3RUZA

Crystal structure of staphylococcal nuclease variant delta+phs v74k at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEKEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Internal ionizable residues in proteins
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2011-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3ruzA00
4K6DA 5IIFA 1KDBA 4KTAA 4DFAA 2F0OA 4ZUIA 1SYFA 2SNSA 1STYA 4K2KA 5DAUA 3QOJA 2F3VA 3SR1A 3D8GA 1EY4A 5K5PA 1TT2A 4EVOA 1SNCA 3BDCA 3HEJA 4RKLA 1EYDA 5CR3A 4K5VA 5KEEA 1NUCA 1KAAA 4K8IA 3SXHA 4J6HA 1EZ6A 1F2ZA 2EYLA 2PZUA 2EY2A 2F0PA 4KJNA 1STBA 2F0KA 2PW7A 4KD4A 3E5SA 4QB4A 4RKBA 5IOCA 4YIJA 4PNYA 4S3SA 5CV5A 4ZQ3A 1SNMA 4NMZA 3T16A 3OSOA 3DHQA 2PZTA 2QDBA 2F0HA 3NQTA 4G57A 2EY6A 5C6AA 1SNDA 2WACA 2F0IA 2M00A 2F0JA 3OMCA 2KQ3A 3NP8A 5ISRA 4EQOA 5C3WA 2EY1A 3C1EA 4HTHA 3SK6A 3S9WA 1RKNA 2OEOA 2PQEA 2ENBA 3BDLA 1STNA 4N9TA 3SHLA 5KYLA 2HQEA 4EQPA 3DMUA 5F2DA 4QF4A 1A3TA 1EY6A 1EYAA 1SNQA 2F0MA 2RKSA 3NXWA 4HMIA 4J1MA 4F7XA 1AEXA 5IGDA 3SK5A 1A3UA 3QB3A 4IALA 5J1ZA 5IGBA 1A3VA 4KY5A 2KHSA 4DGZA 4ODGA 3P1HA 4DU9A 5KIXA 5KRUA 3OWFA 5M9OA 3D6CA 1SYEA 5C5MA 5I6YA 2F3WA 3TP5A 4F8MA 5HGTA 4OL7A 4WORA 5CGKA 1KDCA 2F0DA 5CV7A 2RDFA 5DEHA 5I6WA 4KHVA 1EZ8A 2RBMA 1EYCA 1SYBA 5E1FA 4B9XA 5J22A 5I9PA 1JORA 2F0NA 4KV6A 5EGTA 1F2MA 3SK8A 3SK4A 4R8NA 1EQVA 1JOKA 3TMEA 3EJIA 5CV6A 2NUCA 3ERQA 4KY7A 4K8JA 3RUZA 1EY5A 1TR5A 3PMFA 4PMCA 2F0LA 3EVQA 4IZ8A 4K5XA 4I65A 2SNMA 2F0UA 3V2TA 3VA5A 4IUNA 3OMGA 5C3XA 2EYMA 3R3OA 4DF7A 2F0VA 3TP8A 4E6IA 2LKVA 1II3A 1IHZA 3D4WA 4K2LA 3D4DA 4LAAA 1JOQA 2EYPA 3P75A 3T13A 1KABA 2EYFA 4K5WA 5IODA 5IGEA 1ENCA 2F0QA 2OXPA 3HZXA 4KY6A 5NUCA 5E3FA 1SNOA 1STHA 2EYHA 3NHHA 5EKKA 5C5LA 3NUCA 3QOLA 3TP6A 3MVVA 2F0TA 1JOOA 1SYDA 4NP5A 2F0WA 2F0FA 2PZWA 2EY5A 5KGUA 1EY8A 3MZ5A 4TRDA 1EY7A 2OF1A 1U9RA 4ID6A 5JOBA 4B9WA 5CC4A 2F0GA 4ZUJA 4NKLA 3MEHA 3TP7A 5CV9A 5HURA 5C4ZA 5I9OA 4KJOA 3MHBA 1STGA 2F0EA 3H6MA 4H7BA 2F0SA 2SOBA 3NK9A 1STAA 1ENAA 4QMGA 4NDXA 1EY0A 3EROA 1SNPA 3MXPA 4ME5A 2PYKA 5JAVA 5IGCA 5KYIA 1A2UA 3ITPA 5CV4A 4WRDA 4PMBA 5EKLA 1TQOA 4KD3A 1NSNS 2EYOA 4MIUA 2PW5A 5IGGA 1EY9A 1A2TA 3C1FA 2EYJA 5CV8A 3U9OA 5IGFA 5J39A 4N9PA 4EQNA 1SYGA 3LX0A 1KDAA 2EXZA 2O4XA 4K14A 5C4HA 4HMJA 1SYCA 1F2YA
chains in the Genus database with same CATH superfamily
1FVIA 4WJ3M 1FD7D 1K83B 1X54A 2SEBD 4C2MB 1Q7YC 2Z4HA 4DPGA 1GUGA 2KJXA 4RKLA 2YTVA 1CI3M 2NTTA 2QDLA 4DN4M 2JP1A 1N32L 4JI7Q 1Y14B 1KQSA 3T56B 2JA6G 3Q24A 2F0IA 4CJ2C 3M3YB 3NP8A 4UP7A 3H15A 3S9WA 4DNTB 4KHPQ 5KYLA 1XMQQ 1XTDA 3K5MA 4A3LG 1XTCD 1HZCA 3Q8DA 4HMIA 4MZ9A 4HIKA 2ZXPA 1JICA 2E2DC 4C3IH 3P20A 2HDMA 3QB3A 5M5XH 5IYDG 4OEMB 4XXEA 2KOLA 3G6JB 4OONA 3RNUA 3DEOA 1D7QA 4B3TQ 3E3XA 2QEJC 5BR8L 1TY2A 1DOMA 3L0OA 5IT9c 1C0AA 3C2PA 4JYAL 3KF8B 2NWGA 2NUCA 3DM3A 3ERQA 4KY7A 2E2JH 3S15H 1WD1A 4B08A 5M3MG 2SNMA 5C4XH 1ASYA 1UAPA 4DR7Q 2M2LA 1EU3A 1IHZA 3S2DB 1Y8OB 5E4XA 2C35B 3RZOB 1Q12A 1FNWA 2RCFA 2XSCA 5JEAJ 2WV6D 2R92B 4DA2A 4DR4Q 1SNOA 1STHA 4RFBA 1I3QH 1TU2B 4X65L 1JOOA 4YWMA 4QUCA 1EWIA 1H9MA 5JJZA 5JOBA 3KF6A 3MFYA 3HOUB 5CBAE 4V0BA 3PO2B 1MJCA 4OIKA 1WI5A 5J3BA 5JPMC 4YY3L 4H7BA 4GKKL 4H13C 1E22A 5ELBA 4X3SA 2UUAL 4P73A 2ID0A 4YCWA 1JJCB 1YNNC 1H9SA 1PDQA 4GLXA 2NVYB 2NVTB 3A5UA 3SVMA 1KDAA 1S5BD 5GAGC 5C44G 3K57A 3EA6A 5EKIA 2F3VA 1EY4A 1PLFA 1GVPA 1ESRA 4A3EB 3HEJA 5KEEA 1VQLA 1BVSA 1XXGA 1JMCA 2YU9B 4JV5L 1UE7A 4KD4A 5K36G 2WB1B 2EY6A 1I4QA 4DAPA 4CKEA 3OW7A 4B3ML 1YNJD 3FKIB 2DGYA 1D5ZC 1HTLD 4DK0A 3S17B 2K5QA 1ZYRC 2L55A 1EYAA 3QR8A 4GNXA 1UEAB 2RDHA 3S1RB 2VY3A 4KKTA 3RN2A 1TWHH 1B70B 4DV0Q 3VR3A 3NTKA 4LFBL 4IOCA 1AFPA 1SXTA 4A3FB 1WTWA 3S16B 1VQGA 4DV6L 2F0DA 2RHSB 5IP9G 3GTOB 1B7YB 4OX9L 1DONA 4DK1A 2R92H 2I5MX 4QUFA 3R2TA 2KBNA 2B8FA 2L15A 2IPKD 1HA5A 5EGTA 3SDZA 2B63B 1L1OC 2EJFC 1KNAA 2UUBQ 3RUZA 3BYYB 1PZJD 2JYOA 1J6QA 4ZLTF 3OMGA 4G7ZC 2RSOA 4GN4B 3MAQA 2LKVA 4GLAC 3AFQA 1TXYA 1VQHA 2GN5A 3I3CA 3R93A 1PTOC 1RTOA 5E3FA 5M5XB 3KK7A 4WFN3 1GM5A 4LMQD 1EY8A 1BXTA 4OO1G 3E6ZX 2OTLA 4B3RQ 1DD2A 2GA4B 1BOSA 2LSSA 3KFUA 2E76C 2A69C 4QGUA 4A3IH 4DV1L 3F2DA 3KDFB 1QCBD 4WRDA 3DEPA 3HP3A 3T51B 1OO9B 3H0GB 1A2TA 1SRUA 4G4KA 3S14H 2VL6A 3T1HQ 4NXNL 1JWUD 3ZJYC 3W3AA 4K2KA 2CWPA 3HOVG 1Q90A 2XGTA 4PG3A 1WOCA 1IBMQ 3BJUA 1LTAD 1OXXK 3T53B 4K8IA 4J6HA 4KJNA 2B2VC 4UHVA 1STBA 3CCRA 2E75C 2EQSA 3BDOA 4PNYA 1KXLA 2A73B 3M4QA 1O80A 4KHZA 4Y7NH 2K05A 3P7JA 3L9AX 1QB5D 2K28A 5COYA 3GTOH 1CQFA 1PXUA 5F2DA 3M4OH 1G6ZA 1G2SA 3CRKC 4Q0FA 4DV5Q 4GKJQ 1AEXA 1PH7A 2C5CA 3TEHB 5J1ZA 1PV4A 2HDLA 1VQAA 1K3BC 3GTPB 1HZBA 5KRUA 2Z0SA 1DZ1A 5FO9B 4TVAB 4R9WA 2ICEC 1PRTC 3KF8A 1EUJA 2WKDA 3IFTA 4XIGS 2QA4A 1DM0B 4B9XA 1CZGA 5J22A 5LMUQ 4LJZC 3T1YL 3SK4A 2K5HA 1E2ZA 1SDFA 3HKZB 3NQIA 1CUKA 3ULPA 4X3UA 4A3KH 2OWOA 5C3XA 2G9HD 1N9WA 2L1BA 3TQYA 3RZDH 2F4VL 3PF4A 2CWAA 1V9PA 2O5IC 5IGEA 3BZDB 3PIPA 1LT6D 1LT4D 4JI4Q 1S5ED 3TZDA 2CVRA 3A5ZB 4X66L 4A3FH 2KUMA 4CJ1B 2A6EC 3PIP3 3TP7A 2E8GA 2Q8IB 4JI6Q 1SLJA 1C48A 1DJRD 5IGCA 5CV4A 1WVLA 2XWBB 1Q3LA 1HR0L 4HJ7A 1I4GA 4N9PA 1KLUD 4EQNA 1EFWA 1ZYRD 2IX1A 4C2MH 4DR5L 5EBCA 4DR1L 2BA1A 4CDEC 4ZUIA 1FGUA 1S5CD 1L0YB 3JAME 1S4ZA 1U4LA 4H02A 3UE0A 2N49A 3HOYB 1SMXA 4A3DG 2EDGA 1PH4A 1J5EQ 2ZJPA 1I50B 3OSOA 1TIID 2QDBA 3NQTA 4IJHA 4A3IG 1KLGD 4CKBA 1W3SA 1R9TH 5FLMG 1VQMA 5IP9H 4YCVA 1RKNA 3A74A 2MUYA 5EBDA 1CKOA 5D14A 5ELCA 3BYTB 3J7ZC 4JYAQ 3F2UA 5IWAL 1KD1C 1TS5A 4HCEA 4JBJA 4KKUA 1KC8C 3PV0A 2I46A 1PFBA 1HUNA 2B2UC 2VB2X 1N36L 3I4LA 4KY5A 2NZHA 4A3JG 2A68D 4A3BB 4JI5L 1GUWA 4WORA 1KHIA 2LMCB 4A3KG 2UUBL 1AN8A 5FLXc 1BCPD 5D3IB 4DV2Q 4DK6C 4RCOA 3VYSA 4OX9Q 1LTID 2PCFB 3PMFA 1E3PA 4DV6Q 3RN5A 1HR0Q 3F8TA 4OGQC 2Z6KC 3HOXB 1HNZL 4UAIA 1PHJA 2B2WA 1J9OA 4L5QA 3K6OA 4LFCQ 3OIQA 1QUQB 1QUQA 4K5WA 4QIWB 2Z4IA 3PUWA 5IP7H 1Q82C 3RR5A 1Q8IA 1DOKA 1IW7C 1GHJA 3L7ZC 4ZAIA 2EYHA 2I0QA 2XTIA 3NUCA 1E1OA 2E2HB 2Z6BA 4FO2A 1NE3A 4ZK9B 2OQ0A 2EOTA 4XT1B 2SDFA 4AQYQ 2AQ2B 2IHEA 2R92G 5FJ8H 1TVXA 1VQNA 4NDXA 3MXPA 4NPSA 4ME5A 5ELNA 1PYBA 2F4VQ 3ITPA 3S2DH 4DR2Q 1XNQL 1B44D 2A6ED 2XVSA 4OWXB 2CHBD 5J39A 3KYHC 1Q86C 3ONAB 4C3HG 4LFCL 1V1PB 1CA5A 2FJ2A 1H95A 2JE6I 3GTLB 3HOUH 3B6YA 1AP0A 1YIJA 5T1GA 3TRZA 4HAEA 4DV2L 3BDCA 3TS2A 2OTJA 2CH4W 4U673 3QG1A 1SAPA 2AMCB 4A3CH 2PW7A 1VMPA 2WFWA 1GUNA 4IN3A 5IOCA 4YIJA 4APVA 4LUVA 3K0XA 2Q2TA 5CBEE 5LHY1 2HCIA 5I2YA 2NVYH 2NVTH 3O13A 1X3FA 3STBC 3DMUA 3Q6SA 3M7NA 1TWAB 2K32A 1KNEA 4B3RL 2NZOA 3J80E 3CRLC 4RGTA 5IY0A 2IY5B 1TWGH 3A55A 4BY7H 1VQBA 5KIXA 2VQEL 1JQYD 3FKIG 4A3GG 4J8QA 3IRBA 3K58A 1Y1WB 2R93G 1D6EC 1Y1VH 1K0SA 5CYUA 1VDZA 1WTRA 5KNBA 1JR0D 2F3IA 3TMEA 1WD0A 4XYOA 1C9OA 1VQEA 4ME3A 4K8JA 4A76A 2N55A 3D6WA 4KKSA 1YNXA 1FNVA 2JA5B 4N8FA 3QWNA 1B4OA 1IZ6A 4P74A 4E6IA 4JI3L 2B63G 3FPUB 3GTKH 4M8AA 2VUMB 5M3MB 5C4JB 1GXDC 2PPBC 4JI8Q 2K01A 5C3EH 3H94A 3CCUA 3K0YA 5NUCA 4B3SQ 2R93H 2DNEA 3TP6A 3NBIA 3K7AH 5GROA 2WB1E 3UDFA 4FF4A 1TWCH 3K81C 3R8BA 4JI0L 4A3IB 5KNDA 1JB3A 3N6RA 2KHJA 1X32A 4Z9CB 5JAVA 3J80i 3K8AA 4DUZL 1K3RA 3GO5A 3OTOL 2Y0SE 2J4XA 2HHHQ 1N33Q 2QEXA 1M1KC 5IP7G 1H9SB 3SEBA 1BBWA 1B2TA 1MSHA 5CMDA 4LF9Q 3QOJA 1TT2A 3F1ZA 5LMNQ 5CR3A 1CZWA 4C1NI 3DWPA 4LF6L 1Y69U 2EXDA 2EYLA 3MEFA 1NMGA 2F0KA 3I4MB 4RKBA 4FXDA 2AQ1B 2PMZB 1W2BA 1OXSC 2F0HA 3G48A 1FR3A 2ATWA 3VR4A 1GO3E 4JBKA 3MTSA 1MI2A 2WINB 3SK6A 1NR4A 2K4KA 5CORA 1SEBD 1O7ZA 3DWAA 4B3MQ 2R7DA 2A8VA 3PCOB 4LF9L 3GTPH 2A68C 1VQPA 1GKHA 3DWQA 2R61A 4IALA 3PSIA 5M9OA 2XRQD 4JV5Q 4RG1A 2F52A 1FGBD 3GTKB 5DEHA 4P72A 4PQXA 2WAQG 4A3DH 1K8AC 2F0NA 3NELA 1X3EA 2H1EA 5K36H 1S5DD 1VQIA 1CKNA 5FLMH 5TSSA 3RLFA 3V2TA 2FHTA 2UUAQ 3R3OA 4P71A 3FHWA 3WOFA 1WTQA 4B3SL 1EFID 2DN8A 1LM0A 4C56C 1TWGB 1EYGA 2CFMA 1CKMA 1VQJA 2LS01 4C3HH 3QOLA 4JPBW 2AWNA 2EY5A 3KJOA 1K73C 1HZAA 4ID6A 1IXRA 3GTMH 2PNHA 4ZUJA 3JAMi 5C4ZA 5M3FG 4DAYA 2ICIA 1W6JA 3HOZG 5C0XJ 2RHQB 1MSGA 4C3JH 3OWEB 4PMBA 2B39A 5ELDA 4EQ5A 3SGIA 1JCKB 4LF7L 1QVFA 2UXBL 3C1FA 1X3GA 4J15A 3BZCA 1RDPD 2JSOA 1N32Q 2B2UA 2IT1A 3NWSA 3GTGH 5IIFA 2FMMA 1XPUA 4M1UB 1I5FA 2K75A 1VQ7A 3SR1A 1D1KA 1HNXL 2R93B 1BUVT 4IO9A 3I90A 3SXHA 3D4RA 3CC7A 2F0PA 1SJED 4RHRA 2NN6I 1O7IA 1JWMD 3PUYA 4XYQA 1SNMA 1HTPA 2PZTA 4IPDA 4G57A 5KNCA 4QIWE 2K7VA 1PTOH 1XPOA 1VQFA 2DY8A 2ENBA 4N9TA 4C3IG 1RJTA 2A74C 4QF4A 5I4DA 1YITA 1A3TA 3QJYA 1B1ZA 2HUGA 2E5LL 1YJWA 2ES2A 1NR2A 4ZYSA 1VQKA 2VUMG 3PUZA 1A3UA 1ZKOA 2PI2E 3J7A5 3RD4A 3F2BA 2PO4A 1ML0D 1IBKQ 1ET6A 2F3WA 4IFDJ 1QZGA 5FLXE 