5CV7A

Crystal structure of staphylococcal nuclease variant delta+phs v66h/i92d at cryogenic temperature
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMHENAKKIEVEFDKGQRTDKYGRGLAYDYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS V66H/I92D at cryogenic temperature
rcsb
source organism Staphylococcus aureus
total genus 36
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2015-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5cv7A00
2F0NA 3QOLA 3D4WA 4LAAA 4TRDA 4K5XA 5DEHA 4KD3A 4KJOA 4J6HA 1KAAA 5CV6A 2EYFA 4F7XA 1JOOA 1ENAA 1STGA 2EYOA 2F0JA 5KRUA 5F2DA 2EXZA 2F0EA 3QOJA 5C5LA 4B9XA 5CGKA 5IGGA 3BDCA 5J39A 2RBMA 3DMUA 3C1EA 1KDAA 4K5WA 5JOBA 2RKSA 2EYPA 1EZ6A 1SNDA 1SNMA 2NUCA 3MZ5A 4NKLA 4ZUJA 2EY1A 3OMCA 5EGTA 5C4HA 1KDBA 5IGCA 1SNPA 4KV6A 5IGDA 2F0LA 3T16A 1JOQA 2F3VA 2EYHA 1SYCA 2OXPA 5IGBA 4F8MA 5IOCA 5JAVA 2WACA 4DF7A 5KGUA 3NHHA 1STHA 1AEXA 1EY6A 1A3UA 2PZUA 4H7BA 1SYBA 2SNMA 1STBA 5EKLA 3MHBA 3DHQA 5J22A 3TP8A 4E6IA 4IUNA 5E1FA 5I6YA 2F0OA 3OWFA 1EY8A 3TMEA 3E5SA 1F2YA 3TP7A 1SYFA 2F0SA 2HQEA 4K8JA 2F0DA 1KABA 2F0VA 2SOBA 3D4DA 1STYA 2F0HA 1STNA 3PMFA 3SK4A 3MEHA 5DAUA 4KY5A 3SK6A 5K5PA 3ITPA 4HTHA 1NUCA 1A2UA 2F0GA 3T13A 4R8NA 1TR5A 2EY5A 1II3A 3R3OA 4K2KA 2F3WA 3NP8A 1ENCA 4DGZA 5I6WA 4HMJA 3QB3A 3SHLA 2F0UA 2EY2A 5C5MA 1JOKA 4PMCA 4ZQ3A 5I9OA 2M00A 1EY5A 5I9PA 5HURA 1STAA 3RUZA 5J1ZA 2OEOA 4G57A 2F0WA 2PZTA 4HMIA 4QMGA 3ERQA 4K2LA 2PYKA 2F0QA 4IZ8A 4PNYA 3SR1A 1EY9A 2F0PA 2EYLA 3SK5A 5C3XA 1EY0A 3BDLA 5CC4A 1F2MA 3C1FA 5CV7A 1A2TA 5ISRA 5C3WA 4KHVA 4KY7A 4RKBA 2F0IA 2PW5A 4EQNA 2PZWA 1SNOA 4OL7A 5CV4A 4KTAA 1EQVA 1SYDA 4EQOA 2SNSA 3MVVA 5KIXA 5KYIA 4KY6A 3SK8A 4K8IA 2ENBA 4K14A 5IODA 4MIUA 5M9OA 4J1MA 4KJNA 4EVOA 1A3TA 4ODGA 1SYEA 2PQEA 4B9WA 5E3FA 1NSNS 5NUCA 3MXPA 3U9OA 1EYDA 1U9RA 1KDCA 4DU9A 3S9WA 5IIFA 2F0FA 1TQOA 3HEJA 1A3VA 4N9TA 4QF4A 1EYCA 1F2ZA 4YIJA 3D6CA 4KD4A 4ZUIA 4S3SA 4ME5A 3D8GA 5CR3A 1EZ8A 2LKVA 1RKNA 3P1HA 3P75A 5CV5A 4NMZA 3NXWA 4K5VA 4N9PA 3H6MA 2F0TA 3OSOA 3SXHA 5IGFA 5KEEA 4K6DA 3NK9A 1EY7A 2EYMA 3NUCA 4ID6A 2EY6A 5CV9A 4DFAA 5HGTA 4PMBA 1SNQA 3LX0A 3VA5A 4NP5A 2PW7A 1IHZA 4IALA 3NQTA 4EQPA 1TT2A 3EROA 5IGEA 2EYJA 2KQ3A 3V2TA 5C4ZA 4I65A 2O4XA 2KHSA 3HZXA 3OMGA 4QB4A 4NDXA 4WORA 3TP6A 3TP5A 2F0MA 4RKLA 1SYGA 1EYAA 5CV8A 1EY4A 1SNCA 2F0KA 2QDBA 5KYLA 3EJIA 5EKKA 2RDFA 4WRDA 2OF1A 1JORA 5C6AA 3EVQA
chains in the Genus database with same CATH superfamily
1VQ7A 1CA5A 4HSVA 3I7FA 2J7ZA 5M3FG 2I5MX 5DLQE 4C2MH 1KDAA 5I9OA 4DV5Q 4JV5L 4GKJL 4V190 2CW0D 1PXUA 1L0WA 4DK1A 5IGCA 3DXJC 4RAUC 2EYHA 1PTOB 5KGUA 2RF4A 3CPWA 3HOVG 4A3JB 1TWHH 3AQQA 1IYJB 2WB1E 4JCVE 2IWHA 3TMEA 3S1NB 4R4OA 4XT1B 1B8AA 3CP0A 4LFAL 4FO2A 1KC8C 3D4DA 2SOBA 3MEHA 4KY5A 3X3MA 1Q86C 2HIVA 2JA6B 3EBEA 5C3EH 5C44B 5JVH3 1OXSC 2JA5B 1P8LA 5GQOA 2CQOA 1QUQA 5JJLA 5C5MA 1PH9A 3HGBA 5IP7H 3CMAA 1TXYA 4OIJA 4POGA 4RH6A 1CQFA 2Z6KA 2PYKA 2JQOA 4IZ8A 5T1IA 3S15B 1WYDA 1B2TA 2HCIA 1PH6A 3S2DB 1GUOA 4FP5D 1ESRA 1Y1WG 3NELA 1TIID 1NTGA 1OXTA 5E4XA 1EIGA 2ZXRA 2MPMA 3NTKA 4X62Q 2XGTA 4CDCC 5M9OA 4FF3A 1B3AA 1WTOA 4KJNA 3TN2A 5I4DA 3JAML 4GOPA 1G91A 3MXNB 2JE6I 1VQAA 1BBWA 4JG2A 2PO4A 1JB3A 5KNDA 2ATWA 2GA4B 4NXNQ 4DV6Q 4GNXB 2R3ZA 4U673 1S3OA 4R4TA 1TWFH 4XT3B 4LK1C 2Y0SB 1IBMQ 2M9VA 4LFCL 4QUFA 1T9HA 1XPOA 2PI2A 1EEID 3A56A 1VQ9A 3GO5A 5BN5A 2JYOA 3G48A 2F0KA 4IURA 1WVLA 2F0NA 3HKSA 3D4WA 3ER0A 5DEHA 2FMCA 4A3JG 3GTMB 5JEAH 2N88A 2VUMH 4JV5Q 5IT9L 4GKJQ 3I4OA 2DGYA 2R7FA 2F03A 3DMUA 3C1EA 3SVMA 4K5WA 4RMFA 2E2DC 2IX1A 1Q81C 3K6OA 3D6WA 1B53A 1E22A 1XTDA 1JQYD 1HFGA 3CPFA 3H0GB 2K5HA 1GJXA 4FDBA 1PV4A 3MFYA 4LFAQ 4LJZC 1HTPA 3K5NA 1TY0A 5IYCG 1VMPA 2F0HA 3CXCA 3S16B 1FJGL 4HTHA 1NUCA 2F4VL 2HHHL 2BOSA 1AW7A 4CJ2C 1BF4A 4ZLTF 3GTJB 3I56A 5IP9G 1PLFA 1TU2B 2Q2TA 4JYAL 1BXTA 1W6JA 4LF9L 4NB3A 4BY7H 1BBUA 4K2LA 1YJWA 3T4AC 2UXBL 4UP9A 1I6VC 1HXYD 1ZEQX 4JVZA 2VW9A 1E3PA 3PO2H 3PO3H 1I4PA 5ISRA 3MFGA 5A35A 4KY7A 5CYUA 4XTCS 3HS0C 3M85A 4C1NI 4B3TL 1U4RA 1B1ZA 1PFMA 4AIMA 1JJ2A 4L63B 3M4OH 4K14A 1K8OA 1T5EA 5M3MH 1CSPA 1FYCA 1A3TA 1O80A 3OW2A 5LL6S 2Y0SG 3IKJA 2B2VA 1GHKA 1B9NA 4DUYL 2D62A 3N52A 1LT5D 4IO9A 1XPRA 1GKHA 1VF5C 2L9HA 2DNCA 3NXWA 4PZ7A 4IQZA 4B3RL 3NPPA 2B39A 1UEAB 1QVCA 3CCRA 2N49A 1J6QA 1YITA 3MA2B 5FJ8G 4OX9L 4LFCQ 2KECA 1EQTA 1K0SA 2ZT9C 4NP5A 4CKCA 2AMCB 4IALA 4DK0A 4OXPA 5ELNA 1XTCD 4XXEA 4A75A 3DEOA 1VQMA 1SYGA 1Z9FA 2QDBA 1B9MA 3J81i 2VXWA 1O7YA 1I5FA 1QJOA 3GD7A 3NTIA 1S5BD 3J7ZC 3NTHA 1JOOA 3DWAA 2ZJPA 4Q0FA 1CQVA 2QILA 2R61A 5ELFA 5GAGC 5G3LF 3K57A 2YV5A 4RG1A 5C4HA 2BA0A 4OELB 4A3FB 1DOLA 3M7NA 1SYCA 2WACA 2H1EA 3CC7A 2A8VA 2Z1CA 4EQ5A 1VQNA 2L5TA 3TP8A 3I73A 2JA7H 5ELCA 4A3EH 4C3JB 5C0XJ 4MTKA 2MGSA 1QOHA 3TDQA 3GTOH 2E2IB 3L7ZC 1VQ6A 4A3BB 1X3EA 1FJGQ 1UNSA 2F52A 3Q0AA 2F4VQ 2PQAA 1RL2A 2HHHQ 3VR5A 2O5IC 1B3QA 4C3HG 4DGZA 2QEJC 1SXTA 4JYAQ 4G7OC 3K59A 4LF9Q 1TWCH 1JWUD 4YHHL 4L8JA 2UXBQ 4A3DH 4DR6L 1KLGD 4C3IH 1EOTA 4CKBA 2EJMA 3CCQA 2B63B 3SK5A 1HNZL 1GOZA 1JMCA 5I2XA 2WP8J 4PG3A 4B3TQ 4KHVA 1S5FD 5LMUL 3CCEA 3E9IA 4R9WA 3F2BA 4K6LA 3F2DA 1SN8A 4KK7A 1RTOA 1NAPA 1PFNA 1L1OA 1VQDA 3HOXG 1JJGA 3MXPA 4LF6L 4DUYQ 4JI2L 1TWAH 4KI0A 4Z9CB 2LY7A 3KF6B 4R4QA 1IL8A 4KD4A 4B3RQ 1EU4A 4JBWA 2IPKD 3FVQA 3I8ZA 4OX9Q 3RZDB 5KEEA 2UUAL 2EIFA 3I4MB 3BYTB 3QWNA 3FHWA 4HIOA 2ZXOA 5HGTA 1PRTB 1H9RA 2RVLA 2JSOA 1Q8IA 2WAQE 3MXUA 5BR8L 4WJ4A 5C4ZA 3LNNA 4QB4A 1C8CA 4IN3A 1O78A 2YTXA 1D5MC 1Q8KA 4A3FG 3J81c 2NVXH 1GM5A 4N8FA 1PH2A 1VMCA 4C2MB 4K5XA 2K03A 2Z9HA 3PIP3 2K5WA 3BVMA 5FO9B 3GTKH 3A7LA 1ZXTA 2A69D 5D65A 1VQIA 2F0EA 1G2TA 4C3JG 1E24A 3Q22A 3W1BA 5EGTA 1TS2A 1X3FA 3BZCA 1SNPA 1TWHB 1ZYRD 1VQ4A 1CHPD 4JK1C 4DF7A 4ALPA 5G3LD 1LTID 5I2YA 3AMUA 1SYBA 5EKLA 3TREA 1EFWA 2JA8H 2F0OA 2KCNA 4A3GH 3E5SA 4A3IH 3JAMi 4POFA 3CQZH 4JBKA 2PMZE 4HIKA 2B63G 4O1NA 3T1HL 1TR5A 1BCPB 4YHHQ 1ENCA 3ND9A 1YJNA 3K0YA 2UU9L 3MC0B 2EOTA 3RLFA 1EWIA 2SDFA 4BA2I 5EQ0A 1K9MC 1HNZQ 3WOEA 1QUQB 2F0PA 5LMUQ 4F87A 5LMNL 3AFPA 1VF7A 1MBYA 2MHVA 2KA7A 1HPCA 3UDFA 2F0IA 2PZWA 3HOUB 1SYDA 3MVVA 3RR5A 1EUJA 1HZ9A 1YJ9A 3I4MG 4BBRG 4LF6Q 4JI2Q 1SEBD 2I0QA 2LXKA 2EPBA 3EN2A 4K0KL 5IIFA 4WFN3 1A3VA 4GOPB 3CC2A 1TWFB 3VYUA 3I4NB 2UUAQ 4IFDI 2NTTA 4B3SL 4RCOA 2D0PA 3F2CA 4K6DA 1LV9A 2Q2HA 5BR8Q 4KMUC 3LX0A 2BCOA 1G291 2PW7A 3M4QA 2EE1A 3NQTA 1QZHA 4HSPA 1JCKB 3ICEA 4I65A 2C5CA 3SGIA 1EYAA 5FLMG 4NXML 3EJIA 1JORA 4CJ0B 1NJIC 1IZ6A 1KAAA 3R2IA 1D1KA 1A63A 3QOJA 2A6ED 1B70B 4A3CG 3RN5A 3G4SA 3DWPA 1NY4A 2JJQA 1F9PA 2K01A 4KV6A 1YNJD 2K50A 3HKZB 4ZYSA 1QWYA 5IYBG 2NN6I 1DOKA 3PIOA 2A68D 4P71A 3I70A 5J22A 4O0AA 3D31A 4DAVA 3TZDA 4JI6L 1AE3A 4MHEA 3S14B 1DXMA 3TP7A 1SSOA 2K5NA 3JAMc 2HQEA 2R7ZG 1KNAA 1PTOF 2WAQG 3T1HQ 3EIVA 4TVAB 1LTGD 3SK6A 3GP7A 5FKAC 1AN8A 3TSSA 4X6AH 2UU9Q 4K2KA 2O5JC 1WCMH 5D3DA 4LUZA 4EGVA 1PMRA 4DV5L 1VQHA 4BY7B 5E4WC 3HOUG 1HNXL 2IT1A 1DZ1A 1YNNC 3PO2B 1STAA 5EPLA 3PO3B 4LNQA 2OEOA 5IYDH 2YU9H 5LMNQ 1AP0A 1C4QA 3ERSX 4JOIA 1K8AC 4YWLA 1OTCA 1GUGA 2RSNA 1DONA 3FP9A 3M4OB 3OIPA 2LMCB 2BDOA 2JP1A 3I4NG 1GUSA 2CFMA 3HG9A 3ULJA 3GTQH 1FNWA 1VQ5A 2HD3A 4K0KQ 4PV1C 3M3YH 4L5RC 1NSNS 1NR2A 1N32L 4KKTA 5IT9c 2NVQB 1V1PA 1ZYRC 1QNKA 1BDOA 2Z0SA 4B3SQ 3F8TA 5CR3A 5IGFA 3K5MA 4A93G 5JEAG 1O7ZA 3H3VC 2CWPA 3VA5A 2Z6KC 1IXRA 1HFNA 1PH4A 1TY2A 4X62L 1ET6A 5C4XH 4NXMQ 1XMQL 5A2QE 1EL0A 3BVZA 5J39A 4WRDA 3HKZG 2I5LX 3IFTA 2B2UC 4MTNA 2C35B 1CZGA 1F9QA 4QY7A 1STGA 1LTTD 4DPGA 3NEMA 4JI7L 3HOZH 3KJPA 4CKEA 2A5HA 1UE5A 1X3PA 3M4PA 4BS9A 2OTLA 2R92G 4F8MA 3WWVA 4R4CA 4A3EB 3HOYG 1WOCA 4JI6Q 1N33L 3GTOB 2IHEA 3DHQA 1S5CD 1X3GA 3VYRA 1WTPA 4FXKC 4CDFC 4IUQA 2H4OA 1I50H 3J7YW 1GUTA 1SYFA 1KL9A 2R93H 1R4PB 1WTRA 3J81j 2X6LA 3T51B 4DV1L 1E2ZA 4RFBA 1HR0L 1A2UA 2F0GA 3STBD 1IW7D 3R3OA 4MNOA 2F3WA 2PQAB 4OGQC 1Q46A 1HNXQ 4A3DB 1LO5D 4X3UA 1PTOD 4IOAA 3QJYA 1CKOA 2GVBA 1YZ6A 4LWCA 1JOKA 1UE1A 1I6HH 1V1QA 4NW2A 1BUVT 5FLXL 3E0JA 1H9SB 4X65L 2Y0SE 5GAHC 1I3QH 1K3BC 1Y8NB 4JI1L 4BXXG 1KRTA 4BBSH 4BY1H 4P75A 2Z4HA 3GQBA 4A3MB 4LW1A 4EQOA 4KY6A 3AFQA 1N32Q 1X32A 3ONAB 4GKKL 1YBYA 5LMNW 1U9RA 1LUZA 1GVPA 1V9PA 2A73B 4ZRZA 1YNJC 3KDFB 4YIJA 2VZAA 1LT6D 4CDDC 3RLOA 1WTWA 4Y52H 1D6EC 1AE2A 1NMFA 3FKIG 4CHTB 1HA5A 2A68C 3VR6A 2CHBD 3NK9A 2HDLA 4J15A 4IOCA 3H3VH 3V96A 2RA4A 3U50C 2VQFL 4A4IA 1HQMC 2OT2A 1IHZA 3Q23A 2B2UA 1T5XD 1XMQQ 5M5WH 1Y14B 3CAMA 4YCVA 2NVXB 2K7VA 4WORA 3OMGA 3RMHA 2F0MA 2HDMA 2RSOA 1TWGH 4RGTA 3GTKB 2K5QA 2AWOA 1O7IA 3V05A 1N36L 2X6GA 1NNXA 4JI7Q 