2HHHL

Crystal structure of kasugamycin bound to the 30s ribosomal subunit
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
publication title The antibiotic kasugamycin mimics mRNA nucleotides to destabilize tRNA binding and inhibit canonical translation initiation.
pubmed doi rcsb
total genus 13
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2006-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2hhhL00
3U58A 1KL9A 4LFAL 2UUCL 1H95A 1X65A 4J15A 5LMNQ 4JBJA 1PA6A 1N36Q 3F2BA 1KRSA 1YHAA 4AQYQ 4JV5Q 2PNHA 1XMOQ 1M1KC 4IFDG 2UUBQ 3UDGA 3KF8B 1VQ7A 3CC4A 3RLFA 4DK6C 2F4VL 2DUDA 3KOJA 3TEHB 3I4NH 3BU2A 2ZM6L 3GD7A 4L5RC 5M3FG 4DV5Q 1PH4A 4LF5L 2ASBA 2UU9Q 4JCVE 3I7FA 4GNXA 4BXXG 1PH7A 2MNAA 4JYAQ 3HOWH 2UXCQ 4JI4L 4RMFA 1UE1A 3A0JA 4NPSA 5H1SE 3CCQA 4GKKQ 4NXML 1GKHA 1XNRQ 3HOZG 1WCMG 1IBLL 3GTQH 3UDFA 4IPCA 2WB1E 4LFCQ 2VUMG 1C0AA 2ZTCA 1Q81C 2VNUD 1N33Q 1VQOA 2NZOA 1HNWQ 1I5FA 2RHSB 3GTOH 4FDBA 1S3OA 4NB3A 4ME3A 4DV7Q 1BBWA 1BBUA 5IY0A 3W1BA 3I55A 1N36L 2YU9H 3M4OH 2JA7G 3K0XA 2WB1G 3J81i 4JG2A 2NVYH 3U4ZA 1HNXQ 1P8LA 2ES2A 4B3RQ 1NE3A 4X62Q 1VQIA 1S72A 2Q2UA 3KDFB 4DR4L 4R4OA 1LYLA 3RLNA 1IYJB 2UXBQ 1Q12A 3CAMA 4P73A 4LF6Q 4EX5A 2ZJQA 1X55A 2I5LX 3A5ZB 3KLWA 4DV5L 4HIDA 4GOPA 4QL5A 1Q1BA 2F3IA 5GROA 4OXPA 2UU9L 4JYAL 5IE8A 2KHJA 2N49A 2CWPA 2K5HA 3ULLA 3EIVA 1PH9A 5GAEC 3PSIA 3TS2A 4GKJQ 4YWLA 4GKKL 1YBYA 1LTLA 1NMGA 3H0GH 3E0EA 4IJLA 4DPGA 2ZJPA 2OTLA 2EXDA 5C44G 4K0KQ 3NELA 4LFCL 3D31A 1IBKQ 3A5UA 3F2CA 2E2HH 1N33L 1MKHA 4UY8C 5M5XH 5M3MG 4DV7L 3CCEA 1VQ6A 1VQHA 1K73C 1EWIA 4DNIA 2ZJRA 1HNXL 1GVPA 2EQSA 4JI8Q 2VW9A 4X62L 3RLOA 3CCLA 5IYDH 2NVTH 2ALYB 1GO3E 1MIUA 3CP0A 3G71A 4DV4Q 1VQ9A 3KFUA 4X64Q 2UXBL 4LF6L 2GVBA 3D0FA 2NN6G 4AH6A 4DK3C 1K9MC 2R7ZG 1D7QA 4X66Q 4BY7G 1KAWA 3M4QA 4A3FG 4LF8L 4A3BG 4IJHA 3E9IA 2JEBI 1KD1C 2H5XA 4A3CG 4GNXB 1IBMQ 2A8VA 3ER0A 1K8AC 3NENA 3CCMA 1VQMA 1KIXA 3RZOH 5LMUQ 4MNOA 2N8NA 2UUAQ 2NVQH 4GKJL 2Z6KA 1YVCA 2Y0SG 2YV5A 1E1TA 4XIGS 4K0KL 4HJ9A 4YCUA 1QZGA 1Y1VG 2N78A 3I56A 1S40A 2BH2A 2IX1A 1E1OA 4PZ7A 4A4IA 2UXDL 4OO1I 1OTCA 3HOUH 4LFAQ 3G6EA 1VQLA 2UUCQ 2K50A 3HOVG 3HOXG 5GAHC 1HJPA 4A3IH 4LF9L 5FLMH 1L1OC 2D62A 3M9BA 3KDFA 4DR3L 4POGA 3S2DH 4GN3B 1YJ9A 2VY3A 2F4VQ 4H02A 5JEAJ 3DM3A 4AYBG 3PIPA 3I2ZA 4KHZA 4X66L 2ZM6Q 4UPAA 4Y7NH 4A3MH 4QQBX 4LF5Q 3TREA 2QEXA 1OXSC 3FP9A 1XPOA 1UWVA 2R93G 4JI4Q 1EFWA 2ID0A 4DV3L 1NJIC 4JBKA 3HOYH 1FVIA 4LFBL 3GO5A 3PUWA 2E2JH 3S17H 1K0RA 5C3EH 1VQ4A 4MTNA 1W2BA 4DR6Q 1PYSB 3L7ZC 1IBLQ 3CMEA 1UE7A 4JI7Q 4PMWA 4B3MQ 2RF4A 1X56A 3CPWA 5IP7G 1VQ8A 3CCSA 1HZ9A 1IL2A 3PO2H 2OQ0A 4KI0A 1YJNA 3G4SA 5C4JH 1OXTA 2LSSA 1XMQL 4LWCA 3JAMi 2VL6A 4DR4Q 2XGTA 2JE6I 3RN2A 2IX0A 3ICEA 3H3VI 1C9OA 2I5MX 1V43A 4POFA 4HJ8A 3S2HH 4OWTB 3DLLA 1QVFA 3WWVA 2B63H 1EQQA 1JT8A 4DUYL 4QJFA 4JOIA 3I4NG 2AWNA 2GN5A 3ULPA 1VQEA 3S15H 2KBNA 4GLVB 2YYZA 1JJ2A 4DR1Q 4LF7Q 1FL0A 1TXYA 3E9HA 1HZBA 1SN8A 3TRZA 1WJJA 3M7NA 3AFPA 2PI2A 4BY1H 3HOWG 1WOCA 3S1NH 1E7ZA 4A93G 3J81j 1U5KA 4P75A 4RG1A 2VQEQ 4DR6L 1N8RC 3F2DA 3PV0A 1YI2A 1L2FA 2IT1A 4JI7L 3OW2A 3CCUA 1PH5A 3AYHB 1VQGA 4B3ML 1M90C 3J7A5 3GTMH 4BBSH 4C3IH 2AWOA 1HH2P 3GTJH 4QIWE 4DAMA 4LW1A 4HJAA 3M3YH 2K14A 4IFDI 1SROA 3AFQA 2Q2IA 4A3EH 4KLKA 3J80i 3PUVA 2JA5H 3KJPA 1K3RA 2K75A 3F8TA 1UEBA 1XNQL 3I4MH 3GDEA 1KHIA 3RNUA 1GD7A 1CSPA 1HZAA 4A3KH 3T1HL 4IFDJ 5FLXc 3A74A 2IHFA 5IWAL 5JJLA 2VUMH 1HZCA 4GNXC 2E2IH 4HIKA 4LF8Q 4DR1L 3HFZB 4LF7L 1N32L 4IOAA 1EQRA 1Y14B 2CKZB 4L5QA 1G51A 4DKAC 4YCVA 4A3GG 1KXLA 4NXNL 2VQEL 2OQKA 4QGUA 1D8LA 1Y1WH 1XJVA 1N9WA 2GVAA 1PH2A 2Z0SA 3S14H 3H0GG 1OXXK 3PCOB 4A3DH 2A19A 5IP9H 5J3BA 1YITA 3PIOA 3RZDH 1VQ5A 3I4OA 4R4IA 2UXDQ 4A3LH 3BZKA 2N3SA 3MXNB 1X9NA 1P16A 3PGZA 1NY4A 3UE0A 3W1GA 3ZJYC 1YJWA 4R4CA 3UDXA 3AEVA 2LXKA 4LF9Q 1SLJA 4DV1Q 1IXRA 2HT1A 2WFWA 4B3TL 5FJ8H 4DR3Q 4GN5A 1PVOA 3KF6B 2OCEA 3ULJA 4GS3A 4IOCA 4GOPC 1EIYB 4WJ3M 1VQFA 2Y0SE 1FJGQ 2A1AA 2VS1A 2R92G 1L0WA 3K81C 5C4XH 4UP9A 5DLQE 3BJUA 4P71A 3OTOL 3HKSA 2L15A 3PO3H 2OWOA 3HKZE 4DV3Q 1NMFA 2JJQA 1YHQA 5IYCH 3CXCA 4LFBQ 3CC2A 4LUZA 4A3JH 1MJEA 4ALPA 3PF5A 2LXJA 2XTIA 4YWKA 5JJIA 1V9PA 3HKZG 1B70B 3CQZH 4BY7H 1I3QH 1PH8A 5GAGC 2BH8A 4DR2L 1JB7A 5C0XG 4LNQA 3HOUG 4AYBE 2JEAI 1RIPA 4DAYB 1J5EQ 1TWHH 4LUVA 5GADC 4X6AH 4JBWA 4DV1L 2AKWB 2FXQA 3L0OA 1KRTA 2KCMA 5GQOA 4IO9A 4A3IG 1YIJA 1X6OA 3RR5A 2QA4A 1XMQQ 4JBMA 4HIOA 3FKIG 1TWCH 2NN6I 1YHBA 2ZTDA 1FJGL 3VDYA 2JA8H 2K4KA 1IZ6A 2EIFA 4DUYQ 4IPHA 1G291 1I50H 5E7NA 4JI1L 4DV2Q 2R7DA 2BA1A 3TQYA 3S1MH 3KYHC 2Z6KC 4O2DA 1I94Q 3HOVH 3AQQA 5IYBH 1UE5A 3PUZA 3S24A 5M5WH 4BBRH 1N34Q 1QZHA 3HOYG 1DGSA 1PH3A 2IHEA 3RN5A 2YTYA 1YZ6A 3LGJA 5C3EG 5BR8L 2JA6H 2YTVA 4PG3A 3CMAA 3H3VH 1YEZA 1Q1EA 3F1ZA 1OXUA 5C0XI 1RL2A 1V1QA 3EN2A 3S1QH 2CWAA 1J5EL 4A75A 4DV0Q 4LF4Q 3K7UC 3PO2G 1JMCA 1CKMA 2Q2TA 2JK8A 3KJOA 1E24A 2HHHL 5K36G 4JI0L 1XNQQ 2R6GA 1X3EA 3IRBA 2E5LL 4JI6L 1PFSA 3KF6A 3K80C 3Q8DA 1KC8C 3T1HQ 1MJCA 5IWAQ 3ERSX 4TVAB 4X65L 4IPGA 5AJ3Q 4OWWB 4P74A 5HY6A 2B3GA 4DV2L 4O0AA 1N32Q 2YTXA 3T1YL 1B8AA 2HQLA 2JA9A 2Q2HA 2KENA 4IPDA 4JC0A 1I94L 2CCZA 4OX9Q 4L5TA 1PHJA 1JJGA 4DR7L 1NTGA 4BA1I 4NXNQ 2K5NA 1CKNB 4BY1G 1N34L 1VCIA 2PQAA 3NEMA 1R9TH 1HNZL 3B6YA 4BA2I 2MQHA 4MZ9A 1Q86C 1L1OB 4R4QA 3CPFA 2WAQE 4HJ5A 4YY3L 4BBSG 5M3FH 1KQSA 2MO1A 4DV0L 4LF4L 1X54A 4BXXH 1JJCB 1JE5A 1CUKA 4A3EG 2WAQG 2JA5G 1XPRA 4A93H 2WP8J 1AE2A 4YHHL 1HR0Q 4B3TQ 2C35B 3I4MG 3HOZH 4JOIC 5IT9c 1WCMH 4C3HH 4LUOA 4DR5Q 4A3KG 5AJ3L 1NBWA 4OONA 1VQJA 4PZ8A 4JI5L 1FGUA 2OTJA 3M85A 3J81c 3STBD 3J80c 4B3SL 3SGIA 2BA0A 4R1JA 1W3SA 2I5HA 1CKOA 3OTOQ 2NVXH 4OX9L 5ELOA 2JA7H 2RCNA 1T9HA 3U50C 5LMNL 3G48A 4AQYL 4JV5L 1XMOL 1Y1WG 1Q82C 2UUBL 3CD6A 1SR3A 3EBEA 5HGQA 1Q8KA 1VQCA 2VQFQ 4A3DG 3CW2C 5IP9G 3PF4A 4QY7A 1E22A 1AE3A 1CSQA 3J7ZC 4DR2Q 1B7YB 4C2MH 2B29A 2KCTA 3H15A 3GTGH 4A3LG 1X3FA 1AH9A 1LUZA 4JI2Q 4YCWA 1PH1A 2UXCL 4A3GH 1I6HH 3S1RH 4KHPQ 2ZTEA 1BVSA 5IYDG 1A8VA 2MO0A 1HR0L 4GLAC 3K7AH 2IY5B 2F52A 2V1CC 5C44H 4OWXB 5FJ8G 1X3GA 4DR5L 1XNRL 1UE6A 3CCJA 1K83H 3UDIA 1QVGA 2K52A 2NZHA 1XTDA 1SRUA 2HIVA 4UP8A 4A76A 3JC66 1QUQB 3UE1A 5M3MH 1WI5A 4JI1Q 1HNWL 2PMZE 5C4XG 1SMXA 4OO1G 1PH6A 2KHIA 2VZAA 3PO3G 1A0IA 4JI3Q 1VQBA 2DGYA 3CCVA 4HJ7A 3GTLH 4B3RL 1CKNA 2PQAB 1EYGA 3S16H 2HIXA 4GN4B 5JEAG 5IYCG 1OXVA 3FHWA 1C7YA 4R4TA 4C3JH 1VQAA 4A3JG 2VQFL 1VQKA 1TWFH 2I0QA 5BR8Q 1L1OA 4L5SA 1A63A 1SE8A 5LMNW 2R7ZH 2D0OA 2D0PA 3CCRA 4A3FH 1U0LA 2PI2E 1ASZA 2RHQB 2R92H 4A3BH 4A3CH 2AMCB 4PZ6A 4JI2L 2ATWA 5EAYA 4GLXA 1PV4A 3PUYA 2R7FA 1K8GA 1VQDA 2HHHQ 5FLMG 1EUJA 4AIMA 1Q7YC 4JI0Q 4WJ4A 4DUZQ 4DV6Q 1BKBA 3TS0A 4JI6Q 2E5LQ 1PYBA 1Y1VH 3CF5A 2QGQA 1E3PA 4TQUS 3NBHB 4EQ5A 4X65Q 3GTPH 1IBKL 2E8GA 4YWMA 2JA8G 2MFIA 3PUXA 1HR0W 4A3MG 4APVA 1A62A 3T1YQ 2K5VA 1YNXA 1Q46A 3HOXH 4JI3L 1Z47A 1VQNA 4DR7Q 1TWAH 4JI8L 2AHOB 5M5YH 5IYBG 1HNZQ 1O7IA 1WFQA 4BBRG 3FKIH 4DV4L 1WYDA 1SFOH 4KHPL 4Y52H 1VQPA 4X64L 4P72A 5JJKA 2JA6G 3W5OA 2CFMA 3GTKH 1VS0A 4XTCS 1EOVA 1XPUA 4YY3Q 1GM5A 4GOPB 1TWGH 1IBML 3L2PA 2R93H 3OYYA 1Z9FA 3BZCA 3MEFA 5LMUL 5C0XJ 4DUZL 4DV6L 4HIMA 2UUAL 1LM0A 4YHHQ 1EIFA 1J6QA 2JQOA 3K8AA 1ASYA 3M4PA 5ELNA 2B63G 4NXMQ 2CQOA 1QVCA 3CC7A 4JI5Q 4UP7A 1QUQA 1G6PA 5IP7H 4B3SQ 3JAMc 3U4VA 3STBC
