3K8AA

Neisseria gonorrhoeae prib
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
100
structure length
100
Chain Sequence
MGFTNLVSLAALIEKAFPIRYTPAGIPVLDIILKHESWQEENGQQCLVQLEIPARILGRQAEEWQYRQGDCATVEGFLAQKSRRSLMPMLRIQNIKEYKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Putative primosomal replication protein
publication title The crystal structure of Neisseria gonorrhoeae PriB reveals mechanistic differences among bacterial DNA replication restart pathways
pubmed doi rcsb
source organism Neisseria gonorrhoeae fa 1090
total genus 14
structure length 100
sequence length 100
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-10-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3k8aA00
1VQMA 3CW2C 2CWAA 1T9HA 4MNOA 2QEXA 5LMNQ 4A3KH 2BH2A 1IL2A 4IFDI 1J5EQ 2IX0A 1VQGA 1AE2A 2YTVA 3TREA 4QJFA 1VQOA 2ZJQA 4A3BG 4K0KL 2VUMG 4DR2L 5JJLA 1TWAH 2KBNA 1WJJA 3E9HA 2ES2A 2R92H 4BY7G 4B3TL 3S1MH 3ERSX 3GTMH 3J7ZC 3K81C 3L2PA 4HIDA 1Q7YC 4DV1L 5IE8A 1SLJA 2FXQA 2A8VA 5M3FH 2JA8H 4JBJA 1L1OC 2Q2UA 3I4NG 1X3GA 1N34L 3PV0A 4P73A 1B8AA 3GTOH 2PQAB 1VQPA 3EN2A 2YV5A 1W2BA 3S15H 1XNRQ 3GDEA 4X62Q 2MQHA 4YWMA 1KL9A 4R4OA 1HR0W 3OYYA 3W1BA 4JI3L 5JEAG 2AMCB 1NMGA 2JK8A 1XPOA 5C4JH 5IYDH 2WP8J 2BH8A 3S24A 4BBRH 1E24A 4DV5L 4XTCS 2JA8G 4YCVA 3CCJA 1YITA 3M7NA 1A8VA 3F8TA 3PCOB 4PZ6A 2OWOA 1HNXQ 5C44G 2LXJA 3RLFA 3IRBA 4LFAL 4X65Q 4A3CH 3STBD 1YJ9A 4BXXG 1K8GA 3CC7A 3CC4A 5LMUQ 3GD7A 5AJ3L 4HJ8A 4HJ7A 3S17H 4DR6Q 2LSSA 3BJUA 3UE0A 3PIPA 2KENA 3FKIH 3PUXA 3CAMA 3HOUH 1KRSA 3OW2A 4R1JA 2JJQA 4O0AA 1EFWA 2B63H 1XJVA 1WCMG 2CFMA 4A3CG 4IFDG 5FLXc 2R93G 4DV6Q 2OTJA 1OXSC 1I94Q 2WFWA 5IYCG 1YEZA 2N3SA 4EX5A 2NN6G 3FKIG 2JA9A 4QY7A 1EYGA 5FLMG 4DKAC 5IT9c 3S1NH 2Z6KC 2WAQG 2B63G 1VQ9A 1I3QH 3ULJA 1BBUA 3W1GA 2NVYH 4GNXC 1HZ9A 4A3IH 1QZHA 2GN5A 4YY3Q 2UXDQ 1JMCA 1PA6A 1Q1BA 1V43A 1QVFA 1FL0A 5M5WH 2JA5G 3M4QA 4IPDA 2F4VL 4B3MQ 3I56A 3CD6A 3PO2H 1UE5A 2IHEA 4DR7Q 4A3EH 3S2HH 4IPCA 4JI0Q 4GKKL 4KHPQ 3AQQA 2ZTCA 4X64Q 2DGYA 4IJLA 4DR1L 1BKBA 1CUKA 3PUZA 4LW1A 4A3JG 1A63A 2JA6G 4A3GG 1X55A 2WAQE 3H0GH 2B3GA 2UXCQ 2VS1A 1O7IA 4TVAB 5C0XJ 1NJIC 3L0OA 4A93H 3PO2G 1Q81C 3HKZG 2D0OA 3JAMi 4A3EG 4LF5Q 1VQHA 4AYBE 2IX1A 4YHHL 1JT8A 3I4MH 1NY4A 4A75A 2OQ0A 4EQ5A 4DV3L 3T1YL 2L15A 4K0KQ 4LF6L 2HIVA 3HOXH 2N49A 3F2BA 1KQSA 1QZGA 3STBC 4DUZL 4MTNA 1VQ8A 3CC2A 4L5QA 1QUQB 4H02A 4PZ8A 1V1QA 1X3FA 4B3TQ 4L5RC 1R9TH 2ATWA 4A93G 5IP7G 1QUQA 2Q2IA 2R6GA 4DV1Q 1W3SA 3HKZE 3I4MG 3S16H 3CPFA 3M3YH 2LXKA 4X6AH 2K5NA 2OQKA 3Q8DA 1PYBA 3J81i 2F52A 1LM0A 1XNQL 1FJGQ 3KF8B 2N8NA 1CKOA 3RR5A 4A76A 1Z47A 2UU9L 3CCEA 2B29A 4TQUS 1BBWA 3ZJYC 3I55A 4A3MH 4JI3Q 4JI5L 3K7AH 2UUBL 2JEAI 1JJCB 4DV5Q 3I2ZA 1A62A 2K5VA 3CQZH 1Q1EA 4QL5A 3CCUA 2Z0SA 2PNHA 1VQ4A 3HKSA 3NEMA 3UE1A 3GTPH 1HZAA 1LUZA 4POGA 1N32L 4OONA 4GKJQ 2ZM6L 2V1CC 1PFSA 1YVCA 2R7DA 5AJ3Q 2VUMH 4DV7L 2JA7H 4AQYL 4BY7H 2Q2HA 3PF4A 3KLWA 1X3EA 2NZOA 1YHQA 5IP9G 4OWWB 1CKNB 1YJWA 2ZTDA 3AFPA 1HZCA 1TXYA 3HFZB 4DV2L 3PUVA 1CKNA 3JAMc 4WJ3M 3I4NH 1VQ5A 3PUYA 1E22A 3W5OA 1WYDA 4GN5A 3CP0A 4C2MH 5M5YH 1EWIA 4KLKA 2JA7G 1I50H 2NN6I 1NE3A 1SFOH 4MZ9A 3GTJH 2AHOB 2OTLA 3TS2A 3DLLA 4J15A 1M90C 4R4QA 3D0FA 2IT1A 1PV4A 4LF4L 5J3BA 2QA4A 3GTKH 5JJKA 2UUAL 5C44H 3KF6A 4LFBL 5K36G 2AWNA 2F4VQ 2DUDA 1PH7A 2UUCL 5HY6A 1TWGH 3VDYA 4BXXH 1TWHH 1VQIA 3NELA 4LFCL 3KJOA 3S2DH 1K0RA 4FDBA 4LUZA 4UP7A 3RZOH 3PSIA 1VQEA 4GKKQ 4DR1Q 5C4XG 1UE7A 2E8GA 3B6YA 3K80C 1HR0L 3PO3G 4NXNL 4L5SA 5M3MH 4JOIC 4JV5L 1IBLL 1WCMH 3MEFA 1Q8KA 2EQSA 4JG2A 3ULLA 2JEBI 2R93H 2ZJPA 2I5MX 1UEBA 4P74A 1PH3A 3HOVG 1X54A 5IYCH 4YHHQ 4OX9L 4KI0A 4L5TA 1C7YA 1GM5A 1J6QA 4BBSG 5FLMH 1G291 4JI1L 3AFQA 1L0WA 5M3MG 4DV3Q 3T1YQ 1K8AC 5GADC 3CXCA 4LF6Q 3CCQA 1XPRA 4DR4L 2H5XA 4B3SL 2JE6I 1P16A 5E7NA 1Y1WG 1PH5A 3F2CA 1N33L 1Q12A 4UP9A 4O2DA 2NVTH 5ELOA 1IYJB 1YHBA 2JA5H 1OXXK 1XPUA 2UXBQ 2EIFA 2F3IA 4GOPB 3CCRA 4GOPA 4LF8Q 1XNQQ 4AH6A 1KHIA 3NBHB 4A3JH 4P71A 1S3OA 2E5LQ 2UU9Q 2JA6H 4A3GH 3TRZA 4JI8L 4JI5Q 4DK3C 2RF4A 2UUBQ 5LMNW 1TWFH 1YIJA 1YI2A 1YHAA 1JJGA 5JJIA 3DM3A 1E1OA 1VQJA 1SMXA 3K7UC 4AYBG 1FGUA 3J81j 2NVQH 3KDFB 3I4OA 5DLQE 1I5FA 4JI6L 1VQNA 1HJPA 1E7ZA 3KDFA 4DR3L 1N32Q 4P72A 2ZM6Q 1P8LA 4A3DG 2YU9H 4JBKA 1IXRA 1B70B 3TEHB 3G4SA 4DV7Q 1EQQA 4AQYQ 1Q82C 3CPWA 2E2JH 4GLVB 3M4OH 3RN2A 3KOJA 4PG3A 4HJAA 1PVOA 4QIWE 1ASZA 1VCIA 1U0LA 5IP7H 2VW9A 2CWPA 4DV2Q 4C3JH 3KYHC 3M85A 1MJEA 1WI5A 4JCVE 4YWKA 1CKMA 2NVXH 1HNZL 1VQDA 4DUYL 4DR2Q 2E2HH 1UWVA 2I5LX 2A19A 3TQYA 2CCZA 5GROA 2I5HA 1X56A 1VQ6A 1WOCA 2VQEL 3U50C 1VQKA 4LF7L 4DV4L 1X65A 2QGQA 4WJ4A 3HOZH 1HNWL 5IWAL 3UDIA 1N34Q 2MO1A 1N8RC 3HOYG 1GD7A 4LF4Q 3GTGH 5C0XI 2UUAQ 3PGZA 4LFBQ 2VY3A 1JB7A 5JEAJ 2K75A 2UUCQ 2ASBA 1XMOL 1YZ6A 4DR6L 4YCWA 1PH2A 1PH8A 1VQLA 4JI7L 4LFCQ 1XMQL 2ZTEA 4A3FG 5H1SE 2E2IH 2R7ZG 2IHFA 1PH9A 2HT1A 3HOZG 4A3LG 3G71A 1HR0Q 3I7FA 5IP9H 4B3RL 2D0PA 4NXNQ 2WB1G 1K9MC 1GO3E 4JV5Q 4Y52H 3JC66 1IBLQ 1MKHA 2Z6KA 1A0IA 1PHJA 3BU2A 4LFAQ 3SGIA 1G6PA 1GVPA 1S40A 1SN8A 4UY8C 3A5ZB 3TS0A 2K50A 2PI2A 2RHSB 4YWLA 4OX9Q 1MIUA 3HOWG 1DGSA 3RZDH 4JI1Q 1QVGA 1IZ6A 2WB1E 1IBKL 2I0QA 4DR4Q 4IFDJ 2UXDL 5EAYA 2PI2E 1VQFA 2KHIA 3KJPA 4GLAC 3F2DA 4B3SQ 1N33Q 4BY1G 3T1HL 3FP9A 4DAYB 2AKWB 4JBWA 3RLNA 1N36L 4GS3A 4KHPL 1JJ2A 3LGJA 1SROA 1KD1C 1AE3A 3MXNB 4OO1I 4QGUA 3ULPA 1U5KA 3A5UA 5C4XH 1YNXA 3CMAA 3PO3H 1HH2P 3AYHB 3KF6B 4JI8Q 4DPGA 1OTCA 1L2FA 1KRTA 3E0EA 5C0XG 4IPHA 3J81c 4HJ5A 2XGTA 4GOPC 1SE8A 4P75A 4R4TA 5BR8L 1GKHA 1E3PA 2KCTA 3HOVH 1QVCA 2CQOA 2MFIA 4JI6Q 1NTGA 3RN5A 5GAEC 1Y1VG 1Z9FA 3D31A 3WWVA 2VQFL 2MNAA 1V9PA 2BA0A 2K5HA 4DR3Q 4BBSH 2KCMA 5ELNA 1M1KC 3RLOA 2HIXA 3H15A 3M9BA 5GAGC 4NXML 3PUWA 3GO5A 4BA1I 4DV0L 4DNIA 3UDGA 1PH4A 1EIFA 1NMFA 1VQ7A 2Y0SG 5C3EG 2ZJRA 1Y1WH 4LF9L 1IBML 4YCUA 4HIKA 4A3KG 4A4IA 4C3IH 2HHHL 3PF5A 4RG1A 1FJGL 4NB3A 4IOCA 2PQAA 2YTXA 4JC0A 4LWCA 3OTOL 1E1TA 4HJ9A 2R92G 4UP8A 2RCNA 1HNZQ 2VZAA 1VS0A 2NZHA 4DUYQ 4JBMA 4DUZQ 4GN4B 4HIOA 4Y7NH 1SR3A 2VQEQ 3NENA 2ID0A 2GVBA 5M3FG 4DV4Q 4JI2L 4JI4L 1LYLA 4LF7Q 2VNUD 1B7YB 1KXLA 2Y0SE 1HNWQ 5IWAQ 2IY5B 3EBEA 5M5XH 4JYAL 3U4ZA 1VQAA 3CF5A 1C0AA 3K8AA 4OO1G 4GKJL 1D8LA 1CSQA 2EXDA 1XMOQ 5IYDG 4BBRG 1HZBA 3KFUA 4A3DH 1VQBA 1G51A 3CCMA 1XMQQ 4JI7Q 2N78A 4X66L 4DR5L 4DK6C 1SRUA 3J7A5 4DAMA 2C35B 1Y14B 1PH1A 4B3RQ 2AWOA 4IO9A 3S14H 1ASYA 1JE5A 4HIMA 1MJCA 1XTDA 1L1OB 5LMNL 4GLXA 4BA2I 1J5EL 2Q2TA 2JQOA 2KHJA 5GAHC 1L1OA 1H95A 4RMFA 1D7QA 1K83H 3EIVA 2D62A 1UE6A 1CSPA 4PMWA 1KIXA 3HOUG 3BZCA 4UPAA 3J80i 2XTIA 5IY0A 1EQRA 4NPSA 1KC8C 1WFQA 3UDXA 2A1AA 3CMEA 4C3HH 1IBKQ 3GTQH 1YBYA 4LNQA 1OXTA 3HOYH 1KAWA 1EOVA 3E9IA 4X62L 1K73C 1XNRL 3GTLH 4LUOA 4OWTB 3T1HQ 4JOIA 1Q86C 4OXPA 4POFA 1N36Q 3K0XA 1N9WA 3G6EA 4KHZA 3FHWA 4LUVA 5HGQA 1X9NA 3AEVA 3S1QH 2PMZE 4A3FH 2R7ZH 1RIPA 3A74A 2R7FA 1X6OA 4A3IG 4A3LH 1HNXL 3CCSA 3PIOA 3L7ZC 3RNUA 4X65L 1K3RA 3G48A 2BA1A 5LMUL 1PH6A 1BVSA 5BR8Q 4APVA 5FJ8H 1S72A 1C9OA 1LTLA 5GQOA 3M4PA 2VQFQ 3HOWH 4AIMA 2K4KA 4QQBX 3ER0A 3H0GG 1NBWA 1EIYB 1OXVA 3F1ZA 4IJHA 4PZ7A 4NXMQ 4DV0Q 4DV6L 1OXUA 4XIGS 4GNXB 1I94L 2UXBL 3H3VI 5FJ8G 4GNXA 4LF9Q 4BY1H 4ME3A 1IBMQ 1AH9A 2GVAA 2K52A 3A0JA 1TWCH 4LF8L 2HHHQ 4IPGA 3BZKA 4R4IA 3HOXG 3J80c 3OTOQ 2E5LL 2CKZB 2HQLA 2YYZA 4YY3L 2ALYB 4GN3B 1Q46A 4OWXB 3S1RH 5IYBH 2MO0A 1FVIA 4JI2Q 4B3ML 4JI4Q 4ALPA 3CCVA 2VL6A 4DR7L 3CCLA 1VQCA 2RHQB 1I6HH 4JI0L 4JYAQ 3ICEA 2OCEA 4X64L 1UE1A 3U4VA 3UDFA 1EUJA 2YTYA 1Y1VH 4A3BH 4A3MG 1YJNA 2UXCL 1PYSB 1RL2A 3U58A 5IYBG 4X66Q 4DR5Q 4R4CA 4IOAA 4LF5L 2K14A 3H3VH 5C3EH
chains in the Genus database with same CATH superfamily
2CWAA 1STNA 4MNOA 4A3KH 2QEXA 1SYCA 1TIID 3NE5B 1I6HB 1J5EQ 1VQGA 1AE2A 3GQBA 3SDZA 3TREA 1VQOA 2K6AA 1B50A 3H09A 5JJLA 1EY8A 3E9HA 2R92H 3DHQA 3S1MH 5A2QL 3WOEA 2B2TA 4HIDA 1Q7YC 2A8VA 4DV1L 1D1KA 4JBJA 3PV0A 2WACA 2CH4W 4RH6A 4KKUA 1B8AA 3MFYA 4A3KB 3S15H 4X62Q 3DEPA 5DEHA 1XPOA 3BYYB 2JK8A 1NMGA 5IYDH 4BBRH 3CCJA 1NR4A 4C1NI 3PCOB 3TZUA 4J8QA 3P75A 2LXJA 1H9MA 1UNSA 4LFAL 2B2YA 4BXXG 5LMUQ 2K5WA 3GD7A 5AJ3L 3MVVA 2LSSA 1CZWA 1LTSD 3PUXA 2OF1A 3CAMA 4BBRB 1KRSA 3IL8A 1Y8PB 2NWGA 4IFDG 4CKEA 2R93G 1OXSC 1W6JA 2WFWA 5IYCG 3V96A 5DNFA 3X3NA 5FLMG 3WDNA 4DKAC 5IT9c 2Z6KC 1PLFA 3TN2A 2B63G 2PMZB 4XYOA 4DN4M 1WTRA 3EJIA 3NBHA 4GNXC 5IGDA 1HZ9A 3T53B 4A3IH 2GN5A 2UXDQ 1QVFA 1FL0A 5M5WH 4IPDA 3M4YA 4FXDA 2FMCA 4IJLA 1CUKA 4DK1A 4A3GG 2VS1A 4FNFA 4TVAB 1G6ZA 4A3IB 4CJ2C 4KN7C 2EYOA 1Q81C 2D0OA 2EY1A 5M5WB 1VQHA 4YHHL 1NY4A 5A2QE 2EYPA 4K6LA 3T1YL 4RHRA 4K0KQ 4LF6L 1PRTB 5FKAC 3S9WA 3D4RA 3STBC 4DUZL 1B44D 1VQ8A 1PZKD 2XNAC 1QUQB 4H02A 4PZ8A 4B3TQ 4A93G 4ZUJA 4MHEA 1ML0D 2Q2IA 2XVSA 5C4ZA 4X3TA 3CU7A 4N9TA 2OQKA 2KUMA 3J81i 2AUJD 1FNVA 1FJGQ 1DJRD 4RFBA 4RGOS 4O1NA 3Q22A 2Z4IA 5I9PA 1D5MC 5KNCA 1Z47A 4TQUS 4A3MH 1C48A 4OIJA 4JI5L 3K7AH 1WD1A 3CCUA 2Z0SA 2HDMA 1AW7A 3UE1A 1BO0A 5JVG3 3HG9A 4OONA 1A15A 4PMBA 3D6CA 2VB3X 2ICIA 4OHJA 1MI2A 1VF7A 4DNRB 1PXUA 5CBEE 4A3MB 4BY7H 1U4PA 1YHQA 5IP9G 3K7AB 1QE6A 3DMUA 4CDCC 1QB5D 2NB0A 3QWNA 3CHBD 4NDXA 2C5CA 4IUQA 1VQ5A 3PUYA 4LJZC 1E22A 5K36H 1EWIA 2CW0C 1ESFA 2B2UA 1GHKA 2F0VA 4BY7B 2AHOB 1D5XC 3DLLA 4J15A 1ENFA 4IALA 4R4QA 2HUGA 3D0FA 2F4VQ 3DUZA 5HY6A 1TWGH 3VDYA 3L3OC 4F8MA 4FDBA 3FVQA 2HCCA 3PSIA 3RZOH 4KY6A 5M3MH 5IGFA 1IBLL 3PO3B 1WCMH 3ULLA 2K04A 1PH3A 3HOVG 1X54A 