4QJFA 5JPMC 3URYA 2E76C 2EYFA 4IJHA 1ENAA 5F2DA 2B2VC 3G6JB 3KLWA 3TEHB 2EYPA 2UUCL 3RNUA 3CRKC 4L5TA 1H95A 5LL6X 1N33Q 4XQJA 1C48A 2KJXA 3RZOH 2ICEC 2ALYB 2ZJQA 3CQZB 2Z8LA 2I5HA 5ELEA 2A6HC 4DV1Q 1HR0Q 4X3KA 2F0VA 3PF5A 3TS0A 1KTKA 5TSSA 3S2HH 2EY5A 4DK6C 4KN7C 1Z7TA 1KAWA 4QUCA 1QZGA 1Y8OB 3E6ZX 1EFID 3AU7A 4A3MG 3NBIA 1VDZA 4UP7A 4X65Q 2KEDA 2JA6G 2B3GA 1LTRD 5C44G 2UUBL 2FFKB 5JJIA 5AJ3L 4JI1Q 4DNIA 1JWSD 2JA5G 1B50A 1EIHA 1KXLA 5CV7A 2LSSA 4JBJA 5ELOA 4DV3L 4UY8C 3EQLC 2F4IA 4WJ3M 1HZBA 2K52A 2ICIA 5HGQA 3UDIA 3BZDB 1IL2A 1TS4A 4YCWA 4IFDG 4CGYB 1Z6HA 5K36G 3OYYA 3SK8A 1BOSA 3I72A 1X65A 4GKKQ 4ZK9B 3VYTA 1ICFB 4A76A 2NVTH 4EVOA 3GTLH 4C1NK 4P74A 2Z4IA 4ILWA 1XNRL 1WD1A 1EYGA 1VQ8A 1TQOA 4QGUA 3K5LA 1F2ZA 1JB7A 3QG1A 3KLSA 1I4GA 2PCFB 4DV4L 2UXCL 2VQFQ 4QIWB 4OO1G 1QCBD 3FEWX 1VQJA 1A6XA 4HCEA 3GTGH 1PYWD 4A3LG 1IYUA 3AB9A 2WINB 5A2QL 2JEBI 2O4XA 3FDTA 2B8FA 1M1KC 2CW0C 3STBC 2L1BA 1CKMA 1N36Q 1PRTF 1XMOL 5M3FH 2NN6G 3NENA 1L1OC 3NBHA 4J6HA 4DR7L 3KYHC 5CGKA 2UUCQ 3MZ5A 3IFDA 4G7HC 1RD9D 1EIYB 2E2JB 1FD7D 1KD1C 1U5KA 1JR0D 2KBNA 2K5VA 4M1UB 2Q8IB 3HOVH 2L4NA 4HR7B 2VNUD 1ML0D 4CDEC 1S5ED 4GN3B 1EY6A 5C0XG 3MHBA 1IBKL 4LF4L 1QNUA 4IUNA 3OW7A 1PHJA 4GLVB 2XRQD 4DNRB 3H0GG 1IKMA 3PMFA 3VR3A 3GTPB 3S1MB 1STNA 4XYQA 4YY3L 4H44C 3KFUA 3DUZA 2TSSA 1CI3M 2D0OA 2QW7A 4RGNA 3M9BA 4HMJA 1U0LA 1SBBB 2CQAA 2VQEL 4KHPL 1DOMA 3D3RA 2UUBQ 5AJ3Q 2M00A 3OOCA 1TKWB 3MXGA 3ZYYX 3TRZA 3ERQA 1R9TH 2FHTA 3W5OA 4DV3Q 1PH1A 1HR0W 4XYOA 1BCPF 1Y1WH 3LWEA 2FXQA 3IAYA 4PZ6A 3A54A 3H91A 3M3YB 2SNSA 2B2YA 1D2BA 4A3KB 4DV7L 4GLXA 2NBFA 1Q7YC 1XNRQ 3WDNA 2AUJD 3F2UA 5ELBA 3H94A 4DA2A 3HOWB 4DV4Q 2D9UA 2RHQB 2WKDA 2GN5A 1AZQA 1VQCA 3D6CA 1PYBA 4S3SA 3KBGA 1MI2A 3D8GA 2VL6A 2UXCQ 1LT4D 1RDPD 2HT1A 1VQEA 4FNFA 2FINB 4OONA 2ZTCA 3QIAA 5JVG3 5CBEE 3BJUA 4O42A 2N8NA 1N8RC 2IY5B 4JI5L 2KHSA 2XTIA 1PH3A 4LFBL 3OPOA 3J80E 4HJ8A 3KBXA 1XMOQ 3OTOL 3L9AX 5NUCA 4IUUA 1L0XB 4A3JH 3HOZB 4DR7Q 5LHY1 2K04A 3I3CA 3DEPA 1W2BA 2XN9C 1M8AA 3S1NH 1V1OA 2VY3A 2AQ1B 4NKLA 1LTSD 1SNDA 1SMYD 2NWGA 3OMCA 3ULLA 1J9OA 3T1YL 1IBKQ 2DJGC 4L6TB 3NHHA 1STHA 4LF4Q 3I90A 5EAYA 1CKNB 1ENFA 1N34L 4H0LC 5IYCH 4YY3Q 2J0TD 2DY7A 1SMXA 4KKSA 1Q90A 5K5PA 3U9SA 3T13A 1I6HB 5IP9H 3MXNA 2VQEQ 4A3BG 4KHPQ 1I4RA 5CORA 1TVXA 1LYLA 1HJPA 4JI3L 4R8IA 4GNXA 2F0UA 2EY2A 3K7UC 5I9PA 4A3KG 1I3QB 2ES2A 2OWOA 1C9OA 4IPGA 4TSSA 3BDLA 3HOWG 1JJCB 1AZPA 1EU3A 3OIQA 4RKBA 5C3EB 2PW5A 1FL0A 3Q24A 4DV7Q 3KLSX 3DM3A 3W1GA 2K05A 1VQPA 1BCPD 2ENBA 4HN7A 2QA4A 3LWUA 5E3FA 1AH9A 2KUMA 1EYDA 1PZJD 2NZ1D 2EJGC 4DU9A 3S9WA 2F0FA 2IL8A 1LTLA 1QE6A 2XVSA 5M5XH 5FLXE 2H5XA 4K5VA 5FJ8H 2CWAA 1MJEA 3A7AB 2V1CC 3RD4A 3HKZE 3PUZA 4X66L 4DFAA 1MHWC 3EA6A 4IUPA 4NPSA 3GV3A 1VQBA 2B2WA 3CW2C 1B44D 4JI5Q 1R4QB 4JOIC 4LFBQ 1DCZA 2C9OA 4NDXA 1F77A 1SAPA 3VR2A 3OTOQ 3LGJA 3G71A 2K1BA 5C6AA 3EVQA 2XRSD 1ASYA 2JK8A 2QF7A 3CF5A 3R8BA 2F0JA 4KN4C 5JPNC 3I2ZA 1WI5A 2CVRA 3T1YQ 4RA8A 2MO0A 3RZOB 3UDGA 4J8QA 4R4IA 3HFZB 1PH8A 4DN4M 3GTJH 4IUTA 3VDYA 3MTSA 2F1MA 4P72A 3DWQA 3L0OA 1N34Q 2VB2X 3G7LA 4OO1I 2VUMB 4JI4L 3CCUA 2KCMA 2WFWA 1CTMA 3RN2A 1ICWA 4FF4A 1STYA 4C3HH 2IW3A 5IWAL 4HCSA 4JI3Q 1X56A 5C3EG 3K81C 3QB3A 5E7NA 4PMCA 1EY5A 4OHJA 4DUZL 2F0WA 5IP7G 1X54A 1EY9A 1A62A 5C3XA 3E0EA 3C1FA 3PUYA 5C3WA 2K14A 3SDZA 2E2HH 1Y8PB 4RHRA 4KTAA 1XYIA 1B4OA 4JI0L 2ID0A 2MO1A 5JJKA 4RHSA 2KEEA 4MIUA 5C0XI 2KOLA 3HOXH 3PIO3 2D5DA 1F9SA 4BWGB 1E1OA 1I4HA 2ASBA 2Z6BA 4QF4A 3PUWA 3J7AF 2XWBB 3BDOA 4DAYA 3P1HA 4NMZA 1WD0A 3U58A 3OSOA 1OXUA 4X66Q 3GTGB 1KHIA 1WJJA 1D5ZC 4Q5VA 2EYMA 1M90C 2EY6A 2D2CC 5M3MB 1SNQA 1P16A 5EJWA 2L0CA 3FMCA 2E5LL 4DV0L 2A69C 2HQLA 2EVBA 3GV6A 3J80L 1K8GA 3TP6A 2MNAA 2MP1A 4A3FH 5M3FB 4RCNA 4C56C 4HIMA 5COYA 1S72A 1LTAD 2ZTDA 1ZKOA 3PUXA 4DKAC 1K8MA 4LAAA 1I94L 4G7ZC 2NVYH 3A74A 3PQIA 3TZUA 5CV6A 4C3JH 1IYVA 4B9XA 4FXDA 2VUMG 2LS01 3J81L 4DR1Q 2RKSA 1EZ6A 3PF4A 2R7DA 1EEFD 1PH7A 2DJFC 1KDBA 4LF5L 5IGDA 2K75A 2UXDL 3OWEB 1SE4A 4ME3A 4JI4Q 1HCZA 2IX3A 3CMEA 1HQRD 1LLRD 3L3OC 2ZXPA 2B63H 4JC0A 2F0DA 5IWAQ 2BH2A 1RODA 3PCOB 1D7QA 3DM1A 3ITPA 4B3ML 3KF6A 1KQSA 1S5DD 1BKBA 3S24A 4DUZQ 1SLJA 1RCVD 2JA7B 3HRZC 1Y1WB 1H9MA 1S40A 4PZ8A 1HZCA 4HMIA 5FO7B 1UEBA 2KHIA 5GAEC 2EYLA 4BY7G 1QVFA 1MGSA 1DJRD 4R1JA 1A2TA 2BH8A 3PO2G 4JI0Q 1NR4A 3PO3G 1MSGA 5EKIA 4OL7A 2HUGA 3BVGA 3I4MH 1SROA 4BBRH 1TWCB 3W3AA 1RF2D 1TS5A 1SFOH 4PMWA 2K32A 1TS3A 3J7A5 5M3MG 4C3IB 1JWMD 1CSQA 1E2VA 1HUMA 2XWJB 1OXVA 4OWTB 2K33A 2LKVA 1RKNA 1RTNA 4AYBB 1IBLL 4ZKCB 1EY7A 2L11A 3NUCA 1J5EL 2E5LQ 4DV0Q 3QO2A 4PMBA 3PSIA 5EBCA 3BS1A 3OHXC 1YHBA 1TWAB 2A6EC 1XX8A 3M4YA 4OWXB 5FLMH 5BN4A 1A8VA 4RKLA 5KNBA 2BE5D 2PPBC 1SNCA 3TQYA 3I55A 4HJ9A 1XJVA 1L1OB 3ND8A 1I4XA 3F1ZA 1I94Q 2RHSB 1AFPA 2A74C 2QGQA 4A3CH 1K83H 2RBMA 5M5YH 4LF5Q 1MKHA 2UXDQ 1SR3A 5IYBH 4GS3A 2B29A 2OXPA 2OCEA 5IOCA 3BZKA 2AUKA 2HIXA 2PZUA 1ASZA 1VQLA 5CMDA 4E6IA 1ET9A 1HTLD 5E1FA 5I6YA 1BO0A 2JXMB 3NSWA 2JA7G 4FXGC 2R7ZH 4A3EG 2X69A 2CH4W 4MN3A 2F0SA 4Y7NH 3MAQA 5AFWA 3IRBA 4B3MQ 2MQHA 3O13A 3WOFA 1PFBA 1X6OA 1HA6A 1ESFA 1PFSA 3NP8A 3HOUH 3VYSA 1PZID 1Y1VH 4OWWB 1CZWA 1VQGA 2FMMA 2JA8B 4IPDA 3MEFA 3CCSA 2AQ2B 4A3GB 1DM0B 3S17H 4A3IB 4QIWE 1X3QA 4DV2L 4A3DG 2DUDA 2F0QA 2QDLA 2AHOB 2E74C 1VQFA 1QILA 4C3IG 3K80C 3U4VA 4DR5L 2E75C 3I4NH 2WB1B 1V8QA 3S1QH 1EQVA 1Q1EA 4AYBG 3K7AH 4HJ5A 4FVMA 5IODA 1J8IA 2LXJA 2DN8A 3KF8A 1PDQA 2CKZB 2AQ3B 5M5XB 3U9OA 3KLRA 4RWSC 3HEJA 5HY6A 1PVOA 1HHVA 1B7YB 5GROA 4ME5A 3CKIB 3K8AA 1IBLQ 5CV5A 4A93H 1J5EQ 4N9PA 4X3TA 1UWVA 2Q8RE 1PH5A 3TS2A 1VS0A 3BYYB 1UAPA 4O2DA 4HEDA 2IX0A 2WKCA 1MD2D 4DK3C 4X3SA 4FF2A 4YCUA 1CT1D 2KQ3A 2RDHA 3J7AV 2V4DA 3VR4A 2JN4A 4TKOB 3FPPA 1RHPA 2B2YC 2Q2IA 4XQQA 5L37A 3H3VI 1HNWL 4N8X1 4I7AA 1CK1A 1H9KA 2MUYA 3Q6SA 1FGUA 4F7XA 5DM63 1VQKA 1GD7A 1XNQL 3S14H 2A1AA 4KHZA 4HJ7A 5C5LA 1CFMA 3NE5B 1G2SA 2R92H 2OTJA 3T16A 3HOYH 1K28A 1Q82C 3SEBA 1GO3E 4GZYC 1AEXA 2WIIB 2PNRC 5D14A 1STBA 1W6KA 1IW7C 1XXGA 5EBDA 1PTOC 2DY8A 2B2TC 4C3HB 4UHVA 2P5ZX 2JA8G 4A3GG 3P7JA 1U4PA 4A3IG 4DR4L 2K28A 1G6PA 4DXGA 1SDFA 2NTSA 4DR3L 4LUOA 4IFDJ 4LF7L 2QCPX 2WB1G 3ZJYC 5I6WA 1L2FA 3SHLA 1A0IA 3K5OA 4DV2Q 4ZQ3A 2L55A 3BU2A 5EPKA 4DXFA 5C4JH 1S4ZA 2ZM6L 1OO9B 2L15A 1RIPA 4WJWA 3SR1A 2E2HB 4DR5Q 2NVQH 2Q2UA 4BXXH 3S1RH 2BE5C 1GHJA 1UE6A 3J80i 2ZJRA 3C2PA 3HOXB 1U4LA 5CV4A 1WCMB 1YHQA 1KRSA 3E3XA 3UDXA 3M7GA 3A5ZB 3GDEA 4ZCKA 4K8IA 3A8JE 2J4XA 3P20A 4J1MA 1YEZA 2PQEA 1FGBD 2YU9B 1PZKD 1EQQA 1WTVA 1NE3A 3FKIH 1W3SA 1M4VA 2QKIC 4L5SA 3AYHB 1WTQA 1D8LA 4IPHA 2N78A 1QG7A 2LFNA 4HIDA 4AH6A 1YIJA 2OQKA 4GNXC 4DAYB 3GTQB 4UAIA 3CCLA 3CCVA 1C0AA 4QQBX 3EROA 1YI2A 4KLKA 2A19A 4V0BA 1UUPA 3PV0A 2K5DA 2VS1A 3L2PA 4GN5A 4TQUS 3PUVA 5CV8A 2NVYB 1EY4A 5EKKA 3A8IE 2RDFA 1HNWQ 2OF1A 1XNQQ 3QOLA 4JI8L 4TRDA 3DLLA 4UPAA 1V1PB 1SE8A 1D1IA 2SEBD 2ZTEA 2L12A 2EYOA 1SNMA 5C4XB 2BA1A 2EDGA 3KK7A 1K0RA 4BA1I 5DNFA 2B2TA 4QCLA 1LACA 2F0LA 3I4LA 4ZKBB 1H9SA 5IGBA 1JOQA 1EOVA 1KLUD 1Q3LA 2SNMA 1CM9A 2YYZA 1PTOH 4IPCA 4XIGS 2B2WC 4DR4Q 1E7ZA 1Q12A 3CC4A 4DR3Q 3T53B 3SE0A 2NYZD 3SK4A 1SJHD 1PRTD 3RLNA 4LF7Q 3I91A 3J81E 4A3MH 2AKWB 3KDFA 3E9HA 1FR3A 1WCMG 5ELDA 2JA6H 2ZM6Q 5FO8B 5C44H 1EWCA 1I50B 5J1ZA 2B8GA 5T1GA 2PZTA 2R93B 2JA5H 2QEXA 3A0JA 2XNAC 1HUNA 2KHJA 5IYDG 1KNEA 4G4KA 2MFIA 5CC4A 4BBRB 1QB5D 1V43A 3J80c 1LT3D 2N55A 1SFOB 3S15H 4IFDH 5K36H 1HZAA 3PIPA 5KYIA 3S2DH 1YNND 2GVAA 2OQ0A 4P2CB 1JT8A 1K3RA 1K73C 1GXDC 1SYEA 2FJ2A 2JEAI 1FNVA 1KDCA 3FPUB 4F88A 4HAEA 4N9TA 1YVCA 2DNEA 2EJFC 4IJLA 3NWSA 3P75A 4BBSB 3A5UA 4BY1B 4OO1H 3SXHA 5GADC 1H9JA 1BR9A 1NBWA 2G9DA 2NZHA 4LMQD 3H09A 4A3LH 3KJOA 4L5QA 4CBVA 1JE5A 1VCIA 1NMGA 2EYJA 2M2LA 4DAMA 1F2LA 2PI2E 4LF8L 1PYSB 3KUPA 3TP5A 4PQXA 1F9RA 3H15A 3MWYW 5C4XG 1Q1BA 5KYLA 2RQXA 2XSCA 4JI8Q 1ILQA 1E2WA 4YWKA 2EXDA 1I4QA 2NN6H 1K83B 4X64L 5M5YB 2TMPA 3CU7A 1JE4A 1CA6A 2JA9A 5KRUA 1WTXA 2EXZA 5J3BA 3C46A 3BDCA 5JOBA 5M5WB 4RGMA 2NUCA 4GLAC 4ZUJA 3GTMH 3HOZG 2RCFA 1HH2P 4DR6Q 1TWGB 3CCJA 3UI2A 2EZVA 5C0XH 1A3UA 2R7ZB 4H7BA 2WAQB 1RJTA 4Y7NB 3UE1A 1QVGA 3OWFA 1F2YA 3H0GH 2Q8TA 2CCZA 1JICA 2K4KA 2IJ0A 4K8JA 3B6YA 3U4ZA 1Y69U 1JC7A 2R93G 1KABA 2HCCA 1L0YB 1FNUA 1Y1VB 5IE8A 3EFXD 5FLXc 3S16H 3S17B 4DR1L 4LUVA 4OEMB 1SRUA 1DGSA 1CUKA 2VB3X 5HURA 3RUZA 1XPUA 4PNYA 3T56B 3S1QB 1EY0A 3W2DA 3K7AB 1WTHA 5H1SE 2WV6D 2I46A 3D0FA 2G9HD 1EWHA 3S2HB 1C7YA 3CRLC 4H02A 3HP3A 4M8AA 2KVMA 2MJ8A 4UP8A 2YTYA 4BY1G 5KIXA 4BBSG 4FYDA 3CD6A 2XIWA 1GUWA 1PA6A 4HJAA 1CHQD 2PMZB 3KOJA 1A15A 1Z47A 2E8GA 3FRPB 5EPJA 3JAME 1MIUA 4AQYL 1GUNA 4A93B 3KF8B 1MSHA 4ABNA 1FVIA 4ZUIA 2RDGA 5BN3A 2BDNA 4UDUC 3R93A 5DM73 2F0TA 4MZ9A 3A8KE 5CV9A 2NVTB 3GTLB 4DNTB 1O7LA 4LF8Q 1TT2A 4JW0A 5IGEA 1G51A 5JJZA 3V2TA 4DAPA 1PRTC 1DD2A 2E2JH 4DR2L 1SMYC 5D3IB 4QL5A 1ONLA 1XWEA 2YTVA 4JPBW 4X64Q 3CHBD 3N6RA 4H13C 2NB0A 3JC66 1HRJA 1G8ZD 4KD3A 4KJOA 2PNHA 3BG3A 5FOBB 5IGGA 2R92B 5IT9E 3G6EA 3HOYB 4XQNA 1MJCA 1X55A 2EY1A 1DYQA 1YNXA 1VQOA 3GTPH 3S1MH 3QR8A 4CJ1B 2F3VA 3CCMA 1LABA 1D5XC 1Y1VG 5JAVA 3TBIB 5KNCA 2R6GA 3K0XA 2EQSA 2IHFA 2NZOA 2AWNA 1NCVA 4ZAIA 2RCNA 4FF1A 1IKLA 1EY8A 3A55A 4ULLA 1OXXK 2KENA 1STEA 1WFQA 2O2LD 1BNZA 5DAUA 2E2IH 3K58A 4A3BH 3HOVB 3NBHB 4R8NA 1II3A 5FK9C 5C4JB 1E1TA 4RGOS 1G6ZA 2CH4A 4U68A 3C3LA 1YHAA 4A3KH 4AYBE 3NWTA 1BCPC 3S1RB 4YWMA 1LTBD 2A6HD 4G57A 4APVA 2I07B 4QMGA 1X9NA 3HOWH 2KCCA 3D4RA 2K6AA 4B08A 1F2MA 5CBAE 4EX5A 3VA7A 1SJED 2KCTA 4EQNA 3Q8DA 4XDXA 1SNOA 5IY0A 1BVSA 1U4MA 3ULPA 1SE2A 3UE0A 3PGZA 1LM0A 4ODGA 4AQYQ 1BBXC 3FKIB 1KIXA 4B9WA 1R9TB 1E0BA 3IL8A 3AEVA 1SE3A 1EYCA 1EQRA 1EZ8A 2G5DA 3R2TA 4GOPC 3H6MA 4NXNL 1ILPA 4DV6L 2N3SA 4ID6A 1EIFA 3RZDH 4IUVA 4JBMA 5JEAJ 2F3IA 4EQPA 1IBML 4DR2Q 4KKUA 4GN4B 3X3NA 1CKNA 3HZXA 3NQIA 4OIKA 1BQQT 1UE7A 4P73A 4I7ZC 1N9WA
