1LT5D

Heat-labile enterotoxin b-pentamer complexed with thiodigalactoside
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
103
structure length
103
Chain Sequence
APQTITELCSEYRNTQIYTINDKILSYTESMAGKREMVIITFKSGETFQVEVPGSQHIDSQKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAISMKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEAT-LABILE ENTEROTOXIN
publication title Structural foundation for the design of receptor antagonists targeting Escherichia coli heat-labile enterotoxin.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Enterotoxin
total genus 24
structure length 103
sequence length 103
chains with identical sequence E, F, G, H
ec nomenclature
pdb deposition date 1997-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1lt5D00
1EEID 1ENFA 2NTTA 3DWAA 1PTOH 1RD9D 2XRQD 5D3DA 1QILA 2AQ1B 3SEBA 1SJED 1EWCA 1B44D 5I4DA 3R2TA 4RGNA 1UNSA 1BXTA 1PYWD 4RGOS 1TS4A 3R8BA 1D6EC 2G9HD 5ELCA 1PTOD 3EA6A 3MC0B 1PTOF 1B1ZA 1XXGA 1UUPA 1RDPD 4ZYSA 4RCOA 3GP7A 4RFBA 1ET6A 1S5BD 4RGTA 1LTRD 1JWSD 1SE3A 5FKAC 5ELFA 3BYTB 1JR0D 1LT5D 1LT3D 1XTCD 3URYA 1HA5A 1F77A 1V1PA 1CQVA 4RHRA 3BVGA 4BWGB 1LT4D 1PTOB 1FD7D 2O2LD 4DXGA 1PZKD 1FNWA 2IJ0A 2AQ3B 1KTKA 5D3IB 1PTOC 1PRTF 1EFID 1CT1D 1LTTD 1LTBD 1I4RA 3DWPA 1JWMD 1CK1A 1RF2D 1SE4A 4OHJA 2SEBD 1CHPD 4Z9CB 1ESFA 1EU4A 1MD2D 3KLSX 1HQRD 4DXFA 1HTLD 1V1PB 1DJRD 1M4VA 2TSSA 1GOZA 1PRTB 3OWEB 3O13A 1EEFD 1LTGD 1TS2A 1AW7A 2Z8LA 1I4HA 1PRTC 3DWQA 1S5FD 2XNAC 3W2DA 1TY0A 4C56C 1PZID 1I4GA 3BZDB 1G8ZD 1RCVD 4RHSA 1L0YB 5FK9C 1I4XA 3BYYB 1SBBB 1PRTD 1S5CD 4L63B 4RGMA 1EU3A 1JQYD 1HXYD 1SE2A 3BVMA 1TS3A 2QILA 2R61A 1SEBD 5ELEA 1JWUD 1LTAD 2AQ2B 4TSSA 3R2IA 1V1OA 1BCPD 1LO5D 1BCPF 3EFXD 3V05A 2XN9C 2CHBD 4L6TB 2J4XA 1LT6D 1PZJD 1LTSD 2ICIA 1LTID 2WV6D 1DYQA 4K6LA 1TY2A 2NTSA 1BCPB 1D5ZC 3TSSA 1S5DD 1AN8A 1BCPC 1LLRD 1SXTA 1CHQD 1D5MC 1FGBD 3CHBD 1I4PA 1KLUD 1KLGD 3BVZA 1FNVA 1ET9A 4RH6A 1I4QA 2QEJC 5ELDA 5TSSA 2RDGA 1SJHD 1D5XC 1S5ED 1T5XD 4O1NA 1STEA 2IPKD 1TS5A 3MFGA 5ELBA 1L0XB 2XRSD 4UDUC 1JCKB 2RDHA 1FNUA
chains in the Genus database with same CATH superfamily
2NWGA 4JI1L 5K5PA 5IP7G 1PTOH 2F52A 2K32A 5DLQE 1EQRA 1C0AA 4G7OC 1U4RA 2EOTA 3UDGA 4CJ0B 3KBXA 1PYWD 4NKLA 4RGOS 2VQFQ 3C3LA 3L9AX 3NQIA 4CDEC 5I2XA 1PTOF 4AQYL 3JAME 1EYDA 5BN4A 3OWFA 5C5LA 3ULJA 4U673 1LT3D 3P75A 3RLFA 3I4NG 3OIQA 3T13A 1WTRA 1AZQA 1CQVA 2F0UA 1PZKD 3PUXA 3JC66 4RMFA 4X3KA 2Q2TA 3A54A 2I5MX 2PW5A 4PZ6A 4GS3A 3T1HL 1CHPD 3GTQH 1B50A 3ULLA 1E2ZA 1N33L 1E3PA 1XX8A 2Z8LA 3WOFA 2NVYH 1TQOA 3HEJA 2BE5C 3BZDB 2BOSA 2K14A 1N8RC 1ASZA 2K01A 1TS3A 5DNFA 4TKOB 1BOSA 2F3WA 1SFOH 3C1EA 1LACA 3ONAB 4IPDA 4C3HH 3CCMA 4BY1B 3HOWB 2K5VA 4X66Q 4TRDA 4A76A 4OX9L 3J80L 5I2YA 4FP5D 3TREA 3TS0A 1I94L 4CKEA 1X6OA 4V0BA 1EIHA 1VQ5A 1TWAB 2PMZE 4OO1I 1B3AA 1W6KA 4H7BA 1VQFA 3CD6A 3D4DA 2E2HB 4POFA 4LFCQ 1HNXL 5M5YB 1ESRA 3P7JA 4ME3A 1TWHH 4JI2L 3VYRA 1I4QA 3K59A 4EGVA 2RKSA 5EGTA 1EYGA 1DCZA 2F4IA 4A93H 2F0GA 1STHA 2PQEA 1STEA 4G7ZC 1GHJA 4CHTB 4J15A 1WTXA 2MO0A 4JW0A 1JOOA 2N55A 4LNQA 1S40A 3MXPA 3GTOH 2O5JC 2H4OA 1F2YA 3W1BA 1VQAA 3J81c 5KYIA 2Q8RE 3F8TA 2D0PA 5CV4A 2JP1A 1Y1VH 3S1NH 2B2UC 4A3DG 3SR1A 3CCRA 2PZTA 3OOCA 2OCEA 4FXDA 4IO9A 3NELA 2F0LA 4DV3Q 5E4WC 5FJ8H 4RFBA 3MXGA 4GN3B 1S3OA 4DV2L 5C3EG 4JI7Q 2K5QA 2E2JB 1SYEA 2BA0A 4DR4L 4NXMQ 4KV6A 5GADC 2KHIA 1VQLA 2Z6BA 4HMJA 3J81i 4FF2A 4DR3L 2A74C 2A68D 2K7VA 4DV1L 3OPOA 2OT2A 2Z6KA 4KMUC 5JAVA 4YY3L 3SK8A 1AP0A 3CCJA 3HOVH 4M8AA 1XNQQ 5KNCA 1DJRD 1KL9A 3GTGH 4ZUJA 1SROA 2UUBL 2F0JA 5IP7H 3RD4A 1R4QB 4K0KQ 3HFZB 5IYCH 3I55A 3V96A 3RNUA 1PXUA 1X56A 2B8GA 3HOYG 5C4ZA 4J1MA 1P8LA 4XIGS 2V1CC 2WKCA 4KY7A 3WWVA 1RHPA 3BYYB 4X3SA 3RN2A 3ZYYX 1QNKA 1C8CA 3PF4A 5FO7B 2EIFA 2HT1A 3NHHA 2YTYA 4A3KB 1BCPF 3I4NH 1Y1WB 2HDLA 4DV0L 1VS0A 2NBFA 4YWKA 3IKJA 5K36G 4IFDJ 3TZUA 1DYQA 4XT3B 3FDTA 1NR4A 2FHTA 3SE0A 4RAUC 4PQXA 4LF4Q 2PNHA 4K5WA 4I7AA 3CF5A 3CMEA 1AZPA 3I2ZA 1L1OA 2C35B 1J8IA 4AYBG 3OIPA 1A62A 1N32Q 1FNVA 1F9QA 3GQBA 1E1TA 4TQUS 3J80c 1SNMA 1T5XD 2BDNA 4FXKC 4KN7C 1PYSB 5KEEA 3PUWA 1H9KA 4BY1G 3HOWG 3AYHB 1SYGA 2JA7B 1JJCB 2K33A 4QIWB 2CCZA 4L63B 4B3SQ 3DWAA 2R3ZA 2NVXH 3CC7A 3KF6B 2KECA 5BN5A 5I4DA 4DR2L 3KOJA 1UNSA 1Q46A 1Y8OB 1YEZA 2CW0C 4X64Q 1QVFA 2UXDL 5JPMC 2JEBI 4IN3A 3QO2A 4JPBW 4QL5A 3KF6A 1YIJA 1EL0A 3J80i 4MIUA 4LUOA 2WP8J 3E0JA 2EYMA 4RGTA 3D4WA 4DUZL 3WOEA 2N78A 4KTAA 5FLXE 5AJ3L 3BYTB 2GVBA 3MA2B 2ZXRA 1HCZA 3M85A 2B2YC 2F0OA 2B63H 2ALYB 4BBSG 4O42A 4A3FB 1A3UA 3H91A 5JEAJ 1IBMQ 1GUGA 1JWMD 2R7DA 2F0VA 3A7AB 3BDOA 1TWGH 2JYOA 1Z6HA 2I0QA 2VUMB 3T53B 4YIJA 2HHHL 2A73B 4DR1Q 4A3MB 3O13A 5CV7A 4QCLA 4B08A 2CWAA 1PRTC 2KCNA 3MEHA 2B2WC 3A8KE 3CW2C 2JK8A 5KNDA 4L5SA 3FPPA 4DFAA 2MPMA 3CPWA 1L2FA 4RWSC 4CJ2C 4JC0A 4GKJL 1G291 4XQJA 4HR7B 2RSNA 1CSQA 1V1OA 1VDZA 5C3EH 4KD3A 1LUZA 4Y7NH 4FF1A 1EOVA 2EYHA 2Y0SB 2J4XA 2HQLA 3S17H 1WTHA 2EPBA 4KD4A 2WKDA 2AHOB 5C0XG 1LTID 2K5DA 5D14A 5C4XH 5IP9G 3RZOB 1H9RA 1N34L 5E4XA 4CJ1B 1K3BC 2DNEA 1ZEQX 4RH6A 3N6RA 4LUZA 3M4YA 3SK6A 2L9HA 5HY6A 2Z1CA 5FOBB 3QWNA 2ENBA 2CW0D 2K50A 4LJZC 1EIGA 1KXLA 2M2LA 1Y1WG 3GTPB 3K0YA 1KHIA 1SJED 4DAVA 3K5LA 1EWCA 4JI5L 2KEEA 1YNXA 1KAAA 5JJIA 3A5ZB 1BKBA 2PYKA 3GO5A 5A35A 3PGZA 1GUOA 4P71A 4AH6A 4BA2I 2L5TA 3I70A 2WACA 3D6CA 3KDFA 4DA2A 1K73C 1PH1A 5K36H 1ET6A 2Z9HA 2ZTEA 1C4QA 4OELB 1LT5D 1HR0Q 3BZCA 3S15H 4LUVA 4JYAL 1CA6A 2WAQE 4X3UA 1EOTA 1V1PA 2JE6I 4HAEA 4HJ7A 1B70B 1JJGA 2O2LD 1KTKA 4HCEA 2RA4A 1VQ8A 2H1EA 3MAQA 3HP3A 5EKIA 4HIMA 3KJOA 1CKNB 2UXBL 4A3BH 5EBCA 3FKIB 1VQMA 1NE3A 4N8FA 1E22A 4DN4M 2F0EA 3H3VI 4LK1C 1SR3A 5HGTA 1PZID 1TWAH 4YHHQ 2ZTCA 1U9RA 2NZ1D 4A3GB 4B3ML 4JI0Q 5M9OA 3E5SA 3TQYA 3H3VH 1UE5A 4S3SA 2E2HH 2XWJB 1PH8A 1HA6A 5M5YH 2YV5A 1CUKA 4KI0A 1X55A 3BVMA 3D4RA 2IL8A 2R61A 1CM9A 2A69C 1AH9A 3UI2A 1Q3LA 1CTMA 5EBDA 3K5NA 3WDNA 4J6HA 4QGUA 1ENCA 2VUMG 3S1MB 3CC4A 1GXDC 1TWCB 1AFPA 3HOXH 1MHWC 2F0KA 1XWEA 5CBEE 1EUJA 4KKUA 3S1RB 4FXGC 2F0QA 5EKKA 2IY5B 1CKMA 1EZ6A 1QCBD 2CWPA 5E3FA 2A6EC 3TRZA 4NP5A 4DGZA 3PUVA 1KRSA 4X65L 2C9OA 3QG1A 2WIIB 3F2DA 3T1YQ 2B2UA 3SGIA 1EY4A 1WJJA 3AFPA 1DM0B 4O1NA 2RHQB 1G6PA 1TS5A 1J9OA 3U9OA 4GKKQ 3CCLA 2E2JH 1WYDA 4J8QA 1IBKQ 1IW7D 3IFDA 4KHZA 3STBC 4JCVE 4IJLA 3OW2A 5C0XI 2R92G 3R8BA 3S16B 4QJFA 2ZM6Q 1PH4A 4RCOA 2Q2IA 1T5EA 1HR0W 5C0XH 3HOUB 2LY7A 5IP9H 1LABA 5IGBA 1OO9B 1EYAA 1A3TA 1VF7A 4JI6L 2IX1A 2QGQA 3FRPB 5J3BA 2F0DA 4YCUA 3FP9A 4DV6L 2LSSA 1QJOA 4HTHA 3KFUA 4JI8Q 1I3QB 2V4DA 1WOCA 4X62Q 1PH5A 5CC4A 3NBHB 4NB3A 1QUQB 3Q8DA 1M4VA 4A3KH 5CV8A 2PW7A 2SNMA 1BR9A 4EQ5A 5FLMG 3T16A 3D0FA 1LTLA 4JV5Q 4KN4C 5KNBA 3K57A 5M3MB 4A3JB 1Q12A 4RGMA 2D2CC 1MJEA 4JBMA 4MNOA 5BN3A 4DAYA 1XPUA 4K2KA 5H1SE 2IWHA 3I4MB 2WB1B 2A6ED 1J5EQ 1XNRL 1Y8NB 3RLOA 1JOQA 2JA7H 1YNNC 4LF6Q 1WTWA 3TBIB 2EE1A 5I6WA 5LMNQ 1SAPA 2FINB 1SN8A 1PFSA 1S5DD 1BO0A 3M3YB 1LLRD 4A3GG 3D31A 2G9DA 1I4PA 3J80E 4HEDA 5IYBG 3I4OA 3SK5A 3BVZA 2DJGC 2QEJC 5ELDA 1H95A 2XTIA 2M00A 4JG2A 3STBD 3I7FA 4B3RQ 3E9HA 5COYA 5ELBA 1WTPA 4UDUC 2F0SA 4BBRB 1EFWA 2ATWA 1WI5A 1GUNA 3MXNA 2KJXA 1TVXA 2WINB 2VB2X 3QIAA 4X66L 1VQ6A 4Q5VA 2B2YA 4A3FH 1HTPA 2K6AA 3CC2A 2B2VC 1RKNA 3R2TA 3J81L 1VMCA 1PFNA 3ERSX 4P72A 1A0IA 1EY6A 2NVQB 5ELCA 1ENAA 1IXRA 2DJFC 2JJQA 4JBWA 1XXGA 4ZYSA 1UUPA 2KCTA 1BF4A 1UWVA 1NCVA 3S2DB 5C44G 4A3MH 2H5XA 4LF5Q 2KOLA 4LFCL 2JXMB 3E6ZX 4H13C 5EAYA 1F77A 2RHSB 1J6QA 1OXUA 3E3XA 4BWGB 4LW1A 3CCUA 2JA5H 1K3RA 3M4PA 1RTOA 2MHVA 2PI2A 1VQDA 1FNWA 4ZKBB 2AQ3B 2B2WA 2JN4A 4XQNA 1PTOC 3ULPA 2KCCA 2E2IB 3HRZC 4RG1A 2A19A 1GUSA 5T1IA 3J81j 1U4PA 3UDFA 2ZJPA 3N52A 4YWMA 4DXFA 3A8JE 4O0AA 2WFWA 1GOZA 3CCVA 1BUVT 4HJAA 1QE6A 3GV3A 3HOYB 4FF4A 1H9MA 2XNAC 5IGEA 4DV7Q 1V8QA 5CYUA 3HOUG 1RJTA 2EY1A 3H0GG 1CZWA 2O5IC 3RZOH 4DV3L 2KVMA 1YHQA 2UXCQ 5GAEC 1XPOA 3S14H 2RBMA 1YNND 3TN2A 4JI7L 1FJGQ 2RCNA 4IUUA 4IJHA 3S24A 3R2IA 4DUYL 1WTVA 4NXML 4CGYB 5C3WA 4EX5A 4XQQA 4HN7A 4FYDA 1OXXK 1QNUA 5IGGA 1SNOA 5LMNW 1DOLA 1STYA 2CQOA 4UP7A 5J22A 3QOJA 3FVQA 4MZ9A 4EQOA 2ZXPA 1PYBA 1SMYC 4GLAC 4AYBB 3RZDH 2ZJRA 1A6XA 1WCMB 1B9MA 1IBLQ 4MHEA 2IW3A 4DAPA 3L7ZC 5M3MG 3PCOB 4A3JG 4K0KL 1ET9A 3KYHC 4OL7A 3VA5A 4HSPA 1UE1A 2QDLA 3PO3B 4U68A 3NK9A 1PV4A 1B8AA 2R7FA 2VNUD 2Z0SA 3GTLH 1KRTA 4E6IA 1C48A 4ZQ3A 4A3CH 3SDZA 1KDAA 5EPJA 3I4MG 2WB1G 5FO8B 2UUAL 2XVSA 