3TP6A

Crystal structure of staphylococcal nuclease variant delta+phs l36e/l103k at cryogenic temperature
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
130
structure length
130
Chain Sequence
KLHKEPATLIKAIDGDTVKLMYKGQPMTFRELLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEAKVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS L36E/L103K at cryogenic temperature
rcsb
source organism Staphylococcus aureus
total genus 38
structure length 130
sequence length 130
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2011-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3tp6A00
5CV7A 1JOQA 1TQOA 1EY0A 3EROA 1EQVA 5JAVA 4KHVA 5EGTA 5I9OA 3OSOA 5IGCA 2NUCA 2PYKA 2F0FA 2PZTA 3OWFA 2EY5A 2ENBA 4KD3A 3E5SA 2F0JA 2QDBA 1A3TA 1STBA 2RBMA 5CC4A 1NUCA 4N9TA 5IGBA 4EQPA 1II3A 2F0UA 2F0PA 5IOCA 4ZUJA 2EYHA 1JOOA 4PNYA 2LKVA 3QOLA 1SNPA 1EY8A 2PQEA 5IGFA 5IODA 1A2UA 3S9WA 2EYMA 2F0KA 4ZQ3A 3NXWA 2F0GA 4PMCA 5CV6A 2F0TA 2OXPA 2O4XA 1ENAA 3D4DA 1RKNA 4B9WA 1A3VA 1EY9A 1NSNS 2EYPA 3HZXA 2F0NA 4QMGA 4K14A 5KYLA 4DFAA 3T16A 4RKBA 4I65A 5KRUA 2EY2A 3TP8A 4HMJA 2SNMA 4PMBA 4HMIA 4WRDA 5IGDA 3T13A 4J1MA 5I9PA 2F3VA 4IUNA 4KJOA 3MEHA 4KY6A 4R8NA 3MHBA 3TP7A 5HGTA 5NUCA 4KTAA 3SK8A 1KDCA 3SK5A 1IHZA 1EYAA 3SK6A 5KYIA 4K8IA 2F0IA 5CV5A 4F8MA 1A3UA 1EY7A 2RKSA 5DAUA 3LX0A 5E1FA 5F2DA 1EZ6A 2EY6A 4G57A 3U9OA 1STNA 3MVVA 3SXHA 2RDFA 2PW7A 5DEHA 3R3OA 1JOKA 3NUCA 1STYA 4NKLA 3QOJA 2F0EA 2KHSA 1U9RA 3EJIA 4K6DA 4DGZA 3OMCA 1EY5A 4ZUIA 4S3SA 3TP5A 4K5XA 2EYLA 5CR3A 1STHA 4IALA 3VA5A 1F2YA 1SNCA 5IGEA 5KEEA 4KY7A 3TMEA 1KABA 3V2TA 1ENCA 2M00A 2KQ3A 2F3WA 5EKKA 2F0OA 3SK4A 3HEJA 4NMZA 3MXPA 4HTHA 4DF7A 1SYFA 5C4HA 3H6MA 5CGKA 5I6WA 1EY4A 3D8GA 4K5VA 5CV9A 1AEXA 3D4WA 3NP8A 4K2LA 3ERQA 2PW5A 2F0SA 4LAAA 1EY6A 3ITPA 3EVQA 5C3XA 4WORA 5EKLA 4DU9A 5J39A 1TT2A 5C3WA 4KJNA 2SNSA 4OL7A 1SNQA 3BDLA 3QB3A 4H7BA 1KDBA 1SNMA 4ID6A 3OMGA 4K8JA 5CV8A 1SNDA 3NQTA 2F0HA 1KAAA 3PMFA 2EYJA 4B9XA 4RKLA 2F0VA 3MZ5A 5JOBA 5C4ZA 1JORA 1F2MA 5ISRA 1SYBA 2OF1A 5K5PA 4QB4A 1STGA 3RUZA 1A2TA 3SR1A 3TP6A 4ME5A 3SHLA 5J22A 2EYOA 3C1FA 4IZ8A 4F7XA 3BDCA 2F0QA 2EY1A 2EXZA 4KD4A 5E3FA 2F0LA 1SNOA 4TRDA 3P75A 1SYGA 5C5MA 5C6AA 3P1HA 4KV6A 4ODGA 5KIXA 4NDXA 4EQNA 5J1ZA 3D6CA 2F0WA 5C5LA 4K2KA 5HURA 3NHHA 4QF4A 1KDAA 5CV4A 5IGGA 1TR5A 5KGUA 3DMUA 2WACA 4E6IA 1EYDA 1SYEA 4KY5A 1SYCA 2HQEA 1EZ8A 2F0DA 2SOBA 5I6YA 4NP5A 4K5WA 1SYDA 2EYFA 2PZWA 4EQOA 1F2ZA 2PZUA 5M9OA 3C1EA 4YIJA 2F0MA 2OEOA 3NK9A 4EVOA 5IIFA 1STAA 4J6HA 1EYCA 3DHQA 4N9PA 4MIUA
chains in the Genus database with same CATH superfamily
5CV7A 4LK1C 2I46A 4X65Q 3PUYA 3T1HL 3QO2A 4EQ5A 5EPJA 4DR7L 1N36L 1II3A 4CBVA 1VQKA 4DNIA 4B3TL 1XNRL 4RG1A 2KCNA 4HIMA 5I2YA 2HT1A 2DY7A 3E0JA 3NXWA 4LF5Q 1XNQL 4M8AA 1RF2D 2CVRA 3QJYA 2F0NA 4BBSH 5KYLA 2F4IA 1G91A 1PH4A 4XQJA 1TWGH 2X69A 2E2IH 5C0XJ 2A19A 1S5ED 4X3KA 4K8IA 2YU9H 1XX8A 4KN7C 3K7UC 2MNAA 2VB3X 2YTVA 1QE6A 4GKJL 1Y1VG 1GUGA 1HUMA 3EA6A 1I4QA 5GQOA 1LT3D 1PFSA 3URYA 4G7OC 1U9RA 3P20A 2RCFA 4LUVA 4S3SA 1GM5A 5GROA 5DLQE 1ESFA 2QW7A 3VA5A 1F2YA 1UUPA 4AYBG 1U4PA 3GTMH 1ENCA 3W3AA 4DV6L 3A55A 4LF9Q 1NBWA 1VQ6A 1JJCB 2R7ZG 3TRZA 3PIOA 5JVH3 4UP9A 1X3FA 3BG3A 3BZKA 5FKAC 4L5TA 1HPCA 4WJWA 2B63B 5C3WA 2B2WC 4KI0A 2HCCA 1K3BC 2H1EA 5IP9H 2CH4W 2EDGA 1L1OB 1STGA 4GNXA 3A8KE 2EPBA 2K33A 1PTOH 4DA2A 2JA6G 5JEAG 2UU9L 3D6CA 1XMQL 5HURA 3M4OH 1CSPA 3VA7A 4P73A 3STBD 5LMNW 2BDNA 1EOTA 2K5WA 5ELCA 5ELDA 3HOYH 1VCIA 4IUUA 3UDFA 5I6YA 2Z8LA 4GLXA 2PZUA 4GN3B 4EGVA 1FNVA 2D5DA 2F0MA 1NR4A 1LM0A 1YNJC 4A3KH 1WTXA 1SN8A 2JSOA 3OIQA 2L55A 3PIPA 1S4ZA 2NBFA 2LS01 1CI3M 1B53A 4XQNA 3H0GB 4L8JA 5AJ3Q 2RBMA 1PH2A 1M8AA 1I4HA 3K0YA 1FGUA 2QEJC 1ET6A 4OEMB 3OW7A 1D2BA 3FPPA 4RCOA 5IODA 3CCLA 4UP8A 2F0GA 4BY7G 4PMCA 3T53B 5EJWA 5IT9E 1Q12A 3K0XA 3HZXA 1TWFH 2Q2HA 2HIXA 3TP8A 1B44D 4NB3A 2RDHA 2KUMA 1GD7A 3I90A 2J7ZA 1IBKL 1HZCA 1FGBD 4LF8Q 2RKSA 4OGQC 4A3EB 1F2LA 4A3MH 1EQRA 1ICFB 1NTGA 5BR8L 1A6XA 1D8LA 2KCCA 4PMWA 2MUYA 2AQ3B 3PCOB 4ZUIA 2EIFA 3NBIA 4HCEA 1EFID 1PFMA 5CR3A 1OXUA 1K83B 1G2TA 3TMEA 3WOFA 1S72A 3UDIA 1J9OA 4B08A 3A8JE 2K5DA 3H6MA 3BVGA 2ASBA 2A6HD 1FL0A 3TREA 3A5UA 4LAAA 5C3XA 4JPBW 1RD9D 2KECA 3OTOL 1NCVA 2AUJD 3K80C 2AHOB 2GVAA 4O2DA 3CPWA 4JI6L 1P16A 5K36G 1JORA 2N8NA 3S2HH 2HDMA 5EQ0A 3RUZA 2XNAC 3K5NA 4RGTA 1HJPA 5J22A 1SMYC 2EY1A 2EJFC 1VS0A 1R9TH 1Y1VH 3FEWX 1EWHA 2TSSA 1JB7A 2WAQG 3MXGA 3GQBA 4HJ9A 3L7ZC 1CK1A 2K7VA 2WACA 1HZBA 1EYDA 2DJGC 1EZ8A 2PPBC 4X64L 4GNXB 3JC66 1GUTA 5M9OA 2ZJRA 1YJNA 2L11A 3UDXA 2XIWA 3X3NA 2F3IA 2R7ZH 2E5LL 1EYCA 4A3GB 2ICIA 2ZM6L 1VQFA 1BR9A 4L5SA 5EGTA 1XYIA 2XWJB 4C2MH 2EY5A 3BYYB 3G7LA 1IW7D 2QDBA 3SE0A 2F0UA 1J5EQ 1PYWD 4DR1Q 1Q82C 4YHHL 4PZ7A 2VZAA 1CKNA 2FMMA 2VQEL 1CHQD 3PO3B 2ZJPA 2G5DA 4HMIA 2A6EC 3T13A 3KFUA 2Z6KC 4HIKA 1HFNA 2IT1A 1YHQA 1ZYRC 2X6GA 3GTGH 5E1FA 3C2PA 1X65A 2L5TA 2L0CA 3I73A 1CZWA 1S5CD 2PW7A 5M5WB 2FJ2A 4GOPC 3NUCA 2B39A 2BDOA 2PNHA 3I2ZA 4J8QA 4P2CB 4AQYL 4KHZA 4ZCKA 2EYLA 3HOWB 2B2YC 4RMFA 4LFBL 3S2DB 2RSNA 5M3MB 1AZPA 4C1NK 3HOXG 2UUBL 2LXJA 2ZTDA 2BH8A 3TZUA 3I4MB 1GUNA 3MXPA 3NWTA 3P7JA 5M3FH 5C4HA 3Q22A 4JI5Q 1M4VA 4CKCA 3SGIA 4HCSA 1EY6A 5J39A 3ND8A 4A75A 3CXCA 4IOAA 1FD7D 3OMGA 3ONAB 3AB9A 1EIYB 3PMFA 3KOJA 4HN7A 1HNWL 1MBYA 1TS2A 2R7FA 3NTHA 1BBWA 3FHWA 1YBYA 3GP7A 3BJUA 1PV4A 1DOLA 4QF4A 2O5JC 1PLFA 1CSQA 3CCUA 4JI0L 1CQVA 4DR4Q 3TS2A 1L0XB 3FPUB 3L2PA 2HQEA 3MTSA 3KLRA 4FNFA 2P5ZX 2OCEA 3KBXA 2EYFA 2VL6A 1VDZA 3KK7A 2R92G 1I94L 2BE5D 2HCIA 5JJIA 3R93A 5C44B 2BA1A 3DWQA 1PFNA 4DUYQ 3ER0A 1KNEA 4KLKA 1EQVA 5IGCA 3LGJA 2YTXA 1FJGQ 1TIID 3K81C 1ZEQX 2NVYH 4CGYB 4KD3A 1PXUA 5CC4A 4OX9L 4EQPA 1Y8NB 3I72A 5K36H 1CKOA 4Q5VA 2KVMA 3WOEA 3NENA 1A2UA 4NXML 2F0KA 1YNJD 5M5XB 3K7AH 1SJHD 3T1YL 1OO9B 2WB1B 1TY0A 1HR0Q 3HGBA 5KRUA 4DAVA 4J1MA 5I9PA 4KJOA 3FVQA 1U4MA 2ES2A 1IL2A 1U5KA 1CA5A 5CV5A 3F2BA 1B2TA 4AH6A 4R9WA 2XN9C 3MEFA 1VQ5A 2MGSA 2LY7A 1ESRA 2IX0A 3VYRA 4JI2L 4KKUA 3R3OA 4TVAB 1CKNB 2JA8B 1ET9A 1GHJA 1WTWA 2CH4A 4XYOA 4DGZA 5LMNL 1EY5A 1O7ZA 4CDDC 2ZT9C 4B3ML 1VF7A 2R3ZA 3KLSX 1JWMD 3TBIB 2B63G 1K0RA 3TDQA 4DF7A 1PH3A 5CGKA 5I6WA 3Q24A 4BY1G 1T9HA 4X65L 3X3MA 4DU9A 1CA6A 1PH7A 2UUAQ 2CWPA 1V43A 3I56A 4DV5Q 3GTJB 4BS9A 2JXMB 3BU2A 1P8LA 1LLRD 3HOUB 4LF5L 4ILWA 3E9HA 2EYOA 4IPDA 4IZ8A 5BN3A 3F2UA 3JAMc 3GTPH 5COYA 2JEBI 1H9KA 2UXBQ 4KV6A 4XT1B 4LF6Q 1XWEA 5FO9B 2JE6I 1K73C 3TS0A 3SEBA 2H5XA 2M9VA 2OQ0A 1GHKA 4JBKA 3AYHB 2E76C 1TS3A 4ABNA 1Y14B 4JBMA 2K75A 5E7NA 4LW1A 1GJXA 2K14A 4DV0Q 1LABA 2OEOA 4IPCA 3KLSA 3BS1A 3DHQA 3EFXD 1T5EA 1KC8C 1XMOQ 3EROA 1Z47A 3S1QH 1Q90A 2HQLA 2PYKA 3CCRA 4G4KA 5C3EG 3CD6A 4A3JG 1IYVA 4YWKA 2FHTA 4N9TA 4F88A 4LF9L 1TKWB 1LT5D 3J81E 3S9WA 3GTLB 3R2IA 1O80A 1TWHB 1Z9FA 5DM73 3VR4A 4K14A 1I4XA 1QJOA 2QCPX 3K8AA 4RKBA 2WFWA 3TEHB 4A3EG 1K8MA 4UAIA 1QVFA 1WYDA 3MC0B 3M9BA 2IY5B 3UE1A 1DCZA 3VYTA 2KBNA 1PZID 4O1NA 4JI4Q 2WIIB 5DAUA 2C5CA 2F03A 1JMCA 2R92H 1Q1EA 4DR5Q 4FDBA 2V1CC 4NKLA 1SFOH 4A3LH 1Y8PB 3A54A 4JI7Q 4Z9CB 4DR6L 1XTCD 2A6ED 2K6AA 4TKOB 2XTIA 3PF4A 2AMCB 3M4PA 1H9JA 1ZYRD 5C0XG 3M85A 1G6PA 1PH1A 2VQFQ 1IXRA 5EAYA 1NY4A 1LTGD 5ELFA 3KJPA 4WORA 1MHWC 5AJ3L 3K6OA 1CKMA 5ELEA 3RZOH 4HJ5A 2F0HA 3FDTA 3V96A 1PZKD 3D6WA 3U4VA 4DV2Q 1ICWA 2MJ8A 1J6QA 1ZXTA 2HIVA 4IJHA 4P74A 1TU2B 2PO4A 4ODGA 1GUSA 3CRKC 1Z7TA 2JA7B 4JYAQ 1S5FD 1VQIA 3T56B 1EQQA 4A3GG 4LF8L 1YIJA 1F9RA 1PVOA 5CBEE 3M7NA 2RDGA 5I4DA 1XXGA 4ZK9B 1C4QA 1SYDA 4R8IA 2B63H 3C1EA 3MWYW 4YIJA 1WD0A 3D31A 1Q8KA 5IOCA 1PTOC 1A62A 1BVSA 4G7ZC 4BY1H 3CC7A 1EY0A 2N78A 5JAVA 3S1MB 1JJ2A 2HD3A 1LT4D 2BOSA 3S1NH 1J8IA 1ZKOA 1B50A 2EE1A 3RD4A 3E5SA 2IW3A 4R4QA 4ZAIA 1EU3A 2F0PA 1KIXA 4L63B 4ZKBB 3PO3G 2IX1A 4ZLTF 1GKHA 1E1TA 3D3RA 2XGTA 3MXUA 3OOCA 4XTCS 4DXGA 1V1PA 4A3DB 1NE3A 3PO2G 4HR7B 1KRTA 1Z6HA 1YI2A 2K04A 4A3IH 4LUZA 4R8NA 5HGTA 1K0SA 1IBLQ 1K28A 2IPKD 3HOWG 2K1BA 1ASZA 5M5YH 1CTMA 3K5LA 3I4MG 4JOIA 3OIPA 4C3JB 1STHA 4IALA 5C3EH 4Y7NB 4A3JH 2QDLA 5JPMC 1XPOA 1X54A 1S40A 2NVTB 1F77A 4DV3L 4X6AH 3S16H 2EOTA 2GN5A 2L4NA 3CQZB 1W3SA 3BVMA 1IBMQ 1VQHA 3HOZH 3PF5A 1PMRA 1JCKB 1TT2A 1WCMH 4OL7A 4A3EH 1J5EL 4FF3A 1T5XD 5CV8A 4DR1L 4QIWB 1PHJA 2VUMH 2OQKA 1FYCA 3C1FA 1CUKA 1E1OA 4TSSA 3CCQA 1K83H 2K32A 5DNFA 5C5LA 1BO0A 2C35B 3KUPA 5IGGA 5FLXc 1H95A 1EEID 5C44G 1JWUD 5LL6S 1VQBA 5C0XH 4UY8C 2B29A 4IPHA 2K5NA 2PMZE 2H4OA 1LACA 4JG2A 4IFDI 2R93B 3I4NH 1AE3A 1I6HB 5IP7H 1D5MC 3OSOA 1EYGA 1Y1WG 2VY3A 5IGBA 1NUCA 4JI1Q 1Y69U 1ASYA 2E75C 4JI5L 2BCOA 