1VQJA

Gene v protein mutant with val 35 replaced by ile 35 (v35i)
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
86
structure length
86
Chain Sequence
MIKVEIKPSQAQFTTRSGVSRQGKPYSLNEQLCYIDLGNEYPVLVKITLDEGQPAYAPGLYTVHLSSFKVGQFGSLMIDRLRLVPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Context dependence of mutational effects in a protein: the crystal structures of the V35I, I47V and V35I/I47V gene V protein core mutants.
pubmed doi rcsb
source organism Enterobacteria phage f1
molecule tags Dna binding protein
molecule keywords GENE V PROTEIN
total genus 9
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 1996-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02303 Phage_DNA_bind Helix-destabilising protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1vqjA00
4C3IH 4QJFA 1TWFH 3U58A 3UDFA 2JK8A 3S2HH 4LUVA 1K0RA 2F3IA 3HOYG 5E7NA 4BBRG 2R92G 4A75A 4A3DG 4JI2Q 1WI5A 2PNHA 5BR8L 2WB1E 2I0QA 2QGQA 3TEHB 3M3YH 2VNUD 4X64Q 5C0XI 5IP7G 4OX9Q 2IHFA 1C9OA 2KCMA 2PI2A 1XPOA 1HNZL 1KRTA 4PZ6A 4DUYL 4Y7NH 3KOJA 5JJLA 4IJLA 3PO3G 4X66L 3TRZA 3AFQA 3ER0A 1HH2P 4KHZA 1XJVA 1Q1BA 1W2BA 5M3FH 1PH7A 4LNQA 4LWCA 3KDFB 3OYYA 2UUAL 3CXCA 1E1OA 4A3GG 1YVCA 1NTGA 4GOPC 2OCEA 2YV5A 3JC66 4DR5Q 5ELOA 4GN5A 1HJPA 3I4NH 4JOIC 3F2DA 3GO5A 2D0OA 3A74A 1NBWA 1LTLA 4A76A 2N3SA 4GOPA 4JV5L 3AQQA 4JI1L 5GAHC 3I4MH 4A4IA 4AQYQ 2OQKA 3CCUA 1HZAA 1L2FA 1XPUA 5IP7H 2JA7G 1TXYA 3K7UC 1YIJA 2E5LQ 3U50C 1VQ5A 4LFAL 1PVOA 4NXMQ 3I4OA 2VL6A 3B6YA 1PV4A 1IBLL 5C3EH 4R4OA 3PUXA 3STBD 1VQ6A 3G4SA 4AQYL 2RHQB 3UDGA 2JA6H 3RN2A 1XNRL 2ZTEA 3D31A 4DV0L 2RF4A 1X9NA 5M5YH 1EUJA 4PG3A 1L0WA 3CCEA 2ATWA 2PQAA 1K8AC 1U0LA 4DR6Q 3GTMH 3S17H 3BZKA 1HNXQ 1PH4A 3F2CA 1VQBA 1FVIA 2ALYB 4YCUA 3HOUH 1EIYB 2UXCQ 1VQFA 3W5OA 3ICEA 1T9HA 4K0KL 3HKZE 3IRBA 5C44G 1B70B 1MKHA 1Q86C 4A3KH 1QVGA 3CC4A 3CCVA 4LF4Q 5FJ8H 3MEFA 4JI6Q 4DR4Q 2EXDA 2JA5H 1L1OA 3PUWA 2BA1A 3HOXG 1I6HH 4HJ8A 2CCZA 4DV2L 3PIPA 2PMZE 4R1JA 2ZTCA 2HIXA 1YNXA 2JQOA 5GAEC 3CPWA 4DR1Q 1SFOH 1MJEA 1I94Q 1CKNA 1S3OA 3G71A 1VQKA 1B8AA 2Q2UA 2B63G 2F4VQ 2JEAI 2OQ0A 3G6EA 1BKBA 2R7ZG 5JEAJ 5IYBG 5IYCH 1SRUA 4GS3A 4DV2Q 4MNOA 2YU9H 4LF5L 3TS2A 1VQDA 2JEBI 4DV4L 1J5EQ 4IFDJ 2UUAQ 2F52A 4X65L 1KQSA 1KD1C 2WP8J 4QQBX 2WFWA 4LF8L 4BY1H 3M85A 3GTOH 1PH8A 2NZHA 1GKHA 1JJCB 3JAMc 1SMXA 4IPCA 3M4OH 4B3TQ 4BY7G 3HOXH 3T1HQ 3PSIA 4BBSH 1Y1VG 5C0XJ 4LF9L 5GQOA 4GOPB 2WAQE 1GD7A 2GVAA 2NVYH 2V1CC 2Z6KC 5BR8Q 1ASYA 3DM3A 1TWHH 1I3QH 4WJ3M 5IYBH 4YHHQ 1VQHA 4UY8C 3GTJH 1Y14B 4GNXC 1IZ6A 2VQEL 1YBYA 2VUMG 4X65Q 1IBML 3RLOA 3HKZG 1IBLQ 1XNQQ 4JBKA 1A0IA 1MJCA 3I7FA 5IT9c 3I56A 1J5EL 2VQEQ 3PF4A 2MO0A 1N9WA 3KLWA 4QL5A 5IWAQ 3DLLA 3K81C 3UE0A 4HJ9A 4O0AA 3GTGH 2B29A 1J6QA 2JA8G 4DV6L 4GNXB 1Y1VH 4KLKA 1CKNB 3HOZH 1X56A 4C3HH 1UE7A 4DR3L 3S16H 4QGUA 5LMNW 4GN4B 3HKSA 4DV3L 1UE1A 3GTLH 2Y0SE 1DGSA 1GO3E 4JI6L 4DR4L 1Q81C 2Y0SG 2IT1A 2VUMH 3J81c 1FGUA 5GAGC 1NMGA 4A3GH 3CCRA 4JI8Q 1HNXL 1SE8A 2JJQA 1N34Q 2PI2E 5LMUQ 2JA9A 4LFBQ 1X54A 3E0EA 1E1TA 1H95A 3ERSX 5C0XG 2JA8H 3I4MG 1RL2A 1PH6A 4JI7L 2JA7H 3KJPA 1XNRQ 4JV5Q 1I94L 1VQIA 3GD7A 1EQRA 3S1NH 2NN6G 1BVSA 5C4JH 1UE5A 4DV1Q 3JAMi 3EBEA 1OXXK 4MTNA 4BA1I 1OXUA 1VQCA 1PYSB 5ELNA 2K5VA 4A3CH 4DV1L 5J3BA 1NJIC 2K50A 3Q8DA 4BA2I 3OTOL 2VZAA 1QUQA 1K8GA 2FXQA 2LXKA 3KF8B 4P74A 4HJ5A 4B3SL 4POGA 2LSSA 4GLVB 3I4NG 1PH2A 3HOWH 2CKZB 1EOVA 2UUCQ 1VS0A 1S40A 1HNWQ 5IE8A 4B3SQ 4B3TL 4DR2Q 5C44H 1KL9A 2XGTA 3F1ZA 4NB3A 4A3BG 1R9TH 4IFDG 4TVAB 2EIFA 2ZM6Q 3T1YL 2JA5G 1OXVA 4JC0A 4AH6A 2AKWB 4UP7A 1TWGH 4JI4Q 4HJ7A 1V43A 4IOAA 2VY3A 4A3CG 1SN8A 3S1QH 1PYBA 3KF6A 3RR5A 2B63H 1XMOQ 4LUZA 4P75A 4LFCQ 1QVCA 2IX1A 3CMEA 4JI2L 2VW9A 4DV7L 3S1MH 5M5XH 3EIVA 1X3GA 1V9PA 3HOWG 5IWAL 2D0PA 4RG1A 1W3SA 1XMOL 4P73A 4A3MG 2CWAA 2ZJPA 1VCIA 4TQUS 4OO1G 1YITA 2CQOA 1Z47A 3PV0A 4YWLA 4MZ9A 5IYDG 1C7YA 2HHHQ 4FDBA 4DV5L 4C2MH 3CMAA 5LMNL 1Y1WG 3MXNB 5H1SE 4JOIA 3HOVG 1GM5A 3LGJA 3F2BA 3H0GH 4R4QA 4X64L 3J80i 4YY3L 2OTLA 1IL2A 1YJ9A 4YCVA 4YWKA 1A63A 4AYBG 2R7FA 4YY3Q 2C35B 4A3EG 3ULPA 1G51A 5C4XG 3W1BA 4IPDA 3J81i 4GN3B 3PIOA 4GLXA 3TREA 3H3VH 1K83H 3U4VA 4H02A 4DV0Q 2R7ZH 5K36G 4ALPA 1N36L 4NXNL 3L7ZC 1E24A 3M7NA 3UDIA 4KI0A 2E2IH 2D62A 5HY6A 2N8NA 3E9HA 4JYAQ 1QZHA 1K73C 4A3FH 4LFAQ 1TWCH 1N33L 5JJIA 1QVFA 3RNUA 4QIWE 4GKKL 4A3DH 4PZ7A 2KCTA 1L1OB 1XMQQ 3HOZG 4K0KQ 2I5LX 2UXDL 3I55A 2E2HH 4BBSG 3H0GG 1OXSC 4HIOA 4L5RC 4A93G 2R92H 3M4PA 3CD6A 5M3MG 4A3EH 1Q12A 4DKAC 2AWNA 2DGYA 4JBJA 4JI3L 4DAMA 1PH9A 1N34L 1PFSA 2I5HA 5AJ3L 4LFBL 4JI4L 4UP8A 5M3FG 1HR0Q 1L1OC 2E8GA 2Q2TA 1AE3A 4R4TA 1M1KC 1K9MC 3F8TA 2MQHA 3BJUA 4OWXB 4B3RL 4P72A 3CC7A 3H15A 3CCQA 1Q7YC 3J7A5 1JJGA 2Q2HA 4RMFA 1KRSA 1S72A 1GVPA 2EQSA 3CPFA 4JI7Q 4A93H 2H5XA 1FJGL 1YHQA 4YWMA 5IY0A 4OWWB 4L5QA 4DR5L 4XTCS 3SGIA 1SROA 5C3EG 1YJNA 2R93G 3L0OA 4JG2A 1JJ2A 3K7AH 3FHWA 4HJAA 2ZTDA 4HIMA 4JI0L 4LF4L 2MNAA 4IFDI 4L5TA 5GROA 3T1YQ 2R6GA 2NVTH 3GTPH 2HQLA 1NY4A 1AE2A 1VQMA 2DUDA 4X66Q 1VQ8A 4LF6L 2Q2IA 3VDYA 4DUZQ 3GDEA 3KYHC 3STBC 4DAYB 4DV7Q 1KC8C 2GVBA 2WAQG 2KENA 4IPHA 3UDXA 4DV3Q 1Q82C 3A5ZB 3M9BA 3UE1A 1K3RA 2VQFL 3S14H 2AMCB 2MO1A 2GN5A 3K8AA 3PUYA 3PUZA 1E7ZA 2CFMA 4A3KG 1X3FA 5FJ8G 3TS0A 1SLJA 4A3LG 1MIUA 2B3GA 3K80C 4IJHA 5FLXc 3M4QA 5GADC 1VQ9A 3BU2A 4XIGS 4DUYQ 2IX0A 2K4KA 4B3ML 3G48A 1PA6A 2ASBA 1IBMQ 2ZJRA 4OX9L 2UXBQ 1WCMG 1HZBA 4QY7A 1PH5A 1EQQA 1QUQB 4OO1I 4DR3Q 3D0FA 1PHJA 2BH2A 1JMCA 3J7ZC 4DV6Q 1LYLA 1VQGA 3AEVA 1YHBA 3RZOH 1XNQL 4PMWA 3ULJA 2LXJA 3NBHB 4JBMA 3L2PA 3NEMA 4A3MH 1VQ4A 2K14A 4POFA 5LMUL 2AWOA 3I2ZA 5FLMH 3T1HL 1N32Q 1G6PA 4JI8L 1PH3A 4L5SA 3E9IA 4JI5L 2N78A 3W1GA 1D7QA 4ME3A 3CF5A 1N36Q 4A3IG 3AFPA 2Z6KA 4BBRH 4UPAA 3KF6B 4DR2L 1WCMH 4DV4Q 2KHJA 1KIXA 4JI3Q 2BA0A 5DLQE 3KDFA 4IOCA 1HR0W 2OTJA 4BXXH 1HZ9A 2K52A 4X62L 4KHPQ 2UUBL 4P71A 3RZDH 3TQYA 4HIDA 2K5HA 3CP0A 1OXTA 1XMQL 2ES2A 1YZ6A 2HHHL 1CKOA 1IBKQ 1VQOA 1WYDA 1YJWA 4EX5A 4LF7L 3A0JA 1A8VA 3BZCA 1WFQA 1YI2A 3AYHB 1N8RC 4LF7Q 1M90C 3KFUA 1KAWA 4GNXA 4YHHL 4LUOA 3PO2H 3HOVH 2BH8A 2MFIA 1CUKA 2I5MX 2R7DA 1VQPA 2F4VL 1HNWL 4X62Q 4KHPL 2UU9Q 4BXXG 4LFCL 5HGQA 1LUZA 2WB1G 4IO9A 1YHAA 3ULLA 1LM0A 4AIMA 1WJJA 4DPGA 4OXPA 3J80c 3CCJA 2Z0SA 1BBWA 2YTVA 4OWTB 4DV5Q 4HIKA 3GTQH 1CSPA 1G291 3S1RH 4LF8Q 2QEXA 4GKJQ 2K75A 3RN5A 3CCLA 1IXRA 4IPGA 1VQNA 3PO3H 2JA6G 2UXCL 1P8LA 2NN6I 3CQZH 1JT8A 4LF5Q 2VQFQ 1JE5A 1VQJA 3RLNA 2UUCL 1Q8KA 3PO2G 1ASZA 3CC2A 2PQAB 1EYGA 1A62A 1EWIA 1NMFA 2QA4A 1V1QA 1E22A 1U5KA 4AYBE 4LW1A 3RLFA 4DNIA 2L15A 2OWOA 5M3MH 4LF6Q 3CCMA 3HOUG 3K0XA 1OTCA 1JB7A 1VQEA 2A8VA 2UXBL 4UP9A 1N33Q 1VQ7A 2VS1A 4NXML 4YCWA 4B3RQ 2YYZA 4DR7L 1PH1A 2NVQH 1P16A 1CSQA 4JI1Q 3A5UA 2ZJQA 1HNZQ 4R4CA 4C3JH 4Y52H 1YEZA 1KHIA 2JE6I 1KXLA 4PZ8A 3PF5A 4DK3C 4X6AH 1Q46A 3S24A 2A19A 4DK6C 2RCNA 4GLAC 3CW2C 3FKIG 2K5NA 4LF9Q 4A3BH 1HZCA 3S2DH 3CCSA 1C0AA 1UE6A 4A3JH 1WOCA 3S15H 2R93H 4GKKQ 1D8LA 5JEAG 2IHEA 4JBWA 4DR7Q 4JI5Q 1X6OA 1X3EA 1I50H 3PCOB 5AJ3Q 2E5LL 3H3VI 4JYAL 1N32L 1RIPA 4EQ5A 3OW2A 1I5FA 1IBKL 2HIVA 1UWVA 1X65A 2NZOA 3PUVA 1FJGQ 3J81j 2IY5B 1SR3A 4JCVE 2YTYA 2A1AA 2UXDQ 5IP9G 2UUBQ 3EN2A 4APVA 5JJKA 3FKIH 3HFZB 2AHOB 1O7IA 4WJ4A 5IYCG 3FP9A 1BBUA 1X55A 4B3MQ 1B7YB 1VQLA 3CAMA 4A3JG 1XPRA 4A3IH 5EAYA 4GKJL 4A3LH 4J15A 2KHIA 2ZM6L 1HR0L 3GTKH 3U4ZA 5IYDH 1QZGA 3HOYH 4BY1G 4R4IA 2N49A 1Q1EA 2ID0A 1E3PA 1FL0A 1XTDA 1IYJB 3ZJYC 2HT1A 1Y1WH 1AH9A 5M5WH 4NPSA 4BY7H 1NE3A 1UEBA 4DR6L 2NVXH 4NXNQ 1VQAA 1EIFA 5IP9H 3NENA 5LMNQ 5C4XH 1EFWA 4DUZL 2UU9L 2CWPA 3OTOQ 2KBNA 3KJOA 4DR1L 4O2DA 3PGZA 3WWVA 3NELA 1CKMA 1Z9FA 2XTIA 5FLMG 2RHSB 4A3FG 2E2JH 1TWAH 4OONA 4JI0Q 2YTXA
chains in the Genus database with same CATH superfamily
4OHJA 3H91A 4QJFA 4RWSC 4C3IH 1EY5A 4A75A 2BDNA 4C3JB 2DNCA 1X32A 2IHFA 5D3IB 2KCMA 2OXPA 1KRTA 4RHRA 4X66L 4TKOB 3AFQA 3ER0A 3TRZA 1PH7A 1I4RA 2I46A 2XN9C 2E2JB 3KLSA 4LWCA 2J0TD 4G57A 2R93B 3CXCA 4A3GG 1YVCA 5M3MB 2OCEA 2YV5A 4GN5A 4WORA 1ENAA 3MXNA 1DJRD 3GO5A 2D0OA 4E6IA 3C2PA 1HCZA 1JE4A 4JV5L 5FO9B 4DFAA 3CCUA 1L2FA 2F3VA 5IP7H 4FF3A 3K7UC 2G9HD 3U50C 2VUMB 2PQEA 1PV4A 4KJNA 1JOOA 4K2KA 1VQ6A 4XXEA 2JA6H 3RN2A 3D31A 5M5YH 2AQ1B 2XWBB 1PFBA 4PG3A 1S5ED 1K8AC 1U0LA 3MTSA 1EFID 1PFMA 4CKCA 2HD3A 4JVZA 3S17H 5E4WC 3S1QB 1EIYB 1HXYD 1KDAA 4OL7A 1ICWA 2ZXRA 3BDCA 4IUNA 5FLXE 1L1OA 2JA5H 5A2QL 4HJ8A 2CCZA 1LV9A 4R1JA 2ZTCA 1SFOH 2B63G 1S3OA 1VQKA 2Q2UA 2RBMA 2JEAI 3G6EA 5JEAJ 5IYBG 2OF1A 4LF5L 3GTOB 2JEBI 4DV4L 2EY6A 5ELCA 1RTOA 1T5EA 3W3AA 4FP5D 2WP8J 1B9MA 4BY1H 5CV7A 3M85A 1I4GA 3X3MA 4G7ZC 4B3TQ 4RCNA 1MGSA 4LF9L 2B8GA 3I72A 2WAQE 2GVAA 5BR8Q 2V1CC 1ASYA 3PMFA 4FXKC 1I3QH 4UY8C 2PNRC 4BBRB 1IZ6A 2JYOA 4GNXC 2PO4A 1PTOC 3RLOA 1IBLQ 1MJCA 3NQIA 3I70A 5FKAC 1SNDA 2VQEQ 1BO0A 1MI2A 4Y7NB 3PF4A 5IWAQ 3DLLA 4DGZA 3P7JA 1FYCA 1W6JA 3DEPA 1SYBA 2H4OA 3ONAB 4GNXB 3GTMB 4KLKA 1X56A 4DR3L 4ABNA 2EYMA 2F0SA 1WTQA 2FINB 3PO2B 2Y0SE 4DR4L 5DM63 2K05A 3DWAA 2IT1A 5GAGC 5IIFA 4PNYA 3CCRA 4JI8Q 2HQEA 1GHKA 2D2CC 1SE8A 3SEBA 5IGFA 2PI2E 1M8AA 4L63B 1X54A 1SNOA 3E0EA 2NVYB 5C0XG 1PH6A 4JI7L 1I94L 2NTSA 3GD7A 5G3LD 3JAME 1CHQD 4BA1I 4ZUJA 1VQCA 1PYSB 1SE2A 1WD0A 4BA2I 1GUWA 3NSWA 1QUQA 1B9NA 3I4NG 4Q0FA 4KKTA 4A93B 2CKZB 5JOBA 3OWEB 1VS0A 2UUCQ 5IE8A 4B3SQ 3L9AX 2F0TA 4EVOA 1DOKA 4UP7A 3I4LA 4HJ7A 3IL8A 3BVZA 1SN8A 1PYBA 5CGKA 2QKIC 1JB3A 1XMOQ 