1LT5D

Heat-labile enterotoxin b-pentamer complexed with thiodigalactoside
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
103
structure length
103
Chain Sequence
APQTITELCSEYRNTQIYTINDKILSYTESMAGKREMVIITFKSGETFQVEVPGSQHIDSQKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAISMKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Enterotoxin
molecule keywords HEAT-LABILE ENTEROTOXIN
publication title Structural foundation for the design of receptor antagonists targeting Escherichia coli heat-labile enterotoxin.
pubmed doi rcsb
source organism Escherichia coli
total genus 24
structure length 103
sequence length 103
chains with identical sequence E, F, G, H
ec nomenclature
pdb deposition date 1997-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1lt5D00
5ELCA 3CHBD 5ELFA 1TS3A 4RHSA 1LTBD 1LT6D 3DWPA 1SEBD 3R8BA 1XTCD 4UDUC 1LTTD 1RCVD 5ELBA 1RDPD 2Z8LA 4RGTA 3BVZA 3KLSX 4RH6A 1SE2A 1LT4D 3GP7A 1BXTA 1D5XC 1CHQD 1DJRD 1PZJD 1AN8A 1FGBD 1PTOD 5TSSA 1I4RA 1MD2D 4OHJA 1TS5A 3EFXD 1JQYD 4O1NA 4RFBA 1I4PA 1PTOC 1JCKB 4L6TB 1EU3A 5D3IB 3EA6A 1D5ZC 1TS2A 3W2DA 1L0XB 2XRQD 1HXYD 1CK1A 2IJ0A 1HA5A 4DXFA 1LTAD 1LTSD 4C56C 3BYTB 4RHRA 1JR0D 1EFID 1EWCA 1V1OA 1V1PA 3MFGA 1KLUD 3O13A 1PRTB 3V05A 1D5MC 2ICIA 1ENFA 2WV6D 2QILA 1EEID 1FNWA 1I4QA 1S5FD 2XN9C 1CT1D 3R2TA 4L63B 2NTTA 1KLGD 1PTOH 4RCOA 1JWUD 1SE3A 1PRTF 1RD9D 1BCPF 1S5CD 3R2IA 1V1PB 2O2LD 1G8ZD 1LTID 3BVMA 3URYA 1LT5D 1T5XD 1DYQA 3SEBA 5FK9C 1PRTD 2AQ1B 1I4HA 1UUPA 2RDHA 3DWQA 1PRTC 2TSSA 1LO5D 4RGMA 1I4GA 1I4XA 1FD7D 1S5BD 1BCPB 1KTKA 1SJED 1XXGA 1PZKD 2XRSD 4RGOS 3MC0B 1D6EC 3OWEB 4TSSA 1FNUA 1ET9A 1TY2A 1STEA 2RDGA 1PZID 1UNSA 1S5DD 1JWMD 1ESFA 1LLRD 2SEBD 1FNVA 1PYWD 1LTRD 1PTOB 3BVGA 1LT3D 1CQVA 1S5ED 2G9HD 4RGNA 5I4DA 5FKAC 1BCPD 1SE4A 1SJHD 1RF2D 2QEJC 2J4XA 3DWAA 1PTOF 1TY0A 1F77A 1LTGD 1JWSD 1GOZA 2AQ2B 1EU4A 5D3DA 1AW7A 1BCPC 2CHBD 1SXTA 2XNAC 3BYYB 1L0YB 1SBBB 1CHPD 5ELEA 4ZYSA 4DXGA 5ELDA 3BZDB 4Z9CB 1EEFD 2AQ3B 1ET6A 2NTSA 1HTLD 2IPKD 4K6LA 1B1ZA 1HQRD 3TSSA 1M4VA 1TS4A 1QILA 2R61A 4BWGB 1B44D
chains in the Genus database with same CATH superfamily
1GO3E 3T56B 4P72A 1K83H 3TMEA 1HR0W 5M3FB 1PFBA 3STBD 4OWWB 5FLMG 2NZ1D 3OSOA 2RSNA 5C6AA 2UU9Q 3GTOH 4DUZL 2O5JC 2K5QA 1SFOB 1ILQA 4G4KA 1VCIA 3CP0A 3HOVB 1QVGA 4B3SQ 4X3TA 4GOPC 4GKJL 4A3GB 4JYAQ 4MTNA 4U68A 1BKBA 3IL8A 4QY7A 4QIWB 1CK1A 4KD3A 3JC66 3M4YA 5C44G 2WINB 1MGSA 4YHHQ 1I6HB 5I2YA 4A3CH 1YNXA 4JI1Q 3M3YH 4FO2A 1U4LA 2FXQA 1JB7A 1Y1WH 4A76A 3A56A 4B9XA 1S5CD 4I7AA 5K36G 1ENCA 4F87A 3NWSA 3H3VC 2BE5C 3Q0AA 4KLKA 2PPBC 1LYLA 2B8GA 4XTCS 4QQBX 4RWSC 1TIID 5IODA 2RA4A 4N9TA 4ODGA 4DAMA 1Q90A 4CBVA 1ML0D 1D7QA 5AJ3Q 3W3AA 4IN3A 4DPGA 3BS1A 1TU2B 2B63H 1MJCA 1Q7YC 3OWEB 3HOYB 1YJ9A 4A3DG 2UU9L 4IUVA 2KHJA 4OL7A 3OMCA 1PZID 1S5DD 1G6PA 1A8VA 3U4ZA 5I9OA 4GOPB 1QUQA 4X66Q 4EQ5A 4B3SL 3AYHB 4R9WA 4JYAL 1DCZA 3E9IA 4DU9A 5KNCA 2JA8H 3J7YW 3QB3A 2NUCA 4HJ8A 1AW7A 3HOWH 2PMZE 1PFMA 2BH8A 1DZ1A 4A3MG 5ELDA 1YI2A 5C3EG 1K8GA 4GKKQ 2F0SA 5EPKA 4C3IH 4YHHL 2K52A 2WAQG 3ZYYX 1Q82C 1IBKQ 2KEDA 5FLXc 3I70A 3ONAB 3HP3A 4F7XA 4PZ7A 3S16B 5JOBA 2IY5B 3NTKA 2I07B 1R4PB 3PO2G 2PZUA 2VQEQ 4CHTB 2PZWA 1EYDA 2F0TA 3U50C 1NCVA 1LT4D 1S3OA 4YCWA 5J39A 1WTHA 1QNKA 2L1BA 2PCFB 5IY0A 3S1NB 1LV9A 3LNNA 1BO0A 3UE0A 5AJ3L 2R7ZG 2B2YC 1CKOA 3N52A 3MXPA 3RZOB 5IIFA 1VQ8A 1M8AA 2SNMA 2K5WA 3P7JA 4DV6Q 4C3HH 3S17H 4PZ6A 1E24A 2MJ8A 4ZUJA 4X66L 5JVH3 4A93G 1EFID 2F0JA 4B9WA 1KLUD 1HRJA 4DFAA 1B7YB 1PRTB 1W6JA 3ND8A 1Q1BA 4R8NA 5FLXE 2K01A 4A3GG 1UWVA 4GN5A 2RQXA 1MSGA 4K6DA 2ID0A 3K5NA 4GKKL 3HOZH 5COYA 4JC0A 1PH2A 1IBKL 1IBLQ 3LX0A 3F2DA 1K3BC 3M85A 5M5YH 2C9OA 1KIXA 2R6GA 4DA2A 1I4XA 3NEMA 1QOHA 1SSOA 3MTSA 3HKZB 4L8JA 4IURA 3RMHA 2PQAA 1EY7A 2BDOA 2VQEL 2XTIA 3HOXH 4A3KH 4IFDJ 1Y8OB 1UNSA 3J81c 2GA4B 2K75A 1PYWD 4KY7A 4PZ8A 2K5HA 3IKJA 1I3QB 2KHIA 3H15A 1T9HA 4RA8A 1V9PA 3CCQA 2Q2IA 4KTAA 2K50A 4OONA 1PTOF 3VR2A 1EU4A 1KHIA 5DAUA 2BOSA 4DV6L 1NBWA 1QJOA 2EYJA 3C46A 1EQQA 1FL0A 4UP7A 4HAEA 1ONLA 2AQ3B 4IFDH 1JE5A 1HTLD 1H9JA 4Y52H 1DGSA 1W2BA 3PO3B 1EWIA 1EYCA 3KBXA 4BWGB 2A6HD 4KD4A 4UHVA 4BA2I 3H3VI 3CC4A 1WCMB 4DR5Q 2JA7H 2N88A 2KCNA 4POFA 4LF4Q 4GLVB 4UDUC 1AZQA 1IBLL 3PUZA 5ELNA 2K04A 3F2UA 5JPMC 1PH7A 1VQ6A 3J81E 4JI5Q 2E2HH 4CKBA 5TSSA 3S2HH 4FNFA 4R1JA 3TS0A 2E74C 1BDOA 3NTHA 1Y1WG 3GTMB 1XTDA 2JQOA 1EYAA 3I4OA 4BBSH 1WJJA 1D5ZC 3S1RH 1TT2A 2MGSA 2PNRC 1E2WA 1Q81C 1TWGB 3MXGA 3CMEA 1XPUA 3S2DB 1JR0D 1V1PA 2B39A 3CRKC 1JJ2A 2JJQA 3AU7A 2FMMA 4XDXA 2J7ZA 2YTYA 2B63G 3D0FA 3V2TA 1VS0A 4OIJA 2R92B 4A3FB 3URYA 2YU9B 3E9HA 1PDQA 2DJFC 1S72A 3PIOA 5C4XG 4G57A 1OO9B 3S14H 1UUPA 3CMAA 1ICFB 4IOAA 4DAYA 1VF5C 2RDHA 4WRDA 1PFSA 5GQOA 3HRZC 2JA8G 1SNOA 1TWFB 4P71A 4DR5L 3PIPA 2K4KA 4LF4L 2SNSA 2JSOA 2XRSD 4DV0Q 1A2TA 4NPSA 4RKLA 4C3IG 1HHVA 4OWTB 2WFWA 5F2DA 3HGBA 1JWMD 4JI5L 3G48A 4BXXG 4YCVA 2VZAA 2FHTA 3KDFA 5IGDA 1SE4A 3TDQA 3KFUA 1JWSD 1QWYA 4ZAIA 4OX9Q 2AKWB 5GADC 5NUCA 1B2TA 3BYYB 3KBGA 3BZDB 4ZQ3A 3AMUA 4HMIA 3WOFA 3S1QB 2EYPA 4K8IA 2VB3X 1CZWA 1T5EA 4LNQA 4K0KQ 2NVQB 1ZEQX 4N8X1 2F03A 3SK5A 1ZYRC 5ELCA 5I9PA 4NXMQ 1MBYA 4APVA 5IP9G 2HIXA 4C2MH 5IT9L 1G51A 4C3HG 4ZCKA 5FO9B 1Q86C 5ELBA 4JW0A 3I8ZA 2ZJQA 2ICEC 1BNZA 2ZXOA 4FF2A 1PH6A 4LK1C 1C9OA 1LM0A 4DN4M 3S1MH 4A3IH 5KNBA 1WTRA 3I91A 5A35A 5GROA 1WCMG 2K05A 2PMZB 1M1KC 1KC8C 3FVQA 4DV0L 1MJEA 3GD7A 3ULLA 3EA6A 1J8IA 2ZT9C 2R93H 2Z4HA 4B3MQ 2CWAA 5IGCA 4HIDA 2JP1A 4YWLA 4X64Q 3SGIA 3CQZB 5BN5A 4DV1Q 4L63B 4OX9L 3CCUA 1IBMQ 2Y0SG 3ERSX 4YCUA 5CC4A 5FO7B 3HOXG 2KCTA 4O42A 4AH6A 3CU7A 1IYUA 5C0XG 2OXPA 1VQ9A 4K0KL 3BJUA 4RKBA 3KF8A 5FLMH 1D1KA 4NXML 3MFYA 1PZKD 3OW2A 2VQFQ 1VF7A 5IYDH 3MC0B 3PGZA 3NSWA 1CQFA 5DLQE 2KVMA 1A3TA 4JI7Q 2RDGA 2WB1E 5IGGA 2DJGC 1TWHB 2PQEA 1YJNA 2AUJD 3SXHA 3NWTA 1TY0A 4YWKA 5D3DA 1JORA 3EROA 4BY1H 1SXTA 1K0SA 5D14A 4UPAA 1O80A 4HMJA 1CUKA 4B3ML 1DOLA 4DAYB 4X64L 5FLXL 4ALPA 5K36H 1FJGQ 3J81j 1H9KA 3DUZA 3SDZA 4DV1L 2FJ2A 1IBML 4LF5Q 4FXKC 2JA9A 2LSSA 2IWHA 2XIWA 5M5XH 4QGUA 2PI2E 4LFAQ 4ZKBB 2CQOA 3GTGH 3PMFA 3NQIA 2MUYA 3WOEA 1J5EQ 5E1FA 1A3UA 3H94A 1X9NA 2F0QA 3MAQA 3SR1A 1TS5A 1YNJD 1JQYD 4RFBA 4HCSA 4QMGA 1BBUA 2VQFL 4PMBA 4UP9A 3M4OH 4JI7L 1TS2A 1JT8A 1MHWC 1F9RA 3CW2C 3IFTA 4AQYQ 4A3MH 1KQSA 5J3BA 2WV6D 5C3EH 3MXUA 3PF4A 4UY8C 1QCBD 4ZUIA 1HNWQ 3OIQA 1G8ZD 1IW7D 1DYQA 2B2TC 1PH5A 1UE7A 1HNXQ 5KIXA 2K6AA 1FJGL 2HQLA 4ILWA 1G6ZA 3OHXC 3RZDB 3PO2H 1X54A 4ZLTF 4LF5L 2KCMA 4GOPA 3PQIA 4S3SA 1B53A 3W1BA 2JA5B 4LFAL 1BCPB 1KTKA 1XXGA 3OIPA 2I5LX 4TSSA 4X62Q 1J5EL 3J81L 4IJLA 3S15B 1HJPA 2XWJB 2SEBD 4P75A 1Q8KA 4HJAA 1QZGA 1YBYA 3J80i 2K14A 3CCEA 5EKIA 1SFOH 1CA6A 2MP1A 4NP5A 4F88A 4H0LC 1IKMA 4A75A 4TVAB 3HOVH 1VQIA 3SK4A 3X3MA 4BBRB 3QR8A 4L5TA 5EJWA 4A3GH 3MHBA 3D4WA 4A3IG 4GS3A 4OO1H 4AQYL 3SK6A 1Q8IA 3KF8B 4C1NK 4CDFC 3UDGA 3A5ZB 1YJWA 1VQBA 3VA5A 1B44D 1VQ4A 1I6HH 2NWGA 4BS9A 2F4VQ 1HNWL 1TS3A 2A6EC 2PI2A 1QVCA 2RHSB 3OPOA 4DK3C 2O5IC 4KHZA 1HNXL 4K14A 4IO9A 2LS01 3PV0A 1N36Q 1RDPD 1X32A 4PMWA 3STBC 2CKZB 2XSCA 3IRBA 3IFDA 1VDZA 1AN8A 1BOSA 1PTOD 2NVTB 1G2SA 2QCPX 5GAHC 1X65A 1JC7A 4V190 5FJ8H 3E5SA 2SOBA 4QF4A 3BDCA 2ENBA 1IYVA 4X62L 4Q0FA 2EIFA 1HZAA 3CC2A 2XRQD 3T4AC 1KAAA 2ZJPA 4JBWA 5DNFA 4A3BG 2F0LA 5CV7A 4P2CB 2Z9HA 1F2MA 1EWCA 2L11A 1V43A 2SDFA 5KEEA 3VA7A 1EIHA 1DXMA 3A7LA 5EQ0A 2QILA 3R2TA 1E22A 3T13A 1TWAB 2EY1A 5C5LA 5JEAG 5IYDG 2D0PA 1WFQA 2WKDA 3U4VA 4X3KA 1TVXA 4DK6C 2IX3A 1LTID 1PYBA 3FHWA 5CBEE 1X3EA 1Y1VG 1MI2A 2AUKA 4WJWA 5I6WA 4LF9Q 3K58A 3D3RA 4B3RQ 1CTMA 1YVCA 2EY6A 2MO0A 2F4VL 5JAVA 4RGMA 1X3QA 3DHQA 2B2YA 1B3AA 4BY1G 1S5BD 5BN4A 4L5SA 1C48A 2OTLA 1YNND 1GUNA 2CH4W 2F3WA 1N36L 2L12A 5HGQA 3H3VH 4HJ5A 3S16H 3HS0C 1PH3A 3J7AV 4WFN3 5T1IA 1K8AC 2ES2A 3ER0A 3VDYA 2I5MX 1PLFA 1S4ZA 4KHVA 4AYBG 1NMFA 2G5DA 5GAGC 4TRDA 1VQKA 2JA5G 1CZGA 1U9RA 2NZOA 2E2JB 1EQTA 3S1NH 5E3FA 1GUWA 2F0WA 3FKIB 3RZOH 3A8JE 4Z9CB 2BDNA 4DF7A 4JI0Q 5JVG3 5HY6A 3A8IE 2Q8RE 3TSSA 3I4NB 2L9HA 1Y14B 2MNAA 1VQOA 5BR8Q 4A3JB 2A74C 5C4XH 2GN5A 1SE8A 3CHBD 4KN4C 4KV6A 2F0VA 1SEBD 2EJGC 3OOCA 4IJHA 4NDXA 1K83B 4XYOA 4MTKA 1BVSA 2IHFA 1PHJA 3GV6A 4LF9L 4FXGC 1N33Q 1Z7TA 2B2WC 1STAA 1CKMA 4B3RL 3GP7A 3I90A 3RLNA 3HG9A 1DOMA 3ULJA 3PUVA 1NR4A 1NTGA 4LFCQ 5EPLA 2Q8TA 4BXXH 3F2BA 1W3SA 1A15A 2UUAQ 3JAMc 1HQMC 1D8LA 