3TP6A

Crystal structure of staphylococcal nuclease variant delta+phs l36e/l103k at cryogenic temperature
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
130
structure length
130
Chain Sequence
KLHKEPATLIKAIDGDTVKLMYKGQPMTFRELLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEAKVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS L36E/L103K at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 38
structure length 130
sequence length 130
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2011-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3tp6A00
4EQOA 5C5MA 2F0FA 5KGUA 3ERQA 5IGEA 1SNDA 2F0IA 4K5XA 2HQEA 2SNSA 3T16A 1JORA 2EYHA 3D4DA 2F0PA 4IZ8A 1NUCA 3SXHA 5ISRA 3HZXA 3NUCA 5CR3A 3SK6A 3TP7A 5DAUA 3TP8A 5I9OA 4N9PA 1STNA 3U9OA 4K8IA 4I65A 1ENAA 3MHBA 5K5PA 3NHHA 4DF7A 1F2MA 2OF1A 3C1FA 3D6CA 4HMIA 1EZ8A 2PZWA 3VA5A 5IGFA 4ZQ3A 5J39A 4OL7A 1TT2A 2SOBA 1JOKA 3PMFA 1STGA 3QOLA 4KD4A 1AEXA 2PZTA 2RBMA 4KJOA 4QF4A 4RKLA 5CV7A 4YIJA 3SK5A 4DU9A 5CC4A 2RDFA 2F0GA 3HEJA 3T13A 2EY5A 2EY2A 4RKBA 1SNMA 3NK9A 4PMCA 2PYKA 2PZUA 3NP8A 2KQ3A 2O4XA 3H6MA 3OSOA 4IALA 2F0OA 1STHA 1U9RA 1EY7A 2EYJA 3MXPA 4KV6A 4B9WA 3OMCA 4NP5A 4HTHA 4QMGA 2F0WA 5C3XA 1EY8A 4F8MA 5I6YA 5KRUA 1TR5A 1EYDA 4IUNA 2NUCA 4WORA 1JOQA 4KD3A 1SYBA 3BDCA 2EY6A 4HMJA 1SNPA 4S3SA 5EKKA 3EVQA 5NUCA 2F0VA 4WRDA 2LKVA 2EY1A 3NQTA 5KEEA 5CV9A 4B9XA 2KHSA 2EXZA 4PMBA 3TP5A 2QDBA 5IGCA 3DMUA 3QOJA 4EQNA 2OEOA 2F0EA 1SYEA 3MVVA 3R3OA 4K2KA 3D8GA 4DGZA 1KABA 2F0LA 1EY6A 3EROA 2F3WA 1A2UA 4N9TA 5CGKA 5C3WA 1KDAA 1SYGA 5CV4A 2EYOA 3RUZA 2F0SA 4G57A 3ITPA 5EGTA 3DHQA 1KDCA 3SK4A 4KTAA 2F3VA 5KIXA 1NSNS 5C5LA 1TQOA 4TRDA 2F0NA 2F0QA 4K14A 2F0UA 3SHLA 1F2YA 2F0MA 2RKSA 4K5WA 4NKLA 4QB4A 2F0TA 1SYFA 1A3UA 2OXPA 4NDXA 4K5VA 2F0KA 3D4WA 2ENBA 4F7XA 2EYFA 5CV6A 5HURA 1STYA 4J6HA 4K2LA 5IGBA 5DEHA 4KY5A 1A3VA 1EY5A 2EYLA 1EY4A 4ZUIA 2WACA 2F0JA 1EZ6A 5JOBA 1EY9A 1A2TA 1ENCA 1RKNA 1KAAA 2EYMA 4KJNA 2M00A 4E6IA 4KY6A 2EYPA 4ME5A 5I9PA 3P75A 1SNCA 4KY7A 5E1FA 3V2TA 1KDBA 2PW7A 4LAAA 1SNQA 4J1MA 4ODGA 3EJIA 3LX0A 5IODA 3NXWA 3MEHA 4ZUJA 5IGDA 1A3TA 3OMGA 5C6AA 2F0HA 3BDLA 4KHVA 5I6WA 1F2ZA 5M9OA 3OWFA 5CV5A 5IIFA 4EQPA 1JOOA 4R8NA 2PQEA 5CV8A 5F2DA 3S9WA 3QB3A 4K6DA 5IOCA 5J1ZA 1IHZA 2F0DA 3SR1A 3TP6A 4EVOA 2SNMA 4K8JA 3C1EA 3SK8A 1STBA 1EY0A 1SYCA 1SYDA 3E5SA 3MZ5A 3P1HA 4ID6A 4DFAA 5IGGA 1EYAA 1SNOA 4PNYA 2PW5A 1EYCA 4MIUA 5EKLA 5JAVA 5C4HA 1EQVA 1STAA 4NMZA 5E3FA 5HGTA 5J22A 5KYLA 3TMEA 4H7BA 5C4ZA 5KYIA 1II3A
chains in the Genus database with same CATH superfamily
2FFKB 4EQOA 1VQ5A 2UXCQ 1HPCA 3DWAA 3CMAA 3S1MH 4C1NI 4HCEA 1GXDC 2IHFA 2Z6KC 1C48A 3BDOA 2E2IH 3EQLC 1CQFA 1AZQA 3MHBA 2J4XA 3I55A 1D7QA 1H9RA 1TT2A 2JEBI 4KD4A 5CV4A 2ICIA 2PZTA 1WI5A 4B08A 2RDFA 2F0GA 1VQIA 3HEJA 2WIIB 3W1GA 3T53B 2RHSB 3KK7A 1CFMA 1TWCB 1H9SA 2GVAA 1EY7A 3EN2A 4PMWA 4PQXA 3OMCA 4HTHA 5C0XH 4A3JH 3I4NG 4DR4Q 4CDCC 3KF8B 1SYBA 3G7LA 4KKTA 1YEZA 3M4OB 3FPPA 4RWSC 2VQFQ 1LUZA 4DNRB 3GTQB 3CP0A 4A3FG 5IGCA 4JOIC 5GAGC 1PV4A 1BBUA 2B3GA 3FDTA 1KABA 2F0LA 2F3WA 1PTOB 4TQUS 1RDPD 1V1PA 1LTSD 1K3RA 4ULLA 3G6EA 4GOPB 4DR5Q 5JJIA 1HFNA 3F8TA 2LSSA 5DLQE 1VQAA 1JR0D 3J7AV 1VQCA 4UHVA 1F9PA 3PO3H 5CBAE 2DJGC 1C7YA 2K05A 3CC7A 4KK7A 4OX9Q 4A3GH 4WJWA 2BA1A 1XPRA 1PHJA 1I6HB 2GA4B 4IPGA 1EY4A 2UU9Q 3GTGH 1B9NA 4YCVA 3V05A 3GTOH 1Q1BA 2A1AA 4PZ7A 5DM73 3HOUG 4JYAL 4YHHL 1O7YA 3GTKB 3V2TA 1KDBA 1ILPA 3TEHB 4LNQA 1LTGD 4DAMA 4RHSA 1Q82C 3N52A 1X32A 1PTOC 5IYCH 2HIXA 1WTPA 4BBRG 4GOPC 3S9WA 1B53A 4B3TL 4DR1Q 1LTAD 1LTRD 2F03A 5IGGA 3E0EA 3TZUA 5ELDA 1VQMA 5D14A 1X3EA 4IURA 1AE2A 2L11A 3MTSA 4BS9A 5C4ZA 4RG1A 1PFNA 4J15A 3CC4A 3BYTB 1CKOA 3FVQA 1SNDA 2F0IA 4KLKA 2QDLA 5M5WB 3SXHA 4DV2Q 3NUCA 3HOUB 4KKUA 2KHJA 3KBGA 2EXDA 2PMZE 3CQZB 3FKIB 3J7YW 1YBYA 3D4RA 4OXPA 1BQQT 5M5YB 2PZWA 2VNUD 4RKLA 1VQNA 2B2WC 2Z9HA 4BBRB 3U4ZA 4V190 2VXWA 2MUYA 4JVZA 3HKZG 1DCZA 3I4NH 3E0JA 5A35A 1EQQA 4HIKA 4QUCA 4A3FH 1ASZA 1WCMB 2CH4A 1G291 3HKSA 4QL5A 4NXML 4WRDA 4IO9A 5T1GA 3H3VH 1W6KA 4TSSA 4L5TA 1SMXA 2R6GA 4R4IA 3G71A 1S72A 2YU9H 2C9OA 3A5UA 3E6ZX 5EGTA 3MA2B 4A3KB 1SR3A 3SHLA 1F2YA 2RKSA 1JWMD 1IW7C 1X55A 1EOTA 2Q2HA 3QR8A 1A15A 1WOCA 4FXDA 1JICA 2ZJRA 1PXUA 2EJGC 1KAAA 4HN7A 2EYPA 4MNOA 3PIO3 3W3AA 2D2CC 2B2VA 4EQ5A 2NN6G 5C4JH 3I70A 2I07B 5L37A 4BY1G 1PYSB 4G7HC 3GTPB 1IBKL 3ZJYC 3ULLA 3DWPA 1LACA 3I4OA 1B70B 2OTLA 1B1ZA 1YVCA 4NMZA 4XDXA 5E4XA 4OHJA 3HP3A 1Y1VG 2JA8G 1AN8A 4DV5L 3J80i 4POGA 2EJFC 3T16A 2JYOA 3RLOA 4ALPA 2XRSD 4LJZC 1L0XB 5G3LF 1XTDA 2JA5G 4GLVB 4L5SA 2PCFB 1SE2A 2B63G 3S2HH 1E2WA 4HMIA 1E22A 4OONA 4QIWE 2F3IA 5A2QE 2FMCA 4A3EB 5BR8L 3QIAA 1SMYD 4IALA 1NMFA 4DAYA 3HOVG 2K04A 1BBWA 1I50H 2UUCQ 3SDZA 1SJHD 4ZKBB 1NCVA 4GN4B 1UWVA 1Y1VB 4A3DH 4FXGC 1K8AC 3GTJH 3IKJA 1Z6HA 1Y8OB 1MBYA 5FKAC 4B3SQ 1O80A 3EROA 2Z6BA 4RCOA 2JA5B 4POFA 5EPKA 4HJAA 2B63B 4GLAC 1EOVA 2M2LA 3UDFA 1T5EA 3MXNA 3NEMA 5CBEE 1XWEA 2A68D 3VR4A 4BA2I 2F0KA 1HJPA 3CAMA 3AYHB 3M4YA 4JI0Q 5JJZA 4UP8A 3MWYW 1STEA 3HOVB 1GHJA 1SAPA 1PH8A 3T56B 2IL8A 5ELCA 2E8GA 2PI2E 1NMGA 3P75A 4KY7A 4WFN3 4HJ5A 4JV5L 4KN4C 4JI8Q 3F2CA 3R2IA 2HQLA 2OT2A 2JP1A 2Z8LA 3J81c 5IGDA 4BY1H 4X65L 1G6PA 4A3LH 4K6LA 1D1KA 1JE5A 4JI6L 4K6DA 1I4QA 4JYAQ 3J81i 3NE5B 1K28A 3C1EA 4YHHQ 1SYDA 1D6EC 3Q22A 1PZJD 2JA8H 1P16A 1WTRA 1ZEQX 4JI4L 1XNQQ 4XTCS 3KLSA 1R9TB 1K83H 1Y8PB 3U9SA 4BY7G 5IP9H 4PZ8A 1X3FA 3CW2C 1MD2D 3A8KE 3DM3A 3PUWA 2XNAC 4X64L 4B3TQ 4IUTA 2NVTH 2K75A 4ZYSA 2F0PA 1EIGA 1GUGA 5CR3A 2LS01 1QJOA 2L15A 4L5RC 1UE1A 3RLFA 2CFMA 2B39A 4C3JB 2JA7H 4IUPA 1QVFA 1LTLA 4B3RL 2A5HA 1WTHA 3ONAB 1ZYRD 1S4ZA 1BOSA 5G3LD 1IL8A 1VQPA 1B9MA 3FEWX 3KF6A 3VR2A 4OWTB 3J80L 1UEBA 4O2DA 1BF4A 1CZGA 3D0FA 4JI3L 4HMJA 3EVQA 4BY7B 1DGSA 3TN2A 5C3EB 4M8AA 1Y69U 1PH9A 2Q2UA 3IAYA 4K2KA 3T1YL 1VF7A 3RZOB 4BA1I 3IFTA 5FO8B 3OOCA 1TWGH 5C3WA 2E2HH 2Q2IA 3OIQA 2UXDL 4DPGA 3S16H 2Z6KA 2XN9C 5M3FB 2F0NA 4NXMQ 2DY7A 1LTBD 4K14A 4IFDG 2A6HC 1QNKA 5EAYA 1NY4A 5KNBA 3Q6SA 5DEHA 1DM0B 1A3VA 1EY5A 1PMRA 1N9WA 1X56A 4DV1L 1PH3A 2R7ZH 1ILQA 4LFAL 3J81E 4OEMB 2JE6I 1PFBA 5E1FA 1UAPA 4HJ8A 1SFOH 1PZID 4IJLA 4A93G 3S15H 3E9IA 1VQ9A 1DJRD 3M3YH 2RA4A 2AQ2B 5IOCA 1Y8NB 4HSPA 3UE1A 2NTSA 5GROA 2XVSA 3E5SA 2L4NA 1I4RA 1K8OA 5JAVA 2KUMA 1CHPD 3T1HL 1FJGL 3WOEA 3S1NH 1HNZL 4GKKL 2JJQA 3W1BA 2PI2A 3I4MH 1TS2A 1B4OA 2R92B 1SRUA 2HQEA 1JORA 1I3QH 2RDHA 5ISRA 4ZK9B 1U4PA 1IBKQ 1R4QB 1DD2A 3KF8A 2N8NA 1Q8IA 5I2XA 2DN8A 3C46A 5GQOA 2XGTA 1CKNB 3DEPA 3Q8DA 4A3IG 4YY3L 3G48A 2H5XA 1KLUD 2F52A 2V1CC 4DV5Q 2RBMA 2DNEA 2NZHA 4LWCA 1A6XA 1ONLA 4PMCA 1VQDA 3NP8A 2KENA 3VA7A 1HNWL 4GOPA 5KNDA 1KRTA 3IRBA 1GD7A 5C3XA 1DOLA 4B9WA 5IGFA 4LF6L 1EY8A 4HCSA 1SSOA 2K52A 5EKKA 1XYIA 1EU3A 4LUZA 3BVMA 1J6QA 3OPOA 2EXZA 1EUJA 2N88A 4DR3L 5BR8Q 4DUYL 1NAPA 1RHPA 4ZRZA 3N6RA 3C2PA 4H0LC 1VQKA 1CSQA 1SYGA 1I6VC 2K33A 1GVPA 4C3HG 1E1TA 3CCEA 1MI2A 3A7LA 2B2TC 3M9BA 1ESRA 3IL8A 4A3MH 2PPBC 2F0QA 1IYJB 1DYQA 5DNFA 3TDQA 4JC0A 3GQBA 3CCLA 1M90C 3SGIA 3CPFA 4KHPL 5FLXL 4IPDA 2B2WA 4UP7A 4BBSG 2D0OA 4A93H 2F0JA 1EZ6A 5GAHC 1RKNA 3Q0AA 2JEAI 3AMUA 1IZ6A 1G2SA 1VQEA 5E4WC 3S1MB 4XT1B 1XPUA 3H0GH 1BKBA 2N49A 2K28A 5I4DA 2ASBA 1I4PA 1K3BC 3GTLH 2E2IB 3D6WA 4HR7B 5F2DA 3JAML 3F2UA 1EFWA 1PFSA 1GJXA 3PUYA 1EY0A 1MSHA 2WAQG 1D5ZC 1CTMA 4JBWA 4A3BG 3WOFA 1TY2A 1I94L 4JV5Q 3DXJC 1PFMA 1RJTA 3DWQA 2JQOA 1XPOA 4DV3L 1S40A 3R2TA 1O7LA 2Z4IA 4JBJA 3PUXA 4QIWB 1E7ZA 3HOYG 1RODA 4JI6Q 4A3JB 1EIFA 2O2LD 1A8VA 3A54A 4NB3A 3I73A 4A3IH 2K5HA 1VMPA 1B44D 2D62A 4GN3B 4P72A 3LWEA 3RLNA 3PGZA 3HOWG 4K8IA 2K01A 4JI4Q 2UUBL 2DGYA 4AH6A 3GV6A 4GN5A 5JPMC 3SEBA 4X64Q 4A76A 2EPBA 3M4QA 5JEAJ 2XTIA 4KHZA 1ET9A 1PA6A 3H91A 3PO3B 1HH2P 4A3GB 3CHBD 1OXVA 1XTCD 1KAWA 1F9QA 1YJNA 1VQFA 2B8GA 3S17H 2EY1A 2JA6H 3GTGB 3GTOB 2KVMA 1J8IA 4QCLA 1JB7A 1F9RA 1M8AA 4LFBQ 2CVRA 4C3HH 1TKWB 3PQIA 1X65A 1KQSA 4Y7NH 1KDAA 3CXCA 1CI3M 4JI3Q 3ITPA 4DNIA 1S5FD 1Q8KA 1SLJA 2MPMA 1TWFH 1OXTA 3M7GA 3K7AH 1PTOF 1CZWA 4BBSH 2Z1CA 4XQJA 2AHOB 3CC2A 1BXTA 3T1YQ 1N36Q 3TQYA 2K5NA 2NVXB 4RAUC 4FF4A 2KEDA 2EYMA 2ZXPA 2ZM6L 2UXDQ 1EQRA 2KA7A 2L55A 1SNQA 4AYBG 1LTTD 1AE3A 1AFPA 3VYTA 2OQKA 2K03A 1YNXA 1D5MC 2CW0D 3I90A 1N8RC 4A3BH 3ULJA 4DV1Q 2G9HD 4EVOA 4DV6Q 4LFAQ 2OQ0A 4F88A 2ZXOA 1VQ4A 4OO1I 1PLFA 3B6YA 4X3SA 1AW7A 1YNJC 2CWAA 1EWHA 3HOYH 3I4NB 5J22A 3CU7A 4LF4L 1F9SA 3RMHA 1KNEA 4TVAB 3NPPA 3RN2A 1VQ6A 3WWVA 4A3FB 3H09A 3HOWH 1Y14B 2X6LA 1WJJA 1EIYB 3T1HQ 4ZCKA 2YU9B 3STBD 2QKIC 4ZQ3A 5J39A 1HNZQ 4GKKQ 