2F0WA

Crystal structure of staphylococcal nuclease mutant v23i/l25i/v66l/i72l
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
136
structure length
136
Chain Sequence
b'KLHKEPATLIKAIDGDTIKIMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMLENAKKLEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Staphylococcal nuclease
publication title Hydrophobic core mutants of Staphylococcal nuclease
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 36
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2005-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2f0wA00
2EY2A 3QOJA 5IGEA 2RKSA 4ZQ3A 5NUCA 5JOBA 1A3UA 3NK9A 1SYBA 4B9XA 5CGKA 2PW7A 2M00A 4I65A 4KY5A 3OWFA 5M9OA 1EQVA 3RUZA 3PMFA 4K2KA 1JOKA 5HGTA 5ISRA 5KGUA 1ENAA 4NP5A 5C5MA 4K2LA 2EYPA 4KY6A 3TP8A 4NDXA 2PW5A 2SNSA 4PNYA 5CR3A 1SNMA 3HEJA 4YIJA 1A3TA 3EJIA 4PMCA 2F0TA 5HURA 2F0NA 3LX0A 5EKLA 3P1HA 3SR1A 5J22A 2PZTA 5K5PA 3NHHA 4K6DA 1U9RA 3DMUA 5EKKA 5C5LA 2OEOA 5I9PA 4K8IA 4RKLA 5EGTA 5J39A 1STHA 5IGDA 5CV8A 3OMGA 1SYDA 5CC4A 3V2TA 2HQEA 5DAUA 2F3VA 2WACA 2F0IA 4LAAA 4IALA 2F0JA 2EY5A 1SYEA 3R3OA 1STGA 4N9PA 4EQOA 5JAVA 1EYDA 2F0MA 1EZ8A 2RBMA 2F0EA 3U9OA 1EY6A 2F0SA 1F2MA 4HMIA 4TRDA 1SNCA 1EY9A 2RDFA 4KJNA 1II3A 1EYCA 2NUCA 2OXPA 3ERQA 4QB4A 1EY4A 5IGFA 3TP5A 4K5XA 1AEXA 3D8GA 3TP6A 2F0LA 4NKLA 2QDBA 2F0QA 5C6AA 4EQPA 1A2TA 5KYIA 3NXWA 3SK4A 5IIFA 3SK8A 5I9OA 4MIUA 1KDCA 1SNPA 2EYHA 4S3SA 5IOCA 4F7XA 2F3WA 3SHLA 4F8MA 1JORA 2EYLA 1EY7A 1TR5A 2PQEA 2SNMA 3BDCA 4WRDA 4DU9A 5IGCA 1SNQA 1JOOA 1EZ6A 5IODA 1STAA 5I6WA 2EY6A 1ENCA 1KDBA 4K5WA 2F0KA 3TP7A 5KRUA 3E5SA 3P75A 4H7BA 3T16A 5C3WA 3T13A 3NQTA 1SYGA 1A2UA 4KD4A 2EYOA 1EY8A 4NMZA 4HTHA 5KYLA 2F0OA 2O4XA 2KQ3A 4ZUIA 3SK5A 1RKNA 5I6YA 4KV6A 4KHVA 3EROA 5KEEA 1A3VA 4J1MA 3VA5A 4DF7A 2OF1A 4DGZA 5C3XA 3C1FA 4R8NA 5E3FA 5DEHA 4EVOA 2F0WA 3OSOA 5IGBA 1TQOA 2F0VA 2F0HA 3MZ5A 4IZ8A 4J6HA 4HMJA 1F2YA 4KJOA 5F2DA 3H6MA 2SOBA 4K14A 3SK6A 3C1EA 4E6IA 2EY1A 2LKVA 3QOLA 1IHZA 5CV9A 1SNDA 4B9WA 1EYAA 4ZUJA 5IGGA 1STBA 1KAAA 3DHQA 4QMGA 5CV6A 4WORA 4ME5A 3TMEA 5C4HA 1EY0A 4ODGA 4K5VA 3SXHA 3ITPA 2EYJA 1EY5A 1STNA 3MEHA 3MHBA 3MXPA 4KD3A 1KABA 3BDLA 4KTAA 1TT2A 5CV5A 1STYA 1SYFA 3D6CA 4QF4A 1JOQA 1NUCA 2F0PA 3QB3A 3OMCA 5J1ZA 5C4ZA 2PZUA 4IUNA 2KHSA 2F0UA 2EXZA 3S9WA 5CV7A 3HZXA 4K8JA 2PZWA 3NUCA 4KY7A 4G57A 4OL7A 2PYKA 5CV4A 3EVQA 4PMBA 1KDAA 4EQNA 5KIXA 3NP8A 1SYCA 4RKBA 3MVVA 4N9TA 2EYFA 1F2ZA 5E1FA 4DFAA 3D4DA 2F0GA 1NSNS 1SNOA 2ENBA 3D4WA 2F0FA 2F0DA 4ID6A 2EYMA
chains in the Genus database with same CATH superfamily
5C4XG 1HJPA 2XIWA 2R92H 4BWGB 5M9OA 1VQHA 1Q1BA 4KKSA 3E6ZX 4JI7Q 1Y1WG 3RZDH 5GROA 2Z6KC 4C3HH 4HJAA 1I4XA 2AQ3B 3DEPA 5J3BA 4ZCKA 3S2DB 3HEJA 4PMCA 2M9VA 3V05A 2NN6I 2HHHQ 1VQOA 3NHHA 5LHY1 1T5EA 4JI7L 5FOBB 3IFDA 2ASBA 1M4VA 1NY4A 3MC0B 4FXKC 5FO7B 1X65A 4Y7NH 4CHTB 5I4DA 4FP5D 1SFOB 3S1MB 4UPAA 3LGJA 1SYEA 2KEDA 3CRKC 1K73C 5BN4A 2HHHL 2RBMA 1K8OA 1PH9A 1JWUD 3VYRA 1WI5A 4KJNA 1PZID 4H44C 4A3DG 5E7NA 1HH2P 1G91A 3BDOA 3KLRA 1D6EC 2G9HD 2QDBA 3KF6A 2H1EA 2B39A 4BBRG 2KCMA 1L1OC 3I56A 5IP9G 2F3IA 5DM63 3A54A 5ELEA 3TP7A 3ULLA 1SJED 2JA7B 3NQIA 1PV4A 4IQZA 2F0OA 3CD6A 5JJKA 3HS0C 3CMAA 3HOVB 5HY6A 2J4XA 2OF1A 2QKIC 3S16H 2K5WA 2IPKD 3QO2A 4IZ8A 3PCOB 4JYAQ 2NVXH 5C3EH 3OYYA 1LYLA 1EIYB 1W3SA 4JVZA 2JA6G 4KD3A 4CKCA 1X56A 2Q2UA 3IRBA 4JG2A 1X54A 4JYAL 4U673 2JA9A 4CJ0B 1Z6HA 1CTMA 4QUFA 2A74C 3H0GB 4JOIA 5DLQE 4OL7A 2MFIA 3CF5A 2WKCA 1JE4A 1CUKA 1IW7C 5C4JH 4LF9Q 5IYCH 2R7ZB 2KCNA 1LTBD 5CGKA 1IXRA 4DV4Q 4OXPA 5COYA 1GXDC 1LO5D 4RGNA 5GAEC 1NMFA 1MSHA 3J81i 3KF6B 1PH1A 4LF9L 1C7YA 4IFDH 5M3MB 3PF4A 1CI3M 5EBDA 1PA6A 3CKIB 1I94Q 2FHTA 4DV4L 2K14A 3VDYA 2JA8H 3FMCA 1GUNA 4LK1C 2O2LD 2IWHA 1I94L 1XNRQ 3KOJA 1F77A 1LTTD 4DV1Q 1KNEA 3VR2A 4DAYB 2E2JH 4IPHA 1DXMA 1YJNA 1SNCA 4QB4A 3ULPA 1LT5D 1UNSA 1EY4A 1JQYD 2WAQG 2VUMG 1XNRL 4DV1L 2ZJPA 3DM3A 3PUXA 1PH6A 2B2VA 1HCZA 1C8CA 1K0RA 2CWAA 2K28A 2RA4A 3BDCA 1FD7D 4WRDA 4IJHA 4DV3Q 1VQIA 4ABNA 1PYWD 1VMPA 1A2UA 1CFMA 1Q3LA 1OXXK 2AKWB 5CYUA 4DV3L 1TS2A 2XWJB 3GTLB 1SN8A 1AN8A 4GN3B 1EWIA 2E2DC 3PO3G 2D0OA 4HJ5A 1VQAA 2B8GA 2MO1A 4C1NK 2F0VA 4C2MB 1EQRA 4MTKA 1XMOL 2MQHA 4A3MB 5EPLA 4B3MQ 3IKJA 3BYTB 1STBA 5T1GA 2PPBC 4LF5Q 3CCRA 3KYHC 3LWEA 3SEBA 1EY5A 3BJUA 3NBHB 3BG3A 2CQOA 2I5HA 2Z9HA 4IUPA 2R92G 1NUCA 2E8GA 3CCQA 1VQBA 1B9MA 4B3ML 2B2UA 3FDTA 2UXBQ 1TWFB 4LF5L 3S9WA 2PI2A 4C3HG 2N8NA 4MHEA 4BS9A 3D31A 1S40A 3S1RB 1SYCA 1HR0W 4QCLA 1TS3A 3G6JB 1CK1A 2KECA 2UU9Q 4PZ6A 3SE0A 3GTJH 1XX8A 2UXBL 5KNDA 3QIAA 3G71A 2D5DA 1U4RA 2L11A 2K5NA 4IUUA 4KKTA 4WJ4A 2PW7A 3RN2A 1VDZA 1M1KC 2DGYA 3GO5A 4K2KA 2UU9L 2WAQE 3KLSA 1QE6A 3U50C 1BOSA 4GKJQ 5BR8L 1IYVA 2YYZA 2F0NA 5EKLA 1TIID 4A3IG 1WTPA 5M5XB 4A3DB 3T56B 1KLUD 4CKBA 4KHZA 5CC4A 4LFCQ 1HZAA 2WACA 4Q5VA 5C0XI 1DM0B 5HGQA 4GKJL 1UE1A 2EY5A 3OW7A 5IWAQ 1PH7A 1GUOA 3N52A 5JAVA 3GTGB 3HKZG 1ASZA 3D0FA 2B2WA 1S5FD 1S5CD 3U9OA 2RF4A 1AZQA 1JT8A 4HJ9A 3ERQA 1HNZQ 4LFCL 1MKHA 2FXQA 2R6GA 3UE0A 3FHWA 5IWAL 2WB1B 2AUKA 1Y1VH 3TDQA 5IIFA 2RDGA 1ONLA 1WCMB 1A63A 1U4PA 1HNZL 1JOOA 2B2TA 3NEMA 4YWKA 1KDBA 3TZDA 3PGZA 5C3EG 3J81L 1K83B 1X3PA 2K5QA 2IY5B 1WTRA 1JWSD 2JEBI 4DK3C 2MUYA 1TY0A 4KV6A 2CVRA 4LWCA 1JB7A 3JAMc 1ILPA 2GA4B 3AU7A 2QCPX 2Z8LA 4R8NA 5E3FA 4EVOA 1T5XD 5F2DA 4GNXA 2QDLA 4U68A 1FGUA 1XPOA 1Y8OB 2E2HH 2Q8TA 4ZUJA 3DHQA 2BDOA 2R3ZA 1VQ6A 1F9SA 3A56A 2JP1A 3CCMA 3MEHA 3HOXG 5IYCG 3I4NB 5C44B 1D7QA 1DYQA 4BA2I 1XNQQ 1CQVA 2E75C 3M3YB 1X6OA 3CQZB 3HZXA 3GTOH 3O13A 3S2HB 4G57A 4IFDG 1NAPA 1VS0A 5KIXA 1F2ZA 1B50A 1XNQL 1IW7D 2JA8G 2L0CA 4IURA 3GQBA 3CHBD 3D3RA 3HKZE 3MFYA 4H13C 3GTKB 5EAYA 1I4PA 1MGSA 3OWFA 3TRZA 3A8JE 2RVLA 4RGOS 3RMHA 1AW7A 2K05A 4C3IH 5CORA 2DNCA 3RR5A 3TP8A 4KY6A 1JJGA 3AQQA 4X3SA 1EIHA 1O7YA 4GZYC 5J22A 2CKZB 3NWSA 3EBEA 1WOCA 5I9PA 4BA1I 4EGVA 5CV8A 3TN2A 3A5ZB 3CCLA 4FF2A 2IJ0A 3HP3A 3W1BA 4XXEA 2Q2TA 2PQAA 3W3AA 4DV6Q 2F0JA 4LW1A 1V1PA 1BR9A 1ENFA 2K5VA 1QOHA 2Z4HA 4HIDA 2E76C 1II3A 4IOAA 1SEBD 4UY8C 1IZ6A 3GTQB 2EJMA 2NVYH 4DV6L 2F0QA 4AIMA 2EZVA 2M2LA 3MWYW 4H0LC 1W6KA 2WFWA 2RHQB 4OIJA 1E0BA 1OTCA 1XTCD 5L37A 2K50A 2B8FA 1STAA 2LY7A 4DPGA 2A19A 5KRUA 5EQ0A 1QWYA 2I46A 2AQ1B 2EQSA 2SEBD 1J6QA 4KD4A 1YIJA 4XYOA 2ZTDA 3K0XA 3S15H 2KHJA 3GDEA 3T1HQ 1U4MA 5JPNC 1LLRD 1BDOA 1I6HB 1JWMD 3I4LA 3Q8DA 3NTKA 1SJHD 2J7ZA 3SK6A 4BBSH 4WJ3M 1BQQT 5GAHC 3T1HL 3ITPA 4L5TA 1H9KA 3S1NH 1EOTA 1K9MC 4H02A 1DGSA 3D6CA 1AZPA 5IE8A 2Q2IA 2Z0SA 5I2YA 4KKUA 4FF4A 2DNEA 3B6YA 1NMGA 2ALYB 2CW0D 4X66Q 1AFPA 5M3FH 3C2PA 2VW9A 4N9TA 3R2IA 3D4WA 4A3FB 1V1PB 4ID6A 4A3IB 4V0BA 3BZCA 3S1QH 1RODA 2C9OA 2RKSA 3I91A 4A75A 3K7AH 1PH8A 1A0IA 1F9PA 3CAMA 4WFN3 5FO8B 5CR3A 1H9JA 2I07B 4NXML 1IYUA 3P1HA 1DOKA 1B9NA 4K6DA 2OEOA 3J7A5 1EEFD 1YJWA 3OMGA 1Y1VG 4LFAQ 1MD2D 1SE4A 4B3TQ 4N8FA 2R93H 2KJXA 4IALA 2HDLA 3HOUH 4O0AA 4EQOA 3H3VC 1JC7A 3ERSX 3NTIA 3RN5A 2F0SA 1BCPB 2D2CC 2NUCA 4LFAL 4A3BH 1R9TB 3CU7A 4B3TL 4A93H 1N32Q 3BVZA 5K36H 1AEXA 4DKAC 1HFNA 3BYYB 4IUVA 4CGYB 4MIUA 1VQFA 3URYA 1Q90A 2OQ0A 1TR5A 5IGCA 3OWEB 1N32L 2Q8RE 3JAMi 5LMNL 4JV5Q 2TMPA 1X9NA 1A15A 4J8QA 1PHJA 1S3OA 4UDUC 5A2QE 3M85A 1ICWA 2KENA 3U4ZA 3G4SA 3HOWH 3HOXB 4JV5L 1HHVA 1X3GA 4DR2Q 3KBXA 4TQUS 4L5SA 1EFID 5D3DA 2JN4A 3PO2B 4L8JA 3FKIB 1GM5A 2K52A 4HCEA 1IHZA 2ZXRA 3MFGA 4C1NI 3J7YW 4DA2A 4BY1G 4TKOB 3M4OH 1STNA 1TKWB 1LM0A 4DR2L 2UXCQ 2ZJQA 1Q12A 2ZJRA 5J1ZA 3E9IA 3GTKH 2B2TC 4JI2Q 1N9WA 4HIKA 3IFTA 2NYZD 1VMCA 5EPKA 5IY0A 1XTDA 2NN6H 1ET6A 2UXCL 3HKSA 5CBEE 1HNWQ 3RZOH 2X6GA 4HAEA 1GJXA 3HOYB 3H3VI 3QWNA 4JI2L 5E4WC 1NE3A 3Q24A 1U0LA 1G51A 1WTOA 2A5HA 1JR0D 4I65A 5ELFA 3RLOA 4IJLA 3J81E 1HNWL 3GP7A 4QQBX 3L7ZC 3S24A 4I7ZC 3J7ZC 3A8KE 4A3EH 1YHQA 1TWGH 1EWCA 4HIOA 3EFXD 2OQKA 3A0JA 2PZTA 1XMQL 3DMUA 1NNXA 4B08A 2K5DA 1HA5A 4RH6A 4DUZQ 2F3VA 3WOFA 4HJ7A 2WKDA 1RIPA 1TWAH 1YNJD 2MHVA 4M8AA 5AJ3Q 4DXGA 4C3JB 3I4MH 2VZAA 1EZ8A 4DAMA 1PYBA 1PZJD 1QG7A 5KNBA 1C0AA 1EY6A 4HMIA 4R4TA 2OXPA 4DUZL 5IGFA 4K5XA 2BA1A 3TP6A 1S5ED 1Y14B 4NKLA 2NVTB 1KLGD 5AJ3L 1JORA 2NZHA 5GQOA 4R4CA 5M5WB 4BY7B 1EY7A 2QEXA 3R93A 4BBSG 2A6EC 4LNQA 1O7IA 4RMFA 4KI0A 1YZ6A 4ZK9B 1KC8C 1FNVA 4DNTB 1X55A 1NR2A 2K1BA 2KQ3A 3FPPA 2KVMA 4IPGA 1LTRD 3DXJC 3K5MA 3EQLC 1FR3A 4JI6Q 4KN7C 1VQ7A 2VXWA 2CCZA 3H6MA 4K14A 1PH2A 4EX5A 4QIWE 2G5DA 5CV6A 3A7AB 1ICFB 4BXXH 1O80A 1EY0A 4RWSC 1CA5A 2EVBA 3PV0A 4JI6L 4HEDA 4P73A 5C0XJ 4R4QA 1SYFA 3BZKA 2E2IB 3J80c 4FDBA 4IUNA 1YNXA 2UXDQ 3ER0A 2EE1A 2VY3A 4KY7A 4AYBB 4A3GH 