1ZYRC 1RD9D 1SYDA 4YCWA 3NE5B 1O7LA 1TWFB 1NSNS 1VMPA 4HJ8A 2AWNA 2XSCA 3NXWA 4RGNA 2GA4B 4OO1H 1HUNA 1BXTA 3KBGA 3NEMA 5JVH3 4DR5Q 5EKLA 5M5XH 1TS4A 1PTOD 3UDXA 3PF5A 3FKIH 4F8MA 4LF4L 2L15A 4JI4L 1RTNA 1B2TA 3HKZB 1A63A 4F87A 1RIPA 4BBSB 4BXXG 4K8JA 1N32L 2FFKB 1K0RA 3K0XA 1W6JA 4A3GH 4BBRG 1A3VA 2I5LX 1YBYA 4CKCA 3TMEA 5I6YA 4QUCA 1B9NA 3KLSX 1T9HA 4K5VA 5IE8A 1EQQA 2L1BA 3KLWA 4KLKA 3OWEB 1ASYA 2OQKA 2L11A 1BDOA 1NMGA 2K05A 5KGUA 1JOKA 4C56C 4X64L 1A15A 3NWTA 3S1RH 4A3IG 4GNXC 1L0YB 4LMQD 4JI3Q 1AE2A 3VR6A 5ELNA 1K0SA 1OXTA 1PA6A 2BE5D 2KENA 1SMYD 3C2PA 4N8X1 1MIUA 1STGA 3PO2H 3EFXD 4LF9Q 1SYFA 3K81C 1IBML 4CDDC 4RKLA 3EQLC 3AEVA 3TP6A 2SNSA 1V43A 1QB5D 2E5LQ 3NTIA 4IPGA 2KCMA 4PNYA 2I46A 2WV6D 2ICEC 3K5MA 2RSOA 1VQ7A 2DN8A 4ALPA 4DV5Q 1O78A 4DR1L 1BCPC 4B9WA 4JK1C 1Z7TA 1ZYRD 1VQHA 2PPBC 3KF8A 1TT2A 3S16H 1CQFA 4BA1I 2IX3A 2K5HA 4QB4A 3VA7A 1ILQA 2BA1A 1VQPA 1V9PA 3I73A 3Q22A 3J7YW 2D0OA 1L1OB 1DD2A 3I8ZA 3HG9A 1FNUA 3QR8A 4WJWA 1XMQQ 2AQ1B 1W2BA 3P20A 5GQOA 1X3PA 1HZAA 4ULLA 4FF3A 2K03A 1TIID 2HIXA 3GTMB 4A3EG 1WCMG 1ZXTA 5CV5A 3EA6A 1VQOA 1KNEA 1B4OA 1B1ZA 1K83B 1S5BD 3PO3G 3I56A 1IYUA 3H6MA 1XTCD 4A75A 4YWLA 3D8GA 4H02A 1ICFB 2ZTDA 1K8AC 3LX0A 2E75C 4ZUIA 3G6EA 1SYBA 2KHSA 5M3MH 1STNA 3AFQA 2K52A 2LXJA 1ICWA 4C1NK 1I4RA 3ITPA 3CCSA 2F0TA 2SEBD 4K8IA 1HUMA 4IFDG 1EU4A 1B3QA 2VL6A 3AQQA 4C1NI 1BNZA 1F9PA 2EYJA 4NXNQ 3DWQA 5CORA 4Y52H 2KUMA 3F1ZA 4L5RC 1DONA 1NJIC 3HKZG 5J1ZA 1DZ1A 1XTDA 3J7A5 4LF8Q 1JQYD 2CH4A 1AEXA 3M3YH 4GN5A 3MHBA 2VQEQ 3GV6A 1HR0L 4LWCA 3PUZA 3M4OB 3MVVA 2JA8B 1BCPD 2NN6G 2JEAI 2QW7A 3BZKA 1Q86C 4BBRH 3S1QB 3L3OC 3S2HB 1LT6D 1ML0D 1X3EA 4UPAA 1STAA 1U0LA 1B7YB 3ND9A 4PZ8A 1HH2P 1E24A 5F2DA 5JOBA 3TSSA 3KUPA 4A3DH 2UUBQ 4MTKA 2R7ZG 1KLUD 4LF7Q 2VS1A 2B2VA 4YHHL 2NVQH 1Z9FA 4JI0L 2ZXOA 2VY3A 4IUPA 3S2DH 5JEAG 1D1KA 2IPKD 5C4JB 1HQMC 1X3GA 3S9WA 2RVLA 3JAMc 2VB3X 2MUYA 4LFAQ 4XYQA 3F2UA 4HMIA 3KLSA 4GOPC 4KY5A 4RCNA 4CDFC 1V1QA 2I5HA 1G91A 5CR3A 5J39A 3PUYA 1K9MC 4DV0Q 2CKZB 1KAWA 4DK3C 4WJ3M 2R92B 1HNZQ 2E2IH 3G7LA 3BS1A 3K6OA 3TDQA 4FO2A 3BJUA 1CSPA 2Q8IB 1IHZA 1CZGA 5KRUA 3HOYH 4TVAB 1Q82C 2AKWB 3JAMi 3URYA 3SHLA 5DEHA 2FMMA 4RHRA 1HNWL 1CKOA 2DNCA 3LWUA 3T1YL 3NTKA 1SLJA 1WTQA 1K8OA 3A56A 1E2VA 2NVTB 3KDFB 1ZKOA 1KNAA 1E0BA 4K2LA 4R4QA 4GKKL 1ESFA 4YCVA 1MD2D 4ZCKA 1B53A 4DNRB 1NTGA 3J7AV 1V1PB 4H0LC 5GROA 1PH3A 1IBKL 1PDQA 1GJXA 1NNXA 3G4SA 3CKIB 1VQIA 2OEOA 2NVYB 1S5FD 4XYOA 4LFBQ 2EYOA 5IYDG 3TS2A 1VQCA 3R3OA 2CFMA 2N3SA 2ZM6L 2E76C 1FVIA 1PRTD 2L12A 4KK7A 5AJ3Q 2MJ8A 4EVOA 1L0WA 1NMFA 4C3HB 1JT8A 3PO3H 3HOWH 4BY1H 3C46A 4IUQA 4L5TA 4PMBA 2YU9B 2ASBA 5GAGC 2CHBD 2K1BA 3LNNA 2LMCB 4WJ4A 1SNPA 1H9SA 1Q1EA 4JI8L 4IFDI 4QIWE 4X62L 1KABA 2J0TD 5LL6S 1EWIA 1D5ZC 1TWFH 1I6HB 1TWHB 4IFDH 5IGDA 2B39A 2IHEA 3H3VC 1CHQD 2NZOA 2A1AA 3AMUA 2EJMA 3TP7A 4QQBX 3PIP3 4JV5L 5LMUQ 3SXHA 2OQ0A 3CPFA 2XRSD 1E2WA 3CU7A 2JA8G 2D5DA 3M4QA 4BBSH 5G3LF 2JA6B 2F4VQ 5DM73 2XRQD 3VYSA 1QILA 3TP5A 2NN6I 1DXMA 1J5EL 2RCFA 1HZBA 3EBEA 3K7AB 4UP9A 5C44B 4NPSA 4PV1C 1I5FA 3MC0B 2A6HC 4LF6L 2KHJA 3Q6SA 5LMNL 1GM5A 1II3A 1NAPA 2I07B 3MTSA 2EY6A 5I9PA 2FJ2A 3KJPA 3M7NA 4G4KA 4DR7Q 1KQSA 2EZVA 2L0CA 3J81E 1RODA 1QWYA 1HRJA 4ODGA 3DUZA 1EY7A 1D2BA 2IJ0A 2EXDA 1N36Q 2JQOA 3CMAA 2HIVA 1TR5A 4L8JA 2F03A 4B3RL 1CK1A 3EIVA 4GNXA 1IKLA 3L0OA 3OSOA 2B29A 1QVGA 4JBKA 5JEAH 1S72A 2SDFA 3HOVB 1BBUA 1YJWA 4P75A 3GTGB 1EEFD 1BBWA 1U4MA 5CV9A 1AW7A 5BR8Q 5JJLA 1I4HA 3ER0A 2Y0SE 3I3CA 1NR2A 3PMFA 3W3AA 3IL8A 3U9SA 3H0GB 4M1UB 4B3TQ 1PVOA 1RCVD 1I4XA 4LF5L 5GAHC 4JYAQ 4K14A 5D65A 1OXSC 3UDIA 3BG3A 1E1OA 2NB0A 1LO5D 1STBA 2Q2UA 2XN9C 1Y1WH 2HCCA 2A69D 3QOLA 4L6TB 3DMUA 2IHFA 4R4TA 3A8IE 1LTSD 3I4LA 4DAYB 4CBVA 4WRDA 2VQFL 1WTOA 5CBAE 1TKWB 2BH8A 3I72A 1HPCA 4IALA 2B3GA 1VQ9A 2MNAA 1Q81C 4G57A 3K80C 4DAMA 2EVBA 1P16A 3I91A 5A2QL 3MFYA 4DV7L 3A55A 5IT9L 1PH9A 3NENA 1PHJA 2CVRA 1D1IA 2G5DA 4HIDA 2UXCL 4PG3A 4C3HG 1K83H 3NTHA 3MFGA 3VDYA 5EJWA 1K28A 1YHBA 3M7GA 3GDEA 4NDXA 5FLXc 2RQXA 2PMZB 1Q90A 3FPUB 4I65A 4IUVA 4C3JB 1FJGL 3U58A 5D3DA 3CAMA 3SEBA 1X32A 3NQTA 5E7NA 2RF4A 4R9WA 1SDFA 2B2TC 2EDGA 4R4OA 1D7QA 2YTVA 4IQZA 2EYPA 5C6AA 2F0WA 2XWBB 1D6EC 2G9HD 1FGUA 3MXNB 2UUCQ 3GP7A 2JSOA 5ISRA 5M5WB 1IBLL 5FKAC 3DM1A 4X65Q 1PH2A 3DM3A 1PH6A 5T1GA 2QA4A 2LKVA 5M3FB 3ERQA 3Q23A 1LT4D 2DY7A 4DNTB 4A4IA 2KBNA 2JA6G 1XYIA 3G48A 1RF2D 1SE4A 2OTJA 4Z9CB 1Y1VG 2OWOA 3M4OH 4UAIA 2X6GA 2EQSA 2VUMH 4QMGA 2JA8H 1PRTB 1TS2A 3A0JA 1KD1C 2RDFA 4JOIC 4C2MB 1YI2A 2AMCB 4DF7A 4A3IB 3S2HH 3M9BA 4DR5L 2NZHA 2J7ZA 3CXCA 4G7HC 1A2TA 3CQZB 1H9JA 4CKBA 4KHVA 1S5CD 1W3SA 5DM63 3F2CA 2YTXA 3I90A 4TSSA 5CV6A 4RA8A 3A5UA 3MXUA 1NUCA 4Y7NB 2F0HA 2N49A 3HOVG 5C4JH 3LWEA 4WFN3 5IWAQ 4X3TA 1VQEA 5C4XB 1EIFA 2ICIA 3T51B 3TEHB 5IYCG 4GOPA 1HZ9A 4ABNA 3G71A 1AN8A 1HHVA 1SXTA 2R92H 5IOCA 1D5MC 3CHBD 1VQBA 1XPRA 4OEMB 1XJVA 2AWOA 1GVPA 4BS9A 3MEFA 1SJHD 2EJGC 1YJ9A 1SRUA 2LS01 3QJYA 4JI3L 3A74A 4IPHA 4UHVA 1Q8KA 1D8LA 3F2BA 1UEBA 1X3FA 2R93B 4Q0FA 2RDHA 3UE0A 4ZLTF 1ENFA 1MGSA 2NTTA 3DHQA 2MGSA 5CMDA 3GTPH 1YJNA 1XNRQ 2IT1A 2X6LA 2NYZD 1XNQL 2UU9Q 4LF9L 4A3EB 3J7AF 5C3XA 1MKHA 2NVTH 4JBJA 5IT9c 2E5LL 3VR3A 4IOCA 5JJZA 2FXQA 2TMPA 2QDBA 3T56B 3GTJB 5FLMH 2P5ZX 4DV5L 4LAAA 1GHKA 3A7LA 4C3IB 3S15B 5LHY1 4F7XA 4KHPQ 2A68C 1HA5A 2VW9A 1Y69U 1YNJC 4B9XA 4DXGA 3OTOQ 1PFBA 1U5KA 4C3JG 5JJKA 2AUJD 3DWPA 1X54A 1XMOQ 1O7YA 4A3BB 4HCSA 1MI2A 2O4XA 3CP0A 3Q0AA 2N8NA 3H94A 3RUZA 2TSSA 2WB1E 1XMQL 2PZWA 2YU9H 1VQNA 2F1MA 2SOBA 3AB9A 4F88A 4DR6Q 4ZK9B 3HGBA 5I9OA 3ICEA 3PQIA 5FK9C 1GKHA 2K5WA 2M9VA 2Z4IA 3X3MA 4DV4Q 5M3FG 2DGYA 1SBBB 2PCFB 5IYBH 2B63G 1VF5C 5E1FA 1I6HH 4BY7B 4DK0A 1SNCA 1JE5A 2QILA 5ELEA 4PMWA 3PV0A 4JI1Q 1LTAD 1JB3A 4B3SL 1F2ZA 2Q2HA 1A2UA 1KC8C 3NWSA 3HOXB 4DKAC 3S1MH 2IX0A 1UAPA 5DAUA 1PZJD 1TWCH 3DLLA 4H44C 2F0IA 2ID0A 2JA6H 1TU2B 4HIOA 4K6LA 4AQYQ 2R7ZB 2HD3A 1KDCA 2PZUA 3BDCA 1YHAA 3BDLA 1I6VC 3QB3A 2L4NA 3X3NA 4NXNL 1LV9A 1KLGD 3K7AH 3NBIA 4DNIA 5C44H 3FHWA 2CH4W 4R8IA 1C7YA 2PI2E 1QVCA 4P2CB 5L37A 4I7ZC 1AE3A 4LF8L 4MN3A 4HSVA 3T1HQ 2VQEL 1UEAB 4RKBA 2AUKA 4DUYQ 3JAML 2QEXA 1LYLA 3KF8B 5ELOA 2N88A 5IODA 1N33Q 1NBWA 5C4XG 1CA5A 3HKSA 3C1FA 1YNJD 1DGSA 1MBYA 4NW2A 1G51A 1HJPA 5C4HA 3VR5A 3PSIA 1SE3A 3HOUH 1JR0D 4JVZA 1R9TB 2XGTA 1EQVA 3H0GH 4LF7L 3K5OA 3NSWA 1A8VA 4XT1B 4KKTA 3OW7A 1FD7D 3HOZB 4OX9Q 4UP8A 2R93G 5D3IB 2PNRC 1EFID 1CT1D 1LTBD 3RLNA 1K8GA 5JPNC 2HUGA 1IL2A 4OHJA 1I94Q 1MSGA 4X6AH 2UUAQ 4LFAL 1JORA 1S4ZA 1X9NA 1I3QH 1HFGA 1JICA 1HTLD 3D3RA 3EVQA 3TP8A 5KIXA 3W5OA 1I50B 1HNXQ 1JMCA 1QG7A 4JI2Q 1IZ6A 1HNZL 2WAQB 1I4GA 3K7UC 2L55A 4C3IG 3NUCA 2BDOA 1EZ8A 4RHSA 2EXZA 4AYBE 1EY9A 4JI4Q 1M8AA 4A3JH 1EU3A 1OTCA 1HXYD 2ES2A 1SEBD 4QY7A 2HCIA 1F9RA 2VZAA 2AQ2B 1LM0A 4A3BG 3I4MH 2K04A 3K58A 4IUTA 4DU9A 2OXPA 4XDXA 1E7ZA 2K75A 3FEWX 4FVMA 3GTKB 2F0PA 4C3JH 4UY8C 1EIYB 3HZXA 2X69A 2NTSA 2E8GA 2KA7A 1FR3A 4ZRZA 2YYZA 5KYLA 1RL2A 3V2TA 3OHXC 1X3QA 3EROA 4DV2Q 1QZGA 1KDBA 1WD0A 1MSHA 1O80A 4BY7G 2B2TA 4DR4Q 4LFBL 2RDGA 4POGA 1SNDA 1O7IA 4ID6A 1S5ED 4DR3Q 2EJFC 4BXXH 2PO4A 2NUCA 3HKZE 5M5WH 4DV1Q 1G2TA 3H15A 4EQPA 1NY4A 5IIFA 2JA9A 4DK1A 5M3FH 1K8MA 4YY3Q 3HOXG 4IZ8A 2KQ3A 1FL0A 4PMCA 1MJCA 1F2MA 5C0XJ 1YVCA 2EY5A 3NPPA 1WD1A 1ONLA 3IRBA 1JWSD 1Q8IA 4C2MH 3IAYA 2ZJQA 4A3IH 2JA5B 4JOIA 4R8NA 1PTOB 1JC7A 3IFTA 5LMUL 3CQZH 1PRTF 3VYTA 4OIKA 3HS0C 3RMHA 1FYCA 1Y14B 1HQRD 2F4VL 1R4PB 2E74C 1EY5A 1G2SA 3R93A 2EY2A 1Q7YC 3W2DA 2LFNA 2Z4HA 4L5QA 1G8ZD 3LGJA 3FMCA 3S14B 4GLVB 2CQAA 4OGQC 4KJOA 1DOKA 1SMXA 4XXEA 3HOZG 4R4IA 4DR7L 2FMCA 1GUTA 2QF7A 3GTQB 1TXYA 4P74A 1SSOA 4DR2Q 1N36L 3H09A 1X65A 3RN5A 1EWHA 4A3KG 3OYYA 4OONA 1SNQA 1WVLA 1YZ6A 4ILWA 3PIPA 2UXDQ 2R93H 1HFNA 2MFIA 1CI3M 3RZDB 1TY2A 3NP8A 1GD7A 1VQJA 2WAQG 4DUZQ 3EN2A 5BR8L 1WCMH 4A3EH 1FGBD 1SFOB 3KLRA 4B3TL 1H9SB 3DEPA 3VR2A 3GTLB 1D5XC 3GTJH 1IW7C 1Z47A 3AU7A 1BBXC 4C3IH 1UE6A 5EQ0A 4QF4A 1Y8PB 1EEID 2HHHQ 2JA7G 5A2QE 5FLXL 5IT9E 1OXVA 1B44D 2EYLA 2E2DC 2ZT9C 3GD7A 5M5XB 1EY8A 4XTCS 5IY0A 4A93B 4FDBA 3SVMA 4APVA 1CKNA 3DEOA 4N9PA 4GKJQ 5EPLA 3GTOB 1VQ4A 1HZCA 3BVGA 4A3LG 5FO9B 1WFQA 2R6GA 3OMGA 4IPCA 4BY7H 2D9UA 1Y1VB 3S1NB 2MP1A 4A3FG 1C9OA 2F0NA 5LL6X 2NN6H 1CFMA 4WORA 1N34Q 4ME5A 1LTGD 1JJ2A 4A3MG 4GNXB 4QUFA 2EYFA 2KEDA 2C5CA 1PFMA 2R7ZH 2Q8TA 1IKMA 2JA5G 2UUCL 2Z6KC 