1LT5D

Heat-labile enterotoxin b-pentamer complexed with thiodigalactoside
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
103
structure length
103
Chain Sequence
APQTITELCSEYRNTQIYTINDKILSYTESMAGKREMVIITFKSGETFQVEVPGSQHIDSQKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAISMKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEAT-LABILE ENTEROTOXIN
publication title Structural foundation for the design of receptor antagonists targeting Escherichia coli heat-labile enterotoxin.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Enterotoxin
total genus 24
structure length 103
sequence length 103
chains with identical sequence E, F, G, H
ec nomenclature
pdb deposition date 1997-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1lt5D00
1G8ZD 4C56C 3BVZA 1CT1D 1KLGD 1BCPC 4O1NA 3MC0B 1V1PA 1EU4A 1I4RA 1MD2D 2AQ2B 1UNSA 4K6LA 3KLSX 2AQ1B 2AQ3B 1L0XB 1BCPF 4BWGB 1XTCD 1LT4D 1TY2A 1JWMD 1AW7A 1TS2A 1ET6A 1LTAD 1SXTA 4RGMA 1LT5D 3OWEB 1BCPD 1LLRD 5ELFA 2TSSA 2XRQD 1V1OA 1JQYD 3V05A 5ELDA 2WV6D 3EA6A 1SE4A 4RGTA 1BXTA 2NTSA 1TS3A 1XXGA 4RCOA 1LTGD 1JWUD 2CHBD 1CQVA 1SJHD 4RGOS 1LO5D 1EEFD 1S5CD 3BYTB 3O13A 1LTSD 1JWSD 1I4HA 1EEID 4DXGA 1HQRD 1PTOH 2IPKD 3MFGA 5ELEA 1I4QA 5D3DA 1CHQD 1QILA 1PTOB 5TSSA 1L0YB 4DXFA 2ICIA 2NTTA 1RF2D 2RDGA 1LT3D 5ELCA 1ENFA 1T5XD 2O2LD 3DWAA 1LTRD 3BZDB 1PRTF 1RCVD 4RFBA 1HXYD 4RH6A 1RD9D 3DWPA 2J4XA 4Z9CB 1DYQA 3R8BA 1S5FD 2Z8LA 1V1PB 3R2IA 1I4GA 1EU3A 1PTOC 2XN9C 4RHSA 1FNWA 3SEBA 2QILA 5ELBA 1LTID 4TSSA 4ZYSA 1PRTB 1STEA 2XRSD 1TS5A 1FGBD 5FKAC 1LT6D 1KTKA 1PTOF 1S5BD 3CHBD 3TSSA 1EWCA 4RHRA 1I4XA 1PTOD 1PRTC 3EFXD 3BYYB 1FD7D 1B44D 2G9HD 1PZKD 4RGNA 2R61A 1I4PA 1AN8A 1SBBB 2RDHA 1CHPD 3BVMA 3GP7A 1TS4A 1S5ED 1PYWD 1D5MC 1HA5A 1SEBD 3W2DA 1LTTD 1PRTD 1S5DD 5D3IB 1SE2A 2SEBD 1PZJD 1KLUD 1DJRD 1PZID 1TY0A 3R2TA 2XNAC 1D5XC 3DWQA 4L6TB 1LTBD 5FK9C 1JCKB 3BVGA 1UUPA 2IJ0A 2QEJC 4L63B 1GOZA 1HTLD 1F77A 1JR0D 1SJED 4UDUC 1FNUA 1FNVA 1ET9A 5I4DA 4OHJA 1CK1A 1D5ZC 1BCPB 1EFID 3URYA 1B1ZA 1D6EC 1SE3A 1RDPD 1ESFA 1M4VA
chains in the Genus database with same CATH superfamily
4JV5L 2B3GA 2BOSA 3A7LA 1G8ZD 2KEDA 2C35B 5IYCG 3PIPA 5IYBH 1PFBA 4EQNA 1A2TA 4XQNA 3UDGA 4DV4Q 1IBMQ 4P72A 2ZJQA 3MXGA 3M4YA 1CSQA 1H9KA 4OELB 4MTKA 4X62L 1C0AA 1Q1EA 3MXNB 2O5IC 2QF7A 2A1AA 1WD1A 1V1OA 5KYIA 5M9OA 4LF6L 3QIAA 3GTPH 4A3FG 4QL5A 4EVOA 1EOVA 3IFDA 2XGTA 2YU9H 1I4HA 2Q2UA 2EXDA 2NVQB 2L4NA 5A35A 2FFKB 3GTGB 4DV5Q 3H0GG 2UXDQ 4GNXA 3F1ZA 2Z4IA 4V190 4K5WA 1EIHA 4POFA 4KV6A 2JN4A 1LV9A 2VNUD 4DV7L 2Q2IA 2Z8LA 1K0SA 3U58A 3RR5A 2QCPX 4BBRH 5A2QE 2AMCB 5I2YA 1A6XA 4DV6L 1ZYRC 3HOXH 4LF9Q 3S1NH 3BDLA 1TU2B 3C1FA 4UHVA 1EQQA 4JI2L 2QDBA 2DGYA 3R93A 4C2MB 2QEXA 2E2JB 3E3XA 4JG2A 1NY4A 1ZYRD 2X6GA 3TP6A 4FXKC 1J5EQ 2XSCA 1G6ZA 3J7AF 2B2TC 3GP7A 1ENCA 5F2DA 1HUMA 2HT1A 5I2XA 1D5MC 1E0BA 1AE3A 1S5DD 3NTKA 5JOBA 1E3PA 1LM0A 5FLXc 1A0IA 5M5YH 5IODA 1X6OA 4ZCKA 3ITPA 2L5TA 3J81E 1OXUA 5DAUA 1QB5D 2FMCA 3TP5A 5IGDA 5K36G 2AUJD 1BCPB 3URYA 4TKOB 4YY3L 1JE5A 5EKLA 2EPBA 1HA6A 3A7AB 4QF4A 2XWBB 2DN8A 3SK5A 1H9RA 3HKZG 4NP5A 1SMYC 3M3YH 4PMWA 1SLJA 2WINB 4DV4L 1IBML 1N32Q 1TWHH 3Q6SA 1VF7A 2C5CA 2CWAA 1NJIC 2XIWA 3I4NG 4JYAQ 3UE1A 2PPBC 1SMYD 3PUZA 2VB3X 1XXGA 1VQFA 3OMGA 2NZOA 3Q23A 4A3IH 2F03A 1XNRQ 1HPCA 1NAPA 4XYQA 3RLNA 3GTPB 4G7HC 1EEID 1BBUA 1U9RA 5ELEA 3J80E 1HFGA 2YU9B 3OIPA 4DUZQ 4FF4A 2JA5G 1SROA 3EIVA 4DV5L 2UXDL 1L1OA 1PRTF 1RCVD 1NCVA 3G6EA 1CQFA 3DUZA 1F2MA 1WFQA 4C1NK 4Q5VA 2YV5A 2F0IA 2PNRC 3M85A 2XN9C 2E2DC 3K7UC 3E9HA 1VQOA 1TS5A 2UUAQ 4F7XA 5JVH3 2V4DA 3I90A 4K5VA 1GUSA 3NWTA 4BBRB 2LMCB 2RDFA 3HOXB 2CW0C 1C8CA 2H4OA 3S1NB 4LF9L 3S17H 3T1YQ 4DV1Q 1KDBA 2OEOA 3DLLA 3M9BA 2ZXOA 1TS4A 3MWYW 4HR7B 1YNNC 2CW0D 4DNIA 1PH2A 1M8AA 1HA5A 1J5EL 4BY7H 1LTTD 2R92H 1IKMA 1HFNA 5FLXL 4GN4B 2NWGA 4P74A 1JJGA 1UAPA 3BS1A 1Z6HA 4KK7A 3A0JA 2HD3A 5IGCA 5M5YB 1KL9A 4NB3A 5M3MG 4UP9A 5DM63 4R9WA 4ZK9B 1D6EC 3CMAA 5HGTA 4R4IA 1KRTA 1Y1VH 1QE6A 3OTOQ 3H3VH 2AWNA 4GKJL 1YITA 2GN5A 1CT1D 1EU4A 4HSVA 3KLSX 5ELNA 2AQ1B 1VQHA 2D62A 2N55A 1SYFA 4APVA 2L11A 4KJOA 1XNQQ 1OXXK 4YCWA 4ZAIA 3M3YB 2Q2HA 1CI3M 1K73C 1N36Q 3K80C 2H5XA 1TWHB 3G6JB 1VQ6A 1N32L 3GV6A 4JOIA 3MHBA 1TXYA 2F0WA 5IP9H 4RCOA 4DR3Q 1WVLA 2HHHQ 1PDQA 4JYAL 1PVOA 1Q46A 3BYTB 3O13A 4DNRB 4KD4A 4A3IB 2MHVA 3S1RH 1XNRL 4QCLA 1IYUA 2OT2A 5IT9L 2ICEC 3IRBA 1Q12A 3NQTA 4PNYA 3K58A 4LF8Q 4GKKQ 1MGSA 1M1KC 2FJ2A 5JAVA 2YTYA 4Q0FA 1PMRA 1PXUA 3W2DA 4DUZL 4PZ7A 2HDLA 3R2IA 4IQZA 2K5DA 1E1OA 1LUZA 4DNTB 4WJ3M 3F2UA 2UU9Q 4AIMA 2XRSD 1I5FA 4OX9Q 1SAPA 4FNFA 5IOCA 1EWCA 5I9OA 2UUAL 3A74A 2PZWA 3S2DH 3J7YW 4H44C 1B3AA 2KBNA 5EPJA 1PRTC 2Z6KA 3P1HA 3MAQA 1VMPA 1GHJA 2EYMA 1HR0Q 1KHIA 3H94A 1YJ9A 3HOWG 3S17B 4CKEA 4DFAA 4TQUS 1VQGA 4BA1I 3T1YL 3M4PA 3OPOA 5FOBB 3H3VI 4FF3A 1EIGA 4DV0Q 3KK7A 4DV1L 1PRTD 5D3IB 2M00A 4GNXB 5JEAG 4A3GH 1WOCA 1J9OA 4BY7B 2A5HA 2R92B 1U0LA 1D5XC 2UUBQ 1UEAB 2KENA 4XQJA 1H9SA 2OTJA 3CCQA 3D31A 1JJ2A 1QOHA 3I7FA 4RA8A 4JBKA 2F3IA 5CV8A 4BY1G 4CJ0B 1B1ZA 3A5UA 4JI8Q 3K6OA 2F0MA 1VF5C 3CCVA 3F8TA 1VS0A 1Y1VB 4JI1Q 2F0QA 4CDCC 4LMQD 1JE4A 2MFIA 2VUMG 1Y1WG 3OTOL 2AQ3B 1L0XB 2WB1G 1A63A 2I07B 3PUWA 4DK0A 1TY2A 1CZGA 1JWMD 1VDZA 1ENAA 3KLSA 2EJGC 2B8FA 3EN2A 1JOOA 1E2WA 1LYLA 1XNQL 4RGTA 2B39A 2L12A 1N36L 1BNZA 2EE1A 4G7OC 1EL0A 4NXNQ 2YTVA 4K6DA 4LWCA 1SNQA 2SDFA 3VDYA 4YCUA 1EEFD 2B29A 4GOPC 4HJ9A 1EY4A 4DR3L 1RKNA 2EJMA 2LXKA 3Q8DA 2HHHL 3EQLC 2YTXA 5C44G 2BDNA 5E7NA 5FJ8H 3RLOA 1QILA 3S1RB 1GUGA 3Q24A 5JJLA 4MHEA 2RDGA 1RF2D 3SE0A 4YWKA 1LT3D 5ELCA 1B50A 4LF8L 4GKKL 3CPFA 2E75C 2L55A 1GUOA 3NBIA 4JC0A 1WTWA 2RHQB 1X3GA 1LT6D 1UE1A 3CCJA 4KHPQ 1KQSA 2G9DA 3HOVH 5DNFA 4BS9A 4KY7A 1RTNA 1OXSC 4OX9L 2F0KA 2ZT9C 3M7NA 3S2DB 1FD7D 3CCMA 2EYHA 4HEDA 1VQ9A 1PZKD 5EJWA 5H1SE 4OEMB 4AYBG 5M3FG 3J81c 3NE5B 1PH9A 4RCNA 2M9VA 1A3VA 1HR0L 2ZTDA 1A2UA 4JI5Q 1K8OA 2CCZA 5KNDA 1DXMA 4XQQA 3DMUA 5C0XH 1DJRD 4DV0L 4A3MH 4A3GB 4L6TB 4DR6Q 1L1OB 2I0QA 1NR4A 2DNCA 4LFCQ 3I56A 5I4DA 3J7A5 5J22A 2UUBL 1XPOA 5IYCH 5J3BA 1VQBA 1SN8A 4G57A 1FL0A 1UEBA 4HJ5A 2IX1A 2R93G 2FINB 1HQMC 3FPPA 3MC0B 4LJZC 4JI8L 3K57A 5JEAJ 4JI1L 2PW5A 5E3FA 1X3FA 4H13C 1IXRA 4KMUC 2WAQG 4A3FH 1Q7YC 3S1QH 1Y8PB 2CQOA 4G7ZC 2OWOA 1O78A 1SSOA 3NUCA 4A3EG 2R6GA 2RSOA 3L2PA 1PH1A 1S3OA 2CHBD 1HH2P 3I4MG 1U4MA 1B8AA 4ZQ3A 2EVBA 1B9NA 1Z47A 4IALA 4M8AA 4NXNL 3FMCA 3F2BA 1G51A 4K14A 3MFGA 1V1QA 1I4QA 4PG3A 5A2QL 4KJNA 2B2WC 2I5LX 3J81j 3OW2A 2MGSA 1VQ5A 4YWMA 3BZCA 1GJXA 1NTGA 4RKLA 1PH5A 1E2VA 5IY0A 4J6HA 2RCNA 3PIO3 1U4RA 2D5DA 1PTOC 3M7GA 2CQAA 3PF5A 2QILA 1VQPA 2N49A 1OO9B 2D0OA 2FXQA 3PQIA 2ASBA 3A55A 2JA9A 3TSSA 4PMCA 3I4LA 4LF7Q 3DM3A 4L5SA 3HOVB 4KHPL 1PTOD 2YYZA 4XIGS 4LAAA 5KNBA 2NVTH 2B2VC 2G9HD 4IJHA 3J81L 3VA5A 3ND9A 4XT1B 1JOQA 3Q22A 1CHPD 2BA0A 1OXVA 5KEEA 3RLFA 2J7ZA 2K4KA 3RN5A 1MBYA 5K36H 4JI5L 2I46A 1KNAA 2ZTCA 1EOTA 3DWQA 2ZM6Q 3AB9A 3E0EA 4X6AH 1JCKB 4FXGC 2A69C 5C5MA 3P7JA 2BCOA 3SHLA 3HOZG 4JI6Q 4DR6L 1EFID 2K01A 1VQJA 3DEPA 4KKSA 5KGUA 4DR1Q 2F0EA 4KN4C 4OO1I 4LFCL 1ESFA 4QB4A 1ICFB 1XMOQ 3HOYG 3M4OH 2DY8A 2A69D 2F0PA 2N78A 1LABA 4JI3Q 3V2TA 1CTMA 5IWAQ 4X3SA 4H0LC 3AQQA 3CCSA 5C3EG 1QVGA 2Y0SG 1N34Q 4EQOA 4ID6A 2K5VA 1KABA 1MI2A 3QJYA 1GUNA 1AW7A 5IYDG 2F0SA 1SXTA 3J80L 4J1MA 3U9OA 3PV0A 5ELDA 4A3FB 2WV6D 2AWOA 1HNXQ 1CUKA 3FRPB 3S1QB 4B08A 3UI2A 3GTKH 4TVAB 1HTPA 2RF4A 3TBIB 2K5QA 4JBMA 4A3JG 1H9SB 2IX3A 1CFMA 2JA5H 1IW7C 1PH3A 5IP7G 4PZ6A 5J39A 3PO3G 1E2ZA 1ENFA 2F3VA 1WTOA 3DWAA 1ML0D 2NVYH 3I8ZA 1O7ZA 3DWPA 3PMFA 1IW7D 3R8BA 2RKSA 1NMGA 4X64Q 3MVVA 1DOLA 3CCRA 1DZ1A 1IL8A 3BDOA 2PMZB 2Q8IB 1I3QH 5LL6S 2HUGA 4X3TA 1GUTA 1FGBD 1A15A 2B2YA 2VZAA 4CDDC 1C7YA 1C48A 3PIOA 2F0LA 3T1HQ 5GADC 5FO8B 4OO1G 1HHVA 4YHHQ 3EBEA 1E1TA 4FXDA 5EQ0A 3FHWA 1DD2A 3BYYB 1B44D 4LF7L 2R61A 3NEMA 4GN3B 4K2KA 3T51B 1YIJA 2JA6G 2NVTB 2NN6G 2F0JA 3TS2A 2N8NA 1S5ED 3CQZH 4MZ9A 1K8MA 1B53A 2R7FA 5M3MH 2EYFA 4J8QA 1KLUD 1TY0A 3BDCA 4P75A 1Q1BA 3RMHA 4POGA 1JR0D 3PSIA 1YBYA 3GQBA 5NUCA 1TVXA 1ILQA 2Z9HA 2ZM6L 3J7AV 3OSOA 3UDFA 5D14A 1PH6A 5COYA 4JI6L 3K5NA 4DR1L 1RHPA 3A8IE 1WTPA 1QUQA 1W3SA 3HKZB 3K5LA 1XMOL 3CP0A 3M4OB 4FF2A 2HIVA 4LK1C 2ZXRA 3K5MA 3CU7A 4KHZA 4K6LA 4OONA 4JI3L 3VR2A 2KHIA 2E76C 5IWAL 4IN3A 2D9UA 3S1MH 3E0JA 4KI0A 1YHBA 2K14A 3MZ5A 5CORA 2B63G 1N34L 