3JAML 2PNHA 1QJOA 4RKBA 1B8AA 1DOMA 3I3CA 4X64Q 2XSCA 1UE6A 3L9AX 1HQRD 4GLXA 2EY2A 5D65A 2UXDL 1BCPC 1SYBA 3T4AC 2CH4W 3PSIA 2R93G 3S17B 2K32A 4X64L 3HOUG 3MXNA 2OWOA 1S5BD 4NDXA 5T1IA 3UI2A 1E24A 2SNSA 2FMMA 2N3SA 2B63H 3LX0A 5FLXc 4A93G 2DY8A 5K36G 1SSOA 4P71A 4O42A 1U9RA 1RHPA 4P74A 4K8IA 4PZ7A 2HCCA 2ICEC 3HOZH 4F88A 3L3OC 2JA5H 2HQEA 2DY7A 4GKKQ 2F0IA 3GTMB 3VYUA 1HZCA 1E2ZA 1X3FA 1IBKQ 3K5NA 3W1GA 3M7GA 2Z4IA 3Q6SA 1K3BC 4GKKL 1Z7TA 1VQGA 1EWHA 1QUQA 3HOWG 1I3QH 1TWHB 1Y8PB 4R1JA 5IOCA 1IBKL 5BN3A 4X62Q 3M4YA 1TU2B 2L15A 3AMUA 4A3JB 2WINB 1G2TA 1EZ6A 1PFSA 1DOLA 4H7BA 3HRZC 1VQDA 3NQTA 2B3GA 2JE6I 4RCNA 1HUNA 3EIVA 4FXGC 4X62L 4CJ2C 4BY1B 4KHVA 4K6LA 1PDQA 2VQFQ 4RGMA 1EIGA 5DEHA 1JE5A 5IGBA 1YNND 4E6IA 4NW2A 2NN6G 5CV9A 4WORA 1SMYC 1RL2A 1HNXQ 1V1QA 2VQFL 2Z6BA 3K80C 5JJIA 4MTNA 3KFUA 1XMOQ 4A3KH 1L0WA 2QW7A 1HNXL 3S14H 4A3EG 3GTPB 1D1KA 1PTOD 1RTNA 4NXNQ 4OONA 3D4DA 2EYMA 5C0XH 4O1NA 2Y0SG 1CT1D 1Q82C 1BBXC 2XNAC 1SLJA 3KK7A 1SMXA 2VB2X 2QF7A 3A7LA 3D6WA 4KN4C 4MZ9A 4NXNL 2N55A 2IHEA 1ENAA 4NP5A 3I4MG 5C4XB 1I4GA 1K28A 4XIGS 2A6HC 2CW0C 2KCCA 1Y1WB 1NR4A 2AHOB 5K5PA 1B7YB 1I50B 3S2DH 2MNAA 1D1IA 5BR8Q 3K58A 2DJGC 5BN5A 2SDFA 3NSWA 2WIIB 2RDFA 1B44D 2MP1A 1SFOH 3S1MH 1MI2A 3DEOA 3KJOA 4KHPQ 3VR4A 2A69C 3NBIA 1A6XA 2BE5C 1IKMA 1WJJA 4F87A 3FP9A 3W5OA 4TSSA 2K6AA 1C4QA 4K5WA 4KHPL 4FYDA 5D14A 2A6ED 3NE5B 1Q7YC 4BBRB 2NWGA 2A68C 1WTVA 4OO1I 5IYBH 2YV5A 4BXXG 3GD7A 5JJZA 1B3QA 3KDFA 1TXYA 4ZUIA 2JA7H 2LXJA 1ESFA 1TWCB 3J7AF 3FPUB 1LTID 2R7FA 1NCVA 4IPDA 3J80i 4A3GG 3HOVH 1AH9A 1D2BA 2IL8A 2Y0SE 4LFBQ 5IT9c 4DK0A 3CPWA 2ZTCA 5G3LF 4CDDC 2YU9B 1YVCA 1K8GA 1IBMQ 3QB3A 2BOSA 2F1MA 3TEHB 3ZYYX 1UEAB 3W2DA 1I4RA 3WWVA 4LFBL 2JA6B 4K8JA 1ZKOA 2JYOA 3K5LA 1SAPA 4YY3Q 1WVLA 3RLFA 3MVVA 1PRTB 1IBML 3G7LA 2ID0A 2B63G 3I8ZA 2ENBA 2OTLA 3V96A 2EJGC 3H0GH 2X69A 1QCBD 4B9XA 3HOZG 1S72A 1BCPD 2JA5G 2C35B 4YY3L 1FNUA 3CMEA 2R7ZH 1VQ9A 5M5YB 3CCEA 4XYQA 3X3MA 1JJ2A 4B3SQ 3ULJA 1B4OA 1SNMA 5AFWA 1AE3A 4RA8A 4LF4Q 4DV0Q 3Q23A 5M3MH 1JCKB 2IT1A 3V2TA 3OIPA 4B3SL 1XJVA 2RCFA 4JW0A 4HJ8A 2F0EA 1VQLA 4DV0L 4LF4L 1F2MA 3VR5A 4L63B 2EJFC 1ESRA 5FO9B 1G8ZD 1CZGA 2F0LA 2K33A 4YHHQ 3WDNA 5C6AA 4EQPA 3CP0A 3NXWA 1FYCA 1ZXTA 2K01A 4M1UB 2JXMB 2WAQB 5CMDA 3U58A 2RSOA 5JEAJ 2VUMB 1Q86C 1PTOB 3M4PA 1YNJC 4YHHL 4JOIC 1VQKA 2HCIA 3CCVA 3PQIA 2XRQD 2IX3A 2YTYA 2AUJD 4ZKBB 1LT3D 2C5CA 2L5TA 1KXLA 4B3RQ 5I6YA 2GVAA 1WTWA 2UUBQ 3KJPA 4DF7A 4GNXB 2KCTA 3K8AA 4A3KG 3RD4A 4N8X1 2XGTA 4YWLA 1BBUA 1KHIA 3C1EA 3GTLH 4B3RL 4NB3A 1VQ4A 1OO9B 4JK1C 1WD1A 2UUBL 5C4HA 1K3RA 3PO3B 4K5VA 1P8LA 3Q22A 1SMYD 4C2MH 4DR1Q 4UAIA 1Z47A 4JC0A 3MXGA 3E0JA 5C0XG 4A3MH 3H94A 1STYA 3PIO3 5C4ZA 2KBNA 2XVSA 3SDZA 5JJLA 4DNIA 2B29A 3DWQA 4DR1L 2EOTA 3CC2A 1X3QA 2R92B 3FRPB 3NP8A 2HIXA 1ZYRC 1C9OA 3RLNA 1TWFH 4K0KQ 1LT4D 3RZDB 5IGEA 4C3HB 4ZQ3A 4X65Q 3EA6A 1A3UA 1HR0L 3WOEA 3S1RH 4GN4B 2B2VC 3RUZA 3PUYA 5HGTA 2VL6A 5E4XA 1IL8A 4K0KL 3STBD 3J80L 1C48A 1GHKA 4X65L 2VNUD 3EJIA 4Y7NB 3DLLA 1BBWA 1NTGA 3P20A 1A8VA 2A6HD 2MGSA 2E5LQ 3BVGA 5LL6S 2PQAB 1SYDA 3M4QA 5IP7H 3TZUA 5TSSA 4LAAA 5M5XH 4R9WA 2Q2HA 3CW2C 4YCWA 4A3DH 4NXMQ 4QUCA 1VQNA 4CDCC 3I72A 3D4RA 2E5LL 2HUGA 2PMZE 3I55A 4JI8Q 5IYBG 3DUZA 2NVQB 1MJCA 2BDNA 3U9SA 3GTGH 5JPMC 4KLKA 3HKZB 4HSPA 5KYIA 4DAVA 2JA7G 2A69D 2NTTA 5FLXL 4S3SA 2MJ8A 2BE5D 1LV9A 4XQNA 4NPSA 3T53B 4JI8L 2B2UC 4LUVA 5IODA 2F0KA 3TBIB 3T16A 2IW3A 1RF2D 1WTHA 3T13A 3HOVG 1MBYA 1EQTA 3S16B 1SYGA 2A68D 1BO0A 1WCMH 2UUCQ 4P72A 2HIVA 3J81j 1PVOA 3A55A 2NVXB 4XDXA 5C3EB 1PRTC 1EYGA 1VF5C 4YCUA 5LMNQ 3PUWA 1MSGA 3NELA 3OPOA 3J7AV 3VA7A 3K5OA 1K83H 2NZOA 2FJ2A 3CXCA 4PG3A 5JEAH 2L4NA 2UUCL 1NBWA 2I0QA 3H3VH 2ZXPA 3A5UA 1DCZA 1J8IA 1ET9A 1B2TA 1EEID 1I5FA 2WP8J 4HN7A 4OWTB 3H0GG 4ZLTF 5JVH3 2XTIA 4CDEC 4JI4Q 1K8MA 1OXVA 3CCJA 1XPRA 2NBFA 5C4JB 1O7LA 1CHQD 4POFA 3MAQA 3I4NH 2NTSA 2R7ZG 4AQYQ 1VF7A 2BCOA 3L0OA 5C44H 3PIP3 1YNNC 2B2WC 3AFQA 4G7OC 3M3YH 4JI4L 2LFNA 1SNOA 3CQZH 3OIQA 4QMGA 3S2HH 2H5XA 5M3MG 1PH4A 4CKEA 4YCVA 4AQYL 1HA6A 2ES2A 1GUWA 3PMFA 2JA8B 4RGTA 1W6JA 1P16A 2XN9C 1PLFA 2G9DA 1A3TA 1L2FA 4RG1A 2F0TA 1VQ8A 1VQPA 1V9PA 4C3IG 1PTOC 1MJEA 5H1SE 3TS0A 4RKLA 2E2JB 3CPFA 2K04A 5LMUQ 4PV1C 4X6AH 4IUTA 3OTOQ 3TS2A 4AYBE 4DUYQ 3HFZB 3KLWA 1FGBD 1RDPD 1B70B 1KNAA 3FEWX 3CCUA 4CJ1B 1XMQQ 4GNXC 5ELBA 3SVMA 1SR3A 1NJIC 3E0EA 5LMUL 1EYCA 1HZ9A 1JMCA 1E3PA 5FKAC 4XQQA 3OTOL 1G6ZA 3BVMA 5A35A 4DUYL 4JI0Q 3VYSA 1L0YB 1F9QA 1PFMA 2I5LX 3SK8A 4DN4M 5I2XA 1KDCA 1UE7A 1HQMC 3HG9A 4F7XA 2F3WA 1J5EQ 2EYLA 3RNUA 1R4QB 3GTQH 3I4OA 4R4IA 4QL5A 3T1YQ 1GOZA 2CFMA 4UP7A 4DK6C 4LUOA 4JI0L 3N6RA 3P7JA 1H9SA 1STEA 1PMRA 2PCFB 1J5EL 1GD7A 5EJWA 1CHPD 4A3MG 2VB3X 3T1YL 4A4IA 1UE5A 2CH4A 3M9BA 1RTOA 4RHRA 2NZ1D 5EBCA 3C1FA 1CZWA 1YJ9A 1EUJA 3BS1A 4J15A 1TQOA 1VQJA 1MIUA 3MTSA 4X3UA 1DD2A 3KUPA 4OEMB 1G291 3X3NA 1I6HH 1G2SA 4ODGA 1BF4A 1E1OA 1YHBA 2J0TD 4KTAA 3BDLA 4OGQC 2RCNA 4QF4A 2F0PA 4FXDA 2H4OA 1M90C 3GTJB 2CQAA 1LTGD 4LF7Q 5CV7A 2OTJA 4XT3B 1GO3E 1BCPF 2PYKA 3EVQA 4LF8Q 4EQNA 4L5QA 1Q46A 2NB0A 1EIFA 2FINB 4X3TA 1ZYRD 1VQEA 1TY2A 1TS5A 2R61A 5M3FG 4LF7L 1SE8A 2ZTEA 5IP7G 2M00A 1GUSA 3PUZA 5IT9L 4LF8L 1GVPA 3NENA 4R4OA 4GOPA 4A3FH 2E74C 4A3IH 3F1ZA 2TSSA 4KMUC 5KGUA 4DV5Q 1CKOA 4XQJA 1B3AA 1DZ1A 4FF3A 3K57A 1EOVA 2HT1A 4FO2A 1B53A 1H9MA 2NVQH 1IL2A 1IYJB 4OX9Q 4DV5L 1KAWA 3CC4A 1QVGA 1H9SB 4HIMA 4QJFA 4IOCA 2MPMA 2EDGA 2WB1G 1E7ZA 1Y1VB 5GADC 4DAYA 5FJ8H 4IUQA 4OX9L 2K5HA 3TP5A 1WCMG 3EN2A 3I73A 4POGA 1Q8KA 2JJQA 3DWAA 4A3BG 4PMWA 1R9TH 3SHLA 2SNMA 3L2PA 4HCSA 5JEAG 4KK7A 3E5SA 1PH3A 5JVG3 1YHAA 4UHVA 1UWVA 2F4IA 3F2DA 3K59A 1H9RA 3SK5A 4RHSA 5IYDH 1D5ZC 4IN3A 2ATWA 3CC7A 4WJWA 2E2HB 1PRTD 1CM9A 2BH8A 3PIOA 4OELB 4L5RC 3J80E 5EPJA 2F0HA 4ZKCB 4HMJA 3I4NG 2V4DA 5C44G 4JI1Q 3HOXH 4QGUA 1VQMA 2KOLA 4GOPB 1HPCA 4ZAIA 1QB5D 3PO2H 3FKIH 3GTOB 1KABA 1N34Q 3K6OA 3DM1A 1O78A 3U4VA 1EQQA 1S4ZA 4JI5Q 1JOQA 3UDFA 3OMCA 3NBHA 4DR4Q 4JI1L 1E2WA 2B2YA 3OW2A 2YTXA 1Q1EA 4PQXA 4LF6Q 1N36Q 3K7UC 1F2LA 3BU2A 5LL6X 1N34L 2EPBA 1LACA 1WTQA 4JI5L 4DFAA 5E1FA 2CHBD 3UE1A 1NSNS 2V1CC 2JK8A 4DR4L 5FLXE 4C3IB 4LF6L 2DN8A 2WB1E 3KBGA 3NK9A 1BKBA 1J9OA 1N36L 1YI2A 1EQVA 3MXNB 2VQEQ 1YITA 3HOYH 2Z1CA 1KRTA 2OT2A 1XPUA 4I7AA 4JBKA 3C46A 5FLMH 4QIWB 1TS4A 2PW5A 1V43A 2L9HA 4YIJA 3R2TA 2PNRC 3SR1A 2VQEL 5EKKA 2PI2E 5EGTA 1STHA 4DV7Q 1SROA 3ONAB 1JJCB 3HGBA 4GLAC 1V8QA 1Y8NB 3T51B 4OO1H 4A76A 2NVYB 3FVQA 1EYDA 3IAYA 2RDHA 1FJGQ 4HR7B 4UP8A 4ALPA 3ND8A 3STBC 1QUQB 4DV7L 1VQCA 2K7VA 3CCSA 4IFDI 1UEBA 4DAPA 4C3JH 4CBVA 1BNZA 1VCIA 4ME3A 1HTLD 4DR7Q 5ELDA 3G6EA 2X6LA 4DXFA 1FJGL 1T9HA 4F8MA 2F52A 3A8IE 4DU9A 1KD1C 2NVTH 1KQSA 1ENCA 1GHJA 3S15B 2Q8IB 2AMCB 3P75A 4DR7L 2DUDA 5M5WH 4BY7H 1CKNA 1ML0D 2ICIA 1OXSC 2O4XA 4BBSB 2LMCB 3EROA 4A3LH 3KF8A 3OHXC 4J1MA 3VA5A 1KL9A 4LMQD 4DGZA 2BH2A 4J6HA 1F2YA 1QVCA 2SOBA 3S1NB 3QOLA 2IX1A 4B9WA 3MA2B 1KAAA 4ME5A 3PIPA 4DV2Q 5A2QL 1LTAD 4Z9CB 5D3IB 2FMCA 2CWPA 5M3FB 1L0XB 5ELNA 1IBLQ 1WTXA 1E2VA 2F0UA 4DV2L 4A3FG 2O5JC 2IX0A 2PZWA 3S1QB 1EU3A 4OHJA 5CV4A 5ELOA 2E2IH 1WYDA 1GUGA 3K7AB 1D5MC 2EYFA 1I4QA 1IBLL 2F0DA 2D9UA 1KRSA 3KLSX 5EKIA 1F9RA 5NUCA 5JOBA 1RJTA 4KY5A 1SBBB 1E1TA 1X3EA 3SGIA 1I4HA 1G6PA 2EYPA 2R7DA 1S5DD 4DK1A 5FJ8G 2HDMA 2R93B 3S17H 3E3XA 1LABA 1GUTA 3G48A 4C56C 3HOUB 1QNKA 3OOCA 2L1BA 1FVIA 3H91A 1YEZA 1CKNB 4A3BB 4G7HC 4A93B 4AH6A 1RCVD 4P2CB 1BXTA 4JBWA 1STGA 1U4LA 4N9PA 4JPBW 3KF8B 3GV3A 4LJZC 4LUZA 2LSSA 1QZGA 3VYTA 2KHIA 1QILA 1TVXA 4L6TB 3GTMH 1XYIA 1N33Q 3H09A 1UUPA 3QJYA 3PF5A 4DNRB 5IYDG 3H15A 4A3CH 1A2TA 5LMNW 2GVBA 1AE2A 1OXTA 4X3KA 4GOPC 1SNPA 1BUVT 3LNNA 2AQ2B 1M8AA 3ND9A 3HOWB 1N33L 1EU4A 1TWHH 4OWXB 3F2BA 2L12A 1JB3A 3KDFB 1KTKA 1N8RC 4NMZA 1GKHA 5CBAE 4A3JH 5IT9E 5KYLA 1QVFA 3PO2G 3FKIG 1U5KA 2RQXA 3K81C 4IO9A 1FNWA 1A3VA 4YWMA 1LTLA 2QEJC 5C3XA 3M7NA 2P5ZX 2K75A 2F0WA 3OSOA 1VQ5A 3M4OB 3MZ5A 4BY1H 4UP9A 1SNDA 1EFWA 3JAME 2Z6KA 3TMEA 2JQOA 3UDXA 4MN3A 1YBYA 1E22A 3MXPA 5KNCA 3IL8A 1DONA 1TT2A 2KA7A 3RZOB 2PZUA 3HOYG 2KHSA 4GN5A 2EXZA 3NUCA 3NTHA 5FLMG 5ELCA 4FNFA 1PYSB 2A8VA 1ASYA 1B1ZA 2F0GA 2F0FA 1HZBA 2K03A 3QOJA 4A3EB 3K0YA 1LT6D 1TWGB 3GTPH 2D62A 1Z9FA 2HD3A 4OO1G 1H95A 5ISRA 1L1OA 2YTVA 2RHSB 5C5MA 4K2LA 3AEVA 2JEAI 2XRSD 4PNYA 4FF1A 2Y0SB 5HURA 3ICEA 4Q0FA 4RAUC 1HR0Q 2IHFA 1TWAB 1PFBA 4C3JG 2EXDA 5C4XH 5J39A 3I4MB 2OCEA 4RFBA 2B2YC 4IPCA 2QA4A 2F4VQ 1Y1WH 3R3OA 2WV6D 4HSVA 3F2CA 3MXUA 1PFNA 2D0PA 1I50H 3NPPA 4Y52H 1EY9A 4BY7G 2QILA 1O7ZA 4P75A 4TVAB 3D8GA 