2N55A 2DJFC 1STGA 1EQTA 1PH2A 2NVXH 1LM0A 3SK5A 2MO0A 1X9NA 1KL9A 2E2DC 4UAIA 2VZAA 3TSSA 2O4XA 3ER0A 3UDGA 1EU4A 5IT9L 4C3IH 2F0WA 1WYDA 4YY3Q 2NUCA 4QQBX 4DV7L 2DY8A 2F0VA 3KOJA 4IUQA 3M7NA 2QDBA 4FDBA 3BJUA 2RVLA 3H3VC 1HNWQ 2QW7A 1CM9A 1JWUD 2MNAA 5C4JB 4LF6Q 3X3NA 4OO1G 1WFQA 4IQZA 3NSWA 3BVGA 5AFWA 4I7AA 4TRDA 4LF5L 3QG1A 4DR3Q 5E7NA 3BZDB 2K5QA 3TREA 1RTNA 1BCPB 4K2LA 2EDGA 4FNFA 4B3ML 2FINB 2K5WA 1K9MC 1SXTA 5IE8A 1HCZA 4KY6A 4A3DG 3I91A 2JA9A 5EJWA 1PTOD 4UY8C 2VB2X 1MSGA 3LX0A 4DXGA 1WTXA 1SE4A 3BDLA 2X6GA 2RHQB 1TIID 1X3PA 3OWFA 2WKCA 4JI2Q 2HHHL 3S2HB 4YWKA 2IX1A 1SEBD 2K7VA 3HKZB 4IPCA 3UDIA 1FVIA 1EYAA 5ELNA 1BCPC 3TMEA 1JB3A 1D2BA 3DUZA 2R7DA 4Q5VA 1I50B 1S3OA 2EVBA 1K8GA 1SMYC 4PZ6A 3I4LA 3NTHA 4A3DB 2Q8TA 3GTJB 1I94Q 3PO2G 2FJ2A 1HQMC 1GHKA 2VY3A 4A3LG 3LWUA 1EZ8A 1QB5D 3SE0A 3J80c 3U4VA 1JOKA 1S5DD 3FP9A 4R4OA 4YIJA 4DUZL 3RZDH 2Y0SG 5T1IA 3NTKA 2EY5A 4RKBA 5AJ3L 3A55A 2PZUA 5M3MG 3ND8A 3K0YA 1TXYA 1U4MA 4O0AA 1C4QA 3RD4A 2B8FA 5I6YA 5IP9G 1L2FA 2UUBQ 4YWLA 1O7ZA 3HOXH 3P7JA 5M5XH 1EFID 2LXJA 3DMUA 3R3OA 4OO1H 3MEFA 1DOKA 1EY6A 4N9TA 3UDXA 2JA7G 2XWBB 3D3RA 4BY1B 2NB0A 1Q7YC 4FF3A 1EEID 1M4VA 1Q3LA 3ICEA 2A6EC 4MZ9A 1IBLL 1Z47A 2B2YC 1CT1D 3R8BA 2SEBD 2JA8B 1Z9FA 1ENCA 3VDYA 4WJ3M 1K83B 2ZJQA 2ID0A 3KJPA 5D65A 3CCJA 2ZTCA 4GNXB 2NVTB 1B2TA 2K5VA 4C56C 3CCQA 1Y1WG 2L12A 2A69C 2TSSA 5C6AA 1JJGA 5IIFA 1HTLD 2PQEA 3TBIB 3S1RH 4G7ZC 2JA7B 1H95A 5CORA 3W2DA 2ZM6Q 1D8LA 1CHQD 1NBWA 3SK8A 1CKNA 4C2MH 1A63A 2L0CA 1RF2D 4RH6A 5GADC 4K0KL 5IWAL 1V1QA 5E3FA 4CJ1B 3MFYA 2BOSA 2B2TA 5KYLA 5I2YA 2LMCB 1K8MA 2LY7A 1PH7A 1ZYRC 2R7ZG 4G7OC 5KGUA 2VL6A 2XWJB 3BU2A 2GVBA 2E5LL 1KTKA 3PO2H 4XIGS 4GNXC 1HA5A 3J80E 1MKHA 3CF5A 4IOCA 3KDFB 3W5OA 3CRKC 2UUAL 1JWSD 3J7A5 3C1FA 1TS3A 1TWGB 2E2HB 1GUOA 1JCKB 5M3MH 3K57A 4OWWB 2BE5C 2IJ0A 3S16B 2QCPX 3SK4A 2QF7A 5C5LA 4DK3C 3OSOA 4U673 2FHTA 3NQIA 4JPBW 4R4QA 3MC0B 2EYJA 2KOLA 3BVZA 1TR5A 1MJEA 3I4MG 3MFGA 3FPUB 3L3OC 5NUCA 2QILA 2Q8IB 2R7ZB 3PUZA 4X3UA 2YV5A 3TP5A 4LF8L 5JJKA 5K36H 1SFOB 4JI1L 2DNCA 3S15B 4P75A 3KUPA 1BDOA 1HNXL 3M3YB 4G57A 3MAQA 2XRQD 1TWAH 3DHQA 1KRSA 1VQ8A 4DV7Q 5FLXc 3O13A 1D5XC 2F0MA 2F0TA 4R9WA 3D4WA 5HURA 2R61A 1BBXC 2J7ZA 4XYOA 1BNZA 3S2DH 1N33L 2A19A 2NZ1D 3URYA 1QCBD 3S1NB 4DR2L 1Y1WH 2RQXA 3I4MB 4LAAA 4LF5Q 3CPWA 1EWCA 2K6AA 1YIJA 3JAMc 1I3QB 2YYZA 1U4RA 1Q12A 1IXRA 4ZUJA 5FJ8H 1PYBA 2CWPA 4CGYB 5I6WA 1JE4A 2D9UA 4OELB 4QJFA 4JI7L 1ET6A 4B3MQ 3JAMi 3C3LA 3TP6A 3CCUA 4A3MG 1HR0W 2SNMA 1EL0A 2VQEL 2WINB 3SVMA 2I5HA 4L63B 1ZKOA 1H9MA 1EYCA 1HR0L 4RMFA 2PO4A 2Q2TA 1H9JA 3HS0C 1EQVA 5ELEA 5C4XH 2K50A 1E1OA 2K32A 3GDEA 2F0FA 4IJHA 5IGEA 4OIJA 2HHHQ 1NE3A 2IWHA 2O5IC 5COYA 3AFQA 3S1QH 2JN4A 3SK6A 1L0YB 3H0GG 4JOIA 1TY0A 4DKAC 2E76C 3ERSX 4OGQC 1ICFB 4GKJL 4OX9L 4O42A 2KECA 3K8AA 3I2ZA 1FNWA 3OWEB 1XNRL 5TSSA 4P2CB 3AEVA 3PF5A 3CMEA 3NK9A 4A3MB 1I4XA 1B50A 5IYDG 4WJ4A 1WTWA 1HTPA 1EYDA 3HKZE 3L2PA 5LHY1 5FO9B 4A93B 1FYCA 3NQTA 4IPHA 5KEEA 2QA4A 4DUZQ 4UDUC 4PG3A 1LO5D 2B2UC 3F1ZA 3QOJA 2F0EA 4DGZA 5AJ3Q 4CKBA 3D8GA 5JVH3 5KNCA 5FLXE 2NVYH 2J0TD 1YZ6A 1A2UA 3BYYB 4UPAA 3H0GB 2A6HD 2RDGA 4KTAA 3GTLB 1H9KA 2P5ZX 5BN3A 4BXXH 1ICWA 5HGQA 3UI2A 2HDMA 1WD1A 4LUVA 4NDXA 1DONA 4F7XA 5CV6A 2E75C 5LMNW 2XIWA 1YHQA 1IKMA 2EYLA 3JAME 3G4SA 4GLXA 2R93H 5LMNL 4KJNA 2M00A 4E6IA 2I0QA 5FO7B 1SDFA 2JA6G 1JJ2A 4J1MA 4ODGA 2IHEA 1VQJA 5IODA 4UP9A 3A7AB 4A3IB 2E2JH 3WDNA 1IBML 1IBLQ 2F0HA 4R4TA 2IT1A 1PRTF 4R8NA 3HGBA 3K7UC 1QUQB 1YITA 1C0AA 1AH9A 1JJCB 2EOTA 5EPJA 1HUNA 1VMCA 5C4HA 3NWTA 1STAA 1BUVT 5H1SE 2NVQH 1II3A 4NPSA 4XT3B 2D5DA 1WD0A 4DV0L 3ERQA 1OXSC 3HOZG 3L9AX 2HT1A 3MXGA 2IPKD 2A74C 3TP7A 3S17B 2JA6B 1IYUA 4K0KQ 3GP7A 5IWAQ 4GZYC 2WB1G 3U9OA 2PQAB 4C3HB 2FXQA 1Q46A 4Y7NB 5FK9C 2VUMG 5IT9c 2MHVA 2E5LQ 5IYDH 1B3AA 5C0XJ 1JMCA 1XMOL 1ZXTA 4CHTB 1QVCA 1X6OA 4DR7L 4X65Q 1TWFB 4N8X1 1VCIA 2VB3X 5C44G 3K7AB 4BBSB 3MXPA 5IYBH 4Y52H 4FF2A 4IUNA 4WORA 4DNTB 4IOAA 4PV1C 5JEAG 2HCCA 2UXBL 1AZPA 5LMUL 1DXMA 3CCSA 2IX3A 2HD3A 5GAEC 4P73A 1GO3E 2WB1B 3BS1A 1KDCA 2KCMA 4IUVA 2WAQB 2YTXA 1FR3A 3K0XA 2EZVA 4A3BB 4NW2A 2MO1A 1YNND 3QWNA 1GUNA 3NBHB 1L1OB 1UEAB 4LF8Q 2ATWA 4B3RQ 4J6HA 4C3IG 2CW0C 2B29A 3IFDA 3FRPB 3HOYB 1G6ZA 1HNXQ 2CKZB 4L5QA 2KJXA 2MFIA 1BR9A 1X54A 2PW7A 4KKSA 4CDEC 3L7ZC 4I7ZC 1CA6A 1HFGA 4H02A 3GTMH 3HOWB 1B7YB 1T5XD 4EX5A 1QILA 1LT3D 3L0OA 1F2ZA 2RCFA 1FGUA 5J3BA 1OTCA 1N33Q 3SR1A 3VR3A 3I8ZA 2UUCL 1E0BA 4CJ0B 2ICEC 4DR2Q 3MZ5A 4MTKA 1HZCA 1L1OC 1SNOA 1CA5A 2PW5A 3K5LA 3VYSA 1QZGA 3HOZH 1WTVA 2WKDA 4X6AH 4H7BA 3STBC 4B3SL 5FLMH 4CKEA 1PRTD 1M1KC 4F87A 2FMMA 1YJWA 5C5MA 4C3IB 4JI7Q 2Z0SA 2BCOA 3PCOB 2SNSA 2B2YA 3K81C 3J7AF 2VQEQ 4J8QA 1TS4A 3A8JE 2WV6D 1HZBA 5IT9E 1HR0Q 2CQOA 3S14H 2LXKA 4I65A 3NBIA 2VUMH 2CQAA 1CUKA 2CH4W 3D6CA 3VA5A 1ML0D 2F4VL 4OL7A 5M9OA 3OIPA 4JI0L 1HUMA 4X3TA 5CC4A 5C44H 4DR6L 2HUGA 3RN5A 4DK6C 5IY0A 1TWHH 2AWNA 2BDNA 2PYKA 1VQOA 1SN8A 1SROA 2F0OA 3OHXC 1STHA 4JI8L 1GOZA 1P8LA 4QMGA 1LT6D 5JEAH 4GKJQ 5JVG3 1DOMA 4CDFC 5EPLA 2A73B 4B9XA 2A8VA 4AYBB 1XNRQ 4LK1C 3RNUA 4EQNA 4YCWA 2OEOA 1FJGQ 3LGJA 2AUKA 3HFZB 3P20A 5CGKA 5IP7G 3FKIG 4GNXA 1XNQL 5LL6S 2ZT9C 2F0UA 4V0BA 4K5WA 3CKIB 2LFNA 1TWCH 1N34L 2KEEA 3MXUA 4IN3A 4FVMA 3K59A 1STYA 2NZOA 3T51B 3DEOA 4ZUIA 3M4OH 2OCEA 2WACA 3GTQH 1IKLA 4KN7C 3CCRA 1WCMG 4RGTA 2EE1A 3HOXG 1BCPF 1SBBB 1XMQL 1CQVA 2QEXA 1F2LA 1QWYA 4FP5D 4JBMA 1PTOH 1YJ9A 2IX0A 2AMCB 1U0LA 4LW1A 4NXNL 2CHBD 1CK1A 4X3KA 2BH8A 4TKOB 5CV8A 2ZTEA 1BO0A 1IHZA 2NN6I 3OYYA 4ABNA 1YNJD 3KDFA 5LMNQ 4DUYQ 4HIMA 2M9VA 1AP0A 4Z9CB 1JQYD 1HZ9A 3KBXA 4A3KG 1WTOA 3RZDB 1EEFD 4PNYA 1VQLA 1I6HH 2R7FA 1LLRD 5EKIA 3QO2A 1X3GA 1IBMQ 4A75A 3AB9A 4RGNA 1IYVA 4LUOA 3GTKH 1Q81C 1B8AA 3I7FA 4DA2A 2DUDA 4DXFA 4ZKCB 4KHPQ 2QGQA 3HOXB 2AWOA 2KBNA 4G4KA 1ENFA 5DAUA 5M5XB 1I4GA 2OWOA 4N9PA 1STNA 1Q86C 2OF1A 4JW0A 1NJIC 4ZLTF 3KLRA 1E2VA 1UUPA 4DV0Q 1RTOA 4AIMA 4U68A 1W2BA 1AEXA 2BDOA 2E74C 1K0SA 4DU9A 2MJ8A 4LF7L 4RA8A 2YTYA 2TMPA 4DN4M 2Q8RE 4IUUA 1V9PA 1KXLA 2N3SA 2WFWA 4F8MA 1JOQA 1UE5A 5M5WH 3BDCA 2CCZA 1SNPA 3HOUH 4P74A 3X3MA 5CMDA 5IP7H 3CQZH 4PMBA 4DV3Q 1V8QA 1XMOQ 3FKIH 2MP1A 4DR7Q 3D31A 1XXGA 4KMUC 2HCIA 5M5YH 1A0IA 2C35B 1RIPA 3JC66 4HIOA 1DZ1A 4YCUA 4R4CA 3RUZA 4BBRH 2F0SA 1X3QA 1PYWD 1H9SB 1TS5A 1TQOA 3S1RB 2JSOA 4NKLA 3ZYYX 4HJ7A 4A3EG 1SYFA 2UXBQ 4C2MB 5LMUQ 2A68C 1WCMH 5IGBA 2GN5A 1G2TA 4X66L 4HIDA 2PNRC 5JOBA 4R1JA 1QOHA 3KYHC 2RSNA 1L0WA 3KJOA 1TVXA 1V1PB 1QNUA 4HEDA 3BZKA 4AQYL 5LL6X 3PO2B 3DLLA 5K36G 1IW7D 3NXWA 1G91A 3PIPA 2JXMB 4APVA 1PDQA 4CKCA 1PH6A 3H94A 3EA6A 4A3KH 5EQ0A 3VR5A 2SDFA 3QB3A 2B2UA 2Y0SB 2F0DA 3HRZC 3G6JB 1PH4A 2F4IA 1BCPD 1VQBA 2AQ1B 1YI2A 1STBA 2KHIA 3P1HA 1U5KA 4RGMA 2IW3A 4DFAA 5M3MB 4M1UB 4YWMA 4DV4L 4MIUA 1B3QA 4FO2A 1I4HA 3GO5A 4KI0A 1WVLA 1FNVA 3TS2A 2WB1E 1EYGA 3NTIA 1SJED 2WAQE 2ZJPA 1Z7TA 2VS1A 3EBEA 5EBDA 5CYUA 2NBFA 3A74A 1Q1EA 3D4DA 3OW2A 1UE7A 1NUCA 5DM63 4JG2A 4R8IA 3A5ZB 5BN4A 2H4OA 1VQ7A 5FJ8G 3U50C 1S5ED 2I5MX 1LTID 1I5FA 4DF7A 4XYQA 3K5NA 3GTPH 2BA0A 2SOBA 3PMFA 5CV7A 4FYDA 1TWAB 3A0JA 3ND9A 1RD9D 1GKHA 1O78A 3I56A 2KQ3A 1MHWC 3A8IE 4RGOS 1U9RA 5ELBA 5C4XG 5KRUA 1J5EL 4QY7A 1G51A 1HA6A 4KD3A 3S2DB 2F4VQ 2L1BA 4A3CG 5A2QL 3FHWA 5CV9A 1EIHA 5BN5A 4DR6Q 1HRJA 2NN6H 5JPNC 4LF4Q 1WTQA 1Y1WB 4X62L 1QE6A 3MVVA 1SYEA 1G8ZD 3PUVA 1D1IA 2G9DA 4L6TB 1KLGD 2D0PA 1FL0A 3GV3A 1V43A 4C3JG 2A6ED 4QGUA 4A3EH 4JI5L 1LABA 1LYLA 1NR4A 4DAPA 2AUJD 4LFCL 3Q24A 5ELOA 4QB4A 1CSPA 1A3UA 3K6OA 3E9HA 4ILWA 3NWSA 1QUQA 2ENBA 1NR2A 2EJMA 2EYFA 1KIXA 2KCCA 3OTOL 3TRZA 2PNHA 4O1NA 1FNUA 2H1EA 2XSCA 1A62A 3CD6A 1Y1VH 3Q23A 3TZDA 5C4XB 1VS0A 4IFDI 1SNCA 2A69D 4CBVA 1N32L 1E24A 3RR5A 3CRLC 4DK1A 2JA5H 5C3EG 3CCMA 3S1QB 1T9HA 1N34Q 4LF9L 3EIVA 3MEHA 2B63H 1R4PB 2UXCL 1U4LA 4AYBE 1MIUA 2ALYB 4N8FA 2L5TA 4BXXG 1QG7A 4P71A 3CCVA 2PQAA 5M3FG 1XMQQ 1E3PA 2MQHA 1QZHA 3HOVH 3NENA 1XJVA 1GM5A 4NXNQ 1RCVD 4LFBL 3BZCA 4CJ2C 2R93G 1J9OA 1MGSA 4FF1A 1BVSA 4K5XA 4DAVA 2EYHA 4IZ8A 1O7IA 4BWGB 3UE0A 1TU2B 4Q0FA 4DR4L 1PZKD 5K5PA 2BE5D 3NHHA 1GUTA 1KHIA 2NVYB 4C1NK 1N36L 2VQFL 1KNAA 4OWXB 1RL2A 3AU7A 3T13A 2EY2A 1SNMA 1R9TH 2ZXRA 3PV0A 2B2VC 4A3CH 2HIVA 2NYZD 1SE8A 1K73C 3F2DA 3NBHA 2ZTDA 4DR5L 1L1OA 1K0RA 1V1OA 4S3SA 1LT5D 2R3ZA 2R93B 2R92G 4MHEA 1NTGA 3VR6A 4DV6L 4LF7Q 3NELA 4XXEA 3F2BA 4IFDJ 4C3JH 4L8JA 1YHBA 1VDZA 5D3IB 2V4DA 5EBCA 3M4PA 2UU9L 3K80C 2E2JB 4DAYB 1OO9B 2RCNA 1HHVA 2F3VA 1NSNS 4JCVE 1OXUA 1ESFA 3DM1A 2OXPA 4HAEA 5HY6A 3FMCA 1UNSA 5IYBG 2AQ3B 4KY5A 