2F0WA

Crystal structure of staphylococcal nuclease mutant v23i/l25i/v66l/i72l
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
136
structure length
136
Chain Sequence
KLHKEPATLIKAIDGDTIKIMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMLENAKKLEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Hydrophobic core mutants of Staphylococcal nuclease
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Staphylococcal nuclease
total genus 36
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2005-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2f0wA00
3MEHA 1F2MA 4DF7A 4KD3A 3HZXA 3OMGA 3QOLA 4PNYA 1SYEA 3DHQA 4OL7A 4N9TA 5DAUA 5IGCA 1STYA 2EYPA 2F0TA 4J1MA 1RKNA 5CV4A 5JAVA 1TQOA 4EQOA 5CGKA 5I9OA 5IGGA 4F8MA 2F0MA 4YIJA 1ENCA 5C5MA 3MZ5A 4G57A 1IHZA 4I65A 3SK8A 3SR1A 2PYKA 5EKKA 5IODA 5J39A 4NP5A 1STGA 5HURA 1KDCA 1SNDA 4NDXA 4HMIA 5C3WA 3BDLA 5M9OA 5C4HA 5CC4A 4PMBA 4K5XA 3SK5A 2EYJA 1JORA 2F0OA 1TR5A 1EYAA 1JOKA 1EY8A 1SYBA 2O4XA 2F0UA 1SYDA 4KV6A 1EZ6A 5E3FA 2ENBA 2F0NA 4ODGA 3RUZA 3QOJA 2OXPA 2F3VA 1EY6A 2PW5A 2HQEA 4IALA 4IUNA 1KABA 1STBA 5IGFA 2PQEA 2SNSA 2PZTA 3E5SA 4DU9A 4QF4A 2RBMA 3ERQA 5IGBA 4MIUA 4KTAA 4RKBA 3V2TA 4ZQ3A 1ENAA 5C3XA 3HEJA 1U9RA 3R3OA 2F0DA 5IIFA 4HTHA 5K5PA 5KIXA 4KJNA 4KJOA 1TT2A 3U9OA 2QDBA 3PMFA 4HMJA 5I6WA 3DMUA 1SNPA 2F3WA 3TP5A 2F0EA 4S3SA 2F0KA 4ZUIA 5CV9A 4K8IA 4K2LA 2KHSA 3SXHA 5KYIA 1A2TA 3NQTA 3P75A 5J22A 2EYFA 3OSOA 5NUCA 2PW7A 3NXWA 3OMCA 4ME5A 2EY1A 2M00A 5DEHA 5F2DA 4B9XA 1II3A 3BDCA 1EYCA 3LX0A 2EXZA 2F0FA 4QB4A 4KY7A 3NP8A 5IGEA 1STNA 3SHLA 1EY9A 5I6YA 4F7XA 4PMCA 1A3TA 2OF1A 3S9WA 2F0LA 3D4WA 3QB3A 2RKSA 3D6CA 4QMGA 2F0IA 3VA5A 4KY6A 3P1HA 2F0HA 4KY5A 1SYGA 4LAAA 4RKLA 3SK4A 5KEEA 4IZ8A 4K8JA 4K5VA 2PZWA 2F0PA 1NUCA 5EKLA 2SOBA 5J1ZA 1STHA 3TP6A 4EQPA 5I9PA 2SNMA 4K14A 3D8GA 3NK9A 1SNQA 4TRDA 3MHBA 2NUCA 1EY4A 3C1FA 1SNOA 5CV8A 1SNMA 3D4DA 1SYCA 2F0GA 3EVQA 1JOOA 3NUCA 5C5LA 3MXPA 1A3VA 3TMEA 1JOQA 4H7BA 2OEOA 3C1EA 1SNCA 1F2ZA 4J6HA 2F0VA 2KQ3A 4KHVA 4WRDA 5CV5A 2EY6A 4WORA 5CV6A 4EVOA 5HGTA 1EQVA 1STAA 1KAAA 2RDFA 4NKLA 5KGUA 2PZUA 4B9WA 1KDBA 3ITPA 5C4ZA 4ZUJA 1F2YA 4R8NA 2EY5A 3OWFA 2EYLA 4EQNA 4K6DA 1EY7A 5KRUA 5KYLA 5C6AA 2EYHA 3T13A 2WACA 2F0JA 3TP8A 5IGDA 5IOCA 3EJIA 5EGTA 1EY5A 1EYDA 2EY2A 2EYMA 2F0QA 3MVVA 3NHHA 4ID6A 4K2KA 3H6MA 4N9PA 4NMZA 5CV7A 1KDAA 3T16A 3EROA 4DGZA 1A2UA 5JOBA 1EZ8A 1EY0A 1A3UA 5E1FA 2F0SA 4DFAA 1NSNS 1SYFA 2LKVA 4KD4A 3SK6A 5CR3A 3TP7A 5ISRA 2EYOA 4E6IA 1AEXA 2F0WA 4K5WA
chains in the Genus database with same CATH superfamily
2MJ8A 1F2MA 1SXTA 5A2QE 1LT4D 2YYZA 2H5XA 3HOWG 4R4QA 2B2YA 3NEMA 3FMCA 2B2TC 5LMNL 1IBLQ 1S5BD 1QVCA 3S1MB 5EJWA 1O7IA 3X3NA 2Y0SE 5COYA 3Q6SA 1KDCA 4C3IB 1AE3A 2NVXH 4C3HB 2PNHA 2K50A 2WP8J 1GUTA 2CQAA 3FVQA 2PW5A 3M7GA 5DNFA 3RN5A 3S1MH 4P72A 2PPBC 3Q24A 4LF5Q 4LJZC 4YCVA 1LTSD 3KDFB 2XRSD 3K0YA 2EDGA 5IIFA 4GNXA 1YHQA 3S1QH 4A3KH 2DNEA 1RJTA 4JCVE 1D1IA 1QUQA 3D6WA 2Y0SB 1BO0A 3BZDB 4K2LA 1OTCA 3NQTA 1GXDC 3NBHB 2PW7A 3V96A 4LF8L 4C1NI 1PTOH 3CPWA 1SE3A 1STNA 5L37A 2JA9A 1DOLA 2CH4W 2BCOA 1F9RA 4KY6A 2R61A 1X32A 2QCPX 2NTTA 2RHQB 4IUTA 2JA5G 3I4NG 1WTPA 1CFMA 1T5XD 3HOVG 5EKLA 2KCTA 1HRJA 1SDFA 2K01A 4GLVB 1NNXA 1SNQA 4BY1H 1A3VA 3AFPA 4FF4A 2OEOA 1EIGA 3K7UC 3KLSA 2C9OA 1B70B 1M90C 4EVOA 2RVLA 2PZUA 4B3ML 1HA6A 4ZUJA 3LNNA 5BN4A 3AFQA 1ML0D 1ASYA 3U58A 3QJYA 3C2PA 2JEBI 5C6AA 1Y1WB 5FJ8G 3GTQB 5IGCA 1JB7A 2OQKA 3IRBA 1H9RA 3J80L 1O78A 3FKIB 3F2DA 4Z9CB 2B2TA 4KLKA 2UXDQ 3L3OC 4LF5L 4A93G 1WTQA 3J81L 2K5NA 1KL9A 2K5WA 2K28A 4G7OC 1E2ZA 5CV4A 5JAVA 1PH3A 3S1NH 1CT1D 4PV1C 4A3BH 1KD1C 4AYBE 3I4MH 5C5MA 4R8IA 1BDOA 2WAQG 4CHTB 5J39A 2L15A 1A15A 5EKKA 5IODA 3A54A 2JA7H 5E7NA 4XDXA 3BDLA 5M9OA 1EEID 1MD2D 5CC4A 3MFGA 1HR0Q 1B50A 1Y1VB 2MNAA 1PTOC 4OX9L 1XMQL 1EZ6A 1IW7C 1O7YA 1CI3M 2K7VA 3OPOA 1SE2A 1JE5A 4DR6L 2IPKD 1EU3A 2A5HA 2Z6BA 1NTGA 4JBJA 4ZQ3A 3TBIB 2K03A 2A73B 4HTHA 1FGUA 3OIPA 1TY0A 4C1NK 3PMFA 4BXXH 1RHPA 2MUYA 1DZ1A 2CW0C 2LMCB 1JJGA 3OTOQ 2X6GA 4K8IA 3GO5A 1I4PA 1PTOD 2JJQA 3A74A 1F77A 3E0JA 3F1ZA 4HJAA 1DJRD 3L2PA 3BZKA 4QB4A 4X65L 3Q22A 1DGSA 4GS3A 3PO2G 3K5OA 3G48A 2Z6KC 1G6PA 3K58A 4U673 2EPBA 5ELFA 2ZTDA 3A7AB 1UEAB 4IURA 3EA6A 2RF4A 3WOEA 3MHBA 1C9OA 3SEBA 3KLSX 3HKSA 4XYQA 3PIP3 2AQ3B 3UDXA 4KKTA 2NVYB 3VR4A 3CXCA 4JI1Q 3AMUA 2B63G 4DR4L 2BDNA 4C2MB 4LF8Q 3J81i 4HSPA 4FXGC 3A0JA 3H0GB 1Q82C 4CJ1B 1KIXA 4B3SQ 3M3YH 2EY5A 2C5CA 4DV1L 5KRUA 1HH2P 1XNQQ 2M2LA 4BY7G 3I73A 1N32Q 3MC0B 1Z7TA 4MTNA 1GUGA 3A5ZB 3GV3A 2XWBB 2A6HC 1D6EC 3K5MA 1Y69U 4OWTB 3AB9A 1AZQA 3CCRA 1NSNS 5T1GA 3STBD 4A3MH 1B4OA 4YWMA 2E5LL 1HQMC 1TS4A 4DF7A 4DNIA 3TQYA 2Z0SA 2I0QA 3MXUA 5FO7B 2IW3A 2L55A 5I9OA 3I4LA 5IGGA 1BCPB 1XMOQ 2JA8G 3FP9A 2E75C 5IYBH 3VR2A 2KBNA 1IYJB 2Z8LA 1PH8A 1JT8A 5ELBA 1GM5A 2R93H 2BOSA 1V1PA 1SNDA 3PIO3 4K6LA 2UUBL 1IBKQ 5LMNW 1E0BA 4DK6C 1B1ZA 4XQQA 3JAMi 1VQKA 5KIXA 1ASZA 1LLRD 2KOLA 5CMDA 2NBFA 4DV0Q 1B3AA 2Q2UA 3NWTA 5G3LD 3LGJA 4FF2A 1LV9A 4LWCA 3OTOL 1PA6A 3ERQA 1Q90A 4HIDA 1MBYA 1MHWC 1STEA 2MO0A 1CSQA 4FXDA 3PGZA 4A93H 3TP5A 2O5IC 3P75A 4A3EB 2PO4A 1VQIA 1OO9B 3HKZE 3IAYA 3H15A 1DONA 1IKMA 2PI2A 1EY9A 1TWHH 2AQ2B 5M3MG 2F0LA 3CMAA 4QMGA 1OXXK 1CTMA 5A2QL 3T53B 1ZYRD 4DR5Q 1I4RA 4DV0L 2K33A 4ABNA 2E2DC 3R2IA 3NBHA 1SNOA 1JOOA 1KQSA 5I2YA 5H1SE 3OWEB 3CMEA 3PUWA 5C0XI 1ILQA 2KQ3A 1JR0D 1YITA 1EQQA 5C44B 2AUKA 3CPFA 2RDFA 1KAAA 5CBAE 3NPPA 1M4VA 1C8CA 4JPBW 1WCMH 3AU7A 2Q2HA 4PG3A 4A3BB 2GVBA 2WACA 5IGDA 4FNFA 4AIMA 3EJIA 3NHHA 1KDAA 1LT5D 2KEDA 2Q2TA 2G9HD 1VQ5A 2K52A 1VQLA 2B8FA 5M3FG 2R92G 4A3MG 4KD3A 1LYLA 1HTPA 1S3OA 2VUMG 1Q3LA 4RAUC 4F8MA 1EFID 1XTDA 4B08A 2BA0A 3CD6A 3FDTA 1MJCA 4NP5A 1IL8A 4DN4M 3HOUB 1QUQB 1HCZA 4PMBA 1IYVA 3MEFA 3NTHA 3EQLC 2L9HA 3UE0A 1LTAD 3GQBA 2A69C 4ZKCB 2EJFC 4CJ0B 5AFWA 4RH6A 1N8RC 2D0OA 3EN2A 3UE1A 3HOXH 3T1HL 4LF4L 2FMCA 1HHVA 1L0XB 5JJKA 2I5MX 1F9SA 1H9SB 2CQOA 1A63A 3CRLC 3HOWH 2L12A 2PI2E 4CKCA 4IPHA 1FVIA 2ATWA 4JBKA 2R92H 4OHJA 5E4XA 2VQEL 1PH5A 1K3BC 3S9WA 2HQLA 1IYUA 1BQQT 2F0IA 1QVFA 4JBWA 4IZ8A 2IHFA 3IL8A 1ET9A 4A3DB 2R7ZB 5TSSA 3BZCA 3FHWA 2K6AA 4QUCA 4R1JA 3KJOA 4JYAQ 2MQHA 1E2WA 3HKZB 4IUUA 3E3XA 1G291 2EXDA 2R7ZG 3NE5B 4A3DG 3IKJA 2NVQB 1TS5A 2UU9L 2EY6A 4A3FB 3NQIA 1B9NA 4KHZA 1RL2A 1SAPA 5FLXE 5BN3A 4JVZA 2EYHA 1XYIA 2XNAC 2K04A 2KENA 5EGTA 1FNVA 4K2KA 1TWAH 4DV6Q 4N8FA 3T16A 3VYRA 4DKAC 1CK1A 3J81E 3RZDB 2HD3A 2VQEQ 1EOTA 2NWGA 4PZ6A 2F0WA 3HP3A 4GKKQ 1BBUA 3PO3H 3IFTA 3MEHA 2LXKA 4OGQC 3OMGA 4OL7A 2TSSA 5GAHC 1IL2A 3GTJH 1JE4A 4HJ5A 4YWKA 1KLUD 1WTRA 4FF3A 3SR1A 2QEXA 2KCMA 3MAQA 2YU9B 2K5HA 1KTKA 1R9TH 2ZTEA 1MGSA 2HIVA 4AYBB 3HOUG 4K5XA 5IP9H 1EY8A 4KV6A 3GTKB 3CP0A 1WTXA 4IALA 1LT3D 1KABA 1S5CD 3QWNA 4TQUS 1DCZA 3Q8DA 1L0YB 2WB1G 3TSSA 5M3FB 3S1RH 1PRTB 2QW7A 3FPPA 2NN6I 5EBDA 1K9MC 4JI6Q 1PVOA 1K8OA 2ID0A 3RN2A 4LW1A 2V1CC 2Q2IA 3OSOA 4YY3L 1A6XA 3NXWA 1U0LA 3OIQA 1DOKA 1WD0A 4X3SA 1PYSB 1O7ZA 1WCMB 4KY7A 3I4MG 1FNUA 3HFZB 5AJ3L 3CCQA 3A56A 1EWIA 4HCEA 3VYSA 2FXQA 4GLXA 5JJZA 1G2TA 4L6TB 1PHJA 3AYHB 1XPUA 1SROA 4EQPA 2B2UA 4XIGS 4BA1I 1V1OA 1JMCA 3KLWA 1OXUA 5IYCH 3P20A 2F0GA 1AZPA 1PZKD 1YJWA 3GV6A 1H9JA 1VQMA 2M9VA 3PIOA 5C4XG 4WJ4A 4WORA 4X62L 2K05A 3BG3A 4B3RQ 4YY3Q 1SLJA 3HOWB 1EY7A 3OYYA 4LF9L 1YEZA 2HDMA 2Z6KA 4DR5L 2Z4HA 4LK1C 2R92B 4A3EG 2I5LX 2L0CA 2HHHL 1EOVA 3H6MA 4LF6L 5FLXL 5IT9c 4PQXA 3HOZH 4IFDH 1HNWQ 2XN9C 1PH2A 5LL6X 1U4RA 1GJXA 4X3UA 1G51A 3M4OH 1VQ6A 4L5RC 4IJHA 1PFSA 1LACA 2A69D 5CGKA 3J7YW 3NELA 2FJ2A 4KN7C 2DN8A 4RGNA 4UHVA 4X3TA 2NN6G 1GVPA 1PH7A 1Y1VH 4XYOA 3X3MA 3GTGB 4RGMA 4C3HH 1Q8KA 2L4NA 5C44H 5IP7H 3URYA 2IWHA 4B3MQ 3VR3A 3OW2A 3GTPH 2F0OA 4R4CA 1HPCA 1WD1A 2VQFL 3PIPA 1EQTA 3H0GH 3BYTB 4DK1A 1NJIC 3RUZA 2OXPA 1EY6A 5C3EB 2QDLA 2JA6B 1WTVA 2IX0A 5E4WC 4MTKA 3CCEA 4J8QA 5IT9E 4RKBA 2F4VL 3HEJA 1N36Q 1HZAA 4KJNA 2CWPA 1BUVT 4BBRH 1ENFA 4IN3A 4A3IG 4B3RL 2F0EA 4X64L 1VQ7A 5CV9A 1QCBD 2R7FA 2NZ1D 5GAEC 2EYFA 4KI0A 1GOZA 3HG9A 5DEHA 5IYBG 3NP8A 3DM3A 1CHQD 4KKUA 4B3SL 3D6CA 2DUDA 2I46A 4KY5A 2CHBD 1V1PB 1BF4A 4K8JA 1K3RA 3VDYA 2PZWA 1JWSD 1Q86C 1LTRD 5I9PA 5EBCA 4QY7A 1X9NA 1GUWA 3DLLA 1PXUA 2ICIA 2R7DA 1SNMA 1Y8NB 3TMEA 1JOQA 1VQJA 1XMOL 2A68D 2LSSA 4RFBA 4LUOA 4A4IA 1D1KA 1BCPC 1GKHA 3VR6A 3J7AF 5C4XH 4NKLA 4QJFA 5KGUA 4B9WA 5JPNC 3I7FA 3K5LA 1NE3A 1LABA 3TP8A 2F0JA 2D62A 2HUGA 3CCUA 1EYDA 4K0KL 1GUSA 4N9PA 1TS2A 2HCIA 1A2UA 2E2JB 1CQVA 4J15A 1UE5A 4ZK9B 2VY3A 2GN5A 3A55A 2LKVA 1YZ6A 3STBC 1RF2D 2JE6I 2E2HH 2C35B 