1BNZA

Sso7d hyperthermophile protein/dna complex
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
64
structure length
64
Chain Sequence
MATVKFKYKGEEKEVDISKIKKVWRVGKMISFTYDEGGGKTGRGAVSEKDAPKELLQMLEKQKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*GP*TP*AP*AP*TP*TP*AP*C)-3'
publication title The crystal structure of the hyperthermophile chromosomal protein Sso7d bound to DNA.
pubmed doi rcsb
source organism Sulfolobus acidocaldarius
molecule tags Dna binding protein/dna
total genus 11
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 1998-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02294 7kD_DNA_binding 7kD DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1bnzA00
2K01A 3DM1A 4DN4M 3SVMA 1G6ZA 1ILQA 2HCCA 1E0BA 2KEEA 2M2LA 2H1EA 3KUPA 4XT3B 5COYA 1HRJA 1M8AA 2X6LA 2R3ZA 1QE6A 2B2WA 3P7JA 5T1GA 4ZKBB 1RJTA 1EIGA 2EE1A 2KVMA 4U68A 1O7YA 1IL8A 2Q8RE 2NZ1D 5T1IA 2FJ2A 1U4RA 1PLFA 1VMCA 5E4WC 1X3PA 1WTQA 1XX8A 1MI2A 4O42A 4CJ1B 2B2UA 2HDLA 1U4LA 5D14A 2B2YC 1EL0A 2FMMA 3FPUB 4R9WA 1Q3LA 1JE4A 1QNKA 4X3KA 1EOTA 2B2VA 1HFGA 4IUUA 3KBXA 3HP3A 2B2UC 4ZAIA 3GV6A 4XT1B 5EPJA 5EQ0A 1J8IA 4QUCA 5E4XA 1CA6A 2NYZD 1SDFA 3I91A 2FINB 5EPLA 4X3SA 1O80A 4MN3A 2B2VC 1KNAA 1B4OA 1G2SA 2IL8A 1WTVA 2DY8A 2VXWA 3I3CA 1WTOA 1DONA 3N52A 2B2TC 1C8CA 2L11A 2XIWA 4HAEA 2K03A 2K1BA 1EIHA 1RHPA 1HHVA 1O7ZA 2EPBA 3G7LA 1A15A 1PFNA 2B2WC 1SSOA 2FFKB 2J7ZA 2X69A 1PFBA 4HEDA 1F2LA 1CM9A 1HFNA 1NCVA 2JYOA 3ONAB 1AP0A 1RTOA 2X6GA 1RTNA 1TVXA 1IKMA 4ZK9B 5EJWA 4IURA 5JJZA 2RSNA 3LWEA 1B3AA 2FHTA 2KOLA 1SAPA 1ZXTA 2L12A 2RVLA 3Q6SA 4RWSC 2N55A 1WTRA 2SDFA 1AZQA 1G2TA 2K05A 3I90A 2KEDA 1U4MA 1MSGA 1NR4A 2DY7A 3F2UA 1IKLA 1BNZA 1DOLA 2RA4A 1S4ZA 2KUMA 2Q8TA 1WD0A 5CBAE 4MHEA 3DEOA 3D6WA 4OIKA 3TN2A 1B50A 4RA8A 1WTXA 1DOKA 3R93A 4LMQD 2CVRA 3MWYW 1ICWA 1X3QA 4X3UA 3TZDA 4ZKCB 3UI2A 3GV3A 1B53A 1KNEA 2KECA 2MGSA 1WTPA 5CORA 1B2TA 1G91A 1BO0A 1NAPA 1WD1A 2HUGA 1ML0D 2BDNA 1ILPA 4OIJA 4XDXA 1U4PA 1X32A 3I8ZA 4CJ2C 2MP1A 1F9QA 2K04A 1RODA 2HCIA 2MJ8A 1F9PA 2NWGA 4IUQA 1VMPA 1LV9A 5EKIA 1DZ1A 4IUPA 2HDMA 2RSOA 5CBEE 2JP1A 3H91A 2L4NA 2L9HA 1BF4A 3QO2A 4IUTA 4HCSA 4HSVA 1HA6A 4RAUC 1PFMA 5AFWA 2D9UA 1PDQA 4NW2A 3IFDA 1ESRA 1MSHA 2B2YA 4UAIA 1WVLA 1CA5A 1WTWA 5DNFA 3FDTA 1XYIA 1MGSA 4CJ0B 4X3TA 2L1BA 5EPKA 4ZLTF 1DOMA 3MTSA 5D65A 1JICA 1EQTA 3IL8A 2MPMA 4R8IA 1NR2A 1AZPA 5CMDA 1GUWA 4IUVA 1F9SA 3DEPA 2K28A 1HUNA 1J9OA 2EOTA 2N88A 4QUFA 1BBXC 1HUMA 1F9RA 2B2TA 1QG7A
chains in the Genus database with same CATH superfamily
2CCZA 2OTJA 2HCCA 5D3DA 1O7IA 1E22A 2R3ZA 1WFQA 4N8X1 2OF1A 3NQTA 4PMBA 2VQFL 1EEFD 1CKOA 4LFBL 3T53B 1PRTC 4V0BA 1N36L 1KAWA 3I4LA 4KY7A 2JA7H 2HQEA 1SNDA 2KHIA 4NDXA 4WJ4A 4IFDH 4F88A 1CTMA 4XT1B 1TWGH 4KD3A 3LGJA 5E4XA 3PQIA 4GN5A 3VYUA 5EPLA 1K8GA 1KC8C 4QIWE 2A8VA 2VXWA 5EGTA 1OTCA 4O0AA 3BVMA 4DAYB 1T9HA 2RCFA 3BYTB 1KRTA 4P75A 3CPWA 1O7ZA 3M4YA 1EY4A 4N9TA 4C3HG 3GDEA 1K3RA 2Y0SG 4LF4Q 3W1GA 2Z4IA 4XQJA 1HR0W 3CC4A 1HQMC 3PCOB 1F2ZA 1PZID 1JOKA 4DV0L 4DV6L 1QUQB 1GKHA 3RZDH 1JJGA 3FPPA 2OQKA 3HKSA 5GAGC 1UEAB 4IO9A 3TS0A 1WTXA 4Y7NH 3P75A 4A3MH 3QOLA 4IPDA 1VQ7A 1YHQA 3MA2B 2UU9L 1QNUA 1R9TB 2BA0A 3GV3A 1B1ZA 4FXGC 3F8TA 1C48A 4H44C 4Q5VA 3CCVA 1Z9FA 3AFPA 2XRSD 1M90C 1XWEA 1Q81C 4LWCA 4K8IA 5M3FH 3CC7A 2EY6A 4UP8A 4O1NA 4FVMA 2RSOA 1VQMA 4QIWB 2OTLA 1PXUA 2RBMA 2PZTA 1IW7C 4LNQA 3M9BA 1V1PB 3IFDA 3MHBA 1WCMH 3KLWA 1GOZA 4DR6Q 3HOUH 2R93H 3HOYB 2PQAB 4GLAC 4PMWA 1DOMA 4G7ZC 2PZWA 1L0XB 2ZT9C 3MC0B 1EYCA 5FLMG 1N32Q 1X3EA 4L63B 1XMOQ 1HJPA 2P5ZX 1UE7A 3SVMA 1X65A 3T1YL 1N33Q 1IYJB 5COYA 1S5DD 2OEOA 1TY2A 3HZXA 2KENA 1Q86C 1EIGA 1CK1A 1YJ9A 2EY2A 5IODA 2DJGC 5JVG3 2NVXH 2G5DA 1X3PA 3OSOA 1MI2A 2AQ1B 1DM0B 1A62A 1Q3LA 5C0XH 4X3KA 4JOIA 4B3MQ 2YTXA 2B2UC 3ICEA 3QIAA 4G4KA 1PYWD 1X3FA 2QKIC 4C3HB 1VQKA 4RGTA 4A3JG 3JAME 4K14A 1I50H 4L8JA 4MZ9A 3PO2H 1LTID 3S15H 5EBDA 3G7LA 1XJVA 4A3CG 1G8ZD 1SYDA 4DR1Q 1I6HH 1TS2A 4OXPA 1LTGD 4DV2L 5A35A 2LFNA 3I4NH 2CWPA 3MFYA 2A6HC 4ILWA 4FYDA 5I6YA 1IZ6A 1PTOH 4J8QA 1ZXTA 4NKLA 4B3TQ 4F7XA 4AQYQ 1ASYA 4GOPB 1IBMQ 4XQNA 2RA4A 1I6VC 4JOIC 4KI0A 2K32A 2QDBA 4TVAB 1HNXL 1EEID 1PRTB 2JA6H 2ALYB 4OIKA 2NBFA 1D1KA 4P73A 3S16H 1PZJD 4JI3L 5I4DA 2DNCA 1RD9D 2PNHA 3GP7A 1EU3A 4ZYSA 3U9OA 2A1AA 4HCEA 3RNUA 1EFID 5CORA 3S2DB 3DLLA 3J80L 4IUQA 1FJGL 1F9PA 1VMPA 4FF1A 1OXUA 2F0MA 3KJPA 1I94L 1I5FA 1NUCA 2KQ3A 3E6ZX 1A3TA 2A68C 2L9HA 4JI0L 3ND8A 2D9UA 4NW2A 3F2DA 2Z6BA 3K57A 4Y52H 3FDTA 1EY7A 1SNMA 1X55A 4RCOA 3BZKA 4JI2Q 2RKSA 3D3RA 5IGDA 4HIKA 1TS4A 3EJIA 5CV7A 4X66L 4A3BH 5D65A 1PH2A 1I4RA 1BBXC 2JA9A 4DK6C 1SXTA 3GTQH 2UXBL 2IY5B 1N34Q 4LF9L 4NXNL 1KLUD 4FNFA 1TXYA 1UAPA 4DV3L 2B2WA 1HR0L 3A7AB 1TWHH 4KKUA 2NTSA 1FGUA 3OMGA 3ITPA 4L5QA 2QCPX 3T16A 4DA2A 2JA5B 3ZYYX 4DV4Q 2ATWA 3K6OA 4R1JA 4PV1C 5D14A 1Y1VG 2F0KA 1ZEQX 1NNXA 4DK0A 3I56A 1ENAA 2K5VA 3JAMc 4GKJQ 1STNA 3PUXA 3EQLC 3NELA 1L1OA 3PO3G 1R4PB 2F0DA 4OX9Q 1UNSA 5C4JH 1DJRD 1SNCA 2J7ZA 2B2WC 4PQXA 4LW1A 2L0CA 2VZAA 2EXDA 2ZJPA 4HJ7A 4NB3A 5JJZA 3TRZA 4EQOA 4RWSC 2EQSA 4C2MB 1IBLQ 3CQZH 3M3YH 3LWUA 5ISRA 1WTRA 4A3IG 4C56C 3M7NA 2E2JB 3TQYA 4A3GH 1B3QA 4B3SL 3EROA 1SMXA 1V43A 1S40A 1JE5A 5JEAJ 5CBAE 2RHQB 4MHEA 4YWLA 2D2CC 4LF6L 3CF5A 2ASBA 3KYHC 4YHHL 3NTKA 2EYHA 3R93A 3F2BA 5C44G 2K5HA 5FLMH 1ICWA 1YI2A 1L1OC 3TZDA 1VF7A 4ABNA 1A2TA 2VY3A 2EVBA 2J4XA 1SYGA 4JBJA 1TWFH 3JAMi 1SNOA 3S1RH 4DXFA 1E2WA 1Y8NB 4X65Q 1TY0A 4YIJA 3GTLB 4UDUC 4K2KA 1HNWQ 1MSHA 3Q24A 1I3QB 1ONLA 4ME5A 1QJOA 5FOBB 2JK8A 4CJ0B 4M1UB 2K52A 1B8AA 2IT1A 4KHVA 3I7FA 5LL6X 3VYRA 4DNRB 3OW7A 2G9HD 3ND9A 4YWKA 3L0OA 1YNJD 1X56A 4HN7A 1E0BA 1CKNB 3TZUA 4XT3B 3VYSA 1C0AA 1D5MC 2UXCQ 4KKTA 4A3CH 3RZOH 2YU9B 3NQIA 5J3BA 2HHHQ 4KV6A 4DV1Q 2UXDQ 2Q8RE 4XYOA 2NZ1D 2BCOA 5KIXA 1K8OA 4PMCA 2ZXPA 2MFIA 2E76C 3FPUB 1PVOA 2ZM6L 1QNKA 4IZ8A 1EOVA 3NBHB 2CQAA 4BBRB 1EYDA 3H6MA 4LAAA 2ZXRA 2FXQA 2XSCA 1SFOH 2NYZD 3BYYB 4N9PA 2F0TA 1WTVA 1WTOA 1IYVA 4K0KL 3BDCA 2K03A 2WV6D 2F4IA 1NMGA 3MXNA 2Z4HA 2EPBA 1STEA 5M5XB 1LTAD 1HZCA 2EDGA 3SEBA 1NCVA 1D1IA 4Z9CB 5IYDH 3HOXG 1S5BD 4C3JH 2Q2HA 1BBUA 1Z6HA 1KD1C 1IXRA 3GTGH 4JV5Q 1K28A 1SNQA 1U4MA 3U4VA 2WAQG 3ULLA 1PYSB 4L6TB 1Z47A 1PMRA 4MTNA 4DR2Q 1AW7A 4G7OC 3DEOA 5LMUQ 2R92H 2HIVA 4IUNA 1GO3E 1BUVT 1DOKA 1VF5C 3G6EA 4KJOA 1I4PA 2IPKD 1W3SA 1PA6A 1TWAB 4A3EH 3T13A 3I4OA 4KK7A 2BDNA 4QY7A 1RF2D 2A6ED 4JBWA 5AJ3L 2JA7G 4YY3L 3EBEA 5M9OA 2K04A 1HH2P 3FKIG 5C3WA 3I2ZA 4GKKQ 4JYAQ 3TP8A 3UDXA 4DAYA 3QO2A 3GTPH 1XPUA 3BDLA 5JEAH 1JOOA 5AFWA 1D8LA 2A19A 1RIPA 3G4SA 3CXCA 2K75A 4MTKA 4K8JA 4A3FH 1MBYA 2WAQE 4CBVA 2MPMA 1FGBD 1XTCD 2SNMA 1QILA 3K7AB 4DU9A 3S2HH 1GUWA 1KDCA 3DEPA 2UUCQ 2BH2A 3J81c 2F0EA 1QUQA 3NK9A 3PO3H 1JMCA 1F9RA 2F0PA 2WINB 4KD4A 1UE5A 2EYPA 4BY1H 1YHAA 4JI7L 2PI2E 4H13C 3QJYA 4TSSA 5BR8Q 1WYDA 1EY8A 2OXPA 4R4CA 1X3GA 2RDHA 3FRPB 2IWHA 4KHPQ 3S1QH 1DGSA 2HDLA 3FVQA 4O2DA 1EL0A 1QVFA 1CZWA 4A3MG 2XRQD 2N49A 1QOHA 3KBXA 1X6OA 4ZAIA 5DEHA 4NMZA 1FR3A 4ID6A 4CKCA 3M85A 5C44H 3FMCA 1CQFA 1V1PA 3IKJA 1CUKA 2JN4A 1F77A 1STYA 1O78A 3EN2A 4HSPA 5M3FG 4I65A 2PQAA 5KGUA 1EY9A 5ELEA 1XPRA 5ELDA 1Z7TA 1PFNA 1PHJA 2WAQB 2N78A 2K50A 3PSIA 3SE0A 1WCMG 1JB3A 2F4VQ 2R93G 1K0RA 4IURA 3TSSA 5IGCA 4WJWA 2VUMG 5JVH3 1YJWA 1HNZQ 2SOBA 1SROA 3W5OA 4FXDA 2HIXA 2CH4A 4JI4L 3DWPA 1MJCA 3MZ5A 2MO1A 4YCWA 4DV7Q 3CKIB 5M5WH 4R8NA 1CI3M 4ZKCB 1D5ZC 3STBD 5I9PA 4X64Q 4U673 4JI8L 1WTPA 2RDGA 2A74C 1TWGB 4BS9A 4EQ5A 1ILPA 1GHJA 4TRDA 5H1SE 5C3EH 1F2MA 4DXGA 4DUZL 5EKIA 3RLFA 4C3IG 2PZUA 5C0XG 2IJ0A 3UDIA 5HGTA 5KYIA 1A8VA 1LTTD 3DUZA 4DFAA 5GAHC 1PFMA 4DNIA 4IJHA 4ALPA 4FXKC 2EY5A 4BY7B 2CKZB 1PH7A 4OO1I 2NB0A 1F9SA 1ZYRC 3SGIA 3O13A 1V1OA 3RZDB 3H3VC 2KVMA 4GOPA 1OXVA 1JT8A 5FO9B 3I4NG 1Y1WH 5JJKA 1HRJA 4AIMA 4Y7NB 4A3MB 5CC4A 1JWUD 2ID0A 2I0QA 4NP5A 4EQNA 2EE1A 2A6EC 2F0SA 3KDFB 1STHA 1IL8A 2BE5C 3HOXH 1LTRD 1GM5A 1VQBA 4AH6A 1XX8A 3IAYA 3OIPA 2JA6G 2VQFQ 2VW9A 2CW0C 2XGTA 1C4QA 2KCNA 5M3FB 1N36Q 3OTOL 1HFGA 3SXHA 4CDCC 3KK7A 1L0WA 4MN3A 1WCMB 3HOUB 1KAAA 2R93B 4L5SA 2PYKA 2E2IB 1L0YB 4GOPC 4BBSH 4X62L 3PIO3 4KTAA 1B9MA 4QQBX 3FKIH 2JYOA 1UUPA 4IOAA 1GUSA 3Q6SA 4A3BG 1CQVA 2F0GA 2K05A 5KEEA 1XMQQ 2NVQH 3LX0A 3C46A 5I6WA 2QEXA 2V1CC 3PGZA 3SK5A 2NVXB 4DV6Q 2WKCA 3AEVA 1PH5A 1LTBD 3MEHA 2ZXOA 1Q12A 3BG3A 3C1EA 1ICFB 3KF8B 3KLRA 1B2TA 5C4XH 1JB7A 1EQRA 3S1MH 1NBWA 4XDXA 5GROA 2IHEA 2ZTCA 2UU9Q 1HPCA 3HOVH 1I50B 4DK1A 3CRKC 3EIVA 2JQOA 2JE6I 3PO2B 2MQHA 