3K8AA

Neisseria gonorrhoeae prib
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
100
structure length
100
Chain Sequence
MGFTNLVSLAALIEKAFPIRYTPAGIPVLDIILKHESWQEENGQQCLVQLEIPARILGRQAEEWQYRQGDCATVEGFLAQKSRRSLMPMLRIQNIKEYKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of Neisseria gonorrhoeae PriB reveals mechanistic differences among bacterial DNA replication restart pathways
pubmed doi rcsb
source organism Neisseria gonorrhoeae fa 1090
molecule tags Dna binding protein
molecule keywords Putative primosomal replication protein
total genus 14
structure length 100
sequence length 100
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-10-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3k8aA00
3CCSA 5C0XG 4JI8L 1YBYA 3EN2A 1CUKA 2ZJPA 2E5LQ 2ES2A 4HJ7A 2CWAA 4IPDA 4B3TL 3PCOB 4LW1A 4ME3A 3RNUA 4LF8Q 4LFAQ 4A3JG 1VQOA 1VQBA 1BBWA 1X3GA 3L7ZC 2ATWA 1NJIC 3UDFA 4A3GH 4XTCS 1EWIA 2ALYB 3J80c 5C4XG 3T1YQ 1Q12A 4R1JA 1G291 2EQSA 2OQ0A 4J15A 3RLOA 1P16A 3UDXA 3DLLA 2Z0SA 5M3MH 1PH5A 4C3IH 1KD1C 1GKHA 1PH2A 4NXML 3D31A 3KFUA 1V1QA 4GNXB 4JI0L 3S14H 2YV5A 1OXTA 1Q81C 5JJKA 4JI5L 3S15H 2K14A 3CCEA 1U5KA 2NZHA 3U58A 2OTLA 1FVIA 4DR4L 1UE6A 3JAMc 3PF5A 4HIKA 4DR6Q 2FXQA 2KENA 4DV7Q 2WB1E 4YY3L 4O2DA 3GO5A 4JI7Q 2K5VA 1QVCA 2AKWB 4A75A 1I94L 1HR0Q 1L1OA 3D0FA 4GOPC 1WOCA 2K4KA 2OWOA 4LF9L 4Y7NH 2QGQA 1XNQL 2E5LL 1GVPA 2IY5B 4OWTB 4MTNA 3STBD 2ZTEA 3G6EA 2E2IH 1IXRA 3HOZH 3J81j 1C9OA 2ZJRA 1PYBA 3W5OA 4OO1G 3Q8DA 3F2BA 1N36Q 4P75A 2XGTA 5AJ3Q 3PO3G 4UPAA 4R4IA 1L1OC 2F4VL 3G71A 2JJQA 3GTJH 1XPRA 2DUDA 4OO1I 1H95A 2LSSA 4P71A 1XNRQ 1KL9A 5LMNQ 2R92G 3J81i 4AIMA 2UXDQ 1HZBA 3HKZG 1N36L 1WJJA 1MJCA 5AJ3L 4A3MG 2UXBL 3BJUA 1UE1A 3GDEA 2A1AA 4LUOA 4DUZL 1A8VA 1N34Q 2WFWA 1I5FA 3SGIA 1IBLL 4KHZA 1I6HH 1CSPA 2ZTDA 4OX9L 3H3VI 3UDGA 4IPHA 1U0LA 4GN3B 4A3JH 5JJLA 4DV4Q 5JJIA 1TXYA 1CSQA 3UE0A 2PI2E 1TWGH 3KDFA 1KHIA 2IHFA 5IT9c 1L1OB 1Y1VG 1NMFA 2V1CC 2WAQG 1UE5A 3FHWA 1TWFH 4PZ7A 4JV5L 1E22A 1YITA 4HIDA 4LF6L 2VY3A 2NZOA 2MQHA 3HOVH 2UU9Q 5M3MG 4JBMA 2UUAQ 4A3KG 2F3IA 1I3QH 4DR3Q 3GTLH 1QZHA 3I56A 4LF5Q 3M4OH 1PH3A 4A3GG 2B29A 1EUJA 4OX9Q 1K9MC 4A3MH 2YTXA 4YWLA 4IFDJ 4DK6C 4A4IA 2K5NA 2R7ZG 1HNZQ 1PV4A 2R92H 2ASBA 2AWNA 3CMAA 1R9TH 2F4VQ 1Y14B 1X55A 1HZ9A 3CCRA 5C4JH 1EYGA 5LMNL 4QQBX 2Q2HA 1W3SA 2R7DA 4DR5L 2VL6A 2PMZE 5GAEC 1QVFA 1PH8A 3PUYA 4R4OA 2ZM6L 3RZOH 4O0AA 4POFA 3FKIH 4DV3Q 4A3DH 4B3TQ 1N8RC 2JK8A 4AQYL 1KIXA 3TRZA 5IP9G 1K0RA 1KRSA 1UE7A 1D7QA 1VCIA 2HT1A 2D0PA 1X6OA 1HNWQ 1V9PA 5C0XJ 1LYLA 2WB1G 2K52A 4NXNL 5C44G 2YTYA 1PH9A 1SROA 1CKNB 3FKIG 3K81C 3NEMA 3RN5A 4C2MH 1X3EA 2VNUD 2K75A 4OWWB 2Z6KA 2UUCQ 4JI2L 4DKAC 4P72A 2A8VA 3S1NH 4LFBQ 3HOWH 1GD7A 2B63H 2MFIA 2B63G 1S72A 4JI0Q 5M3FH 1B70B 2NVQH 1JJGA 4IPGA 3H15A 1OTCA 5FLMG 2VW9A 2R7ZH 1OXVA 4R4QA 4JOIA 4GS3A 3CPFA 3ICEA 3CCLA 1VS0A 1YHAA 2KHIA 2VUMH 4RMFA 4TVAB 1SRUA 2EXDA 5GADC 2I5MX 1O7IA 4GN5A 3GTMH 4BBSG 3I7FA 3HOYG 1VQFA 1VQGA 1CKMA 1YVCA 2CKZB 4YHHL 1QVGA 3TS2A 4DV2L 4K0KL 2OQKA 4JCVE 5LMNW 3F1ZA 4LFCL 4BXXH 3M7NA 1X3FA 1XNQQ 1HZCA 2IHEA 3KF6A 4LF9Q 5IP9H 3T1HQ 3GTPH 3HOUG 4IPCA 3S17H 1JB7A 1OXSC 4JI4Q 3HOUH 4A3DG 1VQ6A 4HIOA 4YWKA 4YCWA 5GAHC 4JI7L 4X62L 1SLJA 4IJLA 5C0XI 1VQMA 2Q2UA 2JEAI 3EBEA 1FL0A 3GTGH 4BY7G 1YHBA 3L0OA 1PH1A 4BY7H 3F8TA 2CCZA 1HR0W 2N3SA 1XNRL 2B3GA 4X65Q 2VUMG 3CC4A 1YIJA 4JC0A 3FP9A 3S1QH 1IBKL 1Y1WG 4DR7L 3G48A 3CQZH 1KXLA 4YWMA 5FLMH 2UXDL 3VDYA 3E9IA 1J6QA 2ZTCA 1TWHH 3CD6A 4A3LG 1G6PA 1AH9A 1EOVA 4EX5A 4DR1L 4JI3L 3BZCA 2R7FA 3RR5A 4DPGA 2QEXA 1XMOL 2CWPA 2KCMA 3CCMA 1OXXK 4LF8L 1VQEA 1FJGQ 3A0JA 3TEHB 2ID0A 3PIOA 5JEAG 3S1RH 2E2JH 2ZJQA 4HJ5A 4LF7Q 5BR8L 4GKKL 5IWAL 4JV5Q 2RHQB 1NY4A 3HFZB 2JA7G 4A3CG 3PUVA 2VQFQ 3E9HA 2VQEQ 1S40A 3HOWG 4DV7L 3ER0A 4X66Q 1VQDA 3CCJA 1XPOA 3IRBA 4DV4L 1PVOA 1IBML 1A0IA 1XPUA 2UXCL 1M1KC 3H3VH 3TREA 4NB3A 4DR2L 1JJCB 3BU2A 3U4ZA 4DV3L 4JI5Q 2YYZA 1T9HA 4GLVB 1VQPA 5M5WH 4L5TA 2AHOB 1HNXQ 4A93G 1Q1EA 1TWAH 3AEVA 2JEBI 1JJ2A 4P73A 3W1BA 5IWAQ 4DR7Q 1CKNA 1OXUA 4DV5L 1N9WA 3PUZA 1AE3A 1G51A 3H0GH 2A19A 3I55A 1XMQL 3CCVA 2N8NA 3DM3A 1PH7A 3PO3H 5IP7H 4L5RC 3KYHC 5GROA 1PA6A 2WAQE 4WJ3M 1HJPA 3U50C 2DGYA 4QJFA 4A3EH 1DGSA 2GN5A 3AQQA 2JQOA 5IY0A 1ASZA 3RN2A 3UE1A 4QGUA 2IT1A 1NE3A 4YCUA 4GNXA 1MKHA 2KHJA 3GD7A 4QIWE 3NENA 1JMCA 1Q8KA 1N33L 4B3SL 1YHQA 1A62A 1HH2P 4UP8A 3F2DA 1RIPA 1PFSA 2JE6I 3M9BA 3RZDH 1NTGA 3KJOA 2MO0A 4JBKA 1IYJB 1RL2A 2N49A 1K8AC 2BA1A 4IJHA 5HY6A 4BY1H 3PF4A 3CW2C 5IYCH 4DV6Q 4B3RQ 1K83H 3J81c 2VQEL 2CFMA 5C3EG 5H1SE 4A3FG 3TQYA 4A76A 2R93G 4YY3Q 3K80C 2IX1A 3A74A 1C0AA 5M3FG 4IFDI 4PZ8A 4LNQA 1BKBA 1SR3A 4MNOA 4IOAA 3HOVG 1SFOH 2HIVA 3JC66 1C7YA 1FGUA 4LF5L 2KBNA 4BBRG 3CP0A 2RHSB 2E8GA 4K0KQ 1PHJA 3AFPA 3ULLA 4JBJA 2LXKA 2VZAA 1KC8C 4AYBE 3PSIA 3HOXH 2UUBL 1VQ4A 1N32L 3KDFB 3NELA 4MZ9A 2NVTH 2NN6I 4L5SA 1XMOQ 1S3OA 4A3IH 4JI6Q 1QZGA 1Q82C 2K5HA 3U4VA 5IP7G 1YEZA 4DV1Q 4GKJL 4DR3L 2BH8A 2NN6G 3OYYA 4BBRH 4EQ5A 1X54A 2HIXA 3A5ZB 5EAYA 1D8LA 3S2DH 4DR6L 4KHPL 5K36G 2KCTA 2BH2A 4JYAQ 1E3PA 4X66L 4DAMA 1YJ9A 4A93H 4HIMA 4A3EG 1GO3E 1XJVA 1VQJA 1I94Q 4B3RL 1HR0L 4B3MQ 1E1TA 1XTDA 3HKSA 1HZAA 3KOJA 4DR2Q 3PO2G 1K73C 3H0GG 1KQSA 4NXNQ 3GTOH 2I5LX 1P8LA 1EQQA 2L15A 2BA0A 2F52A 4JG2A 3L2PA 1VQ8A 2YU9H 1TWCH 3PIPA 3LGJA 4AQYQ 3ZJYC 4LUVA 1L0WA 4OONA 4DV1L 1MIUA 2E2HH 2OCEA 2PQAB 3CC2A 4JI3Q 1B8AA 5LMUQ 3T1HL 4GOPB 1NBWA 3M85A 2D0OA 4UP7A 1VQ9A 1VQLA 1XMQQ 3S2HH 4UY8C 2JA8H 4C3JH 4POGA 1K8GA 1SE8A 4X64Q 4JI8Q 4H02A 4DV0L 3S16H 4DUYQ 2GVAA 4PZ6A 4B3ML 1NMGA 3CPWA 5IYCG 4IFDG 2R93H 1A63A 4PG3A 4BBSH 2Z6KC 3OTOL 3HOZG 1PYSB 2AMCB 4GNXC 3NBHB 2UXCQ 4HJ9A 3STBC 3CC7A 3K0XA 1WYDA 4LF6Q 1X56A 1Z9FA 4PMWA 4JI1L 4GLXA 5C4XH 1ASYA 1QUQA 1HNWL 2XTIA 1YJWA 3I4NH 1GM5A 2UU9L 2YTVA 2JA5H 4JI4L 3M4PA 2RF4A 1J5EL 4KLKA 1I50H 3BZKA 2NVXH 1LUZA 3WWVA 4Y52H 1EFWA 1BVSA 4B3SQ 1Q86C 1FJGL 4DR4Q 1V43A 4LF7L 3CXCA 1HNZL 1N34L 1IBLQ 2JA7H 4OXPA 3T1YL 1W2BA 3I4MG 3I4NG 4A3CH 5M5XH 3W1GA 5DLQE 3ULPA 3CCQA 4LWCA 5GAGC 5E7NA 1K3RA 1Y1WH 4QY7A 3HOYH 5C3EH 1UWVA 2I5HA 3EIVA 5FJ8H 4A3FH 1EIYB 2UUBQ 3HOXG 2UXBQ 4DV5Q 2K50A 1VQCA 4BA1I 4YHHQ 1Z47A 1EIFA 1WCMH 3PUWA 4A3KH 4DUYL 4BXXG 4A3LH 3ULJA 4X64L 3KJPA 4DV0Q 2JA9A 4X65L 5IYDH 3UDIA 3K7AH 4TQUS 1YJNA 2Q2TA 3KLWA 1IZ6A 2HQLA 2GVBA 5GQOA 4DK3C 1YNXA 2JA6G 3AYHB 4P74A 3S1MH 4BA2I 2JA6H 4X62Q 3I4OA 4HJAA 2R6GA 5IYDG 4A3BH 3JAMi 3MXNB 3PGZA 4UP9A 4JOIC 4LF4Q 4DV6L 1KRTA 4DR1Q 2VS1A 1WI5A 4DAYB 4R4CA 4HJ8A 3GTQH 4GLAC 2LXJA 1J5EQ 1LTLA 5M5YH 3OTOQ 3MEFA 5BR8Q 3AFQA 4DUZQ 2PI2A 1VQAA 4R4TA 4GKKQ 1N32Q 2H5XA 2PNHA 2OTJA 3E0EA 3RLNA 1E7ZA 4DR5Q 2D62A 4A3BG 2C35B 4LUZA 4KHPQ 4JI1Q 2NVYH 5JEAJ 5IYBG 1JT8A 3I2ZA 1M90C 3J80i 5IYBH 1WFQA 5HGQA 2RCNA 5FJ8G 1QUQB 2IX0A 1Q7YC 1EQRA 5IE8A 4JBWA 4GKJQ 5ELNA 1JE5A 1WCMG 4YCVA 3S24A 1PH4A 2Q2IA 2JA5G 1VQKA 4LF4L 4XIGS 5ELOA 2I0QA 2UUAL 2N78A 3I4MH 2EIFA 1E1OA 4IO9A 3PV0A 1X65A 4JI2Q 1Q1BA 2QA4A 2UUCL 1BBUA 4LFBL 3GTKH 3CMEA 2Y0SE 3K8AA 1VQ7A 3B6YA 4LFCQ 4WJ4A 3HKZE 1PH6A 2JA8G 4AH6A 4GOPA 1E24A 1L2FA 3ERSX 4RG1A 4IOCA 1IL2A 2PQAA 3M3YH 4AYBG 3TS0A 2MNAA 3A5UA 2Y0SG 3K7UC 3KF8B 1YZ6A 4DNIA 4JI6L 1N33Q 4NXMQ 3KF6B 2ZM6Q 3F2CA 1UEBA 4NPSA 1VQNA 1YI2A 4KI0A 1MJEA 4A3IG 2WP8J 3CCUA 4L5QA 4DV2Q 2HHHQ 3J7A5 1CKOA 4C3HH 1SN8A 4ALPA 4BY1G 1HNXL 4QL5A 3PO2H 1B7YB 2CQOA 1Y1VH 4X6AH 1Q46A 5C44H 5J3BA 1VQ5A 4OWXB 4LFAL 1X9NA 2AWOA 3PUXA 1VQIA 3M4QA 5FLXc 1VQHA 1IBMQ 3CF5A 1IBKQ 1LM0A 1SMXA 2MO1A 4GN4B 2HHHL 5LMUL 3CAMA 3G4SA 3RLFA 4APVA 3OW2A 3J7ZC 4FDBA 2VQFL 1AE2A 1KAWA 4JYAL
chains in the Genus database with same CATH superfamily
3CCSA 5C0XG 4JI8L 1YBYA 3EN2A 3BYYB 4IPDA 1WTRA 3PCOB 5EKIA 2JA8B 4CGYB 4V0BA 1HFGA 1NJIC 4A3GH 4XTCS 2ALYB 3K6OA 1C4QA 1G291 2EQSA 3DLLA 3UDXA 1HQRD 2Z0SA 5M3MH 4C3IH 1PH2A 5JJZA 3D31A 3ND8A 1IYUA 1SNCA 1PRTB 5J39A 3NSWA 4N8FA 4DR4L 1U5KA 5KNCA 1FNUA 1U4MA 4L6TB 5I6YA 3JAMc 2FXQA 2KENA 2WB1E 2MP1A 4JI7Q 2AKWB 3IFDA 1HR0Q 5CYUA 4K5VA 2K4KA 1B1ZA 3HP3A 2Q8IB 1AZQA 1VMCA 2FHTA 1WD0A 3STBD 1EYAA 2E2IH 4K6DA 3HOZH 3J81j 1C9OA 2DNEA 1PYBA 1ICWA 5IGCA 1PFNA 4R9WA 2ZJRA 2XGTA 1DJRD 3S16B 3PO3G 1EYCA 2A6HD 4UPAA 4C3JB 3G71A 1H95A 5LMNQ 2R92G 1SMYD 2J0TD 4A3EB 1QCBD 5AJ3L 2EJGC 4ME5A 3DUZA 4DUZL 4DFAA 1IYVA 1I5FA 3SDZA 4G7HC 2ZTDA 1AN8A 3JAML 4K5WA 3R8BA 3UDGA 2E74C 1TIID 1PRTC 4QUFA 1HXYD 4RA8A 2PZTA 5JJIA 1TXYA 4CDCC 2VB2X 5IT9c 1L1OB 5A2QL 1NMFA 2CHBD 2F03A 3FHWA 1HA6A 4LF6L 5M3MG 3QIAA 4R8IA 2F3IA 2NZ1D 3GTLH 1QZHA 3I56A 4LF5Q 5DAUA 4IUPA 1PH3A 3P20A 4A3GG 3R3OA 1MGSA 1K9MC 2YTXA 4YWLA 4IFDJ 1HNZQ 4ZCKA 3CMAA 1RKNA 1H9JA 2L4NA 5GAEC 1QVFA 4R4OA 2ZM6L 2EDGA 2AUKA 3RZOH 3FKIH 2JK8A 5ISRA 3TRZA 1KRSA 4C56C 2HT1A 1X6OA 1HNWQ 5C0XJ 1LYLA 5C44G 2YTYA 1PH9A 4X3TA 2K01A 3FKIG 1TKWB 2ICIA 1A3VA 1X3EA 4C2MH 1W6KA 4OWWB 1K28A 4JI2L 1DYQA 4DKAC 4M1UB 1SNDA 2O5JC 3NQTA 4IPGA 3WDNA 1OTCA 2VW9A 3TP6A 3D3RA 1D5XC 4JOIA 4GS3A 2F0MA 3ICEA 2KHIA 3C1FA 1GUNA 1SRUA 1EY9A 1NR2A 2J4XA 1JCKB 2OEOA 4YHHL 1CKMA 3E0JA 3NTKA 2BDOA 4X3KA 1R4PB 2F0OA 3C2PA 3F1ZA 3QJYA 4LFCL 4CHTB 3NK9A 4MN3A 3I4NH 3M7NA 2F0NA 4JI4Q 1D1IA 3PMFA 1FD7D 4PNYA 4HIOA 3FVQA 1STBA 5C0XI 2Q2UA 3DEPA 1E0BA 1F2YA 4BY7G 1WCMB 2N55A 2PCFB 4X65Q 1SEBD 2VB3X 1YIJA 2JA6B 3S1QH 2WB1B 4DR7L 2QCPX 2F3WA 3GTOB 2NVQB 1BCPC 4YWMA 1LTBD 3M3YB 1TWHB 5E3FA 1LT3D 1TWHH 