2HHHL

Crystal structure of kasugamycin bound to the 30s ribosomal subunit
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The antibiotic kasugamycin mimics mRNA nucleotides to destabilize tRNA binding and inhibit canonical translation initiation.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 13
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2006-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2hhhL00
3Q8DA 1OTCA 1SE8A 4GS3A 5IT9c 2EXDA 3J80c 4APVA 1VQNA 2OQKA 4DV7L 3SGIA 1PYSB 1QZHA 1AE3A 2CQOA 4C3HH 3CCRA 2IT1A 1E3PA 4A4IA 2CKZB 1PH7A 1RL2A 1YZ6A 3BU2A 1OXVA 2YTYA 1CKNA 4MZ9A 4AH6A 4XTCS 4DNIA 1CKNB 2NVYH 1FL0A 3K81C 1UE5A 1JJCB 2GN5A 2RF4A 5IYDG 4C3JH 3CCLA 1CUKA 3BZCA 3K7UC 4LF8Q 4POGA 2F4VQ 1GO3E 4DAYB 3RN2A 3IRBA 1VQMA 2JA8H 1VQCA 1J5EQ 3I4NG 1PH1A 3CQZH 4NXNQ 2CWAA 4LF6L 1EWIA 5FLMG 1W2BA 2L15A 1H95A 2B29A 3S1MH 4A76A 2I0QA 1Y1WH 1KL9A 1NE3A 1OXXK 1L1OA 4L5TA 3G4SA 3HOYH 4BY1H 2D0OA 1JB7A 4IFDI 1XPRA 5IYCH 4A3CH 2UXDL 1UWVA 4P72A 4HIOA 4YY3L 4LF8L 3GTOH 1PH8A 2KCMA 2F4VL 1K9MC 4X62L 4DV2Q 1E1TA 2JA7G 4X65Q 1Q46A 5FJ8G 2H5XA 4EQ5A 4LF6Q 1TXYA 5AJ3Q 3JAMc 2JA6H 3S17H 4A3LH 1I6HH 3CC7A 1I94L 3A5ZB 1TWCH 5C4XH 4JI5Q 4JI7L 2OCEA 1OXUA 1NMGA 1J5EL 4IFDJ 4JOIC 1VQ9A 1PV4A 1JT8A 4DR1Q 4UY8C 1CKMA 2LSSA 4KLKA 1IBLL 2K5VA 2F3IA 5M3FH 4IO9A 4DR7Q 3TRZA 4BY7G 1K8GA 4JC0A 3FHWA 3CCUA 2ID0A 1PH6A 2UXDQ 1Q82C 2HIXA 2MNAA 4QIWE 1SR3A 4YWKA 4JI5L 1E22A 4DAMA 3F2BA 1K73C 1I94Q 2HHHL 4BXXH 1IL2A 2BA0A 2IHFA 1KD1C 3H3VH 2E2JH 3F1ZA 4YCUA 2JK8A 4LW1A 3J81i 1JMCA 1E7ZA 5IYCG 1IBLQ 4MTNA 4IOCA 3RLOA 1YBYA 2R6GA 1YIJA 4HIDA 4DKAC 4K0KL 2IX0A 1S3OA 1IBKQ 1HZ9A 2WAQG 3CP0A 2AWOA 3S15H 1VQHA 4JI8L 4KHPL 3K80C 5GAHC 4UP8A 2WB1E 3PO2G 4DR7L 5IP7H 3A74A 2JA5G 1B70B 4OX9L 3S14H 2RHQB 2R93G 1WCMG 4JI0Q 3RR5A 3TQYA 1HNWQ 1EIYB 2E2IH 5M3MG 3ERSX 1N36Q 3PUZA 2LXKA 4DPGA 3PF5A 3S1NH 2JJQA 1XMQL 1Y1VG 1J6QA 3HKSA 1UE7A 3CW2C 3UDXA 1HR0L 4YWMA 1K0RA 3NELA 4PG3A 4DV3L 3I55A 4IPGA 1IBKL 3BZKA 4LF7L 3K0XA 1XNRL 2KHIA 3D31A 3PUXA 5HY6A 1YJWA 3HOUH 1HNWL 3CF5A 3I2ZA 3KDFA 3PV0A 4GN5A 4JI6Q 1TWFH 1M90C 2ALYB 3VDYA 1XMQQ 4GLAC 1S40A 1PH3A 2CCZA 2BA1A 1XTDA 4OX9Q 2VL6A 1FGUA 1Y1WG 3T1YQ 4X6AH 1UE1A 4DV3Q 1PHJA 1N36L 4DR6L 1VQAA 1MJCA 1YNXA 2VY3A 2VQFL 1VQKA 2PMZE 2NZHA 4UP9A 1SLJA 2JEBI 5E7NA 3CMAA 4JI6L 4QL5A 1X55A 1A0IA 2XGTA 4JG2A 4ME3A 5IY0A 2D62A 4A3IG 2ZJQA 1JE5A 2QA4A 4P74A 4HJ7A 4LF5Q 1D7QA 3PO3G 2ZM6Q 3UE0A 4BBSH 4LF7Q 2F52A 4GOPB 1XNRQ 3PUVA 2YTXA 4DUYL 1Z9FA 2K50A 1X56A 4TQUS 2VZAA 4C2MH 4JI7Q 3MEFA 3CCSA 4DV1L 4OWTB 2B3GA 5LMUL 1VQFA 1AH9A 1R9TH 1EQQA 2VNUD 4HJ9A 1TWGH 1HNXL 1N9WA 3GTQH 2NN6I 2WFWA 4R4CA 1EIFA 1QUQB 2NVTH 1EOVA 3CXCA 1I5FA 2MO1A 3L0OA 5M5XH 4DR6Q 3DM3A 1NJIC 3G71A 2R7FA 4JOIA 4H02A 4OWXB 3U4VA 3UDFA 4DUYQ 2Z6KA 4A3DH 1YI2A 4GKKL 2K5HA 3J80i 4DV1Q 1KQSA 2VUMG 1N8RC 1LTLA 1A8VA 2YV5A 1W3SA 1NBWA 4GOPC 4LF5L 1Q8KA 4DV5L 1DGSA 1RIPA 4A3JG 2AHOB 1VCIA 3RNUA 3OYYA 4O0AA 1VQIA 2N49A 3GTJH 3OW2A 4A3BH 1Y1VH 1VQ6A 1B8AA 3FKIG 1Q1EA 2DUDA 1IZ6A 5GAEC 4OO1G 4YY3Q 5C44G 4GKKQ 4KHZA 4JI8Q 1MKHA 1TWAH 4IJLA 2MO0A 3K7AH 2IY5B 1K3RA 4KI0A 4BBRH 5HGQA 1ASZA 3GDEA 4BA2I 3S16H 5AJ3L 3JC66 1BVSA 2MFIA 4YCVA 2NZOA 2ASBA 1P16A 4JI0L 4IJHA 3HOVG 3HOVH 2JQOA 3HOUG 5C44H 4O2DA 4DV0L 1N34Q 3GTKH 3H15A 3ULLA 3E9IA 4DV5Q 2ES2A 5JJIA 1YJ9A 4DR1L 1MJEA 3L2PA 1U0LA 3PUWA 2CWPA 2KBNA 1HR0Q 3HOZH 3KF8B 2Q2IA 3S24A 3PCOB 1U5KA 2WB1G 3TS2A 1PH2A 2Z0SA 2NVXH 4GNXA 3E9HA 1Z47A 3FP9A 4GNXB 3NBHB 3UDGA 1X3FA 5C3EG 3DLLA 2JA8G 1VQ8A 3GO5A 4DV4Q 4OONA 3CCMA 4DV0Q 3RN5A 2UUAL 1XNQL 3J81c 1N34L 4B3RL 5M5WH 1SROA 3FKIH 5GROA 2JA6G 3M9BA 3ZJYC 4AQYL 2Q2HA 1T9HA 4A3GH 5C4XG 1EQRA 4JBWA 3T1YL 4NB3A 2K4KA 1X6OA 3M4QA 1D8LA 1GKHA 4LUVA 1SMXA 2R7DA 3A5UA 5LMNW 4A3DG 2R7ZG 1C7YA 1C0AA 4LF4L 2JEAI 3G48A 1Q81C 4DV4L 1XNQQ 2UUAQ 1C9OA 3MXNB 2K52A 2JE6I 5C0XJ 4J15A 2OWOA 1PVOA 2UUBL 3I4NH 2V1CC 1VQ7A 3CCQA 4YHHQ 5FLMH 2A19A 2ATWA 4JBMA 3STBC 4JYAQ 1KIXA 5IYDH 4A3EG 1HNZQ 1NMFA 1HNXQ 3AQQA 2UXBQ 2E8GA 2A1AA 4QY7A 1SFOH 4L5RC 2QGQA 4LUOA 5DLQE 1L1OC 3G6EA 2ZTDA 2I5MX 4LF4Q 2I5HA 1MIUA 3W5OA 4YHHL 1VQLA 1WI5A 1UE6A 4R4TA 4JYAL 3PGZA 4WJ3M 1G51A 1IBML 4YCWA 1VQBA 3RZOH 4A3JH 2XTIA 2N78A 3OTOQ 1VQOA 2Q2TA 1X54A 3H3VI 5JJKA 1GD7A 1HH2P 2JA7H 1PA6A 4JI2Q 4DV6L 1FJGQ 2UXCL 1I50H 3M85A 3K8AA 1YVCA 3KDFB 2EIFA 2VQFQ 1O7IA 1EFWA 3CCVA 3ICEA 1Q12A 4IOAA 1VS0A 1HNZL 5J3BA 3HOYG 3UE1A 1BBUA 5M3MH 4R4IA 1YEZA 3I4OA 4YWLA 1L1OB 5BR8L 3S1RH 1PH9A 2E2HH 3AEVA 2ZM6L 2ZJPA 2UU9Q 1ASYA 5GAGC 4DV6Q 1XPOA 4JI2L 5M3FG 1WJJA 2OTJA 2UXCQ 1SRUA 5IP9H 2C35B 2IHEA 4JBJA 5LMUQ 4DK3C 1IBMQ 3T1HQ 2Y0SE 3OTOL 3WWVA 2Q2UA 4LF9L 1M1KC 3CPFA 4IPHA 1WOCA 2A8VA 2YTVA 4GN3B 1PH5A 2NVQH 5BR8Q 2WP8J 3HKZG 4AYBE 4HIKA 4A3LG 4A3EH 3AFPA 4WJ4A 4R1JA 4JI1L 3J81j 5IP7G 1Y14B 2OQ0A 2E5LQ 2VS1A 1A63A 1CSPA 3EIVA 5FJ8H 5GADC 1QVGA 4JBKA 2B63G 4GLXA 3KFUA 2AMCB 4B3RQ 1QUQA 4P71A 1OXTA 2QEXA 3RZDH 1E24A 3EBEA 2VQEL 2KENA 2UU9L 1LM0A 2K14A 1WYDA 4DR4Q 2PNHA 4B3ML 5FLXc 1N32Q 4BXXG 3PUYA 2ZTCA 2UUCQ 4LWCA 4LF9Q 4XIGS 2OTLA 1JJGA 4A3BG 4GNXC 1XMOL 3H0GG 4A3FH 3A0JA 4QQBX 4OO1I 3KF6B 2R93H 5ELOA 1HZBA 4NPSA 3KF6A 4PZ6A 2JA5H 1VQPA 4HIMA 1EYGA 3GTLH 5EAYA 4P75A 3STBD 4A3KH 1BKBA 1N33L 4B3MQ 1N32L 4DR5L 1TWHH 2ZTEA 4QGUA 3S1QH 4JI4Q 1WCMH 3M7NA 3I4MH 4LFCQ 1LUZA 4MNOA 3J7ZC 3HFZB 2VQEQ 1FVIA 1HJPA 1KHIA 2HQLA 2HIVA 2GVBA 2PI2A 2VW9A 4DR3Q 2RHSB 1X9NA 1X3EA 4Y7NH 4B3TL 2JA9A 5JEAG 3I56A 4P73A 4OXPA 3U58A 2UUCL 2MQHA 3F2DA 2NN6G 5C0XI 3KYHC 1YJNA 4C3IH 1QVFA 3F2CA 2RCNA 1XMOQ 4IPDA 4JI4L 4TVAB 4BA1I 4X64Q 1IYJB 1XJVA 2CFMA 1X3GA 3TREA 1YHAA 4AQYQ 1P8LA 4A3CG 3CD6A 3HOWG 1VQEA 1N33Q 1HZCA 2Z6KC 4RG1A 4A3IH 2KHJA 2HT1A 1PFSA 4B3TQ 3M4OH 4IFDG 4HJ8A 2K75A 4LNQA 1NTGA 2BH8A 5ELNA 3CCEA 4LFCL 1UEBA 2K5NA 5C0XG 3KLWA 3HOXG 4GKJQ 3L7ZC 1EUJA 2UUBQ 1Q7YC 3CC4A 4NXMQ 3KJOA 3JAMi 3ER0A 2GVAA 2R7ZH 4POFA 4PZ8A 4NXNL 5IE8A 4JI3L 3ULPA 3T1HL 1A62A 2I5LX 2LXJA 3W1BA 4GOPA 4A3GG 2UXBL 1YHQA 2YU9H 4R4QA 1K83H 4A93H 1L2FA 3HOXH 1I3QH 1LYLA 1AE2A 2PQAB 3B6YA 4EX5A 3CCJA 5C3EH 4A75A 4B3SL 4BY1G 1VQGA 3HOWH 4JCVE 1V43A 3UDIA 4A3KG 1GM5A 4PZ7A 4LFBL 4JI3Q 1V9PA 3PIPA 3NENA 3PIOA 3LGJA 1G291 3U50C 2EQSA 4BBSG 4DK6C 1VQDA 3NEMA 1XPUA 4NXML 4OWWB 2Y0SG 5K36G 3PO2H 4DR4L 5LMNL 3CPWA 1FJGL 5JEAJ 3AYHB 1HR0W 1V1QA 1B7YB 3HKZE 4A3MG 4B3SQ 4GN4B 4AIMA 2ZJRA 3RLFA 3RLNA 1QZGA 3S2DH 4A93G 1QVCA 3AFQA 4LFBQ 1Q86C 2DGYA 4BBRG 1CKOA 4HJ5A 1KRSA 1PH4A 1Q1BA 2N3SA 3PF4A 4IPCA 5C4JH 5IWAL 1IXRA 4RMFA 3S2HH 4GLVB 2PI2E 1HZAA 4AYBG 1PYBA 1WFQA 5IYBH 3CAMA 2R92H 5JJLA 4R4OA 3M3YH 4Y52H 3U4ZA 3GTPH 5LMNQ 1VQ5A 3I4MG 4DR3L 3H0GH 4A3FG 1YHBA 3ULJA 4JV5Q 4X62Q 4DV2L 5IP9G 3KJPA 4JI1Q 4DUZQ 4X65L 2FXQA 2E5LL 3GTMH 1L0WA 3KOJA 1KAWA 2N8NA 4LFAQ 1SN8A 5IYBG 2IX1A 3HOZG 4X64L 2YYZA 4DR2Q 5IWAQ 2R92G 4L5SA 5H1SE 4JV5L 2B63H 4DUZL 1KRTA 1KC8C 3GTGH 3I7FA 2WAQE 1VQ4A 3D0FA 3W1GA 1S72A 1CSQA 3PO3H 3E0EA 2BH2A 4X66Q 4A3MH 1E1OA 3BJUA 2HHHQ 4GKJL 3TS0A 1YITA 2AKWB 4QJFA 3GD7A 4DV7Q 2KCTA 3PSIA 4DR5Q 4FDBA 3CMEA 1GVPA 3F8TA 5GQOA 4L5QA 4PMWA 4LFAL 3CC2A 2D0PA 3M4PA 1VQJA 4UPAA 4K0KQ 1K8AC 1G6PA 1NY4A 3J7A5 1OXSC 4BY7H 1X65A 4UP7A 4DR2L 1JJ2A 3TEHB 2AWNA 4X66L 4HJAA 4ALPA 2VUMH 4KHPQ 2PQAA 4LUZA 3EN2A 1KXLA 1BBWA 5M5YH
chains in the Genus database with same CATH superfamily
1TWHB 2O2LD 3OHXC 3Q8DA 5A2QL 1SE8A 5IT9c 4APVA 2K05A 1R4PB 3JAME 2PPBC 2LKVA 2KJXA 3MC0B 3P1HA 1AE3A 1LT5D 5FOBB 3OW7A 3CCRA 1B4OA 3BU2A 4DNIA 3TP6A 2GN5A 5IYDG 2SOBA 1Y1WB 3OMGA 4UAIA 1GO3E 3VYUA 4CKEA 4YIJA 3RN2A 5CBEE 2F4VQ 2EZVA 1PH1A 5KEEA 1K28A 1DOKA 2CWAA 4KHVA 4DN4M 1EWIA 2L15A 1HXYD 1OXXK 4L5TA 3G4SA 3HOYH 1EIHA 2B2YA 1XPRA 4HAEA 2NVYB 4P72A 1II3A 5J1ZA 3DHQA 4YY3L 4HIOA 1PH8A 3K5NA 3E0JA 3J80L 4X65Q 2F0WA 2EE1A 4C1NK 4HSVA 2XRSD 3S9WA 4LF6Q 4BWGB 3JAMc 2ZXPA 3A5ZB 3QIAA 2OCEA 4G57A 1GUGA 1TQOA 4KTAA 3QOJA 3MXUA 1IBLL 2O5JC 1TS5A 4ULLA 4IO9A 4DR7Q 5EBCA 2EY5A 1LLRD 4XYQA 1BUVT 2B2VC 1Q82C 4IUUA 3H0GB 4PV1C 2E2JH 1H9JA 3F1ZA 4DXGA 4LW1A 3J81i 1E7ZA 5CR3A 2F1MA 4K8IA 4DKAC 5CV6A 3K57A 1SNDA 1PRTD 4RCOA 2MP1A 3K80C 3PO2G 2D5DA 4DR7L 1A3UA 2FMMA 4OX9L 1Z7TA 1UUPA 3TQYA 2E2IH 1JOQA 2MJ8A 3GP7A 5J22A 2EVBA 1QILA 3BDCA 1KNEA 2GA4B 2RQXA 4Z9CB 1J6QA 1F9QA 1HR0L 4K5XA 3TDQA 4BY1B 3BZKA 5BN4A 3D31A 3HOUH 2F0MA 4KY6A 1SE4A 1TWFH 1M90C 2ALYB 3VDYA 2CCZA 1UNSA 2EJFC 1XTDA 4FO2A 3WOFA 5D3DA 2AQ2B 4XXEA 3MHBA 4HMIA 2D2CC 3SK6A 1SYCA 5BN5A 2VQFL 2JEBI 5E7NA 3CMAA 5J39A 2MUYA 3GTMH 2D62A 1STGA 5C44B 4HJ7A 4LF5Q 1ENAA 1SYEA 2ZM6Q 5EKKA 4KK7A 1Z9FA 2K50A 3VA7A 2F0JA 2VZAA 1FR3A 1KAAA 4BBRB 1QCBD 4OWTB 1VF7A 2NWGA 1AH9A 3HOWB 3LNNA 2F03A 1TWGH 4UHVA 1EIFA 2NVTH 3CXCA 1EY9A 2MO1A 2EYJA 2IW3A 3L0OA 2HD3A 2R7FA 4OWXB 4DK1A 4FP5D 1YI2A 4RH6A 4GKKL 3J80i 1KQSA 1LTLA 3DUZA 2L4NA 2R61A 3AU7A 2AHOB 2EYPA 1G2SA 3QB3A 5FLXE 4A3MB 4O0AA 2A6HC 1PZKD 4GZYC 4OHJA 5GAEC 4TRDA 1TWGB 4KHZA 4JI8Q 1TWAH 3X3MA 3K7AH 2IY5B 2PW5A 4KI0A 1JOOA 4FF4A 1BVSA 1I4GA 2NZOA 1HFGA 2ASBA 3I73A 4S3SA 3HOUG 4DV0L 2F0DA 3OIQA 3GTKH 4DV5Q 1SYBA 1BCPC 3L2PA 2KBNA 2K33A 2PYKA 1FNWA 1TWFB 1GXDC 1PH2A 3E9HA 3UDGA 2A68D 4GNXB 4EGVA 1STYA 5E4WC 1HUNA 3CCMA 5D65A 3Q6SA 4DV0Q 2D9UA 3RN5A 1EY0A 1PZID 3FKIH 1STAA 2JA6G 4DF7A 3NQIA 4A3GH 1ENCA 3M4QA 3A5UA 1ZKOA 1TR5A 2F0EA 3P75A 3SVMA 2JEAI 3G48A 