2F0WA

Crystal structure of staphylococcal nuclease mutant v23i/l25i/v66l/i72l
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
136
structure length
136
Chain Sequence
KLHKEPATLIKAIDGDTIKIMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMLENAKKLEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Staphylococcal nuclease
publication title Hydrophobic core mutants of Staphylococcal nuclease
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 36
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2005-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2f0wA00
2PQEA 1EY0A 4H7BA 5I9OA 2PW5A 4B9WA 1EY9A 2SNSA 5JOBA 1AEXA 4K5WA 4ODGA 2EY6A 5E3FA 2F3VA 3TP5A 3SHLA 5EKLA 5CC4A 3E5SA 3BDLA 3DMUA 4K5VA 5IIFA 5IGBA 1JOOA 3TP8A 3SXHA 2F0JA 4N9PA 1EYAA 5CGKA 5J39A 3TMEA 2KHSA 2F0VA 5C4ZA 1IHZA 4HTHA 4ME5A 2OXPA 4K14A 5IOCA 1F2ZA 5F2DA 2EYJA 2F0FA 5JAVA 2PW7A 3EVQA 4PMBA 2F0OA 4EQNA 3OMGA 1JOKA 3MHBA 5CV8A 3OMCA 1EZ6A 4RKLA 1SNQA 5J22A 2QDBA 1STAA 1TT2A 2F0LA 3C1EA 1KDBA 2F0TA 3D6CA 3HEJA 2WACA 4HMIA 4KD3A 4NP5A 4RKBA 4KTAA 5C3WA 5IODA 4NKLA 4K2LA 4QB4A 4YIJA 4EQOA 4MIUA 4EQPA 5CV5A 1KABA 3NK9A 3QB3A 5KEEA 1SYGA 5C3XA 2F0DA 4J6HA 1A3UA 4KD4A 3T16A 1KAAA 2RBMA 5KGUA 1SYDA 2KQ3A 5I6WA 2F3WA 5IGDA 1STBA 1STHA 2EYOA 3ERQA 3T13A 1KDAA 4OL7A 4F7XA 5HGTA 3NP8A 2F0WA 4DFAA 3QOLA 4EVOA 4ZUJA 1F2MA 2F0KA 1F2YA 2EYHA 2F0HA 5NUCA 5CV6A 3SK6A 5M9OA 3C1FA 4IZ8A 3BDCA 2PYKA 2F0QA 3D8GA 4NMZA 3D4WA 1NSNS 4KV6A 1II3A 5CV4A 2PZUA 5C6AA 1EY5A 1JORA 1EZ8A 4I65A 1EY7A 2EYLA 3P1HA 5DEHA 3VA5A 5IGEA 1TQOA 1RKNA 2EY5A 4KJNA 4K5XA 5DAUA 5KYIA 2PZTA 2F0UA 1JOQA 1SYEA 3OSOA 4E6IA 4DGZA 5IGFA 3V2TA 4N9TA 2F0SA 4QMGA 5CR3A 5HURA 2RDFA 4G57A 3U9OA 2EYFA 1U9RA 4DU9A 2EXZA 5K5PA 1ENAA 2OF1A 3NHHA 2NUCA 3HZXA 1KDCA 2OEOA 3SK4A 2EYPA 4DF7A 4K8JA 5IGGA 4WRDA 2F0PA 3S9WA 2F0IA 2SOBA 2EYMA 3DHQA 1SYCA 3TP7A 5C4HA 4ID6A 1SNOA 4KY5A 4LAAA 4PMCA 4KY7A 5I9PA 5CV9A 1EQVA 1SNCA 5KRUA 1SYBA 2RKSA 4ZQ3A 3OWFA 3MXPA 1SNDA 1NUCA 2LKVA 3D4DA 3PMFA 3QOJA 4NDXA 3TP6A 5EGTA 3MVVA 1ENCA 1EYCA 4F8MA 2F0GA 2EY1A 3MZ5A 1A2TA 4PNYA 5C5MA 1EY6A 3RUZA 1SNPA 1TR5A 3SK8A 3EROA 5IGCA 1EY4A 1SNMA 1STYA 2M00A 4IALA 4KY6A 4S3SA 4WORA 2O4XA 2ENBA 3LX0A 5C5LA 5E1FA 5KIXA 4B9XA 2F0MA 2PZWA 4TRDA 5J1ZA 4K6DA 4ZUIA 2EY2A 3P75A 1A3VA 4R8NA 4QF4A 5EKKA 3NXWA 4KHVA 2SNMA 4K2KA 4KJOA 1STGA 3SK5A 2F0NA 1EYDA 2F0EA 3EJIA 1A3TA 5CV7A 5ISRA 3H6MA 4IUNA 4K8IA 3R3OA 5KYLA 3MEHA 4HMJA 1A2UA 3ITPA 1SYFA 4J1MA 3NQTA 3SR1A 5I6YA 1STNA 1EY8A 3NUCA 2HQEA
chains in the Genus database with same CATH superfamily
1TS5A 2PQEA 2XWBB 1U4RA 3L3OC 1E24A 4JI1Q 4FVMA 3TN2A 2L0CA 2EJMA 1ZYRD 3CMEA 1HR0L 1PFMA 3I4NG 3DLLA 5J39A 1B70B 2QILA 2GVAA 1KTKA 1BNZA 3O13A 5DLQE 4HTHA 3J81c 1QCBD 2EYJA 2XTIA 3CCLA 2IWHA 1H9SB 4CHTB 4DK1A 3HOUG 3U9SA 2TMPA 1QJOA 1E2VA 4GN5A 1LT4D 4J15A 1F9SA 1Y1WG 3A55A 4C3IG 1K83B 1LT6D 1IKMA 3BYTB 1U4PA 3A8JE 4OWXB 1QZHA 3KBXA 4BA1I 2F3IA 2UXDQ 4OX9Q 1R9TB 2L5TA 3V05A 4PG3A 1XPRA 2KQ3A 4X66Q 3G6JB 2NZHA 2E5LL 5HGTA 3J80E 4H02A 5LMUQ 3K5OA 2EYHA 2QF7A 4R4OA 3PIO3 4DK6C 4CBVA 4HAEA 3J7A5 3F1ZA 4OELB 1I4XA 4JVZA 2RQXA 4K5XA 1XNQL 5KYIA 1WI5A 2LSSA 2RHSB 4A3EH 1ICWA 1W6JA 3SVMA 4U68A 2D5DA 1ASZA 3HZXA 1PRTD 4DF7A 2A6EC 3MWYW 3K58A 5ELCA 1SYCA 4HJ8A 4RGNA 3L9AX 4ZKCB 1SYBA 2WB1B 4APVA 3IRBA 1XJVA 1SRUA 3KF6A 5COYA 4F8MA 3RUZA 1TR5A 3EROA 1FVIA 3RZDB 3BU2A 3S15B 5JJIA 4WORA 5ELNA 5FOBB 2NTTA 4K6DA 2VQEL 1WYDA 3G48A 4JPBW 2RCFA 1ESFA 1YNND 2AQ1B 2K50A 3H6MA 3TZUA 4A3GB 4JI8L 2K03A 3N52A 4FF4A 2N88A 3A0JA 2VUMG 2WP8J 1RD9D 2EY6A 4UP9A 4BA2I 1B3AA 1Z6HA 2MHVA 2N78A 4MNOA 3J81i 2UXCL 5C0XH 3U4ZA 2NVQH 3BDLA 3CCQA 3TP8A 3I55A 2F0JA 3JAMc 2KVMA 3HKZG 1G6PA 4YCWA 1T5EA 2JA6B 4UPAA 4CDDC 4G7OC 1TWHH 3PO2G 2XRSD 5EPJA 2R92H 4GOPA 1XMOQ 3GV3A 4IO9A 1E7ZA 4FXKC 4BY7G 4JI6Q 1EOTA 3HOXG 2YYZA 4LF5L 4JI5L 1JWUD 1UEAB 1DYQA 5JPMC 1PDQA 1YEZA 2IHFA 1QG7A 2UUAQ 4JI4Q 3HOZB 5EPKA 1MSGA 1B44D 1TKWB 1QOHA 2OCEA 2GVBA 2L1BA 3I4NH 1TWFB 3J81j 2X6GA 2KA7A 3UE0A 5EBDA 2UU9Q 1Q3LA 3CCJA 5CORA 5K36G 2PYKA 1IYJB 3A56A 3I4OA 2L9HA 2PZUA 1S72A 3DXJC 4BS9A 2ES2A 3HOUH 4DR6L 4OONA 1VS0A 4KJNA 5DAUA 1AW7A 1Y1WH 1GOZA 1RODA 4C3IH 4B3SL 2F4VQ 2BE5D 2B2WA 2EYFA 1D6EC 4QY7A 1SJED 1SMXA 4KI0A 3NHHA 3NTIA 2K75A 4GKJL 4OO1G 1V1OA 1XPOA 3DUZA 3FDTA 4A3KB 4PMCA 1BCPB 2J0TD 1IBLL 1I3QH 1S5FD 4MZ9A 2HHHQ 4UHVA 1D7QA 1QVFA 1EU3A 4X65L 4C2MB 3MVVA 1OXVA 3ONAB 1L0WA 4Q5VA 2EZVA 1WCMG 4YCUA 4TQUS 1EY6A 3PIPA 3KJOA 3HOWB 4DAVA 4GNXB 1KNEA 3AQQA 4DV0L 2O4XA 2PO4A 2F0MA 3EFXD 1BDOA 5C4JB 1PTOH 2A6HC 4KKSA 3A7LA 3S16H 4K8IA 4JI1L 2E2JH 1NMFA 1IW7C 1TVXA 2Z0SA 1G291 2NWGA 4XXEA 1I5FA 3J80L 3JAMi 1C8CA 1OXXK 4P74A 5HGQA 1WTXA 4A4IA 1UE5A 1F9QA 5CC4A 1NBWA 4K5VA 2QCPX 2IPKD 3TMEA 1YJNA 2NB0A 3ZYYX 4A3DB 1HFGA 5IOCA 1UNSA 4R8IA 1N8RC 2BA0A 4PMBA 2F52A 1YZ6A 3GTOH 1HA6A 3QWNA 2UUBQ 4QGUA 3D6WA 1HZCA 1SNQA 2UXDL 3I91A 4OX9L 1EEID 1WJJA 2VXWA 1RTOA 1UE6A 4X66L 4MIUA 5EJWA 1X3FA 2VUMH 1JE5A 2ICEC 2WB1G 2D0PA 1PZID 4R4QA 1FGUA 1RTNA 1O7YA 1Y14B 4JOIA 5CBAE 2FMMA 1X3EA 2O5JC 2KHIA 1BVSA 1PMRA 1TWGH 4IZ8A 1QVGA 5D65A 4Z9CB 4KV6A 1II3A 1L1OC 5IE8A 2ATWA 3TS2A 1J8IA 3H09A 4PZ8A 3PO2H 1UUPA 1QE6A 2JYOA 4OXPA 3GQBA 5IGEA 2PQAB 1PV4A 3OW7A 5FLXE 1SYEA 4JI2Q 2A6HD 2K52A 4E6IA 1TY0A 4BY7H 3HOXH 4QMGA 2E2IB 3E3XA 1N36Q 4DU9A 1DXMA 5K5PA 1S5DD 5DM63 2OF1A 1QVCA 3Q8DA 5A2QL 1EIGA 1DOKA 4C3HB 3H3VH 4L63B 4R4CA 1V43A 1MBYA 1EQVA 5E4XA 3KYHC 4HR7B 4XQJA 1CA6A 1HXYD 3CCRA 4POFA 3TP6A 4HIOA 5K36H 3RLNA 1V1PA 2JEBI 4DV1Q 2EOTA 2JA6G 1Q8KA 4X6AH 2V4DA 5E1FA 1NNXA 3M4YA 4Y7NB 3K5LA 1EU4A 2JN4A 2PNRC 3GTPB 2LMCB 1T9HA 4KHVA 4GLXA 3HS0C 2WIIB 4OO1H 3EBEA 1Q1BA 1O7IA 2XRQD 3MEHA 5M5YH 2N8NA 2AKWB 3EN2A 3HOZG 3D0FA 2NYZD 1JOQA 1PVOA 2SNSA 3I56A 3E9HA 1VQIA 3HKSA 1R4PB 4A93B 4JI0Q 1VQEA 2VB3X 4C56C 1TS2A 1VQ7A 4LF6Q 3SDZA 1WCMH 1G8ZD 5IIFA 1HQRD 4JBJA 5D3DA 1XMOL 1JR0D 1ZXTA 4ULLA 1HNZQ 1PFSA 4HCEA 1K83H 4JI6L 1B7YB 1QNUA 3GV6A 4N8FA 1H95A 5J22A 3HEJA 3D6CA 2QEXA 1R9TH 1JCKB 2MFIA 3OYYA 4JI4L 4QB4A 4QIWE 3MEFA 5CV5A 3PUXA 2DY8A 3GTGH 2A8VA 1CK1A 4KKTA 4YWMA 2UU9L 1RF2D 1A3UA 1EWIA 3BYYB 4I7ZC 4BXXG 3MTSA 3TS0A 3ERQA 2Q2IA 2F0WA 2OQKA 3KLSA 2F0KA 3S1MB 4GN4B 2F0HA 1X6OA 1AE2A 1XMQQ 5D3IB 1UE7A 2F0QA 4A3FB 3CW2C 4JYAQ 2F4VL 3BDOA 1GUTA 1TQOA 4JG2A 2R7FA 2PMZE 2C9OA 2IX1A 2MNAA 3BG3A 1ZEQX 5IGFA 4ZRZA 3IFTA 4G57A 3PIP3 2EXZA 2HHHL 4NB3A 1WOCA 4FXDA 3CQZB 3M7GA 4EX5A 2EDGA 1M4VA 4ZYSA 4LF7Q 3IL8A 3W3AA 3TP7A 2WFWA 3RZDH 3S15H 4DV3L 1CT1D 3PMFA 4A3DG 4K0KQ 2BH8A 3NEMA 2B2TC 1TWAB 2PMZB 2I0QA 2XNAC 1J6QA 2A68C 2D0OA 4S3SA 4TSSA 1HCZA 2CWAA 2B2VA 3ICEA 1U5KA 4LF9Q 2QKIC 1KIXA 1EQTA 3P75A 2SEBD 2EPBA 3CCMA 3GTJH 1L0XB 5ISRA 1FJGQ 1A2UA 5D14A 2HT1A 3RR5A 1S5CD 1ASYA 3M4OB 1H9MA 4WJWA 3SXHA 5LL6S 4XT1B 1D1KA 1FR3A 1TU2B 1AEXA 1EUJA 5E3FA 2B2YA 2CKZB 3I2ZA 2JA6H 5EQ0A 3L2PA 1QB5D 5AJ3Q 1PH4A 2LXJA 2UUBL 3S2HB 3NBHB 1OO9B 3C3LA 1AZQA 2JA9A 4DNRB 3IKJA 5FLXL 1MHWC 2F4IA 3R2IA 1XNRQ 2KECA 2CWPA 1VQPA 5BR8Q 3FVQA 1OTCA 1D5ZC 1UE1A 4C3HG 3HOZH 4HJ5A 4A3IB 4XYQA 1GD7A 4QJFA 4O0AA 1TWFH 4PQXA 2I5MX 4KN4C 2B2WC 2CFMA 2E74C 5CV6A 4BY1B 4JI2L 1K8AC 3U58A 3UI2A 2K4KA 2A68D 3K5NA 1N36L 2AQ2B 2EYLA 3VA5A 2NZ1D 2Q2TA 2ICIA 3NQIA 1D2BA 3MA2B 4P71A 4LUOA 5E4WC 1Q81C 4QUCA 1Y8OB 2VW9A 1L1OB 2E2HH 1BBXC 4A3KH 4GZYC 5CR3A 1SDFA 3V96A 1KDCA 4GLAC 2OEOA 3KJPA 4DV4L 4A93G 1ZYRC 3KLSX 3R8BA 4BXXH 4DR5Q 3HOYB 1E2WA 3F2CA 4DR3L 4CKBA 2RKSA 3K80C 3D4DA 2LXKA 2XWJB 1JJGA 4HCSA 4HJ7A 2F0GA 1BR9A 3LGJA 1I94Q 2I07B 3J81E 4HIKA 2BA1A 1MJCA 2O2LD 3AU7A 4XDXA 3QJYA 5JJKA 4JBWA 1JC7A 2EQSA 4H13C 2QA4A 4L5SA 1EQQA 2SNMA 3QR8A 3VYTA 5CV7A 4IUNA 3GTQB 1QILA 2ZXRA 1EOVA 2X6LA 4LF6L 1LUZA 2K5DA 2PW5A 4RHRA 3OTOQ 4A3DH 1LT5D 4A3FG 5EKLA 3N6RA 3QIAA 5FK9C 1WTRA 2K33A 5IGBA 2K14A 1HTLD 1J5EQ 1EYAA 2K7VA 3D4RA 2VQFQ 3URYA 1D8LA 3U4VA 1IXRA 4ME5A 4K14A 1F2ZA 2HIXA 3FHWA 1A62A 1Y1VB 5F2DA 3VYRA 2K5NA 5KNCA 4KN7C 1VQOA 4OEMB 1PXUA 1IBMQ 1PRTC 1F77A 2WKCA 4RKLA 1CFMA 5KYLA 4LW1A 4JOIC 4IFDI 4JI3Q 1SMYC 5T1IA 4QUFA 2WINB 5ELOA 4K2LA 1BF4A 1MI2A 3LNNA 4XTCS 1KABA 1PH9A 1PYBA 2CCZA 3VYSA 1N32Q 3T56B 4CDEC 1XMQL 1O7ZA 2RBMA 2Y0SE 1SYDA 4IPGA 2NN6I 4JYAL 4ILWA 1V1QA 1STHA 2AHOB 2RA4A 3T13A 1IKLA 5CMDA 3L0OA 2CQAA 4CDFC 5LMNW 1MIUA 2VB2X 1UAPA 1SEBD 3KF8A 2E2IH 3G4SA 1A0IA 2JSOA 1YNNC 1DOLA 2R6GA 4OIKA 1HJPA 2EJGC 1RKNA 1IBKQ 1K0RA 1I4HA 3I73A 4LF7L 4KLKA 5I2YA 1EEFD 4C3HH 1VQ8A 1B8AA 1BXTA 2NUCA 3ND9A 3WOEA 1XTDA 2VZAA 4XQNA 2F0PA 4C1NK 3D3RA 1YIJA 3PF4A 