1PFBA 2R3ZA 4A3LG 2P5ZX 2KHSA 2K32A 4EX5A 4K8JA 2R7FA 2QEXA 1F2LA 4PMCA 4RGOS 2C9OA 1Y1WB 5BR8L 5IWAL 4RFBA 2EJFC 1MSHA 2JA7G 1S40A 1EWHA 1Y69U 1I3QB 4X66Q 2A73B 4KY5A 3HOVB 4X3UA 2UXCL 1BBXC 3H3VH 2EY1A 1RTNA 1B3AA 2IWHA 3BU2A 3U4ZA 4JI5Q 4KN7C 5M5WH 3GTQB 1Q1EA 4XYQA 3NXWA 4Z9CB 3A54A 4P73A 5IWAQ 1UEAB 1S5FD 2A19A 4K2LA 5GROA 1HJPA 1L0XB 1DGSA 2GN5A 1ESRA 3AQQA 5IY0A 4QGUA 2IT1A 3AU7A 1NE3A 3BZDB 1JMCA 1LLRD 5EGTA 1YHQA 4I7ZC 1RIPA 4F8MA 2XRQD 1PYWD 1RL2A 1K8AC 2ZT9C 3BYTB 4IJHA 4DV6Q 4JVZA 4JK1C 1BR9A 1I4XA 2RA4A 1I4QA 3K80C 1CFMA 1C0AA 4XT3B 1BF4A 4PZ8A 2H4OA 3GTJB 1M4VA 1A15A 4TKOB 3D6WA 1Y8PB 3DMUA 1SR3A 5IODA 1SFOH 2HIVA 4CKEA 1C7YA 2NN6H 1QB5D 4NW2A 2XSCA 2RHSB 3AFPA 1KC8C 1N32L 4AYBE 3PSIA 2UUBL 1VQ4A 3KDFB 4MZ9A 2QKIC 2NN6I 1XMOQ 1S3OA 1O7YA 3I91A 3GV3A 2F0WA 1Q82C 2HDMA 2HQEA 4EQOA 4GKJL 2NN6G 3Q23A 1CHPD 1D8LA 4DR6L 3OMCA 4KHPL 3S2HB 2KCNA 4HIMA 1IKMA 1JWMD 4B3RL 2Z4IA 4E6IA 1XTDA 3HKSA 1B3QA 1KQSA 3L2PA 2A68D 2OCEA 2KA7A 5DEHA 2E75C 3J7AV 2D0OA 3SVMA 3W2DA 1U4LA 3FMCA 3K59A 4RHRA 1SE8A 4H02A 4JPBW 3T53B 3PQIA 3GTPB 4IFDG 2R93H 3OTOL 3HOZG 1EY0A 1LT4D 2LS01 4GNXC 2UXCQ 1AP0A 1ILPA 1WYDA 1KAAA 1PTOC 5C4XH 2XTIA 2VUMB 1YNJC 3H91A 2JA5H 1S5DD 4PMBA 5I4DA 3QOLA 1U9RA 2QILA 3BZKA 2NVXH 1E2WA 4CKBA 1LTGD 3X3MA 2JA7H 1TS2A 3T56B 3I4MG 5FLXL 1VF5C 5DLQE 3J80E 2ZXPA 3GTKB 4QY7A 4A3FH 5FJ8H 2UXBQ 2K50A 1Z47A 1WCMH 5A35A 2WINB 4A3LH 4HAEA 3KJPA 2HQLA 5G3LD 1KTKA 3I4OA 1HTPA 5IYDG 4A3BH 3MXNB 3R2TA 1RD9D 4UP9A 4JOIC 1EWCA 5C4XB 5M5YB 2VS1A 2G9DA 3BDCA 1JICA 4GLAC 2EY6A 4I65A 3OTOQ 1J5EQ 1VQAA 1N32Q 2H5XA 2OTJA 3E0EA 3HOUB 2XWJB 3RLNA 4DR5Q 4LUZA 4KHPQ 4HR7B 2L0CA 5IYBG 3A8IE 1JT8A 1M90C 5IYBH 1WFQA 4RGMA 2RCNA 5HGQA 4FO2A 5ELNA 2EVBA 3TN2A 3VA7A 2HUGA 2EJMA 2JYOA 2AQ1B 4KJOA 4IO9A 3PV0A 1X65A 4JI2Q 5C3EB 3HKZE 1SSOA 4Q5VA 2EE1A 4RKLA 4RG1A 4IOCA 1IL2A 4AYBG 1JORA 2Y0SG 4P2CB 1EU3A 1RODA 1N33Q 3AMUA 3F2CA 4F88A 1UEBA 3ZYYX 2HHHQ 4KD4A 4L5QA 3CCUA 4DV2Q 1CKOA 4C3HH 3K5LA 1SJHD 3PO2H 3QWNA 2L11A 1ML0D 3NUCA 3I4MB 2F0PA 1B2TA 3M4QA 2F0EA 2EYPA 1BXTA 1TR5A 3CF5A 4GN4B 5AFWA 2HHHL 3G4SA 4BBSB 2SNMA 3J7ZC 2VQFL 3MC0B 2MPMA 3OOCA 2ZJPA 4HJ7A 2CWAA 4LW1A 4LJZC 1VQBA 3EQLC 3KLSX 4IN3A 3J80c 5C4XG 2F0VA 5I2YA 4R1JA 4A3KG 2OQ0A 4DGZA 1KD1C 3V05A 5EKLA 1V1QA 4GNXB 1Q81C 5JJKA 1CM9A 5E4XA 4JI5L 2K14A 3S9WA 3U58A 1I4GA 1FVIA 3DWQA 5C4JB 2BCOA 1KNAA 2RSOA 4YY3L 3GO5A 1I94L 2R92B 1SE3A 1DONA 1ONLA 1L1OA 3D0FA 4C3JG 4LF9L 4Y7NH 2QGQA 1XNQL 4HCSA 1EFID 2E5LL 1GVPA 5C0XH 3JAME 3G6EA 1AEXA 2K5QA 1OO9B 3TP7A 1HA5A 4OO1G 3Q8DA 1STAA 4P75A 1Q90A 1GOZA 3W3AA 2CH4W 2WKCA 2DY8A 1XPRA 2JJQA 1ILQA 3GTJH 4OO1I 1TS3A 1CI3M 1LT5D 4A3JB 1KL9A 4KHVA 2EYMA 1I4RA 1B50A 4ZLTF 2SEBD 1MJCA 2Z1CA 3MWYW 4A3MG 2IPKD 1UE1A 1KDBA 1IW7C 1N34Q 5NUCA 4KHZA 1B44D 1CSPA 5LHY1 4L8JA 1JR0D 1U0LA 4GN3B 2B8GA 4DV4Q 1CSQA 1O78A 3KDFA 1KHIA 2D2CC 2WAQG 2AQ3B 3QO2A 3A56A 2MQHA 2UU9Q 4JBMA 3I8ZA 3EA6A 4F7XA 4F87A 4ABNA 4N9TA 2K5DA 2NVTB 2NWGA 2R61A 2EXZA 4A3MH 1GUOA 5M5WB 4FP5D 1ET9A 3SK4A 1R9TH 5C5MA 4DAPA 2ZXRA 3MA2B 3N6RA 1O80A 1EYGA 5LMNL 4QQBX 4FXGC 3A55A 2A5HA 4XQQA 2EOTA 3K57A 4M8AA 4O0AA 4POFA 4DNTB 4A3DH 5I9PA 1KIXA 5IP9G 1K0RA 1UE7A 1VCIA 4RAUC 2D0PA 4N9PA 5FO8B 1NAPA 3K81C 3NEMA 1EOTA 2B2TC 2VNUD 3D4RA 1TQOA 2B63H 3URYA 2K1BA 3VR4A 2NVQH 1JJGA 1B70B 3H15A 2NVYB 4R4QA 1EZ6A 4DXFA 2A69C 2AUJD 5ELBA 4BY7B 1YHAA 2E76C 3GTGB 2EXDA 3I4LA 4GN5A 3GTMH 4BBSG 1MD2D 2AQ2B 1VQFA 1VQGA 1YVCA 2CKZB 3TS2A 3I3CA 4K0KL 3D6CA 5LMNW 3F2UA 1XNQQ 3I4MH 1QE6A 5IP9H 5M3FB 1JQYD 2GA4B 4IUTA 3I72A 4A3DG 2B63B 5GAHC 4JI7L 2A68C 1Y8NB 4X62L 1SYBA 2EY5A 1O7LA 1FL0A 3GTGH 1LTID 1SYCA 1SJED 4FF2A 4BY7H 1RF2D 3MFGA 3HOYB 1PLFA 1Y1WG 4DA2A 2UXDL 3WOEA 3NHHA 3VDYA 1CA5A 4C2MB 2L5TA 4PQXA 5C4HA 3RR5A 1QNKA 2DNCA 2RDGA 2CWPA 3SR1A 2D9UA 4LF7Q 3R93A 5LL6S 3PIOA 4DK0A 2ZJQA 1LO5D 1WTOA 1EIGA 4JV5Q 5IGEA 1NY4A 2H1EA 1PZJD 4DAYA 3HS0C 2VQEQ 3VR3A 3TZUA 3RZOB 3ER0A 1VQDA 3BDLA 3VYRA 1A0IA 1TT2A 3E3XA 4DR2L 1R9TB 3H94A 2YYZA 1T9HA 1J9OA 4GLVB 4OIKA 1FR3A 1TWGB 2F0HA 4L5TA 3I70A 4J6HA 5DM63 1F2ZA 2MJ8A 3W1BA 4DR7Q 4OO1H 2K04A 1XTCD 4DV5L 3H3VC 1STGA 1AE3A 3H0GH 3I55A 1XMQL 1MHWC 2N8NA 4WJ3M 2WAQE 3Q22A 1TY2A 2JQOA 1ASZA 3RN2A 5KGUA 1MKHA 1BNZA 1Q8KA 3RZDH 1HH2P 2NBFA 3M9BA 5BN4A 1AW7A 4WFN3 2N49A 2BA1A 2PNRC 3CW2C 2LY7A 4FF1A 4TRDA 3BG3A 1NUCA 4A3FG 3TQYA 2JA7B 3ND9A 5M3FG 5EPJA 1BKBA 2SOBA 5I9OA 4MNOA 4IOAA 2NVXB 1GUSA 1T5EA 3BDOA 1QWYA 1HCZA 4UHVA 4LF5L 4K0KQ 1PHJA 2L55A 2LXKA 3NQIA 2NTTA 4WRDA 4JI6Q 1QZGA 3RD4A 3U4VA 5IP7G 1YEZA 5IT9E 2WV6D 1X54A 2HIXA 5EAYA 2CVRA 1STEA 2KCTA 2L1BA 1E3PA 1SNQA 1FNWA 4DAMA 1YJ9A 4A3EG 1GO3E 1XXGA 4B3MQ 1B9MA 4ZYSA 5BN5A 3GTOH 1TWCB 1P8LA 3P7JA 4HCEA 1EQQA 2YU9H 2BA0A 1VQ8A 4FYDA 1TWCH 3KF8A 1K0SA 5FO9B 2E2HH 4EQNA 3CKIB 1B8AA 2F0JA 2F1MA 2FFKB 3QR8A 1VQLA 3M85A 2JA8H 3L3OC 1K8GA 4X64Q 4DV0L 4PZ6A 4B3ML 1NMGA 3CPWA 3KLSA 5IYCG 1A63A 4BBSH 2Z6KC 3IKJA 3STBC 4XQJA 5EPLA 1X56A 1Z9FA 4JI1L 1QJOA 1HNWL 3L9AX 2E2DC 1Z7TA 1EEID 1GXDC 4G57A 4JI4L 3NWSA 5JVG3 5FK9C 1ZKOA 3WWVA 4Y52H 4K2KA 1BVSA 1Q86C 1V43A 4LF7L 1N34L 2EY2A 4A3CH 3T1YL 3EROA 1W2BA 3I4NG 1JOOA 4LWCA 5E7NA 4LAAA 1TS4A 1K3RA 2I5HA 1VQCA 4YHHQ 1EIFA 4L63B 4X65L 4TQUS 2KJXA 4KJNA 2PO4A 2Q2TA 3KLWA 1IZ6A 1HFNA 2B2WC 4IUUA 4DF7A 3ERQA 4DK3C 1KABA 2LKVA 3AYHB 1EEFD 1I50B 4BS9A 3EFXD 1TS5A 3S1MH 2I07B 1SMYC 3A7LA 3PGZA 4C1NI 4DV6L 1RJTA 4HMJA 5M5YH 3HEJA 5BR8Q 3AFQA 2PI2A 1ZEQX 4XXEA 4GKKQ 2PNHA 1E7ZA 2RBMA 4A3BG 1LT6D 4JI1Q 1Y1VB 1WVLA 3I2ZA 2OTLA 3J80i 3HGBA 1JE5A 2NTSA 3IFTA 1PH4A 3NBHA 1S4ZA 2Q2IA 5CMDA 3NE5B 3SE0A 2UUAL 2N78A 2EIFA 1HUMA 1Q1BA 2R7ZB 1BBUA 3GTKH 2PZUA 3U9SA 3S1NB 4GOPA 5JVH3 2MNAA 3M4YA 3K7UC 3S2DB 4JI6L 2N88A 4NXMQ 1II3A 3KF6B 1IW7D 1HHVA 4NPSA 5EQ0A 4A3IG 1YNNC 3J7A5 4KMUC 4ZAIA 4BY1G 1EZ8A 2DN8A 1Y1VH 3I4NB 1Q46A 1VQ5A 1Y8OB 4LFAL 1X9NA 2X6LA 1UAPA 3N52A 1VQHA 2F0UA 1IBMQ 1SNPA 3CAMA 2Q8RE 3RLFA 3OHXC 1G2SA 1X3PA 2IL8A 4FDBA 1NNXA 5KIXA 5IGFA 2ES2A 2E5LQ 3K5NA 4B3TL 3LX0A 3TDQA 2JN4A 2A69D 3CHBD 4ME3A 4LFAQ 1X3GA 1QOHA 2BDNA 3L7ZC 1WTPA 1U4PA 3LNNA 1V1OA 1Q12A 4FF4A 1PH5A 1P16A 3NP8A 2B8FA 3HOZB 4FVMA 4C3HG 1DOKA 4NXML 4G7ZC 3KFUA 5JEAH 1IL8A 4ZK9B 3C3LA 3FEWX 3CCEA 3S15H 4DR6Q 2Z4HA 5CGKA 3PF5A 4HIKA 1V1PB 4DV7Q 1SBBB 2KQ3A 2TMPA 3BVMA 1EIHA 2K5VA 1QVCA 3V96A 4A75A 2FMCA 1FNVA 1PTOF 1RTOA 4A3MB 2OWOA 3OIQA 2IY5B 4OWTB 4MTNA 1CZWA 4C3IB 1SFOB 3F2BA 1N36Q 4K8IA 4C1NK 1K8MA 1DD2A 4NP5A 2F4VL 4P71A 3D4DA 4LMQD 1HZBA 3K5MA 3OW7A 1WJJA 2E2HB 4UDUC 2UXBL 3BJUA 3GDEA 2A1AA 4LUOA 3H0GB 3HG9A 4H7BA 5COYA 3SGIA 1IBLL 3H3VI 4OX9L 4IPHA 1RHPA 4A3JH 1UNSA 3VR6A 3UE0A 2PI2E 1WD1A 1TWGH 4U68A 4DNRB 3K58A 4CDDC 1UE5A 4HSPA 2EZVA 4HTHA 3NPPA 4KKSA 4CJ1B 2VY3A 2NZOA 3HOVH 4WJWA 2UUAQ 3J80L 1I3QH 2A6HC 2EYJA 3M4OH 2B2YA 1EUJA 2QDLA 2Z9HA 4OX9Q 1I4HA 3C46A 4B9WA 4A4IA 2TSSA 2K5NA 2R7ZG 2R92H 1PXUA 1SNOA 2ASBA 2X69A 1Y14B 5DNFA 1X55A 1HZ9A 4DN4M 2Z8LA 5C4JH 2WKDA 1W3SA 2A6ED 4DR5L 2OXPA 4AYBB 1CQVA 3DXJC 4C3HB 4DV3Q 1GUGA 4B3TQ 1N8RC 4QF4A 2VXWA 4AQYL 3S1QB 1D7QA 2O5IC 3CRKC 1F9RA 4NXNL 3MZ5A 3G6JB 1SROA 3TMEA 2OT2A 3RN5A 3CU7A 2K75A 4Q0FA 4EQPA 4P72A 2A8VA 1EY6A 3S1NH 4WORA 2MFIA 1I6VC 2F0DA 3WOFA 4BWGB 2B63G 1S72A 5M3FH 3OIPA 2R7ZH 5FLMG 1OXVA 3CPFA 3CCLA 2VUMH 4RMFA 2XWBB 4TVAB 4CDEC 2JSOA 1VDZA 3I7FA 4RGTA 3HOYG 1QVGA 3M4OB 1DM0B 4DV2L 3NTHA 1S5ED 2WACA 5EBDA 3S17B 4BXXH 1X3FA 4KKUA 3GTPH 3KF6A 3T1HQ 4DXGA 3HOUG 5CV9A 2ZXOA 1JB7A 3E5SA 4YWKA 3Q24A 4RHSA 4IJLA 2JEAI 1VQMA 2MUYA 1GJXA 2XVSA 1EQVA 4A3KB 5CORA 4ILWA 3L0OA 4G7OC 1PDQA 4DAVA 2B2YC 2B3GA 2F0IA 4RKBA 1SAPA 1KLUD 4JC0A 1YNND 1EY4A 1F9PA 3CQZH 3SEBA 1KXLA 3FDTA 1YNJD 3E9IA 1J6QA 4GZYC 5LL6X 1LTRD 3CD6A 1AH9A 5DM73 3RMHA 5EPKA 4JI3L 1XMOL 3CCMA 2EYHA 1D6EC 2IX3A 4LF8L 1G2TA 1VQEA 1FJGQ 2F0GA 3A0JA 4V190 4GKKL 3KLRA 3FPUB 2RHQB 3KUPA 2VQFQ 3E9HA 3MHBA 3IAYA 3CCJA 3EVQA 3CRLC 4DV4L 4KTAA 1PVOA 1XPUA 1M1KC 2O2LD 1STYA 3TREA 1H9SA 1EY8A 5CBEE 4DV3L 1VQPA 2NB0A 1HNXQ 2AHOB 3BS1A 4A93G 3A8KE 1TWAH 3LWUA 1F9QA 1JB3A 1A3UA 1Z6HA 1JJ2A 3QG1A 4EVOA 5I6WA 2R93B 1N9WA 1G51A 1PH7A 3CCVA 1NR4A 2KEEA 3U50C 1LTAD 2LFNA 4QJFA 4CJ2C 3NWTA 1SYEA 1ENAA 4GNXA 1BCPF 3T51B 4B3SL 1A62A 2JE6I 4ZKBB 1NTGA 1IYJB 2A74C 1UUPA 3PF4A 5IYCH 1K83H 2VQEL 2CFMA 2V4DA 3HRZC 3SHLA 5C5LA 4IFDH 4YY3Q 2R93G 1JE4A 2IX1A 1A2TA 3A74A 4Y7NB 1R4QB 4LNQA 2HD3A 3HOVG 1F9SA 1WTHA 1FGUA 2KBNA 4BBRG 1HRJA 3ULLA 4JBJA 4J8QA 2DJGC 3NELA 1PFMA 2F0TA 4A3IH 1HQMC 3EJIA 2KUMA 5IOCA 2B2UA 5FO7B 4DR3L 2BH8A 3OYYA 4BBRH 4EQ5A 1K83B 3OSOA 2XN9C 3DEOA 2F0QA 3S2DH 1BQQT 2BH2A 4JYAQ 3DM1A 4X66L 4A93H 4FF3A 2A6EC 1PRTF 1HR0L 1TU2B 1E1TA 3PO2G 1ZXTA 2I5LX 2F3VA 1EU4A 2F52A 1D2BA 2K7VA 4L5RC 3ZJYC 4LUVA 4OONA 3MAQA 2PQAB 3CC2A 4JI3Q 2K03A 5LMUQ 3T1HL 3RZDB 5D3IB 2JP1A 4KD3A 4GOPB 4QB4A 2EYLA 3S2HH 4NDXA 4UY8C 1HPCA 2C5CA 4XT1B 2WAQB 1E2ZA 2AMCB 1SDFA 2DY7A 5TSSA 4LF6Q 4PMWA 4GLXA 1JWSD 3AB9A 5D65A 5M9OA 2YTVA 1LTSD 3OPOA 3M4PA 5FOBB 2RF4A 2RDFA 4XYOA 1D5MC 1O7ZA 5J22A 4B3SQ 2OF1A 4ZUIA 1FJGL 1JOQA 1HNZL 2XIWA 1IBLQ 3DWAA 3MFYA 1A2UA 3W1GA 3Q6SA 1MSGA 3ULPA 1EQTA 1CTMA 3CQZB 3K5OA 1KLGD 2QEJC 1Y1WH 5KEEA 5C3EH 1UWVA 2UUBQ 3HOXG 4DV5Q 3GV6A 3PUWA 5A2QE 2HCCA 4DUYL 1Q8IA 4X64L 4DV0Q 5IYDH 1DOMA 1BO0A 3FKIB 3K7AH 2D5DA 2QDBA 1YJNA 5GQOA 1YNXA 2JA6G 4H44C 4P74A 4X62Q 2PMZB 4QMGA 5D14A 1GHKA 3VYUA 4LF4Q 