3RUZA

Crystal structure of staphylococcal nuclease variant delta+phs v74k at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
b'LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEKEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Internal ionizable residues in proteins
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2011-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3ruzA00
2O4XA 1KDBA 1A3UA 4KHVA 1TQOA 2EYPA 4KY6A 5IGBA 3S9WA 3OMCA 3D8GA 1STAA 2F0VA 3H6MA 4K5VA 5C6AA 2F0QA 1JORA 5NUCA 3EJIA 1JOOA 5I6WA 2F0PA 2F0JA 2F3VA 3HEJA 2F0NA 2RBMA 4K8JA 2PZTA 5IIFA 4J6HA 3BDCA 4NDXA 4PMBA 5E1FA 5I6YA 1STNA 2PZWA 3D6CA 3MVVA 5C5LA 4I65A 5I9PA 1F2ZA 2F0IA 1A3VA 1EQVA 3VA5A 5KIXA 1EY6A 2F0EA 2WACA 4B9XA 4HMJA 2F0DA 2F0SA 2SOBA 4KD3A 4N9PA 5CC4A 2EYJA 1SYBA 2EYMA 3OSOA 5IGDA 5JAVA 4J1MA 2NUCA 5HURA 3NXWA 4KV6A 5C4HA 2F3WA 2EYFA 4HTHA 5DEHA 4R8NA 4DF7A 2F0GA 5IGCA 1JOQA 2EYOA 2RKSA 3NHHA 3TP6A 3EROA 5EGTA 5C5MA 1RKNA 3MHBA 1NUCA 3NQTA 4NKLA 1STYA 3DMUA 4K5XA 4PMCA 2PQEA 5EKKA 1SYGA 4ODGA 3SK4A 3V2TA 5I9OA 2PYKA 3EVQA 3QOJA 1KABA 3QB3A 5CV5A 3OMGA 4QF4A 5IOCA 5IGFA 5C3XA 4KY5A 2EXZA 2EYHA 1II3A 2SNMA 3D4WA 4KY7A 5CV6A 3E5SA 1SNPA 4KD4A 3SK5A 4WORA 5HGTA 3MZ5A 2EY5A 4NP5A 1SNMA 3NK9A 4B9WA 1A3TA 1AEXA 5CV8A 3DHQA 2EY1A 4IUNA 4OL7A 4H7BA 2QDBA 4G57A 3PMFA 4YIJA 5DAUA 2F0FA 3ERQA 1EY5A 1STBA 1ENCA 2F0UA 1F2YA 3RUZA 5CGKA 5C4ZA 4TRDA 4DFAA 4NMZA 1ENAA 2ENBA 5J1ZA 4E6IA 3SR1A 4K2LA 1EY4A 3U9OA 1IHZA 5J22A 2F0OA 4EVOA 2F0TA 3MXPA 4KTAA 3SXHA 1EY0A 3P75A 2M00A 4RKBA 2OXPA 5KYLA 3T16A 5ISRA 5KRUA 1EZ6A 1KAAA 4IZ8A 4ME5A 1SNQA 2F0HA 4K14A 1STGA 1EYAA 1STHA 4K6DA 5CR3A 4KJOA 4ZUJA 5J39A 1EYCA 1SYFA 2RDFA 2PZUA 3T13A 4EQNA 2F0WA 1TR5A 1EY7A 2OEOA 3C1FA 4K2KA 4KJNA 3MEHA 4RKLA 5JOBA 3SHLA 5IGEA 1SNCA 5M9OA 2PW5A 3LX0A 3R3OA 3BDLA 1SYCA 5IODA 4HMIA 2EY6A 4EQOA 4F8MA 5C3WA 4WRDA 3SK8A 4DGZA 3D4DA 2EYLA 4QMGA 3OWFA 1NSNS 5KEEA 2F0MA 4S3SA 2KHSA 1JOKA 3TP7A 5F2DA 4ZUIA 1SNDA 4MIUA 2EY2A 4K5WA 3TP8A 1EY9A 1F2MA 4LAAA 5KYIA 4DU9A 4F7XA 3NP8A 2HQEA 2KQ3A 4EQPA 5CV9A 3TMEA 1TT2A 4N9TA 3P1HA 4ZQ3A 2OF1A 5CV7A 5CV4A 5KGUA 4ID6A 3ITPA 2F0LA 2LKVA 1U9RA 1SYDA 3SK6A 3C1EA 4IALA 1SNOA 1EZ8A 2PW7A 3NUCA 1EY8A 1SYEA 1KDCA 4PNYA 1A2UA 5E3FA 2F0KA 5EKLA 1A2TA 3QOLA 5IGGA 4K8IA 1EYDA 3HZXA 3TP5A 4QB4A 1KDAA 5K5PA 2SNSA
chains in the Genus database with same CATH superfamily
1FL0A 1XMQQ 3ND8A 2NZ1D 1HQRD 1X3EA 1PH1A 4KY6A 3V96A 1O7IA 1AH9A 2E75C 4JBMA 3BZCA 2DNCA 3U4ZA 4JV5Q 3NBIA 5IYBG 1G2TA 2H1EA 1PV4A 1LTSD 1PH8A 3KJPA 3G7LA 3I91A 4LJZC 3K0XA 5JAVA 3KLSX 4C56C 2ASBA 3CCMA 1AZPA 4NXNQ 2EYOA 3S1MH 4CDDC 1DONA 2WKDA 2BA1A 4IURA 1O7YA 3V2TA 1R4PB 3K7AH 4BBRH 4C3IH 5C3EH 1HUMA 2K32A 1QILA 4CKBA 2E76C 2K04A 4DUZQ 2O5IC 4DV5L 1I4XA 4V0BA 1PH5A 4A3JB 4BBSH 3S24A 4G7OC 4H7BA 2PI2A 3RUZA 2MO0A 2IX1A 2FHTA 4R4QA 1HRJA 2B8GA 1VQ8A 4J8QA 2G9HD 1DZ1A 3OIQA 2BE5C 4ALPA 4KTAA 2ZT9C 4FNFA 4KLKA 4OO1G 1PH2A 3F2CA 3NSWA 4HIMA 4KJOA 1SYFA 2R7FA 4RHRA 4JBWA 4LUVA 3AU7A 2B39A 2ALYB 1DYQA 4DK1A 1Q8IA 3HGBA 4QY7A 3PO2B 1EUJA 4K5WA 2K1BA 4C2MB 2VQFL 1HTPA 4DR7L 4B3RL 5IT9c 1N33L 1F9RA 2RVLA 4XQQA 4ME3A 1PVOA 1EY8A 1SE2A 4YHHQ 2XWJB 3GTOH 4P2CB 1MSGA 2RSNA 2PQAA 1TQOA 4R4OA 1DOMA 4OXPA 3ONAB 1BBWA 4DV2L 2F0VA 3ERSX 1PDQA 3ULLA 4IUPA 1CI3M 1QVCA 2RCFA 3EJIA 4O42A 2BDNA 2CWAA 1U5KA 1X3QA 2F0NA 3EBEA 3OW7A 4J6HA 1VQNA 4PMBA 1S5DD 1K73C 1PTOF 3AFPA 1DCZA 3S2HB 4C3JH 4RA8A 4O2DA 5COYA 3LWEA 3CPWA 3ICEA 1B50A 2VQEL 1K3RA 4N9PA 2EYMA 2F4IA 1GOZA 3FDTA 3NPPA 5C4HA 2QGQA 4JI5Q 3E9HA 4IJHA 3OYYA 2A6HD 1E24A 2B2TC 2NZHA 1Q1EA 1QG7A 5EGTA 1HNXQ 3GV3A 4B3SL 1Z47A 4K5XA 2PQEA 5EKKA 3GQBA 3UDIA 2F3IA 3VA7A 3K59A 5FOBB 1QJOA 4JI1L 4KD4A 2G9DA 4FXKC 1GO3E 2CH4W 3CCQA 1EWCA 2XNAC 5FO7B 3BVZA 1Y1WB 5HGQA 4C3IG 5C3EG 1NR4A 3M4OB 3PV0A 3GTLH 3CMEA 1CZGA 1H95A 1WVLA 2K5QA 1EY4A 4BBSG 1SJED 2L15A 4B3TQ 2AWNA 2JEBI 1NCVA 4LF9L 4AYBG 4WJ3M 1SNQA 4CDFC 1QNKA 2KUMA 2R6GA 2Q2TA 4LFAQ 3HKSA 3SHLA 3S17B 4LK1C 4JW0A 5JVG3 4HMIA 4XXEA 3KLSA 4WRDA 4GOPC 5C44H 3UE0A 1E2VA 3D4DA 1VQCA 4LUOA 3CCSA 1OXUA 3PUYA 3VYTA 2VW9A 5M3MH 1JWMD 3W5OA 3NEMA 1EIGA 2CW0D 1YNNC 3UE1A 4FDBA 3J81c 1RCVD 2OF1A 1BUVT 4DV7Q 3A54A 4YWKA 1K28A 3GV6A 3STBC 1SYEA 1NR2A 4DAMA 2AKWB 4JOIA 1T5XD 3CRLC 4KHPL 3M9BA 1KHIA 3HKZE 1D8LA 1WYDA 4RGMA 1X54A 1KL9A 5M5YB 4LF8L 1Q12A 5LMUQ 1VQKA 4K5VA 1UEBA 5I6WA 3Q8DA 1K8GA 3I7FA 1E2ZA 4FF3A 1XNRQ 4RHSA 1HNZL 5I9PA 1F2ZA 1S40A 2F52A 3T53B 3LGJA 2JA7B 2GVBA 5GQOA 1B7YB 3CMAA 4CBVA 1SYBA 2CVRA 1Q1BA 4MNOA 3R2IA 5GROA 4C3JG 1MSHA 3I55A 2R92H 1W6JA 3F2DA 1UE7A 5JEAG 1STYA 3DMUA 3WDNA 3HOUB 1PRTF 1H9JA 2RDHA 3SK4A 4K6LA 3RD4A 1KXLA 5BN5A 3I73A 1ET9A 3S2DH 1I94Q 2Z6KC 4WORA 4B08A 1SMYD 4ZYSA 2EY5A 4NP5A 1W3SA 4ABNA 2EY1A 4PQXA 3PMFA 3NWTA 1STBA 3Q23A 5C4ZA 1I6HB 1XJVA 2HDLA 2UUCL 4LF4Q 4X3TA 3EFXD 3LNNA 3DLLA 1TWHB 2M00A 1KQSA 3HOVB 4OGQC 3OHXC 1F77A 5M5WB 1STHA 4ZUJA 1NE3A 4NB3A 5G3LD 4JG2A 1ASYA 5IGBA 3KUPA 2BA0A 5M5XB 5EAYA 1HH2P 5GADC 1JICA 3URYA 3KF8B 3AYHB 2L5TA 2EYLA 1TU2B 4Z9CB 4S3SA 4O0AA 3JAMc 3S1NH 1L1OB 1IZ6A 1UE5A 2KQ3A 3I4NH 3FP9A 5C44G 4GN5A 2LKVA 4C1NK 3C1EA 5M3MG 1GXDC 4HCSA 4A4IA 1GUSA 4BY7B 3M7GA 4LW1A 1NMGA 1AFPA 3A56A 3H3VC 2A69C 1O80A 2CH4A 3E6ZX 3VR4A 1DM0B 2SNSA 4FF4A 1SEBD 4GKJL 1A3UA 2B3GA 1BDOA 3U9SA 1I4QA 4DV5Q 2JA5B 1GUOA 2WINB 3RR5A 1H9SA 3ZJYC 2KEEA 1TWFH 4A3IH 1SBBB 3MAQA 4CJ2C 4NDXA 2Y0SE 4A3KH 1HR0L 2PPBC 3IRBA 2A19A 1HFNA 1I6VC 1K83B 4DV3L 2DJGC 1SAPA 1AP0A 3MFGA 2BE5D 4RCNA 4JI8Q 4KK7A 4GNXA 1HHVA 1G6ZA 3GP7A 3I4MH 2B2VA 3R8BA 3NHHA 4R4TA 4IOAA 5IP7H 1JCKB 3MHBA 1OXTA 3QJYA 3MXGA 1LT5D 2GN5A 1L0YB 3T51B 5BN4A 2UXDL 2CHBD 5CV5A 3NTHA 1LABA 1XYIA 2XRSD 3A8IE 4HSPA 1C48A 2VQFQ 1AEXA 3PQIA 5CV8A 1EIYB 2NB0A 3I4LA 3PIP3 4B3RQ 4JK1C 2F0FA 2DY8A 1N33Q 1Y8OB 4MTNA 4BA1I 4YCWA 1S72A 2EPBA 5J1ZA 1HZ9A 3E3XA 2IT1A 4AYBE 2K14A 3SGIA 1N34L 2QEJC 5K36H 2A8VA 2B8FA 3Q24A 1Q90A 4RG1A 3DWAA 4L63B 1S4ZA 3HOWB 4EQNA 1Y1VH 5JOBA 4GZYC 4JI3L 3TSSA 1GHKA 1I4PA 2PW5A 3J80i 4DV1L 2B2UA 1AN8A 3N6RA 4KN4C 5C4XB 4X6AH 1G2SA 1K0RA 2YTYA 2E2IB 2X69A 4Q5VA 1JE5A 4BY1B 5JJZA 3M7NA 1BCPB 5FLMH 4UAIA 4C3HH 3GTKB 5H1SE 2R7ZB 4Y7NB 3TMEA 4OIKA 3VYUA 3CCVA 4A93B 1VCIA 2K03A 2L4NA 3QWNA 4KMUC 1X9NA 4A3DH 2Z4HA 1W2BA 1DD2A 2IHEA 3CF5A 2KCNA 4H0LC 2WIIB 1HPCA 3I4NG 3FEWX 4L5TA 4JI1Q 4JI2L 1A8VA 3A7LA 2UUBL 4L5RC 3BU2A 2DNEA 4KKSA 1BBUA 2VUMH 3RZDB 2K75A 3MC0B 1Z9FA 2B63H 2F0JA 1YHQA 5TSSA 5JJKA 1FR3A 2X6LA 1L0WA 3HOZH 1S5CD 2F0IA 2LMCB 1SE3A 4ZCKA 1TS3A 1Q82C 4LF9Q 4KD3A 1LTID 4A3IG 4DAYB 2QW7A 4A3KG 3WWVA 1ET6A 1O78A 1SJHD 3BVMA 2EOTA 3GTPH 3EROA 4QUCA 1D7QA 3KDFA 3AEVA 3KBXA 3CC4A 3CW2C 2ZM6L 1UE1A 3S1RB 4A3MG 4LNQA 2IY5B 4R4IA 3PIOA 2R93B 1KABA 3I4MG 1B3QA 3HS0C 5IGFA 1WCMB 5IP7G 3J80E 1KLGD 3CCJA 5IP9H 1YNND 2BH2A 4HEDA 2K01A 1PFMA 1D5ZC 4O1NA 1ENAA 2E5LL 4TVAB 1SLJA 5J22A 3HOXB 1OTCA 3STBD 4KHPQ 3CAMA 1WTOA 5FLXE 1LTTD 4LFBL 3PIO3 2L1BA 1FNUA 4X64L 4LF8Q 1HA6A 4HAEA 3Q6SA 4DPGA 4K14A 5EQ0A 1LTLA 1SRUA 5ELOA 3M4YA 1FVIA 1YJNA 2CQOA 5K36G 1EWIA 4ZRZA 1TWGH 1CSPA 2OCEA 5IODA 1MJEA 3T1HL 1HNZQ 1LV9A 1VQ6A 3K6OA 3M3YB 4N8X1 4A3GH 3GO5A 1S5ED 2ZJPA 3TS0A 4XTCS 4CJ1B 1PYWD 1SNDA 5FKAC 4HJ7A 4L5QA 3T56B 3UI2A 1KLUD 1YHAA 4G4KA 1S3OA 1KTKA 4HCEA 1H9KA 3KLRA 4UY8C 4QJFA 1B2TA 3KYHC 4JI6L 3DXJC 2BDOA 5DM63 4ZAIA 1LM0A 5EBCA 3BS1A 1TY0A 4POGA 3E0EA 4KHVA 4YWLA 1EOTA 3S9WA 4JYAL 4R1JA 4A3DG 2HT1A 1JORA 4CDCC 1I94L 2RHSB 5GAGC 3TZDA 1EYGA 1PXUA 2O5JC 1PTOB 1E1TA 2JA8H 4P73A 2UUCQ 1PZID 2RHQB 1Z7TA 2EE1A 2SEBD 2WFWA 5G3LF 2VUMG 1EQVA 3VA5A 1VQAA 3S14B 1ILPA 2B63G 1C0AA 4XYQA 2B2TA 1IYVA 4L8JA 3HOZG 1LTRD 3CU7A 4X3SA 1LYLA 2QCPX 3FKIH 3HKZG 4DR4L 5IYCH 3FVQA 1WI5A 3CXCA 3K81C 3CPFA 2TSSA 4KY7A 4Q0FA 5IGDA 2XRQD 2UU9Q 2KBNA 5HGTA 1EQTA 2JN4A 1G6PA 4LF5Q 2KECA 3OW2A 3PUZA 2A5HA 3ULPA 2HHHQ 1FGBD 4G57A 1QNUA 1TWAB 1YHBA 3RN5A 4YY3L 3U9OA 1IHZA 4DR3L 2HQLA 3PO3H 4GKJQ 3S1QH 4XDXA 1M90C 1EFWA 3PF5A 2NYZD 5BN3A 3T16A 4X66L 2A69D 4CKEA 1S5FD 1M8AA 1GHJA 2RDFA 1TWCB 4GOPA 2F0WA 4IFDJ 1CSQA 4J15A 4CDEC 1VQ5A 1HR0Q 5EPLA 1UEAB 1K3BC 2D5DA 1G8ZD 5KEEA 3GTGB 1XXGA 4DV3Q 4ULLA 1PFNA 2KOLA 4H44C 4MZ9A 1EEFD 4TSSA 4JI4L 1TT2A 2B29A 1LT3D 1PFBA 5KGUA 4Y52H 4JI8L 3CKIB 4U673 1EZ8A 3NUCA 1VQPA 5EJWA 2BOSA 2UXDQ 3S2HH 3TP5A 3H09A 3SXHA 1PH9A 2E2HH 1O7LA 2Z9HA 4L6TB 1GKHA 2IWHA 1CKMA 4A3EG 2V1CC 3DEPA 5NUCA 5KNBA 2JE6I 3RLOA 1BQQT 4CHTB 4UPAA 4K8JA 2VL6A 4A3CH 3X3NA 5I6YA 2MUYA 2MQHA 2PZWA 1Q81C 2JK8A 1N34Q 2PCFB 5KIXA 