5CV7A

Crystal structure of staphylococcal nuclease variant delta+phs v66h/i92d at cryogenic temperature
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMHENAKKIEVEFDKGQRTDKYGRGLAYDYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS V66H/I92D at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 36
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2015-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5cv7A00
2EYOA 5M9OA 4KJOA 3PMFA 4HMJA 1TT2A 4K5XA 2EYLA 2WACA 2RDFA 1STNA 4KTAA 4EQPA 5E1FA 4OL7A 1SNQA 1SYEA 3NHHA 3NP8A 3VA5A 4EQOA 3TP8A 1F2MA 2QDBA 4EQNA 3P1HA 1EY8A 3MHBA 3V2TA 3TP7A 1SNMA 2F0SA 3MVVA 3D4DA 3NXWA 5IODA 1SYGA 4PNYA 1STAA 4S3SA 3QOJA 2O4XA 2F0EA 4KV6A 5CGKA 3D8GA 4RKLA 2F0QA 4K8IA 3SXHA 5I6WA 2PYKA 3HZXA 4KHVA 5E3FA 5IIFA 4QB4A 5CV8A 3RUZA 5IGGA 3TMEA 4QF4A 4KY5A 1SNCA 5I9OA 4ME5A 4PMCA 5CV7A 1SYBA 2OXPA 4G57A 1F2YA 1SYDA 1KDAA 4KY6A 2F3VA 3NQTA 4NDXA 5CV9A 2PZWA 4ZUJA 5J1ZA 5C4HA 3HEJA 5C4ZA 2F0OA 5IOCA 3NUCA 4PMBA 4K5VA 3T16A 3U9OA 1STHA 4R8NA 3ITPA 5HURA 2EY6A 4HMIA 2F0LA 5IGFA 1STGA 4ZUIA 5CV5A 2HQEA 2SNMA 5KYIA 4B9XA 3T13A 1SNDA 3MZ5A 5C5MA 1RKNA 5CV4A 2PW7A 4ID6A 3SK8A 1NUCA 1II3A 3D6CA 3MEHA 2PZTA 1JOOA 4K2LA 2F0PA 1F2ZA 4J6HA 2SOBA 3NK9A 3ERQA 4NMZA 4WRDA 2EYMA 2EY5A 1SYFA 3OMGA 1ENCA 2PW5A 5KYLA 2EY1A 3MXPA 2EYFA 1STBA 4F7XA 2F0IA 5J22A 3OWFA 3R3OA 2F0WA 2LKVA 4KD3A 4RKBA 5JOBA 1IHZA 4E6IA 1EY6A 2EYPA 2F0VA 3BDLA 1EZ8A 2F0HA 2PZUA 3P75A 1KABA 3OSOA 3LX0A 4HTHA 4MIUA 2EYJA 2RBMA 1EZ6A 4N9PA 5DAUA 5C3XA 5I6YA 3QOLA 3S9WA 2M00A 4H7BA 5IGDA 1JOKA 4IALA 4K6DA 4ZQ3A 5KEEA 5EKLA 5K5PA 1KDBA 3SK6A 5C3WA 3E5SA 2KQ3A 1EYCA 1KAAA 1AEXA 1EY7A 1U9RA 2SNSA 2KHSA 3C1EA 3DMUA 4K5WA 4I65A 5NUCA 3BDCA 5CV6A 1A3UA 2EY2A 1JORA 1KDCA 1EQVA 1EYDA 2F0TA 2EYHA 1NSNS 4KY7A 5EKKA 2F0MA 1STYA 4DGZA 5ISRA 1TR5A 5IGCA 1EY4A 5KIXA 2F0JA 4EVOA 1A2UA 4IUNA 1JOQA 2F0UA 2EXZA 4KJNA 4NP5A 1EY9A 5I9PA 5C6AA 1TQOA 5IGEA 2PQEA 1EYAA 4K2KA 5DEHA 5J39A 2F0KA 2F0NA 3OMCA 4NKLA 5C5LA 5EGTA 4QMGA 4B9WA 4F8MA 1ENAA 3TP5A 4LAAA 3SR1A 5IGBA 2F3WA 3EROA 5CC4A 1EY0A 2F0FA 5JAVA 1A3TA 4DFAA 2ENBA 4TRDA 4N9TA 3SK4A 4DU9A 3TP6A 1SNOA 5F2DA 5KRUA 2F0DA 4KD4A 3SHLA 2RKSA 3SK5A 2OEOA 2F0GA 4IZ8A 3QB3A 4K14A 5CR3A 1A2TA 4ODGA 5KGUA 3H6MA 4WORA 5HGTA 4DF7A 4YIJA 3EVQA 1EY5A 2NUCA 2OF1A 4K8JA 1A3VA 3EJIA 4J1MA 3C1FA 1SNPA 1SYCA 3DHQA 3D4WA
chains in the Genus database with same CATH superfamily
2E75C 1N36Q 1PTOH 3S1MB 1B8AA 3VR3A 1C9OA 3H15A 3OWEB 1O7LA 4JI0L 4WJ3M 1CKNA 1DYQA 1VQ6A 2LXKA 3GTMH 2CHBD 5CGKA 4CHTB 4K8IA 1S5DD 1PZKD 2O5JC 3CC7A 1GUSA 4A3IB 2NVQH 4MZ9A 2E76C 3AFQA 3CMEA 2O5IC 1IBKQ 3H3VI 1PH6A 1LTLA 3T1HQ 3STBD 5M5YH 4JI1Q 1PHJA 4C3JG 1STGA 1IBLQ 2VY3A 4A3MB 4C3IH 3H3VC 2A6EC 2CQOA 2IX0A 4J6HA 2SOBA 2JA6B 1L1OB 1D5MC 4CKBA 3Q23A 1SJED 1ZYRD 1MHWC 1IHZA 1DOLA 3OSOA 3HOZG 1PRTF 1QZHA 3GV6A 5C3XA 5DAUA 1AN8A 1R9TH 3HG9A 5FLMH 1UNSA 4BXXG 4K6DA 1WVLA 3X3NA 3H0GB 4A3CG 4GZYC 1LT4D 3A7LA 4UP9A 3CU7A 4FXGC 1G91A 1EY4A 5ELBA 1GUGA 4BXXH 4WFN3 1LM0A 1PRTC 1XYIA 4J8QA 2UU9Q 2YU9B 2X69A 5EGTA 1K28A 1Q1BA 2FMMA 4XQJA 4JI6Q 2Q8RE 4LF7L 2ASBA 2MO1A 2K52A 3FKIB 4CDFC 2ZXPA 4KHZA 2RVLA 3CP0A 3SHLA 4DR3Q 2PMZB 2OTJA 2R7ZB 2N55A 2J0TD 3ZJYC 5HGTA 1Q7YC 2L9HA 2O2LD 1CA5A 3R3OA 1M4VA 2K7VA 1IL8A 1IXRA 2D9UA 5BR8Q 3D4DA 2E2DC 2L5TA 3HKZE 3BZDB 2D2CC 4N8X1 4DR4Q 5GAHC 2B2WC 3FEWX 4GOPB 5CV8A 4U673 4B3TQ 1ICFB 1I4RA 4PMCA 1I50B 4LFBQ 3CPWA 3A5ZB 1WCMG 3A8IE 1ENFA 3P7JA 2PCFB 4R9WA 1VQKA 4JV5L 2K5DA 3OPOA 1MJEA 1LTGD 1TS4A 4F87A 2VQEQ 1ESFA 4J15A 1RIPA 1RCVD 2RHSB 1X3PA 3X3MA 3MEHA 4KKSA 1JQYD 1KXLA 2A73B 3RZOH 3KUPA 3SVMA 3J80E 4F7XA 2NZHA 5BR8L 2ATWA 4KD3A 3EIVA 1TKWB 4OELB 2Z4HA 1B4OA 4HIOA 4B3TL 1UWVA 2LY7A 4JI3Q 4QJFA 5EKLA 3GTQH 4A93H 3PO3G 4XYOA 3T1YQ 4BY1G 1GKHA 3C1EA 1HJPA 5CORA 4EGVA 5IT9c 2JA7H 1IBML 3HOXH 4G7HC 1L0YB 3A7AB 3KBGA 4C2MB 2A19A 2F0JA 4RG1A 3AMUA 2EXZA 2K03A 2AQ1B 4RFBA 1UEBA 2A69D 3KLWA 3OTOL 1RTOA 3AU7A 3IL8A 4H0LC 3PIP3 1QJOA 2MNAA 3MC0B 3GTGB 3FVQA 1UEAB 2XRSD 4IFDJ 4ILWA 1NMFA 5IP7G 1KTKA 4AQYQ 1CSPA 2G5DA 1EQRA 1EY5A 4JW0A 4DV3Q 4J1MA 3C1FA 4LF9Q 1E1TA 5C0XJ 4A3FH 1YNNC 2WACA 4KKUA 5C44B 1BR9A 1EFID 2M9VA 1XXGA 3VYRA 1OXUA 3VA5A 1IW7C 1A63A 4TQUS 3RLNA 3FPPA 3P1HA 1EY8A 3K5LA 4DV3L 1T5XD 4OWTB 3ND9A 2HIXA 1PFBA 4YHHL 3D8GA 3R8BA 1EWCA 1L0WA 3RUZA 1R4QB 1WD1A 4XIGS 1I4GA 3J81i 2A6HC 3PIOA 1I6VC 2F3VA 3Q8DA 2Q2TA 1QNUA 1Y14B 5AFWA 1MSHA 2EY6A 3NBHA 2HQLA 4C3IB 1G6ZA 1KQSA 4MTNA 4UPAA 3M85A 4DV0Q 4MN3A 4JBWA 2Z6BA 3MEFA 1HNZQ 1KLGD 3NEMA 4K2LA 4MNOA 4DNTB 4WRDA 2PMZE 4QCLA 2EY5A 3CCSA 4RH6A 3VR4A 1CKMA 2NTTA 5JOBA 2WINB 1Q81C 5J3BA 1HNWQ 1BKBA 2IX1A 5ELDA 2CKZB 2FJ2A 4DK3C 4IN3A 1GUTA 1O80A 2EQSA 3J81L 4IUTA 4RWSC 1YHAA 1KDCA 1EQVA 1OXXK 2R92H 2C35B 4A75A 1C7YA 3S1NB 4EVOA 4ZKBB 2VL6A 4DV4Q 1GJXA 1W2BA 2BE5D 2JQOA 5ELFA 1AE2A 1ENAA 1DD2A 1JC7A 4ULLA 1QB5D 2MPMA 3HOXG 3PUXA 1D5XC 4FXKC 2QCPX 4TRDA 1F9SA 4DU9A 4RA8A 4FP5D 4IZ8A 5H1SE 1XNQL 1I50H 4DR4L 3LNNA 2XRQD 3I91A 3HOUH 1YNND 2OF1A 2JE6I 2I5HA 1LTBD 3CXCA 3T53B 4HMJA 4IPDA 2EYLA 3UI2A 2D62A 2ES2A 5ELNA 3DWQA 3NP8A 3QR8A 1BXTA 1F2MA 4EQNA 2EJGC 4A76A 1CA6A 1HUNA 3V2TA 4MTKA 1SNMA 4BBRH 3M4YA 3A74A 2BDNA 2HCIA 4A3DB 3F2BA 4DN4M 1SE8A 4IPGA 2EDGA 3HOWB 1WD0A 3BDOA 4GLAC 5I9OA 3NENA 3KJPA 3U9SA 2I5LX 3HOZB 4NDXA 1KD1C 3HEJA 1N34L 3S15H 1ICWA 4DPGA 4XYQA 2Z1CA 1EIGA 5IGFA 4ZUIA 1V1OA 2HQEA 5EPKA 1T5EA 5A2QL 4DV2Q 1CKNB 2Z8LA 1ZEQX 2H1EA 2A5HA 2PW7A 2XWBB 4JYAL 1LTID 1VQAA 4UP8A 1BOSA 2EYMA 2VB3X 4LF6Q 1Q46A 3H91A 4A3JG 2F0VA 4JI5Q 1EZ8A 2IL8A 1KABA 3DEOA 1Z7TA 3LX0A 3CCVA 4CKCA 1U4LA 1M90C 4FF3A 1JWSD 2M00A 1WTRA 4RAUC 5KEEA 1IKMA 5E4XA 3S1MH 3SK6A 5HGQA 3OHXC 1A15A 2B2YC 2WB1E 4LFCQ 1WOCA 2KCTA 2R7ZG 1A3UA 3M4OB 3QO2A 3UDFA 1GHJA 5IGCA 1B9NA 2SDFA 1YJ9A 1SE4A 2AQ3B 1PH1A 1EWHA 1XMQQ 3LWUA 1K83H 1YNJD 3AB9A 1SMXA 2B63H 3URYA 1PVOA 4BBSB 4A3DG 2G9HD 3VYSA 3CD6A 4FYDA 1YEZA 3BZCA 5GAGC 3RZOB 4A3GG 5HY6A 1A2TA 4PZ7A 3Q0AA 3S2DH 3TDQA 1B50A 3T1HL 5A2QE 1FR3A 3I56A 3N6RA 4KKTA 5M3MB 1VQCA 2UUAL 4IO9A 1K83B 2MQHA 5CMDA 1JE4A 1IL2A 5IT9L 4EX5A 5C0XH 3S1RH 2B8FA 1ML0D 2JXMB 3HOYB 2KCCA 3KJOA 4A3LG 3VR5A 1HTLD 1TWFB 3H0GH 1PV4A 1B53A 1MBYA 2H4OA 2YTYA 1DZ1A 1SNCA 4IFDH 1CK1A 3F1ZA 1K3BC 5JVH3 5KNDA 4QY7A 4AYBG 4IFDI 2KHJA 2B63G 1V1PB 1UE6A 3T16A 3KOJA 4CDDC 2DJGC 4OXPA 3PF4A 2KCMA 2KUMA 2WP8J 2JP1A 1O7IA 1XMOL 5K36G 1NUCA 4XQNA 3D6CA 1Q3LA 1ASZA 4OIJA 1IZ6A 1J6QA 4DV6Q 2JA5H 1SYFA 5DNFA 4FNFA 3HKZB 2YTVA 4HTHA 5TSSA 4V190 2Q8IB 3I4LA 1P8LA 4IPCA 2MO0A 4LMQD 4IALA 2BCOA 4GNXA 3NTIA 2L11A 5JVG3 4A3BB 2A69C 3CCLA 1XX8A 4CDCC 3BVMA 3BDCA 5D65A 5FKAC 1FNWA 5AJ3L 3V05A 2EYHA 4DV4L 4JOIC 2SEBD 1S4ZA 1A2UA 4NB3A 2Y0SB 3MXGA 4C3JH 1EY9A 3L7ZC 4L5SA 2B2TA 2F03A 1EYAA 3MXUA 1X54A 2F0KA 5J39A 1GHKA 1BQQT 4A3MH 2WFWA 4PQXA 3RLOA 2Z6KA 1BO0A 4PG3A 4DR5L 4A3EG 4ALPA 1TWGH 5M5WH 4KLKA 2XVSA 4DR3L 5KRUA 4BWGB 1RF2D 3NELA 3TEHB 2NYZD 1KRTA 4KHPQ 1UE7A 3T56B 3MA2B 2JA6G 1XPRA 4DUZL 4OX9Q 4R4TA 3AFPA 4LUOA 3M7NA 1D8LA 4KJOA 1E24A 2FHTA 2Y0SG 3HGBA 4RHSA 3MFGA 4C3JB 4X65Q 2PNHA 4IJLA 3L9AX 4OEMB 2ID0A 1VQ8A 2VB2X 1Q8KA 2IHEA 4A3EB 3GTOB 3O13A 3IAYA 1PDQA 5KNCA 2NN6I 2ZM6L 3WOFA 4MHEA 4Q0FA 1XNRL 2HHHL 3GTJH 3RNUA 4DR5Q 1SYDA 1HZAA 1JB7A 5J1ZA 3W1BA 3A5UA 1K8AC 4ZUJA 3A55A 1YNXA 4BA2I 4LUZA 2BH8A 2UUBQ 1IBKL 4GNXB 3TZDA 4PMBA 2ZM6Q 3UE0A 4KK7A 3A0JA 1V1QA 1YHBA 2JA9A 4JI7L 1CHQD 4N8FA 2F4VL 2Q8TA 4BA1I 3Q24A 1JWMD 3ONAB 1WTVA 3CF5A 1E2VA 5CV4A 1EIFA 1Q90A 1II3A 1MGSA 4L6TB 1HHVA 1JOOA 4P74A 2NTSA 2PW5A 3MXPA 1EOTA 4A3BG 3I4MB 1G51A 1RDPD 2I0QA 2DY7A 1C8CA 2HDLA 3TQYA 1TU2B 1BF4A 3CAMA 1IKLA 4X3KA 2NWGA 1G8ZD 1HNXQ 2B3GA 3W3AA 4LUVA 2VUMH 5JJKA 2X6GA 3M3YB 3GTMB 2N88A 2NN6H 1O7YA 3PO2G 2N49A 4O42A 4Y52H 2QW7A 2RSNA 1NY4A 3W5OA 1SROA 3PQIA 2F0UA 1WCMH 1QE6A 2NVXH 3BJUA 4DR7L 2QDLA 1EU4A 3SE0A 3PO2B 3CQZB 4LJZC 5IYDH 4GLXA 4TVAB 1A62A 1FNUA 1HZ9A 1MI2A 4LF9L 2R92B 1XTCD 3SK5A 1EUJA 1SSOA 1HQRD 4ZLTF 3QWNA 3I4MG 3FKIG 5CR3A 1IYUA 1P16A 4Z9CB 4KHPL 4XQQA 2OT2A 1HFGA 2IWHA 2GVBA 2B2WA 4QQBX 1EIHA 1I4HA 3J81E 2RF4A 3BYTB 1X32A 3PUYA 2ICIA 4L5QA 2UXDL 1CI3M 1PTOD 3NBHB 2NVXB 4POFA 1NCVA 1RD9D 4DA2A 4UY8C 4DAMA 2CFMA 1G2TA 1SYGA 3JC66 3J80i 2WKDA 4HJ8A 3MXNA 4OO1G 4POGA 4Y7NH 2PYKA 4QB4A 1JB3A 3V96A 5COYA 4HEDA 3W1GA 2PO4A 3BYYB 4JI6L 2KCNA 1B44D 2PI2E 2C9OA 3S1QB 2WB1G 3G71A 1JE5A 3NUCA 1VMPA 5IYBH 4A3KG 3E0JA 1PTOB 4FF1A 3PIO3 1VQBA 1NAPA 1QCBD 3I2ZA 3K0YA 1SE3A 2SNMA 3ND8A 1VS0A 3T13A 4IPHA 1GXDC 5IE8A 