1CQFA 4OHJA 4DR1Q 4LK1C 4DAYB 4R4CA 5KRUA 4HJ8A 3GTQH 2LXJA 1QILA 4NMZA 2WIIB 4R4TA 3GTLB 2D62A 5JEAJ 5CR3A 5KNBA 3PO2B 1ENCA 1LACA 3R2IA 5FJ8G 1Q7YC 3HOWB 5EBCA 3ITPA 4JBWA 4HSVA 4GKJQ 1WCMG 4IUQA 1XWEA 2KCCA 5D3DA 2JA5G 5C6AA 4LF4L 4A3FB 2YU9B 2B39A 3KBXA 3V2TA 3CMEA 2Y0SE 1CA6A 3K8AA 1VQ7A 3B6YA 4LFCQ 4WJ4A 4ODGA 2JA8G 4RCNA 4AH6A 3VR5A 3Q0AA 4KV6A 1L2FA 4A93B 4OIJA 3M3YH 2PQAA 1PTOB 3TS0A 3A5UA 4U673 1YZ6A 5CBAE 2ENBA 1NSNS 4YIJA 1SXTA 5F2DA 2L12A 1EYDA 2MGSA 3X3NA 4KK7A 1YI2A 1VQNA 2JA5B 4KI0A 1MJEA 4OEMB 2WP8J 5T1GA 4B9XA 4N8X1 4A3DB 1SN8A 1I4PA 4OL7A 4IALA 3MEHA 1B7YB 1HTLD 4HN7A 5J3BA 2K28A 4OWXB 2F4IA 5FLXE 1TWFB 5C3XA 2AWOA 2BE5D 2F0LA 4RCOA 2CH4A 2K5WA 4ZRZA 3S14B 1SMXA 2MO1A 5LMUL 4MHEA 4APVA 4DU9A 1CUKA 4IUNA 3VYSA 1KDCA 1SYFA 2PW7A 1SE2A 3RNUA 4LF8Q 1TY0A 4A3JG 1VQOA 1BBWA 1X32A 2ATWA 1T5XD 1IKLA 3UDFA 1EWIA 1STHA 2FJ2A 4MTKA 1K8OA 3T1YQ 3RLOA 1RDPD 3MTSA 4J15A 2G9HD 3VR2A 1GKHA 2BE5C 2PW5A 4I7AA 4JI0L 3S14H 2YV5A 1OXTA 1TWAB 1J8IA 1EY5A 2EPBA 2NZHA 2XNAC 1WTVA 1UE6A 3SXHA 4O2DA 2L9HA 3S15B 4H0LC 1WOCA 4GOPC 1EL0A 1GUTA 2ZTEA 1IXRA 3M7GA 2B2VC 1FYCA 3W5OA 5AJ3Q 4R4IA 1L1OC 2DUDA 2LSSA 1XNRQ 5CV8A 2FMMA 1JOKA 3J81i 4AIMA 2UXDQ 3KBGA 1XYIA 3HKZG 2IW3A 1N36L 1EY7A 5KYIA 1A8VA 4BY1B 2WFWA 3J7YW 5ELFA 4O42A 1I6HH 1JC7A 3SK5A 3J81L 5JJLA 4IQZA 1CZGA 2IHFA 1TVXA 3ONAB 3GP7A 1Y1VG 1ZYRD 2V1CC 4B08A 4PZ7A 1TWFH 4JV5L 1E22A 1YITA 4HIDA 1BDOA 2RSNA 1SYDA 2E2IB 1V1PA 4OGQC 1C48A 2ICEC 4DR3Q 1Q3LA 4KKTA 2B29A 3GTMB 1F2MA 5C4ZA 4DK6C 4CDFC 3K0YA 1PV4A 4IUVA 2AWNA 1W6JA 2F4VQ 4HEDA 3CCRA 1U4RA 1VF7A 2Q2HA 1PTOH 2R7DA 2VL6A 1WTQA 2PMZE 2Z6BA 1PH8A 3PUYA 5HGTA 3K7AB 3D8GA 3MXUA 4RH6A 5IIFA 5KNDA 1BOSA 4O1NA 1V9PA 2WB1G 2K52A 4XQNA 4KY6A 4OELB 4ZUJA 1CKNB 1H9KA 3TZDA 5IGDA 3MVVA 1B4OA 3MXPA 4QUCA 2Z6KA 2UUCQ 4LFBQ 4H13C 3UI2A 3HOWH 1GD7A 4XDXA 4JI0Q 1X3QA 4FNFA 3LWEA 2M9VA 1VS0A 1G8ZD 1GHJA 3P75A 5GADC 2I5MX 1O7IA 2HCIA 4CJ0B 1S5CD 2KVMA 1CK1A 2NYZD 1V8QA 2LMCB 2OQKA 1DZ1A 4JCVE 4ZQ3A 1HZCA 2IHEA 3O13A 4LF9Q 4IPCA 1K3BC 5ELDA 3S17H 1OXSC 3HOUH 1VQ6A 5G3LF 1A3TA 1F77A 3NTIA 4QIWB 4YCWA 3SK8A 1HUNA 5JAVA 1SLJA 5E1FA 3EBEA 1PZID 1YHBA 1PH1A 1XX8A 3F8TA 3FRPB 2B2VA 2RVLA 1HR0W 2N3SA 2CCZA 1XNRL 2O4XA 2VUMG 3CC4A 3FP9A 1IBKL 3G48A 5FLMH 1S5BD 2PQEA 4R8NA 2ZTCA 5K36H 1G6PA 1EOVA 4DR1L 3BZCA 4DPGA 4DK1A 2KCMA 1RCVD 2RKSA 1OXXK 1B53A 2JXMB 3P1HA 3TEHB 1MBYA 2ID0A 3S1RH 5JEAG 2E2JH 4HJ5A 4CBVA 5I2XA 4A3CG 3HFZB 4A3IB 3PUVA 2M00A 4PV1C 3HOWG 3QB3A 4DV7L 4IURA 1XPOA 3IRBA 4IZ8A 3H6MA 1IBML 2J7ZA 4NB3A 3NBIA 1JJCB 2B2TA 3J81E 1WTWA 2XRSD 4CKCA 3DWPA 3AEVA 2JEBI 3VA5A 1DOLA 1PTOD 1CKNA 2PZWA 1OXUA 3PUZA 3RUZA 2F0SA 3PO3H 3I90A 3FPPA 3DM3A 5IP7H 1IHZA 3KYHC 1FGBD 1PA6A 5E4WC 2DGYA 5JPMC 2QF7A 4A3EH 2B2UC 3MXGA 1NCVA 3UE1A 1AFPA 1ENFA 4YCUA 1N33L 2KHJA 3GD7A 4QIWE 3NENA 2PYKA 4K5XA 3F2DA 2X6GA 4UP8A 1PFSA 3U9OA 2CQAA 2DJFC 3KJOA 2MO0A 4JBKA 5HY6A 4BY1H 4B3RQ 3J81c 1WTXA 5EJWA 5C3EG 5H1SE 4A76A 5IT9L 5M5XB 1MI2A 4IFDI 5CV5A 2K6AA 2G5DA 3DHQA 4S3SA 4X3SA 4FXKC 3T4AC 3PIO3 3JC66 1ZYRC 1E2VA 1QG7A 3CP0A 2E8GA 2VZAA 4UAIA 3HOXH 3TSSA 2NVTH 2MHVA 3OWFA 5CC4A 4L5SA 3OWEB 4C3IG 2K5HA 4DV1Q 5CV6A 3H09A 2E2JB 3TP8A 3A5ZB 1CHQD 2EYFA 1CT1D 1D1KA 5L37A 5K36G 1PMRA 4EGVA 1XJVA 1VQJA 1I94Q 1HZAA 3KOJA 1LTTD 4DR2Q 1K73C 2PPBC 3H0GG 2M2LA 4NXNQ 5KYLA 5ELEA 2L15A 4JG2A 3OMGA 5FKAC 3PIPA 3LGJA 5CV7A 1LABA 4DV1L 4AQYQ 1L0WA 1MIUA 1NBWA 4UP7A 1VQ9A 1G91A 1XMQQ 4ID6A 4C3JH 4POGA 1ICFB 2HDLA 4QCLA 4JI8Q 3S16H 3GQBA 4DUYQ 2GVAA 5C44B 2RQXA 3PO3B 1L0YB 2IJ0A 4BBRB 3BVGA 4PG3A 1PYSB 4K14A 3NBHB 4HMIA 4HJ9A 4RGNA 3HKZB 3CC7A 3K0XA 3HOXB 1ASYA 2SDFA 1G6ZA 4MIUA 1QUQA 2QW7A 1YJWA 2CW0C 2F0FA 1GM5A 2UU9L 4A3BB 3QOJA 1SE4A 1ET6A 1J5EL 4KLKA 1I50H 3S1MB 1LUZA 4ULLA 1EFWA 4DR4Q 5IGGA 5BN3A 2F0KA 4J1MA 3CXCA 1H9RA 4OXPA 3TBIB 5M5XH 4KY7A 3CCQA 2NUCA 5GAGC 3S1RB 5M3MB 3HOYH 3EIVA 1EIYB 3BVZA 1SYGA 3G7LA 4BA1I 3T13A 4A3GB 2FINB 4A3KH 4BXXG 1KNEA 1D5ZC 3ULJA 2JA9A 3UDIA 1VMPA 5JOBA 2CW0D 2GVBA 2Y0SB 1H9SB 1A6XA 4BA2I 2JA6H 4HJAA 2I46A 2R6GA 2KEDA 2KOLA 3JAMi 2KECA 1BUVT 1KRTA 1BCPB 5C3WA 1M8AA 1GUWA 1WI5A 4G4KA 1LTLA 3MEFA 5T1IA 4DUZQ 2SNSA 2BOSA 2C35B 5IGBA 1PRTD 2NVYH 3VYTA 1QUQB 1B9NA 2IX0A 1EQRA 3SK6A 5IE8A 3HZXA 5JPNC 1AZPA 4NKLA 4YCVA 3S24A 4FXDA 1SNMA 1VQKA 4XIGS 5J1ZA 5ELOA 2I0QA 3A7AB 1E1OA 1STNA 1I6HB 2UUCL 4LFBL 2QA4A 2K33A 3I73A 1PH6A 3PIP3 1ESFA 3D4WA 1E24A 3ERSX 2RCFA 1PZKD 5K5PA 4RWSC 3IL8A 3KF8B 4DNIA 1JWUD 2ZM6Q 2Q8TA 1DXMA 3T16A 3A8JE 3C1EA 5ELCA 2B2WA 5CV4A 4ALPA 1LV9A 1HNXL 4K6LA 4QL5A 3MXNA 2CQOA 1C8CA 4X6AH 4JW0A 5C44H 4TSSA 3PUXA 1VQIA 1DCZA 4ZKCB 3J7AF 1KDAA 5FLXc 4KN4C 2RDHA 3E6ZX 5HURA 1IBKQ 1LM0A 2EYOA 5EKKA 2K05A 1H9MA 3TP5A 1QNUA 3OW2A 1BCPD 1AE2A 3KK7A 1KAWA 4JYAL
chains in the Genus database with same CATH topology
3CCSA 5C0XG 4JI8L 1YBYA 3EN2A 1CUKA 2ZJPA 2E5LQ 2ES2A 4HJ7A 2CWAA 4IPDA 4B3TL 3PCOB 4LW1A 4ME3A 3RNUA 4LF8Q 4LFAQ 4A3JG 1VQOA 1VQBA 1BBWA 1X3GA 3L7ZC 2ATWA 1NJIC 3UDFA 4A3GH 4XTCS 1EWIA 2ALYB 3J80c 5C4XG 3T1YQ 1Q12A 4R1JA 1G291 2EQSA 2OQ0A 4J15A 3RLOA 1P16A 3UDXA 3DLLA 2Z0SA 5M3MH 1PH5A 4C3IH 1KD1C 1GKHA 1PH2A 4NXML 3D31A 3KFUA 1V1QA 4GNXB 4JI0L 3S14H 2YV5A 1OXTA 1Q81C 5JJKA 4JI5L 3S15H 2K14A 3CCEA 1U5KA 2NZHA 3U58A 2OTLA 1FVIA 4DR4L 1UE6A 3JAMc 3PF5A 4HIKA 4DR6Q 2FXQA 2KENA 4DV7Q 2WB1E 4YY3L 4O2DA 3GO5A 4JI7Q 2K5VA 1QVCA 2AKWB 4A75A 1I94L 1HR0Q 1L1OA 3D0FA 4GOPC 1WOCA 2K4KA 2OWOA 4LF9L 4Y7NH 2QGQA 1XNQL 2E5LL 1GVPA 2IY5B 4OWTB 4MTNA 3STBD 2ZTEA 3G6EA 2E2IH 1IXRA 3HOZH 3J81j 1C9OA 2ZJRA 1PYBA 3W5OA 4OO1G 3Q8DA 3F2BA 1N36Q 4P75A 2XGTA 5AJ3Q 3PO3G 4UPAA 4R4IA 1L1OC 2F4VL 3G71A 2JJQA 3GTJH 1XPRA 2DUDA 4OO1I 1H95A 2LSSA 4P71A 1XNRQ 1KL9A 5LMNQ 2R92G 3J81i 4AIMA 2UXDQ 1HZBA 3HKZG 1N36L 1WJJA 1MJCA 5AJ3L 4A3MG 2UXBL 3BJUA 1UE1A 3GDEA 2A1AA 4LUOA 4DUZL 1A8VA 1N34Q 2WFWA 1I5FA 3SGIA 1IBLL 4KHZA 1I6HH 1CSPA 2ZTDA 4OX9L 3H3VI 3UDGA 4IPHA 1U0LA 4GN3B 4A3JH 5JJLA 4DV4Q 5JJIA 1TXYA 1CSQA 3UE0A 2PI2E 1TWGH 3KDFA 1KHIA 2IHFA 5IT9c 1L1OB 1Y1VG 1NMFA 2V1CC 2WAQG 1UE5A 3FHWA 1TWFH 4PZ7A 4JV5L 1E22A 1YITA 4HIDA 4LF6L 2VY3A 2NZOA 2MQHA 3HOVH 2UU9Q 5M3MG 4JBMA 2UUAQ 4A3KG 2F3IA 1I3QH 4DR3Q 3GTLH 1QZHA 3I56A 4LF5Q 3M4OH 1PH3A 4A3GG 2B29A 1EUJA 4OX9Q 1K9MC 4A3MH 2YTXA 4YWLA 4IFDJ 4DK6C 4A4IA 2K5NA 2R7ZG 1HNZQ 1PV4A 2R92H 2ASBA 2AWNA 3CMAA 1R9TH 2F4VQ 1Y14B 1X55A 1HZ9A 3CCRA 5C4JH 1EYGA 5LMNL 4QQBX 2Q2HA 1W3SA 2R7DA 4DR5L 2VL6A 2PMZE 5GAEC 1QVFA 1PH8A 3PUYA 4R4OA 2ZM6L 3RZOH 4O0AA 4POFA 3FKIH 4DV3Q 4A3DH 4B3TQ 1N8RC 2JK8A 4AQYL 1KIXA 3TRZA 5IP9G 1K0RA 1KRSA 1UE7A 1D7QA 1VCIA 2HT1A 2D0PA 1X6OA 1HNWQ 1V9PA 5C0XJ 1LYLA 2WB1G 2K52A 4NXNL 5C44G 2YTYA 1PH9A 1SROA 1CKNB 3FKIG 3K81C 3NEMA 3RN5A 4C2MH 1X3EA 2VNUD 2K75A 4OWWB 2Z6KA 2UUCQ 4JI2L 4DKAC 4P72A 2A8VA 3S1NH 4LFBQ 3HOWH 1GD7A 2B63H 2MFIA 2B63G 1S72A 4JI0Q 5M3FH 1B70B 2NVQH 1JJGA 4IPGA 3H15A 1OTCA 5FLMG 2VW9A 2R7ZH 1OXVA 4R4QA 4JOIA 4GS3A 3CPFA 3ICEA 3CCLA 1VS0A 1YHAA 2KHIA 2VUMH 4RMFA 4TVAB 1SRUA 2EXDA 5GADC 2I5MX 1O7IA 4GN5A 3GTMH 4BBSG 3I7FA 3HOYG 1VQFA 1VQGA 1CKMA 1YVCA 2CKZB 4YHHL 1QVGA 3TS2A 4DV2L 4K0KL 2OQKA 4JCVE 5LMNW 3F1ZA 4LFCL 4BXXH 3M7NA 1X3FA 1XNQQ 1HZCA 2IHEA 3KF6A 4LF9Q 5IP9H 3T1HQ 3GTPH 3HOUG 4IPCA 3S17H 1JB7A 1OXSC 4JI4Q 3HOUH 4A3DG 1VQ6A 4HIOA 4YWKA 4YCWA 5GAHC 4JI7L 4X62L 1SLJA 4IJLA 5C0XI 1VQMA 2Q2UA 2JEAI 3EBEA 1FL0A 3GTGH 4BY7G 1YHBA 3L0OA 1PH1A 4BY7H 3F8TA 2CCZA 1HR0W 2N3SA 1XNRL 2B3GA 4X65Q 2VUMG 3CC4A 1YIJA 4JC0A 3FP9A 3S1QH 1IBKL 1Y1WG 4DR7L 3G48A 3CQZH 1KXLA 4YWMA 5FLMH 2UXDL 3VDYA 3E9IA 1J6QA 2ZTCA 1TWHH 3CD6A 4A3LG 1G6PA 1AH9A 1EOVA 4EX5A 4DR1L 4JI3L 3BZCA 2R7FA 3RR5A 4DPGA 2QEXA 1XMOL 2CWPA 2KCMA 3CCMA 1OXXK 4LF8L 1VQEA 1FJGQ 3A0JA 3TEHB 2ID0A 3PIOA 5JEAG 3S1RH 2E2JH 2ZJQA 4HJ5A 4LF7Q 5BR8L 4GKKL 5IWAL 4JV5Q 2RHQB 1NY4A 3HFZB 2JA7G 4A3CG 3PUVA 2VQFQ 3E9HA 2VQEQ 1S40A 3HOWG 4DV7L 3ER0A 4X66Q 1VQDA 3CCJA 1XPOA 3IRBA 4DV4L 1PVOA 1IBML 1A0IA 1XPUA 2UXCL 1M1KC 3H3VH 3TREA 4NB3A 4DR2L 1JJCB 3BU2A 3U4ZA 4DV3L 4JI5Q 2YYZA 1T9HA 4GLVB 1VQPA 5M5WH 4L5TA 2AHOB 1HNXQ 4A93G 1Q1EA 1TWAH 3AEVA 2JEBI 1JJ2A 4P73A 3W1BA 5IWAQ 4DR7Q 1CKNA 1OXUA 4DV5L 1N9WA 3PUZA 1AE3A 1G51A 3H0GH 2A19A 3I55A 1XMQL 3CCVA 2N8NA 3DM3A 1PH7A 3PO3H 5IP7H 4L5RC 3KYHC 5GROA 1PA6A 2WAQE 4WJ3M 1HJPA 3U50C 2DGYA 4QJFA 4A3EH 1DGSA 2GN5A 3AQQA 2JQOA 5IY0A 1ASZA 3RN2A 3UE1A 4QGUA 2IT1A 1NE3A 4YCUA 4GNXA 1MKHA 2KHJA 3GD7A 4QIWE 3NENA 1JMCA 1Q8KA 1N33L 4B3SL 1YHQA 1A62A 1HH2P 4UP8A 3F2DA 1RIPA 1PFSA 2JE6I 3M9BA 3RZDH 1NTGA 3KJOA 2MO0A 4JBKA 1IYJB 1RL2A 2N49A 1K8AC 2BA1A 4IJHA 5HY6A 4BY1H 3PF4A 3CW2C 5IYCH 4DV6Q 4B3RQ 1K83H 3J81c 2VQEL 2CFMA 5C3EG 5H1SE 4A3FG 3TQYA 4A76A 2R93G 4YY3Q 3K80C 2IX1A 3A74A 1C0AA 5M3FG 4IFDI 4PZ8A 4LNQA 1BKBA 1SR3A 4MNOA 4IOAA 3HOVG 1SFOH 2HIVA 3JC66 1C7YA 1FGUA 4LF5L 2KBNA 4BBRG 3CP0A 2RHSB 2E8GA 4K0KQ 1PHJA 3AFPA 3ULLA 4JBJA 2LXKA 2VZAA 1KC8C 4AYBE 3PSIA 3HOXH 2UUBL 1VQ4A 1N32L 3KDFB 3NELA 4MZ9A 2NVTH 2NN6I 4L5SA 1XMOQ 1S3OA 4A3IH 4JI6Q 1QZGA 1Q82C 2K5HA 3U4VA 5IP7G 1YEZA 4DV1Q 4GKJL 4DR3L 2BH8A 2NN6G 3OYYA 4BBRH 4EQ5A 1X54A 2HIXA 3A5ZB 5EAYA 1D8LA 3S2DH 4DR6L 4KHPL 5K36G 2KCTA 2BH2A 4JYAQ 1E3PA 4X66L 4DAMA 1YJ9A 4A93H 4HIMA 4A3EG 1GO3E 1XJVA 1VQJA 1I94Q 4B3RL 1HR0L 4B3MQ 1E1TA 1XTDA 3HKSA 1HZAA 3KOJA 4DR2Q 3PO2G 1K73C 3H0GG 1KQSA 4NXNQ 3GTOH 2I5LX 1P8LA 1EQQA 2L15A 2BA0A 