2F0WA

Crystal structure of staphylococcal nuclease mutant v23i/l25i/v66l/i72l
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
136
structure length
136
Chain Sequence
KLHKEPATLIKAIDGDTIKIMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMLENAKKLEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Hydrophobic core mutants of Staphylococcal nuclease
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Staphylococcal nuclease
total genus 36
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2005-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2f0wA00
3MEHA 2RDFA 2EYMA 3MXPA 2F0VA 1STGA 4I65A 4NMZA 3OMCA 3SHLA 4HTHA 2F0TA 2PW7A 2F0DA 4RKLA 5C3WA 3ITPA 1JOKA 5F2DA 3SXHA 5IGFA 4IALA 4K5VA 1ENAA 4DF7A 5CV8A 1TR5A 2F0HA 2O4XA 3NQTA 5E1FA 5JOBA 1II3A 5CC4A 1KDCA 1KDBA 2F0NA 4KD4A 4KV6A 3V2TA 4K2KA 4RKBA 3SR1A 2RKSA 5EKLA 5C4HA 4LAAA 4ZUJA 4OL7A 1A2UA 5EGTA 3E5SA 1KAAA 5K5PA 4B9WA 1EY8A 3QOLA 2HQEA 4N9PA 4K8JA 4K5XA 1SNMA 1STHA 4QB4A 3VA5A 4DU9A 3BDLA 2F0LA 4F7XA 4K6DA 5CV7A 3DMUA 3OSOA 4ME5A 5DAUA 2F0KA 3SK8A 5DEHA 5NUCA 1EY9A 3C1EA 4ZUIA 2PW5A 3TP6A 2OXPA 5J39A 1EYAA 4NDXA 3SK5A 5ISRA 1JOQA 1F2ZA 1SNDA 1SYEA 3EVQA 1SYFA 2EYJA 4KY7A 5I9PA 3HEJA 3D4DA 3HZXA 3NUCA 3SK4A 3LX0A 2F0QA 4PNYA 4KJOA 4E6IA 4EQOA 3T13A 2PZWA 5J1ZA 4DGZA 1KDAA 2F0WA 1SNOA 4B9XA 4EQNA 4F8MA 5IGDA 5IGBA 5KYLA 1STNA 3MZ5A 1KABA 1U9RA 3D4WA 3D6CA 4IUNA 4J6HA 1SNCA 2PQEA 3RUZA 5KIXA 1SYCA 4TRDA 1JORA 2F0UA 1EYCA 1EQVA 1SYDA 5CV5A 4KJNA 4PMCA 5I6YA 4K2LA 2F0PA 3EROA 3T16A 3DHQA 4KTAA 5EKKA 4K5WA 2EYLA 3TP8A 5C3XA 1F2YA 1EY7A 3NP8A 1SYBA 4QF4A 4ID6A 4NP5A 2EYFA 4KY6A 2OF1A 4KHVA 4KD3A 1IHZA 4K8IA 5HURA 4H7BA 2F0FA 2PZTA 4N9TA 3OMGA 4S3SA 2F0GA 3BDCA 1TT2A 4IZ8A 5CR3A 5C5MA 5M9OA 5J22A 1EY6A 2SOBA 1F2MA 2EY1A 2EY5A 3H6MA 5I6WA 4NKLA 2F3VA 5CV4A 2F0MA 2EYPA 2KQ3A 5E3FA 3TP7A 5C5LA 3QOJA 2F0JA 4WORA 4ODGA 2EXZA 4G57A 2M00A 4DFAA 3P75A 1A3VA 5HGTA 5KGUA 2F0SA 1A3TA 1EYDA 1EZ8A 1RKNA 1STYA 2LKVA 3R3OA 3U9OA 5IIFA 5KRUA 4QMGA 2F0OA 1NUCA 4K14A 5KYIA 1TQOA 1SYGA 5CGKA 4EQPA 3MHBA 5IGCA 4PMBA 1SNPA 3NK9A 1ENCA 2SNSA 1JOOA 3ERQA 2RBMA 5IOCA 4WRDA 5CV9A 2ENBA 2F3WA 2SNMA 3P1HA 4YIJA 1A2TA 1AEXA 1STAA 1STBA 5IGEA 5C4ZA 5C6AA 2WACA 2EY2A 2F0IA 3QB3A 4ZQ3A 3NXWA 3S9WA 3C1FA 1EZ6A 3D8GA 2EYOA 3TMEA 1EY4A 4KY5A 4J1MA 4HMJA 5IODA 2KHSA 3EJIA 3SK6A 4HMIA 3TP5A 3NHHA 1A3UA 5JAVA 5CV6A 2PZUA 4R8NA 1NSNS 5I9OA 2OEOA 5IGGA 1SNQA 2QDBA 2EY6A 2NUCA 2F0EA 3OWFA 2PYKA 1EY0A 1EY5A 3MVVA 4MIUA 5KEEA 2EYHA 4EVOA 3PMFA
chains in the Genus database with same CATH superfamily
2JP1A 3QO2A 3OMCA 2VUMH 2HD3A 2F0TA 2DY8A 4KKUA 5C3WA 4HCSA 5BR8Q 2Z6BA 4POFA 1VQKA 1DOLA 5LMUL 4GOPA 4AYBB 1HHVA 1U4LA 2E76C 3I91A 2XSCA 1N34Q 5C4JB 2KECA 4HEDA 2LXJA 4BBSB 1A2UA 2Q2HA 3G6EA 1DGSA 4G7OC 2XIWA 1EWHA 4X66Q 1DZ1A 2HQEA 4XYOA 1B50A 3QJYA 4IFDG 2PNHA 4A93G 4ZCKA 1Y1VH 1YEZA 3D31A 4KN7C 4ZUIA 2MO0A 2JA5H 1YI2A 1B3AA 1T5XD 3K7AB 4KY7A 4IJHA 4MZ9A 4X65Q 1GHJA 4DGZA 1EQRA 1A15A 4EQNA 3OW7A 2JA7B 4A3FH 3S1NB 4J6HA 2UXCL 1BDOA 1X3FA 3GQBA 3OWEB 3BVMA 4DV1Q 2H5XA 2I5LX 5M5YB 3EROA 2UUAL 2A68D 1H95A 3BJUA 1N34L 3A8KE 3HOVH 2CH4A 5M3FB 4HJAA 2P5ZX 3IFDA 2E2IB 2ZTEA 1SDFA 1BCPB 1CI3M 2A69D 1IBLL 1B7YB 4LF4Q 2B2TC 4ODGA 4O2DA 5I4DA 1A3VA 4DR4Q 1L0YB 2KJXA 1STYA 2B2YC 4YWLA 4JYAL 1DCZA 4DAMA 4DN4M 4DV4Q 1TWFB 3NK9A 3MAQA 1JOOA 3FMCA 4WRDA 2IY5B 3K81C 1EOVA 2RHSB 4X3KA 3VYRA 5FOBB 5K36G 1FJGQ 4KHPL 2QW7A 1ILPA 4BY7B 1AZQA 2E2JH 3PUWA 2EY2A 1E1TA 1SBBB 5FO7B 1SE2A 1PZJD 5JJKA 2FJ2A 4EQ5A 4R8NA 2NTTA 5KNDA 4DR4L 5C0XI 2VQEQ 1IKLA 4HIDA 3S1RH 3M7GA 4MN3A 3GTGH 3MC0B 4JI0L 2ZXRA 2DUDA 3W2DA 4L5TA 4DF7A 5G3LD 2F0HA 4ZLTF 2GVBA 1SFOH 1DJRD 3TDQA 1PVOA 4K2KA 3LWUA 3HOZH 2OQ0A 3GTOH 1CQVA 5EGTA 4O0AA 1PH2A 2E5LQ 2D5DA 4N9PA 4K5XA 4B3TQ 1HZ9A 1M1KC 5DAUA 4QY7A 4DV6L 2G9DA 3G71A 3S16B 1JJ2A 3S17B 1YITA 1HUMA 4Y7NH 1TXYA 4QL5A 5IT9L 2J0TD 2XWBB 2QGQA 1VQ8A 5CV5A 2NVTH 2JJQA 4KTAA 1Y1VB 4K5WA 2EYLA 4A3CH 1LTRD 4QF4A 1LM0A 4DV2Q 1G2SA 3H0GB 4X3UA 4GNXB 2UXDQ 3QWNA 4C3JG 2RDGA 2EVBA 4S3SA 3OW2A 3NEMA 4A3GG 2B2VA 1NE3A 3H6MA 1JWUD 1CSPA 3CF5A 1XPUA 1ASZA 1KQSA 3I55A 1FNWA 5C5LA 5LL6X 1HR0L 1YNJC 2WV6D 1EYDA 1ZEQX 3I90A 2MJ8A 3DXJC 4R1JA 2K6AA 4K14A 4OWXB 1LABA 4JOIC 3C3LA 1TWAH 4L63B 4B08A 4K6LA 3E6ZX 1QG7A 2B2UA 3DWAA 2XGTA 1FNUA 5FK9C 3T4AC 5I2XA 1WTQA 1IYUA 1J6QA 4FVMA 3UDGA 4J1MA 4HAEA 4BBRH 4DV2L 1X32A 3FDTA 3VYTA 1H9JA 2K05A 4CHTB 2I07B 1XWEA 2B63B 3J80c 2I5MX 3CC4A 3NQIA 3OYYA 5DLQE 1ET9A 2BE5D 2NYZD 1MGSA 3PIP3 1PTOC 2G9HD 1JOKA 1R4QB 3RN5A 4A3JH 4UY8C 3UDFA 4B3SL 1TS2A 2L1BA 2F0NA 3ZYYX 1LLRD 3KFUA 3PCOB 1QJOA 2A74C 1HRJA 5IYDG 1VQBA 2IX3A 3I72A 2J7ZA 5D3IB 3AMUA 1SE4A 1S5CD 2JQOA 3N6RA 3J81c 3GTJB 3S2DH 1E2WA 1PZID 4DK1A 3S24A 3J7AV 2A19A 1YNNC 3DM1A 1LTID 2F1MA 3PUYA 4KJOA 3N52A 3R93A 5DM63 4IN3A 5COYA 2ICEC 1SNCA 3CC2A 1SYCA 3TQYA 1EQVA 2ID0A 1VQAA 4DR1Q 1EQTA 2F0PA 2WAQB 4KK7A 4A3EB 3F2BA 1KNAA 2BDOA 2R7ZG 3A0JA 1RD9D 2TSSA 1AE3A 4K8IA 4JK1C 1K73C 4H7BA 4DV0L 2F0FA 4RGTA 4DK0A 5LMNW 1D7QA 1TT2A 4IUUA 1BR9A 2CKZB 5C5MA 4WJWA 1WD0A 2EDGA 1W2BA 2VNUD 1V1PB 3RLFA 2EXDA 2BH2A 1EZ8A 2RDHA 4BY7G 3GP7A 5KYIA 1IBML 1IBLQ 3MHBA 4HJ7A 2AUKA 4NXNQ 2ALYB 4YIJA 4PMWA 1SR3A 1MJCA 1HNZL 4O42A 4GNXC 3RZOH 2ASBA 4ZQ3A 2NZOA 4H0LC 1VQ9A 4KN4C 4UP9A 4CGYB 3QIAA 2CCZA 5D14A 2F4VQ 2R7ZH 5JPNC 1MIUA 1Q8KA 4R4CA 1F2YA 2A6EC 2EYHA 4P74A 3SHLA 4DK6C 1TY2A 5C0XJ 2Z4IA 3GTLH 4LK1C 1STGA 4A93B 3E0EA 5C0XG 4X65L 3ITPA 4HJ5A 3SEBA 2NVXH 2UXDL 2V1CC 1SJHD 4DA2A 3HOYH 5JOBA 3I4MB 3VYSA 4CKEA 4JI0Q 3V2TA 5JEAJ 2RKSA 2YYZA 1SRUA 4OL7A 3F1ZA 4IFDJ 2CWPA 3J7A5 4AYBE 2N8NA 5K5PA 5DNFA 1WCMH 4K6DA 5NUCA 1EEFD 1MKHA 3CCLA 3PO3G 1MD2D 4CDEC 2E2IH 2F0QA 1PFNA 5IGDA 2NWGA 1K83H 1I50B 3HGBA 1PFSA 4A3IH 3MZ5A 1KABA 3AU7A 2NZHA 1V1PA 3IFTA 3F8TA 4ABNA 4KJNA 1LTGD 3S15B 1RJTA 4GOPB 4UDUC 3T53B 1YZ6A 2D2CC 1L0WA 2VW9A 1PA6A 2Q8TA 2HHHQ 1MSHA 4K0KQ 1PYBA 1QUQB 2DY7A 3HFZB 2EY1A 1WTXA 2KEEA 2QA4A 4AQYQ 3J7AF 3W1BA 2IW3A 1D6EC 2JA5B 4PG3A 3W1GA 1NTGA 3NTHA 2KCCA 2XNAC 5KRUA 3S1QH 4DUZL 3K59A 2K5HA 2BOSA 4EQPA 1TWHB 4DUYL 1NMGA 2MO1A 3IKJA 5E4XA 1XMQQ 4LF8Q 2VY3A 1E1OA 1OXSC 2JSOA 1G6ZA 3D8GA 1JMCA 2IPKD 1EEID 4YWKA 2UUBQ 2L9HA 3EJIA 2JN4A 3SK6A 2MFIA 1PH7A 2PZUA 1VQGA 3DM3A 4FYDA 1HFNA 4A3CG 1WYDA 3CCMA 1P16A 3J81L 2M9VA 4DAYB 3MVVA 2GVAA 3RZDH 4PZ8A 2NVQB 1LYLA 4DXFA 5ELNA 1OO9B 1X3GA 5JVH3 1O7IA 4DR2L 2F0DA 3MWYW 1CFMA 5BN4A 2ZTCA 1R9TB 2MPMA 4A75A 3BYYB 1J8IA 1SAPA 2CW0D 1II3A 4RFBA 1EIHA 1HZAA 3BU2A 4DXGA 5IP7G 2AWNA 1G291 2K75A 4FNFA 1VS0A 1YHAA 4GNXA 3K7UC 4YWMA 3QOLA 1STHA 3VYUA 3CMAA 4DAVA 2N49A 3DMUA 3J80L 4OELB 3M7NA 4R4OA 2K5QA 4HIMA 3TS2A 3BDOA 3OIQA 4LW1A 1JOQA 2KEDA 1T9HA 3EVQA 1XMOL 2VUMB 1SJED 1GUTA 1LTBD 1E2VA 1J5EQ 1ET6A 2OT2A 1KDAA 2WB1E 1KLUD 3SVMA 1G51A 4QIWE 2PQEA 4RAUC 1FGUA 1PYWD 4JI3L 4TRDA 4WFN3 4A3IG 1BCPF 2BH8A 2A68C 4L5QA 5GROA 1IHZA 1E22A 4IQZA 1V1QA 1VF5C 3OMGA 3PO3H 3KF6A 3A55A 4XTCS 2QKIC 1SSOA 1Y69U 1X6OA 5K36H 1PRTF 4OGQC 2K5WA 1VQDA 2K50A 2K4KA 1CKNA 4P73A 3FP9A 4GZYC 2Q8IB 5FLXL 4JV5L 1PH5A 3GV3A 4O1NA 4IO9A 4XXEA 3ERQA 3F2DA 4NW2A 2ENBA 2MGSA 3CQZB 3HKSA 1TS3A 1S72A 3W5OA 1BO0A 1GVPA 4LUZA 5C4ZA 2O5JC 3OHXC 5AJ3Q 1GKHA 2WACA 3E0JA 1EYGA 3ND8A 4RGMA 1F2LA 4F88A 2RF4A 2UU9Q 1XJVA 2MHVA 4BA1I 1STEA 3LNNA 4R9WA 2AQ3B 1W6KA 3J81E 3NTIA 2WIIB 2BA1A 1IYVA 1EOTA 5ELEA 3E9IA 2B2YA 1NJIC 4DR6Q 3GTKB 4LWCA 1JE4A 1I4GA 4DAPA 4JI8Q 2O5IC 2HUGA 4ZUJA 1UUPA 1HNXQ 3HRZC 1EFWA 1Y1VG 4A93H 1Q8IA 3J81i 1MI2A 1AP0A 1SE3A 2DJFC 4XQJA 3BZKA 2PQAA 4ME5A 5CV7A 3SK8A 4DR3L 1VQ4A 1QVCA 2EE1A 3J80E 3HP3A 1QWYA 1J5EL 2D0OA 3GD7A 4N8FA 3JAMc 4DV7Q 1M90C 1Y8PB 5ISRA 5M5XH 4A3LH 3STBD 3I4MG 5GAEC 1CA6A 1K0SA 3PQIA 5J1ZA 4NXML 1TS5A 5JJIA 3RMHA 1WTOA 2VUMG 3RUZA 2X6LA 1SMXA 3CCJA 3WOFA 2F0UA 1LTAD 3VR6A 2DN8A 1JCKB 4X66L 5JJLA 4GN4B 4A3EH 1VQNA 1I3QH 3HKZE 2VQFL 1I4HA 4ZKBB 2V4DA 4BY1H 4LF9Q 1J9OA 5BR8L 4NXNL 4C3HG 4IJLA 2B63H 4P75A 2KQ3A 2KVMA 4UAIA 1GUOA 2F0JA 1NY4A 3I7FA 1HTLD 1TIID 3EIVA 1WTHA 4RMFA 1I94Q 1HPCA 5DM73 1A6XA 5KEEA 1W3SA 2NVTB 2I5HA 4I7ZC 2WAQG 4LJZC 4HSVA 3Q23A 1UEBA 2RQXA 1AEXA 4DR2Q 2CQOA 3U4ZA 1O7YA 4JI4Q 5IWAL 1F77A 3TMEA 5C4XG 1UE7A 5IT9c 3CP0A 1Q90A 4FF3A 4XQQA 3ULLA 3G6JB 1SNQA 4FF1A 2NUCA 3WWVA 1B3QA 3GTJH 5FO9B 1UWVA 4DNIA 1XYIA 2PQAB 5IY0A 1H9MA 4DR7L 4LUOA 3GO5A 2FFKB 2HCCA 4NXMQ 4M8AA 4JI7Q 5JJZA 4YY3Q 2IHEA 4RKLA 2EOTA 5F2DA 2A5HA 5EPJA 1E0BA 2A69C 1K9MC 2X69A 5BN3A 4DR3Q 1VQEA 1O7ZA 3CCVA 1LTLA 1WD1A 1VDZA 1SNMA 2D9UA 3X3MA 4LF4L 2FMMA 2ATWA 2AQ1B 1I5FA 5C3EB 1EWCA 1F9RA 4A3KB 3LWEA 1ZXTA 3G7LA 4DV5L 4PNYA 2IX0A 2SDFA 2JA6H 5IGBA 3S2HB 3KDFB 1WI5A 2BDNA 1IZ6A 2KENA 1NBWA 1JORA 3CCEA 1UE6A 1EYCA 3GTPH 5C44G 1XNRL 2N3SA 1QUQA 4BBSG 4WJ4A 4ID6A 2EYFA 4X6AH 4B3MQ 1EUJA 3I8ZA 1N33Q 2QILA 2NN6I 2K33A 1Y8OB 1TWFH 1GD7A 1SXTA 2BA0A 3BDCA 4OX9L 3I4LA 1JR0D 4NKLA 4DR7Q 3L7ZC 3TP7A 4RG1A 2Z9HA 2KOLA 4G57A 5ELCA 3ER0A 4QMGA 1MJEA 4IOAA 1LACA 4IPHA 1ENCA 4ILWA 1TS4A 5IOCA 4R4TA 4NB3A 4XIGS 1NCVA 1JQYD 5I2YA 1FGBD 2UUCL 1STAA 2CQAA 3KBXA 3E3XA 5D65A 1P8LA 4C1NI 2QEJC 2JYOA 3S9WA 1XMQL 4LF8L 1EZ6A 1I4RA 3VR5A 4C3JB 3TP5A 2QDLA 5CV6A 3MXNA 1NSNS 5I9OA 4BBSH 2EJFC 3OWFA 1MSGA 5GADC 1IBKL 3ONAB 1B53A 1LTSD 1YNJD 2ZT9C 1PV4A 1RHPA 3HOVB 2IHFA 1D5XC 1D5ZC 5FJ8H 1ASYA 3U58A 4OO1G 1JB3A 2EJGC 4OONA 1Q1EA 2VQFQ 3H3VI 1UEAB 3V05A 5LMNL 4QIWB 5CC4A 3HOXB 3SR1A 1YJNA 1EIYB 1HR0W 1VQLA 3M4PA 2RVLA 4GS3A 2JA7H 4ZK9B 1X9NA 3JAML 3HOXG 3HOWH 3L3OC 4L6TB 1BBWA 1I4XA 1QZGA 5JEAH 4JI3Q 2PO4A 1MHWC 3FKIG 2Z6KA 4U673 1AN8A 5JPMC 5M3MH 1V43A 1KTKA 1Q46A 1NMFA 5ELDA 3HOVG 3S2HH 1HTPA 1FYCA 2K14A 3NWSA 3FKIB 4E6IA 3URYA 3K5NA 3TZDA 2Y0SE 2H1EA 5KYLA 2NB0A 1A8VA 1YIJA 3CRLC 4IUTA 3A8JE 4C3HB 5I6YA 4DNTB 1G6PA 3A5ZB 1EQQA 2R7FA 1BOSA 3WOEA 1QE6A 4ME3A 4EX5A 4ZKCB 2BE5C 1RL2A 2XN9C 1XTCD 2ZJQA 3LGJA 5C4XH 2KCNA 5GAHC 1H9KA 5CR3A 5EBDA 3UDXA 3PIO3 1EY6A 4LNQA 4KHPQ 4DAYA 4DK3C 4YHHL 3W3AA 1V1OA 1O78A 2OWOA 3CXCA 2R93B 1WTWA 1IW7D 4DUZQ 2R92B 1X55A 1CUKA 3RLNA 4JCVE 1C4QA 1NNXA 3S14H 1G2TA 1AH9A 3SGIA 2F03A 1XNQL 1K28A 4HR7B 4JOIA 1AW7A 3H3VH 1S5FD 3AYHB 4CKCA 2B63G 4LF9L 3A56A 1B2TA 4V190 3T51B 3S1MH 3VDYA 1SFOB 1FR3A 4U68A 3OTOL 4KY5A 2WB1B 2JA9A 1K8OA 1A3UA 1N36L 3A7AB 1ENFA 3NBHA 4HN7A 1N32Q 1HZCA 4H44C 2UU9L 4B3RL 3MXPA 4HTHA 1SMYD 4X64Q 3DEPA 3BZCA 1BBXC 3IAYA 4RWSC 4K5VA 2WKCA 3I4MH 3I4NB 2E2HB 5C3EG 2J4XA 4I7AA 3FEWX 2B3GA 4KD4A 3CQZH 4OEMB 3IRBA 1CT1D 3GTLB 2F4VL 3H0GG 5T1GA 4ZAIA 1T5EA 4JI8L 2F0KA 3UE1A 1B9MA 1Y1WH 2UXBQ 1F9SA 1F2ZA 1SNDA 1Y8NB 2G5DA 3HEJA 2FHTA 4IUVA 5LL6S 3JAMi 1GHKA 4OO1I 3ND9A 2XWJB 4IPGA 1M4VA 3MXUA 4MTKA 4B9XA 4F8MA 4DUYQ 1G91A 4TSSA 2WKDA 4R4QA 1VQ5A 5IT9E 2KA7A 4JYAQ 3J81j 2Z1CA 3ULJA 3CPWA 4PMCA 5ELOA 2K28A 3I70A 3V96A 2JK8A 1HR0Q 2L15A 2K5NA 2ZXOA 2X6GA 1K0RA 4LF6Q 2NZ1D 2N78A 3L0OA 4IPCA 4KHVA 4KY6A 3HOUG 3TRZA 3KUPA 2B2VC 1VQHA 2PZTA 2A6HD 5M3MG 4A3IB 1XMOQ 1S40A 3FKIH 3BVGA 1A63A 5J22A 1S5DD 4KLKA 4XT1B 2CVRA 4BY1B 1WOCA 3MEFA 1X3PA 4RA8A 1Y1WB 2HDMA 3K7AH 3PUVA 4X3TA 4KMUC 4DFAA 4XQNA 3G4SA 2MNAA 3R3OA 4DV3L 1PH8A 2RCFA 4PZ6A 4DV1L 2NTSA 1K3RA 3HOWB 1R4PB 1SNPA 2SNSA 3M4YA 4Y52H 3S16H 1DYQA 1GUSA 2F3WA 3J7YW 3OTOQ 3M3YB 1OXTA 2VB2X 3K5OA 1TWAB 1TWCB 3K5MA 4OWTB 1JB7A 1ONLA 4GLXA 5FJ8G 3AB9A 4OO1H 1XPRA 1I4QA 4PV1C 1EY4A 4HMJA 3E9HA 4CJ1B 3BVZA 5G3LF 4YCUA 2QDBA 3R2TA 1EY0A 5CYUA 3PIOA 3PMFA 3S17H 1VQ6A 5EJWA 2JA8G 1D2BA 1F9PA 3I4NH 1UE5A 4JBWA 3FRPB 1YJ9A 2DNEA 4QUFA 1BVSA 4IALA 1IXRA 1LV9A 3KF8B 1KL9A 4OXPA 3TSSA 1KDBA 1PZKD 3GDEA 4RKBA 2JEBI 1JWSD 1UAPA 3HKZB 4RHSA 3L2PA 3J7ZC 5IP7H 4LF7Q 1VQCA 4FXKC 5H1SE 5LMNQ 1E24A 4HIOA 4JBJA 1JJGA 4X3SA 2F0WA 2LS01 4FXGC 4JI1L 5C44H 4IUNA 3D4RA 5IYBH 2YU9B 3HOZB 2PPBC 4XDXA 4IPDA 1I6HB 4X62Q 1YHQA 2JA6G 1Z6HA 1EY7A 2VS1A 5FLMG 1XX8A 5E7NA 2LY7A 5EPKA 4FF4A 2MUYA 5LHY1 4QCLA 1SMYC 1X3EA 2CHBD 1EIFA 2F4IA 3S14B 2Z6KC 2F3VA 1MBYA 4P71A 4AYBG 4HIKA 1VF7A 4LF7L 2K5VA 3TS0A 4A3KH 1RDPD 1XTDA 2RHQB 2F3IA 3CD6A 3S2DB 1ESRA 1U4MA 3CW2C 5IIFA 5EPLA 1TQOA 3CAMA 1U0LA 3PO3B 1D1KA 2DGYA 4DPGA 3O13A 3Q22A 3T1YQ 5EBCA 3QB3A 4R8IA 2LSSA 3VR4A 3C1FA 2LMCB 4X64L 3HG9A 3PF4A 4GN5A 2KHSA 3ERSX 4B3RQ 1R9TH 3PIPA 3EN2A 4UP7A 4A3DH 5IGGA 3PSIA 3S1NH 3GTGB 1TKWB 4C1NK 2RSOA 1W6JA 1PRTB 3GTMH 1Q86C 1N36Q 2EYMA 4TQUS 4I65A 2A6ED 2HDLA 3K0XA 1PLFA 1HNWQ 1N9WA 1LO5D 3NELA 1K3BC 3RLOA 4LUVA 1BBUA 5EAYA 3K8AA 3NQTA 2FMCA 3KF8A 1BCPC 3NWTA 3CRKC 5C4HA 3NBHB 1PH4A 4DR1L 1CHPD 1GUGA 4B9WA 4HSPA 1ICWA 4DU9A 3S1RB 1GUWA 3BDLA 1CHQD 3C2PA 2XTIA 3PO2G 5DEHA 1B44D 4C3HH 2OXPA 5J39A 4A3DB 1EYAA 2NBFA 4NDXA 1Q7YC 1SYEA 3HOYG 4DV5Q 5HGQA 2JXMB 1EL0A 1ML0D 4N8X1 4KI0A 2R93G 4KHZA 1GXDC 2PZWA 4A3EG 5D3DA 5C0XH 1K8GA 4LF6L 5M3FH 4APVA 1AFPA 3MXGA 4LFAQ 3UDIA 4OIJA 3M85A 1GUNA 4GLAC 1LT4D 3I3CA 5EKKA 2NVXB 5EQ0A 1CKNB 4NP5A 3T1HL 2AUJD 3KLRA 3AFQA 3DUZA 3P7JA 5LMUQ 4CDFC 4CJ2C 4UPAA 4A3LG 4Q5VA 1PYSB 1KAWA 1VMCA 1KIXA 2C35B 3Q0AA 3KF6B 3SDZA 2NN6H 4J15A 2L5TA 1Y14B 4GN3B 4WORA 5M3MB 3U9SA 2L0CA 4YCWA 1A3TA 1GOZA 2YTXA 1TVXA 5CGKA 1ZKOA 3NSWA 5IGCA 3GTPB 1L2FA 1NR2A 3GTQH 2SNMA 2WFWA 4HJ8A 1EWIA 3MXNB 4BA2I 5IGEA 1RTNA 2B2UC 4LFCL 1PMRA 2ZXPA 2E8GA 3M4OH 2XRQD 2JEAI 2ZTDA 3MA2B 1VQPA 4J8QA 1OXUA 4A76A 1Q81C 3NHHA 1KRTA 4DV4L 2EY6A 2UUAQ 2L12A 1QCBD 1EU4A 1HXYD 3WDNA 3D0FA 1IBKQ 2A73B 3OIPA 2AQ2B 2UUBL 4A3FB 3MEHA 2RDFA 5M3FG 3Q6SA 4BXXH 4YHHQ 1QNKA 1KHIA 5M5WB 4A4IA 1KLGD 2UUCQ 3MFGA 3AFPA 1GO3E 2MQHA 1KDCA 4KKSA 1QOHA 3EBEA 2B2WA 5T1IA 3D6WA 4TVAB 2R3ZA 1K8AC 1JT8A 1EY8A 4K8JA 2MP1A 1ILQA 1ESFA 4H02A 4PZ7A 2F0LA 1B1ZA 4JI2L 4YCVA 4QJFA 2PMZB 4DR5L 3KJPA 3C1EA 3TP6A 2WINB 5GAGC 4JG2A 2K04A 5GQOA 1GM5A 1IL8A 3QR8A 3NUCA 3SK4A 4BWGB 4A3JG 3LX0A 4CJ0B 2EJMA 2LFNA 5J3BA 2FINB 3D4WA 1U9RA 2I46A 3I4OA 3TN2A 1C7YA 1L1OB 4L8JA 5IP9G 1A0IA 1RTOA 1HJPA 3TP8A 4A3GB 4KKTA 3RD4A 1U4PA 2OF1A 4BBRG 5BN5A 5HURA 5AJ3L 3M3YH 3A5UA 2D62A 5KNCA 3TEHB 5C44B 4K0KL 3H15A 2F0GA 4JI7L 3VR3A 2WB1G 3QOJA 1I3QB 5E4WC 1IYJB 3J80i 2M00A 1RF2D 5HGTA 5CBEE 4HJ9A 5KGUA 1H9RA 2F0SA 4RHRA 1HA6A 1Q12A 2B29A 1SYGA 1KRSA 1IL2A 3R8BA 1HCZA 4A3KG 2N55A 4HCEA 4LMQD 4QGUA 5M5XB 1L1OA 1QB5D 3I56A 2Z8LA 1SLJA 1C8CA 1WVLA 5C6AA 1G8ZD 4A3GH 1GJXA 2C5CA 2R92G 4DV0Q 2DNCA 5TSSA 2EYOA 4FF2A 4JW0A 5IODA 1PHJA 4CDCC 2B39A 2OEOA 4AIMA 5A2QE 2GN5A 2HQLA 2PYKA 3VA7A 2PI2A 1FNVA 4MIUA 4F87A 4IUPA 2DJGC 1CKMA 1WFQA 3ZJYC 2OTJA 5IYBG 2PMZE 3BS1A 1FL0A 3K6OA 2R92H 2OTLA 3L9AX 1C9OA 4PQXA 1U5KA 2YTVA 3SXHA 1IW7C 2AMCB 5CV8A 4RGOS 1I6VC 4DV7L 1HQRD 1XNQQ 1DM0B 4JPBW 4KV6A 5EKLA 1NR4A 5C4XB 4G7HC 3QG1A 1KAAA 1N32L 3KLSX 1BQQT 3M4QA 2ICIA 3RN2A 4QQBX 1EU3A 5CMDA 2ZJPA 5JVG3 4NPSA 4GLVB 1DD2A 1CZWA 1HH2P 3STBC 3T56B 5M5WH 4JI4L 3TBIB 1X65A 3F2UA 2EQSA 5EKIA 1JJCB 1VQFA 3KOJA 4IOCA 1TWGH 1YVCA 1OXVA 2D0PA 4JVZA 3CCUA 2A1AA 5IP9H 1I94L 2ZM6Q 1LT5D 1LT6D 1SROA 1PTOH 1Z9FA 1SN8A 1VQMA 3X3NA 1QILA 2CH4W 3NP8A 1TWCH 3U4VA 4IUQA 4ALPA 2JE6I 1DXMA 4DKAC 1KNEA 3GTOB 2PNRC 2CW0C 3NPPA 2UXBL 4JI5Q 5M9OA 3EFXD 3K58A 3H3VC 2EY5A 2L4NA 5CV4A 1F9QA 1WCMG 2EYPA 3TREA 4FXDA 1PDQA 1WJJA 4V0BA 1V9PA 4BBRB 1CQFA 3KJOA 2K1BA 1C48A 3U9OA 4G4KA 2ZM6L 3PO2B 2F0OA 3M4OB 2HCIA 3H91A 2Q8RE 4JI6Q 4DNRB 3CU7A 2IJ0A 2Q2IA 4GKJL 4OIKA 1EIGA 3KDFA 1PRTD 5FLXc 2YTYA 2B8FA 2EPBA 2HHHL 3FPUB 4ZYSA 4BXXG 1VQOA 4A3JB 4B3TL 2FXQA 2F0EA 3GTQB 4DV3Q 2CFMA 3K0YA 1CSQA 1TWHH 1E7ZA 1DOKA 2N88A 2AKWB 2K32A 3BG3A 4NMZA 2F0VA 3BZDB 3P20A 2A8VA 2RA4A 1YJWA 3FPPA 2HT1A 1TU2B 1WCMB 5E1FA 1SEBD 1U4RA 1FD7D 2HIVA 2E2JB 4LFBQ 4BY7H 4JI2Q 1CM9A 4R4IA 4RH6A 2E74C 2Y0SG 4ULLA 3E5SA 5KIXA 4QB4A 1Z47A 4IFDH 4FO2A 3RZDB 2E5LL 1Q1BA 2F52A 2KCMA 2Q2TA 3UI2A 2NN6G 4F7XA 1V8QA 3OSOA 1KD1C 4FDBA 3H09A 3NTKA 4OHJA 1RCVD 2PW5A 2IX1A 1D8LA 2VB3X 4OX9Q 1DOMA 5I9PA 2EYJA 5C3EH 3D4DA 3CCSA 4B3ML 1ZYRC 1S3OA 4POGA 3GTMB 1X3QA 1ICFB 1JWMD 1SNOA 4IURA 3IL8A 4EVOA 5CORA 1JE5A 5C4JH 1H9SA 2IT1A 1SYDA 3NENA 4A3FG 4K2LA 3T16A 2VL6A 2E2DC 4RCNA 4L5RC 2HIXA 1SYBA 4LFBL 2R93H 3MTSA 4AH6A 2ES2A 2Z4HA 1SE8A 1O80A 5HY6A 1YBYA 1B8AA 2R6GA 4EGVA 3PGZA 2PCFB 1N8RC 3SE0A 2OCEA 2M2LA 1AE2A 1D1IA 3CCRA 3PO2H 3D3RA 4Z9CB 5M5YH 1CK1A 1BUVT 4IFDI 1A62A 1S5ED 1YNND 3P75A 5IYDH 4M1UB 4C3IH 1S5BD 2LKVA 2K52A 1M8AA 2R61A 1NUCA 3U50C 4RCOA 3PUXA 5IYCH 4JI1Q 1JC7A 1H9SB 3A74A 4LF5L 1HUNA 2KCTA 3DEOA 3VR2A 3RR5A 3HOYB 1CZGA 2OQKA 5FLXE 2Q2UA 1PH3A 5IE8A 3A7LA 3CKIB 3T1HQ 3OOCA 4Q0FA 1TWGB 4CKBA 3KK7A 1PTOD 4A3DG 3K5LA 3ULPA 1EY5A 3RNUA 3PV0A 1AZPA 2TMPA 1BXTA 4TKOB 3CCQA 1ZYRD 1UNSA 3Q24A 2L55A 3JAME 2L11A 3DWPA 2QCPX 5FKAC 3T1YL 1FJGL 1BF4A 1TR5A 3M9BA 2O4XA 4QUCA 4UP8A 2K01A 2K5DA 3AEVA 1L1OC 1VQ7A 4LAAA 4JBMA 2KHJA 4GKKL 4OWWB 4A3BG 3CPFA 3JC66 2VXWA 5JEAG 5AFWA 3HOXH 3HOWG 2E2HH 4MHEA 1B9NA 4JBKA 2BCOA 2JA7G 3A54A 4C56C 2SEBD 3NE5B 4XT3B 4C3JH 1SYFA 2B2TA 5L37A 3HZXA 4DR6L 5FLMH 4EQOA 2E75C 4DR5Q 2RSNA 4A3MH 2Y0SB 3MFYA 1STNA 4C2MH 2CWAA 3HS0C 1KXLA 3FVQA 2QEXA 1K8MA 5C3XA 1PH6A 5CBAE 3S15H 3RZOB 1PTOF 2KBNA 4KD3A 2IWHA 5ELBA 1EFID 1BCPD 1PRTC 1DONA 2LXKA 4IZ8A 2Z0SA 4GKJQ 4XYQA 4C3IB 1YHBA 3CMEA 2F0MA 2AHOB 4JI6L 1LTTD 