1BNZA

Sso7d hyperthermophile protein/dna complex
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
64
structure length
64
Chain Sequence
MATVKFKYKGEEKEVDISKIKKVWRVGKMISFTYDEGGGKTGRGAVSEKDAPKELLQMLEKQKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/dna
molecule keywords 5'-D(*GP*TP*AP*AP*TP*TP*AP*C)-3'
publication title The crystal structure of the hyperthermophile chromosomal protein Sso7d bound to DNA.
pubmed doi rcsb
source organism Sulfolobus acidocaldarius
total genus 11
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 1998-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02294 7kD_DNA_binding 7kD DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1bnzA00
1BO0A 2HDMA 1WTVA 2RSNA 2L4NA 1C8CA 1ILPA 4X3KA 1RHPA 1TVXA 2HCIA 2K05A 4UAIA 4X3UA 1CA5A 1HRJA 2B2VC 2B2YA 1RTNA 2N88A 1NR4A 1XX8A 1DOLA 1ILQA 2J7ZA 4HEDA 5COYA 1F9QA 1IKLA 1DOMA 1PDQA 2K1BA 2SDFA 4R9WA 1EIHA 1IL8A 2B2TA 2FJ2A 2FINB 3DM1A 4LMQD 3I90A 1G91A 1J8IA 1AZPA 1MGSA 3KUPA 3P7JA 5E4XA 4RWSC 2IL8A 2K28A 1ESRA 1B3AA 1HFGA 2K03A 2KUMA 4IUPA 4OIKA 4XDXA 5T1IA 2R3ZA 1ML0D 2KVMA 1IKMA 4MN3A 1DONA 5CMDA 2X6LA 3Q6SA 4XT3B 1BF4A 2Q8TA 1MSGA 4X3SA 4IUUA 4CJ0B 1SAPA 1NR2A 4IUTA 2DY8A 1HFNA 2HDLA 4DN4M 1B4OA 2KEDA 4NW2A 1WTOA 2K01A 1GUWA 1X3PA 4X3TA 4CJ2C 2XIWA 4O42A 1F2LA 5DNFA 1O7YA 1RTOA 1ZXTA 1QE6A 4RA8A 1O7ZA 2N55A 3F2UA 4HCSA 2Q8RE 4HSVA 1KNEA 4IUQA 1WD0A 2X6GA 3I3CA 4ZLTF 2RA4A 2B2WA 2X69A 5EPJA 1ICWA 2MJ8A 2FFKB 3DEOA 1WTXA 4ZKCB 4RAUC 2MP1A 4HAEA 4OIJA 1G2SA 1B53A 5AFWA 2M2LA 5JJZA 5E4WC 2L11A 3R93A 4QUFA 1CA6A 2KEEA 1S4ZA 2B2YC 4U68A 3FPUB 1U4MA 2H1EA 2FMMA 4CJ1B 2L1BA 3DEPA 1X32A 3QO2A 3N52A 1MSHA 3MWYW 2B2TC 1EL0A 1U4RA 3UI2A 2B2UA 5CORA 1DOKA 2HCCA 1J9OA 1B2TA 1EIGA 3GV3A 1WVLA 1NCVA 1QNKA 3IFDA 4IUVA 5EKIA 5EPKA 2VXWA 3GV6A 1EOTA 1WTWA 4IURA 4R8IA 3SVMA 1F9PA 1F9SA 2B2VA 2NZ1D 1MI2A 2JYOA 2MPMA 1WTPA 3KBXA 2EPBA 2JP1A 2D9UA 1E0BA 1QG7A 2RVLA 2MGSA 1HUMA 3TN2A 1BBXC 3ONAB 2L12A 3D6WA 2CVRA 4MHEA 1VMPA 1M8AA 1JICA 1RODA 5EJWA 2L9HA 1PLFA 1X3QA 3TZDA 3IL8A 1O80A 1WTQA 1RJTA 1XYIA 3FDTA 2RSOA 2HUGA 1B50A 3G7LA 1Q3LA 1CM9A 1EQTA 3LWEA 2NWGA 1SSOA 2KOLA 4ZAIA 5CBEE 1HUNA 4ZK9B 2BDNA 2FHTA 2B2WC 1BNZA 5T1GA 1KNAA 1SDFA 1A15A 1AZQA 4ZKBB 1G2TA 1NAPA 3H91A 1VMCA 2EE1A 1U4PA 2NYZD 1HHVA 3HP3A 1F9RA 1PFNA 2EOTA 1WTRA 1LV9A 1PFBA 2K04A 1AP0A 5EPLA 5EQ0A 2DY7A 1JE4A 1DZ1A 4QUCA 5D65A 1HA6A 4XT1B 1WD1A 3I8ZA 5CBAE 2B2UC 1PFMA 1U4LA 2KECA 3I91A 3MTSA 1G6ZA 5D14A
chains in the Genus database with same CATH superfamily
2HDMA 3GTGB 5E1FA 2R7FA 2F0FA 1AW7A 3S2HH 4LF5Q 3PUWA 1TVXA 1CA5A 5C0XG 4DV5L 2WFWA 5D3DA 5LMNW 3K5NA 1XPOA 4BY1H 5K36G 1A3TA 1JOOA 4J6HA 4EVOA 1YVCA 1U5KA 1PTOF 2PI2A 1FL0A 1F2ZA 4A3EB 3I56A 1FNUA 1LLRD 4DUYQ 3VYSA 1SNPA 4FP5D 2K28A 3HOWH 1PH3A 3D6CA 4JBJA 4AIMA 1BF4A 1N33L 3NBHB 5FLXc 1R4PB 5KYLA 2PI2E 4A3BG 3CRLC 1LTRD 4XYQA 2M00A 2E5LL 2ZM6Q 1KIXA 5L37A 3WOEA 1JOKA 3J81c 3CC7A 1ESFA 4XYOA 1M4VA 1Q86C 1GD7A 4CKBA 2ENBA 1VF7A 3FEWX 3I3CA 2B2WA 5EPJA 4A3EG 4P74A 3OIPA 2F4IA 2JE6I 5E4WC 4JYAQ 2VUMH 3AEVA 2B2YC 3PIPA 1STBA 1V1PA 1N32Q 1D5ZC 5G3LD 3BVGA 1DOKA 1WOCA 3QR8A 1VQKA 1TS2A 1C48A 2CCZA 2VL6A 2ZT9C 3TEHB 1O7IA 2K6AA 4LK1C 4IALA 4ZQ3A 1KDCA 2AKWB 3H09A 3TBIB 4P73A 1XNQL 1EQRA 4DV3L 2RCNA 3DXJC 3IL8A 1NJIC 3RUZA 1RD9D 2CFMA 1DD2A 1IYUA 4FXDA 4PNYA 2BDNA 2JA8B 3VYRA 1RIPA 3ER0A 5IGGA 3R3OA 3GTJB 3H91A 1VMCA 1ZEQX 1LTTD 2K04A 4KJNA 2DY7A 3P20A 4JCVE 5D65A 1JE5A 2BE5D 4DR1Q 2WACA 3TP8A 5IYBG 1PZID 2PNHA 4EQNA 3VR5A 3I4MH 1I50B 1WFQA 3PUYA 4DK3C 4LF6L 2KCCA 2ICIA 3PO3H 3BZCA 2XN9C 1D2BA 2JA8G 1WI5A 3I72A 1EIHA 3VR3A 2B2TA 2PZWA 1PFSA 1SEBD 3ZJYC 4C3JH 1U0LA 1JT8A 1RCVD 4IUPA 4UHVA 4IOCA 3NSWA 4X65Q 3S15B 4JK1C 2JA6B 1SAPA 3TP6A 1GUWA 3J7AF 1WCMH 1B7YB 1RTOA 2LSSA 2DJGC 4A3IH 2EYFA 1GXDC 1VQJA 2A68D 3X3MA 4RFBA 4IUQA 4OGQC 1I3QB 2NTSA 4OL7A 4YWKA 2X69A 1S72A 5DLQE 4IZ8A 3V05A 1IBLL 2DN8A 1B53A 4B9XA 1KAAA 4RHRA 2IY5B 2JQOA 4RG1A 2JA6G 5KIXA 3GD7A 2PMZE 3QO2A 4C2MB 1U4RA 5I2YA 4RCOA 2AWNA 2Z1CA 3IFDA 1MKHA 5JOBA 1ONLA 4BWGB 1EU4A 5M3MB 3C1FA 4R1JA 3K5LA 5C4XB 2A68C 1VQEA 5CV8A 3TZDA 2NVYB 4GLVB 3G7LA 3ZYYX 1SSOA 1VQAA 1NTGA 3M4OB 2Q2HA 1I4GA 1QWYA 1KHIA 1KDBA 4DV4L 1LT5D 1MIUA 4WORA 1PFNA 5LMNQ 1OXUA 1CZWA 2QDBA 1GOZA 3S14H 1T5EA 5M3MG 2IHEA 5C4XG 4KHZA 4C3IB 1PTOD 3GTMH 4DKAC 2EXDA 4GN5A 2PZTA 1B3QA 2KENA 3SDZA 2EY5A 2EYPA 5M3FB 1EQQA 1IHZA 1PA6A 4RMFA 1DCZA 4DNTB 4L5TA 1LT6D 1MBYA 4LF5L 2E2HB 1N36L 3GTPH 2VB2X 3T51B 4BBSH 1Z9FA 1AP0A 4OIKA 2K5NA 4KKSA 1VQ7A 4MN3A 1Q46A 2AQ1B 4LF7L 4XT3B 2Z9HA 4JW0A 3S2HB 1R9TB 1STNA 5BR8L 2XRQD 1CKNA 4IUUA 3PUXA 3T13A 2DJFC 4DGZA 4IJHA 1TWCB 3NQIA 1B44D 4C3IG 4A3LG 1B4OA 1WTOA 4NW2A 3J80L 4L63B 2Z4HA 3A74A 3UDFA 5M3FG 3CW2C 2ZTEA 1YHBA 4GOPA 1PTOC 2TMPA 3K5OA 1Y1WH 1ICWA 2MJ8A 4N9PA 3ERSX 1K8AC 3PIOA 2XWBB 2UXBL 3H0GH 5FJ8H 3CCJA 4CJ1B 2ASBA 3T56B 3DWAA 1VQOA 2SEBD 4BY1G 2QEJC 4DK1A 3G6JB 2UXDL 4EX5A 1L0WA 2A73B 1HNXQ 4CKEA 1E3PA 3G48A 1N32L 1WTPA 2HIXA 1SE3A 2VUMB 2C9OA 3S9WA 1QNUA 4JI1L 2KCMA 2D0OA 3NTIA 1HXYD 3QWNA 3J7YW 1M8AA 3NWTA 5C44H 4A4IA 4E6IA 3LX0A 2L9HA 2YTVA 3C3LA 4UP9A 1KTKA 1E22A 2XGTA 1VQ8A 2KHJA 4DAYA 1Y8PB 5M5WH 1PH1A 4B3TQ 4P71A 2K5QA 3G4SA 4P75A 1T9HA 1JWMD 3TRZA 1JWUD 4GNXA 1EEID 3NE5B 1CZGA 1Z7TA 2VUMG 1X55A 3E5SA 1HA6A 1I94L 2WKCA 3A7AB 3FHWA 5ELNA 1A2TA 1JB3A 1VF5C 3TS0A 3IAYA 3BZKA 1UUPA 2L4NA 2AMCB 1ILPA 1RHPA 1STAA 1D5MC 1STEA 4JI4L 2VS1A 3TDQA 5JPMC 2OTJA 4WRDA 2UUAL 3KBGA 4C3HB 1VQLA 1A62A 1FJGL 2A6HD 2K03A 3A8JE 5T1IA 3I4MB 2KVMA 3OW7A 4X6AH 4DV5Q 1LT4D 5IT9E 4OEMB 2DY8A 2HT1A 1VQ4A 3PO3B 1CT1D 1S5BD 1Q82C 2L0CA 3CQZH 2D62A 3L0OA 4MTKA 1L1OB 4TRDA 4C3JB 1LTSD 1EY0A 4K2KA 3TZUA 2IX0A 1KQSA 1N33Q 3OTOL 5C6AA 5LMUL 1TWAH 2E5LQ 3I4MG 2OWOA 1GM5A 1GHKA 4V190 1E1OA 4LF9L 1WCMB 1HCZA 4RHSA 3DLLA 1VQFA 3PO3G 4DAMA 2LFNA 2A6HC 2HCCA 4QGUA 1HPCA 1BVSA 2ID0A 4PMBA 5C4HA 1UE1A 3A0JA 4DPGA 4FF2A 4K2LA 1DGSA 3GTLB 2ZXPA 2B2VA 1TY0A 1HA5A 4C3JG 4A3CH 1ICFB 3R2TA 4OXPA 4JI8Q 1E0BA 1E24A 5A2QL 2ATWA 1S3OA 2H5XA 4QB4A 4FF1A 4J8QA 1JB7A 2F0UA 2CVRA 3S1QH 5DEHA 1SMYD 1YJ9A 4X66Q 1GUOA 1WCMG 2DNCA 4AQYL 3MZ5A 3LWEA 1CSPA 1H9SA 4BA2I 2B2WC 2QW7A 4DUZL 3S16H 5CV6A 2WINB 2BOSA 3HOUH 2AQ3B 4DV3Q 5FOBB 4M1UB 1PZKD 1L0YB 1QUQB 5EPLA 1A2UA 4YHHL 1TS5A 5FLXE 1V1OA 2I0QA 4L8JA 5CBAE 1ET9A 3PUVA 3MTSA 5ELOA 1H9RA 5D14A 4B3SL 5HGTA 2RSNA 3Q8DA 1BR9A 4GS3A 1I6HH 1HR0W 4ZUJA 4K8JA 4A3KH 2VNUD 2F0TA 3AFQA 1IL8A 3LGJA 2L55A 2PPBC 4A3DH 1MJEA 3S14B 1VQGA 4BA1I 2IW3A 3P7JA 3IRBA 5JEAJ 1BCPC 1HFGA 3NQTA 2EJGC 2F0MA 3GTMB 5GADC 4LF6Q 2PQAA 1W6JA 2K01A 3DWQA 3CP0A 2KHSA 3D4RA 3J7ZC 4YIJA 5A35A 2F52A 1AEXA 4DV7L 3GTPB 4BBSB 3F2DA 3OMGA 2PW7A 4RGNA 2X6GA 5IP7H 1PTOH 2F0JA 4ZKCB 3T1YQ 1KLGD 5AFWA 5BN5A 1T5XD 2AUJD 1JOQA 2HHHL 3FVQA 2QA4A 4POGA 3AB9A 5LHY1 2PW5A 1EYCA 2EDGA 1STHA 3OW2A 1MSHA 2B2TC 5IE8A 2NVQH 3W3AA 1NCVA 5EPKA 1Y1WB 1IBLQ 4WJ3M 5GROA 3BG3A 1VQPA 2NZ1D 1MI2A 4BBSG 1V8QA 4MIUA 2PO4A 2D9UA 1SJED 3H0GB 5EKLA 2C35B 2QGQA 3NP8A 2FMCA 3I4LA 1AH9A 1ENCA 1EY6A 4LF4L 5J1ZA 3K58A 4DV2L 2RHSB 4RGOS 4LFCL 4F87A 3GTQH 3E0EA 1K8GA 2NWGA 5IT9c 1SMXA 2K14A 2OT2A 1KNAA 4ILWA 2F0PA 3HKZB 4JI7L 1Y1WG 5JEAH 3CKIB 3M4QA 1VQCA 5C44B 3CCRA 3H0GG 4B3TL 5FJ8G 5ELCA 3CC4A 2BA1A 5KNDA 4PZ6A 5IGFA 3OYYA 4N9TA 4HIKA 5M5WB 5IODA 4DV4Q 1C8CA 2OXPA 5FKAC 1H95A 1NR4A 1TWHH 1DOMA 2SDFA 1K28A 3I2ZA 2EJFC 5HY6A 1B1ZA 1G91A 1FR3A 3HKZG 1MGSA 4PV1C 1Y1VB 2B8GA 2NTTA 2RQXA 5C44G 1IKMA 5LL6S 5BN3A 5CMDA 1YJWA 2OF1A 3RZDH 2Q8TA 4G7ZC 1PH5A 4A3BB 2KEDA 1X3PA 3JAML 2EYHA 1PH6A 1O7YA 1N36Q 4RA8A 1EY5A 3MXNB 2V1CC 4MTNA 4LF7Q 3EN2A 5BR8Q 1XWEA 1YNJC 1I4PA 4JOIA 4RAUC 3E0JA 4DAVA 1Y1VG 2L11A 4GLXA 1OXXK 3CMAA 2N78A 3KYHC 4FXKC 4KMUC 1C7YA 1U4MA 3CQZB 4CDDC 4N8FA 3SK8A 2CWPA 1EIGA 2A5HA 1HNZL 3M9BA 4IURA 2IX1A 1JC7A 2UXBQ 3RLNA 1TWAB 4Y52H 3A5UA 4APVA 2MGSA 1HUMA 1KL9A 1X65A 2AWOA 5ELEA 2UXDQ 3SEBA 3C46A 5KRUA 4JI8L 4JG2A 4QY7A 4QQBX 1TWGH 1RJTA 1PRTF 4GOPC 3AFPA 1HUNA 4YY3L 4ZK9B 5T1GA 4ZYSA 4JI1Q 1G2TA 4X66L 2YU9H 1G291 1FYCA 2EY6A 4KKTA 4L5QA 4JI5L 1WTRA 3S1QB 4WJWA 4UP7A 4CGYB 3CHBD 5H1SE 5IY0A 1VCIA 2HIVA 3U50C 1U4LA 1SYEA 3I91A 4NPSA 3D8GA 3NWSA 4L5SA 1SFOH 1Q90A 3UDIA 3VYUA 4L5RC 3S16B 4F7XA 2KA7A 3HOUB 3OPOA 1XNRL 2LKVA 4QIWE 5COYA 4F88A 2AQ2B 2K1BA 3HS0C 4R8NA 3A56A 4A3CG 2FJ2A 2ZTCA 3W1GA 1I94Q 5CC4A 4NMZA 1J8IA 4TSSA 3Q23A 4O1NA 3MAQA 1ENFA 1NBWA 2UUBL 2B39A 5C3XA 1UNSA 1Y8NB 2R3ZA 2JA5H 5I4DA 3NK9A 2WAQE 3FPPA 1I6HB 