1Q90A 1JC7A 2YTVA 2PMZB 4EGVA 2QEJC 4BY7H 1NNXA 4DR1L 5C3EH 2EQSA 2NVQB 3KLSX 5I9PA 3PIP3 3RZOH 1W3SA 3AQQA 3LNNA 2K4KA 3EJIA 2K14A 2MGSA 5C0XI 3MXNB 3OMGA 2VW9A 3HG9A 5JJLA 1MJCA 2WP8J 5CV5A 4EQPA 1JOOA 5M3FH 3PF4A 4HSVA 4X66Q 3EFXD 4MTNA 5J1ZA 3H15A 3J81L 2RF4A 4DV2L 2C5CA 1SYCA 1CKMA 4AQYQ 5EKLA 1PH5A 2I5LX 3VYUA 4HJ9A 1IL2A 1PH1A 2KCTA 5KYIA 4XQNA 1HQRD 2HDLA 1VF5C 2KCNA 5D3DA 1C9OA 3J81j 3TS0A 1F77A 1KC8C 3HZXA 2RSOA 5ELFA 3TP8A 2K1BA 2BH2A 4DV4Q 5I9OA 1FGBD 4CDDC 1SE3A 1ENAA 3BG3A 5FOBB 3OW7A 3KLWA 1F2MA 3QOLA 2OTJA 4KJOA 4H13C 4QF4A 4GS3A 4JBKA 1JT8A 4RHRA 3K5OA 3V96A 3I3CA 1VQHA 1W6JA 2X69A 4IFDH 4A4IA 3ULPA 1GUSA 3H6MA 2AKWB 4KV6A 2Y0SE 3J7ZC 4NP5A 1VQGA 5FLMG 4FXKC 2R92H 2ES2A 2EY6A 4RCNA 4JI2L 2I46A 1YNNC 2LKVA 5C0XG 4A3JG 1C8CA 2KHSA 2Z4HA 4MN3A 4XQQA 3GD7A 4LMQD 1LV9A 1PRTB 1EWIA 1XX8A 3KF6B 4ZAIA 3GTMB 2EYOA 1J5EQ 2EIFA 1LT4D 2G5DA 2F1MA 1E2ZA 5KIXA 2NWGA 1GUWA 1ASYA 4H44C 4OIKA 1UE6A 1FD7D 2JK8A 2UUAQ 1KD1C 3T4AC 4K5VA 2N78A 4X62Q 2O5JC 3K58A 3PO3G 2K5DA 2L9HA 3HOZB 1A2TA 1EY9A 1OXXK 4A3GG 3M85A 4JI5Q 4ME5A 2IY5B 3KFUA 3K5MA 1HXYD 3AFPA 1HZAA 3VYRA 1PVOA 3I72A 4LFCQ 4JK1C 3PIOA 1PRTC 1A3TA 1QVGA 3S24A 2NTTA 4KHVA 3OTOQ 4QUFA 3S14B 3QJYA 3PSIA 2VUMB 4RFBA 5IYCG 3H3VI 4K8JA 4JI1Q 4ID6A 1S5CD 4DK0A 3A56A 1YHAA 1N32Q 3U58A 1S5BD 5C44B 3R93A 5HGTA 1TWHB 4ME3A 4LF9Q 3E3XA
chains in the Genus database with same CATH topology
2FFKB 4EQOA 1HPCA 3DWAA 4C1NI 4HCEA 1GXDC 1C48A 3BDOA 3EQLC 1CQFA 1AZQA 3MHBA 2J4XA 1H9RA 1TT2A 2JEBI 4KD4A 5CV4A 2ICIA 2PZTA 4B08A 2RDFA 2F0GA 3HEJA 2WIIB 3T53B 3KK7A 1CFMA 1TWCB 1H9SA 4PMWA 1EY7A 4PQXA 3OMCA 4HTHA 5C0XH 1SYBA 3G7LA 4KKTA 3M4OB 3FPPA 4RWSC 3GTQB 4DNRB 5IGCA 3FDTA 1KABA 2F0LA 2F3WA 1PTOB 4TQUS 1RDPD 1V1PA 1LTSD 4ULLA 1HFNA 1JR0D 3J7AV 1F9PA 5CBAE 2K05A 4KK7A 4WJWA 2BA1A 1I6HB 2GA4B 1EY4A 1B9NA 1K8OA 3V05A 1Q1BA 5DM73 1O7YA 3GTKB 3V2TA 1KDBA 1ILPA 1LTGD 4RHSA 3N52A 1X32A 1PTOC 1WTPA 3S9WA 1B53A 1LTAD 1LTRD 2F03A 5IGGA 3TZUA 5ELDA 5D14A 4IURA 2L11A 3MTSA 4BS9A 5C4ZA 1PFNA 3BYTB 3FVQA 1SNDA 2F0IA 5M5WB 3SXHA 3NUCA 3HOUB 4KKUA 3KBGA 3CQZB 3FKIB 3J7YW 3D4RA 1BQQT 5M5YB 2PZWA 2VNUD 4RKLA 2B2WC 4BBRB 4V190 2VXWA 2MUYA 1DCZA 3E0JA 5A35A 4QUCA 1WCMB 1G291 4WRDA 5T1GA 1W6KA 4TSSA 2R6GA 2C9OA 3E6ZX 5EGTA 3MA2B 4A3KB 3SHLA 1F2YA 2RKSA 1JWMD 1IW7C 1EOTA 1A15A 4FXDA 1JICA 1PXUA 2EJGC 1KAAA 4HN7A 2EYPA 3PIO3 3W3AA 2D2CC 2B2VA 2NN6G 3I70A 2I07B 4G7HC 3GTPB 3DWPA 1LACA 1B1ZA 4NMZA 4XDXA 5E4XA 4OHJA 3HP3A 1AN8A 2EJFC 3T16A 2JYOA 2XRSD 4LJZC 1L0XB 5G3LF 2PCFB 1SE2A 1E2WA 4HMIA 5A2QE 2FMCA 4A3EB 3QIAA 1SMYD 4IALA 4DAYA 2K04A 3SDZA 1SJHD 4ZKBB 1NCVA 1Y1VB 4FXGC 3IKJA 1Z6HA 1Y8OB 1MBYA 5FKAC 1O80A 3EROA 4RCOA 2JA5B 5EPKA 2B63B 2M2LA 1T5EA 3MXNA 5CBEE 1XWEA 2A68D 3VR4A 4BA2I 2F0KA 3M4YA 5JJZA 3MWYW 1STEA 3HOVB 1GHJA 1SAPA 3T56B 2IL8A 5ELCA 3P75A 4KY7A 4WFN3 4KN4C 3R2IA 2OT2A 2JP1A 2Z8LA 5IGDA 4K6LA 1D1KA 4K6DA 1I4QA 3NE5B 3C1EA 1SYDA 1D6EC 3Q22A 1PZJD 1WTRA 1ZEQX 4XTCS 3KLSA 1R9TB 1Y8PB 3U9SA 1MD2D 3A8KE 3PUWA 2XNAC 4IUTA 4ZYSA 2F0PA 1EIGA 1GUGA 5CR3A 2LS01 1QJOA 3RLFA 2B39A 4C3JB 4IUPA 2A5HA 3ONAB 1ZYRD 1S4ZA 1BOSA 5G3LD 1IL8A 1B9MA 3FEWX 3VR2A 3J80L 1BF4A 1CZGA 4HMJA 3EVQA 4BY7B 3TN2A 5C3EB 4M8AA 1Y69U 3IAYA 4K2KA 1VF7A 3RZOB 4BA1I 3IFTA 5FO8B 3OOCA 5C3WA 3OIQA 2XN9C 5M3FB 2F0NA 2DY7A 1LTBD 4K14A 4IFDG 2A6HC 1QNKA 5KNBA 3Q6SA 5DEHA 1DM0B 1A3VA 1EY5A 1PMRA 1ILQA 3J81E 2JE6I 1PFBA 5E1FA 1UAPA 1PZID 1DJRD 2RA4A 2AQ2B 5IOCA 1Y8NB 4HSPA 2NTSA 2XVSA 3E5SA 2L4NA 1I4RA 5JAVA 2KUMA 1CHPD 3WOEA 1TS2A 1B4OA 2R92B 2HQEA 1JORA 2RDHA 5ISRA 4ZK9B 1U4PA 1R4QB 1DD2A 3KF8A 1Q8IA 5I2XA 2DN8A 3C46A 3DEPA 1KLUD 2RBMA 2DNEA 1A6XA 1ONLA 4PMCA 3NP8A 3VA7A 5KNDA 5C3XA 1DOLA 4B9WA 5IGFA 1EY8A 4HCSA 1SSOA 5EKKA 1XYIA 1EU3A 3BVMA 3OPOA 2EXZA 2N88A 1NAPA 1RHPA 4ZRZA 3N6RA 3C2PA 4H0LC 1SYGA 1I6VC 2K33A 4C3HG 1MI2A 3A7LA 2B2TC 1ESRA 3IL8A 2PPBC 2F0QA 1DYQA 5DNFA 3TDQA 3GQBA 5FLXL 2B2WA 2F0JA 1EZ6A 1RKNA 3Q0AA 2JEAI 3AMUA 1G2SA 5E4WC 3S1MB 4XT1B 2K28A 5I4DA 1I4PA 2E2IB 3D6WA 4HR7B 5F2DA 3JAML 3F2UA 1GJXA 1EY0A 3PUYA 1MSHA 1D5ZC 1CTMA 4JBWA 3WOFA 1TY2A 3DXJC 1PFMA 1RJTA 3DWQA 3R2TA 1O7LA 2Z4IA 3PUXA 4QIWB 1RODA 4A3JB 2O2LD 3A54A 3I73A 1VMPA 1B44D 2D62A 3LWEA 4K8IA 2K01A 3GV6A 5JPMC 3SEBA 2EPBA 5JEAJ 4KHZA 1ET9A 3H91A 3PO3B 4A3GB 3CHBD 1OXVA 1XTCD 1F9QA 2B8GA 2EY1A 3GTGB 3GTOB 2KVMA 1J8IA 4QCLA 1F9RA 1M8AA 2CVRA 1TKWB 1KDAA 1CI3M 3ITPA 1S5FD 2MPMA 1OXTA 3M7GA 1PTOF 1CZWA 2Z1CA 4XQJA 1BXTA 2NVXB 4RAUC 4FF4A 2KEDA 2EYMA 2ZXPA 2KA7A 2L55A 1SNQA 1LTTD 1AFPA 3VYTA 2K03A 1D5MC 2CW0D 3I90A 2G9HD 4EVOA 4F88A 2ZXOA 4OO1I 1PLFA 4X3SA 1AW7A 1YNJC 1EWHA 3I4NB 5J22A 3CU7A 1F9SA 3RMHA 1KNEA 3NPPA 4A3FB 3H09A 2X6LA 2YU9B 2QKIC 4ZQ3A 5J39A 2N55A 1STGA 1EQTA 3SK5A 2E2DC 4UAIA 3TSSA 2O4XA 1EU4A 5IT9L 2F0WA 2NUCA 2DY8A 2F0VA 4IUQA 3M7NA 2QDBA 2RVLA 3H3VC 1CM9A 1JWUD 5C4JB 3X3NA 4OO1G 4IQZA 3NSWA 3BVGA 5AFWA 4TRDA 3QG1A 3BZDB 2K5QA 1RTNA 1BCPB 4K2LA 2EDGA 4FNFA 2FINB 2K5WA 1SXTA 1HCZA 4KY6A 3I91A 5EJWA 1PTOD 2VB2X 1MSGA 3LX0A 4DXGA 1WTXA 1SE4A 2X6GA 3BDLA 1TIID 1X3PA 3OWFA 2WKCA 3S2HB 2IX1A 1SEBD 2K7VA 3HKZB 1EYAA 1BCPC 3TMEA 1JB3A 1D2BA 3DUZA 4Q5VA 1I50B 2EVBA 1SMYC 3I4LA 3NTHA 4A3DB 2Q8TA 3GTJB 2FJ2A 1HQMC 1GHKA 3LWUA 1EZ8A 1QB5D 3SE0A 1JOKA 1S5DD 4YIJA 5T1IA 3NTKA 2EY5A 4RKBA 3A55A 2PZUA 3ND8A 3K0YA 1U4MA 1C4QA 3RD4A 2B8FA 5I6YA 1O7ZA 3P7JA 1EFID 3DMUA 3R3OA 4OO1H 1DOKA 1EY6A 4N9TA 2XWBB 3D3RA 4BY1B 2NB0A 4FF3A 1EEID 1M4VA 1Q3LA 2A6EC 1Z47A 2B2YC 1CT1D 3R8BA 2SEBD 2JA8B 1ENCA 1K83B 2ID0A 5D65A 2NVTB 1B2TA 4C56C 2L12A 2A69C 2TSSA 5C6AA 5IIFA 1HTLD 2PQEA 3TBIB 4G7ZC 2JA7B 5CORA 3W2DA 1CHQD 3SK8A 2L0CA 1RF2D 4RH6A 5E3FA 4CJ1B 3MFYA 2BOSA 2B2TA 5KYLA 5I2YA 2LMCB 1K8MA 2LY7A 1ZYRC 4G7OC 5KGUA 2XWJB 1KTKA 4XIGS 1HA5A 3J80E 3CRKC 1JWSD 3C1FA 1TS3A 1TWGB 2E2HB 1GUOA 1JCKB 3K57A 2BE5C 2IJ0A 3S16B 2QCPX 3SK4A 2QF7A 5C5LA 3OSOA 4U673 2FHTA 3NQIA 3MC0B 2EYJA 2KOLA 3BVZA 1TR5A 3MFGA 3FPUB 3L3OC 5NUCA 2QILA 2Q8IB 2R7ZB 3PUZA 4X3UA 3TP5A 5K36H 1SFOB 2DNCA 3S15B 3KUPA 1BDOA 3M3YB 4G57A 3MAQA 2XRQD 3DHQA 3O13A 1D5XC 2F0MA 2F0TA 4R9WA 3D4WA 5HURA 2R61A 1BBXC 2J7ZA 4XYOA 1BNZA 2NZ1D 3URYA 1QCBD 3S1NB 2RQXA 3I4MB 4LAAA 1EWCA 2K6AA 1I3QB 2YYZA 1U4RA 1Q12A 4ZUJA 4CGYB 5I6WA 1JE4A 2D9UA 1ET6A 3C3LA 3TP6A 2SNMA 1EL0A 2WINB 3SVMA 4L63B 1ZKOA 1H9MA 1EYCA 2PO4A 1H9JA 3HS0C 1EQVA 5ELEA 2K32A 2F0FA 5IGEA 4OIJA 2IWHA 2O5IC 5COYA 3SK6A 1L0YB 1TY0A 2E76C 4OGQC 4O42A 2KECA 3OWEB 1FNWA 5TSSA 4P2CB 3NK9A 4A3MB 1I4XA 1B50A 1WTWA 1HTPA 1EYDA 5LHY1 5FO9B 4A93B 1FYCA 3NQTA 5KEEA 4UDUC 1LO5D 2B2UC 3QOJA 2F0EA 4DGZA 4CKBA 3D8GA 5JVH3 5KNCA 5FLXE 2J0TD 1A2UA 3BYYB 3H0GB 2A6HD 2RDGA 4KTAA 3GTLB 1H9KA 5BN3A 1ICWA 3UI2A 2HDMA 1WD1A 4NDXA 1DONA 4F7XA 5CV6A 2E75C 2XIWA 1IKMA 2EYLA 3JAME 4KJNA 2M00A 4E6IA 5FO7B 1SDFA 4J1MA 4ODGA 5IODA 3A7AB 4A3IB 3WDNA 2F0HA 2IT1A 1PRTF 4R8NA 3HGBA 2EOTA 5EPJA 1HUNA 1VMCA 5C4HA 3NWTA 1STAA 1BUVT 1II3A 4XT3B 2D5DA 1WD0A 3ERQA 1OXSC 3L9AX 3MXGA 2IPKD 2A74C 3TP7A 3S17B 2JA6B 1IYUA 3GP7A 4GZYC 3U9OA 4C3HB 4Y7NB 5FK9C 2MHVA 1B3AA 5C0XJ 1ZXTA 4CHTB 1TWFB 1VCIA 2VB3X 3K7AB 4BBSB 3MXPA 4FF2A 4IUNA 4WORA 4DNTB 4PV1C 5JEAG 2HCCA 1AZPA 1DXMA 2IX3A 2WB1B 3BS1A 1KDCA 4IUVA 2WAQB 1FR3A 2EZVA 4A3BB 4NW2A 1YNND 3QWNA 1GUNA 1UEAB 4J6HA 4C3IG 2CW0C 3IFDA 3FRPB 3HOYB 1G6ZA 2KJXA 1BR9A 2PW7A 4KKSA 3L7ZC 4I7ZC 1CA6A 1HFGA 3HOWB 1T5XD 1QILA 1LT3D 1F2ZA 3SR1A 3VR3A 3I8ZA 1E0BA 4CJ0B 2ICEC 3MZ5A 1SNOA 1CA5A 2PW5A 3K5LA 3VYSA 1WTVA 2WKDA 4H7BA 4CKEA 1PRTD 4F87A 2FMMA 5C5MA 4C3IB 2BCOA 2SNSA 2B2YA 3J7AF 4J8QA 1TS4A 3A8JE 2WV6D 5IT9E 4I65A 3NBIA 2CQAA 3D6CA 3VA5A 1ML0D 4OL7A 5M9OA 3OIPA 1HUMA 4X3TA 5CC4A 2HUGA 2AWNA 2BDNA 2PYKA 2F0OA 3OHXC 1STHA 1GOZA 4QMGA 1LT6D 5JEAH 5JVG3 1DOMA 5EPLA 2A73B 4B9XA 4AYBB 4LK1C 4EQNA 2OEOA 2AUKA 3P20A 5CGKA 5LL6S 2ZT9C 2F0UA 4V0BA 4K5WA 3CKIB 2LFNA 2KEEA 3MXUA 4IN3A 4FVMA 3K59A 1STYA 3T51B 3DEOA 4ZUIA 2WACA 1IKLA 4KN7C 4RGTA 2EE1A 1BCPF 1SBBB 1CQVA 1F2LA 1QWYA 4FP5D 1PTOH 2IX0A 2CHBD 1CK1A 4X3KA 4TKOB 5CV8A 1BO0A 1IHZA 2NN6I 4ABNA 1YNJD 2M9VA 1AP0A 4Z9CB 1JQYD 3KBXA 1WTOA 3RZDB 1EEFD 4PNYA 1LLRD 5EKIA 3QO2A 1IYVA 3AB9A 4RGNA 4DA2A 4DXFA 4ZKCB 3HOXB 2AWOA 4G4KA 1ENFA 5DAUA 5M5XB 1I4GA 4N9PA 1STNA 2OF1A 4ZLTF 3KLRA 1E2VA 1UUPA 1RTOA 4U68A 1AEXA 2BDOA 2E74C 4DU9A 2MJ8A 4RA8A 2TMPA 4DN4M 2Q8RE 4IUUA 4F8MA 1JOQA 3BDCA 1SNPA 3X3MA 5CMDA 4PMBA 1V8QA 2MP1A 3D31A 1XXGA 4KMUC 2HCIA 1DZ1A 3RUZA 2F0SA 1X3QA 1PYWD 1H9SB 1TS5A 1TQOA 3S1RB 2JSOA 4NKLA 3ZYYX 1SYFA 4C2MB 2A68C 5IGBA 