1S5FD 4BS9A 1TWGB 3RZOB 2CVRA 1XXGA 1L0WA 2B2VA 4JI1L 2KOLA 5IIFA 1XPRA 2BE5C 2PZUA 5M3MB 1F2YA 1WCMB 1Y1WG 4C56C 2RSOA 2LMCB 1F2LA 3OMGA 3MC0B 2EIFA 4JK1C 1UUPA 4LF8Q 1PRTC 2LY7A 1XNQQ 3NBHB 4FF2A 4P71A 1EQTA 1CI3M 1S3OA 2E5LQ 2UU9Q 3IAYA 2JA6H 2MPMA 2WAQB 1AZQA 4EQNA 3DM3A 5CV4A 5C5MA 4LK1C 3J81j 2O5JC 3TMEA 3KDFB 5M5XB 1VQNA 2ZXPA 2YU9H 4DV7Q 3G4SA 3MFGA 2JA6B 4AQYQ 3CPWA 4GLVB 2J7ZA 4HJAA 2L0CA 5IP7H 4DV2Q 4YWKA 2NVXH 4DR2Q 2E2HH 1ZXTA 4ZKCB 2CCZA 2YU9B 4H44C 1WOCA 2F0WA 3UDIA 1LTAD 1JOQA 5C0XI 2VY3A 2B2TC 2V4DA 4YCWA 4CHTB 1SEBD 1PH2A 1HRJA 2E2HB 4R8IA 4A3FG 2E2IH 4ME5A 1HR0Q 3I7FA 3SE0A 2WB1G 5E4WC 1MKHA 1NR2A 3OOCA 3SGIA 3E3XA 2MP1A 2A6EC 1SDFA 2RHSB 4YWLA 3SEBA 1MIUA 4CDEC 5CC4A 1DGSA 1YNNC 2B8GA 3LNNA 2MGSA 2Q8IB 5JJZA 2B2YC 1QVGA 2WB1E 4NP5A 2I0QA 2L9HA 2LS01 2UXDL 4HR7B 5EAYA 3KJPA 2XWJB 2L11A 5D3DA 4DK0A 4RCOA 5C0XH 1N33Q 3FP9A 4DAYB 3LX0A 1JJ2A 5M9OA 5DM63 1KD1C 2AUKA 1U5KA 2PCFB 5C4XH 1YNXA 2MUYA 1HH2P 1KRTA 3K5LA 4F88A 2K1BA 5KRUA 4HJ5A 1DZ1A 4R4TA 1LLRD 1Z7TA 1NTGA 1F2ZA 1Y1VG 3WWVA 2VQFL 4IQZA 4BBSH 1GHJA 3HRZC 3A56A 2G9DA 4IZ8A 5C4XB 5GAGC 4NXML 1GUNA 4XQNA 4KMUC 1PH4A 1VQ7A 5DM73 4LF9L 3VR3A 1A3TA 4K8IA 4HIKA 1KNEA 1IL8A 1F9PA 1K28A 1WD0A 1FJGL 4NB3A 4LWCA 2NBFA 4UP8A 1DOLA 1STAA 1IYVA 1F9RA 1H9RA 4Y7NH 1SR3A 2VQEQ 3NENA 2ID0A 2GVBA 4O42A 4JI2L 4HCSA 4JI4L 4LF7Q 5IGGA 1KXLA 1B7YB 1HNWQ 4C1NK 1R4QB 1D5ZC 2A69D 3U4ZA 1VQAA 3CF5A 1II3A 1HQMC 1TY0A 3KBGA 1TR5A 2A6HC 1XMQQ 4DR5L 3QO2A 1ENCA 1O7YA 3J7A5 4B3RQ 4KHVA 1L1OB 5GAHC 1G8ZD 3ND8A 5E1FA 4PMWA 3HOUG 1HXYD 2N88A 3NXWA 2B39A 5IY0A 1EQRA 1MSHA 1EIHA 1M4VA 1WFQA 3GTQH 1OXTA 2CH4A 1EOVA 2IJ0A 5EPJA 4OWTB 2DJFC 4OXPA 4X3UA 3H91A 1N9WA 3P1HA 3FHWA 4LUVA 5A35A 1CT1D 4PNYA 4P2CB 1RIPA 3A74A 3CCSA 4FVMA 4WRDA 5CR3A 3PIOA 4X65L 3GTQB 2QEJC 2B2UC 2XN9C 1EY5A 4Q0FA 3SHLA 1C9OA 3OW7A 4H7BA 3SK6A 4AIMA 4QQBX 3H0GG 1NBWA 4HAEA 4NKLA 3VR4A 1OXVA 1M8AA 3MTSA 4X3SA 1CA6A 1RHPA 2BDOA 5I6YA 1I94L 3H3VI 5EPKA 1SE2A 4GNXA 4ME3A 5J22A 1I4QA 1IBMQ 3A0JA 1SNMA 4LF8L 1HTLD 4TKOB 1JOKA 4R4IA 2D2CC 3HOXG 2E5LL 2YYZA 4U68A 2K5QA 2IX3A 2ALYB 4GN3B 2AQ2B 3NTHA 3H6MA 1S5BD 2M2LA 2KHSA 1GUSA 4JI0L 1EWHA 1TQOA 1HA5A 1FGBD 1SAPA 3UDFA 2OT2A 1YJNA 2O5IC 2UXCL 1PYSB 1X3QA 1EYAA 3U58A 4IOAA 1SJHD 3NWSA 3BYTB 2BA1A 3H3VH 5C3EH 1T9HA 1KDBA 5LMNQ 2C9OA 4IFDI 3DWQA 2YTVA 4QJFA 2VUMG 4DR2L 2XIWA 1TWAH 4XT1B 3GTMH 5COYA 1EWCA 1EY7A 3K81C 3MA2B 1HA6A 2FXQA 5F2DA 5EKIA 5M3FH 2Q2UA 1L1OC 1BNZA 4FXKC 3TDQA 4K5WA 4P73A 5C3EB 3GTOH 3EN2A 1W2BA 2EYJA 3V05A 2F0SA 1PYWD 1KL9A 2F4IA 4ID6A 1HR0W 5JEAG 3D4WA 1TWAB 5K5PA 3S24A 3V2TA 4OIKA 3GTMB 1YITA 3EFXD 5M3FB 1HNXQ 1QWYA 3K57A 3GTOB 4IFDH 3STBD 2KJXA 2GA4B 3CC7A 1G2SA 3MHBA 4HJ7A 4DR6Q 2NTSA 2PNRC 1ZYRD 3PIPA 3FDTA 5CV8A 3MWYW 4R1JA 3OW2A 2B63H 3D4DA 1F9QA 2CFMA 4UAIA 5AFWA 1QG7A 2A74C 4EGVA 4DV6Q 4XXEA 5IT9E 4ZRZA 1YEZA 3VA5A 1DD2A 2M00A 2SEBD 3OIQA 5EGTA 2IL8A 4B9WA 5KIXA 1A3VA 1BBUA 3W1GA 4J6HA 2B63B 5G3LF 4YY3Q 1JMCA 1PA6A 1Q1BA 1PZID 2QW7A 1KABA 2X69A 3Q23A 5JVH3 4PMCA 4YIJA 4DAVA 4DR7Q 1EU4A 3KLSX 2ZTCA 1ET6A 1BXTA 2DGYA 1RKNA 4A3JG 3P7JA 5I9OA 1O7IA 5C0XJ 4DA2A 3L0OA 4A93H 2DJGC 3PO2G 2CW0D 1QNUA 4AYBE 2J4XA 1JORA 4L8JA 3QG1A 4EQ5A 3CRKC 3T51B 4H13C 1WTOA 2L15A 2WV6D 1HTPA 1KQSA 2EXZA 4L5QA 3CC2A 5D65A 2ATWA 1V1QA 1CZGA 4L5RC 1EY4A 1I4GA 1QUQA 4A93B 1W3SA 5T1IA 1EFID 4X6AH 3A8JE 3Q8DA 1PYBA 4ODGA 2F52A 1LTID 3G6JB 4MTKA 1CQFA 3PQIA 3CCEA 5KEEA 3ZJYC 1BBWA 1DOMA 1ESRA 4JI3Q 2RDFA 1FNUA 4DV5Q 1A62A 3CQZH 5J39A 3H3VC 1Q1EA 1EZ6A 2PNHA 2EYMA 4RGMA 2F0MA 4DAPA 2ZM6L 1B9NA 2JXMB 3PF4A 3KLWA 2EZVA 1YJWA 2ZTDA 3AFPA 4L6TB 1TXYA 3CQZB 1PRTD 1BCPC 3I4NH 1JOOA 3OMCA 5LHY1 3I8ZA 5M5YH 3NWTA 3SK5A 2NN6I 2L12A 3TP8A 2OTLA 3RZDB 3TS2A 4FYDA 1M90C 1JCKB 2IT1A 1L0YB 3I4NB 1BCPF 5JJKA 5C44H 3KF6A 4LFBL 4JPBW 1MGSA 4RHSA 3NELA 5M5YB 4GKKQ 4UP7A 1VQEA 1EY6A 1NCVA 3D6WA 4DR1Q 1UE7A 4WFN3 4JV5L 1JB3A 4KV6A 4JG2A 1Q8KA 2JEBI 4HMIA 5C44B 2EJMA 3SK4A 4P74A 1A3UA 5I6WA 2BOSA 4OX9L 4KI0A 2NN6H 1J6QA 4DV3Q 1D2BA 5EKLA 1RODA 5GADC 3CXCA 4DU9A 1P16A 5CMDA 1XPUA 2JA5H 1STEA 2Z8LA 3CCRA 4FF3A 3QIAA 1RDPD 2WKDA 2EY5A 1JWSD 4JI8L 1LABA 1BQQT 2A6ED 2RF4A 2UUBQ 5LMNW 1TWFH 1YIJA 1YI2A 1E1OA 4HEDA 3K7UC 1FGUA 4RKLA 2JA5B 1YNND 3OHXC 1IKLA 3I4OA 5DLQE 4JI6L 4KY7A 4FO2A 3KDFA 4DR3L 1N32Q 4P72A 5C6AA 1P8LA 4A3DG 2TSSA 2A68D 1IXRA 1B70B 3TEHB 3M4OH 1Q82C 3KOJA 3C46A 2K7VA 4QIWE 1TWFB 4K6DA 2VW9A 4RWSC 3HKZB 3UI2A 4C3JH 3M85A 1PMRA 3C1FA 1WI5A 4JCVE 1HNZL 5C3WA 1VQDA 2EYFA 4B08A 1UWVA 1H9KA 1BUVT 1VMPA 1KLGD 1EEID 1X56A 4J1MA 3M4OB 4XDXA 1VQKA 4DV4L 4WJ4A 3T16A 1GUWA 3HOYG 2IPKD 1GD7A 4LF4Q 4C3JB 1HHVA 1EIGA 2UUAQ 4KN4C 1JB7A 2UUCQ 4DR6L 1Z6HA 1XMOL 4LFCQ 2ZTEA 4G57A 5H1SE 3QOLA 2HT1A 3HOZG 4A3FB 2D0PA 4NXNQ 1YNJD 3EQLC 4Y52H 2WB1B 3P20A 4G4KA 5IODA 4UY8C 2NZ1D 3A5ZB 2PI2A 1ILQA 3MXUA 1SYDA 3R2TA 1RF2D 1CM9A 2WINB 4DR4Q 4IFDJ 4B3SQ 4GLAC 3NP8A 4BY1G 2L1BA 4RGTA 3T1HL 4X3KA 3RLNA 4PQXA 3QR8A 4I7ZC 3NK9A 4DAYA 3ULPA 4CKBA 4WJWA 3PO3H 1OTCA 3AYHB 3KF6B 1L2FA 2HD3A 3E0EA 4IPHA 3J81c 2XGTA 3BVGA 1GKHA 1E3PA 2F0DA 2CQOA 2MFIA 4JW0A 4K5XA 5GAEC 1RD9D 3U9SA 2MNAA 2IW3A 3RLOA 1UAPA 4BA1I 4DV0L 2Y0SG 1PZJD 5BN4A 4A3KG 4HTHA 4A4IA 5EPLA 2HHHL 3PF5A 3ONAB 2PQAA 4JC0A 1E1TA 3A54A 2R92G 3I91A 3I4LA 4DUYQ 2NZHA 4GN4B 1STBA 2VNUD 1LYLA 2QKIC 2Y0SE 4V0BA 3VR5A 5IWAQ 4C3IG 5M5XH 2IY5B 4JYAL 4N9PA 1SNPA 5CV7A 3C3LA 1D8LA 3I90A 3E0JA 4ABNA 2K28A 5IYDG 4BBRG 1VQBA 4JI7Q 1FNWA 4X66L 4DK6C 2C35B 3CKIB 4HCEA 2K32A 4IO9A 1ASYA 1JE5A 4HIMA 2QILA 1J5EL 1KDAA 2JQOA 3BS1A 1LT6D 1L1OA 1TT2A 3A55A 1K83H 1A6XA 3EIVA 1PTOH 2CQAA 3BZCA 4UPAA 3J80i 4ZAIA 4RCNA 4C3HH 1IBKQ 1LTBD 2G9HD 2EYLA 4LNQA 3E9IA 1K73C 4X62L 3GTLH 4LUOA 4H0LC 2DNEA 1N36Q 1K83B 3K0XA 3DWAA 3AEVA 1X9NA 1PTOB 3S1QH 2PMZE 1WTHA 2R7ZH 1SNQA 4A3IG 1TS5A 4A3LH 1W6KA 3RNUA 4C3HB 1K3RA 2OXPA 3I3CA 1H9JA 2F0HA 1XX8A 1E0BA 3GTLB 5LMUL 1DYQA 1I6VC 1BVSA 3FPPA 5BR8Q 4G7ZC 1ET9A 5EQ0A 5BN3A 3MAQA 3HOWH 2K4KA 3S1QB 2K03A 2R7ZB 1K0SA 3F1ZA 4IJHA 3T13A 1SYGA 4XQJA 1OXUA 1V1OA 3NTKA 2F0KA 5FJ8G 3PMFA 2FMMA 1AH9A 2K52A 4FF1A 1VDZA 3J80c 1T5EA 3OTOQ 4IUTA 1NNXA 4UDUC 3HOWB 2HQLA 3HOXB 3LWUA 3RD4A 1RTOA 2BCOA 3CCVA 3S16B 1VQCA 2RHQB 1J9OA 5G3LD 1UE1A 1S5CD 1STYA 1STHA 4A3MG 2A73B 4KK7A 2Z9HA 2KECA 3E6ZX 1LT3D 1S5DD 3CW2C 2BH2A 3GTPB 4A3BG 4K0KL 4ZUIA 2KBNA 4IUNA 4CBVA 2F0TA 1SMYC 4BY7G 4B3TL 5JEAH 2VUMB 4I65A 2D9UA 3ND9A 3J7ZC 5IE8A 5CORA 1BF4A 2PQAB 1VQPA 3GV3A 2YV5A 4GZYC 1XNRQ 3GDEA 4K2KA 3VYTA 1EY0A 1TS3A 4YWMA 5EJWA 4R4OA 3OYYA 3NQTA 2AMCB 3K6OA 5C4JH 1RCVD 1DM0B 1E24A 2NYZD 4XTCS 5ELBA 1SBBB 2JA8G 5IGBA 4PV1C 1A8VA 2F0QA 4CGYB 2OWOA 4ZCKA 3RLFA 3IRBA 1TY2A 2K5DA 3EVQA 3GTKB 3AU7A 1K8GA 3VR2A 3CC4A 2XSCA 1PTOC 3BJUA 1AFPA 4MN3A 5C4JB 2JJQA 1LACA 3Q24A 4O0AA 1EFWA 2RSNA 1WCMG 5DAUA 4A3CG 5FLXc 1O7ZA 1QNKA 1GXDC 1IW7D 4DNTB 4R8NA 3PIP3 4EX5A 3FKIG 2JA9A 4QY7A 1EYGA 2F0FA 2FINB 1PTOF 2XRQD 3TBIB 3MEHA 2K01A 2WAQG 4OEMB 1VQ9A 1I3QH 2NVYH 1SYFA 1QZHA 5D14A 4DXFA 2ICEC 2F4VL 3M4QA 4B3MQ 3I56A 3CD6A 3PO2H 3S2HH 3C2PA 4KHPQ 3DEOA 2J0TD 3AQQA 3GP7A 4X64Q 4LW1A 3R2IA 1A63A 2JA6G 1X55A 2WAQE 2PPBC 1I3QB 1R4PB 2Q8TA 2NVYB 2A5HA 1F77A 1S4ZA 3A7AB 3JAMi 4A3EG 4LF5Q 1E2WA 3PO2B 2X6LA 4FP5D 4A75A 2OQ0A 3FMCA 3S2HB 1JQYD 3KBXA 1I4RA 2N49A 2PW7A 3KLSA 1QZGA 4MTNA 1B9MA 1X3FA 5IP7G 1IHZA 2R6GA 1E2ZA 4DV1Q 3I4MG 1XYIA 3M3YH 2LXKA 2K5NA 4DFAA 1LM0A 1XNQL 5I4DA 2N8NA 4A76A 1GUOA 2UU9L 1JR0D 3FRPB 2I46A 2VXWA 2JEAI 1IKMA 2K5VA 4DGZA 1I4PA 5IGEA 4R9WA 3M3YB 1HZAA 1PFSA 1YVCA 2R7DA 5AJ3Q 4E6IA 4DV7L 4AQYL 1X3EA 3URYA 4NMZA 1CKNB 2PZTA 3HFZB 5T1GA 4DV2L 3JAMc 4WJ3M 2B8FA 2R61A 1ENAA 3CP0A 2Z1CA 4C2MH 2JA7G 1B3QA 1NE3A 1SFOH 5HURA 1ZKOA 2G5DA 4ULLA 3GTJH 1EEFD 5HGTA 4HSVA 3MZ5A 5C4HA 5J3BA 3NBIA 1PH7A 1DCZA 1CHQD 4BXXH 1VQIA 4C2MB 2F0NA 1K0RA 2B2WA 4NW2A 4LUZA 1H9SA 1XTCD 3HEJA 1SFOB 5C4XG 3FPUB 2RVLA 1HR0L 1STGA 4L5SA 3GTJB 4EQPA 1FYCA 1DXMA 2EQSA 5FOBB 1BCPB 2PQEA 3VA7A 1C8CA 2R93H 2ZJPA 5IYCH 4YHHQ 3VYUA 4L5TA 1Q90A 1D1IA 4BBSG 5FLMH 1G291 3T1YQ 1K8AC 4LF6Q 3CCQA 3J7AF 2JE6I 5E7NA 1PH5A 2L4NA 1N33L 1L0XB 1Q12A 4UP9A 4O2DA 2NVTH 2UXBQ 2R93B 1OXXK 2ZXOA 1TVXA 2F3IA 3TZDA 4GOPB 1GOZA 1HCZA 3W3AA 3I72A 2TMPA 4AH6A 1KHIA 2CHBD 5CBAE 3TRZA 4A3GH 4JI5Q 4DK3C 1SE3A 1S5ED 4AYBG 1VQJA 1SMXA 4QUFA 5I2XA 3J81L 2NVTB 5FO9B 2NVQH 1I5FA 1HJPA 1E7ZA 2QCPX 5LL6X 1VF5C 4JBKA 1EQQA 4A3GB 2F0UA 3A8KE 2EPBA 4PG3A 1BOSA 1PVOA 1U0LA 2CWPA 3G7LA 2SOBA 1ICFB 3KYHC 3TSSA 2NVQB 4TSSA 1U9RA 2I5LX 2A19A 1O80A 3TQYA 2I5HA 4LAAA 2AQ3B 1VQ6A 2VQEL 5EBDA 4LF7L 2QGQA 2JSOA 3HOZH 1HNWL 1N34Q 2MO1A 2FFKB 3E5SA 2JYOA 1KTKA 1RTNA 4K8JA 5JEAJ 2ASBA 1YZ6A 1PH8A 3U9OA 1XMQL 4XQQA 2IHFA 2A69C 1PH9A 1IYUA 5IP9H 4B3RL 1K9MC 1GO3E 3HOZB 1K8MA 1SXTA 1IBLQ 1B53A 2DNCA 1A0IA 5KYLA 2BE5D 1G6PA 1GVPA 1AP0A 2IWHA 3TS0A 2K50A 5ELDA 1OO9B 3RZDH 4EVOA 4JI1Q 3HP3A 1Y8NB 1PDQA 1IZ6A 1LO5D 5J1ZA 2Q8RE 1A2TA 2F3WA 3OWFA 2AKWB 4GS3A 4KHPL 1AEXA 1AN8A 1BDOA 1CTMA 3LGJA 1AE3A 1B2TA 2X6GA 3J81E 3CMAA 3K59A 5JPNC 2E74C 4HMJA 4GOPC 1SE8A 4P75A 1H9SB 3T56B 3SK8A 2KCTA 1UEAB 3HOVH 5KGUA 2P5ZX 1Z9FA 3D31A 4RKBA 1V9PA 1MSGA 2KCMA 5ELNA 1M1KC 2HIXA 4DNIA 3UDGA 2NUCA 3Q0AA 5C3EG 1Y1WH 3ZYYX 1IBML 2Y0SB 4C3IH 1QCBD 4RG1A 3HOVB 4IOCA 4RAUC 1I4HA 2YTXA 2LFNA 2RCNA 1EYDA 3J80L 1VS0A 3T4AC 2R92B 5CYUA 4HIOA 3S1MB 5M3FG 1F9SA 3VYRA 