chains in the Genus database with same CATH topology
1CA5A 4HSVA 2J7ZA 5I9OA 1KDAA 4V190 2CW0D 1PXUA 4DK1A 5IGCA 3DXJC 4RAUC 2EYHA 1PTOB 5KGUA 4A3JB 2IWHA 3TMEA 3S1NB 4XT1B 4FO2A 3D4DA 2SOBA 3MEHA 4KY5A 3X3MA 2JA6B 5C44B 5JVH3 1OXSC 2JA5B 5C5MA 3HGBA 4OIJA 4RH6A 1CQFA 2PYKA 4IZ8A 5T1IA 3S15B 1B2TA 2HCIA 3S2DB 1GUOA 4FP5D 1ESRA 1TIID 1OXTA 5E4XA 1EIGA 2ZXRA 2MPMA 3NTKA 5M9OA 4FF3A 1B3AA 1WTOA 4KJNA 3TN2A 5I4DA 3JAML 1G91A 2JE6I 2PO4A 1JB3A 5KNDA 2GA4B 2R3ZA 4U673 4XT3B 4LK1C 2Y0SB 2M9VA 4QUFA 1EEID 3A56A 3GO5A 5BN5A 2JYOA 2F0KA 4IURA 1WVLA 2F0NA 3D4WA 5DEHA 2FMCA 3GTMB 5JEAH 2N88A 5IT9L 2F03A 3DMUA 3C1EA 3SVMA 4K5WA 2E2DC 2IX1A 3K6OA 3D6WA 1B53A 1JQYD 1HFGA 3H0GB 1GJXA 3MFYA 4LJZC 1HTPA 3K5NA 1TY0A 1VMPA 2F0HA 3S16B 4HTHA 1NUCA 2BOSA 1AW7A 4CJ2C 1BF4A 4ZLTF 3GTJB 1PLFA 1TU2B 1BXTA 1W6JA 4K2LA 3T4AC 1I6VC 1HXYD 1ZEQX 1I4PA 5ISRA 3MFGA 5A35A 4KY7A 5CYUA 4XTCS 3HS0C 3M85A 4C1NI 1U4RA 1B1ZA 1PFMA 4L63B 4K14A 1K8OA 1T5EA 1FYCA 1A3TA 1O80A 5LL6S 3IKJA 2B2VA 1GHKA 1B9NA 2D62A 3N52A 1LT5D 1VF5C 2L9HA 2DNCA 3NXWA 4IQZA 3NPPA 2B39A 1UEAB 3MA2B 2KECA 1EQTA 2ZT9C 4NP5A 4CKCA 4IALA 4DK0A 4XXEA 1XTCD 3DEOA 1SYGA 2QDBA 1B9MA 2VXWA 1O7YA 1QJOA 3GD7A 3NTIA 1S5BD 3NTHA 1JOOA 3DWAA 4Q0FA 1CQVA 2QILA 2R61A 5ELFA 5G3LF 3K57A 5C4HA 2BA0A 4A3FB 1DOLA 3M7NA 1SYCA 2WACA 2H1EA 2Z1CA 2L5TA 3TP8A 3I73A 5ELCA 4C3JB 5C0XJ 2MGSA 1QOHA 3TDQA 2E2IB 3L7ZC 4A3BB 1UNSA 3Q0AA 3VR5A 2O5IC 4C3HG 4DGZA 2QEJC 1SXTA 4G7OC 3K59A 1JWUD 4L8JA 1KLGD 1EOTA 4CKBA 2EJMA 2B63B 3SK5A 1GOZA 5I2XA 2WP8J 4KHVA 1S5FD 4R9WA 4K6LA 4KK7A 1RTOA 1NAPA 1PFNA 3MXPA 4KI0A 4Z9CB 2LY7A 1IL8A 4KD4A 1EU4A 4JBWA 2IPKD 3FVQA 3I8ZA 3RZDB 5KEEA 3I4MB 3BYTB 3QWNA 2ZXOA 5HGTA 1PRTB 1H9RA 2RVLA 2JSOA 1Q8IA 3MXUA 5C4ZA 3LNNA 4QB4A 1C8CA 4IN3A 1O78A 1D5MC 1VMCA 4C2MB 4K5XA 2K03A 3PIP3 2K5WA 3BVMA 5FO9B 3A7LA 1ZXTA 2A69D 5D65A 2F0EA 1G2TA 4C3JG 3Q22A 5EGTA 1TS2A 1SNPA 1TWHB 1ZYRD 1CHPD 4JK1C 4DF7A 5G3LD 1LTID 5I2YA 3AMUA 1SYBA 5EKLA 2F0OA 2KCNA 3E5SA 4O1NA 1TR5A 1BCPB 1ENCA 3ND9A 3K0YA 3MC0B 2EOTA 3RLFA 2SDFA 4BA2I 5EQ0A 3WOEA 2F0PA 4F87A 1VF7A 1MBYA 2MHVA 2KA7A 1HPCA 2F0IA 2PZWA 3HOUB 1SYDA 3MVVA 1SEBD 2EPBA 5IIFA 4WFN3 1A3VA 1TWFB 3VYUA 3I4NB 4IFDI 2NTTA 4RCOA 4K6DA 1LV9A 4KMUC 3LX0A 2BCOA 1G291 2PW7A 2EE1A 3NQTA 4HSPA 1JCKB 4I65A 2C5CA 1EYAA 3EJIA 1JORA 4CJ0B 1KAAA 3R2IA 1D1KA 3QOJA 2A6ED 3DWPA 1F9PA 2K01A 4KV6A 1YNJD 3HKZB 4ZYSA 1QWYA 2NN6I 1DOKA 2A68D 3I70A 5J22A 3D31A 4DAVA 3TZDA 4MHEA 3S14B 1DXMA 3TP7A 1SSOA 2HQEA 1KNAA 1PTOF 1LTGD 3SK6A 3GP7A 5FKAC 1AN8A 3TSSA 4K2KA 2O5JC 5D3DA 4EGVA 1PMRA 4BY7B 5E4WC 2IT1A 1DZ1A 1YNNC 3PO2B 1STAA 5EPLA 3PO3B 2OEOA 1AP0A 1C4QA 1GUGA 2RSNA 1DONA 3M4OB 3OIPA 2LMCB 2BDOA 2JP1A 1GUSA 3HG9A 1FNWA 4PV1C 1NSNS 1NR2A 4KKTA 2NVQB 1V1PA 1ZYRC 1QNKA 1BDOA 5CR3A 5IGFA 3K5MA 5JEAG 1O7ZA 3H3VC 3VA5A 1HFNA 1TY2A 1ET6A 5A2QE 1EL0A 3BVZA 5J39A 4WRDA 3IFTA 2B2UC 1CZGA 1F9QA 1STGA 1LTTD 4CKEA 2A5HA 1X3PA 4BS9A 4F8MA 4A3EB 3GTOB 3DHQA 1S5CD 3VYRA 1WTPA 4FXKC 4IUQA 2H4OA 3J7YW 1GUTA 1SYFA 1R4PB 1WTRA 2X6LA 3T51B 1E2ZA 4RFBA 1A2UA 2F0GA 1IW7D 3R3OA 4A3DB 2F3WA 4OGQC 1LO5D 4X3UA 1PTOD 3QJYA 1JOKA 4NW2A 1BUVT 5FLXL 3E0JA 1H9SB 1Y8NB 2Z4HA 3GQBA 4A3MB 4EQOA 4KY6A 1X32A 3ONAB 1U9RA 2A73B 4ZRZA 1YNJC 4YIJA 1LT6D 1WTWA 1D6EC 4CHTB 1HA5A 2A68C 3VR6A 2CHBD 3NK9A 2HDLA 3V96A 2RA4A 1HQMC 2OT2A 1IHZA 3Q23A 2B2UA 1T5XD 2NVXB 2K7VA 4WORA 3OMGA 3RMHA 2F0MA 2HDMA 2RSOA 4RGTA 3GTKB 2K5QA 2AWOA 3V05A 2X6GA 5JPMC 3URYA 2E76C 2EYFA 1ENAA 5F2DA 2B2VC 3G6JB 2EYPA 3CRKC 5LL6X 4XQJA 1C48A 2KJXA 2ICEC 3CQZB 2Z8LA 5ELEA 2A6HC 4X3KA 2F0VA 1KTKA 5TSSA 2EY5A 4KN7C 1Z7TA 4QUCA 1Y8OB 3E6ZX 1EFID 3AU7A 3NBIA 1VDZA 2KEDA 1LTRD 2FFKB 1JWSD 1EIHA 1B50A 5CV7A 3EQLC 2F4IA 2ICIA 3BZDB 1TS4A 4IFDG 4CGYB 1Z6HA 5K36G 3SK8A 1BOSA 3I72A 4ZK9B 3VYTA 4EVOA 4C1NK 2Z4IA 4ILWA 1WD1A 1TQOA 3K5LA 1F2ZA 3QG1A 3KLSA 1I4GA 2PCFB 4QIWB 4OO1G 1QCBD 3FEWX 1A6XA 4HCEA 1PYWD 1IYUA 3AB9A 2WINB 5A2QL 2JEBI 2O4XA 3FDTA 2B8FA 2CW0C 2L1BA 1PRTF 2NN6G 3NBHA 4J6HA 5CGKA 3MZ5A 3IFDA 4G7HC 1RD9D 2E2JB 1FD7D 1JR0D 4M1UB 2Q8IB 2L4NA 4HR7B 2VNUD 1ML0D 1S5ED 1EY6A 5C0XG 3MHBA 1QNUA 4IUNA 3OW7A 2XRQD 4DNRB 1IKMA 3PMFA 3VR3A 3GTPB 3S1MB 1STNA 4XYQA 4H44C 3DUZA 2TSSA 1CI3M 4RGNA 4HMJA 1SBBB 2CQAA 1DOMA 3D3RA 2M00A 3OOCA 1TKWB 3MXGA 3ZYYX 3ERQA 2FHTA 4XYOA 1BCPF 3LWEA 3IAYA 3A54A 3H91A 3M3YB 2SNSA 2B2YA 1D2BA 4A3KB 2NBFA 3WDNA 2AUJD 3F2UA 5ELBA 3H94A 4DA2A 3HOWB 2D9UA 2WKDA 1AZQA 3D6CA 4S3SA 3KBGA 1MI2A 3D8GA 1LT4D 1RDPD 4FNFA 2FINB 3QIAA 5JVG3 5CBEE 4O42A 2KHSA 3OPOA 3J80E 3KBXA 3L9AX 5NUCA 4IUUA 1L0XB 3HOZB 5LHY1 2K04A 3I3CA 3DEPA 2XN9C 1M8AA 1V1OA 2AQ1B 4NKLA 1LTSD 1SNDA 1SMYD 2NWGA 3OMCA 1J9OA 4L6TB 3NHHA 1STHA 3I90A 1ENFA 4H0LC 2J0TD 2DY7A 5K5PA 4KKSA 1Q90A 3U9SA 3T13A 1I6HB 3MXNA 1I4RA 5CORA 1TVXA 4R8IA 2F0UA 2EY2A 5I9PA 1I3QB 4TSSA 3BDLA 1AZPA 1EU3A 3OIQA 4RKBA 5C3EB 2PW5A 3Q24A 3KLSX 2K05A 1BCPD 2ENBA 4HN7A 3LWUA 5E3FA 2KUMA 1EYDA 1PZJD 2NZ1D 2EJGC 4DU9A 3S9WA 2F0FA 2IL8A 1QE6A 2XVSA 5FLXE 4K5VA 3A7AB 3RD4A 3PUZA 4DFAA 3EA6A 4IUPA 3GV3A 2B2WA 1B44D 1R4QB 1DCZA 2C9OA 4NDXA 1F77A 1SAPA 3VR2A 2K1BA 5C6AA 3EVQA 2XRSD 2QF7A 3R8BA 2F0JA 4KN4C 5JPNC 2CVRA 4RA8A 3RZOB 4J8QA 4DN4M 4IUTA 3MTSA 2F1MA 3DWQA 2VB2X 3G7LA 4OO1I 2VUMB 1CTMA 1ICWA 4FF4A 1STYA 2IW3A 4HCSA 3QB3A 4PMCA 1EY5A 4OHJA 2F0WA 1EY9A 5C3XA 3C1FA 3PUYA 5C3WA 3SDZA 1Y8PB 4RHRA 4KTAA 1XYIA 1B4OA 2ID0A 4RHSA 2KEEA 4MIUA 5C0XI 2KOLA 3PIO3 2D5DA 1F9SA 4BWGB 1I4HA 4QF4A 3PUWA 3J7AF 2XWBB 3BDOA 4DAYA 3P1HA 4NMZA 1WD0A 3OSOA 1OXUA 3GTGB 1D5ZC 4Q5VA 2EYMA 2EY6A 2D2CC 5M3MB 1SNQA 5EJWA 2L0CA 3FMCA 2A69C 2EVBA 3GV6A 3J80L 3TP6A 2MP1A 5M3FB 4RCNA 4C56C 5COYA 1LTAD 1ZKOA 3PUXA 1K8MA 4LAAA 4G7ZC 3TZUA 5CV6A 1IYVA 4B9XA 4FXDA 2LS01 3J81L 2RKSA 1EZ6A 1EEFD 1KDBA 5IGDA 3OWEB 1SE4A 1HCZA 2IX3A 1HQRD 1LLRD 3L3OC 2ZXPA 2F0DA 1RODA 3DM1A 3ITPA 1S5DD 1RCVD 2JA7B 3HRZC 1Y1WB 1H9MA 5FO7B 4HMIA 2EYLA 1MGSA 1DJRD 1A2TA 1NR4A 1MSGA 5EKIA 4OL7A 2HUGA 3BVGA 1TWCB 3W3AA 1RF2D 1TS5A 4PMWA 2K32A 1TS3A 4C3IB 1JWMD 1E2VA 1HUMA 2XWJB 1OXVA 2K33A 2LKVA 1RKNA 1RTNA 4AYBB 4ZKCB 1EY7A 2L11A 3NUCA 3QO2A 4PMBA 5EBCA 3BS1A 3OHXC 1TWAB 2A6EC 1XX8A 3M4YA 5BN4A 4RKLA 5KNBA 2BE5D 2PPBC 1SNCA 3ND8A 1I4XA 1AFPA 2A74C 2RBMA 2OXPA 5IOCA 2AUKA 2PZUA 5CMDA 4E6IA 1ET9A 1HTLD 5E1FA 5I6YA 1BO0A 2JXMB 3NSWA 4FXGC 2X69A 4MN3A 2F0SA 3MAQA 5AFWA 3O13A 3WOFA 1PFBA 1HA6A 1ESFA 3NP8A 3VYSA 1PZID 1CZWA 2FMMA 2JA8B 2AQ2B 4A3GB 1DM0B 4A3IB 1X3QA 2F0QA 2E74C 1QILA 4C3IG 2E75C 2WB1B 1V8QA 1EQVA 1Q1EA 4FVMA 5IODA 1J8IA 2DN8A 3KF8A 1PDQA 2AQ3B 5M5XB 3U9OA 3KLRA 4RWSC 3HEJA 1HHVA 4ME5A 3CKIB 5CV5A 4N9PA 4X3TA 2Q8RE 3BYYB 1UAPA 4HEDA 2IX0A 2WKCA 1MD2D 4X3SA 4FF2A 1CT1D 2KQ3A 2RDHA 3J7AV 2V4DA 3VR4A 4TKOB 3FPPA 1RHPA 2B2YC 4XQQA 1CK1A 1H9KA 2MUYA 3Q6SA 4F7XA 5DM63 4KHZA 5C5LA 1CFMA 3NE5B 1G2SA 3T16A 3SEBA 4GZYC 1AEXA 2WIIB 2PNRC 5D14A 1STBA 1W6KA 1IW7C 1XXGA 5EBDA 1PTOC 2DY8A 2B2TC 4C3HB 3P7JA 1U4PA 2K28A 4DXGA 1SDFA 2NTSA 4IFDJ 2QCPX 5I6WA 3SHLA 3K5OA 4ZQ3A 2L55A 5EPKA 4DXFA 1S4ZA 1OO9B 4WJWA 3SR1A 2E2HB 2BE5C 1GHJA 3C2PA 3HOXB 1U4LA 5CV4A 1WCMB 3M7GA 4K8IA 3A8JE 2J4XA 3P20A 4J1MA 2PQEA 1FGBD 2YU9B 1PZKD 1WTVA 1M4VA 2QKIC 1WTQA 1QG7A 2LFNA 3GTQB 4UAIA 3EROA 4V0BA 1UUPA 