1VQJA

Gene v protein mutant with val 35 replaced by ile 35 (v35i)
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
86
structure length
86
Chain Sequence
MIKVEIKPSQAQFTTRSGVSRQGKPYSLNEQLCYIDLGNEYPVLVKITLDEGQPAYAPGLYTVHLSSFKVGQFGSLMIDRLRLVPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords GENE V PROTEIN
publication title Context dependence of mutational effects in a protein: the crystal structures of the V35I, I47V and V35I/I47V gene V protein core mutants.
pubmed doi rcsb
source organism Enterobacteria phage f1
total genus 9
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 1996-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02303 Phage_DNA_bind Helix-destabilising protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1vqjA00
5J3BA 4JI1Q 3FP9A 1KQSA 1K83H 2IHFA 3L0OA 3DLLA 3RN2A 4A3JG 1NMGA 1VQKA 4A3CH 1W2BA 3S2DH 1NJIC 2R7FA 5BR8L 2AHOB 1OXVA 1IBML 4O0AA 2JA6G 2N3SA 3I55A 2Z6KA 2E2IH 3U50C 3ULLA 4IO9A 4OX9L 1JE5A 2VL6A 4GLVB 4X66L 2MNAA 4JI3Q 2XGTA 1XNQL 2UUAL 4DR2Q 4YWMA 3SGIA 3B6YA 1N9WA 3CW2C 5IY0A 1N32L 3GTPH 1P8LA 4YCUA 3CC7A 1FGUA 2VUMH 3KF6B 4QL5A 1LYLA 2VQEQ 2IHEA 3PUYA 1YHAA 2YTXA 3CCUA 1PHJA 5M5XH 2NVXH 3CQZH 2A1AA 3CMEA 1OTCA 3PCOB 5C44H 4IOCA 3F2BA 3CPWA 4DV7L 1I5FA 3I7FA 1HZ9A 1Q1EA 4BA1I 3T1YL 3A74A 5M5YH 3PUWA 3M85A 3UDIA 1D7QA 4X64Q 2B3GA 4DPGA 5IYBG 3UDGA 1PH8A 2JA8G 3J81c 3KDFA 1PYSB 2UXBL 1YITA 3CC4A 4Y52H 3M7NA 1RL2A 2Z6KC 1P16A 5AJ3Q 1S72A 1N33Q 4K0KL 2AKWB 1SFOH 4B3TL 4QQBX 3RNUA 1YJNA 4Y7NH 2UXCQ 4KHZA 4DR6L 1X3EA 4A3DG 2ZTCA 3GTQH 2YTVA 1VQ8A 1CSQA 5JJKA 2ASBA 4JI4Q 1G51A 4P75A 4JI5Q 1HNWL 1V1QA 1R9TH 3HOWH 1XNRQ 3HOYH 1I50H 2BA0A 1WI5A 4GN3B 4LF9Q 3HOUG 2KHJA 3TREA 4JI0L 3S1MH 4NB3A 3HFZB 2RF4A 1UEBA 2KENA 3CCVA 2FXQA 4PZ7A 3PUXA 3CCQA 1M1KC 3RZDH 4C3HH 2L15A 4DUYL 2R93G 4JBWA 1FL0A 1LUZA 4RG1A 1L1OA 4AQYQ 4DV3Q 2F4VQ 2RHQB 2OQKA 1V43A 4JYAL 1PH7A 3S2HH 4JCVE 3A5UA 4DV6L 3H3VI 2NZOA 3M4PA 3I4OA 4TQUS 4XTCS 2ATWA 3CC2A 3H0GG 3J81j 1I94Q 2ZJPA 1L0WA 2HHHL 2E2JH 1X6OA 1L2FA 4HJ5A 5GAHC 3S15H 5M3FH 4DR3Q 1NMFA 3RZOH 3HOYG 3BU2A 1QVCA 2ALYB 1AH9A 2BH2A 2HT1A 4DV2Q 1WYDA 1E24A 2CWAA 1XMQL 1E1TA 1EOVA 1MIUA 3HKZE 4C2MH 5FLMH 1KIXA 2IX1A 2GVBA 3K7AH 1HR0Q 4YCWA 3PGZA 4LUVA 4A93H 2ZTEA 3OW2A 1IBKQ 4PG3A 2UUCQ 1IL2A 3RR5A 3G71A 1WJJA 1U5KA 3T1HQ 2YYZA 1HNZQ 4JI6L 3HOXG 1Y1VH 1VQNA 4LFAL 1N36Q 2UXCL 4DR1L 2IY5B 4JI1L 2UUBQ 2RCNA 4WJ3M 3E0EA 3GD7A 1OXXK 3D0FA 2F52A 5DLQE 2NN6G 4A3JH 1PVOA 1OXSC 4DAMA 1CKNA 1VQ7A 1L1OC 4JG2A 4DV1Q 5JJIA 3FKIG 1DGSA 3RLFA 1N34L 5GAEC 1MJCA 4JI3L 5IP7G 1B70B 3Q8DA 1HZBA 2QGQA 3NBHB 2VQFL 1Q8KA 3CP0A 1GD7A 4LFCL 5JEAG 3TQYA 4OO1I 4A3KG 4IPDA 3GTMH 3ERSX 3HKZG 4PZ6A 4BBRG 2HIXA 5LMNL 1NTGA 1XMOQ 2Q2IA 3G48A 1EUJA 2VQEL 1S40A 3GDEA 4A3GH 5IT9c 2R7ZH 1Y1VG 3A0JA 1EIFA 1VQGA 2VNUD 4DV4Q 1WCMG 5FJ8G 3CCEA 3PF4A 1BKBA 4GN4B 1TWCH 3CCJA 4LF6Q 4YWKA 3S1QH 4IOAA 3PIOA 3A5ZB 4R4TA 3NENA 1VQ6A 1K0RA 1PH9A 2ES2A 2D62A 3J80c 5IE8A 4ALPA 4X64L 2VW9A 3GTKH 3FHWA 1BBWA 4A3EG 5HGQA 5IYBH 3TS0A 3S1RH 2JA8H 2KCTA 4HIMA 1B7YB 3DM3A 5IP9G 1RIPA 1L1OB 3HKSA 5AJ3L 1N33L 3CD6A 3AYHB 3E9HA 5IYCG 1T9HA 4YWLA 5IYDG 2N78A 5HY6A 2Q2TA 1UE5A 3U4ZA 3NEMA 5GADC 1K73C 2K5HA 5ELNA 1CKMA 4DK3C 1EWIA 3I4MG 4A3GG 4EQ5A 1UE7A 1Q12A 4LUOA 1VQPA 2R7ZG 4DR5Q 4BY7G 4A3DH 1K3RA 3CCMA 1EYGA 4JI5L 3UE1A 3W1GA 1KRTA 3J80i 1N8RC 1SRUA 1J6QA 3TEHB 1XNRL 4LF9L 1EFWA 4O2DA 3HOUH 4LFAQ 3ICEA 2JA9A 2ZM6Q 4YY3Q 3PIPA 2XTIA 2ZTDA 4LF4Q 4FDBA 5GAGC 3KJPA 4KHPQ 1TWAH 3PSIA 5C0XJ 3UE0A 1TWFH 2Q2UA 1KXLA 4R1JA 2DUDA 2D0PA 3K80C 1SROA 1BVSA 1WFQA 3F2DA 4DUZQ 2R93H 4B3SQ 4WJ4A 3K8AA 5M3MG 5FLXc 4DV3L 4AQYL 3JAMc 1C9OA 1PH6A 2F4VL 4DR7Q 4A3IH 2VZAA 5C0XI 1CKNB 3F2CA 1E7ZA 1Q7YC 1PV4A 3UDXA 2PI2E 3HOZG 4JI7Q 1I94L 1PH4A 1M90C 3H0GH 1Z47A 2IT1A 3K0XA 3HOVH 5IWAL 2CKZB 3M4OH 2EIFA 4BXXG 3KJOA 1SLJA 1SE8A 2PQAA 2WAQE 4DV0Q 4DR3L 4JI8Q 1HZCA 1X3GA 3RN5A 2KBNA 3AFPA 4GLAC 4X62Q 2CFMA 4DV2L 3J81i 4PZ8A 1A0IA 4JBMA 4GKKQ 3BZCA 1D8LA 1HR0L 4QIWE 3NELA 3JAMi 1PH2A 1IBKL 2UUCL 1U0LA 1TWGH 3J7ZC 1IXRA 1AE3A 3PUVA 1HNZL 1Q86C 1N36L 2ZJRA 3HOXH 3PV0A 2UUBL 4A3IG 4L5QA 4IFDJ 2PMZE 1FVIA 2WP8J 2QEXA 1XPRA 1J5EQ 2OCEA 1Q46A 4DR4Q 3BZKA 1QVGA 2UXDQ 4ME3A 4UP9A 4DV1L 4H02A 4A76A 5K36G 3S17H 2JEAI 3HOVG 4BBSH 3CMAA 4IFDI 2MO0A 3AQQA 3FKIH 4DNIA 1GVPA 4OWWB 2WAQG 3S1NH 4MNOA 4P74A 3GO5A 2RHSB 3M9BA 5IP7H 2EXDA 2YV5A 3G6EA 3VDYA 4NXMQ 1QUQA 2LXKA 5E7NA 2UXBQ 2K50A 1Q1BA 4A3KH 2HQLA 2K5NA 4BBRH 1KL9A 2CQOA 1XMOL 2JA7H 1VQ9A 2PI2A 1VQLA 2PNHA 4DKAC 1K8GA 4LF8Q 3MEFA 4JC0A 2GN5A 4DV5Q 3LGJA 5GQOA 4DV4L 1IBLQ 4JV5Q 1YJ9A 1WCMH 2N49A 4LF6L 1HZAA 4P72A 4R4CA 3F1ZA 3M4QA 5FJ8H 5C3EH 3CF5A 1TWHH 2JEBI 1VQ4A 3PUZA 2CWPA 1VQBA 1ASYA 3EIVA 4BBSG 5C4XG 2Y0SE 1OXTA 3KF8B 4GNXA 4A3EH 5EAYA 2OQ0A 1G291 3WWVA 4DR2L 2V1CC 4X65Q 1QZGA 4IJLA 2R6GA 4JBKA 1QVFA 5IP9H 1MJEA 3OTOQ 1I6HH 4L5SA 3L2PA 1W3SA 5IYCH 3H15A 1IYJB 4P73A 3CCLA 2JA7G 5IYDH 1C0AA 3UDFA 4A3LG 4A75A 1VQJA 1OXUA 2E8GA 1IZ6A 1A8VA 1O7IA 1SN8A 1UWVA 5LMNW 3AEVA 4B3MQ 4DR5L 3I4MH 3KOJA 4BY7H 2CCZA 2PQAB 4HJ7A 2H5XA 5LMUQ 5C3EG 4EX5A 2VY3A 4JI2Q 3PO3G 4AYBE 4IPCA 2YU9H 2K75A 2MFIA 3W5OA 1Z9FA 4YCVA 3KYHC 2ZM6L 2Y0SG 3EN2A 4LF5Q 1VQAA 4YY3L 4A3FG 1Y14B 2A8VA 4LF4L 4KHPL 4A3BG 3STBC 4UY8C 1PH3A 1E1OA 2B63G 3M3YH 4DUZL 4HIDA 2Q2HA 1VQEA 4GNXC 1Q82C 1C7YA 4B3SL 1Y1WG 5M3MH 4LF7Q 4C3IH 1JT8A 1NBWA 4OO1G 4IPHA 2LSSA 4IJHA 1VS0A 4JI7L 1LM0A 2MO1A 3HOZH 3PO2G 1JMCA 4B3RQ 4HJ8A 5JJLA 2UU9L 4JI4L 4LFBQ 4GKJQ 1UE1A 1E22A 1KAWA 4DV0L 4BXXH 1CSPA 4JI8L 3J7A5 1G6PA 4LUZA 4AYBG 1TXYA 1QUQB 1YNXA 4X62L 1VQDA 4HIOA 1N34Q 1KD1C 1X9NA 4X6AH 1YHQA 4HJAA 2VQFQ 4BA2I 1X54A 4HIKA 4GKKL 4LFCQ 4YHHQ 1PH1A 2OTJA 4IPGA 3W1BA 2QA4A 1KRSA 2E5LQ 2UU9Q 4BY1H 5LMNQ 1Q81C 1FJGQ 5ELOA 4C3JH 1K9MC 4A3MG 1JB7A 1HNXQ 2NVTH 1VQHA 1YBYA 2C35B 3I2ZA 1EQRA 1J5EL 4DR4L 4GN5A 2UXDL 2NVYH 1JJ2A 2NZHA 4GLXA 4NXNQ 1KHIA 4GS3A 2KHIA 3I4NH 4A3CG 1I3QH 1PA6A 4R4QA 1GO3E 2AMCB 4GNXB 1YEZA 3ER0A 5M5WH 5BR8Q 2A19A 1IBMQ 4NXML 4APVA 3GTLH 4OX9Q 2R92H 3K7UC 1HH2P 1VQFA 1VCIA 4X66Q 1KC8C 1NE3A 4NPSA 2UUAQ 1XNQQ 3E9IA 4OWXB 1H95A 3ULJA 1UE6A 2VS1A 1S3OA 4OONA 4UP8A 1YHBA 4AH6A 4GOPA 1N32Q 3IRBA 4PMWA 1A63A 4BY1G 1EQQA 1HR0W 4MZ9A 4LF8L 4DV5L 3T1HL 2VUMG 3K81C 1LTLA 1VQ5A 1PFSA 1YIJA 1IBLL 2OTLA 4JV5L 1YZ6A 3PF5A 1PYBA 4QJFA 3S14H 2E2HH 5H1SE 4UP7A 3I4NG 5C44G 3JC66 1GM5A 2JA5H 5C0XG 2I5LX 4AIMA 2BH8A 2D0OA 5C4XH 2WFWA 1A62A 2GVAA 1JJCB 4DV7Q 3T1YQ 2N8NA 1CKOA 3H3VH 1X65A 1SMXA 2R7DA 1YI2A 4TVAB 3L7ZC 4X65L 2AWOA 1X55A 4KI0A 4A4IA 2R92G 3ULPA 1XPUA 3OTOL 1WOCA 1V9PA 2DGYA 3GTGH 1YVCA 2KCMA 4K0KQ 2NN6I 3CXCA 4A3LH 1VQOA 5C4JH 3CCRA 4L5TA 4B3TQ 4B3ML 4LW1A 1B8AA 2WB1E 3KFUA 4NXNL 2ID0A 4R4OA 3KF6A 5JEAJ 3G4SA 4DR6Q 5LMUL 4GOPC 1QZHA 1EIYB 4JI2L 2K14A 1JJGA 1X56A 2NVQH 2B29A 2BA1A 4RMFA 5IWAQ 4QY7A 3STBD 2ZJQA 3PO3H 2JA5G 1E3PA 1YJWA 3HOWG 1HNWQ 2YTYA 4QGUA 4LF5L 1XPOA 2LXJA 3CPFA 2AWNA 3RLOA 3MXNB 3GTOH 4A3FH 1VQMA 4JI0Q 1XTDA 4JOIA 2HIVA 3ZJYC 4IFDG 5GROA 4A3BH 2JJQA 2EQSA 1PH5A 2B63H 4R4IA 3F8TA 2MQHA 4DUYQ 1Y1WH 4LF7L 3S16H 3KLWA 4POGA 1SR3A 2JE6I 3EBEA 2OWOA 1GKHA 4OXPA 4HJ9A 4JYAQ 4J15A 3TRZA 4B3RL 2WB1G 3PO2H 4LNQA 3BJUA 4DV6Q 1AE2A 4MTNA 4GKJL 4LFBL 1K8AC 1XJVA 3OYYA 2F3IA 2JA6H 2HHHQ 2JQOA 4POFA 3KDFB 5M3FG 2K52A 1CUKA 3S24A 2Z0SA 3AFQA 1X3FA 4DR1Q 1NY4A 4DAYB 4DK6C 4GOPB 4XIGS 4YHHL 1HJPA 5FLMG 3CCSA 1XMQQ 4L5RC 2IX0A 2E5LL 1VQCA 3I56A 3GTJH 3U58A 1ASZA 4LWCA 2I5MX 2K4KA 1VQIA 3RLNA 4UPAA 1FJGL 3TS2A 1HNXL 4A93G 1MKHA 3D31A 4DR7L 3CAMA 2K5VA 4JOIC 2JK8A 4KLKA 4P71A 4A3MH 2I5HA 3U4VA 4JI6Q 1BBUA 4OWTB 2I0QA 4JBJA
chains in the Genus database with same CATH superfamily
1KQSA 1K83H 3DLLA 2L4NA 4IALA 1W2BA 2R7FA 5BR8L 1R4PB 4NP5A 2N3SA 3QJYA 2RA4A 4OX9L 2MNAA 4JI3Q 4X66L 3NWSA 4ZLTF 2JN4A 2NVXB 4XYQA 1LABA 1L0XB 3GTPH 3D6CA 3CC7A 4U673 2VUMH 5M5YB 2LFNA 1TVXA 5M5XH 1TWFB 2A1AA 3CMEA 1OTCA 5C44H 5KGUA 3F2BA 3FDTA 4DV7L 3I7FA 4BA1I 2BDNA 4J8QA 4JVZA 4Y7NB 4X64Q 4ODGA 3UDGA 3NQTA 1F9PA 3H0GB 1EY7A 2V4DA 3CRLC 3NBHA 3PMFA 1HFNA 2Z6KC 1N33Q 4K0KL 1A3VA 3BYYB 4B3TL 1PRTC 1YJNA 3HOYB 4QUCA 1FYCA 3D8GA 3GTQH 4F87A 1CSQA 2Z6BA 1HHVA 5I6YA 1TWGB 3RZDB 3I73A 1PFMA 1LT6D 1KABA 3E3XA 1I50H 1JWMD 4LF9Q 3JAML 3HFZB 4IUQA 5C5LA 2FXQA 1PZJD 1BO0A 1HUNA 3FKIB 2L15A 2C5CA 1FL0A 4ZRZA 4RG1A 1CI3M 2F1MA 4JYAL 1V43A 3QIAA 3R3OA 4HSVA 4JCVE 3M4PA 2ATWA 4TQUS 4XTCS 4A3KB 5A2QE 2B2WC 5DAUA 1XTCD 1KAAA 1KDBA 3EROA 5M3FH 1IW7D 1NMFA 3AB9A 5CC4A 2B2YA 4FXGC 3BDCA 1AH9A 1SBBB 2HT1A 1WCMB 2A6EC 1E24A 3QOLA 4LK1C 1LTBD 2IX1A 1KIXA 2GVBA 1KLGD 2F0KA 3OW2A 1B2TA 3VYTA 2YYZA 1HNZQ 1SSOA 4K6LA 2UXCL 3DEPA 3E0EA 5DLQE 4JK1C 3MWYW 1B53A 4DAMA 4DA2A 1L1OC 4DV1Q 1DGSA 3RLFA 1N34L 3LWUA 4JI3L 1LT5D 3HG9A 4G57A 2F0TA 3NBHB 2R7ZB 3CP0A 1I4RA 4LFCL 5C4ZA 3TQYA 2Q8RE 1FD7D 3HKZG 4BBRG 2L11A 2HIXA 3TN2A 1XMOQ 2YU9B 1VDZA 3H94A 1IL8A 1S40A 3J81E 1HQRD 2I46A 1Y1VG 4ZKCB 2K1BA 4DV4Q 4HTHA 3PF4A 1EEFD 1BKBA 4GN4B 1TWCH 2KECA 4IOAA 4YWKA 3M3YB 1PFBA 1GUTA 1PH9A 1U9RA 4X64L 2KA7A 3GTKH 1PRTD 2F0QA 3HOZB 1Z6HA 2B2UC 2J7ZA 2JA8H 5CV5A 2QF7A 2KCTA 3DM3A 5EBDA 2CH4A 1N33L 3CD6A 3WDNA 3E9HA 1G8ZD 5D14A 1O7LA 2Q2TA 3U4ZA 2K5HA 5ELNA 4PNYA 3I4MG 4A3GG 4EQ5A 4BY7G 1Q12A 4LUOA 1VQPA 3J7AF 4FXDA 1SYEA 3HZXA 1K3RA 2E74C 3SK8A 1EYGA 3UE1A 3J80i 1A6XA 1SRUA 1J6QA 1HUMA 2AQ3B 4LF9L 2NVTB 