4MTKA 5CGKA 2RF4A 5M5WH 4GZYC 1FL0A 5E1FA 3J7AV 3J80c 4RHSA 1VQOA 3V96A 4PV1C 2ZM6L 3SE0A 1KRTA 4AQYL 2RCNA 3KF6B 4Q5VA 1IYJB 1N8RC 3BZKA 4KK7A 1YVCA 3DM1A 3ULJA 2PQAB 4BBRB 1PH9A 3UDXA 4DF7A 3TP8A 3CU7A 5BN4A 3GTQB 4IQZA 4XQQA 4C3JB 1EIYB 1K28A 2VS1A 2JA9A 3NHHA 3FVQA 4GKKQ 4L5RC 2IL8A 2PZWA 2WB1G 1T5EA 1IBML 2KA7A 1U9RA 4HJAA 3GTGB 2Q2UA 1YEZA 1BR9A 4X62Q 2XNAC 3HOXH 1QILA 1B3AA 1EIFA 1NBWA 4X65Q 2A69D 3CQZB 3G6EA 2UXDL 3T1HL 2DJGC 1CTMA 1D2BA 1OXVA 5IGGA 1T9HA 2UXCL 4KI0A 4UP9A 1SE8A 1I50H 1CSQA 2V4DA 1J8IA 2ZXRA 1Z6HA 1A15A 1I6HH 3M4PA 4L63B 1XPRA 2LFNA 1I94L 3I8ZA 3NWTA 3AMUA 4PMWA 2VZAA 4FVMA 4LFAL 5DNFA 4B3TL 4ILWA 1Z9FA 2AUJD 3DHQA 1JC7A 2B2VA 1M4VA 2KQ3A 1RL2A 3HOYG 3FKIH 4JCVE 1LTLA 1O78A 3HG9A 1STNA 3GTJB 1LTRD 4UP8A 4FXGC 4A3LH 5IYDH 4TKOB 1OXUA 4YWKA 1IKLA 5IGBA 4DR6Q 5A2QL 1B9NA 4IFDG 4CBVA 4A93B 1Y8PB 4HEDA 3IFDA 3GTQH 1U5KA 5LMNL 1KDCA 5CV7A 1EIGA 3LGJA 2RBMA 1SYBA 4AYBE 4A3JB 1HFGA 4YHHL 4DV4L 4R8NA 4DNIA 3HOZB 1MIUA 1LTGD 1XNRL 5DM73 4L5TA 3LWEA 5EJWA 4DKAC 1BO0A 1VQDA 2E2HH 3C46A 4OHJA 3X3MA 3D0FA 1M8AA 3BVMA 4DUZQ 4BXXG 3M4YA 5M3MH 5AFWA 3T13A 3W1GA 2KVMA 3OHXC 4Y52H 3MXNA 3VDYA 2UUCQ 1U4RA 3S1NH 1TWCB 1X55A 2A5HA 2PQAA 2KHIA 1SYDA 4CHTB 1M90C 2WIIB 1VF7A 2F0WA 3J7YW 4JK1C 4TRDA 1RCVD 4DNRB 4A4IA 5CV9A 4LF8L 4KJOA 4BY1H 1TS2A 1K9MC 1EY0A 5KYIA 5IYCG 3HS0C 3FP9A 3GV6A 4IUPA 4CDDC 3NEMA 4WJ4A 3H0GH 1XJVA 3I4NB 1EY9A 1QJOA 1NTGA 5CV8A 1E24A 2KECA 1HHVA 3H09A 2HIXA 3S14B 4BBRH 4POGA 1PFNA 2K33A 2L11A 4K14A 4HMJA 1PMRA 2IX0A 5GAHC 2ZTCA 2CQOA 1NCVA 4K6DA 3F2CA 4KTAA 4CKCA 1HNWL 3E0EA 3GTJH 5GQOA 1S5FD 3DUZA 4EVOA 5K5PA 3H3VI 1G6PA 1EYDA 1KAAA 1QNUA 4R1JA 2PZUA 2BE5D 2EY2A 1WYDA 3HKZG 3W2DA 3AYHB 4TSSA 3J80L 2O5JC 1KRSA 1SR3A 4P2CB 5CV5A 1QNKA 2MO1A 3HFZB 1CFMA 4CDCC 1S72A 4ABNA 4HJ9A 1Q46A 4X6AH 4FF3A 2NYZD 3FRPB 3PO3H 3V05A 4O42A 1KAWA 1SMYC 4OELB 3M4OB 1CM9A 3IKJA 1YHQA 3A0JA 1WTOA 4RWSC 5FO8B 2FINB 2D0OA 3Q0AA 4KN4C 1BCPF 1Q1BA 3PO2H 3GQBA 5C5MA 3WWVA 3GP7A 3M7GA 2K5DA 1FJGL 1IKMA 1EZ8A 1P8LA 1YI2A 4A3CG 1E2VA 4BBSG 4JI1L 4PZ7A 3HRZC 1HR0W 1LT3D 5G3LD 4LF8Q 3MA2B 3EJIA 3CC4A 4IJLA 3EQLC 4C1NK 4DK3C 2RDGA 5M5YB 4U68A 4DR2L 1VQ6A 1IW7D 1TS4A 2WAQB 4YHHQ 4OO1I 4FDBA 2D0PA 4LF5Q 2IW3A 2DUDA 2MGSA 1C8CA 1C4QA 1SSOA 1VF5C 2L4NA 2YU9H 2D62A 5D65A 5DM63 3NE5B 2JA5G 4A3DB 3W5OA 2MNAA 3GTMB 4BBSH 4FYDA 4XTCS 5KGUA 1SFOB 3PUXA 1Y1VG 1PVOA 1PZID 1MBYA 1QVCA 2L5TA 3MHBA 4A3JH 1IBKL 5CV6A 3NK9A 1SNPA 2NBFA 2NB0A 2HCCA 4RGMA 1W6KA 1HNZQ 2KEDA 4MIUA 2PW5A 1IBLQ 1F9PA 2TMPA 3QO2A 3K5OA 4LF5L 2GVAA 2NN6G 2EXZA 3CAMA 4LFAQ 1UE1A 5M3FB 1BF4A 3S16H 3CPFA 4DR6L 1WCMH 1BKBA 2K6AA 1GUTA 1STYA 4QL5A 1UEBA 3K7UC 1EIHA 1HCZA 2EE1A 2NVXH 3VA7A 5A35A 1TWFH 1FJGQ 5JJIA 1LYLA 1LABA 3MXUA 5AJ3L 3J81E 1IL2A 1HNXQ 1VQ9A 4BWGB 4MNOA 4DR3Q 3HOXG 3C3LA 1TY0A 4WJWA 3I4MG 2UXDQ 4G7OC 1G91A 1HXYD 2E2IH 3STBD 4JC0A 2HQEA 2PNRC 2CKZB 5DLQE 3CHBD 2RKSA 4ZCKA 5E7NA 2AKWB 4O1NA 2VB3X 1LUZA 1NNXA 2RA4A 1G2TA 2PI2A 5EAYA 4A3BH 4R4QA 1OXTA 3GTLH 4RGOS 1SE3A 5IT9E 5I6WA 1GHKA 1HUMA 4PZ8A 1EYCA 4JOIC 1R4PB 4KV6A 4YY3Q 3J81i 3PO3G 1CT1D 5C4XG 4C3HB 4GOPC 3MWYW 5LL6S 1AE2A 4YWLA 2A6HC 3I72A 4R8IA 4IUNA 3NTHA 1NAPA 1AH9A 4IPHA 4DV3Q 3EBEA 1YBYA 2D2CC 3S1MB 5T1IA 2R7FA 3I4OA 1Y8NB 4NXMQ 2N3SA 5A2QE 2OXPA 2JN4A 4P75A 1X56A 3A7LA 2ASBA 3OYYA 4GLVB 4BBRG 5C5LA 4LF6Q 2B29A 4NP5A 1GJXA 3MZ5A 2OF1A 2X69A 1F9QA 3A56A 3EIVA 2Q8TA 1N34L 3U4VA 1JE4A 2ZTEA 1Q1EA 3A8IE 3ICEA 2WKCA 3CF5A 3I56A 1MD2D 2KCTA 1HQMC 5EPJA 3AEVA 3H3VC 2H5XA 4BA1I 5M5YH 2BCOA 2I07B 3KLWA 4A3GB 4JI2L 3U50C 3CPWA 2UU9L 4O2DA 4DFAA 2F0OA 4V190 2SNSA 4JOIA 1K83H 4HIMA 2D5DA 3I91A 1AZQA 1SNCA 3U4ZA 5JPNC 5BN3A 4GS3A 1EEFD 3WOEA 5EPKA 2E74C 3RMHA 2UXBQ 3OMCA 2G9DA 2NZ1D 5C3WA 3PIOA 4IPGA 4JI7L 2LY7A 2Z9HA 3OW2A 1TWAH 2BA0A 1WCMG 4F7XA 3TN2A 5IGDA 4BY7B 2JEAI 4FXKC 3G4SA 4C3IB 4DGZA 4DR7L 2QGQA 3D6CA 1UUPA 1Y1WH 2DNCA 3L3OC 1N36Q 4IURA 1PZKD 1NJIC 4LF7Q 3IL8A 4AYBB 3CMEA 2BOSA 3AU7A 4QY7A 1K0RA 2N78A 1WFQA 2Y0SB 3IAYA 3KBGA 1I94Q 1MHWC 3KDFA 4NW2A 3I4MH 1UNSA 4IUQA 5IYBH 1QWYA 2Q2IA 2F0UA 2B2WC 1J5EL 5C3EG 4GNXB 1I4XA 4A93H 1II3A 1JOQA 3HKSA 3AB9A 1QZHA 2UXCQ 3TREA 2Z8LA 1Q8KA 1G291 3D31A 1K8OA 1E2WA 2A6HD 1ENCA 5HGQA 3I73A 5JEAG 2K52A 1PH1A 4GNXC 1MJEA 4DR1Q 4DUYQ 1R9TB 1LT5D 5H1SE 4C3JG 4O0AA 2X6LA 4NKLA 5I9OA 3OOCA 2I5LX 2F0EA 3HOWG 2SOBA 3ULLA 1RTNA 2JXMB 3K59A 5ELFA 4K0KQ 1JWSD 1F9RA 2VQEQ 3TBIB 3I70A 2F4IA 2IWHA 1NSNS 4HN7A 1LV9A 3EN2A 3G71A 1MGSA 3S1NB 1SYGA 2XIWA 5C4HA 1D5MC 1KDBA 1KTKA 3CCSA 2ZJRA 4JI4L 5DAUA 1LACA 4DXGA 4DAVA 2A19A 4BY1B 2IHFA 2MQHA 4DV0L 3E5SA 2F1MA 4XT3B 4OXPA 1G51A 2BH2A 4ZQ3A 1E1TA 5EPLA 3OTOQ 3PO3B 4FF1A 2PMZE 4HIOA 2WACA 5C4XB 2M00A 1WTHA 1PRTF 2A1AA 3A8KE 1VQ5A 1X3QA 3PO2G 1I4PA 1ICFB 3MXNB 2JEBI 1CHQD 1EU4A 4IUVA 3VR2A 5HY6A 1AZPA 4JI2Q 1BDOA 2LXKA 1CK1A 1V1QA 4EX5A 3BS1A 1VQCA 4X3KA 3H91A 3Q23A 2G5DA 1SE4A 1EQTA 1PTOD 1H9KA 1HRJA 2K03A 2NN6H 5FOBB 1ONLA 3HGBA 1XNQQ 5G3LF 1XMOQ 2KHSA 4R4CA 2Q2HA 4NB3A 3RLOA 1SYEA 5IE8A 2RDFA 3VYTA 1B9MA 4DV5L 3H3VH 3KLRA 1E0BA 1CKNB 4A3EG 1X3PA 1F2MA 4A93G 3OIPA 2B2TC 4JI0Q 2VNUD 1DCZA 1XWEA 3HOYH 2NTSA 4OWWB 4K5XA 3S2HH 5IWAQ 1BCPC 1B8AA 2JQOA 1VMCA 4JG2A 3HOVH 1EWHA 1JJ2A 1A6XA 4ZKCB 3JC66 3Q22A 3K80C 1RODA 2F0QA 2B2YA 2EJMA 4N8X1 1HNWQ 3I4NH 2R7ZG 1ESFA 1O7YA 4GOPA 4POFA 3KOJA 4I7AA 4PZ6A 4H0LC 2KENA 4DR4L 3CCLA 4A3FG 3MFGA 1BNZA 5L37A 3CCEA 2N88A 2CQAA 1ILPA 3KJPA 2JA7B 1EQRA 3UE1A 5FKAC 4RGNA 3I7FA 1WTVA 1ENFA 4KD3A 2LXJA 5D3DA 5I2XA 3U9OA 1SN8A 3PGZA 3BVGA 1K8GA 1TWHB 2O2LD 3A54A 1FNUA 2O4XA 2B2TA 4J1MA 3NPPA 3BU2A 3PF5A 2R7ZH 4F88A 3I4NG 3JAMc 1B53A 1EOTA 1Z7TA 1ASZA 4MHEA 1A63A 1A62A 2JA6B 4X66Q 1L0WA 2UU9Q 4G7HC 1BCPB 2CH4A 3K5NA 3I2ZA 3S1QH 2P5ZX 3JAML 1PFSA 1I4RA 3E9IA 2E2IB 3DXJC 5ISRA 1L2FA 5M3FH 2EY1A 4HTHA 4DV7L 1C7YA 3BDLA 1PH3A 4XQNA 4K6LA 4MTNA 3RLNA 5JVG3 1HA6A 2EIFA 3H0GG 1VQ8A 4LK1C 2DY7A 1L1OA 1EEID 4FF2A 1JJGA 1V1OA 4QQBX 3M3YH 4XQJA 3OWFA 1TWFB 2B3GA 4X64L 3CXCA 5GADC 3TP5A 1SROA 4HIDA 4LNQA 3E9HA 4OL7A 3M9BA 1K8MA 3ER0A 1DGSA 4FNFA 1XX8A 4IOAA 1RF2D 4X64Q 4HSPA 4QJFA 4DV3L 1D5XC 4L6TB 2XN9C 2FFKB 4JI1Q 1U4MA 2YV5A 4BS9A 4BBSB 2F0LA 3EVQA 5GAEC 2L12A 1L1OB 4OWTB 1FYCA 5FO7B 1N33L 3GD7A 2RQXA 2HHHL 1A0IA 5JVH3 1CHPD 4F87A 1N34Q 1CSPA 3FDTA 4K0KL 4BY1G 1BBXC 3S15B 1ZEQX 1I6VC 1LO5D 1EY7A 4UDUC 4B9WA 2F0GA 1JB7A 4DAMA 2Z6KA 4A3MB 4NXML 4Y7NB 5HURA 1XYIA 2DJFC 1STGA 1G8ZD 4DUYL 1STAA 1ENAA 4CDFC 1Y1VB 1LTBD 4DR3L 3HOZH 1TQOA 1YHAA 3CCMA 4A3GH 4JI5Q 3T4AC 1PTOF 3HKZE 3M85A 3R2IA 2NVXB 4H44C 4DV1Q 4KLKA 4ULLA 3VR5A 1HZ9A 1LTTD 2OCEA 1LTSD 1UWVA 3KLSX 1I6HB 1ET9A 4UY8C 1P16A 2JA5H 3D8GA 4QCLA 4I7ZC 4LUZA 1D8LA 4DR5Q 1EZ6A 1F2ZA 1F9SA 2R6GA 5C4JH 2L9HA 4LUOA 5FK9C 1SMYD 2K04A 1KIXA 1RIPA 3G7LA 1B3QA 3T16A 1PH8A 4IFDI 3CC2A 3K7AB 3VR6A 3ERSX 3ND9A 5LMNW 4EQOA 1HPCA 1R4QB 2K14A 2QF7A 3A8JE 3FEWX 2OEOA 4YCUA 1GOZA 1U4PA 3E0JA 1EY6A 1YZ6A 3NSWA 3SK5A 3NENA 2ZT9C 3LNNA 2AQ3B 2CCZA 3QIAA 2R7ZB 5I6YA 5C0XH 5HGTA 3OPOA 4FP5D 4XDXA 4KHVA 4OIJA 4LFBQ 5FJ8G 4LF4Q 1JORA 4JW0A 3TSSA 3S1MH 3SK8A 1AE3A 2JA7G 3EFXD 1EQVA 1UE5A 1VQ4A 4JI6L 4RAUC 1KL9A 1PRTD 4HJ8A 1CQVA 1S40A 1TR5A 2Z1CA 3CW2C 4IZ8A 2EVBA 1Q81C 1IBLL 2AUKA 4RH6A 4AYBG 3T1YQ 2EYMA 2E2JB 1F77A 5LMUL 2F0VA 2C9OA 2L0CA 3HOUG 4K2LA 3J81j 3D4DA 3P75A 1JE5A 1JT8A 1KABA 1OTCA 4GOPB 2B63H 3MXGA 2KCMA 3D3RA 5C0XI 5EQ0A 3VYRA 1NY4A 2H4OA 1IL8A 2K1BA 1PYSB 1YJ9A 4GKJL 1I3QB 2D9UA 1PTOB 2MJ8A 2CW0C 3PQIA 4A3BG 3MEHA 3AQQA 3MC0B 5C44B 4A3EH 1ZXTA 2F0SA 1SE2A 3CMAA 4JBWA 2M9VA 2PYKA 4GN5A 2ZXOA 1X65A 3TDQA 4IUUA 1O7LA 2EYOA 4JBMA 5IGFA 2QKIC 3LX0A 1HH2P 2QILA 4ODGA 3A7AB 1F2YA 5M5WB 3NTIA 4AH6A 1GUOA 5E4WC 3U58A 3UDIA 4R4OA 2B8GA 5ELEA 4JVZA 4K5VA 1ICWA 2ZTDA 3N52A 4DV7Q 1YHBA 4UPAA 3PUVA 2B2YC 1MKHA 2EJGC 4S3SA 4NMZA 4X62L 4LWCA 4MN3A 1SFOH 1SNDA 1CA6A 3FPPA 4DAYB 2VQFL 3C1EA 4KMUC 2PQEA 4CGYB 2JA8G 1HQRD 3GDEA 4EQPA 5IYCH 1YJNA 1H9RA 2XWJB 4RMFA 1STEA 1TKWB 2VQFQ 1SNQA 2F0MA 3NXWA 3KUPA 2K5WA 3BVZA 2ZJQA 1SBBB 1A3VA 1ILQA 4IFDH 2VXWA 3P1HA 2K5VA 4TQUS 4RCNA 5BR8Q 4DU9A 1WJJA 3CD6A 2AWOA 1WCMB 1DXMA 2KEEA 2MO0A 3CQZH 3UDGA 4BY7G 1V1PA 1EWCA 1I4HA 2VW9A 4A3MG 3W1BA 5I9PA 2RVLA 3U9SA 1QVGA 1PRTB 1JOKA 2JA8H 2QCPX 1HFNA 1GD7A 4X3TA 2NVQH 1EY5A 2EPBA 4PMCA 4ZKBB 3KLSA 3VA5A 4DV4Q 4KHPL 2BE5C 2Y0SG 5C44H 4IPCA 2ALYB 2WP8J 3D4WA 1PH2A 1PH5A 2EYPA 2MP1A 3CCJA 2MFIA 3NBHB 1L0XB 4DXFA 1EL0A 2HT1A 1S3OA 2J7ZA 3HZXA 1BQQT 2HD3A 5C3EB 5C0XG 1SJHD 4HR7B 2YTYA 3MVVA 2F03A 4RA8A 1RHPA 2YTXA 2UUCL 1DOLA 3RZDB 5BN5A 2JA7H 1WTPA 1T5XD 1Y1WG 2WAQE 2OT2A 3S2HB 1PH6A 2HIVA 5IT9L 1GUSA 1PFMA 2GVBA 1U0LA 3HOVB 4BA2I 1D1IA 1X6OA 5EKLA 5JJKA 2YYZA 1RD9D 2EYJA 2N8NA 2K50A 1BBUA 3CKIB 3HOWB 2OQKA 2E5LQ 1DYQA 2IX3A 2BH8A 1XNRQ 2QW7A 3LWUA 3X3NA 1XMQL 4R4IA 1AW7A 1YNND 4EGVA 4LF4L 1SYFA 4HSVA 1TS3A 1EQQA 4JI8L 4BXXH 3CP0A 4CJ0B 5ELOA 1PYWD 1NUCA 4JI3Q 3FMCA 4QB4A 2HQLA 2KCCA 3BG3A 2R3ZA 5C6AA 4ZRZA 3L2PA 2F0JA 4HJ5A 2CW0D 3TZUA 1F2LA 3SHLA 2VUMH 1QE6A 2JJQA 1V8QA 3CCVA 3URYA 3VYUA 2AHOB 4A3KB 2NVQB 1IYVA 3NBHA 5FLXL 3ND8A 3S1QB 1LLRD 1X9NA 1E7ZA 2FXQA 3DLLA 1YNJC 2V1CC 1QOHA 3KBXA 4OO1H 3AFPA 5LL6X 2FMCA 2KCNA 1NMFA 3S24A 5IYBG 3UI2A 3K5LA 2MHVA 3GV3A 3CCQA 4I65A 4L8JA 5JEAH 1IYUA 1HJPA 4NXNQ 1UE6A 4LAAA 1XMOL 1V43A 2RSNA 1PA6A 1Z47A 2XRSD 2EYFA 1A8VA 4IUTA 5IODA 4ALPA 5AJ3Q 4KY6A 4LW1A 3I55A 3TS0A 2EZVA 5EKKA 3HOWH 3J81c 2F0TA 2TSSA 4A3MH 2JK8A 2F0FA 4R4TA 1VS0A 5CC4A 2MPMA 2Q8RE 1B50A 1QG7A 4A75A 2K5NA 3H6MA 2BDNA 2BDOA 4GN3B 4QMGA 3EROA 2X6GA 4KN7C 1A2UA 1H9JA 2JA6H 3RZOH 3J81L 2JA8B 4L5SA 4AIMA 3S17H 5JJLA 3PIO3 1VCIA 3ZYYX 2I5HA 3WDNA 2J0TD 3S1RH 3J7AF 2IJ0A 4HCSA 4F8MA 1SYCA 1EOVA 2ZM6Q 1WTXA
