5CV7A

Crystal structure of staphylococcal nuclease variant delta+phs v66h/i92d at cryogenic temperature
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMHENAKKIEVEFDKGQRTDKYGRGLAYDYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS V66H/I92D at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 36
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2015-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5cv7A00
5J39A 2EYOA 4DU9A 4OL7A 2F0SA 2F0LA 4QB4A 1TR5A 3MVVA 4NDXA 4B9XA 4B9WA 2RDFA 2F0OA 5C6AA 3ERQA 5KIXA 1JOKA 5J22A 1EY6A 2LKVA 3T13A 2EY1A 4DFAA 5EKKA 5IOCA 3TMEA 5IGEA 2F0HA 3D4DA 1JOQA 4RKLA 4PNYA 2EYMA 3QB3A 1EY7A 4NMZA 4H7BA 2ENBA 2EYHA 1KDCA 4IZ8A 5M9OA 3SR1A 3MEHA 1II3A 4K6DA 5CV5A 4EQOA 2F0FA 5JOBA 1KABA 1SNMA 2HQEA 2KHSA 5I6WA 4K5WA 1RKNA 5EGTA 2O4XA 1SNPA 5C4ZA 1STYA 4HMIA 1SYGA 4DF7A 2RKSA 2PZWA 5KYIA 4K14A 3RUZA 4TRDA 2PZTA 4KHVA 5CC4A 3QOJA 3NQTA 2F0WA 2PZUA 5E1FA 5I6YA 2F0EA 1KDAA 4KJOA 5C5LA 2NUCA 1EQVA 3SHLA 5C3WA 2F0VA 3OSOA 2EY2A 5CV7A 5IODA 3MZ5A 1ENAA 1EZ6A 1KAAA 2F3VA 1EYDA 2SNMA 3LX0A 3PMFA 4WORA 4KD3A 5KEEA 5HURA 2EXZA 4QMGA 5HGTA 3HZXA 4J6HA 1U9RA 3MXPA 3H6MA 4KTAA 2EYLA 2F0JA 4QF4A 4WRDA 5DEHA 4KY6A 1NUCA 4NP5A 4K5VA 4KY7A 1JORA 2EYJA 5CV8A 1EY8A 4EQPA 2EY5A 1TQOA 5I9OA 1A3TA 2F0IA 3R3OA 2PW5A 3VA5A 3EVQA 1SNCA 4G57A 4F8MA 5KRUA 3SXHA 3NXWA 2F0DA 3TP8A 3U9OA 4EQNA 4KY5A 3SK4A 5KGUA 1A3UA 3C1FA 5JAVA 1SYEA 4K5XA 5C4HA 5CGKA 1KDBA 3OWFA 1STNA 1A2TA 3C1EA 1AEXA 3SK6A 4DGZA 4F7XA 2F0QA 1JOOA 2F0MA 5C3XA 4K8IA 4HTHA 4R8NA 3TP6A 3EJIA 3NHHA 5CV4A 4ZQ3A 1SNDA 1STHA 4EVOA 3BDLA 5I9PA 4IUNA 3D4WA 1SNQA 1SYCA 3BDCA 2WACA 2SNSA 2OEOA 5CV6A 4YIJA 4S3SA 1EY4A 1EY9A 2QDBA 1SYFA 1SNOA 2F0NA 1TT2A 5IIFA 3QOLA 2RBMA 2F0UA 3HEJA 5IGDA 5E3FA 3MHBA 3ITPA 1NSNS 2PQEA 4KD4A 4RKBA 3SK5A 1F2YA 5KYLA 1F2MA 1IHZA 2OXPA 3DHQA 3NUCA 4N9TA 2KQ3A 4IALA 2EYFA 4N9PA 5DAUA 2F0TA 2PYKA 3E5SA 3P1HA 4I65A 4ODGA 1SYBA 1A2UA 5CR3A 3SK8A 3NP8A 3TP5A 1SYDA 4KV6A 4LAAA 4ZUIA 1STBA 4K2LA 5C5MA 1EZ8A 4K8JA 4KJNA 3T16A 5IGFA 5K5PA 1ENCA 2PW7A 1STAA 4MIUA 1EYAA 5J1ZA 1EYCA 3EROA 3OMCA 3OMGA 5EKLA 5NUCA 2F0KA 5IGBA 4ME5A 2OF1A 3D6CA 5CV9A 1A3VA 2M00A 4PMBA 4J1MA 5F2DA 4NKLA 5IGGA 3S9WA 3D8GA 2F3WA 3V2TA 1EY5A 3TP7A 4ZUJA 4E6IA 3DMUA 4PMCA 2SOBA 1F2ZA 4K2KA 2F0PA 5IGCA 5ISRA 4HMJA 4ID6A 1STGA 2EY6A 1EY0A 2EYPA 3NK9A 3P75A 2F0GA
chains in the Genus database with same CATH superfamily
3I4OA 2EPBA 4AQYQ 2HQLA 3ERQA 1BNZA 3T13A 1OXUA 4GNXC 5EKKA 1RHPA 2KENA 1ONLA 1PTOD 4NB3A 4O42A 3K7UC 1LT6D 4NMZA 4ZKBB 2M2LA 3ERSX 4DV7Q 1W6JA 4IFDI 1PZKD 5C4ZA 2K03A 3S16B 4DR3L 5KYIA 1B4OA 2JA7H 3RUZA 1S5ED 4OO1G 4TRDA 2Q8IB 4R8IA 4JVZA 3URYA 4X65L 1I4PA 3GTJB 2B39A 3SHLA 4EX5A 1BOSA 1STEA 1XMOL 3RN2A 3HOVH 4KHPQ 1LTID 2LXJA 2EXZA 1D5XC 4FYDA 5G3LF 1Y69U 1HA6A 1U9RA 3CMAA 3I91A 2BH2A 4JI3Q 1EL0A 3ONAB 1EFWA 5K36H 1VQ6A 3GTQH 3DM3A 1KC8C 1HTPA 2AWNA 1HZAA 4C3JB 4G57A 1VQ5A 1TY0A 1XX8A 1SJHD 2MUYA 3NTKA 5IT9c 3JAME 1I6VC 3D31A 1EIHA 3NHHA 2AUKA 2CWPA 3NELA 3BDLA 4UY8C 4GOPC 3BDCA 3H3VI 3RLNA 4YCUA 2OEOA 4HN7A 3G6JB 1Y1VB 2IX0A 3IFDA 1GM5A 2RQXA 4HJ5A 3KLWA 4IUTA 2C9OA 1B3QA 2HHHQ 2A6HD 5C3EG 1MGSA 1TY2A 4I65A 1EQRA 5BR8Q 1VQOA 4DNRB 1E2VA 3PO3G 2UXDL 1EZ8A 2NVQB 4DR5L 2ZTEA 3HOXB 1QNKA 4G7OC 1S4ZA 2WAQG 1SN8A 2IWHA 2EXDA 5LL6S 1AE3A 4ME5A 3X3NA 2K5NA 3RNUA 3NBHA 2WFWA 3TP7A 1BF4A 4IUQA 2VL6A 4LF4L 1EWIA 3S1QB 1HTLD 1O7ZA 4B3TQ 3Q8DA 3NQIA 5ELOA 4RCOA 2B3GA 2EYPA 2KEDA 3CW2C 2HIXA 2Z6KA 1L0YB 1XNQL 3W3AA 5BN5A 2EYOA 4G7ZC 3RZOH 4NDXA 2RDGA 1KXLA 3IAYA 3MC0B 2F0HA 1BQQT 3RMHA 4C1NI 1UWVA 4BBSG 5M5YB 1D2BA 5EAYA 1ILPA 3NWTA 3K5OA 3I73A 1CSPA 5JOBA 1KABA 2O4XA 1ESRA 5IYCH 1AZPA 4K14A 1WD1A 3P7JA 1WTPA 4L5SA 2F0WA 3HOWG 1PVOA 3NEMA 4KJOA 1N34Q 5FLMG 4A3GH 2KHJA 4HCEA 2R93B 1EYDA 1BCPB 4JI1L 1HNZQ 5JJIA 2QA4A 2A8VA 2J0TD 4L6TB 3G4SA 1VF7A 1HQMC 5DM73 3CCLA 4MTKA 3LNNA 2AQ3B 1L0XB 3STBC 4L63B 1AE2A 1NMFA 2Q8TA 3VYUA 1LT4D 3KDFB 2VQFL 5GAEC 1JWSD 4OXPA 2MHVA 4A3DB 2NB0A 1W3SA 1PRTF 3GTOB 3J80i 4CBVA 2B63B 4DV5Q 1D1IA 3TDQA 1D7QA 3M3YB 4TQUS 2J4XA 5BR8L 1C0AA 4DR1L 5D65A 2R7ZG 4WJ4A 4C3IB 1JB3A 5A35A 1KL9A 4GLVB 2D5DA 2PYKA 5CR3A 5L37A 4Y7NB 4C3JG 3F2DA 3S1NB 2A68C 4C56C 1DM0B 1SEBD 1R4PB 4C1NK 3BVZA 1PDQA 5IGFA 4IOCA 3CC2A 1JQYD 4CJ2C 1RTOA 2R92B 3H0GH 1S3OA 5M3MB 4PMCA 2LS01 3I7FA 1B9NA 1Y1VG 1TS5A 5G3LD 1S5FD 1JE4A 2JA6B 5IY0A 1PFMA 4A3LG 4K0KQ 2YV5A 5EKIA 4B9XA 3J80c 3CF5A 2QILA 4GN4B 2Z4HA 1B8AA 1YHBA 4B3RL 2EJFC 3S24A 3A5ZB 1EY7A 1G91A 3EQLC 1AZQA 4JI7Q 1FD7D 5M9OA 3SEBA 4EQOA 2VS1A 1G291 1XJVA 2A68D 3HOXG 1SNMA 1OTCA 5EGTA 3F2UA 4OO1I 4HJ9A 4OIKA 1JR0D 1X56A 4G4KA 2Q8RE 3CQZH 4LFAL 4YWKA 1KDAA 2NUCA 3CCRA 1PTOH 2JJQA 1ICFB 5EQ0A 3Q0AA 3MTSA 4IFDH 4FF2A 1RD9D 3JAML 1HR0L 3RLFA 2PMZE 3EBEA 4NP5A 2IW3A 3TBIB 2K14A 1PMRA 2CHBD 3T1YQ 1DXMA 1NNXA 1TQOA 3F2CA 1EWCA 3GTGB 3Q6SA 4QIWB 3NSWA 2E75C 2XNAC 2HDLA 3GV3A 1T5XD 4RHSA 1WCMH 2KCMA 2F0QA 4LUVA 1IL8A 1JOOA 4RG1A 4X66L 3J81i 4A3BH 1UE1A 2B2UA 4RA8A 5D14A 2KA7A 1BO0A 5CV6A 1HH2P 2CH4A 2F4VQ 1EY9A 3CKIB 1EOVA 4OWWB 2VNUD 4FF1A 1HNWL 3GTPH 1C9OA 2Q2UA 2Z4IA 1EQQA 3DEOA 5IYDH 2KCCA 4ABNA 2UXBQ 3HRZC 4JV5Q 2I0QA 3H3VH 3KF6B 5ELBA 1KRSA 3AYHB 5D3DA 2PW7A 1D6EC 2ZTDA 3U9SA 3PIPA 3A7AB 3J81j 5I2XA 4A3DG 1VQCA 2B2YC 1N32L 2B63G 4DK1A 4ID6A 2EY6A 1GVPA 1BBWA 1HNXL 4GOPB 1K3BC 1LABA 1I4QA 3J81c 2B2TC 2G9DA 4JI8Q 1YJWA 2F0SA 3MVVA 4B9WA 5I2YA 5KIXA 5C0XJ 5T1GA 2YTVA 5C4XH 2PNRC 3J7ZC 1I4XA 1JOQA 3U4VA 3PIP3 4BBRB 1VDZA 2GVBA 2B29A 3Q23A 1HFGA 1XNRL 2I5LX 3H09A 1YHAA 3A74A 1G8ZD 2KECA 5LMUQ 1DOKA 5DM63 3HOZH 1SMXA 5LHY1 4X3SA 4LFCQ 2R92G 1PRTD 1X3FA 1WYDA 1H9SB 5M3MG 1OXTA 2KHIA 4H44C 2I5HA 2NZOA 4GNXA 3S15H 5IT9E 1JMCA 4CGYB 3MZ5A 1MSGA 4X62L 5HURA 1I6HB 1C7YA 3HZXA 4RWSC 4TKOB 3CCQA 4KY6A 1PZJD 4UDUC 5JEAJ 5IWAQ 1KNAA 1CI3M 4TSSA 1RDPD 1PFNA 3PCOB 3BG3A 2KJXA 1HA5A 3TQYA 2M9VA 1V1QA 2MPMA 2UUCQ 3MFYA 2HUGA 2UXCQ 1WD0A 2XIWA 4R8NA 5FO9B 4JCVE 2CFMA 1STHA 1XTDA 3OYYA 1Y8PB 1P16A 4IUNA 3TSSA 1IYJB 1JWMD 2GN5A 2OTLA 3KF6A 4YCVA 4DAPA 1DONA 1SNOA 1X54A 2F0NA 1N9WA 3U50C 5C44B 1JE5A 3HEJA 5IGDA 5C0XG 1PH8A 3HOUH 5AJ3Q 1QNUA 1BKBA 1QE6A 4RKBA 1IHZA 4XQNA 2KQ3A 4A3FG 3ICEA 3M4PA 1SYBA 3T16A 1X3GA 3T56B 3E0JA 5KNBA 1BR9A 1YNJC 1QZGA 4DA2A 1NBWA 1LUZA 2H5XA 1S40A 1MSHA 1MJEA 4J1MA 1W2BA 3KFUA 1N33L 4A93H 2NYZD 1C8CA 2ALYB 1XYIA 1JWUD 1WOCA 2JSOA 5IP7G 2MJ8A 4DV4Q 3BJUA 1VQLA 4X64Q 1EY6A 5BN3A 2E2IH 2L5TA 2NWGA 1M4VA 5JEAG 1K83H 1B2TA 1XPOA 2XWJB 4JYAQ 2EYMA 3BU2A 4DR4Q 1VQNA 1YNND 5CBEE 1HZBA 1HQRD 1ZEQX 2ZM6Q 2XSCA 3UDGA 4H0LC 4DV0L 4B3SQ 1F9RA 3MXGA 2D9UA 4YCWA 2OQ0A 4CJ0B 3RN5A 1SFOH 2X69A 3GTMB 1Q8KA 3VR3A 5JJKA 1R9TH 1KAAA 1YIJA 1LM0A 3F1ZA 2BE5D 2CVRA 2ZTCA 3MXPA 3UE0A 4OO1H 2K52A 2NVXH 3L9AX 1YHQA 5FK9C 3VR5A 4BBRG 1A0IA 2EY5A 2UXCL 1O78A 4F88A 2K5HA 1E0BA 2E2HB 1SJED 4F87A 5KGUA 2XRQD 1FL0A 3L0OA 3CPFA 3SK6A 3GTKH 2DJFC 5ELFA 2BA1A 4K8IA 1CK1A 1F2LA 1AN8A 4DR3Q 1BCPD 1MKHA 2WACA 2B2UC 4YIJA 4X65Q 1SMYC 1HUMA 3FMCA 1YVCA 2WKCA 1S5BD 1T5EA 1NJIC 1XMOQ 3VR6A 1NSNS 2P5ZX 3A0JA 1G2SA 1F2MA 3NUCA 1E22A 3T51B 5E4XA 2D62A 1VQ4A 2E8GA 1JORA 4E6IA 1Q1BA 3GD7A 2CW0C 4YWMA 4BY1H 1LV9A 2NZHA 1M8AA 3DEPA 2NVTB 3J80E 2MO1A 1QB5D 5IGBA 3CC4A 5E4WC 1W6KA 1LTLA 4C2MH 5F2DA 4DUYQ 4KKTA 5E7NA 3OHXC 1IW7D 3PO3H 2CWAA 4UP9A 1CM9A 3EFXD 3IKJA 1X3EA 1IZ6A 5HY6A 1L2FA 4HIKA 4OL7A 4QY7A 5M5XB 1CTMA 2ZM6L 1JOKA 4BBSB 2LKVA 1U4PA 1XMQL 1PH1A 3GP7A 3NPPA 1SAPA 3QB3A 1NR2A 4A3EH 1B3AA 1VQJA 2EYHA 4UHVA 3BVGA 2JYOA 2F0FA 2UXDQ 1LTBD 1PRTB 1H9JA 2C35B 3CRKC 2LSSA 4HMIA 4DR5Q 1VQMA 3KBXA 1Q86C 4FXKC 2Q2HA 2UUAL 2A74C 4IURA 1VQIA 1YBYA 2BDNA 2MP1A 4JI0L 5IODA 4LF4Q 1EZ6A 1HZCA 1HZ9A 2DNEA 2K7VA 3NBHB 3O13A 3WWVA 1VQBA 5HGTA 1B7YB 2B2VC 4PZ8A 3WOEA 1XNQQ 1EWHA 2EYLA 2HIVA 3NWSA 5JJZA 4QL5A 3HOWH 4KY7A 1IBKQ 3HS0C 2NVYB 3R3OA 1Q12A 3C2PA 4OEMB 1C48A 3OWEB 3TP8A 4KY5A 1TWFB 1VMPA 3SK4A 1Q90A 4XQQA 2Y0SE 4K5XA 4DGZA 1AEXA 4DV1Q 4R4QA 4ALPA 2CKZB 2F0MA 4ZCKA 4K6LA 4AYBG 2O5JC 4LF8L 3KJPA 3VYRA 4NPSA 2R7ZB 1I5FA 1L1OC 1Y8NB 2E76C 1K8OA 3GTLH 3H3VC 4JI1Q 2L11A 2AUJD 4PMWA 5FJ8G 1OO9B 3GTJH 3PQIA 2A6EC 4A3KB 4DUYL 1GO3E 1EUJA 4JOIC 4K2LA 2CQOA 1V1PA 2EE1A 5K5PA 1ENCA 1CKOA 2ZJRA 1GKHA 4JW0A 1NE3A 3FKIB 3I4LA 4ZAIA 1GHJA 2VQFQ 1PV4A 2M00A 3G7LA 4RGOS 4P2CB 2QDLA 3V2TA 4C3JH 4LMQD 4R4OA 2RHQB 5IGCA 1ZYRC 2K5VA 2OTJA 3K59A 4OHJA 4FVMA 3K5LA 2WB1E 2VUMB 3B6YA 4A3IB 5J22A 4DR1Q 4BXXG 3A56A 3D4DA 4PZ6A 1FYCA 3TS2A 3NE5B 3TN2A 3CCSA 1PYWD 2B2YA 1L0WA 5JPMC 