chains in the Genus database with same CATH superfamily
4LFAL 3HOWB 3A7AB 4A93B 1PA6A 1NR2A 1O7ZA 3U9OA 1KRSA 1M1KC 4XXEA 2J4XA 5EQ0A 2UUBQ 5BN3A 3KF8B 2I46A 5J22A 4KD3A 4RGOS 1CFMA 2F4VL 1G6ZA 2NVXB 1U9RA 3BU2A 2ZM6L 3GD7A 4L5RC 1PZJD 3VA7A 4DV5Q 4LF5L 1C48A 5EGTA 2SNSA 5E4XA 3OW7A 1UE1A 3A0JA 1RCVD 3CCQA 1F9RA 4GKKQ 4NXML 1GKHA 3I91A 1K3BC 3NBHA 5E1FA 3VYTA 3EA6A 4DNRB 4B9XA 1YNND 2I07B 1HNWQ 3M7GA 3GTOH 4NB3A 1I6HB 4DV7Q 2WINB 2IX3A 2YU9H 1N36L 5CV9A 3M4OH 1EL0A 2WB1G 3H0GB 2WV6D 4DR4L 3G6JB 1EYAA 3RLNA 5EKIA 1WTRA 1ILQA 3CAMA 2ZJQA 4X3UA 1X55A 1Q1BA 2EYJA 5CC4A 2RDFA 4OXPA 2UU9L 1EY8A 4JYAL 2K5DA 2KHJA 5IT9E 3ULLA 2NVTB 3TS2A 1FNVA 2F0JA 5CMDA 2OTLA 4X3TA 1B9NA 5C44G 2R92B 3D31A 1IBKQ 4RGNA 1N33L 4UY8C 1HQRD 4FO2A 2F3VA 1IW7C 3CCEA 3E3XA 2CW0C 1HNXL 3DWAA 4JI8Q 3D6WA 2ALYB 3EROA 3MFGA 1SSOA 4XT1B 2GVBA 4DK3C 2NN6G 5ELBA 4AH6A 1FR3A 4BY7G 3M4QA 1TWAB 1JOKA 1JR0D 3A8KE 2ZXOA 2BCOA 2DN8A 1JC7A 2EVBA 2MUYA 2JSOA 2NVQH 1Y69U 2Y0SG 1E1TA 5JEAH 1U4RA 1Y1VG 2N78A 2BH2A 3N6RA 5EJWA 1HA5A 4CDCC 4Y7NB 4NKLA 1TS4A 4IUTA 4EGVA 5C0XH 1B53A 2SNMA 3HOUH 2K50A 3HOYB 4WJWA 1Z7TA 2PPBC 3M9BA 4LJZC 1NNXA 4POGA 1S5CD 5G3LD 2VY3A 4H02A 5JEAJ 4AYBG 4XYQA 4DXGA 2V4DA 4HSVA 1OXSC 2XRQD 4JI4Q 4FXKC 4K2LA 2ID0A 2L5TA 4DV3L 5FOBB 2RKSA 3S2HB 1VQ4A 1TS2A 1EYDA 5C3EH 4EVOA 3L7ZC 5AFWA 3CMEA 1PTOB 1UE7A 4JI7Q 2RF4A 3VR4A 3PO2H 1HZ9A 2B8GA 1BR9A 3S1NB 2OQ0A 2F0PA 5C4JH 1EY0A 1EEFD 3LX0A 2XGTA 2BOSA 3RN2A 4FVMA 4XQJA 2I5MX 3EVQA 4HJ8A 3GTMB 3PIO3 4OWTB 1JT8A 5C4ZA 1SNOA 4JOIA 4OIKA 2K6AA 1PDQA 1VQEA 4GLVB 4G4KA 2YYZA 3TP5A 4DR1Q 4LF7Q 2WAQB 1F2YA 1SN8A 3I4MB 3UI2A 5EBCA 1MBYA 4ILWA 3MXUA 2IT1A 4B3ML 1VQGA 1BF4A 1F9PA 4BBSH 2AWOA 1HH2P 3GTJH 4QIWE 4FF4A 1AW7A 3K59A 4IALA 4DAYA 5A2QE 4KLKA 3KJPA 2BE5D 1K3RA 2K75A 3F8TA 1XNQL 3GDEA 1H9SB 1CSPA 3NPPA 2RDHA 4A3KH 2IHFA 5IWAL 1ENCA 5JJLA 5FO9B 2D5DA 1SDFA 4ZLTF 1Y14B 5D65A 3FPPA 1WTHA 1E2ZA 4RCOA 4IURA 1Y1WH 4RWSC 2Z0SA 5TSSA 3S14H 1HFNA 1OXXK 4A3DH 3PIOA 5CV4A 4R4IA 2E74C 4HCEA 2UXDQ 4PMCA 1X9NA 3PGZA 1NY4A 1QWYA 3UDXA 2HT1A 2NYZD 2WFWA 4C3JG 2OCEA 4GS3A 1EIYB 2NTTA 5IT9L 1FJGQ 3O13A 1AZQA 1L0WA 3H6MA 3DUZA 2RDGA 5C4XH 2LS01 3CRKC 4G7HC 3PO3H 2EY2A 2JJQA 1KNAA 1MJEA 3E5SA 1BQQT 2NUCA 1IL8A 1V9PA 2B2YA 2VB3X 3S1MB 4DR2L 5C0XG 4OELB 3HOUG 1AFPA 1TWHH 1B3AA 3OIPA 5GADC 1KRTA 1R4QB 1X6OA 1TWCH 1DONA 2ZTDA 2K4KA 4HSPA 1I50H 3KYHC 1UE5A 3S24A 2EDGA 1N34Q 2PO4A 1WTPA 3RN5A 5C3EG 2JA6H 5BR8L 2YTVA 4PG3A 4QUFA 1EY4A 1YEZA 3ITPA 1OXUA 1V1QA 1HPCA 3TZUA 3HS0C 4A75A 1J5EL 4LF4Q 3PO2G 3WOFA 2EXZA 2XIWA 3KJOA 1PRTC 3A7LA 1R9TB 1CI3M 2R6GA 5JPNC 3IRBA 2A6ED 4QB4A 1KC8C 4X3KA 4X65L 2R61A 3IFTA 1BXTA 4P74A 5HY6A 2PCFB 4FXDA 3S9WA 2CQAA 3TN2A 4PMBA 1RTOA 2JA9A 1PTOF 2X69A 2CCZA 4L5TA 1PHJA 4CJ1B 1NTGA 2JXMB 3NEMA 5CV5A 1ENAA 1U4PA 3B6YA 4BA2I 3SK6A 1Z6HA 4MZ9A 1L1OB 4R4QA 3IAYA 3R2TA 2WAQE 1EQTA 2EYHA 4HJ5A 4BBSG 1KQSA 2WB1B 1JE5A 4KK7A 3OPOA 1SE3A 1SJHD 5E4WC 4J8QA 4YHHL 2C35B 3K6OA 3HOZH 4JOIC 1WCMH 4RGTA 1BCPB 4A3KG 3HRZC 1NBWA 4HMIA 1VQJA 4OONA 4PZ8A 1FGUA 3GTGB 3J81c 2FFKB 5DAUA 4QCLA 3S1RB 2QCPX 2RCNA 3C2PA 2DNEA 5C44B 1Y1WG 5EKLA 3CD6A 5HGQA 1PLFA 5I9OA 4A3DG 3SHLA 1SMYC 2Z4IA 1Y8PB 5A2QL 5FK9C 2K32A 1GUGA 4R8NA 2KCTA 4ABNA 4J6HA 4JI2Q 4YCWA 2UXCL 4KHPQ 2ZTEA 5FLXE 3TP6A 5IYDG 4FF1A 2MO0A 5IGEA 1TWFB 5KYLA 1EIHA 1XNRL 3R2IA 1K83H 4XQNA 4BY7B 1QVGA 2NZHA 1SNPA 3JC66 1QUQB 4KV6A 1WI5A 5C4XG 2SDFA 3M4YA 1SMXA 5DNFA 1PH6A 2F0QA 4KN7C 1O7LA 3PO3G 2Y0SB 4JI3Q 2NZ1D 4B3RL 1Y1VB 2F3WA 1KDAA 3GTPB 3KF8A 2I0QA 4HCSA 5LMNW 2L1BA 3P20A 4A3FH 2PI2E 1F2ZA 2FJ2A 5CBEE 4Z9CB 1KABA 4GLXA 1PV4A 4F8MA 3PUYA 4B9WA 5FLMG 4KKTA 3NQIA 3J7AV 4AYBB 1WTWA 3GTKB 2QGQA 4YWMA 2MFIA 1HR0W 1QB5D 1IW7D 4LMQD 4APVA 2CW0D 3T1YQ 2K5VA 1HUMA 1VQNA 4DR7Q 3D8GA 1HNZQ 4Y52H 3FKIH 2B2YC 4X64L 2JA6G 1F9QA 1EOVA 4IZ8A 1TWGH 1AZPA 2OXPA 1GUSA 2R93H 5LMUL 1C4QA 4ZCKA 5IGDA 3HG9A 1FGBD 1I4XA 1V1PB 4NXMQ 2NWGA 2CQOA 5COYA 4JI5Q 2RBMA 3K57A 1WVLA 4B3SQ 3JAMc 2FMCA 3STBC 3RUZA 1X65A 4J15A 1BUVT 4JVZA 4JBJA 5EKKA 5LMNQ 3F2BA 1N36Q 4AQYQ 4JV5Q 2PNHA 1XMOQ 5ELFA 4K5XA 4DK6C 2AQ1B 1EYCA 2J0TD 3R93A 1XYIA 3I4NH 1JWUD 3GTOB 2HDMA 2YU9B 2UU9Q 3I7FA 4JYAQ 1IHZA 1PH7A 2EY1A 1KAAA 1LT3D 4RMFA 2IJ0A 2K5QA 3TP7A 3F2UA 3HOZG 4J1MA 1WCMG 3GV3A 3GTQH 1XXGA 1H9JA 2WB1E 4UDUC 4BWGB 1X3PA 3NTIA 1N33Q 2H4OA 2JYOA 4FDBA 4ID6A 4ME3A 3ONAB 3K0XA 3J81i 1HNXQ 1KDBA 2NVYH 1P8LA 5IGCA 3P7JA 1S72A 1ONLA 3NWSA 1FNWA 5I2YA 1Q12A 3A5ZB 4GOPA 4QL5A 1EWHA 2A5HA 4DA2A 1BCPF 2G9DA 1I4HA 3S16B 1RKNA 2N49A 2K5HA 3EIVA 4C3JB 2KQ3A 3PSIA 1YBYA 2JN4A 4IJLA 3OMGA 3NELA 4LFCL 1ICFB 3A5UA 3F2CA 4XQQA 2E2HH 5CV6A 3NSWA 4HMJA 3MWYW 1C8CA 1VQHA 1K73C 1F2MA 5ELDA 4HEDA 3TP8A 2NVQB 1PFMA 4IQZA 4X62L 4I65A 3SVMA 3G71A 3T16A 1VQ9A 3KFUA 1EEID 1T5XD 2DNCA 4LF6L 5M9OA 4F87A 3HOUB 5NUCA 5FLXL 4A3FG 4LF8L 1RD9D 3E9IA 2JEBI 3H94A 4GNXB 1HFGA 2A8VA 4DU9A 3ND8A 4N8X1 3RZOH 4O1NA 4NMZA 2UUAQ 3AU7A 2Q8RE 1YVCA 4KKUA 4XYOA 4HJ9A 3BDCA 4X3SA 4HTHA 2F0GA 5IGBA 2CHBD 1ML0D 4OO1I 3MHBA 2UUCQ 3V05A 1HJPA 1ENFA 1SJED 5C3EB 3KDFA 1SNCA 4DR3L 3S2DH 5I4DA 4GN3B 1H9SA 3CHBD 3I2ZA 4KHZA 3MEHA 3P1HA 3PO2B 1ILPA 4A3MH 5C4JB 2ICIA 2K5WA 3HP3A 3FP9A 2QEXA 1XPOA 2RCFA 2R93G 1EFWA 3K5NA 1R4PB 1NJIC 1W2BA 3T13A 1IBLQ 3E6ZX 4PMWA 4B3MQ 2MGSA 1FYCA 1CHQD 1CZWA 2C5CA 1IL2A 3A54A 1YJNA 5K36H 3QWNA 4WRDA 2LSSA 2G5DA 3JAMi 2VL6A 5G3LF 2IX0A 3ICEA 1V43A 4BBSB 3DLLA 1D1KA 3VYSA 1QVFA 4M8AA 1EQQA 3GTJB 1CTMA 4DUYL 2B63H 1DOMA 3I4NG 3I4LA 5ELEA 1HZBA 1ZXTA 3FDTA 3TRZA 1WJJA 2PI2A 2WKCA 4BY1H 5FO7B 4A3KB 4RG1A 4DR6L 1N8RC 2PZUA 3U9SA 3LWEA 1TKWB 1UEAB 1PFBA 1LV9A 2IPKD 2Z1CA 1K8OA 3T4AC 1SE4A 4HJAA 1GHJA 2K14A 1PRTD 3J80i 1SAPA 2P5ZX 1Y1WB 3T51B 2Q8TA 1AN8A 3V2TA 4A3DB 2IL8A 3T1HL 3N52A 4IFDJ 3H09A 2VUMH 1HZCA 1S5ED 4C1NK 4HIKA 5CGKA 1EQRA 1PMRA 4WFN3 4A3GG 1CM9A 2CH4A 4NXNL 2VQEL 1A3UA 2IW3A 1N9WA 2R3ZA 1GUWA 3PCOB 1ET6A 3RZDH 5C4XB 2H1EA 1SYBA 3PO3B 1UAPA 4IUPA 1YJWA 1KTKA 2LXKA 2F1MA 4CBVA 4LF9Q 2EY5A 1D5ZC 4B3TL 2X6GA 1PFNA 2NB0A 3KF6B 3ULJA 4GOPC 2VXWA 1VQFA 2A1AA 4FP5D 1JWMD 4UP9A 1TWHB 3OTOL 4OO1H 2RA4A 3HKSA 2OWOA 1QCBD 1TWCB 1NMFA 1ET9A 4LFBQ 4YIJA 1PTOC 4BS9A 4K14A 1SMYD 1I50B 1TS3A 1E0BA 3HKZG 3CQZH 1PH8A 1JB7A 2BH8A 1SYEA 1J5EQ 3BVZA 4LUVA 1D1IA 1YIJA 5GQOA 1V8QA 1XMQQ 4HIOA 2JA6B 2CVRA 2A68C 2JA8H 3VDYA 4IPHA 1U4LA 1YNJD 2L12A 4O2DA 4CHTB 2XNAC 3HOVH 4NDXA 3PUZA 5D3DA 2F0EA 1CK1A 1DGSA 2IHEA 2YTYA 3DWQA 4F88A 1A3TA 1O78A 1Q1EA 3F1ZA 1RL2A 3MXNA 3S1QH 1XWEA 5K36G 1LTRD 2HHHL 3FRPB 4JI0L 1CT1D 1X3EA 4JI6L 1PFSA 3Q8DA 4C3IB 2K28A 3CKIB 3K5LA 2XRSD 4DV2L 2K1BA 4O0AA 1N32Q 4JC0A 1I94L 1RTNA 3TBIB 1JJGA 4BA1I 5JAVA 2K5NA 4BY1G 3HOZB 1K28A 1WCMB 2BDOA 3IL8A 1HCZA 5K5PA 2N88A 2E2IB 4OL7A 3CPFA 2EJFC 5M3FH 2F0VA 4ME5A 4DV0L 2MHVA 4KHVA 3BDOA 4A93H 3EFXD 5IT9c 1EU4A 4C3HH 3NE5B 2PQEA 2OTJA 2O2LD 3STBD 3SGIA 1DJRD 4R1JA 2NVXH 2JA7H 3U50C 4ZYSA 1JOOA 1I4RA 4XDXA 5ELCA 1K83B 2UUBL 1NR4A 3VA5A 5LL6S 2E76C 3CW2C 3PF4A 2OEOA 4QY7A 3A8IE 3C1EA 1AE3A 1VDZA 1CSQA 4KMUC 5IGGA 4C2MH 2B29A 3FVQA 3H15A 1AH9A 3OOCA 4K8IA 1I6HH 5IGFA 3MTSA 5IOCA 4GLAC 3I70A 5DM63 3K7AH 2F52A 1HQMC 2LY7A 4OWXB 1X3GA 4DR5L 1U4MA 1UE6A 3CCJA 3UDIA 1MI2A 4A3FB 2K52A 4JI1Q 1EU3A 1HNWL 4H7BA 4OO1G 2KHIA 3GTLH 2DJGC 3CRLC 1CKNA 4IN3A 1EYGA 4U673 5JEAG 