3K8AA

Neisseria gonorrhoeae prib
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
100
structure length
100
Chain Sequence
MGFTNLVSLAALIEKAFPIRYTPAGIPVLDIILKHESWQEENGQQCLVQLEIPARILGRQAEEWQYRQGDCATVEGFLAQKSRRSLMPMLRIQNIKEYKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of Neisseria gonorrhoeae PriB reveals mechanistic differences among bacterial DNA replication restart pathways
pubmed doi rcsb
source organism Neisseria gonorrhoeae fa 1090
molecule tags Dna binding protein
molecule keywords Putative primosomal replication protein
total genus 14
structure length 100
sequence length 100
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-10-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3k8aA00
4A3JG 4DV3Q 2EIFA 4IPDA 3RZOH 3BJUA 4TVAB 4NXNQ 1KL9A 4Y7NH 1C7YA 1PV4A 3A5UA 4GOPA 1XNQQ 4C3HH 4P73A 1I94L 4X64L 4JC0A 1KD1C 1QUQB 3BU2A 4IO9A 4DR2L 4BBSH 2GN5A 4DV4L 5HGQA 4BY7G 4A3DG 4A3GG 1UWVA 1VQHA 2OCEA 1OTCA 2CKZB 2ZJPA 2UXBL 1KRSA 1YHBA 3PF4A 4A3CH 4JYAQ 4R4QA 5GAGC 3SGIA 1YHQA 4GNXB 2UUAL 1PH6A 4PZ8A 2I5LX 4DV2Q 2K4KA 2CCZA 2N78A 2NZHA 1AE2A 4QY7A 4AYBG 2I0QA 1IBKL 4LF4L 1X55A 2E5LQ 3JC66 1FJGL 3CCEA 5IYCG 2N49A 1Q46A 1YI2A 1L1OB 3AFPA 2ZTCA 3L2PA 2YTVA 3M3YH 4EX5A 2WAQG 3CMEA 4BY1H 1Q12A 3CAMA 1UE5A 4OO1G 1JB7A 5IP9H 1W3SA 4IOAA 4NXNL 2ASBA 3OTOQ 3OW2A 1YJWA 1PYSB 5K36G 1DGSA 4J15A 2NVTH 4HIDA 1MJEA 3ERSX 3HOYH 5FLXc 1NBWA 4DR1L 1NMFA 1SR3A 4LFCL 1HNXL 2NN6G 2ZTEA 4DAYB 4P74A 3TS0A 1HR0L 1VQPA 3I7FA 2NVQH 4GKJL 1CKOA 4OONA 4R4OA 3I4NH 4JBWA 4IPGA 2BH8A 2N3SA 2A1AA 2Q2HA 4DK6C 1FGUA 1XMQL 3AEVA 2Q2TA 3GTOH 1LUZA 4DR6L 5ELOA 3WWVA 3KLWA 1XNRL 3ULLA 2UXDL 4LFCQ 2YTXA 5C4XG 2PI2E 3UDXA 4IJLA 1GM5A 3W1BA 3T1HQ 5FJ8G 2D0OA 2R93G 1QZHA 4LUZA 2BA1A 5FLMG 4JBMA 4LWCA 4JI0L 1K8GA 1Q8KA 2VUMG 2WB1G 3UDIA 1M90C 1WCMH 3HKSA 1KIXA 1K9MC 2RHQB 1BBWA 1Q86C 4GN3B 3RZDH 3HOUH 1JJGA 4A3IG 4BA2I 3PGZA 4KLKA 5LMUQ 3K80C 3CXCA 3CMAA 4HJ5A 1E7ZA 4WJ3M 1CSPA 5JEAG 3TS2A 3W1GA 5IYDG 3H3VH 5FLMH 3CCSA 2UXDQ 3HKZE 5M3MH 1XMQQ 4R4IA 4A3BG 3GTMH 4JOIA 5IE8A 1H95A 1PH9A 4LFBQ 4DV4Q 3HOWG 1V9PA 2K5HA 5IT9c 2KHIA 1VQJA 4PMWA 5IWAL 1VQLA 2D62A 2HHHL 5JEAJ 1I6HH 3HFZB 2QEXA 1K83H 3GDEA 2JQOA 4JV5L 2I5MX 4UPAA 1KRTA 1C9OA 3FKIG 1CSQA 4DK3C 3OTOL 4HIKA 4BXXG 1PYBA 3CCVA 1YJ9A 2HT1A 3M4PA 3S14H 4A93H 5IP7G 1OXXK 3MXNB 3UDFA 1N9WA 4X66L 4DKAC 4DUYQ 1Q7YC 2KCMA 2KCTA 1FL0A 1QVCA 4L5QA 4MZ9A 4BY7H 1KXLA 3L7ZC 1RL2A 1YZ6A 3PIPA 4JI6L 2UU9L 1C0AA 3M9BA 1N36Q 1VS0A 4R4TA 4LF7L 2A19A 3T1YL 1N34L 4DV2L 5E7NA 4DNIA 4JI1Q 4GNXC 2UUAQ 1FJGQ 2E5LL 3FKIH 2K5NA 5GAEC 5M3FH 4YHHQ 4LF4Q 2JEAI 3PO3G 3PO2G 1BVSA 1YVCA 1J5EQ 3IRBA 3Q8DA 2OTJA 2VQFL 4LF8Q 2PQAA 4K0KL 3PUVA 4JI2Q 2R92G 2VNUD 4DR3Q 2N8NA 3H3VI 1L1OC 1U5KA 3F1ZA 3W5OA 2JA6G 5HY6A 1GD7A 4YWKA 1Q1BA 3S2HH 2UXBQ 3B6YA 1YIJA 3RR5A 2VUMH 5JJIA 1EIFA 1WCMG 1IBKQ 1V43A 3CCQA 4BBSG 3A74A 5J3BA 2WFWA 1E1TA 2ES2A 2F52A 4LF6Q 3S2DH 1Y1VG 1KC8C 4JI1L 2NZOA 1J5EL 1TXYA 1YEZA 4JBJA 3CPFA 5C44H 4YHHL 3KJOA 1PA6A 3RN2A 1UEBA 1X6OA 1QVGA 2UU9Q 2JE6I 1M1KC 1VQ5A 2JEBI 2Z6KC 1XJVA 3UE0A 1MKHA 2ZJRA 1A8VA 1PH7A 1KQSA 1N36L 3PCOB 3GTGH 1I50H 3TREA 2R7DA 3CCRA 1HR0W 3KFUA 3M7NA 3S1MH 1IXRA 4GN5A 4DR1Q 2UUCQ 3RLOA 4JBKA 4QIWE 3F2BA 1PH2A 5GADC 1KHIA 2XTIA 3A0JA 3CQZH 4OWWB 1A62A 1TWHH 1N33Q 1PH5A 3PF5A 3FHWA 4XTCS 4YCVA 1L0WA 2UUBL 1VQ9A 1QUQA 3TQYA 2IT1A 2MQHA 1VQEA 1NMGA 3JAMi 3KF6B 3BZKA 3CW2C 4GOPB 3LGJA 4MTNA 3KJPA 3CCJA 1G291 4LF5L 2F3IA 4A3KG 4DR4L 1WFQA 1VQDA 3K0XA 1P16A 4POFA 1EWIA 4HJ9A 2D0PA 3H0GG 4L5RC 2E8GA 3I4NG 5C0XI 3JAMc 4B3MQ 4DV1L 2JA5G 4DR3L 2AHOB 3RLNA 1SMXA 4DAMA 4HJ8A 4C3IH 2AKWB 4JYAL 4NXML 1CUKA 3EBEA 3J7ZC 2Z6KA 4BA1I 2MNAA 4IFDG 4X62Q 4X65Q 3U4VA 3I2ZA 2UXCL 4ALPA 4RMFA 4JI0Q 1BBUA 3PUZA 5H1SE 5IP9G 3K8AA 4X66Q 4JG2A 3CC4A 1B7YB 1TWGH 3EN2A 4LFAQ 1PFSA 4A3DH 4DR4Q 5GROA 1Z9FA 4AIMA 3KDFB 4H02A 4B3SL 4B3TQ 1OXUA 2HQLA 4JI8L 3S24A 3G6EA 4TQUS 4JV5Q 4GN4B 2ZM6L 1KAWA 3NENA 2JA8H 2Z0SA 1Y1WG 3RN5A 3J81i 1UE1A 4KHPL 4YCWA 4JI3L 1W2BA 3GTPH 3HOVH 4QL5A 5M5YH 2LSSA 3CPWA 2E2JH 1IBML 4A3FG 2IX0A 2XGTA 2K14A 1VQGA 2JJQA 1YITA 4PZ7A 1X3GA 2GVBA 1CKNA 5BR8L 1HZBA 3G71A 2VQEL 4DV6Q 3ZJYC 3S1RH 1YJNA 4LNQA 4GLAC 2K5VA 4YCUA 3NBHB 4P75A 4A76A 2RHSB 3KYHC 1SLJA 3HKZG 2ZM6Q 4A4IA 4HIMA 1XPRA 1HNWL 3S15H 2YV5A 1CKMA 2HIXA 2VL6A 3ULPA 2BH2A 1PH8A 3U58A 1E24A 1JJCB 1L2FA 5C44G 2JA6H 2IX1A 2R7ZG 1NE3A 4GOPC 4B3SQ 1AE3A 2PMZE 1JT8A 2RF4A 4DV0L 4P72A 3J81c 1OXTA 4JI5L 2E2HH 4IOCA 4DV7L 2OTLA 1UE7A 2QGQA 2WAQE 1NJIC 5M3FG 1K73C 1E22A 1VQ8A 2UXCQ 1B8AA 5LMNQ 3T1HL 1WJJA 3I55A 4HJAA 2CWPA 2VQFQ 4LF8L 4K0KQ 3KF8B 2WP8J 3E9HA 1D8LA 4WJ4A 1Q82C 2VW9A 2VZAA 5BR8Q 4DV6L 3HOYG 4IPCA 3VDYA 3PO3H 2YYZA 3M4OH 3T1YQ 4BBRH 3G4SA 2MFIA 3U4ZA 2H5XA 1Y14B 3BZCA 4DPGA 1VQCA 4BY1G 3STBC 4APVA 3F2DA 3ULJA 4X64Q 1HNXQ 1VQ6A 4BXXH 1VQKA 3HOXG 5ELNA 4EQ5A 2I5HA 3KOJA 2QA4A 2B63G 2Y0SE 3G48A 1QZGA 2AWNA 3UDGA 1BKBA 1O7IA 3F2CA 1AH9A 4Y52H 1IBLL 1YBYA 5EAYA 3U50C 5C4JH 3GO5A 4BBRG 2EXDA 1VCIA 1OXSC 4QJFA 2C35B 3M85A 4GKKL 4A3IH 4LF9Q 5C0XG 5LMNW 1QVFA 2OQKA 4A3MH 2YTYA 4A3GH 1XTDA 1I5FA 3RNUA 1HZCA 4JCVE 3OYYA 4IJHA 1G51A 1Y1VH 1GO3E 3AFQA 2WB1E 3HOZH 2RCNA 4X62L 1SN8A 3AQQA 1VQFA 1R9TH 1S3OA 4YY3Q 4L5SA 4NXMQ 2NVYH 4FDBA 1EUJA 2NVXH 4AYBE 5AJ3Q 5AJ3L 3CCUA 5LMNL 4LF6L 3PO2H 2ZJQA 3CD6A 1IZ6A 4DV5L 3PUXA 1EYGA 1HNZQ 4DR2Q 4OX9L 4B3RQ 4GNXA 1VQ4A 1SRUA 1ASZA 4UP9A 4LF9L 3AYHB 4A3MG 1WI5A 1TWCH 2E2IH 3PSIA 1YNXA 5FJ8H 3S1NH 1X56A 1EQRA 1X3FA 2VS1A 4NB3A 4DUZQ 2B29A 5IYBG 4A3KH 1L1OA 3E9IA 3M4QA 4UY8C 1X54A 5GQOA 1MIUA 2K75A 2K50A 4YY3L 3S1QH 3I4MH 1E1OA 4RG1A 4IFDJ 2UUCL 1IBLQ 4JI7Q 1TWAH 1Q1EA 1K3RA 2R6GA 4PG3A 1EFWA 4PZ6A 2R7FA 3CC7A 1EOVA 1I3QH 1T9HA 4HJ7A 4A3FH 1PHJA 4L5TA 4LF7Q 4DR7L 1LM0A 2VQEQ 5IP7H 3D0FA 5IY0A 4R1JA 4A3LG 1RIPA 4DR6Q 2L15A 1PVOA 3HOWH 1N32L 5DLQE 2R92H 3L0OA 3CP0A 1NY4A 1GKHA 4A3CG 2IY5B 2GVAA 3D31A 1A0IA 4ME3A 2MO1A 4AQYL 4KI0A 4A75A 1WYDA 1IYJB 4JI3Q 1SE8A 3GTKH 5IYDH 2VY3A 1A63A 1Z47A 1XPOA 1P8LA 4KHZA 2HHHQ 4DR5L 3PIOA 3CC2A 5IYCH 5C4XH 3S16H 1XMOQ 4DV7Q 2IHFA 2A8VA 2CFMA 3GD7A 2AWOA 4DV0Q 4OX9Q 4JOIC 4B3RL 1X3EA 4R4CA 3GTQH 3F8TA 4JI2L 4GLXA 4LFAL 1HZ9A 5C0XJ 4A3JH 3RLFA 4QQBX 3HOUG 2R7ZH 1SFOH 2B3GA 2Q2IA 5M5XH 3HOXH 1GVPA 4QGUA 2JA5H 1TWFH 3PUWA 3CF5A 4NPSA 4JI6Q 4GS3A 1VQAA 3STBD 2DUDA 3I4OA 5M3MG 2KBNA 1HH2P 4JI5Q 3I56A 4A3EG 1PH3A 4GKKQ 2Y0SG 2Q2UA 5GAHC 1WOCA 3NEMA 3MEFA 4MNOA 2PNHA 4O2DA 4DUYL 1IBMQ 2OQ0A 5IYBH 1X9NA 3ER0A 1LTLA 3GTLH 3TRZA 2B63H 2KHJA 1HR0Q 1XMOL 1HJPA 4YWMA 2PQAB 1OXVA 5IWAQ 1JJ2A 4OWTB 4JI4L 3EIVA 4JI4Q 3CCMA 4DR5Q 2JA7H 4AH6A 2OWOA 4AQYQ 1IL2A 2ID0A 4A93G 3K7UC 1Y1WH 1N8RC 3DLLA 1LYLA 2DGYA 2HIVA 1NTGA 2MO0A 1K8AC 1CKNB 2K52A 4POGA 3J81j 1XNRQ 2AMCB 4A3LH 4OXPA 4LFBL 3NELA 1ASYA 4B3TL 3FP9A 5C3EG 2V1CC 4JI8Q 4DR7Q 1X65A 5LMUL 3CCLA 2JK8A 2LXJA 1PH4A 1VQOA 4GKJQ 2R93H 3J80i 1PH1A 3ICEA 1VQBA 2KENA 2YU9H 3K7AH 5M5WH 4KHPQ 5JJKA 5JJLA 2JA8G 4GLVB 3GTJH 1U0LA 2CWAA 3E0EA 1YHAA 4JI7L 1MJCA 1XPUA 3J80c 1VQ7A 2ALYB 2F4VL 1D7QA 3S17H 1VQNA 3KDFA 3A5ZB 2LXKA 4B3ML 3UE1A 2PI2A 1HZAA 5C3EH 4DUZL 4UP7A 2JA9A 3TEHB 1EQQA 3HOVG 4P71A 1K0RA 3H0GH 4O0AA 4IFDI 3KF6A 4C2MH 4X65L 1S72A 4LF5Q 1G6PA 4XIGS 4A3BH 3H15A 3I4MG 1HNZL 4C3JH 1HNWQ 4DV5Q 3HOZG 2F4VQ 1B70B 1N33L 3PUYA 2NN6I 1SROA 4DV3L 4HIOA 4DV1Q 1FVIA 2ATWA 4YWLA 1JE5A 1V1QA 4A3EH 2IHEA 4UP8A 3J7A5 1E3PA 1N32Q 1VQMA 1JMCA 1Q81C 1N34Q 2ZTDA 1XNQL 3K81C 1J6QA 3PV0A 4OWXB 1S40A 1I94Q 1EIYB 4OO1I 1VQIA 2FXQA 2EQSA 3DM3A 4LUVA 4LW1A 2UUBQ 4IPHA 2JA7G 2CQOA 4LUOA 4X6AH 1UE6A 2BA0A
chains in the Genus database with same CATH superfamily
3WOEA 5M5XB 2CVRA 3BJUA 4NXNQ 3HOZB 1C7YA 1PV4A 5M3MB 4GOPA 1I4PA 3GTMB 2F0VA 2DY8A 3ND9A 3S9WA 1QUQB 2B8FA 4NP5A 2B2TA 1UWVA 1VQHA 1KRSA 1K83B 4A3CH 3SGIA 4KKTA 2CH4A 4PZ8A 1HQRD 4LK1C 2E5LQ 2J0TD 4ZLTF 2OF1A 2N49A 4KN7C 1L1OB 2B2UC 2ZTCA 3M3YH 4EX5A 2WKCA 1PZID 4OO1G 1W3SA 3NBIA 4IOAA 1CI3M 1Q90A 5M5WB 4XQQA 3GTJB 4HIDA 3HOYH 5FLXc 1LT4D 1TWGB 4IUVA 4LFCL 1CTMA 1GUGA 1HR0L 1SNPA 1I4RA 1Y69U 4ME5A 3I4NH 2F0EA 2F0KA 2RCFA 3AEVA 1XMQL 2Q2HA 3GTOH 1A2UA 1LV9A 1ML0D 3KLWA 4C2MB 2UXDL 4LFCQ 1FNWA 5KGUA 2E2JB 3G6JB 1XTCD 1U9RA 3UDXA 2ICIA 1GM5A 4A3JB 1PRTB 2QILA 2K5WA 4LUZA 1TWFB 4JBMA 3H3VC 2L1BA 4X3SA 3OIPA 3S15B 1WTPA 4EQPA 2VUMG 2WB1G 1S5DD 1K9MC 1TWHB 3BVMA 1BBWA 1JJGA 1B4OA 1HA6A 2F0IA 3NHHA 1A2TA 4HJ5A 1C4QA 1CSPA 2JXMB 1STBA 3VR3A 5C3XA 3HKZE 4R4IA 1CK1A 3HOWG 4OIKA 1V9PA 4DXGA 1BQQT 5IT9c 4CJ1B 1VQLA 3H6MA 3HFZB 1I6HH 2HD3A 3VR2A 2JQOA 2I5MX 1KRTA 1C9OA 3FKIG 5AFWA 4KV6A 4X3TA 5CV5A 2HT1A 1BDOA 5DM63 3UDFA 1N9WA 2KCMA 2KCTA 1QVCA 4BY7H 4BS9A 1FR3A 3L7ZC 2UU9L 4XXEA 2A19A 3T1YL 5EBDA 1N34L 4O1NA 5E7NA 1Q3LA 2K5NA 5GAEC 2L9HA 2XVSA 4YHHQ 3PO3G 1YVCA 1J5EQ 3IRBA 3Q8DA 4HR7B 5J39A 2VQFL 2PQAA 4A3MB 4LF8Q 4HTHA 3TZUA 2F1MA 1IW7C 4A3EB 2NTTA 3KLRA 5BN4A 3KLSA 1V43A 2NVXB 5J3BA 1KC8C 4JI1L 1PA6A 1VF7A 3CPFA 3KJOA 2JA6B 4KK7A 3BS1A 1TWCB 2E2IB 1VQ5A 1PXUA 2QDBA 2Z6KC 1KQSA 1SBBB 1N36L 3GTGH 1U4MA 1SDFA 1G8ZD 4C3HB 2VB2X 4RKBA 1D6EC 2K05A 3OIQA 4JK1C 1D1KA 3EVQA 3A0JA 3CQZH 3E0JA 1A62A 3T4AC 4U68A 4OWWB 2X6LA 2A73B 4RHSA 3AMUA 2J4XA 3TQYA 1VQEA 3JAMi 5TSSA 1H9MA 2AQ1B 4MTNA 4DR4L 1WFQA 3D4RA 4BA2I 1P16A 5T1IA 1RCVD 3A7LA 5C0XI 4B3MQ 2JA5G 4DR3L 1SYGA 3RLNA 4HJ8A 4C3IH 4NXML 1CUKA 4ODGA 2CH4W 3GV6A 