2VXWA 2IHEA 2XIWA 4DV6L 3DHQA 1JC7A 1K0RA 2CH4A 4GOPA 1D5ZC 3PO2H 2XSCA 2ZM6Q 3A8IE 1ENCA 4DA2A 4EGVA 3MZ5A 4OONA 3AEVA 2PMZE 2VW9A 4JK1C 4C3JH 3DEPA 3CCSA 3VYTA 1HR0L 3ULPA 4DV7L 3LWUA 4AH6A 1SE4A 4ZAIA 1KRTA 4JI0Q 1SSOA 2P5ZX 2F0UA 1SYDA 3BYYB 1V1QA 4JYAL 4U68A 2HQEA 4X65Q 1QNUA 2Q8IB 1PH1A 3J81j 5M5WB 2PZTA 3CC2A 3S15H 1XWEA 2RBMA 1XXGA 1YNXA 4QF4A 4G7ZC 1L1OB 2UXBQ 2WV6D 1YBYA 4OELB 2F0DA 1FR3A 4MHEA 1PRTD 5FKAC 3PO2B 1N36L 1CHPD 2KECA 1E22A 5I6WA 4OO1H 2F3WA 1VMCA 1QOHA 1A2TA 5JPMC 2EJGC 1I4GA 4O2DA 1SBBB 3NBIA 1II3A 4DV4L 5IYDG 2H1EA 3H3VC 3BJUA 4DK3C 4M8AA 5IGEA 3F2UA 3SHLA 5I6YA 3RLFA 4F7XA 5JVH3 4PZ8A 2OF1A 3VYUA 2IJ0A 4C2MH 4LUVA 4P2CB 2F3IA 2Q8TA 4LUZA 4TSSA 2FINB 5J1ZA 1HA5A 2JA6H 1JICA 3DWQA 3HKZG 3K5NA 4IOCA 2NVYH 4F87A 4X66Q 2YTXA 1SMYC 3NUCA 2JP1A 4DK0A 5CV6A 3KDFA 3T4AC 5HGTA 1CKNA 1TWHB 1EQVA 2FFKB 3Q23A 1VQGA 3J81c 5JJIA 1LT6D 3ICEA 4UP7A 3GTGH 2DY7A 3BU2A 5CBEE 5M5YB 1KNAA 3OWFA 3CKIB 4LF9Q 1NY4A 3F8TA 4DPGA 2B2WC 4A93B 2OCEA 4OO1G 3KF6A 1FD7D 1EY0A 3J7AV 4BBSH 2F0SA 1SYFA 2MFIA 1U4MA 4JI8L 1WI5A 1W6JA 1GHKA 3CU7A 4JI6L 2B2YC 2DGYA 4L5TA 1BBXC 4CKEA 1D5XC 1TWGB 1ILPA 4DR7L 3G4SA 1EWCA 5ELNA 3GTPB 5HURA 3M4YA 4KMUC 4IOAA 5BR8L 4P74A 2D2CC 2XGTA 3E9IA 2VZAA 1VQOA 3J7A5 3I8ZA 5C4HA 4DUZQ 1S72A 1QB5D 2K5VA 3J80i 3PUXA 4XT1B 1C4QA 4JG2A 3H09A 4DR1L 1X3EA 1IBML 4LFAL 5I4DA 3I90A 4X62Q 3JAML 3S14H 4JI4Q 3M4OB 1J8IA 3SE0A 3E5SA 4GNXC 4JOIC 3VA7A 1WCMG 2UU9Q 5KNBA 4B3TL 3R3OA 1VQ8A 3GTJB 4LFCL 4ZYSA 1MI2A 4V190 1FL0A 1PV4A 4YWLA 4DR2L 1VF5C 5A35A 3S16B 3LWEA 1HZ9A 2Y0SG 4YHHL 4P75A 4LF7L 1W2BA 1ZKOA 1FJGQ 3LX0A 1YI2A 3TS0A 3RLNA 3D4WA 1HNXQ 4Y52H 3P1HA 5M5XH 3GDEA 1JWUD 4K5VA 1CA5A 1YJNA 1UE1A 4OWWB 3K81C 4UP9A 3GTOH 1Y1VG 1KXLA 3ER0A 4TRDA 4K0KQ 2WINB 4DV7Q 1NCVA 3G7LA 3D4DA 1UAPA 3WDNA 4XXEA 3DM1A 5IY0A 4AYBG 2G9DA 1HNXL 2ZXPA 2Z9HA 1RIPA 4L63B 5LL6S 4UP8A 4GLAC 2X6LA 4A3EH 1PFBA 1K8MA 3PQIA 5KNDA 2EY2A 1RTNA 2EYMA 3MVVA 5GQOA 3SGIA 1G6ZA 3RR5A 1CZWA 3GTMH 3E9HA 1VQDA 3CQZH 4KD4A 3M9BA 3HOYH 4DUYL 4DR3Q 2NB0A 4QL5A 4N9TA 2PMZB 3M4QA 2ZXOA 4G4KA 4EQOA 5D3IB 5DLQE 1VQCA 4LFCQ 2KCCA 2NN6H 1EWHA 3OW7A 3K7AH 3PSIA 3NWSA 1RTOA 3SDZA 1HXYD 1BCPF 4A3LG 1UUPA 1HZCA 3HOVB 1LTID 4X6AH 4FDBA 2BA1A 4OWXB 3A5UA 4H13C 4IO9A 2E2IH 4DR1Q 1YNJC 1EL0A 2D0PA 1K8GA 4RHSA 3L7ZC 1L0WA 1YHBA 4KTAA 2QILA 3QG1A 5C3XA 1CZGA 1CKNB 2KVMA 2CVRA 2BE5C 2IT1A 5EPLA 1VQFA 1V43A 2UUAL 2HDLA 2QDBA 4L8JA 2ES2A 3EIVA 2UUCQ 2AQ1B 4S3SA 1EIHA 2F52A 2AWOA 3UDFA 2CCZA 5DM63 1VMPA 1SFOH 1SJHD 2D5DA 4A3CH 1PLFA 4X64Q 2K1BA 2NYZD 2RKSA 5KNCA 1LTBD 5KEEA 4JI7L 3B6YA 2NZOA 4I7ZC 2F0PA 1MSGA 5BR8Q 5C0XH 4LNQA 2RHSB 3D8GA 4DV5Q 3ZYYX 1F2LA 5FO8B 3I4OA 1NR4A 3CC7A 1PYWD 3NTKA 5GADC 4H02A 1SNCA 2I5HA 1STAA 2A8VA 2PQAB 3T1YQ 2K4KA 1X55A 1KDBA 3H3VH 4R9WA 1SE8A 4HSVA 5FK9C 3I4NB 3TS2A 1ICWA 2KCNA 2EE1A 4DGZA 3CCMA 4A3MB 2TMPA 3I4MB 4LF7Q 5BN5A 2EYOA 4DV4Q 3HOYG 1H9MA 1QG7A 3RMHA 2IL8A 2OTLA 2DJGC 4PNYA 1BVSA 5AJ3Q 1YHAA 1DXMA 5M3MH 1I94L 2WFWA 4B3TQ 2JA8H 1JWMD 3C46A 1VQEA 5EQ0A 3N52A 2OWOA 1BR9A 1SEBD 1H95A 3NTIA 3KF6B 4FP5D 4A3LH 3HOUH 3ND9A 5C0XG 1Y14B 1LTGD 2WIIB 4OIJA 1JOKA 1IBKL 1B3QA 1SYBA 1SMYD 2AUJD 4A3FH 4GZYC 5C4XB 2EOTA 1B2TA 3J7ZC 4Y7NH 1JCKB 1NMFA 2B63B 1XX8A 1K83H 2NVTB 4A3JB 5D14A 4RA8A 3QIAA 2SNSA 4OIKA 2H4OA 3U4ZA 2JQOA 1QWYA 4JI7Q 3V2TA 5T1IA 4C3IG 1VQPA 4MNOA 3D0FA 1Q1BA 4JI1L 1YNND 1QILA 2WB1E 3MFYA 1W3SA 3PO3B 2EIFA 3CAMA 1ESRA 5KYIA 1VQNA 1X6OA 1Z6HA 3GTLB 2XRQD 4ME3A 1Y1WG 1ZEQX 1A0IA 2M00A 1MIUA 4H44C 4LF4Q 4A3IB 4PMCA 1G8ZD 1PZJD 4DV1Q 4DNRB 4DAMA 4KKSA 4OEMB 1WVLA 1B53A 3HS0C 5IWAQ 5C4JH 5M5WH 1VQBA 4P73A 1Q8IA 3MXGA 5C3EG 5CV8A 2AHOB 1LM0A 3NENA 2ZM6L 1PFNA 4HAEA 1U5KA 1O7LA 1N9WA 2ZJQA 1BNZA 2Z1CA 3BDOA 5JEAH 2RCFA 4DR6Q 4I7AA 3OHXC 4AQYL 3R2TA 1PRTF 3KF8A 1QE6A 2XVSA 2EYLA 3KJPA 3SVMA 1H9SA 1EY5A 3D4RA 4ID6A 4G7HC 5CV7A 4BBRB 1F9PA 1VQAA 4L5QA 5LMUQ 4GKJQ 5M3MB 4DFAA 3HOXG 3J80c 3BS1A 2RDGA 1QZGA 1HZBA 4BY7B 1AEXA 4ODGA 4UAIA 4UPAA 1TWCH 2RSOA 4A3KB 1NR2A 1SYEA 1EU4A 4ALPA 4QGUA 1STYA 1HFNA 3HRZC 1YNJD 4YIJA 3TN2A 1XPOA 1IHZA 1P16A 3TRZA 4HIOA 1JB3A 1EFWA 1CUKA 1QZHA 2EQSA 1IKLA 4NDXA 4DAYA 4RHRA 1PTOF 2MGSA 1C7YA 4DR7Q 1NMGA 5GAGC 4C3JG 5FO9B 1TXYA 4AQYQ 4JI5L 1TS3A 2F3VA 1HNZQ 2R93B 3ND8A 4P71A 2HCCA 5EPJA 1LTTD 3T1YL 5IE8A 3JAMc 4LFAQ 1IBMQ 4BXXG 1VS0A 4POFA 4FF1A 3GTOB 5C4JB 1Z47A 3D3RA 4NPSA 1GD7A 3O13A 1JJ2A 2GA4B 2PNRC 4A3GH 4DAVA 1PTOB 1I5FA 2JA5H 1X3FA 1EIYB 2VQFQ 3VA5A 3S2DH 1G91A 1SYGA 4X66L 5IP7G 1ZXTA 2WB1B 2KEEA 4XQNA 4BY1B 5I2XA 1PRTC 2N88A 2X69A 1EY4A 2KA7A 1KNEA 4UDUC 3K59A 4LMQD 2K75A 2A6EC 1B44D 4OO1I 1ICFB 2A74C 5J3BA 4KHVA 1VQ4A 1BOSA 4JBMA 1I6HH 2ICEC 2LY7A 1TWFB 2MP1A 1K73C 1O80A 4RGTA 2JK8A 2WKDA 4R8NA 3HOZG 2WAQB 2J7ZA 3PF5A 4XQJA 1TWGH 4LFBL 2I07B 5EPKA 3HOXB 3H3VI 1B9MA 3PUZA 4JI4L 1LO5D 4QQBX 1D8LA 3SK6A 3TP7A 5ISRA 3I56A 3RZOH 3RZDH 1ONLA 1PFMA 3L0OA 1Q7YC 3HZXA 5G3LF 3GD7A 1K8AC 2BE5D 4Y7NB 2E74C 4DUZL 4A3GG 4GN3B 2N8NA 4Q0FA 1V8QA 4DUYQ 4DR3L 1D7QA 2SDFA 2VUMH 4DXFA 3PUVA 4A3BG 4JV5L 4A3FG 2JA6G 2NVQH 4NW2A 1J9OA 2OQ0A 3W5OA 2EYJA 3P7JA 4EQ5A 1EYAA 2F4IA 3T51B 3U9SA 2F0NA 1T5EA 4JI3L 2IX1A 1HNZL 1I3QB 2R3ZA 4GOPB 1TKWB 1YNNC 2VS1A 3K57A 2YTYA 3HGBA 4MIUA 4BY7H 1GUOA 2G5DA 2ASBA 3H91A 4IFDJ 5K5PA 2YV5A 3W1GA 1VQHA 1E1OA 4HJ8A 3DXJC 1UEBA 2F0KA 4CJ2C 4R4OA 3SXHA 1IW7D 2EJMA 2B29A 5IYDH 4B9XA 2EY1A 1UNSA 3W2DA 4GKKL 2F0FA 2MHVA 3S17H 1EEFD 4KN4C 1X65A 2K5QA 1K28A 2F0HA 4A3JG 3DWPA 3ULLA 1J5EL 3S15B 1STHA 5JVG3 1NAPA 1BCPD 3NK9A 3TZUA 1PH6A 1CA6A 4O42A 4IPCA 4C3HG 2RSNA 3C1FA 3N6RA 4IPDA 4HR7B 2SEBD 5D65A 4JI5Q 4R4TA 4TKOB 5C3EH 2NVXB 2OTJA 2DY8A 1KLGD 3GTKH 4BS9A 3G71A 1B8AA 1S5FD 1X3PA 1AN8A 3R93A 4DV3Q 1B7YB 4JC0A 1SMXA 1L2FA 3QR8A 5DM73 2VUMB 3E0EA 1LTLA 3OOCA 2N55A 3G6EA 5ELEA 5ELDA 4DXGA 2JA8B 2BDOA 2UXDL 1N33Q 1TIID 4HEDA 4YHHQ 2F4VQ 1FYCA 1PDQA 5IGFA 5ELOA 4K5WA 1BKBA 3QOLA 2B39A 3EFXD 4FVMA 3KF8B 4YCUA 5DAUA 4CDFC 2NVTH 3E6ZX 1E1TA 3ERSX 3S14B 1L1OA 1QNKA 1K83B 1TWFH 4C3JB 2JA7B 5K36G 3CC4A 5C44G 2O5JC 2UXCL 3BVZA 4ILWA 4DR4Q 2ENBA 4R4IA 5IWAL 4YCWA 3QOJA 3U4VA 2RDHA 1KRSA 1I6VC 1CKMA 5C0XJ 1SRUA 2OT2A 2FMMA 3VR5A 4BA2I 5HY6A 4BBSB 2LXJA 5EAYA 4KJOA 1HFGA 4HJ9A 3ZJYC 4A3IH 3DEOA 5FOBB 3DMUA 1SNPA 3IFDA 1IXRA 2MPMA 1W6KA 2EZVA 1Q1EA 1AP0A 4JI2Q 4CBVA 3CQZB 5NUCA 1T9HA 2FHTA 5F2DA 1EUJA 1I94Q 3BDCA 4RWSC 1WOCA 4RCNA 2N78A 1JJCB 3QB3A 2ZJRA 1QVGA 4RKLA 2J0TD 2MO1A 2LFNA 3SK4A 1PH9A 4LFBQ 1NUCA 1LUZA 1HJPA 2KJXA 1JQYD 2SNMA 4JV5Q 1GO3E 1J6QA 2B2VA 4A76A 2JN4A 3M7NA 3MXPA 3I2ZA 5CYUA 1XMQQ 1N34L 1HUNA 3RD4A 2F0VA 2XWJB 3K0XA 5IP9G 2K14A 3K6OA 3R8BA 4RG1A 1UE7A 2KUMA 4QUFA 1EQRA 3S2DB 4EQNA 3MWYW 5JJLA 3DWAA 4JI2L 1N34Q 3T13A 2K5DA 1YJ9A 2CKZB 2QA4A 4JI0L 5IOCA 2O2LD 3CCJA 1R4QB 1KHIA 1PYBA 2F0QA 4H0LC 4HIKA 1ESFA 2PCFB 1WTOA 2J4XA 4HN7A 3S1QB 3I3CA 2E2HB 1IZ6A 1RDPD 4DAYB 2B3GA 1X56A 3V05A 3PO3G 4E6IA 1HTLD 1H9KA 2KHJA 1OXSC 2E2JH 3W1BA 1YVCA 4BBSG 2JXMB 4NB3A 1C0AA 2EYPA 2F0TA 5D3DA 3T1HQ 1KAWA 3T56B 3FKIG 4A75A 1Q81C 1G2SA 3NSWA 2A6HD 4XTCS 1S4ZA 2ZT9C 1X3GA 4I65A 2L5TA 3I4NH 1Q46A 1M1KC 3H0GG 1XNRQ 3TREA 3KBGA 2ALYB 2AMCB 4NXML 1I4QA 2UUBQ 3SK5A 5M5YH 3HOVH 1JORA 1HR0W 4KHPL 2O4XA 5GROA 3S1NB 1HQRD 1X3QA 1WFQA 3U50C 5FLMH 2AWNA 4DV5L 2QKIC 1X54A 1RCVD 2CWAA 3M4PA 3I72A 1E2VA 1UE6A 4NXNQ 2JA5B 3MA2B 4HMJA 4PMWA 2WKCA 4FO2A 3WOFA 2VL6A 5J22A 3KK7A 5LMNQ 1IBLL 1K0SA 4IFDG 1WTHA 2EXZA 4IUPA 3CF5A 4CGYB 1GUNA 1Y1WH 1E24A 3BVMA 2WAQE 4PZ7A 5CORA 3PF4A 1RODA 1E3PA 4GNXB 1N32L 2R93G 1I4HA 3TP6A 1I6HB 4K14A 4UY8C 2B63H 5HGQA 3KBXA 5IYCG 4DV2L 1XTCD 2UXBL 5C5LA 2UXCQ 3EVQA 5JEAG 2D9UA 1FGBD 1VCIA 1Y8OB 2RA4A 5CV5A 1YIJA 4EX5A 3GP7A 2RCNA 4CDEC 4IQZA 1AH9A 5FLMG 1I50H 2QF7A 4RGOS 1XPRA 4NXMQ 1EYGA 3AQQA 5JOBA 3JC66 2QGQA 5E1FA 5JEAJ 3GTLH 2HT1A 5CR3A 4BBRG 3BVGA 4ZRZA 2DNCA 3A8JE 3KFUA 1NBWA 4NXNL 3GTQH 4J1MA 1D2BA 4DNTB 1TU2B 1DM0B 2A1AA 1CSPA 3I91A 3FKIH 3FEWX 1BXTA 3SK8A 2PYKA 4A3JH 1AFPA 2F03A 2AKWB 3EBEA 4DR2Q 1MJEA 2ZTCA 2VB2X 1I50B 4HMIA 2R6GA 4CKBA 4IFDI 1HNWL 3UDGA 1UWVA 2L11A 3L9AX 3UDIA 4O0AA 3JAME 3KLRA 2IY5B 1FNWA 4JOIA 4IUNA 1N33L 2PQEA 4V0BA 5IGBA 2ZXRA 4CDCC 4DU9A 4QIWE 2YTVA 3MXNA 1ENAA 1U9RA 1CM9A 3HOYB 3CCLA 4DV2Q 3TDQA 3MTSA 3PV0A 2JSOA 1TWCB 1SFOB 1S40A 4A3GB 1V9PA 3RZOB 3ULJA 2IX3A 3FRPB 4BWGB 3WWVA 2DJFC 3M3YB 1EYCA 1SJED 4LF6Q 3A8KE 4ZCKA 1A3TA 1OXTA 1E7ZA 4OX9Q 4LAAA 4RCOA 5EKIA 4DAPA 4MN3A 1RD9D 3KUPA 2BH2A 2CFMA 3ONAB 4JI3Q 4IPGA 3CW2C 2NUCA 4N8X1 4IUVA 3A7LA 1SYCA 5FLXc 3W3AA 5LHY1 4QCLA 1I3QH 