5GAEC 4JC0A 5FLXE 1LV9A 2KA7A 4A3CH 1VQJA 3EA6A 5DM63 4IQZA 3R2IA 5JEAH 2F52A 2JK8A 1SR3A 1K8MA 1LABA 5EKIA 4L8JA 2EYJA 1QNKA 2OCEA 3KF6A 2CCZA 3GD7A 1EEFD 1TWHH 1ET9A 2DUDA 4PZ8A 3PV0A 5C3EB 5L37A 1FL0A 1HA5A 3T51B 2K04A 1ASYA 4X3SA 4LF8L 1EY7A 1ZKOA 3J81j 4I65A 1OO9B 4HCSA 4BY1B 5CV6A 1GO3E 3GTGH 3Q6SA 1B70B 1PA6A 1OXSC 3S1NH 2QKIC 2JA8H 1TS2A 3H09A 1VDZA 5LMUQ 2J7ZA 3EFXD 5I9PA 1G2SA 2HHHQ 3G48A 3I7FA 4K0KQ 4B9WA 5A35A 1GVPA 3OOCA 3MXNB 1PRTD 3ERSX 3I70A 1SNOA 1VQOA 3BU2A 1HUMA 1E0BA 1RTNA 4NW2A 4DR6Q 1X3QA 3D4RA 2UXBQ 4DF7A 5FLMG 3UDGA 1AFPA 4DR1Q 1T9HA 1DONA 2WB1B 2L4NA 1OTCA 1TT2A 5T1GA 2UXCQ 3NTKA 4QL5A 1YI2A 1X3FA 3VR2A 1X3EA 1Y8OB 3L2PA 2RQXA 5IODA 4AYBB 4H44C 5LL6X 1GUWA 1PRTB 2O4XA 2WAQE 1DGSA 1XNRQ 2UUCQ 4OO1I 3KDFB 1AZPA 3TREA 4GOPA 3GTJB 3IRBA 1S5BD 4ME5A 5CV7A 5M3FG 3EQLC 3HOXB 3HS0C 3K81C 5C4XB 2ZJQA 1F9PA 2HIVA 2OQKA 1VQ4A 3K7AB 5FK9C 3MZ5A 2DGYA 4ID6A 1NTGA 4JI3L 3K5NA 4F8MA 2R93G 3GTKB 4FF4A 3J7ZC 4HAEA 4QGUA 1ENCA 2UXDQ 2BA1A 2EYFA 1MIUA 2LKVA 4RKBA 4IOCA 4DAYA 2A1AA 2WAQB 2BDOA 2IT1A 2RBMA 5C44G 1HPCA 4BBSG 3S17B 3DWAA 2AQ2B 5K5PA 1XMOQ 3E5SA 4F88A 4LFCL 1NR4A 5BN3A 1PH4A 5M3FB 5GADC 3SEBA 4BY7H 4PZ6A 1AP0A 4O2DA 4KY7A 4DGZA 1H9JA 1HZCA 5D14A 3CQZH 3J81c 1FYCA 2DNEA 4NP5A 2ZJPA 4K2KA 4DUZQ 5DEHA 4OX9L 5JEAG 2BH2A 2V4DA 1VQMA 4LAAA 3F2CA 2CWAA 4X66L 2WV6D 5JAVA 4DFAA 4Y7NB 3SK4A 2M2LA 5M5YB 2NZ1D 1PTOC 2RCFA 2RKSA 4JI8L 2OEOA 4QUFA 2JEAI 3FKIH 1CM9A 4TSSA 3I4MH 1BBWA 2PQAB 4A3GB 4H13C 3EVQA 5BN4A 4G7OC 1Y8PB 4KY5A 3DHQA 3DM3A 3D4WA 2K33A 3ULJA 5M9OA 3HOUB 1STNA 1K0SA 1SJHD 4L63B 1SYEA 5DM73 3CMAA 1HFNA 3HOWG 3I4NH 1BBXC 1YITA 2JYOA 1D7QA 3JAME 3CCRA 1OXVA 2KENA 4X3UA 3M4OH 5GQOA 4GNXC 1I94Q 1PYSB 4ME3A 3A8KE 2MJ8A 3N52A 4OO1H 2F4IA 5IGGA 4B3MQ 4GKKL 1EQTA 1LTTD 3I4OA 1ILQA 1F2LA 4KY6A 1S72A 4UP7A 1J9OA 3J7YW 3SDZA 3KF8B 1KIXA 4A4IA 3PUZA 2FFKB 1WTXA 3C46A 3K58A 1CZWA 3M9BA 4K5VA 4R1JA 5FLXL 2B2VC 2FINB 2NVYH 5HURA 1Q12A 1U4RA 2RCNA 5CV5A 4YWMA 2L0CA 1NBWA 1MD2D 5BN5A 2QILA 3U4ZA 3GTLB 2YTXA 1DXMA 2VQFL 2PZTA 3CC2A 1N9WA 2PQAA 4NMZA 2NZOA 3W2DA 4RMFA 5KYLA 5IYDG 4DAPA 2VZAA 2MHVA 5FOBB 1H9SB 5J22A 1ONLA 3LGJA 1YHQA 3S16B 3GV3A 1ET6A 4LF7Q 3P75A 1MJCA 4QIWB 3QOLA 1U0LA 5IGDA 1QUQB 4XT1B 2VXWA 4LNQA 4NXMQ 3PO2H 4BY7G 4DK1A 2R92G 2MUYA 4AH6A 2UUCL 1JICA 3OW7A 1AEXA 1TXYA 3CHBD 4B3RL 3TN2A 1CUKA 5JPNC 3K7UC 1KNAA 1YBYA 4P71A 1W3SA 4CGYB 3C3LA 2VQEL 2ALYB 1CFMA 1YZ6A 5JEAJ 1Z6HA 1PFMA 5C6AA 2WAQG 3OIPA 3CC4A 3NQIA 5C4JB 4DR1L 3CRLC 5AJ3Q 4JK1C 1BVSA 3I8ZA 3D0FA 1SN8A 3FP9A 4CJ0B 4LFBL 4DK6C 3TP6A 4BY7B 2F0DA 2F0GA 1PFSA 2KBNA 3H6MA 4NPSA 1F9RA 1X6OA 2D0PA 1A0IA 4HSPA 2A68C 1SNPA 1SYCA 1JOQA 2B63B 3D31A 3UDIA 1U5KA 2WIIB 4JI2Q 5LL6S 5C3EH 2N3SA 1CSQA 4DV6L 1Y1VG 2B8GA 3IKJA 3RLFA 3MHBA 2QF7A 3MVVA 1GM5A 3GTKH 1XTDA 1KNEA 3EBEA 2CW0C 4HSVA 4RKLA 3KLSA 1B7YB 2FXQA 2K5WA 2XGTA 5FLXc 1VQ9A 4QF4A 3BG3A 3R93A 4IOAA 3HOWH 3I4NG 1F2YA 1FD7D 1TWFH 1Y1WH 5IWAL 4C2MH 1I6HH 3VYTA 3HOVG 1JJ2A 4JI0Q 4OONA 1NR2A 4RCOA 4RGMA 1BBUA 2KEEA 4DV7Q 1K0RA 1QUQA 3RZDH 4AQYL 1V8QA 3ITPA 4ZK9B 2P5ZX 3M3YH 4A3IG 1Q82C 2JA6H 1PFNA 2Q2UA 3E6ZX 1TIID 3A56A 4A3DH 4YWKA 3H94A 4UHVA 1PMRA 3NPPA 5E7NA 1AE3A 4U68A 1DM0B 3KFUA 1N34Q 3S2DB 2CWPA 4A3MG 3J80c 4ZCKA 5C4XG 3MTSA 5M3MH 4N9PA 3HOZH 3SGIA 4LF5Q 4R8IA 4DUYQ 3DLLA 1HNZL 1WTOA 1B9MA 2OQ0A 2IJ0A 5IT9E 4DV0L 3DWPA 1NE3A 4K5WA 3H0GG 2E8GA 1LT6D 2F0TA 1EYDA 2JA8B 5D3IB 1ZYRC 1LACA 5EKKA 2AMCB 5JJZA 5G3LD 1J5EQ 1K9MC 2K5NA 4IUNA 3G4SA 1GOZA 4K6LA 2PNRC 1TQOA 2EJMA 2PQEA 3B6YA 1WCMB 3CCUA 5ELCA 4OWXB 3SR1A 1PLFA 1A3TA 1BCPD 1I4PA 3STBC 3FPUB 2JA5G 3NWTA 1TY0A 4YY3L 2R93H 4HIKA 5GROA 2VNUD 4DR6L 2VUMB 5LHY1 2ZT9C 1PTOF 2AUKA 4WJ4A 2NUCA 2GA4B 1SLJA 1D6EC 3AYHB 3CKIB 4C1NK 3J7AV 2EYOA 4NXML 1QVCA 1N8RC 3RN2A 4LF6L 2UXCL 4L5TA 4K0KL 2VW9A 3GDEA 2AHOB 3BS1A 1PH9A 1X9NA 5M3FH 4JBKA 2JA8G 3NXWA 4HJ7A 2CVRA 1SFOH 1H9MA 1JWUD 3I72A 1RL2A 1WFQA 3PIPA 1BCPB 4R4OA 2UXBL 1YJWA 1B3AA 5C0XG 5JPMC 1H95A 4GN5A 1VQ5A 2A6HD 1VQEA 2AKWB 4AIMA 1GUOA 5I4DA 3QIAA 3JAML 2V1CC 2DY8A 3VA7A 3HP3A 1ESRA 2F0OA 1AH9A 2UUBL 4FF2A 1D1KA 4FVMA 3RD4A 1LT5D 3GP7A 5EQ0A 4JG2A 2CQAA 4R4CA 3FRPB 3PGZA 3E3XA 4A3GH 1F2ZA 1K8OA 1TVXA 3ULPA 2JEBI 5LMUL 3NSWA 4JI1L 2XWJB 2L12A 4DR2L 1J5EL 1EZ6A 3F2DA 2EE1A 5EPJA 2NN6G 4XT3B 1TWHB 5C3WA 2EPBA 1PZID 3KBXA 1VCIA 1WTQA 3GTPH 1VQHA 2R7ZH 2E2IH 2VUMG 5NUCA 2KHSA 2BOSA 2PI2A 1E3PA 1JJCB 3OYYA 1K3RA 4EQ5A 3HFZB 4DNRB 3ER0A 1TR5A 4HJ5A 4JOIA 1DOMA 2DNCA 2OWOA 2F3IA 2E5LQ 2EXDA 1Y1WG 4FXDA 4A3JH 3LWEA 2E5LL 1VF7A 1Y1VB 4JBJA 4O1NA 3TSSA 4X3TA 2F0FA 1I4XA 2ZXRA 2B39A 5CBAE 4B3SL 5F2DA 2JA7B 2A8VA 3PCOB 3PF5A 2K14A 4K14A 1IBLL 1B2TA 3I73A 1SDFA 2Z9HA 1E22A 4YIJA 5M3MG 3EJIA 2HD3A 5C3EG 1M1KC 1PYWD 1L1OC 1H9SA 5IYBG 4A3KH 1R9TB 1L1OA 1LTSD 2TSSA 4OL7A 4DV5L 1N33Q 1KL9A 1TWAH 3K5MA 4FO2A 2XN9C 1IBMQ 4QUCA 2E2IB 2JJQA 4JPBW 1STAA 3I55A 4C3HG 1XPUA 1Q86C 2K75A 2F0QA 4A3IH 2KOLA 4RGTA 5EJWA 3KF8A 1YNJC 2UU9L 1O78A 1DCZA 2E74C 1SYBA 4JI2L 4C3HB 4NXNQ 1KDAA 5C4HA 2XNAC 2PZWA 4CKEA 4ZRZA 2Z4IA 1QWYA 3K7AH 5EBDA 1NNXA 1WYDA 3DUZA 2KEDA 3Q22A 1YJNA 3U50C 1BCPC 2I5MX 1HZBA 1EFWA 4DR7Q 4HIDA 1H9RA 2E2HB 1K8GA 2D5DA 5LMNQ 1OXTA 3HOUG 4OHJA 1TWCB 1RKNA 2I46A 5ELEA 3VR6A 2TMPA 4R4IA 4A3EH 1EU3A 2F0PA 4LFAL 3OMGA 1QOHA 2K1BA 4HN7A 3S14H 2QA4A 3K0XA 1PZJD 1STBA 3K57A 3CW2C 3SK8A 2PZUA 1XWEA 3TZUA 4JI7Q 2X6LA 4YCUA 4XXEA 4V0BA 1C4QA 4HCEA 4RHRA 3I3CA 4JI4L 4LF4L 1D1IA 1EOVA 2JA7G 1U4MA 1XPOA 2KQ3A 3E9IA 2R7DA 1Y69U 1E2ZA 1RODA 1JT8A 1BUVT 1HXYD 5DLQE 4AYBE 4DXGA 1SXTA 2VQFQ 1Y1WB 2IY5B 1O7ZA 4X6AH 1CQVA 3I90A 5ISRA 1STYA 1S40A 1AZQA 3KYHC 2ZTCA 1SMYC 1Q8IA 1SE2A 3T4AC 4GLVB 2B2UA 3CCQA 1HR0Q 2F0NA 3OMCA 2MGSA 5C5LA 3AQQA 2WKCA 3J7AF 1IYJB 1VQIA 4P75A 3QB3A 2L15A 2G9DA 3S14B 1CZGA 3NTHA 1D5ZC 2NVTH 4JCVE 5JJIA 1S5ED 3J80L 4C1NI 1KAWA 4A3FB 4DAYB 4B08A 2F0LA 4DV2L 3D6WA 1VQDA 4OWWB 1JJGA 2L1BA 1PH5A 2JN4A 4B3ML 2K5VA 2B2YA 3TP7A 4YY3Q 1VQNA 3WWVA 1HCZA 3E0EA 1E2WA 1RJTA 4KV6A 2F0EA 1NMGA 3JAMi 4LK1C 5LMNL 1JMCA 1WTPA 1Z9FA 4KHVA 1XJVA 2NVQB 3K8AA 2A74C 1SBBB 3PO3H 2B2UC 2K01A 5EBCA 5C4ZA 3FMCA 2IHFA 1STHA 1Z47A 1STEA 4HMIA 4GKJQ 2KHIA 1QILA 2B29A 5C0XI 5KYIA 3M4QA 3U58A 4CDEC 3GTQB 4HIMA 1VQFA 3NK9A 2I07B 5K36H 2F0IA 3MWYW 3OWFA 2EVBA 1TS5A 1HR0W 3E9HA 1EY6A 3BDLA 4IUUA 5IWAQ 5M5XH 3CRKC 3NBIA 3ULLA 3GO5A 1PH8A 1JOKA 2OTLA 3RMHA 2KECA 1BCPF 3S17H 2B2VA 1W6JA 1U9RA 2AWOA 2SNSA 1HRJA 1I3QH 1JORA 3PUVA 3CCJA 3CCMA 3FDTA 4A3LH 4DXFA 4BY1H 2QEXA 2CH4W 4A93G 1YVCA 4H02A 1FNVA 2CH4A 5KIXA 1TY2A 2F1MA 1WI5A 1TWAB 4KJNA 1DOKA 4A93B 3KLRA 1I4QA 1JR0D 4UAIA 4KI0A 1X3GA 1D2BA 4C56C 5IGBA 1EL0A 2UUAQ 1SRUA 1CT1D 1B1ZA 4X64L 2BA0A 4YCWA 5EPLA 5FO8B 1LTAD 4B3RQ 2RSOA 3R2TA 3BZKA 4C3HH 5C44H 3HKZG 2AUJD 3PMFA 5CBEE 4JI4Q 4LF4Q 3F2UA 2RDFA 1Q1EA 3TS0A 4DV1Q 1SNQA 4DV1L 3H3VH 4DV7L 1EYGA 2K6AA 4APVA 4EQOA 3S1QH 1IYVA 3TS2A 2CW0D 2RA4A 4I7ZC 1PH2A 3CCEA 4PNYA 4KN4C 4S3SA 1C48A 2ICEC 1LT3D 4HR7B 3ZYYX 2NBFA 5IIFA 3PO3B 1HNXL 4IJHA 3TMEA 4GOPC 4XDXA 4RGOS 1HR0L 2EOTA 2YU9H 4X64Q 1H9KA 1KC8C 2B2TC 2LSSA 3S15B 2R61A 3UDXA 5KNBA 3S16H 1GUNA 3NQTA 3KK7A 5CV9A 5CYUA 1BNZA 3HOVB 1YIJA 4HJ9A 2A6ED 2KVMA 4LWCA 1E7ZA 4LW1A 4JBMA 2C5CA 2HDMA 4GKKQ 4I7AA 1LLRD 2QEJC 2IX3A 1KHIA 4JYAQ 2K32A 4JVZA 3U4VA 2NB0A 2EYPA 4MIUA 3TRZA 3VDYA 3IFDA 1L2FA 4DNIA 2EZVA 1HA6A 4TKOB 5C4XH 5LMNW 4H7BA 5C4JH 2BE5C 4JI5L 2Q2IA 1PH7A 3GTOH 1EYCA 1S5CD 1KAAA 1WTHA 4LF8Q 1B3QA 3I4NB 5JJLA 1EIYB 3A8JE 2H5XA 4OIKA 4L5RC 4JV5Q 4X65L 4KN7C 1NSNS 2F0MA 1FVIA 4IUPA 3T1YL 2Y0SE 4X66Q 1UAPA 4NKLA 3OTOQ 3KDFA 3BVZA 3D3RA 3M7GA 3TP5A 1F77A 2IW3A 5CC4A 1LYLA 1N36L 3QJYA 1VQGA 2VS1A 4ABNA 3RN5A 1X55A 2ZTEA 3HRZC 2K05A 4ODGA 1XNQQ 4C3IG 4WORA 3TBIB 3GTLH 3C2PA 1A3VA 1MSGA 1V43A 5C5MA 1Y1VH 3CPFA 3K6OA 2J4XA 4KTAA 4EQPA 3S2HH 5E1FA 1WJJA 5FO7B 4ZKCB 2Z6KC 1SAPA 4GN3B 3TP8A 4CJ2C 3S24A 4JI8Q 4P72A 5IP9G 1IW7D 4B3SQ 3DXJC 3QOJA 5I6WA 3NWSA 3HZXA 3GTPB 4X62Q 2LMCB 1KRSA 2R6GA 5E4WC 1FGUA 2K28A 4BBRG 4G57A 2RDGA 4WJWA 3HOVH 3OIQA 3PUWA 1I5FA 1F9QA 4LF5L 5EAYA 1GD7A 4FDBA 3U9OA 2N78A 3K5OA 1V9PA 5FJ8G 2K4KA 1EQQA 1KLUD 4RCNA 3G6EA 4M1UB 4Q5VA 3OW2A 1QZGA 3NE5B 1TS3A 4IURA 2NVTB 1HH2P 2ZXOA 1FJGL 2ZTDA 1SMYD 3KF6B 2A68D 1QVGA 4IUVA 1UUPA 2YV5A 5I2XA 2E2JH 5M5XB 3K59A 2F0WA 1VMCA 2YYZA 3WOEA 3S2HB 4E6IA 5I2YA 3L0OA 2F0HA 2MFIA 4R4QA 3DEPA 4DKAC 3K80C 3G7LA 4X62L 3HOYH 4KMUC 1KDBA 1TWCH 1JCKB 3S1RB 1BDOA 2R3ZA 1ZXTA 2HCCA 1G291 1MKHA 3BVGA 3DMUA 4BBRB 1A8VA 1VF5C 1HQMC 2RDHA 1K73C 2IPKD 4P73A 2L55A 2MP1A 1CTMA 5IYCH 1HNWL 1X65A 3P20A 3QG1A 4RGNA 4QMGA 2F3WA 3EROA 1EY0A 1VQLA 2Q2HA 4NXNL 3UE1A 1HTPA 1CKOA 3MFYA 1U4PA 5IY0A 3RZDB 4PMWA 3A54A 4OGQC 2JA5B 5FJ8H 2XSCA 5IP7H 4GKJL 2LS01 5KGUA 1CQFA 2E2JB 3F8TA 4P2CB 2R7FA 4YHHQ 1UE5A 1Y8NB 1I94L 1DJRD 3AEVA 4A3KB 4K8JA 1S3OA 4DUYL 2XTIA 1PH3A 1XMQL 4K5XA 2E2HH 3WDNA 4A3BH 4DV5Q 1PYBA 2Z0SA 3NHHA 2QDBA 4CJ1B 3M4PA 4YCVA 2F0SA 2ZJRA 1C0AA 5IP9H 1E1OA 2F4VQ 1QVFA 4UDUC 5G3LF 3SXHA 5FO9B 1EWIA 3JAMc 1V1PA 5E3FA 1LTRD 1G6PA 1CHPD 3G6JB 1L0XB 1SEBD 1LO5D 2OXPA 4CBVA 1S5FD 4DAVA 5ELOA 3GQBA 2JSOA 2LFNA 5T1IA 5IOCA 2GN5A 2EIFA 3MAQA 1VQ7A 1I6HB 4PV1C 2DJFC 1X56A 1SFOB 4IUQA 4A3FG 2PPBC 4R8NA 1TWGB 5M5WB 2QGQA 2EJFC 3DM1A 1RHPA 4B9XA 1M8AA 1PXUA 1SNDA 2K5QA 1W6KA 4LFAQ 1A6XA 3ERQA 1N33L 2R93B 2EY1A 1EEID 2AWNA 2XIWA 4XTCS 2HUGA 3HKSA 1J8IA 4QIWE 4BBSH 3EN2A 2N8NA 4YWLA 1VQPA 2GVAA 5I6YA 2LXJA 4G7ZC 3S9WA 3KLSX 4BS9A 4ZQ3A 1WTWA 2K5HA 3FHWA 4GN4B 1UE1A 4A3JB 2K50A 5IYCG 2DN8A 3PSIA 5D3DA 4DK0A 1N32Q 2KJXA 1ILPA 4GS3A 2EY2A 1FGBD 3RR5A 4O0AA 1R4PB 4G4KA 3HOYG 2D0OA 4HJAA 1N32L 2FMCA 4ZAIA 5IGEA 3VYUA 3L3OC 4IFDG 2RHQB 3IFTA 1NJIC 4M8AA 1FJGQ 2ENBA 3ICEA 4N9TA 2NVYB 1AW7A 1LUZA 1I3QB 4KD4A 4DR2Q 4ZYSA 3J7A5 2HT1A 1QG7A
