1LT5D

Heat-labile enterotoxin b-pentamer complexed with thiodigalactoside
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
103
structure length
103
Chain Sequence
b'APQTITELCSEYRNTQIYTINDKILSYTESMAGKREMVIITFKSGETFQVEVPGSQHIDSQKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAISMKN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEAT-LABILE ENTEROTOXIN
publication title Structural foundation for the design of receptor antagonists targeting Escherichia coli heat-labile enterotoxin.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Enterotoxin
total genus 24
structure length 103
sequence length 103
chains with identical sequence E, F, G, H
ec nomenclature
pdb deposition date 1997-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1lt5D00
4RGOS 1F77A 1SE2A 1UNSA 1JWSD 2AQ3B 3R8BA 2G9HD 1AW7A 1LT6D 2R61A 1PTOH 1LT4D 3EA6A 1HXYD 1LO5D 1PTOF 1D5XC 1EU3A 1PTOD 1D5ZC 3DWQA 3W2DA 1LTTD 4RFBA 2QEJC 5ELDA 1ESFA 1PRTB 1FD7D 1BCPC 1JQYD 1JWMD 1TS4A 4RGNA 3KLSX 2XNAC 3OWEB 2XRQD 4DXFA 1S5CD 2O2LD 4RHRA 3DWAA 1V1PA 1T5XD 1B1ZA 3R2IA 3SEBA 1L0YB 1TS5A 1PTOB 1QILA 2NTTA 1CT1D 1CHQD 1PZID 3URYA 2RDGA 1PRTC 1PZKD 4DXGA 1EU4A 1I4QA 1LLRD 2CHBD 5D3IB 3TSSA 4BWGB 1V1PB 1EFID 1BCPF 3BVMA 1STEA 4L6TB 2AQ2B 1KLUD 1ENFA 1SXTA 2IPKD 1DJRD 1CHPD 4L63B 1SJHD 1I4XA 2AQ1B 1EEFD 3BVZA 3BVGA 3BYYB 2RDHA 3BZDB 4C56C 5FKAC 1SE4A 5D3DA 1LTGD 1PTOC 1XTCD 1LT3D 1TY0A 1TY2A 2IJ0A 1ET6A 1I4GA 3DWPA 2XRSD 4RH6A 3GP7A 2J4XA 1CK1A 5ELCA 4RGMA 1GOZA 3R2TA 3CHBD 1PRTF 5ELFA 5FK9C 4TSSA 2NTSA 1PYWD 1UUPA 1V1OA 1M4VA 1HA5A 1I4RA 1SJED 1AN8A 1JR0D 1BCPD 1S5BD 2XN9C 1RF2D 1S5DD 4RGTA 1JWUD 1KTKA 2TSSA 1LTBD 1JCKB 1EWCA 1LTSD 1PZJD 5ELBA 1TS3A 5I4DA 1D5MC 1HTLD 1HQRD 2ICIA 5TSSA 3V05A 1SE3A 4RHSA 1RD9D 4UDUC 1RCVD 1KLGD 1BXTA 1D6EC 1EEID 1ET9A 1LTID 1XXGA 3BYTB 2WV6D 1I4PA 1FGBD 3EFXD 3O13A 4K6LA 1SBBB 1PRTD 1MD2D 3MC0B 5ELEA 4ZYSA 2SEBD 1TS2A 1BCPB 1CQVA 1B44D 1DYQA 1S5FD 4O1NA 1SEBD 4RCOA 1S5ED 1FNUA 1LT5D 1LTRD 1FNVA 2QILA 1FNWA 2Z8LA 4OHJA 4Z9CB 1L0XB 1RDPD 1LTAD 1G8ZD 3MFGA 1I4HA
chains in the Genus database with same CATH superfamily
3PMFA 4ME5A 1ASYA 1K8MA 3EA6A 2HHHL 3X3MA 4GN4B 1EYDA 4ULLA 4LJZC 2I46A 2R7ZB 3W2DA 2VQEL 3N6RA 2F03A 2R7ZG 2GA4B 5F2DA 4OWXB 3FRPB 2KA7A 3E3XA 4KN4C 2BA0A 2PW7A 3Q0AA 3HFZB 5M3FH 1E1TA 1WTQA 1U0LA 1CQFA 1SNMA 1DONA 1EUJA 1DD2A 1R4QB 2UUCL 4YWKA 1L0YB 3WOEA 1QILA 2L11A 2CH4W 5IGCA 1STHA 4R9WA 2EJGC 4A3EB 2Z4HA 3BVMA 4JK1C 4OGQC 1JC7A 4A3EG 2IPKD 1X65A 1CA6A 4DV2L 1SJHD 4HJ5A 3BVZA 1Y1WB 2D0OA 4QB4A 3KYHC 2VS1A 1TY0A 1Y1WG 1BQQT 2CQAA 4PNYA 2WAQB 4IPHA 2EYOA 2WAQG 3CHBD 1QE6A 4RAUC 5FK9C 5DAUA 5HURA 4A3MH 4DV6L 4DK0A 4DV0L 4N8X1 4UAIA 5CGKA 4QGUA 4ME3A 1EOVA 5JJIA 1OXSC 4CKEA 4J6HA 2Q8TA 1NBWA 1J5EQ 4OO1G 3S15B 2JQOA 3FPUB 5TSSA 4IPDA 4RHSA 1ESRA 4KMUC 3A8IE 5LMUQ 1EY0A 2CH4A 2H1EA 1H9RA 2CVRA 3VYSA 1R9TB 2IX0A 3EFXD 3E5SA 1SBBB 3M7GA 1GUTA 1VS0A 4APVA 1K3RA 4FDBA 1EQQA 4RGOS 2EVBA 3KLWA 2G9HD 1BO0A 1B50A 3HG9A 2VW9A 4CDFC 4JC0A 2Y0SE 2IL8A 3EBEA 3V96A 1D8LA 1Y8NB 3M4OH 2N8NA 3MXUA 2X6LA 4DF7A 1NMGA 4DA2A 4JI4Q 4NKLA 5CV7A 4A3DB 2QF7A 1Q1BA 3VA5A 1IYVA 1YJ9A 4HR7B 4A3DG 3R93A 3MXGA 3S15H 1CZWA 1K0RA 1U4PA 3CP0A 2QEXA 3A7LA 3KF6A 2JA7B 5H1SE 3HOUB 1XPRA 5IP7G 3X3NA 5GADC 3CRLC 2B39A 3FDTA 3HOUG 2OXPA 5FOBB 1PFBA 1GVPA 3F2DA 4DV1Q 1R9TH 1PYBA 1XYIA 5COYA 5C0XH 1G6ZA 1A8VA 2M9VA 3PF4A 2IHFA 3T51B 1VQFA 3LGJA 4KTAA 1JE4A 2NZHA 4GOPA 2EYHA 2EXDA 4A3JB 2VNUD 5IYBH 4A3JG 2RF4A 3BYYB 3KF8B 2NZ1D 4KKTA 2VZAA 1PYSB 3GTMH 1JOQA 5IODA 4A3IH 4JI6Q 3JC66 2KOLA 1PH9A 3OTOQ 1CK1A 3UE1A 1O78A 2RDFA 4QIWE 4A3DH 3STBC 3F2CA 1J5EL 1HQMC 1VQ4A 2QW7A 3S1NB 5IP7H 4JI5Q 2EJFC 2A68C 3DXJC 2A8VA 2L4NA 4HIOA 1WD0A 1WTHA 2A19A 3M4QA 2I0QA 1HTLD 3AYHB 1CKNB 3NP8A 4U673 3I2ZA 1KRSA 1BBUA 1E22A 4KLKA 2F0FA 2HQLA 2MQHA 1YHBA 4DR7Q 3PUXA 1XNQQ 1U9RA 1D7QA 4G7ZC 2LKVA 5C4XH 4CJ2C 2A6HD 2RQXA 1DYQA 1B44D 1S5FD 4AQYQ 1G2TA 1HUMA 3IFTA 3KK7A 4X65Q 5DEHA 3T13A 5J39A 1V8QA 3HGBA 3PSIA 3PO2B 1S40A 1KNEA 5E4WC 5BN3A 3PO2G 1D5XC 4JI4L 2EE1A 1D5ZC 1IKLA 3MEFA 1LTTD 4C2MB 2MPMA 2QEJC 5ELDA 1EIHA 4ZQ3A 4HIMA 1JQYD 1JOKA 2NZOA 3S1NH 4RGNA 4C3HB 4DGZA 3I70A 4OL7A 4C3HG 1SFOB 2HCCA 1QUQA 4LW1A 1QZHA 5I2YA 1PLFA 1Y1VB 4DAYB 3RN5A 1AE2A 1V1PA 4L8JA 3K0XA 4DV1L 4FP5D 1Y1VG 1K83B 4CHTB 1TIID 2WB1B 2WB1G 2RDGA 3OPOA 4RA8A 4JI1Q 4OO1I 5EKIA 5D3IB 2K5HA 2IT1A 2FINB 1WTPA 3K6OA 4WORA 1X3GA 1MIUA 2JSOA 3ERSX 2K7VA 4LFAQ 3P1HA 3BVGA 5JEAH 1LTGD 1YJNA 2DGYA 2YTYA 4DK6C 4EGVA 5C6AA 2LXJA 1HNWQ 1YNJC 2A6ED 1T5EA 5CV8A 5ELFA 4JI5L 3QR8A 1SSOA 2JP1A 2UUAL 1EWIA 1UEBA 1SROA 2ZM6Q 2E75C 4MZ9A 3SDZA 3QOLA 4RGTA 1K83H 2VB2X 1LABA 3TN2A 2WKDA 1D5MC 1NAPA 3NBHA 4DR7L 4YCVA 4A3FB 1XNQL 2LXKA 4K0KQ 1EYAA 1EZ6A 1W6JA 4A3FG 3HKSA 5KEEA 1STGA 1KDBA 2R7FA 4AQYL 1GJXA 5M3MG 4X65L 4BA2I 1EL0A 3OOCA 1FNUA 1VQCA 4HJ9A 2OT2A 3FP9A 4YWLA 4WJ3M 1QCBD 2X6GA 3K81C 1NMFA 1I94Q 3P75A 4DV5Q 3Q8DA 3SE0A 3GD7A 3TZDA 3ERQA 5DLQE 3Q6SA 4B3RQ 1XNRQ 1HNZQ 4RG1A 1RHPA 2N49A 3I3CA 1X3EA 2Z6KC 3DUZA 4A3BG 2HDLA 1C0AA 4RHRA 1DXMA 4I65A 2JA8H 1I6HB 4KK7A 1WTVA 2BH8A 5JJZA 5JJLA 2KHSA 3HRZC 1MSHA 1Q8IA 4DR5Q 4OEMB 1CI3M 4C3IB 3S1QH 1CT1D 5I6WA 5M3MH 3ER0A 4C3IG 1I3QH 3IFDA 1SAPA 2F0EA 1KQSA 5FJ8G 3L2PA 4LFAL 1YIJA 3A8KE 1BDOA 3TEHB 4L6TB 4LF8Q 1DJRD 2B8GA 3HZXA 4I7ZC 4A3CG 3U4ZA 2KHJA 1LT3D 3SK6A 4HSVA 2IJ0A 2WP8J 4XT3B 2UXDQ 2WFWA 4DR1Q 3GP7A 1KDAA 2ZM6L 2A73B 3DHQA 4A3BH 5CMDA 4CDEC 2VL6A 4RKBA 2JA5B 2CFMA 2JA5G 1OTCA 1LUZA 1KDCA 3GTJH 3WOFA 2E2HB 1I6HH 3CQZB 2F0LA 2TSSA 4K0KL 1WI5A 3OW2A 2R92H 4K5XA 1B3QA 5I4DA 3IKJA 2JA6B 2ICIA 5GAGC 3J81j 5LMNW 4DAMA 2JA6G 1HA6A 2OCEA 2Z6KA 5FJ8H 1TWFH 3RUZA 1JMCA 3VR4A 4ALPA 4GN3B 3HOXB 3C2PA 3A74A 3HOXG 3BZCA 1PRTD 4P74A 2KVMA 2SEBD 1TS2A 4F87A 1PA6A 5NUCA 4A3KB 2RBMA 1I94L 3STBD 2NVQB 4A3KG 3JAMc 1N34L 3IL8A 3KLRA 5DM63 4FXKC 4OHJA 3TQYA 4FF1A 1B7YB 1XNRL 1HNZL 1FR3A 4POGA 1HXYD 1C9OA 4JI3Q 1GUGA 4O42A 3VYTA 1VMCA 5IYDH 2JA5H 1G91A 5C44H 1KXLA 4GLAC 3PO3B 2EJMA 1SN8A 2E2HH 3PO3G 1H95A 1Y69U 4B3SQ 2F0KA 3PIO3 4DR5L 4J1MA 5M5XH 1IBKQ 2E2JB 2RHSB 3DWAA 1VQ9A 3NPPA 3J7AV 3FKIH 3C46A 1P8LA 3J81c 4C3JB 4DPGA 2L0CA 4C3JG 2IWHA 1UE1A 1PFMA 1KC8C 3M3YB 4LUOA 3OIQA 3A0JA 4KV6A 3CMAA 4LF8L 5KYLA 1GUNA 2BDNA 1SYBA 3ONAB 3I4NH 3MXNB 4BY7B 1LV9A 2H5XA 2PNRC 2PZUA 4BY7G 1SDFA 3SK5A 3HOWH 2VQEQ 3NEMA 1CHPD 2DY7A 1D1KA 2UXDL 3RR5A 4DR1L 2OWOA 3LX0A 3K7AB 5FKAC 2EYPA 2A1AA 4XQQA 4F88A 3FHWA 3TREA 3PUYA 2JXMB 3AQQA 4HIDA 1CFMA 1A62A 3QO2A 1V43A 3K5NA 4NW2A 4FF4A 4LAAA 1F9QA 1JR0D 1BCPD 1G51A 2F4VQ 3QOJA 1S5DD 2CKZB 1EY7A 3J7A5 4XYQA 1KTKA 3K8AA 4GNXA 3UDGA 1TS3A 3KJOA 1JJCB 4JBMA 1E2ZA 2BE5D 2Y0SB 3C1EA 3M3YH 1KLGD 3G71A 2Y0SG 1RTNA 3I4OA 1MSGA 4UP7A 3QWNA 4JBKA 1I4PA 4BY7H 4G4KA 4LUVA 1B8AA 1YNJD 4GLVB 4OIKA 3U9OA 5ELEA 1Z7TA 1B2TA 3MWYW 3CKIB 1CQVA 2MNAA 1LT5D 1JT8A 1FNVA 4JI3L 3EVQA 2GVAA 2Q2TA 3GTGH 4DV3L 4L5SA 4HSPA 4JBJA 2EY1A 2JYOA 3RZDB 1F77A 2K5DA 2AQ3B 1N8RC 3CC4A 1LT6D 1PTOH 1HZCA 4X3SA 3HOYH 1PTOF 2E5LL 2PPBC 4HN7A 4MTKA 1QOHA 1XMOQ 3D6CA 5LHY1 1EY5A 3MZ5A 1X3PA 2A69D 1HFGA 5EBDA 1IBKL 4IUUA 1TR5A 1X55A 4JVZA 1C48A 3RLFA 4MIUA 4BBSG 3KBGA 3BDCA 4ZUJA 2O2LD 4AYBE 4X62Q 2DN8A 3H91A 1Q81C 3GTQH 2AKWB 4OELB 1I50B 1GO3E 3NENA 1YZ6A 1BBXC 3Q24A 2K5NA 4GOPB 2FMMA 4ZKCB 1J9OA 5C3EH 3QIAA 4QIWB 4X66L 3HOVH 1TWCB 4BXXG 1EU4A 4GN5A 2D5DA 3CMEA 1ZXTA 4G57A 3S14H 1J8IA 3RLNA 1DM0B 5M9OA 3GTKB 4WJ4A 1L0WA 1SXTA 1VMPA 1TXYA 2PMZE 3NQTA 2R93B 1RIPA 3HOZH 4NP5A 4Q5VA 2P5ZX 2R93G 1PTOC 4R4IA 3I4MB 2QA4A 1K8OA 3S1MB 3I4MG 1OXTA 1LTLA 1QG7A 2C5CA 5C5LA 5IGBA 1HPCA 2BA1A 2TMPA 1YNNC 4BBSH 2F4VL 4TSSA 1CSQA 4HCSA 4MTNA 3OW7A 1M4VA 1YI2A 3G48A 2K03A 3GV6A 1S5BD 2IX1A 3RZOB 1RODA 4YWMA 3CW2C 1VQJA 3S2HB 1YHAA 1FVIA 5HGTA 2NVXB 1CUKA 1HUNA 2D9UA 2R7ZH 3SVMA 1CKOA 1TWCH 3ULJA 4FF2A 5CV4A 4HIKA 1HR0W 2AUKA 5T1GA 3K58A 1PH6A 1ILQA 1KHIA 4EQNA 2AMCB 2G5DA 3GTKH 2PYKA 2DJGC 3UDIA 1XMQQ 2J7ZA 2R93H 1I5FA 1XMOL 1RDPD 4X3TA 1G6PA 3AU7A 1WTXA 1AW7A 3G6EA 2ICEC 1RJTA 1EIGA 2F0OA 1B70B 3MA2B 5E1FA 1G2SA 4J15A 4K14A 4DK1A 4QMGA 4RFBA 4B9WA 1A15A 1ENCA 1QUQB 2QDLA 3K7UC 1SRUA 1M90C 3OWFA 1L1OB 4A3EH 1PRTB 1FD7D 4X62L 4LF6Q 3CD6A 1K3BC 4EQOA 3CU7A 1PH7A 1OXVA 3T4AC 3PIPA 4ZAIA 2Z6BA 4MN3A 4JV5Q 5I9PA 1EY6A 1Y1WH 1VQ8A 1IW7D 1B1ZA 4HMJA 1IYUA 4ID6A 5CBEE 1IZ6A 5IWAQ 