4H7BA 4WJWA 3D31A 2N3SA 1F2ZA 3M85A 4HIMA 3KOJA 4ULLA 1VF7A 4C56C 3CCVA 2Z4IA 2YU9H 5C4ZA 3S24A 2JEAI 4OXPA 1F2YA 4FYDA 4Q5VA 4K6DA 5KYLA 2NTSA 2RQXA 3PCOB 1MKHA 1XNRL 4IJLA 3I70A 4NMZA 1AW7A 1R4PB 2EVBA 3EROA 1F9QA 1SN8A 4KK7A 4RMFA 1A3UA 3KYHC 1XJVA 1S5ED 3S16H 1D5MC 3CRKC 4GOPC 4XT3B 4JI8Q 2E8GA 1RKNA 2UUCL 1TQOA 4A3CG 3K80C 2F0MA 3TZDA 4G57A 3S2HB 1STGA 2V4DA 3QO2A 3F2BA 2HHHQ 5C3WA 1R9TB 2F1MA 1ZYRC 3K8AA 2A19A 1WJJA 1HUMA 1U4LA 3K7AB 4TVAB 3TEHB 1TR5A 4ZKBB 1TVXA 5E3FA 2E76C 1U4PA 1STBA 3Q0AA 2A68C 2VB3X 3G6JB 3MXNB 4ZLTF 1M8AA 3UI2A 2L1BA 2LS01 2JYOA 1GHJA 2GVAA 1Q12A 2BH8A 3I55A 4A3KG 1MSHA 3J80E 1KC8C 1DYQA 1TT2A 3U9OA 2UUAQ 1C48A 1S5DD 4GN4B 4ZUIA 1XNQL 2KHSA 5M5XB 4CDDC 5FJ8H 4ME5A 3OMCA 2B8GA 4IUQA 3GTMB 4GN5A 1Z9FA 3H94A 1J5EQ 3HOZB 1TWAB 2B2UC 1PZID 1SR3A 1CQFA 1DOMA 1DD2A 4APVA 1VDZA 1PMRA 1OXVA 4DV3L 2B2VC 2A6ED 2E5LQ 5K36H 3RLOA 1PH4A 2CW0D 2XTIA 4QIWB 2NZHA 4O1NA 2SOBA 4F88A 1L1OC 4WJ3M 4M1UB 3PUYA 3FPUB 4FXKC 1TY2A 5LMUL 2JA7G 4GKJL 4BY1G 1P8LA 4KHPQ 2ZJPA 2N49A 2KHIA 2QEJC 3CHBD 3C1EA 2B2WA 1EIFA 4J6HA 4WRDA 4L5SA 4WFN3 4MZ9A 1VQ9A 2E2IB 5ELCA 1WTWA 2R7ZH 4A3DH 1WYDA 3ITPA 2PQAA 4HCSA 1BBWA 1A8VA 3RNUA 1CKOA 1ET6A 4X3KA 4C3IH 3C3LA 3F2CA 1A62A 4JW0A 1I4XA 1QJOA 5IT9L 3S2HH 4POGA 1AE2A 4HJ7A 3S17B 3DUZA 2K32A 1EZ8A 2VNUD 2HIXA 5M3FH 3S1RB 2Q8RE 1FJGL 1Y8PB
chains in the Genus database with same CATH topology
2MJ8A 1F2MA 1SXTA 5A2QE 1LT4D 2YYZA 2B2YA 3FMCA 2B2TC 1S5BD 3S1MB 5EJWA 3X3NA 5COYA 3Q6SA 1KDCA 4C3IB 4C3HB 2WP8J 1GUTA 2CQAA 3FVQA 2PW5A 3M7GA 5DNFA 2PPBC 3Q24A 4LJZC 1LTSD 2XRSD 3K0YA 2EDGA 5IIFA 2DNEA 1RJTA 1D1IA 3D6WA 2Y0SB 1BO0A 3BZDB 4K2LA 3NQTA 1GXDC 2PW7A 3V96A 4C1NI 1PTOH 1SE3A 1STNA 1DOLA 2BCOA 1F9RA 4KY6A 2R61A 1X32A 2QCPX 2NTTA 4IUTA 1WTPA 1CFMA 1T5XD 5EKLA 1HRJA 1SDFA 2K01A 1SNQA 1A3VA 4FF4A 2OEOA 1EIGA 3KLSA 2C9OA 4EVOA 2RVLA 2PZUA 1HA6A 4ZUJA 3LNNA 5BN4A 1ML0D 3QJYA 3C2PA 2JEBI 5C6AA 1Y1WB 3GTQB 5IGCA 1H9RA 3J80L 1O78A 3FKIB 4Z9CB 2B2TA 3L3OC 1WTQA 3J81L 2K5WA 2K28A 4G7OC 1E2ZA 5CV4A 5JAVA 1CT1D 4PV1C 5C5MA 4R8IA 1BDOA 4CHTB 5J39A 1A15A 5EKKA 5IODA 3A54A 4XDXA 3BDLA 5M9OA 1EEID 1MD2D 5CC4A 3MFGA 1B50A 1Y1VB 1PTOC 1EZ6A 1IW7C 1O7YA 1CI3M 2K7VA 3OPOA 1SE2A 2IPKD 1EU3A 2A5HA 4ZQ3A 3TBIB 2K03A 2A73B 4HTHA 3OIPA 1TY0A 4C1NK 3PMFA 1RHPA 2MUYA 1DZ1A 2CW0C 2LMCB 2X6GA 4K8IA 3GO5A 1I4PA 1PTOD 3E0JA 1F77A 1DJRD 4QB4A 3Q22A 3K5OA 3K58A 4U673 2EPBA 5ELFA 3A7AB 1UEAB 4IURA 3EA6A 3WOEA 3MHBA 3SEBA 3KLSX 4XYQA 3PIP3 2AQ3B 4KKTA 2NVYB 3VR4A 3AMUA 2BDNA 4C2MB 4HSPA 4FXGC 3H0GB 4CJ1B 2EY5A 2C5CA 5KRUA 2M2LA 3I73A 3MC0B 1Z7TA 1GUGA 3GV3A 2XWBB 2A6HC 1D6EC 3K5MA 1Y69U 3AB9A 1AZQA 1NSNS 5T1GA 1B4OA 1HQMC 1TS4A 4DF7A 3MXUA 5FO7B 2IW3A 2L55A 5I9OA 3I4LA 5IGGA 1BCPB 2E75C 3VR2A 2Z8LA 5ELBA 2BOSA 1V1PA 1SNDA 3PIO3 4K6LA 1E0BA 1B1ZA 4XQQA 5KIXA 5CMDA 1LLRD 2KOLA 2NBFA 1B3AA 3NWTA 5G3LD 4FF2A 1LV9A 3ERQA 1Q90A 1MBYA 1STEA 4FXDA 3TP5A 2O5IC 3P75A 4A3EB 2PO4A 1OO9B 3IAYA 1DONA 1IKMA 1EY9A 2AQ2B 2F0LA 4QMGA 1OXXK 1CTMA 5A2QL 3T53B 1ZYRD 1I4RA 2K33A 4ABNA 2E2DC 3R2IA 3NBHA 1SNOA 1JOOA 5I2YA 3OWEB 3PUWA 5C0XI 1ILQA 2KQ3A 1JR0D 5C44B 2AUKA 5CBAE 1KAAA 2RDFA 3NPPA 1M4VA 1C8CA 3AU7A 4A3BB 5IGDA 2WACA 4FNFA 3EJIA 3NHHA 1KDAA 1LT5D 2KEDA 2G9HD 2B8FA 4KD3A 1HTPA 1Q3LA 4RAUC 4F8MA 1EFID 4B08A 2BA0A 3FDTA 4NP5A 1IL8A 4DN4M 3HOUB 1HCZA 4PMBA 1IYVA 3NTHA 3EQLC 2L9HA 1LTAD 3GQBA 2A69C 4ZKCB 2EJFC 4CJ0B 5AFWA 4RH6A 2FMCA 1HHVA 1L0XB 1F9SA 1H9SB 3CRLC 2L12A 4CKCA 4OHJA 5E4XA 3S9WA 1IYUA 1BQQT 2F0IA 4JBWA 4IZ8A 3IL8A 1ET9A 4A3DB 2R7ZB 5TSSA 2K6AA 4QUCA 1E2WA 3HKZB 4IUUA 1G291 3NE5B 3IKJA 2NVQB 1TS5A 2EY6A 4A3FB 3NQIA 1B9NA 4KHZA 1SAPA 5FLXE 5BN3A 2EYHA 1XYIA 2XNAC 2K04A 5EGTA 1FNVA 4K2KA 3VYRA 3T16A 1CK1A 3J81E 3RZDB 1EOTA 2NWGA 2F0WA 3HP3A 3IFTA 3MEHA 4OGQC 3OMGA 4OL7A 2TSSA 1JE4A 1KLUD 1WTRA 4FF3A 3SR1A 3MAQA 2YU9B 1KTKA 1MGSA 4AYBB 4K5XA 1EY8A 4KV6A 3GTKB 1WTXA 4IALA 1LT3D 1KABA 1S5CD 3QWNA 4TQUS 1DCZA 1L0YB 3TSSA 5M3FB 1PRTB 3FPPA 2NN6I 5EBDA 1K8OA 2ID0A 3OSOA 1A6XA 3NXWA 3OIQA 1DOKA 1WD0A 4X3SA 1O7ZA 1WCMB 4KY7A 1FNUA 3A56A 4HCEA 3VYSA 5JJZA 1G2TA 4L6TB 4EQPA 2B2UA 4XIGS 4BA1I 1V1OA 1OXUA 3P20A 2F0GA 1AZPA 1PZKD 3GV6A 1H9JA 2M9VA 4WORA 2K05A 3BG3A 3HOWB 1EY7A 2HDMA 2Z4HA 4LK1C 2R92B 2L0CA 3H6MA 4IFDH 5FLXL 4PQXA 2XN9C 5LL6X 1U4RA 1GJXA 4X3UA 1LACA 2A69D 5CGKA 3J7YW 2FJ2A 4KN7C 2DN8A 4RGNA 4X3TA 2NN6G 4XYOA 3X3MA 3GTGB 4RGMA 2L4NA 3URYA 2IWHA 3VR3A 2F0OA 1HPCA 1WD1A 1EQTA 3BYTB 4DK1A 3RUZA 2OXPA 1EY6A 5C3EB 2JA6B 1WTVA 2IX0A 5E4WC 4J8QA 5IT9E 4RKBA 3HEJA 4KJNA 1BUVT 1ENFA 4IN3A 2F0EA 5CV9A 1QCBD 2NZ1D 2EYFA 4KI0A 1GOZA 3HG9A 5DEHA 3NP8A 1CHQD 4KKUA 3D6CA 2I46A 4KY5A 2CHBD 1V1PB 1BF4A 4K8JA 2PZWA 1JWSD 1LTRD 5I9PA 5EBCA 1GUWA 1PXUA 2ICIA 1SNMA 1Y8NB 3TMEA 1JOQA 2A68D 4RFBA 1D1KA 1BCPC 3VR6A 3J7AF 5KGUA 4NKLA 4B9WA 5JPNC 3K5LA 1LABA 3TP8A 2F0JA 2D62A 2HUGA 1EYDA 1GUSA 4N9PA 1TS2A 2HCIA 1A2UA 2E2JB 1CQVA 4ZK9B 3A55A 2LKVA 1RF2D 2JE6I 2VXWA 2XIWA 3DHQA 1JC7A 1D5ZC 2XSCA 3A8IE 1ENCA 4DA2A 4EGVA 3MZ5A 4JK1C 3DEPA 3VYTA 3LWUA 1SE4A 4ZAIA 1SSOA 2F0UA 1SYDA 3BYYB 4U68A 2HQEA 1QNUA 2Q8IB 5M5WB 2PZTA 1XWEA 2RBMA 1XXGA 4QF4A 4G7ZC 2WV6D 3PO2B 5FKAC 2F0DA 1FR3A 4MHEA 1PRTD 1CHPD 2KECA 5I6WA 4OO1H 2F3WA 1VMCA 1QOHA 1A2TA 5JPMC 2EJGC 1I4GA 1SBBB 3NBIA 1II3A 2H1EA 3H3VC 4M8AA 5JVH3 5IGEA 3F2UA 3SHLA 3RLFA 4F7XA 5I6YA 2OF1A 3VYUA 2IJ0A 4P2CB 2Q8TA 4TSSA 2FINB 5J1ZA 1HA5A 1JICA 3DWQA 3K5NA 4F87A 1SMYC 3NUCA 2JP1A 4DK0A 5CV6A 5HGTA 3T4AC 3Q23A 1TWHB 2FFKB 1EQVA 1LT6D 2DY7A 5CBEE 5M5YB 1KNAA 3OWFA 3CKIB 2B2WC 4A93B 4OO1G 1FD7D 1EY0A 3J7AV 2F0SA 1SYFA 1U4MA 1W6JA 1GHKA 3CU7A 2B2YC 1BBXC 4CKEA 1D5XC 1TWGB 1ILPA 1EWCA 3GTPB 5HURA 3M4YA 4KMUC 2D2CC 3I8ZA 5C4HA 1QB5D 3PUXA 4XT1B 1C4QA 3H09A 5I4DA 3I90A 3JAML 1J8IA 3M4OB 3SE0A 3E5SA 3VA7A 5KNBA 3R3OA 3GTJB 4ZYSA 1MI2A 4V190 1VF5C 5A35A 3S16B 3LWEA 1ZKOA 3LX0A 3D4WA 3P1HA 1JWUD 4K5VA 1CA5A 4TRDA 2WINB 1NCVA 3G7LA 3D4DA 1UAPA 3WDNA 4XXEA 3DM1A 2G9DA 2ZXPA 4L63B 5LL6S 2X6LA 1PFBA 1K8MA 5KNDA 2EY2A 1RTNA 2EYMA 3MVVA 1G6ZA 1CZWA 4KD4A 2NB0A 4N9TA 2PMZB 2ZXOA 4G4KA 4EQOA 5D3IB 2KCCA 2NN6H 1EWHA 3OW7A 3NWSA 1RTOA 3SDZA 1HXYD 1BCPF 1UUPA 3HOVB 1LTID 2BA1A 4H13C 1YNJC 1EL0A 4RHSA 3L7ZC 4KTAA 2QILA 3QG1A 5C3XA 1CZGA 2KVMA 2CVRA 2BE5C 2IT1A 5EPLA 1V43A 2HDLA 2QDBA 4L8JA 2AQ1B 4S3SA 1EIHA 2AWOA 5DM63 1VMPA 1SJHD 2D5DA 1PLFA 2K1BA 2NYZD 2RKSA 5KNCA 1LTBD 5KEEA 4I7ZC 2F0PA 1MSGA 5C0XH 3D8GA 3ZYYX 1F2LA 5FO8B 1NR4A 1PYWD 3NTKA 1SNCA 1STAA 1KDBA 4R9WA 4HSVA 5FK9C 3I4NB 1ICWA 2KCNA 2EE1A 4DGZA 4A3MB 2TMPA 3I4MB 5BN5A 2EYOA 1H9MA 1QG7A 3RMHA 2IL8A 4PNYA 1DXMA 1JWMD 3C46A 5EQ0A 3N52A 1BR9A 1SEBD 3NTIA 4FP5D 5C0XG 3ND9A 1LTGD 2WIIB 4OIJA 1JOKA 1SYBA 1SMYD 2AUJD 4GZYC 5C4XB 2EOTA 1B2TA 1JCKB 2B63B 1XX8A 2NVTB 4A3JB 5D14A 4RA8A 3QIAA 2SNSA 4OIKA 2H4OA 1QWYA 3V2TA 5T1IA 4C3IG 1Q1BA 1YNND 1QILA 3MFYA 3PO3B 1ESRA 5KYIA 1Z6HA 3GTLB 2XRQD 1ZEQX 2M00A 4H44C 4A3IB 4PMCA 1G8ZD 1PZJD 4DNRB 4KKSA 1WVLA 1B53A 3HS0C 1Q8IA 3MXGA 5CV8A 1PFNA 4HAEA 1O7LA 1BNZA 2Z1CA 3BDOA 5JEAH 3OHXC 3R2TA 1PRTF 3KF8A 1QE6A 2XVSA 2EYLA 3SVMA 1H9SA 1EY5A 3D4RA 4ID6A 4G7HC 5CV7A 4BBRB 1F9PA 5M3MB 4DFAA 3BS1A 2RDGA 4BY7B 1AEXA 4ODGA 4UAIA 2RSOA 4A3KB 1NR2A 1SYEA 1EU4A 1HFNA 1STYA 3HRZC 1YNJD 4YIJA 3TN2A 1IHZA 1JB3A 1IKLA 4NDXA 4DAYA 4RHRA 1PTOF 2MGSA 4C3JG 5FO9B 1TS3A 2F3VA 2R93B 3ND8A 5EPJA 2HCCA 1LTTD 4FF1A 3GTOB 5C4JB 1Z47A 3D3RA 3O13A 2GA4B 2PNRC 4DAVA 1PTOB 3VA5A 1G91A 1SYGA 1ZXTA 2WB1B 2KEEA 4XQNA 4BY1B 5I2XA 1PRTC 2N88A 2X69A 1EY4A 2KA7A 1KNEA 4UDUC 3K59A 4LMQD 2A6EC 1B44D 4OO1I 2A74C 4KHVA 1BOSA 2ICEC 2LY7A 1TWFB 2MP1A 1O80A 4RGTA 2WKDA 4R8NA 2WAQB 2J7ZA 4XQJA 2I07B 5EPKA 3HOXB 1B9MA 3PUZA 1LO5D 3SK6A 3TP7A 5ISRA 1ONLA 1PFMA 3HZXA 5G3LF 3GD7A 2BE5D 4Y7NB 2E74C 4Q0FA 1V8QA 2SDFA 4DXFA 3PUVA 1J9OA 4NW2A 2EYJA 3P7JA 1EYAA 2F4IA 3T51B 3U9SA 2F0NA 1T5EA 2IX1A 1I3QB 2R3ZA 1TKWB 1YNNC 3K57A 3HGBA 4MIUA 1GUOA 3H91A 4IFDJ 5K5PA 3DXJC 2F0KA 4CJ2C 3SXHA 1IW7D 2EJMA 4B9XA 2EY1A 1UNSA 3W2DA 2F0FA 2MHVA 1EEFD 4KN4C 2K5QA 2F0HA 3DWPA 3S15B 1STHA 5JVG3 1NAPA 1BCPD 3NK9A 3TZUA 1CA6A 4O42A 4C3HG 2RSNA 3C1FA 3N6RA 4HR7B 2SEBD 5D65A 4TKOB 2NVXB 2DY8A 1KLGD 4BS9A 1S5FD 1X3PA 1AN8A 3R93A 5DM73 2VUMB 3OOCA 2N55A 5ELEA 5ELDA 4DXGA 2JA8B 2BDOA 1TIID 4HEDA 1FYCA 1PDQA 5IGFA 4K5WA 3QOLA 2B39A 3EFXD 4FVMA 5DAUA 3E6ZX 3S14B 1QNKA 1K83B 4C3JB 2JA7B 5K36G 2O5JC 3BVZA 4ILWA 2ENBA 3QOJA 2RDHA 1I6VC 5C0XJ 2OT2A 2FMMA 3VR5A 4BA2I 4BBSB 4KJOA 1HFGA 3DEOA 5FOBB 3DMUA 1SNPA 3IFDA 2EZVA 2MPMA 1W6KA 