1NMGA 1UEBA 1UE7A 4HAEA 4UP7A 1I3QB 3S17B 2I5MX 3K81C 1AFPA 1SNPA 3HP3A 1H9RA 2B2TA 4OELB 4JG2A 2K50A 2O2LD 1QVFA 3QOJA 2G5DA 2NVQH 2C5CA 4XYQA 2JA5G 4A3JH 1IBKL 3RZOB 4HJAA 3HOXH 2TSSA 4WORA 5M3FB 1E24A 1F9SA 2ICEC 3WDNA 2XGTA 1NR4A 1XXGA 3S1QH 5BN4A 2EYJA 4KHZA 4DV1L 4DV3L 1HHVA 1ILQA 2YTXA 4B3RQ 3AFPA 2VW9A 2MGSA 4N8FA 1CZGA 1UAPA 2N49A 3RR5A 1PYBA 4A3CG 5M5YH 4XT1B 4KKUA 3W1BA 4H02A 5I9PA 1E3PA 4RFBA 3DXJC 3HOYB 3FPUB 2ES2A 4LFAQ 2Z6BA 1PH7A 1G51A 2RBMA 1XPUA 1J9OA 3A54A 5E3FA 4IUVA 1SE4A 5KYLA 2OXPA 3DHQA 5GAGC 1HR0Q 1FNUA 1SXTA 2EIFA 4JBJA 2R93H 3UDIA 2N78A 5JVG3 3MA2B 1IL2A 4JI6L 5LMNL 4LW1A 1TWHB 2NN6G 1KLUD 1CFMA 4YHHL 4A3MB 4HJ7A 1S5CD 3D0FA 3FHWA 3VDYA 2FMCA 4BA2I 3D3RA 2HT1A 1A3VA 1SROA 4MNOA 3IL8A 4IJLA 5FLXE 2WKDA 4X66Q 4NW2A 1VQHA 2ZXRA 2LXKA 4IUPA 3M4YA 2E5LL 3VA7A 5COYA 4A3DH 3FDTA 4GN5A 2AWOA 4KKSA 3GTOH 4FF4A 5IOCA 1HNWQ 3STBD 1VF5C 4A3KG 1S72A 3M3YH 1Y1WB 1TS4A 4MTNA 1CZWA 1SDFA 1II3A 2PMZB 5CV5A 4C3IH 2SDFA 3FKIG 1WTWA 5JVH3 1HR0W 3EA6A 3KBGA 2YU9B 4Y7NH 1VQKA 2Q2IA 3S1NH 3BYTB 5CC4A 1PZID 1N32Q 2V4DA 1F9QA 2F3IA 5KNCA 4YY3L 4DXFA 3KLRA 3K58A 3M7NA 5CV7A 2VUMG 5EJWA 3LX0A 4A3IG 1HNXQ 2JQOA 3RZDB 1XTCD 2EDGA 1PA6A 1JJ2A 1K0SA 1NUCA 3M4OB 2L1BA 3CAMA 2JA6H 4RGMA 1G6ZA 4IPDA 3OOCA 1CA6A 3PIOA 3I4NB 2QEXA 4EQNA 3R93A 4IQZA 1Y8OB 1XNRQ 3W5OA 1X55A 1FNVA 4DR2L 2ID0A 5CV4A 4DR7L 1OXXK 2E74C 5M3FG 2IX3A 2VZAA 4V0BA 3TZUA 1V9PA 1RJTA 4M1UB 1RTNA 3BS1A 4A3FB 4GNXB 4X62Q 5GADC 3PIO3 3CD6A 4DK0A 3TZDA 1V8QA 4LF9L 1VQ9A 4LAAA 1DZ1A 3QWNA 3TRZA 1KAWA 3KLSA 5EBCA 4A3GG 5DLQE 3GTGH 1ET9A 4DN4M 1U4MA 3HOYG 4Q0FA 1E2ZA 4JI4L 1Q82C 4APVA 5KNDA 1XPRA 3I55A 2GVAA 4DK3C 2KCTA 2QF7A 1Q8IA 4GKJL 2A69C 3FPPA 2XRSD 2BH8A 1K73C 3TS0A 4PZ7A 1UUPA 1GUWA 2DNCA 3TMEA 1PLFA 2CCZA 1RCVD 1RF2D 1QG7A 2E2JB 4H7BA 4R4TA 1VQFA 4DAVA 4HSVA 4IZ8A 1CSQA 4P74A 4A3MG 5IP7H 4I7AA 4DF7A 5JEAH 4CDDC 1FVIA 2KBNA 4P73A 4IFDJ 3J7AF 4GN3B 4C3HB 1YI2A 2F3VA 4QUFA 1O7YA 3MAQA 1EIYB 1N33Q 3HKZE 4GKKL 1LTAD 1I4HA 1A62A 3QR8A 1HUNA 3H6MA 4KTAA 1UE6A 2L15A 1IBML 1Y1WG 4A4IA 3JAMc 1SLJA 3LGJA 4F8MA 5KRUA 2FINB 3S1MB 1ENFA 4JBWA 1KTKA 2HDMA 3K0YA 5JAVA 3CC7A 3C1EA 4IPGA 1B53A 3AFQA 3GV6A 3UE1A 4DV0Q 4BBRH 2L9HA 3TP6A 2B2VA 3S14B 1WTOA 2K6AA 4ULLA 1SYCA 4LFBL 1JC7A 2JEAI 2QDBA 1PFBA 4N8X1 1KNEA 4LNQA 4KD4A 2PQEA 2DY8A 1CHPD 4N9TA 4ME3A 2PCFB 2F0TA 2F4IA 3I4NG 2KCNA 4DAYA 2NN6I 5FLXL 3R8BA 4QQBX 1I6HH 3BZKA 5C4JB 2OCEA 3CPWA 1PH4A 1E7ZA 5CYUA 3PF4A 3OMCA 5EKLA 5NUCA 2BDOA 1WFQA 1L1OA 1QUQA 4HJ8A 4LF6L 1XWEA 1TWGB 2KEEA 3I2ZA 4ZUJA 4XXEA 3N52A 1B70B 4IFDG 1O7IA 3CP0A 3G71A 3Q22A 1D5MC 2QGQA 4NXML 1RL2A 3CHBD 3NQTA 4JOIA 2A5HA 4DU9A 4QB4A 2A73B 1Q3LA 5JJLA 1N36L 1BBUA 3MEFA 1V43A 3L3OC 4RKLA 1O7LA 4DV2L 4JC0A 5C44H 1HPCA 3AMUA 4BY7B 3VYSA 1QCBD 1CUKA 2K75A 4J8QA 2KHSA 2LY7A 3ULPA 2Z8LA 1QILA 1PTOF 4P71A 2ICIA 3TEHB 4LF7L 4DXGA 4RGTA 2KUMA 2SNMA 4A75A 4QMGA 4JPBW 1K83B 2NZ1D 2F4VL 4QF4A 5HGQA 1B44D 3R2IA 4XYOA 1O80A 1TIID 4DV6L 5EPJA 4A76A 3S2HB 5I9OA 2K1BA 2B8GA 2R6GA 5ELDA 2JP1A 1XMQQ 2EOTA 4LF5L 1YNJD 3C1FA 4AH6A 2UUBL 2K4KA 5CGKA 2UU9L 1CKNA 1SFOB 3R2TA 4AYBB 3AB9A 5I4DA 1Z6HA 4KMUC 5LL6X 2XTIA 4Q5VA 4DKAC 5CMDA 1IYUA 4C3HG 5J3BA 2UUAQ 3M85A 5C4XG 4S3SA 1EY4A 3OTOL 2NVXB 2K05A 4JI5L 4JI0Q 2BA0A 2OWOA 1B50A 4HIMA 4QCLA 1TWAB 3GTMH 1I50B 2MQHA 4HIOA 1D5ZC 4IPHA 1VCIA 3I4MB 4KV6A 4IO9A 5C5MA 3MFGA 1SRUA 3E6ZX 4MIUA 1EYCA 1MJCA 3EROA 5FJ8H 4B08A 5CV9A 4NKLA 1U4RA 3VYTA 2E2HH 3DMUA 4XTCS 1JJGA 2IT1A 4LF8Q 3K7AB 1B9MA 1A6XA 1G2TA 2WP8J 2JN4A 3C3LA 2F0LA 4RHRA 1ZXTA 1JJCB 2FXQA 2L0CA 3PUWA 2PQAA 1PH2A 4BY1B 4B3ML 1DJRD 1E2WA 1YITA 3PO2B 1Q7YC 4FO2A 3DWPA 1K28A 2ZXOA 3SR1A 3K0XA 3T4AC 4BWGB 5C3EH 1TWCB 4DR6L 3PGZA 2JXMB 3H94A 4O0AA 2PZWA 3BVMA 4DUZL 4LK1C 4BXXH 2JA5B 1V1PB 4UAIA 2YTYA 1LTTD 4MHEA 2NVTH 2L12A 2Y0SB 1SMYD 4NXNQ 4ZK9B 4FP5D 1I4RA 1TVXA 3AU7A 3KYHC 2BOSA 5FO8B 1FNWA 3A55A 1IYVA 3CRLC 3E9IA 3S1RH 1PFSA 3S2DH 4A3EB 3A8IE 1BVSA 2JA8B 4LUZA 2R61A 1IKMA 5IT9L 2Q2TA 2CW0D 2WV6D 1GUGA 4WJWA 2OQKA 1DD2A 2KVMA 3EVQA 2DY7A 1PTOC 4BY7G 2EJMA 3NXWA 1KHIA 1MIUA 4BBSH 5M5WB 3IRBA 2D0OA 4JBKA 3EJIA 3PUYA 1QOHA 3A8JE 3GO5A 4IJHA 4ZQ3A 4EVOA 4HCSA 3LWEA 1SR3A 1C4QA 3RLOA 3D6WA 4R1JA 2IHEA 4JI2L 4POGA 3BYYB 3QOLA 3CCJA 1J5EL 5FLMH 3ITPA 2O5IC 1PH3A 2RVLA 2X6LA 4UP8A 2B2WC 5IYBG 2V1CC 5DAUA 2YYZA 4ODGA 2WB1B 2JA7B 2WAQE 1VQ8A 4DV3Q 1SYDA 3PUVA 5D3IB 4HIDA 4KJNA 4FNFA 4OIJA 4GLAC 3CCEA 1SE2A 3ND8A 3HOVB 2NVYH 3A8KE 3M7GA 3T1HL 4OX9L 1ESFA 4L8JA 3CCVA 3MXNA 3D8GA 2F3WA 3S16H 5C0XI 3DWQA 4U68A 3F8TA 1TWFH 3GTQB 3GTLB 2NN6H 2Z9HA 2IJ0A 3QG1A 2I07B 3PUZA 1PYSB 3J81E 1IKLA 1HRJA 2EY1A 4U673 1E1TA 1EEID 4L5QA 3QJYA 4FDBA 2XN9C 2A6HC 2R7ZH 3I4MG 2AKWB 5EPKA 1UEAB 1KDCA 1IBLL 2NBFA 2IY5B 1GOZA 4FXGC 4I7ZC 1S5DD 2DN8A 4JI6Q 3IFTA 3CMEA 5LMNQ 4NXNL 2RSNA 1SE8A 4YHHQ 5IP9G 2N3SA 3BZDB 3OPOA 1NCVA 2HCIA 2PZTA 4A3KH 3T53B 3HGBA 5C5LA 1Z7TA 1EEFD 3ZYYX 5C3WA 4M8AA 1QVGA 2EY2A 1DGSA 3FKIH 3A5UA 1X65A 1LTGD 1JB7A 4O2DA 1H9MA 2E5LQ 1Y1VH 4BY1G 4GZYC 1FR3A 3PO2G 2A6ED 2FMMA 3SVMA 4QUCA 4A3LH 1FJGL 3VA5A 2AMCB 3KLSX 2VUMH 1A15A 3SXHA 4A3IH 1NY4A 4ZRZA 3P20A 1TU2B 1YJNA 3PV0A 4V190 3OWFA 1STNA 4CDFC 1EYGA 1HXYD 2H1EA 2N8NA 4PV1C 2D2CC 4A3JB 1ZYRD 2Y0SG 2DUDA 1I3QH 1U4LA 3S17H 1VQDA 1FGUA 2WIIB 2XVSA 5LMNW 1SE3A 3K6OA 4YY3Q 4AQYL 1SYFA 3FVQA 2N55A 3SDZA 3E3XA 2QKIC 4A3EG 5EPLA 1F2YA 2RCNA 2JA8G 4QJFA 1B1ZA 3E5SA 3P1HA 4DV7L 1ICWA 2L55A 5FOBB 5M3FH 3FEWX 3NTHA 3VR2A 4ZUIA 1OXVA 1CT1D 2K5DA 3PF5A 4A3GB 1STAA 3GDEA 2Z0SA 5IGGA 2K01A 2R7FA 3OIPA 4DR2Q 1D8LA 1F2ZA 2IPKD 2SOBA 4K2KA 2MO0A 4DR7Q 2F1MA 4KHPL 3J80L 3NK9A 4JI3L 5J39A 2F0OA 4BS9A 2JK8A 4J15A 3ND9A 4DFAA 5IGEA 2JA7G 2WB1G 3HOYH 4P75A 4FF3A 4PNYA 4LWCA 2K5WA 3UI2A 4LF9Q 1J8IA 3LWUA 3MEHA 2LFNA 3UDXA 3HOVG 2B8FA 1RKNA 2AQ2B 1SYGA 2FFKB 3W2DA 2LMCB 1LTSD 4AIMA 4MN3A 5I6YA 1WTXA 1TS3A 5K36G 4ZYSA 1TWHH 4OONA 3H91A 4A3MH 4JI4Q 2FHTA 4KD3A 4R4IA 2B63H 1VS0A 2HHHL 4GKJQ 5IE8A 5CV8A 3M9BA 4JK1C 4OWTB 1HFNA 3H0GB 2EVBA 4LJZC 2G9HD 2D0PA 3ZJYC 2BCOA 2NTTA 3E0EA 3KOJA 1GXDC 1KDBA 2R7DA 1A2TA 3HG9A 1Y1WH 4CKEA 4CHTB 4B3TL 2F03A 1SNQA 2R92H 4P72A 3V05A 3J7AV 3EIVA 3PSIA 5M3MH 1A8VA 4IOAA 1KLGD 4PQXA 5IIFA 2H4OA 4RH6A 2YU9H 1LT5D 4ILWA 1TS2A 1GUOA 3GQBA 5ELCA 4GKKQ 1UNSA 2JE6I 3SGIA 5DNFA 1WVLA 1UE5A 2EYFA 4RCNA 3SK8A 2HCCA 2RA4A 1IBMQ 1AH9A 3NP8A 3U4ZA 3CQZB 1D1KA 1STBA 1Z9FA 3RZDH 1DOLA 1E1OA 2IHFA 4HSPA 1PTOB 1FGBD 1EYAA 5J1ZA 2JA9A 1Q1EA 4A3JG 3M4OH 4PMBA 1N34L 1TKWB 4DK6C 2GA4B 5JPNC 3OW7A 3OIQA 3J81L 3I4NH 1DCZA 5ISRA 1OXSC 1WI5A 4KN4C 1HNZL 1EY0A 1VQAA 1P8LA 1CKMA 4LFBQ 3JC66 3I70A 2K32A 2ZJPA 1VMCA 5GQOA 5IYCG 1WCMB 3QIAA 3KDFA 2K33A 1ASZA 2RF4A 5C0XH 3HKZB 3DM1A 4A3BB 1HCZA 1CHQD 4R4CA 4K6DA 1U0LA 4A3FH 1I94Q 4O1NA 4YWLA 2HQEA 4DAMA 2ZJQA 4MZ9A 3K80C 3SE0A 4DAYB 2VB2X 2RHSB 3KF8B 4DV5L 3GTPB 2EJGC 4LF6Q 2X6GA 5E1FA 2TMPA 3JAMi 1V1OA 2Z1CA 2AHOB 2F0VA 3OSOA 4X3TA 1L1OB 1EFID 1QUQB 2IX1A 5KEEA 2SEBD 4NXMQ 1EQTA 2R93G 4J6HA 2ASBA 1GJXA 1AW7A 2OT2A 2F0JA 1I4GA 2EQSA 4DNTB 4CJ1B 1N36Q 1ASYA 2PW5A 1YZ6A 1QJOA 1M90C 1SNCA 2MNAA 1ZKOA 1AP0A 5ELEA 3U9OA 3I72A 1J6QA 3G6EA 3C46A 1A3UA 4DV2Q 2VQEQ 1PHJA 3FRPB 3D4RA 4RMFA 3F2BA 3ULJA 5FKAC 4XT3B 2K28A 4HTHA 1PRTC 2E2JH 3NTIA 1LACA 1SNDA 5C4XB 2J7ZA 3NBIA 1KQSA 2L4NA 2SNSA 2DJGC 2A69D 4K0KL 4EQ5A 5A2QE 1Q46A 3U58A 4LF7Q 1QWYA 4QIWE 2F0UA 3CCUA 2CQAA 1N8RC 3HOZB 1BCPF 1BUVT 3H0GG 4IALA 1F77A 4C3IG 4N9PA 3RD4A 5AFWA 1GUSA 4BA1I 4C3HH 4DV6Q 4JI7L 1EU3A 2NTSA 2Z6KC 3HKSA 4DPGA 1BXTA 2DGYA 2QCPX 1T9HA 3S15B 3CU7A 4L5TA 4LF5Q 4CKCA 1BDOA 2UUBQ 1CQVA 2UU9Q 1K3RA 1PH5A 2MFIA 4FXDA 3ULLA 1EY5A 1WTHA 5FO7B 1TXYA 3S1MH 2PPBC 2F0PA 4ZKCB 1A63A 1CKNB 2ZT9C 2B2WA 1GHKA 3KUPA 3P75A 3S9WA 2N88A 1K8GA 4XIGS 3OTOQ 2RDFA 1GD7A 3T1YL 2JA6G 1VQEA 3KK7A 4JI5Q 1I94L 3S14H 3UDFA 2XWBB 3E9HA 3KF8A 1YJ9A 4X3KA 3I90A 1CQFA 3MXUA 1LLRD 1BBXC 4K5WA 1EU4A 3PUXA 1VQPA 2RKSA 1LTRD 2WINB 2KOLA 2CH4W 1H95A 4KHVA 3HOUB 2F0EA 3I8ZA 5C4JH 1EQVA 2AQ1B 1X6OA 3L7ZC 4XQJA 1ENAA 3PMFA 2RDHA 1X3PA 1TWGH 1ET6A 3FP9A 4DNIA 4RAUC 4WRDA 1WCMG 1KD1C 2UXBL 2VQEL 4JV5L 1EY8A 1NTGA 1DYQA 3HKZG 1EOTA 4EQPA 2F0IA 3K57A 4A3BG 4B3MQ 1JT8A 1Y14B 3A7LA 3OW2A 1YNNC 2PQAB 3N6RA 3WOFA 4X3UA 4JBMA 1PH6A 4A93B 1G6PA 1LT3D 1K8MA 1PXUA 4X6AH 2K04A 4KN7C 4CDEC 4POFA 4GOPA 3HFZB 4DR6Q 1EIGA 4DUZQ 2E2IB 3D4WA 5IYDG 1QZHA 4BY7H 3BZCA 3NENA 4JI8L 1LYLA 2F52A 4QGUA 4LUOA 4UPAA 4OWXB 1TT2A 1Q81C 1KIXA 5EBDA 1SSOA 4WJ3M 3AEVA 3MHBA 3SK5A 3ER0A 4HEDA 2BE5C 1ML0D 3VR4A 1F9PA 4EGVA 1WTRA 3TP5A 5LMUL 2R3ZA 1H9SA 1MHWC 1PH9A 4K8JA 4LFCL 3I56A 3EN2A 2FJ2A 3I3CA 1R9TB 3OMGA 2F0KA 5FLXc 3CCMA 4Y52H 2OF1A 1H9KA 3D6CA 3S2HH 5IYBH 3Q24A 1WTVA 1M1KC 1BCPC 4R9WA 3J7YW 2HD3A 4JI2Q 1YNXA 1Z47A 4CDCC 1TR5A 5C3XA 5C6AA 4WFN3 5IWAL 3CXCA 3HOZG 3KJOA 1JICA 1CA5A 1NAPA 1J5EQ 3GTKB 2ATWA 4KK7A 3L2PA 2ENBA 3DWAA 1MBYA 3DUZA 3QO2A 1GUTA 2UUCL 4KLKA 4RGNA 1TWAH 1LO5D 4KI0A 1EIFA 5I6WA 1VQ7A 1I50H 2PO4A 4Z9CB 1U5KA 1K9MC 1STYA 4TVAB 3J7A5 4G7HC 2K5QA 1JCKB 3T1HQ 1WTQA 1KRTA 3I4MH 2PZUA 4OX9Q 3G48A 1IW7C 1IXRA 1GUNA 2ZXPA 3MXNB 2PI2E 4H13C 5AJ3L 5IP9H 5DEHA 4OGQC 2A19A 4K5VA 5GROA 3DLLA 1R4QB 1X32A 1A3TA 4C2MB 3K7AH 5C3EB 1RIPA 1SBBB 5CBAE 3TREA 1HJPA 2F0DA 3AQQA 2IL8A 4AYBE 3PO3B 5T1IA 1DOMA 1SYEA 3X3MA 1IBLQ 5C4HA 5A2QL 4IUUA 4F7XA 2VB3X 2RSOA 2WAQB 3MWYW 2JEBI 4CKBA 4IN3A 3PO2H 3HOUG 4XDXA 5H1SE 1X3QA 1K0RA 1MI2A 4HR7B 2PNHA 2E2DC 4GLXA 1TWCH 3K8AA 4L5RC 4PG3A 3BDOA 4DV4L 3S1RB 4X64L 3S2DB 2VXWA 2PI2A 1RODA 2RCFA 2JA5H 5ELNA 5C44G 4JYAL 4DR4L 1WJJA 5M5XH 3K5MA 1A2UA 1MD2D 2VY3A 4IPCA 1QVCA 5CORA 1FJGQ 1K8AC 2A1AA 4B3SL 3M4QA 4A93G 5TSSA 2I46A 1X9NA 3K5NA 2JA8H 3H15A 2QEJC 1VQGA 4ZLTF 5GAHC 3W1GA 1YEZA 3V96A 4HMJA 2EZVA 3HOWB 4A3CH 1STGA 4GS3A 5M5WH 2QW7A 2F0GA