3S15B 4YCUA 5HY6A 2DJFC 4UHVA 3E0JA 3A55A 2NVTH 3NENA 2E2HH 3ER0A 3QG1A 3L7ZC 3CP0A 3AU7A 4IJLA 2KHSA 3TP6A 4GZYC 1AZPA 4HIDA 4IUVA 4APVA 4C1NK 3UE0A 1J9OA 1HZBA 3NTHA 2L5TA 1SRUA 1ASZA 2JA6B 1KRSA 1E2ZA 3K0XA 2D5DA 2F3VA 2Y0SE 2AWNA 2L55A 4LF4L 4B9WA 4EQPA 4GNXB 4U68A 4A3GG 4LF8Q 1PLFA 2VQEL 4FO2A 2B2UA 2KCMA 4EGVA 3W3AA 4YWMA 2VUMH 1ET9A 1KDBA 1X54A 1I4GA 3TDQA 4KN4C 1QVCA 4DF7A 4LF7Q 2K14A 4BWGB 1KNAA 2R7DA 1B4OA 2YV5A 4JI1Q 2KCCA 4KHZA 5CV9A 4DGZA 2EYLA 2AKWB 3S9WA 2F0JA 4LF5Q 4A3BB 2N8NA 1XPOA 2FFKB 5IT9L 3GTQB 3R3OA 1M4VA 3SDZA 1VQ6A 1RTOA 4C3IH 1RTNA 1TVXA 4IPCA 1BCPF 1CKNA 1GUOA 4DR6L 1U9RA 3J80E 2Y0SB 4RFBA 1KQSA 3Q8DA 3C3LA 2WKDA 5KYLA 3TP5A 1YIJA 2CVRA 2YTYA 1HNXQ 3NBHA 3PUWA 4MIUA 5A2QL 1KNEA 2ZJRA 1OXTA 5IE8A 5M3MG 1J5EL 5BN4A 4JI3Q 2E5LL 1D7QA 2MP1A 4HMJA 1OXSC 2K7VA 1SE2A 3BVZA 2R7ZG 2O2LD 2F0WA 2F0VA 5C4JB 4IUTA 1GJXA 3J7ZC 1EFWA 4G7HC 1QB5D 3NWTA 1I94Q 3GTKH 1D6EC 2JSOA 1V9PA 2O4XA 2L1BA 4JI0Q 4ODGA 2XVSA 5K36H 2K6AA 4R8IA 2CWAA 3CQZB 3S14H 3M3YB 1R9TH 4G57A 1VQDA 1HUMA 3IRBA 1NY4A 3Q23A 3HOZH 2Q8IB 4A3GB 4X66Q 1H9SB 1EQVA 2K01A 1SEBD 5C5LA 1VQIA 5CV4A 1NMFA 4BA1I 5IYDG 4A3DH 4A93G 1M8AA 3P7JA 4C3JG 2UXBQ 1K3BC 4K5WA 3MVVA 3PF4A 4OO1G 4H0LC 1LTLA 3H94A 2PPBC 2N3SA 5FKAC 3CMEA 4DV3Q 3KF6B 2E75C 3CAMA 1U4LA 5CYUA 3MFGA 1QWYA 1TWFB 3NXWA 2R92G 1QVGA 3RUZA 4P72A 2NN6I 4PG3A 4CKEA 3NSWA 4QUCA 1ENFA 1SDFA 4A3EG 2FINB 1AEXA 5L37A 3PIP3 2IL8A 3K80C 2IW3A 4JI5Q 3H0GH 1EIHA 1C7YA 5IWAL 4LFCL 3PUZA 1E1OA 4OEMB 3CCQA 5JEAG 4A3JB 3ONAB 3NHHA 3A54A 3I73A 2X6GA 3J80c 1LT5D 3LWEA 3WOEA 2FHTA 4A3FG 4PZ6A 2B39A 4DR7L 4LFAL 2R61A 3VA5A 1TWCB 3A5UA 4JI2L 3K5NA 1PH9A 4HTHA 4OL7A 4DAVA 2K5WA 1B50A 4BY1G 5IYBG 4P71A 4CKBA 1X3QA 4B3SQ 3PIOA 1N34L 5ELNA 4XTCS 1B9NA 3D8GA 2ZTEA 4YHHQ 2QGQA 2Z1CA 1BO0A 1WD1A 4KY6A 4GLVB 1SFOB 1U4PA 1PZKD 2M00A 2B8GA 2VB3X 1EUJA 3VR5A 3KOJA 4K2LA 2R7FA 4DV4L 3H91A 2K4KA 1VQ5A 4I7ZC 1IYUA 1YNND 4HCSA 3PMFA 4LUOA 2OT2A 3RN5A 4OHJA 4H02A 3CPFA 1VQJA 4GKJL 2F52A 5LMNQ 3IL8A 4A3LG 2VS1A 3W2DA 3F2CA 5DM73 1IHZA 3J80i 3U4ZA 4JCVE 3OWFA 2PI2A 2CHBD 2WP8J 1TIID 3OMCA 1S5ED 3KUPA 4CDFC 1MHWC 4YCVA 4L5RC 2HT1A 2WACA 3A8KE 3GTMB 2XN9C 1O7YA 2WB1G 2H5XA 3I55A 5GADC 4RGMA 4KN7C 3TS2A 4A3KH 1OXXK 4QF4A 4CJ1B 4JI6Q 1FVIA 3S1NH 1S5CD 1JE4A 3K8AA 1EOTA 4OWWB 3CCLA 1J8IA 3ULPA 5CR3A 1G2SA 1Y1VB 3UDFA 1YJNA 4OELB 5C3EG 4A3FB 1PTOD 1C8CA 4DNTB 5M3MH 1CSQA 3S2HB 1CHQD 1PFBA 4KMUC 4DPGA 3PO3B 4DR4L 2R7ZH 2PNRC 4X65L 4BY1B 4K5XA 1SN8A 2RSNA 3SK8A 2AMCB 2KOLA 1ENCA 4B3RL 4E6IA 1RL2A 2EYJA 2L15A 3D0FA 5M5YH 3KDFA 4GN4B 1WD0A 3S1QB 1EWIA 3RD4A 4OGQC 1Y1WG 3BZDB 1AE2A 4A3IB 3TP7A 1E24A 2IX1A 5JPNC 1B53A 1H9JA 1E3PA 3CCUA 1XTDA 4FF4A 4A93H 4OWXB 2CQOA 2HHHL 5C44B 1BVSA 4DV1L 2UXDL 2EXZA 4OO1H 1FYCA 4CDDC 2EJGC 1P8LA 2JP1A 2CFMA 4IALA 4DAPA 1U0LA 4FF3A 1CT1D 1HFNA 4UP7A 2B2YA 2BA1A 3D4RA 1KABA 1Y69U 3V2TA 4KJNA 4DV5L 4HIOA 3HKZG 4ZLTF 3G48A 3K0YA 3H3VI 4BBSG 1EYAA 4P2CB 5C5MA 1XNRQ 3J81L 4QGUA 1UWVA 4QUFA 2AHOB 1II3A 1YEZA 3DM1A 4HMIA 1NJIC 2BOSA 1KIXA 2FMCA 4JVZA 1PH4A 1IBKL 2I5MX 2C5CA 3K5OA 2BH8A 2UUAL 3GTLH 5LHY1 1Q46A 3BJUA 2HQLA 1GUTA 1BOSA 1TQOA 3I70A 1I3QH 1VMCA 3KF8A 5E4WC 3T4AC 5C3EB 2B2YC 3GD7A 1E2VA 4DR2L 3V05A 2F1MA 5LMUL 5IYBH 4X3SA 1VCIA 1JWSD 4ZUIA 5C4XG 2B2VC 1MKHA 3OOCA 3R8BA 3HOVG 4DUYL 3CCSA 3HG9A 4AYBG 3WOFA 3HOWH 1SNPA 5IP7H 5KNDA 3M4OH 4WJ3M 5IGGA 1EIFA 3GTOH 4H7BA 2IX0A 1Y1WB 1W2BA 1EQQA 3AMUA 2F0IA 4BBRH 1JWMD 4DR3L 1IKLA 3T1HQ 4GNXA 3CD6A 3PIPA 1SE3A 4DAMA 4HJ8A 1QZGA 3HOXB 2QEJC 4A3LH 2E74C 4LUVA 3A5ZB 1EY5A 2YYZA 4JI4Q 1YNJC 2RQXA 3Q22A 3UDGA 1HZAA 2MGSA 5EKLA 2DUDA 5M5XH 4IFDJ 1N8RC 1X32A 1PTOC 4AYBE 5BR8L 4JBKA 1DZ1A 5K5PA 2HDMA 3GQBA 4BBSB 5CBEE 3NBIA 2TSSA 3CCRA 4RAUC 1LACA 2JA7B 5JJLA 4UAIA 4FP5D 1CA5A 5IP9H 1T5XD 1XYIA 3FKIB 1LLRD 4GNXC 4X3TA 5IIFA 5IYCH 2WIIB 5FK9C 1JICA 1EQTA 1PRTF 3M7GA 2NVQB 4PZ8A 3RLNA 2B63H 1FNUA 4IPGA 1LM0A 1FNWA 4R4IA 1LO5D 2F03A 4HIMA 2NZHA 2KCTA 4QCLA 3G6JB 3R2IA 2JA8H 2YTVA 1SE8A 5FLXL 5C4ZA 4FF2A 3S1MB 1IW7D 4XIGS 4O42A 3NPPA 1HNZL 3U50C 1XNQQ 3HOVB 1L2FA 2CH4W 2KBNA 1BKBA 4IPHA 1G291 4AYBB 4OONA 4ZRZA 1RKNA 4DV7L 2NVTB 3NUCA 2E2HB 1LUZA 1K83H 3B6YA 3R2TA 4X64L 2EIFA 3N52A 5KRUA 3VDYA 2R6GA 1RHPA 2QILA 3T56B 4WFN3 1F2LA 1PH8A 2K33A 2GN5A 3VR2A 4X62Q 2GVBA 5BN5A 1GVPA 4LFBQ 3JC66 1H9SA 1GHKA 4KLKA 5F2DA 4IQZA 4M8AA 2SDFA 5K36G 1D5XC 4DR5L 4NXML 1STBA 3AQQA 3VR4A 4JW0A 3L9AX 3HOZG 4I7AA 4QJFA 2UUBL 1A3VA 2XNAC 3KF6A 3X3NA 1Q8KA 4A3DG 2VUMB 2K5DA 1EWCA 4JK1C 4A76A 2LXJA 3K59A 1WTHA 4DK3C 2KECA 2OQ0A 1NAPA 1DCZA 4RGNA 3VR3A 1F9QA 3DWQA 3V96A 3FP9A 4V190 3HOYG 5E3FA 1PH3A 2L4NA 2A6HD 3NEMA 2EJFC 5CMDA 3MAQA 1G6PA 1EY0A 3VA7A 2BDOA 4DV0Q 1GUNA 5G3LF 1WJJA 1CHPD 2M9VA 2NVYH 4RKLA 5IY0A 1FD7D 4LK1C 4RHRA 4C3IB 1S72A 2D62A 3H0GG 3J7A5 1PH1A 4JC0A 1HUNA 3HRZC 2KJXA 2EOTA 2HD3A 2DGYA 1BR9A 1G6ZA 1B7YB 1A2UA 1EWHA 2X6LA 2NN6H 1QE6A 4ULLA 1Q90A 3I4MH 4RCNA 4FDBA 4JPBW 1HTPA 5J1ZA 2RF4A 1Q1EA 1I6HB 1MIUA 2A68D 2D0OA 2LXKA 1JQYD 3EVQA 3VR6A 3I4NB 3EA6A 2KA7A 1STGA 4BY7H 1XMQL 3QB3A 4R9WA 1PTOB 3OWEB 4R4TA 1TT2A 3GTJH 1W6JA 2ES2A 5IT9E 2XWJB 3A7LA 2VQEQ 1UE1A 5EPJA 1CA6A 5EBCA 1BCPD 1EIYB 1VQLA 1O80A 5CV8A 4OWTB 3S17H 3GTKB 5LL6S 3I3CA 3STBC 3S16B 3Q0AA 1Q7YC 3DHQA 4HAEA 4ZCKA 2F3IA 3T1YQ 3E0EA 1KL9A 1HHVA 3S14B 2X69A 5DLQE 1JOQA 1H9RA 3HOZB 3M4PA 1AP0A 1IKMA 1W6KA 1NE3A 4A3DB 1PYBA 4A75A 2L12A 5CGKA 5A2QE 1PV4A 3E9IA 4DKAC 1FL0A 2Z8LA 3F2UA 5I9OA 4F87A 1SE4A 3QOJA 1KHIA 1VQCA 1S4ZA 2Q8TA 1Q8IA 3NP8A 4RA8A 5JPMC 2E2IH 1IL2A 4GN3B 1YBYA 3UI2A 4CGYB 2PW7A 1G91A 4Q0FA 1UE6A 1STAA 1ML0D 2HUGA 4K6DA 4R4OA 3D4DA 2PMZE 3CCEA 1RODA 4A3KG 3NE5B 3BU2A 4J1MA 1GD7A 3PF5A 1TWHB 4DV2Q 2AQ2B 3HFZB 4LF8L 3H0GB 1J5EQ 1X9NA 3QR8A 5ELBA 2E5LQ 3M4QA 2GVAA 3ERSX 1PDQA 4K5VA 4HJ9A 2LY7A 5JOBA 1N32L 4B9XA 1Q1BA 1V1QA 1XMOL 1YITA 1KTKA 3E3XA 4LF7L 3MTSA 1A6XA 2F0HA 3KLSA 1N33L 1S5FD 4JI1L 2K28A 2SNSA 5I2YA 1I4XA 5LMNW 1HA6A 4LF5L 2JA5G 1HA5A 4CDEC 1BDOA 4EX5A 1VQAA 4UP9A 3CW2C 3S24A 1FJGQ 3T51B 2RCNA 1EU4A 4B3ML 4LUZA 3OW2A 5IT9c 2QW7A 1WTQA 3SR1A 3A56A 2B29A 2XTIA 4UY8C 5GAEC 4IUUA 2PMZB 2NTTA 2IX3A 3HP3A 1VDZA 2A69D 4POGA 3D31A 1VQOA 2F0NA 1HQRD 4IOCA 2DY8A 4DR1L 3K7UC 2K1BA 4LF9Q 4NXNQ 1H9MA 1EZ8A 1FNVA 2XWBB 4IFDI 1HR0Q 2J0TD 2LMCB 4B3TL 2Z6KA 2AWOA 1AFPA 4AQYL 2LS01 3HOYH 3S1RB 1IBML 1XXGA 5EJWA 3VYTA 5IWAQ 4LFCQ 1B3AA 3HS0C 2RVLA 3JAML 2N55A 1JJCB 3I90A 1NR4A 4B08A 2G9DA 1VQHA 4BXXG 5FJ8G 4DR7Q 3KJOA 4LFAQ 3MEFA 2I5LX 2TMPA 3MXGA 4A3KB 3E9HA 1RDPD 3HEJA 2IHFA 1VS0A 4LMQD 3S1NB 1VQFA 4X3UA 4LJZC 1BCPC 3PUVA 3TEHB 1B70B 3NWSA 3NTIA 3TREA 1LABA 4HJAA 1K0SA 3FHWA 3K81C 4KY5A 3A8IE 2PO4A 2HCIA 5FO7B 4C1NI 3H3VH 2Z6KC 4IUPA 3RZOB 4GS3A 5M3MB 1SJHD 5CV5A 5JAVA 4C3HH 3MXUA 1WVLA 3SHLA 1Q82C 1P16A 2I5HA 2R7ZB 3CC2A 3DMUA 1Y8PB 5EPKA 1VQ9A 3W1BA 4HR7B 4LF6Q 4RHSA 2LKVA 2EZVA 2N88A 4JI5L 3HOWG 3SK4A 5IP7G 1HTLD 3H15A 5M5YB 2KEEA 1A0IA 2Q2TA 4ZUJA 1RJTA 4BBRG 3BDOA 4QL5A 1B44D 5J22A 1AN8A 2FJ2A 3AYHB 4A93B 1SYBA 2NZOA 3H09A 2D0PA 1A3UA 4C3JB 1KLGD 3GTGB 3OYYA 4XQQA 2SEBD 5NUCA 3GV6A 1G51A 3S2DH 4OX9L 5FO8B 3U58A 3KBGA 2R92B 1A63A 2O5IC 4A4IA 1DONA 2QDLA 5E7NA 3OHXC 5C0XI 4TQUS 1KDAA 3WDNA 1A15A 1GXDC 4S3SA 3RMHA 4A3EB 2Z0SA 1IBLL 4HEDA 2Q2UA 1CM9A 3P20A 1HCZA 5CV6A 2RHSB 2MO0A 5IP9G 3KLSX 1EZ6A 3AFQA 1ET6A 5TSSA 3J7AF 1SAPA 5IYCG 2AUJD 1G2TA 1K9MC 1YVCA 3GTPB 4DR4Q 1HXYD 2DY7A 1BQQT 2AQ3B 2ZM6Q 1YNXA 5LMNL 2EYFA 2B63G 1TS5A 4B3RQ 4K6LA 3BS1A 3OPOA 2A69C 1H9KA 3L3OC 4R4QA 1WOCA 1JORA 1M1KC 2JA5H 4K0KQ 2JA8G 1SBBB 2VNUD 3URYA 1I4HA 3TBIB 2JXMB 4A3JH 4CJ2C 4P74A 1VQEA 2WB1E 1HNWL 1RCVD 3IFTA 5C3XA 3J81E 2A5HA 5I2XA 4JBMA 2GA4B 1BF4A 1TWCH 4J6HA 4JI6L 1DXMA 2F0OA 3HOWB 2MHVA 1KXLA 1WTWA 5DNFA 3P1HA 2JEBI 3M4OB 1JR0D 1MGSA 5DM63 2I07B 3GTOB 1N9WA 2PW5A 1SR3A 3I72A 1SJED 3A8JE 1I4QA 4CHTB 1WI5A 2UXCL 4DV5Q 1SMYD 4KKSA 4DN4M 1LTSD 2H1EA 2ZJQA 4C2MH 1LYLA 4RKBA 3CCJA 4NPSA 5AJ3Q 4YY3Q 3KFUA 2E2JH 1AE3A 3C2PA 2EY1A 3K58A 2F0QA 3J7YW 1ZKOA 3L2PA 1BCPB 3D6CA 3E5SA 4PZ7A 2NUCA 5T1IA 1U4RA 1CZGA 4N8FA 2I46A 4J15A 1IBKQ 2DN8A 4IN3A 2C9OA 3OIQA 2UUAQ 2H4OA 2FMMA 4RMFA 4GLXA 2B2VA 1NTGA 4QB4A 3G71A 3CHBD 4BXXH 3X3MA 2MUYA 2WB1B 5FJ8H 5EQ0A 2JJQA 2MNAA 3K5LA 1SYFA 4XYQA 1PTOF 1D2BA 4RGOS 1ZYRD 2EJMA 2WFWA 5IOCA 3UE1A 3PUYA 3AB9A 3DM3A 1EY6A 2L11A 3WWVA 2K5NA 5M5WB 5IGEA 4JI7Q 3FEWX 1O7LA 1VQGA 3GTMH 4TKOB 3CU7A 2ZTDA 4JV5L 3A0JA 4PNYA 5D3IB 4X6AH 1K8MA 4DUYQ 2B63B 2BE5D 1YNNC 1CKMA 1T5EA 1E7ZA 2C35B 1R4QB 4UPAA 