1Q81C 1XNQQ 3MXNB 4KKTA 4J15A 1LT4D 3I4NH 1EY4A 3C2PA 4QCLA 2A73B 1YNJC 4A3BB 4JYAQ 5IYDH 4A3EG 3C46A 1I4PA 1PTOB 1NR4A 3C3LA 1ZEQX 4L5RC 3G6EA 2Z4HA 1L1OC 2PNRC 1CHPD 4KY7A 2ZTDA 3TMEA 1H9SB 2I5HA 3W5OA 3JAML 1VQLA 5ELEA 2MPMA 4R4TA 1X3QA 4JYAL 4WJ3M 1G51A 3BZDB 5EPLA 2XTIA 1JWUD 1SAPA 2F0KA 1YVCA 3KDFB 4TKOB 1EWCA 4IOAA 3CCVA 3ICEA 1BOSA 2EYFA 2FFKB 2XN9C 5A2QE 1AZQA 3UE1A 1BBUA 1HNZL 3HS0C 4KJNA 4YWLA 3AEVA 2ZM6L 2EYLA 1CZGA 2FJ2A 2ZJPA 1DD2A 2F0NA 4I65A 2OTJA 1TT2A 4RHRA 1GJXA 2B2UC 4LF9L 3TP7A 1FD7D 1WOCA 1PH5A 4GN3B 2NVQH 5BR8Q 3HKZG 2OT2A 1SFOB 3AFPA 3J81j 2E5LQ 2RSOA 2OQ0A 5IT9L 1V1PB 1CSPA 3EIVA 1C4QA 3NBHA 2I46A 3OPOA 4P71A 1F2ZA 2C5CA 2PO4A 1E24A 2K5DA 3EBEA 4X3KA 1N32Q 1YNNC 1GOZA 3CRLC 4BXXG 2CVRA 1PFNA 2B8FA 1FYCA 2VB2X 1XMOL 3H0GG 4CJ1B 4QQBX 4OO1I 2CH4A 3BVMA 4HIMA 1A3TA 1CFMA 3RMHA 1BKBA 1N33L 4IN3A 1TWHH 4QGUA 1DYQA 5ELBA 4JI4Q 3M7NA 1TY2A 2PCFB 5C6AA 2GVBA 1EFID 3QR8A 2NVQB 2LY7A 2RHSB 1SJED 4Y7NH 2JA9A 3IL8A 4P73A 2UUCL 1ILQA 4MHEA 2NN6G 2RDGA 2WINB 4IPDA 4TVAB 1IYJB 4N9PA 1EY6A 4J1MA 1P8LA 2SDFA 1VQEA 1EYCA 2KHJA 3Q23A 1BNZA 4B3TQ 1XWEA 3M4OH 4IFDG 4HJ8A 1SXTA 4LNQA 2BH8A 5ELNA 5LL6S 4LFCL 1LT3D 2ENBA 4ZK9B 2XWJB 3HOXG 4JPBW 1EUJA 4FF1A 5FO8B 3QO2A 3CC4A 3JAMi 1E2ZA 5FO7B 4AYBB 5IE8A 3KLSA 3T1HL 2I5LX 4GOPA 3ITPA 1L2FA 3EVQA 1BR9A 1EOTA 3I4MB 3I72A 4ZKBB 1VQGA 2J7ZA 3PIPA 2CHBD 3CU7A 3U50C 3AMUA 4NXML 4OWWB 2A5HA 4BBSB 3VR5A 3AYHB 1HR0W 2Q8IB 3HKZE 5JPMC 2QKIC 4B3SQ 5C5MA 1I4HA 1Q86C 1SEBD 4HJ5A 3DEPA 3DXJC 1KRSA 1PH4A 1Q1BA 3RZDB 4IPCA 2EY6A 3HEJA 4NMZA 1IXRA 1Y8PB 3K5LA 2YU9B 4GLVB 2PI2E 1SYDA 3CAMA 3H6MA 3I4MG 2LFNA 5CBAE 1S4ZA 3H0GH 1YHBA 3ULJA 2XWBB 1JB3A 2M9VA 2A6HD 3K6OA 1S5DD 1KDAA 4ZQ3A 3KOJA 2BE5D 2KOLA 3SDZA 1PRTC 1HA5A 2FMCA 5IWAQ 4WFN3 4JV5L 1SE3A 5HGTA 1KRTA 1XYIA 3I7FA 3MVVA 1ICFB 3D0FA 3W1GA 1S72A 3NWSA 3PO3H 1DOMA 3E0EA 4A3MH 4GKJL 4BS9A 1YITA 4A3JB 4OGQC 3RZOB 3MA2B 3PSIA 4FDBA 3F8TA 5GQOA 4LFAL 4PMWA 2G9DA 2JSOA 1K8OA 4Y7NB 1K8AC 3J7A5 4UP7A 2IX3A 1JJ2A 4X66L 4KHPQ 2PQAA 2FHTA 4RGTA 4LUZA 3C1FA 2JA5B 5M5YH 2F0OA 1OTCA 4GS3A 3J80c 4K14A 1A3VA 4DV7L 1SBBB 3SGIA 5G3LD 3PIP3 1QZHA 5CMDA 2IT1A 3NWTA 4HCSA 3QJYA 1MSHA 1RL2A 4AH6A 1CKNB 5FK9C 1BF4A 1SNQA 1CUKA 3BZCA 1WTQA 4LF8Q 4POGA 5HURA 4DAYB 1VQMA 3IRBA 1SYFA 2SNMA 3A55A 1A2UA 1STNA 5FLMG 2B29A 3S1MH 3E3XA 1KL9A 1NE3A 4BY1H 4A3CH 4LF8L 3BVZA 1RDPD 4X62L 2HQEA 2JA7G 2H5XA 4EQ5A 1EYDA 1TXYA 4A3LH 5I6WA 5M3MB 1I6HH 3R2TA 5C4XH 4KD3A 4EVOA 1J5EL 4IFDJ 1ESRA 1A2TA 4DR1Q 4UY8C 1CKMA 2MHVA 3SK8A 3OWFA 3TRZA 2TMPA 3EJIA 1PH6A 2UXDQ 2ID0A 1O78A 2HIXA 1G6PA 4JI5L 1I94Q 1JT8A 4BXXH 1IL2A 2BA0A 1KD1C 1A6XA 2JK8A 2G9HD 4OIJA 1PDQA 4IOCA 3NHHA 4IZ8A 2IX0A 5CV7A 1S3OA 1HZ9A 3CP0A 1PTOH 3GQBA 1SNPA 3A74A 4UDUC 4QUFA 2HDLA 5ELCA 2K32A 2BOSA 2A6EC 4JI0Q 1HNWQ 1GHJA 1TVXA 5M3MG 4DGZA 4O42A 1EU3A 4DPGA 3KBXA 1UE7A 3CW2C 3UDXA 1K0RA 1CM9A 1KTKA 2KHIA 4HR7B 1W6JA 2JN4A 4CDCC 5M5WB 3DMUA 3P20A 3U9OA 1XMQQ 3MFYA 1WTXA 2BA1A 2B2TA 1EY8A 2VL6A 2XRQD 4V190 3T1YQ 4X6AH 1ONLA 2F0HA 1PHJA 1VQAA 1MJCA 2NTTA 2VY3A 4IUTA 5ISRA 4QL5A 2XGTA 4ME3A 4U673 2QA4A 1XTCD 2J4XA 4GOPB 4IUPA 3PUVA 1X56A 4TQUS 4JI7Q 3CCSA 2PMZB 2B3GA 1VQFA 3R93A 2PZUA 1R9TH 1HNXL 2JXMB 1CQVA 4R4CA 2VUMB 1QUQB 2ICIA 1EOVA 3KUPA 1I5FA 3O13A 5M5XH 3G71A 4RCNA 4RGNA 3UDFA 2DJFC 4WJWA 1S5ED 2RCFA 3A56A 2YV5A 1NBWA 2R7ZB 1EQTA 1PRTB 1RIPA 4A3JG 1VCIA 1LTTD 3RNUA 4RAUC 3GTJH 3OW2A 3NP8A 5FLXL 3A8IE 1IZ6A 4C2MB 1NUCA 4IJLA 3LX0A 1C8CA 4BBRH 1EU4A 4DAPA 1ASZA 3U9SA 1U4PA 5AJ3L 4YCVA 2SNSA 4FXDA 1B3QA 1U4LA 3HOVG 5C44H 3L3OC 4OO1H 1N34Q 3V05A 4A3GB 2BCOA 1U0LA 3PUWA 4KN4C 4ZUJA 1HR0Q 4HN7A 1B50A 4NP5A 2NVXH 5M9OA 4GNXA 2EY2A 1Z47A 2KHSA 1X3FA 2JA8G 1I3QB 4XQQA 1O80A 4OONA 1SSOA 1N34L 3M9BA 3A54A 1EQRA 2R93B 1X6OA 3TN2A 1D8LA 4LUVA 4Q5VA 4A3DG 5TSSA 3I70A 1C7YA 4IUNA 5KYLA 4CKCA 4KKSA 3KLRA 4C3HB 2QF7A 3K7AB 2K52A 2JE6I 2OWOA 2UUBL 2BE5C 5FLMH 2A19A 3NQTA 3D6CA 1HNZQ 1D1KA 3AQQA 1PTOD 2A1AA 3K58A 3EROA 2BDNA 5DLQE 1JORA 2A69D 3MAQA 1MIUA 5IODA 3NTKA 3RZOH 2QILA 4A3JH 2B8GA 4G7OC 1HH2P 2JA7H 2UXCL 1FJGQ 1I50H 3K8AA 2F0VA 1RF2D 1DM0B 1V8QA 1E2VA 1AEXA 3HOYG 4R4IA 1YEZA 3I4OA 5DM73 2E2HH 4ZUIA 1ICWA 1ASYA 4DV6Q 1LV9A 1WJJA 1SRUA 5IP9H 1FNVA 4DK3C 3J7AF 2DY7A 1IBMQ 1O7YA 2Y0SE 2G5DA 2Q2UA 5C4HA 4OL7A 5K5PA 2YTVA 3CRKC 4FF2A 1LT6D 2JA8B 4AYBE 4A3EH 4WJ4A 4JI1L 2NBFA 2VS1A 4WORA 1QVGA 4JBKA 2B63G 3KFUA 3NPPA 2KEEA 2PZTA 1QWYA 2QEXA 1G91A 3MXPA 4DR4Q 3G6JB 4B3ML 5FLXc 2XNAC 4OEMB 1A15A 3HOVB 3D6WA 2E2IB 2UUCQ 1JR0D 2ZXOA 5EKLA 1L0YB 4LF9Q 1JJGA 4A3BG 2A6ED 1XX8A 4P2CB 2R93H 1HZBA 4PZ6A 5CGKA 1VQPA 4P75A 3STBD 4B3MQ 2BDOA 4DR5L 1MD2D 1ESFA 3I8ZA 2Q8TA 4CDDC 3I4MH 2VQEQ 3VR2A 3HFZB 1FVIA 3T56B 2PI2A 3FRPB 4B3TL 2Z8LA 4OXPA 3U58A 2QDLA 2MQHA 5IGFA 3KYHC 2HDMA 1CK1A 2IPKD 4C3IH 2QEJC 1IKMA 4JI4L 4BA1I 2MGSA 2CFMA 1X3GA 5C0XH 4AQYQ 3CD6A 1N33Q 1PFSA 3HP3A 2EJGC 2X6LA 1I4XA 2K75A 5C4XB 1NTGA 3I4NB 1UEBA 2K5NA 2F3WA 4LAAA 2OF1A 3KJOA 4FNFA 2WB1B 2R7ZH 5CV8A 1S5CD 2Q8RE 4ZCKA 4A3GG 3FKIB 2UXBL 1YHQA 1RTOA 4R4QA 5EPKA 1I3QH 3R8BA 1AE2A 5C3EH 4B3SL 1IYVA 1V1PA 4JCVE 1V43A 3UDIA 1SJHD 1GM5A 3NENA 4CGYB 2K1BA 3TP5A 1VQDA 2NN6H 2Y0SG 1STEA 1GHKA 1FJGL 1V1QA 4C3HG 3GTMB 3S2DB 4GN4B 2ZJRA 1QZGA 1Y8NB 1EIGA 4L8JA 3RLFA 4A93G 1QVCA 3AFQA 1STBA 5EGTA 3PO2B 4BBRG 1CKOA 1LTAD 3OOCA 3TP8A 5ELFA 4QF4A 5C4JH 5IWAL 3Q0AA 1AN8A 4RMFA 1SNCA 3SE0A 1PYBA 2AUKA 5JJLA 5KYIA 2WIIB 4R4OA 2KEDA 4HCEA 4Y52H 5JAVA 3GTPH 2M00A 3VYRA 4DR3L 5C5LA 4X62Q 1LO5D 4U68A 3VR3A 5M5XB 1PYWD 1L0WA 1QNUA 3PO3B 1KAWA 2N8NA 1I4RA 3HOZG 4X64L 4CJ0B 2R92G 2X6GA 5CORA 3Q22A 2RSNA 4DUZL 1PFMA 2WAQE 3SEBA 1VQ4A 1WD0A 1QG7A 4K2KA 4C3IB 2JA7B 4X66Q 4CHTB 3NTIA 3BJUA 2HHHQ 2WKCA 3MTSA 2AKWB 4ID6A 3KLSX 4HTHA 1UEAB 3MEHA 2Z4IA 2AQ3B 3CMEA 4O1NA 3NSWA 4Q0FA 3CC2A 5NUCA 1I4QA 1VMPA 4UPAA 1X65A 4DR2L 2TSSA 3IFTA 3LWUA 3V2TA 4CDFC 2AWNA 2Z6BA 1WCMB 3EN2A 4PMBA 3NXWA 3NK9A 5COYA 4E6IA 4FXGC 5DEHA 2OQKA 3WOEA 4CKBA 2L9HA 2HCIA 1STHA 5C3WA 2CQOA 4C3HH 2CKZB 1PH7A 1YZ6A 2YTYA 1CKNA 1FL0A 3K81C 1JJCB 1KABA 2RF4A 4C3JH 3CCLA 3K7UC 1GUNA 1GUOA 4KD4A 1VQCA 3I4NG 4BY7B 3CQZH 4LF6L 1G6ZA 5JVG3 4A76A 4G7ZC 4RA8A 2D0OA 4IFDI 2DNEA 2UXDL 4HMJA 3GTOH 1L0XB 4JVZA 2F4IA 2KCMA 2WACA 3VR4A 3ZYYX 1K9MC 1Q46A 1O7LA 3IKJA 4K6LA 1TS2A 5IT9E 4JI7L 4ZLTF 3BYYB 4K5VA 1OXUA 2ICEC 4H44C 1X3PA 3N52A 1VQ9A 1PV4A 4KLKA 3N6RA 4BY7G 1K8GA 4JC0A 1PFBA 3FHWA 3MXGA 3CCUA 1F77A 1SR3A 2F0PA 3F2BA 2IHFA 3H3VH 4YCUA 1JMCA 1DCZA 1RJTA 3ND8A 3K59A 4MTNA 3BDLA 3RLOA 2R6GA 1YIJA 4K0KL 1KNAA 4C56C 2WAQG 5C4JB 2SEBD 2DY8A 1VQHA 3A7AB 4KKUA 4JI8L 4KN7C 4UP8A 2WB1E 5IGDA 5E1FA 1LTID 5IP7H 2JA5G 3VYSA 1B70B 1EZ8A 2NYZD 4CBVA 3S14H 1WCMG 2L0CA 2R93G 4EQPA 3RR5A 1EIYB 1ENFA 1I6VC 1WD1A 3J7AV 2JJQA 1Y1VG 1KLUD 5I2YA 4X3SA 2EOTA 4YWMA 4PG3A 3KF8A 5I9OA 5KRUA 5M5YB 1IBKL 4IPGA 2FINB 4RKBA 2K5QA 3BG3A 5KNCA 4JI6Q 4DAYA 3OSOA 1KDBA 1PH3A 1S40A 2PW7A 1JWSD 2O5IC 4DV3Q 2K7VA 1N36L 4DR6L 1YNXA 1VQKA 2NZHA 5IY0A 1X55A 1A0IA 2ZJQA 1JE5A 2L12A 3PO3G 4BBSH 4LF7Q 1G2TA 5EQ0A 1BCPF 1Q3LA 4EQOA 3HRZC 3MEFA 5I4DA 5LMUL 1EQQA 1DZ1A 2O4XA 4HJ9A 4XT3B 4XT1B 1N9WA 2NN6I 1Y1VB 5KNDA 1Q90A 4JOIA 4A3DH 2Z6KA 4DV1Q 2VUMG 1HFNA 1WTPA 2EPBA 1A8VA 4LF5L 1W3SA 1KLGD 1B2TA 1Q8KA 4A3DB 1NSNS 3BDOA 3OYYA 2N49A 5DAUA 3W2DA 4A3BH 1Y1VH 1VQ6A 3UI2A 2Y0SB 4OO1G 1GUTA 2N55A 1MSGA 3DM1A 2OXPA 2MO0A 1J8IA 1K3RA 2CH4W 3GDEA 3S16H 5IGGA 3NE5B 3IFDA 1D2BA 1I6HB 1P16A 1CZWA 2JQOA 2NTSA 1JE4A 5D14A 2QW7A 3H15A 1SYGA 3E9IA 5JJIA 3PIO3 1MJEA 1WTWA 3HOZH 2Q2IA 3S24A 3TS2A 2WB1G 1PLFA 3FP9A 1HUMA 1TU2B 2E74C 3DLLA 1PZJD 3FDTA 1VQ8A 3HOXB 1XNQL 2UUAL 1S5BD 3K5MA 5EBDA 1SROA 1ZYRD 2H4OA 2Q2HA 2XIWA 1T9HA 5C4XG 2K4KA 5LMNW 1GKHA 2R7DA 1YNJD 4M1UB 1C0AA 1JCKB 1SDFA 2K6AA 4XDXA 5C0XJ 1JWMD 2V1CC 3NBIA 3NUCA 1VQ7A 3CCQA 2Z9HA 1GUWA 2ATWA 1I50B 4JBMA 1KIXA 3I4LA 2E8GA 2R3ZA 2WKDA 4QY7A 1SFOH 3FVQA 4LF4Q 4YHHL 1WI5A 1SNOA 1UE6A 2KECA 3PGZA 3J80E 5IOCA 2N78A 3OTOQ 1CI3M 5JJKA 3GTQB 1F2YA 1W6KA 1Z6HA 4JI2Q 3M85A 4NDXA 3S1RB 4PQXA 3H3VC 1RTNA 3GTGB 4MTKA 1EFWA 2L11A 4K6DA 1VS0A 5M3MH 3ONAB 4IUVA 1L1OB 4H7BA 5GAGC 1XPOA 4JI2L 1PTOC 5EKIA 2DN8A 1WTVA 1F9SA 2C35B 1H9KA 2IHEA 3DWAA 4JBJA 5AFWA 3T1HQ 3WWVA 1IW7D 5CC4A 3CPFA 1MI2A 5JVH3 1PXUA 1BQQT 4R1JA 2R92B 5IP7G 1Y14B 3I90A 3PQIA 2NVXB 1B44D 2KCCA 3C1EA 5FJ8H 4C3JB 4GLXA 5JJZA 3A8KE 2AMCB 4B3RQ 1QUQA 3RZDH 2WAQB 1FGBD 4DNTB 2K14A 4PNYA 1TS3A 5C3XA 4A3FB 4FVMA 3PUYA 2ZTCA 4C1NI 2B2WC 4X3UA 4XIGS 2OTLA 4GNXC 1D5ZC 2A69C 4A3FH 3A0JA 5ELOA 4NPSA 3KF6A 1C48A 2JA5H 3GTLH 1EYGA 5EAYA 3ERQA 1D5XC 1WTHA 1N32L 3S15B 4CDEC 3VA5A 1K8MA 3QOLA 4ZAIA 3S1QH 4DFAA 1RODA 1EWHA 5JPNC 1RKNA 3GTJB 3L9AX 4A3EB 1HJPA 1F9PA 3NTHA 2HIVA 4A93B 4I7AA 4DR3Q 2E2JB 2Z1CA 3H09A 5JEAG 3I3CA 3F2DA 4B9WA 5K36H 5C0XI 1QVFA 1AP0A 1XMOQ 3E6ZX 5I9PA 4RFBA 1HA6A 5M3FB 3TREA 1YHAA 4A3CG 3HOWG 4DA2A 1R9TB 4RGOS 2Z6KC 4RG1A 3J7YW 2HT1A 1MHWC 2IJ0A 4IFDH 2L5TA 3CCEA 2KUMA 1B9NA 1IYUA 2K01A 3KLWA 4A3IB 4H0LC 1HRJA 1T5XD 3L7ZC 3MZ5A 2IWHA 2UUBQ 1Q7YC 1BCPD 3ER0A 2GVAA 4POFA 2RBMA 4PZ8A 1IHZA 3ULPA 4K2LA 2LXJA 1TIID 3W1BA 2NVTB 4J8QA 1LYLA 1LTSD 2CQAA 2PQEA 1EEID 2CW0C 4BY1G 3HOWH 2B2VA 3OWEB 4PZ7A 3R2IA 4G7HC 4LFBL 2KQ3A 4RGMA 4HSPA 4DAVA 1G291 1MBYA 2EQSA 4BBSG 4B9XA 3NEMA 3PO2H 4DR4L 3CPWA 3KBGA 5JEAJ 1B7YB 1ET9A 