4NXNL 4JI4Q 4R4TA 3S1NH 2UU9L 4KN7C 3PQIA 4DAPA 2HDLA 4A3KB 2E2IB 1HFNA 1BQQT 3CF5A 4KLKA 2UUAQ 3KDFA 3VR2A 2XWJB 5DNFA 2F0NA 1KLUD 1UE5A 4GNXC 4A3DB 3T4AC 4HIOA 1IBML 1FJGQ 1O7LA 3K59A 3HOUG 3H94A 3NPPA 4UPAA 1SR3A 1PYBA 1A8VA 3B6YA 1H9KA 1Y69U 3CAMA 4J1MA 3S2DH 1G2SA 3BU2A 3MXPA 4QL5A 2EYOA 1SYGA 3TMEA 1TIID 5CGKA 4K0KL 3OOCA 3U4ZA 2QDLA 4MNOA 4GKKL 4A3KG 3T1YL 3OTOQ 3K6OA 1J9OA 5LMUQ 3HOXH 4XQNA 4IJLA 4A3DG 4IUVA 4IO9A 4KY7A 2BE5C 3GV6A 4ZRZA 1CUKA 1UAPA 1V1QA 2MPMA 1EFID 4LF9Q 4C1NI 3PCOB 3TN2A 1EYAA 1A6XA 4A3JB 3ONAB 3D6WA 4IUNA 5CV4A 1JMCA 1VMPA 4KTAA 1YNND 4R4OA 4RGMA 5EJWA 5C3EB 2NVQB 2F1MA 1BDOA 1O80A 1GO3E 1PYSB 3DUZA 4K5XA 4IFDH 1H9MA 2FHTA 3MEHA 1CK1A 4HJ8A 5IP7G 4DK0A 2EE1A 2GVBA 1LO5D 2IX3A 2D0PA 2B3GA 4JI2L 4AQYQ 1SYCA 3GTQB 4TVAB 5E7NA 4A3JG 2K5WA 4XT1B 4DV6L 1G6ZA 3OHXC 4DUZQ 4HCEA 1WTVA 1TT2A 2GA4B 5C3EG 3K7AH 2IT1A 3CCMA 1PV4A 1YZ6A 2EYJA 3H3VI 2B2VC 3HKSA 2N88A 4OONA 3S1RB 4YHHQ 1IYJB 1R4QB 1IKLA 1PZJD 4K5VA 4DU9A 2L5TA 1IXRA 4ME5A 1QOHA 2F0OA 4HIDA 1X56A 1P8LA 1HZCA 4H0LC 4B3SQ 5M5XB 4A3FH 4DXGA 3R2IA 3U9OA 2E76C 1HZ9A 5DM73 4LUVA 4CJ0B 1TWHB 2R61A 5KNCA 3T1HL 1GUTA 1EZ8A 1Y8OB 1EY4A 2DNEA 3KK7A 4DR6L 3EBEA 2G9DA 2O2LD 4HSVA 5JEAG 1A63A 5IYDH 3NXWA 2E75C 3QOJA 1JR0D 1WTXA 1SNDA 4OHJA 2EVBA 1L2FA 3RZOH 2JA7H 5FO9B 2L1BA 4KY6A 4DV7Q 1B70B 4KI0A 4JBWA 4XIGS 4BY1B 5KEEA 3UDXA 4U673 1B2TA 3M85A 1E1TA 3U9SA 3W2DA 3I4OA 2JYOA 5JJLA 2F0DA 1C4QA 3HOWB 3S17H 2JP1A 2HHHQ 2F0LA 2N49A 1B9NA 5J22A 1PRTD 3BDLA 1HTPA 2A6ED 4L6TB 1DXMA 1MJCA 3L2PA 1K0SA 3CRKC 3HOYH 5CV9A 2OEOA 4DR3L 2CW0D 5AJ3L 3KF6B 4KD4A 3F1ZA 3JAMi 3M4YA 3GQBA 4DF7A 4AYBE 3D0FA 4B9WA 2JXMB 2D5DA 2NN6H 1HHVA 3HP3A 4LF4Q 4DV2Q 3HOWG 2QCPX 4LFCQ 3ERQA 2K5HA 2VQEL 4A3MH 1KDAA 1HR0L 1TWGB 2VZAA 4KD3A 2KECA 2N8NA 4JI7Q 3GTOH 1HRJA 1PRTC 3Q22A 1TWFH 4DXFA 3URYA 1LTGD 1C9OA 3SHLA 2Q2UA 2A6EC 3DM1A 1K0RA 3LWUA 4HN7A 4KJOA 4RGTA 1FD7D 1FNVA 1AZPA 1V1PB 1ESRA 4EQOA 1CSQA 2CW0C 4N8X1 4A93H 1DONA 5I9OA 2F0SA 1PH7A 3NUCA 2YTYA 4NXML 4CKCA 2K4KA 4IUTA 1SYBA 4ZCKA 1NNXA 3KOJA 4O42A 1O78A 3QG1A 3PIP3 2KCNA 3KF8A 1QE6A 2MHVA 3A8IE 5BN4A 1YEZA 1HH2P 4HCSA 1BCPB 2A19A 4B3RL 2JA5B 3MFGA 3G71A 3CCQA 4HJ9A 2QKIC 2WB1E 4LFAL 2NZOA 3S1NB 4H02A 2VY3A 3O13A 4BXXH 2EY2A 4QUFA 1S5CD 1TS3A 4DNIA 2KEEA 3QIAA 2IHFA 2H1EA 2FMMA 4QMGA 3KLRA 4C1NK 2F3IA 1OXTA 4JBKA 2D2CC 3QOLA 3RR5A 2B2UA 2Z6KA 4XQQA 4Y7NH 3GTGH 2Z6BA 3GV3A 5EAYA 1XMOL 3NBHA 2VXWA 5I2XA 3VA7A 3S2DB 4LUOA 3CC2A 1EY8A 1AFPA 1N9WA 2R93H 3SK6A 1H9JA 3TP7A 2JA5G 4GKJL 3DM3A 4NKLA 4LF8L 2RCFA 5FK9C 2BDOA 4FO2A 1IW7D 1LYLA 1HNZQ 3VYTA 3HOXB 1WTQA 4A3IB 1Q3LA 5CBEE 1XPRA 2KOLA 1K9MC 1VDZA 3EQLC 3F8TA 4DR4L 1SDFA 1UEAB 2R6GA 4JOIC 5JJIA 1M1KC 1EWIA 2JEAI 2LXJA 3ND9A 1JORA 1Z6HA 3AYHB 5C5MA 3J7AV 3ULLA 4YY3Q 1S5DD 3Q0AA 4KY5A 4C56C 5C4ZA 2PMZB 2MQHA 1VQ6A 5IOCA 3HOXG 3CCEA 3EIVA 4JI5Q 2NVXH 4A3IG 3I70A 5IGDA 2WKDA 4B3ML 3OWFA 5CV7A 1PDQA 3HGBA 5EBCA 1K83H 4LMQD 1IW7C 2AUKA 4MZ9A 3V2TA 2NVTH 1CTMA 4RWSC 4XDXA 4CHTB 1CHQD 4XTCS 3K7AB 2PNRC 4JI0L 1XNRQ 1SJHD 1EYGA 2B63H 3BVZA 4DN4M 1VQMA 1W6KA 3DMUA 2F4VL 2O5JC 2UUBQ 2HQEA 1M90C 3VR6A 3HOZH 5EGTA 2JA8H 3PF5A 1SMYC 4A3FB 4LWCA 4NXNQ 2UU9Q 4OO1H 5ELBA 4HAEA 3N6RA 3L7ZC 5JJZA 3TREA 3EROA 3X3NA 4POFA 5J3BA 1NMFA 5GAHC 1IBMQ 2MUYA 1XTDA 4JPBW 2UUCL 3KLSA 1ZYRD 3K7UC 5HURA 1VQ5A 1FGBD 3N52A 3BYTB 4X64L 3CCVA 1BKBA 3NTKA 4G7OC 1SE2A 3K0YA 1WVLA 4IPCA 4K14A 5FLMH 2GVAA 1GVPA 2F3WA 3RZOB 4A3FG 4K0KQ 4IN3A 1XMQL 2UXCL 1SE8A 4GKKQ 1N34L 1SROA 1K3RA 1ET6A 1SN8A 1RODA 3F2BA 3KJOA 1YI2A 1S5FD 3CPWA 3JAMc 3MC0B 3RN2A 5KGUA 3SE0A 4PZ7A 1TKWB 5IYDG 5GQOA 1YITA 1C0AA 1NAPA 3T16A 3U58A 2ZXOA 1F9RA 1IBKL 5ELFA 1ZYRC 3P75A 5D3IB 2JA7G 2PZUA 3S1MH 2EIFA 2E8GA 3HOYB 4UY8C 2I07B 3RMHA 1A0IA 4ME3A 5IGCA 4GOPB 1QJOA 3I4NH 4Q5VA 1PYWD 1RL2A 4FYDA 1LUZA 1NMGA 5NUCA 3NBIA 4YWLA 2J7ZA 1ILQA 3EFXD 3J80i 4V0BA 1SYFA 4JI2Q 4EGVA 2FINB 3STBD 4A3MB 4DV6Q 1D6EC 1D1KA 1NUCA 4R4QA 5E4XA 2KUMA 1B3AA 3EJIA 4NDXA 4PZ8A 5IP9H 4DR7L 2LMCB 3GTOB 3CCSA 1EWHA 4X3SA 2F03A 3HOYG 1TWFB 5C4XH 3PIO3 3BJUA 1EYDA 2Z4IA 1K3BC 1AE3A 2EYLA 4WJ4A 4JV5L 4RKBA 1VQHA 1E2ZA 1SNMA 3RD4A 5FO7B 3K8AA 3AQQA 3M4OH 4A93B 1W3SA 4KHPL 3CU7A 1N8RC 1EWCA 2B8FA 3DEOA 4A3MG 4A3GH 2CKZB 4OIJA 3T1HQ 4DAYB 3OWEB 2NUCA 3C2PA 3J80E 4K8IA 1CA6A 4DR6Q 1EY7A 4DA2A 1JJGA 1RDPD 3H15A 2LXKA 4GNXB 2VQFL 4DV0L 1FVIA 4KK7A 4HMIA 3HFZB 1EIFA 5EKIA 2Y0SE 4HIMA 1LTBD 3D4DA 3SVMA 1VQBA 2CH4W 4G57A 2WB1B 1TXYA 1LM0A 4A93G 1LT3D 2RVLA 5KNBA 1BBXC 4H44C 1CHPD 5IWAL 4X62L 4ODGA 4P72A 1R9TH 4DR2L 3FDTA 2F0EA 1EQTA 3OMCA 4YCWA 3W5OA 1TWCH 2DUDA 4B08A 1QVGA 4DK6C 2R93B 1KC8C 2PQEA 3L9AX 3KFUA 4FF3A 3KF6A 5EQ0A 3KLSX 1JE4A 2WB1G 4HJ5A 4BXXG 1DZ1A 1WJJA 3K57A 4DR3Q 2N3SA 2YV5A 4JI6L 1Z47A 5AJ3Q 2FXQA 1PFMA 1SLJA 2V4DA 1YHQA 4PQXA 4UDUC 1VQNA 2IPKD 2RKSA 4ULLA 4X3KA 3MA2B 1OTCA 2HCIA 3TP5A 5IT9L 2E2DC 4I65A 1HQRD 2XVSA 3NEMA 4R9WA 2R93G 1UEBA 2VQEQ 1BBUA 2K33A 1HR0Q 2CQOA 2NBFA 4PG3A 1B9MA 5EBDA 1QB5D 3PGZA 1W2BA 3ULJA 1UWVA 1V9PA 1HNWL 1IL2A 1PH8A 2RF4A 1MSGA 2NVXB 3ND8A 3L3OC 4QJFA 4X3TA 4CJ2C 2MO0A 2XIWA 1K83B 5C4JH 1YNXA 2K52A 3BDOA 1GHJA 1VS0A 2F0WA 4IFDJ 2K32A 4GZYC 2NVTB 4O0AA 2Q8IB 1WD0A 4F8MA 4ZLTF 2LY7A 2RA4A 4NXMQ 3W1BA 3CPFA 2FFKB 1X9NA 1SRUA 1H9SB 3K0XA 2B63B 4HSPA 2R92H 2M2LA 3E9HA 5ISRA 1JJCB 1S4ZA 2WIIB 3MVVA 4U68A 3CMEA 2ES2A 2MO1A 4OO1I 1X32A 3ULPA 3TQYA 1D7QA 3HOZB 4AH6A 3UI2A 2ZJQA 4B3RQ 1LTAD 1X3FA 4IPDA 2QEXA 4LFAQ 1XTCD 1QNKA 3A55A 5M5YH 1NSNS 1F9SA 2K75A 4H7BA 3V96A 1J5EL 4C3HH 1L1OA 1JWSD 2B63G 3LNNA 2KQ3A 1XMOQ 5FLXL 2XRSD 1XYIA 1YJNA 2TSSA 4O2DA 3HOZG 1HZAA 3M4PA 3M7NA 5C3WA 3J81L 2F3VA 2I46A 4ZKBB 2P5ZX 4JI3L 5A2QE 1PTOB 3PO2H 4GKJQ 2LS01 4LF8Q 4OO1G 1U4PA 3HOVH 2XTIA 4LFBL 2PQAB 2RDFA 1UE7A 2I5MX 1WD1A 2B2UC 2Z6KC 5EKKA 3A7LA 3WOFA 1E2WA 4DR4Q 1EQVA 1CFMA 4HMJA 1RF2D 2RDGA 2G9HD 1E2VA 1EZ6A 1GUNA 2F0HA 2SNMA 3J80c 1S40A 2CH4A 3E6ZX 2G5DA 1IZ6A 1K8OA 5FLMG 5DAUA 5M9OA 1F9QA 1E7ZA 1VQIA 3PV0A 5J39A 1PH4A 3S1MB 1P16A 3CCLA 1NE3A 3GTLH 4K6DA 4RKLA 2R7ZH 4YCVA 1G8ZD 1G51A 1SBBB 3I4NB 3Q6SA 4FXGC 5I6WA 5K5PA 4B3MQ 4FF4A 1NR2A 2SNSA 1QUQA 1PRTB 5IYCH 4HJ7A 4JBMA 4Z9CB 1BOSA 1ZXTA 1ENAA 3I7FA 3F2UA 1YNNC 1I4HA 4ALPA 1KNEA 4JI0Q 5JVH3 3DHQA 1XPUA 2K5DA 1VQ9A 1D8LA 4CDFC 3OIQA 2XSCA 3D3RA 2F4VQ 5CV5A 5IGBA 3R93A 1SXTA 4BY7H 3I4NG 1SNCA 3DEPA 3UDGA 4OX9L 4DR5Q 4DNRB 1EL0A 2A74C 2JN4A 1WYDA 1DYQA 1SNQA 3BZDB 2VW9A 3HG9A 3C1EA 4A3GB 2HQLA 3T53B 4KV6A 2EPBA 1BCPF 3MEFA 1Q81C 4FNFA 1QG7A 1BBWA 1FGUA 3IKJA 3OSOA 4JVZA 5IP9G 3RZDB 2UUCQ 3NENA 3RLOA 4OWWB 4X64Q 1G6PA 2EQSA 1F77A 1D5XC 2OQ0A 4DV1Q 1PLFA 3ITPA 4IPGA 2Q2IA 4CDEC 1B50A 1PMRA 1KXLA 4OWXB 5GAEC 2Y0SB 1XMQQ 1Q7YC 1X54A 2UXCQ 5C0XJ 2IWHA 1N34Q 1SYDA 4UP8A 1TR5A 4A3GG 2E74C 2I5LX 4XXEA 3AU7A 1PXUA 4XQJA 3GP7A 4A75A 2I5HA 3I8ZA 5JPNC 1TQOA 1LTLA 3HRZC 4DUYL 3TSSA 4KKUA 4I7ZC 1Q1EA 4X3UA 3GTKH 2Z8LA 2B2YA 1IBKQ 2JK8A 5GAGC 1DOLA 4A76A 3FKIH 5CR3A 5DM63 1F2YA 1QCBD 2Y0SG 4BBRH 2K7VA 1TS4A 2ZM6L 5F2DA 4KN4C 1I4XA 1KABA 2IL8A 4J15A 2ALYB 2QF7A 4OWTB 1GKHA 2X6LA 2CHBD 3VDYA 3RN5A 4GN4B 3J7A5 1Q8IA 3M3YH 3I73A 1F2LA 1X6OA 4JYAL 1QZGA 4RH6A 1LACA 2PCFB 2YU9B 2ZJRA 2E2JH 1RKNA 3E9IA 2Q8RE 3HKZE 5CYUA 4Q0FA 3CCUA 4DR7Q 1HTLD 1HZBA 4K5WA 2SOBA 5E3FA 2ZTDA 3NELA 1PH2A 1EFWA 1Q12A 1V43A 1VQDA 4RCNA 4DFAA 1SFOB 4JV5Q 4KHVA 3JAME 3FPUB 1K8MA 5JAVA 5C4JB 3K5MA 2HD3A 3BYYB 2F0VA 1HJPA 4CBVA 2OTLA 4KHPQ 4YWMA 4QIWB 5C0XH 5FO8B 1BXTA 3HZXA 5JJKA 4QCLA 2EYMA 3CXCA 5K36H 1F9PA 1NY4A 2BCOA 4H13C 2R92B 3H3VC 1OXSC 2VQFQ 4DV0Q 3A5ZB 4GLAC 2WAQB 1JICA 1Y1VH 3P1HA 3MXNA 2YYZA 2ZXRA 1AE2A 2CQAA 2RSOA 2HUGA 2PYKA 3GO5A 1F2MA 4GN3B 4LAAA 4ZAIA 5M5YB 4DR1L 2A69D 4A3BH 1LTID 1BNZA 3BVMA 1AZQA 1YIJA 1GUSA 2NB0A 4WFN3 2NZHA 5IWAQ 2EOTA 4TKOB 1JCKB 1LV9A 1PFBA 4X62Q 2R92G 1HQMC 1LABA 2F0KA 4QUCA 2Q2TA 1S5ED 3KDFB 1QILA 4DR2Q 4A3EH 3JC66 3KJPA 1EEFD 2WAQG 4LNQA 3SK4A 1YBYA 5TSSA 4K6LA 1U9RA 4G4KA 4X65L 2K05A 4UAIA 1EIYB 3PO2B 1JQYD 2BH2A 1XX8A 1WTHA 3HOVB 1I5FA 4LUZA 1TY2A 5I9PA 1DM0B 3J81j 2RHQB 3I90A 2JSOA 2QILA 4JI6Q 2B29A 4C3HG 1A3VA 3KUPA 2O4XA 3RNUA 2A69C 3RLFA 2EY1A 3SR1A 4IFDI 1ML0D 1I6VC 3BDCA 2M9VA 3G6EA 1SE4A 3AMUA 2KCTA 2K5VA 4HTHA 1CQVA 1XJVA 3PO2G 1II3A 4FDBA 1EU3A 3HOVG 1D1IA 1HNWQ 3UE1A 2R7ZB 3J81i 4FVMA 2OQKA 3KLWA 3MXUA 3U4VA 3CD6A 3PUZA 2XNAC 3FRPB 1CKOA 2MP1A 3D31A 4R4IA 5IYBH 2JA9A 1I4QA 1BCPD 4IFDG 3WWVA 5KYIA 1IYVA 3SXHA 3MFYA 3NTHA 1EOTA 1WTWA 3QB3A 1XNQQ 3FP9A 4DR5L 4S3SA 3KBXA 4HJAA 3WDNA 2R7ZG 5G3LF 3UE0A 2EXZA 3GTJH 4BY7B 4HR7B 2O5IC 4MHEA 5LMNL 5IYCG 1X3QA 2F0IA 2KHIA 3J81E 1PH9A 3K81C 2WP8J 3IFTA 2KBNA 3VR4A 4OELB 1ASZA 1GJXA 4NP5A 3HEJA 1CM9A 4IQZA 2E2IH 4LW1A 2A1AA 4DV1L 2VB3X 1KD1C 1J5EQ 4YCUA 3QJYA 2MNAA 1I50H 1J6QA 4G7HC 2EJMA 4CDCC 2EZVA 2JA7B 3F2CA 3M7GA 4BY7G 4LJZC 1X3EA 2L15A 3S15H 1BUVT 3A8KE 3SK5A 4EQPA 2C5CA 1BO0A 2RBMA 2A8VA 3E3XA 4JI3Q 1QZHA 2JA6H 2BH8A 4LFBQ 1RTNA 5C5LA 4EQ5A 3EVQA 4HEDA 3NHHA 2AHOB 3H6MA 4BS9A 3BS1A 1SNOA 3S17B 4I7AA 1CKMA 3TS2A 1L1OC 1DJRD 2R7DA 3A54A 1CKNB 4JC0A 4ABNA 1I3QH 4NB3A 3R8BA 4IOAA 4P2CB 4M8AA 4A3JH 2JEBI 1A3UA 2F0GA 3GTKB 1CQFA 2NN6I 4TQUS 5I6YA 1KAWA 3FKIB 1AN8A 1ASYA 5C3EH 1K73C 4BBRB 5JVG3 3GDEA 5IGEA 1O7ZA 2JJQA 4C2MH 1OO9B 5HGQA 1EUJA 4AYBB 2N55A 3PF4A 5LL6X 3D4WA 2GN5A 1X3GA 3SGIA 1L0XB 1HNXL 3S24A 4IPHA 1FNWA 4ZUIA 2J4XA 2YTXA 5M3MH 3M3YB 1TU2B 1ZKOA 2E2JB 3MWYW 3I55A 3FKIG 1GUGA 5CORA 2NVYH 4BBRG 3K80C 2Z0SA 3MHBA 1XXGA 1STGA 1B8AA 2NN6G 4R8IA 2CWAA 4AYBG 2J0TD 3S1RH 1STYA 3VA5A 1PVOA 4R4CA 1OXVA 1MD2D 1PHJA 1MHWC 3H3VH 1I4RA 4OX9Q 3PMFA 5C0XI 1Q1BA 2L12A 2MFIA 2H4OA 3DWPA 4QF4A 5M5XH 3FMCA 4ID6A 3EA6A 3MXGA 1EOVA 3STBC 2ICEC 1QVCA 5ELDA 2OCEA 1KRSA 1YNJD 3ICEA 2WV6D 1Q8KA 4PMCA 4C3IH 4A3LH 2IJ0A 2DGYA 1A15A 1Y14B 3Q24A 1QVFA 1YHAA 5M3FH 2ZJPA 2NYZD 2KJXA 1EY9A 2BA0A 2F0QA 1KRTA 4PMWA 1CI3M 5IIFA 2RDHA 2E2HH 3KF8B 1JJ2A 1UE6A 2K50A 4Y7NB 3PSIA
chains in the Genus database with same CATH topology
2HDMA 3GTGB 5E1FA 2F0FA 1AW7A 3PUWA 1TVXA 1CA5A 5C0XG 5D3DA 3K5NA 5K36G 1A3TA 1JOOA 4J6HA 4EVOA 1PTOF 1F2ZA 4A3EB 1FNUA 1LLRD 3VYSA 1SNPA 4FP5D 2K28A 3D6CA 1BF4A 1R4PB 5KYLA 3CRLC 1LTRD 4XYQA 2M00A 3WOEA 1JOKA 1ESFA 4XYOA 1M4VA 4CKBA 2ENBA 1VF7A 3FEWX 3I3CA 2B2WA 5EPJA 3OIPA 2F4IA 2JE6I 5E4WC 2B2YC 1STBA 1V1PA 1D5ZC 5G3LD 3BVGA 1DOKA 1TS2A 1C48A 2ZT9C 2K6AA 4LK1C 4IALA 4ZQ3A 1KDCA 3H09A 3TBIB 3DXJC 3IL8A 3RUZA 1RD9D 1DD2A 1IYUA 4FXDA 4PNYA 2BDNA 2JA8B 3VYRA 5IGGA 3R3OA 3GTJB 3H91A 1VMCA 1ZEQX 1LTTD 2K04A 4KJNA 2DY7A 3P20A 5D65A 2BE5D 2WACA 3TP8A 1PZID 4EQNA 3VR5A 1I50B 3PUYA 2KCCA 2ICIA 2XN9C 1D2BA 3I72A 1EIHA 3VR3A 2B2TA 2PZWA 1SEBD 1RCVD 4IUPA 3S15B 3NSWA 4JK1C 2JA6B 1SAPA 3TP6A 1GUWA 3J7AF 1RTOA 2EYFA 1GXDC 2A68D 3X3MA 4RFBA 4IUQA 4OGQC 1I3QB 2NTSA 4OL7A 2X69A 4IZ8A 3V05A 2DN8A 1B53A 4B9XA 1KAAA 4RHRA 5KIXA 3GD7A 3QO2A 4C2MB 1U4RA 5I2YA 4RCOA 2AWNA 2Z1CA 3IFDA 5JOBA 1ONLA 4BWGB 1EU4A 5M3MB 3C1FA 3K5LA 5C4XB 2A68C 5CV8A 3TZDA 2NVYB 3G7LA 3ZYYX 1SSOA 3M4OB 1I4GA 1QWYA 1KDBA 1LT5D 4WORA 1PFNA 1OXUA 1CZWA 2QDBA 1GOZA 1T5EA 4KHZA 4C3IB 1PTOD 2PZTA 3SDZA 2EY5A 2EYPA 5M3FB 1IHZA 1DCZA 4DNTB 1LT6D 1MBYA 2E2HB 2VB2X 3T51B 1AP0A 4OIKA 4KKSA 4MN3A 2AQ1B 4XT3B 3S2HB 1R9TB 1STNA 2XRQD 4IUUA 3PUXA 3T13A 4DGZA 1TWCB 3NQIA 1B44D 4C3IG 1B4OA 1WTOA 4NW2A 3J80L 4L63B 2Z4HA 1PTOC 2TMPA 3K5OA 1ICWA 2MJ8A 4N9PA 2XWBB 4CJ1B 3T56B 3DWAA 2SEBD 2QEJC 4DK1A 3G6JB 2A73B 4CKEA 1WTPA 1SE3A 2VUMB 2C9OA 3S9WA 1QNUA 3NTIA 1HXYD 3QWNA 3J7YW 1M8AA 3NWTA 4E6IA 3LX0A 2L9HA 3C3LA 1KTKA 4DAYA 1Y8PB 2K5QA 1JWMD 1JWUD 1EEID 3NE5B 1CZGA 1Z7TA 3E5SA 1HA6A 2WKCA 3A7AB 1A2TA 1JB3A 1VF5C 3IAYA 1UUPA 2L4NA 1ILPA 1RHPA 1STAA 1D5MC 1STEA 3TDQA 5JPMC 4WRDA 3KBGA 4C3HB 2A6HD 2K03A 3A8JE 5T1IA 3I4MB 2KVMA 3OW7A 1LT4D 5IT9E 2DY8A 3PO3B 1CT1D 1S5BD 2L0CA 2D62A 4TRDA 4C3JB 1LTSD 1EY0A 4K2KA 3TZUA 2IX0A 5C6AA 1GHKA 4V190 1WCMB 1HCZA 4RHSA 2LFNA 2A6HC 2HCCA 1HPCA 5C4HA 2ID0A 4PMBA 4FF2A 4K2LA 3GTLB 4C3JG 2ZXPA 1TY0A 1HA5A 2B2VA 3R2TA 1E0BA 5A2QL 4QB4A 4FF1A 4J8QA 2F0UA 2CVRA 5DEHA 1SMYD 1GUOA 2DNCA 3MZ5A 3LWEA 4BA2I 1H9SA 2B2WC 5CV6A 2WINB 2BOSA 2AQ3B 5FOBB 4M1UB 1PZKD 1L0YB 5EPLA 1A2UA 1TS5A 5FLXE 1V1OA 4L8JA 5CBAE 1ET9A 3PUVA 3MTSA 1H9RA 5D14A 5HGTA 2RSNA 1BR9A 4ZUJA 4K8JA 2VNUD 2F0TA 1IL8A 2L55A 2PPBC 3S14B 4BA1I 2IW3A 3P7JA 5JEAJ 1BCPC 1HFGA 3NQTA 2EJGC 2F0MA 3GTMB 1W6JA 2K01A 3DWQA 2KHSA 3D4RA 4YIJA 5A35A 1AEXA 3GTPB 4BBSB 3OMGA 2PW7A 4RGNA 2X6GA 1PTOH 2F0JA 4ZKCB 1KLGD 5AFWA 5BN5A 1T5XD 2AUJD 1JOQA 3FVQA 3AB9A 5LHY1 2PW5A 1EYCA 2EDGA 1STHA 1MSHA 2B2TC 3W3AA 1NCVA 5EPKA 1Y1WB 3BG3A 2NZ1D 1MI2A 1V8QA 4MIUA 2PO4A 2D9UA 1SJED 3H0GB 5EKLA 3NP8A 2FMCA 3I4LA 1ENCA 1EY6A 5J1ZA 3K58A 4RGOS 4F87A 2NWGA 2OT2A 1KNAA 4ILWA 2F0PA 3HKZB 5JEAH 3CKIB 5C44B 5ELCA 2BA1A 5KNDA 5IGFA 4N9TA 5M5WB 5IODA 1C8CA 2OXPA 5FKAC 1NR4A 1DOMA 2SDFA 2EJFC 1B1ZA 1G91A 1FR3A 1MGSA 4PV1C 1Y1VB 2B8GA 2NTTA 2RQXA 1IKMA 5LL6S 5BN3A 5CMDA 2OF1A 2Q8TA 4G7ZC 4A3BB 2KEDA 1X3PA 3JAML 2EYHA 1O7YA 4RA8A 1EY5A 1XWEA 1YNJC 1I4PA 4RAUC 3E0JA 4DAVA 2L11A 1OXXK 4FXKC 4KMUC 1U4MA 3CQZB 3SK8A 1EIGA 2A5HA 4IURA 2IX1A 1JC7A 1TWAB 2MGSA 1HUMA 2AWOA 5ELEA 3SEBA 3C46A 5KRUA 1RJTA 1PRTF 1HUNA 4ZK9B 5T1GA 4ZYSA 1G2TA 1G291 1FYCA 2EY6A 4KKTA 1WTRA 3S1QB 4WJWA 4CGYB 3CHBD 1VCIA 1U4LA 1SYEA 3I91A 3D8GA 3NWSA 1Q90A 3VYUA 3S16B 4F7XA 2KA7A 3HOUB 3OPOA 2LKVA 5COYA 4F88A 2AQ2B 2K1BA 3HS0C 4R8NA 3A56A 2FJ2A 5CC4A 4NMZA 1J8IA 4TSSA 3Q23A 4O1NA 3MAQA 1ENFA 2B39A 5C3XA 1UNSA 1Y8NB 2R3ZA 5I4DA 3NK9A 1I6HB 3FPPA 4KN7C 4DAPA 2HDLA 4A3KB 2E2IB 1HFNA 1BQQT 3VR2A 2XWJB 5DNFA 2F0NA 1KLUD 4A3DB 3T4AC 1O7LA 3K59A 3H94A 3NPPA 1H9KA 1Y69U 4J1MA 1G2SA 3MXPA 2EYOA 1SYGA 3TMEA 1TIID 5CGKA 3OOCA 3K6OA 1J9OA 4XQNA 4IUVA 4KY7A 2BE5C 3GV6A 4ZRZA 1UAPA 2MPMA 1EFID 4C1NI 3TN2A 1EYAA 1A6XA 4A3JB 3ONAB 3D6WA 5CV4A 4IUNA 1VMPA 4KTAA 1YNND 4RGMA 5EJWA 5C3EB 2NVQB 2F1MA 1BDOA 1O80A 3DUZA 4K5XA 4IFDH 1H9MA 2FHTA 3MEHA 1CK1A 4DK0A 2EE1A 1LO5D 2IX3A 1SYCA 3GTQB 2K5WA 4XT1B 1G6ZA 3OHXC 4HCEA 1WTVA 1TT2A 2GA4B 2IT1A 2EYJA 2B2VC 2N88A 3S1RB 1R4QB 1IKLA 1PZJD 4K5VA 4DU9A 2L5TA 4ME5A 1QOHA 2F0OA 4H0LC 5M5XB 4DXGA 3R2IA 3U9OA 2E76C 5DM73 4CJ0B 1TWHB 2R61A 5KNCA 1GUTA 1EZ8A 1Y8OB 1EY4A 2DNEA 3KK7A 2G9DA 2O2LD 4HSVA 5JEAG 3NXWA 2E75C 3QOJA 1JR0D 1WTXA 1SNDA 4OHJA 2EVBA 5FO9B 2L1BA 4KY6A 4KI0A 4JBWA 4XIGS 4BY1B 5KEEA 4U673 1B2TA 3M85A 3U9SA 3W2DA 2JYOA 2F0DA 1C4QA 3HOWB 2JP1A 2F0LA 1B9NA 5J22A 1PRTD 3BDLA 1HTPA 2A6ED 4L6TB 1DXMA 3CRKC 5CV9A 2OEOA 2CW0D 4KD4A 3M4YA 3GQBA 4DF7A 4B9WA 2JXMB 2D5DA 2NN6H 1HHVA 3HP3A 2QCPX 3ERQA 1KDAA 1TWGB 4KD3A 2KECA 1HRJA 1PRTC 3Q22A 4DXFA 3URYA 1LTGD 3SHLA 2A6EC 3DM1A 3LWUA 4HN7A 4KJOA 4RGTA 1FD7D 1FNVA 1AZPA 1V1PB 1ESRA 4EQOA 2CW0C 1DONA 5I9OA 2F0SA 3NUCA 4CKCA 4IUTA 1SYBA 4O42A 1O78A 3QG1A 3PIP3 2KCNA 3KF8A 1QE6A 2MHVA 3A8IE 5BN4A 4HCSA 1BCPB 2JA5B 3MFGA 2QKIC 3S1NB 3O13A 2EY2A 4QUFA 1S5CD 1TS3A 2KEEA 3QIAA 2H1EA 2FMMA 4QMGA 3KLRA 4C1NK 1OXTA 2D2CC 3QOLA 2B2UA 4XQQA 3GV3A 3NBHA 2VXWA 5I2XA 3VA7A 3S2DB 1EY8A 1AFPA 3SK6A 3TP7A 1H9JA 4NKLA 5FK9C 2BDOA 4FO2A 1IW7D 3HOXB 3VYTA 1WTQA 4A3IB 1Q3LA 5CBEE 2KOLA 1VDZA 3EQLC 1SDFA 1UEAB 2R6GA 2JEAI 3ND9A 1JORA 1Z6HA 5C5MA 3J7AV 1S5DD 3Q0AA 4KY5A 4C56C 5C4ZA 2PMZB 5IOCA 3I70A 5IGDA 2WKDA 3OWFA 5CV7A 1PDQA 3HGBA 5EBCA 4LMQD 1IW7C 2AUKA 3V2TA 1CTMA 4RWSC 4XDXA 4CHTB 1CHQD 4XTCS 3K7AB 2PNRC 1SJHD 3BVZA 4DN4M 1W6KA 3DMUA 2O5JC 2HQEA 3VR6A 5EGTA 4A3FB 1SMYC 4OO1H 5ELBA 4HAEA 3N6RA 3L7ZC 5JJZA 3EROA 3X3NA 2MUYA 3KLSA 1ZYRD 5HURA 1FGBD 3N52A 3BYTB 3NTKA 4G7OC 1SE2A 3K0YA 1WVLA 4K14A 2F3WA 3RZOB 4IN3A 1ET6A 1RODA 1S5FD 3MC0B 5KGUA 3SE0A 1TKWB 1NAPA 3T16A 2ZXOA 1F9RA 5ELFA 1ZYRC 3P75A 5D3IB 2PZUA 3HOYB 2I07B 3RMHA 5IGCA 1QJOA 4Q5VA 1PYWD 4FYDA 5NUCA 3NBIA 2J7ZA 1ILQA 3EFXD 4V0BA 1SYFA 4EGVA 2FINB 4A3MB 1D6EC 1D1KA 1NUCA 5E4XA 2KUMA 1B3AA 3EJIA 4NDXA 2LMCB 3GTOB 1EWHA 4X3SA 2F03A 1TWFB 3PIO3 1EYDA 2Z4IA 2EYLA 4RKBA 1E2ZA 1SNMA 3RD4A 5FO7B 4A93B 3CU7A 1EWCA 2B8FA 3DEOA 4OIJA 3OWEB 2NUCA 3C2PA 3J80E 4K8IA 1CA6A 1EY7A 4DA2A 1RDPD 4KK7A 4HMIA 5EKIA 1LTBD 3D4DA 3SVMA 4G57A 2WB1B 1LT3D 2RVLA 5KNBA 1BBXC 4H44C 1CHPD 4ODGA 3FDTA 2F0EA 1EQTA 3OMCA 4B08A 2R93B 2PQEA 3L9AX 4FF3A 5EQ0A 3KLSX 1JE4A 1DZ1A 3K57A 1Z47A 1PFMA 2V4DA 4PQXA 4UDUC 2IPKD 2RKSA 4ULLA 4X3KA 3MA2B 2HCIA 3TP5A 5IT9L 2E2DC 4I65A 1HQRD 2XVSA 4R9WA 2K33A 2NBFA 1B9MA 5EBDA 1QB5D 1MSGA 2NVXB 3ND8A 3L3OC 4X3TA 4CJ2C 2XIWA 1K83B 3BDOA 1GHJA 2F0WA 4IFDJ 2K32A 4GZYC 2NVTB 2Q8IB 1WD0A 4F8MA 4ZLTF 2LY7A 2RA4A 2FFKB 1H9SB 2B63B 4HSPA 2M2LA 5ISRA 1S4ZA 2WIIB 4U68A 3MVVA 4OO1I 1X32A 3HOZB 3UI2A 1LTAD 1XTCD 1QNKA 3A55A 1NSNS 1F9SA 4H7BA 3V96A 1JWSD 3LNNA 2KQ3A 5FLXL 2XRSD 1XYIA 2TSSA 3M7NA 5C3WA 3J81L 2F3VA 2I46A 4ZKBB 5A2QE 1PTOB 2LS01 4OO1G 1U4PA 2RDFA 1WD1A 2B2UC 5EKKA 3A7LA 3WOFA 1E2WA 1EQVA 1CFMA 4HMJA 1RF2D 2RDGA 2G9HD 1E2VA 1EZ6A 1GUNA 2F0HA 2SNMA 3E6ZX 1K8OA 5DAUA 5M9OA 1F9QA 3PV0A 5J39A 3S1MB 4K6DA 4RKLA 1G8ZD 1SBBB 3I4NB 3Q6SA 4FXGC 5I6WA 5K5PA 4FF4A 1NR2A 2SNSA 1PRTB 4Z9CB 1BOSA 1ZXTA 