1G2TA 2PNRC 5JOBA 1QOHA 2RSNA 1TVXA 1V1PB 1QNUA 4HEDA 5LL6X 3PO2B 5K36G 1IW7D 3NXWA 1G91A 2JXMB 1PDQA 4CKCA 3H94A 3EA6A 5EQ0A 3VR5A 2SDFA 3QB3A 2B2UA 2Y0SB 2F0DA 3HRZC 3G6JB 2F4IA 1BCPD 2AQ1B 1STBA 3P1HA 4RGMA 2IW3A 4DFAA 5M3MB 4M1UB 4MIUA 1I4HA 4FO2A 3GO5A 4KI0A 1WVLA 1FNVA 3NTIA 1SJED 1Z7TA 5EBDA 5CYUA 2NBFA 1Q1EA 3D4DA 1NUCA 5DM63 4R8IA 5BN4A 2H4OA 1S5ED 1LTID 4DF7A 4XYQA 3K5NA 2BA0A 2SOBA 3PMFA 5CV7A 4FYDA 1TWAB 3ND9A 1RD9D 1O78A 2KQ3A 3A8IE 4RGOS 1U9RA 5ELBA 5KRUA 1HA6A 4KD3A 3S2DB 2L1BA 5A2QL 5CV9A 1EIHA 5BN5A 1HRJA 2NN6H 5JPNC 1WTQA 1Y1WB 1QE6A 3MVVA 1SYEA 1G8ZD 3PUVA 1D1IA 2G9DA 4L6TB 1KLGD 3GV3A 1V43A 4C3JG 2A6ED 1LABA 1NR4A 4DAPA 2AUJD 3Q24A 4QB4A 1A3UA 3K6OA 4ILWA 3NWSA 2ENBA 1NR2A 2EJMA 2EYFA 2KCCA 4O1NA 1FNUA 2H1EA 2XSCA 3Q23A 3TZDA 5C4XB 4IFDI 1SNCA 2A69D 4CBVA 3CRLC 4DK1A 3S1QB 3MEHA 1R4PB 1U4LA 2L5TA 1QG7A 1RCVD 4CJ2C 1J9OA 1MGSA 4FF1A 4K5XA 4DAVA 2EYHA 4IZ8A 4BWGB 1TU2B 4Q0FA 1PZKD 5K5PA 2BE5D 3NHHA 1GUTA 2NVYB 4C1NK 1KNAA 3AU7A 3T13A 2EY2A 1SNMA 2ZXRA 3PV0A 2B2VC 2NYZD 3NBHA 1V1OA 4S3SA 1LT5D 2R3ZA 2R93B 4MHEA 3VR6A 4XXEA 4IFDJ 4L8JA 1VDZA 5D3IB 2V4DA 5EBCA 2E2JB 1OO9B 1HHVA 2F3VA 1NSNS 1OXUA 1ESFA 3DM1A 2OXPA 4HAEA 3FMCA 1UNSA 2AQ3B 4KY5A 1Q90A 1JC7A 2PMZB 4EGVA 2QEJC 2NVQB 3KLSX 5I9PA 3PIP3 3LNNA 3EJIA 2MGSA 5C0XI 3OMGA 3HG9A 2WP8J 5CV5A 4EQPA 1JOOA 4HSVA 3EFXD 5J1ZA 3J81L 2C5CA 1SYCA 5EKLA 3VYUA 5KYIA 4XQNA 1HQRD 2HDLA 1VF5C 2KCNA 5D3DA 1F77A 3HZXA 2RSOA 5ELFA 3TP8A 2K1BA 5I9OA 1FGBD 1SE3A 1ENAA 3BG3A 5FOBB 3OW7A 1F2MA 3QOLA 4KJOA 4H13C 4QF4A 4RHRA 3K5OA 3V96A 3I3CA 2X69A 1W6JA 4IFDH 1GUSA 3H6MA 4KV6A 4NP5A 4FXKC 2EY6A 4RCNA 2I46A 1YNNC 2LKVA 5C0XG 1C8CA 2KHSA 2Z4HA 4MN3A 4XQQA 3GD7A 4LMQD 1LV9A 1PRTB 1XX8A 3GTMB 4ZAIA 2EYOA 1LT4D 2F1MA 1E2ZA 5KIXA 2NWGA 1GUWA 4H44C 4OIKA 1FD7D 3T4AC 4K5VA 2O5JC 3K58A 2K5DA 2L9HA 3HOZB 1A2TA 1EY9A 1OXXK 3M85A 4ME5A 3K5MA 1HXYD 3VYRA 3I72A 4JK1C 1PRTC 1A3TA 2NTTA 4KHVA 4QUFA 3S14B 3QJYA 2VUMB 4RFBA 4K8JA 4ID6A 1S5CD 4DK0A 3A56A 1S5BD 5C44B 3R93A 5HGTA 1TWHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EQO A;  5C5M A;  2F0F A;  5KGU A;  3ERQ A;  5IGE A;  1SND A;  2F0I A;  4K5X A;  2HQE A;  2SNS A;  3T16 A;  1JOR A;  2EYH A;  3D4D A;  2F0P A;  4IZ8 A;  1NUC A;  3SXH A;  5ISR A;  3HZX A;  3NUC A;  5CR3 A;  3SK6 A;  3TP7 A;  5DAU A;  3TP8 A;  5I9O A;  4N9P A;  1STN A;  3U9O A;  4K8I A;  4I65 A;  1ENA A;  3MHB A;  5K5P A;  3NHH A;  4DF7 A;  1F2M A;  2OF1 A;  3C1F A;  3D6C A;  4HMI A;  1EZ8 A;  2PZW A;  3VA5 A;  5IGF A;  4ZQ3 A;  5J39 A;  4OL7 A;  1TT2 A;  2SOB A;  1JOK A;  3PMF A;  1STG A;  3QOL A;  4KD4 A;  1AEX A;  2PZT A;  2RBM A;  4KJO A;  4QF4 A;  4RKL A;  5CV7 A;  4YIJ A;  3SK5 A;  4DU9 A;  5CC4 A;  2RDF A;  2F0G A;  3HEJ A;  3T13 A;  2EY5 A;  2EY2 A;  4RKB A;  1SNM A;  3NK9 A;  4PMC A;  2PYK A;  2PZU A;  3NP8 A;  2KQ3 A;  2O4X A;  3H6M A;  3OSO A;  4IAL A;  2F0O A;  1STH A;  1U9R A;  1EY7 A;  2EYJ A;  3MXP A;  4KV6 A;  4B9W A;  3OMC A;  4NP5 A;  4HTH A;  4QMG A;  2F0W A;  5C3X A;  1EY8 A;  4F8M A;  5I6Y A;  5KRU A;  1TR5 A;  1EYD A;  4IUN A;  2NUC A;  4WOR A;  1JOQ A;  4KD3 A;  1SYB A;  3BDC A;  2EY6 A;  4HMJ A;  1SNP A;  4S3S A;  5EKK A;  3EVQ A;  5NUC A;  2F0V A;  4WRD A;  2LKV A;  2EY1 A;  3NQT A;  5KEE A;  5CV9 A;  4B9X A;  2KHS A;  2EXZ A;  4PMB A;  3TP5 A;  2QDB A;  5IGC A;  3DMU A;  3QOJ A;  4EQN A;  2OEO A;  2F0E A;  1SYE A;  3MVV A;  3R3O A;  4K2K A;  3D8G A;  4DGZ A;  1KAB A;  2F0L A;  1EY6 A;  3ERO A;  2F3W A;  1A2U A;  4N9T A;  5CGK A;  5C3W A;  1KDA A;  1SYG A;  5CV4 A;  2EYO A;  3RUZ A;  2F0S A;  4G57 A;  3ITP A;  5EGT A;  3DHQ A;  1KDC A;  3SK4 A;  4KTA A;  2F3V A;  5KIX A;  1NSN S;  5C5L A;  1TQO A;  4TRD A;  2F0N A;  2F0Q A;  4K14 A;  2F0U A;  3SHL A;  1F2Y A;  2F0M A;  2RKS A;  4K5W A;  4NKL A;  4QB4 A;  2F0T A;  1SYF A;  1A3U A;  2OXP A;  4NDX A;  4K5V A;  2F0K A;  3D4W A;  2ENB A;  4F7X A;  2EYF A;  5CV6 A;  5HUR A;  1STY A;  4J6H A;  4K2L A;  5IGB A;  5DEH A;  4KY5 A;  1A3V A;  1EY5 A;  2EYL A;  1EY4 A;  4ZUI A;  2WAC A;  2F0J A;  1EZ6 A;  5JOB A;  1EY9 A;  1A2T A;  1ENC A;  1RKN A;  1KAA A;  2EYM A;  4KJN A;  2M00 A;  4E6I A;  4KY6 A;  2EYP A;  4ME5 A;  5I9P A;  3P75 A;  1SNC A;  4KY7 A;  5E1F A;  3V2T A;  1KDB A;  2PW7 A;  4LAA A;  1SNQ A;  4J1M A;  4ODG A;  3EJI A;  3LX0 A;  5IOD A;  3NXW A;  3MEH A;  4ZUJ A;  5IGD A;  1A3T A;  3OMG A;  5C6A A;  2F0H A;  3BDL A;  4KHV A;  5I6W A;  1F2Z A;  5M9O A;  3OWF A;  5CV5 A;  5IIF A;  4EQP A;  1JOO A;  4R8N A;  2PQE A;  5CV8 A;  5F2D A;  3S9W A;  3QB3 A;  4K6D A;  5IOC A;  5J1Z A;  1IHZ A;  2F0D A;  3SR1 A;  3TP6 A;  4EVO A;  2SNM A;  4K8J A;  3C1E A;  3SK8 A;  1STB A;  1EY0 A;  1SYC A;  1SYD A;  3E5S A;  3MZ5 A;  3P1H A;  4ID6 A;  4DFA A;  5IGG A;  1EYA A;  1SNO A;  4PNY A;  2PW5 A;  1EYC A;  4MIU A;  5EKL A;  5JAV A;  5C4H A;  1EQV A;  1STA A;  4NMZ A;  5E3F A;  5HGT A;  5J22 A;  5KYL A;  3TME A;  4H7B A;  5C4Z A;  5KYI A;  1II3 A; 
#chains in the Genus database with same CATH topology
 2FFK B;  4EQO A;  1VQ5 A;  2UXC Q;  1HPC A;  3DWA A;  3CMA A;  3S1M H;  4C1N I;  4HCE A;  1GXD C;  2IHF A;  2Z6K C;  1C48 A;  3BDO A;  2E2I H;  3EQL C;  1CQF A;  1AZQ A;  3MHB A;  2J4X A;  3I55 A;  1D7Q A;  1H9R A;  1TT2 A;  2JEB I;  4KD4 A;  5CV4 A;  2ICI A;  2PZT A;  1WI5 A;  4B08 A;  2RDF A;  2F0G A;  1VQI A;  3HEJ A;  2WII B;  3W1G A;  3T53 B;  2RHS B;  3KK7 A;  1CFM A;  1TWC B;  1H9S A;  2GVA A;  1EY7 A;  3EN2 A;  4PMW A;  4PQX A;  3OMC A;  4HTH A;  5C0X H;  4A3J H;  3I4N G;  4DR4 Q;  4CDC C;  3KF8 B;  1SYB A;  3G7L A;  4KKT A;  1YEZ A;  3M4O B;  3FPP A;  4RWS C;  2VQF Q;  1LUZ A;  4DNR B;  3GTQ B;  3CP0 A;  4A3F G;  5IGC A;  4JOI C;  5GAG C;  1PV4 A;  1BBU A;  2B3G A;  3FDT A;  1KAB A;  2F0L A;  2F3W A;  1PTO B;  4TQU S;  1RDP D;  1V1P A;  1LTS D;  1K3R A;  4ULL A;  3G6E A;  4GOP B;  4DR5 Q;  5JJI A;  1HFN A;  3F8T A;  2LSS A;  5DLQ E;  1VQA A;  1JR0 D;  3J7A V;  1VQC A;  4UHV A;  1F9P A;  3PO3 H;  5CBA E;  2DJG C;  1C7Y A;  2K05 A;  3CC7 A;  4KK7 A;  4OX9 Q;  4A3G H;  4WJW A;  2BA1 A;  1XPR A;  1PHJ A;  1I6H B;  2GA4 B;  4IPG A;  1EY4 A;  2UU9 Q;  3GTG H;  1B9N A;  4YCV A;  3V05 A;  3GTO H;  1Q1B A;  2A1A A;  4PZ7 A;  5DM7 3;  3HOU G;  4JYA L;  4YHH L;  1O7Y A;  3GTK B;  3V2T A;  1KDB A;  1ILP A;  3TEH B;  4LNQ A;  1LTG D;  4DAM A;  4RHS A;  1Q82 C;  3N52 A;  1X32 A;  1PTO C;  5IYC H;  2HIX A;  1WTP A;  4BBR G;  4GOP C;  3S9W A;  1B53 A;  4B3T L;  4DR1 Q;  1LTA D;  1LTR D;  2F03 A;  5IGG A;  3E0E A;  3TZU A;  5ELD A;  1VQM A;  5D14 A;  1X3E A;  4IUR A;  1AE2 A;  2L11 A;  3MTS A;  4BS9 A;  5C4Z A;  4RG1 A;  1PFN A;  4J15 A;  3CC4 A;  3BYT B;  1CKO A;  3FVQ A;  1SND A;  2F0I A;  4KLK A;  2QDL A;  5M5W B;  3SXH A;  4DV2 Q;  3NUC A;  3HOU B;  4KKU A;  2KHJ A;  3KBG A;  2EXD A;  2PMZ E;  3CQZ B;  3FKI B;  3J7Y W;  1YBY A;  3D4R A;  4OXP A;  1BQQ T;  5M5Y B;  2PZW A;  2VNU D;  4RKL A;  1VQN A;  2B2W C;  2Z9H A;  4BBR B;  3U4Z A;  4V19 0;  2VXW A;  2MUY A;  4JVZ A;  3HKZ G;  1DCZ A;  3I4N H;  3E0J A;  5A35 A;  1EQQ A;  4HIK A;  4QUC A;  4A3F H;  1ASZ A;  1WCM B;  2CH4 A;  1G29 1;  3HKS A;  4QL5 A;  4NXM L;  4WRD A;  4IO9 A;  5T1G A;  3H3V H;  1W6K A;  4TSS A;  4L5T A;  1SMX A;  2R6G A;  4R4I A;  3G71 A;  1S72 A;  2YU9 H;  2C9O A;  3A5U A;  3E6Z X;  5EGT A;  3MA2 B;  4A3K B;  1SR3 A;  3SHL A;  1F2Y A;  2RKS A;  1JWM D;  1IW7 C;  1X55 A;  1EOT A;  2Q2H A;  3QR8 A;  1A15 A;  1WOC A;  4FXD A;  1JIC A;  2ZJR A;  1PXU A;  2EJG C;  1KAA A;  4HN7 A;  2EYP A;  4MNO A;  3PIO 3;  3W3A A;  2D2C C;  2B2V A;  4EQ5 A;  2NN6 G;  5C4J H;  3I70 A;  2I07 B;  5L37 A;  4BY1 G;  1PYS B;  4G7H C;  3GTP B;  1IBK L;  3ZJY C;  3ULL A;  3DWP A;  1LAC A;  3I4O A;  1B70 B;  2OTL A;  1B1Z A;  1YVC A;  4NMZ A;  4XDX A;  5E4X A;  4OHJ A;  3HP3 A;  1Y1V G;  2JA8 G;  1AN8 A;  4DV5 L;  3J80 i;  4POG A;  2EJF C;  3T16 A;  2JYO A;  3RLO A;  4ALP A;  2XRS D;  4LJZ C;  1L0X B;  5G3L F;  1XTD A;  2JA5 G;  4GLV B;  4L5S A;  2PCF B;  1SE2 A;  2B63 G;  3S2H H;  1E2W A;  4HMI A;  1E22 A;  4OON A;  4QIW E;  2F3I A;  5A2Q E;  2FMC A;  4A3E B;  5BR8 L;  3QIA A;  1SMY D;  4IAL A;  1NMF A;  4DAY A;  3HOV G;  2K04 A;  1BBW A;  1I50 H;  2UUC Q;  3SDZ A;  1SJH D;  4ZKB B;  1NCV A;  4GN4 B;  1UWV A;  1Y1V B;  4A3D H;  4FXG C;  1K8A C;  3GTJ H;  3IKJ A;  1Z6H A;  1Y8O B;  1MBY A;  5FKA C;  4B3S Q;  1O80 A;  3ERO A;  2Z6B A;  4RCO A;  2JA5 B;  4POF A;  5EPK A;  4HJA A;  2B63 B;  