chains in the Genus database with same CATH topology
1FD7D 1K83B 2SEBD 4C2MB 2Z4HA 1GUGA 2KJXA 4RKLA 1CI3M 2NTTA 4DN4M 2JP1A 3T56B 3Q24A 2F0IA 4CJ2C 3M3YB 3NP8A 3S9WA 4DNTB 5KYLA 3K5MA 1XTCD 4HMIA 2ZXPA 1JICA 2E2DC 3P20A 2HDMA 3QB3A 4XXEA 2KOLA 3G6JB 3DEOA 2QEJC 1TY2A 1DOMA 3C2PA 2NWGA 2NUCA 3ERQA 4KY7A 1WD1A 4B08A 2SNMA 1UAPA 2M2LA 1EU3A 1IHZA 3S2DB 1Y8OB 5E4XA 3RZOB 1Q12A 1FNWA 2XSCA 5JEAJ 2R92B 2WV6D 4DA2A 1SNOA 1STHA 4RFBA 1TU2B 1JOOA 4QUCA 1H9MA 5JJZA 5JOBA 3MFYA 3HOUB 5CBAE 4V0BA 3PO2B 4OIKA 5JPMC 4H7BA 4H13C 5ELBA 4X3SA 2ID0A 1YNNC 1H9SA 1PDQA 2NVYB 2NVTB 3SVMA 1KDAA 1S5BD 3K57A 3EA6A 5EKIA 2F3VA 1EY4A 1PLFA 1ESRA 4A3EB 3HEJA 5KEEA 1XXGA 2YU9B 4KD4A 5K36G 2WB1B 2EY6A 1I4QA 4DAPA 4CKEA 3OW7A 1YNJD 3FKIB 1D5ZC 1HTLD 4DK0A 3S17B 2K5QA 1ZYRC 2L55A 1EYAA 1UEAB 2RDHA 3S1RB 4KKTA 3VR3A 3NTKA 1AFPA 1SXTA 4A3FB 1WTWA 3S16B 2F0DA 3GTOB 1DONA 4DK1A 4QUFA 3R2TA 2B8FA 3SDZA 2IPKD 1HA5A 5EGTA 2B63B 2EJFC 1KNAA 3RUZA 3BYYB 1PZJD 2JYOA 4ZLTF 3OMGA 4G7ZC 2RSOA 3MAQA 2LKVA 3I3CA 3R93A 1PTOC 1RTOA 5E3FA 5M5XB 3KK7A 4WFN3 4LMQD 1EY8A 1BXTA 4OO1G 3E6ZX 1DD2A 2GA4B 1BOSA 2E76C 2A69C 1QCBD 4WRDA 3DEPA 3HP3A 3T51B 1OO9B 3H0GB 1A2TA 4G4KA 1JWUD 3W3AA 4K2KA 1Q90A 1LTAD 1OXXK 3T53B 4K8IA 4J6HA 4KJNA 2B2VC 1STBA 2E75C 3BDOA 4PNYA 2A73B 1O80A 4KHZA 2K05A 3P7JA 1QB5D 2K28A 3L9AX 5COYA 1CQFA 1PXUA 5F2DA 1G6ZA 1G2SA 3CRKC 4Q0FA 1AEXA 2C5CA 5J1ZA 2HDLA 3GTPB 5KRUA 1DZ1A 5FO9B 4R9WA 2ICEC 1PRTC 3KF8A 2WKDA 3IFTA 4XIGS 1DM0B 4B9XA 1CZGA 5J22A 4LJZC 3SK4A 1E2ZA 1SDFA 3HKZB 3NQIA 4X3UA 5C3XA 2G9HD 2L1BA 2O5IC 5IGEA 3BZDB 1LT6D 1LT4D 1S5ED 3TZDA 2CVRA 2KUMA 4CJ1B 2A6EC 3PIP3 3TP7A 2Q8IB 1C48A 1DJRD 5IGCA 5CV4A 1WVLA 2XWBB 1Q3LA 1I4GA 4N9PA 1KLUD 4EQNA 1ZYRD 2IX1A 5EBCA 2BA1A 4ZUIA 1S5CD 1L0YB 3JAME 1U4LA 1S4ZA 3HOYB 2EDGA 1I50B 1TIID 3OSOA 2QDBA 3NQTA 1KLGD 4CKBA 1RKNA 5ELCA 5EBDA 2MUYA 5D14A 3BYTB 3F2UA 1TS5A 4HCEA 4KKUA 3PV0A 2I46A 1PFBA 1HUNA 2B2UC 2VB2X 3I4LA 4KY5A 2A68D 4A3BB 1GUWA 4WORA 2LMCB 1AN8A 1BCPD 5D3IB 4RCOA 3VYSA 1LTID 2PCFB 3PMFA 4OGQC 3HOXB 4UAIA 2B2WA 1J9OA 3K6OA 3OIQA 4K5WA 4QIWB 2Z4IA 3PUWA 1Q8IA 1DOKA 1IW7C 1GHJA 3L7ZC 4ZAIA 2EYHA 3NUCA 2E2HB 4FO2A 4ZK9B 2EOTA 4XT1B 2SDFA 2AQ2B 1TVXA 4NDXA 3MXPA 4ME5A 3ITPA 1B44D 2A6ED 2XVSA 2CHBD 5J39A 3ONAB 4C3HG 1V1PB 1CA5A 2FJ2A 2JE6I 3GTLB 1AP0A 5T1GA 4HAEA 3BDCA 4U673 3QG1A 1SAPA 2PW7A 1VMPA 1GUNA 4IN3A 5IOCA 4YIJA 5CBEE 5LHY1 2HCIA 5I2YA 3O13A 3DMUA 3Q6SA 3M7NA 1TWAB 2K32A 1KNEA 3J80E 3CRLC 4RGTA 3A55A 5KIXA 1JQYD 4J8QA 3K58A 1Y1WB 1D6EC 5CYUA 1VDZA 1WTRA 5KNBA 1JR0D 3TMEA 1WD0A 4XYOA 4K8JA 2N55A 3D6WA 4KKSA 1FNVA 2JA5B 3QWNA 1B4OA 4E6IA 3FPUB 4M8AA 2VUMB 5M3MB 5C4JB 1GXDC 2PPBC 2K01A 3H94A 3K0YA 5NUCA 2DNEA 3TP6A 3NBIA 4FF4A 3R8BA 4A3IB 5KNDA 1JB3A 3N6RA 4Z9CB 1X32A 5JAVA 3GO5A 2J4XA 1H9SB 3SEBA 1B2TA 1MSHA 5CMDA 3QOJA 1TT2A 5CR3A 1CZWA 4C1NI 3DWPA 1Y69U 2EYLA 2F0KA 3I4MB 4RKBA 4FXDA 2AQ1B 2PMZB 1OXSC 2F0HA 1FR3A 3VR4A 3MTSA 1MI2A 2WINB 3SK6A 1NR4A 5CORA 1SEBD 1O7ZA 3DWAA 2A68C 3DWQA 2R61A 4IALA 5M9OA 2XRQD 1FGBD 3GTKB 5DEHA 4PQXA 2F0NA 2H1EA 5K36H 1S5DD 5TSSA 3RLFA 3V2TA 2FHTA 3R3OA 3WOFA 1WTQA 1EFID 2DN8A 4C56C 1TWGB 2LS01 3QOLA 2AWNA 2EY5A 4ID6A 4ZUJA 5C4ZA 4DAYA 2ICIA 1W6JA 5C0XJ 1MSGA 3OWEB 4PMBA 2B39A 5ELDA 1JCKB 3C1FA 1RDPD 2JSOA 2B2UA 2IT1A 3NWSA 5IIFA 2FMMA 4M1UB 3SR1A 1D1KA 2R93B 1BUVT 3I90A 3SXHA 3D4RA 2F0PA 1SJED 4RHRA 2NN6I 1JWMD 3PUYA 4XYQA 1SNMA 1HTPA 2PZTA 4G57A 5KNCA 2K7VA 1PTOH 2DY8A 2ENBA 4N9TA 4C3IG 1RJTA 2A74C 4QF4A 5I4DA 1A3TA 3QJYA 1B1ZA 2HUGA 1NR2A 4ZYSA 3PUZA 1A3UA 1ZKOA 3RD4A 2PO4A 1ML0D 1ET6A 2F3WA 4IFDJ 5FLXE 5CGKA 4GZYC 5E1FA 3J7AV 4RHSA 3V96A 4PV1C 3SE0A 4Q5VA 4KK7A 3DM1A 4BBRB 4DF7A 3TP8A 3CU7A 5BN4A 3GTQB 4IQZA 4XQQA 4C3JB 3NHHA 3FVQA 2IL8A 2PZWA 1T5EA 2KA7A 1U9RA 3GTGB 1BR9A 2XNAC 1QILA 1B3AA 2A69D 3CQZB 1CTMA 1D2BA 1OXVA 5IGGA 1SYCA 4KI0A 2V4DA 1J8IA 2ZXRA 1Z6HA 1A15A 4L63B 2LFNA 3I8ZA 3NWTA 3AMUA 4PMWA 4FVMA 5DNFA 4ILWA 2AUJD 3DHQA 1JC7A 2B2VA 1M4VA 2KQ3A 1O78A 3HG9A 3GTJB 1STNA 1LTRD 4FXGC 4TKOB 1OXUA 1IKLA 5IGBA 5A2QL 1B9NA 4IFDG 4CBVA 4A93B 1Y8PB 4HEDA 3IFDA 1KDCA 5CV7A 1EIGA 2RBMA 1SYBA 4A3JB 1HFGA 4R8NA 3HOZB 1LTGD 5DM73 3LWEA 5EJWA 1BO0A 3C46A 4OHJA 3X3MA 1M8AA 3BVMA 3M4YA 5AFWA 3T13A 2KVMA 3OHXC 3MXNA 1U4RA 1TWCB 2A5HA 1SYDA 4CHTB 2WIIB 1VF7A 2F0WA 3J7YW 4JK1C 4TRDA 1RCVD 4DNRB 5CV9A 4KJOA 1TS2A 1EY0A 5KYIA 3HS0C 3GV6A 4IUPA 3I4NB 1EY9A 1QJOA 5CV8A 2KECA 1HHVA 3H09A 3S14B 1PFNA 2K33A 2L11A 4K14A 4HMJA 1PMRA 2IX0A 4K6DA 1NCVA 4KTAA 4CKCA 1S5FD 3DUZA 4EVOA 5K5PA 1EYDA 1KAAA 1QNUA 2PZUA 2BE5D 2EY2A 3W2DA 4TSSA 3J80L 2O5JC 4P2CB 5CV5A 1QNKA 1CFMA 4ABNA 4FF3A 2NYZD 3FRPB 3V05A 4O42A 1SMYC 3M4OB 1CM9A 3IKJA 1WTOA 4RWSC 5FO8B 2FINB 3Q0AA 4KN4C 1BCPF 1Q1BA 3GQBA 5C5MA 3GP7A 3M7GA 2K5DA 1IKMA 1EZ8A 1E2VA 3HRZC 1LT3D 5G3LD 3MA2B 3EJIA 3EQLC 4C1NK 2RDGA 5M5YB 4U68A 1IW7D 1TS4A 2WAQB 4OO1I 2IW3A 2MGSA 1C8CA 1C4QA 1SSOA 1VF5C 2L4NA 2D62A 5D65A 5DM63 3NE5B 4A3DB 3GTMB 4FYDA 4XTCS 5KGUA 1SFOB 3PUXA 1PZID 1MBYA 2L5TA 3MHBA 5CV6A 3NK9A 1SNPA 2NBFA 2NB0A 2HCCA 4RGMA 1W6KA 2KEDA 4MIUA 2PW5A 1F9PA 2TMPA 3QO2A 3K5OA 2NN6G 2EXZA 5M3FB 1BF4A 2K6AA 1GUTA 1STYA 1EIHA 1HCZA 2EE1A 3VA7A 5A35A 1LABA 3MXUA 3J81E 4BWGB 3C3LA 1TY0A 4WJWA 4G7OC 1G91A 1HXYD 2HQEA 2PNRC 3CHBD 2RKSA 4O1NA 2VB3X 2RA4A 1G2TA 1OXTA 4RGOS 1SE3A 5IT9E 5I6WA 1GHKA 1HUMA 1EYCA 1R4PB 4KV6A 1CT1D 4C3HB 3MWYW 5LL6S 2A6HC 3I72A 4R8IA 4IUNA 3NTHA 1NAPA 2D2CC 3S1MB 5T1IA 1Y8NB 5A2QE 2OXPA 3A7LA 5C5LA 4NP5A 1GJXA 3MZ5A 2OF1A 2X69A 1F9QA 3A56A 2Q8TA 1JE4A 1Q1EA 3A8IE 2WKCA 1MD2D 1HQMC 5EPJA 3H3VC 4BA1I 2BCOA 2I07B 4A3GB 4DFAA 2F0OA 4V190 2SNSA 2D5DA 3I91A 1AZQA 1SNCA 5JPNC 5BN3A 1EEFD 3WOEA 5EPKA 2E74C 3RMHA 3OMCA 2G9DA 2NZ1D 5C3WA 2LY7A 2BA0A 4F7XA 3TN2A 5IGDA 4BY7B 2JEAI 4FXKC 4C3IB 4DGZA 3D6CA 1UUPA 2DNCA 3L3OC 4IURA 1PZKD 3IL8A 4AYBB 2BOSA 3AU7A 3IAYA 2Y0SB 3KBGA 4NW2A 1UNSA 4IUQA 1QWYA 2F0UA 2B2WC 1I4XA 1II3A 1JOQA 3AB9A 2Z8LA 1G291 3D31A 1K8OA 1E2WA 2A6HD 1ENCA 3I73A 5JEAG 1R9TB 1LT5D 4C3JG 2X6LA 4NKLA 5I9OA 3OOCA 2F0EA 2SOBA 1RTNA 2JXMB 3K59A 5ELFA 1JWSD 1F9RA 3TBIB 3I70A 2F4IA 2IWHA 1NSNS 4HN7A 1LV9A 1MGSA 3S1NB 1SYGA 2XIWA 5C4HA 1D5MC 1KDBA 1KTKA 5DAUA 1LACA 4DXGA 4DAVA 4BY1B 3E5SA 2F1MA 4XT3B 4ZQ3A 5EPLA 3PO3B 4FF1A 2WACA 5C4XB 2M00A 1PRTF 3A8KE 1X3QA 1I4PA 2JEBI 1CHQD 1EU4A 4IUVA 3VR2A 1AZPA 1BDOA 1CK1A 3BS1A 4X3KA 3H91A 3Q23A 1SE4A 1EQTA 1PTOD 1H9KA 1HRJA 2K03A 2NN6H 5FOBB 1ONLA 3HGBA 5G3LF 2KHSA 1SYEA 2RDFA 3VYTA 1B9MA 3KLRA 1E0BA 1X3PA 1F2MA 3OIPA 2B2TC 2VNUD 1DCZA 1XWEA 2NTSA 4K5XA 1BCPC 1VMCA 1EWHA 1A6XA 4ZKCB 3Q22A 1RODA 2F0QA 2B2YA 2EJMA 1ESFA 1O7YA 4H0LC 3MFGA 1BNZA 2N88A 2CQAA 1ILPA 2JA7B 5FKAC 4RGNA 1WTVA 1ENFA 4KD3A 5D3DA 5I2XA 3U9OA 3BVGA 1TWHB 2O2LD 3A54A 1FNUA 2O4XA 2B2TA 4J1MA 3NPPA 4F88A 1B53A 1EOTA 1Z7TA 4MHEA 2JA6B 4G7HC 1BCPB 3K5NA 3JAML 1I4RA 2E2IB 3DXJC 5ISRA 2EY1A 4HTHA 3BDLA 4XQNA 4K6LA 5JVG3 1HA6A 2DY7A 4LK1C 1EEID 4FF2A 1V1OA 4XQJA 3OWFA 1TWFB 3TP5A 4OL7A 1K8MA 4FNFA 1XX8A 1RF2D 4HSPA 1D5XC 4L6TB 2XN9C 2FFKB 1U4MA 4BS9A 4BBSB 2F0LA 3EVQA 2L12A 1FYCA 5FO7B 3GD7A 2RQXA 5JVH3 1CHPD 4F87A 3FDTA 1BBXC 3S15B 1ZEQX 1I6VC 1LO5D 1EY7A 4UDUC 4B9WA 2F0GA 4A3MB 4Y7NB 5HURA 1XYIA 1STGA 1G8ZD 1STAA 1ENAA 1Y1VB 1LTBD 1TQOA 3T4AC 1PTOF 3M85A 3R2IA 2NVXB 4H44C 4ULLA 3VR5A 