1VQJA

Gene v protein mutant with val 35 replaced by ile 35 (v35i)
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
86
structure length
86
Chain Sequence
MIKVEIKPSQAQFTTRSGVSRQGKPYSLNEQLCYIDLGNEYPVLVKITLDEGQPAYAPGLYTVHLSSFKVGQFGSLMIDRLRLVPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Context dependence of mutational effects in a protein: the crystal structures of the V35I, I47V and V35I/I47V gene V protein core mutants.
pubmed doi rcsb
source organism Enterobacteria phage f1
molecule tags Dna binding protein
molecule keywords GENE V PROTEIN
total genus 9
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 1996-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02303 Phage_DNA_bind Helix-destabilising protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1vqjA00
5ELNA 4GN3B 3KLWA 1SMXA 5FLMG 4YHHQ 1U0LA 3J81c 1VQ4A 5C44H 1YHQA 3S1NH 1Y1WH 1CUKA 5LMNL 2UXBQ 4PZ6A 1SRUA 3GTJH 3B6YA 4JI1L 1N36L 4RMFA 1K8GA 3S24A 2JA8H 4QGUA 1YEZA 2FXQA 2R92H 4B3RL 5E7NA 1A63A 1G51A 2PI2A 4LF6Q 3I4NH 1OXSC 2ZTEA 4MZ9A 5AJ3L 4DV1Q 4LF4Q 1C0AA 1VQ9A 2AMCB 4KI0A 3CXCA 1KRSA 2RHQB 4A3IG 5M3FH 1G291 2AWOA 4JI2L 3GTLH 1PH5A 2OWOA 1Q12A 1M90C 2B3GA 1TWGH 3NEMA 2NN6G 4DR6L 2VY3A 4PZ8A 3CF5A 3TQYA 1WOCA 1YJWA 2ALYB 4HJ7A 1IZ6A 5IP9H 4JV5Q 2UXDQ 2R7DA 3I4MH 4UP7A 3TS2A 1PYSB 1SR3A 1TWAH 3PUVA 4EQ5A 4IOAA 5K36G 4X65Q 3W1GA 5H1SE 2A1AA 4DAMA 4LFAQ 1R9TH 2E8GA 4UPAA 5AJ3Q 4RG1A 4DV1L 1ASZA 3HOUH 1S3OA 3FP9A 3K80C 4DV3L 4JI6L 3S1QH 3A74A 4KHZA 1HR0W 3PF4A 4DUYQ 4JBKA 1OXUA 3HKZG 5IYDH 2BA0A 3RLFA 2I0QA 1K0RA 2DGYA 4IO9A 2HHHL 2EXDA 4GNXA 1HZCA 2XGTA 1X3GA 5LMUQ 1T9HA 2RHSB 5BR8Q 1K9MC 1VQAA 4BY7G 5HY6A 1CSPA 1EUJA 3KYHC 3W1BA 5FJ8G 4P73A 3CCSA 1NY4A 4HIOA 5JJLA 3L2PA 3M85A 2JA8G 2VUMG 3JC66 3NBHB 3G4SA 4OX9Q 3U4VA 3T1YQ 1YNXA 2NVQH 1PVOA 1G6PA 2C35B 4DV5Q 3TS0A 5M5WH 2HHHQ 2YTXA 1Q46A 1FL0A 4DV4Q 4JI7L 3HKSA 4GOPB 4DR1Q 4IOCA 2F3IA 5LMUL 2OQ0A 1LM0A 4LF6L 2ES2A 3K8AA 3PIOA 3PGZA 5LMNQ 1KQSA 3IRBA 1PYBA 3GO5A 3BU2A 3T1HL 5M3FG 4XTCS 3S1MH 2H5XA 4JOIC 3J80c 1Q1BA 2JK8A 2F4VL 2KBNA 4P75A 3S14H 1IBKL 1EIFA 4A3KH 4A3MG 2GN5A 2UUAQ 2JA6H 3S15H 3J80i 4IPDA 2UXDL 3TEHB 4DV6Q 3H0GG 1NMFA 4DV4L 4IFDI 1WFQA 1S40A 1HNZQ 1BBWA 5C44G 2AHOB 1Y14B 2WFWA 5DLQE 5FLMH 2ATWA 1Q86C 1E7ZA 1L1OC 4A3GH 3UDIA 2UUCQ 2PI2E 1AE2A 1L1OB 1I94L 2JA6G 1VQ6A 4LF4L 3M3YH 1FJGL 4HJ5A 3KDFB 2JEAI 1I6HH 2K50A 3J7ZC 3RZDH 1X55A 4B3RQ 1IYJB 4C2MH 3OW2A 1TWFH 1XPUA 3EN2A 3I56A 4LF9L 1WCMG 4DKAC 2JE6I 2AWNA 1X65A 2AKWB 1KAWA 3PV0A 1PH8A 1JJGA 2ID0A 1QVCA 4DPGA 1PH1A 4LNQA 3H3VH 4A3GG 3AEVA 2PNHA 4PMWA 2JA5G 4BBRG 1CKNA 4DV3Q 3F2DA 4YCVA 4JI6Q 1SLJA 1Y1VH 1JB7A 2UUBL 3MXNB 3CPFA 4YCUA 1X56A 4OWXB 3GTMH 3PO2H 1U5KA 2B63G 1EQRA 5ELOA 3M4QA 1XMQL 1SE8A 4HIKA 4JBWA 1JE5A 2NZHA 3G48A 1V1QA 4C3IH 1HNWL 1IBLQ 2E5LQ 2Q2HA 1AE3A 3J81i 2Y0SE 1HZ9A 4AQYL 1B7YB 4B3ML 3RZOH 4KHPL 3S1RH 1N32Q 2BA1A 4OO1I 1CKNB 4UP9A 1TWHH 4C3HH 2K5HA 3KOJA 1HZAA 5IP7H 3CW2C 1XMOL 4IFDJ 1MIUA 1UWVA 4DR4L 3E0EA 1HR0Q 4AIMA 4A3FH 2MNAA 2OTLA 1EWIA 3PSIA 2KHIA 4JI0Q 4JI3Q 4NXML 4YY3Q 2VUMH 2B29A 3PIPA 5C0XI 3I4MG 1CKOA 2HQLA 1VQ8A 4IFDG 4R4TA 2WAQE 4JOIA 1K73C 3E9HA 4AH6A 1QVGA 4NB3A 3Q8DA 1XPRA 1GO3E 1VQNA 1UE5A 2VQFL 1PH2A 1HNWQ 2GVBA 4P71A 4UP8A 3CCUA 1VCIA 4X66Q 1WJJA 2E2JH 1BVSA 3I2ZA 4JC0A 1JT8A 2WB1G 5IYDG 2I5MX 4DV7L 3CQZH 2UU9L 1GKHA 2V1CC 1AH9A 3F1ZA 3CCLA 4HJAA 4GKKQ 4BBSG 3CCMA 2VNUD 4PG3A 1JJCB 1EIYB 4MTNA 4Y7NH 2Z6KA 4AYBE 2JA5H 5M3MH 2JQOA 2QA4A 1L2FA 2JA7H 3T1HQ 2E2IH 4JYAQ 4LUOA 3CC2A 2N3SA 2ZTCA 1C9OA 1K3RA 2YTYA 4GN5A 3KJPA 4R4QA 2I5LX 1VQMA 4YWKA 1P16A 4R1JA 4DR2Q 1HR0L 5IWAL 4H02A 4POFA 1YZ6A 4JCVE 3CCRA 4JI8L 2Z6KC 3J81j 1L1OA 3ULJA 4OWWB 2YU9H 4QQBX 2UXCL 1YJ9A 3HOYG 1O7IA 4IJHA 2E2HH 4LF7L 3M7NA 4LFBL 3M9BA 1N34L 1IBKQ 1DGSA 2VQEL 4OO1G 3CP0A 1Y1VG 1IBML 1MKHA 4GN4B 1JJ2A 3F8TA 4QIWE 1YHAA 4BBRH 3FKIH 3M4OH 1NBWA 1NMGA 1MJCA 1K83H 4A3MH 4A3KG 1HH2P 2CWPA 4YHHL 4A3BH 5IWAQ 2R7ZG 1X9NA 4X64L 4A76A 4JBJA 4BY1G 3L0OA 4A3LH 2OQKA 4LF9Q 5C4XH 5C3EG 4O0AA 2R93H 2MQHA 3I55A 1YHBA 1TXYA 2PMZE 3WWVA 4HJ8A 1XJVA 3UDFA 4OX9L 4GKJQ 2PQAB 1KRTA 1HJPA 2JEBI 3SGIA 3ERSX 1IXRA 5LMNW 4DV2Q 4JI5Q 3GTOH 4A3BG 1KD1C 2Z0SA 3KF8B 2JA7G 3ZJYC 1S72A 4LF5Q 1GM5A 3S17H 1PH9A 4LF8Q 2VW9A 1J6QA 2EQSA 4X62L 4LF5L 2QGQA 3CPWA 3HOXH 2UU9Q 1CKMA 3EBEA 2CQOA 2UUCL 3PUYA 5FJ8H 4OONA 3U58A 2UUBQ 1WYDA 3KF6B 4GNXB 4HJ9A 2EIFA 3UDGA 4LWCA 4Y52H 2ZM6Q 1J5EL 4L5QA 4EX5A 4LUZA 2ZJRA 1N8RC 1UEBA 1X6OA 3CMAA 1XPOA 1E24A 1LYLA 3HFZB 4K0KQ 3HOWG 2ZM6L 1J5EQ 1VQFA 4DV0Q 3GDEA 4BA1I 4L5SA 4R4IA 3F2CA 5C0XG 4HIDA 4DR3L 1IBMQ 2YV5A 2VQEQ 2MO1A 4DR4Q 2D0OA 4QJFA 4DV5L 1NJIC 3S16H 1UE1A 2ASBA 5M5XH 1SFOH 4LF7Q 2CKZB 1NTGA 4BBSH 4LFBQ 4QY7A 4NPSA 2R6GA 4DR1L 1I94Q 3S2DH 4YCWA 3CCVA 4LFCL 4R4OA 4AQYQ 2IX0A 1VQHA 3JAMi 1KL9A 4DR5L 3OYYA 3GD7A 3K7AH 1KHIA 4LFCQ 4BXXG 4A93G 1SN8A 3A0JA 4DK6C 1N33L 4A75A 1V43A 4HIMA 4O2DA 1PH6A 1XNRL 3BJUA 1EFWA 3H15A 1PV4A 1X3FA 2BH8A 4L5RC 2UXBL 4K0KL 2Q2UA 3I7FA 1K8AC 1PA6A 5BR8L 4POGA 1TWCH 2B63H 3CMEA 3ULPA 3RN5A 1VQGA 1QVFA 4DUYL 4DV0L 4OXPA 5JJKA 3ICEA 2BH2A 1WI5A 3D31A 5IYBH 4IPCA 3BZKA 3EIVA 1PH4A 3S2HH 2CCZA 1VQCA 2CWAA 1QUQB 5IYCH 4A4IA 1EYGA 1VQ7A 3G6EA 5IP9G 3AYHB 4KLKA 1VQPA 1XNRQ 5JJIA 2WP8J 3HOWH 1WCMH 3DM3A 4X62Q 3CC4A 3TREA 4ME3A 2VS1A 2UXCQ 2R93G 4AYBG 2CFMA 1D8LA 2Y0SG 5GAHC 1VQKA 3CCQA 4JBMA 1VQOA 4B3SL 4BY1H 4A3EH 2JA9A 4DR2L 4JI5L 4J15A 3I4NG 2R7ZH 1D7QA 4GLXA 1OXVA 4LUVA 4DR6Q 4DNIA 3PO3G 1M1KC 4YY3L 5JEAG 3PUXA 2R92G 3TRZA 2WB1E 4JI2Q 1HNZL 2MO0A 4JYAL 2IX1A 4JG2A 3NELA 1KC8C 3J7A5 1BKBA 1N36Q 4GKJL 3H0GH 2K4KA 3G71A 1OTCA 5GROA 1X54A 1L0WA 4A3JG 1H95A 4X64Q 5FLXc 3RN2A 4MNOA 1FGUA 5EAYA 3DLLA 3PF5A 3GTKH 4GS3A 5IT9c 2DUDA 4A3EG 4WJ4A 4DV7Q 1VQ5A 1Q8KA 5C4XG 1Z47A 2IHEA 1N34Q 1E1TA 2GVAA 3VDYA 4B3TQ 3L7ZC 1EOVA 2OCEA 3AFPA 3STBC 2VQFQ 2VZAA 4A3JH 5GQOA 3CAMA 4APVA 2D62A 5HGQA 3LGJA 4DV2L 3RNUA 5M3MG 4UY8C 4PZ7A 3KJOA 3GTQH 4DR7L 1B70B 3U4ZA 4NXNQ 1LUZA 5IYBG 1ASYA 1C7YA 1FVIA 2N78A 3ER0A 4GOPC 2HIXA 3JAMc 1Q81C 2LXKA 2N49A 3NENA 3MEFA 2K5VA 1YITA 1PH7A 3HOYH 1GVPA 4JI4L 1VQLA 2K5NA 4BY7H 1E22A 2NZOA 1RL2A 2LXJA 3K0XA 4DUZQ 2KCMA 1YJNA 1QZHA 1N32L 4IJLA 4C3JH 1HNXQ 4A93H 1YVCA 3HOVG 3OTOL 3HOZH 1KIXA 2A8VA 1PFSA 5GAGC 3U50C 5GAEC 3CCEA 1A0IA 1VQBA 4BA2I 4WJ3M 4KHPQ 2R7FA 1Q7YC 1I50H 4LFAL 1Z9FA 2IT1A 3UE1A 2NN6I 2NVYH 4DK3C 4LW1A 5GADC 3GTGH 1CSQA 4XIGS 2A19A 2OTJA 1UE6A 2KENA 3CC7A 1XTDA 1VQEA 2JJQA 3UE0A 5C0XJ 2QEXA 3E9IA 3FHWA 4OWTB 3ULLA 1NE3A 2YTVA 4DAYB 4P72A 4JI3L 3OTOQ 4JI0L 4JI4Q 4ALPA 3HOVH 3F2BA 3HOZG 1HZBA 1I5FA 3PUZA 2HT1A 4YWMA 4DUZL 4A3IH 2L15A 1X3EA 3M4PA 2D0PA 2KHJA 1XMOQ 1RIPA 2I5HA 3K81C 3UDXA 1I3QH 4BXXH 1VQJA 4NXNL 1XNQQ 2K52A 4IPHA 1PHJA 1BBUA 1OXTA 3RLNA 5IY0A 4GKKL 4X6AH 4B3MQ 3PCOB 4JI1Q 4TVAB 3HKZE 1QZGA 1YIJA 3KF6A 4QL5A 1Q1EA 4R4CA 1B8AA 3T1YL 3PUWA 3HOUG 1SROA 4DR7Q 1VQIA 1Q82C 3CD6A 3D0FA 1Y1WG 2MFIA 3W5OA 2ZJPA 4P74A 4A3FG 1W2BA 1FJGQ 1IBLL 2F52A 2LSSA 2RCNA 5IP7G 4DV6L 3RR5A 4TQUS 4X66L 4GNXC 1XMQQ 2WAQG 1EQQA 3AQQA 5C4JH 1OXXK 2PQAA 1E3PA 2K14A 4JI8Q 5IE8A 1QUQA 1GD7A 4A3LG 3STBD 2Q2TA 2KCTA 4A3CG 4GLAC 4YWLA 1E1OA 2XTIA 3CCJA 3A5UA 1XNQL 3BZCA 1W3SA 4NXMQ 4GLVB 1YBYA 3PO2G 2HIVA 2NVTH 5M5YH 3FKIG 1P8LA 1JMCA 3HOXG 3K7UC 4X65L 3I4OA 3AFQA 1VS0A 2N8NA 2ZJQA 2RF4A 5J3BA 1N9WA 1A62A 2IHFA 4IPGA 4L5TA 1VQDA 4GOPA 4JV5L 1N33Q 1YI2A 4LF8L 4A3DH 5JEAJ 2IY5B 4JI7Q 1A8VA 3RLOA 2ZTDA 3PO3H 4DR5Q 3GTPH 4B3SQ 2E5LL 1UE7A 1V9PA 3H3VI 2NVXH 4A3CH 5C3EH 1PH3A 3A5ZB 2K75A 1IL2A 2YYZA 2UUAL 3KFUA 1KXLA 2VL6A 2F4VQ 4DR3Q 4B3TL 1HNXL 4A3DG 2Q2IA 3KDFA 4FDBA 5IYCG 1LTLA 1MJEA
chains in the Genus database with same CATH superfamily
4DR7L 4GN3B 4YHHQ 1SMXA 1W6JA 3J81c 1VQ4A 5LMNL 5C4HA 2A6HD 4RMFA 4ILWA 2FXQA 4L6TB 2PI2A 2K7VA 2AMCB 2PYKA 1KRSA 2RHQB 2AWOA 4JI2L 3GTLH 3GTQB 2B3GA 1E0BA 3T13A 1HA6A 2VY3A 5IP9H 1LTAD 3I4MH 3HOYB 3OIQA 4ZKBB 5AJ3Q 4DV1L 5BN3A 3FP9A 5EKKA 3J7YW 3PF4A 4DUYQ 4JBKA 1GUNA 3GTLB 1D5ZC 3RLFA 3K59A 3VR2A 2I0QA 2JXMB 3OW7A 4UAIA 4GNXA 1X3GA 3RZDB 4K2LA 3VYTA 1DOMA 3TP6A 5FJ8G 3MEHA 4P73A 1WVLA 3L2PA 3M85A 1NNXA 2JA8G 1D5XC 5C5LA 4OX9Q 3TP5A 1EY8A 3VYRA 3T1YQ 3H94A 2JA6B 2G9DA 2HHHQ 1EZ8A 4IOCA 2F3IA 3IAYA 2OQ0A 1XTCD 1WTOA 2R92B 1U4RA 3NE5B 1WTXA 1ICWA 4XTCS 2B2WC 2KBNA 4C3IB 2QILA 3MFGA 1R9TB 1EIFA 1BO0A 2UUAQ 2JA6H 2UXDL 4GZYC 4DV6Q 1EYAA 2AHOB 4ZAIA 1HCZA 3DMUA 2XN9C 1L1OC 4RWSC 4A3GH 2OXPA 3UDIA 2UUCQ 1L1OB 1I94L 1VQ6A 3EROA 4LF4L 1EQTA 3KDFB 1I6HH 1F2ZA 3J7ZC 3OW2A 1GHJA 3I56A 3G7LA 3M4YA 2JE6I 1KABA 2AKWB 4Y7NB 2NZ1D 1X32A 2ID0A 3KF8A 4A3GB 3AEVA 2PNHA 4PMWA 5ELFA 4ODGA 4QUFA 1D5MC 4DV3Q 4KD3A 4CJ0B 1Y1VH 2UUBL 2A6EC 3MXNB 4YCUA 3MAQA 4DF7A 3M4QA 5I9PA 5DEHA 1LT4D 1JE5A 3G48A 1HNWL 2LY7A 4KD4A 4OEMB 3GV3A 2Q2HA 2E5LQ 5K5PA 4RHRA 2G5DA 4KHPL 1B7YB 3X3MA 5FK9C 4B3ML 1XX8A 4KTAA 1EOTA 1PTOB 2K5HA 3HGBA 3KOJA 3CW2C 1XMOL 4IFDH 3E0EA 1HR0Q 5KNCA 1YNNC 3TMEA 2OTLA 4FXDA 1EWIA 2KHIA 4JI0Q 2F0KA 2VUMH 5C0XI 1CKOA 3NSWA 1K73C 4AH6A 1QVGA 4NB3A 4NDXA 1VQNA 1GXDC 1EYCA 1UE5A 1A3TA 2WKCA 1DONA 1VCIA 2XWJB 1JT8A 2WB1G 3CU7A 2UU9L 2NWGA 1S5FD 1I4XA 4ZQ3A 4HJAA 2VNUD 4QB4A 1DJRD 4MTNA 2F0HA 4Q0FA 2JA5H 2EYLA 2QA4A 1L2FA 2EOTA 4JYAQ 4LUOA 3CC2A 3SK4A 3MC0B 3FKIB 1B3QA 4YWKA 1RKNA 4R1JA 1SE4A 4H02A 1FNUA 4POFA 1L1OA 3ULJA 3A54A 1VF7A 2P5ZX 2PMZB 