4MTNA 1VCIA 4LFAL 5KNBA 3CC7A 2K03A 1HNXL 3HOZG 1I6HH 1HA5A 1WTVA 1CA5A 2RBMA 2AWOA 5CV9A 3P1HA 1PFMA 4H13C 4ZRZA 4FP5D 3FHWA 1HZBA 3Q8DA 1A2TA 2KHIA 1HNZQ 1N33L 4BS9A 3I4NG 2JA8H 3R2IA 1IKMA 3H94A 1BNZA 5JAVA 4L5SA 1D5MC 2ZJRA 3F2CA 2XRSD 1PXUA 2JA6B 2GA4B 4A3BB 1C0AA 4WJ3M 4P72A 1B4OA 1LUZA 3HKZG 3KLWA 4RGNA 2XVSA 2PW7A 4B3SQ 4A3MG 5IWAQ 2I0QA 2C9OA 5IGFA 2WP8J 1CTMA 4UHVA 4LFCQ 1RODA 1ENAA 3PUZA 1S4ZA 4JC0A 3EA6A 2NVYH 2H4OA 1HFGA 1NAPA 1PFBA 4DV6Q 4JV5Q 3NBIA 2EZVA 3VA5A 2JA8B 1L0XB 3ICEA 1WTPA 4A3BH 4G7ZC 2K7VA 3AQQA 3GTKH 1EY9A 3I2ZA 2R7ZB 4AQYL 1BKBA 1FVIA 4JI5L 3SK5A 3A8IE 1TY0A 1B70B 1RIPA 3K80C 4YY3L 3HOUH 2O2LD 1O7LA 2RCNA 3T13A 3S1QB 1I4PA 3I73A 2VQEL 2NVYB 2A6HC 4GOPC 3G48A 3DLLA 1PH9A 3OPOA 1CKOA 3B6YA 3CHBD 3DHQA 2VZAA 3K57A 3S1MB 2UXCQ 1PTOB 1XPOA 2B2WC 5A2QL 3KYHC 5FO8B 1JICA 2YU9H 2WAQE 4N9TA 1UE1A 1VQIA 3C46A 1QVGA 1Y1WG 1E3PA 3TZUA 2JA5G 4LF5Q 4A3MB 1HNWL 1QVFA 1LT3D 1YNXA 1F2MA 1VQJA 2SOBA 5I6WA 1Q3LA 1X54A 3HOUB 3EQLC 5E3FA 3DWQA 1E2ZA 1X56A 2EIFA 5IYCG 1IBMQ 3UE0A 2IL8A 3H0GH 1XNRQ 2EXZA 1KC8C 3BYTB 1RKNA 5A35A 1I50H 1K83B 4P2CB 2NVQH 1OTCA 2QF7A 4C3IG 1XXGA 1HQMC 2KUMA 4PMBA 1QNUA 1WTRA 1PH1A 3GV6A 1OXXK 3PF5A 1Q82C 1STBA 2B8GA 4Y7NB 4BY1G 2R7DA 2F0IA 1Z7TA 3NXWA 5ELFA 2PI2E 4HMIA 3KLSA 4X62L 4CDDC 1VMPA 4C2MB 4MNOA 4CBVA 3KBGA 4GKKQ 3D6CA 1QZHA 2YV5A
chains in the Genus database with same CATH topology
2JP1A 3QO2A 3OMCA 2F0TA 2DY8A 4KKUA 5C3WA 4HCSA 1DOLA 4AYBB 1HHVA 1U4LA 2E76C 3I91A 2XSCA 5C4JB 2KECA 4HEDA 4BBSB 1A2UA 4G7OC 2XIWA 1EWHA 1DZ1A 2HQEA 4XYOA 1B50A 3QJYA 4IFDG 3D31A 4KN7C 4ZUIA 1B3AA 1T5XD 3K7AB 4KY7A 1GHJA 4DGZA 1A15A 4EQNA 3OW7A 2JA7B 3S1NB 4J6HA 1BDOA 3GQBA 3OWEB 3BVMA 5M5YB 3EROA 2A68D 3A8KE 5M3FB 3IFDA 2E2IB 1SDFA 1BCPB 1CI3M 2A69D 2B2TC 4ODGA 5I4DA 1A3VA 1L0YB 2KJXA 1STYA 2B2YC 1DCZA 4DN4M 1TWFB 3NK9A 3MAQA 1JOOA 3FMCA 4WRDA 4X3KA 3VYRA 5FOBB 5K36G 1ILPA 4BY7B 1AZQA 3PUWA 2EY2A 1SBBB 5FO7B 1SE2A 1PZJD 2FJ2A 4R8NA 2NTTA 5KNDA 5C0XI 1IKLA 3M7GA 4MN3A 3MC0B 2ZXRA 3W2DA 4DF7A 5G3LD 2F0HA 4ZLTF 1DJRD 3TDQA 4K2KA 3LWUA 1CQVA 5EGTA 2D5DA 4N9PA 4K5XA 5DAUA 2G9DA 3S16B 3S17B 1HUMA 5IT9L 2J0TD 2XWBB 5CV5A 4KTAA 1Y1VB 4K5WA 2EYLA 1LTRD 4QF4A 1G2SA 3H0GB 4X3UA 3QWNA 4C3JG 2RDGA 2EVBA 4S3SA 2B2VA 3H6MA 1JWUD 1FNWA 5C5LA 5LL6X 1YNJC 2WV6D 1EYDA 1ZEQX 3I90A 2MJ8A 3DXJC 2K6AA 4K14A 1LABA 3C3LA 4L63B 4B08A 4K6LA 3E6ZX 1QG7A 2B2UA 3DWAA 1FNUA 5FK9C 3T4AC 5I2XA 1WTQA 1IYUA 4FVMA 4J1MA 4HAEA 1X32A 3FDTA 3VYTA 1H9JA 2K05A 4CHTB 2I07B 1XWEA 2B63B 3NQIA 1ET9A 2BE5D 2NYZD 1MGSA 3PIP3 1PTOC 2G9HD 1JOKA 1R4QB 1TS2A 2L1BA 2F0NA 3ZYYX 1LLRD 1QJOA 2A74C 1HRJA 2IX3A 3I72A 2J7ZA 5D3IB 3AMUA 1SE4A 1S5CD 3N6RA 3GTJB 1E2WA 1PZID 4DK1A 3J7AV 1YNNC 3DM1A 1LTID 2F1MA 3PUYA 4KJOA 3N52A 3R93A 5DM63 4IN3A 5COYA 2ICEC 1SNCA 1SYCA 1EQVA 2ID0A 1EQTA 2F0PA 2WAQB 4KK7A 4A3EB 1KNAA 2BDOA 1RD9D 2TSSA 4K8IA 4JK1C 4H7BA 2F0FA 4RGTA 4DK0A 1TT2A 4IUUA 1BR9A 5C5MA 4WJWA 1WD0A 2EDGA 2VNUD 1V1PB 3RLFA 1EZ8A 2RDHA 3GP7A 5KYIA 3MHBA 2AUKA 4PMWA 4YIJA 4O42A 4ZQ3A 4H0LC 4KN4C 4CGYB 3QIAA 5D14A 5JPNC 1F2YA 2A6EC 2EYHA 3SHLA 1TY2A 5C0XJ 2Z4IA 4LK1C 1STGA 4A93B 5C0XG 3ITPA 3SEBA 1SJHD 4DA2A 5JOBA 3I4MB 3VYSA 4CKEA 3V2TA 5JEAJ 2RKSA 2YYZA 4OL7A 4IFDJ 5K5PA 5DNFA 4K6DA 5NUCA 1EEFD 1MD2D 2F0QA 1PFNA 5IGDA 2NWGA 1I50B 3HGBA 3MZ5A 1KABA 3AU7A 1V1PA 3IFTA 4ABNA 4KJNA 1LTGD 3S15B 1RJTA 4UDUC 3T53B 2D2CC 2Q8TA 1MSHA 2DY7A 1WTXA 2EY1A 2KEEA 3J7AF 2IW3A 1D6EC 2JA5B 3NTHA 2KCCA 2XNAC 5KRUA 3K59A 2BOSA 4EQPA 1TWHB 3IKJA 5E4XA 1OXSC 2JSOA 1G6ZA 3D8GA 2IPKD 1EEID 2L9HA 3EJIA 3SK6A 2PZUA 4FYDA 1HFNA 3J81L 2M9VA 3MVVA 2NVQB 4DXFA 1OO9B 5JVH3 2F0DA 3MWYW 1CFMA 5BN4A 1R9TB 2MPMA 3BYYB 1J8IA 1SAPA 2CW0D 1II3A 4RFBA 1EIHA 4DXGA 2AWNA 1G291 4FNFA 3QOLA 1STHA 3VYUA 4DAVA 3DMUA 3J80L 3M7NA 2K5QA 3BDOA 3OIQA 1JOQA 2KEDA 3EVQA 2VUMB 1SJED 1GUTA 1LTBD 1E2VA 1ET6A 2OT2A 1KDAA 1KLUD 3SVMA 2PQEA 4RAUC 1PYWD 4TRDA 4WFN3 1BCPF 2A68C 1IHZA 4IQZA 1VF5C 3OMGA 3A55A 4XTCS 2QKIC 1SSOA 1Y69U 5K36H 1PRTF 4OGQC 2K5WA 4GZYC 2Q8IB 5FLXL 3GV3A 4O1NA 4XXEA 3ERQA 4NW2A 2ENBA 2MGSA 3CQZB 1TS3A 1BO0A 2O5JC 5C4ZA 3OHXC 2WACA 3E0JA 3ND8A 4RGMA 1F2LA 4F88A 2MHVA 4BA1I 1STEA 3LNNA 4R9WA 2AQ3B 1W6KA 3J81E 3NTIA 2WIIB 2BA1A 1IYVA 1EOTA 5ELEA 2B2YA 3GTKB 1JE4A 1I4GA 4DAPA 2O5IC 2HUGA 4ZUJA 1UUPA 3HRZC 1Q8IA 1MI2A 1AP0A 1SE3A 4XQJA 5CV7A 4ME5A 3SK8A 2EE1A 3J80E 3HP3A 1QWYA 3GD7A 1Y8PB 5ISRA 1CA6A 5J1ZA 1TS5A 3RMHA 1WTOA 3RUZA 2X6LA 3WOFA 2F0UA 1LTAD 3VR6A 2DN8A 1JCKB 1I4HA 4ZKBB 2V4DA 1J9OA 4C3HG 2KQ3A 2KVMA 4UAIA 1GUOA 2F0JA 1HTLD 1TIID 1HPCA 5DM73 1A6XA 5KEEA 2NVTB 4I7ZC 4LJZC 4HSVA 3Q23A 2RQXA 1AEXA 1O7YA 1F77A 3TMEA 1Q90A 4FF3A 4XQQA 3G6JB 1SNQA 4FF1A 2NUCA 5FO9B 1XYIA 1H9MA 3GO5A 2FFKB 2HCCA 4M8AA 5JJZA 4RKLA 2EOTA 5F2DA 2A5HA 5EPJA 1E0BA 2A69C 2X69A 5BN3A 1O7ZA 1WD1A 1VDZA 1SNMA 2D9UA 3X3MA 2FMMA 2AQ1B 5C3EB 1EWCA 1F9RA 4A3KB 3LWEA 1ZXTA 3G7LA 4PNYA 2IX0A 2SDFA 5IGBA 3S2HB 2BDNA 1JORA 1EYCA 4ID6A 2EYFA 3I8ZA 2QILA 2NN6I 2K33A 1Y8OB 1SXTA 2BA0A 3BDCA 3I4LA 1JR0D 4NKLA 3L7ZC 3TP7A 5ELCA 2KOLA 4G57A 4QMGA 1LACA 1ENCA 4ILWA 1TS4A 5IOCA 4XIGS 1NCVA 1JQYD 5I2YA 1FGBD 1STAA 2CQAA 3KBXA 5D65A 4C1NI 2QEJC 2JYOA 3S9WA 1EZ6A 1I4RA 3VR5A 4C3JB 3TP5A 5CV6A 3MXNA 1NSNS 5I9OA 2EJFC 3OWFA 1MSGA 3ONAB 1B53A 1LTSD 1YNJD 2ZT9C 1RHPA 3HOVB 4OO1G 1D5XC 1D5ZC 1JB3A 2EJGC 1Q1EA 1UEAB 3V05A 4QIWB 5CC4A 3HOXB 3SR1A 2RVLA 4ZK9B 3JAML 3L3OC 4L6TB 1I4XA 5JEAH 2PO4A 4U673 1AN8A 5JPMC 1V43A 1KTKA 5ELDA 1HTPA 1FYCA 3NWSA 3FKIB 4E6IA 3URYA 3K5NA 3TZDA 2H1EA 5KYLA 2NB0A 3CRLC 4IUTA 3A8JE 4C3HB 5I6YA 4DNTB 3WOEA 1BOSA 1QE6A 4ZKCB 2BE5C 2XN9C 1XTCD 2KCNA 1H9KA 5CR3A 5EBDA 3PIO3 1EY6A 4DAYA 3W3AA 1V1OA 1O78A 2R93B 1WTWA 1IW7D 2R92B 1C4QA 1G2TA 2F03A 4HR7B 1AW7A 1S5FD 4CKCA 3A56A 1B2TA 4V190 3T51B 1SFOB 1FR3A 4U68A 4KY5A 2WB1B 1K8OA 1A3UA 3A7AB 1ENFA 3NBHA 4HN7A 4H44C 3MXPA 4HTHA 1SMYD 3DEPA 1BBXC 3IAYA 4RWSC 4K5VA 2WKCA 3I4NB 2E2HB 2J4XA 3FEWX 4KD4A 1CT1D 3GTLB 5T1GA 4ZAIA 1T5EA 2F0KA 1B9MA 1F9SA 1F2ZA 1SNDA 1Y8NB 3HEJA 2FHTA 4IUVA 5LL6S 1GHKA 4OO1I 3ND9A 2XWJB 1M4VA 3MXUA 4B9XA 4F8MA 1G91A 4TSSA 2WKDA 5IT9E 2KA7A 2Z1CA 4PMCA 2K28A 3I70A 2ZXOA 2X6GA 2NZ1D 4KY6A 4KHVA 3KUPA 2B2VC 2PZTA 2A6HD 4A3IB 3BVGA 5J22A 1S5DD 4XT1B 2CVRA 4BY1B 1X3PA 4RA8A 1Y1WB 2HDMA 3PUVA 4X3TA 4KMUC 4DFAA 4XQNA 3R3OA 2NTSA 3HOWB 1R4PB 1SNPA 2SNSA 3M4YA 1DYQA 1GUSA 2F3WA 3J7YW 3M3YB 1OXTA 2VB2X 3K5OA 1TWAB 1TWCB 3K5MA 1ONLA 3AB9A 4OO1H 1I4QA 4PV1C 1EY4A 4HMJA 4CJ1B 3BVZA 5G3LF 2QDBA 3R2TA 1EY0A 5CYUA 3PMFA 5EJWA 1D2BA 1F9PA 4JBWA 3FRPB 2DNEA 4QUFA 4IALA 1LV9A 3TSSA 1KDBA 1PZKD 4RKBA 2JEBI 1JWSD 1UAPA 3HKZB 4RHSA 4FXKC 4X3SA 2F0WA 2LS01 4FXGC 4IUNA 3D4RA 2YU9B 3HOZB 2PPBC 4XDXA 1I6HB 1Z6HA 1EY7A 1XX8A 2LY7A 5EPKA 4FF4A 2MUYA 5LHY1 4QCLA 1SMYC 2CHBD 2F4IA 3S14B 2F3VA 1MBYA 1VF7A 1RDPD 3S2DB 1ESRA 1U4MA 5IIFA 5EPLA 1TQOA 3PO3B 1D1KA 3O13A 3Q22A 5EBCA 3QB3A 4R8IA 3VR4A 3C1FA 2LMCB 3HG9A 2KHSA 5IGGA 3GTGB 1TKWB 4C1NK 2RSOA 1W6JA 1PRTB 2EYMA 4TQUS 4I65A 2A6ED 2HDLA 1PLFA 1LO5D 3NQTA 2FMCA 3KF8A 1BCPC 3NWTA 3CRKC 5C4HA 1CHPD 1GUGA 4B9WA 4HSPA 1ICWA 4DU9A 3S1RB 1GUWA 3BDLA 1CHQD 3C2PA 5DEHA 1B44D 2OXPA 5J39A 4A3DB 1EYAA 2NBFA 4NDXA 1SYEA 2JXMB 1EL0A 1ML0D 4KI0A 4KHZA 1GXDC 2PZWA 5D3DA 5C0XH 1AFPA 3MXGA 4OIJA 3M85A 1GUNA 1LT4D 3I3CA 5EKKA 2NVXB 5EQ0A 4NP5A 2AUJD 3KLRA 3DUZA 3P7JA 4CJ2C 4Q5VA 1VMCA 3Q0AA 3SDZA 2NN6H 2L5TA 4WORA 5M3MB 3U9SA 2L0CA 1A3TA 1GOZA 1TVXA 5CGKA 1ZKOA 3NSWA 5IGCA 3GTPB 1NR2A 2SNMA 4BA2I 5IGEA 1RTNA 2B2UC 1PMRA 2ZXPA 2XRQD 2JEAI 3MA2B 4J8QA 1OXUA 3NHHA 2EY6A 2L12A 1EU4A 1HXYD 1QCBD 3WDNA 2A73B 3OIPA 2AQ2B 4A3FB 3MEHA 2RDFA 3Q6SA 1QNKA 5M5WB 1KLGD 3MFGA 1KDCA 4KKSA 1QOHA 2B2WA 5T1IA 3D6WA 2R3ZA 1EY8A 4K8JA 2MP1A 1ILQA 1ESFA 2F0LA 1B1ZA 2PMZB 3C1EA 3TP6A 2WINB 2K04A 1IL8A 3NUCA 3SK4A 4BWGB 3LX0A 4CJ0B 2EJMA 2LFNA 2FINB 3D4WA 1U9RA 2I46A 3TN2A 4L8JA 1RTOA 3TP8A 4A3GB 4KKTA 3RD4A 1U4PA 2OF1A 5BN5A 5HURA 2D62A 5KNCA 5C44B 2F0GA 3VR3A 3QOJA 1I3QB 5E4WC 2M00A 1RF2D 5HGTA 5CBEE 5KGUA 1H9RA 2F0SA 4RHRA 1HA6A 1Q12A 1SYGA 3R8BA 1HCZA 2N55A 4HCEA 4LMQD 5M5XB 1QB5D 2Z8LA 1C8CA 1WVLA 5C6AA 1G8ZD 1GJXA 2C5CA 2DNCA 5TSSA 2EYOA 4FF2A 5IODA 2B39A 2OEOA 5A2QE 2PYKA 3VA7A 1FNVA 4MIUA 4F87A 4IUPA 3BS1A 3K6OA 3L9AX 4PQXA 3SXHA 1IW7C 5CV8A 4RGOS 1I6VC 1HQRD 1DM0B 4KV6A 5EKLA 1NR4A 5C4XB 4G7HC 3QG1A 1KAAA 3KLSX 1BQQT 2ICIA 1EU3A 5CMDA 5JVG3 1DD2A 1CZWA 3T56B 3TBIB 3F2UA 5EKIA 1OXVA 1LT5D 1LT6D 1PTOH 3X3NA 1QILA 3NP8A 4IUQA 2JE6I 1DXMA 1KNEA 3GTOB 2PNRC 2CW0C 3NPPA 5M9OA 