5KNBA 1Y1WB 1MBYA 1I4XA 1LV9A 1C0AA 4C3IB 4OO1G 3S15B 1CSQA 3EA6A 2F0JA 3KFUA 3DM1A 4ZLTF 1G51A 3CCMA 4EQOA 1NSNS 2AWOA 3S14H 1XTDA 5LMNL 4V190 2Q2TA 2KHJA 4RMFA 3BDLA 1D7QA 3D3RA 1V8QA 1CSPA 3DXJC 2OEOA 3R93A 1GJXA 3BZDB 4NPSA 4QUCA 1KC8C 3UDXA 2A1AA 2F1MA 2HDLA 3S14B 1KAWA 1JWMD 1Q86C 4JOIA 1X3PA 4ZQ3A 2KEDA 4A3FH 2DY7A 4M8AA 2R7FA 1X6OA 1HNXL 3L7ZC 4IN3A 5I2YA 3G48A 1V1PA 1SMYD 1ILPA 2K33A 3IKJA 1S72A 1PH6A 5FJ8H 1LTLA 2VB2X 1SE4A 2VQFQ 3ER0A 3K0YA 4ZKBB 2N55A 1EIYB 4PZ7A 4NXMQ 4Z9CB 5ELFA 4DV6L 4XIGS 2B2WC 1MD2D 3NHHA 3X3MA 1ZYRC 2UXBL 5FLXL 3J80E 4DF7A 1BR9A 3R8BA 5TSSA 4LF9Q 2EE1A 2GVAA 4CJ0B 3LWEA 3BZKA 4ZK9B 3ERQA 1SNOA 1U4RA 2ZT9C 3NUCA 3KF8A 4YY3L 3EROA 1Q46A 4OWXB 1QILA 1PTOD 3N52A 2A6HD 4JI2Q 4JI4Q 4ALPA 2VL6A 4DR7L 2L55A 2OCEA 2DN8A 2YTYA 1Y1VH 4A3BH 1HUNA 1QJOA 1RL2A 2EJFC 5IYBG 4DR5Q 4R4CA 2K14A 1VQMA 2M9VA 3RUZA 2NTTA 5E3FA 3RMHA 1IL2A 1TS4A 2IX0A 1TS2A 2ZJQA 4IUPA 1Y1VB 4A3BB 1WJJA 2ES2A 2KVMA 3ERSX 4XT3B 2EY6A 2RBMA 2LKVA 3L2PA 2JA8H 1SLJA 3I4NG 1X3GA 1N34L 3CRLC 4S3SA 4G7HC 3TP7A 4HN7A 2MQHA 3W1BA 4JI3L 1Q3LA 2WP8J 2BH8A 4DV5L 1GUTA 1MHWC 4YCVA 2MJ8A 2JA8B 3M7NA 3F8TA 4PZ6A 2EDGA 3C1EA 5ELCA 5C44G 3OWEB 5CV9A 4A3CH 4X65Q 1YJ9A 3NSWA 2H1EA 4HJ8A 3MXPA 3KUPA 3S17H 2I07B 3UE0A 2KENA 3FKIH 3HOUH 5IGCA 5FLXE 4QCLA 5LL6S 3NPPA 4QB4A 5JPMC 1XJVA 3JAML 4F7XA 1CHPD 2OTJA 4N8X1 4FF4A 1I94Q 4U673 2RDHA 2N3SA 2NN6G 4CJ1B 3S17B 1EZ8A 3FKIB 4CKCA 3S1NH 3HOUB 1F2MA 1LT4D 3ULJA 5ISRA 3J7YW 3K5OA 1V43A 2JA5G 4FXGC 1D6EC 1UE5A 2IHEA 3QOJA 5ELEA 3HS0C 4A3EH 4QMGA 4IPCA 1EOTA 4JI0Q 4GKKL 5CV6A 1JE4A 4DR1L 1BKBA 3PUZA 1GUGA 1PRTF 5FO8B 3S1NB 2F0PA 3H94A 1WTWA 3H0GH 2B3GA 5IOCA 2UXCQ 1V1PB 3K5MA 3BVZA 2AQ1B 5BN5A 1NJIC 3HKZG 4CDFC 2DY8A 2IX1A 1JT8A 3I4MH 4A3EB 2EJGC 3W2DA 3VYSA 4DV3L 1EQVA 2HIVA 4KJNA 3PIO3 3HOXH 1CFMA 3F2BA 1WTQA 4UHVA 1FD7D 3H0GB 4BWGB 1R9TH 3J7AV 1RJTA 3GV6A 1T5XD 5JOBA 5NUCA 3S16H 3HKZE 1DONA 3CPFA 4C3JG 2BDNA 2E76C 3SXHA 4Q5VA 1JICA 3I4MB 4CDDC 1LTRD 3KF8B 1CKOA 2NVXB 3RR5A 2B29A 3I55A 1TKWB 1KAAA 1ONLA 3M7GA 2UUBL 1JJCB 5L37A 3I2ZA 1R9TB 4QL5A 2QDLA 1VQ4A 2QF7A 5EKKA 3HKSA 3NEMA 3GTPH 2RCFA 3BDOA 1LUZA 2O4XA 4OELB 4POGA 1N32L 4GKJQ 2V1CC 5EBCA 2VUMH 3JAME 2JA7H 2PZWA 4KKTA 2Q2HA 4N8FA 2NZOA 3OSOA 2E2IB 4OWWB 1HZCA 2QDBA 3PUVA 1CKNA 4ZYSA 2A68C 3W5OA 1WYDA 4GN5A 4RGNA 4KLKA 1I50H 2JA7B 4MZ9A 1KDCA 4L63B 5FK9C 3MXNA 3ITPA 4MIUA 1PV4A 4LF4L 2QA4A 3GTKH 2PO4A 2UUAL 5K36G 1A2UA 1NUCA 2AWNA 2KCCA 2DUDA 1SNCA 5CV5A 1EY9A 2UUCL 3FEWX 1TWHH 3S2DH 4LFCL 3KJOA 3MXGA 1I50B 4OL7A 1LTTD 2E8GA 3B6YA 3K80C 5E4XA 2E2DC 4NXNL 3PO3G 1WTPA 2XWBB 4JOIC 3MEFA 2I5MX 1UEBA 1TWHB 3S2DB 1YNJC 1GM5A 1C7YA 3AFQA 5M3MG 1NAPA 4JVZA 1LTGD 4BBSB 4IUUA 4DR4L 3OIPA 2H5XA 4B3SL 4ILWA 3F2CA 5ELOA 1IYJB 1YHBA 3OPOA 3A7LA 5C5LA 4GOPA 2D5DA 3NQIA 4A3JH 2RQXA 2RDGA 2F0IA 1YHAA 4Y7NB 1JJGA 5JJIA 4B9XA 4AYBB 1LT5D 3D8GA 2HCIA 1BCPD 1Y69U 2ZM6Q 4A3JB 2E2JH 2Z6BA 4M1UB 3RN2A 1ASZA 1VCIA 5KNDA 1G2TA 1C4QA 4K2LA 4TRDA 1MJEA 1SJED 1CKMA 4DUYL 1SYBA 1O78A 5GROA 1HFGA 5C3XA 1ZEQX 1WTXA 2E2JB 1PFBA 4RA8A 3U50C 1J8IA 1X65A 4K14A 4C3HG 5IWAL 2RKSA 2WIIB 1N8RC 3GTGH 5CGKA 3PGZA 4LFBQ 2K75A 3IFDA 1VQLA 4JI7L 2R7ZG 2E75C 3VR6A 4A3LG 2F3VA 1ICWA 3G71A 4JV5Q 3JC66 4KJOA 1CQVA 2Z6KA 4I7AA 1PHJA 3BU2A 4LFAQ 3GTGB 1S40A 2EVBA 1SN8A 4XYQA 4OX9Q 2H4OA 2KCNA 3HOWG 3BG3A 5IT9L 4KY5A 1IBKL 1K8OA 1K3BC 1B4OA 4LMQD 3F2DA 2PI2E 1VQFA 2KHIA 1JWUD 3R3OA 2B2VC 4JBWA 1N36L 2KQ3A 1HFNA 1SROA 4OO1I 3A8IE 3MXNB 4QGUA 3A5UA 1B1ZA 3L9AX 2ZXRA 4DPGA 4JI8Q 1DOKA 3AB9A 5C0XG 3K5NA 1BBXC 5BR8L 4IUVA 1QVCA 4JI6Q 3RN5A 2K5HA 2BA0A 4DR3Q 3N6RA 3H15A 3M9BA 2EOTA 3KK7A 3GO5A 3PUWA 3SVMA 2Z4HA 1EIFA 1NMFA 2ENBA 1CK1A 2EY2A 3IFTA 2ZJRA 1G91A 4YCUA 4OO1H 2KEEA 3OTOL 4HJ9A 1HNZQ 2VZAA 2F0EA 4JBMA 2L5TA 4DUZQ 4KKSA 3AMUA 4DV4Q 1SNDA 2PYKA 1WVLA 1U4MA 3EBEA 3Q6SA 3K8AA 4GKJL 1EL0A 1JC7A 1U4LA 2KA7A 2MHVA 4WORA 2EXDA 1VMCA 1XMOQ 1HZBA 4A3DH 2WKCA 3HZXA 2N78A 1SRUA 2RA4A 1KLUD 2JP1A 4DAMA 3I73A 1Y14B 1PH1A 3WOFA 4QIWB 3NTIA 1WTVA 4BA2I 1MJCA 4GLXA 1XWEA 1H95A 3KLRA 2F03A 4OGQC 4KD3A 2D62A 1UE6A 2PW5A 1KIXA 2FJ2A 4A3DB 2XTIA 5FO7B 5JAVA 2K05A 3K58A 4KTAA 3CMEA 2FHTA 1Q8IA 3SR1A 1YBYA 1B3AA 3HOYH 4DXGA 1XNRL 4K5VA 3T1HQ 1AZPA 4POFA 2F0LA 4KD4A 4F87A 2EYHA 4KHZA 3G6EA 5HGQA 2XRSD 4IURA 3QJYA 2R3ZA 1EU3A 1EYCA 5KYIA 2HQEA 1PFNA 1PFMA 3HOYB 3BDCA 4APVA 2SDFA 1HPCA 1SSOA 3QB3A 3HGBA 5D3IB 1TU2B 5GQOA 3M4PA 1QOHA 1X32A 2SNMA 4DV0Q 4GNXB 2F0GA 1KNAA 2F0OA 1CA5A 4BY1H 1HUMA 3I70A 1TWCH 2HHHQ 4IPGA 2CKZB 1IW7C 3BVMA 1Y8OB 3S1RH 1HQRD 2MO0A 1FVIA 3TP5A 5IYBH 4B3ML 2SNSA 3CCLA 1FR3A 1I6HH 4BY1B 3TP6A 4JYAQ 3ICEA 4X64L 1TWCB 3U4VA 2O2LD 1EUJA 4G7OC 3DWPA 4QF4A 1E2VA 1SYEA 2JN4A 4X66Q 3O13A 3F2UA 3S1RB 4HSPA 4LF5L 1O7LA
chains in the Genus database with same CATH topology
1VQMA 3CW2C 2CWAA 1T9HA 4MNOA 2QEXA 5LMNQ 4A3KH 2BH2A 1IL2A 4IFDI 1J5EQ 2IX0A 1VQGA 1AE2A 2YTVA 3TREA 4QJFA 1VQOA 2ZJQA 4A3BG 4K0KL 2VUMG 4DR2L 5JJLA 1TWAH 2KBNA 1WJJA 3E9HA 2ES2A 2R92H 4BY7G 4B3TL 3S1MH 3ERSX 3GTMH 3J7ZC 3K81C 3L2PA 4HIDA 1Q7YC 4DV1L 5IE8A 1SLJA 2FXQA 2A8VA 5M3FH 2JA8H 4JBJA 1L1OC 2Q2UA 3I4NG 1X3GA 1N34L 3PV0A 4P73A 1B8AA 3GTOH 2PQAB 1VQPA 3EN2A 2YV5A 1W2BA 3S15H 1XNRQ 3GDEA 4X62Q 2MQHA 4YWMA 1KL9A 4R4OA 1HR0W 3OYYA 3W1BA 4JI3L 5JEAG 2AMCB 1NMGA 2JK8A 1XPOA 5C4JH 5IYDH 2WP8J 2BH8A 3S24A 4BBRH 1E24A 4DV5L 4XTCS 2JA8G 4YCVA 3CCJA 1YITA 3M7NA 1A8VA 3F8TA 3PCOB 4PZ6A 2OWOA 1HNXQ 5C44G 2LXJA 3RLFA 3IRBA 4LFAL 4X65Q 4A3CH 3STBD 1YJ9A 4BXXG 1K8GA 3CC7A 3CC4A 5LMUQ 3GD7A 5AJ3L 4HJ8A 4HJ7A 3S17H 4DR6Q 2LSSA 3BJUA 3UE0A 3PIPA 2KENA 3FKIH 3PUXA 3CAMA 3HOUH 1KRSA 3OW2A 4R1JA 2JJQA 4O0AA 1EFWA 2B63H 1XJVA 1WCMG 2CFMA 4A3CG 4IFDG 5FLXc 2R93G 4DV6Q 2OTJA 1OXSC 1I94Q 2WFWA 5IYCG 1YEZA 2N3SA 4EX5A 2NN6G 3FKIG 2JA9A 4QY7A 1EYGA 5FLMG 4DKAC 5IT9c 3S1NH 2Z6KC 2WAQG 2B63G 1VQ9A 1I3QH 3ULJA 1BBUA 3W1GA 2NVYH 4GNXC 1HZ9A 4A3IH 1QZHA 2GN5A 4YY3Q 2UXDQ 1JMCA 1PA6A 1Q1BA 1V43A 1QVFA 1FL0A 5M5WH 2JA5G 3M4QA 4IPDA 2F4VL 4B3MQ 3I56A 3CD6A 3PO2H 1UE5A 2IHEA 4DR7Q 4A3EH 3S2HH 4IPCA 4JI0Q 4GKKL 4KHPQ 3AQQA 2ZTCA 4X64Q 2DGYA 4IJLA 4DR1L 1BKBA 1CUKA 3PUZA 4LW1A 4A3JG 1A63A 2JA6G 4A3GG 1X55A 2WAQE 3H0GH 2B3GA 2UXCQ 2VS1A 1O7IA 4TVAB 5C0XJ 1NJIC 3L0OA 4A93H 3PO2G 1Q81C 3HKZG 2D0OA 3JAMi 4A3EG 4LF5Q 1VQHA 4AYBE 2IX1A 4YHHL 1JT8A 3I4MH 1NY4A 4A75A 2OQ0A 4EQ5A 4DV3L 3T1YL 2L15A 4K0KQ 4LF6L 2HIVA 3HOXH 2N49A 3F2BA 1KQSA 1QZGA 3STBC 4DUZL 4MTNA 1VQ8A 3CC2A 4L5QA 1QUQB 4H02A 4PZ8A 1V1QA 1X3FA 4B3TQ 4L5RC 1R9TH 2ATWA 4A93G 5IP7G 1QUQA 2Q2IA 2R6GA 4DV1Q 1W3SA 3HKZE 3I4MG 3S16H 3CPFA 3M3YH 2LXKA 4X6AH 2K5NA 2OQKA 3Q8DA 1PYBA 3J81i 2F52A 1LM0A 1XNQL 1FJGQ 3KF8B 2N8NA 1CKOA 3RR5A 4A76A 1Z47A 2UU9L 3CCEA 2B29A 4TQUS 1BBWA 3ZJYC 3I55A 4A3MH 4JI3Q 4JI5L 3K7AH 2UUBL 2JEAI 1JJCB 4DV5Q 3I2ZA 1A62A 2K5VA 3CQZH 1Q1EA 4QL5A 3CCUA 2Z0SA 2PNHA 1VQ4A 3HKSA 3NEMA 3UE1A 3GTPH 1HZAA 1LUZA 4POGA 1N32L 4OONA 4GKJQ 2ZM6L 2V1CC 1PFSA 1YVCA 2R7DA 5AJ3Q 2VUMH 4DV7L 2JA7H 4AQYL 4BY7H 2Q2HA 3PF4A 3KLWA 1X3EA 2NZOA 1YHQA 5IP9G 4OWWB 1CKNB 1YJWA 2ZTDA 3AFPA 1HZCA 1TXYA 3HFZB 4DV2L 3PUVA 1CKNA 3JAMc 4WJ3M 3I4NH 1VQ5A 3PUYA 1E22A 3W5OA 1WYDA 4GN5A 3CP0A 4C2MH 5M5YH 1EWIA 4KLKA 2JA7G 1I50H 2NN6I 1NE3A 1SFOH 4MZ9A 3GTJH 2AHOB 2OTLA 3TS2A 3DLLA 4J15A 1M90C 4R4QA 3D0FA 2IT1A 1PV4A 4LF4L 5J3BA 2QA4A 3GTKH 5JJKA 2UUAL 5C44H 3KF6A 4LFBL 5K36G 2AWNA 2F4VQ 2DUDA 1PH7A 2UUCL 5HY6A 1TWGH 3VDYA 4BXXH 1TWHH 1VQIA 3NELA 4LFCL 3KJOA 3S2DH 1K0RA 4FDBA 4LUZA 4UP7A 3RZOH 3PSIA 1VQEA 4GKKQ 4DR1Q 5C4XG 1UE7A 2E8GA 3B6YA 3K80C 1HR0L 3PO3G 4NXNL 4L5SA 5M3MH 4JOIC 4JV5L 1IBLL 1WCMH 3MEFA 1Q8KA 2EQSA 4JG2A 3ULLA 2JEBI 2R93H 2ZJPA 2I5MX 1UEBA 4P74A 1PH3A 3HOVG 1X54A 5IYCH 4YHHQ 4OX9L 4KI0A 4L5TA 1C7YA 1GM5A 1J6QA 4BBSG 5FLMH 1G291 4JI1L 3AFQA 1L0WA 5M3MG 4DV3Q 3T1YQ 1K8AC 5GADC 3CXCA 4LF6Q 3CCQA 1XPRA 4DR4L 2H5XA 4B3SL 2JE6I 1P16A 5E7NA 1Y1WG 1PH5A 3F2CA 1N33L 1Q12A 4UP9A 4O2DA 2NVTH 5ELOA 1IYJB 1YHBA 2JA5H 1OXXK 1XPUA 2UXBQ 2EIFA 2F3IA 4GOPB 3CCRA 4GOPA 4LF8Q 1XNQQ 4AH6A 1KHIA 3NBHB 4A3JH 4P71A 1S3OA 2E5LQ 2UU9Q 2JA6H 4A3GH 3TRZA 4JI8L 4JI5Q 4DK3C 2RF4A 2UUBQ 5LMNW 1TWFH 1YIJA 1YI2A 1YHAA 1JJGA 5JJIA 3DM3A 1E1OA 1VQJA 1SMXA 3K7UC 4AYBG 1FGUA 3J81j 2NVQH 3KDFB 3I4OA 5DLQE 1I5FA 4JI6L 1VQNA 1HJPA 1E7ZA 3KDFA 4DR3L 1N32Q 4P72A 2ZM6Q 1P8LA 4A3DG 2YU9H 4JBKA 1IXRA 1B70B 3TEHB 3G4SA 4DV7Q 1EQQA 4AQYQ 1Q82C 3CPWA 2E2JH 4GLVB 3M4OH 3RN2A 3KOJA 4PG3A 4HJAA 1PVOA 4QIWE 1ASZA 1VCIA 1U0LA 5IP7H 2VW9A 2CWPA 4DV2Q 4C3JH 3KYHC 3M85A 1MJEA 1WI5A 4JCVE 4YWKA 1CKMA 2NVXH 1HNZL 1VQDA 4DUYL 4DR2Q 2E2HH 1UWVA 2I5LX 2A19A 3TQYA 2CCZA 5GROA 2I5HA 1X56A 1VQ6A 1WOCA 2VQEL 3U50C 1VQKA 4LF7L 4DV4L 1X65A 2QGQA 4WJ4A 3HOZH 1HNWL 5IWAL 3UDIA 1N34Q 2MO1A 1N8RC 3HOYG 1GD7A 4LF4Q 3GTGH 5C0XI 2UUAQ 3PGZA 4LFBQ 2VY3A 1JB7A 5JEAJ 2K75A 2UUCQ 2ASBA 1XMOL 1YZ6A 4DR6L 4YCWA 1PH2A 1PH8A 1VQLA 4JI7L 4LFCQ 1XMQL 2ZTEA 4A3FG 5H1SE 2E2IH 2R7ZG 2IHFA 1PH9A 2HT1A 3HOZG 4A3LG 3G71A 1HR0Q 3I7FA 5IP9H 4B3RL 2D0PA 4NXNQ 2WB1G 1K9MC 1GO3E 4JV5Q 4Y52H 3JC66 1IBLQ 1MKHA 2Z6KA 1A0IA 1PHJA 3BU2A 4LFAQ 3SGIA 1G6PA 1GVPA 1S40A 1SN8A 4UY8C 3A5ZB 3TS0A 2K50A 2PI2A 2RHSB 4YWLA 4OX9Q 1MIUA 3HOWG 1DGSA 3RZDH 4JI1Q 1QVGA 1IZ6A 2WB1E 1IBKL 2I0QA 4DR4Q 4IFDJ 2UXDL 5EAYA 2PI2E 1VQFA 2KHIA 3KJPA 4GLAC 3F2DA 4B3SQ 1N33Q 4BY1G 3T1HL 3FP9A 4DAYB 2AKWB 4JBWA 