5IGFA 1FNUA 1FNVA 1PLFA 1V1OA 3OSOA 3GQBA 4N8FA 3C1EA 4JG2A 3CC4A 1BNZA 1PFNA 2B2WA 1LTID 5GROA 4B3SL 4K8JA 3KDFB 1SAPA 4H02A 3F2UA 3S24A 4TQUS 5FOBB 1EYDA 4ZUIA 3IKJA 4OHJA 1F9RA 1UUPA 1GUTA 3SXHA 4KHPL 3A54A 4JI3L 3HOVH 4QL5A 1JWSD 1ZYRC 3DMUA 1IBML 2K01A 4A3FG 3E6ZX 2XGTA 3CKIB 2JJQA 1YITA 4DV6Q 4RGOS 4LNQA 2JA7B 5KIXA 2DNCA 3I70A 5D65A 3TDQA 3Q24A 3C46A 5COYA 2RHSB 1XPRA 2RDGA 1HNWL 3MXPA 1CKMA 3S2DB 2VL6A 2DJGC 2BH2A 4MHEA 3U58A 1LTGD 4A3FB 1IL8A 4GOPC 4JPBW 3RZDB 1K8OA 3P20A 2RF4A 3QR8A 1OXTA 3ERQA 3OW7A 2WAQE 1NJIC 3S1MB 2PZUA 4KD4A 1WJJA 1T5XD 3W3AA 4K0KQ 4OGQC 3KF8B 4N9PA 2WP8J 3E9HA 1D8LA 1PTOF 2VW9A 2VZAA 3VDYA 5CV6A 2YYZA 2ZT9C 4RFBA 4BBRH 3I4LA 2E75C 3GTQB 3H09A 2F0MA 4BY1G 4IALA 4R9WA 1VQ6A 1SJED 2R7ZB 3PMFA 1NSNS 1SFOB 2JA5B 2F0TA 4EQ5A 2B63G 1QZGA 4XQNA 4RGTA 5IIFA 5C4JH 1K3BC 1RHPA 2E74C 1OXSC 2SDFA 5KNDA 1XWEA 5KEEA 1SNOA 3U9SA 2YTYA 4ZQ3A 4JCVE 4NW2A 3OMGA 2B63B 3S2HB 3HOZH 1G91A 2A68D 5C5MA 3PO2H 3OPOA 1EQVA 4DR2Q 4B3RQ 1AW7A 1L0XB 4XYQA 1VQ4A 1ENCA 1ASZA 4EQOA 4UP9A 4RKLA 5IOCA 4LF9L 1WI5A 1DD2A 4DNRB 3S1NH 2F0PA 2MP1A 1I6VC 3S1RB 3M4QA 2LFNA 1WTQA 1ZYRD 1MIUA 2ENBA 2KEDA 1E1OA 4CGYB 4JI7Q 3TZDA 1TIID 1BCPF 3CC7A 1RJTA 4LF7Q 1EZ8A 2VQEQ 3MC0B 3SK8A 1RIPA 4EGVA 2R92H 1EOTA 5EGTA 1NY4A 3SDZA 4A3CG 4ME3A 4J8QA 5ELEA 4A75A 1IYJB 1FD7D 2RSOA 3GV3A 2WIIB 3I4NB 5F2DA 4DR5L 1TQOA 5IYCH 1QNKA 3Q6SA 1DZ1A 1H9SB 1QOHA 4B3RL 1X3EA 4R4CA 1CM9A 3K0YA 5EPKA 4IURA 2CHBD 3J81E 2NUCA 2CW0C 3RLFA 4A3JH 4QQBX 2Q2IA 2Q8IB 1TWFH 3IFDA 4Y7NB 4JI6Q 2EY5A 2KBNA 1HH2P 1SSOA 2A5HA 1PZKD 1PH3A 3NEMA 4MNOA 2L4NA 2A6ED 1TT2A 2OQ0A 5IYBH 1X9NA 1S5CD 1LTLA 3C2PA 3TRZA 5FK9C 3H94A 2WB1B 4OWTB 3EIVA 4DR5Q 2RSNA 3LNNA 5J22A 3NBHA 2ID0A 3BDCA 3NE5B 5IT9L 3DLLA 1K8AC 1XNRQ 2P5ZX 1YNJC 4ZUJA 1STHA 5C3EG 1SYEA 2V1CC 1EYCA 1X65A 5LMUL 2R93H 1BO0A 1PH1A 3ICEA 2I46A 5JJKA 2E76C 4KY6A 4A3KB 2JA8G 5I6WA 1U0LA 5EBCA 2E2HB 2CWAA 3E0EA 1EY0A 2AQ3B 5BN5A 1D7QA 4MTKA 4B3ML 2O5IC 3UE1A 3BDOA 1D2BA 4UP7A 1GOZA 3TEHB 2EZVA 3PO3B 2EJGC 5I9OA 4LF5Q 5C4ZA 4XIGS 3H15A 3I4MG 1TU2B 1HTPA 3FRPB 4C3JH 1HNWQ 4DV5Q 2EYMA 1ZXTA 4HIOA 5JVH3 1JE5A 1GUWA 2Z6BA 4A3EH 1AN8A 3J7A5 1VQMA 2RKSA 1JMCA 1N34Q 4RCOA 4G7HC 3S16B 5C4XB 2ZTDA 2AQ2B 2PPBC 3TP5A 3BZDB 4G57A 1VQIA 2EQSA 4LUVA 1PMRA 5KYLA 2UUBQ 1SNDA 4LUOA 2L12A 1UE6A 2PZTA 1E2WA 2PW7A 4X6AH 4IPDA 3RZOH 1Y1VB 1HFNA 3AB9A 3A5UA 1FYCA 4C3HH 1RKNA 4X64L 4JC0A 5I6YA 2DN8A 4ID6A 4RGMA 2OCEA 2UXBL 1YHBA 3PF4A 5CMDA 2LMCB 4OL7A 3DEPA 2N88A 1Y8NB 3MHBA 4GNXB 2K4KA 2RDHA 2NZHA 1VDZA 5ELCA 4O42A 2M2LA 1YI2A 1TS2A 3AFPA 3A7AB 4BY1H 4RHRA 1JB7A 4NKLA 1ET9A 4KJNA 5BN3A 1PYSB 1DGSA 4OEMB 1BCPC 2PNRC 4DR1L 1S5ED 1SR3A 4ZK9B 4K8IA 1PTOC 4E6IA 3A56A 2I07B 1CA5A 4JBWA 3P75A 2QEJC 4RCNA 5EKLA 3SE0A 2BDNA 1SNMA 3WWVA 2WKDA 5KYIA 2YTXA 1EL0A 2PI2E 3W1BA 3T1HQ 1DCZA 1HRJA 2D0OA 3MXNA 1ICWA 1TY2A 2O2LD 5FLMG 1A3VA 1IHZA 1Q8KA 3RD4A 3UDIA 1M90C 1X32A 4QF4A 4EQNA 3RZDH 4A3IG 4KLKA 4QMGA 4WJ3M 4QIWB 1Z7TA 3TS2A 3W1GA 4FF3A 1XMQQ 1H9JA 3I91A 5K5PA 2QDLA 1STNA 5FO9B 1VQJA 4PMWA 2D62A 2HHHL 2QEXA 4BBRB 1SMYD 1S5FD 3GDEA 3A8IE 4IN3A 2YU9B 4DK3C 3CCVA 1YJ9A 3S14H 1II3A 1BF4A 3MXNB 5JOBA 3FVQA 4FVMA 1KXLA 1YZ6A 4JI6L 3M9BA 1N36Q 1VS0A 4R4TA 4LF7L 4L6TB 3O13A 4DV2L 3VYTA 3FKIH 3PO2G 3SHLA 5M3FH 2XWBB 2JEAI 2NVTB 4RH6A 4K0KL 1A3UA 4X3UA 4JI2Q 1CZGA 2N8NA 1U5KA 3F1ZA 2JA6G 4YWKA 1Q1BA 3S2HH 1LT3D 3B6YA 2NVQB 5JJIA 1K28A 2DY7A 4F87A 3HG9A 3QB3A 3CCQA 3PO2B 2WFWA 2Z8LA 2F52A 2KOLA 3MVVA 2NZOA 3JAML 1J5EL 4JBJA 4YHHL 4CDCC 3RN2A 1X6OA 4IUTA 2BE5D 3PQIA 4K5WA 2JEBI 2KJXA 3UE0A 1MKHA 1QB5D 3PIO3 2H1EA 3HZXA 2ZJRA 3PCOB 3CRLC 1I50H 4XT1B 1HR0W 3KFUA 1EIGA 1YNNC 3M7NA 1B2TA 1D5XC 1J9OA 2F0GA 4QIWE 3F2BA 1WCMB 1PH2A 2XTIA 1N33Q 1JOOA 1DYQA 2F03A 3PF5A 4YCVA 1PRTC 1ESRA 3CHBD 5C4HA 2GA4B 2R92B 5ELBA 3T16A 1JICA 2QCPX 4FXDA 3LGJA 1XYIA 3CCJA 1G291 4ZRZA 2F3IA 2K1BA 3K0XA 1EWIA 1ZKOA 2D0PA 3I4NG 2OEOA 3LX0A 5I4DA 4ZAIA 4G7ZC 4JYAL 2MNAA 3MEHA 3NQTA 5FLXE 4X62Q 1LLRD 1GXDC 4JI0Q 1BBUA 1ICFB 3I73A 3K8AA 1O80A 1VMPA 2TMPA 4LFAQ 2EYFA 3QOJA 4DR4Q 4B3TQ 1HXYD 2XNAC 1AEXA 2H4OA 1SNCA 2MPMA 5ISRA 2FINB 4GN4B 2ZM6L 4M8AA 4KJOA 4H13C 1UE1A 1W2BA 3QWNA 3CPWA 1K0SA 2FHTA 2K14A 3IAYA 1CFMA 2GVBA 2Y0SB 3G71A 3J7YW 2VQEL 3ZJYC 1BXTA 1QILA 4GLAC 2K5VA 1SLJA 3HKZG 2SOBA 2HIXA 1XXGA 3ULPA 5CGKA 2R93B 3QOLA 3J81L 4B3SQ 1AE3A 4PMCA 4DV0L 5LL6S 2E2HH 1SJHD 4IOCA 2OTLA 5M3FG 1K73C 2NTSA 5FLXL 2F0JA 4HJAA 4PMBA 4WJ4A 2F0LA 1Q82C 5BR8Q 3HOYG 3PO3H 5JEAH 3MFGA 3T1YQ 2V4DA 1TVXA 3G4SA 2MFIA 3U4ZA 2H5XA 4IUNA 4KTAA 3BZCA 4C3JB 4DPGA 3STBC 5EPJA 3MZ5A 3ULJA 1HNXQ 1F9SA 4RGNA 3HOXG 1CHPD 2MJ8A 2X69A 3DHQA 2QA4A 3G48A 4HSVA 4Q5VA 1H9KA 2EJFC 5LHY1 1AH9A 5CBAE 4QJFA 2LY7A 4JW0A 2C35B 3KBXA 1EY6A 2K7VA 2L55A 1HZCA 4A3DB 4HSPA 4IJHA 3SK5A 1Y1VH 1GO3E 3D6WA 2RCNA 2VUMB 2HQEA 1R9TH 1NAPA 1Y1WB 4L5SA 2NVYH 4FDBA 4LF6L 3PUXA 3NXWA 1HNZQ 2MHVA 1MBYA 3GTPB 4GNXA 1SRUA 3J7AF 1I4QA 1GUNA 2AUJD 3K7AB 1X56A 1EQRA 2SNSA 1CZWA 1PYWD 1L1OA 1KDAA 4UY8C 5GQOA 2K75A 3S1QH 2PYKA 1TWAH 3R93A 4RA8A 4PZ6A 1EOVA 4HJ7A 1T9HA 2SEBD 4L5TA 5IP7H 2JSOA 3D0FA 5IY0A 1F77A 4TRDA 3HOWH 2Z1CA 1N32L 2CW0D 5KNCA 1ENAA 3M4YA 1JB3A 3MAQA 1GKHA 2IY5B 2GVAA 1A0IA 2R3ZA 1WYDA 1UEAB 1UAPA 2VY3A 1A63A 2F4IA 3EROA 3QIAA 1XPOA 4CHTB 3NTIA 1P8LA 4KHZA 1G2TA 2CQAA 1JQYD 3CC2A 2EXZA 1XMOQ 2EYOA 3X3MA 2AUKA 3M4OB 2AWOA 2LKVA 4JI2L 3SR1A 5DEHA 2B3GA 5M5XH 3HOXH 1A3TA 2NN6H 4GS3A 2E2DC 5M3MG 1GUSA 2JA8B 5JJZA 3VA5A 1BBXC 2Y0SG 5JPMC 3MEFA 1EY8A 1KDCA 2F0WA 4N9TA 2HUGA 3GTLH 1HJPA 5IWAQ 1RTNA 1JJ2A 4JI4L 1J8IA 2KECA 1IL2A 4LJZC 2KEEA 1S5BD 2DGYA 2XSCA 2MO0A 3VR6A 1CKNB 3E3XA 4OXPA 3VA7A 3NELA 3M3YB 3FP9A 3NTHA 5KNBA 4DR7Q 3EJIA 1PH4A 4GKJQ 4V0BA 3J80i 1V8QA 1DOKA 2YU9H 5K36H 5M5WH 4KHPQ 1WD1A 4CJ0B 4GLVB 3GTJH 1PFMA 1MSHA 1XPUA 1MJCA 3ONAB 4I7AA 2HCIA 1RF2D 2LXKA 1TR5A 2PI2A 4JVZA 5CORA 2ZXOA 1SYCA 1T5EA 2JA9A 1GHKA 1CQFA 3H0GH 1QNUA 4X65L 4C2MH 5M3FB 2PCFB 2EY1A 2TSSA 3NWTA 1N33L 4DV3L 1SROA 3BYYB 1FVIA 1BCPB 1D5MC 3V2TA 3DWAA 4N8X1 5I2YA 4NDXA 1XNQL 4XT3B 2B2TC 4H7BA 4OO1I 1B1ZA 1I94Q 3J80E 3P1HA 2B2VA 3I72A 4A3GB 2EIFA 4TVAB 1KL9A 3QO2A 4P73A 2A69D 1I94L 3MWYW 3VR5A 1KD1C 1KAAA 4BBSH 4DV4L 3KF8A 4B9XA 5HGQA 4BY7G 5C5LA 1CQVA 1WD0A 2CKZB 2EVBA 2ZJPA 5EQ0A 1AFPA 4FF1A 4JYAQ 4R4QA 3TBIB 5GAGC 5IGGA 1PH6A 4DV2Q 2F0OA 2CCZA 2EOTA 2N78A 4QY7A 3DEOA 5ELFA 3SVMA 2B39A 1Q46A 2YTVA 2WAQG 1Q12A 1EY4A 5IGBA 2EJMA 5IP9H 2K5QA 4DXFA 2ASBA 1WVLA 1SE4A 1YJWA 5K36G 1B3QA 1NBWA 1R4PB 1HNXL 4P74A 2FJ2A 3TS0A 3FDTA 1VQPA 3FPPA 4GKJL 1CKOA 4OONA 4R4OA 2BH8A 2N3SA 1KABA 2Q2TA 2RVLA 5CV7A 4DR6L 5ELOA 4UAIA 4H44C 1LO5D 3AU7A 1WTRA 2A69C 5A2QL 4IJLA 1C8CA 2R93G 1QZHA 2BA1A 4K2KA 1AZQA 1K8GA 2K6AA 1JORA 1KDBA 1KIXA 1RDPD 4F8MA 1PFBA 1Q86C 3PGZA 3L9AX 3CMAA 5IYDG 3RMHA 5FLMH 4DU9A 3CCSA 5M3MH 4CKEA 2UXDQ 4IQZA 4A3BG 1NCVA 1OO9B 3GTMH 4JOIA 4R8NA 1PH9A 2B2YA 2IWHA 4HMIA 3K6OA 2K5HA 3R8BA 2NYZD 5IWAL 3NWSA 5JEAJ 1K83H 4B9WA 1F9PA 3FMCA 3OTOL 1CSQA 1EY5A 1PYBA 3M4PA 5IP7G 1W6JA 2K33A 4DUYQ 4X66L 1Q7YC 1KLUD 3SK4A 3N52A 4MZ9A 3GP7A 3S17B 5FO8B 1RL2A 1QJOA 5FKAC 3PIPA 2EYHA 5EPLA 5C3EB 3DM1A 2L11A 2PMZB 1EQTA 4GNXC 4JI1Q 2UUAQ 2E5LL 3HOVB 4KHVA 2O4XA 4BWGB 2OTJA 2R92G 4DR3Q 3H3VI 3QG1A 1L1OC 5HY6A 2N55A 2VUMH 5CV4A 1EIFA 1WCMG 3GTOB 2PW5A 2ES2A 4LF6Q 3S2DH 1Y1VG 1DM0B 3R2IA 2NZ1D 2BDOA 2EYJA 2UU9Q 2B2VC 2JE6I 5D3DA 1A8VA 4I65A 1U4LA 3S1QB 3TREA 3CCRA 3S1MH 3MTSA 1DONA 2VXWA 4DR1Q 4JBKA 1HQMC 1STYA 1KHIA 2J7ZA 1TWHH 1L0WA 4XTCS 1VQ9A 1QUQA 2EYLA 4L8JA 2B2UA 2IT1A 2MQHA 3HOWB 1EWHA 1DOLA 5IGEA 3T13A 3KF6B 2FMMA 3CW2C 4GOPB 4DA2A 4K5VA 5LL6X 3KJPA 1LTBD 1KLGD 4POFA 1VQDA 1PZJD 1Y8PB 1SMXA 1O7ZA 4DAMA 2AKWB 4DN4M 3EBEA 3J7ZC 2Z6KA 4BA1I 4IFDG 1I6HB 5C4JB 4X65Q 1QWYA 3U4VA 2UXCL 4FO2A 2RA4A 3PUZA 5CR3A 5H1SE 1MI2A 3J80L 1B7YB 1EEFD 1PFSA 4AIMA 3HOXB 1OXUA 2QW7A 4JV5Q 4G7OC 1NR4A 3NENA 4RWSC 4LAAA 2JA8H 1Y1WG 2F0NA 5G3LF 1GHJA 3J81i 4CBVA 2HDLA 3IL8A 1DJRD 4NMZA 5M5YH 2LSSA 4CKBA 1HFGA 1E0BA 1JCKB 3GTLB 4K5XA 3S1NB 4PZ7A 5T1GA 3TSSA 5BR8L 1HZBA 1YJNA 3S1RH 1VMCA 4YCUA 3NBHB 4P75A 4S3SA 5J1ZA 4A76A 3KYHC 4HIMA 4B08A 1PH8A 4H0LC 3Q23A 1JJCB 1L2FA 1ONLA 4L63B 5C44G 2JA6H 2IX1A 5DAUA 1NE3A 3HOUB 1JT8A 1O7YA 1EY7A 4P72A 3J81c 4DV7L 1UE7A 2QGQA 4MN3A 1B8AA 3I55A 3QJYA 2CWPA 4DAVA 4RAUC 2F3WA 4IPCA 2BCOA 5JAVA 5EKKA 1WTOA 1PTOD 1Y14B 1VQCA 4A93B 3F2DA 5EJWA 4C1NK 4X64Q 1B9NA 2XRQD 3OWFA 1E2ZA 1VQKA 5ELNA 3V05A 3KOJA 2Y0SE 3KK7A 4KY5A 3R2TA 4C3IB 1A6XA 4IUUA 3UDGA 1BKBA 1O7IA 4Y52H 2LS01 1WTXA 1IBLL 5EKIA 3U50C 4BBRG 2F0DA 1VCIA 1F2YA 4J1MA 3M85A 4GKKL 3I3CA 4A3IH 4LF9Q 1QVFA 3HP3A 4A3GH 3LWUA 4HAEA 1XTDA 3RNUA 3OYYA 1G51A 2Z4HA 2WB1E 3VYUA 3CRKC 1SN8A 1JR0D 2ICEC 5A2QE 3AQQA 2G9DA 1S3OA 4CDDC 4DAYA 4ZKCB 4YY3Q 4NXMQ 1EUJA 2BE5C 4AYBE 5AJ3Q 3CCUA 5LMNL 2F3VA 3VR4A 2IL8A 2ZJQA 3CD6A 4DV5L 4BBSB 1EYGA 4OX9L 2DJFC 4F7XA 3H91A 5C44B 3OWEB 1JE4A 3AYHB 4A3MG 1KTKA 1X3FA 4NB3A 4A3KH 1IW7D 1D5ZC 1X54A 2K50A 4FXGC 4RG1A 2FFKB 3I4MH 4IFDJ 2UUCL 1I4GA 1K3RA 4PG3A 2NWGA 1I4HA 4A3FH 4DR7L 1Q8IA 4R1JA 2L15A 3LWEA 3ZYYX 1SE3A 4QB4A 2SNMA 2F0HA 2B2YC 3CP0A 4KMUC 3D31A 3D6CA 4KI0A 2Z9HA 1G6ZA 1SE8A 3GTKH 5IODA 2IW3A 2HHHQ 4ULLA 2NB0A 3PIOA 1HTLD 1SE2A 5C4XH 3S16H 5CV8A 4DV7Q 1H9SA 2IHFA 2CFMA 2R61A 4C3HG 4OX9Q 4ILWA 3GTQH 1SYFA 4GLXA 3I8ZA 5C0XJ 2R7ZH 1SFOH 2JA5H 1GJXA 