3PV0A 2K5DA 4TQUS 3PUVA 5CV8A 2NVYB 1EY4A 5EKKA 3A8IE 2RDFA 2OF1A 3QOLA 4TRDA 1V1PB 1D1IA 2SEBD 2L12A 2EYOA 1SNMA 5C4XB 2BA1A 2EDGA 3KK7A 4BA1I 5DNFA 2B2TA 4QCLA 1LACA 2F0LA 3I4LA 4ZKBB 1H9SA 5IGBA 1JOQA 1KLUD 1Q3LA 2SNMA 1CM9A 2YYZA 1PTOH 4XIGS 2B2WC 1Q12A 3T53B 3SE0A 2NYZD 3SK4A 1SJHD 1PRTD 3I91A 3J81E 1FR3A 5ELDA 5FO8B 1EWCA 1I50B 5J1ZA 2B8GA 5T1GA 2PZTA 2R93B 2XNAC 1HUNA 1KNEA 4G4KA 5CC4A 4BBRB 1QB5D 1V43A 1LT3D 2N55A 1SFOB 4IFDH 5K36H 5KYIA 1YNND 4P2CB 1GXDC 1SYEA 2FJ2A 2JEAI 1FNVA 1KDCA 3FPUB 4F88A 4HAEA 4N9TA 2DNEA 2EJFC 3NWSA 3P75A 4BBSB 4BY1B 4OO1H 3SXHA 1H9JA 1BR9A 2G9DA 4LMQD 3H09A 4CBVA 1VCIA 2M2LA 2EYJA 1F2LA 3KUPA 3TP5A 4PQXA 1F9RA 3MWYW 1Q1BA 5KYLA 2RQXA 2XSCA 1ILQA 1E2WA 1I4QA 2NN6H 1K83B 5M5YB 2TMPA 3CU7A 1JE4A 1CA6A 5KRUA 1WTXA 2EXZA 3C46A 3BDCA 5JOBA 5M5WB 4RGMA 2NUCA 4ZUJA 1TWGB 3UI2A 2EZVA 5C0XH 1A3UA 2R7ZB 4H7BA 2WAQB 1RJTA 4Y7NB 3OWFA 1F2YA 2Q8TA 1JICA 4K8JA 2IJ0A 1Y69U 1JC7A 1KABA 2HCCA 1L0YB 1FNUA 1Y1VB 3EFXD 3S17B 2VB3X 5HURA 3RUZA 4PNYA 3T56B 3S1QB 1EY0A 3W2DA 3K7AB 2WV6D 2I46A 2G9HD 1EWHA 3S2HB 3CRLC 4M8AA 3HP3A 2KVMA 2MJ8A 5KIXA 4FYDA 2XIWA 1GUWA 1CHQD 2PMZB 1A15A 1Z47A 5EPJA 3FRPB 3JAME 1GUNA 4A93B 1MSHA 4ABNA 4ZUIA 2RDGA 5BN3A 2BDNA 4UDUC 3R93A 5DM73 2F0TA 3A8KE 5CV9A 2NVTB 3GTLB 4DNTB 1O7LA 1TT2A 5IGEA 5JJZA 3V2TA 4DAPA 1PRTC 1DD2A 1SMYC 5D3IB 1ONLA 1XWEA 3CHBD 3N6RA 4H13C 2NB0A 1HRJA 1G8ZD 4KD3A 4KJOA 3BG3A 5FOBB 5IGGA 2R92B 5IT9E 3HOYB 4XQNA 2EY1A 1DYQA 4CJ1B 2F3VA 1LABA 1D5XC 5JAVA 3TBIB 5KNCA 2R6GA 4ZAIA 2AWNA 1NCVA 4FF1A 1IKLA 1EY8A 3A55A 4ULLA 1OXXK 1STEA 2O2LD 1BNZA 5DAUA 3K58A 3HOVB 4R8NA 1II3A 5FK9C 5C4JB 1G6ZA 4RGOS 4U68A 3C3LA 3NWTA 1BCPC 3S1RB 1LTBD 2A6HD 4G57A 2I07B 4QMGA 2KCCA 3D4RA 2K6AA 4B08A 1F2MA 5CBAE 3VA7A 1SJED 4EQNA 4XDXA 1SNOA 1U4MA 1SE2A 4ODGA 1BBXC 3FKIB 4B9WA 1R9TB 1E0BA 3IL8A 1SE3A 1EYCA 1EZ8A 3R2TA 3H6MA 1ILPA 4ID6A 4IUVA 5JEAJ 4EQPA 4KKUA 3X3NA 3HZXA 3NQIA 4OIKA 1BQQT 4I7ZC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F0N A;  3QOL A;  3D4W A;  4LAA A;  4TRD A;  4K5X A;  5DEH A;  4KD3 A;  4KJO A;  4J6H A;  1KAA A;  5CV6 A;  2EYF A;  4F7X A;  1JOO A;  1ENA A;  1STG A;  2EYO A;  2F0J A;  5KRU A;  5F2D A;  2EXZ A;  2F0E A;  3QOJ A;  5C5L A;  4B9X A;  5CGK A;  5IGG A;  3BDC A;  5J39 A;  2RBM A;  3DMU A;  3C1E A;  1KDA A;  4K5W A;  5JOB A;  2RKS A;  2EYP A;  1EZ6 A;  1SND A;  1SNM A;  2NUC A;  3MZ5 A;  4NKL A;  4ZUJ A;  2EY1 A;  3OMC A;  5EGT A;  5C4H A;  1KDB A;  5IGC A;  1SNP A;  4KV6 A;  5IGD A;  2F0L A;  3T16 A;  1JOQ A;  2F3V A;  2EYH A;  1SYC A;  2OXP A;  5IGB A;  4F8M A;  5IOC A;  5JAV A;  2WAC A;  4DF7 A;  5KGU A;  3NHH A;  1STH A;  1AEX A;  1EY6 A;  1A3U A;  2PZU A;  4H7B A;  1SYB A;  2SNM A;  1STB A;  5EKL A;  3MHB A;  3DHQ A;  5J22 A;  3TP8 A;  4E6I A;  4IUN A;  5E1F A;  5I6Y A;  2F0O A;  3OWF A;  1EY8 A;  3TME A;  3E5S A;  1F2Y A;  3TP7 A;  1SYF A;  2F0S A;  2HQE A;  4K8J A;  2F0D A;  1KAB A;  2F0V A;  2SOB A;  3D4D A;  1STY A;  2F0H A;  1STN A;  3PMF A;  3SK4 A;  3MEH A;  5DAU A;  4KY5 A;  3SK6 A;  5K5P A;  3ITP A;  4HTH A;  1NUC A;  1A2U A;  2F0G A;  3T13 A;  4R8N A;  1TR5 A;  2EY5 A;  1II3 A;  3R3O A;  4K2K A;  2F3W A;  3NP8 A;  1ENC A;  4DGZ A;  5I6W A;  4HMJ A;  3QB3 A;  3SHL A;  2F0U A;  2EY2 A;  5C5M A;  1JOK A;  4PMC A;  4ZQ3 A;  5I9O A;  2M00 A;  1EY5 A;  5I9P A;  5HUR A;  1STA A;  3RUZ A;  5J1Z A;  2OEO A;  4G57 A;  2F0W A;  2PZT A;  4HMI A;  4QMG A;  3ERQ A;  4K2L A;  2PYK A;  2F0Q A;  4IZ8 A;  4PNY A;  3SR1 A;  1EY9 A;  2F0P A;  2EYL A;  3SK5 A;  5C3X A;  1EY0 A;  3BDL A;  5CC4 A;  1F2M A;  3C1F A;  5CV7 A;  1A2T A;  5ISR A;  5C3W A;  4KHV A;  4KY7 A;  4RKB A;  2F0I A;  2PW5 A;  4EQN A;  2PZW A;  1SNO A;  4OL7 A;  5CV4 A;  4KTA A;  1EQV A;  1SYD A;  4EQO A;  2SNS A;  3MVV A;  5KIX A;  5KYI A;  4KY6 A;  3SK8 A;  4K8I A;  2ENB A;  4K14 A;  5IOD A;  4MIU A;  5M9O A;  4J1M A;  4KJN A;  4EVO A;  1A3T A;  4ODG A;  1SYE A;  2PQE A;  4B9W A;  5E3F A;  1NSN S;  5NUC A;  3MXP A;  3U9O A;  1EYD A;  1U9R A;  1KDC A;  4DU9 A;  3S9W A;  5IIF A;  2F0F A;  1TQO A;  3HEJ A;  1A3V A;  4N9T A;  4QF4 A;  1EYC A;  1F2Z A;  4YIJ A;  3D6C A;  4KD4 A;  4ZUI A;  4S3S A;  4ME5 A;  3D8G A;  5CR3 A;  1EZ8 A;  2LKV A;  1RKN A;  3P1H A;  3P75 A;  5CV5 A;  4NMZ A;  3NXW A;  4K5V A;  4N9P A;  3H6M A;  2F0T A;  3OSO A;  3SXH A;  5IGF A;  5KEE A;  4K6D A;  3NK9 A;  1EY7 A;  2EYM A;  3NUC A;  4ID6 A;  2EY6 A;  5CV9 A;  4DFA A;  5HGT A;  4PMB A;  1SNQ A;  3LX0 A;  3VA5 A;  4NP5 A;  2PW7 A;  1IHZ A;  4IAL A;  3NQT A;  4EQP A;  1TT2 A;  3ERO A;  5IGE A;  2EYJ A;  2KQ3 A;  3V2T A;  5C4Z A;  4I65 A;  2O4X A;  2KHS A;  3HZX A;  3OMG A;  4QB4 A;  4NDX A;  4WOR A;  3TP6 A;  3TP5 A;  2F0M A;  4RKL A;  1SYG A;  1EYA A;  5CV8 A;  1EY4 A;  1SNC A;  2F0K A;  2QDB A;  5KYL A;  3EJI A;  5EKK A;  2RDF A;  4WRD A;  2OF1 A;  1JOR A;  5C6A A;  3EVQ A; 
#chains in the Genus database with same CATH topology
 1VQ7 A;  1CA5 A;  4HSV A;  3I7F A;  2J7Z A;  5M3F G;  2I5M X;  5DLQ E;  4C2M H;  1KDA A;  5I9O A;  4DV5 Q;  4JV5 L;  4GKJ L;  4V19 0;  2CW0 D;  1PXU A;  1L0W A;  4DK1 A;  5IGC A;  3DXJ C;  4RAU C;  2EYH A;  1PTO B;  5KGU A;  2RF4 A;  3CPW A;  3HOV G;  4A3J B;  1TWH H;  3AQQ A;  1IYJ B;  2WB1 E;  4JCV E;  2IWH A;  3TME A;  3S1N B;  4R4O A;  4XT1 B;  1B8A A;  3CP0 A;  4LFA L;  4FO2 A;  1KC8 C;  3D4D A;  2SOB A;  3MEH A;  4KY5 A;  3X3M A;  1Q86 C;  2HIV A;  2JA6 B;  3EBE A;  5C3E H;  5C44 B;  5JVH 3;  1OXS C;  2JA5 B;  1P8L A;  5GQO A;  2CQO A;  1QUQ A;  5JJL A;  5C5M A;  1PH9 A;  3HGB A;  5IP7 H;  3CMA A;  1TXY A;  4OIJ A;  4POG A;  4RH6 A;  1CQF A;  2Z6K A;  2PYK A;  2JQO A;  4IZ8 A;  5T1I A;  3S15 B;  1WYD A;  1B2T A;  2HCI A;  1PH6 A;  3S2D B;  1GUO A;  4FP5 D;  1ESR A;  1Y1W G;  3NEL A;  1TII D;  1NTG A;  1OXT A;  5E4X A;  1EIG A;  2ZXR A;  2MPM A;  3NTK A;  4X62 Q;  2XGT A;  4CDC C;  5M9O A;  4FF3 A;  1B3A A;  1WTO A;  4KJN A;  3TN2 A;  5I4D A;  3JAM L;  4GOP A;  1G91 A;  3MXN B;  2JE6 I;  1VQA A;  1BBW A;  4JG2 A;  2PO4 A;  1JB3 A;  5KND A;  2ATW A;  2GA4 B;  4NXN Q;  4DV6 Q;  4GNX B;  2R3Z A;  4U67 3;  1S3O A;  4R4T A;  1TWF H;  4XT3 B;  4LK1 C;  2Y0S B;  1IBM Q;  2M9V A;  4LFC L;  4QUF A;  1T9H A;  1XPO A;  2PI2 A;  1EEI D;  3A56 A;  1VQ9 A;  3GO5 A;  5BN5 A;  2JYO A;  3G48 A;  2F0K A;  4IUR A;  1WVL A;  2F0N A;  3HKS A;  3D4W A;  3ER0 A;  5DEH A;  2FMC A;  4A3J G;  3GTM B;  5JEA H;  2N88 A;  2VUM H;  4JV5 Q;  5IT9 L;  4GKJ Q;  3I4O A;  2DGY A;  2R7F A;  2F03 A;  3DMU A;  3C1E A;  3SVM A;  4K5W A;  4RMF A;  2E2D C;  2IX1 A;  1Q81 C;  3K6O A;  3D6W A;  1B53 A;  1E22 A;  1XTD A;  1JQY D;  1HFG A;  3CPF A;  3H0G B;  2K5H A;  1GJX A;  4FDB A;  1PV4 A;  3MFY A;  4LFA Q;  4LJZ C;  1HTP A;  3K5N A;  1TY0 A;  5IYC G;  1VMP A;  2F0H A;  3CXC A;  3S16 B;  1FJG L;  4HTH A;  1NUC A;  2F4V L;  2HHH L;  2BOS A;  1AW7 A;  4CJ2 C;  1BF4 A;  4ZLT F;  3GTJ B;  3I56 A;  5IP9 G;  1PLF A;  1TU2 B;  2Q2T A;  4JYA L;  1BXT A;  1W6J A;  4LF9 L;  4NB3 A;  4BY7 H;  1BBU A;  4K2L A;  1YJW A;  3T4A C;  2UXB L;  4UP9 A;  1I6V C;  1HXY D;  1ZEQ X;  4JVZ A;  2VW9 A;  1E3P A;  3PO2 H;  3PO3 H;  1I4P A;  5ISR A;  3MFG A;  5A35 A;  4KY7 A;  5CYU A;  4XTC S;  3HS0 C;  3M85 A;  4C1N I;  4B3T L;  1U4R A;  1B1Z A;  1PFM A;  4AIM A;  1JJ2 A;  4L63 B;  3M4O H;  4K14 A;  1K8O A;  1T5E A;  5M3M H;  1CSP A;  1FYC A;  1A3T A;  1O80 A;  3OW2 A;  5LL6 S;  2Y0S G;  3IKJ A;  2B2V A;  1GHK A;  1B9N A;  4DUY L;  2D62 A;  3N52 A;  1LT5 D;  4IO9 A;  1XPR A;  1GKH A;  1VF5 C;  2L9H A;  2DNC A;  3NXW A;  4PZ7 A;  4IQZ A;  4B3R L;  3NPP A;  2B39 A;  1UEA B;  1QVC A;  3CCR A;  2N49 A;  1J6Q A;  1YIT A;  3MA2 B;  5FJ8 G;  4OX9 L;  4LFC Q;  2KEC A;  1EQT A;  1K0S A;  2ZT9 C;  4NP5 A;  4CKC A;  2AMC B;  4IAL A;  4DK0 A;  4OXP A;  5ELN A;  1XTC D;  4XXE A;  4A75 A;  3DEO A;  1VQM A;  1SYG A;  1Z9F A;  2QDB A;  1B9M A;  3J81 i;  2VXW A;  1O7Y A;  1I5F A;  1QJO A;  3GD7 A;  3NTI A;  1S5B D;  3J7Z C;  3NTH A;  1JOO A;  3DWA A;  2ZJP A;  4Q0F A;  1CQV A;  2QIL A;  2R61 A;  5ELF A;  5GAG C;  5G3L F;  3K57 A;  2YV5 A;  4RG1 A;  5C4H A;  2BA0 A;  4OEL B;  4A3F B;  1DOL A;  3M7N A;  1SYC A;  2WAC A;  2H1E A;  3CC7 A;  2A8V A;  2Z1C A;  4EQ5 A;  1VQN A;  2L5T A;  3TP8 A;  3I73 A;  2JA7 H;  5ELC A;  4A3E H;  4C3J B;  5C0X J;  4MTK A;  2MGS A;  1QOH A;  3TDQ A;  3GTO H;  2E2I B;  3L7Z C;  1VQ6 A;  4A3B B;  1X3E A;  1FJG Q;  1UNS A;  2F52 A;  3Q0A