4ZRZA 2DJGC 3RLNA 1M4VA 2K28A 4LFBQ 2DGYA 5KGUA 2QDBA 3MWYW 2N3SA 1LACA 3S2HH 3TZDA 3V96A 1HZAA 4AYBG 1WFQA 4KV6A 4OELB 3HZXA 3RUZA 2KVMA 3U4ZA 4ABNA 3SXHA 5LMNQ 3HOZB 4A3FG 4JV5Q 1DXMA 4DV2L 4DUZQ 4JI1Q 2FXQA 3S1NB 1LABA 1BXTA 4IQZA 5IYBG 2IX1A 4ILWA 1ILPA 1LTRD 4L5SA 1MGSA 1EQVA 5H1SE 5BN3A 2I07B 1D5MC 3URYA 1CSQA 2V4DA 5IIFA 2DNCA 2BH2A 2B2TC 3TS0A 5T1GA 4DV7Q 2KCTA 4LJZC 1GVPA 4R8NA 2K03A 5CYUA 4L6TB 2M2LA 2D0PA 3M4PA 1VQJA 4K0KQ 4BY7H 1OXSC 2NUCA 1JQYD 2XVSA 3TEHB 1Q8IA 2L1BA 2VB3X 4K8JA 1B1ZA 1FNUA 3H91A 3CKIB 2EXDA 5E4XA 5I6YA 3HG9A 4DU9A 1VQNA 1S5FD 1PYSB 4CJ2C 4FYDA 4DNRB 1E3PA 4A4IA 2ZT9C 1D1IA 1OXVA 2RVLA 4LMQD 4MZ9A 4XTCS 2NVYH 1UE5A 2F0QA 4EQNA 4OIKA 5G3LF 4F87A 2JA8H 1J5EQ 2RA4A 1K83B 4NKLA 2B2YC 4NXNQ 1W2BA 1H95A 1EYAA 3FMCA 2I0QA 1Y1WH 1L1OA 3F2UA 2F3VA 3IAYA 4R8IA 1JB7A 5IYCH 1UWVA 2F4VL 4DV2Q 1E1TA 5CV9A 5FJ8G 2E2HB 1QJOA 5AJ3Q 2JA6H 1QOHA 1VDZA 3S17H 3T53B 3CC7A 1I94L 4JI5Q 1TWCH 3A7LA 4N8FA 1NMGA 4JW0A 4JOIC 1TS4A 4J6HA 2LSSA 2K5VA 2F3IA 2KCNA 5M3FH 3EFXD 2MNAA 4QIWE 4YWKA 4DAMA 1E22A 1K73C 2HHHL 4MIUA 4N8X1 2IL8A 1HPCA 3EQLC 3GTPB 5IYCG 1TKWB 4RKLA 1IBLQ 3MXNA 1YBYA 4HIDA 1K0SA 5T1IA 1IBKQ 3DWPA 2AWOA 3S15H 5JEAH 4L63B 4KHPL 3GTLB 1JICA 2B63B 5GAHC 2EXZA 1PTOF 1RCVD 4F8MA 2K5WA 3E5SA 1EL0A 2RHQB 2K04A 3ERSX 1N36Q 3PUZA 2LXKA 3PF5A 3S1NH 1WTOA 3PMFA 1XMQL 3HKSA 1Y69U 3GTOB 3NELA 2P5ZX 4DV3L 3I55A 4LF7L 2VXWA 3K0XA 1XNRL 3M3YB 1VF5C 2JYOA 3PUXA 1SMYD 5HY6A 1YJWA 1HNWL 1HHVA 3CF5A 3MFGA 3I2ZA 3KDFA 3PV0A 4GN5A 3OIPA 4QIWB 1GUSA 2B39A 1M8AA 3TBIB 4GLAC 4OX9Q 3HOUB 5LL6X 1U4RA 1FGUA 1Y1WG 3A8JE 1AW7A 1UE1A 2PMZE 4UP9A 1SLJA 1CT1D 4JI6L 5IGEA 4JG2A 3SK5A 4A3IG 4P74A 2N88A 1BBXC 2RDFA 1D7QA 3UE0A 2F52A 3QG1A 1XNRQ 2YTXA 4DUYL 4C2MH 4XQJA 4DV1L 1QE6A 2XSCA 1EY5A 1T5EA 2VNUD 3GTQH 2WFWA 1F2MA 1F2LA 4DXFA 4DR6Q 3DM3A 1NJIC 4ZKCB 1H9SA 1U4MA 4H02A 3U4VA 4DUYQ 1IL8A 3HGBA 2K5HA 1N8RC 4LK1C 1IKLA 4GOPC 1XXGA 4DV5L 1DGSA 3R3OA 3M7GA 3S2HB 1VQIA 2EDGA 3T51B 1B8AA 3FKIG 1Q1EA 2DUDA 3X3NA 2QCPX 4YY3Q 5C44G 4GKKQ 4XYOA 3KK7A 5EJWA 1MKHA 3Q24A 4IURA 5IGCA 1WTRA 5FKAC 4F88A 5HGQA 1O7ZA 4BA2I 3JC66 1X32A 2MFIA 4QB4A 3SHLA 3BYTB 4JI0L 4IJHA 2X69A 3HOVH 4O2DA 1ET6A 2ES2A 3ULLA 3P7JA 1YJ9A 4DR1L 2CWPA 1J9OA 3KF8B 3PCOB 1U5KA 2Z0SA 3GV3A 1DJRD 5A35A 3NBHB 5C3EG 3GO5A 4DV4Q 4B3RL 3J81c 3T13A 5M5WH 1EZ6A 5GROA 3ZJYC 3K0YA 4AQYL 4K5WA 4H13C 3G7LA 4KMUC 4WRDA 4JBWA 4ME5A 3T1YL 4NB3A 1SMXA 2R7ZG 4LF4L 4DV4L 2UUAQ 1C9OA 2B2WA 4QMGA 1PVOA 2LS01 3S14B 1CQFA 4YHHQ 4PMCA 3STBC 1AFPA 4IALA 1NMFA 1HNXQ 2UXBQ 2F0UA 3VYTA 3W3AA 4R9WA 1DONA 2PZWA 2QGQA 4LUOA 2I5MX 4RHSA 4KJOA 2RDHA 1B9MA 4C3JG 1IBML 4YCWA 1VQBA 1YNND 1VQOA 2Q2TA 1X54A 3H3VI 1GD7A 3D4WA 4RWSC 1PA6A 4DV6L 3S1QB 1AZPA 5FO9B 3K5OA 5E3FA 5I2XA 2EIFA 2VQFQ 1O7IA 4V0BA 1Q12A 5J3BA 3M4OB 2EYOA 1IW7C 5BR8L 3S1RH 1PH9A 1JOKA 1HQRD 4FF3A 2F0LA 2J0TD 1K3BC 2UU9Q 2UXCQ 5M3FG 2NZ1D 1Y8OB 2C9OA 2NB0A 5LMUQ 3HOYB 4M8AA 3OTOL 4N9TA 1M1KC 4IPHA 2A8VA 3FEWX 2WP8J 1ML0D 4HIKA 4A3LG 4XQNA 3I91A 3OMCA 1A63A 3CQZB 5GADC 1SMYC 3T16A 2JP1A 1OXTA 1E0BA 2VQEL 2KENA 2UU9L 1LM0A 1WYDA 2LMCB 2PNHA 1NR2A 3GV6A 3QWNA 5CV5A 3T4AC 3TZUA 3FPPA 4FXKC 1QB5D 4LWCA 1U9RA 5IGBA 2F0SA 3CHBD 1NAPA 2HUGA 3KF6B 3LWEA 1B3AA 3DEOA 3ND9A 4A3KH 5KNBA 4X3TA 2OEOA 2CW0D 2ZTEA 4ZYSA 1WVLA 1WCMH 2L55A 4LFCQ 1LUZA 4MNOA 3J7ZC 1ZXTA 1KHIA 2HQLA 2VW9A 1X9NA 1X3EA 3I56A 1YJNA 2E75C 3F2CA 2F0IA 2RCNA 1PMRA 2AUJD 4X64Q 3J81E 1LTGD 1XJVA 2E2DC 4B08A 1HZCA 2F0GA 4A3IH 1D6EC 2F0TA 5ELDA 1TWCB 4C3IG 3M4YA 4HEDA 1RHPA 2A68C 4KY5A 2JA6B 2E76C 3S17B 5LHY1 5C0XG 3SK4A 4NW2A 4GKJQ 4QUCA 4NXMQ 1DOLA 1KDCA 3H94A 1HTPA 1V1OA 2A74C 1F9RA 4NXNL 5D3IB 1BDOA 4JI3L 4IUQA 1A62A 1H9RA 2YU9H 2AQ1B 1K83H 4A93H 3HOXH 2EY1A 2H1EA 1UAPA 2PQAB 3CCJA 4EX5A 2HCCA 3B6YA 2B2UA 4A75A 4F7XA 1CTMA 5KIXA 4JK1C 4A3KG 4JI3Q 1V9PA 3TSSA 5CV4A 1E2WA 2EYHA 3PIOA 3LGJA 1G8ZD 5L37A 4DK6C 1HTLD 1XPUA 4TSSA 5K36G 1SE2A 5LMNL 4MN3A 5DNFA 4A3MG 4AIMA 3S2DH 3AB9A 3S16B 1QNKA 3WDNA 1TY0A 5C4ZA 1BCPB 4I7ZC 1OO9B 3D8GA 3PF4A 4ODGA 2F0FA 5C3EB 1LTBD 1EEFD 5IYBH 2R92H 2KA7A 5DM63 3M3YH 2EJMA 1VMCA 1VQ5A 1PRTF 5IP9G 3KJPA 2E5LL 4X65L 3BVGA 3EA6A 3GTKB 1JC7A 2ZXRA 3J81L 4LFAQ 1SN8A 3D3RA 1CHQD 1NNXA 2YYZA 3RD4A 3D4DA 3VR6A 4DR2Q 1TWAB 3SR1A 2B63H 2RKSA 3HKZB 1H9MA 3DWQA 1NCVA 1KC8C 3GTGH 1CA6A 2EYMA 1B53A 5EPJA 1CA5A 1ZYRC 1E1OA 1HCZA 1RD9D 4G4KA 4QJFA 3GD7A 3BS1A 4DR5Q 3D4RA 4L5QA 3S1MB 1NY4A 1EY7A 1BO0A 1HQMC 4DK0A 4HJAA 1SNMA 4ALPA 1R4QB 5F2DA 2VUMH 4A3KB 2WV6D 1KXLA 3FPUB 5JOBA 1BBWA
chains in the Genus database with same CATH topology
3Q8DA 1OTCA 1SE8A 4GS3A 5IT9c 2EXDA 3J80c 4APVA 1VQNA 2OQKA 4DV7L 3SGIA 1PYSB 1QZHA 1AE3A 2CQOA 4C3HH 3CCRA 2IT1A 1E3PA 4A4IA 2CKZB 1PH7A 1RL2A 1YZ6A 3BU2A 1OXVA 2YTYA 1CKNA 4MZ9A 4AH6A 4XTCS 4DNIA 1CKNB 2NVYH 1FL0A 3K81C 1UE5A 1JJCB 2GN5A 2RF4A 5IYDG 4C3JH 3CCLA 1CUKA 3BZCA 3K7UC 4LF8Q 4POGA 2F4VQ 1GO3E 4DAYB 3RN2A 3IRBA 1VQMA 2JA8H 1VQCA 1J5EQ 3I4NG 1PH1A 3CQZH 4NXNQ 2CWAA 4LF6L 1EWIA 5FLMG 1W2BA 2L15A 1H95A 2B29A 3S1MH 4A76A 2I0QA 1Y1WH 1KL9A 1NE3A 1OXXK 1L1OA 4L5TA 3G4SA 3HOYH 4BY1H 2D0OA 1JB7A 4IFDI 1XPRA 5IYCH 4A3CH 2UXDL 1UWVA 4P72A 4HIOA 4YY3L 4LF8L 3GTOH 1PH8A 2KCMA 2F4VL 1K9MC 4X62L 4DV2Q 1E1TA 2JA7G 4X65Q 1Q46A 5FJ8G 2H5XA 4EQ5A 4LF6Q 1TXYA 5AJ3Q 3JAMc 2JA6H 3S17H 4A3LH 1I6HH 3CC7A 1I94L 3A5ZB 1TWCH 5C4XH 4JI5Q 4JI7L 2OCEA 1OXUA 1NMGA 1J5EL 4IFDJ 4JOIC 1VQ9A 1PV4A 1JT8A 4DR1Q 4UY8C 1CKMA 2LSSA 4KLKA 1IBLL 2K5VA 2F3IA 5M3FH 4IO9A 4DR7Q 3TRZA 4BY7G 1K8GA 4JC0A 3FHWA 3CCUA 2ID0A 1PH6A 2UXDQ 1Q82C 2HIXA 2MNAA 4QIWE 1SR3A 4YWKA 4JI5L 1E22A 4DAMA 3F2BA 1K73C 1I94Q 2HHHL 4BXXH 1IL2A 2BA0A 2IHFA 1KD1C 3H3VH 2E2JH 3F1ZA 4YCUA 2JK8A 4LW1A 3J81i 1JMCA 1E7ZA 5IYCG 1IBLQ 4MTNA 4IOCA 3RLOA 1YBYA 2R6GA 1YIJA 4HIDA 4DKAC 4K0KL 2IX0A 1S3OA 1IBKQ 1HZ9A 2WAQG 3CP0A 2AWOA 3S15H 1VQHA 4JI8L 4KHPL 3K80C 5GAHC 4UP8A 2WB1E 3PO2G 4DR7L 5IP7H 3A74A 2JA5G 1B70B 4OX9L 3S14H 2RHQB 2R93G 1WCMG 4JI0Q 3RR5A 3TQYA 1HNWQ 1EIYB 2E2IH 5M3MG 3ERSX 1N36Q 3PUZA 2LXKA 4DPGA 3PF5A 3S1NH 2JJQA 1XMQL 1Y1VG 1J6QA 3HKSA 1UE7A 3CW2C 3UDXA 1HR0L 4YWMA 1K0RA 3NELA 4PG3A 4DV3L 3I55A 4IPGA 1IBKL 3BZKA 4LF7L 3K0XA 1XNRL 2KHIA 3D31A 3PUXA 5HY6A 1YJWA 3HOUH 1HNWL 3CF5A 3I2ZA 3KDFA 3PV0A 4GN5A 4JI6Q 1TWFH 1M90C 2ALYB 3VDYA 1XMQQ 4GLAC 1S40A 1PH3A 2CCZA 2BA1A 1XTDA 4OX9Q 2VL6A 1FGUA 1Y1WG 3T1YQ 4X6AH 1UE1A 4DV3Q 1PHJA 1N36L 4DR6L 1VQAA 1MJCA 1YNXA 2VY3A 2VQFL 1VQKA 2PMZE 2NZHA 4UP9A 1SLJA 2JEBI 5E7NA 3CMAA 4JI6L 4QL5A 1X55A 1A0IA 2XGTA 4JG2A 4ME3A 5IY0A 2D62A 4A3IG 2ZJQA 1JE5A 2QA4A 4P74A 4HJ7A 4LF5Q 1D7QA 3PO3G 2ZM6Q 3UE0A 4BBSH 4LF7Q 2F52A 4GOPB 1XNRQ 3PUVA 2YTXA 4DUYL 1Z9FA 2K50A 1X56A 4TQUS 2VZAA 4C2MH 4JI7Q 3MEFA 3CCSA 4DV1L 4OWTB 2B3GA 5LMUL 1VQFA 1AH9A 1R9TH 1EQQA 2VNUD 4HJ9A 1TWGH 1HNXL 1N9WA 3GTQH 2NN6I 2WFWA 4R4CA 1EIFA 1QUQB 2NVTH 1EOVA 3CXCA 1I5FA 2MO1A 3L0OA 5M5XH 4DR6Q 3DM3A 1NJIC 3G71A 2R7FA 4JOIA 4H02A 4OWXB 3U4VA 3UDFA 4DUYQ 2Z6KA 4A3DH 1YI2A 4GKKL 2K5HA 3J80i 4DV1Q 1KQSA 2VUMG 1N8RC 1LTLA 1A8VA 2YV5A 1W3SA 1NBWA 4GOPC 4LF5L 1Q8KA 4DV5L 1DGSA 1RIPA 4A3JG 2AHOB 1VCIA 3RNUA 3OYYA 4O0AA 1VQIA 2N49A 3GTJH 3OW2A 4A3BH 1Y1VH 1VQ6A 1B8AA 3FKIG 1Q1EA 2DUDA 1IZ6A 5GAEC 4OO1G 4YY3Q 5C44G 4GKKQ 4KHZA 4JI8Q 1MKHA 1TWAH 4IJLA 2MO0A 3K7AH 2IY5B 1K3RA 4KI0A 4BBRH 5HGQA 1ASZA 3GDEA 4BA2I 3S16H 5AJ3L 3JC66 1BVSA 2MFIA 4YCVA 2NZOA 2ASBA 1P16A 4JI0L 4IJHA 3HOVG 3HOVH 2JQOA 3HOUG 5C44H 4O2DA 4DV0L 1N34Q 3GTKH 3H15A 3ULLA 3E9IA 4DV5Q 2ES2A 5JJIA 1YJ9A 4DR1L 1MJEA 3L2PA 1U0LA 3PUWA 2CWPA 2KBNA 1HR0Q 3HOZH 3KF8B 2Q2IA 3S24A 3PCOB 1U5KA 2WB1G 3TS2A 1PH2A 2Z0SA 2NVXH 4GNXA 3E9HA 1Z47A 3FP9A 4GNXB 3NBHB 3UDGA 1X3FA 5C3EG 3DLLA 2JA8G 1VQ8A 3GO5A 4DV4Q 4OONA 3CCMA 4DV0Q 3RN5A 2UUAL 1XNQL 3J81c 1N34L 4B3RL 5M5WH 1SROA 3FKIH 5GROA 2JA6G 3M9BA 3ZJYC 4AQYL 2Q2HA 1T9HA 4A3GH 5C4XG 1EQRA 4JBWA 3T1YL 4NB3A 2K4KA 1X6OA 3M4QA 1D8LA 1GKHA 4LUVA 1SMXA 2R7DA 3A5UA 5LMNW 4A3DG 2R7ZG 1C7YA 1C0AA 4LF4L 2JEAI 3G48A 1Q81C 4DV4L 1XNQQ 2UUAQ 1C9OA 3MXNB 2K52A 2JE6I 5C0XJ 4J15A 2OWOA 1PVOA 2UUBL 3I4NH 2V1CC 1VQ7A 3CCQA 4YHHQ 5FLMH 2A19A 2ATWA 4JBMA 3STBC 4JYAQ 1KIXA 5IYDH 4A3EG 1HNZQ 1NMFA 1HNXQ 3AQQA 2UXBQ 2E8GA 2A1AA 4QY7A 1SFOH 4L5RC 2QGQA 4LUOA 5DLQE 1L1OC 3G6EA 2ZTDA 2I5MX 4LF4Q 2I5HA 1MIUA 3W5OA 4YHHL 1VQLA 1WI5A 1UE6A 4R4TA 4JYAL 3PGZA 4WJ3M 1G51A 1IBML 4YCWA 1VQBA 3RZOH 4A3JH 2XTIA 2N78A 3OTOQ 1VQOA 2Q2TA 1X54A 3H3VI 5JJKA 1GD7A 1HH2P 2JA7H 1PA6A 4JI2Q 4DV6L 1FJGQ 2UXCL 1I50H 3M85A 3K8AA 1YVCA 3KDFB 2EIFA 2VQFQ 1O7IA 1EFWA 3CCVA 3ICEA 1Q12A 4IOAA 1VS0A 1HNZL 5J3BA 3HOYG 3UE1A 1BBUA 5M3MH 4R4IA 1YEZA 3I4OA 4YWLA 1L1OB 5BR8L 3S1RH 1PH9A 2E2HH 3AEVA 2ZM6L 2ZJPA 2UU9Q 1ASYA 5GAGC 4DV6Q 1XPOA 4JI2L 5M3FG 1WJJA 2OTJA 2UXCQ 1SRUA 5IP9H 2C35B 2IHEA 4JBJA 5LMUQ 4DK3C 1IBMQ 3T1HQ 2Y0SE 3OTOL 3WWVA 2Q2UA 4LF9L 1M1KC 3CPFA 4IPHA 1WOCA 2A8VA 2YTVA 4GN3B 1PH5A 2NVQH 5BR8Q 2WP8J 3HKZG 4AYBE 4HIKA 4A3LG 4A3EH 3AFPA 4WJ4A 4R1JA 4JI1L 3J81j 5IP7G 1Y14B 2OQ0A 2E5LQ 2VS1A 1A63A 1CSPA 3EIVA 5FJ8H 5GADC 1QVGA 4JBKA 2B63G 4GLXA 3KFUA 2AMCB 4B3RQ 1QUQA 4P71A 1OXTA 2QEXA 3RZDH 1E24A 3EBEA 2VQEL 2KENA 2UU9L 1LM0A 2K14A 1WYDA 4DR4Q 2PNHA 4B3ML 5FLXc 1N32Q 4BXXG 3PUYA 2ZTCA 2UUCQ 4LWCA 4LF9Q 4XIGS 2OTLA 1JJGA 4A3BG 4GNXC 1XMOL 3H0GG 4A3FH 3A0JA 4QQBX 4OO1I 3KF6B 2R93H 5ELOA 