1OXVA 3FHWA 1NAPA 2VQFL 2XWJB 1SE8A 1LTSD 2ENBA 2D0OA 2PW7A 2R92H 4A3BH 4A3CH 3X3NA 2J7ZA 1DXMA 3OWFA 1AP0A 5J39A 4TRDA 4WJ4A 4AIMA 5A35A 1EZ8A 3TS0A 3FPUB 2E5LQ 3G7LA 4LK1C 3NBHB 1IBKL 2E8GA 1TWGB 2JA8G 4R8IA 3PUXA 2FINB 2R93B 3SR1A 2HCIA 1Q46A 4FXGC 3HOXH 1TWAH 4JI8L 1LTGD 2AHOB 2QDBA 4IUQA 5M5YH 1O7IA 1WFQA 1SFOH 3QOLA 4LAAA 1VQPA 3KBGA 1VS0A 4XTCS 4YY3Q 3L2PA 1JOQA 1MD2D 4DUZL 4DV6L 1BCPC 1J6QA 4WORA 3FMCA 2A69C 4K5VA 3HGBA 1RJTA 3I4NB 4O42A 1G2TA 3A55A 5KNCA 2B2TA 1KL9A 3KBXA 1H95A 3TSSA 1YHAA 2RQXA 4DGZA 5KNBA 3GTQB 1VQ7A 4HN7A 5C5LA 3L3OC 2XVSA 4OHJA 2DUDA 3ERQA 1DD2A 1JE4A 1PTOH 5M3FG 1GOZA 2ZT9C 2A74C 4JCVE 4GNXA 2MNAA 4JI4L 5KNDA 2A6HC 2QF7A 4H13C 2L9HA 4C3HG 3EJIA 4LFCQ 3JAME 1Q81C 2F0IA 1VQOA 1I5FA 5CORA 1DM0B 1S3OA 4A3GB 3ND9A 1BBWA 3W1BA 4HR7B 4V190 2K01A 5KEEA 1SNDA 4N9PA 2JA7G 3W3AA 1I4PA 3OSOA 4JG2A 3U4ZA 2ES2A 4X62Q 1VQIA 5KYIA 1SNMA 4R4OA 1PRTB 3NTKA 1D5XC 1IYJB 4LF6Q 4QUCA 4EX5A 3SEBA 1HXYD 3KLWA 1F2LA 1KLUD 5IE8A 1S5DD 1PH9A 3H3VC 3VR6A 5I2XA 1LTLA 3NTHA 3E0EA 4UAIA 2EXDA 3J80E 1MKHA 2BDNA 5M5XH 3GQBA 1QE6A 3RZOB 2MJ8A 1EWIA 4DNIA 5KGUA 1YNJC 1EZ6A 1GVPA 2EQSA 2VW9A 4ZAIA 3RLOA 2HUGA 5C6AA 3CP0A 1L0YB 3NHHA 4DV4Q 1HRJA 5LHY1 2DY8A 3HKZB 2UXBL 2C9OA 3D0FA 1D7QA 1H9RA 1KAWA 4G57A 4A3BG 4A3CG 3DWPA 1IBMQ 1KIXA 3NENA 1ICWA 1VQMA 4KKSA 4MHEA 4HAEA 4MNOA 2N8NA 4GKJL 2YV5A 4ZUIA 3WOEA 1XX8A 4K0KL 4EQOA 2KEEA 1S40A 2X6LA 2IX1A 4RAUC 5EPJA 3A56A 3DMUA 4PZ7A 2UXDL 4LFAQ 3HEJA 3T53B 3HOXG 1L0XB 4A3IH 4DK1A 2L4NA 3NBIA 2F4VQ 4X66L 2ZM6Q 1DYQA 4NP5A 4UPAA 4LF5Q 1NSNS 3TREA 2WACA 2F0OA 3MAQA 1STBA 1PTOD 4JBKA 1FVIA 1LTID 3PQIA 4F7XA 3PUWA 3T56B 2E2JH 3S17H 4DR6Q 4MTNA 1PYSB 2DY7A 2KJXA 2L11A 4CDFC 4N9TA 1JQYD 3NXWA 3CCSA 1TIID 4BY1B 4KI0A 4ZK9B 1OXTA 1LTAD 1I4GA 3AMUA 4LWCA 4DR4Q 2A68D 1LT6D 1QILA 3H3VI 2AQ2B 4POFA 3C46A 2GN5A 3ULPA 2E2DC 3S15H 2KBNA 3M4OB 4RH6A 4CKCA 1V1OA 3AFPA 1WOCA 3J81j 1U5KA 2VQEQ 3F2DA 1KNEA 3PV0A 1YI2A 1LACA 3CCUA 1PH5A 2B2TC 5DEHA 3J7A5 4RKBA 2EZVA 4EQPA 3M3YH 1RODA 4CJ0B 3MXGA 4QMGA 4IFDI 4TSSA 4A3EH 3PUVA 2JA5H 1UEBA 4MTKA 1GD7A 1HZAA 1EWCA 3RZDB 3QO2A 5FLXc 3A74A 2M2LA 3A8JE 4GNXC 3IKJA 1SNQA 1Y8NB 1NCVA 1G51A 4DKAC 2LFNA 1KXLA 4QGUA 1D8LA 1XJVA 2F0NA 1PH2A 2A19A 5IP9H 2FMMA 1D2BA 3I4OA 1H9KA 3DHQA 1STHA 4A3LH 1PRTF 1P16A 1LTBD 3UE0A 2B2VA 3PMFA 3W1GA 5J1ZA 1SLJA 2PMZB 1CZGA 1G91A 1TT2A 1JCKB 4I7ZC 5FJ8H 4GN5A 1PVOA 4IOCA 1CHPD 3CQZB 4WJ3M 4JPBW 1A2TA 2Y0SE 2VS1A 4ULLA 2PYKA 1SYFA 1O80A 3IFDA 2L15A 3J80L 5CYUA 5LL6X 3HKZE 4DV3Q 1YHQA 5IYCH 3CC2A 4LUZA 4A3JH 1CQVA 4ALPA 2JA8B 2XTIA 4YWKA 5JJIA 4Q0FA 1B70B 3I90A 2F0TA 2QDLA 4BY7H 1B2TA 1I3QH 5GAGC 1K0SA 3QOJA 4RCNA 5I9PA 1K8MA 2Z8LA 4AYBE 1RIPA 2JEAI 1EY5A 4R9WA 4X6AH 3HZXA 4JBWA 4DV1L 2FXQA 2Z9HA 1SE2A 4C56C 4KHPL 4A3IG 3RR5A 4JBMA 3BYTB 3FKIG 3BYYB 1B44D 1PYWD 1YHBA 2EIFA 1G291 4DV2Q 2BA1A 2NTSA 1G8ZD 4FF3A 5JJZA 1I94Q 2ZXPA 1UNSA 3AQQA 2L0CA 5FKAC 3K5OA 5M5WH 4BBRH 1PH3A 1YZ6A 3LGJA 3CMAA 3SK5A 3H3VH 1RF2D 5C0XI 4G7ZC 2D2CC 2CWAA 1HTLD 2K03A 3K7UC 4DV0Q 1JMCA 1CKMA 2Q2TA 2JK8A 1E24A 1XNQQ 1MGSA 3X3MA 3K80C 2L55A 4DF7A 1MJCA 5IWAQ 4TVAB 5M3FB 2PW5A 3KLSX 3TZDA 2B3GA 2YTXA 3T1YL 1B8AA 2HQLA 2Q2HA 2KENA 1DOLA 5D14A 4DR7L 3SK4A 4IFDH 4C3HB 1VCIA 1RHPA 1HNZL 1JORA 5HGTA 1QG7A 1Q86C 1ZYRC 1EY6A 2ZXRA 1D5MC 2MO1A 1ZEQX 2HD3A 2JA7B 1EFID 4KTAA 1X54A 4BXXH 1JJCB 3S14B 1CUKA 2EJGC 1BCPD 2MP1A 4A3EG 4M1UB 4QIWB 5C3XA 1CA5A 2JA5G 4L6TB 2WP8J 3Q23A 1WD0A 2A69D 4CDEC 4CJ2C 4LUOA 4DR5Q 4RGMA 5AJ3L 1S5BD 4JI5L 4C2MB 3M85A 4H0LC 4B3SL 4OX9L 4ZKCB 1W3SA 2I5HA 1GXDC 3NQTA 3OMCA 5ELOA 1W6KA 2F0WA 2KCNA 5LMNL 1LLRD 3K7AB 4AQYL 4JV5L 1XMOL 5CBAE 1BOSA 1Q82C 1X3QA 3Q0AA 1VQCA 2VQFQ 4IUVA 4JK1C 5IP9G 2E75C 3D3RA 1E22A 1TU2B 4DR2Q 1B7YB 4A3LG 1J9OA 3I73A 3GTLB 4EQNA 2A6HD 2F0MA 1HR0L 2IY5B 2V1CC 5FJ8G 4A3BB 4PQXA 5C4HA 1SRUA 2HIVA 4KY5A 4UP8A 4A76A 5M3MH 2PMZE 1D6EC 4ZQ3A 1A0IA 2RSNA 5C3WA 1A15A 2PQAB 3S16H 2HIXA 5IYCG 4DNTB 4C3JH 1PZID 1VQAA 4A3JG 4L63B 1L1OA 5F2DA 5BR8Q 4FNFA 4B08A 2R7ZH 4TKOB 2D0PA 5JOBA 2B2VC 2AMCB 4K2KA 3HOXB 1WTVA 1TVXA 2ATWA 1QOHA 1QJOA 2QILA 5EAYA 2K04A 5M5YB 1K8GA 1X32A 1SFOB 1EOTA 4DUZQ 4DV6Q 1BKBA 2KHSA 1PYBA 1E3PA 4TQUS 2FHTA 3C1FA 4X65Q 5JVG3 1B3QA 4A3MG 3Q6SA 1A62A 5ISRA 3BS1A 4DN4M 4BBRG 4P72A 1M4VA 2B2WA 3I8ZA 5JJKA 3W5OA 1F9SA 2OT2A 3LNNA 4GOPB 2A73B 3OYYA 1Z9FA 1LT4D 3MEFA 2MPMA 5C0XJ 2UUAL 1VF7A 4YHHQ 1EIFA 2PZWA 2JQOA 2M00A 2SOBA 2B63G 1M8AA 2D9UA 2Z6BA 3J7AF 3CC7A 3K5MA 4UP7A 1QUQA 4ZRZA 1G6PA 5IP7H 1OO9B 3U58A 2UUCL 4P2CB 4IFDG 3UDGA 3CC4A 3RLFA 5FO8B 5KRUA 3KOJA 3TEHB 1B50A 1PH4A 2ASBA 4BXXG 3D4DA 3LWUA 3HOWH 2UXCQ 4DXFA 4NPSA 5H1SE 1HUNA 3D6CA 4KD4A 2DJFC 2PNRC 1XNRQ 1IBLL 3UDFA 4IPCA 4RHRA 2VUMG 1C0AA 2ZTCA 2KA7A 2VNUD 2NZOA 1KDCA 2RHSB 1BBUA 5IY0A 3I55A 3C3LA 3MVVA 4B3RQ 1NE3A 1LO5D 2Q2UA 3KDFB 5EPLA 1LYLA 3Q22A 1HHVA 3OWEB 2UXBQ 5M5XB 4P73A 1KLGD 2I5LX 2EE1A 4DV5L 4HIDA 2F3IA 5GROA 1IKMA 1FD7D 2PZTA 1SYDA 2CWPA 1GHKA 1RDPD 5GAEC 4GKJQ 4YWLA 4GKKL 1NMGA 3H0GH 1V1PA 4DPGA 3J81E 2ZJPA 4K0KQ 2XSCA 3PIP3 3MA2B 5M3MG 4DV7L 1VQ6A 4ODGA 2ZJRA 1A2UA 3EQLC 3W2DA 1PXUA 3CCLA 5IYDH 2NVTH 3J7YW 1GO3E 1MIUA 4X64Q 2N55A 1BNZA 2R7ZG 1K9MC 4X66Q 4IJHA 1KD1C 2H5XA 3ER0A 1K8AC 4A3IB 3CCMA 5CR3A 2EJMA 2WKDA 5LMUQ 3FKIB 1ESFA 2Z6KA 1O7YA 3SE0A 4XIGS 1QZGA 4YCUA 1SYGA 3I56A 1TS5A 3BDLA 2F0KA 1E2WA 1E1OA 2RVLA 4A4IA 5E3FA 1LT5D 4CGYB 1TQOA 3E0JA 1OTCA 3G6EA 1VQLA 3HOVG 5GAHC 4DAVA 2AUJD 4DAPA 4LF9L 2E2JB 5FLMH 1L1OC 1BO0A 2D62A 3S17B 1GJXA 3URYA 1T5EA 4FYDA 4KJOA 1YJ9A 4PNYA 2JP1A 4K8JA 1SYCA 2EY6A 3DM3A 3PIPA 3AB9A 4N8FA 2IWHA 4K6DA 4Y7NH 4QQBX 1UWVA 5EPKA 2M9VA 3NWTA 3HOYH 1Q3LA 4LFBL 3GO5A 1K0RA 1MHWC 2F0DA 1Q90A 2RSOA 3S15B 2K33A 1X56A 3CPWA 1YNNC 5IP7G 3VR2A 1VQ8A 3G4SA 2B8FA 4OGQC 4U68A 4XT3B 1WTOA 2B2WC 1XMQL 1HTPA 2JE6I 4ZKBB 1C9OA 4MIUA 4NW2A 3S2HH 3WWVA 3VR5A 3M3YB 4QJFA 1II3A 3WDNA 2AWNA 3FEWX 3NK9A 3DXJC 1JJ2A 4RHSA 3I72A 1AEXA 4GZYC 2F4IA 2NVYB 4A3EB 1FL0A 2EOTA 1TXYA 2EYMA 3E9HA 3MFYA 2JA5B 3M7NA 3HOWG 3S1NH 4A93G 1E7ZA 1Q8IA 4P75A 2O5JC 1QNUA 1L2FA 5L37A 4JI7L 3OW2A 3AYHB 3QJYA 1M90C 3GTMH 2WIIB 4C3IH 2QKIC 4DAMA 4LW1A 1SBBB 1Y8OB 2XWBB 3DEPA 1SROA 3AFQA 2Q2IA 1ZKOA 3I4MH 3NP8A 1KHIA 2GA4B 3QB3A 5CV8A 3RNUA 2E2HB 1A3VA 4CKEA 2ICEC 1GUNA 1VF5C 2CH4W 4CDDC 3RMHA 1G2SA 2E2IH 4LF8Q 1TY2A 4DR1L 3HFZB 4LF7L 1N32L 4IOAA 2VB2X 2CKZB 4L5QA 4DFAA 4YCVA 2KCCA 3CU7A 2OQKA 2GVAA 1ZYRD 3H0GG 1GUTA 3NUCA 1BDOA 5J3BA 1YITA 1VQ5A 5I6YA 2EYLA 3DEOA 3BZKA 3H91A 2N3SA 3MXNB 1LTTD 4ZUJA 1JICA 3ZJYC 1ESRA 4R4CA 3AEVA 3V96A 3OIQA 1EIGA 1IXRA 4DV1Q 4A3JB 3ZYYX 2KVMA 4G7OC 3MZ5A 4DR3Q 2OF1A 1I3QB 2R92G 3K81C 2B39A 3D4RA 3BJUA 2QW7A 5DLQE 4P71A 1IYUA 3J81L 2EYPA 4RFBA 1A6XA 3S2DB 4K6LA 1NUCA 3CXCA 2B2UA 5IODA 3PF5A 1J8IA 2LXJA 2F0UA 1DOKA 4A3MB 1CQFA 2KECA 3BVMA 1CA6A 4Q5VA 4H44C 3MC0B 2KEDA 1BBXC 4K5WA 4LNQA 1PZKD 4RA8A 3KUPA 1STEA 4DAYB 5M5WB 2AKWB 1QNKA 3L0OA 4BBRB 2KCMA 4IO9A 2QA4A 1I6VC 1B1ZA 1S4ZA 2NN6I 3KK7A 1FJGL 2K05A 1IZ6A 4DUYQ 1STNA 1TY0A 4L8JA 4MN3A 5E7NA 4JI1L 2R7DA 3S1MH 3TQYA 2Z6KC 5D3IB 4I7AA 3SXHA 4PV1C 1IYVA 1XTCD 5IYBH 3KLRA 2B63B 3HOYG 1QZHA 3Q24A 4C1NI 3SDZA 4JW0A 3SK8A 2LKVA 3VYUA 3EN2A 3QIAA 5KIXA 5BN5A 2BE5C 2E5LL 1JWSD 3KF6A 1WTXA 3T1HQ 3ERSX 4IPGA 5AJ3Q 4OWWB 2HQEA 3GV6A 1DCZA 