3QOJA 1JQYD 1F2LA 3DXJC 2B2UA 3GO5A 1LTGD 1JWUD 1F9PA 1CQVA 3KBGA 4RGOS 4YIJA 4IUTA 4UP7A 4B9XA 4N8FA 2E2IH 3D0FA 1HNXL 3GTKB 4B3RQ 2IPKD 1NR2A 2JA5B 2HCCA 3HG9A 4EGVA 4HAEA 1PH8A 2IY5B 2K04A 2D0PA 5C6AA 3TN2A 3HRZC 2A6HD 5I6WA 1I94Q 5EBDA 2NVYB 1MJEA 3BJUA 1IKLA 3EROA 4LF4Q 3I72A 2P5ZX 2AKWB 2R3ZA 5KIXA 4X64L 1X9NA 1N8RC 4NPSA 1I3QB 1VCIA 3HOWH 1EFWA 1HUNA 1K0RA 3NHHA 3GD7A 2EYJA 3EFXD 4H02A 3P75A 3F2CA 3T1HL 4B3SQ 5EKIA 3FKIG 3KLRA 2UXCQ 5JEAH 4YHHL 2DJGC 2CVRA 3ONAB 2VQEQ 3KDFA 3PCOB 5BR8Q 4HIDA 4OWWB 1B7YB 1W2BA 1X32A 3QG1A 2SEBD 3CQZB 4DR4Q 4A93G 1UE5A 2JK8A 4BY1H 3GTJH 3D8GA 2F4IA 1UUPA 2IJ0A 1Z7TA 1GOZA 1I50H 2KCCA 1CK1A 4FO2A 3D3RA 2K5WA 2EY1A 4R8IA 4GLXA 1QVCA 1SE3A 4WORA 2VUMH 1CKMA 1Y1WH 1STAA 2DNEA 4WFN3 4GLVB 1JJCB 4FYDA 1Q90A 1F2ZA 3CF5A 3IFTA 3A8KE 3CC4A 1BCPC 2F0UA 1Y69U 1SFOH 1IBLQ 1V1PA 1I4RA 3MEFA 3E9IA 5IGFA 1I6HH 1EY6A 3TMEA 4A4IA 1DCZA 3TEHB 4C3JG 4HIKA 3WWVA 2L0CA 1EY7A 1BCPD 2X69A 2EY2A 2TSSA 3S1MB 4EQ5A 1SE4A 5C4XG 3E5SA 4R1JA 5C44H 3MXUA 4DAYB 3TDQA 3H6MA 3EJIA 3FDTA 1WI5A 2NUCA 1SNDA 3HS0C 5HGQA 1YJNA 4L8JA 3PF4A 2E2IB 2Q2TA 1Y8NB 4B3RL 5TSSA 4NDXA 2VL6A 1EYCA 2F0HA 3CCLA 2NB0A 1BQQT 2A19A 5CGKA 4IUQA 4G4KA 1P8LA 3V96A 1X54A 2K52A 4PQXA 4RHSA 3SEBA 2EOTA 3D4DA 4OWXB 3PGZA 1I94L 3I2ZA 1KTKA 5LMNW 3CHBD 1U5KA 4LF4L 1MSGA 4JBJA 1XJVA 1N9WA 5FO9B 5M3FH 2PCFB 1U4LA 2IW3A 2N3SA 2QDLA 1Q82C 3T53B 2F52A 3OW7A 3HOWB 1DONA 1RODA 3VYUA 3SK4A 1CKOA 1SBBB 4DR5Q 5CV9A 3AFPA 3BVMA 2JA7G 4ULLA 2UXCL 1XMQQ 4HJ7A 3JC66 4KN7C 5CYUA 2VQEL 1AZQA 1G2TA 1IYJB 4KHVA 5BR8L 4CJ1B 4NKLA 5EPLA 1X55A 1F2YA 1TWCH 2IL8A 4HMJA 3ZJYC 5T1GA 3N52A 4X65Q 1A8VA 1O7LA 2IT1A 4LUVA 1B70B 1GHKA 4BY1B 4DR4L 3RUZA 3GTQH 1ET9A 3GTJB 4OHJA 3SK6A 4KD3A 5EKKA 2UUCQ 4XYOA 2R93H 1I50B 2HCIA 3LX0A 1NNXA 4C3HG 3STBC 4KLKA 1SNMA 1D2BA 4H7BA 4A3KG 1W6JA 1Y1WB 2VUMB 1V8QA 3HZXA 1YHAA 4IO9A 4O1NA 2Z6BA 1WCMG 5GAHC 1EYAA 2WB1B 3D6CA 1S4ZA 4QQBX 1SE8A 5JPMC 1SFOB 3AEVA 1OXTA 4BWGB 4A3EH 2EJFC 1IBLL 3STBD 2WFWA 4DAVA 4OIJA 1I6HB 4WJWA 2Y0SE 3I4MH 1LLRD 2B2TA 2XRQD 1T9HA 3EA6A 3T16A 2NTSA 4IPCA 1VQKA 5AJ3Q 1TR5A 1K9MC 1BUVT 4JI7Q 5EGTA 2R7ZG 3OHXC 5M5WH 2JSOA 5C44B 1AFPA 3OOCA 1C4QA 1CHQD 3GTLH 1KXLA 1PH4A 5KNCA 2NTTA 3A8JE 4RFBA 1RJTA 1QUQB 1RD9D 4O2DA 1DGSA 2E8GA 2FHTA 1S5FD 3X3MA 4QIWB 2DY7A 1VMCA 4JPBW 3ICEA 1K3RA 1AH9A 2JEBI 4DK6C 1S5BD 1PTOF 1VQ4A 2CFMA 3D4WA 4X3KA 2SNMA 2KOLA 3DHQA 4IURA 1WJJA 1O7YA 4AYBB 5M3FB 2EDGA 2F0OA 2B8GA 2MPMA 1XPUA 1E7ZA 2KUMA 4ZUIA 4OGQC 2OXPA 1B2TA 1PFMA 2VY3A 4DR5L 1BBXC 2CH4A 2A74C 5CBEE 1CA6A 3ULPA 3HOZH 4UY8C 4PZ8A 4HIOA 2NYZD 1XMQL 4AQYQ 2UU9L 4B9WA 2SNSA 4UPAA 5FLMG 4DUYQ 1TWCB 2PMZE 3HOYH 1F77A 3PO2G 3FEWX 4JK1C 4GNXC 1D7QA 4J15A 3NTHA 4U68A 1D5ZC 2QKIC 4JI0Q 4X65L 2EIFA 4HJ8A 4LFBQ 3GTQB 2K32A 4C1NI 5C3EH 2R93B 2UUCL 2ZTEA 1ASYA 4DK1A 3DEOA 3QOLA 1JICA 3OYYA 5IYDH 3TZDA 3KBXA 1G2SA 1H9MA 2HIXA 3HEJA 1BO0A 3KYHC 2WAQB 1BR9A 1KRSA 1QWYA 3HKSA 5CMDA 1TWAH 1XTCD 2M2LA 3KDFB 2PZUA 2BA1A 1ET6A 4A3EB 1FGUA 4A3JH 4LUZA 1BOSA 4I7AA 3GTOH 3CC2A 3HOUG 3NK9A 3I4MB 3L0OA 3K81C 3A56A 5IP7H 1HZCA 4F8MA 3IAYA 2RA4A 1ESRA 2E2HH 1STYA 3KJPA 4PV1C 3PO3H 4I65A 1NUCA 4U673 5AJ3L 2PNHA 1K28A 5M5WB 4JI7L 3SR1A 4JI4Q 1VQEA 4FDBA 3S24A 1FYCA 3X3NA 4P73A 2E5LQ 3HKZE 1KAAA 3OWFA 5GAGC 1G6PA 5E4WC 3GTLB 1MIUA 3DM1A 2JYOA 3W3AA 2JA8G 2N88A 4N9TA 4RKBA 1Q3LA 1CSPA 1V1PB 1A3UA 1EU3A 4HIMA 4OO1H 1FNWA 4TSSA 3H0GH 1EQVA 2K50A 3I55A 1F9QA 4K0KQ 1EY0A 1NE3A 2DJFC 1L0WA 2A68C 1UE7A 4GN5A 4IFDG 4RHRA 1HZ9A 2IWHA 4K8JA 3ZYYX 5IE8A 2JA6H 1Q8KA 2NN6H 5CV7A 4DAMA 2KQ3A 2MUYA 3M4QA 4A3DG 4LUOA 2A68D 4A3LG 5IGBA 5JJZA 1R9TH 2NVXH 4BBSG 2L9HA 1HJPA 2WACA 2JE6I 3CPWA 1R4PB 3FVQA 3IL8A 1F9SA 1SE2A 5D65A 2XTIA 1SDFA 1IZ6A 2PQAB 4GZYC 4UAIA 1HNZQ 3TQYA 3HOZB 2Z4HA 3BVGA 1QNKA 4L63B 2H1EA 3CCEA 4AQYL 1PHJA 1LTLA 1WTVA 4CKCA 4DUYL 3G71A 5EBCA 1KAWA 2PQEA 4A3CG 4CDFC 2F1MA 4M1UB 3KOJA 4BA2I 1L1OC 1X3EA 3JAMi 1V43A 4LFBL 5C3EB 3IKJA 3S2HH 2XVSA 5M5XH 2ENBA 2Y0SB 3T13A 1KDCA 2B63H 3CRKC 1STHA 4DAYA 3I73A 3CMEA 1LT4D 2F0FA 4DF7A 1UE6A 3ER0A 1BVSA 4A3MB 2F0NA 1TWAB 3K0YA 1UWVA 1VQIA 1J8IA 1FJGQ 4A3JB 2R7DA 1B9MA 4DV2Q 3GTOB 5GROA 1CKNA 4JI2Q 3VA7A 1F9RA 1PA6A 1QZHA 4DV3Q 2O4XA 2F3WA 2QGQA 2KVMA 2E2HB 2ZJPA 1LACA 4R4CA 2E2JH 3I4NH 3PO3B 2NN6I 2ICIA 2GVBA 3W1BA 3AFQA 1GD7A 1U4PA 4JI4L 4RH6A 1SYBA 2D2CC 2K05A 2MO1A 1WTRA 4Z9CB 3H09A 3WOFA 2E5LL 2MO0A 3I3CA 1JT8A 2K03A 2NZHA 2F0VA 4IUNA 1E24A 2SOBA 4ZYSA 3VR4A 1EZ6A 1IHZA 1VQ7A 5JJKA 1HZAA 2KEEA 4FP5D 5CV6A 3FKIH 4CDEC 3H0GB 4S3SA 2EYPA 4K0KL 2HQEA 1EIFA 4A3BG 4L5QA 5K5PA 4IPDA 3CW2C 4O42A 3D4RA 1Q86C 2JA6B 2TMPA 1I4PA 1AN8A 3GV3A 3W5OA 4A93H 4HN7A 1EY9A 1XX8A 5HURA 4GOPA 2XWJB 4JOIC 3MFYA 4C3IG 1R9TB 2IX0A 2NVXB 4DAPA 1K8AC 3KFUA 1PH7A 1TWGH 2QA4A 3QR8A 2JJQA 3LWUA 2KCTA 2EY5A 2OQKA 5G3LD 1PZJD 4N8X1 5C3XA 4FF1A 1DM0B 4YWLA 4IFDJ 2Q8TA 1YZ6A 1HTLD 1EY5A 1SJED 1MHWC 1ASZA 1FNVA 1HNZL 3L3OC 3ULJA 1EWHA 2MP1A 1RDPD 3FPUB 1EIYB 3RD4A 3HP3A 3CRLC 3AMUA 4E6IA 4X66Q 1KLGD 3CC7A 3VR6A 4C3JH 2VW9A 4OIKA 2OQ0A 3S2HB 2BH2A 5M5XB 1BCPF 1YHQA 3U4VA 1TIID 2B63B 4IPGA 3RZOH 5C4XH 4JCVE 4KTAA 4QJFA 2RQXA 1DOMA 1PLFA 2K5NA 3KUPA 4V0BA 2Z6KC 1XPRA 1GM5A 1VQDA 1KD1C 5EPKA 1BXTA 2WKCA 4NW2A 1TS3A 1YNXA 3CD6A 1SJHD 1EWIA 2EYOA 2KHSA 2KJXA 2FMMA 1FJGL 1LTSD 4IOAA 5JPNC 1VQAA 1TT2A 1HQRD 4TRDA 4DV2L 1K83H 1QCBD 2OTLA 1VQNA 5D3DA 4DV3L 1L0YB 1BDOA 3I4NB 4HMIA 2IHEA 2WB1E 2VQFQ 1LTRD 4KKTA 3S9WA 2J4XA 2JXMB 2RSNA 3JAME 2LFNA 2KCMA 5ELBA 2RBMA 1STEA 5EAYA 4BXXG 2K5HA 4ZKBB 2A6HC 1Q81C 1NBWA 5J1ZA 3W1GA 3TP8A 1I4XA 3SXHA 3N6RA 3S15H 3FKIB 2JA7H 4JW0A 5LL6X 3TS0A 3KF6A 2OCEA 4DU9A 4RGNA 3C3LA 4GKJQ 2RDHA 1EYGA 1K3BC 1QVFA 1ONLA 4A93B 4CBVA 3GTMH 1SYCA 3TZUA 2B2WA 1ZEQX 1TWGB 5FO7B 4R4TA 3VYRA 1YNJC 4C3HH 2JQOA 4R4OA 4F88A 5DEHA 4QIWE 4QY7A 1MKHA 4A3KH 3E6ZX 5C0XJ 3CAMA 1KIXA 1WCMH 5BN3A 1YJWA 4QGUA 1JOKA 1WTHA 3H91A 1HZBA 5CC4A 5E4XA 5I6YA 1YNJD 3U4ZA 1EZ8A 4C56C 3BVZA 1RTOA 4AYBE 1PFNA 1VQ8A 4OL7A 4HJAA 2ZJRA 3VR5A 2MQHA 3F2DA 2LS01 1STNA 4X66L 2X6LA 4C3JB 5IT9c 3BU2A 3UDXA 3WDNA 5M3MB 1KDAA 2O5JC 2B2VA 1NSNS 5IYBG 3SDZA 4ABNA 2VS1A 1SR3A 4B3MQ 1LT5D 2KCNA 3OWEB 3PUXA 2R7ZH 2Z0SA 3RZOB 5C4XB 2K28A 4YCVA 3V05A 3QB3A 1ZXTA 2OF1A 3QO2A 4ALPA 2ID0A 4O0AA 2MJ8A 1X3PA 4DKAC 3OIQA 1ZKOA 4HTHA 1JWSD 1HRJA 1H9JA 4XDXA 4I7ZC 1YI2A 4DXGA 2K6AA 2F0DA 4WRDA 1SRUA 2CH4W 3A54A 2RVLA 1K83B 4XT3B 1WTXA 2ZXPA 3C1EA 1O7IA 4DXFA 2I5HA 5AFWA 2BE5C 2LKVA 1TQOA 1EY8A 1MSHA 2CWPA 3C2PA 3QWNA 2EYLA 1X65A 2WAQE 3HFZB 1TKWB 1I4GA 2C9OA 2VQFL 1J6QA 4DGZA 1PRTB 3AYHB 3TRZA 3GDEA 2BE5D 5LMNQ 1EYDA 1I6VC 4KY6A 3TP7A 4BBRG 3G4SA 1YNND 2HQLA 1XTDA 3VR3A 2PQAA 3HOXG 1JB3A 3KF8A 3S15B 5IGGA 2JA7B 1CKNB 4LFAQ 4CJ2C 4F87A 1R4QB 1S72A 5FLMH 1PYWD 1CA5A 5ELOA 3NXWA 3PO2H 1D1KA 3ERQA 3K5OA 2EZVA 2L15A 3R2TA 1L2FA 1JB7A 3SGIA 3GTMB 1LTBD 2LY7A 2PYKA 5FK9C 4AH6A 4CKBA 1QZGA 4UDUC 3Q0AA 4XTCS 4DK3C 2EY6A 4C3HB 3UDIA 4HCEA 4A3KB 1GKHA 4NXMQ 1JMCA 2KHJA 4B3SL 3P20A 1WCMB 1AP0A 4UP8A 3G48A 4LW1A 1BKBA 4ZRZA 2K1BA 4IUPA 4Y52H 1JORA 3VYSA 5CBAE 3HOUH 2KA7A 3PUYA 1KNEA 3I91A 4P71A 1AE2A 1SMXA 1D1IA 2JP1A 4GOPB 4DR2Q 5LMUQ 3AU7A 5ELFA 2IHFA 2AUKA 4XXEA 4B3ML 2R7ZB 2GVAA 1STBA 2GA4B 4K5XA 1Z9FA 4ME3A 2VB2X 1PTOH 3NBHA 1TWFH 2A73B 4IPHA 5E1FA 2ALYB 2NZ1D 4A3IG 3K7AH 2JA8H 3H15A 4QUCA 4QMGA 3PUVA 4K2LA 3T4AC 3U50C 4KKUA 2O2LD 4K8IA 3BZDB 1HXYD 1MJCA 1ILPA 4DR7Q 4IFDH 2UXBQ 3I4OA 1ICWA 5T1IA 1WD0A 5FKAC 1Y8OB 4A3DH 3ERSX 3NTIA 3RNUA 4ZLTF 4A3LH 1VQMA 5LMNL 4BBSH 2AHOB 2J0TD 4DPGA 2KECA 4CGYB 3BG3A 3HGBA 1HR0W 2PW7A 1VQLA 1NMFA 1HNWQ 4EQPA 4MIUA 3MXNA 4LFAL 1DOKA 2PI2A 2L1BA 2PZTA 3B6YA 1IL2A 4OXPA 4ZKCB 1JC7A 1G291 4IUVA 5HY6A 1AEXA 1QJOA 2XNAC 3K0XA 5IGEA 3PO2B 1PYSB 5C5LA 4A3CH 1E22A 4RMFA 4BY7G 2R92G 1X3QA 4HSPA 4X3UA 3MXPA 3FP9A 1KC8C 1AZPA 2I5MX 5FLXE 3D6WA 1HCZA 5L37A 3K59A 4GLAC 4L5RC 3K8AA 3S14H 3TREA 3L7ZC 4NXML 4N9PA 4IJLA 1MD2D 1Y1VG 3NWSA 5KYLA 1UNSA 5KRUA 3KF6B 2B2YC 1WYDA 1G91A 3SK8A 1SYGA 1N33Q 3MTSA 3HOUB 1D8LA 4RGMA 3MA2B 3G7LA 3LNNA 5CR3A 4IFDI 1B3QA 4B3TQ 2RHSB 2NBFA 4JVZA 4DA2A 4DR2L 5LMUL 1LO5D 2ATWA 1S5CD 1YEZA 2EQSA 4RWSC 2PI2E 1X56A 5IP9G 5CV5A 4OWTB 5GQOA 3JAMc 3NQIA 4MTNA 4HCSA 1PTOB 3NENA 1TWFB 4WJ4A 4R4QA 5BN4A 4IZ8A 3K7AB 2G5DA 1T5XD 2JA8B 2Z1CA 3NP8A 4JBWA 4MNOA 3H3VC 2LSSA 1DYQA 2RCFA 2WP8J 2QW7A 3LWEA 2VXWA 