1CZWA 2F3VA 1IBKQ 5HGTA 3MXGA 4IUNA 1CTMA 1SDFA 1C4QA 2BCOA 2RSNA 3FKIH 1NBWA 1NMGA 3PMFA 1K83H 3TSSA 1HH2P 2CWPA 1HUMA 3IKJA 1I4RA 3SEBA 4EQOA 4X64L 1X9NA 4JBJA 4BY1G 4S3SA 3CQZB 5KYLA 2TSSA 2H1EA 3UDFA 4GKJQ 5CV8A 5LMNW 1T5EA 4A3BG 1KD1C 3ZJYC 3VYSA 1CHQD 2EQSA 2KEEA 4X62L 1EY4A 2QGQA 4CJ1B 3K5NA 1CKMA 3T56B 3FPPA 5BN5A 1EIGA 2RDFA 4BY1B 2ZXOA 4LWCA 4L5QA 4ZK9B 1X6OA 1CI3M 4PMCA 1LYLA 1NSNS 2AQ3B 1J5EQ 2J7ZA 4BA1I 3J81E 2ENBA 4L5SA 4R4IA 4HIDA 3PO2B 1FD7D 2D0OA 4DV5L 4O1NA 2ASBA 2B63B 1Y8NB 1SFOH 4LFBQ 5JJIA 1F9RA 4NPSA 1PRTB 1RDPD 2EJGC 4QY7A 4DR1L 1I94Q 1HQMC 5DNFA 4R4OA 2A69C 2IX0A 3IFDA 1KL9A 1SE3A 3OYYA 1KHIA 5CV9A 4EVOA 1TWHB 1KDCA 3A0JA 1N33L 4O2DA 1ZYRC 4ZUIA 1PH6A 1TS2A 4A3FB 3BJUA 2F0TA 4F87A 1EFWA 1X3FA 3ERQA 2UXBL 4BWGB 3KUPA 2Q2UA 1FR3A 2B63H 4KN7C 4RGNA 3CMEA 1SYGA 1VQGA 4A3EB 1QVFA 3D31A 3BZKA 1PH4A 5EKLA 3QJYA 5K36H 4A4IA 3AYHB 2JYOA 4I65A 2WP8J 5F2DA 3CC4A 3H0GB 3TREA 1PTOD 1F9PA 3A7LA 3KBGA 1D8LA 2Y0SG 1L0YB 3C1EA 2EY6A 4JBMA 4K5WA 3PO3B 1IW7C 4A3EH 3TN2A 5COYA 1OXVA 3FEWX 4LUVA 4WFN3 2EYHA 4YY3L 5JPNC 2F0PA 4JG2A 4HMJA 4GKJL 2KECA 3SVMA 3H0GH 3OPOA 3MXUA 2RBMA 1SYFA 2KUMA 3S9WA 4X64Q 3RN2A 4MNOA 1FGUA 4GS3A 4WORA 2L5TA 4WJ4A 5IOCA 1V8QA 5C4XG 1N34Q 5LL6X 5IT9L 3RUZA 4TRDA 2RDHA 3AFPA 2OCEA 3STBC 3CAMA 4APVA 4ZRZA 3WDNA 4L8JA 5EBDA 3SHLA 4DV2L 2PW7A 3LGJA 3NWTA 3GTQH 3NBIA 1CK1A 3BDOA 2E2DC 5IYBG 4DAVA 1C7YA 2N78A 3T51B 1RTOA 3JAMc 2N49A 3KLSX 1YITA 1PH7A 3HOYH 4JI4L 4BY7H 1E22A 3BVGA 3K0XA 4DUZQ 1YJNA 1WD1A 3OTOL 3BS1A 2A8VA 5GAGC 3U50C 3OMCA 1CHPD 1A0IA 4DU9A 1VQBA 4ULLA 1CA5A 3J80L 3H3VC 2OTJA 1I4QA 5CV4A 1XYIA 4FF2A 3IFTA 1PZKD 4X3UA 3CC7A 3GTPB 3A8IE 1GOZA 5IGBA 3UE0A 1MSHA 3E5SA 3FHWA 4K2KA 2ZXRA 3MXNA 4JI0L 4NKLA 4K14A 3HOZG 1STGA 2KA7A 4YWMA 2LMCB 1ILQA 3E3XA 2D0PA 2KHJA 1XMOQ 1X3PA 3UDXA 1ET6A 1U4MA 5IY0A 4GKKL 5CMDA 1HXYD 2F0JA 5ISRA 5C3EB 1K8OA 1QWYA 4QL5A 4FF3A 1B8AA 2JA8B 2GA4B 3AB9A 1H9JA 1SROA 2B2UA 4XYOA 1BCPF 5CGKA 1Y1WG 4V190 2MFIA 3W5OA 4P74A 1AEXA 1FJGQ 1IBLL 2LSSA 5IP7G 4DV6L 4TQUS 4X66L 3SXHA 2WAQG 4CKEA 5C4JH 3SK5A 3ND8A 2K14A 5I9OA 1QUQA 3OMGA 4DN4M 4A3LG 2XRSD 3TZDA 3E0JA 5KGUA 1STHA 2AQ2B 5EPLA 3I91A 4GLVB 4XDXA 4XQQA 3PO2G 1H9SA 1KLGD 1QNUA 3GP7A 3AFQA 5I2YA 3HOWB 5J3BA 1A62A 2IHFA 4IPGA 4GOPA 1G2TA 1SNCA 3R8BA 1N33Q 2OF1A 3H6MA 4A3DH 4A3IB 4JI7Q 5D65A 1AZPA 4B3SQ 1UE7A 3K5MA 3H3VI 2NVXH 1ESRA 2Q8TA 3N52A 2B8FA 1IL2A 2UUAL 3FDTA 2VL6A 1TY0A 2K04A 4H13C 1U4LA 2Q2IA 3S2HH 3HEJA 5E3FA 5ELNA 4DK1A 1JB3A 5C6AA 1ILPA 1CUKA 1BBXC 1TU2B 4JI1L 1K8GA 3S24A 1M8AA 2CH4A 3NP8A 5EPJA 1A63A 5FO8B 2B2UC 4LF6Q 4Z9CB 1C0AA 2ZTEA 1VQ9A 1UNSA 3QOLA 3MFYA 2NN6G 3CF5A 4R8NA 2MP1A 2ALYB 4HJ7A 1YJWA 1GUSA 2E76C 2O4XA 2R7DA 3TDQA 3TS2A 1Z7TA 1SR3A 5K36G 3HS0C 4ZYSA 4O42A 2A1AA 4LFAQ 4UPAA 1SSOA 3HOUH 4DV3L 3A74A 1EQVA 2JA5B 1O7ZA 2DGYA 5HURA 4IO9A 1S5CD 1AW7A 1HZCA 1LTGD 2CW0D 2XGTA 5LMUQ 5EQ0A 2M2LA 2L0CA 1K9MC 1VQAA 1TWFB 5HY6A 1EUJA 3W1BA 3CCSA 1NY4A 4HIOA 3HOUB 3C1FA 5CBEE 2VUMG 2PPBC 3BDLA 3U4VA 1D2BA 1PVOA 3MWYW 2C35B 4DV5Q 2F0FA 5M5WH 2EY2A 2YTXA 4JI7L 2B8GA 1PDQA 2EJFC 2LKVA 4DR1Q 4OIKA 4OL7A 2SOBA 2F4IA 3PIOA 5LMNQ 3WOEA 5JAVA 3D8GA 5M3FG 3DWQA 3I4MB 3J80c 1Q1BA 2F4VL 2V4DA 1BCPB 3SE0A 4PNYA 3S15H 4MTKA 3J80i 1KNAA 2KCNA 3QG1A 4FO2A 1NMFA 1WFQA 3GV6A 1YNJC 2WFWA 5FLMH 3BVZA 1BR9A 4KJNA 1LABA 1ZKOA 3VR6A 1DOLA 4QF4A 1A2TA 3RZDH 1X55A 3MTSA 5FKAC 4B3RQ 4G57A 4IQZA 3SK8A 3J80E 4FXKC 1QILA 4LF9L 1WCMG 4OGQC 4DKAC 2NYZD 3PV0A 1PH8A 5M3MB 4A3GG 1CKNA 2FINB 1SLJA 2G9HD 5A35A 1JB7A 1SBBB 2JN4A 1X56A 3BDCA 3V2TA 3PO2H 2B63G 5AFWA 1AP0A 4HIKA 4JBWA 2EJMA 4C3IH 1V1QA 1EU3A 1JICA 2DJFC 4CKCA 1LT3D 3J81i 1HZ9A 4AQYL 2A74C 1TS3A 1HFGA 2Z9HA 5C44B 4UP9A 1TWHH 5IP7H 2IWHA 1UWVA 4A3FH 4G4KA 2MNAA 1TQOA 3JAME 1RODA 4JI3Q 3NTHA 4NXML 1V1PA 5E4WC 4R4TA 2WAQE 4IFDG 1PFMA 3QOJA 3E9HA 1L0XB 4XT1B 2B2TA 5C4ZA 1GO3E 5IODA 1TWGB 4HEDA 2VQFL 3OWEB 4RGTA 3CCUA 1WJJA 5I6WA 1BVSA 4JC0A 4ME5A 1OO9B 3NXWA 2I5MX 3BVMA 5IYDG 1CQFA 3V96A 2PW5A 1S5BD 4PG3A 2YU9B 1EIYB 4HR7B 1I4PA 1PLFA 2EYJA 3CRKC 3F2UA 3T1HQ 2E2IH 3QO2A 5I4DA 1SJHD 4E6IA 1C9OA 4RHSA 4GN5A 3KJPA 1VQMA 2I5LX 3HKZB 1PTOH 1I4HA 1P16A 4DFAA 1HR0L 5C5MA 2K05A 3BG3A 2YU9H 1F77A 1O7IA 2E2HH 4LF7L 1PRTF 1ONLA 2OT2A 2QKIC 4F88A 5D3DA 4OO1G 3CP0A 1Y1VG 3NTIA 1IBML 1MKHA 1AFPA 3F8TA 4QIWE 2F0OA 1JC7A 2ICIA 1ICFB 2KOLA 4YHHL 4A3MH 1WTVA 1STBA 3S16B 4KK7A 1EYDA 3NBHA 3L0OA 4A3LH 1TY2A 2OQKA 4LF9Q 5C4XH 5KNDA 2HD3A 2R93H 4ZCKA 1YHBA 1TXYA 2PMZE 1XJVA 1ENAA 2JEBI 3TBIB 1NR2A 4LF5Q 1GM5A 1TIID 1Y8OB 1STYA 2VW9A 3I72A 3CPWA 2H4OA 2NTSA 1FYCA 5BN4A 1K28A 2UUCL 3PUYA 3U58A 4JVZA 5DM63 2EIFA 3UDGA 2R7ZB 4RH6A 1J5EL 2K1BA 4EX5A 3PIO3 4LUZA 1UEBA 2CVRA 1XPOA 1VQFA 4DV0Q 1KTKA 2IX3A 2HCIA 3HP3A 4DR3L 5C0XG 1IBMQ 2VQEQ 4LJZC 4QJFA 1NJIC 5M5XH 2LFNA 2CKZB 1EEID 2R6GA 2VB2X 2XWBB 1AZQA 1VQHA 4R8IA 4DR5L 2PCFB 3K7AH 2B2TC 4LFCQ 4A93G 2K5DA 1V43A 1B4OA 1XNRL 4L5RC 2BH8A 5C4JB 3I7FA 1K8AC 5C3WA 4POGA 5E1FA 5M5XB 3E6ZX 3A7AB 5JJKA 2F0DA 3ICEA 5IYBH 3EIVA 1VQCA 1ENFA 2CWAA 2SNSA 1HA5A 1YNJD 1Q3LA 3VR5A 3HOWH 1LTBD 5FLXE 1GUWA 5EPKA 1EY7A 2UXCQ 2R93G 4AYBG 4EGVA 5GAHC 2O5JC 3ZYYX 4B3SL 4J6HA 4IURA 2EYPA 2JA9A 4DR2L 5M9OA 4LK1C 2NVXB 5EKIA 5KNBA 1M1KC 2Y0SB 2N88A 3PUXA 5JEAG 1QG7A 3DM1A 1F2MA 4JI2Q 4DXFA 2L9HA 1JOQA 2F0SA 4JYAL 3BYTB 3OWFA 1B1ZA 3D6WA 3HOVB 4X3TA 1LTTD 3DWAA 1L0WA 4A3JG 5FLXc 3C46A 2BE5D 3PF5A 3R3OA 3GTKH 1B9MA 5IT9c 5L37A 2DUDA 2WINB 4DV7Q 1Z47A 2N55A 4HN7A 5CR3A 4B3TQ 1SNOA 3I73A 3L7ZC 3P20A 1EOVA 2EY1A 4A3JH 2FHTA 5GQOA 2I07B 4UY8C 3I4LA 5M3MG 4PZ7A 3KJOA 4N8X1 1ASYA 2ZT9C 3IL8A 1R4PB 3ER0A 2FFKB 5E4XA 2LXKA 1Q81C 2HQEA 1GVPA 3X3NA 3FVQA 3MXPA 5I6YA 1G6ZA 1JWUD 2LXJA 2B2YC 4CDDC 1N32L 1Y8PB 4A3JB 5IGEA 4X3SA 1YVCA 2AUKA 3HOVG 4G7OC 1K0SA 3CCEA 3MVVA 1I6VC 5JVH3 2R7FA 4KMUC 3UE1A 2NN6I 2NVYH 2A19A 4XXEA 1UE6A 2KENA 5A2QE 1VQEA 4KKUA 3E9IA 4EQPA 4OWTB 3ULLA 1NE3A 4AYBB 2OEOA 3BZDB 5D14A 3OTOQ 2F0NA 2O5IC 3F2BA 3PUZA 5EGTA 2HT1A 1X3EA 2I5HA 3K81C 1I3QH 2K52A 1BBUA 1OXTA 3RLNA 4X6AH 4JI1Q 4TVAB 3HKZE 2Z6BA 3T16A 4B08A 1YIJA 4R4CA 1D6EC 3EFXD 2DNCA 1XWEA 4BY7B 3S15B 3P1HA 1MHWC 3NK9A 2F52A 5J39A 3RR5A 1BNZA 1I3QB 2KCCA 1XMQQ 4XT3B 1HTPA 1QNKA 1D1KA 2RKSA 2Z4IA 4A3CG 2KCTA 2HDLA 5EBCA 1E1OA 4BS9A 4KKTA 3A5UA 4HTHA 4JW0A 1YBYA 3DWPA 2CHBD 2D2CC 5M5YH 1P8LA 4X65L 1VS0A 1SMYC 2N8NA 1DOKA 5I2XA 4N9PA 4L5TA 4CGYB 1C48A 3R93A 2IY5B 5JEAH 3RLOA 2FJ2A 2IW3A 1EIHA 4H44C 4DNRB 3CHBD 4A3CH 5C3EH 3A5ZB 4XQNA 2CH4W 3EVQA 3R2IA 2D5DA 4P2CB 3I70A 1HNXL 5ELEA 2DJGC 1CFMA 5C44H 3J7AF 2IPKD 2WV6D 4PZ6A 3GTJH 3ONAB 2XRQD 2Q8IB 4M8AA 2R92H 1YEZA 1GUGA 4B3RL 5E7NA 1G51A 4K8IA 2F1MA 1FGBD 1MBYA 1OXSC 4CDEC 4KI0A 4A3IG 4J8QA 1PH5A 1CT1D 1TWGH 1FNVA 4DR6L 1MSGA 4PMBA 4PZ8A 3TQYA 1WTRA 1WOCA 4DGZA 3GTJB 4NW2A 1PYSB 3PUVA 3VA5A 3R2TA 4X65Q 4DAMA 4DAPA 2E8GA 1SYBA 4JI6L 3S1QH 1RCVD 4G7ZC 4KHZA 2XNAC 3HKZG 5IYDH 2NN6H 3A8KE 3MHBA 2WAQB 1SYEA 2IL8A 1PRTC 5FO9B 1NR4A 1T9HA 1B2TA 3OSOA 1CSPA 4DK0A 3KYHC 4MN3A 5JJLA 3JC66 3NBHB 1MGSA 2KQ3A 1YNXA 2NVQH 1G6PA 1B53A 1G2SA 1FL0A 4MHEA 3HKSA 3D4DA 2L11A 4KY6A 5LMUL 1STAA 3EQLC 2ES2A 3K8AA 3PGZA 2C5CA 3IRBA 4IUTA 4RCOA 3BU2A 5CC4A 4K6DA 1MD2D 2H5XA 4C3IG 5CBAE 3NHHA 4P75A 1E2VA 3S14H 1IBKL 5IIFA 4A3MG 2R93B 1SEBD 4IPDA 1DD2A 3TEHB 5LHY1 4IZ8A 3S1RB 4IFDI 4R9WA 1S40A 4ID6A 1BBWA 1RHPA 5JOBA 5C44G 1Q86C 4HSVA 1AE2A 1EWHA 2JA6G 3W2DA 2PZWA 4HJ5A 1FJGL 1VDZA 1PFBA 1A15A 3GTMB 1IYJB 3S14B 1TWFH 1XPUA 3EN2A 1W6KA 3G6JB 1SNPA 4NMZA 1F9SA 2AWNA 1JJGA 1KAWA 4DPGA 2KEDA 1PH1A 1DXMA 4BBRG 4RAUC 3F2DA 1F2LA 2F0LA 4OWXB 3GTMH 1U5KA 1PFNA 1EY6A 5ELOA 4IUPA 1XMQL 1SE8A 3HZXA 4UHVA 3DEPA 1AE3A 4CHTB 1JQYD 2BA1A 1CKNB 4C3HH 3S1NB 1HZAA 2KVMA 4AIMA 2X6GA 2HDMA 1EFID 3VR4A 1RF2D 3I4NB 4KN4C 3D6CA 2C9OA 4YY3Q 2B29A 3KBXA 3I4MG 2HQLA 1IYUA 4JOIA 5M3FB 1WTPA 2A6HC 3Q8DA 5CORA 1XPRA 5KYIA 1IW7D 5FO7B 1PH2A 1ML0D 2HUGA 5EJWA 1HNWQ 1Y69U 4X66Q 2E2JH 1LACA 3I2ZA 1VMCA 1IKLA 1K3BC 1U4PA 1GKHA 2V1CC 2MJ8A 1AH9A 1PZID 4GKKQ 1A6XA 1BQQT 1JJCB 3U9SA 3GTOB 4Y7NH 2Z6KA 4N9TA 1BOSA 3WOFA 3TP7A 3M7GA 4AYBE 2JQOA 4K6LA 2A68C 4FYDA 1EY5A 1Y1VB 2ZTCA 2E2JB 1K3RA 2J0TD 2YTYA 3DEOA 1SJED 1WTWA 4JCVE 3CCRA 4JI8L 2Z6KC 4QQBX 1PXUA 5J22A 4OWWB 3Q0AA 1YJ9A 2EYFA 3M9BA 4IUQA 3EA6A 1DGSA 2VQEL 3NTKA 1BXTA 4GN4B 4G7HC 1MJCA 4A3KG 4A3BH 1HFNA 1GUOA 2NTTA 4BBSB 4A76A 2Z1CA 2MQHA 3WWVA 4OX9L 1X3QA 2PQAB 1KRTA 1HJPA 3SGIA 4JI5Q 3ERSX 4DV2Q 1LTRD 2Z0SA 3KF8B 2JA7G 3S17H 2E2IB 4LF8Q 4A3BB 1PYWD 1QE6A 4LF5L 4N8FA 4C2MB 1JORA 3EBEA 2CQOA 4OONA 1WYDA 3KF6B 4FVMA 3QB3A 2F0VA 3U9OA 2E74C 4Y52H 2F0UA 2ZM6Q 3QIAA 1EZ6A 1NCVA 5CV6A 1QCBD 3CMAA 2SEBD 2VB3X 3HFZB 4K0KQ 3HOWG 3K6OA 4OIJA 1PRTD 3GDEA 1BDOA 5IGCA 4DAYA 5JJZA 2YV5A 2CQAA 2MO1A 3S16H 1STNA 2LS01 4LF7Q 4V0BA 1RD9D 4LFCL 4AQYQ 3NUCA 3JAMi 3RZOB 1IYVA 3GD7A 1BF4A 5LL6S 4HIMA 3OOCA 1PTOC 1WCMB 4RKBA 3H15A 1PV4A 4K0KL 5BR8L 2HCCA 2QCPX 4KHVA 1TS5A 3ULPA 2K5QA 2K28A 4DUYL 3I8ZA 1WI5A 5DM73 4IPCA 3I3CA 2CCZA 1YNND 5IYCH 1QUQB 1VQ7A 5M5YB 3FPUB 1XNRQ 1WCMH 3DM3A 2EPBA 2VS1A 1T5XD 5T1GA 4C3JG 1VQKA 4BY1H 2D9UA 4J15A 4JI5L 3I4NG 1D7QA 4GLXA 4CDFC 3KLRA 2O2LD 3UI2A 3TRZA 2WB1E 3FMCA 2IX1A 3NELA 5D3IB 1B44D 2K4KA 3A55A 3G71A 4HMIA 5GROA 2X6LA 1BUVT 4MIUA 4WRDA 3DLLA 5EAYA 5FOBB 2K5WA 1SFOB 1WD0A 1DM0B 2IHEA 4RA8A 1E1TA 1G8ZD 3Q24A 4FXGC 2EYMA 4BBRB 1ENCA 3M4OB 