3TP6A 2JA9A 5HURA 5CV9A 3CRKC 3KF8A 4FDBA 5GAGC 4LF4Q 1TKWB 5IGBA 4ZQ3A 2DUDA 3A8KE 3K8AA 2NBFA 5FLXc 3E5SA 1UNSA 3GQBA 1IYVA 2B2TC 2P5ZX 1PV4A 1WTVA 2A6ED 4NMZA 3BVMA 4BXXG 1SE8A 2B8GA 4HCSA 1AZPA 2R61A 4JI8Q 2KBNA 4KK7A 4GLAC 3SE0A 4X62Q 3J81i 4N9PA 2CW0C 4QF4A 1QOHA 3T4AC 1RTNA 5C4HA 3C2PA 1D8LA 4QIWE 1NCVA 4J6HA 1AW7A 4QMGA 1A2UA 1IXRA 2A74C 1AE3A 3J7ZC 1HNZL 1Q86C 4A3IG 4L5QA 2WP8J 5I2XA 1PTOF 4DR4Q 1QVGA 2UXDQ 4DV1L 4A76A 3DWPA 3S17H 4BBSH 3CMAA 4IFDI 3AQQA 4DNIA 1GVPA 2WAQG 4P74A 4B9WA 1ENAA 3M9BA 2EXDA 5IP7H 3G6EA 3VDYA 3AU7A 4LAAA 3NQIA 2LXKA 3K5NA 2F0GA 2UXBQ 2HQLA 1XMOL 1J8IA 1VQLA 2N55A 2KEEA 1LACA 2B2VA 4DV4L 1IBLQ 4JV5Q 2N49A 5C3EH 5EBCA 2PYKA 2RSOA 1Y1WB 4EGVA 1CZWA 1ASYA 1KDCA 4RCOA 3KF8B 5F2DA 1CZGA 2OQ0A 4BY7B 3PO2B 4DR2L 1PTOB 1KTKA 4IJLA 3OSOA 1GUWA 1NR4A 2JXMB 1ET6A 1D2BA 4P73A 1F9QA 2KCNA 5EJWA 1VQJA 3EQLC 4IUVA 1W6KA 2E8GA 3NP8A 1UWVA 3QG1A 2CCZA 5LMUQ 1QNUA 5CV6A 2VY3A 3JAME 3PO3G 4AYBE 2MFIA 3KYHC 3K59A 1E2ZA 1UAPA 2O4XA 2A8VA 4LF4L 1I4HA 3SR1A 4A3BG 3TSSA 2B63G 1VQEA 5IGGA 2F0JA 1Q82C 4C3IH 1NBWA 4CDFC 5CORA 1LM0A 4RGNA 2RKSA 2CW0D 2HD3A 4FF3A 3GTPB 4JI4L 4LFBQ 5EPKA 4BY1B 1ENCA 4JI8L 3D4DA 2VUMB 1C48A 2WKCA 1K8OA 4LUZA 4X62L 1TXYA 1CHQD 1EL0A 4EQPA 4HJAA 1WTWA 1TT2A 3PIO3 4HIKA 3UI2A 4KMUC 4CGYB 1D6EC 2OT2A 3U9OA 5C44B 3OIQA 1HTLD 2K6AA 4IPGA 3V05A 1FJGQ 3NE5B 5JPNC 3HRZC 4A3MG 5J22A 3MFYA 1LV9A 3NK9A 4KKUA 3EJIA 4DR4L 4ZAIA 2UXDL 2NVYH 1BBXC 4A3CG 3FVQA 1GO3E 1CQFA 5M5WH 1TS5A 4S3SA 3W2DA 1IBMQ 4CKBA 3GTQB 1VCIA 1NE3A 4NPSA 2UUAQ 1XNQQ 2PZTA 3E9IA 2KCCA 1UE6A 3MC0B 1S3OA 4UP8A 4XT3B 4AH6A 2JA5B 2HUGA 1S4ZA 3D6WA 2ENBA 5ELEA 3TBIB 3K81C 3PIP3 1IBLL 4JV5L 1YZ6A 3PF5A 4QJFA 1EIGA 1HA5A 3SEBA 4EQOA 2E2HH 4I65A 4IUPA 2EY1A 2AQ1B 2I5LX 4AIMA 2WFWA 3T1YQ 4IN3A 3TP5A 1CKOA 5IGDA 1EY4A 1K0SA 2G9HD 3L7ZC 1X55A 2PNRC 2R92G 3TZUA 1XPUA 1A3UA 5E1FA 2NVQB 3Q23A 3GTGH 3PO3B 2NZ1D 3GV3A 5M9OA 2KCMA 5M3FB 2NN6I 1VQOA 4L5TA 1RHPA 1WTQA 5KNDA 5J39A 5LMUL 4GOPC 1KLUD 4F8MA 1HNWQ 2YTYA 3P7JA 2EJGC 2M2LA 1LT4D 3ZJYC 4IFDG 2H1EA 2BCOA 2PW7A 4TKOB 2JA6B 1ILQA 1G2SA 2M00A 4HJ9A 4NW2A 3TRZA 4LFBL 2PZUA 3L9AX 3OYYA 2GA4B 2JQOA 1MGSA 3KBGA 3KDFB 1CTMA 2K52A 2NB0A 3TP8A 2Z0SA 3AFQA 1X3FA 1RCVD 1OO9B 5E4WC 3T13A 1VQCA 3I56A 1FJGL 1VQIA 4K14A 3TS2A 2AUKA 1KNAA 1MKHA 2ICEC 3ITPA 4CDCC 3GTKB 5CR3A 4FXKC 3U4VA 4DGZA 2Z4HA 3TP7A 4JI6Q 1G6ZA 2JA8B 3NWTA 4LFAQ 4ZYSA 2I0QA 5J3BA 1VQKA 4DFAA 1D5XC 1ZEQX 1CM9A 1OXVA 1IBML 1DCZA 3U50C 1EEID 4IO9A 2KEDA 4ZUJA 1AFPA 1G2TA 1XNQL 2UUAL 4YWMA 3SGIA 1N9WA 3IAYA 1S5ED 3MXNA 1E2VA 1FGUA 1LLRD 1LYLA 3J80L 4KHVA 4BWGB 4UAIA 1PHJA 4HEDA 3PCOB 3VR3A 4IOCA 5C0XH 1A3TA 1I5FA 3T1YL 1SNDA 3PUWA 1D7QA 4X3UA 3J81c 3H09A 1O80A 1WD1A 1SFOH 4RA8A 2SNMA 3A8JE 3S1MB 3FPPA 1VQ8A 1ILPA 1ONLA 2FFKB 3J81L 3BZDB 1HNWL 1ESFA 1R9TH 3HOWH 5FOBB 2KHJA 5FO8B 3DXJC 1FNWA 1H9MA 3S2HB 1H9SA 1MHWC 2KENA 3CCVA 1B3AA 3CCQA 4KY6A 3S9WA 4C3HH 2E2JB 4AQYQ 4DV3Q 2RHQB 2OQKA 1PH7A 5FO7B 1MD2D 3A5UA 3H3VI 3I4OA 1STAA 3H0GG 1EZ8A 3J81j 2ZJPA 3M4YA 3K7AB 1LTTD 2VXWA 4HJ5A 1L2FA 5GAHC 1E0BA 3HOYG 3FRPB 2ALYB 2KOLA 4Q0FA 4DXGA 5LL6X 4DV2Q 1S5DD 5IIFA 2RBMA 2CWAA 1MIUA 3HKZE 2L5TA 1HFGA 3PGZA 4A93H 2A69C 2ZTEA 4PG3A 1WJJA 4H44C 3T1HQ 4JI6L 1Y1VH 4LFAL 4ULLA 1SYFA 4WJ3M 1JOQA 2F52A 1SE4A 2NN6G 3NUCA 4A3JH 1PVOA 1CKNA 3FKIG 3VR5A 1D1KA 3X3NA 2PQEA 1STHA 2K04A 4A3KG 3GTMH 4OGQC 1F2YA 1BCPC 3QWNA 4CBVA 2DY8A 1SJHD 1C8CA 4A3GH 3A0JA 5E3FA 4EQNA 1WTPA 1WCMG 2XRSD 1SDFA 2K5QA 2XWJB 2R3ZA 5FJ8G 3FPUB 3CCEA 4LF6Q 4HR7B 5T1IA 3PIOA 3A5ZB 4RH6A 3E6ZX 1X3PA 1VQ6A 1K0RA 1H9SB 1B3QA 4NKLA 1QWYA 2EY2A 1BBWA 5IYBH 3TS0A 3S1RH 4U68A 5IP9G 5IYCG 1PMRA 3NTIA 5FKAC 1UE5A 5GADC 3NEMA 1EWIA 2R7ZG 4A3DH 3TEHB 3K6OA 5ELBA 3HOUH 3HS0C 1JWUD 3PIPA 2ZTDA 4KHPQ 1TWAH 3LNNA 5M5WB 3HOVB 1KXLA 4R1JA 2R93H 4WJ4A 1WFQA 2MPMA 1PYWD 4B3SQ 4AQYL 4DV3L 4DR7Q 3JAMc 3KUPA 4A3IH 1CKNB 3K5OA 4N8FA 1Q7YC 4IURA 3HOZG 1EYCA 1M90C 2SDFA 2IT1A 3K0XA 2QCPX 5IWAL 3DM1A 3KJOA 2WAQE 2X6LA 1X3GA 2A69D 3N6RA 4OHJA 2L55A 4ABNA 4DV2L 4PZ8A 3Q6SA 2PO4A 1DOMA 4B08A 4KKSA 4C3JG 2M9VA 2ZJRA 1IHZA 3PV0A 3HOXH 4IFDJ 2PMZE 1V8QA 2QEXA 3IFDA 3N52A 4RWSC 3GTGB 3VYUA 2F0IA 4MN3A 2MO0A 3KK7A 2JA7B 1BCPD 1SMYC 1MSGA 4OWWB 3S1NH 4MNOA 3GO5A 4NXMQ 2YV5A 1SJED 4IZ8A 1QUQA 4R9WA 3T53B 1SNOA 5JEAH 2K50A 1Q1BA 4CKEA 2K5NA 3J80E 1KL9A 3OOCA 1VQ9A 2KHSA 3C3LA 2NTSA 1VF5C 2F3VA 2PNHA 2Y0SB 3MEFA 5BN5A 2GN5A 4DV5Q 1F9RA 4OELB 1YJ9A 1EWCA 4LF6L 5D3DA 1KDAA 4K2LA 4OL7A 1I6HB 1TWHH 1ESRA 4FO2A 1F2ZA 1YNJC 3EIVA 1JQYD 4FF1A 4GNXA 5EKIA 2J0TD 4K8JA 5L37A 1EYDA 4A3EH 1TIID 1JWSD 1G291 2V1CC 1QZGA 2JSOA 1QVFA 1MJEA 3OTOQ 2ZXRA 3L2PA 2K01A 2F0LA 5IYDH 1W6JA 3OMCA 5D3IB 5ISRA 1F2LA 1BDOA 1STNA 1ENFA 1LTRD 4CJ2C 3IL8A 4HJ7A 4JI2Q 2DN8A 4XQQA 1MBYA 4IPCA 2K75A 4YCVA 4LF5Q 2BDOA 4G7HC 3MHBA 4KHPL 4K5WA 4IUUA 4UY8C 4HIDA 2Q2HA 4B3SL 5JJZA 1Y1WG 5M3MH 3QOJA 4N8X1 1JT8A 3MFGA 5CBAE 2OEOA 1F2MA 2LSSA 4IPHA 2BOSA 5G3LD 1E2WA 1SYGA 3PO2G 4GKJQ 2X6GA 1CSPA 4KJNA 3J7A5 1RJTA 4C3JB 1QUQB 4WRDA 1VQDA 2SNSA 1U4MA 1Z7TA 4ILWA 1TU2B 2VQFQ 1X54A 5DM73 3I4NB 1JOKA 2F4IA 4YHHQ 4OIJA 2UU9Q 5LMNQ 1Q81C 1DOLA 5ELOA 2H4OA 3GTLB 5JOBA 1SMYD 1YBYA 2C35B 3I2ZA 4RAUC 1Q90A 4GN5A 4I7AA 2NZHA 4DK0A 2XRQD 3BS1A 1PA6A 4HMIA 5K36H 2AMCB 3I72A 2Q8IB 1YEZA 4GNXB 4DXFA 1XYIA 2XSCA 2F0VA 4LJZC 4H13C 3K5MA 4NXML 2R92H 3K7UC 1KC8C 4OONA 3HOWB 5J1ZA 4BY1G 3K5LA 1VMCA 1BR9A 2VUMG 4DV5L 1EY5A 4G7ZC 1YNJD 1Q8IA 1FNVA 1PYBA 4DNTB 5I6WA 5JAVA 5DNFA 4UP7A 3RUZA 4C3HB 5C44G 4WFN3 4RKLA 3JC66 1GM5A 2LMCB 2BH8A 1EFID 5C4XH 2K7VA 2EJMA 1SMXA 3MEHA 1YI2A 4RKBA 2WB1B 4C56C 1B1ZA 4A4IA 1G91A 1GHKA 1MI2A 3OTOL 1WOCA 2E76C 2IX3A 1HTPA 3CXCA 4A3LH 5IOCA 3K58A 2MHVA 2EZVA 1BUVT 4LW1A 4X3KA 3GTOB 2ID0A 3KF6A 3NSWA 3G4SA 4DR6Q 1EIYB 4JI2L 1RODA 1AZQA 4FF2A 2EYOA 4A93B 1GJXA 2JA5G 1Q3LA 3S16B 4LF5L 1XPOA 3RLOA 1IKMA 4A3FH 1VQMA 4JI0Q 4A3JB 4DN4M 2LKVA 1SYDA 1T5XD 5EPLA 4DUYQ 2ZT9C 4OO1H 3DUZA 4K2KA 4J15A 3I8ZA 5CV4A 3OMGA 4Z9CB 4DV6Q 1AE2A 2D9UA 2TMPA 3GTMB 4GKJL 4HN7A 4XT1B 2F3IA 5K5PA 2EY6A 5M3FG 1QCBD 2SOBA 2WKDA 4DAYB 1IKLA 1JOOA 5EPJA 4YHHL 1HJPA 1K83B 4O42A 5ELCA 5BN4A 3CCSA 4X3TA 1XMQQ 2UU9L 4L5RC 3CHBD 3GTJH 2TSSA 3RLNA 2K4KA 1Y69U 2Z8LA 4JOIC 2JK8A 4P71A 3S1RB 4PMCA 1BBUA 4OWTB 3TZDA 2AQ2B 3FP9A 2IHFA 3RN2A 2K5DA 4ME5A 2AHOB 1ZXTA 4O0AA 2JA6G 3I55A 1B9NA 2Z6KA 4XXEA 3ULLA 2E2IH 3MZ5A 4GLVB 4A3DB 1LTID 2XGTA 5IT9L 5M5XB 5ELFA 1EY6A 1HCZA 1P8LA 5FO9B 1GUSA 2BE5C 3HOUB 2FMCA 3KF6B 4MHEA 3Q24A 2VQEQ 3PUYA 4L8JA 2YTXA 3CCUA 2NVXH 2QDLA 5EKLA 1HA6A 2R93B 4BS9A 3CPWA 1ICWA 1M8AA 4QB4A 1NUCA 2NTTA 5M5YH 3M85A 4KV6A 1D5MC 1GUNA 2B3GA 2XNAC 2JA8G 3KDFA 2UXBL 1YITA 3M7NA 1P16A 2Z9HA 1PRTF 5ELDA 4QQBX 2B2WA 3RNUA 1I50B 4Y7NH 1SEBD 2WINB 4DR6L 5IODA 1G51A 4P75A 4JI5Q 1V1QA 4K8IA 2RDFA 4KKTA 3HOYH 3KLRA 2BA0A 1WI5A 4GN3B 3HOXB 4JI0L 4NB3A 2EYJA 2EJFC 3VYRA 3PUXA 4KN7C 3MXPA 3RZDH 4DUYL 4JBWA 1LUZA 4E6IA 1L1OA 1JC7A 5LHY1 4RGTA 1STGA 4DAPA 4DV6L 5KIXA 1I94Q 2EE1A 3D4WA 1L0WA 3MXUA 5IGCA 1ZYRC 1PRTB 3DWAA 4X3SA 3J7YW 4DR3Q 3RZOH 1PZKD 3BU2A 1JICA 4KN4C 1M4VA 1WYDA 1XMQL 1E1TA 4C2MH 5FLMH 1TWHB 3MTSA 5I4DA 5BN3A 1IL2A 1FNUA 3RR5A 2K5WA 1GXDC 1U5KA 3P1HA 1S5CD 4A3EB 1N36Q 4O1NA 4FF4A 3D0FA 1OXSC 4HAEA 2B2UA 5JJIA 5JVH3 1MJCA 2BE5D 5IP7G 1HZBA 2QGQA 1Q8KA 1AEXA 1GD7A 3WOFA 1TWCB 1WVLA 3V96A 4IPDA 4PZ6A 1TS3A 2B2YC 2Q2IA 3G48A 1FR3A 4CJ1B 5KRUA 2VQEL 2R7ZH 2A73B 2IPKD 4RHSA 1DM0B 2VNUD 1F9SA 4R4TA 3NENA 4TRDA 2ZXOA 5M3MB 1EQVA 3MXGA 3HP3A 3J80c 4ALPA 2VW9A 3FHWA 2KJXA 2ICIA 4WORA 4HIMA 2B2TA 2QILA 3HKSA 1L1OB 1D5ZC 3AYHB 3SK6A 1T9HA 4YWLA 1RKNA 2EPBA 5HY6A 2EY5A 4P2CB 4DR5Q 3BVZA 4JI5L 3W3AA 1KRTA 3W1GA 1N8RC 4DNRB 4M1UB 3AMUA 1U4LA 4O2DA 1Y8PB 2CH4W 3ICEA 2QKIC 5KNBA 2XTIA 3KJPA 2QEJC 2NUCA 3CU7A 3UE0A 2Q2UA 3OW7A 2D0PA 3K80C 1SROA 1BVSA 3F2DA 1PH6A 4C3IG 3K57A 2VZAA 1ZYRD 1STEA 5C0XI 1I94L 1PH4A 1NAPA 1Z47A 3M4OH 4QIWB 1XX8A 3GV6A 4DR3L 1HZCA 3RN5A 2EVBA 5DEHA 3AFPA 3MAQA 2CFMA 5CV7A 1BNZA 1CK1A 1HXYD 4JBMA 4GKKQ 1TY0A 3NELA 1PH2A 3S17B 1U0LA 3Q22A 4BBSB 5C4XB 1DOKA 2VB3X 3C1FA 2WV6D 1N36L 1SXTA 1XPRA 1FVIA 2OCEA 3BZKA 1PTOC 4ME3A 1NSNS 1RDPD 2JEAI 4H7BA 5A35A 3HOVG 5IT9E 3ND8A 1TS4A 2F0SA 3E0JA 2AUJD 2DNEA 2F0HA 1EWHA 1V1OA 2O2LD 5E7NA 5C3EB 1I4PA 4BBRH 1SE3A 2CQOA 2KVMA 2A68C 1GUGA 3SXHA 2PI2A 2OF1A 3VYSA 4DKAC 2F0UA 1K8GA 4JC0A 4A3FB 5GQOA 2Z4IA 1ICFB 1HZAA 4P72A 2F0EA 3M4QA 4R4CA 2Q8TA 2HCIA 3CF5A 2DJFC 1B50A 3EVQA 1XXGA 2CWPA 1VQBA 3URYA 2C9OA 3WWVA 5KYIA 2CHBD 1TY2A 3M7GA 2WACA 4L6TB 1EQTA 1QJOA 3I3CA 2ZXPA 4KD3A 5TSSA 4AYBB 2JA7G 2FJ2A 3UDFA 5FK9C 1BQQT 2X69A 3VA7A 1SN8A 4XDXA 3AEVA 4B3MQ 4DR5L 3I4MH 4BY7H 1GHJA 2KQ3A 3KBXA 1WTXA 2B2VC 4GZYC 4C3IB 1YNNC 1Z9FA 2Y0SG 3EN2A 3OIPA 4FNFA 4XQJA 1JE4A 4G4KA 3STBC 1E1OA 1WTHA 4LF7Q 2EYFA 2RCFA 1VS0A 4CHTB 2MO1A 4JW0A 1JMCA 4HJ8A 4B3RQ 5JJLA 1GUOA 3SDZA 4BXXH 1KAWA 4KJOA 1AN8A 1N34Q 1YNXA 4HIOA 1X9NA 1PLFA 3VA5A 4BA2I 4GKKL 4TSSA 2NVYB 4LFCQ 1QG7A 1HQMC 3P20A 1PH1A 2OTJA 4F88A 1PTOD 1KRSA 1ZKOA 2E5LQ 4BY1H 1O7ZA 1K9MC 1JB7A 3IFTA 1S5BD 3OWEB 1JJ2A 1KHIA 1NR2A 2KHIA 4GS3A 1I3QH 5NUCA 3NTKA 3ER0A 2HDMA 2L9HA 2A68D 2EYPA 1TR5A 2DY7A 2E2HB 5CGKA 1H95A 4OWXB 3ULJA 1F77A 2VS1A 4DK1A 4GOPA 1AP0A 1YHBA 1N32Q 3IRBA 2B8FA 2J4XA 3A8IE 4PMWA 1EQQA 3T1HL 1PFSA 5IGEA 1YIJA 3S14H 3VR6A 3P75A 5CMDA 5H1SE 3I4NG 2JA5H 1SNCA 