1Q1EA 1AP0A 4CBVA 3CQZB 5NUCA 2FHTA 5F2DA 3BDCA 4RWSC 4RCNA 3QB3A 4RKLA 2J0TD 2LFNA 3SK4A 1NUCA 2KJXA 1JQYD 2SNMA 2B2VA 3M7NA 3MXPA 5CYUA 1HUNA 3RD4A 2F0VA 2XWJB 3K6OA 3R8BA 2KUMA 4QUFA 3S2DB 4EQNA 3MWYW 3DWAA 3T13A 2K5DA 5IOCA 2O2LD 1R4QB 2F0QA 4H0LC 1ESFA 2PCFB 1WTOA 2J4XA 4HN7A 3S1QB 3I3CA 2E2HB 1RDPD 3V05A 4E6IA 1HTLD 1H9KA 1OXSC 2JXMB 2EYPA 2F0TA 5D3DA 3T56B 1G2SA 3NSWA 2A6HD 4XTCS 1S4ZA 2ZT9C 4I65A 2L5TA 3KBGA 1I4QA 3SK5A 1JORA 2O4XA 3S1NB 1HQRD 1X3QA 2AWNA 2QKIC 1RCVD 3I72A 1E2VA 2JA5B 3MA2B 4HMJA 4PMWA 2WKCA 4FO2A 3WOFA 5J22A 3KK7A 4IFDG 2EXZA 4IUPA 4CGYB 1GUNA 3BVMA 5CORA 1RODA 1I4HA 3TP6A 1I6HB 4K14A 3KBXA 1XTCD 5C5LA 3EVQA 5JEAG 2D9UA 1FGBD 1VCIA 1Y8OB 2RA4A 5CV5A 3GP7A 4IQZA 2QF7A 4RGOS 5JOBA 5E1FA 5JEAJ 5CR3A 3BVGA 4ZRZA 2DNCA 3A8JE 4J1MA 1D2BA 4DNTB 1TU2B 1DM0B 3I91A 3FEWX 1BXTA 3SK8A 2PYKA 1AFPA 2F03A 2VB2X 1I50B 4HMIA 2R6GA 4CKBA 4IFDI 2L11A 3L9AX 3JAME 3KLRA 1FNWA 4IUNA 2PQEA 4V0BA 5IGBA 2ZXRA 4DU9A 3MXNA 1ENAA 1U9RA 1CM9A 3HOYB 3TDQA 3MTSA 3PV0A 2JSOA 1TWCB 1SFOB 4A3GB 3RZOB 2IX3A 3FRPB 4BWGB 3M3YB 1EYCA 1SJED 3A8KE 1A3TA 1OXTA 4LAAA 4RCOA 5EKIA 4DAPA 4MN3A 1RD9D 3KUPA 3ONAB 2NUCA 4IUVA 3A7LA 1SYCA 3W3AA 5LHY1 4QCLA 4H7BA 4WJWA 3D31A 3M85A 1F2ZA 4ULLA 1VF7A 4C56C 2Z4IA 5C4ZA 2JEAI 1F2YA 4FYDA 4Q5VA 4K6DA 5KYLA 2NTSA 2RQXA 3I70A 4NMZA 1AW7A 1R4PB 2EVBA 3EROA 1F9QA 4KK7A 1A3UA 1S5ED 1D5MC 3CRKC 4XT3B 1RKNA 1TQOA 2F0MA 3TZDA 4G57A 3S2HB 1STGA 2V4DA 3QO2A 5C3WA 1R9TB 2F1MA 1ZYRC 1HUMA 1U4LA 3K7AB 1TR5A 4ZKBB 1TVXA 5E3FA 2E76C 1U4PA 1STBA 3Q0AA 2A68C 2VB3X 3G6JB 4ZLTF 1M8AA 3UI2A 2L1BA 2LS01 2JYOA 1GHJA 1Q12A 1MSHA 3J80E 1DYQA 1TT2A 3U9OA 1C48A 1S5DD 4ZUIA 2KHSA 5M5XB 4ME5A 3OMCA 2B8GA 4IUQA 3GTMB 3H94A 3HOZB 1TWAB 2B2UC 1PZID 1DD2A 1CQFA 1DOMA 1VDZA 1PMRA 1OXVA 2B2VC 2A6ED 5K36H 2CW0D 4QIWB 4O1NA 2SOBA 4F88A 4M1UB 3PUYA 3FPUB 4FXKC 1TY2A 2QEJC 3CHBD 3C1EA 2B2WA 4J6HA 4WRDA 4WFN3 2E2IB 5ELCA 1WTWA 3ITPA 4HCSA 1ET6A 4X3KA 3C3LA 1I4XA 1QJOA 5IT9L 3S17B 3DUZA 2K32A 1EZ8A 2VNUD 3S1RB 2Q8RE 1Y8PB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MEH A;  1F2M A;  4DF7 A;  4KD3 A;  3HZX A;  3OMG A;  3QOL A;  4PNY A;  1SYE A;  3DHQ A;  4OL7 A;  4N9T A;  5DAU A;  5IGC A;  1STY A;  2EYP A;  2F0T A;  4J1M A;  1RKN A;  5CV4 A;  5JAV A;  1TQO A;  4EQO A;  5CGK A;  5I9O A;  5IGG A;  4F8M A;  2F0M A;  4YIJ A;  1ENC A;  5C5M A;  3MZ5 A;  4G57 A;  1IHZ A;  4I65 A;  3SK8 A;  3SR1 A;  2PYK A;  5EKK A;  5IOD A;  5J39 A;  4NP5 A;  1STG A;  5HUR A;  1KDC A;  1SND A;  4NDX A;  4HMI A;  5C3W A;  3BDL A;  5M9O A;  5C4H A;  5CC4 A;  4PMB A;  4K5X A;  3SK5 A;  2EYJ A;  1JOR A;  2F0O A;  1TR5 A;  1EYA A;  1JOK A;  1EY8 A;  1SYB A;  2O4X A;  2F0U A;  1SYD A;  4KV6 A;  1EZ6 A;  5E3F A;  2ENB A;  2F0N A;  4ODG A;  3RUZ A;  3QOJ A;  2OXP A;  2F3V A;  1EY6 A;  2PW5 A;  2HQE A;  4IAL A;  4IUN A;  1KAB A;  1STB A;  5IGF A;  2PQE A;  2SNS A;  2PZT A;  3E5S A;  4DU9 A;  4QF4 A;  2RBM A;  3ERQ A;  5IGB A;  4MIU A;  4KTA A;  4RKB A;  3V2T A;  4ZQ3 A;  1ENA A;  5C3X A;  3HEJ A;  1U9R A;  3R3O A;  2F0D A;  5IIF A;  4HTH A;  5K5P A;  5KIX A;  4KJN A;  4KJO A;  1TT2 A;  3U9O A;  2QDB A;  3PMF A;  4HMJ A;  5I6W A;  3DMU A;  1SNP A;  2F3W A;  3TP5 A;  2F0E A;  4S3S A;  2F0K A;  4ZUI A;  5CV9 A;  4K8I A;  4K2L A;  2KHS A;  3SXH A;  5KYI A;  1A2T A;  3NQT A;  3P75 A;  5J22 A;  2EYF A;  3OSO A;  5NUC A;  2PW7 A;  3NXW A;  3OMC A;  4ME5 A;  2EY1 A;  2M00 A;  5DEH A;  5F2D A;  4B9X A;  1II3 A;  3BDC A;  1EYC A;  3LX0 A;  2EXZ A;  2F0F A;  4QB4 A;  4KY7 A;  3NP8 A;  5IGE A;  1STN A;  3SHL A;  1EY9 A;  5I6Y A;  4F7X A;  4PMC A;  1A3T A;  2OF1 A;  3S9W A;  2F0L A;  3D4W A;  3QB3 A;  2RKS A;  3D6C A;  4QMG A;  2F0I A;  3VA5 A;  4KY6 A;  3P1H A;  2F0H A;  4KY5 A;  1SYG A;  4LAA A;  4RKL A;  3SK4 A;  5KEE A;  4IZ8 A;  4K8J A;  4K5V A;  2PZW A;  2F0P A;  1NUC A;  5EKL A;  2SOB A;  5J1Z A;  1STH A;  3TP6 A;  4EQP A;  5I9P A;  2SNM A;  4K14 A;  3D8G A;  3NK9 A;  1SNQ A;  4TRD A;  3MHB A;  2NUC A;  1EY4 A;  3C1F A;  1SNO A;  5CV8 A;  1SNM A;  3D4D A;  1SYC A;  2F0G A;  3EVQ A;  1JOO A;  3NUC A;  5C5L A;  3MXP A;  1A3V A;  3TME A;  1JOQ A;  4H7B A;  2OEO A;  3C1E A;  1SNC A;  1F2Z A;  4J6H A;  2F0V A;  2KQ3 A;  4KHV A;  4WRD A;  5CV5 A;  2EY6 A;  4WOR A;  5CV6 A;  4EVO A;  5HGT A;  1EQV A;  1STA A;  1KAA A;  2RDF A;  4NKL A;  5KGU A;  2PZU A;  4B9W A;  1KDB A;  3ITP A;  5C4Z A;  4ZUJ A;  1F2Y A;  4R8N A;  2EY5 A;  3OWF A;  2EYL A;  4EQN A;  4K6D A;  1EY7 A;  5KRU A;  5KYL A;  5C6A A;  2EYH A;  3T13 A;  2WAC A;  2F0J A;  3TP8 A;  5IGD A;  5IOC A;  3EJI A;  5EGT A;  1EY5 A;  1EYD A;  2EY2 A;  2EYM A;  2F0Q A;  3MVV A;  3NHH A;  4ID6 A;  4K2K A;  3H6M A;  4N9P A;  4NMZ A;  5CV7 A;  1KDA A;  3T16 A;  3ERO A;  4DGZ A;  1A2U A;  5JOB A;  1EZ8 A;  1EY0 A;  1A3U A;  5E1F A;  2F0S A;  4DFA A;  1NSN S;  1SYF A;  2LKV A;  4KD4 A;  3SK6 A;  5CR3 A;  3TP7 A;  5ISR A;  2EYO A;  4E6I A;  1AEX A;  2F0W A;  4K5W A; 
#chains in the Genus database with same CATH topology
 2MJ8 A;  1F2M A;  1SXT A;  5A2Q E;  1LT4 D;  2YYZ A;  2H5X A;  3HOW G;  4R4Q A;  2B2Y A;  3NEM A;  3FMC A;  2B2T C;  5LMN L;  1IBL Q;  1S5B D;  1QVC A;  3S1M B;  5EJW A;  1O7I A;  3X3N A;  2Y0S E;  5COY A;  3Q6S A;  1KDC A;  4C3I B;  1AE3 A;  2NVX H;  4C3H B;  2PNH A;  2K50 A;  2WP8 J;  1GUT A;  2CQA A;  3FVQ A;  2PW5 A;  3M7G A;  5DNF A;  3RN5 A;  3S1M H;  4P72 A;  2PPB C;  3Q24 A;  4LF5 Q;  4LJZ C;  4YCV A;  1LTS D;  3KDF B;  2XRS D;  3K0Y A;  2EDG A;  5IIF A;  4GNX A;  1YHQ A;  3S1Q H;  4A3K H;  2DNE A;  1RJT A;  4JCV E;  1D1I A;  1QUQ A;  3D6W A;  2Y0S B;  1BO0 A;  3BZD B;  4K2L A;  1OTC A;  3NQT A;  1GXD C;  3NBH B;  2PW7 A;  3V96 A;  4LF8 L;  4C1N I;  1PTO H;  3CPW A;  1SE3 A;  1STN A;  5L37 A;  2JA9 A;  1DOL A;  2CH4 W;  2BCO A;  1F9R A;  4KY6 A;  2R61 A;  1X32 A;  2QCP X;  2NTT A;  2RHQ B;  4IUT A;  2JA5 G;  3I4N G;  1WTP A;  1CFM A;  1T5X D;  3HOV G;  5EKL A;  2KCT A;  1HRJ A;  1SDF A;  2K01 A;  4GLV B;  1NNX A;  1SNQ A;  4BY1 H;  1A3V A;  3AFP A;  4FF4 A;  2OEO A;  1EIG A;  3K7U C;  3KLS A;  2C9O A;  1B70 B;  1M90 C;  4EVO A;  2RVL A;  2PZU A;  4B3M L;  1HA6 A;  4ZUJ A;  3LNN A;  5BN4 A;  3AFQ A;  1ML0 D;  1ASY A;  3U58 A;  3QJY A;  3C2P A;  2JEB I;  5C6A A;  1Y1W B;  5FJ8 G;  3GTQ B;  5IGC A;  1JB7 A;  2OQK A;  3IRB A;  1H9R A;  3J80 L;  1O78 A;  3FKI B;  3F2D A;  4Z9C B;  2B2T A;  4KLK A;  2UXD Q;  3L3O C;  4LF5 L;  4A93 G;  1WTQ A;  3J81 L;  2K5N A;  1KL9 A;  2K5W A;  2K28 A;  4G7O C;  1E2Z A;  5CV4 A;  5JAV A;  1PH3 A;  3S1N H;  1CT1 D;  4PV1 C;  4A3B H;  1KD1 C;  4AYB E;  3I4M H;  5C5M A;  4R8I A;  1BDO A;  2WAQ G;  4CHT B;  5J39 A;  2L15 A;  1A15 A;  5EKK A;  5IOD A;  3A54 A;  2JA7 H;  5E7N A;  4XDX A;  3BDL A;  5M9O A;  1EEI D;  1MD2 D;  5CC4 A;  3MFG A;  1HR0 Q;  1B50 A;  1Y1V B;  2MNA A;  1PTO C;  4OX9 L;  1XMQ L;  1EZ6 A;  1IW7 C;  1O7Y A;  1CI3 M;  2K7V A;  3OPO A;  1SE2 A;  1JE5 A;  4DR6 L;  2IPK D;  1EU3 A;  2A5H A;  2Z6B A;  1NTG A;  4JBJ A;  4ZQ3 A;  3TBI B;  2K03 A;  2A73 B;  4HTH A;  1FGU A;  3OIP A;  1TY0 A;  4C1N K;  3PMF A;  4BXX H;  1RHP A;  2MUY A;  1DZ1 A;  2CW0 C;  2LMC B;  1JJG A;  3OTO Q;  2X6G A;  4K8I A;  3GO5 A;  1I4P A;  1PTO D;  2JJQ A;  3A74 A;  1F77 A;  3E0J A;  3F1Z A;  4HJA A;  1DJR D;  3L2P A;  3BZK A;  4QB4 A;  4X65 L;  3Q22 A;  1DGS A;  4GS3 A;  3PO2 G;  3K5O A;  3G48 A;  2Z6K C;  1G6P A;  3K58 A;  4U67 3;  2EPB A;  5ELF A;  2ZTD A;  3A7A B;  1UEA B;  4IUR A;  3EA6 A;  2RF4 A;  3WOE A;  3MHB A;  1C9O A;  3SEB A;  3KLS X;  3HKS A;  4XYQ A;  3PIP 3;  2AQ3 B;  3UDX A;  4KKT A;  2NVY B;  3VR4 A;  3CXC A;  4JI1 Q;  3AMU A;  2B63 G;  4DR4 L;  2BDN A;  4C2M B;  4LF8 Q;  3J81 i;  4HSP A;  4FXG C;  3A0J A;  3H0G B;  1Q82 C;  4CJ1 B;  1KIX A;  4B3S Q;  3M3Y H;  2EY5 A;  2C5C A;  4DV1 L;  5KRU A;  1HH2 P;  1XNQ Q;  2M2L A;  4BY7 G;  3I73 A;  1N32 Q;  3MC0 B;  1Z7T A;  4MTN A;  1GUG A;  3A5Z B;  3GV3 A;  2XWB B;  2A6H C;  1D6E C;  3K5M A;  1Y69 U;  4OWT B;  3AB9 A;  1AZQ A;  3CCR A;  1NSN S;  5T1G A;  3STB D;  4A3M H;  1B4O A;  4YWM A;  2E5L L;  1HQM C;  1TS4 A;  4DF7 A;  4DNI A;  3TQY A;  2Z0S A;  2I0Q A;  3MXU A;  5FO7 B;  2IW3 A;  2L55 A;  5I9O A;  3I4L A;  5IGG A;  1BCP B;  1XMO Q;  2JA8 G;  3FP9 A;  2E75 C;  5IYB H;  3VR2 A;  2KBN A;  1IYJ B;  2Z8L A;  1PH8 A;  1JT8 A;  5ELB A;  1GM5 A;  2R93 H;  2BOS A;  1V1P A;  1SND A;  3PIO 3;  4K6L A;  2UUB L;  1IBK Q;  5LMN W;  1E0B A;  4DK6 C;  