1S40A 1XWEA 5IT9E 4DR7L 4A3BH 1C9OA 2UXBL 2A6EC 4DN4M 3LGJA 1A3TA 1K8GA 4A3DB 4Y7NH 3S16H 1V9PA 3A5ZB 5C4JH 4C3IH 2F4VQ 5IIFA 4BBSB 1QG7A 2CKZB 1IBKQ 2A6ED 1H95A 2PO4A 5G3LF 3J7ZC 5DLQE 4ILWA 2B2UC 2WKDA 5GAEC 1HNWL 4PMBA 2A8VA 1SYEA 1VQCA 2DUDA 1II3A 1EQRA 3C46A 1PFSA 1QNUA 3RZDH 4LF5Q 1SYDA 1GUWA 1GO3E 4MN3A 3ND8A 4A3GG 3R3OA 1T5EA 4NMZA 3PIP3 4JV5Q 3J80c 3BZKA 1SNPA 3UE0A 4R8NA 2MNAA 1M4VA 4ME5A 2E74C 1EQTA 2HDMA 2ES2A 1Y14B 4GS3A 3CKIB 3RN2A 3S14B 2AQ2B 1O80A 4X62Q 3KF8B 3I70A 1TS2A 1LTAD 4LF6Q 3SVMA 4EX5A 1IYVA 5I9PA 3HOYB 1N33L 4P2CB 5C4ZA 3U9SA 4QUFA 4JI0L 1CZWA 1SNOA 3WOEA 2NVQH 5C0XI 4B3TL 4LNQA 3GTGH 1STGA 3NPPA 3ULLA 3JAML 1BBWA 1EUJA 1FVIA 5C3WA 3J81i 4IOCA 4KY5A 1YVCA 4CHTB 1P16A 1Q8IA 2K33A 3OMCA 4DV7Q 3NELA 1GVPA 2K7VA 3VYTA 4BXXH 1B4OA 2V1CC 4RG1A 5FJ8G 4DV6Q 3T56B 1FR3A 1CM9A 1OTCA 5LHY1 4L5TA 1LTID 4ODGA 3CXCA 5DM73 1PV4A 1WTQA 4IUUA 1GXDC 5ISRA 4A3BB 4A76A 2EXZA 4C2MH 2K75A 4RAUC 3HOVG 4Y7NB 3S16B 3KLWA 1RIPA 2Q8RE 5C4JB 4C3IB 4FVMA 2F0GA 3KJOA 2F4VL 3NBHB 4A75A 4ZUJA 1SEBD 1BF4A 3EVQA 1IBKL 2F0TA 5JJIA 5CV4A 3MEHA 2LXJA 1SNCA 2BDOA 1PZID 5JVG3 3J80i 1XYIA 2WIIB 5BN5A 3CCUA 3NSWA 2QEJC 3RZDB 4YY3Q 2BH8A 1A62A 1M90C 1W6KA 1FNUA 5C0XG 4LF5L 1RL2A 5C4HA 1PYBA 3L9AX 4A3MG 2JEAI
chains in the Genus database with same CATH topology
2BOSA 3A7LA 1G8ZD 2KEDA 1PFBA 4EQNA 1A2TA 4XQNA 3MXGA 3M4YA 1H9KA 1Q1EA 2O5IC 2QF7A 1WD1A 1V1OA 5KYIA 5M9OA 3QIAA 4EVOA 3IFDA 1I4HA 2NVQB 2L4NA 5A35A 2FFKB 3GTGB 2Z4IA 4V190 4K5WA 1EIHA 4KV6A 1LV9A 2VNUD 2Z8LA 2QCPX 5A2QE 5I2YA 1A6XA 1ZYRC 3BDLA 1TU2B 3C1FA 2QDBA 3R93A 4C2MB 2E2JB 1ZYRD 2X6GA 3TP6A 4FXKC 2XSCA 1G6ZA 3J7AF 2B2TC 3GP7A 1ENCA 5F2DA 1HUMA 5I2XA 1D5MC 1E0BA 1S5DD 3NTKA 5JOBA 5IODA 3ITPA 2L5TA 3J81E 1OXUA 5DAUA 1QB5D 2FMCA 3TP5A 5IGDA 5K36G 2AUJD 1BCPB 3URYA 4TKOB 5EKLA 2EPBA 1HA6A 3A7AB 4QF4A 2XWBB 2DN8A 3SK5A 1H9RA 4NP5A 1SMYC 4PMWA 2WINB 3Q6SA 1VF7A 2C5CA 2XIWA 2PPBC 1SMYD 3PUZA 2VB3X 1XXGA 3OMGA 3Q23A 2F03A 1HPCA 1NAPA 4XYQA 3GTPB 4G7HC 1EEID 1U9RA 5ELEA 3J80E 1HFGA 2YU9B 3OIPA 4FF4A 1RCVD 1PRTF 1NCVA 1CQFA 3DUZA 1F2MA 4C1NK 4Q5VA 2F0IA 2PNRC 3M85A 2XN9C 2E2DC 1TS5A 4F7XA 5JVH3 2V4DA 3I90A 4K5VA 1GUSA 3NWTA 4BBRB 2LMCB 2RDFA 3HOXB 2CW0C 1C8CA 2H4OA 3S1NB 1KDBA 2OEOA 2ZXOA 1TS4A 3MWYW 4HR7B 1YNNC 2CW0D 1M8AA 1HA5A 1LTTD 1IKMA 1HFNA 5FLXL 2NWGA 1UAPA 3BS1A 1Z6HA 4KK7A 5IGCA 5M5YB 5DM63 4R9WA 4ZK9B 1D6EC 5HGTA 1QE6A 2AWNA 1CT1D 1EU4A 4HSVA 3KLSX 2AQ1B 2D62A 2N55A 1SYFA 2L11A 4KJOA 1OXXK 4ZAIA 3M3YB 1CI3M 1TWHB 3G6JB 3GV6A 3MHBA 2F0WA 4RCOA 1WVLA 1PDQA 3BYTB 3O13A 4DNRB 4KD4A 4A3IB 2MHVA 4QCLA 1IYUA 2OT2A 5IT9L 2ICEC 1Q12A 3NQTA 4PNYA 3K58A 1MGSA 2FJ2A 5JAVA 4Q0FA 3W2DA 1PMRA 1PXUA 2HDLA 3R2IA 4IQZA 2K5DA 4DNTB 3F2UA 2XRSD 1SAPA 4FNFA 5IOCA 1EWCA 5I9OA 2PZWA 3J7YW 4H44C 1B3AA 5EPJA 1PRTC 3P1HA 3MAQA 1VMPA 1GHJA 2EYMA 3H94A 3S17B 4CKEA 4DFAA 4TQUS 4BA1I 3OPOA 5FOBB 4FF3A 1EIGA 3KK7A 1PRTD 5D3IB 2M00A 5JEAG 1J9OA 4BY7B 2A5HA 2R92B 1D5XC 1UEAB 4XQJA 1H9SA 3D31A 1QOHA 4RA8A 5CV8A 4CJ0B 1B1ZA 3K6OA 2F0MA 1VF5C 1Y1VB 2F0QA 4LMQD 1JE4A 2AQ3B 1L0XB 2I07B 3PUWA 4DK0A 1TY2A 1CZGA 1JWMD 1VDZA 1ENAA 2EJGC 3KLSA 2B8FA 1JOOA 1E2WA 4RGTA 2B39A 2L12A 1BNZA 4G7OC 2EE1A 1EL0A 4K6DA 1SNQA 2SDFA 1EEFD 1EY4A 1RKNA 2EJMA 3EQLC 2BDNA 3S1RB 1QILA 1GUGA 3Q24A 4MHEA 2RDGA 1RF2D 3SE0A 1LT3D 5ELCA 1B50A 2E75C 2L55A 1GUOA 3NBIA 1WTWA 1LT6D 2G9DA 5DNFA 4BS9A 4KY7A 1RTNA 1OXSC 2F0KA 2ZT9C 3M7NA 3S2DB 1FD7D 2EYHA 4HEDA 1PZKD 5EJWA 3NE5B 4RCNA 2M9VA 1A3VA 1A2UA 1K8OA 5KNDA 1DXMA 4XQQA 3DMUA 5C0XH 1DJRD 4A3GB 4L6TB 1NR4A 2DNCA 5I4DA 5J22A 4G57A 2IX1A 2FINB 1HQMC 3FPPA 3MC0B 4LJZC 3K57A 5JEAJ 2PW5A 5E3FA 4H13C 4KMUC 1Y8PB 4G7ZC 1O78A 1SSOA 3NUCA 2R6GA 2RSOA 2CHBD 1U4MA 4ZQ3A 2EVBA 1B9NA 1Z47A 4IALA 4M8AA 3FMCA 4K14A 3MFGA 1I4QA 5A2QL 4KJNA 2B2WC 2MGSA 1GJXA 4RKLA 1E2VA 4J6HA 3PIO3 1U4RA 2D5DA 1PTOC 3M7GA 2CQAA 2QILA 1OO9B 3A55A 3TSSA 4PMCA 3I4LA 3HOVB 1PTOD 2YYZA 4XIGS 4LAAA 5KNBA 2B2VC 2G9HD 3J81L 3VA5A 3ND9A 4XT1B 1JOQA 3Q22A 1CHPD 2BA0A 1OXVA 5KEEA 3RLFA 2J7ZA 1MBYA 5K36H 2I46A 1KNAA 3DWQA 1EOTA 3AB9A 1JCKB 4FXGC 2A69C 5C5MA 3P7JA 2BCOA 3SHLA 1EFID 2K01A 3DEPA 4KKSA 5KGUA 2F0EA 4KN4C 4OO1I 1ESFA 4QB4A 2DY8A 2A69D 2F0PA 1LABA 3V2TA 1CTMA 4X3SA 4H0LC 4EQOA 4ID6A 1KABA 1MI2A 3QJYA 1GUNA 1AW7A 2F0SA 1SXTA 3J80L 4J1MA 3U9OA 3PV0A 5ELDA 4A3FB 2WV6D 2AWOA 3S1QB 3FRPB 4B08A 3UI2A 1HTPA 3TBIB 2K5QA 1H9SB 2IX3A 1CFMA 1IW7C 5J39A 1E2ZA 1ENFA 2F3VA 1WTOA 3DWAA 1ML0D 3I8ZA 1O7ZA 3DWPA 3PMFA 1IW7D 3R8BA 2RKSA 3MVVA 1DOLA 1DZ1A 1IL8A 3BDOA 2PMZB 2Q8IB 5LL6S 2HUGA 4X3TA 1GUTA 1FGBD 1A15A 2B2YA 1C48A 2F0LA 5FO8B 4OO1G 1HHVA 4FXDA 5EQ0A 1DD2A 3BYYB 1B44D 2R61A 3T51B 4K2KA 2NVTB 2NN6G 2F0JA 1S5ED 1K8MA 1B53A 2EYFA 4J8QA 1KLUD 1TY0A 3BDCA 1Q1BA 3RMHA 1JR0D 3GQBA 5NUCA 1TVXA 1ILQA 3J7AV 3OSOA 5D14A 5COYA 3K5NA 1RHPA 3A8IE 1WTPA 3HKZB 3K5LA 3M4OB 4FF2A 4LK1C 2ZXRA 3K5MA 3CU7A 4KHZA 4K6LA 3VR2A 2E76C 4IN3A 2D9UA 3E0JA 4KI0A 5CORA 3MZ5A 3QOJA 1JQYD 1F2LA 3DXJC 2B2UA 3GO5A 1LTGD 1JWUD 1F9PA 1CQVA 3KBGA 4RGOS 4YIJA 4IUTA 4B9XA 3GTKB 2IPKD 1NR2A 2JA5B 4EGVA 2HCCA 3HG9A 4HAEA 2K04A 5C6AA 3TN2A 3HRZC 2A6HD 5I6WA 5EBDA 2NVYB 1IKLA 3EROA 3I72A 5KIXA 2R3ZA 1I3QB 1VCIA 1HUNA 3NHHA 3GD7A 2EYJA 3EFXD 3P75A 5EKIA 3KLRA 5JEAH 2CVRA 3ONAB 1X32A 3QG1A 2SEBD 3CQZB 3D8GA 2F4IA 1UUPA 2IJ0A 1Z7TA 1GOZA 2KCCA 1CK1A 4FO2A 3D3RA 2K5WA 2EY1A 4R8IA 1SE3A 4WORA 1STAA 2DNEA 4WFN3 4FYDA 1Q90A 1F2ZA 3IFTA 3A8KE 1BCPC 2F0UA 1Y69U 1V1PA 1I4RA 5IGFA 1EY6A 3TMEA 1DCZA 4C3JG 2L0CA 1EY7A 1BCPD 2X69A 2EY2A 2TSSA 3S1MB 1SE4A 3E5SA 3MXUA 3TDQA 3H6MA 3EJIA 2NUCA 3FDTA 1SNDA 3HS0C 4L8JA 2E2IB 1Y8NB 5TSSA 4NDXA 1EYCA 2F0HA 2NB0A 1BQQT 5CGKA 4IUQA 4G4KA 3V96A 4PQXA 4RHSA 3SEBA 2EOTA 3D4DA 1KTKA 3CHBD 1MSGA 5FO9B 2PCFB 1U4LA 2IW3A 3T53B 3OW7A 3HOWB 1DONA 1RODA 3VYUA 3SK4A 1SBBB 5CV9A 3BVMA 4ULLA 4KN7C 5CYUA 1AZQA 1G2TA 4KHVA 4CJ1B 4NKLA 5EPLA 1F2YA 2IL8A 4HMJA 5T1GA 3N52A 1GHKA 1O7LA 2IT1A 4BY1B 3RUZA 1ET9A 3GTJB 4OHJA 3SK6A 4KD3A 5EKKA 4XYOA 1I50B 2HCIA 3LX0A 4C3HG 1SNMA 1D2BA 4H7BA 1W6JA 1Y1WB 2VUMB 1V8QA 3HZXA 4O1NA 1EYAA 2WB1B 3D6CA 1S4ZA 5JPMC 1SFOB 1OXTA 4BWGB 2EJFC 4DAVA 4OIJA 1I6HB 4WJWA 1LLRD 2B2TA 2XRQD 3EA6A 3T16A 2NTSA 1TR5A 1BUVT 5EGTA 3OHXC 2JSOA 5C44B 1AFPA 3OOCA 1C4QA 1CHQD 5KNCA 2NTTA 3A8JE 4RFBA 1RJTA 1RD9D 2FHTA 1S5FD 3X3MA 4QIWB 2DY7A 1VMCA 2JEBI 1S5BD 1PTOF 3D4WA 4X3KA 2SNMA 2KOLA 3DHQA 4IURA 1O7YA 4AYBB 5M3FB 2EDGA 2F0OA 2B8GA 2MPMA 2KUMA 4ZUIA 4OGQC 2OXPA 1B2TA 1PFMA 1BBXC 2A74C 5CBEE 1CA6A 2NYZD 4B9WA 2SNSA 1TWCB 1F77A 3FEWX 4JK1C 3NTHA 4U68A 1D5ZC 2QKIC 3GTQB 2K32A 4C1NI 2R93B 4DK1A 3DEOA 3QOLA 1JICA 3TZDA 3KBXA 1G2SA 1H9MA 3HEJA 1BO0A 2WAQB 1BR9A 1QWYA 5CMDA 1XTCD 2M2LA 2PZUA 2BA1A 1ET6A 4A3EB 1BOSA 3NK9A 3I4MB 3A56A 4F8MA 3IAYA 2RA4A 1ESRA 1STYA 4PV1C 4I65A 1NUCA 4U673 5M5WB 3SR1A 1FYCA 3X3NA 1KAAA 3OWFA 5E4WC 3GTLB 3DM1A 2JYOA 3W3AA 2N88A 4N9TA 4RKBA 1Q3LA 1V1PB 1A3UA 1EU3A 4OO1H 1FNWA 4TSSA 1EQVA 1F9QA 1EY0A 2A68C 4IFDG 4RHRA 2IWHA 4K8JA 3ZYYX 2NN6H 5CV7A 2KQ3A 2MUYA 2A68D 5IGBA 5JJZA 2L9HA 2WACA 2JE6I 1R4PB 3FVQA 3IL8A 1F9SA 1SE2A 5D65A 1SDFA 4GZYC 4UAIA 3HOZB 2Z4HA 3BVGA 1QNKA 4L63B 2H1EA 1WTVA 4CKCA 5EBCA 2PQEA 2F1MA 4M1UB 4BA2I 1V43A 5C3EB 3IKJA 2XVSA 2ENBA 2Y0SB 3T13A 1KDCA 3CRKC 1STHA 4DAYA 3I73A 1LT4D 2F0FA 4DF7A 4A3MB 2F0NA 1TWAB 3K0YA 1J8IA 4A3JB 1B9MA 3GTOB 3VA7A 1F9RA 2O4XA 2F3WA 2KVMA 2E2HB 1LACA 3PO3B 2NN6I 2ICIA 1U4PA 4RH6A 1SYBA 2D2CC 2K05A 1WTRA 4Z9CB 3H09A 3WOFA 3I3CA 2K03A 2F0VA 4IUNA 2SOBA 4ZYSA 3VR4A 1EZ6A 1IHZA 2KEEA 4FP5D 5CV6A 3H0GB 4S3SA 2EYPA 2HQEA 5K5PA 4O42A 3D4RA 2JA6B 2TMPA 1I4PA 1AN8A 3GV3A 4HN7A 1EY9A 1XX8A 5HURA 2XWJB 4C3IG 3MFYA 1R9TB 2IX0A 2NVXB 4DAPA 3LWUA 2EY5A 5G3LD 1PZJD 5C3XA 4FF1A 1DM0B 4IFDJ 2Q8TA 1HTLD 1EY5A 1SJED 1FNVA 3L3OC 1EWHA 2MP1A 1RDPD 3FPUB 3RD4A 3HP3A 3CRLC 3AMUA 4E6IA 1KLGD 3VR6A 4OIKA 3S2HB 5M5XB 1BCPF 1TIID 2B63B 4KTAA 2RQXA 1DOMA 1PLFA 3KUPA 4V0BA 5EPKA 1BXTA 2WKCA 4NW2A 1TS3A 1SJHD 2EYOA 2KHSA 2KJXA 2FMMA 1LTSD 5JPNC 4TRDA 1TT2A 1HQRD 1QCBD 5D3DA 1L0YB 1BDOA 3I4NB 4HMIA 1LTRD 4KKTA 3S9WA 2J4XA 2JXMB 2RSNA 3JAME 2LFNA 5ELBA 2RBMA 1STEA 4ZKBB 2A6HC 5J1ZA 3TP8A 1I4XA 3SXHA 3N6RA 3FKIB 5LL6X 4DU9A 4RGNA 3C3LA 2RDHA 1ONLA 4A93B 4CBVA 1SYCA 3TZUA 2B2WA 1ZEQX 1TWGB 5FO7B 3VYRA 1YNJC 4F88A 5DEHA 3E6ZX 5C0XJ 5BN3A 1JOKA 3H91A 5CC4A 5E4XA 