3OWEB 5JJLA 1AP0A 3KF6B 1SNDA 4DV5Q 4LF9L 4Y7NH 2ZTDA 1BCPF 3GTPH 2RF4A 3MZ5A 1X56A 3NPPA 1LLRD 1VQNA 1VQDA 5GADC 3W2DA 4RFBA 2K5QA 5FO9B 4A3IG 2LFNA 1XWEA 1EYDA 3KBGA 4ME3A 2MJ8A 4IJHA 4RAUC 1SMYD 4A93H 2K04A 3SEBA 4HEDA 3OOCA 3E0JA 3IAYA 4BWGB 3HP3A 5JOBA 5AJ3L 1RL2A 4DUZQ 4O1NA 2R7ZB 4BY1G 1GXDC 1LTRD 1Y8NB 3M7NA 4HJAA 1GUGA 4EGVA 3DEOA 1XNRL 5M3FB 2XIWA 5BR8L 1I50B 3CCVA 1E0BA 1YBYA 4GOPB 4DV7Q 3J7ZC 2BE5C 1LO5D 2KCMA 4QL5A 3T1HQ 1VQFA 4DUYQ 2B2TA 3F8TA 1HR0W 1HZAA 2QDBA 1TT2A 1GVPA 4YWKA 2G9HD 2JK8A 3CXCA 2NVTB 3HOYG 5A2QE 4MTKA 3A54A 3S1MH 1DGSA 3S1QB 4KD4A 3S2DB 4A3FH 5CYUA 2OQ0A 1NR4A 5IGDA 1STBA 1VQ4A 4BBSB 1KDAA 3J81L 4EVOA 2N49A 3MXNA 2NZOA 3TZDA 1YI2A 1NSNS 2K5HA 1CSPA 5EPLA 5G3LF 3J80c 3FMCA 1JJCB 3P1HA 3RNUA 1S40A 3CQZH 1SAPA 4DNIA 3PSIA 2VY3A 2C35B 2F0UA 1G91A 4OHJA 4DR5L 3W5OA 1U9RA 3PCOB 3S14B 5DM73 4IUVA 3SK4A 1VQAA 1PH6A 4YCVA 4P2CB 2B2VC 1TWAH 2KHJA 1SNOA 2MUYA 1SLJA 2ALYB 1VCIA 2DNEA 5M5WB 3S1RB 4NDXA 2DJGC 2MQHA 5C4XB 4DK3C 1Y1VG 1ENCA 3RZOB 1HRJA 2PNHA 4IPDA 1QUQA 5C5LA 3S24A 1PLFA 1DCZA 1LTTD 2Q2UA 1XX8A 4RHSA 3FEWX 4EQ5A 3M4OH 2B2YC 2KENA 3OTOL 3NQTA 1JWMD 3B6YA 1VF5C 1B9NA 1EY8A 3TSSA 4FXGC 2ID0A 5C0XI 1J5EL 2VQFL 1B50A 2K6AA 4X64Q 3VR6A 3J7YW 4DR1Q 1JT8A 4TVAB 4ZLTF 1EIHA 4BBRB 4IUPA 1KXLA 1N34Q 1YVCA 4JBKA 4RCNA 2H5XA 2JE6I 4JI3L 1D5XC 1LTSD 3RLOA 1TXYA 4A3IH 1O78A 4EQNA 1AH9A 4Y52H 2BDOA 1EZ6A 1WTVA 1Y8PB 2F0LA 5L37A 4KD3A 5T1GA 2XSCA 4KTAA 1KRTA 3UDFA 2F1MA 2JA5B 1WTQA 3DWPA 1EFID 2FJ2A 3TRZA 1TWCB 1PRTB 2UUCQ 3TQYA 3SE0A 2KCCA 1XTCD 2A5HA 3IFDA 5GAGC 3GTMB 4BY1H 3MXGA 3CCSA 3JAML 2NVYB 2B2UA 1JMCA 3HGBA 3DWQA 5KNBA 4IUUA 3J80i 1IBKL 5LL6X 4JW0A 3D8GA 4DAYA 1JWSD 1NR2A 1E2ZA 2G9DA 2EY5A 1PH5A 4FF3A 2K01A 4A3JB 1F2LA 5ELFA 1A8VA 1WTOA 1H9JA 3OW2A 3OSOA 3HOYH 5LMUL 4P75A 3R2TA 1H9RA 1PTOC 5HY6A 1XPUA 3T4AC 3W1GA 4DV5L 2HDMA 4CGYB 4V0BA 1ET6A 4X62Q 1FNWA 1AFPA 1O7LA 1DOMA 1V1PB 5M3FG 4R1JA 2LKVA 3QOJA 3PGZA 2KEEA 1YNXA 3EQLC 2WV6D 4FP5D 1C9OA 2YTVA 4A3GG 1BBWA 4KY6A 1SSOA 3EA6A 1GUNA 3I70A 3GTQH 1CZGA 1CZWA 5AFWA 3E9IA 3EIVA 2A19A 2MPMA 2OWOA 2F0EA 4DUZL 1WTWA 5DNFA 3M85A 4B3MQ 2A69C 4LWCA 2CW0C 3A5UA 4BBSG 1LTLA 4ZK9B 5I9OA 3AFQA 2FXQA 3S1NH 3TP5A 3Q23A 1Y1VH 4DV7L 3HOVB 2H4OA 3K8AA 3T1HL 4JV5Q 1JOOA 4DUYL 1PFNA 2E76C 4IPCA 2RCNA 4AYBE 3F2BA 2B3GA 1K9MC 2NTSA 4XQQA 4QQBX 2Q8RE 3GO5A 5JAVA 5EAYA 4UY8C 1U4MA 1Z9FA 1VQBA 5CV8A 1B9MA 1SJHD 1PTOD 1A6XA 5KEEA 3BVMA 4N8X1 2ZTCA 2GA4B 4J6HA 4AYBB 2MGSA 1G2SA 2JJQA 4IPHA 3TBIB 1I4RA 2Z6KC 3A5ZB 1ET9A 4A3CG 1F2MA 2EVBA 5BN4A 1N33Q 2E2DC 1K8GA 3AYHB 1O80A 2UUAL 1EY7A 2B8FA 3F2UA 4RH6A 4A3KG 1KLUD 4KHZA 4RGOS 4DAPA 2L15A 3KUPA 4N9TA 2Q8IB 2RHQB 5GAHC 1FGBD 4PZ7A 3G7LA 1MSHA 1E1TA 2A69D 3HOWG 1SXTA 2CW0D 2UXBQ 4UP8A 2L11A 3FPPA 2DJFC 2QW7A 5IT9c 2WAQE 4IFDG 1CKNA 3I4LA 5I9PA 4QIWB 5C5MA 4WJ3M 3SK8A 4DN4M 1SNMA 3I72A 2ASBA 2V1CC 3GTKB 3MC0B 1G6ZA 4KMUC 1A3VA 2JA5G 2NN6G 2VS1A 1S5ED 2CQOA 4UAIA 3EJIA 2R7ZH 1VQCA 2G5DA 5I6YA 4RA8A 1F9PA 4X64L 2WAQB 4DR1L 4H7BA 2JQOA 3TREA 5M3FH 3RMHA 1I50H 2F3VA 1N34L 3SHLA 4HJ9A 1A63A 4A3GH 4MN3A 5CGKA 2F0VA 4HSVA 4A3JG 2Z1CA 5IYDG 3NTKA 2NVTH 3X3MA 4V190 4FNFA 5BN3A 2UUCL 2IT1A 1NY4A 3S1QH 3KDFA 1W3SA 1EYGA 1K3BC 3S2DH 4WJ4A 1HZBA 2J7ZA 1GO3E 4EQOA 1RHPA 2ZXPA 4BBSH 3NK9A 3X3NA 1SYGA 4KK7A 3ND8A 3RN2A 4DK0A 1PYWD 3CKIB 1PH7A 1Y1WB 4F7XA 2DN8A 1EWHA 2L4NA 1F2YA 3C1FA 4B3TQ 1Q46A 1CKOA 1EY5A 1V8QA 4I65A 3S14H 2JA8B 2KBNA 1RCVD 1U0LA 1I3QB 2A74C 4PV1C 1HFNA 1YITA 4X62L 1UEBA 3V2TA 4DA2A 3U9OA 5JPNC 5IYBG 3H94A 5M5WH 3S1RH 3RZOH 1YHAA 3HOVG 4OIJA 4L6TB 5EKIA 1WD0A 3UDIA 3A8IE 4LAAA 3UE1A 4A3CH 2D62A 3CCUA 2FHTA 1XYIA 2IY5B 4JI8Q 4PNYA 2K32A 3CRKC 3CPWA 3GTLB 3FPUB 1I4QA 5JVG3 2IX0A 4B9XA 4IJLA 4ZUIA 5IP7G 1LM0A 2EY2A 2E8GA 4B3ML 5M3MB 1L0YB 1LYLA 2Z6BA 4QF4A 1SN8A 1HPCA 4C2MH 1CTMA 3R3OA 4DV1L 2IX3A 2OTJA 4G7HC 4AYBG 3PF5A 3HOWH 3DWAA 2B63B 3OIPA 1SE2A 2FMCA 2Z4IA 4JV5L 3HG9A 1EY9A 4LUZA 3W1BA 2EIFA 5C4JH 1PA6A 1P16A 4LFBQ 3NE5B 1Z47A 3J7AF 4IFDH 5GROA 3E5SA 3Q24A 3M4PA 2YU9B 1K3RA 4N9PA 3KLRA 4JI5Q 2Z9HA 2KHSA 3PUYA 1IHZA 5E7NA 5IY0A 2VUMB 2IW3A 4TKOB 1ONLA 2JA5H 4DPGA 1CKMA 2NN6H 3PUVA 1EQRA 1FNUA 1TWCH 3OMGA 4JI0L 2B2UC 1STAA 4A75A 1WTHA 4IOCA 4NKLA 1AZPA 2RVLA 2NVYH 1QNKA 2HD3A 2F03A 3GP7A 4GKKQ 3LWEA 4DR2Q 1HNZL 1BOSA 3T16A 1N33L 1ENFA 4XIGS 2EXDA 1FL0A 3K6OA 2JA7B 3KF8B 5IP9G 4KKUA 1KRSA 5NUCA 4A3JH 2R3ZA 5IYDH 4GKJQ 5C6AA 1NE3A 2HCCA 1Q1EA 1Q82C 1G2TA 3ZJYC 1EZ8A 3A7AB 2ZJQA 1Z7TA 1HQMC 2NVXB 2IHEA 5JEAG 1X3GA 2K5VA 2WAQG 2UXBL 3RD4A 3T53B 5M5XB 2YV5A 3FRPB 4AIMA 5GQOA 1VQGA 3PUWA 4LF8Q 3S9WA 3BZCA 3DHQA 5C4HA 2CHBD 2A1AA 1KAWA 4ZQ3A 3OWFA 1NUCA 4XT3B 2L12A 5FO7B 3H15A 2CVRA 2M2LA 3Q0AA 3M3YB 1GJXA 3UDGA 2BOSA 5M5YB 3LWUA 1SNPA 1CQFA 4A3BB 5C44B 1KHIA 2M00A 4GN3B 2Z6KA 1EFWA 4NXMQ 4R9WA 1FNVA 2Y0SB 1OXSC 3SK5A 1STGA 5IYBH 1WCMB 2KCTA 4K0KL 3NSWA 4HMJA 5JJZA 1OXUA 1SYFA 3BZKA 1TS4A 3MAQA 3HOVH 1N9WA 2OTLA 2JP1A 4B9WA 4HIDA 3K0YA 3H0GB 4XYOA 1BCPD 3JAME 3OHXC 3J7AV 4IQZA 3BJUA 3I8ZA 4H44C 1DD2A 3DMUA 1FJGL 1LT3D 2JA8G 1E1OA 3ULPA 1FYCA 2LS01 3WOFA 3STBD 3GTGB 3NBIA 5IP7H 5TSSA 1HNXQ 1ESRA 3U50C 3AB9A 2PW7A 4C3JB 2H1EA 3QG1A 5ELBA 4RG1A 3K7AB 2JXMB 1JOKA 3CRLC 2WB1E 2BDNA 4HMIA 4RMFA 1H9SA 4QCLA 2ZJRA 2KCNA 4LFAQ 1D1IA 3A74A 4DNTB 1X32A 3JC66 1BBUA 4B3TL 1PRTF 1C7YA 1Q8IA 2I5LX 3MXNB 3VR4A 2D9UA 3CU7A 4OL7A 3ULLA 3VA7A 4DFAA 4MHEA 3SK6A 3PV0A 4L8JA 5M9OA 3BDCA 3VR2A 5M3MG 2BH2A 1I6HB 5CBEE 2AUKA 4ZKBB 4CJ2C 1C0AA 4GLVB 3CP0A 1JICA 2PI2E 4NPSA 3FKIB 2JEAI 3F2DA 1K8OA 2B63G 2RDFA 1ZKOA 1D5MC 4FYDA 4GS3A 2AQ3B 4PMWA 5FJ8G 1UWVA 1B3QA 4O2DA 1HUMA 1PHJA 3K5MA 5CV9A 1RDPD 5IP9H 1VQKA 3GTKH 2DNCA 3CC4A 1QUQB 1GM5A 4L5TA 4X3TA 3GTJB 5G3LD 1EYCA 1B2TA 1EY4A 3LX0A 1L2FA 2EE1A 3Q6SA 2CH4W 5KIXA 3T1YQ 3FP9A 5JEAH 1R4QB 1NTGA 4LFBL 2I5HA 1I94L 2SDFA 2YTYA 1IZ6A 3K7UC 3WWVA 4L5RC 3NWSA 1CSQA 1PZJD 2JA7G 2FFKB 3H91A 3GD7A 2Q8TA 3T51B 3AMUA 1MJEA 2A6ED 1SFOB 2Z4HA 2AWNA 3ER0A 2PI2A 4H0LC 3CC7A 1GHJA 4DR7Q 4DV6Q 4AQYQ 3I4MB 1JJ2A 1EIFA 2F0OA 2M9VA 4GKKL 1VQ6A 1IL2A 4DR2L 4LK1C 4C1NI 4JI7Q 2IJ0A 1E22A 4RKBA 1KDBA 4NP5A 4WRDA 4FF2A 3S2HH 4EQPA 2MP1A 1IYVA 4HN7A 4DV2Q 1RJTA 2C5CA 2F0DA 1X9NA 1Q86C 2N3SA 1IBML 2A73B 3KLWA 4A3BG 4DAYB 5C44G 2VNUD 2JA8H 2E2HB 2J4XA 2WKDA 4IUQA 4NMZA 2Y0SG 3DEPA 1QZGA 1JORA 1B53A 2AUJD 4OGQC 2R7DA 4M1UB 5ELDA 1N32L 2XVSA 1AE3A 1GUOA 2QDLA 4DV3Q 2ZM6Q 4LF8L 4X3SA 4ZAIA 5FLMG 4RWSC 4YY3Q 5A35A 4LUVA 3BZDB 1G51A 3G71A 1EL0A 1ENAA 3H0GG 1H9KA 2R61A 4I7AA 2XGTA 5C3EB 4K8JA 1MKHA 2QGQA 1NAPA 2RDHA 4NW2A 3CPFA 1LABA 2E75C 2EYMA 2HUGA 4HSPA 3RLFA 3PQIA 3K0XA 4YHHQ 3PO3B 3GTLH 4POGA 3S17B 4PZ6A 4R4IA 3TEHB 2B29A 4NXML 5M3MH 4KHPQ 4C3JG 3DM1A 1CA5A 1VMCA 1YHBA 3G6EA 4B3RQ 3CAMA 5I4DA 1Y69U 4GNXA 2B63H 3UDXA 3D31A 5EKKA 5GAEC 3NXWA 2R7ZG 2ZJPA 4M8AA 1GHKA 1VQ5A 1HHVA 1A3TA 1IL8A 4J1MA 3SR1A 2R93B 5FJ8H 3NUCA 2YU9H 4A3MB 4DKAC 4CJ1B 1PZKD 1IYUA 1XXGA 2B39A 4MTNA 1HNXL 2P5ZX 2X69A 4RCOA 1TIID 2I46A 5FKAC 4L5QA 4ABNA 1WVLA 1VDZA 1PH1A 2D2CC 4A3LG 3FKIG 1ML0D 2KJXA 4R4TA 3SGIA 1VQHA 4DAMA 5H1SE 4X3KA 2F0FA 1W2BA 3EVQA 4LFAL 4G4KA 2HIVA 2EJFC 5IODA 5C3WA 2LY7A 4J8QA 2JA7H 3QB3A 2K28A 3R93A 2K05A 1ILPA 2RSOA 4CJ0B 2PPBC 4DXFA 1IW7D 5IT9E 4CKEA 1K8MA 1PH3A 3NENA 2ZT9C 2NVXH 3VYUA 5LMNQ 2K5WA 4IN3A 3P20A 3VR5A 4NXNQ 1TS3A 3D4WA 3NELA 4DV4Q 2Q2HA 5M5XH 3CC2A 4IFDJ 1KNAA 3ULJA 3MFGA 3AEVA 5FO8B 4DR3Q 2GN5A 4U673 4F87A 3NWTA 2PQAA 5C4XG 2EYPA 5IGGA 4A3EB 3M3YH 3H3VC 2HDLA 4A3BH 5C44H 1CKNB 3MXPA 2VL6A 4ZCKA 4IURA 4P72A 3A8KE 3T1YL 5EGTA 1PTOF 1HNWQ 1A2TA 3I4MG 1KLGD 1M1KC 1ICFB 4IALA 4DR4Q 2ENBA 1YJ9A 1CUKA 1I4GA 4TRDA 5J1ZA 1SBBB 3H3VI 1U4LA 4R8NA 5FLMH 1KQSA 4LF4Q 3CD6A 1T5XD 2AMCB 1BKBA 4KJOA 5FLXc 4LFCQ 3H0GH 1J9OA 1YNJC 3ERSX 3OIQA 1W6KA 3ITPA 4LMQD 4BBRG 2L55A 5IWAQ 2HQEA 3NTHA 1LTGD 2MO1A 4K5WA 4O42A 1LTBD 4IUTA 1CHPD 1LTID 4DR7L 4C3JH 4DV6L 1M90C 1X54A 4AQYL 3K7AH 1ILQA 1Q7YC 1WTPA 3CF5A 1VQJA 4OO1I 2O5IC 4JI7L 2N55A 2OXPA 3KDFB 1LACA 2DY7A 1HR0Q 2NVQB 4RGMA 1JB7A 1X65A 3OMCA 2PCFB 4HIMA 5C3EG 4DV2L 5KRUA 3C1EA 2WACA 1JB3A 1VMPA 4Q0FA 1TWHB 5IYCG 1YJWA 3PO3G 1GUWA 4ALPA 2R92B 4AH6A 3KOJA 3VDYA 5C3XA 1DM0B 2OT2A 1S3OA 1EIYB 1KAAA 1WFQA 1HTPA 5KGUA 1I6HH 1FD7D 2F3WA 5JVH3 1K28A 2EYOA 4FF1A 1I4PA 3QOLA 4ZUJA 4CKCA 4A3LH 3C46A 1SE4A 3FKIH 1B4OA 3MXUA 2ZM6L 1JE4A 5CV4A 4YY3L 2E5LQ 1OXTA 2B8GA 3I4NB 1Q90A 3P7JA 5DEHA 1HA5A 4LJZC 1NJIC 1MGSA 2BCOA 2R93G 2PZTA 4DGZA 2F0SA 4A3MG 4YHHL 2K1BA 1YNJD 1LV9A 4UP7A 3HOUB 1XNQQ 2HQLA 1HZ9A 3BS1A 3PIOA 2F0IA 