3H3VC 3EFXD 3K58A 2EY5A 2L4NA 5CV4A 1F9QA 2EYPA 4FXDA 1PDQA 4V0BA 4BBRB 1CQFA 2K1BA 1C48A 3U9OA 4G4KA 3PO2B 2F0OA 3M4OB 2HCIA 3H91A 2Q8RE 4DNRB 3CU7A 2IJ0A 4OIKA 1EIGA 1PRTD 2B8FA 2EPBA 3FPUB 4ZYSA 4A3JB 2F0EA 3GTQB 3K0YA 1DOKA 2N88A 2K32A 3BG3A 4NMZA 2F0VA 3BZDB 3P20A 2RA4A 3FPPA 1TU2B 1WCMB 5E1FA 1SEBD 1U4RA 1FD7D 2E2JB 1CM9A 4RH6A 2E74C 4ULLA 3E5SA 5KIXA 4QB4A 1Z47A 4IFDH 4FO2A 3RZDB 1Q1BA 3UI2A 2NN6G 4F7XA 1V8QA 3OSOA 3H09A 3NTKA 1RCVD 4OHJA 2PW5A 2IX1A 2VB3X 1DOMA 5I9PA 2EYJA 3D4DA 1ZYRC 3GTMB 1X3QA 1JWMD 1SNOA 4IURA 3IL8A 4EVOA 5CORA 1H9SA 2IT1A 1SYDA 4K2LA 3T16A 2E2DC 4RCNA 1SYBA 3MTSA 2Z4HA 1O80A 2R6GA 4EGVA 2PCFB 3SE0A 2M2LA 1D1IA 3D3RA 4Z9CB 1CK1A 1BUVT 4IFDI 1S5ED 1YNND 3P75A 4M1UB 1S5BD 2LKVA 1M8AA 2R61A 1NUCA 4RCOA 3PUXA 1JC7A 1H9SB 1HUNA 3DEOA 3VR2A 3HOYB 1CZGA 5FLXE 3A7LA 3CKIB 3OOCA 4Q0FA 1TWGB 4CKBA 3KK7A 1PTOD 3K5LA 1EY5A 3PV0A 1AZPA 2TMPA 1BXTA 4TKOB 1ZYRD 1UNSA 3Q24A 2L55A 3JAME 2L11A 3DWPA 2QCPX 5FKAC 1BF4A 1TR5A 2O4XA 4QUCA 2K01A 2K5DA 4LAAA 5JEAG 2VXWA 5AFWA 4MHEA 1B9NA 2BCOA 3A54A 4C56C 2SEBD 3NE5B 4XT3B 1SYFA 2B2TA 3HZXA 4EQOA 2E75C 2RSNA 2Y0SB 3MFYA 1STNA 3HS0C 3FVQA 1K8MA 5C3XA 5CBAE 3RZOB 1PTOF 4KD3A 2IWHA 5ELBA 1EFID 1BCPD 1PRTC 1DONA 4IZ8A 4XYQA 4C3IB 2F0MA 1LTTD 1VCIA 5KNBA 2K03A 1HA5A 1WTVA 1CA5A 2RBMA 2AWOA 5CV9A 3P1HA 1PFMA 4H13C 4ZRZA 4FP5D 1A2TA 4BS9A 3R2IA 1IKMA 3H94A 1BNZA 5JAVA 1D5MC 2XRSD 1PXUA 2JA6B 2GA4B 4A3BB 1B4OA 4RGNA 2XVSA 2PW7A 2C9OA 5IGFA 2WP8J 1CTMA 1RODA 1ENAA 3PUZA 1S4ZA 3EA6A 2H4OA 1HFGA 1NAPA 1PFBA 3NBIA 2EZVA 3VA5A 2JA8B 1L0XB 1WTPA 4G7ZC 2K7VA 1EY9A 2R7ZB 3SK5A 3A8IE 1TY0A 2O2LD 1O7LA 3T13A 3S1QB 1I4PA 3I73A 2NVYB 2A6HC 3OPOA 3CHBD 3DHQA 3K57A 3S1MB 1PTOB 2B2WC 5A2QL 5FO8B 1JICA 4N9TA 3C46A 3TZUA 4A3MB 1LT3D 2SOBA 1F2MA 5I6WA 1Q3LA 3HOUB 3EQLC 5E3FA 3DWQA 1E2ZA 2IL8A 2EXZA 3BYTB 1RKNA 5A35A 1K83B 4P2CB 2QF7A 4C3IG 1XXGA 1HQMC 2KUMA 4PMBA 1QNUA 1WTRA 3GV6A 1OXXK 1STBA 2B8GA 4Y7NB 2F0IA 1Z7TA 3NXWA 5ELFA 4HMIA 3KLSA 1VMPA 4C2MB 4CBVA 3KBGA 3D6CA 3V96A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MEH A;  2RDF A;  2EYM A;  3MXP A;  2F0V A;  1STG A;  4I65 A;  4NMZ A;  3OMC A;  3SHL A;  4HTH A;  2F0T A;  2PW7 A;  2F0D A;  4RKL A;  5C3W A;  3ITP A;  1JOK A;  5F2D A;  3SXH A;  5IGF A;  4IAL A;  4K5V A;  1ENA A;  4DF7 A;  5CV8 A;  1TR5 A;  2F0H A;  2O4X A;  3NQT A;  5E1F A;  5JOB A;  1II3 A;  5CC4 A;  1KDC A;  1KDB A;  2F0N A;  4KD4 A;  4KV6 A;  3V2T A;  4K2K A;  4RKB A;  3SR1 A;  2RKS A;  5EKL A;  5C4H A;  4LAA A;  4ZUJ A;  4OL7 A;  1A2U A;  5EGT A;  3E5S A;  1KAA A;  5K5P A;  4B9W A;  1EY8 A;  3QOL A;  2HQE A;  4N9P A;  4K8J A;  4K5X A;  1SNM A;  1STH A;  4QB4 A;  3VA5 A;  4DU9 A;  3BDL A;  2F0L A;  4F7X A;  4K6D A;  5CV7 A;  3DMU A;  3OSO A;  4ME5 A;  5DAU A;  2F0K A;  3SK8 A;  5DEH A;  5NUC A;  1EY9 A;  3C1E A;  4ZUI A;  2PW5 A;  3TP6 A;  2OXP A;  5J39 A;  1EYA A;  4NDX A;  3SK5 A;  5ISR A;  1JOQ A;  1F2Z A;  1SND A;  1SYE A;  3EVQ A;  1SYF A;  2EYJ A;  4KY7 A;  5I9P A;  3HEJ A;  3D4D A;  3HZX A;  3NUC A;  3SK4 A;  3LX0 A;  2F0Q A;  4PNY A;  4KJO A;  4E6I A;  4EQO A;  3T13 A;  2PZW A;  5J1Z A;  4DGZ A;  1KDA A;  2F0W A;  1SNO A;  4B9X A;  4EQN A;  4F8M A;  5IGD A;  5IGB A;  5KYL A;  1STN A;  3MZ5 A;  1KAB A;  1U9R A;  3D4W A;  3D6C A;  4IUN A;  4J6H A;  1SNC A;  2PQE A;  3RUZ A;  5KIX A;  1SYC A;  4TRD A;  1JOR A;  2F0U A;  1EYC A;  1EQV A;  1SYD A;  5CV5 A;  4KJN A;  4PMC A;  5I6Y A;  4K2L A;  2F0P A;  3ERO A;  3T16 A;  3DHQ A;  4KTA A;  5EKK A;  4K5W A;  2EYL A;  3TP8 A;  5C3X A;  1F2Y A;  1EY7 A;  3NP8 A;  1SYB A;  4QF4 A;  4ID6 A;  4NP5 A;  2EYF A;  4KY6 A;  2OF1 A;  4KHV A;  4KD3 A;  1IHZ A;  4K8I A;  5HUR A;  4H7B A;  2F0F A;  2PZT A;  4N9T A;  3OMG A;  4S3S A;  2F0G A;  3BDC A;  1TT2 A;  4IZ8 A;  5CR3 A;  5C5M A;  5M9O A;  5J22 A;  1EY6 A;  2SOB A;  1F2M A;  2EY1 A;  2EY5 A;  3H6M A;  5I6W A;  4NKL A;  2F3V A;  5CV4 A;  2F0M A;  2EYP A;  2KQ3 A;  5E3F A;  3TP7 A;  5C5L A;  3QOJ A;  2F0J A;  4WOR A;  4ODG A;  2EXZ A;  4G57 A;  2M00 A;  4DFA A;  3P75 A;  1A3V A;  5HGT A;  5KGU A;  2F0S A;  1A3T A;  1EYD A;  1EZ8 A;  1RKN A;  1STY A;  2LKV A;  3R3O A;  3U9O A;  5IIF A;  5KRU A;  4QMG A;  2F0O A;  1NUC A;  4K14 A;  5KYI A;  1TQO A;  1SYG A;  5CGK A;  4EQP A;  3MHB A;  5IGC A;  4PMB A;  1SNP A;  3NK9 A;  1ENC A;  2SNS A;  1JOO A;  3ERQ A;  2RBM A;  5IOC A;  4WRD A;  5CV9 A;  2ENB A;  2F3W A;  2SNM A;  3P1H A;  4YIJ A;  1A2T A;  1AEX A;  1STA A;  1STB A;  5IGE A;  5C4Z A;  5C6A A;  2WAC A;  2EY2 A;  2F0I A;  3QB3 A;  4ZQ3 A;  3NXW A;  3S9W A;  3C1F A;  1EZ6 A;  3D8G A;  2EYO A;  3TME A;  1EY4 A;  4KY5 A;  4J1M A;  4HMJ A;  5IOD A;  2KHS A;  3EJI A;  3SK6 A;  4HMI A;  3TP5 A;  3NHH A;  1A3U A;  5JAV A;  5CV6 A;  2PZU A;  4R8N A;  1NSN S;  5I9O A;  2OEO A;  5IGG A;  1SNQ A;  2QDB A;  2EY6 A;  2NUC A;  2F0E A;  3OWF A;  2PYK A;  1EY0 A;  1EY5 A;  3MVV A;  4MIU A;  5KEE A;  2EYH A;  4EVO A;  3PMF A; 
#chains in the Genus database with same CATH topology
 2JP1 A;  3QO2 A;  3OMC A;  2VUM H;  2HD3 A;  2F0T A;  2DY8 A;  4KKU A;  5C3W A;  4HCS A;  5BR8 Q;  2Z6B A;  4POF A;  1VQK A;  1DOL A;  5LMU L;  4GOP A;  4AYB B;  1HHV A;  1U4L A;  2E76 C;  3I91 A;  2XSC A;  1N34 Q;  5C4J B;  2KEC A;  4HED A;  2LXJ A;  4BBS B;  1A2U A;  2Q2H A;  3G6E A;  1DGS A;  4G7O C;  2XIW A;  1EWH A;  4X66 Q;  1DZ1 A;  2HQE A;  4XYO A;  1B50 A;  3QJY A;  4IFD G;  2PNH A;  4A93 G;  4ZCK A;  1Y1V H;  1YEZ A;  3D31 A;  4KN7 C;  4ZUI A;  2MO0 A;  2JA5 H;  1YI2 A;  1B3A A;  1T5X D;  3K7A B;  4KY7 A;  4IJH A;  4MZ9 A;  4X65 Q;  1GHJ A;  4DGZ A;  1EQR A;  1A15 A;  4EQN A;  3OW7 A;  2JA7 B;  4A3F H;  3S1N B;  4J6H A;  2UXC L;  1BDO A;  1X3F A;  3GQB A;  3OWE B;  3BVM A;  4DV1 Q;  2H5X A;  2I5L X;  5M5Y B;  3ERO A;  2UUA L;  2A68 D;  1H95 A;  3BJU A;  1N34 L;  3A8K E;  3HOV H;  2CH4 A;  5M3F B;  4HJA A;  2P5Z X;  3IFD A;  2E2I B;  2ZTE A;  1SDF A;  1BCP B;  1CI3 M;  2A69 D;  1IBL L;  1B7Y B;  4LF4 Q;  2B2T C;  4ODG A;  4O2D A;  5I4D A;  1A3V A;  4DR4 Q;  1L0Y B;  2KJX A;  1STY A;  2B2Y C;  4YWL A;  4JYA L;  1DCZ A;  4DAM A;  4DN4 M;  4DV4 Q;  1TWF B;  3NK9 A;  3MAQ A;  1JOO A;  3FMC A;  4WRD A;  2IY5 B;  3K81 C;  1EOV A;  2RHS B;  4X3K A;  3VYR A;  5FOB B;  5K36 G;  1FJG Q;  4KHP L;  2QW7 A;  1ILP A;  4BY7 B;  1AZQ A;  2E2J H;  3PUW A;  2EY2 A;  1E1T A;  1SBB B;  5FO7 B;  1SE2 A;  1PZJ D;  5JJK A;  2FJ2 A;  4EQ5 A;  4R8N A;  2NTT A;  5KND A;  4DR4 L;  5C0X I;  2VQE Q;  1IKL A;  4HID A;  3S1R H;  3M7G A;  4MN3 A;  3GTG H;  3MC0 B;  4JI0 L;  2ZXR A;  2DUD A;  3W2D A;  4L5T A;  4DF7 A;  5G3L D;  2F0H A;  4ZLT F;  2GVB A;  1SFO H;  1DJR D;  3TDQ A;  1PVO A;  4K2K A;  3LWU A;  3HOZ H;  2OQ0 A;  3GTO H;  1CQV A;  5EGT A;  4O0A A;  1PH2 A;  2E5L Q;  2D5D A;  4N9P A;  4K5X A;  4B3T Q;  1HZ9 A;  1M1K C;  5DAU A;  4QY7 A;  4DV6 L;  2G9D A;  3G71 A;  3S16 B;  1JJ2 A;  3S17 B;  1YIT A;  1HUM A;  4Y7N H;  1TXY A;  4QL5 A;  5IT9 L;  2J0T D;  2XWB B;  2QGQ A;  1VQ8 A;  5CV5 A;  2NVT H;  2JJQ A;  4KTA A;  1Y1V B;  4K5W A;  2EYL A;  4A3C H;  1LTR D;  4QF4 A;  1LM0 A;  4DV2 Q;  1G2S A;  3H0G B;  4X3U A;  4GNX B;  2UXD Q;  3QWN A;  4C3J G;  2RDG A;  2EVB A;  4S3S A;  3OW2 A;  3NEM A;  4A3G G;  2B2V A;  1NE3 A;  3H6M A;  1JWU D;  1CSP A;  3CF5 A;  1XPU A;  1ASZ A;  1KQS A;  3I55 A;  1FNW A;  5C5L A;  5LL6 X;  1HR0 L;  1YNJ C;  2WV6 D;  1EYD A;  1ZEQ X;  3I90 A;  2MJ8 A;  3DXJ C;  4R1J A;  2K6A A;  4K14 A;  4OWX B;  1LAB A;  4JOI C;  3C3L A;  1TWA H;  4L63 B;  4B08 A;  4K6L A;  3E6Z X;  1QG7 A;  2B2U A;  3DWA A;  2XGT A;  1FNU A;  5FK9 C;  3T4A C;  5I2X A;  1WTQ A;  1IYU A;  1J6Q A;  4FVM A;  3UDG A;  4J1M A;  4HAE A;  4BBR H;  4DV2 L;  1X32 A;  3FDT A;  3VYT A;  1H9J A;  2K05 A;  4CHT B;  2I07 B;  1XWE A;  2B63 B;  3J80 c;  2I5M X;  3CC4 A;  3NQI A;  3OYY A;  5DLQ E;  1ET9 A;  2BE5 D;  2NYZ D;  1MGS A;  3PIP 3;  1PTO C;  2G9H D;  1JOK A;  1R4Q B;  3RN5 A;  4A3J H;  4UY8 C;  3UDF A;  4B3S L;  1TS2 A;  2L1B A;  2F0N A;  3ZYY X;  1LLR D;  3KFU A;  3PCO B;  1QJO A;  2A74 C;  1HRJ A;  5IYD G;  1VQB A;  2IX3 A;  3I72 A;  2J7Z A;  5D3I B;  3AMU A;  1SE4 A;  1S5C D;  2JQO A;  3N6R A;  3J81 c;  3GTJ B;  3S2D H;  1E2W A;  1PZI D;  4DK1 A;  3S24 A;  3J7A V;  2A19 A;  1YNN C;  3DM1 A;  1LTI D;  2F1M A;  3PUY A;  4KJO A;  3N52 A;  3R93 A;  5DM6 3;  4IN3 A;  5COY A;  2ICE C;  1SNC A;  3CC2 A;  1SYC A;  3TQY A;  1EQV A;  2ID0 A;  1VQA A;  4DR1 Q;  