2F4VL 1K8AC 3MEFA 2KEEA 4A3LG 3SK4A 1PXUA 2QGQA 5I9OA 2EYHA 3I70A 3AFPA 2PQEA 1R4PB 3CRLC 4ILWA 2GN5A 2EY6A 1QNUA 2PO4A 1K0SA 1PRTF 2RSNA 4V190 3BZDB 3UDIA 2EYOA 1EY8A 1ILQA 4HTHA 2UUAQ 1RKNA 1FL0A 5DM73 4JBJA 2A1AA 4BBRH 3E9HA 4RCOA 2K4KA 2N88A 1IKLA 1UAPA 3AB9A 4O2DA 5IP9H 2ZM6Q 4XT1B 4EQ5A 3F2UA 1D5XC 1HTPA 2EY1A 2UUAL 4PZ8A 5IGGA 1TWCH 3SXHA 3C3LA 2EYJA 4X66L 1L1OB 3MHBA 1KIXA 1XWEA 2F03A 2MO0A 4AYBG 2ZM6L 4A3GB 2ZT9C 1HFGA 4DR3Q 1WD0A 1SRUA 1W2BA 3F8TA 5GAGC 2YU9H 5DNFA 4CDFC 1KDAA 3TREA 3QG1A 2AWOA 1CA6A 3QR8A 4DR3L 2JA6H 2O5IC 1LTSD 1Q81C 4ZRZA 3UDGA 3VR6A 4JI3Q 2VS1A 3I2ZA 1CSPA 2B63B 2DJFC 4APVA 2JSOA 1PTOF 1JOKA 1XXGA 1LUZA 4ULLA 3LWUA 3HOZB 1X32A 2KUMA 3ZJYC 2JA5B 4QY7A 3R8BA 4JI3L 4G7ZC 1Y69U 5FK9C 1WFQA 5C5LA 2L55A 5M5YH 5IGDA 4A3CG 4JBMA 5DAUA 1QZHA 3J81c 2ZXOA 1AP0A 2LS01 2F0MA 3GV6A 1DJRD 4XTCS 4GS3A 1I3QB 3PUVA 1CSQA 4TRDA 1JICA 1A62A 4R8IA 4OWWB 2FFKB 1Q8IA 2AWNA 1ZEQX 4A3JG 2HQLA 2N49A 3JC66 1OXUA 1HRJA 1PH5A 4MNOA 3I90A 1SNQA 2BA0A 1EL0A 5I6WA 5C3WA 1CQFA 1BVSA 3A74A 4ZYSA 1MHWC 4OIKA 2EIFA 2VUMH 4JCVE 3VR3A 1PTOH 5KEEA 3TQYA 2N78A 5G3LD 1D8LA 1PZKD 1V1OA 1RD9D 4KJOA 2LKVA 2PMZB 1EYAA 4DR5Q 2LXKA 4DR6Q 3NWTA 3Q0AA 4A3KB 5CV5A 3I7FA 3S14B 4G4KA 1SE3A 3DWPA 4GLVB 3PO3H 4DR5L 1I6VC 4FVMA 4DR6L 1SE2A 3TSSA 4IFDJ 1HXYD 4PMBA 1CKMA 1SXTA 2A73B 2XWBB 1SDFA 3AYHB 2I5MX 1HUMA
chains in the Genus database with same CATH topology
2XIWA 4BWGB 5M9OA 1Q1BA 4KKSA 3E6ZX 1I4XA 2AQ3B 3DEPA 3S2DB 3HEJA 4PMCA 2M9VA 3V05A 2NN6I 3NHHA 5LHY1 1T5EA 5FOBB 3IFDA 1M4VA 3MC0B 4FXKC 5FO7B 4CHTB 5I4DA 4FP5D 1SFOB 3S1MB 1SYEA 2KEDA 3CRKC 5BN4A 2RBMA 1K8OA 1JWUD 3VYRA 4KJNA 1PZID 4H44C 1G91A 3BDOA 3KLRA 1D6EC 2G9HD 2QDBA 2H1EA 2B39A 5DM63 3A54A 5ELEA 3TP7A 1SJED 2JA7B 3NQIA 4IQZA 2F0OA 3HS0C 3HOVB 2J4XA 2OF1A 2QKIC 2K5WA 2IPKD 3QO2A 4IZ8A 4KD3A 4CKCA 4U673 4CJ0B 1Z6HA 1CTMA 4QUFA 2A74C 3H0GB 4OL7A 2WKCA 1JE4A 1IW7C 2R7ZB 2KCNA 1LTBD 5CGKA 5COYA 1GXDC 1LO5D 4RGNA 1MSHA 4IFDH 5M3MB 1CI3M 5EBDA 3CKIB 2FHTA 3FMCA 1GUNA 4LK1C 2O2LD 2IWHA 1F77A 1LTTD 1KNEA 3VR2A 1DXMA 1SNCA 4QB4A 1LT5D 1UNSA 1EY4A 1JQYD 3PUXA 2B2VA 1HCZA 1C8CA 2K28A 2RA4A 3BDCA 1FD7D 4WRDA 4ABNA 1PYWD 1VMPA 1A2UA 1CFMA 1Q3LA 1OXXK 5CYUA 1TS2A 2XWJB 3GTLB 1AN8A 2E2DC 2B8GA 4C1NK 4C2MB 2F0VA 4A3MB 5EPLA 3IKJA 3BYTB 1STBA 5T1GA 2PPBC 3SEBA 3LWEA 1EY5A 3BG3A 4IUPA 1NUCA 1B9MA 2B2UA 3FDTA 1TWFB 3S9WA 4C3HG 4MHEA 4BS9A 3D31A 3S1RB 1SYCA 4QCLA 1TS3A 3G6JB 1CK1A 2KECA 3SE0A 1XX8A 5KNDA 3QIAA 2D5DA 1U4RA 2L11A 4IUUA 4KKTA 2PW7A 1VDZA 4K2KA 3GO5A 3KLSA 1QE6A 1BOSA 1IYVA 2YYZA 2F0NA 5EKLA 1TIID 1WTPA 5M5XB 4A3DB 3T56B 1KLUD 4CKBA 4KHZA 5CC4A 2WACA 4Q5VA 5C0XI 1DM0B 2EY5A 3OW7A 1GUOA 3N52A 5JAVA 3GTGB 2B2WA 1S5FD 1S5CD 3U9OA 1AZQA 3ERQA 2R6GA 2WB1B 2AUKA 3TDQA 5IIFA 2RDGA 1ONLA 1WCMB 1U4PA 1JOOA 2B2TA 1KDBA 3TZDA 3J81L 1K83B 1X3PA 2K5QA 1WTRA 1JWSD 2JEBI 2MUYA 1TY0A 4KV6A 2CVRA 1ILPA 4R8NA 2GA4B 2QCPX 4EVOA 2Z8LA 3AU7A 5E3FA 1T5XD 5F2DA 4U68A 1Y8OB 2Q8TA 4ZUJA 3DHQA 2BDOA 2R3ZA 1F9SA 3A56A 2JP1A 3MEHA 3I4NB 5C44B 1DYQA 4BA2I 1CQVA 2E75C 3M3YB 3CQZB 3HZXA 3S2HB 3O13A 4G57A 4IFDG 1NAPA 5KIXA 1F2ZA 1B50A 1IW7D 2L0CA 4IURA 3GQBA 3CHBD 3D3RA 3MFYA 4H13C 3GTKB 1I4PA 1MGSA 3OWFA 2RVLA 3A8JE 4RGOS 3RMHA 1AW7A 2K05A 5CORA 2DNCA 3TP8A 4KY6A 4X3SA 1EIHA 1O7YA 4GZYC 5J22A 3NWSA 5I9PA 4BA1I 4EGVA 5CV8A 3TN2A 4FF2A 2IJ0A 3HP3A 4XXEA 3W3AA 2F0JA 1V1PA 1BR9A 1ENFA 1QOHA 2Z4HA 2E76C 1II3A 1SEBD 3GTQB 2EJMA 2F0QA 2EZVA 2M2LA 3MWYW 4H0LC 1W6KA 4OIJA 1E0BA 1XTCD 2B8FA 1STAA 2LY7A 5KRUA 5EQ0A 1QWYA 2I46A 2AQ1B 2SEBD 4KD4A 4XYOA 1U4MA 5JPNC 1LLRD 1BDOA 1I6HB 1JWMD 3I4LA 3NTKA 1SJHD 2J7ZA 3SK6A 1BQQT 3ITPA 1H9KA 1EOTA 3D6CA 1AZPA 5I2YA 4KKUA 4FF4A 2DNEA 2CW0D 1AFPA 3C2PA 4N9TA 3R2IA 3D4WA 4A3FB 1V1PB 4ID6A 4A3IB 4V0BA 1RODA 2C9OA 2RKSA 3I91A 1F9PA 4WFN3 5FO8B 5CR3A 1H9JA 2I07B 1IYUA 3P1HA 1DOKA 1B9NA 4K6DA 2OEOA 1EEFD 3OMGA 1MD2D 1SE4A 2KJXA 4IALA 2HDLA 4EQOA 3H3VC 1JC7A 3NTIA 2F0SA 1BCPB 2D2CC 2NUCA 1R9TB 3CU7A 3BVZA 5K36H 1AEXA 1HFNA 3BYYB 4IUVA 4CGYB 4MIUA 3URYA 1Q90A 1TR5A 5IGCA 3OWEB 2Q8RE 2TMPA 1A15A 4J8QA 5A2QE 4UDUC 3M85A 1ICWA 3HOXB 1HHVA 3KBXA 4TQUS 1EFID 5D3DA 3PO2B 4L8JA 3FKIB 4HCEA 1IHZA 2ZXRA 3MFGA 4C1NI 3J7YW 4DA2A 4TKOB 1STNA 1TKWB 1Q12A 5J1ZA 2B2TC 3IFTA 2NYZD 1VMCA 5EPKA 2NN6H 1ET6A 5CBEE 2X6GA 4HAEA 1GJXA 3HOYB 3QWNA 5E4WC 3Q24A 1WTOA 2A5HA 1JR0D 4I65A 5ELFA 3J81E 3GP7A 3L7ZC 4I7ZC 3A8KE 1EWCA 3EFXD 2PZTA 3DMUA 4B08A 2K5DA 1HA5A 4RH6A 2F3VA 3WOFA 2WKDA 1YNJD 2MHVA 4M8AA 4DXGA 4C3JB 1EZ8A 5KNBA 1PZJD 1QG7A 1EY6A 4HMIA 2OXPA 5IGFA 4K5XA 2BA1A 3TP6A 1S5ED 4NKLA 2NVTB 1KLGD 1JORA 5M5WB 4BY7B 1EY7A 3R93A 2A6EC 4KI0A 4ZK9B 1FNVA 4DNTB 1NR2A 2K1BA 2KQ3A 3FPPA 2KVMA 1LTRD 3DXJC 3K5MA 3EQLC 1FR3A 4KN7C 2VXWA 3H6MA 4K14A 5CV6A 3A7AB 1O80A 1EY0A 4RWSC 1CA5A 2EVBA 3PV0A 4HEDA 5C0XJ 1SYFA 2E2IB 4IUNA 2EE1A 4KY7A 4AYBB 3JAML 1QJOA 4RKBA 1DOMA 3I3CA 2XSCA 3L9AX 1HQRD 2EY2A 5D65A 1BCPC 1SYBA 3T4AC 3S17B 2K32A 3MXNA 1S5BD 4NDXA 5T1IA 3UI2A 2SNSA 2FMMA 3LX0A 2DY8A 5K36G 1SSOA 4O42A 1U9RA 1RHPA 4K8IA 2HCCA 2ICEC 4F88A 3L3OC 2HQEA 2DY7A 2F0IA 3GTMB 3VYUA 1E2ZA 3K5NA 3M7GA 2Z4IA 3Q6SA 1Z7TA 1EWHA 1TWHB 1Y8PB 5IOCA 5BN3A 3M4YA 1TU2B 3AMUA 4A3JB 2WINB 1G2TA 1EZ6A 1DOLA 4H7BA 3HRZC 3NQTA 2JE6I 4RCNA 1HUNA 4FXGC 4CJ2C 4BY1B 4KHVA 4K6LA 1PDQA 4RGMA 1EIGA 5DEHA 5IGBA 1YNND 4E6IA 4NW2A 2NN6G 5CV9A 4WORA 1SMYC 3GTPB 1D1KA 1PTOD 1RTNA 3D4DA 2EYMA 5C0XH 4O1NA 1CT1D 1BBXC 2XNAC 3KK7A 2VB2X 2QF7A 3A7LA 3D6WA 4KN4C 2N55A 1ENAA 4NP5A 5C4XB 1I4GA 4XIGS 2A6HC 2CW0C 2KCCA 1Y1WB 1NR4A 5K5PA 1I50B 1D1IA 3K58A 5BN5A 2SDFA 3NSWA 2WIIB 2RDFA 1B44D 2MP1A 1MI2A 3DEOA 3VR4A 2A69C 3NBIA 1A6XA 2BE5C 1IKMA 4F87A 4TSSA 2K6AA 1C4QA 4K5WA 4FYDA 5D14A 2A6ED 3NE5B 4BBRB 2NWGA 2A68C 1WTVA 4OO1I 3GD7A 5JJZA 4ZUIA 1ESFA 1TWCB 3J7AF 3FPUB 1LTID 1NCVA 1D2BA 2IL8A 4DK0A 5G3LF 2YU9B 3QB3A 2BOSA 2F1MA 3ZYYX 1UEAB 3W2DA 1I4RA 2JA6B 4K8JA 1ZKOA 2JYOA 3K5LA 1SAPA 1WVLA 3RLFA 3MVVA 1PRTB 3G7LA 2ID0A 3I8ZA 2ENBA 3V96A 2EJGC 2X69A 1QCBD 4B9XA 1BCPD 1FNUA 5M5YB 4XYQA 3X3MA 1B4OA 1SNMA 5AFWA 4RA8A 3Q23A 1JCKB 2IT1A 3V2TA 3OIPA 2F0EA 1F2MA 3VR5A 4L63B 2EJFC 1ESRA 5FO9B 1G8ZD 1CZGA 2F0LA 2K33A 3WDNA 5C6AA 4EQPA 3NXWA 1FYCA 1ZXTA 2K01A 4M1UB 2JXMB 2WAQB 5CMDA 2RSOA 5JEAJ 2VUMB 1PTOB 1YNJC 2HCIA 2XRQD 2IX3A 2AUJD 4ZKBB 1LT3D 2C5CA 2L5TA 5I6YA 1WTWA 4DF7A 3RD4A 3C1EA 1OO9B 4JK1C 1WD1A 5C4HA 3PO3B 4K5VA 3Q22A 1SMYD 4UAIA 1Z47A 3MXGA 3E0JA 5C0XG 3H94A 1STYA 3PIO3 5C4ZA 2XVSA 3SDZA 3DWQA 2EOTA 1X3QA 2R92B 3FRPB 3NP8A 1ZYRC 1LT4D 3RZDB 5IGEA 4C3HB 4ZQ3A 3EA6A 1A3UA 3WOEA 2B2VC 3RUZA 3PUYA 5HGTA 5E4XA 1IL8A 3J80L 1C48A 1GHKA 2VNUD 3EJIA 4Y7NB 3P20A 2MGSA 2A6HD 3BVGA 5LL6S 1SYDA 3TZUA 5TSSA 4LAAA 4R9WA 4QUCA 3I72A 3D4RA 2HUGA 3DUZA 2NVQB 2BDNA 3U9SA 5JPMC 3HKZB 4HSPA 5KYIA 4DAVA 2A69D 2NTTA 5FLXL 4S3SA 2MJ8A 2BE5D 1LV9A 4XQNA 3T53B 2B2UC 5IODA 2F0KA 3TBIB 3T16A 2IW3A 1RF2D 3T13A 1MBYA 1EQTA 3S16B 1SYGA 2A68D 1BO0A 3A55A 2NVXB 4XDXA 5C3EB 1PRTC 1VF5C 3PUWA 1MSGA 3OPOA 3J7AV 3VA7A 3K5OA 2FJ2A 5JEAH 2L4NA 2ZXPA 1DCZA 1J8IA 1ET9A 1B2TA 1EEID 4HN7A 2WP8J 4ZLTF 5JVH3 1K8MA 1OXVA 2NBFA 5C4JB 1O7LA 1CHQD 3MAQA 2NTSA 1VF7A 2BCOA 3PIP3 1YNNC 2B2WC 4G7OC 2LFNA 1SNOA 3OIQA 4QMGA 4CKEA 1HA6A 1GUWA 3PMFA 2JA8B 4RGTA 1W6JA 2XN9C 1PLFA 2G9DA 1A3TA 2F0TA 4C3IG 1PTOC 4RKLA 2E2JB 2K04A 4PV1C 4IUTA 1FGBD 1RDPD 1KNAA 3FEWX 4CJ1B 5ELBA 3SVMA 1EYCA 5FKAC 4XQQA 1G6ZA 3BVMA 5A35A 3VYSA 1L0YB 1F9QA 1PFMA 3SK8A 4DN4M 5I2XA 1KDCA 1HQMC 3HG9A 4F7XA 2F3WA 2EYLA 1R4QB 1GOZA 3N6RA 3P7JA 1H9SA 1STEA 1PMRA 2PCFB 5EJWA 1CHPD 2VB3X 1RTOA 4RHRA 2NZ1D 5EBCA 3C1FA 1CZWA 3BS1A 1TQOA 4X3UA 3MTSA 1DD2A 3KUPA 1G291 3X3NA 1G2SA 4ODGA 1BF4A 2J0TD 4KTAA 3BDLA 4OGQC 4QF4A 2F0PA 4FXDA 2H4OA 3GTJB 2CQAA 1LTGD 5CV7A 4XT3B 1BCPF 2PYKA 3EVQA 4EQNA 2NB0A 2FINB 4X3TA 1ZYRD 1TY2A 1TS5A 2R61A 2M00A 1GUSA 3PUZA 5IT9L 2E74C 2TSSA 4KMUC 5KGUA 4XQJA 1B3AA 1DZ1A 4FF3A 3K57A 4FO2A 1B53A 1H9MA 1H9SB 2MPMA 2EDGA 1Y1VB 4DAYA 4IUQA 3TP5A 3I73A 3DWAA 4PMWA 3SHLA 2SNMA 4HCSA 5JEAG 4KK7A 3E5SA 5JVG3 2F4IA 3K59A 1H9RA 3SK5A 4RHSA 1D5ZC 4IN3A 4WJWA 2E2HB 1PRTD 1CM9A 3J80E 4ZKCB 2F0HA 5EPJA 4HMJA 2V4DA 2KOLA 1HPCA 4ZAIA 1QB5D 3GTOB 1KABA 3K6OA 3DM1A 1O78A 1S4ZA 1JOQA 3OMCA 3NBHA 1E2WA 2B2YA 1Q1EA 4PQXA 1F2LA 5LL6X 2EPBA 1LACA 1WTQA 4DFAA 5E1FA 2CHBD 1NSNS 5FLXE 4C3IB 2DN8A 3KBGA 3NK9A 1J9OA 1EQVA 2Z1CA 2OT2A 3C46A 4QIWB 1TS4A 2PW5A 1V43A 2L9HA 4YIJA 3R2TA 2PNRC 3SR1A 5EKKA 5EGTA 1STHA 3ONAB 3HGBA 1V8QA 1Y8NB 3T51B 4OO1H 2NVYB 3FVQA 1EYDA 3IAYA 2RDHA 