2KEDA 2F0LA 3HKZE 2CW0D 2ENBA 2KHJA 1VQNA 3CMAA 1BNZA 4EVOA 1DOLA 1SYEA 2JA8B 4IFDG 4XXEA 3CRLC 2ICEC 5BN3A 1AH9A 3TN2A 1Y1VH 1XNRL 2QA4A 4DR3Q 2YU9H 2NN6G 5HURA 5HGQA 1Y8OB 2QF7A 3I4MG 4GKKL 4JYAL 2Z9HA 5E1FA 1TKWB 2Q2IA 4OIJA 1PRTD 3LNNA 3CCMA 3RN2A 1K73C 5C4HA 1K8AC 3DXJC 5IGBA 2VL6A 1K83B 2LSSA 4BY7G 3DWAA 5ELFA 4RG1A 4HSVA 1BBWA 1L1OB 5C6AA 3K5MA 2UUCL 1JCKB 4QMGA 2K5QA 4A3IH 5FLXE 1HZ9A 1DYQA 1SLJA 4WRDA 5KNBA 2JEAI 1SYCA 2AUKA 2PQEA 1E1TA 1LT4D 3GO5A 2B2TA 4ZQ3A 1QG7A 1UEBA 3HKZB 3TMEA 4HJ5A 1ILQA 2M2LA 4JI8Q 1LT6D 4KHPL 5T1GA 3BVGA 3ZJYC 4ZKBB 4DUZQ 3J81j 3RLOA 1VQ4A 1EYGA 2O5JC 3HGBA 1S3OA 1H95A 3T1HL 3HOUG 1JC7A 4JG2A 3J81i 2PCFB 1QZHA 1MD2D 2F0UA 5ELCA 4POFA 1TWAH 2E2DC 2EYMA 3D4WA 2VB2X 3I91A 2OCEA 4MNOA 3SK6A 2A73B 2NVYB 1GUGA 3F1ZA 5J39A 2B2TC 1TR5A 2XIWA 2B3GA 3QWNA 4F8MA 2F4VL 1C9OA 1F2YA 1YZ6A 1MJEA 1SSOA 1SMYC 5C4XB 1PFSA 5IGFA 2DNEA 1LT3D 4ZK9B 3K7AH 2E8GA 5JJIA 1AZQA 5DAUA 2V4DA 1J6QA 1CSPA 3N6RA 4RH6A 5EAYA 1VQ8A 3I4MB 1MSGA 1TU2B 5ELOA 3U9SA 5KNCA 3OTOQ 2KUMA 1CFMA 3D6WA 1YHBA 4DR5Q 4NXMQ 3MXPA 3MWYW 5G3LD 1VQPA 1V8QA 3GTJB 3RR5A 2UUBQ 3PO2G 1DD2A 1Y14B 2EYOA 1NSNS 3I8ZA 1U5KA 4ME3A 3S17B 2MJ8A 2NWGA 4WORA 4L5TA 1PH6A 2RDFA 1LV9A 3BZCA 4BA2I 1ESFA 1ESRA 3A74A 1TS3A 5EKKA 1XNQL 1OO9B 5FLXc 3J7AV 5GQOA 1JJ2A 3MXNB 3ERQA 2ICIA 1BXTA 1NR2A 3ULJA 5C0XJ 2OWOA 1QCBD 2F0FA 3EFXD 2F3WA 3PV0A 2B8FA 3C1FA
chains in the Genus database with same CATH topology
2HCCA 5D3DA 2R3ZA 2OF1A 3NQTA 4PMBA 1EEFD 3T53B 1PRTC 4V0BA 3I4LA 4KY7A 2HQEA 1SNDA 4NDXA 4IFDH 4F88A 1CTMA 4XT1B 4KD3A 5E4XA 3VYUA 5EPLA 2VXWA 5EGTA 3BVMA 3BYTB 1O7ZA 3M4YA 1EY4A 4N9TA 4C3HG 2Z4IA 4XQJA 1HQMC 1F2ZA 1PZID 1JOKA 3FPPA 1UEAB 1WTXA 3P75A 3QOLA 3MA2B 1QNUA 1R9TB 2BA0A 3GV3A 1B1ZA 4FXGC 1C48A 4H44C 4Q5VA 2XRSD 1XWEA 4K8IA 2EY6A 4O1NA 4FVMA 2RSOA 4QIWB 1PXUA 2RBMA 2PZTA 1IW7C 1V1PB 3IFDA 3MHBA 1GOZA 3HOYB 4PMWA 1DOMA 4G7ZC 2PZWA 1L0XB 2ZT9C 3MC0B 1EYCA 4L63B 3SVMA 5COYA 1S5DD 2OEOA 1TY2A 3HZXA 1EIGA 1CK1A 2EY2A 5IODA 5JVG3 1X3PA 3OSOA 1MI2A 2AQ1B 1DM0B 1Q3LA 5C0XH 4X3KA 2B2UC 3QIAA 4G4KA 1PYWD 2QKIC 4C3HB 4RGTA 3JAME 4K14A 4L8JA 1LTID 5EBDA 3G7LA 1G8ZD 1SYDA 1TS2A 1LTGD 5A35A 2LFNA 3MFYA 2A6HC 4ILWA 4FYDA 5I6YA 4J8QA 1PTOH 1ZXTA 4NKLA 4F7XA 4XQNA 2RA4A 1I6VC 4KI0A 2K32A 2QDBA 1EEID 1PRTB 4OIKA 2NBFA 1D1KA 1PZJD 5I4DA 2DNCA 1RD9D 3GP7A 1EU3A 4ZYSA 3U9OA 4HCEA 1EFID 5CORA 3S2DB 3J80L 4IUQA 1F9PA 1VMPA 4FF1A 1OXUA 2F0MA 1NUCA 2KQ3A 3E6ZX 1A3TA 2A68C 2L9HA 3ND8A 2D9UA 4NW2A 3K57A 3FDTA 1SNMA 1EY7A 4RCOA 2RKSA 3D3RA 5IGDA 1TS4A 3EJIA 5CV7A 5D65A 1I4RA 1BBXC 1SXTA 1KLUD 1UAPA 4FNFA 2B2WA 3A7AB 4KKUA 2NTSA 3OMGA 3ITPA 2QCPX 3T16A 4DA2A 2JA5B 3ZYYX 3K6OA 4PV1C 5D14A 2F0KA 1ZEQX 4DK0A 1ENAA 1STNA 3PUXA 3EQLC 1R4PB 2F0DA 1UNSA 1DJRD 1SNCA 2J7ZA 2B2WC 4PQXA 2L0CA 5JJZA 4EQOA 4RWSC 4C2MB 3LWUA 5ISRA 1WTRA 2E2JB 4C56C 3M7NA 3EROA 1V43A 5JEAJ 5CBAE 4MHEA 2D2CC 3NTKA 2EYHA 3R93A 1ICWA 3TZDA 1VF7A 4ABNA 1A2TA 2EVBA 2J4XA 1SYGA 1SNOA 4DXFA 1E2WA 1Y8NB 1TY0A 4YIJA 3GTLB 4UDUC 4K2KA 1MSHA 3Q24A 1I3QB 1ONLA 4ME5A 1QJOA 5FOBB 4CJ0B 4M1UB 2IT1A 4KHVA 5LL6X 3VYRA 4DNRB 3OW7A 2G9HD 3ND9A 1YNJD 4HN7A 1E0BA 3TZUA 4XT3B 3VYSA 1D5MC 4KKTA 2YU9B 3NQIA 4KV6A 2Q8RE 4XYOA 2NZ1D 2BCOA 5KIXA 1K8OA 4PMCA 2ZXPA 2E76C 3FPUB 1QNKA 4IZ8A 2CQAA 4BBRB 1EYDA 3H6MA 4LAAA 2ZXRA 2XSCA 2NYZD 3BYYB 4N9PA 2F0TA 1WTVA 1WTOA 1IYVA 3BDCA 2K03A 2WV6D 2F4IA 3MXNA 2Z4HA 2EPBA 1STEA 5M5XB 1LTAD 2EDGA 3SEBA 1NCVA 1D1IA 4Z9CB 1S5BD 1Z6HA 1SNQA 1U4MA 4L6TB 1Z47A 1PMRA 1AW7A 4G7OC 3DEOA 4IUNA 1BUVT 1DOKA 1VF5C 4KJOA 1I4PA 2IPKD 1TWAB 3T13A 4KK7A 2BDNA 1RF2D 2A6ED 4JBWA 5M9OA 2K04A 5C3WA 3TP8A 4DAYA 3QO2A 3BDLA 5JEAH 1JOOA 5AFWA 4K8JA 1MBYA 4CBVA 2MPMA 1FGBD 1XTCD 2SNMA 4DU9A 1QILA 3K7AB 1GUWA 1KDCA 3DEPA 2F0EA 3NK9A 1F9RA 2F0PA 2WINB 4KD4A 2EYPA 4H13C 3QJYA 4TSSA 1EY8A 2OXPA 2RDHA 3FRPB 2IWHA 2HDLA 3FVQA 1EL0A 1CZWA 2XRQD 1QOHA 3KBXA 4ZAIA 5DEHA 4NMZA 1FR3A 4ID6A 4CKCA 3M85A 3FMCA 1CQFA 1V1PA 3IKJA 1F77A 1STYA 1O78A 4HSPA 4I65A 5KGUA 1EY9A 5ELEA 5ELDA 1Z7TA 1PFNA 2WAQB 3SE0A 1JB3A 4IURA 3TSSA 5IGCA 4WJWA 5JVH3 2SOBA 4FXDA 3DWPA 3MZ5A 3CKIB 4R8NA 1CI3M 4ZKCB 1D5ZC 5I9PA 4U673 1WTPA 2RDGA 2A74C 1TWGB 4BS9A 1ILPA 1GHJA 4TRDA 1F2MA 4DXGA 5EKIA 3RLFA 4C3IG 2PZUA 5C0XG 2IJ0A 5HGTA 5KYIA 1LTTD 3DUZA 4DFAA 1PFMA 4FXKC 2EY5A 4BY7B 4OO1I 2NB0A 1F9SA 1ZYRC 3O13A 1V1OA 3RZDB 3H3VC 2KVMA 1OXVA 5FO9B 1HRJA 4Y7NB 4A3MB 5CC4A 1JWUD 2ID0A 4NP5A 4EQNA 2EE1A 2A6EC 2F0SA 1STHA 1IL8A 2BE5C 1LTRD 1XX8A 3IAYA 3OIPA 2CW0C 1C4QA 2KCNA 5M3FB 1HFGA 3SXHA 3KK7A 4MN3A 1WCMB 3HOUB 1KAAA 2R93B 2E2IB 2PYKA 1L0YB 3PIO3 4KTAA 1B9MA 2JYOA 1UUPA 1GUSA 3Q6SA 1CQVA 2F0GA 2K05A 5KEEA 3LX0A 3C46A 5I6WA 3SK5A 2NVXB 2WKCA 1LTBD 3MEHA 2ZXOA 1Q12A 3BG3A 3C1EA 3KLRA 1B2TA 4XDXA 1HPCA 1I50B 4DK1A 3CRKC 2JE6I 3PO2B 3S15B 3E0JA 3A55A 3QG1A 3L7ZC 3AU7A 2KHSA 3TP6A 4GZYC 1AZPA 4IUVA 4C1NK 1J9OA 3NTHA 2L5TA 2JA6B 1E2ZA 2D5DA 2F3VA 2AWNA 2L55A 4B9WA 4EQPA 4U68A 1PLFA 4FO2A 2B2UA 4EGVA 3W3AA 1ET9A 1KDBA 1I4GA 3TDQA 4KN4C 4DF7A 4BWGB 1KNAA 1B4OA 2KCCA 4KHZA 5CV9A 4DGZA 2EYLA 3S9WA 2F0JA 4A3BB 2FFKB 5IT9L 3GTQB 3R3OA 1M4VA 3SDZA 1RTOA 1RTNA 1TVXA 1BCPF 1GUOA 1U9RA 3J80E 2Y0SB 4RFBA 3C3LA 2WKDA 5KYLA 3TP5A 2CVRA 3NBHA 3PUWA 4MIUA 5A2QL 1KNEA 1OXTA 5BN4A 2MP1A 4HMJA 1OXSC 2K7VA 1SE2A 3BVZA 2O2LD 2F0WA 2F0VA 5C4JB 4IUTA 1GJXA 4G7HC 1QB5D 3NWTA 1D6EC 2JSOA 2O4XA 2L1BA 4ODGA 2XVSA 5K36H 2K6AA 4R8IA 3CQZB 3M3YB 4G57A 1HUMA 3Q23A 4A3GB 2Q8IB 1H9SB 5C5LA 1EQVA 1SEBD 2K01A 5CV4A 4BA1I 1M8AA 3P7JA 4C3JG 4K5WA 3MVVA 4OO1G 4H0LC 3H94A 2PPBC 5FKAC 2E75C 1U4LA 5CYUA 3MFGA 1QWYA 1TWFB 3NXWA 3RUZA 2NN6I 4CKEA 3NSWA 4QUCA 1ENFA 1SDFA 2FINB 1AEXA 3PIP3 2IL8A 2IW3A 1EIHA 3PUZA 5JEAG 4A3JB 3ONAB 3NHHA 3A54A 3I73A 2X6GA 1LT5D 3LWEA 3WOEA 2FHTA 2B39A 2R61A 3VA5A 1TWCB 3K5NA 4HTHA 4OL7A 4DAVA 2K5WA 1B50A 4CKBA 1X3QA 4XTCS 1B9NA 3D8GA 2Z1CA 1BO0A 1WD1A 4KY6A 1SFOB 1U4PA 1PZKD 2M00A 2B8GA 2VB3X 3VR5A 4K2LA 3H91A 4I7ZC 1IYUA 1YNND 4HCSA 3PMFA 2OT2A 4OHJA 3IL8A 3W2DA 5DM73 1IHZA 3OWFA 2CHBD 2WP8J 1TIID 3OMCA 1S5ED 3KUPA 2WACA 3A8KE 3GTMB 2XN9C 1O7YA 4RGMA 4KN7C 1OXXK 4QF4A 4CJ1B 1S5CD 1JE4A 1EOTA 1J8IA 5CR3A 1G2SA 1Y1VB 4A3FB 1PTOD 1C8CA 4DNTB 3S2HB 1CHQD 1PFBA 4KMUC 3PO3B 2PNRC 4BY1B 4K5XA 2RSNA 3SK8A 2KOLA 1ENCA 4E6IA 2EYJA 1WD0A 3S1QB 3RD4A 4OGQC 3BZDB 4A3IB 3TP7A 2IX1A 5JPNC 1B53A 1H9JA 4FF4A 5C44B 2EXZA 4OO1H 1FYCA 2EJGC 2JP1A 4IALA 4DAPA 4FF3A 1CT1D 1HFNA 2B2YA 2BA1A 3D4RA 1KABA 1Y69U 3V2TA 4KJNA 4ZLTF 3K0YA 1EYAA 4P2CB 5C5MA 3J81L 4QUFA 1II3A 3DM1A 4HMIA 2BOSA 2FMCA 2C5CA 3K5OA 5LHY1 1GUTA 1BOSA 1TQOA 3I70A 1VMCA 3KF8A 5E4WC 3T4AC 5C3EB 2B2YC 3GD7A 1E2VA 3V05A 2F1MA 4X3SA 1VCIA 1JWSD 4ZUIA 2B2VC 3OOCA 3R8BA 3HG9A 3WOFA 1SNPA 5KNDA 5IGGA 4H7BA 2IX0A 1Y1WB 3AMUA 2F0IA 1JWMD 1IKLA 1SE3A 3HOXB 2QEJC 2E74C 1EY5A 2YYZA 1YNJC 2RQXA 3Q22A 2MGSA 5EKLA 4IFDJ 1X32A 1PTOC 1DZ1A 5K5PA 2HDMA 3GQBA 4BBSB 5CBEE 3NBIA 2TSSA 4RAUC 1LACA 2JA7B 4UAIA 4FP5D 1CA5A 1T5XD 1XYIA 3FKIB 1LLRD 4X3TA 5IIFA 2WIIB 5FK9C 1JICA 1EQTA 1PRTF 3M7GA 2NVQB 1FNUA 1FNWA 1LO5D 2F03A 4QCLA 3G6JB 3R2IA 5FLXL 5C4ZA 4FF2A 3S1MB 1IW7D 4XIGS 4O42A 3NPPA 3HOVB 1G291 4AYBB 4ZRZA 1RKNA 2NVTB 3NUCA 2E2HB 3R2TA 3N52A 5KRUA 2R6GA 1RHPA 2QILA 3T56B 4WFN3 1F2LA 2K33A 3VR2A 5BN5A 1H9SA 1GHKA 5F2DA 4IQZA 4M8AA 2SDFA 5K36G 1D5XC 1STBA 3VR4A 3L9AX 1A3VA 2XNAC 3X3NA 2VUMB 2K5DA 1EWCA 4JK1C 3K59A 2KECA 1NAPA 1DCZA 4RGNA 3VR3A 1F9QA 3DWQA 3V96A 4V190 5E3FA 2L4NA 2A6HD 2EJFC 5CMDA 3MAQA 1EY0A 3VA7A 2BDOA 1GUNA 5G3LF 1CHPD 2M9VA 4RKLA 1FD7D 4LK1C 4RHRA 4C3IB 2D62A 1HUNA 3HRZC 2KJXA 2EOTA 1BR9A 1G6ZA 1A2UA 1EWHA 2X6LA 2NN6H 1QE6A 4ULLA 1Q90A 4RCNA 1HTPA 5J1ZA 1I6HB 1Q1EA 2A68D 1JQYD 3EVQA 3VR6A 3I4NB 3EA6A 2KA7A 1STGA 3QB3A 4R9WA 1PTOB 3OWEB 1TT2A 1W6JA 5IT9E 2XWJB 3A7LA 5EPJA 1CA6A 5EBCA 1BCPD 1O80A 5CV8A 3GTKB 5LL6S 3I3CA 3S16B 3Q0AA 3DHQA 4HAEA 1HHVA 3S14B 2X69A 1JOQA 1H9RA 3HOZB 1AP0A 1IKMA 1W6KA 4A3DB 2L12A 5CGKA 5A2QE 2Z8LA 3F2UA 5I9OA 4F87A 1SE4A 3QOJA 1S4ZA 2Q8TA 1Q8IA 3NP8A 4RA8A 5JPMC 3UI2A 4CGYB 2PW7A 1G91A 4Q0FA 1STAA 1ML0D 2HUGA 4K6DA 3D4DA 1RODA 3NE5B 4J1MA 1TWHB 2AQ2B 3H0GB 5ELBA 1PDQA 4K5VA 2LY7A 5JOBA 4B9XA 1Q1BA 1KTKA 3MTSA 1A6XA 2F0HA 3KLSA 1S5FD 2K28A 2SNSA 5I2YA 1I4XA 1HA6A 1HA5A 1BDOA 3T51B 1EU4A 1WTQA 3SR1A 3A56A 4IUUA 2PMZB 2NTTA 2IX3A 3HP3A 1VDZA 2A69D 3D31A 2F0NA 1HQRD 2DY8A 2K1BA 1H9MA 1EZ8A 1FNVA 2XWBB 4IFDI 2J0TD 2LMCB 1AFPA 2AWOA 2LS01 3S1RB 1XXGA 5EJWA 3VYTA 1B3AA 3HS0C 2RVLA 3JAML 2N55A 3I90A 