1ENAA 3F2UA 1YNNC 1I4HA 1KNEA 5JVH3 3DHQA 2K5DA 3OIQA 2XSCA 3D3RA 5CV5A 5IGBA 3R93A 1SXTA 1SNCA 3DEPA 4DNRB 1EL0A 2A74C 1DYQA 1SNQA 3BZDB 3HG9A 3C1EA 4A3GB 3T53B 4KV6A 2EPBA 1BCPF 4FNFA 1QG7A 3IKJA 3OSOA 3RZDB 1F77A 1D5XC 1PLFA 3ITPA 1B50A 1PMRA 2Y0SB 5C0XJ 2IWHA 1SYDA 1TR5A 2E74C 4XXEA 3AU7A 1PXUA 4XQJA 3GP7A 3I8ZA 5JPNC 1TQOA 3HRZC 3TSSA 4KKUA 4I7ZC 1Q1EA 4X3UA 2Z8LA 2B2YA 1DOLA 5CR3A 5DM63 1F2YA 1QCBD 2K7VA 1TS4A 5F2DA 4KN4C 1I4XA 1KABA 2IL8A 2QF7A 2X6LA 2CHBD 1Q8IA 3I73A 1F2LA 4RH6A 1LACA 2PCFB 2YU9B 1RKNA 2Q8RE 5CYUA 4Q0FA 1HTLD 4K5WA 2SOBA 5E3FA 1Q12A 1V43A 4RCNA 4DFAA 1SFOB 4KHVA 3JAME 3FPUB 1K8MA 5JAVA 5C4JB 3K5MA 3BYYB 2F0VA 4CBVA 4QIWB 5C0XH 5FO8B 1BXTA 3HZXA 4QCLA 2EYMA 5K36H 1F9PA 2BCOA 4H13C 2R92B 3H3VC 1OXSC 2WAQB 1JICA 3MXNA 3P1HA 2YYZA 2ZXRA 2CQAA 2RSOA 2HUGA 2PYKA 3GO5A 1F2MA 5M5YB 4LAAA 4ZAIA 2A69D 1LTID 1BNZA 3BVMA 1AZQA 1GUSA 2NB0A 4WFN3 2EOTA 4TKOB 1JCKB 1LV9A 1PFBA 1HQMC 1LABA 2F0KA 4QUCA 1S5ED 1QILA 1EEFD 3SK4A 5TSSA 4K6LA 1U9RA 4G4KA 2K05A 4UAIA 3PO2B 1JQYD 1XX8A 3HOVB 1TY2A 5I9PA 1DM0B 3I90A 2JSOA 2QILA 4C3HG 1A3VA 3KUPA 2O4XA 2A69C 3RLFA 2EY1A 3SR1A 4IFDI 1ML0D 1I6VC 3BDCA 2M9VA 3AMUA 1SE4A 4HTHA 1CQVA 1II3A 1EU3A 1D1IA 2R7ZB 4FVMA 3MXUA 3PUZA 2XNAC 3FRPB 2MP1A 3D31A 1I4QA 1BCPD 4IFDG 5KYIA 1IYVA 3SXHA 3MFYA 3NTHA 1EOTA 1WTWA 3QB3A 4S3SA 3KBXA 3WDNA 5G3LF 2EXZA 4BY7B 4HR7B 2O5IC 4MHEA 1X3QA 2F0IA 3J81E 3VR4A 2WP8J 3IFTA 1GJXA 4NP5A 3HEJA 1CM9A 4IQZA 2VB3X 3QJYA 4G7HC 2EJMA 2EZVA 2JA7B 3M7GA 4LJZC 1BUVT 3A8KE 3SK5A 4EQPA 2C5CA 1BO0A 2RBMA 1RTNA 5C5LA 3EVQA 4HEDA 3NHHA 4BS9A 3H6MA 3BS1A 1SNOA 3S17B 1DJRD 3A54A 4ABNA 3R8BA 4P2CB 4M8AA 2JEBI 1A3UA 2F0GA 3GTKB 1CQFA 2NN6I 4TQUS 5I6YA 3FKIB 1AN8A 4BBRB 5JVG3 5IGEA 1O7ZA 1OO9B 4AYBB 2N55A 5LL6X 3D4WA 1L0XB 1FNWA 4ZUIA 2J4XA 3M3YB 1TU2B 1ZKOA 2E2JB 3MWYW 1GUGA 5CORA 3MHBA 1XXGA 1STGA 2NN6G 4R8IA 2J0TD 1STYA 3VA5A 1OXVA 1MD2D 1I4RA 3PMFA 5C0XI 1Q1BA 2L12A 2H4OA 3DWPA 4QF4A 3FMCA 4ID6A 3EA6A 3MXGA 2ICEC 5ELDA 1YNJD 2WV6D 4PMCA 2IJ0A 1A15A 3Q24A 2NYZD 2KJXA 1EY9A 2BA0A 2F0QA 4PMWA 1CI3M 5IIFA 2RDHA 4Y7NB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BO0 A;  2HDM A;  1WTV A;  2RSN A;  2L4N A;  1C8C A;  1ILP A;  4X3K A;  1RHP A;  1TVX A;  2HCI A;  2K05 A;  4UAI A;  4X3U A;  1CA5 A;  1HRJ A;  2B2V C;  2B2Y A;  1RTN A;  2N88 A;  1NR4 A;  1XX8 A;  1DOL A;  1ILQ A;  2J7Z A;  4HED A;  5COY A;  1F9Q A;  1IKL A;  1DOM A;  1PDQ A;  2K1B A;  2SDF A;  4R9W A;  1EIH A;  1IL8 A;  2B2T A;  2FJ2 A;  2FIN B;  3DM1 A;  4LMQ D;  3I90 A;  1G91 A;  1J8I A;  1AZP A;  1MGS A;  3KUP A;  3P7J A;  5E4X A;  4RWS C;  2IL8 A;  2K28 A;  1ESR A;  1B3A A;  1HFG A;  2K03 A;  2KUM A;  4IUP A;  4OIK A;  4XDX A;  5T1I A;  2R3Z A;  1ML0 D;  2KVM A;  1IKM A;  4MN3 A;  1DON A;  5CMD A;  2X6L A;  3Q6S A;  4XT3 B;  1BF4 A;  2Q8T A;  1MSG A;  4X3S A;  4IUU A;  4CJ0 B;  1SAP A;  1NR2 A;  4IUT A;  2DY8 A;  1HFN A;  2HDL A;  4DN4 M;  1B4O A;  2KED A;  4NW2 A;  1WTO A;  2K01 A;  1GUW A;  1X3P A;  4X3T A;  4CJ2 C;  2XIW A;  4O42 A;  1F2L A;  5DNF A;  1O7Y A;  1RTO A;  1ZXT A;  1QE6 A;  4RA8 A;  1O7Z A;  2N55 A;  3F2U A;  4HCS A;  2Q8R E;  4HSV A;  1KNE A;  4IUQ A;  1WD0 A;  2X6G A;  3I3C A;  4ZLT F;  2RA4 A;  2B2W A;  2X69 A;  5EPJ A;  1ICW A;  2MJ8 A;  2FFK B;  3DEO A;  1WTX A;  4ZKC B;  4RAU C;  2MP1 A;  4HAE A;  4OIJ A;  1G2S A;  1B53 A;  5AFW A;  2M2L A;  5JJZ A;  5E4W C;  2L11 A;  3R93 A;  4QUF A;  1CA6 A;  2KEE A;  1S4Z A;  2B2Y C;  4U68 A;  3FPU B;  1U4M A;  2H1E A;  2FMM A;  4CJ1 B;  2L1B A;  3DEP A;  1X32 A;  3QO2 A;  3N52 A;  1MSH A;  3MWY W;  2B2T C;  1EL0 A;  1U4R A;  3UI2 A;  2B2U A;  5COR A;  1DOK A;  2HCC A;  1J9O A;  1B2T A;  1EIG A;  3GV3 A;  1WVL A;  1NCV A;  1QNK A;  3IFD A;  4IUV A;  5EKI A;  5EPK A;  2VXW A;  3GV6 A;  1EOT A;  1WTW A;  4IUR A;  4R8I A;  3SVM A;  1F9P A;  1F9S A;  2B2V A;  2NZ1 D;  1MI2 A;  2JYO A;  2MPM A;  1WTP A;  3KBX A;  2EPB A;  2JP1 A;  2D9U A;  1E0B A;  1QG7 A;  2RVL A;  2MGS A;  1HUM A;  3TN2 A;  1BBX C;  3ONA B;  2L12 A;  3D6W A;  2CVR A;  4MHE A;  1VMP A;  1M8A A;  1JIC A;  1ROD A;  5EJW A;  2L9H A;  1PLF A;  1X3Q A;  3TZD A;  3IL8 A;  1O80 A;  1WTQ A;  1RJT A;  1XYI A;  3FDT A;  2RSO A;  2HUG A;  1B50 A;  3G7L A;  1Q3L A;  1CM9 A;  1EQT A;  3LWE A;  2NWG A;  1SSO A;  2KOL A;  4ZAI A;  5CBE E;  1HUN A;  4ZK9 B;  2BDN A;  2FHT A;  2B2W C;  1BNZ A;  5T1G A;  1KNA A;  1SDF A;  1A15 A;  1AZQ A;  4ZKB B;  1G2T A;  1NAP A;  3H91 A;  1VMC A;  2EE1 A;  1U4P A;  2NYZ D;  1HHV A;  3HP3 A;  1F9R A;  1PFN A;  2EOT A;  1WTR A;  1LV9 A;  1PFB A;  2K04 A;  1AP0 A;  5EPL A;  5EQ0 A;  2DY7 A;  1JE4 A;  1DZ1 A;  4QUC A;  5D65 A;  1HA6 A;  4XT1 B;  1WD1 A;  3I8Z A;  5CBA E;  2B2U C;  1PFM A;  1U4L A;  2KEC A;  3I91 A;  3MTS A;  1G6Z A;  5D14 A; 
#chains in the Genus database with same CATH topology
 2HDM A;  3GTG B;  5E1F A;  2R7F A;  2F0F A;  1AW7 A;  3S2H H;  4LF5 Q;  3PUW A;  1TVX A;  1CA5 A;  5C0X G;  4DV5 L;  2WFW A;  5D3D A;  5LMN W;  3K5N A;  1XPO A;  4BY1 H;  5K36 G;  1A3T A;  1JOO A;  4J6H A;  4EVO A;  1YVC A;  1U5K A;  1PTO F;  2PI2 A;  1FL0 A;  1F2Z A;  4A3E B;  3I56 A;  1FNU A;  1LLR D;  4DUY Q;  3VYS A;  1SNP A;  4FP5 D;  2K28 A;  3HOW H;  1PH3 A;  3D6C A;  4JBJ A;  4AIM A;  1BF4 A;  1N33 L;  3NBH B;  5FLX c;  1R4P B;  5KYL A;  2PI2 E;  4A3B G;  3CRL C;  1LTR D;  4XYQ A;  2M00 A;  2E5L L;  2ZM6 Q;  1KIX A;  5L37 A;  3WOE A;  1JOK A;  3J81 c;  3CC7 A;  1ESF A;  4XYO A;  1M4V A;  1Q86 C;  1GD7 A;  4CKB A;  2ENB A;  1VF7 A;  3FEW X;  3I3C A;  2B2W A;  5EPJ A;  4A3E G;  4P74 A;  3OIP A;  2F4I A;  2JE6 I;  5E4W C;  4JYA Q;  2VUM H;  3AEV A;  2B2Y C;  3PIP A;  1STB A;  1V1P A;  1N32 Q;  1D5Z C;  5G3L D;  3BVG A;  1DOK A;  1WOC A;  3QR8 A;  1VQK A;  1TS2 A;  1C48 A;  2CCZ A;  2VL6 A;  2ZT9 C;  3TEH B;  1O7I A;  2K6A A;  4LK1 C;  4IAL A;  4ZQ3 A;  1KDC A;  2AKW B;  3H09 A;  3TBI B;  4P73 A;  1XNQ L;  1EQR A;  4DV3 L;  2RCN A;  3DXJ C;  3IL8 A;  1NJI C;  3RUZ A;  1RD9 D;  2CFM A;  1DD2 A;  1IYU A;  4FXD A;  4PNY A;  2BDN A;  2JA8 B;  3VYR A;  1RIP A;  3ER0 A;  5IGG A;  3R3O A;  3GTJ B;  3H91 A;  1VMC A;  1ZEQ X;  1LTT D;  2K04 A;  4KJN A;  2DY7 A;  3P20 A;  4JCV E;  5D65 A;  1JE5 A;  2BE5 D;  4DR1 Q;  2WAC A;  3TP8 A;  5IYB G;  1PZI D;  2PNH A;  4EQN A;  3VR5 A;  3I4M H;  1I50 B;  1WFQ A;  3PUY A;  4DK3 C;  4LF6 L;  2KCC A;  2ICI A;  3PO3 H;  3BZC A;  2XN9 C;  1D2B A;  2JA8 G;  1WI5 A;  3I72 A;  1EIH A;  3VR3 A;  2B2T A;  2PZW A;  1PFS A;  1SEB D;  3ZJY C;  4C3J H;  1U0L A;  1JT8 A;  1RCV D;  4IUP A;  4UHV A;  4IOC A;  3NSW A;  4X65 Q;  3S15 B;  4JK1 C;  2JA6 B;  1SAP A;  3TP6 A;  1GUW A;  3J7A F;  1WCM H;  1B7Y B;  1RTO A;  2LSS A;  2DJG C;  4A3I H;  2EYF A;  1GXD C;  1VQJ A;  2A68 D;  3X3M A;  4RFB A;  4IUQ A;  4OGQ C;  1I3Q B;  2NTS A;  4OL7 A;  4YWK A;  2X69 A;  1S72 A;  5DLQ E;  4IZ8 A;  3V05 A;  1IBL L;  2DN8 A;  1B53 A;  4B9X A;  1KAA A;  4RHR A;  2IY5 B;  2JQO A;  4RG1 A;  2JA6 G;  5KIX A;  3GD7 A;  2PMZ E;  3QO2 A;  4C2M B;  1U4R A;  5I2Y A;  4RCO A;  2AWN A;  2Z1C A;  3IFD A;  1MKH A;  5JOB A;  1ONL A;  4BWG B;  1EU4 A;  5M3M B;  3C1F A;  4R1J A;  3K5L A;  5C4X B;  2A68 C;  1VQE A;  5CV8 A;  3TZD A;  2NVY B;  4GLV B;  3G7L A;  3ZYY X;  1SSO A;  1VQA A;  1NTG A;  3M4O B;  2Q2H A;  1I4G A;  1QWY A;  1KHI A;  1KDB A;  4DV4 L;  1LT5 D;  1MIU A;  4WOR A;  1PFN A;  5LMN Q;  1OXU A;  1CZW A;  2QDB A;  1GOZ A;  3S14 H;  1T5E A;  5M3M G;  2IHE A;  5C4X G;  4KHZ A;  4C3I B;  1PTO D;  3GTM H;  4DKA C;  2EXD A;  4GN5 A;  2PZT A;  1B3Q A;  2KEN A;  3SDZ A;  2EY5 A;  2EYP A;  5M3F B;  1EQQ A;  1IHZ A;  1PA6 A;  4RMF A;  1DCZ A;  4DNT B;  4L5T A;  1LT6 D;  1MBY A;  4LF5 L;  2E2H B;  1N36 L;  3GTP H;  2VB2 X;  3T51 B;  4BBS H;  1Z9F A;  1AP0 A;  4OIK A;  2K5N A;  4KKS A;  1VQ7 A;  4MN3 A;  1Q46 A;  2AQ1 B;  4LF7 L;  4XT3 B;  2Z9H A;  4JW0 A;  3S2H B;  1R9T B;  1STN A;  5BR8 L;  2XRQ D;  1CKN A;  4IUU A;  3PUX A;  3T13 A;  2DJF C;  4DGZ A;  4IJH A;  1TWC B;  3NQI A;  1B44 D;  4C3I G;  4A3L G;  1B4O A;  1WTO A;  4NW2 A;  3J80 L;  4L63 B;  2Z4H A;  3A74 A;  3UDF A;  5M3F G;  3CW2 C;  2ZTE A;  1YHB A;  4GOP A;  1PTO C;  2TMP A;  3K5O A;  1Y1W H;  1ICW A;  2MJ8 A;  4N9P A;  3ERS X;  1K8A C;  3PIO A;  2XWB B;  2UXB L;  3H0G H;  5FJ8 H;  3CCJ A;  4CJ1 B;  2ASB A;  3T56 B;  3DWA A;  1VQO A;  2SEB D;  4BY1 G;  2QEJ C;  4DK1 A;  3G6J B;  2UXD L;  4EX5 A;  1L0W