5I6YA 1YNJD 4C56C 1EZ8A 3BVZA 1RTOA 1PFNA 4OL7A 3VR5A 2LS01 1STNA 4C3JB 2X6LA 3WDNA 5M3MB 1KDAA 2O5JC 2B2VA 1NSNS 3SDZA 4ABNA 1LT5D 2KCNA 3OWEB 3PUXA 3RZOB 5C4XB 2K28A 3V05A 3QB3A 1ZXTA 2OF1A 3QO2A 2ID0A 2MJ8A 1X3PA 3OIQA 1ZKOA 4HTHA 1JWSD 1HRJA 1H9JA 4XDXA 4I7ZC 4DXGA 2K6AA 2F0DA 4WRDA 3A54A 2RVLA 1K83B 4XT3B 1WTXA 2ZXPA 3C1EA 4DXFA 5AFWA 2BE5C 2LKVA 1TQOA 1EY8A 1MSHA 3C2PA 3QWNA 2EYLA 1TKWB 1I4GA 2C9OA 4DGZA 1PRTB 2BE5D 1EYDA 1I6VC 4KY6A 3TP7A 1YNND 3VR3A 1JB3A 3KF8A 3S15B 5IGGA 2JA7B 4CJ2C 4F87A 1R4QB 1PYWD 1CA5A 3NXWA 1D1KA 3ERQA 3K5OA 2EZVA 3R2TA 3GTMB 1LTBD 2LY7A 2PYKA 5FK9C 4CKBA 4UDUC 3Q0AA 4XTCS 2EY6A 4C3HB 4HCEA 4A3KB 3P20A 1WCMB 1AP0A 4ZRZA 2K1BA 4IUPA 1JORA 3VYSA 5CBAE 2KA7A 3PUYA 1KNEA 3I91A 1D1IA 2JP1A 3AU7A 5ELFA 2AUKA 4XXEA 2R7ZB 1STBA 2GA4B 4K5XA 2VB2X 1PTOH 3NBHA 2A73B 5E1FA 2NZ1D 4QUCA 4QMGA 3PUVA 4K2LA 3T4AC 4KKUA 2O2LD 4K8IA 3BZDB 1HXYD 1ILPA 4IFDH 1ICWA 5T1IA 1WD0A 5FKAC 1Y8OB 3NTIA 4ZLTF 2J0TD 2KECA 4CGYB 3BG3A 3HGBA 2PW7A 4EQPA 4MIUA 3MXNA 1DOKA 2PZTA 2L1BA 4ZKCB 1JC7A 1G291 4IUVA 1AEXA 1QJOA 2XNAC 5IGEA 3PO2B 5C5LA 1X3QA 4HSPA 4X3UA 3MXPA 1AZPA 5FLXE 3D6WA 1HCZA 3K59A 3L7ZC 4N9PA 5KYLA 1MD2D 3NWSA 1UNSA 5KRUA 2B2YC 1G91A 3SK8A 1SYGA 3MTSA 3HOUB 4RGMA 3MA2B 3G7LA 3LNNA 5CR3A 4IFDI 2NBFA 4DA2A 1LO5D 1S5CD 4RWSC 5CV5A 3NQIA 4HCSA 1PTOB 1TWFB 5BN4A 4IZ8A 3K7AB 2JA8B 1T5XD 2Z1CA 3NP8A 4JBWA 3H3VC 1DYQA 2WP8J 3LWEA 2VXWA 1XWEA 5IT9E 2A6EC 4DN4M 1A3TA 4A3DB 5IIFA 4BBSB 1QG7A 2A6ED 2PO4A 5G3LF 4ILWA 2B2UC 2WKDA 4PMBA 1SYEA 1II3A 3C46A 1QNUA 1GUWA 1SYDA 4MN3A 3ND8A 3R3OA 1T5EA 4NMZA 3PIP3 1SNPA 4R8NA 1M4VA 4ME5A 2E74C 1EQTA 2HDMA 3CKIB 3S14B 2AQ2B 1O80A 3I70A 1TS2A 1LTAD 3SVMA 1IYVA 5I9PA 3HOYB 4P2CB 5C4ZA 3U9SA 4QUFA 1CZWA 1SNOA 3WOEA 5C0XI 1STGA 3NPPA 3JAML 5C3WA 4KY5A 4CHTB 2K33A 1Q8IA 3OMCA 2K7VA 3VYTA 1B4OA 3T56B 1FR3A 1CM9A 5LHY1 1LTID 4ODGA 5DM73 1WTQA 4IUUA 1GXDC 5ISRA 4A3BB 2EXZA 4RAUC 4Y7NB 3S16B 2Q8RE 5C4JB 4C3IB 4FVMA 2F0GA 4ZUJA 1SEBD 1BF4A 3EVQA 2F0TA 5CV4A 3MEHA 1SNCA 2BDOA 1PZID 5JVG3 1XYIA 2WIIB 5BN5A 3NSWA 2QEJC 3RZDB 1W6KA 1FNUA 5C0XG 5C4HA 3L9AX 2JEAI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G8Z D;  4C56 C;  3BVZ A;  1CT1 D;  1KLG D;  1BCP C;  4O1N A;  3MC0 B;  1V1P A;  1EU4 A;  1I4R A;  1MD2 D;  2AQ2 B;  1UNS A;  4K6L A;  3KLS X;  2AQ1 B;  2AQ3 B;  1L0X B;  1BCP F;  4BWG B;  1XTC D;  1LT4 D;  1TY2 A;  1JWM D;  1AW7 A;  1TS2 A;  1ET6 A;  1LTA D;  1SXT A;  4RGM A;  1LT5 D;  3OWE B;  1BCP D;  1LLR D;  5ELF A;  2TSS A;  2XRQ D;  1V1O A;  1JQY D;  3V05 A;  5ELD A;  2WV6 D;  3EA6 A;  1SE4 A;  4RGT A;  1BXT A;  2NTS A;  1TS3 A;  1XXG A;  4RCO A;  1LTG D;  1JWU D;  2CHB D;  1CQV A;  1SJH D;  4RGO S;  1LO5 D;  1EEF D;  1S5C D;  3BYT B;  3O13 A;  1LTS D;  1JWS D;  1I4H A;  1EEI D;  4DXG A;  1HQR D;  1PTO H;  2IPK D;  3MFG A;  5ELE A;  1I4Q A;  5D3D A;  1CHQ D;  1QIL A;  1PTO B;  5TSS A;  1L0Y B;  4DXF A;  2ICI A;  2NTT A;  1RF2 D;  2RDG A;  1LT3 D;  5ELC A;  1ENF A;  1T5X D;  2O2L D;  3DWA A;  1LTR D;  3BZD B;  1PRT F;  1RCV D;  4RFB A;  1HXY D;  4RH6 A;  1RD9 D;  3DWP A;  2J4X A;  4Z9C B;  1DYQ A;  3R8B A;  1S5F D;  2Z8L A;  1V1P B;  3R2I A;  1I4G A;  1EU3 A;  1PTO C;  2XN9 C;  4RHS A;  1FNW A;  3SEB A;  2QIL A;  5ELB A;  1LTI D;  4TSS A;  4ZYS A;  1PRT B;  1STE A;  2XRS D;  1TS5 A;  1FGB D;  5FKA C;  1LT6 D;  1KTK A;  1PTO F;  1S5B D;  3CHB D;  3TSS A;  1EWC A;  4RHR A;  1I4X A;  1PTO D;  1PRT C;  3EFX D;  3BYY B;  1FD7 D;  1B44 D;  2G9H D;  1PZK D;  4RGN A;  2R61 A;  1I4P A;  1AN8 A;  1SBB B;  2RDH A;  1CHP D;  3BVM A;  3GP7 A;  1TS4 A;  1S5E D;  1PYW D;  1D5M C;  1HA5 A;  1SEB D;  3W2D A;  1LTT D;  1PRT D;  1S5D D;  5D3I B;  1SE2 A;  2SEB D;  1PZJ D;  1KLU D;  1DJR D;  1PZI D;  1TY0 A;  3R2T A;  2XNA C;  1D5X C;  3DWQ A;  4L6T B;  1LTB D;  5FK9 C;  1JCK B;  3BVG A;  1UUP A;  2IJ0 A;  2QEJ C;  4L63 B;  1GOZ A;  1HTL D;  1F77 A;  1JR0 D;  1SJE D;  4UDU C;  1FNU A;  1FNV A;  1ET9 A;  5I4D A;  4OHJ A;  1CK1 A;  1D5Z C;  1BCP B;  1EFI D;  3URY A;  1B1Z A;  1D6E C;  1SE3 A;  1RDP D;  1ESF A;  1M4V A; 
#chains in the Genus database with same CATH topology
 4JV5 L;  2B3G A;  2BOS A;  3A7L A;  1G8Z D;  2KED A;  2C35 B;  5IYC G;  3PIP A;  5IYB H;  1PFB A;  4EQN A;  1A2T A;  4XQN A;  3UDG A;  4DV4 Q;  1IBM Q;  4P72 A;  2ZJQ A;  3MXG A;  3M4Y A;  1CSQ A;  1H9K A;  4OEL B;  4MTK A;  4X62 L;  1C0A A;  1Q1E A;  3MXN B;  2O5I C;  2QF7 A;  2A1A A;  1WD1 A;  1V1O A;  5KYI A;  5M9O A;  4LF6 L;  3QIA A;  3GTP H;  4A3F G;  4QL5 A;  4EVO A;  1EOV A;  3IFD A;  2XGT A;  2YU9 H;  1I4H A;  2Q2U A;  2EXD A;  2NVQ B;  2L4N A;  5A35 A;  2FFK B;  3GTG B;  4DV5 Q;  3H0G G;  2UXD Q;  4GNX A;  3F1Z A;  2Z4I A;  4V19 0;  4K5W A;  1EIH A;  4POF A;  4KV6 A;  2JN4 A;  1LV9 A;  2VNU D;  4DV7 L;  2Q2I A;  2Z8L A;  1K0S A;  3U58 A;  3RR5 A;  2QCP X;  4BBR H;  5A2Q E;  2AMC B;  5I2Y A;  1A6X A;  4DV6 L;  1ZYR C;  3HOX H;  4LF9 Q;  3S1N H;  3BDL A;  1TU2 B;  3C1F A;  4UHV A;  1EQQ A;  4JI2 L;  2QDB A;  2DGY A;  3R93 A;  4C2M B;  2QEX A;  2E2J B;  3E3X A;  4JG2 A;  1NY4 A;  1ZYR D;  2X6G A;  3TP6 A;  4FXK C;  1J5E Q;  2XSC A;  1G6Z A;  3J7A F;  2B2T C;  3GP7 A;  1ENC A;  5F2D A;  1HUM A;  2HT1 A;  5I2X A;  1D5M C;  1E0B A;  1AE3 A;  1S5D D;  3NTK A;  5JOB A;  1E3P A;  1LM0 A;  5FLX c;  1A0I A;  5M5Y H;  5IOD A;  1X6O A;  4ZCK A;  3ITP A;  2L5T A;  3J81 E;  1OXU A;  5DAU A;  1QB5 D;  2FMC A;  3TP5 A;  5IGD A;  5K36 G;  2AUJ D;  1BCP B;  3URY A;  4TKO B;  4YY3 L;  1JE5 A;  5EKL A;  2EPB A;  1HA6 A;  3A7A B;  4QF4 A;  2XWB B;  2DN8 A;  3SK5 A;  1H9R A;  3HKZ G;  4NP5 A;  1SMY C;  3M3Y H;  4PMW A;  1SLJ A;  2WIN B;  4DV4 L;  1IBM L;  1N32 Q;  1TWH H;  3Q6S A;  1VF7 A;  2C5C A;  2CWA A;  1NJI C;  2XIW A;  3I4N G;  4JYA Q;  3UE1 A;  2PPB C;  1SMY D;  3PUZ A;  2VB3 X;  1XXG A;  1VQF A;  3OMG A;  2NZO A;  3Q23 A;  4A3I H;  2F03 A;  1XNR Q;  1HPC A;  1NAP A;  4XYQ A;  3RLN A;  3GTP B;  4G7H C;  1EEI D;  1BBU A;  1U9R A;  5ELE A;  3J80 E;  1HFG A;  2YU9 B;  3OIP A;  4DUZ Q;  4FF4 A;  2JA5 G;  1SRO A;  3EIV A;  4DV5 L;  2UXD L;  1L1O A;  1PRT F;  1RCV D;  1NCV A;  3G6E A;  1CQF A;  3DUZ A;  1F2M A;  1WFQ A;  4C1N K;  4Q5V A;  2YV5 A;  2F0I A;  2PNR C;  3M85 A;  2XN9 C;  2E2D C;  3K7U C;  3E9H A;  1VQO A;  1TS5 A;  2UUA Q;  4F7X A;  5JVH 3;  2V4D A;  3I90 A;  4K5V A;  1GUS A;  3NWT A;  4BBR B;  2LMC B;  2RDF A;  3HOX B;  2CW0 C;  1C8C A;  2H4O A;  3S1N B;  4LF9 L;  3S17 H;  3T1Y Q;  4DV1 Q;  1KDB A;  2OEO A;  3DLL A;  3M9B A;  2ZXO A;  1TS4 A;  3MWY W;  4HR7 B;  1YNN C;  2CW0 D;  4DNI A;  1PH2 A;  1M8A A;  1HA5 A;  1J5E L;  4BY7 H;  1LTT D;  2R92 H;  1IKM A;  1HFN A;  5FLX L;  4GN4 B;  2NWG A;  4P74 A;  1JJG A;  1UAP A;  3BS1 A;  1Z6H A;  4KK7 A;  3A0J A;  2HD3 A;  5IGC A;  5M5Y B;  1KL9 A;  4NB3 A;  5M3M G;  4UP9 A;  5DM6 3;  4R9W A;  4ZK9 B;  1D6E C;  3CMA A;  5HGT A;  4R4I A;  1KRT A;  1Y1V H;  1QE6 A;  3OTO Q;  3H3V H;  2AWN A;  4GKJ L;  1YIT A;  2GN5 A;  1CT1 D;  1EU4 A;  4HSV A;  3KLS X;  5ELN A;  2AQ1 B;  1VQH A;  2D62 A;  2N55 A;  1SYF A;  4APV A;  2L11 A;  4KJO A;  1XNQ Q;  1OXX K;  4YCW A;  4ZAI A;  3M3Y B;  2Q2H A;  1CI3 M;  1K73 C;  1N36 Q;  3K80 C;  2H5X A;  1TWH B;  3G6J B;  1VQ6 A;  1N32 L;  3GV6 A;  4JOI A;  3MHB A;  1TXY A;  2F0W A;  5IP9 H;  4RCO A;  4DR3 Q;  1WVL A;  2HHH Q;  1PDQ A;  4JYA L;  1PVO A;  1Q46 A;  3BYT B;  3O13 A;  4DNR B;  4KD4 A;  4A3I B;  2MHV A;  3S1R H;  1XNR L;  4QCL A;  1IYU A;  2OT2 A;  5IT9 L;  2ICE C;  3IRB A;  1Q12 A;  3NQT A;  4PNY A;  3K58 A;  4LF8 Q;  4GKK Q;  1MGS A;  1M1K C;  2FJ2 A;  5JAV A;  2YTY A;  4Q0F A;  1PMR A;  1PXU A;  3W2D A;  4DUZ L;  4PZ7 A;  2HDL A;  3R2I A;  4IQZ A;  2K5D A;  1E1O A;  1LUZ A;  4DNT B;  4WJ3 M;  3F2U A;  2UU9 Q;  4AIM A;  2XRS D;  1I5F A;  4OX9 Q;  1SAP A;  4FNF A;  5IOC A;  1EWC A;  5I9O A;  2UUA L;  3A74 A;  2PZW A;  3S2D H;  3J7Y W;  4H44 C;  1B3A A;  2KBN A;  5EPJ A;  1PRT C;  2Z6K A;  3P1H A;  3MAQ A;  1VMP A;  1GHJ A;  2EYM A;  1HR0 Q;  1KHI A;  3H94 A;  1YJ9 A;  3HOW G;  3S17 B;  4CKE A;  4DFA A;  4TQU S;  1VQG A;  4BA1 I;  3T1Y L;  3M4P A;  3OPO A;  5FOB B;  3H3V I;  4FF3 A;  1EIG A;  4DV0 Q;  3KK7 A;  4DV1 L;  1PRT D;  5D3I B;  2M00 A;  4GNX B;  5JEA G;  4A3G H;  1WOC A;  1J9O A;  4BY7 B;  2A5H