1NR4A 4B08A 2G9DA 2TMPA 3MXGA 4A3KB 1RDPD 3HEJA 4LMQD 3S1NB 4X3UA 4LJZC 1BCPC 3PUVA 3NWSA 3NTIA 1LABA 4KY5A 3A8IE 2PO4A 2HCIA 5FO7B 4C1NI 4IUPA 3RZOB 5M3MB 1SJHD 5CV5A 5JAVA 3MXUA 1WVLA 3SHLA 2R7ZB 3DMUA 1Y8PB 5EPKA 4HR7B 4RHSA 2LKVA 2EZVA 2N88A 3SK4A 1HTLD 5M5YB 2KEEA 4ZUJA 1RJTA 3BDOA 1B44D 5J22A 1AN8A 2FJ2A 4A93B 1SYBA 3H09A 4C3JB 1A3UA 1KLGD 3GTGB 4XQQA 2SEBD 5NUCA 3GV6A 5FO8B 3KBGA 2R92B 2O5IC 1DONA 3OHXC 5C0XI 4TQUS 1KDAA 3WDNA 1A15A 1GXDC 4S3SA 3RMHA 4A3EB 4HEDA 1CM9A 3P20A 1HCZA 5CV6A 3KLSX 1EZ6A 1ET6A 5TSSA 3J7AF 1SAPA 1G2TA 2AUJD 3GTPB 1HXYD 2DY7A 1BQQT 2AQ3B 2EYFA 1TS5A 4K6LA 3BS1A 3OPOA 2A69C 1H9KA 3L3OC 1JORA 2VNUD 1SBBB 3URYA 1I4HA 3TBIB 2JXMB 4CJ2C 1RCVD 3IFTA 5C3XA 3J81E 2A5HA 5I2XA 2GA4B 1BF4A 4J6HA 1DXMA 2F0OA 3HOWB 2MHVA 1WTWA 5DNFA 3P1HA 2JEBI 3M4OB 1JR0D 1MGSA 5DM63 2I07B 3GTOB 2PW5A 3I72A 1SJED 3A8JE 1I4QA 4CHTB 1SMYD 4KKSA 4DN4M 1LTSD 2H1EA 4RKBA 3C2PA 2EY1A 3K58A 2F0QA 3J7YW 1ZKOA 1BCPB 3D6CA 3E5SA 5T1IA 2NUCA 1U4RA 1CZGA 2I46A 2DN8A 4IN3A 2C9OA 3OIQA 2H4OA 2FMMA 2B2VA 4QB4A 3CHBD 3X3MA 2MUYA 2WB1B 5EQ0A 3K5LA 1SYFA 4XYQA 1PTOF 1D2BA 4RGOS 1ZYRD 2EJMA 5IOCA 3PUYA 3AB9A 1EY6A 2L11A 5M5WB 5IGEA 3FEWX 1O7LA 4TKOB 3CU7A 4PNYA 5D3IB 1K8MA 2B63B 2BE5D 1YNNC 1T5EA 1R4QB 2KEDA 2F0LA 2CW0D 2ENBA 1BNZA 4EVOA 1DOLA 1SYEA 2JA8B 4IFDG 4XXEA 3CRLC 2ICEC 5BN3A 3TN2A 2NN6G 5HURA 1Y8OB 2QF7A 5E1FA 1TKWB 4OIJA 1PRTD 3LNNA 5C4HA 3DXJC 5IGBA 1K83B 3DWAA 5ELFA 4HSVA 5C6AA 3K5MA 1JCKB 4QMGA 2K5QA 5FLXE 1DYQA 4WRDA 5KNBA 2JEAI 1SYCA 2AUKA 2PQEA 4ZQ3A 1LT4D 2B2TA 3GO5A 1QG7A 3TMEA 3HKZB 1ILQA 2M2LA 1LT6D 5T1GA 3BVGA 4ZKBB 2O5JC 3HGBA 1JC7A 2PCFB 1MD2D 2F0UA 5ELCA 2E2DC 2EYMA 3D4WA 2VB2X 3I91A 3SK6A 2A73B 2NVYB 1GUGA 5J39A 2B2TC 1TR5A 2XIWA 3QWNA 4F8MA 1F2YA 1SSOA 1SMYC 5C4XB 5IGFA 2DNEA 1LT3D 4ZK9B 1AZQA 5DAUA 2V4DA 4RH6A 3N6RA 3I4MB 1MSGA 1TU2B 3U9SA 5KNCA 2KUMA 1CFMA 3D6WA 3MXPA 3MWYW 5G3LD 1V8QA 3GTJB 1DD2A 2EYOA 1NSNS 3I8ZA 3S17B 2MJ8A 2NWGA 4WORA 2RDFA 1LV9A 4BA2I 1ESFA 1ESRA 1TS3A 5EKKA 1OO9B 3J7AV 3ERQA 2ICIA 1BXTA 1NR2A 5C0XJ 1QCBD 2F0FA 3EFXD 2F3WA 3PV0A 2B8FA 3C1FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K01 A;  3DM1 A;  4DN4 M;  3SVM A;  1G6Z A;  1ILQ A;  2HCC A;  1E0B A;  2KEE A;  2M2L A;  2H1E A;  3KUP A;  4XT3 B;  5COY A;  1HRJ A;  1M8A A;  2X6L A;  2R3Z A;  1QE6 A;  2B2W A;  3P7J A;  5T1G A;  4ZKB B;  1RJT A;  1EIG A;  2EE1 A;  2KVM A;  4U68 A;  1O7Y A;  1IL8 A;  2Q8R E;  2NZ1 D;  5T1I A;  2FJ2 A;  1U4R A;  1PLF A;  1VMC A;  5E4W C;  1X3P A;  1WTQ A;  1XX8 A;  1MI2 A;  4O42 A;  4CJ1 B;  2B2U A;  2HDL A;  1U4L A;  5D14 A;  2B2Y C;  1EL0 A;  2FMM A;  3FPU B;  4R9W A;  1Q3L A;  1JE4 A;  1QNK A;  4X3K A;  1EOT A;  2B2V A;  1HFG A;  4IUU A;  3KBX A;  3HP3 A;  2B2U C;  4ZAI A;  3GV6 A;  4XT1 B;  5EPJ A;  5EQ0 A;  1J8I A;  4QUC A;  5E4X A;  1CA6 A;  2NYZ D;  1SDF A;  3I91 A;  2FIN B;  5EPL A;  4X3S A;  1O80 A;  4MN3 A;  2B2V C;  1KNA A;  1B4O A;  1G2S A;  2IL8 A;  1WTV A;  2DY8 A;  2VXW A;  3I3C A;  1WTO A;  1DON A;  3N52 A;  2B2T C;  1C8C A;  2L11 A;  2XIW A;  4HAE A;  2K03 A;  2K1B A;  1EIH A;  1RHP A;  1HHV A;  1O7Z A;  2EPB A;  3G7L A;  1A15 A;  1PFN A;  2B2W C;  1SSO A;  2FFK B;  2J7Z A;  2X69 A;  1PFB A;  4HED A;  1F2L A;  1CM9 A;  1HFN A;  1NCV A;  2JYO A;  3ONA B;  1AP0 A;  1RTO A;  2X6G A;  1RTN A;  1TVX A;  1IKM A;  4ZK9 B;  5EJW A;  4IUR A;  5JJZ A;  2RSN A;  3LWE A;  1B3A A;  2FHT A;  2KOL A;  1SAP A;  1ZXT A;  2L12 A;  2RVL A;  3Q6S A;  4RWS C;  2N55 A;  1WTR A;  2SDF A;  1AZQ A;  1G2T A;  2K05 A;  3I90 A;  2KED A;  1U4M A;  1MSG A;  1NR4 A;  2DY7 A;  3F2U A;  1IKL A;  1BNZ A;  1DOL A;  2RA4 A;  1S4Z A;  2KUM A;  2Q8T A;  1WD0 A;  5CBA E;  4MHE A;  3DEO A;  3D6W A;  4OIK A;  3TN2 A;  1B50 A;  4RA8 A;  1WTX A;  1DOK A;  3R93 A;  4LMQ D;  2CVR A;  3MWY W;  1ICW A;  1X3Q A;  4X3U A;  3TZD A;  4ZKC B;  3UI2 A;  3GV3 A;  1B53 A;  1KNE A;  2KEC A;  2MGS A;  1WTP A;  5COR A;  1B2T A;  1G91 A;  1BO0 A;  1NAP A;  1WD1 A;  2HUG A;  1ML0 D;  2BDN A;  1ILP A;  4OIJ A;  4XDX A;  1U4P A;  1X32 A;  3I8Z A;  4CJ2 C;  2MP1 A;  1F9Q A;  2K04 A;  1ROD A;  2HCI A;  2MJ8 A;  1F9P A;  2NWG A;  4IUQ A;  1VMP A;  1LV9 A;  5EKI A;  1DZ1 A;  4IUP A;  2HDM A;  2RSO A;  5CBE E;  2JP1 A;  3H91 A;  2L4N A;  2L9H A;  1BF4 A;  3QO2 A;  4IUT A;  4HCS A;  4HSV A;  1HA6 A;  4RAU C;  1PFM A;  5AFW A;  2D9U A;  1PDQ A;  4NW2 A;  3IFD A;  1ESR A;  1MSH A;  2B2Y A;  4UAI A;  1WVL A;  1CA5 A;  1WTW A;  5DNF A;  3FDT A;  1XYI A;  1MGS A;  4CJ0 B;  4X3T A;  2L1B A;  5EPK A;  4ZLT F;  1DOM A;  3MTS A;  5D65 A;  1JIC A;  1EQT A;  3IL8 A;  2MPM A;  4R8I A;  1NR2 A;  1AZP A;  5CMD A;  1GUW A;  4IUV A;  1F9S A;  3DEP A;  2K28 A;  1HUN A;  1J9O A;  2EOT A;  2N88 A;  4QUF A;  1BBX C;  1HUM A;  1F9R A;  2B2T A;  1QG7 A; 
#chains in the Genus database with same CATH topology
 2CCZ A;  2OTJ A;  2HCC A;  5D3D A;  1O7I A;  1E22 A;  2R3Z A;  1WFQ A;  4N8X 1;  2OF1 A;  3NQT A;  4PMB A;  2VQF L;  1EEF D;  1CKO A;  4LFB L;  3T53 B;  1PRT C;  4V0B A;  1N36 L;  1KAW A;  3I4L A;  4KY7 A;  2JA7 H;  2HQE A;  1SND A;  2KHI A;  4NDX A;  4WJ4 A;  4IFD H;  4F88 A;  1CTM A;  4XT1 B;  1TWG H;  4KD3 A;  3LGJ A;  5E4X A;  3PQI A;  4GN5 A;  3VYU A;  5EPL A;  1K8G A;  1KC8 C;  4QIW E;  2A8V A;  2VXW A;  5EGT A;  1OTC A;  4O0A A;  3BVM A;  4DAY B;  1T9H A;  2RCF A;  3BYT B;  1KRT A;  4P75 A;  3CPW A;  1O7Z A;  3M4Y A;  1EY4 A;  4N9T A;  4C3H G;  3GDE A;  1K3R A;  2Y0S G;  4LF4 Q;  3W1G A;  2Z4I A;  4XQJ A;  1HR0 W;  3CC4 A;  1HQM C;  3PCO B;  1F2Z A;  1PZI D;  1JOK A;  4DV0 L;  4DV6 L;  1QUQ B;  1GKH A;  3RZD H;  1JJG A;  3FPP A;  2OQK A;  3HKS A;  5GAG C;  1UEA B;  4IO9 A;  3TS0 A;  1WTX A;  4Y7N H;  3P75 A;  4A3M H;  3QOL A;  4IPD A;  1VQ7 A;  1YHQ A;  3MA2 B;  2UU9 L;  1QNU A;  1R9T B;  2BA0 A;  3GV3 A;  1B1Z A;  4FXG C;  3F8T A;  1C48 A;  4H44 C;  4Q5V A;  3CCV A;  1Z9F A;  3AFP A;  2XRS D;  1M90 C;  1XWE A;  1Q81 C;  4LWC A;  4K8I A;  5M3F H;  3CC7 A;  2EY6 A;  4UP8 A;  4O1N A;  4FVM A;  2RSO A;  1VQM A;  4QIW B;  2OTL A;  1PXU A;  2RBM A;  2PZT A;  1IW7 C;  4LNQ A;  3M9B A;  1V1P B;  3IFD A;  3MHB A;  1WCM H;  3KLW A;  1GOZ A;  4DR6 Q;  3HOU H;  2R93 H;  3HOY B;  2PQA B;  4GLA C;  4PMW A;  1DOM A;  4G7Z C;  2PZW A;  1L0X B;  2ZT9 C;  3MC0 B;  1EYC A;  5FLM G;  1N32 Q;  1X3E A;  4L63 B;  1XMO Q;  1HJP A;  2P5Z X;  1UE7 A;  3SVM A;  1X65 A;  3T1Y L;  1N33 Q;  1IYJ B;  5COY A;  1S5D D;  2OEO A;  1TY2 A;  3HZX A;  2KEN A;  1Q86 C;  1EIG A;  1CK1 A;  1YJ9 A;  2EY2 A;  5IOD A;  2DJG C;  5JVG 3;  2NVX H;  2G5D A;  1X3P A;  3OSO A;  1MI2 A;  2AQ1 B;  1DM0 B;  1A62 A;  1Q3L A;  5C0X H;  4X3K A;  4JOI A;  4B3M Q;  2YTX A;  2B2U C;  3ICE A;  3QIA A;  4G4K A;  1PYW D;  1X3F A;  2QKI C;  4C3H B;  1VQK A;  4RGT A;  4A3J G;  3JAM E;  4K14 A;  1I50 H;  4L8J A;  4MZ9 A;  3PO2 H;  1LTI D;  3S15 H;  5EBD A;  3G7L A;  1XJV A;  4A3C G;  1G8Z D;  1SYD A;  4DR1 Q;  1I6H H;  1TS2 A;  4OXP A;  1LTG D;  4DV2 L;  5A35 A;  2LFN A;  3I4N H;  2CWP A;  3MFY A;  2A6H C;  4ILW A;  4FYD A;  5I6Y A;  1IZ6 A;  1PTO H;  4J8Q A;  1ZXT A;  4NKL A;  4B3T Q;  4F7X A;  4AQY Q;  1ASY A;  4GOP B;  1IBM Q;  4XQN A;  2RA4 A;  1I6V C;  4JOI C;  4KI0 A;  2K32 A;  2QDB A;  4TVA B;  1HNX L;  1EEI D;  1PRT B;  2JA6 H;  2ALY B;  4OIK A;  2NBF A;  1D1K A;  4P73 A;  3S16 H;  1PZJ D;  4JI3 L;  5I4D A;  2DNC A;  1RD9 D;  2PNH A;  3GP7 A;  1EU3 A;  4ZYS A;  3U9O A;  2A1A A;  4HCE A;  3RNU A;  1EFI D;  5COR A;  3S2D B;  3DLL A;  3J80 L;  4IUQ A;  1FJG L;  1F9P A;  1VMP A;  4FF1 A;  1OXU A;  2F0M A;  3KJP A;  1I94 L;  1I5F A;  1NUC A;  2KQ3 A;  3E6Z X;  1A3T A;  2A68 C;  2L9H A;  4JI0 L;  3ND8 A;  2D9U A;  4NW2 A;  3F2D A;  2Z6B A;  3K57 A;  4Y52 H;  3FDT A;  1EY7 A;  1SNM A;  1X55 A;  4RCO A;  3BZK A;  4JI2 Q;  2RKS A;  3D3R A;  5IGD A;  4HIK A;  1TS4 A;  3EJI A;  5CV7 A;  4X66 L;  4A3B H;  5D65 A;  1PH2 A;  1I4R A;  1BBX C;  2JA9 A;  4DK6 C;  1SXT A;  3GTQ H;  2UXB L;  2IY5 B;  1N34 Q;  4LF9 L;  4NXN L;  1KLU D;  4FNF A;  1TXY A;  1UAP A;  4DV3 L;  2B2W A;  1HR0 L;  3A7A B;  1TWH H;  4KKU A;  2NTS A;  1FGU A;  3OMG A;  3ITP A;  4L5Q A;  2QCP X;  3T16 A;  4DA2 A;  2JA5 B;  3ZYY X;  4DV4 Q;  2ATW A;  3K6O A;  4R1J A;  4PV1 C;  5D14 A;  1Y1V G;  2F0K A;  1ZEQ X;  1NNX A;  4DK0 A;  3I56 A;  1ENA A;  2K5V A;  3JAM c;  4GKJ Q;  1STN A;  3PUX A;  3EQL C;  3NEL A;  1L1O A;  3PO3 G;  1R4P B;  2F0D