4LUZA 4P75A 3BYYB 3FPUB 3NTKA 4R9WA 4IZ8A 2IX1A 1B3QA 4JI2L 2Z6BA 1LTGD 5K36H 4CHTB 2D0PA 1W3SA 1XMOL 4A3MG 2CWAA 2ZJPA 1S5DD 3I8ZA 4TQUS 1AZQA 4OO1G 4IALA 1CHPD 3PV0A 2B8FA 5CV5A 1C7YA 3K7AB 1WD1A 3CMAA 5LMNL 1I4HA 5H1SE 4C56C 4H44C 4X64L 2ZXPA 1YJ9A 1PTOD 4A3EG 5C4XG 3MFGA 4IPDA 2LS01 5E3FA 2EY5A 3H3VH 1ONLA 1N36L 1RCVD 1E24A 4DN4M 4KI0A 4IUTA 5HY6A 3OWFA 3GTKB 2B2TA 1PRTF 1K73C 3A8KE 5K5PA 3S1RB 4EQPA 1TWCH 1STAA 1QVFA 3RNUA 2A6EC 3K5NA 1XMQQ 2B2YC 1STBA 4NW2A 4BBSG 3H0GG 2MHVA 1YNNC 5M3MG 2DGYA 4DAMA 1XWEA 1CTMA 1N34L 4LFBL 3S2HB 4IUPA 4UP8A 3A56A 1L1OC 3EQLC 3SK8A 4ZQ3A 1DYQA 3ITPA 4IUQA 1NSNS 2F0HA 1R9TB 4HCEA 2Q2HA 1KNEA 2EYOA 1KRSA 4KY6A 3GP7A 2WACA 2SNMA 4LJZC 3BS1A 5CV8A 3MXUA 4K6LA 4O42A 1PTOB 3TMEA 2B2WA 1JWSD 4DR5L 4XTCS 3PO3B 2B2VC 2P5ZX 2JN4A 1JJ2A 4L6TB 4IFDI 3T1YQ 2R6GA 3GTPH 3DUZA 1VQMA 4X66Q 1VQ8A 4LF6L 4RFBA 2Q2IA 3KYHC 5CC4A 4NP5A 4DV7Q 3S1NB 1AEXA 2WAQG 2KENA 3MAQA 4DV3Q 5EKLA 3A5ZB 4B9XA 4EQOA 3S14H 2GN5A 2B63B 3FDTA 3PUZA 1F9QA 4A3KG 2JXMB 1EZ6A 2RDFA 1X3FA 4A3LG 5HGTA 5GADC 1VQ9A 3JAML 3BU2A 4XIGS 1LTRD 2ASBA 1IBMQ 2UXBQ 2EVBA 2EY1A 4FO2A 2BH2A 4ZAIA 3J7ZC 1VQGA 2WV6D 2XIWA 5COYA 4JBMA 3NEMA 1Y1VB 1LTTD 1AZPA 2HDLA 1JICA 1I4PA 4DA2A 1GHJA 5EBCA 5JVH3 4L5SA 3E9IA 4JI5L 3W1GA 5HURA 2K03A 1N36Q 3VYUA 1B1ZA 3C1FA 4JI3Q 2BA0A 3A7LA 1NR2A 2EPBA 3OMGA 4XYQA 5AFWA 1HZ9A 2JA8B 4X62L 4P71A 5D3DA 3A7AB 5G3LF 1WCMB 1IBKQ 1SNCA 1SNMA 1VQOA 1SE4A 1A8VA 2SDFA 4HN7A 1M90C 2XNAC 1EY7A 4GNXA 1A2TA 4LUOA 2PPBC 4BS9A 5JJZA 3PIP3 2R7DA 2F4VL 4X62Q 4LK1C 2R92B 4IURA 4XT1B 4LFCL 1LT6D 2SNSA 2WB1G 4F7XA 4UDUC 4IO9A 1D5XC 3J80c 1BBWA 2YTVA 3CRKC 4GZYC 1IL8A 1BF4A 2QEXA 5CV4A 4GKJQ 3RN5A 1ZEQX 1IXRA 2MGSA 4IPGA 1VQNA 3I91A 2RSOA 3CQZH 3RLNA 1K83B 1M4VA 1ASZA 1EYGA 1A62A 3NPPA 3SK4A 3VYSA 1SYEA 3RLFA 4AYBE 2OWOA 5M3MH 1HUNA 3H6MA 3P1HA 2L11A 1JB7A 1YNJC 2F0JA 1N33Q 3AMUA 3A5UA 2ZJQA 1HNZQ 1RODA 4R4CA 4C3JH 2JE6I 4CDEC 3PF5A 4DK3C 5BN4A 4DK6C 4A3BH 4LF9Q 5FO8B 1HZCA 3V96A 1HTLD 3KK7A 2Z8LA 5IGBA 3S15H 3GV6A 3TSSA 1LT5D 1PYWD 1LTID 5DEHA 1TY2A 1S5FD 2K5QA 1I5FA 2M9VA 1UWVA 1JOKA 1LLRD 3PUVA 4A3BB 1SR3A 4JCVE 3VA5A 4AYBB 2WB1B 3EN2A 2F3WA 5JJKA 2AHOB 4WJ4A 1X55A 1B7YB 3Q24A 5EAYA 4J15A 3DXJC 2ZM6L 5C5MA 5I9PA 5IYDH 1EL0A 1C8CA 1XTDA 1AH9A 5BN3A 4DR6L 1TS4A 2QW7A 1ESFA 2CVRA 2JP1A 3QO2A 3NENA 3H0GB 2KBNA 2F0NA 3WWVA 5FLMG 1EY9A 3S9WA 1TWAH 4C1NI 2X6GA 4WJWA 4RGOS 3TZUA 3HOYG 2EZVA 2B2TC 2R92G 4A3DG 1WI5A 2QDBA 2I0QA 3URYA 2QGQA 2L12A 2VNUD 2E2HB 3QJYA 4X64Q 5C0XI 5IP7G 2EJMA 1C4QA 1C9OA 1A6XA 1Y8OB 1XPOA 1SJHD 3H09A 3SK6A 4DUYL 4UAIA 5JJLA 3KOJA 1HTPA 4LNQA 3HZXA 2UUAL 1E1OA 2PZUA 3NTHA 1NTGA 4GOPC 5C44B 4JOIC 3A74A 1NBWA 5C6AA 1LTLA 4A76A 4GOPA 2K1BA 2F0LA 3AQQA 4CJ2C 1ZYRD 3V2TA 1PFNA 1HZAA 1XPUA 1BCPF 2E5LQ 5CR3A 3K6OA 5ELEA 1PVOA 1LACA 2VL6A 3B6YA 3I4OA 2AUJD 5C3EH 3G4SA 2RHQB 2ICIA 5IT9L 2RSNA 3VR3A 1L0WA 3CCEA 4XT3B 2PQAA 2G5DA 1CZGA 4Z9CB 3BVGA 3TP5A 2IWHA 2F0WA 1FVIA 3E0JA 5JEAH 4X3SA 4RGMA 1T9HA 3HKZE 1B70B 4LF4Q 5FJ8H 5I6WA 4HSVA 2BA1A 2MUYA 4DV2L 3NUCA 4IUUA 2PMZE 4NXNQ 1JQYD 1MJEA 2UU9L 4C1NK 2LMCB 2F4VQ 2J4XA 3G71A 1DOLA 1B8AA 5KEEA 2E2DC 3WDNA 3FVQA 4QB4A 1D1KA 2R7ZG 1W6KA 4GS3A 4DV2Q 4MNOA 2YU9H 3TS2A 4IFDJ 1V1OA 1GJXA 4X65L 1KQSA 1QE6A 2WFWA 4LF8L 1TS5A 4DK0A 1GKHA 3JAMc 3SE0A 1HRJA 4IPCA 3QWNA 4S3SA 3HOXH 3GTJB 2X69A 1LTBD 3NE5B 1GD7A 1Z6HA 2A6HC 4WJ3M 4YHHQ 1VQHA 3BVMA 4K6DA 1Y8NB 1WTWA 4X65Q 3J81E 1IBML 4XQNA 3NXWA 4CKEA 2MO0A 1N9WA 3KLWA 4JPBW 4QL5A 3K81C 5NUCA 5DNFA 3GTGH 2B29A 1J6QA 1H9SB 4DV6L 4K5VA 5T1GA 3HOZH 1CKNB 5EKKA 4QGUA 4CDDC 2E74C 1QNKA 4GN4B 4DV3L 4JW0A 2M2LA 4JI6L 1NUCA 1SDFA 2Y0SG 1NMGA 4A3GH 3KBXA 2A68D 4RAUC 3BYTB 2NWGA 1PXUA 3GV3A 3O13A 1ESRA 1DONA 5C4XB 1H95A 2FHTA 4KY7A 3ERSX 2JA8H 4JV5Q 1IW7C 3KJPA 2F0OA 1QB5D 1VQIA 3A54A 3DMUA 1CA6A 1EQRA 1UE5A 4DV1Q 3JAMi 3EBEA 4MTNA 1JR0D 3K5LA 2F03A 1WTRA 3VR5A 5J3BA 1NJIC 1XTCD 2FXQA 2LXKA 3KF8B 4HJ5A 4B3SL 1FNWA 5JAVA 2LSSA 3HOWH 3H3VC 4K2LA 1FD7D 1RF2D 1KL9A 3SXHA 4OO1H 4IFDG 2EIFA 2RVLA 2JA5G 1OXVA 4JC0A 4A3KB 4CJ1B 1TU2B 5KYLA 4JI4Q 2B2YA 2A74C 2R7ZB 2WKDA 3RR5A 2B63H 4DAYA 4LFCQ 1QCBD 1Y8PB 1QVCA 3DEOA 5ELFA 3CMEA 4R8IA 2A6ED 3EVQA 1FR3A 1YITA 3TP8A 2A5HA 5I9OA 4C2MH 5KGUA 5D14A 1KAAA 1Y1WG 3HOVG 4NDXA 3MHBA 4JOIA 2IW3A 5LHY1 3J80i 1IL2A 2OTLA 1A63A 4YCVA 3QOJA 4YWKA 1G51A 1H9KA 2B2WC 3J81i 3Q6SA 3PIOA 1YNJD 2HUGA 2K7VA 3U4VA 4ALPA 4HEDA 4OGQC 4NXNL 3Q23A 2E2IH 2D62A 4C2MB 2KUMA 4LFAQ 1N33L 5JJIA 4QIWE 1J9OA 1PZJD 4PZ7A 1L1OB 2A69D 1SJED 4QMGA 3FRPB 1OXSC 2WINB 3E5SA 5IGGA 3M4PA 3CD6A 4A3EH 1Q12A 1TQOA 2L5TA 5AJ3L 1EIHA 2Q8IB 1TR5A 1K0SA 1AE3A 1EY4A 4HSPA 4OWXB 4B3RL 1E2ZA 4P72A 4A3JB 2K01A 3H15A 1Q7YC 1K28A 4HMJA 4RMFA 3IFTA 1GVPA 4JI7Q 3HOWB 4YWMA 4OWWB 4L5QA 4CDCC 4CJ0B 1YJNA 3L0OA 4JG2A 1X3QA 3FHWA 3K7AH 4O1NA 2GA4B 5GROA 1O7ZA 3C3LA 3GDEA 2N55A 3STBC 4DAYB 1KC8C 1Q82C 1ET6A 4RGNA 3UE1A 3K5MA 1EU4A 1SFOB 3DWQA 4QUCA 2CFMA 3DWPA 1MIUA 2B3GA 3K80C 5FLXc 4GKKQ 2EY2A 3M4QA 4DUYQ 1K3BC 3N52A 2ZJRA 4DU9A 1EQQA 3WOEA 1PHJA 3TZDA 1JMCA 3AEVA 1KLGD 2LXJA 3NBHB 2MP1A 4A3MH 1VQ4A 2K14A 3MZ5A 1TKWB 1K8OA 3I2ZA 3IAYA 3T1HL 5F2DA 1G6PA 4DNTB 3SDZA 5A2QE 4IQZA 4A3IG 3AFPA 2RQXA 3KF6B 3A8JE 4DV4Q 1KIXA 2AQ3B 2K52A 4KHPQ 5LL6X 2UUBL 3CP0A 4OIJA 4F88A 1XMQL 1WVLA 5EPKA 4IN3A 4U68A 3TP7A 5E4XA 1YJWA 2XVSA 4EX5A 4LF7L 5C4HA 3Q0AA 1EYCA 4LF7Q 1JWUD 2F0GA 1KAWA 1STGA 2Y0SB 3PO2H 3HOVH 4C3HG 2BH8A 4NKLA 1VQPA 1VMCA 4KHPL 2UU9Q 4BXXG 3NK9A 3ZYYX 5ELBA 5IOCA 1WJJA 3CCJA 3GTQH 4ME5A 3U9SA 2CHBD 2AUKA 3PO3H 2E2IB 1PTOH 1JT8A 4LF5Q 2VQFQ 3CC2A 1EU3A 1BR9A 1EWIA 2QA4A 1U5KA 4LW1A 2L15A 4LF6Q 4CGYB 5C3XA 1OO9B 3T51B 1OTCA 2BE5C 1A15A 1NR4A 2F0UA 2NN6H 4NXML 4B3RQ 4ZCKA 2M00A 3RUZA 2NVQH 1P16A 1DXMA 3BG3A 2LKVA 2DY7A 4JI1Q 1KHIA 4PZ8A 4HTHA 1DOMA 2A19A 3AU7A 4R8NA 2RCNA 4GLAC 3CCSA 2CH4W 2A69C 1UE6A 3HP3A 1WOCA 2PYKA 5T1IA 3TP6A 1SYDA 2ICEC 4JBWA 4JI5Q 4RH6A 1X3EA 1KDBA 1I50H 5AJ3Q 4JYAL 1RIPA 4DXFA 2HIVA 1X65A 1TS2A 2F0PA 1FJGQ 1O78A 3LX0A 2YTYA 1Y1WB 3OPOA 2O2LD 5IYCG 2HCCA 3NWTA 1BBUA 2KCNA 5J22A 4G7OC 4A3IB 2CW0D 4A3JG 4GKJL 3NWSA 1G6ZA 1HR0L 4J6HA 3U4ZA 1QZGA 3FKIB 3HOYH 1SE3A 2N49A 4H13C 4R4IA 1Q1EA 3A55A 1E3PA 1FL0A 1IYJB 4BY7H 1NE3A 5LMNQ 1H9RA 5C4XH 1PLFA 3KJOA 4DR1L 1PTOF 4O2DA 2H1EA 3NELA 1RDPD 2XTIA 4A3FG 2E2JH 4OONA 2L0CA 4JI0Q 1XNQL 2YTXA 3EROA 3U58A 2QILA 1UAPA 1CT1D 3T56B 2FMCA 1QJOA 4A3EB 1LTAD 2Q8RE 4JI2Q 1GUTA 2WB1E 1E2WA 3TEHB 3M3YH 2PW7A 4OX9Q 1GUGA 3GTGB 1HNZL 4PZ6A 3SHLA 4C3IB 4M8AA 1XJVA 1HH2P 4KHZA 1F77A 1Q1BA 3MEHA 5M3FH 3ND9A 4DAVA 3KDFB 1A3UA 1U4MA 1Q3LA 1D2BA 1EY6A 2D9UA 3JC66 1BBXC 2QEJC 1KABA 4OIKA 5ELOA 2KEDA 1DM0B 3I4NH 3F2DA 1F2YA 1IYUA 5M5WB 2B2VA 2N3SA 5GAHC 5I2YA 4QF4A 2OQKA 4AQYQ 2JA7G 1TXYA 1YIJA 1F2MA 4LFAL 4N9PA 2IPKD 4R4OA 3HEJA 5C5LA 1MD2D 4C3JG 2F0VA 4AQYL 1FGBD 2HDMA 4X3UA 2ZTEA 4TRDA 5C4JB 2RF4A 4DV0L 4DAPA 1B3AA 1EUJA 1X9NA 1B50A 2ATWA 2K32A 4DR6Q 3GTMH 2NB0A 4P2CB 4L8JA 4F87A 1BXTA 2N88A 1PH4A 1VQBA 1HA6A 2ALYB 5I4DA 3HOUH 4KN7C 2UXCQ 1VQFA 4K0KL 3CQZB 3IRBA 5C44G 1QVGA 1HQMC 4A3KH 4IFDH 3CCVA 2NBFA 3N6RA 4DR4Q 4U673 4XQJA 2VXWA 3HOXG 5EBDA 1I6HH 2F0IA 3PIPA 2HIXA 2JQOA 1I94Q 1NCVA 5IT9E 2OQ0A 1FNVA 3KUPA 5KIXA 1LO5D 2O5IC 1VQDA 3D6CA 3EA6A 4M1UB 3W2DA 5IODA 4QQBX 3GTOH 1PH8A 1JJCB 3M4OH 3MXPA 1DZ1A 4BBSH 3TDQA 1QG7A 1TWHB 5CBEE 4GOPB 2Q8TA 1SYGA 1TWHH 4FF2A 2JA5B 2F0EA 1Y14B 3I73A 3ND8A 3R3OA 3X3NA 1YBYA 4FXDA 3HKZG 2NYZD 1U4PA 1A0IA 3I7FA 3I56A 1J5EL 1XYIA 1SAPA 3LWUA 4X3KA 4N8X1 2JA8G 1Y1VH 1UE7A 3HOZB 5M5YB 1E0BA 2K5DA 4EQNA 2L55A 3GTLH 2ZXOA 1DGSA 2SEBD 1BOSA 1QWYA 2VUMH 3J81c 1SYCA 4PQXA 4RKBA 1GUNA 2NZ1D 1HNXL 5IGCA 1I4XA 5LMUQ 4QUFA 3RZDB 1F9SA 3I4MG 4KN4C 3D6WA 4HR7B 3S1NH 1DCZA 2NN6G 1BCPB 1GUSA 5C4JH 1EEID 1OXXK 3K58A 3KLRA 2K5VA 4A3CH 3HRZC 1EWHA 4K8JA 4DV1L 1H9SA 3BDOA 3KF8A 3Q8DA 3VR6A 1ENCA 2L4NA 2VZAA 3OTOL 1K8GA 5KNDA 1EQTA 2TSSA 2XSCA 1PH2A 3K0YA 1HFGA 5I2XA 3EJIA 4DR2Q 4A3BG 2KCCA 3F1ZA 4NB3A 1R9TH 4TVAB 2K28A 2ZM6Q 2PW5A 5J1ZA 4BWGB 3J7AF 1AP0A 1SBBB 2AKWB 1TWGH 1V43A 1EEFD 1LABA 3KF6A 2BE5D 3DHQA 5D65A 2KA7A 2VW9A 3S1MH 5M5XH 2X6LA 3EIVA 3QOLA 1X3GA 4RKLA 1V9PA 3HOWG 4V0BA 4RG1A 3L3OC 1V8QA 5JPMC 1VCIA 5L37A 4MZ9A 1H9MA 2HHHQ 4K8IA 2A73B 1L0XB 1BQQT 3F2UA 3MXNB 2F0DA 3M7GA 3F2BA 4R4QA 2R3ZA 5M5XB 1KTKA 2JA7B 4AYBG 1EYAA 2C35B 3OSOA 4GLXA 4GN3B 4KTAA 1K83H 4H02A 4DV0Q 3M7NA 4JYAQ 1YNND 4PMBA 1QZHA 3GQBA 1EY0A 3R93A 1AN8A 1R4QB 2EDGA 2OEOA 1NNXA 2KCTA 4K0KQ 3HOZG 2I5LX 3BDLA 3I55A 1LT4D 5CORA 2E2HH 2R92H 4LAAA 4C3HB 2AWNA 4JI3L 4J1MA 2Z4IA 1SYFA 1PZKD 5M3FG 1HR0Q 1E2VA 1S5BD 2E8GA 1M1KC 3BJUA 2PZTA 4OEMB 3CC7A 2Z9HA 4KY5A 3CCQA 4ZLTF 2ZT9C 1ILPA 1JJGA 2KQ3A 4ZYSA 1S72A 3CPFA 4A93H 4F8MA 2H5XA 1FJGL 1YHQA 3VYRA 4B08A 3K59A 1D6EC 3U9OA 2R93G 2R61A 1B4OA 4DNRB 2ZTDA 1BCPD 5DAUA 1TS3A 2NVQB 4L5TA 5LL6S 2EE1A 2B2UA 2DUDA 1TY0A 1CM9A 3VDYA 3QG1A 2GVBA 1LTSD 3M9BA 1D5ZC 4ULLA 4TSSA 1CI3M 1RKNA 4FNFA 1JORA 1SLJA 1UUPA 2IX0A 3SR1A 4B3ML 3G48A 1PA6A 1WCMG 3GTQB 4ID6A 4QY7A 3E3XA 1PH5A 1QUQB 4OO1I 3FEWX 3OOCA 3S14B 2IL8A 2MJ8A 3T4AC 1V1PA 3ULJA 1VDZA 4BBSB 1A3TA 3M4OB 2CW0C 5LMUL 2AWOA 3HOVB 5FLMH 1IYVA 1STEA 3GTPB 3I3CA 1D7QA 2D5DA 2N78A 1JOQA 3EFXD 2Z6KA 4BBRH 4DR2L 4H0LC 3KDFA 5CV9A 5DLQE 4IOCA 1Y69U 4BXXH 1Z7TA 3BZDB 1BUVT 3TQYA 1I6HB 3QIAA 2ES2A 1HFNA 2KECA 2HHHL 1CKOA 1MSHA 2O5JC 3HS0C 3NP8A 