1EQT A;  2F0P A;  2WAQ B;  4KK7 A;  4A3E B;  3F2B A;  1KNA A;  2BDO A;  2R7Z G;  3A0J A;  1RD9 D;  2TSS A;  1AE3 A;  4K8I A;  4JK1 C;  1K73 C;  4H7B A;  4DV0 L;  2F0F A;  4RGT A;  4DK0 A;  5LMN W;  1D7Q A;  1TT2 A;  4IUU A;  1BR9 A;  2CKZ B;  5C5M A;  4WJW A;  1WD0 A;  2EDG A;  1W2B A;  2VNU D;  1V1P B;  3RLF A;  2EXD A;  2BH2 A;  1EZ8 A;  2RDH A;  4BY7 G;  3GP7 A;  5KYI A;  1IBM L;  1IBL Q;  3MHB A;  4HJ7 A;  2AUK A;  4NXN Q;  2ALY B;  4YIJ A;  4PMW A;  1SR3 A;  1MJC A;  1HNZ L;  4O42 A;  4GNX C;  3RZO H;  2ASB A;  4ZQ3 A;  2NZO A;  4H0L C;  1VQ9 A;  4KN4 C;  4UP9 A;  4CGY B;  3QIA A;  2CCZ A;  5D14 A;  2F4V Q;  2R7Z H;  5JPN C;  1MIU A;  1Q8K A;  4R4C A;  1F2Y A;  2A6E C;  2EYH A;  4P74 A;  3SHL A;  4DK6 C;  1TY2 A;  5C0X J;  2Z4I A;  3GTL H;  4LK1 C;  1STG A;  4A93 B;  3E0E A;  5C0X G;  4X65 L;  3ITP A;  4HJ5 A;  3SEB A;  2NVX H;  2UXD L;  2V1C C;  1SJH D;  4DA2 A;  3HOY H;  5JOB A;  3I4M B;  3VYS A;  4CKE A;  4JI0 Q;  3V2T A;  5JEA J;  2RKS A;  2YYZ A;  1SRU A;  4OL7 A;  3F1Z A;  4IFD J;  2CWP A;  3J7A 5;  4AYB E;  2N8N A;  5K5P A;  5DNF A;  1WCM H;  4K6D A;  5NUC A;  1EEF D;  1MKH A;  3CCL A;  3PO3 G;  1MD2 D;  4CDE C;  2E2I H;  2F0Q A;  1PFN A;  5IGD A;  2NWG A;  1K83 H;  1I50 B;  3HGB A;  1PFS A;  4A3I H;  3MZ5 A;  1KAB A;  3AU7 A;  2NZH A;  1V1P A;  3IFT A;  3F8T A;  4ABN A;  4KJN A;  1LTG D;  3S15 B;  1RJT A;  4GOP B;  4UDU C;  3T53 B;  1YZ6 A;  2D2C C;  1L0W A;  2VW9 A;  1PA6 A;  2Q8T A;  2HHH Q;  1MSH A;  4K0K Q;  1PYB A;  1QUQ B;  2DY7 A;  3HFZ B;  2EY1 A;  1WTX A;  2KEE A;  2QA4 A;  4AQY Q;  3J7A F;  3W1B A;  2IW3 A;  1D6E C;  2JA5 B;  4PG3 A;  3W1G A;  1NTG A;  3NTH A;  2KCC A;  2XNA C;  5KRU A;  3S1Q H;  4DUZ L;  3K59 A;  2K5H A;  2BOS A;  4EQP A;  1TWH B;  4DUY L;  1NMG A;  2MO1 A;  3IKJ A;  5E4X A;  1XMQ Q;  4LF8 Q;  2VY3 A;  1E1O A;  1OXS C;  2JSO A;  1G6Z A;  3D8G A;  1JMC A;  2IPK D;  1EEI D;  4YWK A;  2UUB Q;  2L9H A;  3EJI A;  2JN4 A;  3SK6 A;  2MFI A;  1PH7 A;  2PZU A;  1VQG A;  3DM3 A;  4FYD A;  1HFN A;  4A3C G;  1WYD A;  3CCM A;  1P16 A;  3J81 L;  2M9V A;  4DAY B;  3MVV A;  2GVA A;  3RZD H;  4PZ8 A;  2NVQ B;  1LYL A;  4DXF A;  5ELN A;  1OO9 B;  1X3G A;  5JVH 3;  1O7I A;  4DR2 L;  2F0D A;  3MWY W;  1CFM A;  5BN4 A;  2ZTC A;  1R9T B;  2MPM A;  4A75 A;  3BYY B;  1J8I A;  1SAP A;  2CW0 D;  1II3 A;  4RFB A;  1EIH A;  1HZA A;  3BU2 A;  4DXG A;  5IP7 G;  2AWN A;  1G29 1;  2K75 A;  4FNF A;  1VS0 A;  1YHA A;  4GNX A;  3K7U C;  4YWM A;  3QOL A;  1STH A;  3VYU A;  3CMA A;  4DAV A;  2N49 A;  3DMU A;  3J80 L;  4OEL B;  3M7N A;  4R4O A;  2K5Q A;  4HIM A;  3TS2 A;  3BDO A;  3OIQ A;  4LW1 A;  1JOQ A;  2KED A;  1T9H A;  3EVQ A;  1XMO L;  2VUM B;  1SJE D;  1GUT A;  1LTB D;  1E2V A;  1J5E Q;  1ET6 A;  2OT2 A;  1KDA A;  2WB1 E;  1KLU D;  3SVM A;  1G51 A;  4QIW E;  2PQE A;  4RAU C;  1FGU A;  1PYW D;  4JI3 L;  4TRD A;  4WFN 3;  4A3I G;  1BCP F;  2BH8 A;  2A68 C;  4L5Q A;  5GRO A;  1IHZ A;  1E22 A;  4IQZ A;  1V1Q A;  1VF5 C;  3OMG A;  3PO3 H;  3KF6 A;  3A55 A;  4XTC S;  2QKI C;  1SSO A;  1Y69 U;  1X6O A;  5K36 H;  1PRT F;  4OGQ C;  2K5W A;  1VQD A;  2K50 A;  2K4K A;  1CKN A;  4P73 A;  3FP9 A;  4GZY C;  2Q8I B;  5FLX L;  4JV5 L;  1PH5 A;  3GV3 A;  4O1N A;  4IO9 A;  4XXE A;  3ERQ A;  3F2D A;  4NW2 A;  2ENB A;  2MGS A;  3CQZ B;  3HKS A;  1TS3 A;  1S72 A;  3W5O A;  1BO0 A;  1GVP A;  4LUZ A;  5C4Z A;  2O5J C;  3OHX C;  5AJ3 Q;  1GKH A;  2WAC A;  3E0J A;  1EYG A;  3ND8 A;  4RGM A;  1F2L A;  4F88 A;  2RF4 A;  2UU9 Q;  1XJV A;  2MHV A;  4BA1 I;  1STE A;  3LNN A;  4R9W A;  2AQ3 B;  1W6K A;  3J81 E;  3NTI A;  2WII B;  2BA1 A;  1IYV A;  1EOT A;  5ELE A;  3E9I A;  2B2Y A;  1NJI C;  4DR6 Q;  3GTK B;  4LWC A;  1JE4 A;  1I4G A;  4DAP A;  4JI8 Q;  2O5I C;  2HUG A;  4ZUJ A;  1UUP A;  1HNX Q;  3HRZ C;  1EFW A;  1Y1V G;  4A93 H;  1Q8I A;  3J81 i;  1MI2 A;  1AP0 A;  1SE3 A;  2DJF C;  4XQJ A;  3BZK A;  2PQA A;  4ME5 A;  5CV7 A;  3SK8 A;  4DR3 L;  1VQ4 A;  1QVC A;  2EE1 A;  3J80 E;  3HP3 A;  1QWY A;  1J5E L;  2D0O A;  3GD7 A;  4N8F A;  3JAM c;  4DV7 Q;  1M90 C;  1Y8P B;  5ISR A;  5M5X H;  4A3L H;  3STB D;  3I4M G;  5GAE C;  1CA6 A;  1K0S A;  3PQI A;  5J1Z A;  4NXM L;  1TS5 A;  5JJI A;  3RMH A;  1WTO A;  2VUM G;  3RUZ A;  2X6L A;  1SMX A;  3CCJ A;  3WOF A;  2F0U A;  1LTA D;  3VR6 A;  2DN8 A;  1JCK B;  4X66 L;  5JJL A;  4GN4 B;  4A3E H;  1VQN A;  1I3Q H;  3HKZ E;  2VQF L;  1I4H A;  4ZKB B;  2V4D A;  4BY1 H;  4LF9 Q;  1J9O A;  5BR8 L;  4NXN L;  4C3H G;  4IJL A;  2B63 H;  4P75 A;  2KQ3 A;  2KVM A;  4UAI A;  1GUO A;  2F0J A;  1NY4 A;  3I7F A;  1HTL D;  1TII D;  3EIV A;  1WTH A;  4RMF A;  1I94 Q;  1HPC A;  5DM7 3;  1A6X A;  5KEE A;  1W3S A;  2NVT B;  2I5H A;  4I7Z C;  2WAQ G;  4LJZ C;  4HSV A;  3Q23 A;  1UEB A;  2RQX A;  1AEX A;  4DR2 Q;  2CQO A;  3U4Z A;  1O7Y A;  4JI4 Q;  5IWA L;  1F77 A;  3TME A;  5C4X G;  1UE7 A;  5IT9 c;  3CP0 A;  1Q90 A;  4FF3 A;  4XQQ A;  3ULL A;  3G6J B;  1SNQ A;  4FF1 A;  2NUC A;  3WWV A;  1B3Q A;  3GTJ H;  5FO9 B;  1UWV A;  4DNI A;  1XYI A;  2PQA B;  5IY0 A;  1H9M A;  4DR7 L;  4LUO A;  3GO5 A;  2FFK B;  2HCC A;  4NXM Q;  4M8A A;  4JI7 Q;  5JJZ A;  4YY3 Q;  2IHE A;  4RKL A;  2EOT A;  5F2D A;  2A5H A;  5EPJ A;  1E0B A;  2A69 C;  1K9M C;  2X69 A;  5BN3 A;  4DR3 Q;  1VQE A;  1O7Z A;  3CCV A;  1LTL A;  1WD1 A;  1VDZ A;  1SNM A;  2D9U A;  3X3M A;  4LF4 L;  2FMM A;  2ATW A;  2AQ1 B;  1I5F A;  5C3E B;  1EWC A;  1F9R A;  4A3K B;  3LWE A;  1ZXT A;  3G7L A;  4DV5 L;  4PNY A;  2IX0 A;  2SDF A;  2JA6 H;  5IGB A;  3S2H B;  3KDF B;  1WI5 A;  2BDN A;  1IZ6 A;  2KEN A;  1NBW A;  1JOR A;  3CCE A;  1UE6 A;  1EYC A;  3GTP H;  5C44 G;  1XNR L;  2N3S A;  1QUQ A;  4BBS G;  4WJ4 A;  4ID6 A;  2EYF A;  4X6A H;  4B3M Q;  1EUJ A;  3I8Z A;  1N33 Q;  2QIL A;  2NN6 I;  2K33 A;  1Y8O B;  1TWF H;  1GD7 A;  1SXT A;  2BA0 A;  3BDC A;  4OX9 L;  3I4L A;  1JR0 D;  4NKL A;  4DR7 Q;  3L7Z C;  3TP7 A;  4RG1 A;  2Z9H A;  2KOL A;  4G57 A;  5ELC A;  3ER0 A;  4QMG A;  1MJE A;  4IOA A;  1LAC A;  4IPH A;  1ENC A;  4ILW A;  1TS4 A;  5IOC A;  4R4T A;  4NB3 A;  4XIG S;  1NCV A;  1JQY D;  5I2Y A;  1FGB D;  2UUC L;  1STA A;  2CQA A;  3KBX A;  3E3X A;  5D65 A;  1P8L A;  4C1N I;  2QEJ C;  2JYO A;  3S9W A;  1XMQ L;  4LF8 L;  1EZ6 A;  1I4R A;  3VR5 A;  4C3J B;  3TP5 A;  2QDL A;  5CV6 A;  3MXN A;  1NSN S;  5I9O A;  4BBS H;  2EJF C;  3OWF A;  1MSG A;  5GAD C;  1IBK L;  3ONA B;  1B53 A;  1LTS D;  1YNJ D;  2ZT9 C;  1PV4 A;  1RHP A;  3HOV B;  2IHF A;  1D5X C;  1D5Z C;  5FJ8 H;  1ASY A;  3U58 A;  4OO1 G;  1JB3 A;  2EJG C;  4OON A;  1Q1E A;  2VQF Q;  3H3V I;  1UEA B;  3V05 A;  5LMN L;  4QIW B;  5CC4 A;  3HOX B;  3SR1 A;  1YJN A;  1EIY B;  1HR0 W;  1VQL A;  3M4P A;  2RVL A;  4GS3 A;  2JA7 H;  4ZK9 B;  1X9N A;  3JAM L;  3HOX G;  3HOW H;  3L3O C;  4L6T B;  1BBW A;  1I4X A;  1QZG A;  5JEA H;  4JI3 Q;  2PO4 A;  1MHW C;  3FKI G;  2Z6K A;  4U67 3;  1AN8 A;  5JPM C;  5M3M H;  1V43 A;  1KTK A;  1Q46 A;  1NMF A;  5ELD A;  3HOV G;  3S2H H;  1HTP A;  1FYC A;  2K14 A;  3NWS A;  3FKI B;  4E6I A;  3URY A;  3K5N A;  3TZD A;  2Y0S E;  2H1E A;  5KYL A;  2NB0 A;  1A8V A;  1YIJ A;  3CRL C;  4IUT A;  3A8J E;  4C3H B;  5I6Y A;  4DNT B;  1G6P A;  3A5Z B;  1EQQ A;  2R7F A;  1BOS A;  3WOE A;  1QE6 A;  4ME3 A;  4EX5 A;  4ZKC B;  2BE5 C;  1RL2 A;  2XN9 C;  1XTC D;  2ZJQ A;  3LGJ A;  5C4X H;  2KCN A;  5GAH C;  1H9K A;  5CR3 A;  5EBD A;  3UDX A;  3PIO 3;  1EY6 A;  4LNQ A;  4KHP Q;  4DAY A;  4DK3 C;  4YHH L;  3W3A A;  1V1O A;  1O78 A;  2OWO A;  3CXC A;  2R93 B;  1WTW A;  1IW7 D;  4DUZ Q;  2R92 B;  1X55 A;  1CUK A;  3RLN A;  4JCV E;  1C4Q A;  1NNX A;  3S14 H;  1G2T A;  1AH9 A;  3SGI A;  2F03 A;  1XNQ L;  1K28 A;  4HR7 B;  4JOI A;  1AW7 A;  3H3V H;  1S5F D;  3AYH B;  4CKC A;  2B63 G;  4LF9 L;  3A56 A;  1B2T A;  4V19 0;  3T51 B;  3S1M H;  3VDY A;  1SFO B;  1FR3 A;  4U68 A;  3OTO L;  4KY5 A;  2WB1 B;  2JA9 A;  1K8O A;  1A3U A;  1N36 L;  3A7A B;  1ENF A;  3NBH A;  4HN7 A;  1N32 Q;  1HZC A;  4H44 C;  2UU9 L;  4B3R L;  3MXP A;  4HTH A;  1SMY D;  4X64 Q;  3DEP A;  3BZC A;  1BBX C;  3IAY A;  4RWS C;  4K5V A;  2WKC A;  3I4M H;  3I4N B;  2E2H B;  5C3E G;  2J4X A;  4I7A A;  3FEW X;  2B3G A;  4KD4 A;  3CQZ H;  4OEM B;  3IRB A;  1CT1 D;  3GTL B;  2F4V L;  3H0G G;  5T1G A;  4ZAI A;  1T5E A;  4JI8 L;  2F0K A;  3UE1 A;  1B9M A;  1Y1W H;  2UXB Q;  1F9S A;  1F2Z A;  1SND A;  1Y8N B;  2G5D A;  3HEJ A;  2FHT A;  4IUV A;  5LL6 S;  3JAM i;  1GHK