1LTTD 1LTSD 3KLSX 1I6HB 1ET9A 3D8GA 4QCLA 4I7ZC 1EZ6A 1F2ZA 1F9SA 2R6GA 2L9HA 5FK9C 1SMYD 2K04A 3T16A 3G7LA 4IFDI 3K7AB 3VR6A 3ND9A 4EQOA 1HPCA 1R4QB 2QF7A 3A8JE 3FEWX 2OEOA 1GOZA 1U4PA 3E0JA 1EY6A 3NSWA 3SK5A 2ZT9C 3LNNA 2AQ3B 3QIAA 2R7ZB 5I6YA 5C0XH 5HGTA 3OPOA 4FP5D 4KHVA 4OIJA 1JORA 3TSSA 3SK8A 3EFXD 1EQVA 4RAUC 1PRTD 1CQVA 1TR5A 2Z1CA 4IZ8A 2EVBA 2AUKA 4RH6A 2EYMA 2E2JB 1F77A 2F0VA 2C9OA 2L0CA 4K2LA 3D4DA 3P75A 1KABA 3MXGA 3D3RA 5C0XI 5EQ0A 3VYRA 2H4OA 1IL8A 2K1BA 1I3QB 2D9UA 1PTOB 2MJ8A 2CW0C 3MEHA 3MC0B 5C44B 1ZXTA 2F0SA 1SE2A 4JBWA 2M9VA 2PYKA 2ZXOA 3TDQA 4IUUA 1O7LA 2EYOA 5IGFA 2QKIC 3LX0A 2QILA 4ODGA 3A7AB 1F2YA 5M5WB 3NTIA 1GUOA 5E4WC 2B8GA 5ELEA 4K5VA 1ICWA 3N52A 3PUVA 2B2YC 2EJGC 4S3SA 4NMZA 4MN3A 1SNDA 1CA6A 3FPPA 3C1EA 4KMUC 2PQEA 4CGYB 1HQRD 4EQPA 1H9RA 2XWJB 1STEA 1TKWB 1SNQA 2F0MA 3NXWA 3KUPA 2K5WA 3BVZA 1SBBB 1A3VA 1ILQA 4IFDH 2VXWA 3P1HA 4TQUS 4RCNA 4DU9A 2AWOA 1WCMB 1DXMA 2KEEA 1V1PA 1EWCA 1I4HA 5I9PA 2RVLA 3U9SA 1PRTB 1JOKA 2QCPX 1HFNA 4X3TA 1EY5A 2EPBA 4PMCA 4ZKBB 3KLSA 3VA5A 2BE5C 2WP8J 3D4WA 2EYPA 2MP1A 4DXFA 1L0XB 1EL0A 2J7ZA 3HZXA 1BQQT 5C3EB 5C0XG 1SJHD 4HR7B 3MVVA 2F03A 4RA8A 1RHPA 1DOLA 3RZDB 5BN5A 1WTPA 1T5XD 2OT2A 3S2HB 5IT9L 1GUSA 1PFMA 3HOVB 4BA2I 1D1IA 5EKLA 2YYZA 1RD9D 2EYJA 3CKIB 3HOWB 1DYQA 2IX3A 3LWUA 3X3NA 1AW7A 1YNND 4EGVA 1SYFA 4HSVA 1TS3A 4CJ0B 1PYWD 1NUCA 3FMCA 4QB4A 2KCCA 3BG3A 2R3ZA 5C6AA 4ZRZA 2F0JA 2CW0D 3TZUA 1F2LA 3SHLA 1QE6A 1V8QA 3URYA 3VYUA 2NVQB 4A3KB 1IYVA 3NBHA 5FLXL 3ND8A 3S1QB 1LLRD 1YNJC 1QOHA 3KBXA 4OO1H 5LL6X 2FMCA 2KCNA 3UI2A 3K5LA 2MHVA 3GV3A 4I65A 4L8JA 5JEAH 1IYUA 4LAAA 1V43A 2RSNA 1Z47A 2XRSD 2EYFA 4IUTA 5IODA 4KY6A 2EZVA 5EKKA 2F0TA 2TSSA 2F0FA 5CC4A 2MPMA 2Q8RE 1B50A 1QG7A 3H6MA 2BDNA 2BDOA 4QMGA 3EROA 2X6GA 4KN7C 1A2UA 1H9JA 3J81L 2JA8B 3PIO3 1VCIA 3ZYYX 3WDNA 2J0TD 3J7AF 2IJ0A 4HCSA 4F8MA 4XDXA 1WTXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K6D A;  5IIF A;  1KDB A;  4KTA A;  4DFA A;  2F0O A;  4ZUI A;  1SYF A;  2SNS A;  1STY A;  4K2K A;  5DAU A;  3QOJ A;  2F3V A;  3SR1 A;  3D8G A;  1EY4 A;  5K5P A;  1TT2 A;  4EVO A;  1SNC A;  3BDC A;  3HEJ A;  4RKL A;  1EYD A;  5CR3 A;  4K5V A;  5KEE A;  1NUC A;  1KAA A;  4K8I A;  3SXH A;  4J6H A;  1EZ6 A;  1F2Z A;  2EYL A;  2PZU A;  2EY2 A;  2F0P A;  4KJN A;  1STB A;  2F0K A;  2PW7 A;  4KD4 A;  3E5S A;  4QB4 A;  4RKB A;  5IOC A;  4YIJ A;  4PNY A;  4S3S A;  5CV5 A;  4ZQ3 A;  1SNM A;  4NMZ A;  3T16 A;  3OSO A;  3DHQ A;  2PZT A;  2QDB A;  2F0H A;  3NQT A;  4G57 A;  2EY6 A;  5C6A A;  1SND A;  2WAC A;  2F0I A;  2M00 A;  2F0J A;  3OMC A;  2KQ3 A;  3NP8 A;  5ISR A;  4EQO A;  5C3W A;  2EY1 A;  3C1E A;  4HTH A;  3SK6 A;  3S9W A;  1RKN A;  2OEO A;  2PQE A;  2ENB A;  3BDL A;  1STN A;  4N9T A;  3SHL A;  5KYL A;  2HQE A;  4EQP A;  3DMU A;  5F2D A;  4QF4 A;  1A3T A;  1EY6 A;  1EYA A;  1SNQ A;  2F0M A;  2RKS A;  3NXW A;  4HMI A;  4J1M A;  4F7X A;  1AEX A;  5IGD A;  3SK5 A;  1A3U A;  3QB3 A;  4IAL A;  5J1Z A;  5IGB A;  1A3V A;  4KY5 A;  2KHS A;  4DGZ A;  4ODG A;  3P1H A;  4DU9 A;  5KIX A;  5KRU A;  3OWF A;  5M9O A;  3D6C A;  1SYE A;  5C5M A;  5I6Y A;  2F3W A;  3TP5 A;  4F8M A;  5HGT A;  4OL7 A;  4WOR A;  5CGK A;  1KDC A;  2F0D A;  5CV7 A;  2RDF A;  5DEH A;  5I6W A;  4KHV A;  1EZ8 A;  2RBM A;  1EYC A;  1SYB A;  5E1F A;  4B9X A;  5J22 A;  5I9P A;  1JOR A;  2F0N A;  4KV6 A;  5EGT A;  1F2M A;  3SK8 A;  3SK4 A;  4R8N A;  1EQV A;  1JOK A;  3TME A;  3EJI A;  5CV6 A;  2NUC A;  3ERQ A;  4KY7 A;  4K8J A;  3RUZ A;  1EY5 A;  1TR5 A;  3PMF A;  4PMC A;  2F0L A;  3EVQ A;  4IZ8 A;  4K5X A;  4I65 A;  2SNM A;  2F0U A;  3V2T A;  3VA5 A;  4IUN A;  3OMG A;  5C3X A;  2EYM A;  3R3O A;  4DF7 A;  2F0V A;  3TP8 A;  4E6I A;  2LKV A;  1II3 A;  1IHZ A;  3D4W A;  4K2L A;  3D4D A;  4LAA A;  1JOQ A;  2EYP A;  3P75 A;  3T13 A;  1KAB A;  2EYF A;  4K5W A;  5IOD A;  5IGE A;  1ENC A;  2F0Q A;  2OXP A;  3HZX A;  4KY6 A;  5NUC A;  5E3F A;  1SNO A;  1STH A;  2EYH A;  3NHH A;  5EKK A;  5C5L A;  3NUC A;  3QOL A;  3TP6 A;  3MVV A;  2F0T A;  1JOO A;  1SYD A;  4NP5 A;  2F0W A;  2F0F A;  2PZW A;  2EY5 A;  5KGU A;  1EY8 A;  3MZ5 A;  4TRD A;  1EY7 A;  2OF1 A;  1U9R A;  4ID6 A;  5JOB A;  4B9W A;  5CC4 A;  2F0G A;  4ZUJ A;  4NKL A;  3MEH A;  3TP7 A;  5CV9 A;  5HUR A;  5C4Z A;  5I9O A;  4KJO A;  3MHB A;  1STG A;  2F0E A;  3H6M A;  4H7B A;  2F0S A;  2SOB A;  3NK9 A;  1STA A;  1ENA A;  4QMG A;  4NDX A;  1EY0 A;  3ERO A;  1SNP A;  3MXP A;  4ME5 A;  2PYK A;  5JAV A;  5IGC A;  5KYI A;  1A2U A;  3ITP A;  5CV4 A;  4WRD A;  4PMB A;  5EKL A;  1TQO A;  4KD3 A;  1NSN S;  2EYO A;  4MIU A;  2PW5 A;  5IGG A;  1EY9 A;  1A2T A;  3C1F A;  2EYJ A;  5CV8 A;  3U9O A;  5IGF A;  5J39 A;  4N9P A;  4EQN A;  1SYG A;  3LX0 A;  1KDA A;  2EXZ A;  2O4X A;  4K14 A;  5C4H A;  4HMJ A;  1SYC A;  1F2Y A; 
#chains in the Genus database with same CATH topology
 1FVI A;  4WJ3 M;  1FD7 D;  1K83 B;  1X54 A;  2SEB D;  4C2M B;  1Q7Y C;  2Z4H A;  4DPG A;  1GUG A;  2KJX A;  4RKL A;  2YTV A;  1CI3 M;  2NTT A;  2QDL A;  4DN4 M;  2JP1 A;  1N32 L;  4JI7 Q;  1Y14 B;  1KQS A;  3T56 B;  2JA6 G;  3Q24 A;  2F0I A;  4CJ2 C;  3M3Y B;  3NP8 A;  4UP7 A;  3H15 A;  3S9W A;  4DNT B;  4KHP Q;  5KYL A;  1XMQ Q;  1XTD A;  3K5M A;  4A3L G;  1XTC D;  1HZC A;  3Q8D A;  4HMI A;  4MZ9 A;  4HIK A;  2ZXP A;  1JIC A;  2E2D C;  4C3I H;  3P20 A;  2HDM A;  3QB3 A;  5M5X H;  5IYD G;  4OEM B;  4XXE A;  2KOL A;  3G6J B;  4OON A;  3RNU A;  3DEO A;  1D7Q A;  4B3T Q;  3E3X A;  2QEJ C;  5BR8 L;  1TY2 A;  1DOM A;  3L0O A;  5IT9 c;  1C0A A;  3C2P A;  4JYA L;  3KF8 B;  2NWG A;  2NUC A;  3DM3 A;  3ERQ A;  4KY7 A;  2E2J H;  3S15 H;  1WD1 A;  4B08 A;  5M3M G;  2SNM A;  5C4X H;  1ASY A;  1UAP A;  4DR7 Q;  2M2L A;  1EU3 A;  1IHZ A;  3S2D B;  1Y8O B;  5E4X A;  2C35 B;  3RZO B;  1Q12 A;  1FNW A;  2RCF A;  2XSC A;  5JEA J;  2WV6 D;  2R92 B;  4DA2 A;  4DR4 Q;  1SNO A;  1STH A;  4RFB A;  1I3Q H;  1TU2 B;  4X65 L;  1JOO A;  4YWM A;  4QUC A;  1EWI A;  1H9M A;  5JJZ A;  5JOB A;  3KF6 A;  3MFY A;  3HOU B;  5CBA E;  4V0B A;  3PO2 B;  1MJC A;  4OIK A;  1WI5 A;  5J3B A;  5JPM C;  4YY3 L;  4H7B A;  4GKK L;  4H13 C;  1E22 A;  5ELB A;  4X3S A;  2UUA L;  4P73 A;  2ID0 A;  4YCW A;  1JJC B;  1YNN C;  1H9S A;  1PDQ A;  4GLX A;  2NVY B;  2NVT B;  3A5U A;  3SVM A;  1KDA A;  1S5B D;  5GAG C;  5C44 G;  3K57 A;  3EA6 A;  5EKI A;  2F3V A;  1EY4 A;  1PLF A;  1GVP A;  1ESR A;  4A3E B;  3HEJ A;  5KEE A;  1VQL A;  1BVS A;  1XXG A;  1JMC A;  2YU9 B;  4JV5 L;  1UE7 A;  4KD4 A;  5K36 G;  2WB1 B;  2EY6 A;  1I4Q A;  4DAP A;  4CKE A;  3OW7 A;  4B3M L;  1YNJ D;  3FKI B;  2DGY A;  1D5Z C;  1HTL D;  4DK0 A;  3S17 B;  2K5Q A;  1ZYR C;  2L55 A;  1EYA A;  3QR8 A;  4GNX A;  1UEA B;  2RDH A;  3S1R B;  2VY3 A;  4KKT A;  3RN2 A;  1TWH H;  1B70 B;  4DV0 Q;  3VR3 A;  3NTK A;  4LFB L;  4IOC A;  1AFP A;  1SXT A;  4A3F B;  1WTW A;  3S16 B;  1VQG A;  4DV6 L;  2F0D A;  2RHS B;  5IP9 G;  3GTO B;  1B7Y B;  4OX9 L;  1DON A;  4DK1 A;  2R92 H;  2I5M X;  4QUF A;  3R2T A;  2KBN A;  2B8F A;  2L15 A;  2IPK D;  1HA5 A;  5EGT A;  3SDZ A;  2B63 B;  1L1O C;  2EJF C;  1KNA A;  2UUB Q;  3RUZ A;  3BYY B;  1PZJ D;  2JYO A;  1J6Q A;  4ZLT F;  3OMG A;  4G7Z C;  2RSO A;  4GN4 B;  3MAQ A;  2LKV A;  4GLA C;  3AFQ A;  1TXY A;  1VQH A;  2GN5 A;  3I3C A;  3R93 A;  1PTO C;  1RTO A;  5E3F A;  5M5X B;  3KK7 A;  4WFN 3;  1GM5 A;  4LMQ D;  1EY8 A;  1BXT A;  4OO1 G;  3E6Z X;  2OTL A;  4B3R Q;  1DD2 A;  2GA4 B;  1BOS A;  2LSS A;  3KFU A;  2E76 C;  2A69 C;  4QGU A;  4A3I H;  4DV1 L;  3F2D A;  3KDF B;  1QCB D;  4WRD A;  3DEP A;  3HP3 A;  3T51 B;  1OO9 B;  3H0G B;  1A2T A;  1SRU A;  4G4K A;  3S14 H;  2VL6 A;  3T1H Q;  4NXN L;  1JWU D;  3ZJY C;  3W3A A;  4K2K A;  2CWP A;  3HOV G;  1Q90 A;  2XGT A;  4PG3 A;  1WOC A;  1IBM Q;  3BJU A;  1LTA D;  1OXX K;  3T53 B;  4K8I A;  4J6H A;  4KJN A;  2B2V C;  4UHV A;  1STB A;  3CCR A;  2E75 C;  2EQS A;  3BDO A;  4PNY A;  1KXL A;  2A73 B;  3M4Q A;  1O80 A;  4KHZ A;  4Y7N H;  2K05 A;  3P7J A;  3L9A X;  1QB5 D;  2K28 A;  5COY A;  3GTO H;  1CQF A;  1PXU A;  5F2D A;  3M4O H;  1G6Z A;  1G2S A;  3CRK C;  4Q0F A;  4DV5 Q;  4GKJ Q;  1AEX A;  1PH7 A;  2C5C A;  3TEH B;  5J1Z A;  1PV4 A;  2HDL A;  1VQA A;  1K3B C;  3GTP B;  1HZB A;  5KRU A;  2Z0S A;  1DZ1 A;  5FO9 B;  4TVA B;  4R9W A;  2ICE C;  1PRT C;  3KF8 A;  1EUJ A;  2WKD A;  3IFT A;  4XIG S;  2QA4 A;  1DM0 B;  4B9X A;  1CZG A;  5J22 A;  5LMU Q;  4LJZ C;  3T1Y L;  3SK4 A;  2K5H A;  1E2Z A;  1SDF A;  3HKZ B;  3NQI A;  1CUK A;  3ULP A;  4X3U A;  4A3K H;  2OWO A;  5C3X A;  2G9H D;  1N9W A;  2L1B A;  3TQY A;  3RZD H;  2F4V L;  3PF4 A;  2CWA A;  1V9P A;  2O5I C;  5IGE A;  3BZD B;  3PIP A;  1LT6 D;  1LT4 D;  4JI4 Q;  1S5E D;  3TZD A;  2CVR A;  3A5Z B;  4X66 L;  4A3F H;  2KUM A;  4CJ1 B;  2A6E C;  3PIP 3;  3TP7 A;  2E8G A;  2Q8I B;  4JI6 Q;  1SLJ A;  1C48 A;  1DJR D;  5IGC A;  5CV4 A;  1WVL A;  2XWB B;  1Q3L A;  1HR0 L;  4HJ7 A;  1I4G A;  4N9P A;  1KLU D;  4EQN A;  1EFW A;  1ZYR D;  2IX1 A;  4C2M H;  4DR5 L;  5EBC A;  4DR1 L;  2BA1 A;  4CDE C;  4ZUI A;  1FGU A;  1S5C D;  1L0Y B;  3JAM E;  1S4Z A;  1U4L A;  4H02 A;  3UE0 A;  2N49 A;  3HOY B;  1SMX A;  4A3D G;  2EDG A;  1PH4 A;  1J5E Q;  2ZJP A;  1I50 B;  3OSO A;  1TII D;  2QDB A;  3NQT A;  4IJH A;  4A3I G;  1KLG D;  4CKB A;  1W3S A;  1R9T H;  5FLM G;  1VQM A;  5IP9 H;  4YCV A;  1RKN A;  3A74 A;  2MUY A;  5EBD A;  1CKO A;  5D14 A;  5ELC A;  3BYT B;  3J7Z C;  4JYA Q;  3F2U A;  5IWA L;  1KD1 C;  1TS5 A;  4HCE A;  4JBJ A;  4KKU A;  1KC8 C;  3PV0 A;  2I46 A;  1PFB A;  1HUN A;  2B2U C;  2VB2 X;  1N36 L;  3I4L A;  4KY5 A;  2NZH A;  4A3J G;  2A68 D;  4A3B B;  4JI5 L;  1GUW A;  4WOR A;  1KHI A;  2LMC B;  4A3K G;  2UUB L;  1AN8 A;  5FLX c;  1BCP D;  5D3I B;  4DV2 Q;  4DK6 C;  4RCO A;  3VYS A;  4OX9 Q;  1LTI D;  2PCF B;  3PMF A;  1E3P A;  4DV6 Q;  3RN5 A;  1HR0 Q;  3F8T A;  4OGQ C;  2Z6K C;  3HOX B;  1HNZ L;  4UAI A;  1PHJ A;  2B2W A;  1J9O A;  4L5Q A;  3K6O A;  4LFC Q;  3OIQ A;  1QUQ B;  1QUQ A;  4K5W A;  4QIW B;  2Z4I A;  3PUW A;  5IP7 H;  1Q82 C;  3RR5 A;  1Q8I A;  1DOK A;  1IW7 C;  1GHJ A;  3L7Z C;  4ZAI A;  2EYH A;  2I0Q A;  2XTI A;  3NUC A;  1E1O A;  2E2H B;  2Z6B A;  4FO2 A;  1NE3 A;  4ZK9 B;  2OQ0 A;  2EOT A;  4XT1 B;  2SDF A;  4AQY Q;  2AQ2 B;  2IHE A;  2R92 G;  5FJ8 H;  1TVX A;  1VQN A;  4NDX A;  3MXP A;  4NPS A;  4ME5 A;  5ELN A;  1PYB A;  2F4V Q;  3ITP A;  3S2D H;  4DR2 Q;  1XNQ L;  1B44 D;  2A6E D;  2XVS A;  4OWX B;  2CHB D;  5J39 A;  3KYH C;  1Q86 C;  3ONA B;  4C3H G;  4LFC L;  1V1P B;  1CA5 A;  2FJ2 A;  1H95 A;  2JE6 I;  3GTL B;  3HOU H;  3B6Y A;  1AP0 A;  1YIJ A;  5T1G A;  3TRZ A;  4HAE A;  4DV2 L;  3BDC A;  3TS2 A;  2OTJ A;  2CH4 W;  4U67 3;  3QG1 A;  1SAP A;  2AMC B;  4A3C H;  2PW7 A;  1VMP A;  2WFW A;  1GUN A;  4IN3 A;  5IOC A;  4YIJ A;  4APV A;  4LUV A;  3K0X A;  2Q2T A;  5CBE E;  5LHY 1;  2HCI A;  5I2Y A;  2NVY H;  2NVT H;  3O13 A;  1X3F A;  3STB C;  3DMU A;  3Q6S A;  3M7N A;  1TWA B;  2K32 A;  1KNE A;  4B3R L;  2NZO A;  3J80 E;  3CRL C;  4RGT A;  5IY0 A;  2IY5 B;  1TWG H;  3A55 A;  4BY7 H;  1VQB A;  5KIX A;  2VQE L;  1JQY D;  3FKI G;  4A3G G;  4J8Q A;  3IRB A;  3K58 A;  1Y1W B;  2R93 G;  1D6E C;  1Y1V H;  1K0S A;  5CYU A;  1VDZ A;  1WTR A;  5KNB A;  1JR0 D;  2F3I A;  3TME A;  1WD0 A;  4XYO A;  1C9O A;  1VQE A;  4ME3 A;  4K8J A;  4A76 A;  2N55 A;  3D6W A;  4KKS A;  1YNX A;  1FNV A;  2JA5 B;  4N8F A;  3QWN A;  1B4O A;  1IZ6 A;  4P74 A;  4E6I A;  4JI3 L;  2B63 G;  3FPU B;  3GTK H;  4M8A A;  2VUM B;  5M3M B;  5C4J B;  1GXD C;  2PPB C;  4JI8 Q;  2K01 A;  5C3E H;  3H94 A;  3CCU A;  3K0Y A;  5NUC A;  4B3S Q;  2R93 H;  2DNE A;  3TP6 A;  3NBI A;  3K7A H;  5GRO A;  2WB1 E;  3UDF A;  4FF4 A;  1TWC H;  3K81 C;  3R8B A;  4JI0 L;  4A3I B;  5KND A;  1JB3 A;  3N6R A;  2KHJ A;  1X32 A;  4Z9C B;  5JAV A;  3J80 i;  3K8A A;  4DUZ L;  1K3R A;  3GO5 A;  3OTO L;  2Y0S E;  2J4X A;  2HHH Q;  1N33 Q;  2QEX A;  1M1K C;  5IP7 G;  1H9S B;  3SEB A;  1BBW A;  1B2T A;  1MSH A;  5CMD A;  4LF9 Q;  3QOJ A;  1TT2 A;  3F1Z A;  5LMN Q;  5CR3 A;  1CZW A;  4C1N I;  3DWP A;  4LF6 L;  1Y69 U;  2EXD A;  2EYL A;  3MEF A;  1NMG A;  2F0K A;  3I4M B;  4RKB A;  4FXD A;  2AQ1 B;  2PMZ B;  1W2B A;  1OXS C;  2F0H A;  3G48 A;  1FR3 A;  2ATW A;  3VR4 A;  1GO3 E;  4JBK A;  3MTS A;  1MI2 A;  2WIN B;  3SK6 A;  1NR4 A;  2K4K A;  5COR A;  1SEB D;  1O7Z A;  3DWA A;  4B3M Q;  2R7D A;  2A8V A;  3PCO B;  4LF9 L;  3GTP H;  2A68 C;  1VQP A;  1GKH A;  3DWQ A;  2R61 A;  4IAL A;  3PSI A;  5M9O A;  2XRQ D;  4JV5 Q;  4RG1 A;  2F52 A;  1FGB D;  3GTK B;  5DEH A;  4P72 A;  4PQX A;  2WAQ G;  4A3D H;  1K8A C;  2F0N A;  3NEL A;  1X3E A;  2H1E A;  5K36 H;  1S5D D;  1VQI A;  1CKN A;  5FLM H;  5TSS A;  3RLF A;  3V2T A;  2FHT A;  2UUA Q;  3R3O A;  4P71 A;  3FHW A;  3WOF A;  1WTQ A;  4B3S L;  1EFI D;  2DN8 A;  1LM0 A;  4C56 C;  1TWG B;  1EYG A;  2CFM A;  1CKM A;  1VQJ A;  2LS0 1;  4C3H H;  3QOL A;  4JPB W;  2AWN A;  2EY5 A;  3KJO A;  1K73 C;  1HZA A;  4ID6 A;  1IXR A;  3GTM H;  2PNH A;  4ZUJ A;  3JAM i;  5C4Z A;  5M3F G;  4DAY A;  2ICI A;  1W6J A;  3HOZ G;  5C0X J;  2RHQ B;  1MSG A;  4C3J H;  3OWE B;  4PMB A;  2B39 A;  5ELD A;  4EQ5 A;  3SGI A;  1JCK B;  4LF7 L;  1QVF A;  2UXB L;  3C1F A;  1X3G A;  4J15 A;  3BZC A;  1RDP D;  2JSO A;  1N32 Q;  2B2U A;  2IT1 A;  3NWS A;  3GTG H;  5IIF A;  2FMM A;  1XPU A;  4M1U B;  1I5F A;  2K75 A;  1VQ7 A;  3SR1 A;  1D1K A;  1HNX L;  2R93 B;  1BUV T;  4IO9 A;  3I90 A;  3SXH A;  3D4R A;  3CC7 A;  2F0P A;  1SJE D;  4RHR A;  2NN6 I;  1O7I A;  1JWM D;  3PUY A;  4XYQ A;  1SNM A;  1HTP A;  2PZT A;  4IPD A;  4G57 A;  5KNC A;  4QIW E;  2K7V A;  1PTO H;  1XPO A;  1VQF A;  2DY8 A;  2ENB A;  4N9T A;  4C3I G;  1RJT A;  2A74 C;  4QF4 A;  5I4D A;  1YIT A;  1A3T A;  3QJY A;  1B1Z A;  2HUG A;  2E5L L;  1YJW A;  2ES2 A;  1NR2 A;  4ZYS A;  1VQK A;  2VUM G;  3PUZ A;  1A3U A;  1ZKO A;  2PI2 E;  3J7A 5;  3RD4 A;  3F2B A;  2PO4 A;  1ML0 D;  1IBK Q;  1ET6 A;  2F3W A;  4IFD J;  1QZG A;  5FLX E;  4MTK A;  5CGK A;  2RF4 A;  5M5W H;  4GZY C;  1FL0 A;  5E1F A;  3J7A V;  3J80 c;  4RHS A;  1VQO A;  3V96 A;  4PV1 C;  2ZM6 L;  3SE0 A;  1KRT A;  4AQY L;  2RCN A;  3KF6 B;  4Q5V A;  1IYJ B;  1N8R C;  3BZK A;  4KK7 A;  1YVC A;  3DM1 A;  3ULJ A;  2PQA B;  4BBR B;  1PH9 A;  3UDX A;  4DF7 A;  3TP8 A;  3CU7 A;  5BN4 A;  3GTQ B;  4IQZ A;  4XQQ A;  4C3J B;  1EIY B;  1K28 A;  2VS1 A;  2JA9 A;  3NHH A;  3FVQ A;  4GKK Q;  4L5R C;  2IL8 A;  2PZW A;  2WB1 G;  1T5E A;  1IBM L;  2KA7 A;  1U9R A;  4HJA A;  3GTG B;  2Q2U A;  1YEZ A;  1BR9 A;  4X62 Q;  2XNA C;  3HOX H;  1QIL A;  1B3A A;  1EIF A;  1NBW A;  4X65 Q;  2A69 D;  3CQZ B;  3G6E A;  2UXD L;  3T1H L;  2DJG C;  1CTM A;  1D2B A;  1OXV A;  5IGG A;  1T9H A;  2UXC L;  4KI0 A;  4UP9 A;  1SE8 A;  1I50 H;  1CSQ A;  2V4D A;  1J8I A;  2ZXR A;  1Z6H A;  1A15 A;  1I6H H;  3M4P A;  4L63 B;  1XPR A;  2LFN A;  1I94 L;  3I8Z A;  3NWT A;  3AMU A;  4PMW A;  2VZA A;  4FVM A;  4LFA L;  5DNF A;  4B3T L;  4ILW A;  1Z9F A;  2AUJ D;  3DHQ A;  1JC7 A;  2B2V A;  1M4V A;  2KQ3 A;  1RL2 A;  3HOY G;  3FKI H;  4JCV E;  1LTL A;  1O78 A;  3HG9 A;  1STN A;  3GTJ B;  1LTR D;  4UP8 A;  4FXG C;  4A3L H;  5IYD H;  4TKO B;  1OXU A;  4YWK A;  1IKL A;  5IGB A;  4DR6 Q;  5A2Q L;  1B9N A;  4IFD G;  4CBV A;  4A93 B;  1Y8P B;  4HED A;  3IFD A;  3GTQ H;  1U5K A;  5LMN L;  1KDC A;  5CV7 A;  1EIG A;  3LGJ A;  2RBM A;  1SYB A;  4AYB E;  4A3J B;  1HFG A;  4YHH L;  4DV4 L;  4R8N A;  4DNI A;  3HOZ B;  1MIU A;  1LTG D;  1XNR L;  5DM7 3;  4L5T A;  3LWE A;  5EJW A;  4DKA C;  1BO0 A;  1VQD A;  2E2H H;  3C46 A;  4OHJ A;  3X3M A;  3D0F A;  1M8A A;  3BVM A;  4DUZ Q;  4BXX G;  3M4Y A;  5M3M H;  5AFW A;  3T13 A;  3W1G A;  2KVM A;  3OHX C;  4Y52 H;  3MXN A;  3VDY A;  2UUC Q;  1U4R A;  3S1N H;  1TWC B;  1X55 A;  2A5H A;  2PQA A;  2KHI A;  1SYD A;  4CHT B;  1M90 C;  2WII B;  1VF7 A;  2F0W A;  3J7Y W;  4JK1 C;  4TRD A;  1RCV D;  4DNR B;  4A4I A;  5CV9 A;  4LF8 L;  4KJO A;  4BY1 H;  1TS2 A;  1K9M C;  1EY0 A;  5KYI A;  5IYC G;  3HS0 C;  3FP9 A;  3GV6 A;  4IUP A;  4CDD C;  3NEM A;  4WJ4 A;  3H0G H;  1XJV A;  3I4N B;  1EY9 A;  1QJO A;  1NTG A;  5CV8 A;  1E24 A;  2KEC A;  1HHV A;  3H09 A;  2HIX A;  3S14 B;  4BBR H;  4POG A;  1PFN A;  2K33 A;  2L11 A;  4K14 A;  4HMJ A;  1PMR A;  2IX0 A;  5GAH C;  2ZTC A;  2CQO A;  1NCV A;  4K6D A;  3F2C A;  4KTA A;  4CKC A;  1HNW L;  3E0E A;  3GTJ H;  5GQO A;  1S5F D;  3DUZ A;  4EVO A;  5K5P A;  3H3V I;  1G6P A;  1EYD A;  1KAA A;  1QNU A;  4R1J A;  2PZU A;  2BE5 D;  2EY2 A;  1WYD A;  3HKZ G;  3W2D A;  3AYH B;  4TSS A;  3J80 L;  2O5J C;  1KRS A;  1SR3 A;  4P2C B;  5CV5 A;  1QNK A;  2MO1 A;  3HFZ B;  1CFM A;  4CDC C;  1S72 A;  4ABN A;  4HJ9 A;  1Q46 A;  4X6A H;  4FF3 A;  2NYZ D;  3FRP B;  3PO3 H;  3V05 A;  4O42 A;  1KAW A;  1SMY C;  4OEL B;  3M4O B;  1CM9 A;  3IKJ A;  1YHQ A;  