1GO3E 1SE2A 1U4LA 3W1GA 3J7ZC 4N9TA 4EQNA 1HNWQ 3MZ5A 3U4VA 3CCQA 1JWUD 1G6ZA 3PO2B 3E0EA 4OXPA 2BCOA 2F0MA 2F3IA 4OWXB 4JI5Q 1BVSA 4GN4B 3U50C 4HJ5A 1IL8A 3DXJC 2F0FA 2Y0SG 2OF1A 1M90C 2VXWA 1PLFA 1BCPB 3UE1A 3PIOA 1ILPA 1N9WA 2F3VA 2D62A 1EYCA 5IGFA 1BQQT 4KJNA 5HGQA 2BH2A 1UE7A 1F2LA 3I4NB 3RR5A 3T4AC 1IYVA 3K8AA 3E9IA 1KIXA 2UXBQ 4OWTB 1R9TH 5G3LD 1JCKB 4R4CA 2MQHA 5AFWA 2XIWA 1F9SA 4DK6C 1L1OC 3HOZH 1EY0A 4OIJA 4IURA 2DUDA 5EPKA 1PH7A 2LXKA 2OTLA 4O2DA 1GUWA 5IWAL 1QOHA 1DOMA 3GTMH 3CCEA 4B3MQ 1Q1BA 4R1JA 2QKIC 3B6YA 1RDPD 5JVG3 1M1KC 1I50H 4HIKA 1O7ZA 2B8FA 3BU2A 3PIO3 1LTRD 4AIMA 4ZAIA 5ELFA 3NBHA 3P1HA 5IYDH 1QUQA 4A3CG 2A6HD 3EJIA 1EQTA 5NUCA 2NVXB 3CRLC 1LTTD 4FNFA 3G6JB 4IOAA 5IGCA 4OO1G 1SE8A 2DY8A 2K5NA 2A5HA 3L2PA 3D6WA 2PQAB 4PZ7A 2UU9L 4K6DA 5C5MA 2K28A 3FKIG 3MWYW 4GLXA 4DPGA 4A93G 1TY0A 3GTKH 2B63B 4MTNA 4ZKCB 1VQGA 2PQAA 4NMZA 1PMRA 2K4KA 3U4ZA 1YITA 4IUNA 5HURA 3OMCA 3ZJYC 4OWWB 4V190 3ND8A 1TWGB 2GN5A 4HJ9A 2MO1A 4KHPL 5CGKA 3SK4A 3OTOL 3V05A 4P73A 3KK7A 2HDMA 4A3LH 5FJ8G 1XMOL 1JB7A 3TZDA 3S1QH 2HQEA 4A3DB 3VYUA 2GVAA 4GZYC 1VCIA 2A8VA 2QCPX 4JI6Q 4DR6L 4K5XA 1VQKA 5TSSA 3VR4A 4KKSA 1SYCA 4CDCC 5C3EB 4DV6Q 4DV4L 3CRKC 4GOPB 1IYJB 3PO2G 1JE4A 1L0XB 3S17B 4KY6A 1QZHA 3Q24A
chains in the Genus database with same CATH topology
2NWGA 5K5PA 1PTOH 2K32A 4G7OC 1U4RA 2EOTA 4CJ0B 3KBXA 1PYWD 4NKLA 4RGOS 3C3LA 3L9AX 3NQIA 5I2XA 1PTOF 3JAME 1EYDA 5BN4A 3OWFA 5C5LA 4U673 1LT3D 3P75A 3RLFA 3OIQA 3T13A 1WTRA 1AZQA 1CQVA 2F0UA 1PZKD 3PUXA 4X3KA 3A54A 2PW5A 1CHPD 1B50A 1E2ZA 1XX8A 2Z8LA 3WOFA 1TQOA 3HEJA 2BE5C 3BZDB 2BOSA 2K01A 1TS3A 5DNFA 4TKOB 1BOSA 2F3WA 3C1EA 1LACA 3ONAB 3HOWB 4BY1B 4TRDA 3J80L 5I2YA 4FP5D 1EIHA 4CKEA 4V0BA 1TWAB 4OO1I 1B3AA 1W6KA 4H7BA 3D4DA 2E2HB 5M5YB 1ESRA 3P7JA 3VYRA 1I4QA 3K59A 4EGVA 2RKSA 5EGTA 1DCZA 2F4IA 2F0GA 1STHA 2PQEA 1STEA 4G7ZC 1GHJA 4CHTB 1WTXA 1JOOA 2N55A 3MXPA 2O5JC 2H4OA 1F2YA 5KYIA 2Q8RE 5CV4A 2JP1A 2B2UC 3SR1A 2PZTA 3OOCA 4FXDA 2F0LA 5E4WC 4RFBA 3MXGA 2K5QA 2E2JB 1SYEA 2BA0A 4KV6A 4HMJA 4FF2A 2A74C 2A68D 2K7VA 3OPOA 2OT2A 5JAVA 4KMUC 3SK8A 1AP0A 4M8AA 5KNCA 1DJRD 4ZUJA 2F0JA 3RD4A 1R4QB 3V96A 1PXUA 2B8GA 5C4ZA 4J1MA 4XIGS 2WKCA 4KY7A 1RHPA 3BYYB 4X3SA 3ZYYX 1QNKA 1C8CA 5FO7B 3NHHA 4A3KB 1BCPF 1Y1WB 2HDLA 2NBFA 3IKJA 5K36G 4IFDJ 3TZUA 1DYQA 4XT3B 3FDTA 1NR4A 2FHTA 3SE0A 4RAUC 4PQXA 4K5WA 1AZPA 1J8IA 3OIPA 1FNVA 1F9QA 3GQBA 4TQUS 1SNMA 1T5XD 2BDNA 4FXKC 4KN7C 5KEEA 3PUWA 1H9KA 1SYGA 2JA7B 2K33A 4QIWB 4L63B 3DWAA 2R3ZA 2KECA 5BN5A 5I4DA 1UNSA 1Y8OB 2CW0C 5JPMC 2JEBI 4IN3A 3QO2A 1EL0A 4MIUA 2WP8J 3E0JA 2EYMA 4RGTA 3D4WA 3WOEA 4KTAA 5FLXE 3BYTB 3MA2B 2ZXRA 1HCZA 3M85A 2B2YC 2F0OA 4O42A 4A3FB 1A3UA 3H91A 5JEAJ 1GUGA 1JWMD 2F0VA 3A7AB 3BDOA 2JYOA 1Z6HA 2VUMB 3T53B 4YIJA 2A73B 4A3MB 3O13A 5CV7A 4QCLA 4B08A 1PRTC 2KCNA 3MEHA 2B2WC 3A8KE 5KNDA 3FPPA 4DFAA 2MPMA 4RWSC 4CJ2C 1G291 4XQJA 4HR7B 2RSNA 1V1OA 1VDZA 4KD3A 4FF1A 2EYHA 2Y0SB 2J4XA 2EPBA 4KD4A 2WKDA 5C0XG 1LTID 2K5DA 5D14A 3RZOB 1H9RA 5E4XA 4CJ1B 2DNEA 1ZEQX 4RH6A 3N6RA 3M4YA 3SK6A 2L9HA 2Z1CA 5FOBB 3QWNA 2ENBA 2CW0D 4LJZC 1EIGA 2M2LA 3GTPB 3K0YA 4DAVA 1SJED 3K5LA 1EWCA 2KEEA 1KAAA 2PYKA 3GO5A 5A35A 4BA2I 1GUOA 2L5TA 3I70A 2WACA 3D6CA 5K36H 4DA2A 1ET6A 1C4QA 1LT5D 1CA6A 4X3UA 1EOTA 1V1PA 2JE6I 4HAEA 2O2LD 1KTKA 4HCEA 2RA4A 2H1EA 3MAQA 3HP3A 5EKIA 5EBCA 3FKIB 4DN4M 2F0EA 4LK1C 5HGTA 1PZID 1U9RA 2NZ1D 4A3GB 5M9OA 3E5SA 4S3SA 2XWJB 1HA6A 4KI0A 3BVMA 3D4RA 2IL8A 2R61A 1CM9A 2A69C 3UI2A 1Q3LA 1CTMA 5EBDA 3K5NA 3WDNA 4J6HA 1ENCA 3S1MB 1GXDC 1TWCB 1AFPA 2F0KA 1XWEA 5CBEE 4KKUA 3S1RB 4FXGC 2F0QA 5EKKA 1EZ6A 1QCBD 5E3FA 2A6EC 4NP5A 4DGZA 3PUVA 2C9OA 3QG1A 2WIIB 2B2UA 1EY4A 1DM0B 4O1NA 1TS5A 1J9OA 3U9OA 4J8QA 1IW7D 3IFDA 4KHZA 5C0XI 3R8BA 3S16B 4RCOA 1T5EA 5C0XH 3HOUB 2LY7A 1LABA 5IGBA 1OO9B 1EYAA 1A3TA 1VF7A 2IX1A 3FRPB 2F0DA 1QJOA 4HTHA 1I3QB 2V4DA 5CC4A 1M4VA 5CV8A 2PW7A 2SNMA 1BR9A 3T16A 4KN4C 5KNBA 3K57A 5M3MB 4A3JB 1Q12A 4RGMA 2D2CC 5BN3A 4DAYA 4K2KA 2IWHA 3I4MB 2WB1B 2A6ED 1Y8NB 1JOQA 1YNNC 1WTWA 3TBIB 2EE1A 5I6WA 1SAPA 2FINB 1S5DD 1BO0A 3M3YB 1LLRD 3D31A 2G9DA 1I4PA 3J80E 4HEDA 3SK5A 3BVZA 2QEJC 5ELDA 2M00A 5COYA 5ELBA 1WTPA 4UDUC 2F0SA 4BBRB 1GUNA 3MXNA 2KJXA 1TVXA 2WINB 2VB2X 3QIAA 4Q5VA 2B2YA 1HTPA 2K6AA 2B2VC 1RKNA 3R2TA 3J81L 1VMCA 1PFNA 1EY6A 2NVQB 5ELCA 1ENAA 4JBWA 1XXGA 4ZYSA 1UUPA 1BF4A 1NCVA 3S2DB 2KOLA 2JXMB 3E6ZX 4H13C 1F77A 1OXUA 4BWGB 1RTOA 2MHVA 1FNWA 4ZKBB 2AQ3B 2B2WA 4XQNA 1PTOC 2KCCA 2E2IB 3HRZC 5T1IA 1GUSA 1U4PA 3N52A 4DXFA 3A8JE 1GOZA 1BUVT 1QE6A 3GV3A 3HOYB 4FF4A 1H9MA 2XNAC 5IGEA 1V8QA 5CYUA 1RJTA 2EY1A 2O5IC 1CZWA 2KVMA 2RBMA 1YNND 3TN2A 4IUUA 3R2IA 1WTVA 4CGYB 5C3WA 4XQQA 4HN7A 4FYDA 1OXXK 1QNUA 5IGGA 1SNOA 1DOLA 1STYA 5J22A 3QOJA 3FVQA 4EQOA 2ZXPA 1SMYC 4AYBB 1A6XA 1WCMB 1B9MA 4MHEA 2IW3A 4DAPA 3L7ZC 1ET9A 4OL7A 3VA5A 3PO3B 4HSPA 4U68A 3NK9A 2VNUD 4E6IA 1C48A 4ZQ3A 3SDZA 1KDAA 5EPJA 5FO8B 2XVSA 1ZYRC 1RD9D 1SYDA 3NE5B 1O7LA 1TWFB 1NSNS 1VMPA 2AWNA 2XSCA 3NXWA 4RGNA 2GA4B 4OO1H 1HUNA 1BXTA 3KBGA 5JVH3 5EKLA 1TS4A 1PTOD 4F8MA 1RTNA 1B2TA 3HKZB 4F87A 4BBSB 4K8JA 2FFKB 1W6JA 1A3VA 4CKCA 3TMEA 5I6YA 4QUCA 1B9NA 3KLSX 4K5VA 2L1BA 3OWEB 2L11A 1BDOA 2K05A 5KGUA 1JOKA 4C56C 1A15A 3NWTA 1L0YB 4LMQD 3VR6A 1OXTA 2BE5D 1SMYD 3C2PA 1STGA 3EFXD 1SYFA 4RKLA 3EQLC 3TP6A 2SNSA 1V43A 1QB5D 3NTIA 4PNYA 2I46A 2WV6D 2ICEC 3K5MA 2RSOA 2DN8A 1O78A 1BCPC 4B9WA 4JK1C 1Z7TA 1ZYRD 2PPBC 3KF8A 1TT2A 1CQFA 4BA1I 2IX3A 4QB4A 3VA7A 1ILQA 2BA1A 3I73A 3Q22A 3J7YW 1DD2A 3I8ZA 3HG9A 1FNUA 4WJWA 2AQ1B 3P20A 1X3PA 4ULLA 4FF3A 2K03A 1TIID 3GTMB 1ZXTA 5CV5A 3EA6A 1KNEA 1B4OA 1B1ZA 1K83B 1S5BD 1IYUA 3H6MA 1XTCD 3D8GA 3LX0A 2E75C 4ZUIA 1SYBA 2KHSA 1STNA 1ICWA 4C1NK 1I4RA 3ITPA 2F0TA 2SEBD 4K8IA 1HUMA 4IFDG 1EU4A 4C1NI 1BNZA 1F9PA 2EYJA 3DWQA 5CORA 2KUMA 1DONA 5J1ZA 1DZ1A 1JQYD 1AEXA 3MHBA 3GV6A 3PUZA 3M4OB 3MVVA 2JA8B 1BCPD 2NN6G 2JEAI 3S1QB 3L3OC 3S2HB 1LT6D 1ML0D 1STAA 3ND9A 5F2DA 5JOBA 3TSSA 3KUPA 1KLUD 2B2VA 2ZXOA 4IUPA 5JEAG 1D1KA 2IPKD 5C4JB 1HQMC 3S9WA 2RVLA 2VB3X 2MUYA 4XYQA 3F2UA 4HMIA 3KLSA 4KY5A 4RCNA 1G91A 5CR3A 5J39A 3PUYA 2R92B 3G7LA 3BS1A 3K6OA 3TDQA 4FO2A 2Q8IB 1IHZA 1CZGA 5KRUA 3URYA 3SHLA 5DEHA 2FMMA 4RHRA 2DNCA 3LWUA 3NTKA 1WTQA 1K8OA 3A56A 1E2VA 2NVTB 1ZKOA 1KNAA 1E0BA 4K2LA 1ESFA 1MD2D 1B53A 4DNRB 3J7AV 1V1PB 4H0LC 1GJXA 1PDQA 3CKIB 2OEOA 2NVYB 1S5FD 4XYOA 2EYOA 3R3OA 2E76C 1PRTD 2L12A 4KK7A 2MJ8A 4EVOA 4C3HB 3C46A 4IUQA 4PMBA 2YU9B 2CHBD 2K1BA 3LNNA 2LMCB 1SNPA 1H9SA 1Q1EA 4IFDI 1KABA 2J0TD 5LL6S 1D5ZC 1I6HB 1TWHB 4IFDH 5IGDA 2B39A 3H3VC 1CHQD 3AMUA 2EJMA 3TP7A 3PIP3 3SXHA 2XRSD 1E2WA 3CU7A 2D5DA 5G3LF 2JA6B 5DM73 2XRQD 3VYSA 1QILA 3TP5A 2NN6I 1DXMA 3K7AB 5C44B 4PV1C 3MC0B 2A6HC 3Q6SA 1II3A 1NAPA 2I07B 3MTSA 2EY6A 5I9PA 2FJ2A 3M7NA 4G4KA 2EZVA 2L0CA 3J81E 1RODA 1QWYA 1HRJA 4ODGA 3DUZA 1EY7A 1D2BA 2IJ0A 2F03A 1TR5A 4L8JA 1CK1A 1IKLA 3OSOA 5JEAH 3HOVB 2SDFA 3GTGB 1EEFD 5CV9A 1U4MA 1AW7A 1I4HA 3I3CA 1NR2A 3PMFA 3W3AA 3IL8A 3U9SA 3H0GB 4M1UB 1RCVD 1I4XA 4K14A 5D65A 1OXSC 3BG3A 2NB0A 1LO5D 1STBA 2XN9C 2HCCA 2A69D 3QOLA 4L6TB 3DMUA 3A8IE 1LTSD 3I4LA 4CBVA 4WRDA 1WTOA 5CBAE 1TKWB 3I72A 1HPCA 4IALA 4G57A 2EVBA 3I91A 5A2QL 3MFYA 3A55A 5IT9L 2CVRA 1D1IA 4C3HG 3NTHA 3MFGA 5EJWA 3M7GA 4NDXA 2RQXA 2PMZB 1Q90A 3FPUB 4I65A 4IUVA 4C3JB 5D3DA 3SEBA 1X32A 3NQTA 4R9WA 1SDFA 2B2TC 2EDGA 4IQZA 2EYPA 5C6AA 2F0WA 2XWBB 1D6EC 2G9HD 3GP7A 2JSOA 5ISRA 5M5WB 5FKAC 3DM1A 5T1GA 2LKVA 5M3FB 3ERQA 3Q23A 1LT4D 2DY7A 4DNTB 1XYIA 1RF2D 1SE4A 4Z9CB 4UAIA 2X6GA 4QMGA 1PRTB 1TS2A 2RDFA 4C2MB 4DF7A 4A3IB 2J7ZA 4G7HC 1A2TA 3CQZB 1H9JA 4CKBA 4KHVA 1S5CD 5DM63 3I90A 4TSSA 5CV6A 4RA8A 3MXUA 1NUCA 4Y7NB 2F0HA 3LWEA 4WFN3 4X3TA 5C4XB 2ICIA 3T51B 4ABNA 1AN8A 1HHVA 1SXTA 5IOCA 1D5MC 3CHBD 2AWOA 4BS9A 1SJHD 2EJGC 2LS01 3QJYA 2R93B 4Q0FA 2RDHA 4ZLTF 1ENFA 1MGSA 2NTTA 3DHQA 2MGSA 5CMDA 2IT1A 2X6LA 2NYZD 4A3EB 3J7AF 5C3XA 3VR3A 5JJZA 2TMPA 2QDBA 3T56B 3GTJB 1GHKA 4LAAA 3A7LA 4C3IB 3S15B 5LHY1 4F7XA 2A68C 1HA5A 1Y69U 1YNJC 4B9XA 4DXGA 1PFBA 4C3JG 2AUJD 3DWPA 1O7YA 4A3BB 4HCSA 1MI2A 2O4XA 3Q0AA 3H94A 3RUZA 2TSSA 2PZWA 2F1MA 2SOBA 3AB9A 4F88A 4ZK9B 3HGBA 5I9OA 5FK9C 3X3MA 2K5WA 2M9VA 2Z4IA 4BY7B 1SBBB 2PCFB 1VF5C 5E1FA 4DK0A 1SNCA 2QILA 5ELEA 4PMWA 3PV0A 1LTAD 1JB3A 1F2ZA 1A2UA 3NWSA 3HOXB 2IX0A 1UAPA 5DAUA 1PZJD 4H44C 2F0IA 