1SEBD 3I3CA 4IPDA 4OX9Q 3K0YA 4NXNQ 2F0HA 1N34L 1CKNB 1TR5A 2XN9C 2PQAA 1S5FD 1R9TH 3L9AX 2VUMB 2MQHA 1EQVA 1VMCA 3QR8A 2O5IC 5DM73 3TMEA 4YY3L 4C3IG 5EBDA 4LF4L 2NBFA 2F0SA 4IUNA 2WAQG 1XPRA 5I6WA 2SEBD 4B3TQ 1AE2A 1HR0Q 2Q8IB 3I4MG 1WD1A 2F0LA 4QF4A 3J80c 2BA0A 4DK0A 3OTOQ 1CKOA 3JAML 1T9HA 3G48A 4CKBA 2F03A 1SR3A 3EBEA 1Q8KA 2AUKA 1DZ1A 3MXPA 1FNUA 5IIFA 5M3MB 1IKLA 4KJNA 5HURA 3J7ZC 4KN4C 5JVH3 2QEJC 2KOLA 5T1IA 3GTGH 1X3FA 1LUZA 3RD4A 3D4WA 1PH1A 1GUOA 4A3GH 3S1RH 4FF2A 1BVSA 1A8VA 1MSHA 2K7VA 2EYFA 5C44H 3OHXC 2R7ZB 3R8BA 1XTDA 4S3SA 3UE1A 5JPMC 1STGA 1UUPA 1JB3A 2TMPA 2VZAA 4UHVA 1VQBA 2DGYA 3CCVA 4HJ7A 2HDLA 4GN4B 1B4OA 1C7YA 4R4TA 4L5SA 1VQKA 1TWFH 1A63A 4OEMB 2NN6H 1VMPA 3TDQA 3CCRA 1ASZA 1U0LA 4KY7A 2RHQB 3HOVB 4PZ6A 5BN4A 1F77A 4JI2L 3GP7A 3R3OA 2R7FA 1VQDA 2HHHQ 1EUJA 2G9HD 3K58A 3QG1A 1Q7YC 4JI0Q 4JI6Q 1Y1VH 2O4XA 1EY9A 3CF5A 2A6EC 4IUUA 4OIJA 4EQ5A 3GTPH 2Z4HA 3S1QB 1SXTA 2F0FA 1B9MA 5CV7A 3KLSA 4E6IA 1I4QA 1YNXA 2KUMA 2B2UC 4JI3L 1Z47A 1EY7A 2HCCA 5IYBG 1W6JA 4V0BA 4DV4L 1WYDA 2EPBA 2CFMA 1MSGA 3GTKH 2LMCB 1LABA 1E2VA 1XPUA 1STAA 1GM5A 1IBML 3VR3A 3BVGA 3BZCA 3BZDB 4HIMA 2EYOA 1LM0A 4RKLA 5T1GA 3VYRA 3K8AA 1ASYA 3M4PA 3P75A 1H9MA 1STYA 5ELNA 1HA6A 1WTQA 1QVCA 2AQ3B 2TSSA 5C5MA 4KY6A 3DM1A 3BG3A 3U4VA
chains in the Genus database with same CATH topology
3U58A 1KL9A 4LFAL 2UUCL 1H95A 1X65A 4J15A 5LMNQ 4JBJA 1PA6A 1N36Q 3F2BA 1KRSA 1YHAA 4AQYQ 4JV5Q 2PNHA 1XMOQ 1M1KC 4IFDG 2UUBQ 3UDGA 3KF8B 1VQ7A 3CC4A 3RLFA 4DK6C 2F4VL 2DUDA 3KOJA 3TEHB 3I4NH 3BU2A 2ZM6L 3GD7A 4L5RC 5M3FG 4DV5Q 1PH4A 4LF5L 2ASBA 2UU9Q 4JCVE 3I7FA 4GNXA 4BXXG 1PH7A 2MNAA 4JYAQ 3HOWH 2UXCQ 4JI4L 4RMFA 1UE1A 3A0JA 4NPSA 5H1SE 3CCQA 4GKKQ 4NXML 1GKHA 1XNRQ 3HOZG 1WCMG 1IBLL 3GTQH 3UDFA 4IPCA 2WB1E 4LFCQ 2VUMG 1C0AA 2ZTCA 1Q81C 2VNUD 1N33Q 1VQOA 2NZOA 1HNWQ 1I5FA 2RHSB 3GTOH 4FDBA 1S3OA 4NB3A 4ME3A 4DV7Q 1BBWA 1BBUA 5IY0A 3W1BA 3I55A 1N36L 2YU9H 3M4OH 2JA7G 3K0XA 2WB1G 3J81i 4JG2A 2NVYH 3U4ZA 1HNXQ 1P8LA 2ES2A 4B3RQ 1NE3A 4X62Q 1VQIA 1S72A 2Q2UA 3KDFB 4DR4L 4R4OA 1LYLA 3RLNA 1IYJB 2UXBQ 1Q12A 3CAMA 4P73A 4LF6Q 4EX5A 2ZJQA 1X55A 2I5LX 3A5ZB 3KLWA 4DV5L 4HIDA 4GOPA 4QL5A 1Q1BA 2F3IA 5GROA 4OXPA 2UU9L 4JYAL 5IE8A 2KHJA 2N49A 2CWPA 2K5HA 3ULLA 3EIVA 1PH9A 5GAEC 3PSIA 3TS2A 4GKJQ 4YWLA 4GKKL 1YBYA 1LTLA 1NMGA 3H0GH 3E0EA 4IJLA 4DPGA 2ZJPA 2OTLA 2EXDA 5C44G 4K0KQ 3NELA 4LFCL 3D31A 1IBKQ 3A5UA 3F2CA 2E2HH 1N33L 1MKHA 4UY8C 5M5XH 5M3MG 4DV7L 3CCEA 1VQ6A 1VQHA 1K73C 1EWIA 4DNIA 2ZJRA 1HNXL 1GVPA 2EQSA 4JI8Q 2VW9A 4X62L 3RLOA 3CCLA 5IYDH 2NVTH 2ALYB 1GO3E 1MIUA 3CP0A 3G71A 4DV4Q 1VQ9A 3KFUA 4X64Q 2UXBL 4LF6L 2GVBA 3D0FA 2NN6G 4AH6A 4DK3C 1K9MC 2R7ZG 1D7QA 4X66Q 4BY7G 1KAWA 3M4QA 4A3FG 4LF8L 4A3BG 4IJHA 3E9IA 2JEBI 1KD1C 2H5XA 4A3CG 4GNXB 1IBMQ 2A8VA 3ER0A 1K8AC 3NENA 3CCMA 1VQMA 1KIXA 3RZOH 5LMUQ 4MNOA 2N8NA 2UUAQ 2NVQH 4GKJL 2Z6KA 1YVCA 2Y0SG 2YV5A 1E1TA 4XIGS 4K0KL 4HJ9A 4YCUA 1QZGA 1Y1VG 2N78A 3I56A 1S40A 2BH2A 2IX1A 1E1OA 4PZ7A 4A4IA 2UXDL 4OO1I 1OTCA 3HOUH 4LFAQ 3G6EA 1VQLA 2UUCQ 2K50A 3HOVG 3HOXG 5GAHC 1HJPA 4A3IH 4LF9L 5FLMH 1L1OC 2D62A 3M9BA 3KDFA 4DR3L 4POGA 3S2DH 4GN3B 1YJ9A 2VY3A 2F4VQ 4H02A 5JEAJ 3DM3A 4AYBG 3PIPA 3I2ZA 4KHZA 4X66L 2ZM6Q 4UPAA 4Y7NH 4A3MH 4QQBX 4LF5Q 3TREA 2QEXA 1OXSC 3FP9A 1XPOA 1UWVA 2R93G 4JI4Q 1EFWA 2ID0A 4DV3L 1NJIC 4JBKA 3HOYH 1FVIA 4LFBL 3GO5A 3PUWA 2E2JH 3S17H 1K0RA 5C3EH 1VQ4A 4MTNA 1W2BA 4DR6Q 1PYSB 3L7ZC 1IBLQ 3CMEA 1UE7A 4JI7Q 4PMWA 4B3MQ 2RF4A 1X56A 3CPWA 5IP7G 1VQ8A 3CCSA 1HZ9A 1IL2A 3PO2H 2OQ0A 4KI0A 1YJNA 3G4SA 5C4JH 1OXTA 2LSSA 1XMQL 4LWCA 3JAMi 2VL6A 4DR4Q 2XGTA 2JE6I 3RN2A 2IX0A 3ICEA 3H3VI 1C9OA 2I5MX 1V43A 4POFA 4HJ8A 3S2HH 4OWTB 3DLLA 1QVFA 3WWVA 2B63H 1EQQA 1JT8A 4DUYL 4QJFA 4JOIA 3I4NG 2AWNA 2GN5A 3ULPA 1VQEA 3S15H 2KBNA 4GLVB 2YYZA 1JJ2A 4DR1Q 4LF7Q 1FL0A 1TXYA 3E9HA 1HZBA 1SN8A 3TRZA 1WJJA 3M7NA 3AFPA 2PI2A 4BY1H 3HOWG 1WOCA 3S1NH 1E7ZA 4A93G 3J81j 1U5KA 4P75A 4RG1A 2VQEQ 4DR6L 1N8RC 3F2DA 3PV0A 1YI2A 1L2FA 2IT1A 4JI7L 3OW2A 3CCUA 1PH5A 3AYHB 1VQGA 4B3ML 1M90C 3J7A5 3GTMH 4BBSH 4C3IH 2AWOA 1HH2P 3GTJH 4QIWE 4DAMA 4LW1A 4HJAA 3M3YH 2K14A 4IFDI 1SROA 3AFQA 2Q2IA 4A3EH 4KLKA 3J80i 3PUVA 2JA5H 3KJPA 1K3RA 2K75A 3F8TA 1UEBA 1XNQL 3I4MH 3GDEA 1KHIA 3RNUA 1GD7A 1CSPA 1HZAA 4A3KH 3T1HL 4IFDJ 5FLXc 3A74A 2IHFA 5IWAL 5JJLA 2VUMH 1HZCA 4GNXC 2E2IH 4HIKA 4LF8Q 4DR1L 3HFZB 4LF7L 1N32L 4IOAA 1EQRA 1Y14B 2CKZB 4L5QA 1G51A 4DKAC 4YCVA 4A3GG 1KXLA 4NXNL 2VQEL 2OQKA 4QGUA 1D8LA 1Y1WH 1XJVA 1N9WA 2GVAA 1PH2A 2Z0SA 3S14H 3H0GG 1OXXK 3PCOB 4A3DH 2A19A 5IP9H 5J3BA 1YITA 3PIOA 3RZDH 1VQ5A 3I4OA 4R4IA 2UXDQ 4A3LH 3BZKA 2N3SA 3MXNB 1X9NA 1P16A 3PGZA 1NY4A 3UE0A 3W1GA 3ZJYC 1YJWA 4R4CA 3UDXA 3AEVA 2LXKA 4LF9Q 1SLJA 4DV1Q 1IXRA 2HT1A 2WFWA 4B3TL 5FJ8H 4DR3Q 4GN5A 1PVOA 3KF6B 2OCEA 3ULJA 4GS3A 4IOCA 4GOPC 1EIYB 4WJ3M 1VQFA 2Y0SE 1FJGQ 2A1AA 2VS1A 2R92G 1L0WA 3K81C 5C4XH 4UP9A 5DLQE 3BJUA 4P71A 3OTOL 3HKSA 2L15A 3PO3H 2OWOA 3HKZE 4DV3Q 1NMFA 2JJQA 1YHQA 5IYCH 3CXCA 4LFBQ 3CC2A 4LUZA 4A3JH 1MJEA 4ALPA 3PF5A 2LXJA 2XTIA 4YWKA 5JJIA 1V9PA 3HKZG 1B70B 3CQZH 4BY7H 1I3QH 1PH8A 5GAGC 2BH8A 4DR2L 1JB7A 5C0XG 4LNQA 3HOUG 4AYBE 2JEAI 1RIPA 4DAYB 1J5EQ 1TWHH 4LUVA 5GADC 4X6AH 4JBWA 4DV1L 2AKWB 2FXQA 3L0OA 1KRTA 2KCMA 5GQOA 4IO9A 4A3IG 1YIJA 1X6OA 3RR5A 2QA4A 1XMQQ 4JBMA 4HIOA 3FKIG 1TWCH 2NN6I 1YHBA 2ZTDA 1FJGL 3VDYA 2JA8H 2K4KA 1IZ6A 2EIFA 4DUYQ 4IPHA 1G291 1I50H 5E7NA 4JI1L 4DV2Q 2R7DA 2BA1A 3TQYA 3S1MH 3KYHC 2Z6KC 4O2DA 1I94Q 3HOVH 3AQQA 5IYBH 1UE5A 3PUZA 3S24A 5M5WH 4BBRH 1N34Q 1QZHA 3HOYG 1DGSA 1PH3A 2IHEA 3RN5A 2YTYA 1YZ6A 3LGJA 5C3EG 5BR8L 2JA6H 2YTVA 4PG3A 3CMAA 3H3VH 1YEZA 1Q1EA 3F1ZA 1OXUA 5C0XI 1RL2A 1V1QA 3EN2A 3S1QH 2CWAA 1J5EL 4A75A 4DV0Q 4LF4Q 3K7UC 3PO2G 1JMCA 1CKMA 2Q2TA 2JK8A 3KJOA 1E24A 2HHHL 5K36G 4JI0L 1XNQQ 2R6GA 1X3EA 3IRBA 2E5LL 4JI6L 1PFSA 3KF6A 3K80C 3Q8DA 1KC8C 3T1HQ 1MJCA 5IWAQ 3ERSX 4TVAB 4X65L 4IPGA 5AJ3Q 4OWWB 4P74A 5HY6A 2B3GA 4DV2L 4O0AA 1N32Q 2YTXA 3T1YL 1B8AA 2HQLA 2JA9A 2Q2HA 2KENA 4IPDA 4JC0A 1I94L 2CCZA 4OX9Q 4L5TA 1PHJA 1JJGA 4DR7L 1NTGA 4BA1I 4NXNQ 2K5NA 1CKNB 4BY1G 1N34L 1VCIA 2PQAA 3NEMA 1R9TH 1HNZL 3B6YA 4BA2I 2MQHA 4MZ9A 1Q86C 1L1OB 4R4QA 3CPFA 2WAQE 4HJ5A 4YY3L 4BBSG 5M3FH 1KQSA 2MO1A 4DV0L 4LF4L 1X54A 4BXXH 1JJCB 1JE5A 1CUKA 4A3EG 2WAQG 2JA5G 1XPRA 4A93H 2WP8J 1AE2A 4YHHL 1HR0Q 4B3TQ 2C35B 3I4MG 3HOZH 4JOIC 5IT9c 1WCMH 4C3HH 4LUOA 4DR5Q 4A3KG 5AJ3L 1NBWA 4OONA 1VQJA 4PZ8A 4JI5L 1FGUA 2OTJA 3M85A 3J81c 3STBD 3J80c 4B3SL 3SGIA 2BA0A 4R1JA 1W3SA 2I5HA 1CKOA 3OTOQ 2NVXH 4OX9L 5ELOA 2JA7H 2RCNA 1T9HA 3U50C 5LMNL 3G48A 4AQYL 4JV5L 1XMOL 1Y1WG 1Q82C 2UUBL 3CD6A 1SR3A 3EBEA 5HGQA 1Q8KA 1VQCA 2VQFQ 4A3DG 3CW2C 5IP9G 3PF4A 4QY7A 1E22A 1AE3A 1CSQA 3J7ZC 4DR2Q 1B7YB 4C2MH 2B29A 2KCTA 3H15A 3GTGH 4A3LG 1X3FA 1AH9A 1LUZA 4JI2Q 4YCWA 1PH1A 2UXCL 4A3GH 1I6HH 3S1RH 4KHPQ 2ZTEA 1BVSA 5IYDG 1A8VA 2MO0A 1HR0L 4GLAC 3K7AH 2IY5B 2F52A 2V1CC 5C44H 4OWXB 5FJ8G 1X3GA 4DR5L 1XNRL 1UE6A 3CCJA 1K83H 3UDIA 1QVGA 2K52A 2NZHA 1XTDA 1SRUA 2HIVA 4UP8A 4A76A 3JC66 1QUQB 3UE1A 5M3MH 1WI5A 4JI1Q 1HNWL 2PMZE 5C4XG 1SMXA 4OO1G 1PH6A 2KHIA 2VZAA 3PO3G 1A0IA 4JI3Q 1VQBA 2DGYA 3CCVA 4HJ7A 3GTLH 4B3RL 1CKNA 2PQAB 1EYGA 3S16H 2HIXA 4GN4B 5JEAG 5IYCG 1OXVA 3FHWA 1C7YA 4R4TA 4C3JH 1VQAA 4A3JG 2VQFL 