chains in the Genus database with same CATH topology
2E75C 1PTOH 3S1MB 3VR3A 3OWEB 1O7LA 1DYQA 2CHBD 5CGKA 4CHTB 4K8IA 1S5DD 1PZKD 2O5JC 1GUSA 4A3IB 2E76C 2O5IC 4C3JG 1STGA 4A3MB 3H3VC 2A6EC 2IX0A 4J6HA 2SOBA 2JA6B 1D5MC 4CKBA 3Q23A 1SJED 1ZYRD 1IHZA 1DOLA 3OSOA 1PRTF 3GV6A 5C3XA 5DAUA 1AN8A 3HG9A 1UNSA 4K6DA 1WVLA 3X3NA 3H0GB 4GZYC 1LT4D 3A7LA 3CU7A 4FXGC 1G91A 1EY4A 5ELBA 1GUGA 4WFN3 1PRTC 1XYIA 4J8QA 2YU9B 2X69A 5EGTA 1Q1BA 2FMMA 4XQJA 2Q8RE 3FKIB 2ZXPA 4KHZA 2RVLA 3SHLA 2PMZB 2R7ZB 2N55A 2J0TD 5HGTA 2L9HA 2O2LD 1CA5A 3R3OA 1M4VA 2K7VA 1IL8A 2D9UA 3D4DA 2E2DC 2L5TA 3BZDB 2D2CC 2B2WC 3FEWX 5CV8A 4U673 1I4RA 4PMCA 1I50B 3A8IE 1ENFA 3P7JA 2PCFB 4R9WA 2K5DA 3OPOA 1LTGD 1TS4A 4F87A 1ESFA 1RCVD 1X3PA 3X3MA 3MEHA 4KKSA 1JQYD 2A73B 3KUPA 3SVMA 3J80E 4F7XA 4KD3A 1TKWB 2Z4HA 1B4OA 2LY7A 5EKLA 4XYOA 3C1EA 5CORA 4EGVA 4G7HC 1L0YB 3A7AB 3KBGA 4C2MB 2F0JA 3AMUA 2EXZA 2K03A 2AQ1B 4RFBA 2A69D 1RTOA 3AU7A 3IL8A 4H0LC 3PIP3 1QJOA 3MC0B 3GTGB 3FVQA 1UEAB 2XRSD 4IFDJ 4ILWA 1KTKA 1EY5A 4J1MA 3C1FA 5C0XJ 1YNNC 2WACA 4KKUA 5C44B 1BR9A 1EFID 2M9VA 1XXGA 3VYRA 1OXUA 3VA5A 1IW7C 4TQUS 3FPPA 3P1HA 1EY8A 3K5LA 1T5XD 3ND9A 1PFBA 3D8GA 3R8BA 1EWCA 3RUZA 1R4QB 1WD1A 4XIGS 1I4GA 2A6HC 1I6VC 2F3VA 1QNUA 5AFWA 1MSHA 2EY6A 3NBHA 4C3IB 1G6ZA 3M85A 4MN3A 4JBWA 1KLGD 4K2LA 4DNTB 4WRDA 4QCLA 2EY5A 4RH6A 3VR4A 2NTTA 5JOBA 2WINB 2IX1A 5ELDA 2FJ2A 4IN3A 1GUTA 1O80A 3J81L 4IUTA 4RWSC 1KDCA 1EQVA 1OXXK 3S1NB 4EVOA 4ZKBB 1GJXA 2BE5D 5ELFA 1ENAA 1DD2A 1JC7A 4ULLA 1QB5D 2MPMA 3PUXA 1D5XC 4FXKC 2QCPX 4TRDA 1F9SA 4DU9A 4RA8A 4FP5D 4IZ8A 3LNNA 2XRQD 3I91A 1YNND 2OF1A 2JE6I 1LTBD 3T53B 4HMJA 2EYLA 3UI2A 2D62A 3DWQA 3NP8A 1BXTA 1F2MA 4EQNA 2EJGC 1CA6A 1HUNA 3V2TA 1SNMA 3M4YA 2BDNA 2HCIA 4A3DB 4DN4M 2EDGA 3HOWB 1WD0A 3BDOA 5I9OA 3U9SA 3HOZB 4NDXA 3HEJA 1ICWA 4XYQA 2Z1CA 1EIGA 5IGFA 4ZUIA 1V1OA 2HQEA 5EPKA 1T5EA 5A2QL 2Z8LA 1ZEQX 2H1EA 2A5HA 2PW7A 2XWBB 1LTID 1BOSA 2EYMA 2VB3X 3H91A 2F0VA 1EZ8A 2IL8A 1KABA 3DEOA 1Z7TA 3LX0A 4CKCA 1U4LA 4FF3A 1JWSD 2M00A 1WTRA 4RAUC 5KEEA 1IKMA 5E4XA 3SK6A 3OHXC 1A15A 2B2YC 1A3UA 3M4OB 3QO2A 1GHJA 5IGCA 1B9NA 2SDFA 1SE4A 2AQ3B 1EWHA 3LWUA 1YNJD 3AB9A 3URYA 4BBSB 2G9HD 3VYSA 4FYDA 3RZOB 1A2TA 3Q0AA 3TDQA 1B50A 5A2QE 1FR3A 3N6RA 4KKTA 5M3MB 1K83B 5CMDA 1JE4A 5IT9L 5C0XH 2B8FA 1ML0D 2JXMB 3HOYB 2KCCA 3VR5A 1HTLD 1TWFB 1B53A 1MBYA 2H4OA 1DZ1A 1SNCA 4IFDH 1CK1A 5JVH3 5KNDA 4IFDI 1V1PB 3T16A 2KUMA 2WP8J 2JP1A 5K36G 1NUCA 4XQNA 3D6CA 1Q3LA 4OIJA 1SYFA 5DNFA 4FNFA 3HKZB 4HTHA 5TSSA 4V190 2Q8IB 3I4LA 4LMQD 4IALA 2BCOA 3NTIA 2L11A 5JVG3 4A3BB 2A69C 1XX8A 3BVMA 3BDCA 5D65A 5FKAC 1FNWA 3V05A 2EYHA 2SEBD 1S4ZA 1A2UA 2Y0SB 3MXGA 1EY9A 3L7ZC 2B2TA 2F03A 1EYAA 3MXUA 5J39A 2F0KA 1GHKA 1BQQT 4PQXA 1BO0A 2XVSA 5KRUA 4BWGB 1RF2D 2NYZD 3T56B 3MA2B 3M7NA 4KJOA 2FHTA 3HGBA 4RHSA 3MFGA 4C3JB 3L9AX 2ID0A 2VB2X 4A3EB 3GTOB 3O13A 3IAYA 1PDQA 5KNCA 2NN6I 3WOFA 4MHEA 4Q0FA 1SYDA 5J1ZA 4ZUJA 3A55A 4BA2I 3TZDA 4PMBA 4KK7A 1CHQD 2Q8TA 4BA1I 3Q24A 1JWMD 3ONAB 1WTVA 1E2VA 5CV4A 1Q90A 1II3A 1MGSA 4L6TB 1HHVA 1JOOA 2NTSA 2PW5A 3MXPA 1EOTA 3I4MB 1RDPD 2DY7A 1C8CA 2HDLA 1TU2B 1BF4A 1IKLA 4X3KA 2NWGA 1G8ZD 3W3AA 2X6GA 3M3YB 3GTMB 2N88A 2NN6H 1O7YA 4O42A 2RSNA 2F0UA 1QE6A 1EU4A 3SE0A 3PO2B 3CQZB 4LJZC 1FNUA 1MI2A 2R92B 1XTCD 3SK5A 1SSOA 1HQRD 4ZLTF 3QWNA 5CR3A 1IYUA 4Z9CB 4XQQA 2OT2A 1HFGA 2IWHA 2B2WA 1EIHA 1I4HA 3J81E 3BYTB 1X32A 3PUYA 2ICIA 1CI3M 1PTOD 2NVXB 1NCVA 1RD9D 4DA2A 1G2TA 1SYGA 2WKDA 3MXNA 4OO1G 2PYKA 4QB4A 1JB3A 3V96A 5COYA 4HEDA 2PO4A 3BYYB 2KCNA 1B44D 2C9OA 3S1QB 3NUCA 1VMPA 3E0JA 1PTOB 4FF1A 3PIO3 1NAPA 1QCBD 3K0YA 1SE3A 2SNMA 3ND8A 3T13A 1GXDC 5FLXE 1LV9A 2KA7A 3EA6A 5DM63 4IQZA 3R2IA 5JEAH 1K8MA 1LABA 5EKIA 4L8JA 2EYJA 1QNKA 3GD7A 1EEFD 1ET9A 5C3EB 3PV0A 1HA5A 3T51B 2K04A 4X3SA 1EY7A 1ZKOA 4I65A 1OO9B 4HCSA 4BY1B 5CV6A 3Q6SA 1OXSC 2QKIC 1TS2A 3H09A 1VDZA 2J7ZA 3EFXD 5I9PA 1G2SA 4B9WA 5A35A 3OOCA 1PRTD 3I70A 1SNOA 1HUMA 1E0BA 1RTNA 4NW2A 1X3QA 3D4RA 1AFPA 4DF7A 1DONA 2WB1B 2L4NA 1TT2A 5T1GA 3NTKA 3VR2A 1Y8OB 2RQXA 5IODA 4AYBB 4H44C 5LL6X 1GUWA 1PRTB 2O4XA 4OO1I 1AZPA 3GTJB 1S5BD 4ME5A 5CV7A 3EQLC 3HOXB 3HS0C 5C4XB 1F9PA 3K7AB 5FK9C 3MZ5A 4ID6A 3K5NA 4F8MA 3GTKB 4FF4A 4HAEA 1ENCA 2BA1A 2EYFA 2LKVA 4RKBA 4DAYA 2WAQB 2BDOA 2IT1A 2RBMA 1HPCA 3S17B 3DWAA 2AQ2B 5K5PA 3E5SA 4F88A 1NR4A 5BN3A 5M3FB 3SEBA 1AP0A 4KY7A 4DGZA 1H9JA 5D14A 1FYCA 2DNEA 4NP5A 4K2KA 5DEHA 5JEAG 2V4DA 4LAAA 2WV6D 5JAVA 4DFAA 4Y7NB 3SK4A 2M2LA 5M5YB 2NZ1D 1PTOC 2RKSA 2OEOA 4QUFA 2JEAI 1CM9A 4TSSA 4A3GB 4H13C 3EVQA 5BN4A 4G7OC 1Y8PB 4KY5A 3DHQA 3D4WA 2K33A 5M9OA 3HOUB 1STNA 1SJHD 4L63B 1SYEA 5DM73 1HFNA 1BBXC 2JYOA 3JAME 1OXVA 4X3UA 3A8KE 2MJ8A 3N52A 4OO1H 2F4IA 5IGGA 1EQTA 1LTTD 1ILQA 1F2LA 4KY6A 1J9OA 3J7YW 3SDZA 3PUZA 2FFKB 1WTXA 3C46A 3K58A 1CZWA 4K5VA 5FLXL 2B2VC 2FINB 5HURA 1Q12A 1U4RA 5CV5A 2L0CA 1MD2D 5BN5A 2QILA 3GTLB 1DXMA 2PZTA 4NMZA 3W2DA 5KYLA 4DAPA 2MHVA 5FOBB 1H9SB 5J22A 1ONLA 3S16B 3GV3A 1ET6A 3P75A 4QIWB 3QOLA 5IGDA 4XT1B 2VXWA 4DK1A 2MUYA 1JICA 3OW7A 1AEXA 3CHBD 3TN2A 5JPNC 1KNAA 4CGYB 3C3LA 1CFMA 5JEAJ 1Z6HA 1PFMA 5C6AA 3OIPA 5C4JB 3NQIA 3CRLC 4JK1C 3I8ZA 4CJ0B 3TP6A 4BY7B 2F0DA 2F0GA 3H6MA 1F9RA 4HSPA 2A68C 1SNPA 1SYCA 1JOQA 2B63B 3D31A 2WIIB 5LL6S 2B8GA 3IKJA 3RLFA 3MHBA 2QF7A 3MVVA 1KNEA 2CW0C 4HSVA 4RKLA 3KLSA 2K5WA 4QF4A 3BG3A 3R93A 1F2YA 1FD7D 3VYTA 1NR2A 4RCOA 4RGMA 2KEEA 1V8QA 3ITPA 4ZK9B 1PFNA 3E6ZX 1TIID 3A56A 3H94A 1PMRA 3NPPA 4U68A 1DM0B 3S2DB 3MTSA 4N9PA 4R8IA 1WTOA 1B9MA 2IJ0A 5IT9E 3DWPA 4K5WA 1LT6D 2F0TA 1EYDA 2JA8B 5D3IB 1ZYRC 1LACA 5EKKA 5JJZA 5G3LD 4IUNA 1GOZA 4K6LA 2PNRC 1TQOA 2EJMA 2PQEA 1WCMB 5ELCA 3SR1A 1PLFA 1A3TA 1BCPD 1I4PA 3FPUB 3NWTA 1TY0A 2VNUD 2VUMB 5LHY1 2ZT9C 1PTOF 2AUKA 2NUCA 2GA4B 1D6EC 4C1NK 3CKIB 3J7AV 2EYOA 3BS1A 3NXWA 2CVRA 1H9MA 1JWUD 3I72A 1BCPB 1B3AA 5C0XG 5JPMC 2A6HD 1GUOA 5I4DA 3QIAA 3JAML 2DY8A 3VA7A 3HP3A 1ESRA 2F0OA 4FF2A 1D1KA 4FVMA 3RD4A 1LT5D 3GP7A 5EQ0A 2CQAA 3FRPB 1F2ZA 1K8OA 1TVXA 2JEBI 3NSWA 2XWJB 2L12A 1EZ6A 2EE1A 5EPJA 2NN6G 4XT3B 1TWHB 5C3WA 2EPBA 1PZID 3KBXA 1VCIA 1WTQA 5NUCA 2KHSA 2BOSA 4DNRB 1TR5A 1DOMA 2DNCA 4FXDA 3LWEA 1VF7A 1Y1VB 4O1NA 3TSSA 4X3TA 2F0FA 1I4XA 2ZXRA 2B39A 5CBAE 5F2DA 2JA7B 4K14A 1B2TA 3I73A 1SDFA 4YIJA 3EJIA 1PYWD 1H9SA 1R9TB 1LTSD 2TSSA 4OL7A 3K5MA 4FO2A 2XN9C 4QUCA 2E2IB 1STAA 4C3HG 2F0QA 2KOLA 4RGTA 5EJWA 3KF8A 1YNJC 1O78A 1DCZA 2E74C 1SYBA 4C3HB 1KDAA 5C4HA 2XNAC 2PZWA 4CKEA 4ZRZA 2Z4IA 1QWYA 5EBDA 3DUZA 3Q22A 2KEDA 1BCPC 1H9RA 2E2HB 2D5DA 1OXTA 4OHJA 1TWCB 1RKNA 2I46A 5ELEA 3VR6A 2TMPA 1EU3A 2F0PA 3OMGA 1QOHA 2K1BA 4HN7A 1PZJD 1STBA 3K57A 3SK8A 2PZUA 1XWEA 3TZUA 2X6LA 4XXEA 4V0BA 1C4QA 4HCEA 4RHRA 3I3CA 1D1IA 1U4MA 2KQ3A 1Y69U 1E2ZA 1RODA 1BUVT 1HXYD 4DXGA 1SXTA 1Y1WB 1O7ZA 1CQVA 3I90A 5ISRA 1STYA 1AZQA 1SMYC 1Q8IA 1SE2A 3T4AC 2B2UA 2F0NA 3OMCA 2MGSA 5C5LA 2WKCA 3J7AF 3QB3A 2G9DA 3S14B 1CZGA 3NTHA 1D5ZC 1S5ED 3J80L 4C1NI 4A3FB 4B08A 2F0LA 3D6WA 2L1BA 2B2YA 3TP7A 1HCZA 1E2WA 1RJTA 4KV6A 2F0EA 4LK1C 1WTPA 4KHVA 2NVQB 2A74C 1SBBB 2B2UC 2K01A 5EBCA 5C4ZA 3FMCA 1STHA 1Z47A 1STEA 4HMIA 1QILA 5C0XI 5KYIA 3GTQB 3NK9A 2I07B 5K36H 2F0IA 3MWYW 3OWFA 2EVBA 1TS5A 1EY6A 3BDLA 4IUUA 3CRKC 3NBIA 3GO5A 1JOKA 3RMHA 2KECA 1BCPF 2B2VA 1W6JA 