3W5OA 4MIUA 1JJCB 4K2KA 4C56C 5KYLA 1XMQQ 3N6RA 5AFWA 1O7ZA 4OIKA 4R4IA 4EQPA 1B50A 3FPPA 5M3MG 1KLGD 2ZJRA 1I3QH 1JWUD 2PO4A 1BCPF 2RCFA 3BU2A 3OW7A 4DR6Q 4JI0L 3CPFA 3IAYA 2MFIA 4DV5Q 5E4XA 1HCZA 2QDBA 5M3FG 3SEBA 5IP9H 2F0NA 1SDFA 1PRTD 4YWMA 3L9AX 1KDAA 3DWQA 4C1NI 5BR8L 2B8FA 3NPPA 4BY7B 3PO3H 3HOVG 1BR9A 3TBIB 2DUDA 1K0RA 1VQGA 3G4SA 1BUVT 2LXJA 1GXDC 2D9UA 2BA0A 2L5TA 2DGYA 5H1SE 1XNRQ 1TY2A 1WCMH 1N33L 3JAME 4OO1G 1ESFA 3UDXA 1OXSC 3C1EA 4LFCL 2EYLA 3DM1A 2B2UC 4JI3Q 4HJ9A 5CYUA 4GLXA 1JOKA 4RGNA 2CFMA 1GUOA 4CJ2C 2KCCA 5KRUA 5C0XJ 2J4XA 4OGQC 5LMNQ 1BBXC 1C7YA 1GOZA 1SAPA 2EYFA 2OQ0A 2UUAL 5CORA 1MIUA 1B4OA 2CHBD 5D65A 3GTMH 1OTCA 1IL2A 1XMQL 2IL8A 1ET6A 2IPKD 5CBAE 3A55A 1RODA 2VUMG 2K03A 5FJ8G 1TWGH 2WKCA 4QUCA 3I73A 3CD6A 3S2DH 2JYOA 5C5MA 2NN6H 3AFQA 2YYZA 5ELFA 5C0XH 3E3XA 2A6HC 3FKIG 1ILPA 3VYRA 4DR6L 4DV5L 4K2LA 3A7AB 4O2DA 1EQRA 3HOYG 3KLSX 3VYTA 3I4NG 3JAMi 4A3FH 4HIOA 2R3ZA 1BXTA 3EJIA 1Y8NB 4DR3Q 1X3GA 4JI4Q 4A3JG 4OWXB 5KYIA 5CV4A 1HZ9A 4O1NA 1U5KA 4FF1A 3CCRA 2JA6B 5ISRA 1E2VA 1SR3A 3FEWX 1SLJA 1GUTA 2MHVA 1XNRL 3PUYA 3A54A 2NB0A 2QDLA 3KJPA 3DEOA 2ALYB 3DM3A 3RN2A 4AIMA 5J1ZA 3I4LA 3RR5A 1F9QA 4JI3L 1M90C 2A68D 1QVFA 1WTWA 1AH9A 3D6CA 3UDFA 2QW7A 3S17B 1I4QA 2XN9C 4RCNA 5LMNL 1A63A 3R3OA 3A8KE 1G291 3OMGA 2VL6A 4RMFA 4MZ9A 1EIFA 3SVMA 1TWCH 1RD9D 4KN7C 4POGA 5A2QE 2UXCQ 2Q8IB 2HCCA 4DNRB 4K5WA 4B08A 5C4HA 5CR3A 3C1FA 4LMQD 3HOUB 4DV4Q 1I50B 1YZ6A 1GKHA 1LO5D 4J8QA 5FO8B 5JPNC 2KHSA 3S1QH 5FOBB 3X3NA 5DM73 2F0EA 4DUYQ 4ULLA 1VQCA 5G3LF 1GVPA 2NVQH 1SJED 4QJFA 1EZ6A 2R7DA 2E2DC 5IYBG 2F0KA 2UUBQ 2E2IB 4EGVA 3WDNA 4XQJA 4DNIA 4DR3L 2NVYB 4NKLA 3KLRA 4JI4L 3BVGA 3GTQH 2D0OA 2CW0D 5FKAC 1VMCA 2A5HA 1LTGD 3UE1A 2XWBB 4GNXC 2A8VA 5ELEA 2YTXA 1CHPD 3I4MB 3C2PA 3KYHC 3NK9A 4GZYC 4KHPQ 4WJ3M 4KI0A 3VR5A 4DR1Q 2ATWA 2KECA 1HQRD 2VB2X 4X65Q 3M7GA 1IXRA 3QG1A 4LW1A 1ASZA 3GTJH 4A3EB 3U9OA 5CV5A 3M4PA 2UXCL 2V4DA 3CQZH 2ZTEA 3HKZG 3MEHA 1LABA 4XT3B 2JA7B 5JJIA 1I6VC 2WAQE 4DV4L 1SE2A 1NR2A 3LGJA 2QKIC 3OYYA 1I4RA 4DUYL 2VNUD 2HD3A 1Y8PB 1QZHA 1KNAA 1I4PA 1KRSA 1SNQA 3RN5A 5IP7G 3H91A 2HDMA 3H09A 3S2HB 1OXUA 2WIIB 5LMUQ 4P73A 2OEOA 5HURA 2UUBL 3K0XA 4N8FA 3PCOB 4XQNA 3Q23A 4JG2A 4P74A 2UXBQ 5M5WB 4BBSB 3S1RB 1C4QA 1V1OA 2BA1A 1Z9FA 4DGZA 3PO3G 1J9OA 4GNXB 1S5FD 1TWHH 4YY3Q 3ITPA 1B8AA 1PRTF 3VR6A 4DV2Q 2CCZA 3R2IA 4TKOB 4KHPL 1STHA 2A1AA 4DR1L 4DR4Q 1VQNA 1S40A 2NBFA 1DONA 2IT1A 4X65L 1NMGA 2P5ZX 1GM5A 1EUJA 2K7VA 1WYDA 2EQSA 3K59A 1O7LA 2PYKA 1C8CA 1H9RA 3H0GB 4KKTA 1CFMA 3GDEA 1FNUA 2DY8A 5JEAJ 1HTPA 1PH9A 1PH8A 3HOUG 4UP8A 1KDCA 1SNDA 2Z6KC 1RKNA 2JN4A 1NUCA 1IL8A 1VQJA 2G9HD 4ZRZA 4ZK9B 2NN6G 1R9TH 4Y7NH 1KRTA 4A3BH 3GTLH 1EY5A 1WTOA 1CSPA 2UUCQ 5LMUL 4IQZA 1IHZA 4IUNA 4L5QA 2R92G 1SMXA 1P8LA 2B2TA 4A3FG 2UXBL 5JEAH 2G9DA 2NTSA 3TZDA 3MA2B 3MWYW 4YIJA 1TS4A 3DLLA 1GUSA 2DNEA 1V1QA 4YY3L 1A3VA 2PW5A 5JJLA 1Y1VH 3EN2A 1KABA 2OWOA 4IFDI 4DV2L 4EX5A 4KJOA 3I4MG 2OQKA 3I55A 4X3UA 4DR4L 3HEJA 2UXDL 3M4QA 1LTTD 2KENA 3NHHA 3KJOA 4XXEA 3RLOA 1SNPA 3TP6A 3J80c 4XYQA 3K0YA 3NE5B 1RJTA 5J22A 1H9MA 4IPHA 1SNMA 3RZDH 1YNJC 3E0JA 1XJVA 3UDIA 2JA5H 1JJGA 4JOIA 2AHOB 3J7ZC 4J6HA 1GJXA 1A0IA 1LTSD 2EY5A 3DMUA 2CH4A 2Q2TA 3MFGA 4CGYB 3BZCA 3S15H 2R93B 3GV3A 3K7AH 2UUCL 1SMYD 2K5DA 4RCOA 1SE3A 1U4RA 2V1CC 2WACA 3A74A 1XPOA 1XX8A 2RKSA 3QJYA 3BDLA 4BBRH 1IW7C 2VUMB 3F1ZA 2A69D 1YHAA 2E76C 2F0OA 3AFPA 4A3LH 1PYSB 1EIYB 3J80E 3FPUB 1HUMA 1B9NA 5IGFA 4RGOS 2C35B 1II3A 1STEA 2GVBA 3W1GA 2F0GA 2I46A 3PUWA 3HKSA 4ZKCB 1LT3D 4O0AA 1CQVA 2Z4IA 1STBA 1BCPD 3GTPB 1EY4A 1F77A 1NAPA 1PFNA 2NVTH 3GQBA 5I6YA 2F0IA 3HFZB 4HTHA 4JVZA 4ZYSA 3D4DA 1STNA 5M3MH 1BQQT 1HUNA 5C44B 3M9BA 4OXPA 1OXVA 1B3QA 4FP5D 3NBHA 4PMCA 5EPJA 4K5VA 3QWNA 2H4OA 1EFWA 2WP8J 2PZTA 1N8RC 4C3JB 1HR0Q 5A2QL 2N55A 5M3FH 1SYEA 1I94Q 1F2YA 2M2LA 1X3FA 4JV5Q 1TWAH 3DWPA 1XTCD 3PIO3 1RCVD 1Z47A 2QA4A 3G6EA 2Z8LA 4CJ0B 2RF4A 5M9OA 5M5XB 3I3CA 4XIGS 3LWEA 4JOIC 2BCOA 1DJRD 4GN3B 2EPBA 4HCEA 4FXDA 3K81C 3PIP3 1R4QB 1WOCA 4H13C 1LTLA 2E8GA 1PTOC 3K5LA 3VYSA 2EYMA 2J0TD 1N32Q 4RG1A 1EZ8A 3CAMA 5ELOA 4A3DB 1EU3A 5D3IB 4IOCA 3S9WA 3CCLA 4DXFA 3QIAA 3FDTA 3L7ZC 4GN4B 1IZ6A 4RAUC 2OTJA 4DAVA 4CDDC 1EEID 4CKCA 2LXKA 3OTOQ 1PH1A 2EXZA 4KK7A 3FRPB 3KF6A 4LF7Q 3H6MA 2KJXA 5EBCA 3M7NA 5C3EB 5IYCH 1RTOA 1T5XD 3E0EA 2E2JH 2F52A 4R4CA 2WAQB 2NZHA 3D6WA 4WJ4A 3FKIH 2B2WA 5E7NA 3MXNB 2VW9A 2EZVA 1HR0L 1SYCA 2I0QA 3PSIA 2NVXB 1I94L 1FD7D 3HOYH 2EJMA 2DY7A 1X56A 3I4NH 2CQAA 2Y0SE 3PF5A 2EE1A 3TP7A 4JV5L 3GTKB 4PV1C 2RSOA 2LY7A 4A3JH 2F0HA 1QB5D 3SK8A 2ZTCA 1C0AA 5DEHA 1YNNC 1QNUA 1FYCA 3L2PA 4IALA 1Z6HA 2RCNA 1LTRD 1PTOB 2C5CA 3TS2A 1Q1EA 4L5RC 2R7ZB 4JI8Q 2IX1A 2TMPA 1N32L 1K9MC 2QEJC 5IT9c 3DWAA 1WVLA 2AQ2B 5C4JB 2RHQB 3KOJA 1N9WA 4G7ZC 2F4IA 1WTQA 1NE3A 2X6GA 4DXGA 4A93B 3KK7A 3RUZA 2RBMA 2B29A 4K6LA 1SNCA 2XGTA 2EYHA 3OTOL 4JBMA 5G3LD 2R61A 1GUGA 4LF7L 2K5NA 4HEDA 2EYOA 4LUVA 3TRZA 1ASYA 5LHY1 1LT6D 3EVQA 1GHJA 2Q2UA 1VMPA 4KKUA 1JMCA 3A5UA 3Q6SA 2ASBA 4IPDA 3MVVA 1UEBA 3KLWA 4C3JG 1E2ZA 1D5XC 5IYBH 1FGBD 2B2UA 5CMDA 2AWOA 3CXCA 2F0FA 4I7ZC 1O7IA 1YHQA 2EXDA 5IT9E 2B2VC 4BY7H 2VXWA 4QB4A 1BBWA 2DNCA 4JBJA 1CI3M 4BBRG 1MKHA 1UE1A 5I2XA 2CWPA 3NBHB 2N49A 1EIGA 2FFKB 1JOQA 4R4TA 2KQ3A 4JI8L 2WB1B 1E7ZA 3J7A5 4A3LG 4N9PA 1CT1D 1Q3LA 2RDFA 4CDCC 4IZ8A 4JK1C 3D4RA 2BE5D 3GTOB 5LL6S 3KUPA 1CKNA 4NB3A 3BVMA 4LJZC 3CKIB 1G2TA 3G7LA 4XT1B 5IWAQ 1PRTC 2TSSA 1A62A 1TR5A 3TP8A 3CCJA 1CM9A 1N34Q 3BDOA 5C3WA 1VQMA 2HCIA 4JI1L 1RL2A 3DEPA 1H9SB 3SE0A 5IP7H 1LLRD 1O78A 3CPWA 3M3YB 5EGTA 1S5ED 2L4NA 3EQLC 2IW3A 1Y1WB 2OT2A 3V96A 4KMUC 4LF6Q 5CGKA 4QUFA 3KF6B 4G7HC 2K32A 4EQOA 1WTPA 4DR2Q 2XNAC 3OWFA 2K5VA 3I7FA 2JA6H 1YHBA 4H02A 1HH2P 1E0BA 2HDLA 1EQVA 2B3GA 1YITA 4HR7B 5C3XA 5GAEC 1QILA 1NNXA 4EQNA 4GLAC 1E3PA 2B63B 1FGUA 1HZBA 1UEAB 4IUQA 4OO1I 2MQHA 1G91A 3QOJA 3I2ZA 5K5PA 1AE3A 3K80C 3R8BA 4HIKA 5C4XB 4B3TQ 1PH4A 2HUGA 2VY3A 2GVAA 1VQEA 3QOLA 4BA1I 1PA6A 2HQEA 5IWAL 1QE6A 2JA8B 3J80L 1PZJD 3HOWB 1HZCA 4JCVE 1SYBA 3EFXD 4IPGA 2M00A 3HOUH 4X3SA 4JPBW 3TEHB 5IYCG 1I50H 1N34L 2DN8A 1JCKB 4L6TB 3ZJYC 4C3IB 3Q24A 2F3IA 3UI2A 4GNXA 3W2DA 3WWVA 3I56A 3Q8DA 2D62A 1K8OA 4LFBQ 3BYTB 4KJNA 2HHHQ 3FMCA 2E2IH 4LF6L 2R92H 2A68C 2NVYH 2YU9H 4DR2L 5KGUA 2K28A 2F0MA 2OF1A 1EL0A 1EY6A 1P16A 1Q12A 1DM0B 1ICWA 1YEZA 1RHPA 1LT5D 2MO1A 2FMCA 1W6KA 2N3SA 2WB1G 1CSQA 1TWFH 3I4MH 1VQAA 2N78A 4KKSA 2FINB 5L37A 4MN3A 2K1BA 1I4GA 2E75C 3NUCA 3HZXA 4H44C 5JJKA 1LACA 1LUZA 4C3HB 2D2CC 1XPRA 3R93A 3G71A 4A3EH 1D6EC 4B3TL 4M8AA 4EVOA 1ET9A 4M1UB 1RTNA 1HFNA 3S24A 4J15A 4DNTB 2HIVA 2I5HA 4FDBA 4LWCA 3ULPA 2H1EA 4H7BA 2EVBA 3NXWA 3CCVA 4FF4A 2L55A 3HOZB 2CW0C 1IKLA 1CKNB 3G6JB 2EJFC 1QUQB 4CDEC 1F9SA 4A3CG 3NBIA 4NW2A 5M5YB 1VQ5A 4LFBL 5LMNW 1EEFD 3K8AA 3NELA 4K8JA 1AZPA 4LAAA 1GD7A 2HHHL 3AEVA 1M4VA 1V8QA 4AYBE 3U9SA 2Y0SB 1J6QA 5M5WH 3VR3A 1AE2A 3KLSA 4UAIA 4BY7G 3A0JA 3HOXB 4PG3A 4A3KB 4DV7Q 1LTBD 4IUPA 2M9VA 3EBEA 1QG7A 2F0UA 4RGTA 1F2ZA 4KY5A 1EY8A 2KBNA 1UAPA 4X6AH 3RNUA 1DD2A 3J7AF 2Z6KA 5IOCA 2EOTA 4WORA 3L0OA 1FVIA 1JE4A 1DOKA 1ZXTA 3T1HQ 4IPCA 1F2LA 1VQLA 2HT1A 2VS1A 1MSHA 1X3PA 5EKLA 3MZ5A 3H0GH 2EDGA 3J81i 3BZKA 1LTAD 3PUXA 2L0CA 4TQUS 4RHRA 1CA5A 3HOWG 3D8GA 1D5MC 3DXJC 2NTTA 1YIJA 2E5LQ 1SYGA 4G7OC 4LUZA 1SRUA 2N8NA 3T1YQ 4Q5VA 2E2HB 1E1TA 3NP8A 3CCMA 1K28A 1TWCB 5IE8A 2QEXA 5FK9C 1RIPA 1A2UA 2AQ1B 1KNEA 4PNYA 3T51B 3T16A 3K5MA 5IGBA 3Q22A 4JBKA 1I5FA 1SN8A 2YV5A 1KD1C 4DV7L 4FF3A 1WI5A 1X55A 3ND9A 2JA6G 1JB3A 5T1GA 1WD1A 3TP5A 2H5XA 1VQPA 1L1OA 4JI6Q 5HGTA 1OXXK 5JJZA 3E6ZX 4OELB 2UXDQ 1TKWB 2PQAB 3T1HL 2MPMA 3LWUA 2Q2HA 5CV8A 2LKVA 1WTVA 2OCEA 1PMRA 3GTQB 3S14B 1L0YB 1SBBB 4MHEA 1WTXA 3RD4A 3TN2A 3K6OA 3K7UC 4QIWE 1HNZQ 1UE5A 3P20A 1SYDA 2LMCB 1TXYA 4U673 1ZYRD 4FYDA 2PW7A 3I72A 4ME5A 1VQ7A 2E5LL 3HOZG 3B6YA 4I65A 1TQOA 4RHSA 3T1YL 1EYGA 3F2CA 3VYUA 4NXNQ 4HN7A 3GTJB 1D2BA 4E6IA 2NN6I 3BVZA 1HPCA 1L0WA 5C0XI 3CC7A 1VQHA 2F0PA 2Z1CA 1PV4A 1AFPA 1MD2D 3NTIA 1AEXA 1STGA 4A3KG 1SROA 2VUMH 4QCLA 5EBDA 1XMOQ 4A4IA 1U4MA 1XYIA 1GHKA 2ZXRA 3F8TA 5BN3A 2KUMA 3GO5A 1WD0A 4JI6L 2IJ0A 3NENA 4DV3Q 3MEFA 1KL9A 1K8MA 3O13A 3CF5A 1VQDA 3V05A 4C2MB 5EAYA 2KOLA 3MXNA 4IFDG 4QL5A 4A3EG 1A6XA 1NSNS 4HJ7A 1SMYC 3GTPH 2JEBI 1V1PB 2O2LD 3VR4A 1IYJB 3BG3A 3T53B 1HNZL 4A3IB 3S1MB 3JAML 4DR7Q 4R4OA 