4C3IB 2SOBA 2NBFA 4RGTA 3KFUA 4ID6A 3K59A 4KHPL 1BO0A 5LHY1 3TDQA 4LNQA 4OWWB 2HCIA 2KOLA 1A15A 1CI3M 4B3RL 1PH8A 3BVGA 2EY1A 1VF7A 4GOPC 1SE3A 1SR3A 1STYA 4IOAA 4X3UA 2PZWA 3I90A 1HUNA 3BVZA 1VQ9A 3E0EA 2F0NA 5C4XH 3K81C 3L7ZC 1EWCA 3PUZA 2VQEQ 1X3QA 1STNA 4CDCC 1PTOB 1X55A 1SFOH 1M8AA 5IT9L 1EY0A 3S16B 2FINB 1K73C 2XN9C 4ODGA 1VQLA 3HRZC 1VQMA 1KC8C 2E2JB 1JQYD 3MFYA 1E3PA 1WD1A 4YWLA 1X3PA 2KUMA 4FO2A 3I4MH 1S4ZA 3DM3A 1C4QA 1I6VC 3GDEA 3QO2A 5C4ZA 4JCVE 1QWYA 2IL8A 2UXCQ 2DGYA 3NBHA 1PFBA 4P73A 3MHBA 1YHQA 5BN5A 3CHBD 1BQQT 5C0XJ 4A3EG 2F0TA 1DJRD 1C48A 3E6ZX 4BBRH 4YIJA 2YTXA 4JC0A 3CMAA 5JEAJ 3GTOB 3HKZE 2ZXOA 1DONA 1PH2A 5LMNL 5J3BA 3OPOA 4NXNL 4WFN3 3Q22A 1P8LA 4LF5Q 1HH2P 5I6WA 4OWTB 1GKHA 3NP8A 1CQVA 2CH4A 1CHQD 2Z8LA 3KK7A 1KD1C 1STEA 5ELEA 4UDUC 4A76A 4G7ZC 3M4QA 2MO0A 3GTMH 1RIPA 4JK1C 3HKZB 1LTAD 1Q12A 1TWGB 5C3EH 1NCVA 3HFZB 1MD2D 1NMGA 3CCEA 1B1ZA 4K6LA 5HURA 5KNDA 5IYCH 3PO3H 3PO2B 1BCPC 4B08A 4DR6Q 3S17H 1GUSA 3RN5A 1L1OA 1PYSB 4F88A 2TSSA 3C2PA 4DXGA 1HNWL 4BY7B 1SE8A 4B3SQ 2RSNA 3HOXB 4KY5A 4KY7A 1CM9A 1KL9A 1SNCA 3K57A 4GNXC 1F9RA 3AFPA 3STBC 4DR4L 3M9BA 1SROA 4FDBA 2DUDA 5C0XG 1BUVT 5IGCA 1IBLQ 4LF4L 2KEDA 2RDGA 4LFCL 3VR3A 5EBCA 2QEJC 5I2XA 1K0SA 3I3CA 4X65Q 2R93H 1DZ1A 4JBMA 5IWAL 3S1NB 4A3MH 2ZTEA 2AWOA 4K2KA 4DV0Q 2R92G 1TY2A 3WDNA 1S5BD 1AN8A 3I7FA 1V9PA
chains in the Genus database with same CATH topology
1TS5A 2PQEA 2XWBB 1U4RA 3L3OC 4FVMA 3TN2A 2L0CA 2EJMA 1ZYRD 1PFMA 5J39A 2QILA 1KTKA 1BNZA 3O13A 4HTHA 1QCBD 2EYJA 2IWHA 1H9SB 4CHTB 4DK1A 3U9SA 2TMPA 1QJOA 1E2VA 1LT4D 1F9SA 3A55A 4C3IG 1K83B 1LT6D 1IKMA 3BYTB 1U4PA 3A8JE 3KBXA 4BA1I 1R9TB 2L5TA 3V05A 2KQ3A 3G6JB 5HGTA 3J80E 3K5OA 2EYHA 2QF7A 3PIO3 4CBVA 4HAEA 1I4XA 2RQXA 4K5XA 5KYIA 1ICWA 1W6JA 3SVMA 4U68A 2D5DA 3HZXA 1PRTD 4DF7A 2A6EC 3MWYW 3K58A 5ELCA 1SYCA 4RGNA 3L9AX 4ZKCB 1SYBA 2WB1B 4F8MA 5COYA 3RUZA 1TR5A 3EROA 3RZDB 3S15B 4WORA 5FOBB 2NTTA 4K6DA 1ESFA 1YNND 2AQ1B 3H6MA 3TZUA 4A3GB 2K03A 3N52A 4FF4A 2N88A 2WP8J 1RD9D 2EY6A 4BA2I 1B3AA 1Z6HA 2MHVA 5C0XH 3BDLA 3TP8A 2F0JA 2KVMA 1T5EA 2JA6B 4G7OC 2XRSD 5EPJA 3GV3A 4FXKC 1EOTA 2YYZA 1JWUD 1UEAB 1DYQA 5JPMC 1PDQA 1QG7A 3HOZB 5EPKA 1MSGA 1B44D 1TKWB 1QOHA 2L1BA 1TWFB 2X6GA 2KA7A 5EBDA 1Q3LA 5CORA 5K36G 2PYKA 3A56A 2L9HA 2PZUA 3DXJC 4BS9A 4KJNA 5DAUA 1AW7A 1GOZA 1RODA 2BE5D 2B2WA 2EYFA 1D6EC 1SJED 4KI0A 3NHHA 3NTIA 4OO1G 1V1OA 3DUZA 3FDTA 4A3KB 4PMCA 1BCPB 2J0TD 1S5FD 1EU3A 4C2MB 3MVVA 1OXVA 3ONAB 4Q5VA 2EZVA 4TQUS 1EY6A 3HOWB 4DAVA 1KNEA 2O4XA 2PO4A 2F0MA 3EFXD 1BDOA 5C4JB 1PTOH 2A6HC 4KKSA 3A7LA 4K8IA 1IW7C 1TVXA 1G291 2NWGA 4XXEA 3J80L 1C8CA 1OXXK 1WTXA 1F9QA 5CC4A 4K5VA 2QCPX 2IPKD 3TMEA 2NB0A 3ZYYX 4A3DB 1HFGA 5IOCA 1UNSA 4R8IA 2BA0A 4PMBA 1HA6A 3QWNA 3D6WA 1SNQA 3I91A 1EEID 2VXWA 1RTOA 4MIUA 5EJWA 2ICEC 1PZID 1RTNA 1O7YA 5CBAE 2FMMA 2O5JC 1PMRA 4IZ8A 5D65A 4Z9CB 4KV6A 1II3A 1J8IA 3H09A 1UUPA 1QE6A 2JYOA 5IGEA 3GQBA 3OW7A 5FLXE 1SYEA 2A6HD 4E6IA 1TY0A 2E2IB 4QMGA 4DU9A 1DXMA 5K5PA 1S5DD 5DM63 2OF1A 5A2QL 1EIGA 1DOKA 4C3HB 4L63B 1V43A 1MBYA 1EQVA 5E4XA 4HR7B 4XQJA 1CA6A 1HXYD 3TP6A 5K36H 1V1PA 2JEBI 2EOTA 2V4DA 5E1FA 3M4YA 4Y7NB 3K5LA 1EU4A 2PNRC 3GTPB 2LMCB 4KHVA 3HS0C 2WIIB 4OO1H 1Q1BA 3MEHA 2XRQD 2NYZD 1JOQA 2SNSA 1R4PB 4A93B 2VB3X 4C56C 1TS2A 3SDZA 1G8ZD 5IIFA 1HQRD 5D3DA 1JR0D 1ZXTA 4ULLA 4HCEA 1QNUA 3GV6A 5J22A 3HEJA 3D6CA 1JCKB 4QB4A 5CV5A 3PUXA 2DY8A 1CK1A 4KKTA 1RF2D 1A3UA 3BYYB 4I7ZC 3MTSA 3ERQA 2F0WA 3KLSA 2F0KA 3S1MB 2F0HA 5D3IB 2F0QA 4A3FB 3BDOA 1GUTA 1TQOA 2C9OA 2IX1A 3BG3A 1ZEQX 5IGFA 4ZRZA 3IFTA 4G57A 3PIP3 2EXZA 4FXDA 3CQZB 3M7GA 2EDGA 1M4VA 4ZYSA 3IL8A 3W3AA 3TP7A 1CT1D 3PMFA 2B2TC 1TWAB 2PMZB 2XNAC 2A68C 4S3SA 4TSSA 1HCZA 2B2VA 2QKIC 1EQTA 3P75A 2SEBD 2EPBA 1L0XB 5ISRA 1A2UA 5D14A 1S5CD 3M4OB 1H9MA 3SXHA 4WJWA 5LL6S 4XT1B 1D1KA 1FR3A 1TU2B 1AEXA 5E3FA 2B2YA 5EQ0A 1QB5D 3S2HB 1OO9B 3C3LA 1AZQA 4DNRB 3IKJA 5FLXL 2F4IA 3R2IA 2KECA 3FVQA 1D5ZC 4C3HG 4A3IB 4XYQA 4PQXA 4KN4C 2B2WC 2E74C 5CV6A 4BY1B 3UI2A 2A68D 3K5NA 2AQ2B 2EYLA 3VA5A 2NZ1D 2ICIA 3NQIA 1D2BA 3MA2B 5E4WC 4QUCA 1Y8OB 1BBXC 4GZYC 5CR3A 1SDFA 3V96A 1KDCA 2OEOA 1ZYRC 3KLSX 3R8BA 3HOYB 1E2WA 4CKBA 2RKSA 3D4DA 2XWJB 4HCSA 2F0GA 1BR9A 2I07B 3J81E 2BA1A 2O2LD 3AU7A 4XDXA 3QJYA 4JBWA 1JC7A 4H13C 2SNMA 3VYTA 5CV7A 4IUNA 3GTQB 1QILA 2ZXRA 2X6LA 2K5DA 2PW5A 4RHRA 1LT5D 1WTRA 5EKLA 3N6RA 3QIAA 5FK9C 2K33A 5IGBA 1HTLD 1EYAA 2K7VA 3D4RA 3URYA 4ME5A 4K14A 1F2ZA 1Y1VB 5F2DA 3VYRA 5KNCA 4KN7C 1PXUA 1PRTC 1F77A 2WKCA 4RKLA 1CFMA 5KYLA 4IFDI 1SMYC 5T1IA 4QUFA 2WINB 4K2LA 1BF4A 1MI2A 3LNNA 4XTCS 1KABA 3VYSA 3T56B 1O7ZA 2RBMA 1SYDA 2NN6I 4ILWA 1STHA 2RA4A 3T13A 1IKLA 5CMDA 2CQAA 2VB2X 1UAPA 1SEBD 3KF8A 2JSOA 1YNNC 1DOLA 2R6GA 4OIKA 2EJGC 1RKNA 1I4HA 3I73A 5I2YA 1EEFD 1BXTA 2NUCA 3ND9A 3WOEA 4XQNA 2F0PA 4C1NK 3D3RA 3OWEB 1AP0A 1SNDA 1BCPF 3MZ5A 3NPPA 1LLRD 3W2DA 4RFBA 2K5QA 5FO9B 2LFNA 1XWEA 1EYDA 3KBGA 2MJ8A 4RAUC 1SMYD 2K04A 3SEBA 4HEDA 3OOCA 3E0JA 3IAYA 4BWGB 3HP3A 5JOBA 4O1NA 2R7ZB 1GXDC 1LTRD 1Y8NB 3M7NA 1GUGA 4EGVA 3DEOA 5M3FB 2XIWA 1I50B 1E0BA 2BE5C 1LO5D 2B2TA 2QDBA 1TT2A 2G9HD 2NVTB 5A2QE 3A54A 3S1QB 4KD4A 3S2DB 5CYUA 1NR4A 5IGDA 1STBA 4BBSB 1KDAA 3J81L 4EVOA 3MXNA 3TZDA 1NSNS 5EPLA 5G3LF 3FMCA 3P1HA 1SAPA 2F0UA 1G91A 4OHJA 1U9RA 3S14B 5DM73 4IUVA 3SK4A 4P2CB 2B2VC 1SNOA 2MUYA 1VCIA 2DNEA 5M5WB 3S1RB 4NDXA 5C4XB 1ENCA 3RZOB 1HRJA 5C5LA 1PLFA 1DCZA 1LTTD 1XX8A 4RHSA 3FEWX 2B2YC 3NQTA 1JWMD 1VF5C 1B9NA 1EY8A 3TSSA 4FXGC 2ID0A 5C0XI 1B50A 2K6AA 3VR6A 3J7YW 1EIHA 4ZLTF 4BBRB 4IUPA 4RCNA 2JE6I 1D5XC 1LTSD 1O78A 4EQNA 2BDOA 1EZ6A 1WTVA 1Y8PB 2F0LA 4KD3A 5T1GA 2XSCA 4KTAA 2F1MA 2JA5B 1WTQA 3DWPA 1EFID 2FJ2A 1TWCB 1PRTB 3SE0A 2KCCA 1XTCD 2A5HA 3IFDA 3GTMB 3MXGA 3JAML 2NVYB 2B2UA 3HGBA 3DWQA 5KNBA 4IUUA 5LL6X 4DAYA 3D8GA 1JWSD 1NR2A 1E2ZA 2G9DA 2EY5A 4FF3A 2K01A 4A3JB 1F2LA 5ELFA 1WTOA 1H9JA 3OSOA 3R2TA 1H9RA 1PTOC 3T4AC 2HDMA 4CGYB 4V0BA 1ET6A 1FNWA 1AFPA 1DOMA 1O7LA 1V1PB 2LKVA 3QOJA 2KEEA 3EQLC 2WV6D 4FP5D 4KY6A 1SSOA 3EA6A 1GUNA 3I70A 1CZGA 1CZWA 5AFWA 2MPMA 2F0EA 1WTWA 5DNFA 3M85A 2A69C 2CW0C 5I9OA 4ZK9B 3TP5A 3Q23A 3HOVB 2H4OA 1JOOA 1PFNA 2E76C 2NTSA 4XQQA 2Q8RE 3GO5A 5JAVA 1U4MA 5CV8A 1B9MA 1SJHD 1PTOD 1A6XA 5KEEA 3BVMA 2GA4B 4J6HA 4AYBB 2MGSA 1G2SA 3TBIB 1I4RA 1ET9A 1F2MA 2EVBA 5BN4A 2E2DC 1O80A 1EY7A 2B8FA 3F2UA 4RH6A 1KLUD 4KHZA 4RGOS 4DAPA 3KUPA 4N9TA 2Q8IB 1FGBD 3G7LA 1MSHA 2A69D 1SXTA 2CW0D 2L11A 3FPPA 4IFDG 3I4LA 5I9PA 4QIWB 5C5MA 3SK8A 4DN4M 1SNMA 3I72A 3GTKB 3MC0B 1G6ZA 4KMUC 1A3VA 2NN6G 1S5ED 4UAIA 3EJIA 5I6YA 4RA8A 1F9PA 2WAQB 4H7BA 3RMHA 2F3VA 3SHLA 4MN3A 5CGKA 2F0VA 4HSVA 2Z1CA 3NTKA 3X3MA 4V190 4FNFA 5BN3A 2IT1A 2J7ZA 4EQOA 1RHPA 2ZXPA 3NK9A 3X3NA 1SYGA 4KK7A 3ND8A 4DK0A 1PYWD 3CKIB 1Y1WB 4F7XA 2DN8A 1EWHA 2L4NA 1F2YA 3C1FA 1EY5A 1V8QA 4I65A 2JA8B 1RCVD 1I3QB 2A74C 4PV1C 1HFNA 3V2TA 4DA2A 3U9OA 5JPNC 3H94A 4OIJA 4L6TB 5EKIA 1WD0A 3A8IE 4LAAA 2D62A 2FHTA 1XYIA 4PNYA 2K32A 3CRKC 3GTLB 3FPUB 1I4QA 5JVG3 2IX0A 4B9XA 4ZUIA 2EY2A 5M3MB 1L0YB 4QF4A 1HPCA 1CTMA 3R3OA 2IX3A 4G7HC 3DWAA 2B63B 3OIPA 1SE2A 2FMCA 2Z4IA 3HG9A 1EY9A 3NE5B 1Z47A 3J7AF 4IFDH 3E5SA 3Q24A 2YU9B 4N9PA 3KLRA 2KHSA 3PUYA 1IHZA 2VUMB 2IW3A 4TKOB 1ONLA 2NN6H 3PUVA 1FNUA 3OMGA 2B2UC 1STAA 4NKLA 1AZPA 2RVLA 1QNKA 2F03A 3GP7A 3LWEA 1BOSA 3T16A 1ENFA 4XIGS 3K6OA 2JA7B 4KKUA 5NUCA 2R3ZA 5C6AA 2HCCA 1Q1EA 1G2TA 1EZ8A 3A7AB 1Z7TA 1HQMC 2NVXB 5JEAG 3RD4A 3T53B 5M5XB 3FRPB 3PUWA 3S9WA 5C4HA 3DHQA 2CHBD 4ZQ3A 3OWFA 1NUCA 4XT3B 2L12A 5FO7B 2CVRA 2M2LA 3Q0AA 3M3YB 1GJXA 2BOSA 5M5YB 3LWUA 1SNPA 1CQFA 4A3BB 5C44B 2M00A 4R9WA 1FNVA 2Y0SB 1OXSC 3SK5A 1STGA 1WCMB 3NSWA 4HMJA 5JJZA 1OXUA 1SYFA 1TS4A 3MAQA 2JP1A 4B9WA 3K0YA 3H0GB 4XYOA 1BCPD 3JAME 3OHXC 3J7AV 4IQZA 3I8ZA 4H44C 1DD2A 3DMUA 1LT3D 1FYCA 2LS01 3WOFA 3GTGB 3NBIA 5TSSA 1ESRA 3AB9A 2PW7A 4C3JB 2H1EA 3QG1A 5ELBA 3K7AB 2JXMB 1JOKA 3CRLC 2BDNA 4HMIA 1H9SA 4QCLA 2KCNA 1D1IA 4DNTB 1X32A 1PRTF 1Q8IA 3VR4A 2D9UA 3CU7A 4OL7A 3VA7A 4DFAA 4MHEA 3SK6A 3PV0A 4L8JA 5M9OA 3BDCA 3VR2A 1I6HB 5CBEE 2AUKA 4ZKBB 4CJ2C 1JICA 3FKIB 2JEAI 1K8OA 2RDFA 1ZKOA 1D5MC 4FYDA 2AQ3B 4PMWA 1HUMA 3K5MA 5CV9A 1RDPD 2DNCA 4X3TA 3GTJB 5G3LD 1EYCA 1B2TA 1EY4A 3LX0A 2EE1A 3Q6SA 5KIXA 5JEAH 1R4QB 2SDFA 3NWSA 1PZJD 2FFKB 3H91A 3GD7A 2Q8TA 3T51B 3AMUA 2A6ED 1SFOB 2Z4HA 2AWNA 4H0LC 1GHJA 3I4MB 2F0OA 2M9VA 4LK1C 4C1NI 2IJ0A 4WRDA 4RKBA 1KDBA 4NP5A 4FF2A 4EQPA 2MP1A 1IYVA 4HN7A 1RJTA 2C5CA 2F0DA 2A73B 2VNUD 2E2HB 2J4XA 2WKDA 4IUQA 4NMZA 3DEPA 1JORA 1B53A 2AUJD 4OGQC 