A;  2A73 B;  1HNX Q;  4CKE A;  1E3P A;  3G48 A;  1N32 L;  1WTP A;  2HIX A;  1SE3 A;  2VUM B;  2C9O A;  3S9W A;  1QNU A;  4JI1 L;  2KCM A;  2D0O A;  3NTI A;  1HXY D;  3QWN A;  3J7Y W;  1M8A A;  3NWT A;  5C44 H;  4A4I A;  4E6I A;  3LX0 A;  2L9H A;  2YTV A;  3C3L A;  4UP9 A;  1KTK A;  1E22 A;  2XGT A;  1VQ8 A;  2KHJ A;  4DAY A;  1Y8P B;  5M5W H;  1PH1 A;  4B3T Q;  4P71 A;  2K5Q A;  3G4S A;  4P75 A;  1T9H A;  1JWM D;  3TRZ A;  1JWU D;  4GNX A;  1EEI D;  3NE5 B;  1CZG A;  1Z7T A;  2VUM G;  1X55 A;  3E5S A;  1HA6 A;  1I94 L;  2WKC A;  3A7A B;  3FHW A;  5ELN A;  1A2T A;  1JB3 A;  1VF5 C;  3TS0 A;  3IAY A;  3BZK A;  1UUP A;  2L4N A;  2AMC B;  1ILP A;  1RHP A;  1STA A;  1D5M C;  1STE A;  4JI4 L;  2VS1 A;  3TDQ A;  5JPM C;  2OTJ A;  4WRD A;  2UUA L;  3KBG A;  4C3H B;  1VQL A;  1A62 A;  1FJG L;  2A6H D;  2K03 A;  3A8J E;  5T1I A;  3I4M B;  2KVM A;  3OW7 A;  4X6A H;  4DV5 Q;  1LT4 D;  5IT9 E;  4OEM B;  2DY8 A;  2HT1 A;  1VQ4 A;  3PO3 B;  1CT1 D;  1S5B D;  1Q82 C;  2L0C A;  3CQZ H;  2D62 A;  3L0O A;  4MTK A;  1L1O B;  4TRD A;  4C3J B;  1LTS D;  1EY0 A;  4K2K A;  3TZU A;  2IX0 A;  1KQS A;  1N33 Q;  3OTO L;  5C6A A;  5LMU L;  1TWA H;  2E5L Q;  3I4M G;  2OWO A;  1GM5 A;  1GHK A;  4V19 0;  1E1O A;  4LF9 L;  1WCM B;  1HCZ A;  4RHS A;  3DLL A;  1VQF A;  3PO3 G;  4DAM A;  2LFN A;  2A6H C;  2HCC A;  4QGU A;  1HPC A;  1BVS A;  2ID0 A;  4PMB A;  5C4H A;  1UE1 A;  3A0J A;  4DPG A;  4FF2 A;  4K2L A;  1DGS A;  3GTL B;  2ZXP A;  2B2V A;  1TY0 A;  1HA5 A;  4C3J G;  4A3C H;  1ICF B;  3R2T A;  4OXP A;  4JI8 Q;  1E0B A;  1E24 A;  5A2Q L;  2ATW A;  1S3O A;  2H5X A;  4QB4 A;  4FF1 A;  4J8Q A;  1JB7 A;  2F0U A;  2CVR A;  3S1Q H;  5DEH A;  1SMY D;  1YJ9 A;  4X66 Q;  1GUO A;  1WCM G;  2DNC A;  4AQY L;  3MZ5 A;  3LWE A;  1CSP A;  1H9S A;  4BA2 I;  2B2W C;  2QW7 A;  4DUZ L;  3S16 H;  5CV6 A;  2WIN B;  2BOS A;  3HOU H;  2AQ3 B;  4DV3 Q;  5FOB B;  4M1U B;  1PZK D;  1L0Y B;  1QUQ B;  5EPL A;  1A2U A;  4YHH L;  1TS5 A;  5FLX E;  1V1O A;  2I0Q A;  4L8J A;  5CBA E;  1ET9 A;  3PUV A;  3MTS A;  5ELO A;  1H9R A;  5D14 A;  4B3S L;  5HGT A;  2RSN A;  3Q8D A;  1BR9 A;  4GS3 A;  1I6H H;  1HR0 W;  4ZUJ A;  4K8J A;  4A3K H;  2VNU D;  2F0T A;  3AFQ A;  1IL8 A;  3LGJ A;  2L55 A;  2PPB C;  4A3D H;  1MJE A;  3S14 B;  1VQG A;  4BA1 I;  2IW3 A;  3P7J A;  3IRB A;  5JEA J;  1BCP C;  1HFG A;  3NQT A;  2EJG C;  2F0M A;  3GTM B;  5GAD C;  4LF6 Q;  2PQA A;  1W6J A;  2K01 A;  3DWQ A;  3CP0 A;  2KHS A;  3D4R A;  3J7Z C;  4YIJ A;  5A35 A;  2F52 A;  1AEX A;  4DV7 L;  3GTP B;  4BBS B;  3F2D A;  3OMG A;  2PW7 A;  4RGN A;  2X6G A;  5IP7 H;  1PTO H;  2F0J A;  4ZKC B;  3T1Y Q;  1KLG D;  5AFW A;  5BN5 A;  1T5X D;  2AUJ D;  1JOQ A;  2HHH L;  3FVQ A;  2QA4 A;  4POG A;  3AB9 A;  5LHY 1;  2PW5 A;  1EYC A;  2EDG A;  1STH A;  3OW2 A;  1MSH A;  2B2T C;  5IE8 A;  2NVQ H;  3W3A A;  1NCV A;  5EPK A;  1Y1W B;  1IBL Q;  4WJ3 M;  5GRO A;  3BG3 A;  1VQP A;  2NZ1 D;  1MI2 A;  4BBS G;  1V8Q A;  4MIU A;  2PO4 A;  2D9U A;  1SJE D;  3H0G B;  5EKL A;  2C35 B;  2QGQ A;  3NP8 A;  2FMC A;  3I4L A;  1AH9 A;  1ENC A;  1EY6 A;  4LF4 L;  5J1Z A;  3K58 A;  4DV2 L;  2RHS B;  4RGO S;  4LFC L;  4F87 A;  3GTQ H;  3E0E A;  1K8G A;  2NWG A;  5IT9 c;  1SMX A;  2K14 A;  2OT2 A;  1KNA A;  4ILW A;  2F0P A;  3HKZ B;  4JI7 L;  1Y1W G;  5JEA H;  3CKI B;  3M4Q A;  1VQC A;  5C44 B;  3CCR A;  3H0G G;  4B3T L;  5FJ8 G;  5ELC A;  3CC4 A;  2BA1 A;  5KND A;  4PZ6 A;  5IGF A;  3OYY A;  4N9T A;  4HIK A;  5M5W B;  5IOD A;  4DV4 Q;  1C8C A;  2OXP A;  5FKA C;  1H95 A;  1NR4 A;  1TWH H;  1DOM A;  2SDF A;  1K28 A;  3I2Z A;  2EJF C;  5HY6 A;  1B1Z A;  1G91 A;  1FR3 A;  3HKZ G;  1MGS A;  4PV1 C;  1Y1V B;  2B8G A;  2NTT A;  2RQX A;  5C44 G;  1IKM A;  5LL6 S;  5BN3 A;  5CMD A;  1YJW A;  2OF1 A;  3RZD H;  2Q8T A;  4G7Z C;  1PH5 A;  4A3B B;  2KED A;  1X3P A;  3JAM L;  2EYH A;  1PH6 A;  1O7Y A;  1N36 Q;  4RA8 A;  1EY5 A;  3MXN B;  2V1C C;  4MTN A;  4LF7 Q;  3EN2 A;  5BR8 Q;  1XWE A;  1YNJ C;  1I4P A;  4JOI A;  4RAU C;  3E0J A;  4DAV A;  1Y1V G;  2L11 A;  4GLX A;  1OXX K;  3CMA A;  2N78 A;  3KYH C;  4FXK C;  4KMU C;  1C7Y A;  1U4M A;  3CQZ B;  4CDD C;  4N8F A;  3SK8 A;  2CWP A;  1EIG A;  2A5H A;  1HNZ L;  3M9B A;  4IUR A;  2IX1 A;  1JC7 A;  2UXB Q;  3RLN A;  1TWA B;  4Y52 H;  3A5U A;  4APV A;  2MGS A;  1HUM A;  1KL9 A;  1X65 A;  2AWO A;  5ELE A;  2UXD Q;  3SEB A;  3C46 A;  5KRU A;  4JI8 L;  4JG2 A;  4QY7 A;  4QQB X;  1TWG H;  1RJT A;  1PRT F;  4GOP C;  3AFP A;  1HUN A;  4YY3 L;  4ZK9 B;  5T1G A;  4ZYS A;  4JI1 Q;  1G2T A;  4X66 L;  2YU9 H;  1G29 1;  1FYC A;  2EY6 A;  4KKT A;  4L5Q A;  4JI5 L;  1WTR A;  3S1Q B;  4WJW A;  4UP7 A;  4CGY B;  3CHB D;  5H1S E;  5IY0 A;  1VCI A;  2HIV A;  3U50 C;  1U4L A;  1SYE A;  3I91 A;  4NPS A;  3D8G A;  3NWS A;  4L5S A;  1SFO H;  1Q90 A;  3UDI A;  3VYU A;  4L5R C;  3S16 B;  4F7X A;  2KA7 A;  3HOU B;  3OPO A;  1XNR L;  2LKV A;  4QIW E;  5COY A;  4F88 A;  2AQ2 B;  2K1B A;  3HS0 C;  4R8N A;  3A56 A;  4A3C G;  2FJ2 A;  2ZTC A;  3W1G A;  1I94 Q;  5CC4 A;  4NMZ A;  1J8I A;  4TSS A;  3Q23 A;  4O1N A;  3MAQ A;  1ENF A;  1NBW A;  2UUB L;  2B39 A;  5C3X A;  1UNS A;  1Y8N B;  2R3Z A;  2JA5 H;  5I4D A;  3NK9 A;  2WAQ E;  3FPP A;  1I6H B;  4NXN L;  4JI4 Q;  4R4T A;  3S1N H;  2UU9 L;  4KN7 C;  3PQI A;  4DAP A;  2HDL A;  4A3K B;  2E2I B;  1HFN A;  1BQQ T;  3CF5 A;  4KLK A;  2UUA Q;  3KDF A;  3VR2 A;  2XWJ B;  5DNF A;  2F0N A;  1KLU D;  1UE5 A;  4GNX C;  4A3D B;  3T4A C;  4HIO A;  1IBM L;  1FJG Q;  1O7L A;  3K59 A;  3HOU G;  3H94 A;  3NPP A;  4UPA A;  1SR3 A;  1PYB A;  1A8V A;  3B6Y A;  1H9K A;  1Y69 U;  3CAM A;  4J1M A;  3S2D H;  1G2S A;  3BU2 A;  3MXP A;  4QL5 A;  2EYO A;  1SYG A;  3TME A;  1TII D;  5CGK A;  4K0K L;  3OOC A;  3U4Z A;  2QDL A;  4MNO A;  4GKK L;  4A3K G;  3T1Y L;  3OTO Q;  3K6O A;  1J9O A;  5LMU Q;  3HOX H;  4XQN A;  4IJL A;  4A3D G;  4IUV A;  4IO9 A;  4KY7 A;  2BE5 C;  3GV6 A;  4ZRZ A;  1CUK A;  1UAP A;  1V1Q A;  2MPM A;  1EFI D;  4LF9 Q;  4C1N I;  3PCO B;  3TN2 A;  1EYA A;  1A6X A;  4A3J B;  3ONA B;  3D6W A;  4IUN A;  5CV4 A;  1JMC A;  1VMP A;  4KTA A;  1YNN D;  4R4O A;  4RGM A;  5EJW A;  5C3E B;  2NVQ B;  2F1M A;  1BDO A;  1O80 A;  1GO3 E;  1PYS B;  3DUZ A;  4K5X A;  4IFD H;  1H9M A;  2FHT A;  3MEH A;  1CK1 A;  4HJ8 A;  5IP7 G;  4DK0 A;  2EE1 A;  2GVB A;  1LO5 D;  2IX3 A;  2D0P A;  2B3G A;  4JI2 L;  4AQY Q;  1SYC A;  3GTQ B;  4TVA B;  5E7N A;  4A3J G;  2K5W A;  4XT1 B;  4DV6 L;  1G6Z A;  3OHX C;  4DUZ Q;  4HCE A;  1WTV A;  1TT2 A;  2GA4 B;  5C3E G;  3K7A H;  2IT1 A;  3CCM A;  1PV4 A;  1YZ6 A;  2EYJ A;  3H3V I;  2B2V C;  3HKS A;  2N88 A;  4OON A;  3S1R B;  4YHH Q;  1IYJ B;  1R4Q B;  1IKL A;  1PZJ D;  4K5V A;  4DU9 A;  2L5T A;  1IXR A;  4ME5 A;  1QOH A;  2F0O A;  4HID A;  1X56 A;  1P8L A;  1HZC A;  4H0L C;  4B3S Q;  5M5X B;  4A3F H;  4DXG A;  3R2I A;  3U9O A;  2E76 C;  1HZ9 A;  5DM7 3;  4LUV A;  4CJ0 B;  1TWH B;  2R61 A;  5KNC A;  3T1H L;  1GUT A;  1EZ8 A;  1Y8O B;  1EY4 A;  2DNE A;  3KK7 A;  4DR6 L;  3EBE A;  2G9D A;  2O2L D;  4HSV A;  5JEA G;  1A63 A;  5IYD H;  3NXW A;  2E75 C;  3QOJ A;  1JR0 D;  1WTX A;  1SND A;  4OHJ A;  2EVB A;  1L2F A;  3RZO H;  2JA7 H;  5FO9 B;  2L1B A;  4KY6 A;  4DV7 Q;  1B70 B;  4KI0 A;  4JBW A;  4XIG S;  4BY1 B;  5KEE A;  3UDX A;  4U67 3;  1B2T A;  3M85 A;  1E1T A;  3U9S A;  3W2D A;  3I4O A;  2JYO A;  5JJL A;  2F0D A;  1C4Q A;  3HOW B;  3S17 H;  2JP1 A;  2HHH Q;  2F0L A;  2N49 A;  1B9N A;  5J22 A;  1PRT D;  3BDL A;  1HTP A;  2A6E D;  4L6T B;  1DXM A;  1MJC A;  3L2P A;  1K0S A;  3CRK C;  3HOY H;  5CV9 A;  2OEO A;  4DR3 L;  2CW0 D;  5AJ3 L;  3KF6 B;  4KD4 A;  3F1Z A;  3JAM i;  3M4Y A;  3GQB A;  4DF7 A;  4AYB E;  3D0F A;  4B9W A;  2JXM B;  2D5D A;  2NN6 H;  1HHV A;  3HP3 A;  4LF4 Q;  4DV2 Q;  3HOW G;  2QCP X;  4LFC Q;  3ERQ A;  2K5H A;  2VQE L;  4A3M H;  1KDA A;  1HR0 L;  1TWG B;  2VZA A;  4KD3 A;  2KEC A;  2N8N A;  4JI7 Q;  3GTO H;  1HRJ A;  1PRT C;  3Q22 A;  1TWF H;  4DXF A;  3URY A;  1LTG D;  1C9O A;  3SHL A;  2Q2U A;  2A6E C;  3DM1 A;  1K0R A;  3LWU A;  4HN7 A;  4KJO A;  4RGT A;  1FD7 D;  1FNV A;  1AZP A;  1V1P B;  1ESR A;  4EQO A;  1CSQ A;  2CW0 C;  4N8X 1;  4A93 H;  1DON A;  5I9O A;  2F0S A;  1PH7 A;  3NUC A;  2YTY A;  4NXM L;  4CKC A;  2K4K A;  4IUT A;  1SYB A;  4ZCK A;  1NNX A;  3KOJ A;  4O42 A;  1O78 A;  3QG1 A;  3PIP 3;  2KCN A;  3KF8 A;  1QE6 A;  2MHV A;  3A8I E;  