2F52A 4JG2A 3L2PA 1VQ8A 2YU9H 1TWCH 3PIPA 3LGJA 4AQYQ 3ZJYC 4LUVA 1L0WA 4OONA 4DV1L 1MIUA 2E2HH 2OCEA 2PQAB 3CC2A 4JI3Q 1B8AA 5LMUQ 3T1HL 4GOPB 1NBWA 3M85A 2D0OA 4UP7A 1VQ9A 1VQLA 1XMQQ 3S2HH 4UY8C 2JA8H 4C3JH 4POGA 1K8GA 1SE8A 4X64Q 4JI8Q 4H02A 4DV0L 3S16H 4DUYQ 2GVAA 4PZ6A 4B3ML 1NMGA 3CPWA 5IYCG 4IFDG 2R93H 1A63A 4PG3A 4BBSH 2Z6KC 3OTOL 3HOZG 1PYSB 2AMCB 4GNXC 3NBHB 2UXCQ 4HJ9A 3STBC 3CC7A 3K0XA 1WYDA 4LF6Q 1X56A 1Z9FA 4PMWA 4JI1L 4GLXA 5C4XH 1ASYA 1QUQA 1HNWL 2XTIA 1YJWA 3I4NH 1GM5A 2UU9L 2YTVA 2JA5H 4JI4L 3M4PA 2RF4A 1J5EL 4KLKA 1I50H 3BZKA 2NVXH 1LUZA 3WWVA 4Y52H 1EFWA 1BVSA 4B3SQ 1Q86C 1FJGL 4DR4Q 1V43A 4LF7L 3CXCA 1HNZL 1N34L 1IBLQ 2JA7H 4OXPA 3T1YL 1W2BA 3I4MG 3I4NG 4A3CH 5M5XH 3W1GA 5DLQE 3ULPA 3CCQA 4LWCA 5GAGC 5E7NA 1K3RA 1Y1WH 4QY7A 3HOYH 5C3EH 1UWVA 2I5HA 3EIVA 5FJ8H 4A3FH 1EIYB 2UUBQ 3HOXG 2UXBQ 4DV5Q 2K50A 1VQCA 4BA1I 4YHHQ 1Z47A 1EIFA 1WCMH 3PUWA 4A3KH 4DUYL 4BXXG 4A3LH 3ULJA 4X64L 3KJPA 4DV0Q 2JA9A 4X65L 5IYDH 3UDIA 3K7AH 4TQUS 1YJNA 2Q2TA 3KLWA 1IZ6A 2HQLA 2GVBA 5GQOA 4DK3C 1YNXA 2JA6G 3AYHB 4P74A 3S1MH 4BA2I 2JA6H 4X62Q 3I4OA 4HJAA 2R6GA 5IYDG 4A3BH 3JAMi 3MXNB 3PGZA 4UP9A 4JOIC 4LF4Q 4DV6L 1KRTA 4DR1Q 2VS1A 1WI5A 4DAYB 4R4CA 4HJ8A 3GTQH 4GLAC 2LXJA 1J5EQ 1LTLA 5M5YH 3OTOQ 3MEFA 5BR8Q 3AFQA 4DUZQ 2PI2A 1VQAA 4R4TA 4GKKQ 1N32Q 2H5XA 2PNHA 2OTJA 3E0EA 3RLNA 1E7ZA 4DR5Q 2D62A 4A3BG 2C35B 4LUZA 4KHPQ 4JI1Q 2NVYH 5JEAJ 5IYBG 1JT8A 3I2ZA 1M90C 3J80i 5IYBH 1WFQA 5HGQA 2RCNA 5FJ8G 1QUQB 2IX0A 1Q7YC 1EQRA 5IE8A 4JBWA 4GKJQ 5ELNA 1JE5A 1WCMG 4YCVA 3S24A 1PH4A 2Q2IA 2JA5G 1VQKA 4LF4L 4XIGS 5ELOA 2I0QA 2UUAL 2N78A 3I4MH 2EIFA 1E1OA 4IO9A 3PV0A 1X65A 4JI2Q 1Q1BA 2QA4A 2UUCL 1BBUA 4LFBL 3GTKH 3CMEA 2Y0SE 3K8AA 1VQ7A 3B6YA 4LFCQ 4WJ4A 3HKZE 1PH6A 2JA8G 4AH6A 4GOPA 1E24A 1L2FA 3ERSX 4RG1A 4IOCA 1IL2A 2PQAA 3M3YH 4AYBG 3TS0A 2MNAA 3A5UA 2Y0SG 3K7UC 3KF8B 1YZ6A 4DNIA 4JI6L 1N33Q 4NXMQ 3KF6B 2ZM6Q 3F2CA 1UEBA 4NPSA 1VQNA 1YI2A 4KI0A 1MJEA 4A3IG 2WP8J 3CCUA 4L5QA 4DV2Q 2HHHQ 3J7A5 1CKOA 4C3HH 1SN8A 4ALPA 4BY1G 1HNXL 4QL5A 3PO2H 1B7YB 2CQOA 1Y1VH 4X6AH 1Q46A 5C44H 5J3BA 1VQ5A 4OWXB 4LFAL 1X9NA 2AWOA 3PUXA 1VQIA 3M4QA 5FLXc 1VQHA 1IBMQ 3CF5A 1IBKQ 1LM0A 1SMXA 2MO1A 4GN4B 2HHHL 5LMUL 3CAMA 3G4SA 3RLFA 4APVA 3OW2A 3J7ZC 4FDBA 2VQFL 1AE2A 1KAWA 4JYAL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCS A;  5C0X G;  4JI8 L;  1YBY A;  3EN2 A;  1CUK A;  2ZJP A;  2E5L Q;  2ES2 A;  4HJ7 A;  2CWA A;  4IPD A;  4B3T L;  3PCO B;  4LW1 A;  4ME3 A;  3RNU A;  4LF8 Q;  4LFA Q;  4A3J G;  1VQO A;  1VQB A;  1BBW A;  1X3G A;  3L7Z C;  2ATW A;  1NJI C;  3UDF A;  4A3G H;  4XTC S;  1EWI A;  2ALY B;  3J80 c;  5C4X G;  3T1Y Q;  1Q12 A;  4R1J A;  1G29 1;  2EQS A;  2OQ0 A;  4J15 A;  3RLO A;  1P16 A;  3UDX A;  3DLL A;  2Z0S A;  5M3M H;  1PH5 A;  4C3I H;  1KD1 C;  1GKH A;  1PH2 A;  4NXM L;  3D31 A;  3KFU A;  1V1Q A;  4GNX B;  4JI0 L;  3S14 H;  2YV5 A;  1OXT A;  1Q81 C;  5JJK A;  4JI5 L;  3S15 H;  2K14 A;  3CCE A;  1U5K A;  2NZH A;  3U58 A;  2OTL A;  1FVI A;  4DR4 L;  1UE6 A;  3JAM c;  3PF5 A;  4HIK A;  4DR6 Q;  2FXQ A;  2KEN A;  4DV7 Q;  2WB1 E;  4YY3 L;  4O2D A;  3GO5 A;  4JI7 Q;  2K5V A;  1QVC A;  2AKW B;  4A75 A;  1I94 L;  1HR0 Q;  1L1O A;  3D0F A;  4GOP C;  1WOC A;  2K4K A;  2OWO A;  4LF9 L;  4Y7N H;  2QGQ A;  1XNQ L;  2E5L L;  1GVP A;  2IY5 B;  4OWT B;  4MTN A;  3STB D;  2ZTE A;  3G6E A;  2E2I H;  1IXR A;  3HOZ H;  3J81 j;  1C9O A;  2ZJR A;  1PYB A;  3W5O A;  4OO1 G;  3Q8D A;  3F2B A;  1N36 Q;  4P75 A;  2XGT A;  5AJ3 Q;  3PO3 G;  4UPA A;  4R4I A;  1L1O C;  2F4V L;  3G71 A;  2JJQ A;  3GTJ H;  1XPR A;  2DUD A;  4OO1 I;  1H95 A;  2LSS A;  4P71 A;  1XNR Q;  1KL9 A;  5LMN Q;  2R92 G;  3J81 i;  4AIM A;  2UXD Q;  1HZB A;  3HKZ G;  1N36 L;  1WJJ A;  1MJC A;  5AJ3 L;  4A3M G;  2UXB L;  3BJU A;  1UE1 A;  3GDE A;  2A1A A;  4LUO A;  4DUZ L;  1A8V A;  1N34 Q;  2WFW A;  1I5F A;  3SGI A;  1IBL L;  4KHZ A;  1I6H H;  1CSP A;  2ZTD A;  4OX9 L;  3H3V I;  3UDG A;  4IPH A;  1U0L A;  4GN3 B;  4A3J H;  5JJL A;  4DV4 Q;  5JJI A;  1TXY A;  1CSQ A;  3UE0 A;  2PI2 E;  1TWG H;  3KDF A;  1KHI A;  2IHF A;  5IT9 c;  1L1O B;  1Y1V G;  1NMF A;  2V1C C;  2WAQ G;  1UE5 A;  3FHW A;  1TWF H;  4PZ7 A;  4JV5 L;  1E22 A;  1YIT A;  4HID A;  4LF6 L;  2VY3 A;  2NZO A;  2MQH A;  3HOV H;  2UU9 Q;  5M3M G;  4JBM A;  2UUA Q;  4A3K G;  2F3I A;  1I3Q H;  4DR3 Q;  3GTL H;  1QZH A;  3I56 A;  4LF5 Q;  3M4O H;  1PH3 A;  4A3G G;  2B29 A;  1EUJ A;  4OX9 Q;  1K9M C;  4A3M H;  2YTX A;  4YWL A;  4IFD J;  4DK6 C;  4A4I A;  2K5N A;  2R7Z G;  1HNZ Q;  1PV4 A;  2R92 H;  2ASB A;  2AWN A;  3CMA A;  1R9T H;  2F4V Q;  1Y14 B;  1X55 A;  1HZ9 A;  3CCR A;  5C4J H;  1EYG A;  5LMN L;  4QQB X;  2Q2H A;  1W3S A;  2R7D A;  4DR5 L;  2VL6 A;  2PMZ E;  5GAE C;  1QVF A;  1PH8 A;  3PUY A;  4R4O A;  2ZM6 L;  3RZO H;  4O0A A;  4POF A;  3FKI H;  4DV3 Q;  4A3D H;  4B3T Q;  1N8R C;  2JK8 A;  4AQY L;  1KIX A;  3TRZ A;  5IP9 G;  1K0R A;  1KRS A;  1UE7 A;  1D7Q A;  1VCI A;  2HT1 A;  2D0P A;  1X6O A;  1HNW Q;  1V9P A;  5C0X J;  1LYL A;  2WB1 G;  2K52 A;  4NXN L;  5C44 G;  2YTY A;  1PH9 A;  1SRO A;  1CKN B;  3FKI G;  3K81 C;  3NEM A;  3RN5 A;  4C2M H;  1X3E A;  2VNU D;  2K75 A;  4OWW B;  2Z6K A;  2UUC Q;  4JI2 L;  4DKA C;  4P72 A;  2A8V A;  3S1N H;  4LFB Q;  3HOW H;  1GD7 A;  2B63 H;  2MFI A;  2B63 G;  1S72 A;  4JI0 Q;  5M3F H;  1B70 B;  2NVQ H;  1JJG A;  4IPG A;  3H15 A;  1OTC A;  5FLM G;  2VW9 A;  2R7Z H;  1OXV A;  4R4Q A;  4JOI A;  4GS3 A;  3CPF A;  3ICE A;  3CCL A;  1VS0 A;  1YHA A;  2KHI A;  2VUM H;  4RMF A;  4TVA B;  1SRU A;  2EXD A;  5GAD C;  2I5M X;  1O7I A;  4GN5 A;  3GTM H;  4BBS G;  3I7F A;  3HOY G;  1VQF A;  1VQG A;  1CKM A;  1YVC A;  2CKZ B;  4YHH L;  1QVG A;  3TS2 A;  4DV2 L;  4K0K L;  2OQK A;  4JCV E;  5LMN W;  3F1Z A;  4LFC L;  4BXX H;  3M7N A;  1X3F A;  1XNQ Q;  1HZC A;  2IHE A;  3KF6 A;  4LF9 Q;  5IP9 H;  3T1H Q;  3GTP H;  3HOU G;  4IPC A;  3S17 H;  1JB7 A;  1OXS C;  4JI4 Q;  3HOU H;  4A3D G;  1VQ6 A;  4HIO A;  4YWK A;  4YCW A;  5GAH C;  4JI7 L;  4X62 L;  1SLJ A;  4IJL A;  5C0X I;  1VQM A;  2Q2U A;  2JEA I;  3EBE A;  1FL0 A;  3GTG H;  4BY7 G;  1YHB A;  3L0O A;  1PH1 A;  4BY7 H;  3F8T A;  2CCZ A;  1HR0 W;  2N3S A;  1XNR L;  2B3G A;  4X65 Q;  2VUM G;  3CC4 A;  1YIJ A;  4JC0 A;  3FP9 A;  3S1Q H;  1IBK L;  1Y1W G;  4DR7 L;  3G48 A;  3CQZ H;  1KXL A;  4YWM A;  5FLM H;  2UXD L;  3VDY A;  3E9I A;  1J6Q A;  2ZTC A;  1TWH H;  3CD6 A;  4A3L G;  1G6P A;  1AH9 A;  1EOV A;  4EX5 A;  4DR1 L;  4JI3 L;  3BZC A;  2R7F A;  3RR5 A;  4DPG A;  2QEX A;  1XMO L;  2CWP A;  2KCM A;  3CCM A;  1OXX K;  4LF8 L;  1VQE A;  1FJG Q;  3A0J A;  3TEH B;  2ID0 A;  3PIO A;  5JEA G;  3S1R H;  2E2J H;  2ZJQ A;  4HJ5 A;  4LF7 Q;  5BR8 L;  4GKK L;  5IWA L;  4JV5 Q;  2RHQ B;  1NY4 A;  3HFZ B;  2JA7 G;  4A3C G;  3PUV A;  2VQF Q;  3E9H A;  2VQE Q;  1S40 A;  3HOW G;  4DV7 L;  3ER0 A;  4X66 Q;  1VQD A;  3CCJ A;  1XPO A;  3IRB A;  4DV4 L;  1PVO A;  1IBM L;  1A0I A;  1XPU A;  2UXC L;  1M1K C;  3H3V H;  3TRE A;  4NB3 A;  4DR2 L;  1JJC B;  3BU2 A;  3U4Z A;  4DV3 L;  4JI5 Q;  2YYZ A;  1T9H A;  4GLV B;  1VQP A;  5M5W H;  4L5T A;  2AHO B;  1HNX Q;  4A93 G;  1Q1E A;  1TWA H;  3AEV A;  2JEB I;  1JJ2 A;  4P73 A;  3W1B A;  5IWA Q;  4DR7 Q;  1CKN A;  1OXU A;  4DV5 L;  1N9W A;  3PUZ A;  1AE3 A;  1G51 A;  3H0G H;  2A19 A;  3I55 A;  1XMQ L;  3CCV A;  2N8N A;  3DM3 A;  1PH7 A;  3PO3 H;  5IP7 H;  4L5R C;  3KYH C;  5GRO A;  1PA6 A;  2WAQ E;  4WJ3 M;  1HJP A;  3U50 C;  2DGY A;  4QJF A;  4A3E H;  1DGS A;  2GN5 A;  3AQQ A;  2JQO A;  5IY0 A;  1ASZ A;  3RN2 A;  3UE1 A;  4QGU A;  2IT1 A;  1NE3 A;  4YCU A;  4GNX A;  1MKH A;  2KHJ A;  3GD7 A;  4QIW E;  3NEN A;  1JMC A;  1Q8K A;  1N33 L;  4B3S L;  1YHQ A;  1A62 A;  1HH2 P;  4UP8 A;  3F2D A;  1RIP A;  1PFS A;  2JE6 I;  3M9B A;  3RZD H;  1NTG A;  3KJO A;  2MO0 A;  4JBK A;  1IYJ B;  1RL2 A;  2N49 A;  1K8A C;  2BA1 A;  4IJH A;  5HY6 A;  4BY1 H;  3PF4 A;  3CW2 C;  5IYC H;  4DV6 Q;  4B3R Q;  1K83 H;  3J81 c;  2VQE L;  2CFM A;  5C3E G;  5H1S E;  4A3F G;  3TQY A;  4A76 A;  2R93 G;  4YY3 Q;  3K80 C;  2IX1 A;  3A74 A;  1C0A A;  5M3F G;  4IFD I;  4PZ8 A;  4LNQ A;  1BKB A;  1SR3 A;  4MNO A;  4IOA A;  3HOV G;  1SFO H;  2HIV A;  3JC6 6;  1C7Y A;  1FGU A;  4LF5 L;  2KBN A;  4BBR G;  3CP0 A;  2RHS B;  2E8G A;  4K0K Q;  1PHJ A;  3AFP A;  3ULL A;  4JBJ A;  2LXK A;  2VZA A;  1KC8 C;  4AYB E;  3PSI A;  3HOX H;  2UUB L;  1VQ4 A;  1N32 L;  3KDF B;  3NEL A;  4MZ9 A;  2NVT H;  2NN6 I;  4L5S A;  1XMO Q;  1S3O A;  4A3I H;  4JI6 Q;  1QZG A;  1Q82 C;  2K5H A;  3U4V A;  5IP7 G;  1YEZ A;  4DV1 Q;  4GKJ L;  4DR3 L;  2BH8 A;  2NN6 G;  3OYY A;  4BBR H;  4EQ5 A;  1X54 A;  2HIX A;  3A5Z B;  5EAY A;  1D8L A;  3S2D H;  4DR6 L;  4KHP L;  5K36 G;  2KCT A;  2BH2 A;  4JYA Q;  1E3P A;  4X66 L;  4DAM A;  1YJ9 A;  4A93 H;  4HIM A;  4A3E G;  1GO3 E;  1XJV A;  1VQJ A;  1I94 Q;  4B3R L;  1HR0 L;  4B3M Q;  1E1T A;  1XTD A;  3HKS A;  1HZA A;  3KOJ A;  4DR2 Q;  3PO2 G;  1K73 C;  3H0G G;  1KQS A;  4NXN Q;  3GTO H;  2I5L X;  1P8L A;  1EQQ A;  2L15 A;  2BA0 A;  2F52 A;  4JG2 A;  3L2P A;  1VQ8 A;  2YU9 H;  1TWC H;  3PIP A;  3LGJ A;  4AQY Q;  3ZJY C;  4LUV A;  1L0W A;  4OON A;  4DV1 L;  1MIU A;  2E2H H;  2OCE A;  2PQA B;  3CC2 A;  4JI3 Q;  1B8A A;  5LMU Q;  3T1H