1RODA 1GVPA 4WFN3 4CJ2C 4K6DA 1VQAA 3STBD 1B9MA 3I4OA 4TSSA 4JI5Q 3NK9A 4GKKQ 4QUCA 3UI2A 1WOCA 1SYBA 4WRDA 2PNHA 1F2LA 5D3IB 1F2ZA 4DUYL 1IBMQ 3HRZC 3ER0A 2WACA 2B63H 1O7LA 1HR0Q 2KCCA 3K5OA 3NUCA 4AQYQ 2NBFA 4A93G 1LYLA 4KKSA 2HIVA 1NTGA 1RD9D 2L5TA 1ASYA 1H9RA 1YNND 1DXMA 4JI8Q 4CKCA 5G3LD 1NUCA 4FXKC 3CCLA 3G7LA 2M00A 1VQOA 1CHQD 3P7JA 2KENA 4CDFC 5DNFA 4K6LA 2RBMA 1RTOA 4JI7L 3J80c 2B2WC 2ALYB 4OELB 1VQ7A 2WV6D 3S17H 3PIP3 1VQNA 3KDFA 1PRTF 1QCBD 3K5LA 1ESFA 1HZAA 5C3EH 4LMQD 3VYSA 3N6RA 4OIJA 3A8KE 3HOVG 4P71A 3MA2B 4O0AA 2XWJB 4A3BH 3W2DA 2K28A 4C3IG 1G2SA 1Y8OB 3HOZG 1QG7A 2NN6I 1STAA 4DK0A 4DV1Q 2ATWA 4YWLA 4PQXA 1STEA 5NUCA 1E3PA 4K14A 2BOSA 2RQXA 1AP0A 2QKIC 3OOCA 5CYUA 1U4RA 4OWXB 2FXQA 3BVGA 2X6GA 4IPHA 2JA7G 3K5MA 2CQOA 3M7GA 2PQEA 2BA0A 4KKUA 4A3JG 4M1UB 4DV3Q 4C1NI 2M9VA 5L37A 3FEWX 2IPKD 4Y7NH 5E4WC 1XNQQ 1JOQA 2K5DA 3KUPA 1ILQA 1VF5C 1ET6A 4P2CB 3BU2A 4IO9A 2A6HC 4DR2L 2GN5A 4A3DG 4A3GG 4HMJA 3TP7A 1OTCA 3J7AV 3FPUB 4IUPA 1MSGA 4DF7A 1YHQA 2UUAL 3S14B 2I5LX 2I0QA 4LF4L 1AE2A 4AYBG 1IBKL 1X55A 4X3KA 3JC66 1FJGL 1F9QA 1WTHA 3CCEA 5IYCG 1JWMD 3L2PA 2EY2A 1AZPA 4DK1A 4TKOB 4IZ8A 1I3QB 3CMEA 1Z6HA 3CAMA 1UE5A 4ABNA 1E2VA 4C3JG 4NXNL 3OTOQ 3OW2A 3FKIB 4FNFA 2F0SA 4KY7A 4J15A 2NVTH 1MJEA 1LTTD 3ERSX 3RUZA 4Q0FA 1NMFA 2NN6G 1R4QB 2ZTEA 4DAYB 4WJWA 1LTSD 1LACA 3NSWA 3T51B 3I7FA 2NVQH 5A35A 3OHXC 1SNQA 4IPGA 2A1AA 4DK6C 1FGUA 3A55A 1W6KA 1LUZA 1XNRL 3URYA 3ULLA 4ZYSA 5M5YB 1GUOA 2D2CC 5C4XG 2IJ0A 3HGBA 2MUYA 3CU7A 5FJ8G 2KA7A 1WTVA 4ZKBB 1NR2A 3HKZB 3TP6A 3IFTA 4LWCA 2WINB 2D5DA 5CBEE 4JI0L 3HEJA 3HS0C 1TS4A 1WCMH 3HKSA 2RHQB 3L3OC 3K59A 4GN3B 5HGTA 3HOUH 2KQ3A 5LMUQ 3K80C 3CXCA 3RZOB 1E7ZA 1B3AA 1EYAA 1EEID 3D3RA 5JEAG 3H3VH 1SMYC 3TP8A 4DNTB 1ZEQX 1H95A 5IE8A 2EE1A 4LFBQ 1B44D 3Q0AA 1TS5A 1X3PA 4DV4Q 3U9OA 5C3WA 2KHIA 1SYDA 2F0QA 3KLSX 4EVOA 5E3FA 4DGZA 4JV5L 4UPAA 3T53B 4BXXG 4HIKA 1U4PA 4A93H 1KNAA 1OXXK 2JP1A 4DKAC 1K8MA 1FL0A 4L5QA 2ZXRA 1JC7A 5JVG3 1C0AA 3D4WA 3WDNA 4BY1B 4DNIA 3E5SA 4MIUA 3SEBA 1M8AA 1FJGQ 2Q8TA 2B8GA 4LF4Q 1IKMA 1BVSA 1YNJD 4A3IB 4IFDH 4QCLA 4YIJA 1S4ZA 3PUVA 2VNUD 3W5OA 1UNSA 1GD7A 1QE6A 2UXBQ 1YIJA 1MHWC 3RR5A 4U673 2XRSD 1I4XA 1IBKQ 1LT6D 1BCPD 1X3QA 4BBSG 3A74A 1E1TA 2A6EC 2F0UA 1ILPA 2K32A 1TXYA 1YEZA 5C44H 4UHVA 1PTOB 2G5DA 1LTRD 1UEBA 1QVGA 1M1KC 1TKWB 1XJVA 5I2XA 1PH7A 5C0XH 1FGBD 2R7DA 3I4MB 1IXRA 3DWQA 4GN5A 2UUCQ 3RLOA 2KCNA 3K58A 4ZCKA 5GADC 4G4KA 4DAPA 3WOFA 1PH5A 3FHWA 2UUBL 2C9OA 5ELDA 1NMGA 3C1FA 2Q8RE 3BZKA 5IGDA 1DOMA 2KHSA 2ZXPA 5C6AA 4LF5L 3GTKB 4HCSA 4A3KG 4HJ9A 4L5RC 3H0GG 3I90A 2E8GA 4HCEA 1IYUA 3JAMc 2A6HD 4DV1L 2AHOB 2PO4A 1LT5D 3I2ZA 4ALPA 4RMFA 1HUMA 2C5CA 5IP9G 3HOYB 4X66Q 1TWGH 3EN2A 4A3DH 1Z9FA 2HQLA 4JI8L 3G6EA 3C3LA 4R8IA 3DWPA 1JWUD 1KAWA 2A74C 2NVYB 2Z0SA 3NP8A 3JAME 3BG3A 3SK6A 3RN5A 3TMEA 4PNYA 3NQIA 4YCWA 2G9HD 2KUMA 3GTPH 2E2JH 5E4XA 3NTKA 5D14A 2IX0A 2F0FA 1VQGA 1IKLA 1EY9A 1X3GA 1CKNA 2D9UA 2XN9C 4K2LA 5KRUA 2ZM6Q 4A4IA 1EWCA 3DUZA 3BVZA 3S15H 2YV5A 4OO1H 1E24A 2R7ZG 4GZYC 5I9PA 3K5NA 2PMZE 1HPCA 2JYOA 4JI5L 1I50B 2UXCQ 1VQ8A 1E22A 2WAQB 4V190 5E1FA 5LMNQ 3D4DA 3T1HL 4LF8L 2VQFQ 5CV9A 5IT9E 5FO7B 1HA5A 3D8GA 4DV6L 3R3OA 1HCZA 2IX3A 3M4OH 4A3BB 4I7ZC 1EZ6A 4APVA 1JOKA 1LTAD 4BXXH 4KN4C 4BY7B 2I5HA 1B53A 2OT2A 2AWNA 3F2CA 1YBYA 5EAYA 3GO5A 1LABA 2EXDA 1PDQA 2FMCA 5C0XG 5LMNW 2OQKA 4A3MH 1I5FA 3Q22A 3EFXD 3AFQA 4FP5D 1BOSA 4X62L 5DM73 4FYDA 1VQFA 1F2MA 2NVXH 5AJ3L 2HCCA 1IZ6A 5JPNC 2PZWA 4HN7A 1CT1D 1TWCH 2E2IH 3PSIA 1YNXA 5FJ8H 4PV1C 2DNEA 1EU3A 2HDMA 2VS1A 4DUZQ 4DFAA 1SEBD 2B29A 2KVMA 5IYBG 3E9IA 2JN4A 1V1PA 3GTGB 1D1IA 4YY3L 3EQLC 1SXTA 1IBLQ 2XIWA 3MFYA 5CC4A 1Q1EA 3MXGA 2R6GA 4HEDA 4QUFA 1EFWA 4FF4A 2R7FA 1I3QH 1PHJA 4KD3A 3CQZB 1LM0A 3A8JE 4XYOA 2OXPA 5M9OA 4XQJA 4A3LG 4DR6Q 3H0GB 1PVOA 1IYVA 5DLQE 1MD2D 3L0OA 2RDFA 2MO1A 1MGSA 4AQYL 4JI3Q 5IYDH 3T56B 4UDUC 3KBGA 1Z47A 1L0YB 1TY0A 2A8VA 1PRTD 4Z9CB 4C56C 3GD7A 4DV0Q 2A68C 4JOIC 4XDXA 3F8TA 3X3NA 4LFAL 1HZ9A 3OMCA 3HOUG 4QGUA 2MGSA 3PUWA 3CF5A 4NPSA 2DUDA 3BYTB 3VYRA 3I56A 4A3EG 2Z4IA 2Q2UA 5GAHC 2EPBA 4O2DA 4WORA 4F88A 4J6HA 1TS3A 1EIHA 2L0CA 4CDEC 1M4VA 2KHJA 1XMOL 4YWMA 2PQAB 1OXVA 4JI4Q 3CCMA 2JA7H 1V1PB 4AH6A 2OWOA 1R9TB 3K7UC 1Y1WH 3DXJC 2VB3X 1N8RC 4IUQA 4POGA 1CA6A 1KNEA 2K52A 3TN2A 3J81j 2QF7A 2AMCB 4A3LH 4LFBL 4B3TL 2EYPA 1EFID 2EDGA 2JK8A 2LXJA 1VQBA 3NPPA 1XX8A 3K7AH 5JJLA 1EU4A 4AYBB 5HURA 2K03A 1YHAA 1HHVA 2F4VL 1TWAB 3V96A 1WTWA 3A5ZB 1NNXA 1HUNA 3EA6A 1B50A 4DUZL 1EQQA 1BUVT 1K0RA 4IFDI 2EY6A 3KF6A 1S72A 1ENFA 1G6PA 1HNZL 2F4VQ 1B70B 3PUYA 2K04A 3MXUA 3K57A 1A15A 3ITPA 3BDLA 1V1QA 4FF2A 2IHEA 4UP8A 1N32Q 1Q81C 3K81C 1J6QA 3PV0A 1BR9A 1S40A 5IGCA 1EIYB 2O5JC 3DM3A 1PTOH 4LW1A 1O78A 3ND8A 1STGA 1C48A
chains in the Genus database with same CATH topology
4A3JG 4DV3Q 2EIFA 4IPDA 3RZOH 3BJUA 4TVAB 4NXNQ 1KL9A 4Y7NH 1C7YA 1PV4A 3A5UA 4GOPA 1XNQQ 4C3HH 4P73A 1I94L 4X64L 4JC0A 1KD1C 1QUQB 3BU2A 4IO9A 4DR2L 4BBSH 2GN5A 4DV4L 5HGQA 4BY7G 4A3DG 4A3GG 1UWVA 1VQHA 2OCEA 1OTCA 2CKZB 2ZJPA 2UXBL 1KRSA 1YHBA 3PF4A 4A3CH 4JYAQ 4R4QA 5GAGC 3SGIA 1YHQA 4GNXB 2UUAL 1PH6A 4PZ8A 2I5LX 4DV2Q 2K4KA 2CCZA 2N78A 2NZHA 1AE2A 4QY7A 4AYBG 2I0QA 1IBKL 4LF4L 1X55A 2E5LQ 3JC66 1FJGL 3CCEA 5IYCG 2N49A 1Q46A 1YI2A 1L1OB 3AFPA 2ZTCA 3L2PA 2YTVA 3M3YH 4EX5A 2WAQG 3CMEA 4BY1H 1Q12A 3CAMA 1UE5A 4OO1G 1JB7A 5IP9H 1W3SA 4IOAA 4NXNL 2ASBA 3OTOQ 3OW2A 1YJWA 1PYSB 5K36G 1DGSA 4J15A 2NVTH 4HIDA 1MJEA 3ERSX 3HOYH 5FLXc 1NBWA 4DR1L 1NMFA 1SR3A 4LFCL 1HNXL 2NN6G 2ZTEA 4DAYB 4P74A 3TS0A 1HR0L 1VQPA 3I7FA 2NVQH 4GKJL 1CKOA 4OONA 4R4OA 3I4NH 4JBWA 4IPGA 2BH8A 2N3SA 2A1AA 2Q2HA 4DK6C 1FGUA 1XMQL 3AEVA 2Q2TA 3GTOH 1LUZA 4DR6L 5ELOA 3WWVA 3KLWA 1XNRL 3ULLA 2UXDL 4LFCQ 2YTXA 5C4XG 2PI2E 3UDXA 4IJLA 1GM5A 3W1BA 3T1HQ 5FJ8G 2D0OA 2R93G 1QZHA 4LUZA 2BA1A 5FLMG 4JBMA 4LWCA 4JI0L 1K8GA 1Q8KA 2VUMG 2WB1G 3UDIA 1M90C 1WCMH 3HKSA 1KIXA 1K9MC 2RHQB 1BBWA 1Q86C 4GN3B 3RZDH 3HOUH 1JJGA 4A3IG 4BA2I 3PGZA 4KLKA 5LMUQ 3K80C 3CXCA 3CMAA 4HJ5A 1E7ZA 4WJ3M 1CSPA 5JEAG 3TS2A 3W1GA 5IYDG 3H3VH 5FLMH 3CCSA 2UXDQ 3HKZE 5M3MH 1XMQQ 4R4IA 4A3BG 3GTMH 4JOIA 5IE8A 1H95A 1PH9A 4LFBQ 4DV4Q 3HOWG 1V9PA 2K5HA 5IT9c 2KHIA 1VQJA 4PMWA 5IWAL 1VQLA 2D62A 2HHHL 5JEAJ 1I6HH 3HFZB 2QEXA 1K83H 3GDEA 2JQOA 4JV5L 2I5MX 4UPAA 1KRTA 1C9OA 3FKIG 1CSQA 4DK3C 3OTOL 4HIKA 4BXXG 1PYBA 3CCVA 1YJ9A 2HT1A 3M4PA 3S14H 4A93H 5IP7G 1OXXK 3MXNB 3UDFA 1N9WA 4X66L 4DKAC 4DUYQ 1Q7YC 2KCMA 2KCTA 1FL0A 1QVCA 4L5QA 4MZ9A 4BY7H 1KXLA 3L7ZC 1RL2A 1YZ6A 3PIPA 4JI6L 2UU9L 1C0AA 3M9BA 1N36Q 1VS0A 4R4TA 4LF7L 2A19A 3T1YL 1N34L 4DV2L 5E7NA 4DNIA 4JI1Q 4GNXC 2UUAQ 1FJGQ 2E5LL 3FKIH 2K5NA 5GAEC 5M3FH 4YHHQ 4LF4Q 2JEAI 3PO3G 3PO2G 1BVSA 1YVCA 1J5EQ 3IRBA 3Q8DA 2OTJA 2VQFL 4LF8Q 2PQAA 4K0KL 3PUVA 4JI2Q 2R92G 2VNUD 4DR3Q 2N8NA 3H3VI 1L1OC 1U5KA 3F1ZA 3W5OA 2JA6G 5HY6A 1GD7A 4YWKA 1Q1BA 3S2HH 2UXBQ 3B6YA 1YIJA 3RR5A 2VUMH 5JJIA 1EIFA 1WCMG 1IBKQ 1V43A 3CCQA 4BBSG 3A74A 5J3BA 2WFWA 1E1TA 2ES2A 2F52A 4LF6Q 3S2DH 1Y1VG 1KC8C 4JI1L 2NZOA 1J5EL 1TXYA 1YEZA 4JBJA 3CPFA 5C44H 4YHHL 3KJOA 1PA6A 3RN2A 1UEBA 1X6OA 1QVGA 2UU9Q 2JE6I 1M1KC 1VQ5A 2JEBI 2Z6KC 1XJVA 3UE0A 1MKHA 2ZJRA 1A8VA 1PH7A 1KQSA 1N36L 3PCOB 3GTGH 1I50H 3TREA 2R7DA 3CCRA 1HR0W 3KFUA 3M7NA 3S1MH 1IXRA 4GN5A 4DR1Q 2UUCQ 3RLOA 4JBKA 4QIWE 3F2BA 1PH2A 5GADC 1KHIA 2XTIA 3A0JA 3CQZH 4OWWB 1A62A 1TWHH 1N33Q 1PH5A 3PF5A 3FHWA 4XTCS 4YCVA 1L0WA 2UUBL 1VQ9A 1QUQA 3TQYA 2IT1A 2MQHA 1VQEA 1NMGA 3JAMi 3KF6B 3BZKA 3CW2C 4GOPB 3LGJA 4MTNA 3KJPA 3CCJA 1G291 4LF5L 2F3IA 4A3KG 4DR4L 1WFQA 1VQDA 3K0XA 1P16A 4POFA 1EWIA 4HJ9A 2D0PA 3H0GG 4L5RC 2E8GA 3I4NG 5C0XI 3JAMc 4B3MQ 4DV1L 2JA5G 4DR3L 2AHOB 3RLNA 1SMXA 4DAMA 4HJ8A 4C3IH 2AKWB 4JYAL 4NXML 1CUKA 3EBEA 3J7ZC 2Z6KA 4BA1I 2MNAA 4IFDG 4X62Q 4X65Q 3U4VA 3I2ZA 2UXCL 4ALPA 4RMFA 4JI0Q 1BBUA 3PUZA 5H1SE 5IP9G 3K8AA 4X66Q 4JG2A 3CC4A 1B7YB 1TWGH 3EN2A 4LFAQ 1PFSA 4A3DH 4DR4Q 5GROA 1Z9FA 4AIMA 3KDFB 4H02A 4B3SL 4B3TQ 1OXUA 2HQLA 4JI8L 3S24A 3G6EA 4TQUS 4JV5Q 4GN4B 2ZM6L 1KAWA 3NENA 2JA8H 2Z0SA 1Y1WG 3RN5A 3J81i 1UE1A 4KHPL 4YCWA 4JI3L 1W2BA 3GTPH 3HOVH 4QL5A 5M5YH 2LSSA 3CPWA 2E2JH 1IBML 4A3FG 2IX0A 2XGTA 2K14A 1VQGA 2JJQA 1YITA 4PZ7A 1X3GA 2GVBA 1CKNA 5BR8L 1HZBA 3G71A 2VQEL 4DV6Q 3ZJYC 3S1RH 1YJNA 4LNQA 4GLAC 2K5VA 4YCUA 3NBHB 4P75A 4A76A 2RHSB 3KYHC 1SLJA 3HKZG 2ZM6Q 4A4IA 4HIMA 1XPRA 1HNWL 3S15H 2YV5A 1CKMA 2HIXA 2VL6A 3ULPA 2BH2A 1PH8A 3U58A 1E24A 1JJCB 1L2FA 5C44G 2JA6H 2IX1A 2R7ZG 1NE3A 4GOPC 4B3SQ 1AE3A 2PMZE 1JT8A 2RF4A 4DV0L 4P72A 3J81c 1OXTA 4JI5L 2E2HH 4IOCA 4DV7L 2OTLA 1UE7A 2QGQA 2WAQE 1NJIC 5M3FG 1K73C 1E22A 1VQ8A 2UXCQ 1B8AA 5LMNQ 3T1HL 1WJJA 3I55A 4HJAA 2CWPA 2VQFQ 4LF8L 4K0KQ 3KF8B 2WP8J 3E9HA 1D8LA 4WJ4A 1Q82C 2VW9A 2VZAA 5BR8Q 4DV6L 3HOYG 4IPCA 3VDYA 3PO3H 2YYZA 3M4OH 3T1YQ 4BBRH 3G4SA 2MFIA 3U4ZA 2H5XA 1Y14B 3BZCA 4DPGA 1VQCA 4BY1G 3STBC 4APVA 3F2DA 3ULJA 4X64Q 1HNXQ 1VQ6A 4BXXH 1VQKA 3HOXG 5ELNA 4EQ5A 2I5HA 3KOJA 2QA4A 2B63G 2Y0SE 3G48A 1QZGA 2AWNA 3UDGA 1BKBA 1O7IA 3F2CA 1AH9A 4Y52H 1IBLL 1YBYA 5EAYA 3U50C 5C4JH 3GO5A 4BBRG 2EXDA 1VCIA 1OXSC 4QJFA 2C35B 3M85A 4GKKL 4A3IH 4LF9Q 5C0XG 5LMNW 1QVFA 2OQKA 4A3MH 2YTYA 4A3GH 1XTDA 1I5FA 3RNUA 1HZCA 4JCVE 3OYYA 4IJHA 1G51A 1Y1VH 1GO3E 3AFQA 2WB1E 3HOZH 2RCNA 4X62L 1SN8A 3AQQA 1VQFA 1R9TH 1S3OA 4YY3Q 4L5SA 4NXMQ 2NVYH 4FDBA 1EUJA 