3F2BA 3H3VH 2VY3A 2F0DA 2PQAB 1GD7A 2ICIA 3H0GH 3OSOA 2JA8G 1BO0A 3NXWA 3KK7A 4IUTA 3GD7A 2L12A 3K7AB 3D3RA 2OTLA 4C3IB 5C3EB 4JI3Q 3B6YA 3UDGA 1V1PA 4DV1Q 5I2YA 1PRTB 4H13C 1SYGA 1R9TH 4BBSB 2Z6KA 1BR9A 3DWPA 1E1OA 3EVQA 2MNAA 4QF4A 5C3XA 3SK5A 3FKIG 3KOJA 1D2BA 5KNCA 4AYBB 1SNPA 5IYCG 3NTKA 2PNHA 3PSIA 5A2QL 2NVXH 4LFCQ 2Y0SG 3GTQH 1SNMA 4IUUA 3D31A 1VMPA 3KFUA 5CGKA 4PZ6A 5D3IB 1WTWA 2BCOA 4RMFA 1VQ9A 2RF4A 2F0TA 5C4JH 4LF6L 2MPMA 4RWSC 2EJMA 3K5OA 4DNRB 4JI2Q 4OWTB 4P74A 4RKBA 2UUBQ 2DY7A 1YITA 4XQJA 5LMNL 1D6EC 4B3ML 1GUGA 4YCVA 1BF4A 5I4DA 5IT9L 3PO3G 1SNCA 3R3OA 4A75A 1M1KC 2GVAA 4NW2A 4BBRG 1FD7D 5EPJA 3G6JB 5F2DA 3M85A 5KYIA 4FVMA 3MFYA 2LSSA 1B9NA 5CV4A 1U9RA 3Q22A 3K5LA 1VQHA 2ZM6Q 2WB1G 4DK3C 1VF5C 2L11A 4YWMA 3FRPB 3HZXA 1TS5A 1KDAA 1SE8A 3D8GA 1ZKOA 4C3JB 4WJ4A 3O13A 2F3VA 4WFN3 4I7AA 4DR1L 1GVPA 4UP9A 3DM3A 1JJCB 2K5WA 2E5LQ 1D5MC 3I3CA 1CHQD 1PZJD 2F0SA 4LFBQ 4X64Q 1CA5A 1XX8A 2BH8A 4OHJA 1C8CA 1V1QA 4JVZA 4R9WA 2RKSA 4GLAC 1KNAA 4FO2A 5C5MA 1RKNA 4IQZA 2D62A 3A5ZB 3H0GG 3IFTA 3OIPA 2UUAL 5JVH3 3T1HQ 1WTXA 2TMPA 5I9OA 4PZ8A 3JC66 4FXGC 2EXZA 1II3A 3OWEB 2FINB 1TWHH 3K5MA 2WAQE 4MTKA 5A35A 2ZTDA 3GTMH 1F9QA 1TVXA 2K28A 3NK9A 2K33A 1XPOA 4YIJA 1N36L 2L9HA 2F0UA 2XIWA 2EXDA 4JI6Q 2PNRC 2ES2A 2E8GA 2XTIA 4POFA 2KEDA 1EOVA 1J8IA 2AUKA 5IT9E 4NPSA 2FFKB 3KBGA 5LL6S 4JYAQ 2OXPA 1IL2A 3F1ZA 1G291 2J4XA 3C3LA 2Q2UA 2A68C 2OQKA 5HY6A 3J81L 3K7UC 1RTNA 4MHEA 5C44B 1EYCA 2NTSA 3VYRA 1HQMC 1I50H 2FJ2A 3L0OA 4HIKA 4EX5A 1LO5D 2JA6H 5M3MB 1SYCA 3EIVA 1J5EQ 1RTOA 3HOYH 2VS1A 3NELA 3W1GA 4QMGA 2UXBL 1H9RA 3I2ZA 1IBLL 3PGZA 4KHZA 3FMCA 1WD1A 2KHSA 1JOKA 4CGYB 2HIXA 4MIUA 5GAHC 2A74C 5CMDA 5D14A 3F2UA 3BVGA 4DR4Q 4ZLTF 4QCLA 3SK6A 2F0KA 4XQNA 4K8IA 5ELNA 1O7ZA 4UHVA 2EZVA 1SN8A 2AQ2B 1LACA 1UUPA 1FYCA 2UU9L 2CCZA 5E1FA 4QL5A 4YY3Q 2C35B 4LF5L 2HHHL 4DN4M 4RCOA 4I65A 1CA6A 4DR3Q 5FK9C 2Q8TA 2MJ8A 1EQRA 2F0EA 1FNVA 3NTIA 4DR2L 1Y8NB 1YNXA 2VB2X 4X66Q 4J1MA 4DK0A 2EQSA 2B2WC 2EYFA 3BZKA 2F0GA 1H9SB 4JI0L 1JT8A 4KN7C 3TP6A 2N78A 4IPCA 4V190 3S15H 3S2DB 2PYKA 3MXNA 5C0XJ 1GUWA 4DKAC 1CT1D 4IFDH 2VXWA 4GNXB 1UWVA 4JI4Q 1EEID 3TN2A 3J80c 3BG3A 3J7A5 1Q8KA 4RGNA 4DFAA 1KD1C 1VQOA 1ZYRC 3CQZH 3A7AB 3QG1A 4IPHA 2IJ0A 5JPMC 2XWBB 3JAML 5ISRA 1QVGA 4ME5A 4UP8A 2F0HA 5FLXc 1STGA 1DXMA 2R92G 1T5EA 3T13A 1AW7A 1AE3A 1QOHA 3BDLA 4PG3A 3S1NB 3M4QA 3TQYA 3SK8A 3CCRA 4RFBA 2HD3A 4JOIC 4DK6C 4TKOB 3I4NB 1RJTA 2L55A 2C5CA 3TP8A 4OEMB 4F7XA 3G4SA 3ZYYX 2JA6G 3GTJH 1VQ4A 3HOYG 4ZQ3A 4DXFA 3TEHB 2NVTH 3ITPA 5C0XI 1WJJA 2KENA 2WB1E 2ICEC 1VMCA 4HJ8A 1IBKL 1CKNA 1SXTA 1E2WA 3OOCA 1TWFB 4A3IB 4GN4B 2GA4B 4OIJA 4A3KB 4DNIA 2K05A 5D65A 3T1YL 2I07B 3I8ZA 1MBYA 2NVYH 3CRKC 5IYDH 2F0PA 4LFCL 4A3LH 2RBMA 2RA4A 3BDCA 4FYDA 2E2DC 4A3FH 1A63A 4RAUC 3S16H 2B2YC 3I70A 4A3MB 1A3VA 3NWSA 1XNQQ 3I4MB 3SVMA 2WACA 4LF6Q 2CQAA 1ASZA 1ML0D 5JEAJ 2MFIA 2E2JH 3LWUA 1RL2A 5E4WC 4BXXH 5LMNQ 3H3VI 3QO2A 1XTCD 4B3MQ 2A1AA 2MP1A 5CORA 1HZCA 1IXRA 2QDLA 2HCIA 4NKLA 2I5LX 5M3FH 1VS0A 2YU9H 4JBKA 3MTSA 1RODA 3RMHA 4QGUA 4PMWA 1KIXA 2JA9A 4XT3B 3NBHA 1EFID 4NXML 1BXTA 1HTLD 4U68A 2NVQH 1WTVA 1EY5A 3KDFB 4IFDG 1A62A 1TKWB 4X3UA 1L2FA 2M9VA 3VR3A 3W3AA 4DV6L 4HJ5A 2QKIC 4YCUA 3MEFA 4R4CA 1EQQA 1AZQA 4JBJA 1EZ6A 4K6DA 3WOFA 2I5MX 2K5DA 3KLWA 3RZOH 3SEBA 4RKLA 4K2KA 3J7AF 1L1OC 4DR1Q 2Z6BA 3L9AX 1X32A 4F8MA 1D1KA 1HNWL 1SDFA 3OWFA 1VF7A 2JYOA 1GJXA 1MI2A 1LTBD 4DV0Q 1I4GA 2AUJD 1WTRA 2MHVA 4A3DB 1SROA 1YJ9A 3G71A 5CV9A 3U50C 1BOSA 4LF7L 3A8JE 1X6OA 4JC0A 1PH7A 1A15A 5D3DA 4ID6A 5E4XA 1SNOA 2YYZA 2UUAQ 3NE5B 3X3MA 1K8MA 1F9PA 1EYDA 2VUMB 5IWAQ 1SFOH 4A3BH 2B63B 4QIWE 1MD2D 3Q0AA 1U0LA 5IY0A 3HOZB 1YEZA 1EWHA 1Y1VG 2X6GA 1BVSA 3HKZB 1N36Q 1MIUA 4BA2I 1I4HA 2L0CA 3D6CA 5C5LA 1PLFA 1B8AA 4GKKL 4HMJA 3GTPB 5FLMG 2KJXA 4C3HG 5IE8A 2NUCA 4A3FG 4OO1H 2R3ZA 4KV6A 2R7DA 2Q2IA 5DEHA 3UDXA 1EIHA 1C4QA 2A68D 2KHIA 4FF2A 1U4LA 2HCCA 1L0XB 2UXBQ 4BXXG 1IBLQ 1J5EL 2N49A 3CC7A 2EIFA 3RN2A 1IW7C 4HJAA 5M3FG 2Q8IB 1TWCH 2ZXOA 1ENCA 2Z8LA 4A3JH 1DOLA 3SDZA 4E6IA 3KF6A 1XMOL 2AWOA 3MXPA 1KAWA 1QUQA 1TY2A 2CFMA 2ID0A 1B9MA 2A6EC 1CTMA 1TWGB 3J81j 1HR0W 4OWWB 5ELCA 1IYUA 1X3PA 1ESRA 1BCPC 2N8NA 4X65L 3FPUB 2NBFA 2K4KA 5C3WA 2WAQG 2F03A 1V1OA 3FPPA 2WP8J 3U4VA 1NTGA 1WTPA 3M4PA 1HZAA 4DR2Q 2LXKA 5EPKA 5IP9G 4A3EB 3PO2H 1ICFB 3K57A 5FJ8H 4UP7A 4GOPB 1V8QA 4JI0Q 1J9OA 1I3QB 4FF1A 3H91A 3K58A 4X62L 1NMFA 2RQXA 4KI0A 4C2MH 2EJFC 4X3KA 1A2UA 2JQOA 2OTJA 4IUVA 1I5FA 3HRZC 1HA5A 3E9IA 1KDBA 1OXSC 1DGSA 1KNEA 1VQGA 2JA8B 2QA4A 4XT1B 1ILQA 4BS9A 1MJCA 5C0XH 1YBYA 3OPOA 4A3BG 1HUNA 4ZK9B 2QEXA 4K0KL 1ENFA 1VQBA 2AHOB 3DEOA 4PZ7A 3AQQA 4A3GG 1YVCA 2LS01 4IUQA 1JWSD 1K9MC 2K6AA 1RHPA 1ZYRD 2F4VL 3FKIB 4R8IA 1NJIC 2IPKD 2Y0SB 1DOKA 4R8NA 5BR8L 3PCOB 5AJ3L 2CKZB 4N8FA 1T9HA 1Z6HA 2RSOA 3ND9A 3OMGA 2SNMA 5ELFA 4IJLA 1JJ2A 5ELBA 4C1NI 5T1IA 2OT2A 4DR5Q 2DUDA 4FP5D 4DR6L 1A3TA 3S1MB 1C7YA 4IFDI 3HFZB 4ILWA 2KA7A 3NENA 1F2YA 5J3BA 4DUYL 4EQ5A 1V1PB 3PO3B 3S1QB 2KCCA 2UXCL 1Q7YC 2PMZE 2ENBA 5KNDA 5EBDA 2KCTA 1Y1WH 4BBRB 2H4OA 1IBKQ 3U58A 4LUZA 3VDYA 3M4OH 1ESFA 3W2DA 2DN8A 1PYBA 5KRUA 3RLNA 2AQ3B 4A3JG 4IZ8A 2D9UA 5JJLA 5J39A 3T1YQ 2J7ZA 3H94A 4JI7L 1EU4A 1EY7A 3C1FA 3MEHA 2IX3A 3A0JA 3KJOA 2N55A 2QILA 5M9OA 3LX0A 1N9WA 2H5XA 1KC8C 1A6XA 2WB1B 4DGZA 3TREA 4AH6A 3S17H 1J6QA 4ZUIA 4I7ZC 3I72A 4LAAA 3NP8A 1XNQL 2HQEA 1VQJA 4N9TA 3P1HA 4H02A 1HFGA 2K5NA 1X56A 2ZTCA 1K8OA 1S5BD 4HIOA 2E2HB 1AE2A 1KDCA 5JEAH 1B1ZA 1EU3A 4XIGS 3CD6A 4HJ9A 1A2TA 3ULJA 2D2CC 3PO2G 1PTOC 5FJ8G 1Y69U 1IL8A 1QE6A 3VR5A 3OMCA 5L37A 2YTVA 4HR7B 1X3FA 4GN3B 5C6AA 1YNJC 1GUNA 4NXMQ 1JOOA 3UDFA 3W1BA 2LY7A 5M5YH 1PA6A 1HCZA 3H0GB 1E22A 3GTOB 4DV6Q 3A5UA 1QZHA 1XPUA 2JSOA 2B2WA 5C0XG 3J7ZC 2EYJA 1WTHA 2MGSA 3K0YA 1KRTA 3IAYA 4OWXB 5T1GA 3F8TA 1R9TB 2JA7H 2I0QA 3ER0A 1NUCA 1SSOA 2J0TD 2NN6I 4OONA 1HNWQ 2NVXB 1PMRA 1G51A 3GTQB 3GDEA 3CCUA 2LXJA 4F88A 3HOUH 1FJGL 4IO9A 1PZKD 2YTXA 5LHY1 4B9WA 4LF7Q 2ATWA 1X55A 1CHPD 1WOCA 2HDMA 4DV0L 3TRZA 1G91A 2QDBA 4DV4L 4A3CG 3L7ZC 5C4JB 3PF4A 4NMZA 4DXGA 3BDOA 5A2QE 1E7ZA 1IBML 4DAPA 1NY4A 1I6HH 1EY0A 4GLVB 3HP3A 2AQ1B 3C2PA 1LT4D 1Y14B 5IWAL 4LWCA 1MKHA 1EYAA 1Y1WG 2XSCA 1BBXC 4KJNA 3J7YW 1D5XC 3GTLB 3HOVH 1BKBA 2ZTEA 4IN3A 5M5WH 2Z0SA 4RH6A 4BWGB 3I4OA 4DA2A 3P7JA 1VDZA 2F0MA 4OX9L 4GS3A 1N32L 4GKKQ 2HIVA 5M5XH 1XWEA 2CWPA 2C9OA 3RNUA 1JB3A 4QIWB 5FO9B 2E74C 2F0LA 1QVFA 4IALA 5DLQE 4EGVA 3G6EA 3CCLA 4XYOA 2ZXPA 3QOLA 1C9OA 2O4XA 4P72A 3OTOL 4BY7H 4L5SA 2F1MA 2P5ZX 3H6MA 2AMCB 3E0JA 1IW7D 4AQYL 2B2YA 3HEJA 5DM73 3J81i 2JA5H 3EN2A 2JP1A 3QIAA 3L3OC 1XMOQ 1JJGA 1Q46A 1VQFA 3VR2A 1PRTC 3AB9A 1B44D 2SOBA 1PH4A 1E0BA 3CCEA 5HURA 2FMCA 2FMMA 4DF7A 1FNWA 1X65A 5IGCA 1K83H 1E3PA 1BNZA 2A6ED 1JOQA 5ELEA 1UAPA 4OO1I 4X65Q 3DUZA 1K0SA 2VB3X 4ODGA 1BCPD 2IHFA 4IOCA 3GTMB 1K8AC 2NTTA 3A8KE 2PO4A 3QB3A 2JA7G 1OXXK 4KY5A 1XMQL 2EYHA 2WKCA 3D4WA 1B4OA 3R2TA 2NWGA 2R92B 3DHQA 3P20A 1YZ6A 3D4RA 4JV5L 1VQDA 2OQ0A 4X62Q 1JWUD 3HOUG 4P71A 2VNUD 3MXNB 3KF8A 4HSVA 2PI2E 4ZKBB 1MGSA 4CKCA 1I50B 1EL0A 2K7VA 1WFQA 1L1OA 2Q2HA 5CBAE 2K5HA 2JA6B 4RGOS 3HOYB 4NXNL 1VQEA 2PZUA 1YI2A 1TR5A 2ZJRA 2I46A 2HUGA 4K0KQ 4EQOA 1VQIA 1ONLA 2O2LD 3HOWH 3FHWA 4M1UB 1F9SA 2JEAI 4AIMA 1NBWA 3J81E 4DUZL 3C46A 1EY9A 2F4VQ 3R93A 2XGTA 3HOVG 5C4XH 1F2LA 1EIFA 1QCBD 2E2IH 5BR8Q 4BY1H 4QQBX 1B3AA 5AJ3Q 2EJGC 1SR3A 3IL8A 3GTKH 4QUFA 1NNXA 2R7ZH 3MA2B 4Y7NH 4PNYA 2Q8RE 3TDQA 1CQFA 1VQLA 4A93H 1GUTA 3V05A 3PIPA 4A3MH 1Q86C 1CZWA 3IKJA 5K5PA 1NAPA 1QZGA 3HG9A 3AMUA 1STAA 4DR6Q 1LT6D 3JAMi 2F0QA 2LFNA 1UE6A 1KRSA 5IIFA 2PZTA 3DWQA 4DUYQ 4DR5L 2UXCQ 4KKTA 3BYTB 4FXDA 2IL8A 4BY7G 3MVVA 3RZDH 5LMNW 1LTGD 2XVSA 3D0FA 1CKNB 1RF2D 3BJUA 4P75A 1FGUA 1H9MA 2JA5G 4DR7Q 4HIDA 3S15B 3I56A 3TZUA 2IW3A 3BYYB 1U4RA 4HTHA 5I2XA 1WTQA 3J80L 1V43A 4JI7Q 1R4QB 1RD9D 2A73B 4IPGA 1WD0A 1UNSA 4YHHL 2DJFC 3G48A 2PMZB 4LMQD 5AFWA 4DV2Q 1YIJA 1U4PA 1TS2A 3E5SA 1CQVA 3S1RH 1JR0D 1D1IA 4HN7A 5JPNC 2R93H 5FLXL 2XN9C 5GAEC 1PH6A 3K5NA 1IKMA 2QF7A 4MN3A 1WCMH 4IUNA 4A76A 4CJ0B 1GM5A 3MWYW 3CQZB 3ERQA 3IFDA 4JCVE 4TRDA 1HJPA 3J7AV 2NN6H 3WOEA 2VQEQ 3SR1A 4K2LA 3CC2A 1YJWA 1RDPD 3H15A 3K80C 2EDGA 3DM1A 2KHJA 1IKLA 2ZXRA 3P75A 2A6HC 1JE4A 5KYLA 2K5VA 1QWYA 1KAAA 1PTOD 3HOXH 3NBHB 5CR3A 4JI5L 4B3SQ 2N3SA 3D6WA 4APVA 4JPBW 3SE0A 3TBIB 1HNXL 1Q3LA 1YNJD 2YV5A 4F87A 1CKOA 3RLFA 2SDFA 3K8AA 2EY6A 2D0OA 3JAME 3GTJB 1JC7A 1HZBA 1ZEQX 2Z4IA 1DJRD 5JJIA 1CM9A 3TP7A 5CBEE 2EY2A 3AFQA 2NVTB 3VR6A 3I90A 4DU9A 3M3YH 4EQPA 1N8RC 3HOWG 1Y1VB 4IPDA 3EQLC 5CYUA 1JMCA 1VQMA 1OO9B 2IX0A 1QB5D 1JQYD 2WV6D 5C4XG 4B3TL 2RCNA 3N52A 2DGYA 4BY1G 4G7HC 2NVYB 1PHJA 4GLXA 5IYBH 3BZDB 2EYPA 4C3HB 1FJGQ 2FXQA 3MXUA 1I4RA 1XTDA 1LLRD 2D0PA 4DAYA 4A3FB 2R7ZG 1ICWA 3S16B 2JXMB 4A93G 2MO1A 4LFAL 1X3GA 4DV4Q 1M4VA 3A55A 1VQ7A 1STNA 2Z1CA 2E2JB 1PH3A 1IBMQ 1EY6A 1MHWC 2CW0C 4B9XA 1PTOH 5CC4A 1OXVA 4DNTB 1CUKA 1XPRA 2F3WA 5M3FB 2VZAA 2YU9B 2KCMA 3S14H 4DV7L 3T4AC 1TXYA 1W6KA 2K52A 2RDGA 4GNXC 1CK1A 1P8LA 3NQTA 2B2VC 4PMCA 5DNFA 2EVBA 3CHBD 4M8AA 3QOJA 4OX9Q 3NQIA 1HXYD 1N32Q 5IOCA 2KVMA 5CV6A 1V9PA 2OWOA 2NVQB 2M2LA 3MZ5A 3L2PA 1B53A 1TIID 5LMUL 5IYDG 4OELB 4OL7A 5DAUA 4A3LG 3PUWA 4PV1C 1RIPA 5LL6X 1P16A 1PYSB 1XNRL 2WAQB 4ZKCB 2R93G 2K50A 1STEA 2F0OA 1U4MA 1TWAH 4EVOA 4UDUC 3RZOB 1WCMG 1JB7A 1CFMA 3OTOQ 1SMXA 1TS4A 3TS2A 2NN6G 2I5HA 4RGTA 4A3EH 2V4DA 4AQYQ 2OEOA 5IGEA 2N88A 1I3QH 1LTAD 2NZOA 1A0IA 3KF6B 4KKUA 3HOXG 1NSNS 5FO8B 4WJWA 1SMYC 2JJQA 2B2UC 1QUQB 1SE4A 1IYJB 1F2MA 3QR8A 5EKIA 1BCPF 4TQUS 3GTGH 1PRTD 3CP0A 3EA6A 5CV7A 5E7NA 4DAVA 1PFSA 1Y8PB 1SFOB 4G7ZC 1SYDA 4A3BB 1ZXTA 3PUXA 2R61A 3PUVA 2PW7A 1LUZA 1B70B 5E3FA 5ELDA 5EKLA 2ZJQA 4LF4L 4A3GB 2G5DA 5IGGA 3VYSA 4QB4A 3A74A