5BN4 A;  1YEZ A;  1HH2 P;  4HCS A;  1BCP B;  2A19 A;  4B3R L;  2JA5 B;  3MFG A;  3G71 A;  3CCQ A;  4HJ9 A;  2QKI C;  2WB1 E;  4LFA L;  2NZO A;  3S1N B;  4H02 A;  2VY3 A;  3O13 A;  4BXX H;  2EY2 A;  4QUF A;  1S5C D;  1TS3 A;  4DNI A;  2KEE A;  3QIA A;  2IHF A;  2H1E A;  2FMM A;  4QMG A;  3KLR A;  4C1N K;  2F3I A;  1OXT A;  4JBK A;  2D2C C;  3QOL A;  3RR5 A;  2B2U A;  2Z6K A;  4XQQ A;  4Y7N H;  3GTG H;  2Z6B A;  3GV3 A;  5EAY A;  1XMO L;  3NBH A;  2VXW A;  5I2X A;  3VA7 A;  3S2D B;  4LUO A;  3CC2 A;  1EY8 A;  1AFP A;  1N9W A;  2R93 H;  3SK6 A;  1H9J A;  3TP7 A;  2JA5 G;  4GKJ L;  3DM3 A;  4NKL A;  4LF8 L;  2RCF A;  5FK9 C;  2BDO A;  4FO2 A;  1IW7 D;  1LYL A;  1HNZ Q;  3VYT A;  3HOX B;  1WTQ A;  4A3I B;  1Q3L A;  5CBE E;  1XPR A;  2KOL A;  1K9M C;  1VDZ A;  3EQL C;  3F8T A;  4DR4 L;  1SDF A;  1UEA B;  2R6G A;  4JOI C;  5JJI A;  1M1K C;  1EWI A;  2JEA I;  2LXJ A;  3ND9 A;  1JOR A;  1Z6H A;  3AYH B;  5C5M A;  3J7A V;  3ULL A;  4YY3 Q;  1S5D D;  3Q0A A;  4KY5 A;  4C56 C;  5C4Z A;  2PMZ B;  2MQH A;  1VQ6 A;  5IOC A;  3HOX G;  3CCE A;  3EIV A;  4JI5 Q;  2NVX H;  4A3I G;  3I70 A;  5IGD A;  2WKD A;  4B3M L;  3OWF A;  5CV7 A;  1PDQ A;  3HGB A;  5EBC A;  1K83 H;  4LMQ D;  1IW7 C;  2AUK A;  4MZ9 A;  3V2T A;  2NVT H;  1CTM A;  4RWS C;  4XDX A;  4CHT B;  1CHQ D;  4XTC S;  3K7A B;  2PNR C;  4JI0 L;  1XNR Q;  1SJH D;  1EYG A;  2B63 H;  3BVZ A;  4DN4 M;  1VQM A;  1W6K A;  3DMU A;  2F4V L;  2O5J C;  2UUB Q;  2HQE A;  1M90 C;  3VR6 A;  3HOZ H;  5EGT A;  2JA8 H;  3PF5 A;  1SMY C;  4A3F B;  4LWC A;  4NXN Q;  2UU9 Q;  4OO1 H;  5ELB A;  4HAE A;  3N6R A;  3L7Z C;  5JJZ A;  3TRE A;  3ERO A;  3X3N A;  4POF A;  5J3B A;  1NMF A;  5GAH C;  1IBM Q;  2MUY A;  1XTD A;  4JPB W;  2UUC L;  3KLS A;  1ZYR D;  3K7U C;  5HUR A;  1VQ5 A;  1FGB D;  3N52 A;  3BYT B;  4X64 L;  3CCV A;  1BKB A;  3NTK A;  4G7O C;  1SE2 A;  3K0Y A;  1WVL A;  4IPC A;  4K14 A;  5FLM H;  2GVA A;  1GVP A;  2F3W A;  3RZO B;  4A3F G;  4K0K Q;  4IN3 A;  1XMQ L;  2UXC L;  1SE8 A;  4GKK Q;  1N34 L;  1SRO A;  1K3R A;  1ET6 A;  1SN8 A;  1ROD A;  3F2B A;  3KJO A;  1YI2 A;  1S5F D;  3CPW A;  3JAM c;  3MC0 B;  3RN2 A;  5KGU A;  3SE0 A;  4PZ7 A;  1TKW B;  5IYD G;  5GQO A;  1YIT A;  1C0A A;  1NAP A;  3T16 A;  3U58 A;  2ZXO A;  1F9R A;  1IBK L;  5ELF A;  1ZYR C;  3P75 A;  5D3I B;  2JA7 G;  2PZU A;  3S1M H;  2EIF A;  2E8G A;  3HOY B;  4UY8 C;  2I07 B;  3RMH A;  1A0I A;  4ME3 A;  5IGC A;  4GOP B;  1QJO A;  3I4N H;  4Q5V A;  1PYW D;  1RL2 A;  4FYD A;  1LUZ A;  1NMG A;  5NUC A;  3NBI A;  4YWL A;  2J7Z A;  1ILQ A;  3EFX D;  3J80 i;  4V0B A;  1SYF A;  4JI2 Q;  4EGV A;  2FIN B;  3STB D;  4A3M B;  4DV6 Q;  1D6E C;  1D1K A;  1NUC A;  4R4Q A;  5E4X A;  2KUM A;  1B3A A;  3EJI A;  4NDX A;  4PZ8 A;  5IP9 H;  4DR7 L;  2LMC B;  3GTO B;  3CCS A;  1EWH A;  4X3S A;  2F03 A;  3HOY G;  1TWF B;  5C4X H;  3PIO 3;  3BJU A;  1EYD A;  2Z4I A;  1K3B C;  1AE3 A;  2EYL A;  4WJ4 A;  4JV5 L;  4RKB A;  1VQH A;  1E2Z A;  1SNM A;  3RD4 A;  5FO7 B;  3K8A A;  3AQQ A;  3M4O H;  4A93 B;  1W3S A;  4KHP L;  3CU7 A;  1N8R C;  1EWC A;  2B8F A;  3DEO A;  4A3M G;  4A3G H;  2CKZ B;  4OIJ A;  3T1H Q;  4DAY B;  3OWE B;  2NUC A;  3C2P A;  3J80 E;  4K8I A;  1CA6 A;  4DR6 Q;  1EY7 A;  4DA2 A;  1JJG A;  1RDP D;  3H15 A;  2LXK A;  4GNX B;  2VQF L;  4DV0 L;  1FVI A;  4KK7 A;  4HMI A;  3HFZ B;  1EIF A;  5EKI A;  2Y0S E;  4HIM A;  1LTB D;  3D4D A;  3SVM A;  1VQB A;  2CH4 W;  4G57 A;  2WB1 B;  1TXY A;  1LM0 A;  4A93 G;  1LT3 D;  2RVL A;  5KNB A;  1BBX C;  4H44 C;  1CHP D;  5IWA L;  4X62 L;  4ODG A;  4P72 A;  1R9T H;  4DR2 L;  3FDT A;  2F0E A;  1EQT A;  3OMC A;  4YCW A;  3W5O A;  1TWC H;  2DUD A;  4B08 A;  1QVG A;  4DK6 C;  2R93 B;  1KC8 C;  2PQE A;  3L9A X;  3KFU A;  4FF3 A;  3KF6 A;  5EQ0 A;  3KLS X;  1JE4 A;  2WB1 G;  4HJ5 A;  4BXX G;  1DZ1 A;  1WJJ A;  3K57 A;  4DR3 Q;  2N3S A;  2YV5 A;  4JI6 L;  1Z47 A;  5AJ3 Q;  2FXQ A;  1PFM A;  1SLJ A;  2V4D A;  1YHQ A;  4PQX A;  4UDU C;  1VQN A;  2IPK D;  2RKS A;  4ULL A;  4X3K A;  3MA2 B;  1OTC A;  2HCI A;  3TP5 A;  5IT9 L;  2E2D C;  4I65 A;  1HQR D;  2XVS A;  3NEM A;  4R9W A;  2R93 G;  1UEB A;  2VQE Q;  1BBU A;  2K33 A;  1HR0 Q;  2CQO A;  2NBF A;  4PG3 A;  1B9M A;  5EBD A;  1QB5 D;  3PGZ A;  1W2B A;  3ULJ A;  1UWV A;  1V9P A;  1HNW L;  1IL2 A;  1PH8 A;  2RF4 A;  1MSG A;  2NVX B;  3ND8 A;  3L3O C;  4QJF A;  4X3T A;  4CJ2 C;  2MO0 A;  2XIW A;  1K83 B;  5C4J H;  1YNX A;  2K52 A;  3BDO A;  1GHJ A;  1VS0 A;  2F0W A;  4IFD J;  2K32 A;  4GZY C;  2NVT B;  4O0A A;  2Q8I B;  1WD0 A;  4F8M A;  4ZLT F;  2LY7 A;  2RA4 A;  4NXM Q;  3W1B A;  3CPF A;  2FFK B;  1X9N A;  1SRU A;  1H9S B;  3K0X A;  2B63 B;  4HSP A;  2R92 H;  2M2L A;  3E9H A;  5ISR A;  1JJC B;  1S4Z A;  2WII B;  3MVV A;  4U68 A;  3CME A;  2ES2 A;  2MO1 A;  4OO1 I;  1X32 A;  3ULP A;  3TQY A;  1D7Q A;  3HOZ B;  4AH6 A;  3UI2 A;  2ZJQ A;  4B3R Q;  1LTA D;  1X3F A;  4IPD A;  2QEX A;  4LFA Q;  1XTC D;  1QNK A;  3A55 A;  5M5Y H;  1NSN S;  1F9S A;  2K75 A;  4H7B A;  3V96 A;  1J5E L;  4C3H H;  1L1O A;  1JWS D;  2B63 G;  3LNN A;  2KQ3 A;  1XMO Q;  5FLX L;  2XRS D;  1XYI A;  1YJN A;  2TSS A;  4O2D A;  3HOZ G;  1HZA A;  3M4P A;  3M7N A;  5C3W A;  3J81 L;  2F3V A;  2I46 A;  4ZKB B;  2P5Z X;  4JI3 L;  5A2Q E;  1PTO B;  3PO2 H;  4GKJ Q;  2LS0 1;  4LF8 Q;  4OO1 G;  1U4P A;  3HOV H;  2XTI A;  4LFB L;  2PQA B;  2RDF A;  1UE7 A;  2I5M X;  1WD1 A;  2B2U C;  2Z6K C;  5EKK A;  3A7L A;  3WOF A;  1E2W A;  4DR4 Q;  1EQV A;  1CFM A;  4HMJ A;  1RF2 D;  2RDG A;  2G9H D;  1E2V A;  1EZ6 A;  1GUN A;  2F0H A;  2SNM A;  3J80 c;  1S40 A;  2CH4 A;  3E6Z X;  2G5D A;  1IZ6 A;  1K8O A;  5FLM G;  5DAU A;  5M9O A;  1F9Q A;  1E7Z A;  1VQI A;  3PV0 A;  5J39 A;  1PH4 A;  3S1M B;  1P16 A;  3CCL A;  1NE3 A;  3GTL H;  4K6D A;  4RKL A;  2R7Z H;  4YCV A;  1G8Z D;  1G51 A;  1SBB B;  3I4N B;  3Q6S A;  4FXG C;  5I6W A;  5K5P A;  4B3M Q;  4FF4 A;  1NR2 A;  2SNS A;  1QUQ A;  1PRT B;  5IYC H;  4HJ7 A;  4JBM A;  4Z9C B;  1BOS A;  1ZXT A;  1ENA A;  3I7F A;  3F2U A;  1YNN C;  1I4H A;  4ALP A;  1KNE A;  4JI0 Q;  5JVH 3;  3DHQ A;  1XPU A;  2K5D A;  1VQ9 A;  1D8L A;  4CDF C;  3OIQ A;  2XSC A;  3D3R A;  2F4V Q;  5CV5 A;  5IGB A;  3R93 A;  1SXT A;  4BY7 H;  3I4N G;  1SNC A;  3DEP A;  3UDG A;  4OX9 L;  4DR5 Q;  4DNR B;  1EL0 A;  2A74 C;  2JN4 A;  1WYD A;  1DYQ A;  1SNQ A;  3BZD B;  2VW9 A;  3HG9 A;  3C1E A;  4A3G B;  2HQL A;  3T53 B;  4KV6 A;  2EPB A;  1BCP F;  3MEF A;  1Q81 C;  4FNF A;  1QG7 A;  1BBW A;  1FGU A;  3IKJ A;  3OSO A;  4JVZ A;  5IP9 G;  3RZD B;  2UUC Q;  3NEN A;  3RLO A;  4OWW B;  4X64 Q;  1G6P A;  2EQS A;  1F77 A;  1D5X C;  2OQ0 A;  4DV1 Q;  1PLF A;  3ITP A;  4IPG A;  2Q2I A;  4CDE C;  1B50 A;  1PMR A;  1KXL A;  4OWX B;  5GAE C;  2Y0S B;  1XMQ Q;  1Q7Y C;  1X54 A;  2UXC Q;  5C0X J;  2IWH A;  1N34 Q;  1SYD A;  4UP8 A;  1TR5 A;  4A3G G;  2E74 C;  2I5L X;  4XXE A;  3AU7 A;  1PXU A;  4XQJ A;  3GP7 A;  4A75 A;  2I5H A;  3I8Z A;  5JPN C;  1TQO A;  1LTL A;  3HRZ C;  4DUY L;  3TSS A;  4KKU A;  4I7Z C;  1Q1E A;  4X3U A;  3GTK H;  2Z8L A;  2B2Y A;  1IBK Q;  2JK8 A;  5GAG C;  1DOL A;  4A76 A;  3FKI H;  5CR3 A;  5DM6 3;  1F2Y A;  1QCB D;  2Y0S G;  4BBR H;  2K7V A;  1TS4 A;  2ZM6 L;  5F2D A;  4KN4 C;  1I4X A;  1KAB A;  2IL8 A;  4J15 A;  2ALY B;  2QF7 A;  4OWT B;  1GKH A;  2X6L A;  2CHB D;  3VDY A;  3RN5 A;  4GN4 B;  3J7A 5;  1Q8I A;  3M3Y H;  3I73 A;  1F2L A;  1X6O A;  4JYA L;  1QZG A;  4RH6 A;  1LAC A;  2PCF B;  2YU9 B;  2ZJR A;  2E2J H;  1RKN A;  3E9I A;  2Q8R E;  3HKZ E;  5CYU A;  4Q0F A;  3CCU A;  4DR7 Q;  1HTL D;  1HZB A;  4K5W A;  2SOB A;  5E3F A;  2ZTD A;  3NEL A;  1PH2 A;  1EFW A;  1Q12 A;  1V43 A;  1VQD A;  4RCN A;  4DFA A;  1SFO B;  4JV5 Q;  4KHV A;  3JAM E;  3FPU B;  1K8M A;  5JAV A;  5C4J B;  3K5M A;  2HD3 A;  3BYY B;  2F0V A;  1HJP A;  4CBV A;  2OTL A;  4KHP Q;  4YWM A;  4QIW B;  5C0X H;  5FO8 B;  1BXT A;  3HZX A;  5JJK A;  4QCL A;  2EYM A;  3CXC A;  5K36 H;  1F9P A;  1NY4 A;  2BCO A;  4H13 C;  2R92 B;  3H3V C;  1OXS C;  2VQF Q;  4DV0 Q;  3A5Z B;  4GLA C;  2WAQ B;  1JIC A;  1Y1V H;  3P1H A;  3MXN A;  2YYZ A;  2ZXR A;  1AE2 A;  2CQA A;  2RSO A;  2HUG A;  2PYK A;  3GO5 A;  1F2M A;  4GN3 B;  4LAA A;  4ZAI A;  5M5Y B;  4DR1 L;  2A69 D;  4A3B H;  1LTI D;  1BNZ A;  3BVM A;  1AZQ A;  1YIJ A;  1GUS A;  2NB0 A;  4WFN 3;  2NZH A;  5IWA Q;  2EOT A;  4TKO B;  1JCK B;  1LV9 A;  1PFB A;  4X62 Q;  2R92 G;  