1B1Z A;  4XQQ A;  3JAM i;  1VQK A;  5KIX A;  1ASZ A;  1LLR D;  2KOL A;  5CMD A;  2NBF A;  4DV0 Q;  1B3A A;  2Q2U A;  3NWT A;  5G3L D;  3LGJ A;  4FF2 A;  1LV9 A;  4LWC A;  3OTO L;  1PA6 A;  3ERQ A;  1Q90 A;  4HID A;  1MBY A;  1MHW C;  1STE A;  2MO0 A;  1CSQ A;  4FXD A;  3PGZ A;  4A93 H;  3TP5 A;  2O5I C;  3P75 A;  4A3E B;  2PO4 A;  1VQI A;  1OO9 B;  3HKZ E;  3IAY A;  3H15 A;  1DON A;  1IKM A;  2PI2 A;  1EY9 A;  1TWH H;  2AQ2 B;  5M3M G;  2F0L A;  3CMA A;  4QMG A;  1OXX K;  1CTM A;  5A2Q L;  3T53 B;  1ZYR D;  4DR5 Q;  1I4R A;  4DV0 L;  2K33 A;  4ABN A;  2E2D C;  3R2I A;  3NBH A;  1SNO A;  1JOO A;  1KQS A;  5I2Y A;  5H1S E;  3OWE B;  3CME A;  3PUW A;  5C0X I;  1ILQ A;  2KQ3 A;  1JR0 D;  1YIT A;  1EQQ A;  5C44 B;  2AUK A;  3CPF A;  2RDF A;  1KAA A;  5CBA E;  3NPP A;  1M4V A;  1C8C A;  4JPB W;  1WCM H;  3AU7 A;  2Q2H A;  4PG3 A;  4A3B B;  2GVB A;  2WAC A;  5IGD A;  4FNF A;  4AIM A;  3EJI A;  3NHH A;  1KDA A;  1LT5 D;  2KED A;  2Q2T A;  2G9H D;  1VQ5 A;  2K52 A;  1VQL A;  2B8F A;  5M3F G;  2R92 G;  4A3M G;  4KD3 A;  1LYL A;  1HTP A;  1S3O A;  2VUM G;  1Q3L A;  4RAU C;  4F8M A;  1EFI D;  1XTD A;  4B08 A;  2BA0 A;  3CD6 A;  3FDT A;  1MJC A;  4NP5 A;  1IL8 A;  4DN4 M;  3HOU B;  1QUQ B;  1HCZ A;  4PMB A;  1IYV A;  3MEF A;  3NTH A;  3EQL C;  2L9H A;  3UE0 A;  1LTA D;  3GQB A;  2A69 C;  4ZKC B;  2EJF C;  4CJ0 B;  5AFW A;  4RH6 A;  1N8R C;  2D0O A;  3EN2 A;  3UE1 A;  3HOX H;  3T1H L;  4LF4 L;  2FMC A;  1HHV A;  1L0X B;  5JJK A;  2I5M X;  1F9S A;  1H9S B;  2CQO A;  1A63 A;  3CRL C;  3HOW H;  2L12 A;  2PI2 E;  4CKC A;  4IPH A;  1FVI A;  2ATW A;  4JBK A;  2R92 H;  4OHJ A;  5E4X A;  2VQE L;  1PH5 A;  1K3B C;  3S9W A;  2HQL A;  1IYU A;  1BQQ T;  2F0I A;  1QVF A;  4JBW A;  4IZ8 A;  2IHF A;  3IL8 A;  1ET9 A;  4A3D B;  2R7Z B;  5TSS A;  3BZC A;  3FHW A;  2K6A A;  4QUC A;  4R1J A;  3KJO A;  4JYA Q;  2MQH A;  1E2W A;  3HKZ B;  4IUU A;  3E3X A;  1G29 1;  2EXD A;  2R7Z G;  3NE5 B;  4A3D G;  3IKJ A;  2NVQ B;  1TS5 A;  2UU9 L;  2EY6 A;  4A3F B;  3NQI A;  1B9N A;  4KHZ A;  1RL2 A;  1SAP A;  5FLX E;  5BN3 A;  4JVZ A;  2EYH A;  1XYI A;  2XNA C;  2K04 A;  2KEN A;  5EGT A;  1FNV A;  4K2K A;  1TWA H;  4DV6 Q;  4N8F A;  3T16 A;  3VYR A;  4DKA C;  1CK1 A;  3J81 E;  3RZD B;  2HD3 A;  2VQE Q;  1EOT A;  2NWG A;  4PZ6 A;  2F0W A;  3HP3 A;  4GKK Q;  1BBU A;  3PO3 H;  3IFT A;  3MEH A;  2LXK A;  4OGQ C;  3OMG A;  4OL7 A;  2TSS A;  5GAH C;  1IL2 A;  3GTJ H;  1JE4 A;  4HJ5 A;  4YWK A;  1KLU D;  1WTR A;  4FF3 A;  3SR1 A;  2QEX A;  2KCM A;  3MAQ A;  2YU9 B;  2K5H A;  1KTK A;  1R9T H;  2ZTE A;  1MGS A;  2HIV A;  4AYB B;  3HOU G;  4K5X A;  5IP9 H;  1EY8 A;  4KV6 A;  3GTK B;  3CP0 A;  1WTX A;  4IAL A;  1LT3 D;  1KAB A;  1S5C D;  3QWN A;  4TQU S;  1DCZ A;  3Q8D A;  1L0Y B;  2WB1 G;  3TSS A;  5M3F B;  3S1R H;  1PRT B;  2QW7 A;  3FPP A;  2NN6 I;  5EBD A;  1K9M C;  4JI6 Q;  1PVO A;  1K8O A;  2ID0 A;  3RN2 A;  4LW1 A;  2V1C C;  2Q2I A;  3OSO A;  4YY3 L;  1A6X A;  3NXW A;  1U0L A;  3OIQ A;  1DOK A;  1WD0 A;  4X3S A;  1PYS B;  1O7Z A;  1WCM B;  4KY7 A;  3I4M G;  1FNU A;  3HFZ B;  5AJ3 L;  3CCQ A;  3A56 A;  1EWI A;  4HCE A;  3VYS A;  2FXQ A;  4GLX A;  5JJZ A;  1G2T A;  4L6T B;  1PHJ A;  3AYH B;  1XPU A;  1SRO A;  4EQP A;  2B2U A;  4XIG S;  4BA1 I;  1V1O A;  1JMC A;  3KLW A;  1OXU A;  5IYC H;  3P20 A;  2F0G A;  1AZP A;  1PZK D;  1YJW A;  3GV6 A;  1H9J A;  1VQM A;  2M9V A;  3PIO A;  5C4X G;  4WJ4 A;  4WOR A;  4X62 L;  2K05 A;  3BG3 A;  4B3R Q;  4YY3 Q;  1SLJ A;  3HOW B;  1EY7 A;  3OYY A;  4LF9 L;  1YEZ A;  2HDM A;  2Z6K A;  4DR5 L;  2Z4H A;  4LK1 C;  2R92 B;  4A3E G;  2I5L X;  2L0C A;  2HHH L;  1EOV A;  3H6M A;  4LF6 L;  5FLX L;  5IT9 c;  4PQX A;  3HOZ H;  4IFD H;  1HNW Q;  2XN9 C;  1PH2 A;  5LL6 X;  1U4R A;  1GJX A;  4X3U A;  1G51 A;  3M4O H;  1VQ6 A;  4L5R C;  4IJH A;  1PFS A;  1LAC A;  2A69 D;  5CGK A;  3J7Y W;  3NEL A;  2FJ2 A;  4KN7 C;  2DN8 A;  4RGN A;  4UHV A;  4X3T A;  2NN6 G;  1GVP A;  1PH7 A;  1Y1V H;  4XYO A;  3X3M A;  3GTG B;  4RGM A;  4C3H H;  1Q8K A;  2L4N A;  5C44 H;  5IP7 H;  3URY A;  2IWH A;  4B3M Q;  3VR3 A;  3OW2 A;  3GTP H;  2F0O A;  4R4C A;  1HPC A;  1WD1 A;  2VQF L;  3PIP A;  1EQT A;  3H0G H;  3BYT B;  4DK1 A;  1NJI C;  3RUZ A;  2OXP A;  1EY6 A;  5C3E B;  2QDL A;  2JA6 B;  1WTV A;  2IX0 A;  5E4W C;  4MTK A;  3CCE A;  4J8Q A;  5IT9 E;  4RKB A;  2F4V L;  3HEJ A;  1N36 Q;  1HZA A;  4KJN A;  2CWP A;  1BUV T;  4BBR H;  1ENF A;  4IN3 A;  4A3I G;  4B3R L;  2F0E A;  4X64 L;  1VQ7 A;  5CV9 A;  1QCB D;  2R7F A;  2NZ1 D;  5GAE C;  2EYF A;  4KI0 A;  1GOZ A;  3HG9 A;  5DEH A;  5IYB G;  3NP8 A;  3DM3 A;  1CHQ D;  4KKU A;  4B3S L;  3D6C A;  2DUD A;  2I46 A;  4KY5 A;  2CHB D;  1V1P B;  1BF4 A;  4K8J A;  1K3R A;  3VDY A;  2PZW A;  1JWS D;  1Q86 C;  1LTR D;  5I9P A;  5EBC A;  4QY7 A;  1X9N A;  1GUW A;  3DLL A;  1PXU A;  2ICI A;  2R7D A;  1SNM A;  1Y8N B;  3TME A;  1JOQ A;  1VQJ A;  1XMO L;  2A68 D;  2LSS A;  4RFB A;  4LUO A;  4A4I A;  1D1K A;  1BCP C;  1GKH A;  3VR6 A;  3J7A F;  5C4X H;  4NKL A;  4QJF A;  5KGU A;  4B9W A;  5JPN C;  3I7F A;  3K5L A;  1NE3 A;  1LAB A;  3TP8 A;  2F0J A;  2D62 A;  2HUG A;  3CCU A;  1EYD A;  4K0K L;  1GUS A;  4N9P A;  1TS2 A;  2HCI A;  1A2U A;  2E2J B;  1CQV A;  4J15 A;  1UE5 A;  4ZK9 B;  2VY3 A;  2GN5 A;  3A55 A;  2LKV A;  1YZ6 A;  3STB C;  1RF2 D;  2JE6 I;  2E2H H;  2C35 B;  2VXW A;  2IHE A;  2XIW A;  4DV6 L;  3DHQ A;  1JC7 A;  1K0R A;  2CH4 A;  4GOP A;  1D5Z C;  3PO2 H;  2XSC A;  2ZM6 Q;  3A8I E;  1ENC A;  4DA2 A;  4EGV A;  3MZ5 A;  4OON A;  3AEV A;  2PMZ E;  2VW9 A;  4JK1 C;  4C3J H;  3DEP A;  3CCS A;  3VYT A;  1HR0 L;  3ULP A;  4DV7 L;  3LWU A;  4AH6 A;  1SE4 A;  4ZAI A;  1KRT A;  4JI0 Q;  1SSO A;  2P5Z X;  2F0U A;  1SYD A;  3BYY B;  1V1Q A;  4JYA L;  4U68 A;  2HQE A;  4X65 Q;  1QNU A;  2Q8I B;  1PH1 A;  3J81 j;  5M5W B;  2PZT A;  3CC2 A;  3S15 H;  1XWE A;  2RBM A;  1XXG A;  1YNX A;  4QF4 A;  4G7Z C;  1L1O B;  2UXB Q;  2WV6 D;  1YBY A;  4OEL B;  2F0D A;  1FR3 A;  4MHE A;  1PRT D;  5FKA C;  3PO2 B;  1N36 L;  1CHP D;  2KEC A;  1E22 A;  5I6W A;  4OO1 H;  2F3W A;  1VMC A;  1QOH A;  1A2T A;  5JPM C;  2EJG C;  1I4G A;  4O2D A;  1SBB B;  3NBI A;  1II3 A;  4DV4 L;  5IYD G;  2H1E A;  3H3V C;  3BJU A;  4DK3 C;  4M8A A;  5IGE A;  3F2U A;  3SHL A;  5I6Y A;  3RLF A;  4F7X A;  5JVH 3;  4PZ8 A;  2OF1 A;  3VYU A;  2IJ0 A;  4C2M H;  4LUV A;  4P2C B;  2F3I A;  2Q8T A;  4LUZ A;  4TSS A;  2FIN B;  5J1Z A;  1HA5 A;  2JA6 H;  1JIC A;  3DWQ A;  3HKZ G;  3K5N A;  4IOC A;  2NVY H;  4F87 A;  4X66 Q;  2YTX A;  1SMY C;  3NUC A;  2JP1 A;  4DK0 A;  5CV6 A;  3KDF A;  3T4A C;  5HGT A;  1CKN A;  1TWH B;  1EQV A;  2FFK B;  3Q23 A;  1VQG A;  3J81 c;  5JJI A;  1LT6 D;  3ICE A;  4UP7 A;  3GTG H;  2DY7 A;  3BU2 A;  5CBE E;  5M5Y B;  1KNA A;  3OWF A;  3CKI B;  4LF9 Q;  1NY4 A;  3F8T A;  4DPG A;  2B2W C;  4A93 B;  2OCE A;  4OO1 G;  3KF6 A;  1FD7 D;  1EY0 A;  3J7A V;  4BBS H;  2F0S A;  1SYF A;  2MFI A;  1U4M A;  4JI8 L;  1WI5 A;  1W6J A;  1GHK A;  3CU7 A;  4JI6 L;  2B2Y C;  2DGY A;  4L5T A;  1BBX C;  4CKE A;  1D5X C;  1TWG B;  1ILP A;  4DR7 L;  3G4S A;  1EWC A;  5ELN A;  3GTP B;  5HUR A;  3M4Y A;  4KMU C;  4IOA A;  5BR8 L;  4P74 A;  2D2C C;  2XGT A;  3E9I A;  2VZA A;  1VQO A;  3J7A 5;  3I8Z A;  5C4H A;  4DUZ Q;  1S72 A;  1QB5 D;  2K5V A;  3J80 i;  3PUX A;  4XT1 B;  1C4Q A;  4JG2 A;  3H09 A;  4DR1 L;  1X3E A;  1IBM L;  4LFA L;  5I4D A;  3I90 A;  4X62 Q;  3JAM L;  3S14 H;  4JI4 Q;  3M4O B;  1J8I A;  3SE0 A;  3E5S A;  4GNX C;  4JOI C;  3VA7 A;  1WCM G;  2UU9 Q;  5KNB A;  4B3T L;  3R3O A;  1VQ8 A;  3GTJ B;  4LFC L;  4ZYS A;  1MI2 A;  4V19 0;  1FL0 A;  1PV4 A;  4YWL A;  4DR2 L;  1VF5 C;  5A35 A;  3S16 B;  3LWE A;  1HZ9 A;  2Y0S G;  4YHH L;  4P75 A;  4LF7 L;  1W2B A;  1ZKO A;  1FJG Q;  3LX0 A;  1YI2 A;  3TS0 A;  3RLN A;  3D4W A;  1HNX Q;  4Y52 H;  3P1H A;  5M5X H;  3GDE A;  1JWU D;  4K5V A;  1CA5 A;  1YJN A;  1UE1 A;  4OWW B;  3K81 C;  4UP9 A;  3GTO H;  1Y1V G;  1KXL A;  3ER0 A;  4TRD A;  4K0K Q;  2WIN B;  4DV7 Q;  1NCV A;  3G7L A;  3D4D A;  1UAP A;  3WDN A;  4XXE A;  3DM1 A;  5IY0 A;  4AYB G;  2G9D A;  1HNX L;  2ZXP A;  2Z9H A;  1RIP A;  4L63 B;  5LL6 S;  4UP8 A;  4GLA C;  2X6L A;  4A3E H;  1PFB A;  1K8M A;  3PQI A;  5KND A;  2EY2 A;  1RTN A;  2EYM A;  3MVV A;  5GQO A;  3SGI A;  1G6Z A;  3RR5 A;  1CZW A;  3GTM H;  3E9H A;  1VQD A;  3CQZ H;  4KD4 A;  3M9B A;  3HOY H;  4DUY L;  4DR3 Q;  2NB0 A;  4QL5 