3RLNA 1N36L 4GS3A 4KHPL 1JJ2A 3LGJA 1SROA 1KD1C 1AE3A 3MXNB 4OO1I 4QGUA 3ULPA 1U5KA 3A5UA 5C4XH 1YNXA 3CMAA 3PO3H 1HH2P 3AYHB 3KF6B 4JI8Q 4DPGA 1OTCA 1L2FA 1KRTA 3E0EA 5C0XG 4IPHA 3J81c 4HJ5A 2XGTA 4GOPC 1SE8A 4P75A 4R4TA 5BR8L 1GKHA 1E3PA 2KCTA 3HOVH 1QVCA 2CQOA 2MFIA 4JI6Q 1NTGA 3RN5A 5GAEC 1Y1VG 1Z9FA 3D31A 3WWVA 2VQFL 2MNAA 1V9PA 2BA0A 2K5HA 4DR3Q 4BBSH 2KCMA 5ELNA 1M1KC 3RLOA 2HIXA 3H15A 3M9BA 5GAGC 4NXML 3PUWA 3GO5A 4BA1I 4DV0L 4DNIA 3UDGA 1PH4A 1EIFA 1NMFA 1VQ7A 2Y0SG 5C3EG 2ZJRA 1Y1WH 4LF9L 1IBML 4YCUA 4HIKA 4A3KG 4A4IA 4C3IH 2HHHL 3PF5A 4RG1A 1FJGL 4NB3A 4IOCA 2PQAA 2YTXA 4JC0A 4LWCA 3OTOL 1E1TA 4HJ9A 2R92G 4UP8A 2RCNA 1HNZQ 2VZAA 1VS0A 2NZHA 4DUYQ 4JBMA 4DUZQ 4GN4B 4HIOA 4Y7NH 1SR3A 2VQEQ 3NENA 2ID0A 2GVBA 5M3FG 4DV4Q 4JI2L 4JI4L 1LYLA 4LF7Q 2VNUD 1B7YB 1KXLA 2Y0SE 1HNWQ 5IWAQ 2IY5B 3EBEA 5M5XH 4JYAL 3U4ZA 1VQAA 3CF5A 1C0AA 3K8AA 4OO1G 4GKJL 1D8LA 1CSQA 2EXDA 1XMOQ 5IYDG 4BBRG 1HZBA 3KFUA 4A3DH 1VQBA 1G51A 3CCMA 1XMQQ 4JI7Q 2N78A 4X66L 4DR5L 4DK6C 1SRUA 3J7A5 4DAMA 2C35B 1Y14B 1PH1A 4B3RQ 2AWOA 4IO9A 3S14H 1ASYA 1JE5A 4HIMA 1MJCA 1XTDA 1L1OB 5LMNL 4GLXA 4BA2I 1J5EL 2Q2TA 2JQOA 2KHJA 5GAHC 1L1OA 1H95A 4RMFA 1D7QA 1K83H 3EIVA 2D62A 1UE6A 1CSPA 4PMWA 1KIXA 3HOUG 3BZCA 4UPAA 3J80i 2XTIA 5IY0A 1EQRA 4NPSA 1KC8C 1WFQA 3UDXA 2A1AA 3CMEA 4C3HH 1IBKQ 3GTQH 1YBYA 4LNQA 1OXTA 3HOYH 1KAWA 1EOVA 3E9IA 4X62L 1K73C 1XNRL 3GTLH 4LUOA 4OWTB 3T1HQ 4JOIA 1Q86C 4OXPA 4POFA 1N36Q 3K0XA 1N9WA 3G6EA 4KHZA 3FHWA 4LUVA 5HGQA 1X9NA 3AEVA 3S1QH 2PMZE 4A3FH 2R7ZH 1RIPA 3A74A 2R7FA 1X6OA 4A3IG 4A3LH 1HNXL 3CCSA 3PIOA 3L7ZC 3RNUA 4X65L 1K3RA 3G48A 2BA1A 5LMUL 1PH6A 1BVSA 5BR8Q 4APVA 5FJ8H 1S72A 1C9OA 1LTLA 5GQOA 3M4PA 2VQFQ 3HOWH 4AIMA 2K4KA 4QQBX 3ER0A 3H0GG 1NBWA 1EIYB 1OXVA 3F1ZA 4IJHA 4PZ7A 4NXMQ 4DV0Q 4DV6L 1OXUA 4XIGS 4GNXB 1I94L 2UXBL 3H3VI 5FJ8G 4GNXA 4LF9Q 4BY1H 4ME3A 1IBMQ 1AH9A 2GVAA 2K52A 3A0JA 1TWCH 4LF8L 2HHHQ 4IPGA 3BZKA 4R4IA 3HOXG 3J80c 3OTOQ 2E5LL 2CKZB 2HQLA 2YYZA 4YY3L 2ALYB 4GN3B 1Q46A 4OWXB 3S1RH 5IYBH 2MO0A 1FVIA 4JI2Q 4B3ML 4JI4Q 4ALPA 3CCVA 2VL6A 4DR7L 3CCLA 1VQCA 2RHQB 1I6HH 4JI0L 4JYAQ 3ICEA 2OCEA 4X64L 1UE1A 3U4VA 3UDFA 1EUJA 2YTYA 1Y1VH 4A3BH 4A3MG 1YJNA 2UXCL 1PYSB 1RL2A 3U58A 5IYBG 4X66Q 4DR5Q 4R4CA 4IOAA 4LF5L 2K14A 3H3VH 5C3EH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQM A;  3CW2 C;  2CWA A;  1T9H A;  4MNO A;  2QEX A;  5LMN Q;  4A3K H;  2BH2 A;  1IL2 A;  4IFD I;  1J5E Q;  2IX0 A;  1VQG A;  1AE2 A;  2YTV A;  3TRE A;  4QJF A;  1VQO A;  2ZJQ A;  4A3B G;  4K0K L;  2VUM G;  4DR2 L;  5JJL A;  1TWA H;  2KBN A;  1WJJ A;  3E9H A;  2ES2 A;  2R92 H;  4BY7 G;  4B3T L;  3S1M H;  3ERS X;  3GTM H;  3J7Z C;  3K81 C;  3L2P A;  4HID A;  1Q7Y C;  4DV1 L;  5IE8 A;  1SLJ A;  2FXQ A;  2A8V A;  5M3F H;  2JA8 H;  4JBJ A;  1L1O C;  2Q2U A;  3I4N G;  1X3G A;  1N34 L;  3PV0 A;  4P73 A;  1B8A A;  3GTO H;  2PQA B;  1VQP A;  3EN2 A;  2YV5 A;  1W2B A;  3S15 H;  1XNR Q;  3GDE A;  4X62 Q;  2MQH A;  4YWM A;  1KL9 A;  4R4O A;  1HR0 W;  3OYY A;  3W1B A;  4JI3 L;  5JEA G;  2AMC B;  1NMG A;  2JK8 A;  1XPO A;  5C4J H;  5IYD H;  2WP8 J;  2BH8 A;  3S24 A;  4BBR H;  1E24 A;  4DV5 L;  4XTC S;  2JA8 G;  4YCV A;  3CCJ A;  1YIT A;  3M7N A;  1A8V A;  3F8T A;  3PCO B;  4PZ6 A;  2OWO A;  1HNX Q;  5C44 G;  2LXJ A;  3RLF A;  3IRB A;  4LFA L;  4X65 Q;  4A3C H;  3STB D;  1YJ9 A;  4BXX G;  1K8G A;  3CC7 A;  3CC4 A;  5LMU Q;  3GD7 A;  5AJ3 L;  4HJ8 A;  4HJ7 A;  3S17 H;  4DR6 Q;  2LSS A;  3BJU A;  3UE0 A;  3PIP A;  2KEN A;  3FKI H;  3PUX A;  3CAM A;  3HOU H;  1KRS A;  3OW2 A;  4R1J A;  2JJQ A;  4O0A A;  1EFW A;  2B63 H;  1XJV A;  1WCM G;  2CFM A;  4A3C G;  4IFD G;  5FLX c;  2R93 G;  4DV6 Q;  2OTJ A;  1OXS C;  1I94 Q;  2WFW A;  5IYC G;  1YEZ A;  2N3S A;  4EX5 A;  2NN6 G;  3FKI G;  2JA9 A;  4QY7 A;  1EYG A;  5FLM G;  4DKA C;  5IT9 c;  3S1N H;  2Z6K C;  2WAQ G;  2B63 G;  1VQ9 A;  1I3Q H;  3ULJ A;  1BBU A;  3W1G A;  2NVY H;  4GNX C;  1HZ9 A;  4A3I H;  1QZH A;  2GN5 A;  4YY3 Q;  2UXD Q;  1JMC A;  1PA6 A;  1Q1B A;  1V43 A;  1QVF A;  1FL0 A;  5M5W H;  2JA5 G;  3M4Q A;  4IPD A;  2F4V L;  4B3M Q;  3I56 A;  3CD6 A;  3PO2 H;  1UE5 A;  2IHE A;  4DR7 Q;  4A3E H;  3S2H H;  4IPC A;  4JI0 Q;  4GKK L;  4KHP Q;  3AQQ A;  2ZTC A;  4X64 Q;  2DGY A;  4IJL A;  4DR1 L;  1BKB A;  1CUK A;  3PUZ A;  4LW1 A;  4A3J G;  1A63 A;  2JA6 G;  4A3G G;  1X55 A;  2WAQ E;  3H0G H;  2B3G A;  2UXC Q;  2VS1 A;  1O7I A;  4TVA B;  5C0X J;  1NJI C;  3L0O A;  4A93 H;  3PO2 G;  1Q81 C;  3HKZ G;  2D0O A;  3JAM i;  4A3E G;  4LF5 Q;  1VQH A;  4AYB E;  2IX1 A;  4YHH L;  1JT8 A;  3I4M H;  1NY4 A;  4A75 A;  2OQ0 A;  4EQ5 A;  4DV3 L;  3T1Y L;  2L15 A;  4K0K Q;  4LF6 L;  2HIV A;  3HOX H;  2N49 A;  3F2B A;  1KQS A;  1QZG A;  3STB C;  4DUZ L;  4MTN A;  1VQ8 A;  3CC2 A;  4L5Q A;  1QUQ B;  4H02 A;  4PZ8 A;  1V1Q A;  1X3F A;  4B3T Q;  4L5R C;  1R9T H;  2ATW A;  4A93 G;  5IP7 G;  1QUQ A;  2Q2I A;  2R6G A;  4DV1 Q;  1W3S A;  3HKZ E;  3I4M G;  3S16 H;  3CPF A;  3M3Y H;  2LXK A;  4X6A H;  2K5N A;  2OQK A;  3Q8D A;  1PYB A;  3J81 i;  2F52 A;  1LM0 A;  1XNQ L;  1FJG Q;  3KF8 B;  2N8N A;  1CKO A;  3RR5 A;  4A76 A;  1Z47 A;  2UU9 L;  3CCE A;  2B29 A;  4TQU S;  1BBW A;  3ZJY C;  3I55 A;  4A3M H;  4JI3 Q;  4JI5 L;  3K7A H;  2UUB L;  2JEA I;  1JJC B;  4DV5 Q;  3I2Z A;  1A62 A;  2K5V A;  3CQZ H;  1Q1E A;  4QL5 A;  3CCU A;  2Z0S A;  2PNH A;  1VQ4 A;  3HKS A;  3NEM A;  3UE1 A;  3GTP H;  1HZA A;  1LUZ A;  4POG A;  1N32 L;  4OON A;  4GKJ Q;  2ZM6 L;  2V1C C;  1PFS A;  1YVC A;  2R7D A;  5AJ3 Q;  2VUM H;  4DV7 L;  2JA7 H;  4AQY L;  4BY7 H;  2Q2H A;  3PF4 A;  3KLW A;  1X3E A;  2NZO A;  1YHQ A;  5IP9 G;  4OWW B;  1CKN B;  1YJW A;  2ZTD A;  3AFP A;  1HZC A;  1TXY A;  3HFZ B;  4DV2 L;  3PUV A;  1CKN A;  3JAM c;  4WJ3 M;  3I4N H;  1VQ5 A;  3PUY A;  1E22 A;  3W5O A;  1WYD A;  4GN5 A;  3CP0 A;  4C2M H;  5M5Y H;  1EWI A;  4KLK A;  2JA7 G;  1I50 H;  2NN6 I;  1NE3 A;  1SFO H;  4MZ9 A;  3GTJ H;  2AHO B;  2OTL A;  3TS2 A;  3DLL A;  4J15 A;  1M90 C;  4R4Q A;  3D0F A;  2IT1 A;  1PV4 A;  4LF4 L;  5J3B A;  2QA4 A;  3GTK H;  5JJK A;  2UUA L;  5C44 H;  3KF6 A;  4LFB L;  5K36 G;  2AWN A;  2F4V Q;  2DUD A;  1PH7 A;  2UUC L;  5HY6 A;  1TWG H;  3VDY A;  4BXX H;  1TWH H;  1VQI A;  3NEL A;  4LFC L;  3KJO A;  3S2D H;  1K0R A;  4FDB A;  4LUZ A;  4UP7 A;  3RZO H;  3PSI A;  1VQE A;  4GKK Q;  4DR1 Q;  5C4X G;  1UE7 A;  2E8G A;  3B6Y A;  3K80 C;  1HR0 L;  3PO3 G;  4NXN L;  4L5S A;  5M3M H;  4JOI C;  4JV5 L;  1IBL L;  1WCM H;  3MEF A;  1Q8K A;  2EQS A;  4JG2 A;  3ULL A;  2JEB I;  2R93 H;  2ZJP A;  2I5M X;  1UEB A;  4P74 A;  1PH3 A;  3HOV G;  1X54 A;  5IYC H;  4YHH Q;  4OX9 L;  4KI0 A;  4L5T A;  1C7Y A;  1GM5 A;  1J6Q A;  4BBS G;  5FLM H;  1G29 1;  4JI1 L;  3AFQ A;  1L0W A;  5M3M G;  4DV3 Q;  3T1Y Q;  1K8A C;  5GAD C;  3CXC A;  4LF6 Q;  3CCQ A;  1XPR A;  4DR4 L;  2H5X A;  4B3S L;  2JE6 I;  1P16 A;  5E7N A;  1Y1W G;  1PH5 A;  3F2C A;  1N33 L;  1Q12 A;  4UP9 A;  4O2D A;  2NVT H;  5ELO A;  1IYJ B;  1YHB A;  2JA5 H;  1OXX K;  1XPU A;  2UXB Q;  2EIF A;  2F3I A;  4GOP B;  3CCR A;  4GOP A;  4LF8 Q;  1XNQ Q;  4AH6 A;  1KHI A;  3NBH B;  4A3J H;  4P71 A;  1S3O A;  2E5L Q;  2UU9 Q;  2JA6 H;  4A3G H;  3TRZ A;  4JI8 L;  4JI5 Q;  4DK3 C;  2RF4 A;  2UUB Q;  5LMN W;  1TWF H;  1YIJ A;  1YI2 A;  1YHA A;  1JJG A;  5JJI A;  3DM3 A;  1E1O A;  1VQJ A;  1SMX A;  3K7U C;  4AYB G;  1FGU A;  3J81 j;  2NVQ H;  3KDF B;  3I4O A;  5DLQ E;  1I5F A;  4JI6 L;  1VQN A;  1HJP A;  1E7Z A;  3KDF A;  4DR3 L;  1N32 Q;  4P72 A;  2ZM6 Q;  1P8L A;  4A3D G;  2YU9 H;  4JBK A;  1IXR A;  1B70 B;  3TEH B;  3G4S A;  4DV7 Q;  1EQQ A;  4AQY Q;  1Q82 C;  3CPW A;  2E2J H;  4GLV B;  3M4O H;  3RN2 A;  3KOJ A;  4PG3 A;  4HJA A;  1PVO A;  4QIW E;  1ASZ A;  1VCI A;  1U0L A;  5IP7 H;  2VW9 A;  2CWP A;  4DV2 Q;  4C3J H;  3KYH C;  3M85 A;  1MJE A;  1WI5 A;  4JCV E;  4YWK A;  1CKM A;  2NVX H;  1HNZ L;  1VQD A;  4DUY L;  4DR2 Q;  2E2H H;  1UWV A;  2I5L X;  2A19 A;  3TQY A;  2CCZ A;  5GRO A;  2I5H A;  1X56 A;  1VQ6 A;  1WOC A;  2VQE L;  3U50 C;  1VQK A;  4LF7 L;  4DV4 L;  1X65 A;  2QGQ A;  4WJ4 A;  3HOZ H;  1HNW L;  5IWA L;  3UDI A;  1N34 Q;  2MO1 A;  1N8R C;  3HOY G;  1GD7 A;  4LF4 Q;  3GTG H;  5C0X I;  2UUA Q;  3PGZ A;  4LFB Q;  2VY3 A;  1JB7 A;  5JEA J;  2K75 A;  2UUC Q;  2ASB A;  1XMO L;  1YZ6 A;  4DR6 L;  4YCW A;  1PH2 A;  1PH8 A;  1VQL A;  4JI7 L;  4LFC Q;  1XMQ L;  2ZTE A;  4A3F G;  5H1S E;  2E2I H;  2R7Z G;  2IHF A;  1PH9 A;  2HT1 A;  3HOZ G;  4A3L G;  3G71 A;  1HR0 Q;  3I7F A;  5IP9 H;  4B3R L;  2D0P A;  4NXN Q;  2WB1 G;  1K9M C;  1GO3 E;  4JV5 Q;  4Y52 H;  3JC6 6;  1IBL Q;  1MKH A;  2Z6K A;  1A0I A;  1PHJ A;  3BU2 A;  4LFA Q;  3SGI A;  1G6P A;  1GVP A;  1S40 A;  1SN8 A;  4UY8 C;  3A5Z B;  3TS0 A;  2K50 A;  2PI2 A;  2RHS B;  4YWL A;  4OX9 Q;  1MIU A;  3HOW G;  1DGS A;  3RZD H;  4JI1 Q;  1QVG A;  1IZ6 A;  2WB1 E;  1IBK L;  2I0Q A;  4DR4 Q;  4IFD J;  2UXD L;  5EAY A;  2PI2 E;  1VQF A;  2KHI A;  3KJP A;  4GLA C;  3F2D A;  4B3S Q;  1N33 Q;  4BY1 G;  3T1H L;  3FP9 A;  4DAY B;  2AKW B;  4JBW A;  3RLN A;  1N36 L;  4GS3 A;  4KHP L;  1JJ2 A;  3LGJ A;  1SRO A;  1KD1 C;  1AE3 A;  3MXN B;  4OO1 I;  4QGU A;  3ULP A;  1U5K A;  3A5U A;  5C4X H;  1YNX A;  3CMA A;  3PO3 H;  1HH2 P;  3AYH B;  3KF6 B;  