1U9RA 2AWOA 2SNSA 1HRJA 1JORA 3PUVA 3FDTA 4DXFA 1FNVA 5KIXA 1TY2A 2F1MA 1TWAB 4KJNA 1DOKA 4A93B 3KLRA 1I4QA 1JR0D 4UAIA 4KI0A 1D2BA 4C56C 5IGBA 1EL0A 1CT1D 1B1ZA 2BA0A 5EPLA 5FO8B 1LTAD 2RSOA 3R2TA 2AUJD 3PMFA 5CBEE 3F2UA 2RDFA 1Q1EA 1SNQA 2K6AA 4EQOA 1IYVA 2CW0D 2RA4A 4I7ZC 4PNYA 4KN4C 4S3SA 1C48A 2ICEC 1LT3D 4HR7B 3ZYYX 2NBFA 5IIFA 3PO3B 3TMEA 4XDXA 4RGOS 2EOTA 1H9KA 2B2TC 3S15B 2R61A 5KNBA 1GUNA 3NQTA 3KK7A 5CV9A 5CYUA 1BNZA 3HOVB 2A6ED 2KVMA 2C5CA 2HDMA 1LLRD 2QEJC 2IX3A 2K32A 2NB0A 2EYPA 4MIUA 2EZVA 3IFDA 1HA6A 4TKOB 4H7BA 2BE5C 1EYCA 1S5CD 1KAAA 3I4NB 3A8JE 4OIKA 4KN7C 1NSNS 2F0MA 4IUPA 1UAPA 4NKLA 3BVZA 3D3RA 3M7GA 3TP5A 1F77A 2IW3A 5CC4A 3QJYA 4ABNA 3HRZC 2K05A 4ODGA 4C3IG 4WORA 3TBIB 3C2PA 1A3VA 1MSGA 1V43A 5C5MA 3K6OA 2J4XA 4KTAA 4EQPA 5E1FA 5FO7B 4ZKCB 1SAPA 3TP8A 4CJ2C 1IW7D 3DXJC 3QOJA 5I6WA 3NWSA 3HZXA 3GTPB 2LMCB 2R6GA 5E4WC 2K28A 4G57A 2RDGA 4WJWA 3OIQA 3PUWA 1F9QA 3U9OA 3K5OA 1KLUD 4RCNA 4M1UB 4Q5VA 3NE5B 1TS3A 4IURA 2NVTB 2ZXOA 1SMYD 2A68D 4IUVA 1UUPA 5I2XA 5M5XB 3K59A 2F0WA 1VMCA 2YYZA 3WOEA 3S2HB 4E6IA 5I2YA 2F0HA 3DEPA 3G7LA 4KMUC 1KDBA 1JCKB 3S1RB 1BDOA 2R3ZA 1ZXTA 2HCCA 1G291 3BVGA 3DMUA 4BBRB 1VF5C 1HQMC 2RDHA 2IPKD 2L55A 2MP1A 1CTMA 3P20A 3QG1A 4RGNA 4QMGA 2F3WA 3EROA 1EY0A 1HTPA 3MFYA 1U4PA 3RZDB 4PMWA 3A54A 4OGQC 2JA5B 2XSCA 2LS01 5KGUA 1CQFA 2E2JB 4P2CB 1Y8NB 1DJRD 4A3KB 4K8JA 4K5XA 3WDNA 3NHHA 2QDBA 4CJ1B 2F0SA 4UDUC 5G3LF 3SXHA 5FO9B 1V1PA 5E3FA 1LTRD 1CHPD 3G6JB 1L0XB 1SEBD 1LO5D 2OXPA 4CBVA 1S5FD 4DAVA 3GQBA 2JSOA 2LFNA 5T1IA 5IOCA 3MAQA 1I6HB 4PV1C 1SFOB 2PPBC 4IUQA 4R8NA 1TWGB 5M5WB 2EJFC 3DM1A 1RHPA 4B9XA 1M8AA 1PXUA 1SNDA 2K5QA 1W6KA 1A6XA 3ERQA 2R93B 2EY1A 1EEID 2AWNA 2XIWA 4XTCS 2HUGA 1J8IA 5I6YA 4G7ZC 3S9WA 3KLSX 4BS9A 4ZQ3A 1WTWA 4A3JB 2DN8A 5D3DA 4DK0A 2KJXA 1ILPA 2EY2A 1FGBD 1R4PB 4G4KA 2FMCA 4ZAIA 5IGEA 3VYUA 3L3OC 4IFDG 3IFTA 4M8AA 2ENBA 4N9TA 2NVYB 1AW7A 1I3QB 4KD4A 4ZYSA 1QG7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EYO A;  5M9O A;  4KJO A;  3PMF A;  4HMJ A;  1TT2 A;  4K5X A;  2EYL A;  2WAC A;  2RDF A;  1STN A;  4KTA A;  4EQP A;  5E1F A;  4OL7 A;  1SNQ A;  1SYE A;  3NHH A;  3NP8 A;  3VA5 A;  4EQO A;  3TP8 A;  1F2M A;  2QDB A;  4EQN A;  3P1H A;  1EY8 A;  3MHB A;  3V2T A;  3TP7 A;  1SNM A;  2F0S A;  3MVV A;  3D4D A;  3NXW A;  5IOD A;  1SYG A;  4PNY A;  1STA A;  4S3S A;  3QOJ A;  2O4X A;  2F0E A;  4KV6 A;  5CGK A;  3D8G A;  4RKL A;  2F0Q A;  4K8I A;  3SXH A;  5I6W A;  2PYK A;  3HZX A;  4KHV A;  5E3F A;  5IIF A;  4QB4 A;  5CV8 A;  3RUZ A;  5IGG A;  3TME A;  4QF4 A;  4KY5 A;  1SNC A;  5I9O A;  4ME5 A;  4PMC A;  5CV7 A;  1SYB A;  2OXP A;  4G57 A;  1F2Y A;  1SYD A;  1KDA A;  4KY6 A;  2F3V A;  3NQT A;  4NDX A;  5CV9 A;  2PZW A;  4ZUJ A;  5J1Z A;  5C4H A;  3HEJ A;  5C4Z A;  2F0O A;  5IOC A;  3NUC A;  4PMB A;  4K5V A;  3T16 A;  3U9O A;  1STH A;  4R8N A;  3ITP A;  5HUR A;  2EY6 A;  4HMI A;  2F0L A;  5IGF A;  1STG A;  4ZUI A;  5CV5 A;  2HQE A;  2SNM A;  5KYI A;  4B9X A;  3T13 A;  1SND A;  3MZ5 A;  5C5M A;  1RKN A;  5CV4 A;  2PW7 A;  4ID6 A;  3SK8 A;  1NUC A;  1II3 A;  3D6C A;  3MEH A;  2PZT A;  1JOO A;  4K2L A;  2F0P A;  1F2Z A;  4J6H A;  2SOB A;  3NK9 A;  3ERQ A;  4NMZ A;  4WRD A;  2EYM A;  2EY5 A;  1SYF A;  3OMG A;  1ENC A;  2PW5 A;  5KYL A;  2EY1 A;  3MXP A;  2EYF A;  1STB A;  4F7X A;  2F0I A;  5J22 A;  3OWF A;  3R3O A;  2F0W A;  2LKV A;  4KD3 A;  4RKB A;  5JOB A;  1IHZ A;  4E6I A;  1EY6 A;  2EYP A;  2F0V A;  3BDL A;  1EZ8 A;  2F0H A;  2PZU A;  3P75 A;  1KAB A;  3OSO A;  3LX0 A;  4HTH A;  4MIU A;  2EYJ A;  2RBM A;  1EZ6 A;  4N9P A;  5DAU A;  5C3X A;  5I6Y A;  3QOL A;  3S9W A;  2M00 A;  4H7B A;  5IGD A;  1JOK A;  4IAL A;  4K6D A;  4ZQ3 A;  5KEE A;  5EKL A;  5K5P A;  1KDB A;  3SK6 A;  5C3W A;  3E5S A;  2KQ3 A;  1EYC A;  1KAA A;  1AEX A;  1EY7 A;  1U9R A;  2SNS A;  2KHS A;  3C1E A;  3DMU A;  4K5W A;  4I65 A;  5NUC A;  3BDC A;  5CV6 A;  1A3U A;  2EY2 A;  1JOR A;  1KDC A;  1EQV A;  1EYD A;  2F0T A;  2EYH A;  1NSN S;  4KY7 A;  5EKK A;  2F0M A;  1STY A;  4DGZ A;  5ISR A;  1TR5 A;  5IGC A;  1EY4 A;  5KIX A;  2F0J A;  4EVO A;  1A2U A;  4IUN A;  1JOQ A;  2F0U A;  2EXZ A;  4KJN A;  4NP5 A;  1EY9 A;  5I9P A;  5C6A A;  1TQO A;  5IGE A;  2PQE A;  1EYA A;  4K2K A;  5DEH A;  5J39 A;  2F0K A;  2F0N A;  3OMC A;  4NKL A;  5C5L A;  5EGT A;  4QMG A;  4B9W A;  4F8M A;  1ENA A;  3TP5 A;  4LAA A;  3SR1 A;  5IGB A;  2F3W A;  3ERO A;  5CC4 A;  1EY0 A;  2F0F A;  5JAV A;  1A3T A;  4DFA A;  2ENB A;  4TRD A;  4N9T A;  3SK4 A;  4DU9 A;  3TP6 A;  1SNO A;  5F2D A;  5KRU A;  2F0D A;  4KD4 A;  3SHL A;  2RKS A;  3SK5 A;  2OEO A;  2F0G A;  4IZ8 A;  3QB3 A;  4K14 A;  5CR3 A;  1A2T A;  4ODG A;  5KGU A;  3H6M A;  4WOR A;  5HGT A;  4DF7 A;  4YIJ A;  3EVQ A;  1EY5 A;  2NUC A;  2OF1 A;  4K8J A;  1A3V A;  3EJI A;  4J1M A;  3C1F A;  1SNP A;  1SYC A;  3DHQ A;  3D4W A; 
#chains in the Genus database with same CATH topology
 2E75 C;  1N36 Q;  1PTO H;  3S1M B;  1B8A A;  3VR3 A;  1C9O A;  3H15 A;  3OWE B;  1O7L A;  4JI0 L;  4WJ3 M;  1CKN A;  1DYQ A;  1VQ6 A;  2LXK A;  3GTM H;  2CHB D;  5CGK A;  4CHT B;  4K8I A;  1S5D D;  1PZK D;  2O5J C;  3CC7 A;  1GUS A;  4A3I B;  2NVQ H;  4MZ9 A;  2E76 C;  3AFQ A;  3CME A;  2O5I C;  1IBK Q;  3H3V I;  1PH6 A;  1LTL A;  3T1H Q;  3STB D;  5M5Y H;  4JI1 Q;  1PHJ A;  4C3J G;  1STG A;  1IBL Q;  2VY3 A;  4A3M B;  4C3I H;  3H3V C;  2A6E C;  2CQO A;  2IX0 A;  4J6H A;  2SOB A;  2JA6 B;  1L1O B;  1D5M C;  4CKB A;  3Q23 A;  1SJE D;  1ZYR D;  1MHW C;  1IHZ A;  1DOL A;  3OSO A;  3HOZ G;  1PRT F;  1QZH A;  3GV6 A;  5C3X A;  5DAU A;  1AN8 A;  1R9T H;  3HG9 A;  5FLM H;  1UNS A;  4BXX G;  4K6D A;  1WVL A;  3X3N A;  3H0G B;  4A3C G;  4GZY C;  1LT4 D;  3A7L A;  4UP9 A;  3CU7 A;  4FXG C;  1G91 A;  1EY4 A;  5ELB A;  1GUG A;  4BXX H;  4WFN 3;  1LM0 A;  1PRT C;  1XYI A;  4J8Q A;  2UU9 Q;  2YU9 B;  2X69 A;  5EGT A;  1K28 A;  1Q1B A;  2FMM A;  4XQJ A;  4JI6 Q;  2Q8R E;  4LF7 L;  2ASB A;  2MO1 A;  2K52 A;  3FKI B;  4CDF C;  2ZXP A;  4KHZ A;  2RVL A;  3CP0 A;  3SHL A;  4DR3 Q;  2PMZ B;  2OTJ A;  2R7Z B;  2N55 A;  2J0T D;  3ZJY C;  5HGT A;  1Q7Y C;  2L9H A;  2O2L D;  1CA5 A;  3R3O A;  1M4V A;  2K7V A;  1IL8 A;  1IXR A;  2D9U A;  5BR8 Q;  3D4D A;  2E2D C;  2L5T A;  3HKZ E;  3BZD B;  2D2C C;  4N8X 1;  4DR4 Q;  5GAH C;  2B2W C;  3FEW X;  4GOP B;  5CV8 A;  4U67 3;  4B3T Q;  1ICF B;  1I4R A;  4PMC A;  1I50 B;  4LFB Q;  3CPW A;  3A5Z B;  1WCM G;  3A8I E;  1ENF A;  3P7J A;  2PCF B;  4R9W A;  1VQK A;  4JV5 L;  2K5D A;  3OPO A;  1MJE A;  1LTG D;  1TS4 A;  4F87 A;  2VQE Q;  1ESF A;  4J15 A;  1RIP A;  1RCV D;  2RHS B;  1X3P A;  3X3M A;  3MEH A;  4KKS A;  1JQY D;  1KXL A;  2A73 B;  3RZO H;  3KUP A;  3SVM A;  3J80 E;  4F7X A;  2NZH A;  5BR8 L;  2ATW A;  4KD3 A;  3EIV A;  1TKW B;  4OEL B;  2Z4H A;  1B4O A;  4HIO A;  4B3T L;  1UWV A;  2LY7 A;  4JI3 Q;  4QJF A;  5EKL A;  3GTQ H;  4A93 H;  3PO3 G;  4XYO A;  3T1Y Q;  4BY1 G;  1GKH A;  3C1E A;  1HJP A;  5COR A;  4EGV A;  5IT9 c;  2JA7 H;  1IBM L;  3HOX H;  4G7H C;  1L0Y B;  3A7A B;  3KBG A;  4C2M B;  2A19 A;  2F0J A;  4RG1 A;  3AMU A;  2EXZ A;  2K03 A;  2AQ1 B;  4RFB A;  1UEB A;  2A69 D;  3KLW A;  3OTO L;  1RTO A;  3AU7 A;  3IL8 A;  4H0L C;  3PIP 3;  1QJO A;  2MNA A;  3MC0 B;  3GTG B;  3FVQ A;  1UEA B;  2XRS D;  4IFD J;  4ILW A;  1NMF A;  5IP7 G;  1KTK A;  4AQY Q;  1CSP A;  2G5D A;  1EQR A;  1EY5 A;  4JW0 A;  4DV3 Q;  4J1M A;  3C1F A;  4LF9 Q;  1E1T A;  5C0X J;  4A3F H;  1YNN C;  2WAC A;  4KKU A;  5C44 B;  1BR9 A;  1EFI D;  2M9V A;  1XXG A;  3VYR A;  1OXU A;  3VA5 A;  1IW7 C;  1A63 A;  4TQU S;  3RLN A;  3FPP A;  3P1H A;  1EY8 A;  3K5L A;  4DV3 L;  1T5X D;  4OWT B;  3ND9 A;  2HIX A;  1PFB A;  4YHH L;  3D8G A;  3R8B A;  1EWC A;  1L0W A;  3RUZ A;  1R4Q B;  1WD1 A;  4XIG S;  1I4G A;  3J81 i;  2A6H C;  3PIO A;  1I6V C;  2F3V A;  3Q8D A;  2Q2T A;  1QNU A;  1Y14 B;  5AFW A;  1MSH A;  2EY6 A;  3NBH A;  2HQL A;  4C3I B;  1G6Z A;  1KQS A;  4MTN A;  4UPA A;  3M85 A;  4DV0 Q;  4MN3 A;  4JBW A;  2Z6B A;  3MEF A;  1HNZ Q;  1KLG D;  3NEM A;  4K2L A;  4MNO A;  4DNT B;  4WRD A;  2PMZ E;  4QCL A;  2EY5 A;  3CCS A;  4RH6 A;  3VR4 A;  1CKM A;  2NTT A;  5JOB A;  2WIN B;  1Q81 C;  5J3B A;  1HNW Q;  1BKB A;  2IX1 A;  5ELD A;  2CKZ B;  2FJ2 A;  4DK3 C;  4IN3 A;  1GUT A;  1O80 A;  2EQS A;  3J81 L;  4IUT A;  4RWS C;  1YHA A;  1KDC A;  1EQV A;  1OXX K;  2R92 H;  2C35 B;  4A75 A;  1C7Y A;  3S1N B;  4EVO A;  