1ET9A 3PIO3 1YI2A 3AYHB 1EYDA 3KFUA 3HOUB 4KHVA 3J80E 1STHA 1ICFB 4YHHL 3NBHA 2MFIA 1CUKA 1F9RA 5EPJA 1HNWL 5E1FA 3OIQA 4UHVA 3J81L 2I07B 1LM0A 1WTHA 4AIMA 3Q22A 4OXPA 2Z0SA 4OWTB 4CKBA 4DV5Q 4FYDA 1CSPA 1G291 3KBGA 3S1RH 4LF8Q 4ZK9B 2UXCL 5I6YA 2NN6I 4ZUIA 1WTXA 4CBVA 2NUCA 1Q8KA 2AQ2B 3PO2G 3M4YA 1G2SA 3AB9A 2PQAB 2F0FA 1NMFA 1E22A 3I4NB 3OW7A 1PZID 4ZKCB 1H9JA 2A8VA 2UXBL 2VS1A 2YYZA 4DR7L 1PH1A 2EYLA 5ELDA 2XRSD 3IFDA 4KMUC 3M3YB 1KXLA 4X6AH 1TVXA 3S24A 3CW2C 2K5NA 3S2DH 4J8QA 1RHPA 1U4RA 5M9OA 4A3JH 2K6AA 2R93H 1D8LA 2IHEA 4DR7Q 1EQVA 2LFNA 1X6OA 4K14A 3PCOB 3H3VI 2E5LL 2Z4HA 5C3WA 4NMZA 4EQ5A 2EJFC 4RCOA 2NZOA 2IY5B 2UXDQ 5IP9G 1O7LA 2UUBQ 2F1MA 4APVA 4ODGA 3FKIH 3HOYB 4XYOA 1SXTA 2VB2X 3R2TA 1O7IA 1TT2A 2DJFC 3CHBD 4XDXA 4B3MQ 3CAMA 1XPRA 4A3IH 4A3LH 1WTVA 2KHIA 1C48A 2BDOA 4BY1G 1MHWC 2ID0A 3ZJYC 2HT1A 1Y1WH 1HQRD 3J7AV 1VQAA 5CYUA 1EIFA 3CKIB 1II3A 1EFWA 2FMMA 2CWPA 1I50B 4FXGC 3PGZA 1RJTA 1CKMA 1HPCA 1D5MC 2RHSB 1KNAA 3SK5A 1TWFH 3T53B 3UDFA 2F0MA 2JK8A 3S2HH 4LUVA 1JC7A 1K0RA 2F3IA 5E7NA 1ILQA 4BBRG 1CK1A 2A6HD 4FF4A 1LT3D 2PNHA 5BR8L 2K33A 2RCFA 2KOLA 3OIPA 1XXGA 1MBYA 2PI2A 1TWCB 2PMZB 1TWFB 4Y7NH 1AW7A 4IJLA 3V05A 3PO3G 5EGTA 1W2BA 3OYYA 4DR5Q 1HJPA 1X3PA 4G7HC 2WAQB 5DM73 4WFN3 1GUOA 4JI1L 1CZWA 3I4MH 4A4IA 2EXZA 3HKZB 1VF5C 5FLXL 2HCIA 1VQ5A 4NXMQ 5JPNC 1IBLL 3PUXA 3STBD 2PCFB 5EJWA 3UDGA 1SSOA 1JWMD 3FPPA 1XNRL 1J8IA 1BDOA 3S16B 5FOBB 3G6JB 1CFMA 1G8ZD 2KHSA 1B44D 5KYIA 3BZKA 1RTNA 1HNXQ 2J7ZA 2IJ0A 2V4DA 5A35A 3F2CA 4OELB 1EY8A 4YCUA 1UEAB 3W5OA 3ICEA 1Q86C 3CC4A 1MKHA 1SMYC 3MEFA 4JI6Q 2EXDA 3PUWA 3SVMA 1HHVA 5FO7B 2LY7A 3S2DB 3CPWA 4DR1Q 1YNXA 2F0KA 5GAEC 3MFYA 1CKNA 1ML0D 3K5OA 1SMYD 3UI2A 1BKBA 5IYCH 1SRUA 1J5EQ 2JA6B 2UUAQ 2F52A 1CQVA 1KD1C 2CH4A 3G7LA 1A2UA 2NZHA 3H94A 4QCLA 3KLSX 1SMXA 4A3MB 3TN2A 2NTTA 3OMCA 3T1HQ 4BY7G 3PSIA 1Y1VG 5C0XJ 3QR8A 1STNA 5GQOA 2Z6KC 2NVYH 5CV6A 3DM3A 5IGEA 4X3TA 5IYBH 3GTJH 1O7YA 3HOXB 2VUMG 2VQEL 1SNPA 1XNQQ 2RDHA 4JBKA 5IT9c 3CU7A 4KK7A 1B53A 3UE0A 4HJ9A 4O0AA 2YU9B 5C0XH 4C3HH 3S16H 2WIIB 5LMNW 2C9OA 2SOBA 1CA5A 3HKSA 1UE1A 1GO3E 2DNEA 1BNZA 1Q81C 4FVMA 4MN3A 4ZRZA 1Q90A 2KEEA 1FGUA 4JK1C 1IHZA 1WTPA 1I3QB 2JJQA 1N34Q 4LFBQ 2JA9A 3OHXC 1E1TA 3A8IE 1FNUA 2ENBA 1ZKOA 2L1BA 1HUMA 2NVXB 1RL2A 3MXGA 2JA7H 1XNRQ 1EIGA 1R4PB 3RMHA 1BVSA 3LNNA 1CQFA 3K57A 1AFPA 5ISRA 2JSOA 4BY1B 1OXUA 5ELNA 4EGVA 2EYFA 5C3EB 1GXDC 2K50A 4K5WA 4P74A 2EJGC 4POGA 4GLVB 1V1PB 4I7AA 3NTIA 3D4DA 2E76C 1EOVA 1S40A 1HNWQ 4B3TL 5C44H 2XGTA 3J80L 1IW7D 2RA4A 3T1YL 4AH6A 4RA8A 4A3CG 4IOAA 2VY3A 3S1QH 3D4WA 1SEBD 4HAEA 3S17B 1K8MA 1TIID 5IWAL 4G4KA 4HCSA 4P73A 4RHSA 1PRTC 3P20A 1IKMA 3E6ZX 2CQOA 1Z47A 4YWLA 5IYDG 1S5CD 4A3FB 4FDBA 4DV5L 1VF7A 3LWEA 1GM5A 3LGJA 3H0GH 3I90A 4YY3L 1L0YB 2R7FA 4YY3Q 5C4ZA 3ULPA 3W1BA 2XWJB 3TREA 3PQIA 5K36G 2R7ZH 3L7ZC 3UDIA 1HA5A 3ERQA 1QOHA 2N8NA 1U4LA 3E9HA 5EKIA 2F0QA 4A3FH 3R8BA 3FMCA 4GKKL 4A3DH 4C3IG 2DJGC 2CQAA 4B9WA 3GTLB 2UXDL 3DM1A 4HIOA 2QF7A 4L5RC 4A93G 3IKJA 3MWYW 3MA2B 3VR4A 1UNSA 4DKAC 1QILA 4JBJA 2FJ2A 1PH9A 4FF1A 1PFSA 2I5HA 1RD9D 1ENFA 4JI4L 1ZYRC 2Q2TA 4R4TA 1K9MC 3F8TA 2MQHA 2E75C 3NHHA 3HGBA 3D4RA 3J7A5 3C46A 1DD2A 5EQ0A 1PDQA 2QDLA 1D1IA 2EQSA 5FK9C 5IGDA 1GOZA 1NAPA 3WOFA 1F2ZA 5IY0A 1XX8A 3SGIA 1SROA 1PMRA 5C3EG 5KRUA 4DF7A 4A3GB 4HJAA 3R2IA 4HIMA 4JI0L 4LF4L 2MNAA 2NVTH 2HQLA 1AE2A 1NY4A 5KNCA 4DUZQ 4IPHA 3UDXA 4IUVA 5KNBA 1K3RA 2VQFL 1A3VA 3C1EA 4QIWB 2AMCB 2MO1A 3NBIA 3QB3A 3K8AA 3PUYA 4MIUA 1E7ZA 2XRQD 3RD4A 5JVG3 5FJ8G 3D3RA 2EYJA 3TS0A 4IJHA 2EYHA 2K4KA 2TMPA 4N9TA 4OX9L 1HZBA 2Z1CA 4KD3A 4KV6A 4DR3Q 3D0FA 3VR2A 1LYLA 4DV6Q 3RZOH 1YHBA 4PMWA 4CDFC 4KJOA 3L2PA 1F9PA 4POFA 3VA7A 4HMIA 1N32Q 4JI8L 1PH3A 2NVTB 3J7YW 4ME3A 3CF5A 3VYTA 2DN8A 2F4IA 4UPAA 1JCKB 1WCMH 2KHJA 2B2UC 2OTJA 1HR0W 1U9RA 2O4XA 1EOTA 1BCPC 4I65A 2L9HA 3RZDH 4HIDA 5CMDA 2K5HA 2OT2A 1OXTA 1YZ6A 5EPLA 1WYDA 2MPMA 3A0JA 3BZCA 1WFQA 2K04A 4MTKA 1N8RC 2IX3A 1WTOA 3NQTA 2I5MX 5CBAE 5HGQA 1LUZA 1YHAA 3ULLA 4DPGA 1O80A 4DV7L 2A68C 3T13A 4HIKA 4A3DB 2C5CA 1EWCA 3D8GA 3T16A 2VB3X 2K75A 3CCLA 2K5WA 2JA6G 2PZWA 1P8LA 1I6VC 1JE5A 1VQJA 2UUCL 4MHEA 1EZ8A 2BOSA 2EYPA 4N8FA 4Q5VA 1ZXTA 1V1QA 2B39A 2RKSA 4BY7B 4DNIA 1KLUD 1G91A 3CCMA 3HOUG 3K0XA 4KKUA 1F2LA 1STYA 1VQEA 4UP9A 1SNQA 1VQ7A 1PRTB 4PMCA 4YCWA 5TSSA 4ZKBB 4KD4A 1CSQA 4I7ZC 4LMQD 4WRDA 4Y52H 4ILWA 1YEZA 3I4MB 1IKLA 1KDCA 1Q46A 3MVVA 4K5XA 4YIJA 3RZOB 3FKIG 2DY8A 3TBIB 1C0AA 1G2TA 2FFKB 4XQQA 2KVMA 2RDGA 1TWAB 2EOTA 2KJXA 1B2TA 5JEAG 1VMPA 4KKSA 1N32L 3OW2A 2WKCA 1IBKL 2QCPX 3MC0B 2G9DA 3J81j 1MSGA 5BN5A 2A1AA 3HFZB 3FP9A 5J39A 1VQLA 1I4QA 3P75A 4RGTA 1Q8IA 3GTKH 1QNUA 1S4ZA 4DK1A 4V190 1PRTD 2BCOA 3S1MB 5M5WH 4NPSA 1UEBA 2NVXH 3HG9A 4PV1C 5IP9H 4DUZL 3CRLC 3OTOQ 1TWGB 4DXGA 1T5XD 1Z9FA 5M3FB 3S15B 4H7BA
chains in the Genus database with same CATH topology
4C3IH 4QJFA 1TWFH 3U58A 3UDFA 2JK8A 3S2HH 4LUVA 1K0RA 2F3IA 3HOYG 5E7NA 4BBRG 2R92G 4A75A 4A3DG 4JI2Q 1WI5A 2PNHA 5BR8L 2WB1E 2I0QA 2QGQA 3TEHB 3M3YH 2VNUD 4X64Q 5C0XI 5IP7G 4OX9Q 2IHFA 1C9OA 2KCMA 2PI2A 1XPOA 1HNZL 1KRTA 4PZ6A 4DUYL 4Y7NH 3KOJA 5JJLA 4IJLA 3PO3G 4X66L 3TRZA 3AFQA 3ER0A 1HH2P 4KHZA 1XJVA 1Q1BA 1W2BA 5M3FH 1PH7A 4LNQA 4LWCA 3KDFB 3OYYA 2UUAL 3CXCA 1E1OA 4A3GG 1YVCA 1NTGA 4GOPC 2OCEA 2YV5A 3JC66 4DR5Q 5ELOA 4GN5A 1HJPA 3I4NH 4JOIC 3F2DA 3GO5A 2D0OA 3A74A 1NBWA 1LTLA 4A76A 2N3SA 4GOPA 4JV5L 3AQQA 4JI1L 5GAHC 3I4MH 4A4IA 4AQYQ 2OQKA 3CCUA 1HZAA 1L2FA 1XPUA 5IP7H 2JA7G 1TXYA 3K7UC 1YIJA 2E5LQ 3U50C 1VQ5A 4LFAL 1PVOA 4NXMQ 3I4OA 2VL6A 3B6YA 1PV4A 1IBLL 5C3EH 4R4OA 3PUXA 3STBD 1VQ6A 3G4SA 4AQYL 2RHQB 3UDGA 2JA6H 3RN2A 1XNRL 2ZTEA 3D31A 4DV0L 2RF4A 1X9NA 5M5YH 1EUJA 4PG3A 1L0WA 3CCEA 2ATWA 2PQAA 1K8AC 1U0LA 4DR6Q 3GTMH 3S17H 3BZKA 1HNXQ 1PH4A 3F2CA 1VQBA 1FVIA 2ALYB 4YCUA 3HOUH 1EIYB 2UXCQ 1VQFA 3W5OA 3ICEA 1T9HA 4K0KL 3HKZE 3IRBA 5C44G 1B70B 1MKHA 1Q86C 4A3KH 1QVGA 3CC4A 3CCVA 4LF4Q 5FJ8H 3MEFA 4JI6Q 4DR4Q 2EXDA 2JA5H 1L1OA 3PUWA 2BA1A 3HOXG 1I6HH 4HJ8A 2CCZA 4DV2L 3PIPA 2PMZE 4R1JA 2ZTCA 2HIXA 1YNXA 2JQOA 5GAEC 3CPWA 4DR1Q 1SFOH 1MJEA 1I94Q 1CKNA 1S3OA 3G71A 1VQKA 1B8AA 2Q2UA 2B63G 2F4VQ 2JEAI 2OQ0A 3G6EA 1BKBA 2R7ZG 5JEAJ 5IYBG 5IYCH 1SRUA 4GS3A 4DV2Q 4MNOA 2YU9H 4LF5L 3TS2A 1VQDA 2JEBI 4DV4L 1J5EQ 4IFDJ 2UUAQ 2F52A 4X65L 1KQSA 1KD1C 2WP8J 4QQBX 2WFWA 4LF8L 4BY1H 3M85A 3GTOH 1PH8A 2NZHA 1GKHA 1JJCB 3JAMc 1SMXA 4IPCA 3M4OH 4B3TQ 4BY7G 3HOXH 3T1HQ 3PSIA 4BBSH 1Y1VG 5C0XJ 4LF9L 5GQOA 4GOPB 2WAQE 1GD7A 2GVAA 2NVYH 2V1CC 2Z6KC 5BR8Q 1ASYA 3DM3A 1TWHH 1I3QH 4WJ3M 5IYBH 4YHHQ 1VQHA 4UY8C 3GTJH 1Y14B 4GNXC 1IZ6A 2VQEL 1YBYA 2VUMG 4X65Q 1IBML 3RLOA 3HKZG 1IBLQ 1XNQQ 4JBKA 1A0IA 1MJCA 3I7FA 5IT9c 3I56A 1J5EL 2VQEQ 3PF4A 2MO0A 1N9WA 3KLWA 4QL5A 5IWAQ 3DLLA 3K81C 3UE0A 4HJ9A 4O0AA 3GTGH 2B29A 1J6QA 2JA8G 4DV6L 4GNXB 1Y1VH 4KLKA 1CKNB 3HOZH 1X56A 4C3HH 1UE7A 4DR3L 3S16H 4QGUA 5LMNW 4GN4B 3HKSA 4DV3L 1UE1A 3GTLH 2Y0SE 1DGSA 1GO3E 4JI6L 4DR4L 1Q81C 2Y0SG 2IT1A 2VUMH 3J81c 1FGUA 5GAGC 1NMGA 4A3GH 3CCRA 4JI8Q 1HNXL 1SE8A 2JJQA 1N34Q 2PI2E 5LMUQ 2JA9A 4LFBQ 1X54A 3E0EA 1E1TA 1H95A 3ERSX 5C0XG 2JA8H 3I4MG 1RL2A 1PH6A 4JI7L 2JA7H 3KJPA 1XNRQ 4JV5Q 1I94L 1VQIA 3GD7A 1EQRA 3S1NH 2NN6G 1BVSA 5C4JH 1UE5A 4DV1Q 3JAMi 3EBEA 1OXXK 4MTNA 4BA1I 1OXUA 1VQCA 1PYSB 5ELNA 2K5VA 4A3CH 4DV1L 5J3BA 1NJIC 2K50A 3Q8DA 4BA2I 3OTOL 2VZAA 1QUQA 1K8GA 2FXQA 2LXKA 3KF8B 4P74A 4HJ5A 4B3SL 4POGA 2LSSA 4GLVB 3I4NG 1PH2A 3HOWH 2CKZB 1EOVA 2UUCQ 1VS0A 1S40A 1HNWQ 5IE8A 4B3SQ 4B3TL 4DR2Q 5C44H 1KL9A 2XGTA 3F1ZA 4NB3A 4A3BG 1R9TH 4IFDG 4TVAB 2EIFA 2ZM6Q 3T1YL 2JA5G 1OXVA 4JC0A 4AH6A 2AKWB 4UP7A 1TWGH 4JI4Q 4HJ7A 1V43A 4IOAA 2VY3A 4A3CG 1SN8A 3S1QH 1PYBA 3KF6A 3RR5A 2B63H 1XMOQ 4LUZA 4P75A 4LFCQ 1QVCA 2IX1A 3CMEA 4JI2L 2VW9A 4DV7L 3S1MH 5M5XH 3EIVA 1X3GA 1V9PA 3HOWG 5IWAL 2D0PA 4RG1A 1W3SA 1XMOL 4P73A 4A3MG 2CWAA 2ZJPA 1VCIA 4TQUS 4OO1G 1YITA 2CQOA 1Z47A 3PV0A 4YWLA 4MZ9A 5IYDG 1C7YA 2HHHQ 4FDBA 4DV5L 4C2MH 3CMAA 5LMNL 1Y1WG 3MXNB 5H1SE 4JOIA 3HOVG 1GM5A 3LGJA 3F2BA 3H0GH 4R4QA 4X64L 3J80i 4YY3L 2OTLA 1IL2A 1YJ9A 4YCVA 4YWKA 1A63A 4AYBG 2R7FA 4YY3Q 2C35B 4A3EG 3ULPA 1G51A 5C4XG 3W1BA 4IPDA 3J81i 4GN3B 3PIOA 4GLXA 3TREA 3H3VH 1K83H 3U4VA 4H02A 4DV0Q 2R7ZH 5K36G 4ALPA 1N36L 4NXNL 3L7ZC 1E24A 3M7NA 3UDIA 4KI0A 2E2IH 2D62A 5HY6A 2N8NA 3E9HA 4JYAQ 1QZHA 1K73C 4A3FH 4LFAQ 1TWCH 1N33L 5JJIA 1QVFA 3RNUA 4QIWE 4GKKL 4A3DH 4PZ7A 2KCTA 1L1OB 1XMQQ 3HOZG 4K0KQ 2I5LX 2UXDL 3I55A 2E2HH 4BBSG 3H0GG 1OXSC 4HIOA 4L5RC 4A93G 2R92H 3M4PA 3CD6A 5M3MG 4A3EH 1Q12A 4DKAC 2AWNA 2DGYA 4JBJA 4JI3L 4DAMA 1PH9A 1N34L 1PFSA 2I5HA 5AJ3L 4LFBL 4JI4L 4UP8A 5M3FG 1HR0Q 1L1OC 2E8GA 2Q2TA 1AE3A 4R4TA 1M1KC 1K9MC 3F8TA 2MQHA 3BJUA 4OWXB 4B3RL 4P72A 3CC7A 3H15A 3CCQA 1Q7YC 3J7A5 1JJGA 2Q2HA 4RMFA 1KRSA 1S72A 1GVPA 2EQSA 3CPFA 4JI7Q 4A93H 2H5XA 1FJGL 1YHQA 4YWMA 5IY0A 4OWWB 4L5QA 4DR5L 4XTCS 3SGIA 1SROA 5C3EG 1YJNA 2R93G 3L0OA 4JG2A 1JJ2A 3K7AH 3FHWA 4HJAA 2ZTDA 4HIMA 4JI0L 4LF4L 2MNAA 4IFDI 4L5TA 5GROA 3T1YQ 2R6GA 2NVTH 3GTPH 2HQLA 1NY4A 1AE2A 1VQMA 2DUDA 4X66Q 1VQ8A 4LF6L 2Q2IA 3VDYA 4DUZQ 3GDEA 3KYHC 3STBC 4DAYB 4DV7Q 1KC8C 2GVBA 2WAQG 2KENA 4IPHA 3UDXA 4DV3Q 1Q82C 3A5ZB 3M9BA 3UE1A 1K3RA 2VQFL 3S14H 2AMCB 2MO1A 2GN5A 3K8AA 3PUYA 3PUZA 1E7ZA 2CFMA 4A3KG 1X3FA 5FJ8G 3TS0A 1SLJA 4A3LG 1MIUA 2B3GA 3K80C 4IJHA 5FLXc 3M4QA 5GADC 1VQ9A 