3TZUA 1EOVA 2JA7G 1L1OC 5C44H 2ZTDA 3SHLA 1X6OA 3K57A 1STYA 2KA7A 4R8IA 2Z6BA 1Q46A 2A69C 4ABNA 4V0BA 5E4WC 4NXNL 1XNQQ 4C3JH 2IHEA 2D5DA 2KEEA 4PQXA 4KY6A 3FP9A 1E1OA 1F9PA 1U0LA 1O7YA 4DAPA 1K73C 1UE6A 4BBSG 5I4DA 3D31A 5DM63 1XMOL 1L2FA 2CVRA 3TQYA 1H95A 4CJ1B 3CCSA 1BCPC 3ERQA 1R9TB 2IX0A 3L3OC 2JXMB 3K5OA 4Y7NB 4A3BB 3GTLB 3KDFB 4DV3L 4HSVA 4A3DH 4FVMA 1AP0A 1B1ZA 1KDBA 2RVLA 4HSPA 1NY4A 2Z0SA 2XVSA 1KAWA 5KNDA 1ZKOA 2O4XA 2ZM6Q 1D1IA 4NMZA 4LF8Q 3H0GG 1Y1VB 2LFNA 4OEMB 2ZXPA 1L1OB 5CV9A 4DR7L 4IUUA 4HIMA 4RH6A 3C3LA 2F0DA 1B70B 1OXTA 3QO2A 4DK0A 2L15A 2EY2A 4CKEA 1CHQD 1XWEA 2AMCB 4OHJA 4BY1B 1K3RA 2JE6I 3TREA 1XNQL 4J1MA 1EY9A 3NQTA 5LL6X 2NVXH 3HKZE 5C4ZA 1KXLA 4DK1A 1L0XB 1HXYD 2JK8A 2QGQA 1HA5A 3GTKH 4JI2Q 4IUTA 3AQQA 4AYBB 1VQFA 2ICIA 1ENFA 1FNWA 1PTOH 2A19A 2R7FA 1B9MA 3GTGB 2R7ZH 2NYZD 3P75A 3EIVA 3P1HA 4MNOA 5CV6A 1EOTA 3K7AB 4F8MA 1HFGA 5C4JH 1EWHA 3U58A 3ICEA 1ENAA 1JICA 2K33A 4ID6A 4LUOA 1I4HA 1U4PA 4DUZQ 2PNHA 4A93H 2X69A 5IGEA 4R4QA 2AWNA 1H9SA 3M4OB 1PXUA 1NJIC 4ME3A 2ZM6L 4LF8L 4GKJQ 2B2VA 3AB9A 2YTVA 4A3MB 2JEAI 2X6LA 2BH2A 1FNVA 4DKAC 1BF4A 1JOOA 1SJHD 1RF2D 2R93G 4K5XA 4XQQA 1PVOA 3CRLC 1FR3A 5EKKA 2F1MA 1Y69U 4JI2L 3PO2B 1ESRA 3RLFA 2F3VA 2QF7A 1HA6A 2A73B 5M3MB 1EY0A 2A6ED 1SYFA
chains in the Genus database with same CATH topology
3T56B 3TMEA 5M3FB 1PFBA 2NZ1D 3OSOA 2RSNA 5C6AA 2O5JC 2K5QA 1SFOB 1ILQA 4G4KA 1VCIA 3HOVB 4X3TA 4A3GB 4U68A 3IL8A 4QIWB 1CK1A 4KD3A 3M4YA 2WINB 1MGSA 1I6HB 5I2YA 4FO2A 1U4LA 3A56A 4B9XA 1S5CD 5K36G 1ENCA 4F87A 3NWSA 3H3VC 2BE5C 3Q0AA 2PPBC 2B8GA 4XTCS 4RWSC 1TIID 5IODA 2RA4A 4N9TA 4ODGA 1Q90A 4CBVA 1ML0D 3W3AA 4IN3A 3BS1A 1TU2B 3OWEB 3HOYB 4IUVA 4OL7A 3OMCA 1PZID 1S5DD 5I9OA 4R9WA 1DCZA 4DU9A 5KNCA 3J7YW 3QB3A 2NUCA 1AW7A 1PFMA 1DZ1A 5ELDA 2F0SA 5EPKA 3ZYYX 2KEDA 3I70A 3ONAB 3HP3A 4F7XA 3S16B 5JOBA 3NTKA 2I07B 1R4PB 2PZUA 4CHTB 2PZWA 1EYDA 2F0TA 1NCVA 1LT4D 5J39A 2L1BA 1QNKA 2PCFB 3S1NB 1LV9A 3LNNA 1BO0A 2B2YC 3N52A 3MXPA 3RZOB 5IIFA 1M8AA 2SNMA 2K5WA 3P7JA 4ZUJA 2MJ8A 5JVH3 1EFID 2F0JA 4B9WA 1KLUD 1HRJA 4DFAA 1PRTB 1W6JA 3ND8A 1Q1BA 4R8NA 5FLXE 2K01A 2RQXA 1MSGA 4K6DA 2ID0A 3K5NA 5COYA 3LX0A 3M85A 2C9OA 2R6GA 4DA2A 1I4XA 3MTSA 1QOHA 1SSOA 3HKZB 4L8JA 4IURA 3RMHA 1EY7A 2BDOA 4IFDJ 1Y8OB 1UNSA 2GA4B 1PYWD 4KY7A 3IKJA 1I3QB 4RA8A 4KTAA 1PTOF 3VR2A 1EU4A 5DAUA 2BOSA 1QJOA 2EYJA 3C46A 4HAEA 1ONLA 2AQ3B 4IFDH 1HTLD 1H9JA 3PO3B 1EYCA 3KBXA 4BWGB 2A6HD 4KD4A 4BA2I 1WCMB 2N88A 2KCNA 4UDUC 1AZQA 3PUZA 2K04A 3F2UA 5JPMC 3J81E 4CKBA 5TSSA 4FNFA 2E74C 1BDOA 3NTHA 3GTMB 1EYAA 1D5ZC 1TT2A 2MGSA 2PNRC 1E2WA 1TWGB 3MXGA 3S2DB 1JR0D 1V1PA 2B39A 3CRKC 3AU7A 2FMMA 4XDXA 2J7ZA 3V2TA 4OIJA 2R92B 4A3FB 3URYA 2YU9B 1PDQA 4G57A 1OO9B 1UUPA 4DAYA 1VF5C 2RDHA 4WRDA 3HRZC 1SNOA 1TWFB 2SNSA 2JSOA 2XRSD 1A2TA 4RKLA 4C3IG 1HHVA 5F2DA 3HGBA 1JWMD 2FHTA 5IGDA 1SE4A 3TDQA 1QWYA 1JWSD 4ZAIA 5NUCA 1B2TA 3BYYB 3KBGA 3BZDB 4ZQ3A 3AMUA 4HMIA 3WOFA 3S1QB 2EYPA 4K8IA 2VB3X 1CZWA 1T5EA 2NVQB 1ZEQX 2F03A 3SK5A 1ZYRC 5ELCA 5I9PA 1MBYA 5IT9L 4C3HG 5FO9B 5ELBA 3I8ZA 2ICEC 1BNZA 2ZXOA 4FF2A 4LK1C 4DN4M 5KNBA 1WTRA 3I91A 5A35A 2K05A 2PMZB 3FVQA 3GD7A 3EA6A 1J8IA 2ZT9C 2Z4HA 5IGCA 2JP1A 3CQZB 5BN5A 4L63B 5CC4A 5FO7B 4O42A 3CU7A 1IYUA 5C0XG 2OXPA 4RKBA 3KF8A 1D1KA 3MFYA 1PZKD 1VF7A 3MC0B 3NSWA 1CQFA 2KVMA 1A3TA 2RDGA 5IGGA 1TWHB 2PQEA 2AUJD 3SXHA 3NWTA 1TY0A 5D3DA 1JORA 3EROA 1SXTA 5D14A 1O80A 4HMJA 1DOLA 5FLXL 5K36H 1H9KA 3DUZA 3SDZA 2FJ2A 4FXKC 2IWHA 2XIWA 4ZKBB 3PMFA 3NQIA 2MUYA 3WOEA 5E1FA 1A3UA 3H94A 2F0QA 3MAQA 3SR1A 1TS5A 1YNJD 1JQYD 4RFBA 4HCSA 4QMGA 4PMBA 1TS2A 1F9RA 3IFTA 2WV6D 3MXUA 1QCBD 4ZUIA 3OIQA 1G8ZD 1IW7D 1DYQA 2B2TC 5KIXA 2K6AA 4ILWA 1G6ZA 3OHXC 3RZDB 4ZLTF 2JA5B 4S3SA 1B53A 1BCPB 1KTKA 1XXGA 3OIPA 4TSSA 3J81L 3S15B 2XWJB 2SEBD 5EKIA 1CA6A 2MP1A 4NP5A 4F88A 4H0LC 1IKMA 3SK4A 3X3MA 4BBRB 5EJWA 3MHBA 3D4WA 4OO1H 3SK6A 1Q8IA 4C1NK 3VA5A 1B44D 2NWGA 4BS9A 1TS3A 2A6EC 3OPOA 2O5IC 4KHZA 4K14A 2LS01 3PV0A 1RDPD 1X32A 4PMWA 2XSCA 3IFDA 1VDZA 1AN8A 1BOSA 1PTOD 2NVTB 1G2SA 2QCPX 1JC7A 4V190 3E5SA 2SOBA 4QF4A 3BDCA 2ENBA 1IYVA 4Q0FA 2XRQD 3T4AC 1KAAA 4JBWA 5DNFA 2F0LA 5CV7A 4P2CB 1F2MA 1EWCA 2L11A 1V43A 2SDFA 5KEEA 3VA7A 1EIHA 1DXMA 3A7LA 5EQ0A 2QILA 3R2TA 3T13A 1TWAB 2EY1A 5C5LA 5JEAG 2WKDA 4X3KA 1TVXA 2IX3A 1LTID 5CBEE 1MI2A 2AUKA 4WJWA 5I6WA 3K58A 3D3RA 1CTMA 2EY6A 5JAVA 4RGMA 1X3QA 3DHQA 2B2YA 1B3AA 1S5BD 5BN4A 1C48A 1YNND 1GUNA 2F3WA 2L12A 3HS0C 3J7AV 4WFN3 5T1IA 1PLFA 1S4ZA 4KHVA 4TRDA 1CZGA 1U9RA 2E2JB 1EQTA 5E3FA 1GUWA 2F0WA 3FKIB 3A8JE 4Z9CB 2BDNA 4DF7A 5JVG3 3A8IE 2Q8RE 3TSSA 3I4NB 2L9HA 4A3JB 2A74C 3CHBD 4KN4C 4KV6A 2F0VA 1SEBD 2EJGC 3OOCA 4NDXA 1K83B 4XYOA 3GV6A 4FXGC 1Z7TA 2B2WC 1STAA 3GP7A 3I90A 3HG9A 1DOMA 3PUVA 1NR4A 5EPLA 2Q8TA 1A15A 1HQMC 4MIUA 4K2KA 4C56C 5KYLA 3N6RA 5AFWA 1O7ZA 4OIKA 4EQPA 1B50A 3FPPA 1KLGD 1JWUD 2PO4A 1BCPF 3OW7A 3IAYA 5E4XA 1HCZA 2QDBA 3SEBA 2F0NA 1SDFA 1PRTD 3L9AX 1KDAA 3DWQA 4C1NI 2B8FA 3NPPA 4BY7B 1BR9A 3TBIB 1BUVT 1GXDC 2D9UA 2BA0A 2L5TA 1TY2A 3JAME 4OO1G 1ESFA 1OXSC 3C1EA 2EYLA 3DM1A 2B2UC 5CYUA 1JOKA 4RGNA 1GUOA 4CJ2C 2KCCA 5KRUA 5C0XJ 2J4XA 4OGQC 1BBXC 1GOZA 1SAPA 2EYFA 5CORA 1B4OA 2CHBD 5D65A 2IL8A 1ET6A 2IPKD 5CBAE 3A55A 1RODA 2K03A 2WKCA 4QUCA 3I73A 2JYOA 5C5MA 2NN6H 2YYZA 5ELFA 5C0XH 2A6HC 1ILPA 3VYRA 4K2LA 3A7AB 3KLSX 3VYTA 2R3ZA 1BXTA 3EJIA 1Y8NB 5KYIA 5CV4A 4O1NA 4FF1A 2JA6B 5ISRA 1E2VA 3FEWX 1GUTA 2MHVA 3PUYA 3A54A 2NB0A 3DEOA 5J1ZA 3I4LA 1F9QA 2A68D 1WTWA 3D6CA 3S17B 1I4QA 2XN9C 4RCNA 3R3OA 3A8KE 1G291 3OMGA 3SVMA 1RD9D 4KN7C 5A2QE 2Q8IB 2HCCA 4DNRB 4K5WA 4B08A 5C4HA 5CR3A 3C1FA 4LMQD 3HOUB 1I50B 1LO5D 4J8QA 5FO8B 5JPNC 2KHSA 5FOBB 3X3NA 5DM73 2F0EA 4ULLA 5G3LF 1SJED 1EZ6A 2E2DC 2F0KA 2E2IB 4EGVA 3WDNA 4XQJA 2NVYB 4NKLA 3KLRA 3BVGA 2CW0D 5FKAC 1VMCA 2A5HA 1LTGD 2XWBB 5ELEA 3I4MB 1CHPD 3C2PA 3NK9A 4GZYC 4KI0A 3VR5A 2KECA 1HQRD 2VB2X 3M7GA 3QG1A 4A3EB 3U9OA 5CV5A 2V4DA 3MEHA 1LABA 4XT3B 2JA7B 1I6VC 1SE2A 1NR2A 2QKIC 1I4RA 2VNUD 1Y8PB 1KNAA 1I4PA 1SNQA 3H91A 2HDMA 3H09A 3S2HB 1OXUA 2WIIB 5HURA 2OEOA 4XQNA 3Q23A 5M5WB 4BBSB 3S1RB 1C4QA 1V1OA 2BA1A 4DGZA 1J9OA 1S5FD 3ITPA 1PRTF 3VR6A 3R2IA 4TKOB 1STHA 2NBFA 1DONA 2IT1A 2K7VA 3K59A 1O7LA 2PYKA 1C8CA 1H9RA 3H0GB 4KKTA 1CFMA 1FNUA 2DY8A 5JEAJ 1HTPA 1KDCA 1SNDA 1RKNA 1NUCA 1IL8A 2G9HD 4ZRZA 4ZK9B 2NN6G 1EY5A 1WTOA 4IQZA 1IHZA 4IUNA 2B2TA 5JEAH 2G9DA 2NTSA 3TZDA 3MA2B 3MWYW 4YIJA 1TS4A 1GUSA 2DNEA 1A3VA 2PW5A 1KABA 4IFDI 4KJOA 4X3UA 3HEJA 1LTTD 3NHHA 4XXEA 1SNPA 3TP6A 4XYQA 3K0YA 3NE5B 1RJTA 5J22A 1H9MA 1SNMA 1YNJC 3E0JA 1GJXA 4J6HA 2EY5A 1LTSD 3DMUA 3MFGA 4CGYB 2R93B 3GV3A 1SMYD 2K5DA 4RCOA 1SE3A 1U4RA 2WACA 1XX8A 2RKSA 3QJYA 3BDLA 1IW7C 2VUMB 2A69D 2E76C 2F0OA 3J80E 3FPUB 1HUMA 1B9NA 5IGFA 4RGOS 1II3A 1STEA 2F0GA 2I46A 3PUWA 4ZKCB 1LT3D 1CQVA 2Z4IA 1STBA 1BCPD 3GTPB 1EY4A 1F77A 1NAPA 1PFNA 3GQBA 5I6YA 2F0IA 4HTHA 4ZYSA 3D4DA 1STNA 1BQQT 1HUNA 5C44B 1OXVA 4FP5D 3NBHA 4PMCA 5EPJA 4K5VA 3QWNA 2H4OA 2WP8J 2PZTA 4C3JB 5A2QL 2N55A 1SYEA 1F2YA 2M2LA 3DWPA 1XTCD 3PIO3 1RCVD 1Z47A 2Z8LA 4CJ0B 5M9OA 5M5XB 3I3CA 4XIGS 3LWEA 2BCOA 1DJRD 4HCEA 2EPBA 4FXDA 3PIP3 1R4QB 4H13C 3K5LA 1PTOC 3VYSA 2EYMA 2J0TD 1EZ8A 4A3DB 1EU3A 5D3IB 3S9WA 4DXFA 3QIAA 3FDTA 3L7ZC 4RAUC 4DAVA 1EEID 4CKCA 2EXZA 4KK7A 3FRPB 3H6MA 2KJXA 5EBCA 3M7NA 5C3EB 1RTOA 1T5XD 2WAQB 3D6WA 2B2WA 2EZVA 1SYCA 2NVXB 1FD7D 2EJMA 2DY7A 2CQAA 2EE1A 3TP7A 3GTKB 4PV1C 2RSOA 2LY7A 2F0HA 1QB5D 3SK8A 5DEHA 1YNNC 1QNUA 1FYCA 4IALA 1Z6HA 1LTRD 1PTOB 2C5CA 1Q1EA 2R7ZB 2IX1A 2TMPA 2QEJC 3DWAA 1WVLA 2AQ2B 5C4JB 4G7ZC 2F4IA 1WTQA 2X6GA 4DXGA 4A93B 3KK7A 3RUZA 2RBMA 4K6LA 1SNCA 2EYHA 5G3LD 2R61A 1GUGA 4HEDA 2EYOA 5LHY1 1LT6D 3EVQA 1GHJA 1VMPA 4KKUA 3Q6SA 3MVVA 4C3JG 1E2ZA 1D5XC 1FGBD 2B2UA 5CMDA 2AWOA 2F0FA 4I7ZC 5IT9E 2B2VC 2VXWA 4QB4A 2DNCA 1CI3M 5I2XA 1EIGA 2FFKB 1JOQA 2KQ3A 2WB1B 4N9PA 1CT1D 1Q3LA 2RDFA 4IZ8A 4JK1C 3D4RA 2BE5D 3GTOB 5LL6S 3KUPA 3BVMA 4LJZC 3CKIB 1G2TA 3G7LA 4XT1B 1PRTC 2TSSA 1TR5A 3TP8A 1CM9A 3BDOA 5C3WA 2HCIA 3DEPA 1H9SB 3SE0A 1LLRD 1O78A 3M3YB 5EGTA 1S5ED 2L4NA 3EQLC 2IW3A 1Y1WB 2OT2A 3V96A 4KMUC 5CGKA 4QUFA 1WTPA 4G7HC 2K32A 4EQOA 2XNAC 3OWFA 1E0BA 2HDLA 1EQVA 4HR7B 5C3XA 1QILA 4EQNA 2B63B 1UEAB 4IUQA 4OO1I 1G91A 3QOJA 5K5PA 3R8BA 5C4XB 2HUGA 4BA1I 3QOLA 2HQEA 1QE6A 2JA8B 3J80L 1PZJD 3HOWB 1SYBA 3EFXD 2M00A 4X3SA 