L;  4GOP B;  1NBW A;  3M85 A;  2D0O A;  4UP7 A;  1VQ9 A;  1VQL A;  1XMQ Q;  3S2H H;  4UY8 C;  2JA8 H;  4C3J H;  4POG A;  1K8G A;  1SE8 A;  4X64 Q;  4JI8 Q;  4H02 A;  4DV0 L;  3S16 H;  4DUY Q;  2GVA A;  4PZ6 A;  4B3M L;  1NMG A;  3CPW A;  5IYC G;  4IFD G;  2R93 H;  1A63 A;  4PG3 A;  4BBS H;  2Z6K C;  3OTO L;  3HOZ G;  1PYS B;  2AMC B;  4GNX C;  3NBH B;  2UXC Q;  4HJ9 A;  3STB C;  3CC7 A;  3K0X A;  1WYD A;  4LF6 Q;  1X56 A;  1Z9F A;  4PMW A;  4JI1 L;  4GLX A;  5C4X H;  1ASY A;  1QUQ A;  1HNW L;  2XTI A;  1YJW A;  3I4N H;  1GM5 A;  2UU9 L;  2YTV A;  2JA5 H;  4JI4 L;  3M4P A;  2RF4 A;  1J5E L;  4KLK A;  1I50 H;  3BZK A;  2NVX H;  1LUZ A;  3WWV A;  4Y52 H;  1EFW A;  1BVS A;  4B3S Q;  1Q86 C;  1FJG L;  4DR4 Q;  1V43 A;  4LF7 L;  3CXC A;  1HNZ L;  1N34 L;  1IBL Q;  2JA7 H;  4OXP A;  3T1Y L;  1W2B A;  3I4M G;  3I4N G;  4A3C H;  5M5X H;  3W1G A;  5DLQ E;  3ULP A;  3CCQ A;  4LWC A;  5GAG C;  5E7N A;  1K3R A;  1Y1W H;  4QY7 A;  3HOY H;  5C3E H;  1UWV A;  2I5H A;  3EIV A;  5FJ8 H;  4A3F H;  1EIY B;  2UUB Q;  3HOX G;  2UXB Q;  4DV5 Q;  2K50 A;  1VQC A;  4BA1 I;  4YHH Q;  1Z47 A;  1EIF A;  1WCM H;  3PUW A;  4A3K H;  4DUY L;  4BXX G;  4A3L H;  3ULJ A;  4X64 L;  3KJP A;  4DV0 Q;  2JA9 A;  4X65 L;  5IYD H;  3UDI A;  3K7A H;  4TQU S;  1YJN A;  2Q2T A;  3KLW A;  1IZ6 A;  2HQL A;  2GVB A;  5GQO A;  4DK3 C;  1YNX A;  2JA6 G;  3AYH B;  4P74 A;  3S1M H;  4BA2 I;  2JA6 H;  4X62 Q;  3I4O A;  4HJA A;  2R6G A;  5IYD G;  4A3B H;  3JAM i;  3MXN B;  3PGZ A;  4UP9 A;  4JOI C;  4LF4 Q;  4DV6 L;  1KRT A;  4DR1 Q;  2VS1 A;  1WI5 A;  4DAY B;  4R4C A;  4HJ8 A;  3GTQ H;  4GLA C;  2LXJ A;  1J5E Q;  1LTL A;  5M5Y H;  3OTO Q;  3MEF A;  5BR8 Q;  3AFQ A;  4DUZ Q;  2PI2 A;  1VQA A;  4R4T A;  4GKK Q;  1N32 Q;  2H5X A;  2PNH A;  2OTJ A;  3E0E A;  3RLN A;  1E7Z A;  4DR5 Q;  2D62 A;  4A3B G;  2C35 B;  4LUZ A;  4KHP Q;  4JI1 Q;  2NVY H;  5JEA J;  5IYB G;  1JT8 A;  3I2Z A;  1M90 C;  3J80 i;  5IYB H;  1WFQ A;  5HGQ A;  2RCN A;  5FJ8 G;  1QUQ B;  2IX0 A;  1Q7Y C;  1EQR A;  5IE8 A;  4JBW A;  4GKJ Q;  5ELN A;  1JE5 A;  1WCM G;  4YCV A;  3S24 A;  1PH4 A;  2Q2I A;  2JA5 G;  1VQK A;  4LF4 L;  4XIG S;  5ELO A;  2I0Q A;  2UUA L;  2N78 A;  3I4M H;  2EIF A;  1E1O A;  4IO9 A;  3PV0 A;  1X65 A;  4JI2 Q;  1Q1B A;  2QA4 A;  2UUC L;  1BBU A;  4LFB L;  3GTK H;  3CME A;  2Y0S E;  3K8A A;  1VQ7 A;  3B6Y A;  4LFC Q;  4WJ4 A;  3HKZ E;  1PH6 A;  2JA8 G;  4AH6 A;  4GOP A;  1E24 A;  1L2F A;  3ERS X;  4RG1 A;  4IOC A;  1IL2 A;  2PQA A;  3M3Y H;  4AYB G;  3TS0 A;  2MNA A;  3A5U A;  2Y0S G;  3K7U C;  3KF8 B;  1YZ6 A;  4DNI A;  4JI6 L;  1N33 Q;  4NXM Q;  3KF6 B;  2ZM6 Q;  3F2C A;  1UEB A;  4NPS A;  1VQN A;  1YI2 A;  4KI0 A;  1MJE A;  4A3I G;  2WP8 J;  3CCU A;  4L5Q A;  4DV2 Q;  2HHH Q;  3J7A 5;  1CKO A;  4C3H H;  1SN8 A;  4ALP A;  4BY1 G;  1HNX L;  4QL5 A;  3PO2 H;  1B7Y B;  2CQO A;  1Y1V H;  4X6A H;  1Q46 A;  5C44 H;  5J3B A;  1VQ5 A;  4OWX B;  4LFA L;  1X9N A;  2AWO A;  3PUX A;  1VQI A;  3M4Q A;  5FLX c;  1VQH A;  1IBM Q;  3CF5 A;  1IBK Q;  1LM0 A;  1SMX A;  2MO1 A;  4GN4 B;  2HHH L;  5LMU L;  3CAM A;  3G4S A;  3RLF A;  4APV A;  3OW2 A;  3J7Z C;  4FDB A;  2VQF L;  1AE2 A;  1KAW A;  4JYA L; 
#chains in the Genus database with same CATH topology
 3CCS A;  5C0X G;  4JI8 L;  1YBY A;  3EN2 A;  3BYY B;  4IPD A;  1WTR A;  3PCO B;  5EKI A;  2JA8 B;  4CGY B;  4V0B A;  1HFG A;  1NJI C;  4A3G H;  4XTC S;  2ALY B;  3K6O A;  1C4Q A;  1G29 1;  2EQS A;  3DLL A;  3UDX A;  1HQR D;  2Z0S A;  5M3M H;  4C3I H;  1PH2 A;  5JJZ A;  3D31 A;  3ND8 A;  1IYU A;  1SNC A;  1PRT B;  5J39 A;  3NSW A;  4N8F A;  4DR4 L;  1U5K A;  5KNC A;  1FNU A;  1U4M A;  4L6T B;  5I6Y A;  3JAM c;  2FXQ A;  2KEN A;  2WB1 E;  2MP1 A;  4JI7 Q;  2AKW B;  3IFD A;  1HR0 Q;  5CYU A;  4K5V A;  2K4K A;  1B1Z A;  3HP3 A;  2Q8I B;  1AZQ A;  1VMC A;  2FHT A;  1WD0 A;  3STB D;  1EYA A;  2E2I H;  4K6D A;  3HOZ H;  3J81 j;  1C9O A;  2DNE A;  1PYB A;  1ICW A;  5IGC A;  1PFN A;  4R9W A;  2ZJR A;  2XGT A;  1DJR D;  3S16 B;  3PO3 G;  1EYC A;  2A6H D;  4UPA A;  4C3J B;  3G71 A;  1H95 A;  5LMN Q;  2R92 G;  1SMY D;  2J0T D;  4A3E B;  1QCB D;  5AJ3 L;  2EJG C;  4ME5 A;  3DUZ A;  4DUZ L;  4DFA A;  1IYV A;  1I5F A;  3SDZ A;  4G7H C;  2ZTD A;  1AN8 A;  3JAM L;  4K5W A;  3R8B A;  3UDG A;  2E74 C;  1TII D;  1PRT C;  4QUF A;  1HXY D;  4RA8 A;  2PZT A;  5JJI A;  1TXY A;  4CDC C;  2VB2 X;  5IT9 c;  1L1O B;  5A2Q L;  1NMF A;  2CHB D;  2F03 A;  3FHW A;  1HA6 A;  4LF6 L;  5M3M G;  3QIA A;  4R8I A;  2F3I A;  2NZ1 D;  3GTL H;  1QZH A;  3I56 A;  4LF5 Q;  5DAU A;  4IUP A;  1PH3 A;  3P20 A;  4A3G G;  3R3O A;  1MGS A;  1K9M C;  2YTX A;  4YWL A;  4IFD J;  1HNZ Q;  4ZCK A;  3CMA A;  1RKN A;  1H9J A;  2L4N A;  5GAE C;  1QVF A;  4R4O A;  2ZM6 L;  2EDG A;  2AUK A;  3RZO H;  3FKI H;  2JK8 A;  5ISR A;  3TRZ A;  1KRS A;  4C56 C;  2HT1 A;  1X6O A;  1HNW Q;  5C0X J;  1LYL A;  5C44 G;  2YTY A;  1PH9 A;  4X3T A;  2K01 A;  3FKI G;  1TKW B;  2ICI A;  1A3V A;  1X3E A;  4C2M H;  1W6K A;  4OWW B;  1K28 A;  4JI2 L;  1DYQ A;  4DKA C;  4M1U B;  1SND A;  2O5J C;  3NQT A;  4IPG A;  3WDN A;  1OTC A;  2VW9 A;  3TP6 A;  3D3R A;  1D5X C;  4JOI A;  4GS3 A;  2F0M A;  3ICE A;  2KHI A;  3C1F A;  1GUN A;  1SRU A;  1EY9 A;  1NR2 A;  2J4X A;  1JCK B;  2OEO A;  4YHH L;  1CKM A;  3E0J A;  3NTK A;  2BDO A;  4X3K A;  1R4P B;  2F0O A;  3C2P A;  3F1Z A;  3QJY A;  4LFC L;  4CHT B;  3NK9 A;  4MN3 A;  3I4N H;  3M7N A;  2F0N A;  4JI4 Q;  1D1I A;  3PMF A;  1FD7 D;  4PNY A;  4HIO A;  3FVQ A;  1STB A;  5C0X I;  2Q2U A;  3DEP A;  1E0B A;  1F2Y A;  4BY7 G;  1WCM B;  2N55 A;  2PCF B;  4X65 Q;  1SEB D;  2VB3 X;  1YIJ A;  2JA6 B;  3S1Q H;  2WB1 B;  4DR7 L;  2QCP X;  2F3W A;  3GTO B;  2NVQ B;  1BCP C;  4YWM A;  1LTB D;  3M3Y B;  1TWH B;  5E3F A;  1LT3 D;  1TWH H;  1PFB A;  2R3Z A;  4A3L G;  2P5Z X;  2KHS A;  2K32 A;  4EX5 A;  4K8J A;  2R7F A;  2QEX A;  1F2L A;  4PMC A;  4RGO S;  2C9O A;  1Y1W B;  5BR8 L;  5IWA L;  4RFB A;  2EJF C;  1MSH A;  2JA7 G;  1S40 A;  1EWH A;  1Y69 U;  1I3Q B;  4X66 Q;  2A73 B;  4KY5 A;  3HOV B;  4X3U A;  2UXC L;  1BBX C;  3H3V H;  2EY1 A;  1RTN A;  1B3A A;  2IWH A;  3BU2 A;  3U4Z A;  4JI5 Q;  4KN7 C;  5M5W H;  3GTQ B;  1Q1E A;  4XYQ A;  3NXW A;  4Z9C B;  3A54 A;  4P73 A;  5IWA Q;  1UEA B;  1S5F D;  2A19 A;  4K2L A;  5GRO A;  1HJP A;  1L0X B;  1DGS A;  2GN5 A;  1ESR A;  3AQQ A;  5IY0 A;  4QGU A;  2IT1 A;  3AU7 A;  1NE3 A;  3BZD B;  1JMC A;  1LLR D;  5EGT A;  1YHQ A;  4I7Z C;  1RIP A;  4F8M A;  2XRQ D;  1PYW D;  1RL2 A;  1K8A C;  2ZT9 C;  3BYT B;  4IJH A;  4DV6 Q;  4JVZ A;  4JK1 C;  1BR9 A;  1I4X A;  2RA4 A;  1I4Q A;  3K80 C;  1CFM A;  1C0A A;  4XT3 B;  1BF4 A;  4PZ8 A;  2H4O A;  3GTJ B;  1M4V A;  1A15 A;  4TKO B;  3D6W A;  1Y8P B;  3DMU A;  1SR3 A;  5IOD A;  1SFO H;  2HIV A;  4CKE A;  1C7Y A;  2NN6 H;  1QB5 D;  4NW2 A;  2XSC A;  2RHS B;  3AFP A;  1KC8 C;  1N32 L;  4AYB E;  3PSI A;  2UUB L;  1VQ4 A;  3KDF B;  4MZ9 A;  2QKI C;  2NN6 I;  1XMO Q;  1S3O A;  1O7Y A;  3I91 A;  3GV3 A;  2F0W A;  1Q82 C;  2HDM A;  2HQE A;  4EQO A;  4GKJ L;  2NN6 G;  3Q23 A;  1CHP D;  1D8L A;  4DR6 L;  3OMC A;  4KHP L;  3S2H B;  2KCN A;  4HIM A;  1IKM A;  1JWM D;  4B3R L;  2Z4I A;  4E6I A;  1XTD A;  3HKS A;  1B3Q A;  1KQS A;  3L2P A;  2A68 D;  2OCE A;  2KA7 A;  5DEH A;  2E75 C;  3J7A V;  2D0O A;  3SVM A;  3W2D A;  1U4L A;  3FMC A;  3K59 A;  4RHR A;  1SE8 A;  4H02 A;  4JPB W;  3T53 B;  3PQI A;  3GTP B;  4IFD G;  2R93 H;  3OTO L;  3HOZ G;  1EY0 A;  1LT4 D;  2LS0 1;  4GNX C;  2UXC Q;  1AP0 A;  1ILP A;  1WYD A;  1KAA A;  1PTO C;  5C4X H;  2XTI A;  2VUM B;  1YNJ C;  3H91 A;  2JA5 H;  1S5D D;  4PMB A;  5I4D A;  3QOL A;  1U9R A;  2QIL A;  3BZK A;  2NVX H;  1E2W A;  4CKB A;  1LTG D;  3X3M A;  2JA7 H;  1TS2 A;  3T56 B;  3I4M G;  5FLX L;  1VF5 C;  5DLQ E;  3J80 E;  2ZXP A;  3GTK B;  4QY7 A;  4A3F H;  5FJ8 H;  2UXB Q;  2K50 A;  1Z47 A;  1WCM H;  5A35 A;  2WIN B;  4A3L H;  4HAE A;  3KJP A;  2HQL A;  5G3L D;  1KTK A;  3I4O A;  1HTP A;  5IYD G;  4A3B H;  3MXN B;  3R2T A;  1RD9 D;  4UP9 A;  4JOI C;  1EWC A;  5C4X B;  5M5Y B;  2VS1 A;  2G9D A;  3BDC A;  1JIC A;  4GLA C;  2EY6 A;  4I65 A;  3OTO Q;  1J5E Q;  1VQA A;  1N32 Q;  2H5X A;  2OTJ A;  3E0E A;  3HOU B;  2XWJ B;  3RLN A;  4DR5 Q;  4LUZ A;  4KHP Q;  4HR7 B;  2L0C A;  5IYB G;  3A8I E;  1JT8 A;  1M90 C;  5IYB H;  1WFQ A;  4RGM A;  2RCN A;  5HGQ A;  4FO2 A;  5ELN A;  2EVB A;  3TN2 A;  3VA7 A;  2HUG A;  2EJM A;  2JYO A;  2AQ1 B;  4KJO A;  4IO9 A;  3PV0 A;  1X65 A;  4JI2 Q;  5C3E B;  3HKZ E;  1SSO A;  4Q5V A;  2EE1 A;  4RKL A;  4RG1 A;  4IOC A;  1IL2 A;  4AYB G;  1JOR A;  2Y0S G;  4P2C B;  1EU3 A;  1ROD A;  1N33 Q;  3AMU A;  3F2C A;  4F88 A;  1UEB A;  3ZYY X;  2HHH Q;  4KD4 A;  4L5Q A;  3CCU A;  4DV2 Q;  1CKO A;  4C3H H;  3K5L A;  1SJH D;  3PO2 H;  3QWN A;  2L11 A;  1ML0 D;  3NUC A;  3I4M B;  2F0P A;  1B2T A;  3M4Q A;  2F0E A;  2EYP A;  1BXT A;  1TR5 A;  3CF5 A;  4GN4 B;  5AFW A;  2HHH L;  3G4S A;  4BBS B;  2SNM A;  3J7Z C;  2VQF L;  3MC0 B;  2MPM A;  3OOC A;  2ZJP A;  4HJ7 A;  2CWA A;  4LW1 A;  4LJZ C;  1VQB A;  3EQL C;  3KLS X;  4IN3 A;  3J80 c;  5C4X G;  2F0V A;  5I2Y A;  4R1J A;  4A3K G;  2OQ0 A;  4DGZ A;  1KD1 C;  3V05 A;  5EKL A;  1V1Q A;  4GNX B;  1Q81 C;  5JJK A;  