3BU2A 4XIGS 4DUYQ 2IX0A 2K4KA 4B3ML 3G48A 1PA6A 2ASBA 1IBMQ 2ZJRA 4OX9L 2UXBQ 1WCMG 1HZBA 4QY7A 1PH5A 1EQQA 1QUQB 4OO1I 4DR3Q 3D0FA 1PHJA 2BH2A 1JMCA 3J7ZC 4DV6Q 1LYLA 1VQGA 3AEVA 1YHBA 3RZOH 1XNQL 4PMWA 3ULJA 2LXJA 3NBHB 4JBMA 3L2PA 3NEMA 4A3MH 1VQ4A 2K14A 4POFA 5LMUL 2AWOA 3I2ZA 5FLMH 3T1HL 1N32Q 1G6PA 4JI8L 1PH3A 4L5SA 3E9IA 4JI5L 2N78A 3W1GA 1D7QA 4ME3A 3CF5A 1N36Q 4A3IG 3AFPA 2Z6KA 4BBRH 4UPAA 3KF6B 4DR2L 1WCMH 4DV4Q 2KHJA 1KIXA 4JI3Q 2BA0A 5DLQE 3KDFA 4IOCA 1HR0W 2OTJA 4BXXH 1HZ9A 2K52A 4X62L 4KHPQ 2UUBL 4P71A 3RZDH 3TQYA 4HIDA 2K5HA 3CP0A 1OXTA 1XMQL 2ES2A 1YZ6A 2HHHL 1CKOA 1IBKQ 1VQOA 1WYDA 1YJWA 4EX5A 4LF7L 3A0JA 1A8VA 3BZCA 1WFQA 1YI2A 3AYHB 1N8RC 4LF7Q 1M90C 3KFUA 1KAWA 4GNXA 4YHHL 4LUOA 3PO2H 3HOVH 2BH8A 2MFIA 1CUKA 2I5MX 2R7DA 1VQPA 2F4VL 1HNWL 4X62Q 4KHPL 2UU9Q 4BXXG 4LFCL 5HGQA 1LUZA 2WB1G 4IO9A 1YHAA 3ULLA 1LM0A 4AIMA 1WJJA 4DPGA 4OXPA 3J80c 3CCJA 2Z0SA 1BBWA 2YTVA 4OWTB 4DV5Q 4HIKA 3GTQH 1CSPA 1G291 3S1RH 4LF8Q 2QEXA 4GKJQ 2K75A 3RN5A 3CCLA 1IXRA 4IPGA 1VQNA 3PO3H 2JA6G 2UXCL 1P8LA 2NN6I 3CQZH 1JT8A 4LF5Q 2VQFQ 1JE5A 1VQJA 3RLNA 2UUCL 1Q8KA 3PO2G 1ASZA 3CC2A 2PQAB 1EYGA 1A62A 1EWIA 1NMFA 2QA4A 1V1QA 1E22A 1U5KA 4AYBE 4LW1A 3RLFA 4DNIA 2L15A 2OWOA 5M3MH 4LF6Q 3CCMA 3HOUG 3K0XA 1OTCA 1JB7A 1VQEA 2A8VA 2UXBL 4UP9A 1N33Q 1VQ7A 2VS1A 4NXML 4YCWA 4B3RQ 2YYZA 4DR7L 1PH1A 2NVQH 1P16A 1CSQA 4JI1Q 3A5UA 2ZJQA 1HNZQ 4R4CA 4C3JH 4Y52H 1YEZA 1KHIA 2JE6I 1KXLA 4PZ8A 3PF5A 4DK3C 4X6AH 1Q46A 3S24A 2A19A 4DK6C 2RCNA 4GLAC 3CW2C 3FKIG 2K5NA 4LF9Q 4A3BH 1HZCA 3S2DH 3CCSA 1C0AA 1UE6A 4A3JH 1WOCA 3S15H 2R93H 4GKKQ 1D8LA 5JEAG 2IHEA 4JBWA 4DR7Q 4JI5Q 1X6OA 1X3EA 1I50H 3PCOB 5AJ3Q 2E5LL 3H3VI 4JYAL 1N32L 1RIPA 4EQ5A 3OW2A 1I5FA 1IBKL 2HIVA 1UWVA 1X65A 2NZOA 3PUVA 1FJGQ 3J81j 2IY5B 1SR3A 4JCVE 2YTYA 2A1AA 2UXDQ 5IP9G 2UUBQ 3EN2A 4APVA 5JJKA 3FKIH 3HFZB 2AHOB 1O7IA 4WJ4A 5IYCG 3FP9A 1BBUA 1X55A 4B3MQ 1B7YB 1VQLA 3CAMA 4A3JG 1XPRA 4A3IH 5EAYA 4GKJL 4A3LH 4J15A 2KHIA 2ZM6L 1HR0L 3GTKH 3U4ZA 5IYDH 1QZGA 3HOYH 4BY1G 4R4IA 2N49A 1Q1EA 2ID0A 1E3PA 1FL0A 1XTDA 1IYJB 3ZJYC 2HT1A 1Y1WH 1AH9A 5M5WH 4NPSA 4BY7H 1NE3A 1UEBA 4DR6L 2NVXH 4NXNQ 1VQAA 1EIFA 5IP9H 3NENA 5LMNQ 5C4XH 1EFWA 4DUZL 2UU9L 2CWPA 3OTOQ 2KBNA 3KJOA 4DR1L 4O2DA 3PGZA 3WWVA 3NELA 1CKMA 1Z9FA 2XTIA 5FLMG 2RHSB 4A3FG 2E2JH 1TWAH 4OONA 4JI0Q 2YTXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C3I H;  4QJF A;  1TWF H;  3U58 A;  3UDF A;  2JK8 A;  3S2H H;  4LUV A;  1K0R A;  2F3I A;  3HOY G;  5E7N A;  4BBR G;  2R92 G;  4A75 A;  4A3D G;  4JI2 Q;  1WI5 A;  2PNH A;  5BR8 L;  2WB1 E;  2I0Q A;  2QGQ A;  3TEH B;  3M3Y H;  2VNU D;  4X64 Q;  5C0X I;  5IP7 G;  4OX9 Q;  2IHF A;  1C9O A;  2KCM A;  2PI2 A;  1XPO A;  1HNZ L;  1KRT A;  4PZ6 A;  4DUY L;  4Y7N H;  3KOJ A;  5JJL A;  4IJL A;  3PO3 G;  4X66 L;  3TRZ A;  3AFQ A;  3ER0 A;  1HH2 P;  4KHZ A;  1XJV A;  1Q1B A;  1W2B A;  5M3F H;  1PH7 A;  4LNQ A;  4LWC A;  3KDF B;  3OYY A;  2UUA L;  3CXC A;  1E1O A;  4A3G G;  1YVC A;  1NTG A;  4GOP C;  2OCE A;  2YV5 A;  3JC6 6;  4DR5 Q;  5ELO A;  4GN5 A;  1HJP A;  3I4N H;  4JOI C;  3F2D A;  3GO5 A;  2D0O A;  3A74 A;  1NBW A;  1LTL A;  4A76 A;  2N3S A;  4GOP A;  4JV5 L;  3AQQ A;  4JI1 L;  5GAH C;  3I4M H;  4A4I A;  4AQY Q;  2OQK A;  3CCU A;  1HZA A;  1L2F A;  1XPU A;  5IP7 H;  2JA7 G;  1TXY A;  3K7U C;  1YIJ A;  2E5L Q;  3U50 C;  1VQ5 A;  4LFA L;  1PVO A;  4NXM Q;  3I4O A;  2VL6 A;  3B6Y A;  1PV4 A;  1IBL L;  5C3E H;  4R4O A;  3PUX A;  3STB D;  1VQ6 A;  3G4S A;  4AQY L;  2RHQ B;  3UDG A;  2JA6 H;  3RN2 A;  1XNR L;  2ZTE A;  3D31 A;  4DV0 L;  2RF4 A;  1X9N A;  5M5Y H;  1EUJ A;  4PG3 A;  1L0W A;  3CCE A;  2ATW A;  2PQA A;  1K8A C;  1U0L A;  4DR6 Q;  3GTM H;  3S17 H;  3BZK A;  1HNX Q;  1PH4 A;  3F2C A;  1VQB A;  1FVI A;  2ALY B;  4YCU A;  3HOU H;  1EIY B;  2UXC Q;  1VQF A;  3W5O A;  3ICE A;  1T9H A;  4K0K L;  3HKZ E;  3IRB A;  5C44 G;  1B70 B;  1MKH A;  1Q86 C;  4A3K H;  1QVG A;  3CC4 A;  3CCV A;  4LF4 Q;  5FJ8 H;  3MEF A;  4JI6 Q;  4DR4 Q;  2EXD A;  2JA5 H;  1L1O A;  3PUW A;  2BA1 A;  3HOX G;  1I6H H;  4HJ8 A;  2CCZ A;  4DV2 L;  3PIP A;  2PMZ E;  4R1J A;  2ZTC A;  2HIX A;  1YNX A;  2JQO A;  5GAE C;  3CPW A;  4DR1 Q;  1SFO H;  1MJE A;  1I94 Q;  1CKN A;  1S3O A;  3G71 A;  1VQK A;  1B8A A;  2Q2U A;  2B63 G;  2F4V Q;  2JEA I;  2OQ0 A;  3G6E A;  1BKB A;  2R7Z G;  5JEA J;  5IYB G;  5IYC H;  1SRU A;  4GS3 A;  4DV2 Q;  4MNO A;  2YU9 H;  4LF5 L;  3TS2 A;  1VQD A;  2JEB I;  4DV4 L;  1J5E Q;  4IFD J;  2UUA Q;  2F52 A;  4X65 L;  1KQS A;  1KD1 C;  2WP8 J;  4QQB X;  2WFW A;  4LF8 L;  4BY1 H;  3M85 A;  3GTO H;  1PH8 A;  2NZH A;  1GKH A;  1JJC B;  3JAM c;  1SMX A;  4IPC A;  3M4O H;  4B3T Q;  4BY7 G;  3HOX H;  3T1H Q;  3PSI A;  4BBS H;  1Y1V G;  5C0X J;  4LF9 L;  5GQO A;  4GOP B;  2WAQ E;  1GD7 A;  2GVA A;  2NVY H;  2V1C C;  2Z6K C;  5BR8 Q;  1ASY A;  3DM3 A;  1TWH H;  1I3Q H;  4WJ3 M;  5IYB H;  4YHH Q;  1VQH A;  4UY8 C;  3GTJ H;  1Y14 B;  4GNX C;  1IZ6 A;  2VQE L;  1YBY A;  2VUM G;  4X65 Q;  1IBM L;  3RLO A;  3HKZ G;  1IBL Q;  1XNQ Q;  4JBK A;  1A0I A;  1MJC A;  3I7F A;  5IT9 c;  3I56 A;  1J5E L;  2VQE Q;  3PF4 A;  2MO0 A;  1N9W A;  3KLW A;  4QL5 A;  5IWA Q;  3DLL A;  3K81 C;  3UE0 A;  4HJ9 A;  4O0A A;  3GTG H;  2B29 A;  1J6Q A;  2JA8 G;  4DV6 L;  4GNX B;  1Y1V H;  4KLK A;  1CKN B;  3HOZ H;  1X56 A;  4C3H H;  1UE7 A;  4DR3 L;  3S16 H;  4QGU A;  5LMN W;  4GN4 B;  3HKS A;  4DV3 L;  1UE1 A;  3GTL H;  2Y0S E;  1DGS A;  1GO3 E;  4JI6 L;  4DR4 L;  1Q81 C;  2Y0S G;  2IT1 A;  2VUM H;  3J81 c;  1FGU A;  5GAG C;  1NMG A;  4A3G H;  3CCR A;  4JI8 Q;  1HNX L;  1SE8 A;  2JJQ A;  1N34 Q;  2PI2 E;  5LMU Q;  2JA9 A;  4LFB Q;  1X54 A;  3E0E A;  1E1T A;  1H95 A;  3ERS X;  5C0X G;  2JA8 H;  3I4M G;  1RL2 A;  1PH6 A;  4JI7 L;  2JA7 H;  3KJP A;  1XNR Q;  4JV5 Q;  1I94 L;  1VQI A;  3GD7 A;  1EQR A;  3S1N H;  2NN6 G;  1BVS A;  5C4J H;  1UE5 A;  4DV1 Q;  3JAM i;  3EBE A;  1OXX K;  4MTN A;  4BA1 I;  1OXU A;  1VQC A;  1PYS B;  5ELN A;  2K5V A;  4A3C H;  4DV1 L;  5J3B A;  1NJI C;  2K50 A;  3Q8D A;  4BA2 I;  3OTO L;  2VZA A;  1QUQ A;  1K8G A;  2FXQ A;  2LXK A;  3KF8 B;  4P74 A;  4HJ5 A;  4B3S L;  4POG A;  2LSS A;  4GLV B;  3I4N G;  1PH2 A;  3HOW H;  2CKZ B;  1EOV A;  2UUC Q;  1VS0 A;  1S40 A;  1HNW Q;  5IE8 A;  4B3S Q;  4B3T L;  4DR2 Q;  5C44 H;  1KL9 A;  2XGT A;  3F1Z A;  4NB3 A;  4A3B G;  1R9T H;  4IFD G;  4TVA B;  2EIF A;  2ZM6 Q;  3T1Y L;  2JA5 G;  1OXV A;  4JC0 A;  4AH6 A;  2AKW B;  4UP7 A;  1TWG H;  4JI4 Q;  4HJ7 A;  1V43 A;  4IOA A;  2VY3 A;  4A3C G;  1SN8 A;  3S1Q H;  1PYB A;  3KF6 A;  3RR5 A;  2B63 H;  1XMO Q;  4LUZ A;  4P75 A;  4LFC Q;  1QVC A;  2IX1 A;  3CME A;  4JI2 L;  2VW9 A;  4DV7 L;  3S1M H;  5M5X H;  3EIV A;  1X3G A;  1V9P A;  3HOW G;  5IWA L;  2D0P A;  4RG1 A;  1W3S A;  1XMO L;  4P73 A;  4A3M G;  2CWA A;  2ZJP A;  1VCI A;  4TQU S;  4OO1 G;  1YIT A;  2CQO A;  1Z47 A;  3PV0 A;  4YWL A;  4MZ9 A;  5IYD G;  1C7Y A;  2HHH Q;  4FDB A;  4DV5 L;  4C2M H;  3CMA A;  5LMN L;  1Y1W G;  3MXN B;  5H1S E;  4JOI A;  3HOV G;  1GM5 A;  3LGJ A;  3F2B A;  3H0G H;  4R4Q A;  4X64 L;  3J80 i;  4YY3 L;  2OTL A;  1IL2 A;  1YJ9 A;  4YCV A;  4YWK A;  1A63 A;  4AYB G;  2R7F A;  4YY3 Q;  2C35 B;  4A3E G;  3ULP A;  1G51 A;  5C4X G;  3W1B A;  4IPD A;  3J81 i;  4GN3 B;  3PIO A;  4GLX A;  3TRE A;  3H3V H;  1K83 H;  3U4V A;  4H02 A;  4DV0 Q;  2R7Z H;  5K36 G;  4ALP A;  1N36 L;  4NXN L;  3L7Z C;  1E24 A;  3M7N A;  3UDI A;  4KI0 A;  2E2I H;  2D62 A;  5HY6 A;  2N8N A;  3E9H A;  4JYA Q;  1QZH A;  1K73 C;  4A3F H;  4LFA Q;  1TWC H;  1N33 L;  5JJI A;  1QVF A;  3RNU A;  4QIW E;  4GKK L;  4A3D H;  4PZ7 A;  2KCT A;  1L1O B;  1XMQ Q;  3HOZ G;  4K0K Q;  2I5L X;  2UXD L;  3I55 A;  2E2H H;  4BBS G;  3H0G G;  1OXS C;  4HIO A;  4L5R C;  4A93 G;  2R92 H;  3M4P A;  3CD6 A;  5M3M G;  4A3E H;  1Q12 A;  4DKA C;  2AWN A;  2DGY A;  4JBJ A;  4JI3 L;  4DAM A;  1PH9 A;  1N34 L;  1PFS A;  2I5H A;  5AJ3 L;  4LFB L;  4JI4 L;  4UP8 A;  5M3F G;  1HR0 Q;  1L1O C;  2E8G A;  2Q2T A;  1AE3 A;  4R4T A;  1M1K C;  1K9M C;  3F8T A;  2MQH A;  3BJU A;  4OWX B;  4B3R L;  4P72 A;  3CC7 A;  3H15 A;  3CCQ A;  1Q7Y C;  3J7A 5;  1JJG A;  2Q2H A;  4RMF A;  1KRS A;  1S72 A;  1GVP A;  2EQS A;  3CPF A;  4JI7 Q;  4A93 H;  2H5X A;  1FJG L;  1YHQ A;  4YWM A;  5IY0 A;  4OWW B;  4L5Q A;  4DR5 L;  4XTC S;  3SGI A;  1SRO A;  5C3E G;  1YJN A;  2R93 G;  3L0O A;  4JG2 A;  1JJ2 A;  3K7A H;  3FHW A;  4HJA A;  2ZTD A;  4HIM A;  4JI0 L;  4LF4 L;  2MNA A;  4IFD I;  4L5T A;  5GRO A;  3T1Y Q;  2R6G A;  2NVT H;  3GTP H;  2HQL A;  1NY4 A;  1AE2 A;  1VQM A;  2DUD A;  4X66 Q;  1VQ8 A;  4LF6 L;  2Q2I A;  3VDY A;  4DUZ Q;  3GDE A;  3KYH C;  3STB C;  4DAY B;  4DV7 Q;  1KC8 C;  2GVB A;  2WAQ G;  2KEN A;  4IPH A;  3UDX A;  4DV3 Q;  1Q82 C;  3A5Z B;  3M9B A;  3UE1 A;  1K3R A;  2VQF L;  3S14 H;  2AMC B;  2MO1 A;  2GN5 A;  3K8A A;  3PUY A;  3PUZ A;  1E7Z A;  2CFM A;  4A3K G;  1X3F A;  5FJ8 G;  3TS0 A;  1SLJ A;  4A3L G;  1MIU A;  2B3G A;  3K80 C;  4IJH A;  5FLX c;  3M4Q A;  5GAD C;  1VQ9 A;  3BU2 A;  4XIG S;  4DUY Q;  2IX0 A;  2K4K A;  4B3M L;  3G48 A;  1PA6 A;  2ASB A;  1IBM Q;  2ZJR A;  4OX9 L;  2UXB Q;  1WCM G;  1HZB A;  4QY7 A;  1PH5 A;  1EQQ A;  1QUQ B;  4OO1 I;  4DR3 Q;  3D0F A;  1PHJ A;  2BH2 A;  1JMC A;  3J7Z C;  4DV6 