2F0WA

Crystal structure of staphylococcal nuclease mutant v23i/l25i/v66l/i72l
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
136
structure length
136
Chain Sequence
KLHKEPATLIKAIDGDTIKIMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMLENAKKLEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Staphylococcal nuclease
publication title Hydrophobic core mutants of Staphylococcal nuclease
rcsb
source organism Staphylococcus aureus
total genus 36
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2005-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2f0wA00
3NXWA 4IALA 2EY2A 2NUCA 4I65A 4DFAA 2WACA 5I9PA 1EZ6A 1EYCA 4NMZA 1EYDA 4K2KA 2F0PA 3D8GA 4B9XA 5CV5A 1STAA 4HTHA 3QOLA 4N9TA 4QF4A 5CC4A 5C5MA 5HURA 1A3VA 3C1EA 1TT2A 1EQVA 3MVVA 2F0UA 3H6MA 2PYKA 4S3SA 2EYFA 4ZQ3A 1EY4A 2F0NA 4ZUIA 4WORA 1A2UA 3D6CA 1SNCA 1JOOA 1ENAA 3SK8A 5IGFA 2HQEA 3E5SA 1STBA 1NUCA 1STGA 2EYPA 2F0IA 3C1FA 2F0MA 1EY6A 3OSOA 5KGUA 1AEXA 5IGGA 2F0JA 1EY0A 1KDCA 2PZTA 2SNSA 3MZ5A 1ENCA 3SXHA 2OF1A 4HMIA 4E6IA 5I9OA 5M9OA 5J22A 2F3VA 3ITPA 5J1ZA 4KY6A 5JOBA 4DF7A 5C3XA 1EZ8A 5HGTA 5KYIA 5KIXA 3NK9A 3R3OA 5CV7A 3EJIA 2F0DA 4F8MA 2F0LA 3EROA 4K5WA 2RDFA 2ENBA 3SK5A 2PW7A 4NP5A 1A2TA 5KRUA 5CV6A 2EYJA 2F0WA 3OWFA 4YIJA 1KDBA 4HMJA 4KJOA 5C4HA 3TP6A 1F2MA 3T16A 5I6YA 5CV4A 2EYOA 4R8NA 1SNPA 1STYA 2EY6A 4J1MA 5DEHA 4ZUJA 2O4XA 2KQ3A 3T13A 4KTAA 3HZXA 1EY7A 3TMEA 5J39A 3SK4A 3TP5A 2F0QA 3TP8A 5IOCA 1SNDA 3D4WA 2PQEA 3DHQA 2EY5A 4KJNA 1JOKA 4KD4A 1NSNS 4EVOA 5EGTA 1U9RA 4KD3A 1STNA 5DAUA 4WRDA 5E3FA 2SOBA 4EQOA 3ERQA 2F0GA 3BDCA 4K5VA 3U9OA 4EQNA 5IGBA 2KHSA 5C6AA 1KDAA 3NHHA 5KYLA 3NQTA 4J6HA 4B9WA 1RKNA 1EY5A 5IGCA 3S9WA 2EYHA 3RUZA 5K5PA 3NUCA 3SK6A 2F0TA 1SNOA 4NDXA 4RKBA 4K8IA 5CR3A 1IHZA 4MIUA 1SYEA 3EVQA 4KV6A 4OL7A 5CGKA 2LKVA 5C5LA 5E1FA 1TR5A 4ODGA 3MHBA 1A3TA 2EYLA 3NP8A 3OMGA 3BDLA 3PMFA 3QB3A 1F2YA 2RBMA 3DMUA 4RKLA 5CV8A 4KY7A 5C4ZA 3QOJA 4ID6A 1SYDA 5NUCA 1II3A 3HEJA 3LX0A 4IUNA 4QB4A 5F2DA 3VA5A 1KABA 4DU9A 2F0EA 3SHLA 5I6WA 3P1HA 1SYGA 2OXPA 2PW5A 4QMGA 2F0SA 4IZ8A 1F2ZA 4H7BA 2F0FA 1SNQA 2F0KA 1SNMA 4K8JA 4K5XA 4K2LA 4LAAA 4ME5A 4PNYA 1SYBA 2EYMA 4KHVA 1JORA 3OMCA 2EXZA 3P75A 5JAVA 2PZWA 4F7XA 1TQOA 5IGEA 4PMBA 1SYCA 1EY9A 3MEHA 4EQPA 5IGDA 5KEEA 2QDBA 4NKLA 2PZUA 3SR1A 1A3UA 3TP7A 2SNMA 5EKKA 5EKLA 3V2TA 1JOQA 1EY8A 4KY5A 2F0OA 4N9PA 5IODA 2OEOA 4DGZA 4TRDA 5CV9A 2F0HA 5IIFA 4K6DA 2F3WA 1STHA 1KAAA 2M00A 2EY1A 4K14A 2F0VA 2RKSA 3D4DA 1SYFA 1EYAA 5ISRA 4PMCA 4G57A 5C3WA 3MXPA
chains in the Genus database with same CATH superfamily
4CJ0B 5EKIA 3PIOA 3T51B 1OXTA 1E0BA 2JJQA 3QR8A 4LFCL 1I4GA 4QF4A 3QOLA 5E4WC 3JAMi 1F9SA 1L0WA 5M3FB 2KBNA 1KD1C 3BVGA 3MC0B 2B2YA 1LTRD 1N32L 3KK7A 3G4SA 1J5EQ 1E2ZA 1SNCA 1EFID 1FGUA 3L7ZC 2JA6H 5CYUA 1WTPA 1XTCD 5FO9B 4A3EB 2R93G 4E6IA 4HMIA 4C3IB 2IX0A 3J81j 2K28A 4DF7A 1UE7A 4LF7Q 3R2TA 4BBRH 3UI2A 1CA5A 5KRUA 1U5KA 4TQUS 1I4HA 1KDBA 2EVBA 4HMJA 2EYOA 5AFWA 4JI2L 4A3GH 4BA1I 3WWVA 2JA9A 3CCJA 2C5CA 3CRKC 1HZCA 1EU4A 4ZKBB 2EY5A 1EWCA 3HOVB 3KF6B 5JEAJ 1CI3M 1HNXQ 2EJMA 3SDZA 1OO9B 2MHVA 3BDCA 4IPHA 3GO5A 2A68D 1K3BC 1JB7A 1IL2A 4HJAA 1N36L 1A63A 3CKIB 1RHPA 3KF6A 2ID0A 4XDXA 5J3BA 3DEPA 2K7VA 2VY3A 3T1HL 3S2HH 2K52A 3FKIH 4QCLA 2WB1E 2CCZA 4JYAL 2HDMA 3F2CA 3M7NA 1TWGH 3HOWH 2EDGA 3S1NH 2F0FA 4DR7L 5IT9c 1TWHH 3V05A 1WD1A 5IYDG 4O2DA 1IL8A 2KCTA 1SE3A 1E7ZA 3CU7A 2YV5A 1HA6A 3RLOA 3QWNA 2RQXA 1JB3A 3NWSA 3A5UA 1VQJA 2RCNA 1XJVA 3FHWA 4C3HB 1KNAA 1H95A 1B8AA 3NXWA 4IALA 3FRPB 4CHTB 4UAIA 2KENA 5BN3A 2F0PA 4L5QA 3QG1A 3U4VA 1JT8A 2F0UA 4BY7B 2RVLA 3H15A 5EQ0A 1WTRA 1TU2B 4LFCQ 2R6GA 5T1GA 4XXEA 5C0XH 3GTPH 2XIWA 1B50A 1A8VA 3HOUB 1N32Q 2OWOA 1PYWD 5IP9G 3K80C 5KIXA 4CDEC 3ULPA 1VQMA 3S1RH 1UE6A 4DV0Q 4DR3L 4A93G 4LFBQ 3I55A 4R4IA 4LUZA 2F4VL 3OWFA 5C4HA 1SR3A 4QY7A 5CV4A 1YBYA 5EPLA 3J81E 2JK8A 1CK1A 2EY6A 4JI0L 2DJGC 5I2XA 5M3FG 3EFXD 3GTGB 1IW7D 2F0QA 5LMNW 4QL5A 1MHWC 1PTOF 1MSHA 5DM73 3E0JA 4JI2Q 1E2VA 5M5YB 5C4XB 4JI6L 2GVAA 3HRZC 4WRDA 4A3IH 1X6OA 4JW0A 1GJXA 3CCQA 3NHHA 1H9SB 2YU9B 1HZAA 3H09A 4X65L 5K5PA 3EN2A 3SK6A 4DR4L 1VQ6A 3T53B 1A0IA 5BN4A 4HJ7A 4DUYQ 5C44B 1LTAD 5E1FA 2EE1A 2WKDA 4J15A 2EYLA 1XNRL 3HOZG 1H9SA 1SYDA 1PH1A 1N36Q 1ASYA 3I4MH 1JJ2A 4A3CG 3T1HQ 1J9OA 2LY7A 4DR2L 1MIUA 2BA0A 4JYAQ 4FXKC 5A2QL 2JA7G 5AJ3L 4KHPL 1JWMD 1DOMA 3F2UA 4KMUC 4P72A 4FF2A 2SNMA 5IE8A 3OTOL 1JE4A 2AKWB 3A8IE 1MSGA 1KAAA 2CWAA 5FLMH 1D5MC 4C3IH 3E3XA 3RLNA 3BZDB 4HN7A 5JPNC 5IP7G 2CH4W 4HIMA 4XQQA 3OOCA 4RMFA 1LABA 1C7YA 1K8AC 3KBXA 2F0NA 1YIJA 5COYA 3J80c 1S5CD 4HIDA 2Z8LA 2F0MA 1HHVA 5JJIA 3HOVH 1NR4A 2OF1A 3BDOA 2O2LD 1JJGA 4DV1L 4YWMA 2A68C 2E76C 2K04A 3EROA 4K5WA 1O78A 2UUAQ 5CV6A 4JVZA 3PIPA 3NENA 4A3MB 2FFKB 4JI8Q 2NZHA 2BH8A 4DR3Q 2K33A 4YCUA 1F9QA 4BY7G 3GDEA 2CW0D 1LLRD 3PUZA 4HIKA 1W6KA 4A3JB 2CQAA 2VB2X 1WFQA 2O5JC 1IYJB 2GA4B 4YY3L 4JI0Q 1B7YB 4GNXC 4YWKA 4HSPA 4U673 1SEBD 2BOSA 2K5NA 3IKJA 4DN4M 3WOFA 1UNSA 1X65A 1K3RA 1Y1VB 3I90A 4JI6Q 5FO7B 1UUPA 4OL7A 3VR5A 3D4RA 2HCCA 1CHQD 1ASZA 3T13A 1F2YA 2GN5A 1WCMB 3SE0A 4LFAL 4X65Q 3G6JB 2VUMB 3H3VH 4DR4Q 4JCVE 4HJ8A 3K8AA 2B63G 1IBKL 4U68A 4OEMB 2JN4A 4NXML 1I3QB 2JA5G 1SYCA 2FINB 5IGDA 5KEEA 1FJGL 3TEHB 1KXLA 4IUTA 3S24A 5EKKA 3HKZE 4H0LC 2HIXA 1VQ4A 1JOQA 2D9UA 4I7ZC 1BCPF 5AJ3Q 3URYA 4KHPQ 1GVPA 3L3OC 2H4OA 4K14A 1X9NA 3D4DA 2IWHA 3RN2A 5IY0A 4OXPA 5IWAL 1CKNB 5KYLA 4G7OC 4DPGA 4DV4L 2HUGA 3OTOQ 4C3JB 2Z1CA 4KKSA 1LT6D 3MFYA 2CQOA 2KHJA 2Q8IB 1RIPA 2QDLA 1NCVA 2L12A 5CC4A 3T1YL 3J7A5 1NY4A 3A8KE 4KN7C 1MI2A 1Y1WB 1CKNA 2RDHA 1LTGD 3H6MA 5EJWA 3HOXB 5FLXL 2I0QA 3GTMB 1IW7C 3GTGH 1AP0A 1G8ZD 4A3LH 1NMFA 1H9KA 1CA6A 2E2IB 3M4QA 2WAQG 1VQPA 1VQ7A 2DUDA 5M5YH 3JC66 1BQQT 4N8FA 1EIGA 1SROA 2IW3A 1R4PB 1CHPD 4JI1Q 3OYYA 4JBWA 1OXXK 3PUYA 2YU9H 2V1CC 2Z9HA 3GTJH 1T5EA 4GLVB 2KUMA 5C44H 1EWIA 1NMGA 1O80A 2EJFC 3D0FA 1BCPB 5A35A 1WTHA 5M3MB 5M5XB 5IOCA 2VNUD 3A7LA 1N8RC 4KJNA 1NJIC 1QB5D 4IFDH 4A3BG 3I4NG 4GNXB 1D6EC 5DLQE 3KF8B 2K75A 3NUCA 2VXWA 1QVFA 1HFNA 2ZXRA 1IHZA 5CR3A 1JCKB 1Q7YC 2ZTEA 1EOTA 1S72A 3PF4A 4XQNA 4GNXA 2PI2E 4LJZC 3TP5A 3BS1A 1QZHA 1XPOA 3KF8A 1BBWA 5A2QE 1X3QA 1PTOH 5NUCA 4I7AA 5JVH3 2F0EA 3RZDB 1C48A 5D3IB 1DM0B 4LFAQ 1VQCA 3OMCA 1LYLA 2E5LQ 2EXDA 5FJ8G 5FK9C 1IBKQ 3VR3A 2NN6H 3J7AV 1Y1VG 1NAPA 2KCNA 3A7AB 1KIXA 2FHTA 4B3RL 3K7AH 1A6XA 4NXMQ 2OEOA 1DGSA 4UHVA 5ELEA 4CBVA 1V8QA 4WFN3 1PH5A 1FJGQ 2UUBQ 4O0AA 1EYAA 4G57A 3TRZA 4KHZA 2L1BA 3KYHC 1Y14B 1ENFA 4FNFA 4K6LA 4R1JA 5I2YA 3AYHB 2Q2HA 5EAYA 4GN4B 4BA2I 4A3MH 4RH6A 2A73B 1IKLA 1SMYD 4DV4Q 1WTVA 4JG2A 3CCVA 4GOPB 1RTNA 4JI7L 1HNZL 2CW0C 1STBA 4RHSA 2R93B 4PMWA 4A3JH 2K6AA 3T1YQ 1FR3A 2SNSA 1AFPA 4ZYSA 4NW2A 1H9JA 5IYBG 3M4YA 5EPJA 5LL6X 4GOPA 3WOEA 5BR8L 2QILA 4OO1G 3CQZH 1HNWL 4WJ3M 4LF8L 2EYJA 4ILWA 2F0WA 2XVSA 1P8LA 2V4DA 1BKBA 3T56B 5I6YA 4QJFA 4L6TB 3G6EA 4KTAA 3F2DA 1LTID 3OIQA 1AE3A 1Z47A 5CORA 1WCMH 1CQFA 2R7ZG 2AWNA 1EIFA 3MXGA 4DXGA 2CH4A 2QGQA 3EA6A 4K0KQ 3VYTA 2HHHL 1V43A 2A1AA 4XYOA 5C3EG 1STNA 1DZ1A 2AMCB 1I3QH 5KNCA 3NQTA 4B9WA 1RODA 2N3SA 1YHBA 2F1MA 1I94L 2IY5B 1TWFH 5GAHC 2DY7A 3PF5A 3DLLA 1XWEA 1UEBA 2RA4A 1B53A 2AQ2B 4JBKA 4RKLA 4NB3A 2EIFA 3KJPA 3RD4A 1SE4A 4CDFC 1JJCB 5EBCA 2I5HA 3H94A 3X3MA 3KOJA 2I46A 4IZ8A 1QNKA 1Q46A 1VDZA 4IUQA 4QIWE 1SNQA 4C3JH 2KVMA 1VQ8A 1K8OA 1PVOA 4KHVA 1XYIA 3E0EA 4IUPA 4OWXB 3RNUA 1HTPA 1F9PA 3PO2G 1Y1WH 1I4XA 2XRQD 5G3LF 4EQPA 3BYTB 1YZ6A 4NKLA 3HOXH 4ULLA 3GTMH 3TP7A 4RAUC 2L11A 3PUWA 1VMPA 1BO0A 2A8VA 2JEAI 1E2WA 4DAVA 5JVG3 4XIGS 1S5DD 2BH2A 2E2IH 3M4OB 1SLJA 5M5WB 2F0VA 2RKSA 3CCUA 1N34Q 3PUXA 5FLXE 4B3RQ 4I65A 2WACA 4NMZA 5LMUL 1JR0D 4P74A 1L2FA 2A19A 4BS9A 4IO9A 1CFMA 4N9TA 2I5MX 5H1SE 2K50A 3GTKH 5JJZA 2Y0SE 1WVLA 1ML0D 1ENAA 4L5SA 1OXSC 1STGA 2JA6G 2CKZB 3J81i 2IHEA 5ELFA 2F0JA 1EY0A 2WV6D 2UXBQ 3MXNB 3ITPA 4KY6A 3H0GG 4L63B 1Y8NB 4JI7Q 1HNZQ 4A93B 2L55A 4MTNA 1R4QB 3UDFA 2R92G 2PW7A 1H9RA 3CC2A 3K5LA 4LWCA 4P73A 1CTMA 2ZJRA 1AZPA 3VR4A 3MXNA 1MJCA 2X69A 1G6PA 1GKHA 3ONAB 5BR8Q 3DWPA 1HNWQ 4RCOA 1EY7A 3S14B 3NQIA 1EIYB 4DV0L 4LF8Q 1XXGA 3BZCA 4DKAC 1WD0A 2PCFB 2DGYA 2PQEA 3DHQA 4LFBL 4KI0A 3ERSX 1JWSD 4B3SL 2B2VA 1VQNA 1WJJA 4RGOS 4C56C 3J7YW 2BCOA 3DUZA 1VCIA 1EY5A 1S5ED 2XNAC 1B1ZA 2HHHQ 3S17H 3HOZB 4POFA 1EYGA 3IAYA 1CQVA 3E9HA 3K5OA 1L0YB 2CVRA 1XPRA 1I94Q 1B3AA 3CRLC 2C9OA 5ELCA 3M85A 5JEAG 1PRTD 2A6HD 3HOWG 2J7ZA 4DUYL 2JA7B 1QJOA 3TZUA 5L37A 1IZ6A 5JAVA 2NVQH 2IJ0A 1WTQA 1OTCA 1SMYC 3A54A 1Z6HA 2IL8A 2HCIA 1CSQA 4CJ1B 