2NVXH 4AYBE 5AJ3Q 5AJ3L 3CCUA 5LMNL 4LF6L 3PO2H 2ZJQA 3CD6A 1IZ6A 4DV5L 3PUXA 1EYGA 1HNZQ 4DR2Q 4OX9L 4B3RQ 4GNXA 1VQ4A 1SRUA 1ASZA 4UP9A 4LF9L 3AYHB 4A3MG 1WI5A 1TWCH 2E2IH 3PSIA 1YNXA 5FJ8H 3S1NH 1X56A 1EQRA 1X3FA 2VS1A 4NB3A 4DUZQ 2B29A 5IYBG 4A3KH 1L1OA 3E9IA 3M4QA 4UY8C 1X54A 5GQOA 1MIUA 2K75A 2K50A 4YY3L 3S1QH 3I4MH 1E1OA 4RG1A 4IFDJ 2UUCL 1IBLQ 4JI7Q 1TWAH 1Q1EA 1K3RA 2R6GA 4PG3A 1EFWA 4PZ6A 2R7FA 3CC7A 1EOVA 1I3QH 1T9HA 4HJ7A 4A3FH 1PHJA 4L5TA 4LF7Q 4DR7L 1LM0A 2VQEQ 5IP7H 3D0FA 5IY0A 4R1JA 4A3LG 1RIPA 4DR6Q 2L15A 1PVOA 3HOWH 1N32L 5DLQE 2R92H 3L0OA 3CP0A 1NY4A 1GKHA 4A3CG 2IY5B 2GVAA 3D31A 1A0IA 4ME3A 2MO1A 4AQYL 4KI0A 4A75A 1WYDA 1IYJB 4JI3Q 1SE8A 3GTKH 5IYDH 2VY3A 1A63A 1Z47A 1XPOA 1P8LA 4KHZA 2HHHQ 4DR5L 3PIOA 3CC2A 5IYCH 5C4XH 3S16H 1XMOQ 4DV7Q 2IHFA 2A8VA 2CFMA 3GD7A 2AWOA 4DV0Q 4OX9Q 4JOIC 4B3RL 1X3EA 4R4CA 3GTQH 3F8TA 4JI2L 4GLXA 4LFAL 1HZ9A 5C0XJ 4A3JH 3RLFA 4QQBX 3HOUG 2R7ZH 1SFOH 2B3GA 2Q2IA 5M5XH 3HOXH 1GVPA 4QGUA 2JA5H 1TWFH 3PUWA 3CF5A 4NPSA 4JI6Q 4GS3A 1VQAA 3STBD 2DUDA 3I4OA 5M3MG 2KBNA 1HH2P 4JI5Q 3I56A 4A3EG 1PH3A 4GKKQ 2Y0SG 2Q2UA 5GAHC 1WOCA 3NEMA 3MEFA 4MNOA 2PNHA 4O2DA 4DUYL 1IBMQ 2OQ0A 5IYBH 1X9NA 3ER0A 1LTLA 3GTLH 3TRZA 2B63H 2KHJA 1HR0Q 1XMOL 1HJPA 4YWMA 2PQAB 1OXVA 5IWAQ 1JJ2A 4OWTB 4JI4L 3EIVA 4JI4Q 3CCMA 4DR5Q 2JA7H 4AH6A 2OWOA 4AQYQ 1IL2A 2ID0A 4A93G 3K7UC 1Y1WH 1N8RC 3DLLA 1LYLA 2DGYA 2HIVA 1NTGA 2MO0A 1K8AC 1CKNB 2K52A 4POGA 3J81j 1XNRQ 2AMCB 4A3LH 4OXPA 4LFBL 3NELA 1ASYA 4B3TL 3FP9A 5C3EG 2V1CC 4JI8Q 4DR7Q 1X65A 5LMUL 3CCLA 2JK8A 2LXJA 1PH4A 1VQOA 4GKJQ 2R93H 3J80i 1PH1A 3ICEA 1VQBA 2KENA 2YU9H 3K7AH 5M5WH 4KHPQ 5JJKA 5JJLA 2JA8G 4GLVB 3GTJH 1U0LA 2CWAA 3E0EA 1YHAA 4JI7L 1MJCA 1XPUA 3J80c 1VQ7A 2ALYB 2F4VL 1D7QA 3S17H 1VQNA 3KDFA 3A5ZB 2LXKA 4B3ML 3UE1A 2PI2A 1HZAA 5C3EH 4DUZL 4UP7A 2JA9A 3TEHB 1EQQA 3HOVG 4P71A 1K0RA 3H0GH 4O0AA 4IFDI 3KF6A 4C2MH 4X65L 1S72A 4LF5Q 1G6PA 4XIGS 4A3BH 3H15A 3I4MG 1HNZL 4C3JH 1HNWQ 4DV5Q 3HOZG 2F4VQ 1B70B 1N33L 3PUYA 2NN6I 1SROA 4DV3L 4HIOA 4DV1Q 1FVIA 2ATWA 4YWLA 1JE5A 1V1QA 4A3EH 2IHEA 4UP8A 3J7A5 1E3PA 1N32Q 1VQMA 1JMCA 1Q81C 1N34Q 2ZTDA 1XNQL 3K81C 1J6QA 3PV0A 4OWXB 1S40A 1I94Q 1EIYB 4OO1I 1VQIA 2FXQA 2EQSA 3DM3A 4LUVA 4LW1A 2UUBQ 4IPHA 2JA7G 2CQOA 4LUOA 4X6AH 1UE6A 2BA0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3J G;  4DV3 Q;  2EIF A;  4IPD A;  3RZO H;  3BJU A;  4TVA B;  4NXN Q;  1KL9 A;  4Y7N H;  1C7Y A;  1PV4 A;  3A5U A;  4GOP A;  1XNQ Q;  4C3H H;  4P73 A;  1I94 L;  4X64 L;  4JC0 A;  1KD1 C;  1QUQ B;  3BU2 A;  4IO9 A;  4DR2 L;  4BBS H;  2GN5 A;  4DV4 L;  5HGQ A;  4BY7 G;  4A3D G;  4A3G G;  1UWV A;  1VQH A;  2OCE A;  1OTC A;  2CKZ B;  2ZJP A;  2UXB L;  1KRS A;  1YHB A;  3PF4 A;  4A3C H;  4JYA Q;  4R4Q A;  5GAG C;  3SGI A;  1YHQ A;  4GNX B;  2UUA L;  1PH6 A;  4PZ8 A;  2I5L X;  4DV2 Q;  2K4K A;  2CCZ A;  2N78 A;  2NZH A;  1AE2 A;  4QY7 A;  4AYB G;  2I0Q A;  1IBK L;  4LF4 L;  1X55 A;  2E5L Q;  3JC6 6;  1FJG L;  3CCE A;  5IYC G;  2N49 A;  1Q46 A;  1YI2 A;  1L1O B;  3AFP A;  2ZTC A;  3L2P A;  2YTV A;  3M3Y H;  4EX5 A;  2WAQ G;  3CME A;  4BY1 H;  1Q12 A;  3CAM A;  1UE5 A;  4OO1 G;  1JB7 A;  5IP9 H;  1W3S A;  4IOA A;  4NXN L;  2ASB A;  3OTO Q;  3OW2 A;  1YJW A;  1PYS B;  5K36 G;  1DGS A;  4J15 A;  2NVT H;  4HID A;  1MJE A;  3ERS X;  3HOY H;  5FLX c;  1NBW A;  4DR1 L;  1NMF A;  1SR3 A;  4LFC L;  1HNX L;  2NN6 G;  2ZTE A;  4DAY B;  4P74 A;  3TS0 A;  1HR0 L;  1VQP A;  3I7F A;  2NVQ H;  4GKJ L;  1CKO A;  4OON A;  4R4O A;  3I4N H;  4JBW A;  4IPG A;  2BH8 A;  2N3S A;  2A1A A;  2Q2H A;  4DK6 C;  1FGU A;  1XMQ L;  3AEV A;  2Q2T A;  3GTO H;  1LUZ A;  4DR6 L;  5ELO A;  3WWV A;  3KLW A;  1XNR L;  3ULL A;  2UXD L;  4LFC Q;  2YTX A;  5C4X G;  2PI2 E;  3UDX A;  4IJL A;  1GM5 A;  3W1B A;  3T1H Q;  5FJ8 G;  2D0O A;  2R93 G;  1QZH A;  4LUZ A;  2BA1 A;  5FLM G;  4JBM A;  4LWC A;  4JI0 L;  1K8G A;  1Q8K A;  2VUM G;  2WB1 G;  3UDI A;  1M90 C;  1WCM H;  3HKS A;  1KIX A;  1K9M C;  2RHQ B;  1BBW A;  1Q86 C;  4GN3 B;  3RZD H;  3HOU H;  1JJG A;  4A3I G;  4BA2 I;  3PGZ A;  4KLK A;  5LMU Q;  3K80 C;  3CXC A;  3CMA A;  4HJ5 A;  1E7Z A;  4WJ3 M;  1CSP A;  5JEA G;  3TS2 A;  3W1G A;  5IYD G;  3H3V H;  5FLM H;  3CCS A;  2UXD Q;  3HKZ E;  5M3M H;  1XMQ Q;  4R4I A;  4A3B G;  3GTM H;  4JOI A;  5IE8 A;  1H95 A;  1PH9 A;  4LFB Q;  4DV4 Q;  3HOW G;  1V9P A;  2K5H A;  5IT9 c;  2KHI A;  1VQJ A;  4PMW A;  5IWA L;  1VQL A;  2D62 A;  2HHH L;  5JEA J;  1I6H H;  3HFZ B;  2QEX A;  1K83 H;  3GDE A;  2JQO A;  4JV5 L;  2I5M X;  4UPA A;  1KRT A;  1C9O A;  3FKI G;  1CSQ A;  4DK3 C;  3OTO L;  4HIK A;  4BXX G;  1PYB A;  3CCV A;  1YJ9 A;  2HT1 A;  3M4P A;  3S14 H;  4A93 H;  5IP7 G;  1OXX K;  3MXN B;  3UDF A;  1N9W A;  4X66 L;  4DKA C;  4DUY Q;  1Q7Y C;  2KCM A;  2KCT A;  1FL0 A;  1QVC A;  4L5Q A;  4MZ9 A;  4BY7 H;  1KXL A;  3L7Z C;  1RL2 A;  1YZ6 A;  3PIP A;  4JI6 L;  2UU9 L;  1C0A A;  3M9B A;  1N36 Q;  1VS0 A;  4R4T A;  4LF7 L;  2A19 A;  3T1Y L;  1N34 L;  4DV2 L;  5E7N A;  4DNI A;  4JI1 Q;  4GNX C;  2UUA Q;  1FJG Q;  2E5L L;  3FKI H;  2K5N A;  5GAE C;  5M3F H;  4YHH Q;  4LF4 Q;  2JEA I;  3PO3 G;  3PO2 G;  1BVS A;  1YVC A;  1J5E Q;  3IRB A;  3Q8D A;  2OTJ A;  2VQF L;  4LF8 Q;  2PQA A;  4K0K L;  3PUV A;  4JI2 Q;  2R92 G;  2VNU D;  4DR3 Q;  2N8N A;  3H3V I;  1L1O C;  1U5K A;  3F1Z A;  3W5O A;  2JA6 G;  5HY6 A;  1GD7 A;  4YWK A;  1Q1B A;  3S2H H;  2UXB Q;  3B6Y A;  1YIJ A;  3RR5 A;  2VUM H;  5JJI A;  1EIF A;  1WCM G;  1IBK Q;  1V43 A;  3CCQ A;  4BBS G;  3A74 A;  5J3B A;  2WFW A;  1E1T A;  2ES2 A;  2F52 A;  4LF6 Q;  3S2D H;  1Y1V G;  1KC8 C;  4JI1 L;  2NZO A;  1J5E L;  1TXY A;  1YEZ A;  4JBJ A;  3CPF A;  5C44 H;  4YHH L;  3KJO A;  1PA6 A;  3RN2 A;  1UEB A;  1X6O A;  1QVG A;  2UU9 Q;  2JE6 I;  1M1K C;  1VQ5 A;  2JEB I;  2Z6K C;  1XJV A;  3UE0 A;  1MKH A;  2ZJR A;  1A8V A;  1PH7 A;  1KQS A;  1N36 L;  3PCO B;  3GTG H;  1I50 H;  3TRE A;  2R7D A;  3CCR A;  1HR0 W;  3KFU A;  3M7N A;  3S1M H;  1IXR A;  4GN5 A;  4DR1 Q;  2UUC Q;  3RLO A;  4JBK A;  4QIW E;  3F2B A;  1PH2 A;  5GAD C;  1KHI A;  2XTI A;  3A0J A;  3CQZ H;  4OWW B;  1A62 A;  1TWH H;  1N33 Q;  1PH5 A;  3PF5 A;  3FHW A;  4XTC S;  4YCV A;  1L0W A;  2UUB L;  1VQ9 A;  1QUQ A;  3TQY A;  2IT1 A;  2MQH A;  1VQE A;  1NMG A;  3JAM i;  3KF6 B;  3BZK A;  3CW2 C;  4GOP B;  3LGJ A;  4MTN A;  3KJP A;  3CCJ A;  1G29 1;  4LF5 L;  2F3I A;  4A3K G;  4DR4 L;  1WFQ A;  1VQD A;  3K0X A;  1P16 A;  4POF A;  1EWI A;  4HJ9 A;  2D0P A;  3H0G G;  4L5R C;  2E8G A;  3I4N G;  5C0X I;  3JAM c;  4B3M Q;  4DV1 L;  2JA5 G;  4DR3 L;  2AHO B;  3RLN A;  1SMX A;  4DAM A;  4HJ8 A;  4C3I H;  2AKW B;  4JYA L;  4NXM L;  1CUK A;  3EBE A;  3J7Z C;  2Z6K A;  4BA1 I;  2MNA A;  4IFD G;  4X62 Q;  4X65 Q;  3U4V A;  3I2Z A;  2UXC L;  4ALP A;  4RMF A;  4JI0 Q;  1BBU A;  3PUZ A;  5H1S E;  5IP9 G;  3K8A A;  4X66 Q;  4JG2 A;  3CC4 A;  1B7Y B;  1TWG H;  3EN2 A;  4LFA Q;  1PFS A;  4A3D H;  4DR4 Q;  5GRO A;  1Z9F A;  4AIM A;  3KDF B;  4H02 A;  4B3S L;  4B3T Q;  1OXU A;  2HQL A;  4JI8 L;  3S24 A;  3G6E A;  4TQU S;  4JV5 Q;  4GN4 B;  2ZM6 L;  1KAW A;  3NEN A;  2JA8 H;  2Z0S A;  1Y1W G;  3RN5 A;  3J81 i;  1UE1 A;  4KHP L;  4YCW A;  4JI3 L;  1W2B A;  3GTP H;  3HOV H;  4QL5 A;  5M5Y H;  2LSS A;  3CPW A;  2E2J H;  1IBM L;  4A3F G;  2IX0 A;  2XGT A;  2K14 A;  1VQG A;  2JJQ A;  1YIT A;  4PZ7 A;  1X3G A;  2GVB A;  1CKN A;  5BR8 L;  1HZB A;  3G71 A;  2VQE L;  4DV6 Q;  3ZJY C;  3S1R H;  1YJN A;  4LNQ A;  4GLA C;  2K5V A;  4YCU A;  3NBH B;  4P75 A;  4A76 A;  2RHS B;  3KYH C;  1SLJ A;  3HKZ G;  2ZM6 Q;  4A4I A;  4HIM A;  1XPR A;  1HNW L;  3S15 H;  2YV5 A;  1CKM A;  2HIX A;  2VL6 A;  3ULP A;  2BH2 A;  1PH8 A;  3U58 A;  1E24 A;  1JJC B;  1L2F A;  5C44 G;  2JA6 H;  2IX1 A;  2R7Z G;  1NE3 A;  4GOP C;  4B3S Q;  1AE3 A;  2PMZ E;  1JT8 A;  2RF4 A;  4DV0 L;  4P72 A;  3J81 c;  1OXT A;  4JI5 L;  2E2H H;  4IOC A;  4DV7 L;  2OTL A;  1UE7 A;  2QGQ A;  2WAQ E;  1NJI C;  5M3F G;  1K73 C;  1E22 A;  1VQ8 A;  2UXC Q;  1B8A A;  5LMN Q;  3T1H L;  1WJJ A;  3I55 A;  4HJA A;  2CWP A;  2VQF Q;  4LF8 L;  4K0K Q;  3KF8 B;  2WP8 J;  3E9H A;  1D8L A;  4WJ4 A;  1Q82 C;  2VW9 A;  2VZA A;  5BR8 Q;  4DV6 L;  3HOY G;  4IPC A;  3VDY A;  3PO3 H;  2YYZ A;  3M4O H;  3T1Y Q;  4BBR H;  3G4S A;  2MFI A;  3U4Z A;  2H5X A;  1Y14 B;  3BZC A;  4DPG A;  1VQC A;  4BY1 G;  3STB C;  4APV A;  3F2D A;  3ULJ A;  4X64 Q;  1HNX Q;  1VQ6 A;  4BXX H;  1VQK A;  3HOX G;  5ELN A;  4EQ5 A;  2I5H A;  3KOJ A;  2QA4 A;  2B63 G;  2Y0S E;  3G48 A;  1QZG A;  2AWN A;  3UDG A;  1BKB A;  1O7I A;  3F2C A;  1AH9 A;  4Y52 H;  1IBL L;  1YBY A;  5EAY A;  3U50 C;  5C4J H;  3GO5 A;  4BBR G;  2EXD A;  1VCI A;  1OXS C;  4QJF A;  2C35 B;  3M85 A;  4GKK L;  4A3I H;  4LF9 Q;  5C0X G;  5LMN W;  1QVF A;  2OQK A;  4A3M H;  2YTY A;  4A3G H;  1XTD A;  1I5F A;  3RNU A;  1HZC A;  4JCV E;  3OYY A;  4IJH A;  1G51 A;  1Y1V H;  1GO3 E;  3AFQ A;  2WB1 E;  3HOZ H;  2RCN A;  4X62 L;  1SN8 A;  3AQQ A;  1VQF A;  1R9T H;  1S3O A;  4YY3 Q;  4L5S A;  4NXM Q;  2NVY H;  4FDB A;  1EUJ A;  2NVX H;  4AYB E;  5AJ3 Q;  5AJ3 L;  3CCU A;  5LMN L;  4LF6 L;  3PO2 H;  2ZJQ A;  3CD6 A;  1IZ6 A;  4DV5 L;  3PUX A;  1EYG A;  1HNZ Q;  4DR2 Q;  4OX9 L;  4B3R Q;  4GNX A;  1VQ4 A;  1SRU A;  1ASZ A;  4UP9 