A;  2R92 B;  1U0L A;  1D5X C;  2UUB Q;  1UEA B;  2KEN A;  4XQJ A;  1H9S A;  2OTJ A;  3CCQ A;  3D31 A;  1JJ2 A;  1QOH A;  3I7F A;  4RA8 A;  4JBK A;  2F3I A;  5CV8 A;  4BY1 G;  4CJ0 B;  1B1Z A;  3A5U A;  4JI8 Q;  3K6O A;  2F0M A;  1VF5 C;  3CCV A;  3F8T A;  1VS0 A;  1Y1V B;  4JI1 Q;  2F0Q A;  4CDC C;  4LMQ D;  1JE4 A;  2MFI A;  2VUM G;  1Y1W G;  3OTO L;  2AQ3 B;  1L0X B;  2WB1 G;  1A63 A;  2I07 B;  3PUW A;  4DK0 A;  1TY2 A;  1CZG A;  1JWM D;  1VDZ A;  1ENA A;  3KLS A;  2EJG C;  2B8F A;  3EN2 A;  1JOO A;  1E2W A;  1LYL A;  1XNQ L;  4RGT A;  2B39 A;  2L12 A;  1N36 L;  1BNZ A;  2EE1 A;  4G7O C;  1EL0 A;  4NXN Q;  2YTV A;  4K6D A;  4LWC A;  1SNQ A;  2SDF A;  3VDY A;  4YCU A;  1EEF D;  2B29 A;  4GOP C;  4HJ9 A;  1EY4 A;  4DR3 L;  1RKN A;  2EJM A;  2LXK A;  3Q8D A;  2HHH L;  3EQL C;  2YTX A;  5C44 G;  2BDN A;  5E7N A;  5FJ8 H;  3RLO A;  1QIL A;  3S1R B;  1GUG A;  3Q24 A;  5JJL A;  4MHE A;  2RDG A;  1RF2 D;  3SE0 A;  4YWK A;  1LT3 D;  5ELC A;  1B50 A;  4LF8 L;  4GKK L;  3CPF A;  2E75 C;  2L55 A;  1GUO A;  3NBI A;  4JC0 A;  1WTW A;  2RHQ B;  1X3G A;  1LT6 D;  1UE1 A;  3CCJ A;  4KHP Q;  1KQS A;  2G9D A;  3HOV H;  5DNF A;  4BS9 A;  4KY7 A;  1RTN A;  1OXS C;  4OX9 L;  2F0K A;  2ZT9 C;  3M7N A;  3S2D B;  1FD7 D;  3CCM A;  2EYH A;  4HED A;  1VQ9 A;  1PZK D;  5EJW A;  5H1S E;  4OEM B;  4AYB G;  5M3F G;  3J81 c;  3NE5 B;  1PH9 A;  4RCN A;  2M9V A;  1A3V A;  1HR0 L;  2ZTD A;  1A2U A;  4JI5 Q;  1K8O A;  2CCZ A;  5KND A;  1DXM A;  4XQQ A;  3DMU A;  5C0X H;  1DJR D;  4DV0 L;  4A3M H;  4A3G B;  4L6T B;  4DR6 Q;  1L1O B;  2I0Q A;  1NR4 A;  2DNC A;  4LFC Q;  3I56 A;  5I4D A;  3J7A 5;  5J22 A;  2UUB L;  1XPO A;  5IYC H;  5J3B A;  1VQB A;  1SN8 A;  4G57 A;  1FL0 A;  1UEB A;  4HJ5 A;  2IX1 A;  2R93 G;  2FIN B;  1HQM C;  3FPP A;  3MC0 B;  4LJZ C;  4JI8 L;  3K57 A;  5JEA J;  4JI1 L;  2PW5 A;  5E3F A;  1X3F A;  4H13 C;  1IXR A;  4KMU C;  2WAQ G;  4A3F H;  1Q7Y C;  3S1Q H;  1Y8P B;  2CQO A;  4G7Z C;  2OWO A;  1O78 A;  1SSO A;  3NUC A;  4A3E G;  2R6G A;  2RSO A;  3L2P A;  1PH1 A;  1S3O A;  2CHB D;  1HH2 P;  3I4M G;  1U4M A;  1B8A A;  4ZQ3 A;  2EVB A;  1B9N A;  1Z47 A;  4IAL A;  4M8A A;  4NXN L;  3FMC A;  3F2B A;  1G51 A;  4K14 A;  3MFG A;  1V1Q A;  1I4Q A;  4PG3 A;  5A2Q L;  4KJN A;  2B2W C;  2I5L X;  3J81 j;  3OW2 A;  2MGS A;  1VQ5 A;  4YWM A;  3BZC A;  1GJX A;  1NTG A;  4RKL A;  1PH5 A;  1E2V A;  5IY0 A;  4J6H A;  2RCN A;  3PIO 3;  1U4R A;  2D5D A;  1PTO C;  3M7G A;  2CQA A;  3PF5 A;  2QIL A;  1VQP A;  2N49 A;  1OO9 B;  2D0O A;  2FXQ A;  3PQI A;  2ASB A;  3A55 A;  2JA9 A;  3TSS A;  4PMC A;  3I4L A;  4LF7 Q;  3DM3 A;  4L5S A;  3HOV B;  4KHP L;  1PTO D;  2YYZ A;  4XIG S;  4LAA A;  5KNB A;  2NVT H;  2B2V C;  2G9H D;  4IJH A;  3J81 L;  3VA5 A;  3ND9 A;  4XT1 B;  1JOQ A;  3Q22 A;  1CHP D;  2BA0 A;  1OXV A;  5KEE A;  3RLF A;  2J7Z A;  2K4K A;  3RN5 A;  1MBY A;  5K36 H;  4JI5 L;  2I46 A;  1KNA A;  2ZTC A;  1EOT A;  3DWQ A;  2ZM6 Q;  3AB9 A;  3E0E A;  4X6A H;  1JCK B;  4FXG C;  2A69 C;  5C5M A;  3P7J A;  2BCO A;  3SHL A;  3HOZ G;  4JI6 Q;  4DR6 L;  1EFI D;  2K01 A;  1VQJ A;  3DEP A;  4KKS A;  5KGU A;  4DR1 Q;  2F0E A;  4KN4 C;  4OO1 I;  4LFC L;  1ESF A;  4QB4 A;  1ICF B;  1XMO Q;  3HOY G;  3M4O H;  2DY8 A;  2A69 D;  2F0P A;  2N78 A;  1LAB A;  4JI3 Q;  3V2T A;  1CTM A;  5IWA Q;  4X3S A;  4H0L C;  3AQQ A;  3CCS A;  5C3E G;  1QVG A;  2Y0S G;  1N34 Q;  4EQO A;  4ID6 A;  2K5V A;  1KAB A;  1MI2 A;  3QJY A;  1GUN A;  1AW7 A;  5IYD G;  2F0S A;  1SXT A;  3J80 L;  4J1M A;  3U9O A;  3PV0 A;  5ELD A;  4A3F B;  2WV6 D;  2AWO A;  1HNX Q;  1CUK A;  3FRP B;  3S1Q B;  4B08 A;  3UI2 A;  3GTK H;  4TVA B;  1HTP A;  2RF4 A;  3TBI B;  2K5Q A;  4JBM A;  4A3J G;  1H9S B;  2IX3 A;  1CFM A;  2JA5 H;  1IW7 C;  1PH3 A;  5IP7 G;  4PZ6 A;  5J39 A;  3PO3 G;  1E2Z A;  1ENF A;  2F3V A;  1WTO A;  3DWA A;  1ML0 D;  2NVY H;  3I8Z A;  1O7Z A;  3DWP A;  3PMF A;  1IW7 D;  3R8B A;  2RKS A;  1NMG A;  4X64 Q;  3MVV A;  1DOL A;  3CCR A;  1DZ1 A;  1IL8 A;  3BDO A;  2PMZ B;  2Q8I B;  1I3Q H;  5LL6 S;  2HUG A;  4X3T A;  1GUT A;  1FGB D;  1A15 A;  2B2Y A;  2VZA A;  4CDD C;  1C7Y A;  1C48 A;  3PIO A;  2F0L A;  3T1H Q;  5GAD C;  5FO8 B;  4OO1 G;  1HHV A;  4YHH Q;  3EBE A;  1E1T A;  4FXD A;  5EQ0 A;  3FHW A;  1DD2 A;  3BYY B;  1B44 D;  4LF7 L;  2R61 A;  3NEM A;  4GN3 B;  4K2K A;  3T51 B;  1YIJ A;  2JA6 G;  2NVT B;  2NN6 G;  2F0J A;  3TS2 A;  2N8N A;  1S5E D;  3CQZ H;  4MZ9 A;  1K8M A;  1B53 A;  2R7F A;  5M3M H;  2EYF A;  4J8Q A;  1KLU D;  1TY0 A;  3BDC A;  4P75 A;  1Q1B A;  3RMH A;  4POG A;  1JR0 D;  3PSI A;  1YBY A;  3GQB A;  5NUC A;  1TVX A;  1ILQ A;  2Z9H A;  2ZM6 L;  3J7A V;  3OSO A;  3UDF A;  5D14 A;  1PH6 A;  5COY A;  4JI6 L;  3K5N A;  4DR1 L;  1RHP A;  3A8I E;  1WTP A;  1QUQ A;  1W3S A;  3HKZ B;  3K5L A;  1XMO L;  3CP0 A;  3M4O B;  4FF2 A;  2HIV A;  4LK1 C;  2ZXR A;  3K5M A;  3CU7 A;  4KHZ A;  4K6L A;  4OON A;  4JI3 L;  3VR2 A;  2KHI A;  2E76 C;  5IWA L;  4IN3 A;  2D9U A;  3S1M H;  3E0J A;  4KI0 A;  1YHB A;  2K14 A;  3MZ5 A;  5COR A;  2B63 G;  1N34 L;  3QOJ A;  1JQY D;  1F2L A;  3DXJ C;  2B2U A;  3GO5 A;  1LTG D;  1JWU D;  1F9P A;  1CQV A;  3KBG A;  4RGO S;  4YIJ A;  4IUT A;  4UP7 A;  4B9X A;  4N8F A;  2E2I H;  3D0F A;  1HNX L;  3GTK B;  4B3R Q;  2IPK D;  1NR2 A;  2JA5 B;  2HCC A;  3HG9 A;  4EGV A;  4HAE A;  1PH8 A;  2IY5 B;  2K04 A;  2D0P A;  5C6A A;  3TN2 A;  3HRZ C;  2A6H D;  5I6W A;  1I94 Q;  5EBD A;  2NVY B;  1MJE A;  3BJU A;  1IKL A;  3ERO A;  4LF4 Q;  3I72 A;  2P5Z X;  2AKW B;  2R3Z A;  5KIX A;  4X64 L;  1X9N A;  1N8R C;  4NPS A;  1I3Q B;  1VCI A;  3HOW H;  1EFW A;  1HUN A;  1K0R A;  3NHH A;  3GD7 A;  2EYJ A;  3EFX D;  4H02 A;  3P75 A;  3F2C A;  3T1H L;  4B3S Q;  5EKI A;  3FKI G;  3KLR A;  2UXC Q;  5JEA H;  4YHH L;  2DJG C;  2CVR A;  3ONA B;  2VQE Q;  3KDF A;  3PCO B;  5BR8 Q;  4HID A;  4OWW B;  1B7Y B;  1W2B A;  1X32 A;  3QG1 A;  2SEB D;  3CQZ B;  4DR4 Q;  4A93 G;  1UE5 A;  2JK8 A;  4BY1 H;  3GTJ H;  3D8G A;  2F4I A;  1UUP A;  2IJ0 A;  1Z7T A;  1GOZ A;  1I50 H;  2KCC A;  1CK1 A;  4FO2 A;  3D3R A;  2K5W A;  2EY1 A;  4R8I A;  4GLX A;  1QVC A;  1SE3 A;  4WOR A;  2VUM H;  1CKM A;  1Y1W H;  1STA A;  2DNE A;  4WFN 3;  4GLV B;  1JJC B;  4FYD A;  1Q90 A;  1F2Z A;  3CF5 A;  3IFT A;  3A8K E;  3CC4 A;  1BCP C;  2F0U A;  1Y69 U;  1SFO H;  1IBL Q;  1V1P A;  1I4R A;  3MEF A;  3E9I A;  5IGF A;  1I6H H;  1EY6 A;  3TME A;  4A4I A;  1DCZ A;  3TEH B;  4C3J G;  4HIK A;  3WWV A;  2L0C A;  1EY7 A;  1BCP D;  2X69 A;  2EY2 A;  2TSS A;  3S1M B;  4EQ5 A;  1SE4 A;  5C4X G;  3E5S A;  4R1J A;  5C44 H;  3MXU A;  4DAY B;  3TDQ A;  3H6M A;  3EJI A;  3FDT A;  1WI5 A;  2NUC A;  1SND A;  3HS0 C;  5HGQ A;  1YJN A;  4L8J A;  3PF4 A;  2E2I B;  2Q2T A;  1Y8N B;  4B3R L;  5TSS A;  4NDX A;  2VL6 A;  1EYC A;  2F0H A;  3CCL A;  2NB0 A;  1BQQ T;  2A19 A;  5CGK A;  4IUQ A;  4G4K A;  1P8L A;  3V96 A;  1X54 A;  2K52 A;  4PQX A;  4RHS A;  3SEB A;  2EOT A;  3D4D A;  4OWX B;  3PGZ A;  1I94 L;  3I2Z A;  1KTK A;  5LMN W;  3CHB D;  1U5K A;  4LF4 L;  1MSG A;  4JBJ A;  1XJV A;  1N9W A;  5FO9 B;  5M3F H;  2PCF B;  1U4L A;  2IW3 A;  2N3S A;  2QDL A;  1Q82 C;  3T53 B;  2F52 A;  3OW7 A;  3HOW B;  1DON A;  1ROD A;  3VYU A;  3SK4 A;  1CKO A;  1SBB B;  4DR5 Q;  5CV9 A;  3AFP A;  3BVM A;  2JA7 G;  4ULL A;  2UXC L;  1XMQ Q;  4HJ7 A;  3JC6 6;  4KN7 C;  5CYU A;  2VQE L;  1AZQ A;  1G2T A;  1IYJ B;  4KHV A;  5BR8 L;  4CJ1 B;  4NKL A;  5EPL A;  1X55 A;  1F2Y A;  1TWC H;  2IL8 A;  4HMJ A;  3ZJY C;  5T1G A;  3N52 A;  4X65 Q;  1A8V A;  1O7L A;  2IT1 A;  4LUV A;  1B70 B;  1GHK A;  4BY1 B;  4DR4 L;  3RUZ A;  3GTQ H;  1ET9 A;  3GTJ B;  4OHJ A;  3SK6 A;  4KD3 A;  5EKK A;  2UUC Q;  4XYO A;  2R93 H;  1I50 B;  2HCI A;  3LX0 A;  1NNX A;  4C3H G;  3STB C;  4KLK A;  1SNM A;  1D2B A;  4H7B A;  4A3K G;  1W6J A;  1Y1W B;  2VUM B;  1V8Q A;  3HZX A;  1YHA A;  4IO9 A;  4O1N A;  2Z6B A;  1WCM G;  5GAH C;  1EYA A;  2WB1 B;  3D6C A;  1S4Z A;  4QQB X;  1SE8 A;  5JPM C;  1SFO B;  3AEV A;  1OXT A;  4BWG B;  4A3E H;  2EJF C;  1IBL L;  3STB D;  2WFW A;  4DAV A;  4OIJ A;  1I6H B;  4WJW A;  2Y0S E;  3I4M H;  1LLR D;  2B2T A;  2XRQ D;  1T9H A;  3EA6 A;  3T16 A;  2NTS A;  4IPC A;  1VQK A;  5AJ3 Q;  1TR5 A;  1K9M C;  1BUV T;  4JI7 Q;  5EGT