2DN8A 1JCKB 4L6TB 4C3IB 3Q24A 3UI2A 3W2DA 2D62A 1K8OA 3BYTB 4KJNA 3FMCA 2A68C 5KGUA 2K28A 2F0MA 2OF1A 1EL0A 1EY6A 1Q12A 1DM0B 1ICWA 1RHPA 1LT5D 2FMCA 1W6KA 4KKSA 2FINB 4MN3A 2K1BA 1I4GA 2E75C 3NUCA 3HZXA 4H44C 1LACA 4C3HB 2D2CC 3R93A 1D6EC 4M8AA 4EVOA 1ET9A 4M1UB 1RTNA 1HFNA 4DNTB 2H1EA 4H7BA 2EVBA 3NXWA 4FF4A 2L55A 3HOZB 2CW0C 1IKLA 3G6JB 2EJFC 1F9SA 3NBIA 4NW2A 5M5YB 1EEFD 4K8JA 1AZPA 4LAAA 1M4VA 1V8QA 3U9SA 2Y0SB 3VR3A 3KLSA 4UAIA 3HOXB 4A3KB 1LTBD 4IUPA 2M9VA 1QG7A 2F0UA 4RGTA 1F2ZA 4KY5A 1EY8A 1UAPA 1DD2A 3J7AF 5IOCA 2EOTA 4WORA 1JE4A 1DOKA 1ZXTA 1F2LA 1MSHA 1X3PA 5EKLA 3MZ5A 2EDGA 1LTAD 3PUXA 2L0CA 4TQUS 4RHRA 1CA5A 3D8GA 1D5MC 3DXJC 2NTTA 1SYGA 4G7OC 4Q5VA 2E2HB 3NP8A 1TWCB 5FK9C 1A2UA 2AQ1B 1KNEA 4PNYA 3T51B 3T16A 3K5MA 5IGBA 3Q22A 4FF3A 3ND9A 1JB3A 5T1GA 1WD1A 3TP5A 5HGTA 1OXXK 5JJZA 3E6ZX 1TKWB 2MPMA 3LWUA 5CV8A 2LKVA 1WTVA 1PMRA 3GTQB 3S14B 1L0YB 1SBBB 4MHEA 1WTXA 3RD4A 3TN2A 3K6OA 3P20A 1SYDA 2LMCB 4U673 1ZYRD 4FYDA 2PW7A 3I72A 4ME5A 4I65A 1TQOA 4RHSA 3VYUA 4HN7A 3GTJB 1D2BA 4E6IA 2NN6I 3BVZA 1HPCA 5C0XI 2F0PA 2Z1CA 1AFPA 1MD2D 3NTIA 1AEXA 1STGA 4QCLA 5EBDA 1U4MA 1XYIA 1GHKA 2ZXRA 5BN3A 2KUMA 3GO5A 1WD0A 2IJ0A 3O13A 1K8MA 3V05A 4C2MB 2KOLA 3MXNA 4IFDG 1A6XA 1NSNS 1SMYC 2JEBI 1V1PB 2O2LD 3VR4A 3BG3A 3T53B 3S1MB 4A3IB 3JAML 3TZUA 3SHLA 3K57A 1STYA 2KA7A 4R8IA 2A69C 4ABNA 4V0BA 5E4WC 2D5DA 2KEEA 4PQXA 4KY6A 1F9PA 1O7YA 4DAPA 5I4DA 3D31A 5DM63 2CVRA 4CJ1B 1BCPC 3ERQA 1R9TB 2IX0A 3L3OC 2JXMB 3K5OA 4Y7NB 4A3BB 3GTLB 4HSVA 4FVMA 1AP0A 1B1ZA 1KDBA 2RVLA 4HSPA 2XVSA 5KNDA 1ZKOA 2O4XA 1D1IA 4NMZA 1Y1VB 2LFNA 2ZXPA 5CV9A 4IUUA 4RH6A 3C3LA 2F0DA 4DK0A 1OXTA 3QO2A 4CKEA 2EY2A 1CHQD 1XWEA 4OHJA 4BY1B 2JE6I 4J1MA 1EY9A 3NQTA 5LL6X 5C4ZA 4DK1A 1L0XB 1HXYD 1HA5A 4IUTA 4AYBB 2ICIA 1ENFA 1FNWA 1PTOH 1B9MA 3GTGB 2NYZD 3P75A 3P1HA 5CV6A 1EOTA 3K7AB 4F8MA 1HFGA 1EWHA 1ENAA 1JICA 2K33A 4ID6A 1I4HA 1U4PA 2X69A 5IGEA 2AWNA 1H9SA 3M4OB 1PXUA 2B2VA 3AB9A 4A3MB 2JEAI 2X6LA 1FNVA 1BF4A 1JOOA 1SJHD 1RF2D 4K5XA 4XQQA 3CRLC 1FR3A 5EKKA 2F1MA 1Y69U 3PO2B 1ESRA 3RLFA 2F3VA 2QF7A 1HA6A 2A73B 5M3MB 1EY0A 2A6ED 1SYFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ELC A;  3CHB D;  5ELF A;  1TS3 A;  4RHS A;  1LTB D;  1LT6 D;  3DWP A;  1SEB D;  3R8B A;  1XTC D;  4UDU C;  1LTT D;  1RCV D;  5ELB A;  1RDP D;  2Z8L A;  4RGT A;  3BVZ A;  3KLS X;  4RH6 A;  1SE2 A;  1LT4 D;  3GP7 A;  1BXT A;  1D5X C;  1CHQ D;  1DJR D;  1PZJ D;  1AN8 A;  1FGB D;  1PTO D;  5TSS A;  1I4R A;  1MD2 D;  4OHJ A;  1TS5 A;  3EFX D;  1JQY D;  4O1N A;  4RFB A;  1I4P A;  1PTO C;  1JCK B;  4L6T B;  1EU3 A;  5D3I B;  3EA6 A;  1D5Z C;  1TS2 A;  3W2D A;  1L0X B;  2XRQ D;  1HXY D;  1CK1 A;  2IJ0 A;  1HA5 A;  4DXF A;  1LTA D;  1LTS D;  4C56 C;  3BYT B;  4RHR A;  1JR0 D;  1EFI D;  1EWC A;  1V1O A;  1V1P A;  3MFG A;  1KLU D;  3O13 A;  1PRT B;  3V05 A;  1D5M C;  2ICI A;  1ENF A;  2WV6 D;  2QIL A;  1EEI D;  1FNW A;  1I4Q A;  1S5F D;  2XN9 C;  1CT1 D;  3R2T A;  4L63 B;  2NTT A;  1KLG D;  1PTO H;  4RCO A;  1JWU D;  1SE3 A;  1PRT F;  1RD9 D;  1BCP F;  1S5C D;  3R2I A;  1V1P B;  2O2L D;  1G8Z D;  1LTI D;  3BVM A;  3URY A;  1LT5 D;  1T5X D;  1DYQ A;  3SEB A;  5FK9 C;  1PRT D;  2AQ1 B;  1I4H A;  1UUP A;  2RDH A;  3DWQ A;  1PRT C;  2TSS A;  1LO5 D;  4RGM A;  1I4G A;  1I4X A;  1FD7 D;  1S5B D;  1BCP B;  1KTK A;  1SJE D;  1XXG A;  1PZK D;  2XRS D;  4RGO S;  3MC0 B;  1D6E C;  3OWE B;  4TSS A;  1FNU A;  1ET9 A;  1TY2 A;  1STE A;  2RDG A;  1PZI D;  1UNS A;  1S5D D;  1JWM D;  1ESF A;  1LLR D;  2SEB D;  1FNV A;  1PYW D;  1LTR D;  1PTO B;  3BVG A;  1LT3 D;  1CQV A;  1S5E D;  2G9H D;  4RGN A;  5I4D A;  5FKA C;  1BCP D;  1SE4 A;  1SJH D;  1RF2 D;  2QEJ C;  2J4X A;  3DWA A;  1PTO F;  1TY0 A;  1F77 A;  1LTG D;  1JWS D;  1GOZ A;  2AQ2 B;  1EU4 A;  5D3D A;  1AW7 A;  1BCP C;  2CHB D;  1SXT A;  2XNA C;  3BYY B;  1L0Y B;  1SBB B;  1CHP D;  5ELE A;  4ZYS A;  4DXG A;  5ELD A;  3BZD B;  4Z9C B;  1EEF D;  2AQ3 B;  1ET6 A;  2NTS A;  1HTL D;  2IPK D;  4K6L A;  1B1Z A;  1HQR D;  3TSS A;  1M4V A;  1TS4 A;  1QIL A;  2R61 A;  4BWG B;  1B44 D; 
#chains in the Genus database with same CATH topology
 1GO3 E;  3T56 B;  4P72 A;  1K83 H;  3TME A;  1HR0 W;  5M3F B;  1PFB A;  3STB D;  4OWW B;  5FLM G;  2NZ1 D;  3OSO A;  2RSN A;  5C6A A;  2UU9 Q;  3GTO H;  4DUZ L;  2O5J C;  2K5Q A;  1SFO B;  1ILQ A;  4G4K A;  1VCI A;  3CP0 A;  3HOV B;  1QVG A;  4B3S Q;  4X3T A;  4GOP C;  4GKJ L;  4A3G B;  4JYA Q;  4MTN A;  4U68 A;  1BKB A;  3IL8 A;  4QY7 A;  4QIW B;  1CK1 A;  4KD3 A;  3JC6 6;  3M4Y A;  5C44 G;  2WIN B;  1MGS A;  4YHH Q;  1I6H B;  5I2Y A;  4A3C H;  1YNX A;  4JI1 Q;  3M3Y H;  4FO2 A;  1U4L A;  2FXQ A;  1JB7 A;  1Y1W H;  4A76 A;  3A56 A;  4B9X A;  1S5C D;  4I7A A;  5K36 G;  1ENC A;  4F87 A;  3NWS A;  3H3V C;  2BE5 C;  3Q0A A;  4KLK A;  2PPB C;  1LYL A;  2B8G A;  4XTC S;  4QQB X;  4RWS C;  1TII D;  5IOD A;  2RA4 A;  4N9T A;  4ODG A;  4DAM A;  1Q90 A;  4CBV A;  1ML0 D;  1D7Q A;  5AJ3 Q;  3W3A A;  4IN3 A;  4DPG A;  3BS1 A;  1TU2 B;  2B63 H;  1MJC A;  1Q7Y C;  3OWE B;  3HOY B;  1YJ9 A;  4A3D G;  2UU9 L;  4IUV A;  2KHJ A;  4OL7 A;  3OMC A;  1PZI D;  1S5D D;  1G6P A;  1A8V A;  3U4Z A;  5I9O A;  4GOP B;  1QUQ A;  4X66 Q;  4EQ5 A;  4B3S L;  3AYH B;  4R9W A;  4JYA L;  1DCZ A;  3E9I A;  4DU9 A;  5KNC A;  2JA8 H;  3J7Y W;  3QB3 A;  2NUC A;  4HJ8 A;  1AW7 A;  3HOW H;  2PMZ E;  1PFM A;  2BH8 A;  1DZ1 A;  4A3M G;  5ELD A;  1YI2 A;  5C3E G;  1K8G A;  4GKK Q;  2F0S A;  5EPK A;  4C3I H;  4YHH L;  2K52 A;  2WAQ G;  3ZYY X;  1Q82 C;  1IBK Q;  2KED A;  5FLX c;  3I70 A;  3ONA B;  3HP3 A;  4F7X A;  4PZ7 A;  3S16 B;  5JOB A;  2IY5 B;  3NTK A;  2I07 B;  1R4P B;  3PO2 G;  2PZU A;  2VQE Q;  4CHT B;  2PZW A;  1EYD A;  2F0T A;  3U50 C;  1NCV A;  1LT4 D;  1S3O A;  4YCW A;  5J39 A;  1WTH A;  1QNK A;  2L1B A;  2PCF B;  5IY0 A;  3S1N B;  1LV9 A;  3LNN A;  1BO0 A;  3UE0 A;  5AJ3 L;  2R7Z G;  2B2Y C;  1CKO A;  3N52 A;  3MXP A;  3RZO B;  5IIF A;  1VQ8 A;  1M8A A;  2SNM A;  2K5W A;  3P7J A;  4DV6 Q;  4C3H H;  3S17 H;  4PZ6 A;  1E24 A;  2MJ8 A;  4ZUJ A;  4X66 L;  5JVH 3;  4A93 G;  1EFI D;  2F0J A;  4B9W A;  1KLU D;  1HRJ A;  4DFA A;  1B7Y B;  1PRT B;  1W6J A;  3ND8 A;  1Q1B A;  4R8N A;  5FLX E;  2K01 A;  4A3G G;  1UWV A;  4GN5 A;  2RQX A;  1MSG A;  4K6D A;  2ID0 A;  3K5N A;  4GKK L;  3HOZ H;  5COY A;  4JC0 A;  1PH2 A;  1IBK L;  1IBL Q;  3LX0 A;  3F2D A;  1K3B C;  3M85 A;  5M5Y H;  2C9O A;  1KIX A;  2R6G A;  4DA2 A;  1I4X A;  3NEM A;  1QOH A;  1SSO A;  3MTS A;  3HKZ B;  4L8J A;  4IUR A;  3RMH A;  2PQA A;  1EY7 A;  2BDO A;  2VQE L;  2XTI A;  3HOX H;  4A3K H;  4IFD J;  1Y8O B;  1UNS A;  3J81 c;  2GA4 B;  2K75 A;  1PYW D;  4KY7 A;  4PZ8 A;  2K5H A;  3IKJ A;  1I3Q B;  2KHI A;  3H15 A;  1T9H A;  4RA8 A;  1V9P A;  3CCQ A;  2Q2I A;  4KTA A;  2K50 A;  4OON A;  1PTO F;  3VR2 A;  1EU4 A;  1KHI A;  5DAU A;  2BOS A;  4DV6 L;  1NBW A;  1QJO A;  2EYJ A;  3C46 A;  1EQQ A;  1FL0 A;  4UP7 A;  4HAE A;  1ONL A;  2AQ3 B;  4IFD H;  1JE5 A;  1HTL D;  1H9J A;  4Y52 H;  1DGS A;  1W2B A;  3PO3 B;  1EWI A;  1EYC A;  3KBX A;  4BWG B;  2A6H D;  4KD4 A;  4UHV A;  4BA2 I;  3H3V I;  3CC4 A;  1WCM B;  4DR5 Q;  2JA7 H;  2N88 A;  2KCN A;  4POF A;  4LF4 Q;  4GLV B;  4UDU C;  1AZQ A;  1IBL L;  3PUZ A;  5ELN A;  2K04 A;  3F2U A;  5JPM C;  1PH7 A;  1VQ6 A;  3J81 E;  4JI5 Q;  2E2H H;  4CKB A;  5TSS A;  3S2H H;  4FNF A;  4R1J A;  3TS0 A;  2E74 C;  1BDO A;  3NTH A;  1Y1W G;  3GTM B;  1XTD A;  2JQO A;  1EYA A;  3I4O A;  4BBS H;  1WJJ A;  1D5Z C;  3S1R H;  1TT2 A;  2MGS A;  2PNR C;  1E2W A;  1Q81 C;  1TWG B;  3MXG A;  3CME A;  1XPU A;  3S2D B;  1JR0 D;  1V1P A;  2B39 A;  3CRK C;  1JJ2 A;  2JJQ A;  3AU7 A;  2FMM A;  4XDX A;  2J7Z A;  2YTY A;  2B63 G;  3D0F A;  3V2T A;  1VS0 A;  4OIJ A;  2R92 B;  4A3F B;  3URY A;  2YU9 B;  3E9H A;  1PDQ A;  2DJF C;  1S72 A;  3PIO A;  5C4X G;  4G57 A;  1OO9 B;  3S14 H;  1UUP A;  3CMA A;  1ICF B;  4IOA A;  4DAY A;  1VF5 C;  2RDH A;  4WRD A;  1PFS A;  5GQO A;  3HRZ C;  2JA8 G;  1SNO A;  1TWF B;  4P71 A;  4DR5 L;  3PIP A;  2K4K A;  4LF4 L;  2SNS A;  2JSO A;  2XRS D;  4DV0 Q;  1A2T A;  4NPS A;  4RKL A;  4C3I G;  1HHV A;  4OWT B;  2WFW A;  5F2D A;  3HGB A;  1JWM D;  4JI5 L;  3G48 A;  4BXX G;  4YCV A;  2VZA A;  2FHT A;  3KDF A;  5IGD