2D62A 3L3OC 5HGQA 3RNUA 1B70B 3U4ZA 1LUZA 2MUYA 1F9QA 1FVIA 2HIXA 3MEFA 2ZXPA 1SMYD 2L1BA 4QIWB 2NZOA 1RL2A 1BCPD 4IJLA 4C3JH 1JOOA 3O13A 1HNXQ 2B39A 4A93H 2QEJC 3HOZH 4XYQA 1PFSA 3EJIA 4BA2I 4KHPQ 1Q7YC 1I50H 4LFAL 2IT1A 1VF5C 4LW1A 1HHVA 4XIGS 3GTKB 1PMRA 4RCNA 5C0XH 5ELDA 3TZUA 2JSOA 4JPBW 4RFBA 5J1ZA 4DAYB 4C3JB 4JI4Q 2MHVA 1KNEA 4ALPA 4F7XA 1HPCA 2A68D 2DNEA 4DUZL 3M4PA 3P75A 2RCFA 2EE1A 1RIPA 4OHJA 1VQJA 1LT5D 2J4XA 4NXNL 4IPHA 2WKDA 1QZGA 3LX0A 3DUZA 5ELCA 1VQIA 3H91A 4M1UB 5ELBA 3PQIA 4Q5VA 4A3FG 1W2BA 1I4GA 3HG9A 2M9VA 4IUVA 3AQQA 2XVSA 2PQAA 1E3PA 2A69D 4JI8Q 2FMMA 4IN3A 1GD7A 3KLSA 1NAPA 1RTNA 3P7JA 3BZCA 1ZYRD 4NXMQ 1KDBA 1SXTA 2L12A 4QMGA 2NVTH 3K7UC 3I4OA 1IL8A 1UEAB 4OO1H 1N9WA 1Z6HA 1VQDA 5JEAJ 1A8VA 3MA2B 2I46A 1JE4A 1Y1WB 3VR3A 3GTPH 1U9RA 2E5LL 1V1OA 2QDBA 1DCZA 3DXJC 2K75A 3KFUA 1A3UA 2F4VQ 4H0LC 1RJTA 5M5WB 4FDBA 5IYCG 1LTLA 4LMQD 3KLWA 5FLMG 1U0LA 4FF1A 2UXBQ 1YHQA 4C3HB 1Y1WH 1PTOF 3S1NH 1SRUA 3B6YA 1LV9A 1N36L 2JA8H 1TWAB 3NQIA 4QGUA 3ND9A 2SDFA 2B2YA 3I4NH 5AJ3L 4DV1Q 1LTID 4MZ9A 4LF4Q 3JAML 2K03A 1KAAA 3TP8A 3CXCA 5M3FH 1G291 2OWOA 1Q12A 1M90C 2PO4A 3NEMA 4J1MA 2NUCA 1J9OA 3VA7A 2DY8A 2UXDQ 1IZ6A 4JV5Q 4UP7A 4EQ5A 1TWAH 4IOAA 1QOHA 5G3LF 3J7AV 5CV7A 3W1GA 5H1SE 1R9TH 1ASZA 2AQ1B 1ZEQX 4RG1A 1JCKB 1S3OA 3K80C 1ET9A 1HR0W 1TR5A 3C2PA 2WIIB 1OXUA 2BA0A 4K5VA 1K0RA 1A2UA 4HCEA 2RVLA 2HHHL 2EXDA 1WTHA 1I6HB 3D4WA 3GTGB 2RHSB 5BR8Q 2X69A 4BY7G 2JP1A 4I7AA 2E75C 4JK1C 4ZLTF 2MGSA 3CKIB 4QUCA 3G4SA 2K6AA 3TS0A 1SE2A 3K58A 1Q46A 4DV4Q 4GOPB 2XIWA 2NB0A 1LM0A 4LF6L 1KQSA 1PYBA 1H9SB 3GO5A 3T1HL 1GHKA 5A2QL 3M3YB 3S1MH 1SNQA 4JOIC 1O7YA 4EQNA 2JK8A 1K8MA 4A3KH 2GN5A 2F3WA 3V05A 1QJOA 3H0GG 4DV4L 2L55A 1HNZQ 1Y14B 5DLQE 2ATWA 3NQTA 1E7ZA 3S17B 2PI2E 2FMCA 3M3YH 3QR8A 3AU7A 2JEAI 2EDGA 2K50A 3PIP3 3MZ5A 2VUMB 4C56C 4C2MH 1BCPC 2DN8A 2QF7A 1SNMA 3K5LA 4FF4A 1X65A 4YIJA 1QVCA 4LNQA 3H3VH 2JA5G 4JI6Q 4YCVA 2Q8RE 3CPFA 2B2WA 3OHXC 1CQVA 1EQRA 2WACA 2NZHA 4IUUA 2DY7A 1IBLQ 2Y0SE 3GQBA 2BOSA 1TT2A 1E2WA 1M4VA 3RZOH 3S1RH 1N32Q 1IKMA 4OO1I 4IFDJ 1MIUA 4DR4L 3A56A 4A3MB 3PSIA 4CJ2C 5KEEA 3PIPA 5IGFA 1VQ8A 3D4RA 2F03A 2F0MA 4RKLA 3SK6A 4C3HG 2JA7B 3NWSA 1K83B 4ZUJA 2GVBA 4P71A 2A73B 1EEFD 4UP8A 1H9RA 2Z8LA 3LWEA 2R61A 1KLUD 4DV7L 3CQZH 5FLXL 2QDLA 3F1ZA 3A8JE 3Q23A 3CCLA 4BBSG 3CCMA 1LTSD 1GJXA 5M3MH 2BE5C 1B9NA 3SDZA 2JA7H 1STEA 4WJWA 2Z4HA 1J8IA 1DZ1A 1O7LA 2N3SA 2RA4A 5JVG3 4R4QA 1F2YA 4CKBA 5T1IA 3N6RA 4DR2Q 2PNRC 3K5OA 3BYYB 5IWAL 1HRJA 1EY0A 1YZ6A 3J81j 1C8CA 2UXCL 2CW0C 3HOYG 4IJHA 4KV6A 3M7NA 4LFBL 1EL0A 1N34L 4NP5A 2A6ED 2EYOA 2R3ZA 1JJ2A 1YHAA 4BBRH 3M4OH 4FP5D 2F0WA 5TSSA 1S5ED 5IWAQ 2R7ZG 2NBFA 4TSSA 5C3EG 4O0AA 1EU4A 3LNNA 3I55A 3K57A 5CV5A 1QB5D 4HJ8A 3CRLC 3VYUA 1IXRA 3GTOH 4HSPA 4DNTB 1S72A 4RGMA 4I7ZC 2F0IA 2IJ0A 2K33A 1PH9A 3HOZB 1A3VA 1J6QA 1EY9A 2K01A 4HAEA 3HOXH 4QCLA 3HRZC 4TKOB 2UU9Q 3C3LA 4OELB 5FJ8H 3QWNA 2UUBQ 1R4QB 4GNXB 4HJ9A 3S2DB 2ZJRA 1TKWB 1N8RC 3D3RA 1SYCA 1E24A 2ZM6L 3HOXB 5KIXA 1ESFA 3F2CA 2VXWA 5IGGA 5DAUA 4DR4Q 3DHQA 2E2HB 1UE1A 1TWCB 4BBSH 1NTGA 1SAPA 3S2DH 4L63B 2RSOA 4YCWA 3CCVA 4X3KA 5C3XA 4K8JA 3RD4A 4B9XA 3ITPA 4BXXG 2QW7A 1SN8A 4DK6C 1HUNA 4KJOA 1HQRD 4C1NI 4A75A 4RGOS 1JR0D 4ZKCB 1LLRD 1DYQA 1PA6A 5C4XB 5IGDA 1TWCH 1UAPA 3RN5A 2A5HA 4K5XA 4DV0L 4OXPA 2BH2A 4KKSA 5KRUA 1JWSD 1LT6D 1D1IA 1EWCA 1AN8A 2XSCA 1EYGA 2NVTB 2F0QA 3G6EA 5IP9G 4KLKA 1VQPA 4PQXA 4X62Q 2EY5A 4ME3A 3KK7A 2F0EA 2CFMA 3CCQA 1VQOA 2BDNA 2NVYB 1NUCA 2L4NA 2R7ZH 1Q8IA 3W3AA 4DR6Q 4DNIA 3PO3G 1XXGA 2R92G 2B2VC 2EVBA 4CDCC 1HNZL 2KJXA 2MO0A 3SR1A 1CA6A 1KC8C 3J7A5 1BKBA 1N36Q 1MI2A 1O80A 1JOKA 1OTCA 1X54A 2K32A 1H95A 4B9WA 3Q6SA 2KHSA 4DA2A 4A3EG 2B2VA 1VQ5A 1Q8KA 4LAAA 1E2ZA 2GVAA 3VDYA 1SYDA 4F8MA 3K7AB 2VQFQ 1LO5D 3T53B 2VZAA 2MPMA 5CYUA 1IHZA 4NXNQ 3T4AC 4C1NK 4GOPC 1GUTA 3NENA 2K5VA 1H9KA 4ABNA 3FRPB 5IT9E 1VQLA 2K5NA 3LWUA 4XQJA 2KCMA 3L9AX 3NPPA 1QZHA 1S5DD 4PV1C 1KIXA 1II3A 1VMPA 5GAEC 1CM9A 4WJ3M 2TMPA 1Z9FA 5GADC 3GTGH 4DK3C 1CSQA 1ZXTA 1XTDA 5C0XJ 2JJQA 2QEXA 1PZJD 1O78A 2YTVA 1TS4A 4P72A 4JI3L 5G3LD 3I90A 3HOVH 1HZBA 1I5FA 3J81L 4KY7A 3URYA 4A3IH 2L15A 3RMHA 4A3DB 4UDUC 2EZVA 4DXGA 4BXXH 2F0GA 1XNQQ 1PHJA 1G91A 4B3MQ 3PCOB 4H7BA 1Q90A 3S1MB 3KF6A 5JPMC 1Q1EA 5NUCA 3T1YL 3PUWA 4FNFA 3HOUG 4DR7Q 3CD6A 1Q82C 3D0FA 4KY5A 4A3KB 4U673 1CZGA 2ZJPA 3S2HB 4U68A 1FNWA 2PQEA 2RCNA 1WTQA 4GNXC 4A93B 2EXZA 1EQQA 1OXXK 1UUPA 5IE8A 2SNMA 3STBD 2Q2TA 1I50B 1V1PB 4GLAC 4YWLA 1JWMD 2XTIA 3CCJA 1XNQL 1W3SA 4CBVA 1B3AA 1S4ZA 3OIPA 3S1QB 2HIVA 3FKIG 1JMCA 2RQXA 3HOXG 1TVXA 2ZJQA 2ICEC 1KDAA 2RF4A 4IALA 4JV5L 1YI2A 2RDGA 4LF8L 2M00A 3H09A 2AUJD 2ZTDA 3PO3H 4DR5Q 4HCSA 1H9MA 1V9PA 3AMUA 2PZTA 1B50A 1PH3A 2YYZA 2WB1B 3Q22A 1KXLA 1SNDA 2PZUA 4DR3Q 1HTLD 4B3TL 2NVQB 4A3DG 3KDFA 1MJEA 3K0YA 2BDOA
chains in the Genus database with same CATH topology
5ELNA 4GN3B 3KLWA 1SMXA 5FLMG 4YHHQ 1U0LA 3J81c 1VQ4A 5C44H 1YHQA 3S1NH 1Y1WH 1CUKA 5LMNL 2UXBQ 4PZ6A 1SRUA 3GTJH 3B6YA 4JI1L 1N36L 4RMFA 1K8GA 3S24A 2JA8H 4QGUA 1YEZA 2FXQA 2R92H 4B3RL 5E7NA 1A63A 1G51A 2PI2A 4LF6Q 3I4NH 1OXSC 2ZTEA 4MZ9A 5AJ3L 4DV1Q 4LF4Q 1C0AA 1VQ9A 2AMCB 4KI0A 3CXCA 1KRSA 2RHQB 4A3IG 5M3FH 1G291 2AWOA 4JI2L 3GTLH 1PH5A 2OWOA 1Q12A 1M90C 2B3GA 1TWGH 3NEMA 2NN6G 4DR6L 2VY3A 4PZ8A 3CF5A 3TQYA 1WOCA 1YJWA 2ALYB 4HJ7A 1IZ6A 5IP9H 4JV5Q 2UXDQ 2R7DA 3I4MH 4UP7A 3TS2A 1PYSB 1SR3A 1TWAH 3PUVA 4EQ5A 4IOAA 5K36G 4X65Q 3W1GA 5H1SE 2A1AA 4DAMA 4LFAQ 1R9TH 2E8GA 4UPAA 5AJ3Q 4RG1A 4DV1L 1ASZA 3HOUH 1S3OA 3FP9A 3K80C 4DV3L 4JI6L 3S1QH 3A74A 4KHZA 1HR0W 3PF4A 4DUYQ 4JBKA 1OXUA 3HKZG 5IYDH 2BA0A 3RLFA 2I0QA 1K0RA 2DGYA 4IO9A 2HHHL 2EXDA 4GNXA 1HZCA 2XGTA 1X3GA 5LMUQ 1T9HA 2RHSB 5BR8Q 1K9MC 1VQAA 4BY7G 5HY6A 1CSPA 1EUJA 3KYHC 3W1BA 5FJ8G 4P73A 3CCSA 1NY4A 4HIOA 5JJLA 3L2PA 3M85A 2JA8G 2VUMG 3JC66 3NBHB 3G4SA 4OX9Q 3U4VA 3T1YQ 1YNXA 2NVQH 1PVOA 1G6PA 2C35B 4DV5Q 3TS0A 5M5WH 2HHHQ 2YTXA 1Q46A 1FL0A 4DV4Q 4JI7L 3HKSA 4GOPB 4DR1Q 4IOCA 2F3IA 5LMUL 2OQ0A 1LM0A 4LF6L 2ES2A 3K8AA 3PIOA 3PGZA 5LMNQ 1KQSA 3IRBA 1PYBA 3GO5A 3BU2A 3T1HL 5M3FG 4XTCS 3S1MH 2H5XA 4JOIC 3J80c 1Q1BA 2JK8A 2F4VL 2KBNA 4P75A 3S14H 1IBKL 1EIFA 4A3KH 4A3MG 2GN5A 2UUAQ 2JA6H 3S15H 3J80i 4IPDA 2UXDL 3TEHB 4DV6Q 3H0GG 1NMFA 4DV4L 4IFDI 1WFQA 1S40A 1HNZQ 1BBWA 5C44G 2AHOB 1Y14B 2WFWA 5DLQE 5FLMH 2ATWA 1Q86C 1E7ZA 1L1OC 4A3GH 3UDIA 2UUCQ 2PI2E 1AE2A 1L1OB 1I94L 2JA6G 1VQ6A 4LF4L 3M3YH 1FJGL 4HJ5A 3KDFB 2JEAI 1I6HH 2K50A 3J7ZC 3RZDH 1X55A 4B3RQ 1IYJB 4C2MH 3OW2A 1TWFH 1XPUA 3EN2A 3I56A 4LF9L 1WCMG 4DKAC 2JE6I 2AWNA 1X65A 2AKWB 1KAWA 3PV0A 1PH8A 1JJGA 2ID0A 1QVCA 4DPGA 1PH1A 4LNQA 3H3VH 4A3GG 3AEVA 2PNHA 4PMWA 2JA5G 4BBRG 1CKNA 4DV3Q 3F2DA 4YCVA 4JI6Q 1SLJA 1Y1VH 1JB7A 2UUBL 3MXNB 3CPFA 4YCUA 1X56A 4OWXB 3GTMH 3PO2H 1U5KA 2B63G 1EQRA 5ELOA 3M4QA 1XMQL 1SE8A 4HIKA 4JBWA 1JE5A 2NZHA 3G48A 1V1QA 4C3IH 1HNWL 1IBLQ 2E5LQ 2Q2HA 1AE3A 3J81i 2Y0SE 1HZ9A 4AQYL 1B7YB 4B3ML 3RZOH 4KHPL 3S1RH 1N32Q 2BA1A 4OO1I 1CKNB 4UP9A 1TWHH 4C3HH 2K5HA 3KOJA 1HZAA 5IP7H 3CW2C 1XMOL 4IFDJ 1MIUA 1UWVA 4DR4L 3E0EA 1HR0Q 4AIMA 4A3FH 2MNAA 2OTLA 1EWIA 3PSIA 2KHIA 4JI0Q 4JI3Q 4NXML 4YY3Q 2VUMH 2B29A 3PIPA 5C0XI 3I4MG 1CKOA 2HQLA 1VQ8A 4IFDG 4R4TA 2WAQE 4JOIA 1K73C 3E9HA 4AH6A 1QVGA 4NB3A 3Q8DA 1XPRA 1GO3E 1VQNA 1UE5A 2VQFL 1PH2A 1HNWQ 2GVBA 4P71A 4UP8A 3CCUA 1VCIA 4X66Q 1WJJA 2E2JH 1BVSA 3I2ZA 4JC0A 1JT8A 2WB1G 5IYDG 2I5MX 4DV7L 3CQZH 2UU9L 1GKHA 2V1CC 1AH9A 3F1ZA 3CCLA 4HJAA 4GKKQ 4BBSG 3CCMA 2VNUD 4PG3A 1JJCB 1EIYB 4MTNA 4Y7NH 2Z6KA 4AYBE 2JA5H 5M3MH 2JQOA 2QA4A 1L2FA 2JA7H 3T1HQ 2E2IH 4JYAQ 4LUOA 3CC2A 2N3SA 2ZTCA 1C9OA 1K3RA 2YTYA 4GN5A 3KJPA 4R4QA 2I5LX 1VQMA 4YWKA 1P16A 4R1JA 4DR2Q 1HR0L 5IWAL 4H02A 4POFA 1YZ6A 4JCVE 3CCRA 4JI8L 2Z6KC 3J81j 1L1OA 3ULJA 4OWWB 2YU9H 4QQBX 2UXCL 1YJ9A 3HOYG 1O7IA 4IJHA 2E2HH 4LF7L 3M7NA 4LFBL 3M9BA 1N34L 1IBKQ 1DGSA 2VQEL 4OO1G 3CP0A 1Y1VG 1IBML 1MKHA 4GN4B 1JJ2A 3F8TA 4QIWE 1YHAA 4BBRH 3FKIH 3M4OH 1NBWA 1NMGA 1MJCA 1K83H 4A3MH 4A3KG 1HH2P 2CWPA 4YHHL 4A3BH 5IWAQ 2R7ZG 1X9NA 4X64L 4A76A 4JBJA 4BY1G 3L0OA 4A3LH 2OQKA 4LF9Q 5C4XH 5C3EG 4O0AA 2R93H 2MQHA 3I55A 1YHBA 1TXYA 2PMZE 3WWVA 4HJ8A 1XJVA 3UDFA 4OX9L 4GKJQ 2PQAB 1KRTA 1HJPA 2JEBI 3SGIA 3ERSX 1IXRA 5LMNW 4DV2Q 4JI5Q 3GTOH 4A3BG 1KD1C 2Z0SA 3KF8B 2JA7G 3ZJYC 1S72A 4LF5Q 1GM5A 3S17H 1PH9A 4LF8Q 2VW9A 1J6QA 2EQSA 4X62L 4LF5L 2QGQA 3CPWA 3HOXH 2UU9Q 1CKMA 3EBEA 2CQOA 2UUCL 3PUYA 5FJ8H 4OONA 3U58A 2UUBQ 1WYDA 3KF6B 4GNXB 4HJ9A 2EIFA 3UDGA 4LWCA 4Y52H 2ZM6Q 1J5EL 4L5QA 4EX5A 4LUZA 2ZJRA 1N8RC 1UEBA 1X6OA 3CMAA 1XPOA 1E24A 1LYLA 3HFZB 4K0KQ 3HOWG 2ZM6L 1J5EQ 1VQFA 4DV0Q 3GDEA 4BA1I 4L5SA 4R4IA 3F2CA 5C0XG 4HIDA 4DR3L 1IBMQ 2YV5A 2VQEQ 2MO1A 4DR4Q 2D0OA 4QJFA 4DV5L 1NJIC 3S16H 1UE1A 2ASBA 5M5XH 1SFOH 4LF7Q 2CKZB 1NTGA 4BBSH 4LFBQ 4QY7A 4NPSA 2R6GA 4DR1L 1I94Q 3S2DH 4YCWA 3CCVA 4LFCL 4R4OA 4AQYQ 2IX0A 1VQHA 3JAMi 1KL9A 4DR5L 3OYYA 3GD7A 3K7AH 1KHIA 4LFCQ 4BXXG 4A93G 1SN8A 3A0JA 4DK6C 1N33L 4A75A 1V43A 4HIMA 4O2DA 1PH6A 1XNRL 3BJUA 1EFWA 3H15A 1PV4A 1X3FA 2BH8A 4L5RC 2UXBL 4K0KL 2Q2UA 3I7FA 1K8AC 1PA6A 5BR8L 4POGA 1TWCH 2B63H 3CMEA 3ULPA 3RN5A 1VQGA 1QVFA 4DUYL 4DV0L 4OXPA 5JJKA 3ICEA 2BH2A 1WI5A 3D31A 5IYBH 4IPCA 3BZKA 3EIVA 1PH4A 3S2HH 2CCZA 1VQCA 2CWAA 1QUQB 5IYCH 4A4IA 1EYGA 1VQ7A 3G6EA 5IP9G 3AYHB 4KLKA 1VQPA 1XNRQ 5JJIA 2WP8J 3HOWH 1WCMH 3DM3A 