5C0XG 1PDQA 1X32A 2D0OA 1C0AA 1O7YA 1JJCB 1DD2A 2R7DA 2WIIB 5D65A 1EY9A 4KI0A 3V2TA 1V9PA 2DGYA 1YVCA 1PXUA 3DEOA 3RZOB 5C4JH 2F3WA 1PFNA 3QO2A 4B3ML 4K5VA 1YNND 2KUMA 4R4OA 4LMQD 4C2MB 1QZHA 5C3WA 4HCEA 3OPOA 1XWEA 1X56A 2NVQH 1JJGA 1I4GA 4RMFA 4QY7A 3STBD 3PO3H 1SNPA 1E3PA 5KNCA 3HOWG 3BYTB 1BOSA 4V190 1QE6A 2LS01 2AWNA 5AFWA 1XTDA 4A3BH 1LT3D 3A7LA 2JJQA 2EQSA 1PH5A 5DM63 2B63H 2PZWA 3F8TA 4C3HG 2MQHA 2B39A 4LF7L 3RD4A 4POGA 1O78A 2JE6I 2JP1A 3SK5A 1GKHA 2F0PA 4OXPA 4NDXA 1SNMA 1D1IA 4B3RL 2WB1G 4FP5D 1K8AC 1XJVA 1ET9A 1TS2A 2O5IC 2JA6H 2HHHQ 4POFA 3A56A 3T51B 1CUKA 4MTKA 4XQNA 1NY4A 4DK6C 4GOPB 4C1NK 4XIGS 2E5LL 4Y52H 4LWCA 2I5MX 4A93G 4DR7L 2F0FA 4KLKA 4A3MH 1Y8NB 2I5HA 3TDQA 3HGBA 4JBJA 2IWHA 4DR1Q 4JI1Q 3L0OA 4B9XA 4A3JG 1NMGA 4A3CH 3S2DH 1NJIC 3U9SA 2E75C 1JE5A 2VL6A 1UUPA 2FMMA 4DR2Q 3B6YA 3CW2C 2RDGA 5IY0A 1N32L 4YCUA 1CA6A 4QL5A 1V1PA 1SE2A 3L3OC 2DJGC 2IHEA 1YHAA 4YIJA 2L12A 2RVLA 3MA2B 3R2TA 3CQZH 1IYUA 4I7ZC 2L0CA 4K6DA 2A6HC 3WOEA 1HZ9A 1Q1EA 5KYLA 1SFOB 3A74A 3OWFA 1VMPA 2JYOA 3UDIA 3NTHA 4DPGA 5IYBG 1PH8A 1PYSB 3M4OB 3CC4A 2VB2X 1RL2A 5AJ3Q 1S72A 4DAYA 2AKWB 1R9TB 2F0MA 3BDOA 4H0LC 4PQXA 4KHZA 1X3EA 4A3DG 2ZTCA 3LX0A 2YTVA 5JJKA 2ASBA 1U4PA 4JI4Q 3F2UA 1XNRQ 3HOUG 3TREA 5FLXL 2OXPA 3MVVA 3S1MH 2RF4A 4IFDH 1UEBA 5KEEA 1CT1D 2Z1CA 4PZ7A 4XYOA 1M1KC 3I90A 1VF7A 2R93G 1K8MA 3G7LA 4OIKA 3BVGA 2F4VQ 4F7XA 3GP7A 3R2IA 4RCNA 5I2YA 2K05A 3S2HH 4FYDA 5E4XA 3FEWX 2NZOA 2EYLA 3SK4A 3CC2A 3HKZB 4BBRB 1H9JA 2HHHL 4UDUC 2E2JH 1X6OA 1DJRD 3S15H 1HPCA 1EY0A 1QNKA 1BF4A 4PMBA 2XIWA 1QVCA 1Y1VB 3KLSX 4IUTA 2BH2A 1EOVA 4ZUIA 1CHPD 1V1PB 3K7AH 1HR0Q 4YCWA 4LUVA 1EZ6A 2E2DC 1IBKQ 2UUCQ 2D2CC 1JR0D 3G71A 1VQNA 2K32A 3HOXG 4ZK9B 2IY5B 4DR1L 3ZYYX 4JI1L 2FHTA 3RMHA 2UUBQ 2RCNA 3GD7A 1OXXK 2N88A 1VQ7A 4JG2A 1X3QA 5GAEC 1B70B 3Q8DA 3DWQA 3I4MB 4A3GB 4DAVA 2IL8A 2VQFL 3C1EA 4JPBW 5JEAG 4OO1I 1BCPF 3ERSX 3NXWA 4CDEC 1RD9D 5LMNL 3SHLA 1DYQA 1NTGA 4DF7A 5C6AA 1EUJA 2A6HD 3KLSA 3GDEA 3R8BA 3OHXC 4KY5A 5IT9c 1EIFA 1VQGA 2RDHA 1H9RA 3CCJA 2MUYA 3S1QH 3SVMA 4G7OC 1STBA 3BG3A 1DXMA 3ERQA 4CJ0B 2ES2A 2D62A 5IE8A 3ND9A 1B9MA 4A3EG 2CQAA 5HGQA 3EFXD 1Y8OB 2G5DA 1B7YB 1RIPA 5AJ3L 2XVSA 2DNCA 3EA6A 5IYDG 2N78A 5C5MA 3I91A 1K73C 1HRJA 1CKMA 2HCCA 4DK3C 1UE7A 3Q0AA 1SNQA 3CCMA 1TWAB 1BCPB 3J7AV 4HSPA 5JVG3 1XNRL 1EU3A 1EFWA 2XWBB 4RGMA 4A3IB 1TQOA 2ZM6Q 4YY3Q 1I3QB 3PSIA 5C0XJ 1TWFH 4FVMA 4DUZQ 1I4QA 2WAQB 5CYUA 5M3MG 1WD0A 1BXTA 2F4VL 1C9OA 4IQZA 4CDDC 2EDGA 4R8NA 1E7ZA 3F2CA 2FINB 2RQXA 3UDXA 2PI2E 4JI7Q 3H0GH 3HOVH 2CKZB 3QR8A 2EIFA 3NBIA 1UEAB 1SLJA 2PQAA 4DV0Q 5G3LF 3A7AB 3S14B 1A0IA 1H9KA 2PMZB 3VR4A 1CFMA 5C3XA 3BZCA 5JPMC 1HR0L 3JAMi 1IBKL 2UUCL 1TWGH 1KNEA 4Q5VA 3PUVA 2LY7A 3A55A 5CBEE 3S1NB 1C4QA 2UUBL 2F03A 1J5EQ 1K3BC 1Q46A 2NN6H 1B4OA 4UP9A 1QB5D 4H02A 5K36G 2NWGA 3HEJA 3G6JB 3FKIH 3H6MA 3DHQA 5C4JB 4KTAA 4MIUA 2RHSB 1QILA 4A3KH 3R93A 3DMUA 2JA7H 2A5HA 4PV1C 5EQ0A 4LF8Q 1MSHA 4RHRA 5EGTA 1L0YB 3VR2A 3LGJA 4J1MA 4A3BB 1WCMH 5FJ8H 3F1ZA 2B63B 3I70A 1A2TA 2JEBI 2K33A 1VQ4A 3PUZA 4BBSG 5C4XG 2Y0SE 1OXTA 2G9DA 2F0OA 5EAYA 3TMEA 4X65Q 2EXZA 3BDLA 2R6GA 3T16A 4JBKA 5IP9H 1T5EA 4IUNA 4RGOS 1I6HH 4L5SA 5EKKA 1W3SA 5IYCH 1U4RA 3H15A 1IYJB 3CCLA 1ML0D 4A3LG 4A75A 1OXUA 1IZ6A 1A8VA 1O7IA 3PQIA 5LMNW 1WTRA 5HGTA 1DZ1A 3KOJA 2PQAB 2H5XA 5FLXE 5C3EG 4EX5A 3IKJA 2PPBC 3C46A 2CVRA 4R8IA 4A3MB 2YU9H 3W5OA 2QW7A 2ZM6L 1CQVA 1SYCA 4ZKBB 2MJ8A 1VQAA 4YY3L 4A3FG 1Y14B 1JB3A 3S2DB 1PH3A 3M3YH 4DUZL 4GNXC 1C7YA 4ZCKA 4OO1G 5LL6S 4IJHA 3K0YA 2F0WA 1K28A 4UHVA 4JI7L 3HOZH 2F0DA 1UE1A 1E22A 1EOTA 4DV0L 1G6PA 2XN9C 4AYBG 4X6AH 3H91A 4KD4A 3H3VC 5A2QL 1KD1C 1YHQA 3CQZB 1LO5D 3W1BA 2QA4A 1SAPA 4QUFA 2NYZD 4C3JH 1HNXQ 3D3RA 2NVTH 2HDLA 1VQHA 4L63B 1J5EL 1EQRA 2R92B 5CV8A 1I6VC 2EOTA 4GLXA 4NXNQ 3I4NH 4R4QA 1JCKB 5BR8Q 2A19A 1EU4A 2MGSA 4APVA 3GTLH 1DONA 5IGFA 4HMJA 4OX9Q 1HH2P 1VQFA 4X66Q 5T1GA 1J9OA 3O13A 1STYA 1A63A 1HR0W 4MZ9A 4LF8L 3A54A 1LTLA 1VQ5A 1I4XA 2OTLA 2O5JC 3D4RA 3LWEA 1WTOA 2L1BA 3NHHA 4DU9A 3ONAB 4DV7Q 1A62A 2GVAA 3H3VH 2N8NA 3NPPA 4KY7A 1X65A 4QCLA 4TVAB 4X65L 4EVOA 2AWOA 1LTGD 4WJWA 3ULPA 2EYHA 4CKCA 1PZID 2IJ0A 3CKIB 4RFBA 2QDBA 3S15B 1LTAD 4K0KQ 4N9TA 2F0NA 3CCRA 4B3TQ 2SEBD 5I9PA 1RF2D 1B8AA 2WB1E 4M8AA 3KFUA 1SYBA 5JEAJ 1R4QB 1FGBD 2K14A 3X3MA 2B29A 2BA1A 1RTOA 5IWAQ 2ZJQA 4C1NI 1YJWA 4QGUA 2LXJA 1B44D 3CPFA 3QB3A 3MXNB 3GTOH 4JOIA 2HIVA 3I4LA 5GROA 1EIHA 3FMCA 4R4IA 4ID6A 1NNXA 1Y1WH 2PCFB 3S16H 1LTSD 3KLWA 1II3A 1SR3A 1A15A 2RSNA 3EBEA 2OWOA 4K5XA 4JYAQ 2HQEA 1GOZA 3PO2H 4LNQA 2PW5A 1PTOH 3BJUA 1S5FD 4MTNA 4OEMB 3GTJB 2EYMA 1EY8A 5I9OA 1CA5A 3S24A 1EYAA 2I07B 5COYA 3T56B 5FLMG 3S1QB 2IX0A 2D5DA 3U58A 1ASZA 1JORA 2K03A 1IW7C 4UPAA 1HNXL 2MP1A 3D31A 3CAMA 2K5VA 2E2IB 4V0BA 2K28A 2IW3A 2UXCQ 4NXNL
chains in the Genus database with same CATH topology
5J3BA 4JI1Q 3FP9A 1KQSA 1K83H 2IHFA 3L0OA 3DLLA 3RN2A 4A3JG 1NMGA 1VQKA 4A3CH 1W2BA 3S2DH 1NJIC 2R7FA 5BR8L 2AHOB 1OXVA 1IBML 4O0AA 2JA6G 2N3SA 3I55A 2Z6KA 2E2IH 3U50C 3ULLA 4IO9A 4OX9L 1JE5A 2VL6A 4GLVB 4X66L 2MNAA 4JI3Q 2XGTA 1XNQL 2UUAL 4DR2Q 4YWMA 3SGIA 3B6YA 1N9WA 3CW2C 5IY0A 1N32L 3GTPH 1P8LA 4YCUA 3CC7A 1FGUA 2VUMH 3KF6B 4QL5A 1LYLA 2VQEQ 2IHEA 3PUYA 1YHAA 2YTXA 3CCUA 1PHJA 5M5XH 2NVXH 3CQZH 2A1AA 3CMEA 1OTCA 3PCOB 5C44H 4IOCA 3F2BA 3CPWA 4DV7L 1I5FA 3I7FA 1HZ9A 1Q1EA 4BA1I 3T1YL 3A74A 5M5YH 3PUWA 3M85A 3UDIA 1D7QA 4X64Q 2B3GA 4DPGA 5IYBG 3UDGA 1PH8A 2JA8G 3J81c 3KDFA 1PYSB 2UXBL 1YITA 3CC4A 4Y52H 3M7NA 1RL2A 2Z6KC 1P16A 5AJ3Q 1S72A 1N33Q 4K0KL 2AKWB 1SFOH 4B3TL 4QQBX 3RNUA 1YJNA 4Y7NH 2UXCQ 4KHZA 4DR6L 1X3EA 4A3DG 2ZTCA 3GTQH 2YTVA 1VQ8A 1CSQA 5JJKA 2ASBA 4JI4Q 1G51A 4P75A 4JI5Q 1HNWL 1V1QA 1R9TH 3HOWH 1XNRQ 3HOYH 1I50H 2BA0A 1WI5A 4GN3B 4LF9Q 3HOUG 2KHJA 3TREA 4JI0L 3S1MH 4NB3A 3HFZB 2RF4A 1UEBA 2KENA 3CCVA 2FXQA 4PZ7A 3PUXA 3CCQA 1M1KC 3RZDH 4C3HH 2L15A 4DUYL 2R93G 4JBWA 1FL0A 1LUZA 4RG1A 1L1OA 4AQYQ 4DV3Q 2F4VQ 2RHQB 2OQKA 1V43A 4JYAL 1PH7A 3S2HH 4JCVE 3A5UA 4DV6L 3H3VI 2NZOA 3M4PA 3I4OA 4TQUS 4XTCS 2ATWA 3CC2A 3H0GG 3J81j 1I94Q 2ZJPA 1L0WA 2HHHL 2E2JH 1X6OA 1L2FA 4HJ5A 5GAHC 3S15H 5M3FH 4DR3Q 1NMFA 3RZOH 3HOYG 3BU2A 1QVCA 2ALYB 1AH9A 2BH2A 2HT1A 4DV2Q 1WYDA 1E24A 2CWAA 1XMQL 1E1TA 1EOVA 1MIUA 3HKZE 4C2MH 5FLMH 1KIXA 2IX1A 2GVBA 3K7AH 1HR0Q 4YCWA 3PGZA 4LUVA 4A93H 2ZTEA 3OW2A 1IBKQ 4PG3A 2UUCQ 1IL2A 3RR5A 3G71A 1WJJA 1U5KA 3T1HQ 2YYZA 1HNZQ 4JI6L 3HOXG 1Y1VH 1VQNA 4LFAL 1N36Q 2UXCL 4DR1L 2IY5B 4JI1L 2UUBQ 2RCNA 4WJ3M 3E0EA 3GD7A 1OXXK 3D0FA 2F52A 5DLQE 2NN6G 4A3JH 1PVOA 1OXSC 4DAMA 1CKNA 1VQ7A 1L1OC 4JG2A 4DV1Q 5JJIA 3FKIG 1DGSA 3RLFA 1N34L 5GAEC 1MJCA 4JI3L 5IP7G 1B70B 3Q8DA 1HZBA 2QGQA 3NBHB 2VQFL 1Q8KA 3CP0A 1GD7A 4LFCL 5JEAG 3TQYA 4OO1I 4A3KG 4IPDA 3GTMH 3ERSX 3HKZG 4PZ6A 4BBRG 2HIXA 5LMNL 1NTGA 1XMOQ 2Q2IA 3G48A 1EUJA 2VQEL 1S40A 3GDEA 4A3GH 5IT9c 2R7ZH 1Y1VG 3A0JA 1EIFA 1VQGA 2VNUD 4DV4Q 1WCMG 5FJ8G 3CCEA 3PF4A 1BKBA 4GN4B 1TWCH 3CCJA 4LF6Q 4YWKA 3S1QH 4IOAA 3PIOA 3A5ZB 4R4TA 3NENA 1VQ6A 1K0RA 1PH9A 2ES2A 2D62A 3J80c 5IE8A 4ALPA 4X64L 2VW9A 3GTKH 3FHWA 1BBWA 4A3EG 5HGQA 5IYBH 3TS0A 3S1RH 2JA8H 2KCTA 4HIMA 1B7YB 3DM3A 5IP9G 1RIPA 1L1OB 3HKSA 5AJ3L 1N33L 3CD6A 3AYHB 3E9HA 5IYCG 1T9HA 4YWLA 5IYDG 2N78A 5HY6A 2Q2TA 1UE5A 3U4ZA 3NEMA 5GADC 1K73C 2K5HA 5ELNA 1CKMA 4DK3C 1EWIA 3I4MG 4A3GG 4EQ5A 1UE7A 1Q12A 4LUOA 1VQPA 2R7ZG 4DR5Q 4BY7G 4A3DH 1K3RA 3CCMA 1EYGA 4JI5L 3UE1A 3W1GA 1KRTA 3J80i 1N8RC 1SRUA 1J6QA 3TEHB 1XNRL 4LF9L 1EFWA 4O2DA 3HOUH 4LFAQ 3ICEA 2JA9A 2ZM6Q 4YY3Q 3PIPA 2XTIA 2ZTDA 4LF4Q 4FDBA 5GAGC 3KJPA 4KHPQ 1TWAH 3PSIA 5C0XJ 3UE0A 1TWFH 2Q2UA 1KXLA 4R1JA 2DUDA 2D0PA 3K80C 1SROA 1BVSA 1WFQA 3F2DA 4DUZQ 2R93H 4B3SQ 4WJ4A 3K8AA 5M3MG 5FLXc 4DV3L 4AQYL 3JAMc 1C9OA 1PH6A 2F4VL 4DR7Q 4A3IH 2VZAA 5C0XI 1CKNB 3F2CA 1E7ZA 1Q7YC 1PV4A 3UDXA 2PI2E 3HOZG 4JI7Q 1I94L 1PH4A 1M90C 3H0GH 1Z47A 2IT1A 3K0XA 3HOVH 5IWAL 2CKZB 3M4OH 2EIFA 4BXXG 3KJOA 1SLJA 1SE8A 2PQAA 2WAQE 4DV0Q 4DR3L 4JI8Q 1HZCA 1X3GA 3RN5A 2KBNA 3AFPA 4GLAC 4X62Q 2CFMA 4DV2L 3J81i 4PZ8A 1A0IA 4JBMA 4GKKQ 3BZCA 1D8LA 1HR0L 4QIWE 3NELA 3JAMi 1PH2A 1IBKL 2UUCL 1U0LA 1TWGH 3J7ZC 1IXRA 1AE3A 3PUVA 1HNZL 1Q86C 1N36L 2ZJRA 3HOXH 3PV0A 2UUBL 4A3IG 4L5QA 4IFDJ 2PMZE 1FVIA 2WP8J 2QEXA 1XPRA 1J5EQ 2OCEA 1Q46A 4DR4Q 3BZKA 1QVGA 2UXDQ 4ME3A 4UP9A 4DV1L 4H02A 4A76A 5K36G 3S17H 2JEAI 3HOVG 4BBSH 3CMAA 4IFDI 2MO0A 3AQQA 3FKIH 4DNIA 1GVPA 4OWWB 2WAQG 3S1NH 4MNOA 4P74A 3GO5A 2RHSB 3M9BA 5IP7H 2EXDA 2YV5A 3G6EA 3VDYA 4NXMQ 1QUQA 2LXKA 5E7NA 2UXBQ 2K50A 1Q1BA 4A3KH 2HQLA 2K5NA 4BBRH 1KL9A 2CQOA 1XMOL 2JA7H 1VQ9A 2PI2A 1VQLA 2PNHA 4DKAC 1K8GA 4LF8Q 3MEFA 4JC0A 2GN5A 4DV5Q 3LGJA 5GQOA 4DV4L 1IBLQ 4JV5Q 1YJ9A 1WCMH 2N49A 4LF6L 1HZAA 4P72A 4R4CA 3F1ZA 3M4QA 5FJ8H 5C3EH 3CF5A 1TWHH 2JEBI 1VQ4A 3PUZA 2CWPA 1VQBA 1ASYA 3EIVA 4BBSG 5C4XG 2Y0SE 1OXTA 3KF8B 4GNXA 4A3EH 5EAYA 2OQ0A 1G291 3WWVA 4DR2L 2V1CC 4X65Q 1QZGA 4IJLA 2R6GA 4JBKA 1QVFA 5IP9H 1MJEA 3OTOQ 1I6HH 4L5SA 3L2PA 1W3SA 5IYCH 3H15A 1IYJB 4P73A 3CCLA 2JA7G 5IYDH 1C0AA 3UDFA 4A3LG 4A75A 1VQJA 1OXUA 2E8GA 1IZ6A 1A8VA 1O7IA 1SN8A 1UWVA 5LMNW 3AEVA 4B3MQ 4DR5L 3I4MH 3KOJA 4BY7H 2CCZA 2PQAB 4HJ7A 2H5XA 5LMUQ 5C3EG 4EX5A 2VY3A 4JI2Q 3PO3G 4AYBE 4IPCA 2YU9H 2K75A 2MFIA 3W5OA 1Z9FA 4YCVA 3KYHC 2ZM6L 2Y0SG 3EN2A 4LF5Q 1VQAA 4YY3L 4A3FG 1Y14B 2A8VA 4LF4L 4KHPL 4A3BG 3STBC 4UY8C 1PH3A 