4GLA C;  1EOV A;  2M2L A;  3UDF A;  1T5E A;  3MXN A;  3NEM A;  5CBE E;  1XWE A;  2A68 D;  3VR4 A;  4BA2 I;  2F0K A;  1HJP A;  3CAM A;  3AYH B;  3M4Y A;  4JI0 Q;  5JJZ A;  4UP8 A;  3MWY W;  1STE A;  3HOV B;  1GHJ A;  1SAP A;  1PH8 A;  3T56 B;  2IL8 A;  5ELC A;  2E8G A;  2PI2 E;  1NMG A;  3P75 A;  4KY7 A;  4WFN 3;  4HJ5 A;  4JV5 L;  4KN4 C;  4JI8 Q;  3F2C A;  3R2I A;  2HQL A;  2OT2 A;  2JP1 A;  2Z8L A;  3J81 c;  5IGD A;  4BY1 H;  4X65 L;  1G6P A;  4A3L H;  4K6L A;  1D1K A;  1JE5 A;  4JI6 L;  4K6D A;  1I4Q A;  4JYA Q;  3J81 i;  3NE5 B;  1K28 A;  3C1E A;  4YHH Q;  1SYD A;  1D6E C;  3Q22 A;  1PZJ D;  2JA8 H;  1P16 A;  1WTR A;  1ZEQ X;  4JI4 L;  1XNQ Q;  4XTC S;  3KLS A;  1R9T B;  1K83 H;  1Y8P B;  3U9S A;  4BY7 G;  5IP9 H;  4PZ8 A;  1X3F A;  3CW2 C;  1MD2 D;  3A8K E;  3DM3 A;  3PUW A;  2XNA C;  4X64 L;  4B3T Q;  4IUT A;  2NVT H;  2K75 A;  4ZYS A;  2F0P A;  1EIG A;  1GUG A;  5CR3 A;  2LS0 1;  1QJO A;  2L15 A;  4L5R C;  1UE1 A;  3RLF A;  2CFM A;  2B39 A;  4C3J B;  2JA7 H;  4IUP A;  1QVF A;  1LTL A;  4B3R L;  2A5H A;  1WTH A;  3ONA B;  1ZYR D;  1S4Z A;  1BOS A;  5G3L D;  1IL8 A;  1VQP A;  1B9M A;  3FEW X;  3KF6 A;  3VR2 A;  4OWT B;  3J80 L;  1UEB A;  4O2D A;  1BF4 A;  1CZG A;  3D0F A;  4JI3 L;  4HMJ A;  3EVQ A;  4BY7 B;  1DGS A;  3TN2 A;  5C3E B;  4M8A A;  1Y69 U;  1PH9 A;  2Q2U A;  3IAY A;  4K2K A;  3T1Y L;  1VF7 A;  3RZO B;  4BA1 I;  3IFT A;  5FO8 B;  3OOC A;  1TWG H;  5C3W A;  2E2H H;  2Q2I A;  3OIQ A;  2UXD L;  4DPG A;  3S16 H;  2Z6K A;  2XN9 C;  5M3F B;  2F0N A;  4NXM Q;  2DY7 A;  1LTB D;  4K14 A;  4IFD G;  2A6H C;  1QNK A;  5EAY A;  1NY4 A;  5KNB A;  3Q6S A;  5DEH A;  1DM0 B;  1A3V A;  1EY5 A;  1PMR A;  1N9W A;  1X56 A;  4DV1 L;  1PH3 A;  2R7Z H;  1ILQ A;  4LFA L;  3J81 E;  4OEM B;  2JE6 I;  1PFB A;  5E1F A;  1UAP A;  4HJ8 A;  1SFO H;  1PZI D;  4IJL A;  4A93 G;  3S15 H;  3E9I A;  1VQ9 A;  1DJR D;  3M3Y H;  2RA4 A;  2AQ2 B;  5IOC A;  1Y8N B;  4HSP A;  3UE1 A;  2NTS A;  5GRO A;  2XVS A;  3E5S A;  2L4N A;  1I4R A;  1K8O A;  5JAV A;  2KUM A;  1CHP D;  3T1H L;  1FJG L;  3WOE A;  3S1N H;  1HNZ L;  4GKK L;  2JJQ A;  3W1B A;  2PI2 A;  3I4M H;  1TS2 A;  1B4O A;  2R92 B;  1SRU A;  2HQE A;  1JOR A;  1I3Q H;  2RDH A;  5ISR A;  4ZK9 B;  1U4P A;  1IBK Q;  1R4Q B;  1DD2 A;  3KF8 A;  2N8N A;  1Q8I A;  5I2X A;  2DN8 A;  3C46 A;  5GQO A;  2XGT A;  1CKN B;  3DEP A;  3Q8D A;  4A3I G;  4YY3 L;  3G48 A;  2H5X A;  1KLU D;  2F52 A;  2V1C C;  4DV5 Q;  2RBM A;  2DNE A;  2NZH A;  4LWC A;  1A6X A;  1ONL A;  4PMC A;  1VQD A;  3NP8 A;  2KEN A;  3VA7 A;  1HNW L;  4GOP A;  5KND A;  1KRT A;  3IRB A;  1GD7 A;  5C3X A;  1DOL A;  4B9W A;  5IGF A;  4LF6 L;  1EY8 A;  4HCS A;  1SSO A;  2K52 A;  5EKK A;  1XYI A;  1EU3 A;  4LUZ A;  3BVM A;  1J6Q A;  3OPO A;  2EXZ A;  1EUJ A;  2N88 A;  4DR3 L;  5BR8 Q;  4DUY L;  1NAP A;  1RHP A;  4ZRZ A;  3N6R A;  3C2P A;  4H0L C;  1VQK A;  1CSQ A;  1SYG A;  1I6V C;  2K33 A;  1GVP A;  4C3H G;  1E1T A;  3CCE A;  1MI2 A;  3A7L A;  2B2T C;  3M9B A;  1ESR A;  3IL8 A;  4A3M H;  2PPB C;  2F0Q A;  1IYJ B;  1DYQ A;  5DNF A;  3TDQ A;  4JC0 A;  3GQB A;  3CCL A;  1M90 C;  3SGI A;  3CPF A;  4KHP L;  5FLX L;  4IPD A;  2B2W A;  4UP7 A;  4BBS G;  2D0O A;  4A93 H;  2F0J A;  1EZ6 A;  5GAH C;  1RKN A;  3Q0A A;  2JEA I;  3AMU A;  1IZ6 A;  1G2S A;  1VQE A;  5E4W C;  3S1M B;  4XT1 B;  1XPU A;  3H0G H;  1BKB A;  2N49 A;  2K28 A;  5I4D A;  2ASB A;  1I4P A;  1K3B C;  3GTL H;  2E2I B;  3D6W A;  4HR7 B;  5F2D A;  3JAM L;  3F2U A;  1EFW A;  1PFS A;  1GJX A;  3PUY A;  1EY0 A;  1MSH A;  2WAQ G;  1D5Z C;  1CTM A;  4JBW A;  4A3B G;  3WOF A;  1TY2 A;  1I94 L;  4JV5 Q;  3DXJ C;  1PFM A;  1RJT A;  3DWQ A;  2JQO A;  1XPO A;  4DV3 L;  1S40 A;  3R2T A;  1O7L A;  2Z4I A;  4JBJ A;  3PUX A;  4QIW B;  1E7Z A;  3HOY G;  1ROD A;  4JI6 Q;  4A3J B;  1EIF A;  2O2L D;  1A8V A;  3A54 A;  4NB3 A;  3I73 A;  4A3I H;  2K5H A;  1VMP A;  1B44 D;  2D62 A;  4GN3 B;  4P72 A;  3LWE A;  3RLN A;  3PGZ A;  3HOW G;  4K8I A;  2K01 A;  4JI4 Q;  2UUB L;  2DGY A;  4AH6 A;  3GV6 A;  4GN5 A;  5JPM C;  3SEB A;  4X64 Q;  4A76 A;  2EPB A;  3M4Q A;  5JEA J;  2XTI A;  4KHZ A;  1ET9 A;  1PA6 A;  3H91 A;  3PO3 B;  1HH2 P;  4A3G B;  3CHB D;  1OXV A;  1XTC D;  1KAW A;  1F9Q A;  1YJN A;  1VQF A;  2B8G A;  3S17 H;  2EY1 A;  2JA6 H;  3GTG B;  3GTO B;  2KVM A;  1J8I A;  4QCL A;  1JB7 A;  1F9R A;  1M8A A;  4LFB Q;  2CVR A;  4C3H H;  1TKW B;  3PQI A;  1X65 A;  1KQS A;  4Y7N H;  1KDA A;  3CXC A;  1CI3 M;  4JI3 Q;  3ITP A;  4DNI A;  1S5F D;  1Q8K A;  1SLJ A;  2MPM A;  1TWF H;  1OXT A;  3M7G A;  3K7A H;  1PTO F;  1CZW A;  4BBS H;  2Z1C A;  4XQJ A;  2AHO B;  3CC2 A;  1BXT A;  3T1Y Q;  1N36 Q;  3TQY A;  2K5N A;  2NVX B;  4RAU C;  4FF4 A;  2KED A;  2EYM A;  2ZXP A;  2ZM6 L;  2UXD Q;  1EQR A;  2KA7 A;  2L55 A;  1SNQ A;  4AYB G;  1LTT D;  1AE3 A;  1AFP A;  3VYT A;  2OQK A;  2K03 A;  1YNX A;  1D5M C;  2CW0 D;  3I90 A;  1N8R C;  4A3B H;  3ULJ A;  4DV1 Q;  2G9H D;  4EVO A;  4DV6 Q;  4LFA Q;  2OQ0 A;  4F88 A;  2ZXO A;  1VQ4 A;  4OO1 I;  1PLF A;  3B6Y A;  4X3S A;  1AW7 A;  1YNJ C;  2CWA A;  1EWH A;  3HOY H;  3I4N B;  5J22 A;  3CU7 A;  4LF4 L;  1F9S A;  3RMH A;  1KNE A;  4TVA B;  3NPP A;  3RN2 A;  1VQ6 A;  3WWV A;  4A3F B;  3H09 A;  3HOW H;  1Y14 B;  2X6L A;  1WJJ A;  1EIY B;  3T1H Q;  4ZCK A;  2YU9 B;  3STB D;  2QKI C;  4ZQ3 A;  5J39 A;  1HNZ Q;  4GKK Q;  2N55 A;  2DJF C;  1STG A;  1EQT A;  1PH2 A;  2NVX H;  1LM0 A;  3SK5 A;  2MO0 A;  1X9N A;  1KL9 A;  2E2D C;  4UAI A;  2VZA A;  3TSS A;  2O4X A;  3ER0 A;  3UDG A;  1EU4 A;  5IT9 L;  4C3I H;  2F0W A;  1WYD A;  4YY3 Q;  2NUC A;  4QQB X;  4DV7 L;  2DY8 A;  2F0V A;  3KOJ A;  4IUQ A;  3M7N A;  2QDB A;  4FDB A;  3BJU A;  2RVL A;  3H3V C;  1HNW Q;  2QW7 A;  1CM9 A;  1JWU D;  2MNA A;  5C4J B;  4LF6 Q;  3X3N A;  4OO1 G;  1WFQ A;  4IQZ A;  3NSW A;  3BVG A;  5AFW A;  4I7A A;  4TRD A;  4LF5 L;  3QG1 A;  4DR3 Q;  5E7N A;  3BZD B;  2K5Q A;  3TRE A;  1RTN A;  1BCP B;  4K2L A;  2EDG A;  4FNF A;  4B3M L;  2FIN B;  2K5W A;  1K9M C;  1SXT A;  5IE8 A;  1HCZ A;  4KY6 A;  4A3D G;  3I91 A;  2JA9 A;  5EJW A;  1PTO D;  4UY8 C;  2VB2 X;  1MSG A;  3LX0 A;  4DXG A;  1WTX A;  1SE4 A;  3BDL A;  2X6G A;  2RHQ B;  1TII D;  1X3P A;  3OWF A;  2WKC A;  4JI2 Q;  2HHH L;  3S2H B;  4YWK A;  2IX1 A;  1SEB D;  2K7V A;  3HKZ B;  4IPC A;  3UDI A;  1FVI A;  1EYA A;  5ELN A;  1BCP C;  3TME A;  1JB3 A;  1D2B A;  3DUZ A;  2R7D A;  4Q5V A;  1I50 B;  1S3O A;  2EVB A;  1K8G A;  1SMY C;  4PZ6 A;  3I4L A;  3NTH A;  4A3D B;  2Q8T A;  3GTJ B;  1I94 Q;  3PO2 G;  2FJ2 A;  1HQM C;  1GHK A;  2VY3 A;  4A3L G;  3LWU A;  1EZ8 A;  1QB5 D;  3SE0 A;  3J80 c;  3U4V A;  1JOK A;  1S5D D;  3FP9 A;  4R4O A;  4YIJ A;  4DUZ L;  3RZD H;  2Y0S G;  5T1I A;  3NTK A;  2EY5 A;  4RKB A;  5AJ3 L;  3A55 A;  2PZU A;  5M3M G;  3ND8 A;  3K0Y A;  1TXY A;  1U4M A;  4O0A A;  1C4Q A;  3RD4 A;  2B8F A;  5I6Y A;  5IP9 G;  1L2F A;  2UUB Q;  4YWL A;  1O7Z A;  3HOX H;  3P7J A;  5M5X H;  1EFI D;  2LXJ A;  3DMU A;  3R3O A;  4OO1 H;  3MEF A;  1DOK A;  1EY6 A;  4N9T A;  3UDX A;  2JA7 G;  2XWB B;  3D3R A;  4BY1 B;  2NB0 A;  1Q7Y C;  4FF3 A;  1EEI D;  1M4V A;  1Q3L A;  3ICE A;  2A6E C;  4MZ9 A;  1IBL L;  1Z47 A;  2B2Y C;  1CT1 D;  3R8B A;  2SEB D;  2JA8 B;  1Z9F A;  1ENC A;  3VDY A;  4WJ3 M;  1K83 B;  2ZJQ A;  2ID0 A;  3KJP A;  5D65 A;  3CCJ A;  2ZTC A;  4GNX B;  2NVT B;  1B2T A;  2K5V A;  4C56 C;  3CCQ A;  1Y1W G;  2L12 A;  2A69 C;  2TSS A;  5C6A A;  1JJG A;  5IIF A;  1HTL D;  2PQE A;  3TBI B;  3S1R H;  4G7Z C;  2JA7 B;  1H95 A;  5COR A;  3W2D A;  2ZM6 Q;  1D8L A;  1CHQ D;  1NBW A;  3SK8 A;  1CKN A;  4C2M H;  1A63 A;  2L0C A;  1RF2 D;  4RH6 A;  5GAD C;  4K0K L;  5IWA L;  1V1Q A;  5E3F A;  4CJ1 B;  3MFY A;  2BOS A;  2B2T A;  5KYL A;  5I2Y A;  2LMC B;  1K8M A;  2LY7 A;  1PH7 A;  1ZYR C;  2R7Z G;  4G7O C;  5KGU A;  2VL6 A;  2XWJ B;  3BU2 A;  2GVB A;  2E5L L;  1KTK A;  3PO2 H;  4XIG S;  4GNX C;  1HA5 A;  3J80 E;  1MKH A;  3CF5 A;  4IOC A;  3KDF B;  3W5O A;  3CRK C;  2UUA L;  1JWS D;  3J7A 5;  3C1F A;  1TS3 A;  1TWG B;  2E2H B;  1GUO A;  1JCK B;  5M3M H;  3K57 A;  4OWW B;  2BE5 C;  2IJ0 A;  3S16 B;  2QCP X;  3SK4 A;  2QF7 A;  5C5L A;  4DK3 C;  3OSO A;  4U67 3;  2FHT A;  3NQI A;  4JPB W;  4R4Q A;  3MC0 B;  2EYJ A;  2KOL A;  3BVZ A;  1TR5 A;  1MJE A;  3I4M G;  3MFG A;  3FPU B;  3L3O C;  5NUC A;  2QIL A;  2Q8I B;  2R7Z B;  3PUZ A;  4X3U A;  2YV5 A;  3TP5 A;  4LF8 L;  5JJK A;  5K36 H;  1SFO