A;  4N9T A;  2PMZ B;  3M4Q A;  2ZXO A;  4G4K A;  4EQO A;  5D3I B;  5DLQ E;  1VQC A;  4LFC Q;  2KCC A;  2NN6 H;  1EWH A;  3OW7 A;  3K7A H;  3PSI A;  3NWS A;  1RTO A;  3SDZ A;  1HXY D;  1BCP F;  4A3L G;  1UUP A;  1HZC A;  3HOV B;  1LTI D;  4X6A H;  4FDB A;  2BA1 A;  4OWX B;  3A5U A;  4H13 C;  4IO9 A;  2E2I H;  4DR1 Q;  1YNJ C;  1EL0 A;  2D0P A;  1K8G A;  4RHS A;  3L7Z C;  1L0W A;  1YHB A;  4KTA A;  2QIL A;  3QG1 A;  5C3X A;  1CZG A;  1CKN B;  2KVM A;  2CVR A;  2BE5 C;  2IT1 A;  5EPL A;  1VQF A;  1V43 A;  2UUA L;  2HDL A;  2QDB A;  4L8J A;  2ES2 A;  3EIV A;  2UUC Q;  2AQ1 B;  4S3S A;  1EIH A;  2F52 A;  2AWO A;  3UDF A;  2CCZ A;  5DM6 3;  1VMP A;  1SFO H;  1SJH D;  2D5D A;  4A3C H;  1PLF A;  4X64 Q;  2K1B A;  2NYZ D;  2RKS A;  5KNC A;  1LTB D;  5KEE A;  4JI7 L;  3B6Y A;  2NZO A;  4I7Z C;  2F0P A;  1MSG A;  5BR8 Q;  5C0X H;  4LNQ A;  2RHS B;  3D8G A;  4DV5 Q;  3ZYY X;  1F2L A;  5FO8 B;  3I4O A;  1NR4 A;  3CC7 A;  1PYW D;  3NTK A;  5GAD C;  4H02 A;  1SNC A;  2I5H A;  1STA A;  2A8V A;  2PQA B;  3T1Y Q;  2K4K A;  1X55 A;  1KDB A;  3H3V H;  4R9W A;  1SE8 A;  4HSV A;  5FK9 C;  3I4N B;  3TS2 A;  1ICW A;  2KCN A;  2EE1 A;  4DGZ A;  3CCM A;  4A3M B;  2TMP A;  3I4M B;  4LF7 Q;  5BN5 A;  2EYO A;  4DV4 Q;  3HOY G;  1H9M A;  1QG7 A;  3RMH A;  2IL8 A;  2OTL A;  2DJG C;  4PNY A;  1BVS A;  5AJ3 Q;  1YHA A;  1DXM A;  5M3M H;  1I94 L;  2WFW A;  4B3T Q;  2JA8 H;  1JWM D;  3C46 A;  1VQE A;  5EQ0 A;  3N52 A;  2OWO A;  1BR9 A;  1SEB D;  1H95 A;  3NTI A;  3KF6 B;  4FP5 D;  4A3L H;  3HOU H;  3ND9 A;  5C0X G;  1Y14 B;  1LTG D;  2WII B;  4OIJ A;  1JOK A;  1IBK L;  1B3Q A;  1SYB A;  1SMY D;  2AUJ D;  4A3F H;  4GZY C;  5C4X B;  2EOT A;  1B2T A;  3J7Z C;  4Y7N H;  1JCK B;  1NMF A;  2B63 B;  1XX8 A;  1K83 H;  2NVT B;  4A3J B;  5D14 A;  4RA8 A;  3QIA A;  2SNS A;  4OIK A;  2H4O A;  3U4Z A;  2JQO A;  1QWY A;  4JI7 Q;  3V2T A;  5T1I A;  4C3I G;  1VQP A;  4MNO A;  3D0F A;  1Q1B A;  4JI1 L;  1YNN D;  1QIL A;  2WB1 E;  3MFY A;  1W3S A;  3PO3 B;  2EIF A;  3CAM A;  1ESR A;  5KYI A;  1VQN A;  1X6O A;  1Z6H A;  3GTL B;  2XRQ D;  4ME3 A;  1Y1W G;  1ZEQ X;  1A0I A;  2M00 A;  1MIU A;  4H44 C;  4LF4 Q;  4A3I B;  4PMC A;  1G8Z D;  1PZJ D;  4DV1 Q;  4DNR B;  4DAM A;  4KKS A;  4OEM B;  1WVL A;  1B53 A;  3HS0 C;  5IWA Q;  5C4J H;  5M5W H;  1VQB A;  4P73 A;  1Q8I A;  3MXG A;  5C3E G;  5CV8 A;  2AHO B;  1LM0 A;  3NEN A;  2ZM6 L;  1PFN A;  4HAE A;  1U5K A;  1O7L A;  1N9W A;  2ZJQ A;  1BNZ A;  2Z1C A;  3BDO A;  5JEA H;  2RCF A;  4DR6 Q;  4I7A A;  3OHX C;  4AQY L;  3R2T A;  1PRT F;  3KF8 A;  1QE6 A;  2XVS A;  2EYL A;  3KJP A;  3SVM A;  1H9S A;  1EY5 A;  3D4R A;  4ID6 A;  4G7H C;  5CV7 A;  4BBR B;  1F9P A;  1VQA A;  4L5Q A;  5LMU Q;  4GKJ Q;  5M3M B;  4DFA A;  3HOX G;  3J80 c;  3BS1 A;  2RDG A;  1QZG A;  1HZB A;  4BY7 B;  1AEX A;  4ODG A;  4UAI A;  4UPA A;  1TWC H;  2RSO A;  4A3K B;  1NR2 A;  1SYE A;  1EU4 A;  4ALP A;  4QGU A;  1STY A;  1HFN A;  3HRZ C;  1YNJ D;  4YIJ A;  3TN2 A;  1XPO A;  1IHZ A;  1P16 A;  3TRZ A;  4HIO A;  1JB3 A;  1EFW A;  1CUK A;  1QZH A;  2EQS A;  1IKL A;  4NDX A;  4DAY A;  4RHR A;  1PTO F;  2MGS A;  1C7Y A;  4DR7 Q;  1NMG A;  5GAG C;  4C3J G;  5FO9 B;  1TXY A;  4AQY Q;  4JI5 L;  1TS3 A;  2F3V A;  1HNZ Q;  2R93 B;  3ND8 A;  4P71 A;  2HCC A;  5EPJ A;  1LTT D;  3T1Y L;  5IE8 A;  3JAM c;  4LFA Q;  1IBM Q;  4BXX G;  1VS0 A;  4POF A;  4FF1 A;  3GTO B;  5C4J B;  1Z47 A;  3D3R A;  4NPS A;  1GD7 A;  3O13 A;  1JJ2 A;  2GA4 B;  2PNR C;  4A3G H;  4DAV A;  1PTO B;  1I5F A;  2JA5 H;  1X3F A;  1EIY B;  2VQF Q;  3VA5 A;  3S2D H;  1G91 A;  1SYG A;  4X66 L;  5IP7 G;  1ZXT A;  2WB1 B;  2KEE A;  4XQN A;  4BY1 B;  5I2X A;  1PRT C;  2N88 A;  2X69 A;  1EY4 A;  2KA7 A;  1KNE A;  4UDU C;  3K59 A;  4LMQ D;  2K75 A;  2A6E C;  1B44 D;  4OO1 I;  1ICF B;  2A74 C;  5J3B A;  4KHV A;  1VQ4 A;  1BOS A;  4JBM A;  1I6H H;  2ICE C;  2LY7 A;  1TWF B;  2MP1 A;  1K73 C;  1O80 A;  4RGT A;  2JK8 A;  2WKD A;  4R8N A;  3HOZ G;  2WAQ B;  2J7Z A;  3PF5 A;  4XQJ A;  1TWG H;  4LFB L;  2I07 B;  5EPK A;  3HOX B;  3H3V I;  1B9M A;  3PUZ A;  4JI4 L;  1LO5 D;  4QQB X;  1D8L A;  3SK6 A;  3TP7 A;  5ISR A;  3I56 A;  3RZO H;  3RZD H;  1ONL A;  1PFM A;  3L0O A;  1Q7Y C;  3HZX A;  5G3L F;  3GD7 A;  1K8A C;  2BE5 D;  4Y7N B;  2E74 C;  4DUZ L;  4A3G G;  4GN3 B;  2N8N A;  4Q0F A;  1V8Q A;  4DUY Q;  4DR3 L;  1D7Q A;  2SDF A;  2VUM H;  4DXF A;  3PUV A;  4A3B G;  4JV5 L;  4A3F G;  2JA6 G;  2NVQ H;  4NW2 A;  1J9O A;  2OQ0 A;  3W5O A;  2EYJ A;  3P7J A;  4EQ5 A;  1EYA A;  2F4I A;  3T51 B;  3U9S A;  2F0N A;  1T5E A;  4JI3 L;  2IX1 A;  1HNZ L;  1I3Q B;  2R3Z A;  4GOP B;  1TKW B;  1YNN C;  2VS1 A;  3K57 A;  2YTY A;  3HGB A;  4MIU A;  4BY7 H;  1GUO A;  2G5D A;  2ASB A;  3H91 A;  4IFD J;  5K5P A;  2YV5 A;  3W1G A;  1VQH A;  1E1O A;  4HJ8 A;  3DXJ C;  1UEB A;  2F0K A;  4CJ2 C;  4R4O A;  3SXH A;  1IW7 D;  2EJM A;  2B29 A;  5IYD H;  4B9X A;  2EY1 A;  1UNS A;  3W2D A;  4GKK L;  2F0F A;  2MHV A;  3S17 H;  1EEF D;  4KN4 C;  1X65 A;  2K5Q A;  1K28 A;  2F0H A;  4A3J G;  3DWP A;  3ULL A;  1J5E L;  3S15 B;  1STH A;  5JVG 3;  1NAP A;  1BCP D;  3NK9 A;  3TZU A;  1PH6 A;  1CA6 A;  4O42 A;  4IPC A;  4C3H G;  2RSN A;  3C1F A;  3N6R A;  4IPD A;  4HR7 B;  2SEB D;  5D65 A;  4JI5 Q;  4R4T A;  4TKO B;  5C3E H;  2NVX B;  2OTJ A;  2DY8 A;  1KLG D;  3GTK H;  4BS9 A;  3G71 A;  1B8A A;  1S5F D;  1X3P A;  1AN8 A;  3R93 A;  4DV3 Q;  1B7Y B;  4JC0 A;  1SMX A;  1L2F A;  3QR8 A;  5DM7 3;  2VUM B;  3E0E A;  1LTL A;  3OOC A;  2N55 A;  3G6E A;  5ELE A;  5ELD A;  4DXG A;  2JA8 B;  2BDO A;  2UXD L;  1N33 Q;  1TII D;  4HED A;  4YHH Q;  2F4V Q;  1FYC A;  1PDQ A;  5IGF A;  5ELO A;  4K5W A;  1BKB A;  3QOL A;  2B39 A;  3EFX D;  4FVM A;  3KF8 B;  4YCU A;  5DAU A;  4CDF C;  2NVT H;  3E6Z X;  1E1T A;  3ERS X;  3S14 B;  1L1O A;  1QNK A;  1K83 B;  1TWF H;  4C3J B;  2JA7 B;  5K36 G;  3CC4 A;  5C44 G;  2O5J C;  2UXC L;  3BVZ A;  4ILW A;  4DR4 Q;  2ENB A;  4R4I A;  5IWA L;  4YCW A;  3QOJ A;  3U4V A;  2RDH A;  1KRS A;  1I6V C;  1CKM A;  5C0X J;  1SRU A;  2OT2 A;  2FMM A;  3VR5 A;  4BA2 I;  5HY6 A;  4BBS B;  2LXJ A;  5EAY A;  4KJO A;  1HFG A;  4HJ9 A;  3ZJY C;  4A3I H;  3DEO A;  5FOB B;  3DMU A;  1SNP A;  3IFD A;  1IXR A;  2MPM A;  1W6K A;  2EZV A;  1Q1E A;  1AP0 A;  4JI2 Q;  4CBV A;  3CQZ B;  5NUC A;  1T9H A;  2FHT A;  5F2D A;  1EUJ A;  1I94 Q;  3BDC A;  4RWS C;  1WOC A;  4RCN A;  2N78 A;  1JJC B;  3QB3 A;  2ZJR A;  1QVG A;  4RKL A;  2J0T D;  2MO1 A;  2LFN A;  3SK4 A;  1PH9 A;  4LFB Q;  1NUC A;  1LUZ A;  1HJP A;  2KJX A;  1JQY D;  2SNM A;  4JV5 Q;  1GO3 E;  1J6Q A;  2B2V A;  4A76 A;  2JN4 A;  3M7N A;  3MXP A;  3I2Z A;  5CYU A;  1XMQ Q;  1N34 L;  1HUN A;  3RD4 A;  2F0V A;  2XWJ B;  3K0X A;  5IP9 G;  2K14 A;  3K6O A;  3R8B A;  4RG1 A;  1UE7 A;  2KUM A;  4QUF A;  1EQR A;  3S2D B;  4EQN A;  3MWY W;  5JJL A;  3DWA A;  4JI2 L;  1N34 Q;  3T13 A;  2K5D A;  1YJ9 A;  2CKZ B;  2QA4 A;  4JI0 L;  5IOC A;  2O2L D;  3CCJ A;  1R4Q B;  1KHI A;  1PYB A;  2F0Q A;  4H0L C;  4HIK A;  1ESF A;  2PCF B;  1WTO A;  2J4X A;  4HN7 A;  3S1Q B;  3I3C A;  2E2H B;  1IZ6 A;  1RDP D;  4DAY B;  2B3G A;  1X56 A;  3V05 A;  3PO3 G;  4E6I A;  1HTL D;  1H9K A;  2KHJ A;  1OXS C;  2E2J H;  3W1B A;  1YVC A;  4BBS G;  2JXM B;  4NB3 A;  1C0A A;  2EYP A;  2F0T A;  5D3D A;  3T1H Q;  1KAW A;  3T56 B;  3FKI G;  4A75 A;  1Q81 C;  1G2S A;  3NSW A;  2A6H D;  4XTC S;  1S4Z A;  2ZT9 C;  1X3G A;  4I65 A;  2L5T A;  3I4N H;  1Q46 A;  1M1K C;  3H0G G;  1XNR Q;  3TRE A;  3KBG A;  2ALY B;  2AMC B;  4NXM L;  1I4Q A;  2UUB Q;  3SK5 A;  5M5Y H;  3HOV H;  1JOR A;  1HR0 W;  4KHP L;  2O4X A;  5GRO A;  3S1N B;  1HQR D;  1X3Q A;  1WFQ A;  3U50 C;  5FLM H;  2AWN A;  4DV5 L;  2QKI C;  1X54 A;  1RCV D;  2CWA A;  3M4P A;  3I72 A;  1E2V A;  1UE6 A;  4NXN Q;  2JA5 B;  3MA2 B;  4HMJ A;  4PMW A;  2WKC A;  4FO2 A;  3WOF A;  2VL6 A;  5J22 A;  3KK7 A;  5LMN Q;  1IBL L;  1K0S A;  4IFD G;  1WTH A;  2EXZ A;  4IUP A;  3CF5 A;  4CGY B;  1GUN A;  1Y1W H;  1E24 A;  3BVM A;  2WAQ E;  4PZ7 A;  5COR A;  3PF4 A;  1ROD A;  1E3P A;  4GNX B;  1N32 L;  2R93 G;  1I4H A;  3TP6 A;  1I6H B;  4K14 A;  4UY8 C;  2B63 H;  5HGQ A;  3KBX A;  5IYC G;  4DV2 L;  1XTC D;  2UXB L;  5C5L A;  2UXC Q;  3EVQ A;  5JEA G;  2D9U A;  1FGB D;  1VCI A;  1Y8O B;  2RA4 A;  5CV5 A;  1YIJ A;  4EX5 A;  3GP7 A;  2RCN A;  4CDE C;  4IQZ A;  1AH9 A;  5FLM G;  1I50 H;  2QF7 A;  4RGO S;  1XPR A;  4NXM Q;  1EYG A;  