4M1UB 5ELDA 2XVSA 1GUOA 4X3SA 4ZAIA 4RWSC 5A35A 3BZDB 1EL0A 1ENAA 1H9KA 2R61A 5C3EB 4K8JA 1NAPA 2RDHA 4NW2A 1LABA 2E75C 2EYMA 2HUGA 4HSPA 3RLFA 3PO3B 3S17B 4C3JG 3DM1A 1CA5A 1VMCA 1Y69U 5I4DA 3D31A 5EKKA 3NXWA 4M8AA 1GHKA 1HHVA 1A3TA 1IL8A 4J1MA 3SR1A 2R93B 3NUCA 4A3MB 4CJ1B 1PZKD 1IYUA 1XXGA 2B39A 2X69A 4RCOA 1TIID 2I46A 5FKAC 4ABNA 1WVLA 1VDZA 2D2CC 1ML0D 2KJXA 4X3KA 2F0FA 3EVQA 4G4KA 2EJFC 5IODA 5C3WA 2LY7A 4J8QA 3QB3A 2K28A 3R93A 2K05A 1ILPA 2RSOA 4CJ0B 2PPBC 4DXFA 1IW7D 5IT9E 4CKEA 1K8MA 2ZT9C 3VYUA 2K5WA 4IN3A 3P20A 3VR5A 1TS3A 3D4WA 4IFDJ 1KNAA 3MFGA 5FO8B 4U673 4F87A 3NWTA 2EYPA 5IGGA 4A3EB 3H3VC 2HDLA 3MXPA 4IURA 3A8KE 5EGTA 1PTOF 1A2TA 1KLGD 4IALA 2ENBA 4TRDA 1I4GA 5J1ZA 1SBBB 1U4LA 4R8NA 1T5XD 4KJOA 1J9OA 1YNJC 3OIQA 1W6KA 3ITPA 4LMQD 2L55A 2HQEA 3NTHA 1LTGD 4K5WA 4O42A 1LTBD 4IUTA 1CHPD 1LTID 1ILQA 1WTPA 4OO1I 2O5IC 2N55A 2OXPA 1LACA 2DY7A 2NVQB 4RGMA 3OMCA 2PCFB 5KRUA 3C1EA 2WACA 1JB3A 1VMPA 4Q0FA 1TWHB 1GUWA 2R92B 5C3XA 1DM0B 2OT2A 1KAAA 1HTPA 5KGUA 1FD7D 2F3WA 5JVH3 2EYOA 4FF1A 1I4PA 3QOLA 4ZUJA 4CKCA 3C46A 1SE4A 1B4OA 3MXUA 1JE4A 5CV4A 1OXTA 2B8GA 3I4NB 1Q90A 3P7JA 5DEHA 1HA5A 4LJZC 1MGSA 2BCOA 2PZTA 4DGZA 2F0SA 2K1BA 1YNJD 1LV9A 3HOUB 3BS1A 4C3IB 2F0IA 2SOBA 2NBFA 4RGTA 4ID6A 3K59A 1BO0A 5LHY1 3TDQA 2HCIA 2KOLA 1A15A 1CI3M 3BVGA 2EY1A 1VF7A 1SE3A 1STYA 4X3UA 2PZWA 3I90A 1HUNA 3BVZA 2F0NA 3L7ZC 1EWCA 3PUZA 1X3QA 1STNA 1PTOB 1M8AA 5IT9L 1EY0A 3S16B 2FINB 2XN9C 4ODGA 3HRZC 2E2JB 1JQYD 3MFYA 1WD1A 1X3PA 2KUMA 4FO2A 1S4ZA 1C4QA 1I6VC 3QO2A 5C4ZA 1QWYA 2IL8A 3NBHA 1PFBA 3MHBA 5BN5A 3CHBD 1BQQT 5C0XJ 2F0TA 1DJRD 1C48A 3E6ZX 4YIJA 5JEAJ 3GTOB 2ZXOA 1DONA 3OPOA 4WFN3 3Q22A 5I6WA 1CQVA 2Z8LA 3KK7A 1CHQD 3NP8A 1STEA 5ELEA 4UDUC 4G7ZC 4JK1C 3HKZB 1LTAD 1Q12A 1TWGB 1NCVA 1MD2D 1B1ZA 4K6LA 5HURA 5KNDA 3PO2B 1BCPC 4B08A 1GUSA 4F88A 2TSSA 3C2PA 4DXGA 4BY7B 2RSNA 3HOXB 4KY5A 4KY7A 1CM9A 1SNCA 3K57A 1F9RA 5C0XG 1BUVT 5IGCA 2KEDA 2RDGA 3VR3A 5EBCA 2QEJC 5I2XA 3I3CA 1DZ1A 3S1NB 4K2KA 2AWOA 1TY2A 3WDNA 1S5BD 1AN8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PQE A;  1EY0 A;  4H7B A;  5I9O A;  2PW5 A;  4B9W A;  1EY9 A;  2SNS A;  5JOB A;  1AEX A;  4K5W A;  4ODG A;  2EY6 A;  5E3F A;  2F3V A;  3TP5 A;  3SHL A;  5EKL A;  5CC4 A;  3E5S A;  3BDL A;  3DMU A;  4K5V A;  5IIF A;  5IGB A;  1JOO A;  3TP8 A;  3SXH A;  2F0J A;  4N9P A;  1EYA A;  5CGK A;  5J39 A;  3TME A;  2KHS A;  2F0V A;  5C4Z A;  1IHZ A;  4HTH A;  4ME5 A;  2OXP A;  4K14 A;  5IOC A;  1F2Z A;  5F2D A;  2EYJ A;  2F0F A;  5JAV A;  2PW7 A;  3EVQ A;  4PMB A;  2F0O A;  4EQN A;  3OMG A;  1JOK A;  3MHB A;  5CV8 A;  3OMC A;  1EZ6 A;  4RKL A;  1SNQ A;  5J22 A;  2QDB A;  1STA A;  1TT2 A;  2F0L A;  3C1E A;  1KDB A;  2F0T A;  3D6C A;  3HEJ A;  2WAC A;  4HMI A;  4KD3 A;  4NP5 A;  4RKB A;  4KTA A;  5C3W A;  5IOD A;  4NKL A;  4K2L A;  4QB4 A;  4YIJ A;  4EQO A;  4MIU A;  4EQP A;  5CV5 A;  1KAB A;  3NK9 A;  3QB3 A;  5KEE A;  1SYG A;  5C3X A;  2F0D A;  4J6H A;  1A3U A;  4KD4 A;  3T16 A;  1KAA A;  2RBM A;  5KGU A;  1SYD A;  2KQ3 A;  5I6W A;  2F3W A;  5IGD A;  1STB A;  1STH A;  2EYO A;  3ERQ A;  3T13 A;  1KDA A;  4OL7 A;  4F7X A;  5HGT A;  3NP8 A;  2F0W A;  4DFA A;  3QOL A;  4EVO A;  4ZUJ A;  1F2M A;  2F0K A;  1F2Y A;  2EYH A;  2F0H A;  5NUC A;  5CV6 A;  3SK6 A;  5M9O A;  3C1F A;  4IZ8 A;  3BDC A;  2PYK A;  2F0Q A;  3D8G A;  4NMZ A;  3D4W A;  1NSN S;  4KV6 A;  1II3 A;  5CV4 A;  2PZU A;  5C6A A;  1EY5 A;  1JOR A;  1EZ8 A;  4I65 A;  1EY7 A;  2EYL A;  3P1H A;  5DEH A;  3VA5 A;  5IGE A;  1TQO A;  1RKN A;  2EY5 A;  4KJN A;  4K5X A;  5DAU A;  5KYI A;  2PZT A;  2F0U A;  1JOQ A;  1SYE A;  3OSO A;  4E6I A;  4DGZ A;  5IGF A;  3V2T A;  4N9T A;  2F0S A;  4QMG A;  5CR3 A;  5HUR A;  2RDF A;  4G57 A;  3U9O A;  2EYF A;  1U9R A;  4DU9 A;  2EXZ A;  5K5P A;  1ENA A;  2OF1 A;  3NHH A;  2NUC A;  3HZX A;  1KDC A;  2OEO A;  3SK4 A;  2EYP A;  4DF7 A;  4K8J A;  5IGG A;  4WRD A;  2F0P A;  3S9W A;  2F0I A;  2SOB A;  2EYM A;  3DHQ A;  1SYC A;  3TP7 A;  5C4H A;  4ID6 A;  1SNO A;  4KY5 A;  4LAA A;  4PMC A;  4KY7 A;  5I9P A;  5CV9 A;  1EQV A;  1SNC A;  5KRU A;  1SYB A;  2RKS A;  4ZQ3 A;  3OWF A;  3MXP A;  1SND A;  1NUC A;  2LKV A;  3D4D A;  3PMF A;  3QOJ A;  4NDX A;  3TP6 A;  5EGT A;  3MVV A;  1ENC A;  1EYC A;  4F8M A;  2F0G A;  2EY1 A;  3MZ5 A;  1A2T A;  4PNY A;  5C5M A;  1EY6 A;  3RUZ A;  1SNP A;  1TR5 A;  3SK8 A;  3ERO A;  5IGC A;  1EY4 A;  1SNM A;  1STY A;  2M00 A;  4IAL A;  4KY6 A;  4S3S A;  4WOR A;  2O4X A;  2ENB A;  3LX0 A;  5C5L A;  5E1F A;  5KIX A;  4B9X A;  2F0M A;  2PZW A;  4TRD A;  5J1Z A;  4K6D A;  4ZUI A;  2EY2 A;  3P75 A;  1A3V A;  4R8N A;  4QF4 A;  5EKK A;  3NXW A;  4KHV A;  2SNM A;  4K2K A;  4KJO A;  1STG A;  3SK5 A;  2F0N A;  1EYD A;  2F0E A;  3EJI A;  1A3T A;  5CV7 A;  5ISR A;  3H6M A;  4IUN A;  4K8I A;  3R3O A;  5KYL A;  3MEH A;  4HMJ A;  1A2U A;  3ITP A;  1SYF A;  4J1M A;  3NQT A;  3SR1 A;  5I6Y A;  1STN A;  1EY8 A;  3NUC A;  2HQE A; 
#chains in the Genus database with same CATH topology
 1TS5 A;  2PQE A;  2XWB B;  1U4R A;  3L3O C;  1E24 A;  4JI1 Q;  4FVM A;  3TN2 A;  2L0C A;  2EJM A;  1ZYR D;  3CME A;  1HR0 L;  1PFM A;  3I4N G;  3DLL A;  5J39 A;  1B70 B;  2QIL A;  2GVA A;  1KTK A;  1BNZ A;  3O13 A;  5DLQ E;  4HTH A;  3J81 c;  1QCB D;  2EYJ A;  2XTI A;  3CCL A;  2IWH A;  1H9S B;  4CHT B;  4DK1 A;  3HOU G;  3U9S A;  2TMP A;  1QJO A;  1E2V A;  4GN5 A;  1LT4 D;  4J15 A;  1F9S A;  1Y1W G;  3A55 A;  4C3I G;  1K83 B;  1LT6 D;  1IKM A;  3BYT B;  1U4P A;  3A8J E;  4OWX B;  1QZH A;  3KBX A;  4BA1 I;  2F3I A;  2UXD Q;  4OX9 Q;  1R9T B;  2L5T A;  3V05 A;  4PG3 A;  1XPR A;  2KQ3 A;  4X66 Q;  3G6J B;  2NZH A;  2E5L L;  5HGT A;  3J80 E;  4H02 A;  5LMU Q;  3K5O A;  2EYH A;  2QF7 A;  4R4O A;  3PIO 3;  4DK6 C;  4CBV A;  4HAE A;  3J7A 5;  3F1Z A;  4OEL B;  1I4X A;  4JVZ A;  2RQX A;  4K5X A;  1XNQ L;  5KYI A;  1WI5 A;  2LSS A;  2RHS B;  4A3E H;  1ICW A;  1W6J A;  3SVM A;  4U68 A;  2D5D A;  1ASZ A;  3HZX A;  1PRT D;  4DF7 A;  2A6E C;  3MWY W;  3K58 A;  5ELC A;  1SYC A;  4HJ8 A;  4RGN A;  3L9A X;  4ZKC B;  1SYB A;  2WB1 B;  4APV A;  3IRB A;  1XJV A;  1SRU A;  3KF6 A;  5COY A;  4F8M A;  3RUZ A;  1TR5 A;  3ERO A;  1FVI A;  3RZD B;  3BU2 A;  3S15 B;  5JJI A;  4WOR A;  5ELN A;  5FOB B;  2NTT A;  4K6D A;  2VQE L;  1WYD A;  3G48 A;  4JPB W;  2RCF A;  1ESF A;  1YNN D;  2AQ1 B;  2K50 A;  3H6M A;  3TZU A;  4A3G B;  4JI8 L;  2K03 A;  3N52 A;  4FF4 A;  2N88 A;  3A0J A;  2VUM G;  2WP8 J;  1RD9 D;  2EY6 A;  4UP9 A;  4BA2 I;  1B3A A;  1Z6H A;  2MHV A;  2N78 A;  4MNO A;  3J81 i;  2UXC L;  5C0X H;  3U4Z A;  2NVQ H;  3BDL A;  3CCQ A;  3TP8 A;  3I55 A;  2F0J A;  3JAM c;  2KVM A;  3HKZ G;  1G6P A;  4YCW A;  1T5E A;  2JA6 B;  4UPA A;  4CDD C;  4G7O C;  1TWH H;  3PO2 G;  2XRS D;  5EPJ A;  2R92 H;  4GOP A;  1XMO Q;  3GV3 A;  4IO9 A;  1E7Z A;  4FXK C;  4BY7 G;  4JI6 Q;  1EOT A;  3HOX G;  2YYZ A;  4LF5 L;  4JI5 L;  1JWU D;  1UEA B;  1DYQ A;  5JPM C;  1PDQ A;  1YEZ A;  2IHF A;  1QG7 A;  2UUA Q;  4JI4 Q;  3HOZ B;  5EPK A;  1MSG A;  1B44 D;  1TKW B;  1QOH A;  2OCE A;  2GVB A;  2L1B A;  3I4N H;  1TWF B;  3J81 j;  2X6G A;  2KA7 A;  3UE0 A;  5EBD A;  2UU9 Q;  1Q3L A;  3CCJ A;  5COR A;  5K36 G;  2PYK A;  1IYJ B;  3A56 A;  3I4O A;  2L9H A;  2PZU A;  1S72 A;  3DXJ C;  4BS9 A;  2ES2 A;  3HOU H;  4DR6 L;  4OON A;  1VS0 A;  4KJN A;  5DAU A;  1AW7 A;  1Y1W H;  1GOZ A;  1ROD A;  4C3I H;  4B3S L;  2F4V Q;  2BE5 D;  2B2W A;  2EYF A;  1D6E C;  4QY7 A;  1SJE D;  1SMX A;  4KI0 A;  3NHH A;  3NTI A;  2K75 A;  4GKJ L;  4OO1 G;  1V1O A;  1XPO A;  3DUZ A;  3FDT A;  4A3K B;  4PMC A;  1BCP B;  2J0T D;  1IBL L;  1I3Q H;  1S5F D;  4MZ9 A;  2HHH Q;  4UHV A;  1D7Q A;  1QVF A;  1EU3 A;  4X65 L;  4C2M B;  3MVV A;  1OXV A;  3ONA B;  1L0W A;  4Q5V A;  2EZV A;  1WCM G;  4YCU A;  4TQU S;  1EY6 A;  3PIP A;  3KJO A;  3HOW B;  4DAV A;  4GNX B;  1KNE A;  3AQQ A;  4DV0 L;  2O4X A;  2PO4 A;  2F0M A;  3EFX D;  1BDO A;  5C4J B;  1PTO H;  2A6H C;  4KKS A;  3A7L A;  3S16 H;  4K8I A;  4JI1 L;  2E2J H;  1NMF A;  1IW7 C;  1TVX A;  2Z0S A;  1G29 1;  2NWG A;  4XXE A;  1I5F A;  3J80 L;  3JAM i;  1C8C A;  1OXX K;  4P74 A;  5HGQ A;  1WTX A;  4A4I A;  1UE5 A;  1F9Q A;  5CC4 A;  1NBW A;  4K5V A;  2QCP X;  2IPK D;  3TME A;  1YJN A;  2NB0 A;  3ZYY X;  4A3D B;  1HFG A;  5IOC A;  1UNS A;  4R8I A;  1N8R C;  2BA0 A;  4PMB A;  2F52 A;  1YZ6 A;  3GTO H;  1HA6 A;  3QWN A;  2UUB Q;  4QGU A;  3D6W A;  1HZC A;  1SNQ A;  2UXD L;  3I91 A;  4OX9 L;  1EEI D;  1WJJ A;  2VXW A;  1RTO A;  1UE6 A;  4X66 L;  4MIU A;  5EJW A;  1X3F A;  2VUM H;  1JE5 A;  2ICE C;  2WB1 G;  2D0P A;  1PZI D;  4R4Q A;  1FGU A;  1RTN A;  1O7Y A;  1Y14 B;  4JOI A;  5CBA E;  2FMM A;  1X3E A;  2O5J C;  2KHI A;  1BVS A;  1PMR A;  1TWG H;  4IZ8 A;  1QVG A;  5D65 A;  4Z9C B;  4KV6 A;  1II3 A;  1L1O C;  5IE8 A;  2ATW A;  3TS2 A;  1J8I A;  3H09 A;  4PZ8 A;  3PO2 H;  1UUP A;  1QE6 A;  2JYO A;  4OXP A;  3GQB A;  5IGE A;  2PQA B;  1PV4 A;  3OW7 A;  5FLX E;  1SYE A;  4JI2 Q;  2A6H D;  2K52 A;  4E6I A;  1TY0 A;  4BY7 H;  3HOX H;  4QMG A;  2E2I B;  3E3X A;  1N36 Q;  4DU9 A;  1DXM A;  5K5P A;  1S5D D;  5DM6 3;  2OF1 A;  1QVC A;  3Q8D A;  5A2Q L;  1EIG A;  1DOK A;  4C3H B;  3H3V H;  4L63 B;  4R4C A;  1V43 A;  1MBY A;  1EQV A;  5E4X A;  3KYH C;  4HR7 B;  4XQJ A;  1CA6 A;  1HXY D;  3CCR A;  4POF A;  3TP6 A;  4HIO A;  5K36 H;  3RLN A;  1V1P A;  2JEB I;  4DV1 Q;  2EOT A;  2JA6 G;  1Q8K A;  4X6A H;  2V4D A;  5E1F A;  1NNX A;  3M4Y A;  4Y7N B;  3K5L A;  1EU4 A;  2JN4 A;  2PNR C;  3GTP B;  2LMC B;  1T9H A;  4KHV A;  4GLX A;  3HS0 C;  2WII B;  4OO1 H;  3EBE A;  1Q1B A;  1O7I A;  2XRQ D;  3MEH A;  5M5Y H;  2N8N A;  2AKW B;  3EN2 A;  3HOZ G;  3D0F A;  2NYZ D;  1JOQ A;  1PVO A;  2SNS A;  3I56 A;  3E9H A;  1VQI A;  3HKS A;  1R4P B;  4A93 B;  4JI0 Q;  1VQE A;  2VB3 X;  4C56 C;  1TS2 A;  1VQ7 A;  4LF6 Q;  3SDZ A;  1WCM H;  1G8Z D;  5IIF A;  1HQR D;  4JBJ A;  5D3D A;  1XMO L;  1JR0 D;  1ZXT A;  4ULL A;  1HNZ Q;  1PFS A;  4HCE A;  1K83 H;  4JI6 L;  1B7Y B;  1QNU A;  3GV6 A;  4N8F A;  1H95 A;  5J22 A;  3HEJ A;  3D6C A;  2QEX A;  1R9T H;  1JCK B;  2MFI A;  3OYY A;  4JI4 L;  4QB4 A;  4QIW E;  3MEF A;  5CV5 A;  3PUX A;  2DY8 A;  3GTG H;  2A8V A;  1CK1 A;  4KKT A;  4YWM A;  2UU9 L;  1RF2 D;  1A3U A;  1EWI A;  3BYY B;  4I7Z C;  4BXX G;  3MTS A;  3TS0 A;  3ERQ A;  2Q2I A;  2F0W A;  2OQK A;  3KLS A;  2F0K A;  3S1M B;  4GN4 B;  2F0H A;  1X6O A;  1AE2 A;  1XMQ Q;  5D3I B;  1UE7 A;  2F0Q A;  4A3F B;  3CW2 C;  4JYA Q;  2F4V L;  3BDO A;  1GUT A;  1TQO A;  4JG2 A;  2R7F A;  2PMZ E;  2C9O A;  2IX1 A;  2MNA A;  3BG3 A;  1ZEQ X;  5IGF A;  4ZRZ A;  3IFT A;  4G57 A;  3PIP 3;  2EXZ A;  2HHH L;  4NB3 A;  1WOC A;  4FXD A;  3CQZ B;  3M7G A;  4EX5 A;  2EDG A;  1M4V A;  4ZYS A;  4LF7 Q;  3IL8 A;  3W3A A;  3TP7 A;  2WFW A;  3RZD H;  3S15 H;  4DV3 L;  1CT1 D;  3PMF A;  4A3D G;  4K0K Q;  2BH8 A;  3NEM A;  2B2T C;  1TWA B;  2PMZ B;  2I0Q A;  2XNA C;  1J6Q A;  2A68 C;  2D0O A;  4S3S A;  4TSS A;  1HCZ A;  2CWA A;  2B2V A;  3ICE A;  1U5K A;  4LF9 Q;  2QKI C;  1KIX A;  1EQT A;  3P75 A;  2SEB D;  2EPB A;  3CCM A;  3GTJ H;  1L0X B;  5ISR A;  1FJG Q;  1A2U A;  5D14 A;  2HT1 A;  3RR5 A;  1S5C D;  1ASY A;  3M4O B;  1H9M A;  4WJW A;  3SXH A;  5LL6 S;  4XT1 B;  1D1K A;  1FR3 A;  1TU2 B;  1AEX A;  1EUJ A;  5E3F A;  2B2Y A;  2CKZ B;  3I2Z A;  2JA6 H;  5EQ0 A;  3L2P A;  1QB5 D;  5AJ3 Q;  1PH4 A;  2LXJ A;  2UUB L;  3S2H B;  3NBH B;  1OO9 B;  3C3L A;  1AZQ A;  2JA9 A;  4DNR B;  3IKJ A;  5FLX L;  1MHW C;  2F4I A;  3R2I A;  1XNR Q;  2KEC A;  2CWP A;  1VQP A;  5BR8 Q;  3FVQ A;  1OTC A;  1D5Z C;  1UE1 A;  4C3H G;  3HOZ H;  4HJ5 A;  4A3I B;  4XYQ A;  1GD7 A;  4QJF A;  4O0A A;  1TWF H;  4PQX A;  2I5M X;  4KN4 C;  2B2W C;  2CFM A;  2E74 C;  5CV6 A;  4BY1 B;  4JI2 L;  1K8A C;  3U58 A;  3UI2 A;  2K4K A;  2A68 D;  3K5N A;  1N36 L;  2AQ2 B;  2EYL A;  3VA5 A;  2NZ1 D;  2Q2T A;  2ICI A;  3NQI A;  1D2B A;  3MA2 B;  4P71 A;  4LUO A;  5E4W C;  1Q81 C;  4QUC A;  1Y8O B;  2VW9 A;  1L1O B;  2E2H H;  1BBX C;  4A3K H;  4GZY C;  5CR3 A;  1SDF A;  3V96 A;  1KDC A;  4GLA C;  2OEO A;  3KJP A;  4DV4 L;  4A93 G;  1ZYR C;  3KLS X;  3R8B A;  4BXX H;  4DR5 Q;  3HOY B;  1E2W A;  3F2C A;  4DR3 L;  4CKB A;  2RKS A;  3K80 C;  3D4D A;  2LXK A;  2XWJ B;  1JJG A;  4HCS A;  4HJ7 A;  2F0G A;  1BR9 A;  3LGJ A;  1I94 Q;  2I07 B;  3J81 E;  4HIK A;  2BA1 A;  1MJC A;  2O2L D;  3AU7 A;  4XDX A;  3QJY A;  5JJK A;  4JBW A;  1JC7 A;  2EQS A;  4H13 C;  2QA4 A;  4L5S A;  1EQQ A;  2SNM A;  3QR8 A;  3VYT A;  5CV7 A;  4IUN A;  3GTQ B;  1QIL A;  2ZXR A;  1EOV A;  2X6L A;  4LF6 L;  1LUZ A;  2K5D A;  2PW5 A;  4RHR A;  3OTO Q;  4A3D H;  1LT5 D;  4A3F G;  5EKL A;  3N6R A;  3QIA A;  5FK9 C;  1WTR A;  2K33 A;  5IGB A;  2K14 A;  1HTL D;  1J5E Q;  1EYA A;  2K7V A;  3D4R A;  2VQF Q;  3URY A;  1D8L A;  3U4V A;  1IXR A;  4ME5 A;  4K14 A;  1F2Z A;  2HIX A;  3FHW A;  1A62 A;  1Y1V B;  5F2D A;  3VYR A;  2K5N A;  5KNC A;  4KN7 C;  1VQO A;  4OEM B;  1PXU A;  1IBM Q;  1PRT C;  1F77 A;  2WKC A;  4RKL A;  1CFM A;  5KYL A;  4LW1 A;  4JOI C;  4IFD I;  4JI3 Q;  1SMY C;  5T1I A;  4QUF A;  2WIN B;  5ELO A;  4K2L A;  1BF4 A;  1MI2 A;  3LNN A;  4XTC S;  1KAB A;  1PH9 A;  1PYB A;  2CCZ A;  3VYS A;  1N32 Q;  3T56 B;  4CDE C;  1XMQ L;  1O7Z A;  2RBM A;  2Y0S E;  1SYD A;  4IPG A;  2NN6 I;  4JYA L;  4ILW A;  1V1Q A;  1STH A;  2AHO B;  2RA4 A;  3T13 A;  1IKL A;  5CMD A;  3L0O A;  2CQA A;  4CDF C;  5LMN W;  1MIU A;  2VB2 X;  1UAP A;  1SEB D;  3KF8 A;  2E2I H;  3G4S A;  1A0I A;  2JSO A;  1YNN C;  1DOL A;  2R6G A;  4OIK A;  1HJP A;  2EJG C;  1RKN A;  1IBK Q;  1K0R A;  1I4H A;  3I73 A;  4LF7 L;  4KLK A;  5I2Y A;  1EEF D;  4C3H H;  1VQ8 A;  1B8A A;  1BXT A;  2NUC A;  3ND9 A;  3WOE A;  1XTD A;  2VZA A;  4XQN A;  2F0P A;  4C1N K;  3D3R A;  1YIJ A;  3PF4 A;  3OWE B;  5JJL A;  1AP0 A;  3KF6 B;  1SND A;  4DV5 Q;  4LF9 L;  4Y7N H;  2ZTD A;  1BCP F;  3GTP H;  2RF4 A;  3MZ5 A;  1X56 A;  3NPP A;  1LLR D;  1VQN A;  1VQD A;  5GAD C;  3W2D A;  4RFB A;  2K5Q A;  5FO9 B;  4A3I G;  2LFN A;  1XWE A;  1EYD A;  3KBG A;  4ME3 A;  2MJ8 A;  4IJH A;  4RAU C;  1SMY D;  4A93 H;  2K04 A;  3SEB A;  4HED A;  3OOC A;  3E0J A;  3IAY A;  4BWG B;  3HP3 A;  5JOB A;  5AJ3 L;  1RL2 A;  4DUZ Q;  4O1N A;  2R7Z B;  4BY1 G;  1GXD C;  1LTR D;  1Y8N B;  3M7N A;  4HJA A;  1GUG A;  4EGV A;  3DEO A;  1XNR L;  5M3F B;  2XIW A;  5BR8 L;  1I50 B;  3CCV A;  1E0B A;  1YBY A;  4GOP B;  4DV7 Q;  3J7Z C;  2BE5 C;  1LO5 D;  2KCM A;  4QL5 A;  3T1H Q;  1VQF A;  4DUY Q;  2B2T A;  3F8T A;  1HR0 W;  1HZA A;  2QDB A;  1TT2 A;  1GVP A;  4YWK A;  2G9H D;  2JK8 A;  3CXC A;  2NVT B;  3HOY G;  5A2Q E;  4MTK A;  3A54 A;  3S1M H;  1DGS A;  3S1Q B;  4KD4 A;  3S2D B;  4A3F H;  5CYU A;  2OQ0 A;  1NR4 A;  5IGD A;  1STB A;  1VQ4 A;  4BBS B;  1KDA A;  3J81 L;  4EVO A;  2N49 A;  3MXN A;  2NZO A;  3TZD A;  1YI2 A;  1NSN S;  2K5H A;  1CSP A;  5EPL A;  5G3L F;  3J80 c;  3FMC A;  1JJC B;  3P1H A;  3RNU A;  1S40 A;  3CQZ H;  1SAP A;  4DNI A;  3PSI A;  2VY3 A;  2C35 B;  2F0U A;  1G91 A;  4OHJ A;  4DR5 L;  3W5O A;  1U9R A;  3PCO B;  3S14 B;  5DM7 3;  4IUV A;  3SK4 A;  1VQA A;  1PH6 A;  4YCV A;  4P2C B;  2B2V C;  1TWA H;  2KHJ A;  1SNO A;  2MUY A;  1SLJ A;  2ALY B;  1VCI A;  2DNE A;  5M5W B;  3S1R B;  4NDX A;  2DJG C;  2MQH A;  5C4X B;  4DK3 C;  1Y1V G;  1ENC A;  3RZO B;  1HRJ A;  2PNH A;  4IPD A;  1QUQ A;  5C5L A;  3S24 A;  1PLF A;  1DCZ A;  1LTT D;  2Q2U A;  1XX8 A;  4RHS A;  3FEW X;  4EQ5 A;  3M4O H;  2B2Y C;  2KEN A;  3OTO L;  3NQT A;  1JWM D;  3B6Y A;  1VF5 C;  1B9N A;  1EY8 A;  3TSS A;  4FXG C;  2ID0 A;  5C0X I;  1J5E L;  2VQF L;  1B50 A;  2K6A A;  4X64 Q;  3VR6 A;  3J7Y W;  4DR1 Q;  1JT8 A;  4TVA B;  4ZLT F;  1EIH A;  4BBR B;  4IUP A;  1KXL A;  1N34 Q;  1YVC A;  4JBK A;  4RCN A;  2H5X A;  2JE6 I;  4JI3 L;  1D5X C;  1LTS D;  3RLO A;  1TXY A;  4A3I H;  1O78 A;  4EQN A;  1AH9 A;  4Y52 H;  2BDO A;  1EZ6 A;  1WTV A;  1Y8P B;  2F0L A;  5L37 A;  4KD3 A;  5T1G A;  2XSC A;  4KTA A;  1KRT A;  3UDF A;  2F1M A;  2JA5 B;  1WTQ A;  3DWP A;  1EFI D;  2FJ2 A;  3TRZ A;  1TWC B;  1PRT B;  2UUC Q;  3TQY A;  3SE0 A;  2KCC A;  1XTC D;  2A5H A;  3IFD A;  5GAG C;  3GTM B;  4BY1 H;  3MXG A;  3CCS A;  3JAM L;  2NVY B;  2B2U A;  1JMC A;  3HGB A;  3DWQ A;  5KNB A;  4IUU A;  3J80 i;  1IBK L;  5LL6 X;  4JW0 A;  3D8G A;  4DAY A;  1JWS D;  1NR2 A;  1E2Z A;  2G9D A;  2EY5 A;  1PH5 A;  4FF3 A;  2K01 A;  4A3J B;  1F2L A;  5ELF A;  1A8V A;  1WTO A;  1H9J A;  3OW2 A;  3OSO A;  3HOY H;  5LMU L;  4P75 A;  3R2T A;  1H9R A;  1PTO C;  5HY6 A;  1XPU A;  3T4A C;  3W1G A;  4DV5 L;  2HDM A;  4CGY B;  4V0B A;  1ET6 A;  4X62 Q;  1FNW A;  1AFP A;  1O7L A;  1DOM A;  1V1P B;  5M3F G;  4R1J A;  2LKV A;  3QOJ A;  3PGZ A;  2KEE A;  1YNX A;  3EQL C;  2WV6 D;  4FP5 D;  1C9O A;  2YTV A;  4A3G G;  1BBW A;  4KY6 A;  1SSO A;  3EA6 A;  1GUN A;  3I70 A;  3GTQ H;  1CZG A;  