5FO8B 2I5HA 4DR2Q 3CCMA 3PQIA 1H9SA 1PVOA 4MNOA 3I55A 4DXGA 3H0GB 1U4RA 1VF7A 5JVH3 3TS2A 3H0GG 2CW0C 1EY4A 1ZYRC 5J22A 5K5PA 1PHJA 2F0UA 4IPCA 4BBRB 2NUCA 5EBCA 3MAQA 4OO1H 2F0VA 2B29A 4BBRG 3SHLA 1VQKA 1EEFD 3TP7A 3VA7A 2QDBA 4OX9Q 4B3MQ 3FVQA 5ISRA 2KQ3A 3CCRA 2WINB 3TP6A 2JA7G 1GUWA 3ULLA 2DY8A 2A5HA 4RH6A 5IGGA 1BF4A 2JA9A 4RCNA 1PFNA 1CTMA 1PRTF 1ASZA 3R3OA 1F9SA 1EYCA 1OXUA 3QB3A 4DFAA 3TP5A 2XTIA 3BU2A 2PQEA 4CDDC 1A2UA 2PQAA 1KNAA 1K73C 4CGYB 1N36Q 3D0FA 4PZ7A 3G4SA 1STYA 2EY6A 4JI2Q 4A75A 2AWNA 3J7ZC 1ET9A 1EQRA 1XMQL 3B6YA 1VQOA 4IOCA 2BCOA 3D4DA 2EOTA 1Q82C 4KD4A 1BCPB 3OMCA 4O1NA 2EPBA 4RCOA 1S5ED 4K6DA 4P2CB 2JA7H 2ZJPA 1KAWA 5CV6A 3HOUH 2K6AA 3E9HA 2UUAQ 3S1RB 2SOBA 1PH2A 1RTOA 4NB3A 2D62A 1YHQA 4LF6L 2AHOB 4TKOB 4F8MA 4DR6L 1BR9A 4A4IA 5KGUA 4QY7A 4JV5L 4A3JH 1HZ9A 2EIFA 3OWEB 5IWAL 5KNBA 4DR2L 3H3VI 4H13C 4U68A 1ZEQX 2NVTB 2JEBI 4DU9A 1VQAA 1IHZA 2D2CC 2X69A 4DAVA 1IL8A 3CCVA 1TS5A 1FL0A 4LWCA 5E7NA 4IUQA 4PMCA 4QUFA 3D8GA 3WDNA 2F0DA 4YY3Q 3SK8A 4BWGB 3A54A 4DAPA 1SYFA 4R1JA 1EWHA 2SNMA 1BCPF 3I72A 3VR6A 1MI2A 4OX9L 4B3ML 3JAMi 5I9OA 2K5QA 5BR8Q 2PI2A 3K5LA 2ZXPA 3A8JE 5G3LD 5IP9G 1C4QA 3NE5B 2UU9Q 1A6XA 1TWHB 4H02A 5C5MA 1CM9A 2L1BA 5LMNQ 1B9NA 4GS3A 2Q8RE 1WYDA 4DV7L 4R4QA 3G7LA 4IZ8A 3CC2A 3MHBA 1EY9A 4Y52H 4K8IA 2EY5A 2NVTH 3E0EA 1N36L 1RF2D 1L2FA 4JI2L 4TQUS 3PO2H 2DJFC 4QL5A 3J81i 3K59A 3CPWA 3CPFA 1NE3A 1TWAB 4UDUC 4C2MH 1HRJA 1BXTA 1B3AA 1D6EC 1EIFA 5EAYA 3SR1A 2NN6G 4UY8C 1FGBD 2E2DC 3O13A 1TWGB 2I5LX 4C3HH 1M8AA 1YNND 3F1ZA 1MD2D 4YCUA 1SFOH 1RL2A 1IBLQ 4CBVA 1NY4A 4WJWA 1II3A 1Y1VH 3T1YL 1NJIC 2QILA 4KY7A 1FNWA 4A76A 5FLXc 1DOKA 2B2WC 3DLLA 1SE2A 1TWHH 2UUBQ 1MGSA 4ZUIA 4KJOA 4ZRZA 1B53A 2A74C 1E3PA 3PF5A 2F3WA 2PW5A 2XSCA 5C4ZA 4XYOA 1A3VA 2XNAC 3GTOB 2CWAA 1VDZA 2EYLA 3WWVA 1MHWC 3M4YA 3A5UA 3CXCA 5CV5A 1SYDA 5C4JB 4YY3L 4XQJA 1AP0A 2D0PA 3A56A 2UXBL 3PCOB 4IURA 1P16A 4KHPQ 3H94A 1N34Q 1SYEA 1E24A 4QUCA 1LLRD 4NXMQ 5IE8A 4HEDA 3S9WA 5BR8L 4R8IA 1VQ7A 2YU9B 4DNIA 5EGTA 1ML0D 2KUMA 2SDFA 1ZKOA 1Y14B 4XXEA 2DUDA 2QCPX 4A93B 5DM73 4ZCKA 5L37A 1EOTA 3RN2A 4A93G 4LF5Q 2UU9L 3AFPA 2K28A 5BN5A 4R8NA 1BOSA 3FPPA 4WFN3 4JG2A 4Y7NB 5LMNL 2OQ0A 4A3FH 1CZGA 1DGSA 2F3VA 4HAEA 3SK4A 1PFSA 3LNNA 4BA1I 2K33A 2KJXA 4PG3A 2EY2A 4GNXB 1HNXQ 3I91A 1CKNA 2B2WA 4FXDA 4L5QA 1PH3A 2LMCB 4OWWB 2CW0D 2EYJA 3EQLC 1HTPA 5C4JH 1IKMA 1AFPA 1JWUD 4YIJA 1QVGA 5K36G 1T9HA 2PZTA 4QJFA 3UI2A 4FVMA 3VDYA 2ASBA 4XDXA 2LFNA 1IBLL 4DN4M 1Q8KA 3GTPB 2VQFQ 3BS1A 2GN5A 1DCZA 3SXHA 4YHHQ 5CBAE 3KOJA 3MVVA 1QZGA 4HTHA 3T16A 4OONA 1WTWA 4AYBB 2UUBL 1VF5C 4AYBG 3ZJYC 2CQOA 2Z8LA 2FFKB 4DUZQ 3MFGA 1TVXA 4BS9A 4C3IH 4IFDJ 4DAYA 2N55A 2XGTA 3U58A 1H9KA 4M1UB 1ICFB 1ESFA 2V1CC 1JWMD 2XWJB 4IQZA 1IBMQ 2DNCA 2PMZB 4A3CH 4QCLA 3NELA 3TP8A 5K36H 4KHPL 1B9MA 5E3FA 1U5KA 3MEHA 2AWOA 3CRKC 1Q86C 3JAML 2V4DA 3R2IA 3SEBA 4NXML 1JOOA 2A68D 2F0HA 3W5OA 3GTLB 3HKZE 2M00A 2NTTA 3GTPH 4DV3Q 2JN4A 4LFBQ 3I90A 1STAA 5IYCG 4LF5L 2L15A 4RKLA 3T56B 2E5LQ 1GKHA 2L9HA 4UP8A 2B3GA 2ZTCA 2NN6I 3CQZH 4ABNA 1EYGA 2JA6H 4KD3A 2KENA 4EQ5A 1MKHA 2I5MX 1HNXL 2L12A 2E76C 4LF9L 3QJYA 3GO5A 3J81L 3U4VA 2K01A 3HOXH 3DEOA 3R2TA 5C4HA 2K5WA 2NWGA 2MGSA 1V1OA 4A3KH 2PO4A 4PZ8A 2NVQH 2QKIC 2RSOA 4X66Q 1HR0Q 2ZTDA 5C0XJ 3S16B 1XX8A 2JJQA 2YTXA 1HZBA 5ELBA 3GTLH 2VQFL 1S3OA 4YHHL 1X6OA 3J7YW 3RD4A 2PCFB 2JK8A 2EDGA 3BYTB 1JICA 2MFIA 3PO3H 2B8FA 4B08A 1E0BA 3EIVA 1JE5A 5EPLA 4OWTB 3MC0B 4PV1C 4DUZL 1SNPA 4J8QA 2FXQA 5CYUA 2E2JH 3S17B 3F8TA 3J7AF 4XIGS 3AB9A 1XPOA 2ATWA 2VUMB 4C3JH 3PUVA 2VUMG 2LSSA 1EU3A 2F1MA 1JJ2A 4HCEA 1OO9B 1IBML 1NTGA 3I4LA 1WVLA 4JI8Q 3ND9A 3DMUA 2B63B 3NUCA 2R7DA 1H9SB 2B63G 1Q12A 4IJLA 3K7AH 4JCVE 1FYCA 3NQIA 5G3LF 4V190 3VYUA 3BDOA 1AEXA 3C1FA 4LFBL 4FXGC 3BJUA 2OF1A 4XTCS 1NSNS 1QNUA 1Y8OB 4JBWA 2J0TD 4X3UA 2ES2A 3URYA 1VQBA 1GM5A 2IY5B 2A6HC 4LUZA 5EJWA 1O80A 1K28A 3KF6B 1TQOA 2LY7A 1G291 1VQ6A 4LNQA 3JAME 1SR3A 1STEA 1KLUD 1C7YA 1A3TA 1SNDA 5M3FB 4IJHA 1XJVA 2VUMH 4RWSC 4EQPA 3BZDB 4E6IA 2RDHA 5M3FG 1E2WA 5GAHC 1VQPA 5I6YA 1QJOA 4DKAC 3IRBA 3DWPA 4O0AA 1LACA 1VQEA 1A0IA 2GVBA 5JAVA 1TT2A 4KKUA 5FLMG 3TDQA 1HR0L 1Z47A 1E7ZA 1VQ5A 3EJIA 4IN3A 1Z6HA 2R6GA 3M85A 5DNFA 1I4RA 5J3BA 4GLXA 3W1BA 1X56A 1JB7A 3I8ZA 3L7ZC 3K5MA 4YCWA 4X6AH 3RZDH 2HIVA 1HZAA 3J81E 1M1KC 1SMXA 5LL6X 3J80c 2EXZA 3J80L 1STNA 2F0JA 1F9RA 1HH2P 1SE8A 5EPKA 1EEID 2F52A 1AH9A 2ZT9C 2ZXOA 5JEAJ 4UPAA 5IGEA 2E8GA 5KIXA 4X64L 3ITPA 4A3MB 3MTSA 1GHJA 2WACA 1WTOA 4A3MG 5EKLA 2HCIA 3UDFA 5IIFA 2O4XA 3KDFA 4KI0A 1I50H 3U9SA 3PUZA 4IFDG 3QG1A 5IT9c 1UNSA 3R8BA 4FYDA 1K0SA 5FLMH 5IT9L 2F4IA 4BXXH 2UXCL 2A6EC 4JI8L 5KNCA 2EZVA 3DWQA 1F9PA 4POFA 4JI0Q 1GD7A 4A3GB 2MP1A 2RHQB 1IXRA 4A3GG 1TS4A 1D2BA 1GXDC 2AUJD 1UWVA 3OHXC 4DXFA 2F0WA 5I2XA 5IGDA 3BDLA 3I4MH 1UAPA 3MXNA 3S1MH 2K75A 1DOLA 5AJ3Q 3H3VH 3VYRA 4IOAA 1N32L 1WFQA 1CHQD 2VB3X 1Y8PB 2IW3A 1I4QA 1QB5D 5IGFA 2K50A 2K52A 4JI7Q 3DM1A 2OEOA 3M4OB 4EVOA 3GQBA 1V1PB 1EFID 1E2VA 4CKBA 2B2TC 3DM3A 4DR6Q 4IFDH 3RLOA 3RZOH 3PUWA 3GV3A 1VQGA 2FJ2A 3AMUA 4IUTA 3K57A 3S2HH 4DV4Q 1QWYA 3ZYYX 4MHEA 4FO2A 4KHZA 4GOPC 4JPBW 4CJ1B 2NVXH 4NMZA 1FJGL 4DR4Q 5T1IA 4GKJQ 4A3GH 3W3AA 2OTLA 2ZJRA 3EROA 1JB3A 1PXUA 3L3OC 2G9DA 4CDCC 5A2QL 3CCSA 1V9PA 4A3LG 3LWEA 5C0XG 5E4XA 3A5ZB 4IPGA 1AN8A 2RA4A 4WRDA 1JJGA 1UE5A 2HIXA 1EWCA 1PZJD 2YYZA 5IYBG 3GTMB 3H3VC 2KCNA 3KFUA 4NPSA 4A3IB 2B2UC 2PNHA 1X9NA 2F0QA 4A3IG 5A35A 4JOIC 4HJ7A 2N3SA 1N9WA 2F0MA 3F2BA 2VXWA 1Q7YC 1SMYC 1N33Q 3NBHB 3CAMA 1K8GA 2QGQA 2Q8IB 4PMWA 2MO0A 4F7XA 4ZKBB 3P7JA 1SNOA 3J80E 5KYIA 4Z9CB 1O7ZA 4DV7Q 4JI0L 4KY5A 4S3SA 3HEJA 3BZKA 2R61A 1VQIA 1NNXA 2B2TA 2L55A 1UE6A 3H6MA 3L0OA 4DNRB 3H0GH 4B3TQ 2Q2HA 1HHVA 4A3LH 2OQKA 5KNDA 5FO9B 1F2MA 5M5WB 4BBRH 2Z1CA 1PH5A 5C4XB 2F0IA 2XRQD 5IT9E 1RKNA 1QVFA 1KRTA 5AJ3L 5C4XG 3OMGA 3CCQA 3KLSA 2KBNA 4JW0A 1U4LA 3CCJA 4IO9A 5AFWA 1O7LA 2E2IB 4JI7L 1EIYB 3T1YQ 3EN2A 2KECA 1PZID 2MJ8A 1PH1A 1L1OC 1TU2B 2F0PA 1PRTC 2R3ZA 1BKBA 4K5VA 4ODGA 2CHBD 2RVLA 4KJNA 4H44C 3L9AX 1O7IA 4DV4L 5J1ZA 1B4OA 1X3FA 2EYMA 2I07B 4NXNQ 4DR4L 1ENFA 2B2UA 4IUVA 4GKJL 5LMUL 4O2DA 4DUYQ 3I56A 3S24A 4JOIA 2CCZA 1EQVA 1R4PB 2RKSA 3E6ZX 1I4GA 2XRSD 2EYFA 4KN7C 4IFDI 2WKCA 1WCMB 2K4KA 5IY0A 5M5WH 4P75A 1BBWA 1WCMG 3ICEA 3CCEA 1PMRA 2YV5A 2UXBQ 1YNXA 3PGZA 1PYWD 2BOSA 1Q46A 1SJED 2FHTA 1J6QA 4N9PA 2B2VC 3S1RH 2E2IH 1HCZA 1DOMA 3UE0A 4KY6A 4LF7Q 3V05A 1NCVA 5M5YB 4LFCQ 5JEAG 5A2QE 1RCVD 2HQEA 1N33L 3K80C 1GUSA 1PV4A 5CORA 2WAQE 1UE7A 2HUGA 2WV6D 1GHKA 2HT1A 2PI2E 4G7HC 3I73A 3PIOA 3AEVA 5JJKA 1SEBD 3P20A 1WTRA 1CA5A 2Q2UA 2OTJA 1LTRD 3CCLA 4H7BA 4HJAA 3T53B 2KCCA 1QVCA 1L1OA 1L0XB 4B3TL 2BH2A 3PV0A 1G8ZD 3NHHA 1I4HA 2N78A 3M7NA 3HKZB 1WCMH 1LO5D 3NWTA 2JE6I 3HKZG 1ICWA 3H15A 1JORA 1PTOD 3TRZA 1Q1EA 3D4RA 3MXPA 2XWBB 4FNFA 4ILWA 1W6KA 3C3LA 1BCPC 3NTHA 2Z0SA 1H9MA 3KLSX 4KKSA 4JI6L 1EFWA 3SGIA 4EX5A 5IP9H 2BE5C 2K05A 4B9XA 3OTOL 1KIXA 1I6VC 3NBIA 5M5YH 5C0XI 1T5XD 4PZ6A 3D6WA 3NTIA 2ZTEA 5FLXL 2IX3A 2F0SA 2RCFA 1XWEA 3V2TA 2FMCA 4NXNL 5JOBA 2B2VA 5JVG3 4DUYL 4GZYC 3FMCA 1A2TA 2CWPA 4L63B 3PIP3 1I4XA 2B2YC 2JA8B 4UHVA 5D3DA 3AFQA 1TWAH 1XTCD 2JA8G 4V0BA 4C1NK 4PQXA 2NN6H 2A69C 3N52A 1LYLA 2KCTA 1GOZA 3S1QB 5M3MB 3KF8A 1TWGH 1I3QB 2O5IC 1S4ZA 2H4OA 3M9BA 5C3XA 4AIMA 3S2DB 2MUYA 3A7AB 3OIPA 1YEZA 2N88A 5ELOA 4R4OA 3D3RA 4LF7L 2XN9C 2ENBA 2HD3A 4LFCL 1CSPA 2O5JC 1JCKB 2K14A 1VQHA 2ZXRA 3T1HQ 1VQDA 4UP9A 2PZWA 3NK9A 3MFYA 2HDMA 1F2LA 2NVYB 2K1BA 3IAYA 1S72A 3E9IA 1LTID 1XXGA 3OYYA 1KD1C 3D4WA 1WD1A 4BY1B 4FF3A 3VR3A 4A3BB 3GTOH 5FO7B 4BY1G 1VQNA 4LF9Q 4K2KA 1IL2A 4P72A 1ZYRD 4IALA 4P71A 3CCUA 1KL9A 3GTJB 4G7OC 4LMQD 3TS0A 1MJCA 2F0NA 1TKWB 4JI1L 1SNCA 5GROA 1JWSD 2R92B 5CV9A 4DR3Q 2R92G 2E74C 4LF4Q 2YU9H 1TWFB 3S2DH 4GKKQ 1YITA 2B2YA 1K8AC 3G6JB 1CKMA 1PH8A 3LWUA 4A93H 1SNQA 3NTKA 1SMYD 1YJWA 2ID0A 1IYJB 1S5CD 4IUPA 4Q0FA 1BNZA 5JPNC 3J80i 1V1QA 5CC4A 2NVYH 1HNWL 3W1GA 4Y7NH 3Q22A 1UEAB 4N8FA 2DNEA 3TMEA 3I7FA 3TBIB 1U4MA 3FEWX 5CR3A 4BY1H 3TSSA 3CC7A 1D1IA 5C44B 5IYDG 5C44G 1FGUA 2AQ2B 3U50C 5FLXE 2JEAI 5EQ0A 1EY8A 2AQ1B 2EQSA 2IHEA 1XPUA 5M5XB 4R4TA 1SE4A 4XT1B 5KRUA 5HY6A 3FKIB 1TY2A 1X3QA 3FKIG 2C35B 2J4XA 4L5TA 5ELCA 4RGMA 2WB1E 1O7YA 3TZUA 1W2BA 1X54A 4M8AA 1KABA 1UUPA 2ZJQA 1E1OA 3T1HL 5D65A 1Q90A 4DV5L 5HGQA 3I4NB 1IW7C 1PH4A 1WOCA 1NUCA 2KCMA 