chains in the Genus database with same CATH topology
2EPBA 3ERQA 1BNZA 3T13A 1OXUA 5EKKA 1RHPA 1ONLA 1PTOD 4O42A 1LT6D 4NMZA 4ZKBB 2M2LA 1W6JA 4IFDI 1PZKD 5C4ZA 2K03A 3S16B 5KYIA 1B4OA 3RUZA 1S5ED 4OO1G 4TRDA 2Q8IB 4R8IA 3URYA 3GTJB 1I4PA 2B39A 3SHLA 1BOSA 1STEA 1LTID 2EXZA 1D5XC 4FYDA 5G3LF 1Y69U 1HA6A 1U9RA 3I91A 1EL0A 3ONAB 5K36H 1HTPA 2AWNA 4C3JB 4G57A 1TY0A 1XX8A 1SJHD 2MUYA 3NTKA 3JAME 1I6VC 3D31A 1EIHA 3NHHA 2AUKA 3BDLA 3BDCA 2OEOA 4HN7A 3G6JB 1Y1VB 2IX0A 3IFDA 2RQXA 4IUTA 2C9OA 2A6HD 1MGSA 1TY2A 4I65A 4DNRB 1E2VA 1EZ8A 2NVQB 3HOXB 1QNKA 4G7OC 1S4ZA 2IWHA 5LL6S 4ME5A 3X3NA 3NBHA 3TP7A 1BF4A 4IUQA 3S1QB 1HTLD 1O7ZA 3NQIA 4RCOA 2EYPA 2KEDA 1L0YB 3W3AA 5BN5A 2EYOA 4G7ZC 4NDXA 2RDGA 3IAYA 3MC0B 2F0HA 1BQQT 3RMHA 4C1NI 5M5YB 1D2BA 1ILPA 3NWTA 3K5OA 3I73A 5JOBA 1KABA 2O4XA 1ESRA 1AZPA 4K14A 1WD1A 3P7JA 1WTPA 2F0WA 4KJOA 4HCEA 2R93B 1EYDA 1BCPB 2J0TD 4L6TB 1VF7A 1HQMC 5DM73 3LNNA 2AQ3B 1L0XB 4L63B 2Q8TA 3VYUA 1LT4D 1JWSD 2MHVA 4A3DB 2NB0A 1PRTF 3GTOB 4CBVA 2B63B 1D1IA 3TDQA 3M3YB 4TQUS 2J4XA 5D65A 4C3IB 1JB3A 5A35A 2D5DA 2PYKA 5CR3A 4Y7NB 4C3JG 3S1NB 2A68C 4C56C 1DM0B 1SEBD 1R4PB 4C1NK 3BVZA 1PDQA 5IGFA 1JQYD 4CJ2C 1RTOA 2R92B 5M3MB 4PMCA 2LS01 1B9NA 1TS5A 5G3LD 1S5FD 1JE4A 2JA6B 1PFMA 5EKIA 4B9XA 2QILA 2Z4HA 2EJFC 1EY7A 1G91A 3EQLC 1AZQA 1FD7D 5M9OA 3SEBA 4EQOA 1G291 2A68D 1SNMA 5EGTA 3F2UA 4OO1I 4OIKA 1JR0D 4G4KA 2Q8RE 1KDAA 2NUCA 1PTOH 5EQ0A 3Q0AA 3MTSA 4IFDH 4FF2A 1RD9D 3JAML 3RLFA 4NP5A 2IW3A 3TBIB 1PMRA 2CHBD 1DXMA 1TQOA 1EWCA 3GTGB 3Q6SA 4QIWB 3NSWA 2E75C 2XNAC 2HDLA 3GV3A 1T5XD 4RHSA 2F0QA 1IL8A 1JOOA 2B2UA 4RA8A 5D14A 2KA7A 1BO0A 5CV6A 1EY9A 3CKIB 2VNUD 4FF1A 2Z4IA 3DEOA 2KCCA 4ABNA 3HRZC 5ELBA 5D3DA 2PW7A 1D6EC 3U9SA 3A7AB 5I2XA 2B2YC 4DK1A 4ID6A 2EY6A 1LABA 1I4QA 2B2TC 2G9DA 2F0SA 3MVVA 4B9WA 5I2YA 5KIXA 5C0XJ 5T1GA 2PNRC 1I4XA 1JOQA 3PIP3 4BBRB 1VDZA 3Q23A 1HFGA 3H09A 1G8ZD 2KECA 1DOKA 5DM63 5LHY1 4X3SA 1PRTD 1H9SB 1OXTA 4H44C 5IT9E 4CGYB 3MZ5A 1MSGA 5HURA 1I6HB 3HZXA 4RWSC 4TKOB 4KY6A 1PZJD 4UDUC 5JEAJ 1KNAA 1CI3M 4TSSA 1RDPD 1PFNA 3BG3A 2KJXA 1HA5A 2M9VA 2MPMA 3MFYA 2HUGA 1WD0A 2XIWA 4R8NA 5FO9B 1STHA 1Y8PB 4IUNA 3TSSA 1JWMD 4DAPA 1DONA 1SNOA 2F0NA 5C44B 3HEJA 5IGDA 5C0XG 1QNUA 4RKBA 1QE6A 1IHZA 4XQNA 2KQ3A 1SYBA 3T16A 3T56B 3E0JA 5KNBA 1BR9A 1YNJC 4DA2A 1MSHA 4J1MA 2NYZD 1C8CA 1XYIA 1JWUD 2JSOA 2MJ8A 1EY6A 5BN3A 2L5TA 2NWGA 1M4VA 5JEAG 1B2TA 2XWJB 2EYMA 1YNND 5CBEE 1HQRD 1ZEQX 2XSCA 4H0LC 1F9RA 3MXGA 2D9UA 4CJ0B 2X69A 3GTMB 3VR3A 1KAAA 2BE5D 2CVRA 3MXPA 4OO1H 3L9AX 5FK9C 3VR5A 2EY5A 1O78A 4F88A 1E0BA 2E2HB 1SJED 4F87A 5KGUA 2XRQD 3SK6A 5ELFA 2BA1A 4K8IA 1CK1A 1F2LA 1AN8A 1BCPD 2WACA 2B2UC 4YIJA 1SMYC 1HUMA 3FMCA 2WKCA 1S5BD 1T5EA 3VR6A 1NSNS 1G2SA 1F2MA 3NUCA 3T51B 5E4XA 2D62A 1JORA 4E6IA 1Q1BA 3GD7A 2CW0C 1LV9A 1M8AA 3DEPA 2NVTB 3J80E 1QB5D 5IGBA 5E4WC 1W6KA 5F2DA 4KKTA 3OHXC 1IW7D 1CM9A 3EFXD 3IKJA 4OL7A 5M5XB 1CTMA 1JOKA 4BBSB 2LKVA 1U4PA 3GP7A 3NPPA 1SAPA 3QB3A 1NR2A 1B3AA 2EYHA 3BVGA 2JYOA 2F0FA 1LTBD 1PRTB 1H9JA 3CRKC 4HMIA 3KBXA 4FXKC 2A74C 4IURA 2MP1A 2BDNA 5IODA 1EZ6A 2DNEA 2K7VA 3O13A 5HGTA 2B2VC 3WOEA 1EWHA 2EYLA 3NWSA 5JJZA 4KY7A 3HS0C 2NVYB 3R3OA 1Q12A 3C2PA 1C48A 3OWEB 3TP8A 4KY5A 1TWFB 1VMPA 3SK4A 1Q90A 4XQQA 4K5XA 4DGZA 1AEXA 2F0MA 4K6LA 2O5JC 3VYRA 2R7ZB 2E76C 1Y8NB 1K8OA 3H3VC 2L11A 2AUJD 4PMWA 1OO9B 2A6EC 4A3KB 4K2LA 1V1PA 2EE1A 5K5PA 1ENCA 3FKIB 3I4LA 4ZAIA 1GHJA 2M00A 3G7LA 4RGOS 4P2CB 3V2TA 4LMQD 5IGCA 1ZYRC 3K59A 4OHJA 4FVMA 3K5LA 2VUMB 4A3IB 5J22A 3A56A 3D4DA 1FYCA 3NE5B 3TN2A 1PYWD 2B2YA 5JPMC 4HAEA 1I3QB 3S17B 1AFPA 1SNPA 3HP3A 1H9RA 2B2TA 2O2LD 3QOJA 2C5CA 4XYQA 3RZOB 2TSSA 4WORA 5M3FB 1F9SA 2ICEC 3WDNA 1NR4A 1XXGA 5BN4A 2EYJA 4KHZA 1HHVA 1ILQA 2MGSA 1CZGA 1UAPA 4XT1B 4KKUA 5I9PA 4RFBA 3DXJC 3HOYB 3FPUB 2RBMA 1J9OA 3A54A 5E3FA 4IUVA 1SE4A 5KYLA 2OXPA 3DHQA 1FNUA 1SXTA 5JVG3 3MA2B 1TWHB 2NN6G 1KLUD 1CFMA 4A3MB 1S5CD 2FMCA 4BA2I 3D3RA 1A3VA 3IL8A 5FLXE 2WKDA 4NW2A 2ZXRA 4IUPA 3M4YA 3VA7A 5COYA 3FDTA 2AWOA 4KKSA 4FF4A 5IOCA 1VF5C 1Y1WB 1TS4A 1CZWA 1SDFA 1II3A 2PMZB 5CV5A 2SDFA 1WTWA 5JVH3 3EA6A 3KBGA 2YU9B 3BYTB 5CC4A 1PZID 2V4DA 1F9QA 5KNCA 4DXFA 3KLRA 3K58A 3M7NA 5CV7A 5EJWA 3LX0A 3RZDB 1XTCD 2EDGA 1NUCA 3M4OB 2L1BA 4RGMA 1G6ZA 3OOCA 1CA6A 3I4NB 4EQNA 3R93A 4IQZA 1Y8OB 1FNVA 2ID0A 5CV4A 1OXXK 2E74C 2IX3A 4V0BA 3TZUA 1RJTA 4M1UB 1RTNA 3BS1A 4A3FB 3PIO3 4DK0A 3TZDA 1V8QA 4LAAA 1DZ1A 3QWNA 3KLSA 5EBCA 1ET9A 4DN4M 1U4MA 4Q0FA 1E2ZA 5KNDA 2QF7A 1Q8IA 2A69C 3FPPA 2XRSD 1UUPA 1GUWA 2DNCA 3TMEA 1PLFA 1RCVD 1RF2D 1QG7A 2E2JB 4H7BA 4DAVA 4HSVA 4IZ8A 4DF7A 5JEAH 4IFDJ 3J7AF 4C3HB 2F3VA 4QUFA 1O7YA 3MAQA 1LTAD 1I4HA 1HUNA 3H6MA 4KTAA 4F8MA 5KRUA 2FINB 3S1MB 1ENFA 4JBWA 1KTKA 2HDMA 3K0YA 5JAVA 3C1EA 1B53A 3GV6A 2L9HA 3TP6A 2B2VA 3S14B 1WTOA 2K6AA 4ULLA 1SYCA 1JC7A 2JEAI 2QDBA 1PFBA 1KNEA 4KD4A 2PQEA 2DY8A 1CHPD 4N9TA 2PCFB 2F0TA 2F4IA 2KCNA 4DAYA 2NN6I 5FLXL 3R8BA 5C4JB 5CYUA 3OMCA 5EKLA 5NUCA 2BDOA 1XWEA 1TWGB 2KEEA 4ZUJA 4XXEA 3N52A 4IFDG 3Q22A 1D5MC 3CHBD 3NQTA 2A5HA 4DU9A 4QB4A 2A73B 1Q3LA 1V43A 3L3OC 4RKLA 1O7LA 1HPCA 3AMUA 4BY7B 3VYSA 1QCBD 4J8QA 2KHSA 2LY7A 2Z8LA 1QILA 1PTOF 2ICIA 4DXGA 4RGTA 2KUMA 2SNMA 4QMGA 1K83B 2NZ1D 4QF4A 1B44D 3R2IA 4XYOA 1O80A 1TIID 5EPJA 3S2HB 5I9OA 2K1BA 2B8GA 2R6GA 5ELDA 2JP1A 2EOTA 1YNJD 3C1FA 5CGKA 1SFOB 3R2TA 4AYBB 3AB9A 5I4DA 1Z6HA 4KMUC 5LL6X 4Q5VA 5CMDA 1IYUA 4C3HG 3M85A 4S3SA 1EY4A 2NVXB 2K05A 2BA0A 1B50A 4QCLA 1TWAB 1I50B 1D5ZC 1VCIA 3I4MB 4KV6A 5C5MA 3MFGA 3E6ZX 4MIUA 1EYCA 3EROA 4B08A 5CV9A 4NKLA 1U4RA 3VYTA 3DMUA 4XTCS 2IT1A 3K7AB 1B9MA 1A6XA 1G2TA 2WP8J 3C3LA 2F0LA 4RHRA 1ZXTA 2L0CA 3PUWA 4BY1B 1DJRD 1E2WA 3PO2B 4FO2A 3DWPA 2ZXOA 3SR1A 3T4AC 4BWGB 1TWCB 2JXMB 3H94A 2PZWA 3BVMA 4LK1C 2JA5B 1V1PB 4UAIA 1LTTD 4MHEA 2L12A 2Y0SB 1SMYD 4ZK9B 4FP5D 1I4RA 1TVXA 3AU7A 2BOSA 5FO8B 1FNWA 3A55A 1IYVA 3CRLC 4A3EB 3A8IE 2JA8B 2R61A 1IKMA 5IT9L 2CW0D 2WV6D 1GUGA 4WJWA 1DD2A 2KVMA 3EVQA 2DY7A 1PTOC 2EJMA 3NXWA 5M5WB 3EJIA 3PUYA 1QOHA 3A8JE 3GO5A 4ZQ3A 4EVOA 4HCSA 3LWEA 1C4QA 3D6WA 3BYYB 3QOLA 3ITPA 2O5IC 2RVLA 2X6LA 2B2WC 5DAUA 2YYZA 4ODGA 2WB1B 2JA7B 1SYDA 3PUVA 5D3IB 4KJNA 4FNFA 4OIJA 1SE2A 3ND8A 3HOVB 3A8KE 3M7GA 1ESFA 4L8JA 3MXNA 3D8GA 2F3WA 5C0XI 3DWQA 4U68A 3GTQB 3GTLB 2NN6H 2IJ0A 3QG1A 2I07B 3PUZA 3J81E 1IKLA 1HRJA 2EY1A 4U673 1EEID 3QJYA 2XN9C 2A6HC 5EPKA 1UEAB 1KDCA 2NBFA 1GOZA 4FXGC 4I7ZC 1S5DD 2DN8A 3IFTA 2RSNA 3BZDB 3OPOA 1NCVA 2HCIA 2PZTA 3T53B 3HGBA 5C5LA 1Z7TA 1EEFD 3ZYYX 5C3WA 4M8AA 2EY2A 1LTGD 1H9MA 4GZYC 1FR3A 2A6ED 2FMMA 3SVMA 4QUCA 3VA5A 3KLSX 1A15A 3SXHA 4ZRZA 3P20A 1TU2B 3PV0A 4V190 3OWFA 1STNA 1HXYD 2H1EA 4PV1C 2D2CC 4A3JB 1ZYRD 1U4LA 2WIIB 2XVSA 1SE3A 3K6OA 1SYFA 3FVQA 2N55A 3SDZA 2QKIC 5EPLA 1F2YA 1B1ZA 3E5SA 3P1HA 1ICWA 2L55A 5FOBB 3FEWX 3NTHA 3VR2A 4ZUIA 1OXVA 1CT1D 2K5DA 4A3GB 1STAA 5IGGA 2K01A 3OIPA 2SOBA 1F2ZA 2IPKD 4K2KA 2F1MA 3J80L 3NK9A 5J39A 2F0OA 4BS9A 3ND9A 4DFAA 5IGEA 4FF3A 4PNYA 2K5WA 3UI2A 1J8IA 3LWUA 3MEHA 2LFNA 2B8FA 1RKNA 2AQ2B 1SYGA 2FFKB 3W2DA 2LMCB 1LTSD 4MN3A 5I6YA 1WTXA 1TS3A 5K36G 4ZYSA 3H91A 2FHTA 4KD3A 5CV8A 4JK1C 1HFNA 3H0GB 2EVBA 4LJZC 2G9HD 2BCOA 2NTTA 1GXDC 1KDBA 1A2TA 3HG9A 4CKEA 4CHTB 2F03A 1SNQA 3V05A 3J7AV 1KLGD 4PQXA 5IIFA 2H4OA 