A;  4OX9 Q;  1UNS A;  5C4J H;  1DJR D;  1SNC A;  2J7Z A;  2B2W C;  4PQX A;  4LW1 A;  2L0C A;  2VZA A;  2EXD A;  2ZJP A;  4HJ7 A;  4NB3 A;  5JJZ A;  3TRZ A;  4EQO A;  4RWS C;  2EQS A;  4C2M B;  1IBL Q;  3CQZ H;  3M3Y H;  3LWU A;  5ISR A;  1WTR A;  4A3I G;  4C56 C;  3M7N A;  2E2J B;  3TQY A;  4A3G H;  1B3Q A;  4B3S L;  3ERO A;  1SMX A;  1V43 A;  1S40 A;  1JE5 A;  5JEA J;  5CBA E;  2RHQ B;  4MHE A;  4YWL A;  2D2C C;  4LF6 L;  3CF5 A;  2ASB A;  3KYH C;  4YHH L;  3NTK A;  2EYH A;  3R93 A;  3F2B A;  5C44 G;  2K5H A;  5FLM H;  1ICW A;  1YI2 A;  1L1O C;  3TZD A;  1VF7 A;  4ABN A;  1A2T A;  2VY3 A;  2EVB A;  2J4X A;  1SYG A;  4JBJ A;  1TWF H;  3JAM i;  1SNO A;  3S1R H;  4DXF A;  1E2W A;  1Y8N B;  4X65 Q;  1TY0 A;  4YIJ A;  3GTL B;  4UDU C;  4K2K A;  1HNW Q;  1MSH A;  3Q24 A;  1I3Q B;  1ONL A;  4ME5 A;  1QJO A;  5FOB B;  2JK8 A;  4CJ0 B;  4M1U B;  2K52 A;  1B8A A;  2IT1 A;  4KHV A;  3I7F A;  5LL6 X;  3VYR A;  4DNR B;  3OW7 A;  2G9H D;  3ND9 A;  4YWK A;  3L0O A;  1YNJ D;  1X56 A;  4HN7 A;  1E0B A;  1CKN B;  3TZU A;  4XT3 B;  3VYS A;  1C0A A;  1D5M C;  2UXC Q;  4KKT A;  4A3C H;  3RZO H;  2YU9 B;  3NQI A;  5J3B A;  2HHH Q;  4KV6 A;  4DV1 Q;  2UXD Q;  2Q8R E;  4XYO A;  2NZ1 D;  2BCO A;  5KIX A;  1K8O A;  4PMC A;  2ZXP A;  2MFI A;  2E76 C;  3FPU B;  1PVO A;  2ZM6 L;  1QNK A;  4IZ8 A;  1EOV A;  3NBH B;  2CQA A;  4BBR B;  1EYD A;  3H6M A;  4LAA A;  2ZXR A;  2FXQ A;  2XSC A;  1SFO H;  2NYZ D;  3BYY B;  4N9P A;  2F0T A;  1WTV A;  1WTO A;  1IYV A;  4K0K L;  3BDC A;  2K03 A;  2WV6 D;  2F4I A;  1NMG A;  3MXN A;  2Z4H A;  2EPB A;  1STE A;  5M5X B;  1LTA D;  1HZC A;  2EDG A;  3SEB A;  1NCV A;  1D1I A;  4Z9C B;  5IYD H;  3HOX G;  1S5B D;  4C3J H;  2Q2H A;  1BBU A;  1Z6H A;  1KD1 C;  1IXR A;  3GTG H;  4JV5 Q;  1K28 A;  1SNQ A;  1U4M A;  3U4V A;  2WAQ G;  3ULL A;  1PYS B;  4L6T B;  1Z47 A;  1PMR A;  4MTN A;  4DR2 Q;  1AW7 A;  4G7O C;  3DEO A;  5LMU Q;  2R92 H;  2HIV A;  4IUN A;  1GO3 E;  1BUV T;  1DOK A;  1VF5 C;  3G6E A;  4KJO A;  1I4P A;  2IPK D;  1W3S A;  1PA6 A;  1TWA B;  4A3E H;  3T13 A;  3I4O A;  4KK7 A;  2BDN A;  4QY7 A;  1RF2 D;  2A6E D;  4JBW A;  5AJ3 L;  2JA7 G;  4YY3 L;  3EBE A;  5M9O A;  2K04 A;  1HH2 P;  3FKI G;  5C3W A;  3I2Z A;  4GKK Q;  4JYA Q;  3TP8 A;  3UDX A;  4DAY A;  3QO2 A;  3GTP H;  1XPU A;  3BDL A;  5JEA H;  1JOO A;  5AFW A;  1D8L A;  2A19 A;  1RIP A;  3G4S A;  3CXC A;  2K75 A;  4MTK A;  4K8J A;  4A3F H;  1MBY A;  2WAQ E;  4CBV A;  2MPM A;  1FGB D;  1XTC D;  2SNM A;  1QIL A;  3K7A B;  4DU9 A;  3S2H H;  1GUW A;  1KDC A;  3DEP A;  2UUC Q;  2BH2 A;  3J81 c;  2F0E A;  1QUQ A;  3NK9 A;  3PO3 H;  1JMC A;  1F9R A;  2F0P A;  2WIN B;  4KD4 A;  1UE5 A;  2EYP A;  4BY1 H;  1YHA A;  4JI7 L;  2PI2 E;  4H13 C;  3QJY A;  4TSS A;  5BR8 Q;  1WYD A;  1EY8 A;  2OXP A;  4R4C A;  1X3G A;  2RDH A;  3FRP B;  2IWH A;  4KHP Q;  3S1Q H;  1DGS A;  2HDL A;  3FVQ A;  4O2D A;  1EL0 A;  1QVF A;  1CZW A;  4A3M G;  2XRQ D;  2N49 A;  1QOH A;  3KBX A;  1X6O A;  4ZAI A;  5DEH A;  4NMZ A;  1FR3 A;  4ID6 A;  4CKC A;  3M85 A;  5C44 H;  3FMC A;  1CQF A;  1V1P A;  3IKJ A;  1CUK A;  2JN4 A;  1F77 A;  1STY A;  1O78 A;  3EN2 A;  4HSP A;  5M3F G;  4I65 A;  2PQA A;  5KGU A;  1EY9 A;  5ELE A;  1XPR A;  5ELD A;  1Z7T A;  1PFN A;  1PHJ A;  2WAQ B;  2N78 A;  2K50 A;  3PSI A;  3SE0 A;  1WCM G;  1JB3 A;  2F4V Q;  2R93 G;  1K0R A;  4IUR A;  3TSS A;  5IGC A;  4WJW A;  2VUM G;  5JVH 3;  1YJW A;  1HNZ Q;  2SOB A;  1SRO A;  3W5O A;  4FXD A;  2HIX A;  2CH4 A;  4JI4 L;  3DWP A;  1MJC A;  3MZ5 A;  2MO1 A;  4YCW A;  4DV7 Q;  3CKI B;  5M5W H;  4R8N A;  1CI3 M;  4ZKC B;  1D5Z C;  3STB D;  5I9P A;  4X64 Q;  4U67 3;  4JI8 L;  1WTP A;  2RDG A;  2A74 C;  1TWG B;  4BS9 A;  4EQ5 A;  1ILP A;  1GHJ A;  4TRD A;  5H1S E;  5C3E H;  1F2M A;  4DXG A;  4DUZ L;  5EKI A;  3RLF A;  4C3I G;  2PZU A;  5C0X G;  2IJ0 A;  3UDI A;  5HGT A;  5KYI A;  1A8V A;  1LTT D;  3DUZ A;  4DFA A;  5GAH C;  1PFM A;  4DNI A;  4IJH A;  4ALP A;  4FXK C;  2EY5 A;  4BY7 B;  2CKZ B;  1PH7 A;  4OO1 I;  2NB0 A;  1F9S A;  1ZYR C;  3SGI A;  3O13 A;  1V1O A;  3RZD B;  3H3V C;  2KVM A;  4GOP A;  1OXV A;  1JT8 A;  5FO9 B;  3I4N G;  1Y1W H;  5JJK A;  1HRJ A;  4AIM A;  4Y7N B;  4A3M B;  5CC4 A;  1JWU D;  2ID0 A;  2I0Q A;  4NP5 A;  4EQN A;  2EE1 A;  2A6E C;  2F0S A;  3KDF B;  1STH A;  1IL8 A;  2BE5 C;  3HOX H;  1LTR D;  1GM5 A;  1VQB A;  4AH6 A;  1XX8 A;  3IAY A;  3OIP A;  2JA6 G;  2VQF Q;  2VW9 A;  2CW0 C;  2XGT A;  1C4Q A;  2KCN A;  5M3F B;  1N36 Q;  3OTO L;  1HFG A;  3SXH A;  4CDC C;  3KK7 A;  1L0W A;  4MN3 A;  1WCM B;  3HOU B;  1KAA A;  2R93 B;  4L5S A;  2PYK A;  2E2I B;  1L0Y B;  4GOP C;  4BBS H;  4X62 L;  3PIO 3;  4KTA A;  1B9M A;  4QQB X;  3FKI H;  2JYO A;  1UUP A;  4IOA A;  1GUS A;  3Q6S A;  4A3B G;  1CQV A;  2F0G A;  2K05 A;  5KEE A;  1XMQ Q;  2NVQ H;  3LX0 A;  3C46 A;  5I6W A;  2QEX A;  2V1C C;  3PGZ A;  3SK5 A;  2NVX B;  4DV6 Q;  2WKC A;  3AEV A;  1PH5 A;  1LTB D;  3MEH A;  2ZXO A;  1Q12 A;  3BG3 A;  3C1E A;  1ICF B;  3KF8 B;  3KLR A;  1B2T A;  5C4X H;  1JB7 A;  1EQR A;  3S1M H;  1NBW A;  4XDX A;  5GRO A;  2IHE A;  2ZTC A;  2UU9 Q;  1HPC A;  3HOV H;  1I50 B;  4DK1 A;  3CRK C;  3EIV A;  2JQO A;  2JE6 I;  3PO2 B;  2MQH A;  3S15 B;  4YCU A;  5HY6 A;  2DJF C;  4UHV A;  3E0J A;  3A55 A;  2NVT H;  3NEN A;  2E2H H;  3ER0 A;  3QG1 A;  3L7Z C;  3CP0 A;  3AU7 A;  4IJL A;  2KHS A;  3TP6 A;  4GZY C;  1AZP A;  4HID A;  4IUV A;  4APV A;  4C1N K;  3UE0 A;  1J9O A;  1HZB A;  3NTH A;  2L5T A;  1SRU A;  1ASZ A;  2JA6 B;  1KRS A;  1E2Z A;  3K0X A;  2D5D A;  2F3V A;  2Y0S E;  2AWN A;  2L55 A;  4LF4 L;  4B9W A;  4EQP A;  4GNX B;  4U68 A;  4A3G G;  4LF8 Q;  1PLF A;  2VQE L;  4FO2 A;  2B2U A;  2KCM A;  4EGV A;  3W3A A;  4YWM A;  2VUM H;  1ET9 A;  1KDB A;  1X54 A;  1I4G A;  3TDQ A;  4KN4 C;  1QVC A;  4DF7 A;  4LF7 Q;  2K14 A;  4BWG B;  1KNA A;  2R7D A;  1B4O A;  2YV5 A;  4JI1 Q;  2KCC A;  4KHZ A;  5CV9 A;  4DGZ A;  2EYL A;  2AKW B;  3S9W A;  2F0J A;  4LF5 Q;  4A3B B;  2N8N A;  1XPO A;  2FFK B;  5IT9 L;  3GTQ B;  3R3O A;  1M4V A;  3SDZ A;  1VQ6 A;  1RTO A;  4C3I H;  1RTN A;  1TVX A;  4IPC A;  1BCP F;  1CKN A;  1GUO A;  4DR6 L;  1U9R A;  3J80 E;  2Y0S B;  4RFB A;  1KQS A;  3Q8D A;  3C3L A;  2WKD A;  5KYL A;  3TP5 A;  1YIJ A;  2CVR A;  2YTY A;  1HNX Q;  3NBH A;  3PUW A;  4MIU A;  5A2Q L;  1KNE A;  2ZJR A;  1OXT A;  5IE8 A;  5M3M G;  1J5E L;  5BN4 A;  4JI3 Q;  2E5L L;  1D7Q A;  2MP1 A;  4HMJ A;  1OXS C;  2K7V A;  1SE2 A;  3BVZ A;  2R7Z G;  2O2L D;  2F0W A;  2F0V A;  5C4J B;  4IUT A;  1GJX A;  3J7Z C;  1EFW A;  4G7H C;  1QB5 D;  3NWT A;  1I94 Q;  3GTK H;  1D6E C;  2JSO A;  1V9P A;  2O4X A;  2L1B A;  4JI0 Q;  4ODG A;  2XVS A;  5K36 H;  2K6A A;  4R8I A;  2CWA A;  3CQZ B;  3S14 H;  3M3Y B;  1R9T H;  4G57 A;  1VQD A;  1HUM A;  3IRB A;  1NY4 A;  3Q23 A;  3HOZ H;  2Q8I B;  4A3G B;  4X66 Q;  1H9S B;  1EQV A;  2K01 A;  1SEB D;  5C5L A;  1VQI A;  5CV4 A;  1NMF A;  4BA1 I;  5IYD G;  4A3D H;  4A93 G;  1M8A A;  3P7J A;  4C3J G;  2UXB Q;  1K3B C;  4K5W A;  3MVV A;  3PF4 A;  4OO1 G;  4H0L C;  1LTL A;  3H94 A;  2PPB C;  2N3S A;  5FKA C;  3CME A;  4DV3 Q;  3KF6 B;  2E75 C;  3CAM A;  1U4L A;  5CYU A;  3MFG A;  1QWY A;  1TWF B;  3NXW A;  2R92 G;  1QVG A;  3RUZ A;  4P72 A;  2NN6 I;  4PG3 A;  4CKE A;  3NSW A;  4QUC A;  1ENF A;  1SDF A;  4A3E G;  2FIN B;  1AEX A;  5L37 A;  3PIP 3;  2IL8 A;  3K80 C;  2IW3 A;  4JI5 Q;  3H0G H;  1EIH A;  1C7Y A;  5IWA L;  4LFC L;  3PUZ A;  1E1O A;  4OEM B;  3CCQ A;  5JEA G;  4A3J B;  3ONA B;  3NHH A;  3A54 A;  3I73 A;  2X6G A;  3J80 c;  1LT5 D;  3LWE A;  3WOE A;  2FHT A;  4A3F G;  4PZ6 A;  2B39 A;  4DR7 L;  4LFA L;  2R61 A;  3VA5 A;  1TWC B;  3A5U A;  4JI2 L;  3K5N A;  1PH9 A;  4HTH A;  4OL7 A;  4DAV A;  2K5W A;  1B50 A;  4BY1 G;  5IYB G;  4P71 A;  4CKB A;  1X3Q A;  4B3S Q;  3PIO A;  1N34 L;  5ELN A;  4XTC S;  1B9N A;  3D8G A;  2ZTE A;  4YHH Q;  2QGQ A;  2Z1C A;  1BO0 A;  1WD1 A;  4KY6 A;  4GLV B;  1SFO B;  1U4P A;  1PZK D;  2M00 A;  2B8G A;  2VB3 X;  1EUJ A;  3VR5 A;  3KOJ A;  4K2L A;  2R7F A;  4DV4 L;  3H91 A;  2K4K A;  1VQ5 A;  4I7Z C;  1IYU A;  1YNN D;  4HCS A;  3PMF A;  4LUO A;  2OT2 A;  3RN5 A;  4OHJ A;  4H02 A;  3CPF A;  1VQJ A;  4GKJ L;  2F52 A;  5LMN Q;  3IL8 A;  4A3L G;  2VS1 A;  3W2D A;  3F2C A;  5DM7 3;  1IHZ A;  3J80 i;  3U4Z A;  4JCV E;  3OWF A;  2PI2 A;  2CHB D;  2WP8 J;  1TII D;  3OMC A;  1S5E D;  3KUP A;  4CDF