3PO3B 5IODA 1CSPA 3JAMc 5JJLA 1STHA 4RA8A 1BF4A 1X55A 1SJHD 2Z6KC 3HS0C 2RSNA 3GTQH 1X3GA 4KKUA 1LTTD 1U0LA 2NUCA 2RCFA 4L5RC 3CCLA 1NBWA 1HQRD 2R61A 4WJWA 1OXUA 1J6QA 4DAYA 4DK0A 1B4OA 5LMUQ 4R9WA 1L1OC 1K73C 2XWJB 3SK8A 2MO1A 3C1FA 2QEJC 1AEXA 1FVIA 1LACA 3L0OA 1KDCA 1VQ9A 4X3UA 3AB9A 5C0XJ 5KNBA 4M8AA 1I4RA 3EJIA 3STBC 4APVA 1YNXA 2ENBA 5LMNQ 1RCVD 4JBJA 1H9MA 3HKZG 3CPWA 1BXTA 1I50B 4R8NA 4XTCS 4XT1B 2B8FA 1R9TB 3MWYW 4B3TL 1VQDA 5J39A 1UAPA 2X6GA 2UUAL 4IUUA 3MFGA 1HR0W 4C2MB 1ILPA 3NSWA 4JI8L 5ELDA 4A3IG 3PIO3 1SMXA 1LT5D 2PPBC 4GZYC 1B9NA 3MXUA 3Q23A 1I6HH 2PMZE 1N9WA 4B3SQ 1AN8A 1TIID 5CGKA 4KLKA 5C5LA 3J80L 3FDTA 1PFNA 3NP8A 3PMFA 2TMPA 2NVTB 3GTOB 2X6LA 2B63B 4RG1A 3VA7A 5M5WH 4IQZA 3CCSA 1PHJA 2Z4IA 3P1HA 1KLGD 1XMQQ 2JA5B 4HEDA 4K8JA 3J7AF 4BXXG 2OT2A 3HOYG 2B3GA 1VQAA 4XT3B 1CKMA 1D1IA 3W1BA 2G5DA 3QJYA 4PMBA 1SE8A 1U4RA 2PZUA 1T9HA 3V2TA 1EQQA 5D65A 1HZBA 4DGZA 2TSSA 1GHJA 2WP8J 1SSOA 2DNEA 5IP9H 3S1QH 1GUWA 4R4TA 2Q2IA 1NR2A 3MZ5A 3HG9A 3E9IA 2K5DA 1KHIA 2OQKA 4X6AH 2K5VA 5LHY1 2OCEA 1E22A 3RR5A 1GM5A 1BBXC 2KA7A 4IPDA 1HXYD 1Q8IA 2AUKA 3CAMA 1MKHA 5M3FH 2D0OA 2CWPA 2MO0A 3S14H 1L1OB 2HQEA 3LGJA 2WAQB 5GADC 3PO3G 4A3FG 2NVXB 1ENCA 4A3EH 5KNDA 1SFOB 1W2BA 2LFNA 5JOBA 3D31A 4A3DG 4XQJA 3R3OA 4Q5VA 4ZKCB 3I4OA 2F0LA 1L1OA 1TY0A 4FYDA 1PV4A 2Q8RE 2JQOA 1Y8PB 2VQFQ 5K36G 1SNPA 1C4QA 1S3OA 3A55A 1PYBA 3HOZH 2K32A 3TMEA 4LF4Q 1HUNA 4JI1L 4FF1A 2VL6A 1D8LA 4A3CH 1PH6A 4A3BB 4BBSG 4KD4A 1O7ZA 1PRTC 3I4NB 1NSNS 4PZ6A 2A6HC 4Q0FA 1ZXTA 3RN5A 4GKJQ 1V9PA 2NZOA 3FEWX 2UXDL 4B3TQ 3ERQA 3F8TA 2JA7H 4K5VA 1X3EA 4ZAIA 4FF4A 1RKNA 1YEZA 2HDLA 5I4DA 2ZT9C 2E2DC 2FXQA 1EOVA 3MAQA 1SJED 5IYCG 1WTOA 3A5ZB 2ZXOA 1TY2A 3PQIA 1EWHA 1DOLA 4IOAA 4BWGB 1HZ9A 2AQ1B 3PSIA 3ND9A 4QMGA 5HY6A 4CGYB 3PV0A 1HA5A 2F0KA 3HFZB 3F1ZA 1JORA 5E4XA 5ELOA 2PO4A 3DWQA 5IGEA 3MEHA 1B2TA 2A5HA 5D14A 2D5DA 4BY1G 5LL6S 5T1IA 1U4PA 2E5LL 1E1TA 4AIMA 2AQ3B 4C3HH 3RMHA 2N78A 1B3QA 1C9OA 1FD7D 3KUPA 4O1NA 1PH2A 4RHRA 4X62L 2WB1B 4S3SA 1NNXA 1PH3A 2ZM6L 1R9TH 4RGTA 2UUBL 4BY7H 3S1MB 1TVXA 1IBML 4QUFA 5KGUA 3S2DB 4OELB 1F9RA 2JP1A 5I9OA 5J1ZA 3HOUH 1M90C 4HIOA 3N6RA 3ER0A 1LV9A 4RGMA 3SK5A 3M4PA 2F4IA 4KKTA 3GV6A 1VF5C 3A8JE 1PZID 2WIIB 3T16A 1QZGA 1STYA 1MGSA 4DR5Q 2O4XA 2KQ3A 1ILQA 2R7ZB 5E7NA 2JA8G 2NVTH 2E2HB 3GTOH 3TP8A 2B63H 4UY8C 1GUSA 1QE6A 3NELA 4CDCC 1Q90A 5C3EB 2K14A 2KEDA 3NE5B 2E2JB 4RFBA 5EGTA 4IFDJ 5C4XH 1KRSA 4IFDG 1KRTA 4DV2L 2JA5H 1PFMA 3ULJA 3IFTA 1QCBD 2KHSA 3R93A 4AYBE 1G2TA 2ZJQA 4DNRB 2DNCA 1M8AA 2Y0SG 4JV5L 1XNQQ 1STEA 3TREA 2OQ0A 4K0KL 2K03A 2UXDQ 2HIVA 1CUKA 1YVCA 1TWAB 3K5NA 3BDLA 1Q8KA 3L2PA 2KEEA 5JPMC 2B39A 4UP7A 4H7BA 4GKKQ 4DK6C 2KHIA 1HQMC 4ME5A 3FMCA 1YNJC 3GD7A 4P75A 1UEAB 1TS2A 3PO2B 2QA4A 1FGBD 3A56A 1M4VA 5FO8B 1GUOA 2VQEL 3CC7A 3PIP3 4UP9A 4IJHA 3NBHB 1A3UA 2D0PA 3AFQA 4KY5A 1W3SA 2F0OA 3HGBA 4CKEA 4LF5Q 3C46A 2H5XA 4QGUA 4K6DA 2G9HD 1VQGA 2M00A 2NVXH 2ES2A 2EY1A 1BOSA 1IBLL 1SRUA 1UWVA 1YJNA 1SFOH 1YHAA 1Q81C 3MXPA 3NEMA 4F8MA 3NBHA 4MN3A 1YNND 4JI4Q 2MNAA 1KTKA 1SN8A 4DV6Q 1T5XD 5HURA 1A3VA 1QNUA 3K81C 1X3FA 3U9SA 4V190 4ZQ3A 4G7HC 1N34L 1AZQA 1DD2A 2JA6B 2PQAB 1NUCA 2Z4HA 3OSOA 2PNRC 4A3BH 1ICFB 4X62Q 1HUMA 1S5FD 3H0GB 4DK3C 4A3KG 2MUYA 4ZCKA 2WINB 1UE5A 2ZM6Q 3A0JA 2B2UC 2R92B 4RCNA 4X64Q 2F0DA 2AHOB 1IBMQ 2PQAA 1QVCA 4J8QA 1KAWA 4QUCA 2M2LA 3T4AC 3NWTA 4XYQA 1KLUD 2UXBL 2WB1G 1NE3A 5FLXc 1Q3LA 4IOCA 4ABNA 1EQRA 2XRSD 1MD2D 1K28A 1GD7A 3G7LA 4JI3L 4EVOA 4OO1I 5DAUA 3ICEA 4LF6Q 2SOBA 4LUOA 1V1PB 1GUNA 2F0GA 5IGBA 3U4ZA 3OW7A 2KCMA 3D6WA 5FJ8H 4J6HA 4F88A 4YCVA 1Y1VH 3BU2A 1KQSA 4UPAA 4DV2Q 3S2HB 4O42A 3VR6A 1E3PA 1V1PA 2WFWA 4IUVA 1B9MA 2F52A 1TS4A 1RDPD 2L15A 3DMUA 3QOJA 4ID6A 3VR2A 1II3A 4JV5Q 2VUMH 3TBIB 1TWGB 4FO2A 3HOWB 2L9HA 4NPSA 4YCWA 2YYZA 2M9VA 2XWBB 1VQFA 1VQHA 2SEBD 2ICIA 4FVMA 2QF7A 2E74C 2I5LX 3STBD 1QUQB 2D62A 1BR9A 1S5BD 3VYUA 3L9AX 1TWCB 1J8IA 1DYQA 3I3CA 1WI5A 1Q12A 4DR1Q 1D5ZC 3M3YB 1ET6A 1EY8A 1O7IA 3I2ZA 4N9PA 2FMMA 1QUQA 1PTOD 1RJTA 2F3WA 3CF5A 3S2DH 5IYBH 2VQEQ 3AQQA 1Z9FA 4DAMA 1TKWB 1IYVA 3OPOA 2QCPX 4JBMA 4IN3A 1IBLQ 3D3RA 2EPBA 1G91A 2L0CA 1CZGA 4C1NK 3C1EA 3CCRA 3F2BA 3MVVA 1F77A 3ULLA 2R7ZH 1A2UA 3KDFA 4OWWB 3Q22A 5IGGA 5C3EH 3DM3A 2E2JH 3CC4A 5J22A 4EQ5A 1SE2A 5KYIA 4L8JA 1XPUA 2P5ZX 3LWEA 3S1RB 1DOKA 4UDUC 4A4IA 1RF2D 2XTIA 1MBYA 2JYOA 3HKZB 1SBBB 2BA1A 4B08A 2MFIA 4DV5L 1K8GA 2R7FA 4J1MA 4TVAB 4DR6Q 3JAML 1TWAH 2B2UA 2B2TC 1Y69U 4GLAC 1ESRA 5M3MH 5M5XH 4GN5A 2MP1A 3D4WA 1GOZA 2IT1A 5LMNL 2MQHA 3TN2A 3K0YA 3K0XA 1LO5D 3I91A 5IT9L 3MA2B 4A3IB 4POGA 1LTLA 5ELNA 4DV7L 2E8GA 4AQYL 4BBRG 5HGQA 4TSSA 4FP5D 4PZ8A 4JI3Q 1D5XC 2ALYB 3CW2C 3I70A 2NYZD 4MIUA 2L4NA 3GV3A 3E6ZX 3WDNA 2NVYB 3MHBA 4A3GG 2QKIC 3H3VC 3LX0A 4IUNA 1KABA 4IPGA 2PW5A 1M1KC 3HOYB 1YNNC 3BZKA 1X3PA 4IPCA 3RZDH 2HT1A 2UUCL 4OX9L 1QWYA 3DXJC 1TQOA 1VQIA 4ZK9B 2BDOA 4MHEA 1FNUA 3IL8A 1XMQL 1GHKA 2IX1A 3HP3A 3FKIG 3H0GH 1RTOA 2HD3A 5C3WA 2R92H 2OTJA 3J81c 1YI2A 3EQLC 2MGSA 1GXDC 2AUJD 5GAEC 1STAA 3NTHA 1JICA 1JMCA 3UE1A 2EYFA 3CMEA 3M9BA 1HTLD 2WKCA 3MTSA 3KFUA 3TS2A 1Z7TA 4A3FB 4DNTB 4GS3A 1UE1A 1EY6A 2R93H 2UXCL 2PI2A 1A15A 3KLSA 5M9OA 4A3DB 3CXCA 1AE2A 1EZ8A 1GUTA 2K4KA 3C2PA 2NTSA 5CV7A 4PZ7A 4DAYB 4LK1C 1VQEA 4F87A 3KLRA 2EOTA 4G4KA 4R4OA 3Q0AA 1HR0Q 1ESFA 2JEBI 1BCPD 3FP9A 3TQYA 1O7LA 3KLWA 4BBSB 1AW7A 3TZDA 2ASBA 5C0XI 2DY8A 5JEAH 3OHXC 3GTLB 2NWGA 2DN8A 4DV5Q 3OIPA 4LW1A 1U9RA 4KD3A 5C0XG 1SXTA 2VQFL 4EQOA 1JE5A 1FYCA 5C6AA 2B2TA 2E75C 4LF4L 4Z9CB 1KNEA 3M7GA 3RUZA 1TWCH 4JI5L 4RKBA 4K8IA 3QIAA 1JWUD 3I7FA 4OONA 3M3YH 1I4PA 1BDOA 4GKJL 2XGTA 4DV7Q 1A3TA 4AQYQ 1PTOC 1HH2P 1DJRD 4IURA 1WYDA 3AFPA 3CCEA 4H02A 2I07B 1XMOL 4HAEA 4EGVA 1L0XB 1RD9D 5IYDH 1BUVT 2ZTCA 4GLXA 2XN9C 4OIKA 4BY1B 1ET9A 1EY9A 4HJ5A 3BYYB 4ZLTF 1DCZA 1GUGA 1CT1D 1JQYD 4CDDC 2UUCQ 4OX9Q 2KECA 1PH7A 4X3KA 3NBIA 3UE0A 1I5FA 4Y7NB 1TS5A 3M4OH 2VB3X 3CD6A 3PCOB 1SYFA 1S4ZA 3VDYA 1U4MA 4AYBG 1U4LA 2UU9L 3I4MG 3S15B 4KN4C 1EZ6A 1EYCA 4X66L 4YHHL 2CFMA 4DNIA 2BE5D 3ZYYX 4X3SA 3IRBA 3CPFA 1ONLA 1E24A 1ICWA 3MEFA 4IJLA 2RF4A 3V96A 2EYPA 5EPKA 1D1KA 4QIWB 3DWAA 1EFWA 3I8ZA 3AU7A 5FLMG 4A3EG 5FKAC 4C3IG 3N52A 3G48A 3JAME 4A93H 2ZXPA 1A2TA 1K83B 4DAPA 2UXCQ 3GTJB 5GAGC 1YNJD 3K7UC 3TP6A 3J80i 1PXUA 3QO2A 3UDGA 2Z6KA 5DEHA 5IT9E 5BN5A 1ZYRD 2JA8B 2NVYH 1KC8C 4R4QA 4JOIC 1G6ZA 3HZXA 4EX5A 3S16B 1ZEQX 1LT3D 5GQOA 3RZOB 1PDQA 1D2BA 3HOVG 4BXXH 4LUVA 1E1OA 2K5HA 1G2SA 1X32A 3HOYH 1TXYA 4RGNA 4DR5L 4EQNA 4B3ML 3TDQA 1KDAA 2Y0SB 1DONA 1SNOA 2MPMA 2H1EA 4DR7Q 1VMCA 4RWSC 2KCCA 1PZKD 3DEOA 4OIJA 4CJ2C 2VW9A 4NXNL 3VYRA 5C4ZA 1PMRA 1PTOB 4FDBA 1QVGA 2YTYA 1PFBA 4QB4A 4JI5Q 1FNWA 1KL9A 2LSSA 3SHLA 1Q86C 3AEVA 2B8GA 3KJOA 1XNQL 3K57A 1FL0A 3EIVA 1SYBA 2LS01 3P75A 5DM63 2PZWA 4HJ9A 1IKMA 1ZKOA 1XMOQ 2NTTA 3J7ZC 1VQBA 3K7AB 1PA6A 3PO3H 3OWEB 4A3FH 4GKKL 3RLFA 3I73A 5CV9A 2F0HA 3H3VI 2A6ED 2N49A 4A3DH 4LF9L 5IP7H 2K1BA 3W2DA 2EY2A 4C3HG 5I9PA 3D8GA 4B9XA 2LXJA 4LF5L 3NPPA 5K36H 4HTHA 2A69D 2UU9Q 1LTSD 5CMDA 3H91A 1YJWA 1LM0A 4X66Q 1BCPC 1G51A 4YHHQ 3TSSA 1JOOA 2F4VQ 4BBSH 1F2LA 4JI4L 3GTLH 4A3KB 5C4JB 1IXRA 5JJKA 1AH9A 4DV6L 1MJEA 2XSCA 4LNQA 4QQBX 4LMQD 2RHSB 1PRTF 2EZVA 3HOUG 1EU3A 3CQZB 1CZWA 1VQOA 1PH8A 4NP5A 4ME3A 4ZRZA 5IYCH 2CHBD 2NB0A 5G3LD 5EBDA 5GROA 3AMUA 1I50H 4ZUJA 2FJ2A 4DV3L 1K8MA 4X64L 3I72A 2IX3A 2QEXA 3KBGA 4HR7B 1QILA 4A3LG 4JC0A 3W3AA 1JOKA 3W1GA 4C2MH 5C4XG 1XNRQ 1SDFA 3U9OA 4L5TA 4JOIA 4R8IA 4DA2A 4HSVA 3KLSX 2DJFC 4DR2Q 1TWFB 4BY1H 4CKCA 4JPBW 2BDNA 2LXKA 1CM9A 2LKVA 1GO3E 4B3MQ 1EUJA 4MNOA 4LF6L 5C44G 1N33L 3GQBA 2NZ1D 3QB3A 2YTXA 1HFGA 2GVBA 3ND8A 1EQTA 3VA5A 4Y7NH 1X54A 4IFDI 4MTKA 1G291 1EEFD 1F2ZA 3S15H 1PRTB 2N8NA 2R7DA 3LNNA 1YITA 1VQ5A 4NXNQ 3J80E 4K5XA 4K2LA 2NBFA 2D2CC 2BE5C 4F7XA 3NTIA 4GOPC 3SR1A 3K5MA 1BBUA 1PH9A 1VF7A 3DM1A 4Y52H 2ZJPA 2K5WA 4GN3B 3SEBA 1S40A 2K01A 1I4QA 5D3DA 4V0BA 2R3ZA 3BJUA 1DXMA 1CKOA 4PMCA 2B2WC 4N8X1 2PMZB 3FVQA 1EYDA 4DR1L 4K2KA 1K83H 3ZJYC 5CV5A 4LF9Q 1X56A 5C5MA 1HPCA 1HJPA 1QG7A 1EQVA 1TT2A 2NN6I 1ZYRC 4DV1Q 3GTKB 2PYKA 2JA8H 1YHQA 4ZUIA 4WORA 2G9DA 1QOHA 1XTDA 1HRJA 1D7QA 2NN6G 1WTWA 5IGFA 3S16H 4HCSA 2F0IA 3RZOH 2IHFA 2JXMB 2PZTA 2K5QA 3SXHA 1VQLA 2JE6I 4M1UB 2K05A 3NK9A 1JC7A 3P7JA 4HCEA 2RDFA 3PUVA 2J0TD 1I6VC 1B70B 4KJOA 2PNHA 3K59A 1F2MA 5TSSA 4YY3Q 3CP0A 4CKBA 1C8CA 2LMCB 4A3MG 2Q2UA 2J4XA 2A74C 1HCZA 3I4NH 4YWLA 4DUZL 4A3JG 5E3FA 4DK1A 4BBRB 4DV3Q 2F3IA 4DR6L 1PFSA 1B44D 4FF3A 1OXVA 5FOBB 2FMCA 2Z0SA 2EYHA 3S17B 1A62A 1O7YA 