4HR7B 3ND8A 2K7VA 4IFDI 4DAPA 4CBVA 1BNZA 1VCIA 1HTLD 5ELDA 2X6LA 4DXFA 4F8MA 3A8IE 4DU9A 1ENCA 1GHJA 3S15B 2Q8IB 3P75A 1ML0D 2ICIA 1OXSC 2O4XA 4BBSB 2LMCB 3EROA 3KF8A 3OHXC 4J1MA 3VA5A 4LMQD 4DGZA 4J6HA 1F2YA 2SOBA 3S1NB 3QOLA 2IX1A 4B9WA 3MA2B 1KAAA 4ME5A 5A2QL 1LTAD 4Z9CB 5D3IB 2FMCA 5M3FB 1L0XB 1WTXA 1E2VA 2F0UA 2O5JC 2IX0A 2PZWA 3S1QB 1EU3A 4OHJA 5CV4A 1GUGA 3K7AB 1D5MC 2EYFA 1I4QA 2F0DA 2D9UA 3KLSX 5EKIA 1F9RA 5NUCA 5JOBA 1RJTA 4KY5A 1SBBB 1I4HA 2EYPA 1S5DD 4DK1A 2R93B 2HDMA 1LABA 1GUTA 4C56C 3HOUB 1QNKA 3OOCA 2L1BA 3H91A 4A3BB 4G7HC 4A93B 1RCVD 4P2CB 1BXTA 4JBWA 1STGA 1U4LA 4N9PA 3GV3A 4LJZC 3VYTA 1QILA 1TVXA 4L6TB 1XYIA 3H09A 1UUPA 3QJYA 4DNRB 1A2TA 4X3KA 1OXTA 1SNPA 1BUVT 3LNNA 2AQ2B 1M8AA 3ND9A 3HOWB 1EU4A 2L12A 1JB3A 1KTKA 4NMZA 5CBAE 5IT9E 5KYLA 2RQXA 1FNWA 1A3VA 2QEJC 5C3XA 3M7NA 2F0WA 3OSOA 3M4OB 3MZ5A 1SNDA 3JAME 3TMEA 4MN3A 3MXPA 5KNCA 3IL8A 1DONA 1TT2A 2KA7A 3RZOB 2PZUA 2KHSA 2EXZA 3NUCA 3NTHA 5ELCA 4FNFA 1B1ZA 2F0GA 2F0FA 2K03A 3QOJA 4A3EB 3K0YA 1LT6D 1TWGB 2D62A 4OO1G 5ISRA 5C5MA 4K2LA 2JEAI 2XRSD 4PNYA 4FF1A 2Y0SB 5HURA 4Q0FA 4RAUC 1TWAB 1PFBA 4C3JG 3I4MB 5J39A 4RFBA 2B2YC 3R3OA 2WV6D 4HSVA 3MXUA 1PFNA 3NPPA 1EY9A 2QILA 1O7ZA 3D8GA 2KEEA 3SK4A 1PXUA 5I9OA 2EYHA 3I70A 2PQEA 1R4PB 3CRLC 4ILWA 2PO4A 2EY6A 1QNUA 1PRTF 2RSNA 4V190 3BZDB 2EYOA 1EY8A 1ILQA 4HTHA 1RKNA 5DM73 4RCOA 2N88A 1IKLA 1UAPA 3AB9A 4XT1B 3F2UA 1D5XC 1HTPA 2EY1A 5IGGA 3SXHA 3C3LA 2EYJA 3MHBA 1XWEA 2F03A 4A3GB 2ZT9C 1HFGA 1WD0A 5DNFA 1KDAA 3QG1A 2AWOA 1CA6A 2O5IC 1LTSD 4ZRZA 3VR6A 2B63B 2JSOA 1PTOF 1JOKA 1XXGA 4ULLA 3LWUA 3HOZB 1X32A 2KUMA 2JA5B 3R8BA 4G7ZC 1Y69U 5FK9C 5C5LA 2L55A 5IGDA 5DAUA 2ZXOA 1AP0A 2LS01 2F0MA 3GV6A 1DJRD 4XTCS 1I3QB 3PUVA 4TRDA 1JICA 4R8IA 2FFKB 1Q8IA 2AWNA 1ZEQX 1OXUA 1HRJA 3I90A 1SNQA 2BA0A 1EL0A 5I6WA 5C3WA 1CQFA 4ZYSA 4OIKA 3VR3A 1PTOH 5KEEA 5G3LD 1PZKD 1V1OA 1RD9D 4KJOA 2LKVA 2PMZB 1EYAA 3NWTA 3Q0AA 4A3KB 5CV5A 3S14B 4G4KA 1SE3A 3DWPA 1I6VC 4FVMA 1SE2A 3TSSA 4IFDJ 1HXYD 4PMBA 1SXTA 2A73B 2XWBB 1SDFA 1HUMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EY2 A;  3QOJ A;  5IGE A;  2RKS A;  4ZQ3 A;  5NUC A;  5JOB A;  1A3U A;  3NK9 A;  1SYB A;  4B9X A;  5CGK A;  2PW7 A;  2M00 A;  4I65 A;  4KY5 A;  3OWF A;  5M9O A;  1EQV A;  3RUZ A;  3PMF A;  4K2K A;  1JOK A;  5HGT A;  5ISR A;  5KGU A;  1ENA A;  4NP5 A;  5C5M A;  4K2L A;  2EYP A;  4KY6 A;  3TP8 A;  4NDX A;  2PW5 A;  2SNS A;  4PNY A;  5CR3 A;  1SNM A;  3HEJ A;  4YIJ A;  1A3T A;  3EJI A;  4PMC A;  2F0T A;  5HUR A;  2F0N A;  3LX0 A;  5EKL A;  3P1H A;  3SR1 A;  5J22 A;  2PZT A;  5K5P A;  3NHH A;  4K6D A;  1U9R A;  3DMU A;  5EKK A;  5C5L A;  2OEO A;  5I9P A;  4K8I A;  4RKL A;  5EGT A;  5J39 A;  1STH A;  5IGD A;  5CV8 A;  3OMG A;  1SYD A;  5CC4 A;  3V2T A;  2HQE A;  5DAU A;  2F3V A;  2WAC A;  2F0I A;  4LAA A;  4IAL A;  2F0J A;  2EY5 A;  1SYE A;  3R3O A;  1STG A;  4N9P A;  4EQO A;  5JAV A;  1EYD A;  2F0M A;  1EZ8 A;  2RBM A;  2F0E A;  3U9O A;  1EY6 A;  2F0S A;  1F2M A;  4HMI A;  4TRD A;  1SNC A;  1EY9 A;  2RDF A;  4KJN A;  1II3 A;  1EYC A;  2NUC A;  2OXP A;  3ERQ A;  4QB4 A;  1EY4 A;  5IGF A;  3TP5 A;  4K5X A;  1AEX A;  3D8G A;  3TP6 A;  2F0L A;  4NKL A;  2QDB A;  2F0Q A;  5C6A A;  4EQP A;  1A2T A;  5KYI A;  3NXW A;  3SK4 A;  5IIF A;  3SK8 A;  5I9O A;  4MIU A;  1KDC A;  1SNP A;  2EYH A;  4S3S A;  5IOC A;  4F7X A;  2F3W A;  3SHL A;  4F8M A;  1JOR A;  2EYL A;  1EY7 A;  1TR5 A;  2PQE A;  2SNM A;  3BDC A;  4WRD A;  4DU9 A;  5IGC A;  1SNQ A;  1JOO A;  1EZ6 A;  5IOD A;  1STA A;  5I6W A;  2EY6 A;  1ENC A;  1KDB A;  4K5W A;  2F0K A;  3TP7 A;  5KRU A;  3E5S A;  3P75 A;  4H7B A;  3T16 A;  5C3W A;  3T13 A;  3NQT A;  1SYG A;  1A2U A;  4KD4 A;  2EYO A;  1EY8 A;  4NMZ A;  4HTH A;  5KYL A;  2F0O A;  2O4X A;  2KQ3 A;  4ZUI A;  3SK5 A;  1RKN A;  5I6Y A;  4KV6 A;  4KHV A;  3ERO A;  5KEE A;  1A3V A;  4J1M A;  3VA5 A;  4DF7 A;  2OF1 A;  4DGZ A;  5C3X A;  3C1F A;  4R8N A;  5E3F A;  5DEH A;  4EVO A;  2F0W A;  3OSO A;  5IGB A;  1TQO A;  2F0V A;  2F0H A;  3MZ5 A;  4IZ8 A;  4J6H A;  4HMJ A;  1F2Y A;  4KJO A;  5F2D A;  3H6M A;  2SOB A;  4K14 A;  3SK6 A;  3C1E A;  4E6I A;  2EY1 A;  2LKV A;  3QOL A;  1IHZ A;  5CV9 A;  1SND A;  4B9W A;  1EYA A;  4ZUJ A;  5IGG A;  1STB A;  1KAA A;  3DHQ A;  4QMG A;  5CV6 A;  4WOR A;  4ME5 A;  3TME A;  5C4H A;  1EY0 A;  4ODG A;  4K5V A;  3SXH A;  3ITP A;  2EYJ A;  1EY5 A;  1STN A;  3MEH A;  3MHB A;  3MXP A;  4KD3 A;  1KAB A;  3BDL A;  4KTA A;  1TT2 A;  5CV5 A;  1STY A;  1SYF A;  3D6C A;  4QF4 A;  1JOQ A;  1NUC A;  2F0P A;  3QB3 A;  3OMC A;  5J1Z A;  5C4Z A;  2PZU A;  4IUN A;  2KHS A;  2F0U A;  2EXZ A;  3S9W A;  5CV7 A;  3HZX A;  4K8J A;  2PZW A;  3NUC A;  4KY7 A;  4G57 A;  4OL7 A;  2PYK A;  5CV4 A;  3EVQ A;  4PMB A;  1KDA A;  4EQN A;  5KIX A;  3NP8 A;  1SYC A;  4RKB A;  3MVV A;  4N9T A;  2EYF A;  1F2Z A;  5E1F A;  4DFA A;  3D4D A;  2F0G A;  1NSN S;  1SNO A;  2ENB A;  3D4W A;  2F0F A;  2F0D A;  4ID6 A;  2EYM A; 
#chains in the Genus database with same CATH topology
 5C4X G;  1HJP A;  2XIW A;  2R92 H;  4BWG B;  5M9O A;  1VQH A;  1Q1B A;  4KKS A;  3E6Z X;  4JI7 Q;  1Y1W G;  3RZD H;  5GRO A;  2Z6K C;  4C3H H;  4HJA A;  1I4X A;  2AQ3 B;  3DEP A;  5J3B A;  4ZCK A;  3S2D B;  3HEJ A;  4PMC A;  2M9V A;  3V05 A;  2NN6 I;  2HHH Q;  1VQO A;  3NHH A;  5LHY 1;  1T5E A;  4JI7 L;  5FOB B;  3IFD A;  2ASB A;  1M4V A;  1NY4 A;  3MC0 B;  4FXK C;  5FO7 B;  1X65 A;  4Y7N H;  4CHT B;  5I4D A;  4FP5 D;  1SFO B;  3S1M B;  4UPA A;  3LGJ A;  1SYE A;  2KED A;  3CRK C;  1K73 C;  5BN4 A;  2HHH L;  2RBM A;  1K8O A;  1PH9 A;  1JWU D;  3VYR A;  1WI5 A;  4KJN A;  1PZI D;  4H44 C;  4A3D G;  5E7N A;  1HH2 P;  1G91 A;  3BDO A;  3KLR A;  1D6E C;  2G9H D;  2QDB A;  3KF6 A;  2H1E A;  2B39 A;  4BBR G;  2KCM A;  1L1O C;  3I56 A;  5IP9 G;  2F3I A;  5DM6 3;  3A54 A;  5ELE A;  3TP7 A;  3ULL A;  1SJE D;  2JA7 B;  3NQI A;  1PV4 A;  4IQZ A;  2F0O A;  3CD6 A;  5JJK A;  3HS0 C;  3CMA A;  3HOV B;  5HY6 A;  2J4X A;  2OF1 A;  2QKI C;  3S16 H;  2K5W A;  2IPK D;  3QO2 A;  4IZ8 A;  3PCO B;  4JYA Q;  2NVX H;  5C3E H;  3OYY A;  1LYL A;  1EIY B;  1W3S A;  4JVZ A;  2JA6 G;  4KD3 A;  4CKC A;  1X56 A;  2Q2U A;  3IRB A;  4JG2 A;  1X54 A;  4JYA L;  4U67 3;  2JA9 A;  4CJ0 B;  1Z6H A;  1CTM A;  4QUF A;  2A74 C;  3H0G B;  4JOI A;  5DLQ E;  4OL7 A;  2MFI A;  3CF5 A;  2WKC A;  1JE4 A;  1CUK A;  1IW7 C;  5C4J H;  4LF9 Q;  5IYC H;  2R7Z B;  2KCN A;  1LTB D;  5CGK A;  1IXR A;  4DV4 Q;  4OXP A;  5COY A;  1GXD C;  1LO5 D;  4RGN A;  5GAE C;  1NMF A;  1MSH A;  3J81 i;  3KF6 B;  1PH1 A;  4LF9 L;  1C7Y A;  4IFD H;  5M3M B;  3PF4 A;  1CI3 M;  5EBD A;  1PA6 A;  3CKI B;  1I94 Q;  2FHT A;  4DV4 L;  2K14 A;  3VDY A;  2JA8 H;  3FMC A;  1GUN A;  4LK1 C;  2O2L D;  2IWH A;  1I94 L;  1XNR Q;  3KOJ A;  1F77 A;  1LTT D;  4DV1 Q;  1KNE A;  3VR2 A;  4DAY B;  2E2J H;  4IPH A;  1DXM A;  1YJN A;  1SNC A;  4QB4 A;  3ULP A;  1LT5 D;  1UNS A;  1EY4 A;  1JQY D;  2WAQ G;  2VUM G;  1XNR L;  4DV1 L;  2ZJP A;  3DM3 A;  3PUX A;  1PH6 A;  2B2V A;  1HCZ A;  1C8C A;  1K0R A;  2CWA A;  2K28 A;  2RA4 A;  3BDC A;  1FD7 D;  4WRD A;  4IJH A;  4DV3 Q;  1VQI A;  4ABN A;  1PYW D;  1VMP A;  1A2U A;  1CFM A;  1Q3L A;  1OXX K;  2AKW B;  5CYU A;  4DV3 L;  1TS2 A;  2XWJ B;  3GTL B;  1SN8 A;  1AN8 A;  4GN3 B;  1EWI A;  2E2D C;  3PO3 G;  2D0O A;  4HJ5 A;  1VQA A;  2B8G A;  2MO1 A;  4C1N K;  2F0V A;  4C2M B;  1EQR A;  4MTK A;  1XMO L;  2MQH A;  4A3M B;  5EPL A;  4B3M Q;  3IKJ A;  3BYT B;  1STB A;  5T1G A;  2PPB C;  4LF5 Q;  3CCR A;  3KYH C;  3LWE A;  3SEB A;  1EY5 A;  3BJU A;  3NBH B;  3BG3 A;  2CQO A;  2I5H A;  2Z9H A;  4IUP A;  2R92 G;  1NUC A;  2E8G A;  3CCQ A;  1VQB A;  1B9M A;  4B3M L;  2B2U A;  3FDT A;  2UXB Q;  1TWF B;  4LF5 L;  3S9W A;  2PI2 A;  4C3H G;  2N8N A;  4MHE A;  4BS9 A;  3D31 A;  1S40 A;  3S1R B;  1SYC A;  1HR0 W;  4QCL A;  1TS3 A;  3G6J B;  1CK1 A;  2KEC A;  2UU9 Q;  4PZ6 A;  3SE0 A;  3GTJ H;  1XX8 A;  2UXB L;  5KND A;  3QIA A;  3G71 A;  2D5D A;  1U4R A;  2L11 A;  2K5N A;  4IUU A;  4KKT A;  4WJ4 A;  2PW7 A;  3RN2 A;  1VDZ A;  1M1K C;  2DGY A;  3GO5 A;  4K2K A;  2UU9 L;  2WAQ E;  3KLS A;  1QE6 A;  3U50 C;  1BOS A;  4GKJ Q;  5BR8 L;  1IYV A;  2YYZ A;  2F0N A;  5EKL A;  1TII D;  4A3I G;  1WTP A;  5M5X B;  4A3D B;  3T56 B;  1KLU D;  4CKB A;  4KHZ A;  5CC4 A;  4LFC Q;  1HZA A;  2WAC A;  4Q5V A;  5C0X I;  1DM0 B;  5HGQ A;  4GKJ L;  1UE1 A;  2EY5 A;  3OW7 A;  5IWA Q;  1PH7 A;  1GUO A;  3N52 