3I4NG 3DEPA 3HOWB 1LTBD 1ENAA 2F0TA 1LTSD 1VQMA 3HOWG 4B3RL 1VCIA 1HQRD 1BUVT 1C8CA 1F2YA 1AZPA 1A63A 1MBYA 3M4PA 4GNXC 1QNKA 3KDFB 3HP3A 2K5VA 4JYAQ 1EQTA 4K6LA 5C3WA 1X32A 3Q23A 2ALYB 4CKCA 2LS01 3KJPA 1YBYA 4DR3L 4KHVA 1OXXK 2WIIB 4LF4L 4LK1C 1LTAD 3CF5A 4C1NI 3KUPA 4I7AA 4GKKL 1LT4D 5IYCH 1Z9FA 2YTVA 5LL6S 4P73A 2Z9HA 1HFNA 1NR2A 2SNSA 2Z4IA 4HJ8A 2RSNA 1H9JA 2HHHQ 4K5WA 4XQNA 5GQOA 4TVAB 4RMFA 1XTDA 4X3KA 1SYCA 2K32A 5JPMC 4X64Q 2NYZD 2RCNA 1K9MC 1SYGA 3GTGB 1STBA 5ELNA 1NR4A 5EKKA 1PTOB 3HOYB 3K5OA 2XIWA 3HS0C 3HOYG 2UUCQ 1PZKD 3E0JA 1MJEA 5IOCA 1Q3LA 2F3IA 2MHVA 5D14A 3ULPA 1BVSA 2C9OA 2UXCQ 4OIJA 2NBFA 1EZ8A 2BDOA 3S16H 3D31A 3F2UA 4OXPA 4ZK9B 3NSWA 2Q2IA 4AH6A 4C56C 2K04A 4CJ0B 2KHIA 1A3UA 3GTQB 3GDEA 2F0GA 1GUOA 4DK3C 5GAEC 1ET6A 2NB0A 1VQLA 4PMBA 3A55A 4DV2Q 2XVSA 4N9TA 2VY3A 1WJJA 5C3EB 4IUNA 3NWSA 1DZ1A 3H09A 3HOVB 5C3EG 1W3SA 2NTSA 3HOVG 3S14B 1N32Q 1HA5A 2M2LA 1PDQA 3K0YA 4L5RC 3S17H 4QQBX 3VR5A 1HJPA 4R4CA 4NDXA 4DV6Q 4DNTB 4DV0Q 4QF4A 3HOZB 1ONLA 1YVCA 4TRDA 4JYAL 1SE3A 3NXWA 3HOZG 2KEDA 1RD9D 1ILPA 3BG3A 3RMHA 1LM0A 2MO1A 4B3SL 4K2LA 2PQAB 1FJGQ 3RNUA 4BBSB 2B63H 1SLJA 4HMIA 3UDXA 3VR2A 4ZYSA 1AZQA 2L5TA 3ND8A 4ZLTF 4K8JA 4H0LC 2KEEA 3KBXA 1AE3A 1F2ZA 1KAAA 5BN4A 5EPJA 3OSOA
chains in the Genus database with same CATH topology
3PMFA 4ME5A 1K8MA 3EA6A 3X3MA 1EYDA 4ULLA 4LJZC 2I46A 2R7ZB 3W2DA 3N6RA 2F03A 2GA4B 5F2DA 3FRPB 2KA7A 4KN4C 2BA0A 2PW7A 3Q0AA 1WTQA 1CQFA 1SNMA 1DONA 1DD2A 1R4QB 1L0YB 3WOEA 1QILA 2L11A 5IGCA 1STHA 4R9WA 2EJGC 4A3EB 2Z4HA 3BVMA 4JK1C 4OGQC 1JC7A 2IPKD 1CA6A 1SJHD 3BVZA 1Y1WB 4QB4A 1TY0A 1BQQT 2CQAA 4PNYA 2WAQB 2EYOA 3CHBD 1QE6A 4RAUC 5FK9C 5DAUA 5HURA 4DK0A 4UAIA 5CGKA 1OXSC 4CKEA 4J6HA 2Q8TA 4OO1G 3S15B 3FPUB 5TSSA 4RHSA 1ESRA 4KMUC 3A8IE 1EY0A 2H1EA 1H9RA 2CVRA 3VYSA 1R9TB 2IX0A 3EFXD 3E5SA 1SBBB 3M7GA 1GUTA 4RGOS 2EVBA 2G9HD 1BO0A 1B50A 3HG9A 2IL8A 3V96A 1Y8NB 3MXUA 2X6LA 4DF7A 4DA2A 4NKLA 5CV7A 4A3DB 2QF7A 1Q1BA 3VA5A 1IYVA 4HR7B 3R93A 3MXGA 1CZWA 1U4PA 3A7LA 2JA7B 3HOUB 3X3NA 3CRLC 2B39A 3FDTA 2OXPA 5FOBB 1PFBA 1XYIA 5COYA 5C0XH 1G6ZA 2M9VA 3T51B 4KTAA 1JE4A 2EYHA 4A3JB 2VNUD 3BYYB 2NZ1D 4KKTA 1JOQA 5IODA 2KOLA 1CK1A 1O78A 2RDFA 1HQMC 3S1NB 2EJFC 2A68C 3DXJC 2L4NA 1WD0A 1HTLD 3NP8A 4U673 2F0FA 3PUXA 1U9RA 4G7ZC 2LKVA 4CJ2C 2A6HD 2RQXA 1DYQA 1B44D 1S5FD 1G2TA 1HUMA 3IFTA 3KK7A 5DEHA 3T13A 5J39A 1V8QA 3HGBA 3PO2B 1KNEA 5E4WC 5BN3A 1D5XC 2EE1A 1D5ZC 1IKLA 4C2MB 1LTTD 2MPMA 2QEJC 5ELDA 1EIHA 4ZQ3A 1JQYD 1JOKA 4RGNA 4C3HB 4DGZA 3I70A 4OL7A 4C3HG 1SFOB 2HCCA 5I2YA 1PLFA 1Y1VB 1V1PA 4L8JA 4FP5D 1K83B 4CHTB 1TIID 2WB1B 2RDGA 3OPOA 4RA8A 4OO1I 5EKIA 5D3IB 2IT1A 2FINB 1WTPA 3K6OA 4WORA 2JSOA 2K7VA 3P1HA 3BVGA 5JEAH 1LTGD 4EGVA 5C6AA 1YNJC 2A6ED 1T5EA 5CV8A 5ELFA 1SSOA 2JP1A 2E75C 3SDZA 3QOLA 4RGTA 2VB2X 1LABA 3TN2A 2WKDA 1D5MC 1NAPA 3NBHA 4A3FB 1EYAA 1EZ6A 1W6JA 5KEEA 1STGA 1KDBA 1GJXA 4BA2I 1EL0A 3OOCA 1FNUA 2OT2A 1QCBD 2X6GA 3P75A 3SE0A 3GD7A 3TZDA 3ERQA 3Q6SA 1RHPA 3I3CA 3DUZA 2HDLA 4RHRA 1DXMA 4I65A 1I6HB 4KK7A 1WTVA 5JJZA 2KHSA 3HRZC 1MSHA 1Q8IA 4C3IB 1CI3M 1CT1D 5I6WA 4C3IG 3IFDA 1SAPA 2F0EA 3A8KE 1BDOA 4L6TB 1DJRD 2B8GA 3HZXA 4I7ZC 1LT3D 3SK6A 4HSVA 2IJ0A 2WP8J 4XT3B 3GP7A 1KDAA 2A73B 3DHQA 5CMDA 4RKBA 2JA5B 1KDCA 3WOFA 2E2HB 3CQZB 2F0LA 2TSSA 4K5XA 5I4DA 3IKJA 2JA6B 2ICIA 1HA6A 3RUZA 3VR4A 3HOXB 3C2PA 1PRTD 2KVMA 2SEBD 1TS2A 4F87A 5NUCA 4A3KB 2RBMA 2NVQB 3IL8A 3KLRA 5DM63 4FXKC 4OHJA 4FF1A 1FR3A 1HXYD 1GUGA 4O42A 3VYTA 1VMCA 1G91A 3PO3B 2EJMA 1Y69U 2F0KA 3PIO3 4J1MA 2E2JB 3DWAA 3NPPA 3J7AV 3C46A 4C3JB 2L0CA 4C3JG 2IWHA 1PFMA 3M3YB 3OIQA 4KV6A 5KYLA 1GUNA 2BDNA 1SYBA 3ONAB 4BY7B 1LV9A 2PNRC 2PZUA 1SDFA 3SK5A 1CHPD 2DY7A 1D1KA 3LX0A 3K7AB 5FKAC 2EYPA 4XQQA 4F88A 3PUYA 2JXMB 1CFMA 3QO2A 1V43A 3K5NA 4NW2A 4FF4A 4LAAA 1F9QA 1JR0D 1BCPD 3QOJA 1S5DD 1EY7A 4XYQA 1KTKA 1TS3A 1E2ZA 2BE5D 2Y0SB 3C1EA 1KLGD 1RTNA 1MSGA 3QWNA 1I4PA 4G4KA 1YNJD 4OIKA 3U9OA 5ELEA 1Z7TA 1B2TA 3MWYW 3CKIB 1CQVA 1LT5D 1FNVA 3EVQA 4HSPA 2EY1A 2JYOA 3RZDB 1F77A 2K5DA 2AQ3B 1LT6D 1PTOH 4X3SA 1PTOF 2PPBC 4HN7A 1QOHA 3D6CA 5LHY1 1EY5A 3MZ5A 1X3PA 2A69D 1HFGA 5EBDA 4IUUA 1TR5A 1C48A 3RLFA 4MIUA 3KBGA 3BDCA 4ZUJA 2O2LD 2DN8A 3H91A 1I50B 1BBXC 3Q24A 2FMMA 4ZKCB 1J9OA 3QIAA 4QIWB 1TWCB 1EU4A 2D5DA 1ZXTA 4G57A 1J8IA 1DM0B 5M9OA 3GTKB 1SXTA 1VMPA 3NQTA 2R93B 4NP5A 4Q5VA 1PTOC 3I4MB 1K8OA 3S1MB 1OXTA 1QG7A 2C5CA 5C5LA 5IGBA 1HPCA 2BA1A 2TMPA 1YNNC 4TSSA 4HCSA 3OW7A 1M4VA 2K03A 3GV6A 1S5BD 2IX1A 3RZOB 1RODA 3S2HB 5HGTA 2NVXB 1HUNA 2D9UA 3SVMA 4FF2A 5CV4A 2AUKA 5T1GA 3K58A 1ILQA 4EQNA 2PYKA 2J7ZA 1RDPD 4X3TA 3AU7A 1WTXA 1AW7A 2ICEC 1RJTA 1EIGA 2F0OA 3MA2B 5E1FA 1G2SA 4K14A 4DK1A 4QMGA 4RFBA 4B9WA 1A15A 1ENCA 3OWFA 1PRTB 1FD7D 4EQOA 3CU7A 1OXVA 3T4AC 4ZAIA 4MN3A 5I9PA 1EY6A 1IW7D 1B1ZA 4HMJA 1IYUA 4ID6A 5CBEE 5FO8B 1H9SA 4DXGA 3H0GB 1U4RA 1VF7A 5JVH3 2CW0C 1EY4A 1ZYRC 5J22A 5K5PA 2F0UA 4BBRB 2NUCA 5EBCA 3MAQA 4OO1H 2F0VA 3SHLA 1EEFD 3TP7A 3VA7A 2QDBA 3FVQA 5ISRA 2KQ3A 2WINB 3TP6A 1GUWA 2DY8A 2A5HA 4RH6A 5IGGA 1BF4A 4RCNA 1PFNA 1CTMA 1PRTF 3R3OA 1F9SA 1EYCA 4DFAA 1OXUA 3QB3A 3TP5A 2PQEA 1A2UA 1KNAA 4CGYB 1STYA 2EY6A 2AWNA 1ET9A 2BCOA 3D4DA 2EOTA 4KD4A 1BCPB 3OMCA 4O1NA 2EPBA 4RCOA 1S5ED 4K6DA 4P2CB 5CV6A 2K6AA 3S1RB 2SOBA 1RTOA 2D62A 4TKOB 4F8MA 1BR9A 5KGUA 3OWEB 5KNBA 4H13C 4U68A 1ZEQX 2NVTB 2JEBI 4DU9A 2D2CC 1IHZA 2X69A 4DAVA 1IL8A 1TS5A 4IUQA 4PMCA 4QUFA 3D8GA 3WDNA 2F0DA 3SK8A 4BWGB 3A54A 4DAPA 1SYFA 1EWHA 2SNMA 1BCPF 3I72A 3VR6A 1MI2A 5I9OA 2K5QA 3K5LA 2ZXPA 3A8JE 5G3LD 1C4QA 3NE5B 1A6XA 1TWHB 5C5MA 1CM9A 2L1BA 1B9NA 2Q8RE 3G7LA 4IZ8A 3MHBA 1EY9A 4K8IA 2EY5A 1RF2D 4TQUS 3K59A 1TWAB 4UDUC 1HRJA 1BXTA 1B3AA 1D6EC 3SR1A 2NN6G 1FGBD 2E2DC 3O13A 1TWGB 1M8AA 1YNND 1MD2D 4CBVA 4WJWA 1II3A 2QILA 4KY7A 1FNWA 1DOKA 2B2WC 1SE2A 1MGSA 4ZUIA 4KJOA 4ZRZA 1B53A 2A74C 2F3WA 2PW5A 2XSCA 5C4ZA 4XYOA 1A3VA 2XNAC 3GTOB 1VDZA 2EYLA 3M4YA 5CV5A 1SYDA 5C4JB 4XQJA 1AP0A 3A56A 4IURA 3H94A 1SYEA 4QUCA 1LLRD 4HEDA 3S9WA 2YU9B 4R8IA 5EGTA 1ML0D 2KUMA 2SDFA 1ZKOA 4XXEA 2QCPX 4A93B 5DM73 1EOTA 2K28A 5BN5A 4R8NA 1BOSA 3FPPA 4WFN3 4Y7NB 1CZGA 2F3VA 4HAEA 3SK4A 3LNNA 4BA1I 2K33A 2KJXA 2EY2A 3I91A 2B2WA 4FXDA 2LMCB 2CW0D 2EYJA 3EQLC 1HTPA 1IKMA 1AFPA 1JWUD 4YIJA 5K36G 2PZTA 3UI2A 4FVMA 4XDXA 2LFNA 4DN4M 3GTPB 3BS1A 1DCZA 3SXHA 5CBAE 3MVVA 4HTHA 3T16A 1WTWA 4AYBB 1VF5C 2Z8LA 2FFKB 3MFGA 1TVXA 4BS9A 4IFDJ 4DAYA 2N55A 1H9KA 4M1UB 1ESFA 1JWMD 2XWJB 4IQZA 2DNCA 2PMZB 4QCLA 3TP8A 5K36H 1B9MA 5E3FA 3MEHA 2AWOA 3CRKC 3JAML 2V4DA 3R2IA 3SEBA 1JOOA 2A68D 2F0HA 3GTLB 2M00A 2NTTA 3I90A 1STAA 4RKLA 3T56B 2L9HA 2NN6I 4ABNA 4KD3A 2L12A 2E76C 3QJYA 3GO5A 3J81L 2K01A 3DEOA 3R2TA 5C4HA 2K5WA 2NWGA 2MGSA 1V1OA 2PO4A 2QKIC 2RSOA 5C0XJ 3S16B 1XX8A 5ELBA 3J7YW 3RD4A 2PCFB 2EDGA 3BYTB 1JICA 2B8FA 4B08A 1E0BA 5EPLA 3MC0B 4PV1C 1SNPA 4J8QA 5CYUA 3S17B 3J7AF 4XIGS 3AB9A 2VUMB 3PUVA 1EU3A 2F1MA 4HCEA 1OO9B 3I4LA 1WVLA 3ND9A 3DMUA 2B63B 3NUCA 1H9SB 1Q12A 5G3LF 4V190 1FYCA 3NQIA 3VYUA 3BDOA 1AEXA 3C1FA 4FXGC 2OF1A 4XTCS 1NSNS 1QNUA 1Y8OB 4JBWA 2J0TD 4X3UA 3URYA 2A6HC 5EJWA 1O80A 1TQOA 2LY7A 1G291 3JAME 1STEA 1KLUD 1A3TA 1SNDA 5M3FB 4RWSC 4EQPA 3BZDB 4E6IA 2RDHA 1E2WA 5I6YA 1QJOA 3DWPA 1LACA 5JAVA 1TT2A 4KKUA 3TDQA 1Z47A 3EJIA 4IN3A 1Z6HA 2R6GA 3M85A 5DNFA 1I4RA 3I8ZA 3L7ZC 3K5MA 3J81E 5LL6X 2EXZA 3J80L 1STNA 2F0JA 1F9RA 5EPKA 1EEID 2ZT9C 2ZXOA 5JEAJ 5IGEA 5KIXA 3ITPA 4A3MB 3MTSA 1GHJA 2WACA 1WTOA 5EKLA 2HCIA 5IIFA 2O4XA 4KI0A 4IFDG 3U9SA 3PUZA 3QG1A 1UNSA 3R8BA 4FYDA 5IT9L 2F4IA 2A6EC 5KNCA 2EZVA 3DWQA 1F9PA 4A3GB 2MP1A 1TS4A 1D2BA 1GXDC 2AUJD 3OHXC 4DXFA 2F0WA 5I2XA 5IGDA 3BDLA 1UAPA 3MXNA 1DOLA 3VYRA 1CHQD 2VB3X 1Y8PB 2IW3A 1I4QA 5IGFA 1QB5D 3DM1A 2OEOA 3M4OB 4EVOA 3GQBA 1V1PB 1EFID 1E2VA 4CKBA 2B2TC 4IFDH 3PUWA 3GV3A 2FJ2A 3AMUA 4IUTA 3K57A 1QWYA 3ZYYX 4MHEA 4FO2A 4KHZA 4CJ1B 4NMZA 5T1IA 3W3AA 3EROA 1JB3A 1PXUA 3L3OC 2G9DA 5A2QL 3LWEA 5C0XG 5E4XA 1AN8A 2RA4A 4WRDA 1EWCA 1PZJD 2YYZA 3GTMB 3H3VC 2KCNA 4A3IB 2B2UC 2F0QA 5A35A 2F0MA 2VXWA 1SMYC 2Q8IB 4PMWA 4F7XA 4ZKBB 3P7JA 1SNOA 3J80E 5KYIA 4Z9CB 1O7ZA 4KY5A 4S3SA 3HEJA 2R61A 2B2TA 2L55A 3H6MA 4DNRB 1HHVA 5KNDA 5FO9B 1F2MA 5M5WB 2Z1CA 5C4XB 2F0IA 2XRQD 5IT9E 1RKNA 3OMGA 3KLSA 1U4LA 5AFWA 1O7LA 2E2IB 2KECA 1PZID 2MJ8A 2F0PA 1TU2B 2R3ZA 1PRTC 4K5VA 4ODGA 2CHBD 2RVLA 4KJNA 4H44C 3L9AX 