4ZKB B;  2VL6 A;  4DV4 Q;  1GJX A;  1W2B A;  2BE5 D;  2JQO A;  5ELF A;  1AE2 A;  1ENA A;  1DD2 A;  1JC7 A;  4ULL A;  1QB5 D;  2MPM A;  3HOX G;  3PUX A;  1D5X C;  4FXK C;  2QCP X;  4TRD A;  1F9S A;  4DU9 A;  4RA8 A;  4FP5 D;  4IZ8 A;  5H1S E;  1XNQ L;  1I50 H;  4DR4 L;  3LNN A;  2XRQ D;  3I91 A;  3HOU H;  1YNN D;  2OF1 A;  2JE6 I;  2I5H A;  1LTB D;  3CXC A;  3T53 B;  4HMJ A;  4IPD A;  2EYL A;  3UI2 A;  2D62 A;  2ES2 A;  5ELN A;  3DWQ A;  3NP8 A;  3QR8 A;  1BXT A;  1F2M A;  4EQN A;  2EJG C;  4A76 A;  1CA6 A;  1HUN A;  3V2T A;  4MTK A;  1SNM A;  4BBR H;  3M4Y A;  3A74 A;  2BDN A;  2HCI A;  4A3D B;  3F2B A;  4DN4 M;  1SE8 A;  4IPG A;  2EDG A;  3HOW B;  1WD0 A;  3BDO A;  4GLA C;  5I9O A;  3NEN A;  3KJP A;  3U9S A;  2I5L X;  3HOZ B;  4NDX A;  1KD1 C;  3HEJ A;  1N34 L;  3S15 H;  1ICW A;  4DPG A;  4XYQ A;  2Z1C A;  1EIG A;  5IGF A;  4ZUI A;  1V1O A;  2HQE A;  5EPK A;  1T5E A;  5A2Q L;  4DV2 Q;  1CKN B;  2Z8L A;  1ZEQ X;  2H1E A;  2A5H A;  2PW7 A;  2XWB B;  4JYA L;  1LTI D;  1VQA A;  4UP8 A;  1BOS A;  2EYM A;  2VB3 X;  4LF6 Q;  1Q46 A;  3H91 A;  4A3J G;  2F0V A;  4JI5 Q;  1EZ8 A;  2IL8 A;  1KAB A;  3DEO A;  1Z7T A;  3LX0 A;  3CCV A;  4CKC A;  1U4L A;  1M90 C;  4FF3 A;  1JWS D;  2M00 A;  1WTR A;  4RAU C;  5KEE A;  1IKM A;  5E4X A;  3S1M H;  3SK6 A;  5HGQ A;  3OHX C;  1A15 A;  2B2Y C;  2WB1 E;  4LFC Q;  1WOC A;  2KCT A;  2R7Z G;  1A3U A;  3M4O B;  3QO2 A;  3UDF A;  1GHJ A;  5IGC A;  1B9N A;  2SDF A;  1YJ9 A;  1SE4 A;  2AQ3 B;  1PH1 A;  1EWH A;  1XMQ Q;  3LWU A;  1K83 H;  1YNJ D;  3AB9 A;  1SMX A;  2B63 H;  3URY A;  1PVO A;  4BBS B;  4A3D G;  2G9H D;  3VYS A;  3CD6 A;  4FYD A;  1YEZ A;  3BZC A;  5GAG C;  3RZO B;  4A3G G;  5HY6 A;  1A2T A;  4PZ7 A;  3Q0A A;  3S2D H;  3TDQ A;  1B50 A;  3T1H L;  5A2Q E;  1FR3 A;  3I56 A;  3N6R A;  4KKT A;  5M3M B;  1VQC A;  2UUA L;  4IO9 A;  1K83 B;  2MQH A;  5CMD A;  1JE4 A;  1IL2 A;  5IT9 L;  4EX5 A;  5C0X H;  3S1R H;  2B8F A;  1ML0 D;  2JXM B;  3HOY B;  2KCC A;  3KJO A;  4A3L G;  3VR5 A;  1HTL D;  1TWF B;  3H0G H;  1PV4 A;  1B53 A;  1MBY A;  2H4O A;  2YTY A;  1DZ1 A;  1SNC A;  4IFD H;  1CK1 A;  3F1Z A;  1K3B C;  5JVH 3;  5KND A;  4QY7 A;  4AYB G;  4IFD I;  2KHJ A;  2B63 G;  1V1P B;  1UE6 A;  3T16 A;  3KOJ A;  4CDD C;  2DJG C;  4OXP A;  3PF4 A;  2KCM A;  2KUM A;  2WP8 J;  2JP1 A;  1O7I A;  1XMO L;  5K36 G;  1NUC A;  4XQN A;  3D6C A;  1Q3L A;  1ASZ A;  4OIJ A;  1IZ6 A;  1J6Q A;  4DV6 Q;  2JA5 H;  1SYF A;  5DNF A;  4FNF A;  3HKZ B;  2YTV A;  4HTH A;  5TSS A;  4V19 0;  2Q8I B;  3I4L A;  1P8L A;  4IPC A;  2MO0 A;  4LMQ D;  4IAL A;  2BCO A;  4GNX A;  3NTI A;  2L11 A;  5JVG 3;  4A3B B;  2A69 C;  3CCL A;  1XX8 A;  4CDC C;  3BVM A;  3BDC A;  5D65 A;  5FKA C;  1FNW A;  5AJ3 L;  3V05 A;  2EYH A;  4DV4 L;  4JOI C;  2SEB D;  1S4Z A;  1A2U A;  4NB3 A;  2Y0S B;  3MXG A;  4C3J H;  1EY9 A;  3L7Z C;  4L5S A;  2B2T A;  2F03 A;  1EYA A;  3MXU A;  1X54 A;  2F0K A;  5J39 A;  1GHK A;  1BQQ T;  4A3M H;  2WFW A;  4PQX A;  3RLO A;  2Z6K A;  1BO0 A;  4PG3 A;  4DR5 L;  4A3E G;  4ALP A;  1TWG H;  5M5W H;  4KLK A;  2XVS A;  4DR3 L;  5KRU A;  4BWG B;  1RF2 D;  3NEL A;  3TEH B;  2NYZ D;  1KRT A;  4KHP Q;  1UE7 A;  3T56 B;  3MA2 B;  2JA6 G;  1XPR A;  4DUZ L;  4OX9 Q;  4R4T A;  3AFP A;  4LUO A;  3M7N A;  1D8L A;  4KJO A;  1E24 A;  2FHT A;  2Y0S G;  3HGB A;  4RHS A;  3MFG A;  4C3J B;  4X65 Q;  2PNH A;  4IJL A;  3L9A X;  4OEM B;  2ID0 A;  1VQ8 A;  2VB2 X;  1Q8K A;  2IHE A;  4A3E B;  3GTO B;  3O13 A;  3IAY A;  1PDQ A;  5KNC A;  2NN6 I;  2ZM6 L;  3WOF A;  4MHE A;  4Q0F A;  1XNR L;  2HHH L;  3GTJ H;  3RNU A;  4DR5 Q;  1SYD A;  1HZA A;  1JB7 A;  5J1Z A;  3W1B A;  3A5U A;  1K8A C;  4ZUJ A;  3A55 A;  1YNX A;  4BA2 I;  4LUZ A;  2BH8 A;  2UUB Q;  1IBK L;  4GNX B;  3TZD A;  4PMB A;  2ZM6 Q;  3UE0 A;  4KK7 A;  3A0J A;  1V1Q A;  1YHB A;  2JA9 A;  4JI7 L;  1CHQ D;  4N8F A;  2F4V L;  2Q8T A;  4BA1 I;  3Q24 A;  1JWM D;  3ONA B;  1WTV A;  3CF5 A;  1E2V A;  5CV4 A;  1EIF A;  1Q90 A;  1II3 A;  1MGS A;  4L6T B;  1HHV A;  1JOO A;  4P74 A;  2NTS A;  2PW5 A;  3MXP A;  1EOT A;  4A3B G;  3I4M B;  1G51 A;  1RDP D;  2I0Q A;  2DY7 A;  1C8C A;  2HDL A;  3TQY A;  1TU2 B;  1BF4 A;  3CAM A;  1IKL A;  4X3K A;  2NWG A;  1G8Z D;  1HNX Q;  2B3G A;  3W3A A;  4LUV A;  2VUM H;  5JJK A;  2X6G A;  3M3Y B;  3GTM B;  2N88 A;  2NN6 H;  1O7Y A;  3PO2 G;  2N49 A;  4O42 A;  4Y52 H;  2QW7 A;  2RSN A;  1NY4 A;  3W5O A;  1SRO A;  3PQI A;  2F0U A;  1WCM H;  1QE6 A;  2NVX H;  3BJU A;  4DR7 L;  2QDL A;  1EU4 A;  3SE0 A;  3PO2 B;  3CQZ B;  4LJZ C;  5IYD H;  4GLX A;  4TVA B;  1A62 A;  1FNU A;  1HZ9 A;  1MI2 A;  4LF9 L;  2R92 B;  1XTC D;  3SK5 A;  1EUJ A;  1SSO A;  1HQR D;  4ZLT F;  3QWN A;  3I4M G;  3FKI G;  5CR3 A;  1IYU A;  1P16 A;  4Z9C B;  4KHP L;  4XQQ A;  2OT2 A;  1HFG A;  2IWH A;  2GVB A;  2B2W A;  4QQB X;  1EIH A;  1I4H A;  3J81 E;  2RF4 A;  3BYT B;  1X32 A;  3PUY A;  2ICI A;  4L5Q A;  2UXD L;  1CI3 M;  1PTO D;  3NBH B;  2NVX B;  4POF A;  1NCV A;  1RD9 D;  4DA2 A;  4UY8 C;  4DAM A;  2CFM A;  1G2T A;  1SYG A;  3JC6 6;  3J80 i;  2WKD A;  4HJ8 A;  3MXN A;  4OO1 G;  4POG A;  4Y7N H;  2PYK A;  4QB4 A;  1JB3 A;  3V96 A;  5COY A;  4HED A;  3W1G A;  2PO4 A;  3BYY B;  4JI6 L;  2KCN A;  1B44 D;  2PI2 E;  2C9O A;  3S1Q B;  2WB1 G;  3G71 A;  1JE5 A;  3NUC A;  1VMP A;  5IYB H;  4A3K G;  3E0J A;  1PTO B;  4FF1 A;  3PIO 3;  1VQB A;  1NAP A;  1QCB D;  3I2Z A;  3K0Y A;  1SE3 A;  2SNM A;  3ND8 A;  1VS0 A;  3T13 A;  4IPH A;  1GXD C;  5IE8 A;  5GAE C;  4JC0 A;  5FLX E;  1LV9 A;  2KA7 A;  4A3C H;  1VQJ A;  3EA6 A;  5DM6 3;  4IQZ A;  3R2I A;  5JEA H;  2F52 A;  2JK8 A;  1SR3 A;  1K8M A;  1LAB A;  5EKI A;  4L8J A;  2EYJ A;  1QNK A;  2OCE A;  3KF6 A;  2CCZ A;  3GD7 A;  1EEF D;  1TWH H;  1ET9 A;  2DUD A;  4PZ8 A;  3PV0 A;  5C3E B;  5L37 A;  1FL0 A;  1HA5 A;  3T51 B;  2K04 A;  1ASY A;  4X3S A;  4LF8 L;  1EY7 A;  1ZKO A;  3J81 j;  4I65 A;  1OO9 B;  4HCS A;  4BY1 B;  5CV6 A;  1GO3 E;  3GTG H;  3Q6S A;  1B70 B;  1PA6 A;  1OXS C;  3S1N H;  2QKI C;  2JA8 H;  1TS2 A;  3H09 A;  1VDZ A;  5LMU Q;  2J7Z A;  3EFX D;  5I9P A;  1G2S A;  2HHH Q;  3G48 A;  3I7F A;  4K0K Q;  4B9W A;  5A35 A;  1GVP A;  3OOC A;  3MXN B;  1PRT D;  3ERS X;  3I70 A;  1SNO A;  1VQO A;  3BU2 A;  1HUM A;  1E0B A;  1RTN A;  4NW2 A;  4DR6 Q;  1X3Q A;  3D4R A;  2UXB Q;  4DF7 A;  5FLM G;  3UDG A;  1AFP A;  4DR1 Q;  1T9H A;  1DON A;  2WB1 B;  2L4N A;  1OTC A;  1TT2 A;  5T1G A;  2UXC Q;  3NTK A;  4QL5 A;  1YI2 A;  1X3F A;  3VR2 A;  1X3E A;  1Y8O B;  3L2P A;  2RQX A;  5IOD A;  4AYB B;  4H44 C;  5LL6 X;  1GUW A;  1PRT B;  2O4X A;  2WAQ E;  1DGS A;  1XNR Q;  2UUC Q;  4OO1 I;  3KDF B;  1AZP A;  3TRE A;  4GOP A;  3GTJ B;  3IRB A;  1S5B D;  4ME5 A;  5CV7 A;  5M3F G;  3EQL C;  3HOX B;  3HS0 C;  3K81 C;  5C4X B;  2ZJQ A;  1F9P A;  2HIV A;  2OQK A;  1VQ4 A;  3K7A B;  5FK9 C;  3MZ5 A;  2DGY A;  4ID6 A;  1NTG A;  4JI3 L;  3K5N A;  4F8M A;  2R93 G;  3GTK B;  4FF4 A;  3J7Z C;  4HAE A;  4QGU A;  1ENC A;  2UXD Q;  2BA1 A;  2EYF A;  1MIU A;  2LKV A;  4RKB A;  4IOC A;  4DAY A;  2A1A A;  2WAQ B;  2BDO A;  2IT1 A;  2RBM A;  5C44 G;  1HPC A;  4BBS G;  3S17 B;  3DWA A;  2AQ2 B;  5K5P A;  1XMO Q;  3E5S A;  4F88 A;  4LFC L;  1NR4 A;  5BN3 A;  1PH4 A;  5M3F B;  5GAD C;  3SEB A;  4BY7 H;  4PZ6 A;  1AP0 A;  4O2D A;  4KY7 A;  4DGZ A;  1H9J A;  1HZC A;  5D14 A;  3CQZ H;  3J81 c;  1FYC A;  2DNE A;  4NP5 A;  2ZJP A;  4K2K A;  4DUZ Q;  5DEH A;  4OX9 L;  5JEA G;  2BH2 A;  2V4D A;  1VQM A;  4LAA A;  3F2C A;  2CWA A;  4X66 L;  2WV6 D;  5JAV A;  4DFA A;  4Y7N B;  3SK4 A;  2M2L A;  5M5Y B;  2NZ1 D;  1PTO C;  2RCF A;  2RKS A;  4JI8 L;  2OEO A;  4QUF A;  2JEA I;  3FKI H;  1CM9 A;  4TSS A;  3I4M H;  1BBW A;  2PQA B;  4A3G B;  4H13 C;  3EVQ A;  5BN4 A;  4G7O C;  1Y8P B;  4KY5 A;  3DHQ A;  3DM3 A;  3D4W A;  2K33 A;  3ULJ A;  5M9O A;  3HOU B;  1STN A;  1K0S A;  1SJH D;  4L63 B;  1SYE A;  5DM7 3;  3CMA A;  1HFN A;  3HOW G;  3I4N H;  1BBX C;  1YIT A;  2JYO A;  1D7Q A;  3JAM E;  3CCR A;  1OXV A;  2KEN A;  4X3U A;  3M4O H;  5GQO A;  4GNX C;  1I94 Q;  1PYS B;  4ME3 A;  3A8K E;  2MJ8 A;  3N52 A;  4OO1 H;  2F4I A;  5IGG A;  4B3M Q;  4GKK L;  1EQT A;  1LTT D;  3I4O A;  1ILQ A;  1F2L A;  4KY6 A;  1S72 A;  4UP7 A;  1J9O A;  3J7Y W;  3SDZ A;  3KF8 B;  1KIX A;  4A4I A;  3PUZ A;  2FFK B;  1WTX A;  3C46 A;  3K58 A;  1CZW A;  3M9B A;  4K5V A;  4R1J A;  5FLX L;  2B2V C;  2FIN B;  2NVY H;  5HUR A;  1Q12 