A;  5JAV A;  3GTG B;  3HKZ G;  1ASZ A;  3D0F A;  2B2W A;  1S5F D;  1S5C D;  3U9O A;  2RF4 A;  1AZQ A;  1JT8 A;  4HJ9 A;  3ERQ A;  1HNZ Q;  4LFC L;  1MKH A;  2FXQ A;  2R6G A;  3UE0 A;  3FHW A;  5IWA L;  2WB1 B;  2AUK A;  1Y1V H;  3TDQ A;  5IIF A;  2RDG A;  1ONL A;  1WCM B;  1A63 A;  1U4P A;  1HNZ L;  1JOO A;  2B2T A;  3NEM A;  4YWK A;  1KDB A;  3TZD A;  3PGZ A;  5C3E G;  3J81 L;  1K83 B;  1X3P A;  2K5Q A;  2IY5 B;  1WTR A;  1JWS D;  2JEB I;  4DK3 C;  2MUY A;  1TY0 A;  4KV6 A;  2CVR A;  4LWC A;  1JB7 A;  3JAM c;  1ILP A;  2GA4 B;  3AU7 A;  2QCP X;  2Z8L A;  4R8N A;  5E3F A;  4EVO A;  1T5X D;  5F2D A;  4GNX A;  2QDL A;  4U68 A;  1FGU A;  1XPO A;  1Y8O B;  2E2H H;  2Q8T A;  4ZUJ A;  3DHQ A;  2BDO A;  2R3Z A;  1VQ6 A;  1F9S A;  3A56 A;  2JP1 A;  3CCM A;  3MEH A;  3HOX G;  5IYC G;  3I4N B;  5C44 B;  1D7Q A;  1DYQ A;  4BA2 I;  1XNQ Q;  1CQV A;  2E75 C;  3M3Y B;  1X6O A;  3CQZ B;  3HZX A;  3GTO H;  3O13 A;  3S2H B;  4G57 A;  4IFD G;  1NAP A;  1VS0 A;  5KIX A;  1F2Z A;  1B50 A;  1XNQ L;  1IW7 D;  2JA8 G;  2L0C A;  4IUR A;  3GQB A;  3CHB D;  3D3R A;  3HKZ E;  3MFY A;  4H13 C;  3GTK B;  5EAY A;  1I4P A;  1MGS A;  3OWF A;  3TRZ A;  3A8J E;  2RVL A;  4RGO S;  3RMH A;  1AW7 A;  2K05 A;  4C3I H;  5COR A;  2DNC A;  3RR5 A;  3TP8 A;  4KY6 A;  1JJG A;  3AQQ A;  4X3S A;  1EIH A;  1O7Y A;  4GZY C;  5J22 A;  2CKZ B;  3NWS A;  3EBE A;  1WOC A;  5I9P A;  4BA1 I;  4EGV A;  5CV8 A;  3TN2 A;  3A5Z B;  3CCL A;  4FF2 A;  2IJ0 A;  3HP3 A;  3W1B A;  4XXE A;  2Q2T A;  2PQA A;  3W3A A;  4DV6 Q;  2F0J A;  4LW1 A;  1V1P A;  1BR9 A;  1ENF A;  2K5V A;  1QOH A;  2Z4H A;  4HID A;  2E76 C;  1II3 A;  4IOA A;  1SEB D;  4UY8 C;  1IZ6 A;  3GTQ B;  2EJM A;  2NVY H;  4DV6 L;  2F0Q A;  4AIM A;  2EZV A;  2M2L A;  3MWY W;  4H0L C;  1W6K A;  2WFW A;  2RHQ B;  4OIJ A;  1E0B A;  1OTC A;  1XTC D;  5L37 A;  2K50 A;  2B8F A;  1STA A;  2LY7 A;  4DPG A;  2A19 A;  5KRU A;  5EQ0 A;  1QWY A;  2I46 A;  2AQ1 B;  2EQS A;  2SEB D;  1J6Q A;  4KD4 A;  1YIJ A;  4XYO A;  2ZTD A;  3K0X A;  3S15 H;  2KHJ A;  3GDE A;  3T1H Q;  1U4M A;  5JPN C;  1LLR D;  1BDO A;  1I6H B;  1JWM D;  3I4L A;  3Q8D A;  3NTK A;  1SJH D;  2J7Z A;  3SK6 A;  4BBS H;  4WJ3 M;  1BQQ T;  5GAH C;  3T1H L;  3ITP A;  4L5T A;  1H9K A;  3S1N H;  1EOT A;  1K9M C;  4H02 A;  1DGS A;  3D6C A;  1AZP A;  5IE8 A;  2Q2I A;  2Z0S A;  5I2Y A;  4KKU A;  4FF4 A;  2DNE A;  3B6Y A;  1NMG A;  2ALY B;  2CW0 D;  4X66 Q;  1AFP A;  5M3F H;  3C2P A;  2VW9 A;  4N9T A;  3R2I A;  3D4W A;  4A3F B;  1V1P B;  4ID6 A;  4A3I B;  4V0B A;  3BZC A;  3S1Q H;  1ROD A;  2C9O A;  2RKS A;  3I91 A;  4A75 A;  3K7A H;  1PH8 A;  1A0I A;  1F9P A;  3CAM A;  4WFN 3;  5FO8 B;  5CR3 A;  1H9J A;  2I07 B;  4NXM L;  1IYU A;  3P1H A;  1DOK A;  1B9N A;  4K6D A;  2OEO A;  3J7A 5;  1EEF D;  1YJW A;  3OMG A;  1Y1V G;  4LFA Q;  1MD2 D;  1SE4 A;  4B3T Q;  4N8F A;  2R93 H;  2KJX A;  4IAL A;  2HDL A;  3HOU H;  4O0A A;  4EQO A;  3H3V C;  1JC7 A;  3ERS X;  3NTI A;  3RN5 A;  2F0S A;  1BCP B;  2D2C C;  2NUC A;  4LFA L;  4A3B H;  1R9T B;  3CU7 A;  4B3T L;  4A93 H;  1N32 Q;  3BVZ A;  5K36 H;  1AEX A;  4DKA C;  1HFN A;  3BYY B;  4IUV A;  4CGY B;  4MIU A;  1VQF A;  3URY A;  1Q90 A;  2OQ0 A;  1TR5 A;  5IGC A;  3OWE B;  1N32 L;  2Q8R E;  3JAM i;  5LMN L;  4JV5 Q;  2TMP A;  1X9N A;  1A15 A;  4J8Q A;  1PHJ A;  1S3O A;  4UDU C;  5A2Q E;  3M85 A;  1ICW A;  2KEN A;  3U4Z A;  3G4S A;  3HOW H;  3HOX B;  4JV5 L;  1HHV A;  1X3G A;  4DR2 Q;  3KBX A;  4TQU S;  4L5S A;  1EFI D;  5D3D A;  2JN4 A;  3PO2 B;  4L8J A;  3FKI B;  1GM5 A;  2K52 A;  4HCE A;  1IHZ A;  2ZXR A;  3MFG A;  4C1N I;  3J7Y W;  4DA2 A;  4BY1 G;  4TKO B;  3M4O H;  1STN A;  1TKW B;  1LM0 A;  4DR2 L;  2UXC Q;  2ZJQ A;  1Q12 A;  2ZJR A;  5J1Z A;  3E9I A;  3GTK H;  2B2T C;  4JI2 Q;  1N9W A;  4HIK A;  3IFT A;  2NYZ D;  1VMC A;  5EPK A;  5IY0 A;  1XTD A;  2NN6 H;  1ET6 A;  2UXC L;  3HKS A;  5CBE E;  1HNW Q;  3RZO H;  2X6G A;  4HAE A;  1GJX A;  3HOY B;  3H3V I;  3QWN A;  4JI2 L;  5E4W C;  1NE3 A;  3Q24 A;  1U0L A;  1G51 A;  1WTO A;  2A5H A;  1JR0 D;  4I65 A;  5ELF A;  3RLO A;  4IJL A;  3J81 E;  1HNW L;  3GP7 A;  4QQB X;  3L7Z C;  3S24 A;  4I7Z C;  3J7Z C;  3A8K E;  4A3E H;  1YHQ A;  1TWG H;  1EWC A;  4HIO A;  3EFX D;  2OQK A;  3A0J A;  2PZT A;  1XMQ L;  3DMU A;  1NNX A;  4B08 A;  2K5D A;  1HA5 A;  4RH6 A;  4DUZ Q;  2F3V A;  3WOF A;  4HJ7 A;  2WKD A;  1RIP A;  1TWA H;  1YNJ D;  2MHV A;  4M8A A;  5AJ3 Q;  4DXG A;  4C3J B;  3I4M H;  2VZA A;  1EZ8 A;  4DAM A;  1PYB A;  1PZJ D;  1QG7 A;  5KNB A;  1C0A A;  1EY6 A;  4HMI A;  4R4T A;  2OXP A;  4DUZ L;  5IGF A;  4K5X A;  2BA1 A;  3TP6 A;  1S5E D;  1Y14 B;  4NKL A;  2NVT B;  1KLG D;  5AJ3 L;  1JOR A;  2NZH A;  5GQO A;  4R4C A;  5M5W B;  4BY7 B;  1EY7 A;  2QEX A;  3R93 A;  4BBS G;  2A6E C;  4LNQ A;  1O7I A;  4RMF A;  4KI0 A;  1YZ6 A;  4ZK9 B;  1KC8 C;  1FNV A;  4DNT B;  1X55 A;  1NR2 A;  2K1B A;  2KQ3 A;  3FPP A;  2KVM A;  4IPG A;  1LTR D;  3DXJ C;  3K5M A;  3EQL C;  1FR3 A;  4JI6 Q;  4KN7 C;  1VQ7 A;  2VXW A;  2CCZ A;  3H6M A;  4K14 A;  1PH2 A;  4EX5 A;  4QIW E;  2G5D A;  5CV6 A;  3A7A B;  1ICF B;  4BXX H;  1O80 A;  1EY0 A;  4RWS C;  1CA5 A;  2EVB A;  3PV0 A;  4JI6 L;  4HED A;  4P73 A;  5C0X J;  4R4Q A;  1SYF A;  3BZK A;  2E2I B;  3J80 c;  4FDB A;  4IUN A;  1YNX A;  2UXD Q;  3ER0 A;  2EE1 A;  2VY3 A;  4KY7 A;  4AYB B;  4A3G H;  3JAM L;  2PNH A;  1QJO A;  4RKB A;  1B8A A;  1DOM A;  3I3C A;  4X64 Q;  2XSC A;  1UE6 A;  3L9A X;  1HQR D;  4GLX A;  2EY2 A;  5D65 A;  2UXD L;  1BCP C;  1SYB A;  3T4A C;  2CH4 W;  3PSI A;  2R93 G;  3S17 B;  2K32 A;  4X64 L;  3HOU G;  3MXN A;  2OWO A;  1S5B D;  4NDX A;  5T1I A;  3UI2 A;  1E24 A;  2SNS A;  2FMM A;  2N3S A;  2B63 H;  3LX0 A;  5FLX c;  4A93 G;  2DY8 A;  5K36 G;  1SSO A;  4P71 A;  4O42 A;  1U9R A;  1RHP A;  4P74 A;  4K8I A;  4PZ7 A;  2HCC A;  2ICE C;  3HOZ H;  4F88 A;  3L3O C;  2JA5 H;  2HQE A;  2DY7 A;  4GKK Q;  2F0I A;  3GTM B;  3VYU A;  1HZC A;  1E2Z A;  1X3F A;  1IBK Q;  3K5N A;  3W1G A;  3M7G A;  2Z4I A;  3Q6S A;  1K3B C;  4GKK L;  1Z7T A;  1VQG A;  1EWH A;  1QUQ A;  3HOW G;  1I3Q H;  1TWH B;  1Y8P B;  4R1J A;  5IOC A;  1IBK L;  5BN3 A;  4X62 Q;  3M4Y A;  1TU2 B;  2L15 A;  3AMU A;  4A3J B;  2WIN B;  1G2T A;  1EZ6 A;  1PFS A;  1DOL A;  4H7B A;  3HRZ C;  1VQD A;  3NQT A;  2B3G A;  2JE6 I;  4RCN A;  1HUN A;  3EIV A;  4FXG C;  4X62 L;  4CJ2 C;  4BY1 B;  4KHV A;  4K6L A;  1PDQ A;  2VQF Q;  4RGM A;  1EIG A;  5DEH A;  1JE5 A;  5IGB A;  1YNN D;  4E6I A;  4NW2 A;  2NN6 G;  5CV9 A;  4WOR A;  1SMY C;  1RL2 A;  1HNX Q;  1V1Q A;  2VQF L;  2Z6B A;  3K80 C;  5JJI A;  4MTN A;  3KFU A;  1XMO Q;  4A3K H;  1L0W A;  2QW7 A;  1HNX L;  3S14 H;  4A3E G;  3GTP B;  1D1K A;  1PTO D;  1RTN A;  4NXN Q;  4OON A;  3D4D A;  2EYM A;  5C0X H;  4O1N A;  2Y0S G;  1CT1 D;  1Q82 C;  1BBX C;  2XNA C;  1SLJ A;  3KK7 A;  1SMX A;  2VB2 X;  2QF7 A;  3A7L A;  3D6W A;  4KN4 C;  4MZ9 A;  4NXN L;  2N55 A;  2IHE A;  1ENA A;  4NP5 A;  3I4M G;  5C4X B;  1I4G A;  1K28 A;  4XIG S;  2A6H C;  2CW0 C;  2KCC A;  1Y1W B;  1NR4 A;  2AHO B;  5K5P A;  1B7Y B;  1I50 B;  3S2D H;  2MNA A;  1D1I A;  5BR8 Q;  3K58 A;  2DJG C;  5BN5 A;  2SDF A;  3NSW A;  2WII B;  2RDF A;  1B44 D;  2MP1 A;  1SFO H;  3S1M H;  1MI2 A;  3DEO A;  3KJO A;  4KHP Q;  3VR4 A;  2A69 C;  3NBI A;  1A6X A;  2BE5 C;  1IKM A;  1WJJ A;  4F87 A;  3FP9 A;  3W5O A;  4TSS A;  2K6A A;  1C4Q A;  4K5W A;  4KHP L;  4FYD A;  5D14 A;  2A6E D;  3NE5 B;  1Q7Y C;  4BBR B;  2NWG A;  2A68 C;  1WTV A;  4OO1 I;  5IYB H;  2YV5 A;  4BXX G;  3GD7 A;  5JJZ A;  1B3Q A;  3KDF A;  1TXY A;  4ZUI A;  2JA7 H;  2LXJ A;  1ESF A;  1TWC B;  3J7A F;  3FPU B;  1LTI D;  2R7F A;  1NCV A;  4IPD A;  3J80 i;  4A3G G;  3HOV H;  1AH9 A;  1D2B A;  2IL8 A;  2Y0S E;  4LFB Q;  5IT9 c;  4DK0 A;  3CPW A;  2ZTC A;  5G3L F;  4CDD C;  2YU9 B;  1YVC A;  1K8G A;  1IBM Q;  3QB3 A;  2BOS A;  2F1M A;  3TEH B;  3ZYY X;  1UEA B;  3W2D A;  1I4R A;  3WWV A;  4LFB L;  2JA6 B;  4K8J A;  1ZKO A;  2JYO A;  3K5L A;  1SAP A;  4YY3 Q;  1WVL A;  3RLF A;  3MVV A;  1PRT B;  1IBM L;  3G7L A;  2ID0 A;  2B63 G;  3I8Z A;  2ENB A;  2OTL A;  3V96 A;  2EJG C;  3H0G H;  2X69 A;  1QCB D;  4B9X A;  3HOZ G;  1S72 A;  1BCP D;  2JA5 G;  2C35 B;  4YY3 L;  1FNU A;  3CME A;  2R7Z H;  1VQ9 A;  5M5Y B;  3CCE A;  4XYQ A;  3X3M A;  1JJ2 A;  4B3S Q;  3ULJ A;  1B4O A;  1SNM A;  5AFW A;  1AE3 A;  4RA8 A;  4LF4 Q;  4DV0 Q;  3Q23 A;  5M3M H;  1JCK B;  2IT1 A;  