5J1ZA 1B4OA 2EYMA 2I07B 1ENFA 2B2UA 4IUVA 1EQVA 1R4PB 2RKSA 3E6ZX 1I4GA 2XRSD 2EYFA 4KN7C 4IFDI 2WKCA 1WCMB 1PMRA 1PYWD 2BOSA 1SJED 2FHTA 4N9PA 2B2VC 1HCZA 1DOMA 4KY6A 3V05A 1NCVA 5M5YB 5JEAG 5A2QE 1RCVD 2HQEA 1GUSA 5CORA 2HUGA 2WV6D 1GHKA 4G7HC 3I73A 1SEBD 3P20A 1WTRA 1CA5A 1LTRD 4H7BA 3T53B 2KCCA 1L0XB 3PV0A 1G8ZD 3NHHA 1I4HA 3M7NA 3HKZB 1LO5D 3NWTA 2JE6I 1ICWA 1JORA 1PTOD 1Q1EA 3D4RA 3MXPA 2XWBB 4FNFA 4ILWA 1W6KA 3C3LA 1BCPC 3NTHA 1H9MA 3KLSX 4KKSA 2BE5C 2K05A 4B9XA 1I6VC 3NBIA 5C0XI 1T5XD 3D6WA 3NTIA 5FLXL 2IX3A 2F0SA 1XWEA 3V2TA 2FMCA 5JOBA 2B2VA 5JVG3 4GZYC 3FMCA 1A2TA 4L63B 3PIP3 1I4XA 2B2YC 2JA8B 5D3DA 1XTCD 4V0BA 4C1NK 4PQXA 2NN6H 2A69C 3N52A 1GOZA 3S1QB 5M3MB 3KF8A 1I3QB 2O5IC 1S4ZA 2H4OA 5C3XA 3S2DB 2MUYA 3A7AB 3OIPA 2N88A 3D3RA 2XN9C 2ENBA 2O5JC 1JCKB 2ZXRA 2PZWA 3NK9A 3MFYA 2HDMA 1F2LA 2NVYB 2K1BA 3IAYA 1LTID 1XXGA 3D4WA 1WD1A 4BY1B 4FF3A 3VR3A 4A3BB 5FO7B 4K2KA 1ZYRD 4IALA 3GTJB 4G7OC 4LMQD 2F0NA 1TKWB 1SNCA 1JWSD 2R92B 5CV9A 2E74C 1TWFB 2B2YA 3G6JB 3LWUA 1SNQA 3NTKA 1SMYD 2ID0A 1S5CD 4IUPA 4Q0FA 1BNZA 5JPNC 5CC4A 3Q22A 1UEAB 2DNEA 3TMEA 3TBIB 1U4MA 3FEWX 5CR3A 3TSSA 1D1IA 5C44B 2AQ2B 5FLXE 2JEAI 5EQ0A 1EY8A 2AQ1B 5M5XB 1SE4A 4XT1B 5KRUA 3FKIB 1TY2A 1X3QA 2J4XA 5ELCA 4RGMA 1O7YA 3TZUA 4M8AA 1KABA 1UUPA 5D65A 1Q90A 3I4NB 1IW7C 1NUCA 3DEPA 3HOWB 1LTBD 1ENAA 2F0TA 1LTSD 1VCIA 1HQRD 1BUVT 1C8CA 1F2YA 1AZPA 1MBYA 1QNKA 3HP3A 1EQTA 4K6LA 5C3WA 1X32A 3Q23A 4CKCA 2LS01 4KHVA 1OXXK 2WIIB 4LK1C 1LTAD 4C1NI 3KUPA 1LT4D 5LL6S 1HFNA 1NR2A 2SNSA 2Z4IA 2RSNA 1H9JA 4K5WA 4XQNA 4X3KA 1SYCA 2K32A 5JPMC 2NYZD 1SYGA 3GTGB 1STBA 1NR4A 5EKKA 1PTOB 3HOYB 3K5OA 2XIWA 3HS0C 1PZKD 3E0JA 5IOCA 1Q3LA 2MHVA 5D14A 2C9OA 4OIJA 2NBFA 1EZ8A 2BDOA 3D31A 3F2UA 4ZK9B 3NSWA 4C56C 2K04A 4CJ0B 1A3UA 3GTQB 2F0GA 1GUOA 1ET6A 2NB0A 4PMBA 3A55A 2XVSA 4N9TA 5C3EB 4IUNA 3NWSA 1DZ1A 3H09A 3HOVB 2NTSA 3S14B 1HA5A 2M2LA 1PDQA 3K0YA 3VR5A 4NDXA 4DNTB 4QF4A 3HOZB 1ONLA 4TRDA 1SE3A 3NXWA 2KEDA 1RD9D 1ILPA 3BG3A 3RMHA 4K2LA 4BBSB 4HMIA 3VR2A 4ZYSA 1AZQA 2L5TA 3ND8A 4ZLTF 4K8JA 4H0LC 2KEEA 3KBXA 1F2ZA 1KAAA 5BN4A 5EPJA 3OSOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RGO S;  1F77 A;  1SE2 A;  1UNS A;  1JWS D;  2AQ3 B;  3R8B A;  2G9H D;  1AW7 A;  1LT6 D;  2R61 A;  1PTO H;  1LT4 D;  3EA6 A;  1HXY D;  1LO5 D;  1PTO F;  1D5X C;  1EU3 A;  1PTO D;  1D5Z C;  3DWQ A;  3W2D A;  1LTT D;  4RFB A;  2QEJ C;  5ELD A;  1ESF A;  1PRT B;  1FD7 D;  1BCP C;  1JQY D;  1JWM D;  1TS4 A;  4RGN A;  3KLS X;  2XNA C;  3OWE B;  2XRQ D;  4DXF A;  1S5C D;  2O2L D;  4RHR A;  3DWA A;  1V1P A;  1T5X D;  1B1Z A;  3R2I A;  3SEB A;  1L0Y B;  1TS5 A;  1PTO B;  1QIL A;  2NTT A;  1CT1 D;  1CHQ D;  1PZI D;  3URY A;  2RDG A;  1PRT C;  1PZK D;  4DXG A;  1EU4 A;  1I4Q A;  1LLR D;  2CHB D;  5D3I B;  3TSS A;  4BWG B;  1V1P B;  1EFI D;  1BCP F;  3BVM A;  1STE A;  4L6T B;  2AQ2 B;  1KLU D;  1ENF A;  1SXT A;  2IPK D;  1DJR D;  1CHP D;  4L63 B;  1SJH D;  1I4X A;  2AQ1 B;  1EEF D;  3BVZ A;  3BVG A;  3BYY B;  2RDH A;  3BZD B;  4C56 C;  5FKA C;  1SE4 A;  5D3D A;  1LTG D;  1PTO C;  1XTC D;  1LT3 D;  1TY0 A;  1TY2 A;  2IJ0 A;  1ET6 A;  1I4G A;  3DWP A;  2XRS D;  4RH6 A;  3GP7 A;  2J4X A;  1CK1 A;  5ELC A;  4RGM A;  1GOZ A;  3R2T A;  3CHB D;  1PRT F;  5ELF A;  5FK9 C;  4TSS A;  2NTS A;  1PYW D;  1UUP A;  1V1O A;  1M4V A;  1HA5 A;  1I4R A;  1SJE D;  1AN8 A;  1JR0 D;  1BCP D;  1S5B D;  2XN9 C;  1RF2 D;  1S5D D;  4RGT A;  1JWU D;  1KTK A;  2TSS A;  1LTB D;  1JCK B;  1EWC A;  1LTS D;  1PZJ D;  5ELB A;  1TS3 A;  5I4D A;  1D5M C;  1HTL D;  1HQR D;  2ICI A;  5TSS A;  3V05 A;  1SE3 A;  4RHS A;  1RD9 D;  4UDU C;  1RCV D;  1KLG D;  1BXT A;  1D6E C;  1EEI D;  1ET9 A;  1LTI D;  1XXG A;  3BYT B;  2WV6 D;  1I4P A;  1FGB D;  3EFX D;  3O13 A;  4K6L A;  1SBB B;  1PRT D;  1MD2 D;  3MC0 B;  5ELE A;  4ZYS A;  2SEB D;  1TS2 A;  1BCP B;  1CQV A;  1B44 D;  1DYQ A;  1S5F D;  4O1N A;  1SEB D;  4RCO A;  1S5E D;  1FNU A;  1LT5 D;  1LTR D;  1FNV A;  2QIL A;  1FNW A;  2Z8L A;  4OHJ A;  4Z9C B;  1L0X B;  1RDP D;  1LTA D;  1G8Z D;  3MFG A;  1I4H A; 
#chains in the Genus database with same CATH topology
 3PMF A;  4ME5 A;  1ASY A;  1K8M A;  3EA6 A;  2HHH L;  3X3M A;  4GN4 B;  1EYD A;  4ULL A;  4LJZ C;  2I46 A;  2R7Z B;  3W2D A;  2VQE L;  3N6R A;  2F03 A;  2R7Z G;  2GA4 B;  5F2D A;  4OWX B;  3FRP B;  2KA7 A;  3E3X A;  4KN4 C;  2BA0 A;  2PW7 A;  3Q0A A;  3HFZ B;  5M3F H;  1E1T A;  1WTQ A;  1U0L A;  1CQF A;  1SNM A;  1DON A;  1EUJ A;  1DD2 A;  1R4Q B;  2UUC L;  4YWK A;  1L0Y B;  3WOE A;  1QIL A;  2L11 A;  2CH4 W;  5IGC A;  1STH A;  4R9W A;  2EJG C;  4A3E B;  2Z4H A;  3BVM A;  4JK1 C;  4OGQ C;  1JC7 A;  4A3E G;  2IPK D;  1X65 A;  1CA6 A;  4DV2 L;  1SJH D;  4HJ5 A;  3BVZ A;  1Y1W B;  2D0O A;  4QB4 A;  3KYH C;  2VS1 A;  1TY0 A;  1Y1W G;  1BQQ T;  2CQA A;  4PNY A;  2WAQ B;  4IPH A;  2EYO A;  2WAQ G;  3CHB D;  1QE6 A;  4RAU C;  5FK9 C;  5DAU A;  5HUR A;  4A3M H;  4DV6 L;  4DK0 A;  4DV0 L;  4N8X 1;  4UAI A;  5CGK A;  4QGU A;  4ME3 A;  1EOV A;  5JJI A;  1OXS C;  4CKE A;  4J6H A;  2Q8T A;  1NBW A;  1J5E Q;  4OO1 G;  3S15 B;  2JQO A;  3FPU B;  5TSS A;  4IPD A;  4RHS A;  1ESR A;  4KMU C;  3A8I E;  5LMU Q;  1EY0 A;  2CH4 A;  2H1E A;  1H9R A;  2CVR A;  3VYS A;  1R9T B;  2IX0 A;  3EFX D;  3E5S A;  1SBB B;  3M7G A;  1GUT A;  1VS0 A;  4APV A;  1K3R A;  4FDB A;  1EQQ A;  4RGO S;  2EVB A;  3KLW A;  2G9H D;  1BO0 A;  1B50 A;  3HG9 A;  2VW9 A;  4CDF C;  4JC0 A;  2Y0S E;  2IL8 A;  3EBE A;  3V96 A;  1D8L A;  1Y8N B;  3M4O H;  2N8N A;  3MXU A;  2X6L A;  4DF7 A;  1NMG A;  4DA2 A;  4JI4 Q;  4NKL A;  5CV7 A;  4A3D B;  2QF7 A;  1Q1B A;  3VA5 A;  1IYV A;  1YJ9 A;  4HR7 B;  4A3D G;  3R93 A;  3MXG A;  3S15 H;  1CZW A;  1K0R A;  1U4P A;  3CP0 A;  2QEX A;  3A7L A;  3KF6 A;  2JA7 B;  5H1S E;  3HOU B;  1XPR A;  5IP7 G;  3X3N A;  5GAD C;  3CRL C;  2B39 A;  3FDT A;  3HOU G;  2OXP A;  5FOB B;  1PFB A;  1GVP A;  3F2D A;  4DV1 Q;  1R9T H;  1PYB A;  1XYI A;  5COY A;  5C0X H;  1G6Z A;  1A8V A;  2M9V A;  3PF4 A;  2IHF A;  3T51 B;  1VQF A;  3LGJ A;  4KTA A;  1JE4 A;  2NZH A;  4GOP A;  2EYH A;  2EXD A;  4A3J B;  2VNU D;  5IYB H;  4A3J G;  2RF4 A;  3BYY B;  3KF8 B;  2NZ1 D;  4KKT A;  2VZA A;  1PYS B;  3GTM H;  1JOQ A;  5IOD A;  4A3I H;  4JI6 Q;  3JC6 6;  2KOL A;  1PH9 A;  3OTO Q;  1CK1 A;  3UE1 A;  1O78 A;  2RDF A;  4QIW E;  4A3D H;  3STB C;  3F2C A;  1J5E L;  1HQM C;  1VQ4 A;  2QW7 A;  3S1N B;  5IP7 H;  4JI5 Q;  2EJF C;  2A68 C;  3DXJ C;  2A8V A;  2L4N A;  4HIO A;  1WD0 A;  1WTH A;  2A19 A;  3M4Q A;  2I0Q A;  1HTL D;  3AYH B;  1CKN B;  3NP8 A;  4U67 3;  3I2Z A;  1KRS A;  1BBU A;  1E22 A;  4KLK A;  2F0F A;  2HQL A;  2MQH A;  1YHB A;  4DR7 Q;  3PUX A;  1XNQ Q;  1U9R A;  1D7Q A;  4G7Z C;  2LKV A;  5C4X H;  4CJ2 C;  2A6H D;  2RQX A;  1DYQ A;  1B44 D;  1S5F D;  4AQY Q;  1G2T A;  1HUM A;  3IFT A;  3KK7 A;  4X65 Q;  5DEH A;  3T13 A;  5J39 A;  1V8Q A;  3HGB A;  3PSI A;  3PO2 B;  1S40 A;  1KNE A;  5E4W C;  5BN3 A;  3PO2 G;  1D5X C;  4JI4 L;  2EE1 A;  1D5Z C;  1IKL A;  3MEF A;  1LTT D;  4C2M B;  2MPM A;  2QEJ C;  5ELD A;  1EIH A;  4ZQ3 A;  4HIM A;  1JQY D;  1JOK A;  2NZO A;  3S1N H;  4RGN A;  4C3H B;  4DGZ A;  3I70 A;  4OL7 A;  4C3H G;  1SFO B;  2HCC A;  1QUQ A;  4LW1 A;  1QZH A;  5I2Y A;  1PLF A;  1Y1V B;  4DAY B;  3RN5 A;  1AE2 A;  1V1P A;  4L8J A;  3K0X A;  4DV1 L;  4FP5 D;  1Y1V G;  1K83 B;  4CHT B;  1TII D;  2WB1 B;  2WB1 G;  2RDG A;  3OPO A;  4RA8 A;  4JI1 Q;  4OO1 I;  5EKI A;  5D3I B;  2K5H A;  2IT1 A;  2FIN B;  1WTP A;  3K6O A;  4WOR A;  1X3G A;  1MIU A;  2JSO A;  3ERS X;  2K7V A;  4LFA Q;  3P1H A;  3BVG A;  5JEA H;  1LTG D;  1YJN A;  2DGY A;  2YTY A;  4DK6 C;  4EGV A;  5C6A A;  2LXJ A;  1HNW Q;  1YNJ C;  2A6E D;  1T5E A;  5CV8 A;  5ELF A;  4JI5 L;  3QR8 A;  1SSO A;  2JP1 A;  2UUA L;  1EWI A;  1UEB A;  1SRO A;  2ZM6 Q;  2E75 C;  4MZ9 A;  3SDZ A;  3QOL A;  4RGT A;  1K83 H;  2VB2 X;  1LAB A;  3TN2 A;  2WKD A;  1D5M C;  1NAP A;  3NBH A;  4DR7 L;  4YCV A;  4A3F B;  1XNQ L;  2LXK A;  4K0K Q;  1EYA A;  1EZ6 A;  1W6J A;  4A3F G;  3HKS A;  5KEE A;  1STG A;  1KDB A;  2R7F A;  4AQY L;  1GJX A;  5M3M G;  4X65 L;  4BA2 I;  1EL0 A;  3OOC A;  1FNU A;  1VQC A;  4HJ9 A;  2OT2 A;  3FP9 A;  4YWL A;  4WJ3 M;  1QCB D;  2X6G A;  3K81 C;  1NMF A;  1I94 