1VQKA 1TWFH 2I0QA 5BR8Q 1L1OA 4L5SA 1A63A 1SE8A 5LMNW 2R7ZH 2D0OA 2D0PA 3CCRA 4A3FH 1U0LA 2PI2E 1ASZA 2RHQB 2R92H 4A3BH 4A3CH 2AMCB 4PZ6A 4JI2L 2ATWA 5EAYA 4GLXA 1PV4A 3PUYA 2R7FA 1K8GA 1VQDA 2HHHQ 5FLMG 1EUJA 4AIMA 1Q7YC 4JI0Q 4WJ4A 4DUZQ 4DV6Q 1BKBA 3TS0A 4JI6Q 2E5LQ 1PYBA 1Y1VH 3CF5A 2QGQA 1E3PA 4TQUS 3NBHB 4EQ5A 4X65Q 3GTPH 1IBKL 2E8GA 4YWMA 2JA8G 2MFIA 3PUXA 1HR0W 4A3MG 4APVA 1A62A 3T1YQ 2K5VA 1YNXA 1Q46A 3HOXH 4JI3L 1Z47A 1VQNA 4DR7Q 1TWAH 4JI8L 2AHOB 5M5YH 5IYBG 1HNZQ 1O7IA 1WFQA 4BBRG 3FKIH 4DV4L 1WYDA 1SFOH 4KHPL 4Y52H 1VQPA 4X64L 4P72A 5JJKA 2JA6G 3W5OA 2CFMA 3GTKH 1VS0A 4XTCS 1EOVA 1XPUA 4YY3Q 1GM5A 4GOPB 1TWGH 1IBML 3L2PA 2R93H 3OYYA 1Z9FA 3BZCA 3MEFA 5LMUL 5C0XJ 4DUZL 4DV6L 4HIMA 2UUAL 1LM0A 4YHHQ 1EIFA 1J6QA 2JQOA 3K8AA 1ASYA 3M4PA 5ELNA 2B63G 4NXMQ 2CQOA 1QVCA 3CC7A 4JI5Q 4UP7A 1QUQA 1G6PA 5IP7H 4B3SQ 3JAMc 3U4VA 3STBC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U58 A;  1KL9 A;  4LFA L;  2UUC L;  1H95 A;  1X65 A;  4J15 A;  5LMN Q;  4JBJ A;  1PA6 A;  1N36 Q;  3F2B A;  1KRS A;  1YHA A;  4AQY Q;  4JV5 Q;  2PNH A;  1XMO Q;  1M1K C;  4IFD G;  2UUB Q;  3UDG A;  3KF8 B;  1VQ7 A;  3CC4 A;  3RLF A;  4DK6 C;  2F4V L;  2DUD A;  3KOJ A;  3TEH B;  3I4N H;  3BU2 A;  2ZM6 L;  3GD7 A;  4L5R C;  5M3F G;  4DV5 Q;  1PH4 A;  4LF5 L;  2ASB A;  2UU9 Q;  4JCV E;  3I7F A;  4GNX A;  4BXX G;  1PH7 A;  2MNA A;  4JYA Q;  3HOW H;  2UXC Q;  4JI4 L;  4RMF A;  1UE1 A;  3A0J A;  4NPS A;  5H1S E;  3CCQ A;  4GKK Q;  4NXM L;  1GKH A;  1XNR Q;  3HOZ G;  1WCM G;  1IBL L;  3GTQ H;  3UDF A;  4IPC A;  2WB1 E;  4LFC Q;  2VUM G;  1C0A A;  2ZTC A;  1Q81 C;  2VNU D;  1N33 Q;  1VQO A;  2NZO A;  1HNW Q;  1I5F A;  2RHS B;  3GTO H;  4FDB A;  1S3O A;  4NB3 A;  4ME3 A;  4DV7 Q;  1BBW A;  1BBU A;  5IY0 A;  3W1B A;  3I55 A;  1N36 L;  2YU9 H;  3M4O H;  2JA7 G;  3K0X A;  2WB1 G;  3J81 i;  4JG2 A;  2NVY H;  3U4Z A;  1HNX Q;  1P8L A;  2ES2 A;  4B3R Q;  1NE3 A;  4X62 Q;  1VQI A;  1S72 A;  2Q2U A;  3KDF B;  4DR4 L;  4R4O A;  1LYL A;  3RLN A;  1IYJ B;  2UXB Q;  1Q12 A;  3CAM A;  4P73 A;  4LF6 Q;  4EX5 A;  2ZJQ A;  1X55 A;  2I5L X;  3A5Z B;  3KLW A;  4DV5 L;  4HID A;  4GOP A;  4QL5 A;  1Q1B A;  2F3I A;  5GRO A;  4OXP A;  2UU9 L;  4JYA L;  5IE8 A;  2KHJ A;  2N49 A;  2CWP A;  2K5H A;  3ULL A;  3EIV A;  1PH9 A;  5GAE C;  3PSI A;  3TS2 A;  4GKJ Q;  4YWL A;  4GKK L;  1YBY A;  1LTL A;  1NMG A;  3H0G H;  3E0E A;  4IJL A;  4DPG A;  2ZJP A;  2OTL A;  2EXD A;  5C44 G;  4K0K Q;  3NEL A;  4LFC L;  3D31 A;  1IBK Q;  3A5U A;  3F2C A;  2E2H H;  1N33 L;  1MKH A;  4UY8 C;  5M5X H;  5M3M G;  4DV7 L;  3CCE A;  1VQ6 A;  1VQH A;  1K73 C;  1EWI A;  4DNI A;  2ZJR A;  1HNX L;  1GVP A;  2EQS A;  4JI8 Q;  2VW9 A;  4X62 L;  3RLO A;  3CCL A;  5IYD H;  2NVT H;  2ALY B;  1GO3 E;  1MIU A;  3CP0 A;  3G71 A;  4DV4 Q;  1VQ9 A;  3KFU A;  4X64 Q;  2UXB L;  4LF6 L;  2GVB A;  3D0F A;  2NN6 G;  4AH6 A;  4DK3 C;  1K9M C;  2R7Z G;  1D7Q A;  4X66 Q;  4BY7 G;  1KAW A;  3M4Q A;  4A3F G;  4LF8 L;  4A3B G;  4IJH A;  3E9I A;  2JEB I;  1KD1 C;  2H5X A;  4A3C G;  4GNX B;  1IBM Q;  2A8V A;  3ER0 A;  1K8A C;  3NEN A;  3CCM A;  1VQM A;  1KIX A;  3RZO H;  5LMU Q;  4MNO A;  2N8N A;  2UUA Q;  2NVQ H;  4GKJ L;  2Z6K A;  1YVC A;  2Y0S G;  2YV5 A;  1E1T A;  4XIG S;  4K0K L;  4HJ9 A;  4YCU A;  1QZG A;  1Y1V G;  2N78 A;  3I56 A;  1S40 A;  2BH2 A;  2IX1 A;  1E1O A;  4PZ7 A;  4A4I A;  2UXD L;  4OO1 I;  1OTC A;  3HOU H;  4LFA Q;  3G6E A;  1VQL A;  2UUC Q;  2K50 A;  3HOV G;  3HOX G;  5GAH C;  1HJP A;  4A3I H;  4LF9 L;  5FLM H;  1L1O C;  2D62 A;  3M9B A;  3KDF A;  4DR3 L;  4POG A;  3S2D H;  4GN3 B;  1YJ9 A;  2VY3 A;  2F4V Q;  4H02 A;  5JEA J;  3DM3 A;  4AYB G;  3PIP A;  3I2Z A;  4KHZ A;  4X66 L;  2ZM6 Q;  4UPA A;  4Y7N H;  4A3M H;  4QQB X;  4LF5 Q;  3TRE A;  2QEX A;  1OXS C;  3FP9 A;  1XPO A;  1UWV A;  2R93 G;  4JI4 Q;  1EFW A;  2ID0 A;  4DV3 L;  1NJI C;  4JBK A;  3HOY H;  1FVI A;  4LFB L;  3GO5 A;  3PUW A;  2E2J H;  3S17 H;  1K0R A;  5C3E H;  1VQ4 A;  4MTN A;  1W2B A;  4DR6 Q;  1PYS B;  3L7Z C;  1IBL Q;  3CME A;  1UE7 A;  4JI7 Q;  4PMW A;  4B3M Q;  2RF4 A;  1X56 A;  3CPW A;  5IP7 G;  1VQ8 A;  3CCS A;  1HZ9 A;  1IL2 A;  3PO2 H;  2OQ0 A;  4KI0 A;  1YJN A;  3G4S A;  5C4J H;  1OXT A;  2LSS A;  1XMQ L;  4LWC A;  3JAM i;  2VL6 A;  4DR4 Q;  2XGT A;  2JE6 I;  3RN2 A;  2IX0 A;  3ICE A;  3H3V I;  1C9O A;  2I5M X;  1V43 A;  4POF A;  4HJ8 A;  3S2H H;  4OWT B;  3DLL A;  1QVF A;  3WWV A;  2B63 H;  1EQQ A;  1JT8 A;  4DUY L;  4QJF A;  4JOI A;  3I4N G;  2AWN A;  2GN5 A;  3ULP A;  1VQE A;  3S15 H;  2KBN A;  4GLV B;  2YYZ A;  1JJ2 A;  4DR1 Q;  4LF7 Q;  1FL0 A;  1TXY A;  3E9H A;  1HZB A;  1SN8 A;  3TRZ A;  1WJJ A;  3M7N A;  3AFP A;  2PI2 A;  4BY1 H;  3HOW G;  1WOC A;  3S1N H;  1E7Z A;  4A93 G;  3J81 j;  1U5K A;  4P75 A;  4RG1 A;  2VQE Q;  4DR6 L;  1N8R C;  3F2D A;  3PV0 A;  1YI2 A;  1L2F A;  2IT1 A;  4JI7 L;  3OW2 A;  3CCU A;  1PH5 A;  3AYH B;  1VQG A;  4B3M L;  1M90 C;  3J7A 5;  3GTM H;  4BBS H;  4C3I H;  2AWO A;  1HH2 P;  3GTJ H;  4QIW E;  4DAM A;  4LW1 A;  4HJA A;  3M3Y H;  2K14 A;  4IFD I;  1SRO A;  3AFQ A;  2Q2I A;  4A3E H;  4KLK A;  3J80 i;  3PUV A;  2JA5 H;  3KJP A;  1K3R A;  2K75 A;  3F8T A;  1UEB A;  1XNQ L;  3I4M H;  3GDE A;  1KHI A;  3RNU A;  1GD7 A;  1CSP A;  1HZA A;  4A3K H;  3T1H L;  4IFD J;  5FLX c;  3A74 A;  2IHF A;  5IWA L;  5JJL A;  2VUM H;  1HZC A;  4GNX C;  2E2I H;  4HIK A;  4LF8 Q;  4DR1 L;  3HFZ B;  4LF7 L;  1N32 L;  4IOA A;  1EQR A;  1Y14 B;  2CKZ B;  4L5Q A;  1G51 A;  4DKA C;  4YCV A;  4A3G G;  1KXL A;  4NXN L;  2VQE L;  2OQK A;  4QGU A;  1D8L A;  1Y1W H;  1XJV A;  1N9W A;  2GVA A;  1PH2 A;  2Z0S A;  3S14 H;  3H0G G;  1OXX K;  3PCO B;  4A3D H;  2A19 A;  5IP9 H;  5J3B A;  1YIT A;  3PIO A;  3RZD H;  1VQ5 A;  3I4O A;  4R4I A;  2UXD Q;  4A3L H;  3BZK A;  2N3S A;  3MXN B;  1X9N A;  1P16 A;  3PGZ A;  1NY4 A;  3UE0 A;  3W1G A;  3ZJY C;  1YJW A;  4R4C A;  3UDX A;  3AEV A;  2LXK A;  4LF9 Q;  1SLJ A;  4DV1 Q;  1IXR A;  2HT1 A;  2WFW A;  4B3T L;  5FJ8 H;  4DR3 Q;  4GN5 A;  1PVO A;  3KF6 B;  2OCE A;  3ULJ A;  4GS3 A;  4IOC A;  4GOP C;  1EIY B;  4WJ3 M;  1VQF A;  2Y0S E;  1FJG Q;  2A1A A;  2VS1 A;  2R92 G;  1L0W A;  3K81 C;  5C4X H;  4UP9 A;  5DLQ E;  3BJU A;  4P71 A;  3OTO L;  3HKS A;  2L15 A;  3PO3 H;  2OWO A;  3HKZ E;  4DV3 Q;  1NMF A;  2JJQ A;  1YHQ A;  5IYC H;  3CXC A;  4LFB Q;  3CC2 A;  4LUZ A;  4A3J H;  1MJE A;  4ALP A;  3PF5 A;  2LXJ A;  2XTI A;  4YWK A;  5JJI A;  1V9P A;  3HKZ G;  1B70 B;  3CQZ H;  4BY7 H;  1I3Q H;  1PH8 A;  5GAG C;  2BH8 A;  4DR2 L;  1JB7 A;  5C0X G;  4LNQ A;  3HOU G;  4AYB E;  2JEA I;  1RIP A;  4DAY B;  1J5E Q;  1TWH H;  4LUV A;  5GAD C;  4X6A H;  4JBW A;  4DV1 L;  2AKW B;  2FXQ A;  3L0O A;  1KRT A;  2KCM A;  5GQO A;  4IO9 A;  4A3I G;  1YIJ A;  1X6O A;  3RR5 A;  2QA4 A;  1XMQ Q;  4JBM A;  4HIO A;  3FKI G;  1TWC H;  2NN6 I;  1YHB A;  2ZTD A;  1FJG L;  3VDY A;  2JA8 H;  2K4K A;  1IZ6 A;  2EIF A;  4DUY Q;  4IPH A;  1G29 1;  1I50 H;  5E7N A;  4JI1 L;  4DV2 Q;  2R7D A;  2BA1 A;  3TQY A;  3S1M H;  3KYH C;  2Z6K C;  4O2D A;  1I94 Q;  3HOV H;  3AQQ A;  5IYB H;  1UE5 A;  3PUZ A;  3S24 A;  5M5W H;  4BBR H;  1N34 Q;  1QZH A;  3HOY G;  1DGS A;  1PH3 A;  2IHE A;  3RN5 