3A0J A;  1WTO A;  4RWS C;  5FO8 B;  2FIN B;  2D0O A;  3Q0A A;  4KN4 C;  1BCP F;  1Q1B A;  3PO2 H;  3GQB A;  5C5M A;  3WWV A;  3GP7 A;  3M7G A;  2K5D A;  1FJG L;  1IKM A;  1EZ8 A;  1P8L A;  1YI2 A;  4A3C G;  1E2V A;  4BBS G;  4JI1 L;  4PZ7 A;  3HRZ C;  1HR0 W;  1LT3 D;  5G3L D;  4LF8 Q;  3MA2 B;  3EJI A;  3CC4 A;  4IJL A;  3EQL C;  4C1N K;  4DK3 C;  2RDG A;  5M5Y B;  4U68 A;  4DR2 L;  1VQ6 A;  1IW7 D;  1TS4 A;  2WAQ B;  4YHH Q;  4OO1 I;  4FDB A;  2D0P A;  4LF5 Q;  2IW3 A;  2DUD A;  2MGS A;  1C8C A;  1C4Q A;  1SSO A;  1VF5 C;  2L4N A;  2YU9 H;  2D62 A;  5D65 A;  5DM6 3;  3NE5 B;  2JA5 G;  4A3D B;  3W5O A;  2MNA A;  3GTM B;  4BBS H;  4FYD A;  4XTC S;  5KGU A;  1SFO B;  3PUX A;  1Y1V G;  1PVO A;  1PZI D;  1MBY A;  1QVC A;  2L5T A;  3MHB A;  4A3J H;  1IBK L;  5CV6 A;  3NK9 A;  1SNP A;  2NBF A;  2NB0 A;  2HCC A;  4RGM A;  1W6K A;  1HNZ Q;  2KED A;  4MIU A;  2PW5 A;  1IBL Q;  1F9P A;  2TMP A;  3QO2 A;  3K5O A;  4LF5 L;  2GVA A;  2NN6 G;  2EXZ A;  3CAM A;  4LFA Q;  1UE1 A;  5M3F B;  1BF4 A;  3S16 H;  3CPF A;  4DR6 L;  1WCM H;  1BKB A;  2K6A A;  1GUT A;  1STY A;  4QL5 A;  1UEB A;  3K7U C;  1EIH A;  1HCZ A;  2EE1 A;  2NVX H;  3VA7 A;  5A35 A;  1TWF H;  1FJG Q;  5JJI A;  1LYL A;  1LAB A;  3MXU A;  5AJ3 L;  3J81 E;  1IL2 A;  1HNX Q;  1VQ9 A;  4BWG B;  4MNO A;  4DR3 Q;  3HOX G;  3C3L A;  1TY0 A;  4WJW A;  3I4M G;  2UXD Q;  4G7O C;  1G91 A;  1HXY D;  2E2I H;  3STB D;  4JC0 A;  2HQE A;  2PNR C;  2CKZ B;  5DLQ E;  3CHB D;  2RKS A;  4ZCK A;  5E7N A;  2AKW B;  4O1N A;  2VB3 X;  1LUZ A;  1NNX A;  2RA4 A;  1G2T A;  2PI2 A;  5EAY A;  4A3B H;  4R4Q A;  1OXT A;  3GTL H;  4RGO S;  1SE3 A;  5IT9 E;  5I6W A;  1GHK A;  1HUM A;  4PZ8 A;  1EYC A;  4JOI C;  1R4P B;  4KV6 A;  4YY3 Q;  3J81 i;  3PO3 G;  1CT1 D;  5C4X G;  4C3H B;  4GOP C;  3MWY W;  5LL6 S;  1AE2 A;  4YWL A;  2A6H C;  3I72 A;  4R8I A;  4IUN A;  3NTH A;  1NAP A;  1AH9 A;  4IPH A;  4DV3 Q;  3EBE A;  1YBY A;  2D2C C;  3S1M B;  5T1I A;  2R7F A;  3I4O A;  1Y8N B;  4NXM Q;  2N3S A;  5A2Q E;  2OXP A;  2JN4 A;  4P75 A;  1X56 A;  3A7L A;  2ASB A;  3OYY A;  4GLV B;  4BBR G;  5C5L A;  4LF6 Q;  2B29 A;  4NP5 A;  1GJX A;  3MZ5 A;  2OF1 A;  2X69 A;  1F9Q A;  3A56 A;  3EIV A;  2Q8T A;  1N34 L;  3U4V A;  1JE4 A;  2ZTE A;  1Q1E A;  3A8I E;  3ICE A;  2WKC A;  3CF5 A;  3I56 A;  1MD2 D;  2KCT A;  1HQM C;  5EPJ A;  3AEV A;  3H3V C;  2H5X A;  4BA1 I;  5M5Y H;  2BCO A;  2I07 B;  3KLW A;  4A3G B;  4JI2 L;  3U50 C;  3CPW A;  2UU9 L;  4O2D A;  4DFA A;  2F0O A;  4V19 0;  2SNS A;  4JOI A;  1K83 H;  4HIM A;  2D5D A;  3I91 A;  1AZQ A;  1SNC A;  3U4Z A;  5JPN C;  5BN3 A;  4GS3 A;  1EEF D;  3WOE A;  5EPK A;  2E74 C;  3RMH A;  2UXB Q;  3OMC A;  2G9D A;  2NZ1 D;  5C3W A;  3PIO A;  4IPG A;  4JI7 L;  2LY7 A;  2Z9H A;  3OW2 A;  1TWA H;  2BA0 A;  1WCM G;  4F7X A;  3TN2 A;  5IGD A;  4BY7 B;  2JEA I;  4FXK C;  3G4S A;  4C3I B;  4DGZ A;  4DR7 L;  2QGQ A;  3D6C A;  1UUP A;  1Y1W H;  2DNC A;  3L3O C;  1N36 Q;  4IUR A;  1PZK D;  1NJI C;  4LF7 Q;  3IL8 A;  4AYB B;  3CME A;  2BOS A;  3AU7 A;  4QY7 A;  1K0R A;  2N78 A;  1WFQ A;  2Y0S B;  3IAY A;  3KBG A;  1I94 Q;  1MHW C;  3KDF A;  4NW2 A;  3I4M H;  1UNS A;  4IUQ A;  5IYB H;  1QWY A;  2Q2I A;  2F0U A;  2B2W C;  1J5E L;  5C3E G;  4GNX B;  1I4X A;  4A93 H;  1II3 A;  1JOQ A;  3HKS A;  3AB9 A;  1QZH A;  2UXC Q;  3TRE A;  2Z8L A;  1Q8K A;  1G29 1;  3D31 A;  1K8O A;  1E2W A;  2A6H D;  1ENC A;  5HGQ A;  3I73 A;  5JEA G;  2K52 A;  1PH1 A;  4GNX C;  1MJE A;  4DR1 Q;  4DUY Q;  1R9T B;  1LT5 D;  5H1S E;  4C3J G;  4O0A A;  2X6L A;  4NKL A;  5I9O A;  3OOC A;  2I5L X;  2F0E A;  3HOW G;  2SOB A;  3ULL A;  1RTN A;  2JXM B;  3K59 A;  5ELF A;  4K0K Q;  1JWS D;  1F9R A;  2VQE Q;  3TBI B;  3I70 A;  2F4I A;  2IWH A;  1NSN S;  4HN7 A;  1LV9 A;  3EN2 A;  3G71 A;  1MGS A;  3S1N B;  1SYG A;  2XIW A;  5C4H A;  1D5M C;  1KDB A;  1KTK A;  3CCS A;  2ZJR A;  4JI4 L;  5DAU A;  1LAC A;  4DXG A;  4DAV A;  2A19 A;  4BY1 B;  2IHF A;  2MQH A;  4DV0 L;  3E5S A;  2F1M A;  4XT3 B;  4OXP A;  1G51 A;  2BH2 A;  4ZQ3 A;  1E1T A;  5EPL A;  3OTO Q;  3PO3 B;  4FF1 A;  2PMZ E;  4HIO A;  2WAC A;  5C4X B;  2M00 A;  1WTH A;  1PRT F;  2A1A A;  3A8K E;  1VQ5 A;  1X3Q A;  3PO2 G;  1I4P A;  1ICF B;  3MXN B;  2JEB I;  1CHQ D;  1EU4 A;  4IUV A;  3VR2 A;  5HY6 A;  1AZP A;  4JI2 Q;  1BDO A;  2LXK A;  1CK1 A;  1V1Q A;  4EX5 A;  3BS1 A;  1VQC A;  4X3K A;  3H91 A;  3Q23 A;  2G5D A;  1SE4 A;  1EQT A;  1PTO D;  1H9K A;  1HRJ A;  2K03 A;  2NN6 H;  5FOB B;  1ONL A;  3HGB A;  1XNQ Q;  5G3L F;  1XMO Q;  2KHS A;  4R4C A;  2Q2H A;  4NB3 A;  3RLO A;  1SYE A;  5IE8 A;  2RDF A;  3VYT A;  1B9M A;  4DV5 L;  3H3V H;  3KLR A;  1E0B A;  1CKN B;  4A3E G;  1X3P A;  1F2M A;  4A93 G;  3OIP A;  2B2T C;  4JI0 Q;  2VNU D;  1DCZ A;  1XWE A;  3HOY H;  2NTS A;  4OWW B;  4K5X A;  3S2H H;  5IWA Q;  1BCP C;  1B8A A;  2JQO A;  1VMC A;  4JG2 A;  3HOV H;  1EWH A;  1JJ2 A;  1A6X A;  4ZKC B;  3JC6 6;  3Q22 A;  3K80 C;  1ROD A;  2F0Q A;  2B2Y A;  2EJM A;  4N8X 1;  1HNW Q;  3I4N H;  2R7Z G;  1ESF A;  1O7Y A;  4GOP A;  4POF A;  3KOJ A;  4I7A A;  4PZ6 A;  4H0L C;  2KEN A;  4DR4 L;  3CCL A;  4A3F G;  3MFG A;  1BNZ A;  5L37 A;  3CCE A;  2N88 A;  2CQA A;  1ILP A;  3KJP A;  2JA7 B;  1EQR A;  3UE1 A;  5FKA C;  4RGN A;  3I7F A;  1WTV A;  1ENF A;  4KD3 A;  2LXJ A;  5D3D A;  5I2X A;  3U9O A;  1SN8 A;  3PGZ A;  3BVG A;  1K8G A;  1TWH B;  2O2L D;  3A54 A;  1FNU A;  2O4X A;  2B2T A;  4J1M A;  3NPP A;  3BU2 A;  3PF5 A;  2R7Z H;  4F88 A;  3I4N G;  3JAM c;  1B53 A;  1EOT A;  1Z7T A;  1ASZ A;  4MHE A;  1A63 A;  1A62 A;  2JA6 B;  4X66 Q;  1L0W A;  2UU9 Q;  4G7H C;  1BCP B;  2CH4 A;  3K5N A;  3I2Z A;  3S1Q H;  2P5Z X;  3JAM L;  1PFS A;  1I4R A;  3E9I A;  2E2I B;  3DXJ C;  5ISR A;  1L2F A;  5M3F H;  2EY1 A;  4HTH A;  4DV7 L;  1C7Y A;  3BDL A;  1PH3 A;  4XQN A;  4K6L A;  4MTN A;  3RLN A;  5JVG 3;  1HA6 A;  2EIF A;  3H0G G;  1VQ8 A;  4LK1 C;  2DY7 A;  1L1O A;  1EEI D;  4FF2 A;  1JJG A;  1V1O A;  4QQB X;  3M3Y H;  4XQJ A;  3OWF A;  1TWF B;  2B3G A;  4X64 L;  3CXC A;  5GAD C;  3TP5 A;  1SRO A;  4HID A;  4LNQ A;  3E9H A;  4OL7 A;  3M9B A;  1K8M A;  3ER0 A;  1DGS A;  4FNF A;  1XX8 A;  4IOA A;  1RF2 D;  4X64 Q;  4HSP A;  4QJF A;  4DV3 L;  1D5X C;  4L6T B;  2XN9 C;  2FFK B;  4JI1 Q;  1U4M A;  2YV5 A;  4BS9 A;  4BBS B;  2F0L A;  3EVQ A;  5GAE C;  2L12 A;  1L1O B;  4OWT B;  1FYC A;  5FO7 B;  1N33 L;  3GD7 A;  2RQX A;  2HHH L;  1A0I A;  5JVH 3;  1CHP D;  4F87 A;  1N34 Q;  1CSP A;  3FDT A;  4K0K L;  4BY1 G;  1BBX C;  3S15 B;  1ZEQ X;  1I6V C;  1LO5 D;  1EY7 A;  4UDU C;  4B9W A;  2F0G A;  1JB7 A;  4DAM A;  2Z6K A;  4A3M B;  4NXM L;  4Y7N B;  5HUR A;  1XYI A;  2DJF C;  1STG A;  1G8Z D;  4DUY L;  1STA A;  1ENA A;  4CDF C;  1Y1V B;  1LTB D;  4DR3 L;  3HOZ H;  1TQO A;  1YHA A;  3CCM A;  4A3G H;  4JI5 Q;  3T4A C;  1PTO F;  3HKZ E;  3M85 A;  3R2I A;  2NVX B;  4H44 C;  4DV1 Q;  4KLK A;  4ULL A;  3VR5 A;  1HZ9 A;  1LTT D;  2OCE A;  1LTS D;  1UWV A;  3KLS X;  1I6H B;  1ET9 A;  4UY8 C;  1P16 A;  2JA5 H;  3D8G A;  4QCL A;  4I7Z C;  4LUZ A;  1D8L A;  4DR5 Q;  1EZ6 A;  1F2Z A;  1F9S A;  2R6G A;  5C4J H;  2L9H A;  4LUO A;  5FK9 C;  1SMY D;  2K04 A;  1KIX A;  1RIP A;  3G7L A;  1B3Q A;  3T16 A;  1PH8 A;  4IFD I;  3CC2 A;  3K7A B;  3VR6 A;  3ERS X;  3ND9 A;  5LMN W;  4EQO A;  1HPC A;  1R4Q B;  2K14 A;  2QF7 A;  3A8J E;  3FEW X;  2OEO A;  4YCU A;  1GOZ A;  1U4P A;  3E0J A;  1EY6 A;  1YZ6 A;  3NSW A;  3SK5 A;  3NEN A;  2ZT9 C;  3LNN A;  2AQ3 B;  2CCZ A;  3QIA A;  2R7Z B;  5I6Y A;  5C0X H;  5HGT A;  3OPO A;  4FP5 D;  4XDX A;  4KHV A;  4OIJ A;  4LFB Q;  5FJ8 G;  4LF4 Q;  1JOR A;  4JW0 A;  3TSS A;  3S1M H;  3SK8 A;  1AE3 A;  2JA7 G;  3EFX D;  1EQV A;  1UE5 A;  1VQ4 A;  4JI6 L;  4RAU C;  1KL9 A;  1PRT D;  4HJ8 A;  1CQV A;  1S40 A;  1TR5 A;  2Z1C A;  3CW2 C;  4IZ8 A;  2EVB A;  1Q81 C;  1IBL L;  2AUK A;  4RH6 A;  4AYB G;  3T1Y Q;  2EYM A;  2E2J B;  1F77 A;  5LMU L;  2F0V A;  2C9O A;  2L0C A;  3HOU G;  4K2L A;  3J81 j;  3D4D A;  3P75 A;  1JE5 A;  1JT8 A;  1KAB A;  1OTC A;  4GOP B;  2B63 H;  3MXG A;  2KCM A;  3D3R A;  5C0X I;  5EQ0 A;  3VYR A;  1NY4 A;  2H4O A;  1IL8 A;  2K1B A;  1PYS B;  1YJ9 A;  4GKJ L;  1I3Q B;  2D9U A;  1PTO B;  2MJ8 A;  2CW0 C;  3PQI A;  4A3B G;  3MEH A;  3AQQ A;  3MC0 B;  5C44 B;  4A3E H;  1ZXT A;  2F0S A;  1SE2 A;  3CMA A;  4JBW A;  2M9V A;  2PYK A;  4GN5 A;  2ZXO A;  1X65 A;  3TDQ A;  4IUU A;  