A;  2F4V Q;  2PQA A;  1RL2 A;  2HHH Q;  3VR5 A;  2O5I C;  1B3Q A;  4C3H G;  4DGZ A;  2QEJ C;  1SXT A;  4JYA Q;  4G7O C;  3K59 A;  4LF9 Q;  1TWC H;  1JWU D;  4YHH L;  4L8J A;  2UXB Q;  4A3D H;  4DR6 L;  1KLG D;  4C3I H;  1EOT A;  4CKB A;  2EJM A;  3CCQ A;  2B63 B;  3SK5 A;  1HNZ L;  1GOZ A;  1JMC A;  5I2X A;  2WP8 J;  4PG3 A;  4B3T Q;  4KHV A;  1S5F D;  5LMU L;  3CCE A;  3E9I A;  4R9W A;  3F2B A;  4K6L A;  3F2D A;  1SN8 A;  4KK7 A;  1RTO A;  1NAP A;  1PFN A;  1L1O A;  1VQD A;  3HOX G;  1JJG A;  3MXP A;  4LF6 L;  4DUY Q;  4JI2 L;  1TWA H;  4KI0 A;  4Z9C B;  2LY7 A;  3KF6 B;  4R4Q A;  1IL8 A;  4KD4 A;  4B3R Q;  1EU4 A;  4JBW A;  2IPK D;  3FVQ A;  3I8Z A;  4OX9 Q;  3RZD B;  5KEE A;  2UUA L;  2EIF A;  3I4M B;  3BYT B;  3QWN A;  3FHW A;  4HIO A;  2ZXO A;  5HGT A;  1PRT B;  1H9R A;  2RVL A;  2JSO A;  1Q8I A;  2WAQ E;  3MXU A;  5BR8 L;  4WJ4 A;  5C4Z A;  3LNN A;  4QB4 A;  1C8C A;  4IN3 A;  1O78 A;  2YTX A;  1D5M C;  1Q8K A;  4A3F G;  3J81 c;  2NVX H;  1GM5 A;  4N8F A;  1PH2 A;  1VMC A;  4C2M B;  4K5X A;  2K03 A;  2Z9H A;  3PIP 3;  2K5W A;  3BVM A;  5FO9 B;  3GTK H;  3A7L A;  1ZXT A;  2A69 D;  5D65 A;  1VQI A;  2F0E A;  1G2T A;  4C3J G;  1E24 A;  3Q22 A;  3W1B A;  5EGT A;  1TS2 A;  1X3F A;  3BZC A;  1SNP A;  1TWH B;  1ZYR D;  1VQ4 A;  1CHP D;  4JK1 C;  4DF7 A;  4ALP A;  5G3L D;  1LTI D;  5I2Y A;  3AMU A;  1SYB A;  5EKL A;  3TRE A;  1EFW A;  2JA8 H;  2F0O A;  2KCN A;  4A3G H;  3E5S A;  4A3I H;  3JAM i;  4POF A;  3CQZ H;  4JBK A;  2PMZ E;  4HIK A;  2B63 G;  4O1N A;  3T1H L;  1TR5 A;  1BCP B;  4YHH Q;  1ENC A;  3ND9 A;  1YJN A;  3K0Y A;  2UU9 L;  3MC0 B;  2EOT A;  3RLF A;  1EWI A;  2SDF A;  4BA2 I;  5EQ0 A;  1K9M C;  1HNZ Q;  3WOE A;  1QUQ B;  2F0P A;  5LMU Q;  4F87 A;  5LMN L;  3AFP A;  1VF7 A;  1MBY A;  2MHV A;  2KA7 A;  1HPC A;  3UDF A;  2F0I A;  2PZW A;  3HOU B;  1SYD A;  3MVV A;  3RR5 A;  1EUJ A;  1HZ9 A;  1YJ9 A;  3I4M G;  4BBR G;  4LF6 Q;  4JI2 Q;  1SEB D;  2I0Q A;  2LXK A;  2EPB A;  3EN2 A;  4K0K L;  5IIF A;  4WFN 3;  1A3V A;  4GOP B;  3CC2 A;  1TWF B;  3VYU A;  3I4N B;  2UUA Q;  4IFD I;  2NTT A;  4B3S L;  4RCO A;  2D0P A;  3F2C A;  4K6D A;  1LV9 A;  2Q2H A;  5BR8 Q;  4KMU C;  3LX0 A;  2BCO A;  1G29 1;  2PW7 A;  3M4Q A;  2EE1 A;  3NQT A;  1QZH A;  4HSP A;  1JCK B;  3ICE A;  4I65 A;  2C5C A;  3SGI A;  1EYA A;  5FLM G;  4NXM L;  3EJI A;  1JOR A;  4CJ0 B;  1NJI C;  1IZ6 A;  1KAA A;  3R2I A;  1D1K A;  1A63 A;  3QOJ A;  2A6E D;  1B70 B;  4A3C G;  3RN5 A;  3G4S A;  3DWP A;  1NY4 A;  2JJQ A;  1F9P A;  2K01 A;  4KV6 A;  1YNJ D;  2K50 A;  3HKZ B;  4ZYS A;  1QWY A;  5IYB G;  2NN6 I;  1DOK A;  3PIO A;  2A68 D;  4P71 A;  3I70 A;  5J22 A;  4O0A A;  3D31 A;  4DAV A;  3TZD A;  4JI6 L;  1AE3 A;  4MHE A;  3S14 B;  1DXM A;  3TP7 A;  1SSO A;  2K5N A;  3JAM c;  2HQE A;  2R7Z G;  1KNA A;  1PTO F;  2WAQ G;  3T1H Q;  3EIV A;  4TVA B;  1LTG D;  3SK6 A;  3GP7 A;  5FKA C;  1AN8 A;  3TSS A;  4X6A H;  2UU9 Q;  4K2K A;  2O5J C;  1WCM H;  5D3D A;  4LUZ A;  4EGV A;  1PMR A;  4DV5 L;  1VQH A;  4BY7 B;  5E4W C;  3HOU G;  1HNX L;  2IT1 A;  1DZ1 A;  1YNN C;  3PO2 B;  1STA A;  5EPL A;  3PO3 B;  4LNQ A;  2OEO A;  5IYD H;  2YU9 H;  5LMN Q;  1AP0 A;  1C4Q A;  3ERS X;  4JOI A;  1K8A C;  4YWL A;  1OTC A;  1GUG A;  2RSN A;  1DON A;  3FP9 A;  3M4O B;  3OIP A;  2LMC B;  2BDO A;  2JP1 A;  3I4N G;  1GUS A;  2CFM A;  3HG9 A;  3ULJ A;  3GTQ H;  1FNW A;  1VQ5 A;  2HD3 A;  4K0K Q;  4PV1 C;  3M3Y H;  4L5R C;  1NSN S;  1NR2 A;  1N32 L;  4KKT A;  5IT9 c;  2NVQ B;  1V1P A;  1ZYR C;  1QNK A;  1BDO A;  2Z0S A;  4B3S Q;  3F8T A;  5CR3 A;  5IGF A;  3K5M A;  4A93 G;  5JEA G;  1O7Z A;  3H3V C;  2CWP A;  3VA5 A;  2Z6K C;  1IXR A;  1HFN A;  1PH4 A;  1TY2 A;  4X62 L;  1ET6 A;  5C4X H;  4NXM Q;  1XMQ L;  5A2Q E;  1EL0 A;  3BVZ A;  5J39 A;  4WRD A;  3HKZ G;  2I5L X;  3IFT A;  2B2U C;  4MTN A;  2C35 B;  1CZG A;  1F9Q A;  4QY7 A;  1STG A;  1LTT D;  4DPG A;  3NEM A;  4JI7 L;  3HOZ H;  3KJP A;  4CKE A;  2A5H A;  1UE5 A;  1X3P A;  3M4P A;  4BS9 A;  2OTL A;  2R92 G;  4F8M A;  3WWV A;  4R4C A;  4A3E B;  3HOY G;  1WOC A;  4JI6 Q;  1N33 L;  3GTO B;  2IHE A;  3DHQ A;  1S5C D;  1X3G A;  3VYR A;  1WTP A;  4FXK C;  4CDF C;  4IUQ A;  2H4O A;  1I50 H;  3J7Y W;  1GUT A;  1SYF A;  1KL9 A;  2R93 H;  1R4P B;  1WTR A;  3J81 j;  2X6L A;  3T51 B;  4DV1 L;  1E2Z A;  4RFB A;  1HR0 L;  1A2U A;  2F0G A;  3STB D;  1IW7 D;  3R3O A;  4MNO A;  2F3W A;  2PQA B;  4OGQ C;  1Q46 A;  1HNX Q;  4A3D B;  1LO5 D;  4X3U A;  1PTO D;  4IOA A;  3QJY A;  1CKO A;  2GVB A;  1YZ6 A;  4LWC A;  1JOK A;  1UE1 A;  1I6H H;  1V1Q A;  4NW2 A;  1BUV T;  5FLX L;  3E0J A;  1H9S B;  4X65 L;  2Y0S E;  5GAH C;  1I3Q H;  1K3B C;  1Y8N B;  4JI1 L;  4BXX G;  1KRT A;  4BBS H;  4BY1 H;  4P75 A;  2Z4H A;  3GQB A;  4A3M B;  4LW1 A;  4EQO A;  4KY6 A;  3AFQ A;  1N32 Q;  1X32 A;  3ONA B;  4GKK L;  1YBY A;  5LMN W;  1U9R A;  1LUZ A;  1GVP A;  1V9P A;  2A73 B;  4ZRZ A;  1YNJ C;  3KDF B;  4YIJ A;  2VZA A;  1LT6 D;  4CDD C;  3RLO A;  1WTW A;  4Y52 H;  1D6E C;  1AE2 A;  1NMF A;  3FKI G;  4CHT B;  1HA5 A;  2A68 C;  3VR6 A;  2CHB D;  3NK9 A;  2HDL A;  4J15 A;  4IOC A;  3H3V H;  3V96 A;  2RA4 A;  3U50 C;  2VQF L;  4A4I A;  1HQM C;  2OT2 A;  1IHZ A;  3Q23 A;  2B2U A;  1T5X D;  1XMQ Q;  5M5W H;  1Y14 B;  3CAM A;  4YCV A;  2NVX B;  2K7V A;  4WOR A;  3OMG A;  3RMH A;  2F0M A;  2HDM A;  2RSO A;  1TWG H;  4RGT A;  3GTK B;  2K5Q A;  2AWO A;  1O7I A;  3V05 A;  1N36 L;  2X6G A;  1NNX A;  4JI7 Q;  4QJF A;  5JPM C;  3URY A;  2E76 C;  2EYF A;  4IJH A;  1ENA A;  5F2D A;  2B2V C;  3G6J B;  3KLW A;  3TEH B;  2EYP A;  2UUC L;  3RNU A;  3CRK C;  4L5T A;  1H95 A;  5LL6 X;  1N33 Q;  4XQJ A;  1C48 A;  2KJX A;  3RZO H;  2ICE C;  2ALY B;  2ZJQ A;  3CQZ B;  2Z8L A;  2I5H A;  5ELE A;  2A6H C;  4DV1 Q;  1HR0 Q;  4X3K A;  2F0V A;  3PF5 A;  3TS0 A;  1KTK A;  5TSS A;  3S2H H;  2EY5 A;  4DK6 C;  4KN7 C;  1Z7T A;  1KAW A;  4QUC A;  1QZG A;  1Y8O B;  3E6Z X;  1EFI D;  3AU7 A;  4A3M G;  3NBI A;  1VDZ A;  4UP7 A;  4X65 Q;  2KED A;  2JA6 G;  2B3G A;  1LTR D;  5C44 G;  2UUB L;  2FFK B;  5JJI A;  5AJ3 L;  4JI1 Q;  4DNI A;  1JWS D;  2JA5 G;  1B50 A;  1EIH A;  1KXL A;  5CV7 A;  2LSS A;  4JBJ A;  5ELO A;  4DV3 L;  4UY8 C;  3EQL C;  2F4I A;  4WJ3 M;  1HZB A;  2K52 A;  2ICI A;  5HGQ A;  3UDI A;  3BZD B;  1IL2 A;  1TS4 A;  4YCW A;  4IFD G;  4CGY B;  1Z6H A;  5K36 G;  3OYY A;  3SK8 A;  1BOS A;  3I72 A;  1X65 A;  4GKK Q;  4ZK9 B;  3VYT A;  1ICF B;  4A76 A;  2NVT H;  4EVO A;  3GTL H;  4C1N K;  4P74 A;  2Z4I A;  4ILW A;  1XNR L;  1WD1 A;  1EYG A;  1VQ8 A;  1TQO A;  4QGU A;  3K5L A;  1F2Z A;  1JB7 A;  3QG1 A;  3KLS A;  1I4G A;  2PCF B;  4DV4 L;  2UXC L;  2VQF Q;  4QIW B;  4OO1 G;  1QCB D;  3FEW X;  1VQJ A;  1A6X A;  4HCE A;  3GTG H;  1PYW D;  4A3L G;  1IYU A;  3AB9 A;  2WIN B;  5A2Q L;  2JEB I;  2O4X A;  3FDT A;  2B8F A;  1M1K C;  2CW0 C;  3STB C;  2L1B A;  1CKM A;  1N36 Q;  1PRT F;  1XMO L;  5M3F H;  2NN6 G;  3NEN A;  1L1O C;  3NBH A;  4J6H A;  4DR7 L;  3KYH C;  5CGK A;  2UUC Q;  3MZ5 A;  3IFD A;  4G7H C;  1RD9 D;  1EIY B;  2E2J B;  1FD7 D;  1KD1 C;  1U5K A;  1JR0 D;  2KBN A;  2K5V A;  4M1U B;  2Q8I B;  3HOV H;  2L4N A;  4HR7 B;  2VNU D;  1ML0 D;  4CDE C;  1S5E D;  4GN3 B;  1EY6 A;  5C0X G;  3MHB A;  1IBK L;  4LF4 L;  1QNU A;  4IUN A;  3OW7 A;  1PHJ A;  4GLV B;  2XRQ D;  4DNR B;  3H0G G;  1IKM A;  3PMF A;  3VR3 A;  3GTP B;  3S1M B;  1STN A;  4XYQ A;  4YY3 L;  4H44 C;  3KFU A;  3DUZ A;  2TSS A;  1CI3 M;  2D0O A;  2QW7 A;  4RGN A;  3M9B A;  4HMJ A;  1U0L A;  1SBB B;  2CQA A;  2VQE L;  4KHP L;  1DOM A;  3D3R A;  2UUB Q;  5AJ3 Q;  2M00 A;  3OOC A;  1TKW B;  3MXG A;  3ZYY X;  3TRZ A;  3ERQ A;  1R9T H;  2FHT A;  3W5O A;  4DV3 Q;  1PH1 A;  1HR0 W;  4XYO A;  1BCP F;  1Y1W H;  3LWE A;  2FXQ A;  3IAY A;  4PZ6 A;  3A54 A;  3H91 A;  3M3Y B;  2SNS A;  2B2Y A;  1D2B A;  4A3K B;  4DV7 L;  4GLX A;  2NBF A;  1Q7Y C;  1XNR Q;  3WDN A;  2AUJ D;  3F2U A;  5ELB A;  3H94 A;  4DA2 A;  3HOW B;  4DV4 Q;  2D9U A;  2RHQ B;  2WKD A;  2GN5 A;  1AZQ A;  1VQC A;  3D6C A;  1PYB A;  4S3S A;  3KBG A;  1MI2 A;  3D8G A;  2VL6 A;  2UXC Q;  1LT4 D;  1RDP D;  2HT1 A;  1VQE A;  4FNF A;  2FIN B;  4OON A;  2ZTC A;  3QIA A;  5JVG 3;  5CBE E;  3BJU A;  4O42 A;  2N8N A;  1N8R C;  2IY5 B;  4JI5 L;  2KHS A;  2XTI A;  1PH3 A;  4LFB L;  3OPO A;  3J80 E;  4HJ8 A;  3KBX A;  1XMO Q;  3OTO L;  3L9A X;  5NUC A;  4IUU A;  1L0X B;  4A3J H;  3HOZ B;  4DR7 Q;  5LHY 