2F0TA 4NDXA 5CBAE 3EVQA 4A76A 1V1QA 1NTGA 2EJGC 4A3GB 2O5IC 3OMGA 5CV8A 2RBMA 2RDGA 1LT4D 4KY7A 2A6EC 5F2DA 4P2CB 1WCMG 2ZTDA 3FPPA 5I6WA 2N55A 1SYGA 2OXPA 2VUMG 2L5TA 4H13C 3UDXA 1K0SA 1LTBD 1SNMA 4P71A 3IFDA 1N33Q 2RHQB 2HQLA 4LAAA 4C1NI 4PNYA 2EYMA 2MJ8A 3K6OA 4TKOB 5DNFA 2NVQB 4OGQC 4FXGC 3NTKA 2SDFA 1BNZA 2A69C 3Q8DA 5IWAQ 1Y8OB 2QDBA 2AWOA 2N88A 1C0AA 1Q82C 4ALPA 1K9MC 4TRDA 1IYUA 3FKIB 4A3KH 5C4JH 2EQSA 4OWTB 3LWUA 1WOCA 1TS3A 2B2YC 2VS1A 3GTQB 5ISRA 3S1NB 4DXFA 4DFAA 1J5EL 1TWHB 1EL0A 4C3JG 2OTLA 4KK7A 1PLFA 4JK1C 3HKSA 2B2VC 1BVSA 3EBEA 1EY4A 1Y1WG 2B2WA 4PG3A 4PQXA 4G7ZC 3D6CA 4LF7L 3B6YA 3S1MH 3HOXG 3I56A 3E5SA 4MZ9A 4R4CA 3W5OA 4WJ4A 3R8BA 1PZJD 3A74A 3CCMA 1V1OA 1PH4A 2F3VA 4A75A 5C3XA 5HGTA 4OO1H 3BVZA 3P20A 3KDFB 1P16A 2B29A 2YTVA 4YIJA 4OHJA 3TS0A 1PYSB 1HNXL 2KOLA 4X3TA 3UDIA 1RL2A 3PGZA 2ICEC 3CHBD 2QW7A 3SK4A 3BG3A 2E2HH 2JSOA 1SNDA 1XX8A 5M3MG 3X3NA 3GTPB 3FPUB 1SAPA 3CMAA 3SVMA 3J81L 4UP8A 4PV1C 1HR0L 3R2IA 3G71A 1WTXA 1FNVA 3K58A 5IGCA 3Q6SA 2Z6BA 3I4LA 3S9WA 3GP7A 3C3LA 1I6HB 4DUZQ 1SYEA 4KV6A 4H44C 1W6JA 1TR5A 4ODGA 1EEID 1VS0A 1VQKA 1Q1BA 3HEJA 1K0RA 4DU9A 3SGIA 2F0SA 2KJXA 3Q24A 2WAQE 1Q1EA 2F03A 2EXZA 3PO2H 1YJ9A 3U50C 3U58A 2ATWA 5EKLA 3OW2A 5CBEE 2RSOA 3VYSA 1LUZA 2Q8TA 4AH6A 5IIFA 3BVMA 4FXDA 2VZAA 3S1QB 4AYBB 5ELBA 3I4MB 2C35B 2IPKD 1EIHA 3O13A 2Q2TA
chains in the Genus database with same CATH topology
4CJ0B 5EKIA 3T51B 1OXTA 1E0BA 1I4GA 4QF4A 3QOLA 5E4WC 1F9SA 5M3FB 3BVGA 3MC0B 2B2YA 1LTRD 3KK7A 1E2ZA 1SNCA 1EFID 3L7ZC 5CYUA 1WTPA 1XTCD 5FO9B 4A3EB 4E6IA 4HMIA 4C3IB 2IX0A 2K28A 4DF7A 3R2TA 3UI2A 1CA5A 5KRUA 4TQUS 1I4HA 1KDBA 2EVBA 4HMJA 2EYOA 5AFWA 4BA1I 2C5CA 3CRKC 1EU4A 4ZKBB 2EY5A 1EWCA 3HOVB 5JEAJ 1CI3M 2EJMA 3SDZA 1OO9B 2MHVA 3BDCA 3GO5A 2A68D 3CKIB 1RHPA 2ID0A 4XDXA 3DEPA 2K7VA 4QCLA 2HDMA 3M7NA 2EDGA 2F0FA 3V05A 1WD1A 1IL8A 1SE3A 3CU7A 1HA6A 3QWNA 2RQXA 1JB3A 3NWSA 4C3HB 1KNAA 3NXWA 4IALA 3FRPB 4CHTB 4UAIA 5BN3A 2F0PA 3QG1A 2F0UA 4BY7B 2RVLA 5EQ0A 1WTRA 1TU2B 2R6GA 5T1GA 4XXEA 5C0XH 2XIWA 1B50A 3HOUB 1PYWD 5KIXA 3OWFA 5C4HA 5CV4A 5EPLA 3J81E 1CK1A 2EY6A 5I2XA 3EFXD 3GTGB 1IW7D 2F0QA 1PTOF 1MSHA 5DM73 3E0JA 1E2VA 5M5YB 5C4XB 3HRZC 4WRDA 1GJXA 3NHHA 1H9SB 2YU9B 3H09A 5K5PA 3SK6A 3T53B 5BN4A 5C44B 1LTAD 5E1FA 2EE1A 2WKDA 2EYLA 1H9SA 1SYDA 1J9OA 2LY7A 2BA0A 4FXKC 5A2QL 1JWMD 1DOMA 3F2UA 4KMUC 4FF2A 2SNMA 1JE4A 3A8IE 1MSGA 1KAAA 1D5MC 3BZDB 4HN7A 5JPNC 4XQQA 3OOCA 1LABA 3KBXA 2F0NA 5COYA 1S5CD 2Z8LA 2F0MA 1HHVA 1NR4A 2OF1A 3BDOA 2O2LD 2A68C 2E76C 2K04A 3EROA 4K5WA 1O78A 5CV6A 4A3MB 2FFKB 2K33A 1F9QA 2CW0D 1LLRD 3PUZA 1W6KA 4A3JB 2CQAA 2VB2X 2O5JC 2GA4B 4HSPA 4U673 1SEBD 2BOSA 3IKJA 4DN4M 3WOFA 1UNSA 1Y1VB 3I90A 5FO7B 1UUPA 4OL7A 3VR5A 3D4RA 2HCCA 1CHQD 3T13A 1F2YA 3SE0A 1WCMB 3G6JB 2VUMB 4U68A 1I3QB 1SYCA 2FINB 5IGDA 5KEEA 4IUTA 5EKKA 1JOQA 4H0LC 2D9UA 4I7ZC 1BCPF 3URYA 4K14A 3L3OC 2H4OA 3D4DA 2IWHA 5KYLA 4G7OC 2HUGA 4C3JB 2Z1CA 4KKSA 1LT6D 3MFYA 2Q8IB 1NCVA 2L12A 5CC4A 4KN7C 3A8KE 1MI2A 1Y1WB 3H6MA 2RDHA 1LTGD 5EJWA 3HOXB 5FLXL 3GTMB 1IW7C 1AP0A 1G8ZD 1H9KA 1CA6A 2E2IB 1BQQT 1EIGA 2IW3A 1R4PB 1CHPD 4JBWA 1OXXK 3PUYA 1T5EA 2KUMA 1O80A 2EJFC 5A35A 1BCPB 5M3MB 5M5XB 5IOCA 2VNUD 3A7LA 4KJNA 1QB5D 4IFDH 1D6EC 3NUCA 2VXWA 1HFNA 2ZXRA 1IHZA 5CR3A 1JCKB 1EOTA 4XQNA 4LJZC 3TP5A 3BS1A 3KF8A 5A2QE 1X3QA 1PTOH 5NUCA 5JVH3 2F0EA 3RZDB 1C48A 5D3IB 1DM0B 3OMCA 5FK9C 3VR3A 2NN6H 3J7AV 2KCNA 1NAPA 1A6XA 3A7AB 2FHTA 2OEOA 5ELEA 4CBVA 1V8QA 4WFN3 1EYAA 4G57A 4KHZA 2L1BA 1ENFA 4FNFA 4K6LA 5I2YA 4BA2I 4RH6A 2A73B 1IKLA 1SMYD 1WTVA 1RTNA 2CW0C 1STBA 4RHSA 2R93B 4PMWA 2K6AA 1FR3A 2SNSA 1AFPA 4ZYSA 4NW2A 1H9JA 3M4YA 5EPJA 5LL6X 3WOEA 4OO1G 2QILA 2EYJA 4ILWA 2F0WA 2XVSA 2V4DA 3T56B 5I6YA 4L6TB 4KTAA 1LTID 3OIQA 1Z47A 5CORA 1CQFA 2AWNA 3MXGA 4DXGA 3EA6A 3VYTA 1V43A 4XYOA 1STNA 1DZ1A 5KNCA 3NQTA 4B9WA 1RODA 2F1MA 2DY7A 1XWEA 2RA4A 1B53A 2AQ2B 4RKLA 3RD4A 1SE4A 5EBCA 3H94A 3X3MA 2I46A 4IZ8A 1QNKA 1VDZA 4IUQA 1SNQA 2KVMA 1K8OA 4KHVA 1XYIA 4IUPA 1HTPA 1F9PA 1I4XA 2XRQD 5G3LF 4EQPA 3BYTB 4NKLA 4ULLA 3TP7A 4RAUC 2L11A 3PUWA 1VMPA 1BO0A 2JEAI 1E2WA 4DAVA 5JVG3 4XIGS 1S5DD 3M4OB 5M5WB 2F0VA 2RKSA 3PUXA 5FLXE 4I65A 2WACA 4NMZA 1JR0D 4BS9A 1CFMA 4N9TA 5JJZA 1WVLA 1ML0D 1ENAA 1OXSC 1STGA 5ELFA 2F0JA 1EY0A 2WV6D 3ITPA 4KY6A 4L63B 1Y8NB 4A93B 2L55A 1R4QB 2PW7A 1H9RA 3K5LA 1CTMA 1AZPA 3VR4A 3MXNA 2X69A 3ONAB 3DWPA 4RCOA 1EY7A 3S14B 3NQIA 1XXGA 1WD0A 2PCFB 2PQEA 3DHQA 4KI0A 1JWSD 2B2VA 4RGOS 4C56C 3J7YW 2BCOA 3DUZA 1VCIA 1EY5A 1S5ED 2XNAC 1B1ZA 3HOZB 3IAYA 1CQVA 3K5OA 1L0YB 2CVRA 1B3AA 3CRLC 2C9OA 5ELCA 3M85A 5JEAG 1PRTD 2A6HD 2J7ZA 2JA7B 1QJOA 3TZUA 5JAVA 2IJ0A 1WTQA 1SMYC 3A54A 1Z6HA 2IL8A 2HCIA 4CJ1B 3PO3B 5IODA 1STHA 4RA8A 1BF4A 1SJHD 3HS0C 2RSNA 4KKUA 1LTTD 2NUCA 1HQRD 2R61A 4WJWA 1OXUA 4DAYA 4DK0A 1B4OA 4R9WA 2XWJB 3SK8A 3C1FA 2QEJC 1AEXA 1LACA 1KDCA 4X3UA 3AB9A 5C0XJ 5KNBA 4M8AA 1I4RA 3EJIA 2ENBA 1RCVD 1H9MA 1BXTA 1I50B 4R8NA 4XTCS 4XT1B 2B8FA 1R9TB 3MWYW 5J39A 1UAPA 2X6GA 4IUUA 3MFGA 4C2MB 1ILPA 3NSWA 5ELDA 3PIO3 4GZYC 1LT5D 2PPBC 1B9NA 3MXUA 3Q23A 1AN8A 1TIID 5CGKA 5C5LA 3J80L 3FDTA 1PFNA 3NP8A 3PMFA 2TMPA 2NVTB 3GTOB 2X6LA 2B63B 3VA7A 4IQZA 2Z4IA 3P1HA 1KLGD 2JA5B 4HEDA 4K8JA 3J7AF 2OT2A 4XT3B 1D1IA 3QJYA 4PMBA 1U4RA 2PZUA 3V2TA 5D65A 4DGZA 2TSSA 1GHJA 2WP8J 1SSOA 2DNEA 1GUWA 1NR2A 3MZ5A 3HG9A 2K5DA 5LHY1 1BBXC 2KA7A 1HXYD 1Q8IA 2AUKA 2HQEA 2WAQB 2NVXB 1ENCA 5KNDA 1SFOB 2LFNA 5JOBA 3D31A 4XQJA 3R3OA 4Q5VA 4ZKCB 2F0LA 1TY0A 4FYDA 2Q8RE 1Y8PB 5K36G 1SNPA 1C4QA 3A55A 2K32A 3TMEA 1HUNA 4FF1A 4A3BB 4KD4A 1O7ZA 1PRTC 3I4NB 1NSNS 2A6HC 4Q0FA 1ZXTA 3FEWX 3ERQA 4K5VA 4ZAIA 4FF4A 5I4DA 1RKNA 2HDLA 2ZT9C 2E2DC 3MAQA 1SJED 1WTOA 2ZXOA 1TY2A 1EWHA 1DOLA 4BWGB 2AQ1B 3ND9A 4QMGA 4CGYB 3PV0A 1HA5A 2F0KA 1JORA 5E4XA 2PO4A 3DWQA 5IGEA 3MEHA 1B2TA 2A5HA 5D14A 2D5DA 5LL6S 5T1IA 1U4PA 2AQ3B 3RMHA 1FD7D 3KUPA 4O1NA 4RHRA 2WB1B 4S3SA 4RGTA 3S1MB 1TVXA 4QUFA 5KGUA 3S2DB 1F9RA 2JP1A 5I9OA 5J1ZA 3N6RA 1LV9A 4RGMA 3SK5A 2F4IA 4KKTA 3GV6A 1VF5C 3A8JE 1PZID 2WIIB 3T16A 1STYA 1MGSA 2O4XA 2KQ3A 1ILQA 2R7ZB 2E2HB 3TP8A 1QE6A 1GUSA 1Q90A 5C3EB 2KEDA 3NE5B 2E2JB 4RFBA 5EGTA 4IFDJ 4IFDG 1PFMA 3IFTA 1QCBD 2KHSA 3R93A 1G2TA 4DNRB 2DNCA 1M8AA 1STEA 2K03A 1TWAB 3K5NA 3BDLA 2KEEA 5JPMC 2B39A 4H7BA 1HQMC 4ME5A 3FMCA 1YNJC 3GD7A 1UEAB 1TS2A 3PO2B 1FGBD 3A56A 1M4VA 5FO8B 1GUOA 3PIP3 1A3UA 4KY5A 2F0OA 4CKEA 3HGBA 3C46A 4K6DA 2G9HD 2M00A 2EY1A 1BOSA 3MXPA 4F8MA 3NBHA 4MN3A 1YNND 1KTKA 1T5XD 5HURA 1A3VA 1QNUA 3U9SA 4V190 4ZQ3A 4G7HC 1AZQA 1DD2A 2JA6B 1NUCA 2Z4HA 3OSOA 2PNRC 1HUMA 1S5FD 3H0GB 2MUYA 2WINB 2B2UC 2R92B 4RCNA 2F0DA 4J8QA 4QUCA 2M2LA 3T4AC 3NWTA 4XYQA 1KLUD 1Q3LA 4ABNA 2XRSD 1MD2D 3G7LA 4EVOA 4OO1I 5DAUA 2SOBA 1V1PB 1GUNA 2F0GA 5IGBA 3OW7A 3D6WA 4J6HA 4F88A 3S2HB 4O42A 3VR6A 1V1PA 4IUVA 1B9MA 1TS4A 1RDPD 3DMUA 3QOJA 4ID6A 3VR2A 1II3A 3TBIB 1TWGB 4FO2A 3HOWB 2L9HA 2YYZA 2M9VA 2XWBB 2SEBD 2ICIA 4FVMA 2QF7A 2E74C 2D62A 1BR9A 1S5BD 3VYUA 3L9AX 1TWCB 1J8IA 1DYQA 3I3CA 1Q12A 1D5ZC 3M3YB 1ET6A 1EY8A 4N9PA 2FMMA 1PTOD 1RJTA 2F3WA 1TKWB 1IYVA 3OPOA 2QCPX 4IN3A 3D3RA 2EPBA 1G91A 4C1NK 1CZGA 2L0CA 3C1EA 3MVVA 1F77A 1A2UA 3Q22A 5IGGA 5J22A 5KYIA 1SE2A 4L8JA 3LWEA 3S1RB 1DOKA 4UDUC 1RF2D 1MBYA 2JYOA 3HKZB 1SBBB 2BA1A 4B08A 4J1MA 3JAML 2B2UA 2B2TC 1Y69U 1ESRA 2MP1A 3D4WA 1GOZA 2IT1A 3TN2A 3K0YA 1LO5D 3I91A 5IT9L 3MA2B 4A3IB 4TSSA 4FP5D 1D5XC 3I70A 2NYZD 4MIUA 2L4NA 3GV3A 3E6ZX 3WDNA 2NVYB 3MHBA 2QKIC 3H3VC 3LX0A 4IUNA 1KABA 2PW5A 3HOYB 1YNNC 1X3PA 1QWYA 3DXJC 1TQOA 4ZK9B 2BDOA 4MHEA 1FNUA 3IL8A 1GHKA 2IX1A 3HP3A 1RTOA 5C3WA 3EQLC 2MGSA 1GXDC 2AUJD 1STAA 3NTHA 1JICA 2EYFA 1HTLD 2WKCA 3MTSA 1Z7TA 4A3FB 4DNTB 1EY6A 1A15A 3KLSA 5M9OA 4A3DB 1EZ8A 1GUTA 3C2PA 2NTSA 5CV7A 4LK1C 4F87A 3KLRA 2EOTA 4G4KA 3Q0AA 1ESFA 2JEBI 1BCPD 1O7LA 4BBSB 1AW7A 3TZDA 5C0XI 2DY8A 5JEAH 3OHXC 3GTLB 2NWGA 2DN8A 3OIPA 5C0XG 1U9RA 4KD3A 1SXTA 4EQOA 1FYCA 5C6AA 2B2TA 2E75C 4Z9CB 1KNEA 3M7GA 3RUZA 4RKBA 4K8IA 3QIAA 1JWUD 1I4PA 1BDOA 1A3TA 1PTOC 1DJRD 4IURA 2I07B 4HAEA 4EGVA 1L0XB 1RD9D 1BUVT 2XN9C 4OIKA 4BY1B 1ET9A 1EY9A 3BYYB 4ZLTF 1DCZA 1GUGA 1CT1D 1JQYD 2KECA 4X3KA 3NBIA 4Y7NB 1TS5A 2VB3X 1SYFA 1S4ZA 1U4MA 1U4LA 3S15B 4KN4C 1EZ6A 1EYCA 2BE5D 3ZYYX 4X3SA 1ONLA 1ICWA 3V96A 2EYPA 5EPKA 1D1KA 4QIWB 3DWAA 3I8ZA 3AU7A 5FKAC 4C3IG 3N52A 3JAME 2ZXPA 1A2TA 1K83B 4DAPA 3GTJB 1YNJD 3TP6A 1PXUA 3QO2A 5DEHA 5IT9E 5BN5A 1ZYRD 2JA8B 1G6ZA 3HZXA 3S16B 1ZEQX 1LT3D 3RZOB 1PDQA 1D2BA 1G2SA 1X32A 4RGNA 4EQNA 3TDQA 1KDAA 2Y0SB 