A;  2R7Z G;  3OHX C;  5M5W H;  2JSO A;  5C44 B;  1AFP A;  3OOC A;  1C4Q A;  1CHQ D;  3GTL H;  1KXL A;  1PH4 A;  5KNC A;  2NTT A;  3A8J E;  4RFB A;  1RJT A;  1QUQ B;  1RD9 D;  4O2D A;  1DGS A;  2E8G A;  2FHT A;  1S5F D;  3X3M A;  4QIW B;  2DY7 A;  1VMC A;  4JPB W;  3ICE A;  1K3R A;  1AH9 A;  2JEB I;  4DK6 C;  1S5B D;  1PTO F;  1VQ4 A;  2CFM A;  3D4W A;  4X3K A;  2SNM A;  2KOL A;  3DHQ A;  4IUR A;  1WJJ A;  1O7Y A;  4AYB B;  5M3F B;  2EDG A;  2F0O A;  2B8G A;  2MPM A;  1XPU A;  1E7Z A;  2KUM A;  4ZUI A;  4OGQ C;  2OXP A;  1B2T A;  1PFM A;  2VY3 A;  4DR5 L;  1BBX C;  2CH4 A;  2A74 C;  5CBE E;  1CA6 A;  3ULP A;  3HOZ H;  4UY8 C;  4PZ8 A;  4HIO A;  2NYZ D;  1XMQ L;  4AQY Q;  2UU9 L;  4B9W A;  2SNS A;  4UPA A;  5FLM G;  4DUY Q;  1TWC B;  2PMZ E;  3HOY H;  1F77 A;  3PO2 G;  3FEW X;  4JK1 C;  4GNX C;  1D7Q A;  4J15 A;  3NTH A;  4U68 A;  1D5Z C;  2QKI C;  4JI0 Q;  4X65 L;  2EIF A;  4HJ8 A;  4LFB Q;  3GTQ B;  2K32 A;  4C1N I;  5C3E H;  2R93 B;  2UUC L;  2ZTE A;  1ASY A;  4DK1 A;  3DEO A;  3QOL A;  1JIC A;  3OYY A;  5IYD H;  3TZD A;  3KBX A;  1G2S A;  1H9M A;  2HIX A;  3HEJ A;  1BO0 A;  3KYH C;  2WAQ B;  1BR9 A;  1KRS A;  1QWY A;  3HKS A;  5CMD A;  1TWA H;  1XTC D;  2M2L A;  3KDF B;  2PZU A;  2BA1 A;  1ET6 A;  4A3E B;  1FGU A;  4A3J H;  4LUZ A;  1BOS A;  4I7A A;  3GTO H;  3CC2 A;  3HOU G;  3NK9 A;  3I4M B;  3L0O A;  3K81 C;  3A56 A;  5IP7 H;  1HZC A;  4F8M A;  3IAY A;  2RA4 A;  1ESR A;  2E2H H;  1STY A;  3KJP A;  4PV1 C;  3PO3 H;  4I65 A;  1NUC A;  4U67 3;  5AJ3 L;  2PNH A;  1K28 A;  5M5W B;  4JI7 L;  3SR1 A;  4JI4 Q;  1VQE A;  4FDB A;  3S24 A;  1FYC A;  3X3N A;  4P73 A;  2E5L Q;  3HKZ E;  1KAA A;  3OWF A;  5GAG C;  1G6P A;  5E4W C;  3GTL B;  1MIU A;  3DM1 A;  2JYO A;  3W3A A;  2JA8 G;  2N88 A;  4N9T A;  4RKB A;  1Q3L A;  1CSP A;  1V1P B;  1A3U A;  1EU3 A;  4HIM A;  4OO1 H;  1FNW A;  4TSS A;  3H0G H;  1EQV A;  2K50 A;  3I55 A;  1F9Q A;  4K0K Q;  1EY0 A;  1NE3 A;  2DJF C;  1L0W A;  2A68 C;  1UE7 A;  4GN5 A;  4IFD G;  4RHR A;  1HZ9 A;  2IWH A;  4K8J A;  3ZYY X;  5IE8 A;  2JA6 H;  1Q8K A;  2NN6 H;  5CV7 A;  4DAM A;  2KQ3 A;  2MUY A;  3M4Q A;  4A3D G;  4LUO A;  2A68 D;  4A3L G;  5IGB A;  5JJZ A;  1R9T H;  2NVX H;  4BBS G;  2L9H A;  1HJP A;  2WAC A;  2JE6 I;  3CPW A;  1R4P B;  3FVQ A;  3IL8 A;  1F9S A;  1SE2 A;  5D65 A;  2XTI A;  1SDF A;  1IZ6 A;  2PQA B;  4GZY C;  4UAI A;  1HNZ Q;  3TQY A;  3HOZ B;  2Z4H A;  3BVG A;  1QNK A;  4L63 B;  2H1E A;  3CCE A;  4AQY L;  1PHJ A;  1LTL A;  1WTV A;  4CKC A;  4DUY L;  3G71 A;  5EBC A;  1KAW A;  2PQE A;  4A3C G;  4CDF C;  2F1M A;  4M1U B;  3KOJ A;  4BA2 I;  1L1O C;  1X3E A;  3JAM i;  1V43 A;  4LFB L;  5C3E B;  3IKJ A;  3S2H H;  2XVS A;  5M5X H;  2ENB A;  2Y0S B;  3T13 A;  1KDC A;  2B63 H;  3CRK C;  1STH A;  4DAY A;  3I73 A;  3CME A;  1LT4 D;  2F0F A;  4DF7 A;  1UE6 A;  3ER0 A;  1BVS A;  4A3M B;  2F0N A;  1TWA B;  3K0Y A;  1UWV A;  1VQI A;  1J8I A;  1FJG Q;  4A3J B;  2R7D A;  1B9M A;  4DV2 Q;  3GTO B;  5GRO A;  1CKN A;  4JI2 Q;  3VA7 A;  1F9R A;  1PA6 A;  1QZH A;  4DV3 Q;  2O4X A;  2F3W A;  2QGQ A;  2KVM A;  2E2H B;  2ZJP A;  1LAC A;  4R4C A;  2E2J H;  3I4N H;  3PO3 B;  2NN6 I;  2ICI A;  2GVB A;  3W1B A;  3AFQ A;  1GD7 A;  1U4P A;  4JI4 L;  4RH6 A;  1SYB A;  2D2C C;  2K05 A;  2MO1 A;  1WTR A;  4Z9C B;  3H09 A;  3WOF A;  2E5L L;  2MO0 A;  3I3C A;  1JT8 A;  2K03 A;  2NZH A;  2F0V A;  4IUN A;  1E24 A;  2SOB A;  4ZYS A;  3VR4 A;  1EZ6 A;  1IHZ A;  1VQ7 A;  5JJK A;  1HZA A;  2KEE A;  4FP5 D;  5CV6 A;  3FKI H;  4CDE C;  3H0G B;  4S3S A;  2EYP A;  4K0K L;  2HQE A;  1EIF A;  4A3B G;  4L5Q A;  5K5P A;  4IPD A;  3CW2 C;  4O42 A;  3D4R A;  1Q86 C;  2JA6 B;  2TMP A;  1I4P A;  1AN8 A;  3GV3 A;  3W5O A;  4A93 H;  4HN7 A;  1EY9 A;  1XX8 A;  5HUR A;  4GOP A;  2XWJ B;  4JOI C;  3MFY A;  4C3I G;  1R9T B;  2IX0 A;  2NVX B;  4DAP A;  1K8A C;  3KFU A;  1PH7 A;  1TWG H;  2QA4 A;  3QR8 A;  2JJQ A;  3LWU A;  2KCT A;  2EY5 A;  2OQK A;  5G3L D;  1PZJ D;  4N8X 1;  5C3X A;  4FF1 A;  1DM0 B;  4YWL A;  4IFD J;  2Q8T A;  1YZ6 A;  1HTL D;  1EY5 A;  1SJE D;  1MHW C;  1ASZ A;  1FNV A;  1HNZ L;  3L3O C;  3ULJ A;  1EWH A;  2MP1 A;  1RDP D;  3FPU B;  1EIY B;  3RD4 A;  3HP3 A;  3CRL C;  3AMU A;  4E6I A;  4X66 Q;  1KLG D;  3CC7 A;  3VR6 A;  4C3J H;  2VW9 A;  4OIK A;  2OQ0 A;  3S2H B;  2BH2 A;  5M5X B;  1BCP F;  1YHQ A;  3U4V A;  1TII D;  2B63 B;  4IPG A;  3RZO H;  5C4X H;  4JCV E;  4KTA A;  4QJF A;  2RQX A;  1DOM A;  1PLF A;  2K5N A;  3KUP A;  4V0B A;  2Z6K C;  1XPR A;  1GM5 A;  1VQD A;  1KD1 C;  5EPK A;  1BXT A;  2WKC A;  4NW2 A;  1TS3 A;  1YNX A;  3CD6 A;  1SJH D;  1EWI A;  2EYO A;  2KHS A;  2KJX A;  2FMM A;  1FJG L;  1LTS D;  4IOA A;  5JPN C;  1VQA A;  1TT2 A;  1HQR D;  4TRD A;  4DV2 L;  1K83 H;  1QCB D;  2OTL A;  1VQN A;  5D3D A;  4DV3 L;  1L0Y B;  1BDO A;  3I4N B;  4HMI A;  2IHE A;  2WB1 E;  2VQF Q;  1LTR D;  4KKT A;  3S9W A;  2J4X A;  2JXM B;  2RSN A;  3JAM E;  2LFN A;  2KCM A;  5ELB A;  2RBM A;  1STE A;  5EAY A;  4BXX G;  2K5H A;  4ZKB B;  2A6H C;  1Q81 C;  1NBW A;  5J1Z A;  3W1G A;  3TP8 A;  1I4X A;  3SXH A;  3N6R A;  3S15 H;  3FKI B;  2JA7 H;  4JW0 A;  5LL6 X;  3TS0 A;  3KF6 A;  2OCE A;  4DU9 A;  4RGN A;  3C3L A;  4GKJ Q;  2RDH A;  1EYG A;  1K3B C;  1QVF A;  1ONL A;  4A93 B;  4CBV A;  3GTM H;  1SYC A;  3TZU A;  2B2W A;  1ZEQ X;  1TWG B;  5FO7 B;  4R4T A;  3VYR A;  1YNJ C;  4C3H H;  2JQO A;  4R4O A;  4F88 A;  5DEH A;  4QIW E;  4QY7 A;  1MKH A;  4A3K H;  3E6Z X;  5C0X J;  3CAM A;  1KIX A;  1WCM H;  5BN3 A;  1YJW A;  4QGU A;  1JOK A;  1WTH A;  3H91 A;  1HZB A;  5CC4 A;  5E4X A;  5I6Y A;  1YNJ D;  3U4Z A;  1EZ8 A;  4C56 C;  3BVZ A;  1RTO A;  4AYB E;  1PFN A;  1VQ8 A;  4OL7 A;  4HJA A;  2ZJR A;  3VR5 A;  2MQH A;  3F2D A;  2LS0 1;  1STN A;  4X66 L;  2X6L A;  4C3J B;  5IT9 c;  3BU2 A;  3UDX A;  3WDN A;  5M3M B;  1KDA A;  2O5J C;  2B2V A;  1NSN S;  5IYB G;  3SDZ A;  4ABN A;  2VS1 A;  1SR3 A;  4B3M Q;  1LT5 D;  2KCN A;  3OWE B;  3PUX A;  2R7Z H;  2Z0S A;  3RZO B;  5C4X B;  2K28 A;  4YCV A;  3V05 A;  3QB3 A;  1ZXT A;  2OF1 A;  3QO2 A;  4ALP A;  2ID0 A;  4O0A A;  2MJ8 A;  1X3P A;  4DKA C;  3OIQ A;  1ZKO A;  4HTH A;  1JWS D;  1HRJ A;  1H9J A;  4XDX A;  4I7Z C;  1YI2 A;  4DXG A;  2K6A A;  2F0D A;  4WRD A;  1SRU A;  2CH4 W;  3A54 A;  2RVL A;  1K83 B;  4XT3 B;  1WTX A;  2ZXP A;  3C1E A;  1O7I A;  4DXF A;  2I5H A;  5AFW A;  2BE5 C;  2LKV A;  1TQO A;  1EY8 A;  1MSH A;  2CWP A;  3C2P A;  3QWN A;  2EYL A;  1X65 A;  2WAQ E;  3HFZ B;  1TKW B;  1I4G A;  2C9O A;  2VQF L;  1J6Q A;  4DGZ A;  1PRT B;  3AYH B;  3TRZ A;  3GDE A;  2BE5 D;  5LMN Q;  1EYD A;  1I6V C;  4KY6 A;  3TP7 A;  4BBR G;  3G4S A;  1YNN D;  2HQL A;  1XTD A;  3VR3 A;  2PQA A;  3HOX G;  1JB3 A;  3KF8 A;  3S15 B;  5IGG A;  2JA7 B;  1CKN B;  4LFA Q;  4CJ2 C;  4F87 A;  1R4Q B;  1S72 A;  5FLM H;  1PYW D;  1CA5 A;  5ELO A;  3NXW A;  3PO2 H;  1D1K A;  3ERQ A;  3K5O A;  2EZV A;  2L15 A;  3R2T A;  1L2F A;  1JB7 A;  3SGI A;  3GTM B;  1LTB D;  2LY7 A;  2PYK A;  5FK9 C;  4AH6 A;  4CKB A;  1QZG A;  4UDU C;  3Q0A A;  4XTC S;  4DK3 C;  2EY6 A;  4C3H B;  3UDI A;  4HCE A;  4A3K B;  1GKH A;  4NXM Q;  1JMC A;  2KHJ A;  4B3S L;  3P20 A;  1WCM B;  1AP0 A;  4UP8 A;  3G48 A;  4LW1 A;  1BKB A;  4ZRZ A;  2K1B A;  4IUP A;  4Y52 H;  1JOR A;  3VYS A;  5CBA E;  3HOU H;  2KA7 A;  3PUY A;  1KNE A;  3I91 A;  4P71 A;  1AE2 A;  1SMX A;  1D1I A;  2JP1 A;  4GOP B;  4DR2 Q;  5LMU Q;  3AU7 A;  5ELF A;  2IHF A;  2AUK A;  4XXE A;  4B3M L;  2R7Z B;  2GVA A;  1STB A;  2GA4 B;  4K5X A;  1Z9F A;  4ME3 A;  2VB2 X;  1PTO H;  3NBH A;  1TWF H;  2A73 B;  4IPH A;  5E1F A;  2ALY B;  2NZ1 D;  4A3I G;  3K7A H;  2JA8 H;  3H15 A;  4QUC A;  4QMG A;  3PUV A;  4K2L A;  3T4A C;  3U50 C;  4KKU A;  2O2L D;  4K8I A;  3BZD B;  1HXY D;  1MJC A;  1ILP A;  4DR7 Q;  4IFD H;  2UXB Q;  3I4O A;  1ICW A;  5T1I A;  1WD0 A;  5FKA C;  1Y8O B;  4A3D H;  3ERS X;  3NTI A;  3RNU A;  4ZLT F;  4A3L H;  1VQM A;  5LMN L;  4BBS H;  2AHO B;  2J0T D;  4DPG A;  2KEC A;  4CGY B;  3BG3 A;  3HGB A;  1HR0 W;  2PW7 A;  1VQL A;  1NMF A;  1HNW Q;  4EQP A;  4MIU A;  3MXN A;  4LFA L;  1DOK A;  2PI2 A;  2L1B A;  2PZT A;  3B6Y A;  1IL2 A;  4OXP A;  4ZKC B;  1JC7 A;  1G29 1;  4IUV A;  5HY6 A;  1AEX A;  1QJO A;  2XNA C;  3K0X A;  5IGE