3V2T A;  3OIP A;  4B3S L;  1XJV A;  2RCF A;  4JW0 A;  4HJ8 A;  2F0E A;  1VQL A;  4DV0 L;  4LF4 L;  1F2M A;  3VR5 A;  4L63 B;  2EJF C;  1ESR A;  5FO9 B;  1G8Z D;  1CZG A;  2F0L A;  2K33 A;  4YHH Q;  3WDN A;  5C6A A;  4EQP A;  3CP0 A;  3NXW A;  1FYC A;  1ZXT A;  2K01 A;  4M1U B;  2JXM B;  2WAQ B;  5CMD A;  3U58 A;  2RSO A;  5JEA J;  2VUM B;  1Q86 C;  1PTO B;  3M4P A;  1YNJ C;  4YHH L;  4JOI C;  1VQK A;  2HCI A;  3CCV A;  3PQI A;  2XRQ D;  2IX3 A;  2YTY A;  2AUJ D;  4ZKB B;  1LT3 D;  2C5C A;  2L5T A;  1KXL A;  4B3R Q;  5I6Y A;  2GVA A;  1WTW A;  2UUB Q;  3KJP A;  4DF7 A;  4GNX B;  2KCT A;  3K8A A;  4A3K G;  3RD4 A;  4N8X 1;  2XGT A;  4YWL A;  1BBU A;  1KHI A;  3C1E A;  3GTL H;  4B3R L;  4NB3 A;  1VQ4 A;  1OO9 B;  4JK1 C;  1WD1 A;  2UUB L;  5C4H A;  1K3R A;  3PO3 B;  4K5V A;  1P8L A;  3Q22 A;  1SMY D;  4C2M H;  4DR1 Q;  4UAI A;  1Z47 A;  4JC0 A;  3MXG A;  3E0J A;  5C0X G;  4A3M H;  3H94 A;  1STY A;  3PIO 3;  5C4Z A;  2KBN A;  2XVS A;  3SDZ A;  5JJL A;  4DNI A;  2B29 A;  3DWQ A;  4DR1 L;  2EOT A;  3CC2 A;  1X3Q A;  2R92 B;  3FRP B;  3NP8 A;  2HIX A;  1ZYR C;  1C9O A;  3RLN A;  1TWF H;  4K0K Q;  1LT4 D;  3RZD B;  5IGE A;  4C3H B;  4ZQ3 A;  4X65 Q;  3EA6 A;  1A3U A;  1HR0 L;  3WOE A;  3S1R H;  4GN4 B;  2B2V C;  3RUZ A;  3PUY A;  5HGT A;  2VL6 A;  5E4X A;  1IL8 A;  4K0K L;  3STB D;  3J80 L;  1C48 A;  1GHK A;  4X65 L;  2VNU D;  3EJI A;  4Y7N B;  3DLL A;  1BBW A;  1NTG A;  3P20 A;  1A8V A;  2A6H D;  2MGS A;  2E5L Q;  3BVG A;  5LL6 S;  2PQA B;  1SYD A;  3M4Q A;  5IP7 H;  3TZU A;  5TSS A;  4LAA A;  5M5X H;  4R9W A;  2Q2H A;  3CW2 C;  4YCW A;  4A3D H;  4NXM Q;  4QUC A;  1VQN A;  4CDC C;  3I72 A;  3D4R A;  2E5L L;  2HUG A;  2PMZ E;  3I55 A;  4JI8 Q;  5IYB G;  3DUZ A;  2NVQ B;  1MJC A;  2BDN A;  3U9S A;  3GTG H;  5JPM C;  4KLK A;  3HKZ B;  4HSP A;  5KYI A;  4DAV A;  2JA7 G;  2A69 D;  2NTT A;  5FLX L;  4S3S A;  2MJ8 A;  2BE5 D;  1LV9 A;  4XQN A;  4NPS A;  3T53 B;  4JI8 L;  2B2U C;  4LUV A;  5IOD A;  2F0K A;  3TBI B;  3T16 A;  2IW3 A;  1RF2 D;  1WTH A;  3T13 A;  3HOV G;  1MBY A;  1EQT A;  3S16 B;  1SYG A;  2A68 D;  1BO0 A;  1WCM H;  2UUC Q;  4P72 A;  2HIV A;  3J81 j;  1PVO A;  3A55 A;  2NVX B;  4XDX A;  5C3E B;  1PRT C;  1EYG A;  1VF5 C;  4YCU A;  5LMN Q;  3PUW A;  1MSG A;  3NEL A;  3OPO A;  3J7A V;  3VA7 A;  3K5O A;  1K83 H;  2NZO A;  2FJ2 A;  3CXC A;  4PG3 A;  5JEA H;  2L4N A;  2UUC L;  1NBW A;  2I0Q A;  3H3V H;  2ZXP A;  3A5U A;  1DCZ A;  1J8I A;  1ET9 A;  1B2T A;  1EEI D;  1I5F A;  2WP8 J;  4HN7 A;  4OWT B;  3H0G G;  4ZLT F;  5JVH 3;  2XTI A;  4CDE C;  4JI4 Q;  1K8M A;  1OXV A;  3CCJ A;  1XPR A;  2NBF A;  5C4J B;  1O7L A;  1CHQ D;  4POF A;  3MAQ A;  3I4N H;  2NTS A;  2R7Z G;  4AQY Q;  1VF7 A;  2BCO A;  3L0O A;  5C44 H;  3PIP 3;  1YNN C;  2B2W C;  3AFQ A;  4G7O C;  3M3Y H;  4JI4 L;  2LFN A;  1SNO A;  3CQZ H;  3OIQ A;  4QMG A;  3S2H H;  2H5X A;  5M3M G;  1PH4 A;  4CKE A;  4YCV A;  4AQY L;  1HA6 A;  2ES2 A;  1GUW A;  3PMF A;  2JA8 B;  4RGT A;  1W6J A;  1P16 A;  2XN9 C;  1PLF A;  2G9D A;  1A3T A;  1L2F A;  4RG1 A;  2F0T A;  1VQ8 A;  1VQP A;  1V9P A;  4C3I G;  1PTO C;  1MJE A;  5H1S E;  3TS0 A;  4RKL A;  2E2J B;  3CPF A;  2K04 A;  5LMU Q;  4PV1 C;  4X6A H;  4IUT A;  3OTO Q;  3TS2 A;  4AYB E;  4DUY Q;  3HFZ B;  3KLW A;  1FGB D;  1RDP D;  1B70 B;  1KNA A;  3FEW X;  3CCU A;  4CJ1 B;  1XMQ Q;  4GNX C;  5ELB A;  3SVM A;  1SR3 A;  1NJI C;  3E0E A;  5LMU L;  1EYC A;  1HZ9 A;  1JMC A;  1E3P A;  5FKA C;  4XQQ A;  3OTO L;  1G6Z A;  3BVM A;  5A35 A;  4DUY L;  4JI0 Q;  3VYS A;  1L0Y B;  1F9Q A;  1PFM A;  2I5L X;  3SK8 A;  4DN4 M;  5I2X A;  1KDC A;  1UE7 A;  1HQM C;  3HG9 A;  4F7X A;  2F3W A;  1J5E Q;  2EYL A;  3RNU A;  1R4Q B;  3GTQ H;  3I4O A;  4R4I A;  4QL5 A;  3T1Y Q;  1GOZ A;  2CFM A;  4UP7 A;  4DK6 C;  4LUO A;  4JI0 L;  3N6R A;  3P7J A;  1H9S A;  1STE A;  1PMR A;  2PCF B;  1J5E L;  1GD7 A;  5EJW A;  1CHP D;  4A3M G;  2VB3 X;  3T1Y L;  4A4I A;  1UE5 A;  2CH4 A;  3M9B A;  1RTO A;  4RHR A;  2NZ1 D;  5EBC A;  3C1F A;  1CZW A;  1YJ9 A;  1EUJ A;  3BS1 A;  4J15 A;  1TQO A;  1VQJ A;  1MIU A;  3MTS A;  4X3U A;  1DD2 A;  3KUP A;  4OEM B;  1G29 1;  3X3N A;  1I6H H;  1G2S A;  4ODG A;  1BF4 A;  1E1O A;  1YHB A;  2J0T D;  4KTA A;  3BDL A;  4OGQ C;  2RCN A;  4QF4 A;  2F0P A;  4FXD A;  2H4O A;  1M90 C;  3GTJ B;  2CQA A;  1LTG D;  4LF7 Q;  5CV7 A;  2OTJ A;  4XT3 B;  1GO3 E;  1BCP F;  2PYK A;  3EVQ A;  4LF8 Q;  4EQN A;  4L5Q A;  1Q46 A;  2NB0 A;  1EIF A;  2FIN B;  4X3T A;  1ZYR D;  1VQE A;  1TY2 A;  1TS5 A;  2R61 A;  5M3F G;  4LF7 L;  1SE8 A;  2ZTE A;  5IP7 G;  2M00 A;  1GUS A;  3PUZ A;  5IT9 L;  4LF8 L;  1GVP A;  3NEN A;  4R4O A;  4GOP A;  4A3F H;  2E74 C;  4A3I H;  3F1Z A;  2TSS A;  4KMU C;  5KGU A;  4DV5 Q;  1CKO A;  4XQJ A;  1B3A A;  1DZ1 A;  4FF3 A;  3K57 A;  1EOV A;  2HT1 A;  4FO2 A;  1B53 A;  1H9M A;  2NVQ H;  1IL2 A;  1IYJ B;  4OX9 Q;  4DV5 L;  1KAW A;  3CC4 A;  1QVG A;  1H9S B;  4HIM A;  4QJF A;  4IOC A;  2MPM A;  2EDG A;  2WB1 G;  1E7Z A;  1Y1V B;  5GAD C;  4DAY A;  5FJ8 H;  4IUQ A;  4OX9 L;  2K5H A;  3TP5 A;  1WCM G;  3EN2 A;  3I73 A;  4POG A;  1Q8K A;  2JJQ A;  3DWA A;  4A3B G;  4PMW A;  1R9T H;  3SHL A;  2SNM A;  3L2P A;  4HCS A;  5JEA G;  4KK7 A;  3E5S A;  1PH3 A;  5JVG 3;  1YHA A;  4UHV A;  1UWV A;  2F4I A;  3F2D A;  3K59 A;  1H9R A;  3SK5 A;  4RHS A;  5IYD H;  1D5Z C;  4IN3 A;  2ATW A;  3CC7 A;  4WJW A;  2E2H B;  1PRT D;  1CM9 A;  2BH8 A;  3PIO A;  4OEL B;  4L5R C;  3J80 E;  5EPJ A;  2F0H A;  4ZKC B;  4HMJ A;  3I4N G;  2V4D A;  5C44 G;  4JI1 Q;  3HOX H;  4QGU A;  1VQM A;  2KOL A;  4GOP B;  1HPC A;  4ZAI A;  1QB5 D;  3PO2 H;  3FKI H;  3GTO B;  1KAB A;  1N34 Q;  3K6O A;  3DM1 A;  1O78 A;  3U4V A;  1EQQ A;  1S4Z A;  4JI5 Q;  1JOQ A;  3UDF A;  3OMC A;  3NBH A;  4DR4 Q;  4JI1 L;  1E2W A;  2B2Y A;  3OW2 A;  2YTX A;  1Q1E A;  4PQX A;  4LF6 Q;  1N36 Q;  3K7U C;  1F2L A;  3BU2 A;  5LL6 X;  1N34 L;  2EPB A;  1LAC A;  1WTQ A;  4JI5 L;  4DFA A;  5E1F A;  2CHB D;  3UE1 A;  1NSN S;  2V1C C;  2JK8 A;  4DR4 L;  5FLX E;  4C3I B;  4LF6 L;  2DN8 A;  2WB1 E;  3KBG A;  3NK9 A;  1BKB A;  1J9O A;  1N36 L;  1YI2 A;  1EQV A;  3MXN B;  2VQE Q;  1YIT A;  3HOY H;  2Z1C A;  1KRT A;  2OT2 A;  1XPU A;  4I7A A;  4JBK A;  3C46 A;  5FLM H;  4QIW B;  1TS4 A;  2PW5 A;  1V43 A;  2L9H A;  4YIJ A;  3R2T A;  2PNR C;  3SR1 A;  2VQE L;  5EKK A;  2PI2 E;  5EGT A;  1STH A;  4DV7 Q;  1SRO A;  3ONA B;  1JJC B;  3HGB A;  4GLA C;  1V8Q A;  1Y8N B;  3T51 B;  4OO1 H;  4A76 A;  2NVY B;  3FVQ A;  1EYD A;  3IAY A;  2RDH A;  1FJG Q;  4HR7 B;  4UP8 A;  4ALP A;  3ND8 A;  3STB C;  1QUQ B;  4DV7 L;  1VQC A;  2K7V A;  3CCS A;  4IFD I;  1UEB A;  4DAP A;  4C3J H;  4CBV A;  1BNZ A;  1VCI A;  4ME3 A;  1HTL D;  4DR7 Q;  5ELD A;  3G6E A;  2X6L A;  4DXF A;  1FJG L;  1T9H A;  4F8M A;  2F52 A;  3A8I E;  4DU9 A;  1KD1 C;  2NVT H;  1KQS A;  1ENC A;  1GHJ A;  3S15 B;  2Q8I B;  2AMC B;  3P75 A;  4DR7 L;  2DUD A;  5M5W H;  4BY7 H;  1CKN A;  1ML0 D;  2ICI A;  1OXS C;  2O4X A;  4BBS B;  2LMC B;  3ERO A;  4A3L H;  3KF8 A;  3OHX C;  4J1M A;  3VA5 A;  1KL9 A;  4LMQ D;  4DGZ A;  2BH2 A;  4J6H A;  1F2Y A;  1QVC A;  2SOB A;  3S1N B;  3QOL A;  2IX1 A;  4B9W A;  3MA2 B;  1KAA A;  4ME5 A;  3PIP A;  4DV2 Q;  5A2Q L;  1LTA D;  4Z9C B;  5D3I B;  2FMC A;  2CWP A;  5M3F B;  1L0X B;  5ELN A;  1IBL Q;  1WTX A;  1E2V A;  2F0U A;  4DV2 L;  4A3F G;  2O5J C;  2IX0 A;  2PZW A;  3S1Q B;  1EU3 A;  4OHJ A;  5CV4 A;  5ELO A;  2E2I H;  1WYD A;  1GUG A;  3K7A B;  1D5M C;  2EYF A;  1I4Q A;  1IBL L;  2F0D A;  2D9U A;  1KRS A;  3KLS X;  5EKI A;  1F9R A;  5NUC A;  5JOB A;  1RJT A;  4KY5 A;  1SBB B;  1E1T A;  1X3E A;  3SGI A;  1I4H A;  1G6P A;  2EYP A;  2R7D A;  1S5D D;  4DK1 A;  5FJ8 G;  2HDM A;  2R93 B;  3S17 H;  3E3X A;  1LAB A;  1GUT A;  3G48 A;  4C56 C;  3HOU B;  1QNK A;  3OOC A;  2L1B A;  1FVI A;  3H91 A;  1YEZ A;  1CKN B;  4A3B B;  4G7H C;  4A93 B;  4AH6 A;  1RCV D;  4P2C B;  1BXT A;  4JBW A;  1STG A;  1U4L A;  4N9P A;  4JPB W;  3KF8 B;  3GV3 A;  4LJZ C;  4LUZ A;  2LSS A;  1QZG A;  3VYT A;  2KHI A;  1QIL A;  1TVX A;  4L6T B;  3GTM H;  1XYI A;  1N33 Q;  3H09 A;  1UUP A;  3QJY A;  3PF5 A;  4DNR B;  5IYD G;  3H15 A;  4A3C H;  1A2T A;  5LMN W;  2GVB A;  1AE2 A;  1OXT A;  4X3K A;  4GOP C;  1SNP A;  1BUV T;  3LNN A;  2AQ2 B;  1M8A A;  3ND9 A;  3HOW B;  1N33 L;  1EU4 A;  1TWH H;  4OWX B;  3F2B A;  2L12 A;  1JB3 A;  3KDF B;  1KTK A;  1N8R C;  4NMZ A;  1GKH A;  5CBA