A;  2YTY A;  1YZ6 A;  3LGJ A;  5C3E G;  5BR8 L;  2JA6 H;  2YTV A;  4PG3 A;  3CMA A;  3H3V H;  1YEZ A;  1Q1E A;  3F1Z A;  1OXU A;  5C0X I;  1RL2 A;  1V1Q A;  3EN2 A;  3S1Q H;  2CWA A;  1J5E L;  4A75 A;  4DV0 Q;  4LF4 Q;  3K7U C;  3PO2 G;  1JMC A;  1CKM A;  2Q2T A;  2JK8 A;  3KJO A;  1E24 A;  2HHH L;  5K36 G;  4JI0 L;  1XNQ Q;  2R6G A;  1X3E A;  3IRB A;  2E5L L;  4JI6 L;  1PFS A;  3KF6 A;  3K80 C;  3Q8D A;  1KC8 C;  3T1H Q;  1MJC A;  5IWA Q;  3ERS X;  4TVA B;  4X65 L;  4IPG A;  5AJ3 Q;  4OWW B;  4P74 A;  5HY6 A;  2B3G A;  4DV2 L;  4O0A A;  1N32 Q;  2YTX A;  3T1Y L;  1B8A A;  2HQL A;  2JA9 A;  2Q2H A;  2KEN A;  4IPD A;  4JC0 A;  1I94 L;  2CCZ A;  4OX9 Q;  4L5T A;  1PHJ A;  1JJG A;  4DR7 L;  1NTG A;  4BA1 I;  4NXN Q;  2K5N A;  1CKN B;  4BY1 G;  1N34 L;  1VCI A;  2PQA A;  3NEM A;  1R9T H;  1HNZ L;  3B6Y A;  4BA2 I;  2MQH A;  4MZ9 A;  1Q86 C;  1L1O B;  4R4Q A;  3CPF A;  2WAQ E;  4HJ5 A;  4YY3 L;  4BBS G;  5M3F H;  1KQS A;  2MO1 A;  4DV0 L;  4LF4 L;  1X54 A;  4BXX H;  1JJC B;  1JE5 A;  1CUK A;  4A3E G;  2WAQ G;  2JA5 G;  1XPR A;  4A93 H;  2WP8 J;  1AE2 A;  4YHH L;  1HR0 Q;  4B3T Q;  2C35 B;  3I4M G;  3HOZ H;  4JOI C;  5IT9 c;  1WCM H;  4C3H H;  4LUO A;  4DR5 Q;  4A3K G;  5AJ3 L;  1NBW A;  4OON A;  1VQJ A;  4PZ8 A;  4JI5 L;  1FGU A;  2OTJ A;  3M85 A;  3J81 c;  3STB D;  3J80 c;  4B3S L;  3SGI A;  2BA0 A;  4R1J A;  1W3S A;  2I5H A;  1CKO A;  3OTO Q;  2NVX H;  4OX9 L;  5ELO A;  2JA7 H;  2RCN A;  1T9H A;  3U50 C;  5LMN L;  3G48 A;  4AQY L;  4JV5 L;  1XMO L;  1Y1W G;  1Q82 C;  2UUB L;  3CD6 A;  1SR3 A;  3EBE A;  5HGQ A;  1Q8K A;  1VQC A;  2VQF Q;  4A3D G;  3CW2 C;  5IP9 G;  3PF4 A;  4QY7 A;  1E22 A;  1AE3 A;  1CSQ A;  3J7Z C;  4DR2 Q;  1B7Y B;  4C2M H;  2B29 A;  2KCT A;  3H15 A;  3GTG H;  4A3L G;  1X3F A;  1AH9 A;  1LUZ A;  4JI2 Q;  4YCW A;  1PH1 A;  2UXC L;  4A3G H;  1I6H H;  3S1R H;  4KHP Q;  2ZTE A;  1BVS A;  5IYD G;  1A8V A;  2MO0 A;  1HR0 L;  4GLA C;  3K7A H;  2IY5 B;  2F52 A;  2V1C C;  5C44 H;  4OWX B;  5FJ8 G;  1X3G A;  4DR5 L;  1XNR L;  1UE6 A;  3CCJ A;  1K83 H;  3UDI A;  1QVG A;  2K52 A;  2NZH A;  1XTD A;  1SRU A;  2HIV A;  4UP8 A;  4A76 A;  3JC6 6;  1QUQ B;  3UE1 A;  5M3M H;  1WI5 A;  4JI1 Q;  1HNW L;  2PMZ E;  5C4X G;  1SMX A;  4OO1 G;  1PH6 A;  2KHI A;  2VZA A;  3PO3 G;  1A0I A;  4JI3 Q;  1VQB A;  2DGY A;  3CCV A;  4HJ7 A;  3GTL H;  4B3R L;  1CKN A;  2PQA B;  1EYG A;  3S16 H;  2HIX A;  4GN4 B;  5JEA G;  5IYC G;  1OXV A;  3FHW A;  1C7Y A;  4R4T A;  4C3J H;  1VQA A;  4A3J G;  2VQF L;  1VQK A;  1TWF H;  2I0Q A;  5BR8 Q;  1L1O A;  4L5S A;  1A63 A;  1SE8 A;  5LMN W;  2R7Z H;  2D0O A;  2D0P A;  3CCR A;  4A3F H;  1U0L A;  2PI2 E;  1ASZ A;  2RHQ B;  2R92 H;  4A3B H;  4A3C H;  2AMC B;  4PZ6 A;  4JI2 L;  2ATW A;  5EAY A;  4GLX A;  1PV4 A;  3PUY A;  2R7F A;  1K8G A;  1VQD A;  2HHH Q;  5FLM G;  1EUJ A;  4AIM A;  1Q7Y C;  4JI0 Q;  4WJ4 A;  4DUZ Q;  4DV6 Q;  1BKB A;  3TS0 A;  4JI6 Q;  2E5L Q;  1PYB A;  1Y1V H;  3CF5 A;  2QGQ A;  1E3P A;  4TQU S;  3NBH B;  4EQ5 A;  4X65 Q;  3GTP H;  1IBK L;  2E8G A;  4YWM A;  2JA8 G;  2MFI A;  3PUX A;  1HR0 W;  4A3M G;  4APV A;  1A62 A;  3T1Y Q;  2K5V A;  1YNX A;  1Q46 A;  3HOX H;  4JI3 L;  1Z47 A;  1VQN A;  4DR7 Q;  1TWA H;  4JI8 L;  2AHO B;  5M5Y H;  5IYB G;  1HNZ Q;  1O7I A;  1WFQ A;  4BBR G;  3FKI H;  4DV4 L;  1WYD A;  1SFO H;  4KHP L;  4Y52 H;  1VQP A;  4X64 L;  4P72 A;  5JJK A;  2JA6 G;  3W5O A;  2CFM A;  3GTK H;  1VS0 A;  4XTC S;  1EOV A;  1XPU A;  4YY3 Q;  1GM5 A;  4GOP B;  1TWG H;  1IBM L;  3L2P A;  2R93 H;  3OYY A;  1Z9F A;  3BZC A;  3MEF A;  5LMU L;  5C0X J;  4DUZ L;  4DV6 L;  4HIM A;  2UUA L;  1LM0 A;  4YHH Q;  1EIF A;  1J6Q A;  2JQO A;  3K8A A;  1ASY A;  3M4P A;  5ELN A;  2B63 G;  4NXM Q;  2CQO A;  1QVC A;  3CC7 A;  4JI5 Q;  4UP7 A;  1QUQ A;  1G6P A;  5IP7 H;  4B3S Q;  3JAM c;  3U4V A;  3STB C; 
#chains in the Genus database with same CATH topology
 4LFA L;  3HOW B;  3A7A B;  4A93 B;  1PA6 A;  1NR2 A;  1O7Z A;  3U9O A;  1KRS A;  1M1K C;  4XXE A;  2J4X A;  5EQ0 A;  2UUB Q;  5BN3 A;  3KF8 B;  2I46 A;  5J22 A;  4KD3 A;  4RGO S;  1CFM A;  2F4V L;  1G6Z A;  2NVX B;  1U9R A;  3BU2 A;  2ZM6 L;  3GD7 A;  4L5R C;  1PZJ D;  3VA7 A;  4DV5 Q;  4LF5 L;  1C48 A;  5EGT A;  2SNS A;  5E4X A;  3OW7 A;  1UE1 A;  3A0J A;  1RCV D;  3CCQ A;  1F9R A;  4GKK Q;  4NXM L;  1GKH A;  3I91 A;  1K3B C;  3NBH A;  5E1F A;  3VYT A;  3EA6 A;  4DNR B;  4B9X A;  1YNN D;  2I07 B;  1HNW Q;  3M7G A;  3GTO H;  4NB3 A;  1I6H B;  4DV7 Q;  2WIN B;  2IX3 A;  2YU9 H;  1N36 L;  5CV9 A;  3M4O H;  1EL0 A;  2WB1 G;  3H0G B;  2WV6 D;  4DR4 L;  3G6J B;  1EYA A;  3RLN A;  5EKI A;  1WTR A;  1ILQ A;  3CAM A;  2ZJQ A;  4X3U A;  1X55 A;  1Q1B A;  2EYJ A;  5CC4 A;  2RDF A;  4OXP A;  2UU9 L;  1EY8 A;  4JYA L;  2K5D A;  2KHJ A;  5IT9 E;  3ULL A;  2NVT B;  3TS2 A;  1FNV A;  2F0J A;  5CMD A;  2OTL A;  4X3T A;  1B9N A;  5C44 G;  2R92 B;  3D31 A;  1IBK Q;  4RGN A;  1N33 L;  4UY8 C;  1HQR D;  4FO2 A;  2F3V A;  1IW7 C;  3CCE A;  3E3X A;  2CW0 C;  1HNX L;  3DWA A;  4JI8 Q;  3D6W A;  2ALY B;  3ERO A;  3MFG A;  1SSO A;  4XT1 B;  2GVB A;  4DK3 C;  2NN6 G;  5ELB A;  4AH6 A;  1FR3 A;  4BY7 G;  3M4Q A;  1TWA B;  1JOK A;  1JR0 D;  3A8K E;  2ZXO A;  2BCO A;  2DN8 A;  1JC7 A;  2EVB A;  2MUY A;  2JSO A;  2NVQ H;  1Y69 U;  2Y0S G;  1E1T A;  5JEA H;  1U4R A;  1Y1V G;  2N78 A;  2BH2 A;  3N6R A;  5EJW A;  1HA5 A;  4CDC C;  4Y7N B;  4NKL A;  1TS4 A;  4IUT A;  4EGV A;  5C0X H;  1B53 A;  2SNM A;  3HOU H;  2K50 A;  3HOY B;  4WJW A;  1Z7T A;  2PPB C;  3M9B A;  4LJZ C;  1NNX A;  4POG A;  1S5C D;  5G3L D;  2VY3 A;  4H02 A;  5JEA J;  4AYB G;  4XYQ A;  4DXG A;  2V4D A;  4HSV A;  1OXS C;  2XRQ D;  4JI4 Q;  4FXK C;  4K2L A;  2ID0 A;  2L5T A;  4DV3 L;  5FOB B;  2RKS A;  3S2H B;  1VQ4 A;  1TS2 A;  1EYD A;  5C3E H;  4EVO A;  3L7Z C;  5AFW A;  3CME A;  1PTO B;  1UE7 A;  4JI7 Q;  2RF4 A;  3VR4 A;  3PO2 H;  1HZ9 A;  2B8G A;  1BR9 A;  3S1N B;  2OQ0 A;  2F0P A;  5C4J H;  1EY0 A;  1EEF D;  3LX0 A;  2XGT A;  2BOS A;  3RN2 A;  4FVM A;  4XQJ A;  2I5M X;  3EVQ A;  4HJ8 A;  3GTM B;  3PIO 3;  4OWT B;  1JT8 A;  5C4Z A;  1SNO A;  4JOI A;  4OIK A;  2K6A A;  1PDQ A;  1VQE A;  4GLV B;  4G4K A;  2YYZ A;  3TP5 A;  4DR1 Q;  4LF7 Q;  2WAQ B;  1F2Y A;  1SN8 A;  3I4M B;  3UI2 A;  5EBC A;  1MBY A;  4ILW A;  3MXU A;  2IT1 A;  4B3M L;  1VQG A;  1BF4 A;  1F9P A;  4BBS H;  2AWO A;  1HH2 P;  3GTJ H;  4QIW E;  4FF4 A;  1AW7 A;  3K59 A;  4IAL A;  4DAY A;  5A2Q E;  4KLK A;  3KJP A;  2BE5 D;  1K3R A;  2K75 A;  3F8T A;  1XNQ L;  3GDE A;  1H9S B;  1CSP A;  3NPP A;  2RDH A;  4A3K H;  2IHF A;  5IWA L;  1ENC A;  5JJL A;  5FO9 B;  2D5D A;  1SDF A;  4ZLT F;  1Y14 B;  5D65 A;  3FPP A;  1WTH A;  1E2Z A;  4RCO A;  4IUR A;  1Y1W H;  4RWS C;  2Z0S A;  5TSS A;  3S14 H;  1HFN A;  1OXX K;  4A3D H;  3PIO A;  5CV4 A;  4R4I A;  2E74 C;  4HCE A;  2UXD Q;  4PMC A;  1X9N A;  3PGZ A;  1NY4 A;  1QWY A;  3UDX A;  2HT1 A;  2NYZ D;  2WFW A;  4C3J G;  2OCE A;  4GS3 A;  1EIY B;  2NTT A;  5IT9 L;  1FJG Q;  3O13 A;  1AZQ A;  1L0W A;  3H6M A;  3DUZ A;  2RDG A;  5C4X H;  2LS0 1;  3CRK C;  4G7H C;  3PO3 H;  2EY2 A;  2JJQ A;  1KNA A;  1MJE A;  3E5S A;  1BQQ T;  2NUC A;  1IL8 A;  1V9P A;  2B2Y A;  2VB3 