1HCZA 3DEPA 1MIUA 3R8BA 2PQEA 5IGFA 1RDPD 4A3FB 1ENAA 1RKNA 3GTQB 1TWCB 1YJWA 1DGSA 1N9WA 1SR3A 1JE5A 4OO1G 4WRDA 3CCJA 1UE6A 2L9HA 2JA8G 4OIJA 4NW2A 4A3GH 2JEAI 1EYAA 1S5DD 2L15A 4G57A 4LF4Q 1STNA 3MVVA 3VR3A 1VQNA 2KENA 1GUWA 1O7YA 2DY8A 2R6GA 1C8CA 1V1PB 2KEDA 1IL8A 2Y0SB 1R4QB 4X3TA 2JA5G 1E3PA 5KEEA 4WFN3 3T4AC 4XYQA 2XRSD 1V8QA 2FMCA 3TN2A 1SE3A 3BVZA 2NYZD 2TMPA 4DUYL 1U4RA 4OXPA 3PO3H 1C9OA 1EY4A 1S3OA 5CV9A 1FJGL 3NEMA 1WD1A 4RH6A 4TQUS 2WV6D 3HOUG 5T1GA 1IYUA 1ILQA 4BBSB 3BDLA 4K8JA 4GS3A 2UUCQ 1DZ1A 3PO2H 5M5WH 2A69D 2E2IB 3MZ5A 4OELB 5K5PA 1RTNA 2MHVA 4B3RQ 4A3BB 1R4PB 2B2UC 2OT2A 3VR6A 2YU9B 1WI5A 3P75A 3S2DH 5C6AA 1BNZA 4XQQA 3RN5A 4YWMA 4HJ8A 3LWUA 1PRTD 3I4MH 4JI8Q 1PRTB 1HUNA 2KOLA 2UXDL 5FOBB 3Q0AA 2K52A 1SYEA 3H15A 1FNWA 1UAPA 2SOBA 1YJ9A 2B2WA 5GADC 5A2QE 1Q46A 4WJ4A 3NK9A 3NSWA 1RL2A 1STAA 3H91A 2OTJA 4PV1C 3MA2B 2A68C 2XWBB 3GDEA 4GLVB 3J7YW 2A5HA 5GAHC 2NUCA 1E2WA 3TZDA 2A73B 2WB1E 3VDYA 5FJ8G 2BH2A 3U4ZA 2I5HA 3I91A 4DK6C 5C4JH 3J7AV 2ZTCA 3AEVA 1FVIA 1JOOA 3ULJA 4AIMA 5KNCA 4IFDG 2WP8J 1PTOD 3ZJYC 5G3LD 2F0TA 2UUAL 1VMCA 4C3HG 4P72A 4DV5L 4DR3Q 1BCPD 1PH6A 2RVLA 1BCPB 3M4OB 1KXLA 1YITA 2Z6BA 5C44H 3HG9A 1ONLA 1KRSA 3D0FA 3HOYB 4KHPQ 1DJRD 2UXBL 4DAMA 2PMZB 4LF6L 1NAPA 1EIFA 3ND9A 4G7HC 1D1KA 2WKDA 2KHSA 4DAYA 3IFDA 1B9MA 1F9QA 1VQOA 2ZXOA 1Y1WH 1GOZA 2JA6H 4PQXA 5JEAH 4J15A 3D4RA 3NPPA 4DV0L 5ELNA 2B3GA 3L3OC 2KQ3A 3S17B 2F3WA 1XMOL 2B2TC 2F0SA 3K5OA 5IYCG 3EVQA 1OXVA 2I5LX 3J80i 2KA7A 3PGZA 1STEA 1CM9A 1WTHA 3PUVA 4OHJA 4Y52H 1F9SA 2VNUD 2BA0A 1SNMA 1TWFB 1SNDA 4B9XA 1IYJB 4LFAQ 5FLMG 4KKSA 4OWXB 3T51B 2MP1A 3KBGA 4DV6Q 2JA7G 1A2TA 3F8TA 1I5FA 1UE1A 3BDCA 3E3XA 4KD4A 1EWCA 4A3MB 2PQAA 1SXTA 1H9RA 1GO3E 4IURA 4PZ6A 4BY7H 1I50B 4JI4L 1WTRA 5C4XG 1HA5A 3M7GA 2JA5H 1E22A 2F0DA 3PQIA 1L0YB 3S1RB 4DR5L 2VW9A 4DV4Q 4BBRG 1AZQA 1LV9A 3Q8DA 4RWSC 3VR2A 3JAME 1QVCA 3I8ZA 1X55A 3GTJH 1I3QH 1WTVA 4DV1L 3HOUH 2PZTA 1LUZA 1OXSC 2VQFL 2NVQH 4DNRB 4K0KL 4FXKC 4DN4M 5BN5A 5LMUQ 2G9HD 3DWAA 3QOLA 3MFGA 2QA4A 4ZQ3A 3RZDB 1CFMA 1R9TB 4RA8A 4IN3A 1Y1VB 1W6KA 2JJQA 1HNXQ 2K03A 1AP0A 2ZTEA 1X9NA 2IJ0A 1W6JA 3PIO3 3TP7A 3ULLA 1N34Q 5HY6A 2D9UA 5F2DA 3C46A 2EY6A 2F52A 3NELA 4GLAC 3SXHA 1B8AA 5DEHA 4JYAL 3DLLA 4R1JA 4OWWB 2E2JH 4K6DA 3N6RA 2J0TD 1SNCA 3Q6SA 3CCEA 5FJ8H 4QJFA 1MKHA 2QF7A 1UEBA 3OWEB 3W1BA 5JPNC 5LHY1 4H13C 2F0OA 2IHFA 4NMZA 4HTHA 2JK8A 5C0XI 2Z6KA 1EEFD 2VXWA 2QKIC 5JJZA 4IFDH 1EL0A 1BXTA 3KF6A 4Q0FA 4DAYB 5CORA 4C3HH 3J80L 3GTOH 3VYUA 1H9SA 3O13A 5EPKA 3GTKB 1XTDA 3AQQA 1C0AA 4GOPA 1QB5D 3NQTA 5HGQA 2JYOA 2DNCA 3J81i 2EYJA 2EJMA 3I70A 4RKLA 5C4ZA 2QEXA 1KLGD 3A7AB 3IFTA 2WINB 3EBEA 3SR1A 2NN6I 4CKEA 3SHLA 3PIP3 1K8GA 2B2YA 1E0BA 3GTGB 4DR2Q 4ULLA 1PYBA 2ZJQA 3HOVB 4MTNA 4C3IB 3U58A 4H44C 3N52A 5EKIA 3UE0A 1KNAA 5AFWA 4YWLA 1HNZQ 2AQ2B 1IBLL 2R93G 1TWAH 4UPAA 1ILPA 1WVLA 1U4LA 4NP5A 1I4RA 1QCBD 3VR5A 1F2ZA 5TSSA 4RGMA 3A56A 4EVOA 4IUTA 5M3FB 1AN8A 5E4XA 4J6HA 4O42A 4ALPA 2PQAB 4MIUA 2VB2X 1JOQA 1VQ8A 2PNRC 4HIDA 2F0JA 1G2SA 4A3FG 2RA4A 4ZUJA 5FLMH 1A8VA 4I7ZC 2JA7H 1IBML 1EY8A 2KCTA 3DXJC 4DV7Q 3CPFA 1QNUA 2RHQB 1I4GA 2A68D 4FXGC 1SMYD 4CJ0B 3HOXH 1M90C 1XPUA 1NSNS 2DN8A 1HZ9A 3QG1A 3H0GG 2MO0A 2I0QA 1SBBB 1L1OC 4C56C 2EJGC 1AFPA 4IUNA 2KJXA 3MEHA 4UHVA 5C4XH 1RCVD 3CAMA 4F87A 1IHZA 1I6VC 1EY7A 2Y0SG 5A35A 3LX0A 1EZ6A 2ID0A 4BBRH 4MZ9A 4GN5A 4RGNA 1BOSA 2MPMA 4L5QA 4FF1A 4YCVA 2XVSA 1JR0D 4LJZC 3R2TA 1HR0W 1N8RC 4A93B 1KAWA 2NVYB 5EBDA 2NTTA 4KY7A 2O2LD 4BBSG 2J4XA 4QIWE 1E2ZA 3NP8A 1DM0B 3ERQA 2NTSA 4YCWA 3J80c 1UE5A 2AWOA 4A3BG 4YCUA 1VQMA 4KJNA 1A63A 2SNSA 4JI1L 2KEEA 2ZXRA 1C7YA 3J81L 4A3CG 2WKCA 2KHIA 2EZVA 3A8IE 4NXNQ 1VQCA 2K05A 5H1SE 3K5MA 2F0QA 4KN4C 4X62Q 3HS0C 1GXDC 2CCZA 1SYGA 2JN4A 3KF6B 1MJCA 4Y7NH 4POGA 1VQGA 2NVTH 3W5OA 1H9SB 1X3EA 1AW7A 4GN4B 4GOPB 3CQZH 3MXNA 2O5IC 2NN6G 3G6JB 1QVGA 3EQLC 4K5WA 5EBCA 2AUKA 2SDFA 1ML0D 2AWNA 4L6TB 5IIFA 1EUJA 1NR2A 1O7IA 3OYYA 4YY3Q 1LTBD 2FFKB 1B4OA 1O78A 1WTQA 1F9PA 3KJOA 1SLJA 3G6EA 2RCNA 5FLXE 1LTTD 2DUDA 2CKZB 3BDOA 1YNXA 1KL9A 2B8FA 1VQ4A 2D2CC 3EIVA 1DOMA 2A1AA 4RHRA 2A6HC 1SMXA 2HHHQ 4QL5A 3H3VC 1C48A 2IWHA 4QMGA 2UUCL 4IOCA 2CFMA 2EY2A 1BBUA 5IGDA 1BQQT 1YVCA 4KY6A 1X6OA 2Y0SE 1D5XC 4XIGS 4APVA 4OO1I 1EQTA 2E2HB 1XPRA 4UP7A 1S5BD 3S14B 1B3AA 3RN2A 2NVXB 4JI8L 3S15B 3RMHA 1JQYD 4CKBA 3CP0A 1FNUA 1MGSA 1JE4A 2DJFC 4RHSA 3S1QB 3TP5A 4K5XA 4GNXC 5I2XA 4A3FH 1KABA 1VQ9A 3TQYA 2JA9A 4K5VA 3SVMA 3H09A 4FVMA 2NB0A 4QY7A 1LTRD 2Q8TA 1VQJA 1OTCA 1IW7C 4DUZQ 1RJTA 4JBJA 3A0JA 3H0GH 5M3MG 1MI2A 3DUZA 1UWVA 4IPGA 3QWNA 2VS1A 2F0VA 1OXTA 4POFA 1KTKA 1SYBA 2F4VQ 4ME5A 1QNKA 2D0OA 4GKKQ 2D0PA 3PV0A 4DR3L 2CW0C 4ZKCB 2R92B 4LF7Q 3NHHA 3ERSX 3DM1A 4LNQA 3HKZB 1SFOB 2JQOA 4KHPL 4LFCQ 1Q86C 1BF4A 4CHTB 4DK0A 4CDFC 2CQOA 5D14A 2MQHA 2K5HA 1EU4A 3CC2A 4OONA 4FO2A 2K5VA 1EIGA 4NPSA 3CCMA 3OPOA 1WOCA 5KIXA 1JT8A 2K28A 5ELBA 1SE8A 4QCLA 1K8OA 1LTAD 2Z4HA 4A3BH 4JC0A 3MXNB 1LYLA 2D62A 3RZOB 2MFIA 1N33Q 1NMFA 4R4TA 4A3CH 3E0EA 3Q23A 4CDEC 3FMCA 3M3YB 1UE7A 2LKVA 4QUCA 2B8GA 5JVG3 3U9SA 5FK9C 3PSIA 1TXYA 2EXDA 2O4XA 3F2CA 1MJEA 4B3SQ 3H3VH 4DFAA 2ZXPA 5CYUA 3CKIB 4LFAL 3AMUA 3FKIB 2LMCB 2XSCA 3J81j 5KYIA 2F0IA 4F8MA 2NN6H 1GUOA 3TSSA 1XJVA 3GD7A 4N8FA 2WB1G 4A4IA 3CCSA 3MFYA 1HA6A 2F0EA 3K59A 2G9DA 1TVXA 4BY1B 3K58A 5IWAQ 1A0IA 1NJIC 5IGEA 1B1ZA 4DV4L 3S1NB 4JV5Q 2FINB 1BBXC 2BE5C 3V2TA 2ALYB 4ZRZA 3RLNA 1QZHA 2OTLA 5IE8A 2GA4B 4JVZA 1QZGA 4XT3B 1AEXA 3GO5A 2UXCQ 4DR6Q 1Y8OB 3M4YA 3NQIA 1QUQA 2YYZA 1WTOA 4R4CA 1MSHA 1SNQA 4RAUC 3HOVG 4C3IG 5LMUL 2YTYA 2N55A 4HJ7A 4DR4L 3I4LA 1Q1BA 1F2MA 1N32Q 4A3IB 5CMDA 2NZ1D 2R7DA 1JC7A 1TS5A 1LTID 2A8VA 5E3FA 1SE2A 4KK7A 4QGUA 4WJ3M 1HNXL 4IUQA 4EQNA 5M5YB 2F0WA 3S17H 1N34L 1SDFA 4CJ2C 5J3BA 4IQZA 5M3FG 1VQ7A 4R4OA 1IKMA 1BKBA 1SYCA 2LXKA 5C3EB 1PDQA 1VQPA 1X32A 2Z4IA 4A3JB 2AKWB 4X66Q 2PZWA 1TWGB 4MNOA 1K9MC 1M1KC 2GVBA 1VQDA 4IUVA 4FF4A 3S16B 2Q8RE 5IT9L 4DK1A 2AQ1B 1TQOA 4KHVA 3BYTB 2L1BA 3HOWH 2N88A 3HOZB 1SRUA 1HR0L 4DPGA 5M3MH 1WCMB 4JBWA 4DKAC 1YEZA 4OIKA 1E7ZA 1B3QA 4JI3Q 3CW2C 1Q8IA 5KNDA 4QUFA 2OWOA 2VUMB 1PRTF 2Q2IA 1I50H 5CV6A 4AYBE 3GTMB 4X3UA 3D4DA 4KKTA 1EY9A 4IO9A 4ZYSA 3S1RH 4HMJA 1D5ZC 3E6ZX 4PMBA 4A76A 1UEAB 3W2DA 3CMEA 4KTAA 4DR2L 3PUZA 1DD2A 3E9IA 3L9AX 3F2DA 2PI2E 5D65A 2F1MA 1DOKA 4A93G 2RDFA 4H02A 5KNBA 4DAPA 1HNZL 3QOJA 1D6EC 3I4NB 1CT1D 2Z0SA 3CRLC 3IAYA 1PTOB 1RIPA 5A2QL 3JAMi 5T1IA 3WWVA 1PTOF 1HXYD 3RZDH 5G3LF 1WJJA 3T1HQ 4DR7Q 3SK4A 3HEJA 1N36Q 1K3RA 1BCPF 3HRZC 1CHPD 1YNNC 2PI2A 4B3TQ 1XNRQ 3NBHA 3BZCA 3PUWA 1G51A 5JEAJ 3ITPA 1I4PA 4C1NI 4XXEA 1WTPA 1XNQQ 1GVPA 1QWYA 4H7BA 1KAAA 3J7A5 2I07B 4DV7L 4A3KB 2X6LA 5CBAE 4DV3Q 2CQAA 4JCVE 3TP6A 3I7FA 5M5XH 2EXZA 2M2LA 4RGOS 2LSSA 3J7AF 4TRDA 4FP5D 3KYHC 3IKJA 4GKJQ 1QUQB 5CV4A 2ATWA 5KGUA 1L2FA 3S24A 5L37A 4KY5A 1BUVT 2LFNA 1G8ZD 4OO1H 1CZGA 1EWIA 2C9OA 4HSPA 1O7LA 2CW0D 3GTKH 4RFBA 2JA8H 5IT9c 1PZJD 2B2UA 4MHEA 3C3LA 1W2BA 4V190 1G6ZA 3HOVH 4K6LA 1Q3LA 1TS4A 3QIAA 4C3IH 2RQXA 3PO2B 3CHBD 1VQEA 2EYHA 3I3CA 3ZYYX 3LWEA 1HTLD 2EYMA 3CMAA 2OXPA 4B9WA 2EYPA 3NWSA 4L5RC 4I7AA 2MO1A 3KDFA 4I65A 2IL8A 2HDLA 3IRBA 2I5MX 1KQSA 4JI7L 2UU9Q 2SNMA 4NXNL 1XMQQ 2F3VA 2RHSB 3HP3A 1HQMC 4BXXG 4P75A 1JJGA 3SDZA 3OHXC 5NUCA 1SSOA 1K8AC 4X62L 1A3UA 2IX3A 4QQBX 1UNSA 3U9OA 4PG3A 4DXFA 1V1OA 1JOKA 2EVBA 1B7YB 3DM3A 4A3DG 3S2HB 3EJIA 3G4SA 3OMCA 2FXQA 4JK1C 4KMUC 5IYBG 3JAML 1VQLA 2WAQE 2HUGA 5EKKA 2K01A 5D3DA 5IYDG 5C4JB 4DV2L 4YY3L 1SYFA 1LTSD 2A74C 4K2LA 4AYBB 4C3JG 4HEDA 2K50A 1KLUD 4CJ1B 3I55A 1JICA 4BA2I 4PZ8A 2R7ZB 4R4IA 4IFDJ 5D3IB 5JOBA 1JB3A 2HHHL 2OF1A 2SEBD 3KLWA 3J7ZC 3HKZG 4C2MB 3GTLH 4A3LG 3AFPA 4DNTB 1TWHH 3NTIA 3KF8A 1IBKQ 3NBHB 2F0LA 1LO5D 3QR8A 1X3QA 1SAPA 5C5MA 4A93H 1L0WA 4NDXA 4O0AA 5J1ZA 3J80E 1SEBD 4K2KA 1Q7YC 5BR8Q 1TR5A 1AE2A 3OW2A 2Q2TA 2B2TA 4EX5A 3H3VI 4HSVA 2NWGA 1A15A 1Y1WB 4CDCC 2JA6B 2PCFB 2K4KA 3RLOA 1H9MA 1QILA 4N9PA 4U673 2QGQA 1HRJA 1BDOA 1OXXK 5LL6X 2F0FA 3LNNA 2NZOA 2UXDQ 2ENBA 2KHJA 3OTOQ 1A3TA 3A7LA 3FP9A 1QG7A 4JI6Q 1AH9A 1SNPA 2QILA 3FKIG 4BWGB 1PA6A 3AFQA 1KHIA 1E24A 2CHBD 2E74C 3WDNA 4DUZL 2CWAA 4FYDA 2L12A 1A3VA 1NMGA 1X3GA 3RNUA 3GV3A 2DGYA 3RR5A 2F4VL 5JJLA 2KCMA 4BY7B 2R61A 5IYCH 1D7QA 1B70B 3CU7A 3SK5A 3SK6A 4GKKL 3G71A 1TY2A 1VMPA 1ENFA 2JA5B 4LF7L 4ME3A 3NE5B 1PYSB 2N49A 1X3PA 4X64Q 3CF5A 1B9NA 1STYA 3BZDB 3G48A 3F1ZA 4RCNA 3KDFB 4LFCL 2XRQD 2E5LQ 2YV5A 1I3QB 4LUOA 4X3SA 2ZM6Q 3B6YA 3FRPB 2JP1A 3ULPA 2NVQB 1JWSD 1HTPA 1LT6D 4IUPA 3W1GA 3CC4A 3D4WA 