1DONA 1SNOA 2MPMA 2H1EA 1VMCA 4RWSC 2KCCA 1PZKD 3DEOA 4OIJA 4CJ2C 3VYRA 5C4ZA 1PMRA 1PTOB 1PFBA 4QB4A 1FNWA 3SHLA 2B8GA 3K57A 1SYBA 2LS01 3P75A 5DM63 2PZWA 1IKMA 1ZKOA 2NTTA 3K7AB 3OWEB 3RLFA 3I73A 5CV9A 2F0HA 2A6ED 2K1BA 3W2DA 2EY2A 4C3HG 5I9PA 3D8GA 4B9XA 3NPPA 5K36H 4HTHA 2A69D 1LTSD 5CMDA 3H91A 1BCPC 3TSSA 1JOOA 1F2LA 4A3KB 5C4JB 2XSCA 4LMQD 1PRTF 2EZVA 1EU3A 3CQZB 1CZWA 4NP5A 4ZRZA 2CHBD 2NB0A 5G3LD 5EBDA 3AMUA 4ZUJA 2FJ2A 1K8MA 3I72A 2IX3A 3KBGA 4HR7B 1QILA 3W3AA 1JOKA 1SDFA 3U9OA 4R8IA 4DA2A 4HSVA 3KLSX 1TWFB 4CKCA 2BDNA 1CM9A 2LKVA 3GQBA 2NZ1D 3QB3A 1HFGA 3ND8A 1EQTA 3VA5A 4IFDI 1G291 1EEFD 1F2ZA 1PRTB 3LNNA 3J80E 4K5XA 4K2LA 2NBFA 2D2CC 2BE5C 4F7XA 3NTIA 3SR1A 3K5MA 1VF7A 3DM1A 2K5WA 3SEBA 2K01A 1I4QA 5D3DA 4V0BA 2R3ZA 1DXMA 4PMCA 2B2WC 2PMZB 3FVQA 1EYDA 4K2KA 5CV5A 5C5MA 1HPCA 1QG7A 1TT2A 1EQVA 2NN6I 1ZYRC 3GTKB 2PYKA 4ZUIA 4WORA 2G9DA 1QOHA 1HRJA 2NN6G 1WTWA 5IGFA 4HCSA 2F0IA 2JXMB 2PZTA 2K5QA 3SXHA 2JE6I 4M1UB 2K05A 3NK9A 1JC7A 3P7JA 4HCEA 2RDFA 3PUVA 2J0TD 1I6VC 4KJOA 3K59A 1F2MA 5TSSA 4CKBA 1C8CA 2LMCB 2J4XA 2A74C 1HCZA 5E3FA 4DK1A 4BBRB 1B44D 4FF3A 5FOBB 1OXVA 2FMCA 2EYHA 3S17B 1O7YA 2F0TA 4NDXA 5CBAE 3EVQA 2EJGC 4A3GB 2O5IC 5CV8A 3OMGA 2RBMA 2RDGA 1LT4D 4KY7A 2A6EC 5F2DA 4P2CB 3FPPA 5I6WA 2N55A 1SYGA 2OXPA 2L5TA 4H13C 1LTBD 1SNMA 3IFDA 4LAAA 4C1NI 4PNYA 2EYMA 2MJ8A 3K6OA 4TKOB 5DNFA 2NVQB 4OGQC 4FXGC 3NTKA 2SDFA 1BNZA 2A69C 1Y8OB 2QDBA 2AWOA 2N88A 4TRDA 1IYUA 3FKIB 3LWUA 1TS3A 2B2YC 3GTQB 5ISRA 3S1NB 4DXFA 4DFAA 1TWHB 1EL0A 4C3JG 4KK7A 1PLFA 4JK1C 2B2VC 1EY4A 2B2WA 4PQXA 4G7ZC 3D6CA 3E5SA 3R8BA 1PZJD 1V1OA 2F3VA 5C3XA 5HGTA 4OO1H 3BVZA 3P20A 4YIJA 4OHJA 2KOLA 4X3TA 2ICEC 3CHBD 3SK4A 3BG3A 2JSOA 1SNDA 1XX8A 3X3NA 3GTPB 3FPUB 1SAPA 3SVMA 3J81L 4PV1C 3R2IA 1WTXA 1FNVA 3K58A 5IGCA 3Q6SA 3S9WA 3I4LA 3GP7A 3C3LA 1I6HB 1SYEA 4KV6A 4H44C 1W6JA 1TR5A 4ODGA 1EEID 1Q1BA 3HEJA 4DU9A 2F0SA 2KJXA 3Q24A 1Q1EA 2F03A 2EXZA 5EKLA 5CBEE 2RSOA 3VYSA 2Q8TA 5IIFA 3BVMA 4FXDA 3S1QB 4AYBB 5ELBA 3I4MB 2IPKD 1EIHA 3O13A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NXW A;  4IAL A;  2EY2 A;  2NUC A;  4I65 A;  4DFA A;  2WAC A;  5I9P A;  1EZ6 A;  1EYC A;  4NMZ A;  1EYD A;  4K2K A;  2F0P A;  3D8G A;  4B9X A;  5CV5 A;  1STA A;  4HTH A;  3QOL A;  4N9T A;  4QF4 A;  5CC4 A;  5C5M A;  5HUR A;  1A3V A;  3C1E A;  1TT2 A;  1EQV A;  3MVV A;  2F0U A;  3H6M A;  2PYK A;  4S3S A;  2EYF A;  4ZQ3 A;  1EY4 A;  2F0N A;  4ZUI A;  4WOR A;  1A2U A;  3D6C A;  1SNC A;  1JOO A;  1ENA A;  3SK8 A;  5IGF A;  2HQE A;  3E5S A;  1STB A;  1NUC A;  1STG A;  2EYP A;  2F0I A;  3C1F A;  2F0M A;  1EY6 A;  3OSO A;  5KGU A;  1AEX A;  5IGG A;  2F0J A;  1EY0 A;  1KDC A;  2PZT A;  2SNS A;  3MZ5 A;  1ENC A;  3SXH A;  2OF1 A;  4HMI A;  4E6I A;  5I9O A;  5M9O A;  5J22 A;  2F3V A;  3ITP A;  5J1Z A;  4KY6 A;  5JOB A;  4DF7 A;  5C3X A;  1EZ8 A;  5HGT A;  5KYI A;  5KIX A;  3NK9 A;  3R3O A;  5CV7 A;  3EJI A;  2F0D A;  4F8M A;  2F0L A;  3ERO A;  4K5W A;  2RDF A;  2ENB A;  3SK5 A;  2PW7 A;  4NP5 A;  1A2T A;  5KRU A;  5CV6 A;  2EYJ A;  2F0W A;  3OWF A;  4YIJ A;  1KDB A;  4HMJ A;  4KJO A;  5C4H A;  3TP6 A;  1F2M A;  3T16 A;  5I6Y A;  5CV4 A;  2EYO A;  4R8N A;  1SNP A;  1STY A;  2EY6 A;  4J1M A;  5DEH A;  4ZUJ A;  2O4X A;  2KQ3 A;  3T13 A;  4KTA A;  3HZX A;  1EY7 A;  3TME A;  5J39 A;  3SK4 A;  3TP5 A;  2F0Q A;  3TP8 A;  5IOC A;  1SND A;  3D4W A;  2PQE A;  3DHQ A;  2EY5 A;  4KJN A;  1JOK A;  4KD4 A;  1NSN S;  4EVO A;  5EGT A;  1U9R A;  4KD3 A;  1STN A;  5DAU A;  4WRD A;  5E3F A;  2SOB A;  4EQO A;  3ERQ A;  2F0G A;  3BDC A;  4K5V A;  3U9O A;  4EQN A;  5IGB A;  2KHS A;  5C6A A;  1KDA A;  3NHH A;  5KYL A;  3NQT A;  4J6H A;  4B9W A;  1RKN A;  1EY5 A;  5IGC A;  3S9W A;  2EYH A;  3RUZ A;  5K5P A;  3NUC A;  3SK6 A;  2F0T A;  1SNO A;  4NDX A;  4RKB A;  4K8I A;  5CR3 A;  1IHZ A;  4MIU A;  1SYE A;  3EVQ A;  4KV6 A;  4OL7 A;  5CGK A;  2LKV A;  5C5L A;  5E1F A;  1TR5 A;  4ODG A;  3MHB A;  1A3T A;  2EYL A;  3NP8 A;  3OMG A;  3BDL A;  3PMF A;  3QB3 A;  1F2Y A;  2RBM A;  3DMU A;  4RKL A;  5CV8 A;  4KY7 A;  5C4Z A;  3QOJ A;  4ID6 A;  1SYD A;  5NUC A;  1II3 A;  3HEJ A;  3LX0 A;  4IUN A;  4QB4 A;  5F2D A;  3VA5 A;  1KAB A;  4DU9 A;  2F0E A;  3SHL A;  5I6W A;  3P1H A;  1SYG A;  2OXP A;  2PW5 A;  4QMG A;  2F0S A;  4IZ8 A;  1F2Z A;  4H7B A;  2F0F A;  1SNQ A;  2F0K A;  1SNM A;  4K8J A;  4K5X A;  4K2L A;  4LAA A;  4ME5 A;  4PNY A;  1SYB A;  2EYM A;  4KHV A;  1JOR A;  3OMC A;  2EXZ A;  3P75 A;  5JAV A;  2PZW A;  4F7X A;  1TQO A;  5IGE A;  4PMB A;  1SYC A;  1EY9 A;  3MEH A;  4EQP A;  5IGD A;  5KEE A;  2QDB A;  4NKL A;  2PZU A;  3SR1 A;  1A3U A;  3TP7 A;  2SNM A;  5EKK A;  5EKL A;  3V2T A;  1JOQ A;  1EY8 A;  4KY5 A;  2F0O A;  4N9P A;  5IOD A;  2OEO A;  4DGZ A;  4TRD A;  5CV9 A;  2F0H A;  5IIF A;  4K6D A;  2F3W A;  1STH A;  1KAA A;  2M00 A;  2EY1 A;  4K14 A;  2F0V A;  2RKS A;  3D4D A;  1SYF A;  1EYA A;  5ISR A;  4PMC A;  4G57 A;  5C3W A;  3MXP A; 
#chains in the Genus database with same CATH topology
 4CJ0 B;  5EKI A;  3PIO A;  3T51 B;  1OXT A;  1E0B A;  2JJQ A;  3QR8 A;  4LFC L;  1I4G A;  4QF4 A;  3QOL A;  5E4W C;  3JAM i;  1F9S A;  1L0W A;  5M3F B;  2KBN A;  1KD1 C;  3BVG A;  3MC0 B;  2B2Y A;  1LTR D;  1N32 L;  3KK7 A;  3G4S A;  1J5E Q;  1E2Z A;  1SNC A;  1EFI D;  1FGU A;  3L7Z C;  2JA6 H;  5CYU A;  1WTP A;  1XTC D;  5FO9 B;  4A3E B;  2R93 G;  4E6I A;  4HMI A;  4C3I B;  2IX0 A;  3J81 j;  2K28 A;  4DF7 A;  1UE7 A;  4LF7 Q;  3R2T A;  4BBR H;  3UI2 A;  1CA5 A;  5KRU A;  1U5K A;  4TQU S;  1I4H A;  1KDB A;  2EVB A;  4HMJ A;  2EYO A;  5AFW A;  4JI2 L;  4A3G H;  4BA1 I;  3WWV A;  2JA9 A;  3CCJ A;  2C5C A;  3CRK C;  1HZC A;  1EU4 A;  4ZKB B;  2EY5 A;  1EWC A;  3HOV B;  3KF6 B;  5JEA J;  1CI3 M;  1HNX Q;  2EJM A;  3SDZ A;  1OO9 B;  2MHV A;  3BDC A;  4IPH A;  3GO5 A;  2A68 D;  1K3B C;  1JB7 A;  1IL2 A;  4HJA A;  1N36 L;  1A63 A;  3CKI B;  1RHP A;  3KF6 A;  2ID0 A;  4XDX A;  5J3B A;  3DEP A;  2K7V A;  2VY3 A;  3T1H L;  3S2H H;  2K52 A;  3FKI H;  4QCL A;  2WB1 E;  2CCZ A;  4JYA L;  2HDM A;  3F2C A;  3M7N A;  1TWG H;  3HOW H;  2EDG A;  3S1N H;  2F0F A;  4DR7 L;  5IT9 c;  1TWH H;  3V05 A;  1WD1 A;  5IYD G;  4O2D A;  1IL8 A;  2KCT A;  1SE3 A;  1E7Z A;  3CU7 A;  2YV5 A;  1HA6 A;  3RLO A;  3QWN A;  2RQX A;  1JB3 A;  3NWS A;  3A5U A;  1VQJ A;  2RCN A;  1XJV A;  3FHW A;  4C3H B;  1KNA A;  1H95 A;  1B8A A;  3NXW A;  4IAL A;  3FRP B;  4CHT B;  4UAI A;  2KEN A;  5BN3 A;  2F0P A;  4L5Q A;  3QG1 A;  3U4V A;  1JT8 A;  2F0U A;  4BY7 B;  2RVL A;  3H15 A;  5EQ0 A;  1WTR A;  1TU2 B;  4LFC Q;  2R6G A;  5T1G A;  4XXE A;  5C0X H;  3GTP H;  2XIW A;  1B50 A;  1A8V A;  3HOU B;  1N32 Q;  2OWO A;  1PYW D;  5IP9 G;  3K80 C;  5KIX A;  4CDE C;  3ULP A;  1VQM A;  3S1R H;  1UE6 A;  4DV0 Q;  4DR3 L;  4A93 G;  4LFB Q;  3I55 A;  4R4I A;  4LUZ A;  2F4V L;  3OWF A;  5C4H A;  1SR3 A;  4QY7 A;  5CV4 A;  1YBY A;  5EPL A;  3J81 E;  2JK8 A;  1CK1 A;  2EY6 A;  4JI0 L;  2DJG C;  5I2X A;  5M3F G;  3EFX D;  3GTG B;  1IW7 D;  2F0Q A;  5LMN W;  4QL5 A;  1MHW C;  1PTO F;  1MSH A;  5DM7 3;  3E0J A;  4JI2 Q;  1E2V A;  5M5Y B;  5C4X B;  4JI6 L;  2GVA A;  3HRZ C;  4WRD A;  4A3I H;  1X6O A;  4JW0 A;  1GJX A;  3CCQ A;  3NHH A;  1H9S B;  2YU9 B;  1HZA A;  3H09 A;  4X65 L;  5K5P A;  3EN2 A;  3SK6 A;  4DR4 L;  1VQ6 A;  3T53 B;  1A0I A;  5BN4 A;  4HJ7 A;  4DUY Q;  5C44 B;  1LTA D;  5E1F A;  2EE1 A;  2WKD A;  4J15 A;  2EYL A;  1XNR L;  3HOZ G;  1H9S A;  1SYD A;  1PH1 A;  1N36 Q;  1ASY A;  3I4M H;  1JJ2 A;  4A3C G;  3T1H Q;  1J9O A;  2LY7 A;  4DR2 L;  1MIU A;  2BA0 A;  4JYA Q;  4FXK C;  5A2Q L;  2JA7 G;  5AJ3 L;  4KHP L;  1JWM D;  1DOM A;  3F2U A;  4KMU C;  4P72 A;  4FF2 A;  2SNM A;  5IE8 A;  3OTO L;  1JE4 A;  2AKW B;  3A8I E;  1MSG A;  1KAA A;  2CWA A;  5FLM H;  1D5M C;  4C3I H;  3E3X A;  3RLN A;  3BZD B;  4HN7 A;  5JPN C;  5IP7 G;  2CH4 W;  4HIM A;  4XQQ A;  3OOC A;  4RMF A;  1LAB A;  1C7Y A;  1K8A C;  3KBX A;  2F0N A;  1YIJ A;  5COY A;  3J80 c;  1S5C D;  4HID A;  2Z8L A;  2F0M A;  1HHV A;  5JJI A;  3HOV H;  1NR4 A;  2OF1 A;  3BDO A;  2O2L D;  1JJG A;  4DV1 L;  4YWM A;  2A68 C;  2E76 C;  2K04 A;  3ERO A;  4K5W A;  1O78 A;  2UUA Q;  5CV6 A;  4JVZ A;  3PIP A;  3NEN A;  4A3M B;  2FFK B;  4JI8 Q;  2NZH A;  2BH8 A;  4DR3 Q;  2K33 A;  4YCU A;  1F9Q A;  4BY7 G;  3GDE A;  2CW0 D;  1LLR D;  3PUZ A;  4HIK A;  1W6K A;  4A3J B;  2CQA A;  2VB2 X;  1WFQ A;  2O5J C;  1IYJ B;  2GA4 B;  4YY3 L;  4JI0 