3AQQ A;  5JOB A;  3JC6 6;  2QGQ A;  5E1F A;  5JEA J;  3GTL H;  2HT1 A;  5CR3 A;  4BBR G;  3BVG A;  4ZRZ A;  2DNC A;  3A8J E;  3KFU A;  1NBW A;  4NXN L;  3GTQ H;  4J1M A;  1D2B A;  4DNT B;  1TU2 B;  1DM0 B;  2A1A A;  1CSP A;  3I91 A;  3FKI H;  3FEW X;  1BXT A;  3SK8 A;  2PYK A;  4A3J H;  1AFP A;  2F03 A;  2AKW B;  3EBE A;  4DR2 Q;  1MJE A;  2ZTC A;  2VB2 X;  1I50 B;  4HMI A;  2R6G A;  4CKB A;  4IFD I;  1HNW L;  3UDG A;  1UWV A;  2L11 A;  3L9A X;  3UDI A;  4O0A A;  3JAM E;  3KLR A;  2IY5 B;  1FNW A;  4JOI A;  4IUN A;  1N33 L;  2PQE A;  4V0B A;  5IGB A;  2ZXR A;  4CDC C;  4DU9 A;  4QIW E;  2YTV A;  3MXN A;  1ENA A;  1U9R A;  1CM9 A;  3HOY B;  3CCL A;  4DV2 Q;  3TDQ A;  3MTS A;  3PV0 A;  2JSO A;  1TWC B;  1SFO B;  1S40 A;  4A3G B;  1V9P A;  3RZO B;  3ULJ A;  2IX3 A;  3FRP B;  4BWG B;  3WWV A;  2DJF C;  3M3Y B;  1EYC A;  1SJE D;  4LF6 Q;  3A8K E;  4ZCK A;  1A3T A;  1OXT A;  1E7Z A;  4OX9 Q;  4LAA A;  4RCO A;  5EKI A;  4DAP A;  4MN3 A;  1RD9 D;  3KUP A;  2BH2 A;  2CFM A;  3ONA B;  4JI3 Q;  4IPG A;  3CW2 C;  2NUC A;  4N8X 1;  4IUV A;  3A7L A;  1SYC A;  5FLX c;  3W3A A;  5LHY 1;  4QCL A;  1I3Q H;  4H7B A;  4WJW A;  3D31 A;  2N3S A;  1F2Z A;  3M85 A;  4HIM A;  3KOJ A;  4ULL A;  1VF7 A;  4C56 C;  3CCV A;  2Z4I A;  2YU9 H;  5C4Z A;  3S24 A;  2JEA I;  4OXP A;  1F2Y A;  4FYD A;  4Q5V A;  4K6D A;  5KYL A;  2NTS A;  2RQX A;  3PCO B;  1MKH A;  1XNR L;  4IJL A;  3I70 A;  4NMZ A;  1AW7 A;  1R4P B;  2EVB A;  3ERO A;  1F9Q A;  1SN8 A;  4KK7 A;  4RMF A;  1A3U A;  3KYH C;  1XJV A;  1S5E D;  3S16 H;  1D5M C;  3CRK C;  4GOP C;  4XT3 B;  4JI8 Q;  2E8G A;  1RKN A;  2UUC L;  1TQO A;  4A3C G;  3K80 C;  2F0M A;  3TZD A;  4G57 A;  3S2H B;  1STG A;  2V4D A;  3QO2 A;  3F2B A;  2HHH Q;  5C3W A;  1R9T B;  2F1M A;  1ZYR C;  3K8A A;  2A19 A;  1WJJ A;  1HUM A;  1U4L A;  3K7A B;  4TVA B;  3TEH B;  1TR5 A;  4ZKB B;  1TVX A;  5E3F A;  2E76 C;  1U4P A;  1STB A;  3Q0A A;  2A68 C;  2VB3 X;  3G6J B;  3MXN B;  4ZLT F;  1M8A A;  3UI2 A;  2L1B A;  2LS0 1;  2JYO A;  1GHJ A;  2GVA A;  1Q12 A;  2BH8 A;  3I55 A;  4A3K G;  1MSH A;  3J80 E;  1KC8 C;  1DYQ A;  1TT2 A;  3U9O A;  2UUA Q;  1C48 A;  1S5D D;  4GN4 B;  4ZUI A;  1XNQ L;  2KHS A;  5M5X B;  4CDD C;  5FJ8 H;  4ME5 A;  3OMC A;  2B8G A;  4IUQ A;  3GTM B;  4GN5 A;  1Z9F A;  3H94 A;  1J5E Q;  3HOZ B;  1TWA B;  2B2U C;  1PZI D;  1SR3 A;  1CQF A;  1DOM A;  1DD2 A;  4APV A;  1VDZ A;  1PMR A;  1OXV A;  4DV3 L;  2B2V C;  2A6E D;  2E5L Q;  5K36 H;  3RLO A;  1PH4 A;  2CW0 D;  2XTI A;  4QIW B;  2NZH A;  4O1N A;  2SOB A;  4F88 A;  1L1O C;  4WJ3 M;  4M1U B;  3PUY A;  3FPU B;  4FXK C;  1TY2 A;  5LMU L;  2JA7 G;  4GKJ L;  4BY1 G;  1P8L A;  4KHP Q;  2ZJP A;  2N49 A;  2KHI A;  2QEJ C;  3CHB D;  3C1E A;  2B2W A;  1EIF A;  4J6H A;  4WRD A;  4L5S A;  4WFN 3;  4MZ9 A;  1VQ9 A;  2E2I B;  5ELC A;  1WTW A;  2R7Z H;  4A3D H;  1WYD A;  3ITP A;  2PQA A;  4HCS A;  1BBW A;  1A8V A;  3RNU A;  1CKO A;  1ET6 A;  4X3K A;  4C3I H;  3C3L A;  3F2C A;  1A62 A;  4JW0 A;  1I4X A;  1QJO A;  5IT9 L;  3S2H H;  4POG A;  1AE2 A;  4HJ7 A;  3S17 B;  3DUZ A;  2K32 A;  1EZ8 A;  2VNU D;  2HIX A;  5M3F H;  3S1R B;  2Q8R E;  1FJG L;  1Y8P B; 
#chains in the Genus database with same CATH homology
 2MJ8 A;  1F2M A;  1SXT A;  5A2Q E;  1LT4 D;  2YYZ A;  2B2Y A;  3FMC A;  2B2T C;  1S5B D;  3S1M B;  5EJW A;  3X3N A;  5COY A;  3Q6S A;  1KDC A;  4C3I B;  4C3H B;  2WP8 J;  1GUT A;  2CQA A;  3FVQ A;  2PW5 A;  3M7G A;  5DNF A;  2PPB C;  3Q24 A;  4LJZ C;  1LTS D;  2XRS D;  3K0Y A;  2EDG A;  5IIF A;  2DNE A;  1RJT A;  1D1I A;  3D6W A;  2Y0S B;  1BO0 A;  3BZD B;  4K2L A;  3NQT A;  1GXD C;  2PW7 A;  3V96 A;  4C1N I;  1PTO H;  1SE3 A;  1STN A;  1DOL A;  2BCO A;  1F9R A;  4KY6 A;  2R61 A;  1X32 A;  2QCP X;  2NTT A;  4IUT A;  1WTP A;  1CFM A;  1T5X D;  5EKL A;  1HRJ A;  1SDF A;  2K01 A;  1SNQ A;  1A3V A;  4FF4 A;  2OEO A;  1EIG A;  3KLS A;  2C9O A;  4EVO A;  2RVL A;  2PZU A;  1HA6 A;  4ZUJ A;  3LNN A;  5BN4 A;  1ML0 D;  3QJY A;  3C2P A;  2JEB I;  5C6A A;  1Y1W B;  3GTQ B;  5IGC A;  1H9R A;  3J80 L;  1O78 A;  3FKI B;  4Z9C B;  2B2T A;  3L3O C;  1WTQ A;  3J81 L;  2K5W A;  2K28 A;  4G7O C;  1E2Z A;  5CV4 A;  5JAV A;  1CT1 D;  4PV1 C;  5C5M A;  4R8I A;  1BDO A;  4CHT B;  5J39 A;  1A15 A;  5EKK A;  5IOD A;  3A54 A;  4XDX A;  3BDL A;  5M9O A;  1EEI D;  1MD2 D;  5CC4 A;  3MFG A;  1B50 A;  1Y1V B;  1PTO C;  1EZ6 A;  1IW7 C;  1O7Y A;  1CI3 M;  2K7V A;  3OPO A;  1SE2 A;  2IPK D;  1EU3 A;  2A5H A;  4ZQ3 A;  3TBI B;  2K03 A;  2A73 B;  4HTH A;  3OIP A;  1TY0 A;  4C1N K;  3PMF A;  1RHP A;  2MUY A;  1DZ1 A;  2CW0 C;  2LMC B;  2X6G A;  4K8I A;  3GO5 A;  1I4P A;  1PTO D;  3E0J A;  1F77 A;  1DJR D;  4QB4 A;  3Q22 A;  3K5O A;  3K58 A;  4U67 3;  2EPB A;  5ELF A;  3A7A B;  1UEA B;  4IUR A;  3EA6 A;  3WOE A;  3MHB A;  3SEB A;  3KLS X;  4XYQ A;  3PIP 3;  2AQ3 B;  4KKT A;  2NVY B;  3VR4 A;  3AMU A;  2BDN A;  4C2M B;  4HSP A;  4FXG C;  3H0G B;  4CJ1 B;  2EY5 A;  2C5C A;  5KRU A;  2M2L A;  3I73 A;  3MC0 B;  1Z7T A;  1GUG A;  3GV3 A;  2XWB B;  2A6H C;  1D6E C;  3K5M A;  1Y69 U;  3AB9 A;  1AZQ A;  1NSN S;  5T1G A;  1B4O A;  1HQM C;  1TS4 A;  4DF7 A;  3MXU A;  5FO7 B;  2IW3 A;  2L55 A;  5I9O A;  3I4L A;  5IGG A;  1BCP B;  2E75 C;  3VR2 A;  2Z8L A;  5ELB A;  2BOS A;  1V1P A;  1SND A;  3PIO 3;  4K6L A;  1E0B A;  1B1Z A;  4XQQ A;  5KIX A;  5CMD A;  1LLR D;  2KOL A;  2NBF A;  1B3A A;  3NWT A;  5G3L D;  4FF2 A;  1LV9 A;  3ERQ A;  1Q90 A;  1MBY A;  1STE A;  4FXD A;  3TP5 A;  2O5I C;  3P75 A;  4A3E B;  2PO4 A;  1OO9 B;  3IAY A;  1DON A;  1IKM A;  1EY9 A;  2AQ2 B;  2F0L A;  4QMG A;  1OXX K;  1CTM A;  5A2Q L;  3T53 B;  1ZYR D;  1I4R A;  2K33 A;  4ABN A;  2E2D C;  3R2I A;  3NBH A;  1SNO A;  1JOO A;  5I2Y A;  3OWE B;  3PUW A;  5C0X I;  1ILQ A;  2KQ3 A;  1JR0 D;  5C44 B;  2AUK A;  5CBA E;  1KAA A;  2RDF A;  3NPP A;  1M4V A;  1C8C A;  3AU7 A;  4A3B B;  5IGD A;  2WAC A;  4FNF A;  3EJI A;  3NHH A;  1KDA A;  1LT5 D;  2KED A;  2G9H D;  2B8F A;  4KD3 A;  1HTP A;  1Q3L A;  4RAU C;  4F8M A;  1EFI D;  4B08 A;  2BA0 A;  3FDT A;  4NP5 A;  1IL8 A;  4DN4 M;  3HOU B;  1HCZ A;  4PMB A;  1IYV A;  3NTH A;  3EQL C;  2L9H A;  1LTA D;  3GQB A;  2A69 C;  4ZKC B;  2EJF C;  4CJ0 B;  5AFW A;  4RH6 A;  2FMC A;  1HHV A;  1L0X B;  1F9S A;  1H9S B;  3CRL C;  2L12 A;  4CKC A;  4OHJ A;  5E4X A;  3S9W A;  1IYU A;  1BQQ T;  2F0I A;  4JBW A;  4IZ8 A;  3IL8 A;  1ET9 A;  4A3D B;  2R7Z B;  5TSS A;  2K6A A;  4QUC A;  1E2W A;  3HKZ B;  4IUU A;  1G29 1;  3NE5 B;  3IKJ A;  2NVQ B;  1TS5 A;  2EY6 A;  4A3F B;  3NQI A;  1B9N A;  4KHZ A;  1SAP A;  5FLX E;  5BN3 A;  2EYH A;  1XYI A;  2XNA C;  2K04 A;  5EGT A;  1FNV A;  4K2K A;  3VYR A;  3T16 A;  1CK1 A;  3J81 E;  3RZD B;  1EOT A;  2NWG A;  2F0W A;  3HP3 A;  3IFT A;  3MEH A;  4OGQ C;  3OMG A;  4OL7 A;  2TSS A;  1JE4 A;  1KLU D;  1WTR A;  4FF3 A;  3SR1 A;  3MAQ A;  2YU9 B;  1KTK A;  1MGS A;  4AYB B;  4K5X A;  1EY8 A;  4KV6 A;  3GTK B;  1WTX A;  4IAL A;  1LT3 D;  1KAB A;  1S5C D;  3QWN A;  4TQU S;  1DCZ A;  1L0Y B;  3TSS A;  5M3F B;  1PRT B;  3FPP A;  2NN6 I;  5EBD A;  1K8O A;  2ID0 A;  3OSO A;  1A6X A;  3NXW A;  3OIQ A;  1DOK A;  1WD0 A;  4X3S A;  1O7Z A;  1WCM B;  4KY7 A;  1FNU A;  3A56 A;  4HCE A;  3VYS A;  5JJZ A;  1G2T A;  4L6T B;  4EQP A;  2B2U A;  4XIG S;  4BA1 I;  1V1O A;  1OXU A;  3P20 A;  2F0G A;  1AZP A;  1PZK D;  3GV6 A;  1H9J A;  2M9V A;  4WOR A;  2K05 A;  3BG3 A;  3HOW B;  1EY7 A;  2HDM A;  2Z4H A;  4LK1 C;  2R92 B;  2L0C A;  3H6M A;  4IFD H;  5FLX L;  4PQX A;  2XN9 C;  5LL6 X;  1U4R A;  1GJX A;  4X3U A;  1LAC A;  2A69 D;  5CGK A;  3J7Y W;  2FJ2 A;  4KN7 C;  2DN8 A;  4RGN A;  4X3T A;  2NN6 G;  4XYO A;  3X3M A;  3GTG B;  4RGM A;  2L4N A;  3URY A;  2IWH A;  3VR3 A;  2F0O A;  1HPC A;  1WD1 A;  1EQT A;  3BYT B;  4DK1 A;  3RUZ A;  2OXP A;  1EY6 A;  5C3E B;  2JA6 B;  1WTV A;  2IX0 A;  5E4W C;  4J8Q A;  5IT9 E;  4RKB A;  3HEJ A;  4KJN A;  1BUV T;  1ENF A;  4IN3 A;  2F0E A;  5CV9 A;  1QCB D;  2NZ1 D;  2EYF A;  4KI0 A;  1GOZ A;  3HG9 A;  5DEH A;  3NP8 A;  1CHQ D;  4KKU A;  3D6C A;  2I46 A;  4KY5 A;  2CHB D;  1V1P B;  1BF4 A;  4K8J A;  2PZW A;  1JWS D;  1LTR D;  5I9P A;  5EBC A;  1GUW A;  1PXU A;  2ICI A;  1SNM A;  1Y8N B;  3TME A;  1JOQ A;  2A68 D;  4RFB A;  1D1K A;  1BCP C;  3VR6 A;  3J7A F;  5KGU A;  4NKL A;  4B9W A;  5JPN C;  3K5L A;  1LAB A;  3TP8 A;  2F0J A;  2D62 A;  2HUG A;  1EYD A;  1GUS A;  4N9P A;  1TS2 A;  2HCI A;  1A2U