1E1OA 2B63G 3M3YH 4DUZL 4HIDA 2Q2HA 1VQEA 4GNXC 1Q82C 1C7YA 4B3SL 1Y1WG 5M3MH 4LF7Q 4C3IH 1JT8A 1NBWA 4OO1G 4IPHA 2LSSA 4IJHA 1VS0A 4JI7L 1LM0A 2MO1A 3HOZH 3PO2G 1JMCA 4B3RQ 4HJ8A 5JJLA 2UU9L 4JI4L 4LFBQ 4GKJQ 1UE1A 1E22A 1KAWA 4DV0L 4BXXH 1CSPA 4JI8L 3J7A5 1G6PA 4LUZA 4AYBG 1TXYA 1QUQB 1YNXA 4X62L 1VQDA 4HIOA 1N34Q 1KD1C 1X9NA 4X6AH 1YHQA 4HJAA 2VQFQ 4BA2I 1X54A 4HIKA 4GKKL 4LFCQ 4YHHQ 1PH1A 2OTJA 4IPGA 3W1BA 2QA4A 1KRSA 2E5LQ 2UU9Q 4BY1H 5LMNQ 1Q81C 1FJGQ 5ELOA 4C3JH 1K9MC 4A3MG 1JB7A 1HNXQ 2NVTH 1VQHA 1YBYA 2C35B 3I2ZA 1EQRA 1J5EL 4DR4L 4GN5A 2UXDL 2NVYH 1JJ2A 2NZHA 4GLXA 4NXNQ 1KHIA 4GS3A 2KHIA 3I4NH 4A3CG 1I3QH 1PA6A 4R4QA 1GO3E 2AMCB 4GNXB 1YEZA 3ER0A 5M5WH 5BR8Q 2A19A 1IBMQ 4NXML 4APVA 3GTLH 4OX9Q 2R92H 3K7UC 1HH2P 1VQFA 1VCIA 4X66Q 1KC8C 1NE3A 4NPSA 2UUAQ 1XNQQ 3E9IA 4OWXB 1H95A 3ULJA 1UE6A 2VS1A 1S3OA 4OONA 4UP8A 1YHBA 4AH6A 4GOPA 1N32Q 3IRBA 4PMWA 1A63A 4BY1G 1EQQA 1HR0W 4MZ9A 4LF8L 4DV5L 3T1HL 2VUMG 3K81C 1LTLA 1VQ5A 1PFSA 1YIJA 1IBLL 2OTLA 4JV5L 1YZ6A 3PF5A 1PYBA 4QJFA 3S14H 2E2HH 5H1SE 4UP7A 3I4NG 5C44G 3JC66 1GM5A 2JA5H 5C0XG 2I5LX 4AIMA 2BH8A 2D0OA 5C4XH 2WFWA 1A62A 2GVAA 1JJCB 4DV7Q 3T1YQ 2N8NA 1CKOA 3H3VH 1X65A 1SMXA 2R7DA 1YI2A 4TVAB 3L7ZC 4X65L 2AWOA 1X55A 4KI0A 4A4IA 2R92G 3ULPA 1XPUA 3OTOL 1WOCA 1V9PA 2DGYA 3GTGH 1YVCA 2KCMA 4K0KQ 2NN6I 3CXCA 4A3LH 1VQOA 5C4JH 3CCRA 4L5TA 4B3TQ 4B3ML 4LW1A 1B8AA 2WB1E 3KFUA 4NXNL 2ID0A 4R4OA 3KF6A 5JEAJ 3G4SA 4DR6Q 5LMUL 4GOPC 1QZHA 1EIYB 4JI2L 2K14A 1JJGA 1X56A 2NVQH 2B29A 2BA1A 4RMFA 5IWAQ 4QY7A 3STBD 2ZJQA 3PO3H 2JA5G 1E3PA 1YJWA 3HOWG 1HNWQ 2YTYA 4QGUA 4LF5L 1XPOA 2LXJA 3CPFA 2AWNA 3RLOA 3MXNB 3GTOH 4A3FH 1VQMA 4JI0Q 1XTDA 4JOIA 2HIVA 3ZJYC 4IFDG 5GROA 4A3BH 2JJQA 2EQSA 1PH5A 2B63H 4R4IA 3F8TA 2MQHA 4DUYQ 1Y1WH 4LF7L 3S16H 3KLWA 4POGA 1SR3A 2JE6I 3EBEA 2OWOA 1GKHA 4OXPA 4HJ9A 4JYAQ 4J15A 3TRZA 4B3RL 2WB1G 3PO2H 4LNQA 3BJUA 4DV6Q 1AE2A 4MTNA 4GKJL 4LFBL 1K8AC 1XJVA 3OYYA 2F3IA 2JA6H 2HHHQ 2JQOA 4POFA 3KDFB 5M3FG 2K52A 1CUKA 3S24A 2Z0SA 3AFQA 1X3FA 4DR1Q 1NY4A 4DAYB 4DK6C 4GOPB 4XIGS 4YHHL 1HJPA 5FLMG 3CCSA 1XMQQ 4L5RC 2IX0A 2E5LL 1VQCA 3I56A 3GTJH 3U58A 1ASZA 4LWCA 2I5MX 2K4KA 1VQIA 3RLNA 4UPAA 1FJGL 3TS2A 1HNXL 4A93G 1MKHA 3D31A 4DR7L 3CAMA 2K5VA 4JOIC 2JK8A 4KLKA 4P71A 4A3MH 2I5HA 3U4VA 4JI6Q 1BBUA 4OWTB 2I0QA 4JBJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J3B A;  4JI1 Q;  3FP9 A;  1KQS A;  1K83 H;  2IHF A;  3L0O A;  3DLL A;  3RN2 A;  4A3J G;  1NMG A;  1VQK A;  4A3C H;  1W2B A;  3S2D H;  1NJI C;  2R7F A;  5BR8 L;  2AHO B;  1OXV A;  1IBM L;  4O0A A;  2JA6 G;  2N3S A;  3I55 A;  2Z6K A;  2E2I H;  3U50 C;  3ULL A;  4IO9 A;  4OX9 L;  1JE5 A;  2VL6 A;  4GLV B;  4X66 L;  2MNA A;  4JI3 Q;  2XGT A;  1XNQ L;  2UUA L;  4DR2 Q;  4YWM A;  3SGI A;  3B6Y A;  1N9W A;  3CW2 C;  5IY0 A;  1N32 L;  3GTP H;  1P8L A;  4YCU A;  3CC7 A;  1FGU A;  2VUM H;  3KF6 B;  4QL5 A;  1LYL A;  2VQE Q;  2IHE A;  3PUY A;  1YHA A;  2YTX A;  3CCU A;  1PHJ A;  5M5X H;  2NVX H;  3CQZ H;  2A1A A;  3CME A;  1OTC A;  3PCO B;  5C44 H;  4IOC A;  3F2B A;  3CPW A;  4DV7 L;  1I5F A;  3I7F A;  1HZ9 A;  1Q1E A;  4BA1 I;  3T1Y L;  3A74 A;  5M5Y H;  3PUW A;  3M85 A;  3UDI A;  1D7Q A;  4X64 Q;  2B3G A;  4DPG A;  5IYB G;  3UDG A;  1PH8 A;  2JA8 G;  3J81 c;  3KDF A;  1PYS B;  2UXB L;  1YIT A;  3CC4 A;  4Y52 H;  3M7N A;  1RL2 A;  2Z6K C;  1P16 A;  5AJ3 Q;  1S72 A;  1N33 Q;  4K0K L;  2AKW B;  1SFO H;  4B3T L;  4QQB X;  3RNU A;  1YJN A;  4Y7N H;  2UXC Q;  4KHZ A;  4DR6 L;  1X3E A;  4A3D G;  2ZTC A;  3GTQ H;  2YTV A;  1VQ8 A;  1CSQ A;  5JJK A;  2ASB A;  4JI4 Q;  1G51 A;  4P75 A;  4JI5 Q;  1HNW L;  1V1Q A;  1R9T H;  3HOW H;  1XNR Q;  3HOY H;  1I50 H;  2BA0 A;  1WI5 A;  4GN3 B;  4LF9 Q;  3HOU G;  2KHJ A;  3TRE A;  4JI0 L;  3S1M H;  4NB3 A;  3HFZ B;  2RF4 A;  1UEB A;  2KEN A;  3CCV A;  2FXQ A;  4PZ7 A;  3PUX A;  3CCQ A;  1M1K C;  3RZD H;  4C3H H;  2L15 A;  4DUY L;  2R93 G;  4JBW A;  1FL0 A;  1LUZ A;  4RG1 A;  1L1O A;  4AQY Q;  4DV3 Q;  2F4V Q;  2RHQ B;  2OQK A;  1V43 A;  4JYA L;  1PH7 A;  3S2H H;  4JCV E;  3A5U A;  4DV6 L;  3H3V I;  2NZO A;  3M4P A;  3I4O A;  4TQU S;  4XTC S;  2ATW A;  3CC2 A;  3H0G G;  3J81 j;  1I94 Q;  2ZJP A;  1L0W A;  2HHH L;  2E2J H;  1X6O A;  1L2F A;  4HJ5 A;  5GAH C;  3S15 H;  5M3F H;  4DR3 Q;  1NMF A;  3RZO H;  3HOY G;  3BU2 A;  1QVC A;  2ALY B;  1AH9 A;  2BH2 A;  2HT1 A;  4DV2 Q;  1WYD A;  1E24 A;  2CWA A;  1XMQ L;  1E1T A;  1EOV A;  1MIU A;  3HKZ E;  4C2M H;  5FLM H;  1KIX A;  2IX1 A;  2GVB A;  3K7A H;  1HR0 Q;  4YCW A;  3PGZ A;  4LUV A;  4A93 H;  2ZTE A;  3OW2 A;  1IBK Q;  4PG3 A;  2UUC Q;  1IL2 A;  3RR5 A;  3G71 A;  1WJJ A;  1U5K A;  3T1H Q;  2YYZ A;  1HNZ Q;  4JI6 L;  3HOX G;  1Y1V H;  1VQN A;  4LFA L;  1N36 Q;  2UXC L;  4DR1 L;  2IY5 B;  4JI1 L;  2UUB Q;  2RCN A;  4WJ3 M;  3E0E A;  3GD7 A;  1OXX K;  3D0F A;  2F52 A;  5DLQ E;  2NN6 G;  4A3J H;  1PVO A;  1OXS C;  4DAM A;  1CKN A;  1VQ7 A;  1L1O C;  4JG2 A;  4DV1 Q;  5JJI A;  3FKI G;  1DGS A;  3RLF A;  1N34 L;  5GAE C;  1MJC A;  4JI3 L;  5IP7 G;  1B70 B;  3Q8D A;  1HZB A;  2QGQ A;  3NBH B;  2VQF L;  1Q8K A;  3CP0 A;  1GD7 A;  4LFC L;  5JEA G;  3TQY A;  4OO1 I;  4A3K G;  4IPD A;  3GTM H;  3ERS X;  3HKZ G;  4PZ6 A;  4BBR G;  2HIX A;  5LMN L;  1NTG A;  1XMO Q;  2Q2I A;  3G48 A;  1EUJ A;  2VQE L;  1S40 A;  3GDE A;  4A3G H;  5IT9 c;  2R7Z H;  1Y1V G;  3A0J A;  1EIF A;  1VQG A;  2VNU D;  4DV4 Q;  1WCM G;  5FJ8 G;  3CCE A;  3PF4 A;  1BKB A;  4GN4 B;  1TWC H;  3CCJ A;  4LF6 Q;  4YWK A;  3S1Q H;  4IOA A;  3PIO A;  3A5Z B;  4R4T A;  3NEN A;  1VQ6 A;  1K0R A;  1PH9 A;  2ES2 A;  2D62 A;  3J80 c;  5IE8 A;  4ALP A;  4X64 L;  2VW9 A;  3GTK H;  3FHW A;  1BBW A;  4A3E G;  5HGQ A;  5IYB H;  3TS0 A;  3S1R H;  2JA8 H;  2KCT A;  4HIM A;  1B7Y B;  3DM3 A;  5IP9 G;  1RIP A;  1L1O B;  3HKS A;  5AJ3 L;  1N33 L;  3CD6 A;  3AYH B;  3E9H A;  5IYC G;  1T9H A;  4YWL A;  5IYD G;  2N78 A;  5HY6 A;  2Q2T A;  1UE5 A;  3U4Z A;  3NEM A;  5GAD C;  1K73 C;  2K5H A;  5ELN A;  1CKM A;  4DK3 C;  1EWI A;  3I4M G;  4A3G G;  4EQ5 A;  1UE7 A;  1Q12 A;  4LUO A;  1VQP A;  2R7Z G;  4DR5 Q;  4BY7 G;  4A3D H;  1K3R A;  3CCM A;  1EYG A;  4JI5 L;  3UE1 A;  3W1G A;  1KRT A;  3J80 i;  1N8R C;  1SRU A;  1J6Q A;  3TEH B;  1XNR L;  4LF9 L;  1EFW A;  4O2D A;  3HOU H;  4LFA Q;  3ICE A;  2JA9 A;  2ZM6 Q;  4YY3 Q;  3PIP A;  2XTI A;  2ZTD A;  4LF4 Q;  4FDB A;  5GAG C;  3KJP A;  4KHP Q;  1TWA H;  3PSI A;  5C0X J;  3UE0 A;  1TWF H;  2Q2U A;  1KXL A;  4R1J A;  2DUD A;  2D0P A;  3K80 C;  1SRO A;  1BVS A;  1WFQ A;  3F2D A;  4DUZ Q;  2R93 H;  4B3S Q;  4WJ4 A;  3K8A A;  5M3M G;  5FLX c;  4DV3 L;  4AQY L;  3JAM c;  1C9O A;  1PH6 A;  2F4V L;  4DR7 Q;  4A3I H;  2VZA A;  5C0X I;  1CKN B;  3F2C A;  1E7Z A;  1Q7Y C;  1PV4 A;  3UDX A;  2PI2 E;  3HOZ G;  4JI7 Q;  1I94 L;  1PH4 A;  1M90 C;  3H0G H;  1Z47 A;  2IT1 A;  3K0X A;  3HOV H;  5IWA L;  2CKZ B;  3M4O H;  2EIF A;  4BXX G;  3KJO A;  1SLJ A;  1SE8 A;  2PQA A;  2WAQ E;  4DV0 Q;  4DR3 L;  4JI8 Q;  1HZC A;  1X3G A;  3RN5 A;  2KBN A;  3AFP A;  4GLA C;  4X62 Q;  2CFM A;  4DV2 L;  3J81 i;  4PZ8 A;  1A0I A;  4JBM A;  4GKK Q;  3BZC A;  1D8L A;  1HR0 L;  4QIW E;  3NEL A;  3JAM i;  1PH2 A;  1IBK L;  2UUC L;  1U0L A;  1TWG H;  3J7Z C;  1IXR A;  1AE3 A;  3PUV A;  1HNZ L;  1Q86 C;  1N36 L;  2ZJR A;  3HOX H;  3PV0 A;  2UUB L;  4A3I G;  4L5Q A;  4IFD J;  2PMZ E;  1FVI A;  2WP8 J;  2QEX A;  1XPR A;  1J5E Q;  2OCE A;  1Q46 A;  4DR4 Q;  3BZK A;  1QVG A;  2UXD Q;  4ME3 A;  4UP9 A;  4DV1 L;  4H02 A;  4A76 A;  5K36 G;  3S17 H;  2JEA I;  3HOV G;  4BBS H;  3CMA A;  4IFD I;  2MO0 A;  3AQQ A;  3FKI H;  4DNI A;  1GVP A;  4OWW B;  2WAQ G;  3S1N H;  4MNO A;  4P74 A;  3GO5 A;  2RHS B;  3M9B A;  5IP7 H;  2EXD A;  2YV5 A;  3G6E A;  3VDY A;  4NXM Q;  1QUQ A;  2LXK A;  5E7N A;  2UXB Q;  2K50 A;  1Q1B A;  4A3K H;  2HQL A;  2K5N A;  4BBR H;  1KL9 A;  2CQO A;  1XMO L;  2JA7 H;  1VQ9 A;  2PI2 A;  1VQL A;  2PNH A;  4DKA C;  1K8G A;  4LF8 Q;  3MEF A;  4JC0 A;  2GN5 A;  4DV5 Q;  3LGJ A;  5GQO A;  4DV4 L;  1IBL Q;  4JV5 Q;  1YJ9 A;  1WCM H;  2N49 A;  4LF6 L;  1HZA A;  4P72 A;  4R4C A;  3F1Z A;  3M4Q A;  5FJ8 H;  5C3E H;  3CF5 A;  1TWH H;  2JEB I;  1VQ4 A;  3PUZ A;  2CWP A;  1VQB A;  1ASY A;  3EIV A;  4BBS G;  5C4X G;  2Y0S E;  1OXT A;  3KF8 B;  4GNX A;  4A3E H;  5EAY A;  2OQ0 A;  1G29 1;  3WWV A;  4DR2 L;  2V1C C;  4X65 Q;  1QZG A;  4IJL A;  2R6G A;  4JBK A;  1QVF A;  5IP9 H;  1MJE A;  3OTO Q;  1I6H H;  4L5S A;  3L2P A;  1W3S A;  5IYC H;  3H15 A;  1IYJ B;  4P73 A;  3CCL A;  2JA7 G;  5IYD H;  1C0A A;  3UDF A;  4A3L G;  4A75 A;  1VQJ A;  1OXU A;  2E8G A;  1IZ6 A;  1A8V A;  1O7I A;  1SN8 A;  1UWV A;  5LMN W;  3AEV A;  4B3M Q;  4DR5 L;  3I4M H;  3KOJ A;  4BY7 H;  2CCZ A;  2PQA B;  4HJ7 A;  2H5X A;  5LMU Q;  5C3E G;  4EX5 A;  2VY3 A;  4JI2 Q;  3PO3 G;  4AYB E;  4IPC A;  2YU9 H;  2K75 A;  2MFI A;  3W5O A;  1Z9F A;  4YCV A;  3KYH C;  2ZM6 L;  2Y0S G;  3EN2 A;  4LF5 Q;  1VQA A;  4YY3 L;  4A3F G;  1Y14 B;  2A8V A;  4LF4 L;  4KHP L;  4A3B G;  3STB C;  4UY8 C;  1PH3 A;  1E1O A;  2B63 G;  3M3Y H;  4DUZ L;  4HID A;  2Q2H A;  1VQE A;  4GNX C;  1Q82 C;  1C7Y A;  4B3S L;  1Y1W G;  5M3M H;  4LF7 Q;  4C3I H;  1JT8 A;  1NBW A;  4OO1 G;  4IPH A;  2LSS A;  4IJH A;  1VS0 A;  4JI7 L;  1LM0 A;  2MO1 A;  