4X62Q 3CC4A 3TREA 4ME3A 2VS1A 2UXCQ 2R93G 4AYBG 2CFMA 1D8LA 2Y0SG 5GAHC 1VQKA 3CCQA 4JBMA 1VQOA 4B3SL 4BY1H 4A3EH 2JA9A 4DR2L 4JI5L 4J15A 3I4NG 2R7ZH 1D7QA 4GLXA 1OXVA 4LUVA 4DR6Q 4DNIA 3PO3G 1M1KC 4YY3L 5JEAG 3PUXA 2R92G 3TRZA 2WB1E 4JI2Q 1HNZL 2MO0A 4JYAL 2IX1A 4JG2A 3NELA 1KC8C 3J7A5 1BKBA 1N36Q 4GKJL 3H0GH 2K4KA 3G71A 1OTCA 5GROA 1X54A 1L0WA 4A3JG 1H95A 4X64Q 5FLXc 3RN2A 4MNOA 1FGUA 5EAYA 3DLLA 3PF5A 3GTKH 4GS3A 5IT9c 2DUDA 4A3EG 4WJ4A 4DV7Q 1VQ5A 1Q8KA 5C4XG 1Z47A 2IHEA 1N34Q 1E1TA 2GVAA 3VDYA 4B3TQ 3L7ZC 1EOVA 2OCEA 3AFPA 3STBC 2VQFQ 2VZAA 4A3JH 5GQOA 3CAMA 4APVA 2D62A 5HGQA 3LGJA 4DV2L 3RNUA 5M3MG 4UY8C 4PZ7A 3KJOA 3GTQH 4DR7L 1B70B 3U4ZA 4NXNQ 1LUZA 5IYBG 1ASYA 1C7YA 1FVIA 2N78A 3ER0A 4GOPC 2HIXA 3JAMc 1Q81C 2LXKA 2N49A 3NENA 3MEFA 2K5VA 1YITA 1PH7A 3HOYH 1GVPA 4JI4L 1VQLA 2K5NA 4BY7H 1E22A 2NZOA 1RL2A 2LXJA 3K0XA 4DUZQ 2KCMA 1YJNA 1QZHA 1N32L 4IJLA 4C3JH 1HNXQ 4A93H 1YVCA 3HOVG 3OTOL 3HOZH 1KIXA 2A8VA 1PFSA 5GAGC 3U50C 5GAEC 3CCEA 1A0IA 1VQBA 4BA2I 4WJ3M 4KHPQ 2R7FA 1Q7YC 1I50H 4LFAL 1Z9FA 2IT1A 3UE1A 2NN6I 2NVYH 4DK3C 4LW1A 5GADC 3GTGH 1CSQA 4XIGS 2A19A 2OTJA 1UE6A 2KENA 3CC7A 1XTDA 1VQEA 2JJQA 3UE0A 5C0XJ 2QEXA 3E9IA 3FHWA 4OWTB 3ULLA 1NE3A 2YTVA 4DAYB 4P72A 4JI3L 3OTOQ 4JI0L 4JI4Q 4ALPA 3HOVH 3F2BA 3HOZG 1HZBA 1I5FA 3PUZA 2HT1A 4YWMA 4DUZL 4A3IH 2L15A 1X3EA 3M4PA 2D0PA 2KHJA 1XMOQ 1RIPA 2I5HA 3K81C 3UDXA 1I3QH 4BXXH 1VQJA 4NXNL 1XNQQ 2K52A 4IPHA 1PHJA 1BBUA 1OXTA 3RLNA 5IY0A 4GKKL 4X6AH 4B3MQ 3PCOB 4JI1Q 4TVAB 3HKZE 1QZGA 1YIJA 3KF6A 4QL5A 1Q1EA 4R4CA 1B8AA 3T1YL 3PUWA 3HOUG 1SROA 4DR7Q 1VQIA 1Q82C 3CD6A 3D0FA 1Y1WG 2MFIA 3W5OA 2ZJPA 4P74A 4A3FG 1W2BA 1FJGQ 1IBLL 2F52A 2LSSA 2RCNA 5IP7G 4DV6L 3RR5A 4TQUS 4X66L 4GNXC 1XMQQ 2WAQG 1EQQA 3AQQA 5C4JH 1OXXK 2PQAA 1E3PA 2K14A 4JI8Q 5IE8A 1QUQA 1GD7A 4A3LG 3STBD 2Q2TA 2KCTA 4A3CG 4GLAC 4YWLA 1E1OA 2XTIA 3CCJA 3A5UA 1XNQL 3BZCA 1W3SA 4NXMQ 4GLVB 1YBYA 3PO2G 2HIVA 2NVTH 5M5YH 3FKIG 1P8LA 1JMCA 3HOXG 3K7UC 4X65L 3I4OA 3AFQA 1VS0A 2N8NA 2ZJQA 2RF4A 5J3BA 1N9WA 1A62A 2IHFA 4IPGA 4L5TA 1VQDA 4GOPA 4JV5L 1N33Q 1YI2A 4LF8L 4A3DH 5JEAJ 2IY5B 4JI7Q 1A8VA 3RLOA 2ZTDA 3PO3H 4DR5Q 3GTPH 4B3SQ 2E5LL 1UE7A 1V9PA 3H3VI 2NVXH 4A3CH 5C3EH 1PH3A 3A5ZB 2K75A 1IL2A 2YYZA 2UUAL 3KFUA 1KXLA 2VL6A 2F4VQ 4DR3Q 4B3TL 1HNXL 4A3DG 2Q2IA 3KDFA 4FDBA 5IYCG 1LTLA 1MJEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ELN A;  4GN3 B;  3KLW A;  1SMX A;  5FLM G;  4YHH Q;  1U0L A;  3J81 c;  1VQ4 A;  5C44 H;  1YHQ A;  3S1N H;  1Y1W H;  1CUK A;  5LMN L;  2UXB Q;  4PZ6 A;  1SRU A;  3GTJ H;  3B6Y A;  4JI1 L;  1N36 L;  4RMF A;  1K8G A;  3S24 A;  2JA8 H;  4QGU A;  1YEZ A;  2FXQ A;  2R92 H;  4B3R L;  5E7N A;  1A63 A;  1G51 A;  2PI2 A;  4LF6 Q;  3I4N H;  1OXS C;  2ZTE A;  4MZ9 A;  5AJ3 L;  4DV1 Q;  4LF4 Q;  1C0A A;  1VQ9 A;  2AMC B;  4KI0 A;  3CXC A;  1KRS A;  2RHQ B;  4A3I G;  5M3F H;  1G29 1;  2AWO A;  4JI2 L;  3GTL H;  1PH5 A;  2OWO A;  1Q12 A;  1M90 C;  2B3G A;  1TWG H;  3NEM A;  2NN6 G;  4DR6 L;  2VY3 A;  4PZ8 A;  3CF5 A;  3TQY A;  1WOC A;  1YJW A;  2ALY B;  4HJ7 A;  1IZ6 A;  5IP9 H;  4JV5 Q;  2UXD Q;  2R7D A;  3I4M H;  4UP7 A;  3TS2 A;  1PYS B;  1SR3 A;  1TWA H;  3PUV A;  4EQ5 A;  4IOA A;  5K36 G;  4X65 Q;  3W1G A;  5H1S E;  2A1A A;  4DAM A;  4LFA Q;  1R9T H;  2E8G A;  4UPA A;  5AJ3 Q;  4RG1 A;  4DV1 L;  1ASZ A;  3HOU H;  1S3O A;  3FP9 A;  3K80 C;  4DV3 L;  4JI6 L;  3S1Q H;  3A74 A;  4KHZ A;  1HR0 W;  3PF4 A;  4DUY Q;  4JBK A;  1OXU A;  3HKZ G;  5IYD H;  2BA0 A;  3RLF A;  2I0Q A;  1K0R A;  2DGY A;  4IO9 A;  2HHH L;  2EXD A;  4GNX A;  1HZC A;  2XGT A;  1X3G A;  5LMU Q;  1T9H A;  2RHS B;  5BR8 Q;  1K9M C;  1VQA A;  4BY7 G;  5HY6 A;  1CSP A;  1EUJ A;  3KYH C;  3W1B A;  5FJ8 G;  4P73 A;  3CCS A;  1NY4 A;  4HIO A;  5JJL A;  3L2P A;  3M85 A;  2JA8 G;  2VUM G;  3JC6 6;  3NBH B;  3G4S A;  4OX9 Q;  3U4V A;  3T1Y Q;  1YNX A;  2NVQ H;  1PVO A;  1G6P A;  2C35 B;  4DV5 Q;  3TS0 A;  5M5W H;  2HHH Q;  2YTX A;  1Q46 A;  1FL0 A;  4DV4 Q;  4JI7 L;  3HKS A;  4GOP B;  4DR1 Q;  4IOC A;  2F3I A;  5LMU L;  2OQ0 A;  1LM0 A;  4LF6 L;  2ES2 A;  3K8A A;  3PIO A;  3PGZ A;  5LMN Q;  1KQS A;  3IRB A;  1PYB A;  3GO5 A;  3BU2 A;  3T1H L;  5M3F G;  4XTC S;  3S1M H;  2H5X A;  4JOI C;  3J80 c;  1Q1B A;  2JK8 A;  2F4V L;  2KBN A;  4P75 A;  3S14 H;  1IBK L;  1EIF A;  4A3K H;  4A3M G;  2GN5 A;  2UUA Q;  2JA6 H;  3S15 H;  3J80 i;  4IPD A;  2UXD L;  3TEH B;  4DV6 Q;  3H0G G;  1NMF A;  4DV4 L;  4IFD I;  1WFQ A;  1S40 A;  1HNZ Q;  1BBW A;  5C44 G;  2AHO B;  1Y14 B;  2WFW A;  5DLQ E;  5FLM H;  2ATW A;  1Q86 C;  1E7Z A;  1L1O C;  4A3G H;  3UDI A;  2UUC Q;  2PI2 E;  1AE2 A;  1L1O B;  1I94 L;  2JA6 G;  1VQ6 A;  4LF4 L;  3M3Y H;  1FJG L;  4HJ5 A;  3KDF B;  2JEA I;  1I6H H;  2K50 A;  3J7Z C;  3RZD H;  1X55 A;  4B3R Q;  1IYJ B;  4C2M H;  3OW2 A;  1TWF H;  1XPU A;  3EN2 A;  3I56 A;  4LF9 L;  1WCM G;  4DKA C;  2JE6 I;  2AWN A;  1X65 A;  2AKW B;  1KAW A;  3PV0 A;  1PH8 A;  1JJG A;  2ID0 A;  1QVC A;  4DPG A;  1PH1 A;  4LNQ A;  3H3V H;  4A3G G;  3AEV A;  2PNH A;  4PMW A;  2JA5 G;  4BBR G;  1CKN A;  4DV3 Q;  3F2D A;  4YCV A;  4JI6 Q;  1SLJ A;  1Y1V H;  1JB7 A;  2UUB L;  3MXN B;  3CPF A;  4YCU A;  1X56 A;  4OWX B;  3GTM H;  3PO2 H;  1U5K A;  2B63 G;  1EQR A;  5ELO A;  3M4Q A;  1XMQ L;  1SE8 A;  4HIK A;  4JBW A;  1JE5 A;  2NZH A;  3G48 A;  1V1Q A;  4C3I H;  1HNW L;  1IBL Q;  2E5L Q;  2Q2H A;  1AE3 A;  3J81 i;  2Y0S E;  1HZ9 A;  4AQY L;  1B7Y B;  4B3M L;  3RZO H;  4KHP L;  3S1R H;  1N32 Q;  2BA1 A;  4OO1 I;  1CKN B;  4UP9 A;  1TWH H;  4C3H H;  2K5H A;  3KOJ A;  1HZA A;  5IP7 H;  3CW2 C;  1XMO L;  4IFD J;  1MIU A;  1UWV A;  4DR4 L;  3E0E A;  1HR0 Q;  4AIM A;  4A3F H;  2MNA A;  2OTL A;  1EWI A;  3PSI A;  2KHI A;  4JI0 Q;  4JI3 Q;  4NXM L;  4YY3 Q;  2VUM H;  2B29 A;  3PIP A;  5C0X I;  3I4M G;  1CKO A;  2HQL A;  1VQ8 A;  4IFD G;  4R4T A;  2WAQ E;  4JOI A;  1K73 C;  3E9H A;  4AH6 A;  1QVG A;  4NB3 A;  3Q8D A;  1XPR A;  1GO3 E;  1VQN A;  1UE5 A;  2VQF L;  1PH2 A;  1HNW Q;  2GVB A;  4P71 A;  4UP8 A;  3CCU A;  1VCI A;  4X66 Q;  1WJJ A;  2E2J H;  1BVS A;  3I2Z A;  4JC0 A;  1JT8 A;  2WB1 G;  5IYD G;  2I5M X;  4DV7 L;  3CQZ H;  2UU9 L;  1GKH A;  2V1C C;  1AH9 A;  3F1Z A;  3CCL A;  4HJA A;  4GKK Q;  4BBS G;  3CCM A;  2VNU D;  4PG3 A;  1JJC B;  1EIY B;  4MTN A;  4Y7N H;  2Z6K A;  4AYB E;  2JA5 H;  5M3M H;  2JQO A;  2QA4 A;  1L2F A;  2JA7 H;  3T1H Q;  2E2I H;  4JYA Q;  4LUO A;  3CC2 A;  2N3S A;  2ZTC A;  1C9O A;  1K3R A;  2YTY A;  4GN5 A;  3KJP A;  4R4Q A;  2I5L X;  1VQM A;  4YWK A;  1P16 A;  4R1J A;  4DR2 Q;  1HR0 L;  5IWA L;  4H02 A;  4POF A;  1YZ6 A;  4JCV E;  3CCR A;  4JI8 L;  2Z6K C;  3J81 j;  1L1O A;  3ULJ A;  4OWW B;  2YU9 H;  4QQB X;  2UXC L;  1YJ9 A;  3HOY G;  1O7I A;  4IJH A;  2E2H H;  4LF7 L;  3M7N A;  4LFB L;  3M9B A;  1N34 L;  1IBK Q;  1DGS A;  2VQE L;  4OO1 G;  3CP0 A;  1Y1V G;  1IBM L;  1MKH A;  4GN4 B;  1JJ2 A;  3F8T A;  4QIW E;  1YHA A;  4BBR H;  3FKI H;  3M4O H;  1NBW A;  1NMG A;  1MJC A;  1K83 H;  4A3M H;  4A3K G;  1HH2 P;  2CWP A;  4YHH L;  4A3B H;  5IWA Q;  2R7Z G;  1X9N A;  4X64 L;  4A76 A;  4JBJ A;  4BY1 G;  3L0O A;  4A3L H;  2OQK A;  4LF9 Q;  5C4X H;  5C3E G;  4O0A A;  2R93 H;  2MQH A;  3I55 A;  1YHB A;  1TXY A;  2PMZ E;  3WWV A;  4HJ8 A;  1XJV A;  3UDF A;  4OX9 L;  4GKJ Q;  2PQA B;  1KRT A;  1HJP A;  2JEB I;  3SGI A;  3ERS X;  1IXR A;  5LMN W;  4DV2 Q;  4JI5 Q;  3GTO H;  4A3B G;  1KD1 C;  2Z0S A;  3KF8 B;  2JA7 G;  3ZJY C;  1S72 A;  4LF5 Q;  1GM5 A;  3S17 H;  1PH9 A;  4LF8 Q;  2VW9 A;  1J6Q A;  2EQS A;  4X62 L;  4LF5 L;  2QGQ A;  3CPW A;  3HOX H;  2UU9 Q;  1CKM A;  3EBE A;  2CQO A;  2UUC L;  3PUY A;  5FJ8 H;  4OON A;  3U58 A;  2UUB Q;  1WYD A;  3KF6 B;  4GNX B;  4HJ9 A;  2EIF A;  3UDG A;  4LWC A;  4Y52 H;  2ZM6 Q;  1J5E L;  4L5Q A;  4EX5 A;  4LUZ A;  2ZJR A;  1N8R C;  1UEB A;  1X6O A;  3CMA A;  1XPO A;  1E24 A;  1LYL A;  3HFZ B;  4K0K Q;  3HOW G;  2ZM6 L;  1J5E Q;  1VQF A;  4DV0 Q;  3GDE A;  4BA1 I;  4L5S A;  4R4I A;  3F2C A;  5C0X G;  4HID A;  4DR3 L;  1IBM Q;  2YV5 A;  2VQE Q;  2MO1 A;  4DR4 Q;  2D0O A;  4QJF A;  4DV5 L;  1NJI C;  3S16 H;  1UE1 A;  2ASB A;  5M5X H;  1SFO H;  4LF7 Q;  2CKZ B;  1NTG A;  4BBS H;  4LFB Q;  4QY7 A;  4NPS A;  2R6G A;  4DR1 L;  1I94 Q;  3S2D H;  4YCW A;  3CCV A;  4LFC L;  4R4O A;  4AQY Q;  2IX0 A;  1VQH A;  3JAM i;  1KL9 A;  4DR5 L;  3OYY A;  3GD7 A;  3K7A H;  1KHI A;  4LFC Q;  4BXX G;  4A93 G;  1SN8 A;  3A0J A;  4DK6 C;  1N33 L;  4A75 A;  1V43 A;  4HIM A;  4O2D A;  1PH6 A;  1XNR L;  3BJU A;  1EFW A;  3H15 A;  1PV4 A;  1X3F A;  2BH8 A;  4L5R C;  2UXB L;  4K0K L;  2Q2U A;  3I7F A;  1K8A C;  1PA6 A;  5BR8 L;  4POG A;  1TWC H;  2B63 H;  3CME A;  3ULP A;  3RN5 A;  1VQG A;  1QVF A;  4DUY L;  4DV0 L;  4OXP A;  5JJK A;  3ICE A;  2BH2 A;  1WI5 A;  3D31 A;  5IYB H;  4IPC A;  3BZK A;  3EIV A;  1PH4 A;  3S2H H;  2CCZ A;  1VQC A;  2CWA A;  1QUQ B;  5IYC H;  4A4I A;  1EYG A;  1VQ7 A;  3G6E A;  5IP9 G;  3AYH B;  4KLK A;  1VQP A;  1XNR Q;  5JJI A;  2WP8 J;  3HOW H;  1WCM H;  3DM3 A;  4X62 Q;  3CC4 A;  3TRE A;  4ME3 A;  2VS1 A;  2UXC Q;  2R93 G;  4AYB G;  2CFM A;  1D8L A;  2Y0S G;  5GAH C;  1VQK A;  3CCQ A;  4JBM A;  1VQO A;  4B3S L;  4BY1 H;  4A3E H;  2JA9 A;  4DR2 L;  4JI5 L;  4J15 A;  3I4N G;  2R7Z H;  1D7Q A;  4GLX