chains in the Genus database with same CATH topology
3ND8A 2NZ1D 1HQRD 4KY6A 3V96A 2E75C 2DNCA 3NBIA 1G2TA 2H1EA 1LTSD 3G7LA 3I91A 4LJZC 5JAVA 3KLSX 4C56C 1AZPA 2EYOA 1DONA 2WKDA 2BA1A 4IURA 1O7YA 3V2TA 1R4PB 1HUMA 2K32A 1QILA 4CKBA 2E76C 2K04A 2O5IC 1I4XA 4V0BA 4A3JB 4G7OC 4H7BA 3RUZA 2IX1A 2FHTA 1HRJA 2B8GA 4J8QA 2G9HD 1DZ1A 3OIQA 2BE5C 4KTAA 2ZT9C 4FNFA 4OO1G 3NSWA 4KJOA 1SYFA 4RHRA 4JBWA 3AU7A 2B39A 1DYQA 4DK1A 1Q8IA 3HGBA 3PO2B 4K5WA 2K1BA 4C2MB 1HTPA 1F9RA 2RVLA 4XQQA 1EY8A 1SE2A 2XWJB 4P2CB 1MSGA 2RSNA 1TQOA 1DOMA 3ONAB 2F0VA 1PDQA 4IUPA 1CI3M 3EJIA 4O42A 2BDNA 1X3QA 2F0NA 3OW7A 4J6HA 4PMBA 1S5DD 1PTOF 1DCZA 3S2HB 4RA8A 5COYA 3LWEA 1B50A 4N9PA 2EYMA 2F4IA 1GOZA 3FDTA 3NPPA 5C4HA 2A6HD 2B2TC 1Q1EA 1QG7A 5EGTA 3GV3A 1Z47A 4K5XA 2PQEA 5EKKA 3GQBA 3VA7A 3K59A 5FOBB 1QJOA 4KD4A 2G9DA 4FXKC 1EWCA 2XNAC 5FO7B 3BVZA 1Y1WB 4C3IG 1NR4A 3M4OB 3PV0A 1CZGA 1WVLA 2K5QA 1EY4A 1SJED 2AWNA 2JEBI 1NCVA 1SNQA 1QNKA 2KUMA 2R6GA 3SHLA 3S17B 4LK1C 5JVG3 4HMIA 4XXEA 3KLSA 4WRDA 1E2VA 3D4DA 1OXUA 3PUYA 3VYTA 1JWMD 1EIGA 2CW0D 1YNNC 1RCVD 2OF1A 1BUVT 3A54A 3GV6A 1SYEA 1NR2A 1T5XD 3CRLC 4RGMA 5M5YB 1Q12A 4K5VA 5I6WA 1E2ZA 4FF3A 4RHSA 5I9PA 1F2ZA 3T53B 2JA7B 4CBVA 1SYBA 2CVRA 1Q1BA 3R2IA 4C3JG 1MSHA 1W6JA 5JEAG 1STYA 3DMUA 3WDNA 3HOUB 1PRTF 1H9JA 2RDHA 3SK4A 4K6LA 3RD4A 5BN5A 3I73A 1ET9A 4WORA 4B08A 1SMYD 4ZYSA 2EY5A 4NP5A 4ABNA 2EY1A 4PQXA 3PMFA 3NWTA 1STBA 3Q23A 5C4ZA 1I6HB 2HDLA 4X3TA 3EFXD 3LNNA 1TWHB 2M00A 3HOVB 4OGQC 3OHXC 1F77A 5M5WB 1STHA 4ZUJA 5G3LD 5IGBA 3KUPA 2BA0A 5M5XB 1JICA 3URYA 2L5TA 2EYLA 1TU2B 4Z9CB 4S3SA 2KQ3A 2LKVA 4C1NK 3C1EA 1GXDC 4HCSA 1GUSA 4BY7B 3M7GA 1AFPA 3A56A 3H3VC 2A69C 1O80A 3E6ZX 3VR4A 1DM0B 2SNSA 4FF4A 1SEBD 1A3UA 1BDOA 3U9SA 1I4QA 2JA5B 1GUOA 2WINB 1H9SA 2KEEA 1SBBB 3MAQA 4CJ2C 4NDXA 2PPBC 1HFNA 1I6VC 1K83B 1SAPA 1AP0A 3MFGA 2BE5D 4RCNA 4KK7A 1HHVA 1G6ZA 3GP7A 2B2VA 3R8BA 3NHHA 1JCKB 3MHBA 1OXTA 3MXGA 3QJYA 1LT5D 1L0YB 3T51B 5BN4A 2CHBD 5CV5A 3NTHA 1LABA 1XYIA 2XRSD 3A8IE 4HSPA 1C48A 1AEXA 5CV8A 2NB0A 3I4LA 3PIP3 4JK1C 2F0FA 2DY8A 1Y8OB 4BA1I 2EPBA 5J1ZA 2IT1A 2QEJC 5K36H 2B8FA 3Q24A 1Q90A 3DWAA 4L63B 1S4ZA 3HOWB 4EQNA 5JOBA 4GZYC 3TSSA 1GHKA 1I4PA 2PW5A 2B2UA 1AN8A 3N6RA 4KN4C 5C4XB 1G2SA 2E2IB 2X69A 4Q5VA 4BY1B 5JJZA 3M7NA 1BCPB 4UAIA 3GTKB 2R7ZB 4Y7NB 3TMEA 4OIKA 3VYUA 4A93B 1VCIA 2K03A 2L4NA 3QWNA 4KMUC 2Z4HA 1DD2A 2KCNA 4H0LC 2WIIB 1HPCA 3FEWX 3A7LA 2DNEA 4KKSA 3RZDB 3MC0B 2F0JA 5TSSA 1FR3A 2X6LA 1S5CD 2F0IA 2LMCB 1SE3A 1TS3A 4KD3A 1LTID 1ET6A 1O78A 1SJHD 3BVMA 2EOTA 3EROA 4QUCA 3KBXA 3S1RB 2R93B 1KABA 3HS0C 5IGFA 1WCMB 3J80E 1KLGD 1YNND 4HEDA 2K01A 1PFMA 1D5ZC 4O1NA 1ENAA 5J22A 3HOXB 1WTOA 5FLXE 1LTTD 3PIO3 2L1BA 1FNUA 1HA6A 4HAEA 3Q6SA 4K14A 5EQ0A 3M4YA 5K36G 4ZRZA 5IODA 1LV9A 3K6OA 3M3YB 3GO5A 1S5ED 4XTCS 4CJ1B 1PYWD 1SNDA 5FKAC 3T56B 3UI2A 1KLUD 4G4KA 1KTKA 4HCEA 1H9KA 3KLRA 1B2TA 3DXJC 2BDOA 5DM63 4ZAIA 5EBCA 3BS1A 1TY0A 4KHVA 3S9WA 1EOTA 1JORA 3TZDA 1PXUA 2O5JC 1PTOB 1PZID 1Z7TA 2EE1A 2SEBD 5G3LF 1EQVA 3VA5A 3S14B 1ILPA 4XYQA 2B2TA 1IYVA 4L8JA 1LTRD 3CU7A 4X3SA 2QCPX 3FVQA 2TSSA 4KY7A 4Q0FA 5IGDA 2XRQD 5HGTA 1EQTA 2KECA 3PUZA 2A5HA 1FGBD 4G57A 1QNUA 1TWAB 3U9OA 1IHZA 4XDXA 2NYZD 5BN3A 3T16A 2A69D 4CKEA 1S5FD 1M8AA 1GHJA 2RDFA 1TWCB 2F0WA 4IFDJ 5EPLA 1UEAB 2D5DA 1G8ZD 5KEEA 3GTGB 1XXGA 4ULLA 1PFNA 2KOLA 4H44C 1EEFD 4TSSA 1TT2A 1LT3D 1PFBA 5KGUA 3CKIB 4U673 1EZ8A 3NUCA 5EJWA 2BOSA 3TP5A 3H09A 3SXHA 1O7LA 4L6TB 2IWHA 3DEPA 5NUCA 5KNBA 2JE6I 1BQQT 4CHTB 4K8JA 3X3NA 5I6YA 2MUYA 2PZWA 2PCFB 5KIXA 2F0DA 2ICIA 3OSOA 1BO0A 3NXWA 3KK7A 4IUTA 3GD7A 2L12A 3K7AB 3D3RA 4C3IB 5C3EB 1V1PA 5I2YA 1PRTB 4H13C 1SYGA 4BBSB 3DWPA 1BR9A 3EVQA 4QF4A 5C3XA 3SK5A 1D2BA 5KNCA 4AYBB 1SNPA 5A2QL 3NTKA 1SNMA 4IUUA 3D31A 1VMPA 5CGKA 5D3IB 1WTWA 2BCOA 2F0TA 2MPMA 4RWSC 2EJMA 3K5OA 4DNRB 4RKBA 2DY7A 4XQJA 1D6EC 1GUGA 1BF4A 5I4DA 5IT9L 1SNCA 3R3OA 4NW2A 1FD7D 5EPJA 3G6JB 5F2DA 3M85A 5KYIA 4FVMA 3MFYA 1B9NA 5CV4A 1U9RA 3Q22A 3K5LA 1VF5C 2L11A 3FRPB 3HZXA 1TS5A 1KDAA 3D8GA 1ZKOA 4C3JB 3O13A 2F3VA 4WFN3 2K5WA 1D5MC 3I3CA 1CHQD 1PZJD 2F0SA 1CA5A 1XX8A 4OHJA 1C8CA 4R9WA 2RKSA 1KNAA 4FO2A 5C5MA 1RKNA 4IQZA 2D62A 3OIPA 3IFTA 5JVH3 1WTXA 2TMPA 5I9OA 4FXGC 2EXZA 1II3A 3OWEB 2FINB 3K5MA 5A35A 1F9QA 1TVXA 2K28A 3NK9A 2K33A 4YIJA 2L9HA 2F0UA 2XIWA 2PNRC 2KEDA 1J8IA 2AUKA 5IT9E 2FFKB 3KBGA 5LL6S 2OXPA 1G291 2J4XA 3C3LA 2A68C 3J81L 1RTNA 4MHEA 5C44B 1EYCA 2NTSA 3VYRA 1HQMC 2FJ2A 1LO5D 5M3MB 1SYCA 1RTOA 4QMGA 1H9RA 4KHZA 3FMCA 1WD1A 2KHSA 1JOKA 4CGYB 4MIUA 2A74C 5CMDA 5D14A 3F2UA 3BVGA 4ZLTF 4QCLA 3SK6A 2F0KA 4XQNA 4K8IA 1O7ZA 2EZVA 2AQ2B 1LACA 1UUPA 1FYCA 5E1FA 4DN4M 4RCOA 4I65A 1CA6A 5FK9C 2Q8TA 2MJ8A 2F0EA 1FNVA 3NTIA 1Y8NB 2VB2X 4J1MA 4DK0A 2B2WC 2EYFA 2F0GA 1H9SB 4KN7C 3TP6A 4V190 3S2DB 2PYKA 3MXNA 5C0XJ 1GUWA 1CT1D 4IFDH 2VXWA 1EEID 3TN2A 3BG3A 4RGNA 4DFAA 1ZYRC 3A7AB 3QG1A 2IJ0A 5JPMC 2XWBB 3JAML 5ISRA 4ME5A 2F0HA 1STGA 1DXMA 1T5EA 3T13A 1AW7A 1QOHA 3BDLA 3S1NB 3SK8A 4RFBA 4TKOB 3I4NB 1RJTA 2L55A 2C5CA 3TP8A 4F7XA 3ZYYX 4ZQ3A 4DXFA 3ITPA 5C0XI 2ICEC 1VMCA 1SXTA 1E2WA 3OOCA 1TWFB 4A3IB 2GA4B 4OIJA 4A3KB 2K05A 5D65A 2I07B 3I8ZA 1MBYA 3CRKC 2F0PA 2RBMA 2RA4A 3BDCA 4FYDA 2E2DC 4RAUC 2B2YC 3I70A 4A3MB 1A3VA 3NWSA 3I4MB 3SVMA 2WACA 2CQAA 1ML0D 5JEAJ 3LWUA 5E4WC 3QO2A 1XTCD 2MP1A 5CORA 2HCIA 4NKLA 3MTSA 1RODA 3RMHA 4PMWA 4XT3B 3NBHA 1EFID 1BXTA 1HTLD 4U68A 1WTVA 1EY5A 4IFDG 1TKWB 4X3UA 2M9VA 3VR3A 3W3AA 2QKIC 1AZQA 1EZ6A 4K6DA 3WOFA 2K5DA 3SEBA 4RKLA 4K2KA 3J7AF 3L9AX 1X32A 4F8MA 1D1KA 1SDFA 3OWFA 1VF7A 2JYOA 1GJXA 1MI2A 1LTBD 1I4GA 2AUJD 1WTRA 2MHVA 4A3DB 5CV9A 1BOSA 3A8JE 1A15A 5D3DA 4ID6A 5E4XA 1SNOA 2YYZA 3NE5B 3X3MA 1K8MA 1F9PA 1EYDA 2VUMB 2B63B 1MD2D 3Q0AA 3HOZB 1EWHA 2X6GA 3HKZB 4BA2I 1I4HA 2L0CA 3D6CA 5C5LA 1PLFA 4HMJA 3GTPB 2KJXA 4C3HG 2NUCA 4OO1H 2R3ZA 4KV6A 5DEHA 1EIHA 1C4QA 2A68D 4FF2A 1U4LA 2HCCA 1L0XB 1IW7C 2Q8IB 2ZXOA 1ENCA 2Z8LA 1DOLA 3SDZA 4E6IA 2AWOA 3MXPA 1TY2A 1B9MA 2ID0A 2A6EC 1CTMA 1TWGB 5ELCA 1IYUA 1X3PA 1ESRA 1BCPC 3FPUB 2NBFA 5C3WA 2F03A 1V1OA 3FPPA 2WP8J 1WTPA 5EPKA 4A3EB 3K57A 1V8QA 1J9OA 1I3QB 4FF1A 3H91A 3K58A 2RQXA 4KI0A 2EJFC 4X3KA 1A2UA 4IUVA 1HA5A 3HRZC 1KDBA 1OXSC 1KNEA 2JA8B 4XT1B 1ILQA 4BS9A 5C0XH 3OPOA 1HUNA 4ZK9B 1ENFA 3DEOA 4IUQA 2LS01 1JWSD 2K6AA 1RHPA 1ZYRD 3FKIB 4R8IA 2IPKD 2Y0SB 1DOKA 4R8NA 1Z6HA 2RSOA 3ND9A 3OMGA 2SNMA 5ELFA 5ELBA 4C1NI 5T1IA 2OT2A 4FP5D 1A3TA 3S1MB 4IFDI 4ILWA 2KA7A 1F2YA 3PO3B 3S1QB 1V1PB 2KCCA 2ENBA 5KNDA 5EBDA 4BBRB 2H4OA 1ESFA 3W2DA 2DN8A 5KRUA 2AQ3B 4IZ8A 2D9UA 5J39A 2J7ZA 3H94A 1EU4A 1EY7A 3C1FA 3MEHA 2IX3A 2N55A 2QILA 5M9OA 3LX0A 1A6XA 2WB1B 4DGZA 4ZUIA 4I7ZC 3I72A 4LAAA 3NP8A 2HQEA 4N9TA 3P1HA 1HFGA 1K8OA 1S5BD 2E2HB 1KDCA 5JEAH 1B1ZA 1EU3A 4XIGS 1A2TA 2D2CC 1PTOC 1Y69U 1IL8A 1QE6A 3VR5A 3OMCA 4HR7B 5C6AA 1YNJC 1GUNA 1JOOA 2LY7A 1HCZA 3H0GB 3GTOB 2JSOA 2B2WA 5C0XG 2EYJA 2MGSA 3K0YA 3IAYA 5T1GA 1R9TB 1NUCA 1SSOA 2J0TD 2NN6I 2NVXB 1PMRA 3GTQB 4F88A 1PZKD 5LHY1 4B9WA 1CHPD 2HDMA 1G91A 2QDBA 3L7ZC 5C4JB 4NMZA 4DXGA 3BDOA 5A2QE 4DAPA 1EY0A 3HP3A 2AQ1B 3C2PA 1LT4D 1EYAA 2XSCA 1BBXC 4KJNA 3J7YW 1D5XC 3GTLB 4IN3A 4RH6A 4BWGB 4DA2A 3P7JA 1VDZA 2F0MA 1XWEA 2C9OA 1JB3A 4QIWB 5FO9B 2E74C 2F0LA 4IALA 4EGVA 4XYOA 2ZXPA 3QOLA 2O4XA 