Q;  1B7Y B;  4GNX C;  4YWK A;  4HSP A;  4U67 3;  1SEB D;  2BOS A;  2K5N A;  3IKJ A;  4DN4 M;  3WOF A;  1UNS A;  1X65 A;  1K3R A;  1Y1V B;  3I90 A;  4JI6 Q;  5FO7 B;  1UUP A;  4OL7 A;  3VR5 A;  3D4R A;  2HCC A;  1CHQ D;  1ASZ A;  3T13 A;  1F2Y A;  2GN5 A;  1WCM B;  3SE0 A;  4LFA L;  4X65 Q;  3G6J B;  2VUM B;  3H3V H;  4DR4 Q;  4JCV E;  4HJ8 A;  3K8A A;  2B63 G;  1IBK L;  4U68 A;  4OEM B;  2JN4 A;  4NXM L;  1I3Q B;  2JA5 G;  1SYC A;  2FIN B;  5IGD A;  5KEE A;  1FJG L;  3TEH B;  1KXL A;  4IUT A;  3S24 A;  5EKK A;  3HKZ E;  4H0L C;  2HIX A;  1VQ4 A;  1JOQ A;  2D9U A;  4I7Z C;  1BCP F;  5AJ3 Q;  3URY A;  4KHP Q;  1GVP A;  3L3O C;  2H4O A;  4K14 A;  1X9N A;  3D4D A;  2IWH A;  3RN2 A;  5IY0 A;  4OXP A;  5IWA L;  1CKN B;  5KYL A;  4G7O C;  4DPG A;  4DV4 L;  2HUG A;  3OTO Q;  4C3J B;  2Z1C A;  4KKS A;  1LT6 D;  3MFY A;  2CQO A;  2KHJ A;  2Q8I B;  1RIP A;  2QDL A;  1NCV A;  2L12 A;  5CC4 A;  3T1Y L;  3J7A 5;  1NY4 A;  3A8K E;  4KN7 C;  1MI2 A;  1Y1W B;  1CKN A;  2RDH A;  1LTG D;  3H6M A;  5EJW A;  3HOX B;  5FLX L;  2I0Q A;  3GTM B;  1IW7 C;  3GTG H;  1AP0 A;  1G8Z D;  4A3L H;  1NMF A;  1H9K A;  1CA6 A;  2E2I B;  3M4Q A;  2WAQ G;  1VQP A;  1VQ7 A;  2DUD A;  5M5Y H;  3JC6 6;  1BQQ T;  4N8F A;  1EIG A;  1SRO A;  2IW3 A;  1R4P B;  1CHP D;  4JI1 Q;  3OYY A;  4JBW A;  1OXX K;  3PUY A;  2YU9 H;  2V1C C;  2Z9H A;  3GTJ H;  1T5E A;  4GLV B;  2KUM A;  5C44 H;  1EWI A;  1NMG A;  1O80 A;  2EJF C;  3D0F A;  1BCP B;  5A35 A;  1WTH A;  5M3M B;  5M5X B;  5IOC A;  2VNU D;  3A7L A;  1N8R C;  4KJN A;  1NJI C;  1QB5 D;  4IFD H;  4A3B G;  3I4N G;  4GNX B;  1D6E C;  5DLQ E;  3KF8 B;  2K75 A;  3NUC A;  2VXW A;  1QVF A;  1HFN A;  2ZXR A;  1IHZ A;  5CR3 A;  1JCK B;  1Q7Y C;  2ZTE A;  1EOT A;  1S72 A;  3PF4 A;  4XQN A;  4GNX A;  2PI2 E;  4LJZ C;  3TP5 A;  3BS1 A;  1QZH A;  1XPO A;  3KF8 A;  1BBW A;  5A2Q E;  1X3Q A;  1PTO H;  5NUC A;  4I7A A;  5JVH 3;  2F0E A;  3RZD B;  1C48 A;  5D3I B;  1DM0 B;  4LFA Q;  1VQC A;  3OMC A;  1LYL A;  2E5L Q;  2EXD A;  5FJ8 G;  5FK9 C;  1IBK Q;  3VR3 A;  2NN6 H;  3J7A V;  1Y1V G;  1NAP A;  2KCN A;  3A7A B;  1KIX A;  2FHT A;  4B3R L;  3K7A H;  1A6X A;  4NXM Q;  2OEO A;  1DGS A;  4UHV A;  5ELE A;  4CBV A;  1V8Q A;  4WFN 3;  1PH5 A;  1FJG Q;  2UUB Q;  4O0A A;  1EYA A;  4G57 A;  3TRZ A;  4KHZ A;  2L1B A;  3KYH C;  1Y14 B;  1ENF A;  4FNF A;  4K6L A;  4R1J A;  5I2Y A;  3AYH B;  2Q2H A;  5EAY A;  4GN4 B;  4BA2 I;  4A3M H;  4RH6 A;  2A73 B;  1IKL A;  1SMY D;  4DV4 Q;  1WTV A;  4JG2 A;  3CCV A;  4GOP B;  1RTN A;  4JI7 L;  1HNZ L;  2CW0 C;  1STB A;  4RHS A;  2R93 B;  4PMW A;  4A3J H;  2K6A A;  3T1Y Q;  1FR3 A;  2SNS A;  1AFP A;  4ZYS A;  4NW2 A;  1H9J A;  5IYB G;  3M4Y A;  5EPJ A;  5LL6 X;  4GOP A;  3WOE A;  5BR8 L;  2QIL A;  4OO1 G;  3CQZ H;  1HNW L;  4WJ3 M;  4LF8 L;  2EYJ A;  4ILW A;  2F0W A;  2XVS A;  1P8L A;  2V4D A;  1BKB A;  3T56 B;  5I6Y A;  4QJF A;  4L6T B;  3G6E A;  4KTA A;  3F2D A;  1LTI D;  3OIQ A;  1AE3 A;  1Z47 A;  5COR A;  1WCM H;  1CQF A;  2R7Z G;  2AWN A;  1EIF A;  3MXG A;  4DXG A;  2CH4 A;  2QGQ A;  3EA6 A;  4K0K Q;  3VYT A;  2HHH L;  1V43 A;  2A1A A;  4XYO A;  5C3E G;  1STN A;  1DZ1 A;  2AMC B;  1I3Q H;  5KNC A;  3NQT A;  4B9W A;  1ROD A;  2N3S A;  1YHB A;  2F1M A;  1I94 L;  2IY5 B;  1TWF H;  5GAH C;  2DY7 A;  3PF5 A;  3DLL A;  1XWE A;  1UEB A;  2RA4 A;  1B53 A;  2AQ2 B;  4JBK A;  4RKL A;  4NB3 A;  2EIF A;  3KJP A;  3RD4 A;  1SE4 A;  4CDF C;  1JJC B;  5EBC A;  2I5H A;  3H94 A;  3X3M A;  3KOJ A;  2I46 A;  4IZ8 A;  1QNK A;  1Q46 A;  1VDZ A;  4IUQ A;  4QIW E;  1SNQ A;  4C3J H;  2KVM A;  1VQ8 A;  1K8O A;  1PVO A;  4KHV A;  1XYI A;  3E0E A;  4IUP A;  4OWX B;  3RNU A;  1HTP A;  1F9P A;  3PO2 G;  1Y1W H;  1I4X A;  2XRQ D;  5G3L F;  4EQP A;  3BYT B;  1YZ6 A;  4NKL A;  3HOX H;  4ULL A;  3GTM H;  3TP7 A;  4RAU C;  2L11 A;  3PUW A;  1VMP A;  1BO0 A;  2A8V A;  2JEA I;  1E2W A;  4DAV A;  5JVG 3;  4XIG S;  1S5D D;  2BH2 A;  2E2I H;  3M4O B;  1SLJ A;  5M5W B;  2F0V A;  2RKS A;  3CCU A;  1N34 Q;  3PUX A;  5FLX E;  4B3R Q;  4I65 A;  2WAC A;  4NMZ A;  5LMU L;  1JR0 D;  4P74 A;  1L2F A;  2A19 A;  4BS9 A;  4IO9 A;  1CFM A;  4N9T A;  2I5M X;  5H1S E;  2K50 A;  3GTK H;  5JJZ A;  2Y0S E;  1WVL A;  1ML0 D;  1ENA A;  4L5S A;  1OXS C;  1STG A;  2JA6 G;  2CKZ B;  3J81 i;  2IHE A;  5ELF A;  2F0J A;  1EY0 A;  2WV6 D;  2UXB Q;  3MXN B;  3ITP A;  4KY6 A;  3H0G G;  4L63 B;  1Y8N B;  4JI7 Q;  1HNZ Q;  4A93 B;  2L55 A;  4MTN A;  1R4Q B;  3UDF A;  2R92 G;  2PW7 A;  1H9R A;  3CC2 A;  3K5L A;  4LWC A;  4P73 A;  1CTM A;  2ZJR A;  1AZP A;  3VR4 A;  3MXN A;  1MJC A;  2X69 A;  1G6P A;  1GKH A;  3ONA B;  5BR8 Q;  3DWP A;  1HNW Q;  4RCO A;  1EY7 A;  3S14 B;  3NQI A;  1EIY B;  4DV0 L;  4LF8 Q;  1XXG A;  3BZC A;  4DKA C;  1WD0 A;  2PCF B;  2DGY A;  2PQE A;  3DHQ A;  4LFB L;  4KI0 A;  3ERS X;  1JWS D;  4B3S L;  2B2V A;  1VQN A;  1WJJ A;  4RGO S;  4C56 C;  3J7Y W;  2BCO A;  3DUZ A;  1VCI A;  1EY5 A;  1S5E D;  2XNA C;  1B1Z A;  2HHH Q;  3S17 H;  3HOZ B;  4POF A;  1EYG A;  3IAY A;  1CQV A;  3E9H A;  3K5O A;  1L0Y B;  2CVR A;  1XPR A;  1I94 Q;  1B3A A;  3CRL C;  2C9O A;  5ELC A;  3M85 A;  5JEA G;  1PRT D;  2A6H D;  3HOW G;  2J7Z A;  4DUY L;  2JA7 B;  1QJO A;  3TZU A;  5L37 A;  1IZ6 A;  5JAV A;  2NVQ H;  2IJ0 A;  1WTQ A;  1OTC A;  1SMY C;  3A54 A;  1Z6H A;  2IL8 A;  2HCI A;  1CSQ A;  4CJ1 B;  3PO3 B;  5IOD A;  1CSP A;  3JAM c;  5JJL A;  1STH A;  4RA8 A;  1BF4 A;  1X55 A;  1SJH D;  2Z6K C;  3HS0 C;  2RSN A;  3GTQ H;  1X3G A;  4KKU A;  1LTT D;  1U0L A;  2NUC A;  2RCF A;  4L5R C;  3CCL A;  1NBW A;  1HQR D;  2R61 A;  4WJW A;  1OXU A;  1J6Q A;  4DAY A;  4DK0 A;  1B4O A;  5LMU Q;  4R9W A;  1L1O C;  1K73 C;  2XWJ B;  3SK8 A;  2MO1 A;  3C1F A;  2QEJ C;  1AEX A;  1FVI A;  1LAC A;  3L0O A;  1KDC A;  1VQ9 A;  4X3U A;  3AB9 A;  5C0X J;  5KNB A;  4M8A A;  1I4R A;  3EJI A;  3STB C;  4APV A;  1YNX A;  2ENB A;  5LMN Q;  1RCV D;  4JBJ A;  1H9M A;  3HKZ G;  3CPW A;  1BXT A;  1I50 B;  4R8N A;  4XTC S;  4XT1 B;  2B8F A;  1R9T B;  3MWY W;  4B3T L;  1VQD A;  5J39 A;  1UAP A;  2X6G A;  2UUA L;  4IUU A;  3MFG A;  1HR0 W;  4C2M B;  1ILP A;  3NSW A;  4JI8 L;  5ELD A;  4A3I G;  3PIO 3;  1SMX A;  1LT5 D;  2PPB C;  4GZY C;  1B9N A;  3MXU A;  3Q23 A;  1I6H H;  2PMZ E;  1N9W A;  4B3S Q;  1AN8 A;  1TII D;  5CGK A;  4KLK A;  5C5L A;  3J80 L;  3FDT A;  1PFN A;  3NP8 A;  3PMF A;  2TMP A;  2NVT B;  3GTO B;  2X6L A;  2B63 B;  4RG1 A;  3VA7 A;  5M5W H;  4IQZ A;  3CCS A;  1PHJ A;  2Z4I A;  3P1H A;  1KLG D;  1XMQ Q;  2JA5 B;  4HED A;  4K8J A;  3J7A F;  4BXX G;  2OT2 A;  3HOY G;  2B3G A;  1VQA A;  4XT3 B;  1CKM A;  1D1I A;  3W1B A;  2G5D A;  3QJY A;  4PMB A;  1SE8 A;  1U4R A;  2PZU A;  1T9H A;  3V2T A;  1EQQ A;  5D65 A;  1HZB A;  4DGZ A;  2TSS A;  1GHJ A;  2WP8 J;  1SSO A;  2DNE A;  5IP9 H;  3S1Q H;  1GUW A;  4R4T A;  2Q2I A;  1NR2 A;  3MZ5 A;  3HG9 A;  3E9I A;  2K5D A;  1KHI A;  2OQK A;  4X6A H;  2K5V A;  5LHY 1;  2OCE A;  1E22 A;  3RR5 A;  1GM5 A;  1BBX C;  2KA7 A;  4IPD A;  1HXY D;  1Q8I A;  2AUK A;  3CAM A;  1MKH A;  5M3F H;  2D0O A;  2CWP A;  2MO0 A;  3S14 H;  1L1O B;  2HQE A;  3LGJ A;  2WAQ B;  5GAD C;  3PO3 G;  4A3F G;  2NVX B;  1ENC A;  4A3E H;  5KND A;  1SFO B;  1W2B A;  2LFN A;  5JOB A;  3D31 A;  4A3D G;  4XQJ A;  3R3O A;  4Q5V A;  4ZKC B;  3I4O A;  2F0L A;  1L1O A;  1TY0 A;  4FYD A;  1PV4 A;  2Q8R E;  2JQO A;  1Y8P B;  2VQF Q;  5K36 G;  1SNP A;  1C4Q A;  1S3O A;  3A55 A;  1PYB A;  3HOZ H;  2K32 A;  3TME A;  4LF4 Q;  1HUN A;  4JI1 L;  4FF1 A;  2VL6 A;  1D8L A;  4A3C H;  1PH6 A;  4A3B B;  4BBS G;  4KD4 A;  1O7Z A;  1PRT C;  3I4N B;  1NSN S;  4PZ6 A;  2A6H C;  4Q0F A;  1ZXT A;  3RN5 A;  4GKJ Q;  1V9P A;  2NZO A;  3FEW X;  2UXD L;  4B3T Q;  3ERQ A;  3F8T A;  2JA7 H;  4K5V A;  1X3E A;  4ZAI A;  4FF4 A;  1RKN A;  1YEZ A;  2HDL A;  5I4D A;  2ZT9 C;  2E2D C;  2FXQ A;  1EOV A;  3MAQ A;  1SJE D;  5IYC G;  1WTO A;  3A5Z B;  2ZXO A;  1TY2 A;  3PQI A;  1EWH A;  1DOL A;  4IOA A;  4BWG B;  1HZ9 A;  2AQ1 B;  3PSI A;  3ND9 A;  4QMG A;  5HY6 A;  4CGY B;  3PV0 A;  1HA5 A;  2F0K A;  3HFZ B;  3F1Z A;  1JOR A;  5E4X A;  5ELO A;  2PO4 A;  3DWQ A;  5IGE A;  3MEH A;  1B2T A;  2A5H A;  5D14 A;  2D5D A;  4BY1 G;  5LL6 S;  5T1I A;  1U4P A;  2E5L L;  1E1T A;  4AIM A;  2AQ3 B;  4C3H H;  3RMH A;  2N78 A;  1B3Q A;  1C9O A;  1FD7 D;  3KUP A;  4O1N A;  1PH2 A;  4RHR A;  4X62 L;  2WB1 B;  4S3S A;  1NNX A;  1PH3 A;  2ZM6 L;  1R9T H;  4RGT A;  