A;  3PO2 B;  1PYS B;  5C5L A;  4A3C H;  1E22 A;  4RMF A;  4BY7 G;  2R92 G;  1X3Q A;  4HSP A;  4X3U A;  3MXP A;  3FP9 A;  1KC8 C;  1AZP A;  2I5M X;  5FLX E;  3D6W A;  1HCZ A;  5L37 A;  3K59 A;  4GLA C;  4L5R C;  3K8A A;  3S14 H;  3TRE A;  3L7Z C;  4NXM L;  4N9P A;  4IJL A;  1MD2 D;  1Y1V G;  3NWS A;  5KYL A;  1UNS A;  5KRU A;  3KF6 B;  2B2Y C;  1WYD A;  1G91 A;  3SK8 A;  1SYG A;  1N33 Q;  3MTS A;  3HOU B;  1D8L A;  4RGM A;  3MA2 B;  3G7L A;  3LNN A;  5CR3 A;  4IFD I;  1B3Q A;  4B3T Q;  2RHS B;  2NBF A;  4JVZ A;  4DA2 A;  4DR2 L;  5LMU L;  1LO5 D;  2ATW A;  1S5C D;  1YEZ A;  2EQS A;  4RWS C;  2PI2 E;  1X56 A;  5IP9 G;  5CV5 A;  4OWT B;  5GQO A;  3JAM c;  3NQI A;  4MTN A;  4HCS A;  1PTO B;  3NEN A;  1TWF B;  4WJ4 A;  4R4Q A;  5BN4 A;  4IZ8 A;  3K7A B;  2G5D A;  1T5X D;  2JA8 B;  2Z1C A;  3NP8 A;  4JBW A;  4MNO A;  3H3V C;  2LSS A;  1DYQ A;  2RCF A;  2WP8 J;  2QW7 A;  3LWE A;  2VXW A;  1S40 A;  1XWE A;  5IT9 E;  4DR7 L;  4A3B H;  1C9O A;  2UXB L;  2A6E C;  4DN4 M;  3LGJ A;  1A3T A;  1K8G A;  4A3D B;  4Y7N H;  3S16 H;  1V9P A;  3A5Z B;  5C4J H;  4C3I H;  2F4V Q;  5IIF A;  4BBS B;  1QG7 A;  2CKZ B;  1IBK Q;  2A6E D;  1H95 A;  2PO4 A;  5G3L F;  3J7Z C;  5DLQ E;  4ILW A;  2B2U C;  2WKD A;  5GAE C;  1HNW L;  4PMB A;  2A8V A;  1SYE A;  1VQC A;  2DUD A;  1II3 A;  1EQR A;  3C46 A;  1PFS A;  1QNU A;  3RZD H;  4LF5 Q;  1SYD A;  1GUW A;  1GO3 E;  4MN3 A;  3ND8 A;  4A3G G;  3R3O A;  1T5E A;  4NMZ A;  3PIP 3;  4JV5 Q;  3J80 c;  3BZK A;  1SNP A;  3UE0 A;  4R8N A;  2MNA A;  1M4V A;  4ME5 A;  2E74 C;  1EQT A;  2HDM A;  2ES2 A;  1Y14 B;  4GS3 A;  3CKI B;  3RN2 A;  3S14 B;  2AQ2 B;  1O80 A;  4X62 Q;  3KF8 B;  3I70 A;  1TS2 A;  1LTA D;  4LF6 Q;  3SVM A;  4EX5 A;  1IYV A;  5I9P A;  3HOY B;  1N33 L;  4P2C B;  5C4Z A;  3U9S A;  4QUF A;  4JI0 L;  1CZW A;  1SNO A;  3WOE A;  2NVQ H;  5C0X I;  4B3T L;  4LNQ A;  3GTG H;  1STG A;  3NPP A;  3ULL A;  3JAM L;  1BBW A;  1EUJ A;  1FVI A;  5C3W A;  3J81 i;  4IOC A;  4KY5 A;  1YVC A;  4CHT B;  1P16 A;  1Q8I A;  2K33 A;  3OMC A;  4DV7 Q;  3NEL A;  1GVP A;  2K7V A;  3VYT A;  4BXX H;  1B4O A;  2V1C C;  4RG1 A;  5FJ8 G;  4DV6 Q;  3T56 B;  1FR3 A;  1CM9 A;  1OTC A;  5LHY 1;  4L5T A;  1LTI D;  4ODG A;  3CXC A;  5DM7 3;  1PV4 A;  1WTQ A;  4IUU A;  1GXD C;  5ISR A;  4A3B B;  4A76 A;  2EXZ A;  4C2M H;  2K75 A;  4RAU C;  3HOV G;  4Y7N B;  3S16 B;  3KLW A;  1RIP A;  2Q8R E;  5C4J B;  4C3I B;  4FVM A;  2F0G A;  3KJO A;  2F4V L;  3NBH B;  4A75 A;  4ZUJ A;  1SEB D;  1BF4 A;  3EVQ A;  1IBK L;  2F0T A;  5JJI A;  5CV4 A;  3MEH A;  2LXJ A;  1SNC A;  2BDO A;  1PZI D;  5JVG 3;  3J80 i;  1XYI A;  2WII B;  5BN5 A;  3CCU A;  3NSW A;  2QEJ C;  3RZD B;  4YY3 Q;  2BH8 A;  1A62 A;  1M90 C;  1W6K A;  1FNU A;  5C0X G;  4LF5 L;  1RL2 A;  5C4H A;  1PYB A;  3L9A X;  4A3M G;  2JEA I; 
#chains in the Genus database with same CATH homology
 2BOS A;  3A7L A;  1G8Z D;  2KED A;  1PFB A;  4EQN A;  1A2T A;  4XQN A;  3MXG A;  3M4Y A;  1H9K A;  1Q1E A;  2O5I C;  2QF7 A;  1WD1 A;  1V1O A;  5KYI A;  5M9O A;  3QIA A;  4EVO A;  3IFD A;  1I4H A;  2NVQ B;  2L4N A;  5A35 A;  2FFK B;  3GTG B;  2Z4I A;  4V19 0;  4K5W A;  1EIH A;  4KV6 A;  1LV9 A;  2VNU D;  2Z8L A;  2QCP X;  5A2Q E;  5I2Y A;  1A6X A;  1ZYR C;  3BDL A;  1TU2 B;  3C1F A;  2QDB A;  3R93 A;  4C2M B;  2E2J B;  1ZYR D;  2X6G A;  3TP6 A;  4FXK C;  2XSC A;  1G6Z A;  3J7A F;  2B2T C;  3GP7 A;  1ENC A;  5F2D A;  1HUM A;  5I2X A;  1D5M C;  1E0B A;  1S5D D;  3NTK A;  5JOB A;  5IOD A;  3ITP A;  2L5T A;  3J81 E;  1OXU A;  5DAU A;  1QB5 D;  2FMC A;  3TP5 A;  5IGD A;  5K36 G;  2AUJ D;  1BCP B;  3URY A;  4TKO B;  5EKL A;  2EPB A;  1HA6 A;  3A7A B;  4QF4 A;  2XWB B;  2DN8 A;  3SK5 A;  1H9R A;  4NP5 A;  1SMY C;  4PMW A;  2WIN B;  3Q6S A;  1VF7 A;  2C5C A;  2XIW A;  2PPB C;  1SMY D;  3PUZ A;  2VB3 X;  1XXG A;  3OMG A;  3Q23 A;  2F03 A;  1HPC A;  1NAP A;  4XYQ A;  3GTP B;  4G7H C;  1EEI D;  1U9R A;  5ELE A;  3J80 E;  1HFG A;  2YU9 B;  3OIP A;  4FF4 A;  1RCV D;  1PRT F;  1NCV A;  1CQF A;  3DUZ A;  1F2M A;  4C1N K;  4Q5V A;  2F0I A;  2PNR C;  3M85 A;  2XN9 C;  2E2D C;  1TS5 A;  4F7X A;  5JVH 3;  2V4D A;  3I90 A;  4K5V A;  1GUS A;  3NWT A;  4BBR B;  2LMC B;  2RDF A;  3HOX B;  2CW0 C;  1C8C A;  2H4O A;  3S1N B;  1KDB A;  2OEO A;  2ZXO A;  1TS4 A;  3MWY W;  4HR7 B;  1YNN C;  2CW0 D;  1M8A A;  1HA5 A;  1LTT D;  1IKM A;  1HFN A;  5FLX L;  2NWG A;  1UAP A;  3BS1 A;  1Z6H A;  4KK7 A;  5IGC A;  5M5Y B;  5DM6 3;  4R9W A;  4ZK9 B;  1D6E C;  5HGT A;  1QE6 A;  2AWN A;  1CT1 D;  1EU4 A;  4HSV A;  3KLS X;  2AQ1 B;  2D62 A;  2N55 A;  1SYF A;  2L11 A;  4KJO A;  1OXX K;  4ZAI A;  3M3Y B;  1CI3 M;  1TWH B;  3G6J B;  3GV6 A;  3MHB A;  2F0W A;  4RCO A;  1WVL A;  1PDQ A;  3BYT B;  3O13 A;  4DNR B;  4KD4 A;  4A3I B;  2MHV A;  4QCL A;  1IYU A;  2OT2 A;  5IT9 L;  2ICE C;  1Q12 A;  3NQT A;  4PNY A;  3K58 A;  1MGS A;  2FJ2 A;  5JAV A;  4Q0F A;  3W2D A;  1PMR A;  1PXU A;  2HDL A;  3R2I A;  4IQZ A;  2K5D A;  4DNT B;  3F2U A;  2XRS D;  1SAP A;  4FNF A;  5IOC A;  1EWC A;  5I9O A;  2PZW A;  3J7Y W;  4H44 C;  1B3A A;  5EPJ A;  1PRT C;  3P1H A;  3MAQ A;  1VMP A;  1GHJ A;  2EYM A;  3H94 A;  3S17 B;  4CKE A;  4DFA A;  4TQU S;  4BA1 I;  3OPO A;  5FOB B;  4FF3 A;  1EIG A;  3KK7 A;  1PRT D;  5D3I B;  2M00 A;  5JEA G;  1J9O A;  4BY7 B;  2A5H A;  2R92 B;  1D5X C;  1UEA B;  4XQJ A;  1H9S A;  3D31 A;  1QOH A;  4RA8 A;  5CV8 A;  4CJ0 B;  1B1Z A;  3K6O A;  2F0M A;  1VF5 C;  1Y1V B;  2F0Q A;  4LMQ D;  1JE4 A;  2AQ3 B;  1L0X B;  2I07 B;  3PUW A;  4DK0 A;  1TY2 A;  1CZG A;  1JWM D;  1VDZ A;  1ENA A;  2EJG C;  3KLS A;  2B8F A;  1JOO A;  1E2W A;  4RGT A;  2B39 A;  2L12 A;  1BNZ A;  4G7O C;  2EE1 A;  1EL0 A;  4K6D A;  1SNQ A;  2SDF A;  1EEF D;  1EY4 A;  1RKN A;  2EJM A;  3EQL C;  2BDN A;  3S1R B;  1QIL A;  1GUG A;  3Q24 A;  4MHE A;  2RDG A;  1RF2 D;  3SE0 A;  1LT3 D;  5ELC A;  1B50 A;  2E75 C;  2L55 A;  1GUO A;  3NBI A;  1WTW A;  1LT6 D;  2G9D A;  5DNF A;  4BS9 A;  4KY7 A;  1RTN A;  1OXS C;  2F0K A;  2ZT9 C;  3M7N A;  3S2D B;  1FD7 D;  2EYH A;  4HED A;  1PZK D;  5EJW A;  3NE5 B;  4RCN A;  2M9V A;  1A3V A;  1A2U A;  1K8O A;  5KND A;  1DXM A;  4XQQ A;  3DMU A;  5C0X H;  1DJR D;  4A3G B;  4L6T B;  1NR4 A;  2DNC A;  5I4D A;  5J22 A;  4G57 A;  2IX1 A;  2FIN B;  1HQM C;  3FPP A;  3MC0 B;  4LJZ C;  3K57 A;  5JEA J;  2PW5 A;  5E3F A;  4H13 C;  4KMU C;  1Y8P B;  4G7Z C;  1O78 A;  1SSO A;  3NUC A;  2R6G A;  2RSO A;  2CHB D;  1U4M A;  4ZQ3 A;  2EVB A;  1B9N A;  1Z47 A;  4IAL A;  4M8A A;  3FMC A;  4K14 A;  3MFG A;  1I4Q A;  5A2Q L;  4KJN A;  2B2W C;  2MGS A;  1GJX A;  4RKL A;  1E2V A;  4J6H A;  3PIO 3;  1U4R A;  2D5D A;  1PTO C;  3M7G A;  2CQA A;  2QIL A;  1OO9 B;  3A55 A;  3TSS A;  4PMC A;  3I4L A;  3HOV B;  1PTO D;  2YYZ A;  4XIG S;  4LAA A;  5KNB A;  2B2V C;  2G9H D;  3J81 L;  3VA5 A;  3ND9 A;  4XT1 B;  1JOQ A;  3Q22 A;  1CHP D;  2BA0 A;  1OXV A;  5KEE A;  3RLF A;  2J7Z A;  1MBY A;  5K36 H;  2I46 A;  1KNA A;  3DWQ A;  1EOT A;  3AB9 A;  1JCK B;  4FXG C;  2A69 C;  5C5M A;  3P7J A;  2BCO A;  3SHL A;  1EFI D;  2K01 A;  3DEP A;  4KKS A;  5KGU A;  2F0E A;  4KN4 C;  4OO1 I;  1ESF A;  4QB4 A;  2DY8 A;  2A69 D;  2F0P A;  1LAB A;  3V2T A;  1CTM A;  4X3S A;  4H0L C;  4EQO A;  4ID6 A;  1KAB A;  1MI2 A;  3QJY A;  1GUN A;  1AW7 A;  2F0S A;  1SXT A;  3J80 L;  4J1M A;  3U9O A;  3PV0 A;  5ELD A;  4A3F B;  2WV6 D;  2AWO A;  3S1Q B;  3FRP B;  4B08 A;  3UI2 A;  1HTP A;  3TBI B;  2K5Q A;  1H9S B;  2IX3 A;  1CFM A;  1IW7 C;  5J39 A;  1E2Z A;  1ENF A;  2F3V A;  1WTO A;  3DWA A;  1ML0 D;  3I8Z A;  1O7Z A;  3DWP A;  3PMF A;  1IW7 D;  3R8B A;  2RKS A;  3MVV A;  1DOL A;  1DZ1 A;  1IL8 A;  3BDO A;  2PMZ B;  2Q8I B;  5LL6 S;  2HUG A;  4X3T A;  1GUT A;  1FGB D;  1A15 A;  2B2Y A;  1C48 A;  2F0L A;  5FO8 B;  4OO1 G;  1HHV A;  4FXD A;  5EQ0 A;  1DD2 A;  3BYY B;  1B44 D;  2R61 A;  3T51 B;  4K2K A;  2NVT B;  2NN6 G;  2F0J A;  1S5E D;  1K8M A;  1B53 A;  2EYF A;  4J8Q A;  1KLU D;  1TY0 A;  3BDC A;  1Q1B A;  3RMH A;  1JR0 D;  3GQB A;  5NUC A;  1TVX A;  1ILQ A;  3J7A V;  3OSO A;  5D14 A;  5COY A;  3K5N A;  1RHP A;  3A8I E;  1WTP A;  3HKZ B;  3K5L A;  3M4O B;  4FF2 A;  4LK1 C;  2ZXR A;  3K5M A;  3CU7 A;  4KHZ A;  4K6L A;  3VR2 A;  2E76 C;  4IN3 A;  2D9U A;  