Q;  1LYL A;  1VQG A;  3AEV A;  1YHB A;  3RZO H;  1XNQ L;  4PMW A;  3ULJ A;  2LXJ A;  3NBH B;  4JBM A;  3L2P A;  3NEM A;  4A3M H;  1VQ4 A;  2K14 A;  4POF A;  5LMU L;  2AWO A;  3I2Z A;  5FLM H;  3T1H L;  1N32 Q;  1G6P A;  4JI8 L;  1PH3 A;  4L5S A;  3E9I A;  4JI5 L;  2N78 A;  3W1G A;  1D7Q A;  4ME3 A;  3CF5 A;  1N36 Q;  4A3I G;  3AFP A;  2Z6K A;  4BBR H;  4UPA A;  3KF6 B;  4DR2 L;  1WCM H;  4DV4 Q;  2KHJ A;  1KIX A;  4JI3 Q;  2BA0 A;  5DLQ E;  3KDF A;  4IOC A;  1HR0 W;  2OTJ A;  4BXX H;  1HZ9 A;  2K52 A;  4X62 L;  4KHP Q;  2UUB L;  4P71 A;  3RZD H;  3TQY A;  4HID A;  2K5H A;  3CP0 A;  1OXT A;  1XMQ L;  2ES2 A;  1YZ6 A;  2HHH L;  1CKO A;  1IBK Q;  1VQO A;  1WYD A;  1YJW A;  4EX5 A;  4LF7 L;  3A0J A;  1A8V A;  3BZC A;  1WFQ A;  1YI2 A;  3AYH B;  1N8R C;  4LF7 Q;  1M90 C;  3KFU A;  1KAW A;  4GNX A;  4YHH L;  4LUO A;  3PO2 H;  3HOV H;  2BH8 A;  2MFI A;  1CUK A;  2I5M X;  2R7D A;  1VQP A;  2F4V L;  1HNW L;  4X62 Q;  4KHP L;  2UU9 Q;  4BXX G;  4LFC L;  5HGQ A;  1LUZ A;  2WB1 G;  4IO9 A;  1YHA A;  3ULL A;  1LM0 A;  4AIM A;  1WJJ A;  4DPG A;  4OXP A;  3J80 c;  3CCJ A;  2Z0S A;  1BBW A;  2YTV A;  4OWT B;  4DV5 Q;  4HIK A;  3GTQ H;  1CSP A;  1G29 1;  3S1R H;  4LF8 Q;  2QEX A;  4GKJ Q;  2K75 A;  3RN5 A;  3CCL A;  1IXR A;  4IPG A;  1VQN A;  3PO3 H;  2JA6 G;  2UXC L;  1P8L A;  2NN6 I;  3CQZ H;  1JT8 A;  4LF5 Q;  2VQF Q;  1JE5 A;  1VQJ A;  3RLN A;  2UUC L;  1Q8K A;  3PO2 G;  1ASZ A;  3CC2 A;  2PQA B;  1EYG A;  1A62 A;  1EWI A;  1NMF A;  2QA4 A;  1V1Q A;  1E22 A;  1U5K A;  4AYB E;  4LW1 A;  3RLF A;  4DNI A;  2L15 A;  2OWO A;  5M3M H;  4LF6 Q;  3CCM A;  3HOU G;  3K0X A;  1OTC A;  1JB7 A;  1VQE A;  2A8V A;  2UXB L;  4UP9 A;  1N33 Q;  1VQ7 A;  2VS1 A;  4NXM L;  4YCW A;  4B3R Q;  2YYZ A;  4DR7 L;  1PH1 A;  2NVQ H;  1P16 A;  1CSQ A;  4JI1 Q;  3A5U A;  2ZJQ A;  1HNZ Q;  4R4C A;  4C3J H;  4Y52 H;  1YEZ A;  1KHI A;  2JE6 I;  1KXL A;  4PZ8 A;  3PF5 A;  4DK3 C;  4X6A H;  1Q46 A;  3S24 A;  2A19 A;  4DK6 C;  2RCN A;  4GLA C;  3CW2 C;  3FKI G;  2K5N A;  4LF9 Q;  4A3B H;  1HZC A;  3S2D H;  3CCS A;  1C0A A;  1UE6 A;  4A3J H;  1WOC A;  3S15 H;  2R93 H;  4GKK Q;  1D8L A;  5JEA G;  2IHE A;  4JBW A;  4DR7 Q;  4JI5 Q;  1X6O A;  1X3E A;  1I50 H;  3PCO B;  5AJ3 Q;  2E5L L;  3H3V I;  4JYA L;  1N32 L;  1RIP A;  4EQ5 A;  3OW2 A;  1I5F A;  1IBK L;  2HIV A;  1UWV A;  1X65 A;  2NZO A;  3PUV A;  1FJG Q;  3J81 j;  2IY5 B;  1SR3 A;  4JCV E;  2YTY A;  2A1A A;  2UXD Q;  5IP9 G;  2UUB Q;  3EN2 A;  4APV A;  5JJK A;  3FKI H;  3HFZ B;  2AHO B;  1O7I A;  4WJ4 A;  5IYC G;  3FP9 A;  1BBU A;  1X55 A;  4B3M Q;  1B7Y B;  1VQL A;  3CAM A;  4A3J G;  1XPR A;  4A3I H;  5EAY A;  4GKJ L;  4A3L H;  4J15 A;  2KHI A;  2ZM6 L;  1HR0 L;  3GTK H;  3U4Z A;  5IYD H;  1QZG A;  3HOY H;  4BY1 G;  4R4I A;  2N49 A;  1Q1E A;  2ID0 A;  1E3P A;  1FL0 A;  1XTD A;  1IYJ B;  3ZJY C;  2HT1 A;  1Y1W H;  1AH9 A;  5M5W H;  4NPS A;  4BY7 H;  1NE3 A;  1UEB A;  4DR6 L;  2NVX H;  4NXN Q;  1VQA A;  1EIF A;  5IP9 H;  3NEN A;  5LMN Q;  5C4X H;  1EFW A;  4DUZ L;  2UU9 L;  2CWP A;  3OTO Q;  2KBN A;  3KJO A;  4DR1 L;  4O2D A;  3PGZ A;  3WWV A;  3NEL A;  1CKM A;  1Z9F A;  2XTI A;  5FLM G;  2RHS B;  4A3F G;  2E2J H;  1TWA H;  4OON A;  4JI0 Q;  2YTX A; 
#chains in the Genus database with same CATH topology
 4OHJ A;  3H91 A;  4QJF A;  4RWS C;  4C3I H;  1EY5 A;  4A75 A;  2BDN A;  4C3J B;  2DNC A;  1X32 A;  2IHF A;  5D3I B;  2KCM A;  2OXP A;  1KRT A;  4RHR A;  4X66 L;  4TKO B;  3AFQ A;  3ER0 A;  3TRZ A;  1PH7 A;  1I4R A;  2I46 A;  2XN9 C;  2E2J B;  3KLS A;  4LWC A;  2J0T D;  4G57 A;  2R93 B;  3CXC A;  4A3G G;  1YVC A;  5M3M B;  2OCE A;  2YV5 A;  4GN5 A;  4WOR A;  1ENA A;  3MXN A;  1DJR D;  3GO5 A;  2D0O A;  4E6I A;  3C2P A;  1HCZ A;  1JE4 A;  4JV5 L;  5FO9 B;  4DFA A;  3CCU A;  1L2F A;  2F3V A;  5IP7 H;  4FF3 A;  3K7U C;  2G9H D;  3U50 C;  2VUM B;  2PQE A;  1PV4 A;  4KJN A;  1JOO A;  4K2K A;  1VQ6 A;  4XXE A;  2JA6 H;  3RN2 A;  3D31 A;  5M5Y H;  2AQ1 B;  2XWB B;  1PFB A;  4PG3 A;  1S5E D;  1K8A C;  1U0L A;  3MTS A;  1EFI D;  1PFM A;  4CKC A;  2HD3 A;  4JVZ A;  3S17 H;  5E4W C;  3S1Q B;  1EIY B;  1HXY D;  1KDA A;  4OL7 A;  1ICW A;  2ZXR A;  3BDC A;  4IUN A;  5FLX E;  1L1O A;  2JA5 H;  5A2Q L;  4HJ8 A;  2CCZ A;  1LV9 A;  4R1J A;  2ZTC A;  1SFO H;  2B63 G;  1S3O A;  1VQK A;  2Q2U A;  2RBM A;  2JEA I;  3G6E A;  5JEA J;  5IYB G;  2OF1 A;  4LF5 L;  3GTO B;  2JEB I;  4DV4 L;  2EY6 A;  5ELC A;  1RTO A;  1T5E A;  3W3A A;  4FP5 D;  2WP8 J;  1B9M A;  4BY1 H;  5CV7 A;  3M85 A;  1I4G A;  3X3M A;  4G7Z C;  4B3T Q;  4RCN A;  1MGS A;  4LF9 L;  2B8G A;  3I72 A;  2WAQ E;  2GVA A;  5BR8 Q;  2V1C C;  1ASY A;  3PMF A;  4FXK C;  1I3Q H;  4UY8 C;  2PNR C;  4BBR B;  1IZ6 A;  2JYO A;  4GNX C;  2PO4 A;  1PTO C;  3RLO A;  1IBL Q;  1MJC A;  3NQI A;  3I70 A;  5FKA C;  1SND A;  2VQE Q;  1BO0 A;  1MI2 A;  4Y7N B;  3PF4 A;  5IWA Q;  3DLL A;  4DGZ A;  3P7J A;  1FYC A;  1W6J A;  3DEP A;  1SYB A;  2H4O A;  3ONA B;  4GNX B;  3GTM B;  4KLK A;  1X56 A;  4DR3 L;  4ABN A;  2EYM A;  2F0S A;  1WTQ A;  2FIN B;  3PO2 B;  2Y0S E;  4DR4 L;  5DM6 3;  2K05 A;  3DWA A;  2IT1 A;  5GAG C;  5IIF A;  4PNY A;  3CCR A;  4JI8 Q;  2HQE A;  1GHK A;  2D2C C;  1SE8 A;  3SEB A;  5IGF A;  2PI2 E;  1M8A A;  4L63 B;  1X54 A;  1SNO A;  3E0E A;  2NVY B;  5C0X G;  1PH6 A;  4JI7 L;  1I94 L;  2NTS A;  3GD7 A;  5G3L D;  3JAM E;  1CHQ D;  4BA1 I;  4ZUJ A;  1VQC A;  1PYS B;  1SE2 A;  1WD0 A;  4BA2 I;  1GUW A;  3NSW A;  1QUQ A;  1B9N A;  3I4N G;  4Q0F A;  4KKT A;  4A93 B;  2CKZ B;  5JOB A;  3OWE B;  1VS0 A;  2UUC Q;  5IE8 A;  4B3S Q;  3L9A X;  2F0T A;  4EVO A;  1DOK A;  4UP7 A;  3I4L A;  4HJ7 A;  3IL8 A;  3BVZ A;  1SN8 A;  1PYB A;  5CGK A;  2QKI C;  1JB3 A;  1XMO Q;  4LUZ A;  4P75 A;  3BYY B;  3FPU B;  3NTK A;  4R9W A;  4IZ8 A;  2IX1 A;  1B3Q A;  4JI2 L;  2Z6B A;  1LTG D;  5K36 H;  4CHT B;  2D0P A;  1W3S A;  1XMO L;  4A3M G;  2CWA A;  2ZJP A;  1S5D D;  3I8Z A;  4TQU S;  1AZQ A;  4OO1 G;  4IAL A;  1CHP D;  3PV0 A;  2B8F A;  5CV5 A;  1C7Y A;  3K7A B;  1WD1 A;  3CMA A;  5LMN L;  1I4H A;  5H1S E;  4C56 C;  4H44 C;  4X64 L;  2ZXP A;  1YJ9 A;  1PTO D;  4A3E G;  5C4X G;  3MFG A;  4IPD A;  2LS0 1;  5E3F A;  2EY5 A;  3H3V H;  1ONL A;  1N36 L;  1RCV D;  1E24 A;  4DN4 M;  4KI0 A;  4IUT A;  5HY6 A;  3OWF A;  3GTK B;  2B2T A;  1PRT F;  1K73 C;  3A8K E;  5K5P A;  3S1R B;  4EQP A;  1TWC H;  1STA A;  1QVF A;  3RNU A;  2A6E C;  3K5N A;  1XMQ Q;  2B2Y C;  1STB A;  4NW2 A;  4BBS G;  3H0G G;  2MHV A;  1YNN C;  5M3M G;  2DGY A;  4DAM A;  1XWE A;  1CTM A;  1N34 L;  4LFB L;  3S2H B;  4IUP A;  4UP8 A;  3A56 A;  1L1O C;  3EQL C;  3SK8 A;  4ZQ3 A;  1DYQ A;  3ITP A;  4IUQ A;  1NSN S;  2F0H A;  1R9T B;  4HCE A;  2Q2H A;  1KNE A;  2EYO A;  1KRS A;  4KY6 A;  3GP7 A;  2WAC A;  2SNM A;  4LJZ C;  3BS1 A;  5CV8 A;  3MXU A;  4K6L A;  4O42 A;  1PTO B;  3TME A;  2B2W A;  1JWS D;  4DR5 L;  4XTC S;  3PO3 B;  2B2V C;  2P5Z X;  2JN4 A;  1JJ2 A;  4L6T B;  4IFD I;  3T1Y Q;  2R6G A;  3GTP H;  3DUZ A;  1VQM A;  4X66 Q;  1VQ8 A;  4LF6 L;  4RFB A;  2Q2I A;  3KYH C;  5CC4 A;  4NP5 A;  4DV7 Q;  3S1N B;  1AEX A;  2WAQ G;  2KEN A;  3MAQ A;  4DV3 Q;  5EKL A;  3A5Z B;  4B9X A;  4EQO A;  3S14 H;  2GN5 A;  2B63 B;  3FDT A;  3PUZ A;  1F9Q A;  4A3K G;  2JXM B;  1EZ6 A;  2RDF A;  1X3F A;  4A3L G;  5HGT A;  5GAD C;  1VQ9 A;  3JAM L;  3BU2 A;  4XIG S;  1LTR D;  2ASB A;  1IBM Q;  2UXB Q;  2EVB A;  2EY1 A;  4FO2 A;  2BH2 A;  4ZAI A;  3J7Z C;  1VQG A;  2WV6 D;  2XIW A;  5COY A;  4JBM A;  3NEM A;  1Y1V B;  1LTT D;  1AZP A;  2HDL A;  1JIC A;  1I4P A;  4DA2 A;  1GHJ A;  5EBC A;  5JVH 3;  4L5S A;  3E9I A;  4JI5 L;  3W1G A;  5HUR A;  2K03 A;  1N36 Q;  3VYU A;  1B1Z A;  3C1F A;  4JI3 Q;  2BA0 A;  3A7L A;  1NR2 A;  2EPB A;  3OMG A;  4XYQ A;  5AFW A;  1HZ9 A;  2JA8 B;  4X62 L;  4P71 A;  5D3D A;  3A7A B;  5G3L F;  1WCM B;  1IBK Q;  1SNC A;  1SNM A;  1VQO A;  1SE4 A;  1A8V A;  2SDF A;  4HN7 A;  1M90 C;  2XNA C;  1EY7 A;  4GNX A;  1A2T A;  4LUO A;  2PPB C;  4BS9 A;  5JJZ A;  3PIP 3;  2R7D A;  2F4V L;  4X62 Q;  4LK1 C;  2R92 B;  4IUR A;  4XT1 B;  4LFC L;  1LT6 D;  2SNS A;  2WB1 G;  4F7X A;  4UDU C;  4IO9 A;  1D5X C;  3J80 c;  1BBW A;  2YTV A;  3CRK C;  4GZY C;  1IL8 A;  1BF4 A;  2QEX A;  5CV4 A;  4GKJ Q;  3RN5 A;  1ZEQ X;  1IXR A;  2MGS A;  4IPG A;  1VQN A;  3I91 A;  2RSO A;  3CQZ H;  3RLN A;  1K83 B;  1M4V A;  1ASZ A;  1EYG A;  1A62 A;  3NPP A;  3SK4 A;  3VYS A;  1SYE A;  3RLF A;  4AYB E;  2OWO A;  5M3M H;  1HUN A;  3H6M A;  3P1H A;  2L11 A;  1JB7 A;  1YNJ C;  2F0J A;  1N33 Q;  3AMU A;  3A5U A;  2ZJQ A;  1HNZ Q;  1ROD A;  4R4C A;  4C3J H;  2JE6 I;  4CDE C;  3PF5 A;  4DK3 C;  5BN4 A;  4DK6 C;  4A3B H;  4LF9 Q;  5FO8 B;  1HZC A;  3V96 A;  1HTL D;  3KK7 A;  2Z8L A;  5IGB A;  3S15 H;  3GV6 A;  3TSS A;  1LT5 D;  1PYW D;  1LTI D;  5DEH A;  1TY2 A;  1S5F D;  2K5Q A;  1I5F A;  2M9V A;  1UWV A;  1JOK A;  1LLR D;  3PUV A;  4A3B B;  1SR3 A;  4JCV E;  3VA5 A;  4AYB B;  2WB1 B;  3EN2 A;  2F3W A;  5JJK A;  2AHO B;  4WJ4 A;  1X55 A;  1B7Y B;  3Q24 A;  5EAY A;  4J15 A;  3DXJ C;  2ZM6 L;  5C5M A;  5I9P A;  5IYD H;  1EL0 A;  1C8C A;  1XTD A;  1AH9 A;  5BN3 A;  4DR6 L;  1TS4 A;  2QW7 A;  1ESF A;  2CVR A;  2JP1 A;  3QO2 A;  3NEN A;  3H0G B;  2KBN A;  2F0N A;  3WWV A;  