B;  4JI1 L;  2DNC A;  3S15 B;  4P75 A;  3KUP A;  1BDO A;  1HNX L;  3M3Y B;  4G57 A;  3MAQ A;  2XRQ D;  1TWA H;  3DHQ A;  1KRS A;  1VQ8 A;  4DV7 Q;  5FLX c;  3O13 A;  1D5X C;  2F0M A;  2F0T A;  4R9W A;  3D4W A;  5HUR A;  2R61 A;  1BBX C;  2J7Z A;  4XYO A;  1BNZ A;  3S2D H;  1N33 L;  2A19 A;  2NZ1 D;  3URY A;  1QCB D;  3S1N B;  4DR2 L;  1Y1W H;  2RQX A;  3I4M B;  4LAA A;  4LF5 Q;  3CPW A;  1EWC A;  2K6A A;  1YIJ A;  3JAM c;  1I3Q B;  2YYZ A;  1U4R A;  1Q12 A;  1IXR A;  4ZUJ A;  5FJ8 H;  1PYB A;  2CWP A;  4CGY B;  5I6W A;  1JE4 A;  2D9U A;  4OEL B;  4QJF A;  4JI7 L;  1ET6 A;  4B3M Q;  3JAM i;  3C3L A;  3TP6 A;  3CCU A;  4A3M G;  1HR0 W;  2SNM A;  1EL0 A;  2VQE L;  2WIN B;  3SVM A;  2I5H A;  4L63 B;  1ZKO A;  1H9M A;  1EYC A;  1HR0 L;  4RMF A;  2PO4 A;  2Q2T A;  1H9J A;  3HS0 C;  1EQV A;  5ELE A;  5C4X H;  2K50 A;  1E1O A;  2K32 A;  3GDE A;  2F0F A;  4IJH A;  5IGE A;  4OIJ A;  2HHH Q;  1NE3 A;  2IWH A;  2O5I C;  5COY A;  3AFQ A;  3S1Q H;  2JN4 A;  3SK6 A;  1L0Y B;  3H0G G;  4JOI A;  1TY0 A;  4DKA C;  2E76 C;  3ERS X;  4OGQ C;  1ICF B;  4GKJ L;  4OX9 L;  4O42 A;  2KEC A;  3K8A A;  3I2Z A;  1FNW A;  3OWE B;  1XNR L;  5TSS A;  4P2C B;  3AEV A;  3PF5 A;  3CME A;  3NK9 A;  4A3M B;  1I4X A;  1B50 A;  5IYD G;  4WJ4 A;  1WTW A;  1HTP A;  1EYD A;  3HKZ E;  3L2P A;  5LHY 1;  5FO9 B;  4A93 B;  1FYC A;  3NQT A;  4IPH A;  5KEE A;  2QA4 A;  4DUZ Q;  4UDU C;  4PG3 A;  1LO5 D;  2B2U C;  3F1Z A;  3QOJ A;  2F0E A;  4DGZ A;  5AJ3 Q;  4CKB A;  3D8G A;  5JVH 3;  5KNC A;  5FLX E;  2NVY H;  2J0T D;  1YZ6 A;  1A2U A;  3BYY B;  4UPA A;  3H0G B;  2A6H D;  2RDG A;  4KTA A;  3GTL B;  1H9K A;  2P5Z X;  5BN3 A;  4BXX H;  1ICW A;  5HGQ A;  3UI2 A;  2HDM A;  1WD1 A;  4LUV A;  4NDX A;  1DON A;  4F7X A;  5CV6 A;  2E75 C;  5LMN W;  2XIW A;  1YHQ A;  1IKM A;  2EYL A;  3JAM E;  3G4S A;  4GLX A;  2R93 H;  5LMN L;  4KJN A;  2M00 A;  4E6I A;  2I0Q A;  5FO7 B;  1SDF A;  2JA6 G;  1JJ2 A;  4J1M A;  4ODG A;  2IHE A;  1VQJ A;  5IOD A;  4UP9 A;  3A7A B;  4A3I B;  2E2J H;  3WDN A;  1IBM L;  1IBL Q;  2F0H A;  4R4T A;  2IT1 A;  1PRT F;  4R8N A;  3HGB A;  3K7U C;  1QUQ B;  1YIT A;  1C0A A;  1AH9 A;  1JJC B;  2EOT A;  5EPJ A;  1HUN A;  1VMC A;  5C4H A;  3NWT A;  1STA A;  1BUV T;  5H1S E;  2NVQ H;  1II3 A;  4NPS A;  4XT3 B;  2D5D A;  1WD0 A;  4DV0 L;  3ERQ A;  1OXS C;  3HOZ G;  3L9A X;  2HT1 A;  3MXG A;  2IPK D;  2A74 C;  3TP7 A;  3S17 B;  2JA6 B;  1IYU A;  4K0K Q;  3GP7 A;  5IWA Q;  4GZY C;  2WB1 G;  3U9O A;  2PQA B;  4C3H B;  2FXQ A;  1Q46 A;  4Y7N B;  5FK9 C;  2VUM G;  5IT9 c;  2MHV A;  2E5L Q;  5IYD H;  1B3A A;  5C0X J;  1JMC A;  1XMO L;  1ZXT A;  4CHT B;  1QVC A;  1X6O A;  4DR7 L;  4X65 Q;  1TWF B;  4N8X 1;  1VCI A;  2VB3 X;  5C44 G;  3K7A B;  4BBS B;  3MXP A;  5IYB H;  4Y52 H;  4FF2 A;  4IUN A;  4WOR A;  4DNT B;  4IOA A;  4PV1 C;  5JEA G;  2HCC A;  2UXB L;  1AZP A;  5LMU L;  1DXM A;  3CCS A;  2IX3 A;  2HD3 A;  5GAE C;  4P73 A;  1GO3 E;  2WB1 B;  3BS1 A;  1KDC A;  2KCM A;  4IUV A;  2WAQ B;  2YTX A;  1FR3 A;  3K0X A;  2EZV A;  4A3B B;  4NW2 A;  2MO1 A;  1YNN D;  3QWN A;  1GUN A;  3NBH B;  1L1O B;  1UEA B;  4LF8 Q;  2ATW A;  4B3R Q;  4J6H A;  4C3I G;  2CW0 C;  2B29 A;  3IFD A;  3FRP B;  3HOY B;  1G6Z A;  1HNX Q;  2CKZ B;  4L5Q A;  2KJX A;  2MFI A;  1BR9 A;  1X54 A;  2PW7 A;  4KKS A;  4CDE C;  3L7Z C;  4I7Z C;  1CA6 A;  1HFG A;  4H02 A;  3GTM H;  3HOW B;  1B7Y B;  1T5X D;  4EX5 A;  1QIL A;  1LT3 D;  3L0O A;  1F2Z A;  2RCF A;  1FGU A;  5J3B A;  1OTC A;  1N33 Q;  3SR1 A;  3VR3 A;  3I8Z A;  2UUC L;  1E0B A;  4CJ0 B;  2ICE C;  4DR2 Q;  3MZ5 A;  4MTK A;  1HZC A;  1L1O C;  1SNO A;  1CA5 A;  2PW5 A;  3K5L A;  3VYS A;  1QZG A;  3HOZ H;  1WTV A;  2WKD A;  4X6A H;  4H7B A;  3STB C;  4B3S L;  5FLM H;  4CKE A;  1PRT D;  1M1K C;  4F87 A;  2FMM A;  1YJW A;  5C5M A;  4C3I B;  4JI7 Q;  2Z0S A;  2BCO A;  3PCO B;  2SNS A;  2B2Y A;  3K81 C;  3J7A F;  2VQE Q;  4J8Q A;  1TS4 A;  3A8J E;  2WV6 D;  1HZB A;  5IT9 E;  1HR0 Q;  2CQO A;  3S14 H;  2LXK A;  4I65 A;  3NBI A;  2VUM H;  2CQA A;  1CUK A;  2CH4 W;  3D6C A;  3VA5 A;  1ML0 D;  2F4V L;  4OL7 A;  5M9O A;  3OIP A;  4JI0 L;  1HUM A;  4X3T A;  5CC4 A;  5C44 H;  4DR6 L;  2HUG A;  3RN5 A;  4DK6 C;  5IY0 A;  1TWH H;  2AWN A;  2BDN A;  2PYK A;  1VQO A;  1SN8 A;  1SRO A;  2F0O A;  3OHX C;  1STH A;  4JI8 L;  1GOZ A;  1P8L A;  4QMG A;  1LT6 D;  5JEA H;  4GKJ Q;  5JVG 3;  1DOM A;  4CDF C;  5EPL A;  2A73 B;  4B9X A;  2A8V A;  4AYB B;  1XNR Q;  4LK1 C;  3RNU A;  4EQN A;  4YCW A;  2OEO A;  1FJG Q;  3LGJ A;  2AUK A;  3HFZ B;  3P20 A;  5CGK A;  5IP7 G;  3FKI G;  4GNX A;  1XNQ L;  5LL6 S;  2ZT9 C;  2F0U A;  4V0B A;  4K5W A;  3CKI B;  2LFN A;  1TWC H;  1N34 L;  2KEE A;  3MXU A;  4IN3 A;  4FVM A;  3K59 A;  1STY A;  2NZO A;  3T51 B;  3DEO A;  4ZUI A;  3M4O H;  2OCE A;  2WAC A;  3GTQ H;  1IKL A;  4KN7 C;  3CCR A;  1WCM G;  4RGT A;  2EE1 A;  3HOX G;  1BCP F;  1SBB B;  1XMQ L;  1CQV A;  2QEX A;  1F2L A;  1QWY A;  4FP5 D;  4JBM A;  1PTO H;  1YJ9 A;  2IX0 A;  2AMC B;  1U0L A;  4LW1 A;  4NXN L;  2CHB D;  1CK1 A;  4X3K A;  2BH8 A;  4TKO B;  5CV8 A;  2ZTE A;  1BO0 A;  1IHZ A;  2NN6 I;  3OYY A;  4ABN A;  1YNJ D;  3KDF A;  5LMN Q;  4DUY Q;  4HIM A;  2M9V A;  1AP0 A;  4Z9C B;  1JQY D;  1HZ9 A;  3KBX A;  4A3K G;  1WTO A;  3RZD B;  1EEF D;  4PNY A;  1VQL A;  1I6H H;  2R7F A;  1LLR D;  5EKI A;  3QO2 A;  1X3G A;  1IBM Q;  4A75 A;  3AB9 A;  4RGN A;  1IYV A;  4LUO A;  3GTK H;  1Q81 C;  1B8A A;  3I7F A;  4DA2 A;  2DUD A;  4DXF A;  4ZKC B;  4KHP Q;  2QGQ A;  3HOX B;  2AWO A;  2KBN A;  4G4K A;  1ENF A;  5DAU A;  5M5X B;  1I4G A;  2OWO A;  4N9P A;  1STN A;  1Q86 C;  2OF1 A;  4JW0 A;  1NJI C;  4ZLT F;  3KLR A;  1E2V A;  1UUP A;  4DV0 Q;  1RTO A;  4AIM A;  4U68 A;  1W2B A;  1AEX A;  2BDO A;  2E74 C;  1K0S A;  4DU9 A;  2MJ8 A;  4LF7 L;  4RA8 A;  2YTY A;  2TMP A;  4DN4 M;  2Q8R E;  4IUU A;  1V9P A;  1KXL A;  2N3S A;  2WFW A;  4F8M A;  1JOQ A;  1UE5 A;  5M5W H;  3BDC A;  2CCZ A;  1SNP A;  3HOU H;  4P74 A;  3X3M A;  5CMD A;  5IP7 H;  3CQZ H;  4PMB A;  4DV3 Q;  1V8Q A;  1XMO Q;  3FKI H;  2MP1 A;  4DR7 Q;  3D31 A;  1XXG A;  4KMU C;  2HCI A;  5M5Y H;  1A0I A;  2C35 B;  1RIP A;  3JC6 6;  4HIO A;  1DZ1 A;  4YCU A;  4R4C A;  3RUZ A;  4BBR H;  2F0S A;  1X3Q A;  1PYW D;  1H9S B;  1TS5 A;  1TQO A;  3S1R B;  2JSO A;  4NKL A;  3ZYY X;  4HJ7 A;  4A3E G;  1SYF A;  2UXB Q;  4C2M B;  5LMU Q;  2A68 C;  1WCM H;  5IGB A;  2GN5 A;  1G2T A;  4X66 L;  4HID A;  2PNR C;  5JOB A;  4R1J A;  1QOH A;  3KYH C;  2RSN A;  1L0W A;  3KJO A;  1TVX A;  1V1P B;  1QNU A;  4HED A;  3BZK A;  4AQY L;  5LL6 X;  3PO2 B;  3DLL A;  5K36 G;  1IW7 D;  3NXW A;  1G91 A;  3PIP A;  2JXM B;  4APV A;  1PDQ A;  4CKC A;  1PH6 A;  3H94 A;  3EA6 A;  4A3K H;  5EQ0 A;  3VR5 A;  2SDF A;  3QB3 A;  2B2U A;  2Y0S B;  2F0D A;  3HRZ C;  3G6J B;  1PH4 A;  2F4I A;  1BCP D;  1VQB A;  2AQ1 B;  1YI2 A;  1STB A;  2KHI A;  3P1H A;  1U5K A;  4RGM A;  2IW3 A;  4DFA A;  5M3M B;  4M1U B;  4YWM A;  4DV4 L;  4MIU A;  1B3Q A;  4FO2 A;  1I4H A;  3GO5 A;  4KI0 A;  1WVL A;  1FNV A;  3TS2 A;  2WB1 E;  1EYG A;  3NTI A;  1SJE D;  2WAQ E;  2ZJP A;  1Z7T A;  2VS1 A;  3EBE A;  5EBD A;  5CYU A;  2NBF A;  3A74 A;  1Q1E A;  3D4D A;  3OW2 A;  1UE7 A;  1NUC A;  5DM6 3;  4JG2 A;  4R8I A;  3A5Z B;  5BN4 A;  2H4O A;  1VQ7 A;  5FJ8 G;  3U50 C;  1S5E D;  2I5M X;  1LTI D;  1I5F A;  4DF7 A;  4XYQ A;  3K5N A;  3GTP H;  2BA0 A;  2SOB A;  3PMF A;  5CV7 A;  4FYD A;  1TWA B;  3A0J A;  3ND9 A;  1RD9 D;  1GKH A;  1O78 A;  3I56 A;  2KQ3 A;  1MHW C;  3A8I E;  4RGO S;  1U9R A;  5ELB A;  5C4X G;  5KRU A;  1J5E L;  4QY7 A;  1G51 A;  1HA6 A;  4KD3 A;  3S2D B;  2F4V Q;  2L1B A;  4A3C G;  5A2Q L;  3FHW A;  5CV9 A;  1EIH A;  5BN5 A;  4DR6 Q;  1HRJ A;  2NN6 H;  5JPN C;  4LF4 Q;  1WTQ A;  1Y1W B;  4X62 L;  1QE6 A;  3MVV A;  1SYE A;  1G8Z D;  3PUV A;  1D1I A;  2G9D A;  4L6T B;  1KLG D;  2D0P A;  1FL0 A;  3GV3 A;  1V43 A;  4C3J G;  2A6E D;  4QGU A;  4A3E H;  4JI5 L;  1LAB A;  1LYL A;  1NR4 A;  4DAP A;  2AUJ D;  4LFC L;  3Q24 A;  5ELO A;  4QB4 A;  1CSP A;  1A3U A;  3K6O A;  3E9H A;  4ILW A;  3NWS A;  1QUQ A;  2ENB A;  1NR2 A;  2EJM A;  2EYF A;  1KIX A;  2KCC A;  3OTO L;  3TRZ A;  2PNH A;  4O1N A;  1FNU A;  2H1E A;  2XSC A;  1A62 A;  3CD6 A;  1Y1V H;  3Q23 A;  3TZD A;  5C4X B;  1VS0 A;  4IFD I;  1SNC A;  2A69 D;  4CBV A;  1N32 L;  1E24 A;  3RR5 A;  3CRL C;  4DK1 A;  2JA5 H;  5C3E G;  3CCM A;  3S1Q B;  1T9H A;  1N34 Q;  