4RH6A 1LT5D 4ILWA 1TS2A 1GUOA 3GQBA 5ELCA 1UNSA 2JE6I 5DNFA 1WVLA 2EYFA 4RCNA 3SK8A 2HCCA 2RA4A 3NP8A 3CQZB 1D1KA 1STBA 1DOLA 4HSPA 1PTOB 1FGBD 1EYAA 5J1ZA 1Q1EA 4PMBA 1TKWB 2GA4B 5JPNC 3OW7A 3OIQA 3J81L 1DCZA 5ISRA 1OXSC 4KN4C 1EY0A 3I70A 2K32A 1VMCA 1WCMB 3QIAA 2K33A 5C0XH 3HKZB 3DM1A 4A3BB 1HCZA 1CHQD 4K6DA 4O1NA 2HQEA 3SE0A 2VB2X 3GTPB 2EJGC 2X6GA 5E1FA 2TMPA 1V1OA 2Z1CA 2F0VA 3OSOA 4X3TA 1EFID 2IX1A 5KEEA 2SEBD 1EQTA 4J6HA 1GJXA 1AW7A 2OT2A 2F0JA 1I4GA 4DNTB 4CJ1B 2PW5A 1QJOA 1SNCA 1ZKOA 1AP0A 5ELEA 3U9OA 3I72A 3C46A 1A3UA 3FRPB 3D4RA 5FKAC 4XT3B 2K28A 4HTHA 1PRTC 3NTIA 1LACA 1SNDA 5C4XB 2J7ZA 3NBIA 2L4NA 2SNSA 2A69D 5A2QE 1QWYA 2F0UA 2CQAA 3HOZB 1BCPF 1BUVT 4IALA 4C3IG 1F77A 4N9PA 3RD4A 5AFWA 1GUSA 4BA1I 1EU3A 2NTSA 1BXTA 2QCPX 3S15B 3CU7A 4CKCA 1BDOA 1CQVA 4FXDA 1EY5A 5FO7B 2PPBC 2F0PA 4ZKCB 2ZT9C 2B2WA 1GHKA 3KUPA 3P75A 3S9WA 2N88A 4XIGS 2RDFA 3KK7A 2XWBB 3KF8A 4X3KA 3I90A 1CQFA 3MXUA 1LLRD 1BBXC 4K5WA 1EU4A 3PUXA 2RKSA 1LTRD 2WINB 2KOLA 4KHVA 3HOUB 2F0EA 3I8ZA 1EQVA 2AQ1B 3L7ZC 4XQJA 1ENAA 3PMFA 2RDHA 1X3PA 1ET6A 4RAUC 4WRDA 1EY8A 4EQPA 1DYQA 1EOTA 3K57A 2F0IA 3A7LA 1YNNC 3N6RA 3WOFA 4X3UA 4A93B 1LT3D 1K8MA 1PXUA 2K04A 4KN7C 1EIGA 2E2IB 3D4WA 1TT2A 5EBDA 1SSOA 3MHBA 3SK5A 4HEDA 2BE5C 1ML0D 3VR4A 1F9PA 4EGVA 1WTRA 3TP5A 2R3ZA 1H9SA 4K8JA 2FJ2A 3I3CA 1R9TB 3OMGA 2F0KA 2OF1A 1H9KA 3D6CA 3Q24A 1WTVA 1BCPC 4R9WA 3J7YW 5C3XA 1Z47A 4WFN3 1TR5A 5C6AA 1JICA 1CA5A 1NAPA 3GTKB 4KK7A 2ENBA 3DWAA 1MBYA 1GUTA 3QO2A 3DUZA 4RGNA 4KI0A 1LO5D 5I6WA 4Z9CB 2PO4A 1STYA 4G7HC 2K5QA 1JCKB 1WTQA 2PZUA 1IW7C 1GUNA 2ZXPA 4H13C 5DEHA 4OGQC 4K5VA 1R4QB 1X32A 1A3TA 4C2MB 5C3EB 1SBBB 5CBAE 2F0DA 2IL8A 3PO3B 5T1IA 1DOMA 1SYEA 3X3MA 5C4HA 5A2QL 4IUUA 4F7XA 2VB3X 2RSOA 2WAQB 3MWYW 2JEBI 4CKBA 4IN3A 4XDXA 1X3QA 1MI2A 4HR7B 2E2DC 3BDOA 3S1RB 3S2DB 2VXWA 1RODA 3K5MA 1A2UA 1MD2D 5CORA 5TSSA 2I46A 3K5NA 2QEJC 4ZLTF 3V96A 4HMJA 2EZVA 3HOWB 1STGA 2F0GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J39 A;  2EYO A;  4DU9 A;  4OL7 A;  2F0S A;  2F0L A;  4QB4 A;  1TR5 A;  3MVV A;  4NDX A;  4B9X A;  4B9W A;  2RDF A;  2F0O A;  5C6A A;  3ERQ A;  5KIX A;  1JOK A;  5J22 A;  1EY6 A;  2LKV A;  3T13 A;  2EY1 A;  4DFA A;  5EKK A;  5IOC A;  3TME A;  5IGE A;  2F0H A;  3D4D A;  1JOQ A;  4RKL A;  4PNY A;  2EYM A;  3QB3 A;  1EY7 A;  4NMZ A;  4H7B A;  2ENB A;  2EYH A;  1KDC A;  4IZ8 A;  5M9O A;  3SR1 A;  3MEH A;  1II3 A;  4K6D A;  5CV5 A;  4EQO A;  2F0F A;  5JOB A;  1KAB A;  1SNM A;  2HQE A;  2KHS A;  5I6W A;  4K5W A;  1RKN A;  5EGT A;  2O4X A;  1SNP A;  5C4Z A;  1STY A;  4HMI A;  1SYG A;  4DF7 A;  2RKS A;  2PZW A;  5KYI A;  4K14 A;  3RUZ A;  4TRD A;  2PZT A;  4KHV A;  5CC4 A;  3QOJ A;  3NQT A;  2F0W A;  2PZU A;  5E1F A;  5I6Y A;  2F0E A;  1KDA A;  4KJO A;  5C5L A;  2NUC A;  1EQV A;  3SHL A;  5C3W A;  2F0V A;  3OSO A;  2EY2 A;  5CV7 A;  5IOD A;  3MZ5 A;  1ENA A;  1EZ6 A;  1KAA A;  2F3V A;  1EYD A;  2SNM A;  3LX0 A;  3PMF A;  4WOR A;  4KD3 A;  5KEE A;  5HUR A;  2EXZ A;  4QMG A;  5HGT A;  3HZX A;  4J6H A;  1U9R A;  3MXP A;  3H6M A;  4KTA A;  2EYL A;  2F0J A;  4QF4 A;  4WRD A;  5DEH A;  4KY6 A;  1NUC A;  4NP5 A;  4K5V A;  4KY7 A;  1JOR A;  2EYJ A;  5CV8 A;  1EY8 A;  4EQP A;  2EY5 A;  1TQO A;  5I9O A;  1A3T A;  2F0I A;  3R3O A;  2PW5 A;  3VA5 A;  3EVQ A;  1SNC A;  4G57 A;  4F8M A;  5KRU A;  3SXH A;  3NXW A;  2F0D A;  3TP8 A;  3U9O A;  4EQN A;  4KY5 A;  3SK4 A;  5KGU A;  1A3U A;  3C1F A;  5JAV A;  1SYE A;  4K5X A;  5C4H A;  5CGK A;  1KDB A;  3OWF A;  1STN A;  1A2T A;  3C1E A;  1AEX A;  3SK6 A;  4DGZ A;  4F7X A;  2F0Q A;  1JOO A;  2F0M A;  5C3X A;  4K8I A;  4HTH A;  4R8N A;  3TP6 A;  3EJI A;  3NHH A;  5CV4 A;  4ZQ3 A;  1SND A;  1STH A;  4EVO A;  3BDL A;  5I9P A;  4IUN A;  3D4W A;  1SNQ A;  1SYC A;  3BDC A;  2WAC A;  2SNS A;  2OEO A;  5CV6 A;  4YIJ A;  4S3S A;  1EY4 A;  1EY9 A;  2QDB A;  1SYF A;  1SNO A;  2F0N A;  1TT2 A;  5IIF A;  3QOL A;  2RBM A;  2F0U A;  3HEJ A;  5IGD A;  5E3F A;  3MHB A;  3ITP A;  1NSN S;  2PQE A;  4KD4 A;  4RKB A;  3SK5 A;  1F2Y A;  5KYL A;  1F2M A;  1IHZ A;  2OXP A;  3DHQ A;  3NUC A;  4N9T A;  2KQ3 A;  4IAL A;  2EYF A;  4N9P A;  5DAU A;  2F0T A;  2PYK A;  3E5S A;  3P1H A;  4I65 A;  4ODG A;  1SYB A;  1A2U A;  5CR3 A;  3SK8 A;  3NP8 A;  3TP5 A;  1SYD A;  4KV6 A;  4LAA A;  4ZUI A;  1STB A;  4K2L A;  5C5M A;  1EZ8 A;  4K8J A;  4KJN A;  3T16 A;  5IGF A;  5K5P A;  1ENC A;  2PW7 A;  1STA A;  4MIU A;  1EYA A;  5J1Z A;  1EYC A;  3ERO A;  3OMC A;  3OMG A;  5EKL A;  5NUC A;  2F0K A;  5IGB A;  4ME5 A;  2OF1 A;  3D6C A;  5CV9 A;  1A3V A;  2M00 A;  4PMB A;  4J1M A;  5F2D A;  4NKL A;  5IGG A;  3S9W A;  3D8G A;  2F3W A;  3V2T A;  1EY5 A;  3TP7 A;  4ZUJ A;  4E6I A;  3DMU A;  4PMC A;  2SOB A;  1F2Z A;  4K2K A;  2F0P A;  5IGC A;  5ISR A;  4HMJ A;  4ID6 A;  1STG A;  2EY6 A;  1EY0 A;  2EYP A;  3NK9 A;  3P75 A;  2F0G A; 
#chains in the Genus database with same CATH topology
 3I4O A;  2EPB A;  4AQY Q;  2HQL A;  3ERQ A;  1BNZ A;  3T13 A;  1OXU A;  4GNX C;  5EKK A;  1RHP A;  2KEN A;  1ONL A;  1PTO D;  4NB3 A;  4O42 A;  3K7U C;  1LT6 D;  4NMZ A;  4ZKB B;  2M2L A;  3ERS X;  4DV7 Q;  1W6J A;  4IFD I;  1PZK D;  5C4Z A;  2K03 A;  3S16 B;  4DR3 L;  5KYI A;  1B4O A;  2JA7 H;  3RUZ A;  1S5E D;  4OO1 G;  4TRD A;  2Q8I B;  4R8I A;  4JVZ A;  3URY A;  4X65 L;  1I4P A;  3GTJ B;  2B39 A;  3SHL A;  4EX5 A;  1BOS A;  1STE A;  1XMO L;  3RN2 A;  3HOV H;  4KHP Q;  1LTI D;  2LXJ A;  2EXZ A;  1D5X C;  4FYD A;  5G3L F;  1Y69 U;  1HA6 A;  1U9R A;  3CMA A;  3I91 A;  2BH2 A;  4JI3 Q;  1EL0 A;  3ONA B;  1EFW A;  5K36 H;  1VQ6 A;  3GTQ H;  3DM3 A;  1KC8 C;  1HTP A;  2AWN A;  1HZA A;  4C3J B;  4G57 A;  1VQ5 A;  1TY0 A;  1XX8 A;  1SJH D;  2MUY A;  3NTK A;  5IT9 c;  3JAM E;  1I6V C;  3D31 A;  1EIH A;  3NHH A;  2AUK A;  2CWP A;  3NEL A;  3BDL A;  4UY8 C;  4GOP C;  3BDC A;  3H3V I;  3RLN A;  4YCU A;  2OEO A;  4HN7 A;  3G6J B;  1Y1V B;  2IX0 A;  3IFD A;  1GM5 A;  2RQX A;  4HJ5 A;  3KLW A;  4IUT A;  2C9O A;  1B3Q A;  2HHH Q;  2A6H D;  5C3E G;  1MGS A;  1TY2 A;  4I65 A;  1EQR A;  5BR8 Q;  1VQO A;  4DNR B;  1E2V A;  3PO3 G;  2UXD L;  1EZ8 A;  2NVQ B;  4DR5 L;  2ZTE A;  3HOX B;  1QNK A;  4G7O C;  1S4Z A;  2WAQ G;  1SN8 A;  2IWH A;  2EXD A;  5LL6 S;  1AE3 A;  4ME5 A;  3X3N A;  2K5N A;  3RNU A;  3NBH A;  2WFW A;  3TP7 A;  1BF4 A;  4IUQ A;  2VL6 A;  4LF4 L;  1EWI A;  3S1Q B;  1HTL D;  1O7Z A;  4B3T Q;  3Q8D A;  3NQI A;  5ELO A;  4RCO A;  2B3G A;  2EYP A;  2KED A;  3CW2 C;  2HIX A;  2Z6K A;  1L0Y B;  1XNQ L;  3W3A A;  5BN5 A;  2EYO A;  4G7Z C;  3RZO H;  4NDX A;  2RDG A;  1KXL A;  3IAY A;  3MC0 B;  2F0H A;  1BQQ T;  3RMH A;  4C1N I;  1UWV A;  4BBS G;  5M5Y B;  1D2B A;  5EAY A;  1ILP A;  3NWT A;  3K5O A;  3I73 A;  1CSP A;  5JOB A;  1KAB A;  2O4X A;  1ESR A;  5IYC H;  1AZP A;  4K14 A;  1WD1 A;  3P7J A;  1WTP A;  4L5S A;  2F0W A;  3HOW G;  1PVO A;  3NEM A;  4KJO A;  1N34 Q;  5FLM G;  4A3G H;  2KHJ A;  4HCE A;  2R93 B;  1EYD A;  1BCP B;  4JI1 L;  1HNZ Q;  5JJI A;  2QA4 A;  2A8V A;  2J0T D;  4L6T B;  3G4S A;  1VF7 A;  1HQM C;  5DM7 3;  3CCL A;  4MTK A;  3LNN A;  2AQ3 B;  1L0X B;  3STB C;  4L63 B;  1AE2 A;  1NMF A;  2Q8T A;  3VYU A;  1LT4 D;  3KDF B;  2VQF L;  5GAE C;  1JWS D;  4OXP A;  2MHV A;  4A3D B;  2NB0 A;  1W3S A;  1PRT F;  3GTO B;  3J80 i;  4CBV A;  2B63 B;  4DV5 Q;  1D1I A;  3TDQ A;  1D7Q A;  3M3Y B;  4TQU S;  2J4X A;  5BR8 L;  1C0A A;  4DR1 L;  5D65 A;  2R7Z G;  4WJ4 A;  4C3I B;  1JB3 A;  5A35 A;  1KL9 A;  4GLV B;  2D5D A;  2PYK A;  5CR3 A;  5L37 A;  4Y7N B;  4C3J G;  3F2D A;  3S1N B;  2A68 C;  4C56 C;  1DM0 B;  1SEB D;  1R4P B;  4C1N K;  3BVZ A;  1PDQ A;  5IGF A;  4IOC A;  3CC2 A;  1JQY D;  4CJ2 C;  1RTO A;  2R92 B;  3H0G H;  1S3O A;  5M3M B;  4PMC A;  2LS0 1;  3I7F A;  1B9N A;  1Y1V G;  1TS5 A;  5G3L D;  1S5F D;  1JE4 A;  2JA6 B;  5IY0 A;  1PFM A;  4A3L G;  4K0K Q;  2YV5 A;  5EKI A;  4B9X A;  3J80 c;  3CF5 A;  2QIL A;  4GN4 B;  2Z4H A;  1B8A A;  1YHB A;  4B3R L;  2EJF C;  3S24 A;  3A5Z B;  1EY7 A;  1G91 A;  3EQL C;  1AZQ A;  4JI7 Q;  1FD7 D;  5M9O A;  3SEB A;  4EQO A;  2VS1 A;  1G29 1;  1XJV A;  2A68 D;  3HOX G;  1SNM A;  1OTC A;  5EGT A;  3F2U A;  4OO1 I;  4HJ9 A;  4OIK A;  1JR0 D;  1X56 A;  4G4K A;  2Q8R E;  3CQZ H;  4LFA L;  4YWK A;  1KDA A;  2NUC A;  3CCR A;  1PTO H;  2JJQ A;  1ICF B;  5EQ0 A;  3Q0A A;  3MTS A;  4IFD H;  4FF2 A;  1RD9 D;  3JAM L;  1HR0 L;  3RLF A;  2PMZ E;  3EBE A;  4NP5 A;  2IW3 A;  