2NZHA 3S1MH 4YHHQ 2ICEC 4A3IG 1PH9A 4H0LC 4U68A 1HFGA 2E2HH 2IHEA 2Z1CA 1YHBA 5GAEC 1N33L 2VQEQ 3IL8A 4ID6A 1SE4A 4OWTB 3S14H 3HKZE 3STBC 4BXXH 2NVXH 3S15H 1HZAA 5ISRA 4QB4A 5E4WC 1E2VA 4BA1I 2EQSA 4F7XA 1YNND 1SROA 1PH8A 1VQAA 4JW0A 4B3SL 3ICEA 2B2VC 4GZYC 4MN3A 1DYQA 1FR3A 1SJED 3V05A 4A3DH 4V0BA 4HJAA 2E2JB 3GV6A 3K7AB 4AQYQ 1DXMA 1HQRD 4FXDA 5IYBH 3K57A 2Q2UA 1G291 4LFBQ 3HOZG 2WAQB 4EQOA 1EFWA 3KF8B 1RTOA 5ELOA 5BN4A 1WCMG 2UUBQ 5IYDH 4HIOA 5IWAL 5I9OA 4C3JH 4JV5L 2VUMG 1EOVA 1NNXA 4C3HB 3OWFA 3GTOB 4XDXA 1V9PA 1STBA 5IY0A 2RF4A 2RSOA 1MSGA 2N3SA 4PNYA 4JOIC 1CQFA 3NTKA 4LWCA 4LF4L 2UXCL 2V4DA 3H94A 1HNWQ 1LTLA 4DV1Q 3T16A 1MD2D 2A69C 1N32L 5IP9G 4K0KQ 1HHVA 3MHBA 5EPLA 4M1UB 1TWAB 3SK8A 1KDCA 3HKSA 3HFZB 4JI0Q 3I4NG 5IP7G 3UI2A 1RHPA 4HAEA 1EIHA 1DONA 3A74A 1PRTC 1I94Q 5DM63 2DNEA 3UDGA 5FO7B 5FO8B 3RLFA 1QOHA 3GTPB 3M3YH 3HOYG 4X66L 4FF2A 1Q81C 2M00A 4OX9Q 1L1OA 1RODA 2Z9HA 4B3RL 2R93H 3L0OA 3DWPA 3DEOA 1U0LA 3D8GA 1PFBA 1HH2P 3FKIH 1I6HH 5FLXL 2PW5A 4A3KG 3MAQA 4NXMQ 5EKLA 3HOXB 1IKLA 4P71A 3T1YQ 3QB3A 1KDBA 1IZ6A 4N8X1 4JI3L 3VYSA 1WFQA 4LMQD 1X56A 1D1IA 5C4XB 2E2DC 4UDUC 4IJLA 1VF5C 1SNOA 3AU7A 1TWCH 3GTQH 4BBRB 2K5QA 1BCPC 3P1HA 2B2VA 1PH5A 4MTKA 3M4QA 1KDAA 4JI2Q 1KD1C 3CCVA 2E8GA 3A5ZB 3DMUA 1V1QA 4E6IA 4DK3C 5LMNQ 3PUXA 3EN2A 5GAGC 3I4OA 3J81c 4B3MQ 2Q8IB 4A3MG 1YZ6A 5JJKA 3U50C 1YHAA
chains in the Genus database with same CATH topology
5CV7A 4LK1C 2I46A 3PUYA 3QO2A 5EPJA 1II3A 4CBVA 2KCNA 5I2YA 2DY7A 3E0JA 3NXWA 4M8AA 1RF2D 2CVRA 3QJYA 2F0NA 5KYLA 2F4IA 1G91A 4XQJA 2X69A 5C0XJ 1S5ED 4X3KA 4K8IA 1XX8A 4KN7C 2VB3X 1QE6A 1GUGA 1HUMA 3EA6A 1I4QA 1LT3D 3URYA 4G7OC 1U9RA 3P20A 4S3SA 1ESFA 3VA5A 1F2YA 1UUPA 1U4PA 1ENCA 3W3AA 3A55A 5JVH3 3BG3A 5FKAC 1HPCA 4WJWA 2B63B 5C3WA 2B2WC 4KI0A 2HCCA 2H1EA 2EDGA 1STGA 3A8KE 2EPBA 2K33A 1PTOH 4DA2A 5JEAG 3D6CA 5HURA 3VA7A 2BDNA 1EOTA 2K5WA 5ELCA 5ELDA 1VCIA 4IUUA 5I6YA 2Z8LA 2PZUA 4EGVA 1FNVA 2D5DA 2F0MA 1NR4A 1YNJC 1WTXA 2JSOA 3OIQA 2L55A 1S4ZA 2NBFA 2LS01 1CI3M 1B53A 4XQNA 3H0GB 4L8JA 2RBMA 1M8AA 1I4HA 3K0YA 2QEJC 1ET6A 3OW7A 1D2BA 3FPPA 4RCOA 5IODA 2F0GA 4PMCA 3T53B 5EJWA 5IT9E 1Q12A 3HZXA 3TP8A 1B44D 2RDHA 2KUMA 3I90A 2J7ZA 1FGBD 2RKSA 4OGQC 4A3EB 1F2LA 1A6XA 2KCCA 4PMWA 2MUYA 2AQ3B 4ZUIA 3NBIA 4HCEA 1EFID 1PFMA 5CR3A 1OXUA 1K83B 1G2TA 3TMEA 3WOFA 1J9OA 4B08A 3A8JE 2K5DA 3H6MA 3BVGA 2A6HD 4LAAA 5C3XA 1RD9D 2KECA 1NCVA 2AUJD 5K36G 1JORA 2HDMA 5EQ0A 3RUZA 2XNAC 3K5NA 4RGTA 5J22A 1SMYC 2EY1A 2EJFC 3FEWX 1EWHA 2TSSA 3MXGA 3GQBA 3L7ZC 1CK1A 2K7VA 2WACA 1EYDA 1EZ8A 2PPBC 1GUTA 5M9OA 2L11A 2XIWA 3X3NA 1EYCA 4A3GB 2ICIA 1BR9A 5EGTA 1XYIA 2XWJB 2EY5A 3BYYB 3G7LA 1IW7D 2QDBA 3SE0A 2F0UA 1PYWD 2FMMA 1CHQD 3PO3B 4HMIA 2A6EC 3T13A 1HFNA 2IT1A 1ZYRC 2X6GA 5E1FA 3C2PA 2L5TA 2L0CA 3I73A 1CZWA 1S5CD 2PW7A 5M5WB 2FJ2A 2B39A 2BDOA 3NUCA 4J8QA 4P2CB 4KHZA 2EYLA 3HOWB 2B2YC 3S2DB 2RSNA 5M3MB 1AZPA 4C1NK 3TZUA 3I4MB 1GUNA 3MXPA 3NWTA 3P7JA 5C4HA 3Q22A 1M4VA 4CKCA 4HCSA 1EY6A 5J39A 3ND8A 1FD7D 3OMGA 3ONAB 3AB9A 3PMFA 4HN7A 1MBYA 1TS2A 3NTHA 3GP7A 1DOLA 4QF4A 2O5JC 1PLFA 1CQVA 1L0XB 3FPUB 2HQEA 3MTSA 3KLRA 4FNFA 3KBXA 2EYFA 1VDZA 3KK7A 2BE5D 2HCIA 3R93A 5C44B 2BA1A 3DWQA 1PFNA 1KNEA 1EQVA 5IGCA 1TIID 1ZEQX 4CGYB 4KD3A 1PXUA 5CC4A 4EQPA 1Y8NB 3I72A 5K36H 4Q5VA 2KVMA 3WOEA 1A2UA 2F0KA 1YNJD 5M5XB 1SJHD 1OO9B 2WB1B 1TY0A 3HGBA 5KRUA 4DAVA 4J1MA 5I9PA 4KJOA 3FVQA 1U4MA 1CA5A 5CV5A 1B2TA 4R9WA 2XN9C 2MGSA 2LY7A 1ESRA 2IX0A 3VYRA 4KKUA 3R3OA 2JA8B 1ET9A 1GHJA 1WTWA 4XYOA 4DGZA 1EY5A 1O7ZA 2ZT9C 1VF7A 2R3ZA 3KLSX 1JWMD 3TBIB 3TDQA 4DF7A 5CGKA 5I6WA 3Q24A 3X3MA 4DU9A 1CA6A 1V43A 3GTJB 4BS9A 2JXMB 1LLRD 3HOUB 4ILWA 5BN3A 2EYOA 4IZ8A 3F2UA 5COYA 2JEBI 1H9KA 4KV6A 4XT1B 1XWEA 5FO9B 2JE6I 3SEBA 2M9VA 1GHKA 2E76C 1TS3A 4ABNA 1GJXA 1LABA 2OEOA 3KLSA 3BS1A 3DHQA 3EFXD 1T5EA 3EROA 1Z47A 1Q90A 2PYKA 4G4KA 1IYVA 2FHTA 4N9TA 4F88A 1TKWB 1LT5D 3J81E 3S9WA 3GTLB 3R2IA 1O80A 1TWHB 5DM73 3VR4A 4K14A 1I4XA 1QJOA 2QCPX 4RKBA 1K8MA 4UAIA 3MC0B 1DCZA 3VYTA 1PZID 4O1NA 2WIIB 5DAUA 2C5CA 2F03A 1Q1EA 4NKLA 1Y8PB 3A54A 4Z9CB 1XTCD 2A6ED 2K6AA 4TKOB 1H9JA 1ZYRD 5C0XG 3M85A 1LTGD 5ELFA 4WORA 3K6OA 5ELEA 2F0HA 3FDTA 3V96A 1PZKD 3D6WA 1ICWA 2MJ8A 1ZXTA 1TU2B 2PO4A 4ODGA 1GUSA 3CRKC 1Z7TA 2JA7B 1S5FD 3T56B 1F9RA 5CBEE 3M7NA 2RDGA 5I4DA 1XXGA 4ZK9B 1C4QA 1SYDA 4R8IA 3C1EA 3MWYW 4YIJA 1WD0A 3D31A 5IOCA 1PTOC 4G7ZC 1EY0A 5JAVA 3S1MB 1LT4D 2BOSA 1J8IA 1ZKOA 1B50A 3RD4A 2EE1A 3E5SA 4ZAIA 2IW3A 1EU3A 2F0PA 4L63B 4ZKBB 2IX1A 4ZLTF 3D3RA 3MXUA 3OOCA 4XTCS 4DXGA 1V1PA 4A3DB 4HR7B 1Z6HA 2K04A 4R8NA 5HGTA 2IPKD 2K1BA 1CTMA 3K5LA 3OIPA 4C3JB 1STHA 4IALA 4Y7NB 5JPMC 2NVTB 1F77A 2EOTA 2L4NA 3CQZB 3BVMA 1PMRA 1JCKB 1TT2A 4OL7A 4FF3A 1T5XD 5CV8A 4QIWB 1FYCA 3C1FA 4TSSA 2K32A 5DNFA 5C5LA 1BO0A 3KUPA 5IGGA 1EEID 1JWUD 5LL6S 5C0XH 2H4OA 1LACA 4IFDI 2R93B 1I6HB 1D5MC 3OSOA 5IGBA 1NUCA 1Y69U 2E75C 2BCOA 1HCZA 3DEPA 3R8BA 2PQEA 5IGFA 1RDPD 4A3FB 1ENAA 1RKNA 3GTQB 1TWCB 4OO1G 4WRDA 2L9HA 4OIJA 4NW2A 2JEAI 1EYAA 1S5DD 4G57A 1STNA 3MVVA 3VR3A 1GUWA 1O7YA 2DY8A 2R6GA 1C8CA 1V1PB 2KEDA 1IL8A 2Y0SB 1R4QB 4X3TA 5KEEA 4WFN3 3T4AC 4XYQA 2XRSD 1V8QA 2FMCA 3TN2A 1SE3A 3BVZA 2NYZD 2TMPA 1U4RA 1EY4A 5CV9A 1WD1A 4RH6A 4TQUS 2WV6D 5T1GA 1IYUA 1ILQA 4BBSB 3BDLA 4K8JA 1DZ1A 2A69D 2E2IB 3MZ5A 5K5PA 1RTNA 2MHVA 4A3BB 1R4PB 2B2UC 2OT2A 3VR6A 2YU9B 3P75A 5C6AA 1BNZA 4XQQA 3LWUA 1PRTD 1PRTB 1HUNA 2KOLA 5FOBB 3Q0AA 1SYEA 1FNWA 1UAPA 2SOBA 2B2WA 5A2QE 3NK9A 3NSWA 1STAA 3H91A 4PV1C 3MA2B 2A68C 2XWBB 3J7YW 2A5HA 2NUCA 1E2WA 3TZDA 2A73B 3I91A 3J7AV 1JOOA 5KNCA 4IFDG 2WP8J 1PTOD 5G3LD 2F0TA 1VMCA 4C3HG 1BCPD 2RVLA 1BCPB 3M4OB 3HG9A 1ONLA 3HOYB 1DJRD 2PMZB 1NAPA 3ND9A 4G7HC 1D1KA 2WKDA 2KHSA 4DAYA 3IFDA 1B9MA 1F9QA 2ZXOA 1GOZA 4PQXA 5JEAH 3D4RA 3NPPA 3L3OC 2KQ3A 3S17B 2F3WA 2B2TC 2F0SA 3K5OA 3EVQA 1OXVA 2KA7A 1STEA 1CM9A 3PUVA 4OHJA 1F9SA 2VNUD 2BA0A 1SNMA 1TWFB 1SNDA 4B9XA 4KKSA 3T51B 2MP1A 3KBGA 1A2TA 3BDCA 4KD4A 1EWCA 4A3MB 1SXTA 1H9RA 4IURA 1I50B 1WTRA 1HA5A 3M7GA 2F0DA 1L0YB 3S1RB 1AZQA 1LV9A 4RWSC 3VR2A 3JAME 3I8ZA 1WTVA 2PZTA 1OXSC 4DNRB 4FXKC 4DN4M 5BN5A 2G9HD 3DWAA 3QOLA 3MFGA 4ZQ3A 3RZDB 1CFMA 1R9TB 4RA8A 4IN3A 1Y1VB 1W6KA 2K03A 1AP0A 2IJ0A 1W6JA 3PIO3 3TP7A 2D9UA 5F2DA 3C46A 2EY6A 3SXHA 5DEHA 4K6DA 3N6RA 2J0TD 1SNCA 3Q6SA 2QF7A 3OWEB 5JPNC 5LHY1 4H13C 2F0OA 4NMZA 4HTHA 5C0XI 1EEFD 2VXWA 2QKIC 5JJZA 4IFDH 1EL0A 1BXTA 4Q0FA 5CORA 3J80L 3VYUA 1H9SA 3O13A 5EPKA 3GTKB 1QB5D 3NQTA 2JYOA 2DNCA 2EYJA 2EJMA 3I70A 4RKLA 5C4ZA 1KLGD 3A7AB 3IFTA 2WINB 3SR1A 2NN6I 4CKEA 3SHLA 3PIP3 2B2YA 1E0BA 3GTGB 4ULLA 3HOVB 4C3IB 4H44C 3N52A 5EKIA 1KNAA 5AFWA 2AQ2B 1ILPA 1WVLA 1U4LA 4NP5A 1I4RA 1QCBD 3VR5A 1F2ZA 5TSSA 4RGMA 3A56A 4EVOA 4IUTA 5M3FB 1AN8A 5E4XA 4J6HA 4O42A 4MIUA 2VB2X 1JOQA 2PNRC 2F0JA 1G2SA 2RA4A 4ZUJA 4I7ZC 1EY8A 3DXJC 1QNUA 1I4GA 2A68D 4FXGC 1SMYD 4CJ0B 1NSNS 2DN8A 3QG1A 1SBBB 4C56C 2EJGC 1AFPA 4IUNA 2KJXA 3MEHA 1RCVD 4F87A 1IHZA 1I6VC 1EY7A 5A35A 3LX0A 1EZ6A 2ID0A 4RGNA 1BOSA 2MPMA 4FF1A 2XVSA 1JR0D 4LJZC 3R2TA 4A93B 2NVYB 5EBDA 2NTTA 4KY7A 2O2LD 2J4XA 1E2ZA 3NP8A 1DM0B 3ERQA 2NTSA 2AWOA 4KJNA 2SNSA 2KEEA 2ZXRA 3J81L 2WKCA 2EZVA 3A8IE 2K05A 3K5MA 2F0QA 4KN4C 3HS0C 1GXDC 1SYGA 1H9SB 1AW7A 3MXNA 2O5IC 2NN6G 3G6JB 3EQLC 4K5WA 5EBCA 2AUKA 2SDFA 1ML0D 2AWNA 4L6TB 5IIFA 1NR2A 1LTBD 2FFKB 1B4OA 1O78A 1WTQA 1F9PA 5FLXE 1LTTD 3BDOA 2B8FA 2D2CC 1DOMA 4RHRA 2A6HC 3H3VC 1C48A 2IWHA 4QMGA 2EY2A 5IGDA 1BQQT 4KY6A 1D5XC 4XIGS 4OO1I 1EQTA 2E2HB 1S5BD 3S14B 1B3AA 2NVXB 3S15B 3RMHA 1JQYD 4CKBA 1FNUA 1MGSA 1JE4A 4RHSA 3S1QB 3TP5A 4K5XA 5I2XA 1KABA 4K5VA 3SVMA 3H09A 4FVMA 2NB0A 1LTRD 2Q8TA 1IW7C 1RJTA 1MI2A 3DUZA 3QWNA 2F0VA 1OXTA 1KTKA 1SYBA 4ME5A 1QNKA 3PV0A 2CW0C 4ZKCB 2R92B 3NHHA 3DM1A 3HKZB 1SFOB 1BF4A 4CHTB 4DK0A 5D14A 1EU4A 4FO2A 1EIGA 3OPOA 5KIXA 2K28A 5ELBA 4QCLA 1K8OA 1LTAD 2Z4HA 2D62A 3RZOB 3Q23A 3FMCA 3M3YB 4QUCA 2LKVA 2B8GA 5JVG3 3U9SA 5FK9C 2O4XA 4DFAA 2ZXPA 5CYUA 3CKIB 3AMUA 3FKIB 2LMCB 2XSCA 5KYIA 2F0IA 4F8MA 2NN6H 1GUOA 3TSSA 3GD7A 3MFYA 1HA6A 2F0EA 3K59A 2G9DA 1TVXA 4BY1B 3K58A 5IGEA 1B1ZA 3S1NB 2FINB 1BBXC 2BE5C 3V2TA 4ZRZA 2GA4B 4XT3B 1AEXA 3GO5A 1Y8OB 3M4YA 3NQIA 2YYZA 1WTOA 1MSHA 1SNQA 4RAUC 4C3IG 2N55A 3I4LA 1Q1BA 1F2MA 4A3IB 5CMDA 2NZ1D 1JC7A 1TS5A 1LTID 5E3FA 1SE2A 4KK7A 4IUQA 4EQNA 5M5YB 2F0WA 1SDFA 4CJ2C 4IQZA 1IKMA 1SYCA 5C3EB 1PDQA 1X32A 2Z4IA 4A3JB 2PZWA 1TWGB 4IUVA 4FF4A 3S16B 2Q8RE 5IT9L 4DK1A 2AQ1B 1TQOA 4KHVA 3BYTB 2L1BA 2N88A 3HOZB 1WCMB 4JBWA 4OIKA 1Q8IA 5KNDA 4QUFA 2VUMB 1PRTF 