A;  1SE4 A;  3TDQ A;  3KFU A;  1JWS D;  1QWY A;  4ZAI A;  4OX9 Q;  2AKW B;  5GAD C;  5NUC A;  1B2T A;  3BYY B;  3KBG A;  3BZD B;  4ZQ3 A;  3AMU A;  4HMI A;  3WOF A;  3S1Q B;  2EYP A;  4K8I A;  2VB3 X;  1CZW A;  1T5E A;  4LNQ A;  4K0K Q;  2NVQ B;  1ZEQ X;  4N8X 1;  2F03 A;  3SK5 A;  1ZYR C;  5ELC A;  5I9P A;  4NXM Q;  1MBY A;  4APV A;  5IP9 G;  2HIX A;  4C2M H;  5IT9 L;  1G51 A;  4C3H G;  4ZCK A;  5FO9 B;  1Q86 C;  5ELB A;  4JW0 A;  3I8Z A;  2ZJQ A;  2ICE C;  1BNZ A;  2ZXO A;  4FF2 A;  1PH6 A;  4LK1 C;  1C9O A;  1LM0 A;  4DN4 M;  3S1M H;  4A3I H;  5KNB A;  1WTR A;  3I91 A;  5A35 A;  5GRO A;  1WCM G;  2K05 A;  2PMZ B;  1M1K C;  1KC8 C;  3FVQ A;  4DV0 L;  1MJE A;  3GD7 A;  3ULL A;  3EA6 A;  1J8I A;  2ZT9 C;  2R93 H;  2Z4H A;  4B3M Q;  2CWA A;  5IGC A;  4HID A;  2JP1 A;  4YWL A;  4X64 Q;  3SGI A;  3CQZ B;  5BN5 A;  4DV1 Q;  4L63 B;  4OX9 L;  3CCU A;  1IBM Q;  2Y0S G;  3ERS X;  4YCU A;  5CC4 A;  5FO7 B;  3HOX G;  2KCT A;  4O42 A;  4AH6 A;  3CU7 A;  1IYU A;  5C0X G;  2OXP A;  1VQ9 A;  4K0K L;  3BJU A;  4RKB A;  3KF8 A;  5FLM H;  1D1K A;  4NXM L;  3MFY A;  1PZK D;  3OW2 A;  2VQF Q;  1VF7 A;  5IYD H;  3MC0 B;  3PGZ A;  3NSW A;  1CQF A;  5DLQ E;  2KVM A;  1A3T A;  4JI7 Q;  2RDG A;  2WB1 E;  5IGG A;  2DJG C;  1TWH B;  2PQE A;  1YJN A;  2AUJ D;  3SXH A;  3NWT A;  1TY0 A;  4YWK A;  5D3D A;  1JOR A;  3ERO A;  4BY1 H;  1SXT A;  1K0S A;  5D14 A;  4UPA A;  1O80 A;  4HMJ A;  1CUK A;  4B3M L;  1DOL A;  4DAY B;  4X64 L;  5FLX L;  4ALP A;  5K36 H;  1FJG Q;  3J81 j;  1H9K A;  3DUZ A;  3SDZ A;  4DV1 L;  2FJ2 A;  1IBM L;  4LF5 Q;  4FXK C;  2JA9 A;  2LSS A;  2IWH A;  2XIW A;  5M5X H;  4QGU A;  2PI2 E;  4LFA Q;  4ZKB B;  2CQO A;  3GTG H;  3PMF A;  3NQI A;  2MUY A;  3WOE A;  1J5E Q;  5E1F A;  1A3U A;  3H94 A;  1X9N A;  2F0Q A;  3MAQ A;  3SR1 A;  1TS5 A;  1YNJ D;  1JQY D;  4RFB A;  4HCS A;  4QMG A;  1BBU A;  2VQF L;  4PMB A;  4UP9 A;  3M4O H;  4JI7 L;  1TS2 A;  1JT8 A;  1MHW C;  1F9R A;  3CW2 C;  3IFT A;  4AQY Q;  4A3M H;  1KQS A;  5J3B A;  2WV6 D;  5C3E H;  3MXU A;  3PF4 A;  4UY8 C;  1QCB D;  4ZUI A;  1HNW Q;  3OIQ A;  1G8Z D;  1IW7 D;  1DYQ A;  2B2T C;  1PH5 A;  1UE7 A;  1HNX Q;  5KIX A;  2K6A A;  1FJG L;  2HQL A;  4ILW A;  1G6Z A;  3OHX C;  3RZD B;  3PO2 H;  1X54 A;  4ZLT F;  4LF5 L;  2KCM A;  4GOP A;  3PQI A;  4S3S A;  1B53 A;  3W1B A;  2JA5 B;  4LFA L;  1BCP B;  1KTK A;  1XXG A;  3OIP A;  2I5L X;  4TSS A;  4X62 Q;  1J5E L;  3J81 L;  4IJL A;  3S15 B;  1HJP A;  2XWJ B;  2SEB D;  4P75 A;  1Q8K A;  4HJA A;  1QZG A;  1YBY A;  3J80 i;  2K14 A;  3CCE A;  5EKI A;  1SFO H;  1CA6 A;  2MP1 A;  4NP5 A;  4F88 A;  4H0L C;  1IKM A;  4A75 A;  4TVA B;  3HOV H;  1VQI A;  3SK4 A;  3X3M A;  4BBR B;  3QR8 A;  4L5T A;  5EJW A;  4A3G H;  3MHB A;  3D4W A;  4A3I G;  4GS3 A;  4OO1 H;  4AQY L;  3SK6 A;  1Q8I A;  3KF8 B;  4C1N K;  4CDF C;  3UDG A;  3A5Z B;  1YJW A;  1VQB A;  3VA5 A;  1B44 D;  1VQ4 A;  1I6H H;  2NWG A;  4BS9 A;  2F4V Q;  1HNW L;  1TS3 A;  2A6E C;  2PI2 A;  1QVC A;  2RHS B;  3OPO A;  4DK3 C;  2O5I C;  4KHZ A;  1HNX L;  4K14 A;  4IO9 A;  2LS0 1;  3PV0 A;  1N36 Q;  1RDP D;  1X32 A;  4PMW A;  3STB C;  2CKZ B;  2XSC A;  3IRB A;  3IFD A;  1VDZ A;  1AN8 A;  1BOS A;  1PTO D;  2NVT B;  1G2S A;  2QCP X;  5GAH C;  1X65 A;  1JC7 A;  4V19 0;  5FJ8 H;  3E5S A;  2SOB A;  4QF4 A;  3BDC A;  2ENB A;  1IYV A;  4X62 L;  4Q0F A;  2EIF A;  1HZA A;  3CC2 A;  2XRQ D;  3T4A C;  1KAA A;  2ZJP A;  4JBW A;  5DNF A;  4A3B G;  2F0L A;  5CV7 A;  4P2C B;  2Z9H A;  1F2M A;  1EWC A;  2L11 A;  1V43 A;  2SDF A;  5KEE A;  3VA7 A;  1EIH A;  1DXM A;  3A7L A;  5EQ0 A;  2QIL A;  3R2T A;  1E22 A;  3T13 A;  1TWA B;  2EY1 A;  5C5L A;  5JEA G;  5IYD G;  2D0P A;  1WFQ A;  2WKD A;  3U4V A;  4X3K A;  1TVX A;  4DK6 C;  2IX3 A;  1LTI D;  1PYB A;  3FHW A;  5CBE E;  1X3E A;  1Y1V G;  1MI2 A;  2AUK A;  4WJW A;  5I6W A;  4LF9 Q;  3K58 A;  3D3R A;  4B3R Q;  1CTM A;  1YVC A;  2EY6 A;  2MO0 A;  2F4V L;  5JAV A;  4RGM A;  1X3Q A;  3DHQ A;  2B2Y A;  1B3A A;  4BY1 G;  1S5B D;  5BN4 A;  4L5S A;  1C48 A;  2OTL A;  1YNN D;  1GUN A;  2CH4 W;  2F3W A;  1N36 L;  2L12 A;  5HGQ A;  3H3V H;  4HJ5 A;  3S16 H;  3HS0 C;  1PH3 A;  3J7A V;  4WFN 3;  5T1I A;  1K8A C;  2ES2 A;  3ER0 A;  3VDY A;  2I5M X;  1PLF A;  1S4Z A;  4KHV A;  4AYB G;  1NMF A;  2G5D A;  5GAG C;  4TRD A;  1VQK A;  2JA5 G;  1CZG A;  1U9R A;  2NZO A;  2E2J B;  1EQT A;  3S1N H;  5E3F A;  1GUW A;  2F0W A;  3FKI B;  3RZO H;  3A8J E;  4Z9C B;  2BDN A;  4DF7 A;  4JI0 Q;  5JVG 3;  5HY6 A;  3A8I E;  2Q8R E;  3TSS A;  3I4N B;  2L9H A;  1Y14 B;  2MNA A;  1VQO A;  5BR8 Q;  4A3J B;  2A74 C;  5C4X H;  2GN5 A;  1SE8 A;  3CHB D;  4KN4 C;  4KV6 A;  2F0V A;  1SEB D;  2EJG C;  3OOC A;  4IJH A;  4NDX A;  1K83 B;  4XYO A;  4MTK A;  1BVS A;  2IHF A;  1PHJ A;  3GV6 A;  4LF9 L;  4FXG C;  1N33 Q;  1Z7T A;  2B2W C;  1STA A;  1CKM A;  4B3R L;  3GP7 A;  3I90 A;  3RLN A;  3HG9 A;  1DOM A;  3ULJ A;  3PUV A;  1NR4 A;  1NTG A;  4LFC Q;  5EPL A;  2Q8T A;  4BXX H;  3F2B A;  1W3S A;  1A15 A;  2UUA Q;  3JAM c;  1HQM C;  1D8L A;  3W5O A;  4MIU A;  1JJC B;  4K2K A;  4C56 C;  5KYL A;  1XMQ Q;  3N6R A;  5AFW A;  1O7Z A;  4OIK A;  4R4I A;  4EQP A;  1B50 A;  3FPP A;  5M3M G;  1KLG D;  2ZJR A;  1I3Q H;  1JWU D;  2PO4 A;  1BCP F;  2RCF A;  3BU2 A;  3OW7 A;  4DR6 Q;  4JI0 L;  3CPF A;  3IAY A;  2MFI A;  4DV5 Q;  5E4X A;  1HCZ A;  2QDB A;  5M3F G;  3SEB A;  5IP9 H;  2F0N A;  1SDF A;  1PRT D;  4YWM A;  3L9A X;  1KDA A;  3DWQ A;  4C1N I;  5BR8 L;  2B8F A;  3NPP A;  4BY7 B;  3PO3 H;  3HOV G;  1BR9 A;  3TBI B;  2DUD A;  1K0R A;  1VQG A;  3G4S A;  1BUV T;  2LXJ A;  1GXD C;  2D9U A;  2BA0 A;  2L5T A;  2DGY A;  5H1S E;  1XNR Q;  1TY2 A;  1WCM H;  1N33 L;  3JAM E;  4OO1 G;  1ESF A;  3UDX A;  1OXS C;  3C1E A;  4LFC L;  2EYL A;  3DM1 A;  2B2U C;  4JI3 Q;  4HJ9 A;  5CYU A;  4GLX A;  1JOK A;  4RGN A;  2CFM A;  1GUO A;  4CJ2 C;  2KCC A;  5KRU A;  5C0X J;  2J4X A;  4OGQ C;  5LMN Q;  1BBX C;  1C7Y A;  1GOZ A;  1SAP A;  2EYF A;  2OQ0 A;  2UUA L;  5COR A;  1MIU A;  1B4O A;  2CHB D;  5D65 A;  3GTM H;  1OTC A;  1IL2 A;  1XMQ L;  2IL8 A;  1ET6 A;  2IPK D;  5CBA E;  3A55 A;  1ROD A;  2VUM G;  2K03 A;  5FJ8 G;  1TWG H;  2WKC A;  4QUC A;  3I73 A;  3CD6 A;  3S2D H;  2JYO A;  5C5M A;  2NN6 H;  3AFQ A;  2YYZ A;  5ELF A;  5C0X H;  3E3X A;  2A6H C;  3FKI G;  1ILP A;  3VYR A;  4DR6 L;  4DV5 L;  4K2L A;  3A7A B;  4O2D A;  1EQR A;  3HOY G;  3KLS X;  3VYT A;  3I4N G;  3JAM i;  4A3F H;  4HIO A;  2R3Z A;  1BXT A;  3EJI A;  1Y8N B;  4DR3 Q;  1X3G A;  4JI4 Q;  4A3J G;  4OWX B;  5KYI A;  5CV4 A;  1HZ9 A;  4O1N A;  1U5K A;  4FF1 A;  3CCR A;  2JA6 B;  5ISR A;  1E2V A;  1SR3 A;  3FEW X;  1SLJ A;  1GUT A;  2MHV A;  1XNR L;  3PUY A;  3A54 A;  2NB0 A;  2QDL A;  3KJP A;  3DEO A;  2ALY B;  3DM3 A;  3RN2 A;  4AIM A;  5J1Z A;  3I4L A;  3RR5 A;  1F9Q A;  4JI3 L;  1M90 C;  2A68 D;  1QVF A;  1WTW A;  1AH9 A;  3D6C A;  3UDF A;  2QW7 A;  3S17 B;  1I4Q A;  2XN9 C;  4RCN A;  5LMN L;  1A63 A;  3R3O A;  3A8K E;  1G29 1;  3OMG A;  2VL6 A;  4RMF A;  4MZ9 A;  1EIF A;  3SVM A;  1TWC H;  1RD9 D;  4KN7 C;  4POG A;  5A2Q E;  2UXC Q;  2Q8I B;  2HCC A;  4DNR B;  4K5W A;  4B08 A;  5C4H A;  5CR3 A;  3C1F A;  4LMQ D;  3HOU B;  4DV4 Q;  1I50 B;  1YZ6 A;  1GKH A;  1LO5 D;  4J8Q A;  5FO8 B;  5JPN C;  2KHS A;  3S1Q H;  5FOB B;  3X3N A;  5DM7 3;  2F0E A;  4DUY Q;  4ULL A;  1VQC A;  5G3L F;  1GVP A;  2NVQ H;  1SJE D;  4QJF A;  1EZ6 A;  2R7D A;  2E2D C;  5IYB G;  2F0K A;  2UUB Q;  2E2I B;  4EGV A;  3WDN A;  4XQJ A;  4DNI A;  4DR3 L;  2NVY B;  4NKL A;  3KLR A;  4JI4 L;  3BVG A;  3GTQ H;  2D0O A;  2CW0 D;  5FKA C;  1VMC A;  2A5H A;  1LTG D;  3UE1 A;  2XWB B;  4GNX C;  2A8V A;  5ELE A;  2YTX A;  1CHP D;  3I4M B;  3C2P A;  3KYH C;  3NK9 A;  4GZY C;  4KHP Q;  4WJ3 M;  4KI0 A;  3VR5 A;  4DR1 Q;  2ATW A;  2KEC A;  1HQR D;  2VB2 X;  4X65 Q;  3M7G A;  1IXR A;  3QG1 A;  4LW1 A;  1ASZ A;  3GTJ H;  4A3E B;  3U9O A;  5CV5 A;  3M4P A;  2UXC L;  2V4D A;  3CQZ H;  2ZTE A;  3HKZ G;  3MEH A;  1LAB A;  4XT3 B;  2JA7 B;  5JJI A;  1I6V C;  2WAQ E;  4DV4 L;  1SE2 A;  1NR2 A;  3LGJ A;  2QKI C;  3OYY A;  1I4R A;  4DUY L;  2VNU D;  2HD3 A;  1Y8P B;  1QZH A;  1KNA A;  1I4P A;  1KRS A;  1SNQ A;  3RN5 A;  5IP7 G;  3H91 A;  2HDM A;  3H09 A;  3S2H B;  1OXU