2F1MA 3H6MA 3E0JA 1IW7D 2B2YA 3HEJA 5DM73 2JP1A 3QIAA 3L3OC 3VR2A 1PRTC 3AB9A 1B44D 2SOBA 1E0BA 5HURA 2FMCA 2FMMA 4DF7A 1FNWA 5IGCA 1BNZA 1JOQA 2A6ED 5ELEA 1UAPA 4OO1I 3DUZA 2VB3X 4ODGA 1BCPD 3GTMB 2NTTA 3A8KE 2PO4A 3QB3A 1OXXK 4KY5A 2EYHA 2WKCA 3D4WA 1B4OA 3R2TA 2NWGA 2R92B 3DHQA 3P20A 3D4RA 1JWUD 2VNUD 3KF8A 4HSVA 4ZKBB 1MGSA 4CKCA 1I50B 1EL0A 2K7VA 5CBAE 2JA6B 4RGOS 3HOYB 2PZUA 1TR5A 2I46A 2HUGA 4EQOA 1ONLA 2O2LD 4M1UB 1F9SA 2JEAI 3J81E 3C46A 1EY9A 3R93A 1F2LA 1QCBD 1B3AA 2EJGC 3IL8A 4QUFA 3MA2B 4PNYA 2Q8RE 3TDQA 1CQFA 1GUTA 3V05A 1CZWA 3IKJA 5K5PA 1NAPA 3HG9A 3AMUA 1STAA 1LT6D 2F0QA 2LFNA 5IIFA 2PZTA 3DWQA 4KKTA 3BYTB 4FXDA 2IL8A 3MVVA 1LTGD 2XVSA 1RF2D 1H9MA 3S15B 3TZUA 2IW3A 3BYYB 1U4RA 4HTHA 5I2XA 1WTQA 3J80L 1V43A 1R4QB 1RD9D 2A73B 1WD0A 1UNSA 2PMZB 4LMQD 5AFWA 1U4PA 1TS2A 3E5SA 1CQVA 1JR0D 1D1IA 4HN7A 5JPNC 5FLXL 2XN9C 3K5NA 1IKMA 2QF7A 4MN3A 4IUNA 4CJ0B 3MWYW 3CQZB 3ERQA 3IFDA 4TRDA 3J7AV 2NN6H 3WOEA 3SR1A 4K2LA 1RDPD 2EDGA 3DM1A 1IKLA 2ZXRA 3P75A 2A6HC 1JE4A 5KYLA 1QWYA 1KAAA 1PTOD 5CR3A 3D6WA 3SE0A 3TBIB 1Q3LA 1YNJD 4F87A 3RLFA 2SDFA 2EY6A 3JAME 3GTJB 1JC7A 2Z4IA 1ZEQX 1DJRD 1CM9A 3TP7A 5CBEE 2EY2A 2NVTB 3VR6A 3I90A 4DU9A 4EQPA 1Y1VB 3EQLC 5CYUA 1OO9B 2IX0A 1QB5D 1JQYD 2WV6D 3N52A 4G7HC 2NVYB 3BZDB 2EYPA 4C3HB 3MXUA 1I4RA 1LLRD 4DAYA 4A3FB 1ICWA 3S16B 2JXMB 1M4VA 3A55A 1STNA 2Z1CA 2E2JB 1EY6A 2CW0C 4B9XA 1PTOH 5CC4A 1OXVA 4DNTB 2F3WA 5M3FB 2YU9B 3T4AC 1W6KA 2RDGA 1CK1A 3NQTA 2B2VC 4PMCA 5DNFA 2EVBA 3CHBD 4M8AA 3QOJA 3NQIA 1HXYD 5IOCA 2KVMA 5CV6A 2NVQB 2M2LA 3MZ5A 1B53A 1TIID 4OL7A 5DAUA 3PUWA 4PV1C 5LL6X 2WAQB 4ZKCB 1STEA 2F0OA 1U4MA 4EVOA 4UDUC 3RZOB 1CFMA 1TS4A 2NN6G 4RGTA 2V4DA 2OEOA 5IGEA 2N88A 1LTAD 4KKUA 1NSNS 5FO8B 4WJWA 1SMYC 2B2UC 1SE4A 1F2MA 5EKIA 1BCPF 4TQUS 1PRTD 3EA6A 5CV7A 4DAVA 1Y8PB 1SFOB 4G7ZC 1SYDA 4A3BB 1ZXTA 3PUXA 2R61A 3PUVA 2PW7A 5E3FA 5EKLA 5ELDA 4A3GB 5IGGA 3VYSA 4QB4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O4X A;  1KDB A;  1A3U A;  4KHV A;  1TQO A;  2EYP A;  4KY6 A;  5IGB A;  3S9W A;  3OMC A;  3D8G A;  1STA A;  2F0V A;  3H6M A;  4K5V A;  5C6A A;  2F0Q A;  1JOR A;  5NUC A;  3EJI A;  1JOO A;  5I6W A;  2F0P A;  2F0J A;  2F3V A;  3HEJ A;  2F0N A;  2RBM A;  4K8J A;  2PZT A;  5IIF A;  4J6H A;  3BDC A;  4NDX A;  4PMB A;  5E1F A;  5I6Y A;  1STN A;  2PZW A;  3D6C A;  3MVV A;  5C5L A;  4I65 A;  5I9P A;  1F2Z A;  2F0I A;  1A3V A;  1EQV A;  3VA5 A;  5KIX A;  1EY6 A;  2F0E A;  2WAC A;  4B9X A;  4HMJ A;  2F0D A;  2F0S A;  2SOB A;  4KD3 A;  4N9P A;  5CC4 A;  2EYJ A;  1SYB A;  2EYM A;  3OSO A;  5IGD A;  5JAV A;  4J1M A;  2NUC A;  5HUR A;  3NXW A;  4KV6 A;  5C4H A;  2F3W A;  2EYF A;  4HTH A;  5DEH A;  4R8N A;  4DF7 A;  2F0G A;  5IGC A;  1JOQ A;  2EYO A;  2RKS A;  3NHH A;  3TP6 A;  3ERO A;  5EGT A;  5C5M A;  1RKN A;  3MHB A;  1NUC A;  3NQT A;  4NKL A;  1STY A;  3DMU A;  4K5X A;  4PMC A;  2PQE A;  5EKK A;  1SYG A;  4ODG A;  3SK4 A;  3V2T A;  5I9O A;  2PYK A;  3EVQ A;  3QOJ A;  1KAB A;  3QB3 A;  5CV5 A;  3OMG A;  4QF4 A;  5IOC A;  5IGF A;  5C3X A;  4KY5 A;  2EXZ A;  2EYH A;  1II3 A;  2SNM A;  3D4W A;  4KY7 A;  5CV6 A;  3E5S A;  1SNP A;  4KD4 A;  3SK5 A;  4WOR A;  5HGT A;  3MZ5 A;  2EY5 A;  4NP5 A;  1SNM A;  3NK9 A;  4B9W A;  1A3T A;  1AEX A;  5CV8 A;  3DHQ A;  2EY1 A;  4IUN A;  4OL7 A;  4H7B A;  2QDB A;  4G57 A;  3PMF A;  4YIJ A;  5DAU A;  2F0F A;  3ERQ A;  1EY5 A;  1STB A;  1ENC A;  2F0U A;  1F2Y A;  3RUZ A;  5CGK A;  5C4Z A;  4TRD A;  4DFA A;  4NMZ A;  1ENA A;  2ENB A;  5J1Z A;  4E6I A;  3SR1 A;  4K2L A;  1EY4 A;  3U9O A;  1IHZ A;  5J22 A;  2F0O A;  4EVO A;  2F0T A;  3MXP A;  4KTA A;  3SXH A;  1EY0 A;  3P75 A;  2M00 A;  4RKB A;  2OXP A;  5KYL A;  3T16 A;  5ISR A;  5KRU A;  1EZ6 A;  1KAA A;  4IZ8 A;  4ME5 A;  1SNQ A;  2F0H A;  4K14 A;  1STG A;  1EYA A;  1STH A;  4K6D A;  5CR3 A;  4KJO A;  4ZUJ A;  5J39 A;  1EYC A;  1SYF A;  2RDF A;  2PZU A;  3T13 A;  4EQN A;  2F0W A;  1TR5 A;  1EY7 A;  2OEO A;  3C1F A;  4K2K A;  4KJN A;  3MEH A;  4RKL A;  5JOB A;  3SHL A;  5IGE A;  1SNC A;  5M9O A;  2PW5 A;  3LX0 A;  3R3O A;  3BDL A;  1SYC A;  5IOD A;  4HMI A;  2EY6 A;  4EQO A;  4F8M A;  5C3W A;  4WRD A;  3SK8 A;  4DGZ A;  3D4D A;  2EYL A;  4QMG A;  3OWF A;  1NSN S;  5KEE A;  2F0M A;  4S3S A;  2KHS A;  1JOK A;  3TP7 A;  5F2D A;  4ZUI A;  1SND A;  4MIU A;  2EY2 A;  4K5W A;  3TP8 A;  1EY9 A;  1F2M A;  4LAA A;  5KYI A;  4DU9 A;  4F7X A;  3NP8 A;  2HQE A;  2KQ3 A;  4EQP A;  5CV9 A;  3TME A;  1TT2 A;  4N9T A;  3P1H A;  4ZQ3 A;  2OF1 A;  5CV7 A;  5CV4 A;  5KGU A;  4ID6 A;  3ITP A;  2F0L A;  2LKV A;  1U9R A;  1SYD A;  3SK6 A;  3C1E A;  4IAL A;  1SNO A;  1EZ8 A;  2PW7 A;  3NUC A;  1EY8 A;  1SYE A;  1KDC A;  4PNY A;  1A2U A;  5E3F A;  2F0K A;  5EKL A;  1A2T A;  3QOL A;  5IGG A;  4K8I A;  1EYD A;  3HZX A;  3TP5 A;  4QB4 A;  1KDA A;  5K5P A;  2SNS A; 
#chains in the Genus database with same CATH topology
 1FL0 A;  1XMQ Q;  3ND8 A;  2NZ1 D;  1HQR D;  1X3E A;  1PH1 A;  4KY6 A;  3V96 A;  1O7I A;  1AH9 A;  2E75 C;  4JBM A;  3BZC A;  2DNC A;  3U4Z A;  4JV5 Q;  3NBI A;  5IYB G;  1G2T A;  2H1E A;  1PV4 A;  1LTS D;  1PH8 A;  3KJP A;  3G7L A;  3I91 A;  4LJZ C;  3K0X A;  5JAV A;  3KLS X;  4C56 C;  2ASB A;  3CCM A;  1AZP A;  4NXN Q;  2EYO A;  3S1M H;  4CDD C;  1DON A;  2WKD A;  2BA1 A;  4IUR A;  1O7Y A;  3V2T A;  1R4P B;  3K7A H;  4BBR H;  4C3I H;  5C3E H;  1HUM A;  2K32 A;  1QIL A;  4CKB A;  2E76 C;  2K04 A;  4DUZ Q;  2O5I C;  4DV5 L;  1I4X A;  4V0B A;  1PH5 A;  4A3J B;  4BBS H;  3S24 A;  4G7O C;  4H7B A;  2PI2 A;  3RUZ A;  2MO0 A;  2IX1 A;  2FHT A;  4R4Q A;  1HRJ A;  2B8G A;  1VQ8 A;  4J8Q A;  2G9H D;  1DZ1 A;  3OIQ A;  2BE5 C;  4ALP A;  4KTA A;  2ZT9 C;  4FNF A;  4KLK A;  4OO1 G;  1PH2 A;  3F2C A;  3NSW A;  4HIM A;  4KJO A;  1SYF A;  2R7F A;  4RHR A;  4JBW A;  4LUV A;  3AU7 A;  2B39 A;  2ALY B;  1DYQ A;  4DK1 A;  1Q8I A;  3HGB A;  4QY7 A;  3PO2 B;  1EUJ A;  4K5W A;  2K1B A;  4C2M B;  2VQF L;  1HTP A;  4DR7 L;  4B3R L;  5IT9 c;  1N33 L;  1F9R A;  2RVL A;  4XQQ A;  4ME3 A;  1PVO A;  1EY8 A;  1SE2 A;  4YHH Q;  2XWJ B;  3GTO H;  4P2C B;  1MSG A;  2RSN A;  2PQA A;  1TQO A;  4R4O A;  1DOM A;  4OXP A;  3ONA B;  1BBW A;  4DV2 L;  2F0V A;  3ERS X;  1PDQ A;  3ULL A;  4IUP A;  1CI3 M;  1QVC A;  2RCF A;  3EJI A;  4O42 A;  2BDN A;  2CWA A;  1U5K A;  1X3Q A;  2F0N A;  3EBE A;  3OW7 A;  4J6H A;  1VQN A;  4PMB A;  1S5D D;  1K73 C;  1PTO F;  3AFP A;  1DCZ A;  3S2H B;  4C3J H;  4RA8 A;  4O2D A;  5COY A;  3LWE A;  3CPW A;  3ICE A;  1B50 A;  2VQE L;  1K3R A;  4N9P A;  2EYM A;  2F4I A;  1GOZ A;  3FDT A;  3NPP A;  5C4H A;  2QGQ A;  4JI5 Q;  3E9H A;  4IJH A;  3OYY A;  2A6H D;  1E24 A;  2B2T C;  2NZH A;  1Q1E A;  1QG7 A;  5EGT A;  1HNX Q;  3GV3 A;  4B3S L;  1Z47 A;  4K5X A;  2PQE A;  5EKK A;  3GQB A;  3UDI A;  2F3I A;  3VA7 A;  3K59 A;  5FOB B;  1QJO A;  4JI1 L;  4KD4 A;  2G9D A;  4FXK C;  1GO3 E;  2CH4 W;  3CCQ A;  1EWC A;  2XNA C;  5FO7 B;  3BVZ A;  1Y1W B;  5HGQ A;  4C3I G;  5C3E G;  1NR4 A;  3M4O B;  3PV0 A;  3GTL H;  3CME A;  1CZG A;  1H95 A;  1WVL A;  2K5Q A;  1EY4 A;  4BBS G;  1SJE D;  2L15 A;  4B3T Q;  2AWN A;  2JEB I;  1NCV A;  4LF9 L;  4AYB G;  4WJ3 M;  1SNQ A;  4CDF C;  1QNK A;  2KUM A;  2R6G A;  2Q2T A;  4LFA Q;  3HKS A;  3SHL A;  3S17 B;  4LK1 C;  4JW0 A;  5JVG 3;  4HMI A;  4XXE A;  3KLS A;  4WRD A;  4GOP C;  5C44 H;  3UE0 A;  1E2V A;  3D4D A;  1VQC A;  4LUO A;  3CCS A;  1OXU A;  3PUY A;  3VYT A;  2VW9 A;  5M3M H;  1JWM D;  3W5O A;  3NEM A;  1EIG A;  2CW0 D;  1YNN C;  3UE1 A;  4FDB A;  3J81 c;  1RCV D;  2OF1 A;  1BUV T;  4DV7 Q;  3A54 A;  4YWK A;  1K28 A;  3GV6 A;  3STB C;  1SYE A;  1NR2 A;  4DAM A;  2AKW B;  4JOI A;  1T5X D;  3CRL C;  4KHP L;  3M9B A;  1KHI A;  3HKZ E;  1D8L A;  1WYD A;  4RGM A;  1X54 A;  1KL9 A;  5M5Y B;  4LF8 L;  1Q12 A;  5LMU Q;  1VQK A;  4K5V A;  1UEB A;  5I6W A;  3Q8D A;  1K8G A;  3I7F A;  1E2Z A;  4FF3 A;  1XNR Q;  4RHS A;  1HNZ L;  5I9P A;  1F2Z A;  1S40 A;  2F52 A;  3T53 B;  3LGJ A;  2JA7 B;  2GVB A;  5GQO A;  1B7Y B;  3CMA A;  4CBV A;  1SYB A;  2CVR A;  1Q1B A;  4MNO A;  3R2I A;  5GRO A;  4C3J G;  1MSH A;  3I55 A;  2R92 H;  1W6J A;  3F2D A;  1UE7 A;  5JEA G;  1STY A;  3DMU A;  3WDN A;  3HOU B;  1PRT F;  1H9J A;  2RDH A;  3SK4 A;  4K6L A;  3RD4 A;  1KXL A;  5BN5 A;  3I73 A;  1ET9 A;  3S2D H;  1I94 Q;  2Z6K C;  4WOR A;  4B08 A;  1SMY D;  4ZYS A;  2EY5 A;  4NP5 A;  1W3S A;  4ABN A;  2EY1 A;  4PQX A;  3PMF