A;  1OXV A;  4LUV A;  4DR6 Q;  4DNI A;  3PO3 G;  1M1K C;  4YY3 L;  5JEA G;  3PUX A;  2R92 G;  3TRZ A;  2WB1 E;  4JI2 Q;  1HNZ L;  2MO0 A;  4JYA L;  2IX1 A;  4JG2 A;  3NEL A;  1KC8 C;  3J7A 5;  1BKB A;  1N36 Q;  4GKJ L;  3H0G H;  2K4K A;  3G71 A;  1OTC A;  5GRO A;  1X54 A;  1L0W A;  4A3J G;  1H95 A;  4X64 Q;  5FLX c;  3RN2 A;  4MNO A;  1FGU A;  5EAY A;  3DLL A;  3PF5 A;  3GTK H;  4GS3 A;  5IT9 c;  2DUD A;  4A3E G;  4WJ4 A;  4DV7 Q;  1VQ5 A;  1Q8K A;  5C4X G;  1Z47 A;  2IHE A;  1N34 Q;  1E1T A;  2GVA A;  3VDY A;  4B3T Q;  3L7Z C;  1EOV A;  2OCE A;  3AFP A;  3STB C;  2VQF Q;  2VZA A;  4A3J H;  5GQO A;  3CAM A;  4APV A;  2D62 A;  5HGQ A;  3LGJ A;  4DV2 L;  3RNU A;  5M3M G;  4UY8 C;  4PZ7 A;  3KJO A;  3GTQ H;  4DR7 L;  1B70 B;  3U4Z A;  4NXN Q;  1LUZ A;  5IYB G;  1ASY A;  1C7Y A;  1FVI A;  2N78 A;  3ER0 A;  4GOP C;  2HIX A;  3JAM c;  1Q81 C;  2LXK A;  2N49 A;  3NEN A;  3MEF A;  2K5V A;  1YIT A;  1PH7 A;  3HOY H;  1GVP A;  4JI4 L;  1VQL A;  2K5N A;  4BY7 H;  1E22 A;  2NZO A;  1RL2 A;  2LXJ A;  3K0X A;  4DUZ Q;  2KCM A;  1YJN A;  1QZH A;  1N32 L;  4IJL A;  4C3J H;  1HNX Q;  4A93 H;  1YVC A;  3HOV G;  3OTO L;  3HOZ H;  1KIX A;  2A8V A;  1PFS A;  5GAG C;  3U50 C;  5GAE C;  3CCE A;  1A0I A;  1VQB A;  4BA2 I;  4WJ3 M;  4KHP Q;  2R7F A;  1Q7Y C;  1I50 H;  4LFA L;  1Z9F A;  2IT1 A;  3UE1 A;  2NN6 I;  2NVY H;  4DK3 C;  4LW1 A;  5GAD C;  3GTG H;  1CSQ A;  4XIG S;  2A19 A;  2OTJ A;  1UE6 A;  2KEN A;  3CC7 A;  1XTD A;  1VQE A;  2JJQ A;  3UE0 A;  5C0X J;  2QEX A;  3E9I A;  3FHW A;  4OWT B;  3ULL A;  1NE3 A;  2YTV A;  4DAY B;  4P72 A;  4JI3 L;  3OTO Q;  4JI0 L;  4JI4 Q;  4ALP A;  3HOV H;  3F2B A;  3HOZ G;  1HZB A;  1I5F A;  3PUZ A;  2HT1 A;  4YWM A;  4DUZ L;  4A3I H;  2L15 A;  1X3E A;  3M4P A;  2D0P A;  2KHJ A;  1XMO Q;  1RIP A;  2I5H A;  3K81 C;  3UDX A;  1I3Q H;  4BXX H;  1VQJ A;  4NXN L;  1XNQ Q;  2K52 A;  4IPH A;  1PHJ A;  1BBU A;  1OXT A;  3RLN A;  5IY0 A;  4GKK L;  4X6A H;  4B3M Q;  3PCO B;  4JI1 Q;  4TVA B;  3HKZ E;  1QZG A;  1YIJ A;  3KF6 A;  4QL5 A;  1Q1E A;  4R4C A;  1B8A A;  3T1Y L;  3PUW A;  3HOU G;  1SRO A;  4DR7 Q;  1VQI A;  1Q82 C;  3CD6 A;  3D0F A;  1Y1W G;  2MFI A;  3W5O A;  2ZJP A;  4P74 A;  4A3F G;  1W2B A;  1FJG Q;  1IBL L;  2F52 A;  2LSS A;  2RCN A;  5IP7 G;  4DV6 L;  3RR5 A;  4TQU S;  4X66 L;  4GNX C;  1XMQ Q;  2WAQ G;  1EQQ A;  3AQQ A;  5C4J H;  1OXX K;  2PQA A;  1E3P A;  2K14 A;  4JI8 Q;  5IE8 A;  1QUQ A;  1GD7 A;  4A3L G;  3STB D;  2Q2T A;  2KCT A;  4A3C G;  4GLA C;  4YWL A;  1E1O A;  2XTI A;  3CCJ A;  3A5U A;  1XNQ L;  3BZC A;  1W3S A;  4NXM Q;  4GLV B;  1YBY A;  3PO2 G;  2HIV A;  2NVT H;  5M5Y H;  3FKI G;  1P8L A;  1JMC A;  3HOX G;  3K7U C;  4X65 L;  3I4O A;  3AFQ A;  1VS0 A;  2N8N A;  2ZJQ A;  2RF4 A;  5J3B A;  1N9W A;  1A62 A;  2IHF A;  4IPG A;  4L5T A;  1VQD A;  4GOP A;  4JV5 L;  1N33 Q;  1YI2 A;  4LF8 L;  4A3D H;  5JEA J;  2IY5 B;  4JI7 Q;  1A8V A;  3RLO A;  2ZTD A;  3PO3 H;  4DR5 Q;  3GTP H;  4B3S Q;  2E5L L;  1UE7 A;  1V9P A;  3H3V I;  2NVX H;  4A3C H;  5C3E H;  1PH3 A;  3A5Z B;  2K75 A;  1IL2 A;  2YYZ A;  2UUA L;  3KFU A;  1KXL A;  2VL6 A;  2F4V Q;  4DR3 Q;  4B3T L;  1HNX L;  4A3D G;  2Q2I A;  3KDF A;  4FDB A;  5IYC G;  1LTL A;  1MJE A; 
#chains in the Genus database with same CATH topology
 4DR7 L;  4GN3 B;  4YHH Q;  1SMX A;  1W6J A;  3J81 c;  1VQ4 A;  5LMN L;  5C4H A;  2A6H D;  4RMF A;  4ILW A;  2FXQ A;  4L6T B;  2PI2 A;  2K7V A;  2AMC B;  2PYK A;  1KRS A;  2RHQ B;  2AWO A;  4JI2 L;  3GTL H;  3GTQ B;  2B3G A;  1E0B A;  3T13 A;  1HA6 A;  2VY3 A;  5IP9 H;  1LTA D;  3I4M H;  3HOY B;  3OIQ A;  4ZKB B;  5AJ3 Q;  4DV1 L;  5BN3 A;  3FP9 A;  5EKK A;  3J7Y W;  3PF4 A;  4DUY Q;  4JBK A;  1GUN A;  3GTL B;  1D5Z C;  3RLF A;  3K59 A;  3VR2 A;  2I0Q A;  2JXM B;  3OW7 A;  4UAI A;  4GNX A;  1X3G A;  3RZD B;  4K2L A;  3VYT A;  1DOM A;  3TP6 A;  5FJ8 G;  3MEH A;  4P73 A;  1WVL A;  3L2P A;  3M85 A;  1NNX A;  2JA8 G;  1D5X C;  5C5L A;  4OX9 Q;  3TP5 A;  1EY8 A;  3VYR A;  3T1Y Q;  3H94 A;  2JA6 B;  2G9D A;  2HHH Q;  1EZ8 A;  4IOC A;  2F3I A;  3IAY A;  2OQ0 A;  1XTC D;  1WTO A;  2R92 B;  1U4R A;  3NE5 B;  1WTX A;  1ICW A;  4XTC S;  2B2W C;  2KBN A;  4C3I B;  2QIL A;  3MFG A;  1R9T B;  1EIF A;  1BO0 A;  2UUA Q;  2JA6 H;  2UXD L;  4GZY C;  4DV6 Q;  1EYA A;  2AHO B;  4ZAI A;  1HCZ A;  3DMU A;  2XN9 C;  1L1O C;  4RWS C;  4A3G H;  2OXP A;  3UDI A;  2UUC Q;  1L1O B;  1I94 L;  1VQ6 A;  3ERO A;  4LF4 L;  1EQT A;  3KDF B;  1I6H H;  1F2Z A;  3J7Z C;  3OW2 A;  1GHJ A;  3I56 A;  3G7L A;  3M4Y A;  2JE6 I;  1KAB A;  2AKW B;  4Y7N B;  2NZ1 D;  1X32 A;  2ID0 A;  3KF8 A;  4A3G B;  3AEV A;  2PNH A;  4PMW A;  5ELF A;  4ODG A;  4QUF A;  1D5M C;  4DV3 Q;  4KD3 A;  4CJ0 B;  1Y1V H;  2UUB L;  2A6E C;  3MXN B;  4YCU A;  3MAQ A;  4DF7 A;  3M4Q A;  5I9P A;  5DEH A;  1LT4 D;  1JE5 A;  3G48 A;  1HNW L;  2LY7 A;  4KD4 A;  4OEM B;  3GV3 A;  2Q2H A;  2E5L Q;  5K5P A;  4RHR A;  2G5D A;  4KHP L;  1B7Y B;  3X3M A;  5FK9 C;  4B3M L;  1XX8 A;  4KTA A;  1EOT A;  1PTO B;  2K5H A;  3HGB A;  3KOJ A;  3CW2 C;  1XMO L;  4IFD H;  3E0E A;  1HR0 Q;  5KNC A;  1YNN C;  3TME A;  2OTL A;  4FXD A;  1EWI A;  2KHI A;  4JI0 Q;  2F0K A;  2VUM H;  5C0X I;  1CKO A;  3NSW A;  1K73 C;  4AH6 A;  1QVG A;  4NB3 A;  4NDX A;  1VQN A;  1GXD C;  1EYC A;  1UE5 A;  1A3T A;  2WKC A;  1DON A;  1VCI A;  2XWJ B;  1JT8 A;  2WB1 G;  3CU7 A;  2UU9 L;  2NWG A;  1S5F D;  1I4X A;  4ZQ3 A;  4HJA A;  2VNU D;  4QB4 A;  1DJR D;  4MTN A;  2F0H A;  4Q0F A;  2JA5 H;  2EYL A;  2QA4 A;  1L2F A;  2EOT A;  4JYA Q;  4LUO A;  3CC2 A;  3SK4 A;  3MC0 B;  3FKI B;  1B3Q A;  4YWK A;  1RKN A;  4R1J A;  1SE4 A;  4H02 A;  1FNU A;  4POF A;  1L1O A;  3ULJ A;  3A54 A;  1VF7 A;  2P5Z X;  2PMZ B;  1CZW A;  2F3V A;  1IBK Q;  5HGT A;  3MXG A;  4IUN A;  1CTM A;  1SDF A;  1C4Q A;  2BCO A;  2RSN A;  3FKI H;  1NBW A;  1NMG A;  3PMF A;  1K83 H;  3TSS A;  1HH2 P;  2CWP A;  1HUM A;  3IKJ A;  1I4R A;  3SEB A;  4EQO A;  4X64 L;  1X9N A;  4JBJ A;  4BY1 G;  4S3S A;  3CQZ B;  5KYL A;  2TSS A;  2H1E A;  3UDF A;  4GKJ Q;  5CV8 A;  5LMN W;  1T5E A;  4A3B G;  1KD1 C;  3ZJY C;  3VYS A;  1CHQ D;  2EQS A;  2KEE A;  4X62 L;  1EY4 A;  2QGQ A;  4CJ1 B;  3K5N A;  1CKM A;  3T56 B;  3FPP A;  5BN5 A;  1EIG A;  2RDF A;  4BY1 B;  2ZXO A;  4LWC A;  4L5Q A;  4ZK9 B;  1X6O A;  1CI3 M;  4PMC A;  1LYL A;  1NSN S;  2AQ3 B;  1J5E Q;  2J7Z A;  4BA1 I;  3J81 E;  2ENB A;  4L5S A;  4R4I A;  4HID A;  3PO2 B;  1FD7 D;  2D0O A;  4DV5 L;  4O1N A;  2ASB A;  2B63 B;  1Y8N B;  1SFO H;  4LFB Q;  5JJI A;  1F9R A;  4NPS A;  1PRT B;  1RDP D;  2EJG C;  4QY7 A;  4DR1 L;  1I94 Q;  1HQM C;  5DNF A;  4R4O A;  2A69 C;  2IX0 A;  3IFD A;  1KL9 A;  1SE3 A;  3OYY A;  1KHI A;  5CV9 A;  4EVO A;  1TWH B;  1KDC A;  3A0J A;  1N33 L;  4O2D A;  1ZYR C;  4ZUI A;  1PH6 A;  1TS2 A;  4A3F B;  3BJU A;  2F0T A;  4F87 A;  1EFW A;  1X3F A;  3ERQ A;  2UXB L;  4BWG B;  3KUP A;  2Q2U A;  1FR3 A;  2B63 H;  4KN7 C;  4RGN A;  3CME A;  1SYG A;  1VQG A;  4A3E B;  1QVF A;  3D31 A;  3BZK A;  1PH4 A;  5EKL A;  3QJY A;  5K36 H;  4A4I A;  3AYH B;  2JYO A;  4I65 A;  2WP8 J;  5F2D A;  3CC4 A;  3H0G B;  3TRE A;  1PTO D;  1F9P A;  3A7L A;  3KBG A;  1D8L A;  2Y0S G;  1L0Y B;  3C1E A;  2EY6 A;  4JBM A;  4K5W A;  3PO3 B;  1IW7 C;  4A3E H;  3TN2 A;  5COY A;  1OXV A;  3FEW X;  4LUV A;  4WFN 3;  2EYH A;  4YY3 L;  5JPN C;  2F0P A;  4JG2 A;  4HMJ A;  4GKJ L;  2KEC A;  3SVM A;  3H0G H;  3OPO A;  3MXU A;  2RBM A;  1SYF A;  2KUM A;  3S9W A;  4X64 Q;  3RN2 A;  4MNO A;  1FGU A;  4GS3 A;  4WOR A;  2L5T A;  4WJ4 A;  5IOC A;  1V8Q A;  5C4X G;  1N34 Q;  5LL6 X;  5IT9 L;  3RUZ A;  4TRD A;  2RDH A;  3AFP A;  2OCE A;  3STB C;  3CAM A;  4APV A;  4ZRZ A;  3WDN A;  4L8J A;  5EBD A;  3SHL A;  4DV2 L;  2PW7 A;  3LGJ A;  3NWT A;  3GTQ H;  3NBI A;  1CK1 A;  3BDO A;  2E2D C;  5IYB G;  4DAV A;  1C7Y A;  2N78 A;  3T51 B;  1RTO A;  3JAM c;  2N49 A;  3KLS X;  1YIT A;  1PH7 A;  3HOY H;  4JI4 L;  4BY7 H;  1E22 A;  3BVG A;  3K0X A;  4DUZ Q;  1YJN A;  1WD1 A;  3OTO L;  3BS1 A;  2A8V A;  5GAG C;  3U50 C;  3OMC A;  1CHP D;  1A0I A;  4DU9 A;  1VQB A;  4ULL A;  1CA5 A;  3J80 L;  3H3V C;  2OTJ A;  1I4Q A;  5CV4 A;  1XYI A;  4FF2 A;  3IFT A;  1PZK D;  4X3U A;  3CC7 A;  3GTP B;  3A8I E;  1GOZ A;  5IGB A;  3UE0 A;  1MSH A;  3E5S A;  3FHW A;  4K2K A;  2ZXR A;  3MXN A;  4JI0 L;  4NKL A;  4K14 A;  3HOZ G;  1STG A;  2KA7 A;  4YWM A;  2LMC B;  1ILQ A;  3E3X A;  2D0P A;  2KHJ A;  1XMO Q;  1X3P A;  3UDX A;  1ET6 A;  1U4M A;  5IY0 A;  4GKK L;  5CMD A;  1HXY D;  2F0J A;  5ISR A;  5C3E B;  1K8O A;  1QWY A;  4QL5 A;  4FF3 A;  1B8A A;  2JA8 B;  2GA4 B;  3AB9 A;  1H9J A;  1SRO A;  2B2U A;  4XYO A;  1BCP F;  5CGK A;  1Y1W G;  4V19 0;  2MFI A;  3W5O A;  4P74 A;  1AEX A;  1FJG Q;  1IBL L;  2LSS A;  5IP7 G;  4DV6 L;  4TQU S;  4X66 L;  3SXH A;  2WAQ G;  4CKE A;  5C4J H;  3SK5 A;  3ND8 A;  2K14 A;  5I9O A;  1QUQ A;  3OMG A;  4DN4 M;  4A3L G;  2XRS D;  3TZD A;  3E0J A;  5KGU A;  1STH A;  2AQ2 B;  5EPL A;  3I91 A;  4GLV B;  4XDX A;  4XQQ A;  3PO2 G;  1H9S A;  1KLG D;  1QNU A;  3GP7 A;  3AFQ A;  5I2Y A;  3HOW B;  5J3B A;  1A62 A;  2IHF A;  4IPG A;  4GOP A;  1G2T A;  1SNC A;  3R8B A;  1N33 Q;  2OF1 A;  3H6M A;  4A3D H;  4A3I B;  4JI7 Q;  5D65 A;  1AZP A;  4B3S Q;  