2ID0A 1TU2B 4K6LA 2R7ZB 1KDCA 2PZUA 3BDCA 3BDLA 1I6VC 3QB3A 2L4NA 3X3NA 1LV9A 1KLGD 3NBIA 4R8IA 4P2CB 4I7ZC 4MN3A 4HSVA 1UEAB 4RKBA 2AUKA 3JAML 5IODA 2N88A 1CA5A 3C1FA 1YNJD 1MBYA 4NW2A 5C4HA 3VR5A 1SE3A 1JR0D 1R9TB 1EQVA 3K5OA 3NSWA 4XT1B 4KKTA 3OW7A 1FD7D 3HOZB 5D3IB 2PNRC 1EFID 1CT1D 1LTBD 5JPNC 2HUGA 4OHJA 1MSGA 1JORA 1S4ZA 1HFGA 1JICA 1HTLD 3D3RA 3EVQA 3TP8A 5KIXA 1I50B 1QG7A 2WAQB 1I4GA 2L55A 4C3IG 3NUCA 2BDOA 1EZ8A 4RHSA 2EXZA 1EY9A 1M8AA 1EU3A 1HXYD 1SEBD 2HCIA 1F9RA 2AQ2B 2K04A 3K58A 4IUTA 4DU9A 2OXPA 4XDXA 3FEWX 4FVMA 3GTKB 2F0PA 3HZXA 2X69A 2NTSA 2KA7A 1FR3A 4ZRZA 2YYZA 5KYLA 3V2TA 3OHXC 1X3QA 3EROA 1KDBA 1WD0A 1MSHA 1O80A 2B2TA 2RDGA 1SNDA 4ID6A 1S5ED 2EJFC 2PO4A 2NUCA 1G2TA 4EQPA 5IIFA 4DK1A 1K8MA 4IZ8A 2KQ3A 4PMCA 1F2MA 5C0XJ 2EY5A 3NPPA 1WD1A 1ONLA 1JWSD 1Q8IA 3IAYA 2JA5B 4R8NA 1PTOB 1JC7A 3IFTA 1PRTF 3VYTA 4OIKA 3HS0C 3RMHA 1FYCA 1HQRD 1R4PB 2E74C 1EY5A 1G2SA 3R93A 2EY2A 3W2DA 2LFNA 2Z4HA 1G8ZD 3FMCA 3S14B 2CQAA 4OGQC 4KJOA 1DOKA 4XXEA 2FMCA 1GUTA 2QF7A 3GTQB 1SSOA 3H09A 1EWHA 1SNQA 1WVLA 4ILWA 1HFNA 1CI3M 3RZDB 1TY2A 3NP8A 1FGBD 1SFOB 3KLRA 1H9SB 3DEPA 3VR2A 3GTLB 1D5XC 1IW7C 1Z47A 3AU7A 1BBXC 5EQ0A 4QF4A 1Y8PB 1EEID 5A2QE 5FLXL 5IT9E 1OXVA 1B44D 2EYLA 2E2DC 2ZT9C 3GD7A 5M5XB 1EY8A 4XTCS 4A93B 3SVMA 3DEOA 4N9PA 5EPLA 3GTOB 3BVGA 5FO9B 3OMGA 2R6GA 2D9UA 1Y1VB 3S1NB 2MP1A 2F0NA 5LL6X 2NN6H 1CFMA 4WORA 4ME5A 1LTGD 4QUFA 2EYFA 2KEDA 2C5CA 1PFMA 1IKMA 2Q8TA 1SE2A 1U4LA 4N9TA 4EQNA 3MZ5A 1JWUD 1G6ZA 3PO2B 2BCOA 2F0MA 1IL8A 3DXJC 2F0FA 2OF1A 2VXWA 1PLFA 1BCPB 1ILPA 2F3VA 2D62A 1EYCA 5IGFA 1BQQT 4KJNA 1F2LA 3I4NB 3T4AC 1IYVA 5G3LD 1JCKB 5AFWA 2XIWA 1F9SA 1EY0A 4OIJA 4IURA 5EPKA 1GUWA 1QOHA 1DOMA 1Q1BA 2QKIC 1RDPD 5JVG3 1O7ZA 2B8FA 3PIO3 1LTRD 4ZAIA 5ELFA 3NBHA 3P1HA 2A6HD 3EJIA 1EQTA 5NUCA 2NVXB 3CRLC 1LTTD 4FNFA 3G6JB 5IGCA 4OO1G 2DY8A 2A5HA 3D6WA 4K6DA 5C5MA 2K28A 3MWYW 1TY0A 2B63B 4ZKCB 4NMZA 1PMRA 4IUNA 5HURA 3OMCA 4V190 3ND8A 1TWGB 5CGKA 3SK4A 3V05A 3KK7A 2HDMA 3TZDA 2HQEA 4A3DB 3VYUA 4GZYC 1VCIA 2QCPX 4K5XA 5TSSA 3VR4A 4KKSA 1SYCA 5C3EB 3CRKC 1JE4A 1L0XB 3S17B 4KY6A 3Q24A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EEI D;  1ENF A;  2NTT A;  3DWA A;  1PTO H;  1RD9 D;  2XRQ D;  5D3D A;  1QIL A;  2AQ1 B;  3SEB A;  1SJE D;  1EWC A;  1B44 D;  5I4D A;  3R2T A;  4RGN A;  1UNS A;  1BXT A;  1PYW D;  4RGO S;  1TS4 A;  3R8B A;  1D6E C;  2G9H D;  5ELC A;  1PTO D;  3EA6 A;  3MC0 B;  1PTO F;  1B1Z A;  1XXG A;  1UUP A;  1RDP D;  4ZYS A;  4RCO A;  3GP7 A;  4RFB A;  1ET6 A;  1S5B D;  4RGT A;  1LTR D;  1JWS D;  1SE3 A;  5FKA C;  5ELF A;  3BYT B;  1JR0 D;  1LT5 D;  1LT3 D;  1XTC D;  3URY A;  1HA5 A;  1F77 A;  1V1P A;  1CQV A;  4RHR A;  3BVG A;  4BWG B;  1LT4 D;  1PTO B;  1FD7 D;  2O2L D;  4DXG A;  1PZK D;  1FNW A;  2IJ0 A;  2AQ3 B;  1KTK A;  5D3I B;  1PTO C;  1PRT F;  1EFI D;  1CT1 D;  1LTT D;  1LTB D;  1I4R A;  3DWP A;  1JWM D;  1CK1 A;  1RF2 D;  1SE4 A;  4OHJ A;  2SEB D;  1CHP D;  4Z9C B;  1ESF A;  1EU4 A;  1MD2 D;  3KLS X;  1HQR D;  4DXF A;  1HTL D;  1V1P B;  1DJR D;  1M4V A;  2TSS A;  1GOZ A;  1PRT B;  3OWE B;  3O13 A;  1EEF D;  1LTG D;  1TS2 A;  1AW7 A;  2Z8L A;  1I4H A;  1PRT C;  3DWQ A;  1S5F D;  2XNA C;  3W2D A;  1TY0 A;  4C56 C;  1PZI D;  1I4G A;  3BZD B;  1G8Z D;  1RCV D;  4RHS A;  1L0Y B;  5FK9 C;  1I4X A;  3BYY B;  1SBB B;  1PRT D;  1S5C D;  4L63 B;  4RGM A;  1EU3 A;  1JQY D;  1HXY D;  1SE2 A;  3BVM A;  1TS3 A;  2QIL A;  2R61 A;  1SEB D;  5ELE A;  1JWU D;  1LTA D;  2AQ2 B;  4TSS A;  3R2I A;  1V1O A;  1BCP D;  1LO5 D;  1BCP F;  3EFX D;  3V05 A;  2XN9 C;  2CHB D;  4L6T B;  2J4X A;  1LT6 D;  1PZJ D;  1LTS D;  2ICI A;  1LTI D;  2WV6 D;  1DYQ A;  4K6L A;  1TY2 A;  2NTS A;  1BCP B;  1D5Z C;  3TSS A;  1S5D D;  1AN8 A;  1BCP C;  1LLR D;  1SXT A;  1CHQ D;  1D5M C;  1FGB D;  3CHB D;  1I4P A;  1KLU D;  1KLG D;  3BVZ A;  1FNV A;  1ET9 A;  4RH6 A;  1I4Q A;  2QEJ C;  5ELD A;  5TSS A;  2RDG A;  1SJH D;  1D5X C;  1S5E D;  1T5X D;  4O1N A;  1STE A;  2IPK D;  1TS5 A;  3MFG A;  5ELB A;  1L0X B;  2XRS D;  4UDU C;  1JCK B;  2RDH A;  1FNU A; 
#chains in the Genus database with same CATH topology
 2NWG A;  4JI1 L;  5K5P A;  5IP7 G;  1PTO H;  2F52 A;  2K32 A;  5DLQ E;  1EQR A;  1C0A A;  4G7O C;  1U4R A;  2EOT A;  3UDG A;  4CJ0 B;  3KBX A;  1PYW D;  4NKL A;  4RGO S;  2VQF Q;  3C3L A;  3L9A X;  3NQI A;  4CDE C;  5I2X A;  1PTO F;  4AQY L;  3JAM E;  1EYD A;  5BN4 A;  3OWF A;  5C5L A;  3ULJ A;  4U67 3;  1LT3 D;  3P75 A;  3RLF A;  3I4N G;  3OIQ A;  3T13 A;  1WTR A;  1AZQ A;  1CQV A;  2F0U A;  1PZK D;  3PUX A;  3JC6 6;  4RMF A;  4X3K A;  2Q2T A;  3A54 A;  2I5M X;  2PW5 A;  4PZ6 A;  4GS3 A;  3T1H L;  1CHP D;  3GTQ H;  1B50 A;  3ULL A;  1E2Z A;  1N33 L;  1E3P A;  1XX8 A;  2Z8L A;  3WOF A;  2NVY H;  1TQO A;  3HEJ A;  2BE5 C;  3BZD B;  2BOS A;  2K14 A;  1N8R C;  1ASZ A;  2K01 A;  1TS3 A;  5DNF A;  4TKO B;  1BOS A;  2F3W A;  1SFO H;  3C1E A;  1LAC A;  3ONA B;  4IPD A;  4C3H H;  3CCM A;  4BY1 B;  3HOW B;  2K5V A;  4X66 Q;  4TRD A;  4A76 A;  4OX9 L;  3J80 L;  5I2Y A;  4FP5 D;  3TRE A;  3TS0 A;  1I94 L;  4CKE A;  1X6O A;  4V0B A;  1EIH A;  1VQ5 A;  1TWA B;  2PMZ E;  4OO1 I;  1B3A A;  1W6K A;  4H7B A;  1VQF A;  3CD6 A;  3D4D A;  2E2H B;  4POF A;  4LFC Q;  1HNX L;  5M5Y B;  1ESR A;  3P7J A;  4ME3 A;  1TWH H;  4JI2 L;  3VYR A;  1I4Q A;  3K59 A;  4EGV A;  2RKS A;  5EGT A;  1EYG A;  1DCZ A;  2F4I A;  4A93 H;  2F0G A;  1STH A;  2PQE A;  1STE A;  4G7Z C;  1GHJ A;  4CHT B;  4J15 A;  1WTX A;  2MO0 A;  4JW0 A;  1JOO A;  2N55 A;  4LNQ A;  1S40 A;  3MXP A;  3GTO H;  2O5J C;  2H4O A;  1F2Y A;  3W1B A;  1VQA A;  3J81 c;  5KYI A;  2Q8R E;  3F8T A;  2D0P A;  5CV4 A;  2JP1 A;  1Y1V H;  3S1N H;  2B2U C;  4A3D G;  3SR1 A;  3CCR A;  2PZT A;  3OOC A;  2OCE A;  4FXD A;  4IO9 A;  3NEL A;  2F0L A;  4DV3 Q;  5E4W C;  5FJ8 H;  4RFB A;  3MXG A;  4GN3 B;  1S3O A;  4DV2 L;  5C3E G;  4JI7 Q;  2K5Q A;  2E2J B;  1SYE A;  2BA0 A;  4DR4 L;  4NXM Q;  4KV6 A;  5GAD C;  2KHI A;  1VQL A;  2Z6B A;  4HMJ A;  3J81 i;  4FF2 A;  4DR3 L;  2A74 C;  2A68 D;  2K7V A;  4DV1 L;  3OPO A;  2OT2 A;  2Z6K A;  4KMU C;  5JAV A;  4YY3 L;  3SK8 A;  1AP0 A;  3CCJ A;  3HOV H;  4M8A A;  1XNQ Q;  5KNC A;  1DJR D;  1KL9 A;  3GTG H;  4ZUJ A;  1SRO A;  2UUB L;  2F0J A;  5IP7 H;  3RD4 A;  1R4Q B;  4K0K Q;  3HFZ B;  5IYC H;  3I55 A;  3V96 A;  3RNU A;  1PXU A;  1X56 A;  2B8G A;  3HOY G;  5C4Z A;  4J1M A;  1P8L A;  4XIG S;  2V1C C;  2WKC A;  4KY7 A;  3WWV A;  1RHP A;  3BYY B;  4X3S A;  3RN2 A;  3ZYY X;  1QNK A;  1C8C A;  3PF4 A;  5FO7 B;  2EIF A;  2HT1 A;  3NHH A;  2YTY A;  4A3K B;  1BCP F;  3I4N H;  1Y1W B;  2HDL A;  4DV0 L;  1VS0 A;  2NBF A;  4YWK A;  3IKJ A;  5K36 G;  4IFD J;  3TZU A;  1DYQ A;  4XT3 B;  3FDT A;  1NR4 A;  2FHT A;  3SE0 A;  4RAU C;  4PQX A;  4LF4 Q;  2PNH A;  4K5W A;  4I7A A;  3CF5 A;  3CME A;  1AZP A;  3I2Z A;  1L1O A;  2C35 B;  1J8I A;  4AYB G;  3OIP A;  1A62 A;  1N32 Q;  1FNV A;  1F9Q A;  3GQB A;  1E1T A;  4TQU S;  3J80 c;  1SNM A;  1T5X D;  2BDN A;  4FXK C;  4KN7 C;  1PYS B;  5KEE A;  3PUW A;  1H9K A;  4BY1 G;  3HOW G;  3AYH B;  1SYG A;  2JA7 B;  1JJC B;  2K33 A;  4QIW B;  2CCZ A;  4L63 B;  4B3S Q;  3DWA A;  2R3Z A;  2NVX H;  3CC7 A;  3KF6 B;  2KEC A;  5BN5 A;  5I4D A;  4DR2 L;  3KOJ A;  1UNS A;  1Q46 A;  1Y8O B;  1YEZ A;  2CW0 C;  4X64 Q;  1QVF A;  2UXD L;  5JPM C;  2JEB I;  4IN3 A;  3QO2 A;  4JPB W;  4QL5 A;  3KF6 A;  1YIJ A;  1EL0 A;  3J80 i;  4MIU A;  4LUO A;  2WP8 J;  3E0J A;  2EYM A;  4RGT A;  3D4W A;  4DUZ L;  3WOE A;  2N78 A;  4KTA A;  5FLX E;  5AJ3 L;  3BYT B;  2GVB A;  3MA2 B;  2ZXR A;  1HCZ A;  3M85 A;  2B2Y C;  2F0O A;  2B63 H;  2ALY B;  4BBS G;  4O42 A;  4A3F B;  1A3U A;  3H91 A;  5JEA J;  1IBM Q;  1GUG A;  1JWM D;  2R7D A;  2F0V A;  3A7A B;  3BDO A;  1TWG H;  2JYO A;  1Z6H A;  2I0Q A;  2VUM B;  3T53 B;  4YIJ A;  2HHH L;  2A73 B;  4DR1 Q;  4A3M B;  3O13 A;  5CV7 A;  4QCL A;  4B08 A;  2CWA A;  1PRT C;  2KCN A;  3MEH A;  2B2W C;  3A8K E;  3CW2 C;  2JK8 A;  5KND A;  4L5S A;  3FPP A;  4DFA A;  2MPM A;  3CPW A;  1L2F A;  4RWS C;  4CJ2 C;  4JC0 A;  4GKJ L;  1G29 1;  4XQJ A;  4HR7 B;  2RSN A;  1CSQ A;  1V1O A;  1VDZ A;  5C3E H;  4KD3 A;  1LUZ A;  4Y7N H;  4FF1 A;  1EOV A;  2EYH A;  2Y0S B;  2J4X A;  2HQL A;  3S17 H;  1WTH A;  2EPB