4JI8 Q;  4DPG A;  1OTC A;  1L2F A;  1KRT A;  3E0E A;  5C0X G;  4IPH A;  3J81 c;  4HJ5 A;  2XGT A;  4GOP C;  1SE8 A;  4P75 A;  4R4T A;  5BR8 L;  1GKH A;  1E3P A;  2KCT A;  3HOV H;  1QVC A;  2CQO A;  2MFI A;  4JI6 Q;  1NTG A;  3RN5 A;  5GAE C;  1Y1V G;  1Z9F A;  3D31 A;  3WWV A;  2VQF L;  2MNA A;  1V9P A;  2BA0 A;  2K5H A;  4DR3 Q;  4BBS H;  2KCM A;  5ELN A;  1M1K C;  3RLO A;  2HIX A;  3H15 A;  3M9B A;  5GAG C;  4NXM L;  3PUW A;  3GO5 A;  4BA1 I;  4DV0 L;  4DNI A;  3UDG A;  1PH4 A;  1EIF A;  1NMF A;  1VQ7 A;  2Y0S G;  5C3E G;  2ZJR A;  1Y1W H;  4LF9 L;  1IBM L;  4YCU A;  4HIK A;  4A3K G;  4A4I A;  4C3I H;  2HHH L;  3PF5 A;  4RG1 A;  1FJG L;  4NB3 A;  4IOC A;  2PQA A;  2YTX A;  4JC0 A;  4LWC A;  3OTO L;  1E1T A;  4HJ9 A;  2R92 G;  4UP8 A;  2RCN A;  1HNZ Q;  2VZA A;  1VS0 A;  2NZH A;  4DUY Q;  4JBM A;  4DUZ Q;  4GN4 B;  4HIO A;  4Y7N H;  1SR3 A;  2VQE Q;  3NEN A;  2ID0 A;  2GVB A;  5M3F G;  4DV4 Q;  4JI2 L;  4JI4 L;  1LYL A;  4LF7 Q;  2VNU D;  1B7Y B;  1KXL A;  2Y0S E;  1HNW Q;  5IWA Q;  2IY5 B;  3EBE A;  5M5X H;  4JYA L;  3U4Z A;  1VQA A;  3CF5 A;  1C0A A;  3K8A A;  4OO1 G;  4GKJ L;  1D8L A;  1CSQ A;  2EXD A;  1XMO Q;  5IYD G;  4BBR G;  1HZB A;  3KFU A;  4A3D H;  1VQB A;  1G51 A;  3CCM A;  1XMQ Q;  4JI7 Q;  2N78 A;  4X66 L;  4DR5 L;  4DK6 C;  1SRU A;  3J7A 5;  4DAM A;  2C35 B;  1Y14 B;  1PH1 A;  4B3R Q;  2AWO A;  4IO9 A;  3S14 H;  1ASY A;  1JE5 A;  4HIM A;  1MJC A;  1XTD A;  1L1O B;  5LMN L;  4GLX A;  4BA2 I;  1J5E L;  2Q2T A;  2JQO A;  2KHJ A;  5GAH C;  1L1O A;  1H95 A;  4RMF A;  1D7Q A;  1K83 H;  3EIV A;  2D62 A;  1UE6 A;  1CSP A;  4PMW A;  1KIX A;  3HOU G;  3BZC A;  4UPA A;  3J80 i;  2XTI A;  5IY0 A;  1EQR A;  4NPS A;  1KC8 C;  1WFQ A;  3UDX A;  2A1A A;  3CME A;  4C3H H;  1IBK Q;  3GTQ H;  1YBY A;  4LNQ A;  1OXT A;  3HOY H;  1KAW A;  1EOV A;  3E9I A;  4X62 L;  1K73 C;  1XNR L;  3GTL H;  4LUO A;  4OWT B;  3T1H Q;  4JOI A;  1Q86 C;  4OXP A;  4POF A;  1N36 Q;  3K0X A;  1N9W A;  3G6E A;  4KHZ A;  3FHW A;  4LUV A;  5HGQ A;  1X9N A;  3AEV A;  3S1Q H;  2PMZ E;  4A3F H;  2R7Z H;  1RIP A;  3A74 A;  2R7F A;  1X6O A;  4A3I G;  4A3L H;  1HNX L;  3CCS A;  3PIO A;  3L7Z C;  3RNU A;  4X65 L;  1K3R A;  3G48 A;  2BA1 A;  5LMU L;  1PH6 A;  1BVS A;  5BR8 Q;  4APV A;  5FJ8 H;  1S72 A;  1C9O A;  1LTL A;  5GQO A;  3M4P A;  2VQF Q;  3HOW H;  4AIM A;  2K4K A;  4QQB X;  3ER0 A;  3H0G G;  1NBW A;  1EIY B;  1OXV A;  3F1Z A;  4IJH A;  4PZ7 A;  4NXM Q;  4DV0 Q;  4DV6 L;  1OXU A;  4XIG S;  4GNX B;  1I94 L;  2UXB L;  3H3V I;  5FJ8 G;  4GNX A;  4LF9 Q;  4BY1 H;  4ME3 A;  1IBM Q;  1AH9 A;  2GVA A;  2K52 A;  3A0J A;  1TWC H;  4LF8 L;  2HHH Q;  4IPG A;  3BZK A;  4R4I A;  3HOX G;  3J80 c;  3OTO Q;  2E5L L;  2CKZ B;  2HQL A;  2YYZ A;  4YY3 L;  2ALY B;  4GN3 B;  1Q46 A;  4OWX B;  3S1R H;  5IYB H;  2MO0 A;  1FVI A;  4JI2 Q;  4B3M L;  4JI4 Q;  4ALP A;  3CCV A;  2VL6 A;  4DR7 L;  3CCL A;  1VQC A;  2RHQ B;  1I6H H;  4JI0 L;  4JYA Q;  3ICE A;  2OCE A;  4X64 L;  1UE1 A;  3U4V A;  3UDF A;  1EUJ A;  2YTY A;  1Y1V H;  4A3B H;  4A3M G;  1YJN A;  2UXC L;  1PYS B;  1RL2 A;  3U58 A;  5IYB G;  4X66 Q;  4DR5 Q;  4R4C A;  4IOA A;  4LF5 L;  2K14 A;  3H3V H;  5C3E H; 
#chains in the Genus database with same CATH topology
 2CWA A;  1STN A;  4MNO A;  4A3K H;  2QEX A;  1SYC A;  1TII D;  3NE5 B;  1I6H B;  1J5E Q;  1VQG A;  1AE2 A;  3GQB A;  3SDZ A;  3TRE A;  1VQO A;  2K6A A;  1B50 A;  3H09 A;  5JJL A;  1EY8 A;  3E9H A;  2R92 H;  3DHQ A;  3S1M H;  5A2Q L;  3WOE A;  2B2T A;  4HID A;  1Q7Y C;  2A8V A;  4DV1 L;  1D1K A;  4JBJ A;  3PV0 A;  2WAC A;  2CH4 W;  4RH6 A;  4KKU A;  1B8A A;  3MFY A;  4A3K B;  3S15 H;  4X62 Q;  3DEP A;  5DEH A;  1XPO A;  3BYY B;  2JK8 A;  1NMG A;  5IYD H;  4BBR H;  3CCJ A;  1NR4 A;  4C1N I;  3PCO B;  3TZU A;  4J8Q A;  3P75 A;  2LXJ A;  1H9M A;  1UNS A;  4LFA L;  2B2Y A;  4BXX G;  5LMU Q;  2K5W A;  3GD7 A;  5AJ3 L;  3MVV A;  2LSS A;  1CZW A;  1LTS D;  3PUX A;  2OF1 A;  3CAM A;  4BBR B;  1KRS A;  3IL8 A;  1Y8P B;  2NWG A;  4IFD G;  4CKE A;  2R93 G;  1OXS C;  1W6J A;  2WFW A;  5IYC G;  3V96 A;  5DNF A;  3X3N A;  5FLM G;  3WDN A;  4DKA C;  5IT9 c;  2Z6K C;  1PLF A;  3TN2 A;  2B63 G;  2PMZ B;  4XYO A;  4DN4 M;  1WTR A;  3EJI A;  3NBH A;  4GNX C;  5IGD A;  1HZ9 A;  3T53 B;  4A3I H;  2GN5 A;  2UXD Q;  1QVF A;  1FL0 A;  5M5W H;  4IPD A;  3M4Y A;  4FXD A;  2FMC A;  4IJL A;  1CUK A;  4DK1 A;  4A3G G;  2VS1 A;  4FNF A;  4TVA B;  1G6Z A;  4A3I B;  4CJ2 C;  4KN7 C;  2EYO A;  1Q81 C;  2D0O A;  2EY1 A;  5M5W B;  1VQH A;  4YHH L;  1NY4 A;  5A2Q E;  2EYP A;  4K6L A;  3T1Y L;  4RHR A;  4K0K Q;  4LF6 L;  1PRT B;  5FKA C;  3S9W A;  3D4R A;  3STB C;  4DUZ L;  1B44 D;  1VQ8 A;  1PZK D;  2XNA C;  1QUQ B;  4H02 A;  4PZ8 A;  4B3T Q;  4A93 G;  4ZUJ A;  4MHE A;  1ML0 D;  2Q2I A;  2XVS A;  5C4Z A;  4X3T A;  3CU7 A;  4N9T A;  2OQK A;  2KUM A;  3J81 i;  2AUJ D;  1FNV A;  1FJG Q;  1DJR D;  4RFB A;  4RGO S;  4O1N A;  3Q22 A;  2Z4I A;  5I9P A;  1D5M C;  5KNC A;  1Z47 A;  4TQU S;  4A3M H;  1C48 A;  4OIJ A;  4JI5 L;  3K7A H;  1WD1 A;  3CCU A;  2Z0S A;  2HDM A;  1AW7 A;  3UE1 A;  1BO0 A;  5JVG 3;  3HG9 A;  4OON A;  1A15 A;  4PMB A;  3D6C A;  2VB3 X;  2ICI A;  4OHJ A;  1MI2 A;  1VF7 A;  4DNR B;  1PXU A;  5CBE E;  4A3M B;  4BY7 H;  1U4P A;  1YHQ A;  5IP9 G;  3K7A B;  1QE6 A;  3DMU A;  4CDC C;  1QB5 D;  2NB0 A;  3QWN A;  3CHB D;  4NDX A;  2C5C A;  4IUQ A;  1VQ5 A;  3PUY A;  4LJZ C;  1E22 A;  5K36 H;  1EWI A;  2CW0 C;  1ESF A;  2B2U A;  1GHK A;  2F0V A;  4BY7 B;  2AHO B;  1D5X C;  3DLL A;  4J15 A;  1ENF A;  4IAL A;  4R4Q A;  2HUG A;  3D0F A;  2F4V Q;  3DUZ A;  5HY6 A;  1TWG H;  3VDY A;  3L3O C;  4F8M A;  4FDB A;  3FVQ A;  2HCC A;  3PSI A;  3RZO H;  4KY6 A;  5M3M H;  5IGF A;  1IBL L;  3PO3 B;  1WCM H;  3ULL A;  2K04 A;  1PH3 A;  3HOV G;  1X54 A;  1S5F D;  4BS9 A;  1TWG B;  3RZO B;  2CVR A;  1XXG A;  1L0W A;  2B2V A;  4JI1 L;  2KOL A;  5IIF A;  1XPR A;  2BE5 C;  2PZU A;  5M3M B;  1F2Y A;  1WCM B;  1Y1W G;  4C56 C;  2RSO A;  2LMC B;  1F2L A;  3OMG A;  3MC0 B;  2EIF A;  4JK1 C;  1UUP A;  4LF8 Q;  1PRT C;  2LY7 A;  1XNQ Q;  3NBH B;  4FF2 A;  4P71 A;  1EQT A;  1CI3 M;  1S3O A;  2E5L Q;  2UU9 Q;  3IAY A;  2JA6 H;  2MPM A;  2WAQ B;  1AZQ A;  4EQN A;  3DM3 A;  5CV4 A;  5C5M A;  4LK1 C;  3J81 j;  2O5J C;  3TME A;  3KDF B;  5M5X B;  1VQN A;  2ZXP A;  2YU9 H;  4DV7 Q;  3G4S A;  3MFG A;  2JA6 B;  4AQY Q;  3CPW A;  4GLV B;  2J7Z A;  4HJA A;  2L0C A;  5IP7 H;  4DV2 Q;  4YWK A;  2NVX H;  4DR2 Q;  2E2H H;  1ZXT A;  4ZKC B;  2CCZ A;  2YU9 B;  4H44 C;  1WOC A;  2F0W A;  3UDI A;  1LTA D;  1JOQ A;  5C0X I;  2VY3 A;  2B2T C;  2V4D A;  4YCW A;  4CHT B;  1SEB D;  1PH2 A;  1HRJ A;  2E2H B;  4R8I A;  4A3F G;  2E2I H;  4ME5 A;  1HR0 Q;  3I7F A;  3SE0 A;  2WB1 G;  5E4W C;  1MKH A;  1NR2 A;  3OOC A;  3SGI A;  3E3X A;  2MP1 A;  2A6E C;  1SDF A;  2RHS B;  4YWL A;  3SEB A;  1MIU A;  4CDE C;  5CC4 A;  1DGS A;  1YNN C;  2B8G A;  3LNN A;  2MGS A;  2Q8I B;  5JJZ A;  2B2Y C;  1QVG A;  2WB1 E;  4NP5 A;  2I0Q A;  2L9H A;  2LS0 1;  2UXD L;  4HR7 B;  5EAY A;  3KJP A;  2XWJ B;  2L11 A;  5D3D A;  4DK0 A;  4RCO A;  5C0X H;  1N33 Q;  3FP9 A;  4DAY B;  3LX0 A;  1JJ2 A;  5M9O A;  5DM6 3;  1KD1 C;  2AUK A;  1U5K A;  2PCF B;  5C4X H;  1YNX A;  2MUY A;  1HH2 P;  1KRT A;  3K5L A;  4F88 A;  2K1B A;  5KRU A;  4HJ5 A;  1DZ1 A;  4R4T A;  1LLR D;  1Z7T A;  1NTG A;  1F2Z A;  1Y1V G;  3WWV A;  2VQF L;  4IQZ A;  4BBS H;  1GHJ A;  3HRZ C;  3A56 A;  2G9D A;  4IZ8 A;  5C4X B;  5GAG C;  4NXM L;  1GUN A;  4XQN A;  4KMU C;  1PH4 A;  1VQ7 A;  5DM7 3;  4LF9 L;  3VR3 A;  1A3T A;  4K8I A;  4HIK A;  1KNE A;  1IL8 A;  1F9P A;  1K28 A;  1WD0 A;  1FJG L;  4NB3 A;  4LWC A;  2NBF A;  4UP8 A;  1DOL A;  1STA A;  1IYV A;  1F9R A;  1H9R A;  4Y7N H;  1SR3 A;  2VQE Q;  3NEN A;  2ID0 A;  2GVB A;  4O42 A;  4JI2 L;  4HCS A;  4JI4 L;  4LF7 Q;  5IGG A;  1KXL A;  1B7Y B;  1HNW Q;  4C1N K;  1R4Q B;  1D5Z C;  2A69 D;  3U4Z A;  1VQA A;  3CF5 A;  1II3 A;  1HQM C;  1TY0 A;  3KBG A;  1TR5 A;  2A6H C;  1XMQ Q;  4DR5 L;  3QO2 A;  1ENC A;  1O7Y A;  3J7A 5;  4B3R Q;  4KHV A;  1L1O B;  5GAH C;  1G8Z D;  3ND8 A;  5E1F A;  4PMW A;  3HOU G;  1HXY D;  2N88 A;  3NXW A;  2B39 A;  5IY0 A;  1EQR A;  1MSH A;  1EIH A;  1M4V A;  1WFQ A;  3GTQ H;  1OXT A;  2CH4 A;  1EOV A;  2IJ0 A;  5EPJ A;  4OWT B;  2DJF C;  4OXP A;  4X3U A;  3H91 A;  1N9W A;  3P1H A;  3FHW A;  4LUV A;  5A35 A;  1CT1 D;  4PNY A;  4P2C B;  1RIP A;  3A74 A;  3CCS A;  4FVM A;  4WRD A;  5CR3 A;  3PIO A;  4X65 L;  3GTQ B;  2QEJ C;  2B2U C;  2XN9 C;  1EY5 A;  4Q0F A;  3SHL A;  1C9O A;  3OW7 A;  4H7B A;  3SK6 A;  4AIM A;  4QQB X;  3H0G G;  1NBW A;  4HAE A;  4NKL A;  3VR4 A;  1OXV A;  1M8A A;  3MTS A;  4X3S A;  1CA6 A;  1RHP A;  2BDO A;  5I6Y A;  1I94 L;  3H3V I;  5EPK A;  1SE2 A;  4GNX A;  4ME3 A;  5J22 A;  1I4Q A;  1IBM Q;  3A0J A;  1SNM A;  4LF8 L;  1HTL D;  4TKO B;  1JOK A;  4R4I A;  2D2C C;  3HOX G;  2E5L L;  2YYZ A;  4U68 A;  2K5Q A;  2IX3 A;  2ALY B;  4GN3 B;  2AQ2 B;  3NTH A;  3H6M A;  1S5B D;  2M2L A;  2KHS A;  1GUS A;  4JI0 L;  1EWH A;  1TQO A;  1HA5 A;  1FGB D;  1SAP A;  3UDF A;  2OT2 A;  1YJN A;  2O5I C;  2UXC L;  1PYS B;  1X3Q A;  1EYA A;  3U58 A;  4IOA A;  1SJH D;  3NWS A;  3BYT B;  2BA1 A;  3H3V H;  5C3E