E;  4A3J H;  5IT9 E;  5KYL A;  1QVF A;  3PO2 G;  3FKI G;  1U5K A;  2RQX A;  3K81 C;  4IO9 A;  1FNW A;  1A3V A;  4YWM A;  1LTL A;  2QEJ C;  5C3X A;  3M7N A;  2P5Z X;  2K75 A;  2F0W A;  3OSO A;  1VQ5 A;  3M4O B;  3MZ5 A;  4BY1 H;  4UP9 A;  1SND A;  1EFW A;  3JAM E;  2Z6K A;  3TME A;  2JQO A;  3UDX A;  4MN3 A;  1YBY A;  1E22 A;  3MXP A;  5KNC A;  3IL8 A;  1DON A;  1TT2 A;  2KA7 A;  3RZO B;  2PZU A;  3HOY G;  2KHS A;  4GN5 A;  2EXZ A;  3NUC A;  3NTH A;  5FLM G;  5ELC A;  4FNF A;  1PYS B;  2A8V A;  1ASY A;  1B1Z A;  2F0G A;  2F0F A;  1HZB A;  2K03 A;  3QOJ A;  4A3E B;  3K0Y A;  1LT6 D;  1TWG B;  3GTP H;  2D62 A;  1Z9F A;  2HD3 A;  4OO1 G;  1H95 A;  5ISR A;  1L1O A;  2YTV A;  2RHS B;  5C5M A;  4K2L A;  3AEV A;  2JEA I;  2XRS D;  4PNY A;  4FF1 A;  2Y0S B;  5HUR A;  3ICE A;  4Q0F A;  4RAU C;  1HR0 Q;  2IHF A;  1TWA B;  1PFB A;  4C3J G;  2EXD A;  5C4X H;  5J39 A;  3I4M B;  2OCE A;  4RFB A;  2B2Y C;  4IPC A;  2QA4 A;  2F4V Q;  1Y1W H;  3R3O A;  2WV6 D;  4HSV A;  3F2C A;  3MXU A;  1PFN A;  2D0P A;  1I50 H;  3NPP A;  4Y52 H;  1EY9 A;  4BY7 G;  2QIL A;  1O7Z A;  4P75 A;  4TVA B;  3D8G A;  2F4V L;  1K8A C;  3MEF A;  2KEE A;  4A3L G;  3SK4 A;  1PXU A;  2QGQ A;  5I9O A;  2EYH A;  3I70 A;  3AFP A;  2PQE A;  1R4P B;  3CRL C;  4ILW A;  2GN5 A;  2EY6 A;  1QNU A;  2PO4 A;  1K0S A;  1PRT F;  2RSN A;  4V19 0;  3BZD B;  3UDI A;  2EYO A;  1EY8 A;  1ILQ A;  4HTH A;  2UUA Q;  1RKN A;  1FL0 A;  5DM7 3;  4JBJ A;  2A1A A;  4BBR H;  3E9H A;  4RCO A;  2K4K A;  2N88 A;  1IKL A;  1UAP A;  3AB9 A;  4O2D A;  5IP9 H;  2ZM6 Q;  4XT1 B;  4EQ5 A;  3F2U A;  1D5X C;  1HTP A;  2EY1 A;  2UUA L;  4PZ8 A;  5IGG A;  1TWC H;  3SXH A;  3C3L A;  2EYJ A;  4X66 L;  1L1O B;  3MHB A;  1KIX A;  1XWE A;  2F03 A;  2MO0 A;  4AYB G;  2ZM6 L;  4A3G B;  2ZT9 C;  1HFG A;  4DR3 Q;  1WD0 A;  1SRU A;  1W2B A;  3F8T A;  5GAG C;  2YU9 H;  5DNF A;  4CDF C;  1KDA A;  3TRE A;  3QG1 A;  2AWO A;  1CA6 A;  3QR8 A;  4DR3 L;  2JA6 H;  2O5I C;  1LTS D;  1Q81 C;  4ZRZ A;  3UDG A;  3VR6 A;  4JI3 Q;  2VS1 A;  3I2Z A;  1CSP A;  2B63 B;  2DJF C;  4APV A;  2JSO A;  1PTO F;  1JOK A;  1XXG A;  1LUZ A;  4ULL A;  3LWU A;  3HOZ B;  1X32 A;  2KUM A;  3ZJY C;  2JA5 B;  4QY7 A;  3R8B A;  4JI3 L;  4G7Z C;  1Y69 U;  5FK9 C;  1WFQ A;  5C5L A;  2L55 A;  5M5Y H;  5IGD A;  4A3C G;  4JBM A;  5DAU A;  1QZH A;  3J81 c;  2ZXO A;  1AP0 A;  2LS0 1;  2F0M A;  3GV6 A;  1DJR D;  4XTC S;  4GS3 A;  1I3Q B;  3PUV A;  1CSQ A;  4TRD A;  1JIC A;  1A62 A;  4R8I A;  4OWW B;  2FFK B;  1Q8I A;  2AWN A;  1ZEQ X;  4A3J G;  2HQL A;  2N49 A;  3JC6 6;  1OXU A;  1HRJ A;  1PH5 A;  4MNO A;  3I90 A;  1SNQ A;  2BA0 A;  1EL0 A;  5I6W A;  5C3W A;  1CQF A;  1BVS A;  3A74 A;  4ZYS A;  1MHW C;  4OIK A;  2EIF A;  2VUM H;  4JCV E;  3VR3 A;  1PTO H;  5KEE A;  3TQY A;  2N78 A;  5G3L D;  1D8L A;  1PZK D;  1V1O A;  1RD9 D;  4KJO A;  2LKV A;  2PMZ B;  1EYA A;  4DR5 Q;  2LXK A;  4DR6 Q;  3NWT A;  3Q0A A;  4A3K B;  5CV5 A;  3I7F A;  3S14 B;  4G4K A;  1SE3 A;  3DWP A;  4GLV B;  3PO3 H;  4DR5 L;  1I6V C;  4FVM A;  4DR6 L;  1SE2 A;  3TSS A;  4IFD J;  1HXY D;  4PMB A;  1CKM A;  1SXT A;  2A73 B;  2XWB B;  1SDF A;  3AYH B;  2I5M X;  1HUM A; 
#chains in the Genus database with same CATH homology
 2XIW A;  4BWG B;  5M9O A;  1Q1B A;  4KKS A;  3E6Z X;  1I4X A;  2AQ3 B;  3DEP A;  3S2D B;  3HEJ A;  4PMC A;  2M9V A;  3V05 A;  2NN6 I;  3NHH A;  5LHY 1;  1T5E A;  5FOB B;  3IFD A;  1M4V A;  3MC0 B;  4FXK C;  5FO7 B;  4CHT B;  5I4D A;  4FP5 D;  1SFO B;  3S1M B;  1SYE A;  2KED A;  3CRK C;  5BN4 A;  2RBM A;  1K8O A;  1JWU D;  3VYR A;  4KJN A;  1PZI D;  4H44 C;  1G91 A;  3BDO A;  3KLR A;  1D6E C;  2G9H D;  2QDB A;  2H1E A;  2B39 A;  5DM6 3;  3A54 A;  5ELE A;  3TP7 A;  1SJE D;  2JA7 B;  3NQI A;  4IQZ A;  2F0O A;  3HS0 C;  3HOV B;  2J4X A;  2OF1 A;  2QKI C;  2K5W A;  2IPK D;  3QO2 A;  4IZ8 A;  4KD3 A;  4CKC A;  4U67 3;  4CJ0 B;  1Z6H A;  1CTM A;  4QUF A;  2A74 C;  3H0G B;  4OL7 A;  2WKC A;  1JE4 A;  1IW7 C;  2R7Z B;  2KCN A;  1LTB D;  5CGK A;  5COY A;  1GXD C;  1LO5 D;  4RGN A;  1MSH A;  4IFD H;  5M3M B;  1CI3 M;  5EBD A;  3CKI B;  2FHT A;  3FMC A;  1GUN A;  4LK1 C;  2O2L D;  2IWH A;  1F77 A;  1LTT D;  1KNE A;  3VR2 A;  1DXM A;  1SNC A;  4QB4 A;  1LT5 D;  1UNS A;  1EY4 A;  1JQY D;  3PUX A;  2B2V A;  1HCZ A;  1C8C A;  2K28 A;  2RA4 A;  3BDC A;  1FD7 D;  4WRD A;  4ABN A;  1PYW D;  1VMP A;  1A2U A;  1CFM A;  1Q3L A;  1OXX K;  5CYU A;  1TS2 A;  2XWJ B;  3GTL B;  1AN8 A;  2E2D C;  2B8G A;  4C1N K;  4C2M B;  2F0V A;  4A3M B;  5EPL A;  3IKJ A;  3BYT B;  1STB A;  5T1G A;  2PPB C;  3SEB A;  3LWE A;  1EY5 A;  3BG3 A;  4IUP A;  1NUC A;  1B9M A;  2B2U A;  3FDT A;  1TWF B;  3S9W A;  4C3H G;  4MHE A;  4BS9 A;  3D31 A;  3S1R B;  1SYC A;  4QCL A;  1TS3 A;  3G6J B;  1CK1 A;  2KEC A;  3SE0 A;  1XX8 A;  5KND A;  3QIA A;  2D5D A;  1U4R A;  2L11 A;  4IUU A;  4KKT A;  2PW7 A;  1VDZ A;  4K2K A;  3GO5 A;  3KLS A;  1QE6 A;  1BOS A;  1IYV A;  2YYZ A;  2F0N A;  5EKL A;  1TII D;  1WTP A;  5M5X B;  4A3D B;  3T56 B;  1KLU D;  4CKB A;  4KHZ A;  5CC4 A;  2WAC A;  4Q5V A;  5C0X I;  1DM0 B;  2EY5 A;  3OW7 A;  1GUO A;  3N52 A;  5JAV A;  3GTG B;  2B2W A;  1S5F D;  1S5C D;  3U9O A;  1AZQ A;  3ERQ A;  2R6G A;  2WB1 B;  2AUK A;  3TDQ A;  5IIF A;  2RDG A;  1ONL A;  1WCM B;  1U4P A;  1JOO A;  2B2T A;  1KDB A;  3TZD A;  3J81 L;  1K83 B;  1X3P A;  2K5Q A;  1WTR A;  1JWS D;  2JEB I;  2MUY A;  1TY0 A;  4KV6 A;  2CVR A;  1ILP A;  4R8N A;  2GA4 B;  2QCP X;  4EVO A;  2Z8L A;  3AU7 A;  5E3F A;  1T5X D;  5F2D A;  4U68 A;  1Y8O B;  2Q8T A;  4ZUJ A;  3DHQ A;  2BDO A;  2R3Z A;  1F9S A;  3A56 A;  2JP1 A;  3MEH A;  3I4N B;  5C44 B;  1DYQ A;  4BA2 I;  1CQV A;  2E75 C;  3M3Y B;  3CQZ B;  3HZX A;  3S2H B;  3O13 A;  4G57 A;  4IFD G;  1NAP A;  5KIX A;  1F2Z A;  1B50 A;  1IW7 D;  2L0C A;  4IUR A;  3GQB A;  3CHB D;  3D3R A;  3MFY A;  4H13 C;  3GTK B;  1I4P A;  1MGS A;  3OWF A;  2RVL A;  3A8J E;  4RGO S;  3RMH A;  1AW7 A;  2K05 A;  5COR A;  2DNC A;  3TP8 A;  4KY6 A;  4X3S A;  1EIH A;  1O7Y A;  4GZY C;  5J22 A;  3NWS A;  5I9P A;  4BA1 I;  4EGV A;  5CV8 A;  3TN2 A;  4FF2 A;  2IJ0 A;  3HP3 A;  4XXE A;  3W3A A;  2F0J A;  1V1P A;  1BR9 A;  1ENF A;  1QOH A;  2Z4H A;  2E76 C;  1II3 A;  1SEB D;  3GTQ B;  2EJM A;  2F0Q A;  2EZV A;  2M2L A;  3MWY W;  4H0L C;  1W6K A;  4OIJ A;  1E0B A;  1XTC D;  2B8F A;  1STA A;  2LY7 A;  5KRU A;  5EQ0 A;  1QWY A;  2I46 A;  2AQ1 B;  2SEB D;  4KD4 A;  4XYO A;  1U4M A;  5JPN C;  1LLR D;  1BDO A;  1I6H B;  1JWM D;  3I4L A;  3NTK A;  1SJH D;  2J7Z A;  3SK6 A;  1BQQ T;  3ITP A;  1H9K A;  1EOT A;  3D6C A;  1AZP A;  5I2Y A;  4KKU A;  4FF4 A;  2DNE A;  2CW0 D;  1AFP A;  3C2P A;  4N9T A;  3R2I A;  3D4W A;  4A3F B;  1V1P B;  4ID6 A;  4A3I B;  4V0B A;  1ROD A;  2C9O A;  2RKS A;  3I91 A;  1F9P A;  4WFN 3;  5FO8 B;  5CR3 A;  1H9J A;  2I07 B;  1IYU A;  3P1H A;  1DOK A;  1B9N A;  4K6D A;  2OEO A;  1EEF D;  3OMG A;  1MD2 D;  1SE4 A;  2KJX A;  4IAL A;  2HDL A;  4EQO A;  3H3V C;  1JC7 A;  3NTI A;  2F0S A;  1BCP B;  2D2C C;  2NUC A;  1R9T B;  3CU7 A;  3BVZ A;  5K36 H;  1AEX A;  1HFN A;  3BYY B;  4IUV A;  4CGY B;  4MIU A;  3URY A;  1Q90 A;  1TR5 A;  5IGC A;  3OWE B;  2Q8R E;  2TMP A;  1A15 A;  4J8Q A;  5A2Q E;  4UDU C;  3M85 A;  1ICW A;  3HOX B;  1HHV A;  3KBX A;  4TQU S;  1EFI D;  5D3D A;  3PO2 B;  4L8J A;  3FKI B;  4HCE A;  1IHZ A;  2ZXR A;  3MFG A;  4C1N I;  3J7Y W;  4DA2 A;  4TKO B;  1STN A;  1TKW B;  1Q12 A;  5J1Z A;  2B2T C;  3IFT A;  2NYZ D;  1VMC A;  5EPK A;  2NN6 H;  1ET6 A;  5CBE E;  2X6G A;  4HAE A;  1GJX A;  3HOY B;  3QWN A;  5E4W C;  3Q24 A;  1WTO A;  2A5H A;  1JR0 D;  4I65 A;  5ELF A;  3J81 E;  3GP7 A;  3L7Z C;  4I7Z C;  3A8K E;  1EWC A;  3EFX D;  2PZT A;  3DMU A;  4B08 A;  2K5D A;  1HA5 A;  4RH6 A;  2F3V A;  3WOF A;  2WKD A;  1YNJ D;  2MHV A;  4M8A A;  4DXG A;  4C3J B;  1EZ8 A;  5KNB A;  1PZJ D;  1QG7 A;  1EY6 A;  4HMI A;  2OXP A;  5IGF A;  4K5X A;  2BA1 A;  3TP6 A;  1S5E D;  4NKL A;  2NVT B;  1KLG D;  1JOR A;  5M5W B;  4BY7 B;  1EY7 A;  3R93 A;  2A6E C;  4KI0 A;  4ZK9 B;  1FNV A;  4DNT B;  1NR2 A;  2K1B A;  2KQ3 A;  3FPP A;  2KVM A;  1LTR D;  3DXJ C;  3K5M A;  3EQL C;  1FR3 A;  4KN7 C;  2VXW A;  3H6M A;  4K14 A;  5CV6 A;  3A7A B;  1O80 A;  1EY0 A;  4RWS C;  1CA5 A;  2EVB A;  3PV0 A;  4HED A;  5C0X J;  1SYF A;  2E2I B;  4IUN A;  2EE1 A;  4KY7 A;  4AYB B;  3JAM L;  1QJO A;  4RKB A;  1DOM A;  3I3C A;  2XSC A;  3L9A X;  1HQR D;  2EY2 A;  