1CZW A;  5AFW A;  3E9I A;  3EIV A;  2A19 A;  2MPM A;  2OWO A;  2F0E A;  4DUZ L;  1WTW A;  5DNF A;  3M85 A;  4B3M Q;  2A69 C;  4LWC A;  2CW0 C;  3A5U A;  4BBS G;  1LTL A;  4ZK9 B;  5I9O A;  3AFQ A;  2FXQ A;  3S1N H;  3TP5 A;  3Q23 A;  1Y1V H;  4DV7 L;  3HOV B;  2H4O A;  3K8A A;  3T1H L;  4JV5 Q;  1JOO A;  4DUY L;  1PFN A;  2E76 C;  4IPC A;  2RCN A;  4AYB E;  3F2B A;  2B3G A;  1K9M C;  2NTS A;  4XQQ A;  4QQB X;  2Q8R E;  3GO5 A;  5JAV A;  5EAY A;  4UY8 C;  1U4M A;  1Z9F A;  1VQB A;  5CV8 A;  1B9M A;  1SJH D;  1PTO D;  1A6X A;  5KEE A;  3BVM A;  4N8X 1;  2ZTC A;  2GA4 B;  4J6H A;  4AYB B;  2MGS A;  1G2S A;  2JJQ A;  4IPH A;  3TBI B;  1I4R A;  2Z6K C;  3A5Z B;  1ET9 A;  4A3C G;  1F2M A;  2EVB A;  5BN4 A;  1N33 Q;  2E2D C;  1K8G A;  3AYH B;  1O80 A;  2UUA L;  1EY7 A;  2B8F A;  3F2U A;  4RH6 A;  4A3K G;  1KLU D;  4KHZ A;  4RGO S;  4DAP A;  2L15 A;  3KUP A;  4N9T A;  2Q8I B;  2RHQ B;  5GAH C;  1FGB D;  4PZ7 A;  3G7L A;  1MSH A;  1E1T A;  2A69 D;  3HOW G;  1SXT A;  2CW0 D;  2UXB Q;  4UP8 A;  2L11 A;  3FPP A;  2DJF C;  2QW7 A;  5IT9 c;  2WAQ E;  4IFD G;  1CKN A;  3I4L A;  5I9P A;  4QIW B;  5C5M A;  4WJ3 M;  3SK8 A;  4DN4 M;  1SNM A;  3I72 A;  2ASB A;  2V1C C;  3GTK B;  3MC0 B;  1G6Z A;  4KMU C;  1A3V A;  2JA5 G;  2NN6 G;  2VS1 A;  1S5E D;  2CQO A;  4UAI A;  3EJI A;  2R7Z H;  1VQC A;  2G5D A;  5I6Y A;  4RA8 A;  1F9P A;  4X64 L;  2WAQ B;  4DR1 L;  4H7B A;  2JQO A;  3TRE A;  5M3F H;  3RMH A;  1I50 H;  2F3V A;  1N34 L;  3SHL A;  4HJ9 A;  1A63 A;  4A3G H;  4MN3 A;  5CGK A;  2F0V A;  4HSV A;  4A3J G;  2Z1C A;  5IYD G;  3NTK A;  2NVT H;  3X3M A;  4V19 0;  4FNF A;  5BN3 A;  2UUC L;  2IT1 A;  1NY4 A;  3S1Q H;  3KDF A;  1W3S A;  1EYG A;  1K3B C;  3S2D H;  4WJ4 A;  1HZB A;  2J7Z A;  1GO3 E;  4EQO A;  1RHP A;  2ZXP A;  4BBS H;  3NK9 A;  3X3N A;  1SYG A;  4KK7 A;  3ND8 A;  3RN2 A;  4DK0 A;  1PYW D;  3CKI B;  1PH7 A;  1Y1W B;  4F7X A;  2DN8 A;  1EWH A;  2L4N A;  1F2Y A;  3C1F A;  4B3T Q;  1Q46 A;  1CKO A;  1EY5 A;  1V8Q A;  4I65 A;  3S14 H;  2JA8 B;  2KBN A;  1RCV D;  1U0L A;  1I3Q B;  2A74 C;  4PV1 C;  1HFN A;  1YIT A;  4X62 L;  1UEB A;  3V2T A;  4DA2 A;  3U9O A;  5JPN C;  5IYB G;  3H94 A;  5M5W H;  3S1R H;  3RZO H;  1YHA A;  3HOV G;  4OIJ A;  4L6T B;  5EKI A;  1WD0 A;  3UDI A;  3A8I E;  4LAA A;  3UE1 A;  4A3C H;  2D62 A;  3CCU A;  2FHT A;  1XYI A;  2IY5 B;  4JI8 Q;  4PNY A;  2K32 A;  3CRK C;  3CPW A;  3GTL B;  3FPU B;  1I4Q A;  5JVG 3;  2IX0 A;  4B9X A;  4IJL A;  4ZUI A;  5IP7 G;  1LM0 A;  2EY2 A;  2E8G A;  4B3M L;  5M3M B;  1L0Y B;  1LYL A;  2Z6B A;  4QF4 A;  1SN8 A;  1HPC A;  4C2M H;  1CTM A;  3R3O A;  4DV1 L;  2IX3 A;  2OTJ A;  4G7H C;  4AYB G;  3PF5 A;  3HOW H;  3DWA A;  2B63 B;  3OIP A;  1SE2 A;  2FMC A;  2Z4I A;  4JV5 L;  3HG9 A;  1EY9 A;  4LUZ A;  3W1B A;  2EIF A;  5C4J H;  1PA6 A;  1P16 A;  4LFB Q;  3NE5 B;  1Z47 A;  3J7A F;  4IFD H;  5GRO A;  3E5S A;  3Q24 A;  3M4P A;  2YU9 B;  1K3R A;  4N9P A;  3KLR A;  4JI5 Q;  2Z9H A;  2KHS A;  3PUY A;  1IHZ A;  5E7N A;  5IY0 A;  2VUM B;  2IW3 A;  4TKO B;  1ONL A;  2JA5 H;  4DPG A;  1CKM A;  2NN6 H;  3PUV A;  1EQR A;  1FNU A;  1TWC H;  3OMG A;  4JI0 L;  2B2U C;  1STA A;  4A75 A;  1WTH A;  4IOC A;  4NKL A;  1AZP A;  2RVL A;  2NVY H;  1QNK A;  2HD3 A;  2F03 A;  3GP7 A;  4GKK Q;  3LWE A;  4DR2 Q;  1HNZ L;  1BOS A;  3T16 A;  1N33 L;  1ENF A;  4XIG S;  2EXD A;  1FL0 A;  3K6O A;  2JA7 B;  3KF8 B;  5IP9 G;  4KKU A;  1KRS A;  5NUC A;  4A3J H;  2R3Z A;  5IYD H;  4GKJ Q;  5C6A A;  1NE3 A;  2HCC A;  1Q1E A;  1Q82 C;  1G2T A;  3ZJY C;  1EZ8 A;  3A7A B;  2ZJQ A;  1Z7T A;  1HQM C;  2NVX B;  2IHE A;  5JEA G;  1X3G A;  2K5V A;  2WAQ G;  2UXB L;  3RD4 A;  3T53 B;  5M5X B;  2YV5 A;  3FRP B;  4AIM A;  5GQO A;  1VQG A;  3PUW A;  4LF8 Q;  3S9W A;  3BZC A;  3DHQ A;  5C4H A;  2CHB D;  2A1A A;  1KAW A;  4ZQ3 A;  3OWF A;  1NUC A;  4XT3 B;  2L12 A;  5FO7 B;  3H15 A;  2CVR A;  2M2L A;  3Q0A A;  3M3Y B;  1GJX A;  3UDG A;  2BOS A;  5M5Y B;  3LWU A;  1SNP A;  1CQF A;  4A3B B;  5C44 B;  1KHI A;  2M00 A;  4GN3 B;  2Z6K A;  1EFW A;  4NXM Q;  4R9W A;  1FNV A;  2Y0S B;  1OXS C;  3SK5 A;  1STG A;  5IYB H;  1WCM B;  2KCT A;  4K0K L;  3NSW A;  4HMJ A;  5JJZ A;  1OXU A;  1SYF A;  3BZK A;  1TS4 A;  3MAQ A;  3HOV H;  1N9W A;  2OTL A;  2JP1 A;  4B9W A;  4HID A;  3K0Y A;  3H0G B;  4XYO A;  1BCP D;  3JAM E;  3OHX C;  3J7A V;  4IQZ A;  3BJU A;  3I8Z A;  4H44 C;  1DD2 A;  3DMU A;  1FJG L;  1LT3 D;  2JA8 G;  1E1O A;  3ULP A;  1FYC A;  2LS0 1;  3WOF A;  3STB D;  3GTG B;  3NBI A;  5IP7 H;  5TSS A;  1HNX Q;  1ESR A;  3U50 C;  3AB9 A;  2PW7 A;  4C3J B;  2H1E A;  3QG1 A;  5ELB A;  4RG1 A;  3K7A B;  2JXM B;  1JOK A;  3CRL C;  2WB1 E;  2BDN A;  4HMI A;  4RMF A;  1H9S A;  4QCL A;  2ZJR A;  2KCN A;  4LFA Q;  1D1I A;  3A74 A;  4DNT B;  1X32 A;  3JC6 6;  1BBU A;  4B3T L;  1PRT F;  1C7Y A;  1Q8I A;  2I5L X;  3MXN B;  3VR4 A;  2D9U A;  3CU7 A;  4OL7 A;  3ULL A;  3VA7 A;  4DFA A;  4MHE A;  3SK6 A;  3PV0 A;  4L8J A;  5M9O A;  3BDC A;  3VR2 A;  5M3M G;  2BH2 A;  1I6H B;  5CBE E;  2AUK A;  4ZKB B;  4CJ2 C;  1C0A A;  4GLV B;  3CP0 A;  1JIC A;  2PI2 E;  4NPS A;  3FKI B;  2JEA I;  3F2D A;  1K8O A;  2B63 G;  2RDF A;  1ZKO A;  1D5M C;  4FYD A;  4GS3 A;  2AQ3 B;  4PMW A;  5FJ8 G;  1UWV A;  1B3Q A;  4O2D A;  1HUM A;  1PHJ A;  3K5M A;  5CV9 A;  1RDP D;  5IP9 H;  1VQK A;  3GTK H;  2DNC A;  3CC4 A;  1QUQ B;  1GM5 A;  4L5T A;  4X3T A;  3GTJ B;  5G3L D;  1EYC A;  1B2T A;  1EY4 A;  3LX0 A;  1L2F A;  2EE1 A;  3Q6S A;  2CH4 W;  5KIX A;  3T1Y Q;  3FP9 A;  5JEA H;  1R4Q B;  1NTG A;  4LFB L;  2I5H A;  1I94 L;  2SDF A;  2YTY A;  1IZ6 A;  3K7U C;  3WWV A;  4L5R C;  3NWS A;  1CSQ A;  1PZJ D;  2JA7 G;  2FFK B;  3H91 A;  3GD7 A;  2Q8T A;  3T51 B;  3AMU A;  1MJE A;  2A6E D;  1SFO B;  2Z4H A;  2AWN A;  3ER0 A;  2PI2 A;  4H0L C;  3CC7 A;  1GHJ A;  4DR7 Q;  4DV6 Q;  4AQY Q;  3I4M B;  1JJ2 A;  1EIF A;  2F0O A;  2M9V A;  4GKK L;  1VQ6 A;  1IL2 A;  4DR2 L;  4LK1 C;  4C1N I;  4JI7 Q;  2IJ0 A;  1E22 A;  4RKB A;  1KDB A;  4NP5 A;  4WRD A;  4FF2 A;  3S2H H;  4EQP A;  2MP1 A;  1IYV A;  4HN7 A;  4DV2 Q;  1RJT A;  2C5C A;  2F0D A;  1X9N A;  1Q86 C;  2N3S A;  1IBM L;  2A73 B;  3KLW A;  4A3B G;  4DAY B;  5C44 G;  2VNU D;  2JA8 H;  2E2H B;  2J4X A;  2WKD A;  4IUQ A;  4NMZ A;  2Y0S G;  3DEP A;  1QZG A;  1JOR A;  1B53 A;  2AUJ D;  4OGQ C;  2R7D A;  4M1U B;  5ELD A;  1N32 L;  2XVS A;  1AE3 A;  1GUO A;  2QDL A;  4DV3 Q;  2ZM6 Q;  4LF8 L;  4X3S A;  4ZAI A;  5FLM G;  4RWS C;  4YY3 Q;  5A35 A;  4LUV A;  3BZD B;  1G51 A;  3G71 A;  1EL0 A;  1ENA A;  3H0G G;  1H9K A;  2R61 A;  4I7A A;  2XGT A;  5C3E B;  4K8J A;  1MKH A;  2QGQ A;  1NAP A;  2RDH A;  4NW2 A;  3CPF A;  1LAB A;  2E75 C;  2EYM A;  2HUG A;  4HSP A;  3RLF A;  3PQI A;  3K0X A;  4YHH Q;  3PO3 B;  3GTL H;  4POG A;  3S17 B;  4PZ6 A;  4R4I A;  3TEH B;  2B29 A;  4NXM L;  5M3M H;  4KHP Q;  4C3J G;  3DM1 A;  1CA5 A;  1VMC A;  1YHB A;  3G6E A;  4B3R Q;  3CAM A;  5I4D A;  1Y69 U;  4GNX A;  2B63 H;  3UDX A;  3D31 A;  5EKK A;  5GAE C;  3NXW A;  2R7Z G;  2ZJP A;  4M8A A;  1GHK A;  1VQ5 A;  1HHV A;  1A3T A;  1IL8 A;  4J1M A;  3SR1 A;  2R93 B;  5FJ8 H;  3NUC A;  2YU9 H;  4A3M B;  4DKA C;  4CJ1 B;  1PZK D;  1IYU A;  1XXG A;  2B39 A;  4MTN A;  1HNX L;  2P5Z X;  2X69 A;  4RCO A;  1TII D;  2I46 A;  5FKA C;  4L5Q A;  4ABN A;  1WVL A;  1VDZ A;  1PH1 A;  2D2C C;  4A3L G;  3FKI G;  1ML0 D;  2KJX A;  4R4T A;  3SGI A;  1VQH A;  4DAM A;  5H1S E;  4X3K A;  2F0F A;  1W2B A;  3EVQ A;  4LFA L;  4G4K A;  2HIV A;  2EJF C;  5IOD A;  5C3W A;  2LY7 A;  4J8Q A;  2JA7 H;  3QB3 A;  2K28 A;  3R93 A;  2K05 A;  1ILP A;  2RSO A;  4CJ0 B;  2PPB C;  4DXF A;  1IW7 D;  5IT9 E;  4CKE A;  1K8M A;  1PH3 A;  3NEN A;  2ZT9 C;  2NVX H;  3VYU A;  5LMN Q;  2K5W A;  4IN3 A;  3P20 A;  3VR5 A;  4NXN Q;  1TS3 A;  3D4W A;  3NEL A;  4DV4 Q;  2Q2H A;  5M5X H;  3CC2 A;  4IFD J;  1KNA A;  3ULJ A;  3MFG A;  3AEV A;  5FO8 B;  4DR3 Q;  2GN5 A;  4U67 3;  4F87 A;  3NWT A;  2PQA A;  5C4X G;  2EYP A;  5IGG A;  4A3E B;  3M3Y H;  3H3V C;  2HDL A;  4A3B H;  5C44 H;  1CKN B;  3MXP A;  2VL6 A;  4ZCK A;  4IUR A;  4P72 A;  3A8K E;  3T1Y L;  5EGT A;  1PTO F;  1HNW Q;  1A2T A;  3I4M G;  1KLG D;  1M1K C;  1ICF B;  4IAL A;  4DR4 Q;  2ENB A;  1YJ9 A;  1CUK A;  1I4G A;  4TRD A;  5J1Z A;  1SBB B;  3H3V I;  1U4L A;  4R8N A;  5FLM H;  1KQS A;  4LF4 Q;  3CD6 A;  1T5X D;  2AMC B;  1BKB A;  4KJO A;  5FLX c;  4LFC Q;  3H0G H;  1J9O A;  1YNJ C;  3ERS