3E0J A;  4KI0 A;  5COR A;  3MZ5 A;  3QOJ A;  1JQY D;  1F2L A;  3DXJ C;  2B2U A;  3GO5 A;  1LTG D;  1JWU D;  1F9P A;  1CQV A;  3KBG A;  4RGO S;  4YIJ A;  4IUT A;  4B9X A;  3GTK B;  2IPK D;  1NR2 A;  2JA5 B;  4EGV A;  2HCC A;  3HG9 A;  4HAE A;  2K04 A;  5C6A A;  3TN2 A;  3HRZ C;  2A6H D;  5I6W A;  5EBD A;  2NVY B;  1IKL A;  3ERO A;  3I72 A;  5KIX A;  2R3Z A;  1I3Q B;  1VCI A;  1HUN A;  3NHH A;  3GD7 A;  2EYJ A;  3EFX D;  3P75 A;  5EKI A;  3KLR A;  5JEA H;  2CVR A;  3ONA B;  1X32 A;  3QG1 A;  2SEB D;  3CQZ B;  3D8G A;  2F4I A;  1UUP A;  2IJ0 A;  1Z7T A;  1GOZ A;  2KCC A;  1CK1 A;  4FO2 A;  3D3R A;  2K5W A;  2EY1 A;  4R8I A;  1SE3 A;  4WOR A;  1STA A;  2DNE A;  4WFN 3;  4FYD A;  1Q90 A;  1F2Z A;  3IFT A;  3A8K E;  1BCP C;  2F0U A;  1Y69 U;  1V1P A;  1I4R A;  5IGF A;  1EY6 A;  3TME A;  1DCZ A;  4C3J G;  2L0C A;  1EY7 A;  1BCP D;  2X69 A;  2EY2 A;  2TSS A;  3S1M B;  1SE4 A;  3E5S A;  3MXU A;  3TDQ A;  3H6M A;  3EJI A;  2NUC A;  3FDT A;  1SND A;  3HS0 C;  4L8J A;  2E2I B;  1Y8N B;  5TSS A;  4NDX A;  1EYC A;  2F0H A;  2NB0 A;  1BQQ T;  5CGK A;  4IUQ A;  4G4K A;  3V96 A;  4PQX A;  4RHS A;  3SEB A;  2EOT A;  3D4D A;  1KTK A;  3CHB D;  1MSG A;  5FO9 B;  2PCF B;  1U4L A;  2IW3 A;  3T53 B;  3OW7 A;  3HOW B;  1DON A;  1ROD A;  3VYU A;  3SK4 A;  1SBB B;  5CV9 A;  3BVM A;  4ULL A;  4KN7 C;  5CYU A;  1AZQ A;  1G2T A;  4KHV A;  4CJ1 B;  4NKL A;  5EPL A;  1F2Y A;  2IL8 A;  4HMJ A;  5T1G A;  3N52 A;  1GHK A;  1O7L A;  2IT1 A;  4BY1 B;  3RUZ A;  1ET9 A;  3GTJ B;  4OHJ A;  3SK6 A;  4KD3 A;  5EKK A;  4XYO A;  1I50 B;  2HCI A;  3LX0 A;  4C3H G;  1SNM A;  1D2B A;  4H7B A;  1W6J A;  1Y1W B;  2VUM B;  1V8Q A;  3HZX A;  4O1N A;  1EYA A;  2WB1 B;  3D6C A;  1S4Z A;  5JPM C;  1SFO B;  1OXT A;  4BWG B;  2EJF C;  4DAV A;  4OIJ A;  1I6H B;  4WJW A;  1LLR D;  2B2T A;  2XRQ D;  3EA6 A;  3T16 A;  2NTS A;  1TR5 A;  1BUV T;  5EGT A;  3OHX C;  2JSO A;  5C44 B;  1AFP A;  3OOC A;  1C4Q A;  1CHQ D;  5KNC A;  2NTT A;  3A8J E;  4RFB A;  1RJT A;  1RD9 D;  2FHT A;  1S5F D;  3X3M A;  4QIW B;  2DY7 A;  1VMC A;  2JEB I;  1S5B D;  1PTO F;  3D4W A;  4X3K A;  2SNM A;  2KOL A;  3DHQ A;  4IUR A;  1O7Y A;  4AYB B;  5M3F B;  2EDG A;  2F0O A;  2B8G A;  2MPM A;  2KUM A;  4ZUI A;  4OGQ C;  2OXP A;  1B2T A;  1PFM A;  1BBX C;  2A74 C;  5CBE E;  1CA6 A;  2NYZ D;  4B9W A;  2SNS A;  1TWC B;  1F77 A;  3FEW X;  4JK1 C;  3NTH A;  4U68 A;  1D5Z C;  2QKI C;  3GTQ B;  2K32 A;  4C1N I;  2R93 B;  4DK1 A;  3DEO A;  3QOL A;  1JIC A;  3TZD A;  3KBX A;  1G2S A;  1H9M A;  3HEJ A;  1BO0 A;  2WAQ B;  1BR9 A;  1QWY A;  5CMD A;  1XTC D;  2M2L A;  2PZU A;  2BA1 A;  1ET6 A;  4A3E B;  1BOS A;  3NK9 A;  3I4M B;  3A56 A;  4F8M A;  3IAY A;  2RA4 A;  1ESR A;  1STY A;  4PV1 C;  4I65 A;  1NUC A;  4U67 3;  5M5W B;  3SR1 A;  1FYC A;  3X3N A;  1KAA A;  3OWF A;  5E4W C;  3GTL B;  3DM1 A;  2JYO A;  3W3A A;  2N88 A;  4N9T A;  4RKB A;  1Q3L A;  1V1P B;  1A3U A;  1EU3 A;  4OO1 H;  1FNW A;  4TSS A;  1EQV A;  1F9Q A;  1EY0 A;  2A68 C;  4IFD G;  4RHR A;  2IWH A;  4K8J A;  3ZYY X;  2NN6 H;  5CV7 A;  2KQ3 A;  2MUY A;  2A68 D;  5IGB A;  5JJZ A;  2L9H A;  2WAC A;  2JE6 I;  1R4P B;  3FVQ A;  3IL8 A;  1F9S A;  1SE2 A;  5D65 A;  1SDF A;  4GZY C;  4UAI A;  3HOZ B;  2Z4H A;  3BVG A;  1QNK A;  4L63 B;  2H1E A;  1WTV A;  4CKC A;  5EBC A;  2PQE A;  2F1M A;  4M1U B;  4BA2 I;  1V43 A;  5C3E B;  3IKJ A;  2XVS A;  2ENB A;  2Y0S B;  3T13 A;  1KDC A;  3CRK C;  1STH A;  4DAY A;  3I73 A;  1LT4 D;  2F0F A;  4DF7 A;  4A3M B;  2F0N A;  1TWA B;  3K0Y A;  1J8I A;  4A3J B;  1B9M A;  3GTO B;  3VA7 A;  1F9R A;  2O4X A;  2F3W A;  2KVM A;  2E2H B;  1LAC A;  3PO3 B;  2NN6 I;  2ICI A;  1U4P A;  4RH6 A;  1SYB A;  2D2C C;  2K05 A;  1WTR A;  4Z9C B;  3H09 A;  3WOF A;  3I3C A;  2K03 A;  2F0V A;  4IUN A;  2SOB A;  4ZYS A;  3VR4 A;  1EZ6 A;  1IHZ A;  2KEE A;  4FP5 D;  5CV6 A;  3H0G B;  4S3S A;  2EYP A;  2HQE A;  5K5P A;  4O42 A;  3D4R A;  2JA6 B;  2TMP A;  1I4P A;  1AN8 A;  3GV3 A;  4HN7 A;  1EY9 A;  1XX8 A;  5HUR A;  2XWJ B;  4C3I G;  3MFY A;  1R9T B;  2IX0 A;  2NVX B;  4DAP A;  3LWU A;  2EY5 A;  5G3L D;  1PZJ D;  5C3X A;  4FF1 A;  1DM0 B;  4IFD J;  2Q8T A;  1HTL D;  1EY5 A;  1SJE D;  1FNV A;  3L3O C;  1EWH A;  2MP1 A;  1RDP D;  3FPU B;  3RD4 A;  3HP3 A;  3CRL C;  3AMU A;  4E6I A;  1KLG D;  3VR6 A;  4OIK A;  3S2H B;  5M5X B;  1BCP F;  1TII D;  2B63 B;  4KTA A;  2RQX A;  1DOM A;  1PLF A;  3KUP A;  4V0B A;  5EPK A;  1BXT A;  2WKC A;  4NW2 A;  1TS3 A;  1SJH D;  2EYO A;  2KHS A;  2KJX A;  2FMM A;  1LTS D;  5JPN C;  4TRD A;  1TT2 A;  1HQR D;  1QCB D;  5D3D A;  1L0Y B;  1BDO A;  3I4N B;  4HMI A;  1LTR D;  4KKT A;  3S9W A;  2J4X A;  2JXM B;  2RSN A;  3JAM E;  2LFN A;  5ELB A;  2RBM A;  1STE A;  4ZKB B;  2A6H C;  5J1Z A;  3TP8 A;  1I4X A;  3SXH A;  3N6R A;  3FKI B;  5LL6 X;  4DU9 A;  4RGN A;  3C3L A;  2RDH A;  1ONL A;  4A93 B;  4CBV A;  1SYC A;  3TZU A;  2B2W A;  1ZEQ X;  1TWG B;  5FO7 B;  3VYR A;  1YNJ C;  4F88 A;  5DEH A;  3E6Z X;  5C0X J;  5BN3 A;  1JOK A;  3H91 A;  5CC4 A;  5E4X A;  5I6Y A;  1YNJ D;  4C56 C;  1EZ8 A;  3BVZ A;  1RTO A;  1PFN A;  4OL7 A;  3VR5 A;  2LS0 1;  1STN A;  4C3J B;  2X6L A;  3WDN A;  5M3M B;  1KDA A;  2O5J C;  2B2V A;  1NSN S;  3SDZ A;  4ABN A;  1LT5 D;  2KCN A;  3OWE B;  3PUX A;  3RZO B;  5C4X B;  2K28 A;  3V05 A;  3QB3 A;  1ZXT A;  2OF1 A;  3QO2 A;  2ID0 A;  2MJ8 A;  1X3P A;  3OIQ A;  1ZKO A;  4HTH A;  1JWS D;  1HRJ A;  1H9J A;  4XDX A;  4I7Z C;  4DXG A;  2K6A A;  2F0D A;  4WRD A;  3A54 A;  2RVL A;  1K83 B;  4XT3 B;  1WTX A;  2ZXP A;  3C1E A;  4DXF A;  5AFW A;  2BE5 C;  2LKV A;  1TQO A;  1EY8 A;  1MSH A;  3C2P A;  3QWN A;  2EYL A;  1TKW B;  1I4G A;  2C9O A;  4DGZ A;  1PRT B;  2BE5 D;  1EYD A;  1I6V C;  4KY6 A;  3TP7 A;  1YNN D;  3VR3 A;  1JB3 A;  3KF8 A;  3S15 B;  5IGG A;  2JA7 B;  4CJ2 C;  4F87 A;  1R4Q B;  1PYW D;  1CA5 A;  3NXW A;  1D1K A;  3ERQ A;  3K5O A;  2EZV A;  3R2T A;  3GTM B;  1LTB D;  2LY7 A;  2PYK A;  5FK9 C;  4CKB A;  4UDU C;  3Q0A A;  4XTC S;  2EY6 A;  4C3H B;  4HCE A;  4A3K B;  3P20 A;  1WCM B;  1AP0 A;  4ZRZ A;  2K1B A;  4IUP A;  1JOR A;  3VYS A;  5CBA E;  2KA7 A;  3PUY A;  1KNE A;  3I91 A;  1D1I A;  2JP1 A;  3AU7 A;  5ELF A;  2AUK A;  4XXE A;  2R7Z B;  1STB A;  2GA4 B;  4K5X A;  2VB2 X;  1PTO H;  3NBH A;  2A73 B;  5E1F A;  2NZ1 D;  4QUC A;  4QMG A;  3PUV A;  4K2L A;  3T4A C;  4KKU A;  2O2L D;  4K8I A;  3BZD B;  1HXY D;  1ILP A;  4IFD H;  1ICW A;  5T1I A;  1WD0 A;  5FKA C;  1Y8O B;  3NTI A;  4ZLT F;  2J0T D;  2KEC A;  4CGY B;  3BG3 A;  3HGB A;  2PW7 A;  4EQP A;  4MIU A;  3MXN A;  1DOK A;  2PZT A;  2L1B A;  4ZKC B;  1JC7 A;  1G29 1;  4IUV A;  1AEX A;  1QJO A;  2XNA C;  5IGE A;  3PO2 B;  5C5L A;  1X3Q A;  4HSP A;  4X3U A;  3MXP A;  1AZP A;  5FLX E;  3D6W A;  1HCZ A;  3K59 A;  3L7Z C;  4N9P A;  5KYL A;  1MD2 D;  3NWS A;  1UNS A;  5KRU A;  2B2Y C;  1G91 A;  3SK8 A;  1SYG A;  3MTS A;  3HOU B;  4RGM A;  3MA2 B;  3G7L A;  3LNN A;  5CR3 A;  4IFD I;  2NBF A;  4DA2 A;  1LO5 D;  1S5C D;  4RWS C;  5CV5 A;  3NQI A;  4HCS A;  1PTO B;  1TWF B;  5BN4 A;  4IZ8 A;  3K7A B;  2JA8 B;  1T5X D;  2Z1C A;  3NP8 A;  4JBW A;  3H3V C;  1DYQ A;  2WP8 J;  3LWE A;  2VXW A;  1XWE A;  5IT9 E;  2A6E C;  4DN4 M;  1A3T A;  4A3D B;  5IIF A;  4BBS B;  1QG7 A;  2A6E D;  2PO4 A;  5G3L F;  4ILW A;  2B2U C;  2WKD A;  4PMB A;  1SYE A;  1II3 A;  3C46 A;  1QNU A;  1GUW A;  1SYD A;  4MN3 A;  3ND8 A;  3R3O A;  1T5E A;  4NMZ A;  3PIP 3;  1SNP A;  4R8N A;  1M4V A;  4ME5 A;  2E74 C;  1EQT A;  2HDM A;  3CKI B;  3S14 B;  2AQ2 B;  1O80 A;  3I70 A;  1TS2 A;  1LTA D;  3SVM A;  1IYV A;  5I9P A;  3HOY B;  4P2C B;  5C4Z A;  3U9S A;  4QUF A;  1CZW A;  1SNO A;  3WOE A;  5C0X I;  1STG A;  3NPP A;  3JAM L;  5C3W A;  4KY5 A;  4CHT B;  2K33 A;  1Q8I A;  3OMC A;  2K7V A;  3VYT A;  1B4O A;  3T56 B;  1FR3 A;  1CM9 A;  5LHY 1;  1LTI D;  4ODG A;  5DM7 3;  1WTQ A;  4IUU A;  1GXD C;  5ISR A;  4A3B B;  2EXZ A;  4RAU C;  4Y7N B;  3S16 B;  2Q8R E;  5C4J B;  4C3I B;  4FVM A;  2F0G A;  4ZUJ A;  1SEB D;  1BF4 A;  3EVQ A;  2F0T A;  5CV4 A;  3MEH A;  1SNC A;  2BDO A;  1PZI D;  5JVG 3;  1XYI A;  2WII B;  5BN5 A;  3NSW A;  2QEJ C;  3RZD B;  1W6K A;  1FNU A;  5C0X G;  5C4H A;  3L9A X;  2JEA I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...