A;  3NWT A;  1STB A;  3Q23 A;  5C4Z A;  1I6H B;  1XJV A;  2HDL A;  2UUC L;  4LF4 Q;  4X3T A;  3EFX D;  3LNN A;  3DLL A;  1TWH B;  2M00 A;  1KQS A;  3HOV B;  4OGQ C;  3OHX C;  1F77 A;  5M5W B;  1STH A;  4ZUJ A;  1NE3 A;  4NB3 A;  5G3L D;  4JG2 A;  1ASY A;  5IGB A;  3KUP A;  2BA0 A;  5M5X B;  5EAY A;  1HH2 P;  5GAD C;  1JIC A;  3URY A;  3KF8 B;  3AYH B;  2L5T A;  2EYL A;  1TU2 B;  4Z9C B;  4S3S A;  4O0A A;  3JAM c;  3S1N H;  1L1O B;  1IZ6 A;  1UE5 A;  2KQ3 A;  3I4N H;  3FP9 A;  5C44 G;  4GN5 A;  2LKV A;  4C1N K;  3C1E A;  5M3M G;  1GXD C;  4HCS A;  4A4I A;  1GUS A;  4BY7 B;  3M7G A;  4LW1 A;  1NMG A;  1AFP A;  3A56 A;  3H3V C;  2A69 C;  1O80 A;  2CH4 A;  3E6Z X;  3VR4 A;  1DM0 B;  2SNS A;  4FF4 A;  1SEB D;  4GKJ L;  1A3U A;  2B3G A;  1BDO A;  3U9S A;  1I4Q A;  4DV5 Q;  2JA5 B;  1GUO A;  2WIN B;  3RR5 A;  1H9S A;  3ZJY C;  2KEE A;  1TWF H;  4A3I H;  1SBB B;  3MAQ A;  4CJ2 C;  4NDX A;  2Y0S E;  4A3K H;  1HR0 L;  2PPB C;  3IRB A;  2A19 A;  1HFN A;  1I6V C;  1K83 B;  4DV3 L;  2DJG C;  1SAP A;  1AP0 A;  3MFG A;  2BE5 D;  4RCN A;  4JI8 Q;  4KK7 A;  4GNX A;  1HHV A;  1G6Z A;  3GP7 A;  3I4M H;  2B2V A;  3R8B A;  3NHH A;  4R4T A;  4IOA A;  5IP7 H;  1JCK B;  3MHB A;  1OXT A;  3QJY A;  3MXG A;  1LT5 D;  2GN5 A;  1L0Y B;  3T51 B;  5BN4 A;  2UXD L;  2CHB D;  5CV5 A;  3NTH A;  1LAB A;  1XYI A;  2XRS D;  3A8I E;  4HSP A;  1C48 A;  2VQF Q;  1AEX A;  3PQI A;  5CV8 A;  1EIY B;  2NB0 A;  3I4L A;  3PIP 3;  4B3R Q;  4JK1 C;  2F0F A;  2DY8 A;  1N33 Q;  1Y8O B;  4MTN A;  4BA1 I;  4YCW A;  1S72 A;  2EPB A;  5J1Z A;  1HZ9 A;  3E3X A;  2IT1 A;  4AYB E;  2K14 A;  3SGI A;  1N34 L;  2QEJ C;  5K36 H;  2A8V A;  2B8F A;  3Q24 A;  1Q90 A;  4RG1 A;  3DWA A;  4L63 B;  1S4Z A;  3HOW B;  4EQN A;  1Y1V H;  5JOB A;  4GZY C;  4JI3 L;  3TSS A;  1GHK A;  1I4P A;  2PW5 A;  3J80 i;  4DV1 L;  2B2U A;  1AN8 A;  3N6R A;  4KN4 C;  5C4X B;  4X6A H;  1G2S A;  1K0R A;  2YTY A;  2E2I B;  2X69 A;  4Q5V A;  1JE5 A;  4BY1 B;  5JJZ A;  3M7N A;  1BCP B;  5FLM H;  4UAI A;  4C3H H;  3GTK B;  5H1S E;  2R7Z B;  4Y7N B;  3TME A;  4OIK A;  3VYU A;  3CCV A;  4A93 B;  1VCI A;  2K03 A;  2L4N A;  3QWN A;  4KMU C;  1X9N A;  4A3D H;  2Z4H A;  1W2B A;  1DD2 A;  2IHE A;  3CF5 A;  2KCN A;  4H0L C;  2WII B;  1HPC A;  3I4N G;  3FEW X;  4L5T A;  4JI1 Q;  4JI2 L;  1A8V A;  3A7L A;  2UUB L;  4L5R C;  3BU2 A;  2DNE A;  4KKS A;  1BBU A;  2VUM H;  3RZD B;  2K75 A;  3MC0 B;  1Z9F A;  2B63 H;  2F0J A;  1YHQ A;  5TSS A;  5JJK A;  1FR3 A;  2X6L A;  1L0W A;  3HOZ H;  1S5C D;  2F0I A;  2LMC B;  1SE3 A;  4ZCK A;  1TS3 A;  1Q82 C;  4LF9 Q;  4KD3 A;  1LTI D;  4A3I G;  4DAY B;  2QW7 A;  4A3K G;  3WWV A;  1ET6 A;  1O78 A;  1SJH D;  3BVM A;  2EOT A;  3GTP H;  3ERO A;  4QUC A;  1D7Q A;  3KDF A;  3AEV A;  3KBX A;  3CC4 A;  3CW2 C;  2ZM6 L;  1UE1 A;  3S1R B;  4A3M G;  4LNQ A;  2IY5 B;  4R4I A;  3PIO A;  2R93 B;  1KAB A;  3I4M G;  1B3Q A;  3HS0 C;  5IGF A;  1WCM B;  5IP7 G;  3J80 E;  1KLG D;  3CCJ A;  5IP9 H;  1YNN D;  2BH2 A;  4HED A;  2K01 A;  1PFM A;  1D5Z C;  4O1N A;  1ENA A;  2E5L L;  4TVA B;  1SLJ A;  5J22 A;  3HOX B;  1OTC A;  3STB D;  4KHP Q;  3CAM A;  1WTO A;  5FLX E;  1LTT D;  4LFB L;  3PIO 3;  2L1B A;  1FNU A;  4X64 L;  4LF8 Q;  1HA6 A;  4HAE A;  3Q6S A;  4DPG A;  4K14 A;  5EQ0 A;  1LTL A;  1SRU A;  5ELO A;  3M4Y A;  1FVI A;  1YJN A;  2CQO A;  5K36 G;  1EWI A;  4ZRZ A;  1TWG H;  1CSP A;  2OCE A;  5IOD A;  1MJE A;  3T1H L;  1HNZ Q;  1LV9 A;  1VQ6 A;  3K6O A;  3M3Y B;  4N8X 1;  4A3G H;  3GO5 A;  1S5E D;  2ZJP A;  3TS0 A;  4XTC S;  4CJ1 B;  1PYW D;  1SND A;  5FKA C;  4HJ7 A;  4L5Q A;  3T56 B;  3UI2 A;  1KLU D;  1YHA A;  4G4K A;  1S3O A;  1KTK A;  4HCE A;  1H9K A;  3KLR A;  4UY8 C;  4QJF A;  1B2T A;  3KYH C;  4JI6 L;  3DXJ C;  2BDO A;  5DM6 3;  4ZAI A;  1LM0 A;  5EBC A;  3BS1 A;  1TY0 A;  4POG A;  3E0E A;  4KHV A;  4YWL A;  1EOT A;  3S9W A;  4JYA L;  4R1J A;  4A3D G;  2HT1 A;  1JOR A;  4CDC C;  1I94 L;  2RHS B;  5GAG C;  3TZD A;  1EYG A;  1PXU A;  2O5J C;  1PTO B;  1E1T A;  2JA8 H;  4P73 A;  2UUC Q;  1PZI D;  2RHQ B;  1Z7T A;  2EE1 A;  2SEB D;  2WFW A;  5G3L F;  2VUM G;  1EQV A;  3VA5 A;  1VQA A;  3S14 B;  1ILP A;  2B63 G;  1C0A A;  4XYQ A;  2B2T A;  1IYV A;  4L8J A;  3HOZ G;  1LTR D;  3CU7 A;  4X3S A;  1LYL A;  2QCP X;  3FKI H;  3HKZ G;  4DR4 L;  5IYC H;  3FVQ A;  1WI5 A;  3CXC A;  3K81 C;  3CPF A;  2TSS A;  4KY7 A;  4Q0F A;  5IGD A;  2XRQ D;  2UU9 Q;  2KBN A;  5HGT A;  1EQT A;  2JN4 A;  1G6P A;  4LF5 Q;  2KEC A;  3OW2 A;  3PUZ A;  2A5H A;  3ULP A;  2HHH Q;  1FGB D;  4G57 A;  1QNU A;  1TWA B;  1YHB A;  3RN5 A;  4YY3 L;  3U9O A;  1IHZ A;  4DR3 L;  2HQL A;  3PO3 H;  4GKJ Q;  3S1Q H;  4XDX A;  1M90 C;  1EFW A;  3PF5 A;  2NYZ D;  5BN3 A;  3T16 A;  4X66 L;  2A69 D;  4CKE A;  1S5F D;  1M8A A;  1GHJ A;  2RDF A;  1TWC B;  4GOP A;  2F0W A;  4IFD J;  1CSQ A;  4J15 A;  4CDE C;  1VQ5 A;  1HR0 Q;  5EPL A;  1UEA B;  1K3B C;  2D5D A;  1G8Z D;  5KEE A;  3GTG B;  1XXG A;  4DV3 Q;  4ULL A;  1PFN A;  2KOL A;  4H44 C;  4MZ9 A;  1EEF D;  4TSS A;  4JI4 L;  1TT2 A;  2B29 A;  1LT3 D;  1PFB A;  5KGU A;  4Y52 H;  4JI8 L;  3CKI B;  4U67 3;  1EZ8 A;  3NUC A;  1VQP A;  5EJW A;  2BOS A;  2UXD Q;  3S2H H;  3TP5 A;  3H09 A;  3SXH A;  1PH9 A;  2E2H H;  1O7L A;  2Z9H A;  4L6T B;  1GKH A;  2IWH A;  1CKM A;  4A3E G;  2V1C C;  3DEP A;  5NUC A;  5KNB A;  2JE6 I;  3RLO A;  1BQQ T;  4CHT B;  4UPA A;  4K8J A;  2VL6 A;  4A3C H;  3X3N A;  5I6Y A;  2MUY A;  2MQH A;  2PZW A;  1Q81 C;  2JK8 A;  1N34 Q;  2PCF B;  5KIX A;  3F2B A;  3H3V H;  2VY3 A;  2F0D A;  2PQA B;  1GD7 A;  2ICI A;  3H0G H;  3OSO A;  2JA8 G;  1BO0 A;  3NXW A;  3KK7 A;  4IUT A;  3GD7 A;  2L12 A;  3K7A B;  3D3R A;  2OTL A;  4C3I B;  5C3E B;  4JI3 Q;  3B6Y A;  3UDG A;  1V1P A;  4DV1 Q;  5I2Y A;  1PRT B;  4H13 C;  1SYG A;  1R9T H;  4BBS B;  2Z6K A;  1BR9 A;  3DWP A;  1E1O A;  3EVQ A;  2MNA A;  4QF4 A;  5C3X A;  3SK5 A;  3FKI G;  3KOJ A;  1D2B A;  5KNC A;  4AYB B;  1SNP A;  5IYC G;  3NTK A;  2PNH A;  3PSI A;  5A2Q L;  2NVX H;  4LFC Q;  2Y0S G;  3GTQ H;  1SNM A;  4IUU A;  3D31 A;  1VMP A;  3KFU A;  5CGK A;  4PZ6 A;  5D3I B;  1WTW A;  2BCO A;  4RMF A;  1VQ9 A;  2RF4 A;  2F0T A;  5C4J H;  4LF6 L;  2MPM A;  4RWS C;  2EJM A;  3K5O A;  4DNR B;  4JI2 Q;  4OWT B;  4P74 A;  4RKB A;  2UUB Q;  2DY7 A;  1YIT A;  4XQJ A;  5LMN L;  1D6E C;  4B3M L;  1GUG A;  4YCV A;  1BF4 A;  5I4D A;  5IT9 L;  3PO3 G;  1SNC A;  3R3O A;  4A75 A;  1M1K C;  2GVA A;  4NW2 A;  4BBR G;  1FD7 D;  5EPJ A;  3G6J B;  5F2D A;  3M85 A;  5KYI A;  4FVM A;  3MFY A;  2LSS A;  1B9N A;  5CV4 A;  1U9R A;  3Q22 A;  3K5L A;  1VQH A;  2ZM6 Q;  2WB1 G;  4DK3 C;  1VF5 C;  2L11 A;  4YWM A;  3FRP B;  3HZX A;  1TS5 A;  1KDA A;  1SE8 A;  3D8G A;  1ZKO A;  4C3J B;  4WJ4 A;  3O13 A;  2F3V A;  4WFN 3;  4I7A A;  4DR1 L;  1GVP A;  4UP9 A;  3DM3 A;  1JJC B;  2K5W A;  2E5L Q;  1D5M C;  3I3C A;  1CHQ D;  1PZJ D;  2F0S A;  4LFB Q;  4X64 Q;  1CA5 A;  1XX8 A;  2BH8 A;  4OHJ A;  1C8C A;  1V1Q A;  4JVZ A;  4R9W A;  2RKS A;  4GLA C;  1KNA A;  4FO2 A;  5C5M A;  1RKN A;  4IQZ A;  2D62 A;  3A5Z B;  3H0G G;  3IFT A;  3OIP A;  2UUA L;  5JVH 3;  3T1H Q;  1WTX A;  2TMP A;  5I9O A;  4PZ8 A;  3JC6 6;  4FXG C;  2EXZ A;  1II3 A;  3OWE B;  2FIN B;  1TWH H;  3K5M A;  2WAQ E;  4MTK A;  5A35 A;  2ZTD A;  3GTM H;  1F9Q A;  1TVX A;  2K28 A;  3NK9 A;  2K33 A;  1XPO A;  4YIJ A;  1N36 L;  2L9H A;  2F0U A;  2XIW A;  2EXD A;  4JI6 Q;  2PNR C;  2ES2 A;  2E8G A;  2XTI A;  4POF A;  2KED A;  1EOV A;  1J8I A;  2AUK A;  5IT9 E;  4NPS A;  2FFK B;  3KBG A;  5LL6 S;  4JYA Q;  2OXP A;  1IL2 A;  3F1Z A;  1G29 1;  2J4X A;  3C3L A;  2Q2U A;  2A68 C;  2OQK A;  5HY6 A;  3J81 L;  3K7U C;  1RTN A;  4MHE A;  5C44 B;  1EYC A;  2NTS A;  3VYR A;  1HQM C;  1I50 H;  2FJ2 A;  3L0O A;  4HIK A;  4EX5 A;  1LO5 D;  2JA6 H;  5M3M B;  1SYC A;  3EIV A;  1J5E Q;  1RTO A;  3HOY H;  2VS1 A;  3NEL A;  3W1G A;  4QMG A;  2UXB L;  1H9R A;  3I2Z A;  1IBL L;  3PGZ A;  4KHZ A;  3FMC A;  1WD1 A;  2KHS A;  1JOK A;  4CGY B;  2HIX A;  4MIU A;  5GAH C;  2A74 C;  5CMD A;  5D14 A;  3F2U A;  3BVG A;  4DR4 Q;  4ZLT F;  4QCL A;  3SK6 A;  2F0K A;  4XQN A;  4K8I A;  5ELN A;  1O7Z A;  4UHV A;  2EZV A;  1SN8 A;  2AQ2 B;  1LAC A;  1UUP A;  1FYC A;  2UU9 L;  2CCZ A;  5E1F A;  4QL5 A;  4YY3 Q;  2C35 B;  4LF5 L;  2HHH L;  4DN4 M;  4RCO A;  4I65 A;  1CA6 A;  4DR3 Q;  5FK9 C;  2Q8T A;  2MJ8 A;  1EQR A;  2F0E A;  1FNV A;  3NTI A;  4DR2 