H;  1T9H A;  1KDB A;  5LMN Q;  2C9O A;  4IFD I;  3DWQ A;  2YTV A;  4QJF A;  2VUM G;  4DR2 L;  2XIW A;  1TWA H;  4XT1 B;  3GTM H;  5COY A;  1EWC A;  1EY7 A;  3K81 C;  3MA2 B;  1HA6 A;  2FXQ A;  5F2D A;  5EKI A;  5M3F H;  2Q2U A;  1L1O C;  1BNZ A;  4FXK C;  3TDQ A;  4K5W A;  4P73 A;  5C3E B;  3GTO H;  3EN2 A;  1W2B A;  2EYJ A;  3V05 A;  2F0S A;  1PYW D;  1KL9 A;  2F4I A;  4ID6 A;  1HR0 W;  5JEA G;  3D4W A;  1TWA B;  5K5P A;  3S24 A;  3V2T A;  4OIK A;  3GTM B;  1YIT A;  3EFX D;  5M3F B;  1HNX Q;  1QWY A;  3K57 A;  3GTO B;  4IFD H;  3STB D;  2KJX A;  2GA4 B;  3CC7 A;  1G2S A;  3MHB A;  4HJ7 A;  4DR6 Q;  2NTS A;  2PNR C;  1ZYR D;  3PIP A;  3FDT A;  5CV8 A;  3MWY W;  4R1J A;  3OW2 A;  2B63 H;  3D4D A;  1F9Q A;  2CFM A;  4UAI A;  5AFW A;  1QG7 A;  2A74 C;  4EGV A;  4DV6 Q;  4XXE A;  5IT9 E;  4ZRZ A;  1YEZ A;  3VA5 A;  1DD2 A;  2M00 A;  2SEB D;  3OIQ A;  5EGT A;  2IL8 A;  4B9W A;  5KIX A;  1A3V A;  1BBU A;  3W1G A;  4J6H A;  2B63 B;  5G3L F;  4YY3 Q;  1JMC A;  1PA6 A;  1Q1B A;  1PZI D;  2QW7 A;  1KAB A;  2X69 A;  3Q23 A;  5JVH 3;  4PMC A;  4YIJ A;  4DAV A;  4DR7 Q;  1EU4 A;  3KLS X;  2ZTC A;  1ET6 A;  1BXT A;  2DGY A;  1RKN A;  4A3J G;  3P7J A;  5I9O A;  1O7I A;  5C0X J;  4DA2 A;  3L0O A;  4A93 H;  2DJG C;  3PO2 G;  2CW0 D;  1QNU A;  4AYB E;  2J4X A;  1JOR A;  4L8J A;  3QG1 A;  4EQ5 A;  3CRK C;  3T51 B;  4H13 C;  1WTO A;  2L15 A;  2WV6 D;  1HTP A;  1KQS A;  2EXZ A;  4L5Q A;  3CC2 A;  5D65 A;  2ATW A;  1V1Q A;  1CZG A;  4L5R C;  1EY4 A;  1I4G A;  1QUQ A;  4A93 B;  1W3S A;  5T1I A;  1EFI D;  4X6A H;  3A8J E;  3Q8D A;  1PYB A;  4ODG A;  2F52 A;  1LTI D;  3G6J B;  4MTK A;  1CQF A;  3PQI A;  3CCE A;  5KEE A;  3ZJY C;  1BBW A;  1DOM A;  1ESR A;  4JI3 Q;  2RDF A;  1FNU A;  4DV5 Q;  1A62 A;  3CQZ H;  5J39 A;  3H3V C;  1Q1E A;  1EZ6 A;  2PNH A;  2EYM A;  4RGM A;  2F0M A;  4DAP A;  2ZM6 L;  1B9N A;  2JXM B;  3PF4 A;  3KLW A;  2EZV A;  1YJW A;  2ZTD A;  3AFP A;  4L6T B;  1TXY A;  3CQZ B;  1PRT D;  1BCP C;  3I4N H;  1JOO A;  3OMC A;  5LHY 1;  3I8Z A;  5M5Y H;  3NWT A;  3SK5 A;  2NN6 I;  2L12 A;  3TP8 A;  2OTL A;  3RZD B;  3TS2 A;  4FYD A;  1M90 C;  1JCK B;  2IT1 A;  1L0Y B;  3I4N B;  1BCP F;  5JJK A;  5C44 H;  3KF6 A;  4LFB L;  4JPB W;  1MGS A;  4RHS A;  3NEL A;  5M5Y B;  4GKK Q;  4UP7 A;  1VQE A;  1EY6 A;  1NCV A;  3D6W A;  4DR1 Q;  1UE7 A;  4WFN 3;  4JV5 L;  1JB3 A;  4KV6 A;  4JG2 A;  1Q8K A;  2JEB I;  4HMI A;  5C44 B;  2EJM A;  3SK4 A;  4P74 A;  1A3U A;  5I6W A;  2BOS A;  4OX9 L;  4KI0 A;  2NN6 H;  1J6Q A;  4DV3 Q;  1D2B A;  5EKL A;  1ROD A;  5GAD C;  3CXC A;  4DU9 A;  1P16 A;  5CMD A;  1XPU A;  2JA5 H;  1STE A;  2Z8L A;  3CCR A;  4FF3 A;  3QIA A;  1RDP D;  2WKD A;  2EY5 A;  1JWS D;  4JI8 L;  1LAB A;  1BQQ T;  2A6E D;  2RF4 A;  2UUB Q;  5LMN W;  1TWF H;  1YIJ A;  1YI2 A;  1E1O A;  4HED A;  3K7U C;  1FGU A;  4RKL A;  2JA5 B;  1YNN D;  3OHX C;  1IKL A;  3I4O A;  5DLQ E;  4JI6 L;  4KY7 A;  4FO2 A;  3KDF A;  4DR3 L;  1N32 Q;  4P72 A;  5C6A A;  1P8L A;  4A3D G;  2TSS A;  2A68 D;  1IXR A;  1B70 B;  3TEH B;  3M4O H;  1Q82 C;  3KOJ A;  3C46 A;  2K7V A;  4QIW E;  1TWF B;  4K6D A;  2VW9 A;  4RWS C;  3HKZ B;  3UI2 A;  4C3J H;  3M85 A;  1PMR A;  3C1F A;  1WI5 A;  4JCV E;  1HNZ L;  5C3W A;  1VQD A;  2EYF A;  4B08 A;  1UWV A;  1H9K A;  1BUV T;  1VMP A;  1KLG D;  1EEI D;  1X56 A;  4J1M A;  3M4O B;  4XDX A;  1VQK A;  4DV4 L;  4WJ4 A;  3T16 A;  1GUW A;  3HOY G;  2IPK D;  1GD7 A;  4LF4 Q;  4C3J B;  1HHV A;  1EIG A;  2UUA Q;  4KN4 C;  1JB7 A;  2UUC Q;  4DR6 L;  1Z6H A;  1XMO L;  4LFC Q;  2ZTE A;  4G57 A;  5H1S E;  3QOL A;  2HT1 A;  3HOZ G;  4A3F B;  2D0P A;  4NXN Q;  1YNJ D;  3EQL C;  4Y52 H;  2WB1 B;  3P20 A;  4G4K A;  5IOD A;  4UY8 C;  2NZ1 D;  3A5Z B;  2PI2 A;  1ILQ A;  3MXU A;  1SYD A;  3R2T A;  1RF2 D;  1CM9 A;  2WIN B;  4DR4 Q;  4IFD J;  4B3S Q;  4GLA C;  3NP8 A;  4BY1 G;  2L1B A;  4RGT A;  3T1H L;  4X3K A;  3RLN A;  4PQX A;  3QR8 A;  4I7Z C;  3NK9 A;  4DAY A;  3ULP A;  4CKB A;  4WJW A;  3PO3 H;  1OTC A;  3AYH B;  3KF6 B;  1L2F A;  2HD3 A;  3E0E A;  4IPH A;  3J81 c;  2XGT A;  3BVG A;  1GKH A;  1E3P A;  2F0D A;  2CQO A;  2MFI A;  4JW0 A;  4K5X A;  5GAE C;  1RD9 D;  3U9S A;  2MNA A;  2IW3 A;  3RLO A;  1UAP A;  4BA1 I;  4DV0 L;  2Y0S G;  1PZJ D;  5BN4 A;  4A3K G;  4HTH A;  4A4I A;  5EPL A;  2HHH L;  3PF5 A;  3ONA B;  2PQA A;  4JC0 A;  1E1T A;  3A54 A;  2R92 G;  3I91 A;  3I4L A;  4DUY Q;  2NZH A;  4GN4 B;  1STB A;  2VNU D;  1LYL A;  2QKI C;  2Y0S E;  4V0B A;  3VR5 A;  5IWA Q;  4C3I G;  5M5X H;  2IY5 B;  4JYA L;  4N9P A;  1SNP A;  5CV7 A;  3C3L A;  1D8L A;  3I90 A;  3E0J A;  4ABN A;  2K28 A;  5IYD G;  4BBR G;  1VQB A;  4JI7 Q;  1FNW A;  4X66 L;  4DK6 C;  2C35 B;  3CKI B;  4HCE A;  2K32 A;  4IO9 A;  1ASY A;  1JE5 A;  4HIM A;  2QIL A;  1J5E L;  1KDA A;  2JQO A;  3BS1 A;  1LT6 D;  1L1O A;  1TT2 A;  3A55 A;  1K83 H;  1A6X A;  3EIV A;  1PTO H;  2CQA A;  3BZC A;  4UPA A;  3J80 i;  4ZAI A;  4RCN A;  4C3H H;  1IBK Q;  1LTB D;  2G9H D;  2EYL A;  4LNQ A;  3E9I A;  1K73 C;  4X62 L;  3GTL H;  4LUO A;  4H0L C;  2DNE A;  1N36 Q;  1K83 B;  3K0X A;  3DWA A;  3AEV A;  1X9N A;  1PTO B;  3S1Q H;  2PMZ E;  1WTH A;  2R7Z H;  1SNQ A;  4A3I G;  1TS5 A;  4A3L H;  1W6K A;  3RNU A;  4C3H B;  1K3R A;  2OXP A;  3I3C A;  1H9J A;  2F0H A;  1XX8 A;  1E0B A;  3GTL B;  5LMU L;  1DYQ A;  1I6V C;  1BVS A;  3FPP A;  5BR8 Q;  4G7Z C;  1ET9 A;  5EQ0 A;  5BN3 A;  3MAQ A;  3HOW H;  2K4K A;  3S1Q B;  2K03 A;  2R7Z B;  1K0S A;  3F1Z A;  4IJH A;  3T13 A;  1SYG A;  4XQJ A;  1OXU A;  1V1O A;  3NTK A;  2F0K A;  5FJ8 G;  3PMF A;  2FMM A;  1AH9 A;  2K52 A;  4FF1 A;  1VDZ A;  3J80 c;  1T5E A;  3OTO Q;  4IUT A;  1NNX A;  4UDU C;  3HOW B;  2HQL A;  3HOX B;  3LWU A;  3RD4 A;  1RTO A;  2BCO A;  3CCV A;  3S16 B;  1VQC A;  2RHQ B;  1J9O A;  5G3L D;  1UE1 A;  1S5C D;  1STY A;  1STH A;  4A3M G;  2A73 B;  4KK7 A;  2Z9H A;  2KEC A;  3E6Z X;  1LT3 D;  1S5D D;  3CW2 C;  2BH2 A;  3GTP B;  4A3B G;  4K0K L;  4ZUI A;  2KBN A;  4IUN A;  4CBV A;  2F0T A;  1SMY C;  4BY7 G;  4B3T L;  5JEA H;  2VUM B;  4I65 A;  2D9U A;  3ND9 A;  3J7Z C;  5IE8 A;  5COR A;  1BF4 A;  2PQA B;  1VQP A;  3GV3 A;  2YV5 A;  4GZY C;  1XNR Q;  3GDE A;  4K2K A;  3VYT A;  1EY0 A;  1TS3 A;  4YWM A;  5EJW A;  4R4O A;  3OYY A;  3NQT A;  2AMC B;  3K6O A;  5C4J H;  1RCV D;  1DM0 B;  1E24 A;  2NYZ D;  4XTC S;  5ELB A;  1SBB B;  2JA8 G;  5IGB A;  4PV1 C;  1A8V A;  2F0Q A;  4CGY B;  2OWO A;  4ZCK A;  3RLF A;  3IRB A;  1TY2 A;  2K5D A;  3EVQ A;  3GTK B;  3AU7 A;  1K8G A;  3VR2 A;  3CC4 A;  2XSC A;  1PTO C;  3BJU A;  1AFP A;  4MN3 A;  5C4J B;  2JJQ A;  1LAC A;  3Q24 A;  4O0A A;  1EFW A;  2RSN A;  1WCM G;  5DAU A;  4A3C G;  5FLX c;  1O7Z A;  1QNK A;  1GXD C;  1IW7 D;  4DNT B;  4R8N A;  3PIP 3;  4EX5 A;  3FKI G;  2JA9 A;  4QY7 A;  1EYG A;  2F0F A;  2FIN B;  1PTO F;  2XRQ D;  3TBI B;  3MEH A;  2K01 A;  2WAQ G;  4OEM B;  1VQ9 A;  1I3Q H;  2NVY H;  1SYF A;  1QZH A;  5D14 A;  4DXF A;  2ICE C;  2F4V L;  3M4Q A;  4B3M Q;  3I56 A;  3CD6 A;  3PO2 H;  3S2H H;  3C2P A;  4KHP Q;  3DEO A;  2J0T D;  3AQQ A;  3GP7 A;  4X64 Q;  4LW1 A;  3R2I A;  1A63 A;  2JA6 G;  1X55 A;  2WAQ E;  2PPB C;  1I3Q B;  1R4P B;  2Q8T A;  2NVY B;  2A5H A;  1F77 A;  1S4Z A;  3A7A B;  3JAM i;  4A3E G;  4LF5 Q;  1E2W A;  3PO2 B;  2X6L A;  4FP5 D;  4A75 A;  2OQ0 A;  3FMC A;  3S2H B;  1JQY D;  3KBX A;  1I4R A;  2N49 A;  2PW7 A;  3KLS A;  1QZG A;  4MTN A;  1B9M A;  1X3F A;  5IP7 G;  1IHZ A;  2R6G A;  1E2Z A;  4DV1 Q;  3I4M G;  1XYI A;  3M3Y H;  2LXK A;  2K5N A;  4DFA A;  1LM0 A;  1XNQ L;  5I4D A;  2N8N A;  4A76 A;  1GUO A;  2UU9 L;  1JR0 D;  3FRP B;  2I46 A;  2VXW A;  2JEA I;  1IKM A;  2K5V A;  4DGZ A;  1I4P A;  5IGE A;  4R9W A;  3M3Y B;  1HZA A;  1PFS A;  1YVC A;  2R7D A;  5AJ3 Q;  4E6I A;  4DV7 L;  4AQY L;  1X3E A;  3URY A;  4NMZ A;  1CKN B;  2PZT A;  3HFZ B;  5T1G A;  4DV2 L;  3JAM c;  4WJ3 M;  2B8F A;  2R61 A;  1ENA A;  3CP0 A;  2Z1C A;  4C2M H;  2JA7 G;  1B3Q A;  1NE3 A;  1SFO H;  5HUR A;  1ZKO A;  2G5D A;  4ULL A;  3GTJ H;  1EEF D;  5HGT A;  4HSV A;  3MZ5 A;  5C4H A;  5J3B A;  3NBI A;  1PH7 A;  1DCZ A;  1CHQ D;  4BXX H;  1VQI A;  4C2M B;  2F0N A;  1K0R A;  2B2W A;  4NW2 A;  4LUZ A;  1H9S A;  1XTC D;  3HEJ A;  1SFO B;  5C4X G;  3FPU B;  2RVL A;  1HR0 L;  1STG A;  4L5S A;  3GTJ B;  4EQP A;  1FYC A;  1DXM A;  2EQS A;  5FOB B;  1BCP B;  2PQE A;  3VA7 A;  1C8C A;  2R93 H;  2ZJP A;  5IYC H;  4YHH Q;  3VYU A;  4L5T A;  1Q90 A;  1D1I A;  4BBS G;  5FLM H;  1G29 1;  3T1Y Q;  1K8A C;  4LF6 Q;  3CCQ A;  3J7A F;  2JE6 I;  5E7N A;  1PH5 A;  2L4N A;  1N33 L;  1L0X B;  1Q12 A;  4UP9 A;  4O2D A;  2NVT H;  2UXB Q;  2R93 B;  1OXX K;  2ZXO A;  1TVX A;  2F3I A;  3TZD A;  4GOP B;  1GOZ A;  1HCZ A;  3W3A A;  3I72 A;  2TMP A;  4AH6 A;  1KHI A;  2CHB D;  5CBA E;  3TRZ A;  4A3G H;  4JI5 Q;  4DK3 C;  1SE3 A;  1S5E D;  4AYB G;  1VQJ A;  1SMX A;  4QUF A;  5I2X A;  3J81 L;  2NVT B;  5FO9 B;  2NVQ H;  1I5F A;  1HJP A;  1E7Z A;  2QCP X;  5LL6 X;  1VF5 C;  4JBK A;  1EQQ A;  4A3G B;  2F0U A;  3A8K E;  2EPB A;  4PG3 A;  1BOS A;  1PVO A;  1U0L A;  2CWP A;  3G7L A;  2SOB A;  1ICF B;  3KYH C;  3TSS A;  2NVQ B;  4TSS A;  1U9R A;  2I5L X;  2A19 A;  1O80 A;  3TQY A;  2I5H A;  4LAA A;  2AQ3 B;  1VQ6 A;  2VQE L;  