5FLM G;  1EY9 A;  3S9W A;  1TWA H;  4C1N I;  2X6G A;  4WJW A;  4RGO S;  3TZU A;  3HOY G;  2EZV A;  2B2T C;  2R92 G;  4A3D G;  1WI5 A;  2QDB A;  2I0Q A;  3URY A;  2QGQ A;  2L12 A;  2VNU D;  2E2H B;  3QJY A;  4X64 Q;  5C0X I;  5IP7 G;  2EJM A;  1C4Q A;  1C9O A;  1A6X A;  1Y8O B;  1XPO A;  1SJH D;  3H09 A;  3SK6 A;  4DUY L;  4UAI A;  5JJL A;  3KOJ A;  1HTP A;  4LNQ A;  3HZX A;  2UUA L;  1E1O A;  2PZU A;  3NTH A;  1NTG A;  4GOP C;  5C44 B;  4JOI C;  3A74 A;  1NBW A;  5C6A A;  1LTL A;  4A76 A;  4GOP A;  2K1B A;  2F0L A;  3AQQ A;  4CJ2 C;  1ZYR D;  3V2T A;  1PFN A;  1HZA A;  1XPU A;  1BCP F;  2E5L Q;  5CR3 A;  3K6O A;  5ELE A;  1PVO A;  1LAC A;  2VL6 A;  3B6Y A;  3I4O A;  2AUJ D;  5C3E H;  3G4S A;  2RHQ B;  2ICI A;  5IT9 L;  2RSN A;  3VR3 A;  1L0W A;  3CCE A;  4XT3 B;  2PQA A;  2G5D A;  1CZG A;  4Z9C B;  3BVG A;  3TP5 A;  2IWH A;  2F0W A;  1FVI A;  3E0J A;  5JEA H;  4X3S A;  4RGM A;  1T9H A;  3HKZ E;  1B70 B;  4LF4 Q;  5FJ8 H;  5I6W A;  4HSV A;  2BA1 A;  2MUY A;  4DV2 L;  3NUC A;  4IUU A;  2PMZ E;  4NXN Q;  1JQY D;  1MJE A;  2UU9 L;  4C1N K;  2LMC B;  2F4V Q;  2J4X A;  3G71 A;  1DOL A;  1B8A A;  5KEE A;  2E2D C;  3WDN A;  3FVQ A;  4QB4 A;  1D1K A;  2R7Z G;  1W6K A;  4GS3 A;  4DV2 Q;  4MNO A;  2YU9 H;  3TS2 A;  4IFD J;  1V1O A;  1GJX A;  4X65 L;  1KQS A;  1QE6 A;  2WFW A;  4LF8 L;  1TS5 A;  4DK0 A;  1GKH A;  3JAM c;  3SE0 A;  1HRJ A;  4IPC A;  3QWN A;  4S3S A;  3HOX H;  3GTJ B;  2X69 A;  1LTB D;  3NE5 B;  1GD7 A;  1Z6H A;  2A6H C;  4WJ3 M;  4YHH Q;  1VQH A;  3BVM A;  4K6D A;  1Y8N B;  1WTW A;  4X65 Q;  3J81 E;  1IBM L;  4XQN A;  3NXW A;  4CKE A;  2MO0 A;  1N9W A;  3KLW A;  4JPB W;  4QL5 A;  3K81 C;  5NUC A;  5DNF A;  3GTG H;  2B29 A;  1J6Q A;  1H9S B;  4DV6 L;  4K5V A;  5T1G A;  3HOZ H;  1CKN B;  5EKK A;  4QGU A;  4CDD C;  2E74 C;  1QNK A;  4GN4 B;  4DV3 L;  4JW0 A;  2M2L A;  4JI6 L;  1NUC A;  1SDF A;  2Y0S G;  1NMG A;  4A3G H;  3KBX A;  2A68 D;  4RAU C;  3BYT B;  2NWG A;  1PXU A;  3GV3 A;  3O13 A;  1ESR A;  1DON A;  5C4X B;  1H95 A;  2FHT A;  4KY7 A;  3ERS X;  2JA8 H;  4JV5 Q;  1IW7 C;  3KJP A;  2F0O A;  1QB5 D;  1VQI A;  3A54 A;  3DMU A;  1CA6 A;  1EQR A;  1UE5 A;  4DV1 Q;  3JAM i;  3EBE A;  4MTN A;  1JR0 D;  3K5L A;  2F03 A;  1WTR A;  3VR5 A;  5J3B A;  1NJI C;  1XTC D;  2FXQ A;  2LXK A;  3KF8 B;  4HJ5 A;  4B3S L;  1FNW A;  5JAV A;  2LSS A;  3HOW H;  3H3V C;  4K2L A;  1FD7 D;  1RF2 D;  1KL9 A;  3SXH A;  4OO1 H;  4IFD G;  2EIF A;  2RVL A;  2JA5 G;  1OXV A;  4JC0 A;  4A3K B;  4CJ1 B;  1TU2 B;  5KYL A;  4JI4 Q;  2B2Y A;  2A74 C;  2R7Z B;  2WKD A;  3RR5 A;  2B63 H;  4DAY A;  4LFC Q;  1QCB D;  1Y8P B;  1QVC A;  3DEO A;  5ELF A;  3CME A;  4R8I A;  2A6E D;  3EVQ A;  1FR3 A;  1YIT A;  3TP8 A;  2A5H A;  5I9O A;  4C2M H;  5KGU A;  5D14 A;  1KAA A;  1Y1W G;  3HOV G;  4NDX A;  3MHB A;  4JOI A;  2IW3 A;  5LHY 1;  3J80 i;  1IL2 A;  2OTL A;  1A63 A;  4YCV A;  3QOJ A;  4YWK A;  1G51 A;  1H9K A;  2B2W C;  3J81 i;  3Q6S A;  3PIO A;  1YNJ D;  2HUG A;  2K7V A;  3U4V A;  4ALP A;  4HED A;  4OGQ C;  4NXN L;  3Q23 A;  2E2I H;  2D62 A;  4C2M B;  2KUM A;  4LFA Q;  1N33 L;  5JJI A;  4QIW E;  1J9O A;  1PZJ D;  4PZ7 A;  1L1O B;  2A69 D;  1SJE D;  4QMG A;  3FRP B;  1OXS C;  2WIN B;  3E5S A;  5IGG A;  3M4P A;  3CD6 A;  4A3E H;  1Q12 A;  1TQO A;  2L5T A;  5AJ3 L;  1EIH A;  2Q8I B;  1TR5 A;  1K0S A;  1AE3 A;  1EY4 A;  4HSP A;  4OWX B;  4B3R L;  1E2Z A;  4P72 A;  4A3J B;  2K01 A;  3H15 A;  1Q7Y C;  1K28 A;  4HMJ A;  4RMF A;  3IFT A;  1GVP A;  4JI7 Q;  3HOW B;  4YWM A;  4OWW B;  4L5Q A;  4CDC C;  4CJ0 B;  1YJN A;  3L0O A;  4JG2 A;  1X3Q A;  3FHW A;  3K7A H;  4O1N A;  2GA4 B;  5GRO A;  1O7Z A;  3C3L A;  3GDE A;  2N55 A;  3STB C;  4DAY B;  1KC8 C;  1Q82 C;  1ET6 A;  4RGN A;  3UE1 A;  3K5M A;  1EU4 A;  1SFO B;  3DWQ A;  4QUC A;  2CFM A;  3DWP A;  1MIU A;  2B3G A;  3K80 C;  5FLX c;  4GKK Q;  2EY2 A;  3M4Q A;  4DUY Q;  1K3B C;  3N52 A;  2ZJR A;  4DU9 A;  1EQQ A;  3WOE A;  1PHJ A;  3TZD A;  1JMC A;  3AEV A;  1KLG D;  2LXJ A;  3NBH B;  2MP1 A;  4A3M H;  1VQ4 A;  2K14 A;  3MZ5 A;  1TKW B;  1K8O A;  3I2Z A;  3IAY A;  3T1H L;  5F2D A;  1G6P A;  4DNT B;  3SDZ A;  5A2Q E;  4IQZ A;  4A3I G;  3AFP A;  2RQX A;  3KF6 B;  3A8J E;  4DV4 Q;  1KIX A;  2AQ3 B;  2K52 A;  4KHP Q;  5LL6 X;  2UUB L;  3CP0 A;  4OIJ A;  4F88 A;  1XMQ L;  1WVL A;  5EPK A;  4IN3 A;  4U68 A;  3TP7 A;  5E4X A;  1YJW A;  2XVS A;  4EX5 A;  4LF7 L;  5C4H A;  3Q0A A;  1EYC A;  4LF7 Q;  1JWU D;  2F0G A;  1KAW A;  1STG A;  2Y0S B;  3PO2 H;  3HOV H;  4C3H G;  2BH8 A;  4NKL A;  1VQP A;  1VMC A;  4KHP L;  2UU9 Q;  4BXX G;  3NK9 A;  3ZYY X;  5ELB A;  5IOC A;  1WJJ A;  3CCJ A;  3GTQ H;  4ME5 A;  3U9S A;  2CHB D;  2AUK A;  3PO3 H;  2E2I B;  1PTO H;  1JT8 A;  4LF5 Q;  2VQF Q;  3CC2 A;  1EU3 A;  1BR9 A;  1EWI A;  2QA4 A;  1U5K A;  4LW1 A;  2L15 A;  4LF6 Q;  4CGY B;  5C3X A;  1OO9 B;  3T51 B;  1OTC A;  2BE5 C;  1A15 A;  1NR4 A;  2F0U A;  2NN6 H;  4NXM L;  4B3R Q;  4ZCK A;  2M00 A;  3RUZ A;  2NVQ H;  1P16 A;  1DXM A;  3BG3 A;  2LKV A;  2DY7 A;  4JI1 Q;  1KHI A;  4PZ8 A;  4HTH A;  1DOM A;  2A19 A;  3AU7 A;  4R8N A;  2RCN A;  4GLA C;  3CCS A;  2CH4 W;  2A69 C;  1UE6 A;  3HP3 A;  1WOC A;  2PYK A;  5T1I A;  3TP6 A;  1SYD A;  2ICE C;  4JBW A;  4JI5 Q;  4RH6 A;  1X3E A;  1KDB A;  1I50 H;  5AJ3 Q;  4JYA L;  1RIP A;  4DXF A;  2HIV A;  1X65 A;  1TS2 A;  2F0P A;  1FJG Q;  1O78 A;  3LX0 A;  2YTY A;  1Y1W B;  3OPO A;  2O2L D;  5IYC G;  2HCC A;  3NWT A;  1BBU A;  2KCN A;  5J22 A;  4G7O C;  4A3I B;  2CW0 D;  4A3J G;  4GKJ L;  3NWS A;  1G6Z A;  1HR0 L;  4J6H A;  3U4Z A;  1QZG A;  3FKI B;  3HOY H;  1SE3 A;  2N49 A;  4H13 C;  4R4I A;  1Q1E A;  3A55 A;  1E3P A;  1FL0 A;  1IYJ B;  4BY7 H;  1NE3 A;  5LMN Q;  1H9R A;  5C4X H;  1PLF A;  3KJO A;  4DR1 L;  1PTO F;  4O2D A;  2H1E A;  3NEL A;  1RDP D;  2XTI A;  4A3F G;  2E2J H;  4OON A;  2L0C A;  4JI0 Q;  1XNQ L;  2YTX A;  3ERO A;  3U58 A;  2QIL A;  1UAP A;  1CT1 D;  3T56 B;  2FMC A;  1QJO A;  4A3E B;  1LTA D;  2Q8R E;  4JI2 Q;  1GUT A;  2WB1 E;  1E2W A;  3TEH B;  3M3Y H;  2PW7 A;  4OX9 Q;  1GUG A;  3GTG B;  1HNZ L;  4PZ6 A;  3SHL A;  4C3I B;  4M8A A;  1XJV A;  1HH2 P;  4KHZ A;  1F77 A;  1Q1B A;  3MEH A;  5M3F H;  3ND9 A;  4DAV A;  3KDF B;  1A3U A;  1U4M A;  1Q3L A;  1D2B A;  1EY6 A;  2D9U A;  3JC6 6;  1BBX C;  2QEJ C;  1KAB A;  4OIK A;  5ELO A;  2KED A;  1DM0 B;  3I4N H;  3F2D A;  1F2Y A;  1IYU A;  5M5W B;  2B2V A;  2N3S A;  5GAH C;  5I2Y A;  4QF4 A;  2OQK A;  4AQY Q;  2JA7 G;  1TXY A;  1YIJ A;  1F2M A;  4LFA L;  4N9P A;  2IPK D;  4R4O A;  3HEJ A;  5C5L A;  1MD2 D;  4C3J G;  2F0V A;  4AQY L;  1FGB D;  2HDM A;  4X3U A;  2ZTE A;  4TRD A;  5C4J B;  2RF4 A;  4DV0 L;  4DAP A;  1B3A A;  1EUJ A;  1X9N A;  1B50 A;  2ATW A;  2K32 A;  4DR6 Q;  3GTM H;  2NB0 A;  4P2C B;  4L8J A;  4F87 A;  1BXT A;  2N88 A;  1PH4 A;  1VQB A;  1HA6 A;  2ALY B;  5I4D A;  3HOU H;  4KN7 C;  2UXC Q;  1VQF A;  4K0K L;  3CQZ B;  3IRB A;  5C44 G;  1QVG A;  1HQM C;  4A3K H;  4IFD H;  3CCV A;  2NBF A;  3N6R A;  4DR4 Q;  4U67 3;  4XQJ A;  2VXW A;  3HOX G;  5EBD A;  1I6H H;  2F0I A;  3PIP A;  2HIX A;  2JQO A;  1I94 Q;  1NCV A;  5IT9 E;  2OQ0 A;  1FNV A;  3KUP A;  5KIX A;  1LO5 D;  2O5I C;  1VQD A;  3D6C A;  3EA6 A;  4M1U B;  3W2D A;  5IOD A;  4QQB X;  3GTO H;  1PH8 A;  1JJC B;  3M4O H;  3MXP A;  1DZ1 A;  4BBS H;  3TDQ A;  1QG7 A;  1TWH B;  5CBE E;  4GOP B;  2Q8T A;  1SYG A;  1TWH H;  4FF2 A;  2JA5 B;  2F0E A;  1Y14 B;  3I73 A;  3ND8 A;  3R3O A;  3X3N A;  1YBY A;  4FXD A;  3HKZ G;  2NYZ D;  1U4P A;  1A0I A;  3I7F A;  3I56 A;  1J5E L;  1XYI A;  1SAP A;  3LWU A;  4X3K A;  4N8X 1;  2JA8 G;  1Y1V H;  1UE7 A;  3HOZ B;  5M5Y B;  1E0B A;  2K5D A;  4EQN A;  2L55 A;  3GTL H;  2ZXO A;  1DGS A;  2SEB D;  1BOS A;  1QWY A;  2VUM H;  3J81 c;  1SYC A;  4PQX A;  4RKB A;  1GUN A;  2NZ1 D;  1HNX L;  5IGC A;  1I4X A;  5LMU Q;  4QUF A;  3RZD B;  1F9S A;  3I4M G;  4KN4 C;  3D6W A;  4HR7 B;  3S1N H;  1DCZ A;  2NN6 G;  1BCP B;  1GUS A;  5C4J H;  1EEI D;  1OXX K;  3K58 A;  3KLR A;  2K5V A;  4A3C H;  3HRZ C;  1EWH A;  4K8J A;  4DV1 L;  1H9S A;  3BDO A;  3KF8 A;  3Q8D A;  3VR6 A;  1ENC A;  2L4N A;  2VZA A;  3OTO L;  1K8G A;  5KND A;  1EQT A;  2TSS A;  2XSC A;  1PH2 A;  3K0Y A;  1HFG A;  5I2X A;  3EJI A;  4DR2 Q;  4A3B G;  2KCC A;  3F1Z A;  4NB3 A;  1R9T H;  4TVA B;  2K28 A;  2ZM6 Q;  2PW5 A;  5J1Z A;  4BWG B;  3J7A F;  1AP0 A;  1SBB B;  2AKW B;  1TWG H;  1V43 A;  1EEF D;  1LAB A;  3KF6 A;  2BE5 D;  3DHQ A;  5D65 A;  2KA7 A;  2VW9 A;  3S1M H;  5M5X H;  2X6L A;  3EIV A;  3QOL A;  1X3G A;  4RKL A;  1V9P A;  3HOW G;  4V0B A;  4RG1 A;  3L3O C;  1V8Q A;  5JPM C;  1VCI A;  5L37 A;  4MZ9 A;  1H9M A;  2HHH Q;  4K8I A;  2A73 B;  1L0X B;  1BQQ T;  3F2U A;  3MXN B;  2F0D A;  3M7G A;  3F2B A;  4R4Q A;  2R3Z A;  5M5X B;  1KTK A;  2JA7 B;  4AYB G;  1EYA A;  2C35 B;  3OSO A;  4GLX A;  4GN3 B;  4KTA A;  1K83 H;  4H02 A;  4DV0 Q;  3M7N A;  4JYA Q;  1YNN D;  4PMB A;  1QZH A;  3GQB A;  1EY0 A;  3R93 A;  1AN8 A;  1R4Q B;  2EDG A;  2OEO A;  1NNX A;  2KCT A;  4K0K Q;  3HOZ G;  2I5L X;  3BDL A;  3I55 A;  1LT4 D;  5COR A;  2E2H H;  2R92 H;  4LAA A;  4C3H B;  2AWN A;  4JI3 L;  4J1M A;  2Z4I A;  1SYF A;  1PZK D;  5M3F G;  1HR0 Q;  1E2V A;  1S5B D;  2E8G A;  1M1K C;  3BJU