X;  3S1M B;  4DR2 L;  5C0X G;  4OEL B;  3HOU G;  1AFP A;  1TWH H;  1B3A A;  3OIP A;  5GAD C;  1KRT A;  1R4Q B;  1X6O A;  1TWC H;  1DON A;  2ZTD A;  2K4K A;  4HSP A;  1I50 H;  3KYH C;  1UE5 A;  3S24 A;  2EDG A;  1N34 Q;  2PO4 A;  1WTP A;  3RN5 A;  5C3E G;  2JA6 H;  5BR8 L;  2YTV A;  4PG3 A;  4QUF A;  1EY4 A;  1YEZ A;  3ITP A;  1OXU A;  1V1Q A;  1HPC A;  3TZU A;  3HS0 C;  4A75 A;  1J5E L;  4LF4 Q;  3PO2 G;  3WOF A;  2EXZ A;  2XIW A;  3KJO A;  1PRT C;  3A7L A;  1R9T B;  1CI3 M;  2R6G A;  5JPN C;  3IRB A;  2A6E D;  4QB4 A;  1KC8 C;  4X3K A;  4X65 L;  2R61 A;  3IFT A;  1BXT A;  4P74 A;  5HY6 A;  2PCF B;  4FXD A;  3S9W A;  2CQA A;  3TN2 A;  4PMB A;  1RTO A;  2JA9 A;  1PTO F;  2X69 A;  2CCZ A;  4L5T A;  1PHJ A;  4CJ1 B;  1NTG A;  2JXM B;  3NEM A;  5CV5 A;  1ENA A;  1U4P A;  3B6Y A;  4BA2 I;  3SK6 A;  1Z6H A;  4MZ9 A;  1L1O B;  4R4Q A;  3IAY A;  3R2T A;  2WAQ E;  1EQT A;  2EYH A;  4HJ5 A;  4BBS G;  1KQS A;  2WB1 B;  1JE5 A;  4KK7 A;  3OPO A;  1SE3 A;  1SJH D;  5E4W C;  4J8Q A;  4YHH L;  2C35 B;  3K6O A;  3HOZ H;  4JOI C;  1WCM H;  4RGT A;  1BCP B;  4A3K G;  3HRZ C;  1NBW A;  4HMI A;  1VQJ A;  4OON A;  4PZ8 A;  1FGU A;  3GTG B;  3J81 c;  2FFK B;  5DAU A;  4QCL A;  3S1R B;  2QCP X;  2RCN A;  3C2P A;  2DNE A;  5C44 B;  1Y1W G;  5EKL A;  3CD6 A;  5HGQ A;  1PLF A;  5I9O A;  4A3D G;  3SHL A;  1SMY C;  2Z4I A;  1Y8P B;  5A2Q L;  5FK9 C;  2K32 A;  1GUG A;  4R8N A;  2KCT A;  4ABN A;  4J6H A;  4JI2 Q;  4YCW A;  2UXC L;  4KHP Q;  2ZTE A;  5FLX E;  3TP6 A;  5IYD G;  4FF1 A;  2MO0 A;  5IGE A;  1TWF B;  5KYL A;  1EIH A;  1XNR L;  3R2I A;  1K83 H;  4XQN A;  4BY7 B;  1QVG A;  2NZH A;  1SNP A;  3JC6 6;  1QUQ B;  4KV6 A;  1WI5 A;  5C4X G;  2SDF A;  3M4Y A;  1SMX A;  5DNF A;  1PH6 A;  2F0Q A;  4KN7 C;  1O7L A;  3PO3 G;  2Y0S B;  4JI3 Q;  2NZ1 D;  4B3R L;  1Y1V B;  2F3W A;  1KDA A;  3GTP B;  3KF8 A;  2I0Q A;  4HCS A;  5LMN W;  2L1B A;  3P20 A;  4A3F H;  2PI2 E;  1F2Z A;  2FJ2 A;  5CBE E;  4Z9C B;  1KAB A;  4GLX A;  1PV4 A;  4F8M A;  3PUY A;  4B9W A;  5FLM G;  4KKT A;  3NQI A;  3J7A V;  4AYB B;  1WTW A;  3GTK B;  2QGQ A;  4YWM A;  2MFI A;  1HR0 W;  1QB5 D;  1IW7 D;  4LMQ D;  4APV A;  2CW0 D;  3T1Y Q;  2K5V A;  1HUM A;  1VQN A;  4DR7 Q;  3D8G A;  1HNZ Q;  4Y52 H;  3FKI H;  2B2Y C;  4X64 L;  2JA6 G;  1F9Q A;  1EOV A;  4IZ8 A;  1TWG H;  1AZP A;  2OXP A;  1GUS A;  2R93 H;  5LMU L;  1C4Q A;  4ZCK A;  5IGD A;  3HG9 A;  1FGB D;  1I4X A;  1V1P B;  4NXM Q;  2NWG A;  2CQO A;  5COY A;  4JI5 Q;  2RBM A;  3K57 A;  1WVL A;  4B3S Q;  3JAM c;  2FMC A;  3STB C;  3RUZ A;  1X65 A;  4J15 A;  1BUV T;  4JVZ A;  4JBJ A;  5EKK A;  5LMN Q;  3F2B A;  1N36 Q;  4AQY Q;  4JV5 Q;  2PNH A;  1XMO Q;  5ELF A;  4K5X A;  4DK6 C;  2AQ1 B;  1EYC A;  2J0T D;  3R93 A;  1XYI A;  3I4N H;  1JWU D;  3GTO B;  2HDM A;  2YU9 B;  2UU9 Q;  3I7F A;  4JYA Q;  1IHZ A;  1PH7 A;  2EY1 A;  1KAA A;  1LT3 D;  4RMF A;  2IJ0 A;  2K5Q A;  3TP7 A;  3F2U A;  3HOZ G;  4J1M A;  1WCM G;  3GV3 A;  3GTQ H;  1XXG A;  1H9J A;  2WB1 E;  4UDU C;  4BWG B;  1X3P A;  3NTI A;  1N33 Q;  2H4O A;  2JYO A;  4FDB A;  4ID6 A;  4ME3 A;  3ONA B;  3K0X A;  3J81 i;  1HNX Q;  1KDB A;  2NVY H;  1P8L A;  5IGC A;  3P7J A;  1S72 A;  1ONL A;  3NWS A;  1FNW A;  5I2Y A;  1Q12 A;  3A5Z B;  4GOP A;  4QL5 A;  1EWH A;  2A5H A;  4DA2 A;  1BCP F;  2G9D A;  1I4H A;  3S16 B;  1RKN A;  2N49 A;  2K5H A;  3EIV A;  4C3J B;  2KQ3 A;  3PSI A;  1YBY A;  2JN4 A;  4IJL A;  3OMG A;  3NEL A;  4LFC L;  1ICF B;  3A5U A;  3F2C A;  4XQQ A;  2E2H H;  5CV6 A;  3NSW A;  4HMJ A;  3MWY W;  1C8C A;  1VQH A;  1K73 C;  1F2M A;  5ELD A;  4HED A;  3TP8 A;  2NVQ B;  1PFM A;  4IQZ A;  4X62 L;  4I65 A;  3SVM A;  3G71 A;  3T16 A;  1VQ9 A;  3KFU A;  1EEI D;  1T5X D;  2DNC A;  4LF6 L;  5M9O A;  4F87 A;  3HOU B;  5NUC A;  5FLX L;  4A3F G;  4LF8 L;  1RD9 D;  3E9I A;  2JEB I;  3H94 A;  4GNX B;  1HFG A;  2A8V A;  4DU9 A;  3ND8 A;  4N8X 1;  3RZO H;  4O1N A;  4NMZ A;  2UUA Q;  3AU7 A;  2Q8R E;  1YVC A;  4KKU A;  4XYO A;  4HJ9 A;  3BDC A;  4X3S A;  4HTH A;  2F0G A;  5IGB A;  2CHB D;  1ML0 D;  4OO1 I;  3MHB A;  2UUC Q;  3V05 A;  1HJP A;  1ENF A;  1SJE D;  5C3E B;  3KDF A;  1SNC A;  4DR3 L;  3S2D H;  5I4D A;  4GN3 B;  1H9S A;  3CHB D;  3I2Z A;  4KHZ A;  3MEH A;  3P1H A;  3PO2 B;  1ILP A;  4A3M H;  5C4J B;  2ICI A;  2K5W A;  3HP3 A;  3FP9 A;  2QEX A;  1XPO A;  2RCF A;  2R93 G;  1EFW A;  3K5N A;  1R4P B;  1NJI C;  1W2B A;  3T13 A;  1IBL Q;  3E6Z X;  4PMW A;  4B3M Q;  2MGS A;  1FYC A;  1CHQ D;  1CZW A;  2C5C A;  1IL2 A;  3A54 A;  1YJN A;  5K36 H;  3QWN A;  4WRD A;  2LSS A;  2G5D A;  3JAM i;  2VL6 A;  5G3L F;  2IX0 A;  3ICE A;  1V43 A;  4BBS B;  3DLL A;  1D1K A;  3VYS A;  1QVF A;  4M8A A;  1EQQ A;  3GTJ B;  1CTM A;  4DUY L;  2B63 H;  1DOM A;  3I4N G;  3I4L A;  5ELE A;  1HZB A;  1ZXT A;  3FDT A;  3TRZ A;  1WJJ A;  2PI2 A;  2WKC A;  4BY1 H;  5FO7 B;  4A3K B;  4RG1 A;  4DR6 L;  1N8R C;  2PZU A;  3U9S A;  3LWE A;  1TKW B;  1UEA B;  1PFB A;  1LV9 A;  2IPK D;  2Z1C A;  1K8O A;  3T4A C;  1SE4 A;  4HJA A;  1GHJ A;  2K14 A;  1PRT D;  3J80 i;  1SAP A;  2P5Z X;  1Y1W B;  3T51 B;  2Q8T A;  1AN8 A;  3V2T A;  4A3D B;  2IL8 A;  3T1H L;  3N52 A;  4IFD J;  3H09 A;  2VUM H;  1HZC A;  1S5E D;  4C1N K;  4HIK A;  5CGK A;  1EQR A;  1PMR A;  4WFN 3;  4A3G G;  1CM9 A;  2CH4 A;  4NXN L;  2VQE L;  1A3U A;  2IW3 A;  1N9W A;  2R3Z A;  1GUW A;  3PCO B;  1ET6 A;  3RZD H;  5C4X B;  2H1E A;  1SYB A;  3PO3 B;  1UAP A;  4IUP A;  1YJW A;  1KTK A;  2LXK A;  2F1M A;  4CBV A;  4LF9 Q;  2EY5 A;  1D5Z C;  4B3T L;  2X6G A;  1PFN A;  2NB0 A;  3KF6 B;  3ULJ A;  4GOP C;  2VXW A;  1VQF A;  2A1A A;  4FP5 D;  1JWM D;  4UP9 A;  1TWH B;  3OTO L;  4OO1 H;  2RA4 A;  3HKS A;  2OWO A;  1QCB D;  1TWC B;  1NMF A;  1ET9 A;  4LFB Q;  4YIJ A;  1PTO C;  4BS9 A;  4K14 A;  1SMY D;  1I50 B;  1TS3 A;  1E0B A;  3HKZ G;  3CQZ H;  1PH8 A;  1JB7 A;  2BH8 A;  1SYE A;  1J5E Q;  3BVZ A;  4LUV A;  1D1I A;  1YIJ A;  5GQO A;  1V8Q A;  1XMQ Q;  4HIO A;  2JA6 B;  2CVR A;  2A68 C;  2JA8 H;  3VDY A;  4IPH A;  1U4L A;  1YNJ D;  2L12 A;  4O2D A;  4CHT B;  2XNA C;  3HOV H;  4NDX A;  3PUZ A;  5D3D A;  2F0E A;  1CK1 A;  1DGS A;  2IHE A;  2YTY A;  3DWQ A;  4F88 A;  1A3T A;  1O78 A;  1Q1E A;  3F1Z A;  1RL2 A;  3MXN A;  3S1Q H;  1XWE A;  5K36 G;  1LTR D;  2HHH L;  3FRP B;  4JI0 L;  1CT1 D;  1X3E A;  4JI6 L;  1PFS A;  3Q8D A;  4C3I B;  2K28 A;  3CKI B;  3K5L A;  2XRS D;  4DV2 L;  2K1B A;  4O0A A;  1N32 Q;  4JC0 A;  1I94 L;  1RTN A;  3TBI B;  1JJG A;  4BA1 I;  5JAV A;  2K5N A;  4BY1 G;  3HOZ B;  1K28 A;  1WCM B;  2BDO A;  3IL8 A;  1HCZ A;  5K5P A;  2N88 A;  2E2I B;  4OL7 A;  3CPF A;  2EJF C;  5M3F H;  2F0V A;  4ME5 A;  4DV0 L;  2MHV A;  4KHV A;  3BDO A;  4A93 H;  3EFX D;  5IT9 c;  1EU4 A;  4C3H H;  3NE5 B;  2PQE A;  2OTJ A;  2O2L D;  3STB D;  3SGI A;  1DJR D;  4R1J A;  2NVX H;  2JA7 H;  3U50 C;  4ZYS A;  1JOO A;  1I4R A;  4XDX A;  5ELC A;  1K83 B;  2UUB L;  1NR4 A;  3VA5 A;  5LL6 S;  2E76 C;  3CW2 C;  3PF4 A;  2OEO A;  4QY7 A;  3A8I E;  3C1E A;  1AE3 A;  1VDZ A;  1CSQ A;  4KMU C;  5IGG A;  4C2M H;  2B29 A;  3FVQ A;  3H15 A;  1AH9 A;  3OOC A;  4K8I A;  1I6H H;  5IGF A;  3MTS A;  5IOC A;  4GLA C;  3I70 A;  5DM6 3;  3K7A H;  2F52 A;  