3TBI B;  2K14 A;  1PMR A;  2CHB D;  3T1Y Q;  1DXM A;  1NNX A;  1TQO A;  3F2C A;  1EWC A;  3GTG B;  3Q6S A;  4QIW B;  3NSW A;  2E75 C;  2XNA C;  2HDL A;  3GV3 A;  1T5X D;  4RHS A;  1WCM H;  2KCM A;  2F0Q A;  4LUV A;  1IL8 A;  1JOO A;  4RG1 A;  4X66 L;  3J81 i;  4A3B H;  1UE1 A;  2B2U A;  4RA8 A;  5D14 A;  2KA7 A;  1BO0 A;  5CV6 A;  1HH2 P;  2CH4 A;  2F4V Q;  1EY9 A;  3CKI B;  1EOV A;  4OWW B;  2VNU D;  4FF1 A;  1HNW L;  3GTP H;  1C9O A;  2Q2U A;  2Z4I A;  1EQQ A;  3DEO A;  5IYD H;  2KCC A;  4ABN A;  2UXB Q;  3HRZ C;  4JV5 Q;  2I0Q A;  3H3V H;  3KF6 B;  5ELB A;  1KRS A;  3AYH B;  5D3D A;  2PW7 A;  1D6E C;  2ZTD A;  3U9S A;  3PIP A;  3A7A B;  3J81 j;  5I2X A;  4A3D G;  1VQC A;  2B2Y C;  1N32 L;  2B63 G;  4DK1 A;  4ID6 A;  2EY6 A;  1GVP A;  1BBW A;  1HNX L;  4GOP B;  1K3B C;  1LAB A;  1I4Q A;  3J81 c;  2B2T C;  2G9D A;  4JI8 Q;  1YJW A;  2F0S A;  3MVV A;  4B9W A;  5I2Y A;  5KIX A;  5C0X J;  5T1G A;  2YTV A;  5C4X H;  2PNR C;  3J7Z C;  1I4X A;  1JOQ A;  3U4V A;  3PIP 3;  4BBR B;  1VDZ A;  2GVB A;  2B29 A;  3Q23 A;  1HFG A;  1XNR L;  2I5L X;  3H09 A;  1YHA A;  3A74 A;  1G8Z D;  2KEC A;  5LMU Q;  1DOK A;  5DM6 3;  3HOZ H;  1SMX A;  5LHY 1;  4X3S A;  4LFC Q;  2R92 G;  1PRT D;  1X3F A;  1WYD A;  1H9S B;  5M3M G;  1OXT A;  2KHI A;  4H44 C;  2I5H A;  2NZO A;  4GNX A;  3S15 H;  5IT9 E;  1JMC A;  4CGY B;  3MZ5 A;  1MSG A;  4X62 L;  5HUR A;  1I6H B;  1C7Y A;  3HZX A;  4RWS C;  4TKO B;  3CCQ A;  4KY6 A;  1PZJ D;  4UDU C;  5JEA J;  5IWA Q;  1KNA A;  1CI3 M;  4TSS A;  1RDP D;  1PFN A;  3PCO B;  3BG3 A;  2KJX A;  1HA5 A;  3TQY A;  2M9V A;  1V1Q A;  2MPM A;  2UUC Q;  3MFY A;  2HUG A;  2UXC Q;  1WD0 A;  2XIW A;  4R8N A;  5FO9 B;  4JCV E;  2CFM A;  1STH A;  1XTD A;  3OYY A;  1Y8P B;  1P16 A;  4IUN A;  3TSS A;  1IYJ B;  1JWM D;  2GN5 A;  2OTL A;  3KF6 A;  4YCV A;  4DAP A;  1DON A;  1SNO A;  1X54 A;  2F0N A;  1N9W A;  3U50 C;  5C44 B;  1JE5 A;  3HEJ A;  5IGD A;  5C0X G;  1PH8 A;  3HOU H;  5AJ3 Q;  1QNU A;  1BKB A;  1QE6 A;  4RKB A;  1IHZ A;  4XQN A;  2KQ3 A;  4A3F G;  3ICE A;  3M4P A;  1SYB A;  3T16 A;  1X3G A;  3T56 B;  3E0J A;  5KNB A;  1BR9 A;  1YNJ C;  1QZG A;  4DA2 A;  1NBW A;  1LUZ A;  2H5X A;  1S40 A;  1MSH A;  1MJE A;  4J1M A;  1W2B A;  3KFU A;  1N33 L;  4A93 H;  2NYZ D;  1C8C A;  2ALY B;  1XYI A;  1JWU D;  1WOC A;  2JSO A;  5IP7 G;  2MJ8 A;  4DV4 Q;  3BJU A;  1VQL A;  4X64 Q;  1EY6 A;  5BN3 A;  2E2I H;  2L5T A;  2NWG A;  1M4V A;  5JEA G;  1K83 H;  1B2T A;  1XPO A;  2XWJ B;  4JYA Q;  2EYM A;  3BU2 A;  4DR4 Q;  1VQN A;  1YNN D;  5CBE E;  1HZB A;  1HQR D;  1ZEQ X;  2ZM6 Q;  2XSC A;  3UDG A;  4H0L C;  4DV0 L;  4B3S Q;  1F9R A;  3MXG A;  2D9U A;  4YCW A;  2OQ0 A;  4CJ0 B;  3RN5 A;  1SFO H;  2X69 A;  3GTM B;  1Q8K A;  3VR3 A;  5JJK A;  1R9T H;  1KAA A;  1YIJ A;  1LM0 A;  3F1Z A;  2BE5 D;  2CVR A;  2ZTC A;  3MXP A;  3UE0 A;  4OO1 H;  2K52 A;  2NVX H;  3L9A X;  1YHQ A;  5FK9 C;  3VR5 A;  4BBR G;  1A0I A;  2EY5 A;  2UXC L;  1O78 A;  4F88 A;  2K5H A;  1E0B A;  2E2H B;  1SJE D;  4F87 A;  5KGU A;  2XRQ D;  1FL0 A;  3L0O A;  3CPF A;  3SK6 A;  3GTK H;  2DJF C;  5ELF A;  2BA1 A;  4K8I A;  1CK1 A;  1F2L A;  1AN8 A;  4DR3 Q;  1BCP D;  1MKH A;  2WAC A;  2B2U C;  4YIJ A;  4X65 Q;  1SMY C;  1HUM A;  3FMC A;  1YVC A;  2WKC A;  1S5B D;  1T5E A;  1NJI C;  1XMO Q;  3VR6 A;  1NSN S;  2P5Z X;  3A0J A;  1G2S A;  1F2M A;  3NUC A;  1E22 A;  3T51 B;  5E4X A;  2D62 A;  1VQ4 A;  2E8G A;  1JOR A;  4E6I A;  1Q1B A;  3GD7 A;  2CW0 C;  4YWM A;  4BY1 H;  1LV9 A;  2NZH A;  1M8A A;  3DEP A;  2NVT B;  3J80 E;  2MO1 A;  1QB5 D;  5IGB A;  3CC4 A;  5E4W C;  1W6K A;  1LTL A;  4C2M H;  5F2D A;  4DUY Q;  4KKT A;  5E7N A;  3OHX C;  1IW7 D;  3PO3 H;  2CWA A;  4UP9 A;  1CM9 A;  3EFX D;  3IKJ A;  1X3E A;  1IZ6 A;  5HY6 A;  1L2F A;  4HIK A;  4OL7 A;  4QY7 A;  5M5X B;  1CTM A;  2ZM6 L;  1JOK A;  4BBS B;  2LKV A;  1U4P A;  1XMQ L;  1PH1 A;  3GP7 A;  3NPP A;  1SAP A;  3QB3 A;  1NR2 A;  4A3E H;  1B3A A;  1VQJ A;  2EYH A;  4UHV A;  3BVG A;  2JYO A;  2F0F A;  2UXD Q;  1LTB D;  1PRT B;  1H9J A;  2C35 B;  3CRK C;  2LSS A;  4HMI A;  4DR5 Q;  1VQM A;  3KBX A;  1Q86 C;  4FXK C;  2Q2H A;  2UUA L;  2A74 C;  4IUR A;  1VQI A;  1YBY A;  2BDN A;  2MP1 A;  4JI0 L;  5IOD A;  4LF4 Q;  1EZ6 A;  1HZC A;  1HZ9 A;  2DNE A;  2K7V A;  3NBH B;  3O13 A;  3WWV A;  1VQB A;  5HGT A;  1B7Y B;  2B2V C;  4PZ8 A;  3WOE A;  1XNQ Q;  1EWH A;  2EYL A;  2HIV A;  3NWS A;  5JJZ A;  4QL5 A;  3HOW H;  4KY7 A;  1IBK Q;  3HS0 C;  2NVY B;  3R3O A;  1Q12 A;  3C2P A;  4OEM B;  1C48 A;  3OWE B;  3TP8 A;  4KY5 A;  1TWF B;  1VMP A;  3SK4 A;  1Q90 A;  4XQQ A;  2Y0S E;  4K5X A;  4DGZ A;  1AEX A;  4DV1 Q;  4R4Q A;  4ALP A;  2CKZ B;  2F0M A;  4ZCK A;  4K6L A;  4AYB G;  2O5J C;  4LF8 L;  3KJP A;  3VYR A;  4NPS A;  2R7Z B;  1I5F A;  1L1O C;  1Y8N B;  2E76 C;  1K8O A;  3GTL H;  3H3V C;  4JI1 Q;  2L11 A;  2AUJ D;  4PMW A;  5FJ8 G;  1OO9 B;  3GTJ H;  3PQI A;  2A6E C;  4A3K B;  4DUY L;  1GO3 E;  1EUJ A;  4JOI C;  4K2L A;  2CQO A;  1V1P A;  2EE1 A;  5K5P A;  1ENC A;  1CKO A;  2ZJR A;  1GKH A;  4JW0 A;  1NE3 A;  3FKI B;  3I4L A;  4ZAI A;  1GHJ A;  2VQF Q;  1PV4 A;  2M00 A;  3G7L A;  4RGO S;  4P2C B;  2QDL A;  3V2T A;  4C3J H;  4LMQ D;  4R4O A;  2RHQ B;  5IGC A;  1ZYR C;  2K5V A;  2OTJ A;  3K59 A;  4OHJ A;  4FVM A;  3K5L A;  2WB1 E;  2VUM B;  3B6Y A;  4A3I B;  5J22 A;  4DR1 Q;  4BXX G;  3A56 A;  3D4D A;  4PZ6 A;  1FYC A;  3TS2 A;  3NE5 B;  3TN2 A;  3CCS A;  1PYW D;  2B2Y A;  1L0W A;  5JPM C;  1NMG A;  1UEB A;  1UE7 A;  4HAE A;  4UP7 A;  1I3Q B;  3S17 B;  2I5M X;  3K81 C;  1AFP A;  1SNP A;  3HP3 A;  1H9R A;  2B2T A;  4OEL B;  4JG2 A;  2K50 A;  2O2L D;  1QVF A;  3QOJ A;  2G5D A;  2NVQ H;  2C5C A;  4XYQ A;  2JA5 G;  4A3J H;  1IBK L;  3RZO B;  4HJA A;  3HOX H;  2TSS A;  4WOR A;  5M3F B;  1E24 A;  1F9S A;  2ICE C;  3WDN A;  2XGT A;  1NR4 A;  1XXG A;  3S1Q H;  5BN4 A;  2EYJ A;  4KHZ A;  4DV1 L;  4DV3 L;  1HHV A;  1ILQ A;  2YTX A;  4B3R Q;  3AFP A;  2VW9 A;  2MGS A;  4N8F A;  1CZG A;  1UAP A;  2N49 A;  3RR5 A;  1PYB A;  4A3C G;  5M5Y H;  4XT1 B;  4KKU A;  3W1B A;  4H02 A;  5I9P A;  1E3P A;  4RFB A;  3DXJ C;  3HOY B;  3FPU B;  2ES2 A;  4LFA Q;  2Z6B A;  1PH7 A;  1G51 A;  2RBM A;  1XPU A;  1J9O A;  3A54 A;  5E3F A;  4IUV A;  1SE4 A;  5KYL A;  2OXP A;  3DHQ A;  5GAG C;  1HR0 Q;  1FNU A;  1SXT A;  2EIF A;  4JBJ A;  2R93 H;  3UDI A;  2N78 A;  5JVG 3;  3MA2 B;  1IL2 A;  4JI6 L;  5LMN L;  4LW1 A;  1TWH B;  2NN6 G;  1KLU D;  1CFM A;  4YHH L;  4A3M B;  4HJ7 A;  1S5C D;  3D0F A;  3FHW A;  3VDY A;  2FMC A;  4BA2 I;  3D3R A;  2HT1 A;  1A3V A;  1SRO A;  4MNO A;  3IL8 A;  4IJL A;  5FLX E;  2WKD A;  4X66 Q;  4NW2 A;  1VQH A;  2ZXR A;  2LXK A;  4IUP A;  3M4Y A;  2E5L L;  3VA7 A;  5COY A;  4A3D H;  3FDT A;  4GN5 A;  2AWO A;  4KKS A;  3GTO H;  4FF4 A;  5IOC A;  1HNW Q;  3STB D;  1VF5 C;  4A3K G;  1S72 A;  3M3Y H;  1Y1W B;  1TS4 A;  4MTN A;  1CZW A;  1SDF A;  1II3 A;  2PMZ B;  5CV5 A;  4C3I H;  2SDF A;  3FKI G;  1WTW A;  5JVH 3;  1HR0 W;  3EA6 A;  3KBG A;  2YU9 B;  4Y7N H;  1VQK A;  2Q2I A;  3S1N H;  3BYT B;  5CC4 A;  1PZI D;  1N32 Q;  2V4D A;  1F9Q A;  2F3I A;  5KNC A;  4YY3 L;  4DXF A;  3KLR A;  3K58 A;  3M7N A;  5CV7 A;  2VUM G;  5EJW A;  3LX0 A;  4A3I G;  1HNX Q;  2JQO A;  3RZD B;  1XTC D;  2EDG A;  1PA6 A;  1JJ2 A;  1K0S A;  1NUC A;  3M4O B;  2L1B A;  3CAM A;  2JA6 H;  4RGM A;  1G6Z A;  4IPD A;  3OOC A;  1CA6 A;  3PIO A;  3I4N B;  2QEX A;  4EQN A;  3R93 A;  4IQZ A;  1Y8O B;  1XNR Q;  3W5O A;  1X55 A;  1FNV A;  4DR2 L;  2ID0 A;  5CV4 A;  4DR7 L;  1OXX K;  2E74 C;  5M3F G;  2IX3 A;  2VZA A;  4V0B A;  3TZU A;  1V9P A;  1RJT A;  4M1U B;  1RTN A;  3BS1 A;  4A3F B;  4GNX B;  4X62 Q;  5GAD C;  3PIO 3;  3CD6 A;  4DK0 A;  3TZD A;  1V8Q A;  4LF9 L;  1VQ9 A;  4LAA A;  1DZ1 A;  3QWN A;  3TRZ A;  1KAW A;  3KLS A;  5EBC A;  4A3G G;  5DLQ E;  3GTG H;  1ET9 A;  4DN4 M;  1U4M A;  3HOY G;  4Q0F A;  1E2Z A;  4JI4 L;  1Q82 C;  4APV A;  5KND A;  1XPR A;  3I55 A;  2GVA A;  4DK3 C;  2KCT A;  2QF7 A;  1Q8I A;  4GKJ L;  2A69 C;  3FPP A;  2XRS D;  2BH8 A;  1K73 C;  3TS0 A;  4PZ7 A;  1UUP A;  1GUW A;  2DNC A;  3TME A;  1PLF A;  2CCZ A;  1RCV D;  1RF2 D;  1QG7 A;  2E2J B;  4H7B A;  4R4T A;  1VQF A;  4DAV A;  4HSV A;  4IZ8 A;  1CSQ A;  4P74 A;  4A3M G;  5IP7 H;  4I7A A;  4DF7 A;  5JEA H;  4CDD C;  1FVI A;  2KBN A;  4P73 A;  4IFD J;  3J7A F;  4GN3 B;  4C3H B;  1YI2 A;  2F3V A;  4QUF A;  1O7Y