A;  2PZT A;  4OEM B;  3CC7 A;  2Z9H A;  4KY5 A;  3CCQ A;  4ZLT F;  2ZT9 C;  1ILP A;  1JJG A;  2KQ3 A;  4ZYS A;  1S72 A;  3CPF A;  4A93 H;  4F8M A;  2H5X A;  1FJG L;  1YHQ A;  3VYR A;  4B08 A;  3K59 A;  1D6E C;  3U9O A;  2R93 G;  2R61 A;  1B4O A;  4DNR B;  2ZTD A;  1BCP D;  5DAU A;  1TS3 A;  2NVQ B;  4L5T A;  5LL6 S;  2EE1 A;  2B2U A;  2DUD A;  1TY0 A;  1CM9 A;  3VDY A;  3QG1 A;  2GVB A;  1LTS D;  3M9B A;  1D5Z C;  4ULL A;  4TSS A;  1CI3 M;  1RKN A;  4FNF A;  1JOR A;  1SLJ A;  1UUP A;  2IX0 A;  3SR1 A;  4B3M L;  3G48 A;  1PA6 A;  1WCM G;  3GTQ B;  4ID6 A;  4QY7 A;  3E3X A;  1PH5 A;  1QUQ B;  4OO1 I;  3FEW X;  3OOC A;  3S14 B;  2IL8 A;  2MJ8 A;  3T4A C;  1V1P A;  3ULJ A;  1VDZ A;  4BBS B;  1A3T A;  3M4O B;  2CW0 C;  5LMU L;  2AWO A;  3HOV B;  5FLM H;  1IYV A;  1STE A;  3GTP B;  3I3C A;  1D7Q A;  2D5D A;  2N78 A;  1JOQ A;  3EFX D;  2Z6K A;  4BBR H;  4DR2 L;  4H0L C;  3KDF A;  5CV9 A;  5DLQ E;  4IOC A;  1Y69 U;  4BXX H;  1Z7T A;  3BZD B;  1BUV T;  3TQY A;  1I6H B;  3QIA A;  2ES2 A;  1HFN A;  2KEC A;  2HHH L;  1CKO A;  1MSH A;  2O5J C;  3HS0 C;  3NP8 A;  1ET9 A;  3PIO 3;  1YI2 A;  3AYH B;  1EYD A;  3KFU A;  3HOU B;  4KHV A;  3J80 E;  1STH A;  1ICF B;  4YHH L;  3NBH A;  2MFI A;  1CUK A;  1F9R A;  5EPJ A;  1HNW L;  5E1F A;  3OIQ A;  4UHV A;  3J81 L;  2I07 B;  1LM0 A;  1WTH A;  4AIM A;  3Q22 A;  4OXP A;  2Z0S A;  4OWT B;  4CKB A;  4DV5 Q;  4FYD A;  1CSP A;  1G29 1;  3KBG A;  3S1R H;  4LF8 Q;  4ZK9 B;  2UXC L;  5I6Y A;  2NN6 I;  4ZUI A;  1WTX A;  4CBV A;  2NUC A;  1Q8K A;  2AQ2 B;  3PO2 G;  3M4Y A;  1G2S A;  3AB9 A;  2PQA B;  2F0F A;  1NMF A;  1E22 A;  3I4N B;  3OW7 A;  1PZI D;  4ZKC B;  1H9J A;  2A8V A;  2UXB L;  2VS1 A;  2YYZ A;  4DR7 L;  1PH1 A;  2EYL A;  5ELD A;  2XRS D;  3IFD A;  4KMU C;  3M3Y B;  1KXL A;  4X6A H;  1TVX A;  3S24 A;  3CW2 C;  2K5N A;  3S2D H;  4J8Q A;  1RHP A;  1U4R A;  5M9O A;  4A3J H;  2K6A A;  2R93 H;  1D8L A;  2IHE A;  4DR7 Q;  1EQV A;  2LFN A;  1X6O A;  4K14 A;  3PCO B;  3H3V I;  2E5L L;  2Z4H A;  5C3W A;  4NMZ A;  4EQ5 A;  2EJF C;  4RCO A;  2NZO A;  2IY5 B;  2UXD Q;  5IP9 G;  1O7L A;  2UUB Q;  2F1M A;  4APV A;  4ODG A;  3FKI H;  3HOY B;  4XYO A;  1SXT A;  2VB2 X;  3R2T A;  1O7I A;  1TT2 A;  2DJF C;  3CHB D;  4XDX A;  4B3M Q;  3CAM A;  1XPR A;  4A3I H;  4A3L H;  1WTV A;  2KHI A;  1C48 A;  2BDO A;  4BY1 G;  1MHW C;  2ID0 A;  3ZJY C;  2HT1 A;  1Y1W H;  1HQR D;  3J7A V;  1VQA A;  5CYU A;  1EIF A;  3CKI B;  1II3 A;  1EFW A;  2FMM A;  2CWP A;  1I50 B;  4FXG C;  3PGZ A;  1RJT A;  1CKM A;  1HPC A;  1D5M C;  2RHS B;  1KNA A;  3SK5 A;  1TWF H;  3T53 B;  3UDF A;  2F0M A;  2JK8 A;  3S2H H;  4LUV A;  1JC7 A;  1K0R A;  2F3I A;  5E7N A;  1ILQ A;  4BBR G;  1CK1 A;  2A6H D;  4FF4 A;  1LT3 D;  2PNH A;  5BR8 L;  2K33 A;  2RCF A;  2KOL A;  3OIP A;  1XXG A;  1MBY A;  2PI2 A;  1TWC B;  2PMZ B;  1TWF B;  4Y7N H;  1AW7 A;  4IJL A;  3V05 A;  3PO3 G;  5EGT A;  1W2B A;  3OYY A;  4DR5 Q;  1HJP A;  1X3P A;  4G7H C;  2WAQ B;  5DM7 3;  4WFN 3;  1GUO A;  4JI1 L;  1CZW A;  3I4M H;  4A4I A;  2EXZ A;  3HKZ B;  1VF5 C;  5FLX L;  2HCI A;  1VQ5 A;  4NXM Q;  5JPN C;  1IBL L;  3PUX A;  3STB D;  2PCF B;  5EJW A;  3UDG A;  1SSO A;  1JWM D;  3FPP A;  1XNR L;  1J8I A;  1BDO A;  3S16 B;  5FOB B;  3G6J B;  1CFM A;  1G8Z D;  2KHS A;  1B44 D;  5KYI A;  3BZK A;  1RTN A;  1HNX Q;  2J7Z A;  2IJ0 A;  2V4D A;  5A35 A;  3F2C A;  4OEL B;  1EY8 A;  4YCU A;  1UEA B;  3W5O A;  3ICE A;  1Q86 C;  3CC4 A;  1MKH A;  1SMY C;  3MEF A;  4JI6 Q;  2EXD A;  3PUW A;  3SVM A;  1HHV A;  5FO7 B;  2LY7 A;  3S2D B;  3CPW A;  4DR1 Q;  1YNX A;  2F0K A;  5GAE C;  3MFY A;  1CKN A;  1ML0 D;  3K5O A;  1SMY D;  3UI2 A;  1BKB A;  5IYC H;  1SRU A;  1J5E Q;  2JA6 B;  2UUA Q;  2F52 A;  1CQV A;  1KD1 C;  2CH4 A;  3G7L A;  1A2U A;  2NZH A;  3H94 A;  4QCL A;  3KLS X;  1SMX A;  4A3M B;  3TN2 A;  2NTT A;  3OMC A;  3T1H Q;  4BY7 G;  3PSI A;  1Y1V G;  5C0X J;  3QR8 A;  1STN A;  5GQO A;  2Z6K C;  2NVY H;  5CV6 A;  3DM3 A;  5IGE A;  4X3T A;  5IYB H;  3GTJ H;  1O7Y A;  3HOX B;  2VUM G;  2VQE L;  1SNP A;  1XNQ Q;  2RDH A;  4JBK A;  5IT9 c;  3CU7 A;  4KK7 A;  1B53 A;  3UE0 A;  4HJ9 A;  4O0A A;  2YU9 B;  5C0X H;  4C3H H;  3S16 H;  2WII B;  5LMN W;  2C9O A;  2SOB A;  1CA5 A;  3HKS A;  1UE1 A;  1GO3 E;  2DNE A;  1BNZ A;  1Q81 C;  4FVM A;  4MN3 A;  4ZRZ A;  1Q90 A;  2KEE A;  1FGU A;  4JK1 C;  1IHZ A;  1WTP A;  1I3Q B;  2JJQ A;  1N34 Q;  4LFB Q;  2JA9 A;  3OHX C;  1E1T A;  3A8I E;  1FNU A;  2ENB A;  1ZKO A;  2L1B A;  1HUM A;  2NVX B;  1RL2 A;  3MXG A;  2JA7 H;  1XNR Q;  1EIG A;  1R4P B;  3RMH A;  1BVS A;  3LNN A;  1CQF A;  3K57 A;  1AFP A;  5ISR A;  2JSO A;  4BY1 B;  1OXU A;  5ELN A;  4EGV A;  2EYF A;  5C3E B;  1GXD C;  2K50 A;  4K5W A;  4P74 A;  2EJG C;  4POG A;  4GLV B;  1V1P B;  4I7A A;  3NTI A;  3D4D A;  2E76 C;  1EOV A;  1S40 A;  1HNW Q;  4B3T L;  5C44 H;  2XGT A;  3J80 L;  1IW7 D;  2RA4 A;  3T1Y L;  4AH6 A;  4RA8 A;  4A3C G;  4IOA A;  2VY3 A;  3S1Q H;  3D4W A;  1SEB D;  4HAE A;  3S17 B;  1K8M A;  1TII D;  5IWA L;  4G4K A;  4HCS A;  4P73 A;  4RHS A;  1PRT C;  3P20 A;  1IKM A;  3E6Z X;  2CQO A;  1Z47 A;  4YWL A;  5IYD G;  1S5C D;  4A3F B;  4FDB A;  4DV5 L;  1VF7 A;  3LWE A;  1GM5 A;  3LGJ A;  3H0G H;  3I90 A;  4YY3 L;  1L0Y B;  2R7F A;  4YY3 Q;  5C4Z A;  3ULP A;  3W1B A;  2XWJ B;  3TRE A;  3PQI A;  5K36 G;  2R7Z H;  3L7Z C;  3UDI A;  1HA5 A;  3ERQ A;  1QOH A;  2N8N A;  1U4L A;  3E9H A;  5EKI A;  2F0Q A;  4A3F H;  3R8B A;  3FMC A;  4GKK L;  4A3D H;  4C3I G;  2DJG C;  2CQA A;  4B9W A;  3GTL B;  2UXD L;  3DM1 A;  4HIO A;  2QF7 A;  4L5R C;  4A93 G;  3IKJ A;  3MWY W;  3MA2 B;  3VR4 A;  1UNS A;  4DKA C;  1QIL A;  4JBJ A;  2FJ2 A;  1PH9 A;  4FF1 A;  1PFS A;  2I5H A;  1RD9 D;  1ENF A;  4JI4 L;  1ZYR C;  2Q2T A;  4R4T A;  1K9M C;  3F8T A;  2MQH A;  2E75 C;  3NHH A;  3HGB A;  3D4R A;  3J7A 5;  3C46 A;  1DD2 A;  5EQ0 A;  1PDQ A;  2QDL A;  1D1I A;  2EQS A;  5FK9 C;  5IGD A;  1GOZ A;  1NAP A;  3WOF A;  1F2Z A;  5IY0 A;  1XX8 A;  3SGI A;  1SRO A;  1PMR A;  5C3E G;  5KRU A;  4DF7 A;  4A3G B;  4HJA A;  3R2I A;  4HIM A;  4JI0 L;  4LF4 L;  2MNA A;  2NVT H;  2HQL A;  1AE2 A;  1NY4 A;  5KNC A;  4DUZ Q;  4IPH A;  3UDX A;  4IUV A;  5KNB A;  1K3R A;  2VQF L;  1A3V A;  3C1E A;  4QIW B;  2AMC B;  2MO1 A;  3NBI A;  3QB3 A;  3K8A A;  3PUY A;  4MIU A;  1E7Z A;  2XRQ D;  3RD4 A;  5JVG 3;  5FJ8 G;  3D3R A;  2EYJ A;  3TS0 A;  4IJH A;  2EYH A;  2K4K A;  2TMP A;  4N9T A;  4OX9 L;  1HZB A;  2Z1C A;  4KD3 A;  4KV6 A;  4DR3 Q;  3D0F A;  3VR2 A;  1LYL A;  4DV6 Q;  3RZO H;  1YHB A;  4PMW A;  4CDF C;  4KJO A;  3L2P A;  1F9P A;  4POF A;  3VA7 A;  4HMI A;  1N32 Q;  4JI8 L;  1PH3 A;  2NVT B;  3J7Y W;  4ME3 A;  3CF5 A;  3VYT A;  2DN8 A;  2F4I A;  4UPA A;  1JCK B;  1WCM H;  2KHJ A;  2B2U C;  2OTJ A;  1HR0 W;  1U9R A;  2O4X A;  1EOT A;  1BCP C;  4I65 A;  2L9H A;  3RZD H;  4HID A;  5CMD A;  2K5H A;  2OT2 A;  1OXT A;  1YZ6 A;  5EPL A;  1WYD A;  2MPM A;  3A0J A;  3BZC A;  1WFQ A;  2K04 A;  4MTK A;  1N8R C;  2IX3 A;  1WTO A;  3NQT A;  2I5M X;  5CBA E;  5HGQ A;  1LUZ A;  1YHA A;  3ULL A;  4DPG A;  1O80 A;  4DV7 L;  2A68 C;  3T13 A;  4HIK A;  4A3D B;  2C5C A;  1EWC A;  3D8G A;  3T16 A;  2VB3 X;  2K75 A;  3CCL A;  2K5W A;  2JA6 G;  2PZW A;  1P8L A;  1I6V C;  1JE5 A;  1VQJ A;  2UUC L;  4MHE A;  1EZ8 A;  2BOS A;  2EYP A;  4N8F A;  4Q5V A;  1ZXT A;  1V1Q A;  2B39 A;  2RKS A;  4BY7 B;  4DNI A;  1KLU D;  1G91 A;  3CCM A;  3HOU G;  3K0X A;  4KKU A;  1F2L A;  1STY A;  1VQE A;  4UP9 A;  1SNQ A;  1VQ7 A;  1PRT B;  4PMC A;  4YCW A;  5TSS A;  4ZKB B;  4KD4 A;  1CSQ A;  4I7Z C;  4LMQ D;  4WRD A;  4Y52 H;  4ILW A;  1YEZ A;  3I4M B;  1IKL A;  1KDC A;  1Q46 A;  3MVV A;  4K5X A;  4YIJ A;  3RZO B;  3FKI G;  2DY8 A;  3TBI B;  1C0A A;  1G2T A;  2FFK B;  4XQQ A;  2KVM A;  2RDG A;  1TWA B;  2EOT A;  2KJX A;  1B2T A;  5JEA G;  1VMP A;  4KKS A;  1N32 L;  3OW2 A;  2WKC A;  1IBK L;  2QCP X;  3MC0 B;  2G9D A;  3J81 j;  1MSG A;  5BN5 A;  2A1A A;  3HFZ B;  3FP9 A;  5J39 A;  1VQL A;  1I4Q A;  3P75 A;  4RGT A;  1Q8I A;  3GTK H;  1QNU A;  1S4Z A;  4DK1 A;  4V19 0;  1PRT D;  2BCO A;  3S1M B;  5M5W H;  4NPS A;  1UEB A;  2NVX H;  3HG9 A;  4PV1 C;  5IP9 H;  4DUZ L;  3CRL C;  3OTO Q;  1TWG B;  4DXG A;  1T5X D;  1Z9F A;  5M3F B;  3S15 B;  4H7B A; 
#chains in the Genus database with same CATH homology