Q;  3P75 A;  4DV5 Q;  3Q8D A;  3SE0 A;  3GD7 A;  3TZD A;  3ERQ A;  5DLQ E;  3Q6S A;  4B3R Q;  1XNR Q;  1HNZ Q;  4RG1 A;  1RHP A;  2N49 A;  3I3C A;  1X3E A;  2Z6K C;  3DUZ A;  4A3B G;  2HDL A;  1C0A A;  4RHR A;  1DXM A;  4I65 A;  2JA8 H;  1I6H B;  4KK7 A;  1WTV A;  2BH8 A;  5JJZ A;  5JJL A;  2KHS A;  3HRZ C;  1MSH A;  1Q8I A;  4DR5 Q;  4OEM B;  1CI3 M;  4C3I B;  3S1Q H;  1CT1 D;  5I6W A;  5M3M H;  3ER0 A;  4C3I G;  1I3Q H;  3IFD A;  1SAP A;  2F0E A;  1KQS A;  5FJ8 G;  3L2P A;  4LFA L;  1YIJ A;  3A8K E;  1BDO A;  3TEH B;  4L6T B;  4LF8 Q;  1DJR D;  2B8G A;  3HZX A;  4I7Z C;  4A3C G;  3U4Z A;  2KHJ A;  1LT3 D;  3SK6 A;  4HSV A;  2IJ0 A;  2WP8 J;  4XT3 B;  2UXD Q;  2WFW A;  4DR1 Q;  3GP7 A;  1KDA A;  2ZM6 L;  2A73 B;  3DHQ A;  4A3B H;  5CMD A;  4CDE C;  2VL6 A;  4RKB A;  2JA5 B;  2CFM A;  2JA5 G;  1OTC A;  1LUZ A;  1KDC A;  3GTJ H;  3WOF A;  2E2H B;  1I6H H;  3CQZ B;  2F0L A;  2TSS A;  4K0K L;  1WI5 A;  3OW2 A;  2R92 H;  4K5X A;  1B3Q A;  5I4D A;  3IKJ A;  2JA6 B;  2ICI A;  5GAG C;  3J81 j;  5LMN W;  4DAM A;  2JA6 G;  1HA6 A;  2OCE A;  2Z6K A;  5FJ8 H;  1TWF H;  3RUZ A;  1JMC A;  3VR4 A;  4ALP A;  4GN3 B;  3HOX B;  3C2P A;  3A74 A;  3HOX G;  3BZC A;  1PRT D;  4P74 A;  2KVM A;  2SEB D;  1TS2 A;  4F87 A;  1PA6 A;  5NUC A;  4A3K B;  2RBM A;  1I94 L;  3STB D;  2NVQ B;  4A3K G;  3JAM c;  1N34 L;  3IL8 A;  3KLR A;  5DM6 3;  4FXK C;  4OHJ A;  3TQY A;  4FF1 A;  1B7Y B;  1XNR L;  1HNZ L;  1FR3 A;  4POG A;  1HXY D;  1C9O A;  4JI3 Q;  1GUG A;  4O42 A;  3VYT A;  1VMC A;  5IYD H;  2JA5 H;  1G91 A;  5C44 H;  1KXL A;  4GLA C;  3PO3 B;  2EJM A;  1SN8 A;  2E2H H;  3PO3 G;  1H95 A;  1Y69 U;  4B3S Q;  2F0K A;  3PIO 3;  4DR5 L;  4J1M A;  5M5X H;  1IBK Q;  2E2J B;  2RHS B;  3DWA A;  1VQ9 A;  3NPP A;  3J7A V;  3FKI H;  3C46 A;  1P8L A;  3J81 c;  4C3J B;  4DPG A;  2L0C A;  4C3J G;  2IWH A;  1UE1 A;  1PFM A;  1KC8 C;  3M3Y B;  4LUO A;  3OIQ A;  3A0J A;  4KV6 A;  3CMA A;  4LF8 L;  5KYL A;  1GUN A;  2BDN A;  1SYB A;  3ONA B;  3I4N H;  3MXN B;  4BY7 B;  1LV9 A;  2H5X A;  2PNR C;  2PZU A;  4BY7 G;  1SDF A;  3SK5 A;  3HOW H;  2VQE Q;  3NEM A;  1CHP D;  2DY7 A;  1D1K A;  2UXD L;  3RR5 A;  4DR1 L;  2OWO A;  3LX0 A;  3K7A B;  5FKA C;  2EYP A;  2A1A A;  4XQQ A;  4F88 A;  3FHW A;  3TRE A;  3PUY A;  2JXM B;  3AQQ A;  4HID A;  1CFM A;  1A62 A;  3QO2 A;  1V43 A;  3K5N A;  4NW2 A;  4FF4 A;  4LAA A;  1F9Q A;  1JR0 D;  1BCP D;  1G51 A;  2F4V Q;  3QOJ A;  1S5D D;  2CKZ B;  1EY7 A;  3J7A 5;  4XYQ A;  1KTK A;  3K8A A;  4GNX A;  3UDG A;  1TS3 A;  3KJO A;  1JJC B;  4JBM A;  1E2Z A;  2BE5 D;  2Y0S B;  3C1E A;  3M3Y H;  1KLG D;  3G71 A;  2Y0S G;  1RTN A;  3I4O A;  1MSG A;  4UP7 A;  3QWN A;  4JBK A;  1I4P A;  4BY7 H;  4G4K A;  4LUV A;  1B8A A;  1YNJ D;  4GLV B;  4OIK A;  3U9O A;  5ELE A;  1Z7T A;  1B2T A;  3MWY W;  3CKI B;  1CQV A;  2MNA A;  1LT5 D;  1JT8 A;  1FNV A;  4JI3 L;  3EVQ A;  2GVA A;  2Q2T A;  3GTG H;  4DV3 L;  4L5S A;  4HSP A;  4JBJ A;  2EY1 A;  2JYO A;  3RZD B;  1F77 A;  2K5D A;  2AQ3 B;  1N8R C;  3CC4 A;  1LT6 D;  1PTO H;  1HZC A;  4X3S A;  3HOY H;  1PTO F;  2E5L L;  2PPB C;  4HN7 A;  4MTK A;  1QOH A;  1XMO Q;  3D6C A;  5LHY 1;  1EY5 A;  3MZ5 A;  1X3P A;  2A69 D;  1HFG A;  5EBD A;  1IBK L;  4IUU A;  1TR5 A;  1X55 A;  4JVZ A;  1C48 A;  3RLF A;  4MIU A;  4BBS G;  3KBG A;  3BDC A;  4ZUJ A;  2O2L D;  4AYB E;  4X62 Q;  2DN8 A;  3H91 A;  1Q81 C;  3GTQ H;  2AKW B;  4OEL B;  1I50 B;  1GO3 E;  3NEN A;  1YZ6 A;  1BBX C;  3Q24 A;  2K5N A;  4GOP B;  2FMM A;  4ZKC B;  1J9O A;  5C3E H;  3QIA A;  4QIW B;  4X66 L;  3HOV H;  1TWC B;  4BXX G;  1EU4 A;  4GN5 A;  2D5D A;  3CME A;  1ZXT A;  4G57 A;  3S14 H;  1J8I A;  3RLN A;  1DM0 B;  5M9O A;  3GTK B;  4WJ4 A;  1L0W A;  1SXT A;  1VMP A;  1TXY A;  2PMZ E;  3NQT A;  2R93 B;  1RIP A;  3HOZ H;  4NP5 A;  4Q5V A;  2P5Z X;  2R93 G;  1PTO C;  4R4I A;  3I4M B;  2QA4 A;  1K8O A;  3S1M B;  3I4M G;  1OXT A;  1LTL A;  1QG7 A;  2C5C A;  5C5L A;  5IGB A;  1HPC A;  2BA1 A;  2TMP A;  1YNN C;  4BBS H;  2F4V L;  4TSS A;  1CSQ A;  4HCS A;  4MTN A;  3OW7 A;  1M4V A;  1YI2 A;  3G48 A;  2K03 A;  3GV6 A;  1S5B D;  2IX1 A;  3RZO B;  1ROD A;  4YWM A;  3CW2 C;  1VQJ A;  3S2H B;  1YHA A;  1FVI A;  5HGT A;  2NVX B;  1CUK A;  1HUN A;  2D9U A;  2R7Z H;  3SVM A;  1CKO A;  1TWC H;  3ULJ A;  4FF2 A;  5CV4 A;  4HIK A;  1HR0 W;  2AUK A;  5T1G A;  3K58 A;  1PH6 A;  1ILQ A;  1KHI A;  4EQN A;  2AMC B;  2G5D A;  3GTK H;  2PYK A;  2DJG C;  3UDI A;  1XMQ Q;  2J7Z A;  2R93 H;  1I5F A;  1XMO L;  1RDP D;  4X3T A;  1G6P A;  3AU7 A;  1WTX A;  1AW7 A;  3G6E A;  2ICE C;  1RJT A;  1EIG A;  2F0O A;  1B70 B;  3MA2 B;  5E1F A;  1G2S A;  4J15 A;  4K14 A;  4DK1 A;  4QMG A;  4RFB A;  4B9W A;  1A15 A;  1ENC A;  1QUQ B;  2QDL A;  3K7U C;  1SRU A;  1M90 C;  3OWF A;  1L1O B;  4A3E H;  1PRT B;  1FD7 D;  4X62 L;  4LF6 Q;  3CD6 A;  1K3B C;  4EQO A;  3CU7 A;  1PH7 A;  1OXV A;  3T4A C;  3PIP A;  4ZAI A;  2Z6B A;  4MN3 A;  4JV5 Q;  5I9P A;  1EY6 A;  1Y1W H;  1VQ8 A;  1IW7 D;  1B1Z A;  4HMJ A;  1IYU A;  4ID6 A;  5CBE E;  1IZ6 A;  5IWA Q;  5FO8 B;  2I5H A;  4DR2 Q;  3CCM A;  3PQI A;  1H9S A;  1PVO A;  4MNO A;  3I55 A;  4DXG A;  3H0G B;  1U4R A;  1VF7 A;  5JVH 3;  3TS2 A;  3H0G G;  2CW0 C;  1EY4 A;  1ZYR C;  5J22 A;  5K5P A;  1PHJ A;  2F0U A;  4IPC A;  4BBR B;  2NUC A;  5EBC A;  3MAQ A;  4OO1 H;  2F0V A;  2B29 A;  4BBR G;  3SHL A;  1VQK A;  1EEF D;  3TP7 A;  3VA7 A;  2QDB A;  4OX9 Q;  4B3M Q;  3FVQ A;  5ISR A;  2KQ3 A;  3CCR A;  2WIN B;  3TP6 A;  2JA7 G;  1GUW A;  3ULL A;  2DY8 A;  2A5H A;  4RH6 A;  5IGG A;  1BF4 A;  2JA9 A;  4RCN A;  1PFN A;  1CTM A;  1PRT F;  1ASZ A;  3R3O A;  1F9S A;  1EYC A;  1OXU A;  3QB3 A;  4DFA A;  3TP5 A;  2XTI A;  3BU2 A;  2PQE A;  4CDD C;  1A2U A;  2PQA A;  1KNA A;  1K73 C;  4CGY B;  1N36 Q;  3D0F A;  4PZ7 A;  3G4S A;  1STY A;  2EY6 A;  4JI2 Q;  4A75 A;  2AWN A;  3J7Z C;  1ET9 A;  1EQR A;  1XMQ L;  3B6Y A;  1VQO A;  4IOC A;  2BCO A;  3D4D A;  2EOT A;  1Q82 C;  4KD4 A;  1BCP B;  3OMC A;  4O1N A;  2EPB A;  4RCO A;  1S5E D;  4K6D A;  4P2C B;  2JA7 H;  2ZJP A;  1KAW A;  5CV6 A;  3HOU H;  2K6A A;  3E9H A;  2UUA Q;  3S1R B;  2SOB A;  1PH2 A;  1RTO A;  4NB3 A;  2D62 A;  1YHQ A;  4LF6 L;  2AHO B;  4TKO B;  4F8M A;  4DR6 L;  1BR9 A;  4A4I A;  5KGU A;  4QY7 A;  4JV5 L;  4A3J H;  1HZ9 A;  2EIF A;  3OWE B;  5IWA L;  5KNB A;  4DR2 L;  3H3V I;  4H13 C;  4U68 A;  1ZEQ X;  2NVT B;  2JEB I;  4DU9 A;  1VQA A;  1IHZ A;  2D2C C;  2X69 A;  4DAV A;  1IL8 A;  3CCV A;  1TS5 A;  1FL0 A;  4LWC A;  5E7N A;  4IUQ A;  4PMC A;  4QUF A;  3D8G A;  3WDN A;  2F0D A;  4YY3 Q;  3SK8 A;  4BWG B;  3A54 A;  4DAP A;  1SYF A;  4R1J A;  1EWH A;  2SNM A;  1BCP F;  3I72 A;  3VR6 A;  1MI2 A;  4OX9 L;  4B3M L;  3JAM i;  5I9O A;  2K5Q A;  5BR8 Q;  2PI2 A;  3K5L A;  2ZXP A;  3A8J E;  5G3L D;  5IP9 G;  1C4Q A;  3NE5 B;  2UU9 Q;  1A6X A;  1TWH B;  4H02 A;  5C5M A;  1CM9 A;  2L1B A;  5LMN Q;  1B9N A;  4GS3 A;  2Q8R E;  1WYD A;  4DV7 L;  4R4Q A;  3G7L A;  4IZ8 A;  3CC2 A;  3MHB A;  1EY9 A;  4Y52 H;  4K8I A;  2EY5 A;  2NVT H;  3E0E A;  1N36 L;  1RF2 D;  1L2F A;  4JI2 L;  4TQU S;  3PO2 H;  2DJF C;  4QL5 A;  3J81 i;  3K59 A;  3CPW A;  3CPF A;  1NE3 A;  1TWA B;  4UDU C;  4C2M H;  1HRJ A;  1BXT A;  1B3A A;  1D6E C;  1EIF A;  5EAY A;  3SR1 A;  2NN6 G;  4UY8 C;  1FGB D;  2E2D C;  3O13 A;  1TWG B;  2I5L X;  4C3H H;  1M8A A;  1YNN D;  3F1Z A;  1MD2 D;  4YCU A;  1SFO H;  1RL2 A;  1IBL Q;  4CBV A;  1NY4 A;  4WJW A;  1II3 A;  1Y1V H;  3T1Y L;  1NJI C;  2QIL A;  4KY7 A;  1FNW A;  4A76 A;  5FLX c;  1DOK A;  2B2W C;  3DLL A;  1SE2 A;  1TWH H;  2UUB Q;  1MGS A;  4ZUI A;  4KJO A;  4ZRZ A;  1B53 A;  2A74 C;  1E3P A;  3PF5 A;  2F3W A;  2PW5 A;  2XSC A;  5C4Z A;  4XYO A;  1A3V A;  2XNA C;  3GTO B;  2CWA A;  1VDZ A;  2EYL A;  3WWV A;  1MHW C;  3M4Y A;  3A5U A;  3CXC A;  5CV5 A;  1SYD A;  5C4J B;  4YY3 L;  4XQJ A;  1AP0 A;  2D0P A;  3A56 A;  2UXB L;  3PCO B;  4IUR A;  1P16 A;  4KHP Q;  3H94 A;  1N34 Q;  1SYE A;  1E24 A;  4QUC A;  1LLR D;  4NXM Q;  5IE8 A;  4HED A;  3S9W A;  5BR8 L;  4R8I A;  1VQ7 A;  2YU9 B;  4DNI A;  5EGT A;  1ML0 D;  2KUM A;  2SDF A;  1ZKO A;  1Y14 B;  4XXE A;  2DUD A;  2QCP X;  4A93 B;  5DM7 3;  4ZCK A;  5L37 A;  1EOT A;  3RN2 A;  4A93 G;  4LF5 Q;  2UU9 L;  3AFP A;  