X;  3OIQ A;  1W6K A;  3ITP A;  4LMQ D;  4BBR G;  2L55 A;  5IWA Q;  2HQE A;  3NTH A;  1LTG D;  2MO1 A;  4K5W A;  4O42 A;  1LTB D;  4IUT A;  1CHP D;  1LTI D;  4DR7 L;  4C3J H;  4DV6 L;  1M90 C;  1X54 A;  4AQY L;  3K7A H;  1ILQ A;  1Q7Y C;  1WTP A;  3CF5 A;  1VQJ A;  4OO1 I;  2O5I C;  4JI7 L;  2N55 A;  2OXP A;  3KDF B;  1LAC A;  2DY7 A;  1HR0 Q;  2NVQ B;  4RGM A;  1JB7 A;  1X65 A;  3OMC A;  2PCF B;  4HIM A;  5C3E G;  4DV2 L;  5KRU A;  3C1E A;  2WAC A;  1JB3 A;  1VMP A;  4Q0F A;  1TWH B;  5IYC G;  1YJW A;  3PO3 G;  1GUW A;  4ALP A;  2R92 B;  4AH6 A;  3KOJ A;  3VDY A;  5C3X A;  1DM0 B;  2OT2 A;  1S3O A;  1EIY B;  1KAA A;  1WFQ A;  1HTP A;  5KGU A;  1I6H H;  1FD7 D;  2F3W A;  5JVH 3;  1K28 A;  2EYO A;  4FF1 A;  1I4P A;  3QOL A;  4ZUJ A;  4CKC A;  4A3L H;  3C46 A;  1SE4 A;  3FKI H;  1B4O A;  3MXU A;  2ZM6 L;  1JE4 A;  5CV4 A;  4YY3 L;  2E5L Q;  1OXT A;  2B8G A;  3I4N B;  1Q90 A;  3P7J A;  5DEH A;  1HA5 A;  4LJZ C;  1NJI C;  1MGS A;  2BCO A;  2R93 G;  2PZT A;  4DGZ A;  2F0S A;  4A3M G;  4YHH L;  2K1B A;  1YNJ D;  1LV9 A;  4UP7 A;  3HOU B;  1XNQ Q;  2HQL A;  1HZ9 A;  3BS1 A;  3PIO A;  2F0I A;  4C3I B;  2SOB A;  2NBF A;  4RGT A;  3KFU A;  4ID6 A;  3K59 A;  4KHP L;  1BO0 A;  5LHY 1;  3TDQ A;  4LNQ A;  4OWW B;  2HCI A;  2KOL A;  1A15 A;  1CI3 M;  4B3R L;  1PH8 A;  3BVG A;  2EY1 A;  1VF7 A;  4GOP C;  1SE3 A;  1SR3 A;  1STY A;  4IOA A;  4X3U A;  2PZW A;  3I90 A;  1HUN A;  3BVZ A;  1VQ9 A;  3E0E A;  2F0N A;  5C4X H;  3K81 C;  3L7Z C;  1EWC A;  3PUZ A;  2VQE Q;  1X3Q A;  1STN A;  4CDC C;  1PTO B;  1X55 A;  1SFO H;  1M8A A;  5IT9 L;  1EY0 A;  3S16 B;  2FIN B;  1K73 C;  2XN9 C;  4ODG A;  1VQL A;  3HRZ C;  1VQM A;  1KC8 C;  2E2J B;  1JQY D;  3MFY A;  1E3P A;  1WD1 A;  4YWL A;  1X3P A;  2KUM A;  4FO2 A;  3I4M H;  1S4Z A;  3DM3 A;  1C4Q A;  1I6V C;  3GDE A;  3QO2 A;  5C4Z A;  4JCV E;  1QWY A;  2IL8 A;  2UXC Q;  2DGY A;  3NBH A;  1PFB A;  4P73 A;  3MHB A;  1YHQ A;  5BN5 A;  3CHB D;  1BQQ T;  5C0X J;  4A3E G;  2F0T A;  1DJR D;  1C48 A;  3E6Z X;  4BBR H;  4YIJ A;  2YTX A;  4JC0 A;  3CMA A;  5JEA J;  3GTO B;  3HKZ E;  2ZXO A;  1DON A;  1PH2 A;  5LMN L;  5J3B A;  3OPO A;  4NXN L;  4WFN 3;  3Q22 A;  1P8L A;  4LF5 Q;  1HH2 P;  5I6W A;  4OWT B;  1GKH A;  3NP8 A;  1CQV A;  2CH4 A;  1CHQ D;  2Z8L A;  3KK7 A;  1KD1 C;  1STE A;  5ELE A;  4UDU C;  4A76 A;  4G7Z C;  3M4Q A;  2MO0 A;  3GTM H;  1RIP A;  4JK1 C;  3HKZ B;  1LTA D;  1Q12 A;  1TWG B;  5C3E H;  1NCV A;  3HFZ B;  1MD2 D;  1NMG A;  3CCE A;  1B1Z A;  4K6L A;  5HUR A;  5KND A;  5IYC H;  3PO3 H;  3PO2 B;  1BCP C;  4B08 A;  4DR6 Q;  3S17 H;  1GUS A;  3RN5 A;  1L1O A;  1PYS B;  4F88 A;  2TSS A;  3C2P A;  4DXG A;  1HNW L;  4BY7 B;  1SE8 A;  4B3S Q;  2RSN A;  3HOX B;  4KY5 A;  4KY7 A;  1CM9 A;  1KL9 A;  1SNC A;  3K57 A;  4GNX C;  1F9R A;  3AFP A;  3STB C;  4DR4 L;  3M9B A;  1SRO A;  4FDB A;  2DUD A;  5C0X G;  1BUV T;  5IGC A;  1IBL Q;  4LF4 L;  2KED A;  2RDG A;  4LFC L;  3VR3 A;  5EBC A;  2QEJ C;  5I2X A;  1K0S A;  3I3C A;  4X65 Q;  2R93 H;  1DZ1 A;  4JBM A;  5IWA L;  3S1N B;  4A3M H;  2ZTE A;  2AWO A;  4K2K A;  4DV0 Q;  2R92 G;  1TY2 A;  3WDN A;  1S5B D;  1AN8 A;  3I7F A;  1V9P A; 
#chains in the Genus database with same CATH homology
 1TS5 A;  2PQE A;  2XWB B;  1U4R A;  3L3O C;  4FVM A;  3TN2 A;  2L0C A;  2EJM A;  1ZYR D;  1PFM A;  5J39 A;  2QIL A;  1KTK A;  1BNZ A;  3O13 A;  4HTH A;  1QCB D;  2EYJ A;  2IWH A;  1H9S B;  4CHT B;  4DK1 A;  3U9S A;  2TMP A;  1QJO A;  1E2V A;  1LT4 D;  1F9S A;  3A55 A;  4C3I G;  1K83 B;  1LT6 D;  1IKM A;  3BYT B;  1U4P A;  3A8J E;  3KBX A;  4BA1 I;  1R9T B;  2L5T A;  3V05 A;  2KQ3 A;  3G6J B;  5HGT A;  3J80 E;  3K5O A;  2EYH A;  2QF7 A;  3PIO 3;  4CBV A;  4HAE A;  1I4X A;  2RQX A;  4K5X A;  5KYI A;  1ICW A;  1W6J A;  3SVM A;  4U68 A;  2D5D A;  3HZX A;  1PRT D;  4DF7 A;  2A6E C;  3MWY W;  3K58 A;  5ELC A;  1SYC A;  4RGN A;  3L9A X;  4ZKC B;  1SYB A;  2WB1 B;  4F8M A;  5COY A;  3RUZ A;  1TR5 A;  3ERO A;  3RZD B;  3S15 B;  4WOR A;  5FOB B;  2NTT A;  4K6D A;  1ESF A;  1YNN D;  2AQ1 B;  3H6M A;  3TZU A;  4A3G B;  2K03 A;  3N52 A;  4FF4 A;  2N88 A;  2WP8 J;  1RD9 D;  2EY6 A;  4BA2 I;  1B3A A;  1Z6H A;  2MHV A;  5C0X H;  3BDL A;  3TP8 A;  2F0J A;  2KVM A;  1T5E A;  2JA6 B;  4G7O C;  2XRS D;  5EPJ A;  3GV3 A;  4FXK C;  1EOT A;  2YYZ A;  1JWU D;  1UEA B;  1DYQ A;  5JPM C;  1PDQ A;  1QG7 A;  3HOZ B;  5EPK A;  1MSG A;  1B44 D;  1TKW B;  1QOH A;  2L1B A;  1TWF B;  2X6G A;  2KA7 A;  5EBD A;  1Q3L A;  5COR A;  5K36 G;  2PYK A;  3A56 A;  2L9H A;  2PZU A;  3DXJ C;  4BS9 A;  4KJN A;  5DAU A;  1AW7 A;  1GOZ A;  1ROD A;  2BE5 D;  2B2W A;  2EYF A;  1D6E C;  1SJE D;  4KI0 A;  3NHH A;  3NTI A;  4OO1 G;  1V1O A;  3DUZ A;  3FDT A;  4A3K B;  4PMC A;  1BCP B;  2J0T D;  1S5F D;  1EU3 A;  4C2M B;  3MVV A;  1OXV A;  3ONA B;  4Q5V A;  2EZV A;  4TQU S;  1EY6 A;  3HOW B;  4DAV A;  1KNE A;  2O4X A;  2PO4 A;  2F0M A;  3EFX D;  1BDO A;  5C4J B;  1PTO H;  2A6H C;  4KKS A;  3A7L A;  4K8I A;  1IW7 C;  1TVX A;  1G29 1;  2NWG A;  4XXE A;  3J80 L;  1C8C A;  1OXX K;  1WTX A;  1F9Q A;  5CC4 A;  4K5V A;  2QCP X;  2IPK D;  3TME A;  2NB0 A;  3ZYY X;  4A3D B;  1HFG A;  5IOC A;  1UNS A;  4R8I A;  2BA0 A;  4PMB A;  1HA6 A;  3QWN A;  3D6W A;  1SNQ A;  3I91 A;  1EEI D;  2VXW A;  1RTO A;  4MIU A;  5EJW A;  2ICE C;  1PZI D;  1RTN A;  1O7Y A;  5CBA E;  2FMM A;  2O5J C;  1PMR A;  4IZ8 A;  5D65 A;  4Z9C B;  4KV6 A;  1II3 A;  1J8I A;  3H09 A;  1UUP A;  1QE6 A;  2JYO A;  5IGE A;  3GQB A;  3OW7 A;  5FLX E;  1SYE A;  2A6H D;  4E6I A;  1TY0 A;  2E2I B;  4QMG A;  4DU9 A;  1DXM A;  5K5P A;  1S5D D;  5DM6 3;  2OF1 A;  5A2Q L;  1EIG A;  1DOK A;  4C3H B;  4L63 B;  1V43 A;  1MBY A;  1EQV A;  5E4X A;  4HR7 B;  4XQJ A;  1CA6 A;  1HXY D;  3TP6 A;  5K36 H;  1V1P A;  2JEB I;  2EOT A;  2V4D A;  5E1F A;  3M4Y A;  4Y7N B;  3K5L A;  1EU4 A;  2PNR C;  3GTP B;  2LMC B;  4KHV A;  3HS0 C;  2WII B;  4OO1 H;  1Q1B A;  3MEH A;  2XRQ D;  2NYZ D;  1JOQ A;  2SNS A;  1R4P B;  4A93 B;  2VB3 X;  4C56 C;  1TS2 A;  3SDZ A;  1G8Z D;  5IIF A;  1HQR D;  5D3D A;  1JR0 D;  1ZXT A;  4ULL A;  4HCE A;  1QNU A;  3GV6 A;  5J22 A;  3HEJ A;  3D6C A;  1JCK B;  4QB4 A;  5CV5 A;  3PUX A;  2DY8 A;  1CK1 A;  4KKT A;  1RF2 D;  1A3U A;  3BYY B;  4I7Z C;  3MTS A;  3ERQ A;  2F0W A;  3KLS A;  2F0K A;  3S1M B;  2F0H A;  5D3I B;  2F0Q A;  4A3F B;  3BDO A;  1GUT A;  1TQO A;  2C9O A;  2IX1 A;  3BG3 A;  1ZEQ X;  5IGF A;  4ZRZ A;  3IFT A;  4G57 A;  3PIP 3;  2EXZ A;  4FXD A;  3CQZ B;  3M7G A;  2EDG A;  1M4V A;  4ZYS A;  3IL8 A;  3W3A A;  3TP7 A;  1CT1 D;  3PMF A;  2B2T C;  1TWA B;  2PMZ B;  2XNA C;  2A68 C;  4S3S A;  4TSS A;  1HCZ A;  2B2V A;  2QKI C;  1EQT A;  3P75 A;  2SEB D;  2EPB A;  1L0X B;  5ISR A;  1A2U A;  5D14 A;  1S5C D;  3M4O B;  1H9M A;  3SXH A;  4WJW A;  5LL6 S;  4XT1 B;  1D1K A;  1FR3 A;  1TU2 B;  1AEX A;  5E3F A;  2B2Y A;  5EQ0 A;  1QB5 D;  3S2H B;  1OO9 B;  3C3L A;  1AZQ A;  4DNR B;  3IKJ A;  5FLX L;  2F4I A;  3R2I A;  2KEC A;  3FVQ A;  1D5Z C;  4C3H G;  4A3I B;  4XYQ A;  4PQX A;  4KN4 C;  2B2W C;  2E74 C;  5CV6 A;  4BY1 B;  3UI2 A;  2A68 D;  3K5N A;  2AQ2 B;  2EYL A;  3VA5 A;  2NZ1 D;  2ICI A;  3NQI A;  1D2B A;  3MA2 B;  5E4W C;  4QUC A;  1Y8O B;  1BBX C;  4GZY C;  5CR3 A;  1SDF A;  3V96 A;  1KDC A;  2OEO A;  1ZYR C;  3KLS X;  3R8B A;  3HOY B;  1E2W A;  4CKB A;  2RKS A;  3D4D A;  2XWJ B;  4HCS A;  2F0G A;  1BR9 A;  2I07 B;  3J81 E;  2BA1 A;  2O2L D;  3AU7 A;  4XDX A;  3QJY A;  4JBW A;  1JC7 A;  4H13 C;  2SNM A;  3VYT A;  5CV7 A;  4IUN A;  3GTQ B;  1QIL A;  2ZXR A;  2X6L A;  2K5D A;  2PW5 A;  4RHR A;  1LT5 D;  1WTR A;  5EKL A;  3N6R A;  3QIA A;  5FK9 C;  2K33 A;  5IGB A;  1HTL D;  1EYA A;  2K7V A;  3D4R A;  3URY A;  4ME5 A;  4K14 A;  1F2Z A;  1Y1V B;  5F2D A;  3VYR A;  5KNC A;  4KN7 C;  1PXU A;  1PRT C;  1F77 A;  2WKC A;  4RKL A;  1CFM A;  5KYL A;  4IFD I;  1SMY C;  5T1I A;  4QUF A;  2WIN B;  4K2L A;  1BF4 A;  1MI2 A;  3LNN A;  4XTC S;  1KAB A;  3VYS A;  3T56 B;  1O7Z A;  2RBM A;  1SYD A;  2NN6 I;  4ILW A;  1STH A;  2RA4 A;  3T13 A;  1IKL A;  5CMD A;  2CQA A;  2VB2 X;  1UAP A;  1SEB D;  3KF8 A;  2JSO A;  1YNN C;  1DOL A;  2R6G A;  4OIK A;  2EJG C;  1RKN A;  1I4H A;  3I73 A;  5I2Y A;  1EEF D;  1BXT A;  2NUC A;  3ND9 A;  3WOE A;  4XQN A;  2F0P A;  4C1N K;  3D3R A;  3OWE B;  1AP0 A;  1SND A;  1BCP F;  3MZ5 A;  3NPP A;  1LLR D;  3W2D A;  4RFB A;  2K5Q A;  5FO9 B;  2LFN A;  1XWE A;  1EYD A;  