2UUB L;  4BY7 H;  3S1M B;  1TVX A;  1IBM L;  4QUF A;  5KGU A;  3S2D B;  4OEL B;  1F9R A;  2JP1 A;  5I9O A;  5J1Z A;  3HOU H;  1M90 C;  4HIO A;  3N6R A;  3ER0 A;  1LV9 A;  4RGM A;  3SK5 A;  3M4P A;  2F4I A;  4KKT A;  3GV6 A;  1VF5 C;  3A8J E;  1PZI D;  2WII B;  3T16 A;  1QZG A;  1STY A;  1MGS A;  4DR5 Q;  2O4X A;  2KQ3 A;  1ILQ A;  2R7Z B;  5E7N A;  2JA8 G;  2NVT H;  2E2H B;  3GTO H;  3TP8 A;  2B63 H;  4UY8 C;  1GUS A;  1QE6 A;  3NEL A;  4CDC C;  1Q90 A;  5C3E B;  2K14 A;  2KED A;  3NE5 B;  2E2J B;  4RFB A;  5EGT A;  4IFD J;  5C4X H;  1KRS A;  4IFD G;  1KRT A;  4DV2 L;  2JA5 H;  1PFM A;  3ULJ A;  3IFT A;  1QCB D;  2KHS A;  3R93 A;  4AYB E;  1G2T A;  2ZJQ A;  4DNR B;  2DNC A;  1M8A A;  2Y0S G;  4JV5 L;  1XNQ Q;  1STE A;  3TRE A;  2OQ0 A;  4K0K L;  2K03 A;  2UXD Q;  2HIV A;  1CUK A;  1YVC A;  1TWA B;  3K5N A;  3BDL A;  1Q8K A;  3L2P A;  2KEE A;  5JPM C;  2B39 A;  4UP7 A;  4H7B A;  4GKK Q;  4DK6 C;  2KHI A;  1HQM C;  4ME5 A;  3FMC A;  1YNJ C;  3GD7 A;  4P75 A;  1UEA B;  1TS2 A;  3PO2 B;  2QA4 A;  1FGB D;  3A56 A;  1M4V A;  5FO8 B;  1GUO A;  2VQE L;  3CC7 A;  3PIP 3;  4UP9 A;  4IJH A;  3NBH B;  1A3U A;  2D0P A;  3AFQ A;  4KY5 A;  1W3S A;  2F0O A;  3HGB A;  4CKE A;  4LF5 Q;  3C46 A;  2H5X A;  4QGU A;  4K6D A;  2G9H D;  1VQG A;  2M00 A;  2NVX H;  2ES2 A;  2EY1 A;  1BOS A;  1IBL L;  1SRU A;  1UWV A;  1YJN A;  1SFO H;  1YHA A;  1Q81 C;  3MXP A;  3NEM A;  4F8M A;  3NBH A;  4MN3 A;  1YNN D;  4JI4 Q;  2MNA A;  1KTK A;  1SN8 A;  4DV6 Q;  1T5X D;  5HUR A;  1A3V A;  1QNU A;  3K81 C;  1X3F A;  3U9S A;  4V19 0;  4ZQ3 A;  4G7H C;  1N34 L;  1AZQ A;  1DD2 A;  2JA6 B;  2PQA B;  1NUC A;  2Z4H A;  3OSO A;  2PNR C;  4A3B H;  1ICF B;  4X62 Q;  1HUM A;  1S5F D;  3H0G B;  4DK3 C;  4A3K G;  2MUY A;  4ZCK A;  2WIN B;  1UE5 A;  2ZM6 Q;  3A0J A;  2B2U C;  2R92 B;  4RCN A;  4X64 Q;  2F0D A;  2AHO B;  1IBM Q;  2PQA A;  1QVC A;  4J8Q A;  1KAW A;  4QUC A;  2M2L A;  3T4A C;  3NWT A;  4XYQ A;  1KLU D;  2UXB L;  2WB1 G;  1NE3 A;  5FLX c;  1Q3L A;  4IOC A;  4ABN A;  1EQR A;  2XRS D;  1MD2 D;  1K28 A;  1GD7 A;  3G7L A;  4JI3 L;  4EVO A;  4OO1 I;  5DAU A;  3ICE A;  4LF6 Q;  2SOB A;  4LUO A;  1V1P B;  1GUN A;  2F0G A;  5IGB A;  3U4Z A;  3OW7 A;  2KCM A;  3D6W A;  5FJ8 H;  4J6H A;  4F88 A;  4YCV A;  1Y1V H;  3BU2 A;  1KQS A;  4UPA A;  4DV2 Q;  3S2H B;  4O42 A;  3VR6 A;  1E3P A;  1V1P A;  2WFW A;  4IUV A;  1B9M A;  2F52 A;  1TS4 A;  1RDP D;  2L15 A;  3DMU A;  3QOJ A;  4ID6 A;  3VR2 A;  1II3 A;  4JV5 Q;  2VUM H;  3TBI B;  1TWG B;  4FO2 A;  3HOW B;  2L9H A;  4NPS A;  4YCW A;  2YYZ A;  2M9V A;  2XWB B;  1VQF A;  1VQH A;  2SEB D;  2ICI A;  4FVM A;  2QF7 A;  2E74 C;  2I5L X;  3STB D;  1QUQ B;  2D62 A;  1BR9 A;  1S5B D;  3VYU A;  3L9A X;  1TWC B;  1J8I A;  1DYQ A;  3I3C A;  1WI5 A;  1Q12 A;  4DR1 Q;  1D5Z C;  3M3Y B;  1ET6 A;  1EY8 A;  1O7I A;  3I2Z A;  4N9P A;  2FMM A;  1QUQ A;  1PTO D;  1RJT A;  2F3W A;  3CF5 A;  3S2D H;  5IYB H;  2VQE Q;  3AQQ A;  1Z9F A;  4DAM A;  1TKW B;  1IYV A;  3OPO A;  2QCP X;  4JBM A;  4IN3 A;  1IBL Q;  3D3R A;  2EPB A;  1G91 A;  2L0C A;  1CZG A;  4C1N K;  3C1E A;  3CCR A;  3F2B A;  3MVV A;  1F77 A;  3ULL A;  2R7Z H;  1A2U A;  3KDF A;  4OWW B;  3Q22 A;  5IGG A;  5C3E H;  3DM3 A;  2E2J H;  3CC4 A;  5J22 A;  4EQ5 A;  1SE2 A;  5KYI A;  4L8J A;  1XPU A;  2P5Z X;  3LWE A;  3S1R B;  1DOK A;  4UDU C;  4A4I A;  1RF2 D;  2XTI A;  1MBY A;  2JYO A;  3HKZ B;  1SBB B;  2BA1 A;  4B08 A;  2MFI A;  4DV5 L;  1K8G A;  2R7F A;  4J1M A;  4TVA B;  4DR6 Q;  3JAM L;  1TWA H;  2B2U A;  2B2T C;  1Y69 U;  4GLA C;  1ESR A;  5M3M H;  5M5X H;  4GN5 A;  2MP1 A;  3D4W A;  1GOZ A;  2IT1 A;  5LMN L;  2MQH A;  3TN2 A;  3K0Y A;  3K0X A;  1LO5 D;  3I91 A;  5IT9 L;  3MA2 B;  4A3I B;  4POG A;  1LTL A;  5ELN A;  4DV7 L;  2E8G A;  4AQY L;  4BBR G;  5HGQ A;  4TSS A;  4FP5 D;  4PZ8 A;  4JI3 Q;  1D5X C;  2ALY B;  3CW2 C;  3I70 A;  2NYZ D;  4MIU A;  2L4N A;  3GV3 A;  3E6Z X;  3WDN A;  2NVY B;  3MHB A;  4A3G G;  2QKI C;  3H3V C;  3LX0 A;  4IUN A;  1KAB A;  4IPG A;  2PW5 A;  1M1K C;  3HOY B;  1YNN C;  3BZK A;  1X3P A;  4IPC A;  3RZD H;  2HT1 A;  2UUC L;  4OX9 L;  1QWY A;  3DXJ C;  1TQO A;  1VQI A;  4ZK9 B;  2BDO A;  4MHE A;  1FNU A;  3IL8 A;  1XMQ L;  1GHK A;  2IX1 A;  3HP3 A;  3FKI G;  3H0G H;  1RTO A;  2HD3 A;  5C3W A;  2R92 H;  2OTJ A;  3J81 c;  1YI2 A;  3EQL C;  2MGS A;  1GXD C;  2AUJ D;  5GAE C;  1STA A;  3NTH A;  1JIC A;  1JMC A;  3UE1 A;  2EYF A;  3CME A;  3M9B A;  1HTL D;  2WKC A;  3MTS A;  3KFU A;  3TS2 A;  1Z7T A;  4A3F B;  4DNT B;  4GS3 A;  1UE1 A;  1EY6 A;  2R93 H;  2UXC L;  2PI2 A;  1A15 A;  3KLS A;  5M9O A;  4A3D B;  3CXC A;  1AE2 A;  1EZ8 A;  1GUT A;  2K4K A;  3C2P A;  2NTS A;  5CV7 A;  4PZ7 A;  4DAY B;  4LK1 C;  1VQE A;  4F87 A;  3KLR A;  2EOT A;  4G4K A;  4R4O A;  3Q0A A;  1HR0 Q;  1ESF A;  2JEB I;  1BCP D;  3FP9 A;  3TQY A;  1O7L A;  3KLW A;  4BBS B;  1AW7 A;  3TZD A;  2ASB A;  5C0X I;  2DY8 A;  5JEA H;  3OHX C;  3GTL B;  2NWG A;  2DN8 A;  4DV5 Q;  3OIP A;  4LW1 A;  1U9R A;  4KD3 A;  5C0X G;  1SXT A;  2VQF L;  4EQO A;  1JE5 A;  1FYC A;  5C6A A;  2B2T A;  2E75 C;  4LF4 L;  4Z9C B;  1KNE A;  3M7G A;  3RUZ A;  1TWC H;  4JI5 L;  4RKB A;  4K8I A;  3QIA A;  1JWU D;  3I7F A;  4OON A;  3M3Y H;  1I4P A;  1BDO A;  4GKJ L;  2XGT A;  4DV7 Q;  1A3T A;  4AQY Q;  1PTO C;  1HH2 P;  1DJR D;  4IUR A;  1WYD A;  3AFP A;  3CCE A;  4H02 A;  2I07 B;  1XMO L;  4HAE A;  4EGV A;  1L0X B;  1RD9 D;  5IYD H;  1BUV T;  2ZTC A;  4GLX A;  2XN9 C;  4OIK A;  4BY1 B;  1ET9 A;  1EY9 A;  4HJ5 A;  3BYY B;  4ZLT F;  1DCZ A;  1GUG A;  1CT1 D;  1JQY D;  4CDD C;  2UUC Q;  4OX9 Q;  2KEC A;  1PH7 A;  4X3K A;  3NBI A;  3UE0 A;  1I5F A;  4Y7N B;  1TS5 A;  3M4O H;  2VB3 X;  3CD6 A;  3PCO B;  1SYF A;  1S4Z A;  3VDY A;  1U4M A;  4AYB G;  1U4L A;  2UU9 L;  3I4M G;  3S15 B;  4KN4 C;  1EZ6 A;  1EYC A;  4X66 L;  4YHH L;  2CFM A;  4DNI A;  2BE5 D;  3ZYY X;  4X3S A;  3IRB A;  3CPF A;  1ONL A;  1E24 A;  1ICW A;  3MEF A;  4IJL A;  2RF4 A;  3V96 A;  2EYP A;  5EPK A;  1D1K A;  4QIW B;  3DWA A;  1EFW A;  3I8Z A;  3AU7 A;  5FLM G;  4A3E G;  5FKA C;  4C3I G;  3N52 A;  3G48 A;  3JAM E;  4A93 H;  2ZXP A;  1A2T A;  1K83 B;  4DAP A;  2UXC Q;  3GTJ B;  5GAG C;  1YNJ D;  3K7U C;  3TP6 A;  3J80 i;  1PXU A;  3QO2 A;  3UDG A;  2Z6K A;  5DEH A;  5IT9 E;  5BN5 A;  1ZYR D;  2JA8 B;  2NVY H;  1KC8 C;  4R4Q A;  4JOI C;  1G6Z A;  3HZX A;  4EX5 A;  3S16 B;  1ZEQ X;  1LT3 D;  5GQO A;  3RZO B;  1PDQ A;  1D2B A;  3HOV G;  4BXX H;  4LUV A;  1E1O A;  2K5H A;  1G2S A;  1X32 A;  3HOY H;  1TXY A;  4RGN A;  4DR5 L;  4EQN A;  4B3M L;  3TDQ A;  1KDA A;  2Y0S B;  1DON A;  1SNO A;  2MPM A;  2H1E A;  4DR7 Q;  1VMC A;  4RWS C;  2KCC A;  1PZK D;  3DEO A;  4OIJ A;  4CJ2 C;  2VW9 A;  4NXN L;  3VYR A;  5C4Z A;  1PMR A;  1PTO B;  4FDB A;  1QVG A;  2YTY A;  1PFB A;  4QB4 A;  4JI5 Q;  1FNW A;  1KL9 A;  2LSS A;  3SHL A;  1Q86 C;  3AEV A;  2B8G A;  3KJO A;  1XNQ L;  3K57 A;  1FL0 A;  3EIV A;  1SYB A;  2LS0 1;  3P75 A;  5DM6 3;  2PZW A;  4HJ9 A;  1IKM A;  1ZKO A;  1XMO Q;  2NTT A;  3J7Z C;  1VQB A;  3K7A B;  1PA6 A;  3PO3 H;  3OWE B;  4A3F H;  4GKK L;  3RLF A;  3I73 A;  5CV9 A;  2F0H A;  3H3V I;  2A6E D;  2N49 A;  4A3D H;  4LF9 L;  5IP7 H;  2K1B A;  3W2D A;  2EY2 A;  4C3H G;  5I9P A;  3D8G A;  4B9X A;  2LXJ A;  4LF5 L;  3NPP A;  5K36 H;  4HTH A;  2A69 D;  2UU9 Q;  1LTS D;  5CMD A;  3H91 A;  1YJW A;  1LM0 A;  4X66 Q;  1BCP C;  1G51 A;  4YHH Q;  3TSS A;  1JOO A;  2F4V Q;  4BBS H;  1F2L A;  4JI4 L;  3GTL H;  4A3K B;  5C4J B;  1IXR A;  5JJK A;  1AH9 A;  4DV6 L;  1MJE A;  2XSC A;  4LNQ A;  4QQB X;  4LMQ D;  2RHS B;  1PRT F;  2EZV A;  3HOU G;  1EU3 A;  3CQZ B;  1CZW A;  1VQO A;  1PH8 A;  4NP5 A;  4ME3 A;  4ZRZ A;  5IYC H;  2CHB D;  2NB0 A;  5G3L D;  5EBD A;  5GRO A;  3AMU A;  1I50 H;  4ZUJ A;  2FJ2 A;  4DV3 L;  1K8M A;  4X64 L;  3I72 A;  2IX3 A;  2QEX A;  3KBG A;  4HR7 B;  1QIL A;  4A3L G;  4JC0 A;  3W3A A;  1JOK A;  3W1G A;  4C2M H;  5C4X G;  1XNR Q;  1SDF A;  3U9O A;  4L5T A;  4JOI A;  4R8I A;  4DA2 A;  4HSV A;  3KLS X;  2DJF C;  4DR2 Q;  1TWF B;  4BY1 H;  4CKC A;  4JPB W;  2BDN A;  2LXK A;  1CM9 A;  2LKV A;  1GO3 E;  4B3M Q;  1EUJ A;  4MNO A;  4LF6 L;  5C44 G;  1N33 L;  3GQB A;  2NZ1 D;  3QB3 A;  2YTX A;  1HFG A;  2GVB A;  3ND8 A;  1EQT A;  3VA5 A;  4Y7N H;  1X54 A;  4IFD I;  4MTK A;  1G29 1;  1EEF D;  1F2Z A;  3S15 H;  1PRT B;  2N8N A;  2R7D A;  3LNN A;  1YIT A;  1VQ5 A;  4NXN Q;  3J80 