3HOZ H;  3PO2 G;  1JMC A;  4B3R Q;  4HJ8 A;  5JJL A;  2UU9 L;  4JI4 L;  4LFB Q;  4GKJ Q;  1UE1 A;  1E22 A;  1KAW A;  4DV0 L;  4BXX H;  1CSP A;  4JI8 L;  3J7A 5;  1G6P A;  4LUZ A;  4AYB G;  1TXY A;  1QUQ B;  1YNX A;  4X62 L;  1VQD A;  4HIO A;  1N34 Q;  1KD1 C;  1X9N A;  4X6A H;  1YHQ A;  4HJA A;  2VQF Q;  4BA2 I;  1X54 A;  4HIK A;  4GKK L;  4LFC Q;  4YHH Q;  1PH1 A;  2OTJ A;  4IPG A;  3W1B A;  2QA4 A;  1KRS A;  2E5L Q;  2UU9 Q;  4BY1 H;  5LMN Q;  1Q81 C;  1FJG Q;  5ELO A;  4C3J H;  1K9M C;  4A3M G;  1JB7 A;  1HNX Q;  2NVT H;  1VQH A;  1YBY A;  2C35 B;  3I2Z A;  1EQR A;  1J5E L;  4DR4 L;  4GN5 A;  2UXD L;  2NVY H;  1JJ2 A;  2NZH A;  4GLX A;  4NXN Q;  1KHI A;  4GS3 A;  2KHI A;  3I4N H;  4A3C G;  1I3Q H;  1PA6 A;  4R4Q A;  1GO3 E;  2AMC B;  4GNX B;  1YEZ A;  3ER0 A;  5M5W H;  5BR8 Q;  2A19 A;  1IBM Q;  4NXM L;  4APV A;  3GTL H;  4OX9 Q;  2R92 H;  3K7U C;  1HH2 P;  1VQF A;  1VCI A;  4X66 Q;  1KC8 C;  1NE3 A;  4NPS A;  2UUA Q;  1XNQ Q;  3E9I A;  4OWX B;  1H95 A;  3ULJ A;  1UE6 A;  2VS1 A;  1S3O A;  4OON A;  4UP8 A;  1YHB A;  4AH6 A;  4GOP A;  1N32 Q;  3IRB A;  4PMW A;  1A63 A;  4BY1 G;  1EQQ A;  1HR0 W;  4MZ9 A;  4LF8 L;  4DV5 L;  3T1H L;  2VUM G;  3K81 C;  1LTL A;  1VQ5 A;  1PFS A;  1YIJ A;  1IBL L;  2OTL A;  4JV5 L;  1YZ6 A;  3PF5 A;  1PYB A;  4QJF A;  3S14 H;  2E2H H;  5H1S E;  4UP7 A;  3I4N G;  5C44 G;  3JC6 6;  1GM5 A;  2JA5 H;  5C0X G;  2I5L X;  4AIM A;  2BH8 A;  2D0O A;  5C4X H;  2WFW A;  1A62 A;  2GVA A;  1JJC B;  4DV7 Q;  3T1Y Q;  2N8N A;  1CKO A;  3H3V H;  1X65 A;  1SMX A;  2R7D A;  1YI2 A;  4TVA B;  3L7Z C;  4X65 L;  2AWO A;  1X55 A;  4KI0 A;  4A4I A;  2R92 G;  3ULP A;  1XPU A;  3OTO L;  1WOC A;  1V9P A;  2DGY A;  3GTG H;  1YVC A;  2KCM A;  4K0K Q;  2NN6 I;  3CXC A;  4A3L H;  1VQO A;  5C4J H;  3CCR A;  4L5T A;  4B3T Q;  4B3M L;  4LW1 A;  1B8A A;  2WB1 E;  3KFU A;  4NXN L;  2ID0 A;  4R4O A;  3KF6 A;  5JEA J;  3G4S A;  4DR6 Q;  5LMU L;  4GOP C;  1QZH A;  1EIY B;  4JI2 L;  2K14 A;  1JJG A;  1X56 A;  2NVQ H;  2B29 A;  2BA1 A;  4RMF A;  5IWA Q;  4QY7 A;  3STB D;  2ZJQ A;  3PO3 H;  2JA5 G;  1E3P A;  1YJW A;  3HOW G;  1HNW Q;  2YTY A;  4QGU A;  4LF5 L;  1XPO A;  2LXJ A;  3CPF A;  2AWN A;  3RLO A;  3MXN B;  3GTO H;  4A3F H;  1VQM A;  4JI0 Q;  1XTD A;  4JOI A;  2HIV A;  3ZJY C;  4IFD G;  5GRO A;  4A3B H;  2JJQ A;  2EQS A;  1PH5 A;  2B63 H;  4R4I A;  3F8T A;  2MQH A;  4DUY Q;  1Y1W H;  4LF7 L;  3S16 H;  3KLW A;  4POG A;  1SR3 A;  2JE6 I;  3EBE A;  2OWO A;  1GKH A;  4OXP A;  4HJ9 A;  4JYA Q;  4J15 A;  3TRZ A;  4B3R L;  2WB1 G;  3PO2 H;  4LNQ A;  3BJU A;  4DV6 Q;  1AE2 A;  4MTN A;  4GKJ L;  4LFB L;  1K8A C;  1XJV A;  3OYY A;  2F3I A;  2JA6 H;  2HHH Q;  2JQO A;  4POF A;  3KDF B;  5M3F G;  2K52 A;  1CUK A;  3S24 A;  2Z0S A;  3AFQ A;  1X3F A;  4DR1 Q;  1NY4 A;  4DAY B;  4DK6 C;  4GOP B;  4XIG S;  4YHH L;  1HJP A;  5FLM G;  3CCS A;  1XMQ Q;  4L5R C;  2IX0 A;  2E5L L;  1VQC A;  3I56 A;  3GTJ H;  3U58 A;  1ASZ A;  4LWC A;  2I5M X;  2K4K A;  1VQI A;  3RLN A;  4UPA A;  1FJG L;  3TS2 A;  1HNX L;  4A93 G;  1MKH A;  3D31 A;  4DR7 L;  3CAM A;  2K5V A;  4JOI C;  2JK8 A;  4KLK A;  4P71 A;  4A3M H;  2I5H A;  3U4V A;  4JI6 Q;  1BBU A;  4OWT B;  2I0Q A;  4JBJ A; 
#chains in the Genus database with same CATH topology
 1KQS A;  1K83 H;  3DLL A;  2L4N A;  4IAL A;  1W2B A;  2R7F A;  5BR8 L;  1R4P B;  4NP5 A;  2N3S A;  3QJY A;  2RA4 A;  4OX9 L;  2MNA A;  4JI3 Q;  4X66 L;  3NWS A;  4ZLT F;  2JN4 A;  2NVX B;  4XYQ A;  1LAB A;  1L0X B;  3GTP H;  3D6C A;  3CC7 A;  4U67 3;  2VUM H;  5M5Y B;  2LFN A;  1TVX A;  5M5X H;  1TWF B;  2A1A A;  3CME A;  1OTC A;  5C44 H;  5KGU A;  3F2B A;  3FDT A;  4DV7 L;  3I7F A;  4BA1 I;  2BDN A;  4J8Q A;  4JVZ A;  4Y7N B;  4X64 Q;  4ODG A;  3UDG A;  3NQT A;  1F9P A;  3H0G B;  1EY7 A;  2V4D A;  3CRL C;  3NBH A;  3PMF A;  1HFN A;  2Z6K C;  1N33 Q;  4K0K L;  1A3V A;  3BYY B;  4B3T L;  1PRT C;  1YJN A;  3HOY B;  4QUC A;  1FYC A;  3D8G A;  3GTQ H;  4F87 A;  1CSQ A;  2Z6B A;  1HHV A;  5I6Y A;  1TWG B;  3RZD B;  3I73 A;  1PFM A;  1LT6 D;  1KAB A;  3E3X A;  1I50 H;  1JWM D;  4LF9 Q;  3JAM L;  3HFZ B;  4IUQ A;  5C5L A;  2FXQ A;  1PZJ D;  1BO0 A;  1HUN A;  3FKI B;  2L15 A;  2C5C A;  1FL0 A;  4ZRZ A;  4RG1 A;  1CI3 M;  2F1M A;  4JYA L;  1V43 A;  3QIA A;  3R3O A;  4HSV A;  4JCV E;  3M4P A;  2ATW A;  4TQU S;  4XTC S;  4A3K B;  5A2Q E;  2B2W C;  5DAU A;  1XTC D;  1KAA A;  1KDB A;  3ERO A;  5M3F H;  1IW7 D;  1NMF A;  3AB9 A;  5CC4 A;  2B2Y A;  4FXG C;  3BDC A;  1AH9 A;  1SBB B;  2HT1 A;  1WCM B;  2A6E C;  1E24 A;  3QOL A;  4LK1 C;  1LTB D;  2IX1 A;  1KIX A;  2GVB A;  1KLG D;  2F0K A;  3OW2 A;  1B2T A;  3VYT A;  2YYZ A;  1HNZ Q;  1SSO A;  4K6L A;  2UXC L;  3DEP A;  3E0E A;  5DLQ E;  4JK1 C;  3MWY W;  1B53 A;  4DAM A;  4DA2 A;  1L1O C;  4DV1 Q;  1DGS A;  3RLF A;  1N34 L;  3LWU A;  4JI3 L;  1LT5 D;  3HG9 A;  4G57 A;  2F0T A;  3NBH B;  2R7Z B;  3CP0 A;  1I4R A;  4LFC L;  5C4Z A;  3TQY A;  2Q8R E;  1FD7 D;  3HKZ G;  4BBR G;  2L11 A;  2HIX A;  3TN2 A;  1XMO Q;  2YU9 B;  1VDZ A;  3H94 A;  1IL8 A;  1S40 A;  3J81 E;  1HQR D;  2I46 A;  1Y1V G;  4ZKC B;  2K1B A;  4DV4 Q;  4HTH A;  3PF4 A;  1EEF D;  1BKB A;  4GN4 B;  1TWC H;  2KEC A;  4IOA A;  4YWK A;  3M3Y B;  1PFB A;  1GUT A;  1PH9 A;  1U9R A;  4X64 L;  2KA7 A;  3GTK H;  1PRT D;  2F0Q A;  3HOZ B;  1Z6H A;  2B2U C;  2J7Z A;  2JA8 H;  5CV5 A;  2QF7 A;  2KCT A;  3DM3 A;  5EBD A;  2CH4 A;  1N33 L;  3CD6 A;  3WDN A;  3E9H A;  1G8Z D;  5D14 A;  1O7L A;  2Q2T A;  3U4Z A;  2K5H A;  5ELN A;  4PNY A;  3I4M G;  4A3G G;  4EQ5 A;  4BY7 G;  1Q12 A;  4LUO A;  1VQP A;  3J7A F;  4FXD A;  1SYE A;  3HZX A;  1K3R A;  2E74 C;  3SK8 A;  1EYG A;  3UE1 A;  3J80 i;  1A6X A;  1SRU A;  1J6Q A;  1HUM A;  2AQ3 B;  4LF9 L;  2NVT B;  3TP6 A;  2JA9 A;  5HUR A;  5CV9 A;  3CRK C;  3KF8 A;  4FDB A;  5GAG C;  4LF4 Q;  1TKW B;  5IGB A;  4ZQ3 A;  2DUD A;  3A8K E;  3K8A A;  2NBF A;  5FLX c;  3E5S A;  1UNS A;  3GQB A;  1IYV A;  2B2T C;  2P5Z X;  1PV4 A;  1WTV A;  2A6E D;  4NMZ A;  3BVM A;  4BXX G;  1SE8 A;  2B8G A;  4HCS A;  1AZP A;  2R61 A;  4JI8 Q;  2KBN A;  4KK7 A;  4GLA C;  3SE0 A;  4X62 Q;  3J81 i;  4N9P A;  2CW0 C;  4QF4 A;  1QOH A;  3T4A C;  1RTN A;  5C4H A;  3C2P A;  1D8L A;  4QIW E;  1NCV A;  4J6H A;  1AW7 A;  4QMG A;  1A2U A;  1IXR A;  2A74 C;  1AE3 A;  3J7Z C;  1HNZ L;  1Q86 C;  4A3I G;  4L5Q A;  2WP8 J;  5I2X A;  1PTO F;  4DR4 Q;  1QVG A;  2UXD Q;  4DV1 L;  4A76 A;  3DWP A;  3S17 H;  4BBS H;  3CMA A;  4IFD I;  3AQQ A;  4DNI A;  1GVP A;  2WAQ G;  4P74 A;  4B9W A;  1ENA A;  3M9B A;  2EXD A;  5IP7 H;  3G6E A;  3VDY A;  3AU7 A;  4LAA A;  3NQI A;  2LXK A;  3K5N A;  2F0G A;  2UXB Q;  2HQL A;  1XMO L;  1J8I A;  1VQL A;  2N55 A;  2KEE A;  1LAC A;  2B2V A;  4DV4 L;  1IBL Q;  4JV5 Q;  2N49 A;  5C3E H;  5EBC A;  2PYK A;  2RSO A;  1Y1W B;  4EGV A;  1CZW A;  1ASY A;  1KDC A;  4RCO A;  3KF8 B;  5F2D A;  1CZG A;  2OQ0 A;  4BY7 B;  3PO2 B;  4DR2 L;  1PTO B;  1KTK A;  4IJL A;  3OSO A;  1GUW A;  1NR4 A;  2JXM B;  1ET6 A;  1D2B A;  4P73 A;  1F9Q A;  2KCN A;  5EJW A;  1VQJ A;  3EQL C;  4IUV A;  1W6K A;  2E8G A;  3NP8 A;  1UWV A;  3QG1 A;  2CCZ A;  5LMU Q;  1QNU A;  5CV6 A;  2VY3 A;  3JAM E;  3PO3 G;  4AYB E;  2MFI A;  3KYH C;  3K59 A;  1E2Z A;  1UAP A;  2O4X A;  2A8V A;  4LF4 L;  1I4H A;  3SR1 A;  4A3B G;  3TSS A;  2B63 G;  1VQE A;  5IGG A;  2F0J A;  1Q82 C;  4C3I H;  1NBW A;  4CDF C;  5COR A;  1LM0 A;  4RGN A;  2RKS A;  2CW0 D;  2HD3 A;  4FF3 A;  3GTP B;  4JI4 L;  4LFB Q;  5EPK A;  4BY1 B;  1ENC A;  4JI8 L;  3D4D A;  2VUM B;  1C48 A;  2WKC A;  1K8O A;  4LUZ A;  4X62 L;  1TXY A;  1CHQ D;  1EL0 A;  4EQP A;  4HJA A;  1WTW A;  1TT2 A;  3PIO 3;  4HIK A;  3UI2 A;  4KMU C;  4CGY B;  1D6E C;  2OT2 A;  3U9O A;  5C44 B;  3OIQ A;  1HTL D;  2K6A A;  4IPG A;  3V05 A;  1FJG Q;  3NE5 B;  5JPN C;  3HRZ C;  4A3M G;  5J22 A;  3MFY A;  1LV9 A;  3NK9 A;  4KKU A;  3EJI A;  4DR4 L;  4ZAI A;  2UXD L;  2NVY H;  1BBX C;  4A3C G;  3FVQ A;  1GO3 E;  1CQF A;  5M5W H;  1TS5 A;  4S3S A;  3W2D A;  1IBM Q;  4CKB A;  3GTQ B;  1VCI A;  1NE3 A;  4NPS A;  2UUA Q;  1XNQ Q;  2PZT A;  3E9I A;  2KCC A;  1UE6 A;  3MC0 B;  1S3O A;  4UP8 A;  4XT3 B;  4AH6 A;  2JA5 B;  2HUG A;  1S4Z A;  3D6W A;  2ENB A;  5ELE A;  3TBI B;  3K81 C;  3PIP 3;  1IBL L;  4JV5 L;  1YZ6 A;  3PF5 A;  4QJF A;  1EIG A;  1HA5 A;  3SEB A;  4EQO A;  2E2H H;  4I65 A;  4IUP A;  2EY1 A;  2AQ1 B;  2I5L X;  4AIM A;  2WFW A;  3T1Y Q;  4IN3 A;  3TP5 A;  1CKO A;  5IGD A;  1EY4 A;  1K0S A;  2G9H D;  3L7Z C;  1X55 A;  2PNR C;  2R92 G;  3TZU A;  1XPU A;  1A3U A;  5E1F A;  2NVQ B;  3Q23 A;  3GTG H;  3PO3 B;  2NZ1 D;  3GV3 A;  5M9O A;  2KCM A;  5M3F B;  2NN6 I;  1VQO A;  4L5T A;  1RHP A;  1WTQ A;  5KND A;  5J39 A;  5LMU L;  4GOP C;  1KLU D;  4F8M A;  1HNW Q;  2YTY A;  3P7J A;  2EJG C;  2M2L A;  1LT4 D;  3ZJY C;  4IFD G;  2H1E A;  2BCO A;  2PW7 A;  4TKO B;  2JA6 B;  1ILQ A;  1G2S A;  2M00 A;  4HJ9 A;  4NW2 A;  3TRZ A;  4LFB L;  2PZU A;  3L9A X;  3OYY A;  2GA4 B;  2JQO A;  1MGS A;  3KBG A;  3KDF B;  1CTM A;  2K52 A;  2NB0 A;  3TP8 A;  2Z0S A;  3AFQ A;  1X3F A;  1RCV D;  1OO9 B;  5E4W C;  3T13 A;  1VQC A;  3I56 A;  1FJG L;  1VQI A;  4K14 A;  3TS2 A;  2AUK A;  1KNA A;  1MKH A;  2ICE C;  3ITP A;  4CDC C;  3GTK B;  