3KBG A;  2MJ8 A;  4RAU C;  1SMY D;  2K04 A;  3SEB A;  4HED A;  3OOC A;  3E0J A;  3IAY A;  4BWG B;  3HP3 A;  5JOB A;  4O1N A;  2R7Z B;  1GXD C;  1LTR D;  1Y8N B;  3M7N A;  1GUG A;  4EGV A;  3DEO A;  5M3F B;  2XIW A;  1I50 B;  1E0B A;  2BE5 C;  1LO5 D;  2B2T A;  2QDB A;  1TT2 A;  2G9H D;  2NVT B;  5A2Q E;  3A54 A;  3S1Q B;  4KD4 A;  3S2D B;  5CYU A;  1NR4 A;  5IGD A;  1STB A;  4BBS B;  1KDA A;  3J81 L;  4EVO A;  3MXN A;  3TZD A;  1NSN S;  5EPL A;  5G3L F;  3FMC A;  3P1H A;  1SAP A;  2F0U A;  1G91 A;  4OHJ A;  1U9R A;  3S14 B;  5DM7 3;  4IUV A;  3SK4 A;  4P2C B;  2B2V C;  1SNO A;  2MUY A;  1VCI A;  2DNE A;  5M5W B;  3S1R B;  4NDX A;  5C4X B;  1ENC A;  3RZO B;  1HRJ A;  5C5L A;  1PLF A;  1DCZ A;  1LTT D;  1XX8 A;  4RHS A;  3FEW X;  2B2Y C;  3NQT A;  1JWM D;  1VF5 C;  1B9N A;  1EY8 A;  3TSS A;  4FXG C;  2ID0 A;  5C0X I;  1B50 A;  2K6A A;  3VR6 A;  3J7Y W;  1EIH A;  4ZLT F;  4BBR B;  4IUP A;  4RCN A;  2JE6 I;  1D5X C;  1LTS D;  1O78 A;  4EQN A;  2BDO A;  1EZ6 A;  1WTV A;  1Y8P B;  2F0L A;  4KD3 A;  5T1G A;  2XSC A;  4KTA A;  2F1M A;  2JA5 B;  1WTQ A;  3DWP A;  1EFI D;  2FJ2 A;  1TWC B;  1PRT B;  3SE0 A;  2KCC A;  1XTC D;  2A5H A;  3IFD A;  3GTM B;  3MXG A;  3JAM L;  2NVY B;  2B2U A;  3HGB A;  3DWQ A;  5KNB A;  4IUU A;  5LL6 X;  4DAY A;  3D8G A;  1JWS D;  1NR2 A;  1E2Z A;  2G9D A;  2EY5 A;  4FF3 A;  2K01 A;  4A3J B;  1F2L A;  5ELF A;  1WTO A;  1H9J A;  3OSO A;  3R2T A;  1H9R A;  1PTO C;  3T4A C;  2HDM A;  4CGY B;  4V0B A;  1ET6 A;  1FNW A;  1AFP A;  1DOM A;  1O7L A;  1V1P B;  2LKV A;  3QOJ A;  2KEE A;  3EQL C;  2WV6 D;  4FP5 D;  4KY6 A;  1SSO A;  3EA6 A;  1GUN A;  3I70 A;  1CZG A;  1CZW A;  5AFW A;  2MPM A;  2F0E A;  1WTW A;  5DNF A;  3M85 A;  2A69 C;  2CW0 C;  5I9O A;  4ZK9 B;  3TP5 A;  3Q23 A;  3HOV B;  2H4O A;  1JOO A;  1PFN A;  2E76 C;  2NTS A;  4XQQ A;  2Q8R E;  3GO5 A;  5JAV A;  1U4M A;  5CV8 A;  1B9M A;  1SJH D;  1PTO D;  1A6X A;  5KEE A;  3BVM A;  2GA4 B;  4J6H A;  4AYB B;  2MGS A;  1G2S A;  3TBI B;  1I4R A;  1ET9 A;  1F2M A;  2EVB A;  5BN4 A;  2E2D C;  1O80 A;  1EY7 A;  2B8F A;  3F2U A;  4RH6 A;  1KLU D;  4KHZ A;  4RGO S;  4DAP A;  3KUP A;  4N9T A;  2Q8I B;  1FGB D;  3G7L A;  1MSH A;  2A69 D;  1SXT A;  2CW0 D;  2L11 A;  3FPP A;  4IFD G;  3I4L A;  5I9P A;  4QIW B;  5C5M A;  3SK8 A;  4DN4 M;  1SNM A;  3I72 A;  3GTK B;  3MC0 B;  1G6Z A;  4KMU C;  1A3V A;  2NN6 G;  1S5E D;  4UAI A;  3EJI A;  5I6Y A;  4RA8 A;  1F9P A;  2WAQ B;  4H7B A;  3RMH A;  2F3V A;  3SHL A;  4MN3 A;  5CGK A;  2F0V A;  4HSV A;  2Z1C A;  3NTK A;  3X3M A;  4V19 0;  4FNF A;  5BN3 A;  2IT1 A;  2J7Z A;  4EQO A;  1RHP A;  2ZXP A;  3NK9 A;  3X3N A;  1SYG A;  4KK7 A;  3ND8 A;  4DK0 A;  1PYW D;  3CKI B;  1Y1W B;  4F7X A;  2DN8 A;  1EWH A;  2L4N A;  1F2Y A;  3C1F A;  1EY5 A;  1V8Q A;  4I65 A;  2JA8 B;  1RCV D;  1I3Q B;  2A74 C;  4PV1 C;  1HFN A;  3V2T A;  4DA2 A;  3U9O A;  5JPN C;  3H94 A;  4OIJ A;  4L6T B;  5EKI A;  1WD0 A;  3A8I E;  4LAA A;  2D62 A;  2FHT A;  1XYI A;  4PNY A;  2K32 A;  3CRK C;  3GTL B;  3FPU B;  1I4Q A;  5JVG 3;  2IX0 A;  4B9X A;  4ZUI A;  2EY2 A;  5M3M B;  1L0Y B;  4QF4 A;  1HPC A;  1CTM A;  3R3O A;  2IX3 A;  4G7H C;  3DWA A;  2B63 B;  3OIP A;  1SE2 A;  2FMC A;  2Z4I A;  3HG9 A;  1EY9 A;  3NE5 B;  1Z47 A;  3J7A F;  4IFD H;  3E5S A;  3Q24 A;  2YU9 B;  4N9P A;  3KLR A;  2KHS A;  3PUY A;  1IHZ A;  2VUM B;  2IW3 A;  4TKO B;  1ONL A;  2NN6 H;  3PUV A;  1FNU A;  3OMG A;  2B2U C;  1STA A;  4NKL A;  1AZP A;  2RVL A;  1QNK A;  2F03 A;  3GP7 A;  3LWE A;  1BOS A;  3T16 A;  1ENF A;  4XIG S;  3K6O A;  2JA7 B;  4KKU A;  5NUC A;  2R3Z A;  5C6A A;  2HCC A;  1Q1E A;  1G2T A;  1EZ8 A;  3A7A B;  1Z7T A;  1HQM C;  2NVX B;  5JEA G;  3RD4 A;  3T53 B;  5M5X B;  3FRP B;  3PUW A;  3S9W A;  5C4H A;  3DHQ A;  2CHB D;  4ZQ3 A;  3OWF A;  1NUC A;  4XT3 B;  2L12 A;  5FO7 B;  2CVR A;  2M2L A;  3Q0A A;  3M3Y B;  1GJX A;  2BOS A;  5M5Y B;  3LWU A;  1SNP A;  1CQF A;  4A3B B;  5C44 B;  2M00 A;  4R9W A;  1FNV A;  2Y0S B;  1OXS C;  3SK5 A;  1STG A;  1WCM B;  3NSW A;  4HMJ A;  5JJZ A;  1OXU A;  1SYF A;  1TS4 A;  3MAQ A;  2JP1 A;  4B9W A;  3K0Y A;  3H0G B;  4XYO A;  1BCP D;  3JAM E;  3OHX C;  3J7A V;  4IQZ A;  3I8Z A;  4H44 C;  1DD2 A;  3DMU A;  1LT3 D;  1FYC A;  2LS0 1;  3WOF A;  3GTG B;  3NBI A;  5TSS A;  1ESR A;  3AB9 A;  2PW7 A;  4C3J B;  2H1E A;  3QG1 A;  5ELB A;  3K7A B;  2JXM B;  1JOK A;  3CRL C;  2BDN A;  4HMI A;  1H9S A;  4QCL A;  2KCN A;  1D1I A;  4DNT B;  1X32 A;  1PRT F;  1Q8I A;  3VR4 A;  2D9U A;  3CU7 A;  4OL7 A;  3VA7 A;  4DFA A;  4MHE A;  3SK6 A;  3PV0 A;  4L8J A;  5M9O A;  3BDC A;  3VR2 A;  1I6H B;  5CBE E;  2AUK A;  4ZKB B;  4CJ2 C;  1JIC A;  3FKI B;  2JEA I;  1K8O A;  2RDF A;  1ZKO A;  1D5M C;  4FYD A;  2AQ3 B;  4PMW A;  1HUM A;  3K5M A;  5CV9 A;  1RDP D;  2DNC A;  4X3T A;  3GTJ B;  5G3L D;  1EYC A;  1B2T A;  1EY4 A;  3LX0 A;  2EE1 A;  3Q6S A;  5KIX A;  5JEA H;  1R4Q B;  2SDF A;  3NWS A;  1PZJ D;  2FFK B;  3H91 A;  3GD7 A;  2Q8T A;  3T51 B;  3AMU A;  2A6E D;  1SFO B;  2Z4H A;  2AWN A;  4H0L C;  1GHJ A;  3I4M B;  2F0O A;  2M9V A;  4LK1 C;  4C1N I;  2IJ0 A;  4WRD A;  4RKB A;  1KDB A;  4NP5 A;  4FF2 A;  4EQP A;  2MP1 A;  1IYV A;  4HN7 A;  1RJT A;  2C5C A;  2F0D A;  2A73 B;  2VNU D;  2E2H B;  2J4X A;  2WKD A;  4IUQ A;  4NMZ A;  3DEP A;  1JOR A;  1B53 A;  2AUJ D;  4OGQ C;  4M1U B;  5ELD A;  2XVS A;  1GUO A;  4X3S A;  4ZAI A;  4RWS C;  5A35 A;  3BZD B;  1EL0 A;  1ENA A;  1H9K A;  2R61 A;  5C3E B;  4K8J A;  1NAP A;  2RDH A;  4NW2 A;  1LAB A;  2E75 C;  2EYM A;  2HUG A;  4HSP A;  3RLF A;  3PO3 B;  3S17 B;  4C3J G;  3DM1 A;  1CA5 A;  1VMC A;  1Y69 U;  5I4D A;  3D31 A;  5EKK A;  3NXW A;  4M8A A;  1GHK A;  1HHV A;  1A3T A;  1IL8 A;  4J1M A;  3SR1 A;  2R93 B;  3NUC A;  4A3M B;  4CJ1 B;  1PZK D;  1IYU A;  1XXG A;  2B39 A;  2X69 A;  4RCO A;  1TII D;  2I46 A;  5FKA C;  4ABN A;  1WVL A;  1VDZ A;  2D2C C;  1ML0 D;  2KJX A;  4X3K A;  2F0F A;  3EVQ A;  4G4K A;  2EJF C;  5IOD A;  5C3W A;  2LY7 A;  4J8Q A;  3QB3 A;  2K28 A;  3R93 A;  2K05 A;  1ILP A;  2RSO A;  4CJ0 B;  2PPB C;  4DXF A;  1IW7 D;  5IT9 E;  4CKE A;  1K8M A;  2ZT9 C;  3VYU A;  2K5W A;  4IN3 A;  3P20 A;  3VR5 A;  1TS3 A;  3D4W A;  4IFD J;  1KNA A;  3MFG A;  5FO8 B;  4U67 3;  4F87 A;  3NWT A;  2EYP A;  5IGG A;  4A3E B;  3H3V C;  2HDL A;  3MXP A;  4IUR A;  3A8K E;  5EGT A;  1PTO F;  1A2T A;  1KLG D;  4IAL A;  2ENB A;  4TRD A;  1I4G A;  5J1Z A;  1SBB B;  1U4L A;  4R8N A;  1T5X D;  4KJO A;  1J9O A;  1YNJ C;  3OIQ A;  1W6K A;  3ITP A;  4LMQ D;  2L55 A;  2HQE A;  3NTH A;  1LTG D;  4K5W A;  4O42 A;  1LTB D;  4IUT A;  1CHP D;  1LTI D;  1ILQ A;  1WTP A;  4OO1 I;  2O5I C;  2N55 A;  2OXP A;  1LAC A;  2DY7 A;  2NVQ B;  4RGM A;  3OMC A;  2PCF B;  5KRU A;  3C1E A;  2WAC A;  1JB3 A;  1VMP A;  4Q0F A;  1TWH B;  1GUW A;  2R92 B;  5C3X A;  1DM0 B;  2OT2 A;  1KAA A;  1HTP A;  5KGU A;  1FD7 D;  2F3W A;  5JVH 3;  2EYO A;  4FF1 A;  1I4P A;  3QOL A;  4ZUJ A;  4CKC A;  3C46 A;  1SE4 A;  1B4O A;  3MXU A;  1JE4 A;  5CV4 A;  1OXT A;  2B8G A;  3I4N B;  1Q90 A;  3P7J A;  5DEH A;  1HA5 A;  4LJZ C;  1MGS A;  2BCO A;  2PZT A;  4DGZ A;  2F0S A;  2K1B A;  1YNJ D;  1LV9 A;  3HOU B;  3BS1 A;  4C3I B;  2F0I A;  2SOB A;  2NBF A;  4RGT A;  4ID6 A;  3K59 A;  1BO0 A;  5LHY 1;  3TDQ A;  2HCI A;  2KOL A;  1A15 A;  1CI3 M;  3BVG A;  2EY1 A;  1VF7 A;  1SE3 A;  1STY A;  4X3U A;  2PZW A;  3I90 A;  1HUN A;  3BVZ A;  2F0N A;  3L7Z C;  1EWC A;  3PUZ A;  1X3Q A;  1STN A;  1PTO B;  1M8A A;  5IT9 L;  1EY0 A;  3S16 B;  2FIN B;  2XN9 C;  4ODG A;  3HRZ C;  2E2J B;  1JQY D;  3MFY A;  1WD1 A;  1X3P A;  2KUM A;  4FO2 A;  1S4Z A;  1C4Q A;  1I6V C;  3QO2 A;  5C4Z A;  1QWY A;  2IL8 A;  3NBH A;  1PFB A;  3MHB A;  5BN5 A;  3CHB D;  1BQQ T;  5C0X J;  2F0T A;  1DJR D;  1C48 A;  3E6Z X;  4YIJ A;  5JEA J;  3GTO B;  2ZXO A;  1DON A;  3OPO A;  4WFN 3;  3Q22 A;  5I6W A;  1CQV A;  2Z8L A;  3KK7 A;  1CHQ D;  3NP8 A;  1STE A;  5ELE A;  4UDU C;  4G7Z C;  4JK1 C;  3HKZ B;  1LTA D;  1Q12 A;  1TWG B;  1NCV A;  1MD2 D;  1B1Z A;  4K6L A;  5HUR A;  5KND A;  3PO2 B;  1BCP C;  4B08 A;  1GUS A;  4F88 A;  2TSS A;  3C2P A;  4DXG A;  4BY7 B;  2RSN A;  3HOX B;  4KY5 A;  4KY7 A;  1CM9 A;  1SNC A;  3K57 A;  1F9R A;  5C0X G;  1BUV T;  5IGC A;  2KED A;  2RDG A;  3VR3 A;  5EBC A;  2QEJ C;  5I2X A;  3I3C A;  1DZ1 A;  3S1N B;  4K2K A;  2AWO A;  1TY2 A;  3WDN A;  1S5B D;  1AN8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...