A;  4KD4 A;  2WKD A;  2AHO B;  5C0X G;  1LTI D;  2K5D A;  5D14 A;  5C4X H;  5IP9 G;  3RZO B;  1H9R A;  1N34 L;  5E4X A;  4CJ1 B;  1K3B C;  2DNE A;  1ZEQ X;  4RH6 A;  3N6R A;  4LUZ A;  3M4Y A;  3SK6 A;  2L9H A;  5HY6 A;  2Z1C A;  5FOB B;  3QWN A;  2ENB A;  2CW0 D;  2K50 A;  4LJZ C;  1EIG A;  1KXL A;  2M2L A;  1Y1W G;  3GTP B;  3K0Y A;  1KHI A;  1SJE D;  4DAV A;  3K5L A;  1EWC A;  4JI5 L;  2KEE A;  1YNX A;  1KAA A;  5JJI A;  3A5Z B;  1BKB A;  2PYK A;  3GO5 A;  5A35 A;  3PGZ A;  1GUO A;  4P71 A;  4AH6 A;  4BA2 I;  2L5T A;  3I70 A;  2WAC A;  3D6C A;  3KDF A;  4DA2 A;  1K73 C;  1PH1 A;  5K36 H;  1ET6 A;  2Z9H A;  2ZTE A;  1C4Q A;  4OEL B;  1LT5 D;  1HR0 Q;  3BZC A;  3S15 H;  4LUV A;  4JYA L;  1CA6 A;  2WAQ E;  4X3U A;  1EOT A;  1V1P A;  2JE6 I;  4HAE A;  4HJ7 A;  1B70 B;  1JJG A;  2O2L D;  1KTK A;  4HCE A;  2RA4 A;  1VQ8 A;  2H1E A;  3MAQ A;  3HP3 A;  5EKI A;  4HIM A;  3KJO A;  1CKN B;  2UXB L;  4A3B H;  5EBC A;  3FKI B;  1VQM A;  1NE3 A;  4N8F A;  1E22 A;  4DN4 M;  2F0E A;  3H3V I;  4LK1 C;  1SR3 A;  5HGT A;  1PZI D;  1TWA H;  4YHH Q;  2ZTC A;  1U9R A;  2NZ1 D;  4A3G B;  4B3M L;  4JI0 Q;  5M9O A;  3E5S A;  3TQY A;  3H3V H;  1UE5 A;  4S3S A;  2E2H H;  2XWJ B;  1PH8 A;  1HA6 A;  5M5Y H;  2YV5 A;  1CUK A;  4KI0 A;  1X55 A;  3BVM A;  3D4R A;  2IL8 A;  2R61 A;  1CM9 A;  2A69 C;  1AH9 A;  3UI2 A;  1Q3L A;  1CTM A;  5EBD A;  3K5N A;  3WDN A;  4J6H A;  4QGU A;  1ENC A;  2VUM G;  3S1M B;  3CC4 A;  1GXD C;  1TWC B;  1AFP A;  3HOX H;  1MHW C;  2F0K A;  1XWE A;  5CBE E;  1EUJ A;  4KKU A;  3S1R B;  4FXG C;  2F0Q A;  5EKK A;  2IY5 B;  1CKM A;  1EZ6 A;  1QCB D;  2CWP A;  5E3F A;  2A6E C;  3TRZ A;  4NP5 A;  4DGZ A;  3PUV A;  1KRS A;  4X65 L;  2C9O A;  3QG1 A;  2WII B;  3F2D A;  3T1Y Q;  2B2U A;  3SGI A;  1EY4 A;  1WJJ A;  3AFP A;  1DM0 B;  4O1N A;  2RHQ B;  1G6P A;  1TS5 A;  1J9O A;  3U9O A;  4GKK Q;  3CCL A;  2E2J H;  1WYD A;  4J8Q A;  1IBK Q;  1IW7 D;  3IFD A;  4KHZ A;  3STB C;  4JCV E;  4IJL A;  3OW2 A;  5C0X I;  2R92 G;  3R8B A;  3S16 B;  4QJF A;  2ZM6 Q;  1PH4 A;  4RCO A;  2Q2I A;  1T5E A;  1HR0 W;  5C0X H;  3HOU B;  2LY7 A;  5IP9 H;  1LAB A;  5IGB A;  1OO9 B;  1EYA A;  1A3T A;  1VF7 A;  4JI6 L;  2IX1 A;  2QGQ A;  3FRP B;  5J3B A;  2F0D A;  4YCU A;  3FP9 A;  4DV6 L;  2LSS A;  1QJO A;  4HTH A;  3KFU A;  4JI8 Q;  1I3Q B;  2V4D A;  1WOC A;  4X62 Q;  1PH5 A;  5CC4 A;  3NBH B;  4NB3 A;  1QUQ B;  3Q8D A;  1M4V A;  4A3K H;  5CV8 A;  2PW7 A;  2SNM A;  1BR9 A;  4EQ5 A;  5FLM G;  3T16 A;  3D0F A;  1LTL A;  4JV5 Q;  4KN4 C;  5KNB A;  3K57 A;  5M3M B;  4A3J B;  1Q12 A;  4RGM A;  2D2C C;  1MJE A;  4JBM A;  4MNO A;  5BN3 A;  4DAY A;  1XPU A;  4K2K A;  5H1S E;  2IWH A;  3I4M B;  2WB1 B;  2A6E D;  1J5E Q;  1XNR L;  1Y8N B;  3RLO A;  1JOQ A;  2JA7 H;  1YNN C;  4LF6 Q;  1WTW A;  3TBI B;  2EE1 A;  5I6W A;  5LMN Q;  1SAP A;  2FIN B;  1SN8 A;  1PFS A;  1S5D D;  1BO0 A;  3M3Y B;  1LLR D;  4A3G G;  3D31 A;  2G9D A;  1I4P A;  3J80 E;  4HED A;  5IYB G;  3I4O A;  3SK5 A;  3BVZ A;  2DJG C;  2QEJ C;  5ELD A;  1H95 A;  2XTI A;  2M00 A;  4JG2 A;  3STB D;  3I7F A;  4B3R Q;  3E9H A;  5COY A;  5ELB A;  1WTP A;  4UDU C;  2F0S A;  4BBR B;  1EFW A;  2ATW A;  1WI5 A;  1GUN A;  3MXN A;  2KJX A;  1TVX A;  2WIN B;  2VB2 X;  3QIA A;  4X66 L;  1VQ6 A;  4Q5V A;  2B2Y A;  4A3F H;  1HTP A;  2K6A A;  3CC2 A;  2B2V C;  1RKN A;  3R2T A;  3J81 L;  1VMC A;  1PFN A;  3ERS X;  4P72 A;  1A0I A;  1EY6 A;  2NVQ B;  5ELC A;  1ENA A;  1IXR A;  2DJF C;  2JJQ A;  4JBW A;  1XXG A;  4ZYS A;  1UUP A;  2KCT A;  1BF4 A;  1UWV A;  1NCV A;  3S2D B;  5C44 G;  4A3M H;  2H5X A;  4LF5 Q;  2KOL A;  4LFC L;  2JXM B;  3E6Z X;  4H13 C;  5EAY A;  1F77 A;  2RHS B;  1J6Q A;  1OXU A;  3E3X A;  4BWG B;  4LW1 A;  3CCU A;  2JA5 H;  1K3R A;  3M4P A;  1RTO A;  2MHV A;  2PI2 A;  1VQD A;  1FNW A;  4ZKB B;  2AQ3 B;  2B2W A;  2JN4 A;  4XQN A;  1PTO C;  3ULP A;  2KCC A;  2E2I B;  3HRZ C;  4RG1 A;  2A19 A;  1GUS A;  5T1I A;  3J81 j;  1U4P A;  3UDF A;  2ZJP A;  3N52 A;  4YWM A;  4DXF A;  3A8J E;  4O0A A;  2WFW A;  1GOZ A;  3CCV A;  1BUV T;  4HJA A;  1QE6 A;  3GV3 A;  3HOY B;  4FF4 A;  1H9M A;  2XNA C;  5IGE A;  4DV7 Q;  1V8Q A;  5CYU A;  3HOU G;  1RJT A;  2EY1 A;  3H0G G;  1CZW A;  2O5I C;  3RZO H;  4DV3 L;  2KVM A;  1YHQ A;  2UXC Q;  5GAE C;  1XPO A;  3S14 H;  2RBM A;  1YNN D;  3TN2 A;  4JI7 L;  1FJG Q;  2RCN A;  4IUU A;  4IJH A;  3S24 A;  3R2I A;  4DUY L;  1WTV A;  4NXM L;  4CGY B;  5C3W A;  4EX5 A;  4XQQ A;  4HN7 A;  4FYD A;  1OXX K;  1QNU A;  5IGG A;  1SNO A;  5LMN W;  1DOL A;  1STY A;  2CQO A;  4UP7 A;  5J22 A;  3QOJ A;  3FVQ A;  4MZ9 A;  4EQO A;  2ZXP A;  1PYB A;  1SMY C;  4GLA C;  4AYB B;  3RZD H;  2ZJR A;  1A6X A;  1WCM B;  1B9M A;  1IBL Q;  4MHE A;  2IW3 A;  4DAP A;  3L7Z C;  5M3M G;  3PCO B;  4A3J G;  4K0K L;  1ET9 A;  3KYH C;  4OL7 A;  3VA5 A;  4HSP A;  1UE1 A;  2QDL A;  3PO3 B;  4U68 A;  3NK9 A;  1PV4 A;  1B8A A;  2R7F A;  2VNU D;  2Z0S A;  3GTL H;  1KRT A;  4E6I A;  1C48 A;  4ZQ3 A;  4A3C H;  3SDZ A;  1KDA A;  5EPJ A;  3I4M G;  2WB1 G;  5FO8 B;  2UUA L;  2XVS A;  1ZYR C;  1RD9 D;  1SYD A;  4YCW A;  3NE5 B;  1O7L A;  1TWF B;  1NSN S;  1VMP A;  4HJ8 A;  2AWN A;  2XSC A;  3NXW A;  4RGN A;  2GA4 B;  4OO1 H;  1HUN A;  1BXT A;  3KBG A;  3NEM A;  5JVH 3;  4DR5 Q;  5EKL A;  5M5X H;  1TS4 A;  1PTO D;  3UDX A;  3PF5 A;  3FKI H;  4F8M A;  4LF4 L;  2L15 A;  4JI4 L;  1RTN A;  1B2T A;  3HKZ B;  1A63 A;  4F87 A;  1RIP A;  4BBS B;  4BXX G;  4K8J A;  1N32 L;  2FFK B;  1K0R A;  3K0X A;  1W6J A;  4A3G H;  4BBR G;  1A3V A;  2I5L X;  1YBY A;  4CKC A;  3TME A;  5I6Y A;  4QUC A;  1B9N A;  3KLS X;  1T9H A;  4K5V A;  5IE8 A;  1EQQ A;  2L1B A;  3KLW A;  4KLK A;  3OWE B;  1ASY A;  2OQK A;  2L11 A;  1BDO A;  1NMG A;  2K05 A;  5KGU A;  1JOK A;  4C56 C;  4X64 L;  1A15 A;  3NWT A;  3S1R H;  4A3I G;  4GNX C;  1L0Y B;  4LMQ D;  4JI3 Q;  1AE2 A;  3VR6 A;  5ELN A;  1K0S A;  1OXT A;  1PA6 A;  2BE5 D;  2KEN A;  1SMY D;  3C2P A;  4N8X 1;  1MIU A;  1STG A;  3PO2 H;  3EFX D;  4LF9 Q;  1SYF A;  3K81 C;  1IBM L;  4CDD C;  4RKL A;  3EQL C;  3AEV A;  3TP6 A;  2SNS A;  1V43 A;  1QB5 D;  2E5L Q;  3NTI A;  4IPG A;  2KCM A;  4PNY A;  2I46 A;  2WV6 D;  2ICE C;  3K5M A;  2RSO A;  1VQ7 A;  2DN8 A;  4ALP A;  4DV5 Q;  1O78 A;  4DR1 L;  1BCP C;  4B9W A;  4JK1 C;  1Z7T A;  1ZYR D;  1VQH A;  2PPB C;  3KF8 A;  1TT2 A;  3S16 H;  1CQF A;  4BA1 I;  2IX3 A;  2K5H A;  4QB4 A;  3VA7 A;  1ILQ A;  2BA1 A;  1VQP A;  1V9P A;  3I73 A;  3Q22 A;  3J7Y W;  2D0O A;  1L1O B;  1DD2 A;  3I8Z A;  3HG9 A;  1FNU A;  3QR8 A;  4WJW A;  1XMQ Q;  2AQ1 B;  1W2B A;  3P20 A;  5GQO A;  1X3P A;  1HZA A;  4ULL A;  4FF3 A;  2K03 A;  1TII D;  2HIX A;  3GTM B;  4A3E G;  1WCM G;  1ZXT A;  5CV5 A;  3EA6 A;  1VQO A;  1KNE A;  1B4O A;  1B1Z A;  1K83 B;  1S5B D;  3PO3 G;  3I56 A;  1IYU A;  3H6M A;  1XTC D;  4A75 A;  4YWL A;  3D8G A;  4H02 A;  1ICF B;  2ZTD A;  1K8A C;  3LX0 A;  2E75 C;  4ZUI A;  3G6E A;  1SYB A;  2KHS A;  5M3M H;  1STN A;  3AFQ A;  2K52 A;  2LXJ A;  1ICW A;  4C1N K;  1I4R A;  3ITP A;  3CCS A;  2F0T A;  2SEB D;  4K8I A;  1HUM A;  4IFD G;  1EU4 A;  1B3Q A;  2VL6 A;  3AQQ A;  4C1N I;  1BNZ A;  1F9P A;  2EYJ A;  4NXN Q;  3DWQ A;  5COR A;  4Y52 H;  2KUM A;  3F1Z A;  4L5R C;  1DON A;  1NJI C;  3HKZ G;  5J1Z A;  1DZ1 A;  1XTD A;  3J7A 5;  4LF8 Q;  1JQY D;  2CH4 A;  1AEX A;  3M3Y H;  4GN5 A;  3MHB A;  2VQE Q;  3GV6 A;  1HR0 L;  4LWC A;  3PUZ A;  3M4O B;  3MVV A;  2JA8 B;  1BCP D;  2NN6 G;  2JEA I;  2QW7 A;  3BZK A;  1Q86 C;  4BBR H;  3S1Q B;  3L3O C;  3S2H B;  1LT6 D;  1ML0 D;  1X3E A;  4UPA A;  1STA A;  1U0L A;  1B7Y B;  3ND9 A;  4PZ8 A;  1HH2 P;  1E24 A;  5F2D A;  5JOB A;  3TSS A;  3KUP A;  4A3D H;  2UUB Q;  4MTK A;  2R7Z G;  1KLU D;  4LF7 Q;  2VS1 A;  2B2V A;  4YHH L;  2NVQ H;  1Z9F A;  4JI0 L;  2ZXO A;  2VY3 A;  4IUP A;  3S2D H;  5JEA G;  1D1K A;  2IPK D;  5C4J B;  1HQM C;  1X3G A;  3S9W A;  2RVL A;  3JAM c;  2VB3 X;  2MUY A;  4LFA Q;  4XYQ A;  3F2U A;  4HMI A;  3KLS A;  4GOP C;  4KY5 A;  4RCN A;  4CDF C;  1V1Q A;  2I5H A;  1G91 A;  5CR3 A;  5J39 A;  3PUY A;  1K9M C;  4DV0 Q;  2CKZ B;  1KAW A;  4DK3 C;  4WJ3 M;  2R92 B;  1HNZ Q;  2E2I H;  3G7L A;  3BS1 A;  3K6O A;  3TDQ A;  4FO2 A;  3BJU A;  1CSP A;  2Q8I B;  1IHZ A;  1CZG A;  5KRU A;  3HOY