5CR3 A;  4FXK C;  3U4V A;  4DGZ A;  2Z4H A;  3TP7 A;  4JI6 Q;  1G6Z A;  2JA8 B;  3NWT A;  4LFA Q;  4ZYS A;  2I0Q A;  5J3B A;  1VQK A;  4DFA A;  1D5X C;  1ZEQ X;  1CM9 A;  1OXV A;  1IBM L;  1DCZ A;  3U50 C;  1EEI D;  4IO9 A;  2KED A;  4ZUJ A;  1AFP A;  1G2T A;  1XNQ L;  2UUA L;  4YWM A;  3SGI A;  1N9W A;  3IAY A;  1S5E D;  3MXN A;  1E2V A;  1FGU A;  1LLR D;  1LYL A;  3J80 L;  4KHV A;  4BWG B;  4UAI A;  1PHJ A;  4HED A;  3PCO B;  3VR3 A;  4IOC A;  5C0X H;  1A3T A;  1I5F A;  3T1Y L;  1SND A;  3PUW A;  1D7Q A;  4X3U A;  3J81 c;  3H09 A;  1O80 A;  1WD1 A;  1SFO H;  4RA8 A;  2SNM A;  3A8J E;  3S1M B;  3FPP A;  1VQ8 A;  1ILP A;  1ONL A;  2FFK B;  3J81 L;  3BZD B;  1HNW L;  1ESF A;  1R9T H;  3HOW H;  5FOB B;  2KHJ A;  5FO8 B;  3DXJ C;  1FNW A;  1H9M A;  3S2H B;  1H9S A;  1MHW C;  2KEN A;  3CCV A;  1B3A A;  3CCQ A;  4KY6 A;  3S9W A;  4C3H H;  2E2J B;  4AQY Q;  4DV3 Q;  2RHQ B;  2OQK A;  1PH7 A;  5FO7 B;  1MD2 D;  3A5U A;  3H3V I;  3I4O A;  1STA A;  3H0G G;  1EZ8 A;  3J81 j;  2ZJP A;  3M4Y A;  3K7A B;  1LTT D;  2VXW A;  4HJ5 A;  1L2F A;  5GAH C;  1E0B A;  3HOY G;  3FRP B;  2ALY B;  2KOL A;  4Q0F A;  4DXG A;  5LL6 X;  4DV2 Q;  1S5D D;  5IIF A;  2RBM A;  2CWA A;  1MIU A;  3HKZ E;  2L5T A;  1HFG A;  3PGZ A;  4A93 H;  2A69 C;  2ZTE A;  4PG3 A;  1WJJ A;  4H44 C;  3T1H Q;  4JI6 L;  1Y1V H;  4LFA L;  4ULL A;  1SYF A;  4WJ3 M;  1JOQ A;  2F52 A;  1SE4 A;  2NN6 G;  3NUC A;  4A3J H;  1PVO A;  1CKN A;  3FKI G;  3VR5 A;  1D1K A;  3X3N A;  2PQE A;  1STH A;  2K04 A;  4A3K G;  3GTM H;  4OGQ C;  1F2Y A;  1BCP C;  3QWN A;  4CBV A;  2DY8 A;  1SJH D;  1C8C A;  4A3G H;  3A0J A;  5E3F A;  4EQN A;  1WTP A;  1WCM G;  2XRS D;  1SDF A;  2K5Q A;  2XWJ B;  2R3Z A;  5FJ8 G;  3FPU B;  3CCE A;  4LF6 Q;  4HR7 B;  5T1I A;  3PIO A;  3A5Z B;  4RH6 A;  3E6Z X;  1X3P A;  1VQ6 A;  1K0R A;  1H9S B;  1B3Q A;  4NKL A;  1QWY A;  2EY2 A;  1BBW A;  5IYB H;  3TS0 A;  3S1R H;  4U68 A;  5IP9 G;  5IYC G;  1PMR A;  3NTI A;  5FKA C;  1UE5 A;  5GAD C;  3NEM A;  1EWI A;  2R7Z G;  4A3D H;  3TEH B;  3K6O A;  5ELB A;  3HOU H;  3HS0 C;  1JWU D;  3PIP A;  2ZTD A;  4KHP Q;  1TWA H;  3LNN A;  5M5W B;  3HOV B;  1KXL A;  4R1J A;  2R93 H;  4WJ4 A;  1WFQ A;  2MPM A;  1PYW D;  4B3S Q;  4AQY L;  4DV3 L;  4DR7 Q;  3JAM c;  3KUP A;  4A3I H;  1CKN B;  3K5O A;  4N8F A;  1Q7Y C;  4IUR A;  3HOZ G;  1EYC A;  1M90 C;  2SDF A;  2IT1 A;  3K0X A;  2QCP X;  5IWA L;  3DM1 A;  3KJO A;  2WAQ E;  2X6L A;  1X3G A;  2A69 D;  3N6R A;  4OHJ A;  2L55 A;  4ABN A;  4DV2 L;  4PZ8 A;  3Q6S A;  2PO4 A;  1DOM A;  4B08 A;  4KKS A;  4C3J G;  2M9V A;  2ZJR A;  1IHZ A;  3PV0 A;  3HOX H;  4IFD J;  2PMZ E;  1V8Q A;  2QEX A;  3IFD A;  3N52 A;  4RWS C;  3GTG B;  3VYU A;  2F0I A;  4MN3 A;  2MO0 A;  3KK7 A;  2JA7 B;  1BCP D;  1SMY C;  1MSG A;  4OWW B;  3S1N H;  4MNO A;  3GO5 A;  4NXM Q;  2YV5 A;  1SJE D;  4IZ8 A;  1QUQ A;  4R9W A;  3T53 B;  1SNO A;  5JEA H;  2K50 A;  1Q1B A;  4CKE A;  2K5N A;  3J80 E;  1KL9 A;  3OOC A;  1VQ9 A;  2KHS A;  3C3L A;  2NTS A;  1VF5 C;  2F3V A;  2PNH A;  2Y0S B;  3MEF A;  5BN5 A;  2GN5 A;  4DV5 Q;  1F9R A;  4OEL B;  1YJ9 A;  1EWC A;  4LF6 L;  5D3D A;  1KDA A;  4K2L A;  4OL7 A;  1I6H B;  1TWH H;  1ESR A;  4FO2 A;  1F2Z A;  1YNJ C;  3EIV A;  1JQY D;  4FF1 A;  4GNX A;  5EKI A;  2J0T D;  4K8J A;  5L37 A;  1EYD A;  4A3E H;  1TII D;  1JWS D;  1G29 1;  2V1C C;  1QZG A;  2JSO A;  1QVF A;  1MJE A;  3OTO Q;  2ZXR A;  3L2P A;  2K01 A;  2F0L A;  5IYD H;  1W6J A;  3OMC A;  5D3I B;  5ISR A;  1F2L A;  1BDO A;  1STN A;  1ENF A;  1LTR D;  4CJ2 C;  3IL8 A;  4HJ7 A;  4JI2 Q;  2DN8 A;  4XQQ A;  1MBY A;  4IPC A;  2K75 A;  4YCV A;  4LF5 Q;  2BDO A;  4G7H C;  3MHB A;  4KHP L;  4K5W A;  4IUU A;  4UY8 C;  4HID A;  2Q2H A;  4B3S L;  5JJZ A;  1Y1W G;  5M3M H;  3QOJ A;  4N8X 1;  1JT8 A;  3MFG A;  5CBA E;  2OEO A;  1F2M A;  2LSS A;  4IPH A;  2BOS A;  5G3L D;  1E2W A;  1SYG A;  3PO2 G;  4GKJ Q;  2X6G A;  1CSP A;  4KJN A;  3J7A 5;  1RJT A;  4C3J B;  1QUQ B;  4WRD A;  1VQD A;  2SNS A;  1U4M A;  1Z7T A;  4ILW A;  1TU2 B;  2VQF Q;  1X54 A;  5DM7 3;  3I4N B;  1JOK A;  2F4I A;  4YHH Q;  4OIJ A;  2UU9 Q;  5LMN Q;  1Q81 C;  1DOL A;  5ELO A;  2H4O A;  3GTL B;  5JOB A;  1SMY D;  1YBY A;  2C35 B;  3I2Z A;  4RAU C;  1Q90 A;  4GN5 A;  4I7A A;  2NZH A;  4DK0 A;  2XRQ D;  3BS1 A;  1PA6 A;  4HMI A;  5K36 H;  2AMC B;  3I72 A;  2Q8I B;  1YEZ A;  4GNX B;  4DXF A;  1XYI A;  2XSC A;  2F0V A;  4LJZ C;  4H13 C;  3K5M A;  4NXM L;  2R92 H;  3K7U C;  1KC8 C;  4OON A;  3HOW B;  5J1Z A;  4BY1 G;  3K5L A;  1VMC A;  1BR9 A;  2VUM G;  4DV5 L;  1EY5 A;  4G7Z C;  1YNJ D;  1Q8I A;  1FNV A;  1PYB A;  4DNT B;  5I6W A;  5JAV A;  5DNF A;  4UP7 A;  3RUZ A;  4C3H B;  5C44 G;  4WFN 3;  4RKL A;  3JC6 6;  1GM5 A;  2LMC B;  2BH8 A;  1EFI D;  5C4X H;  2K7V A;  2EJM A;  1SMX A;  3MEH A;  1YI2 A;  4RKB A;  2WB1 B;  4C56 C;  1B1Z A;  4A4I A;  1G91 A;  1GHK A;  1MI2 A;  3OTO L;  1WOC A;  2E76 C;  2IX3 A;  1HTP A;  3CXC A;  4A3L H;  5IOC A;  3K58 A;  2MHV A;  2EZV A;  1BUV T;  4LW1 A;  4X3K A;  3GTO B;  2ID0 A;  3KF6 A;  3NSW A;  3G4S A;  4DR6 Q;  1EIY B;  4JI2 L;  1ROD A;  1AZQ A;  4FF2 A;  2EYO A;  4A93 B;  1GJX A;  2JA5 G;  1Q3L A;  3S16 B;  4LF5 L;  1XPO A;  3RLO A;  1IKM A;  4A3F H;  1VQM A;  4JI0 Q;  4A3J B;  4DN4 M;  2LKV A;  1SYD A;  1T5X D;  5EPL A;  4DUY Q;  2ZT9 C;  4OO1 H;  3DUZ A;  4K2K A;  4J15 A;  3I8Z A;  5CV4 A;  3OMG A;  4Z9C B;  4DV6 Q;  1AE2 A;  2D9U A;  2TMP A;  3GTM B;  4GKJ L;  4HN7 A;  4XT1 B;  2F3I A;  5K5P A;  2EY6 A;  5M3F G;  1QCB D;  2SOB A;  2WKD A;  4DAY B;  1IKL A;  1JOO A;  5EPJ A;  4YHH L;  1HJP A;  1K83 B;  4O42 A;  5ELC A;  5BN4 A;  3CCS A;  4X3T A;  1XMQ Q;  2UU9 L;  4L5R C;  3CHB D;  3GTJ H;  2TSS A;  3RLN A;  2K4K A;  1Y69 U;  2Z8L A;  4JOI C;  2JK8 A;  4P71 A;  3S1R B;  4PMC A;  1BBU A;  4OWT B;  3TZD A;  2AQ2 B;  3FP9 A;  2IHF A;  3RN2 A;  2K5D A;  4ME5 A;  2AHO B;  1ZXT A;  4O0A A;  2JA6 G;  3I55 A;  1B9N A;  2Z6K A;  4XXE A;  3ULL A;  2E2I H;  3MZ5 A;  4GLV B;  4A3D B;  1LTI D;  2XGT A;  5IT9 L;  5M5X B;  5ELF A;  1EY6 A;  1HCZ A;  1P8L A;  5FO9 B;  1GUS A;  2BE5 C;  3HOU B;  2FMC A;  3KF6 B;  4MHE A;  3Q24 A;  2VQE Q;  3PUY A;  4L8J A;  2YTX A;  3CCU A;  2NVX H;  2QDL A;  5EKL A;  1HA6 A;  2R93 B;  4BS9 A;  3CPW A;  1ICW A;  1M8A A;  4QB4 A;  1NUC A;  2NTT A;  5M5Y H;  3M85 A;  4KV6 A;  1D5M C;  1GUN A;  2B3G A;  2XNA C;  2JA8 G;  3KDF A;  2UXB L;  1YIT A;  3M7N A;  1P16 A;  2Z9H A;  1PRT F;  5ELD A;  4QQB X;  2B2W A;  3RNU A;  1I50 B;  4Y7N H;  1SEB D;  2WIN B;  4DR6 L;  5IOD A;  1G51 A;  4P75 A;  4JI5 Q;  1V1Q A;  4K8I A;  2RDF A;  4KKT A;  3HOY H;  3KLR A;  2BA0 A;  1WI5 A;  4GN3 B;  3HOX B;  4JI0 L;  4NB3 A;  2EYJ A;  2EJF C;  3VYR A;  3PUX A;  4KN7 C;  3MXP A;  3RZD H;  4DUY L;  4JBW A;  1LUZ A;  4E6I A;  1L1O A;  1JC7 A;  5LHY 1;  4RGT A;  1STG A;  4DAP A;  4DV6 L;  5KIX A;  1I94 Q;  2EE1 A;  3D4W A;  1L0W A;  3MXU A;  5IGC A;  1ZYR C;  1PRT B;  3DWA A;  4X3S A;  3J7Y W;  4DR3 Q;  3RZO H;  1PZK D;  3BU2 A;  1JIC A;  4KN4 C;  1M4V A;  1WYD A;  1XMQ L;  1E1T A;  4C2M H;  5FLM H;  1TWH B;  3MTS A;  5I4D A;  5BN3 A;  1IL2 A;  1FNU A;  3RR5 A;  2K5W A;  1GXD C;  1U5K A;  3P1H A;  1S5C D;  4A3E B;  1N36 Q;  4O1N A;  4FF4 A;  3D0F A;  1OXS C;  4HAE A;  2B2U A;  5JJI A;  5JVH 3;  1MJC A;  2BE5 D;  5IP7 G;  1HZB A;  2QGQ A;  1Q8K A;  1AEX A;  1GD7 A;  3WOF A;  1TWC B;  1WVL A;  3V96 A;  4IPD A;  4PZ6 A;  1TS3 A;  2B2Y C;  2Q2I A;  3G48 A;  1FR3 A;  4CJ1 B;  5KRU A;  2VQE L;  2R7Z H;  2A73 B;  2IPK D;  4RHS A;  1DM0 B;  2VNU D;  1F9S A;  4R4T A;  3NEN A;  4TRD A;  2ZXO A;  5M3M B;  1EQV A;  3MXG A;  3HP3 A;  3J80 c;  4ALP A;  2VW9 A;  3FHW A;  2KJX A;  2ICI A;  4WOR A;  4HIM A;  2B2T A;  2QIL A;  3HKS A;  1L1O B;  1D5Z C;  3AYH B;  3SK6 A;  1T9H A;  4YWL A;  1RKN A;  2EPB A;  5HY6 A;  2EY5 A;  4P2C B;  4DR5 Q;  3BVZ A;  4JI5 L;  3W3A A;  1KRT A;  3W1G A;  1N8R C;  4DNR B;  4M1U B;  3AMU A;  1U4L A;  4O2D A;  1Y8P B;  2CH4 W;  3ICE A;  2QKI C;  5KNB A;  2XTI A;  3KJP A;  2QEJ C;  2NUC A;  3CU7 A;  3UE0 A;  2Q2U A;  3OW7 A;  2D0P A;  3K80 C;  1SRO A;  1BVS A;  3F2D A;  1PH6 A;  4C3I G;  3K57 A;  2VZA A;  1ZYR D;  1STE A;  5C0X I;  1I94 L;  1PH4 A;  1NAP A;  1Z47 A;  3M4O H;  4QIW B;  1XX8 A;  3GV6 A;  4DR3 L;  1HZC A;  3RN5 A;  2EVB A;  5DEH A;  3AFP A;  3MAQ A;  2CFM A;  5CV7 A;  1BNZ A;  1CK1 A;  1HXY D;  4JBM A;  4GKK Q;  1TY0 A;  3NEL A;  1PH2 A;  3S17 B;  1U0L A;  3Q22 A;  4BBS B;  5C4X B;  1DOK A;  2VB3 X;  3C1F A;  2WV6 D;  1N36 L;  1SXT A;  1XPR A;  1FVI A;  2OCE A;  3BZK A;  1PTO C;  4ME3 A;  1NSN S;  1RDP D;  2JEA I;  4H7B A;  5A35 A;  3HOV G;  5IT9 E;  3ND8 A;  1TS4 A;  2F0S A;  3E0J A;  2AUJ D;  2DNE A;  2F0H A;  1EWH A;  1V1O A;  2O2L D;  5E7N A;  5C3E B;  1I4P A;  4BBR H;  1SE3 A;  2CQO A;  2KVM A;  2A68 C;  1GUG A;  3SXH A;  2PI2 A;  2OF1 A;  3VYS A;  4DKA C;  2F0U A;  1K8G A;  4JC0 A;  4A3F B;  5GQO A;  2Z4I A;  1ICF B;  1HZA A;  4P72 A;  2F0E A;  3M4Q A;  4R4C A;  2Q8T A;  2HCI A;  3CF5 A;  2DJF C;  1B50 A;  3EVQ A;  1XXG A;  2CWP A;  1VQB A;  3URY A;  2C9O A;  3WWV A;  5KYI A;  2CHB D;  1TY2 A;  3M7G A;  2WAC A;  4L6T B;  1EQT A;  1QJO A;  3I3C A;  2ZXP A;  4KD3 A;  5TSS A;  4AYB B;  2JA7 G;  2FJ2 A;  3UDF