A;  4LF9 L;  3AYH B;  4A3M G;  1WI5 A;  1TWC H;  2E2I H;  3PSI A;  1YNX A;  5FJ8 H;  3S1N H;  1X56 A;  1EQR A;  1X3F A;  2VS1 A;  4NB3 A;  4DUZ Q;  2B29 A;  5IYB G;  4A3K H;  1L1O A;  3E9I A;  3M4Q A;  4UY8 C;  1X54 A;  5GQO A;  1MIU A;  2K75 A;  2K50 A;  4YY3 L;  3S1Q H;  3I4M H;  1E1O A;  4RG1 A;  4IFD J;  2UUC L;  1IBL Q;  4JI7 Q;  1TWA H;  1Q1E A;  1K3R A;  2R6G A;  4PG3 A;  1EFW A;  4PZ6 A;  2R7F A;  3CC7 A;  1EOV A;  1I3Q H;  1T9H A;  4HJ7 A;  4A3F H;  1PHJ A;  4L5T A;  4LF7 Q;  4DR7 L;  1LM0 A;  2VQE Q;  5IP7 H;  3D0F A;  5IY0 A;  4R1J A;  4A3L G;  1RIP A;  4DR6 Q;  2L15 A;  1PVO A;  3HOW H;  1N32 L;  5DLQ E;  2R92 H;  3L0O A;  3CP0 A;  1NY4 A;  1GKH A;  4A3C G;  2IY5 B;  2GVA A;  3D31 A;  1A0I A;  4ME3 A;  2MO1 A;  4AQY L;  4KI0 A;  4A75 A;  1WYD A;  1IYJ B;  4JI3 Q;  1SE8 A;  3GTK H;  5IYD H;  2VY3 A;  1A63 A;  1Z47 A;  1XPO A;  1P8L A;  4KHZ A;  2HHH Q;  4DR5 L;  3PIO A;  3CC2 A;  5IYC H;  5C4X H;  3S16 H;  1XMO Q;  4DV7 Q;  2IHF A;  2A8V A;  2CFM A;  3GD7 A;  2AWO A;  4DV0 Q;  4OX9 Q;  4JOI C;  4B3R L;  1X3E A;  4R4C A;  3GTQ H;  3F8T A;  4JI2 L;  4GLX A;  4LFA L;  1HZ9 A;  5C0X J;  4A3J H;  3RLF A;  4QQB X;  3HOU G;  2R7Z H;  1SFO H;  2B3G A;  2Q2I A;  5M5X H;  3HOX H;  1GVP A;  4QGU A;  2JA5 H;  1TWF H;  3PUW A;  3CF5 A;  4NPS A;  4JI6 Q;  4GS3 A;  1VQA A;  3STB D;  2DUD A;  3I4O A;  5M3M G;  2KBN A;  1HH2 P;  4JI5 Q;  3I56 A;  4A3E G;  1PH3 A;  4GKK Q;  2Y0S G;  2Q2U A;  5GAH C;  1WOC A;  3NEM A;  3MEF A;  4MNO A;  2PNH A;  4O2D A;  4DUY L;  1IBM Q;  2OQ0 A;  5IYB H;  1X9N A;  3ER0 A;  1LTL A;  3GTL H;  3TRZ A;  2B63 H;  2KHJ A;  1HR0 Q;  1XMO L;  1HJP A;  4YWM A;  2PQA B;  1OXV A;  5IWA Q;  1JJ2 A;  4OWT B;  4JI4 L;  3EIV A;  4JI4 Q;  3CCM A;  4DR5 Q;  2JA7 H;  4AH6 A;  2OWO A;  4AQY Q;  1IL2 A;  2ID0 A;  4A93 G;  3K7U C;  1Y1W H;  1N8R C;  3DLL A;  1LYL A;  2DGY A;  2HIV A;  1NTG A;  2MO0 A;  1K8A C;  1CKN B;  2K52 A;  4POG A;  3J81 j;  1XNR Q;  2AMC B;  4A3L H;  4OXP A;  4LFB L;  3NEL A;  1ASY A;  4B3T L;  3FP9 A;  5C3E G;  2V1C C;  4JI8 Q;  4DR7 Q;  1X65 A;  5LMU L;  3CCL A;  2JK8 A;  2LXJ A;  1PH4 A;  1VQO A;  4GKJ Q;  2R93 H;  3J80 i;  1PH1 A;  3ICE A;  1VQB A;  2KEN A;  2YU9 H;  3K7A H;  5M5W H;  4KHP Q;  5JJK A;  5JJL A;  2JA8 G;  4GLV B;  3GTJ H;  1U0L A;  2CWA A;  3E0E A;  1YHA A;  4JI7 L;  1MJC A;  1XPU A;  3J80 c;  1VQ7 A;  2ALY B;  2F4V L;  1D7Q A;  3S17 H;  1VQN A;  3KDF A;  3A5Z B;  2LXK A;  4B3M L;  3UE1 A;  2PI2 A;  1HZA A;  5C3E H;  4DUZ L;  4UP7 A;  2JA9 A;  3TEH B;  1EQQ A;  3HOV G;  4P71 A;  1K0R A;  3H0G H;  4O0A A;  4IFD I;  3KF6 A;  4C2M H;  4X65 L;  1S72 A;  4LF5 Q;  1G6P A;  4XIG S;  4A3B H;  3H15 A;  3I4M G;  1HNZ L;  4C3J H;  1HNW Q;  4DV5 Q;  3HOZ G;  2F4V Q;  1B70 B;  1N33 L;  3PUY A;  2NN6 I;  1SRO A;  4DV3 L;  4HIO A;  4DV1 Q;  1FVI A;  2ATW A;  4YWL A;  1JE5 A;  1V1Q A;  4A3E H;  2IHE A;  4UP8 A;  3J7A 5;  1E3P A;  1N32 Q;  1VQM A;  1JMC A;  1Q81 C;  1N34 Q;  2ZTD A;  1XNQ L;  3K81 C;  1J6Q A;  3PV0 A;  4OWX B;  1S40 A;  1I94 Q;  1EIY B;  4OO1 I;  1VQI A;  2FXQ A;  2EQS A;  3DM3 A;  4LUV A;  4LW1 A;  2UUB Q;  4IPH A;  2JA7 G;  2CQO A;  4LUO A;  4X6A H;  1UE6 A;  2BA0 A; 
#chains in the Genus database with same CATH topology
 3WOE A;  5M5X B;  2CVR A;  3BJU A;  4NXN Q;  3HOZ B;  1C7Y A;  1PV4 A;  5M3M B;  4GOP A;  1I4P A;  3GTM B;  2F0V A;  2DY8 A;  3ND9 A;  3S9W A;  1QUQ B;  2B8F A;  4NP5 A;  2B2T A;  1UWV A;  1VQH A;  1KRS A;  1K83 B;  4A3C H;  3SGI A;  4KKT A;  2CH4 A;  4PZ8 A;  1HQR D;  4LK1 C;  2E5L Q;  2J0T D;  4ZLT F;  2OF1 A;  2N49 A;  4KN7 C;  1L1O B;  2B2U C;  2ZTC A;  3M3Y H;  4EX5 A;  2WKC A;  1PZI D;  4OO1 G;  1W3S A;  3NBI A;  4IOA A;  1CI3 M;  1Q90 A;  5M5W B;  4XQQ A;  3GTJ B;  4HID A;  3HOY H;  5FLX c;  1LT4 D;  1TWG B;  4IUV A;  4LFC L;  1CTM A;  1GUG A;  1HR0 L;  1SNP A;  1I4R A;  1Y69 U;  4ME5 A;  3I4N H;  2F0E A;  2F0K A;  2RCF A;  3AEV A;  1XMQ L;  2Q2H A;  3GTO H;  1A2U A;  1LV9 A;  1ML0 D;  3KLW A;  4C2M B;  2UXD L;  4LFC Q;  1FNW A;  5KGU A;  2E2J B;  3G6J B;  1XTC D;  1U9R A;  3UDX A;  2ICI A;  1GM5 A;  4A3J B;  1PRT B;  2QIL A;  2K5W A;  4LUZ A;  1TWF B;  4JBM A;  3H3V C;  2L1B A;  4X3S A;  3OIP A;  3S15 B;  1WTP A;  4EQP A;  2VUM G;  2WB1 G;  1S5D D;  1K9M C;  1TWH B;  3BVM A;  1BBW A;  1JJG A;  1B4O A;  1HA6 A;  2F0I A;  3NHH A;  1A2T A;  4HJ5 A;  1C4Q A;  1CSP A;  2JXM B;  1STB A;  3VR3 A;  5C3X A;  3HKZ E;  4R4I A;  1CK1 A;  3HOW G;  4OIK A;  1V9P A;  4DXG A;  1BQQ T;  5IT9 c;  4CJ1 B;  1VQL A;  3H6M A;  3HFZ B;  1I6H H;  2HD3 A;  3VR2 A;  2JQO A;  2I5M X;  1KRT A;  1C9O A;  3FKI G;  5AFW A;  4KV6 A;  4X3T A;  5CV5 A;  2HT1 A;  1BDO A;  5DM6 3;  3UDF A;  1N9W A;  2KCM A;  2KCT A;  1QVC A;  4BY7 H;  4BS9 A;  1FR3 A;  3L7Z C;  2UU9 L;  4XXE A;  2A19 A;  3T1Y L;  5EBD A;  1N34 L;  4O1N A;  5E7N A;  1Q3L A;  2K5N A;  5GAE C;  2L9H A;  2XVS A;  4YHH Q;  3PO3 G;  1YVC A;  1J5E Q;  3IRB A;  3Q8D A;  4HR7 B;  5J39 A;  2VQF L;  2PQA A;  4A3M B;  4LF8 Q;  4HTH A;  3TZU A;  2F1M A;  1IW7 C;  4A3E B;  2NTT A;  3KLR A;  5BN4 A;  3KLS A;  1V43 A;  2NVX B;  5J3B A;  1KC8 C;  4JI1 L;  1PA6 A;  1VF7 A;  3CPF A;  3KJO A;  2JA6 B;  4KK7 A;  3BS1 A;  1TWC B;  2E2I B;  1VQ5 A;  1PXU A;  2QDB A;  2Z6K C;  1KQS A;  1SBB B;  1N36 L;  3GTG H;  1U4M A;  1SDF A;  1G8Z D;  4C3H B;  2VB2 X;  4RKB A;  1D6E C;  2K05 A;  3OIQ A;  4JK1 C;  1D1K A;  3EVQ A;  3A0J A;  3CQZ H;  3E0J A;  1A62 A;  3T4A C;  4U68 A;  4OWW B;  2X6L A;  2A73 B;  4RHS A;  3AMU A;  2J4X A;  3TQY A;  1VQE A;  3JAM i;  5TSS A;  1H9M A;  2AQ1 B;  4MTN A;  4DR4 L;  1WFQ A;  3D4R A;  4BA2 I;  1P16 A;  5T1I A;  1RCV D;  3A7L A;  5C0X I;  4B3M Q;  2JA5 G;  4DR3 L;  1SYG A;  3RLN A;  4HJ8 A;  4C3I H;  4NXM L;  1CUK A;  4ODG A;  2CH4 W;  3GV6 A;  5IGF A;  1FNU A;  1FNV A;  1PLF A;  1V1O A;  3OSO A;  3GQB A;  4N8F A;  3C1E A;  4JG2 A;  3CC4 A;  1BNZ A;  1PFN A;  2B2W A;  1LTI D;  5GRO A;  4B3S L;  4K8J A;  3KDF B;  1SAP A;  4H02 A;  3F2U A;  3S24 A;  4TQU S;  5FOB B;  1EYD A;  4ZUI A;  3IKJ A;  4OHJ A;  1F9R A;  1UUP A;  1GUT A;  3SXH A;  4KHP L;  3A54 A;  4JI3 L;  3HOV H;  4QL5 A;  1JWS D;  1ZYR C;  3DMU A;  1IBM L;  2K01 A;  4A3F G;  3E6Z X;  2XGT A;  3CKI B;  2JJQ A;  1YIT A;  4DV6 Q;  4RGO S;  4LNQ A;  2JA7 B;  5KIX A;  2DNC A;  3I70 A;  5D65 A;  3TDQ A;  3Q24 A;  3C46 A;  5COY A;  2RHS B;  1XPR A;  2RDG A;  1HNW L;  3MXP A;  1CKM A;  3S2D B;  2VL6 A;  2DJG C;  2BH2 A;  4MHE A;  3U58 A;  1LTG D;  4A3F B;  1IL8 A;  4GOP C;  4JPB W;  3RZD B;  1K8O A;  3P20 A;  2RF4 A;  3QR8 A;  1OXT A;  3ERQ A;  3OW7 A;  2WAQ E;  1NJI C;  3S1M B;  2PZU A;  4KD4 A;  1WJJ A;  1T5X D;  3W3A A;  4K0K Q;  4OGQ C;  3KF8 B;  4N9P A;  2WP8 J;  3E9H A;  1D8L A;  1PTO F;  2VW9 A;  2VZA A;  3VDY A;  5CV6 A;  2YYZ A;  2ZT9 C;  4RFB A;  4BBR H;  3I4L A;  2E75 C;  3GTQ B;  3H09 A;  2F0M A;  4BY1 G;  4IAL A;  4R9W A;  1VQ6 A;  1SJE D;  2R7Z B;  3PMF A;  1NSN S;  1SFO B;  2JA5 B;  2F0T A;  4EQ5 A;  2B63 G;  1QZG A;  4XQN A;  4RGT A;  5IIF A;  5C4J H;  1K3B C;  1RHP A;  2E74 C;  1OXS C;  2SDF A;  5KND A;  1XWE A;  5KEE A;  1SNO A;  3U9S A;  2YTY A;  4ZQ3 A;  4JCV E;  4NW2 A;  3OMG A;  2B63 B;  3S2H B;  3HOZ H;  1G91 A;  2A68 D;  5C5M A;  3PO2 H;  3OPO A;  1EQV A;  4DR2 Q;  4B3R Q;  1AW7 A;  1L0X B;  4XYQ A;  1VQ4 A;  1ENC A;  1ASZ A;  4EQO A;  4UP9 A;  4RKL A;  5IOC A;  4LF9 L;  1WI5 A;  1DD2 A;  4DNR B;  3S1N H;  2F0P A;  2MP1 A;  1I6V C;  3S1R B;  3M4Q A;  2LFN A;  1WTQ A;  1ZYR D;  1MIU A;  2ENB A;  2KED A;  1E1O A;  4CGY B;  4JI7 Q;  3TZD A;  1TII D;  1BCP F;  3CC7 A;  1RJT A;  4LF7 Q;  1EZ8 A;  2VQE Q;  3MC0 B;  3SK8 A;  1RIP A;  4EGV A;  2R92 H;  1EOT A;  5EGT A;  1NY4 A;  3SDZ A;  4A3C G;  4ME3 A;  4J8Q A;  5ELE A;  4A75 A;  1IYJ B;  1FD7 D;  2RSO A;  3GV3 A;  2WII B;  3I4N B;  5F2D A;  4DR5 L;  1TQO A;  5IYC H;  1QNK A;  3Q6S A;  1DZ1 A;  1H9S B;  1QOH A;  4B3R L;  1X3E A;  4R4C A;  1CM9 A;  3K0Y A;  5EPK A;  4IUR A;  2CHB D;  3J81 E;  2NUC A;  2CW0 C;  3RLF A;  4A3J H;  4QQB X;  2Q2I A;  2Q8I B;  1TWF H;  3IFD A;  4Y7N B;  4JI6 Q;  2EY5 A;  2KBN A;  1HH2 P;  1SSO A;  2A5H A;  1PZK D;  1PH3 A;  3NEM A;  4MNO A;  2L4N A;  2A6E D;  1TT2 A;  2OQ0 A;  5IYB H;  1X9N A;  1S5C D;  1LTL A;  3C2P A;  3TRZ A;  5FK9 C;  3H94 A;  2WB1 B;  4OWT B;  3EIV A;  4DR5 Q;  2RSN A;  3LNN A;  5J22 A;  3NBH A;  2ID0 A;  3BDC A;  3NE5 B;  5IT9 L;  3DLL A;  1K8A C;  1XNR Q;  2P5Z X;  1YNJ C;  4ZUJ A;  1STH A;  5C3E G;  1SYE A;  2V1C C;  1EYC A;  1X65 A;  5LMU L;  2R93 H;  1BO0 A;  1PH1 A;  3ICE A;  2I46 A;  5JJK A;  2E76 C;  4KY6 A;  4A3K B;  2JA8 G;  5I6W A;  1U0L A;  5EBC A;  2E2H B;  2CWA A;  3E0E A;  1EY0 A;  2AQ3 B;  5BN5 A;  1D7Q A;  4MTK A;  4B3M L;  2O5I C;  3UE1 A;  3BDO A;  1D2B A;  4UP7 A;  1GOZ A;  3TEH B;  2EZV A;  3PO3 B;  2EJG C;  5I9O A;  4LF5 Q;  5C4Z A;  4XIG S;  3H15 A;  3I4M G;  1TU2 B;  1HTP A;  3FRP B;  4C3J H;  1HNW Q;  4DV5 Q;  2EYM A;  1ZXT A;  4HIO A;  5JVH 3;  1JE5 A;  1GUW A;  2Z6B A;  4A3E H;  1AN8 A;  3J7A 5;  1VQM A;  2RKS A;  1JMC A;  1N34 Q;  4RCO A;  4G7H C;  3S16 B;  5C4X B;  2ZTD A;  2AQ2 B;  2PPB C;  3TP5 A;  3BZD B;  4G57 A;  1VQI A;  2EQS A;  4LUV A;  1PMR A;  5KYL A;  2UUB Q;  1SND A;  4LUO A;  