C;  1MHW C;  4YCV A;  4L5R C;  2HT1 A;  2WAC A;  3A8K E;  3GTM B;  2XN9 C;  1O7Y A;  2WB1 G;  2H5X A;  3I55 A;  5GAD C;  4RGM A;  4KN7 C;  3TS2 A;  4A3K H;  1OXX K;  4QF4 A;  4CJ1 B;  4JI6 Q;  1FVI A;  3S1N H;  1S5C D;  1JE4 A;  3K8A A;  1EOT A;  4OWW B;  3CCL A;  1J8I A;  3ULP A;  5CR3 A;  1G2S A;  1Y1V B;  3UDF A;  1YJN A;  4OEL B;  5C3E G;  4A3F B;  1PTO D;  1C8C A;  4DNT B;  5M3M H;  1CSQ A;  3S2H B;  1CHQ D;  1PFB A;  4KMU C;  4DPG A;  3PO3 B;  4DR4 L;  2R7Z H;  2PNR C;  4X65 L;  4BY1 B;  4K5X A;  1SN8 A;  2RSN A;  3SK8 A;  2AMC B;  2KOL A;  1ENC A;  4B3R L;  4E6I A;  1RL2 A;  2EYJ A;  2L15 A;  3D0F A;  5M5Y H;  3KDF A;  4GN4 B;  1WD0 A;  3S1Q B;  1EWI A;  3RD4 A;  4OGQ C;  1Y1W G;  3BZD B;  1AE2 A;  4A3I B;  3TP7 A;  1E24 A;  2IX1 A;  5JPN C;  1B53 A;  1H9J A;  1E3P A;  3CCU A;  1XTD A;  4FF4 A;  4A93 H;  4OWX B;  2CQO A;  2HHH L;  5C44 B;  1BVS A;  4DV1 L;  2UXD L;  2EXZ A;  4OO1 H;  1FYC A;  4CDD C;  2EJG C;  1P8L A;  2JP1 A;  2CFM A;  4IAL A;  4DAP A;  1U0L A;  4FF3 A;  1CT1 D;  1HFN A;  4UP7 A;  2B2Y A;  2BA1 A;  3D4R A;  1KAB A;  1Y69 U;  3V2T A;  4KJN A;  4DV5 L;  4HIO A;  3HKZ G;  4ZLT F;  3G48 A;  3K0Y A;  3H3V I;  4BBS G;  1EYA A;  4P2C B;  5C5M A;  1XNR Q;  3J81 L;  4QGU A;  1UWV A;  4QUF A;  2AHO B;  1II3 A;  1YEZ A;  3DM1 A;  4HMI A;  1NJI C;  2BOS A;  1KIX A;  2FMC A;  4JVZ A;  1PH4 A;  1IBK L;  2I5M X;  2C5C A;  3K5O A;  2BH8 A;  2UUA L;  3GTL H;  5LHY 1;  1Q46 A;  3BJU A;  2HQL A;  1GUT A;  1BOS A;  1TQO A;  3I70 A;  1I3Q H;  1VMC A;  3KF8 A;  5E4W C;  3T4A C;  5C3E B;  2B2Y C;  3GD7 A;  1E2V A;  4DR2 L;  3V05 A;  2F1M A;  5LMU L;  5IYB H;  4X3S A;  1VCI A;  1JWS D;  4ZUI A;  5C4X G;  2B2V C;  1MKH A;  3OOC A;  3R8B A;  3HOV G;  4DUY L;  3CCS A;  3HG9 A;  4AYB G;  3WOF A;  3HOW H;  1SNP A;  5IP7 H;  5KND A;  3M4O H;  4WJ3 M;  5IGG A;  1EIF A;  3GTO H;  4H7B A;  2IX0 A;  1Y1W B;  1W2B A;  1EQQ A;  3AMU A;  2F0I A;  4BBR H;  1JWM D;  4DR3 L;  1IKL A;  3T1H Q;  4GNX A;  3CD6 A;  3PIP A;  1SE3 A;  4DAM A;  4HJ8 A;  1QZG A;  3HOX B;  2QEJ C;  4A3L H;  2E74 C;  4LUV A;  3A5Z B;  1EY5 A;  2YYZ A;  4JI4 Q;  1YNJ C;  2RQX A;  3Q22 A;  3UDG A;  1HZA A;  2MGS A;  5EKL A;  2DUD A;  5M5X H;  4IFD J;  1N8R C;  1X32 A;  1PTO C;  4AYB E;  5BR8 L;  4JBK A;  1DZ1 A;  5K5P A;  2HDM A;  3GQB A;  4BBS B;  5CBE E;  3NBI A;  2TSS A;  3CCR A;  4RAU C;  1LAC A;  2JA7 B;  5JJL A;  4UAI A;  4FP5 D;  1CA5 A;  5IP9 H;  1T5X D;  1XYI A;  3FKI B;  1LLR D;  4GNX C;  4X3T A;  5IIF A;  5IYC H;  2WII B;  5FK9 C;  1JIC A;  1EQT A;  1PRT F;  3M7G A;  2NVQ B;  4PZ8 A;  3RLN A;  2B63 H;  1FNU A;  4IPG A;  1LM0 A;  1FNW A;  4R4I A;  1LO5 D;  2F03 A;  4HIM A;  2NZH A;  2KCT A;  4QCL A;  3G6J B;  3R2I A;  2JA8 H;  2YTV A;  1SE8 A;  5FLX L;  5C4Z A;  4FF2 A;  3S1M B;  1IW7 D;  4XIG S;  4O42 A;  3NPP A;  1HNZ L;  3U50 C;  1XNQ Q;  3HOV B;  1L2F A;  2CH4 W;  2KBN A;  1BKB A;  4IPH A;  1G29 1;  4AYB B;  4OON A;  4ZRZ A;  1RKN A;  4DV7 L;  2NVT B;  3NUC A;  2E2H B;  1LUZ A;  1K83 H;  3B6Y A;  3R2T A;  4X64 L;  2EIF A;  3N52 A;  5KRU A;  3VDY A;  2R6G A;  1RHP A;  2QIL A;  3T56 B;  4WFN 3;  1F2L A;  1PH8 A;  2K33 A;  2GN5 A;  3VR2 A;  4X62 Q;  2GVB A;  5BN5 A;  1GVP A;  4LFB Q;  3JC6 6;  1H9S A;  1GHK A;  4KLK A;  5F2D A;  4IQZ A;  4M8A A;  2SDF A;  5K36 G;  1D5X C;  4DR5 L;  4NXM L;  1STB A;  3AQQ A;  3VR4 A;  4JW0 A;  3L9A X;  3HOZ G;  4I7A A;  4QJF A;  2UUB L;  1A3V A;  2XNA C;  3KF6 A;  3X3N A;  1Q8K A;  4A3D G;  2VUM B;  2K5D A;  1EWC A;  4JK1 C;  4A76 A;  2LXJ A;  3K59 A;  1WTH A;  4DK3 C;  2KEC A;  2OQ0 A;  1NAP A;  1DCZ A;  4RGN A;  3VR3 A;  1F9Q A;  3DWQ A;  3V96 A;  3FP9 A;  4V19 0;  3HOY G;  5E3F A;  1PH3 A;  2L4N A;  2A6H D;  3NEM A;  2EJF C;  5CMD A;  3MAQ A;  1G6P A;  1EY0 A;  3VA7 A;  2BDO A;  4DV0 Q;  1GUN A;  5G3L F;  1WJJ A;  1CHP D;  2M9V A;  2NVY H;  4RKL A;  5IY0 A;  1FD7 D;  4LK1 C;  4RHR A;  4C3I B;  1S72 A;  2D62 A;  3H0G G;  3J7A 5;  1PH1 A;  4JC0 A;  1HUN A;  3HRZ C;  2KJX A;  2EOT A;  2HD3 A;  2DGY A;  1BR9 A;  1G6Z A;  1B7Y B;  1A2U A;  1EWH A;  2X6L A;  2NN6 H;  1QE6 A;  4ULL A;  1Q90 A;  3I4M H;  4RCN A;  4FDB A;  4JPB W;  1HTP A;  5J1Z A;  2RF4 A;  1Q1E A;  1I6H B;  1MIU A;  2A68 D;  2D0O A;  2LXK A;  1JQY D;  3EVQ A;  3VR6 A;  3I4N B;  3EA6 A;  2KA7 A;  1STG A;  4BY7 H;  1XMQ L;  3QB3 A;  4R9W A;  1PTO B;  3OWE B;  4R4T A;  1TT2 A;  3GTJ H;  1W6J A;  2ES2 A;  5IT9 E;  2XWJ B;  3A7L A;  2VQE Q;  1UE1 A;  5EPJ A;  1CA6 A;  5EBC A;  1BCP D;  1EIY B;  1VQL A;  1O80 A;  5CV8 A;  4OWT B;  3S17 H;  3GTK B;  5LL6 S;  3I3C A;  3STB C;  3S16 B;  3Q0A A;  1Q7Y C;  3DHQ A;  4HAE A;  4ZCK A;  2F3I A;  3T1Y Q;  3E0E A;  1KL9 A;  1HHV A;  3S14 B;  2X69 A;  5DLQ E;  1JOQ A;  1H9R A;  3HOZ B;  3M4P A;  1AP0 A;  1IKM A;  1W6K A;  1NE3 A;  4A3D B;  1PYB A;  4A75 A;  2L12 A;  5CGK A;  5A2Q E;  1PV4 A;  3E9I A;  4DKA C;  1FL0 A;  2Z8L A;  3F2U A;  5I9O A;  4F87 A;  1SE4 A;  3QOJ A;  1KHI A;  1VQC A;  1S4Z A;  2Q8T A;  1Q8I A;  3NP8 A;  4RA8 A;  5JPM C;  2E2I H;  1IL2 A;  4GN3 B;  1YBY A;  3UI2 A;  4CGY B;  2PW7 A;  1G91 A;  4Q0F A;  1UE6 A;  1STA A;  1ML0 D;  2HUG A;  4K6D A;  4R4O A;  3D4D A;  2PMZ E;  3CCE A;  1ROD A;  4A3K G;  3NE5 B;  3BU2 A;  4J1M A;  1GD7 A;  3PF5 A;  1TWH B;  4DV2 Q;  2AQ2 B;  3HFZ B;  4LF8 L;  3H0G B;  1J5E Q;  1X9N A;  3QR8 A;  5ELB A;  2E5L Q;  3M4Q A;  2GVA A;  3ERS X;  1PDQ A;  4K5V A;  4HJ9 A;  2LY7 A;  5JOB A;  1N32 L;  4B9X A;  1Q1B A;  1V1Q A;  1XMO L;  1YIT A;  1KTK A;  3E3X A;  4LF7 L;  3MTS A;  1A6X A;  2F0H A;  3KLS A;  1N33 L;  1S5F D;  4JI1 L;  2K28 A;  2SNS A;  5I2Y A;  1I4X A;  5LMN W;  1HA6 A;  4LF5 L;  2JA5 G;  1HA5 A;  4CDE C;  1BDO A;  4EX5 A;  1VQA A;  4UP9 A;  3CW2 C;  3S24 A;  1FJG Q;  3T51 B;  2RCN A;  1EU4 A;  4B3M L;  4LUZ A;  3OW2 A;  5IT9 c;  2QW7 A;  1WTQ A;  3SR1 A;  3A56 A;  2B29 A;  2XTI A;  4UY8 C;  5GAE C;  4IUU A;  2PMZ B;  2NTT A;  2IX3 A;  3HP3 A;  1VDZ A;  2A69 D;  4POG A;  3D31 A;  1VQO A;  2F0N A;  1HQR D;  4IOC A;  2DY8 A;  4DR1 L;  3K7U C;  2K1B A;  4LF9 Q;  4NXN Q;  1H9M A;  1EZ8 A;  1FNV A;  2XWB B;  4IFD I;  1HR0 Q;  2J0T D;  2LMC B;  4B3T L;  2Z6K A;  2AWO A;  1AFP A;  4AQY L;  2LS0 1;  3HOY H;  3S1R B;  1IBM L;  1XXG A;  5EJW A;  3VYT A;  5IWA Q;  4LFC Q;  1B3A A;  3HS0 C;  2RVL A;  3JAM L;  2N55 A;  1JJC B;  3I90 A;  1NR4 A;  4B08 A;  2G9D A;  1VQH A;  4BXX G;  5FJ8 G;  4DR7 Q;  3KJO A;  4LFA Q;  3MEF A;  2I5L X;  2TMP A;  3MXG A;  4A3K B;  3E9H A;  1RDP D;  3HEJ A;  2IHF A;  1VS0 A;  4LMQ D;  3S1N B;  1VQF A;  4X3U A;  4LJZ C;  1BCP C;  3PUV A;  3TEH B;  1B70 B;  3NWS A;  3NTI A;  3TRE A;  1LAB A;  4HJA A;  1K0S A;  3FHW A;  3K81 C;  4KY5 A;  3A8I E;  2PO4 A;  2HCI A;  5FO7 B;  4C1N I;  3H3V H;  2Z6K C;  4IUP A;  3RZO B;  4GS3 A;  5M3M B;  1SJH D;  5CV5 A;  5JAV A;  4C3H H;  3MXU A;  1WVL A;  3SHL A;  1Q82 C;  1P16 A;  2I5H A;  2R7Z B;  3CC2 A;  3DMU A;  1Y8P B;  5EPK A;  1VQ9 A;  3W1B A;  4HR7 B;  4LF6 Q;  4RHS A;  2LKV A;  2EZV A;  2N88 A;  4JI5 L;  3HOW G;  3SK4 A;  5IP7 G;  1HTL D;  3H15 A;  5M5Y B;  2KEE A;  1A0I A;  2Q2T A;  4ZUJ A;  1RJT A;  4BBR G;  3BDO A;  4QL5 A;  1B44 D;  5J22 A;  1AN8 A;  2FJ2 A;  3AYH B;  4A93 B;  1SYB A;  2NZO A;  3H09 A;  2D0P A;  1A3U A;  4C3J B;  1KLG D;  3GTG B;  3OYY A;  4XQQ A;  2SEB D;  5NUC A;  3GV6 A;  1G51 A;  3S2D H;  4OX9 L;  5FO8 B;  3U58 A;  3KBG A;  2R92 B;  1A63 A;  2O5I C;  4A4I A;  1DON A;  2QDL A;  5E7N A;  3OHX C;  5C0X I;  4TQU S;  1KDA A;  3WDN A;  1A15 A;  1GXD C;  4S3S A;  3RMH A;  4A3E B;  2Z0S A;  1IBL L;  4HED A;  2Q2U A;  1CM9 A;  3P20 A;  1HCZ A;  5CV6 A;  2RHS B;  2MO0 A;  5IP9 G;  3KLS X;  1EZ6 A;  3AFQ A;  1ET6 A;  5TSS A;  3J7A F;  1SAP A;  5IYC G;  2AUJ D;  1G2T A;  1K9M C;  1YVC A;  3GTP B;  4DR4 Q;  1HXY D;  2DY7 A;  1BQQ T;  2AQ3 B;  2ZM6 Q;  1YNX A;  5LMN L;  2EYF A;  2B63 G;  1TS5 A;  4B3R Q;  4K6L A;  3BS1 A;  3OPO A;  2A69 C;  1H9K A;  3L3O C;  4R4Q A;  1WOC A;  1JOR A;  1M1K C;  2JA5 H;  4K0K Q;  2JA8 G;  1SBB B;  2VNU D;  3URY A;  1I4H A;  3TBI B;  2JXM B;  4A3J H;  4CJ2 C;  4P74 A;  1VQE A;  2WB1 E;  1HNW L;  1RCV D;  3IFT A;  5C3X A;  3J81 E;  2A5H A;  5I2X A;  4JBM A;  2GA4 B;  1BF4 A;  1TWC H;  4J6H A;  4JI6 L;  1DXM A;  2F0O A;  3HOW B;  2MHV A;  1KXL A;  1WTW A;  5DNF A;  3P1H A;  2JEB I;  3M4O B;  1JR0 D;  1MGS A;  5DM6 3;  2I07 B;  3GTO B;  1N9W A;  2PW5 A;  1SR3 