A;  4OO1 I;  3ND9 A;  2XWJ B;  4IPG A;  1M4V A;  3MXU A;  4MTK A;  4B9X A;  4F8M A;  4DUY Q;  1G91 A;  4TSS A;  2WKD A;  4R4Q A;  1VQ5 A;  5IT9 E;  2KA7 A;  4JYA Q;  3J81 j;  2Z1C A;  3ULJ A;  3CPW A;  4PMC A;  5ELO A;  2K28 A;  3I70 A;  3V96 A;  2JK8 A;  1HR0 Q;  2L15 A;  2K5N A;  2ZXO A;  2X6G A;  1K0R A;  4LF6 Q;  2NZ1 D;  2N78 A;  3L0O A;  4IPC A;  4KHV A;  4KY6 A;  3HOU G;  3TRZ A;  3KUP A;  2B2V C;  1VQH A;  2PZT A;  2A6H D;  5M3M G;  4A3I B;  1XMO Q;  1S40 A;  3FKI H;  3BVG A;  1A63 A;  5J22 A;  1S5D D;  4KLK A;  4XT1 B;  2CVR A;  4BY1 B;  1WOC A;  3MEF A;  1X3P A;  4RA8 A;  1Y1W B;  2HDM A;  3K7A H;  3PUV A;  4X3T A;  4KMU C;  4DFA A;  4XQN A;  3G4S A;  2MNA A;  3R3O A;  4DV3 L;  1PH8 A;  2RCF A;  4PZ6 A;  4DV1 L;  2NTS A;  1K3R A;  3HOW B;  1R4P B;  1SNP A;  2SNS A;  3M4Y A;  4Y52 H;  3S16 H;  1DYQ A;  1GUS A;  2F3W A;  3J7Y W;  3OTO Q;  3M3Y B;  1OXT A;  2VB2 X;  3K5O A;  1TWA B;  1TWC B;  3K5M A;  4OWT B;  1JB7 A;  1ONL A;  4GLX A;  5FJ8 G;  3AB9 A;  4OO1 H;  1XPR A;  1I4Q A;  4PV1 C;  1EY4 A;  4HMJ A;  3E9H A;  4CJ1 B;  3BVZ A;  5G3L F;  4YCU A;  2QDB A;  3R2T A;  1EY0 A;  5CYU A;  3PIO A;  3PMF A;  3S17 H;  1VQ6 A;  5EJW A;  2JA8 G;  1D2B A;  1F9P A;  3I4N H;  1UE5 A;  4JBW A;  3FRP B;  1YJ9 A;  2DNE A;  4QUF A;  1BVS A;  4IAL A;  1IXR A;  1LV9 A;  3KF8 B;  1KL9 A;  4OXP A;  3TSS A;  1KDB A;  1PZK D;  3GDE A;  4RKB A;  2JEB I;  1JWS D;  1UAP A;  3HKZ B;  4RHS A;  3L2P A;  3J7Z C;  5IP7 H;  4LF7 Q;  1VQC A;  4FXK C;  5H1S E;  5LMN Q;  1E24 A;  4HIO A;  4JBJ A;  1JJG A;  4X3S A;  2F0W A;  2LS0 1;  4FXG C;  4JI1 L;  5C44 H;  4IUN A;  3D4R A;  5IYB H;  2YU9 B;  3HOZ B;  2PPB C;  4XDX A;  4IPD A;  1I6H B;  4X62 Q;  1YHQ A;  2JA6 G;  1Z6H A;  1EY7 A;  2VS1 A;  5FLM G;  1XX8 A;  5E7N A;  2LY7 A;  5EPK A;  4FF4 A;  2MUY A;  5LHY 1;  4QCL A;  1SMY C;  1X3E A;  2CHB D;  1EIF A;  2F4I A;  3S14 B;  2Z6K C;  2F3V A;  1MBY A;  4P71 A;  4AYB G;  4HIK A;  1VF7 A;  4LF7 L;  2K5V A;  3TS0 A;  4A3K H;  1RDP D;  1XTD A;  2RHQ B;  2F3I A;  3CD6 A;  3S2D B;  1ESR A;  1U4M A;  3CW2 C;  5IIF A;  5EPL A;  1TQO A;  3CAM A;  1U0L A;  3PO3 B;  1D1K A;  2DGY A;  4DPG A;  3O13 A;  3Q22 A;  3T1Y Q;  5EBC A;  3QB3 A;  4R8I A;  2LSS A;  3VR4 A;  3C1F A;  2LMC B;  4X64 L;  3HG9 A;  3PF4 A;  4GN5 A;  2KHS A;  3ERS X;  4B3R Q;  1R9T H;  3PIP A;  3EN2 A;  4UP7 A;  4A3D H;  5IGG A;  3PSI A;  3S1N H;  3GTG B;  1TKW B;  4C1N K;  2RSO A;  1W6J A;  1PRT B;  3GTM H;  1Q86 C;  1N36 Q;  2EYM A;  4TQU S;  4I65 A;  2A6E D;  2HDL A;  3K0X A;  1PLF A;  1HNW Q;  1N9W A;  1LO5 D;  3NEL A;  1K3B C;  3RLO A;  4LUV A;  1BBU A;  5EAY A;  3K8A A;  3NQT A;  2FMC A;  3KF8 A;  1BCP C;  3NWT A;  3CRK C;  5C4H A;  3NBH B;  1PH4 A;  4DR1 L;  1CHP D;  1GUG A;  4B9W A;  4HSP A;  1ICW A;  4DU9 A;  3S1R B;  1GUW A;  3BDL A;  1CHQ D;  3C2P A;  2XTI A;  3PO2 G;  5DEH A;  1B44 D;  4C3H H;  2OXP A;  5J39 A;  4A3D B;  1EYA A;  2NBF A;  4NDX A;  1Q7Y C;  1SYE A;  3HOY G;  4DV5 Q;  5HGQ A;  2JXM B;  1EL0 A;  1ML0 D;  4N8X 1;  4KI0 A;  2R93 G;  4KHZ A;  1GXD C;  2PZW A;  4A3E G;  5D3D A;  5C0X H;  1K8G A;  4LF6 L;  5M3F H;  4APV A;  1AFP A;  3MXG A;  4LFA Q;  3UDI A;  4OIJ A;  3M85 A;  1GUN A;  4GLA C;  1LT4 D;  3I3C A;  5EKK A;  2NVX B;  5EQ0 A;  1CKN B;  4NP5 A;  3T1H L;  2AUJ D;  3KLR A;  3AFQ A;  3DUZ A;  3P7J A;  5LMU Q;  4CDF C;  4CJ2 C;  4UPA A;  4A3L G;  4Q5V A;  1PYS B;  1KAW A;  1VMC A;  1KIX A;  2C35 B;  3Q0A A;  3KF6 B;  3SDZ A;  2NN6 H;  4J15 A;  2L5T A;  1Y14 B;  4GN3 B;  4WOR A;  5M3M B;  3U9S A;  2L0C A;  4YCW A;  1A3T A;  1GOZ A;  2YTX A;  1TVX A;  5CGK A;  1ZKO A;  3NSW A;  5IGC A;  3GTP B;  1L2F A;  1NR2 A;  3GTQ H;  2SNM A;  2WFW A;  4HJ8 A;  1EWI A;  3MXN B;  4BA2 I;  5IGE A;  1RTN A;  2B2U C;  4LFC L;  1PMR A;  2ZXP A;  2E8G A;  3M4O H;  2XRQ D;  2JEA I;  2ZTD A;  3MA2 B;  1VQP A;  4J8Q A;  1OXU A;  4A76 A;  1Q81 C;  3NHH A;  1KRT A;  4DV4 L;  2EY6 A;  2UUA Q;  2L12 A;  1QCB D;  1EU4 A;  1HXY D;  3WDN A;  3D0F A;  1IBK Q;  2A73 B;  3OIP A;  2AQ2 B;  2UUB L;  4A3F B;  3MEH A;  2RDF A;  5M3F G;  3Q6S A;  4BXX H;  4YHH Q;  1QNK A;  1KHI A;  5M5W B;  4A4I A;  1KLG D;  2UUC Q;  3MFG A;  3AFP A;  1GO3 E;  2MQH A;  1KDC A;  4KKS A;  1QOH A;  3EBE A;  2B2W A;  5T1I A;  3D6W A;  4TVA B;  2R3Z A;  1K8A C;  1JT8 A;  1EY8 A;  4K8J A;  2MP1 A;  1ILQ A;  1ESF A;  4H02 A;  4PZ7 A;  2F0L A;  1B1Z A;  4JI2 L;  4YCV A;  4QJF A;  2PMZ B;  4DR5 L;  3KJP A;  3C1E A;  3TP6 A;  2WIN B;  5GAG C;  4JG2 A;  2K04 A;  5GQO A;  1GM5 A;  1IL8 A;  3QR8 A;  3NUC A;  3SK4 A;  4BWG B;  4A3J G;  3LX0 A;  4CJ0 B;  2EJM A;  2LFN A;  5J3B A;  2FIN B;  3D4W A;  1U9R A;  2I46 A;  3I4O A;  3TN2 A;  1C7Y A;  1L1O B;  4L8J A;  5IP9 G;  1A0I A;  1RTO A;  1HJP A;  3TP8 A;  4A3G B;  4KKT A;  3RD4 A;  1U4P A;  2OF1 A;  4BBR G;  5BN5 A;  5HUR A;  5AJ3 L;  3M3Y H;  3A5U A;  2D62 A;  5KNC A;  3TEH B;  5C44 B;  4K0K L;  3H15 A;  2F0G A;  4JI7 L;  3VR3 A;  2WB1 G;  3QOJ A;  1I3Q B;  5E4W C;  1IYJ B;  3J80 i;  2M00 A;  1RF2 D;  5HGT A;  5CBE E;  4HJ9 A;  5KGU A;  1H9R A;  2F0S A;  4RHR A;  1HA6 A;  1Q12 A;  2B29 A;  1SYG A;  1KRS A;  1IL2 A;  3R8B A;  1HCZ A;  4A3K G;  2N55 A;  4HCE A;  4LMQ D;  4QGU A;  5M5X B;  1L1O A;  1QB5 D;  3I56 A;  2Z8L A;  1SLJ A;  1C8C A;  1WVL A;  5C6A A;  1G8Z D;  4A3G H;  1GJX A;  2C5C A;  2R92 G;  4DV0 Q;  2DNC A;  5TSS A;  2EYO A;  4FF2 A;  4JW0 A;  5IOD A;  1PHJ A;  4CDC C;  2B39 A;  2OEO A;  4AIM A;  5A2Q E;  2GN5 A;  2HQL A;  2PYK A;  3VA7 A;  2PI2 A;  1FNV A;  4MIU A;  4F87 A;  4IUP A;  2DJG C;  1CKM A;  1WFQ A;  3ZJY C;  2OTJ A;  5IYB G;  2PMZ E;  3BS1 A;  1FL0 A;  3K6O A;  2R92 H;  2OTL A;  3L9A X;  1C9O A;  4PQX A;  1U5K A;  2YTV A;  3SXH A;  1IW7 C;  2AMC B;  5CV8 A;  4RGO S;  1I6V C;  4DV7 L;  1HQR D;  1XNQ Q;  1DM0 B;  4JPB W;  4KV6 A;  5EKL A;  1NR4 A;  5C4X B;  4G7H C;  3QG1 A;  1KAA A;  1N32 L;  3KLS X;  1BQQ T;  3M4Q A;  2ICI A;  3RN2 A;  4QQB X;  1EU3 A;  5CMD A;  2ZJP A;  5JVG 3;  4NPS A;  4GLV B;  1DD2 A;  1CZW A;  1HH2 P;  3STB C;  3T56 B;  5M5W H;  4JI4 L;  3TBI B;  1X65 A;  3F2U A;  2EQS A;  5EKI A;  1JJC B;  1VQF A;  3KOJ A;  4IOC A;  1TWG H;  1YVC A;  1OXV A;  2D0P A;  4JVZ A;  3CCU A;  2A1A A;  5IP9 H;  1I94 L;  2ZM6 Q;  1LT5 D;  1LT6 D;  1SRO A;  1PTO H;  1Z9F A;  1SN8 A;  1VQM A;  3X3N A;  1QIL A;  2CH4 W;  3NP8 A;  1TWC H;  3U4V A;  4IUQ A;  4ALP A;  2JE6 I;  1DXM A;  4DKA C;  1KNE A;  3GTO B;  2PNR C;  2CW0 C;  3NPP A;  2UXB L;  4JI5 Q;  5M9O A;  3EFX D;  3K58 A;  3H3V C;  2EY5 A;  2L4N A;  5CV4 A;  1F9Q A;  1WCM G;  2EYP A;  3TRE A;  4FXD A;  1PDQ A;  1WJJ A;  4V0B A;  1V9P A;  4BBR B;  1CQF A;  3KJO A;  2K1B A;  1C48 A;  3U9O A;  4G4K A;  2ZM6 L;  3PO2 B;  2F0O A;  3M4O B;  2HCI A;  3H91 A;  2Q8R E;  4JI6 Q;  4DNR B;  3CU7 A;  2IJ0 A;  2Q2I A;  4GKJ L;  4OIK A;  1EIG A;  3KDF A;  1PRT D;  5FLX c;  2YTY A;  2B8F A;  2EPB A;  2HHH L;  3FPU B;  4ZYS A;  4BXX G;  1VQO A;  4A3J B;  4B3T L;  2FXQ A;  2F0E A;  3GTQ B;  4DV3 Q;  2CFM A;  3K0Y A;  1CSQ A;  1TWH H;  1E7Z A;  1DOK A;  2N88 A;  2AKW B;  2K32 A;  3BG3 A;  4NMZ A;  2F0V A;  3BZD B;  3P20 A;  2A8V A;  2RA4 A;  1YJW A;  3FPP A;  2HT1 A;  1TU2 B;  1WCM B;  5E1F A;  1SEB D;  1U4R A;  1FD7 D;  2HIV A;  2E2J B;  4LFB Q;  4BY7 H;  4JI2 Q;  1CM9 A;  4R4I A;  4RH6 A;  2E74 C;  2Y0S G;  4ULL A;  3E5S A;  5KIX A;  4QB4 A;  1Z47 A;  4IFD H;  4FO2 A;  3RZD B;  2E5L L;  1Q1B A;  2F52 A;  2KCM A;  2Q2T A;  3UI2 A;  2NN6 G;  4F7X A;  1V8Q A;  3OSO A;  1KD1 C;  4FDB A;  3H09 A;  3NTK A;  4OHJ A;  1RCV D;  2PW5 A;  2IX1 A;  1D8L A;  2VB3 X;  4OX9 Q;  1DOM A;  5I9P A;  2EYJ A;  5C3E H;  3D4D A;  3CCS A;  4B3M L;  1ZYR C;  1S3O A;  4POG A;  3GTM B;  1X3Q A;  1ICF B;  1JWM D;  1SNO A;  4IUR A;  3IL8 A;  4EVO A;  5COR A;  1JE5 A;  5C4J H;  1H9S A;  2IT1 A;  1SYD A;  3NEN A;  4A3F G;  4K2L A;  3T16 A;  2VL6 A;  2E2D C;  4RCN A;  4L5R C;  2HIX A;  1SYB A;  4LFB L;  2R93 H;  3MTS A;  4AH6 A;  2ES2 A;  2Z4H A;  1SE8 A;  1O80 A;  5HY6 A;  1YBY A;  1B8A A;  2R6G A;  4EGV A;  3PGZ A;  2PCF B;  1N8R C;  3SE0 A;  2OCE A;  2M2L A;  1AE2 A;  1D1I A;  3CCR A;  3PO2 H;  3D3R A;  4Z9C B;  5M5Y H;  1CK1 A;  1BUV T;  4IFD I;  1A62 A;  1S5E D;  1YNN D;  3P75 A;  5IYD H;  4M1U B;  4C3I H;  1S5B D;  2LKV A;  2K52 A;  1M8A A;  2R61 A;  1NUC A;  3U50 C;  4RCO A;  3PUX A;  5IYC H;  4JI1 Q;  1JC7 A;  1H9S B;  3A74 A;  4LF5 L;  1HUN A;  2KCT A;  3DEO A;  