A;  2E2J B;  1CQV A;  4ZK9 B;  3A55 A;  2LKV A;  1RF2 D;  2JE6 I;  2VXW A;  2XIW A;  3DHQ A;  1JC7 A;  1D5Z C;  2XSC A;  3A8I E;  1ENC A;  4DA2 A;  4EGV A;  3MZ5 A;  4JK1 C;  3DEP A;  3VYT A;  3LWU A;  1SE4 A;  4ZAI A;  1SSO A;  2F0U A;  1SYD A;  3BYY B;  4U68 A;  2HQE A;  1QNU A;  2Q8I B;  5M5W B;  2PZT A;  1XWE A;  2RBM A;  1XXG A;  4QF4 A;  4G7Z C;  2WV6 D;  3PO2 B;  5FKA C;  2F0D A;  1FR3 A;  4MHE A;  1PRT D;  1CHP D;  2KEC A;  5I6W A;  4OO1 H;  2F3W A;  1VMC A;  1QOH A;  1A2T A;  5JPM C;  2EJG C;  1I4G A;  1SBB B;  3NBI A;  1II3 A;  2H1E A;  3H3V C;  4M8A A;  5JVH 3;  5IGE A;  3F2U A;  3SHL A;  3RLF A;  4F7X A;  5I6Y A;  2OF1 A;  3VYU A;  2IJ0 A;  4P2C B;  2Q8T A;  4TSS A;  2FIN B;  5J1Z A;  1HA5 A;  1JIC A;  3DWQ A;  3K5N A;  4F87 A;  1SMY C;  3NUC A;  2JP1 A;  4DK0 A;  5CV6 A;  5HGT A;  3T4A C;  3Q23 A;  1TWH B;  2FFK B;  1EQV A;  1LT6 D;  2DY7 A;  5CBE E;  5M5Y B;  1KNA A;  3OWF A;  3CKI B;  2B2W C;  4A93 B;  4OO1 G;  1FD7 D;  1EY0 A;  3J7A V;  2F0S A;  1SYF A;  1U4M A;  1W6J A;  1GHK A;  3CU7 A;  2B2Y C;  1BBX C;  4CKE A;  1D5X C;  1TWG B;  1ILP A;  1EWC A;  3GTP B;  5HUR A;  3M4Y A;  4KMU C;  2D2C C;  3I8Z A;  5C4H A;  1QB5 D;  3PUX A;  4XT1 B;  1C4Q A;  3H09 A;  5I4D A;  3I90 A;  3JAM L;  1J8I A;  3M4O B;  3SE0 A;  3E5S A;  3VA7 A;  5KNB A;  3R3O A;  3GTJ B;  4ZYS A;  1MI2 A;  4V19 0;  1VF5 C;  5A35 A;  3S16 B;  3LWE A;  1ZKO A;  3LX0 A;  3D4W A;  3P1H A;  1JWU D;  4K5V A;  1CA5 A;  4TRD A;  2WIN B;  1NCV A;  3G7L A;  3D4D A;  1UAP A;  3WDN A;  4XXE A;  3DM1 A;  2G9D A;  2ZXP A;  4L63 B;  5LL6 S;  2X6L A;  1PFB A;  1K8M A;  5KND A;  2EY2 A;  1RTN A;  2EYM A;  3MVV A;  1G6Z A;  1CZW A;  4KD4 A;  2NB0 A;  4N9T A;  2PMZ B;  2ZXO A;  4G4K A;  4EQO A;  5D3I B;  2KCC A;  2NN6 H;  1EWH A;  3OW7 A;  3NWS A;  1RTO A;  3SDZ A;  1HXY D;  1BCP F;  1UUP A;  3HOV B;  1LTI D;  2BA1 A;  4H13 C;  1YNJ C;  1EL0 A;  4RHS A;  3L7Z C;  4KTA A;  2QIL A;  3QG1 A;  5C3X A;  1CZG A;  2KVM A;  2CVR A;  2BE5 C;  2IT1 A;  5EPL A;  1V43 A;  2HDL A;  2QDB A;  4L8J A;  2AQ1 B;  4S3S A;  1EIH A;  2AWO A;  5DM6 3;  1VMP A;  1SJH D;  2D5D A;  1PLF A;  2K1B A;  2NYZ D;  2RKS A;  5KNC A;  1LTB D;  5KEE A;  4I7Z C;  2F0P A;  1MSG A;  5C0X H;  3D8G A;  3ZYY X;  1F2L A;  5FO8 B;  1NR4 A;  1PYW D;  3NTK A;  1SNC A;  1STA A;  1KDB A;  4R9W A;  4HSV A;  5FK9 C;  3I4N B;  1ICW A;  2KCN A;  2EE1 A;  4DGZ A;  4A3M B;  2TMP A;  3I4M B;  5BN5 A;  2EYO A;  1H9M A;  1QG7 A;  3RMH A;  2IL8 A;  4PNY A;  1DXM A;  1JWM D;  3C46 A;  5EQ0 A;  3N52 A;  1BR9 A;  1SEB D;  3NTI A;  4FP5 D;  5C0X G;  3ND9 A;  1LTG D;  2WII B;  4OIJ A;  1JOK A;  1SYB A;  1SMY D;  2AUJ D;  4GZY C;  5C4X B;  2EOT A;  1B2T A;  1JCK B;  2B63 B;  1XX8 A;  2NVT B;  4A3J B;  5D14 A;  4RA8 A;  3QIA A;  2SNS A;  4OIK A;  2H4O A;  1QWY A;  3V2T A;  5T1I A;  4C3I G;  1Q1B A;  1YNN D;  1QIL A;  3MFY A;  3PO3 B;  1ESR A;  5KYI A;  1Z6H A;  3GTL B;  2XRQ D;  1ZEQ X;  2M00 A;  4H44 C;  4A3I B;  4PMC A;  1G8Z D;  1PZJ D;  4DNR B;  4KKS A;  1WVL A;  1B53 A;  3HS0 C;  1Q8I A;  3MXG A;  5CV8 A;  1PFN A;  4HAE A;  1O7L A;  1BNZ A;  2Z1C A;  3BDO A;  5JEA H;  3OHX C;  3R2T A;  1PRT F;  3KF8 A;  1QE6 A;  2XVS A;  2EYL A;  3SVM A;  1H9S A;  1EY5 A;  3D4R A;  4ID6 A;  4G7H C;  5CV7 A;  4BBR B;  1F9P A;  5M3M B;  4DFA A;  3BS1 A;  2RDG A;  4BY7 B;  1AEX A;  4ODG A;  4UAI A;  2RSO A;  4A3K B;  1NR2 A;  1SYE A;  1EU4 A;  1HFN A;  1STY A;  3HRZ C;  1YNJ D;  4YIJ A;  3TN2 A;  1IHZ A;  1JB3 A;  1IKL A;  4NDX A;  4DAY A;  4RHR A;  1PTO F;  2MGS A;  4C3J G;  5FO9 B;  1TS3 A;  2F3V A;  2R93 B;  3ND8 A;  5EPJ A;  2HCC A;  1LTT D;  4FF1 A;  3GTO B;  5C4J B;  1Z47 A;  3D3R A;  3O13 A;  2GA4 B;  2PNR C;  4DAV A;  1PTO B;  3VA5 A;  1G91 A;  1SYG A;  1ZXT A;  2WB1 B;  2KEE A;  4XQN A;  4BY1 B;  5I2X A;  1PRT C;  2N88 A;  2X69 A;  1EY4 A;  2KA7 A;  1KNE A;  4UDU C;  3K59 A;  4LMQ D;  2A6E C;  1B44 D;  4OO1 I;  2A74 C;  4KHV A;  1BOS A;  2ICE C;  2LY7 A;  1TWF B;  2MP1 A;  1O80 A;  4RGT A;  2WKD A;  4R8N A;  2WAQ B;  2J7Z A;  4XQJ A;  2I07 B;  5EPK A;  3HOX B;  1B9M A;  3PUZ A;  1LO5 D;  3SK6 A;  3TP7 A;  5ISR A;  1ONL A;  1PFM A;  3HZX A;  5G3L F;  3GD7 A;  2BE5 D;  4Y7N B;  2E74 C;  4Q0F A;  1V8Q A;  2SDF A;  4DXF A;  3PUV A;  1J9O A;  4NW2 A;  2EYJ A;  3P7J A;  1EYA A;  2F4I A;  3T51 B;  3U9S A;  2F0N A;  1T5E A;  2IX1 A;  1I3Q B;  2R3Z A;  1TKW B;  1YNN C;  3K57 A;  3HGB A;  4MIU A;  1GUO A;  3H91 A;  4IFD J;  5K5P A;  3DXJ C;  2F0K A;  4CJ2 C;  3SXH A;  1IW7 D;  2EJM A;  4B9X A;  2EY1 A;  1UNS A;  3W2D A;  2F0F A;  2MHV A;  1EEF D;  4KN4 C;  2K5Q A;  2F0H A;  3DWP A;  3S15 B;  1STH A;  5JVG 3;  1NAP A;  1BCP D;  3NK9 A;  3TZU A;  1CA6 A;  4O42 A;  4C3H G;  2RSN A;  3C1F A;  3N6R A;  4HR7 B;  2SEB D;  5D65 A;  4TKO B;  2NVX B;  2DY8 A;  1KLG D;  4BS9 A;  1S5F D;  1X3P A;  1AN8 A;  3R93 A;  5DM7 3;  2VUM B;  3OOC A;  2N55 A;  5ELE A;  5ELD A;  4DXG A;  2JA8 B;  2BDO A;  1TII D;  4HED A;  1FYC A;  1PDQ A;  5IGF A;  4K5W A;  3QOL A;  2B39 A;  3EFX D;  4FVM A;  5DAU A;  3E6Z X;  3S14 B;  1QNK A;  1K83 B;  4C3J B;  2JA7 B;  5K36 G;  2O5J C;  3BVZ A;  4ILW A;  2ENB A;  3QOJ A;  2RDH A;  1I6V C;  5C0X J;  2OT2 A;  2FMM A;  3VR5 A;  4BA2 I;  4BBS B;  4KJO A;  1HFG A;  3DEO A;  5FOB B;  3DMU A;  1SNP A;  3IFD A;  2EZV A;  2MPM A;  1W6K A;  1Q1E A;  1AP0 A;  4CBV A;  3CQZ B;  5NUC A;  2FHT A;  5F2D A;  3BDC A;  4RWS C;  4RCN A;  3QB3 A;  4RKL A;  2J0T D;  2LFN A;  3SK4 A;  1NUC A;  2KJX A;  1JQY D;  2SNM A;  2B2V A;  3M7N A;  3MXP A;  5CYU A;  1HUN A;  3RD4 A;  2F0V A;  2XWJ B;  3K6O A;  3R8B A;  2KUM A;  4QUF A;  3S2D B;  4EQN A;  3MWY W;  3DWA A;  3T13 A;  2K5D A;  5IOC A;  2O2L D;  1R4Q B;  2F0Q A;  4H0L C;  1ESF A;  2PCF B;  1WTO A;  2J4X A;  4HN7 A;  3S1Q B;  3I3C A;  2E2H B;  1RDP D;  3V05 A;  4E6I A;  1HTL D;  1H9K A;  1OXS C;  2JXM B;  2EYP A;  2F0T A;  5D3D A;  3T56 B;  1G2S A;  3NSW A;  2A6H D;  4XTC S;  1S4Z A;  2ZT9 C;  4I65 A;  2L5T A;  3KBG A;  1I4Q A;  3SK5 A;  1JOR A;  2O4X A;  3S1N B;  1HQR D;  1X3Q A;  2AWN A;  2QKI C;  1RCV D;  3I72 A;  1E2V A;  2JA5 B;  3MA2 B;  4HMJ A;  4PMW A;  2WKC A;  4FO2 A;  3WOF A;  5J22 A;  3KK7 A;  4IFD G;  2EXZ A;  4IUP A;  4CGY B;  1GUN A;  3BVM A;  5COR A;  1ROD A;  1I4H A;  3TP6 A;  1I6H B;  4K14 A;  3KBX A;  1XTC D;  5C5L A;  3EVQ A;  5JEA G;  2D9U A;  1FGB D;  1VCI A;  1Y8O B;  2RA4 A;  5CV5 A;  3GP7 A;  4IQZ A;  2QF7 A;  4RGO S;  5JOB A;  5E1F A;  5JEA J;  5CR3 A;  3BVG A;  4ZRZ A;  2DNC A;  3A8J E;  4J1M A;  1D2B A;  4DNT B;  1TU2 B;  1DM0 B;  3I91 A;  3FEW X;  1BXT A;  3SK8 A;  2PYK A;  1AFP A;  2F03 A;  2VB2 X;  1I50 B;  4HMI A;  2R6G A;  4CKB A;  4IFD I;  2L11 A;  3L9A X;  3JAM E;  3KLR A;  1FNW A;  4IUN A;  2PQE A;  4V0B A;  5IGB A;  2ZXR A;  4DU9 A;  3MXN A;  1ENA A;  1U9R A;  1CM9 A;  3HOY B;  3TDQ A;  3MTS A;  3PV0 A;  2JSO A;  1TWC B;  1SFO B;  4A3G B;  3RZO B;  2IX3 A;  3FRP B;  4BWG B;  3M3Y B;  1EYC A;  1SJE D;  3A8K E;  1A3T A;  1OXT A;  4LAA A;  4RCO A;  5EKI A;  4DAP A;  4MN3 A;  1RD9 D;  3KUP A;  3ONA B;  2NUC A;  4IUV A;  3A7L A;  1SYC A;  3W3A A;  5LHY 1;  4QCL A;  4H7B A;  4WJW A;  3D31 A;  3M85 A;  1F2Z A;  4ULL A;  1VF7 A;  4C56 C;  2Z4I A;  5C4Z A;  2JEA I;  1F2Y A;  4FYD A;  4Q5V A;  4K6D A;  5KYL A;  2NTS A;  2RQX A;  3I70 A;  4NMZ A;  1AW7 A;  1R4P B;  2EVB A;  3ERO A;  1F9Q A;  4KK7 A;  1A3U A;  1S5E D;  1D5M C;  3CRK C;  4XT3 B;  1RKN A;  1TQO A;  2F0M A;  3TZD A;  4G57 A;  3S2H B;  1STG A;  2V4D A;  3QO2 A;  5C3W A;  1R9T B;  2F1M A;  1ZYR C;  1HUM A;  1U4L A;  3K7A B;  1TR5 A;  4ZKB B;  1TVX A;  5E3F A;  2E76 C;  1U4P A;  1STB A;  3Q0A A;  2A68 C;  2VB3 X;  3G6J B;  4ZLT F;  1M8A A;  3UI2 A;  2L1B A;  2LS0 1;  2JYO A;  1GHJ A;  1Q12 A;  1MSH A;  3J80 E;  1DYQ A;  1TT2 A;  3U9O A;  1C48 A;  1S5D D;  4ZUI A;  2KHS A;  5M5X B;  4ME5 A;  3OMC A;  2B8G A;  4IUQ A;  3GTM B;  3H94 A;  3HOZ B;  1TWA B;  2B2U C;  1PZI D;  1DD2 A;  1CQF A;  1DOM A;  1VDZ A;  1PMR A;  1OXV A;  2B2V C;  2A6E D;  5K36 H;  2CW0 D;  4QIW B;  4O1N A;  2SOB A;  4F88 A;  4M1U B;  3PUY A;  3FPU B;  4FXK C;  1TY2 A;  2QEJ C;  3CHB D;  3C1E A;  2B2W A;  4J6H A;  4WRD A;  4WFN 3;  2E2I B;  5ELC A;  1WTW A;  3ITP A;  4HCS A;  1ET6 A;  4X3K A;  3C3L A;  1I4X A;  1QJO A;  5IT9 L;  3S17 B;  3DUZ A;  2K32 A;  1EZ8 A;  2VNU D;  3S1R B;  2Q8R E;  1Y8P B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...