A;  3I72 A;  1SJE D;  3A8J E;  1I4Q A;  4CHT B;  1WI5 A;  2UXC L;  4DV5 Q;  1SMY D;  4KKS A;  4DN4 M;  1LTS D;  2H1E A;  2ZJQ A;  4C2M H;  1LYL A;  4RKB A;  3CCJ A;  4NPS A;  5AJ3 Q;  4YY3 Q;  3KFU A;  2E2J H;  1AE3 A;  3C2P A;  2EY1 A;  3K58 A;  2F0Q A;  3J7Y W;  1ZKO A;  3L2P A;  1BCP B;  3D6C A;  3E5S A;  4PZ7 A;  2NUC A;  5T1I A;  1U4R A;  1CZG A;  4N8F A;  2I46 A;  4J15 A;  1IBK Q;  2DN8 A;  4IN3 A;  2C9O A;  3OIQ A;  2UUA Q;  2H4O A;  2FMM A;  4RMF A;  4GLX A;  2B2V A;  1NTG A;  4QB4 A;  3G71 A;  3CHB D;  4BXX H;  3X3M A;  2MUY A;  2WB1 B;  5FJ8 H;  5EQ0 A;  2JJQ A;  2MNA A;  3K5L A;  1SYF A;  4XYQ A;  1PTO F;  1D2B A;  4RGO S;  1ZYR D;  2EJM A;  2WFW A;  5IOC A;  3UE1 A;  3PUY A;  3AB9 A;  3DM3 A;  1EY6 A;  2L11 A;  3WWV A;  2K5N A;  5M5W B;  5IGE A;  4JI7 Q;  3FEW X;  1O7L A;  1VQG A;  3GTM H;  4TKO B;  3CU7 A;  2ZTD A;  4JV5 L;  3A0J A;  4PNY A;  5D3I B;  4X6A H;  1K8M A;  4DUY Q;  2B63 B;  2BE5 D;  1YNN C;  1CKM A;  1T5E A;  1E7Z A;  2C35 B;  1R4Q B;  4UPA A;  2KED A;  2F0L A;  3HKZ E;  2CW0 D;  2ENB A;  2KHJ A;  1VQN A;  3CMA A;  1BNZ A;  4EVO A;  1DOL A;  1SYE A;  2JA8 B;  4IFD G;  4XXE A;  3CRL C;  2ICE C;  5BN3 A;  1AH9 A;  3TN2 A;  1Y1V H;  1XNR L;  2QA4 A;  4DR3 Q;  2YU9 H;  2NN6 G;  5HUR A;  5HGQ A;  1Y8O B;  2QF7 A;  3I4M G;  4GKK L;  4JYA L;  2Z9H A;  5E1F A;  1TKW B;  2Q2I A;  4OIJ A;  1PRT D;  3LNN A;  3CCM A;  3RN2 A;  1K73 C;  5C4H A;  1K8A C;  3DXJ C;  5IGB A;  2VL6 A;  1K83 B;  2LSS A;  4BY7 G;  3DWA A;  5ELF A;  4RG1 A;  4HSV A;  1BBW A;  1L1O B;  5C6A A;  3K5M A;  2UUC L;  1JCK B;  4QMG A;  2K5Q A;  4A3I H;  5FLX E;  1HZ9 A;  1DYQ A;  1SLJ A;  4WRD A;  5KNB A;  2JEA I;  1SYC A;  2AUK A;  2PQE A;  1E1T A;  1LT4 D;  3GO5 A;  2B2T A;  4ZQ3 A;  1QG7 A;  1UEB A;  3HKZ B;  3TME A;  4HJ5 A;  1ILQ A;  2M2L A;  4JI8 Q;  1LT6 D;  4KHP L;  5T1G A;  3BVG A;  3ZJY C;  4ZKB B;  4DUZ Q;  3J81 j;  3RLO A;  1VQ4 A;  1EYG A;  2O5J C;  3HGB A;  1S3O A;  1H95 A;  3T1H L;  3HOU G;  1JC7 A;  4JG2 A;  3J81 i;  2PCF B;  1QZH A;  1MD2 D;  2F0U A;  5ELC A;  4POF A;  1TWA H;  2E2D C;  2EYM A;  3D4W A;  2VB2 X;  3I91 A;  2OCE A;  4MNO A;  3SK6 A;  2A73 B;  2NVY B;  1GUG A;  3F1Z A;  5J39 A;  2B2T C;  1TR5 A;  2XIW A;  2B3G A;  3QWN A;  4F8M A;  2F4V L;  1C9O A;  1F2Y A;  1YZ6 A;  1MJE A;  1SSO A;  1SMY C;  5C4X B;  1PFS A;  5IGF A;  2DNE A;  1LT3 D;  4ZK9 B;  3K7A H;  2E8G A;  5JJI A;  1AZQ A;  5DAU A;  2V4D A;  1J6Q A;  1CSP A;  3N6R A;  4RH6 A;  5EAY A;  1VQ8 A;  3I4M B;  1MSG A;  1TU2 B;  5ELO A;  3U9S A;  5KNC A;  3OTO Q;  2KUM A;  1CFM A;  3D6W A;  1YHB A;  4DR5 Q;  4NXM Q;  3MXP A;  3MWY W;  5G3L D;  1VQP A;  1V8Q A;  3GTJ B;  3RR5 A;  2UUB Q;  3PO2 G;  1DD2 A;  1Y14 B;  2EYO A;  1NSN S;  3I8Z A;  1U5K A;  4ME3 A;  3S17 B;  2MJ8 A;  2NWG A;  4WOR A;  4L5T A;  1PH6 A;  2RDF A;  1LV9 A;  3BZC A;  4BA2 I;  1ESF A;  1ESR A;  3A74 A;  1TS3 A;  5EKK A;  1XNQ L;  1OO9 B;  5FLX c;  3J7A V;  5GQO A;  1JJ2 A;  3MXN B;  3ERQ A;  2ICI A;  1BXT A;  1NR2 A;  3ULJ A;  5C0X J;  2OWO A;  1QCB D;  2F0F A;  3EFX D;  2F3W A;  3PV0 A;  2B8F A;  3C1F A; 
#chains in the Genus database with same CATH homology
 2HCC A;  5D3D A;  2R3Z A;  2OF1 A;  3NQT A;  4PMB A;  1EEF D;  3T53 B;  1PRT C;  4V0B A;  3I4L A;  4KY7 A;  2HQE A;  1SND A;  4NDX A;  4IFD H;  4F88 A;  1CTM A;  4XT1 B;  4KD3 A;  5E4X A;  3VYU A;  5EPL A;  2VXW A;  5EGT A;  3BVM A;  3BYT B;  1O7Z A;  3M4Y A;  1EY4 A;  4N9T A;  4C3H G;  2Z4I A;  4XQJ A;  1HQM C;  1F2Z A;  1PZI D;  1JOK A;  3FPP A;  1UEA B;  1WTX A;  3P75 A;  3QOL A;  3MA2 B;  1QNU A;  1R9T B;  2BA0 A;  3GV3 A;  1B1Z A;  4FXG C;  1C48 A;  4H44 C;  4Q5V A;  2XRS D;  1XWE A;  4K8I A;  2EY6 A;  4O1N A;  4FVM A;  2RSO A;  4QIW B;  1PXU A;  2RBM A;  2PZT A;  1IW7 C;  1V1P B;  3IFD A;  3MHB A;  1GOZ A;  3HOY B;  4PMW A;  1DOM A;  4G7Z C;  2PZW A;  1L0X B;  2ZT9 C;  3MC0 B;  1EYC A;  4L63 B;  3SVM A;  5COY A;  1S5D D;  2OEO A;  1TY2 A;  3HZX A;  1EIG A;  1CK1 A;  2EY2 A;  5IOD A;  5JVG 3;  1X3P A;  3OSO A;  1MI2 A;  2AQ1 B;  1DM0 B;  1Q3L A;  5C0X H;  4X3K A;  2B2U C;  3QIA A;  4G4K A;  1PYW D;  2QKI C;  4C3H B;  4RGT A;  3JAM E;  4K14 A;  4L8J A;  1LTI D;  5EBD A;  3G7L A;  1G8Z D;  1SYD A;  1TS2 A;  1LTG D;  5A35 A;  2LFN A;  3MFY A;  2A6H C;  4ILW A;  4FYD A;  5I6Y A;  4J8Q A;  1PTO H;  1ZXT A;  4NKL A;  4F7X A;  4XQN A;  2RA4 A;  1I6V C;  4KI0 A;  2K32 A;  2QDB A;  1EEI D;  1PRT B;  4OIK A;  2NBF A;  1D1K A;  1PZJ D;  5I4D A;  2DNC A;  1RD9 D;  3GP7 A;  1EU3 A;  4ZYS A;  3U9O A;  4HCE A;  1EFI D;  5COR A;  3S2D B;  3J80 L;  4IUQ A;  1F9P A;  1VMP A;  4FF1 A;  1OXU A;  2F0M A;  1NUC A;  2KQ3 A;  3E6Z X;  1A3T A;  2A68 C;  2L9H A;  3ND8 A;  2D9U A;  4NW2 A;  3K57 A;  3FDT A;  1SNM A;  1EY7 A;  4RCO A;  2RKS A;  3D3R A;  5IGD A;  1TS4 A;  3EJI A;  5CV7 A;  5D65 A;  1I4R A;  1BBX C;  1SXT A;  1KLU D;  1UAP A;  4FNF A;  2B2W A;  3A7A B;  4KKU A;  2NTS A;  3OMG A;  3ITP A;  2QCP X;  3T16 A;  4DA2 A;  2JA5 B;  3ZYY X;  3K6O A;  4PV1 C;  5D14 A;  2F0K A;  1ZEQ X;  4DK0 A;  1ENA A;  1STN A;  3PUX A;  3EQL C;  1R4P B;  2F0D A;  1UNS A;  1DJR D;  1SNC A;  2J7Z A;  2B2W C;  4PQX A;  2L0C A;  5JJZ A;  4EQO A;  4RWS C;  4C2M B;  3LWU A;  5ISR A;  1WTR A;  2E2J B;  4C56 C;  3M7N A;  3ERO A;  1V43 A;  5JEA J;  5CBA E;  4MHE A;  2D2C C;  3NTK A;  2EYH A;  3R93 A;  1ICW A;  3TZD A;  1VF7 A;  4ABN A;  1A2T A;  2EVB A;  2J4X A;  1SYG A;  1SNO A;  4DXF A;  1E2W A;  1Y8N B;  1TY0 A;  4YIJ A;  3GTL B;  4UDU C;  4K2K A;  1MSH A;  3Q24 A;  1I3Q B;  1ONL A;  4ME5 A;  1QJO A;  5FOB B;  4CJ0 B;  4M1U B;  2IT1 A;  4KHV A;  5LL6 X;  3VYR A;  4DNR B;  3OW7 A;  2G9H D;  3ND9 A;  1YNJ D;  4HN7 A;  1E0B A;  3TZU A;  4XT3 B;  3VYS A;  1D5M C;  4KKT A;  2YU9 B;  3NQI A;  4KV6 A;  2Q8R E;  4XYO A;  2NZ1 D;  2BCO A;  5KIX A;  1K8O A;  4PMC A;  2ZXP A;  2E76 C;  3FPU B;  1QNK A;  4IZ8 A;  2CQA A;  4BBR B;  1EYD A;  3H6M A;  4LAA A;  2ZXR A;  2XSC A;  2NYZ D;  3BYY B;  4N9P A;  2F0T A;  1WTV A;  1WTO A;  1IYV A;  3BDC A;  2K03 A;  2WV6 D;  2F4I A;  3MXN A;  2Z4H A;  2EPB A;  1STE A;  5M5X B;  1LTA D;  2EDG A;  3SEB A;  1NCV A;  1D1I A;  4Z9C B;  1S5B D;  1Z6H A;  1SNQ A;  1U4M A;  4L6T B;  1Z47 A;  1PMR A;  1AW7 A;  4G7O C;  3DEO A;  4IUN A;  1BUV T;  1DOK A;  1VF5 C;  4KJO A;  1I4P A;  2IPK D;  1TWA B;  3T13 A;  4KK7 A;  2BDN A;  1RF2 D;  2A6E D;  4JBW A;  5M9O A;  2K04 A;  5C3W A;  3TP8 A;  4DAY A;  3QO2 A;  3BDL A;  5JEA H;  1JOO A;  5AFW A;  4K8J A;  1MBY A;  4CBV A;  2MPM A;  1FGB D;  1XTC D;  2SNM A;  4DU9 A;  1QIL A;  3K7A B;  1GUW A;  1KDC A;  3DEP A;  2F0E A;  3NK9 A;  1F9R A;  2F0P A;  2WIN B;  4KD4 A;  2EYP A;  4H13 C;  3QJY A;  4TSS A;  1EY8 A;  2OXP A;  2RDH A;  3FRP B;  2IWH A;  2HDL A;  3FVQ A;  1EL0 A;  1CZW A;  2XRQ D;  1QOH A;  3KBX A;  4ZAI A;  5DEH A;  4NMZ A;  1FR3 A;  4ID6 A;  4CKC A;  3M85 A;  3FMC A;  1CQF A;  1V1P A;  3IKJ A;  1F77 A;  1STY A;  1O78 A;  4HSP A;  4I65 A;  5KGU A;  1EY9 A;  5ELE A;  5ELD A;  1Z7T A;  1PFN A;  2WAQ B;  3SE0 A;  1JB3 A;  4IUR A;  3TSS A;  5IGC A;  4WJW A;  5JVH 3;  2SOB A;  4FXD A;  3DWP A;  3MZ5 A;  3CKI B;  4R8N A;  1CI3 M;  4ZKC B;  1D5Z C;  5I9P A;  4U67 3;  1WTP A;  2RDG A;  2A74 C;  1TWG B;  4BS9 A;  1ILP A;  1GHJ A;  4TRD A;  1F2M A;  4DXG A;  5EKI A;  3RLF A;  4C3I G;  2PZU A;  5C0X G;  2IJ0 A;  5HGT A;  5KYI A;  1LTT D;  3DUZ A;  4DFA A;  1PFM A;  4FXK C;  2EY5 A;  4BY7 B;  4OO1 I;  2NB0 A;  1F9S A;  1ZYR C;  3O13 A;  1V1O A;  3RZD B;  3H3V C;  2KVM A;  1OXV A;  5FO9 B;  1HRJ A;  4Y7N B;  4A3M B;  5CC4 A;  1JWU D;  2ID0 A;  4NP5 A;  4EQN A;  2EE1 A;  2A6E C;  2F0S A;  1STH A;  1IL8 A;  2BE5 C;  1LTR D;  1XX8 A;  3IAY A;  3OIP A;  2CW0 C;  1C4Q A;  2KCN A;  5M3F B;  1HFG A;  3SXH A;  3KK7 A;  4MN3 A;  1WCM B;  3HOU B;  1KAA A;  2R93 B;  2E2I B;  2PYK A;  1L0Y B;  3PIO 3;  4KTA A;  1B9M A;  2JYO A;  1UUP A;  1GUS A;  3Q6S A;  1CQV A;  2F0G A;  2K05 A;  5KEE A;  3LX0 A;  3C46 A;  5I6W A;  3SK5 A;  2NVX B;  2WKC A;  1LTB D;  3MEH A;  2ZXO A;  1Q12 A;  3BG3 A;  3C1E A;  3KLR A;  1B2T A;  4XDX A;  1HPC A;  1I50 B;  4DK1 A;  3CRK C;  2JE6 I;  3PO2 B;  3S15 B;  3E0J A;  3A55 A;  3QG1 A;  3L7Z C;  3AU7 A;  2KHS A;  3TP6 A;  4GZY C;  1AZP A;  4IUV A;  4C1N K;  1J9O A;  3NTH A;  2L5T A;  2JA6 B;  1E2Z A;  2D5D A;  2F3V A;  2AWN A;  2L55 A;  4B9W A;  4EQP A;  4U68 A;  1PLF A;  4FO2 A;  2B2U