 4C3I H;  4QJF A;  1TWF H;  3U58 A;  3UDF A;  2JK8 A;  3S2H H;  4LUV A;  1K0R A;  2F3I A;  3HOY G;  5E7N A;  4BBR G;  2R92 G;  4A75 A;  4A3D G;  4JI2 Q;  1WI5 A;  2PNH A;  5BR8 L;  2WB1 E;  2I0Q A;  2QGQ A;  3TEH B;  3M3Y H;  2VNU D;  4X64 Q;  5C0X I;  5IP7 G;  4OX9 Q;  2IHF A;  1C9O A;  2KCM A;  2PI2 A;  1XPO A;  1HNZ L;  1KRT A;  4PZ6 A;  4DUY L;  4Y7N H;  3KOJ A;  5JJL A;  4IJL A;  3PO3 G;  4X66 L;  3TRZ A;  3AFQ A;  3ER0 A;  1HH2 P;  4KHZ A;  1XJV A;  1Q1B A;  1W2B A;  5M3F H;  1PH7 A;  4LNQ A;  4LWC A;  3KDF B;  3OYY A;  2UUA L;  3CXC A;  1E1O A;  4A3G G;  1YVC A;  1NTG A;  4GOP C;  2OCE A;  2YV5 A;  3JC6 6;  4DR5 Q;  5ELO A;  4GN5 A;  1HJP A;  3I4N H;  4JOI C;  3F2D A;  3GO5 A;  2D0O A;  3A74 A;  1NBW A;  1LTL A;  4A76 A;  2N3S A;  4GOP A;  4JV5 L;  3AQQ A;  4JI1 L;  5GAH C;  3I4M H;  4A4I A;  4AQY Q;  2OQK A;  3CCU A;  1HZA A;  1L2F A;  1XPU A;  5IP7 H;  2JA7 G;  1TXY A;  3K7U C;  1YIJ A;  2E5L Q;  3U50 C;  1VQ5 A;  4LFA L;  1PVO A;  4NXM Q;  3I4O A;  2VL6 A;  3B6Y A;  1PV4 A;  1IBL L;  5C3E H;  4R4O A;  3PUX A;  3STB D;  1VQ6 A;  3G4S A;  4AQY L;  2RHQ B;  3UDG A;  2JA6 H;  3RN2 A;  1XNR L;  2ZTE A;  3D31 A;  4DV0 L;  2RF4 A;  1X9N A;  5M5Y H;  1EUJ A;  4PG3 A;  1L0W A;  3CCE A;  2ATW A;  2PQA A;  1K8A C;  1U0L A;  4DR6 Q;  3GTM H;  3S17 H;  3BZK A;  1HNX Q;  1PH4 A;  3F2C A;  1VQB A;  1FVI A;  2ALY B;  4YCU A;  3HOU H;  1EIY B;  2UXC Q;  1VQF A;  3W5O A;  3ICE A;  1T9H A;  4K0K L;  3HKZ E;  3IRB A;  5C44 G;  1B70 B;  1MKH A;  1Q86 C;  4A3K H;  1QVG A;  3CC4 A;  3CCV A;  4LF4 Q;  5FJ8 H;  3MEF A;  4JI6 Q;  4DR4 Q;  2EXD A;  2JA5 H;  1L1O A;  3PUW A;  2BA1 A;  3HOX G;  1I6H H;  4HJ8 A;  2CCZ A;  4DV2 L;  3PIP A;  2PMZ E;  4R1J A;  2ZTC A;  2HIX A;  1YNX A;  2JQO A;  5GAE C;  3CPW A;  4DR1 Q;  1SFO H;  1MJE A;  1I94 Q;  1CKN A;  1S3O A;  3G71 A;  1VQK A;  1B8A A;  2Q2U A;  2B63 G;  2F4V Q;  2JEA I;  2OQ0 A;  3G6E A;  1BKB A;  2R7Z G;  5JEA J;  5IYB G;  5IYC H;  1SRU A;  4GS3 A;  4DV2 Q;  4MNO A;  2YU9 H;  4LF5 L;  3TS2 A;  1VQD A;  2JEB I;  4DV4 L;  1J5E Q;  4IFD J;  2UUA Q;  2F52 A;  4X65 L;  1KQS A;  1KD1 C;  2WP8 J;  4QQB X;  2WFW A;  4LF8 L;  4BY1 H;  3M85 A;  3GTO H;  1PH8 A;  2NZH A;  1GKH A;  1JJC B;  3JAM c;  1SMX A;  4IPC A;  3M4O H;  4B3T Q;  4BY7 G;  3HOX H;  3T1H Q;  3PSI A;  4BBS H;  1Y1V G;  5C0X J;  4LF9 L;  5GQO A;  4GOP B;  2WAQ E;  1GD7 A;  2GVA A;  2NVY H;  2V1C C;  2Z6K C;  5BR8 Q;  1ASY A;  3DM3 A;  1TWH H;  1I3Q H;  4WJ3 M;  5IYB H;  4YHH Q;  1VQH A;  4UY8 C;  3GTJ H;  1Y14 B;  4GNX C;  1IZ6 A;  2VQE L;  1YBY A;  2VUM G;  4X65 Q;  1IBM L;  3RLO A;  3HKZ G;  1IBL Q;  1XNQ Q;  4JBK A;  1A0I A;  1MJC A;  3I7F A;  5IT9 c;  3I56 A;  1J5E L;  2VQE Q;  3PF4 A;  2MO0 A;  1N9W A;  3KLW A;  4QL5 A;  5IWA Q;  3DLL A;  3K81 C;  3UE0 A;  4HJ9 A;  4O0A A;  3GTG H;  2B29 A;  1J6Q A;  2JA8 G;  4DV6 L;  4GNX B;  1Y1V H;  4KLK A;  1CKN B;  3HOZ H;  1X56 A;  4C3H H;  1UE7 A;  4DR3 L;  3S16 H;  4QGU A;  5LMN W;  4GN4 B;  3HKS A;  4DV3 L;  1UE1 A;  3GTL H;  2Y0S E;  1DGS A;  1GO3 E;  4JI6 L;  4DR4 L;  1Q81 C;  2Y0S G;  2IT1 A;  2VUM H;  3J81 c;  1FGU A;  5GAG C;  1NMG A;  4A3G H;  3CCR A;  4JI8 Q;  1HNX L;  1SE8 A;  2JJQ A;  1N34 Q;  2PI2 E;  5LMU Q;  2JA9 A;  4LFB Q;  1X54 A;  3E0E A;  1E1T A;  1H95 A;  3ERS X;  5C0X G;  2JA8 H;  3I4M G;  1RL2 A;  1PH6 A;  4JI7 L;  2JA7 H;  3KJP A;  1XNR Q;  4JV5 Q;  1I94 L;  1VQI A;  3GD7 A;  1EQR A;  3S1N H;  2NN6 G;  1BVS A;  5C4J H;  1UE5 A;  4DV1 Q;  3JAM i;  3EBE A;  1OXX K;  4MTN A;  4BA1 I;  1OXU A;  1VQC A;  1PYS B;  5ELN A;  2K5V A;  4A3C H;  4DV1 L;  5J3B A;  1NJI C;  2K50 A;  3Q8D A;  4BA2 I;  3OTO L;  2VZA A;  1QUQ A;  1K8G A;  2FXQ A;  2LXK A;  3KF8 B;  4P74 A;  4HJ5 A;  4B3S L;  4POG A;  2LSS A;  4GLV B;  3I4N G;  1PH2 A;  3HOW H;  2CKZ B;  1EOV A;  2UUC Q;  1VS0 A;  1S40 A;  1HNW Q;  5IE8 A;  4B3S Q;  4B3T L;  4DR2 Q;  5C44 H;  1KL9 A;  2XGT A;  3F1Z A;  4NB3 A;  4A3B G;  1R9T H;  4IFD G;  4TVA B;  2EIF A;  2ZM6 Q;  3T1Y L;  2JA5 G;  1OXV A;  4JC0 A;  4AH6 A;  2AKW B;  4UP7 A;  1TWG H;  4JI4 Q;  4HJ7 A;  1V43 A;  4IOA A;  2VY3 A;  4A3C G;  1SN8 A;  3S1Q H;  1PYB A;  3KF6 A;  3RR5 A;  2B63 H;  1XMO Q;  4LUZ A;  4P75 A;  4LFC Q;  1QVC A;  2IX1 A;  3CME A;  4JI2 L;  2VW9 A;  4DV7 L;  3S1M H;  5M5X H;  3EIV A;  1X3G A;  1V9P A;  3HOW G;  5IWA L;  2D0P A;  4RG1 A;  1W3S A;  1XMO L;  4P73 A;  4A3M G;  2CWA A;  2ZJP A;  1VCI A;  4TQU S;  4OO1 G;  1YIT A;  2CQO A;  1Z47 A;  3PV0 A;  4YWL A;  4MZ9 A;  5IYD G;  1C7Y A;  2HHH Q;  4FDB A;  4DV5 L;  4C2M H;  3CMA A;  5LMN L;  1Y1W G;  3MXN B;  5H1S E;  4JOI A;  3HOV G;  1GM5 A;  3LGJ A;  3F2B A;  3H0G H;  4R4Q A;  4X64 L;  3J80 i;  4YY3 L;  2OTL A;  1IL2 A;  1YJ9 A;  4YCV A;  4YWK A;  1A63 A;  4AYB G;  2R7F A;  4YY3 Q;  2C35 B;  4A3E G;  3ULP A;  1G51 A;  5C4X G;  3W1B A;  4IPD A;  3J81 i;  4GN3 B;  3PIO A;  4GLX A;  3TRE A;  3H3V H;  1K83 H;  3U4V A;  4H02 A;  4DV0 Q;  2R7Z H;  5K36 G;  4ALP A;  1N36 L;  4NXN L;  3L7Z C;  1E24 A;  3M7N A;  3UDI A;  4KI0 A;  2E2I H;  2D62 A;  5HY6 A;  2N8N A;  3E9H A;  4JYA Q;  1QZH A;  1K73 C;  4A3F H;  4LFA Q;  1TWC H;  1N33 L;  5JJI A;  1QVF A;  3RNU A;  4QIW E;  4GKK L;  4A3D H;  4PZ7 A;  2KCT A;  1L1O B;  1XMQ Q;  3HOZ G;  4K0K Q;  2I5L X;  2UXD L;  3I55 A;  2E2H H;  4BBS G;  3H0G G;  1OXS C;  4HIO A;  4L5R C;  4A93 G;  2R92 H;  3M4P A;  3CD6 A;  5M3M G;  4A3E H;  1Q12 A;  4DKA C;  2AWN A;  2DGY A;  4JBJ A;  4JI3 L;  4DAM A;  1PH9 A;  1N34 L;  1PFS A;  2I5H A;  5AJ3 L;  4LFB L;  4JI4 L;  4UP8 A;  5M3F G;  1HR0 Q;  1L1O C;  2E8G A;  2Q2T A;  1AE3 A;  4R4T A;  1M1K C;  1K9M C;  3F8T A;  2MQH A;  3BJU A;  4OWX B;  4B3R L;  4P72 A;  3CC7 A;  3H15 A;  3CCQ A;  1Q7Y C;  3J7A 5;  1JJG A;  2Q2H A;  4RMF A;  1KRS A;  1S72 A;  1GVP A;  2EQS A;  3CPF A;  4JI7 Q;  4A93 H;  2H5X A;  1FJG L;  1YHQ A;  4YWM A;  5IY0 A;  4OWW B;  4L5Q A;  4DR5 L;  4XTC S;  3SGI A;  1SRO A;  5C3E G;  1YJN A;  2R93 G;  3L0O A;  4JG2 A;  1JJ2 A;  3K7A H;  3FHW A;  4HJA A;  2ZTD A;  4HIM A;  4JI0 L;  4LF4 L;  2MNA A;  4IFD I;  4L5T A;  5GRO A;  3T1Y Q;  2R6G A;  2NVT H;  3GTP H;  2HQL A;  1NY4 A;  1AE2 A;  1VQM A;  2DUD A;  4X66 Q;  1VQ8 A;  4LF6 L;  2Q2I A;  3VDY A;  4DUZ Q;  3GDE A;  3KYH C;  3STB C;  4DAY B;  4DV7 Q;  1KC8 C;  2GVB A;  2WAQ G;  2KEN A;  4IPH A;  3UDX A;  4DV3 Q;  1Q82 C;  3A5Z B;  3M9B A;  3UE1 A;  1K3R A;  2VQF L;  3S14 H;  2AMC B;  2MO1 A;  2GN5 A;  3K8A A;  3PUY A;  3PUZ A;  1E7Z A;  2CFM A;  4A3K G;  1X3F A;  5FJ8 G;  3TS0 A;  1SLJ A;  4A3L G;  1MIU A;  2B3G A;  3K80 C;  4IJH A;  5FLX c;  3M4Q A;  5GAD C;  1VQ9 A;  3BU2 A;  4XIG S;  4DUY Q;  2IX0 A;  2K4K A;  4B3M L;  3G48 A;  1PA6 A;  2ASB A;  1IBM Q;  2ZJR A;  4OX9 L;  2UXB Q;  1WCM G;  1HZB A;  4QY7 A;  1PH5 A;  1EQQ A;  1QUQ B;  4OO1 I;  4DR3 Q;  3D0F A;  1PHJ A;  2BH2 A;  1JMC A;  3J7Z C;  4DV6 Q;  1LYL A;  1VQG A;  3AEV A;  1YHB A;  3RZO H;  1XNQ L;  4PMW A;  3ULJ A;  2LXJ A;  3NBH B;  4JBM A;  3L2P A;  3NEM A;  4A3M H;  1VQ4 A;  2K14 A;  4POF A;  5LMU L;  2AWO A;  3I2Z A;  5FLM H;  3T1H L;  1N32 Q;  1G6P A;  4JI8 L;  1PH3 A;  4L5S A;  3E9I A;  4JI5 L;  2N78 A;  3W1G A;  1D7Q A;  4ME3 A;  3CF5 A;  1N36 Q;  4A3I G;  3AFP A;  2Z6K A;  4BBR H;  4UPA A;  3KF6 B;  4DR2 L;  1WCM H;  4DV4 Q;  2KHJ A;  1KIX A;  4JI3 Q;  2BA0 A;  5DLQ E;  3KDF A;  4IOC A;  1HR0 W;  2OTJ A;  4BXX H;  1HZ9 A;  2K52 A;  4X62 L;  4KHP Q;  2UUB L;  4P71 A;  3RZD H;  3TQY A;  4HID A;  2K5H A;  3CP0 A;  1OXT A;  1XMQ L;  2ES2 A;  1YZ6 A;  2HHH L;  1CKO A;  1IBK Q;  1VQO A;  1WYD A;  1YJW A;  4EX5 A;  4LF7 L;  3A0J A;  1A8V A;  3BZC A;  1WFQ A;  1YI2 A;  3AYH B;  1N8R C;  4LF7 Q;  1M90 C;  3KFU A;  1KAW A;  4GNX A;  4YHH L;  4LUO A;  3PO2 H;  3HOV H;  2BH8 A;  2MFI A;  1CUK A;  2I5M X;  2R7D A;  1VQP A;  2F4V L;  1HNW L;  4X62 Q;  4KHP L;  2UU9 Q;  4BXX G;  4LFC L;  5HGQ A;  1LUZ A;  2WB1 G;  4IO9 A;  1YHA A;  3ULL A;  1LM0 A;  4AIM A;  1WJJ A;  4DPG A;  4OXP A;  3J80 c;  3CCJ A;  2Z0S A;  1BBW A;  2YTV A;  4OWT B;  4DV5 Q;  4HIK A;  3GTQ H;  1CSP A;  1G29 1;  3S1R H;  4LF8 Q;  2QEX A;  4GKJ Q;  2K75 A;  3RN5 A;  3CCL A;  1IXR A;  4IPG A;  1VQN A;  3PO3 H;  2JA6 G;  2UXC L;  1P8L A;  2NN6 I;  3CQZ H;  1JT8 A;  4LF5 Q;  2VQF Q;  1JE5 A;  1VQJ A;  3RLN A;  2UUC L;  1Q8K A;  3PO2 G;  1ASZ A;  3CC2 A;  2PQA B;  1EYG A;  1A62 A;  1EWI A;  1NMF A;  2QA4 A;  1V1Q A;  1E22 A;  1U5K A;  4AYB E;  4LW1 A;  3RLF A;  4DNI A;  2L15 A;  2OWO A;  5M3M H;  4LF6 Q;  3CCM A;  3HOU G;  3K0X A;  1OTC A;  1JB7 A;  1VQE A;  2A8V A;  2UXB L;  4UP9 A;  1N33 Q;  1VQ7 A;  2VS1 A;  4NXM L;  4YCW A;  4B3R Q;  2YYZ A;  4DR7 L;  1PH1 A;  2NVQ H;  1P16 A;  1CSQ A;  4JI1 Q;  3A5U A;  2ZJQ A;  1HNZ Q;  4R4C A;  4C3J H;  4Y52 H;  1YEZ A;  1KHI A;  2JE6 I;  1KXL A;  4PZ8 A;  3PF5 A;  4DK3 C;  4X6A H;  1Q46 A;  3S24 A;  2A19 A;  4DK6 C;  2RCN A;  4GLA C;  3CW2 C;  3FKI G;  2K5N A;  4LF9 Q;  4A3B H;  1HZC A;  3S2D H;  3CCS A;  1C0A A;  1UE6 A;  4A3J H;  1WOC A;  3S15 H;  2R93 H;  4GKK Q;  1D8L A;  5JEA G;  2IHE A;  4JBW A;  4DR7 Q;  4JI5 Q;  1X6O A;  1X3E A;  1I50 H;  3PCO B;  5AJ3 Q;  2E5L L;  3H3V I;  4JYA L;  1N32 L;  1RIP A;  4EQ5 A;  3OW2 A;  1I5F A;  1IBK L;  2HIV A;  1UWV A;  1X65 A;  2NZO A;  3PUV A;  1FJG Q;  3J81 j;  2IY5 B;  1SR3 A;  4JCV E;  2YTY A;  2A1A A;  2UXD Q;  5IP9 G;  2UUB Q;  3EN2 A;  4APV A;  5JJK A;  3FKI H;  3HFZ B;  2AHO B;  1O7I A;  4WJ4 A;  5IYC G;  3FP9 A;  1BBU A;  1X55 A;  4B3M Q;  1B7Y B;  1VQL A;  3CAM A;  4A3J G;  1XPR A;  4A3I H;  5EAY A;  4GKJ L;  4A3L H;  4J15 A;  2KHI A;  2ZM6 L;  1HR0 L;  3GTK H;  3U4Z A;  5IYD H;  1QZG A;  3HOY H;  4BY1 G;  4R4I A;  2N49 A;  1Q1E A;  2ID0 A;  1E3P A;  1FL0 A;  1XTD A;  1IYJ B;  3ZJY C;  2HT1 A;  1Y1W H;  1AH9 A;  5M5W H;  4NPS A;  4BY7 H;  1NE3 A;  1UEB A;  4DR6 L;  2NVX H;  4NXN Q;  1VQA A;  1EIF A;  5IP9 H;  3NEN A;  5LMN Q;  5C4X H;  1EFW A;  4DUZ L;  2UU9 L;  2CWP A;  3OTO Q;  2KBN A;  3KJO A;  4DR1 L;  4O2D A;  3PGZ A;  3WWV A;  3NEL A;  1CKM A;  1Z9F A;  2XTI A;  5FLM G;  2RHS B;  4A3F G;  2E2J H;  1TWA H;  4OON A;  4JI0 Q;  2YTX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...