5CV6A 3GTMB 4X3UA 3D4DA 4KKTA 1EY9A 4ZYSA 4HMJA 1D5ZC 3E6ZX 4PMBA 1UEAB 3W2DA 4KTAA 3PUZA 1DD2A 3L9AX 5D65A 2F1MA 1DOKA 2RDFA 5KNBA 4DAPA 3QOJA 1D6EC 3I4NB 1CT1D 3CRLC 3IAYA 1PTOB 5A2QL 5T1IA 1PTOF 1HXYD 5G3LF 3SK4A 3HEJA 1BCPF 3HRZC 1CHPD 1YNNC 3NBHA 3PUWA 5JEAJ 3ITPA 1I4PA 4C1NI 4XXEA 1WTPA 1QWYA 4H7BA 1KAAA 2I07B 4A3KB 2X6LA 5CBAE 2CQAA 3TP6A 2EXZA 2M2LA 4RGOS 3J7AF 4TRDA 4FP5D 3IKJA 5CV4A 5KGUA 4KY5A 1BUVT 2LFNA 1G8ZD 4OO1H 1CZGA 2C9OA 4HSPA 1O7LA 2CW0D 4RFBA 1PZJD 2B2UA 4MHEA 3C3LA 4V190 1G6ZA 4K6LA 1Q3LA 1TS4A 3QIAA 2RQXA 3PO2B 3CHBD 2EYHA 3I3CA 3ZYYX 3LWEA 1HTLD 2EYMA 2OXPA 4B9WA 2EYPA 3NWSA 4I65A 2IL8A 2HDLA 2SNMA 2F3VA 3HP3A 1HQMC 3SDZA 3OHXC 5NUCA 1SSOA 1A3UA 2IX3A 1UNSA 3U9OA 4DXFA 1V1OA 1JOKA 2EVBA 3S2HB 3EJIA 3OMCA 4JK1C 4KMUC 3JAML 2HUGA 5EKKA 2K01A 5D3DA 5C4JB 1SYFA 1LTSD 2A74C 4K2LA 4AYBB 4C3JG 4HEDA 1KLUD 4CJ1B 1JICA 4BA2I 2R7ZB 4IFDJ 5D3IB 5JOBA 1JB3A 2OF1A 2SEBD 4C2MB 4DNTB 3NTIA 3KF8A 2F0LA 1LO5D 1X3QA 1SAPA 5C5MA 4NDXA 5J1ZA 3J80E 1SEBD 4K2KA 1TR5A 2B2TA 4HSVA 2NWGA 1A15A 1Y1WB 2JA6B 2PCFB 1H9MA 1QILA 4N9PA 4U673 1HRJA 1BDOA 1OXXK 5LL6X 2F0FA 3LNNA 2ENBA 1A3TA 3A7LA 1QG7A 1SNPA 2QILA 4BWGB 3WDNA 2CHBD 2E74C 4FYDA 2L12A 1A3VA 3GV3A 4BY7B 2R61A 3CU7A 3SK5A 3SK6A 2JA5B 1TY2A 1VMPA 1ENFA 3NE5B 1X3PA 1B9NA 1STYA 3BZDB 4RCNA 2XRQD 1I3QB 4X3SA 3FRPB 2JP1A 2NVQB 1JWSD 1HTPA 1LT6D 4IUPA 3D4WA 2ICEC 4H0LC 4U68A 1HFGA 2Z1CA 3IL8A 4ID6A 1SE4A 5ISRA 4QB4A 5E4WC 1E2VA 4BA1I 4F7XA 1YNND 2B2VC 4GZYC 4MN3A 1DYQA 1FR3A 1SJED 3V05A 4V0BA 2E2JB 3GV6A 3K7AB 1DXMA 1HQRD 4FXDA 3K57A 1G291 2WAQB 4EQOA 1RTOA 5BN4A 5I9OA 4C3HB 3OWFA 3GTOB 4XDXA 1STBA 2RSOA 1MSGA 4PNYA 1CQFA 3NTKA 2V4DA 3H94A 3T16A 1MD2D 2A69C 1HHVA 3MHBA 5EPLA 4M1UB 1TWAB 3SK8A 1KDCA 3UI2A 1RHPA 4HAEA 1EIHA 1DONA 1PRTC 5DM63 2DNEA 5FO7B 5FO8B 3RLFA 1QOHA 3GTPB 4FF2A 2M00A 1RODA 3DWPA 3DEOA 3D8GA 1PFBA 5FLXL 2PW5A 3MAQA 5EKLA 3HOXB 1IKLA 3QB3A 1KDBA 3VYSA 4LMQD 1D1IA 5C4XB 2E2DC 4UDUC 1VF5C 1SNOA 3AU7A 4BBRB 2K5QA 1BCPC 3P1HA 2B2VA 1KDAA 3DMUA 4E6IA 3PUXA 2Q8IB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CV7 A;  1JOQ A;  1TQO A;  1EY0 A;  3ERO A;  1EQV A;  5JAV A;  4KHV A;  5EGT A;  5I9O A;  3OSO A;  5IGC A;  2NUC A;  2PYK A;  2F0F A;  2PZT A;  3OWF A;  2EY5 A;  2ENB A;  4KD3 A;  3E5S A;  2F0J A;  2QDB A;  1A3T A;  1STB A;  2RBM A;  5CC4 A;  1NUC A;  4N9T A;  5IGB A;  4EQP A;  1II3 A;  2F0U A;  2F0P A;  5IOC A;  4ZUJ A;  2EYH A;  1JOO A;  4PNY A;  2LKV A;  3QOL A;  1SNP A;  1EY8 A;  2PQE A;  5IGF A;  5IOD A;  1A2U A;  3S9W A;  2EYM A;  2F0K A;  4ZQ3 A;  3NXW A;  2F0G A;  4PMC A;  5CV6 A;  2F0T A;  2OXP A;  2O4X A;  1ENA A;  3D4D A;  1RKN A;  4B9W A;  1A3V A;  1EY9 A;  1NSN S;  2EYP A;  3HZX A;  2F0N A;  4QMG A;  4K14 A;  5KYL A;  4DFA A;  3T16 A;  4RKB A;  4I65 A;  5KRU A;  2EY2 A;  3TP8 A;  4HMJ A;  2SNM A;  4PMB A;  4HMI A;  4WRD A;  5IGD A;  3T13 A;  4J1M A;  5I9P A;  2F3V A;  4IUN A;  4KJO A;  3MEH A;  4KY6 A;  4R8N A;  3MHB A;  3TP7 A;  5HGT A;  5NUC A;  4KTA A;  3SK8 A;  1KDC A;  3SK5 A;  1IHZ A;  1EYA A;  3SK6 A;  5KYI A;  4K8I A;  2F0I A;  5CV5 A;  4F8M A;  1A3U A;  1EY7 A;  2RKS A;  5DAU A;  3LX0 A;  5E1F A;  5F2D A;  1EZ6 A;  2EY6 A;  4G57 A;  3U9O A;  1STN A;  3MVV A;  3SXH A;  2RDF A;  2PW7 A;  5DEH A;  3R3O A;  1JOK A;  3NUC A;  1STY A;  4NKL A;  3QOJ A;  2F0E A;  2KHS A;  1U9R A;  3EJI A;  4K6D A;  4DGZ A;  3OMC A;  1EY5 A;  4ZUI A;  4S3S A;  3TP5 A;  4K5X A;  2EYL A;  5CR3 A;  1STH A;  4IAL A;  3VA5 A;  1F2Y A;  1SNC A;  5IGE A;  5KEE A;  4KY7 A;  3TME A;  1KAB A;  3V2T A;  1ENC A;  2M00 A;  2KQ3 A;  2F3W A;  5EKK A;  2F0O A;  3SK4 A;  3HEJ A;  4NMZ A;  3MXP A;  4HTH A;  4DF7 A;  1SYF A;  5C4H A;  3H6M A;  5CGK A;  5I6W A;  1EY4 A;  3D8G A;  4K5V A;  5CV9 A;  1AEX A;  3D4W A;  3NP8 A;  4K2L A;  3ERQ A;  2PW5 A;  2F0S A;  4LAA A;  1EY6 A;  3ITP A;  3EVQ A;  5C3X A;  4WOR A;  5EKL A;  4DU9 A;  5J39 A;  1TT2 A;  5C3W A;  4KJN A;  2SNS A;  4OL7 A;  1SNQ A;  3BDL A;  3QB3 A;  4H7B A;  1KDB A;  1SNM A;  4ID6 A;  3OMG A;  4K8J A;  5CV8 A;  1SND A;  3NQT A;  2F0H A;  1KAA A;  3PMF A;  2EYJ A;  4B9X A;  4RKL A;  2F0V A;  3MZ5 A;  5JOB A;  5C4Z A;  1JOR A;  1F2M A;  5ISR A;  1SYB A;  2OF1 A;  5K5P A;  4QB4 A;  1STG A;  3RUZ A;  1A2T A;  3SR1 A;  3TP6 A;  4ME5 A;  3SHL A;  5J22 A;  2EYO A;  3C1F A;  4IZ8 A;  4F7X A;  3BDC A;  2F0Q A;  2EY1 A;  2EXZ A;  4KD4 A;  5E3F A;  2F0L A;  1SNO A;  4TRD A;  3P75 A;  1SYG A;  5C5M A;  5C6A A;  3P1H A;  4KV6 A;  4ODG A;  5KIX A;  4NDX A;  4EQN A;  5J1Z A;  3D6C A;  2F0W A;  5C5L A;  4K2K A;  5HUR A;  3NHH A;  4QF4 A;  1KDA A;  5CV4 A;  5IGG A;  1TR5 A;  5KGU A;  3DMU A;  2WAC A;  4E6I A;  1EYD A;  1SYE A;  4KY5 A;  1SYC A;  2HQE A;  1EZ8 A;  2F0D A;  2SOB A;  5I6Y A;  4NP5 A;  4K5W A;  1SYD A;  2EYF A;  2PZW A;  4EQO A;  1F2Z A;  2PZU A;  5M9O A;  3C1E A;  4YIJ A;  2F0M A;  2OEO A;  3NK9 A;  4EVO A;  5IIF A;  1STA A;  4J6H A;  1EYC A;  3DHQ A;  4N9P A;  4MIU A; 
#chains in the Genus database with same CATH topology
 5CV7 A;  4LK1 C;  2I46 A;  4X65 Q;  3PUY A;  3T1H L;  3QO2 A;  4EQ5 A;  5EPJ A;  4DR7 L;  1N36 L;  1II3 A;  4CBV A;  1VQK A;  4DNI A;  4B3T L;  1XNR L;  4RG1 A;  2KCN A;  4HIM A;  5I2Y A;  2HT1 A;  2DY7 A;  3E0J A;  3NXW A;  4LF5 Q;  1XNQ L;  4M8A A;  1RF2 D;  2CVR A;  3QJY A;  2F0N A;  4BBS H;  5KYL A;  2F4I A;  1G91 A;  1PH4 A;  4XQJ A;  1TWG H;  2X69 A;  2E2I H;  5C0X J;  2A19 A;  1S5E D;  4X3K A;  4K8I A;  2YU9 H;  1XX8 A;  4KN7 C;  3K7U C;  2MNA A;  2VB3 X;  2YTV A;  1QE6 A;  4GKJ L;  1Y1V G;  1GUG A;  1HUM A;  3EA6 A;  1I4Q A;  5GQO A;  1LT3 D;  1PFS A;  3URY A;  4G7O C;  1U9R A;  3P20 A;  2RCF A;  4LUV A;  4S3S A;  1GM5 A;  5GRO A;  5DLQ E;  1ESF A;  2QW7 A;  3VA5 A;  1F2Y A;  1UUP A;  4AYB G;  1U4P A;  3GTM H;  1ENC A;  3W3A A;  4DV6 L;  3A55 A;  4LF9 Q;  1NBW A;  1VQ6 A;  1JJC B;  2R7Z G;  3TRZ A;  3PIO A;  5JVH 3;  4UP9 A;  1X3F A;  3BG3 A;  3BZK A;  5FKA C;  4L5T A;  1HPC A;  4WJW A;  2B63 B;  5C3W A;  2B2W C;  4KI0 A;  2HCC A;  1K3B C;  2H1E A;  5IP9 H;  2CH4 W;  2EDG A;  1L1O B;  1STG A;  4GNX A;  3A8K E;  2EPB A;  2K33 A;  1PTO H;  4DA2 A;  2JA6 G;  5JEA G;  2UU9 L;  3D6C A;  1XMQ L;  5HUR A;  3M4O H;  1CSP A;  3VA7 A;  4P73 A;  3STB D;  5LMN W;  2BDN A;  1EOT A;  2K5W A;  5ELC A;  5ELD A;  3HOY H;  1VCI A;  4IUU A;  3UDF A;  5I6Y A;  2Z8L A;  4GLX A;  2PZU A;  4GN3 B;  4EGV A;  1FNV A;  2D5D A;  2F0M A;  1NR4 A;  1LM0 A;  1YNJ C;  4A3K H;  1WTX A;  1SN8 A;  2JSO A;  3OIQ A;  2L55 A;  3PIP A;  1S4Z A;  2NBF A;  2LS0 1;  1CI3 M;  1B53 A;  4XQN A;  3H0G B;  4L8J A;  5AJ3 Q;  2RBM A;  1PH2 A;  1M8A A;  1I4H A;  3K0Y A;  1FGU A;  2QEJ C;  1ET6 A;  4OEM B;  3OW7 A;  1D2B A;  3FPP A;  4RCO A;  5IOD A;  3CCL A;  4UP8 A;  2F0G A;  4BY7 G;  4PMC A;  3T53 B;  5EJW A;  5IT9 E;  1Q12 A;  3K0X A;  3HZX A;  1TWF H;  2Q2H A;  2HIX A;  3TP8 A;  1B44 D;  4NB3 A;  2RDH A;  2KUM A;  1GD7 A;  3I90 A;  2J7Z A;  1IBK L;  1HZC A;  1FGB D;  4LF8 Q;  2RKS A;  4OGQ C;  4A3E B;  1F2L A;  4A3M H;  1EQR A;  1ICF B;  1NTG A;  5BR8 L;  1A6X A;  1D8L A;  2KCC A;  4PMW A;  2MUY A;  2AQ3 B;  3PCO B;  4ZUI A;  2EIF A;  3NBI A;  4HCE A;  1EFI D;  1PFM A;  5CR3 A;  1OXU A;  1K83 B;  1G2T A;  3TME A;  3WOF A;  1S72 A;  3UDI A;  1J9O A;  4B08 A;  3A8J E;  2K5D A;  3H6M A;  3BVG A;  2ASB A;  2A6H D;  1FL0 A;  3TRE A;  3A5U A;  4LAA A;  5C3X A;  4JPB W;  1RD9 D;  2KEC A;  3OTO L;  1NCV A;  2AUJ D;  3K80 C;  2AHO B;  2GVA A;  4O2D A;  3CPW A;  4JI6 L;  1P16 A;  5K36 G;  1JOR A;  2N8N A;  3S2H H;  2HDM A;  5EQ0 A;  3RUZ A;  2XNA C;  3K5N A;  4RGT A;  1HJP A;  5J22 A;  1SMY C;  2EY1 A;  2EJF C;  1VS0 A;  1R9T H;  1Y1V H;  3FEW X;  1EWH A;  2TSS A;  1JB7 A;  2WAQ G;  3MXG A;  3GQB A;  4HJ9 A;  3L7Z C;  1CK1 A;  2K7V A;  2WAC A;  1HZB A;  1EYD A;  2DJG C;  1EZ8 A;  2PPB C;  4X64 L;  4GNX B;  3JC6 6;  1GUT A;  5M9O A;  2ZJR A;  1YJN A;  2L11 A;  3UDX A;  2XIW A;  3X3N A;  2F3I A;  2R7Z H;  2E5L L;  1EYC A;  4A3G B;  2ICI A;  2ZM6 L;  1VQF A;  1BR9 A;  4L5S A;  5EGT A;  1XYI A;  2XWJ B;  4C2M H;  2EY5 A;  3BYY B;  3G7L A;  1IW7 D;  2QDB A;  3SE0 A;  2F0U A;  1J5E Q;  1PYW D;  4DR1 Q;  1Q82 C;  4YHH L;  4PZ7 A;  2VZA A;  1CKN A;  2FMM A;  2VQE L;  1CHQ D;  3PO3 B;  2ZJP A;  2G5D A;  4HMI A;  2A6E C;  3T13 A;  3KFU A;  2Z6K C;  4HIK A;  1HFN A;  2IT1 A;  1YHQ A;  1ZYR C;  2X6G A;  3GTG H;  5E1F A;  3C2P A;  1X65 A;  2L5T A;  2L0C A;  3I73 A;  1CZW