1UE7 A;  3K5M A;  3H3V I;  2NVX H;  1ESR A;  2Q8T A;  3N52 A;  2B8F A;  1IL2 A;  2UUA L;  3FDT A;  2VL6 A;  1TY0 A;  2K04 A;  4H13 C;  1U4L A;  2Q2I A;  3S2H H;  3HEJ A;  5E3F A;  5ELN A;  4DK1 A;  1JB3 A;  5C6A A;  1ILP A;  1CUK A;  1BBX C;  1TU2 B;  4JI1 L;  1K8G A;  3S24 A;  1M8A A;  2CH4 A;  3NP8 A;  5EPJ A;  1A63 A;  5FO8 B;  2B2U C;  4LF6 Q;  4Z9C B;  1C0A A;  2ZTE A;  1VQ9 A;  1UNS A;  3QOL A;  3MFY A;  2NN6 G;  3CF5 A;  4R8N A;  2MP1 A;  2ALY B;  4HJ7 A;  1YJW A;  1GUS A;  2E76 C;  2O4X A;  2R7D A;  3TDQ A;  3TS2 A;  1Z7T A;  1SR3 A;  5K36 G;  3HS0 C;  4ZYS A;  4O42 A;  2A1A A;  4LFA Q;  4UPA A;  1SSO A;  3HOU H;  4DV3 L;  3A74 A;  1EQV A;  2JA5 B;  1O7Z A;  2DGY A;  5HUR A;  4IO9 A;  1S5C D;  1AW7 A;  1HZC A;  1LTG D;  2CW0 D;  2XGT A;  5LMU Q;  5EQ0 A;  2M2L A;  2L0C A;  1K9M C;  1VQA A;  1TWF B;  5HY6 A;  1EUJ A;  3W1B A;  3CCS A;  1NY4 A;  4HIO A;  3HOU B;  3C1F A;  5CBE E;  2VUM G;  2PPB C;  3BDL A;  3U4V A;  1D2B A;  1PVO A;  3MWY W;  2C35 B;  4DV5 Q;  2F0F A;  5M5W H;  2EY2 A;  2YTX A;  4JI7 L;  2B8G A;  1PDQ A;  2EJF C;  2LKV A;  4DR1 Q;  4OIK A;  4OL7 A;  2SOB A;  2F4I A;  3PIO A;  5LMN Q;  3WOE A;  5JAV A;  3D8G A;  5M3F G;  3DWQ A;  3I4M B;  3J80 c;  1Q1B A;  2F4V L;  2V4D A;  1BCP B;  3SE0 A;  4PNY A;  3S15 H;  4MTK A;  3J80 i;  1KNA A;  2KCN A;  3QG1 A;  4FO2 A;  1NMF A;  1WFQ A;  3GV6 A;  1YNJ C;  2WFW A;  5FLM H;  3BVZ A;  1BR9 A;  4KJN A;  1LAB A;  1ZKO A;  3VR6 A;  1DOL A;  4QF4 A;  1A2T A;  3RZD H;  1X55 A;  3MTS A;  5FKA C;  4B3R Q;  4G57 A;  4IQZ A;  3SK8 A;  3J80 E;  4FXK C;  1QIL A;  4LF9 L;  1WCM G;  4OGQ C;  4DKA C;  2NYZ D;  3PV0 A;  1PH8 A;  5M3M B;  4A3G G;  1CKN A;  2FIN B;  1SLJ A;  2G9H D;  5A35 A;  1JB7 A;  1SBB B;  2JN4 A;  1X56 A;  3BDC A;  3V2T A;  3PO2 H;  2B63 G;  5AFW A;  1AP0 A;  4HIK A;  4JBW A;  2EJM A;  4C3I H;  1V1Q A;  1EU3 A;  1JIC A;  2DJF C;  4CKC A;  1LT3 D;  3J81 i;  1HZ9 A;  4AQY L;  2A74 C;  1TS3 A;  1HFG A;  2Z9H A;  5C44 B;  4UP9 A;  1TWH H;  5IP7 H;  2IWH A;  1UWV A;  4A3F H;  4G4K A;  2MNA A;  1TQO A;  3JAM E;  1ROD A;  4JI3 Q;  3NTH A;  4NXM L;  1V1P A;  5E4W C;  4R4T A;  2WAQ E;  4IFD G;  1PFM A;  3QOJ A;  3E9H A;  1L0X B;  4XT1 B;  2B2T A;  5C4Z A;  1GO3 E;  5IOD A;  1TWG B;  4HED A;  2VQF L;  3OWE B;  4RGT A;  3CCU A;  1WJJ A;  5I6W A;  1BVS A;  4JC0 A;  4ME5 A;  1OO9 B;  3NXW A;  2I5M X;  3BVM A;  5IYD G;  1CQF A;  3V96 A;  2PW5 A;  1S5B D;  4PG3 A;  2YU9 B;  1EIY B;  4HR7 B;  1I4P A;  1PLF A;  2EYJ A;  3CRK C;  3F2U A;  3T1H Q;  2E2I H;  3QO2 A;  5I4D A;  1SJH D;  4E6I A;  1C9O A;  4RHS A;  4GN5 A;  3KJP A;  1VQM A;  2I5L X;  3HKZ B;  1PTO H;  1I4H A;  1P16 A;  4DFA A;  1HR0 L;  5C5M A;  2K05 A;  3BG3 A;  2YU9 H;  1F77 A;  1O7I A;  2E2H H;  4LF7 L;  1PRT F;  1ONL A;  2OT2 A;  2QKI C;  4F88 A;  5D3D A;  4OO1 G;  3CP0 A;  1Y1V G;  3NTI A;  1IBM L;  1MKH A;  1AFP A;  3F8T A;  4QIW E;  2F0O A;  1JC7 A;  2ICI A;  1ICF B;  2KOL A;  4YHH L;  4A3M H;  1WTV A;  1STB A;  3S16 B;  4KK7 A;  1EYD A;  3NBH A;  3L0O A;  4A3L H;  1TY2 A;  2OQK A;  4LF9 Q;  5C4X H;  5KND A;  2HD3 A;  2R93 H;  4ZCK A;  1YHB A;  1TXY A;  2PMZ E;  1XJV A;  1ENA A;  2JEB I;  3TBI B;  1NR2 A;  4LF5 Q;  1GM5 A;  1TII D;  1Y8O B;  1STY A;  2VW9 A;  3I72 A;  3CPW A;  2H4O A;  2NTS A;  1FYC A;  5BN4 A;  1K28 A;  2UUC L;  3PUY A;  3U58 A;  4JVZ A;  5DM6 3;  2EIF A;  3UDG A;  2R7Z B;  4RH6 A;  1J5E L;  2K1B A;  4EX5 A;  3PIO 3;  4LUZ A;  1UEB A;  2CVR A;  1XPO A;  1VQF A;  4DV0 Q;  1KTK A;  2IX3 A;  2HCI A;  3HP3 A;  4DR3 L;  5C0X G;  1IBM Q;  2VQE Q;  4LJZ C;  4QJF A;  1NJI C;  5M5X H;  2LFN A;  2CKZ B;  1EEI D;  2R6G A;  2VB2 X;  2XWB B;  1AZQ A;  1VQH A;  4R8I A;  4DR5 L;  2PCF B;  3K7A H;  2B2T C;  4LFC Q;  4A93 G;  2K5D A;  1V43 A;  1B4O A;  1XNR L;  4L5R C;  2BH8 A;  5C4J B;  3I7F A;  1K8A C;  5C3W A;  4POG A;  5E1F A;  5M5X B;  3E6Z X;  3A7A B;  5JJK A;  2F0D A;  3ICE A;  5IYB H;  3EIV A;  1VQC A;  1ENF A;  2CWA A;  2SNS A;  1HA5 A;  1YNJ D;  1Q3L A;  3VR5 A;  3HOW H;  1LTB D;  5FLX E;  1GUW A;  5EPK A;  1EY7 A;  2UXC Q;  2R93 G;  4AYB G;  4EGV A;  5GAH C;  2O5J C;  3ZYY X;  4B3S L;  4J6H A;  4IUR A;  2EYP A;  2JA9 A;  4DR2 L;  5M9O A;  4LK1 C;  2NVX B;  5EKI A;  5KNB A;  1M1K C;  2Y0S B;  2N88 A;  3PUX A;  5JEA G;  1QG7 A;  3DM1 A;  1F2M A;  4JI2 Q;  4DXF A;  2L9H A;  1JOQ A;  2F0S A;  4JYA L;  3BYT B;  3OWF A;  1B1Z A;  3D6W A;  3HOV B;  4X3T A;  1LTT D;  3DWA A;  1L0W A;  4A3J G;  5FLX c;  3C46 A;  2BE5 D;  3PF5 A;  3R3O A;  3GTK H;  1B9M A;  5IT9 c;  5L37 A;  2DUD A;  2WIN B;  4DV7 Q;  1Z47 A;  2N55 A;  4HN7 A;  5CR3 A;  4B3T Q;  1SNO A;  3I73 A;  3L7Z C;  3P20 A;  1EOV A;  2EY1 A;  4A3J H;  2FHT A;  5GQO A;  2I07 B;  4UY8 C;  3I4L A;  5M3M G;  4PZ7 A;  3KJO A;  4N8X 1;  1ASY A;  2ZT9 C;  3IL8 A;  1R4P B;  3ER0 A;  2FFK B;  5E4X A;  2LXK A;  1Q81 C;  2HQE A;  1GVP A;  3X3N A;  3FVQ A;  3MXP A;  5I6Y A;  1G6Z A;  1JWU D;  2LXJ A;  2B2Y C;  4CDD C;  1N32 L;  1Y8P B;  4A3J B;  5IGE A;  4X3S A;  1YVC A;  2AUK A;  3HOV G;  4G7O C;  1K0S A;  3CCE A;  3MVV A;  1I6V C;  5JVH 3;  2R7F A;  4KMU C;  3UE1 A;  2NN6 I;  2NVY H;  2A19 A;  4XXE A;  1UE6 A;  2KEN A;  5A2Q E;  1VQE A;  4KKU A;  3E9I A;  4EQP A;  4OWT B;  3ULL A;  1NE3 A;  4AYB B;  2OEO A;  3BZD B;  5D14 A;  3OTO Q;  2F0N A;  2O5I C;  3F2B A;  3PUZ A;  5EGT A;  2HT1 A;  1X3E A;  2I5H A;  3K81 C;  1I3Q H;  2K52 A;  1BBU A;  1OXT A;  3RLN A;  4X6A H;  4JI1 Q;  4TVA B;  3HKZ E;  2Z6B A;  3T16 A;  4B08 A;  1YIJ A;  4R4C A;  1D6E C;  3EFX D;  2DNC A;  1XWE A;  4BY7 B;  3S15 B;  3P1H A;  1MHW C;  3NK9 A;  2F52 A;  5J39 A;  3RR5 A;  1BNZ A;  1I3Q B;  2KCC A;  1XMQ Q;  4XT3 B;  1HTP A;  1QNK A;  1D1K A;  2RKS A;  2Z4I A;  4A3C G;  2KCT A;  2HDL A;  5EBC A;  1E1O A;  4BS9 A;  4KKT A;  3A5U A;  4HTH A;  4JW0 A;  1YBY A;  3DWP A;  2CHB D;  2D2C C;  5M5Y H;  1P8L A;  4X65 L;  1VS0 A;  1SMY C;  2N8N A;  1DOK A;  5I2X A;  4N9P A;  4L5T A;  4CGY B;  1C48 A;  3R93 A;  2IY5 B;  5JEA H;  3RLO A;  2FJ2 A;  2IW3 A;  1EIH A;  4H44 C;  4DNR B;  3CHB D;  4A3C H;  5C3E H;  3A5Z B;  4XQN A;  2CH4 W;  3EVQ A;  3R2I A;  2D5D A;  4P2C B;  3I70 A;  1HNX L;  5ELE A;  2DJG C;  1CFM A;  5C44 H;  3J7A F;  2IPK D;  2WV6 D;  4PZ6 A;  3GTJ H;  3ONA B;  2XRQ D;  2Q8I B;  4M8A A;  2R92 H;  1YEZ A;  1GUG A;  4B3R L;  5E7N A;  1G51 A;  4K8I A;  2F1M A;  1FGB D;  1MBY A;  1OXS C;  4CDE C;  4KI0 A;  4A3I G;  4J8Q A;  1PH5 A;  1CT1 D;  1TWG H;  1FNV A;  4DR6 L;  1MSG A;  4PMB A;  4PZ8 A;  3TQY A;  1WTR A;  1WOC A;  4DGZ A;  3GTJ B;  4NW2 A;  1PYS B;  3PUV A;  3VA5 A;  3R2T A;  4X65 Q;  4DAM A;  4DAP A;  2E8G A;  1SYB A;  4JI6 L;  3S1Q H;  1RCV D;  4G7Z C;  4KHZ A;  2XNA C;  3HKZ G;  5IYD H;  2NN6 H;  3A8K E;  3MHB A;  2WAQ B;  1SYE A;  2IL8 A;  1PRT C;  5FO9 B;  1NR4 A;  1T9H A;  1B2T A;  3OSO A;  1CSP A;  4DK0 A;  3KYH C;  4MN3 A;  5JJL A;  3JC6 6;  3NBH B;  1MGS A;  2KQ3 A;  1YNX A;  2NVQ H;  1G6P A;  1B53 A;  1G2S A;  1FL0 A;  4MHE A;  3HKS A;  3D4D A;  2L11 A;  4KY6 A;  5LMU L;  1STA A;  3EQL C;  2ES2 A;  3K8A A;  3PGZ A;  2C5C A;  3IRB A;  4IUT A;  4RCO A;  3BU2 A;  5CC4 A;  4K6D A;  1MD2 D;  2H5X A;  4C3I G;  5CBA E;  3NHH A;  4P75 A;  1E2V A;  3S14 H;  1IBK L;  5IIF A;  4A3M G;  2R93 B;  1SEB D;  4IPD A;  1DD2 A;  3TEH B;  5LHY 1;  4IZ8 A;  3S1R B;  4IFD I;  4R9W A;  1S40 A;  4ID6 A;  1BBW A;  1RHP A;  5JOB A;  5C44 G;  1Q86 C;  4HSV A;  1AE2 A;  1EWH A;  2JA6 G;  3W2D A;  2PZW A;  4HJ5 A;  1FJG L;  1VDZ A;  1PFB A;  1A15 A;  3GTM B;  1IYJ B;  3S14 B;  1TWF H;  1XPU A;  3EN2 A;  1W6K A;  3G6J B;  1SNP A;  4NMZ A;  1F9S A;  2AWN A;  1JJG A;  1KAW A;  4DPG A;  2KED A;  1PH1 A;  1DXM A;  4BBR G;  4RAU C;  3F2D A;  1F2L A;  2F0L A;  4OWX B;  3GTM H;  1U5K A;  1PFN A;  1EY6 A;  5ELO A;  4IUP A;  1XMQ L;  1SE8 A;  3HZX A;  4UHV A;  3DEP A;  1AE3 A;  4CHT B;  1JQY D;  2BA1 A;  1CKN B;  4C3H H;  3S1N B;  1HZA A;  2KVM A;  4AIM A;  2X6G A;  2HDM A;  1EFI D;  3VR4 A;  1RF2 D;  3I4N B;  4KN4 C;  3D6C A;  2C9O A;  4YY3 Q;  2B29 A;  3KBX A;  3I4M G;  2HQL A;  1IYU A;  4JOI A;  5M3F B;  1WTP A;  2A6H C;  3Q8D A;  5COR A;  1XPR A;  5KYI A;  1IW7 D;  5FO7 B;  1PH2 A;  1ML0 D;  2HUG A;  5EJW A;  1HNW Q;  1Y69 U;  4X66 Q;  2E2J H;  1LAC A;  3I2Z A;  1VMC A;  1IKL A;  1K3B C;  1U4P A;  1GKH A;  2V1C C;  2MJ8 A;  1AH9 A;  1PZI D;  4GKK Q;  1A6X A;  1BQQ T;  1JJC B;  3U9S A;  3GTO B;  4Y7N H;  2Z6K A;  4N9T A;  1BOS A;  3WOF A;  3TP7 A;  3M7G A;  4AYB E;  2JQO A;  4K6L A;  2A68 C;  4FYD A;  1EY5 A;  1Y1V B;  2ZTC A;  2E2J B;  1K3R A;  2J0T D;  2YTY A;  3DEO A;  1SJE D;  1WTW A;  4JCV E;  3CCR A;  4JI8 L;  2Z6K C;  4QQB X;  1PXU A;  5J22 A;  4OWW B;  3Q0A A;  1YJ9 A;  2EYF A;  3M9B A;  4IUQ A;  3EA6 A;  1DGS A;  2VQE L;  3NTK A;  1BXT A;  4GN4 B;  4G7H C;  1MJC A;  4A3K G;  4A3B H;  1HFN A;  1GUO A;  2NTT A;  4BBS B;  4A76 A;  2Z1C A;  2MQH A;  3WWV A;  4OX9 L;  1X3Q A;  2PQA B;  1KRT A;  1HJP A;  3SGI A;  4JI5 Q;  3ERS X;  4DV2 Q;  1LTR D;  2Z0S A;  3KF8 B;  2JA7 G;  3S17 H;  2E2I B;  4LF8 Q;  4A3B B;  1PYW D;  1QE6 A;  4LF5 L;  4N8F A;  4C2M B;  1JOR A;  3EBE A;  2CQO A;  4OON A;  1WYD A;  3KF6 B;  4FVM A;  3QB3 A;  2F0V A;  3U9O A;  2E74 C;  4Y52 H;  2F0U A;  2ZM6 Q;  3QIA