1CM9 A;  5E4X A;  4JI5 L;  2K14 A;  3S9W A;  3U58 A;  1I4G A;  1FVI A;  3DWQ A;  5C4J B;  2BCO A;  1KNA A;  2RSO A;  4YY3 L;  3GO5 A;  1I94 L;  2R92 B;  1SE3 A;  1DON A;  1ONL A;  1L1O A;  3D0F A;  4C3J G;  4LF9 L;  4Y7N H;  2QGQ A;  1XNQ L;  4HCS A;  1EFI D;  2E5L L;  1GVP A;  5C0X H;  3JAM E;  3G6E A;  1AEX A;  2K5Q A;  1OO9 B;  3TP7 A;  1HA5 A;  4OO1 G;  3Q8D A;  1STA A;  4P75 A;  1Q90 A;  1GOZ A;  3W3A A;  2CH4 W;  2WKC A;  2DY8 A;  1XPR A;  2JJQ A;  1ILQ A;  3GTJ H;  4OO1 I;  1TS3 A;  1CI3 M;  1LT5 D;  4A3J B;  1KL9 A;  4KHV A;  2EYM A;  1I4R A;  1B50 A;  4ZLT F;  2SEB D;  1MJC A;  2Z1C A;  3MWY W;  4A3M G;  2IPK D;  1UE1 A;  1KDB A;  1IW7 C;  1N34 Q;  5NUC A;  4KHZ A;  1B44 D;  1CSP A;  5LHY 1;  4L8J A;  1JR0 D;  1U0L A;  4GN3 B;  2B8G A;  4DV4 Q;  1CSQ A;  1O78 A;  3KDF A;  1KHI A;  2D2C C;  2WAQ G;  2AQ3 B;  3QO2 A;  3A56 A;  2MQH A;  2UU9 Q;  4JBM A;  3I8Z A;  3EA6 A;  4F7X A;  4F87 A;  4ABN A;  4N9T A;  2K5D A;  2NVT B;  2NWG A;  2R61 A;  2EXZ A;  4A3M H;  1GUO A;  5M5W B;  4FP5 D;  1ET9 A;  3SK4 A;  1R9T H;  5C5M A;  4DAP A;  2ZXR A;  3MA2 B;  3N6R A;  1O80 A;  1EYG A;  5LMN L;  4QQB X;  4FXG C;  3A55 A;  2A5H A;  4XQQ A;  2EOT A;  3K57 A;  4M8A A;  4O0A A;  4POF A;  4DNT B;  4A3D H;  5I9P A;  1KIX A;  5IP9 G;  1K0R A;  1UE7 A;  1VCI A;  4RAU C;  2D0P A;  4N9P A;  5FO8 B;  1NAP A;  3K81 C;  3NEM A;  1EOT A;  2B2T C;  2VNU D;  3D4R A;  1TQO A;  2B63 H;  3URY A;  2K1B A;  3VR4 A;  2NVQ H;  1JJG A;  1B70 B;  3H15 A;  2NVY B;  4R4Q A;  1EZ6 A;  4DXF A;  2A69 C;  2AUJ D;  5ELB A;  4BY7 B;  1YHA A;  2E76 C;  3GTG B;  2EXD A;  3I4L A;  4GN5 A;  3GTM H;  4BBS G;  1MD2 D;  2AQ2 B;  1VQF A;  1VQG A;  1YVC A;  2CKZ B;  3TS2 A;  3I3C A;  4K0K L;  3D6C A;  5LMN W;  3F2U A;  1XNQ Q;  3I4M H;  1QE6 A;  5IP9 H;  5M3F B;  1JQY D;  2GA4 B;  4IUT A;  3I72 A;  4A3D G;  2B63 B;  5GAH C;  4JI7 L;  2A68 C;  1Y8N B;  4X62 L;  1SYB A;  2EY5 A;  1O7L A;  1FL0 A;  3GTG H;  1LTI D;  1SYC A;  1SJE D;  4FF2 A;  4BY7 H;  1RF2 D;  3MFG A;  3HOY B;  1PLF A;  1Y1W G;  4DA2 A;  2UXD L;  3WOE A;  3NHH A;  3VDY A;  1CA5 A;  4C2M B;  2L5T A;  4PQX A;  5C4H A;  3RR5 A;  1QNK A;  2DNC A;  2RDG A;  2CWP A;  3SR1 A;  2D9U A;  4LF7 Q;  3R93 A;  5LL6 S;  3PIO A;  4DK0 A;  2ZJQ A;  1LO5 D;  1WTO A;  1EIG A;  4JV5 Q;  5IGE A;  1NY4 A;  2H1E A;  1PZJ D;  4DAY A;  3HS0 C;  2VQE Q;  3VR3 A;  3TZU A;  3RZO B;  3ER0 A;  1VQD A;  3BDL A;  3VYR A;  1A0I A;  1TT2 A;  3E3X A;  4DR2 L;  1R9T B;  3H94 A;  2YYZ A;  1T9H A;  1J9O A;  4GLV B;  4OIK A;  1FR3 A;  1TWG B;  2F0H A;  4L5T A;  3I70 A;  4J6H A;  5DM6 3;  1F2Z A;  2MJ8 A;  3W1B A;  4DR7 Q;  4OO1 H;  2K04 A;  1XTC D;  4DV5 L;  3H3V C;  1STG A;  1AE3 A;  3H0G H;  3I55 A;  1XMQ L;  1MHW C;  2N8N A;  4WJ3 M;  2WAQ E;  3Q22 A;  1TY2 A;  2JQO A;  1ASZ A;  3RN2 A;  5KGU A;  1MKH A;  1BNZ A;  1Q8K A;  3RZD H;  1HH2 P;  2NBF A;  3M9B A;  5BN4 A;  1AW7 A;  4WFN 3;  2N49 A;  2BA1 A;  2PNR C;  3CW2 C;  2LY7 A;  4FF1 A;  4TRD A;  3BG3 A;  1NUC A;  4A3F G;  3TQY A;  2JA7 B;  3ND9 A;  5M3F G;  5EPJ A;  1BKB A;  2SOB A;  5I9O A;  4MNO A;  4IOA A;  2NVX B;  1GUS A;  1T5E A;  3BDO A;  1QWY A;  1HCZ A;  4UHV A;  4LF5 L;  4K0K Q;  1PHJ A;  2L55 A;  2LXK A;  3NQI A;  2NTT A;  4WRD A;  4JI6 Q;  1QZG A;  3RD4 A;  3U4V A;  5IP7 G;  1YEZ A;  5IT9 E;  2WV6 D;  1X54 A;  2HIX A;  5EAY A;  2CVR A;  1STE A;  2KCT A;  2L1B A;  1E3P A;  1SNQ A;  1FNW A;  4DAM A;  1YJ9 A;  4A3E G;  1GO3 E;  1XXG A;  4B3M Q;  1B9M A;  4ZYS A;  5BN5 A;  3GTO H;  1TWC B;  1P8L A;  3P7J A;  4HCE A;  1EQQ A;  2YU9 H;  2BA0 A;  1VQ8 A;  4FYD A;  1TWC H;  3KF8 A;  1K0S A;  5FO9 B;  2E2H H;  4EQN A;  3CKI B;  1B8A A;  2F0J A;  2F1M A;  2FFK B;  3QR8 A;  1VQL A;  3M85 A;  2JA8 H;  3L3O C;  1K8G A;  4X64 Q;  4DV0 L;  4PZ6 A;  4B3M L;  1NMG A;  3CPW A;  3KLS A;  5IYC G;  1A63 A;  4BBS H;  2Z6K C;  3IKJ A;  3STB C;  4XQJ A;  5EPL A;  1X56 A;  1Z9F A;  4JI1 L;  1QJO A;  1HNW L;  3L9A X;  2E2D C;  1Z7T A;  1EEI D;  1GXD C;  4G57 A;  4JI4 L;  3NWS A;  5JVG 3;  5FK9 C;  1ZKO A;  3WWV A;  4Y52 H;  4K2K A;  1BVS A;  1Q86 C;  1V43 A;  4LF7 L;  1N34 L;  2EY2 A;  4A3C H;  3T1Y L;  3ERO A;  1W2B A;  3I4N G;  1JOO A;  4LWC A;  5E7N A;  4LAA A;  1TS4 A;  1K3R A;  2I5H A;  1VQC A;  4YHH Q;  1EIF A;  4L63 B;  4X65 L;  4TQU S;  2KJX A;  4KJN A;  2PO4 A;  2Q2T A;  3KLW A;  1IZ6 A;  1HFN A;  2B2W C;  4IUU A;  4DF7 A;  3ERQ A;  4DK3 C;  1KAB A;  2LKV A;  3AYH B;  1EEF D;  1I50 B;  4BS9 A;  3EFX D;  1TS5 A;  3S1M H;  2I07 B;  1SMY C;  3A7L A;  3PGZ A;  4C1N I;  4DV6 L;  1RJT A;  4HMJ A;  5M5Y H;  3HEJ A;  5BR8 Q;  3AFQ A;  2PI2 A;  1ZEQ X;  4XXE A;  4GKK Q;  2PNH A;  1E7Z A;  2RBM A;  4A3B G;  1LT6 D;  4JI1 Q;  1Y1V B;  1WVL A;  3I2Z A;  2OTL A;  3J80 i;  3HGB A;  1JE5 A;  2NTS A;  3IFT A;  1PH4 A;  3NBH A;  1S4Z A;  2Q2I A;  5CMD A;  3NE5 B;  3SE0 A;  2UUA L;  2N78 A;  2EIF A;  1HUM A;  1Q1B A;  2R7Z B;  1BBU A;  3GTK H;  2PZU A;  3U9S A;  3S1N B;  4GOP A;  5JVH 3;  2MNA A;  3M4Y A;  3K7U C;  3S2D B;  4JI6 L;  2N88 A;  4NXM Q;  1II3 A;  3KF6 B;  1IW7 D;  1HHV A;  4NPS A;  5EQ0 A;  4A3I G;  1YNN C;  3J7A 5;  4KMU C;  4ZAI A;  4BY1 G;  1EZ8 A;  2DN8 A;  1Y1V H;  3I4N B;  1Q46 A;  1VQ5 A;  1Y8O B;  4LFA L;  1X9N A;  2X6L A;  1UAP A;  3N52 A;  1VQH A;  2F0U A;  1IBM Q;  1SNP A;  3CAM A;  2Q8R E;  3RLF A;  3OHX C;  1G2S A;  1X3P A;  2IL8 A;  4FDB A;  1NNX A;  5KIX A;  5IGF A;  2ES2 A;  2E5L Q;  3K5N A;  4B3T L;  3LX0 A;  3TDQ A;  2JN4 A;  2A69 D;  3CHB D;  4ME3 A;  4LFA Q;  1X3G A;  1QOH A;  2BDN A;  3L7Z C;  1WTP A;  1U4P A;  3LNN A;  1V1O A;  1Q12 A;  4FF4 A;  1PH5 A;  1P16 A;  3NP8 A;  2B8F A;  3HOZ B;  4FVM A;  4C3H G;  1DOK A;  4NXM L;  4G7Z C;  3KFU A;  5JEA H;  1IL8 A;  4ZK9 B;  3C3L A;  3FEW X;  3CCE A;  3S15 H;  4DR6 Q;  2Z4H A;  5CGK A;  3PF5 A;  4HIK A;  1V1P B;  4DV7 Q;  1SBB B;  2KQ3 A;  2TMP A;  3BVM A;  1EIH A;  2K5V A;  1QVC A;  3V96 A;  4A75 A;  2FMC A;  1FNV A;  1PTO F;  1RTO A;  4A3M B;  2OWO A;  3OIQ A;  2IY5 B;  4OWT B;  4MTN A;  1CZW A;  4C3I B;  1SFO B;  3F2B A;  1N36 Q;  4K8I A;  4C1N K;  1K8M A;  1DD2 A;  4NP5 A;  2F4V L;  4P71 A;  3D4D A;  4LMQ D;  1HZB A;  3K5M A;  3OW7 A;  1WJJ A;  2E2H B;  4UDU C;  2UXB L;  3BJU A;  3GDE A;  2A1A A;  4LUO A;  3H0G B;  3HG9 A;  4H7B A;  5COY A;  3SGI A;  1IBL L;  3H3V I;  4OX9 L;  4IPH A;  1RHP A;  4A3J H;  1UNS A;  3VR6 A;  3UE0 A;  2PI2 E;  1WD1 A;  1TWG H;  4U68 A;  4DNR B;  3K58 A;  4CDD C;  1UE5 A;  4HSP A;  2EZV A;  4HTH A;  3NPP A;  4KKS A;  4CJ1 B;  2VY3 A;  2NZO A;  3HOV H;  4WJW A;  2UUA Q;  3J80 L;  1I3Q H;  2A6H C;  2EYJ A;  3M4O H;  2B2Y A;  1EUJ A;  2QDL A;  2Z9H A;  4OX9 Q;  1I4H A;  3C46 A;  4B9W A;  4A4I A;  2TSS A;  2K5N A;  2R7Z G;  2R92 H;  1PXU A;  1SNO A;  2ASB A;  2X69 A;  1Y14 B;  5DNF A;  1X55 A;  1HZ9 A;  4DN4 M;  2Z8L A;  5C4J H;  2WKD A;  1W3S A;  2A6E D;  4DR5 L;  2OXP A;  4AYB B;  1CQV A;  3DXJ C;  4C3H B;  4DV3 Q;  1GUG A;  4B3T Q;  1N8R C;  4QF4 A;  2VXW A;  4AQY L;  3S1Q B;  1D7Q A;  2O5I C;  3CRK C;  1F9R A;  4NXN L;  3MZ5 A;  3G6J B;  1SRO A;  3TME A;  2OT2 A;  3RN5 A;  3CU7 A;  2K75 A;  4Q0F A;  4EQP A;  4P72 A;  2A8V A;  1EY6 A;  3S1N H;  4WOR A;  2MFI A;  1I6V C;  2F0D A;  3WOF A;  4BWG B;  2B63 G;  1S72 A;  5M3F H;  3OIP A;  2R7Z H;  5FLM G;  1OXV A;  3CPF A;  3CCL A;  2VUM H;  4RMF A;  2XWB B;  4TVA B;  4CDE C;  2JSO A;  1VDZ A;  3I7F A;  4RGT A;  3HOY G;  1QVG A;  3M4O B;  1DM0 B;  4DV2 L;  3NTH A;  1S5E D;  2WAC A;  5EBD A;  3S17 B;  4BXX H;  1X3F A;  4KKU A;  3GTP H;  3KF6 A;  3T1H Q;  4DXG A;  3HOU G;  5CV9 A;  2ZXO A;  1JB7 A;  3E5S A;  4YWK A;  3Q24 A;  4RHS A;  4IJL A;  2JEA I;  1VQM A;  2MUY A;  1GJX A;  2XVS A;  1EQV A;  4A3K B;  5COR A;  4ILW A;  3L0O A;  4G7O C;  1PDQ A;  4DAV A;  2B2Y C;  2B3G A;  2F0I A;  4RKB A;  1SAP A;  1KLU D;  4JC0 A;  1YNN D;  1EY4 A;  1F9P A;  3CQZ H;  3SEB A;  1KXL A;  3FDT A;  1YNJ D;  3E9I A;  1J6Q A;  4GZY C;  5LL6 X;  1LTR D;  3CD6 A;  1AH9 A;  5DM7 3;  3RMH A;  5EPK A;  4JI3 L;  1XMO L;  3CCM A;  2EYH A;  1D6E C;  2IX3 A;  4LF8 L;  1G2T A;  1VQE A;  1FJG Q;  2F0G A;  3A0J A;  4V19 0;  4GKK L;  3KLR A;  3FPU B;  2RHQ B;  3KUP A;  2VQF Q;  3E9H A;  3MHB A;  3IAY A;  3CCJ A;  3EVQ A;  3CRL C;  4DV4 L;  4KTA A;  1PVO A;  1XPU A;  1M1K C;  2O2L D;  1STY A;  3TRE A;  1H9S A;  1EY8 A;  5CBE E;  4DV3 L;  1VQP A;  2NB0 A;  1HNX Q;  2AHO B;  3BS1 A;  4A93 G;  3A8K E;  1TWA H;  3LWU A;  1F9Q A;  1JB3 A;  1A3U A;  1Z6H A;  1JJ2 A;  3QG1 A;  4EVO A;  5I6W A;  2R93 B;  1N9W A;  1G51 A;  1PH7 A;  3CCV A;  1NR4 A;  2KEE A;  3U50 C;  1LTA D;  2LFN A;  4QJF A;  4CJ2 C;  3NWT A;  1SYE A;  1ENA A;  4GNX A;  1BCP F;  3T51 B;  4B3S L;  1A62 A;  2JE6 I;  4ZKB B;  1NTG A;  1IYJ B;  2A74 C;  1UUP A;  3PF4 A;  5IYC H;  1K83 H;  2VQE L;  2CFM A;  2V4D A;  3HRZ C;  3SHL A;  5C5L A;  4IFD H;  4YY3 Q;  2R93 G;  1JE4 A;  2IX1 A;  1A2T A;  3A74 A;  4Y7N B;  1R4Q B;  4LNQ A;  2HD3 A;  3HOV G;  1F9S A;  1WTH A;  1FGU A;  2KBN A;  4BBR G;  1HRJ A;  3ULL A;  4JBJ A;  4J8Q A;  2DJG C;  3NEL A;  1PFM A;  2F0T A;  4A3I H;  1HQM C;  3EJI A;  2KUM A;  5IOC A;  2B2U A;  5FO7 B;  4DR3 L;  2BH8 A;  3OYY A;  4BBR H;  4EQ5 A;  1K83 B;  3OSO A;  2XN9 C;  3DEO A;  2F0Q