A;  2WII B;  5LMU Q;  4P73 A;  2OEO A;  5HUR A;  2UUB L;  3K0X A;  4N8F A;  3PCO B;  4XQN A;  3Q23 A;  4JG2 A;  4P74 A;  2UXB Q;  5M5W B;  4BBS B;  3S1R B;  1C4Q A;  1V1O A;  2BA1 A;  1Z9F A;  4DGZ A;  3PO3 G;  1J9O A;  4GNX B;  1S5F D;  1TWH H;  4YY3 Q;  3ITP A;  1B8A A;  1PRT F;  3VR6 A;  4DV2 Q;  2CCZ A;  3R2I A;  4TKO B;  4KHP L;  1STH A;  2A1A A;  4DR1 L;  4DR4 Q;  1VQN A;  1S40 A;  2NBF A;  1DON A;  2IT1 A;  4X65 L;  1NMG A;  2P5Z X;  1GM5 A;  1EUJ A;  2K7V A;  1WYD A;  2EQS A;  3K59 A;  1O7L A;  2PYK A;  1C8C A;  1H9R A;  3H0G B;  4KKT A;  1CFM A;  3GDE A;  1FNU A;  2DY8 A;  5JEA J;  1HTP A;  1PH9 A;  1PH8 A;  3HOU G;  4UP8 A;  1KDC A;  1SND A;  2Z6K C;  1RKN A;  2JN4 A;  1NUC A;  1IL8 A;  1VQJ A;  2G9H D;  4ZRZ A;  4ZK9 B;  2NN6 G;  1R9T H;  4Y7N H;  1KRT A;  4A3B H;  3GTL H;  1EY5 A;  1WTO A;  1CSP A;  2UUC Q;  5LMU L;  4IQZ A;  1IHZ A;  4IUN A;  4L5Q A;  2R92 G;  1SMX A;  1P8L A;  2B2T A;  4A3F G;  2UXB L;  5JEA H;  2G9D A;  2NTS A;  3TZD A;  3MA2 B;  3MWY W;  4YIJ A;  1TS4 A;  3DLL A;  1GUS A;  2DNE A;  1V1Q A;  4YY3 L;  1A3V A;  2PW5 A;  5JJL A;  1Y1V H;  3EN2 A;  1KAB A;  2OWO A;  4IFD I;  4DV2 L;  4EX5 A;  4KJO A;  3I4M G;  2OQK A;  3I55 A;  4X3U A;  4DR4 L;  3HEJ A;  2UXD L;  3M4Q A;  1LTT D;  2KEN A;  3NHH A;  3KJO A;  4XXE A;  3RLO A;  1SNP A;  3TP6 A;  3J80 c;  4XYQ A;  3K0Y A;  3NE5 B;  1RJT A;  5J22 A;  1H9M A;  4IPH A;  1SNM A;  3RZD H;  1YNJ C;  3E0J A;  1XJV A;  3UDI A;  2JA5 H;  1JJG A;  4JOI A;  2AHO B;  3J7Z C;  4J6H A;  1GJX A;  1A0I A;  1LTS D;  2EY5 A;  3DMU A;  2CH4 A;  2Q2T A;  3MFG A;  4CGY B;  3BZC A;  3S15 H;  2R93 B;  3GV3 A;  3K7A H;  2UUC L;  1SMY D;  2K5D A;  4RCO A;  1SE3 A;  1U4R A;  2V1C C;  2WAC A;  3A74 A;  1XPO A;  1XX8 A;  2RKS A;  3QJY A;  3BDL A;  4BBR H;  1IW7 C;  2VUM B;  3F1Z A;  2A69 D;  1YHA A;  2E76 C;  2F0O A;  3AFP A;  4A3L H;  1PYS B;  1EIY B;  3J80 E;  3FPU B;  1HUM A;  1B9N A;  5IGF A;  4RGO S;  2C35 B;  1II3 A;  1STE A;  2GVB A;  3W1G A;  2F0G A;  2I46 A;  3PUW A;  3HKS A;  4ZKC B;  1LT3 D;  4O0A A;  1CQV A;  2Z4I A;  1STB A;  1BCP D;  3GTP B;  1EY4 A;  1F77 A;  1NAP A;  1PFN A;  2NVT H;  3GQB A;  5I6Y A;  2F0I A;  3HFZ B;  4HTH A;  4JVZ A;  4ZYS A;  3D4D A;  1STN A;  5M3M H;  1BQQ T;  1HUN A;  5C44 B;  3M9B A;  4OXP A;  1OXV A;  1B3Q A;  4FP5 D;  3NBH A;  4PMC A;  5EPJ A;  4K5V A;  3QWN A;  2H4O A;  1EFW A;  2WP8 J;  2PZT A;  1N8R C;  4C3J B;  1HR0 Q;  5A2Q L;  2N55 A;  5M3F H;  1SYE A;  1I94 Q;  1F2Y A;  2M2L A;  1X3F A;  4JV5 Q;  1TWA H;  3DWP A;  1XTC D;  3PIO 3;  1RCV D;  1Z47 A;  2QA4 A;  3G6E A;  2Z8L A;  4CJ0 B;  2RF4 A;  5M9O A;  5M5X B;  3I3C A;  4XIG S;  3LWE A;  4JOI C;  2BCO A;  1DJR D;  4GN3 B;  2EPB A;  4HCE A;  4FXD A;  3K81 C;  3PIP 3;  1R4Q B;  1WOC A;  4H13 C;  1LTL A;  2E8G A;  1PTO C;  3K5L A;  3VYS A;  2EYM A;  2J0T D;  1N32 Q;  4RG1 A;  1EZ8 A;  3CAM A;  5ELO A;  4A3D B;  1EU3 A;  5D3I B;  4IOC A;  3S9W A;  3CCL A;  4DXF A;  3QIA A;  3FDT A;  3L7Z C;  4GN4 B;  1IZ6 A;  4RAU C;  2OTJ A;  4DAV A;  4CDD C;  1EEI D;  4CKC A;  2LXK A;  3OTO Q;  1PH1 A;  2EXZ A;  4KK7 A;  3FRP B;  3KF6 A;  4LF7 Q;  3H6M A;  2KJX A;  5EBC A;  3M7N A;  5C3E B;  5IYC H;  1RTO A;  1T5X D;  3E0E A;  2E2J H;  2F52 A;  4R4C A;  2WAQ B;  2NZH A;  3D6W A;  4WJ4 A;  3FKI H;  2B2W A;  5E7N A;  3MXN B;  2VW9 A;  2EZV A;  1HR0 L;  1SYC A;  2I0Q A;  3PSI A;  2NVX B;  1I94 L;  1FD7 D;  3HOY H;  2EJM A;  2DY7 A;  1X56 A;  3I4N H;  2CQA A;  2Y0S E;  3PF5 A;  2EE1 A;  3TP7 A;  4JV5 L;  3GTK B;  4PV1 C;  2RSO A;  2LY7 A;  4A3J H;  2F0H A;  1QB5 D;  3SK8 A;  2ZTC A;  1C0A A;  5DEH A;  1YNN C;  1QNU A;  1FYC A;  3L2P A;  4IAL A;  1Z6H A;  2RCN A;  1LTR D;  1PTO B;  2C5C A;  3TS2 A;  1Q1E A;  4L5R C;  2R7Z B;  4JI8 Q;  2IX1 A;  2TMP A;  1N32 L;  1K9M C;  2QEJ C;  5IT9 c;  3DWA A;  1WVL A;  2AQ2 B;  5C4J B;  2RHQ B;  3KOJ A;  1N9W A;  4G7Z C;  2F4I A;  1WTQ A;  1NE3 A;  2X6G A;  4DXG A;  4A93 B;  3KK7 A;  3RUZ A;  2RBM A;  2B29 A;  4K6L A;  1SNC A;  2XGT A;  2EYH A;  3OTO L;  4JBM A;  5G3L D;  2R61 A;  1GUG A;  4LF7 L;  2K5N A;  4HED A;  2EYO A;  4LUV A;  3TRZ A;  1ASY A;  5LHY 1;  1LT6 D;  3EVQ A;  1GHJ A;  2Q2U A;  1VMP A;  4KKU A;  1JMC A;  3A5U A;  3Q6S A;  2ASB A;  4IPD A;  3MVV A;  1UEB A;  3KLW A;  4C3J G;  1E2Z A;  1D5X C;  5IYB H;  1FGB D;  2B2U A;  5CMD A;  2AWO A;  3CXC A;  2F0F A;  4I7Z C;  1O7I A;  1YHQ A;  2EXD A;  5IT9 E;  2B2V C;  4BY7 H;  2VXW A;  4QB4 A;  1BBW A;  2DNC A;  4JBJ A;  1CI3 M;  4BBR G;  1MKH A;  1UE1 A;  5I2X A;  2CWP A;  3NBH B;  2N49 A;  1EIG A;  2FFK B;  1JOQ A;  4R4T A;  2KQ3 A;  4JI8 L;  2WB1 B;  1E7Z A;  3J7A 5;  4A3L G;  4N9P A;  1CT1 D;  1Q3L A;  2RDF A;  4CDC C;  4IZ8 A;  4JK1 C;  3D4R A;  2BE5 D;  3GTO B;  5LL6 S;  3KUP A;  1CKN A;  4NB3 A;  3BVM A;  4LJZ C;  3CKI B;  1G2T A;  3G7L A;  4XT1 B;  5IWA Q;  1PRT C;  2TSS A;  1A62 A;  1TR5 A;  3TP8 A;  3CCJ A;  1CM9 A;  1N34 Q;  3BDO A;  5C3W A;  1VQM A;  2HCI A;  4JI1 L;  1RL2 A;  3DEP A;  1H9S B;  3SE0 A;  5IP7 H;  1LLR D;  1O78 A;  3CPW A;  3M3Y B;  5EGT A;  1S5E D;  2L4N A;  3EQL C;  2IW3 A;  1Y1W B;  2OT2 A;  3V96 A;  4KMU C;  4LF6 Q;  5CGK A;  4QUF A;  3KF6 B;  4G7H C;  2K32 A;  4EQO A;  1WTP A;  4DR2 Q;  2XNA C;  3OWF A;  2K5V A;  3I7F A;  2JA6 H;  1YHB A;  4H02 A;  1HH2 P;  1E0B A;  2HDL A;  1EQV A;  2B3G A;  1YIT A;  4HR7 B;  5C3X A;  5GAE C;  1QIL A;  1NNX A;  4EQN A;  4GLA C;  1E3P A;  2B63 B;  1FGU A;  1HZB A;  1UEA B;  4IUQ A;  4OO1 I;  2MQH A;  1G91 A;  3QOJ A;  3I2Z A;  5K5P A;  1AE3 A;  3K80 C;  3R8B A;  4HIK A;  5C4X B;  4B3T Q;  1PH4 A;  2HUG A;  2VY3 A;  2GVA A;  1VQE A;  3QOL A;  4BA1 I;  1PA6 A;  2HQE A;  5IWA L;  1QE6 A;  2JA8 B;  3J80 L;  1PZJ D;  3HOW B;  1HZC A;  4JCV E;  1SYB A;  3EFX D;  4IPG A;  2M00 A;  3HOU H;  4X3S A;  4JPB W;  3TEH B;  5IYC G;  1I50 H;  1N34 L;  2DN8 A;  1JCK B;  4L6T B;  3ZJY C;  4C3I B;  3Q24 A;  2F3I A;  3UI2 A;  4GNX A;  3W2D A;  3WWV A;  3I56 A;  3Q8D A;  2D62 A;  1K8O A;  4LFB Q;  3BYT B;  4KJN A;  2HHH Q;  3FMC A;  2E2I H;  4LF6 L;  2R92 H;  2A68 C;  2NVY H;  2YU9 H;  4DR2 L;  5KGU A;  2K28 A;  2F0M A;  2OF1 A;  1EL0 A;  1EY6 A;  1P16 A;  1Q12 A;  1DM0 B;  1ICW A;  1YEZ A;  1RHP A;  1LT5 D;  2MO1 A;  2FMC A;  1W6K A;  2N3S A;  2WB1 G;  1CSQ A;  1TWF H;  3I4M H;  1VQA A;  2N78 A;  4KKS A;  2FIN B;  5L37 A;  4MN3 A;  2K1B A;  1I4G A;  2E75 C;  3NUC A;  3HZX A;  4H44 C;  5JJK A;  1LAC A;  1LUZ A;  4C3H B;  2D2C C;  1XPR A;  3R93 A;  3G71 A;  4A3E H;  1D6E C;  4B3T L;  4M8A A;  4EVO A;  1ET9 A;  4M1U B;  1RTN A;  1HFN A;  3S24 A;  4J15 A;  4DNT B;  2HIV A;  2I5H A;  4FDB A;  4LWC A;  3ULP A;  2H1E A;  4H7B A;  2EVB A;  3NXW A;  3CCV A;  4FF4 A;  2L55 A;  3HOZ B;  2CW0 C;  1IKL A;  1CKN B;  3G6J B;  2EJF C;  1QUQ B;  4CDE C;  1F9S A;  4A3C G;  3NBI A;  4NW2 A;  5M5Y B;  1VQ5 A;  4LFB L;  5LMN W;  1EEF D;  3K8A A;  3NEL A;  4K8J A;  1AZP A;  4LAA A;  1GD7 A;  2HHH L;  3AEV A;  1M4V A;  1V8Q A;  4AYB E;  3U9S A;  2Y0S B;  1J6Q A;  5M5W H;  3VR3 A;  1AE2 A;  3KLS A;  4UAI A;  4BY7 G;  3A0J A;  3HOX B;  4PG3 A;  4A3K B;  4DV7 Q;  1LTB D;  4IUP A;  2M9V A;  3EBE A;  1QG7 A;  2F0U A;  4RGT A;  1F2Z A;  4KY5 A;  1EY8 A;  2KBN A;  1UAP A;  4X6A H;  3RNU A;  1DD2 A;  3J7A F;  2Z6K A;  5IOC A;  2EOT A;  4WOR A;  3L0O A;  1FVI A;  1JE4 A;  1DOK A;  1ZXT A;  3T1H Q;  4IPC A;  1F2L A;  1VQL A;  2HT1 A;  2VS1 A;  1MSH A;  1X3P A;  5EKL A;  3MZ5 A;  3H0G H;  2EDG A;  3J81 i;  3BZK A;  1LTA D;  3PUX A;  2L0C A;  4TQU S;  4RHR A;  1CA5 A;  3HOW G;  3D8G A;  1D5M C;  3DXJ C;  2NTT A;  1YIJ A;  2E5L Q;  1SYG A;  4G7O C;  4LUZ A;  1SRU A;  2N8N A;  3T1Y Q;  4Q5V A;  2E2H B;  1E1T A;  3NP8 A;  3CCM A;  1K28 A;  1TWC B;  5IE8 A;  2QEX A;  5FK9 C;  1RIP A;  1A2U A;  2AQ1 B;  1KNE A;  4PNY A;  3T51 B;  3T16 A;  3K5M A;  5IGB A;  3Q22 A;  4JBK A;  1I5F A;  1SN8 A;  2YV5 A;  1KD1 C;  4DV7 L;  4FF3 A;  1WI5 A;  1X55 A;  3ND9 A;  2JA6 G;  1JB3 A;  5T1G A;  1WD1 A;  3TP5 A;  2H5X A;  1VQP A;  1L1O A;  4JI6 Q;  5HGT A;  1OXX K;  5JJZ A;  3E6Z X;  4OEL B;  2UXD Q;  1TKW B;  2PQA B;  3T1H L;  2MPM A;  3LWU A;  2Q2H A;  5CV8 A;  2LKV A;  1WTV A;  2OCE A;  1PMR A;  3GTQ B;  3S14 B;  1L0Y B;  1SBB B;  4MHE A;  1WTX A;  3RD4 A;  3TN2 