1HZBA 4NPSA 3KF6A 4PZ6A 2JA5H 1VQPA 4HIMA 1EYGA 3GTLH 5EAYA 4P75A 3STBD 4A3KH 1BKBA 1N33L 4B3MQ 1N32L 4DR5L 1TWHH 2ZTEA 4QGUA 3S1QH 4JI4Q 1WCMH 3M7NA 3I4MH 4LFCQ 1LUZA 4MNOA 3J7ZC 3HFZB 2VQEQ 1FVIA 1HJPA 1KHIA 2HQLA 2HIVA 2GVBA 2PI2A 2VW9A 4DR3Q 2RHSB 1X9NA 1X3EA 4Y7NH 4B3TL 2JA9A 5JEAG 3I56A 4P73A 4OXPA 3U58A 2UUCL 2MQHA 3F2DA 2NN6G 5C0XI 3KYHC 1YJNA 4C3IH 1QVFA 3F2CA 2RCNA 1XMOQ 4IPDA 4JI4L 4TVAB 4BA1I 4X64Q 1IYJB 1XJVA 2CFMA 1X3GA 3TREA 1YHAA 4AQYQ 1P8LA 4A3CG 3CD6A 3HOWG 1VQEA 1N33Q 1HZCA 2Z6KC 4RG1A 4A3IH 2KHJA 2HT1A 1PFSA 4B3TQ 3M4OH 4IFDG 4HJ8A 2K75A 4LNQA 1NTGA 2BH8A 5ELNA 3CCEA 4LFCL 1UEBA 2K5NA 5C0XG 3KLWA 3HOXG 4GKJQ 3L7ZC 1EUJA 2UUBQ 1Q7YC 3CC4A 4NXMQ 3KJOA 3JAMi 3ER0A 2GVAA 2R7ZH 4POFA 4PZ8A 4NXNL 5IE8A 4JI3L 3ULPA 3T1HL 1A62A 2I5LX 2LXJA 3W1BA 4GOPA 4A3GG 2UXBL 1YHQA 2YU9H 4R4QA 1K83H 4A93H 1L2FA 3HOXH 1I3QH 1LYLA 1AE2A 2PQAB 3B6YA 4EX5A 3CCJA 5C3EH 4A75A 4B3SL 4BY1G 1VQGA 3HOWH 4JCVE 1V43A 3UDIA 4A3KG 1GM5A 4PZ7A 4LFBL 4JI3Q 1V9PA 3PIPA 3NENA 3PIOA 3LGJA 1G291 3U50C 2EQSA 4BBSG 4DK6C 1VQDA 3NEMA 1XPUA 4NXML 4OWWB 2Y0SG 5K36G 3PO2H 4DR4L 5LMNL 3CPWA 1FJGL 5JEAJ 3AYHB 1HR0W 1V1QA 1B7YB 3HKZE 4A3MG 4B3SQ 4GN4B 4AIMA 2ZJRA 3RLFA 3RLNA 1QZGA 3S2DH 4A93G 1QVCA 3AFQA 4LFBQ 1Q86C 2DGYA 4BBRG 1CKOA 4HJ5A 1KRSA 1PH4A 1Q1BA 2N3SA 3PF4A 4IPCA 5C4JH 5IWAL 1IXRA 4RMFA 3S2HH 4GLVB 2PI2E 1HZAA 4AYBG 1PYBA 1WFQA 5IYBH 3CAMA 2R92H 5JJLA 4R4OA 3M3YH 4Y52H 3U4ZA 3GTPH 5LMNQ 1VQ5A 3I4MG 4DR3L 3H0GH 4A3FG 1YHBA 3ULJA 4JV5Q 4X62Q 4DV2L 5IP9G 3KJPA 4JI1Q 4DUZQ 4X65L 2FXQA 2E5LL 3GTMH 1L0WA 3KOJA 1KAWA 2N8NA 4LFAQ 1SN8A 5IYBG 2IX1A 3HOZG 4X64L 2YYZA 4DR2Q 5IWAQ 2R92G 4L5SA 5H1SE 4JV5L 2B63H 4DUZL 1KRTA 1KC8C 3GTGH 3I7FA 2WAQE 1VQ4A 3D0FA 3W1GA 1S72A 1CSQA 3PO3H 3E0EA 2BH2A 4X66Q 4A3MH 1E1OA 3BJUA 2HHHQ 4GKJL 3TS0A 1YITA 2AKWB 4QJFA 3GD7A 4DV7Q 2KCTA 3PSIA 4DR5Q 4FDBA 3CMEA 1GVPA 3F8TA 5GQOA 4L5QA 4PMWA 4LFAL 3CC2A 2D0PA 3M4PA 1VQJA 4UPAA 4K0KQ 1K8AC 1G6PA 1NY4A 3J7A5 1OXSC 4BY7H 1X65A 4UP7A 4DR2L 1JJ2A 3TEHB 2AWNA 4X66L 4HJAA 4ALPA 2VUMH 4KHPQ 2PQAA 4LUZA 3EN2A 1KXLA 1BBWA 5M5YH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q8D A;  1OTC A;  1SE8 A;  4GS3 A;  5IT9 c;  2EXD A;  3J80 c;  4APV A;  1VQN A;  2OQK A;  4DV7 L;  3SGI A;  1PYS B;  1QZH A;  1AE3 A;  2CQO A;  4C3H H;  3CCR A;  2IT1 A;  1E3P A;  4A4I A;  2CKZ B;  1PH7 A;  1RL2 A;  1YZ6 A;  3BU2 A;  1OXV A;  2YTY A;  1CKN A;  4MZ9 A;  4AH6 A;  4XTC S;  4DNI A;  1CKN B;  2NVY H;  1FL0 A;  3K81 C;  1UE5 A;  1JJC B;  2GN5 A;  2RF4 A;  5IYD G;  4C3J H;  3CCL A;  1CUK A;  3BZC A;  3K7U C;  4LF8 Q;  4POG A;  2F4V Q;  1GO3 E;  4DAY B;  3RN2 A;  3IRB A;  1VQM A;  2JA8 H;  1VQC A;  1J5E Q;  3I4N G;  1PH1 A;  3CQZ H;  4NXN Q;  2CWA A;  4LF6 L;  1EWI A;  5FLM G;  1W2B A;  2L15 A;  1H95 A;  2B29 A;  3S1M H;  4A76 A;  2I0Q A;  1Y1W H;  1KL9 A;  1NE3 A;  1OXX K;  1L1O A;  4L5T A;  3G4S A;  3HOY H;  4BY1 H;  2D0O A;  1JB7 A;  4IFD I;  1XPR A;  5IYC H;  4A3C H;  2UXD L;  1UWV A;  4P72 A;  4HIO A;  4YY3 L;  4LF8 L;  3GTO H;  1PH8 A;  2KCM A;  2F4V L;  1K9M C;  4X62 L;  4DV2 Q;  1E1T A;  2JA7 G;  4X65 Q;  1Q46 A;  5FJ8 G;  2H5X A;  4EQ5 A;  4LF6 Q;  1TXY A;  5AJ3 Q;  3JAM c;  2JA6 H;  3S17 H;  4A3L H;  1I6H H;  3CC7 A;  1I94 L;  3A5Z B;  1TWC H;  5C4X H;  4JI5 Q;  4JI7 L;  2OCE A;  1OXU A;  1NMG A;  1J5E L;  4IFD J;  4JOI C;  1VQ9 A;  1PV4 A;  1JT8 A;  4DR1 Q;  4UY8 C;  1CKM A;  2LSS A;  4KLK A;  1IBL L;  2K5V A;  2F3I A;  5M3F H;  4IO9 A;  4DR7 Q;  3TRZ A;  4BY7 G;  1K8G A;  4JC0 A;  3FHW A;  3CCU A;  2ID0 A;  1PH6 A;  2UXD Q;  1Q82 C;  2HIX A;  2MNA A;  4QIW E;  1SR3 A;  4YWK A;  4JI5 L;  1E22 A;  4DAM A;  3F2B A;  1K73 C;  1I94 Q;  2HHH L;  4BXX H;  1IL2 A;  2BA0 A;  2IHF A;  1KD1 C;  3H3V H;  2E2J H;  3F1Z A;  4YCU A;  2JK8 A;  4LW1 A;  3J81 i;  1JMC A;  1E7Z A;  5IYC G;  1IBL Q;  4MTN A;  4IOC A;  3RLO A;  1YBY A;  2R6G A;  1YIJ A;  4HID A;  4DKA C;  4K0K L;  2IX0 A;  1S3O A;  1IBK Q;  1HZ9 A;  2WAQ G;  3CP0 A;  2AWO A;  3S15 H;  1VQH A;  4JI8 L;  4KHP L;  3K80 C;  5GAH C;  4UP8 A;  2WB1 E;  3PO2 G;  4DR7 L;  5IP7 H;  3A74 A;  2JA5 G;  1B70 B;  4OX9 L;  3S14 H;  2RHQ B;  2R93 G;  1WCM G;  4JI0 Q;  3RR5 A;  3TQY A;  1HNW Q;  1EIY B;  2E2I H;  5M3M G;  3ERS X;  1N36 Q;  3PUZ A;  2LXK A;  4DPG A;  3PF5 A;  3S1N H;  2JJQ A;  1XMQ L;  1Y1V G;  1J6Q A;  3HKS A;  1UE7 A;  3CW2 C;  3UDX A;  1HR0 L;  4YWM A;  1K0R A;  3NEL A;  4PG3 A;  4DV3 L;  3I55 A;  4IPG A;  1IBK L;  3BZK A;  4LF7 L;  3K0X A;  1XNR L;  2KHI A;  3D31 A;  3PUX A;  5HY6 A;  1YJW A;  3HOU H;  1HNW L;  3CF5 A;  3I2Z A;  3KDF A;  3PV0 A;  4GN5 A;  4JI6 Q;  1TWF H;  1M90 C;  2ALY B;  3VDY A;  1XMQ Q;  4GLA C;  1S40 A;  1PH3 A;  2CCZ A;  2BA1 A;  1XTD A;  4OX9 Q;  2VL6 A;  1FGU A;  1Y1W G;  3T1Y Q;  4X6A H;  1UE1 A;  4DV3 Q;  1PHJ A;  1N36 L;  4DR6 L;  1VQA A;  1MJC A;  1YNX A;  2VY3 A;  2VQF L;  1VQK A;  2PMZ E;  2NZH A;  4UP9 A;  1SLJ A;  2JEB I;  5E7N A;  3CMA A;  4JI6 L;  4QL5 A;  1X55 A;  1A0I A;  2XGT A;  4JG2 A;  4ME3 A;  5IY0 A;  2D62 A;  4A3I G;  2ZJQ A;  1JE5 A;  2QA4 A;  4P74 A;  4HJ7 A;  4LF5 Q;  1D7Q A;  3PO3 G;  2ZM6 Q;  3UE0 A;  4BBS H;  4LF7 Q;  2F52 A;  4GOP B;  1XNR Q;  3PUV A;  2YTX A;  4DUY L;  1Z9F A;  2K50 A;  1X56 A;  4TQU S;  2VZA A;  4C2M H;  4JI7 Q;  3MEF A;  3CCS A;  4DV1 L;  4OWT B;  2B3G A;  5LMU L;  1VQF A;  1AH9 A;  1R9T H;  1EQQ A;  2VNU D;  4HJ9 A;  1TWG H;  1HNX L;  1N9W A;  3GTQ H;  2NN6 I;  2WFW A;  4R4C A;  1EIF A;  1QUQ B;  2NVT H;  1EOV A;  3CXC A;  1I5F A;  2MO1 A;  3L0O A;  5M5X H;  4DR6 Q;  3DM3 A;  1NJI C;  3G71 A;  2R7F A;  4JOI A;  4H02 A;  4OWX B;  3U4V A;  3UDF A;  4DUY Q;  2Z6K A;  4A3D H;  1YI2 A;  4GKK L;  2K5H A;  3J80 i;  4DV1 Q;  1KQS A;  2VUM G;  1N8R C;  1LTL A;  1A8V A;  2YV5 A;  1W3S A;  1NBW A;  4GOP C;  4LF5 L;  1Q8K A;  4DV5 L;  1DGS A;  1RIP A;  4A3J G;  2AHO B;  1VCI A;  3RNU A;  3OYY A;  4O0A A;  1VQI A;  2N49 A;  3GTJ H;  3OW2 A;  4A3B H;  1Y1V H;  1VQ6 A;  1B8A A;  3FKI G;  1Q1E A;  2DUD A;  1IZ6 A;  5GAE C;  4OO1 G;  4YY3 Q;  5C44 G;  4GKK Q;  4KHZ A;  4JI8 Q;  1MKH A;  1TWA H;  4IJL A;  2MO0 A;  3K7A H;  2IY5 B;  1K3R A;  4KI0 A;  4BBR H;  5HGQ A;  1ASZ A;  3GDE A;  4BA2 I;  3S16 H;  5AJ3 L;  3JC6 6;  1BVS A;  2MFI A;  4YCV A;  2NZO A;  2ASB A;  1P16 A;  4JI0 L;  4IJH A;  3HOV G;  3HOV H;  2JQO A;  3HOU G;  5C44 H;  4O2D A;  4DV0 L;  1N34 Q;  3GTK H;  3H15 A;  3ULL A;  3E9I A;  4DV5 Q;  2ES2 A;  5JJI A;  1YJ9 A;  4DR1 L;  1MJE A;  3L2P A;  1U0L A;  3PUW A;  2CWP A;  2KBN A;  1HR0 Q;  3HOZ H;  3KF8 B;  2Q2I A;  3S24 A;  3PCO B;  1U5K A;  2WB1 G;  3TS2 A;  1PH2 A;  2Z0S A;  2NVX H;  4GNX A;  3E9H A;  1Z47 A;  3FP9 A;  4GNX B;  3NBH B;  3UDG A;  1X3F A;  5C3E G;  3DLL A;  2JA8 G;  1VQ8 A;  3GO5 A;  4DV4 Q;  4OON A;  3CCM A;  4DV0 Q;  3RN5 A;  2UUA L;  1XNQ L;  3J81 c;  1N34 L;  4B3R L;  5M5W H;  1SRO A;  3FKI H;  5GRO A;  2JA6 G;  3M9B A;  3ZJY C;  4AQY L;  2Q2H A;  1T9H A;  4A3G H;  5C4X G;  1EQR A;  4JBW A;  3T1Y L;  4NB3 A;  2K4K A;  1X6O A;  3M4Q A;  1D8L A;  1GKH A;  4LUV A;  1SMX A;  2R7D A;  3A5U A;  5LMN W;  4A3D G;  2R7Z G;  1C7Y A;  1C0A A;  4LF4 L;  2JEA I;  3G48 A;  1Q81 C;  4DV4 L;  1XNQ Q;  2UUA Q;  1C9O A;  3MXN B;  2K52 A;  2JE6 I;  5C0X J;  4J15 A;  2OWO A;  1PVO A;  2UUB L;  3I4N H;  2V1C C;  1VQ7 A;  3CCQ A;  4YHH Q;  5FLM H;  2A19 A;  2ATW A;  4JBM A;  3STB C;  4JYA Q;  1KIX A;  5IYD H;  4A3E G;  1HNZ Q;  1NMF A;  1HNX Q;  3AQQ A;  2UXB Q;  2E8G A;  2A1A A;  4QY7 A;  1SFO H;  4L5R C;  2QGQ A;  4LUO A;  5DLQ E;  1L1O C;  3G6E A;  2ZTD A;  2I5M X;  4LF4 Q;  2I5H A;  1MIU A;  3W5O A;  4YHH L;  1VQL A;  1WI5 A;  1UE6 A;  4R4T A;  4JYA L;  3PGZ A;  4WJ3 M;  1G51 A;  1IBM L;  4YCW A;  1VQB A;  3RZO H;  4A3J H;  2XTI A;  2N78 A;  3OTO Q;  1VQO A;  2Q2T A;  1X54 A;  3H3V I;  5JJK A;  1GD7 A;  1HH2 P;  2JA7 H;  1PA6 A;  4JI2 Q;  4DV6 L;  1FJG Q;  2UXC L;  1I50 H;  3M85 A;  3K8A A;  1YVC A;  3KDF B;  2EIF A;  2VQF Q;  1O7I A;  1EFW A;  3CCV A;  3ICE A;  1Q12 A;  4IOA A;  1VS0 A;  1HNZ L;  5J3B A;  3HOY G;  3UE1 A;  1BBU A;  5M3M H;  4R4I A;  1YEZ A;  3I4O A;  4YWL A;  1L1O B;  5BR8 L;  3S1R H;  1PH9 A;  2E2H H;  3AEV A;  2ZM6 L;  2ZJP A;  2UU9 Q;  1ASY A;  5GAG C;  4DV6 Q;  1XPO A;  4JI2 L;  5M3F G;  1WJJ A;  2OTJ A;  2UXC Q;  1SRU A;  5IP9 H;  2C35 B;  2IHE A;  4JBJ A;  5LMU Q;  4DK3 C;  1IBM Q;  3T1H Q;  2Y0S E;  3OTO L;  3WWV A;  2Q2U A;  4LF9 L;  1M1K C;  3CPF A;  4IPH A;  1WOC A;  2A8V A;  2YTV A;  4GN3 B;  1PH5 A;  2NVQ H;  5BR8 Q;  2WP8 J;  3HKZ G;  4AYB E;  4HIK A;  4A3L G;  4A3E H;  3AFP A;  4WJ4 A;  4R1J A;  4JI1 L;  3J81 j;  5IP7 G;  1Y14 B;  2OQ0 A;  2E5L Q;  2VS1 A;  1A63 A;  1CSP A;  3EIV A;  5FJ8 H;  5GAD C;  1QVG A;  4JBK A;  2B63 G;  4GLX A;  3KFU A;  2AMC B;  4B3R Q;  1QUQ A;  4P71 A;  1OXT A;  2QEX A;  3RZD H;  1E24 A;  3EBE A;  2VQE L;  2KEN A;  2UU9 L;  1LM0 A;  2K14 A;  1WYD A;  4DR4 Q;  2PNH A;  4B3M L;  5FLX c;  1N32 Q;  4BXX G;  3PUY A;  2ZTC A;  2UUC Q;  4LWC A;  4LF9 Q;  4XIG S;  2OTL A;  1JJG A;  4A3B G;  4GNX C;  1XMO L;  3H0G G;  4A3F H;  3A0J A;  4QQB X;  4OO1 I;  3KF6 B;  2R93 H;  5ELO A;  1HZB A;  4NPS A;  3KF6 A;  4PZ6 A;  2JA5 H;  1VQP A;  4HIM A;  1EYG A;  3GTL