A;  5FK9 C;  1BQQ T;  2X69 A;  3VA7 A;  1SN8 A;  4XDX A;  3AEV A;  4B3M Q;  4DR5 L;  3I4M H;  4BY7 H;  1GHJ A;  2KQ3 A;  3KBX A;  1WTX A;  2B2V C;  4GZY C;  4C3I B;  1YNN C;  1Z9F A;  2Y0S G;  3EN2 A;  3OIP A;  4FNF A;  4XQJ A;  1JE4 A;  4G4K A;  3STB C;  1E1O A;  1WTH A;  4LF7 Q;  2EYF A;  2RCF A;  1VS0 A;  4CHT B;  2MO1 A;  4JW0 A;  1JMC A;  4HJ8 A;  4B3R Q;  5JJL A;  1GUO A;  3SDZ A;  4BXX H;  1KAW A;  4KJO A;  1AN8 A;  1N34 Q;  1YNX A;  4HIO A;  1X9N A;  1PLF A;  3VA5 A;  4BA2 I;  4GKK L;  4TSS A;  2NVY B;  4LFC Q;  1QG7 A;  1HQM C;  3P20 A;  1PH1 A;  2OTJ A;  4F88 A;  1PTO D;  1KRS A;  1ZKO A;  2E5L Q;  4BY1 H;  1O7Z A;  1K9M C;  1JB7 A;  3IFT A;  1S5B D;  3OWE B;  1JJ2 A;  1KHI A;  1NR2 A;  2KHI A;  4GS3 A;  1I3Q H;  5NUC A;  3NTK A;  3ER0 A;  2HDM A;  2L9H A;  2A68 D;  2EYP A;  1TR5 A;  2DY7 A;  2E2H B;  5CGK A;  1H95 A;  4OWX B;  3ULJ A;  1F77 A;  2VS1 A;  4DK1 A;  4GOP A;  1AP0 A;  1YHB A;  1N32 Q;  3IRB A;  2B8F A;  2J4X A;  3A8I E;  4PMW A;  1EQQ A;  3T1H L;  1PFS A;  5IGE A;  1YIJ A;  3S14 H;  3VR6 A;  3P75 A;  5CMD A;  5H1S E;  3I4N G;  2JA5 H;  1SNC A;  5C0X G;  1PDQ A;  1X32 A;  2D0O A;  1C0A A;  1O7Y A;  1JJC B;  1DD2 A;  2R7D A;  2WII B;  5D65 A;  1EY9 A;  4KI0 A;  3V2T A;  1V9P A;  2DGY A;  1YVC A;  1PXU A;  3DEO A;  3RZO B;  5C4J H;  2F3W A;  1PFN A;  3QO2 A;  4B3M L;  4K5V A;  1YNN D;  2KUM A;  4R4O A;  4LMQ D;  4C2M B;  1QZH A;  5C3W A;  4HCE A;  3OPO A;  1XWE A;  1X56 A;  2NVQ H;  1JJG A;  1I4G A;  4RMF A;  4QY7 A;  3STB D;  3PO3 H;  1SNP A;  1E3P A;  5KNC A;  3HOW G;  3BYT B;  1BOS A;  4V19 0;  1QE6 A;  2LS0 1;  2AWN A;  5AFW A;  1XTD A;  4A3B H;  1LT3 D;  3A7L A;  2JJQ A;  2EQS A;  1PH5 A;  5DM6 3;  2B63 H;  2PZW A;  3F8T A;  4C3H G;  2MQH A;  2B39 A;  4LF7 L;  3RD4 A;  4POG A;  1O78 A;  2JE6 I;  2JP1 A;  3SK5 A;  1GKH A;  2F0P A;  4OXP A;  4NDX A;  1SNM A;  1D1I A;  4B3R L;  2WB1 G;  4FP5 D;  1K8A C;  1XJV A;  1ET9 A;  1TS2 A;  2O5I C;  2JA6 H;  2HHH Q;  4POF A;  3A56 A;  3T51 B;  1CUK A;  4MTK A;  4XQN A;  1NY4 A;  4DK6 C;  4GOP B;  4C1N K;  4XIG S;  2E5L L;  4Y52 H;  4LWC A;  2I5M X;  4A93 G;  4DR7 L;  2F0F A;  4KLK A;  4A3M H;  1Y8N B;  2I5H A;  3TDQ A;  3HGB A;  4JBJ A;  2IWH A;  4DR1 Q;  4JI1 Q;  3L0O A;  4B9X A;  4A3J G;  1NMG A;  4A3C H;  3S2D H;  1NJI C;  3U9S A;  2E75 C;  1JE5 A;  2VL6 A;  1UUP A;  2FMM A;  4DR2 Q;  3B6Y A;  3CW2 C;  2RDG A;  5IY0 A;  1N32 L;  4YCU A;  1CA6 A;  4QL5 A;  1V1P A;  1SE2 A;  3L3O C;  2DJG C;  2IHE A;  1YHA A;  4YIJ A;  2L12 A;  2RVL A;  3MA2 B;  3R2T A;  3CQZ H;  1IYU A;  4I7Z C;  2L0C A;  4K6D A;  2A6H C;  3WOE A;  1HZ9 A;  1Q1E A;  5KYL A;  1SFO B;  3A74 A;  3OWF A;  1VMP A;  2JYO A;  3UDI A;  3NTH A;  4DPG A;  5IYB G;  1PH8 A;  1PYS B;  3M4O B;  3CC4 A;  2VB2 X;  1RL2 A;  5AJ3 Q;  1S72 A;  4DAY A;  2AKW B;  1R9T B;  2F0M A;  3BDO A;  4H0L C;  4PQX A;  4KHZ A;  1X3E A;  4A3D G;  2ZTC A;  3LX0 A;  2YTV A;  5JJK A;  2ASB A;  1U4P A;  4JI4 Q;  3F2U A;  1XNR Q;  3HOU G;  3TRE A;  5FLX L;  2OXP A;  3MVV A;  3S1M H;  2RF4 A;  4IFD H;  1UEB A;  5KEE A;  1CT1 D;  2Z1C A;  4PZ7 A;  4XYO A;  1M1K C;  3I90 A;  1VF7 A;  2R93 G;  1K8M A;  3G7L A;  4OIK A;  3BVG A;  2F4V Q;  4F7X A;  3GP7 A;  3R2I A;  4RCN A;  5I2Y A;  2K05 A;  3S2H H;  4FYD A;  5E4X A;  3FEW X;  2NZO A;  2EYL A;  3SK4 A;  3CC2 A;  3HKZ B;  4BBR B;  1H9J A;  2HHH L;  4UDU C;  2E2J H;  1X6O A;  1DJR D;  3S15 H;  1HPC A;  1EY0 A;  1QNK A;  1BF4 A;  4PMB A;  2XIW A;  1QVC A;  1Y1V B;  3KLS X;  4IUT A;  2BH2 A;  1EOV A;  4ZUI A;  1CHP D;  1V1P B;  3K7A H;  1HR0 Q;  4YCW A;  4LUV A;  1EZ6 A;  2E2D C;  1IBK Q;  2UUC Q;  2D2C C;  1JR0 D;  3G71 A;  1VQN A;  2K32 A;  3HOX G;  4ZK9 B;  2IY5 B;  4DR1 L;  3ZYY X;  4JI1 L;  2FHT A;  3RMH A;  2UUB Q;  2RCN A;  3GD7 A;  1OXX K;  2N88 A;  1VQ7 A;  4JG2 A;  1X3Q A;  5GAE C;  1B70 B;  3Q8D A;  3DWQ A;  3I4M B;  4A3G B;  4DAV A;  2IL8 A;  2VQF L;  3C1E A;  4JPB W;  5JEA G;  4OO1 I;  1BCP F;  3ERS X;  3NXW A;  4CDE C;  1RD9 D;  5LMN L;  3SHL A;  1DYQ A;  1NTG A;  4DF7 A;  5C6A A;  1EUJ A;  2A6H D;  3KLS A;  3GDE A;  3R8B A;  3OHX C;  4KY5 A;  5IT9 c;  1EIF A;  1VQG A;  2RDH A;  1H9R A;  3CCJ A;  2MUY A;  3S1Q H;  3SVM A;  4G7O C;  1STB A;  3BG3 A;  1DXM A;  3ERQ A;  4CJ0 B;  2ES2 A;  2D62 A;  5IE8 A;  3ND9 A;  1B9M A;  4A3E G;  2CQA A;  5HGQ A;  3EFX D;  1Y8O B;  2G5D A;  1B7Y B;  1RIP A;  5AJ3 L;  2XVS A;  2DNC A;  3EA6 A;  5IYD G;  2N78 A;  5C5M A;  3I91 A;  1K73 C;  1HRJ A;  1CKM A;  2HCC A;  4DK3 C;  1UE7 A;  3Q0A A;  1SNQ A;  3CCM A;  1TWA B;  1BCP B;  3J7A V;  4HSP A;  5JVG 3;  1XNR L;  1EU3 A;  1EFW A;  2XWB B;  4RGM A;  4A3I B;  1TQO A;  2ZM6 Q;  4YY3 Q;  1I3Q B;  3PSI A;  5C0X J;  1TWF H;  4FVM A;  4DUZ Q;  1I4Q A;  2WAQ B;  5CYU A;  5M3M G;  1WD0 A;  1BXT A;  2F4V L;  1C9O A;  4IQZ A;  4CDD C;  2EDG A;  4R8N A;  1E7Z A;  3F2C A;  2FIN B;  2RQX A;  3UDX A;  2PI2 E;  4JI7 Q;  3H0G H;  3HOV H;  2CKZ B;  3QR8 A;  2EIF A;  3NBI A;  1UEA B;  1SLJ A;  2PQA A;  4DV0 Q;  5G3L F;  3A7A B;  3S14 B;  1A0I A;  1H9K A;  2PMZ B;  3VR4 A;  1CFM A;  5C3X A;  3BZC A;  5JPM C;  1HR0 L;  3JAM i;  1IBK L;  2UUC L;  1TWG H;  1KNE A;  4Q5V A;  3PUV A;  2LY7 A;  3A55 A;  5CBE E;  3S1N B;  1C4Q A;  2UUB L;  2F03 A;  1J5E Q;  1K3B C;  1Q46 A;  2NN6 H;  1B4O A;  4UP9 A;  1QB5 D;  4H02 A;  5K36 G;  2NWG A;  3HEJ A;  3G6J B;  3FKI H;  3H6M A;  3DHQ A;  5C4J B;  4KTA A;  4MIU A;  2RHS B;  1QIL A;  4A3K H;  3R93 A;  3DMU A;  2JA7 H;  2A5H A;  4PV1 C;  5EQ0 A;  4LF8 Q;  1MSH A;  4RHR A;  5EGT A;  1L0Y B;  3VR2 A;  3LGJ A;  4J1M A;  4A3B B;  1WCM H;  5FJ8 H;  3F1Z A;  2B63 B;  3I70 A;  1A2T A;  2JEB I;  2K33 A;  1VQ4 A;  3PUZ A;  4BBS G;  5C4X G;  2Y0S E;  1OXT A;  2G9D A;  2F0O A;  5EAY A;  3TME A;  4X65 Q;  2EXZ A;  3BDL A;  2R6G A;  3T16 A;  4JBK A;  5IP9 H;  1T5E A;  4IUN A;  4RGO S;  1I6H H;  4L5S A;  5EKK A;  1W3S A;  5IYC H;  1U4R A;  3H15 A;  1IYJ B;  3CCL A;  1ML0 D;  4A3L G;  4A75 A;  1OXU A;  1IZ6 A;  1A8V A;  1O7I A;  3PQI A;  5LMN W;  1WTR A;  5HGT A;  1DZ1 A;  3KOJ A;  2PQA B;  2H5X A;  5FLX E;  5C3E G;  4EX5 A;  3IKJ A;  2PPB C;  3C46 A;  2CVR A;  4R8I A;  4A3M B;  2YU9 H;  3W5O A;  2QW7 A;  2ZM6 L;  1CQV A;  1SYC A;  4ZKB B;  2MJ8 A;  1VQA A;  4YY3 L;  4A3F G;  1Y14 B;  1JB3 A;  3S2D B;  1PH3 A;  3M3Y H;  4DUZ L;  4GNX C;  1C7Y A;  4ZCK A;  4OO1 G;  5LL6 S;  4IJH A;  3K0Y A;  2F0W A;  1K28 A;  4UHV A;  4JI7 L;  3HOZ H;  2F0D A;  1UE1 A;  1E22 A;  1EOT A;  4DV0 L;  1G6P A;  2XN9 C;  4AYB G;  4X6A H;  3H91 A;  4KD4 A;  3H3V C;  5A2Q L;  1KD1 C;  1YHQ A;  3CQZ B;  1LO5 D;  3W1B A;  2QA4 A;  1SAP A;  4QUF A;  2NYZ D;  4C3J H;  1HNX Q;  3D3R A;  2NVT H;  2HDL A;  1VQH A;  4L63 B;  1J5E L;  1EQR A;  2R92 B;  5CV8 A;  1I6V C;  2EOT A;  4GLX A;  4NXN Q;  3I4N H;  4R4Q A;  1JCK B;  5BR8 Q;  2A19 A;  1EU4 A;  2MGS A;  4APV A;  3GTL H;  1DON A;  5IGF A;  4HMJ A;  4OX9 Q;  1HH2 P;  1VQF A;  4X66 Q;  5T1G A;  1J9O A;  3O13 A;  1STY A;  1A63 A;  1HR0 W;  4MZ9 A;  4LF8 L;  3A54 A;  1LTL A;  1VQ5 A;  1I4X A;  2OTL A;  2O5J C;  3D4R A;  3LWE A;  1WTO A;  2L1B A;  3NHH A;  4DU9 A;  3ONA B;  4DV7 Q;  1A62 A;  2GVA A;  3H3V H;  2N8N A;  3NPP A;  4KY7 A;  1X65 A;  4QCL A;  4TVA B;  4X65 L;  4EVO A;  2AWO A;  1LTG D;  4WJW A;  3ULP A;  2EYH A;  4CKC A;  1PZI D;  2IJ0 A;  3CKI B;  4RFB A;  2QDB A;  3S15 B;  1LTA D;  4K0K Q;  4N9T A;  2F0N A;  3CCR A;  4B3T Q;  2SEB D;  5I9P A;  1RF2 D;  1B8A A;  2WB1 E;  4M8A A;  3KFU A;  1SYB A;  5JEA J;  1R4Q B;  1FGB D;  2K14 A;  3X3M A;  2B29 A;  2BA1 A;  1RTO A;  5IWA Q;  2ZJQ A;  4C1N I;  1YJW A;  4QGU A;  2LXJ A;  1B44 D;  3CPF A;  3QB3 A;  3MXN B;  3GTO H;  4JOI A;  2HIV A;  3I4L A;  5GRO A;  1EIH A;  3FMC A;  4R4I A;  4ID6 A;  1NNX A;  1Y1W H;  2PCF B;  3S16 H;  1LTS D;  3KLW A;  1II3 A;  1SR3 A;  1A15 A;  2RSN A;  3EBE A;  2OWO A;  4K5X A;  4JYA Q;  2HQE A;  1GOZ A;  3PO2 H;  4LNQ A;  2PW5 A;  1PTO H;  3BJU A;  1S5F D;  4MTN A;  4OEM B;  3GTJ B;  2EYM A;  1EY8 A;  5I9O A;  1CA5 A;  3S24 A;  1EYA A;  2I07 B;  5COY A;  3T56 B;  5FLM G;  3S1Q B;  2IX0 A;  2D5D A;  3U58 A;  1ASZ A;  1JOR A;  2K03 A;  1IW7 C;  4UPA A;  1HNX L;  2MP1 A;  3D31 A;  3CAM A;  2K5V A;  2E2I B;  4V0B A;  2K28 A;  2IW3 A;  2UXC Q;  4NXN L; 
#chains in the Genus database with same CATH homology