H;  4TVA B;  1Q82 C;  2AKW B;  3JAM i;  3URY A;  3SHL A;  5DEH A;  2FMM A;  4RHR A;  1HNW L;  1CKO A;  2DNC A;  3LWU A;  3T1Y L;  3NTK A;  1SLJ A;  1WTQ A;  1K8O A;  3A56 A;  1E2V A;  2NVT B;  3KDF B;  1ZKO A;  1KNA A;  1E0B A;  4K2L A;  4R4Q A;  4GKK L;  1ESF A;  4YCV A;  1MD2 D;  4ZCK A;  1B53 A;  4DNR B;  1NTG A;  3J7A V;  1V1P B;  4H0L C;  5GRO A;  1PH3 A;  1IBK L;  1PDQ A;  1GJX A;  1NNX A;  3G4S A;  3CKI B;  1VQI A;  2OEO A;  2NVY B;  1S5F D;  4XYO A;  4LFB Q;  2EYO A;  5IYD G;  3TS2 A;  1VQC A;  3R3O A;  2CFM A;  2N3S A;  2ZM6 L;  2E76 C;  1FVI A;  1PRT D;  2L12 A;  4KK7 A;  5AJ3 Q;  2MJ8 A;  4EVO A;  1L0W A;  1NMF A;  4C3H B;  1JT8 A;  3PO3 H;  3HOW H;  4BY1 H;  3C46 A;  4IUQ A;  4L5T A;  4PMB A;  2YU9 B;  2ASB A;  5GAG C;  2CHB D;  2K1B A;  3LNN A;  2LMC B;  4WJ4 A;  1SNP A;  1H9S A;  1Q1E A;  4JI8 L;  4IFD I;  4QIW E;  4X62 L;  1KAB A;  2J0T D;  5LL6 S;  1EWI A;  1D5Z C;  1TWF H;  1I6H B;  1TWH B;  4IFD H;  5IGD A;  2B39 A;  2IHE A;  3H3V C;  1CHQ D;  2NZO A;  2A1A A;  3AMU A;  2EJM A;  3TP7 A;  4QQB X;  3PIP 3;  4JV5 L;  5LMU Q;  3SXH A;  2OQ0 A;  3CPF A;  2XRS D;  1E2W A;  3CU7 A;  2JA8 G;  2D5D A;  3M4Q A;  4BBS H;  5G3L F;  2JA6 B;  2F4V Q;  5DM7 3;  2XRQ D;  3VYS A;  1QIL A;  3TP5 A;  2NN6 I;  1DXM A;  1J5E L;  2RCF A;  1HZB A;  3EBE A;  3K7A B;  4UP9 A;  5C44 B;  4NPS A;  4PV1 C;  1I5F A;  3MC0 B;  2A6H C;  4LF6 L;  2KHJ A;  3Q6S A;  5LMN L;  1GM5 A;  1II3 A;  1NAP A;  2I07 B;  3MTS A;  2EY6 A;  5I9P A;  2FJ2 A;  3KJP A;  3M7N A;  4G4K A;  4DR7 Q;  1KQS A;  2EZV A;  2L0C A;  3J81 E;  1ROD A;  1QWY A;  1HRJ A;  4ODG A;  3DUZ A;  1EY7 A;  1D2B A;  2IJ0 A;  2EXD A;  1N36 Q;  2JQO A;  3CMA A;  2HIV A;  1TR5 A;  4L8J A;  2F03 A;  4B3R L;  1CK1 A;  3EIV A;  4GNX A;  1IKL A;  3L0O A;  3OSO A;  2B29 A;  1QVG A;  4JBK A;  5JEA H;  1S72 A;  2SDF A;  3HOV B;  1BBU A;  1YJW A;  4P75 A;  3GTG B;  1EEF D;  1BBW A;  1U4M A;  5CV9 A;  1AW7 A;  5BR8 Q;  5JJL A;  1I4H A;  3ER0 A;  2Y0S E;  3I3C A;  1NR2 A;  3PMF A;  3W3A A;  3IL8 A;  3U9S A;  3H0G B;  4M1U B;  4B3T Q;  1PVO A;  1RCV D;  1I4X A;  4LF5 L;  5GAH C;  4JYA Q;  4K14 A;  5D65 A;  1OXS C;  3UDI A;  3BG3 A;  1E1O A;  2NB0 A;  1LO5 D;  1STB A;  2Q2U A;  2XN9 C;  1Y1W H;  2HCC A;  2A69 D;  3QOL A;  4L6T B;  3DMU A;  2IHF A;  4R4T A;  3A8I E;  1LTS D;  3I4L A;  4DAY B;  4CBV A;  4WRD A;  2VQF L;  1WTO A;  5CBA E;  1TKW B;  2BH8 A;  3I72 A;  1HPC A;  4IAL A;  2B3G A;  1VQ9 A;  2MNA A;  1Q81 C;  4G57 A;  3K80 C;  4DAM A;  2EVB A;  1P16 A;  3I91 A;  5A2Q L;  3MFY A;  4DV7 L;  3A55 A;  5IT9 L;  1PH9 A;  3NEN A;  1PHJ A;  2CVR A;  1D1I A;  2G5D A;  4HID A;  2UXC L;  4PG3 A;  4C3H G;  1K83 H;  3NTH A;  3MFG A;  3VDY A;  5EJW A;  1K28 A;  1YHB A;  3M7G A;  3GDE A;  4NDX A;  5FLX c;  2RQX A;  2PMZ B;  1Q90 A;  3FPU B;  4I65 A;  4IUV A;  4C3J B;  1FJG L;  3U58 A;  5D3D A;  3CAM A;  3SEB A;  1X32 A;  3NQT A;  5E7N A;  2RF4 A;  4R9W A;  1SDF A;  2B2T C;  2EDG A;  4R4O A;  1D7Q A;  2YTV A;  4IQZ A;  2EYP A;  5C6A A;  2F0W A;  2XWB B;  1D6E C;  2G9H D;  1FGU A;  3MXN B;  2UUC Q;  3GP7 A;  2JSO A;  5ISR A;  5M5W B;  1IBL L;  5FKA C;  3DM1 A;  4X65 Q;  1PH2 A;  3DM3 A;  1PH6 A;  5T1G A;  2QA4 A;  2LKV A;  5M3F B;  3ERQ A;  3Q23 A;  1LT4 D;  2DY7 A;  4DNT B;  4A4I A;  2KBN A;  2JA6 G;  1XYI A;  3G48 A;  1RF2 D;  1SE4 A;  2OTJ A;  4Z9C B;  1Y1V G;  2OWO A;  3M4O H;  4UAI A;  2X6G A;  2EQS A;  2VUM H;  4QMG A;  2JA8 H;  1PRT B;  1TS2 A;  3A0J A;  1KD1 C;  2RDF A;  4JOI C;  4C2M B;  1YI2 A;  2AMC B;  4DF7 A;  4A3I B;  3S2H H;  3M9B A;  4DR5 L;  2NZH A;  2J7Z A;  3CXC A;  4G7H C;  1A2T A;  3CQZ B;  1H9J A;  4CKB A;  4KHV A;  1S5C D;  1W3S A;  5DM6 3;  3F2C A;  2YTX A;  3I90 A;  4TSS A;  5CV6 A;  4RA8 A;  3A5U A;  3MXU A;  1NUC A;  4Y7N B;  2F0H A;  2N49 A;  3HOV G;  5C4J H;  3LWE A;  4WFN 3;  5IWA Q;  4X3T A;  1VQE A;  5C4X B;  1EIF A;  2ICI A;  3T51 B;  3TEH B;  5IYC G;  4GOP A;  1HZ9 A;  4ABN A;  3G71 A;  1AN8 A;  1HHV A;  1SXT A;  2R92 H;  5IOC A;  1D5M C;  3CHB D;  1VQB A;  1XPR A;  4OEM B;  1XJV A;  2AWO A;  1GVP A;  4BS9 A;  3MEF A;  1SJH D;  2EJG C;  1YJ9 A;  1SRU A;  2LS0 1;  3QJY A;  4JI3 L;  3A74 A;  4IPH A;  4UHV A;  1Q8K A;  1D8L A;  3F2B A;  1UEB A;  1X3F A;  2R93 B;  4Q0F A;  2RDH A;  3UE0 A;  4ZLT F;  1ENF A;  1MGS A;  2NTT A;  3DHQ A;  2MGS A;  5CMD A;  3GTP H;  1YJN A;  1XNR Q;  2IT1 A;  2X6L A;  2NYZ D;  1XNQ L;  2UU9 Q;  4LF9 L;  4A3E B;  3J7A F;  5C3X A;  1MKH A;  2NVT H;  4JBJ A;  5IT9 c;  2E5L L;  3VR3 A;  4IOC A;  5JJZ A;  2FXQ A;  2TMP A;  2QDB A;  3T56 B;  3GTJ B;  5FLM H;  2P5Z X;  4DV5 L;  4LAA A;  1GHK A;  3A7L A;  4C3I B;  3S15 B;  5LHY 1;  4F7X A;  4KHP Q;  2A68 C;  1HA5 A;  2VW9 A;  1Y69 U;  1YNJ C;  4B9X A;  4DXG A;  3OTO Q;  1PFB A;  1U5K A;  4C3J G;  5JJK A;  2AUJ D;  3DWP A;  1X54 A;  1XMO Q;  1O7Y A;  4A3B B;  4HCS A;  1MI2 A;  2O4X A;  3CP0 A;  3Q0A A;  2N8N A;  3H94 A;  3RUZ A;  2TSS A;  2WB1 E;  1XMQ L;  2PZW A;  2YU9 H;  1VQN A;  2F1M A;  2SOB A;  3AB9 A;  4F88 A;  4DR6 Q;  4ZK9 B;  3HGB A;  5I9O A;  3ICE A;  3PQI A;  5FK9 C;  1GKH A;  2K5W A;  2M9V A;  2Z4I A;  3X3M A;  4DV4 Q;  5M3F G;  2DGY A;  1SBB B;  2PCF B;  5IYB H;  2B63 G;  1VF5 C;  5E1F A;  1I6H H;  4BY7 B;  4DK0 A;  1SNC A;  1JE5 A;  2QIL A;  5ELE A;  4PMW A;  3PV0 A;  4JI1 Q;  1LTA D;  1JB3 A;  4B3S L;  1F2Z A;  2Q2H A;  1A2U A;  1KC8 C;  3NWS A;  3HOX B;  4DKA C;  3S1M H;  2IX0 A;  1UAP A;  5DAU A;  1PZJ D;  1TWC H;  3DLL A;  4H44 C;  2F0I A;  2ID0 A;  2JA6 H;  1TU2 B;  4HIO A;  4K6L A;  4AQY Q;  2R7Z B;  2HD3 A;  1KDC A;  2PZU A;  3BDC A;  1YHA A;  3BDL A;  1I6V C;  3QB3 A;  2L4N A;  3X3N A;  4NXN L;  1LV9 A;  1KLG D;  3K7A H;  3NBI A;  4DNI A;  5C44 H;  3FHW A;  2CH4 W;  4R8I A;  1C7Y A;  2PI2 E;  1QVC A;  4P2C B;  5L37 A;  4I7Z C;  1AE3 A;  4LF8 L;  4MN3 A;  4HSV A;  3T1H Q;  2VQE L;  1UEA B;  4RKB A;  2AUK A;  4DUY Q;  3JAM L;  2QEX A;  1LYL A;  3KF8 B;  5ELO A;  2N88 A;  5IOD A;  1N33 Q;  1NBW A;  5C4X G;  1CA5 A;  3HKS A;  3C1F A;  1YNJ D;  1DGS A;  1MBY A;  4NW2 A;  1G51 A;  1HJP A;  5C4H A;  3VR5 A;  3PSI A;  1SE3 A;  3HOU H;  1JR0 D;  4JVZ A;  1R9T B;  2XGT A;  1EQV A;  3H0G H;  4LF7 L;  3K5O A;  3NSW A;  1A8V A;  4XT1 B;  4KKT A;  3OW7 A;  1FD7 D;  3HOZ B;  4OX9 Q;  4UP8 A;  2R93 G;  5D3I B;  2PNR C;  1EFI D;  1CT1 D;  1LTB D;  3RLN A;  1K8G A;  5JPN C;  2HUG A;  1IL2 A;  4OHJ A;  1I94 Q;  1MSG A;  4X6A H;  2UUA Q;  4LFA L;  1JOR A;  1S4Z A;  1X9N A;  1I3Q H;  1HFG A;  1JIC A;  1HTL D;  3D3R A;  3EVQ A;  3TP8 A;  5KIX A;  3W5O A;  1I50 B;  1HNX Q;  1JMC A;  1QG7 A;  4JI2 Q;  1IZ6 A;  1HNZ L;  2WAQ B;  1I4G A;  3K7U C;  2L55 A;  4C3I G;  3NUC A;  2BDO A;  1EZ8 A;  4RHS A;  2EXZ A;  4AYB E;  1EY9 A;  4JI4 Q;  1M8A A;  4A3J H;  1EU3 A;  1OTC A;  1HXY D;  2ES2 A;  1SEB D;  4QY7 A;  2HCI A;  1F9R A;  2VZA A;  2AQ2 B;  1LM0 A;  4A3B G;  3I4M H;  2K04 A;  3K58 A;  4IUT A;  4DU9 A;  2OXP A;  4XDX A;  1E7Z A;  2K75 A;  3FEW X;  4FVM A;  3GTK B;  2F0P A;  4C3J H;  4UY8 C;  1EIY B;  3HZX A;  2X69 A;  2NTS A;  2E8G A;  2KA7 A;  1FR3 A;  4ZRZ A;  2YYZ A;  5KYL A;  1RL2 A;  3V2T A;  3OHX C;  1X3Q A;  3ERO A;  4DV2 Q;  1QZG A;  1KDB A;  1WD0 A;  1MSH A;  1O80 A;  4BY7 G;  2B2T A;  4DR4 Q;  4LFB L;  2RDG A;  4POG A;  1SND A;  1O7I A;  4ID6 A;  1S5E D;  4DR3 Q;  2EJF C;  4BXX H;  2PO4 A;  2NUC A;  3HKZ E;  5M5W H;  4DV1 Q;  1G2T A;  3H15 A;  4EQP A;  1NY4 A;  5IIF A;  2JA9 A;  4DK1 A;  5M3F H;  1K8M A;  4YY3 Q;  3HOX G;  4IZ8 A;  2KQ3 A;  1FL0 A;  4PMC A;  1MJC A;  1F2M A;  5C0X J;  1YVC A;  2EY5 A;  3NPP A;  1WD1 A;  1ONL A;  3IRB A;  1JWS D;  1Q8I A;  4C2M H;  3IAY A;  2ZJQ A;  4A3I H;  2JA5 B;  4JOI A;  4R8N A;  1PTO B;  1JC7 A;  3IFT A;  5LMU L;  3CQZ H;  1PRT F;  3VYT A;  4OIK A;  3HS0 C;  3RMH A;  1FYC A;  1Y14 B;  1HQR D;  2F4V L;  1R4P B;  2E74 C;  1EY5 A;  1G2S A;  3R93 A;  2EY2 A;  1Q7Y C;  3W2D A;  2LFN A;  2Z4H A;  4L5Q A;  1G8Z D;  3LGJ A;  3FMC A;  3S14 B;  4GLV B;  2CQA A;  4OGQ C;  4KJO A;  1DOK A;  1SMX A;  4XXE A;  3HOZ G;  4R4I A;  4DR7 L;  2FMC A;  1GUT A;  2QF7 A;  3GTQ B;  1TXY A;  4P74 A;  1SSO A;  4DR2 Q;  1N36 L;  3H09 A;  1X65 A;  3RN5 A;  1EWH A;  4A3K G;  3OYY A;  4OON A;  1SNQ A;  1WVL A;  1YZ6 A;  4ILW A;  