H;  5EAY A;  4P75 A;  3STB D;  4A3K H;  1BKB A;  1N33 L;  4B3M Q;  1N32 L;  4DR5 L;  1TWH H;  2ZTE A;  4QGU A;  3S1Q H;  4JI4 Q;  1WCM H;  3M7N A;  3I4M H;  4LFC Q;  1LUZ A;  4MNO A;  3J7Z C;  3HFZ B;  2VQE Q;  1FVI A;  1HJP A;  1KHI A;  2HQL A;  2HIV A;  2GVB A;  2PI2 A;  2VW9 A;  4DR3 Q;  2RHS B;  1X9N A;  1X3E A;  4Y7N H;  4B3T L;  2JA9 A;  5JEA G;  3I56 A;  4P73 A;  4OXP A;  3U58 A;  2UUC L;  2MQH A;  3F2D A;  2NN6 G;  5C0X I;  3KYH C;  1YJN A;  4C3I H;  1QVF A;  3F2C A;  2RCN A;  1XMO Q;  4IPD A;  4JI4 L;  4TVA B;  4BA1 I;  4X64 Q;  1IYJ B;  1XJV A;  2CFM A;  1X3G A;  3TRE A;  1YHA A;  4AQY Q;  1P8L A;  4A3C G;  3CD6 A;  3HOW G;  1VQE A;  1N33 Q;  1HZC A;  2Z6K C;  4RG1 A;  4A3I H;  2KHJ A;  2HT1 A;  1PFS A;  4B3T Q;  3M4O H;  4IFD G;  4HJ8 A;  2K75 A;  4LNQ A;  1NTG A;  2BH8 A;  5ELN A;  3CCE A;  4LFC L;  1UEB A;  2K5N A;  5C0X G;  3KLW A;  3HOX G;  4GKJ Q;  3L7Z C;  1EUJ A;  2UUB Q;  1Q7Y C;  3CC4 A;  4NXM Q;  3KJO A;  3JAM i;  3ER0 A;  2GVA A;  2R7Z H;  4POF A;  4PZ8 A;  4NXN L;  5IE8 A;  4JI3 L;  3ULP A;  3T1H L;  1A62 A;  2I5L X;  2LXJ A;  3W1B A;  4GOP A;  4A3G G;  2UXB L;  1YHQ A;  2YU9 H;  4R4Q A;  1K83 H;  4A93 H;  1L2F A;  3HOX H;  1I3Q H;  1LYL A;  1AE2 A;  2PQA B;  3B6Y A;  4EX5 A;  3CCJ A;  5C3E H;  4A75 A;  4B3S L;  4BY1 G;  1VQG A;  3HOW H;  4JCV E;  1V43 A;  3UDI A;  4A3K G;  1GM5 A;  4PZ7 A;  4LFB L;  4JI3 Q;  1V9P A;  3PIP A;  3NEN A;  3PIO A;  3LGJ A;  1G29 1;  3U50 C;  2EQS A;  4BBS G;  4DK6 C;  1VQD A;  3NEM A;  1XPU A;  4NXM L;  4OWW B;  2Y0S G;  5K36 G;  3PO2 H;  4DR4 L;  5LMN L;  3CPW A;  1FJG L;  5JEA J;  3AYH B;  1HR0 W;  1V1Q A;  1B7Y B;  3HKZ E;  4A3M G;  4B3S Q;  4GN4 B;  4AIM A;  2ZJR A;  3RLF A;  3RLN A;  1QZG A;  3S2D H;  4A93 G;  1QVC A;  3AFQ A;  4LFB Q;  1Q86 C;  2DGY A;  4BBR G;  1CKO A;  4HJ5 A;  1KRS A;  1PH4 A;  1Q1B A;  2N3S A;  3PF4 A;  4IPC A;  5C4J H;  5IWA L;  1IXR A;  4RMF A;  3S2H H;  4GLV B;  2PI2 E;  1HZA A;  4AYB G;  1PYB A;  1WFQ A;  5IYB H;  3CAM A;  2R92 H;  5JJL A;  4R4O A;  3M3Y H;  4Y52 H;  3U4Z A;  3GTP H;  5LMN Q;  1VQ5 A;  3I4M G;  4DR3 L;  3H0G H;  4A3F G;  1YHB A;  3ULJ A;  4JV5 Q;  4X62 Q;  4DV2 L;  5IP9 G;  3KJP A;  4JI1 Q;  4DUZ Q;  4X65 L;  2FXQ A;  2E5L L;  3GTM H;  1L0W A;  3KOJ A;  1KAW A;  2N8N A;  4LFA Q;  1SN8 A;  5IYB G;  2IX1 A;  3HOZ G;  4X64 L;  2YYZ A;  4DR2 Q;  5IWA Q;  2R92 G;  4L5S A;  5H1S E;  4JV5 L;  2B63 H;  4DUZ L;  1KRT A;  1KC8 C;  3GTG H;  3I7F A;  2WAQ E;  1VQ4 A;  3D0F A;  3W1G A;  1S72 A;  1CSQ A;  3PO3 H;  3E0E A;  2BH2 A;  4X66 Q;  4A3M H;  1E1O A;  3BJU A;  2HHH Q;  4GKJ L;  3TS0 A;  1YIT A;  2AKW B;  4QJF A;  3GD7 A;  4DV7 Q;  2KCT A;  3PSI A;  4DR5 Q;  4FDB A;  3CME A;  1GVP A;  3F8T A;  5GQO A;  4L5Q A;  4PMW A;  4LFA L;  3CC2 A;  2D0P A;  3M4P A;  1VQJ A;  4UPA A;  4K0K Q;  1K8A C;  1G6P A;  1NY4 A;  3J7A 5;  1OXS C;  4BY7 H;  1X65 A;  4UP7 A;  4DR2 L;  1JJ2 A;  3TEH B;  2AWN A;  4X66 L;  4HJA A;  4ALP A;  2VUM H;  4KHP Q;  2PQA A;  4LUZ A;  3EN2 A;  1KXL A;  1BBW A;  5M5Y H; 
#chains in the Genus database with same CATH topology
 1TWH B;  2O2L D;  3OHX C;  3Q8D A;  5A2Q L;  1SE8 A;  5IT9 c;  4APV A;  2K05 A;  1R4P B;  3JAM E;  2PPB C;  2LKV A;  2KJX A;  3MC0 B;  3P1H A;  1AE3 A;  1LT5 D;  5FOB B;  3OW7 A;  3CCR A;  1B4O A;  3BU2 A;  4DNI A;  3TP6 A;  2GN5 A;  5IYD G;  2SOB A;  1Y1W B;  3OMG A;  4UAI A;  1GO3 E;  3VYU A;  4CKE A;  4YIJ A;  3RN2 A;  5CBE E;  2F4V Q;  2EZV A;  1PH1 A;  5KEE A;  1K28 A;  1DOK A;  2CWA A;  4KHV A;  4DN4 M;  1EWI A;  2L15 A;  1HXY D;  1OXX K;  4L5T A;  3G4S A;  3HOY H;  1EIH A;  2B2Y A;  1XPR A;  4HAE A;  2NVY B;  4P72 A;  1II3 A;  5J1Z A;  3DHQ A;  4YY3 L;  4HIO A;  1PH8 A;  3K5N A;  3E0J A;  3J80 L;  4X65 Q;  2F0W A;  2EE1 A;  4C1N K;  4HSV A;  2XRS D;  3S9W A;  4LF6 Q;  4BWG B;  3JAM c;  2ZXP A;  3A5Z B;  3QIA A;  2OCE A;  4G57 A;  1GUG A;  1TQO A;  4KTA A;  3QOJ A;  3MXU A;  1IBL L;  2O5J C;  1TS5 A;  4ULL A;  4IO9 A;  4DR7 Q;  5EBC A;  2EY5 A;  1LLR D;  4XYQ A;  1BUV T;  2B2V C;  1Q82 C;  4IUU A;  3H0G B;  4PV1 C;  2E2J H;  1H9J A;  3F1Z A;  4DXG A;  4LW1 A;  3J81 i;  1E7Z A;  5CR3 A;  2F1M A;  4K8I A;  4DKA C;  5CV6 A;  3K57 A;  1SND A;  1PRT D;  4RCO A;  2MP1 A;  3K80 C;  3PO2 G;  2D5D A;  4DR7 L;  1A3U A;  2FMM A;  4OX9 L;  1Z7T A;  1UUP A;  3TQY A;  2E2I H;  1JOQ A;  2MJ8 A;  3GP7 A;  5J22 A;  2EVB A;  1QIL A;  3BDC A;  1KNE A;  2GA4 B;  2RQX A;  4Z9C B;  1J6Q A;  1F9Q A;  1HR0 L;  4K5X A;  3TDQ A;  4BY1 B;  3BZK A;  5BN4 A;  3D31 A;  3HOU H;  2F0M A;  4KY6 A;  1SE4 A;  1TWF H;  1M90 C;  2ALY B;  3VDY A;  2CCZ A;  1UNS A;  2EJF C;  1XTD A;  4FO2 A;  3WOF A;  5D3D A;  2AQ2 B;  4XXE A;  3MHB A;  4HMI A;  2D2C C;  3SK6 A;  1SYC A;  5BN5 A;  2VQF L;  2JEB I;  5E7N A;  3CMA A;  5J39 A;  2MUY A;  3GTM H;  2D62 A;  1STG A;  5C44 B;  4HJ7 A;  4LF5 Q;  1ENA A;  1SYE A;  2ZM6 Q;  5EKK A;  4KK7 A;  1Z9F A;  2K50 A;  3VA7 A;  2F0J A;  2VZA A;  1FR3 A;  1KAA A;  4BBR B;  1QCB D;  4OWT B;  1VF7 A;  2NWG A;  1AH9 A;  3HOW B;  3LNN A;  2F03 A;  1TWG H;  4UHV A;  1EIF A;  2NVT H;  3CXC A;  1EY9 A;  2MO1 A;  2EYJ A;  2IW3 A;  3L0O A;  2HD3 A;  2R7F A;  4OWX B;  4DK1 A;  4FP5 D;  1YI2 A;  4RH6 A;  4GKK L;  3J80 i;  1KQS A;  1LTL A;  3DUZ A;  2L4N A;  2R61 A;  3AU7 A;  2AHO B;  2EYP A;  1G2S A;  3QB3 A;  5FLX E;  4A3M B;  4O0A A;  2A6H C;  1PZK D;  4GZY C;  4OHJ A;  5GAE C;  4TRD A;  1TWG B;  4KHZ A;  4JI8 Q;  1TWA H;  3X3M A;  3K7A H;  2IY5 B;  2PW5 A;  4KI0 A;  1JOO A;  4FF4 A;  1BVS A;  1I4G A;  2NZO A;  1HFG A;  2ASB A;  3I73 A;  4S3S A;  3HOU G;  4DV0 L;  2F0D A;  3OIQ A;  3GTK H;  4DV5 Q;  1SYB A;  1BCP C;  3L2P A;  2KBN A;  2K33 A;  2PYK A;  1FNW A;  1TWF B;  1GXD C;  1PH2 A;  3E9H A;  3UDG A;  2A68 D;  4GNX B;  4EGV A;  1STY A;  5E4W C;  1HUN A;  3CCM A;  5D65 A;  3Q6S A;  4DV0 Q;  2D9U A;  3RN5 A;  1EY0 A;  1PZI D;  3FKI H;  1STA A;  2JA6 G;  4DF7 A;  3NQI A;  4A3G H;  1ENC A;  3M4Q A;  3A5U A;  1ZKO A;  1TR5 A;  2F0E A;  3P75 A;  3SVM A;  2JEA I;  3G48 A;  1Q81 C;  1XNQ Q;  3MXN B;  4KKT A;  4J15 A;  1LT4 D;  3I4N H;  1EY4 A;  3C2P A;  4QCL A;  2A73 B;  1YNJ C;  4A3B B;  4JYA Q;  5IYD H;  4A3E G;  3C46 A;  1I4P A;  1PTO B;  1NR4 A;  3C3L A;  1ZEQ X;  4L5R C;  3G6E A;  2Z4H A;  1L1O C;  2PNR C;  1CHP D;  4KY7 A;  2ZTD A;  3TME A;  1H9S B;  2I5H A;  3W5O A;  3JAM L;  1VQL A;  5ELE A;  2MPM A;  4R4T A;  1X3Q A;  4JYA L;  4WJ3 M;  1G51 A;  3BZD B;  5EPL A;  2XTI A;  1JWU D;  1SAP A;  2F0K A;  1YVC A;  3KDF B;  4TKO B;  1EWC A;  4IOA A;  3CCV A;  3ICE A;  1BOS A;  2EYF A;  2FFK B;  2XN9 C;  5A2Q E;  1AZQ A;  3UE1 A;  1BBU A;  1HNZ L;  3HS0 C;  4KJN A;  4YWL A;  3AEV A;  2ZM6 L;  2EYL A;  1CZG A;  2FJ2 A;  2ZJP A;  1DD2 A;  2F0N A;  4I65 A;  2OTJ A;  1TT2 A;  4RHR A;  1GJX A;  2B2U C;  4LF9 L;  3TP7 A;  1FD7 D;  1WOC A;  1PH5 A;  4GN3 B;  2NVQ H;  5BR8 Q;  3HKZ G;  2OT2 A;  1SFO B;  3AFP A;  3J81 j;  2E5L Q;  2RSO A;  2OQ0 A;  5IT9 L;  1V1P B;  1CSP A;  3EIV A;  1C4Q A;  3NBH A;  2I46 A;  3OPO A;  4P71 A;  1F2Z A;  2C5C A;  2PO4 A;  1E24 A;  2K5D A;  3EBE A;  4X3K A;  1N32 Q;  1YNN C;  1GOZ A;  3CRL C;  4BXX G;  2CVR A;  1PFN A;  2B8F A;  1FYC A;  2VB2 X;  1XMO L;  3H0G G;  4CJ1 B;  4QQB X;  4OO1 I;  2CH4 A;  3BVM A;  4HIM A;  1A3T A;  1CFM A;  3RMH A;  1BKB A;  1N33 L;  4IN3 A;  1TWH H;  4QGU A;  1DYQ A;  5ELB A;  4JI4 Q;  3M7N A;  1TY2 A;  2PCF B;  5C6A A;  2GVB A;  1EFI D;  3QR8 A;  2NVQ B;  2LY7 A;  2RHS B;  1SJE D;  4Y7N H;  2JA9 A;  3IL8 A;  4P73 A;  2UUC L;  1ILQ A;  4MHE A;  2NN6 G;  2RDG A;  2WIN B;  4IPD A;  4TVA B;  1IYJ B;  4N9P A;  1EY6 A;  4J1M A;  1P8L A;  2SDF A;  1VQE A;  1EYC A;  2KHJ A;  3Q23 A;  1BNZ A;  4B3T Q;  1XWE A;  3M4O H;  4IFD G;  4HJ8 A;  1SXT A;  4LNQ A;  2BH8 A;  5ELN A;  5LL6 S;  4LFC L;  1LT3 D;  2ENB A;  4ZK9 B;  2XWJ B;  3HOX G;  4JPB W;  1EUJ A;  4FF1 A;  5FO8 B;  3QO2 A;  3CC4 A;  3JAM i;  1E2Z A;  5FO7 B;  4AYB B;  5IE8 A;  3KLS A;  3T1H L;  2I5L X;  4GOP A;  3ITP A;  1L2F A;  3EVQ A;  1BR9 A;  1EOT A;  3I4M B;  3I72 A;  4ZKB B;  1VQG A;  2J7Z A;  3PIP A;  2CHB D;  3CU7 A;  3U50 C;  3AMU A;  4NXM L;  4OWW B;  2A5H A;  4BBS B;  3VR5 A;  3AYH B;  1HR0 W;  2Q8I B;  3HKZ E;  5JPM C;  2QKI C;  4B3S Q;  5C5M A;  1I4H A;  1Q86 C;  1SEB D;  4HJ5 A;  3DEP A;  3DXJ C;  1KRS A;  1PH4 A;  1Q1B A;  3RZD B;  4IPC A;  2EY6 A;  3HEJ A;  4NMZ A;  1IXR A;  1Y8P B;  3K5L A;  2YU9 B;  4GLV B;  2PI2 E;  1SYD A;  3CAM A;  3H6M A;  3I4M G;  2LFN A;  5CBA E;  1S4Z A;  3H0G H;  1YHB A;  3ULJ A;  2XWB B;  1JB3 A;  2M9V A;  2A6H D;  3K6O A;  1S5D D;  1KDA A;  4ZQ3 A;  3KOJ A;  2BE5 D;  2KOL A;  3SDZ A;  1PRT C;  1HA5 A;  2FMC A;  5IWA Q;  4WFN 3;  4JV5 L;  1SE3 A;  5HGT A;  1KRT A;  1XYI A;  3I7F A;  3MVV A;  1ICF B;  3D0F A;  3W1G A;  1S72 A;  3NWS A;  3PO3 H;  1DOM A;  3E0E A;  4A3M H;  4GKJ L;  4BS9 A;  1YIT A;  4A3J B;  4OGQ C;  3RZO B;  3MA2 B;  3PSI A;  4FDB A;  3F8T A;  5GQO A;  4LFA L;  4PMW A;  2G9D A;  2JSO A;  1K8O A;  4Y7N B;  1K8A C;  3J7A 5;  4UP7 A;  2IX3 A;  1JJ2 A;  4X66 L;  4KHP Q;  2PQA A;  2FHT A;  4RGT A;  4LUZ A;  3C1F A;  2JA5 B;  5M5Y H;  2F0O A;  1OTC A;  4GS3 A;  3J80 c;  4K14 A;  1A3V A;  4DV7 L;  