2K28 A;  5BN5 A;  4R8N A;  1BOS A;  3FPP A;  4WFN 3;  4JG2 A;  4Y7N B;  5LMN L;  2OQ0 A;  4A3F H;  1CZG A;  1DGS A;  2F3V A;  4HAE A;  3SK4 A;  1PFS A;  3LNN A;  4BA1 I;  2K33 A;  2KJX A;  4PG3 A;  2EY2 A;  4GNX B;  1HNX Q;  3I91 A;  1CKN A;  2B2W A;  4FXD A;  4L5Q A;  1PH3 A;  2LMC B;  4OWW B;  2CW0 D;  2EYJ A;  3EQL C;  1HTP A;  5C4J H;  1IKM A;  1AFP A;  1JWU D;  4YIJ A;  1QVG A;  5K36 G;  1T9H A;  2PZT A;  4QJF A;  3UI2 A;  4FVM A;  3VDY A;  2ASB A;  4XDX A;  2LFN A;  1IBL L;  4DN4 M;  1Q8K A;  3GTP B;  2VQF Q;  3BS1 A;  2GN5 A;  1DCZ A;  3SXH A;  4YHH Q;  5CBA E;  3KOJ A;  3MVV A;  1QZG A;  4HTH A;  3T16 A;  4OON A;  1WTW A;  4AYB B;  2UUB L;  1VF5 C;  4AYB G;  3ZJY C;  2CQO A;  2Z8L A;  2FFK B;  4DUZ Q;  3MFG A;  1TVX A;  4BS9 A;  4C3I H;  4IFD J;  4DAY A;  2N55 A;  2XGT A;  3U58 A;  1H9K A;  4M1U B;  1ICF B;  1ESF A;  2V1C C;  1JWM D;  2XWJ B;  4IQZ A;  1IBM Q;  2DNC A;  2PMZ B;  4A3C H;  4QCL A;  3NEL A;  3TP8 A;  5K36 H;  4KHP L;  1B9M A;  5E3F A;  1U5K A;  3MEH A;  2AWO A;  3CRK C;  1Q86 C;  3JAM L;  2V4D A;  3R2I A;  3SEB A;  4NXM L;  1JOO A;  2A68 D;  2F0H A;  3W5O A;  3GTL B;  3HKZ E;  2M00 A;  2NTT A;  3GTP H;  4DV3 Q;  2JN4 A;  4LFB Q;  3I90 A;  1STA A;  5IYC G;  4LF5 L;  2L15 A;  4RKL A;  3T56 B;  2E5L Q;  1GKH A;  2L9H A;  4UP8 A;  2B3G A;  2ZTC A;  2NN6 I;  3CQZ H;  4ABN A;  1EYG A;  2JA6 H;  4KD3 A;  2KEN A;  4EQ5 A;  1MKH A;  2I5M X;  1HNX L;  2L12 A;  2E76 C;  4LF9 L;  3QJY A;  3GO5 A;  3J81 L;  3U4V A;  2K01 A;  3HOX H;  3DEO A;  3R2T A;  5C4H A;  2K5W A;  2NWG A;  2MGS A;  1V1O A;  4A3K H;  2PO4 A;  4PZ8 A;  2NVQ H;  2QKI C;  2RSO A;  4X66 Q;  1HR0 Q;  2ZTD A;  5C0X J;  3S16 B;  1XX8 A;  2JJQ A;  2YTX A;  1HZB A;  5ELB A;  3GTL H;  2VQF L;  1S3O A;  4YHH L;  1X6O A;  3J7Y W;  3RD4 A;  2PCF B;  2JK8 A;  2EDG A;  3BYT B;  1JIC A;  2MFI A;  3PO3 H;  2B8F A;  4B08 A;  1E0B A;  3EIV A;  1JE5 A;  5EPL A;  4OWT B;  3MC0 B;  4PV1 C;  4DUZ L;  1SNP A;  4J8Q A;  2FXQ A;  5CYU A;  2E2J H;  3S17 B;  3F8T A;  3J7A F;  4XIG S;  3AB9 A;  1XPO A;  2ATW A;  2VUM B;  4C3J H;  3PUV A;  2VUM G;  2LSS A;  1EU3 A;  2F1M A;  1JJ2 A;  4HCE A;  1OO9 B;  1IBM L;  1NTG A;  3I4L A;  1WVL A;  4JI8 Q;  3ND9 A;  3DMU A;  2B63 B;  3NUC A;  2R7D A;  1H9S B;  2B63 G;  1Q12 A;  4IJL A;  3K7A H;  4JCV E;  1FYC A;  3NQI A;  5G3L F;  4V19 0;  3VYU A;  3BDO A;  1AEX A;  3C1F A;  4LFB L;  4FXG C;  3BJU A;  2OF1 A;  4XTC S;  1NSN S;  1QNU A;  1Y8O B;  4JBW A;  2J0T D;  4X3U A;  2ES2 A;  3URY A;  1VQB A;  1GM5 A;  2IY5 B;  2A6H C;  4LUZ A;  5EJW A;  1O80 A;  1K28 A;  3KF6 B;  1TQO A;  2LY7 A;  1G29 1;  1VQ6 A;  4LNQ A;  3JAM E;  1SR3 A;  1STE A;  1KLU D;  1C7Y A;  1A3T A;  1SND A;  5M3F B;  4IJH A;  1XJV A;  2VUM H;  4RWS C;  4EQP A;  3BZD B;  4E6I A;  2RDH A;  5M3F G;  1E2W A;  5GAH C;  1VQP A;  5I6Y A;  1QJO A;  4DKA C;  3IRB A;  3DWP A;  4O0A A;  1LAC A;  1VQE A;  1A0I A;  2GVB A;  5JAV A;  1TT2 A;  4KKU A;  5FLM G;  3TDQ A;  1HR0 L;  1Z47 A;  1E7Z A;  1VQ5 A;  3EJI A;  4IN3 A;  1Z6H A;  2R6G A;  3M85 A;  5DNF A;  1I4R A;  5J3B A;  4GLX A;  3W1B A;  1X56 A;  1JB7 A;  3I8Z A;  3L7Z C;  3K5M A;  4YCW A;  4X6A H;  3RZD H;  2HIV A;  1HZA A;  3J81 E;  1M1K C;  1SMX A;  5LL6 X;  3J80 c;  2EXZ A;  3J80 L;  1STN A;  2F0J A;  1F9R A;  1HH2 P;  1SE8 A;  5EPK A;  1EEI D;  2F52 A;  1AH9 A;  2ZT9 C;  2ZXO A;  5JEA J;  4UPA A;  5IGE A;  2E8G A;  5KIX A;  4X64 L;  3ITP A;  4A3M B;  3MTS A;  1GHJ A;  2WAC A;  1WTO A;  4A3M G;  5EKL A;  2HCI A;  3UDF A;  5IIF A;  2O4X A;  3KDF A;  4KI0 A;  1I50 H;  3U9S A;  3PUZ A;  4IFD G;  3QG1 A;  5IT9 c;  1UNS A;  3R8B A;  4FYD A;  1K0S A;  5FLM H;  5IT9 L;  2F4I A;  4BXX H;  2UXC L;  2A6E C;  4JI8 L;  5KNC A;  2EZV A;  3DWQ A;  1F9P A;  4POF A;  4JI0 Q;  1GD7 A;  4A3G B;  2MP1 A;  2RHQ B;  1IXR A;  4A3G G;  1TS4 A;  1D2B A;  1GXD C;  2AUJ D;  1UWV A;  3OHX C;  4DXF A;  2F0W A;  5I2X A;  5IGD A;  3BDL A;  3I4M H;  1UAP A;  3MXN A;  3S1M H;  2K75 A;  1DOL A;  5AJ3 Q;  3H3V H;  3VYR A;  4IOA A;  1N32 L;  1WFQ A;  1CHQ D;  2VB3 X;  1Y8P B;  2IW3 A;  1I4Q A;  1QB5 D;  5IGF A;  2K50 A;  2K52 A;  4JI7 Q;  3DM1 A;  2OEO A;  3M4O B;  4EVO A;  3GQB A;  1V1P B;  1EFI D;  1E2V A;  4CKB A;  2B2T C;  3DM3 A;  4DR6 Q;  4IFD H;  3RLO A;  3RZO H;  3PUW A;  3GV3 A;  1VQG A;  2FJ2 A;  3AMU A;  4IUT A;  3K57 A;  3S2H H;  4DV4 Q;  1QWY A;  3ZYY X;  4MHE A;  4FO2 A;  4KHZ A;  4GOP C;  4JPB W;  4CJ1 B;  2NVX H;  4NMZ A;  1FJG L;  4DR4 Q;  5T1I A;  4GKJ Q;  4A3G H;  3W3A A;  2OTL A;  2ZJR A;  3ERO A;  1JB3 A;  1PXU A;  3L3O C;  2G9D A;  4CDC C;  5A2Q L;  3CCS A;  1V9P A;  4A3L G;  3LWE A;  5C0X G;  5E4X A;  3A5Z B;  4IPG A;  1AN8 A;  2RA4 A;  4WRD A;  1JJG A;  1UE5 A;  2HIX A;  1EWC A;  1PZJ D;  2YYZ A;  5IYB G;  3GTM B;  3H3V C;  2KCN A;  3KFU A;  4NPS A;  4A3I B;  2B2U C;  2PNH A;  1X9N A;  2F0Q A;  4A3I G;  5A35 A;  4JOI C;  4HJ7 A;  2N3S A;  1N9W A;  2F0M A;  3F2B A;  2VXW A;  1Q7Y C;  1SMY C;  1N33 Q;  3NBH B;  3CAM A;  1K8G A;  2QGQ A;  2Q8I B;  4PMW A;  2MO0 A;  4F7X A;  4ZKB B;  3P7J A;  1SNO A;  3J80 E;  5KYI A;  4Z9C B;  1O7Z A;  4DV7 Q;  4JI0 L;  4KY5 A;  4S3S A;  3HEJ A;  3BZK A;  2R61 A;  1VQI A;  1NNX A;  2B2T A;  2L55 A;  1UE6 A;  3H6M A;  3L0O A;  4DNR B;  3H0G H;  4B3T Q;  2Q2H A;  1HHV A;  4A3L H;  2OQK A;  5KND A;  5FO9 B;  1F2M A;  5M5W B;  4BBR H;  2Z1C A;  1PH5 A;  5C4X B;  2F0I A;  2XRQ D;  5IT9 E;  1RKN A;  1QVF A;  1KRT A;  5AJ3 L;  5C4X G;  3OMG A;  3CCQ A;  3KLS A;  2KBN A;  4JW0 A;  1U4L A;  3CCJ A;  4IO9 A;  5AFW A;  1O7L A;  2E2I B;  4JI7 L;  1EIY B;  3T1Y Q;  3EN2 A;  2KEC A;  1PZI D;  2MJ8 A;  1PH1 A;  1L1O C;  1TU2 B;  2F0P A;  1PRT C;  2R3Z A;  1BKB A;  4K5V A;  4ODG A;  2CHB D;  2RVL A;  4KJN A;  4H44 C;  3L9A X;  1O7I A;  4DV4 L;  5J1Z A;  1B4O A;  1X3F A;  2EYM A;  2I07 B;  4NXN Q;  4DR4 L;  1ENF A;  2B2U A;  4IUV A;  4GKJ L;  5LMU L;  4O2D A;  4DUY Q;  3I56 A;  3S24 A;  4JOI A;  2CCZ A;  1EQV A;  1R4P B;  2RKS A;  3E6Z X;  1I4G A;  2XRS D;  2EYF A;  4KN7 C;  4IFD I;  2WKC A;  1WCM B;  2K4K A;  5IY0 A;  5M5W H;  4P75 A;  1BBW A;  1WCM G;  3ICE A;  3CCE A;  1PMR A;  2YV5 A;  2UXB Q;  1YNX A;  3PGZ A;  1PYW D;  2BOS A;  1Q46 A;  1SJE D;  2FHT A;  1J6Q A;  4N9P A;  2B2V C;  3S1R H;  2E2I H;  1HCZ A;  1DOM A;  3UE0 A;  4KY6 A;  4LF7 Q;  3V05 A;  1NCV A;  5M5Y B;  4LFC Q;  5JEA G;  5A2Q E;  1RCV D;  2HQE A;  1N33 L;  3K80 C;  1GUS A;  1PV4 A;  5COR A;  2WAQ E;  1UE7 A;  2HUG A;  2WV6 D;  1GHK A;  2HT1 A;  2PI2 E;  4G7H C;  3I73 A;  3PIO A;  3AEV A;  5JJK A;  1SEB D;  3P20 A;  1WTR A;  1CA5 A;  2Q2U A;  2OTJ A;  1LTR D;  3CCL A;  4H7B A;  4HJA A;  3T53 B;  2KCC A;  1QVC A;  1L1O A;  1L0X B;  4B3T L;  2BH2 A;  3PV0 A;  1G8Z D;  3NHH A;  1I4H A;  2N78 A;  3M7N A;  3HKZ B;  1WCM H;  1LO5 D;  3NWT A;  2JE6 I;  3HKZ G;  1ICW A;  3H15 A;  1JOR A;  1PTO D;  3TRZ A;  1Q1E A;  3D4R A;  3MXP A;  2XWB B;  4FNF A;  4ILW A;  1W6K A;  3C3L A;  1BCP C;  3NTH A;  2Z0S A;  1H9M A;  3KLS X;  4KKS A;  4JI6 L;  1EFW A;  3SGI A;  4EX5 A;  5IP9 H;  2BE5 C;  2K05 A;  4B9X A;  3OTO L;  1KIX A;  1I6V C;  3NBI A;  5M5Y H;  5C0X I;  1T5X D;  4PZ6 A;  3D6W A;  3NTI A;  2ZTE A;  5FLX L;  2IX3 A;  2F0S A;  2RCF A;  1XWE A;  3V2T A;  2FMC A;  4NXN L;  5JOB A;  2B2V A;  5JVG 3;  4DUY L;  4GZY C;  3FMC A;  1A2T A;  2CWP A;  4L63 B;  3PIP 3;  1I4X A;  2B2Y C;  2JA8 B;  4UHV A;  5D3D A;  3AFQ A;  1TWA H;  1XTC D;  2JA8 G;  4V0B A;  4C1N K;  4PQX A;  2NN6 H;  2A69 C;  3N52 A;  1LYL A;  2KCT A;  1GOZ A;  3S1Q B;  5M3M B;  3KF8 A;  1TWG H;  1I3Q B;  2O5I C;  1S4Z A;  2H4O A;  3M9B A;  5C3X A;  4AIM A;  3S2D B;  2MUY A;  3A7A B;  3OIP A;  1YEZ A;  2N88 A;  5ELO A;  4R4O A;  3D3R A;  4LF7 L;  2XN9 C;  2ENB A;  2HD3 A;  4LFC L;  1CSP A;  2O5J C;  1JCK B;  2K14 A;  1VQH A;  2ZXR A;  3T1H Q;  1VQD A;  4UP9 A;  2PZW A;  3NK9 A;  3MFY A;  2HDM A;  1F2L A;  2NVY B;  2K1B A;  3IAY A;  1S72 A;  3E9I A;  1LTI D;  1XXG A;  3OYY A;  1KD1 C;  3D4W A;  1WD1 A;  4BY1 B;  4FF3 A;  3VR3 A;  4A3B B;  3GTO H;  5FO7 B;  4BY1 G;  1VQN A;  4LF9 Q;  4K2K A;  1IL2 A;  4P72 A;  1ZYR D;  4IAL A;  4P71 A;  3CCU A;  1KL9 A;  3GTJ B;  4G7O C;  4LMQ D;  3TS0 A;  1MJC A;  2F0N A;  1TKW B;  4JI1 L;  1SNC A;  5GRO A;  1JWS D;  