A;  3MAQ A;  1EIY B;  1N33 Q;  3HKZ E;  4GKK L;  1LTA D;  1I4H A;  1A62 A;  3QR8 A;  1HUN A;  3H6M A;  4KTA A;  1UE6 A;  2L15 A;  1IBM L;  1Y1W G;  4A4I A;  3JAM c;  1SLJ A;  3LGJ A;  4F8M A;  5KRU A;  2FIN B;  3S1M B;  1ENF A;  4JBW A;  1KTK A;  2HDM A;  3K0Y A;  5JAV A;  3CC7 A;  3C1E A;  4IPG A;  1B53 A;  3AFQ A;  3GV6 A;  3UE1 A;  4DV0 Q;  4BBR H;  2L9H A;  3TP6 A;  2B2V A;  3S14 B;  1WTO A;  2K6A A;  4ULL A;  1SYC A;  4LFB L;  1JC7 A;  2JEA I;  2QDB A;  1PFB A;  4N8X 1;  1KNE A;  4LNQ A;  4KD4 A;  2PQE A;  2DY8 A;  1CHP D;  4N9T A;  4ME3 A;  2PCF B;  2F0T A;  2F4I A;  3I4N G;  2KCN A;  4DAY A;  2NN6 I;  5FLX L;  3R8B A;  4QQB X;  1I6H H;  3BZK A;  5C4J B;  2OCE A;  3CPW A;  1PH4 A;  1E7Z A;  5CYU A;  3PF4 A;  3OMC A;  5EKL A;  5NUC A;  2BDO A;  1WFQ A;  1L1O A;  1QUQ A;  4HJ8 A;  4LF6 L;  1XWE A;  1TWG B;  2KEE A;  3I2Z A;  4ZUJ A;  4XXE A;  3N52 A;  1B70 B;  4IFD G;  1O7I A;  3CP0 A;  3G71 A;  3Q22 A;  1D5M C;  2QGQ A;  4NXM L;  1RL2 A;  3CHB D;  3NQT A;  4JOI A;  2A5H A;  4DU9 A;  4QB4 A;  2A73 B;  1Q3L A;  5JJL A;  1N36 L;  1BBU A;  3MEF A;  1V43 A;  3L3O C;  4RKL A;  1O7L A;  4DV2 L;  4JC0 A;  5C44 H;  1HPC A;  3AMU A;  4BY7 B;  3VYS A;  1QCB D;  1CUK A;  2K75 A;  4J8Q A;  2KHS A;  2LY7 A;  3ULP A;  2Z8L A;  1QIL A;  1PTO F;  4P71 A;  2ICI A;  3TEH B;  4LF7 L;  4DXG A;  4RGT A;  2KUM A;  2SNM A;  4A75 A;  4QMG A;  4JPB W;  1K83 B;  2NZ1 D;  2F4V L;  4QF4 A;  5HGQ A;  1B44 D;  3R2I A;  4XYO A;  1O80 A;  1TII D;  4DV6 L;  5EPJ A;  4A76 A;  3S2H B;  5I9O A;  2K1B A;  2B8G A;  2R6G A;  5ELD A;  2JP1 A;  1XMQ Q;  2EOT A;  4LF5 L;  1YNJ D;  3C1F A;  4AH6 A;  2UUB L;  2K4K A;  5CGK A;  2UU9 L;  1CKN A;  1SFO B;  3R2T A;  4AYB B;  3AB9 A;  5I4D A;  1Z6H A;  4KMU C;  5LL6 X;  2XTI A;  4Q5V A;  4DKA C;  5CMD A;  1IYU A;  4C3H G;  5J3B A;  2UUA Q;  3M85 A;  5C4X G;  4S3S A;  1EY4 A;  3OTO L;  2NVX B;  2K05 A;  4JI5 L;  4JI0 Q;  2BA0 A;  2OWO A;  1B50 A;  4HIM A;  4QCL A;  1TWA B;  3GTM H;  1I50 B;  2MQH A;  4HIO A;  1D5Z C;  4IPH A;  1VCI A;  3I4M B;  4KV6 A;  4IO9 A;  5C5M A;  3MFG A;  1SRU A;  3E6Z X;  4MIU A;  1EYC A;  1MJC A;  3ERO A;  5FJ8 H;  4B08 A;  5CV9 A;  4NKL A;  1U4R A;  3VYT A;  2E2H H;  3DMU A;  4XTC S;  1JJG A;  2IT1 A;  4LF8 Q;  3K7A B;  1B9M A;  1A6X A;  1G2T A;  2WP8 J;  2JN4 A;  3C3L A;  2F0L A;  4RHR A;  1ZXT A;  1JJC B;  2FXQ A;  2L0C A;  3PUW A;  2PQA A;  1PH2 A;  4BY1 B;  4B3M L;  1DJR D;  1E2W A;  1YIT A;  3PO2 B;  1Q7Y C;  4FO2 A;  3DWP A;  1K28 A;  2ZXO A;  3SR1 A;  3K0X A;  3T4A C;  4BWG B;  5C3E H;  1TWC B;  4DR6 L;  3PGZ A;  2JXM B;  3H94 A;  4O0A A;  2PZW A;  3BVM A;  4DUZ L;  4LK1 C;  4BXX H;  2JA5 B;  1V1P B;  4UAI A;  2YTY A;  1LTT D;  4MHE A;  2NVT H;  2L12 A;  2Y0S B;  1SMY D;  4NXN Q;  4ZK9 B;  4FP5 D;  1I4R A;  1TVX A;  3AU7 A;  3KYH C;  2BOS A;  5FO8 B;  1FNW A;  3A55 A;  1IYV A;  3CRL C;  3E9I A;  3S1R H;  1PFS A;  3S2D H;  4A3E B;  3A8I E;  1BVS A;  2JA8 B;  4LUZ A;  2R61 A;  1IKM A;  5IT9 L;  2Q2T A;  2CW0 D;  2WV6 D;  1GUG A;  4WJW A;  2OQK A;  1DD2 A;  2KVM A;  3EVQ A;  2DY7 A;  1PTO C;  4BY7 G;  2EJM A;  3NXW A;  1KHI A;  1MIU A;  4BBS H;  5M5W B;  3IRB A;  2D0O A;  4JBK A;  3EJI A;  3PUY A;  1QOH A;  3A8J E;  3GO5 A;  4IJH A;  4ZQ3 A;  4EVO A;  4HCS A;  3LWE A;  1SR3 A;  1C4Q A;  3RLO A;  3D6W A;  4R1J A;  2IHE A;  4JI2 L;  4POG A;  3BYY B;  3QOL A;  3CCJ A;  1J5E L;  5FLM H;  3ITP A;  2O5I C;  1PH3 A;  2RVL A;  2X6L A;  4UP8 A;  2B2W C;  5IYB G;  2V1C C;  5DAU A;  2YYZ A;  4ODG A;  2WB1 B;  2JA7 B;  2WAQ E;  1VQ8 A;  4DV3 Q;  1SYD A;  3PUV A;  5D3I B;  4HID A;  4KJN A;  4FNF A;  4OIJ A;  4GLA C;  3CCE A;  1SE2 A;  3ND8 A;  3HOV B;  2NVY H;  3A8K E;  3M7G A;  3T1H L;  4OX9 L;  1ESF A;  4L8J A;  3CCV A;  3MXN A;  3D8G A;  2F3W A;  3S16 H;  5C0X I;  3DWQ A;  4U68 A;  3F8T A;  1TWF H;  3GTQ B;  3GTL B;  2NN6 H;  2Z9H A;  2IJ0 A;  3QG1 A;  2I07 B;  3PUZ A;  1PYS B;  3J81 E;  1IKL A;  1HRJ A;  2EY1 A;  4U67 3;  1E1T A;  1EEI D;  4L5Q A;  3QJY A;  4FDB A;  2XN9 C;  2A6H C;  2R7Z H;  3I4M G;  2AKW B;  5EPK A;  1UEA B;  1KDC A;  1IBL L;  2NBF A;  2IY5 B;  1GOZ A;  4FXG C;  4I7Z C;  1S5D D;  2DN8 A;  4JI6 Q;  3IFT A;  3CME A;  5LMN Q;  4NXN L;  2RSN A;  1SE8 A;  4YHH Q;  5IP9 G;  2N3S A;  3BZD B;  3OPO A;  1NCV A;  2HCI A;  2PZT A;  4A3K H;  3T53 B;  3HGB A;  5C5L A;  1Z7T A;  1EEF D;  3ZYY X;  5C3W A;  4M8A A;  1QVG A;  2EY2 A;  1DGS A;  3FKI H;  3A5U A;  1X65 A;  1LTG D;  1JB7 A;  4O2D A;  1H9M A;  2E5L Q;  1Y1V H;  4BY1 G;  4GZY C;  1FR3 A;  3PO2 G;  2A6E D;  2FMM A;  3SVM A;  4QUC A;  4A3L H;  1FJG L;  3VA5 A;  2AMC B;  3KLS X;  2VUM H;  1A15 A;  3SXH A;  4A3I H;  1NY4 A;  4ZRZ A;  3P20 A;  1TU2 B;  1YJN A;  3PV0 A;  4V19 0;  3OWF A;  1STN A;  4CDF C;  1EYG A;  1HXY D;  2H1E A;  2N8N A;  4PV1 C;  2D2C C;  4A3J B;  1ZYR D;  2Y0S G;  2DUD A;  1I3Q H;  1U4L A;  3S17 H;  1VQD A;  1FGU A;  2WII B;  2XVS A;  5LMN W;  1SE3 A;  3K6O A;  4YY3 Q;  4AQY L;  1SYF A;  3FVQ A;  2N55 A;  3SDZ A;  3E3X A;  2QKI C;  4A3E G;  5EPL A;  1F2Y A;  2RCN A;  2JA8 G;  4QJF A;  1B1Z A;  3E5S A;  3P1H A;  4DV7 L;  1ICW A;  2L55 A;  5FOB B;  5M3F H;  3FEW X;  3NTH A;  3VR2 A;  4ZUI A;  1OXV A;  1CT1 D;  2K5D A;  3PF5 A;  4A3G B;  1STA A;  3GDE A;  2Z0S A;  5IGG A;  2K01 A;  2R7F A;  3OIP A;  4DR2 Q;  1D8L A;  1F2Z A;  2IPK D;  2SOB A;  4K2K A;  2MO0 A;  4DR7 Q;  2F1M A;  4KHP L;  3J80 L;  3NK9 A;  4JI3 L;  5J39 A;  2F0O A;  4BS9 A;  2JK8 A;  4J15 A;  3ND9 A;  4DFA A;  5IGE A;  2JA7 G;  2WB1 G;  3HOY H;  4P75 A;  4FF3 A;  4PNY A;  4LWC A;  2K5W A;  3UI2 A;  4LF9 Q;  1J8I A;  3LWU A;  3MEH A;  2LFN A;  3UDX A;  3HOV G;  2B8F A;  1RKN A;  2AQ2 B;  1SYG A;  2FFK B;  3W2D A;  2LMC B;  1LTS D;  4AIM A;  4MN3 A;  5I6Y A;  1WTX A;  1TS3 A;  5K36 G;  4ZYS A;  1TWH H;  4OON A;  3H91 A;  4A3M H;  4JI4 Q;  2FHT A;  4KD3 A;  4R4I A;  2B63 H;  1VS0 A;  2HHH L;  4GKJ Q;  5IE8 A;  5CV8 A;  3M9B A;  4JK1 C;  4OWT B;  1HFN A;  3H0G B;  2EVB A;  4LJZ C;  2G9H D;  2D0P A;  3ZJY C;  2BCO A;  2NTT A;  3E0E A;  3KOJ A;  1GXD C;  1KDB A;  2R7D A;  1A2T A;  3HG9 A;  1Y1W H;  4CKE A;  4CHT B;  4B3T L;  2F03 A;  1SNQ A;  2R92 H;  4P72 A;  3V05 A;  3J7A V;  3EIV A;  3PSI A;  5M3M H;  1A8V A;  4IOA A;  1KLG D;  4PQX A;  5IIF A;  2H4O A;  4RH6 A;  2YU9 H;  1LT5 D;  4ILW A;  1TS2 A;  1GUO A;  3GQB A;  5ELC A;  4GKK Q;  1UNS A;  2JE6 I;  3SGI A;  5DNF A;  1WVL A;  1UE5 A;  2EYF A;  4RCN A;  3SK8 A;  2HCC A;  2RA4 A;  1IBM Q;  1AH9 A;  3NP8 A;  3U4Z A;  3CQZ B;  1D1K A;  1STB A;  1Z9F A;  3RZD H;  1DOL A;  1E1O A;  2IHF A;  4HSP A;  1PTO B;  1FGB D;  1EYA A;  5J1Z A;  2JA9 A;  1Q1E A;  4A3J G;  3M4O H;  4PMB A;  1N34 L;  1TKW B;  4DK6 C;  2GA4 B;  5JPN C;  3OW7 A;  3OIQ A;  3J81 L;  3I4N H;  1DCZ A;  5ISR A;  1OXS C;  1WI5 A;  4KN4 C;  1HNZ L;  1EY0 A;  1VQA A;  1P8L A;  1CKM A;  4LFB Q;  3JC6 6;  3I70 A;  2K32 A;  2ZJP A;  1VMC A;  5GQO A;  5IYC G;  1WCM B;  3QIA A;  3KDF A;  2K33 A;  1ASZ A;  2RF4 A;  5C0X H;  3HKZ B;  3DM1 A;  4A3B B;  1HCZ A;  1CHQ D;  4R4C A;  4K6D A;  1U0L A;  4A3F H;  1I94 Q;  4O1N A;  4YWL A;  2HQE A;  4DAM A;  2ZJQ A;  4MZ9 A;  3K80 C;  3SE0 A;  4DAY B;  2VB2 X;  2RHS B;  3KF8 B;  4DV5 L;  3GTP B;  2EJG C;  4LF6 Q;  2X6G A;  5E1F A;  2TMP A;  3JAM i;  1V1O A;  2Z1C A;  2AHO B;  2F0V A;  3OSO A;  4X3T A;  1L1O B;  1EFI D;  1QUQ B;  2IX1 A;  5KEE A;  2SEB D;  4NXM Q;  1EQT A;  2R93 G;  4J6H A;  2ASB A;  1GJX A;  1AW7 A;  2OT2 A;  2F0J A;  1I4G A;  2EQS A;  4DNT B;  4CJ1 B;  1N36 Q;  1ASY A;  2PW5 A;  1YZ6 A;  1QJO A;  1M90 C;  1SNC A;  2MNA A;  1ZKO A;  1AP0 A;  5ELE A;  3U9O A;  3I72 A;  1J6Q A;  3G6E A;  3C46 A;  1A3U A;  4DV2 Q;  2VQE Q;  1PHJ A;  3FRP B;  3D4R A;  4RMF A;  3F2B A;  3ULJ A;  5FKA C;  4XT3 B;  2K28 A;  4HTH A;  1PRT C;  2E2J H;  3NTI A;  1LAC A;  1SND A;  5C4X B;  2J7Z A;  3NBI A;  1KQS A;  2L4N A;  2SNS A;  2DJG C;  2A69 D;  4K0K L;  4EQ5 A;  5A2Q E;  1Q46 A;  3U58 A;  4LF7 Q;  1QWY A;  4QIW E;  2F0U A;  3CCU A;  2CQA A;  1N8R C;  3HOZ B;  1BCP F;  1BUV T;  3H0G G;  4IAL A;  1F77 A;  4C3I G;  4N9P A;  3RD4 A;  5AFW A;  1GUS A;  4BA1 I;  4C3H H;  4DV6 Q;  4JI7 L;  1EU3 A;  2NTS A;  2Z6K C;  3HKS A;  4DPG A;  1BXT A;  2DGY A;  2QCP X;  1T9H A;  3S15 B;  3CU7 A;  4L5T A;  4LF5 Q;  4CKC A;  1BDO A;  2UUB Q;  1CQV A;  2UU9 Q;  1K3R A;  1PH5 A;  2MFI A;  4FXD A;  3ULL A;  1EY5 A;  1WTH A;  5FO7 B;  