2L12 A;  1UE6 A;  2PZT A;  1E2W A;  2PW7 A;  4X6A H;  4IPD A;  3RZO H;  1Y1V B;  1HFN A;  3AB9 A;  3A5U A;  1FYC A;  4C3H H;  1RKN A;  4X64 L;  4JC0 A;  5I6Y A;  2DN8 A;  4ID6 A;  4RGM A;  2OCE A;  2UXB L;  1YHB A;  3PF4 A;  5CMD A;  2LMC B;  4OL7 A;  3DEP A;  2N88 A;  1Y8N B;  3MHB A;  4GNX B;  2K4K A;  2RDH A;  2NZH A;  1VDZ A;  5ELC A;  4O42 A;  2M2L A;  1YI2 A;  1TS2 A;  3AFP A;  3A7A B;  4BY1 H;  4RHR A;  1JB7 A;  4NKL A;  1ET9 A;  4KJN A;  5BN3 A;  1PYS B;  1DGS A;  4OEM B;  1BCP C;  2PNR C;  4DR1 L;  1S5E D;  1SR3 A;  4ZK9 B;  4K8I A;  1PTO C;  4E6I A;  3A56 A;  2I07 B;  1CA5 A;  4JBW A;  3P75 A;  2QEJ C;  4RCN A;  5EKL A;  3SE0 A;  2BDN A;  1SNM A;  3WWV A;  2WKD A;  5KYI A;  2YTX A;  1EL0 A;  2PI2 E;  3W1B A;  3T1H Q;  1DCZ A;  1HRJ A;  2D0O A;  3MXN A;  1ICW A;  1TY2 A;  2O2L D;  5FLM G;  1A3V A;  1IHZ A;  1Q8K A;  3RD4 A;  3UDI A;  1M90 C;  1X32 A;  4QF4 A;  4EQN A;  3RZD H;  4A3I G;  4KLK A;  4QMG A;  4WJ3 M;  4QIW B;  1Z7T A;  3TS2 A;  3W1G A;  4FF3 A;  1XMQ Q;  1H9J A;  3I91 A;  5K5P A;  2QDL A;  1STN A;  5FO9 B;  1VQJ A;  4PMW A;  2D62 A;  2HHH L;  2QEX A;  4BBR B;  1SMY D;  1S5F D;  3GDE A;  3A8I E;  4IN3 A;  2YU9 B;  4DK3 C;  3CCV A;  1YJ9 A;  3S14 H;  1II3 A;  1BF4 A;  3MXN B;  5JOB A;  3FVQ A;  4FVM A;  1KXL A;  1YZ6 A;  4JI6 L;  3M9B A;  1N36 Q;  1VS0 A;  4R4T A;  4LF7 L;  4L6T B;  3O13 A;  4DV2 L;  3VYT A;  3FKI H;  3PO2 G;  3SHL A;  5M3F H;  2XWB B;  2JEA I;  2NVT B;  4RH6 A;  4K0K L;  1A3U A;  4X3U A;  4JI2 Q;  1CZG A;  2N8N A;  1U5K A;  3F1Z A;  2JA6 G;  4YWK A;  1Q1B A;  3S2H H;  1LT3 D;  3B6Y A;  2NVQ B;  5JJI A;  1K28 A;  2DY7 A;  4F87 A;  3HG9 A;  3QB3 A;  3CCQ A;  3PO2 B;  2WFW A;  2Z8L A;  2F52 A;  2KOL A;  3MVV A;  2NZO A;  3JAM L;  1J5E L;  4JBJ A;  4YHH L;  4CDC C;  3RN2 A;  1X6O A;  4IUT A;  2BE5 D;  3PQI A;  4K5W A;  2JEB I;  2KJX A;  3UE0 A;  1MKH A;  1QB5 D;  3PIO 3;  2H1E A;  3HZX A;  2ZJR A;  3PCO B;  3CRL C;  1I50 H;  4XT1 B;  1HR0 W;  3KFU A;  1EIG A;  1YNN C;  3M7N A;  1B2T A;  1D5X C;  1J9O A;  2F0G A;  4QIW E;  3F2B A;  1WCM B;  1PH2 A;  2XTI A;  1N33 Q;  1JOO A;  1DYQ A;  2F03 A;  3PF5 A;  4YCV A;  1PRT C;  1ESR A;  3CHB D;  5C4H A;  2GA4 B;  2R92 B;  5ELB A;  3T16 A;  1JIC A;  2QCP X;  4FXD A;  3LGJ A;  1XYI A;  3CCJ A;  1G29 1;  4ZRZ A;  2F3I A;  2K1B A;  3K0X A;  1EWI A;  1ZKO A;  2D0P A;  3I4N G;  2OEO A;  3LX0 A;  5I4D A;  4ZAI A;  4G7Z C;  4JYA L;  2MNA A;  3MEH A;  3NQT A;  5FLX E;  4X62 Q;  1LLR D;  1GXD C;  4JI0 Q;  1BBU A;  1ICF B;  3I73 A;  3K8A A;  1O80 A;  1VMP A;  2TMP A;  4LFA Q;  2EYF A;  3QOJ A;  4DR4 Q;  4B3T Q;  1HXY D;  2XNA C;  1AEX A;  2H4O A;  1SNC A;  2MPM A;  5ISR A;  2FIN B;  4GN4 B;  2ZM6 L;  4M8A A;  4KJO A;  4H13 C;  1UE1 A;  1W2B A;  3QWN A;  3CPW A;  1K0S A;  2FHT A;  2K14 A;  3IAY A;  1CFM A;  2GVB A;  2Y0S B;  3G71 A;  3J7Y W;  2VQE L;  3ZJY C;  1BXT A;  1QIL A;  4GLA C;  2K5V A;  1SLJ A;  3HKZ G;  2SOB A;  2HIX A;  1XXG A;  3ULP A;  5CGK A;  2R93 B;  3QOL A;  3J81 L;  4B3S Q;  1AE3 A;  4PMC A;  4DV0 L;  5LL6 S;  2E2H H;  1SJH D;  4IOC A;  2OTL A;  5M3F G;  1K73 C;  2NTS A;  5FLX L;  2F0J A;  4HJA A;  4PMB A;  4WJ4 A;  2F0L A;  1Q82 C;  5BR8 Q;  3HOY G;  3PO3 H;  5JEA H;  3MFG A;  3T1Y Q;  2V4D A;  1TVX A;  3G4S A;  2MFI A;  3U4Z A;  2H5X A;  4IUN A;  4KTA A;  3BZC A;  4C3J B;  4DPG A;  3STB C;  5EPJ A;  3MZ5 A;  3ULJ A;  1HNX Q;  1F9S A;  4RGN A;  3HOX G;  1CHP D;  2MJ8 A;  2X69 A;  3DHQ A;  2QA4 A;  3G48 A;  4HSV A;  4Q5V A;  1H9K A;  2EJF C;  5LHY 1;  1AH9 A;  5CBA E;  4QJF A;  2LY7 A;  4JW0 A;  2C35 B;  3KBX A;  1EY6 A;  2K7V A;  2L55 A;  1HZC A;  4A3D B;  4HSP A;  4IJH A;  3SK5 A;  1Y1V H;  1GO3 E;  3D6W A;  2RCN A;  2VUM B;  2HQE A;  1R9T H;  1NAP A;  1Y1W B;  4L5S A;  2NVY H;  4FDB A;  4LF6 L;  3PUX A;  3NXW A;  1HNZ Q;  2MHV A;  1MBY A;  3GTP B;  4GNX A;  1SRU A;  3J7A F;  1I4Q A;  1GUN A;  2AUJ D;  3K7A B;  1X56 A;  1EQR A;  2SNS A;  1CZW A;  1PYW D;  1L1O A;  1KDA A;  4UY8 C;  5GQO A;  2K75 A;  3S1Q H;  2PYK A;  1TWA H;  3R93 A;  4RA8 A;  4PZ6 A;  1EOV A;  4HJ7 A;  1T9H A;  2SEB D;  4L5T A;  5IP7 H;  2JSO A;  3D0F A;  5IY0 A;  1F77 A;  4TRD A;  3HOW H;  2Z1C A;  1N32 L;  2CW0 D;  5KNC A;  1ENA A;  3M4Y A;  1JB3 A;  3MAQ A;  1GKH A;  2IY5 B;  2GVA A;  1A0I A;  2R3Z A;  1WYD A;  1UEA B;  1UAP A;  2VY3 A;  1A63 A;  2F4I A;  3ERO A;  3QIA A;  1XPO A;  4CHT B;  3NTI A;  1P8L A;  4KHZ A;  1G2T A;  2CQA A;  1JQY D;  3CC2 A;  2EXZ A;  1XMO Q;  2EYO A;  3X3M A;  2AUK A;  3M4O B;  2AWO A;  2LKV A;  4JI2 L;  3SR1 A;  5DEH A;  2B3G A;  5M5X H;  3HOX H;  1A3T A;  2NN6 H;  4GS3 A;  2E2D C;  5M3M G;  1GUS A;  2JA8 B;  5JJZ A;  3VA5 A;  1BBX C;  2Y0S G;  5JPM C;  3MEF A;  1EY8 A;  1KDC A;  2F0W A;  4N9T A;  2HUG A;  3GTL H;  1HJP A;  5IWA Q;  1RTN A;  1JJ2 A;  4JI4 L;  1J8I A;  2KEC A;  1IL2 A;  4LJZ C;  2KEE A;  1S5B D;  2DGY A;  2XSC A;  2MO0 A;  3VR6 A;  1CKN B;  3E3X A;  4OXP A;  3VA7 A;  3NEL A;  3M3Y B;  3FP9 A;  3NTH A;  5KNB A;  4DR7 Q;  3EJI A;  1PH4 A;  4GKJ Q;  4V0B A;  3J80 i;  1V8Q A;  1DOK A;  2YU9 H;  5K36 H;  5M5W H;  4KHP Q;  1WD1 A;  4CJ0 B;  4GLV B;  3GTJ H;  1PFM A;  1MSH A;  1XPU A;  1MJC A;  3ONA B;  4I7A A;  2HCI A;  1RF2 D;  2LXK A;  1TR5 A;  2PI2 A;  4JVZ A;  5COR A;  2ZXO A;  1SYC A;  1T5E A;  2JA9 A;  1GHK A;  1CQF A;  3H0G H;  1QNU A;  4X65 L;  4C2M H;  5M3F B;  2PCF B;  2EY1 A;  2TSS A;  3NWT A;  1N33 L;  4DV3 L;  1SRO A;  3BYY B;  1FVI A;  1BCP B;  1D5M C;  3V2T A;  3DWA A;  4N8X 1;  5I2Y A;  4NDX A;  1XNQ L;  4XT3 B;  2B2T C;  4H7B A;  4OO1 I;  1B1Z A;  1I94 Q;  3J80 E;  3P1H A;  2B2V A;  3I72 A;  4A3G B;  2EIF A;  4TVA B;  1KL9 A;  3QO2 A;  4P73 A;  2A69 D;  1I94 L;  3MWY W;  3VR5 A;  1KD1 C;  1KAA A;  4BBS H;  4DV4 L;  3KF8 A;  4B9X A;  5HGQ A;  4BY7 G;  5C5L A;  1CQV A;  1WD0 A;  2CKZ B;  2EVB A;  2ZJP A;  5EQ0 A;  1AFP A;  4FF1 A;  4JYA Q;  4R4Q A;  3TBI B;  5GAG C;  5IGG A;  1PH6 A;  4DV2 Q;  2F0O A;  2CCZ A;  2EOT A;  2N78 A;  4QY7 A;  3DEO A;  5ELF A;  3SVM A;  2B39 A;  1Q46 A;  2YTV A;  2WAQ G;  1Q12 A;  1EY4 A;  5IGB A;  2EJM A;  5IP9 H;  2K5Q A;  4DXF A;  2ASB A;  1WVL A;  1SE4 A;  1YJW A;  5K36 G;  1B3Q A;  1NBW A;  1R4P B;  1HNX L;  4P74 A;  2FJ2 A;  3TS0 A;  3FDT A;  1VQP A;  3FPP A;  4GKJ L;  1CKO A;  4OON A;  4R4O A;  2BH8 A;  2N3S A;  1KAB A;  2Q2T A;  2RVL A;  5CV7 A;  4DR6 L;  5ELO A;  4UAI A;  4H44 C;  1LO5 D;  3AU7 A;  1WTR A;  2A69 C;  5A2Q L;  4IJL A;  1C8C A;  2R93 G;  1QZH A;  2BA1 A;  4K2K A;  1AZQ A;  1K8G A;  2K6A A;  1JOR A;  1KDB A;  1KIX A;  1RDP D;  4F8M A;  1PFB A;  1Q86 C;  3PGZ A;  3L9A X;  3CMA A;  5IYD G;  3RMH A;  5FLM H;  4DU9 A;  3CCS A;  5M3M H;  4CKE A;  2UXD Q;  4IQZ A;  4A3B G;  1NCV A;  1OO9 B;  3GTM H;  4JOI A;  4R8N A;  1PH9 A;  2B2Y A;  2IWH A;  4HMI A;  3K6O A;  2K5H A;  3R8B A;  2NYZ D;  5IWA L;  3NWS A;  5JEA J;  1K83 H;  4B9W A;  1F9P A;  3FMC A;  3OTO L;  1CSQ A;  1EY5 A;  1PYB A;  3M4P A;  5IP7 G;  1W6J A;  2K33 A;  4DUY Q;  4X66 L;  1Q7Y C;  1KLU D;  3SK4 A;  3N52 A;  4MZ9 A;  3GP7 A;  3S17 B;  5FO8 B;  1RL2 A;  1QJO A;  5FKA C;  3PIP A;  2EYH A;  5EPL A;  5C3E B;  3DM1 A;  2L11 A;  2PMZ B;  1EQT A;  4GNX C;  4JI1 Q;  2UUA Q;  2E5L L;  3HOV B;  4KHV A;  2O4X A;  4BWG B;  2OTJ A;  2R92 G;  4DR3 Q;  3H3V I;  3QG1 A;  1L1O C;  5HY6 A;  2N55 A;  2VUM H;  5CV4 A;  1EIF A;  1WCM G;  3GTO B;  2PW5 A;  2ES2 A;  4LF6 Q;  3S2D H;  1Y1V G;  1DM0 B;  3R2I A;  2NZ1 D;  2BDO A;  2EYJ A;  2UU9 Q;  2B2V C;  2JE6 I;  5D3D A;  1A8V A;  4I65 A;  1U4L A;  3S1Q B;  3TRE A;  3CCR A;  3S1M H;  3MTS A;  1DON A;  2VXW A;  4DR1 Q;  4JBK A;  1HQM C;  1STY A;  1KHI A;  2J7Z A;  1TWH H;  1L0W A;  4XTC S;  1VQ9 A;  1QUQ A;  2EYL A;  4L8J A;  2B2U A;  2IT1 A;  2MQH A;  3HOW B;  1EWH A;  1DOL A;  5IGE A;  3T13 A;  3KF6 B;  2FMM A;  3CW2 C;  4GOP B;  4DA2 A;  4K5V A;  5LL6 X;  3KJP A;  1LTB D;  1KLG D;  4POF A;  1VQD A;  1PZJ D;  1Y8P B;  1SMX A;  1O7Z A;  4DAM A;  2AKW B;  4DN4 M;  3EBE A;  3J7Z C;  2Z6K A;  4BA1 I;  4IFD G;  1I6H B;  5C4J B;  4X65 Q;  1QWY A;  3U4V A;  2UXC L;  4FO2 A;  2RA4 A;  3PUZ A;  5CR3 A;  5H1S E;  1MI2 A;  3J80 L;  1B7Y B;  1EEF D;  1PFS A;  4AIM A;  3HOX B;  1OXU A;  2QW7 A;  4JV5 Q;  4G7O C;  1NR4 A;  3NEN A;  4RWS C;  4LAA A;  2JA8 H;  1Y1W G;  2F0N A;  5G3L F;  1GHJ A;  3J81 i;  4CBV A;  2HDL A;  3IL8 A;  1DJR D;  4NMZ A;  5M5Y H;  2LSS A;  4CKB A;  1HFG A;  1E0B A;  1JCK B;  3GTL B;  4K5X A;  3S1N B;  4PZ7 A;  5T1G A;  3TSS A;  5BR8 L;  1HZB A;  1YJN A;  3S1R H;  1VMC A;  4YCU A;  3NBH B;  4P75 A;  4S3S A;  5J1Z A;  4A76 A;  3KYH C;  4HIM A;  4B08 A;  1PH8 A;  4H0L C;  3Q23 A;  1JJC B;  1L2F A;  1ONL A;  4L63 B;  5C44 G;  2JA6 H;  2IX1 A;  5DAU A;  1NE3 A;  3HOU B;  1JT8 A;  1O7Y A;  1EY7 A;  4P72 A;  3J81 c;  4DV7 L;  1UE7 A;  2QGQ A;  4MN3 A;  1B8A A;  3I55 A;  3QJY A;  2CWP A;  4DAV A;  4RAU C;  2F3W A;  4IPC A;  2BCO A;  5JAV A;  5EKK A;  1WTO A;  1PTO D;  1Y14 B;  1VQC A;  4A93 B;  3F2D A;  5EJW A;  4C1N K;  4X64 Q;  1B9N A;  2XRQ D;  3OWF A;  1E2Z A;  1VQK A;  5ELN A;  3V05 A;  3KOJ A;  2Y0S E;  3KK7 A;  4KY5 A;  3R2T A;  4C3I B;  1A6X A;  4IUU A;  3UDG A;  1BKB A;  1O7I A;  4Y52 H;  2LS0 1;  1WTX A;  1IBL L;  5EKI A;  3U50 C;  4BBR