A;  4EGV A;  3W3A A;  1ET9 A;  1KDB A;  1I4G A;  3TDQ A;  4KN4 C;  4DF7 A;  4BWG B;  1KNA A;  1B4O A;  2KCC A;  4KHZ A;  5CV9 A;  4DGZ A;  2EYL A;  3S9W A;  2F0J A;  4A3B B;  2FFK B;  5IT9 L;  3GTQ B;  3R3O A;  1M4V A;  3SDZ A;  1RTO A;  1RTN A;  1TVX A;  1BCP F;  1GUO A;  1U9R A;  3J80 E;  2Y0S B;  4RFB A;  3C3L A;  2WKD A;  5KYL A;  3TP5 A;  2CVR A;  3NBH A;  3PUW A;  4MIU A;  5A2Q L;  1KNE A;  1OXT A;  5BN4 A;  2MP1 A;  4HMJ A;  1OXS C;  2K7V A;  1SE2 A;  3BVZ A;  2O2L D;  2F0W A;  2F0V A;  5C4J B;  4IUT A;  1GJX A;  4G7H C;  1QB5 D;  3NWT A;  1D6E C;  2JSO A;  2O4X A;  2L1B A;  4ODG A;  2XVS A;  5K36 H;  2K6A A;  4R8I A;  3CQZ B;  3M3Y B;  4G57 A;  1HUM A;  3Q23 A;  4A3G B;  2Q8I B;  1H9S B;  5C5L A;  1EQV A;  1SEB D;  2K01 A;  5CV4 A;  4BA1 I;  1M8A A;  3P7J A;  4C3J G;  4K5W A;  3MVV A;  4OO1 G;  4H0L C;  3H94 A;  2PPB C;  5FKA C;  2E75 C;  1U4L A;  5CYU A;  3MFG A;  1QWY A;  1TWF B;  3NXW A;  3RUZ A;  2NN6 I;  4CKE A;  3NSW A;  4QUC A;  1ENF A;  1SDF A;  2FIN B;  1AEX A;  3PIP 3;  2IL8 A;  2IW3 A;  1EIH A;  3PUZ A;  5JEA G;  4A3J B;  3ONA B;  3NHH A;  3A54 A;  3I73 A;  2X6G A;  1LT5 D;  3LWE A;  3WOE A;  2FHT A;  2B39 A;  2R61 A;  3VA5 A;  1TWC B;  3K5N A;  4HTH A;  4OL7 A;  4DAV A;  2K5W A;  1B50 A;  4CKB A;  1X3Q A;  4XTC S;  1B9N A;  3D8G A;  2Z1C A;  1BO0 A;  1WD1 A;  4KY6 A;  1SFO B;  1U4P A;  1PZK D;  2M00 A;  2B8G A;  2VB3 X;  3VR5 A;  4K2L A;  3H91 A;  4I7Z C;  1IYU A;  1YNN D;  4HCS A;  3PMF A;  2OT2 A;  4OHJ A;  3IL8 A;  3W2D A;  5DM7 3;  1IHZ A;  3OWF A;  2CHB D;  2WP8 J;  1TII D;  3OMC A;  1S5E D;  3KUP A;  2WAC A;  3A8K E;  3GTM B;  2XN9 C;  1O7Y A;  4RGM A;  4KN7 C;  1OXX K;  4QF4 A;  4CJ1 B;  1S5C D;  1JE4 A;  1EOT A;  1J8I A;  5CR3 A;  1G2S A;  1Y1V B;  4A3F B;  1PTO D;  1C8C A;  4DNT B;  3S2H B;  1CHQ D;  1PFB A;  4KMU C;  3PO3 B;  2PNR C;  4BY1 B;  4K5X A;  2RSN A;  3SK8 A;  2KOL A;  1ENC A;  4E6I A;  2EYJ A;  1WD0 A;  3S1Q B;  3RD4 A;  4OGQ C;  3BZD B;  4A3I B;  3TP7 A;  2IX1 A;  5JPN C;  1B53 A;  1H9J A;  4FF4 A;  5C44 B;  2EXZ A;  4OO1 H;  1FYC A;  2EJG C;  2JP1 A;  4IAL A;  4DAP A;  4FF3 A;  1CT1 D;  1HFN A;  2B2Y A;  2BA1 A;  3D4R A;  1KAB A;  1Y69 U;  3V2T A;  4KJN A;  4ZLT F;  3K0Y A;  1EYA A;  4P2C B;  5C5M A;  3J81 L;  4QUF A;  1II3 A;  3DM1 A;  4HMI A;  2BOS A;  2FMC A;  2C5C A;  3K5O A;  5LHY 1;  1GUT A;  1BOS A;  1TQO A;  3I70 A;  1VMC A;  3KF8 A;  5E4W C;  3T4A C;  5C3E B;  2B2Y C;  3GD7 A;  1E2V A;  3V05 A;  2F1M A;  4X3S A;  1VCI A;  1JWS D;  4ZUI A;  2B2V C;  3OOC A;  3R8B A;  3HG9 A;  3WOF A;  1SNP A;  5KND A;  5IGG A;  4H7B A;  2IX0 A;  1Y1W B;  3AMU A;  2F0I A;  1JWM D;  1IKL A;  1SE3 A;  3HOX B;  2QEJ C;  2E74 C;  1EY5 A;  2YYZ A;  1YNJ C;  2RQX A;  3Q22 A;  2MGS A;  5EKL A;  4IFD J;  1X32 A;  1PTO C;  1DZ1 A;  5K5P A;  2HDM A;  3GQB A;  4BBS B;  5CBE E;  3NBI A;  2TSS A;  4RAU C;  1LAC A;  2JA7 B;  4UAI A;  4FP5 D;  1CA5 A;  1T5X D;  1XYI A;  3FKI B;  1LLR D;  4X3T A;  5IIF A;  2WII B;  5FK9 C;  1JIC A;  1EQT A;  1PRT F;  3M7G A;  2NVQ B;  1FNU A;  1FNW A;  1LO5 D;  2F03 A;  4QCL A;  3G6J B;  3R2I A;  5FLX L;  5C4Z A;  4FF2 A;  3S1M B;  1IW7 D;  4XIG S;  4O42 A;  3NPP A;  3HOV B;  1G29 1;  4AYB B;  4ZRZ A;  1RKN A;  2NVT B;  3NUC A;  2E2H B;  3R2T A;  3N52 A;  5KRU A;  2R6G A;  1RHP A;  2QIL A;  3T56 B;  4WFN 3;  1F2L A;  2K33 A;  3VR2 A;  5BN5 A;  1H9S A;  1GHK A;  5F2D A;  4IQZ A;  4M8A A;  2SDF A;  5K36 G;  1D5X C;  1STB A;  3VR4 A;  3L9A X;  1A3V A;  2XNA C;  3X3N A;  2VUM B;  2K5D A;  1EWC A;  4JK1 C;  3K59 A;  2KEC A;  1NAP A;  1DCZ A;  4RGN A;  3VR3 A;  1F9Q A;  3DWQ A;  3V96 A;  4V19 0;  5E3F A;  2L4N A;  2A6H D;  2EJF C;  5CMD A;  3MAQ A;  1EY0 A;  3VA7 A;  2BDO A;  1GUN A;  5G3L F;  1CHP D;  2M9V A;  4RKL A;  1FD7 D;  4LK1 C;  4RHR A;  4C3I B;  2D62 A;  1HUN A;  3HRZ C;  2KJX A;  2EOT A;  1BR9 A;  1G6Z A;  1A2U A;  1EWH A;  2X6L A;  2NN6 H;  1QE6 A;  4ULL A;  1Q90 A;  4RCN A;  1HTP A;  5J1Z A;  1I6H B;  1Q1E A;  2A68 D;  1JQY D;  3EVQ A;  3VR6 A;  3I4N B;  3EA6 A;  2KA7 A;  1STG A;  3QB3 A;  4R9W A;  1PTO B;  3OWE B;  1TT2 A;  1W6J A;  5IT9 E;  2XWJ B;  3A7L A;  5EPJ A;  1CA6 A;  5EBC A;  1BCP D;  1O80 A;  5CV8 A;  3GTK B;  5LL6 S;  3I3C A;  3S16 B;  3Q0A A;  3DHQ A;  4HAE A;  1HHV A;  3S14 B;  2X69 A;  1JOQ A;  1H9R A;  3HOZ B;  1AP0 A;  1IKM A;  1W6K A;  4A3D B;  2L12 A;  5CGK A;  5A2Q E;  2Z8L A;  3F2U A;  5I9O A;  4F87 A;  1SE4 A;  3QOJ A;  1S4Z A;  2Q8T A;  1Q8I A;  3NP8 A;  4RA8 A;  5JPM C;  3UI2 A;  4CGY B;  2PW7 A;  1G91 A;  4Q0F A;  1STA A;  1ML0 D;  2HUG A;  4K6D A;  3D4D A;  1ROD A;  3NE5 B;  4J1M A;  1TWH B;  2AQ2 B;  3H0G B;  5ELB A;  1PDQ A;  4K5V A;  2LY7 A;  5JOB A;  4B9X A;  1Q1B A;  1KTK A;  3MTS A;  1A6X A;  2F0H A;  3KLS A;  1S5F D;  2K28 A;  2SNS A;  5I2Y A;  1I4X A;  1HA6 A;  1HA5 A;  1BDO A;  3T51 B;  1EU4 A;  1WTQ A;  3SR1 A;  3A56 A;  4IUU A;  2PMZ B;  2NTT A;  2IX3 A;  3HP3 A;  1VDZ A;  2A69 D;  3D31 A;  2F0N A;  1HQR D;  2DY8 A;  2K1B A;  1H9M A;  1EZ8 A;  1FNV A;  2XWB B;  4IFD I;  2J0T D;  2LMC B;  1AFP A;  2AWO A;  2LS0 1;  3S1R B;  1XXG A;  5EJW A;  3VYT A;  1B3A A;  3HS0 C;  2RVL A;  3JAM L;  2N55 A;  3I90 A;  1NR4 A;  4B08 A;  2G9D A;  2TMP A;  3MXG A;  4A3K B;  1RDP D;  3HEJ A;  4LMQ D;  3S1N B;  4X3U A;  4LJZ C;  1BCP C;  3PUV A;  3NWS A;  3NTI A;  1LAB A;  4KY5 A;  3A8I E;  2PO4 A;  2HCI A;  5FO7 B;  4C1N I;  4IUP A;  3RZO B;  5M3M B;  1SJH D;  5CV5 A;  5JAV A;  3MXU A;  1WVL A;  3SHL A;  2R7Z B;  3DMU A;  1Y8P B;  5EPK A;  4HR7 B;  4RHS A;  2LKV A;  2EZV A;  2N88 A;  3SK4 A;  1HTL D;  5M5Y B;  2KEE A;  4ZUJ A;  1RJT A;  3BDO A;  1B44 D;  5J22 A;  1AN8 A;  2FJ2 A;  4A93 B;  1SYB A;  3H09 A;  4C3J B;  1A3U A;  1KLG D;  3GTG B;  4XQQ A;  2SEB D;  5NUC A;  3GV6 A;  5FO8 B;  3KBG A;  2R92 B;  2O5I C;  1DON A;  3OHX C;  5C0X I;  4TQU S;  1KDA A;  3WDN A;  1A15 A;  1GXD C;  4S3S A;  3RMH A;  4A3E B;  4HED A;  1CM9 A;  3P20 A;  1HCZ A;  5CV6 A;  3KLS X;  1EZ6 A;  1ET6 A;  5TSS A;  3J7A F;  1SAP A;  1G2T A;  2AUJ D;  3GTP B;  1HXY D;  2DY7 A;  1BQQ T;  2AQ3 B;  2EYF A;  1TS5 A;  4K6L A;  3BS1 A;  3OPO A;  2A69 C;  1H9K A;  3L3O C;  1JOR A;  2VNU D;  1SBB B;  3URY A;  1I4H A;  3TBI B;  2JXM B;  4CJ2 C;  1RCV D;  3IFT A;  5C3X A;  3J81 E;  2A5H A;  5I2X A;  2GA4 B;  1BF4 A;  4J6H A;  1DXM A;  2F0O A;  3HOW B;  2MHV A;  1WTW A;  5DNF A;  3P1H A;  2JEB I;  3M4O B;  1JR0 D;  1MGS A;  5DM6 3;  2I07 B;  3GTO B;  2PW5 A;  3I72 A;  1SJE D;  3A8J E;  1I4Q A;  4CHT B;  1SMY D;  4KKS A;  4DN4 M;  1LTS D;  2H1E A;  4RKB A;  3C2P A;  2EY1 A;  3K58 A;  2F0Q A;  3J7Y W;  1ZKO A;  1BCP B;  3D6C A;  3E5S A;  5T1I A;  2NUC A;  1U4R A;  1CZG A;  2I46 A;  2DN8 A;  4IN3 A;  2C9O A;  3OIQ A;  2H4O A;  2FMM A;  2B2V A;  4QB4 A;  3CHB D;  3X3M A;  2MUY A;  2WB1 B;  5EQ0 A;  3K5L A;  1SYF A;  4XYQ A;  1PTO F;  1D2B A;  4RGO S;  1ZYR D;  2EJM A;  5IOC A;  3PUY A;  3AB9 A;  1EY6 A;  2L11 A;  5M5W B;  5IGE A;  3FEW X;  1O7L A;  4TKO B;  3CU7 A;  4PNY A;  5D3I B;  1K8M A;  2B63 B;  2BE5 D;  1YNN C;  1T5E A;  1R4Q B;  2KED A;  2F0L A;  2CW0 D;  2ENB A;  1BNZ A;  4EVO A;  1DOL A;  1SYE A;  2JA8 B;  4IFD G;  4XXE A;  3CRL C;  2ICE C;  5BN3 A;  3TN2 A;  2NN6 G;  5HUR A;  1Y8O B;  2QF7 A;  5E1F A;  1TKW B;  4OIJ A;  1PRT D;  3LNN A;  5C4H A;  3DXJ C;  5IGB A;  1K83 B;  3DWA A;  5ELF A;  4HSV A;  5C6A A;  3K5M A;  1JCK B;  4QMG A;  2K5Q A;  5FLX E;  1DYQ A;  4WRD A;  5KNB A;  2JEA I;  1SYC A;  2AUK A;  2PQE A;  4ZQ3 A;  1LT4 D;  2B2T A;  3GO5 A;  1QG7 A;  3TME A;  3HKZ B;  1ILQ A;  2M2L A;  1LT6 D;  5T1G A;  3BVG A;  4ZKB B;  2O5J C;  3HGB A;  1JC7 A;  2PCF B;  1MD2 D;  2F0U A;  5ELC A;  2E2D C;  2EYM A;  3D4W A;  2VB2 X;  3I91 A;  3SK6 A;  2A73 B;  2NVY B;  1GUG A;  5J39 A;  2B2T C;  1TR5 A;  2XIW A;  3QWN A;  4F8M A;  1F2Y A;  1SSO A;  1SMY C;  5C4X B;  5IGF A;  2DNE A;  1LT3 D;  4ZK9 B;  1AZQ A;  5DAU A;  2V4D A;  4RH6 A;  3N6R A;  3I4M B;  1MSG A;  1TU2 B;  3U9S A;  5KNC A;  2KUM A;  1CFM A;  3D6W A;  3MXP A;  3MWY W;  5G3L D;  1V8Q A;  3GTJ B;  1DD2 A;  2EYO A;  1NSN S;  3I8Z A;  3S17 B;  2MJ8 A;  2NWG A;  4WOR A;  2RDF A;  1LV9 A;  4BA2 I;  1ESF A;  1ESR A;  1TS3 A;  5EKK A;  1OO9 B;  3J7A V;  3ERQ A;  2ICI A;  1BXT A;  1NR2 A;  5C0X J;  1QCB D;  2F0F A;  3EFX D;  2F3W A;  3PV0 A;  2B8F A;  3C1F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...