3PIP A;  2UXD Q;  2R93 H;  1HFN A;  2MFI A;  1CI3 M;  3RZD B;  1TY2 A;  3NP8 A;  1GD7 A;  1VQJ A;  2WAQ G;  4DUZ Q;  3EN2 A;  5BR8 L;  1WCM H;  4A3E H;  1FGB D;  1SFO B;  3KLR A;  4B3T L;  1H9S B;  3DEP A;  3VR2 A;  3GTL B;  1D5X C;  3GTJ H;  1IW7 C;  1Z47 A;  3AU7 A;  1BBX C;  4C3I H;  1UE6 A;  5EQ0 A;  4QF4 A;  1Y8P B;  1EEI D;  2HHH Q;  2JA7 G;  5A2Q E;  5FLX L;  5IT9 E;  1OXV A;  1B44 D;  2EYL A;  2E2D C;  2ZT9 C;  3GD7 A;  5M5X B;  1EY8 A;  4XTC S;  5IY0 A;  4A93 B;  4FDB A;  3SVM A;  4APV A;  1CKN A;  3DEO A;  4N9P A;  4GKJ Q;  5EPL A;  3GTO B;  1VQ4 A;  1HZC A;  3BVG A;  4A3L G;  5FO9 B;  1WFQ A;  2R6G A;  3OMG A;  4IPC A;  4BY7 H;  2D9U A;  1Y1V B;  3S1N B;  2MP1 A;  4A3F G;  1C9O A;  2F0N A;  5LL6 X;  2NN6 H;  1CFM A;  4WOR A;  1N34 Q;  4ME5 A;  1LTG D;  1JJ2 A;  4A3M G;  4GNX B;  4QUF A;  2EYF A;  2KED A;  2C5C A;  1PFM A;  2R7Z H;  2Q8T A;  1IKM A;  2JA5 G;  2UUC L;  2Z6K C;  1GO3 E;  1SE2 A;  1U4L A;  3W1G A;  3J7Z C;  4N9T A;  4EQN A;  1HNW Q;  3MZ5 A;  3U4V A;  3CCQ A;  1JWU D;  1G6Z A;  3PO2 B;  3E0E A;  4OXP A;  2BCO A;  2F0M A;  2F3I A;  4OWX B;  4JI5 Q;  1BVS A;  4GN4 B;  3U50 C;  4HJ5 A;  1IL8 A;  3DXJ C;  2F0F A;  2Y0S G;  2OF1 A;  1M90 C;  2VXW A;  1PLF A;  1BCP B;  3UE1 A;  3PIO A;  1ILP A;  1N9W A;  2F3V A;  2D62 A;  1EYC A;  5IGF A;  1BQQ T;  4KJN A;  5HGQ A;  2BH2 A;  1UE7 A;  1F2L A;  3I4N B;  3RR5 A;  3T4A C;  1IYV A;  3K8A A;  3E9I A;  1KIX A;  2UXB Q;  4OWT B;  1R9T H;  5G3L D;  1JCK B;  4R4C A;  2MQH A;  5AFW A;  2XIW A;  1F9S A;  4DK6 C;  1L1O C;  3HOZ H;  1EY0 A;  4OIJ A;  4IUR A;  2DUD A;  5EPK A;  1PH7 A;  2LXK A;  2OTL A;  4O2D A;  1GUW A;  5IWA L;  1QOH A;  1DOM A;  3GTM H;  3CCE A;  4B3M Q;  1Q1B A;  4R1J A;  2QKI C;  3B6Y A;  1RDP D;  5JVG 3;  1M1K C;  1I50 H;  4HIK A;  1O7Z A;  2B8F A;  3BU2 A;  3PIO 3;  1LTR D;  4AIM A;  4ZAI A;  5ELF A;  3NBH A;  3P1H A;  5IYD H;  1QUQ A;  4A3C G;  2A6H D;  3EJI A;  1EQT A;  5NUC A;  2NVX B;  3CRL C;  1LTT D;  4FNF A;  3G6J B;  4IOA A;  5IGC A;  4OO1 G;  1SE8 A;  2DY8 A;  2K5N A;  2A5H A;  3L2P A;  3D6W A;  2PQA B;  4PZ7 A;  2UU9 L;  4K6D A;  5C5M A;  2K28 A;  3FKI G;  3MWY W;  4GLX A;  4DPG A;  4A93 G;  1TY0 A;  3GTK H;  2B63 B;  4MTN A;  4ZKC B;  1VQG A;  2PQA A;  4NMZ A;  1PMR A;  2K4K A;  3U4Z A;  1YIT A;  4IUN A;  5HUR A;  3OMC A;  3ZJY C;  4OWW B;  4V19 0;  3ND8 A;  1TWG B;  2GN5 A;  4HJ9 A;  2MO1 A;  4KHP L;  5CGK A;  3SK4 A;  3OTO L;  3V05 A;  4P73 A;  3KK7 A;  2HDM A;  4A3L H;  5FJ8 G;  1XMO L;  1JB7 A;  3TZD A;  3S1Q H;  2HQE A;  4A3D B;  3VYU A;  2GVA A;  4GZY C;  1VCI A;  2A8V A;  2QCP X;  4JI6 Q;  4DR6 L;  4K5X A;  1VQK A;  5TSS A;  3VR4 A;  4KKS A;  1SYC A;  4CDC C;  5C3E B;  4DV6 Q;  4DV4 L;  3CRK C;  4GOP B;  1IYJ B;  3PO2 G;  1JE4 A;  1L0X B;  3S17 B;  4KY6 A;  1QZH A;  3Q24 A; 
#chains in the Genus database with same CATH homology
 2NWG A;  5K5P A;  1PTO H;  2K32 A;  4G7O C;  1U4R A;  2EOT A;  4CJ0 B;  3KBX A;  1PYW D;  4NKL A;  4RGO S;  3C3L A;  3L9A X;  3NQI A;  5I2X A;  1PTO F;  3JAM E;  1EYD A;  5BN4 A;  3OWF A;  5C5L A;  4U67 3;  1LT3 D;  3P75 A;  3RLF A;  3OIQ A;  3T13 A;  1WTR A;  1AZQ A;  1CQV A;  2F0U A;  1PZK D;  3PUX A;  4X3K A;  3A54 A;  2PW5 A;  1CHP D;  1B50 A;  1E2Z A;  1XX8 A;  2Z8L A;  3WOF A;  1TQO A;  3HEJ A;  2BE5 C;  3BZD B;  2BOS A;  2K01 A;  1TS3 A;  5DNF A;  4TKO B;  1BOS A;  2F3W A;  3C1E A;  1LAC A;  3ONA B;  3HOW B;  4BY1 B;  4TRD A;  3J80 L;  5I2Y A;  4FP5 D;  1EIH A;  4CKE A;  4V0B A;  1TWA B;  4OO1 I;  1B3A A;  1W6K A;  4H7B A;  3D4D A;  2E2H B;  5M5Y B;  1ESR A;  3P7J A;  3VYR A;  1I4Q A;  3K59 A;  4EGV A;  2RKS A;  5EGT A;  1DCZ A;  2F4I A;  2F0G A;  1STH A;  2PQE A;  1STE A;  4G7Z C;  1GHJ A;  4CHT B;  1WTX A;  1JOO A;  2N55 A;  3MXP A;  2O5J C;  2H4O A;  1F2Y A;  5KYI A;  2Q8R E;  5CV4 A;  2JP1 A;  2B2U C;  3SR1 A;  2PZT A;  3OOC A;  4FXD A;  2F0L A;  5E4W C;  4RFB A;  3MXG A;  2K5Q A;  2E2J B;  1SYE A;  2BA0 A;  4KV6 A;  4HMJ A;  4FF2 A;  2A74 C;  2A68 D;  2K7V A;  3OPO A;  2OT2 A;  5JAV A;  4KMU C;  3SK8 A;  1AP0 A;  4M8A A;  5KNC A;  1DJR D;  4ZUJ A;  2F0J A;  3RD4 A;  1R4Q B;  3V96 A;  1PXU A;  2B8G A;  5C4Z A;  4J1M A;  4XIG S;  2WKC A;  4KY7 A;  1RHP A;  3BYY B;  4X3S A;  3ZYY X;  1QNK A;  1C8C A;  5FO7 B;  3NHH A;  4A3K B;  1BCP F;  1Y1W B;  2HDL A;  2NBF A;  3IKJ A;  5K36 G;  4IFD J;  3TZU A;  1DYQ A;  4XT3 B;  3FDT A;  1NR4 A;  2FHT A;  3SE0 A;  4RAU C;  4PQX A;  4K5W A;  1AZP A;  1J8I A;  3OIP A;  1FNV A;  1F9Q A;  3GQB A;  4TQU S;  1SNM A;  1T5X D;  2BDN A;  4FXK C;  4KN7 C;  5KEE A;  3PUW A;  1H9K A;  1SYG A;  2JA7 B;  2K33 A;  4QIW B;  4L63 B;  3DWA A;  2R3Z A;  2KEC A;  5BN5 A;  5I4D A;  1UNS A;  1Y8O B;  2CW0 C;  5JPM C;  2JEB I;  4IN3 A;  3QO2 A;  1EL0 A;  4MIU A;  2WP8 J;  3E0J A;  2EYM A;  4RGT A;  3D4W A;  3WOE A;  4KTA A;  5FLX E;  3BYT B;  3MA2 B;  2ZXR A;  1HCZ A;  3M85 A;  2B2Y C;  2F0O A;  4O42 A;  4A3F B;  1A3U A;  3H91 A;  5JEA J;  1GUG A;  1JWM D;  2F0V A;  3A7A B;  3BDO A;  2JYO A;  1Z6H A;  2VUM B;  3T53 B;  4YIJ A;  2A73 B;  4A3M B;  3O13 A;  5CV7 A;  4QCL A;  4B08 A;  1PRT C;  2KCN A;  3MEH A;  2B2W C;  3A8K E;  5KND A;  3FPP A;  4DFA A;  2MPM A;  4RWS C;  4CJ2 C;  1G29 1;  4XQJ A;  4HR7 B;  2RSN A;  1V1O A;  1VDZ A;  4KD3 A;  4FF1 A;  2EYH A;  2Y0S B;  2J4X A;  2EPB A;  4KD4 A;  2WKD A;  5C0X G;  1LTI D;  2K5D A;  5D14 A;  3RZO B;  1H9R A;  5E4X A;  4CJ1 B;  2DNE A;  1ZEQ X;  4RH6 A;  3N6R A;  3M4Y A;  3SK6 A;  2L9H A;  2Z1C A;  5FOB B;  3QWN A;  2ENB A;  2CW0 D;  4LJZ C;  1EIG A;  2M2L A;  3GTP B;  3K0Y A;  4DAV A;  1SJE D;  3K5L A;  1EWC A;  2KEE A;  1KAA A;  2PYK A;  3GO5 A;  5A35 A;  4BA2 I;  1GUO A;  2L5T A;  3I70 A;  2WAC A;  3D6C A;  5K36 H;  4DA2 A;  1ET6 A;  1C4Q A;  1LT5 D;  1CA6 A;  4X3U A;  1EOT A;  1V1P A;  2JE6 I;  4HAE A;  2O2L D;  1KTK A;  4HCE A;  2RA4 A;  2H1E A;  3MAQ A;  3HP3 A;  5EKI A;  5EBC A;  3FKI B;  4DN4 M;  2F0E A;  4LK1 C;  5HGT A;  1PZI D;  1U9R A;  2NZ1 D;  4A3G B;  5M9O A;  3E5S A;  4S3S A;  2XWJ B;  1HA6 A;  4KI0 A;  3BVM A;  3D4R A;  2IL8 A;  2R61 A;  1CM9 A;  2A69 C;  3UI2 A;  1Q3L A;  1CTM A;  5EBD A;  3K5N A;  3WDN A;  4J6H A;  1ENC A;  3S1M B;  1GXD C;  1TWC B;  1AFP A;  2F0K A;  1XWE A;  5CBE E;  4KKU A;  3S1R B;  4FXG C;  2F0Q A;  5EKK A;  1EZ6 A;  1QCB D;  5E3F A;  2A6E C;  4NP5 A;  4DGZ A;  3PUV A;  2C9O A;  3QG1 A;  2WII B;  2B2U A;  1EY4 A;  1DM0 B;  4O1N A;  1TS5 A;  1J9O A;  3U9O A;  4J8Q A;  1IW7 D;  3IFD A;  4KHZ A;  5C0X I;  3R8B A;  3S16 B;  4RCO A;  1T5E A;  5C0X H;  3HOU B;  2LY7 A;  1LAB A;  5IGB A;  1OO9 B;  1EYA A;  1A3T A;  1VF7 A;  2IX1 A;  3FRP B;  2F0D A;  1QJO A;  4HTH A;  1I3Q B;  2V4D A;  5CC4 A;  1M4V A;  5CV8 A;  2PW7 A;  2SNM A;  1BR9 A;  3T16 A;  4KN4 C;  5KNB A;  3K57 A;  5M3M B;  4A3J B;  1Q12 A;  4RGM A;  2D2C C;  5BN3 A;  4DAY A;  4K2K A;  2IWH A;  3I4M B;  2WB1 B;  2A6E D;  1Y8N B;  1JOQ A;  1YNN C;  1WTW A;  3TBI B;  2EE1 A;  5I6W A;  1SAP A;  2FIN B;  1S5D D;  1BO0 A;  3M3Y B;  1LLR D;  3D31 A;  2G9D A;  1I4P A;  3J80 E;  4HED A;  3SK5 A;  3BVZ A;  2QEJ C;  5ELD A;  2M00 A;  5COY A;  5ELB A;  1WTP A;  4UDU C;  2F0S A;  4BBR B;  1GUN A;  3MXN A;  2KJX A;  1TVX A;  2WIN B;  2VB2 X;  3QIA A;  4Q5V A;  2B2Y A;  1HTP A;  2K6A A;  2B2V C;  1RKN A;  3R2T A;  3J81 L;  1VMC A;  1PFN A;  1EY6 A;  2NVQ B;  5ELC A;  1ENA A;  4JBW A;  1XXG A;  4ZYS A;  1UUP A;  1BF4 A;  1NCV A;  3S2D B;  2KOL A;  2JXM B;  3E6Z X;  4H13 C;  1F77 A;  1OXU A;  4BWG B;  1RTO A;  2MHV A;  1FNW A;  4ZKB B;  2AQ3 B;  2B2W A;  4XQN A;  1PTO C;  2KCC A;  2E2I B;  3HRZ C;  5T1I A;  1GUS A;  1U4P A;  3N52 A;  4DXF A;  3A8J E;  1GOZ A;  1BUV T;  1QE6 A;  3GV3 A;  3HOY B;  4FF4 A;  1H9M A;  2XNA C;  5IGE A;  1V8Q A;  5CYU A;  1RJT A;  2EY1 A;  2O5I C;  1CZW A;  2KVM A;  2RBM A;  1YNN D;  3TN2 A;  4IUU A;  3R2I A;  1WTV A;  4CGY B;  5C3W A;  4XQQ A;  4HN7 A;  4FYD A;  1OXX K;  1QNU A;  5IGG A;  1SNO A;  1DOL A;  1STY A;  5J22 A;  3QOJ A;  3FVQ A;  4EQO A;  2ZXP A;  1SMY C;  4AYB B;  1A6X A;  1WCM B;  1B9M A;  4MHE A;  2IW3 A;  4DAP A;  3L7Z C;  1ET9 A;  4OL7 A;  3VA5 A;  3PO3 B;  4HSP A;  4U68 A;  3NK9 A;  2VNU D;  4E6I A;  1C48 A;  4ZQ3 A;  3SDZ A;  1KDA A;  5EPJ A;  5FO8 B;  2XVS A;  