A;  1RD9 D;  2K03 A;  4K5V A;  4O42 A;  1EEI D;  3C1E A;  4U67 3;  4IZ8 A;  2F0G A;  4FXK C;  3P75 A;  2M9V A;  2B39 A;  1GXD C;  5JPN C;  3QIA A;  1STA A;  2XWJ B;  3K5M A;  1KDC A;  3CRL C;  3BDO A;  2PNR C;  5DEH A;  1UNS A;  2B2U C;  1DOL A;  2K5W A;  3H0G B;  4A3K B;  3OOC A;  3AB9 A;  1XWE A;  2X6L A;  4DU9 A;  4ZQ3 A;  2NTS A;  2SOB A;  3VYR A;  4C3I G;  3NHH A;  4ULL A;  4XDX A;  5KIX A;  1IL8 A;  1SSO A;  2A69 D;  1FNV A;  3I3C A;  4PMC A;  1AZQ A;  2F4I A;  1WCM B;  4ILW A;  1D5M C;  1NUC A;  1CT1 D;  1W6J A;  4C2M B;  4KJN A;  4NDX A;  1EWH A;  2L5T A;  4IUN A;  4J8Q A;  5C0X J;  2RSO A;  3AMU A;  1H9J A;  1Q1B A;  1HQM C;  3SDZ A;  2LS0 1;  2EZV A;  4IFD H;  1T5E A;  1BCP C;  1W6K A;  3NUC A;  3BG3 A;  5EKI A;  1D1I A;  3NWT A;  2EY6 A;  2D5D A;  1MSH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...