2R92 B;  5CV9 A;  4DR3 Q;  2R92 G;  2E74 C;  4LF4 Q;  2YU9 H;  1TWF B;  3S2D H;  4GKK Q;  1YIT A;  2B2Y A;  1K8A C;  3G6J B;  1CKM A;  1PH8 A;  3LWU A;  4A93 H;  1SNQ A;  3NTK A;  1SMY D;  1YJW A;  2ID0 A;  1IYJ B;  1S5C D;  4IUP A;  4Q0F A;  1BNZ A;  5JPN C;  3J80 i;  1V1Q A;  5CC4 A;  2NVY H;  1HNW L;  3W1G A;  4Y7N H;  3Q22 A;  1UEA B;  4N8F A;  2DNE A;  3TME A;  3I7F A;  3TBI B;  1U4M A;  3FEW X;  5CR3 A;  4BY1 H;  3TSS A;  3CC7 A;  1D1I A;  5C44 B;  5IYD G;  5C44 G;  1FGU A;  2AQ2 B;  3U50 C;  5FLX E;  2JEA I;  5EQ0 A;  1EY8 A;  2AQ1 B;  2EQS A;  2IHE A;  1XPU A;  5M5X B;  4R4T A;  1SE4 A;  4XT1 B;  5KRU A;  5HY6 A;  3FKI B;  1TY2 A;  1X3Q A;  3FKI G;  2C35 B;  2J4X A;  4L5T A;  5ELC A;  4RGM A;  2WB1 E;  1O7Y A;  3TZU A;  1W2B A;  1X54 A;  4M8A A;  1KAB A;  1UUP A;  2ZJQ A;  1E1O A;  3T1H L;  5D65 A;  1Q90 A;  4DV5 L;  5HGQ A;  3I4N B;  1IW7 C;  1PH4 A;  1WOC A;  1NUC A;  2KCM A;  3I4N G;  3DEP A;  3HOW B;  1LTB D;  1ENA A;  2F0T A;  1LTS D;  1VQM A;  3HOW G;  4B3R L;  1VCI A;  1HQR D;  1BUV T;  1C8C A;  1F2Y A;  1AZP A;  1A63 A;  1MBY A;  3M4P A;  4GNX C;  1QNK A;  3KDF B;  3HP3 A;  2K5V A;  4JYA Q;  1EQT A;  4K6L A;  5C3W A;  1X32 A;  3Q23 A;  2ALY B;  4CKC A;  2LS0 1;  3KJP A;  1YBY A;  4DR3 L;  4KHV A;  1OXX K;  2WII B;  4LF4 L;  4LK1 C;  1LTA D;  3CF5 A;  4C1N I;  3KUP A;  4I7A A;  4GKK L;  1LT4 D;  5IYC H;  1Z9F A;  2YTV A;  5LL6 S;  4P73 A;  2Z9H A;  1HFN A;  1NR2 A;  2SNS A;  2Z4I A;  4HJ8 A;  2RSN A;  1H9J A;  2HHH Q;  4K5W A;  4XQN A;  5GQO A;  4TVA B;  4RMF A;  1XTD A;  4X3K A;  1SYC A;  2K32 A;  5JPM C;  4X64 Q;  2NYZ D;  2RCN A;  1K9M C;  1SYG A;  3GTG B;  1STB A;  5ELN A;  1NR4 A;  5EKK A;  1PTO B;  3HOY B;  3K5O A;  2XIW A;  3HS0 C;  3HOY G;  2UUC Q;  1PZK D;  3E0J A;  1MJE A;  5IOC A;  1Q3L A;  2F3I A;  2MHV A;  5D14 A;  3ULP A;  1BVS A;  2C9O A;  2UXC Q;  4OIJ A;  2NBF A;  1EZ8 A;  2BDO A;  3S16 H;  3D31 A;  3F2U A;  4OXP A;  4ZK9 B;  3NSW A;  2Q2I A;  4AH6 A;  4C56 C;  2K04 A;  4CJ0 B;  2KHI A;  1A3U A;  3GTQ B;  3GDE A;  2F0G A;  1GUO A;  4DK3 C;  5GAE C;  1ET6 A;  2NB0 A;  1VQL A;  4PMB A;  3A55 A;  4DV2 Q;  2XVS A;  4N9T A;  2VY3 A;  1WJJ A;  5C3E B;  4IUN A;  3NWS A;  1DZ1 A;  3H09 A;  3HOV B;  5C3E G;  1W3S A;  2NTS A;  3HOV G;  3S14 B;  1N32 Q;  1HA5 A;  2M2L A;  1PDQ A;  3K0Y A;  4L5R C;  3S17 H;  4QQB X;  3VR5 A;  1HJP A;  4R4C A;  4NDX A;  4DV6 Q;  4DNT B;  4DV0 Q;  4QF4 A;  3HOZ B;  1ONL A;  1YVC A;  4TRD A;  4JYA L;  1SE3 A;  3NXW A;  3HOZ G;  2KED A;  1RD9 D;  1ILP A;  3BG3 A;  3RMH A;  1LM0 A;  2MO1 A;  4B3S L;  4K2L A;  2PQA B;  1FJG Q;  3RNU A;  4BBS B;  2B63 H;  1SLJ A;  4HMI A;  3UDX A;  3VR2 A;  4ZYS A;  1AZQ A;  2L5T A;  3ND8 A;  4ZLT F;  4K8J A;  4H0L C;  2KEE A;  3KBX A;  1AE3 A;  1F2Z A;  1KAA A;  5BN4 A;  5EPJ A;  3OSO A; 
#chains in the Genus database with same CATH homology
 3PMF A;  4ME5 A;  1K8M A;  3EA6 A;  3X3M A;  1EYD A;  4ULL A;  4LJZ C;  2I46 A;  2R7Z B;  3W2D A;  3N6R A;  2F03 A;  2GA4 B;  5F2D A;  3FRP B;  2KA7 A;  4KN4 C;  2BA0 A;  2PW7 A;  3Q0A A;  1WTQ A;  1CQF A;  1SNM A;  1DON A;  1DD2 A;  1R4Q B;  1L0Y B;  3WOE A;  1QIL A;  2L11 A;  5IGC A;  1STH A;  4R9W A;  2EJG C;  4A3E B;  2Z4H A;  3BVM A;  4JK1 C;  4OGQ C;  1JC7 A;  2IPK D;  1CA6 A;  1SJH D;  3BVZ A;  1Y1W B;  4QB4 A;  1TY0 A;  1BQQ T;  2CQA A;  4PNY A;  2WAQ B;  2EYO A;  3CHB D;  1QE6 A;  4RAU C;  5FK9 C;  5DAU A;  5HUR A;  4DK0 A;  4UAI A;  5CGK A;  1OXS C;  4CKE A;  4J6H A;  2Q8T A;  4OO1 G;  3S15 B;  3FPU B;  5TSS A;  4RHS A;  1ESR A;  4KMU C;  3A8I E;  1EY0 A;  2H1E A;  1H9R A;  2CVR A;  3VYS A;  1R9T B;  2IX0 A;  3EFX D;  3E5S A;  1SBB B;  3M7G A;  1GUT A;  4RGO S;  2EVB A;  2G9H D;  1BO0 A;  1B50 A;  3HG9 A;  2IL8 A;  3V96 A;  1Y8N B;  3MXU A;  2X6L A;  4DF7 A;  4DA2 A;  4NKL A;  5CV7 A;  4A3D B;  2QF7 A;  1Q1B A;  3VA5 A;  1IYV A;  4HR7 B;  3R93 A;  3MXG A;  1CZW A;  1U4P A;  3A7L A;  2JA7 B;  3HOU B;  3X3N A;  3CRL C;  2B39 A;  3FDT A;  2OXP A;  5FOB B;  1PFB A;  1XYI A;  5COY A;  5C0X H;  1G6Z A;  2M9V A;  3T51 B;  4KTA A;  1JE4 A;  2EYH A;  4A3J B;  2VNU D;  3BYY B;  2NZ1 D;  4KKT A;  1JOQ A;  5IOD A;  2KOL A;  1CK1 A;  1O78 A;  2RDF A;  1HQM C;  3S1N B;  2EJF C;  2A68 C;  3DXJ C;  2L4N A;  1WD0 A;  1HTL D;  3NP8 A;  4U67 3;  2F0F A;  3PUX A;  1U9R A;  4G7Z C;  2LKV A;  4CJ2 C;  2A6H D;  2RQX A;  1DYQ A;  1B44 D;  1S5F D;  1G2T A;  1HUM A;  3IFT A;  3KK7 A;  5DEH A;  3T13 A;  5J39 A;  1V8Q A;  3HGB A;  3PO2 B;  1KNE A;  5E4W C;  5BN3 A;  1D5X C;  2EE1 A;  1D5Z C;  1IKL A;  4C2M B;  1LTT D;  2MPM A;  2QEJ C;  5ELD A;  1EIH A;  4ZQ3 A;  1JQY D;  1JOK A;  4RGN A;  4C3H B;  4DGZ A;  3I70 A;  4OL7 A;  4C3H G;  1SFO B;  2HCC A;  5I2Y A;  1PLF A;  1Y1V B;  1V1P A;  4L8J A;  4FP5 D;  1K83 B;  4CHT B;  1TII D;  2WB1 B;  2RDG A;  3OPO A;  4RA8 A;  4OO1 I;  5EKI A;  5D3I B;  2IT1 A;  2FIN B;  1WTP A;  3K6O A;  4WOR A;  2JSO A;  2K7V A;  3P1H A;  3BVG A;  5JEA H;  1LTG D;  4EGV A;  5C6A A;  1YNJ C;  2A6E D;  1T5E A;  5CV8 A;  5ELF A;  1SSO A;  2JP1 A;  2E75 C;  3SDZ A;  3QOL A;  4RGT A;  2VB2 X;  1LAB A;  3TN2 A;  2WKD A;  1D5M C;  1NAP A;  3NBH A;  4A3F B;  1EYA A;  1EZ6 A;  1W6J A;  5KEE A;  1STG A;  1KDB A;  1GJX A;  4BA2 I;  1EL0 A;  3OOC A;  1FNU A;  2OT2 A;  1QCB D;  2X6G A;  3P75 A;  3SE0 A;  3GD7 A;  3TZD A;  3ERQ A;  3Q6S A;  1RHP A;  3I3C A;  3DUZ A;  2HDL A;  4RHR A;  1DXM A;  4I65 A;  1I6H B;  4KK7 A;  1WTV A;  5JJZ A;  2KHS A;  3HRZ C;  1MSH A;  1Q8I A;  4C3I B;  1CI3 M;  1CT1 D;  5I6W A;  4C3I G;  3IFD A;  1SAP A;  2F0E A;  3A8K E;  1BDO A;  4L6T B;  1DJR D;  2B8G A;  3HZX A;  4I7Z C;  1LT3 D;  3SK6 A;  4HSV A;  2IJ0 A;  2WP8 J;  4XT3 B;  3GP7 A;  1KDA A;  2A73 B;  3DHQ A;  5CMD A;  4RKB A;  2JA5 B;  1KDC A;  3WOF A;  2E2H B;  3CQZ B;  2F0L A;  2TSS A;  4K5X A;  5I4D A;  3IKJ A;  2JA6 B;  2ICI A;  1HA6 A;  3RUZ A;  3VR4 A;  3HOX B;  3C2P A;  1PRT D;  2KVM A;  2SEB D;  1TS2 A;  4F87 A;  5NUC A;  4A3K B;  2RBM A;  2NVQ B;  3IL8 A;  3KLR A;  5DM6 3;  4FXK C;  4OHJ A;  4FF1 A;  1FR3 A;  1HXY D;  1GUG A;  4O42 A;  3VYT A;  1VMC A;  1G91 A;  3PO3 B;  2EJM A;  1Y69 U;  2F0K A;  3PIO 3;  4J1M A;  2E2J B;  3DWA A;  3NPP A;  3J7A V;  3C46 A;  4C3J B;  2L0C A;  4C3J G;  2IWH A;  1PFM A;  3M3Y B;  3OIQ A;  4KV6 A;  5KYL A;  1GUN A;  2BDN A;  1SYB A;  3ONA B;  4BY7 B;  1LV9 A;  2PNR C;  2PZU A;  1SDF A;  3SK5 A;  1CHP D;  2DY7 A;  1D1K A;  3LX0 A;  3K7A B;  5FKA C;  2EYP A;  4XQQ A;  4F88 A;  3PUY A;  2JXM B;  1CFM A;  3QO2 A;  1V43 A;  3K5N A;  4NW2 A;  4FF4 A;  4LAA A;  1F9Q A;  1JR0 D;  1BCP D;  3QOJ A;  1S5D D;  1EY7 A;  4XYQ A;  1KTK A;  1TS3 A;  1E2Z A;  2BE5 D;  2Y0S B;  3C1E A;  1KLG D;  1RTN A;  1MSG A;  3QWN A;  1I4P A;  4G4K A;  1YNJ D;  4OIK A;  3U9O A;  5ELE A;  1Z7T A;  1B2T A;  3MWY W;  3CKI B;  1CQV A;  1LT5 D;  1FNV A;  3EVQ A;  4HSP A;  2EY1 A;  2JYO A;  3RZD B;  1F77 A;  2K5D A;  2AQ3 B;  1LT6 D;  1PTO H;  4X3S A;  1PTO F;  2PPB C;  4HN7 A;  1QOH A;  3D6C A;  5LHY 1;  1EY5 A;  3MZ5 A;  1X3P A;  2A69 D;  1HFG A;  5EBD A;  4IUU A;  1TR5 A;  1C48 A;  3RLF A;  4MIU A;  3KBG A;  3BDC A;  4ZUJ A;  2O2L D;  2DN8 A;  3H91 A;  1I50 B;  1BBX C;  3Q24 A;  2FMM A;  4ZKC B;  1J9O A;  3QIA A;  4QIW B;  1TWC B;  1EU4 A;  2D5D A;  1ZXT A;  4G57 A;  1J8I A;  1DM0 B;  5M9O A;  3GTK B;  1SXT A;  1VMP A;  3NQT A;  2R93 B;  4NP5 A;  4Q5V A;  1PTO C;  3I4M B;  1K8O A;  3S1M B;  1OXT A;  1QG7 A;  2C5C A;  5C5L A;  5IGB A;  1HPC A;  2BA1 A;  2TMP A;  1YNN C;  4TSS A;  4HCS A;  3OW7 A;  1M4V A;  2K03 A;  3GV6 A;  1S5B D;  2IX1 A;  3RZO B;  1ROD A;  3S2H B;  5HGT A;  2NVX B;  1HUN A;  2D9U A;  3SVM A;  4FF2 A;  5CV4 A;  2AUK A;  5T1G A;  3K58 A;  1ILQ A;  4EQN A;  2PYK A;  2J7Z A;  1RDP D;  4X3T A;  3AU7 A;  1WTX A;  1AW7 A;  2ICE C;  1RJT A;  1EIG A;  2F0O A;  3MA2 B;  5E1F A;  1G2S A;  4K14 A;  4DK1 A;  4QMG A;  4RFB A;  4B9W A;  1A15 A;  1ENC A;  3OWF A;  1PRT B;  1FD7 D;  4EQO A;  3CU7 A;  1OXV A;  3T4A C;  4ZAI A;  4MN3 A;  5I9P A;  1EY6 A;  1IW7 D;  1B1Z A;  4HMJ A;  1IYU A;  4ID6 A;  5CBE E;  5FO8 B;  1H9S A;  4DXG A;  3H0G B;  1U4R A;  1VF7 A;  5JVH 3;  2CW0 C;  1EY4 A;  1ZYR C;  5J22 A;  5K5P A;  2F0U A;  4BBR B;  2NUC A;  5EBC A;  3MAQ A;  4OO1 H;  