1;  2K04 A;  3I3C A;  3DEP A;  1W2B A;  2XN9 C;  1M8A A;  3S1N H;  1V1O A;  2VY3 A;  2AQ1 B;  4NKL A;  1LTS D;  1SND A;  1SMY D;  2NWG A;  3OMC A;  3ULL A;  1J9O A;  3T1Y L;  1IBK Q;  2DJG C;  4L6T B;  3NHH A;  1STH A;  4LF4 Q;  3I90 A;  5EAY A;  1CKN B;  1ENF A;  1N34 L;  4H0L C;  5IYC H;  4YY3 Q;  2J0T D;  2DY7 A;  1SMX A;  4KKS A;  1Q90 A;  5K5P A;  3U9S A;  3T13 A;  1I6H B;  5IP9 H;  3MXN A;  2VQE Q;  4A3B G;  4KHP Q;  1I4R A;  5COR A;  1TVX A;  1LYL A;  1HJP A;  4JI3 L;  4R8I A;  4GNX A;  2F0U A;  2EY2 A;  3K7U C;  5I9P A;  4A3K G;  1I3Q B;  2ES2 A;  2OWO A;  1C9O A;  4IPG A;  4TSS A;  3BDL A;  3HOW G;  1JJC B;  1AZP A;  1EU3 A;  3OIQ A;  4RKB A;  5C3E B;  2PW5 A;  1FL0 A;  3Q24 A;  4DV7 Q;  3KLS X;  3DM3 A;  3W1G A;  2K05 A;  1VQP A;  1BCP D;  2ENB A;  4HN7 A;  2QA4 A;  3LWU A;  5E3F A;  1AH9 A;  2KUM A;  1EYD A;  1PZJ D;  2NZ1 D;  2EJG C;  4DU9 A;  3S9W A;  2F0F A;  2IL8 A;  1LTL A;  1QE6 A;  2XVS A;  5M5X H;  5FLX E;  2H5X A;  4K5V A;  5FJ8 H;  2CWA A;  1MJE A;  3A7A B;  2V1C C;  3RD4 A;  3HKZ E;  3PUZ A;  4X66 L;  4DFA A;  1MHW C;  3EA6 A;  4IUP A;  4NPS A;  3GV3 A;  1VQB A;  2B2W A;  3CW2 C;  1B44 D;  4JI5 Q;  1R4Q B;  4JOI C;  4LFB Q;  1DCZ A;  2C9O A;  4NDX A;  1F77 A;  1SAP A;  3VR2 A;  3OTO Q;  3LGJ A;  3G71 A;  2K1B A;  5C6A A;  3EVQ A;  2XRS D;  1ASY A;  2JK8 A;  2QF7 A;  3CF5 A;  3R8B A;  2F0J A;  4KN4 C;  5JPN C;  3I2Z A;  1WI5 A;  2CVR A;  3T1Y Q;  4RA8 A;  2MO0 A;  3RZO B;  3UDG A;  4J8Q A;  4R4I A;  3HFZ B;  1PH8 A;  4DN4 M;  3GTJ H;  4IUT A;  3VDY A;  3MTS A;  2F1M A;  4P72 A;  3DWQ A;  3L0O A;  1N34 Q;  2VB2 X;  3G7L A;  4OO1 I;  2VUM B;  4JI4 L;  3CCU A;  2KCM A;  2WFW A;  1CTM A;  3RN2 A;  1ICW A;  4FF4 A;  1STY A;  4C3H H;  2IW3 A;  5IWA L;  4HCS A;  4JI3 Q;  1X56 A;  5C3E G;  3K81 C;  3QB3 A;  5E7N A;  4PMC A;  1EY5 A;  4OHJ A;  4DUZ L;  2F0W A;  5IP7 G;  1X54 A;  1EY9 A;  1A62 A;  5C3X A;  3E0E A;  3C1F A;  3PUY A;  5C3W A;  2K14 A;  3SDZ A;  2E2H H;  1Y8P B;  4RHR A;  4KTA A;  1XYI A;  1B4O A;  4JI0 L;  2ID0 A;  2MO1 A;  5JJK A;  4RHS A;  2KEE A;  4MIU A;  5C0X I;  2KOL A;  3HOX H;  3PIO 3;  2D5D A;  1F9S A;  4BWG B;  1E1O A;  1I4H A;  2ASB A;  2Z6B A;  4QF4 A;  3PUW A;  3J7A F;  2XWB B;  3BDO A;  4DAY A;  3P1H A;  4NMZ A;  1WD0 A;  3U58 A;  3OSO A;  1OXU A;  4X66 Q;  3GTG B;  1KHI A;  1WJJ A;  1D5Z C;  4Q5V A;  2EYM A;  1M90 C;  2EY6 A;  2D2C C;  5M3M B;  1SNQ A;  1P16 A;  5EJW A;  2L0C A;  3FMC A;  2E5L L;  4DV0 L;  2A69 C;  2HQL A;  2EVB A;  3GV6 A;  3J80 L;  1K8G A;  3TP6 A;  2MNA A;  2MP1 A;  4A3F H;  5M3F B;  4RCN A;  4C56 C;  4HIM A;  5COY A;  1S72 A;  1LTA D;  2ZTD A;  1ZKO A;  3PUX A;  4DKA C;  1K8M A;  4LAA A;  1I94 L;  4G7Z C;  2NVY H;  3A74 A;  3PQI A;  3TZU A;  5CV6 A;  4C3J H;  1IYV A;  4B9X A;  4FXD A;  2VUM G;  2LS0 1;  3J81 L;  4DR1 Q;  2RKS A;  1EZ6 A;  3PF4 A;  2R7D A;  1EEF D;  1PH7 A;  2DJF C;  1KDB A;  4LF5 L;  5IGD A;  2K75 A;  2UXD L;  3OWE B;  1SE4 A;  4ME3 A;  4JI4 Q;  1HCZ A;  2IX3 A;  3CME A;  1HQR D;  1LLR D;  3L3O C;  2ZXP A;  2B63 H;  4JC0 A;  2F0D A;  5IWA Q;  2BH2 A;  1ROD A;  3PCO B;  1D7Q A;  3DM1 A;  3ITP A;  4B3M L;  3KF6 A;  1KQS A;  1S5D D;  1BKB A;  3S24 A;  4DUZ Q;  1SLJ A;  1RCV D;  2JA7 B;  3HRZ C;  1Y1W B;  1H9M A;  1S40 A;  4PZ8 A;  1HZC A;  4HMI A;  5FO7 B;  1UEB A;  2KHI A;  5GAE C;  2EYL A;  4BY7 G;  1QVF A;  1MGS A;  1DJR D;  4R1J A;  1A2T A;  2BH8 A;  3PO2 G;  4JI0 Q;  1NR4 A;  3PO3 G;  1MSG A;  5EKI A;  4OL7 A;  2HUG A;  3BVG A;  3I4M H;  1SRO A;  4BBR H;  1TWC B;  3W3A A;  1RF2 D;  1TS5 A;  1SFO H;  4PMW A;  2K32 A;  1TS3 A;  3J7A 5;  5M3M G;  4C3I B;  1JWM D;  1CSQ A;  1E2V A;  1HUM A;  2XWJ B;  1OXV A;  4OWT B;  2K33 A;  2LKV A;  1RKN A;  1RTN A;  4AYB B;  1IBL L;  4ZKC B;  1EY7 A;  2L11 A;  3NUC A;  1J5E L;  2E5L Q;  4DV0 Q;  3QO2 A;  4PMB A;  3PSI A;  5EBC A;  3BS1 A;  3OHX C;  1YHB A;  1TWA B;  2A6E C;  1XX8 A;  3M4Y A;  4OWX B;  5FLM H;  5BN4 A;  1A8V A;  4RKL A;  5KNB A;  2BE5 D;  2PPB C;  1SNC A;  3TQY A;  3I55 A;  4HJ9 A;  1XJV A;  1L1O B;  3ND8 A;  1I4X A;  3F1Z A;  1I94 Q;  2RHS B;  1AFP A;  2A74 C;  2QGQ A;  4A3C H;  1K83 H;  2RBM A;  5M5Y H;  4LF5 Q;  1MKH A;  2UXD Q;  1SR3 A;  5IYB H;  4GS3 A;  2B29 A;  2OXP A;  2OCE A;  5IOC A;  3BZK A;  2AUK A;  2HIX A;  2PZU A;  1ASZ A;  1VQL A;  5CMD A;  4E6I A;  1ET9 A;  1HTL D;  5E1F A;  5I6Y A;  1BO0 A;  2JXM B;  3NSW A;  2JA7 G;  4FXG C;  2R7Z H;  4A3E G;  2X69 A;  2CH4 W;  4MN3 A;  2F0S A;  4Y7N H;  3MAQ A;  5AFW A;  3IRB A;  4B3M Q;  2MQH A;  3O13 A;  3WOF A;  1PFB A;  1X6O A;  1HA6 A;  1ESF A;  1PFS A;  3NP8 A;  3HOU H;  3VYS A;  1PZI D;  1Y1V H;  4OWW B;  1CZW A;  1VQG A;  2FMM A;  2JA8 B;  4IPD A;  3MEF A;  3CCS A;  2AQ2 B;  4A3G B;  1DM0 B;  3S17 H;  4A3I B;  4QIW E;  1X3Q A;  4DV2 L;  4A3D G;  2DUD A;  2F0Q A;  2QDL A;  2AHO B;  2E74 C;  1VQF A;  1QIL A;  4C3I G;  3K80 C;  3U4V A;  4DR5 L;  2E75 C;  3I4N H;  2WB1 B;  1V8Q A;  3S1Q H;  1EQV A;  1Q1E A;  4AYB G;  3K7A H;  4HJ5 A;  4FVM A;  5IOD A;  1J8I A;  2LXJ A;  2DN8 A;  3KF8 A;  1PDQ A;  2CKZ B;  2AQ3 B;  5M5X B;  3U9O A;  3KLR A;  4RWS C;  3HEJ A;  5HY6 A;  1PVO A;  1HHV A;  1B7Y B;  5GRO A;  4ME5 A;  3CKI B;  3K8A A;  1IBL Q;  5CV5 A;  4A93 H;  1J5E Q;  4N9P A;  4X3T A;  1UWV A;  2Q8R E;  1PH5 A;  3TS2 A;  1VS0 A;  3BYY B;  1UAP A;  4O2D A;  4HED A;  2IX0 A;  2WKC A;  1MD2 D;  4DK3 C;  4X3S A;  4FF2 A;  4YCU A;  1CT1 D;  2KQ3 A;  2RDH A;  3J7A V;  2V4D A;  3VR4 A;  2JN4 A;  4TKO B;  3FPP A;  1RHP A;  2B2Y C;  2Q2I A;  4XQQ A;  5L37 A;  3H3V I;  1HNW L;  4N8X 1;  4I7A A;  1CK1 A;  1H9K A;  2MUY A;  3Q6S A;  1FGU A;  4F7X A;  5DM6 3;  1VQK A;  1GD7 A;  1XNQ L;  3S14 H;  2A1A A;  4KHZ A;  4HJ7 A;  5C5L A;  1CFM A;  3NE5 B;  1G2S A;  2R92 H;  2OTJ A;  3T16 A;  3HOY H;  1K28 A;  1Q82 C;  3SEB A;  1GO3 E;  4GZY C;  1AEX A;  2WII B;  2PNR C;  5D14 A;  1STB A;  1W6K A;  1IW7 C;  1XXG A;  5EBD A;  1PTO C;  2DY8 A;  2B2T C;  4C3H B;  4UHV A;  2P5Z X;  2JA8 G;  4A3G G;  3P7J A;  1U4P A;  4A3I G;  4DR4 L;  2K28 A;  1G6P A;  4DXG A;  1SDF A;  2NTS A;  4DR3 L;  4LUO A;  4IFD J;  4LF7 L;  2QCP X;  2WB1 G;  3ZJY C;  5I6W A;  1L2F A;  3SHL A;  1A0I A;  3K5O A;  4DV2 Q;  4ZQ3 A;  2L55 A;  3BU2 A;  5EPK A;  4DXF A;  5C4J H;  1S4Z A;  2ZM6 L;  1OO9 B;  2L15 A;  1RIP A;  4WJW A;  3SR1 A;  2E2H B;  4DR5 Q;  2NVQ H;  2Q2U A;  4BXX H;  3S1R H;  2BE5 C;  1GHJ A;  1UE6 A;  3J80 i;  2ZJR A;  3C2P A;  3HOX B;  1U4L A;  5CV4 A;  1WCM B;  1YHQ A;  1KRS A;  3E3X A;  3UDX A;  3M7G A;  3A5Z B;  3GDE A;  4ZCK A;  4K8I A;  3A8J E;  2J4X A;  3P20 A;  4J1M A;  1YEZ A;  2PQE A;  1FGB D;  2YU9 B;  1PZK D;  1EQQ A;  1WTV A;  1NE3 A;  3FKI H;  1W3S A;  1M4V A;  2QKI C;  4L5S A;  3AYH B;  1WTQ A;  1D8L A;  4IPH A;  2N78 A;  1QG7 A;  2LFN A;  4HID A;  4AH6 A;  1YIJ A;  2OQK A;  4GNX C;  4DAY B;  3GTQ B;  4UAI A;  3CCL A;  3CCV A;  1C0A A;  4QQB X;  3ERO A;  1YI2 A;  4KLK A;  2A19 A;  4V0B A;  1UUP A;  3PV0 A;  2K5D A;  2VS1 A;  3L2P A;  4GN5 A;  4TQU S;  3PUV A;  5CV8 A;  2NVY B;  1EY4 A;  5EKK A;  3A8I E;  2RDF A;  1HNW Q;  2OF1 A;  1XNQ Q;  3QOL A;  4JI8 L;  4TRD A;  3DLL A;  4UPA A;  1V1P B;  1SE8 A;  1D1I A;  2SEB D;  2ZTE A;  2L12 A;  2EYO A;  1SNM A;  5C4X B;  2BA1 A;  2EDG A;  3KK7 A;  1K0R A;  4BA1 I;  5DNF A;  2B2T A;  4QCL A;  1LAC A;  2F0L A;  3I4L A;  4ZKB B;  1H9S A;  5IGB A;  1JOQ A;  1EOV A;  1KLU D;  1Q3L A;  2SNM A;  1CM9 A;  2YYZ A;  1PTO H;  4IPC A;  4XIG S;  2B2W C;  4DR4 Q;  1E7Z A;  1Q12 A;  3CC4 A;  4DR3 Q;  3T53 B;  3SE0 A;  2NYZ D;  3SK4 A;  1SJH D;  1PRT D;  3RLN A;  4LF7 Q;  3I91 A;  3J81 E;  4A3M H;  2AKW B;  3KDF A;  3E9H A;  1FR3 A;  1WCM G;  5ELD A;  2JA6 H;  2ZM6 Q;  5FO8 B;  5C44 H;  1EWC A;  1I50 B;  5J1Z A;  2B8G A;  5T1G A;  2PZT A;  2R93 B;  2JA5 H;  2QEX A;  3A0J A;  2XNA C;  1HUN A;  2KHJ A;  5IYD G;  1KNE A;  4G4K A;  2MFI A;  5CC4 A;  4BBR B;  1QB5 D;  1V43 A;  3J80 c;  1LT3 D;  2N55 A;  1SFO B;  3S15 H;  4IFD H;  5K36 H;  1HZA A;  3PIP A;  5KYI A;  3S2D H;  1YNN D;  2GVA A;  2OQ0 A;  4P2C B;  1JT8 A;  1K3R A;  1K73 C;  1GXD C;  1SYE A;  2FJ2 A;  2JEA I;  1FNV A;  1KDC A;  3FPU B;  4F88 A;  4HAE A;  4N9T A;  1YVC A;  2DNE A;  2EJF C;  4IJL A;  3NWS A;  3P75 A;  4BBS B;  3A5U A;  4BY1 B;  4OO1 H;  3SXH A;  5GAD C;  1H9J A;  1BR9 A;  1NBW A;  2G9D A;  2NZH A;  4LMQ D;  3H09 A;  4A3L H;  3KJO A;  4L5Q A;  4CBV A;  1JE5 A;  1VCI