A;  1S5C D;  2PW7 A;  5M5W B;  2FJ2 A;  4GOP C;  3NUC A;  2B39 A;  2BDO A;  2PNH A;  3I2Z A;  4J8Q A;  4P2C B;  4AQY L;  4KHZ A;  4ZCK A;  2EYL A;  3HOW B;  2B2Y C;  4RMF A;  4LFB L;  3S2D B;  2RSN A;  5M3M B;  1AZP A;  4C1N K;  3HOX G;  2UUB L;  2LXJ A;  2ZTD A;  2BH8 A;  3TZU A;  3I4M B;  1GUN A;  3MXP A;  3NWT A;  3P7J A;  5M3F H;  5C4H A;  3Q22 A;  4JI5 Q;  1M4V A;  4CKC A;  3SGI A;  4HCS A;  1EY6 A;  5J39 A;  3ND8 A;  4A75 A;  3CXC A;  4IOA A;  1FD7 D;  3OMG A;  3ONA B;  3AB9 A;  1EIY B;  3PMF A;  3KOJ A;  4HN7 A;  1HNW L;  1MBY A;  1TS2 A;  2R7F A;  3NTH A;  1BBW A;  3FHW A;  1YBY A;  3GP7 A;  3BJU A;  1PV4 A;  1DOL A;  4QF4 A;  2O5J C;  1PLF A;  1CSQ A;  3CCU A;  4JI0 L;  1CQV A;  4DR4 Q;  3TS2 A;  1L0X B;  3FPU B;  3L2P A;  2HQE A;  3MTS A;  3KLR A;  4FNF A;  2P5Z X;  2OCE A;  3KBX A;  2EYF A;  2VL6 A;  1VDZ A;  3KK7 A;  2R92 G;  1I94 L;  2BE5 D;  2HCI A;  5JJI A;  3R93 A;  5C44 B;  2BA1 A;  3DWQ A;  1PFN A;  4DUY Q;  3ER0 A;  1KNE A;  4KLK A;  1EQV A;  5IGC A;  3LGJ A;  2YTX A;  1FJG Q;  1TII D;  3K81 C;  1ZEQ X;  2NVY H;  4CGY B;  4KD3 A;  1PXU A;  5CC4 A;  4OX9 L;  4EQP A;  1Y8N B;  3I72 A;  5K36 H;  1CKO A;  4Q5V A;  2KVM A;  3WOE A;  3NEN A;  1A2U A;  4NXM L;  2F0K A;  1YNJ D;  5M5X B;  3K7A H;  1SJH D;  3T1Y L;  1OO9 B;  2WB1 B;  1TY0 A;  1HR0 Q;  3HGB A;  5KRU A;  4DAV A;  4J1M A;  5I9P A;  4KJO A;  3FVQ A;  1U4M A;  2ES2 A;  1IL2 A;  1U5K A;  1CA5 A;  5CV5 A;  3F2B A;  1B2T A;  4AH6 A;  4R9W A;  2XN9 C;  3MEF A;  1VQ5 A;  2MGS A;  2LY7 A;  1ESR A;  2IX0 A;  3VYR A;  4JI2 L;  4KKU A;  3R3O A;  4TVA B;  1CKN B;  2JA8 B;  1ET9 A;  1GHJ A;  1WTW A;  2CH4 A;  4XYO A;  4DGZ A;  5LMN L;  1EY5 A;  1O7Z A;  4CDD C;  2ZT9 C;  4B3M L;  1VF7 A;  2R3Z A;  3KLS X;  1JWM D;  3TBI B;  2B63 G;  1K0R A;  3TDQ A;  4DF7 A;  1PH3 A;  5CGK A;  5I6W A;  3Q24 A;  4BY1 G;  1T9H A;  4X65 L;  3X3M A;  4DU9 A;  1CA6 A;  1PH7 A;  2UUA Q;  2CWP A;  1V43 A;  3I56 A;  4DV5 Q;  3GTJ B;  4BS9 A;  2JXM B;  3BU2 A;  1P8L A;  1LLR D;  3HOU B;  4LF5 L;  4ILW A;  3E9H A;  2EYO A;  4IPD A;  4IZ8 A;  5BN3 A;  3F2U A;  3JAM c;  3GTP H;  5COY A;  2JEB I;  1H9K A;  2UXB Q;  4KV6 A;  4XT1 B;  4LF6 Q;  1XWE A;  5FO9 B;  2JE6 I;  1K73 C;  3TS0 A;  3SEB A;  2H5X A;  2M9V A;  2OQ0 A;  1GHK A;  4JBK A;  3AYH B;  2E76 C;  1TS3 A;  4ABN A;  1Y14 B;  4JBM A;  2K75 A;  5E7N A;  4LW1 A;  1GJX A;  2K14 A;  4DV0 Q;  1LAB A;  2OEO A;  4IPC A;  3KLS A;  3BS1 A;  3DHQ A;  3EFX D;  1T5E A;  1KC8 C;  1XMO Q;  3ERO A;  1Z47 A;  3S1Q H;  1Q90 A;  2HQL A;  2PYK A;  3CCR A;  4G4K A;  5C3E G;  3CD6 A;  4A3J G;  1IYV A;  4YWK A;  2FHT A;  4N9T A;  4F88 A;  4LF9 L;  1TKW B;  1LT5 D;  3J81 E;  3S9W A;  3GTL B;  3R2I A;  1O80 A;  1TWH B;  1Z9F A;  5DM7 3;  3VR4 A;  4K14 A;  1I4X A;  1QJO A;  2QCP X;  3K8A A;  4RKB A;  2WFW A;  3TEH B;  4A3E G;  1K8M A;  4UAI A;  1QVF A;  1WYD A;  3MC0 B;  3M9B A;  2IY5 B;  3UE1 A;  1DCZ A;  3VYT A;  2KBN A;  1PZI D;  4O1N A;  4JI4 Q;  2WII B;  5DAU A;  2C5C A;  2F03 A;  1JMC A;  2R92 H;  1Q1E A;  4DR5 Q;  4FDB A;  2V1C C;  4NKL A;  1SFO H;  4A3L H;  1Y8P B;  3A54 A;  4JI7 Q;  4Z9C B;  4DR6 L;  1XTC D;  2A6E D;  2K6A A;  4TKO B;  2XTI A;  3PF4 A;  2AMC B;  3M4P A;  1H9J A;  1ZYR D;  5C0X G;  3M85 A;  1G6P A;  1PH1 A;  2VQF Q;  1IXR A;  5EAY A;  1NY4 A;  1LTG D;  5ELF A;  3KJP A;  4WOR A;  1MHW C;  5AJ3 L;  3K6O A;  1CKM A;  5ELE A;  3RZO H;  4HJ5 A;  2F0H A;  3FDT A;  3V96 A;  1PZK D;  3D6W A;  3U4V A;  4DV2 Q;  1ICW A;  2MJ8 A;  1J6Q A;  1ZXT A;  2HIV A;  4IJH A;  4P74 A;  1TU2 B;  2PO4 A;  4ODG A;  1GUS A;  3CRK C;  1Z7T A;  2JA7 B;  4JYA Q;  1S5F D;  1VQI A;  3T56 B;  1EQQ A;  4A3G G;  4LF8 L;  1YIJ A;  1F9R A;  1PVO A;  5CBE E;  3M7N A;  2RDG A;  5I4D A;  1XXG A;  4ZK9 B;  1C4Q A;  1SYD A;  4R8I A;  2B63 H;  3C1E A;  3MWY W;  4YIJ A;  1WD0 A;  3D31 A;  1Q8K A;  5IOC A;  1PTO C;  1A62 A;  1BVS A;  4G7Z C;  4BY1 H;  3CC7 A;  1EY0 A;  2N78 A;  5JAV A;  3S1M B;  1JJ2 A;  2HD3 A;  1LT4 D;  2BOS A;  3S1N H;  1J8I A;  1ZKO A;  1B50 A;  2EE1 A;  3RD4 A;  3E5S A;  2IW3 A;  4R4Q A;  4ZAI A;  1EU3 A;  2F0P A;  1KIX A;  4L63 B;  4ZKB B;  3PO3 G;  2IX1 A;  4ZLT F;  1GKH A;  1E1T A;  3D3R A;  2XGT A;  3MXU A;  3OOC A;  4XTC S;  4DXG A;  1V1P A;  4A3D B;  1NE3 A;  3PO2 G;  4HR7 B;  1KRT A;  1Z6H A;  1YI2 A;  2K04 A;  4A3I H;  4LUZ A;  4R8N A;  5HGT A;  1K0S A;  1IBL Q;  1K28 A;  2IPK D;  3HOW G;  2K1B A;  1ASZ A;  5M5Y H;  1CTM A;  3K5L A;  3I4M G;  4JOI A;  3OIP A;  4C3J B;  1STH A;  4IAL A;  5C3E H;  4Y7N B;  4A3J H;  2QDL A;  5JPM C;  1XPO A;  1X54 A;  1S40 A;  2NVT B;  1F77 A;  4DV3 L;  4X6A H;  3S16 H;  2EOT A;  2GN5 A;  2L4N A;  3CQZ B;  1W3S A;  3BVM A;  1IBM Q;  1VQH A;  3HOZ H;  3PF5 A;  1PMR A;  1JCK B;  1TT2 A;  1WCM H;  4OL7 A;  4A3E H;  1J5E L;  4FF3 A;  1T5X D;  5CV8 A;  4DR1 L;  4QIW B;  1PHJ A;  2VUM H;  2OQK A;  1FYC A;  3C1F A;  1CUK A;  1E1O A;  4TSS A;  3CCQ A;  1K83 H;  2K32 A;  5DNF A;  5C5L A;  1BO0 A;  2C35 B;  3KUP A;  5IGG A;  5FLX c;  1H95 A;  1EEI D;  5C44 G;  1JWU D;  5LL6 S;  1VQB A;  5C0X H;  4UY8 C;  2B29 A;  4IPH A;  2K5N A;  2PMZ E;  2H4O A;  1LAC A;  4JG2 A;  4IFD I;  2R93 B;  3I4N H;  1AE3 A;  1I6H B;  5IP7 H;  1D5M C;  3OSO A;  1EYG A;  1Y1W G;  2VY3 A;  5IGB A;  1NUC A;  4JI1 Q;  1Y69 U;  1ASY A;  2E75 C;  4JI5 L;  2BCO A;  1HCZ A;  3DEP A;  1MIU A;  3R8B A;  2PQE A;  5IGF A;  1RDP D;  4A3F B;  1ENA A;  1RKN A;  3GTQ B;  1TWC B;  1YJW A;  1DGS A;  1N9W A;  1SR3 A;  1JE5 A;  4OO1 G;  4WRD A;  3CCJ A;  1UE6 A;  2L9H A;  2JA8 G;  4OIJ A;  4NW2 A;  4A3G H;  2JEA I;  1EYA A;  1S5D D;  2L15 A;  4G57 A;  4LF4 Q;  1STN A;  3MVV A;  3VR3 A;  1VQN A;  2KEN A;  1GUW A;  1O7Y A;  2DY8 A;  2R6G A;  1C8C A;  1V1P B;  2KED A;  1IL8 A;  2Y0S B;  1R4Q B;  4X3T A;  2JA5 G;  1E3P A;  5KEE A;  4WFN 3;  3T4A C;  4XYQ A;  2XRS D;  1V8Q A;  2FMC A;  3TN2 A;  1SE3 A;  3BVZ A;  2NYZ D;  2TMP A;  4DUY L;  1U4R A;  4OXP A;  3PO3 H;  1C9O A;  1EY4 A;  1S3O A;  5CV9 A;  1FJG L;  3NEM A;  1WD1 A;  4RH6 A;  4TQU S;  2WV6 D;  3HOU G;  5T1G A;  1IYU A;  1ILQ A;  4BBS B;  3BDL A;  4K8J A;  4GS3 A;  2UUC Q;  1DZ1 A;  3PO2 H;  5M5W H;  2A69 D;  2E2I B;  3MZ5 A;  4OEL B;  5K5P A;  1RTN A;  2MHV A;  4B3R Q;  4A3B B;  1R4P B;  2B2U C;  2OT2 A;  3VR6 A;  2YU9 B;  1WI5 A;  3P75 A;  3S2D H;  5C6A A;  1BNZ A;  4XQQ A;  3RN5 A;  4YWM A;  4HJ8 A;  3LWU A;  1PRT D;  3I4M H;  4JI8 Q;  1PRT B;  1HUN A;  2KOL A;  2UXD L;  5FOB B;  3Q0A A;  2K52 A;  1SYE A;  3H15 A;  1FNW A;  1UAP A;  2SOB A;  1YJ9 A;  2B2W A;  5GAD C;  5A2Q E;  1Q46 A;  4WJ4 A;  3NK9 A;  3NSW A;  1RL2 A;  1STA A;  3H91 A;  2OTJ A;  4PV1 C;  3MA2 B;  2A68 C;  2XWB B;  3GDE A;  4GLV B;  3J7Y W;  2A5H A;  5GAH C;  2NUC A;  1E2W A;  3TZD A;  2A73 B;  2WB1 E;  3VDY A;  5FJ8 G;  2BH2 A;  3U4Z A;  2I5H A;  3I91 A;  4DK6 C;  5C4J H;  3J7A V;  2ZTC A;  3AEV A;  1FVI A;  1JOO A;  3ULJ A;  4AIM A;  5KNC A;  4IFD G;  2WP8 J;  1PTO D;  3ZJY C;  5G3L D;  2F0T A;  2UUA L;  1VMC A;  4C3H G;  4P72 A;  4DV5 L;  4DR3 Q;  1BCP D;  1PH6 A;  2RVL A;  1BCP B;  3M4O B;  1KXL A;  1YIT A;  2Z6B A;  5C44 H;  3HG9 A;  1ONL A;  1KRS A;  3D0F A;  3HOY B;  4KHP Q;  1DJR D;  2UXB L;  4DAM A;  2PMZ B;  4LF6 L;  1NAP A;  1EIF A;  3ND9 A;  4G7H C;  1D1K A;  2WKD A;  2KHS A;  4DAY A;  3IFD A;  1B9M A;  1F9Q A;  1VQO A;  2ZXO A;  1Y1W H;  1GOZ A;  2JA6 H;  4PQX A;  5JEA H;  4J15 A;  3D4R A;  3NPP A;  4DV0 L;  5ELN A;  2B3G A;  3L3O C;  2KQ3 A;  3S17 B;  2F3W A;  1XMO L;  2B2T C;  2F0S A;  3K5O A;  5IYC G;  3EVQ A;  1OXV A;  2I5L X;  3J80 i;  2KA7 A;  3PGZ A;  1STE A;  1CM9 A;  1WTH A;  3PUV A;  4OHJ A;  4Y52 H;  1F9S A;  2VNU D;  2BA0 A;  1SNM A;  1TWF B;  1SND A;  4B9X A;  1IYJ B;  4LFA Q;  5FLM G;  4KKS A;  4OWX B;  3T51 B;  2MP1 A;  3KBG A;  4DV6 Q;  2JA7 G;  1A2T A;  3F8T A;  1I5F A;  1UE1 A;  3BDC A;  3E3X A;  4KD4 A;  1EWC A;  4A3M B;  2PQA A;  1SXT A;  1H9R A;  1GO3 E;  4IUR A;  4PZ6 A;  4BY7 H;  1I50 B;  4JI4 L;  1WTR A;  5C4X G;  1HA5 A;  3M7G A;  2JA5 H;  1E22 A;  2F0D A;  3PQI A;  1L0Y B;  3S1R B;  4DR5 L;  2VW9 A;  4DV4 Q;  4BBR G;  1AZQ A;  1LV9 A;  3Q8D A;  4RWS C;  3VR2 A;  3JAM E;  1QVC A;  3I8Z A;  1X55 A;  3GTJ H;  1I3Q H;  1WTV A;  4DV1 L;  3HOU H;  2PZT A;  1LUZ A;  1OXS C;  2VQF L;  2NVQ H;  4DNR B;  4K0K L;  4FXK C;  4DN4 M;  5BN5 A;  5LMU Q;  2G9H D;  3DWA A;  3QOL A;  3MFG A;  2QA4 A;  4ZQ3 A;  3RZD B;  1CFM A;  1R9T B;  4RA8 