A;  1U4R A;  2RCN A;  5CV5 A;  4YWM A;  2L0C A;  1NBW A;  1MD2 D;  5BN5 A;  2QIL A;  3U4Z A;  3GTL B;  2YTX A;  1DXM A;  2VQF L;  2PZT A;  3CC2 A;  1N9W A;  2PQA A;  4NMZ A;  2NZO A;  3W2D A;  4RMF A;  5KYL A;  5IYD G;  4DAP A;  2VZA A;  2MHV A;  5FOB B;  1H9S B;  5J22 A;  1ONL A;  3LGJ A;  1YHQ A;  3S16 B;  3GV3 A;  1ET6 A;  4LF7 Q;  3P75 A;  1MJC A;  4QIW B;  3QOL A;  1U0L A;  5IGD A;  1QUQ B;  4XT1 B;  2VXW A;  4LNQ A;  4NXM Q;  3PO2 H;  4BY7 G;  4DK1 A;  2R92 G;  2MUY A;  4AH6 A;  2UUC L;  1JIC A;  3OW7 A;  1AEX A;  1TXY A;  3CHB D;  4B3R L;  3TN2 A;  1CUK A;  5JPN C;  3K7U C;  1KNA A;  1YBY A;  4P71 A;  1W3S A;  4CGY B;  3C3L A;  2VQE L;  2ALY B;  1CFM A;  1YZ6 A;  5JEA J;  1Z6H A;  1PFM A;  5C6A A;  2WAQ G;  3OIP A;  3CC4 A;  3NQI A;  5C4J B;  4DR1 L;  3CRL C;  5AJ3 Q;  4JK1 C;  1BVS A;  3I8Z A;  3D0F A;  1SN8 A;  3FP9 A;  4CJ0 B;  4LFB L;  4DK6 C;  3TP6 A;  4BY7 B;  2F0D A;  2F0G A;  1PFS A;  2KBN A;  3H6M A;  4NPS A;  1F9R A;  1X6O A;  2D0P A;  1A0I A;  4HSP A;  2A68 C;  1SNP A;  1SYC A;  1JOQ A;  2B63 B;  3D31 A;  3UDI A;  1U5K A;  2WII B;  4JI2 Q;  5LL6 S;  5C3E H;  2N3S A;  1CSQ A;  4DV6 L;  1Y1V G;  2B8G A;  3IKJ A;  3RLF A;  3MHB A;  2QF7 A;  3MVV A;  1GM5 A;  3GTK H;  1XTD A;  1KNE A;  3EBE A;  2CW0 C;  4HSV A;  4RKL A;  3KLS A;  1B7Y B;  2FXQ A;  2K5W A;  2XGT A;  5FLX c;  1VQ9 A;  4QF4 A;  3BG3 A;  3R93 A;  4IOA A;  3HOW H;  3I4N G;  1F2Y A;  1FD7 D;  1TWF H;  1Y1W H;  5IWA L;  4C2M H;  1I6H H;  3VYT A;  3HOV G;  1JJ2 A;  4JI0 Q;  4OON A;  1NR2 A;  4RCO A;  4RGM A;  1BBU A;  2KEE A;  4DV7 Q;  1K0R A;  1QUQ A;  3RZD H;  4AQY L;  1V8Q A;  3ITP A;  4ZK9 B;  2P5Z X;  3M3Y H;  4A3I G;  1Q82 C;  2JA6 H;  1PFN A;  2Q2U A;  3E6Z X;  1TII D;  3A56 A;  4A3D H;  4YWK A;  3H94 A;  4UHV A;  1PMR A;  3NPP A;  5E7N A;  1AE3 A;  4U68 A;  1DM0 B;  3KFU A;  1N34 Q;  3S2D B;  2CWP A;  4A3M G;  3J80 c;  4ZCK A;  5C4X G;  3MTS A;  5M3M H;  4N9P A;  3HOZ H;  3SGI A;  4LF5 Q;  4R8I A;  4DUY Q;  3DLL A;  1HNZ L;  1WTO A;  1B9M A;  2OQ0 A;  2IJ0 A;  5IT9 E;  4DV0 L;  3DWP A;  1NE3 A;  4K5W A;  3H0G G;  2E8G A;  1LT6 D;  2F0T A;  1EYD A;  2JA8 B;  5D3I B;  1ZYR C;  1LAC A;  5EKK A;  2AMC B;  5JJZ A;  5G3L D;  1J5E Q;  1K9M C;  2K5N A;  4IUN A;  3G4S A;  1GOZ A;  4K6L A;  2PNR C;  1TQO A;  2EJM A;  2PQE A;  3B6Y A;  1WCM B;  3CCU A;  5ELC A;  4OWX B;  3SR1 A;  1PLF A;  1A3T A;  1BCP D;  1I4P A;  3STB C;  3FPU B;  2JA5 G;  3NWT A;  1TY0 A;  4YY3 L;  2R93 H;  4HIK A;  5GRO A;  2VNU D;  4DR6 L;  2VUM B;  5LHY 1;  2ZT9 C;  1PTO F;  2AUK A;  4WJ4 A;  2NUC A;  2GA4 B;  1SLJ A;  1D6E C;  3AYH B;  3CKI B;  4C1N K;  3J7A V;  2EYO A;  4NXM L;  1QVC A;  1N8R C;  3RN2 A;  4LF6 L;  2UXC L;  4L5T A;  4K0K L;  2VW9 A;  3GDE A;  2AHO B;  3BS1 A;  1PH9 A;  1X9N A;  5M3F H;  4JBK A;  2JA8 G;  3NXW A;  4HJ7 A;  2CVR A;  1SFO H;  1H9M A;  1JWU D;  3I72 A;  1RL2 A;  1WFQ A;  3PIP A;  1BCP B;  4R4O A;  2UXB L;  1YJW A;  1B3A A;  5C0X G;  5JPM C;  1H95 A;  4GN5 A;  1VQ5 A;  2A6H D;  1VQE A;  2AKW B;  4AIM A;  1GUO A;  5I4D A;  3QIA A;  3JAM L;  2V1C C;  2DY8 A;  3VA7 A;  3HP3 A;  1ESR A;  2F0O A;  1AH9 A;  2UUB L;  4FF2 A;  1D1K A;  4FVM A;  3RD4 A;  1LT5 D;  3GP7 A;  5EQ0 A;  4JG2 A;  2CQA A;  4R4C A;  3FRP B;  3PGZ A;  3E3X A;  4A3G H;  1F2Z A;  1K8O A;  1TVX A;  3ULP A;  2JEB I;  5LMU L;  3NSW A;  4JI1 L;  2XWJ B;  2L12 A;  4DR2 L;  1J5E L;  1EZ6 A;  3F2D A;  2EE1 A;  5EPJ A;  2NN6 G;  4XT3 B;  1TWH B;  5C3W A;  2EPB A;  1PZI D;  3KBX A;  1VCI A;  1WTQ A;  3GTP H;  1VQH A;  2R7Z H;  2E2I H;  2VUM G;  5NUC A;  2KHS A;  2BOS A;  2PI2 A;  1E3P A;  1JJC B;  3OYY A;  1K3R A;  4EQ5 A;  3HFZ B;  4DNR B;  3ER0 A;  1TR5 A;  4HJ5 A;  4JOI A;  1DOM A;  2DNC A;  2OWO A;  2F3I A;  2E5L Q;  2EXD A;  1Y1W G;  4FXD A;  4A3J H;  3LWE A;  2E5L L;  1VF7 A;  1Y1V B;  4JBJ A;  4O1N A;  3TSS A;  4X3T A;  2F0F A;  1I4X A;  2ZXR A;  2B39 A;  5CBA E;  4B3S L;  5F2D A;  2JA7 B;  2A8V A;  3PCO B;  3PF5 A;  2K14 A;  4K14 A;  1IBL L;  1B2T A;  3I73 A;  1SDF A;  2Z9H A;  1E22 A;  4YIJ A;  5M3M G;  3EJI A;  2HD3 A;  5C3E G;  1M1K C;  1PYW D;  1L1O C;  1H9S A;  5IYB G;  4A3K H;  1R9T B;  1L1O A;  1LTS D;  2TSS A;  4OL7 A;  4DV5 L;  1N33 Q;  1KL9 A;  1TWA H;  3K5M A;  4FO2 A;  2XN9 C;  1IBM Q;  4QUC A;  2E2I B;  2JJQ A;  4JPB W;  1STA A;  3I55 A;  4C3H G;  1XPU A;  1Q86 C;  2K75 A;  2F0Q A;  4A3I H;  2KOL A;  4RGT A;  5EJW A;  3KF8 A;  1YNJ C;  2UU9 L;  1O78 A;  1DCZ A;  2E74 C;  1SYB A;  4JI2 L;  4C3H B;  4NXN Q;  1KDA A;  5C4H A;  2XNA C;  2PZW A;  4CKE A;  4ZRZ A;  2Z4I A;  1QWY A;  3K7A H;  5EBD A;  1NNX A;  1WYD A;  3DUZ A;  2KED A;  3Q22 A;  1YJN A;  3U50 C;  1BCP C;  2I5M X;  1HZB A;  1EFW A;  4DR7 Q;  4HID A;  1H9R A;  2E2H B;  1K8G A;  2D5D A;  5LMN Q;  1OXT A;  3HOU G;  4OHJ A;  1TWC B;  1RKN A;  2I46 A;  5ELE A;  3VR6 A;  2TMP A;  4R4I A;  4A3E H;  1EU3 A;  2F0P A;  4LFA L;  3OMG A;  1QOH A;  2K1B A;  4HN7 A;  3S14 H;  2QA4 A;  3K0X A;  1PZJ D;  1STB A;  3K57 A;  3CW2 C;  3SK8 A;  2PZU A;  1XWE A;  3TZU A;  4JI7 Q;  2X6L A;  4YCU A;  4XXE A;  4V0B A;  1C4Q A;  4HCE A;  4RHR A;  3I3C A;  4JI4 L;  4LF4 L;  1D1I A;  1EOV A;  2JA7 G;  1U4M A;  1XPO A;  2KQ3 A;  3E9I A;  2R7D A;  1Y69 U;  1E2Z A;  1ROD A;  1JT8 A;  1BUV T;  1HXY D;  5DLQ E;  4AYB E;  4DXG A;  1SXT A;  2VQF Q;  1Y1W B;  2IY5 B;  1O7Z A;  4X6A H;  1CQV A;  3I90 A;  5ISR A;  1STY A;  1S40 A;  1AZQ A;  3KYH C;  2ZTC A;  1SMY C;  1Q8I A;  1SE2 A;  3T4A C;  4GLV B;  2B2U A;  3CCQ A;  1HR0 Q;  2F0N A;  3OMC A;  2MGS A;  5C5L A;  3AQQ A;  2WKC A;  3J7A F;  1IYJ B;  1VQI A;  4P75 A;  3QB3 A;  2L15 A;  2G9D A;  3S14 B;  1CZG A;  3NTH A;  1D5Z C;  2NVT H;  4JCV E;  5JJI A;  1S5E D;  3J80 L;  4C1N I;  1KAW A;  4A3F B;  4DAY B;  4B08 A;  2F0L A;  4DV2 L;  3D6W A;  1VQD A;  4OWW B;  1JJG A;  2L1B A;  1PH5 A;  2JN4 A;  4B3M L;  2K5V A;  2B2Y A;  3TP7 A;  4YY3 Q;  1VQN A;  3WWV A;  1HCZ A;  3E0E A;  1E2W A;  1RJT A;  4KV6 A;  2F0E A;  1NMG A;  3JAM i;  4LK1 C;  5LMN L;  1JMC A;  1WTP A;  1Z9F A;  4KHV A;  1XJV A;  2NVQ B;  3K8A A;  2A74 C;  1SBB B;  3PO3 H;  2B2U C;  2K01 A;  5EBC A;  5C4Z A;  3FMC A;  2IHF A;  1STH A;  1Z47 A;  1STE A;  4HMI A;  4GKJ Q;  2KHI A;  1QIL A;  2B29 A;  5C0X I;  5KYI A;  3M4Q A;  3U58 A;  4CDE C;  3GTQ B;  4HIM A;  1VQF A;  3NK9 A;  2I07 B;  5K36 H;  2F0I A;  3MWY W;  3OWF A;  2EVB A;  1TS5 A;  1HR0 W;  3E9H A;  1EY6 A;  3BDL A;  4IUU A;  5IWA Q;  5M5X H;  3CRK C;  3NBI A;  3ULL A;  3GO5 A;  1PH8 A;  1JOK A;  2OTL A;  3RMH A;  2KEC A;  1BCP F;  3S17 H;  2B2V A;  1W6J A;  1U9R A;  2AWO A;  2SNS A;  1HRJ A;  1I3Q H;  1JOR A;  3PUV A;  3CCJ A;  3CCM A;  3FDT A;  4A3L H;  4DXF A;  4BY1 H;  2QEX A;  2CH4 W;  4A93 G;  1YVC A;  4H02 A;  1FNV A;  2CH4 A;  5KIX A;  1TY2 A;  2F1M A;  1WI5 A;  1TWA B;  4KJN A;  1DOK A;  4A93 B;  3KLR A;  1I4Q A;  1JR0 D;  4UAI A;  4KI0 A;  1X3G A;  1D2B A;  4C56 C;  5IGB A;  1EL0 A;  2UUA Q;  1SRU A;  1CT1 D;  1B1Z A;  4X64 L;  2BA0 A;  4YCW A;  5EPL A;  5FO8 B;  1LTA D;  4B3R Q;  2RSO A;  3R2T A;  3BZK A;  4C3H H;  5C44 H;  3HKZ G;  2AUJ D;  3PMF A;  5CBE E;  4JI4 Q;  4LF4 Q;  3F2U A;  2RDF A;  1Q1E A;  3TS0 A;  4DV1 Q;  1SNQ A;  4DV1 L;  3H3V H;  4DV7 L;  1EYG A;  2K6A A;  4APV A;  4EQO A;  3S1Q H;  1IYV A;  3TS2 A;  2CW0 D;  2RA4 A;  4I7Z C;  1PH2 A;  3CCE A;  4PNY A;  4KN4 C;  4S3S A;  1C48 A;  2ICE C;  1LT3 D;  4HR7 B;  3ZYY X;  2NBF A;  5IIF A;  3PO3 B;  1HNX L;  4IJH A;  3TME A;  4GOP C;  4XDX A;  4RGO S;  1HR0 L;  2EOT A;  2YU9 H;  4X64 Q;  1H9K A;  1KC8 C;  2B2T C;  2LSS A;  3S15 B;  2R61 A;  3UDX A;  5KNB A;  3S16 H;  1GUN A;  3NQT A;  3KK7 A;  5CV9 A;  5CYU A;  1BNZ A;  3HOV B;  1YIJ A;  4HJ9 A;  2A6E D;  2KVM A;  4LWC A;  1E7Z A;  4LW1 A;  4JBM A;  2C5C A;  2HDM A;  4GKK Q;  4I7A A;  1LLR D;  2QEJ C;  2IX3 A;  1KHI A;  4JYA Q;  2K32 A;  4JVZ A;  3U4V A;  2NB0 A;  2EYP A;  4MIU A;  3TRZ A;  3VDY A;  3IFD A;  1L2F A;  4DNI A;  2EZV A;  1HA6 A;  4TKO B;  5C4X H;  5LMN W;  4H7B A;  5C4J H;  2BE5 C;  4JI5 L;  2Q2I A;  1PH7 A;  3GTO H;  1EYC A;  1S5C D;  1KAA A;  1WTH A;  4LF8 Q;  1B3Q A;  3I4N B;  5JJL A;  1EIY B;  3A8J E;  2H5X A;  4OIK A;  4L5R C;  4JV5 Q;  4X65 L;  4KN7 C;  1NSN S;  2F0M A;  1FVI A;  4IUP A;  3T1Y L;  2Y0S E;  4X66 Q;  1UAP A;  4NKL A;  3OTO Q;  3KDF A;  3BVZ A;  3D3R A;  3M7G A;  3TP5 A;  1F77 A;  2IW3 A;  5CC4 A;  1LYL A;  1N36 L;  3QJY A;  