3VR2 A;  3RR5 A;  3HOY B;  1CZG A;  2OQK A;  5FLX E;  2Q2U A;  1PH3 A;  5IE8 A;  3A7L A;  3CKI B;  3T1H Q;  3OOC A;  4Q0F A;  1TWG B;  4CKB A;  3KK7 A;  1PTO D;  4A3D G;  3K5L A;  3ULP A;  1EY5 A;  3RNU A;  3PV0 A;  1AZP A;  2TMP A;  1BXT A;  4TKO B;  3CCQ A;  1ZYR D;  1UNS A;  3Q24 A;  2L55 A;  3JAM E;  2L11 A;  3DWP A;  2QCP X;  5FKA C;  3T1Y L;  1FJG L;  1BF4 A;  1TR5 A;  3M9B A;  2O4X A;  4QUC A;  4UP8 A;  2K01 A;  2K5D A;  3AEV A;  1L1O C;  1VQ7 A;  4LAA A;  4JBM A;  2KHJ A;  4GKK L;  4OWW B;  4A3B G;  3CPF A;  3JC6 6;  2VXW A;  5JEA G;  5AFW A;  3HOX H;  3HOW G;  2E2H H;  4MHE A;  1B9N A;  4JBK A;  2BCO A;  2JA7 G;  3A54 A;  4C56 C;  2SEB D;  3NE5 B;  4XT3 B;  4C3J H;  1SYF A;  2B2T A;  5L37 A;  3HZX A;  4DR6 L;  5FLM H;  4EQO A;  2E75 C;  4DR5 Q;  2RSN A;  4A3M H;  2Y0S B;  3MFY A;  1STN A;  4C2M H;  2CWA A;  3HS0 C;  1KXL A;  3FVQ A;  2QEX A;  1K8M A;  5C3X A;  1PH6 A;  5CBA E;  3S15 H;  3RZO B;  1PTO F;  2KBN A;  4KD3 A;  2IWH A;  5ELB A;  1EFI D;  1BCP D;  1PRT C;  1DON A;  2LXK A;  4IZ8 A;  2Z0S A;  4GKJ Q;  4XYQ A;  4C3I B;  1YHB A;  3CME A;  2F0M A;  2AHO B;  4JI6 L;  1LTT D;  4MTN A;  1VCI A;  4LFA L;  5KNB A;  3CC7 A;  2K03 A;  1HNX L;  3HOZ G;  1I6H H;  1HA5 A;  1WTV A;  1CA5 A;  2RBM A;  2AWO A;  5CV9 A;  3P1H A;  1PFM A;  4H13 C;  4ZRZ A;  4FP5 D;  3FHW A;  1HZB A;  3Q8D A;  1A2T A;  2KHI A;  1HNZ Q;  1N33 L;  4BS9 A;  3I4N G;  2JA8 H;  3R2I A;  1IKM A;  3H94 A;  1BNZ A;  5JAV A;  4L5S A;  1D5M C;  2ZJR A;  3F2C A;  2XRS D;  1PXU A;  2JA6 B;  2GA4 B;  4A3B B;  1C0A A;  4WJ3 M;  4P72 A;  1B4O A;  1LUZ A;  3HKZ G;  3KLW A;  4RGN A;  2XVS A;  2PW7 A;  4B3S Q;  4A3M G;  5IWA Q;  2I0Q A;  2C9O A;  5IGF A;  2WP8 J;  1CTM A;  4UHV A;  4LFC Q;  1ROD A;  1ENA A;  3PUZ A;  1S4Z A;  4JC0 A;  3EA6 A;  2NVY H;  2H4O A;  1HFG A;  1NAP A;  1PFB A;  4DV6 Q;  4JV5 Q;  3NBI A;  2EZV A;  3VA5 A;  2JA8 B;  1L0X B;  3ICE A;  1WTP A;  4A3B H;  4G7Z C;  2K7V A;  3AQQ A;  3GTK H;  1EY9 A;  3I2Z A;  2R7Z B;  4AQY L;  1BKB A;  1FVI A;  4JI5 L;  3SK5 A;  3A8I E;  1TY0 A;  1B70 B;  1RIP A;  3K80 C;  4YY3 L;  3HOU H;  2O2L D;  1O7L A;  2RCN A;  3T13 A;  3S1Q B;  1I4P A;  3I73 A;  2VQE L;  2NVY B;  2A6H C;  4GOP C;  3G48 A;  3DLL A;  1PH9 A;  3OPO A;  1CKO A;  3B6Y A;  3CHB D;  3DHQ A;  2VZA A;  3K57 A;  3S1M B;  2UXC Q;  1PTO B;  1XPO A;  2B2W C;  5A2Q L;  3KYH C;  5FO8 B;  1JIC A;  2YU9 H;  2WAQ E;  4N9T A;  1UE1 A;  1VQI A;  3C46 A;  1QVG A;  1Y1W G;  1E3P A;  3TZU A;  2JA5 G;  4LF5 Q;  4A3M B;  1HNW L;  1QVF A;  1LT3 D;  1YNX A;  1F2M A;  1VQJ A;  2SOB A;  5I6W A;  1Q3L A;  1X54 A;  3HOU B;  3EQL C;  5E3F A;  3DWQ A;  1E2Z A;  1X56 A;  2EIF A;  5IYC G;  1IBM Q;  3UE0 A;  2IL8 A;  3H0G H;  1XNR Q;  2EXZ A;  1KC8 C;  3BYT B;  1RKN A;  5A35 A;  1I50 H;  1K83 B;  4P2C B;  2NVQ H;  1OTC A;  2QF7 A;  4C3I G;  1XXG A;  1HQM C;  2KUM A;  4PMB A;  1QNU A;  1WTR A;  1PH1 A;  3GV6 A;  1OXX K;  3PF5 A;  1Q82 C;  1STB A;  2B8G A;  4Y7N B;  4BY1 G;  2R7D A;  2F0I A;  1Z7T A;  3NXW A;  5ELF A;  2PI2 E;  4HMI A;  3KLS A;  4X62 L;  4CDD C;  1VMP A;  4C2M B;  4MNO A;  4CBV A;  3KBG A;  4GKK Q;  3D6C A;  1QZH A;  2YV5 A; 
#chains in the Genus database with same CATH homology
 2JP1 A;  3QO2 A;  3OMC A;  2F0T A;  2DY8 A;  4KKU A;  5C3W A;  4HCS A;  1DOL A;  4AYB B;  1HHV A;  1U4L A;  2E76 C;  3I91 A;  2XSC A;  5C4J B;  2KEC A;  4HED A;  4BBS B;  1A2U A;  4G7O C;  2XIW A;  1EWH A;  1DZ1 A;  2HQE A;  4XYO A;  1B50 A;  3QJY A;  4IFD G;  3D31 A;  4KN7 C;  4ZUI A;  1B3A A;  1T5X D;  3K7A B;  4KY7 A;  1GHJ A;  4DGZ A;  1A15 A;  4EQN A;  3OW7 A;  2JA7 B;  3S1N B;  4J6H A;  1BDO A;  3GQB A;  3OWE B;  3BVM A;  5M5Y B;  3ERO A;  2A68 D;  3A8K E;  5M3F B;  3IFD A;  2E2I B;  1SDF A;  1BCP B;  1CI3 M;  2A69 D;  2B2T C;  4ODG A;  5I4D A;  1A3V A;  1L0Y B;  2KJX A;  1STY A;  2B2Y C;  1DCZ A;  4DN4 M;  1TWF B;  3NK9 A;  3MAQ A;  1JOO A;  3FMC A;  4WRD A;  4X3K A;  3VYR A;  5FOB B;  5K36 G;  1ILP A;  4BY7 B;  1AZQ A;  3PUW A;  2EY2 A;  1SBB B;  5FO7 B;  1SE2 A;  1PZJ D;  2FJ2 A;  4R8N A;  2NTT A;  5KND A;  5C0X I;  1IKL A;  3M7G A;  4MN3 A;  3MC0 B;  2ZXR A;  3W2D A;  4DF7 A;  5G3L D;  2F0H A;  4ZLT F;  1DJR D;  3TDQ A;  4K2K A;  3LWU A;  1CQV A;  5EGT A;  2D5D A;  4N9P A;  4K5X A;  5DAU A;  2G9D A;  3S16 B;  3S17 B;  1HUM A;  5IT9 L;  2J0T D;  2XWB B;  5CV5 A;  4KTA A;  1Y1V B;  4K5W A;  2EYL A;  1LTR D;  4QF4 A;  1G2S A;  3H0G B;  4X3U A;  3QWN A;  4C3J G;  2RDG A;  2EVB A;  4S3S A;  2B2V A;  3H6M A;  1JWU D;  1FNW A;  5C5L A;  5LL6 X;  1YNJ C;  2WV6 D;  1EYD A;  1ZEQ X;  3I90 A;  2MJ8 A;  3DXJ C;  2K6A A;  4K14 A;  1LAB A;  3C3L A;  4L63 B;  4B08 A;  4K6L A;  3E6Z X;  1QG7 A;  2B2U A;  3DWA A;  1FNU A;  5FK9 C;  3T4A C;  5I2X A;  1WTQ A;  1IYU A;  4FVM A;  4J1M A;  4HAE A;  1X32 A;  3FDT A;  3VYT A;  1H9J A;  2K05 A;  4CHT B;  2I07 B;  1XWE A;  2B63 B;  3NQI A;  1ET9 A;  2BE5 D;  2NYZ D;  1MGS A;  3PIP 3;  1PTO C;  2G9H D;  1JOK A;  1R4Q B;  1TS2 A;  2L1B A;  2F0N A;  3ZYY X;  1LLR D;  1QJO A;  2A74 C;  1HRJ A;  2IX3 A;  3I72 A;  2J7Z A;  5D3I B;  3AMU A;  1SE4 A;  1S5C D;  3N6R A;  3GTJ B;  1E2W A;  1PZI D;  4DK1 A;  3J7A V;  1YNN C;  3DM1 A;  1LTI D;  2F1M A;  3PUY A;  4KJO A;  3N52 A;  3R93 A;  5DM6 3;  4IN3 A;  5COY A;  2ICE C;  1SNC A;  1SYC A;  1EQV A;  2ID0 A;  1EQT A;  2F0P A;  2WAQ B;  4KK7 A;  4A3E B;  1KNA A;  2BDO A;  1RD9 D;  2TSS A;  4K8I A;  4JK1 C;  4H7B A;  2F0F A;  4RGT A;  4DK0 A;  1TT2 A;  4IUU A;  1BR9 A;  5C5M A;  4WJW A;  1WD0 A;  2EDG A;  2VNU D;  1V1P B;  3RLF A;  1EZ8 A;  2RDH A;  3GP7 A;  5KYI A;  3MHB A;  2AUK A;  4PMW A;  4YIJ A;  4O42 A;  4ZQ3 A;  4H0L C;  4KN4 C;  4CGY B;  3QIA A;  5D14 A;  5JPN C;  1F2Y A;  2A6E C;  2EYH A;  3SHL A;  1TY2 A;  5C0X J;  2Z4I A;  4LK1 C;  1STG A;  4A93 B;  5C0X G;  3ITP A;  3SEB A;  1SJH D;  4DA2 A;  5JOB A;  3I4M B;  3VYS A;  4CKE A;  3V2T A;  5JEA J;  2RKS A;  2YYZ A;  4OL7 A;  4IFD J;  5K5P A;  5DNF A;  4K6D A;  5NUC A;  1EEF D;  1MD2 D;  2F0Q A;  1PFN A;  5IGD A;  2NWG A;  1I50 B;  3HGB A;  3MZ5 A;  1KAB A;  3AU7 A;  1V1P A;  3IFT A;  4ABN A;  4KJN A;  1LTG D;  3S15 B;  1RJT A;  4UDU C;  3T53 B;  2D2C C;  2Q8T A;  1MSH A;  2DY7 A;  1WTX A;  2EY1 A;  2KEE A;  3J7A F;  2IW3 A;  1D6E C;  2JA5 B;  3NTH A;  2KCC A;  2XNA C;  5KRU A;  3K59 A;  2BOS A;  4EQP A;  1TWH B;  3IKJ A;  5E4X A;  1OXS C;  2JSO A;  1G6Z A;  3D8G A;  2IPK D;  1EEI D;  2L9H A;  3EJI A;  3SK6 A;  2PZU A;  4FYD A;  1HFN A;  3J81 L;  2M9V A;  3MVV A;  2NVQ B;  4DXF A;  1OO9 B;  5JVH 3;  2F0D A;  3MWY W;  1CFM A;  5BN4 A;  1R9T B;  2MPM A;  3BYY B;  1J8I A;  1SAP A;  2CW0 D;  1II3 A;  4RFB A;  1EIH A;  4DXG A;  2AWN A;  1G29 1;  4FNF A;  3QOL A;  1STH A;  3VYU A;  4DAV A;  3DMU A;  3J80 L;  3M7N A;  2K5Q A;  3BDO A;  3OIQ A;  1JOQ A;  2KED A;  3EVQ A;  2VUM B;  1SJE D;  1GUT A;  1LTB D;  1E2V A;  1ET6 A;  2OT2 A;  1KDA A;  1KLU D;  3SVM A;  2PQE A;  4RAU C;  1PYW D;  4TRD A;  4WFN 3;  1BCP F;  2A68 C;  1IHZ A;  4IQZ A;  1VF5 C;  3OMG A;  3A55 A;  4XTC S;  2QKI C;  1SSO A;  1Y69 U;  5K36 H;  1PRT F;  4OGQ C;  2K5W A;  4GZY C;  2Q8I B;  5FLX L;  3GV3 A;  4O1N A;  4XXE A;  3ERQ A;  4NW2 A;  2ENB A;  2MGS A;  3CQZ B;  1TS3 A;  1BO0 A;  2O5J C;  5C4Z A;  3OHX C;  2WAC A;  3E0J A;  3ND8 A;  4RGM A;  1F2L A;  4F88 A;  2MHV A;  4BA1 I;  1STE A;  3LNN A;  4R9W A;  2AQ3 B;  1W6K A;  3J81 E;  3NTI A;  2WII B;  2BA1 A;  1IYV A;  1EOT A;  5ELE A;  2B2Y A;  3GTK B;  1JE4 A;  1I4G A;  4DAP A;  2O5I C;  2HUG A;  4ZUJ A;  1UUP A;  3HRZ C;  1Q8I A;  1MI2 A;  1AP0 A;  1SE3 A;  4XQJ A;  5CV7 A;  4ME5 A;  3SK8 A;  2EE1 A;  3J80 E;  3HP3 A;  1QWY A;  3GD7 A;  1Y8P B;  5ISR A;  1CA6 A;  5J1Z A;  1TS5 A;  3RMH A;  1WTO A;  3RUZ A;  2X6L A;  3WOF A;  2F0U A;  1LTA D;  3VR6 A;  2DN8 A;  1JCK B;  1I4H A;  4ZKB B;  2V4D A;  1J9O A;  4C3H G;  2KQ3 A;  2KVM A;  4UAI A;  1GUO A;  2F0J A;  1HTL D;  1TII D;  1HPC A;  5DM7 3;  1A6X A;  5KEE A;  2NVT B;  4I7Z C;  4LJZ C;  4HSV A;  3Q23 A;  2RQX A;  1AEX A;  1O7Y A;  1F77 A;  3TME A;  1Q90 A;  4FF3 A;  4XQQ A;  3G6J B;  1SNQ A;  4FF1 A;  2NUC A;  5FO9 B;  1XYI A;  1H9M A;  3GO5 A;  2FFK B;  2HCC A;  4M8A A;  5JJZ A;  4RKL A;  2EOT A;  5F2D A;  2A5H A;  5EPJ A;  1E0B A;  2A69 C;  2X69 A;  5BN3 A;  1O7Z A;  1WD1 A;  1VDZ A;  1SNM A;  2D9U A;  3X3M A;  2FMM A;  2AQ1 B;  5C3E B;  1EWC A;  1F9R A;  4A3K B;  3LWE A;  1ZXT A;  3G7L A;  4PNY