A;  3K6O A;  3K7U C;  4QIW E;  1HNZ Q;  1UE5 A;  3P20 A;  1SYD A;  2LMC B;  1TXY A;  4U67 3;  1ZYR D;  4FYD A;  2PW7 A;  3I72 A;  4ME5 A;  1VQ7 A;  2E5L L;  3HOZ G;  3B6Y A;  4I65 A;  1TQO A;  4RHS A;  3T1Y L;  1EYG A;  3F2C A;  3VYU A;  4NXN Q;  4HN7 A;  3GTJ B;  1D2B A;  4E6I A;  2NN6 I;  3BVZ A;  1HPC A;  1L0W A;  5C0X I;  3CC7 A;  1VQH A;  2F0P A;  2Z1C A;  1PV4 A;  1AFP A;  1MD2 D;  3NTI A;  1AEX A;  1STG A;  4A3K G;  1SRO A;  2VUM H;  4QCL A;  5EBD A;  1XMO Q;  4A4I A;  1U4M A;  1XYI A;  1GHK A;  2ZXR A;  3F8T A;  5BN3 A;  2KUM A;  3GO5 A;  1WD0 A;  4JI6 L;  2IJ0 A;  3NEN A;  4DV3 Q;  3MEF A;  1KL9 A;  1K8M A;  3O13 A;  3CF5 A;  1VQD A;  3V05 A;  4C2M B;  5EAY A;  2KOL A;  3MXN A;  4IFD G;  4QL5 A;  4A3E G;  1A6X A;  1NSN S;  4HJ7 A;  1SMY C;  3GTP H;  2JEB I;  1V1P B;  2O2L D;  3VR4 A;  1IYJ B;  3BG3 A;  3T53 B;  1HNZ L;  4A3I B;  3S1M B;  3JAM L;  4DR7 Q;  4R4O A;  3TZU A;  1EOV A;  2JA7 G;  1L1O C;  5C44 H;  2ZTD A;  3SHL A;  1X6O A;  3K57 A;  1STY A;  2KA7 A;  4R8I A;  2Z6B A;  1Q46 A;  2A69 C;  4ABN A;  4V0B A;  5E4W C;  4NXN L;  1XNQ Q;  4C3J H;  2IHE A;  2D5D A;  2KEE A;  4PQX A;  4KY6 A;  3FP9 A;  1E1O A;  1F9P A;  1U0L A;  1O7Y A;  4DAP A;  1K73 C;  1UE6 A;  4BBS G;  5I4D A;  3D31 A;  5DM6 3;  1XMO L;  1L2F A;  2CVR A;  3TQY A;  1H95 A;  4CJ1 B;  3CCS A;  1BCP C;  3ERQ A;  1R9T B;  2IX0 A;  3L3O C;  2JXM B;  3K5O A;  4Y7N B;  4A3B B;  3GTL B;  3KDF B;  4DV3 L;  4HSV A;  4A3D H;  4FVM A;  1AP0 A;  1B1Z A;  1KDB A;  2RVL A;  4HSP A;  1NY4 A;  2Z0S A;  2XVS A;  1KAW A;  5KND A;  1ZKO A;  2O4X A;  2ZM6 Q;  1D1I A;  4NMZ A;  4LF8 Q;  3H0G G;  1Y1V B;  2LFN A;  4OEM B;  2ZXP A;  1L1O B;  5CV9 A;  4DR7 L;  4IUU A;  4HIM A;  4RH6 A;  3C3L A;  2F0D A;  1B70 B;  1OXT A;  3QO2 A;  4DK0 A;  2L15 A;  2EY2 A;  4CKE A;  1CHQ D;  1XWE A;  2AMC B;  4OHJ A;  4BY1 B;  1K3R A;  2JE6 I;  3TRE A;  1XNQ L;  4J1M A;  1EY9 A;  3NQT A;  5LL6 X;  2NVX H;  3HKZ E;  5C4Z A;  1KXL A;  4DK1 A;  1L0X B;  1HXY D;  2JK8 A;  2QGQ A;  1HA5 A;  3GTK H;  4JI2 Q;  4IUT A;  3AQQ A;  4AYB B;  1VQF A;  2ICI A;  1ENF A;  1FNW A;  1PTO H;  2A19 A;  2R7F A;  1B9M A;  3GTG B;  2R7Z H;  2NYZ D;  3P75 A;  3EIV A;  3P1H A;  4MNO A;  5CV6 A;  1EOT A;  3K7A B;  4F8M A;  1HFG A;  5C4J H;  1EWH A;  3U58 A;  3ICE A;  1ENA A;  1JIC A;  2K33 A;  4ID6 A;  4LUO A;  1I4H A;  1U4P A;  4DUZ Q;  2PNH A;  4A93 H;  2X69 A;  5IGE A;  4R4Q A;  2AWN A;  1H9S A;  3M4O B;  1PXU A;  1NJI C;  4ME3 A;  2ZM6 L;  4LF8 L;  4GKJ Q;  2B2V A;  3AB9 A;  2YTV A;  4A3M B;  2JEA I;  2X6L A;  2BH2 A;  1FNV A;  4DKA C;  1BF4 A;  1JOO A;  1SJH D;  1RF2 D;  2R93 G;  4K5X A;  4XQQ A;  1PVO A;  3CRL C;  1FR3 A;  5EKK A;  2F1M A;  1Y69 U;  4JI2 L;  3PO2 B;  1ESR A;  3RLF A;  2F3V A;  2QF7 A;  1HA6 A;  2A73 B;  5M3M B;  1EY0 A;  2A6E D;  1SYF A; 
#chains in the Genus database with same CATH homology
 3T56 B;  3TME A;  5M3F B;  1PFB A;  2NZ1 D;  3OSO A;  2RSN A;  5C6A A;  2O5J C;  2K5Q A;  1SFO B;  1ILQ A;  4G4K A;  1VCI A;  3HOV B;  4X3T A;  4A3G B;  4U68 A;  3IL8 A;  4QIW B;  1CK1 A;  4KD3 A;  3M4Y A;  2WIN B;  1MGS A;  1I6H B;  5I2Y A;  4FO2 A;  1U4L A;  3A56 A;  4B9X A;  1S5C D;  5K36 G;  1ENC A;  4F87 A;  3NWS A;  3H3V C;  2BE5 C;  3Q0A A;  2PPB C;  2B8G A;  4XTC S;  4RWS C;  1TII D;  5IOD A;  2RA4 A;  4N9T A;  4ODG A;  1Q90 A;  4CBV A;  1ML0 D;  3W3A A;  4IN3 A;  3BS1 A;  1TU2 B;  3OWE B;  3HOY B;  4IUV A;  4OL7 A;  3OMC A;  1PZI D;  1S5D D;  5I9O A;  4R9W A;  1DCZ A;  4DU9 A;  5KNC A;  3J7Y W;  3QB3 A;  2NUC A;  1AW7 A;  1PFM A;  1DZ1 A;  5ELD A;  2F0S A;  5EPK A;  3ZYY X;  2KED A;  3I70 A;  3ONA B;  3HP3 A;  4F7X A;  3S16 B;  5JOB A;  3NTK A;  2I07 B;  1R4P B;  2PZU A;  4CHT B;  2PZW A;  1EYD A;  2F0T A;  1NCV A;  1LT4 D;  5J39 A;  2L1B A;  1QNK A;  2PCF B;  3S1N B;  1LV9 A;  3LNN A;  1BO0 A;  2B2Y C;  3N52 A;  3MXP A;  3RZO B;  5IIF A;  1M8A A;  2SNM A;  2K5W A;  3P7J A;  4ZUJ A;  2MJ8 A;  5JVH 3;  1EFI D;  2F0J A;  4B9W A;  1KLU D;  1HRJ A;  4DFA A;  1PRT B;  1W6J A;  3ND8 A;  1Q1B A;  4R8N A;  5FLX E;  2K01 A;  2RQX A;  1MSG A;  4K6D A;  2ID0 A;  3K5N A;  5COY A;  3LX0 A;  3M85 A;  2C9O A;  2R6G A;  4DA2 A;  1I4X A;  3MTS A;  1QOH A;  1SSO A;  3HKZ B;  4L8J A;  4IUR A;  3RMH A;  1EY7 A;  2BDO A;  4IFD J;  1Y8O B;  1UNS A;  2GA4 B;  1PYW D;  4KY7 A;  3IKJ A;  1I3Q B;  4RA8 A;  4KTA A;  1PTO F;  3VR2 A;  1EU4 A;  5DAU A;  2BOS A;  1QJO A;  2EYJ A;  3C46 A;  4HAE A;  1ONL A;  2AQ3 B;  4IFD H;  1HTL D;  1H9J A;  3PO3 B;  1EYC A;  3KBX A;  4BWG B;  2A6H D;  4KD4 A;  4BA2 I;  1WCM B;  2N88 A;  2KCN A;  4UDU C;  1AZQ A;  3PUZ A;  2K04 A;  3F2U A;  5JPM C;  3J81 E;  4CKB A;  5TSS A;  4FNF A;  2E74 C;  1BDO A;  3NTH A;  3GTM B;  1EYA A;  1D5Z C;  1TT2 A;  2MGS A;  2PNR C;  1E2W A;  1TWG B;  3MXG A;  3S2D B;  1JR0 D;  1V1P A;  2B39 A;  3CRK C;  3AU7 A;  2FMM A;  4XDX A;  2J7Z A;  3V2T A;  4OIJ A;  2R92 B;  4A3F B;  3URY A;  2YU9 B;  1PDQ A;  4G57 A;  1OO9 B;  1UUP A;  4DAY A;  1VF5 C;  2RDH A;  4WRD A;  3HRZ C;  1SNO A;  1TWF B;  2SNS A;  2JSO A;  2XRS D;  1A2T A;  4RKL A;  4C3I G;  1HHV A;  5F2D A;  3HGB A;  1JWM D;  2FHT A;  5IGD A;  1SE4 A;  3TDQ A;  1QWY A;  1JWS D;  4ZAI A;  5NUC A;  1B2T A;  3BYY B;  3KBG A;  3BZD B;  4ZQ3 A;  3AMU A;  4HMI A;  3WOF A;  3S1Q B;  2EYP A;  4K8I A;  2VB3 X;  1CZW A;  1T5E A;  2NVQ B;  1ZEQ X;  2F03 A;  3SK5 A;  1ZYR C;  5ELC A;  5I9P A;  1MBY A;  5IT9 L;  4C3H G;  5FO9 B;  5ELB A;  3I8Z A;  2ICE C;  1BNZ A;  2ZXO A;  4FF2 A;  4LK1 C;  4DN4 M;  5KNB A;  1WTR A;  3I91 A;  5A35 A;  2K05 A;  2PMZ B;  3FVQ A;  3GD7 A;  3EA6 A;  1J8I A;  2ZT9 C;  2Z4H A;  5IGC A;  2JP1 A;  3CQZ B;  5BN5 A;  4L63 B;  5CC4 A;  5FO7 B;  4O42 A;  3CU7 A;  1IYU A;  5C0X G;  2OXP A;  4RKB A;  3KF8 A;  1D1K A;  3MFY A;  1PZK D;  1VF7 A;  3MC0 B;  3NSW A;  1CQF A;  2KVM A;  1A3T A;  2RDG A;  5IGG A;  1TWH B;  2PQE A;  2AUJ D;  3SXH A;  3NWT A;  1TY0 A;  5D3D A;  1JOR A;  3ERO A;  1SXT A;  5D14 A;  1O80 A;  4HMJ A;  1DOL A;  5FLX L;  5K36 H;  1H9K A;  3DUZ A;  3SDZ A;  2FJ2 A;  4FXK C;  2IWH A;  2XIW A;  4ZKB B;  3PMF A;  3NQI A;  2MUY A;  3WOE A;  5E1F A;  1A3U A;  3H94 A;  2F0Q A;  3MAQ A;  3SR1 A;  1TS5 A;  1YNJ D;  1JQY D;  4RFB A;  4HCS A;  4QMG A;  4PMB A;  1TS2 A;  1F9R A;  3IFT A;  2WV6 D;  3MXU A;  1QCB D;  4ZUI A;  3OIQ A;  1G8Z D;  1IW7 D;  1DYQ A;  2B2T C;  5KIX A;  2K6A A;  4ILW A;  1G6Z A;  3OHX C;  3RZD B;  4ZLT F;  2JA5 B;  4S3S A;  1B53 A;  1BCP B;  1KTK A;  1XXG A;  3OIP A;  4TSS A;  3J81 L;  3S15 B;  2XWJ B;  2SEB D;  5EKI A;  1CA6 A;  2MP1 A;  4NP5 A;  4F88 A;  4H0L C;  1IKM A;  3SK4 A;  3X3M A;  4BBR B;  5EJW A;  3MHB A;  3D4W A;  4OO1 H;  3SK6 A;  1Q8I A;  4C1N K;  3VA5 A;  1B44 D;  2NWG A;  4BS9 A;  1TS3 A;  2A6E C;  3OPO A;  2O5I C;  4KHZ A;  4K14 A;  2LS0 1;  3PV0 A;  1RDP D;  1X32 A;  4PMW A;  2XSC A;  3IFD A;  1VDZ A;  1AN8 A;  1BOS A;  1PTO D;  2NVT B;  1G2S A;  2QCP X;  1JC7 A;  4V19 0;  3E5S A;  2SOB A;  4QF4 A;  3BDC A;  2ENB A;  1IYV A;  4Q0F A;  2XRQ D;  3T4A C;  1KAA A;  4JBW A;  5DNF A;  2F0L A;  5CV7 A;  4P2C B;  1F2M A;  1EWC A;  2L11 A;  1V43 A;  2SDF A;  5KEE A;  3VA7 A;  1EIH A;  1DXM A;  3A7L A;  5EQ0 A;  2QIL A;  3R2T A;  3T13 A;  1TWA B;  2EY1 A;  5C5L A;  5JEA G;  2WKD A;  4X3K A;  1TVX A;  2IX3 A;  1LTI D;  5CBE E;  1MI2 A;  2AUK A;  4WJW A;  5I6W A;  3K58 A;  3D3R A;  1CTM A;  2EY6 A;  5JAV A;  4RGM A;  1X3Q A;  3DHQ A;  2B2Y A;  1B3A A;  1S5B D;  5BN4 A;  1C48 A;  1YNN D;  1GUN A;  2F3W A;  2L12 A;  3HS0 C;  3J7A V;  4WFN 3;  5T1I A;  1PLF A;  1S4Z A;  4KHV A;  4TRD A;  1CZG A;  1U9R A;  2E2J B;  1EQT A;  5E3F A;  1GUW A;  2F0W A;  3FKI B;  3A8J E;  4Z9C B;  2BDN A;  4DF7 A;  5JVG 3;  3A8I E;  2Q8R E;  3TSS A;  3I4N B;  2L9H A;  4A3J B;  2A74 C;  3CHB D;  4KN4 C;  4KV6 A;  2F0V A;  1SEB D;  2EJG C;  3OOC A;  4NDX A;  1K83 B;  4XYO A;  3GV6 A;  4FXG C;  1Z7T A;  2B2W C;  1STA A;  3GP7 A;  3I90 A;  3HG9 A;  1DOM A;  3PUV A;  1NR4 A;  5EPL A;  2Q8T A;  1A15 A;  1HQM C;  4MIU A;  4K2K A;  4C56 C;  5KYL A;  3N6R A;  5AFW A;  1O7Z A;  4OIK A;  4EQP A;  1B50 A;  3FPP A;  1KLG D;  1JWU D;  2PO4 A;  1BCP F;  3OW7 A;  3IAY A;  5E4X A;  1HCZ A;  2QDB A;  3SEB A;  2F0N A;  1SDF A;  1PRT D;  3L9A X;  1KDA