1ZYR C;  1RD9 D;  1SYD A;  3NE5 B;  1O7L A;  1TWF B;  1NSN S;  1VMP A;  2AWN A;  2XSC A;  3NXW A;  4RGN A;  2GA4 B;  4OO1 H;  1HUN A;  1BXT A;  3KBG A;  5JVH 3;  5EKL A;  1TS4 A;  1PTO D;  4F8M A;  1RTN A;  1B2T A;  3HKZ B;  4F87 A;  4BBS B;  4K8J A;  2FFK B;  1W6J A;  1A3V A;  4CKC A;  3TME A;  5I6Y A;  4QUC A;  1B9N A;  3KLS X;  4K5V A;  2L1B A;  3OWE B;  2L11 A;  1BDO A;  2K05 A;  5KGU A;  1JOK A;  4C56 C;  1A15 A;  3NWT A;  1L0Y B;  4LMQ D;  3VR6 A;  1OXT A;  2BE5 D;  1SMY D;  3C2P A;  1STG A;  3EFX D;  1SYF A;  4RKL A;  3EQL C;  3TP6 A;  2SNS A;  1V43 A;  1QB5 D;  3NTI A;  4PNY A;  2I46 A;  2WV6 D;  2ICE C;  3K5M A;  2RSO A;  2DN8 A;  1O78 A;  1BCP C;  4B9W A;  4JK1 C;  1Z7T A;  1ZYR D;  2PPB C;  3KF8 A;  1TT2 A;  1CQF A;  4BA1 I;  2IX3 A;  4QB4 A;  3VA7 A;  1ILQ A;  2BA1 A;  3I73 A;  3Q22 A;  3J7Y W;  1DD2 A;  3I8Z A;  3HG9 A;  1FNU A;  4WJW A;  2AQ1 B;  3P20 A;  1X3P A;  4ULL A;  4FF3 A;  2K03 A;  1TII D;  3GTM B;  1ZXT A;  5CV5 A;  3EA6 A;  1KNE A;  1B4O A;  1B1Z A;  1K83 B;  1S5B D;  1IYU A;  3H6M A;  1XTC D;  3D8G A;  3LX0 A;  2E75 C;  4ZUI A;  1SYB A;  2KHS A;  1STN A;  1ICW A;  4C1N K;  1I4R A;  3ITP A;  2F0T A;  2SEB D;  4K8I A;  1HUM A;  4IFD G;  1EU4 A;  4C1N I;  1BNZ A;  1F9P A;  2EYJ A;  3DWQ A;  5COR A;  2KUM A;  1DON A;  5J1Z A;  1DZ1 A;  1JQY D;  1AEX A;  3MHB A;  3GV6 A;  3PUZ A;  3M4O B;  3MVV A;  2JA8 B;  1BCP D;  2NN6 G;  2JEA I;  3S1Q B;  3L3O C;  3S2H B;  1LT6 D;  1ML0 D;  1STA A;  3ND9 A;  5F2D A;  5JOB A;  3TSS A;  3KUP A;  1KLU D;  2B2V A;  2ZXO A;  4IUP A;  5JEA G;  1D1K A;  2IPK D;  5C4J B;  1HQM C;  3S9W A;  2RVL A;  2VB3 X;  2MUY A;  4XYQ A;  3F2U A;  4HMI A;  3KLS A;  4KY5 A;  4RCN A;  1G91 A;  5CR3 A;  5J39 A;  3PUY A;  2R92 B;  3G7L A;  3BS1 A;  3K6O A;  3TDQ A;  4FO2 A;  2Q8I B;  1IHZ A;  1CZG A;  5KRU A;  3URY A;  3SHL A;  5DEH A;  2FMM A;  4RHR A;  2DNC A;  3LWU A;  3NTK A;  1WTQ A;  1K8O A;  3A56 A;  1E2V A;  2NVT B;  1ZKO A;  1KNA A;  1E0B A;  4K2L A;  1ESF A;  1MD2 D;  1B53 A;  4DNR B;  3J7A V;  1V1P B;  4H0L C;  1GJX A;  1PDQ A;  3CKI B;  2OEO A;  2NVY B;  1S5F D;  4XYO A;  2EYO A;  3R3O A;  2E76 C;  1PRT D;  2L12 A;  4KK7 A;  2MJ8 A;  4EVO A;  4C3H B;  3C46 A;  4IUQ A;  4PMB A;  2YU9 B;  2CHB D;  2K1B A;  3LNN A;  2LMC B;  1SNP A;  1H9S A;  1Q1E A;  4IFD I;  1KAB A;  2J0T D;  5LL6 S;  1D5Z C;  1I6H B;  1TWH B;  4IFD H;  5IGD A;  2B39 A;  3H3V C;  1CHQ D;  3AMU A;  2EJM A;  3TP7 A;  3PIP 3;  3SXH A;  2XRS D;  1E2W A;  3CU7 A;  2D5D A;  5G3L F;  2JA6 B;  5DM7 3;  2XRQ D;  3VYS A;  1QIL A;  3TP5 A;  2NN6 I;  1DXM A;  3K7A B;  5C44 B;  4PV1 C;  3MC0 B;  2A6H C;  3Q6S A;  1II3 A;  1NAP A;  2I07 B;  3MTS A;  2EY6 A;  5I9P A;  2FJ2 A;  3M7N A;  4G4K A;  2EZV A;  2L0C A;  3J81 E;  1ROD A;  1QWY A;  1HRJ A;  4ODG A;  3DUZ A;  1EY7 A;  1D2B A;  2IJ0 A;  2F03 A;  1TR5 A;  4L8J A;  1CK1 A;  1IKL A;  3OSO A;  5JEA H;  3HOV B;  2SDF A;  3GTG B;  1EEF D;  5CV9 A;  1U4M A;  1AW7 A;  1I4H A;  3I3C A;  1NR2 A;  3PMF A;  3W3A A;  3IL8 A;  3U9S A;  3H0G B;  4M1U B;  1RCV D;  1I4X A;  4K14 A;  5D65 A;  1OXS C;  3BG3 A;  2NB0 A;  1LO5 D;  1STB A;  2XN9 C;  2HCC A;  2A69 D;  3QOL A;  4L6T B;  3DMU A;  3A8I E;  1LTS D;  3I4L A;  4CBV A;  4WRD A;  1WTO A;  5CBA E;  1TKW B;  3I72 A;  1HPC A;  4IAL A;  4G57 A;  2EVB A;  3I91 A;  5A2Q L;  3MFY A;  3A55 A;  5IT9 L;  2CVR A;  1D1I A;  4C3H G;  3NTH A;  3MFG A;  5EJW A;  3M7G A;  4NDX A;  2RQX A;  2PMZ B;  1Q90 A;  3FPU B;  4I65 A;  4IUV A;  4C3J B;  5D3D A;  3SEB A;  1X32 A;  3NQT A;  4R9W A;  1SDF A;  2B2T C;  2EDG A;  4IQZ A;  2EYP A;  5C6A A;  2F0W A;  2XWB B;  1D6E C;  2G9H D;  3GP7 A;  2JSO A;  5ISR A;  5M5W B;  5FKA C;  3DM1 A;  5T1G A;  2LKV A;  5M3F B;  3ERQ A;  3Q23 A;  1LT4 D;  2DY7 A;  4DNT B;  1XYI A;  1RF2 D;  1SE4 A;  4Z9C B;  4UAI A;  2X6G A;  4QMG A;  1PRT B;  1TS2 A;  2RDF A;  4C2M B;  4DF7 A;  4A3I B;  2J7Z A;  4G7H C;  1A2T A;  3CQZ B;  1H9J A;  4CKB A;  4KHV A;  1S5C D;  5DM6 3;  3I90 A;  4TSS A;  5CV6 A;  4RA8 A;  3MXU A;  1NUC A;  4Y7N B;  2F0H A;  3LWE A;  4WFN 3;  4X3T A;  5C4X B;  2ICI A;  3T51 B;  4ABN A;  1AN8 A;  1HHV A;  1SXT A;  5IOC A;  1D5M C;  3CHB D;  2AWO A;  4BS9 A;  1SJH D;  2EJG C;  2LS0 1;  3QJY A;  2R93 B;  4Q0F A;  2RDH A;  4ZLT F;  1ENF A;  1MGS A;  2NTT A;  3DHQ A;  2MGS A;  5CMD A;  2IT1 A;  2X6L A;  2NYZ D;  4A3E B;  3J7A F;  5C3X A;  3VR3 A;  5JJZ A;  2TMP A;  2QDB A;  3T56 B;  3GTJ B;  1GHK A;  4LAA A;  3A7L A;  4C3I B;  3S15 B;  5LHY 1;  4F7X A;  2A68 C;  1HA5 A;  1Y69 U;  1YNJ C;  4B9X A;  4DXG A;  1PFB A;  4C3J G;  2AUJ D;  3DWP A;  1O7Y A;  4A3B B;  4HCS A;  1MI2 A;  2O4X A;  3Q0A A;  3H94 A;  3RUZ A;  2TSS A;  2PZW A;  2F1M A;  2SOB A;  3AB9 A;  4F88 A;  4ZK9 B;  3HGB A;  5I9O A;  5FK9 C;  3X3M A;  2K5W A;  2M9V A;  2Z4I A;  4BY7 B;  1SBB B;  2PCF B;  1VF5 C;  5E1F A;  4DK0 A;  1SNC A;  2QIL A;  5ELE A;  4PMW A;  3PV0 A;  1LTA D;  1JB3 A;  1F2Z A;  1A2U A;  3NWS A;  3HOX B;  2IX0 A;  1UAP A;  5DAU A;  1PZJ D;  4H44 C;  2F0I A;  2ID0 A;  1TU2 B;  4K6L A;  2R7Z B;  1KDC A;  2PZU A;  3BDC A;  3BDL A;  1I6V C;  3QB3 A;  2L4N A;  3X3N A;  1LV9 A;  1KLG D;  3NBI A;  4R8I A;  4P2C B;  4I7Z C;  4MN3 A;  4HSV A;  1UEA B;  4RKB A;  2AUK A;  3JAM L;  5IOD A;  2N88 A;  1CA5 A;  3C1F A;  1YNJ D;  1MBY A;  4NW2 A;  5C4H A;  3VR5 A;  1SE3 A;  1JR0 D;  1R9T B;  1EQV A;  3K5O A;  3NSW A;  4XT1 B;  4KKT A;  3OW7 A;  1FD7 D;  3HOZ B;  5D3I B;  2PNR C;  1EFI D;  1CT1 D;  1LTB D;  5JPN C;  2HUG A;  4OHJ A;  1MSG A;  1JOR A;  1S4Z A;  1HFG A;  1JIC A;  1HTL D;  3D3R A;  3EVQ A;  3TP8 A;  5KIX A;  1I50 B;  1QG7 A;  2WAQ B;  1I4G A;  2L55 A;  4C3I G;  3NUC A;  2BDO A;  1EZ8 A;  4RHS A;  2EXZ A;  1EY9 A;  1M8A A;  1EU3 A;  1HXY D;  1SEB D;  2HCI A;  1F9R A;  2AQ2 B;  2K04 A;  3K58 A;  4IUT A;  4DU9 A;  2OXP A;  4XDX A;  3FEW X;  4FVM A;  3GTK B;  2F0P A;  3HZX A;  2X69 A;  2NTS A;  2KA7 A;  1FR3 A;  4ZRZ A;  2YYZ A;  5KYL A;  3V2T A;  3OHX C;  1X3Q A;  3ERO A;  1KDB A;  1WD0 A;  1MSH A;  1O80 A;  2B2T A;  2RDG A;  1SND A;  4ID6 A;  1S5E D;  2EJF C;  2PO4 A;  2NUC A;  1G2T A;  4EQP A;  5IIF A;  4DK1 A;  1K8M A;  4IZ8 A;  2KQ3 A;  4PMC A;  1F2M A;  5C0X J;  2EY5 A;  3NPP A;  1WD1 A;  1ONL A;  1JWS D;  1Q8I A;  3IAY A;  2JA5 B;  4R8N A;  1PTO B;  1JC7 A;  3IFT A;  1PRT F;  3VYT A;  4OIK A;  3HS0 C;  3RMH A;  1FYC A;  1HQR D;  1R4P B;  2E74 C;  1EY5 A;  1G2S A;  3R93 A;  2EY2 A;  3W2D A;  2LFN A;  2Z4H A;  1G8Z D;  3FMC A;  3S14 B;  2CQA A;  4OGQ C;  4KJO A;  1DOK A;  4XXE A;  2FMC A;  1GUT A;  2QF7 A;  3GTQ B;  1SSO A;  3H09 A;  1EWH A;  1SNQ A;  1WVL A;  4ILW A;  1HFN A;  1CI3 M;  3RZD B;  1TY2 A;  3NP8 A;  1FGB D;  1SFO B;  3KLR A;  1H9S B;  3DEP A;  3VR2 A;  3GTL B;  1D5X C;  1IW7 C;  1Z47 A;  3AU7 A;  1BBX C;  5EQ0 A;  4QF4 A;  1Y8P B;  1EEI D;  5A2Q E;  5FLX L;  5IT9 E;  1OXV A;  1B44 D;  2EYL A;  2E2D C;  2ZT9 C;  3GD7 A;  5M5X B;  1EY8 A;  4XTC S;  4A93 B;  3SVM A;  3DEO A;  4N9P A;  5EPL A;  3GTO B;  3BVG A;  5FO9 B;  3OMG A;  2R6G A;  2D9U A;  1Y1V B;  3S1N B;  2MP1 A;  2F0N A;  5LL6 X;  2NN6 H;  1CFM A;  4WOR A;  4ME5 A;  1LTG D;  4QUF A;  2EYF A;  2KED A;  2C5C A;  1PFM A;  1IKM A;  2Q8T A;  1SE2 A;  1U4L A;  4N9T A;  4EQN A;  3MZ5 A;  1JWU D;  1G6Z A;  3PO2 B;  2BCO A;  2F0M A;  1IL8 A;  3DXJ C;  2F0F A;  2OF1 A;  2VXW A;  1PLF A;  1BCP B;  1ILP A;  2F3V A;  2D62 A;  1EYC A;  5IGF A;  1BQQ T;  4KJN A;  1F2L A;  3I4N B;  3T4A C;  1IYV A;  5G3L D;  1JCK B;  5AFW A;  2XIW A;  1F9S A;  1EY0 A;  4OIJ A;  4IUR A;  5EPK A;  1GUW A;  1QOH A;  1DOM A;  1Q1B A;  2QKI C;  1RDP D;  5JVG 3;  1O7Z A;  2B8F A;  3PIO 3;  1LTR D;  4ZAI A;  5ELF A;  3NBH A;  3P1H A;  2A6H D;  3EJI A;  1EQT A;  5NUC A;  2NVX B;  3CRL C;  1LTT D;  4FNF A;  3G6J B;  5IGC A;  4OO1 G;  2DY8 A;  2A5H A;  3D6W A;  4K6D A;  5C5M A;  2K28 A;  3MWY W;  1TY0 A;  2B63 B;  4ZKC B;  4NMZ A;  1PMR A;  4IUN A;  5HUR A;  3OMC A;  4V19 0;  3ND8 A;  1TWG B;  5CGK A;  3SK4 A;  3V05 A;  3KK7 A;  2HDM A;  3TZD A;  2HQE A;  4A3D B;  3VYU A;  4GZY C;  1VCI A;  2QCP X;  4K5X A;  5TSS A;  3VR4 A;  4KKS A;  1SYC A;  5C3E B;  3CRK C;  1JE4 A;  1L0X B;  3S17 B;  4KY6 A;  3Q24 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...