E;  4K5X A;  4K2L A;  2NBF A;  2D2C C;  2BE5 C;  4F7X A;  3NTI A;  4GOP C;  3SR1 A;  3K5M A;  1BBU A;  1PH9 A;  1VF7 A;  3DM1 A;  4Y52 H;  2ZJP A;  2K5W A;  4GN3 B;  3SEB A;  1S40 A;  2K01 A;  1I4Q A;  5D3D A;  4V0B A;  2R3Z A;  3BJU A;  1DXM A;  1CKO A;  4PMC A;  2B2W C;  4N8X 1;  2PMZ B;  3FVQ A;  1EYD A;  4DR1 L;  4K2K A;  1K83 H;  3ZJY C;  5CV5 A;  4LF9 Q;  1X56 A;  5C5M A;  1HPC A;  1HJP A;  1QG7 A;  1EQV A;  1TT2 A;  2NN6 I;  1ZYR C;  4DV1 Q;  3GTK B;  2PYK A;  2JA8 H;  1YHQ A;  4ZUI A;  4WOR A;  2G9D A;  1QOH A;  1XTD A;  1HRJ A;  1D7Q A;  2NN6 G;  1WTW A;  5IGF A;  3S16 H;  4HCS A;  2F0I A;  3RZO H;  2IHF A;  2JXM B;  2PZT A;  2K5Q A;  3SXH A;  1VQL A;  2JE6 I;  4M1U B;  2K05 A;  3NK9 A;  1JC7 A;  3P7J A;  4HCE A;  2RDF A;  3PUV A;  2J0T D;  1I6V C;  1B70 B;  4KJO A;  2PNH A;  3K59 A;  1F2M A;  5TSS A;  4YY3 Q;  3CP0 A;  4CKB A;  1C8C A;  2LMC B;  4A3M G;  2Q2U A;  2J4X A;  2A74 C;  1HCZ A;  3I4N H;  4YWL A;  4DUZ L;  4A3J G;  5E3F A;  4DK1 A;  4BBR B;  4DV3 Q;  2F3I A;  4DR6 L;  1PFS A;  1B44 D;  4FF3 A;  1OXV A;  5FOB B;  2FMC A;  2Z0S A;  2EYH A;  3S17 B;  1A62 A;  1O7Y A;  2F0T A;  4NDX A;  5CBA E;  3EVQ A;  4A76 A;  1V1Q A;  1NTG A;  2EJG C;  4A3G B;  2O5I C;  3OMG A;  5CV8 A;  2RBM A;  2RDG A;  1LT4 D;  4KY7 A;  2A6E C;  5F2D A;  4P2C B;  1WCM G;  2ZTD A;  3FPP A;  5I6W A;  2N55 A;  1SYG A;  2OXP A;  2VUM G;  2L5T A;  4H13 C;  3UDX A;  1K0S A;  1LTB D;  1SNM A;  4P71 A;  3IFD A;  1N33 Q;  2RHQ B;  2HQL A;  4LAA A;  4C1N I;  4PNY A;  2EYM A;  2MJ8 A;  3K6O A;  4TKO B;  5DNF A;  2NVQ B;  4OGQ C;  4FXG C;  3NTK A;  2SDF A;  1BNZ A;  2A69 C;  3Q8D A;  5IWA Q;  1Y8O B;  2QDB A;  2AWO A;  2N88 A;  1C0A A;  1Q82 C;  4ALP A;  1K9M C;  4TRD A;  1IYU A;  3FKI B;  4A3K H;  5C4J H;  2EQS A;  4OWT B;  3LWU A;  1WOC A;  1TS3 A;  2B2Y C;  2VS1 A;  3GTQ B;  5ISR A;  3S1N B;  4DXF A;  4DFA A;  1J5E L;  1TWH B;  1EL0 A;  4C3J G;  2OTL A;  4KK7 A;  1PLF A;  4JK1 C;  3HKS A;  2B2V C;  1BVS A;  3EBE A;  1EY4 A;  1Y1W G;  2B2W A;  4PG3 A;  4PQX A;  4G7Z C;  3D6C A;  4LF7 L;  3B6Y A;  3S1M H;  3HOX G;  3I56 A;  3E5S A;  4MZ9 A;  4R4C A;  3W5O A;  4WJ4 A;  3R8B A;  1PZJ D;  3A74 A;  3CCM A;  1V1O A;  1PH4 A;  2F3V A;  4A75 A;  5C3X A;  5HGT A;  4OO1 H;  3BVZ A;  3P20 A;  3KDF B;  1P16 A;  2B29 A;  2YTV A;  4YIJ A;  4OHJ A;  3TS0 A;  1PYS B;  1HNX L;  2KOL A;  4X3T A;  3UDI A;  1RL2 A;  3PGZ A;  2ICE C;  3CHB D;  2QW7 A;  3SK4 A;  3BG3 A;  2E2H H;  2JSO A;  1SND A;  1XX8 A;  5M3M G;  3X3N A;  3GTP B;  3FPU B;  1SAP A;  3CMA A;  3SVM A;  3J81 L;  4UP8 A;  4PV1 C;  1HR0 L;  3R2I A;  3G71 A;  1WTX A;  1FNV A;  3K58 A;  5IGC A;  3Q6S A;  2Z6B A;  3I4L A;  3S9W A;  3GP7 A;  3C3L A;  1I6H B;  4DUZ Q;  1SYE A;  4KV6 A;  4H44 C;  1W6J A;  1TR5 A;  4ODG A;  1EEI D;  1VS0 A;  1VQK A;  1Q1B A;  3HEJ A;  1K0R A;  4DU9 A;  3SGI A;  2F0S A;  2KJX A;  3Q24 A;  2WAQ E;  1Q1E A;  2F03 A;  2EXZ A;  3PO2 H;  1YJ9 A;  3U50 C;  3U58 A;  2ATW A;  5EKL A;  3OW2 A;  5CBE E;  2RSO A;  3VYS A;  1LUZ A;  2Q8T A;  4AH6 A;  5IIF A;  3BVM A;  4FXD A;  2VZA A;  3S1Q B;  4AYB B;  5ELB A;  3I4M B;  2C35 B;  2IPK D;  1EIH A;  3O13 A;  2Q2T A; 
#chains in the Genus database with same CATH homology
 4CJ0 B;  5EKI A;  3T51 B;  1OXT A;  1E0B A;  1I4G A;  4QF4 A;  3QOL A;  5E4W C;  1F9S A;  5M3F B;  3BVG A;  3MC0 B;  2B2Y A;  1LTR D;  3KK7 A;  1E2Z A;  1SNC A;  1EFI D;  3L7Z C;  5CYU A;  1WTP A;  1XTC D;  5FO9 B;  4A3E B;  4E6I A;  4HMI A;  4C3I B;  2IX0 A;  2K28 A;  4DF7 A;  3R2T A;  3UI2 A;  1CA5 A;  5KRU A;  4TQU S;  1I4H A;  1KDB A;  2EVB A;  4HMJ A;  2EYO A;  5AFW A;  4BA1 I;  2C5C A;  3CRK C;  1EU4 A;  4ZKB B;  2EY5 A;  1EWC A;  3HOV B;  5JEA J;  1CI3 M;  2EJM A;  3SDZ A;  1OO9 B;  2MHV A;  3BDC A;  3GO5 A;  2A68 D;  3CKI B;  1RHP A;  2ID0 A;  4XDX A;  3DEP A;  2K7V A;  4QCL A;  2HDM A;  3M7N A;  2EDG A;  2F0F A;  3V05 A;  1WD1 A;  1IL8 A;  1SE3 A;  3CU7 A;  1HA6 A;  3QWN A;  2RQX A;  1JB3 A;  3NWS A;  4C3H B;  1KNA A;  3NXW A;  4IAL A;  3FRP B;  4CHT B;  4UAI A;  5BN3 A;  2F0P A;  3QG1 A;  2F0U A;  4BY7 B;  2RVL A;  5EQ0 A;  1WTR A;  1TU2 B;  2R6G A;  5T1G A;  4XXE A;  5C0X H;  2XIW A;  1B50 A;  3HOU B;  1PYW D;  5KIX A;  3OWF A;  5C4H A;  5CV4 A;  5EPL A;  3J81 E;  1CK1 A;  2EY6 A;  5I2X A;  3EFX D;  3GTG B;  1IW7 D;  2F0Q A;  1PTO F;  1MSH A;  5DM7 3;  3E0J A;  1E2V A;  5M5Y B;  5C4X B;  3HRZ C;  4WRD A;  1GJX A;  3NHH A;  1H9S B;  2YU9 B;  3H09 A;  5K5P A;  3SK6 A;  3T53 B;  5BN4 A;  5C44 B;  1LTA D;  5E1F A;  2EE1 A;  2WKD A;  2EYL A;  1H9S A;  1SYD A;  1J9O A;  2LY7 A;  2BA0 A;  4FXK C;  5A2Q L;  1JWM D;  1DOM A;  3F2U A;  4KMU C;  4FF2 A;  2SNM A;  1JE4 A;  3A8I E;  1MSG A;  1KAA A;  1D5M C;  3BZD B;  4HN7 A;  5JPN C;  4XQQ A;  3OOC A;  1LAB A;  3KBX A;  2F0N A;  5COY A;  1S5C D;  2Z8L A;  2F0M A;  1HHV A;  1NR4 A;  2OF1 A;  3BDO A;  2O2L D;  2A68 C;  2E76 C;  2K04 A;  3ERO A;  4K5W A;  1O78 A;  5CV6 A;  4A3M B;  2FFK B;  2K33 A;  1F9Q A;  2CW0 D;  1LLR D;  3PUZ A;  1W6K A;  4A3J B;  2CQA A;  2VB2 X;  2O5J C;  2GA4 B;  4HSP A;  4U67 3;  1SEB D;  2BOS A;  3IKJ A;  4DN4 M;  3WOF A;  1UNS A;  1Y1V B;  3I90 A;  5FO7 B;  1UUP A;  4OL7 A;  3VR5 A;  3D4R A;  2HCC A;  1CHQ D;  3T13 A;  1F2Y A;  3SE0 A;  1WCM B;  3G6J B;  2VUM B;  4U68 A;  1I3Q B;  1SYC A;  2FIN B;  5IGD A;  5KEE A;  4IUT A;  5EKK A;  1JOQ A;  4H0L C;  2D9U A;  4I7Z C;  1BCP F;  3URY A;  4K14 A;  3L3O C;  2H4O A;  3D4D A;  2IWH A;  5KYL A;  4G7O C;  2HUG A;  4C3J B;  2Z1C A;  4KKS A;  1LT6 D;  3MFY A;  2Q8I B;  1NCV A;  2L12 A;  5CC4 A;  4KN7 C;  3A8K E;  1MI2 A;  1Y1W B;  3H6M A;  2RDH A;  1LTG D;  5EJW A;  3HOX B;  5FLX L;  3GTM B;  1IW7 C;  1AP0 A;  1G8Z D;  1H9K A;  1CA6 A;  2E2I B;  1BQQ T;  1EIG A;  2IW3 A;  1R4P B;  1CHP D;  4JBW A;  1OXX K;  3PUY A;  1T5E A;  2KUM A;  1O80 A;  2EJF C;  5A35 A;  1BCP B;  5M3M B;  5M5X B;  5IOC A;  2VNU D;  3A7L A;  4KJN A;  1QB5 D;  4IFD H;  1D6E C;  3NUC A;  2VXW A;  1HFN A;  2ZXR A;  1IHZ A;  5CR3 A;  1JCK B;  1EOT A;  4XQN A;  4LJZ C;  3TP5 A;  3BS1 A;  3KF8 A;  5A2Q E;  1X3Q A;  1PTO H;  5NUC A;  5JVH 3;  2F0E A;  3RZD B;  1C48 A;  5D3I B;  1DM0 B;  3OMC A;  5FK9 C;  3VR3 A;  2NN6 H;  3J7A V;  2KCN A;  1NAP A;  1A6X A;  3A7A B;  2FHT A;  2OEO A;  5ELE A;  4CBV A;  1V8Q A;  4WFN 3;  1EYA A;  4G57 A;  4KHZ A;  2L1B A;  1ENF A;  4FNF A;  4K6L A;  5I2Y A;  4BA2 I;  4RH6 A;  2A73 B;  1IKL A;  1SMY D;  1WTV A;  1RTN A;  2CW0 C;  1STB A;  4RHS A;  2R93 B;  4PMW A;  2K6A A;  1FR3 A;  2SNS A;  1AFP A;  4ZYS A;  4NW2 A;  1H9J A;  3M4Y A;  5EPJ A;  5LL6 X;  3WOE A;  4OO1 G;  2QIL A;  2EYJ A;  4ILW A;  2F0W A;  2XVS A;  2V4D A;  3T56 B;  5I6Y A;  4L6T B;  4KTA A;  1LTI D;  3OIQ A;  1Z47 A;  5COR A;  1CQF A;  2AWN A;  3MXG A;  4DXG A;  3EA6 A;  3VYT A;  1V43 A;  4XYO A;  1STN A;  1DZ1 A;  5KNC A;  3NQT A;  4B9W A;  1ROD A;  2F1M A;  2DY7 A;  1XWE A;  2RA4 A;  1B53 A;  2AQ2 B;  4RKL A;  3RD4 A;  1SE4 A;  5EBC A;  3H94 A;  3X3M A;  2I46 A;  4IZ8 A;  1QNK A;  1VDZ A;  4IUQ A;  1SNQ A;  2KVM A;  1K8O A;  4KHV A;  1XYI A;  4IUP A;  1HTP A;  1F9P A;  1I4X A;  2XRQ D;  5G3L F;  4EQP A;  3BYT B;  4NKL A;  4ULL A;  3TP7 A;  4RAU C;  2L11 A;  3PUW A;  1VMP A;  1BO0 A;  2JEA I;  1E2W A;  4DAV A;  5JVG 3;  4XIG S;  1S5D D;  3M4O B;  5M5W B;  2F0V A;  2RKS A;  3PUX A;  5FLX E;  4I65 A;  2WAC A;  4NMZ A;  1JR0 D;  4BS9 A;  1CFM A;  4N9T A;  5JJZ A;  1WVL A;  1ML0 D;  1ENA A;  1OXS C;  1STG A;  5ELF A;  2F0J A;  1EY0 A;  2WV6 D;  3ITP A;  4KY6 A;  4L63 B;  1Y8N B;  4A93 B;  2L55 A;  1R4Q B;  2PW7 A;  1H9R A;  3K5L A;  1CTM A;  1AZP A;  3VR4 A;  3MXN A;  2X69 A;  3ONA B;  3DWP A;  4RCO A;  1EY7 A;  3S14 B;  3NQI A;  1XXG A;  1WD0 A;  2PCF B;  2PQE A;  3DHQ A;  4KI0 A;  1JWS D;  2B2V A;  4RGO S;  4C56 C;  3J7Y W;  2BCO A;  3DUZ A;  1VCI A;  1EY5 A;  1S5E D;  2XNA C;  1B1Z A;  3HOZ B;  3IAY A;  1CQV A;  3K5O A;  1L0Y B;  2CVR A;  1B3A A;  3CRL C;  2C9O A;  5ELC A;  3M85 A;  5JEA G;  1PRT D;  2A6H D;  2J7Z A;  2JA7 B;  1QJO A;  3TZU A;  5JAV A;  2IJ0 A;  1WTQ A;  1SMY C;  3A54 A;  1Z6H A;  2IL8 A;  2HCI A;  4CJ1 B;  3PO3 B;  5IOD A;  1STH A;  4RA8 A;  1BF4 A;  1SJH D;  3HS0 C;  2RSN A;  4KKU A;  1LTT D;  2NUC A;  1HQR D;  2R61 A;  4WJW A;  1OXU A;  4DAY A;  4DK0 A;  1B4O A;  4R9W A;  2XWJ B;  3SK8 A;  3C1F A;  2QEJ C;  1AEX A;  1LAC A;  1KDC A;  4X3U A;  3AB9 A;  5C0X J;  5KNB A;  4M8A A;  1I4R A;  