A;  3DWQ A;  4C1N I;  2B8F A;  3NPP A;  4BY7 B;  1BR9 A;  3TBI B;  1BUV T;  1GXD C;  2D9U A;  2BA0 A;  2L5T A;  1TY2 A;  3JAM E;  4OO1 G;  1ESF A;  1OXS C;  3C1E A;  2EYL A;  3DM1 A;  2B2U C;  5CYU A;  1JOK A;  4RGN A;  1GUO A;  4CJ2 C;  2KCC A;  5KRU A;  5C0X J;  2J4X A;  4OGQ C;  1BBX C;  1GOZ A;  1SAP A;  2EYF A;  5COR A;  1B4O A;  2CHB D;  5D65 A;  2IL8 A;  1ET6 A;  2IPK D;  5CBA E;  3A55 A;  1ROD A;  2K03 A;  2WKC A;  4QUC A;  3I73 A;  2JYO A;  5C5M A;  2NN6 H;  2YYZ A;  5ELF A;  5C0X H;  2A6H C;  1ILP A;  3VYR A;  4K2L A;  3A7A B;  3KLS X;  3VYT A;  2R3Z A;  1BXT A;  3EJI A;  1Y8N B;  5KYI A;  5CV4 A;  4O1N A;  4FF1 A;  2JA6 B;  5ISR A;  1E2V A;  3FEW X;  1GUT A;  2MHV A;  3PUY A;  3A54 A;  2NB0 A;  3DEO A;  5J1Z A;  3I4L A;  1F9Q A;  2A68 D;  1WTW A;  3D6C A;  3S17 B;  1I4Q A;  2XN9 C;  4RCN A;  3R3O A;  3A8K E;  1G29 1;  3OMG A;  3SVM A;  1RD9 D;  4KN7 C;  5A2Q E;  2Q8I B;  2HCC A;  4DNR B;  4K5W A;  4B08 A;  5C4H A;  5CR3 A;  3C1F A;  4LMQ D;  3HOU B;  1I50 B;  1LO5 D;  4J8Q A;  5FO8 B;  5JPN C;  2KHS A;  5FOB B;  3X3N A;  5DM7 3;  2F0E A;  4ULL A;  5G3L F;  1SJE D;  1EZ6 A;  2E2D C;  2F0K A;  2E2I B;  4EGV A;  3WDN A;  4XQJ A;  2NVY B;  4NKL A;  3KLR A;  3BVG A;  2CW0 D;  5FKA C;  1VMC A;  2A5H A;  1LTG D;  2XWB B;  5ELE A;  3I4M B;  1CHP D;  3C2P A;  3NK9 A;  4GZY C;  4KI0 A;  3VR5 A;  2KEC A;  1HQR D;  2VB2 X;  3M7G A;  3QG1 A;  4A3E B;  3U9O A;  5CV5 A;  2V4D A;  3MEH A;  1LAB A;  4XT3 B;  2JA7 B;  1I6V C;  1SE2 A;  1NR2 A;  2QKI C;  1I4R A;  2VNU D;  1Y8P B;  1KNA A;  1I4P A;  1SNQ A;  3H91 A;  2HDM A;  3H09 A;  3S2H B;  1OXU A;  2WII B;  5HUR A;  2OEO A;  4XQN A;  3Q23 A;  5M5W B;  4BBS B;  3S1R B;  1C4Q A;  1V1O A;  2BA1 A;  4DGZ A;  1J9O A;  1S5F D;  3ITP A;  1PRT F;  3VR6 A;  3R2I A;  4TKO B;  1STH A;  2NBF A;  1DON A;  2IT1 A;  2K7V A;  3K59 A;  1O7L A;  2PYK A;  1C8C A;  1H9R A;  3H0G B;  4KKT A;  1CFM A;  1FNU A;  2DY8 A;  5JEA J;  1HTP A;  1KDC A;  1SND A;  1RKN A;  1NUC A;  1IL8 A;  2G9H D;  4ZRZ A;  4ZK9 B;  2NN6 G;  1EY5 A;  1WTO A;  4IQZ A;  1IHZ A;  4IUN A;  2B2T A;  5JEA H;  2G9D A;  2NTS A;  3TZD A;  3MA2 B;  3MWY W;  4YIJ A;  1TS4 A;  1GUS A;  2DNE A;  1A3V A;  2PW5 A;  1KAB A;  4IFD I;  4KJO A;  4X3U A;  3HEJ A;  1LTT D;  3NHH A;  4XXE A;  1SNP A;  3TP6 A;  4XYQ A;  3K0Y A;  3NE5 B;  1RJT A;  5J22 A;  1H9M A;  1SNM A;  1YNJ C;  3E0J A;  1GJX A;  4J6H A;  2EY5 A;  1LTS D;  3DMU A;  3MFG A;  4CGY B;  2R93 B;  3GV3 A;  1SMY D;  2K5D A;  4RCO A;  1SE3 A;  1U4R A;  2WAC A;  1XX8 A;  2RKS A;  3QJY A;  3BDL A;  1IW7 C;  2VUM B;  2A69 D;  2E76 C;  2F0O A;  3J80 E;  3FPU B;  1HUM A;  1B9N A;  5IGF A;  4RGO S;  1II3 A;  1STE A;  2F0G A;  2I46 A;  3PUW A;  4ZKC B;  1LT3 D;  1CQV A;  2Z4I A;  1STB A;  1BCP D;  3GTP B;  1EY4 A;  1F77 A;  1NAP A;  1PFN A;  3GQB A;  5I6Y A;  2F0I A;  4HTH A;  4ZYS A;  3D4D A;  1STN A;  1BQQ T;  1HUN A;  5C44 B;  1OXV A;  4FP5 D;  3NBH A;  4PMC A;  5EPJ A;  4K5V A;  3QWN A;  2H4O A;  2WP8 J;  2PZT A;  4C3J B;  5A2Q L;  2N55 A;  1SYE A;  1F2Y A;  2M2L A;  3DWP A;  1XTC D;  3PIO 3;  1RCV D;  1Z47 A;  2Z8L A;  4CJ0 B;  5M9O A;  5M5X B;  3I3C A;  4XIG S;  3LWE A;  2BCO A;  1DJR D;  4HCE A;  2EPB A;  4FXD A;  3PIP 3;  1R4Q B;  4H13 C;  3K5L A;  1PTO C;  3VYS A;  2EYM A;  2J0T D;  1EZ8 A;  4A3D B;  1EU3 A;  5D3I B;  3S9W A;  4DXF A;  3QIA A;  3FDT A;  3L7Z C;  4RAU C;  4DAV A;  1EEI D;  4CKC A;  2EXZ A;  4KK7 A;  3FRP B;  3H6M A;  2KJX A;  5EBC A;  3M7N A;  5C3E B;  1RTO A;  1T5X D;  2WAQ B;  3D6W A;  2B2W A;  2EZV A;  1SYC A;  2NVX B;  1FD7 D;  2EJM A;  2DY7 A;  2CQA A;  2EE1 A;  3TP7 A;  3GTK B;  4PV1 C;  2RSO A;  2LY7 A;  2F0H A;  1QB5 D;  3SK8 A;  5DEH A;  1YNN C;  1QNU A;  1FYC A;  4IAL A;  1Z6H A;  1LTR D;  1PTO B;  2C5C A;  1Q1E A;  2R7Z B;  2IX1 A;  2TMP A;  2QEJ C;  3DWA A;  1WVL A;  2AQ2 B;  5C4J B;  4G7Z C;  2F4I A;  1WTQ A;  2X6G A;  4DXG A;  4A93 B;  3KK7 A;  3RUZ A;  2RBM A;  4K6L A;  1SNC A;  2EYH A;  5G3L D;  2R61 A;  1GUG A;  4HED A;  2EYO A;  5LHY 1;  1LT6 D;  3EVQ A;  1GHJ A;  1VMP A;  4KKU A;  3Q6S A;  3MVV A;  4C3J G;  1E2Z A;  1D5X C;  1FGB D;  2B2U A;  5CMD A;  2AWO A;  2F0F A;  4I7Z C;  5IT9 E;  2B2V C;  2VXW A;  4QB4 A;  2DNC A;  1CI3 M;  5I2X A;  1EIG A;  2FFK B;  1JOQ A;  2KQ3 A;  2WB1 B;  4N9P A;  1CT1 D;  1Q3L A;  2RDF A;  4IZ8 A;  4JK1 C;  3D4R A;  2BE5 D;  3GTO B;  5LL6 S;  3KUP A;  3BVM A;  4LJZ C;  3CKI B;  1G2T A;  3G7L A;  4XT1 B;  1PRT C;  2TSS A;  1TR5 A;  3TP8 A;  1CM9 A;  3BDO A;  5C3W A;  2HCI A;  3DEP A;  1H9S B;  3SE0 A;  1LLR D;  1O78 A;  3M3Y B;  5EGT A;  1S5E D;  2L4N A;  3EQL C;  2IW3 A;  1Y1W B;  2OT2 A;  3V96 A;  4KMU C;  5CGK A;  4QUF A;  1WTP A;  4G7H C;  2K32 A;  4EQO A;  2XNA C;  3OWF A;  1E0B A;  2HDL A;  1EQV A;  4HR7 B;  5C3X A;  1QIL A;  4EQN A;  2B63 B;  1UEA B;  4IUQ A;  4OO1 I;  1G91 A;  3QOJ A;  5K5P A;  3R8B A;  5C4X B;  2HUG A;  4BA1 I;  3QOL A;  2HQE A;  1QE6 A;  2JA8 B;  3J80 L;  1PZJ D;  3HOW B;  1SYB A;  3EFX D;  2M00 A;  4X3S A;  2DN8 A;  1JCK B;  4L6T B;  4C3I B;  3Q24 A;  3UI2 A;  3W2D A;  2D62 A;  1K8O A;  3BYT B;  4KJN A;  3FMC A;  2A68 C;  5KGU A;  2K28 A;  2F0M A;  2OF1 A;  1EL0 A;  1EY6 A;  1Q12 A;  1DM0 B;  1ICW A;  1RHP A;  1LT5 D;  2FMC A;  1W6K A;  4KKS A;  2FIN B;  4MN3 A;  2K1B A;  1I4G A;  2E75 C;  3NUC A;  3HZX A;  4H44 C;  1LAC A;  4C3H B;  2D2C C;  3R93 A;  1D6E C;  4M8A A;  4EVO A;  1ET9 A;  4M1U B;  1RTN A;  1HFN A;  4DNT B;  2H1E A;  4H7B A;  2EVB A;  3NXW A;  4FF4 A;  2L55 A;  3HOZ B;  2CW0 C;  1IKL A;  3G6J B;  2EJF C;  1F9S A;  3NBI A;  4NW2 A;  5M5Y B;  1EEF D;  4K8J A;  1AZP A;  4LAA A;  1M4V A;  1V8Q A;  3U9S A;  2Y0S B;  3VR3 A;  3KLS A;  4UAI A;  3HOX B;  4A3K B;  1LTB D;  4IUP A;  2M9V A;  1QG7 A;  2F0U A;  4RGT A;  1F2Z A;  4KY5 A;  1EY8 A;  1UAP A;  1DD2 A;  3J7A F;  5IOC A;  2EOT A;  4WOR A;  1JE4 A;  1DOK A;  1ZXT A;  1F2L A;  1MSH A;  1X3P A;  5EKL A;  3MZ5 A;  2EDG A;  1LTA D;  3PUX A;  2L0C A;  4TQU S;  4RHR A;  1CA5 A;  3D8G A;  1D5M C;  3DXJ C;  2NTT A;  1SYG A;  4G7O C;  4Q5V A;  2E2H B;  3NP8 A;  1TWC B;  5FK9 C;  1A2U A;  2AQ1 B;  1KNE A;  4PNY A;  3T51 B;  3T16 A;  3K5M A;  5IGB A;  3Q22 A;  4FF3 A;  3ND9 A;  1JB3 A;  5T1G A;  1WD1 A;  3TP5 A;  5HGT A;  1OXX K;  5JJZ A;  3E6Z X;  1TKW B;  2MPM A;  3LWU A;  5CV8 A;  2LKV A;  1WTV A;  1PMR A;  3GTQ B;  3S14 B;  1L0Y B;  1SBB B;  4MHE A;  1WTX A;  3RD4 A;  3TN2 A;  3K6O A;  3P20 A;  1SYD A;  2LMC B;  4U67 3;  1ZYR D;  4FYD A;  2PW7 A;  3I72 A;  4ME5 A;  4I65 A;  1TQO A;  4RHS A;  3VYU A;  4HN7 A;  3GTJ B;  1D2B A;  4E6I A;  2NN6 I;  3BVZ A;  1HPC A;  5C0X I;  2F0P A;  2Z1C A;  1AFP A;  1MD2 D;  3NTI A;  1AEX A;  1STG A;  4QCL A;  5EBD A;  1U4M A;  1XYI A;  1GHK A;  2ZXR A;  5BN3 A;  2KUM A;  3GO5 A;  1WD0 A;  2IJ0 A;  3O13 A;  1K8M A;  3V05 A;  4C2M B;  2KOL A;  3MXN A;  4IFD G;  1A6X A;  1NSN S;  1SMY C;  2JEB I;  1V1P B;  2O2L D;  3VR4 A;  3BG3 A;  3T53 B;  3S1M B;  4A3I B;  3JAM L;  3TZU A;  3SHL A;  3K57 A;  1STY A;  2KA7 A;  4R8I A;  2A69 C;  4ABN A;  4V0B A;  5E4W C;  2D5D A;  2KEE A;  4PQX A;  4KY6 A;  1F9P A;  1O7Y A;  4DAP A;  5I4D A;  3D31 A;  5DM6 3;  2CVR A;  4CJ1 B;  1BCP C;  3ERQ A;  1R9T B;  2IX0 A;  3L3O C;  2JXM B;  3K5O A;  4Y7N B;  4A3B B;  3GTL B;  4HSV A;  4FVM A;  1AP0 A;  1B1Z A;  1KDB A;  2RVL A;  4HSP A;  2XVS A;  5KND A;  1ZKO A;  2O4X A;  1D1I A;  4NMZ A;  1Y1V B;  2LFN A;  2ZXP A;  5CV9 A;  4IUU A;  4RH6 A;  3C3L A;  2F0D A;  4DK0 A;  1OXT A;  3QO2 A;  4CKE A;  2EY2 A;  1CHQ D;  1XWE A;  4OHJ A;  4BY1 B;  2JE6 I;  4J1M A;  1EY9 A;  3NQT A;  5LL6 X;  5C4Z A;  4DK1 A;  1L0X B;  1HXY D;  1HA5 A;  4IUT A;  4AYB B;  2ICI A;  1ENF A;  1FNW A;  1PTO H;  1B9M A;  3GTG B;  2NYZ D;  3P75 A;  3P1H A;  5CV6 A;  1EOT A;  3K7A B;  4F8M A;  1HFG A;  1EWH A;  1ENA A;  1JIC A;  2K33 A;  4ID6 A;  1I4H A;  1U4P A;  2X69 A;  5IGE A;  2AWN A;  1H9S A;  3M4O B;  1PXU A;  2B2V A;  3AB9 A;  4A3M B;  2JEA I;  2X6L A;  1FNV A;  1BF4 A;  1JOO A;  1SJH D;  1RF2 D;  4K5X A;  4XQQ A;  3CRL C;  1FR3 A;  5EKK A;  2F1M A;  1Y69 U;  3PO2 B;  1ESR A;  3RLF A;  2F3V A;  2QF7 A;  1HA6 A;  2A73 B;  5M3M B;  1EY0 A;  2A6E D;  1SYF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...