A;  3S2D H;  1BQQ T;  2BH2 A;  4JYA Q;  3DM1 A;  4X66 L;  4A93 H;  4FF3 A;  2A6E C;  1PRT F;  1HR0 L;  1TU2 B;  1E1T A;  3PO2 G;  1ZXT A;  2I5L X;  2F3V A;  1EU4 A;  2F52 A;  1D2B A;  2K7V A;  4L5R C;  3ZJY C;  4LUV A;  4OON A;  3MAQ A;  2PQA B;  3CC2 A;  4JI3 Q;  2K03 A;  5LMU Q;  3T1H L;  3RZD B;  5D3I B;  2JP1 A;  4KD3 A;  4GOP B;  4QB4 A;  2EYL A;  3S2H H;  4NDX A;  4UY8 C;  1HPC A;  2C5C A;  4XT1 B;  2WAQ B;  1E2Z A;  2AMC B;  1SDF A;  2DY7 A;  5TSS A;  4LF6 Q;  4PMW A;  4GLX A;  1JWS D;  3AB9 A;  5D65 A;  5M9O A;  2YTV A;  1LTS D;  3OPO A;  3M4P A;  5FOB B;  2RF4 A;  2RDF A;  4XYO A;  1D5M C;  1O7Z A;  5J22 A;  4B3S Q;  2OF1 A;  4ZUI A;  1FJG L;  1JOQ A;  1HNZ L;  2XIW A;  1IBL Q;  3DWA A;  3MFY A;  1A2U A;  3W1G A;  3Q6S A;  1MSG A;  3ULP A;  1EQT A;  1CTM A;  3CQZ B;  3K5O A;  1KLG D;  2QEJ C;  1Y1W H;  5KEE A;  5C3E H;  1UWV A;  2UUB Q;  3HOX G;  4DV5 Q;  3GV6 A;  3PUW A;  5A2Q E;  2HCC A;  4DUY L;  1Q8I A;  4X64 L;  4DV0 Q;  5IYD H;  1DOM A;  1BO0 A;  3FKI B;  3K7A H;  2D5D A;  2QDB A;  1YJN A;  5GQO A;  1YNX A;  2JA6 G;  4H44 C;  4P74 A;  4X62 Q;  2PMZ B;  4QMG A;  5D14 A;  1GHK A;  3VYU A;  4LF4 Q;  1CQF A;  4OHJ A;  4DR1 Q;  4LK1 C;  4DAY B;  4R4C A;  5KRU A;  4HJ8 A;  3GTQ H;  2LXJ A;  1QIL A;  4NMZ A;  2WII B;  4R4T A;  3GTL B;  2D62 A;  5JEA J;  5CR3 A;  5KNB A;  3PO2 B;  1ENC A;  1LAC A;  3R2I A;  5FJ8 G;  1Q7Y C;  3HOW B;  5EBC A;  3ITP A;  4JBW A;  4HSV A;  4GKJ Q;  1WCM G;  4IUQ A;  1XWE A;  2KCC A;  5D3D A;  2JA5 G;  5C6A A;  4LF4 L;  4A3F B;  2YU9 B;  2B39 A;  3KBX A;  3V2T A;  3CME A;  2Y0S E;  1CA6 A;  3K8A A;  1VQ7 A;  3B6Y A;  4LFC Q;  4WJ4 A;  4ODG A;  2JA8 G;  4RCN A;  4AH6 A;  3VR5 A;  3Q0A A;  4KV6 A;  1L2F A;  4A93 B;  4OIJ A;  3M3Y H;  2PQA A;  1PTO B;  3TS0 A;  3A5U A;  4U67 3;  1YZ6 A;  5CBA E;  2ENB A;  1NSN S;  4YIJ A;  1SXT A;  5F2D A;  2L12 A;  1EYD A;  2MGS A;  3X3N A;  4KK7 A;  1YI2 A;  1VQN A;  2JA5 B;  4KI0 A;  1MJE A;  4OEM B;  2WP8 J;  5T1G A;  4B9X A;  4N8X 1;  4A3D B;  1SN8 A;  1I4P A;  4OL7 A;  4IAL A;  3MEH A;  1B7Y B;  1HTL D;  4HN7 A;  5J3B A;  2K28 A;  4OWX B;  2F4I A;  5FLX E;  1TWF B;  5C3X A;  2AWO A;  2BE5 D;  2F0L A;  4RCO A;  2CH4 A;  2K5W A;  4ZRZ A;  3S14 B;  1SMX A;  2MO1 A;  5LMU L;  4MHE A;  4APV A;  4DU9 A;  1CUK A;  4IUN A;  3VYS A;  1KDC A;  1SYF A;  2PW7 A;  1SE2 A;  3RNU A;  4LF8 Q;  1TY0 A;  4A3J G;  1VQO A;  1BBW A;  1X32 A;  2ATW A;  1T5X D;  1IKL A;  3UDF A;  1EWI A;  1STH A;  2FJ2 A;  4MTK A;  1K8O A;  3T1Y Q;  3RLO A;  1RDP D;  3MTS A;  4J15 A;  2G9H D;  3VR2 A;  1GKH A;  2BE5 C;  2PW5 A;  4I7A A;  4JI0 L;  3S14 H;  2YV5 A;  1OXT A;  1TWA B;  1J8I A;  1EY5 A;  2EPB A;  2NZH A;  2XNA C;  1WTV A;  1UE6 A;  3SXH A;  4O2D A;  2L9H A;  3S15 B;  4H0L C;  1WOC A;  4GOP C;  1EL0 A;  1GUT A;  2ZTE A;  1IXR A;  3M7G A;  2B2V C;  1FYC A;  3W5O A;  5AJ3 Q;  4R4I A;  1L1O C;  2DUD A;  2LSS A;  1XNR Q;  5CV8 A;  2FMM A;  1JOK A;  3J81 i;  4AIM A;  2UXD Q;  3KBG A;  1XYI A;  3HKZ G;  2IW3 A;  1N36 L;  1EY7 A;  5KYI A;  1A8V A;  4BY1 B;  2WFW A;  3J7Y W;  5ELF A;  4O42 A;  1I6H H;  1JC7 A;  3SK5 A;  3J81 L;  5JJL A;  4IQZ A;  1CZG A;  2IHF A;  1TVX A;  3ONA B;  3GP7 A;  1Y1V G;  1ZYR D;  2V1C C;  4B08 A;  4PZ7 A;  1TWF H;  4JV5 L;  1E22 A;  1YIT A;  4HID A;  1BDO A;  2RSN A;  1SYD A;  2E2I B;  1V1P A;  4OGQ C;  1C48 A;  2ICE C;  4DR3 Q;  1Q3L A;  4KKT A;  2B29 A;  3GTM B;  1F2M A;  5C4Z A;  4DK6 C;  4CDF C;  3K0Y A;  1PV4 A;  4IUV A;  2AWN A;  1W6J A;  2F4V Q;  4HED A;  3CCR A;  1U4R A;  1VF7 A;  2Q2H A;  1PTO H;  2R7D A;  2VL6 A;  1WTQ A;  2PMZ E;  2Z6B A;  1PH8 A;  3PUY A;  5HGT A;  3K7A B;  3D8G A;  3MXU A;  4RH6 A;  5IIF A;  5KND A;  1BOS A;  4O1N A;  1V9P A;  2WB1 G;  2K52 A;  4XQN A;  4KY6 A;  4OEL B;  4ZUJ A;  1CKN B;  1H9K A;  3TZD A;  5IGD A;  3MVV A;  1B4O A;  3MXP A;  4QUC A;  2Z6K A;  2UUC Q;  4LFB Q;  4H13 C;  3UI2 A;  3HOW H;  1GD7 A;  4XDX A;  4JI0 Q;  1X3Q A;  4FNF A;  3LWE A;  2M9V A;  1VS0 A;  1G8Z D;  1GHJ A;  3P75 A;  5GAD C;  2I5M X;  1O7I A;  2HCI A;  4CJ0 B;  1S5C D;  2KVM A;  1CK1 A;  2NYZ D;  1V8Q A;  2LMC B;  2OQK A;  1DZ1 A;  4JCV E;  4ZQ3 A;  1HZC A;  2IHE A;  3O13 A;  4LF9 Q;  4IPC A;  1K3B C;  5ELD A;  3S17 H;  1OXS C;  3HOU H;  1VQ6 A;  5G3L F;  1A3T A;  1F77 A;  3NTI A;  4QIW B;  4YCW A;  3SK8 A;  1HUN A;  5JAV A;  1SLJ A;  5E1F A;  3EBE A;  1PZI D;  1YHB A;  1PH1 A;  1XX8 A;  3F8T A;  3FRP B;  2B2V A;  2RVL A;  1HR0 W;  2N3S A;  2CCZ A;  1XNR L;  2O4X A;  2VUM G;  3CC4 A;  3FP9 A;  1IBK L;  3G48 A;  5FLM H;  1S5B D;  2PQE A;  4R8N A;  2ZTC A;  5K36 H;  1G6P A;  1EOV A;  4DR1 L;  3BZC A;  4DPG A;  4DK1 A;  2KCM A;  1RCV D;  2RKS A;  1OXX K;  1B53 A;  2JXM B;  3P1H A;  3TEH B;  1MBY A;  2ID0 A;  3S1R H;  5JEA G;  2E2J H;  4HJ5 A;  4CBV A;  5I2X A;  4A3C G;  3HFZ B;  4A3I B;  3PUV A;  2M00 A;  4PV1 C;  3HOW G;  3QB3 A;  4DV7 L;  4IUR A;  1XPO A;  3IRB A;  4IZ8 A;  3H6M A;  1IBM L;  2J7Z A;  4NB3 A;  3NBI A;  1JJC B;  2B2T A;  3J81 E;  1WTW A;  2XRS D;  4CKC A;  3DWP A;  3AEV A;  2JEB I;  3VA5 A;  1DOL A;  1PTO D;  1CKN A;  2PZW A;  1OXU A;  3PUZ A;  3RUZ A;  2F0S A;  3PO3 H;  3I90 A;  3FPP A;  3DM3 A;  5IP7 H;  1IHZ A;  3KYH C;  1FGB D;  1PA6 A;  5E4W C;  2DGY A;  5JPM C;  2QF7 A;  4A3E H;  2B2U C;  3MXG A;  1NCV A;  3UE1 A;  1AFP A;  1ENF A;  4YCU A;  1N33 L;  2KHJ A;  3GD7 A;  4QIW E;  3NEN A;  2PYK A;  4K5X A;  3F2D A;  2X6G A;  4UP8 A;  1PFS A;  3U9O A;  2CQA A;  2DJF C;  3KJO A;  2MO0 A;  4JBK A;  5HY6 A;  4BY1 H;  4B3R Q;  3J81 c;  1WTX A;  5EJW A;  5C3E G;  5H1S E;  4A76 A;  5IT9 L;  5M5X B;  1MI2 A;  4IFD I;  5CV5 A;  2K6A A;  2G5D A;  3DHQ A;  4S3S A;  4X3S A;  4FXK C;  3T4A C;  3PIO 3;  3JC6 6;  1ZYR C;  1E2V A;  1QG7 A;  3CP0 A;  2E8G A;  2VZA A;  4UAI A;  3HOX H;  3TSS A;  2NVT H;  2MHV A;  3OWF A;  5CC4 A;  4L5S A;  3OWE B;  4C3I G;  2K5H A;  4DV1 Q;  5CV6 A;  3H09 A;  2E2J B;  3TP8 A;  3A5Z B;  1CHQ D;  2EYF A;  1CT1 D;  1D1K A;  5L37 A;  5K36 G;  1PMR A;  4EGV A;  1XJV A;  1VQJ A;  1I94 Q;  1HZA A;  3KOJ A;  1LTT D;  4DR2 Q;  1K73 C;  2PPB C;  3H0G G;  2M2L A;  4NXN Q;  5KYL A;  5ELE A;  2L15 A;  4JG2 A;  3OMG A;  5FKA C;  3PIP A;  3LGJ A;  5CV7 A;  1LAB A;  4DV1 L;  4AQY Q;  1L0W A;  1MIU A;  1NBW A;  4UP7 A;  1VQ9 A;  1G91 A;  1XMQ Q;  4ID6 A;  4C3J H;  4POG A;  1ICF B;  2HDL A;  4QCL A;  4JI8 Q;  3S16 H;  3GQB A;  4DUY Q;  2GVA A;  5C44 B;  2RQX A;  3PO3 B;  1L0Y B;  2IJ0 A;  4BBR B;  3BVG A;  4PG3 A;  1PYS B;  4K14 A;  3NBH B;  4HMI A;  4HJ9 A;  4RGN A;  3HKZ B;  3CC7 A;  3K0X A;  3HOX B;  1ASY A;  2SDF A;  1G6Z A;  4MIU A;  1QUQ A;  2QW7 A;  1YJW A;  2CW0 C;  2F0F A;  1GM5 A;  2UU9 L;  4A3B B;  3QOJ A;  1SE4 A;  1ET6 A;  1J5E L;  4KLK A;  1I50 H;  3S1M B;  1LUZ A;  4ULL A;  1EFW A;  4DR4 Q;  5IGG A;  5BN3 A;  2F0K A;  4J1M A;  3CXC A;  1H9R A;  4OXP A;  3TBI B;  5M5X H;  4KY7 A;  3CCQ A;  2NUC A;  5GAG C;  3S1R B;  5M3M B;  3HOY H;  3EIV A;  1EIY B;  3BVZ A;  1SYG A;  3G7L A;  4BA1 I;  3T13 A;  4A3G B;  2FIN B;  4A3K H;  4BXX G;  1KNE A;  1D5Z C;  3ULJ A;  2JA9 A;  3UDI A;  1VMP A;  5JOB A;  2CW0 D;  2GVB A;  2Y0S B;  1H9S B;  1A6X A;  4BA2 I;  2JA6 H;  4HJA A;  2I46 A;  2R6G A;  2KED A;  2KOL A;  3JAM i;  2KEC A;  1BUV T;  1KRT A;  1BCP B;  5C3W A;  1M8A A;  1GUW A;  1WI5 A;  4G4K A;  1LTL A;  3MEF A;  5T1I A;  4DUZ Q;  2SNS A;  2BOS A;  2C35 B;  5IGB A;  1PRT D;  2NVY H;  3VYT A;  1QUQ B;  1B9N A;  2IX0 A;  1EQR A;  3SK6 A;  5IE8 A;  3HZX A;  5JPN C;  1AZP A;  4NKL A;  4YCV A;  3S24 A;  4FXD A;  1SNM A;  1VQK A;  4XIG S;  5J1Z A;  5ELO A;  2I0Q A;  3A7A B;  1E1O A;  1STN A;  1I6H B;  2UUC L;  4LFB L;  2QA4 A;  2K33 A;  3I73 A;  1PH6 A;  3PIP 3;  1ESF A;  3D4W A;  1E24 A;  3ERS X;  2RCF A;  1PZK D;  5K5P A;  4RWS C;  3IL8 A;  3KF8 B;  4DNI A;  1JWU D;  2ZM6 Q;  2Q8T A;  1DXM A;  3T16 A;  3A8J E;  3C1E A;  5ELC A;  2B2W A;  5CV4 A;  4ALP A;  1LV9 A;  1HNX L;  4K6L A;  4QL5 A;  3MXN A;  2CQO A;  1C8C A;  4X6A H;  4JW0 A;  5C44 H;  4TSS A;  3PUX A;  1VQI A;  1DCZ A;  4ZKC B;  3J7A F;  1KDA A;  5FLX c;  4KN4 C;  2RDH A;  3E6Z X;  5HUR A;  1IBK Q;  1LM0 A;  2EYO A;  5EKK A;  2K05 A;  1H9M A;  3TP5 A;  1QNU A;  3OW2 A;  1BCP D;  1AE2 A;  3KK7 A;  1KAW A;  4JYA L; 
#chains in the Genus database with same CATH homology