1TXY A;  3S1M H;  2PPB C;  2F0P A;  4ZKC B;  1A63 A;  1CKN B;  2ZT9 C;  2B2W A;  1GHK A;  3KUP A;  3P75 A;  3S9W A;  2N88 A;  1K8G A;  4XIG S;  3OTO Q;  2RDF A;  1GD7 A;  3T1Y L;  2JA6 G;  1VQE A;  3KK7 A;  4JI5 Q;  1I94 L;  3S14 H;  3UDF A;  2XWB B;  3E9H A;  3KF8 A;  1YJ9 A;  4X3K A;  3I90 A;  1CQF A;  3MXU A;  1LLR D;  1BBX C;  4K5W A;  1EU4 A;  3PUX A;  1VQP A;  2RKS A;  1LTR D;  2WIN B;  2KOL A;  2CH4 W;  1H95 A;  4KHV A;  3HOU B;  2F0E A;  3I8Z A;  5C4J H;  1EQV A;  2AQ1 B;  1X6O A;  3L7Z C;  4XQJ A;  1ENA A;  3PMF A;  2RDH A;  1X3P A;  1TWG H;  1ET6 A;  3FP9 A;  4DNI A;  4RAU C;  4WRD A;  1WCM G;  1KD1 C;  2UXB L;  2VQE L;  4JV5 L;  1EY8 A;  1NTG A;  1DYQ A;  3HKZ G;  1EOT A;  4EQP A;  2F0I A;  3K57 A;  4A3B G;  4B3M Q;  1JT8 A;  1Y14 B;  3A7L A;  3OW2 A;  1YNN C;  2PQA B;  3N6R A;  3WOF A;  4X3U A;  4JBM A;  1PH6 A;  4A93 B;  1G6P A;  1LT3 D;  1K8M A;  1PXU A;  4X6A H;  2K04 A;  4KN7 C;  4CDE C;  4POF A;  4GOP A;  3HFZ B;  4DR6 Q;  1EIG A;  4DUZ Q;  2E2I B;  3D4W A;  5IYD G;  1QZH A;  4BY7 H;  3BZC A;  3NEN A;  4JI8 L;  1LYL A;  2F52 A;  4QGU A;  4LUO A;  4UPA A;  4OWX B;  1TT2 A;  1Q81 C;  1KIX A;  5EBD A;  1SSO A;  4WJ3 M;  3AEV A;  3MHB A;  3SK5 A;  3ER0 A;  4HED A;  2BE5 C;  1ML0 D;  3VR4 A;  1F9P A;  4EGV A;  1WTR A;  3TP5 A;  5LMU L;  2R3Z A;  1H9S A;  1MHW C;  1PH9 A;  4K8J A;  4LFC L;  3I56 A;  3EN2 A;  2FJ2 A;  3I3C A;  1R9T B;  3OMG A;  2F0K A;  5FLX c;  3CCM A;  4Y52 H;  2OF1 A;  1H9K A;  3D6C A;  3S2H H;  5IYB H;  3Q24 A;  1WTV A;  1M1K C;  1BCP C;  4R9W A;  3J7Y W;  2HD3 A;  4JI2 Q;  1YNX A;  1Z47 A;  4CDC C;  1TR5 A;  5C3X A;  5C6A A;  4WFN 3;  5IWA L;  3CXC A;  3HOZ G;  3KJO A;  1JIC A;  1CA5 A;  1NAP A;  1J5E Q;  3GTK B;  2ATW A;  4KK7 A;  3L2P A;  2ENB A;  3DWA A;  1MBY A;  3DUZ A;  3QO2 A;  1GUT A;  2UUC L;  4KLK A;  4RGN A;  1TWA H;  1LO5 D;  4KI0 A;  1EIF A;  5I6W A;  1VQ7 A;  1I50 H;  2PO4 A;  4Z9C B;  1U5K A;  1K9M C;  1STY A;  4TVA B;  3J7A 5;  4G7H C;  2K5Q A;  1JCK B;  3T1H Q;  1WTQ A;  1KRT A;  3I4M H;  2PZU A;  4OX9 Q;  3G48 A;  1IW7 C;  1IXR A;  1GUN A;  2ZXP A;  3MXN B;  2PI2 E;  4H13 C;  5AJ3 L;  5IP9 H;  5DEH A;  4OGQ C;  2A19 A;  4K5V A;  5GRO A;  3DLL A;  1R4Q B;  1X32 A;  1A3T A;  4C2M B;  3K7A H;  5C3E B;  1RIP A;  1SBB B;  5CBA E;  3TRE A;  1HJP A;  2F0D A;  3AQQ A;  2IL8 A;  4AYB E;  3PO3 B;  5T1I A;  1DOM A;  1SYE A;  3X3M A;  1IBL Q;  5C4H A;  5A2Q L;  4IUU A;  4F7X A;  2VB3 X;  2RSO A;  2WAQ B;  3MWY W;  2JEB I;  4CKB A;  4IN3 A;  3PO2 H;  3HOU G;  4XDX A;  5H1S E;  1X3Q A;  1K0R A;  1MI2 A;  4HR7 B;  2PNH A;  2E2D C;  4GLX A;  1TWC H;  3K8A A;  4L5R C;  4PG3 A;  3BDO A;  4DV4 L;  3S1R B;  4X64 L;  3S2D B;  2VXW A;  2PI2 A;  1ROD A;  2RCF A;  2JA5 H;  5ELN A;  5C44 G;  4JYA L;  4DR4 L;  1WJJ A;  5M5X H;  3K5M A;  1A2U A;  1MD2 D;  2VY3 A;  4IPC A;  1QVC A;  5COR A;  1FJG Q;  1K8A C;  2A1A A;  4B3S L;  3M4Q A;  4A93 G;  5TSS A;  2I46 A;  1X9N A;  3K5N A;  2JA8 H;  3H15 A;  2QEJ C;  1VQG A;  4ZLT F;  5GAH C;  3W1G A;  1YEZ A;  3V96 A;  4HMJ A;  2EZV A;  3HOW B;  4A3C H;  1STG A;  4GS3 A;  5M5W H;  2QW7 A;  2F0G A; 
#chains in the Genus database with same CATH homology
 2EPB A;  3ERQ A;  1BNZ A;  3T13 A;  1OXU A;  5EKK A;  1RHP A;  1ONL A;  1PTO D;  4O42 A;  1LT6 D;  4NMZ A;  4ZKB B;  2M2L A;  1W6J A;  4IFD I;  1PZK D;  5C4Z A;  2K03 A;  3S16 B;  5KYI A;  1B4O A;  3RUZ A;  1S5E D;  4OO1 G;  4TRD A;  2Q8I B;  4R8I A;  3URY A;  3GTJ B;  1I4P A;  2B39 A;  3SHL A;  1BOS A;  1STE A;  1LTI D;  2EXZ A;  1D5X C;  4FYD A;  5G3L F;  1Y69 U;  1HA6 A;  1U9R A;  3I91 A;  1EL0 A;  3ONA B;  5K36 H;  1HTP A;  2AWN A;  4C3J B;  4G57 A;  1TY0 A;  1XX8 A;  1SJH D;  2MUY A;  3NTK A;  3JAM E;  1I6V C;  3D31 A;  1EIH A;  3NHH A;  2AUK A;  3BDL A;  3BDC A;  2OEO A;  4HN7 A;  3G6J B;  1Y1V B;  2IX0 A;  3IFD A;  2RQX A;  4IUT A;  2C9O A;  2A6H D;  1MGS A;  1TY2 A;  4I65 A;  4DNR B;  1E2V A;  1EZ8 A;  2NVQ B;  3HOX B;  1QNK A;  4G7O C;  1S4Z A;  2IWH A;  5LL6 S;  4ME5 A;  3X3N A;  3NBH A;  3TP7 A;  1BF4 A;  4IUQ A;  3S1Q B;  1HTL D;  1O7Z A;  3NQI A;  4RCO A;  2EYP A;  2KED A;  1L0Y B;  3W3A A;  5BN5 A;  2EYO A;  4G7Z C;  4NDX A;  2RDG A;  3IAY A;  3MC0 B;  2F0H A;  1BQQ T;  3RMH A;  4C1N I;  5M5Y B;  1D2B A;  1ILP A;  3NWT A;  3K5O A;  3I73 A;  5JOB A;  1KAB A;  2O4X A;  1ESR A;  1AZP A;  4K14 A;  1WD1 A;  3P7J A;  1WTP A;  2F0W A;  4KJO A;  4HCE A;  2R93 B;  1EYD A;  1BCP B;  2J0T D;  4L6T B;  1VF7 A;  1HQM C;  5DM7 3;  3LNN A;  2AQ3 B;  1L0X B;  4L63 B;  2Q8T A;  3VYU A;  1LT4 D;  1JWS D;  2MHV A;  4A3D B;  2NB0 A;  1PRT F;  3GTO B;  4CBV A;  2B63 B;  1D1I A;  3TDQ A;  3M3Y B;  4TQU S;  2J4X A;  5D65 A;  4C3I B;  1JB3 A;  5A35 A;  2D5D A;  2PYK A;  5CR3 A;  4Y7N B;  4C3J G;  3S1N B;  2A68 C;  4C56 C;  1DM0 B;  1SEB D;  1R4P B;  4C1N K;  3BVZ A;  1PDQ A;  5IGF A;  1JQY D;  4CJ2 C;  1RTO A;  2R92 B;  5M3M B;  4PMC A;  2LS0 1;  1B9N A;  1TS5 A;  5G3L D;  1S5F D;  1JE4 A;  2JA6 B;  1PFM A;  5EKI A;  4B9X A;  2QIL A;  2Z4H A;  2EJF C;  1EY7 A;  1G91 A;  3EQL C;  1AZQ A;  1FD7 D;  5M9O A;  3SEB A;  4EQO A;  1G29 1;  2A68 D;  1SNM A;  5EGT A;  3F2U A;  4OO1 I;  4OIK A;  1JR0 D;  4G4K A;  2Q8R E;  1KDA A;  2NUC A;  1PTO H;  5EQ0 A;  3Q0A A;  3MTS A;  4IFD H;  4FF2 A;  1RD9 D;  3JAM L;  3RLF A;  4NP5 A;  2IW3 A;  3TBI B;  1PMR A;  2CHB D;  1DXM A;  1TQO A;  1EWC A;  3GTG B;  3Q6S A;  4QIW B;  3NSW A;  2E75 C;  2XNA C;  2HDL A;  3GV3 A;  1T5X D;  4RHS A;  2F0Q A;  1IL8 A;  1JOO A;  2B2U A;  4RA8 A;  5D14 A;  2KA7 A;  1BO0 A;  5CV6 A;  1EY9 A;  3CKI B;  2VNU D;  4FF1 A;  2Z4I A;  3DEO A;  2KCC A;  4ABN A;  3HRZ C;  5ELB A;  5D3D A;  2PW7 A;  1D6E C;  3U9S A;  3A7A B;  5I2X A;  2B2Y C;  4DK1 A;  4ID6 A;  2EY6 A;  1LAB A;  1I4Q A;  2B2T C;  2G9D A;  2F0S A;  3MVV A;  4B9W A;  5I2Y A;  5KIX A;  5C0X J;  5T1G A;  2PNR C;  1I4X A;  1JOQ A;  3PIP 3;  4BBR B;  1VDZ A;  3Q23 A;  1HFG A;  3H09 A;  1G8Z D;  2KEC A;  1DOK A;  5DM6 3;  5LHY 1;  4X3S A;  1PRT D;  1H9S B;  1OXT A;  4H44 C;  5IT9 E;  4CGY B;  3MZ5 A;  1MSG A;  5HUR A;  1I6H B;  3HZX A;  4RWS C;  4TKO B;  4KY6 A;  1PZJ D;  4UDU C;  5JEA J;  1KNA A;  1CI3 M;  4TSS A;  1RDP D;  1PFN A;  3BG3 A;  2KJX A;  1HA5 A;  2M9V A;  2MPM A;  3MFY A;  2HUG A;  1WD0 A;  2XIW A;  4R8N A;  5FO9 B;  1STH A;  1Y8P B;  4IUN A;  3TSS A;  1JWM D;  4DAP A;  1DON A;  1SNO A;  2F0N A;  5C44 B;  3HEJ A;  5IGD A;  5C0X G;  1QNU A;  4RKB A;  1QE6 A;  1IHZ A;  4XQN A;  2KQ3 A;  1SYB A;  3T16 A;  3T56 B;  3E0J A;  5KNB A;  1BR9 A;  1YNJ C;  4DA2 A;  1MSH A;  4J1M A;  2NYZ D;  1C8C A;  1XYI A;  1JWU D;  2JSO A;  2MJ8 A;  1EY6 A;  5BN3 A;  2L5T A;  2NWG A;  1M4V A;  5JEA G;  1B2T A;  2XWJ B;  2EYM A;  1YNN D;  5CBE E;  1HQR D;  1ZEQ X;  2XSC A;  4H0L C;  1F9R A;  3MXG A;  2D9U A;  4CJ0 B;  2X69 A;  3GTM B;  3VR3 A;  1KAA A;  2BE5 D;  2CVR A;  3MXP A;  4OO1 H;  3L9A X;  5FK9 C;  3VR5 A;  2EY5 A;  1O78 A;  4F88 A;  1E0B A;  2E2H B;  1SJE D;  4F87 A;  5KGU A;  2XRQ D;  3SK6 A;  5ELF A;  2BA1 A;  4K8I A;  1CK1 A;  1F2L A;  1AN8 A;  1BCP D;  2WAC A;  2B2U C;  4YIJ A;  1SMY C;  1HUM A;  3FMC A;  2WKC A;  1S5B D;  1T5E A;  3VR6 A;  1NSN S;  1G2S A;  1F2M A;  3NUC A;  3T51 B;  5E4X A;  2D62 A;  1JOR A;  4E6I A;  1Q1B A;  3GD7 A;  2CW0 C;  1LV9 A;  1M8A A;  3DEP A;  2NVT B;  3J80 E;  1QB5 D;  5IGB A;  5E4W C;  1W6K A;  5F2D A;  4KKT A;  3OHX C;  1IW7 D;  1CM9 A;  3EFX D;  3IKJ A;  4OL7 A;  5M5X B;  1CTM A;  1JOK A;  4BBS B;  2LKV A;  1U4P A;  3GP7 A;  3NPP A;  1SAP A;  3QB3 A;  1NR2 A;  1B3A A;  2EYH A;  3BVG A;  2JYO A;  2F0F A;  1LTB D;  1PRT B;  1H9J A;  3CRK C;  4HMI A;  3KBX A;  4FXK C;  2A74 C;  4IUR A;  2MP1 A;  2BDN A;  5IOD A;  1EZ6 A;  2DNE A;  2K7V A;  3O13 A;  5HGT A;  2B2V C;  3WOE A;  1EWH A;  2EYL A;  3NWS A;  5JJZ A;  4KY7 A;  3HS0 C;  2NVY B;  3R3O A;  1Q12 A;  3C2P A;  1C48 A;  3OWE B;  3TP8 A;  4KY5 A;  1TWF B;  1VMP A;  3SK4 A;  1Q90 A;  4XQQ A;  4K5X A;  4DGZ A;  1AEX A;  2F0M A;  4K6L A;  2O5J C;  3VYR A;  2R7Z B;  2E76 C;  1Y8N B;  1K8O A;  3H3V C;  2L11 A;  2AUJ D;  4PMW A;  1OO9 B;  2A6E C;  4A3K B;  4K2L A;  1V1P A;  2EE1 A;  5K5P A;  1ENC A;  3FKI B;  3I4L A;  4ZAI A;  1GHJ A;  2M00 A;  3G7L A;  4RGO S;  4P2C B;  3V2T A;  4LMQ D;  5IGC A;  1ZYR C;  3K59 A;  4OHJ A;  4FVM A;  3K5L A;  2VUM B;  4A3I B;  5J22 A;  3A56 A;  3D4D A;  1FYC A;  3NE5 B;  3TN2 A;  1PYW D;  