1VQG A;  2VS1 A;  4ABN A;  3RN5 A;  1X55 A;  2ZTE A;  3HRZ C;  2K05 A;  4ODG A;  1XNQ Q;  4C3I G;  4WOR A;  3TBI B;  3GTL H;  3C2P A;  1A3V A;  1MSG A;  1V43 A;  5C5M A;  1Y1V H;  3CPF A;  3K6O A;  2J4X A;  4KTA A;  4EQP A;  3S2H H;  5E1F A;  1WJJ A;  5FO7 B;  4ZKC B;  2Z6K C;  1SAP A;  4GN3 B;  3TP8 A;  4CJ2 C;  3S24 A;  4JI8 Q;  4P72 A;  5IP9 G;  1IW7 D;  4B3S Q;  3DXJ C;  3QOJ A;  5I6W A;  3NWS A;  3HZX A;  3GTP B;  4X62 Q;  2LMC B;  1KRS A;  2R6G A;  5E4W C;  1FGU A;  2K28 A;  4BBR G;  4G57 A;  2RDG A;  4WJW A;  3HOV H;  3OIQ A;  3PUW A;  1I5F A;  1F9Q A;  4LF5 L;  5EAY A;  1GD7 A;  4FDB A;  3U9O A;  2N78 A;  3K5O A;  1V9P A;  5FJ8 G;  2K4K A;  1EQQ A;  1KLU D;  4RCN A;  3G6E A;  4M1U B;  4Q5V A;  3OW2 A;  1QZG A;  3NE5 B;  1TS3 A;  4IUR A;  2NVT B;  1HH2 P;  2ZXO A;  1FJG L;  2ZTD A;  1SMY D;  3KF6 B;  2A68 D;  1QVG A;  4IUV A;  1UUP A;  2YV5 A;  5I2X A;  2E2J H;  5M5X B;  3K59 A;  2F0W A;  1VMC A;  2YYZ A;  3WOE A;  3S2H B;  4E6I A;  5I2Y A;  3L0O A;  2F0H A;  2MFI A;  4R4Q A;  3DEP A;  4DKA C;  3K80 C;  3G7L A;  4X62 L;  3HOY H;  4KMU C;  1KDB A;  1TWC H;  1JCK B;  3S1R B;  1BDO A;  2R3Z A;  1ZXT A;  2HCC A;  1G29 1;  1MKH A;  3BVG A;  3DMU A;  4BBR B;  1A8V A;  1VF5 C;  1HQM C;  2RDH A;  1K73 C;  2IPK D;  4P73 A;  2L55 A;  2MP1 A;  1CTM A;  5IYC H;  1HNW L;  1X65 A;  3P20 A;  3QG1 A;  4RGN A;  4QMG A;  2F3W A;  3ERO A;  1EY0 A;  1VQL A;  2Q2H A;  4NXN L;  3UE1 A;  1HTP A;  1CKO A;  3MFY A;  1U4P A;  5IY0 A;  3RZD B;  4PMW A;  3A54 A;  4OGQ C;  2JA5 B;  5FJ8 H;  2XSC A;  5IP7 H;  4GKJ L;  2LS0 1;  5KGU A;  1CQF A;  2E2J B;  3F8T A;  4P2C B;  2R7F A;  4YHH Q;  1UE5 A;  1Y8N B;  1I94 L;  1DJR D;  3AEV A;  4A3K B;  4K8J A;  1S3O A;  4DUY L;  2XTI A;  1PH3 A;  1XMQ L;  4K5X A;  2E2H H;  3WDN A;  4A3B H;  4DV5 Q;  1PYB A;  2Z0S A;  3NHH A;  2QDB A;  4CJ1 B;  3M4P A;  4YCV A;  2F0S A;  2ZJR A;  1C0A A;  5IP9 H;  1E1O A;  2F4V Q;  1QVF A;  4UDU C;  5G3L F;  3SXH A;  5FO9 B;  1EWI A;  3JAM c;  1V1P A;  5E3F A;  1LTR D;  1G6P A;  1CHP D;  3G6J B;  1L0X B;  1SEB D;  1LO5 D;  2OXP A;  4CBV A;  1S5F D;  4DAV A;  5ELO A;  3GQB A;  2JSO A;  2LFN A;  5T1I A;  5IOC A;  2GN5 A;  2EIF A;  3MAQ A;  1VQ7 A;  1I6H B;  4PV1 C;  2DJF C;  1X56 A;  1SFO B;  4IUQ A;  4A3F G;  2PPB C;  4R8N A;  1TWG B;  5M5W B;  2QGQ A;  2EJF C;  3DM1 A;  1RHP A;  4B9X A;  1M8A A;  1PXU A;  1SND A;  2K5Q A;  1W6K A;  4LFA Q;  1A6X A;  3ERQ A;  1N33 L;  2R93 B;  2EY1 A;  1EEI D;  2AWN A;  2XIW A;  4XTC S;  2HUG A;  3HKS A;  1J8I A;  4QIW E;  4BBS H;  3EN2 A;  2N8N A;  4YWL A;  1VQP A;  2GVA A;  5I6Y A;  2LXJ A;  4G7Z C;  3S9W A;  3KLS X;  4BS9 A;  4ZQ3 A;  1WTW A;  2K5H A;  3FHW A;  4GN4 B;  1UE1 A;  4A3J B;  2K50 A;  5IYC G;  2DN8 A;  3PSI A;  5D3D A;  4DK0 A;  1N32 Q;  2KJX A;  1ILP A;  4GS3 A;  2EY2 A;  1FGB D;  3RR5 A;  4O0A A;  1R4P B;  4G4K A;  3HOY G;  2D0O A;  4HJA A;  1N32 L;  2FMC A;  4ZAI A;  5IGE A;  3VYU A;  3L3O C;  4IFD G;  2RHQ B;  3IFT A;  1NJI C;  4M8A A;  1FJG Q;  2ENB A;  3ICE A;  4N9T A;  2NVY B;  1AW7 A;  1LUZ A;  1I3Q B;  4KD4 A;  4DR2 Q;  4ZYS A;  3J7A 5;  2HT1 A;  1QG7 A; 
#chains in the Genus database with same CATH homology
 2E75 C;  1PTO H;  3S1M B;  3VR3 A;  3OWE B;  1O7L A;  1DYQ A;  2CHB D;  5CGK A;  4CHT B;  4K8I A;  1S5D D;  1PZK D;  2O5J C;  1GUS A;  4A3I B;  2E76 C;  2O5I C;  4C3J G;  1STG A;  4A3M B;  3H3V C;  2A6E C;  2IX0 A;  4J6H A;  2SOB A;  2JA6 B;  1D5M C;  4CKB A;  3Q23 A;  1SJE D;  1ZYR D;  1IHZ A;  1DOL A;  3OSO A;  1PRT F;  3GV6 A;  5C3X A;  5DAU A;  1AN8 A;  3HG9 A;  1UNS A;  4K6D A;  1WVL A;  3X3N A;  3H0G B;  4GZY C;  1LT4 D;  3A7L A;  3CU7 A;  4FXG C;  1G91 A;  1EY4 A;  5ELB A;  1GUG A;  4WFN 3;  1PRT C;  1XYI A;  4J8Q A;  2YU9 B;  2X69 A;  5EGT A;  1Q1B A;  2FMM A;  4XQJ A;  2Q8R E;  3FKI B;  2ZXP A;  4KHZ A;  2RVL A;  3SHL A;  2PMZ B;  2R7Z B;  2N55 A;  2J0T D;  5HGT A;  2L9H A;  2O2L D;  1CA5 A;  3R3O A;  1M4V A;  2K7V A;  1IL8 A;  2D9U A;  3D4D A;  2E2D C;  2L5T A;  3BZD B;  2D2C C;  2B2W C;  3FEW X;  5CV8 A;  4U67 3;  1I4R A;  4PMC A;  1I50 B;  3A8I E;  1ENF A;  3P7J A;  2PCF B;  4R9W A;  2K5D A;  3OPO A;  1LTG D;  1TS4 A;  4F87 A;  1ESF A;  1RCV D;  1X3P A;  3X3M A;  3MEH A;  4KKS A;  1JQY D;  2A73 B;  3KUP A;  3SVM A;  3J80 E;  4F7X A;  4KD3 A;  1TKW B;  2Z4H A;  1B4O A;  2LY7 A;  5EKL A;  4XYO A;  3C1E A;  5COR A;  4EGV A;  4G7H C;  1L0Y B;  3A7A B;  3KBG A;  4C2M B;  2F0J A;  3AMU A;  2EXZ A;  2K03 A;  2AQ1 B;  4RFB A;  2A69 D;  1RTO A;  3AU7 A;  3IL8 A;  4H0L C;  3PIP 3;  1QJO A;  3MC0 B;  3GTG B;  3FVQ A;  1UEA B;  2XRS D;  4IFD J;  4ILW A;  1KTK A;  1EY5 A;  4J1M A;  3C1F A;  5C0X J;  1YNN C;  2WAC A;  4KKU A;  5C44 B;  1BR9 A;  1EFI D;  2M9V A;  1XXG A;  3VYR A;  1OXU A;  3VA5 A;  1IW7 C;  4TQU S;  3FPP A;  3P1H A;  1EY8 A;  3K5L A;  1T5X D;  3ND9 A;  1PFB A;  3D8G A;  3R8B A;  1EWC A;  3RUZ A;  1R4Q B;  1WD1 A;  4XIG S;  1I4G A;  2A6H C;  1I6V C;  2F3V A;  1QNU A;  5AFW A;  1MSH A;  2EY6 A;  3NBH A;  4C3I B;  1G6Z A;  3M85 A;  4MN3 A;  4JBW A;  1KLG D;  4K2L A;  4DNT B;  4WRD A;  4QCL A;  2EY5 A;  4RH6 A;  3VR4 A;  2NTT A;  5JOB A;  2WIN B;  2IX1 A;  5ELD A;  2FJ2 A;  4IN3 A;  1GUT A;  1O80 A;  3J81 L;  4IUT A;  4RWS C;  1KDC A;  1EQV A;  1OXX K;  3S1N B;  4EVO A;  4ZKB B;  1GJX A;  2BE5 D;  5ELF A;  1ENA A;  1DD2 A;  1JC7 A;  4ULL A;  1QB5 D;  2MPM A;  3PUX A;  1D5X C;  4FXK C;  2QCP X;  4TRD A;  1F9S A;  4DU9 A;  4RA8 A;  4FP5 D;  4IZ8 A;  3LNN A;  2XRQ D;  3I91 A;  1YNN D;  2OF1 A;  2JE6 I;  1LTB D;  3T53 B;  4HMJ A;  2EYL A;  3UI2 A;  2D62 A;  3DWQ A;  3NP8 A;  1BXT A;  1F2M A;  4EQN A;  2EJG C;  1CA6 A;  1HUN A;  3V2T A;  1SNM A;  3M4Y A;  2BDN A;  2HCI A;  4A3D B;  4DN4 M;  2EDG A;  3HOW B;  1WD0 A;  3BDO A;  5I9O A;  3U9S A;  3HOZ B;  4NDX A;  3HEJ A;  1ICW A;  4XYQ A;  2Z1C A;  1EIG A;  5IGF A;  4ZUI A;  1V1O A;  2HQE A;  5EPK A;  1T5E A;  5A2Q L;  2Z8L A;  1ZEQ X;  2H1E A;  2A5H A;  2PW7 A;  2XWB B;  1LTI D;  1BOS A;  2EYM A;  2VB3 X;  3H91 A;  2F0V A;  1EZ8 A;  2IL8 A;  1KAB A;  3DEO A;  1Z7T A;  3LX0 A;  4CKC A;  1U4L A;  4FF3 A;  1JWS D;  2M00 A;  1WTR A;  4RAU C;  5KEE A;  1IKM A;  5E4X A;  3SK6 A;  3OHX C;  1A15 A;  2B2Y C;  1A3U A;  3M4O B;  3QO2 A;  1GHJ A;  5IGC A;  1B9N A;  2SDF A;  1SE4 A;  2AQ3 B;  1EWH A;  3LWU A;  1YNJ D;  3AB9 A;  3URY A;  4BBS B;  2G9H D;  3VYS A;  4FYD A;  3RZO B;  1A2T A;  3Q0A A;  3TDQ A;  1B50 A;  5A2Q E;  1FR3 A;  3N6R A;  4KKT A;  5M3M B;  1K83 B;  5CMD A;  1JE4 A;  5IT9 L;  5C0X H;  2B8F A;  1ML0 D;  2JXM B;  3HOY B;  2KCC A;  3VR5 A;  1HTL D;  1TWF B;  1B53 A;  1MBY A;  2H4O A;  1DZ1 A;  1SNC A;  4IFD H;  1CK1 A;  5JVH 3;  5KND A;  4IFD I;  1V1P B;  3T16 A;  2KUM A;  2WP8 J;  2JP1 A;  5K36 G;  1NUC A;  4XQN A;  3D6C A;  1Q3L A;  4OIJ A;  1SYF A;  5DNF A;  4FNF A;  3HKZ B;  4HTH A;  5TSS A;  4V19 0;  2Q8I B;  3I4L A;  4LMQ D;  4IAL A;  2BCO A;  3NTI A;  2L11 A;  5JVG 3;  4A3B B;  2A69 C;  1XX8 A;  3BVM A;  3BDC A;  5D65 A;  5FKA C;  1FNW A;  3V05 A;  2EYH A;  2SEB D;  1S4Z A;  1A2U A;  2Y0S B;  3MXG A;  1EY9 A;  3L7Z C;  2B2T A;  2F03 A;  1EYA A;  3MXU A;  5J39 A;  2F0K A;  1GHK A;  1BQQ T;  4PQX A;  1BO0 A;  2XVS A;  5KRU A;  4BWG B;  1RF2 D;  2NYZ D;  3T56 B;  3MA2 B;  3M7N A;  4KJO A;  2FHT A;  3HGB A;  4RHS A;  3MFG A;  4C3J B;  3L9A X;  2ID0 A;  2VB2 X;  4A3E B;  3GTO B;  3O13 A;  3IAY A;  1PDQ A;  5KNC A;  2NN6 I;  3WOF A;  4MHE A;  4Q0F A;  1SYD A;  5J1Z A;  4ZUJ A;  3A55 A;  4BA2 I;  3TZD A;  4PMB A;  4KK7 A;  1CHQ D;  2Q8T A;  4BA1 I;  3Q24 A;  1JWM D;  3ONA B;  1WTV A;  1E2V A;  5CV4 A;  1Q90 A;  1II3 A;  1MGS A;  4L6T B;  1HHV A;  1JOO A;  2NTS A;  2PW5 A;  3MXP A;  1EOT A;  3I4M B;  1RDP D;  2DY7 A;  1C8C A;  2HDL A;  1TU2 B;  1BF4 A;  1IKL A;  4X3K A;  2NWG A;  1G8Z D;  3W3A A;  2X6G A;  3M3Y B;  3GTM B;  2N88 A;  2NN6 H;  1O7Y A;  4O42 A;  2RSN A;  2F0U A;  1QE6 A;  1EU4 A;  3SE0 A;  3PO2 B;  3CQZ B;  4LJZ C;  1FNU A;  1MI2 A;  2R92 B;  1XTC D;  3SK5 A;  1SSO A;  1HQR D;  4ZLT F;  3QWN A;  5CR3 A;  1IYU A;  4Z9C B;  4XQQ A;  2OT2 A;  1HFG A;  2IWH A;  2B2W A;  1EIH A;  1I4H A;  3J81 E;  3BYT B;  1X32 A;  3PUY A;  2ICI A;  1CI3 M;  1PTO D;  2NVX B;  1NCV A;  1RD9 D;  4DA2 A;  1G2T A;  1SYG A;  2WKD A;  3MXN A;  4OO1 G;  2PYK A;  4QB4 A;  1JB3 A;  3V96 A;  5COY A;  4HED A;  2PO4 A;  3BYY B;  2KCN A;  1B44 D;  2C9O A;  3S1Q B;  