4LF9 L;  3EIV A;  3MEH A;  2B63 H;  1R4P B;  2UXC L;  1U4L A;  4AYB E;  1MIU A;  2ALY B;  4N8F A;  2L5T A;  4BXX G;  1QG7 A;  4P71 A;  3CCV A;  2PQA A;  5M3F G;  1XMQ Q;  1E3P A;  2MQH A;  1QZH A;  3HOV H;  3NEN A;  1XJV A;  1GM5 A;  4NXN Q;  1RCV D;  4LFB L;  3BZC A;  4CJ2 C;  2R93 G;  1J9O A;  1MGS A;  4FF1 A;  1BVS A;  4K5X A;  4DAV A;  2EYH A;  4IZ8 A;  1O7I A;  4BWG B;  3UE0 A;  1TU2 B;  4Q0F A;  4DR4 L;  1PZK D;  5K5P A;  2BE5 D;  3NHH A;  1GUT A;  1KHI A;  2NVY B;  4C1N K;  1N36 L;  2VQF L;  1KNA A;  4OWX B;  1RL2 A;  3AU7 A;  3T13 A;  2EY2 A;  1SNM A;  1R9T H;  2ZXR A;  3PV0 A;  2B2V C;  4A3C H;  2HIV A;  2NYZ D;  1SE8 A;  1K73 C;  3F2D A;  3NBH A;  2ZTD A;  4DR5 L;  1L1O A;  1K0R A;  1V1O A;  4S3S A;  1LT5 D;  2R3Z A;  2R93 B;  2R92 G;  4MHE A;  1NTG A;  3VR6 A;  4DV6 L;  4LF7 Q;  3NEL A;  4XXE A;  3F2B A;  4IFD J;  4C3J H;  4L8J A;  1YHB A;  1VDZ A;  5D3I B;  2V4D A;  5EBC A;  3M4P A;  2UU9 L;  3K80 C;  2E2J B;  4DAY B;  1OO9 B;  2RCN A;  1HHV A;  2F3V A;  1NSN S;  4JCV E;  1OXU A;  1ESF A;  3DM1 A;  2OXP A;  4HAE A;  5HY6 A;  3FMC A;  1UNS A;  5IYB G;  2AQ3 B;  4KY5 A;  1Q90 A;  1JC7 A;  2YTV A;  2PMZ B;  4EGV A;  2QEJ C;  4BY7 H;  1NNX A;  4DR1 L;  5C3E H;  2EQS A;  2NVQ B;  3KLS X;  5I9P A;  3PIP 3;  3RZO H;  1W3S A;  3AQQ A;  3LNN A;  2K4K A;  3EJI A;  2K14 A;  2MGS A;  5C0X I;  3MXN B;  3OMG A;  2VW9 A;  3HG9 A;  5JJL A;  1MJC A;  2WP8 J;  5CV5 A;  4EQP A;  1JOO A;  5M3F H;  3PF4 A;  4HSV A;  4X66 Q;  3EFX D;  4MTN A;  5J1Z A;  3H15 A;  3J81 L;  2RF4 A;  4DV2 L;  2C5C A;  1SYC A;  1CKM A;  4AQY Q;  5EKL A;  1PH5 A;  2I5L X;  3VYU A;  4HJ9 A;  1IL2 A;  1PH1 A;  2KCT A;  5KYI A;  4XQN A;  1HQR D;  2HDL A;  1VF5 C;  2KCN A;  5D3D A;  1C9O A;  3J81 j;  3TS0 A;  1F77 A;  1KC8 C;  3HZX A;  2RSO A;  5ELF A;  3TP8 A;  2K1B A;  2BH2 A;  4DV4 Q;  5I9O A;  1FGB D;  4CDD C;  1SE3 A;  1ENA A;  3BG3 A;  5FOB B;  3OW7 A;  3KLW A;  1F2M A;  3QOL A;  2OTJ A;  4KJO A;  4H13 C;  4QF4 A;  4GS3 A;  4JBK A;  1JT8 A;  4RHR A;  3K5O A;  3V96 A;  3I3C A;  1VQH A;  1W6J A;  2X69 A;  4IFD H;  4A4I A;  3ULP A;  1GUS A;  3H6M A;  2AKW B;  4KV6 A;  2Y0S E;  3J7Z C;  4NP5 A;  1VQG A;  5FLM G;  4FXK C;  2R92 H;  2ES2 A;  2EY6 A;  4RCN A;  4JI2 L;  2I46 A;  1YNN C;  2LKV A;  5C0X G;  4A3J G;  1C8C A;  2KHS A;  2Z4H A;  4MN3 A;  4XQQ A;  3GD7 A;  4LMQ D;  1LV9 A;  1PRT B;  1EWI A;  1XX8 A;  3KF6 B;  4ZAI A;  3GTM B;  2EYO A;  1J5E Q;  2EIF A;  1LT4 D;  2G5D A;  2F1M A;  1E2Z A;  5KIX A;  2NWG A;  1GUW A;  1ASY A;  4H44 C;  4OIK A;  1UE6 A;  1FD7 D;  2JK8 A;  2UUA Q;  1KD1 C;  3T4A C;  4K5V A;  2N78 A;  4X62 Q;  2O5J C;  3K58 A;  3PO3 G;  2K5D A;  2L9H A;  3HOZ B;  1A2T A;  1EY9 A;  1OXX K;  4A3G G;  3M85 A;  4JI5 Q;  4ME5 A;  2IY5 B;  3KFU A;  3K5M A;  1HXY D;  3AFP A;  1HZA A;  3VYR A;  1PVO A;  3I72 A;  4LFC Q;  4JK1 C;  3PIO A;  1PRT C;  1A3T A;  1QVG A;  3S24 A;  2NTT A;  4KHV A;  3OTO Q;  4QUF A;  3S14 B;  3QJY A;  3PSI A;  2VUM B;  4RFB A;  5IYC G;  3H3V I;  4K8J A;  4JI1 Q;  4ID6 A;  1S5C D;  4DK0 A;  3A56 A;  1YHA A;  1N32 Q;  3U58 A;  1S5B D;  5C44 B;  3R93 A;  5HGT A;  1TWH B;  4ME3 A;  4LF9 Q;  3E3X A; 
#chains in the Genus database with same CATH homology
 2FFK B;  4EQO A;  1HPC A;  3DWA A;  4C1N I;  4HCE A;  1GXD C;  1C48 A;  3BDO A;  3EQL C;  1CQF A;  1AZQ A;  3MHB A;  2J4X A;  1H9R A;  1TT2 A;  2JEB I;  4KD4 A;  5CV4 A;  2ICI A;  2PZT A;  4B08 A;  2RDF A;  2F0G A;  3HEJ A;  2WII B;  3T53 B;  3KK7 A;  1CFM A;  1TWC B;  1H9S A;  4PMW A;  1EY7 A;  4PQX A;  3OMC A;  4HTH A;  5C0X H;  1SYB A;  3G7L A;  4KKT A;  3M4O B;  3FPP A;  4RWS C;  3GTQ B;  4DNR B;  5IGC A;  3FDT A;  1KAB A;  2F0L A;  2F3W A;  1PTO B;  4TQU S;  1RDP D;  1V1P A;  1LTS D;  4ULL A;  1HFN A;  1JR0 D;  3J7A V;  1F9P A;  5CBA E;  2K05 A;  4KK7 A;  4WJW A;  2BA1 A;  1I6H B;  2GA4 B;  1EY4 A;  1B9N A;  1K8O A;  3V05 A;  1Q1B A;  5DM7 3;  1O7Y A;  3GTK B;  3V2T A;  1KDB A;  1ILP A;  1LTG D;  4RHS A;  3N52 A;  1X32 A;  1PTO C;  1WTP A;  3S9W A;  1B53 A;  1LTA D;  1LTR D;  2F03 A;  5IGG A;  3TZU A;  5ELD A;  5D14 A;  4IUR A;  2L11 A;  3MTS A;  4BS9 A;  5C4Z A;  1PFN A;  3BYT B;  3FVQ A;  1SND A;  2F0I A;  5M5W B;  3SXH A;  3NUC A;  3HOU B;  4KKU A;  3KBG A;  3CQZ B;  3FKI B;  3J7Y W;  3D4R A;  1BQQ T;  5M5Y B;  2PZW A;  2VNU D;  4RKL A;  2B2W C;  4BBR B;  4V19 0;  2VXW A;  2MUY A;  1DCZ A;  3E0J A;  5A35 A;  4QUC A;  1WCM B;  1G29 1;  4WRD A;  5T1G A;  1W6K A;  4TSS A;  2R6G A;  2C9O A;  3E6Z X;  5EGT A;  3MA2 B;  4A3K B;  3SHL A;  1F2Y A;  2RKS A;  1JWM D;  1IW7 C;  1EOT A;  1A15 A;  4FXD A;  1JIC A;  1PXU A;  2EJG C;  1KAA A;  4HN7 A;  2EYP A;  3PIO 3;  3W3A A;  2D2C C;  2B2V A;  2NN6 G;  3I70 A;  2I07 B;  4G7H C;  3GTP B;  3DWP A;  1LAC A;  1B1Z A;  4NMZ A;  4XDX A;  5E4X A;  4OHJ A;  3HP3 A;  1AN8 A;  2EJF C;  3T16 A;  2JYO A;  2XRS D;  4LJZ C;  1L0X B;  5G3L F;  2PCF B;  1SE2 A;  1E2W A;  4HMI A;  5A2Q E;  2FMC A;  4A3E B;  3QIA A;  1SMY D;  4IAL A;  4DAY A;  2K04 A;  3SDZ A;  1SJH D;  4ZKB B;  1NCV A;  1Y1V B;  4FXG C;  3IKJ A;  1Z6H A;  1Y8O B;  1MBY A;  5FKA C;  1O80 A;  3ERO A;  4RCO A;  2JA5 B;  5EPK A;  2B63 B;  2M2L A;  1T5E A;  3MXN A;  5CBE E;  1XWE A;  2A68 D;  3VR4 A;  4BA2 I;  2F0K A;  3M4Y A;  5JJZ A;  3MWY W;  1STE A;  3HOV B;  1GHJ A;  1SAP A;  3T56 B;  2IL8 A;  5ELC A;  3P75 A;  4KY7 A;  4WFN 3;  4KN4 C;  3R2I A;  2OT2 A;  2JP1 A;  2Z8L A;  5IGD A;  4K6L A;  1D1K A;  4K6D A;  1I4Q A;  3NE5 B;  3C1E A;  1SYD A;  1D6E C;  3Q22 A;  1PZJ D;  1WTR A;  1ZEQ X;  4XTC S;  3KLS A;  1R9T B;  1Y8P B;  3U9S A;  1MD2 D;  3A8K E;  3PUW A;  2XNA C;  4IUT A;  4ZYS A;  2F0P A;  1EIG A;  1GUG A;  5CR3 A;  2LS0 1;  1QJO A;  3RLF A;  2B39 A;  4C3J B;  4IUP A;  2A5H A;  3ONA B;  1ZYR D;  1S4Z A;  1BOS A;  5G3L D;  1IL8 A;  1B9M A;  3FEW X;  3VR2 A;  3J80 L;  1BF4 A;  1CZG A;  4HMJ A;  3EVQ A;  4BY7 B;  3TN2 A;  5C3E B;  4M8A A;  1Y69 U;  3IAY A;  4K2K A;  1VF7 A;  3RZO B;  4BA1 I;  3IFT A;  5FO8 B;  3OOC A;  5C3W A;  3OIQ A;  2XN9 C;  5M3F B;  2F0N A;  2DY7 A;  1LTB D;  4K14 A;  4IFD G;  2A6H C;  1QNK A;  5KNB A;  3Q6S A;  5DEH A;  1DM0 B;  1A3V A;  1EY5 A;  1PMR A;  1ILQ A;  3J81 E;  2JE6 I;  1PFB A;  5E1F A;  1UAP A;  1PZI D;  1DJR D;  2RA4 A;  2AQ2 B;  5IOC A;  1Y8N B;  4HSP A;  2NTS A;  2XVS A;  3E5S A;  2L4N A;  1I4R A;  5JAV A;  2KUM A;  1CHP D;  3WOE A;  1TS2 A;  1B4O A;  2R92 B;  2HQE A;  1JOR A;  2RDH A;  5ISR A;  4ZK9 B;  1U4P A;  1R4Q B;  1DD2 A;  3KF8 A;  1Q8I A;  5I2X A;  2DN8 A;  3C46 A;  3DEP A;  1KLU D;  2RBM A;  2DNE A;  1A6X A;  1ONL A;  4PMC A;  3NP8 A;  3VA7 A;  5KND A;  5C3X A;  1DOL A;  4B9W A;  5IGF A;  1EY8 A;  4HCS A;  1SSO A;  5EKK A;  1XYI A;  1EU3 A;  3BVM A;  3OPO A;  2EXZ A;  2N88 A;  1NAP A;  1RHP A;  4ZRZ A;  3N6R A;  3C2P A;  4H0L C;  1SYG A;  1I6V C;  2K33 A;  4C3H G;  1MI2 A;  3A7L A;  2B2T C;  1ESR A;  3IL8 A;  2PPB C;  2F0Q A;  1DYQ A;  5DNF A;  3TDQ A;  3GQB A;  5FLX L;  2B2W A;  2F0J A;  1EZ6 A;  1RKN A;  3Q0A A;  2JEA I;  3AMU A;  1G2S A;  5E4W C;  3S1M B;  4XT1 B;  2K28 A;  5I4D A;  1I4P A;  2E2I B;  3D6W A;  4HR7 B;  5F2D A;  3JAM L;  3F2U A;  1GJX A;  1EY0 A;  3PUY A;  1MSH A;  1D5Z C;  1CTM A;  4JBW A;  3WOF A;  1TY2 A;  3DXJ C;  1PFM A;  1RJT A;  3DWQ A;  3R2T A;  1O7L A;  2Z4I A;  3PUX A;  4QIW B;  1ROD A;  4A3J B;  2O2L D;  3A54 A;  3I73 A;  1VMP A;  1B44 D;  2D62 A;  3LWE A;  4K8I A;  2K01 A;  3GV6 A;  5JPM C;  3SEB A;  2EPB A;  5JEA J;  4KHZ A;  1ET9 A;  3H91 A;  3PO3 B;  4A3G B;  3CHB D;  1OXV A;  1XTC D;  1F9Q A;  2B8G A;  2EY1 A;  3GTG B;  3GTO B;  2KVM A;  1J8I A;  4QCL A;  1F9R A;  1M8A A;  2CVR A;  1TKW B;  1KDA A;  1CI3 M;  3ITP A;  1S5F D;  2MPM A;  1OXT A;  3M7G A;  1PTO F;  1CZW A;  2Z1C A;  4XQJ A;  1BXT A;  2NVX B;  4RAU C;  4FF4 A;  2KED A;  2EYM A;  2ZXP A;  2KA7 A;  2L55 A;  1SNQ A;  1LTT D;  1AFP A;  3VYT A;  2K03 A;  1D5M C;  2CW0 D;  3I90 A;  2G9H D;  4EVO A;  4F88 A;  2ZXO A;  4OO1 I;  1PLF A;  4X3S A;  1AW7 A;  1YNJ C;  1EWH A;  3I4N B;  5J22 A;  3CU7 A;  1F9S A;  3RMH A;  1KNE A;  3NPP A;  4A3F B;  3H09 A;  2X6L A;  2YU9 B;  2QKI C;  4ZQ3 A;  5J39 A;  2N55 A;  1STG A;  1EQT A;  3SK5 A;  2E2D C;  4UAI A;  3TSS A;  2O4X A;  1EU4 A;  5IT9 L;  2F0W A;  2NUC A;  2DY8 A;  2F0V A;  4IUQ A;  3M7N A;  2QDB A;  2RVL A;  3H3V C;  1CM9 A;  1JWU D;  5C4J B;  3X3N A;  4OO1 G;  4IQZ A;  3NSW A;  3BVG A;  5AFW A;  4TRD A;  