2B2Y A;  5JPM C;  4HAE A;  1I3Q B;  3S17 B;  1AFP A;  1SNP A;  3HP3 A;  1H9R A;  2B2T A;  2O2L D;  3QOJ A;  2C5C A;  4XYQ A;  3RZO B;  2TSS A;  4WOR A;  5M3F B;  1F9S A;  2ICE C;  3WDN A;  1NR4 A;  1XXG A;  5BN4 A;  2EYJ A;  4KHZ A;  1HHV A;  1ILQ A;  2MGS A;  1CZG A;  1UAP A;  4XT1 B;  4KKU A;  5I9P A;  4RFB A;  3DXJ C;  3HOY B;  3FPU B;  2RBM A;  1J9O A;  3A54 A;  5E3F A;  4IUV A;  1SE4 A;  5KYL A;  2OXP A;  3DHQ A;  1FNU A;  1SXT A;  5JVG 3;  3MA2 B;  1TWH B;  2NN6 G;  1KLU D;  1CFM A;  4A3M B;  1S5C D;  2FMC A;  4BA2 I;  3D3R A;  1A3V A;  3IL8 A;  5FLX E;  2WKD A;  4NW2 A;  2ZXR A;  4IUP A;  3M4Y A;  3VA7 A;  5COY A;  3FDT A;  2AWO A;  4KKS A;  4FF4 A;  5IOC A;  1VF5 C;  1Y1W B;  1TS4 A;  1CZW A;  1SDF A;  1II3 A;  2PMZ B;  5CV5 A;  2SDF A;  1WTW A;  5JVH 3;  3EA6 A;  3KBG A;  2YU9 B;  3BYT B;  5CC4 A;  1PZI D;  2V4D A;  1F9Q A;  5KNC A;  4DXF A;  3KLR A;  3K58 A;  3M7N A;  5CV7 A;  5EJW A;  3LX0 A;  3RZD B;  1XTC D;  2EDG A;  1NUC A;  3M4O B;  2L1B A;  4RGM A;  1G6Z A;  3OOC A;  1CA6 A;  3I4N B;  4EQN A;  3R93 A;  4IQZ A;  1Y8O B;  1FNV A;  2ID0 A;  5CV4 A;  1OXX K;  2E74 C;  2IX3 A;  4V0B A;  3TZU A;  1RJT A;  4M1U B;  1RTN A;  3BS1 A;  4A3F B;  3PIO 3;  4DK0 A;  3TZD A;  1V8Q A;  4LAA A;  1DZ1 A;  3QWN A;  3KLS A;  5EBC A;  1ET9 A;  4DN4 M;  1U4M A;  4Q0F A;  1E2Z A;  5KND A;  2QF7 A;  1Q8I A;  2A69 C;  3FPP A;  2XRS D;  1UUP A;  1GUW A;  2DNC A;  3TME A;  1PLF A;  1RCV D;  1RF2 D;  1QG7 A;  2E2J B;  4H7B A;  4DAV A;  4HSV A;  4IZ8 A;  4DF7 A;  5JEA H;  4IFD J;  3J7A F;  4C3H B;  2F3V A;  4QUF A;  1O7Y A;  3MAQ A;  1LTA D;  1I4H A;  1HUN A;  3H6M A;  4KTA A;  4F8M A;  5KRU A;  2FIN B;  3S1M B;  1ENF A;  4JBW A;  1KTK A;  2HDM A;  3K0Y A;  5JAV A;  3C1E A;  1B53 A;  3GV6 A;  2L9H A;  3TP6 A;  2B2V A;  3S14 B;  1WTO A;  2K6A A;  4ULL A;  1SYC A;  1JC7 A;  2JEA I;  2QDB A;  1PFB A;  1KNE A;  4KD4 A;  2PQE A;  2DY8 A;  1CHP D;  4N9T A;  2PCF B;  2F0T A;  2F4I A;  2KCN A;  4DAY A;  2NN6 I;  5FLX L;  3R8B A;  5C4J B;  5CYU A;  3OMC A;  5EKL A;  5NUC A;  2BDO A;  1XWE A;  1TWG B;  2KEE A;  4ZUJ A;  4XXE A;  3N52 A;  4IFD G;  3Q22 A;  1D5M C;  3CHB D;  3NQT A;  2A5H A;  4DU9 A;  4QB4 A;  2A73 B;  1Q3L A;  1V43 A;  3L3O C;  4RKL A;  1O7L A;  1HPC A;  3AMU A;  4BY7 B;  3VYS A;  1QCB D;  4J8Q A;  2KHS A;  2LY7 A;  2Z8L A;  1QIL A;  1PTO F;  2ICI A;  4DXG A;  4RGT A;  2KUM A;  2SNM A;  4QMG A;  1K83 B;  2NZ1 D;  4QF4 A;  1B44 D;  3R2I A;  4XYO A;  1O80 A;  1TII D;  5EPJ A;  3S2H B;  5I9O A;  2K1B A;  2B8G A;  2R6G A;  5ELD A;  2JP1 A;  2EOT A;  1YNJ D;  3C1F A;  5CGK A;  1SFO B;  3R2T A;  4AYB B;  3AB9 A;  5I4D A;  1Z6H A;  4KMU C;  5LL6 X;  4Q5V A;  5CMD A;  1IYU A;  4C3H G;  3M85 A;  4S3S A;  1EY4 A;  2NVX B;  2K05 A;  2BA0 A;  1B50 A;  4QCL A;  1TWA B;  1I50 B;  1D5Z C;  1VCI A;  3I4M B;  4KV6 A;  5C5M A;  3MFG A;  3E6Z X;  4MIU A;  1EYC A;  3ERO A;  4B08 A;  5CV9 A;  4NKL A;  1U4R A;  3VYT A;  3DMU A;  4XTC S;  2IT1 A;  3K7A B;  1B9M A;  1A6X A;  1G2T A;  2WP8 J;  3C3L A;  2F0L A;  4RHR A;  1ZXT A;  2L0C A;  3PUW A;  4BY1 B;  1DJR D;  1E2W A;  3PO2 B;  4FO2 A;  3DWP A;  2ZXO A;  3SR1 A;  3T4A C;  4BWG B;  1TWC B;  2JXM B;  3H94 A;  2PZW A;  3BVM A;  4LK1 C;  2JA5 B;  1V1P B;  4UAI A;  1LTT D;  4MHE A;  2L12 A;  2Y0S B;  1SMY D;  4ZK9 B;  4FP5 D;  1I4R A;  1TVX A;  3AU7 A;  2BOS A;  5FO8 B;  1FNW A;  3A55 A;  1IYV A;  3CRL C;  4A3E B;  3A8I E;  2JA8 B;  2R61 A;  1IKM A;  5IT9 L;  2CW0 D;  2WV6 D;  1GUG A;  4WJW A;  1DD2 A;  2KVM A;  3EVQ A;  2DY7 A;  1PTO C;  2EJM A;  3NXW A;  5M5W B;  3EJI A;  3PUY A;  1QOH A;  3A8J E;  3GO5 A;  4ZQ3 A;  4EVO A;  4HCS A;  3LWE A;  1C4Q A;  3D6W A;  3BYY B;  3QOL A;  3ITP A;  2O5I C;  2RVL A;  2X6L A;  2B2W C;  5DAU A;  2YYZ A;  4ODG A;  2WB1 B;  2JA7 B;  1SYD A;  3PUV A;  5D3I B;  4KJN A;  4FNF A;  4OIJ A;  1SE2 A;  3ND8 A;  3HOV B;  3A8K E;  3M7G A;  1ESF A;  4L8J A;  3MXN A;  3D8G A;  2F3W A;  5C0X I;  3DWQ A;  4U68 A;  3GTQ B;  3GTL B;  2NN6 H;  2IJ0 A;  3QG1 A;  2I07 B;  3PUZ A;  3J81 E;  1IKL A;  1HRJ A;  2EY1 A;  4U67 3;  1EEI D;  3QJY A;  2XN9 C;  2A6H C;  5EPK A;  1UEA B;  1KDC A;  2NBF A;  1GOZ A;  4FXG C;  4I7Z C;  1S5D D;  2DN8 A;  3IFT A;  2RSN A;  3BZD B;  3OPO A;  1NCV A;  2HCI A;  2PZT A;  3T53 B;  3HGB A;  5C5L A;  1Z7T A;  1EEF D;  3ZYY X;  5C3W A;  4M8A A;  2EY2 A;  1LTG D;  1H9M A;  4GZY C;  1FR3 A;  2A6E D;  2FMM A;  3SVM A;  4QUC A;  3VA5 A;  3KLS X;  1A15 A;  3SXH A;  4ZRZ A;  3P20 A;  1TU2 B;  3PV0 A;  4V19 0;  3OWF A;  1STN A;  1HXY D;  2H1E A;  4PV1 C;  2D2C C;  4A3J B;  1ZYR D;  1U4L A;  2WII B;  2XVS A;  1SE3 A;  3K6O A;  1SYF A;  3FVQ A;  2N55 A;  3SDZ A;  2QKI C;  5EPL A;  1F2Y A;  1B1Z A;  3E5S A;  3P1H A;  1ICW A;  2L55 A;  5FOB B;  3FEW X;  3NTH A;  3VR2 A;  4ZUI A;  1OXV A;  1CT1 D;  2K5D A;  4A3G B;  1STA A;  5IGG A;  2K01 A;  3OIP A;  2SOB A;  1F2Z A;  2IPK D;  4K2K A;  2F1M A;  3J80 L;  3NK9 A;  5J39 A;  2F0O A;  4BS9 A;  3ND9 A;  4DFA A;  5IGE A;  4FF3 A;  4PNY A;  2K5W A;  3UI2 A;  1J8I A;  3LWU A;  3MEH A;  2LFN A;  2B8F A;  1RKN A;  2AQ2 B;  1SYG A;  2FFK B;  3W2D A;  2LMC B;  1LTS D;  4MN3 A;  5I6Y A;  1WTX A;  1TS3 A;  5K36 G;  4ZYS A;  3H91 A;  2FHT A;  4KD3 A;  5CV8 A;  4JK1 C;  1HFN A;  3H0G B;  2EVB A;  4LJZ C;  2G9H D;  2BCO A;  2NTT A;  1GXD C;  1KDB A;  1A2T A;  3HG9 A;  4CKE A;  4CHT B;  2F03 A;  1SNQ A;  3V05 A;  3J7A V;  1KLG D;  4PQX A;  5IIF A;  2H4O A;  4RH6 A;  1LT5 D;  4ILW A;  1TS2 A;  1GUO A;  3GQB A;  5ELC A;  1UNS A;  2JE6 I;  5DNF A;  1WVL A;  2EYF A;  4RCN A;  3SK8 A;  2HCC A;  2RA4 A;  3NP8 A;  3CQZ B;  1D1K A;  1STB A;  1DOL A;  4HSP A;  1PTO B;  1FGB D;  1EYA A;  5J1Z A;  1Q1E A;  4PMB A;  1TKW B;  2GA4 B;  5JPN C;  3OW7 A;  3OIQ A;  3J81 L;  1DCZ A;  5ISR A;  1OXS C;  4KN4 C;  1EY0 A;  3I70 A;  2K32 A;  1VMC A;  1WCM B;  3QIA A;  2K33 A;  5C0X H;  3HKZ B;  3DM1 A;  4A3B B;  1HCZ A;  1CHQ D;  4K6D A;  4O1N A;  2HQE A;  3SE0 A;  2VB2 X;  3GTP B;  2EJG C;  2X6G A;  5E1F A;  2TMP A;  1V1O A;  2Z1C A;  2F0V A;  3OSO A;  4X3T A;  1EFI D;  2IX1 A;  5KEE A;  2SEB D;  1EQT A;  4J6H A;  1GJX A;  1AW7 A;  2OT2 A;  2F0J A;  1I4G A;  4DNT B;  4CJ1 B;  2PW5 A;  1QJO A;  1SNC A;  1ZKO A;  1AP0 A;  5ELE A;  3U9O A;  3I72 A;  3C46 A;  1A3U A;  3FRP B;  3D4R A;  5FKA C;  4XT3 B;  2K28 A;  4HTH A;  1PRT C;  3NTI A;  1LAC A;  1SND A;  5C4X B;  2J7Z A;  3NBI A;  2L4N A;  2SNS A;  2A69 D;  5A2Q E;  1QWY A;  2F0U A;  2CQA A;  3HOZ B;  1BCP F;  1BUV T;  4IAL A;  4C3I G;  1F77 A;  4N9P A;  3RD4 A;  5AFW A;  1GUS A;  4BA1 I;  1EU3 A;  2NTS A;  1BXT A;  2QCP X;  3S15 B;  3CU7 A;  4CKC A;  1BDO A;  1CQV A;  4FXD A;  1EY5 A;  5FO7 B;  2PPB C;  2F0P A;  4ZKC B;  2ZT9 C;  2B2W A;  1GHK A;  3KUP A;  3P75 A;  3S9W A;  2N88 A;  4XIG S;  2RDF A;  3KK7 A;  2XWB B;  3KF8 A;  4X3K A;  3I90 A;  1CQF A;  3MXU A;  1LLR D;  1BBX C;  4K5W A;  1EU4 A;  3PUX A;  2RKS A;  1LTR D;  2WIN B;  2KOL A;  4KHV A;  3HOU B;  2F0E A;  3I8Z A;  1EQV A;  2AQ1 B;  3L7Z C;  4XQJ A;  1ENA A;  3PMF A;  2RDH A;  1X3P A;  1ET6 A;  4RAU C;  4WRD A;  1EY8 A;  4EQP A;  1DYQ A;  1EOT A;  3K57 A;  2F0I A;  3A7L A;  1YNN C;  3N6R A;  3WOF A;  4X3U A;  4A93 B;  1LT3 D;  1K8M A;  1PXU A;  2K04 A;  4KN7 C;  1EIG A;  2E2I B;  3D4W A;  1TT2 A;  5EBD A;  1SSO A;  3MHB A;  3SK5 A;  4HED A;  2BE5 C;  1ML0 D;  3VR4 A;  1F9P A;  4EGV A;  1WTR A;  3TP5 A;  2R3Z A;  1H9S A;  4K8J A;  2FJ2 A;  3I3C A;  1R9T B;  3OMG A;  2F0K A;  2OF1 A;  1H9K A;  3D6C A;  3Q24 A;  1WTV A;  1BCP C;  4R9W A;  3J7Y W;  5C3X A;  1Z47 A;  4WFN 3;  1TR5 A;  5C6A A;  1JIC A;  1CA5 A;  1NAP A;  3GTK B;  4KK7 A;  2ENB A;  3DWA A;  1MBY A;  1GUT A;  3QO2 A;  3DUZ A;  4RGN A;  4KI0 A;  1LO5 D;  5I6W A;  4Z9C B;  2PO4 A;  1STY A;  4G7H C;  2K5Q A;  1JCK B;  1WTQ A;  2PZU A;  1IW7 C;  1GUN A;  2ZXP A;  4H13 C;  5DEH A;  4OGQ C;  4K5V A;  1R4Q B;  1X32 A;  1A3T A;  4C2M B;  5C3E B;  1SBB B;  5CBA E;  2F0D A;  2IL8 A;  3PO3 B;  5T1I A;  1DOM A;  1SYE A;  3X3M A;  5C4H A;  5A2Q L;  4IUU A;  4F7X A;  2VB3 X;  2RSO A;  2WAQ B;  3MWY W;  2JEB I;  4CKB A;  4IN3 A;  4XDX A;  1X3Q A;  1MI2 A;  4HR7 B;  2E2D C;  3BDO A;  3S1R B;  3S2D B;  2VXW A;  1ROD A;  3K5M A;  1A2U A;  1MD2 D;  5COR A;  5TSS A;  2I46 A;  3K5N A;  2QEJ C;  4ZLT F;  3V96 A;  4HMJ A;  2EZV A;  3HOW B;  1STG A;  2F0G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...