G;  2F0D A;  1VCI A;  1F2Y A;  4J1M A;  3M85 A;  4GKK L;  3I3C A;  4A3I H;  4LF9 Q;  1QVF A;  3HP3 A;  4A3G H;  3LWU A;  4HAE A;  1XTD A;  3RNU A;  3OYY A;  1G51 A;  2Z4H A;  2WB1 E;  3VYU A;  3CRK C;  1SN8 A;  1JR0 D;  2ICE C;  5A2Q E;  3AQQ A;  2G9D A;  1S3O A;  4CDD C;  4DAY A;  4ZKC B;  4YY3 Q;  4NXM Q;  1EUJ A;  2BE5 C;  4AYB E;  5AJ3 Q;  3CCU A;  5LMN L;  2F3V A;  3VR4 A;  2IL8 A;  2ZJQ A;  3CD6 A;  4DV5 L;  4BBS B;  1EYG A;  4OX9 L;  2DJF C;  4F7X A;  3H91 A;  5C44 B;  3OWE B;  1JE4 A;  3AYH B;  4A3M G;  1KTK A;  1X3F A;  4NB3 A;  4A3K H;  1IW7 D;  1D5Z C;  1X54 A;  2K50 A;  4FXG C;  4RG1 A;  2FFK B;  3I4M H;  4IFD J;  2UUC L;  1I4G A;  1K3R A;  4PG3 A;  2NWG A;  1I4H A;  4A3F H;  4DR7 L;  1Q8I A;  4R1J A;  2L15 A;  3LWE A;  3ZYY X;  1SE3 A;  4QB4 A;  2SNM A;  2F0H A;  2B2Y C;  3CP0 A;  4KMU C;  3D31 A;  3D6C A;  4KI0 A;  2Z9H A;  1G6Z A;  1SE8 A;  3GTK H;  5IOD A;  2IW3 A;  2HHH Q;  4ULL A;  2NB0 A;  3PIO A;  1HTL D;  1SE2 A;  5C4X H;  3S16 H;  5CV8 A;  4DV7 Q;  1H9S A;  2IHF A;  2CFM A;  2R61 A;  4C3H G;  4OX9 Q;  4ILW A;  3GTQ H;  1SYF A;  4GLX A;  3I8Z A;  5C0X J;  2R7Z H;  1SFO H;  2JA5 H;  1GJX A;  1ROD A;  1GVP A;  4WFN 3;  4CJ2 C;  4K6D A;  1VQA A;  3STB D;  1B9M A;  3I4O A;  4TSS A;  4JI5 Q;  3NK9 A;  4GKK Q;  4QUC A;  3UI2 A;  1WOC A;  1SYB A;  4WRD A;  2PNH A;  1F2L A;  5D3I B;  1F2Z A;  4DUY L;  1IBM Q;  3HRZ C;  3ER0 A;  2WAC A;  2B63 H;  1O7L A;  1HR0 Q;  2KCC A;  3K5O A;  3NUC A;  4AQY Q;  2NBF A;  4A93 G;  1LYL A;  4KKS A;  2HIV A;  1NTG A;  1RD9 D;  2L5T A;  1ASY A;  1H9R A;  1YNN D;  1DXM A;  4JI8 Q;  4CKC A;  5G3L D;  1NUC A;  4FXK C;  3CCL A;  3G7L A;  2M00 A;  1VQO A;  1CHQ D;  3P7J A;  2KEN A;  4CDF C;  5DNF A;  4K6L A;  2RBM A;  1RTO A;  4JI7 L;  3J80 c;  2B2W C;  2ALY B;  4OEL B;  1VQ7 A;  2WV6 D;  3S17 H;  3PIP 3;  1VQN A;  3KDF A;  1PRT F;  1QCB D;  3K5L A;  1ESF A;  1HZA A;  5C3E H;  4LMQ D;  3VYS A;  3N6R A;  4OIJ A;  3A8K E;  3HOV G;  4P71 A;  3MA2 B;  4O0A A;  2XWJ B;  4A3B H;  3W2D A;  2K28 A;  4C3I G;  1G2S A;  1Y8O B;  3HOZ G;  1QG7 A;  2NN6 I;  1STA A;  4DK0 A;  4DV1 Q;  2ATW A;  4YWL A;  4PQX A;  1STE A;  5NUC A;  1E3P A;  4K14 A;  2BOS A;  2RQX A;  1AP0 A;  2QKI C;  3OOC A;  5CYU A;  1U4R A;  4OWX B;  2FXQ A;  3BVG A;  2X6G A;  4IPH A;  2JA7 G;  3K5M A;  2CQO A;  3M7G A;  2PQE A;  2BA0 A;  4KKU A;  4A3J G;  4M1U B;  4DV3 Q;  4C1N I;  2M9V A;  5L37 A;  3FEW X;  2IPK D;  4Y7N H;  5E4W C;  1XNQ Q;  1JOQ A;  2K5D A;  3KUP A;  1ILQ A;  1VF5 C;  1ET6 A;  4P2C B;  3BU2 A;  4IO9 A;  2A6H C;  4DR2 L;  2GN5 A;  4A3D G;  4A3G G;  4HMJ A;  3TP7 A;  1OTC A;  3J7A V;  3FPU B;  4IUP A;  1MSG A;  4DF7 A;  1YHQ A;  2UUA L;  3S14 B;  2I5L X;  2I0Q A;  4LF4 L;  1AE2 A;  4AYB G;  1IBK L;  1X55 A;  4X3K A;  3JC6 6;  1FJG L;  1F9Q A;  1WTH A;  3CCE A;  5IYC G;  1JWM D;  3L2P A;  2EY2 A;  1AZP A;  4DK1 A;  4TKO B;  4IZ8 A;  1I3Q B;  3CME A;  1Z6H A;  3CAM A;  1UE5 A;  4ABN A;  1E2V A;  4C3J G;  4NXN L;  3OTO Q;  3OW2 A;  3FKI B;  4FNF A;  2F0S A;  4KY7 A;  4J15 A;  2NVT H;  1MJE A;  1LTT D;  3ERS X;  3RUZ A;  4Q0F A;  1NMF A;  2NN6 G;  1R4Q B;  2ZTE A;  4DAY B;  4WJW A;  1LTS D;  1LAC A;  3NSW A;  3T51 B;  3I7F A;  2NVQ H;  5A35 A;  3OHX C;  1SNQ A;  4IPG A;  2A1A A;  4DK6 C;  1FGU A;  3A55 A;  1W6K A;  1LUZ A;  1XNR L;  3URY A;  3ULL A;  4ZYS A;  5M5Y B;  1GUO A;  2D2C C;  5C4X G;  2IJ0 A;  3HGB A;  2MUY A;  3CU7 A;  5FJ8 G;  2KA7 A;  1WTV A;  4ZKB B;  1NR2 A;  3HKZ B;  3TP6 A;  3IFT A;  4LWC A;  2WIN B;  2D5D A;  5CBE E;  4JI0 L;  3HEJ A;  3HS0 C;  1TS4 A;  1WCM H;  3HKS A;  2RHQ B;  3L3O C;  3K59 A;  4GN3 B;  5HGT A;  3HOU H;  2KQ3 A;  5LMU Q;  3K80 C;  3CXC A;  3RZO B;  1E7Z A;  1B3A A;  1EYA A;  1EEI D;  3D3R A;  5JEA G;  3H3V H;  1SMY C;  3TP8 A;  4DNT B;  1ZEQ X;  1H95 A;  5IE8 A;  2EE1 A;  4LFB Q;  1B44 D;  3Q0A A;  1TS5 A;  1X3P A;  4DV4 Q;  3U9O A;  5C3W A;  2KHI A;  1SYD A;  2F0Q A;  3KLS X;  4EVO A;  5E3F A;  4DGZ A;  4JV5 L;  4UPA A;  3T53 B;  4BXX G;  4HIK A;  1U4P A;  4A93 H;  1KNA A;  1OXX K;  2JP1 A;  4DKA C;  1K8M A;  1FL0 A;  4L5Q A;  2ZXR A;  1JC7 A;  5JVG 3;  1C0A A;  3D4W A;  3WDN A;  4BY1 B;  4DNI A;  3E5S A;  4MIU A;  3SEB A;  1M8A A;  1FJG Q;  2Q8T A;  2B8G A;  4LF4 Q;  1IKM A;  1BVS A;  1YNJ D;  4A3I B;  4IFD H;  4QCL A;  4YIJ A;  1S4Z A;  3PUV A;  2VNU D;  3W5O A;  1UNS A;  1GD7 A;  1QE6 A;  2UXB Q;  1YIJ A;  1MHW C;  3RR5 A;  4U67 3;  2XRS D;  1I4X A;  1IBK Q;  1LT6 D;  1BCP D;  1X3Q A;  4BBS G;  3A74 A;  1E1T A;  2A6E C;  2F0U A;  1ILP A;  2K32 A;  1TXY A;  1YEZ A;  5C44 H;  4UHV A;  1PTO B;  2G5D A;  1LTR D;  1UEB A;  1QVG A;  1M1K C;  1TKW B;  1XJV A;  5I2X A;  1PH7 A;  5C0X H;  1FGB D;  2R7D A;  3I4M B;  1IXR A;  3DWQ A;  4GN5 A;  2UUC Q;  3RLO A;  2KCN A;  3K58 A;  4ZCK A;  5GAD C;  4G4K A;  4DAP A;  3WOF A;  1PH5 A;  3FHW A;  2UUB L;  2C9O A;  5ELD A;  1NMG A;  3C1F A;  2Q8R E;  3BZK A;  5IGD A;  1DOM A;  2KHS A;  2ZXP A;  5C6A A;  4LF5 L;  3GTK B;  4HCS A;  4A3K G;  4HJ9 A;  4L5R C;  3H0G G;  3I90 A;  2E8G A;  4HCE A;  1IYU A;  3JAM c;  2A6H D;  4DV1 L;  2AHO B;  2PO4 A;  1LT5 D;  3I2Z A;  4ALP A;  4RMF A;  1HUM A;  2C5C A;  5IP9 G;  3HOY B;  4X66 Q;  1TWG H;  3EN2 A;  4A3D H;  1Z9F A;  2HQL A;  4JI8 L;  3G6E A;  3C3L A;  4R8I A;  3DWP A;  1JWU D;  1KAW A;  2A74 C;  2NVY B;  2Z0S A;  3NP8 A;  3JAM E;  3BG3 A;  3SK6 A;  3RN5 A;  3TME A;  4PNY A;  3NQI A;  4YCW A;  2G9H D;  2KUM A;  3GTP H;  2E2J H;  5E4X A;  3NTK A;  5D14 A;  2IX0 A;  2F0F A;  1VQG A;  1IKL A;  1EY9 A;  1X3G A;  1CKN A;  2D9U A;  2XN9 C;  4K2L A;  5KRU A;  2ZM6 Q;  4A4I A;  1EWC A;  3DUZ A;  3BVZ A;  3S15 H;  2YV5 A;  4OO1 H;  1E24 A;  2R7Z G;  4GZY C;  5I9P A;  3K5N A;  2PMZ E;  1HPC A;  2JYO A;  4JI5 L;  1I50 B;  2UXC Q;  1VQ8 A;  1E22 A;  2WAQ B;  4V19 0;  5E1F A;  5LMN Q;  3D4D A;  3T1H L;  4LF8 L;  2VQF Q;  5CV9 A;  5IT9 E;  5FO7 B;  1HA5 A;  3D8G A;  4DV6 L;  3R3O A;  1HCZ A;  2IX3 A;  3M4O H;  4A3B B;  4I7Z C;  1EZ6 A;  4APV A;  1JOK A;  1LTA D;  4BXX H;  4KN4 C;  4BY7 B;  2I5H A;  1B53 A;  2OT2 A;  2AWN A;  3F2C A;  1YBY A;  5EAY A;  3GO5 A;  1LAB A;  2EXD A;  1PDQ A;  2FMC A;  5C0X G;  5LMN W;  2OQK A;  4A3M H;  1I5F A;  3Q22 A;  3EFX D;  3AFQ A;  4FP5 D;  1BOS A;  4X62 L;  5DM7 3;  4FYD A;  1VQF A;  1F2M A;  2NVX H;  5AJ3 L;  2HCC A;  1IZ6 A;  5JPN C;  2PZW A;  4HN7 A;  1CT1 D;  1TWC H;  2E2I H;  3PSI A;  1YNX A;  5FJ8 H;  4PV1 C;  2DNE A;  1EU3 A;  2HDM A;  2VS1 A;  4DUZ Q;  4DFA A;  1SEB D;  2B29 A;  2KVM A;  5IYB G;  3E9I A;  2JN4 A;  1V1P A;  3GTG B;  1D1I A;  4YY3 L;  3EQL C;  1SXT A;  1IBL Q;  2XIW A;  3MFY A;  5CC4 A;  1Q1E A;  3MXG A;  2R6G A;  4HED A;  4QUF A;  1EFW A;  4FF4 A;  2R7F A;  1I3Q H;  1PHJ A;  4KD3 A;  3CQZ B;  1LM0 A;  3A8J E;  4XYO A;  2OXP A;  5M9O A;  4XQJ A;  4A3L G;  4DR6 Q;  3H0G B;  1PVO A;  1IYV A;  5DLQ E;  1MD2 D;  3L0O A;  2RDF A;  2MO1 A;  1MGS A;  4AQY L;  4JI3 Q;  5IYD H;  3T56 B;  4UDU C;  3KBG A;  1Z47 A;  1L0Y B;  1TY0 A;  2A8V A;  1PRT D;  4Z9C B;  4C56 C;  3GD7 A;  4DV0 Q;  2A68 C;  4JOI C;  4XDX A;  3F8T A;  3X3N A;  4LFA L;  1HZ9 A;  3OMC A;  3HOU G;  4QGU A;  2MGS A;  3PUW A;  3CF5 A;  4NPS A;  2DUD A;  3BYT B;  3VYR A;  3I56 A;  4A3E G;  2Z4I A;  2Q2U A;  5GAH C;  2EPB A;  4O2D A;  4WOR A;  4F88 A;  4J6H A;  1TS3 A;  1EIH A;  2L0C A;  4CDE C;  1M4V A;  2KHJ A;  1XMO L;  4YWM A;  2PQA B;  1OXV A;  4JI4 Q;  3CCM A;  2JA7 H;  1V1P B;  4AH6 A;  2OWO A;  1R9T B;  3K7U C;  1Y1W H;  3DXJ C;  2VB3 X;  1N8R C;  4IUQ A;  4POG A;  1CA6 A;  1KNE A;  2K52 A;  3TN2 A;  3J81 j;  2QF7 A;  2AMC B;  4A3L H;  4LFB L;  4B3T L;  2EYP A;  1EFI D;  2EDG A;  2JK8 A;  2LXJ A;  1VQB A;  3NPP A;  1XX8 A;  3K7A H;  5JJL A;  1EU4 A;  4AYB B;  5HUR A;  2K03 A;  1YHA A;  1HHV A;  2F4V L;  1TWA B;  3V96 A;  1WTW A;  3A5Z B;  1NNX A;  1HUN A;  3EA6 A;  1B50 A;  4DUZ L;  1EQQ A;  1BUV T;  1K0R A;  4IFD I;  2EY6 A;  3KF6 A;  1S72 A;  1ENF A;  1G6P A;  1HNZ L;  2F4V Q;  1B70 B;  3PUY A;  2K04 A;  3MXU A;  3K57 A;  1A15 A;  3ITP A;  3BDL A;  1V1Q A;  4FF2 A;  2IHE A;  4UP8 A;  1N32 Q;  1Q81 C;  3K81 C;  1J6Q A;  3PV0 A;  1BR9 A;  1S40 A;  5IGC A;  1EIY B;  2O5J C;  3DM3 A;  1PTO H;  4LW1 A;  1O78 A;  3ND8 A;  1STG A;  1C48 A; 
#chains in the Genus database with same CATH homology