L;  1Y8N B;  1YNX A;  2VB2 X;  4X66 Q;  4J1M A;  4DK0 A;  2EQS A;  2B2W C;  2EYF A;  3BZK A;  2F0G A;  1H9S B;  4JI0 L;  1JT8 A;  4KN7 C;  3TP6 A;  2N78 A;  4IPC A;  4V19 0;  3S15 H;  3S2D B;  2PYK A;  3MXN A;  5C0X J;  1GUW A;  4DKA C;  1CT1 D;  4IFD H;  2VXW A;  4GNX B;  1UWV A;  4JI4 Q;  1EEI D;  3TN2 A;  3J80 c;  3BG3 A;  3J7A 5;  1Q8K A;  4RGN A;  4DFA A;  1KD1 C;  1VQO A;  1ZYR C;  3CQZ H;  3A7A B;  3QG1 A;  4IPH A;  2IJ0 A;  5JPM C;  2XWB B;  3JAM L;  5ISR A;  1QVG A;  4ME5 A;  4UP8 A;  2F0H A;  5FLX c;  1STG A;  1DXM A;  2R92 G;  1T5E A;  3T13 A;  1AW7 A;  1AE3 A;  1QOH A;  3BDL A;  4PG3 A;  3S1N B;  3M4Q A;  3TQY A;  3SK8 A;  3CCR A;  4RFB A;  2HD3 A;  4JOI C;  4DK6 C;  4TKO B;  3I4N B;  1RJT A;  2L55 A;  2C5C A;  3TP8 A;  4OEM B;  4F7X A;  3G4S A;  3ZYY X;  2JA6 G;  3GTJ H;  1VQ4 A;  3HOY G;  4ZQ3 A;  4DXF A;  3TEH B;  2NVT H;  3ITP A;  5C0X I;  1WJJ A;  2KEN A;  2WB1 E;  2ICE C;  1VMC A;  4HJ8 A;  1IBK L;  1CKN A;  1SXT A;  1E2W A;  3OOC A;  1TWF B;  4A3I B;  4GN4 B;  2GA4 B;  4OIJ A;  4A3K B;  4DNI A;  2K05 A;  5D65 A;  3T1Y L;  2I07 B;  3I8Z A;  1MBY A;  2NVY H;  3CRK C;  5IYD H;  2F0P A;  4LFC L;  4A3L H;  2RBM A;  2RA4 A;  3BDC A;  4FYD A;  2E2D C;  4A3F H;  1A63 A;  4RAU C;  3S16 H;  2B2Y C;  3I70 A;  4A3M B;  1A3V A;  3NWS A;  1XNQ Q;  3I4M B;  3SVM A;  2WAC A;  4LF6 Q;  2CQA A;  1ASZ A;  1ML0 D;  5JEA J;  2MFI A;  2E2J H;  3LWU A;  1RL2 A;  5E4W C;  4BXX H;  5LMN Q;  3H3V I;  3QO2 A;  1XTC D;  4B3M Q;  2A1A A;  2MP1 A;  5COR A;  1HZC A;  1IXR A;  2QDL A;  2HCI A;  4NKL A;  2I5L X;  5M3F H;  1VS0 A;  2YU9 H;  4JBK A;  3MTS A;  1ROD A;  3RMH A;  4QGU A;  4PMW A;  1KIX A;  2JA9 A;  4XT3 B;  3NBH A;  1EFI D;  4NXM L;  1BXT A;  1HTL D;  4U68 A;  2NVQ H;  1WTV A;  1EY5 A;  3KDF B;  4IFD G;  1A62 A;  1TKW B;  4X3U A;  1L2F A;  2M9V A;  3VR3 A;  3W3A A;  4DV6 L;  4HJ5 A;  2QKI C;  4YCU A;  3MEF A;  4R4C A;  1EQQ A;  1AZQ A;  4JBJ A;  1EZ6 A;  4K6D A;  3WOF A;  2I5M X;  2K5D A;  3KLW A;  3RZO H;  3SEB A;  4RKL A;  4K2K A;  3J7A F;  1L1O C;  4DR1 Q;  2Z6B A;  3L9A X;  1X32 A;  4F8M A;  1D1K A;  1HNW L;  1SDF A;  3OWF A;  1VF7 A;  2JYO A;  1GJX A;  1MI2 A;  1LTB D;  4DV0 Q;  1I4G A;  2AUJ D;  1WTR A;  2MHV A;  4A3D B;  1SRO A;  1YJ9 A;  3G71 A;  5CV9 A;  3U50 C;  1BOS A;  4LF7 L;  3A8J E;  1X6O A;  4JC0 A;  1PH7 A;  1A15 A;  5D3D A;  4ID6 A;  5E4X A;  1SNO A;  2YYZ A;  2UUA Q;  3NE5 B;  3X3M A;  1K8M A;  1F9P A;  1EYD A;  2VUM B;  5IWA Q;  1SFO H;  4A3B H;  2B63 B;  4QIW E;  1MD2 D;  3Q0A A;  1U0L A;  5IY0 A;  3HOZ B;  1YEZ A;  1EWH A;  1Y1V G;  2X6G A;  1BVS A;  3HKZ B;  1N36 Q;  1MIU A;  4BA2 I;  1I4H A;  2L0C A;  3D6C A;  5C5L A;  1PLF A;  1B8A A;  4GKK L;  4HMJ A;  3GTP B;  5FLM G;  2KJX A;  4C3H G;  5IE8 A;  2NUC A;  4A3F G;  4OO1 H;  2R3Z A;  4KV6 A;  2R7D A;  2Q2I A;  5DEH A;  3UDX A;  1EIH A;  1C4Q A;  2A68 D;  2KHI A;  4FF2 A;  1U4L A;  2HCC A;  1L0X B;  2UXB Q;  4BXX G;  1IBL Q;  1J5E L;  2N49 A;  3CC7 A;  2EIF A;  3RN2 A;  1IW7 C;  4HJA A;  5M3F G;  2Q8I B;  1TWC H;  2ZXO A;  1ENC A;  2Z8L A;  4A3J H;  1DOL A;  3SDZ A;  4E6I A;  3KF6 A;  1XMO L;  2AWO A;  3MXP A;  1KAW A;  1QUQ A;  1TY2 A;  2CFM A;  2ID0 A;  1B9M A;  2A6E C;  1CTM A;  1TWG B;  3J81 j;  1HR0 W;  4OWW B;  5ELC A;  1IYU A;  1X3P A;  1ESR A;  1BCP C;  2N8N A;  4X65 L;  3FPU B;  2NBF A;  2K4K A;  5C3W A;  2WAQ G;  2F03 A;  1V1O A;  3FPP A;  2WP8 J;  3U4V A;  1NTG A;  1WTP A;  3M4P A;  1HZA A;  4DR2 Q;  2LXK A;  5EPK A;  5IP9 G;  4A3E B;  3PO2 H;  1ICF B;  3K57 A;  5FJ8 H;  4UP7 A;  4GOP B;  1V8Q A;  4JI0 Q;  1J9O A;  1I3Q B;  4FF1 A;  3H91 A;  3K58 A;  4X62 L;  1NMF A;  2RQX A;  4KI0 A;  4C2M H;  2EJF C;  4X3K A;  1A2U A;  2JQO A;  2OTJ A;  4IUV A;  1I5F A;  3HRZ C;  1HA5 A;  3E9I A;  1KDB A;  1OXS C;  1DGS A;  1KNE A;  1VQG A;  2JA8 B;  2QA4 A;  4XT1 B;  1ILQ A;  4BS9 A;  1MJC A;  5C0X H;  1YBY A;  3OPO A;  4A3B G;  1HUN A;  4ZK9 B;  2QEX A;  4K0K L;  1ENF A;  1VQB A;  2AHO B;  3DEO A;  4PZ7 A;  3AQQ A;  4A3G G;  1YVC A;  2LS0 1;  4IUQ A;  1JWS D;  1K9M C;  2K6A A;  1RHP A;  1ZYR D;  2F4V L;  3FKI B;  4R8I A;  1NJI C;  2IPK D;  2Y0S B;  1DOK A;  4R8N A;  5BR8 L;  3PCO B;  5AJ3 L;  2CKZ B;  4N8F A;  1T9H A;  1Z6H A;  2RSO A;  3ND9 A;  3OMG A;  2SNM A;  5ELF A;  4IJL A;  1JJ2 A;  5ELB A;  4C1N I;  5T1I A;  2OT2 A;  4DR5 Q;  2DUD A;  4FP5 D;  4DR6 L;  1A3T A;  3S1M B;  1C7Y A;  4IFD I;  3HFZ B;  4ILW A;  2KA7 A;  3NEN A;  1F2Y A;  5J3B A;  4DUY L;  4EQ5 A;  1V1P B;  3PO3 B;  3S1Q B;  2KCC A;  2UXC L;  1Q7Y C;  2PMZ E;  2ENB A;  5KND A;  5EBD A;  2KCT A;  1Y1W H;  4BBR B;  2H4O A;  1IBK Q;  3U58 A;  4LUZ A;  3VDY A;  3M4O H;  1ESF A;  3W2D A;  2DN8 A;  1PYB A;  5KRU A;  3RLN A;  2AQ3 B;  4A3J G;  4IZ8 A;  2D9U A;  5JJL A;  5J39 A;  3T1Y Q;  2J7Z A;  3H94 A;  4JI7 L;  1EU4 A;  1EY7 A;  3C1F A;  3MEH A;  2IX3 A;  3A0J A;  3KJO A;  2N55 A;  2QIL A;  5M9O A;  3LX0 A;  1N9W A;  2H5X A;  1KC8 C;  1A6X A;  2WB1 B;  4DGZ A;  3TRE A;  4AH6 A;  3S17 H;  1J6Q A;  4ZUI A;  4I7Z C;  3I72 A;  4LAA A;  3NP8 A;  1XNQ L;  2HQE A;  1VQJ A;  4N9T A;  3P1H A;  4H02 A;  1HFG A;  2K5N A;  1X56 A;  2ZTC A;  1K8O A;  1S5B D;  4HIO A;  2E2H B;  1AE2 A;  1KDC A;  5JEA H;  1B1Z A;  1EU3 A;  4XIG S;  3CD6 A;  4HJ9 A;  1A2T A;  3ULJ A;  2D2C C;  3PO2 G;  1PTO C;  5FJ8 G;  1Y69 U;  1IL8 A;  1QE6 A;  3VR5 A;  3OMC A;  5L37 A;  2YTV A;  4HR7 B;  1X3F A;  4GN3 B;  5C6A A;  1YNJ C;  1GUN A;  4NXM Q;  1JOO A;  3UDF A;  3W1B A;  2LY7 A;  5M5Y H;  1PA6 A;  1HCZ A;  3H0G B;  1E22 A;  3GTO B;  4DV6 Q;  3A5U A;  1QZH A;  1XPU A;  2JSO A;  2B2W A;  5C0X G;  3J7Z C;  2EYJ A;  1WTH A;  2MGS A;  3K0Y A;  1KRT A;  3IAY A;  4OWX B;  5T1G A;  3F8T A;  1R9T B;  2JA7 H;  2I0Q A;  3ER0 A;  1NUC A;  1SSO A;  2J0T D;  2NN6 I;  4OON A;  1HNW Q;  2NVX B;  1PMR A;  1G51 A;  3GTQ B;  3GDE A;  3CCU A;  2LXJ A;  4F88 A;  3HOU H;  1FJG L;  4IO9 A;  1PZK D;  2YTX A;  5LHY 1;  4B9W A;  4LF7 Q;  2ATW A;  1X55 A;  1CHP D;  1WOC A;  2HDM A;  4DV0 L;  3TRZ A;  1G91 A;  2QDB A;  4DV4 L;  4A3C G;  3L7Z C;  5C4J B;  3PF4 A;  4NMZ A;  4DXG A;  3BDO A;  5A2Q E;  1E7Z A;  1IBM L;  4DAP A;  1NY4 A;  1I6H H;  1EY0 A;  4GLV B;  3HP3 A;  2AQ1 B;  3C2P A;  1LT4 D;  1Y14 B;  5IWA L;  4LWC A;  1MKH A;  1EYA A;  1Y1W G;  2XSC A;  1BBX C;  4KJN A;  3J7Y W;  1D5X C;  3GTL B;  3HOV H;  1BKB A;  2ZTE A;  4IN3 A;  5M5W H;  2Z0S A;  4RH6 A;  4BWG B;  3I4O A;  4DA2 A;  3P7J A;  1VDZ A;  2F0M A;  4OX9 L;  4GS3 A;  1N32 L;  4GKK Q;  2HIV A;  5M5X H;  1XWE A;  2CWP A;  2C9O A;  3RNU A;  1JB3 A;  4QIW B;  5FO9 B;  2E74 C;  2F0L A;  1QVF A;  4IAL A;  5DLQ E;  4EGV A;  3G6E A;  3CCL A;  4XYO A;  2ZXP A;  3QOL A;  1C9O A;  2O4X A;  4P72 A;  3OTO L;  4BY7 H;  4L5S A;  2F1M A;  2P5Z X;  3H6M A;  2AMC B;  3E0J A;  1IW7 D;  4AQY L;  2B2Y A;  3HEJ A;  5DM7 3;  3J81 i;  2JA5 H;  3EN2 A;  2JP1 A;  3QIA A;  3L3O C;  1XMO Q;  1JJG A;  1Q46 A;  1VQF A;  3VR2 A;  1PRT C;  3AB9 A;  1B44 D;  2SOB A;  1PH4 A;  1E0B A;  3CCE A;  5HUR A;  2FMC A;  2FMM A;  4DF7 A;  1FNW A;  1X65 A;  5IGC A;  1K83 H;  1E3P A;  1BNZ A;  2A6E D;  1JOQ A;  5ELE A;  1UAP A;  4OO1 I;  4X65 Q;  3DUZ A;  1K0S A;  2VB3 X;  4ODG A;  1BCP D;  2IHF A;  4IOC A;  3GTM B;  1K8A C;  2NTT A;  3A8K E;  2PO4 A;  3QB3 A;  2JA7 G;  1OXX K;  4KY5 A;  1XMQ L;  2EYH A;  2WKC A;  3D4W A;  1B4O A;  3R2T A;  2NWG A;  2R92 B;  3DHQ A;  3P20 A;  1YZ6 A;  3D4R A;  4JV5 L;  1VQD A;  2OQ0 A;  4X62 Q;  1JWU D;  3HOU G;  4P71 A;  2VNU D;  3MXN B;  3KF8 A;  4HSV A;  2PI2 E;  4ZKB B;  1MGS A;  4CKC A;  1I50 B;  1EL0 A;  2K7V A;  1WFQ A;  1L1O A;  2Q2H A;  5CBA E;  2K5H A;  2JA6 B;  4RGO S;  3HOY B;  4NXN L;  1VQE A;  2PZU A;  1YI2 A;  1TR5 A;  2ZJR A;  2I46 A;  2HUG A;  4K0K Q;  4EQO A;  1VQI A;  1ONL A;  2O2L D;  3HOW H;  3FHW A;  4M1U B;  1F9S A;  2JEA I;  4AIM A;  1NBW A;  3J81 E;  4DUZ L;  3C46 A;  1EY9 A;  2F4V Q;  3R93 A;  2XGT A;  3HOV G;  5C4X H;  1F2L A;  1EIF A;  1QCB D;  2E2I H;  5BR8 Q;  4BY1 H;  4QQB X;  1B3A A;  5AJ3 Q;  2EJG C;  1SR3 A;  3IL8 A;  3GTK H;  4QUF A;  1NNX A;  2R7Z H;  3MA2 B;  4Y7N H;  4PNY A;  2Q8R E;  3TDQ A;  1CQF A;  1VQL A;  4A93 H;  1GUT A;  3V05 A;  3PIP A;  4A3M H;  1Q86 C;  1CZW A;  3IKJ A;  5K5P A;  1NAP A;  1QZG A;  3HG9 A;  3AMU A;  1STA A;  4DR6 Q;  1LT6 D;  3JAM i;  2F0Q A;  2LFN A;  1UE6 A;  1KRS A;  5IIF A;  2PZT A;  3DWQ A;  4DUY Q;  4DR5 L;  2UXC