A;  4IN3 A;  1Y1V B;  1W6K A;  2JJQ A;  1HNX Q;  2K03 A;  1AP0 A;  2ZTE A;  1X9N A;  2IJ0 A;  1W6J A;  3PIO 3;  3TP7 A;  3ULL A;  1N34 Q;  5HY6 A;  2D9U A;  5F2D A;  3C46 A;  2EY6 A;  2F52 A;  3NEL A;  4GLA C;  3SXH A;  1B8A A;  5DEH A;  4JYA L;  3DLL A;  4R1J A;  4OWW B;  2E2J H;  4K6D A;  3N6R A;  2J0T D;  1SNC A;  3Q6S A;  3CCE A;  5FJ8 H;  4QJF A;  1MKH A;  2QF7 A;  1UEB A;  3OWE B;  3W1B A;  5JPN C;  5LHY 1;  4H13 C;  2F0O A;  2IHF A;  4NMZ A;  4HTH A;  2JK8 A;  5C0X I;  2Z6K A;  1EEF D;  2VXW A;  2QKI C;  5JJZ A;  4IFD H;  1EL0 A;  1BXT A;  3KF6 A;  4Q0F A;  4DAY B;  5COR A;  4C3H H;  3J80 L;  3GTO H;  3VYU A;  1H9S A;  3O13 A;  5EPK A;  3GTK B;  1XTD A;  3AQQ A;  1C0A A;  4GOP A;  1QB5 D;  3NQT A;  5HGQ A;  2JYO A;  2DNC A;  3J81 i;  2EYJ A;  2EJM A;  3I70 A;  4RKL A;  5C4Z A;  2QEX A;  1KLG D;  3A7A B;  3IFT A;  2WIN B;  3EBE A;  3SR1 A;  2NN6 I;  4CKE A;  3SHL A;  3PIP 3;  1K8G A;  2B2Y A;  1E0B A;  3GTG B;  4DR2 Q;  4ULL A;  1PYB A;  2ZJQ A;  3HOV B;  4MTN A;  4C3I B;  3U58 A;  4H44 C;  3N52 A;  5EKI A;  3UE0 A;  1KNA A;  5AFW A;  4YWL A;  1HNZ Q;  2AQ2 B;  1IBL L;  2R93 G;  1TWA H;  4UPA A;  1ILP A;  1WVL A;  1U4L A;  4NP5 A;  1I4R A;  1QCB D;  3VR5 A;  1F2Z A;  5TSS A;  4RGM A;  3A56 A;  4EVO A;  4IUT A;  5M3F B;  1AN8 A;  5E4X A;  4J6H A;  4O42 A;  4ALP A;  2PQA B;  4MIU A;  2VB2 X;  1JOQ A;  1VQ8 A;  2PNR C;  4HID A;  2F0J A;  1G2S A;  4A3F G;  2RA4 A;  4ZUJ A;  5FLM H;  1A8V A;  4I7Z C;  2JA7 H;  1IBM L;  1EY8 A;  2KCT A;  3DXJ C;  4DV7 Q;  3CPF A;  1QNU A;  2RHQ B;  1I4G A;  2A68 D;  4FXG C;  1SMY D;  4CJ0 B;  3HOX H;  1M90 C;  1XPU A;  1NSN S;  2DN8 A;  1HZ9 A;  3QG1 A;  3H0G G;  2MO0 A;  2I0Q A;  1SBB B;  1L1O C;  4C56 C;  2EJG C;  1AFP A;  4IUN A;  2KJX A;  3MEH A;  4UHV A;  5C4X H;  1RCV D;  3CAM A;  4F87 A;  1IHZ A;  1I6V C;  1EY7 A;  2Y0S G;  5A35 A;  3LX0 A;  1EZ6 A;  2ID0 A;  4BBR H;  4MZ9 A;  4GN5 A;  4RGN A;  1BOS A;  2MPM A;  4L5Q A;  4FF1 A;  4YCV A;  2XVS A;  1JR0 D;  4LJZ C;  3R2T A;  1HR0 W;  1N8R C;  4A93 B;  1KAW A;  2NVY B;  5EBD A;  2NTT A;  4KY7 A;  2O2L D;  4BBS G;  2J4X A;  4QIW E;  1E2Z A;  3NP8 A;  1DM0 B;  3ERQ A;  2NTS A;  4YCW A;  3J80 c;  1UE5 A;  2AWO A;  4A3B G;  4YCU A;  1VQM A;  4KJN A;  1A63 A;  2SNS A;  4JI1 L;  2KEE A;  2ZXR A;  1C7Y A;  3J81 L;  4A3C G;  2WKC A;  2KHI A;  2EZV A;  3A8I E;  4NXN Q;  1VQC A;  2K05 A;  5H1S E;  3K5M A;  2F0Q A;  4KN4 C;  4X62 Q;  3HS0 C;  1GXD C;  2CCZ A;  1SYG A;  2JN4 A;  3KF6 B;  1MJC A;  4Y7N H;  4POG A;  1VQG A;  2NVT H;  3W5O A;  1H9S B;  1X3E A;  1AW7 A;  4GN4 B;  4GOP B;  3CQZ H;  3MXN A;  2O5I C;  2NN6 G;  3G6J B;  1QVG A;  3EQL C;  4K5W A;  5EBC A;  2AUK A;  2SDF A;  1ML0 D;  2AWN A;  4L6T B;  5IIF A;  1EUJ A;  1NR2 A;  1O7I A;  3OYY A;  4YY3 Q;  1LTB D;  2FFK B;  1B4O A;  1O78 A;  1WTQ A;  1F9P A;  3KJO A;  1SLJ A;  3G6E A;  2RCN A;  5FLX E;  1LTT D;  2DUD A;  2CKZ B;  3BDO A;  1YNX A;  1KL9 A;  2B8F A;  1VQ4 A;  2D2C C;  3EIV A;  1DOM A;  2A1A A;  4RHR A;  2A6H C;  1SMX A;  2HHH Q;  4QL5 A;  3H3V C;  1C48 A;  2IWH A;  4QMG A;  2UUC L;  4IOC A;  2CFM A;  2EY2 A;  1BBU A;  5IGD A;  1BQQ T;  1YVC A;  4KY6 A;  1X6O A;  2Y0S E;  1D5X C;  4XIG S;  4APV A;  4OO1 I;  1EQT A;  2E2H B;  1XPR A;  4UP7 A;  1S5B D;  3S14 B;  1B3A A;  3RN2 A;  2NVX B;  4JI8 L;  3S15 B;  3RMH A;  1JQY D;  4CKB A;  3CP0 A;  1FNU A;  1MGS A;  1JE4 A;  2DJF C;  4RHS A;  3S1Q B;  3TP5 A;  4K5X A;  4GNX C;  5I2X A;  4A3F H;  1KAB A;  1VQ9 A;  3TQY A;  2JA9 A;  4K5V A;  3SVM A;  3H09 A;  4FVM A;  2NB0 A;  4QY7 A;  1LTR D;  2Q8T A;  1VQJ A;  1OTC A;  1IW7 C;  4DUZ Q;  1RJT A;  4JBJ A;  3A0J A;  3H0G H;  5M3M G;  1MI2 A;  3DUZ A;  1UWV A;  4IPG A;  3QWN A;  2VS1 A;  2F0V A;  1OXT A;  4POF A;  1KTK A;  1SYB A;  2F4V Q;  4ME5 A;  1QNK A;  2D0O A;  4GKK Q;  2D0P A;  3PV0 A;  4DR3 L;  2CW0 C;  4ZKC B;  2R92 B;  4LF7 Q;  3NHH A;  3ERS X;  3DM1 A;  4LNQ A;  3HKZ B;  1SFO B;  2JQO A;  4KHP L;  4LFC Q;  1Q86 C;  1BF4 A;  4CHT B;  4DK0 A;  4CDF C;  2CQO A;  5D14 A;  2MQH A;  2K5H A;  1EU4 A;  3CC2 A;  4OON A;  4FO2 A;  2K5V A;  1EIG A;  4NPS A;  3CCM A;  3OPO A;  1WOC A;  5KIX A;  1JT8 A;  2K28 A;  5ELB A;  1SE8 A;  4QCL A;  1K8O A;  1LTA D;  2Z4H A;  4A3B H;  4JC0 A;  3MXN B;  1LYL A;  2D62 A;  3RZO B;  2MFI A;  1N33 Q;  1NMF A;  4R4T A;  4A3C H;  3E0E A;  3Q23 A;  4CDE C;  3FMC A;  3M3Y B;  1UE7 A;  2LKV A;  4QUC A;  2B8G A;  5JVG 3;  3U9S A;  5FK9 C;  3PSI A;  1TXY A;  2EXD A;  2O4X A;  3F2C A;  1MJE A;  4B3S Q;  3H3V H;  4DFA A;  2ZXP A;  5CYU A;  3CKI B;  4LFA L;  3AMU A;  3FKI B;  2LMC B;  2XSC A;  3J81 j;  5KYI A;  2F0I A;  4F8M A;  2NN6 H;  1GUO A;  3TSS A;  1XJV A;  3GD7 A;  4N8F A;  2WB1 G;  4A4I A;  3CCS A;  3MFY A;  1HA6 A;  2F0E A;  3K59 A;  2G9D A;  1TVX A;  4BY1 B;  3K58 A;  5IWA Q;  1A0I A;  1NJI C;  5IGE A;  1B1Z A;  4DV4 L;  3S1N B;  4JV5 Q;  2FIN B;  1BBX C;  2BE5 C;  3V2T A;  2ALY B;  4ZRZ A;  3RLN A;  1QZH A;  2OTL A;  5IE8 A;  2GA4 B;  4JVZ A;  1QZG A;  4XT3 B;  1AEX A;  3GO5 A;  2UXC Q;  4DR6 Q;  1Y8O B;  3M4Y A;  3NQI A;  1QUQ A;  2YYZ A;  1WTO A;  4R4C A;  1MSH A;  1SNQ A;  4RAU C;  3HOV G;  4C3I G;  5LMU L;  2YTY A;  2N55 A;  4HJ7 A;  4DR4 L;  3I4L A;  1Q1B A;  1F2M A;  1N32 Q;  4A3I B;  5CMD A;  2NZ1 D;  2R7D A;  1JC7 A;  1TS5 A;  1LTI D;  2A8V A;  5E3F A;  1SE2 A;  4KK7 A;  4QGU A;  4WJ3 M;  1HNX L;  4IUQ A;  4EQN A;  5M5Y B;  2F0W A;  3S17 H;  1N34 L;  1SDF A;  4CJ2 C;  5J3B A;  4IQZ A;  5M3F G;  1VQ7 A;  4R4O A;  1IKM A;  1BKB A;  1SYC A;  2LXK A;  5C3E B;  1PDQ A;  1VQP A;  1X32 A;  2Z4I A;  4A3J B;  2AKW B;  4X66 Q;  2PZW A;  1TWG B;  4MNO A;  1K9M C;  1M1K C;  2GVB A;  1VQD A;  4IUV A;  4FF4 A;  3S16 B;  2Q8R E;  5IT9 L;  4DK1 A;  2AQ1 B;  1TQO A;  4KHV A;  3BYT B;  2L1B A;  3HOW H;  2N88 A;  3HOZ B;  1SRU A;  1HR0 L;  4DPG A;  5M3M H;  1WCM B;  4JBW A;  4DKA C;  1YEZ A;  4OIK A;  1E7Z A;  1B3Q A;  4JI3 Q;  3CW2 C;  1Q8I A;  5KND A;  4QUF A;  2OWO A;  2VUM B;  1PRT F;  2Q2I A;  1I50 H;  5CV6 A;  4AYB E;  3GTM B;  4X3U A;  3D4D A;  4KKT A;  1EY9 A;  4IO9 A;  4ZYS A;  3S1R H;  4HMJ A;  1D5Z C;  3E6Z X;  4PMB A;  4A76 A;  1UEA B;  3W2D A;  3CME A;  4KTA A;  4DR2 L;  3PUZ A;  1DD2 A;  3E9I A;  3L9A X;  3F2D A;  2PI2 E;  5D65 A;  2F1M A;  1DOK A;  4A93 G;  2RDF A;  4H02 A;  5KNB A;  4DAP A;  1HNZ L;  3QOJ A;  1D6E C;  3I4N B;  1CT1 D;  2Z0S A;  3CRL C;  3IAY A;  1PTO B;  1RIP A;  5A2Q L;  3JAM i;  5T1I A;  3WWV A;  1PTO F;  1HXY D;  3RZD H;  5G3L F;  1WJJ A;  3T1H Q;  4DR7 Q;  3SK4 A;  3HEJ A;  1N36 Q;  1K3R A;  1BCP F;  3HRZ C;  1CHP D;  1YNN C;  2PI2 A;  4B3T Q;  1XNR Q;  3NBH A;  3BZC A;  3PUW A;  1G51 A;  5JEA J;  3ITP A;  1I4P A;  4C1N I;  4XXE A;  1WTP A;  1XNQ Q;  1GVP A;  1QWY A;  4H7B A;  1KAA A;  3J7A 5;  2I07 B;  4DV7 L;  4A3K B;  2X6L A;  5CBA E;  4DV3 Q;  2CQA A;  4JCV E;  3TP6 A;  3I7F A;  5M5X H;  2EXZ A;  2M2L A;  4RGO S;  2LSS A;  3J7A F;  4TRD A;  4FP5 D;  3KYH C;  3IKJ A;  4GKJ Q;  1QUQ B;  5CV4 A;  2ATW A;  5KGU A;  1L2F A;  3S24 A;  5L37 A;  4KY5 A;  1BUV T;  2LFN A;  1G8Z D;  4OO1 H;  1CZG A;  1EWI A;  2C9O A;  4HSP A;  1O7L A;  2CW0 D;  3GTK H;  4RFB A;  2JA8 H;  5IT9 c;  1PZJ D;  2B2U A;  4MHE A;  3C3L A;  1W2B A;  4V19 0;  1G6Z A;  3HOV H;  4K6L A;  1Q3L A;  1TS4 A;  3QIA A;  4C3I H;  2RQX A;  3PO2 B;  3CHB D;  1VQE A;  2EYH A;  3I3C A;  3ZYY X;  3LWE A;  1HTL D;  2EYM A;  3CMA A;  2OXP A;  4B9W A;  2EYP A;  3NWS A;  4L5R C;  4I7A A;  2MO1 A;  3KDF A;  4I65 A;  2IL8 A;  2HDL A;  3IRB A;  2I5M X;  1KQS A;  4JI7 L;  2UU9 Q;  2SNM A;  4NXN L;  1XMQ Q;  2F3V A;  2RHS B;  3HP3 A;  1HQM C;  4BXX G;  4P75 A;  1JJG A;  3SDZ A;  3OHX C;  5NUC A;  1SSO A;  1K8A C;  4X62 L;  1A3U A;  2IX3 A;  4QQB X;  1UNS A;  3U9O A;  4PG3 A;  4DXF A;  1V1O A;  1JOK A;  2EVB A;  1B7Y B;  3DM3 A;  4A3D G;  3S2H B;  3EJI A;  3G4S A;  3OMC A;  2FXQ A;  4JK1 C;  4KMU C;  5IYB G;  3JAM L;  1VQL A;  2WAQ E;  2HUG A;  5EKK A;  2K01 A;  5D3D A;  5IYD G;  5C4J B;  4DV2 L;  4YY3 L;  1SYF A;  1LTS D;  2A74 C;  4K2L A;  4AYB B;  4C3J G;  4HED A;  2K50 A;  1KLU D;  4CJ1 B;  3I55 A;  1JIC A;  4BA2 I;  4PZ8 A;  2R7Z B;  4R4I A;  4IFD J;  5D3I B;  5JOB A;  1JB3 A;  2HHH L;  2OF1 A;  2SEB D;  3KLW A;  3J7Z C;  3HKZ G;  4C2M B;  3GTL H;  4A3L G;  3AFP A;  4DNT B;  1TWH H;  3NTI A;  3KF8 A;  1IBK Q;  3NBH B;  2F0L A;  1LO5 D;  3QR8 A;  1X3Q A;  1SAP A;  5C5M A;  4A93 H;  1L0W A;  4NDX