A;  1EZ6 A;  1NCV A;  5CV6 A;  1QCB D;  3CMA A;  2SEB D;  2VB3 X;  3HFZ B;  4K0K Q;  3HOW G;  3K6O A;  4OIJ A;  1PRT D;  3GDE A;  1BDO A;  5IGC A;  4DAY A;  5JJZ A;  2YV5 A;  2CQA A;  2MO1 A;  3S16 H;  1STN A;  2LS0 1;  4LF7 Q;  4V0B A;  1RD9 D;  4LFC L;  4AQY Q;  3NUC A;  3JAM i;  3RZO B;  1IYV A;  3GD7 A;  1BF4 A;  5LL6 S;  4HIM A;  3OOC A;  1PTO C;  1WCM B;  4RKB A;  3H15 A;  1PV4 A;  4K0K L;  5BR8 L;  2HCC A;  2QCP X;  4KHV A;  1TS5 A;  3ULP A;  2K5Q A;  2K28 A;  4DUY L;  3I8Z A;  1WI5 A;  5DM7 3;  4IPC A;  3I3C A;  2CCZ A;  1YNN D;  5IYC H;  1QUQ B;  1VQ7 A;  5M5Y B;  3FPU B;  1XNR Q;  1WCM H;  3DM3 A;  2EPB A;  2VS1 A;  1T5X D;  5T1G A;  4C3J G;  1VQK A;  4BY1 H;  2D9U A;  4J15 A;  4JI5 L;  3I4N G;  1D7Q A;  4GLX A;  4CDF C;  3KLR A;  2O2L D;  3UI2 A;  3TRZ A;  2WB1 E;  3FMC A;  2IX1 A;  3NEL A;  5D3I B;  1B44 D;  2K4K A;  3A55 A;  3G71 A;  4HMI A;  5GRO A;  2X6L A;  1BUV T;  4MIU A;  4WRD A;  3DLL A;  5EAY A;  5FOB B;  2K5W A;  1SFO B;  1WD0 A;  1DM0 B;  2IHE A;  4RA8 A;  1E1T A;  1G8Z D;  3Q24 A;  4FXG C;  2EYM A;  4BBR B;  1ENC A;  3M4O B;  2D62 A;  3L3O C;  5HGQ A;  3RNU A;  1B70 B;  3U4Z A;  1LUZ A;  2MUY A;  1F9Q A;  1FVI A;  2HIX A;  3MEF A;  2ZXP A;  1SMY D;  2L1B A;  4QIW B;  2NZO A;  1RL2 A;  1BCP D;  4IJL A;  4C3J H;  1JOO A;  3O13 A;  1HNX Q;  2B39 A;  4A93 H;  2QEJ C;  3HOZ H;  4XYQ A;  1PFS A;  3EJI A;  4BA2 I;  4KHP Q;  1Q7Y C;  1I50 H;  4LFA L;  2IT1 A;  1VF5 C;  4LW1 A;  1HHV A;  4XIG S;  3GTK B;  1PMR A;  4RCN A;  5C0X H;  5ELD A;  3TZU A;  2JSO A;  4JPB W;  4RFB A;  5J1Z A;  4DAY B;  4C3J B;  4JI4 Q;  2MHV A;  1KNE A;  4ALP A;  4F7X A;  1HPC A;  2A68 D;  2DNE A;  4DUZ L;  3M4P A;  3P75 A;  2RCF A;  2EE1 A;  1RIP A;  4OHJ A;  1VQJ A;  1LT5 D;  2J4X A;  4NXN L;  4IPH A;  2WKD A;  1QZG A;  3LX0 A;  3DUZ A;  5ELC A;  1VQI A;  3H91 A;  4M1U B;  5ELB A;  3PQI A;  4Q5V A;  4A3F G;  1W2B A;  1I4G A;  3HG9 A;  2M9V A;  4IUV A;  3AQQ A;  2XVS A;  2PQA A;  1E3P A;  2A69 D;  4JI8 Q;  2FMM A;  4IN3 A;  1GD7 A;  3KLS A;  1NAP A;  1RTN A;  3P7J A;  3BZC A;  1ZYR D;  4NXM Q;  1KDB A;  1SXT A;  2L12 A;  4QMG A;  2NVT H;  3K7U C;  3I4O A;  1IL8 A;  1UEA B;  4OO1 H;  1N9W A;  1Z6H A;  1VQD A;  5JEA J;  1A8V A;  3MA2 B;  2I46 A;  1JE4 A;  1Y1W B;  3VR3 A;  3GTP H;  1U9R A;  2E5L L;  1V1O A;  2QDB A;  1DCZ A;  3DXJ C;  2K75 A;  3KFU A;  1A3U A;  2F4V Q;  4H0L C;  1RJT A;  5M5W B;  4FDB A;  5IYC G;  1LTL A;  4LMQ D;  3KLW A;  5FLM G;  1U0L A;  4FF1 A;  2UXB Q;  1YHQ A;  4C3H B;  1Y1W H;  1PTO F;  3S1N H;  1SRU A;  3B6Y A;  1LV9 A;  1N36 L;  2JA8 H;  1TWA B;  3NQI A;  4QGU A;  3ND9 A;  2SDF A;  2B2Y A;  3I4N H;  5AJ3 L;  4DV1 Q;  1LTI D;  4MZ9 A;  4LF4 Q;  3JAM L;  2K03 A;  1KAA A;  3TP8 A;  3CXC A;  5M3F H;  1G29 1;  2OWO A;  1Q12 A;  1M90 C;  2PO4 A;  3NEM A;  4J1M A;  2NUC A;  1J9O A;  3VA7 A;  2DY8 A;  2UXD Q;  1IZ6 A;  4JV5 Q;  4UP7 A;  4EQ5 A;  1TWA H;  4IOA A;  1QOH A;  5G3L F;  3J7A V;  5CV7 A;  3W1G A;  5H1S E;  1R9T H;  1ASZ A;  2AQ1 B;  1ZEQ X;  4RG1 A;  1JCK B;  1S3O A;  3K80 C;  1ET9 A;  1HR0 W;  1TR5 A;  3C2P A;  2WII B;  1OXU A;  2BA0 A;  4K5V A;  1K0R A;  1A2U A;  4HCE A;  2RVL A;  2HHH L;  2EXD A;  1WTH A;  1I6H B;  3D4W A;  3GTG B;  2RHS B;  5BR8 Q;  2X69 A;  4BY7 G;  2JP1 A;  4I7A A;  2E75 C;  4JK1 C;  4ZLT F;  2MGS A;  3CKI B;  4QUC A;  3G4S A;  2K6A A;  3TS0 A;  1SE2 A;  3K58 A;  1Q46 A;  4DV4 Q;  4GOP B;  2XIW A;  2NB0 A;  1LM0 A;  4LF6 L;  1KQS A;  1PYB A;  1H9S B;  3GO5 A;  3T1H L;  1GHK A;  5A2Q L;  3M3Y B;  3S1M H;  1SNQ A;  4JOI C;  1O7Y A;  4EQN A;  2JK8 A;  1K8M A;  4A3K H;  2GN5 A;  2F3W A;  3V05 A;  1QJO A;  3H0G G;  4DV4 L;  2L55 A;  1HNZ Q;  1Y14 B;  5DLQ E;  2ATW A;  3NQT A;  1E7Z A;  3S17 B;  2PI2 E;  2FMC A;  3M3Y H;  3QR8 A;  3AU7 A;  2JEA I;  2EDG A;  2K50 A;  3PIP 3;  3MZ5 A;  2VUM B;  4C56 C;  4C2M H;  1BCP C;  2DN8 A;  2QF7 A;  1SNM A;  3K5L A;  4FF4 A;  1X65 A;  4YIJ A;  1QVC A;  4LNQ A;  3H3V H;  2JA5 G;  4JI6 Q;  4YCV A;  2Q8R E;  3CPF A;  2B2W A;  3OHX C;  1CQV A;  1EQR A;  2WAC A;  2NZH A;  4IUU A;  2DY7 A;  1IBL Q;  2Y0S E;  3GQB A;  2BOS A;  1TT2 A;  1E2W A;  1M4V A;  3RZO H;  3S1R H;  1N32 Q;  1IKM A;  4OO1 I;  4IFD J;  1MIU A;  4DR4 L;  3A56 A;  4A3M B;  3PSI A;  4CJ2 C;  5KEE A;  3PIP A;  5IGF A;  1VQ8 A;  3D4R A;  2F03 A;  2F0M A;  4RKL A;  3SK6 A;  4C3H G;  2JA7 B;  3NWS A;  1K83 B;  4ZUJ A;  2GVB A;  4P71 A;  2A73 B;  1EEF D;  4UP8 A;  1H9R A;  2Z8L A;  3LWE A;  2R61 A;  1KLU D;  4DV7 L;  3CQZ H;  5FLX L;  2QDL A;  3F1Z A;  3A8J E;  3Q23 A;  3CCL A;  4BBS G;  3CCM A;  1LTS D;  1GJX A;  5M3M H;  2BE5 C;  1B9N A;  3SDZ A;  2JA7 H;  1STE A;  4WJW A;  2Z4H A;  1J8I A;  1DZ1 A;  1O7L A;  2N3S A;  2RA4 A;  5JVG 3;  4R4Q A;  1F2Y A;  4CKB A;  5T1I A;  3N6R A;  4DR2 Q;  2PNR C;  3K5O A;  3BYY B;  5IWA L;  1HRJ A;  1EY0 A;  1YZ6 A;  3J81 j;  1C8C A;  2UXC L;  2CW0 C;  3HOY G;  4IJH A;  4KV6 A;  3M7N A;  4LFB L;  1EL0 A;  1N34 L;  4NP5 A;  2A6E D;  2EYO A;  2R3Z A;  1JJ2 A;  1YHA A;  4BBR H;  3M4O H;  4FP5 D;  2F0W A;  5TSS A;  1S5E D;  5IWA Q;  2R7Z G;  2NBF A;  4TSS A;  5C3E G;  4O0A A;  1EU4 A;  3LNN A;  3I55 A;  3K57 A;  5CV5 A;  1QB5 D;  4HJ8 A;  3CRL C;  3VYU A;  1IXR A;  3GTO H;  4HSP A;  4DNT B;  1S72 A;  4RGM A;  4I7Z C;  2F0I A;  2IJ0 A;  2K33 A;  1PH9 A;  3HOZ B;  1A3V A;  1J6Q A;  1EY9 A;  2K01 A;  4HAE A;  3HOX H;  4QCL A;  3HRZ C;  4TKO B;  2UU9 Q;  3C3L A;  4OEL B;  5FJ8 H;  3QWN A;  2UUB Q;  1R4Q B;  4GNX B;  4HJ9 A;  3S2D B;  2ZJR A;  1TKW B;  1N8R C;  3D3R A;  1SYC A;  1E24 A;  2ZM6 L;  3HOX B;  5KIX A;  1ESF A;  3F2C A;  2VXW A;  5IGG A;  5DAU A;  4DR4 Q;  3DHQ A;  2E2H B;  1UE1 A;  1TWC B;  4BBS H;  1NTG A;  1SAP A;  3S2D H;  4L63 B;  2RSO A;  4YCW A;  3CCV A;  4X3K A;  5C3X A;  4K8J A;  3RD4 A;  4B9X A;  3ITP A;  4BXX G;  2QW7 A;  1SN8 A;  4DK6 C;  1HUN A;  4KJO A;  1HQR D;  4C1N I;  4A75 A;  4RGO S;  1JR0 D;  4ZKC B;  1LLR D;  1DYQ A;  1PA6 A;  5C4X B;  5IGD A;  1TWC H;  1UAP A;  3RN5 A;  2A5H A;  4K5X A;  4DV0 L;  4OXP A;  2BH2 A;  4KKS A;  5KRU A;  1JWS D;  1LT6 D;  1D1I A;  1EWC A;  1AN8 A;  2XSC A;  1EYG A;  2NVT B;  2F0Q A;  3G6E A;  5IP9 G;  4KLK A;  1VQP A;  4PQX A;  4X62 Q;  2EY5 A;  4ME3 A;  3KK7 A;  2F0E A;  2CFM A;  3CCQ A;  1VQO A;  2BDN A;  2NVY B;  1NUC A;  2L4N A;  2R7Z H;  1Q8I A;  3W3A A;  4DR6 Q;  4DNI A;  3PO3 G;  1XXG A;  2R92 G;  2B2V C;  2EVB A;  4CDC C;  1HNZ L;  2KJX A;  2MO0 A;  3SR1 A;  1CA6 A;  1KC8 C;  3J7A 5;  1BKB A;  1N36 Q;  1MI2 A;  1O80 A;  1JOK A;  1OTC A;  1X54 A;  2K32 A;  1H95 A;  4B9W A;  3Q6S A;  2KHS A;  4DA2 A;  4A3E G;  2B2V A;  1VQ5 A;  1Q8K A;  4LAA A;  1E2Z A;  2GVA A;  3VDY A;  1SYD A;  4F8M A;  3K7A B;  2VQF Q;  1LO5 D;  3T53 B;  2VZA A;  2MPM A;  5CYU A;  1IHZ A;  4NXN Q;  3T4A C;  4C1N K;  4GOP C;  1GUT A;  3NEN A;  2K5V A;  1H9K A;  4ABN A;  3FRP B;  5IT9 E;  1VQL A;  2K5N A;  3LWU A;  4XQJ A;  2KCM A;  3L9A X;  3NPP A;  1QZH A;  1S5D D;  4PV1 C;  1KIX A;  1II3 A;  1VMP A;  5GAE C;  1CM9 A;  4WJ3 M;  2TMP A;  1Z9F A;  5GAD C;  3GTG H;  4DK3 C;  1CSQ A;  1ZXT A;  1XTD A;  5C0X J;  2JJQ A;  2QEX A;  1PZJ D;  1O78 A;  2YTV A;  1TS4 A;  4P72 A;  4JI3 L;  5G3L D;  3I90 A;  3HOV H;  1HZB A;  1I5F A;  3J81 L;  4KY7 A;  3URY A;  4A3I H;  2L15 A;  3RMH A;  4A3D B;  4UDU C;  2EZV A;  4DXG A;  4BXX H;  2F0G A;  1XNQ Q;  1PHJ A;  1G91 A;  4B3M Q;  3PCO B;  4H7B A;  1Q90 A;  3S1M B;  3KF6 A;  5JPM C;  1Q1E A;  5NUC A;  3T1Y L;  3PUW A;  4FNF A;  3HOU G;  4DR7 Q;  3CD6 A;  1Q82 C;  3D0F A;  4KY5 A;  4A3K B;  4U67 3;  1CZG A;  2ZJP A;  3S2H B;  4U68 A;  1FNW A;  2PQE A;  2RCN A;  1WTQ A;  4GNX C;  4A93 B;  2EXZ A;  1EQQ A;  1OXX K;  1UUP A;  5IE8 A;  2SNM A;  3STB D;  2Q2T A;  1I50 B;  1V1P B;  4GLA C;  4YWL A;  1JWM D;  2XTI A;  3CCJ A;  1XNQ L;  1W3S A;  4CBV A;  1B3A A;  1S4Z A;  3OIP A;  3S1Q B;  2HIV A;  3FKI G;  1JMC A;  2RQX A;  3HOX G;  1TVX A;  2ZJQ A;  2ICE C;  1KDA A;  2RF4 A;  4IAL A;  4JV5 L;  1YI2 A;  2RDG A;  4LF8 L;  2M00 A;  3H09 A;  2AUJ D;  2ZTD A;  3PO3 H;  4DR5 Q;  4HCS A;  1H9M A;  1V9P A;  3AMU A;  2PZT A;  1B50 A;  1PH3 A;  2YYZ A;  2WB1 B;  3Q22 A;  1KXL A;  1SND A;  2PZU A;  4DR3 Q;  1HTL D;  4B3T L;  2NVQ B;  4A3D G;  3KDF A;  1MJE A;  3K0Y A;  2BDO A; 
#chains in the Genus database with same CATH homology