1SBB B;  3SGI A;  5G3L D;  3PIP 3;  1QZH A;  5CMD A;  2IT1 A;  3NWT A;  4HCS A;  3QJY A;  1MSH A;  1RL2 A;  4AH6 A;  1CKN B;  5FK9 C;  1BF4 A;  1SNQ A;  1CUK A;  3BZC A;  1WTQ A;  4LF8 Q;  4POG A;  5HUR A;  4DAY B;  1VQM A;  3IRB A;  1SYF A;  2SNM A;  3A55 A;  1A2U A;  1STN A;  5FLM G;  2B29 A;  3S1M H;  3E3X A;  1KL9 A;  1NE3 A;  4BY1 H;  4A3C H;  4LF8 L;  3BVZ A;  1RDP D;  4X62 L;  2HQE A;  2JA7 G;  2H5X A;  4EQ5 A;  1EYD A;  1TXY A;  4A3L H;  5I6W A;  5M3M B;  1I6H H;  3R2T A;  5C4X H;  4KD3 A;  4EVO A;  1J5E L;  4IFD J;  1ESR A;  1A2T A;  4DR1 Q;  4UY8 C;  1CKM A;  2MHV A;  3SK8 A;  3OWF A;  3TRZ A;  2TMP A;  3EJI A;  1PH6 A;  2UXD Q;  2ID0 A;  1O78 A;  2HIX A;  1G6P A;  4JI5 L;  1I94 Q;  1JT8 A;  4BXX H;  1IL2 A;  2BA0 A;  1KD1 C;  1A6X A;  2JK8 A;  2G9H D;  4OIJ A;  1PDQ A;  4IOC A;  3NHH A;  4IZ8 A;  2IX0 A;  5CV7 A;  1S3O A;  1HZ9 A;  3CP0 A;  1PTO H;  3GQB A;  1SNP A;  3A74 A;  4UDU C;  4QUF A;  2HDL A;  5ELC A;  2K32 A;  2BOS A;  2A6E C;  4JI0 Q;  1HNW Q;  1GHJ A;  1TVX A;  5M3M G;  4DGZ A;  4O42 A;  1EU3 A;  4DPG A;  3KBX A;  1UE7 A;  3CW2 C;  3UDX A;  1K0R A;  1CM9 A;  1KTK A;  2KHI A;  4HR7 B;  1W6J A;  2JN4 A;  4CDC C;  5M5W B;  3DMU A;  3P20 A;  3U9O A;  1XMQ Q;  3MFY A;  1WTX A;  2BA1 A;  2B2T A;  1EY8 A;  2VL6 A;  2XRQ D;  4V19 0;  3T1Y Q;  4X6A H;  1ONL A;  2F0H A;  1PHJ A;  1VQA A;  1MJC A;  2NTT A;  2VY3 A;  4IUT A;  5ISR A;  4QL5 A;  2XGT A;  4ME3 A;  4U67 3;  2QA4 A;  1XTC D;  2J4X A;  4GOP B;  4IUP A;  3PUV A;  1X56 A;  4TQU S;  4JI7 Q;  3CCS A;  2PMZ B;  2B3G A;  1VQF A;  3R93 A;  2PZU A;  1R9T H;  1HNX L;  2JXM B;  1CQV A;  4R4C A;  2VUM B;  1QUQ B;  2ICI A;  1EOV A;  3KUP A;  1I5F A;  3O13 A;  5M5X H;  3G71 A;  4RCN A;  4RGN A;  3UDF A;  2DJF C;  4WJW A;  1S5E D;  2RCF A;  3A56 A;  2YV5 A;  1NBW A;  2R7Z B;  1EQT A;  1PRT B;  1RIP A;  4A3J G;  1VCI A;  1LTT D;  3RNU A;  4RAU C;  3GTJ H;  3OW2 A;  3NP8 A;  5FLX L;  3A8I E;  1IZ6 A;  4C2M B;  1NUC A;  4IJL A;  3LX0 A;  1C8C A;  4BBR H;  1EU4 A;  4DAP A;  1ASZ A;  3U9S A;  1U4P A;  5AJ3 L;  4YCV A;  2SNS A;  4FXD A;  1B3Q A;  1U4L A;  3HOV G;  5C44 H;  3L3O C;  4OO1 H;  1N34 Q;  3V05 A;  4A3G B;  2BCO A;  1U0L A;  3PUW A;  4KN4 C;  4ZUJ A;  1HR0 Q;  4HN7 A;  1B50 A;  4NP5 A;  2NVX H;  5M9O A;  4GNX A;  2EY2 A;  1Z47 A;  2KHS A;  1X3F A;  2JA8 G;  1I3Q B;  4XQQ A;  1O80 A;  4OON A;  1SSO A;  1N34 L;  3M9B A;  3A54 A;  1EQR A;  2R93 B;  1X6O A;  3TN2 A;  1D8L A;  4LUV A;  4Q5V A;  4A3D G;  5TSS A;  3I70 A;  1C7Y A;  4IUN A;  5KYL A;  4CKC A;  4KKS A;  3KLR A;  4C3H B;  2QF7 A;  3K7A B;  2K52 A;  2JE6 I;  2OWO A;  2UUB L;  2BE5 C;  5FLM H;  2A19 A;  3NQT A;  3D6C A;  1HNZ Q;  1D1K A;  3AQQ A;  1PTO D;  2A1A A;  3K58 A;  3ERO A;  2BDN A;  5DLQ E;  1JOR A;  2A69 D;  3MAQ A;  1MIU A;  5IOD A;  3NTK A;  3RZO H;  2QIL A;  4A3J H;  2B8G A;  4G7O C;  1HH2 P;  2JA7 H;  2UXC L;  1FJG Q;  1I50 H;  3K8A A;  2F0V A;  1RF2 D;  1DM0 B;  1V8Q A;  1E2V A;  1AEX A;  3HOY G;  4R4I A;  1YEZ A;  3I4O A;  5DM7 3;  2E2H H;  4ZUI A;  1ICW A;  1ASY A;  4DV6 Q;  1LV9 A;  1WJJ A;  1SRU A;  5IP9 H;  1FNV A;  4DK3 C;  3J7A F;  2DY7 A;  1IBM Q;  1O7Y A;  2Y0S E;  2G5D A;  2Q2U A;  5C4H A;  4OL7 A;  5K5P A;  2YTV A;  3CRK C;  4FF2 A;  1LT6 D;  2JA8 B;  4AYB E;  4A3E H;  4WJ4 A;  4JI1 L;  2NBF A;  2VS1 A;  4WOR A;  1QVG A;  4JBK A;  2B63 G;  3KFU A;  3NPP A;  2KEE A;  2PZT A;  1QWY A;  2QEX A;  1G91 A;  3MXP A;  4DR4 Q;  3G6J B;  4B3M L;  5FLX c;  2XNA C;  4OEM B;  1A15 A;  3HOV B;  3D6W A;  2E2I B;  2UUC Q;  1JR0 D;  2ZXO A;  5EKL A;  1L0Y B;  4LF9 Q;  1JJG A;  4A3B G;  2A6E D;  1XX8 A;  4P2C B;  2R93 H;  1HZB A;  4PZ6 A;  5CGK A;  1VQP A;  4P75 A;  3STB D;  4B3M Q;  2BDO A;  4DR5 L;  1MD2 D;  1ESF A;  3I8Z A;  2Q8T A;  4CDD C;  3I4M H;  2VQE Q;  3VR2 A;  3HFZ B;  1FVI A;  3T56 B;  2PI2 A;  3FRP B;  4B3T L;  2Z8L A;  4OXP A;  3U58 A;  2QDL A;  2MQH A;  5IGF A;  3KYH C;  2HDM A;  1CK1 A;  2IPK D;  4C3I H;  2QEJ C;  1IKM A;  4JI4 L;  4BA1 I;  2MGS A;  2CFM A;  1X3G A;  5C0X H;  4AQY Q;  3CD6 A;  1N33 Q;  1PFS A;  3HP3 A;  2EJG C;  2X6L A;  1I4X A;  2K75 A;  5C4X B;  1NTG A;  3I4N B;  1UEB A;  2K5N A;  2F3W A;  4LAA A;  2OF1 A;  3KJO A;  4FNF A;  2WB1 B;  2R7Z H;  5CV8 A;  1S5C D;  2Q8R E;  4ZCK A;  4A3G G;  3FKI B;  2UXB L;  1YHQ A;  1RTO A;  4R4Q A;  5EPK A;  1I3Q H;  3R8B A;  1AE2 A;  5C3E H;  4B3S L;  1IYV A;  1V1P A;  4JCV E;  1V43 A;  3UDI A;  1SJH D;  1GM5 A;  3NEN A;  4CGY B;  2K1B A;  3TP5 A;  1VQD A;  2NN6 H;  2Y0S G;  1STE A;  1GHK A;  1FJG L;  1V1Q A;  4C3H G;  3GTM B;  3S2D B;  4GN4 B;  2ZJR A;  1QZG A;  1Y8N B;  1EIG A;  4L8J A;  3RLF A;  4A93 G;  1QVC A;  3AFQ A;  1STB A;  5EGT A;  3PO2 B;  4BBR G;  1CKO A;  1LTA D;  3OOC A;  3TP8 A;  5ELF A;  4QF4 A;  5C4J H;  5IWA L;  3Q0A A;  1AN8 A;  4RMF A;  1SNC A;  3SE0 A;  1PYB A;  2AUK A;  5JJL A;  5KYI A;  2WII B;  4R4O A;  2KED A;  4HCE A;  4Y52 H;  5JAV A;  3GTP H;  2M00 A;  3VYR A;  4DR3 L;  5C5L A;  4X62 Q;  1LO5 D;  4U68 A;  3VR3 A;  5M5X B;  1PYW D;  1L0W A;  1QNU A;  3PO3 B;  1KAW A;  2N8N A;  1I4R A;  3HOZ G;  4X64 L;  4CJ0 B;  2R92 G;  2X6G A;  5COR A;  3Q22 A;  2RSN A;  4DUZ L;  1PFM A;  2WAQ E;  3SEB A;  1VQ4 A;  1WD0 A;  1QG7 A;  4K2K A;  4C3I B;  2JA7 B;  4X66 Q;  4CHT B;  3NTI A;  3BJU A;  2HHH Q;  2WKC A;  3MTS A;  2AKW B;  4ID6 A;  3KLS X;  4HTH A;  1UEA B;  3MEH A;  2Z4I A;  2AQ3 B;  3CME A;  4O1N A;  3NSW A;  4Q0F A;  3CC2 A;  5NUC A;  1I4Q A;  1VMP A;  4UPA A;  1X65 A;  4DR2 L;  2TSS A;  3IFT A;  3LWU A;  3V2T A;  4CDF C;  2AWN A;  2Z6B A;  1WCM B;  3EN2 A;  4PMB A;  3NXW A;  3NK9 A;  5COY A;  4E6I A;  4FXG C;  5DEH A;  2OQK A;  3WOE A;  4CKB A;  2L9H A;  2HCI A;  1STH A;  5C3W A;  2CQO A;  4C3H H;  2CKZ B;  1PH7 A;  1YZ6 A;  2YTY A;  1CKN A;  1FL0 A;  3K81 C;  1JJC B;  1KAB A;  2RF4 A;  4C3J H;  3CCL A;  3K7U C;  1GUN A;  1GUO A;  4KD4 A;  1VQC A;  3I4N G;  4BY7 B;  3CQZ H;  4LF6 L;  1G6Z A;  5JVG 3;  4A76 A;  4G7Z C;  4RA8 A;  2D0O A;  4IFD I;  2DNE A;  2UXD L;  4HMJ A;  3GTO H;  1L0X B;  4JVZ A;  2F4I A;  2KCM A;  2WAC A;  3VR4 A;  3ZYY X;  1K9M C;  1Q46 A;  1O7L A;  3IKJ A;  4K6L A;  1TS2 A;  5IT9 E;  4JI7 L;  4ZLT F;  3BYY B;  4K5V A;  1OXU A;  2ICE C;  4H44 C;  1X3P A;  3N52 A;  1VQ9 A;  1PV4 A;  4KLK A;  3N6R A;  4BY7 G;  1K8G A;  4JC0 A;  1PFB A;  3FHW A;  3MXG A;  3CCU A;  1F77 A;  1SR3 A;  2F0P A;  3F2B A;  2IHF A;  3H3V H;  4YCU A;  1JMC A;  1DCZ A;  1RJT A;  3ND8 A;  3K59 A;  4MTN A;  3BDL A;  3RLO A;  2R6G A;  1YIJ A;  4K0K L;  1KNA A;  4C56 C;  2WAQ G;  5C4J B;  2SEB D;  2DY8 A;  1VQH A;  3A7A B;  4KKU A;  4JI8 L;  4KN7 C;  4UP8 A;  2WB1 E;  5IGD A;  5E1F A;  1LTI D;  5IP7 H;  2JA5 G;  3VYS A;  1B70 B;  1EZ8 A;  2NYZ D;  4CBV A;  3S14 H;  1WCM G;  2L0C A;  2R93 G;  4EQP A;  3RR5 A;  1EIY B;  1ENF A;  1I6V C;  1WD1 A;  3J7A V;  2JJQ A;  1Y1V G;  1KLU D;  5I2Y A;  4X3S A;  2EOT A;  4YWM A;  4PG3 A;  3KF8 A;  5I9O A;  5KRU A;  5M5Y B;  1IBK L;  4IPG A;  2FIN B;  4RKB A;  2K5Q A;  3BG3 A;  5KNC A;  4JI6 Q;  4DAY A;  3OSO A;  1KDB A;  1PH3 A;  1S40 A;  2PW7 A;  1JWS D;  2O5I C;  4DV3 Q;  2K7V A;  1N36 L;  4DR6 L;  1YNX A;  1VQK A;  2NZH A;  5IY0 A;  1X55 A;  1A0I A;  2ZJQ A;  1JE5 A;  2L12 A;  3PO3 G;  4BBS H;  4LF7 Q;  1G2T A;  5EQ0 A;  1BCP F;  1Q3L A;  4EQO A;  3HRZ C;  3MEF A;  5I4D A;  5LMU L;  1EQQ A;  1DZ1 A;  2O4X A;  4HJ9 A;  4XT3 B;  4XT1 B;  1N9W A;  2NN6 I;  1Y1V B;  5KND A;  1Q90 A;  4JOI A;  4A3D H;  2Z6K A;  4DV1 Q;  2VUM G;  1HFN A;  1WTP A;  2EPB A;  1A8V A;  4LF5 L;  1W3S A;  1KLG D;  1B2T A;  1Q8K A;  4A3D B;  1NSN S;  3BDO A;  3OYY A;  2N49 A;  5DAU A;  3W2D A;  4A3B H;  1Y1V H;  1VQ6 A;  3UI2 A;  2Y0S B;  4OO1 G;  1GUT A;  2N55 A;  1MSG A;  3DM1 A;  2OXP A;  2MO0 A;  1J8I A;  1K3R A;  2CH4 W;  3GDE A;  3S16 H;  5IGG A;  3NE5 B;  3IFD A;  1D2B A;  1I6H B;  1P16 A;  1CZW A;  2JQO A;  2NTS A;  1JE4 A;  5D14 A;  2QW7 A;  3H15 A;  1SYG A;  3E9I A;  5JJI A;  3PIO 3;  1MJE A;  1WTW A;  3HOZ H;  2Q2I A;  3S24 A;  3TS2 A;  2WB1 G;  1PLF A;  3FP9 A;  1HUM A;  1TU2 B;  2E74 C;  3DLL A;  1PZJ D;  3FDT A;  1VQ8 A;  3HOX B;  1XNQ L;  2UUA L;  1S5B D;  3K5M A;  5EBD A;  1SRO A;  1ZYR D;  2H4O A;  2Q2H A;  2XIW A;  1T9H A;  5C4X G;  2K4K A;  5LMN W;  1GKH A;  2R7D A;  1YNJ D;  4M1U B;  1C0A A;  1JCK B;  1SDF A;  2K6A A;  4XDX A;  5C0X J;  1JWM D;  2V1C C;  3NBI A;  3NUC A;  1VQ7 A;  3CCQ A;  2Z9H A;  1GUW A;  2ATW A;  1I50 B;  4JBM A;  1KIX A;  3I4L A;  2E8G A;  2R3Z A;  2WKD A;  4QY7 A;  1SFO H;  3FVQ A;  4LF4 Q;  4YHH L;  1WI5 A;  1SNO A;  1UE6 A;  2KEC A;  3PGZ A;  3J80 E;  5IOC A;  2N78 A;  3OTO Q;  1CI3 M;  5JJK A;  3GTQ B;  1F2Y A;  1W6K A;  1Z6H A;  4JI2 Q;  3M85 A;  4NDX A;  3S1R B;  4PQX A;  3H3V C;  1RTN A;  3GTG B;  4MTK A;  1EFW A;  2L11 A;  4K6D A;  1VS0 A;  5M3M H;  3ONA B;  4IUV A;  1L1O B;  4H7B A;  5GAG C;  1XPO A;  4JI2 L;  1PTO C;  5EKI A;  2DN8 A;  1WTV A;  1F9S A;  2C35 B;  1H9K A;  2IHE A;  3DWA A;  4JBJ A;  5AFW A;  3T1H Q;  3WWV A;  1IW7 D;  5CC4 A;  3CPF A;  1MI2 A;  5JVH 3;  1PXU A;  1BQQ T;  4R1J A;  2R92 B;  5IP7 G;  1Y14 B;  3I90 A;  3PQI A;  2NVX B;  1B44 D;  2KCC A;  3C1E A;  5FJ8 H;  4C3J B;  4GLX