1O7L A;  2EYO A;  4JBM A;  5IGF A;  2QKI C;  3LX0 A;  1HH2 P;  2QIL A;  4ODG A;  3A7A B;  1F2Y A;  5M5W B;  3NTI A;  4AH6 A;  1GUO A;  5E4W C;  3U58 A;  3UDI A;  4R4O A;  2B8G A;  5ELE A;  4JVZ A;  4K5V A;  1ICW A;  2ZTD A;  3N52 A;  4DV7 Q;  1YHB A;  4UPA A;  3PUV A;  2B2Y C;  1MKH A;  2EJG C;  4S3S A;  4NMZ A;  4X62 L;  4LWC A;  4MN3 A;  1SFO H;  1SND A;  1CA6 A;  3FPP A;  4DAY B;  2VQF L;  3C1E A;  4KMU C;  2PQE A;  4CGY B;  2JA8 G;  1HQR D;  3GDE A;  4EQP A;  5IYC H;  1YJN A;  1H9R A;  2XWJ B;  4RMF A;  1STE A;  1TKW B;  2VQF Q;  1SNQ A;  2F0M A;  3NXW A;  3KUP A;  2K5W A;  3BVZ A;  2ZJQ A;  1SBB B;  1A3V A;  1ILQ A;  4IFD H;  2VXW A;  3P1H A;  2K5V A;  4TQU S;  4RCN A;  5BR8 Q;  4DU9 A;  1WJJ A;  3CD6 A;  2AWO A;  1WCM B;  1DXM A;  2KEE A;  2MO0 A;  3CQZ H;  3UDG A;  4BY7 G;  1V1P A;  1EWC A;  1I4H A;  2VW9 A;  4A3M G;  3W1B A;  5I9P A;  2RVL A;  3U9S A;  1QVG A;  1PRT B;  1JOK A;  2JA8 H;  2QCP X;  1HFN A;  1GD7 A;  4X3T A;  2NVQ H;  1EY5 A;  2EPB A;  4PMC A;  4ZKB B;  3KLS A;  3VA5 A;  4DV4 Q;  4KHP L;  2BE5 C;  2Y0S G;  5C44 H;  4IPC A;  2ALY B;  2WP8 J;  3D4W A;  1PH2 A;  1PH5 A;  2EYP A;  2MP1 A;  3CCJ A;  2MFI A;  3NBH B;  1L0X B;  4DXF A;  1EL0 A;  2HT1 A;  1S3O A;  2J7Z A;  3HZX A;  1BQQ T;  2HD3 A;  5C3E B;  5C0X G;  1SJH D;  4HR7 B;  2YTY A;  3MVV A;  2F03 A;  4RA8 A;  1RHP A;  2YTX A;  2UUC L;  1DOL A;  3RZD B;  5BN5 A;  2JA7 H;  1WTP A;  1T5X D;  1Y1W G;  2WAQ E;  2OT2 A;  3S2H B;  1PH6 A;  2HIV A;  5IT9 L;  1GUS A;  1PFM A;  2GVB A;  1U0L A;  3HOV B;  4BA2 I;  1D1I A;  1X6O A;  5EKL A;  5JJK A;  2YYZ A;  1RD9 D;  2EYJ A;  2N8N A;  2K50 A;  1BBU A;  3CKI B;  3HOW B;  2OQK A;  2E5L Q;  1DYQ A;  2IX3 A;  2BH8 A;  1XNR Q;  2QW7 A;  3LWU A;  3X3N A;  1XMQ L;  4R4I A;  1AW7 A;  1YNN D;  4EGV A;  4LF4 L;  1SYF A;  4HSV A;  1TS3 A;  1EQQ A;  4JI8 L;  4BXX H;  3CP0 A;  4CJ0 B;  5ELO A;  1PYW D;  1NUC A;  4JI3 Q;  3FMC A;  4QB4 A;  2HQL A;  2KCC A;  3BG3 A;  2R3Z A;  5C6A A;  4ZRZ A;  3L2P A;  2F0J A;  4HJ5 A;  2CW0 D;  3TZU A;  1F2L A;  3SHL A;  2VUM H;  1QE6 A;  2JJQ A;  1V8Q A;  3CCV A;  3URY A;  3VYU A;  2AHO B;  4A3K B;  2NVQ B;  1IYV A;  3NBH A;  5FLX L;  3ND8 A;  3S1Q B;  1LLR D;  1X9N A;  1E7Z A;  2FXQ A;  3DLL A;  1YNJ C;  2V1C C;  1QOH A;  3KBX A;  4OO1 H;  3AFP A;  5LL6 X;  2FMC A;  2KCN A;  1NMF A;  3S24 A;  5IYB G;  3UI2 A;  3K5L A;  2MHV A;  3GV3 A;  3CCQ A;  4I65 A;  4L8J A;  5JEA H;  1IYU A;  1HJP A;  4NXN Q;  1UE6 A;  4LAA A;  1XMO L;  1V43 A;  2RSN A;  1PA6 A;  1Z47 A;  2XRS D;  2EYF A;  1A8V A;  4IUT A;  5IOD A;  4ALP A;  5AJ3 Q;  4KY6 A;  4LW1 A;  3I55 A;  3TS0 A;  2EZV A;  5EKK A;  3HOW H;  3J81 c;  2F0T A;  2TSS A;  4A3M H;  2JK8 A;  2F0F A;  4R4T A;  1VS0 A;  5CC4 A;  2MPM A;  2Q8R E;  1B50 A;  1QG7 A;  4A75 A;  2K5N A;  3H6M A;  2BDN A;  2BDO A;  4GN3 B;  4QMG A;  3ERO A;  2X6G A;  4KN7 C;  1A2U A;  1H9J A;  2JA6 H;  3RZO H;  3J81 L;  2JA8 B;  4L5S A;  4AIM A;  3S17 H;  5JJL A;  3PIO 3;  1VCI A;  3ZYY X;  2I5H A;  3WDN A;  2J0T D;  3S1R H;  3J7A F;  2IJ0 A;  4HCS A;  4F8M A;  1SYC A;  1EOV A;  2ZM6 Q;  1WTX A; 
#chains in the Genus database with same CATH homology
 1FD7 D;  1K83 B;  2SEB D;  4C2M B;  2Z4H A;  1GUG A;  2KJX A;  4RKL A;  1CI3 M;  2NTT A;  4DN4 M;  2JP1 A;  3T56 B;  3Q24 A;  2F0I A;  4CJ2 C;  3M3Y B;  3NP8 A;  3S9W A;  4DNT B;  5KYL A;  3K5M A;  1XTC D;  4HMI A;  2ZXP A;  1JIC A;  2E2D C;  3P20 A;  2HDM A;  3QB3 A;  4XXE A;  2KOL A;  3G6J B;  3DEO A;  2QEJ C;  1TY2 A;  1DOM A;  3C2P A;  2NWG A;  2NUC A;  3ERQ A;  4KY7 A;  1WD1 A;  4B08 A;  2SNM A;  1UAP A;  2M2L A;  1EU3 A;  1IHZ A;  3S2D B;  1Y8O B;  5E4X A;  3RZO B;  1Q12 A;  1FNW A;  2XSC A;  5JEA J;  2R92 B;  2WV6 D;  4DA2 A;  1SNO A;  1STH A;  4RFB A;  1TU2 B;  1JOO A;  4QUC A;  1H9M A;  5JJZ A;  5JOB A;  3MFY A;  3HOU B;  5CBA E;  4V0B A;  3PO2 B;  4OIK A;  5JPM C;  4H7B A;  4H13 C;  5ELB A;  4X3S A;  2ID0 A;  1YNN C;  1H9S A;  1PDQ A;  2NVY B;  2NVT B;  3SVM A;  1KDA A;  1S5B D;  3K57 A;  3EA6 A;  5EKI A;  2F3V A;  1EY4 A;  1PLF A;  1ESR A;  4A3E B;  3HEJ A;  5KEE A;  1XXG A;  2YU9 B;  4KD4 A;  5K36 G;  2WB1 B;  2EY6 A;  1I4Q A;  4DAP A;  4CKE A;  3OW7 A;  1YNJ D;  3FKI B;  1D5Z C;  1HTL D;  4DK0 A;  3S17 B;  2K5Q A;  1ZYR C;  2L55 A;  1EYA A;  1UEA B;  2RDH A;  3S1R B;  4KKT A;  3VR3 A;  3NTK A;  1AFP A;  1SXT A;  4A3F B;  1WTW A;  3S16 B;  2F0D A;  3GTO B;  1DON A;  4DK1 A;  4QUF A;  3R2T A;  2B8F A;  3SDZ A;  2IPK D;  1HA5 A;  5EGT A;  2B63 B;  2EJF C;  1KNA A;  3RUZ A;  3BYY B;  1PZJ D;  2JYO A;  4ZLT F;  3OMG A;  4G7Z C;  2RSO A;  3MAQ A;  2LKV A;  3I3C A;  3R93 A;  1PTO C;  1RTO A;  5E3F A;  5M5X B;  3KK7 A;  4WFN 3;  4LMQ D;  1EY8 A;  1BXT A;  4OO1 G;  3E6Z X;  1DD2 A;  2GA4 B;  1BOS A;  2E76 C;  2A69 C;  1QCB D;  4WRD A;  3DEP A;  3HP3 A;  3T51 B;  1OO9 B;  3H0G B;  1A2T A;  4G4K A;  1JWU D;  3W3A A;  4K2K A;  1Q90 A;  1LTA D;  1OXX K;  3T53 B;  4K8I A;  4J6H A;  4KJN A;  2B2V C;  1STB A;  2E75 C;  3BDO A;  4PNY A;  2A73 B;  1O80 A;  4KHZ A;  2K05 A;  3P7J A;  1QB5 D;  2K28 A;  3L9A X;  5COY A;  1CQF A;  1PXU A;  5F2D A;  1G6Z A;  1G2S A;  3CRK C;  4Q0F A;  1AEX A;  2C5C A;  5J1Z A;  2HDL A;  3GTP B;  5KRU A;  1DZ1 A;  5FO9 B;  4R9W A;  2ICE C;  1PRT C;  3KF8 A;  2WKD A;  3IFT A;  4XIG S;  1DM0 B;  4B9X A;  1CZG A;  5J22 A;  4LJZ C;  3SK4 A;  1E2Z A;  1SDF A;  3HKZ B;  3NQI A;  4X3U A;  5C3X A;  2G9H D;  2L1B A;  2O5I C;  5IGE A;  3BZD B;  1LT6 D;  1LT4 D;  1S5E D;  3TZD A;  2CVR A;  2KUM A;  4CJ1 B;  2A6E C;  3PIP 3;  3TP7 A;  2Q8I B;  1C48 A;  1DJR D;  5IGC A;  5CV4 A;  1WVL A;  2XWB B;  1Q3L A;  1I4G A;  4N9P A;  1KLU D;  4EQN A;  1ZYR D;  2IX1 A;  5EBC A;  2BA1 A;  4ZUI A;  1S5C D;  1L0Y B;  3JAM E;  1U4L A;  1S4Z A;  3HOY B;  2EDG A;  1I50 B;  1TII D;  3OSO A;  2QDB A;  3NQT A;  1KLG D;  4CKB A;  1RKN A;  5ELC A;  5EBD A;  2MUY A;  5D14 A;  3BYT B;  3F2U A;  1TS5 A;  4HCE A;  4KKU A;  3PV0 A;  2I46 A;  1PFB A;  1HUN A;  2B2U C;  2VB2 X;  3I4L A;  4KY5 A;  2A68 D;  4A3B B;  1GUW A;  4WOR A;  2LMC B;  1AN8 A;  1BCP D;  5D3I B;  4RCO A;  3VYS A;  1LTI D;  2PCF B;  3PMF A;  4OGQ C;  3HOX B;  4UAI A;  2B2W A;  1J9O A;  3K6O A;  3OIQ A;  4K5W A;  4QIW B;  2Z4I A;  3PUW A;  1Q8I A;  1DOK A;  1IW7 C;  1GHJ A;  3L7Z C;  4ZAI A;  2EYH A;  3NUC A;  2E2H B;  4FO2 A;  4ZK9 B;  2EOT A;  4XT1 B;  2SDF A;  2AQ2 B;  1TVX A;  4NDX A;  3MXP A;  4ME5 A;  3ITP A;  1B44 D;  2A6E D;  2XVS A;  2CHB D;  5J39 A;  3ONA B;  4C3H G;  1V1P B;  1CA5 A;  2FJ2 A;  2JE6 I;  3GTL B;  1AP0 A;  5T1G A;  4HAE A;  3BDC A;  4U67 3;  3QG1 A;  1SAP A;  2PW7 A;  1VMP A;  1GUN A;  4IN3 A;  5IOC A;  4YIJ A;  5CBE E;  5LHY 1;  2HCI A;  5I2Y A;  3O13 A;  3DMU A;  3Q6S A;  3M7N A;  1TWA B;  2K32 A;  1KNE A;  3J80 E;  3CRL C;  4RGT A;  3A55 A;  5KIX A;  1JQY D;  4J8Q A;  3K58 A;  1Y1W B;  1D6E C;  5CYU A;  1VDZ A;  1WTR A;  5KNB A;  1JR0 D;  3TME A;  1WD0 A;  4XYO A;  4K8J A;  2N55 A;  3D6W A;  4KKS A;  1FNV A;  2JA5 B;  3QWN A;  1B4O A;  4E6I A;  3FPU B;  4M8A A;  2VUM B;  5M3M B;  5C4J B;  1GXD C;  2PPB C;  2K01 A;  3H94 A;  3K0Y A;  5NUC A;  2DNE A;  3TP6 A;  3NBI A;  4FF4 A;  3R8B A;  4A3I B;  5KND A;  1JB3 A;  3N6R A;  4Z9C B;  1X32 A;  5JAV A;  3GO5 A;  2J4X A;  1H9S B;  3SEB A;  1B2T A;  1MSH A;  5CMD A;  3QOJ A;  1TT2 A;  5CR3 A;  1CZW A;  4C1N I;  3DWP A;  1Y69 U;  2EYL A;  2F0K A;  3I4M B;  4RKB A;  4FXD A;  2AQ1 B;  2PMZ B;  1OXS C;  2F0H A;  1FR3 A;  3VR4 A;  3MTS A;  1MI2 A;  2WIN B;  3SK6 A;  1NR4 A;  5COR A;  1SEB D;  1O7Z A;  3DWA A;  2A68 C;  3DWQ A;  2R61 A;  4IAL A;  5M9O A;  2XRQ D;  1FGB D;  3GTK B;  5DEH A;  4PQX A;  2F0N A;  2H1E A;  5K36 H;  1S5D D;  5TSS A;  3RLF A;  3V2T A;  2FHT A;  3R3O A;  3WOF A;  1WTQ A;  1EFI D;  2DN8 A;  4C56 C;  1TWG B;  2LS0 1;  3QOL A;  2AWN A;  2EY5 A;  4ID6 A;  4ZUJ A;  5C4Z A;  4DAY A;  2ICI A;  1W6J A;  5C0X J;  1MSG A;  3OWE B;  4PMB A;  2B39 A;  5ELD A;  1JCK B;  3C1F A;  1RDP D;  2JSO A;  2B2U A;  2IT1 A;  3NWS A;  5IIF A;  2FMM A;  4M1U B;  3SR1 A;  1D1K A;  2R93 B;  1BUV T;  3I90 A;  3SXH A;  3D4R A;  2F0P A;  1SJE D;  4RHR A;  2NN6 I;  1JWM D;  3PUY A;  4XYQ A;  1SNM A;  1HTP A;  2PZT A;  4G57 A;  5KNC A;  2K7V A;  1PTO H;  2DY8 A;  2ENB A;  4N9T A;  4C3I G;  1RJT A;  2A74 C;  4QF4 A;  5I4D A;  1A3T A;  3QJY A;  1B1Z A;  2HUG A;  1NR2 A;  4ZYS A;  3PUZ A;  1A3U A;  1ZKO A;  3RD4 