3QG1 A;  3BZD B;  2K5Q A;  1RTN A;  1BCP B;  4K2L A;  2EDG A;  4FNF A;  2FIN B;  2K5W A;  1SXT A;  1HCZ A;  4KY6 A;  3I91 A;  5EJW A;  1PTO D;  2VB2 X;  1MSG A;  3LX0 A;  4DXG A;  1WTX A;  1SE4 A;  2X6G A;  3BDL A;  1TII D;  1X3P A;  3OWF A;  2WKC A;  3S2H B;  2IX1 A;  1SEB D;  2K7V A;  3HKZ B;  1EYA A;  1BCP C;  3TME A;  1JB3 A;  1D2B A;  3DUZ A;  4Q5V A;  1I50 B;  2EVB A;  1SMY C;  3I4L A;  3NTH A;  4A3D B;  2Q8T A;  3GTJ B;  2FJ2 A;  1HQM C;  1GHK A;  3LWU A;  1EZ8 A;  1QB5 D;  3SE0 A;  1JOK A;  1S5D D;  4YIJ A;  5T1I A;  3NTK A;  2EY5 A;  4RKB A;  3A55 A;  2PZU A;  3ND8 A;  3K0Y A;  1U4M A;  1C4Q A;  3RD4 A;  2B8F A;  5I6Y A;  1O7Z A;  3P7J A;  1EFI D;  3DMU A;  3R3O A;  4OO1 H;  1DOK A;  1EY6 A;  4N9T A;  2XWB B;  3D3R A;  4BY1 B;  2NB0 A;  4FF3 A;  1EEI D;  1M4V A;  1Q3L A;  2A6E C;  1Z47 A;  2B2Y C;  1CT1 D;  3R8B A;  2SEB D;  2JA8 B;  1ENC A;  1K83 B;  2ID0 A;  5D65 A;  2NVT B;  1B2T A;  4C56 C;  2L12 A;  2A69 C;  2TSS A;  5C6A A;  5IIF A;  1HTL D;  2PQE A;  3TBI B;  4G7Z C;  2JA7 B;  5COR A;  3W2D A;  1CHQ D;  3SK8 A;  2L0C A;  1RF2 D;  4RH6 A;  5E3F A;  4CJ1 B;  3MFY A;  2BOS A;  2B2T A;  5KYL A;  5I2Y A;  2LMC B;  1K8M A;  2LY7 A;  1ZYR C;  4G7O C;  5KGU A;  2XWJ B;  1KTK A;  4XIG S;  1HA5 A;  3J80 E;  3CRK C;  1JWS D;  3C1F A;  1TS3 A;  1TWG B;  2E2H B;  1GUO A;  1JCK B;  3K57 A;  2BE5 C;  2IJ0 A;  3S16 B;  2QCP X;  3SK4 A;  2QF7 A;  5C5L A;  3OSO A;  4U67 3;  2FHT A;  3NQI A;  3MC0 B;  2EYJ A;  2KOL A;  3BVZ A;  1TR5 A;  3MFG A;  3FPU B;  3L3O C;  5NUC A;  2QIL A;  2Q8I B;  2R7Z B;  3PUZ A;  4X3U A;  3TP5 A;  5K36 H;  1SFO B;  2DNC A;  3S15 B;  3KUP A;  1BDO A;  3M3Y B;  4G57 A;  3MAQ A;  2XRQ D;  3DHQ A;  3O13 A;  1D5X C;  2F0M A;  2F0T A;  4R9W A;  3D4W A;  5HUR A;  2R61 A;  1BBX C;  2J7Z A;  4XYO A;  1BNZ A;  2NZ1 D;  3URY A;  1QCB D;  3S1N B;  2RQX A;  3I4M B;  4LAA A;  1EWC A;  2K6A A;  1I3Q B;  2YYZ A;  1U4R A;  1Q12 A;  4ZUJ A;  4CGY B;  5I6W A;  1JE4 A;  2D9U A;  1ET6 A;  3C3L A;  3TP6 A;  2SNM A;  1EL0 A;  2WIN B;  3SVM A;  4L63 B;  1ZKO A;  1H9M A;  1EYC A;  2PO4 A;  1H9J A;  3HS0 C;  1EQV A;  5ELE A;  2K32 A;  2F0F A;  5IGE A;  4OIJ A;  2IWH A;  2O5I C;  5COY A;  3SK6 A;  1L0Y B;  1TY0 A;  2E76 C;  4OGQ C;  4O42 A;  2KEC A;  3OWE B;  1FNW A;  5TSS A;  4P2C B;  3NK9 A;  4A3M B;  1I4X A;  1B50 A;  1WTW A;  1HTP A;  1EYD A;  5LHY 1;  5FO9 B;  4A93 B;  1FYC A;  3NQT A;  5KEE A;  4UDU C;  1LO5 D;  2B2U C;  3QOJ A;  2F0E A;  4DGZ A;  4CKB A;  3D8G A;  5JVH 3;  5KNC A;  5FLX E;  2J0T D;  1A2U A;  3BYY B;  3H0G B;  2A6H D;  2RDG A;  4KTA A;  3GTL B;  1H9K A;  5BN3 A;  1ICW A;  3UI2 A;  2HDM A;  1WD1 A;  4NDX A;  1DON A;  4F7X A;  5CV6 A;  2E75 C;  2XIW A;  1IKM A;  2EYL A;  3JAM E;  4KJN A;  2M00 A;  4E6I A;  5FO7 B;  1SDF A;  4J1M A;  4ODG A;  5IOD A;  3A7A B;  4A3I B;  3WDN A;  2F0H A;  2IT1 A;  1PRT F;  4R8N A;  3HGB A;  2EOT A;  5EPJ A;  1HUN A;  1VMC A;  5C4H A;  3NWT A;  1STA A;  1BUV T;  1II3 A;  4XT3 B;  2D5D A;  1WD0 A;  3ERQ A;  1OXS C;  3L9A X;  3MXG A;  2IPK D;  2A74 C;  3TP7 A;  3S17 B;  2JA6 B;  1IYU A;  3GP7 A;  4GZY C;  3U9O A;  4C3H B;  4Y7N B;  5FK9 C;  2MHV A;  1B3A A;  5C0X J;  1ZXT A;  4CHT B;  1TWF B;  1VCI A;  2VB3 X;  3K7A B;  4BBS B;  3MXP A;  4FF2 A;  4IUN A;  4WOR A;  4DNT B;  4PV1 C;  5JEA G;  2HCC A;  1AZP A;  1DXM A;  2IX3 A;  2WB1 B;  3BS1 A;  1KDC A;  4IUV A;  2WAQ B;  1FR3 A;  2EZV A;  4A3B B;  4NW2 A;  1YNN D;  3QWN A;  1GUN A;  1UEA B;  4J6H A;  4C3I G;  2CW0 C;  3IFD A;  3FRP B;  3HOY B;  1G6Z A;  2KJX A;  1BR9 A;  2PW7 A;  4KKS A;  3L7Z C;  4I7Z C;  1CA6 A;  1HFG A;  3HOW B;  1T5X D;  1QIL A;  1LT3 D;  1F2Z A;  3SR1 A;  3VR3 A;  3I8Z A;  1E0B A;  4CJ0 B;  2ICE C;  3MZ5 A;  1SNO A;  1CA5 A;  2PW5 A;  3K5L A;  3VYS A;  1WTV A;  2WKD A;  4H7B A;  4CKE A;  1PRT D;  4F87 A;  2FMM A;  5C5M A;  4C3I B;  2BCO A;  2SNS A;  2B2Y A;  3J7A F;  4J8Q A;  1TS4 A;  3A8J E;  2WV6 D;  5IT9 E;  4I65 A;  3NBI A;  2CQA A;  3D6C A;  3VA5 A;  1ML0 D;  4OL7 A;  5M9O A;  3OIP A;  1HUM A;  4X3T A;  5CC4 A;  2HUG A;  2AWN A;  2BDN A;  2PYK A;  2F0O A;  3OHX C;  1STH A;  1GOZ A;  4QMG A;  1LT6 D;  5JEA H;  5JVG 3;  1DOM A;  5EPL A;  2A73 B;  4B9X A;  4AYB B;  4LK1 C;  4EQN A;  2OEO A;  2AUK A;  3P20 A;  5CGK A;  5LL6 S;  2ZT9 C;  2F0U A;  4V0B A;  4K5W A;  3CKI B;  2LFN A;  2KEE A;  3MXU A;  4IN3 A;  4FVM A;  3K59 A;  1STY A;  3T51 B;  3DEO A;  4ZUI A;  2WAC A;  1IKL A;  4KN7 C;  4RGT A;  2EE1 A;  1BCP F;  1SBB B;  1CQV A;  1F2L A;  1QWY A;  4FP5 D;  1PTO H;  2IX0 A;  2CHB D;  1CK1 A;  4X3K A;  4TKO B;  5CV8 A;  1BO0 A;  1IHZ A;  2NN6 I;  4ABN A;  1YNJ D;  2M9V A;  1AP0 A;  4Z9C B;  1JQY D;  3KBX A;  1WTO A;  3RZD B;  1EEF D;  4PNY A;  1LLR D;  5EKI A;  3QO2 A;  1IYV A;  3AB9 A;  4RGN A;  4DA2 A;  4DXF A;  4ZKC B;  3HOX B;  2AWO A;  4G4K A;  1ENF A;  5DAU A;  5M5X B;  1I4G A;  4N9P A;  1STN A;  2OF1 A;  4ZLT F;  3KLR A;  1E2V A;  1UUP A;  1RTO A;  4U68 A;  1AEX A;  2BDO A;  2E74 C;  4DU9 A;  2MJ8 A;  4RA8 A;  2TMP A;  4DN4 M;  2Q8R E;  4IUU A;  4F8M A;  1JOQ A;  3BDC A;  1SNP A;  3X3M A;  5CMD A;  4PMB A;  1V8Q A;  2MP1 A;  3D31 A;  1XXG A;  4KMU C;  2HCI A;  1DZ1 A;  3RUZ A;  2F0S A;  1X3Q A;  1PYW D;  1H9S B;  1TS5 A;  1TQO A;  3S1R B;  2JSO A;  4NKL A;  3ZYY X;  1SYF A;  4C2M B;  2A68 C;  5IGB A;  1G2T A;  2PNR C;  5JOB A;  1QOH A;  2RSN A;  1TVX A;  1V1P B;  1QNU A;  4HED A;  5LL6 X;  3PO2 B;  5K36 G;  1IW7 D;  3NXW A;  1G91 A;  2JXM B;  1PDQ A;  4CKC A;  3H94 A;  3EA6 A;  5EQ0 A;  3VR5 A;  2SDF A;  3QB3 A;  2B2U A;  2Y0S B;  2F0D A;  3HRZ C;  3G6J B;  2F4I A;  1BCP D;  2AQ1 B;  1STB A;  3P1H A;  4RGM A;  2IW3 A;  4DFA A;  5M3M B;  4M1U B;  4MIU A;  1I4H A;  4FO2 A;  3GO5 A;  4KI0 A;  1WVL A;  1FNV A;  3NTI A;  1SJE D;  1Z7T A;  5EBD A;  5CYU A;  2NBF A;  1Q1E A;  3D4D A;  1NUC A;  5DM6 3;  4R8I A;  5BN4 A;  2H4O A;  1S5E D;  1LTI D;  4DF7 A;  4XYQ A;  3K5N A;  2BA0 A;  2SOB A;  3PMF A;  5CV7 A;  4FYD A;  1TWA B;  3ND9 A;  1RD9 D;  1O78 A;  2KQ3 A;  3A8I E;  4RGO S;  1U9R A;  5ELB A;  5KRU A;  1HA6 A;  4KD3 A;  3S2D B;  2L1B A;  5A2Q L;  5CV9 A;  1EIH A;  5BN5 A;  1HRJ A;  2NN6 H;  5JPN C;  1WTQ A;  1Y1W B;  1QE6 A;  3MVV A;  1SYE A;  1G8Z D;  3PUV A;  1D1I A;  2G9D A;  4L6T B;  1KLG D;  3GV3 A;  1V43 A;  4C3J G;  2A6E D;  1LAB A;  1NR4 A;  4DAP A;  2AUJ D;  3Q24 A;  4QB4 A;  1A3U A;  3K6O A;  4ILW A;  3NWS A;  2ENB A;  1NR2 A;  2EJM A;  2EYF A;  2KCC A;  4O1N A;  1FNU A;  2H1E A;  2XSC A;  3Q23 A;  3TZD A;  5C4X B;  4IFD I;  1SNC A;  2A69 D;  4CBV A;  3CRL C;  4DK1 A;  3S1Q B;  3MEH A;  1R4P B;  1U4L A;  2L5T A;  1QG7 A;  1RCV D;  4CJ2 C;  1J9O A;  1MGS A;  4FF1 A;  4K5X A;  4DAV A;  2EYH A;  4IZ8 A;  4BWG B;  1TU2 B;  4Q0F A;  1PZK D;  5K5P A;  2BE5 D;  3NHH A;  1GUT A;  2NVY B;  4C1N K;  1KNA A;  3AU7 A;  3T13 A;  2EY2 A;  1SNM A;  2ZXR A;  3PV0 A;  2B2V C;  2NYZ D;  3NBH A;  1V1O A;  4S3S A;  1LT5 D;  2R3Z A;  2R93 B;  4MHE A;  3VR6 A;  4XXE A;  4IFD J;  4L8J A;  1VDZ A;  5D3I B;  2V4D A;  5EBC A;  2E2J B;  1OO9 B;  1HHV A;  2F3V A;  1NSN S;  1OXU A;  1ESF A;  3DM1 A;  2OXP A;  4HAE A;  3FMC A;  1UNS A;  2AQ3 B;  4KY5 A;  1Q90 A;  1JC7 A;  2PMZ B;  4EGV A;  2QEJ C;  2NVQ B;  3KLS X;  5I9P A;  3PIP 3;  3LNN A;  3EJI A;  2MGS A;  5C0X I;  3OMG A;  3HG9 A;  2WP8 J;  5CV5 A;  4EQP A;  1JOO A;  4HSV A;  3EFX D;  5J1Z A;  3J81 L;  2C5C A;  1SYC A;  5EKL A;  3VYU A;  5KYI A;  4XQN A;  1HQR D;  2HDL A;  1VF5 C;  2KCN A;  5D3D A;  1F77 A;  3HZX A;  2RSO A;  5ELF A;  3TP8 A;  2K1B A;  5I9O A;  1FGB D;  1SE3 A;  1ENA A;  3BG3 A;  5FOB B;  3OW7 A;  1F2M A;  3QOL A;  4KJO A;  4H13 C;  4QF4 A;  4RHR A;  3K5O A;  3V96 A;  3I3C A;  2X69 A;  1W6J A;  4IFD H;  1GUS A;  3H6M A;  4KV6 A;  4NP5 A;  4FXK C;  2EY6 A;  4RCN A;  2I46 A;  1YNN C;  2LKV A;  5C0X G;  1C8C A;  2KHS A;  2Z4H A;  4MN3 A;  4XQQ A;  3GD7 A;  4LMQ D;  1LV9 A;  1PRT B;  1XX8 A;  3GTM B;  4ZAI A;  2EYO A;  1LT4 D;  2F1M A;  1E2Z A;  5KIX A;  2NWG A;  1GUW A;  4H44 C;  4OIK A;  1FD7 D;  3T4A C;  4K5V A;  2O5J C;  3K58 A;  2K5D A;  2L9H A;  3HOZ B;  1A2T A;  1EY9 A;  1OXX K;  3M85 A;  4ME5 A;  3K5M A;  1HXY D;  3VYR A;  3I72 A;  4JK1 C;  1PRT C;  1A3T A;  2NTT A;  4KHV A;  4QUF A;  3S14 B;  3QJY A;  2VUM B;  4RFB A;  4K8J A;  4ID6 A;  1S5C D;  4DK0 A;  3A56 A;  1S5B D;  5C44 B;  3R93 A;  5HGT A;  1TWH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...