 5ELN A;  4GN3 B;  3KLW A;  1SMX A;  5FLM G;  4YHH Q;  1U0L A;  3J81 c;  1VQ4 A;  5C44 H;  1YHQ A;  3S1N H;  1Y1W H;  1CUK A;  5LMN L;  2UXB Q;  4PZ6 A;  1SRU A;  3GTJ H;  3B6Y A;  4JI1 L;  1N36 L;  4RMF A;  1K8G A;  3S24 A;  2JA8 H;  4QGU A;  1YEZ A;  2FXQ A;  2R92 H;  4B3R L;  5E7N A;  1A63 A;  1G51 A;  2PI2 A;  4LF6 Q;  3I4N H;  1OXS C;  2ZTE A;  4MZ9 A;  5AJ3 L;  4DV1 Q;  4LF4 Q;  1C0A A;  1VQ9 A;  2AMC B;  4KI0 A;  3CXC A;  1KRS A;  2RHQ B;  4A3I G;  5M3F H;  1G29 1;  2AWO A;  4JI2 L;  3GTL H;  1PH5 A;  2OWO A;  1Q12 A;  1M90 C;  2B3G A;  1TWG H;  3NEM A;  2NN6 G;  4DR6 L;  2VY3 A;  4PZ8 A;  3CF5 A;  3TQY A;  1WOC A;  1YJW A;  2ALY B;  4HJ7 A;  1IZ6 A;  5IP9 H;  4JV5 Q;  2UXD Q;  2R7D A;  3I4M H;  4UP7 A;  3TS2 A;  1PYS B;  1SR3 A;  1TWA H;  3PUV A;  4EQ5 A;  4IOA A;  5K36 G;  4X65 Q;  3W1G A;  5H1S E;  2A1A A;  4DAM A;  4LFA Q;  1R9T H;  2E8G A;  4UPA A;  5AJ3 Q;  4RG1 A;  4DV1 L;  1ASZ A;  3HOU H;  1S3O A;  3FP9 A;  3K80 C;  4DV3 L;  4JI6 L;  3S1Q H;  3A74 A;  4KHZ A;  1HR0 W;  3PF4 A;  4DUY Q;  4JBK A;  1OXU A;  3HKZ G;  5IYD H;  2BA0 A;  3RLF A;  2I0Q A;  1K0R A;  2DGY A;  4IO9 A;  2HHH L;  2EXD A;  4GNX A;  1HZC A;  2XGT A;  1X3G A;  5LMU Q;  1T9H A;  2RHS B;  5BR8 Q;  1K9M C;  1VQA A;  4BY7 G;  5HY6 A;  1CSP A;  1EUJ A;  3KYH C;  3W1B A;  5FJ8 G;  4P73 A;  3CCS A;  1NY4 A;  4HIO A;  5JJL A;  3L2P A;  3M85 A;  2JA8 G;  2VUM G;  3JC6 6;  3NBH B;  3G4S A;  4OX9 Q;  3U4V A;  3T1Y Q;  1YNX A;  2NVQ H;  1PVO A;  1G6P A;  2C35 B;  4DV5 Q;  3TS0 A;  5M5W H;  2HHH Q;  2YTX A;  1Q46 A;  1FL0 A;  4DV4 Q;  4JI7 L;  3HKS A;  4GOP B;  4DR1 Q;  4IOC A;  2F3I A;  5LMU L;  2OQ0 A;  1LM0 A;  4LF6 L;  2ES2 A;  3K8A A;  3PIO A;  3PGZ A;  5LMN Q;  1KQS A;  3IRB A;  1PYB A;  3GO5 A;  3BU2 A;  3T1H L;  5M3F G;  4XTC S;  3S1M H;  2H5X A;  4JOI C;  3J80 c;  1Q1B A;  2JK8 A;  2F4V L;  2KBN A;  4P75 A;  3S14 H;  1IBK L;  1EIF A;  4A3K H;  4A3M G;  2GN5 A;  2UUA Q;  2JA6 H;  3S15 H;  3J80 i;  4IPD A;  2UXD L;  3TEH B;  4DV6 Q;  3H0G G;  1NMF A;  4DV4 L;  4IFD I;  1WFQ A;  1S40 A;  1HNZ Q;  1BBW A;  5C44 G;  2AHO B;  1Y14 B;  2WFW A;  5DLQ E;  5FLM H;  2ATW A;  1Q86 C;  1E7Z A;  1L1O C;  4A3G H;  3UDI A;  2UUC Q;  2PI2 E;  1AE2 A;  1L1O B;  1I94 L;  2JA6 G;  1VQ6 A;  4LF4 L;  3M3Y H;  1FJG L;  4HJ5 A;  3KDF B;  2JEA I;  1I6H H;  2K50 A;  3J7Z C;  3RZD H;  1X55 A;  4B3R Q;  1IYJ B;  4C2M H;  3OW2 A;  1TWF H;  1XPU A;  3EN2 A;  3I56 A;  4LF9 L;  1WCM G;  4DKA C;  2JE6 I;  2AWN A;  1X65 A;  2AKW B;  1KAW A;  3PV0 A;  1PH8 A;  1JJG A;  2ID0 A;  1QVC A;  4DPG A;  1PH1 A;  4LNQ A;  3H3V H;  4A3G G;  3AEV A;  2PNH A;  4PMW A;  2JA5 G;  4BBR G;  1CKN A;  4DV3 Q;  3F2D A;  4YCV A;  4JI6 Q;  1SLJ A;  1Y1V H;  1JB7 A;  2UUB L;  3MXN B;  3CPF A;  4YCU A;  1X56 A;  4OWX B;  3GTM H;  3PO2 H;  1U5K A;  2B63 G;  1EQR A;  5ELO A;  3M4Q A;  1XMQ L;  1SE8 A;  4HIK A;  4JBW A;  1JE5 A;  2NZH A;  3G48 A;  1V1Q A;  4C3I H;  1HNW L;  1IBL Q;  2E5L Q;  2Q2H A;  1AE3 A;  3J81 i;  2Y0S E;  1HZ9 A;  4AQY L;  1B7Y B;  4B3M L;  3RZO H;  4KHP L;  3S1R H;  1N32 Q;  2BA1 A;  4OO1 I;  1CKN B;  4UP9 A;  1TWH H;  4C3H H;  2K5H A;  3KOJ A;  1HZA A;  5IP7 H;  3CW2 C;  1XMO L;  4IFD J;  1MIU A;  1UWV A;  4DR4 L;  3E0E A;  1HR0 Q;  4AIM A;  4A3F H;  2MNA A;  2OTL A;  1EWI A;  3PSI A;  2KHI A;  4JI0 Q;  4JI3 Q;  4NXM L;  4YY3 Q;  2VUM H;  2B29 A;  3PIP A;  5C0X I;  3I4M G;  1CKO A;  2HQL A;  1VQ8 A;  4IFD G;  4R4T A;  2WAQ E;  4JOI A;  1K73 C;  3E9H A;  4AH6 A;  1QVG A;  4NB3 A;  3Q8D A;  1XPR A;  1GO3 E;  1VQN A;  1UE5 A;  2VQF L;  1PH2 A;  1HNW Q;  2GVB A;  4P71 A;  4UP8 A;  3CCU A;  1VCI A;  4X66 Q;  1WJJ A;  2E2J H;  1BVS A;  3I2Z A;  4JC0 A;  1JT8 A;  2WB1 G;  5IYD G;  2I5M X;  4DV7 L;  3CQZ H;  2UU9 L;  1GKH A;  2V1C C;  1AH9 A;  3F1Z A;  3CCL A;  4HJA A;  4GKK Q;  4BBS G;  3CCM A;  2VNU D;  4PG3 A;  1JJC B;  1EIY B;  4MTN A;  4Y7N H;  2Z6K A;  4AYB E;  2JA5 H;  5M3M H;  2JQO A;  2QA4 A;  1L2F A;  2JA7 H;  3T1H Q;  2E2I H;  4JYA Q;  4LUO A;  3CC2 A;  2N3S A;  2ZTC A;  1C9O A;  1K3R A;  2YTY A;  4GN5 A;  3KJP A;  4R4Q A;  2I5L X;  1VQM A;  4YWK A;  1P16 A;  4R1J A;  4DR2 Q;  1HR0 L;  5IWA L;  4H02 A;  4POF A;  1YZ6 A;  4JCV E;  3CCR A;  4JI8 L;  2Z6K C;  3J81 j;  1L1O A;  3ULJ A;  4OWW B;  2YU9 H;  4QQB X;  2UXC L;  1YJ9 A;  3HOY G;  1O7I A;  4IJH A;  2E2H H;  4LF7 L;  3M7N A;  4LFB L;  3M9B A;  1N34 L;  1IBK Q;  1DGS A;  2VQE L;  4OO1 G;  3CP0 A;  1Y1V G;  1IBM L;  1MKH A;  4GN4 B;  1JJ2 A;  3F8T A;  4QIW E;  1YHA A;  4BBR H;  3FKI H;  3M4O H;  1NBW A;  1NMG A;  1MJC A;  1K83 H;  4A3M H;  4A3K G;  1HH2 P;  2CWP A;  4YHH L;  4A3B H;  5IWA Q;  2R7Z G;  1X9N A;  4X64 L;  4A76 A;  4JBJ A;  4BY1 G;  3L0O A;  4A3L H;  2OQK A;  4LF9 Q;  5C4X H;  5C3E G;  4O0A A;  2R93 H;  2MQH A;  3I55 A;  1YHB A;  1TXY A;  2PMZ E;  3WWV A;  4HJ8 A;  1XJV A;  3UDF A;  4OX9 L;  4GKJ Q;  2PQA B;  1KRT A;  1HJP A;  2JEB I;  3SGI A;  3ERS X;  1IXR A;  5LMN W;  4DV2 Q;  4JI5 Q;  3GTO H;  4A3B G;  1KD1 C;  2Z0S A;  3KF8 B;  2JA7 G;  3ZJY C;  1S72 A;  4LF5 Q;  1GM5 A;  3S17 H;  1PH9 A;  4LF8 Q;  2VW9 A;  1J6Q A;  2EQS A;  4X62 L;  4LF5 L;  2QGQ A;  3CPW A;  3HOX H;  2UU9 Q;  1CKM A;  3EBE A;  2CQO A;  2UUC L;  3PUY A;  5FJ8 H;  4OON A;  3U58 A;  2UUB Q;  1WYD A;  3KF6 B;  4GNX B;  4HJ9 A;  2EIF A;  3UDG A;  4LWC A;  4Y52 H;  2ZM6 Q;  1J5E L;  4L5Q A;  4EX5 A;  4LUZ A;  2ZJR A;  1N8R C;  1UEB A;  1X6O A;  3CMA A;  1XPO A;  1E24 A;  1LYL A;  3HFZ B;  4K0K Q;  3HOW G;  2ZM6 L;  1J5E Q;  1VQF A;  4DV0 Q;  3GDE A;  4BA1 I;  4L5S A;  4R4I A;  3F2C A;  5C0X G;  4HID A;  4DR3 L;  1IBM Q;  2YV5 A;  2VQE Q;  2MO1 A;  4DR4 Q;  2D0O A;  4QJF A;  4DV5 L;  1NJI C;  3S16 H;  1UE1 A;  2ASB A;  5M5X H;  1SFO H;  4LF7 Q;  2CKZ B;  1NTG A;  4BBS H;  4LFB Q;  4QY7 A;  4NPS A;  2R6G A;  4DR1 L;  1I94 Q;  3S2D H;  4YCW A;  3CCV A;  4LFC L;  4R4O A;  4AQY Q;  2IX0 A;  1VQH A;  3JAM i;  1KL9 A;  4DR5 L;  3OYY A;  3GD7 A;  3K7A H;  1KHI A;  4LFC Q;  4BXX G;  4A93 G;  1SN8 A;  3A0J A;  4DK6 C;  1N33 L;  4A75 A;  1V43 A;  4HIM A;  4O2D A;  1PH6 A;  1XNR L;  3BJU A;  1EFW A;  3H15 A;  1PV4 A;  1X3F A;  2BH8 A;  4L5R C;  2UXB L;  4K0K L;  2Q2U A;  3I7F A;  1K8A C;  1PA6 A;  5BR8 L;  4POG A;  1TWC H;  2B63 H;  3CME A;  3ULP A;  3RN5 A;  1VQG A;  1QVF A;  4DUY L;  4DV0 L;  4OXP A;  5JJK A;  3ICE A;  2BH2 A;  1WI5 A;  3D31 A;  5IYB H;  4IPC A;  3BZK A;  3EIV A;  1PH4 A;  3S2H H;  2CCZ A;  1VQC A;  2CWA A;  1QUQ B;  5IYC H;  4A4I A;  1EYG A;  1VQ7 A;  3G6E A;  5IP9 G;  3AYH B;  4KLK A;  1VQP A;  1XNR Q;  5JJI A;  2WP8 J;  3HOW H;  1WCM H;  3DM3 A;  4X62 Q;  3CC4 A;  3TRE A;  4ME3 A;  2VS1 A;  2UXC Q;  2R93 G;  4AYB G;  2CFM A;  1D8L A;  2Y0S G;  5GAH C;  1VQK A;  3CCQ A;  4JBM A;  1VQO A;  4B3S L;  4BY1 H;  4A3E H;  2JA9 A;  4DR2 L;  4JI5 L;  4J15 A;  3I4N G;  2R7Z H;  1D7Q A;  4GLX A;  1OXV A;  4LUV A;  4DR6 Q;  4DNI A;  3PO3 G;  1M1K C;  4YY3 L;  5JEA G;  3PUX A;  2R92 G;  3TRZ A;  2WB1 E;  4JI2 Q;  1HNZ L;  2MO0 A;  4JYA L;  2IX1 A;  4JG2 A;  3NEL A;  1KC8 C;  3J7A 5;  1BKB A;  1N36 Q;  4GKJ L;  3H0G H;  2K4K A;  3G71 A;  1OTC A;  5GRO A;  1X54 A;  1L0W A;  4A3J G;  1H95 A;  4X64 Q;  5FLX c;  3RN2 A;  4MNO A;  1FGU A;  5EAY A;  3DLL A;  3PF5 A;  3GTK H;  4GS3 A;  5IT9 c;  2DUD A;  4A3E G;  4WJ4 A;  4DV7 Q;  1VQ5 A;  1Q8K A;  5C4X G;  1Z47 A;  2IHE A;  1N34 Q;  1E1T A;  2GVA A;  3VDY A;  4B3T Q;  3L7Z C;  1EOV A;  2OCE A;  3AFP A;  3STB C;  2VQF Q;  2VZA A;  4A3J H;  5GQO A;  3CAM A;  4APV A;  2D62 A;  5HGQ A;  3LGJ A;  4DV2 L;  3RNU A;  5M3M G;  4UY8 C;  4PZ7 A;  3KJO A;  3GTQ H;  4DR7 L;  1B70 B;  3U4Z A;  4NXN Q;  1LUZ A;  5IYB G;  1ASY A;  1C7Y A;  1FVI A;  2N78 A;  3ER0 A;  4GOP C;  2HIX A;  3JAM c;  1Q81 C;  2LXK A;  2N49 A;  3NEN A;  3MEF A;  2K5V A;  1YIT A;  1PH7 A;  3HOY H;  1GVP A;  4JI4 L;  1VQL A;  2K5N A;  4BY7 H;  1E22 A;  2NZO A;  1RL2 A;  2LXJ A;  3K0X A;  4DUZ Q;  2KCM A;  1YJN A;  1QZH A;  1N32 L;  4IJL A;  4C3J H;  1HNX Q;  4A93 H;  1YVC A;  3HOV G;  3OTO L;  3HOZ H;  1KIX A;  2A8V A;  1PFS A;  5GAG C;  3U50 C;  5GAE C;  3CCE A;  1A0I A;  1VQB A;  4BA2 I;  4WJ3 M;  4KHP Q;  2R7F A;  1Q7Y C;  1I50 H;  4LFA L;  1Z9F A;  2IT1 A;  3UE1 A;  2NN6 I;  2NVY H;  4DK3 C;  4LW1 A;  5GAD C;  3GTG H;  1CSQ A;  4XIG S;  2A19 A;  2OTJ A;  1UE6 A;  2KEN A;  3CC7 A;  1XTD A;  1VQE A;  2JJQ A;  3UE0 A;  5C0X J;  2QEX A;  3E9I A;  3FHW A;  4OWT B;  3ULL A;  1NE3 A;  2YTV A;  4DAY B;  4P72 A;  4JI3 L;  3OTO Q;  4JI0 L;  4JI4 Q;  4ALP A;  3HOV H;  3F2B A;  3HOZ G;  1HZB A;  1I5F A;  3PUZ A;  2HT1 A;  4YWM A;  4DUZ L;  4A3I H;  2L15 A;  1X3E A;  3M4P A;  2D0P A;  2KHJ A;  1XMO Q;  1RIP A;  2I5H A;  3K81 C;  3UDX A;  1I3Q H;  4BXX H;  1VQJ A;  4NXN L;  1XNQ Q;  2K52 A;  4IPH A;  1PHJ A;  1BBU A;  1OXT A;  3RLN A;  5IY0 A;  4GKK L;  4X6A H;  4B3M Q;  3PCO B;  4JI1 Q;  4TVA B;  3HKZ E;  1QZG A;  1YIJ A;  3KF6 A;  4QL5 A;  1Q1E A;  4R4C A;  1B8A A;  3T1Y L;  3PUW A;  3HOU G;  1SRO A;  4DR7 Q;  1VQI A;  1Q82 C;  3CD6 A;  3D0F A;  1Y1W G;  2MFI A;  3W5O A;  2ZJP A;  4P74 A;  4A3F G;  1W2B A;  1FJG Q;  1IBL L;  2F52 A;  2LSS A;  2RCN A;  5IP7 G;  4DV6 L;  3RR5 A;  4TQU S;  4X66 L;  4GNX C;  1XMQ Q;  2WAQ G;  1EQQ A;  3AQQ A;  5C4J H;  1OXX K;  2PQA A;  1E3P A;  2K14 A;  4JI8 Q;  5IE8 A;  1QUQ A;  1GD7 A;  4A3L G;  3STB D;  2Q2T A;  2KCT A;  4A3C G;  4GLA C;  4YWL A;  1E1O A;  2XTI A;  3CCJ A;  3A5U A;  1XNQ L;  3BZC A;  1W3S A;  4NXM Q;  4GLV B;  1YBY A;  3PO2 G;  2HIV A;  2NVT H;  5M5Y H;  3FKI G;  1P8L A;  1JMC A;  3HOX G;  3K7U C;  4X65 L;  3I4O A;  3AFQ A;  1VS0 A;  2N8N A;  2ZJQ A;  2RF4 A;  5J3B A;  1N9W A;  1A62 A;  2IHF A;  4IPG A;  4L5T A;  1VQD A;  4GOP A;  4JV5 L;  1N33 Q;  1YI2 A;  4LF8 L;  4A3D H;  5JEA J;  2IY5 B;  4JI7 Q;  1A8V A;  3RLO A;  2ZTD A;  3PO3 H;  4DR5 Q;  3GTP H;  4B3S Q;  2E5L L;  1UE7 A;  1V9P A;  3H3V I;  2NVX H;  4A3C H;  5C3E H;  1PH3 A;  3A5Z B;  2K75 A;  1IL2 A;  2YYZ A;  2UUA L;  3KFU A;  1KXL A;  2VL6 A;  2F4V Q;  4DR3 Q;  4B3T L;  1HNX L;  4A3D G;  2Q2I A;  3KDF A;  4FDB A;  5IYC G;  1LTL A;  1MJE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...