A;  2IX0 A;  2SDF A;  5IGB A;  3S2H B;  2BDN A;  1JOR A;  1EYC A;  4ID6 A;  2EYF A;  3I8Z A;  2QIL A;  2NN6 I;  2K33 A;  1Y8O B;  1SXT A;  2BA0 A;  3BDC A;  3I4L A;  1JR0 D;  4NKL A;  3L7Z C;  3TP7 A;  5ELC A;  2KOL A;  4G57 A;  4QMG A;  1LAC A;  1ENC A;  4ILW A;  1TS4 A;  5IOC A;  4XIG S;  1NCV A;  1JQY D;  5I2Y A;  1FGB D;  1STA A;  2CQA A;  3KBX A;  5D65 A;  4C1N I;  2QEJ C;  2JYO A;  3S9W A;  1EZ6 A;  1I4R A;  3VR5 A;  4C3J B;  3TP5 A;  5CV6 A;  3MXN A;  1NSN S;  5I9O A;  2EJF C;  3OWF A;  1MSG A;  3ONA B;  1B53 A;  1LTS D;  1YNJ D;  2ZT9 C;  1RHP A;  3HOV B;  4OO1 G;  1D5X C;  1D5Z C;  1JB3 A;  2EJG C;  1Q1E A;  1UEA B;  3V05 A;  4QIW B;  5CC4 A;  3HOX B;  3SR1 A;  2RVL A;  4ZK9 B;  3JAM L;  3L3O C;  4L6T B;  1I4X A;  5JEA H;  2PO4 A;  4U67 3;  1AN8 A;  5JPM C;  1V43 A;  1KTK A;  5ELD A;  1HTP A;  1FYC A;  3NWS A;  3FKI B;  4E6I A;  3URY A;  3K5N A;  3TZD A;  2H1E A;  5KYL A;  2NB0 A;  3CRL C;  4IUT A;  3A8J E;  4C3H B;  5I6Y A;  4DNT B;  3WOE A;  1BOS A;  1QE6 A;  4ZKC B;  2BE5 C;  2XN9 C;  1XTC D;  2KCN A;  1H9K A;  5CR3 A;  5EBD A;  3PIO 3;  1EY6 A;  4DAY A;  3W3A A;  1V1O A;  1O78 A;  2R93 B;  1WTW A;  1IW7 D;  2R92 B;  1C4Q A;  1G2T A;  2F03 A;  4HR7 B;  1AW7 A;  1S5F D;  4CKC A;  3A56 A;  1B2T A;  4V19 0;  3T51 B;  1SFO B;  1FR3 A;  4U68 A;  4KY5 A;  2WB1 B;  1K8O A;  1A3U A;  3A7A B;  1ENF A;  3NBH A;  4HN7 A;  4H44 C;  3MXP A;  4HTH A;  1SMY D;  3DEP A;  1BBX C;  3IAY A;  4RWS C;  4K5V A;  2WKC A;  3I4N B;  2E2H B;  2J4X A;  3FEW X;  4KD4 A;  1CT1 D;  3GTL B;  5T1G A;  4ZAI A;  1T5E A;  2F0K A;  1B9M A;  1F9S A;  1F2Z A;  1SND A;  1Y8N B;  3HEJ A;  2FHT A;  4IUV A;  5LL6 S;  1GHK A;  4OO1 I;  3ND9 A;  2XWJ B;  1M4V A;  3MXU A;  4B9X A;  4F8M A;  1G91 A;  4TSS A;  2WKD A;  5IT9 E;  2KA7 A;  2Z1C A;  4PMC A;  2K28 A;  3I70 A;  2ZXO A;  2X6G A;  2NZ1 D;  4KY6 A;  4KHV A;  3KUP A;  2B2V C;  2PZT A;  2A6H D;  4A3I B;  3BVG A;  5J22 A;  1S5D D;  4XT1 B;  2CVR A;  4BY1 B;  1X3P A;  4RA8 A;  1Y1W B;  2HDM A;  3PUV A;  4X3T A;  4KMU C;  4DFA A;  4XQN A;  3R3O A;  2NTS A;  3HOW B;  1R4P B;  1SNP A;  2SNS A;  3M4Y A;  1DYQ A;  1GUS A;  2F3W A;  3J7Y W;  3M3Y B;  1OXT A;  2VB2 X;  3K5O A;  1TWA B;  1TWC B;  3K5M A;  1ONL A;  3AB9 A;  4OO1 H;  1I4Q A;  4PV1 C;  1EY4 A;  4HMJ A;  4CJ1 B;  3BVZ A;  5G3L F;  2QDB A;  3R2T A;  1EY0 A;  5CYU A;  3PMF A;  5EJW A;  1D2B A;  1F9P A;  4JBW A;  3FRP B;  2DNE A;  4QUF A;  4IAL A;  1LV9 A;  3TSS A;  1KDB A;  1PZK D;  4RKB A;  2JEB I;  1JWS D;  1UAP A;  3HKZ B;  4RHS A;  4FXK C;  4X3S A;  2F0W A;  2LS0 1;  4FXG C;  4IUN A;  3D4R A;  2YU9 B;  3HOZ B;  2PPB C;  4XDX A;  1I6H B;  1Z6H A;  1EY7 A;  1XX8 A;  2LY7 A;  5EPK A;  4FF4 A;  2MUY A;  5LHY 1;  4QCL A;  1SMY C;  2CHB D;  2F4I A;  3S14 B;  2F3V A;  1MBY A;  1VF7 A;  1RDP D;  3S2D B;  1ESR A;  1U4M A;  5IIF A;  5EPL A;  1TQO A;  3PO3 B;  1D1K A;  3O13 A;  3Q22 A;  5EBC A;  3QB3 A;  4R8I A;  3VR4 A;  3C1F A;  2LMC B;  3HG9 A;  2KHS A;  5IGG A;  3GTG B;  1TKW B;  4C1N K;  2RSO A;  1W6J A;  1PRT B;  2EYM A;  4TQU S;  4I65 A;  2A6E D;  2HDL A;  1PLF A;  1LO5 D;  3NQT A;  2FMC A;  3KF8 A;  1BCP C;  3NWT A;  3CRK C;  5C4H A;  1CHP D;  1GUG A;  4B9W A;  4HSP A;  1ICW A;  4DU9 A;  3S1R B;  1GUW A;  3BDL A;  1CHQ D;  3C2P A;  5DEH A;  1B44 D;  2OXP A;  5J39 A;  4A3D B;  1EYA A;  2NBF A;  4NDX A;  1SYE A;  2JXM B;  1EL0 A;  1ML0 D;  4KI0 A;  4KHZ A;  1GXD C;  2PZW A;  5D3D A;  5C0X H;  1AFP A;  3MXG A;  4OIJ A;  3M85 A;  1GUN A;  1LT4 D;  3I3C A;  5EKK A;  2NVX B;  5EQ0 A;  4NP5 A;  2AUJ D;  3KLR A;  3DUZ A;  3P7J A;  4CJ2 C;  4Q5V A;  1VMC A;  3Q0A A;  3SDZ A;  2NN6 H;  2L5T A;  4WOR A;  5M3M B;  3U9S A;  2L0C A;  1A3T A;  1GOZ A;  1TVX A;  5CGK A;  1ZKO A;  3NSW A;  5IGC A;  3GTP B;  1NR2 A;  2SNM A;  4BA2 I;  5IGE A;  1RTN A;  2B2U C;  1PMR A;  2ZXP A;  2XRQ D;  2JEA I;  3MA2 B;  4J8Q A;  1OXU A;  3NHH A;  2EY6 A;  2L12 A;  1EU4 A;  1HXY D;  1QCB D;  3WDN A;  2A73 B;  3OIP A;  2AQ2 B;  4A3F B;  3MEH A;  2RDF A;  3Q6S A;  1QNK A;  5M5W B;  1KLG D;  3MFG A;  1KDC A;  4KKS A;  1QOH A;  2B2W A;  5T1I A;  3D6W A;  2R3Z A;  1EY8 A;  4K8J A;  2MP1 A;  1ILQ A;  1ESF A;  2F0L A;  1B1Z A;  2PMZ B;  3C1E A;  3TP6 A;  2WIN B;  2K04 A;  1IL8 A;  3NUC A;  3SK4 A;  4BWG B;  3LX0 A;  4CJ0 B;  2EJM A;  2LFN A;  2FIN B;  3D4W A;  1U9R A;  2I46 A;  3TN2 A;  4L8J A;  1RTO A;  3TP8 A;  4A3G B;  4KKT A;  3RD4 A;  1U4P A;  2OF1 A;  5BN5 A;  5HUR A;  2D62 A;  5KNC A;  5C44 B;  2F0G A;  3VR3 A;  3QOJ A;  1I3Q B;  5E4W C;  2M00 A;  1RF2 D;  5HGT A;  5CBE E;  5KGU A;  1H9R A;  2F0S A;  4RHR A;  1HA6 A;  1Q12 A;  1SYG A;  3R8B A;  1HCZ A;  2N55 A;  4HCE A;  4LMQ D;  5M5X B;  1QB5 D;  2Z8L A;  1C8C A;  1WVL A;  5C6A A;  1G8Z D;  1GJX A;  2C5C A;  2DNC A;  5TSS A;  2EYO A;  4FF2 A;  5IOD A;  2B39 A;  2OEO A;  5A2Q E;  2PYK A;  3VA7 A;  1FNV A;  4MIU A;  4F87 A;  4IUP A;  3BS1 A;  3K6O A;  3L9A X;  4PQX A;  3SXH A;  1IW7 C;  5CV8 A;  4RGO S;  1I6V C;  1HQR D;  1DM0 B;  4KV6 A;  5EKL A;  1NR4 A;  5C4X B;  4G7H C;  3QG1 A;  1KAA A;  3KLS X;  1BQQ T;  2ICI A;  1EU3 A;  5CMD A;  5JVG 3;  1DD2 A;  1CZW A;  3T56 B;  3TBI B;  3F2U A;  5EKI A;  1OXV A;  1LT5 D;  1LT6 D;  1PTO H;  3X3N A;  1QIL A;  3NP8 A;  4IUQ A;  2JE6 I;  1DXM A;  1KNE A;  3GTO B;  2PNR C;  2CW0 C;  3NPP A;  5M9O A;  3H3V C;  3EFX D;  3K58 A;  2EY5 A;  2L4N A;  5CV4 A;  1F9Q A;  2EYP A;  4FXD A;  1PDQ A;  4V0B A;  4BBR B;  1CQF A;  2K1B A;  1C48 A;  3U9O A;  4G4K A;  3PO2 B;  2F0O A;  3M4O B;  2HCI A;  3H91 A;  2Q8R E;  4DNR B;  3CU7 A;  2IJ0 A;  4OIK A;  1EIG A;  1PRT D;  2B8F A;  2EPB A;  3FPU B;  4ZYS A;  4A3J B;  2F0E A;  3GTQ B;  3K0Y A;  1DOK A;  2N88 A;  2K32 A;  3BG3 A;  4NMZ A;  2F0V A;  3BZD B;  3P20 A;  2RA4 A;  3FPP A;  1TU2 B;  1WCM B;  5E1F A;  1SEB D;  1U4R A;  1FD7 D;  2E2J B;  1CM9 A;  4RH6 A;  2E74 C;  4ULL A;  3E5S A;  5KIX A;  4QB4 A;  1Z47 A;  4IFD H;  4FO2 A;  3RZD B;  1Q1B A;  3UI2 A;  2NN6 G;  4F7X A;  1V8Q A;  3OSO A;  3H09 A;  3NTK A;  1RCV D;  4OHJ A;  2PW5 A;  2IX1 A;  2VB3 X;  1DOM A;  5I9P A;  2EYJ A;  3D4D A;  1ZYR C;  3GTM B;  1X3Q A;  1JWM D;  1SNO A;  4IUR A;  3IL8 A;  4EVO A;  5COR A;  1H9S A;  2IT1 A;  1SYD A;  4K2L A;  3T16 A;  2E2D C;  4RCN A;  1SYB A;  3MTS A;  2Z4H A;  1O80 A;  2R6G A;  4EGV A;  2PCF B;  3SE0 A;  2M2L A;  1D1I A;  3D3R A;  4Z9C B;  1CK1 A;  1BUV T;  4IFD I;  1S5E D;  1YNN D;  3P75 A;  4M1U B;  1S5B D;  2LKV A;  1M8A A;  2R61 A;  1NUC A;  4RCO A;  3PUX A;  1JC7 A;  1H9S B;  1HUN A;  3DEO A;  3VR2 A;  3HOY B;  1CZG A;  5FLX E;  3A7L A;  3CKI B;  3OOC A;  4Q0F A;  1TWG B;  4CKB A;  3KK7 A;  1PTO D;  3K5L A;  1EY5 A;  3PV0 A;  1AZP A;  2TMP A;  1BXT A;  4TKO B;  1ZYR D;  1UNS A;  3Q24 A;  2L55 A;  3JAM E;  2L11 A;  3DWP A;  2QCP X;  5FKA C;  1BF4 A;  1TR5 A;  2O4X A;  4QUC A;  2K01 A;  2K5D A;  4LAA A;  5JEA G;  2VXW A;  5AFW A;  4MHE A;  1B9N A;  2BCO A;  3A54 A;  4C56 C;  2SEB D;  3NE5 B;  4XT3 B;  1SYF A;  2B2T A;  3HZX A;  4EQO A;  2E75 C;  2RSN A;  2Y0S B;  3MFY A;  1STN A;  3HS0 C;  3FVQ A;  1K8M A;  5C3X A;  5CBA E;  3RZO B;  1PTO F;  4KD3 A;  2IWH A;  5ELB A;  1EFI D;  1BCP D;  1PRT C;  1DON A;  4IZ8 A;  4XYQ A;  4C3I B;  2F0M A;  1LTT D;  1VCI A;  5KNB A;  2K03 A;  1HA5 A;  1WTV A;  1CA5 A;  2RBM A;  2AWO A;  5CV9 A;  3P1H A;  1PFM A;  4H13 C;  4ZRZ A;  4FP5 D;  1A2T A;  4BS9 A;  3R2I A;  1IKM A;  3H94 A;  1BNZ A;  5JAV A;  1D5M C;  2XRS D;  1PXU A;  2JA6 B;  2GA4 B;  4A3B B;  1B4O A;  4RGN A;  2XVS A;  2PW7 A;  2C9O A;  5IGF A;  2WP8 J;  1CTM A;  1ROD A;  1ENA A;  3PUZ A;  1S4Z A;  3EA6 A;  2H4O A;  1HFG A;  1NAP A;  1PFB A;  3NBI A;  2EZV A;  3VA5 A;  2JA8 B;  1L0X B;  1WTP A;  4G7Z C;  2K7V A;  1EY9 A;  2R7Z B;  3SK5 A;  3A8I E;  1TY0 A;  2O2L D;  1O7L A;  3T13 A;  3S1Q B;  1I4P A;  3I73 A;  2NVY B;  2A6H C;  3OPO A;  3CHB D;  3DHQ A;  3K57 A;  3S1M B;  1PTO B;  2B2W C;  5A2Q L;  5FO8 B;  1JIC A;  4N9T A;  3C46 A;  3TZU A;  4A3M B;  1LT3 D;  2SOB A;  1F2M A;  5I6W A;  1Q3L A;  3HOU B;  3EQL C;  5E3F A;  3DWQ A;  1E2Z A;  2IL8 A;  2EXZ A;  3BYT B;  1RKN A;  5A35 A;  1K83 B;  4P2C B;  2QF7 A;  4C3I G;  1XXG A;  1HQM C;  2KUM A;  4PMB A;  1QNU A;  1WTR A;  3GV6 A;  1OXX K;  1STB A;  2B8G A;  4Y7N B;  2F0I A;  1Z7T A;  3NXW A;  5ELF A;  4HMI A;  3KLS A;  1VMP A;  4C2M B;  4CBV A;  3KBG A;  3D6C A;  3V96 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...