3NUC A;  1VMP A;  3E0J A;  1PTO B;  4FF1 A;  3PIO 3;  1NAP A;  1QCB D;  3K0Y A;  1SE3 A;  2SNM A;  3ND8 A;  3T13 A;  1GXD C;  5FLX E;  1LV9 A;  2KA7 A;  3EA6 A;  5DM6 3;  4IQZ A;  3R2I A;  5JEA H;  1K8M A;  1LAB A;  5EKI A;  4L8J A;  2EYJ A;  1QNK A;  3GD7 A;  1EEF D;  1ET9 A;  5C3E B;  3PV0 A;  1HA5 A;  3T51 B;  2K04 A;  4X3S A;  1EY7 A;  1ZKO A;  4I65 A;  1OO9 B;  4HCS A;  4BY1 B;  5CV6 A;  3Q6S A;  1OXS C;  2QKI C;  1TS2 A;  3H09 A;  1VDZ A;  2J7Z A;  3EFX D;  5I9P A;  1G2S A;  4B9W A;  5A35 A;  3OOC A;  1PRT D;  3I70 A;  1SNO A;  1HUM A;  1E0B A;  1RTN A;  4NW2 A;  1X3Q A;  3D4R A;  1AFP A;  4DF7 A;  1DON A;  2WB1 B;  2L4N A;  1TT2 A;  5T1G A;  3NTK A;  3VR2 A;  1Y8O B;  2RQX A;  5IOD A;  4AYB B;  4H44 C;  5LL6 X;  1GUW A;  1PRT B;  2O4X A;  4OO1 I;  1AZP A;  3GTJ B;  1S5B D;  4ME5 A;  5CV7 A;  3EQL C;  3HOX B;  3HS0 C;  5C4X B;  1F9P A;  3K7A B;  5FK9 C;  3MZ5 A;  4ID6 A;  3K5N A;  4F8M A;  3GTK B;  4FF4 A;  4HAE A;  1ENC A;  2BA1 A;  2EYF A;  2LKV A;  4RKB A;  4DAY A;  2WAQ B;  2BDO A;  2IT1 A;  2RBM A;  1HPC A;  3S17 B;  3DWA A;  2AQ2 B;  5K5P A;  3E5S A;  4F88 A;  1NR4 A;  5BN3 A;  5M3F B;  3SEB A;  1AP0 A;  4KY7 A;  4DGZ A;  1H9J A;  5D14 A;  1FYC A;  2DNE A;  4NP5 A;  4K2K A;  5DEH A;  5JEA G;  2V4D A;  4LAA A;  2WV6 D;  5JAV A;  4DFA A;  4Y7N B;  3SK4 A;  2M2L A;  5M5Y B;  2NZ1 D;  1PTO C;  2RKS A;  2OEO A;  4QUF A;  2JEA I;  1CM9 A;  4TSS A;  4A3G B;  4H13 C;  3EVQ A;  5BN4 A;  4G7O C;  1Y8P B;  4KY5 A;  3DHQ A;  3D4W A;  2K33 A;  5M9O A;  3HOU B;  1STN A;  1SJH D;  4L63 B;  1SYE A;  5DM7 3;  1HFN A;  1BBX C;  2JYO A;  3JAM E;  1OXV A;  4X3U A;  3A8K E;  2MJ8 A;  3N52 A;  4OO1 H;  2F4I A;  5IGG A;  1EQT A;  1LTT D;  1ILQ A;  1F2L A;  4KY6 A;  1J9O A;  3J7Y W;  3SDZ A;  3PUZ A;  2FFK B;  1WTX A;  3C46 A;  3K58 A;  1CZW A;  4K5V A;  5FLX L;  2B2V C;  2FIN B;  5HUR A;  1Q12 A;  1U4R A;  5CV5 A;  2L0C A;  1MD2 D;  5BN5 A;  2QIL A;  3GTL B;  1DXM A;  2PZT A;  4NMZ A;  3W2D A;  5KYL A;  4DAP A;  2MHV A;  5FOB B;  1H9S B;  5J22 A;  1ONL A;  3S16 B;  3GV3 A;  1ET6 A;  3P75 A;  4QIW B;  3QOL A;  5IGD A;  4XT1 B;  2VXW A;  4DK1 A;  2MUY A;  1JIC A;  3OW7 A;  1AEX A;  3CHB D;  3TN2 A;  5JPN C;  1KNA A;  4CGY B;  3C3L A;  1CFM A;  5JEA J;  1Z6H A;  1PFM A;  5C6A A;  3OIP A;  5C4J B;  3NQI A;  3CRL C;  4JK1 C;  3I8Z A;  4CJ0 B;  3TP6 A;  4BY7 B;  2F0D A;  2F0G A;  3H6M A;  1F9R A;  4HSP A;  2A68 C;  1SNP A;  1SYC A;  1JOQ A;  2B63 B;  3D31 A;  2WII B;  5LL6 S;  2B8G A;  3IKJ A;  3RLF A;  3MHB A;  2QF7 A;  3MVV A;  1KNE A;  2CW0 C;  4HSV A;  4RKL A;  3KLS A;  2K5W A;  4QF4 A;  3BG3 A;  3R93 A;  1F2Y A;  1FD7 D;  3VYT A;  1NR2 A;  4RCO A;  4RGM A;  2KEE A;  1V8Q A;  3ITP A;  4ZK9 B;  1PFN A;  3E6Z X;  1TII D;  3A56 A;  3H94 A;  1PMR A;  3NPP A;  4U68 A;  1DM0 B;  3S2D B;  3MTS A;  4N9P A;  4R8I A;  1WTO A;  1B9M A;  2IJ0 A;  5IT9 E;  3DWP A;  4K5W A;  1LT6 D;  2F0T A;  1EYD A;  2JA8 B;  5D3I B;  1ZYR C;  1LAC A;  5EKK A;  5JJZ A;  5G3L D;  4IUN A;  1GOZ A;  4K6L A;  2PNR C;  1TQO A;  2EJM A;  2PQE A;  1WCM B;  5ELC A;  3SR1 A;  1PLF A;  1A3T A;  1BCP D;  1I4P A;  3FPU B;  3NWT A;  1TY0 A;  2VNU D;  2VUM B;  5LHY 1;  2ZT9 C;  1PTO F;  2AUK A;  2NUC A;  2GA4 B;  1D6E C;  4C1N K;  3CKI B;  3J7A V;  2EYO A;  3BS1 A;  3NXW A;  2CVR A;  1H9M A;  1JWU D;  3I72 A;  1BCP B;  1B3A A;  5C0X G;  5JPM C;  2A6H D;  1GUO A;  5I4D A;  3QIA A;  3JAM L;  2DY8 A;  3VA7 A;  3HP3 A;  1ESR A;  2F0O A;  4FF2 A;  1D1K A;  4FVM A;  3RD4 A;  1LT5 D;  3GP7 A;  5EQ0 A;  2CQA A;  3FRP B;  1F2Z A;  1K8O A;  1TVX A;  2JEB I;  3NSW A;  2XWJ B;  2L12 A;  1EZ6 A;  2EE1 A;  5EPJ A;  2NN6 G;  4XT3 B;  1TWH B;  5C3W A;  2EPB A;  1PZI D;  3KBX A;  1VCI A;  1WTQ A;  5NUC A;  2KHS A;  2BOS A;  4DNR B;  1TR5 A;  1DOM A;  2DNC A;  4FXD A;  3LWE A;  1VF7 A;  1Y1V B;  4O1N A;  3TSS A;  4X3T A;  2F0F A;  1I4X A;  2ZXR A;  2B39 A;  5CBA E;  5F2D A;  2JA7 B;  4K14 A;  1B2T A;  3I73 A;  1SDF A;  4YIJ A;  3EJI A;  1PYW D;  1H9S A;  1R9T B;  1LTS D;  2TSS A;  4OL7 A;  3K5M A;  4FO2 A;  2XN9 C;  4QUC A;  2E2I B;  1STA A;  4C3H G;  2F0Q A;  2KOL A;  4RGT A;  5EJW A;  3KF8 A;  1YNJ C;  1O78 A;  1DCZ A;  2E74 C;  1SYB A;  4C3H B;  1KDA A;  5C4H A;  2XNA C;  2PZW A;  4CKE A;  4ZRZ A;  2Z4I A;  1QWY A;  5EBD A;  3DUZ A;  3Q22 A;  2KED A;  1BCP C;  1H9R A;  2E2H B;  2D5D A;  1OXT A;  4OHJ A;  1TWC B;  1RKN A;  2I46 A;  5ELE A;  3VR6 A;  2TMP A;  1EU3 A;  2F0P A;  3OMG A;  1QOH A;  2K1B A;  4HN7 A;  1PZJ D;  1STB A;  3K57 A;  3SK8 A;  2PZU A;  1XWE A;  3TZU A;  2X6L A;  4XXE A;  4V0B A;  1C4Q A;  4HCE A;  4RHR A;  3I3C A;  1D1I A;  1U4M A;  2KQ3 A;  1Y69 U;  1E2Z A;  1ROD A;  1BUV T;  1HXY D;  4DXG A;  1SXT A;  1Y1W B;  1O7Z A;  1CQV A;  3I90 A;  5ISR A;  1STY A;  1AZQ A;  1SMY C;  1Q8I A;  1SE2 A;  3T4A C;  2B2U A;  2F0N A;  3OMC A;  2MGS A;  5C5L A;  2WKC A;  3J7A F;  3QB3 A;  2G9D A;  3S14 B;  1CZG A;  3NTH A;  1D5Z C;  1S5E D;  3J80 L;  4C1N I;  4A3F B;  4B08 A;  2F0L A;  3D6W A;  2L1B A;  2B2Y A;  3TP7 A;  1HCZ A;  1E2W A;  1RJT A;  4KV6 A;  2F0E A;  4LK1 C;  1WTP A;  4KHV A;  2NVQ B;  2A74 C;  1SBB B;  2B2U C;  2K01 A;  5EBC A;  5C4Z A;  3FMC A;  1STH A;  1Z47 A;  1STE A;  4HMI A;  1QIL A;  5C0X I;  5KYI A;  3GTQ B;  3NK9 A;  2I07 B;  5K36 H;  2F0I A;  3MWY W;  3OWF A;  2EVB A;  1TS5 A;  1EY6 A;  3BDL A;  4IUU A;  3CRK C;  3NBI A;  3GO5 A;  1JOK A;  3RMH A;  2KEC A;  1BCP F;  2B2V A;  1W6J A;  1U9R A;  2AWO A;  2SNS A;  1HRJ A;  1JOR A;  3PUV A;  3FDT A;  4DXF A;  1FNV A;  5KIX A;  1TY2 A;  2F1M A;  1TWA B;  4KJN A;  1DOK A;  4A93 B;  3KLR A;  1I4Q A;  1JR0 D;  4UAI A;  4KI0 A;  1D2B A;  4C56 C;  5IGB A;  1EL0 A;  1CT1 D;  1B1Z A;  2BA0 A;  5EPL A;  5FO8 B;  1LTA D;  2RSO A;  3R2T A;  2AUJ D;  3PMF A;  5CBE E;  3F2U A;  2RDF A;  1Q1E A;  1SNQ A;  2K6A A;  4EQO A;  1IYV A;  2CW0 D;  2RA4 A;  4I7Z C;  4PNY A;  4KN4 C;  4S3S A;  1C48 A;  2ICE C;  1LT3 D;  4HR7 B;  3ZYY X;  2NBF A;  5IIF A;  3PO3 B;  3TME A;  4XDX A;  4RGO S;  2EOT A;  1H9K A;  2B2T C;  3S15 B;  2R61 A;  5KNB A;  1GUN A;  3NQT A;  3KK7 A;  5CV9 A;  5CYU A;  1BNZ A;  3HOV B;  2A6E D;  2KVM A;  2C5C A;  2HDM A;  1LLR D;  2QEJ C;  2IX3 A;  2K32 A;  2NB0 A;  2EYP A;  4MIU A;  2EZV A;  3IFD A;  1HA6 A;  4TKO B;  4H7B A;  2BE5 C;  1EYC A;  1S5C D;  1KAA A;  3I4N B;  3A8J E;  4OIK A;  4KN7 C;  1NSN S;  2F0M A;  4IUP A;  1UAP A;  4NKL A;  3BVZ A;  3D3R A;  3M7G A;  3TP5 A;  1F77 A;  2IW3 A;  5CC4 A;  3QJY A;  4ABN A;  3HRZ C;  2K05 A;  4ODG A;  4C3I G;  4WOR A;  3TBI B;  3C2P A;  1A3V A;  1MSG A;  1V43 A;  5C5M A;  3K6O A;  2J4X A;  4KTA A;  4EQP A;  5E1F A;  5FO7 B;  4ZKC B;  1SAP A;  3TP8 A;  4CJ2 C;  1IW7 D;  3DXJ C;  3QOJ A;  5I6W A;  3NWS A;  3HZX A;  3GTP B;  2LMC B;  2R6G A;  5E4W C;  2K28 A;  4G57 A;  2RDG A;  4WJW A;  3OIQ A;  3PUW A;  1F9Q A;  3U9O A;  3K5O A;  1KLU D;  4RCN A;  4M1U B;  4Q5V A;  3NE5 B;  1TS3 A;  4IUR A;  2NVT B;  2ZXO A;  1SMY D;  2A68 D;  4IUV A;  1UUP A;  5I2X A;  5M5X B;  3K59 A;  2F0W A;  1VMC A;  2YYZ A;  3WOE A;  3S2H B;  4E6I A;  5I2Y A;  2F0H A;  3DEP A;  3G7L A;  4KMU C;  1KDB A;  1JCK B;  3S1R B;  1BDO A;  2R3Z A;  1ZXT A;  2HCC A;  1G29 1;  3BVG A;  3DMU A;  4BBR B;  1VF5 C;  1HQM C;  2RDH A;  2IPK D;  2L55 A;  2MP1 A;  1CTM A;  3P20 A;  3QG1 A;  4RGN A;  4QMG A;  2F3W A;  3ERO A;  1EY0 A;  1HTP A;  3MFY A;  1U4P A;  3RZD B;  4PMW A;  3A54 A;  4OGQ C;  2JA5 B;  2XSC A;  2LS0 1;  5KGU A;  1CQF A;  2E2J B;  4P2C B;  1Y8N B;  1DJR D;  4A3K B;  4K8J A;  4K5X A;  3WDN A;  3NHH A;  2QDB A;  4CJ1 B;  2F0S A;  4UDU C;  5G3L F;  3SXH A;  5FO9 B;  1V1P A;  5E3F A;  1LTR D;  1CHP D;  3G6J B;  1L0X B;  1SEB D;  1LO5 D;  2OXP A;  4CBV A;  1S5F D;  4DAV A;  3GQB A;  2JSO A;  2LFN A;  5T1I A;  5IOC A;  3MAQ A;  1I6H B;  4PV1 C;  1SFO B;  2PPB C;  4IUQ A;  4R8N A;  1TWG B;  5M5W B;  2EJF C;  3DM1 A;  1RHP A;  4B9X A;  1M8A A;  1PXU A;  1SND A;  2K5Q A;  1W6K A;  1A6X A;  3ERQ A;  2R93 B;  2EY1 A;  1EEI D;  2AWN A;  2XIW A;  4XTC S;  2HUG A;  1J8I A;  5I6Y A;  4G7Z C;  3S9W A;  3KLS X;  4BS9 A;  4ZQ3 A;  1WTW A;  4A3J B;  2DN8 A;  5D3D A;  4DK0 A;  2KJX A;  1ILP A;  2EY2 A;  1FGB D;  1R4P B;  4G4K A;  2FMC A;  4ZAI A;  5IGE A;  3VYU A;  3L3O C;  4IFD G;  3IFT A;  4M8A A;  2ENB A;  4N9T A;  2NVY B;  1AW7 A;  1I3Q B;  4KD4 A;  4ZYS A;  1QG7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...