A;  5JJZ A;  3A8K E;  2AMC B;  4B3R Q;  1QUQ A;  3RZD H;  2WAQ B;  1FGB D;  4DNT B;  2K14 A;  4PNY A;  1TS3 A;  5C3X A;  4A3F B;  4FVM A;  3PUY A;  2ZTC A;  4C1N I;  2B2W C;  4X3U A;  4XIG S;  2OTL A;  4GNX C;  1D5Z C;  2A69 C;  4A3F H;  3A0J A;  5ELO A;  4NPS A;  3KF6 A;  1C48 A;  2JA5 H;  3GTL H;  1EYG A;  5EAY A;  3ERQ A;  1D5X C;  1WTH A;  1N32 L;  3S15 B;  4CDE C;  3VA5 A;  1K8M A;  3QOL A;  4ZAI A;  3S1Q H;  4DFA A;  1ROD A;  1EWH A;  5JPN C;  1RKN A;  3GTJ B;  3L9A X;  4A3E B;  1HJP A;  1F9P A;  3NTH A;  2HIV A;  4A93 B;  4I7A A;  4DR3 Q;  2E2J B;  2Z1C A;  3H09 A;  5JEA G;  3I3C A;  3F2D A;  4B9W A;  5K36 H;  5C0X I;  1QVF A;  1AP0 A;  1XMO Q;  3E6Z X;  5I9P A;  4RFB A;  1HA6 A;  5M3F B;  3TRE A;  1YHA A;  4A3C G;  3HOW G;  4DA2 A;  1R9T B;  4RGO S;  2Z6K C;  4RG1 A;  3J7Y W;  2HT1 A;  1MHW C;  2IJ0 A;  4IFD H;  2L5T A;  3CCE A;  2KUM A;  1B9N A;  1IYU A;  2K01 A;  3KLW A;  4A3I B;  4H0L C;  1HRJ A;  1T5X D;  3L7Z C;  3MZ5 A;  2IWH A;  2UUB Q;  1Q7Y C;  1BCP D;  3ER0 A;  2GVA A;  4POF A;  2RBM A;  4PZ8 A;  1IHZ A;  3ULP A;  4K2L A;  2LXJ A;  1TII D;  3W1B A;  2NVT B;  4J8Q A;  1LYL A;  1LTS D;  2CQA A;  2PQE A;  1EEI D;  2CW0 C;  4BY1 G;  3HOW H;  2B2V A;  3OWE B;  4PZ7 A;  3R2I A;  4G7H C;  4LFB L;  2KQ3 A;  4RGM A;  4HSP A;  4DAV A;  1G29 1;  1MBY A;  2EQS A;  4BBS G;  4B9X A;  3NEM A;  3PO2 H;  4DR4 L;  3CPW A;  3KBG A;  5JEA J;  1B7Y B;  1ET9 A;  4ZRZ A;  2DJG C;  3RLN A;  1M4V A;  2K28 A;  4LFB Q;  2DGY A;  5KGU A;  2QDB A;  3MWY W;  2N3S A;  1LAC A;  3S2H H;  3TZD A;  3V96 A;  1HZA A;  4AYB G;  1WFQ A;  4KV6 A;  4OEL B;  3HZX A;  3RUZ A;  2KVM A;  3U4Z A;  4ABN A;  3SXH A;  5LMN Q;  3HOZ B;  4A3F G;  4JV5 Q;  1DXM A;  4DV2 L;  4DUZ Q;  4JI1 Q;  2FXQ A;  3S1N B;  1LAB A;  1BXT A;  4IQZ A;  5IYB G;  2IX1 A;  4ILW A;  1ILP A;  1LTR D;  4L5S A;  1MGS A;  1EQV A;  5H1S E;  5BN3 A;  2I07 B;  1D5M C;  3URY A;  1CSQ A;  2V4D A;  5IIF A;  2DNC A;  2BH2 A;  2B2T C;  3TS0 A;  5T1G A;  4DV7 Q;  2KCT A;  4LJZ C;  1GVP A;  4R8N A;  2K03 A;  5CYU A;  4L6T B;  2M2L A;  2D0P A;  3M4P A;  1VQJ A;  4K0K Q;  4BY7 H;  1OXS C;  2NUC A;  1JQY D;  2XVS A;  3TEH B;  1Q8I A;  2L1B A;  2VB3 X;  4K8J A;  1B1Z A;  1FNU A;  3H91 A;  3CKI B;  2EXD A;  5E4X A;  5I6Y A;  3HG9 A;  4DU9 A;  1VQN A;  1S5F D;  1PYS B;  4CJ2 C;  4FYD A;  4DNR B;  1E3P A;  4A4I A;  2ZT9 C;  1D1I A;  1OXV A;  2RVL A;  4LMQ D;  4MZ9 A;  4XTC S;  2NVY H;  1UE5 A;  2F0Q A;  4EQN A;  4OIK A;  5G3L F;  4F87 A;  2JA8 H;  1J5E Q;  2RA4 A;  1K83 B;  4NKL A;  2B2Y C;  4NXN Q;  1W2B A;  1H95 A;  1EYA A;  3FMC A;  2I0Q A;  1Y1W H;  1L1O A;  3F2U A;  2F3V A;  3IAY A;  4R8I A;  1JB7 A;  5IYC H;  1UWV A;  2F4V L;  4DV2 Q;  1E1T A;  5CV9 A;  5FJ8 G;  2E2H B;  1QJO A;  5AJ3 Q;  2JA6 H;  1QOH A;  1VDZ A;  3S17 H;  3T53 B;  3CC7 A;  1I94 L;  4JI5 Q;  1TWC H;  3A7L A;  4N8F A;  1NMG A;  4JW0 A;  4JOI C;  1TS4 A;  4J6H A;  2LSS A;  2K5V A;  2F3I A;  2KCN A;  5M3F H;  3EFX D;  2MNA A;  4QIW E;  4YWK A;  4DAM A;  1E22 A;  1K73 C;  2HHH L;  4MIU A;  4N8X 1;  2IL8 A;  1HPC A;  3EQL C;  3GTP B;  5IYC G;  1TKW B;  4RKL A;  1IBL Q;  3MXN A;  1YBY A;  4HID A;  1K0S A;  5T1I A;  1IBK Q;  3DWP A;  2AWO A;  3S15 H;  5JEA H;  4L63 B;  4KHP L;  3GTL B;  1JIC A;  2B63 B;  5GAH C;  2EXZ A;  1PTO F;  1RCV D;  4F8M A;  2K5W A;  3E5S A;  1EL0 A;  2RHQ B;  2K04 A;  3ERS X;  1N36 Q;  3PUZ A;  2LXK A;  3PF5 A;  3S1N H;  1WTO A;  3PMF A;  1XMQ L;  3HKS A;  1Y69 U;  3GTO B;  3NEL A;  2P5Z X;  4DV3 L;  3I55 A;  4LF7 L;  2VXW A;  3K0X A;  1XNR L;  3M3Y B;  1VF5 C;  2JYO A;  3PUX A;  1SMY D;  5HY6 A;  1YJW A;  1HNW L;  1HHV A;  3CF5 A;  3MFG A;  3I2Z A;  3KDF A;  3PV0 A;  4GN5 A;  3OIP A;  4QIW B;  1GUS A;  2B39 A;  1M8A A;  3TBI B;  4GLA C;  4OX9 Q;  3HOU B;  5LL6 X;  1U4R A;  1FGU A;  1Y1W G;  3A8J E;  1AW7 A;  1UE1 A;  2PMZ E;  4UP9 A;  1SLJ A;  1CT1 D;  4JI6 L;  5IGE A;  4JG2 A;  3SK5 A;  4A3I G;  4P74 A;  2N88 A;  1BBX C;  2RDF A;  1D7Q A;  3UE0 A;  2F52 A;  3QG1 A;  1XNR Q;  2YTX A;  4DUY L;  4C2M H;  4XQJ A;  4DV1 L;  1QE6 A;  2XSC A;  1EY5 A;  1T5E A;  2VNU D;  3GTQ H;  2WFW A;  1F2M A;  1F2L A;  4DXF A;  4DR6 Q;  3DM3 A;  1NJI C;  4ZKC B;  1H9S A;  1U4M A;  4H02 A;  3U4V A;  4DUY Q;  1IL8 A;  3HGB A;  2K5H A;  1N8R C;  4LK1 C;  1IKL A;  4GOP C;  1XXG A;  4DV5 L;  1DGS A;  3R3O A;  3M7G A;  3S2H B;  1VQI A;  2EDG A;  3T51 B;  1B8A A;  3FKI G;  1Q1E A;  2DUD A;  3X3N A;  2QCP X;  4YY3 Q;  5C44 G;  4GKK Q;  4XYO A;  3KK7 A;  5EJW A;  1MKH A;  3Q24 A;  4IUR A;  5IGC A;  1WTR A;  5FKA C;  4F88 A;  5HGQ A;  1O7Z A;  4BA2 I;  3JC6 6;  1X32 A;  2MFI A;  4QB4 A;  3SHL A;  3BYT B;  4JI0 L;  4IJH A;  2X69 A;  3HOV H;  4O2D A;  1ET6 A;  2ES2 A;  3ULL A;  3P7J A;  1YJ9 A;  4DR1 L;  2CWP A;  1J9O A;  3KF8 B;  3PCO B;  1U5K A;  2Z0S A;  3GV3 A;  1DJR D;  5A35 A;  3NBH B;  5C3E G;  3GO5 A;  4DV4 Q;  4B3R L;  3J81 c;  3T13 A;  5M5W H;  1EZ6 A;  5GRO A;  3ZJY C;  3K0Y A;  4AQY L;  4K5W A;  4H13 C;  3G7L A;  4KMU C;  4WRD A;  4JBW A;  4ME5 A;  3T1Y L;  4NB3 A;  1SMX A;  2R7Z G;  4LF4 L;  4DV4 L;  2UUA Q;  1C9O A;  2B2W A;  4QMG A;  1PVO A;  2LS0 1;  3S14 B;  1CQF A;  4YHH Q;  4PMC A;  3STB C;  1AFP A;  4IAL A;  1NMF A;  1HNX Q;  2UXB Q;  2F0U A;  3VYT A;  3W3A A;  4R9W A;  1DON A;  2PZW A;  2QGQ A;  4LUO A;  2I5M X;  4RHS A;  4KJO A;  2RDH A;  1B9M A;  4C3J G;  1IBM L;  4YCW A;  1VQB A;  1YNN D;  1VQO A;  2Q2T A;  1X54 A;  3H3V I;  1GD7 A;  3D4W A;  4RWS C;  1PA6 A;  4DV6 L;  3S1Q B;  1AZP A;  5FO9 B;  3K5O A;  5E3F A;  5I2X A;  2EIF A;  2VQF Q;  1O7I A;  4V0B A;  1Q12 A;  5J3B A;  3M4O B;  2EYO A;  1IW7 C;  5BR8 L;  3S1R H;  1PH9 A;  1JOK A;  1HQR D;  4FF3 A;  2F0L A;  2J0T D;  1K3B C;  2UU9 Q;  2UXC Q;  5M3F G;  2NZ1 D;  1Y8O B;  2C9O A;  2NB0 A;  5LMU Q;  3HOY B;  4M8A A;  3OTO L;  4N9T A;  1M1K C;  4IPH A;  2A8V A;  3FEW X;  2WP8 J;  1ML0 D;  4HIK A;  4A3L G;  4XQN A;  3I91 A;  3OMC A;  1A63 A;  3CQZ B;  5GAD C;  1SMY C;  3T16 A;  2JP1 A;  1OXT A;  1E0B A;  2VQE L;  2KEN A;  2UU9 L;  1LM0 A;  1WYD A;  2LMC B;  2PNH A;  1NR2 A;  3GV6 A;  3QWN A;  5CV5 A;  3T4A C;  3TZU A;  3FPP A;  4FXK C;  1QB5 D;  4LWC A;  1U9R A;  5IGB A;  2F0S A;  3CHB D;  1NAP A;  2HUG A;  3KF6 B;  3LWE A;  1B3A A;  3DEO A;  3ND9 A;  4A3K H;  5KNB A;  4X3T A;  2OEO A;  2CW0 D;  2ZTE A;  4ZYS A;  1WVL A;  1WCM H;  2L55 A;  4LFC Q;  1LUZ A;  4MNO A;  3J7Z C;  1ZXT A;  1KHI A;  2HQL A;  2VW9 A;  1X9N A;  1X3E A;  3I56 A;  1YJN A;  2E75 C;  3F2C A;  2F0I A;  2RCN A;  1PMR A;  2AUJ D;  4X64 Q;  3J81 E;  1LTG D;  1XJV A;  2E2D C;  4B08 A;  1HZC A;  2F0G A;  4A3I H;  1D6E C;  2F0T A;  5ELD A;  1TWC B;  4C3I G;  3M4Y A;  4HED A;  1RHP A;  2A68 C;  4KY5 A;  2JA6 B;  2E76 C;  3S17 B;  5LHY 1;  5C0X G;  3SK4 A;  4NW2 A;  4GKJ Q;  4QUC A;  4NXM Q;  1DOL A;  1KDC A;  3H94 A;  1HTP A;  1V1O A;  2A74 C;  1F9R A;  4NXN L;  5D3I B;  1BDO A;  4JI3 L;  4IUQ A;  1A62 A;  1H9R A;  2YU9 H;  2AQ1 B;  1K83 H;  4A93 H;  3HOX H;  2EY1 A;  2H1E A;  1UAP A;  2PQA B;  3CCJ A;  4EX5 A;  2HCC A;  3B6Y A;  2B2U A;  4A75 A;  4F7X A;  1CTM A;  5KIX A;  4JK1 C;  4A3K G;  4JI3 Q;  1V9P A;  3TSS A;  5CV4 A;  1E2W A;  2EYH A;  3PIO A;  3LGJ A;  1G8Z D;  5L37 A;  4DK6 C;  1HTL D;  1XPU A;  4TSS A;  5K36 G;  1SE2 A;  5LMN L;  4MN3 A;  5DNF A;  4A3M G;  4AIM A;  3S2D H;  3AB9 A;  3S16 B;  1QNK A;  3WDN A;  1TY0 A;  5C4Z A;  1BCP B;  4I7Z C;  1OO9 B;  3D8G A;  3PF4 A;  4ODG A;  2F0F A;  5C3E B;  1LTB D;  1EEF D;  5IYB H;  2R92 H;  2KA7 A;  5DM6 3;  3M3Y H;  2EJM A;  1VMC A;  1VQ5 A;  1PRT F;  5IP9 G;  3KJP A;  2E5L L;  4X65 L;  3BVG A;  3EA6 A;  3GTK B;  1JC7 A;  2ZXR A;  3J81 L;  4LFA Q;  1SN8 A;  3D3R A;  1CHQ D;  1NNX A;  2YYZ A;  3RD4 A;  3D4D A;  3VR6 A;  4DR2 Q;  1TWA B;  3SR1 A;  2B63 H;  2RKS A;  3HKZ B;  1H9M A;  3DWQ A;  1NCV A;  1KC8 C;  3GTG H;  1CA6 A;  2EYM A;  1B53 A;  5EPJ A;  1CA5 A;  1ZYR C;  1E1O A;  1HCZ A;  1RD9 D;  4G4K A;  4QJF A;  3GD7 A;  3BS1 A;  4DR5 Q;  3D4R A;  4L5Q A;  3S1M B;  1NY4 A;  1EY7 A;  1BO0 A;  1HQM C;  4DK0 A;  4HJA A;  1SNM A;  4ALP A;  1R4Q B;  5F2D A;  2VUM H;  4A3K B;  2WV6 D;  1KXL A;  3FPU B;  5JOB A;  1BBW A; 
#chains in the Genus database with same CATH homology