2F0V A;  3SHL A;  1EEF D;  3TP7 A;  3VA7 A;  2QDB A;  3FVQ A;  5ISR A;  2KQ3 A;  2WIN B;  3TP6 A;  1GUW A;  2DY8 A;  2A5H A;  4RH6 A;  5IGG A;  1BF4 A;  4RCN A;  1PFN A;  1CTM A;  1PRT F;  3R3O A;  1F9S A;  1EYC A;  4DFA A;  1OXU A;  3QB3 A;  3TP5 A;  2PQE A;  1A2U A;  1KNA A;  4CGY B;  1STY A;  2EY6 A;  2AWN A;  1ET9 A;  2BCO A;  3D4D A;  2EOT A;  4KD4 A;  1BCP B;  3OMC A;  4O1N A;  2EPB A;  4RCO A;  1S5E D;  4K6D A;  4P2C B;  5CV6 A;  2K6A A;  3S1R B;  2SOB A;  1RTO A;  2D62 A;  4TKO B;  4F8M A;  1BR9 A;  5KGU A;  3OWE B;  5KNB A;  4H13 C;  4U68 A;  1ZEQ X;  2NVT B;  2JEB I;  4DU9 A;  2D2C C;  1IHZ A;  2X69 A;  4DAV A;  1IL8 A;  1TS5 A;  4IUQ A;  4PMC A;  4QUF A;  3D8G A;  3WDN A;  2F0D A;  3SK8 A;  4BWG B;  3A54 A;  4DAP A;  1SYF A;  1EWH A;  2SNM A;  1BCP F;  3I72 A;  3VR6 A;  1MI2 A;  5I9O A;  2K5Q A;  3K5L A;  2ZXP A;  3A8J E;  5G3L D;  1C4Q A;  3NE5 B;  1A6X A;  1TWH B;  5C5M A;  1CM9 A;  2L1B A;  1B9N A;  2Q8R E;  3G7L A;  4IZ8 A;  3MHB A;  1EY9 A;  4K8I A;  2EY5 A;  1RF2 D;  4TQU S;  3K59 A;  1TWA B;  4UDU C;  1HRJ A;  1BXT A;  1B3A A;  1D6E C;  3SR1 A;  2NN6 G;  1FGB D;  2E2D C;  3O13 A;  1TWG B;  1M8A A;  1YNN D;  1MD2 D;  4CBV A;  4WJW A;  1II3 A;  2QIL A;  4KY7 A;  1FNW A;  1DOK A;  2B2W C;  1SE2 A;  1MGS A;  4ZUI A;  4KJO A;  4ZRZ A;  1B53 A;  2A74 C;  2F3W A;  2PW5 A;  2XSC A;  5C4Z A;  4XYO A;  1A3V A;  2XNA C;  3GTO B;  1VDZ A;  2EYL A;  3M4Y A;  5CV5 A;  1SYD A;  5C4J B;  4XQJ A;  1AP0 A;  3A56 A;  4IUR A;  3H94 A;  1SYE A;  4QUC A;  1LLR D;  4HED A;  3S9W A;  2YU9 B;  4R8I A;  5EGT A;  1ML0 D;  2KUM A;  2SDF A;  1ZKO A;  4XXE A;  2QCP X;  4A93 B;  5DM7 3;  1EOT A;  2K28 A;  5BN5 A;  4R8N A;  1BOS A;  3FPP A;  4WFN 3;  4Y7N B;  1CZG A;  2F3V A;  4HAE A;  3SK4 A;  3LNN A;  4BA1 I;  2K33 A;  2KJX A;  2EY2 A;  3I91 A;  2B2W A;  4FXD A;  2LMC B;  2CW0 D;  2EYJ A;  3EQL C;  1HTP A;  1IKM A;  1AFP A;  1JWU D;  4YIJ A;  5K36 G;  2PZT A;  3UI2 A;  4FVM A;  4XDX A;  2LFN A;  4DN4 M;  3GTP B;  3BS1 A;  1DCZ A;  3SXH A;  5CBA E;  3MVV A;  4HTH A;  3T16 A;  1WTW A;  4AYB B;  1VF5 C;  2Z8L A;  2FFK B;  3MFG A;  1TVX A;  4BS9 A;  4IFD J;  4DAY A;  2N55 A;  1H9K A;  4M1U B;  1ESF A;  1JWM D;  2XWJ B;  4IQZ A;  2DNC A;  2PMZ B;  4QCL A;  3TP8 A;  5K36 H;  1B9M A;  5E3F A;  3MEH A;  2AWO A;  3CRK C;  3JAM L;  2V4D A;  3R2I A;  3SEB A;  1JOO A;  2A68 D;  2F0H A;  3GTL B;  2M00 A;  2NTT A;  3I90 A;  1STA A;  4RKL A;  3T56 B;  2L9H A;  2NN6 I;  4ABN A;  4KD3 A;  2L12 A;  2E76 C;  3QJY A;  3GO5 A;  3J81 L;  2K01 A;  3DEO A;  3R2T A;  5C4H A;  2K5W A;  2NWG A;  2MGS A;  1V1O A;  2PO4 A;  2QKI C;  2RSO A;  5C0X J;  3S16 B;  1XX8 A;  5ELB A;  3J7Y W;  3RD4 A;  2PCF B;  2EDG A;  3BYT B;  1JIC A;  2B8F A;  4B08 A;  1E0B A;  5EPL A;  3MC0 B;  4PV1 C;  1SNP A;  4J8Q A;  5CYU A;  3S17 B;  3J7A F;  4XIG S;  3AB9 A;  2VUM B;  3PUV A;  1EU3 A;  2F1M A;  4HCE A;  1OO9 B;  3I4L A;  1WVL A;  3ND9 A;  3DMU A;  2B63 B;  3NUC A;  1H9S B;  1Q12 A;  5G3L F;  4V19 0;  1FYC A;  3NQI A;  3VYU A;  3BDO A;  1AEX A;  3C1F A;  4FXG C;  2OF1 A;  4XTC S;  1NSN S;  1QNU A;  1Y8O B;  4JBW A;  2J0T D;  4X3U A;  3URY A;  2A6H C;  5EJW A;  1O80 A;  1TQO A;  2LY7 A;  1G29 1;  3JAM E;  1STE A;  1KLU D;  1A3T A;  1SND A;  5M3F B;  4RWS C;  4EQP A;  3BZD B;  4E6I A;  2RDH A;  1E2W A;  5I6Y A;  1QJO A;  3DWP A;  1LAC A;  5JAV A;  1TT2 A;  4KKU A;  3TDQ A;  1Z47 A;  3EJI A;  4IN3 A;  1Z6H A;  2R6G A;  3M85 A;  5DNF A;  1I4R A;  3I8Z A;  3L7Z C;  3K5M A;  3J81 E;  5LL6 X;  2EXZ A;  3J80 L;  1STN A;  2F0J A;  1F9R A;  5EPK A;  1EEI D;  2ZT9 C;  2ZXO A;  5JEA J;  5IGE A;  5KIX A;  3ITP A;  4A3M B;  3MTS A;  1GHJ A;  2WAC A;  1WTO A;  5EKL A;  2HCI A;  5IIF A;  2O4X A;  4KI0 A;  4IFD G;  3U9S A;  3PUZ A;  3QG1 A;  1UNS A;  3R8B A;  4FYD A;  5IT9 L;  2F4I A;  2A6E C;  5KNC A;  2EZV A;  3DWQ A;  1F9P A;  4A3G B;  2MP1 A;  1TS4 A;  1D2B A;  1GXD C;  2AUJ D;  3OHX C;  4DXF A;  2F0W A;  5I2X A;  5IGD A;  3BDL A;  1UAP A;  3MXN A;  1DOL A;  3VYR A;  1CHQ D;  2VB3 X;  1Y8P B;  2IW3 A;  1I4Q A;  5IGF A;  1QB5 D;  3DM1 A;  2OEO A;  3M4O B;  4EVO A;  3GQB A;  1V1P B;  1EFI D;  1E2V A;  4CKB A;  2B2T C;  4IFD H;  3PUW A;  3GV3 A;  2FJ2 A;  3AMU A;  4IUT A;  3K57 A;  1QWY A;  3ZYY X;  4MHE A;  4FO2 A;  4KHZ A;  4CJ1 B;  4NMZ A;  5T1I A;  3W3A A;  3ERO A;  1JB3 A;  1PXU A;  3L3O C;  2G9D A;  5A2Q L;  3LWE A;  5C0X G;  5E4X A;  1AN8 A;  2RA4 A;  4WRD A;  1EWC A;  1PZJ D;  2YYZ A;  3GTM B;  3H3V C;  2KCN A;  4A3I B;  2B2U C;  2F0Q A;  5A35 A;  2F0M A;  2VXW A;  1SMY C;  2Q8I B;  4PMW A;  4F7X A;  4ZKB B;  3P7J A;  1SNO A;  3J80 E;  5KYI A;  4Z9C B;  1O7Z A;  4KY5 A;  4S3S A;  3HEJ A;  2R61 A;  2B2T A;  2L55 A;  3H6M A;  4DNR B;  1HHV A;  5KND A;  5FO9 B;  1F2M A;  5M5W B;  2Z1C A;  5C4X B;  2F0I A;  2XRQ D;  5IT9 E;  1RKN A;  3OMG A;  3KLS A;  1U4L A;  5AFW A;  1O7L A;  2E2I B;  2KEC A;  1PZI D;  2MJ8 A;  2F0P A;  1TU2 B;  2R3Z A;  1PRT C;  4K5V A;  4ODG A;  2CHB D;  2RVL A;  4KJN A;  4H44 C;  3L9A X;  5J1Z A;  1B4O A;  2EYM A;  2I07 B;  1ENF A;  2B2U A;  4IUV A;  1EQV A;  1R4P B;  2RKS A;  3E6Z X;  1I4G A;  2XRS D;  2EYF A;  4KN7 C;  4IFD I;  2WKC A;  1WCM B;  1PMR A;  1PYW D;  2BOS A;  1SJE D;  2FHT A;  4N9P A;  2B2V C;  1HCZ A;  1DOM A;  4KY6 A;  3V05 A;  1NCV A;  5M5Y B;  5JEA G;  5A2Q E;  1RCV D;  2HQE A;  1GUS A;  5COR A;  2HUG A;  2WV6 D;  1GHK A;  4G7H C;  3I73 A;  1SEB D;  3P20 A;  1WTR A;  1CA5 A;  1LTR D;  4H7B A;  3T53 B;  2KCC A;  1L0X B;  3PV0 A;  1G8Z D;  3NHH A;  1I4H A;  3M7N A;  3HKZ B;  1LO5 D;  3NWT A;  2JE6 I;  1ICW A;  1JOR A;  1PTO D;  1Q1E A;  3D4R A;  3MXP A;  2XWB B;  4FNF A;  4ILW A;  1W6K A;  3C3L A;  1BCP C;  3NTH A;  1H9M A;  3KLS X;  4KKS A;  2BE5 C;  2K05 A;  4B9X A;  1I6V C;  3NBI A;  5C0X I;  1T5X D;  3D6W A;  3NTI A;  5FLX L;  2IX3 A;  2F0S A;  1XWE A;  3V2T A;  2FMC A;  5JOB A;  2B2V A;  5JVG 3;  4GZY C;  3FMC A;  1A2T A;  4L63 B;  3PIP 3;  1I4X A;  2B2Y C;  2JA8 B;  5D3D A;  1XTC D;  4V0B A;  4C1N K;  4PQX A;  2NN6 H;  2A69 C;  3N52 A;  1GOZ A;  3S1Q B;  5M3M B;  3KF8 A;  1I3Q B;  2O5I C;  1S4Z A;  2H4O A;  5C3X A;  3S2D B;  2MUY A;  3A7A B;  3OIP A;  2N88 A;  3D3R A;  2XN9 C;  2ENB A;  2O5J C;  1JCK B;  2ZXR A;  2PZW A;  3NK9 A;  3MFY A;  2HDM A;  1F2L A;  2NVY B;  2K1B A;  3IAY A;  1LTI D;  1XXG A;  3D4W A;  1WD1 A;  4BY1 B;  4FF3 A;  3VR3 A;  4A3B B;  5FO7 B;  4K2K A;  1ZYR D;  4IAL A;  3GTJ B;  4G7O C;  4LMQ D;  2F0N A;  1TKW B;  1SNC A;  1JWS D;  2R92 B;  5CV9 A;  2E74 C;  1TWF B;  2B2Y A;  3G6J B;  3LWU A;  1SNQ A;  3NTK A;  1SMY D;  2ID0 A;  1S5C D;  4IUP A;  4Q0F A;  1BNZ A;  5JPN C;  5CC4 A;  3Q22 A;  1UEA B;  2DNE A;  3TME A;  3TBI B;  1U4M A;  3FEW X;  5CR3 A;  3TSS A;  1D1I A;  5C44 B;  2AQ2 B;  5FLX E;  2JEA I;  5EQ0 A;  1EY8 A;  2AQ1 B;  5M5X B;  1SE4 A;  4XT1 B;  5KRU A;  3FKI B;  1TY2 A;  1X3Q A;  2J4X A;  5ELC A;  4RGM A;  1O7Y A;  3TZU A;  4M8A A;  1KAB A;  1UUP A;  5D65 A;  1Q90 A;  3I4N B;  1IW7 C;  1NUC A;  3DEP A;  3HOW B;  1LTB D;  1ENA A;  2F0T A;  1LTS D;  1VCI A;  1HQR D;  1BUV T;  1C8C A;  1F2Y A;  1AZP A;  1MBY A;  1QNK A;  3HP3 A;  1EQT A;  4K6L A;  5C3W A;  1X32 A;  3Q23 A;  4CKC A;  2LS0 1;  4KHV A;  1OXX K;  2WII B;  4LK1 C;  1LTA D;  4C1N I;  3KUP A;  1LT4 D;  5LL6 S;  1HFN A;  1NR2 A;  2SNS A;  2Z4I A;  2RSN A;  1H9J A;  4K5W A;  4XQN A;  4X3K A;  1SYC A;  2K32 A;  5JPM C;  2NYZ D;  1SYG A;  3GTG B;  1STB A;  1NR4 A;  5EKK A;  1PTO B;  3HOY B;  3K5O A;  2XIW A;  3HS0 C;  1PZK D;  3E0J A;  5IOC A;  1Q3L A;  2MHV A;  5D14 A;  2C9O A;  4OIJ A;  2NBF A;  1EZ8 A;  2BDO A;  3D31 A;  3F2U A;  4ZK9 B;  3NSW A;  4C56 C;  2K04 A;  4CJ0 B;  1A3U A;  3GTQ B;  2F0G A;  1GUO A;  1ET6 A;  2NB0 A;  4PMB A;  3A55 A;  2XVS A;  4N9T A;  5C3E B;  4IUN A;  3NWS A;  1DZ1 A;  3H09 A;  3HOV B;  2NTS A;  3S14 B;  1HA5 A;  2M2L A;  1PDQ A;  3K0Y A;  3VR5 A;  4NDX A;  4DNT B;  4QF4 A;  3HOZ B;  1ONL A;  4TRD A;  1SE3 A;  3NXW A;  2KED A;  1RD9 D;  1ILP A;  3BG3 A;  3RMH A;  4K2L A;  4BBS B;  4HMI A;  3VR2 A;  4ZYS A;  1AZQ A;  2L5T A;  3ND8 A;  4ZLT F;  4K8J A;  4H0L C;  2KEE A;  3KBX A;  1F2Z A;  1KAA A;  5BN4 A;  5EPJ A;  3OSO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...