A;  4O0A A;  5J1Z A;  3J80 E;  1SEB D;  4K2K A;  1Q7Y C;  5BR8 Q;  1TR5 A;  1AE2 A;  3OW2 A;  2Q2T A;  2B2T A;  4EX5 A;  3H3V I;  4HSV A;  2NWG A;  1A15 A;  1Y1W B;  4CDC C;  2JA6 B;  2PCF B;  2K4K A;  3RLO A;  1H9M A;  1QIL A;  4N9P A;  4U67 3;  2QGQ A;  1HRJ A;  1BDO A;  1OXX K;  5LL6 X;  2F0F A;  3LNN A;  2NZO A;  2UXD Q;  2ENB A;  2KHJ A;  3OTO Q;  1A3T A;  3A7L A;  3FP9 A;  1QG7 A;  4JI6 Q;  1AH9 A;  1SNP A;  2QIL A;  3FKI G;  4BWG B;  1PA6 A;  3AFQ A;  1KHI A;  1E24 A;  2CHB D;  2E74 C;  3WDN A;  4DUZ L;  2CWA A;  4FYD A;  2L12 A;  1A3V A;  1NMG A;  1X3G A;  3RNU A;  3GV3 A;  2DGY A;  3RR5 A;  2F4V L;  5JJL A;  2KCM A;  4BY7 B;  2R61 A;  5IYC H;  1D7Q A;  1B70 B;  3CU7 A;  3SK5 A;  3SK6 A;  4GKK L;  3G71 A;  1TY2 A;  1VMP A;  1ENF A;  2JA5 B;  4LF7 L;  4ME3 A;  3NE5 B;  1PYS B;  2N49 A;  1X3P A;  4X64 Q;  3CF5 A;  1B9N A;  1STY A;  3BZD B;  3G48 A;  3F1Z A;  4RCN A;  3KDF B;  4LFC L;  2XRQ D;  2E5L Q;  2YV5 A;  1I3Q B;  4LUO A;  4X3S A;  2ZM6 Q;  3B6Y A;  3FRP B;  2JP1 A;  3ULP A;  2NVQ B;  1JWS D;  1HTP A;  1LT6 D;  4IUP A;  3W1G A;  3CC4 A;  3D4W A;  2NZH A;  3S1M H;  4YHH Q;  2ICE C;  4A3I G;  1PH9 A;  4H0L C;  4U68 A;  1HFG A;  2E2H H;  2IHE A;  2Z1C A;  1YHB A;  5GAE C;  1N33 L;  2VQE Q;  3IL8 A;  4ID6 A;  1SE4 A;  4OWT B;  3S14 H;  3HKZ E;  3STB C;  4BXX H;  2NVX H;  3S15 H;  1HZA A;  5ISR A;  4QB4 A;  5E4W C;  1E2V A;  4BA1 I;  2EQS A;  4F7X A;  1YNN D;  1SRO A;  1PH8 A;  1VQA A;  4JW0 A;  4B3S L;  3ICE A;  2B2V C;  4GZY C;  4MN3 A;  1DYQ A;  1FR3 A;  1SJE D;  3V05 A;  4A3D H;  4V0B A;  4HJA A;  2E2J B;  3GV6 A;  3K7A B;  4AQY Q;  1DXM A;  1HQR D;  4FXD A;  5IYB H;  3K57 A;  2Q2U A;  1G29 1;  4LFB Q;  3HOZ G;  2WAQ B;  4EQO A;  1EFW A;  3KF8 B;  1RTO A;  5ELO A;  5BN4 A;  1WCM G;  2UUB Q;  5IYD H;  4HIO A;  5IWA L;  5I9O A;  4C3J H;  4JV5 L;  2VUM G;  1EOV A;  1NNX A;  4C3H B;  3OWF A;  3GTO B;  4XDX A;  1V9P A;  1STB A;  5IY0 A;  2RF4 A;  2RSO A;  1MSG A;  2N3S A;  4PNY A;  4JOI C;  1CQF A;  3NTK A;  4LWC A;  4LF4 L;  2UXC L;  2V4D A;  3H94 A;  1HNW Q;  1LTL A;  4DV1 Q;  3T16 A;  1MD2 D;  2A69 C;  1N32 L;  5IP9 G;  4K0K Q;  1HHV A;  3MHB A;  5EPL A;  4M1U B;  1TWA B;  3SK8 A;  1KDC A;  3HKS A;  3HFZ B;  4JI0 Q;  3I4N G;  5IP7 G;  3UI2 A;  1RHP A;  4HAE A;  1EIH A;  1DON A;  3A74 A;  1PRT C;  1I94 Q;  5DM6 3;  2DNE A;  3UDG A;  5FO7 B;  5FO8 B;  3RLF A;  1QOH A;  3GTP B;  3M3Y H;  3HOY G;  4X66 L;  4FF2 A;  1Q81 C;  2M00 A;  4OX9 Q;  1L1O A;  1ROD A;  2Z9H A;  4B3R L;  2R93 H;  3L0O A;  3DWP A;  3DEO A;  1U0L A;  3D8G A;  1PFB A;  1HH2 P;  3FKI H;  1I6H H;  5FLX L;  2PW5 A;  4A3K G;  3MAQ A;  4NXM Q;  5EKL A;  3HOX B;  1IKL A;  4P71 A;  3T1Y Q;  3QB3 A;  1KDB A;  1IZ6 A;  4N8X 1;  4JI3 L;  3VYS A;  1WFQ A;  4LMQ D;  1X56 A;  1D1I A;  5C4X B;  2E2D C;  4UDU C;  4IJL A;  1VF5 C;  1SNO A;  3AU7 A;  1TWC H;  3GTQ H;  4BBR B;  2K5Q A;  1BCP C;  3P1H A;  2B2V A;  1PH5 A;  4MTK A;  3M4Q A;  1KDA A;  4JI2 Q;  1KD1 C;  3CCV A;  2E8G A;  3A5Z B;  3DMU A;  1V1Q A;  4E6I A;  4DK3 C;  5LMN Q;  3PUX A;  3EN2 A;  5GAG C;  3I4O A;  3J81 c;  4B3M Q;  2Q8I B;  4A3M G;  1YZ6 A;  5JJK A;  3U50 C;  1YHA A; 
#chains in the Genus database with same CATH homology
 5CV7 A;  4LK1 C;  2I46 A;  3PUY A;  3QO2 A;  5EPJ A;  1II3 A;  4CBV A;  2KCN A;  5I2Y A;  2DY7 A;  3E0J A;  3NXW A;  4M8A A;  1RF2 D;  2CVR A;  3QJY A;  2F0N A;  5KYL A;  2F4I A;  1G91 A;  4XQJ A;  2X69 A;  5C0X J;  1S5E D;  4X3K A;  4K8I A;  1XX8 A;  4KN7 C;  2VB3 X;  1QE6 A;  1GUG A;  1HUM A;  3EA6 A;  1I4Q A;  1LT3 D;  3URY A;  4G7O C;  1U9R A;  3P20 A;  4S3S A;  1ESF A;  3VA5 A;  1F2Y A;  1UUP A;  1U4P A;  1ENC A;  3W3A A;  3A55 A;  5JVH 3;  3BG3 A;  5FKA C;  1HPC A;  4WJW A;  2B63 B;  5C3W A;  2B2W C;  4KI0 A;  2HCC A;  2H1E A;  2EDG A;  1STG A;  3A8K E;  2EPB A;  2K33 A;  1PTO H;  4DA2 A;  5JEA G;  3D6C A;  5HUR A;  3VA7 A;  2BDN A;  1EOT A;  2K5W A;  5ELC A;  5ELD A;  1VCI A;  4IUU A;  5I6Y A;  2Z8L A;  2PZU A;  4EGV A;  1FNV A;  2D5D A;  2F0M A;  1NR4 A;  1YNJ C;  1WTX A;  2JSO A;  3OIQ A;  2L55 A;  1S4Z A;  2NBF A;  2LS0 1;  1CI3 M;  1B53 A;  4XQN A;  3H0G B;  4L8J A;  2RBM A;  1M8A A;  1I4H A;  3K0Y A;  2QEJ C;  1ET6 A;  3OW7 A;  1D2B A;  3FPP A;  4RCO A;  5IOD A;  2F0G A;  4PMC A;  3T53 B;  5EJW A;  5IT9 E;  1Q12 A;  3HZX A;  3TP8 A;  1B44 D;  2RDH A;  2KUM A;  3I90 A;  2J7Z A;  1FGB D;  2RKS A;  4OGQ C;  4A3E B;  1F2L A;  1A6X A;  2KCC A;  4PMW A;  2MUY A;  2AQ3 B;  4ZUI A;  3NBI A;  4HCE A;  1EFI D;  1PFM A;  5CR3 A;  1OXU A;  1K83 B;  1G2T A;  3TME A;  3WOF A;  1J9O A;  4B08 A;  3A8J E;  2K5D A;  3H6M A;  3BVG A;  2A6H D;  4LAA A;  5C3X A;  1RD9 D;  2KEC A;  1NCV A;  2AUJ D;  5K36 G;  1JOR A;  2HDM A;  5EQ0 A;  3RUZ A;  2XNA C;  3K5N A;  4RGT A;  5J22 A;  1SMY C;  2EY1 A;  2EJF C;  3FEW X;  1EWH A;  2TSS A;  3MXG A;  3GQB A;  3L7Z C;  1CK1 A;  2K7V A;  2WAC A;  1EYD A;  1EZ8 A;  2PPB C;  1GUT A;  5M9O A;  2L11 A;  2XIW A;  3X3N A;  1EYC A;  4A3G B;  2ICI A;  1BR9 A;  5EGT A;  1XYI A;  2XWJ B;  2EY5 A;  3BYY B;  3G7L A;  1IW7 D;  2QDB A;  3SE0 A;  2F0U A;  1PYW D;  2FMM A;  1CHQ D;  3PO3 B;  4HMI A;  2A6E C;  3T13 A;  1HFN A;  2IT1 A;  1ZYR C;  2X6G A;  5E1F A;  3C2P A;  2L5T A;  2L0C A;  3I73 A;  1CZW A;  1S5C D;  2PW7 A;  5M5W B;  2FJ2 A;  2B39 A;  2BDO A;  3NUC A;  4J8Q A;  4P2C B;  4KHZ A;  2EYL A;  3HOW B;  2B2Y C;  3S2D B;  2RSN A;  5M3M B;  1AZP A;  4C1N K;  3TZU A;  3I4M B;  1GUN A;  3MXP A;  3NWT A;  3P7J A;  5C4H A;  3Q22 A;  1M4V A;  4CKC A;  4HCS A;  1EY6 A;  5J39 A;  3ND8 A;  1FD7 D;  3OMG A;  3ONA B;  3AB9 A;  3PMF A;  4HN7 A;  1MBY A;  1TS2 A;  3NTH A;  3GP7 A;  1DOL A;  4QF4 A;  2O5J C;  1PLF A;  1CQV A;  1L0X B;  3FPU B;  2HQE A;  3MTS A;  3KLR A;  4FNF A;  3KBX A;  2EYF A;  1VDZ A;  3KK7 A;  2BE5 D;  2HCI A;  3R93 A;  5C44 B;  2BA1 A;  3DWQ A;  1PFN A;  1KNE A;  1EQV A;  5IGC A;  1TII D;  1ZEQ X;  4CGY B;  4KD3 A;  1PXU A;  5CC4 A;  4EQP A;  1Y8N B;  3I72 A;  5K36 H;  4Q5V A;  2KVM A;  3WOE A;  1A2U A;  2F0K A;  1YNJ D;  5M5X B;  1SJH D;  1OO9 B;  2WB1 B;  1TY0 A;  3HGB A;  5KRU A;  4DAV A;  4J1M A;  5I9P A;  4KJO A;  3FVQ A;  1U4M A;  1CA5 A;  5CV5 A;  1B2T A;  4R9W A;  2XN9 C;  2MGS A;  2LY7 A;  1ESR A;  2IX0 A;  3VYR A;  4KKU A;  3R3O A;  2JA8 B;  1ET9 A;  1GHJ A;  1WTW A;  4XYO A;  4DGZ A;  1EY5 A;  1O7Z A;  2ZT9 C;  1VF7 A;  2R3Z A;  3KLS X;  1JWM D;  3TBI B;  3TDQ A;  4DF7 A;  5CGK A;  5I6W A;  3Q24 A;  3X3M A;  4DU9 A;  1CA6 A;  1V43 A;  3GTJ B;  4BS9 A;  2JXM B;  1LLR D;  3HOU B;  4ILW A;  5BN3 A;  2EYO A;  4IZ8 A;  3F2U A;  5COY A;  2JEB I;  1H9K A;  4KV6 A;  4XT1 B;  1XWE A;  5FO9 B;  2JE6 I;  3SEB A;  2M9V A;  1GHK A;  2E76 C;  1TS3 A;  4ABN A;  1GJX A;  1LAB A;  2OEO A;  3KLS A;  3BS1 A;  3DHQ A;  3EFX D;  1T5E A;  3ERO A;  1Z47 A;  1Q90 A;  2PYK A;  4G4K A;  1IYV A;  2FHT A;  4N9T A;  4F88 A;  1TKW B;  1LT5 D;  3J81 E;  3S9W A;  3GTL B;  3R2I A;  1O80 A;  1TWH B;  5DM7 3;  3VR4 A;  4K14 A;  1I4X A;  1QJO A;  2QCP X;  4RKB A;  1K8M A;  4UAI A;  3MC0 B;  1DCZ A;  3VYT A;  1PZI D;  4O1N A;  2WII B;  5DAU A;  2C5C A;  2F03 A;  1Q1E A;  4NKL A;  1Y8P B;  3A54 A;  4Z9C B;  1XTC D;  2A6E D;  2K6A A;  4TKO B;  1H9J A;  1ZYR D;  5C0X G;  3M85 A;  1LTG D;  5ELF A;  4WOR A;  3K6O A;  5ELE A;  2F0H A;  3FDT A;  3V96 A;  1PZK D;  3D6W A;  1ICW A;  2MJ8 A;  1ZXT A;  1TU2 B;  2PO4 A;  4ODG A;  1GUS A;  3CRK C;  1Z7T A;  2JA7 B;  1S5F D;  3T56 B;  1F9R A;  5CBE E;  3M7N A;  2RDG A;  5I4D A;  1XXG A;  4ZK9 B;  1C4Q A;  1SYD A;  4R8I A;  3C1E A;  3MWY W;  4YIJ A;  1WD0 A;  3D31 A;  5IOC A;  1PTO C;  4G7Z C;  1EY0 A;  5JAV A;  3S1M B;  1LT4 D;  2BOS A;  1J8I A;  1ZKO A;  1B50 A;  3RD4 A;  2EE1 A;  3E5S A;  4ZAI A;  2IW3 A;  1EU3 A;  2F0P A;  4L63 B;  4ZKB B;  2IX1 A;  4ZLT F;  3D3R A;  3MXU A;  3OOC A;  4XTC S;  4DXG A;  1V1P A;  4A3D B;  4HR7 B;  1Z6H A;  2K04 A;  4R8N A;  5HGT A;  2IPK D;  2K1B A;  1CTM A;  3K5L A;  3OIP A;  4C3J B;  1STH A;  4IAL A;  4Y7N B;  5JPM C;  2NVT B;  1F77 A;  2EOT A;  2L4N A;  3CQZ B;  3BVM A;  1PMR A;  1JCK B;  1TT2 A;  4OL7 A;  4FF3 A;  1T5X D;  5CV8 A;  4QIW B;  1FYC A;  3C1F A;  4TSS A;  2K32 A;  5DNF A;  5C5L A;  1BO0 A;  3KUP A;  5IGG A;  1EEI D;  1JWU D;  5LL6 S;  5C0X H;  2H4O A;  1LAC A;  4IFD I;  2R93 B;  1I6H B;  1D5M C;  3OSO A;  5IGB A;  1NUC A;  1Y69 U;  2E75 C;  2BCO A;  1HCZ A;  3DEP A;  3R8B A;  2PQE A;  5IGF A;  