 5J3B A;  4JI1 Q;  3FP9 A;  1KQS A;  1K83 H;  2IHF A;  3L0O A;  3DLL A;  3RN2 A;  4A3J G;  1NMG A;  1VQK A;  4A3C H;  1W2B A;  3S2D H;  1NJI C;  2R7F A;  5BR8 L;  2AHO B;  1OXV A;  1IBM L;  4O0A A;  2JA6 G;  2N3S A;  3I55 A;  2Z6K A;  2E2I H;  3U50 C;  3ULL A;  4IO9 A;  4OX9 L;  1JE5 A;  2VL6 A;  4GLV B;  4X66 L;  2MNA A;  4JI3 Q;  2XGT A;  1XNQ L;  2UUA L;  4DR2 Q;  4YWM A;  3SGI A;  3B6Y A;  1N9W A;  3CW2 C;  5IY0 A;  1N32 L;  3GTP H;  1P8L A;  4YCU A;  3CC7 A;  1FGU A;  2VUM H;  3KF6 B;  4QL5 A;  1LYL A;  2VQE Q;  2IHE A;  3PUY A;  1YHA A;  2YTX A;  3CCU A;  1PHJ A;  5M5X H;  2NVX H;  3CQZ H;  2A1A A;  3CME A;  1OTC A;  3PCO B;  5C44 H;  4IOC A;  3F2B A;  3CPW A;  4DV7 L;  1I5F A;  3I7F A;  1HZ9 A;  1Q1E A;  4BA1 I;  3T1Y L;  3A74 A;  5M5Y H;  3PUW A;  3M85 A;  3UDI A;  1D7Q A;  4X64 Q;  2B3G A;  4DPG A;  5IYB G;  3UDG A;  1PH8 A;  2JA8 G;  3J81 c;  3KDF A;  1PYS B;  2UXB L;  1YIT A;  3CC4 A;  4Y52 H;  3M7N A;  1RL2 A;  2Z6K C;  1P16 A;  5AJ3 Q;  1S72 A;  1N33 Q;  4K0K L;  2AKW B;  1SFO H;  4B3T L;  4QQB X;  3RNU A;  1YJN A;  4Y7N H;  2UXC Q;  4KHZ A;  4DR6 L;  1X3E A;  4A3D G;  2ZTC A;  3GTQ H;  2YTV A;  1VQ8 A;  1CSQ A;  5JJK A;  2ASB A;  4JI4 Q;  1G51 A;  4P75 A;  4JI5 Q;  1HNW L;  1V1Q A;  1R9T H;  3HOW H;  1XNR Q;  3HOY H;  1I50 H;  2BA0 A;  1WI5 A;  4GN3 B;  4LF9 Q;  3HOU G;  2KHJ A;  3TRE A;  4JI0 L;  3S1M H;  4NB3 A;  3HFZ B;  2RF4 A;  1UEB A;  2KEN A;  3CCV A;  2FXQ A;  4PZ7 A;  3PUX A;  3CCQ A;  1M1K C;  3RZD H;  4C3H H;  2L15 A;  4DUY L;  2R93 G;  4JBW A;  1FL0 A;  1LUZ A;  4RG1 A;  1L1O A;  4AQY Q;  4DV3 Q;  2F4V Q;  2RHQ B;  2OQK A;  1V43 A;  4JYA L;  1PH7 A;  3S2H H;  4JCV E;  3A5U A;  4DV6 L;  3H3V I;  2NZO A;  3M4P A;  3I4O A;  4TQU S;  4XTC S;  2ATW A;  3CC2 A;  3H0G G;  3J81 j;  1I94 Q;  2ZJP A;  1L0W A;  2HHH L;  2E2J H;  1X6O A;  1L2F A;  4HJ5 A;  5GAH C;  3S15 H;  5M3F H;  4DR3 Q;  1NMF A;  3RZO H;  3HOY G;  3BU2 A;  1QVC A;  2ALY B;  1AH9 A;  2BH2 A;  2HT1 A;  4DV2 Q;  1WYD A;  1E24 A;  2CWA A;  1XMQ L;  1E1T A;  1EOV A;  1MIU A;  3HKZ E;  4C2M H;  5FLM H;  1KIX A;  2IX1 A;  2GVB A;  3K7A H;  1HR0 Q;  4YCW A;  3PGZ A;  4LUV A;  4A93 H;  2ZTE A;  3OW2 A;  1IBK Q;  4PG3 A;  2UUC Q;  1IL2 A;  3RR5 A;  3G71 A;  1WJJ A;  1U5K A;  3T1H Q;  2YYZ A;  1HNZ Q;  4JI6 L;  3HOX G;  1Y1V H;  1VQN A;  4LFA L;  1N36 Q;  2UXC L;  4DR1 L;  2IY5 B;  4JI1 L;  2UUB Q;  2RCN A;  4WJ3 M;  3E0E A;  3GD7 A;  1OXX K;  3D0F A;  2F52 A;  5DLQ E;  2NN6 G;  4A3J H;  1PVO A;  1OXS C;  4DAM A;  1CKN A;  1VQ7 A;  1L1O C;  4JG2 A;  4DV1 Q;  5JJI A;  3FKI G;  1DGS A;  3RLF A;  1N34 L;  5GAE C;  1MJC A;  4JI3 L;  5IP7 G;  1B70 B;  3Q8D A;  1HZB A;  2QGQ A;  3NBH B;  2VQF L;  1Q8K A;  3CP0 A;  1GD7 A;  4LFC L;  5JEA G;  3TQY A;  4OO1 I;  4A3K G;  4IPD A;  3GTM H;  3ERS X;  3HKZ G;  4PZ6 A;  4BBR G;  2HIX A;  5LMN L;  1NTG A;  1XMO Q;  2Q2I A;  3G48 A;  1EUJ A;  2VQE L;  1S40 A;  3GDE A;  4A3G H;  5IT9 c;  2R7Z H;  1Y1V G;  3A0J A;  1EIF A;  1VQG A;  2VNU D;  4DV4 Q;  1WCM G;  5FJ8 G;  3CCE A;  3PF4 A;  1BKB A;  4GN4 B;  1TWC H;  3CCJ A;  4LF6 Q;  4YWK A;  3S1Q H;  4IOA A;  3PIO A;  3A5Z B;  4R4T A;  3NEN A;  1VQ6 A;  1K0R A;  1PH9 A;  2ES2 A;  2D62 A;  3J80 c;  5IE8 A;  4ALP A;  4X64 L;  2VW9 A;  3GTK H;  3FHW A;  1BBW A;  4A3E G;  5HGQ A;  5IYB H;  3TS0 A;  3S1R H;  2JA8 H;  2KCT A;  4HIM A;  1B7Y B;  3DM3 A;  5IP9 G;  1RIP A;  1L1O B;  3HKS A;  5AJ3 L;  1N33 L;  3CD6 A;  3AYH B;  3E9H A;  5IYC G;  1T9H A;  4YWL A;  5IYD G;  2N78 A;  5HY6 A;  2Q2T A;  1UE5 A;  3U4Z A;  3NEM A;  5GAD C;  1K73 C;  2K5H A;  5ELN A;  1CKM A;  4DK3 C;  1EWI A;  3I4M G;  4A3G G;  4EQ5 A;  1UE7 A;  1Q12 A;  4LUO A;  1VQP A;  2R7Z G;  4DR5 Q;  4BY7 G;  4A3D H;  1K3R A;  3CCM A;  1EYG A;  4JI5 L;  3UE1 A;  3W1G A;  1KRT A;  3J80 i;  1N8R C;  1SRU A;  1J6Q A;  3TEH B;  1XNR L;  4LF9 L;  1EFW A;  4O2D A;  3HOU H;  4LFA Q;  3ICE A;  2JA9 A;  2ZM6 Q;  4YY3 Q;  3PIP A;  2XTI A;  2ZTD A;  4LF4 Q;  4FDB A;  5GAG C;  3KJP A;  4KHP Q;  1TWA H;  3PSI A;  5C0X J;  3UE0 A;  1TWF H;  2Q2U A;  1KXL A;  4R1J A;  2DUD A;  2D0P A;  3K80 C;  1SRO A;  1BVS A;  1WFQ A;  3F2D A;  4DUZ Q;  2R93 H;  4B3S Q;  4WJ4 A;  3K8A A;  5M3M G;  5FLX c;  4DV3 L;  4AQY L;  3JAM c;  1C9O A;  1PH6 A;  2F4V L;  4DR7 Q;  4A3I H;  2VZA A;  5C0X I;  1CKN B;  3F2C A;  1E7Z A;  1Q7Y C;  1PV4 A;  3UDX A;  2PI2 E;  3HOZ G;  4JI7 Q;  1I94 L;  1PH4 A;  1M90 C;  3H0G H;  1Z47 A;  2IT1 A;  3K0X A;  3HOV H;  5IWA L;  2CKZ B;  3M4O H;  2EIF A;  4BXX G;  3KJO A;  1SLJ A;  1SE8 A;  2PQA A;  2WAQ E;  4DV0 Q;  4DR3 L;  4JI8 Q;  1HZC A;  1X3G A;  3RN5 A;  2KBN A;  3AFP A;  4GLA C;  4X62 Q;  2CFM A;  4DV2 L;  3J81 i;  4PZ8 A;  1A0I A;  4JBM A;  4GKK Q;  3BZC A;  1D8L A;  1HR0 L;  4QIW E;  3NEL A;  3JAM i;  1PH2 A;  1IBK L;  2UUC L;  1U0L A;  1TWG H;  3J7Z C;  1IXR A;  1AE3 A;  3PUV A;  1HNZ L;  1Q86 C;  1N36 L;  2ZJR A;  3HOX H;  3PV0 A;  2UUB L;  4A3I G;  4L5Q A;  4IFD J;  2PMZ E;  1FVI A;  2WP8 J;  2QEX A;  1XPR A;  1J5E Q;  2OCE A;  1Q46 A;  4DR4 Q;  3BZK A;  1QVG A;  2UXD Q;  4ME3 A;  4UP9 A;  4DV1 L;  4H02 A;  4A76 A;  5K36 G;  3S17 H;  2JEA I;  3HOV G;  4BBS H;  3CMA A;  4IFD I;  2MO0 A;  3AQQ A;  3FKI H;  4DNI A;  1GVP A;  4OWW B;  2WAQ G;  3S1N H;  4MNO A;  4P74 A;  3GO5 A;  2RHS B;  3M9B A;  5IP7 H;  2EXD A;  2YV5 A;  3G6E A;  3VDY A;  4NXM Q;  1QUQ A;  2LXK A;  5E7N A;  2UXB Q;  2K50 A;  1Q1B A;  4A3K H;  2HQL A;  2K5N A;  4BBR H;  1KL9 A;  2CQO A;  1XMO L;  2JA7 H;  1VQ9 A;  2PI2 A;  1VQL A;  2PNH A;  4DKA C;  1K8G A;  4LF8 Q;  3MEF A;  4JC0 A;  2GN5 A;  4DV5 Q;  3LGJ A;  5GQO A;  4DV4 L;  1IBL Q;  4JV5 Q;  1YJ9 A;  1WCM H;  2N49 A;  4LF6 L;  1HZA A;  4P72 A;  4R4C A;  3F1Z A;  3M4Q A;  5FJ8 H;  5C3E H;  3CF5 A;  1TWH H;  2JEB I;  1VQ4 A;  3PUZ A;  2CWP A;  1VQB A;  1ASY A;  3EIV A;  4BBS G;  5C4X G;  2Y0S E;  1OXT A;  3KF8 B;  4GNX A;  4A3E H;  5EAY A;  2OQ0 A;  1G29 1;  3WWV A;  4DR2 L;  2V1C C;  4X65 Q;  1QZG A;  4IJL A;  2R6G A;  4JBK A;  1QVF A;  5IP9 H;  1MJE A;  3OTO Q;  1I6H H;  4L5S A;  3L2P A;  1W3S A;  5IYC H;  3H15 A;  1IYJ B;  4P73 A;  3CCL A;  2JA7 G;  5IYD H;  1C0A A;  3UDF A;  4A3L G;  4A75 A;  1VQJ A;  1OXU A;  2E8G A;  1IZ6 A;  1A8V A;  1O7I A;  1SN8 A;  1UWV A;  5LMN W;  3AEV A;  4B3M Q;  4DR5 L;  3I4M H;  3KOJ A;  4BY7 H;  2CCZ A;  2PQA B;  4HJ7 A;  2H5X A;  5LMU Q;  5C3E G;  4EX5 A;  2VY3 A;  4JI2 Q;  3PO3 G;  4AYB E;  4IPC A;  2YU9 H;  2K75 A;  2MFI A;  3W5O A;  1Z9F A;  4YCV A;  3KYH C;  2ZM6 L;  2Y0S G;  3EN2 A;  4LF5 Q;  1VQA A;  4YY3 L;  4A3F G;  1Y14 B;  2A8V A;  4LF4 L;  4KHP L;  4A3B G;  3STB C;  4UY8 C;  1PH3 A;  1E1O A;  2B63 G;  3M3Y H;  4DUZ L;  4HID A;  2Q2H A;  1VQE A;  4GNX C;  1Q82 C;  1C7Y A;  4B3S L;  1Y1W G;  5M3M H;  4LF7 Q;  4C3I H;  1JT8 A;  1NBW A;  4OO1 G;  4IPH A;  2LSS A;  4IJH A;  1VS0 A;  4JI7 L;  1LM0 A;  2MO1 A;  3HOZ H;  3PO2 G;  1JMC A;  4B3R Q;  4HJ8 A;  5JJL A;  2UU9 L;  4JI4 L;  4LFB Q;  4GKJ Q;  1UE1 A;  1E22 A;  1KAW A;  4DV0 L;  4BXX H;  1CSP A;  4JI8 L;  3J7A 5;  1G6P A;  4LUZ A;  4AYB G;  1TXY A;  1QUQ B;  1YNX A;  4X62 L;  1VQD A;  4HIO A;  1N34 Q;  1KD1 C;  1X9N A;  4X6A H;  1YHQ A;  4HJA A;  2VQF Q;  4BA2 I;  1X54 A;  4HIK A;  4GKK L;  4LFC Q;  4YHH Q;  1PH1 A;  2OTJ A;  4IPG A;  3W1B A;  2QA4 A;  1KRS A;  2E5L Q;  2UU9 Q;  4BY1 H;  5LMN Q;  1Q81 C;  1FJG Q;  5ELO A;  4C3J H;  1K9M C;  4A3M G;  1JB7 A;  1HNX Q;  2NVT H;  1VQH A;  1YBY A;  2C35 B;  3I2Z A;  1EQR A;  1J5E L;  4DR4 L;  4GN5 A;  2UXD L;  2NVY H;  1JJ2 A;  2NZH A;  4GLX A;  4NXN Q;  1KHI A;  4GS3 A;  2KHI A;  3I4N H;  4A3C G;  1I3Q H;  1PA6 A;  4R4Q A;  1GO3 E;  2AMC B;  4GNX B;  1YEZ A;  3ER0 A;  5M5W H;  5BR8 Q;  2A19 A;  1IBM Q;  4NXM L;  4APV A;  3GTL H;  4OX9 Q;  2R92 H;  3K7U C;  1HH2 P;  1VQF A;  1VCI A;  4X66 Q;  1KC8 C;  1NE3 A;  4NPS A;  2UUA Q;  1XNQ Q;  3E9I A;  4OWX B;  1H95 A;  3ULJ A;  1UE6 A;  2VS1 A;  1S3O A;  4OON A;  4UP8 A;  1YHB A;  4AH6 A;  4GOP A;  1N32 Q;  3IRB A;  4PMW A;  1A63 A;  4BY1 G;  1EQQ A;  1HR0 W;  4MZ9 A;  4LF8 L;  4DV5 L;  3T1H L;  2VUM G;  3K81 C;  1LTL A;  1VQ5 A;  1PFS A;  1YIJ A;  1IBL L;  2OTL A;  4JV5 L;  1YZ6 A;  3PF5 A;  1PYB A;  4QJF A;  3S14 H;  2E2H H;  5H1S E;  4UP7 A;  3I4N G;  5C44 G;  3JC6 6;  1GM5 A;  2JA5 H;  5C0X G;  2I5L X;  4AIM A;  2BH8 A;  2D0O A;  5C4X H;  2WFW A;  1A62 A;  2GVA A;  1JJC B;  4DV7 Q;  3T1Y Q;  2N8N A;  1CKO A;  3H3V H;  1X65 A;  1SMX A;  2R7D A;  1YI2 A;  4TVA B;  3L7Z C;  4X65 L;  2AWO A;  1X55 A;  4KI0 A;  4A4I A;  2R92 G;  3ULP A;  1XPU A;  3OTO L;  1WOC A;  1V9P A;  2DGY A;  3GTG H;  1YVC A;  2KCM A;  4K0K Q;  2NN6 I;  3CXC A;  4A3L H;  1VQO A;  5C4J H;  3CCR A;  4L5T A;  4B3T Q;  4B3M L;  4LW1 A;  1B8A A;  2WB1 E;  3KFU A;  4NXN L;  2ID0 A;  4R4O A;  3KF6 A;  5JEA J;  3G4S A;  4DR6 Q;  5LMU L;  4GOP C;  1QZH A;  1EIY B;  4JI2 L;  2K14 A;  1JJG A;  1X56 A;  2NVQ H;  2B29 A;  2BA1 A;  4RMF A;  5IWA Q;  4QY7 A;  3STB D;  2ZJQ A;  3PO3 H;  2JA5 G;  1E3P A;  1YJW A;  3HOW G;  1HNW Q;  2YTY A;  4QGU A;  4LF5 L;  1XPO A;  2LXJ A;  3CPF A;  2AWN A;  3RLO A;  3MXN B;  3GTO H;  4A3F H;  1VQM A;  4JI0 Q;  1XTD A;  4JOI A;  2HIV A;  3ZJY C;  4IFD G;  5GRO A;  4A3B H;  2JJQ A;  2EQS A;  1PH5 A;  2B63 H;  4R4I A;  3F8T A;  2MQH A;  4DUY Q;  1Y1W H;  4LF7 L;  3S16 H;  3KLW A;  4POG A;  1SR3 A;  2JE6 I;  3EBE A;  2OWO A;  1GKH A;  4OXP A;  4HJ9 A;  4JYA Q;  4J15 A;  3TRZ A;  4B3R L;  2WB1 G;  3PO2 H;  4LNQ A;  3BJU A;  4DV6 Q;  1AE2 A;  4MTN A;  4GKJ L;  4LFB L;  1K8A C;  1XJV A;  3OYY A;  2F3I A;  2JA6 H;  2HHH Q;  2JQO A;  4POF A;  3KDF B;  5M3F G;  2K52 A;  1CUK A;  3S24 A;  2Z0S A;  3AFQ A;  1X3F A;  4DR1 Q;  1NY4 A;  4DAY B;  4DK6 C;  4GOP B;  4XIG S;  4YHH L;  1HJP A;  5FLM G;  3CCS A;  1XMQ Q;  4L5R C;  2IX0 A;  2E5L L;  1VQC A;  3I56 A;  3GTJ H;  3U58 A;  1ASZ A;  4LWC A;  2I5M X;  2K4K A;  1VQI A;  3RLN A;  4UPA A;  1FJG L;  3TS2 A;  1HNX L;  4A93 G;  1MKH A;  3D31 A;  4DR7 L;  3CAM A;  2K5V A;  4JOI C;  2JK8 A;  4KLK A;  4P71 A;  4A3M H;  2I5H A;  3U4V A;  4JI6 Q;  1BBU A;  4OWT B;  2I0Q A;  4JBJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...