5EBD A;  4LF7 L;  2QGQ A;  2JSO A;  3HOZ H;  1HNW L;  1N34 Q;  2MO1 A;  2FFK B;  3E5S A;  2JYO A;  1KTK A;  1RTN A;  4K8J A;  5JEA J;  2ASB A;  1YZ6 A;  1PH8 A;  3U9O A;  1XMQ L;  4XQQ A;  2IHF A;  2A69 C;  1PH9 A;  1IYU A;  5IP9 H;  4B3R L;  1K9M C;  1GO3 E;  3HOZ B;  1K8M A;  1SXT A;  1IBL Q;  1B53 A;  2DNC A;  1A0I A;  5KYL A;  2BE5 D;  1G6P A;  1GVP A;  1AP0 A;  2IWH A;  3TS0 A;  2K50 A;  5ELD A;  1OO9 B;  3RZD H;  4EVO A;  4JI1 Q;  3HP3 A;  1Y8N B;  1PDQ A;  1IZ6 A;  1LO5 D;  5J1Z A;  2Q8R E;  1A2T A;  2F3W A;  3OWF A;  2AKW B;  4GS3 A;  4KHP L;  1AEX A;  1AN8 A;  1BDO A;  1CTM A;  3LGJ A;  1AE3 A;  1B2T A;  2X6G A;  3J81 E;  3CMA A;  3K59 A;  5JPN C;  2E74 C;  4HMJ A;  4GOP C;  1SE8 A;  4P75 A;  1H9S B;  3T56 B;  3SK8 A;  2KCT A;  1UEA B;  3HOV H;  5KGU A;  2P5Z X;  1Z9F A;  3D31 A;  4RKB A;  1V9P A;  1MSG A;  2KCM A;  5ELN A;  1M1K C;  2HIX A;  4DNI A;  3UDG A;  2NUC A;  3Q0A A;  5C3E G;  1Y1W H;  3ZYY X;  1IBM L;  2Y0S B;  4C3I H;  1QCB D;  4RG1 A;  3HOV B;  4IOC A;  4RAU C;  1I4H A;  2YTX A;  2LFN A;  2RCN A;  1EYD A;  3J80 L;  1VS0 A;  3T4A C;  2R92 B;  5CYU A;  4HIO A;  3S1M B;  5M3F G;  1F9S A;  3VYR A;  5KNB A;  1Y1W B;  1MBY A;  1I4X A;  1LV9 A;  1C0A A;  4C3I B;  4OO1 G;  3S15 B;  1CSQ A;  3EA6 A;  2F0J A;  3KFU A;  3DM1 A;  4ZLT F;  1G51 A;  3CCM A;  4EQO A;  1NSN S;  2AWO A;  3S14 H;  1XTD A;  5LMN L;  4V19 0;  2Q2T A;  2KHJ A;  4RMF A;  3BDL A;  1D7Q A;  3D3R A;  1V8Q A;  1CSP A;  3DXJ C;  2OEO A;  3R93 A;  1GJX A;  3BZD B;  4NPS A;  4QUC A;  1KC8 C;  3UDX A;  2A1A A;  2F1M A;  2HDL A;  3S14 B;  1KAW A;  1JWM D;  1Q86 C;  4JOI A;  1X3P A;  4ZQ3 A;  2KED A;  4A3F H;  2DY7 A;  4M8A A;  2R7F A;  1X6O A;  1HNX L;  3L7Z C;  4IN3 A;  5I2Y A;  3G48 A;  1V1P A;  1SMY D;  1ILP A;  2K33 A;  3IKJ A;  1S72 A;  1PH6 A;  5FJ8 H;  1LTL A;  2VB2 X;  1SE4 A;  2VQF Q;  3ER0 A;  3K0Y A;  4ZKB B;  2N55 A;  1EIY B;  4PZ7 A;  4NXM Q;  4Z9C B;  5ELF A;  4DV6 L;  4XIG S;  2B2W C;  1MD2 D;  3NHH A;  3X3M A;  1ZYR C;  2UXB L;  5FLX L;  3J80 E;  4DF7 A;  1BR9 A;  3R8B A;  5TSS A;  4LF9 Q;  2EE1 A;  2GVA A;  4CJ0 B;  3LWE A;  3BZK A;  4ZK9 B;  3ERQ A;  1SNO A;  1U4R A;  2ZT9 C;  3NUC A;  3KF8 A;  4YY3 L;  3ERO A;  1Q46 A;  4OWX B;  1QIL A;  1PTO D;  3N52 A;  2A6H D;  4JI2 Q;  4JI4 Q;  4ALP A;  2VL6 A;  4DR7 L;  2L55 A;  2OCE A;  2DN8 A;  2YTY A;  1Y1V H;  4A3B H;  1HUN A;  1QJO A;  1RL2 A;  2EJF C;  5IYB G;  4DR5 Q;  4R4C A;  2K14 A;  1VQM A;  2M9V A;  3RUZ A;  2NTT A;  5E3F A;  3RMH A;  1IL2 A;  1TS4 A;  2IX0 A;  1TS2 A;  2ZJQ A;  4IUP A;  1Y1V B;  4A3B B;  1WJJ A;  2ES2 A;  2KVM A;  3ERS X;  4XT3 B;  2EY6 A;  2RBM A;  2LKV A;  3L2P A;  2JA8 H;  1SLJ A;  3I4N G;  1X3G A;  1N34 L;  3CRL C;  4S3S A;  4G7H C;  3TP7 A;  4HN7 A;  2MQH A;  3W1B A;  4JI3 L;  1Q3L A;  2WP8 J;  2BH8 A;  4DV5 L;  1GUT A;  1MHW C;  4YCV A;  2MJ8 A;  2JA8 B;  3M7N A;  3F8T A;  4PZ6 A;  2EDG A;  3C1E A;  5ELC A;  5C44 G;  3OWE B;  5CV9 A;  4A3C H;  4X65 Q;  1YJ9 A;  3NSW A;  2H1E A;  4HJ8 A;  3MXP A;  3KUP A;  3S17 H;  2I07 B;  3UE0 A;  2KEN A;  3FKI H;  3HOU H;  5IGC A;  5FLX E;  4QCL A;  5LL6 S;  3NPP A;  4QB4 A;  5JPM C;  1XJV A;  3JAM L;  4F7X A;  1CHP D;  2OTJ A;  4N8X 1;  4FF4 A;  1I94 Q;  4U67 3;  2RDH A;  2N3S A;  2NN6 G;  4CJ1 B;  3S17 B;  1EZ8 A;  3FKI B;  4CKC A;  3S1N H;  3HOU B;  1F2M A;  1LT4 D;  3ULJ A;  5ISR A;  3J7Y W;  3K5O A;  1V43 A;  2JA5 G;  4FXG C;  1D6E C;  1UE5 A;  2IHE A;  3QOJ A;  5ELE A;  3HS0 C;  4A3E H;  4QMG A;  4IPC A;  1EOT A;  4JI0 Q;  4GKK L;  5CV6 A;  1JE4 A;  4DR1 L;  1BKB A;  3PUZ A;  1GUG A;  1PRT F;  5FO8 B;  3S1N B;  2F0P A;  3H94 A;  1WTW A;  3H0G H;  2B3G A;  5IOC A;  2UXC Q;  1V1P B;  3K5M A;  3BVZ A;  2AQ1 B;  5BN5 A;  1NJI C;  3HKZ G;  4CDF C;  2DY8 A;  2IX1 A;  1JT8 A;  3I4M H;  4A3E B;  2EJG C;  3W2D A;  3VYS A;  4DV3 L;  1EQV A;  2HIV A;  4KJN A;  3PIO 3;  3HOX H;  1CFM A;  3F2B A;  1WTQ A;  4UHV A;  1FD7 D;  3H0G B;  4BWG B;  1R9T H;  3J7A V;  1RJT A;  3GV6 A;  1T5X D;  5JOB A;  5NUC A;  3S16 H;  3HKZ E;  1DON A;  3CPF A;  4C3J G;  2BDN A;  2E76 C;  3SXH A;  4Q5V A;  1JIC A;  3I4M B;  4CDD C;  1LTR D;  3KF8 B;  1CKO A;  2NVX B;  3RR5 A;  2B29 A;  3I55 A;  1TKW B;  1KAA A;  1ONL A;  3M7G A;  2UUB L;  1JJC B;  5L37 A;  3I2Z A;  1R9T B;  4QL5 A;  2QDL A;  1VQ4 A;  2QF7 A;  5EKK A;  3HKS A;  3NEM A;  3GTP H;  2RCF A;  3BDO A;  1LUZ A;  2O4X A;  4OEL B;  4POG A;  1N32 L;  4GKJ Q;  2V1C C;  5EBC A;  2VUM H;  3JAM E;  2JA7 H;  2PZW A;  4KKT A;  2Q2H A;  4N8F A;  2NZO A;  3OSO A;  2E2I B;  4OWW B;  1HZC A;  2QDB A;  3PUV A;  1CKN A;  4ZYS A;  2A68 C;  3W5O A;  1WYD A;  4GN5 A;  4RGN A;  4KLK A;  1I50 H;  2JA7 B;  4MZ9 A;  1KDC A;  4L63 B;  5FK9 C;  3MXN A;  3ITP A;  4MIU A;  1PV4 A;  4LF4 L;  2QA4 A;  3GTK H;  2PO4 A;  2UUA L;  5K36 G;  1A2U A;  1NUC A;  2AWN A;  2KCC A;  2DUD A;  1SNC A;  5CV5 A;  1EY9 A;  2UUC L;  3FEW X;  1TWH H;  3S2D H;  4LFC L;  3KJO A;  3MXG A;  1I50 B;  4OL7 A;  1LTT D;  2E8G A;  3B6Y A;  3K80 C;  5E4X A;  2E2D C;  4NXN L;  3PO3 G;  1WTP A;  2XWB B;  4JOI C;  3MEF A;  2I5M X;  1UEB A;  1TWH B;  3S2D B;  1YNJ C;  1GM5 A;  1C7Y A;  3AFQ A;  5M3M G;  1NAP A;  4JVZ A;  1LTG D;  4BBS B;  4IUU A;  4DR4 L;  3OIP A;  2H5X A;  4B3S L;  4ILW A;  3F2C A;  5ELO A;  1IYJ B;  1YHB A;  3OPO A;  3A7L A;  5C5L A;  4GOP A;  2D5D A;  3NQI A;  4A3J H;  2RQX A;  2RDG A;  2F0I A;  1YHA A;  4Y7N B;  1JJG A;  5JJI A;  4B9X A;  4AYB B;  1LT5 D;  3D8G A;  2HCI A;  1BCP D;  1Y69 U;  2ZM6 Q;  4A3J B;  2E2J H;  2Z6B A;  4M1U B;  3RN2 A;  1ASZ A;  1VCI A;  5KND A;  1G2T A;  1C4Q A;  4K2L A;  4TRD A;  1MJE A;  1SJE D;  1CKM A;  4DUY L;  1SYB A;  1O78 A;  5GRO A;  1HFG A;  5C3X A;  1ZEQ X;  1WTX A;  2E2J B;  1PFB A;  4RA8 A;  3U50 C;  1J8I A;  1X65 A;  4K14 A;  4C3H G;  5IWA L;  2RKS A;  2WII B;  1N8R C;  3GTG H;  5CGK A;  3PGZ A;  4LFB Q;  2K75 A;  3IFD A;  1VQL A;  4JI7 L;  2R7Z G;  2E75 C;  3VR6 A;  4A3L G;  2F3V A;  1ICW A;  3G71 A;  4JV5 Q;  3JC6 6;  4KJO A;  1CQV A;  2Z6K A;  4I7A A;  1PHJ A;  3BU2 A;  4LFA Q;  3GTG B;  1S40 A;  2EVB A;  1SN8 A;  4XYQ A;  4OX9 Q;  2H4O A;  2KCN A;  3HOW G;  3BG3 A;  5IT9 L;  4KY5 A;  1IBK L;  1K8O A;  1K3B C;  1B4O A;  4LMQ D;  3F2D A;  2PI2 E;  1VQF A;  2KHI A;  1JWU D;  3R3O A;  2B2V C;  4JBW A;  1N36 L;  2KQ3 A;  1HFN A;  1SRO A;  4OO1 I;  3A8I E;  3MXN B;  4QGU A;  3A5U A;  1B1Z A;  3L9A X;  2ZXR A;  4DPG A;  4JI8 Q;  1DOK A;  3AB9 A;  5C0X G;  3K5N A;  1BBX C;  5BR8 L;  4IUV A;  1QVC A;  4JI6 Q;  3RN5 A;  2K5H A;  2BA0 A;  4DR3 Q;  3N6R A;  3H15 A;  3M9B A;  2EOT A;  3KK7 A;  3GO5 A;  3PUW A;  3SVM A;  2Z4H A;  1EIF A;  1NMF A;  2ENB A;  1CK1 A;  2EY2 A;  3IFT A;  2ZJR A;  1G91 A;  4YCU A;  4OO1 H;  2KEE A;  3OTO L;  4HJ9 A;  1HNZ Q;  2VZA A;  2F0E A;  4JBM A;  2L5T A;  4DUZ Q;  4KKS A;  3AMU A;  4DV4 Q;  1SND A;  2PYK A;  1WVL A;  1U4M A;  3EBE A;  3Q6S A;  3K8A A;  4GKJ L;  1EL0 A;  1JC7 A;  1U4L A;  2KA7 A;  2MHV A;  4WOR A;  2EXD A;  1VMC A;  1XMO Q;  1HZB A;  4A3D H;  2WKC A;  3HZX A;  2N78 A;  1SRU A;  2RA4 A;  1KLU D;  2JP1 A;  4DAM A;  3I73 A;  1Y14 B;  1PH1 A;  3WOF A;  4QIW B;  3NTI A;  1WTV A;  4BA2 I;  1MJC A;  4GLX A;  1XWE A;  1H95 A;  3KLR A;  2F03 A;  4OGQ C;  4KD3 A;  2D62 A;  1UE6 A;  2PW5 A;  1KIX A;  2FJ2 A;  4A3D B;  2XTI A;  5FO7 B;  5JAV A;  2K05 A;  3K58 A;  4KTA A;  3CME A;  2FHT A;  1Q8I A;  3SR1 A;  1YBY A;  1B3A A;  3HOY H;  4DXG A;  1XNR L;  4K5V A;  3T1H Q;  1AZP A;  4POF A;  2F0L A;  4KD4 A;  4F87 A;  2EYH A;  4KHZ A;  3G6E A;  5HGQ A;  2XRS D;  4IUR A;  3QJY A;  2R3Z A;  1EU3 A;  1EYC A;  5KYI A;  2HQE A;  1PFN A;  1PFM A;  3HOY B;  3BDC A;  4APV A;  2SDF A;  1HPC A;  1SSO A;  3QB3 A;  3HGB A;  5D3I B;  1TU2 B;  5GQO A;  3M4P A;  1QOH A;  1X32 A;  2SNM A;  4DV0 Q;  4GNX B;  2F0G A;  1KNA A;  2F0O A;  1CA5 A;  4BY1 H;  1HUM A;  3I70 A;  1TWC H;  2HHH Q;  4IPG A;  2CKZ B;  1IW7 C;  3BVM A;  1Y8O B;  3S1R H;  1HQR D;  2MO0 A;  1FVI A;  3TP5 A;  5IYB H;  4B3M L;  2SNS A;  3CCL A;  1FR3 A;  1I6H H;  4BY1 B;  3TP6 A;  4JYA Q;  3ICE A;  4X64 L;  1TWC B;  3U4V A;  2O2L D;  1EUJ A;  4G7O C;  3DWP A;  4QF4 A;  1E2V A;  1SYE A;  2JN4 A;  4X66 Q;  3O13 A;  3F2U A;  3S1R B;  4HSP A;  4LF5 L;  1O7L A; 
#chains in the Genus database with same CATH homology