 3Q8D A;  1OTC A;  1SE8 A;  4GS3 A;  5IT9 c;  2EXD A;  3J80 c;  4APV A;  1VQN A;  2OQK A;  4DV7 L;  3SGI A;  1PYS B;  1QZH A;  1AE3 A;  2CQO A;  4C3H H;  3CCR A;  2IT1 A;  1E3P A;  4A4I A;  2CKZ B;  1PH7 A;  1RL2 A;  1YZ6 A;  3BU2 A;  1OXV A;  2YTY A;  1CKN A;  4MZ9 A;  4AH6 A;  4XTC S;  4DNI A;  1CKN B;  2NVY H;  1FL0 A;  3K81 C;  1UE5 A;  1JJC B;  2GN5 A;  2RF4 A;  5IYD G;  4C3J H;  3CCL A;  1CUK A;  3BZC A;  3K7U C;  4LF8 Q;  4POG A;  2F4V Q;  1GO3 E;  4DAY B;  3RN2 A;  3IRB A;  1VQM A;  2JA8 H;  1VQC A;  1J5E Q;  3I4N G;  1PH1 A;  3CQZ H;  4NXN Q;  2CWA A;  4LF6 L;  1EWI A;  5FLM G;  1W2B A;  2L15 A;  1H95 A;  2B29 A;  3S1M H;  4A76 A;  2I0Q A;  1Y1W H;  1KL9 A;  1NE3 A;  1OXX K;  1L1O A;  4L5T A;  3G4S A;  3HOY H;  4BY1 H;  2D0O A;  1JB7 A;  4IFD I;  1XPR A;  5IYC H;  4A3C H;  2UXD L;  1UWV A;  4P72 A;  4HIO A;  4YY3 L;  4LF8 L;  3GTO H;  1PH8 A;  2KCM A;  2F4V L;  1K9M C;  4X62 L;  4DV2 Q;  1E1T A;  2JA7 G;  4X65 Q;  1Q46 A;  5FJ8 G;  2H5X A;  4EQ5 A;  4LF6 Q;  1TXY A;  5AJ3 Q;  3JAM c;  2JA6 H;  3S17 H;  4A3L H;  1I6H H;  3CC7 A;  1I94 L;  3A5Z B;  1TWC H;  5C4X H;  4JI5 Q;  4JI7 L;  2OCE A;  1OXU A;  1NMG A;  1J5E L;  4IFD J;  4JOI C;  1VQ9 A;  1PV4 A;  1JT8 A;  4DR1 Q;  4UY8 C;  1CKM A;  2LSS A;  4KLK A;  1IBL L;  2K5V A;  2F3I A;  5M3F H;  4IO9 A;  4DR7 Q;  3TRZ A;  4BY7 G;  1K8G A;  4JC0 A;  3FHW A;  3CCU A;  2ID0 A;  1PH6 A;  2UXD Q;  1Q82 C;  2HIX A;  2MNA A;  4QIW E;  1SR3 A;  4YWK A;  4JI5 L;  1E22 A;  4DAM A;  3F2B A;  1K73 C;  1I94 Q;  2HHH L;  4BXX H;  1IL2 A;  2BA0 A;  2IHF A;  1KD1 C;  3H3V H;  2E2J H;  3F1Z A;  4YCU A;  2JK8 A;  4LW1 A;  3J81 i;  1JMC A;  1E7Z A;  5IYC G;  1IBL Q;  4MTN A;  4IOC A;  3RLO A;  1YBY A;  2R6G A;  1YIJ A;  4HID A;  4DKA C;  4K0K L;  2IX0 A;  1S3O A;  1IBK Q;  1HZ9 A;  2WAQ G;  3CP0 A;  2AWO A;  3S15 H;  1VQH A;  4JI8 L;  4KHP L;  3K80 C;  5GAH C;  4UP8 A;  2WB1 E;  3PO2 G;  4DR7 L;  5IP7 H;  3A74 A;  2JA5 G;  1B70 B;  4OX9 L;  3S14 H;  2RHQ B;  2R93 G;  1WCM G;  4JI0 Q;  3RR5 A;  3TQY A;  1HNW Q;  1EIY B;  2E2I H;  5M3M G;  3ERS X;  1N36 Q;  3PUZ A;  2LXK A;  4DPG A;  3PF5 A;  3S1N H;  2JJQ A;  1XMQ L;  1Y1V G;  1J6Q A;  3HKS A;  1UE7 A;  3CW2 C;  3UDX A;  1HR0 L;  4YWM A;  1K0R A;  3NEL A;  4PG3 A;  4DV3 L;  3I55 A;  4IPG A;  1IBK L;  3BZK A;  4LF7 L;  3K0X A;  1XNR L;  2KHI A;  3D31 A;  3PUX A;  5HY6 A;  1YJW A;  3HOU H;  1HNW L;  3CF5 A;  3I2Z A;  3KDF A;  3PV0 A;  4GN5 A;  4JI6 Q;  1TWF H;  1M90 C;  2ALY B;  3VDY A;  1XMQ Q;  4GLA C;  1S40 A;  1PH3 A;  2CCZ A;  2BA1 A;  1XTD A;  4OX9 Q;  2VL6 A;  1FGU A;  1Y1W G;  3T1Y Q;  4X6A H;  1UE1 A;  4DV3 Q;  1PHJ A;  1N36 L;  4DR6 L;  1VQA A;  1MJC A;  1YNX A;  2VY3 A;  2VQF L;  1VQK A;  2PMZ E;  2NZH A;  4UP9 A;  1SLJ A;  2JEB I;  5E7N A;  3CMA A;  4JI6 L;  4QL5 A;  1X55 A;  1A0I A;  2XGT A;  4JG2 A;  4ME3 A;  5IY0 A;  2D62 A;  4A3I G;  2ZJQ A;  1JE5 A;  2QA4 A;  4P74 A;  4HJ7 A;  4LF5 Q;  1D7Q A;  3PO3 G;  2ZM6 Q;  3UE0 A;  4BBS H;  4LF7 Q;  2F52 A;  4GOP B;  1XNR Q;  3PUV A;  2YTX A;  4DUY L;  1Z9F A;  2K50 A;  1X56 A;  4TQU S;  2VZA A;  4C2M H;  4JI7 Q;  3MEF A;  3CCS A;  4DV1 L;  4OWT B;  2B3G A;  5LMU L;  1VQF A;  1AH9 A;  1R9T H;  1EQQ A;  2VNU D;  4HJ9 A;  1TWG H;  1HNX L;  1N9W A;  3GTQ H;  2NN6 I;  2WFW A;  4R4C A;  1EIF A;  1QUQ B;  2NVT H;  1EOV A;  3CXC A;  1I5F A;  2MO1 A;  3L0O A;  5M5X H;  4DR6 Q;  3DM3 A;  1NJI C;  3G71 A;  2R7F A;  4JOI A;  4H02 A;  4OWX B;  3U4V A;  3UDF A;  4DUY Q;  2Z6K A;  4A3D H;  1YI2 A;  4GKK L;  2K5H A;  3J80 i;  4DV1 Q;  1KQS A;  2VUM G;  1N8R C;  1LTL A;  1A8V A;  2YV5 A;  1W3S A;  1NBW A;  4GOP C;  4LF5 L;  1Q8K A;  4DV5 L;  1DGS A;  1RIP A;  4A3J G;  2AHO B;  1VCI A;  3RNU A;  3OYY A;  4O0A A;  1VQI A;  2N49 A;  3GTJ H;  3OW2 A;  4A3B H;  1Y1V H;  1VQ6 A;  1B8A A;  3FKI G;  1Q1E A;  2DUD A;  1IZ6 A;  5GAE C;  4OO1 G;  4YY3 Q;  5C44 G;  4GKK Q;  4KHZ A;  4JI8 Q;  1MKH A;  1TWA H;  4IJL A;  2MO0 A;  3K7A H;  2IY5 B;  1K3R A;  4KI0 A;  4BBR H;  5HGQ A;  1ASZ A;  3GDE A;  4BA2 I;  3S16 H;  5AJ3 L;  3JC6 6;  1BVS A;  2MFI A;  4YCV A;  2NZO A;  2ASB A;  1P16 A;  4JI0 L;  4IJH A;  3HOV G;  3HOV H;  2JQO A;  3HOU G;  5C44 H;  4O2D A;  4DV0 L;  1N34 Q;  3GTK H;  3H15 A;  3ULL A;  3E9I A;  4DV5 Q;  2ES2 A;  5JJI A;  1YJ9 A;  4DR1 L;  1MJE A;  3L2P A;  1U0L A;  3PUW A;  2CWP A;  2KBN A;  1HR0 Q;  3HOZ H;  3KF8 B;  2Q2I A;  3S24 A;  3PCO B;  1U5K A;  2WB1 G;  3TS2 A;  1PH2 A;  2Z0S A;  2NVX H;  4GNX A;  3E9H A;  1Z47 A;  3FP9 A;  4GNX B;  3NBH B;  3UDG A;  1X3F A;  5C3E G;  3DLL A;  2JA8 G;  1VQ8 A;  3GO5 A;  4DV4 Q;  4OON A;  3CCM A;  4DV0 Q;  3RN5 A;  2UUA L;  1XNQ L;  3J81 c;  1N34 L;  4B3R L;  5M5W H;  1SRO A;  3FKI H;  5GRO A;  2JA6 G;  3M9B A;  3ZJY C;  4AQY L;  2Q2H A;  1T9H A;  4A3G H;  5C4X G;  1EQR A;  4JBW A;  3T1Y L;  4NB3 A;  2K4K A;  1X6O A;  3M4Q A;  1D8L A;  1GKH A;  4LUV A;  1SMX A;  2R7D A;  3A5U A;  5LMN W;  4A3D G;  2R7Z G;  1C7Y A;  1C0A A;  4LF4 L;  2JEA I;  3G48 A;  1Q81 C;  4DV4 L;  1XNQ Q;  2UUA Q;  1C9O A;  3MXN B;  2K52 A;  2JE6 I;  5C0X J;  4J15 A;  2OWO A;  1PVO A;  2UUB L;  3I4N H;  2V1C C;  1VQ7 A;  3CCQ A;  4YHH Q;  5FLM H;  2A19 A;  2ATW A;  4JBM A;  3STB C;  4JYA Q;  1KIX A;  5IYD H;  4A3E G;  1HNZ Q;  1NMF A;  1HNX Q;  3AQQ A;  2UXB Q;  2E8G A;  2A1A A;  4QY7 A;  1SFO H;  4L5R C;  2QGQ A;  4LUO A;  5DLQ E;  1L1O C;  3G6E A;  2ZTD A;  2I5M X;  4LF4 Q;  2I5H A;  1MIU A;  3W5O A;  4YHH L;  1VQL A;  1WI5 A;  1UE6 A;  4R4T A;  4JYA L;  3PGZ A;  4WJ3 M;  1G51 A;  1IBM L;  4YCW A;  1VQB A;  3RZO H;  4A3J H;  2XTI A;  2N78 A;  3OTO Q;  1VQO A;  2Q2T A;  1X54 A;  3H3V I;  5JJK A;  1GD7 A;  1HH2 P;  2JA7 H;  1PA6 A;  4JI2 Q;  4DV6 L;  1FJG Q;  2UXC L;  1I50 H;  3M85 A;  3K8A A;  1YVC A;  3KDF B;  2EIF A;  2VQF Q;  1O7I A;  1EFW A;  3CCV A;  3ICE A;  1Q12 A;  4IOA A;  1VS0 A;  1HNZ L;  5J3B A;  3HOY G;  3UE1 A;  1BBU A;  5M3M H;  4R4I A;  1YEZ A;  3I4O A;  4YWL A;  1L1O B;  5BR8 L;  3S1R H;  1PH9 A;  2E2H H;  3AEV A;  2ZM6 L;  2ZJP A;  2UU9 Q;  1ASY A;  5GAG C;  4DV6 Q;  1XPO A;  4JI2 L;  5M3F G;  1WJJ A;  2OTJ A;  2UXC Q;  1SRU A;  5IP9 H;  2C35 B;  2IHE A;  4JBJ A;  5LMU Q;  4DK3 C;  1IBM Q;  3T1H Q;  2Y0S E;  3OTO L;  3WWV A;  2Q2U A;  4LF9 L;  1M1K C;  3CPF A;  4IPH A;  1WOC A;  2A8V A;  2YTV A;  4GN3 B;  1PH5 A;  2NVQ H;  5BR8 Q;  2WP8 J;  3HKZ G;  4AYB E;  4HIK A;  4A3L G;  4A3E H;  3AFP A;  4WJ4 A;  4R1J A;  4JI1 L;  3J81 j;  5IP7 G;  1Y14 B;  2OQ0 A;  2E5L Q;  2VS1 A;  1A63 A;  1CSP A;  3EIV A;  5FJ8 H;  5GAD C;  1QVG A;  4JBK A;  2B63 G;  4GLX A;  3KFU A;  2AMC B;  4B3R Q;  1QUQ A;  4P71 A;  1OXT A;  2QEX A;  3RZD H;  1E24 A;  3EBE A;  2VQE L;  2KEN A;  2UU9 L;  1LM0 A;  2K14 A;  1WYD A;  4DR4 Q;  2PNH A;  4B3M L;  5FLX c;  1N32 Q;  4BXX G;  3PUY A;  2ZTC A;  2UUC Q;  4LWC A;  4LF9 Q;  4XIG S;  2OTL A;  1JJG A;  4A3B G;  4GNX C;  1XMO L;  3H0G G;  4A3F H;  3A0J A;  4QQB X;  4OO1 I;  3KF6 B;  2R93 H;  5ELO A;  1HZB A;  4NPS A;  3KF6 A;  4PZ6 A;  2JA5 H;  1VQP A;  4HIM A;  1EYG A;  3GTL H;  5EAY A;  4P75 A;  3STB D;  4A3K H;  1BKB A;  1N33 L;  4B3M Q;  1N32 L;  4DR5 L;  1TWH H;  2ZTE A;  4QGU A;  3S1Q H;  4JI4 Q;  1WCM H;  3M7N A;  3I4M H;  4LFC Q;  1LUZ A;  4MNO A;  3J7Z C;  3HFZ B;  2VQE Q;  1FVI A;  1HJP A;  1KHI A;  2HQL A;  2HIV A;  2GVB A;  2PI2 A;  2VW9 A;  4DR3 Q;  2RHS B;  1X9N A;  1X3E A;  4Y7N H;  4B3T L;  2JA9 A;  5JEA G;  3I56 A;  4P73 A;  4OXP A;  3U58 A;  2UUC L;  2MQH A;  3F2D A;  2NN6 G;  5C0X I;  3KYH C;  1YJN A;  4C3I H;  1QVF A;  3F2C A;  2RCN A;  1XMO Q;  4IPD A;  4JI4 L;  4TVA B;  4BA1 I;  4X64 Q;  1IYJ B;  1XJV A;  2CFM A;  1X3G A;  3TRE A;  1YHA A;  4AQY Q;  1P8L A;  4A3C G;  3CD6 A;  3HOW G;  1VQE A;  1N33 Q;  1HZC A;  2Z6K C;  4RG1 A;  4A3I H;  2KHJ A;  2HT1 A;  1PFS A;  4B3T Q;  3M4O H;  4IFD G;  4HJ8 A;  2K75 A;  4LNQ A;  1NTG A;  2BH8 A;  5ELN A;  3CCE A;  4LFC L;  1UEB A;  2K5N A;  5C0X G;  3KLW A;  3HOX G;  4GKJ Q;  3L7Z C;  1EUJ A;  2UUB Q;  1Q7Y C;  3CC4 A;  4NXM Q;  3KJO A;  3JAM i;  3ER0 A;  2GVA A;  2R7Z H;  4POF A;  4PZ8 A;  4NXN L;  5IE8 A;  4JI3 L;  3ULP A;  3T1H L;  1A62 A;  2I5L X;  2LXJ A;  3W1B A;  4GOP A;  4A3G G;  2UXB L;  1YHQ A;  2YU9 H;  4R4Q A;  1K83 H;  4A93 H;  1L2F A;  3HOX H;  1I3Q H;  1LYL A;  1AE2 A;  2PQA B;  3B6Y A;  4EX5 A;  3CCJ A;  5C3E H;  4A75 A;  4B3S L;  4BY1 G;  1VQG A;  3HOW H;  4JCV E;  1V43 A;  3UDI A;  4A3K G;  1GM5 A;  4PZ7 A;  4LFB L;  4JI3 Q;  1V9P A;  3PIP A;  3NEN A;  3PIO A;  3LGJ A;  1G29 1;  3U50 C;  2EQS A;  4BBS G;  4DK6 C;  1VQD A;  3NEM A;  1XPU A;  4NXM L;  4OWW B;  2Y0S G;  5K36 G;  3PO2 H;  4DR4 L;  5LMN L;  3CPW A;  1FJG L;  5JEA J;  3AYH B;  1HR0 W;  1V1Q A;  1B7Y B;  3HKZ E;  4A3M G;  4B3S Q;  4GN4 B;  4AIM A;  2ZJR A;  3RLF A;  3RLN A;  1QZG A;  3S2D H;  4A93 G;  1QVC A;  3AFQ A;  4LFB Q;  1Q86 C;  2DGY A;  4BBR G;  1CKO A;  4HJ5 A;  1KRS A;  1PH4 A;  1Q1B A;  2N3S A;  3PF4 A;  4IPC A;  5C4J H;  5IWA L;  1IXR A;  4RMF A;  3S2H H;  4GLV B;  2PI2 E;  1HZA A;  4AYB G;  1PYB A;  1WFQ A;  5IYB H;  3CAM A;  2R92 H;  5JJL A;  4R4O A;  3M3Y H;  4Y52 H;  3U4Z A;  3GTP H;  5LMN Q;  1VQ5 A;  3I4M G;  4DR3 L;  3H0G H;  4A3F G;  1YHB A;  3ULJ A;  4JV5 Q;  4X62 Q;  4DV2 L;  5IP9 G;  3KJP A;  4JI1 Q;  4DUZ Q;  4X65 L;  2FXQ A;  2E5L L;  3GTM H;  1L0W A;  3KOJ A;  1KAW A;  2N8N A;  4LFA Q;  1SN8 A;  5IYB G;  2IX1 A;  3HOZ G;  4X64 L;  2YYZ A;  4DR2 Q;  5IWA Q;  2R92 G;  4L5S A;  5H1S E;  4JV5 L;  2B63 H;  4DUZ L;  1KRT A;  1KC8 C;  3GTG H;  3I7F A;  2WAQ E;  1VQ4 A;  3D0F A;  3W1G A;  1S72 A;  1CSQ A;  3PO3 H;  3E0E A;  2BH2 A;  4X66 Q;  4A3M H;  1E1O A;  3BJU A;  2HHH Q;  4GKJ L;  3TS0 A;  1YIT A;  2AKW B;  4QJF A;  3GD7 A;  4DV7 Q;  2KCT A;  3PSI A;  4DR5 Q;  4FDB A;  3CME A;  1GVP A;  3F8T A;  5GQO A;  4L5Q A;  4PMW A;  4LFA L;  3CC2 A;  2D0P A;  3M4P A;  1VQJ A;  4UPA A;  4K0K Q;  1K8A C;  1G6P A;  1NY4 A;  3J7A 5;  1OXS C;  4BY7 H;  1X65 A;  4UP7 A;  4DR2 L;  1JJ2 A;  3TEH B;  2AWN A;  4X66 L;  4HJA A;  4ALP A;  2VUM H;  4KHP Q;  2PQA A;  4LUZ A;  3EN2 A;  1KXL A;  1BBW A;  5M5Y H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...