Q;  4KKT A;  3BYT B;  4FXD A;  2IL8 A;  4BY7 G;  3MVV A;  3RZD H;  5LMN W;  1LTG D;  2XVS A;  3D0F A;  1CKN B;  1RF2 D;  3BJU A;  4P75 A;  1FGU A;  1H9M A;  2JA5 G;  4DR7 Q;  4HID A;  3S15 B;  3I56 A;  3TZU A;  2IW3 A;  3BYY B;  1U4R A;  4HTH A;  5I2X A;  1WTQ A;  3J80 L;  1V43 A;  4JI7 Q;  1R4Q B;  1RD9 D;  2A73 B;  4IPG A;  1WD0 A;  1UNS A;  4YHH L;  2DJF C;  3G48 A;  2PMZ B;  4LMQ D;  5AFW A;  4DV2 Q;  1YIJ A;  1U4P A;  1TS2 A;  3E5S A;  1CQV A;  3S1R H;  1JR0 D;  1D1I A;  4HN7 A;  5JPN C;  2R93 H;  5FLX L;  2XN9 C;  5GAE C;  1PH6 A;  3K5N A;  1IKM A;  2QF7 A;  4MN3 A;  1WCM H;  4IUN A;  4A76 A;  4CJ0 B;  1GM5 A;  3MWY W;  3CQZ B;  3ERQ A;  3IFD A;  4JCV E;  4TRD A;  1HJP A;  3J7A V;  2NN6 H;  3WOE A;  2VQE Q;  3SR1 A;  4K2L A;  3CC2 A;  1YJW A;  1RDP D;  3H15 A;  3K80 C;  2EDG A;  3DM1 A;  2KHJ A;  1IKL A;  2ZXR A;  3P75 A;  2A6H C;  1JE4 A;  5KYL A;  2K5V A;  1QWY A;  1KAA A;  1PTO D;  3HOX H;  3NBH B;  5CR3 A;  4JI5 L;  4B3S Q;  2N3S A;  3D6W A;  4APV A;  4JPB W;  3SE0 A;  3TBI B;  1HNX L;  1Q3L A;  1YNJ D;  2YV5 A;  4F87 A;  1CKO A;  3RLF A;  2SDF A;  3K8A A;  2EY6 A;  2D0O A;  3JAM E;  3GTJ B;  1JC7 A;  1HZB A;  1ZEQ X;  2Z4I A;  1DJR D;  5JJI A;  1CM9 A;  3TP7 A;  5CBE E;  2EY2 A;  3AFQ A;  2NVT B;  3VR6 A;  3I90 A;  4DU9 A;  3M3Y H;  4EQP A;  1N8R C;  3HOW G;  1Y1V B;  4IPD A;  3EQL C;  5CYU A;  1JMC A;  1VQM A;  1OO9 B;  2IX0 A;  1QB5 D;  1JQY D;  2WV6 D;  5C4X G;  4B3T L;  2RCN A;  3N52 A;  2DGY A;  4BY1 G;  4G7H C;  2NVY B;  1PHJ A;  4GLX A;  5IYB H;  3BZD B;  2EYP A;  4C3H B;  1FJG Q;  2FXQ A;  3MXU A;  1I4R A;  1XTD A;  1LLR D;  2D0P A;  4DAY A;  4A3F B;  2R7Z G;  1ICW A;  3S16 B;  2JXM B;  4A93 G;  2MO1 A;  4LFA L;  1X3G A;  4DV4 Q;  1M4V A;  3A55 A;  1VQ7 A;  1STN A;  2Z1C A;  2E2J B;  1PH3 A;  1IBM Q;  1EY6 A;  1MHW C;  2CW0 C;  4B9X A;  1PTO H;  5CC4 A;  1OXV A;  4DNT B;  1CUK A;  1XPR A;  2F3W A;  5M3F B;  2VZA A;  2YU9 B;  2KCM A;  3S14 H;  4DV7 L;  3T4A C;  1TXY A;  1W6K A;  2K52 A;  2RDG A;  4GNX C;  1CK1 A;  1P8L A;  3NQT A;  2B2V C;  4PMC A;  5DNF A;  2EVB A;  3CHB D;  4M8A A;  3QOJ A;  4OX9 Q;  3NQI A;  1HXY D;  1N32 Q;  5IOC A;  2KVM A;  5CV6 A;  1V9P A;  2OWO A;  2NVQ B;  2M2L A;  3MZ5 A;  3L2P A;  1B53 A;  1TII D;  5LMU L;  5IYD G;  4OEL B;  4OL7 A;  5DAU A;  4A3L G;  3PUW A;  4PV1 C;  1RIP A;  5LL6 X;  1P16 A;  1PYS B;  1XNR L;  2WAQ B;  4ZKC B;  2R93 G;  2K50 A;  1STE A;  2F0O A;  1U4M A;  1TWA H;  4EVO A;  4UDU C;  3RZO B;  1WCM G;  1JB7 A;  1CFM A;  3OTO Q;  1SMX A;  1TS4 A;  3TS2 A;  2NN6 G;  2I5H A;  4RGT A;  4A3E H;  2V4D A;  4AQY Q;  2OEO A;  5IGE A;  2N88 A;  1I3Q H;  1LTA D;  2NZO A;  1A0I A;  3KF6 B;  4KKU A;  3HOX G;  1NSN S;  5FO8 B;  4WJW A;  1SMY C;  2JJQ A;  2B2U C;  1QUQ B;  1SE4 A;  1IYJ B;  1F2M A;  3QR8 A;  5EKI A;  1BCP F;  4TQU S;  3GTG H;  1PRT D;  3CP0 A;  3EA6 A;  5CV7 A;  5E7N A;  4DAV A;  1PFS A;  1Y8P B;  1SFO B;  4G7Z C;  1SYD A;  4A3B B;  1ZXT A;  3PUX A;  2R61 A;  3PUV A;  2PW7 A;  1LUZ A;  1B70 B;  5E3F A;  5ELD A;  5EKL A;  2ZJQ A;  4LF4 L;  4A3G B;  2G5D A;  5IGG A;  3VYS A;  4QB4 A;  3A74 A; 
#chains in the Genus database with same CATH homology
 3ND8 A;  2NZ1 D;  1HQR D;  4KY6 A;  3V96 A;  2E75 C;  2DNC A;  3NBI A;  1G2T A;  2H1E A;  1LTS D;  3G7L A;  3I91 A;  4LJZ C;  5JAV A;  3KLS X;  4C56 C;  1AZP A;  2EYO A;  1DON A;  2WKD A;  2BA1 A;  4IUR A;  1O7Y A;  3V2T A;  1R4P B;  1HUM A;  2K32 A;  1QIL A;  4CKB A;  2E76 C;  2K04 A;  2O5I C;  1I4X A;  4V0B A;  4A3J B;  4G7O C;  4H7B A;  3RUZ A;  2IX1 A;  2FHT A;  1HRJ A;  2B8G A;  4J8Q A;  2G9H D;  1DZ1 A;  3OIQ A;  2BE5 C;  4KTA A;  2ZT9 C;  4FNF A;  4OO1 G;  3NSW A;  4KJO A;  1SYF A;  4RHR A;  4JBW A;  3AU7 A;  2B39 A;  1DYQ A;  4DK1 A;  1Q8I A;  3HGB A;  3PO2 B;  4K5W A;  2K1B A;  4C2M B;  1HTP A;  1F9R A;  2RVL A;  4XQQ A;  1EY8 A;  1SE2 A;  2XWJ B;  4P2C B;  1MSG A;  2RSN A;  1TQO A;  1DOM A;  3ONA B;  2F0V A;  1PDQ A;  4IUP A;  1CI3 M;  3EJI A;  4O42 A;  2BDN A;  1X3Q A;  2F0N A;  3OW7 A;  4J6H A;  4PMB A;  1S5D D;  1PTO F;  1DCZ A;  3S2H B;  4RA8 A;  5COY A;  3LWE A;  1B50 A;  4N9P A;  2EYM A;  2F4I A;  1GOZ A;  3FDT A;  3NPP A;  5C4H A;  2A6H D;  2B2T C;  1Q1E A;  1QG7 A;  5EGT A;  3GV3 A;  1Z47 A;  4K5X A;  2PQE A;  5EKK A;  3GQB A;  3VA7 A;  3K59 A;  5FOB B;  1QJO A;  4KD4 A;  2G9D A;  4FXK C;  1EWC A;  2XNA C;  5FO7 B;  3BVZ A;  1Y1W B;  4C3I G;  1NR4 A;  3M4O B;  3PV0 A;  1CZG A;  1WVL A;  2K5Q A;  1EY4 A;  1SJE D;  2AWN A;  2JEB I;  1NCV A;  1SNQ A;  1QNK A;  2KUM A;  2R6G A;  3SHL A;  3S17 B;  4LK1 C;  5JVG 3;  4HMI A;  4XXE A;  3KLS A;  4WRD A;  1E2V A;  3D4D A;  1OXU A;  3PUY A;  3VYT A;  1JWM D;  1EIG A;  2CW0 D;  1YNN C;  1RCV D;  2OF1 A;  1BUV T;  3A54 A;  3GV6 A;  1SYE A;  1NR2 A;  1T5X D;  3CRL C;  4RGM A;  5M5Y B;  1Q12 A;  4K5V A;  5I6W A;  1E2Z A;  4FF3 A;  4RHS A;  5I9P A;  1F2Z A;  3T53 B;  2JA7 B;  4CBV A;  1SYB A;  2CVR A;  1Q1B A;  3R2I A;  4C3J G;  1MSH A;  1W6J A;  5JEA G;  1STY A;  3DMU A;  3WDN A;  3HOU B;  1PRT F;  1H9J A;  2RDH A;  3SK4 A;  4K6L A;  3RD4 A;  5BN5 A;  3I73 A;  1ET9 A;  4WOR A;  4B08 A;  1SMY D;  4ZYS A;  2EY5 A;  4NP5 A;  4ABN A;  2EY1 A;  4PQX A;  3PMF A;  3NWT A;  1STB A;  3Q23 A;  5C4Z A;  1I6H B;  2HDL A;  4X3T A;  3EFX D;  3LNN A;  1TWH B;  2M00 A;  3HOV B;  4OGQ C;  3OHX C;  1F77 A;  5M5W B;  1STH A;  4ZUJ A;  5G3L D;  5IGB A;  3KUP A;  2BA0 A;  5M5X B;  1JIC A;  3URY A;  2L5T A;  2EYL A;  1TU2 B;  4Z9C B;  4S3S A;  2KQ3 A;  2LKV A;  4C1N K;  3C1E A;  1GXD C;  4HCS A;  1GUS A;  4BY7 B;  3M7G A;  1AFP A;  3A56 A;  3H3V C;  2A69 C;  1O80 A;  3E6Z X;  3VR4 A;  1DM0 B;  2SNS A;  4FF4 A;  1SEB D;  1A3U A;  1BDO A;  3U9S A;  1I4Q A;  2JA5 B;  1GUO A;  2WIN B;  1H9S A;  2KEE A;  1SBB B;  3MAQ A;  4CJ2 C;  4NDX A;  2PPB C;  1HFN A;  1I6V C;  1K83 B;  1SAP A;  1AP0 A;  3MFG A;  2BE5 D;  4RCN A;  4KK7 A;  1HHV A;  1G6Z A;  3GP7 A;  2B2V A;  3R8B A;  3NHH A;  1JCK B;  3MHB A;  1OXT A;  3MXG A;  3QJY A;  1LT5 D;  1L0Y B;  3T51 B;  5BN4 A;  2CHB D;  5CV5 A;  3NTH A;  1LAB A;  1XYI A;  2XRS D;  3A8I E;  4HSP A;  1C48 A;  1AEX A;  5CV8 A;  2NB0 A;  3I4L A;  3PIP 3;  4JK1 C;  2F0F A;  2DY8 A;  1Y8O B;  4BA1 I;  2EPB A;  5J1Z A;  2IT1 A;  2QEJ C;  5K36 H;  2B8F A;  3Q24 A;  1Q90 A;  3DWA A;  4L63 B;  1S4Z A;  3HOW B;  4EQN A;  5JOB A;  4GZY C;  3TSS A;  1GHK A;  1I4P A;  2PW5 A;  2B2U A;  1AN8 A;  3N6R A;  4KN4 C;  5C4X B;  1G2S A;  2E2I B;  2X69 A;  4Q5V A;  4BY1 B;  5JJZ A;  3M7N A;  1BCP B;  4UAI A;  3GTK B;  2R7Z B;  4Y7N B;  3TME A;  4OIK A;  3VYU A;  4A93 B;  1VCI A;  2K03 A;  2L4N A;  3QWN A;  4KMU C;  2Z4H A;  1DD2 A;  2KCN A;  4H0L C;  2WII B;  1HPC A;  3FEW X;  3A7L A;  2DNE A;  4KKS A;  3RZD B;  3MC0 B;  2F0J A;  5TSS A;  1FR3 A;  2X6L A;  1S5C D;  2F0I A;  2LMC B;  1SE3 A;  1TS3 A;  4KD3 A;  1LTI D;  1ET6 A;  1O78 A;  1SJH D;  3BVM A;  2EOT A;  3ERO A;  4QUC A;  3KBX A;  3S1R B;  2R93 B;  1KAB A;  3HS0 C;  5IGF A;  1WCM B;  3J80 E;  1KLG D;  1YNN D;  4HED A;  2K01 A;  1PFM A;  1D5Z C;  4O1N A;  1ENA A;  5J22 A;  3HOX B;  1WTO A;  5FLX E;  1LTT D;  3PIO 3;  2L1B A;  1FNU A;  1HA6 A;  4HAE A;  3Q6S A;  4K14 A;  5EQ0 A;  3M4Y A;  5K36 G;  4ZRZ A;  5IOD A;  1LV9 A;  3K6O A;  3M3Y B;  3GO5 A;  1S5E D;  4XTC S;  4CJ1 B;  1PYW D;  1SND A;  5FKA C;  3T56 B;  3UI2 A;  1KLU D;  4G4K A;  1KTK A;  4HCE A;  1H9K A;  3KLR A;  1B2T A;  3DXJ C;  2BDO A;  5DM6 3;  4ZAI A;  5EBC A;  3BS1 A;  1TY0 A;  4KHV A;  3S9W A;  1EOT A;  1JOR A;  3TZD A;  1PXU A;  2O5J C;  1PTO B;  1PZI D;  1Z7T A;  2EE1 A;  2SEB D;  5G3L F;  1EQV A;  3VA5 A;  3S14 B;  1ILP A;  4XYQ A;  2B2T A;  1IYV A;  4L8J A;  1LTR D;  3CU7 A;  4X3S A;  2QCP X;  3FVQ A;  2TSS A;  4KY7 A;  4Q0F A;  5IGD A;  2XRQ D;  5HGT A;  1EQT A;  2KEC A;  3PUZ A;  2A5H A;  1FGB D;  4G57 A;  1QNU A;  1TWA B;  3U9O A;  1IHZ A;  4XDX A;  2NYZ D;  5BN3 A;  3T16 A;  2A69 D;  4CKE A;  1S5F D;  1M8A A;  1GHJ A;  2RDF A;  1TWC B;  2F0W A;  4IFD J;  5EPL A;  1UEA B;  2D5D A;  1G8Z D;  5KEE A;  3GTG B;  1XXG A;  4ULL A;  1PFN A;  2KOL A;  4H44 C;  1EEF D;  4TSS A;  1TT2 A;  1LT3 D;  1PFB A;  5KGU A;  3CKI B;  4U67 3;  1EZ8 A;  3NUC A;  5EJW A;  2BOS A;  3TP5 A;  3H09 A;  3SXH A;  1O7L A;  4L6T B;  2IWH A;  3DEP A;  5NUC A;  5KNB A;  2JE6 I;  1BQQ T;  4CHT B;  4K8J A;  3X3N A;  5I6Y A;  2MUY A;  2PZW A;  2PCF B;  5KIX A;  2F0D A;  2ICI