3EJI A;  2ENB A;  1RCV D;  1H9M A;  1BXT A;  1I50 B;  4R8N A;  4XTC S;  4XT1 B;  2B8F A;  1R9T B;  3MWY W;  5J39 A;  1UAP A;  2X6G A;  4IUU A;  3MFG A;  4C2M B;  1ILP A;  3NSW A;  5ELD A;  3PIO 3;  4GZY C;  1LT5 D;  2PPB C;  1B9N A;  3MXU A;  3Q23 A;  1AN8 A;  1TII D;  5CGK A;  5C5L A;  3J80 L;  3FDT A;  1PFN A;  3NP8 A;  3PMF A;  2TMP A;  2NVT B;  3GTO B;  2X6L A;  2B63 B;  3VA7 A;  4IQZ A;  2Z4I A;  3P1H A;  1KLG D;  2JA5 B;  4HED A;  4K8J A;  3J7A F;  2OT2 A;  4XT3 B;  1D1I A;  3QJY A;  4PMB A;  1U4R A;  2PZU A;  3V2T A;  5D65 A;  4DGZ A;  2TSS A;  1GHJ A;  2WP8 J;  1SSO A;  2DNE A;  1GUW A;  1NR2 A;  3MZ5 A;  3HG9 A;  2K5D A;  5LHY 1;  1BBX C;  2KA7 A;  1HXY D;  1Q8I A;  2AUK A;  2HQE A;  2WAQ B;  2NVX B;  1ENC A;  5KND A;  1SFO B;  2LFN A;  5JOB A;  3D31 A;  4XQJ A;  3R3O A;  4Q5V A;  4ZKC B;  2F0L A;  1TY0 A;  4FYD A;  2Q8R E;  1Y8P B;  5K36 G;  1SNP A;  1C4Q A;  3A55 A;  2K32 A;  3TME A;  1HUN A;  4FF1 A;  4A3B B;  4KD4 A;  1O7Z A;  1PRT C;  3I4N B;  1NSN S;  2A6H C;  4Q0F A;  1ZXT A;  3FEW X;  3ERQ A;  4K5V A;  4ZAI A;  4FF4 A;  5I4D A;  1RKN A;  2HDL A;  2ZT9 C;  2E2D C;  3MAQ A;  1SJE D;  1WTO A;  2ZXO A;  1TY2 A;  1EWH A;  1DOL A;  4BWG B;  2AQ1 B;  3ND9 A;  4QMG A;  4CGY B;  3PV0 A;  1HA5 A;  2F0K A;  1JOR A;  5E4X A;  2PO4 A;  3DWQ A;  5IGE A;  3MEH A;  1B2T A;  2A5H A;  5D14 A;  2D5D A;  5LL6 S;  5T1I A;  1U4P A;  2AQ3 B;  3RMH A;  1FD7 D;  3KUP A;  4O1N A;  4RHR A;  2WB1 B;  4S3S A;  4RGT A;  3S1M B;  1TVX A;  4QUF A;  5KGU A;  3S2D B;  1F9R A;  2JP1 A;  5I9O A;  5J1Z A;  3N6R A;  1LV9 A;  4RGM A;  3SK5 A;  2F4I A;  4KKT A;  3GV6 A;  1VF5 C;  3A8J E;  1PZI D;  2WII B;  3T16 A;  1STY A;  1MGS A;  2O4X A;  2KQ3 A;  1ILQ A;  2R7Z B;  2E2H B;  3TP8 A;  1QE6 A;  1GUS A;  1Q90 A;  5C3E B;  2KED A;  3NE5 B;  2E2J B;  4RFB A;  5EGT A;  4IFD J;  4IFD G;  1PFM A;  3IFT A;  1QCB D;  2KHS A;  3R93 A;  1G2T A;  4DNR B;  2DNC A;  1M8A A;  1STE A;  2K03 A;  1TWA B;  3K5N A;  3BDL A;  2KEE A;  5JPM C;  2B39 A;  4H7B A;  1HQM C;  4ME5 A;  3FMC A;  1YNJ C;  3GD7 A;  1UEA B;  1TS2 A;  3PO2 B;  1FGB D;  3A56 A;  1M4V A;  5FO8 B;  1GUO A;  3PIP 3;  1A3U A;  4KY5 A;  2F0O A;  4CKE A;  3HGB A;  3C46 A;  4K6D A;  2G9H D;  2M00 A;  2EY1 A;  1BOS A;  3MXP A;  4F8M A;  3NBH A;  4MN3 A;  1YNN D;  1KTK A;  1T5X D;  5HUR A;  1A3V A;  1QNU A;  3U9S A;  4V19 0;  4ZQ3 A;  4G7H C;  1AZQ A;  1DD2 A;  2JA6 B;  1NUC A;  2Z4H A;  3OSO A;  2PNR C;  1HUM A;  1S5F D;  3H0G B;  2MUY A;  2WIN B;  2B2U C;  2R92 B;  4RCN A;  2F0D A;  4J8Q A;  4QUC A;  2M2L A;  3T4A C;  3NWT A;  4XYQ A;  1KLU D;  1Q3L A;  4ABN A;  2XRS D;  1MD2 D;  3G7L A;  4EVO A;  4OO1 I;  5DAU A;  2SOB A;  1V1P B;  1GUN A;  2F0G A;  5IGB A;  3OW7 A;  3D6W A;  4J6H A;  4F88 A;  3S2H B;  4O42 A;  3VR6 A;  1V1P A;  4IUV A;  1B9M A;  1TS4 A;  1RDP D;  3DMU A;  3QOJ A;  4ID6 A;  3VR2 A;  1II3 A;  3TBI B;  1TWG B;  4FO2 A;  3HOW B;  2L9H A;  2YYZ A;  2M9V A;  2XWB B;  2SEB D;  2ICI A;  4FVM A;  2QF7 A;  2E74 C;  2D62 A;  1BR9 A;  1S5B D;  3VYU A;  3L9A X;  1TWC B;  1J8I A;  1DYQ A;  3I3C A;  1Q12 A;  1D5Z C;  3M3Y B;  1ET6 A;  1EY8 A;  4N9P A;  2FMM A;  1PTO D;  1RJT A;  2F3W A;  1TKW B;  1IYV A;  3OPO A;  2QCP X;  4IN3 A;  3D3R A;  2EPB A;  1G91 A;  4C1N K;  1CZG A;  2L0C A;  3C1E A;  3MVV A;  1F77 A;  1A2U A;  3Q22 A;  5IGG A;  5J22 A;  5KYI A;  1SE2 A;  4L8J A;  3LWE A;  3S1R B;  1DOK A;  4UDU C;  1RF2 D;  1MBY A;  2JYO A;  3HKZ B;  1SBB B;  2BA1 A;  4B08 A;  4J1M A;  3JAM L;  2B2U A;  2B2T C;  1Y69 U;  1ESR A;  2MP1 A;  3D4W A;  1GOZ A;  2IT1 A;  3TN2 A;  3K0Y A;  1LO5 D;  3I91 A;  5IT9 L;  3MA2 B;  4A3I B;  4TSS A;  4FP5 D;  1D5X C;  3I70 A;  2NYZ D;  4MIU A;  2L4N A;  3GV3 A;  3E6Z X;  3WDN A;  2NVY B;  3MHB A;  2QKI C;  3H3V C;  3LX0 A;  4IUN A;  1KAB A;  2PW5 A;  3HOY B;  1YNN C;  1X3P A;  1QWY A;  3DXJ C;  1TQO A;  4ZK9 B;  2BDO A;  4MHE A;  1FNU A;  3IL8 A;  1GHK A;  2IX1 A;  3HP3 A;  1RTO A;  5C3W A;  3EQL C;  2MGS A;  1GXD C;  2AUJ D;  1STA A;  3NTH A;  1JIC A;  2EYF A;  1HTL D;  2WKC A;  3MTS A;  1Z7T A;  4A3F B;  4DNT B;  1EY6 A;  1A15 A;  3KLS A;  5M9O A;  4A3D B;  1EZ8 A;  1GUT A;  3C2P A;  2NTS A;  5CV7 A;  4LK1 C;  4F87 A;  3KLR A;  2EOT A;  4G4K A;  3Q0A A;  1ESF A;  2JEB I;  1BCP D;  1O7L A;  4BBS B;  1AW7 A;  3TZD A;  5C0X I;  2DY8 A;  5JEA H;  3OHX C;  3GTL B;  2NWG A;  2DN8 A;  3OIP A;  5C0X G;  1U9R A;  4KD3 A;  1SXT A;  4EQO A;  1FYC A;  5C6A A;  2B2T A;  2E75 C;  4Z9C B;  1KNE A;  3M7G A;  3RUZ A;  4RKB A;  4K8I A;  3QIA A;  1JWU D;  1I4P A;  1BDO A;  1A3T A;  1PTO C;  1DJR D;  4IUR A;  2I07 B;  4HAE A;  4EGV A;  1L0X B;  1RD9 D;  1BUV T;  2XN9 C;  4OIK A;  4BY1 B;  1ET9 A;  1EY9 A;  3BYY B;  4ZLT F;  1DCZ A;  1GUG A;  1CT1 D;  1JQY D;  2KEC A;  4X3K A;  3NBI A;  4Y7N B;  1TS5 A;  2VB3 X;  1SYF A;  1S4Z A;  1U4M A;  1U4L A;  3S15 B;  4KN4 C;  1EZ6 A;  1EYC A;  2BE5 D;  3ZYY X;  4X3S A;  1ONL A;  1ICW A;  3V96 A;  2EYP A;  5EPK A;  1D1K A;  4QIW B;  3DWA A;  3I8Z A;  3AU7 A;  5FKA C;  4C3I G;  3N52 A;  3JAM E;  2ZXP A;  1A2T A;  1K83 B;  4DAP A;  3GTJ B;  1YNJ D;  3TP6 A;  1PXU A;  3QO2 A;  5DEH A;  5IT9 E;  5BN5 A;  1ZYR D;  2JA8 B;  1G6Z A;  3HZX A;  3S16 B;  1ZEQ X;  1LT3 D;  3RZO B;  1PDQ A;  1D2B A;  1G2S A;  1X32 A;  4RGN A;  4EQN A;  3TDQ A;  1KDA A;  2Y0S B;  1DON A;  1SNO A;  2MPM A;  2H1E A;  1VMC A;  4RWS C;  2KCC A;  1PZK D;  3DEO A;  4OIJ A;  4CJ2 C;  3VYR A;  5C4Z A;  1PMR A;  1PTO B;  1PFB A;  4QB4 A;  1FNW A;  3SHL A;  2B8G A;  3K57 A;  1SYB A;  2LS0 1;  3P75 A;  5DM6 3;  2PZW A;  1IKM A;  1ZKO A;  2NTT A;  3K7A B;  3OWE B;  3RLF A;  3I73 A;  5CV9 A;  2F0H A;  2A6E D;  2K1B A;  3W2D A;  2EY2 A;  4C3H G;  5I9P A;  3D8G A;  4B9X A;  3NPP A;  5K36 H;  4HTH A;  2A69 D;  1LTS D;  5CMD A;  3H91 A;  1BCP C;  3TSS A;  1JOO A;  1F2L A;  4A3K B;  5C4J B;  2XSC A;  4LMQ D;  1PRT F;  2EZV A;  1EU3 A;  3CQZ B;  1CZW A;  4NP5 A;  4ZRZ A;  2CHB D;  2NB0 A;  5G3L D;  5EBD A;  3AMU A;  4ZUJ A;  2FJ2 A;  1K8M A;  3I72 A;  2IX3 A;  3KBG A;  4HR7 B;  1QIL A;  3W3A A;  1JOK A;  1SDF A;  3U9O A;  4R8I A;  4DA2 A;  4HSV A;  3KLS X;  1TWF B;  4CKC A;  2BDN A;  1CM9 A;  2LKV A;  3GQB A;  2NZ1 D;  3QB3 A;  1HFG A;  3ND8 A;  1EQT A;  3VA5 A;  4IFD I;  1G29 1;  1EEF D;  1F2Z A;  1PRT B;  3LNN A;  3J80 E;  4K5X A;  4K2L A;  2NBF A;  2D2C C;  2BE5 C;  4F7X A;  3NTI A;  3SR1 A;  3K5M A;  1VF7 A;  3DM1 A;  2K5W A;  3SEB A;  2K01 A;  1I4Q A;  5D3D A;  4V0B A;  2R3Z A;  1DXM A;  4PMC A;  2B2W C;  2PMZ B;  3FVQ A;  1EYD A;  4K2K A;  5CV5 A;  5C5M A;  1HPC A;  1QG7 A;  1TT2 A;  1EQV A;  2NN6 I;  1ZYR C;  3GTK B;  2PYK A;  4ZUI A;  4WOR A;  2G9D A;  1QOH A;  1HRJ A;  2NN6 G;  1WTW A;  5IGF A;  4HCS A;  2F0I A;  2JXM B;  2PZT A;  2K5Q A;  3SXH A;  2JE6 I;  4M1U B;  2K05 A;  3NK9 A;  1JC7 A;  3P7J A;  4HCE A;  2RDF A;  3PUV A;  2J0T D;  1I6V C;  4KJO A;  3K59 A;  1F2M A;  5TSS A;  4CKB A;  1C8C A;  2LMC B;  2J4X A;  2A74 C;  1HCZ A;  5E3F A;  4DK1 A;  4BBR B;  1B44 D;  4FF3 A;  5FOB B;  1OXV A;  2FMC A;  2EYH A;  3S17 B;  1O7Y A;  2F0T A;  4NDX A;  5CBA E;  3EVQ A;  2EJG C;  4A3G B;  2O5I C;  5CV8 A;  3OMG A;  2RBM A;  2RDG A;  1LT4 D;  4KY7 A;  2A6E C;  5F2D A;  4P2C B;  3FPP A;  5I6W A;  2N55 A;  1SYG A;  2OXP A;  2L5T A;  4H13 C;  1LTB D;  1SNM A;  3IFD A;  4LAA A;  4C1N I;  4PNY A;  2EYM A;  2MJ8 A;  3K6O A;  4TKO B;  5DNF A;  2NVQ B;  4OGQ C;  4FXG C;  3NTK A;  2SDF A;  1BNZ A;  2A69 C;  1Y8O B;  2QDB A;  2AWO A;  2N88 A;  4TRD A;  1IYU A;  3FKI B;  3LWU A;  1TS3 A;  2B2Y C;  3GTQ B;  5ISR A;  3S1N B;  4DXF A;  4DFA A;  1TWH B;  1EL0 A;  4C3J G;  4KK7 A;  1PLF A;  4JK1 C;  2B2V C;  1EY4 A;  2B2W A;  4PQX A;  4G7Z C;  3D6C A;  3E5S A;  3R8B A;  1PZJ D;  1V1O A;  2F3V A;  5C3X A;  5HGT A;  4OO1 H;  3BVZ A;  3P20 A;  4YIJ A;  4OHJ A;  2KOL A;  4X3T A;  2ICE C;  3CHB D;  3SK4 A;  3BG3 A;  2JSO A;  1SND A;  1XX8 A;  3X3N A;  3GTP B;  3FPU B;  1SAP A;  3SVM A;  3J81 L;  4PV1 C;  3R2I A;  1WTX A;  1FNV A;  3K58 A;  5IGC A;  3Q6S A;  3S9W A;  3I4L A;  3GP7 A;  3C3L A;  1I6H B;  1SYE A;  4KV6 A;  4H44 C;  1W6J A;  1TR5 A;  4ODG A;  1EEI D;  1Q1B A;  3HEJ A;  4DU9 A;  2F0S A;  2KJX A;  3Q24 A;  1Q1E A;  2F03 A;  2EXZ A;  5EKL A;  5CBE E;  2RSO A;  3VYS A;  2Q8T A;  5IIF A;  3BVM A;  4FXD A;  3S1Q B;  4AYB B;  5ELB A;  3I4M B;  2IPK D;  1EIH A;  3O13 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...