A;  1NMG A;  2EYJ A;  2M2L A;  4DAM A;  1F2L A;  2PI2 E;  4LF8 L;  1PYS B;  3KUP A;  3TP5 A;  4PQX A;  1F9R A;  3H15 A;  3MWY W;  5C4X G;  1Q1B A;  5KYL A;  2RQX A;  2XSC A;  4JI8 Q;  1ILQ A;  1E2W A;  4YWK A;  2EXD A;  1I4Q A;  2NN6 H;  1K83 B;  4X64 L;  5M5Y B;  2TMP A;  3CU7 A;  1JE4 A;  1CA6 A;  2JA9 A;  5KRU A;  1WTX A;  2EXZ A;  5J3B A;  3C46 A;  3BDC A;  5JOB A;  5M5W B;  4RGM A;  2NUC A;  4GLA C;  4ZUJ A;  3GTM H;  3HOZ G;  2RCF A;  1HH2 P;  4DR6 Q;  1TWG B;  3CCJ A;  3UI2 A;  2EZV A;  5C0X H;  1A3U A;  2R7Z B;  4H7B A;  2WAQ B;  1RJT A;  4Y7N B;  3UE1 A;  1QVG A;  3OWF A;  1F2Y A;  3H0G H;  2Q8T A;  2CCZ A;  1JIC A;  2K4K A;  2IJ0 A;  4K8J A;  3B6Y A;  3U4Z A;  1Y69 U;  1JC7 A;  2R93 G;  1KAB A;  2HCC A;  1L0Y B;  1FNU A;  1Y1V B;  5IE8 A;  3EFX D;  5FLX c;  3S16 H;  3S17 B;  4DR1 L;  4LUV A;  4OEM B;  1SRU A;  1DGS A;  1CUK A;  2VB3 X;  5HUR A;  3RUZ A;  1XPU A;  4PNY A;  3T56 B;  3S1Q B;  1EY0 A;  3W2D A;  3K7A B;  1WTH A;  5H1S E;  2WV6 D;  2I46 A;  3D0F A;  2G9H D;  1EWH A;  3S2H B;  1C7Y A;  3CRL C;  4H02 A;  3HP3 A;  4M8A A;  2KVM A;  2MJ8 A;  4UP8 A;  2YTY A;  4BY1 G;  5KIX A;  4BBS G;  4FYD A;  3CD6 A;  2XIW A;  1GUW A;  1PA6 A;  4HJA A;  1CHQ D;  2PMZ B;  3KOJ A;  1A15 A;  1Z47 A;  2E8G A;  3FRP B;  5EPJ A;  3JAM E;  1MIU A;  4AQY L;  1GUN A;  4A93 B;  3KF8 B;  1MSH A;  4ABN A;  1FVI A;  4ZUI A;  2RDG A;  5BN3 A;  2BDN A;  4UDU C;  3R93 A;  5DM7 3;  2F0T A;  4MZ9 A;  3A8K E;  5CV9 A;  2NVT B;  3GTL B;  4DNT B;  1O7L A;  4LF8 Q;  1TT2 A;  4JW0 A;  5IGE A;  1G51 A;  5JJZ A;  3V2T A;  4DAP A;  1PRT C;  1DD2 A;  2E2J H;  4DR2 L;  1SMY C;  5D3I B;  4QL5 A;  1ONL A;  1XWE A;  2YTV A;  4JPB W;  4X64 Q;  3CHB D;  3N6R A;  4H13 C;  2NB0 A;  3JC6 6;  1HRJ A;  1G8Z D;  4KD3 A;  4KJO A;  2PNH A;  3BG3 A;  5FOB B;  5IGG A;  2R92 B;  5IT9 E;  3G6E A;  3HOY B;  4XQN A;  1MJC A;  1X55 A;  2EY1 A;  1DYQ A;  1YNX A;  1VQO A;  3GTP H;  3S1M H;  3QR8 A;  4CJ1 B;  2F3V A;  3CCM A;  1LAB A;  1D5X C;  1Y1V G;  5JAV A;  3TBI B;  5KNC A;  2R6G A;  3K0X A;  2EQS A;  2IHF A;  2NZO A;  2AWN A;  1NCV A;  4ZAI A;  2RCN A;  4FF1 A;  1IKL A;  1EY8 A;  3A55 A;  4ULL A;  1OXX K;  2KEN A;  1STE A;  1WFQ A;  2O2L D;  1BNZ A;  5DAU A;  2E2I H;  3K58 A;  4A3B H;  3HOV B;  3NBH B;  4R8N A;  1II3 A;  5FK9 C;  5C4J B;  1E1T A;  4RGO S;  1G6Z A;  2CH4 A;  4U68 A;  3C3L A;  1YHA A;  4A3K H;  4AYB E;  3NWT A;  1BCP C;  3S1R B;  4YWM A;  1LTB D;  2A6H D;  4G57 A;  4APV A;  2I07 B;  4QMG A;  1X9N A;  3HOW H;  2KCC A;  3D4R A;  2K6A A;  4B08 A;  1F2M A;  5CBA E;  4EX5 A;  3VA7 A;  1SJE D;  2KCT A;  4EQN A;  3Q8D A;  4XDX A;  1SNO A;  5IY0 A;  1BVS A;  1U4M A;  3ULP A;  1SE2 A;  3UE0 A;  3PGZ A;  1LM0 A;  4ODG A;  4AQY Q;  1BBX C;  3FKI B;  1KIX A;  4B9W A;  1R9T B;  1E0B A;  3IL8 A;  3AEV A;  1SE3 A;  1EYC A;  1EQR A;  1EZ8 A;  2G5D A;  3R2T A;  4GOP C;  3H6M A;  4NXN L;  1ILP A;  4DV6 L;  2N3S A;  4ID6 A;  1EIF A;  3RZD H;  4IUV A;  4JBM A;  5JEA J;  2F3I A;  4EQP A;  1IBM L;  4DR2 Q;  4KKU A;  4GN4 B;  3X3N A;  1CKN A;  3HZX A;  3NQI A;  4OIK A;  1BQQ T;  1UE7 A;  4P73 A;  4I7Z C;  1N9W A; 
#chains in the Genus database with same CATH homology
 1CA5 A;  4HSV A;  2J7Z A;  5I9O A;  1KDA A;  4V19 0;  2CW0 D;  1PXU A;  4DK1 A;  5IGC A;  3DXJ C;  4RAU C;  2EYH A;  1PTO B;  5KGU A;  4A3J B;  2IWH A;  3TME A;  3S1N B;  4XT1 B;  4FO2 A;  3D4D A;  2SOB A;  3MEH A;  4KY5 A;  3X3M A;  2JA6 B;  5C44 B;  5JVH 3;  1OXS C;  2JA5 B;  5C5M A;  3HGB A;  4OIJ A;  4RH6 A;  1CQF A;  2PYK A;  4IZ8 A;  5T1I A;  3S15 B;  1B2T A;  2HCI A;  3S2D B;  1GUO A;  4FP5 D;  1ESR A;  1TII D;  1OXT A;  5E4X A;  1EIG A;  2ZXR A;  2MPM A;  3NTK A;  5M9O A;  4FF3 A;  1B3A A;  1WTO A;  4KJN A;  3TN2 A;  5I4D A;  3JAM L;  1G91 A;  2JE6 I;  2PO4 A;  1JB3 A;  5KND A;  2GA4 B;  2R3Z A;  4U67 3;  4XT3 B;  4LK1 C;  2Y0S B;  2M9V A;  4QUF A;  1EEI D;  3A56 A;  3GO5 A;  5BN5 A;  2JYO A;  2F0K A;  4IUR A;  1WVL A;  2F0N A;  3D4W A;  5DEH A;  2FMC A;  3GTM B;  5JEA H;  2N88 A;  5IT9 L;  2F03 A;  3DMU A;  3C1E A;  3SVM A;  4K5W A;  2E2D C;  2IX1 A;  3K6O A;  3D6W A;  1B53 A;  1JQY D;  1HFG A;  3H0G B;  1GJX A;  3MFY A;  4LJZ C;  1HTP A;  3K5N A;  1TY0 A;  1VMP A;  2F0H A;  3S16 B;  4HTH A;  1NUC A;  2BOS A;  1AW7 A;  4CJ2 C;  1BF4 A;  4ZLT F;  3GTJ B;  1PLF A;  1TU2 B;  1BXT A;  1W6J A;  4K2L A;  3T4A C;  1I6V C;  1HXY D;  1ZEQ X;  1I4P A;  5ISR A;  3MFG A;  5A35 A;  4KY7 A;  5CYU A;  4XTC S;  3HS0 C;  3M85 A;  4C1N I;  1U4R A;  1B1Z A;  1PFM A;  4L63 B;  4K14 A;  1K8O A;  1T5E A;  1FYC A;  1A3T A;  1O80 A;  5LL6 S;  3IKJ A;  2B2V A;  1GHK A;  1B9N A;  2D62 A;  3N52 A;  1LT5 D;  1VF5 C;  2L9H A;  2DNC A;  3NXW A;  4IQZ A;  3NPP A;  2B39 A;  1UEA B;  3MA2 B;  2KEC A;  1EQT A;  2ZT9 C;  4NP5 A;  4CKC A;  4IAL A;  4DK0 A;  4XXE A;  1XTC D;  3DEO A;  1SYG A;  2QDB A;  1B9M A;  2VXW A;  1O7Y A;  1QJO A;  3GD7 A;  3NTI A;  1S5B D;  3NTH A;  1JOO A;  3DWA A;  4Q0F A;  1CQV A;  2QIL A;  2R61 A;  5ELF A;  5G3L F;  3K57 A;  5C4H A;  2BA0 A;  4A3F B;  1DOL A;  3M7N A;  1SYC A;  2WAC A;  2H1E A;  2Z1C A;  2L5T A;  3TP8 A;  3I73 A;  5ELC A;  4C3J B;  5C0X J;  2MGS A;  1QOH A;  3TDQ A;  2E2I B;  3L7Z C;  4A3B B;  1UNS A;  3Q0A A;  3VR5 A;  2O5I C;  4C3H G;  4DGZ A;  2QEJ C;  1SXT A;  4G7O C;  3K59 A;  1JWU D;  4L8J A;  1KLG D;  1EOT A;  4CKB A;  2EJM A;  2B63 B;  3SK5 A;  1GOZ A;  5I2X A;  2WP8 J;  4KHV A;  1S5F D;  4R9W A;  4K6L A;  4KK7 A;  1RTO A;  1NAP A;  1PFN A;  3MXP A;  4KI0 A;  4Z9C B;  2LY7 A;  1IL8 A;  4KD4 A;  1EU4 A;  4JBW A;  2IPK D;  3FVQ A;  3I8Z A;  3RZD B;  5KEE A;  3I4M B;  3BYT B;  3QWN A;  2ZXO A;  5HGT A;  1PRT B;  1H9R A;  2RVL A;  2JSO A;  1Q8I A;  3MXU A;  5C4Z A;  3LNN A;  4QB4 A;  1C8C A;  4IN3 A;  1O78 A;  1D5M C;  1VMC A;  4C2M B;  4K5X A;  2K03 A;  3PIP 3;  2K5W A;  3BVM A;  5FO9 B;  3A7L A;  1ZXT A;  2A69 D;  5D65 A;  2F0E A;  1G2T A;  4C3J G;  3Q22 A;  5EGT A;  1TS2 A;  1SNP A;  1TWH B;  1ZYR D;  1CHP D;  4JK1 C;  4DF7 A;  5G3L D;  1LTI D;  5I2Y A;  3AMU A;  1SYB A;  5EKL A;  2F0O A;  2KCN A;  3E5S A;  4O1N A;  1TR5 A;  1BCP B;  1ENC A;  3ND9 A;  3K0Y A;  3MC0 B;  2EOT A;  3RLF A;  2SDF A;  4BA2 I;  5EQ0 A;  3WOE A;  2F0P A;  4F87 A;  1VF7 A;  1MBY A;  2MHV A;  2KA7 A;  1HPC A;  2F0I A;  2PZW A;  3HOU B;  1SYD A;  3MVV A;  1SEB D;  2EPB A;  5IIF A;  4WFN 3;  1A3V A;  1TWF B;  3VYU A;  3I4N B;  4IFD I;  2NTT A;  4RCO A;  4K6D A;  1LV9 A;  4KMU C;  3LX0 A;  2BCO A;  1G29 1;  2PW7 A;  2EE1 A;  3NQT A;  4HSP A;  1JCK B;  4I65 A;  2C5C A;  1EYA A;  3EJI A;  1JOR A;  4CJ0 B;  1KAA A;  3R2I A;  1D1K A;  3QOJ A;  2A6E D;  3DWP A;  1F9P A;  2K01 A;  4KV6 A;  1YNJ D;  3HKZ B;  4ZYS A;  1QWY A;  2NN6 I;  1DOK A;  2A68 D;  3I70 A;  5J22 A;  3D31 A;  4DAV A;  3TZD A;  4MHE A;  3S14 B;  1DXM A;  3TP7 A;  1SSO A;  2HQE A;  1KNA A;  1PTO F;  1LTG D;  3SK6 A;  3GP7 A;  5FKA C;  1AN8 A;  3TSS A;  4K2K A;  2O5J C;  5D3D A;  4EGV A;  1PMR A;  4BY7 B;  5E4W C;  2IT1 A;  1DZ1 A;  1YNN C;  3PO2 B;  1STA A;  5EPL A;  3PO3 B;  2OEO A;  1AP0 A;  1C4Q A;  1GUG A;  2RSN A;  1DON A;  3M4O B;  3OIP A;  2LMC B;  2BDO A;  2JP1 A;  1GUS A;  3HG9 A;  1FNW A;  4PV1 C;  1NSN S;  1NR2 A;  4KKT A;  2NVQ B;  1V1P A;  1ZYR C;  1QNK A;  1BDO A;  5CR3 A;  5IGF A;  3K5M A;  5JEA G;  1O7Z A;  3H3V C;  3VA5 A;  1HFN A;  1TY2 A;  1ET6 A;  5A2Q E;  1EL0 A;  3BVZ A;  5J39 A;  4WRD A;  3IFT A;  2B2U C;  1CZG A;  1F9Q A;  1STG A;  1LTT D;  4CKE A;  2A5H A;  1X3P A;  4BS9 A;  4F8M A;  4A3E B;  3GTO B;  3DHQ A;  1S5C D;  3VYR A;  1WTP A;  4FXK C;  4IUQ A;  2H4O A;  3J7Y W;  1GUT A;  1SYF A;  1R4P B;  1WTR A;  2X6L A;  3T51 B;  1E2Z A;  4RFB A;  1A2U A;  2F0G A;  1IW7 D;  3R3O A;  4A3D B;  2F3W A;  4OGQ C;  1LO5 D;  4X3U A;  1PTO D;  3QJY A;  1JOK A;  4NW2 A;  1BUV T;  5FLX L;  3E0J A;  1H9S B;  1Y8N B;  2Z4H A;  3GQB A;  4A3M B;  4EQO A;  4KY6 A;  1X32 A;  3ONA B;  1U9R A;  2A73 B;  4ZRZ A;  1YNJ C;  4YIJ A;  1LT6 D;  1WTW A;  1D6E C;  4CHT B;  1HA5 A;  2A68 C;  3VR6 A;  2CHB D;  3NK9 A;  2HDL A;  3V96 A;  2RA4 A;  1HQM C;  2OT2 A;  1IHZ A;  3Q23 A;  2B2U A;  1T5X D;  2NVX B;  2K7V A;  4WOR A;  3OMG A;  3RMH A;  2F0M A;  2HDM A;  2RSO A;  4RGT A;  3GTK B;  2K5Q A;  2AWO A;  3V05 A;  2X6G A;  5JPM C;  3URY A;  2E76 C;  2EYF A;  1ENA A;  5F2D A;  2B2V C;  3G6J B;  2EYP A;  3CRK C;  5LL6 X;  4XQJ A;  1C48 A;  2KJX A;  2ICE C;  