1RDP D;  4A3F B;  1ENA A;  1RKN A;  3GTQ B;  1TWC B;  4OO1 G;  4WRD A;  2L9H A;  4OIJ A;  4NW2 A;  2JEA I;  1EYA A;  1S5D D;  4G57 A;  1STN A;  3MVV A;  3VR3 A;  1GUW A;  1O7Y A;  2DY8 A;  2R6G A;  1C8C A;  1V1P B;  2KED A;  1IL8 A;  2Y0S B;  1R4Q B;  4X3T A;  5KEE A;  4WFN 3;  3T4A C;  4XYQ A;  2XRS D;  1V8Q A;  2FMC A;  3TN2 A;  1SE3 A;  3BVZ A;  2NYZ D;  2TMP A;  1U4R A;  1EY4 A;  5CV9 A;  1WD1 A;  4RH6 A;  4TQU S;  2WV6 D;  5T1G A;  1IYU A;  1ILQ A;  4BBS B;  3BDL A;  4K8J A;  1DZ1 A;  2A69 D;  2E2I B;  3MZ5 A;  5K5P A;  1RTN A;  2MHV A;  4A3B B;  1R4P B;  2B2U C;  2OT2 A;  3VR6 A;  2YU9 B;  3P75 A;  5C6A A;  1BNZ A;  4XQQ A;  3LWU A;  1PRT D;  1PRT B;  1HUN A;  2KOL A;  5FOB B;  3Q0A A;  1SYE A;  1FNW A;  1UAP A;  2SOB A;  2B2W A;  5A2Q E;  3NK9 A;  3NSW A;  1STA A;  3H91 A;  4PV1 C;  3MA2 B;  2A68 C;  2XWB B;  3J7Y W;  2A5H A;  2NUC A;  1E2W A;  3TZD A;  2A73 B;  3I91 A;  3J7A V;  1JOO A;  5KNC A;  4IFD G;  2WP8 J;  1PTO D;  5G3L D;  2F0T A;  1VMC A;  4C3H G;  1BCP D;  2RVL A;  1BCP B;  3M4O B;  3HG9 A;  1ONL A;  3HOY B;  1DJR D;  2PMZ B;  1NAP A;  3ND9 A;  4G7H C;  1D1K A;  2WKD A;  2KHS A;  4DAY A;  3IFD A;  1B9M A;  1F9Q A;  2ZXO A;  1GOZ A;  4PQX A;  5JEA H;  3D4R A;  3NPP A;  3L3O C;  2KQ3 A;  3S17 B;  2F3W A;  2B2T C;  2F0S A;  3K5O A;  3EVQ A;  1OXV A;  2KA7 A;  1STE A;  1CM9 A;  3PUV A;  4OHJ A;  1F9S A;  2VNU D;  2BA0 A;  1SNM A;  1TWF B;  1SND A;  4B9X A;  4KKS A;  3T51 B;  2MP1 A;  3KBG A;  1A2T A;  3BDC A;  4KD4 A;  1EWC A;  4A3M B;  1SXT A;  1H9R A;  4IUR A;  1I50 B;  1WTR A;  1HA5 A;  3M7G A;  2F0D A;  1L0Y B;  3S1R B;  1AZQ A;  1LV9 A;  4RWS C;  3VR2 A;  3JAM E;  3I8Z A;  1WTV A;  2PZT A;  1OXS C;  4DNR B;  4FXK C;  4DN4 M;  5BN5 A;  2G9H D;  3DWA A;  3QOL A;  3MFG A;  4ZQ3 A;  3RZD B;  1CFM A;  1R9T B;  4RA8 A;  4IN3 A;  1Y1V B;  1W6K A;  2K03 A;  1AP0 A;  2IJ0 A;  1W6J A;  3PIO 3;  3TP7 A;  2D9U A;  5F2D A;  3C46 A;  2EY6 A;  3SXH A;  5DEH A;  4K6D A;  3N6R A;  2J0T D;  1SNC A;  3Q6S A;  2QF7 A;  3OWE B;  5JPN C;  5LHY 1;  4H13 C;  2F0O A;  4NMZ A;  4HTH A;  5C0X I;  1EEF D;  2VXW A;  2QKI C;  5JJZ A;  4IFD H;  1EL0 A;  1BXT A;  4Q0F A;  5COR A;  3J80 L;  3VYU A;  1H9S A;  3O13 A;  5EPK A;  3GTK B;  1QB5 D;  3NQT A;  2JYO A;  2DNC A;  2EYJ A;  2EJM A;  3I70 A;  4RKL A;  5C4Z A;  1KLG D;  3A7A B;  3IFT A;  2WIN B;  3SR1 A;  2NN6 I;  4CKE A;  3SHL A;  3PIP 3;  2B2Y A;  1E0B A;  3GTG B;  4ULL A;  3HOV B;  4C3I B;  4H44 C;  3N52 A;  5EKI A;  1KNA A;  5AFW A;  2AQ2 B;  1ILP A;  1WVL A;  1U4L A;  4NP5 A;  1I4R A;  1QCB D;  3VR5 A;  1F2Z A;  5TSS A;  4RGM A;  3A56 A;  4EVO A;  4IUT A;  5M3F B;  1AN8 A;  5E4X A;  4J6H A;  4O42 A;  4MIU A;  2VB2 X;  1JOQ A;  2PNR C;  2F0J A;  1G2S A;  2RA4 A;  4ZUJ A;  4I7Z C;  1EY8 A;  3DXJ C;  1QNU A;  1I4G A;  2A68 D;  4FXG C;  1SMY D;  4CJ0 B;  1NSN S;  2DN8 A;  3QG1 A;  1SBB B;  4C56 C;  2EJG C;  1AFP A;  4IUN A;  2KJX A;  3MEH A;  1RCV D;  4F87 A;  1IHZ A;  1I6V C;  1EY7 A;  5A35 A;  3LX0 A;  1EZ6 A;  2ID0 A;  4RGN A;  1BOS A;  2MPM A;  4FF1 A;  2XVS A;  1JR0 D;  4LJZ C;  3R2T A;  4A93 B;  2NVY B;  5EBD A;  2NTT A;  4KY7 A;  2O2L D;  2J4X A;  1E2Z A;  3NP8 A;  1DM0 B;  3ERQ A;  2NTS A;  2AWO A;  4KJN A;  2SNS A;  2KEE A;  2ZXR A;  3J81 L;  2WKC A;  2EZV A;  3A8I E;  2K05 A;  3K5M A;  2F0Q A;  4KN4 C;  3HS0 C;  1GXD C;  1SYG A;  1H9S B;  1AW7 A;  3MXN A;  2O5I C;  2NN6 G;  3G6J B;  3EQL C;  4K5W A;  5EBC A;  2AUK A;  2SDF A;  1ML0 D;  2AWN A;  4L6T B;  5IIF A;  1NR2 A;  1LTB D;  2FFK B;  1B4O A;  1O78 A;  1WTQ A;  1F9P A;  5FLX E;  1LTT D;  3BDO A;  2B8F A;  2D2C C;  1DOM A;  4RHR A;  2A6H C;  3H3V C;  1C48 A;  2IWH A;  4QMG A;  2EY2 A;  5IGD A;  1BQQ T;  4KY6 A;  1D5X C;  4XIG S;  4OO1 I;  1EQT A;  2E2H B;  1S5B D;  3S14 B;  1B3A A;  2NVX B;  3S15 B;  3RMH A;  1JQY D;  4CKB A;  1FNU A;  1MGS A;  1JE4 A;  4RHS A;  3S1Q B;  3TP5 A;  4K5X A;  5I2X A;  1KAB A;  4K5V A;  3SVM A;  3H09 A;  4FVM A;  2NB0 A;  1LTR D;  2Q8T A;  1IW7 C;  1RJT A;  1MI2 A;  3DUZ A;  3QWN A;  2F0V A;  1OXT A;  1KTK A;  1SYB A;  4ME5 A;  1QNK A;  3PV0 A;  2CW0 C;  4ZKC B;  2R92 B;  3NHH A;  3DM1 A;  3HKZ B;  1SFO B;  1BF4 A;  4CHT B;  4DK0 A;  5D14 A;  1EU4 A;  4FO2 A;  1EIG A;  3OPO A;  5KIX A;  2K28 A;  5ELB A;  4QCL A;  1K8O A;  1LTA D;  2Z4H A;  2D62 A;  3RZO B;  3Q23 A;  3FMC A;  3M3Y B;  4QUC A;  2LKV A;  2B8G A;  5JVG 3;  3U9S A;  5FK9 C;  2O4X A;  4DFA A;  2ZXP A;  5CYU A;  3CKI B;  3AMU A;  3FKI B;  2LMC B;  2XSC A;  5KYI A;  2F0I A;  4F8M A;  2NN6 H;  1GUO A;  3TSS A;  3GD7 A;  3MFY A;  1HA6 A;  2F0E A;  3K59 A;  2G9D A;  1TVX A;  4BY1 B;  3K58 A;  5IGE A;  1B1Z A;  3S1N B;  2FIN B;  1BBX C;  2BE5 C;  3V2T A;  4ZRZ A;  2GA4 B;  4XT3 B;  1AEX A;  3GO5 A;  1Y8O B;  3M4Y A;  3NQI A;  2YYZ A;  1WTO A;  1MSH A;  1SNQ A;  4RAU C;  4C3I G;  2N55 A;  3I4L A;  1Q1B A;  1F2M A;  4A3I B;  5CMD A;  2NZ1 D;  1JC7 A;  1TS5 A;  1LTI D;  5E3F A;  1SE2 A;  4KK7 A;  4IUQ A;  4EQN A;  5M5Y B;  2F0W A;  1SDF A;  4CJ2 C;  4IQZ A;  1IKM A;  1SYC A;  5C3E B;  1PDQ A;  1X32 A;  2Z4I A;  4A3J B;  2PZW A;  1TWG B;  4IUV A;  4FF4 A;  3S16 B;  2Q8R E;  5IT9 L;  4DK1 A;  2AQ1 B;  1TQO A;  4KHV A;  3BYT B;  2L1B A;  2N88 A;  3HOZ B;  1WCM B;  4JBW A;  4OIK A;  1Q8I A;  5KND A;  4QUF A;  2VUM B;  1PRT F;  5CV6 A;  3GTM B;  4X3U A;  3D4D A;  4KKT A;  1EY9 A;  4ZYS A;  4HMJ A;  1D5Z C;  3E6Z X;  4PMB A;  1UEA B;  3W2D A;  4KTA A;  3PUZ A;  1DD2 A;  3L9A X;  5D65 A;  2F1M A;  1DOK A;  2RDF A;  5KNB A;  4DAP A;  3QOJ A;  1D6E C;  3I4N B;  1CT1 D;  3CRL C;  3IAY A;  1PTO B;  5A2Q L;  5T1I A;  1PTO F;  1HXY D;  5G3L F;  3SK4 A;  3HEJ A;  1BCP F;  3HRZ C;  1CHP D;  1YNN C;  3NBH A;  3PUW A;  5JEA J;  3ITP A;  1I4P A;  4C1N I;  4XXE A;  1WTP A;  1QWY A;  4H7B A;  1KAA A;  2I07 B;  4A3K B;  2X6L A;  5CBA E;  2CQA A;  3TP6 A;  2EXZ A;  2M2L A;  4RGO S;  3J7A F;  4TRD A;  4FP5 D;  3IKJ A;  5CV4 A;  5KGU A;  4KY5 A;  1BUV T;  2LFN A;  1G8Z D;  4OO1 H;  1CZG A;  2C9O A;  4HSP A;  1O7L A;  2CW0 D;  4RFB A;  1PZJ D;  2B2U A;  4MHE A;  3C3L A;  4V19 0;  1G6Z A;  4K6L A;  1Q3L A;  1TS4 A;  3QIA A;  2RQX A;  3PO2 B;  3CHB D;  2EYH A;  3I3C A;  3ZYY X;  3LWE A;  1HTL D;  2EYM A;  2OXP A;  4B9W A;  2EYP A;  3NWS A;  4I65 A;  2IL8 A;  2HDL A;  2SNM A;  2F3V A;  3HP3 A;  1HQM C;  3SDZ A;  3OHX C;  5NUC A;  1SSO A;  1A3U A;  2IX3 A;  1UNS A;  3U9O A;  4DXF A;  1V1O A;  1JOK A;  2EVB A;  3S2H B;  3EJI A;  3OMC A;  4JK1 C;  4KMU C;  3JAM L;  2HUG A;  5EKK A;  2K01 A;  5D3D A;  5C4J B;  1SYF A;  1LTS D;  2A74 C;  4K2L A;  4AYB B;  4C3J G;  4HED A;  1KLU D;  4CJ1 B;  1JIC A;  4BA2 I;  2R7Z B;  4IFD J;  5D3I B;  5JOB A;  1JB3 A;  2OF1 A;  2SEB D;  4C2M B;  4DNT B;  3NTI A;  3KF8 A;  2F0L A;  1LO5 D;  1X3Q A;  1SAP A;  5C5M A;  4NDX A;  5J1Z A;  3J80 E;  1SEB D;  4K2K A;  1TR5 A;  2B2T A;  4HSV A;  2NWG A;  1A15 A;  1Y1W B;  2JA6 B;  2PCF B;  1H9M A;  1QIL A;  4N9P A;  4U67 3;  1HRJ A;  1BDO A;  1OXX K;  5LL6 X;  2F0F A;  3LNN A;  2ENB A;  1A3T A;  3A7L A;  1QG7 A;  1SNP A;  2QIL A;  4BWG B;  3WDN A;  2CHB D;  2E74 C;  4FYD A;  2L12 A;  1A3V A;  3GV3 A;  4BY7 B;  2R61 A;  3CU7 A;  3SK5 A;  3SK6 A;  2JA5 B;  1TY2 A;  1VMP A;  1ENF A;  3NE5 B;  1X3P A;  1B9N A;  1STY A;  3BZD B;  4RCN A;  2XRQ D;  1I3Q B;  4X3S A;  3FRP B;  2JP1 A;  2NVQ B;  1JWS D;  1HTP A;  1LT6 D;  4IUP A;  3D4W A;  2ICE C;  4H0L C;  4U68 A;  1HFG A;  2Z1C A;  3IL8 A;  4ID6 A;  1SE4 A;  5ISR A;  4QB4 A;  5E4W C;  1E2V A;  4BA1 I;  4F7X A;  1YNN D;  2B2V C;  4GZY C;  4MN3 A;  1DYQ A;  1FR3 A;  1SJE D;  3V05 A;  4V0B A;  2E2J B;  3GV6 A;  3K7A B;  1DXM A;  1HQR D;  4FXD A;  3K57 A;  1G29 1;  2WAQ B;  4EQO A;  1RTO A;  5BN4 A;  5I9O A;  4C3H B;  3OWF A;  3GTO B;  4XDX A;  1STB A;  2RSO A;  1MSG A;  4PNY A;  1CQF A;  3NTK A;  2V4D A;  3H94 A;  3T16 A;  1MD2 D;  2A69 C;  1HHV A;  3MHB A;  5EPL A;  4M1U B;  1TWA B;  3SK8 A;  1KDC A;  3UI2 A;  1RHP A;  4HAE A;  1EIH A;  1DON A;  1PRT C;  5DM6 3;  2DNE A;  5FO7 B;  5FO8 B;  3RLF A;  1QOH A;  3GTP B;  4FF2 A;  2M00 A;  1ROD A;  3DWP A;  3DEO A;  3D8G A;  1PFB A;  5FLX L;  2PW5 A;  3MAQ A;  5EKL A;  3HOX B;  1IKL A;  3QB3 A;  1KDB A;  3VYS A;  4LMQ D;  1D1I A;  5C4X B;  2E2D C;  4UDU C;  1VF5 C;  1SNO A;  3AU7 A;  4BBR B;  2K5Q A;  1BCP C;  3P1H A;  2B2V A;  1KDA A;  3DMU A;  4E6I A;  3PUX A;  2Q8I B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...