A;  3OSO A;  1BO0 A;  3NXW A;  3KK7 A;  4IUT A;  3GD7 A;  2L12 A;  3K7A B;  3D3R A;  4C3I B;  5C3E B;  1V1P A;  5I2Y A;  1PRT B;  4H13 C;  1SYG A;  4BBS B;  3DWP A;  1BR9 A;  3EVQ A;  4QF4 A;  5C3X A;  3SK5 A;  1D2B A;  5KNC A;  4AYB B;  1SNP A;  5A2Q L;  3NTK A;  1SNM A;  4IUU A;  3D31 A;  1VMP A;  5CGK A;  5D3I B;  1WTW A;  2BCO A;  2F0T A;  2MPM A;  4RWS C;  2EJM A;  3K5O A;  4DNR B;  4RKB A;  2DY7 A;  4XQJ A;  1D6E C;  1GUG A;  1BF4 A;  5I4D A;  5IT9 L;  1SNC A;  3R3O A;  4NW2 A;  1FD7 D;  5EPJ A;  3G6J B;  5F2D A;  3M85 A;  5KYI A;  4FVM A;  3MFY A;  1B9N A;  5CV4 A;  1U9R A;  3Q22 A;  3K5L A;  1VF5 C;  2L11 A;  3FRP B;  3HZX A;  1TS5 A;  1KDA A;  3D8G A;  1ZKO A;  4C3J B;  3O13 A;  2F3V A;  4WFN 3;  2K5W A;  1D5M C;  3I3C A;  1CHQ D;  1PZJ D;  2F0S A;  1CA5 A;  1XX8 A;  4OHJ A;  1C8C A;  4R9W A;  2RKS A;  1KNA A;  4FO2 A;  5C5M A;  1RKN A;  4IQZ A;  2D62 A;  3OIP A;  3IFT A;  5JVH 3;  1WTX A;  2TMP A;  5I9O A;  4FXG C;  2EXZ A;  1II3 A;  3OWE B;  2FIN B;  3K5M A;  5A35 A;  1F9Q A;  1TVX A;  2K28 A;  3NK9 A;  2K33 A;  4YIJ A;  2L9H A;  2F0U A;  2XIW A;  2PNR C;  2KED A;  1J8I A;  2AUK A;  5IT9 E;  2FFK B;  3KBG A;  5LL6 S;  2OXP A;  1G29 1;  2J4X A;  3C3L A;  2A68 C;  3J81 L;  1RTN A;  4MHE A;  5C44 B;  1EYC A;  2NTS A;  3VYR A;  1HQM C;  2FJ2 A;  1LO5 D;  5M3M B;  1SYC A;  1RTO A;  4QMG A;  1H9R A;  4KHZ A;  3FMC A;  1WD1 A;  2KHS A;  1JOK A;  4CGY B;  4MIU A;  2A74 C;  5CMD A;  5D14 A;  3F2U A;  3BVG A;  4ZLT F;  4QCL A;  3SK6 A;  2F0K A;  4XQN A;  4K8I A;  1O7Z A;  2EZV A;  2AQ2 B;  1LAC A;  1UUP A;  1FYC A;  5E1F A;  4DN4 M;  4RCO A;  4I65 A;  1CA6 A;  5FK9 C;  2Q8T A;  2MJ8 A;  2F0E A;  1FNV A;  3NTI A;  1Y8N B;  2VB2 X;  4J1M A;  4DK0 A;  2B2W C;  2EYF A;  2F0G A;  1H9S B;  4KN7 C;  3TP6 A;  4V19 0;  3S2D B;  2PYK A;  3MXN A;  5C0X J;  1GUW A;  1CT1 D;  4IFD H;  2VXW A;  1EEI D;  3TN2 A;  3BG3 A;  4RGN A;  4DFA A;  1ZYR C;  3A7A B;  3QG1 A;  2IJ0 A;  5JPM C;  2XWB B;  3JAM L;  5ISR A;  4ME5 A;  2F0H A;  1STG A;  1DXM A;  1T5E A;  3T13 A;  1AW7 A;  1QOH A;  3BDL A;  3S1N B;  3SK8 A;  4RFB A;  4TKO B;  3I4N B;  1RJT A;  2L55 A;  2C5C A;  3TP8 A;  4F7X A;  3ZYY X;  4ZQ3 A;  4DXF A;  3ITP A;  5C0X I;  2ICE C;  1VMC A;  1SXT A;  1E2W A;  3OOC A;  1TWF B;  4A3I B;  2GA4 B;  4OIJ A;  4A3K B;  2K05 A;  5D65 A;  2I07 B;  3I8Z A;  1MBY A;  3CRK C;  2F0P A;  2RBM A;  2RA4 A;  3BDC A;  4FYD A;  2E2D C;  4RAU C;  2B2Y C;  3I70 A;  4A3M B;  1A3V A;  3NWS A;  3I4M B;  3SVM A;  2WAC A;  2CQA A;  1ML0 D;  5JEA J;  3LWU A;  5E4W C;  3QO2 A;  1XTC D;  2MP1 A;  5COR A;  2HCI A;  4NKL A;  3MTS A;  1ROD A;  3RMH A;  4PMW A;  4XT3 B;  3NBH A;  1EFI D;  1BXT A;  1HTL D;  4U68 A;  1WTV A;  1EY5 A;  4IFD G;  1TKW B;  4X3U A;  2M9V A;  3VR3 A;  3W3A A;  2QKI C;  1AZQ A;  1EZ6 A;  4K6D A;  3WOF A;  2K5D A;  3SEB A;  4RKL A;  4K2K A;  3J7A F;  3L9A X;  1X32 A;  4F8M A;  1D1K A;  1SDF A;  3OWF A;  1VF7 A;  2JYO A;  1GJX A;  1MI2 A;  1LTB D;  1I4G A;  2AUJ D;  1WTR A;  2MHV A;  4A3D B;  5CV9 A;  1BOS A;  3A8J E;  1A15 A;  5D3D A;  4ID6 A;  5E4X A;  1SNO A;  2YYZ A;  3NE5 B;  3X3M A;  1K8M A;  1F9P A;  1EYD A;  2VUM B;  2B63 B;  1MD2 D;  3Q0A A;  3HOZ B;  1EWH A;  2X6G A;  3HKZ B;  4BA2 I;  1I4H A;  2L0C A;  3D6C A;  5C5L A;  1PLF A;  4HMJ A;  3GTP B;  2KJX A;  4C3H G;  2NUC A;  4OO1 H;  2R3Z A;  4KV6 A;  5DEH A;  1EIH A;  1C4Q A;  2A68 D;  4FF2 A;  1U4L A;  2HCC A;  1L0X B;  1IW7 C;  2Q8I B;  2ZXO A;  1ENC A;  2Z8L A;  1DOL A;  3SDZ A;  4E6I A;  2AWO A;  3MXP A;  1TY2 A;  1B9M A;  2ID0 A;  2A6E C;  1CTM A;  1TWG B;  5ELC A;  1IYU A;  1X3P A;  1ESR A;  1BCP C;  3FPU B;  2NBF A;  5C3W A;  2F03 A;  1V1O A;  3FPP A;  2WP8 J;  1WTP A;  5EPK A;  4A3E B;  3K57 A;  1V8Q A;  1J9O A;  1I3Q B;  4FF1 A;  3H91 A;  3K58 A;  2RQX A;  4KI0 A;  2EJF C;  4X3K A;  1A2U A;  4IUV A;  1HA5 A;  3HRZ C;  1KDB A;  1OXS C;  1KNE A;  2JA8 B;  4XT1 B;  1ILQ A;  4BS9 A;  5C0X H;  3OPO A;  1HUN A;  4ZK9 B;  1ENF A;  3DEO A;  4IUQ A;  2LS0 1;  1JWS D;  2K6A A;  1RHP A;  1ZYR D;  3FKI B;  4R8I A;  2IPK D;  2Y0S B;  1DOK A;  4R8N A;  1Z6H A;  2RSO A;  3ND9 A;  3OMG A;  2SNM A;  5ELF A;  5ELB A;  4C1N I;  5T1I A;  2OT2 A;  4FP5 D;  1A3T A;  3S1M B;  4IFD I;  4ILW A;  2KA7 A;  1F2Y A;  3PO3 B;  3S1Q B;  1V1P B;  2KCC A;  2ENB A;  5KND A;  5EBD A;  4BBR B;  2H4O A;  1ESF A;  3W2D A;  2DN8 A;  5KRU A;  2AQ3 B;  4IZ8 A;  2D9U A;  5J39 A;  2J7Z A;  3H94 A;  1EU4 A;  1EY7 A;  3C1F A;  3MEH A;  2IX3 A;  2N55 A;  2QIL A;  5M9O A;  3LX0 A;  1A6X A;  2WB1 B;  4DGZ A;  4ZUI A;  4I7Z C;  3I72 A;  4LAA A;  3NP8 A;  2HQE A;  4N9T A;  3P1H A;  1HFG A;  1K8O A;  1S5B D;  2E2H B;  1KDC A;  5JEA H;  1B1Z A;  1EU3 A;  4XIG S;  1A2T A;  2D2C C;  1PTO C;  1Y69 U;  1IL8 A;  1QE6 A;  3VR5 A;  3OMC A;  4HR7 B;  5C6A A;  1YNJ C;  1GUN A;  1JOO A;  2LY7 A;  1HCZ A;  3H0G B;  3GTO B;  2JSO A;  2B2W A;  5C0X G;  2EYJ A;  2MGS A;  3K0Y A;  3IAY A;  5T1G A;  1R9T B;  1NUC A;  1SSO A;  2J0T D;  2NN6 I;  2NVX B;  1PMR A;  3GTQ B;  4F88 A;  1PZK D;  5LHY 1;  4B9W A;  1CHP D;  2HDM A;  1G91 A;  2QDB A;  3L7Z C;  5C4J B;  4NMZ A;  4DXG A;  3BDO A;  5A2Q E;  4DAP A;  1EY0 A;  3HP3 A;  2AQ1 B;  3C2P A;  1LT4 D;  1EYA A;  2XSC A;  1BBX C;  4KJN A;  3J7Y W;  1D5X C;  3GTL B;  4IN3 A;  4RH6 A;  4BWG B;  4DA2 A;  3P7J A;  1VDZ A;  2F0M A;  1XWE A;  2C9O A;  1JB3 A;  4QIW B;  5FO9 B;  2E74 C;  2F0L A;  4IAL A;  4EGV A;  4XYO A;  2ZXP A;  3QOL A;  2O4X A;  2F1M A;  3H6M A;  3E0J A;  1IW7 D;  2B2Y A;  3HEJ A;  5DM7 3;  2JP1 A;  3QIA A;  3L3O C;  3VR2 A;  1PRT C;  3AB9 A;  1B44 D;  2SOB A;  1E0B A;  5HUR A;  2FMC A;  2FMM A;  4DF7 A;  1FNW A;  5IGC A;  1BNZ A;  1JOQ A;  2A6E D;  5ELE A;  1UAP A;  4OO1 I;  3DUZ A;  2VB3 X;  4ODG A;  1BCP D;  3GTM B;  2NTT A;  3A8K E;  2PO4 A;  3QB3 A;  1OXX K;  4KY5 A;  2EYH A;  2WKC A;  3D4W A;  1B4O A;  3R2T A;  2NWG A;  2R92 B;  3DHQ A;  3P20 A;  3D4R A;  1JWU D;  2VNU D;  3KF8 A;  4HSV A;  4ZKB B;  1MGS A;  4CKC A;  1I50 B;  1EL0 A;  2K7V A;  5CBA E;  2JA6 B;  4RGO S;  3HOY B;  2PZU A;  1TR5 A;  2I46 A;  2HUG A;  4EQO A;  1ONL A;  2O2L D;  4M1U B;  1F9S A;  2JEA I;  3J81 E;  3C46 A;  1EY9 A;  3R93 A;  1F2L A;  1QCB D;  1B3A A;  2EJG C;  3IL8 A;  4QUF A;  3MA2 B;  4PNY A;  2Q8R E;  3TDQ A;  1CQF A;  1GUT A;  3V05 A;  1CZW A;  3IKJ A;  5K5P A;  1NAP A;  3HG9 A;  3AMU A;  1STA A;  1LT6 D;  2F0Q A;  2LFN A;  5IIF A;  2PZT A;  3DWQ A;  4KKT A;  3BYT B;  4FXD A;  2IL8 A;  3MVV A;  1LTG D;  2XVS A;  1RF2 D;  1H9M A;  3S15 B;  3TZU A;  2IW3 A;  3BYY B;  1U4R A;  4HTH A;  5I2X A;  1WTQ A;  3J80 L;  1V43 A;  1R4Q B;  1RD9 D;  2A73 B;  1WD0 A;  1UNS A;  2PMZ B;  4LMQ D;  5AFW A;  1U4P A;  1TS2 A;  3E5S A;  1CQV A;  1JR0 D;  1D1I A;  4HN7 A;  5JPN C;  5FLX L;  2XN9 C;  3K5N A;  1IKM A;  2QF7 A;  4MN3 A;  4IUN A;  4CJ0 B;  3MWY W;  3CQZ B;  3ERQ A;  3IFD A;  4TRD A;  3J7A V;  2NN6 H;  3WOE A;  3SR1 A;  4K2L A;  1RDP D;  2EDG A;  3DM1 A;  1IKL A;  2ZXR A;  3P75 A;  2A6H C;  1JE4 A;  5KYL A;  1QWY A;  1KAA A;  1PTO D;  5CR3 A;  3D6W A;  3SE0 A;  3TBI B;  1Q3L A;  1YNJ D;  4F87 A;  3RLF A;  2SDF A;  2EY6 A;  3JAM E;  3GTJ B;  1JC7 A;  2Z4I A;  1ZEQ X;  1DJR D;  1CM9 A;  3TP7 A;  5CBE E;  2EY2 A;  2NVT B;  3VR6 A;  3I90 A;  4DU9 A;  4EQP A;  1Y1V B;  3EQL C;  5CYU A;  1OO9 B;  2IX0 A;  1QB5 D;  1JQY D;  2WV6 D;  3N52 A;  4G7H C;  2NVY B;  3BZD B;  2EYP A;  4C3H B;  3MXU A;  1I4R A;  1LLR D;  4DAY A;  4A3F B;  1ICW A;  3S16 B;  2JXM B;  1M4V A;  3A55 A;  1STN A;  2Z1C A;  2E2J B;  1EY6 A;  2CW0 C;  4B9X A;  1PTO H;  5CC4 A;  1OXV A;  4DNT B;  2F3W A;  5M3F B;  2YU9 B;  3T4A C;  1W6K A;  2RDG A;  1CK1 A;  3NQT A;  2B2V C;  4PMC A;  5DNF A;  2EVB A;  3CHB D;  4M8A A;  3QOJ A;  3NQI A;  1HXY D;  5IOC A;  2KVM A;  5CV6 A;  2NVQ B;  2M2L A;  3MZ5 A;  1B53 A;  1TII D;  4OL7 A;  5DAU A;  3PUW A;  4PV1 C;  5LL6 X;  2WAQ B;  4ZKC B;  1STE A;  2F0O A;  1U4M A;  4EVO A;  4UDU C;  3RZO B;  1CFM A;  1TS4 A;  2NN6 G;  4RGT A;  2V4D A;  2OEO A;  5IGE A;  2N88 A;  1LTA D;  4KKU A;  1NSN S;  5FO8 B;  4WJW A;  1SMY C;  2B2U C;  1SE4 A;  1F2M A;  5EKI A;  1BCP F;  4TQU S;  1PRT D;  3EA6 A;  5CV7 A;  4DAV A;  1Y8P B;  1SFO B;  4G7Z C;  1SYD A;  4A3B B;  1ZXT A;  3PUX A;  2R61 A;  3PUV A;  2PW7 A;  5E3F A;  5EKL A;  5ELD A;  4A3G B;  5IGG A;  3VYS A;  4QB4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...