3CQZ B;  2Z8L A;  5ELE A;  2A6H C;  4X3K A;  2F0V A;  1KTK A;  5TSS A;  2EY5 A;  4KN7 C;  1Z7T A;  4QUC A;  1Y8O B;  3E6Z X;  1EFI D;  3AU7 A;  3NBI A;  1VDZ A;  2KED A;  1LTR D;  2FFK B;  1JWS D;  1EIH A;  1B50 A;  5CV7 A;  3EQL C;  2F4I A;  2ICI A;  3BZD B;  1TS4 A;  4IFD G;  4CGY B;  1Z6H A;  5K36 G;  3SK8 A;  1BOS A;  3I72 A;  4ZK9 B;  3VYT A;  4EVO A;  4C1N K;  2Z4I A;  4ILW A;  1WD1 A;  1TQO A;  3K5L A;  1F2Z A;  3QG1 A;  3KLS A;  1I4G A;  2PCF B;  4QIW B;  4OO1 G;  1QCB D;  3FEW X;  1A6X A;  4HCE A;  1PYW D;  1IYU A;  3AB9 A;  2WIN B;  5A2Q L;  2JEB I;  2O4X A;  3FDT A;  2B8F A;  2CW0 C;  2L1B A;  1PRT F;  2NN6 G;  3NBH A;  4J6H A;  5CGK A;  3MZ5 A;  3IFD A;  4G7H C;  1RD9 D;  2E2J B;  1FD7 D;  1JR0 D;  4M1U B;  2Q8I B;  2L4N A;  4HR7 B;  2VNU D;  1ML0 D;  1S5E D;  1EY6 A;  5C0X G;  3MHB A;  1QNU A;  4IUN A;  3OW7 A;  2XRQ D;  4DNR B;  1IKM A;  3PMF A;  3VR3 A;  3GTP B;  3S1M B;  1STN A;  4XYQ A;  4H44 C;  3DUZ A;  2TSS A;  1CI3 M;  4RGN A;  4HMJ A;  1SBB B;  2CQA A;  1DOM A;  3D3R A;  2M00 A;  3OOC A;  1TKW B;  3MXG A;  3ZYY X;  3ERQ A;  2FHT A;  4XYO A;  1BCP F;  3LWE A;  3IAY A;  3A54 A;  3H91 A;  3M3Y B;  2SNS A;  2B2Y A;  1D2B A;  4A3K B;  2NBF A;  3WDN A;  2AUJ D;  3F2U A;  5ELB A;  3H94 A;  4DA2 A;  3HOW B;  2D9U A;  2WKD A;  1AZQ A;  3D6C A;  4S3S A;  3KBG A;  1MI2 A;  3D8G A;  1LT4 D;  1RDP D;  4FNF A;  2FIN B;  3QIA A;  5JVG 3;  5CBE E;  4O42 A;  2KHS A;  3OPO A;  3J80 E;  3KBX A;  3L9A X;  5NUC A;  4IUU A;  1L0X B;  3HOZ B;  5LHY 1;  2K04 A;  3I3C A;  3DEP A;  2XN9 C;  1M8A A;  1V1O A;  2AQ1 B;  4NKL A;  1LTS D;  1SND A;  1SMY D;  2NWG A;  3OMC A;  1J9O A;  4L6T B;  3NHH A;  1STH A;  3I90 A;  1ENF A;  4H0L C;  2J0T D;  2DY7 A;  5K5P A;  4KKS A;  1Q90 A;  3U9S A;  3T13 A;  1I6H B;  3MXN A;  1I4R A;  5COR A;  1TVX A;  4R8I A;  2F0U A;  2EY2 A;  5I9P A;  1I3Q B;  4TSS A;  3BDL A;  1AZP A;  1EU3 A;  3OIQ A;  4RKB A;  5C3E B;  2PW5 A;  3Q24 A;  3KLS X;  2K05 A;  1BCP D;  2ENB A;  4HN7 A;  3LWU A;  5E3F A;  2KUM A;  1EYD A;  1PZJ D;  2NZ1 D;  2EJG C;  4DU9 A;  3S9W A;  2F0F A;  2IL8 A;  1QE6 A;  2XVS A;  5FLX E;  4K5V A;  3A7A B;  3RD4 A;  3PUZ A;  4DFA A;  3EA6 A;  4IUP A;  3GV3 A;  2B2W A;  1B44 D;  1R4Q B;  1DCZ A;  2C9O A;  4NDX A;  1F77 A;  1SAP A;  3VR2 A;  2K1B A;  5C6A A;  3EVQ A;  2XRS D;  2QF7 A;  3R8B A;  2F0J A;  4KN4 C;  5JPN C;  2CVR A;  4RA8 A;  3RZO B;  4J8Q A;  4DN4 M;  4IUT A;  3MTS A;  2F1M A;  3DWQ A;  2VB2 X;  3G7L A;  4OO1 I;  2VUM B;  1CTM A;  1ICW A;  4FF4 A;  1STY A;  2IW3 A;  4HCS A;  3QB3 A;  4PMC A;  1EY5 A;  4OHJ A;  2F0W A;  1EY9 A;  5C3X A;  3C1F A;  3PUY A;  5C3W A;  3SDZ A;  1Y8P B;  4RHR A;  4KTA A;  1XYI A;  1B4O A;  2ID0 A;  4RHS A;  2KEE A;  4MIU A;  5C0X I;  2KOL A;  3PIO 3;  2D5D A;  1F9S A;  4BWG B;  1I4H A;  4QF4 A;  3PUW A;  3J7A F;  2XWB B;  3BDO A;  4DAY A;  3P1H A;  4NMZ A;  1WD0 A;  3OSO A;  1OXU A;  3GTG B;  1D5Z C;  4Q5V A;  2EYM A;  2EY6 A;  2D2C C;  5M3M B;  1SNQ A;  5EJW A;  2L0C A;  3FMC A;  2A69 C;  2EVB A;  3GV6 A;  3J80 L;  3TP6 A;  2MP1 A;  5M3F B;  4RCN A;  4C56 C;  5COY A;  1LTA D;  1ZKO A;  3PUX A;  1K8M A;  4LAA A;  4G7Z C;  3TZU A;  5CV6 A;  1IYV A;  4B9X A;  4FXD A;  2LS0 1;  3J81 L;  2RKS A;  1EZ6 A;  1EEF D;  1KDB A;  5IGD A;  3OWE B;  1SE4 A;  1HCZ A;  2IX3 A;  1HQR D;  1LLR D;  3L3O C;  2ZXP A;  2F0D A;  1ROD A;  3DM1 A;  3ITP A;  1S5D D;  1RCV D;  2JA7 B;  3HRZ C;  1Y1W B;  1H9M A;  5FO7 B;  4HMI A;  2EYL A;  1MGS A;  1DJR D;  1A2T A;  1NR4 A;  1MSG A;  5EKI A;  4OL7 A;  2HUG A;  3BVG A;  1TWC B;  3W3A A;  1RF2 D;  1TS5 A;  4PMW A;  2K32 A;  1TS3 A;  4C3I B;  1JWM D;  1E2V A;  1HUM A;  2XWJ B;  1OXV A;  2K33 A;  2LKV A;  1RKN A;  1RTN A;  4AYB B;  4ZKC B;  1EY7 A;  2L11 A;  3NUC A;  3QO2 A;  4PMB A;  5EBC A;  3BS1 A;  3OHX C;  1TWA B;  2A6E C;  1XX8 A;  3M4Y A;  5BN4 A;  4RKL A;  5KNB A;  2BE5 D;  2PPB C;  1SNC A;  3ND8 A;  1I4X A;  1AFP A;  2A74 C;  2RBM A;  2OXP A;  5IOC A;  2AUK A;  2PZU A;  5CMD A;  4E6I A;  1ET9 A;  1HTL D;  5E1F A;  5I6Y A;  1BO0 A;  2JXM B;  3NSW A;  4FXG C;  2X69 A;  4MN3 A;  2F0S A;  3MAQ A;  5AFW A;  3O13 A;  3WOF A;  1PFB A;  1HA6 A;  1ESF A;  3NP8 A;  3VYS A;  1PZI D;  1CZW A;  2FMM A;  2JA8 B;  2AQ2 B;  4A3G B;  1DM0 B;  4A3I B;  1X3Q A;  2F0Q A;  2E74 C;  1QIL A;  4C3I G;  2E75 C;  2WB1 B;  1V8Q A;  1EQV A;  1Q1E A;  4FVM A;  5IOD A;  1J8I A;  2DN8 A;  3KF8 A;  1PDQ A;  2AQ3 B;  5M5X B;  3U9O A;  3KLR A;  4RWS C;  3HEJ A;  1HHV A;  4ME5 A;  3CKI B;  5CV5 A;  4N9P A;  4X3T A;  2Q8R E;  3BYY B;  1UAP A;  4HED A;  2IX0 A;  2WKC A;  1MD2 D;  4X3S A;  4FF2 A;  1CT1 D;  2KQ3 A;  2RDH A;  3J7A V;  2V4D A;  3VR4 A;  4TKO B;  3FPP A;  1RHP A;  2B2Y C;  4XQQ A;  1CK1 A;  1H9K A;  2MUY A;  3Q6S A;  4F7X A;  5DM6 3;  4KHZ A;  5C5L A;  1CFM A;  3NE5 B;  1G2S A;  3T16 A;  3SEB A;  4GZY C;  1AEX A;  2WII B;  2PNR C;  5D14 A;  1STB A;  1W6K A;  1IW7 C;  1XXG A;  5EBD A;  1PTO C;  2DY8 A;  2B2T C;  4C3H B;  3P7J A;  1U4P A;  2K28 A;  4DXG A;  1SDF A;  2NTS A;  4IFD J;  2QCP X;  5I6W A;  3SHL A;  3K5O A;  4ZQ3 A;  2L55 A;  5EPK A;  4DXF A;  1S4Z A;  1OO9 B;  4WJW A;  3SR1 A;  2E2H B;  2BE5 C;  1GHJ A;  3C2P A;  3HOX B;  1U4L A;  5CV4 A;  1WCM B;  3M7G A;  4K8I A;  3A8J E;  2J4X A;  3P20 A;  4J1M A;  2PQE A;  1FGB D;  2YU9 B;  1PZK D;  1WTV A;  1M4V A;  2QKI C;  1WTQ A;  1QG7 A;  2LFN A;  3GTQ B;  4UAI A;  3ERO A;  4V0B A;  1UUP A;  3PV0 A;  2K5D A;  4TQU S;  3PUV A;  5CV8 A;  2NVY B;  1EY4 A;  5EKK A;  3A8I E;  2RDF A;  2OF1 A;  3QOL A;  4TRD A;  1V1P B;  1D1I A;  2SEB D;  2L12 A;  2EYO A;  1SNM A;  5C4X B;  2BA1 A;  2EDG A;  3KK7 A;  4BA1 I;  5DNF A;  2B2T A;  4QCL A;  1LAC A;  2F0L A;  3I4L A;  4ZKB B;  1H9S A;  5IGB A;  1JOQ A;  1KLU D;  1Q3L A;  2SNM A;  1CM9 A;  2YYZ A;  1PTO H;  4XIG S;  2B2W C;  1Q12 A;  3T53 B;  3SE0 A;  2NYZ D;  3SK4 A;  1SJH D;  1PRT D;  3I91 A;  3J81 E;  1FR3 A;  5ELD A;  5FO8 B;  1EWC A;  1I50 B;  5J1Z A;  2B8G A;  5T1G A;  2PZT A;  2R93 B;  2XNA C;  1HUN A;  1KNE A;  4G4K A;  5CC4 A;  4BBR B;  1QB5 D;  1V43 A;  1LT3 D;  2N55 A;  1SFO B;  4IFD H;  5K36 H;  5KYI A;  1YNN D;  4P2C B;  1GXD C;  1SYE A;  2FJ2 A;  2JEA I;  1FNV A;  1KDC A;  3FPU B;  4F88 A;  4HAE A;  4N9T A;  2DNE A;  2EJF C;  3NWS A;  3P75 A;  4BBS B;  4BY1 B;  4OO1 H;  3SXH A;  1H9J A;  1BR9 A;  2G9D A;  4LMQ D;  3H09 A;  4CBV A;  1VCI A;  2M2L A;  2EYJ A;  1F2L A;  3KUP A;  3TP5 A;  4PQX A;  1F9R A;  3MWY W;  1Q1B A;  5KYL A;  2RQX A;  2XSC A;  1ILQ A;  1E2W A;  1I4Q A;  2NN6 H;  1K83 B;  5M5Y B;  2TMP A;  3CU7 A;  1JE4 A;  1CA6 A;  5KRU A;  1WTX A;  2EXZ A;  3C46 A;  3BDC A;  5JOB A;  5M5W B;  4RGM A;  2NUC A;  4ZUJ A;  1TWG B;  3UI2 A;  2EZV A;  5C0X H;  1A3U A;  2R7Z B;  4H7B A;  2WAQ B;  1RJT A;  4Y7N B;  3OWF A;  1F2Y A;  2Q8T A;  1JIC A;  4K8J A;  2IJ0 A;  1Y69 U;  1JC7 A;  1KAB A;  2HCC A;  1L0Y B;  1FNU A;  1Y1V B;  3EFX D;  3S17 B;  2VB3 X;  5HUR A;  3RUZ A;  4PNY A;  3T56 B;  3S1Q B;  1EY0 A;  3W2D A;  3K7A B;  2WV6 D;  2I46 A;  2G9H D;  1EWH A;  3S2H B;  3CRL C;  4M8A A;  3HP3 A;  2KVM A;  2MJ8 A;  5KIX A;  4FYD A;  2XIW A;  1GUW A;  1CHQ D;  2PMZ B;  1A15 A;  1Z47 A;  5EPJ A;  3FRP B;  3JAM E;  1GUN A;  4A93 B;  1MSH A;  4ABN A;  4ZUI A;  2RDG A;  5BN3 A;  2BDN A;  4UDU C;  3R93 A;  5DM7 3;  2F0T A;  3A8K E;  5CV9 A;  2NVT B;  3GTL B;  4DNT B;  1O7L A;  1TT2 A;  5IGE A;  5JJZ A;  3V2T A;  4DAP A;  1PRT C;  1DD2 A;  1SMY C;  5D3I B;  1ONL A;  1XWE A;  3CHB D;  3N6R A;  4H13 C;  2NB0 A;  1HRJ A;  1G8Z D;  4KD3 A;  4KJO A;  3BG3 A;  5FOB B;  5IGG A;  2R92 B;  5IT9 E;  3HOY B;  4XQN A;  2EY1 A;  1DYQ A;  4CJ1 B;  2F3V A;  1LAB A;  1D5X C;  5JAV A;  3TBI B;  5KNC A;  2R6G A;  4ZAI A;  2AWN A;  1NCV A;  4FF1 A;  1IKL A;  1EY8 A;  3A55 A;  4ULL A;  1OXX K;  1STE A;  2O2L D;  1BNZ A;  5DAU A;  3K58 A;  3HOV B;  4R8N A;  1II3 A;  5FK9 C;  5C4J B;  1G6Z A;  4RGO S;  4U68 A;  3C3L A;  3NWT A;  1BCP C;  3S1R B;  1LTB D;  2A6H D;  4G57 A;  2I07 B;  4QMG A;  2KCC A;  3D4R A;  2K6A A;  4B08 A;  1F2M A;  5CBA E;  3VA7 A;  1SJE D;  4EQN A;  4XDX A;  1SNO A;  1U4M A;  1SE2 A;  4ODG A;  1BBX C;  3FKI B;  4B9W A;  1R9T B;  1E0B A;  3IL8 A;  1SE3 A;  1EYC A;  1EZ8 A;  3R2T A;  3H6M A;  1ILP A;  4ID6 A;  4IUV A;  5JEA J;  4EQP A;  4KKU A;  3X3N A;  3HZX A;  3NQI A;  4OIK A;  1BQQ T;  4I7Z C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...