A;  2PO4 A;  1ML0 D;  1ET6 A;  2F3W A;  4IFD J;  5FLX E;  5CGK A;  4GZY C;  5E1F A;  3J7A V;  4RHS A;  3V96 A;  4PV1 C;  3SE0 A;  4Q5V A;  4KK7 A;  3DM1 A;  4BBR B;  4DF7 A;  3TP8 A;  3CU7 A;  5BN4 A;  3GTQ B;  4IQZ A;  4XQQ A;  4C3J B;  3NHH A;  3FVQ A;  2IL8 A;  2PZW A;  1T5E A;  2KA7 A;  1U9R A;  3GTG B;  1BR9 A;  2XNA C;  1QIL A;  1B3A A;  2A69 D;  3CQZ B;  1CTM A;  1D2B A;  1OXV A;  5IGG A;  1SYC A;  4KI0 A;  2V4D A;  1J8I A;  2ZXR A;  1Z6H A;  1A15 A;  4L63 B;  2LFN A;  3I8Z A;  3NWT A;  3AMU A;  4PMW A;  4FVM A;  5DNF A;  4ILW A;  2AUJ D;  3DHQ A;  1JC7 A;  2B2V A;  1M4V A;  2KQ3 A;  1O78 A;  3HG9 A;  3GTJ B;  1STN A;  1LTR D;  4FXG C;  4TKO B;  1OXU A;  1IKL A;  5IGB A;  5A2Q L;  1B9N A;  4IFD G;  4CBV A;  4A93 B;  1Y8P B;  4HED A;  3IFD A;  1KDC A;  5CV7 A;  1EIG A;  2RBM A;  1SYB A;  4A3J B;  1HFG A;  4R8N A;  3HOZ B;  1LTG D;  5DM7 3;  3LWE A;  5EJW A;  1BO0 A;  3C46 A;  4OHJ A;  3X3M A;  1M8A A;  3BVM A;  3M4Y A;  5AFW A;  3T13 A;  2KVM A;  3OHX C;  3MXN A;  1U4R A;  1TWC B;  2A5H A;  1SYD A;  4CHT B;  2WII B;  1VF7 A;  2F0W A;  3J7Y W;  4JK1 C;  4TRD A;  1RCV D;  4DNR B;  5CV9 A;  4KJO A;  1TS2 A;  1EY0 A;  5KYI A;  3HS0 C;  3GV6 A;  4IUP A;  3I4N B;  1EY9 A;  1QJO A;  5CV8 A;  2KEC A;  1HHV A;  3H09 A;  3S14 B;  1PFN A;  2K33 A;  2L11 A;  4K14 A;  4HMJ A;  1PMR A;  2IX0 A;  4K6D A;  1NCV A;  4KTA A;  4CKC A;  1S5F D;  3DUZ A;  4EVO A;  5K5P A;  1EYD A;  1KAA A;  1QNU A;  2PZU A;  2BE5 D;  2EY2 A;  3W2D A;  4TSS A;  3J80 L;  2O5J C;  4P2C B;  5CV5 A;  1QNK A;  1CFM A;  4ABN A;  4FF3 A;  2NYZ D;  3FRP B;  3V05 A;  4O42 A;  1SMY C;  3M4O B;  1CM9 A;  3IKJ A;  1WTO A;  4RWS C;  5FO8 B;  2FIN B;  3Q0A A;  4KN4 C;  1BCP F;  1Q1B A;  3GQB A;  5C5M A;  3GP7 A;  3M7G A;  2K5D A;  1IKM A;  1EZ8 A;  1E2V A;  3HRZ C;  1LT3 D;  5G3L D;  3MA2 B;  3EJI A;  3EQL C;  4C1N K;  2RDG A;  5M5Y B;  4U68 A;  1IW7 D;  1TS4 A;  2WAQ B;  4OO1 I;  2IW3 A;  2MGS A;  1C8C A;  1C4Q A;  1SSO A;  1VF5 C;  2L4N A;  2D62 A;  5D65 A;  5DM6 3;  3NE5 B;  4A3D B;  3GTM B;  4FYD A;  4XTC S;  5KGU A;  1SFO B;  3PUX A;  1PZI D;  1MBY A;  2L5T A;  3MHB A;  5CV6 A;  3NK9 A;  1SNP A;  2NBF A;  2NB0 A;  2HCC A;  4RGM A;  1W6K A;  2KED A;  4MIU A;  2PW5 A;  1F9P A;  2TMP A;  3QO2 A;  3K5O A;  2NN6 G;  2EXZ A;  5M3F B;  1BF4 A;  2K6A A;  1GUT A;  1STY A;  1EIH A;  1HCZ A;  2EE1 A;  3VA7 A;  5A35 A;  1LAB A;  3MXU A;  3J81 E;  4BWG B;  3C3L A;  1TY0 A;  4WJW A;  4G7O C;  1G91 A;  1HXY D;  2HQE A;  2PNR C;  3CHB D;  2RKS A;  4O1N A;  2VB3 X;  2RA4 A;  1G2T A;  1OXT A;  4RGO S;  1SE3 A;  5IT9 E;  5I6W A;  1GHK A;  1HUM A;  1EYC A;  1R4P B;  4KV6 A;  1CT1 D;  4C3H B;  3MWY W;  5LL6 S;  2A6H C;  3I72 A;  4R8I A;  4IUN A;  3NTH A;  1NAP A;  2D2C C;  3S1M B;  5T1I A;  1Y8N B;  5A2Q E;  2OXP A;  3A7L A;  5C5L A;  4NP5 A;  1GJX A;  3MZ5 A;  2OF1 A;  2X69 A;  1F9Q A;  3A56 A;  2Q8T A;  1JE4 A;  1Q1E A;  3A8I E;  2WKC A;  1MD2 D;  1HQM C;  5EPJ A;  3H3V C;  4BA1 I;  2BCO A;  2I07 B;  4A3G B;  4DFA A;  2F0O A;  4V19 0;  2SNS A;  2D5D A;  3I91 A;  1AZQ A;  1SNC A;  5JPN C;  5BN3 A;  1EEF D;  3WOE A;  5EPK A;  2E74 C;  3RMH A;  3OMC A;  2G9D A;  2NZ1 D;  5C3W A;  2LY7 A;  2BA0 A;  4F7X A;  3TN2 A;  5IGD A;  4BY7 B;  2JEA I;  4FXK C;  4C3I B;  4DGZ A;  3D6C A;  1UUP A;  2DNC A;  3L3O C;  4IUR A;  1PZK D;  3IL8 A;  4AYB B;  2BOS A;  3AU7 A;  3IAY A;  2Y0S B;  3KBG A;  4NW2 A;  1UNS A;  4IUQ A;  1QWY A;  2F0U A;  2B2W C;  1I4X A;  1II3 A;  1JOQ A;  3AB9 A;  2Z8L A;  1G29 1;  3D31 A;  1K8O A;  1E2W A;  2A6H D;  1ENC A;  3I73 A;  5JEA G;  1R9T B;  1LT5 D;  4C3J G;  2X6L A;  4NKL A;  5I9O A;  3OOC A;  2F0E A;  2SOB A;  1RTN A;  2JXM B;  3K59 A;  5ELF A;  1JWS D;  1F9R A;  3TBI B;  3I70 A;  2F4I A;  2IWH A;  1NSN S;  4HN7 A;  1LV9 A;  1MGS A;  3S1N B;  1SYG A;  2XIW A;  5C4H A;  1D5M C;  1KDB A;  1KTK A;  5DAU A;  1LAC A;  4DXG A;  4DAV A;  4BY1 B;  3E5S A;  2F1M A;  4XT3 B;  4ZQ3 A;  5EPL A;  3PO3 B;  4FF1 A;  2WAC A;  5C4X B;  2M00 A;  1PRT F;  3A8K E;  1X3Q A;  1I4P A;  2JEB I;  1CHQ D;  1EU4 A;  4IUV A;  3VR2 A;  1AZP A;  1BDO A;  1CK1 A;  3BS1 A;  4X3K A;  3H91 A;  3Q23 A;  1SE4 A;  1EQT A;  1PTO D;  1H9K A;  1HRJ A;  2K03 A;  2NN6 H;  5FOB B;  1ONL A;  3HGB A;  5G3L F;  2KHS A;  1SYE A;  2RDF A;  3VYT A;  1B9M A;  3KLR A;  1E0B A;  1X3P A;  1F2M A;  3OIP A;  2B2T C;  2VNU D;  1DCZ A;  1XWE A;  2NTS A;  4K5X A;  1BCP C;  1VMC A;  1EWH A;  1A6X A;  4ZKC B;  3Q22 A;  1ROD A;  2F0Q A;  2B2Y A;  2EJM A;  1ESF A;  1O7Y A;  4H0L C;  3MFG A;  1BNZ A;  2N88 A;  2CQA A;  1ILP A;  2JA7 B;  5FKA C;  4RGN A;  1WTV A;  1ENF A;  4KD3 A;  5D3D A;  5I2X A;  3U9O A;  3BVG A;  1TWH B;  2O2L D;  3A54 A;  1FNU A;  2O4X A;  2B2T A;  4J1M A;  3NPP A;  4F88 A;  1B53 A;  1EOT A;  1Z7T A;  4MHE A;  2JA6 B;  4G7H C;  1BCP B;  3K5N A;  3JAM L;  1I4R A;  2E2I B;  3DXJ C;  5ISR A;  2EY1 A;  4HTH A;  3BDL A;  4XQN A;  4K6L A;  5JVG 3;  1HA6 A;  2DY7 A;  4LK1 C;  1EEI D;  4FF2 A;  1V1O A;  4XQJ A;  3OWF A;  1TWF B;  3TP5 A;  4OL7 A;  1K8M A;  4FNF A;  1XX8 A;  1RF2 D;  4HSP A;  1D5X C;  4L6T B;  2XN9 C;  2FFK B;  1U4M A;  4BS9 A;  4BBS B;  2F0L A;  3EVQ A;  2L12 A;  1FYC A;  5FO7 B;  3GD7 A;  2RQX A;  5JVH 3;  1CHP D;  4F87 A;  3FDT A;  1BBX C;  3S15 B;  1ZEQ X;  1I6V C;  1LO5 D;  1EY7 A;  4UDU C;  4B9W A;  2F0G A;  4A3M B;  4Y7N B;  5HUR A;  1XYI A;  1STG A;  1G8Z D;  1STA A;  1ENA A;  1Y1V B;  1LTB D;  1TQO A;  3T4A C;  1PTO F;  3M85 A;  3R2I A;  2NVX B;  4H44 C;  4ULL A;  3VR5 A;  1LTT D;  1LTS D;  3KLS X;  1I6H B;  1ET9 A;  3D8G A;  4QCL A;  4I7Z C;  1EZ6 A;  1F2Z A;  1F9S A;  2R6G A;  2L9H A;  5FK9 C;  1SMY D;  2K04 A;  3T16 A;  3G7L A;  4IFD I;  3K7A B;  3VR6 A;  3ND9 A;  4EQO A;  1HPC A;  1R4Q B;  2QF7 A;  3A8J E;  3FEW X;  2OEO A;  1GOZ A;  1U4P A;  3E0J A;  1EY6 A;  3NSW A;  3SK5 A;  2ZT9 C;  3LNN A;  2AQ3 B;  3QIA A;  2R7Z B;  5I6Y A;  5C0X H;  5HGT A;  3OPO A;  4FP5 D;  4KHV A;  4OIJ A;  1JOR A;  3TSS A;  3SK8 A;  3EFX D;  1EQV A;  4RAU C;  1PRT D;  1CQV A;  1TR5 A;  2Z1C A;  4IZ8 A;  2EVB A;  2AUK A;  4RH6 A;  2EYM A;  2E2J B;  1F77 A;  2F0V A;  2C9O A;  2L0C A;  4K2L A;  3D4D A;  3P75 A;  1KAB A;  3MXG A;  3D3R A;  5C0X I;  5EQ0 A;  3VYR A;  2H4O A;  1IL8 A;  2K1B A;  1I3Q B;  2D9U A;  1PTO B;  2MJ8 A;  2CW0 C;  3MEH A;  3MC0 B;  5C44 B;  1ZXT A;  2F0S A;  1SE2 A;  4JBW A;  2M9V A;  2PYK A;  2ZXO A;  3TDQ A;  4IUU A;  1O7L A;  2EYO A;  5IGF A;  2QKI C;  3LX0 A;  2QIL A;  4ODG A;  3A7A B;  1F2Y A;  5M5W B;  3NTI A;  1GUO A;  5E4W C;  2B8G A;  5ELE A;  4K5V A;  1ICW A;  3N52 A;  3PUV A;  2B2Y C;  2EJG C;  4S3S A;  4NMZ A;  4MN3 A;  1SND A;  1CA6 A;  3FPP A;  3C1E A;  4KMU C;  2PQE A;  4CGY B;  1HQR D;  4EQP A;  1H9R A;  2XWJ B;  1STE A;  1TKW B;  1SNQ A;  2F0M A;  3NXW A;  3KUP A;  2K5W A;  3BVZ A;  1SBB B;  1A3V A;  1ILQ A;  4IFD H;  2VXW A;  3P1H A;  4TQU S;  4RCN A;  4DU9 A;  2AWO A;  1WCM B;  1DXM A;  2KEE A;  1V1P A;  1EWC A;  1I4H A;  5I9P A;  2RVL A;  3U9S A;  1PRT B;  1JOK A;  2QCP X;  1HFN A;  4X3T A;  1EY5 A;  2EPB A;  4PMC A;  4ZKB B;  3KLS A;  3VA5 A;  2BE5 C;  2WP8 J;  3D4W A;  2EYP A;  2MP1 A;  4DXF A;  1L0X B;  1EL0 A;  2J7Z A;  3HZX A;  1BQQ T;  5C3E B;  5C0X G;  1SJH D;  4HR7 B;  3MVV A;  2F03 A;  4RA8 A;  1RHP A;  1DOL A;  3RZD B;  5BN5 A;  1WTP A;  1T5X D;  2OT2 A;  3S2H B;  5IT9 L;  1GUS A;  1PFM A;  3HOV B;  4BA2 I;  1D1I A;  5EKL A;  2YYZ A;  1RD9 D;  2EYJ A;  3CKI B;  3HOW B;  1DYQ A;  2IX3 A;  3LWU A;  3X3N A;  1AW7 A;  1YNN D;  4EGV A;  1SYF A;  4HSV A;  1TS3 A;  4CJ0 B;  1PYW D;  1NUC A;  3FMC A;  4QB4 A;  2KCC A;  3BG3 A;  2R3Z A;  5C6A A;  4ZRZ A;  2F0J A;  2CW0 D;  3TZU A;  1F2L A;  3SHL A;  1QE6 A;  1V8Q A;  3URY A;  3VYU A;  2NVQ B;  4A3K B;  1IYV A;  3NBH A;  5FLX L;  3ND8 A;  3S1Q B;  1LLR D;  1YNJ C;  1QOH A;  3KBX A;  4OO1 H;  5LL6 X;  2FMC A;  2KCN A;  3UI2 A;  3K5L A;  2MHV A;  3GV3 A;  4I65 A;  4L8J A;  5JEA H;  1IYU A;  4LAA A;  1V43 A;  2RSN A;  1Z47 A;  2XRS D;  2EYF A;  4IUT A;  5IOD A;  4KY6 A;  2EZV A;  5EKK A;  2F0T A;  2TSS A;  2F0F A;  5CC4 A;  2MPM A;  2Q8R E;  1B50 A;  1QG7 A;  3H6M A;  2BDN A;  2BDO A;  4QMG A;  3ERO A;  2X6G A;  4KN7 C;  1A2U A;  1H9J A;  3J81 L;  2JA8 B;  3PIO 3;  1VCI A;  3ZYY X;  3WDN A;  2J0T D;  3J7A F;  2IJ0 A;  4HCS A;  4F8M A;  4XDX A;  1WTX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...