 1VQM A;  3CW2 C;  2CWA A;  1T9H A;  4MNO A;  2QEX A;  5LMN Q;  4A3K H;  2BH2 A;  1IL2 A;  4IFD I;  1J5E Q;  2IX0 A;  1VQG A;  1AE2 A;  2YTV A;  3TRE A;  4QJF A;  1VQO A;  2ZJQ A;  4A3B G;  4K0K L;  2VUM G;  4DR2 L;  5JJL A;  1TWA H;  2KBN A;  1WJJ A;  3E9H A;  2ES2 A;  2R92 H;  4BY7 G;  4B3T L;  3S1M H;  3ERS X;  3GTM H;  3J7Z C;  3K81 C;  3L2P A;  4HID A;  1Q7Y C;  4DV1 L;  5IE8 A;  1SLJ A;  2FXQ A;  2A8V A;  5M3F H;  2JA8 H;  4JBJ A;  1L1O C;  2Q2U A;  3I4N G;  1X3G A;  1N34 L;  3PV0 A;  4P73 A;  1B8A A;  3GTO H;  2PQA B;  1VQP A;  3EN2 A;  2YV5 A;  1W2B A;  3S15 H;  1XNR Q;  3GDE A;  4X62 Q;  2MQH A;  4YWM A;  1KL9 A;  4R4O A;  1HR0 W;  3OYY A;  3W1B A;  4JI3 L;  5JEA G;  2AMC B;  1NMG A;  2JK8 A;  1XPO A;  5C4J H;  5IYD H;  2WP8 J;  2BH8 A;  3S24 A;  4BBR H;  1E24 A;  4DV5 L;  4XTC S;  2JA8 G;  4YCV A;  3CCJ A;  1YIT A;  3M7N A;  1A8V A;  3F8T A;  3PCO B;  4PZ6 A;  2OWO A;  1HNX Q;  5C44 G;  2LXJ A;  3RLF A;  3IRB A;  4LFA L;  4X65 Q;  4A3C H;  3STB D;  1YJ9 A;  4BXX G;  1K8G A;  3CC7 A;  3CC4 A;  5LMU Q;  3GD7 A;  5AJ3 L;  4HJ8 A;  4HJ7 A;  3S17 H;  4DR6 Q;  2LSS A;  3BJU A;  3UE0 A;  3PIP A;  2KEN A;  3FKI H;  3PUX A;  3CAM A;  3HOU H;  1KRS A;  3OW2 A;  4R1J A;  2JJQ A;  4O0A A;  1EFW A;  2B63 H;  1XJV A;  1WCM G;  2CFM A;  4A3C G;  4IFD G;  5FLX c;  2R93 G;  4DV6 Q;  2OTJ A;  1OXS C;  1I94 Q;  2WFW A;  5IYC G;  1YEZ A;  2N3S A;  4EX5 A;  2NN6 G;  3FKI G;  2JA9 A;  4QY7 A;  1EYG A;  5FLM G;  4DKA C;  5IT9 c;  3S1N H;  2Z6K C;  2WAQ G;  2B63 G;  1VQ9 A;  1I3Q H;  3ULJ A;  1BBU A;  3W1G A;  2NVY H;  4GNX C;  1HZ9 A;  4A3I H;  1QZH A;  2GN5 A;  4YY3 Q;  2UXD Q;  1JMC A;  1PA6 A;  1Q1B A;  1V43 A;  1QVF A;  1FL0 A;  5M5W H;  2JA5 G;  3M4Q A;  4IPD A;  2F4V L;  4B3M Q;  3I56 A;  3CD6 A;  3PO2 H;  1UE5 A;  2IHE A;  4DR7 Q;  4A3E H;  3S2H H;  4IPC A;  4JI0 Q;  4GKK L;  4KHP Q;  3AQQ A;  2ZTC A;  4X64 Q;  2DGY A;  4IJL A;  4DR1 L;  1BKB A;  1CUK A;  3PUZ A;  4LW1 A;  4A3J G;  1A63 A;  2JA6 G;  4A3G G;  1X55 A;  2WAQ E;  3H0G H;  2B3G A;  2UXC Q;  2VS1 A;  1O7I A;  4TVA B;  5C0X J;  1NJI C;  3L0O A;  4A93 H;  3PO2 G;  1Q81 C;  3HKZ G;  2D0O A;  3JAM i;  4A3E G;  4LF5 Q;  1VQH A;  4AYB E;  2IX1 A;  4YHH L;  1JT8 A;  3I4M H;  1NY4 A;  4A75 A;  2OQ0 A;  4EQ5 A;  4DV3 L;  3T1Y L;  2L15 A;  4K0K Q;  4LF6 L;  2HIV A;  3HOX H;  2N49 A;  3F2B A;  1KQS A;  1QZG A;  3STB C;  4DUZ L;  4MTN A;  1VQ8 A;  3CC2 A;  4L5Q A;  1QUQ B;  4H02 A;  4PZ8 A;  1V1Q A;  1X3F A;  4B3T Q;  4L5R C;  1R9T H;  2ATW A;  4A93 G;  5IP7 G;  1QUQ A;  2Q2I A;  2R6G A;  4DV1 Q;  1W3S A;  3HKZ E;  3I4M G;  3S16 H;  3CPF A;  3M3Y H;  2LXK A;  4X6A H;  2K5N A;  2OQK A;  3Q8D A;  1PYB A;  3J81 i;  2F52 A;  1LM0 A;  1XNQ L;  1FJG Q;  3KF8 B;  2N8N A;  1CKO A;  3RR5 A;  4A76 A;  1Z47 A;  2UU9 L;  3CCE A;  2B29 A;  4TQU S;  1BBW A;  3ZJY C;  3I55 A;  4A3M H;  4JI3 Q;  4JI5 L;  3K7A H;  2UUB L;  2JEA I;  1JJC B;  4DV5 Q;  3I2Z A;  1A62 A;  2K5V A;  3CQZ H;  1Q1E A;  4QL5 A;  3CCU A;  2Z0S A;  2PNH A;  1VQ4 A;  3HKS A;  3NEM A;  3UE1 A;  3GTP H;  1HZA A;  1LUZ A;  4POG A;  1N32 L;  4OON A;  4GKJ Q;  2ZM6 L;  2V1C C;  1PFS A;  1YVC A;  2R7D A;  5AJ3 Q;  2VUM H;  4DV7 L;  2JA7 H;  4AQY L;  4BY7 H;  2Q2H A;  3PF4 A;  3KLW A;  1X3E A;  2NZO A;  1YHQ A;  5IP9 G;  4OWW B;  1CKN B;  1YJW A;  2ZTD A;  3AFP A;  1HZC A;  1TXY A;  3HFZ B;  4DV2 L;  3PUV A;  1CKN A;  3JAM c;  4WJ3 M;  3I4N H;  1VQ5 A;  3PUY A;  1E22 A;  3W5O A;  1WYD A;  4GN5 A;  3CP0 A;  4C2M H;  5M5Y H;  1EWI A;  4KLK A;  2JA7 G;  1I50 H;  2NN6 I;  1NE3 A;  1SFO H;  4MZ9 A;  3GTJ H;  2AHO B;  2OTL A;  3TS2 A;  3DLL A;  4J15 A;  1M90 C;  4R4Q A;  3D0F A;  2IT1 A;  1PV4 A;  4LF4 L;  5J3B A;  2QA4 A;  3GTK H;  5JJK A;  2UUA L;  5C44 H;  3KF6 A;  4LFB L;  5K36 G;  2AWN A;  2F4V Q;  2DUD A;  1PH7 A;  2UUC L;  5HY6 A;  1TWG H;  3VDY A;  4BXX H;  1TWH H;  1VQI A;  3NEL A;  4LFC L;  3KJO A;  3S2D H;  1K0R A;  4FDB A;  4LUZ A;  4UP7 A;  3RZO H;  3PSI A;  1VQE A;  4GKK Q;  4DR1 Q;  5C4X G;  1UE7 A;  2E8G A;  3B6Y A;  3K80 C;  1HR0 L;  3PO3 G;  4NXN L;  4L5S A;  5M3M H;  4JOI C;  4JV5 L;  1IBL L;  1WCM H;  3MEF A;  1Q8K A;  2EQS A;  4JG2 A;  3ULL A;  2JEB I;  2R93 H;  2ZJP A;  2I5M X;  1UEB A;  4P74 A;  1PH3 A;  3HOV G;  1X54 A;  5IYC H;  4YHH Q;  4OX9 L;  4KI0 A;  4L5T A;  1C7Y A;  1GM5 A;  1J6Q A;  4BBS G;  5FLM H;  1G29 1;  4JI1 L;  3AFQ A;  1L0W A;  5M3M G;  4DV3 Q;  3T1Y Q;  1K8A C;  5GAD C;  3CXC A;  4LF6 Q;  3CCQ A;  1XPR A;  4DR4 L;  2H5X A;  4B3S L;  2JE6 I;  1P16 A;  5E7N A;  1Y1W G;  1PH5 A;  3F2C A;  1N33 L;  1Q12 A;  4UP9 A;  4O2D A;  2NVT H;  5ELO A;  1IYJ B;  1YHB A;  2JA5 H;  1OXX K;  1XPU A;  2UXB Q;  2EIF A;  2F3I A;  4GOP B;  3CCR A;  4GOP A;  4LF8 Q;  1XNQ Q;  4AH6 A;  1KHI A;  3NBH B;  4A3J H;  4P71 A;  1S3O A;  2E5L Q;  2UU9 Q;  2JA6 H;  4A3G H;  3TRZ A;  4JI8 L;  4JI5 Q;  4DK3 C;  2RF4 A;  2UUB Q;  5LMN W;  1TWF H;  1YIJ A;  1YI2 A;  1YHA A;  1JJG A;  5JJI A;  3DM3 A;  1E1O A;  1VQJ A;  1SMX A;  3K7U C;  4AYB G;  1FGU A;  3J81 j;  2NVQ H;  3KDF B;  3I4O A;  5DLQ E;  1I5F A;  4JI6 L;  1VQN A;  1HJP A;  1E7Z A;  3KDF A;  4DR3 L;  1N32 Q;  4P72 A;  2ZM6 Q;  1P8L A;  4A3D G;  2YU9 H;  4JBK A;  1IXR A;  1B70 B;  3TEH B;  3G4S A;  4DV7 Q;  1EQQ A;  4AQY Q;  1Q82 C;  3CPW A;  2E2J H;  4GLV B;  3M4O H;  3RN2 A;  3KOJ A;  4PG3 A;  4HJA A;  1PVO A;  4QIW E;  1ASZ A;  1VCI A;  1U0L A;  5IP7 H;  2VW9 A;  2CWP A;  4DV2 Q;  4C3J H;  3KYH C;  3M85 A;  1MJE A;  1WI5 A;  4JCV E;  4YWK A;  1CKM A;  2NVX H;  1HNZ L;  1VQD A;  4DUY L;  4DR2 Q;  2E2H H;  1UWV A;  2I5L X;  2A19 A;  3TQY A;  2CCZ A;  5GRO A;  2I5H A;  1X56 A;  1VQ6 A;  1WOC A;  2VQE L;  3U50 C;  1VQK A;  4LF7 L;  4DV4 L;  1X65 A;  2QGQ A;  4WJ4 A;  3HOZ H;  1HNW L;  5IWA L;  3UDI A;  1N34 Q;  2MO1 A;  1N8R C;  3HOY G;  1GD7 A;  4LF4 Q;  3GTG H;  5C0X I;  2UUA Q;  3PGZ A;  4LFB Q;  2VY3 A;  1JB7 A;  5JEA J;  2K75 A;  2UUC Q;  2ASB A;  1XMO L;  1YZ6 A;  4DR6 L;  4YCW A;  1PH2 A;  1PH8 A;  1VQL A;  4JI7 L;  4LFC Q;  1XMQ L;  2ZTE A;  4A3F G;  5H1S E;  2E2I H;  2R7Z G;  2IHF A;  1PH9 A;  2HT1 A;  3HOZ G;  4A3L G;  3G71 A;  1HR0 Q;  3I7F A;  5IP9 H;  4B3R L;  2D0P A;  4NXN Q;  2WB1 G;  1K9M C;  1GO3 E;  4JV5 Q;  4Y52 H;  3JC6 6;  1IBL Q;  1MKH A;  2Z6K A;  1A0I A;  1PHJ A;  3BU2 A;  4LFA Q;  3SGI A;  1G6P A;  1GVP A;  1S40 A;  1SN8 A;  4UY8 C;  3A5Z B;  3TS0 A;  2K50 A;  2PI2 A;  2RHS B;  4YWL A;  4OX9 Q;  1MIU A;  3HOW G;  1DGS A;  3RZD H;  4JI1 Q;  1QVG A;  1IZ6 A;  2WB1 E;  1IBK L;  2I0Q A;  4DR4 Q;  4IFD J;  2UXD L;  5EAY A;  2PI2 E;  1VQF A;  2KHI A;  3KJP A;  4GLA C;  3F2D A;  4B3S Q;  1N33 Q;  4BY1 G;  3T1H L;  3FP9 A;  4DAY B;  2AKW B;  4JBW A;  3RLN A;  1N36 L;  4GS3 A;  4KHP L;  1JJ2 A;  3LGJ A;  1SRO A;  1KD1 C;  1AE3 A;  3MXN B;  4OO1 I;  4QGU A;  3ULP A;  1U5K A;  3A5U A;  5C4X H;  1YNX A;  3CMA A;  3PO3 H;  1HH2 P;  3AYH B;  3KF6 B;  4JI8 Q;  4DPG A;  1OTC A;  1L2F A;  1KRT A;  3E0E A;  5C0X G;  4IPH A;  3J81 c;  4HJ5 A;  2XGT A;  4GOP C;  1SE8 A;  4P75 A;  4R4T A;  5BR8 L;  1GKH A;  1E3P A;  2KCT A;  3HOV H;  1QVC A;  2CQO A;  2MFI A;  4JI6 Q;  1NTG A;  3RN5 A;  5GAE C;  1Y1V G;  1Z9F A;  3D31 A;  3WWV A;  2VQF L;  2MNA A;  1V9P A;  2BA0 A;  2K5H A;  4DR3 Q;  4BBS H;  2KCM A;  5ELN A;  1M1K C;  3RLO A;  2HIX A;  3H15 A;  3M9B A;  5GAG C;  4NXM L;  3PUW A;  3GO5 A;  4BA1 I;  4DV0 L;  4DNI A;  3UDG A;  1PH4 A;  1EIF A;  1NMF A;  1VQ7 A;  2Y0S G;  5C3E G;  2ZJR A;  1Y1W H;  4LF9 L;  1IBM L;  4YCU A;  4HIK A;  4A3K G;  4A4I A;  4C3I H;  2HHH L;  3PF5 A;  4RG1 A;  1FJG L;  4NB3 A;  4IOC A;  2PQA A;  2YTX A;  4JC0 A;  4LWC A;  3OTO L;  1E1T A;  4HJ9 A;  2R92 G;  4UP8 A;  2RCN A;  1HNZ Q;  2VZA A;  1VS0 A;  2NZH A;  4DUY Q;  4JBM A;  4DUZ Q;  4GN4 B;  4HIO A;  4Y7N H;  1SR3 A;  2VQE Q;  3NEN A;  2ID0 A;  2GVB A;  5M3F G;  4DV4 Q;  4JI2 L;  4JI4 L;  1LYL A;  4LF7 Q;  2VNU D;  1B7Y B;  1KXL A;  2Y0S E;  1HNW Q;  5IWA Q;  2IY5 B;  3EBE A;  5M5X H;  4JYA L;  3U4Z A;  1VQA A;  3CF5 A;  1C0A A;  3K8A A;  4OO1 G;  4GKJ L;  1D8L A;  1CSQ A;  2EXD A;  1XMO Q;  5IYD G;  4BBR G;  1HZB A;  3KFU A;  4A3D H;  1VQB A;  1G51 A;  3CCM A;  1XMQ Q;  4JI7 Q;  2N78 A;  4X66 L;  4DR5 L;  4DK6 C;  1SRU A;  3J7A 5;  4DAM A;  2C35 B;  1Y14 B;  1PH1 A;  4B3R Q;  2AWO A;  4IO9 A;  3S14 H;  1ASY A;  1JE5 A;  4HIM A;  1MJC A;  1XTD A;  1L1O B;  5LMN L;  4GLX A;  4BA2 I;  1J5E L;  2Q2T A;  2JQO A;  2KHJ A;  5GAH C;  1L1O A;  1H95 A;  4RMF A;  1D7Q A;  1K83 H;  3EIV A;  2D62 A;  1UE6 A;  1CSP A;  4PMW A;  1KIX A;  3HOU G;  3BZC A;  4UPA A;  3J80 i;  2XTI A;  5IY0 A;  1EQR A;  4NPS A;  1KC8 C;  1WFQ A;  3UDX A;  2A1A A;  3CME A;  4C3H H;  1IBK Q;  3GTQ H;  1YBY A;  4LNQ A;  1OXT A;  3HOY H;  1KAW A;  1EOV A;  3E9I A;  4X62 L;  1K73 C;  1XNR L;  3GTL H;  4LUO A;  4OWT B;  3T1H Q;  4JOI A;  1Q86 C;  4OXP A;  4POF A;  1N36 Q;  3K0X A;  1N9W A;  3G6E A;  4KHZ A;  3FHW A;  4LUV A;  5HGQ A;  1X9N A;  3AEV A;  3S1Q H;  2PMZ E;  4A3F H;  2R7Z H;  1RIP A;  3A74 A;  2R7F A;  1X6O A;  4A3I G;  4A3L H;  1HNX L;  3CCS A;  3PIO A;  3L7Z C;  3RNU A;  4X65 L;  1K3R A;  3G48 A;  2BA1 A;  5LMU L;  1PH6 A;  1BVS A;  5BR8 Q;  4APV A;  5FJ8 H;  1S72 A;  1C9O A;  1LTL A;  5GQO A;  3M4P A;  2VQF Q;  3HOW H;  4AIM A;  2K4K A;  4QQB X;  3ER0 A;  3H0G G;  1NBW A;  1EIY B;  1OXV A;  3F1Z A;  4IJH A;  4PZ7 A;  4NXM Q;  4DV0 Q;  4DV6 L;  1OXU A;  4XIG S;  4GNX B;  1I94 L;  2UXB L;  3H3V I;  5FJ8 G;  4GNX A;  4LF9 Q;  4BY1 H;  4ME3 A;  1IBM Q;  1AH9 A;  2GVA A;  2K52 A;  3A0J A;  1TWC H;  4LF8 L;  2HHH Q;  4IPG A;  3BZK A;  4R4I A;  3HOX G;  3J80 c;  3OTO Q;  2E5L L;  2CKZ B;  2HQL A;  2YYZ A;  4YY3 L;  2ALY B;  4GN3 B;  1Q46 A;  4OWX B;  3S1R H;  5IYB H;  2MO0 A;  1FVI A;  4JI2 Q;  4B3M L;  4JI4 Q;  4ALP A;  3CCV A;  2VL6 A;  4DR7 L;  3CCL A;  1VQC A;  2RHQ B;  1I6H H;  4JI0 L;  4JYA Q;  3ICE A;  2OCE A;  4X64 L;  1UE1 A;  3U4V A;  3UDF A;  1EUJ A;  2YTY A;  1Y1V H;  4A3B H;  4A3M G;  1YJN A;  2UXC L;  1PYS B;  1RL2 A;  3U58 A;  5IYB G;  4X66 Q;  4DR5 Q;  4R4C A;  4IOA A;  4LF5 L;  2K14 A;  3H3V H;  5C3E H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...