1HQM C;  1LAB A;  2F0K A;  4QUC A;  2Q2T A;  1S5E D;  3KDF B;  1QIL A;  4DR2 Q;  4A3E H;  3JC6 6;  3KJP A;  1EEF D;  2WAQ G;  4LNQ A;  3SK4 A;  1YBY A;  5TSS A;  4K6L A;  1U9R A;  4G4K A;  4X65 L;  2K05 A;  4UAI A;  1EIY B;  3PO2 B;  1JQY D;  2BH2 A;  1XX8 A;  1WTH A;  3HOV B;  1I5F A;  4LUZ A;  1TY2 A;  5I9P A;  1DM0 B;  3J81 j;  2RHQ B;  3I90 A;  2JSO A;  2QIL A;  4JI6 Q;  2B29 A;  4C3H G;  1A3V A;  3KUP A;  2O4X A;  3RNU A;  2A69 C;  3RLF A;  2EY1 A;  3SR1 A;  4IFD I;  1ML0 D;  1I6V C;  3BDC A;  2M9V A;  3G6E A;  1SE4 A;  3AMU A;  2KCT A;  2K5V A;  4HTH A;  1CQV A;  1XJV A;  3PO2 G;  1II3 A;  4FDB A;  1EU3 A;  3HOV G;  1D1I A;  1HNW Q;  3UE1 A;  2R7Z B;  3J81 i;  4FVM A;  2OQK A;  3KLW A;  3MXU A;  3U4V A;  3CD6 A;  3PUZ A;  2XNA C;  3FRP B;  1CKO A;  2MP1 A;  3D31 A;  4R4I A;  5IYB H;  2JA9 A;  1I4Q A;  1BCP D;  4IFD G;  3WWV A;  5KYI A;  1IYV A;  3SXH A;  3MFY A;  3NTH A;  1EOT A;  1WTW A;  3QB3 A;  1XNQ Q;  3FP9 A;  4DR5 L;  4S3S A;  3KBX A;  4HJA A;  3WDN A;  2R7Z G;  5G3L F;  3UE0 A;  2EXZ A;  3GTJ H;  4BY7 B;  4HR7 B;  2O5I C;  4MHE A;  5LMN L;  5IYC G;  1X3Q A;  2F0I A;  2KHI A;  3J81 E;  1PH9 A;  3K81 C;  2WP8 J;  3IFT A;  2KBN A;  3VR4 A;  4OEL B;  1ASZ A;  1GJX A;  4NP5 A;  3HEJ A;  1CM9 A;  4IQZ A;  2E2I H;  4LW1 A;  2A1A A;  4DV1 L;  2VB3 X;  1KD1 C;  1J5E Q;  4YCU A;  3QJY A;  2MNA A;  1I50 H;  1J6Q A;  4G7H C;  2EJM A;  4CDC C;  2EZV A;  2JA7 B;  3F2C A;  3M7G A;  4BY7 G;  4LJZ C;  1X3E A;  2L15 A;  3S15 H;  1BUV T;  3A8K E;  3SK5 A;  4EQP A;  2C5C A;  1BO0 A;  2RBM A;  2A8V A;  3E3X A;  4JI3 Q;  1QZH A;  2JA6 H;  2BH8 A;  4LFB Q;  1RTN A;  5C5L A;  4EQ5 A;  3EVQ A;  4HED A;  3NHH A;  2AHO B;  3H6M A;  4BS9 A;  3BS1 A;  1SNO A;  3S17 B;  4I7A A;  1CKM A;  3TS2 A;  1L1O C;  1DJR D;  2R7D A;  3A54 A;  1CKN B;  4JC0 A;  4ABN A;  1I3Q H;  4NB3 A;  3R8B A;  4IOA A;  4P2C B;  4M8A A;  4A3J H;  2JEB I;  1A3U A;  2F0G A;  3GTK B;  1CQF A;  2NN6 I;  4TQU S;  5I6Y A;  1KAW A;  3FKI B;  1AN8 A;  1ASY A;  5C3E H;  1K73 C;  4BBR B;  5JVG 3;  3GDE A;  5IGE A;  1O7Z A;  2JJQ A;  4C2M H;  1OO9 B;  5HGQ A;  1EUJ A;  4AYB B;  2N55 A;  3PF4 A;  5LL6 X;  3D4W A;  2GN5 A;  1X3G A;  3SGI A;  1L0X B;  1HNX L;  3S24 A;  4IPH A;  1FNW A;  4ZUI A;  2J4X A;  2YTX A;  5M3M H;  3M3Y B;  1TU2 B;  1ZKO A;  2E2J B;  3MWY W;  3I55 A;  3FKI G;  1GUG A;  5COR A;  2NVY H;  4BBR G;  3K80 C;  2Z0S A;  3MHB A;  1XXG A;  1STG A;  1B8A A;  2NN6 G;  4R8I A;  2CWA A;  4AYB G;  2J0T D;  3S1R H;  1STY A;  3VA5 A;  1PVO A;  4R4C A;  1OXV A;  1MD2 D;  1PHJ A;  1MHW C;  3H3V H;  1I4R A;  4OX9 Q;  3PMF A;  5C0X I;  1Q1B A;  2L12 A;  2MFI A;  2H4O A;  3DWP A;  4QF4 A;  5M5X H;  3FMC A;  4ID6 A;  3EA6 A;  3MXG A;  1EOV A;  3STB C;  2ICE C;  1QVC A;  5ELD A;  2OCE A;  1KRS A;  1YNJ D;  3ICE A;  2WV6 D;  1Q8K A;  4PMC A;  4C3I H;  4A3L H;  2IJ0 A;  2DGY A;  1A15 A;  1Y14 B;  3Q24 A;  1QVF A;  1YHA A;  5M3F H;  2ZJP A;  2NYZ D;  2KJX A;  1EY9 A;  2BA0 A;  2F0Q A;  1KRT A;  4PMW A;  1CI3 M;  5IIF A;  2RDH A;  2E2H H;  3KF8 B;  1JJ2 A;  1UE6 A;  2K50 A;  4Y7N B;  3PSI A; 
#chains in the Genus database with same CATH homology
 2HDM A;  3GTG B;  5E1F A;  2F0F A;  1AW7 A;  3PUW A;  1TVX A;  1CA5 A;  5C0X G;  5D3D A;  3K5N A;  5K36 G;  1A3T A;  1JOO A;  4J6H A;  4EVO A;  1PTO F;  1F2Z A;  4A3E B;  1FNU A;  1LLR D;  3VYS A;  1SNP A;  4FP5 D;  2K28 A;  3D6C A;  1BF4 A;  1R4P B;  5KYL A;  3CRL C;  1LTR D;  4XYQ A;  2M00 A;  3WOE A;  1JOK A;  1ESF A;  4XYO A;  1M4V A;  4CKB A;  2ENB A;  1VF7 A;  3FEW X;  3I3C A;  2B2W A;  5EPJ A;  3OIP A;  2F4I A;  2JE6 I;  5E4W C;  2B2Y C;  1STB A;  1V1P A;  1D5Z C;  5G3L D;  3BVG A;  1DOK A;  1TS2 A;  1C48 A;  2ZT9 C;  2K6A A;  4LK1 C;  4IAL A;  4ZQ3 A;  1KDC A;  3H09 A;  3TBI B;  3DXJ C;  3IL8 A;  3RUZ A;  1RD9 D;  1DD2 A;  1IYU A;  4FXD A;  4PNY A;  2BDN A;  2JA8 B;  3VYR A;  5IGG A;  3R3O A;  3GTJ B;  3H91 A;  1VMC A;  1ZEQ X;  1LTT D;  2K04 A;  4KJN A;  2DY7 A;  3P20 A;  5D65 A;  2BE5 D;  2WAC A;  3TP8 A;  1PZI D;  4EQN A;  3VR5 A;  1I50 B;  3PUY A;  2KCC A;  2ICI A;  2XN9 C;  1D2B A;  3I72 A;  1EIH A;  3VR3 A;  2B2T A;  2PZW A;  1SEB D;  1RCV D;  4IUP A;  3S15 B;  3NSW A;  4JK1 C;  2JA6 B;  1SAP A;  3TP6 A;  1GUW A;  3J7A F;  1RTO A;  2EYF A;  1GXD C;  2A68 D;  3X3M A;  4RFB A;  4IUQ A;  4OGQ C;  1I3Q B;  2NTS A;  4OL7 A;  2X69 A;  4IZ8 A;  3V05 A;  2DN8 A;  1B53 A;  4B9X A;  1KAA A;  4RHR A;  5KIX A;  3GD7 A;  3QO2 A;  4C2M B;  1U4R A;  5I2Y A;  4RCO A;  2AWN A;  2Z1C A;  3IFD A;  5JOB A;  1ONL A;  4BWG B;  1EU4 A;  5M3M B;  3C1F A;  3K5L A;  5C4X B;  2A68 C;  5CV8 A;  3TZD A;  2NVY B;  3G7L A;  3ZYY X;  1SSO A;  3M4O B;  1I4G A;  1QWY A;  1KDB A;  1LT5 D;  4WOR A;  1PFN A;  1OXU A;  1CZW A;  2QDB A;  1GOZ A;  1T5E A;  4KHZ A;  4C3I B;  1PTO D;  2PZT A;  3SDZ A;  2EY5 A;  2EYP A;  5M3F B;  1IHZ A;  1DCZ A;  4DNT B;  1LT6 D;  1MBY A;  2E2H B;  2VB2 X;  3T51 B;  1AP0 A;  4OIK A;  4KKS A;  4MN3 A;  2AQ1 B;  4XT3 B;  3S2H B;  1R9T B;  1STN A;  2XRQ D;  4IUU A;  3PUX A;  3T13 A;  4DGZ A;  1TWC B;  3NQI A;  1B44 D;  4C3I G;  1B4O A;  1WTO A;  4NW2 A;  3J80 L;  4L63 B;  2Z4H A;  1PTO C;  2TMP A;  3K5O A;  1ICW A;  2MJ8 A;  4N9P A;  2XWB B;  4CJ1 B;  3T56 B;  3DWA A;  2SEB D;  2QEJ C;  4DK1 A;  3G6J B;  2A73 B;  4CKE A;  1WTP A;  1SE3 A;  2VUM B;  2C9O A;  3S9W A;  1QNU A;  3NTI A;  1HXY D;  3QWN A;  3J7Y W;  1M8A A;  3NWT A;  4E6I A;  3LX0 A;  2L9H A;  3C3L A;  1KTK A;  4DAY A;  1Y8P B;  2K5Q A;  1JWM D;  1JWU D;  1EEI D;  3NE5 B;  1CZG A;  1Z7T A;  3E5S A;  1HA6 A;  2WKC A;  3A7A B;  1A2T A;  1JB3 A;  1VF5 C;  3IAY A;  1UUP A;  2L4N A;  1ILP A;  1RHP A;  1STA A;  1D5M C;  1STE A;  3TDQ A;  5JPM C;  4WRD A;  3KBG A;  4C3H B;  2A6H D;  2K03 A;  3A8J E;  5T1I A;  3I4M B;  2KVM A;  3OW7 A;  1LT4 D;  5IT9 E;  2DY8 A;  3PO3 B;  1CT1 D;  1S5B D;  2L0C A;  2D62 A;  4TRD A;  4C3J B;  1LTS D;  1EY0 A;  4K2K A;  3TZU A;  2IX0 A;  5C6A A;  1GHK A;  4V19 0;  1WCM B;  1HCZ A;  4RHS A;  2LFN A;  2A6H C;  2HCC A;  1HPC A;  5C4H A;  2ID0 A;  4PMB A;  4FF2 A;  4K2L A;  3GTL B;  4C3J G;  2ZXP A;  1TY0 A;  1HA5 A;  2B2V A;  3R2T A;  1E0B A;  5A2Q L;  4QB4 A;  4FF1 A;  4J8Q A;  2F0U A;  2CVR A;  5DEH A;  1SMY D;  1GUO A;  2DNC A;  3MZ5 A;  3LWE A;  4BA2 I;  1H9S A;  2B2W C;  5CV6 A;  2WIN B;  2BOS A;  2AQ3 B;  5FOB B;  4M1U B;  1PZK D;  1L0Y B;  5EPL A;  1A2U A;  1TS5 A;  5FLX E;  1V1O A;  4L8J A;  5CBA E;  1ET9 A;  3PUV A;  3MTS A;  1H9R A;  5D14 A;  5HGT A;  2RSN A;  1BR9 A;  4ZUJ A;  4K8J A;  2VNU D;  2F0T A;  1IL8 A;  2L55 A;  2PPB C;  3S14 B;  4BA1 I;  2IW3 A;  3P7J A;  5JEA J;  1BCP C;  1HFG A;  3NQT A;  2EJG C;  2F0M A;  3GTM B;  1W6J A;  2K01 A;  3DWQ A;  2KHS A;  3D4R A;  4YIJ A;  5A35 A;  1AEX A;  3GTP B;  4BBS B;  3OMG A;  2PW7 A;  4RGN A;  2X6G A;  1PTO H;  2F0J A;  4ZKC B;  1KLG D;  5AFW A;  5BN5 A;  1T5X D;  2AUJ D;  1JOQ A;  3FVQ A;  3AB9 A;  5LHY 1;  2PW5 A;  1EYC A;  2EDG A;  1STH A;  1MSH A;  2B2T C;  3W3A A;  1NCV A;  5EPK A;  1Y1W B;  3BG3 A;  2NZ1 D;  1MI2 A;  1V8Q A;  4MIU A;  2PO4 A;  2D9U A;  1SJE D;  3H0G B;  5EKL A;  3NP8 A;  2FMC A;  3I4L A;  1ENC A;  1EY6 A;  5J1Z A;  3K58 A;  4RGO S;  4F87 A;  2NWG A;  2OT2 A;  1KNA A;  4ILW A;  2F0P A;  3HKZ B;  5JEA H;  3CKI B;  5C44 B;  5ELC A;  2BA1 A;  5KND A;  5IGF A;  4N9T A;  5M5W B;  5IOD A;  1C8C A;  2OXP A;  5FKA C;  1NR4 A;  1DOM A;  2SDF A;  2EJF C;  1B1Z A;  1G91 A;  1FR3 A;  1MGS A;  4PV1 C;  1Y1V B;  2B8G A;  2NTT A;  2RQX A;  1IKM A;  5LL6 S;  5BN3 A;  5CMD A;  2OF1 A;  2Q8T A;  4G7Z C;  4A3B B;  2KED A;  1X3P A;  3JAM L;  2EYH A;  1O7Y A;  4RA8 A;  1EY5 A;  1XWE A;  1YNJ C;  1I4P A;  4RAU C;  3E0J A;  4DAV A;  2L11 A;  1OXX K;  4FXK C;  4KMU C;  1U4M A;  3CQZ B;  3SK8 A;  1EIG A;  2A5H A;  4IUR A;  2IX1 A;  1JC7 A;  1TWA B;  2MGS A;  1HUM A;  2AWO A;  5ELE A;  3SEB A;  3C46 A;  5KRU A;  1RJT A;  1PRT F;  1HUN A;  4ZK9 B;  5T1G A;  4ZYS A;  1G2T A;  1G29 1;  1FYC A;  2EY6 A;  4KKT A;  1WTR A;  3S1Q B;  4WJW A;  4CGY B;  3CHB D;  1VCI A;  1U4L A;  1SYE A;  3I91 A;  3D8G A;  3NWS A;  1Q90 A;  3VYU A;  3S16 B;  4F7X A;  2KA7 A;  3HOU B;  3OPO A;  2LKV A;  5COY A;  4F88 A;  2AQ2 B;  2K1B A;  3HS0 C;  4R8N A;  3A56 A;  2FJ2 A;  5CC4 A;  4NMZ A;  1J8I A;  4TSS A;  3Q23 A;  4O1N A;  3MAQ A;  1ENF A;  2B39 A;  5C3X A;  1UNS A;  1Y8N B;  2R3Z A;  5I4D A;  3NK9 A;  