5D65 A;  1BCP C;  1SYB A;  3T4A C;  3S17 B;  2K32 A;  3MXN A;  1S5B D;  4NDX A;  5T1I A;  3UI2 A;  2SNS A;  2FMM A;  3LX0 A;  2DY8 A;  5K36 G;  1SSO A;  4O42 A;  1U9R A;  1RHP A;  4K8I A;  2HCC A;  2ICE C;  4F88 A;  3L3O C;  2HQE A;  2DY7 A;  2F0I A;  3GTM B;  3VYU A;  1E2Z A;  3K5N A;  3M7G A;  2Z4I A;  3Q6S A;  1Z7T A;  1EWH A;  1TWH B;  1Y8P B;  5IOC A;  5BN3 A;  3M4Y A;  1TU2 B;  3AMU A;  4A3J B;  2WIN B;  1G2T A;  1EZ6 A;  1DOL A;  4H7B A;  3HRZ C;  3NQT A;  2JE6 I;  4RCN A;  1HUN A;  4FXG C;  4CJ2 C;  4BY1 B;  4KHV A;  4K6L A;  1PDQ A;  4RGM A;  1EIG A;  5DEH A;  5IGB A;  1YNN D;  4E6I A;  4NW2 A;  2NN6 G;  5CV9 A;  4WOR A;  1SMY C;  3GTP B;  1D1K A;  1PTO D;  1RTN A;  3D4D A;  2EYM A;  5C0X H;  4O1N A;  1CT1 D;  1BBX C;  2XNA C;  3KK7 A;  2VB2 X;  2QF7 A;  3A7L A;  3D6W A;  4KN4 C;  2N55 A;  1ENA A;  4NP5 A;  5C4X B;  1I4G A;  4XIG S;  2A6H C;  2CW0 C;  2KCC A;  1Y1W B;  1NR4 A;  5K5P A;  1I50 B;  1D1I A;  3K58 A;  5BN5 A;  2SDF A;  3NSW A;  2WII B;  2RDF A;  1B44 D;  2MP1 A;  1MI2 A;  3DEO A;  3VR4 A;  2A69 C;  3NBI A;  1A6X A;  2BE5 C;  1IKM A;  4F87 A;  4TSS A;  2K6A A;  1C4Q A;  4K5W A;  4FYD A;  5D14 A;  2A6E D;  3NE5 B;  4BBR B;  2NWG A;  2A68 C;  1WTV A;  4OO1 I;  3GD7 A;  5JJZ A;  4ZUI A;  1ESF A;  1TWC B;  3J7A F;  3FPU B;  1LTI D;  1NCV A;  1D2B A;  2IL8 A;  4DK0 A;  5G3L F;  2YU9 B;  3QB3 A;  2BOS A;  2F1M A;  3ZYY X;  1UEA B;  3W2D A;  1I4R A;  2JA6 B;  4K8J A;  1ZKO A;  2JYO A;  3K5L A;  1SAP A;  1WVL A;  3RLF A;  3MVV A;  1PRT B;  3G7L A;  2ID0 A;  3I8Z A;  2ENB A;  3V96 A;  2EJG C;  2X69 A;  1QCB D;  4B9X A;  1BCP D;  1FNU A;  5M5Y B;  4XYQ A;  3X3M A;  1B4O A;  1SNM A;  5AFW A;  4RA8 A;  3Q23 A;  1JCK B;  2IT1 A;  3V2T A;  3OIP A;  2F0E A;  1F2M A;  3VR5 A;  4L63 B;  2EJF C;  1ESR A;  5FO9 B;  1G8Z D;  1CZG A;  2F0L A;  2K33 A;  3WDN A;  5C6A A;  4EQP A;  3NXW A;  1FYC A;  1ZXT A;  2K01 A;  4M1U B;  2JXM B;  2WAQ B;  5CMD A;  2RSO A;  5JEA J;  2VUM B;  1PTO B;  1YNJ C;  2HCI A;  2XRQ D;  2IX3 A;  2AUJ D;  4ZKB B;  1LT3 D;  2C5C A;  2L5T A;  5I6Y A;  1WTW A;  4DF7 A;  3RD4 A;  3C1E A;  1OO9 B;  4JK1 C;  1WD1 A;  5C4H A;  3PO3 B;  4K5V A;  3Q22 A;  1SMY D;  4UAI A;  1Z47 A;  3MXG A;  3E0J A;  5C0X G;  3H94 A;  1STY A;  3PIO 3;  5C4Z A;  2XVS A;  3SDZ A;  3DWQ A;  2EOT A;  1X3Q A;  2R92 B;  3FRP B;  3NP8 A;  1ZYR C;  1LT4 D;  3RZD B;  5IGE A;  4C3H B;  4ZQ3 A;  3EA6 A;  1A3U A;  3WOE A;  2B2V C;  3RUZ A;  3PUY A;  5HGT A;  5E4X A;  1IL8 A;  3J80 L;  1C48 A;  1GHK A;  2VNU D;  3EJI A;  4Y7N B;  3P20 A;  2MGS A;  2A6H D;  3BVG A;  5LL6 S;  1SYD A;  3TZU A;  5TSS A;  4LAA A;  4R9W A;  4QUC A;  3I72 A;  3D4R A;  2HUG A;  3DUZ A;  2NVQ B;  2BDN A;  3U9S A;  5JPM C;  3HKZ B;  4HSP A;  5KYI A;  4DAV A;  2A69 D;  2NTT A;  5FLX L;  4S3S A;  2MJ8 A;  2BE5 D;  1LV9 A;  4XQN A;  3T53 B;  2B2U C;  5IOD A;  2F0K A;  3TBI B;  3T16 A;  2IW3 A;  1RF2 D;  3T13 A;  1MBY A;  1EQT A;  3S16 B;  1SYG A;  2A68 D;  1BO0 A;  3A55 A;  2NVX B;  4XDX A;  5C3E B;  1PRT C;  1VF5 C;  3PUW A;  1MSG A;  3OPO A;  3J7A V;  3VA7 A;  3K5O A;  2FJ2 A;  5JEA H;  2L4N A;  2ZXP A;  1DCZ A;  1J8I A;  1ET9 A;  1B2T A;  1EEI D;  4HN7 A;  2WP8 J;  4ZLT F;  5JVH 3;  1K8M A;  1OXV A;  2NBF A;  5C4J B;  1O7L A;  1CHQ D;  3MAQ A;  2NTS A;  1VF7 A;  2BCO A;  3PIP 3;  1YNN C;  2B2W C;  4G7O C;  2LFN A;  1SNO A;  3OIQ A;  4QMG A;  4CKE A;  1HA6 A;  1GUW A;  3PMF A;  2JA8 B;  4RGT A;  1W6J A;  2XN9 C;  1PLF A;  2G9D A;  1A3T A;  2F0T A;  4C3I G;  1PTO C;  4RKL A;  2E2J B;  2K04 A;  4PV1 C;  4IUT A;  1FGB D;  1RDP D;  1KNA A;  3FEW X;  4CJ1 B;  5ELB A;  3SVM A;  1EYC A;  5FKA C;  4XQQ A;  1G6Z A;  3BVM A;  5A35 A;  3VYS A;  1L0Y B;  1F9Q A;  1PFM A;  3SK8 A;  4DN4 M;  5I2X A;  1KDC A;  1HQM C;  3HG9 A;  4F7X A;  2F3W A;  2EYL A;  1R4Q B;  1GOZ A;  3N6R A;  3P7J A;  1H9S A;  1STE A;  1PMR A;  2PCF B;  5EJW A;  1CHP D;  2VB3 X;  1RTO A;  4RHR A;  2NZ1 D;  5EBC A;  3C1F A;  1CZW A;  3BS1 A;  1TQO A;  4X3U A;  3MTS A;  1DD2 A;  3KUP A;  1G29 1;  3X3N A;  1G2S A;  4ODG A;  1BF4 A;  2J0T D;  4KTA A;  3BDL A;  4OGQ C;  4QF4 A;  2F0P A;  4FXD A;  2H4O A;  3GTJ B;  2CQA A;  1LTG D;  5CV7 A;  4XT3 B;  1BCP F;  2PYK A;  3EVQ A;  4EQN A;  2NB0 A;  2FIN B;  4X3T A;  1ZYR D;  1TY2 A;  1TS5 A;  2R61 A;  2M00 A;  1GUS A;  3PUZ A;  5IT9 L;  2E74 C;  2TSS A;  4KMU C;  5KGU A;  4XQJ A;  1B3A A;  1DZ1 A;  4FF3 A;  3K57 A;  4FO2 A;  1B53 A;  1H9M A;  1H9S B;  2MPM A;  2EDG A;  1Y1V B;  4DAY A;  4IUQ A;  3TP5 A;  3I73 A;  3DWA A;  4PMW A;  3SHL A;  2SNM A;  4HCS A;  5JEA G;  4KK7 A;  3E5S A;  5JVG 3;  2F4I A;  3K59 A;  1H9R A;  3SK5 A;  4RHS A;  1D5Z C;  4IN3 A;  4WJW A;  2E2H B;  1PRT D;  1CM9 A;  3J80 E;  4ZKC B;  2F0H A;  5EPJ A;  4HMJ A;  2V4D A;  2KOL A;  1HPC A;  4ZAI A;  1QB5 D;  3GTO B;  1KAB A;  3K6O A;  3DM1 A;  1O78 A;  1S4Z A;  1JOQ A;  3OMC A;  3NBH A;  1E2W A;  2B2Y A;  1Q1E A;  4PQX A;  1F2L A;  5LL6 X;  2EPB A;  1LAC A;  1WTQ A;  4DFA A;  5E1F A;  2CHB D;  1NSN S;  5FLX E;  4C3I B;  2DN8 A;  3KBG A;  3NK9 A;  1J9O A;  1EQV A;  2Z1C A;  2OT2 A;  3C46 A;  4QIW B;  1TS4 A;  2PW5 A;  1V43 A;  2L9H A;  4YIJ A;  3R2T A;  2PNR C;  3SR1 A;  5EKK A;  5EGT A;  1STH A;  3ONA B;  3HGB A;  1V8Q A;  1Y8N B;  3T51 B;  4OO1 H;  2NVY B;  3FVQ A;  1EYD A;  3IAY A;  2RDH A;  4HR7 B;  3ND8 A;  2K7V A;  4IFD I;  4DAP A;  4CBV A;  1BNZ A;  1VCI A;  1HTL D;  5ELD A;  2X6L A;  4DXF A;  4F8M A;  3A8I E;  4DU9 A;  1ENC A;  1GHJ A;  3S15 B;  2Q8I B;  3P75 A;  1ML0 D;  2ICI A;  1OXS C;  2O4X A;  4BBS B;  2LMC B;  3ERO A;  3KF8 A;  3OHX C;  4J1M A;  3VA5 A;  4LMQ D;  4DGZ A;  4J6H A;  1F2Y A;  2SOB A;  3S1N B;  3QOL A;  2IX1 A;  4B9W A;  3MA2 B;  1KAA A;  4ME5 A;  5A2Q L;  1LTA D;  4Z9C B;  5D3I B;  2FMC A;  5M3F B;  1L0X B;  1WTX A;  1E2V A;  2F0U A;  2O5J C;  2IX0 A;  2PZW A;  3S1Q B;  1EU3 A;  4OHJ A;  5CV4 A;  1GUG A;  3K7A B;  1D5M C;  2EYF A;  1I4Q A;  2F0D A;  2D9U A;  3KLS X;  5EKI A;  1F9R A;  5NUC A;  5JOB A;  1RJT A;  4KY5 A;  1SBB B;  1I4H A;  2EYP A;  1S5D D;  4DK1 A;  2R93 B;  2HDM A;  1LAB A;  1GUT A;  4C56 C;  3HOU B;  1QNK A;  3OOC A;  2L1B A;  3H91 A;  4A3B B;  4G7H C;  4A93 B;  1RCV D;  4P2C B;  1BXT A;  4JBW A;  1STG A;  1U4L A;  4N9P A;  3GV3 A;  4LJZ C;  3VYT A;  1QIL A;  1TVX A;  4L6T B;  1XYI A;  3H09 A;  1UUP A;  3QJY A;  4DNR B;  1A2T A;  4X3K A;  1OXT A;  1SNP A;  1BUV T;  3LNN A;  2AQ2 B;  1M8A A;  3ND9 A;  3HOW B;  1EU4 A;  2L12 A;  1JB3 A;  1KTK A;  4NMZ A;  5CBA E;  5IT9 E;  5KYL A;  2RQX A;  1FNW A;  1A3V A;  2QEJ C;  5C3X A;  3M7N A;  2F0W A;  3OSO A;  3M4O B;  3MZ5 A;  1SND A;  3JAM E;  3TME A;  4MN3 A;  3MXP A;  5KNC A;  3IL8 A;  1DON A;  1TT2 A;  2KA7 A;  3RZO B;  2PZU A;  2KHS A;  2EXZ A;  3NUC A;  3NTH A;  5ELC A;  4FNF A;  1B1Z A;  2F0G A;  2F0F A;  2K03 A;  3QOJ A;  4A3E B;  3K0Y A;  1LT6 D;  1TWG B;  2D62 A;  4OO1 G;  5ISR A;  5C5M A;  4K2L A;  2JEA I;  2XRS D;  4PNY A;  4FF1 A;  2Y0S B;  5HUR A;  4Q0F A;  4RAU C;  1TWA B;  1PFB A;  4C3J G;  3I4M B;  5J39 A;  4RFB A;  2B2Y C;  3R3O A;  2WV6 D;  4HSV A;  3MXU A;  1PFN A;  3NPP A;  1EY9 A;  2QIL A;  1O7Z A;  3D8G A;  2KEE A;  3SK4 A;  1PXU A;  5I9O A;  2EYH A;  3I70 A;  2PQE A;  1R4P B;  3CRL C;  4ILW A;  2PO4 A;  2EY6 A;  1QNU A;  1PRT F;  2RSN A;  4V19 0;  3BZD B;  2EYO A;  1EY8 A;  1ILQ A;  4HTH A;  1RKN A;  5DM7 3;  4RCO A;  2N88 A;  1IKL A;  1UAP A;  3AB9 A;  4XT1 B;  3F2U A;  1D5X C;  1HTP A;  2EY1 A;  5IGG A;  3SXH A;  3C3L A;  2EYJ A;  3MHB A;  1XWE A;  2F03 A;  4A3G B;  2ZT9 C;  1HFG A;  1WD0 A;  5DNF A;  1KDA A;  3QG1 A;  2AWO A;  1CA6 A;  2O5I C;  1LTS D;  4ZRZ A;  3VR6 A;  2B63 B;  2JSO A;  1PTO F;  1JOK A;  1XXG A;  4ULL A;  3LWU A;  3HOZ B;  1X32 A;  2KUM A;  2JA5 B;  3R8B A;  4G7Z C;  1Y69 U;  5FK9 C;  5C5L A;  2L55 A;  5IGD A;  5DAU A;  2ZXO A;  1AP0 A;  2LS0 1;  2F0M A;  3GV6 A;  1DJR D;  4XTC S;  1I3Q B;  3PUV A;  4TRD A;  1JIC A;  4R8I A;  2FFK B;  1Q8I A;  2AWN A;  1ZEQ X;  1OXU A;  1HRJ A;  3I90 A;  1SNQ A;  2BA0 A;  1EL0 A;  5I6W A;  5C3W A;  1CQF A;  4ZYS A;  4OIK A;  3VR3 A;  1PTO H;  5KEE A;  5G3L D;  1PZK D;  1V1O A;  1RD9 D;  4KJO A;  2LKV A;  2PMZ B;  1EYA A;  3NWT A;  3Q0A A;  4A3K B;  5CV5 A;  3S14 B;  4G4K A;  1SE3 A;  3DWP A;  1I6V C;  4FVM A;  1SE2 A;  3TSS A;  4IFD J;  1HXY D;  4PMB A;  1SXT A;  2A73 B;  2XWB B;  1SDF A;  1HUM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...