 4A3J G;  4DV3 Q;  2EIF A;  4IPD A;  3RZO H;  3BJU A;  4TVA B;  4NXN Q;  1KL9 A;  4Y7N H;  1C7Y A;  1PV4 A;  3A5U A;  4GOP A;  1XNQ Q;  4C3H H;  4P73 A;  1I94 L;  4X64 L;  4JC0 A;  1KD1 C;  1QUQ B;  3BU2 A;  4IO9 A;  4DR2 L;  4BBS H;  2GN5 A;  4DV4 L;  5HGQ A;  4BY7 G;  4A3D G;  4A3G G;  1UWV A;  1VQH A;  2OCE A;  1OTC A;  2CKZ B;  2ZJP A;  2UXB L;  1KRS A;  1YHB A;  3PF4 A;  4A3C H;  4JYA Q;  4R4Q A;  5GAG C;  3SGI A;  1YHQ A;  4GNX B;  2UUA L;  1PH6 A;  4PZ8 A;  2I5L X;  4DV2 Q;  2K4K A;  2CCZ A;  2N78 A;  2NZH A;  1AE2 A;  4QY7 A;  4AYB G;  2I0Q A;  1IBK L;  4LF4 L;  1X55 A;  2E5L Q;  3JC6 6;  1FJG L;  3CCE A;  5IYC G;  2N49 A;  1Q46 A;  1YI2 A;  1L1O B;  3AFP A;  2ZTC A;  3L2P A;  2YTV A;  3M3Y H;  4EX5 A;  2WAQ G;  3CME A;  4BY1 H;  1Q12 A;  3CAM A;  1UE5 A;  4OO1 G;  1JB7 A;  5IP9 H;  1W3S A;  4IOA A;  4NXN L;  2ASB A;  3OTO Q;  3OW2 A;  1YJW A;  1PYS B;  5K36 G;  1DGS A;  4J15 A;  2NVT H;  4HID A;  1MJE A;  3ERS X;  3HOY H;  5FLX c;  1NBW A;  4DR1 L;  1NMF A;  1SR3 A;  4LFC L;  1HNX L;  2NN6 G;  2ZTE A;  4DAY B;  4P74 A;  3TS0 A;  1HR0 L;  1VQP A;  3I7F A;  2NVQ H;  4GKJ L;  1CKO A;  4OON A;  4R4O A;  3I4N H;  4JBW A;  4IPG A;  2BH8 A;  2N3S A;  2A1A A;  2Q2H A;  4DK6 C;  1FGU A;  1XMQ L;  3AEV A;  2Q2T A;  3GTO H;  1LUZ A;  4DR6 L;  5ELO A;  3WWV A;  3KLW A;  1XNR L;  3ULL A;  2UXD L;  4LFC Q;  2YTX A;  5C4X G;  2PI2 E;  3UDX A;  4IJL A;  1GM5 A;  3W1B A;  3T1H Q;  5FJ8 G;  2D0O A;  2R93 G;  1QZH A;  4LUZ A;  2BA1 A;  5FLM G;  4JBM A;  4LWC A;  4JI0 L;  1K8G A;  1Q8K A;  2VUM G;  2WB1 G;  3UDI A;  1M90 C;  1WCM H;  3HKS A;  1KIX A;  1K9M C;  2RHQ B;  1BBW A;  1Q86 C;  4GN3 B;  3RZD H;  3HOU H;  1JJG A;  4A3I G;  4BA2 I;  3PGZ A;  4KLK A;  5LMU Q;  3K80 C;  3CXC A;  3CMA A;  4HJ5 A;  1E7Z A;  4WJ3 M;  1CSP A;  5JEA G;  3TS2 A;  3W1G A;  5IYD G;  3H3V H;  5FLM H;  3CCS A;  2UXD Q;  3HKZ E;  5M3M H;  1XMQ Q;  4R4I A;  4A3B G;  3GTM H;  4JOI A;  5IE8 A;  1H95 A;  1PH9 A;  4LFB Q;  4DV4 Q;  3HOW G;  1V9P A;  2K5H A;  5IT9 c;  2KHI A;  1VQJ A;  4PMW A;  5IWA L;  1VQL A;  2D62 A;  2HHH L;  5JEA J;  1I6H H;  3HFZ B;  2QEX A;  1K83 H;  3GDE A;  2JQO A;  4JV5 L;  2I5M X;  4UPA A;  1KRT A;  1C9O A;  3FKI G;  1CSQ A;  4DK3 C;  3OTO L;  4HIK A;  4BXX G;  1PYB A;  3CCV A;  1YJ9 A;  2HT1 A;  3M4P A;  3S14 H;  4A93 H;  5IP7 G;  1OXX K;  3MXN B;  3UDF A;  1N9W A;  4X66 L;  4DKA C;  4DUY Q;  1Q7Y C;  2KCM A;  2KCT A;  1FL0 A;  1QVC A;  4L5Q A;  4MZ9 A;  4BY7 H;  1KXL A;  3L7Z C;  1RL2 A;  1YZ6 A;  3PIP A;  4JI6 L;  2UU9 L;  1C0A A;  3M9B A;  1N36 Q;  1VS0 A;  4R4T A;  4LF7 L;  2A19 A;  3T1Y L;  1N34 L;  4DV2 L;  5E7N A;  4DNI A;  4JI1 Q;  4GNX C;  2UUA Q;  1FJG Q;  2E5L L;  3FKI H;  2K5N A;  5GAE C;  5M3F H;  4YHH Q;  4LF4 Q;  2JEA I;  3PO3 G;  3PO2 G;  1BVS A;  1YVC A;  1J5E Q;  3IRB A;  3Q8D A;  2OTJ A;  2VQF L;  4LF8 Q;  2PQA A;  4K0K L;  3PUV A;  4JI2 Q;  2R92 G;  2VNU D;  4DR3 Q;  2N8N A;  3H3V I;  1L1O C;  1U5K A;  3F1Z A;  3W5O A;  2JA6 G;  5HY6 A;  1GD7 A;  4YWK A;  1Q1B A;  3S2H H;  2UXB Q;  3B6Y A;  1YIJ A;  3RR5 A;  2VUM H;  5JJI A;  1EIF A;  1WCM G;  1IBK Q;  1V43 A;  3CCQ A;  4BBS G;  3A74 A;  5J3B A;  2WFW A;  1E1T A;  2ES2 A;  2F52 A;  4LF6 Q;  3S2D H;  1Y1V G;  1KC8 C;  4JI1 L;  2NZO A;  1J5E L;  1TXY A;  1YEZ A;  4JBJ A;  3CPF A;  5C44 H;  4YHH L;  3KJO A;  1PA6 A;  3RN2 A;  1UEB A;  1X6O A;  1QVG A;  2UU9 Q;  2JE6 I;  1M1K C;  1VQ5 A;  2JEB I;  2Z6K C;  1XJV A;  3UE0 A;  1MKH A;  2ZJR A;  1A8V A;  1PH7 A;  1KQS A;  1N36 L;  3PCO B;  3GTG H;  1I50 H;  3TRE A;  2R7D A;  3CCR A;  1HR0 W;  3KFU A;  3M7N A;  3S1M H;  1IXR A;  4GN5 A;  4DR1 Q;  2UUC Q;  3RLO A;  4JBK A;  4QIW E;  3F2B A;  1PH2 A;  5GAD C;  1KHI A;  2XTI A;  3A0J A;  3CQZ H;  4OWW B;  1A62 A;  1TWH H;  1N33 Q;  1PH5 A;  3PF5 A;  3FHW A;  4XTC S;  4YCV A;  1L0W A;  2UUB L;  1VQ9 A;  1QUQ A;  3TQY A;  2IT1 A;  2MQH A;  1VQE A;  1NMG A;  3JAM i;  3KF6 B;  3BZK A;  3CW2 C;  4GOP B;  3LGJ A;  4MTN A;  3KJP A;  3CCJ A;  1G29 1;  4LF5 L;  2F3I A;  4A3K G;  4DR4 L;  1WFQ A;  1VQD A;  3K0X A;  1P16 A;  4POF A;  1EWI A;  4HJ9 A;  2D0P A;  3H0G G;  4L5R C;  2E8G A;  3I4N G;  5C0X I;  3JAM c;  4B3M Q;  4DV1 L;  2JA5 G;  4DR3 L;  2AHO B;  3RLN A;  1SMX A;  4DAM A;  4HJ8 A;  4C3I H;  2AKW B;  4JYA L;  4NXM L;  1CUK A;  3EBE A;  3J7Z C;  2Z6K A;  4BA1 I;  2MNA A;  4IFD G;  4X62 Q;  4X65 Q;  3U4V A;  3I2Z A;  2UXC L;  4ALP A;  4RMF A;  4JI0 Q;  1BBU A;  3PUZ A;  5H1S E;  5IP9 G;  3K8A A;  4X66 Q;  4JG2 A;  3CC4 A;  1B7Y B;  1TWG H;  3EN2 A;  4LFA Q;  1PFS A;  4A3D H;  4DR4 Q;  5GRO A;  1Z9F A;  4AIM A;  3KDF B;  4H02 A;  4B3S L;  4B3T Q;  1OXU A;  2HQL A;  4JI8 L;  3S24 A;  3G6E A;  4TQU S;  4JV5 Q;  4GN4 B;  2ZM6 L;  1KAW A;  3NEN A;  2JA8 H;  2Z0S A;  1Y1W G;  3RN5 A;  3J81 i;  1UE1 A;  4KHP L;  4YCW A;  4JI3 L;  1W2B A;  3GTP H;  3HOV H;  4QL5 A;  5M5Y H;  2LSS A;  3CPW A;  2E2J H;  1IBM L;  4A3F G;  2IX0 A;  2XGT A;  2K14 A;  1VQG A;  2JJQ A;  1YIT A;  4PZ7 A;  1X3G A;  2GVB A;  1CKN A;  5BR8 L;  1HZB A;  3G71 A;  2VQE L;  4DV6 Q;  3ZJY C;  3S1R H;  1YJN A;  4LNQ A;  4GLA C;  2K5V A;  4YCU A;  3NBH B;  4P75 A;  4A76 A;  2RHS B;  3KYH C;  1SLJ A;  3HKZ G;  2ZM6 Q;  4A4I A;  4HIM A;  1XPR A;  1HNW L;  3S15 H;  2YV5 A;  1CKM A;  2HIX A;  2VL6 A;  3ULP A;  2BH2 A;  1PH8 A;  3U58 A;  1E24 A;  1JJC B;  1L2F A;  5C44 G;  2JA6 H;  2IX1 A;  2R7Z G;  1NE3 A;  4GOP C;  4B3S Q;  1AE3 A;  2PMZ E;  1JT8 A;  2RF4 A;  4DV0 L;  4P72 A;  3J81 c;  1OXT A;  4JI5 L;  2E2H H;  4IOC A;  4DV7 L;  2OTL A;  1UE7 A;  2QGQ A;  2WAQ E;  1NJI C;  5M3F G;  1K73 C;  1E22 A;  1VQ8 A;  2UXC Q;  1B8A A;  5LMN Q;  3T1H L;  1WJJ A;  3I55 A;  4HJA A;  2CWP A;  2VQF Q;  4LF8 L;  4K0K Q;  3KF8 B;  2WP8 J;  3E9H A;  1D8L A;  4WJ4 A;  1Q82 C;  2VW9 A;  2VZA A;  5BR8 Q;  4DV6 L;  3HOY G;  4IPC A;  3VDY A;  3PO3 H;  2YYZ A;  3M4O H;  3T1Y Q;  4BBR H;  3G4S A;  2MFI A;  3U4Z A;  2H5X A;  1Y14 B;  3BZC A;  4DPG A;  1VQC A;  4BY1 G;  3STB C;  4APV A;  3F2D A;  3ULJ A;  4X64 Q;  1HNX Q;  1VQ6 A;  4BXX H;  1VQK A;  3HOX G;  5ELN A;  4EQ5 A;  2I5H A;  3KOJ A;  2QA4 A;  2B63 G;  2Y0S E;  3G48 A;  1QZG A;  2AWN A;  3UDG A;  1BKB A;  1O7I A;  3F2C A;  1AH9 A;  4Y52 H;  1IBL L;  1YBY A;  5EAY A;  3U50 C;  5C4J H;  3GO5 A;  4BBR G;  2EXD A;  1VCI A;  1OXS C;  4QJF A;  2C35 B;  3M85 A;  4GKK L;  4A3I H;  4LF9 Q;  5C0X G;  5LMN W;  1QVF A;  2OQK A;  4A3M H;  2YTY A;  4A3G H;  1XTD A;  1I5F A;  3RNU A;  1HZC A;  4JCV E;  3OYY A;  4IJH A;  1G51 A;  1Y1V H;  1GO3 E;  3AFQ A;  2WB1 E;  3HOZ H;  2RCN A;  4X62 L;  1SN8 A;  3AQQ A;  1VQF A;  1R9T H;  1S3O A;  4YY3 Q;  4L5S A;  4NXM Q;  2NVY H;  4FDB A;  1EUJ A;  2NVX H;  4AYB E;  5AJ3 Q;  5AJ3 L;  3CCU A;  5LMN L;  4LF6 L;  3PO2 H;  2ZJQ A;  3CD6 A;  1IZ6 A;  4DV5 L;  3PUX A;  1EYG A;  1HNZ Q;  4DR2 Q;  4OX9 L;  4B3R Q;  4GNX A;  1VQ4 A;  1SRU A;  1ASZ A;  4UP9 A;  4LF9 L;  3AYH B;  4A3M G;  1WI5 A;  1TWC H;  2E2I H;  3PSI A;  1YNX A;  5FJ8 H;  3S1N H;  1X56 A;  1EQR A;  1X3F A;  2VS1 A;  4NB3 A;  4DUZ Q;  2B29 A;  5IYB G;  4A3K H;  1L1O A;  3E9I A;  3M4Q A;  4UY8 C;  1X54 A;  5GQO A;  1MIU A;  2K75 A;  2K50 A;  4YY3 L;  3S1Q H;  3I4M H;  1E1O A;  4RG1 A;  4IFD J;  2UUC L;  1IBL Q;  4JI7 Q;  1TWA H;  1Q1E A;  1K3R A;  2R6G A;  4PG3 A;  1EFW A;  4PZ6 A;  2R7F A;  3CC7 A;  1EOV A;  1I3Q H;  1T9H A;  4HJ7 A;  4A3F H;  1PHJ A;  4L5T A;  4LF7 Q;  4DR7 L;  1LM0 A;  2VQE Q;  5IP7 H;  3D0F A;  5IY0 A;  4R1J A;  4A3L G;  1RIP A;  4DR6 Q;  2L15 A;  1PVO A;  3HOW H;  1N32 L;  5DLQ E;  2R92 H;  3L0O A;  3CP0 A;  1NY4 A;  1GKH A;  4A3C G;  2IY5 B;  2GVA A;  3D31 A;  1A0I A;  4ME3 A;  2MO1 A;  4AQY L;  4KI0 A;  4A75 A;  1WYD A;  1IYJ B;  4JI3 Q;  1SE8 A;  3GTK H;  5IYD H;  2VY3 A;  1A63 A;  1Z47 A;  1XPO A;  1P8L A;  4KHZ A;  2HHH Q;  4DR5 L;  3PIO A;  3CC2 A;  5IYC H;  5C4X H;  3S16 H;  1XMO Q;  4DV7 Q;  2IHF A;  2A8V A;  2CFM A;  3GD7 A;  2AWO A;  4DV0 Q;  4OX9 Q;  4JOI C;  4B3R L;  1X3E A;  4R4C A;  3GTQ H;  3F8T A;  4JI2 L;  4GLX A;  4LFA L;  1HZ9 A;  5C0X J;  4A3J H;  3RLF A;  4QQB X;  3HOU G;  2R7Z H;  1SFO H;  2B3G A;  2Q2I A;  5M5X H;  3HOX H;  1GVP A;  4QGU A;  2JA5 H;  1TWF H;  3PUW A;  3CF5 A;  4NPS A;  4JI6 Q;  4GS3 A;  1VQA A;  3STB D;  2DUD A;  3I4O A;  5M3M G;  2KBN A;  1HH2 P;  4JI5 Q;  3I56 A;  4A3E G;  1PH3 A;  4GKK Q;  2Y0S G;  2Q2U A;  5GAH C;  1WOC A;  3NEM A;  3MEF A;  4MNO A;  2PNH A;  4O2D A;  4DUY L;  1IBM Q;  2OQ0 A;  5IYB H;  1X9N A;  3ER0 A;  1LTL A;  3GTL H;  3TRZ A;  2B63 H;  2KHJ A;  1HR0 Q;  1XMO L;  1HJP A;  4YWM A;  2PQA B;  1OXV A;  5IWA Q;  1JJ2 A;  4OWT B;  4JI4 L;  3EIV A;  4JI4 Q;  3CCM A;  4DR5 Q;  2JA7 H;  4AH6 A;  2OWO A;  4AQY Q;  1IL2 A;  2ID0 A;  4A93 G;  3K7U C;  1Y1W H;  1N8R C;  3DLL A;  1LYL A;  2DGY A;  2HIV A;  1NTG A;  2MO0 A;  1K8A C;  1CKN B;  2K52 A;  4POG A;  3J81 j;  1XNR Q;  2AMC B;  4A3L H;  4OXP A;  4LFB L;  3NEL A;  1ASY A;  4B3T L;  3FP9 A;  5C3E G;  2V1C C;  4JI8 Q;  4DR7 Q;  1X65 A;  5LMU L;  3CCL A;  2JK8 A;  2LXJ A;  1PH4 A;  1VQO A;  4GKJ Q;  2R93 H;  3J80 i;  1PH1 A;  3ICE A;  1VQB A;  2KEN A;  2YU9 H;  3K7A H;  5M5W H;  4KHP Q;  5JJK A;  5JJL A;  2JA8 G;  4GLV B;  3GTJ H;  1U0L A;  2CWA A;  3E0E A;  1YHA A;  4JI7 L;  1MJC A;  1XPU A;  3J80 c;  1VQ7 A;  2ALY B;  2F4V L;  1D7Q A;  3S17 H;  1VQN A;  3KDF A;  3A5Z B;  2LXK A;  4B3M L;  3UE1 A;  2PI2 A;  1HZA A;  5C3E H;  4DUZ L;  4UP7 A;  2JA9 A;  3TEH B;  1EQQ A;  3HOV G;  4P71 A;  1K0R A;  3H0G H;  4O0A A;  4IFD I;  3KF6 A;  4C2M H;  4X65 L;  1S72 A;  4LF5 Q;  1G6P A;  4XIG S;  4A3B H;  3H15 A;  3I4M G;  1HNZ L;  4C3J H;  1HNW Q;  4DV5 Q;  3HOZ G;  2F4V Q;  1B70 B;  1N33 L;  3PUY A;  2NN6 I;  1SRO A;  4DV3 L;  4HIO A;  4DV1 Q;  1FVI A;  2ATW A;  4YWL A;  1JE5 A;  1V1Q A;  4A3E H;  2IHE A;  4UP8 A;  3J7A 5;  1E3P A;  1N32 Q;  1VQM A;  1JMC A;  1Q81 C;  1N34 Q;  2ZTD A;  1XNQ L;  3K81 C;  1J6Q A;  3PV0 A;  4OWX B;  1S40 A;  1I94 Q;  1EIY B;  4OO1 I;  1VQI A;  2FXQ A;  2EQS A;  3DM3 A;  4LUV A;  4LW1 A;  2UUB Q;  4IPH A;  2JA7 G;  2CQO A;  4LUO A;  4X6A H;  1UE6 A;  2BA0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...