 3CCS A;  5C0X G;  4JI8 L;  1YBY A;  3EN2 A;  1CUK A;  2ZJP A;  2E5L Q;  2ES2 A;  4HJ7 A;  2CWA A;  4IPD A;  4B3T L;  3PCO B;  4LW1 A;  4ME3 A;  3RNU A;  4LF8 Q;  4LFA Q;  4A3J G;  1VQO A;  1VQB A;  1BBW A;  1X3G A;  3L7Z C;  2ATW A;  1NJI C;  3UDF A;  4A3G H;  4XTC S;  1EWI A;  2ALY B;  3J80 c;  5C4X G;  3T1Y Q;  1Q12 A;  4R1J A;  1G29 1;  2EQS A;  2OQ0 A;  4J15 A;  3RLO A;  1P16 A;  3UDX A;  3DLL A;  2Z0S A;  5M3M H;  1PH5 A;  4C3I H;  1KD1 C;  1GKH A;  1PH2 A;  4NXM L;  3D31 A;  3KFU A;  1V1Q A;  4GNX B;  4JI0 L;  3S14 H;  2YV5 A;  1OXT A;  1Q81 C;  5JJK A;  4JI5 L;  3S15 H;  2K14 A;  3CCE A;  1U5K A;  2NZH A;  3U58 A;  2OTL A;  1FVI A;  4DR4 L;  1UE6 A;  3JAM c;  3PF5 A;  4HIK A;  4DR6 Q;  2FXQ A;  2KEN A;  4DV7 Q;  2WB1 E;  4YY3 L;  4O2D A;  3GO5 A;  4JI7 Q;  2K5V A;  1QVC A;  2AKW B;  4A75 A;  1I94 L;  1HR0 Q;  1L1O A;  3D0F A;  4GOP C;  1WOC A;  2K4K A;  2OWO A;  4LF9 L;  4Y7N H;  2QGQ A;  1XNQ L;  2E5L L;  1GVP A;  2IY5 B;  4OWT B;  4MTN A;  3STB D;  2ZTE A;  3G6E A;  2E2I H;  1IXR A;  3HOZ H;  3J81 j;  1C9O A;  2ZJR A;  1PYB A;  3W5O A;  4OO1 G;  3Q8D A;  3F2B A;  1N36 Q;  4P75 A;  2XGT A;  5AJ3 Q;  3PO3 G;  4UPA A;  4R4I A;  1L1O C;  2F4V L;  3G71 A;  2JJQ A;  3GTJ H;  1XPR A;  2DUD A;  4OO1 I;  1H95 A;  2LSS A;  4P71 A;  1XNR Q;  1KL9 A;  5LMN Q;  2R92 G;  3J81 i;  4AIM A;  2UXD Q;  1HZB A;  3HKZ G;  1N36 L;  1WJJ A;  1MJC A;  5AJ3 L;  4A3M G;  2UXB L;  3BJU A;  1UE1 A;  3GDE A;  2A1A A;  4LUO A;  4DUZ L;  1A8V A;  1N34 Q;  2WFW A;  1I5F A;  3SGI A;  1IBL L;  4KHZ A;  1I6H H;  1CSP A;  2ZTD A;  4OX9 L;  3H3V I;  3UDG A;  4IPH A;  1U0L A;  4GN3 B;  4A3J H;  5JJL A;  4DV4 Q;  5JJI A;  1TXY A;  1CSQ A;  3UE0 A;  2PI2 E;  1TWG H;  3KDF A;  1KHI A;  2IHF A;  5IT9 c;  1L1O B;  1Y1V G;  1NMF A;  2V1C C;  2WAQ G;  1UE5 A;  3FHW A;  1TWF H;  4PZ7 A;  4JV5 L;  1E22 A;  1YIT A;  4HID A;  4LF6 L;  2VY3 A;  2NZO A;  2MQH A;  3HOV H;  2UU9 Q;  5M3M G;  4JBM A;  2UUA Q;  4A3K G;  2F3I A;  1I3Q H;  4DR3 Q;  3GTL H;  1QZH A;  3I56 A;  4LF5 Q;  3M4O H;  1PH3 A;  4A3G G;  2B29 A;  1EUJ A;  4OX9 Q;  1K9M C;  4A3M H;  2YTX A;  4YWL A;  4IFD J;  4DK6 C;  4A4I A;  2K5N A;  2R7Z G;  1HNZ Q;  1PV4 A;  2R92 H;  2ASB A;  2AWN A;  3CMA A;  1R9T H;  2F4V Q;  1Y14 B;  1X55 A;  1HZ9 A;  3CCR A;  5C4J H;  1EYG A;  5LMN L;  4QQB X;  2Q2H A;  1W3S A;  2R7D A;  4DR5 L;  2VL6 A;  2PMZ E;  5GAE C;  1QVF A;  1PH8 A;  3PUY A;  4R4O A;  2ZM6 L;  3RZO H;  4O0A A;  4POF A;  3FKI H;  4DV3 Q;  4A3D H;  4B3T Q;  1N8R C;  2JK8 A;  4AQY L;  1KIX A;  3TRZ A;  5IP9 G;  1K0R A;  1KRS A;  1UE7 A;  1D7Q A;  1VCI A;  2HT1 A;  2D0P A;  1X6O A;  1HNW Q;  1V9P A;  5C0X J;  1LYL A;  2WB1 G;  2K52 A;  4NXN L;  5C44 G;  2YTY A;  1PH9 A;  1SRO A;  1CKN B;  3FKI G;  3K81 C;  3NEM A;  3RN5 A;  4C2M H;  1X3E A;  2VNU D;  2K75 A;  4OWW B;  2Z6K A;  2UUC Q;  4JI2 L;  4DKA C;  4P72 A;  2A8V A;  3S1N H;  4LFB Q;  3HOW H;  1GD7 A;  2B63 H;  2MFI A;  2B63 G;  1S72 A;  4JI0 Q;  5M3F H;  1B70 B;  2NVQ H;  1JJG A;  4IPG A;  3H15 A;  1OTC A;  5FLM G;  2VW9 A;  2R7Z H;  1OXV A;  4R4Q A;  4JOI A;  4GS3 A;  3CPF A;  3ICE A;  3CCL A;  1VS0 A;  1YHA A;  2KHI A;  2VUM H;  4RMF A;  4TVA B;  1SRU A;  2EXD A;  5GAD C;  2I5M X;  1O7I A;  4GN5 A;  3GTM H;  4BBS G;  3I7F A;  3HOY G;  1VQF A;  1VQG A;  1CKM A;  1YVC A;  2CKZ B;  4YHH L;  1QVG A;  3TS2 A;  4DV2 L;  4K0K L;  2OQK A;  4JCV E;  5LMN W;  3F1Z A;  4LFC L;  4BXX H;  3M7N A;  1X3F A;  1XNQ Q;  1HZC A;  2IHE A;  3KF6 A;  4LF9 Q;  5IP9 H;  3T1H Q;  3GTP H;  3HOU G;  4IPC A;  3S17 H;  1JB7 A;  1OXS C;  4JI4 Q;  3HOU H;  4A3D G;  1VQ6 A;  4HIO A;  4YWK A;  4YCW A;  5GAH C;  4JI7 L;  4X62 L;  1SLJ A;  4IJL A;  5C0X I;  1VQM A;  2Q2U A;  2JEA I;  3EBE A;  1FL0 A;  3GTG H;  4BY7 G;  1YHB A;  3L0O A;  1PH1 A;  4BY7 H;  3F8T A;  2CCZ A;  1HR0 W;  2N3S A;  1XNR L;  2B3G A;  4X65 Q;  2VUM G;  3CC4 A;  1YIJ A;  4JC0 A;  3FP9 A;  3S1Q H;  1IBK L;  1Y1W G;  4DR7 L;  3G48 A;  3CQZ H;  1KXL A;  4YWM A;  5FLM H;  2UXD L;  3VDY A;  3E9I A;  1J6Q A;  2ZTC A;  1TWH H;  3CD6 A;  4A3L G;  1G6P A;  1AH9 A;  1EOV A;  4EX5 A;  4DR1 L;  4JI3 L;  3BZC A;  2R7F A;  3RR5 A;  4DPG A;  2QEX A;  1XMO L;  2CWP A;  2KCM A;  3CCM A;  1OXX K;  4LF8 L;  1VQE A;  1FJG Q;  3A0J A;  3TEH B;  2ID0 A;  3PIO A;  5JEA G;  3S1R H;  2E2J H;  2ZJQ A;  4HJ5 A;  4LF7 Q;  5BR8 L;  4GKK L;  5IWA L;  4JV5 Q;  2RHQ B;  1NY4 A;  3HFZ B;  2JA7 G;  4A3C G;  3PUV A;  2VQF Q;  3E9H A;  2VQE Q;  1S40 A;  3HOW G;  4DV7 L;  3ER0 A;  4X66 Q;  1VQD A;  3CCJ A;  1XPO A;  3IRB A;  4DV4 L;  1PVO A;  1IBM L;  1A0I A;  1XPU A;  2UXC L;  1M1K C;  3H3V H;  3TRE A;  4NB3 A;  4DR2 L;  1JJC B;  3BU2 A;  3U4Z A;  4DV3 L;  4JI5 Q;  2YYZ A;  1T9H A;  4GLV B;  1VQP A;  5M5W H;  4L5T A;  2AHO B;  1HNX Q;  4A93 G;  1Q1E A;  1TWA H;  3AEV A;  2JEB I;  1JJ2 A;  4P73 A;  3W1B A;  5IWA Q;  4DR7 Q;  1CKN A;  1OXU A;  4DV5 L;  1N9W A;  3PUZ A;  1AE3 A;  1G51 A;  3H0G H;  2A19 A;  3I55 A;  1XMQ L;  3CCV A;  2N8N A;  3DM3 A;  1PH7 A;  3PO3 H;  5IP7 H;  4L5R C;  3KYH C;  5GRO A;  1PA6 A;  2WAQ E;  4WJ3 M;  1HJP A;  3U50 C;  2DGY A;  4QJF A;  4A3E H;  1DGS A;  2GN5 A;  3AQQ A;  2JQO A;  5IY0 A;  1ASZ A;  3RN2 A;  3UE1 A;  4QGU A;  2IT1 A;  1NE3 A;  4YCU A;  4GNX A;  1MKH A;  2KHJ A;  3GD7 A;  4QIW E;  3NEN A;  1JMC A;  1Q8K A;  1N33 L;  4B3S L;  1YHQ A;  1A62 A;  1HH2 P;  4UP8 A;  3F2D A;  1RIP A;  1PFS A;  2JE6 I;  3M9B A;  3RZD H;  1NTG A;  3KJO A;  2MO0 A;  4JBK A;  1IYJ B;  1RL2 A;  2N49 A;  1K8A C;  2BA1 A;  4IJH A;  5HY6 A;  4BY1 H;  3PF4 A;  3CW2 C;  5IYC H;  4DV6 Q;  4B3R Q;  1K83 H;  3J81 c;  2VQE L;  2CFM A;  5C3E G;  5H1S E;  4A3F G;  3TQY A;  4A76 A;  2R93 G;  4YY3 Q;  3K80 C;  2IX1 A;  3A74 A;  1C0A A;  5M3F G;  4IFD I;  4PZ8 A;  4LNQ A;  1BKB A;  1SR3 A;  4MNO A;  4IOA A;  3HOV G;  1SFO H;  2HIV A;  3JC6 6;  1C7Y A;  1FGU A;  4LF5 L;  2KBN A;  4BBR G;  3CP0 A;  2RHS B;  2E8G A;  4K0K Q;  1PHJ A;  3AFP A;  3ULL A;  4JBJ A;  2LXK A;  2VZA A;  1KC8 C;  4AYB E;  3PSI A;  3HOX H;  2UUB L;  1VQ4 A;  1N32 L;  3KDF B;  3NEL A;  4MZ9 A;  2NVT H;  2NN6 I;  4L5S A;  1XMO Q;  1S3O A;  4A3I H;  4JI6 Q;  1QZG A;  1Q82 C;  2K5H A;  3U4V A;  5IP7 G;  1YEZ A;  4DV1 Q;  4GKJ L;  4DR3 L;  2BH8 A;  2NN6 G;  3OYY A;  4BBR H;  4EQ5 A;  1X54 A;  2HIX A;  3A5Z B;  5EAY A;  1D8L A;  3S2D H;  4DR6 L;  4KHP L;  5K36 G;  2KCT A;  2BH2 A;  4JYA Q;  1E3P A;  4X66 L;  4DAM A;  1YJ9 A;  4A93 H;  4HIM A;  4A3E G;  1GO3 E;  1XJV A;  1VQJ A;  1I94 Q;  4B3R L;  1HR0 L;  4B3M Q;  1E1T A;  1XTD A;  3HKS A;  1HZA A;  3KOJ A;  4DR2 Q;  3PO2 G;  1K73 C;  3H0G G;  1KQS A;  4NXN Q;  3GTO H;  2I5L X;  1P8L A;  1EQQ A;  2L15 A;  2BA0 A;  2F52 A;  4JG2 A;  3L2P A;  1VQ8 A;  2YU9 H;  1TWC H;  3PIP A;  3LGJ A;  4AQY Q;  3ZJY C;  4LUV A;  1L0W A;  4OON A;  4DV1 L;  1MIU A;  2E2H H;  2OCE A;  2PQA B;  3CC2 A;  4JI3 Q;  1B8A A;  5LMU Q;  3T1H L;  4GOP B;  1NBW A;  3M85 A;  2D0O A;  4UP7 A;  1VQ9 A;  1VQL A;  1XMQ Q;  3S2H H;  4UY8 C;  2JA8 H;  4C3J H;  4POG A;  1K8G A;  1SE8 A;  4X64 Q;  4JI8 Q;  4H02 A;  4DV0 L;  3S16 H;  4DUY Q;  2GVA A;  4PZ6 A;  4B3M L;  1NMG A;  3CPW A;  5IYC G;  4IFD G;  2R93 H;  1A63 A;  4PG3 A;  4BBS H;  2Z6K C;  3OTO L;  3HOZ G;  1PYS B;  2AMC B;  4GNX C;  3NBH B;  2UXC Q;  4HJ9 A;  3STB C;  3CC7 A;  3K0X A;  1WYD A;  4LF6 Q;  1X56 A;  1Z9F A;  4PMW A;  4JI1 L;  4GLX A;  5C4X H;  1ASY A;  1QUQ A;  1HNW L;  2XTI A;  1YJW A;  3I4N H;  1GM5 A;  2UU9 L;  2YTV A;  2JA5 H;  4JI4 L;  3M4P A;  2RF4 A;  1J5E L;  4KLK A;  1I50 H;  3BZK A;  2NVX H;  1LUZ A;  3WWV A;  4Y52 H;  1EFW A;  1BVS A;  4B3S Q;  1Q86 C;  1FJG L;  4DR4 Q;  1V43 A;  4LF7 L;  3CXC A;  1HNZ L;  1N34 L;  1IBL Q;  2JA7 H;  4OXP A;  3T1Y L;  1W2B A;  3I4M G;  3I4N G;  4A3C H;  5M5X H;  3W1G A;  5DLQ E;  3ULP A;  3CCQ A;  4LWC A;  5GAG C;  5E7N A;  1K3R A;  1Y1W H;  4QY7 A;  3HOY H;  5C3E H;  1UWV A;  2I5H A;  3EIV A;  5FJ8 H;  4A3F H;  1EIY B;  2UUB Q;  3HOX G;  2UXB Q;  4DV5 Q;  2K50 A;  1VQC A;  4BA1 I;  4YHH Q;  1Z47 A;  1EIF A;  1WCM H;  3PUW A;  4A3K H;  4DUY L;  4BXX G;  4A3L H;  3ULJ A;  4X64 L;  3KJP A;  4DV0 Q;  2JA9 A;  4X65 L;  5IYD H;  3UDI A;  3K7A H;  4TQU S;  1YJN A;  2Q2T A;  3KLW A;  1IZ6 A;  2HQL A;  2GVB A;  5GQO A;  4DK3 C;  1YNX A;  2JA6 G;  3AYH B;  4P74 A;  3S1M H;  4BA2 I;  2JA6 H;  4X62 Q;  3I4O A;  4HJA A;  2R6G A;  5IYD G;  4A3B H;  3JAM i;  3MXN B;  3PGZ A;  4UP9 A;  4JOI C;  4LF4 Q;  4DV6 L;  1KRT A;  4DR1 Q;  2VS1 A;  1WI5 A;  4DAY B;  4R4C A;  4HJ8 A;  3GTQ H;  4GLA C;  2LXJ A;  1J5E Q;  1LTL A;  5M5Y H;  3OTO Q;  3MEF A;  5BR8 Q;  3AFQ A;  4DUZ Q;  2PI2 A;  1VQA A;  4R4T A;  4GKK Q;  1N32 Q;  2H5X A;  2PNH A;  2OTJ A;  3E0E A;  3RLN A;  1E7Z A;  4DR5 Q;  2D62 A;  4A3B G;  2C35 B;  4LUZ A;  4KHP Q;  4JI1 Q;  2NVY H;  5JEA J;  5IYB G;  1JT8 A;  3I2Z A;  1M90 C;  3J80 i;  5IYB H;  1WFQ A;  5HGQ A;  2RCN A;  5FJ8 G;  1QUQ B;  2IX0 A;  1Q7Y C;  1EQR A;  5IE8 A;  4JBW A;  4GKJ Q;  5ELN A;  1JE5 A;  1WCM G;  4YCV A;  3S24 A;  1PH4 A;  2Q2I A;  2JA5 G;  1VQK A;  4LF4 L;  4XIG S;  5ELO A;  2I0Q A;  2UUA L;  2N78 A;  3I4M H;  2EIF A;  1E1O A;  4IO9 A;  3PV0 A;  1X65 A;  4JI2 Q;  1Q1B A;  2QA4 A;  2UUC L;  1BBU A;  4LFB L;  3GTK H;  3CME A;  2Y0S E;  3K8A A;  1VQ7 A;  3B6Y A;  4LFC Q;  4WJ4 A;  3HKZ E;  1PH6 A;  2JA8 G;  4AH6 A;  4GOP A;  1E24 A;  1L2F A;  3ERS X;  4RG1 A;  4IOC A;  1IL2 A;  2PQA A;  3M3Y H;  4AYB G;  3TS0 A;  2MNA A;  3A5U A;  2Y0S G;  3K7U C;  3KF8 B;  1YZ6 A;  4DNI A;  4JI6 L;  1N33 Q;  4NXM Q;  3KF6 B;  2ZM6 Q;  3F2C A;  1UEB A;  4NPS A;  1VQN A;  1YI2 A;  4KI0 A;  1MJE A;  4A3I G;  2WP8 J;  3CCU A;  4L5Q A;  4DV2 Q;  2HHH Q;  3J7A 5;  1CKO A;  4C3H H;  1SN8 A;  4ALP A;  4BY1 G;  1HNX L;  4QL5 A;  3PO2 H;  1B7Y B;  2CQO A;  1Y1V H;  4X6A H;  1Q46 A;  5C44 H;  5J3B A;  1VQ5 A;  4OWX B;  4LFA L;  1X9N A;  2AWO A;  3PUX A;  1VQI A;  3M4Q A;  5FLX c;  1VQH A;  1IBM Q;  3CF5 A;  1IBK Q;  1LM0 A;  1SMX A;  2MO1 A;  4GN4 B;  2HHH L;  5LMU L;  3CAM A;  3G4S A;  3RLF A;  4APV A;  3OW2 A;  3J7Z C;  4FDB A;  2VQF L;  1AE2 A;  1KAW A;  4JYA L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...