1I6H B;  3FPP A;  4KN7 C;  4DAP A;  2HDL A;  4A3K B;  2E2I B;  1HFN A;  1BQQ T;  3VR2 A;  2XWJ B;  5DNF A;  2F0N A;  1KLU D;  4A3D B;  3T4A C;  1O7L A;  3K59 A;  3H94 A;  3NPP A;  1H9K A;  1Y69 U;  4J1M A;  1G2S A;  3MXP A;  2EYO A;  1SYG A;  3TME A;  1TII D;  5CGK A;  3OOC A;  3K6O A;  1J9O A;  4XQN A;  4IUV A;  4KY7 A;  2BE5 C;  3GV6 A;  4ZRZ A;  1UAP A;  2MPM A;  1EFI D;  4C1N I;  3TN2 A;  1EYA A;  1A6X A;  4A3J B;  3ONA B;  3D6W A;  5CV4 A;  4IUN A;  1VMP A;  4KTA A;  1YNN D;  4RGM A;  5EJW A;  5C3E B;  2NVQ B;  2F1M A;  1BDO A;  1O80 A;  3DUZ A;  4K5X A;  4IFD H;  1H9M A;  2FHT A;  3MEH A;  1CK1 A;  4DK0 A;  2EE1 A;  1LO5 D;  2IX3 A;  1SYC A;  3GTQ B;  2K5W A;  4XT1 B;  1G6Z A;  3OHX C;  4HCE A;  1WTV A;  1TT2 A;  2GA4 B;  2IT1 A;  2EYJ A;  2B2V C;  2N88 A;  3S1R B;  1R4Q B;  1IKL A;  1PZJ D;  4K5V A;  4DU9 A;  2L5T A;  4ME5 A;  1QOH A;  2F0O A;  4H0L C;  5M5X B;  4DXG A;  3R2I A;  3U9O A;  2E76 C;  5DM7 3;  4CJ0 B;  1TWH B;  2R61 A;  5KNC A;  1GUT A;  1EZ8 A;  1Y8O B;  1EY4 A;  2DNE A;  3KK7 A;  2G9D A;  2O2L D;  4HSV A;  5JEA G;  3NXW A;  2E75 C;  3QOJ A;  1JR0 D;  1WTX A;  1SND A;  4OHJ A;  2EVB A;  5FO9 B;  2L1B A;  4KY6 A;  4KI0 A;  4JBW A;  4XIG S;  4BY1 B;  5KEE A;  4U67 3;  1B2T A;  3M85 A;  3U9S A;  3W2D A;  2JYO A;  2F0D A;  1C4Q A;  3HOW B;  2JP1 A;  2F0L A;  1B9N A;  5J22 A;  1PRT D;  3BDL A;  1HTP A;  2A6E D;  4L6T B;  1DXM A;  3CRK C;  5CV9 A;  2OEO A;  2CW0 D;  4KD4 A;  3M4Y A;  3GQB A;  4DF7 A;  4B9W A;  2JXM B;  2D5D A;  2NN6 H;  1HHV A;  3HP3 A;  2QCP X;  3ERQ A;  1KDA A;  1TWG B;  4KD3 A;  2KEC A;  1HRJ A;  1PRT C;  3Q22 A;  4DXF A;  3URY A;  1LTG D;  3SHL A;  2A6E C;  3DM1 A;  3LWU A;  4HN7 A;  4KJO A;  4RGT A;  1FD7 D;  1FNV A;  1AZP A;  1V1P B;  1ESR A;  4EQO A;  2CW0 C;  1DON A;  5I9O A;  2F0S A;  3NUC A;  4CKC A;  4IUT A;  1SYB A;  4O42 A;  1O78 A;  3QG1 A;  3PIP 3;  2KCN A;  3KF8 A;  1QE6 A;  2MHV A;  3A8I E;  5BN4 A;  4HCS A;  1BCP B;  2JA5 B;  3MFG A;  2QKI C;  3S1N B;  3O13 A;  2EY2 A;  4QUF A;  1S5C D;  1TS3 A;  2KEE A;  3QIA A;  2H1E A;  2FMM A;  4QMG A;  3KLR A;  4C1N K;  1OXT A;  2D2C C;  3QOL A;  2B2U A;  4XQQ A;  3GV3 A;  3NBH A;  2VXW A;  5I2X A;  3VA7 A;  3S2D B;  1EY8 A;  1AFP A;  3SK6 A;  3TP7 A;  1H9J A;  4NKL A;  5FK9 C;  2BDO A;  4FO2 A;  1IW7 D;  3HOX B;  3VYT A;  1WTQ A;  4A3I B;  1Q3L A;  5CBE E;  2KOL A;  1VDZ A;  3EQL C;  1SDF A;  1UEA B;  2R6G A;  2JEA I;  3ND9 A;  1JOR A;  1Z6H A;  5C5M A;  3J7A V;  1S5D D;  3Q0A A;  4KY5 A;  4C56 C;  5C4Z A;  2PMZ B;  5IOC A;  3I70 A;  5IGD A;  2WKD A;  3OWF A;  5CV7 A;  1PDQ A;  3HGB A;  5EBC A;  4LMQ D;  1IW7 C;  2AUK A;  3V2T A;  1CTM A;  4RWS C;  4XDX A;  4CHT B;  1CHQ D;  4XTC S;  3K7A B;  2PNR C;  1SJH D;  3BVZ A;  4DN4 M;  1W6K A;  3DMU A;  2O5J C;  2HQE A;  3VR6 A;  5EGT A;  4A3F B;  1SMY C;  4OO1 H;  5ELB A;  4HAE A;  3N6R A;  3L7Z C;  5JJZ A;  3ERO A;  3X3N A;  2MUY A;  3KLS A;  1ZYR D;  5HUR A;  1FGB D;  3N52 A;  3BYT B;  3NTK A;  4G7O C;  1SE2 A;  3K0Y A;  1WVL A;  4K14 A;  2F3W A;  3RZO B;  4IN3 A;  1ET6 A;  1ROD A;  1S5F D;  3MC0 B;  5KGU A;  3SE0 A;  1TKW B;  1NAP A;  3T16 A;  2ZXO A;  1F9R A;  5ELF A;  1ZYR C;  3P75 A;  5D3I B;  2PZU A;  3HOY B;  2I07 B;  3RMH A;  5IGC A;  1QJO A;  4Q5V A;  1PYW D;  4FYD A;  5NUC A;  3NBI A;  2J7Z A;  1ILQ A;  3EFX D;  4V0B A;  1SYF A;  4EGV A;  2FIN B;  4A3M B;  1D6E C;  1D1K A;  1NUC A;  5E4X A;  2KUM A;  1B3A A;  3EJI A;  4NDX A;  2LMC B;  3GTO B;  1EWH A;  4X3S A;  2F03 A;  1TWF B;  3PIO 3;  1EYD A;  2Z4I A;  2EYL A;  4RKB A;  1E2Z A;  1SNM A;  3RD4 A;  5FO7 B;  4A93 B;  3CU7 A;  1EWC A;  2B8F A;  3DEO A;  4OIJ A;  3OWE B;  2NUC A;  3C2P A;  3J80 E;  4K8I A;  1CA6 A;  1EY7 A;  4DA2 A;  1RDP D;  4KK7 A;  4HMI A;  5EKI A;  1LTB D;  3D4D A;  3SVM A;  4G57 A;  2WB1 B;  1LT3 D;  2RVL A;  5KNB A;  1BBX C;  4H44 C;  1CHP D;  4ODG A;  3FDT A;  2F0E A;  1EQT A;  3OMC A;  4B08 A;  2R93 B;  2PQE A;  3L9A X;  4FF3 A;  5EQ0 A;  3KLS X;  1JE4 A;  1DZ1 A;  3K57 A;  1Z47 A;  1PFM A;  2V4D A;  4PQX A;  4UDU C;  2IPK D;  2RKS A;  4ULL A;  4X3K A;  3MA2 B;  2HCI A;  3TP5 A;  5IT9 L;  2E2D C;  4I65 A;  1HQR D;  2XVS A;  4R9W A;  2K33 A;  2NBF A;  1B9M A;  5EBD A;  1QB5 D;  1MSG A;  2NVX B;  3ND8 A;  3L3O C;  4X3T A;  4CJ2 C;  2XIW A;  1K83 B;  3BDO A;  1GHJ A;  2F0W A;  4IFD J;  2K32 A;  4GZY C;  2NVT B;  2Q8I B;  1WD0 A;  4F8M A;  4ZLT F;  2LY7 A;  2RA4 A;  2FFK B;  1H9S B;  2B63 B;  4HSP A;  2M2L A;  5ISR A;  1S4Z A;  2WII B;  4U68 A;  3MVV A;  4OO1 I;  1X32 A;  3HOZ B;  3UI2 A;  1LTA D;  1XTC D;  1QNK A;  3A55 A;  1NSN S;  1F9S A;  4H7B A;  3V96 A;  1JWS D;  3LNN A;  2KQ3 A;  5FLX L;  2XRS D;  1XYI A;  2TSS A;  3M7N A;  5C3W A;  3J81 L;  2F3V A;  2I46 A;  4ZKB B;  5A2Q E;  1PTO B;  2LS0 1;  4OO1 G;  1U4P A;  2RDF A;  1WD1 A;  2B2U C;  5EKK A;  3A7L A;  3WOF A;  1E2W A;  1EQV A;  1CFM A;  4HMJ A;  1RF2 D;  2RDG A;  2G9H D;  1E2V A;  1EZ6 A;  1GUN A;  2F0H A;  2SNM A;  3E6Z X;  1K8O A;  5DAU A;  5M9O A;  1F9Q A;  3PV0 A;  5J39 A;  3S1M B;  4K6D A;  4RKL A;  1G8Z D;  1SBB B;  3I4N B;  3Q6S A;  4FXG C;  5I6W A;  5K5P A;  4FF4 A;  1NR2 A;  2SNS A;  1PRT B;  4Z9C B;  1BOS A;  1ZXT A;  1ENA A;  3F2U A;  1YNN C;  1I4H A;  1KNE A;  5JVH 3;  3DHQ A;  2K5D A;  3OIQ A;  2XSC A;  3D3R A;  5CV5 A;  5IGB A;  3R93 A;  1SXT A;  1SNC A;  3DEP A;  4DNR B;  1EL0 A;  2A74 C;  1DYQ A;  1SNQ A;  3BZD B;  3HG9 A;  3C1E A;  4A3G B;  3T53 B;  4KV6 A;  2EPB A;  1BCP F;  4FNF A;  1QG7 A;  3IKJ A;  3OSO A;  3RZD B;  1F77 A;  1D5X C;  1PLF A;  3ITP A;  1B50 A;  1PMR A;  2Y0S B;  5C0X J;  2IWH A;  1SYD A;  1TR5 A;  2E74 C;  4XXE A;  3AU7 A;  1PXU A;  4XQJ A;  3GP7 A;  3I8Z A;  5JPN C;  1TQO A;  3HRZ C;  3TSS A;  4KKU A;  4I7Z C;  1Q1E A;  4X3U A;  2Z8L A;  2B2Y A;  1DOL A;  5CR3 A;  5DM6 3;  1F2Y A;  1QCB D;  2K7V A;  1TS4 A;  5F2D A;  4KN4 C;  1I4X A;  1KAB A;  2IL8 A;  2QF7 A;  2X6L A;  2CHB D;  1Q8I A;  3I73 A;  1F2L A;  4RH6 A;  1LAC A;  2PCF B;  2YU9 B;  1RKN A;  2Q8R E;  5CYU A;  4Q0F A;  1HTL D;  4K5W A;  2SOB A;  5E3F A;  1Q12 A;  1V43 A;  4RCN A;  4DFA A;  1SFO B;  4KHV A;  3JAM E;  3FPU B;  1K8M A;  5JAV A;  5C4J B;  3K5M A;  3BYY B;  2F0V A;  4CBV A;  4QIW B;  5C0X H;  5FO8 B;  1BXT A;  3HZX A;  4QCL A;  2EYM A;  5K36 H;  1F9P A;  2BCO A;  4H13 C;  2R92 B;  3H3V C;  1OXS C;  2WAQ B;  1JIC A;  3MXN A;  3P1H A;  2YYZ A;  2ZXR A;  2CQA A;  2RSO A;  2HUG A;  2PYK A;  3GO5 A;  1F2M A;  5M5Y B;  4LAA A;  4ZAI A;  2A69 D;  1LTI D;  1BNZ A;  3BVM A;  1AZQ A;  1GUS A;  2NB0 A;  4WFN 3;  2EOT A;  4TKO B;  1JCK B;  1LV9 A;  1PFB A;  1HQM C;  1LAB A;  2F0K A;  4QUC A;  1S5E D;  1QIL A;  1EEF D;  3SK4 A;  5TSS A;  4K6L A;  1U9R A;  4G4K A;  2K05 A;  4UAI A;  3PO2 B;  1JQY D;  1XX8 A;  3HOV B;  1TY2 A;  5I9P A;  1DM0 B;  3I90 A;  2JSO A;  2QIL A;  4C3H G;  1A3V A;  3KUP A;  2O4X A;  2A69 C;  3RLF A;  2EY1 A;  3SR1 A;  4IFD I;  1ML0 D;  1I6V C;  3BDC A;  2M9V A;  3AMU A;  1SE4 A;  4HTH A;  1CQV A;  1II3 A;  1EU3 A;  1D1I A;  2R7Z B;  4FVM A;  3MXU A;  3PUZ A;  2XNA C;  3FRP B;  2MP1 A;  3D31 A;  1I4Q A;  1BCP D;  4IFD G;  5KYI A;  1IYV A;  3SXH A;  3MFY A;  3NTH A;  1EOT A;  1WTW A;  3QB3 A;  4S3S A;  3KBX A;  3WDN A;  5G3L F;  2EXZ A;  4BY7 B;  4HR7 B;  2O5I C;  4MHE A;  1X3Q A;  2F0I A;  3J81 E;  3VR4 A;  2WP8 J;  3IFT A;  1GJX A;  4NP5 A;  3HEJ A;  1CM9 A;  4IQZ A;  2VB3 X;  3QJY A;  4G7H C;  2EJM A;  2EZV A;  2JA7 B;  3M7G A;  4LJZ C;  1BUV T;  3A8K E;  3SK5 A;  4EQP A;  2C5C A;  1BO0 A;  2RBM A;  1RTN A;  5C5L A;  3EVQ A;  4HED A;  3NHH A;  4BS9 A;  3H6M A;  3BS1 A;  1SNO A;  3S17 B;  1DJR D;  3A54 A;  4ABN A;  3R8B A;  4P2C B;  4M8A A;  2JEB I;  1A3U A;  2F0G A;  3GTK B;  1CQF A;  2NN6 I;  4TQU S;  5I6Y A;  3FKI B;  1AN8 A;  4BBR B;  5JVG 3;  5IGE A;  1O7Z A;  1OO9 B;  4AYB B;  2N55 A;  5LL6 X;  3D4W A;  1L0X B;  1FNW A;  4ZUI A;  2J4X A;  3M3Y B;  1TU2 B;  1ZKO A;  2E2J B;  3MWY W;  1GUG A;  5COR A;  3MHB A;  1XXG A;  1STG A;  2NN6 G;  4R8I A;  2J0T D;  1STY A;  3VA5 A;  1OXV A;  1MD2 D;  1I4R A;  3PMF A;  5C0X I;  1Q1B A;  2L12 A;  2H4O A;  3DWP A;  4QF4 A;  3FMC A;  4ID6 A;  3EA6 A;  3MXG A;  2ICE C;  5ELD A;  1YNJ D;  2WV6 D;  4PMC A;  2IJ0 A;  1A15 A;  3Q24 A;  2NYZ D;  2KJX A;  1EY9 A;  2BA0 A;  2F0Q A;  4PMW A;  1CI3 M;  5IIF A;  2RDH A;  4Y7N B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...