1HQM C;  2LY7 A;  4OWX B;  1X3G A;  4DR5 L;  1U4M A;  1UE6 A;  3CCJ A;  3UDI A;  1MI2 A;  4A3F B;  2K52 A;  4JI1 Q;  1EU3 A;  1HNW L;  4H7B A;  4OO1 G;  2KHI A;  3GTL H;  2DJG C;  3CRL C;  1CKN A;  4IN3 A;  1EYG A;  4U67 3;  5JEA G;  1OXV A;  3FHW A;  1NAP A;  2VQF L;  2XWJ B;  1SE8 A;  1LTS D;  2ENB A;  2D0O A;  2PW7 A;  2R92 H;  4A3B H;  4A3C H;  3X3N A;  2J7Z A;  1DXM A;  3OWF A;  1AP0 A;  5J39 A;  4TRD A;  4WJ4 A;  4AIM A;  5A35 A;  1EZ8 A;  3TS0 A;  3FPU B;  2E5L Q;  3G7L A;  4LK1 C;  3NBH B;  1IBK L;  2E8G A;  1TWG B;  2JA8 G;  4R8I A;  3PUX A;  2FIN B;  2R93 B;  3SR1 A;  2HCI A;  1Q46 A;  4FXG C;  3HOX H;  1TWA H;  4JI8 L;  1LTG D;  2AHO B;  2QDB A;  4IUQ A;  5M5Y H;  1O7I A;  1WFQ A;  1SFO H;  3QOL A;  4LAA A;  1VQP A;  3KBG A;  1VS0 A;  4XTC S;  4YY3 Q;  3L2P A;  1JOQ A;  1MD2 D;  4DUZ L;  4DV6 L;  1BCP C;  1J6Q A;  4WOR A;  3FMC A;  2A69 C;  4K5V A;  3HGB A;  1RJT A;  3I4N B;  4O42 A;  1G2T A;  3A55 A;  5KNC A;  2B2T A;  1KL9 A;  3KBX A;  1H95 A;  3TSS A;  1YHA A;  2RQX A;  4DGZ A;  5KNB A;  3GTQ B;  1VQ7 A;  4HN7 A;  5C5L A;  3L3O C;  2XVS A;  4OHJ A;  2DUD A;  3ERQ A;  1DD2 A;  1JE4 A;  1PTO H;  5M3F G;  1GOZ A;  2ZT9 C;  2A74 C;  4JCV E;  4GNX A;  2MNA A;  4JI4 L;  5KND A;  2A6H C;  2QF7 A;  4H13 C;  2L9H A;  4C3H G;  3EJI A;  4LFC Q;  3JAM E;  1Q81 C;  2F0I A;  1VQO A;  1I5F A;  5COR A;  1DM0 B;  1S3O A;  4A3G B;  3ND9 A;  1BBW A;  3W1B A;  4HR7 B;  4V19 0;  2K01 A;  5KEE A;  1SND A;  4N9P A;  2JA7 G;  3W3A A;  1I4P A;  3OSO A;  4JG2 A;  3U4Z A;  2ES2 A;  4X62 Q;  1VQI A;  5KYI A;  1SNM A;  4R4O A;  1PRT B;  3NTK A;  1D5X C;  1IYJ B;  4LF6 Q;  4QUC A;  4EX5 A;  3SEB A;  1HXY D;  3KLW A;  1F2L A;  1KLU D;  5IE8 A;  1S5D D;  1PH9 A;  3H3V C;  3VR6 A;  5I2X A;  1LTL A;  3NTH A;  3E0E A;  4UAI A;  2EXD A;  3J80 E;  1MKH A;  2BDN A;  5M5X H;  3GQB A;  1QE6 A;  3RZO B;  2MJ8 A;  1EWI A;  4DNI A;  5KGU A;  1YNJ C;  1EZ6 A;  1GVP A;  2EQS A;  2VW9 A;  4ZAI A;  3RLO A;  2HUG A;  5C6A A;  3CP0 A;  1L0Y B;  3NHH A;  4DV4 Q;  1HRJ A;  5LHY 1;  2DY8 A;  3HKZ B;  2UXB L;  2C9O A;  3D0F A;  1D7Q A;  1H9R A;  1KAW A;  4G57 A;  4A3B G;  4A3C G;  3DWP A;  1IBM Q;  1KIX A;  3NEN A;  1ICW A;  1VQM A;  4KKS A;  4MHE A;  4HAE A;  4MNO A;  2N8N A;  4GKJ L;  2YV5 A;  4ZUI A;  3WOE A;  1XX8 A;  4K0K L;  4EQO A;  2KEE A;  1S40 A;  2X6L A;  2IX1 A;  4RAU C;  5EPJ A;  3A56 A;  3DMU A;  4PZ7 A;  2UXD L;  4LFA Q;  3HEJ A;  3T53 B;  3HOX G;  1L0X B;  4A3I H;  4DK1 A;  2L4N A;  3NBI A;  2F4V Q;  4X66 L;  2ZM6 Q;  1DYQ A;  4NP5 A;  4UPA A;  4LF5 Q;  1NSN S;  3TRE A;  2WAC A;  2F0O A;  3MAQ A;  1STB A;  1PTO D;  4JBK A;  1FVI A;  1LTI D;  3PQI A;  4F7X A;  3PUW A;  3T56 B;  2E2J H;  3S17 H;  4DR6 Q;  4MTN A;  1PYS B;  2DY7 A;  2KJX A;  2L11 A;  4CDF C;  4N9T A;  1JQY D;  3NXW A;  3CCS A;  1TII D;  4BY1 B;  4KI0 A;  4ZK9 B;  1OXT A;  1LTA D;  1I4G A;  3AMU A;  4LWC A;  4DR4 Q;  2A68 D;  1LT6 D;  1QIL A;  3H3V I;  2AQ2 B;  4POF A;  3C46 A;  2GN5 A;  3ULP A;  2E2D C;  3S15 H;  2KBN A;  3M4O B;  4RH6 A;  4CKC A;  1V1O A;  3AFP A;  1WOC A;  3J81 j;  1U5K A;  2VQE Q;  3F2D A;  1KNE A;  3PV0 A;  1YI2 A;  1LAC A;  3CCU A;  1PH5 A;  2B2T C;  5DEH A;  3J7A 5;  4RKB A;  2EZV A;  4EQP A;  3M3Y H;  1ROD A;  4CJ0 B;  3MXG A;  4QMG A;  4IFD I;  4TSS A;  4A3E H;  3PUV A;  2JA5 H;  1UEB A;  4MTK A;  1GD7 A;  1HZA A;  1EWC A;  3RZD B;  3QO2 A;  5FLX c;  3A74 A;  2M2L A;  3A8J E;  4GNX C;  3IKJ A;  1SNQ A;  1Y8N B;  1NCV A;  1G51 A;  4DKA C;  2LFN A;  1KXL A;  4QGU A;  1D8L A;  1XJV A;  2F0N A;  1PH2 A;  2A19 A;  5IP9 H;  2FMM A;  1D2B A;  3I4O A;  1H9K A;  3DHQ A;  1STH A;  4A3L H;  1PRT F;  1P16 A;  1LTB D;  3UE0 A;  2B2V A;  3PMF A;  3W1G A;  5J1Z A;  1SLJ A;  2PMZ B;  1CZG A;  1G91 A;  1TT2 A;  1JCK B;  4I7Z C;  5FJ8 H;  4GN5 A;  1PVO A;  4IOC A;  1CHP D;  3CQZ B;  4WJ3 M;  4JPB W;  1A2T A;  2Y0S E;  2VS1 A;  4ULL A;  2PYK A;  1SYF A;  1O80 A;  3IFD A;  2L15 A;  3J80 L;  5CYU A;  5LL6 X;  3HKZ E;  4DV3 Q;  1YHQ A;  5IYC H;  3CC2 A;  4LUZ A;  4A3J H;  1CQV A;  4ALP A;  2JA8 B;  2XTI A;  4YWK A;  5JJI A;  4Q0F A;  1B70 B;  3I90 A;  2F0T A;  2QDL A;  4BY7 H;  1B2T A;  1I3Q H;  5GAG C;  1K0S A;  3QOJ A;  4RCN A;  5I9P A;  1K8M A;  2Z8L A;  4AYB E;  1RIP A;  2JEA I;  1EY5 A;  4R9W A;  4X6A H;  3HZX A;  4JBW A;  4DV1 L;  2FXQ A;  2Z9H A;  1SE2 A;  4C56 C;  4KHP L;  4A3I G;  3RR5 A;  4JBM A;  3BYT B;  3FKI G;  3BYY B;  1B44 D;  1PYW D;  1YHB A;  2EIF A;  1G29 1;  4DV2 Q;  2BA1 A;  2NTS A;  1G8Z D;  4FF3 A;  5JJZ A;  1I94 Q;  2ZXP A;  1UNS A;  3AQQ A;  2L0C A;  5FKA C;  3K5O A;  5M5W H;  4BBR H;  1PH3 A;  1YZ6 A;  3LGJ A;  3CMA A;  3SK5 A;  3H3V H;  1RF2 D;  5C0X I;  4G7Z C;  2D2C C;  2CWA A;  1HTL D;  2K03 A;  3K7U C;  4DV0 Q;  1JMC A;  1CKM A;  2Q2T A;  2JK8 A;  1E24 A;  1XNQ Q;  1MGS A;  3X3M A;  3K80 C;  2L55 A;  4DF7 A;  1MJC A;  5IWA Q;  4TVA B;  5M3F B;  2PW5 A;  3KLS X;  3TZD A;  2B3G A;  2YTX A;  3T1Y L;  1B8A A;  2HQL A;  2Q2H A;  2KEN A;  1DOL A;  5D14 A;  4DR7 L;  3SK4 A;  4IFD H;  4C3H B;  1VCI A;  1RHP A;  1HNZ L;  1JOR A;  5HGT A;  1QG7 A;  1Q86 C;  1ZYR C;  1EY6 A;  2ZXR A;  1D5M C;  2MO1 A;  1ZEQ X;  2HD3 A;  2JA7 B;  1EFI D;  4KTA A;  1X54 A;  4BXX H;  1JJC B;  3S14 B;  1CUK A;  2EJG C;  1BCP D;  2MP1 A;  4A3E G;  4M1U B;  4QIW B;  5C3X A;  1CA5 A;  2JA5 G;  4L6T B;  2WP8 J;  3Q23 A;  1WD0 A;  2A69 D;  4CDE C;  4CJ2 C;  4LUO A;  4DR5 Q;  4RGM A;  5AJ3 L;  1S5B D;  4JI5 L;  4C2M B;  3M85 A;  4H0L C;  4B3S L;  4OX9 L;  4ZKC B;  1W3S A;  2I5H A;  1GXD C;  3NQT A;  3OMC A;  5ELO A;  1W6K A;  2F0W A;  2KCN A;  5LMN L;  1LLR D;  3K7A B;  4AQY L;  4JV5 L;  1XMO L;  5CBA E;  1BOS A;  1Q82 C;  1X3Q A;  3Q0A A;  1VQC A;  2VQF Q;  4IUV A;  4JK1 C;  5IP9 G;  2E75 C;  3D3R A;  1E22 A;  1TU2 B;  4DR2 Q;  1B7Y B;  4A3L G;  1J9O A;  3I73 A;  3GTL B;  4EQN A;  2A6H D;  2F0M A;  1HR0 L;  2IY5 B;  2V1C C;  5FJ8 G;  4A3B B;  4PQX A;  5C4H A;  1SRU A;  2HIV A;  4KY5 A;  4UP8 A;  4A76 A;  5M3M H;  2PMZ E;  1D6E C;  4ZQ3 A;  1A0I A;  2RSN A;  5C3W A;  1A15 A;  2PQA B;  3S16 H;  2HIX A;  5IYC G;  4DNT B;  4C3J H;  1PZI D;  1VQA A;  4A3J G;  4L63 B;  1L1O A;  5F2D A;  5BR8 Q;  4FNF A;  4B08 A;  2R7Z H;  4TKO B;  2D0P A;  5JOB A;  2B2V C;  2AMC B;  4K2K A;  3HOX B;  1WTV A;  1TVX A;  2ATW A;  1QOH A;  1QJO A;  2QIL A;  5EAY A;  2K04 A;  5M5Y B;  1K8G A;  1X32 A;  1SFO B;  1EOT A;  4DUZ Q;  4DV6 Q;  1BKB A;  2KHS A;  1PYB A;  1E3P A;  4TQU S;  2FHT A;  3C1F A;  4X65 Q;  5JVG 3;  1B3Q A;  4A3M G;  3Q6S A;  1A62 A;  5ISR A;  3BS1 A;  4DN4 M;  4BBR G;  4P72 A;  1M4V A;  2B2W A;  3I8Z A;  5JJK A;  3W5O A;  1F9S A;  2OT2 A;  3LNN A;  4GOP B;  2A73 B;  3OYY A;  1Z9F A;  1LT4 D;  3MEF A;  2MPM A;  5C0X J;  2UUA L;  1VF7 A;  4YHH Q;  1EIF A;  2PZW A;  2JQO A;  2M00 A;  2SOB A;  2B63 G;  1M8A A;  2D9U A;  2Z6B A;  3J7A F;  3CC7 A;  3K5M A;  4UP7 A;  1QUQ A;  4ZRZ A;  1G6P A;  5IP7 H;  1OO9 B;  3U58 A;  2UUC L;  4P2C B;  4IFD G;  3UDG A;  3CC4 A;  3RLF A;  5FO8 B;  5KRU A;  3KOJ A;  3TEH B;  1B50 A;  1PH4 A;  2ASB A;  4BXX G;  3D4D A;  3LWU A;  3HOW H;  2UXC Q;  4DXF A;  4NPS A;  5H1S E;  1HUN A;  3D6C A;  4KD4 A;  2DJF C;  2PNR C;  1XNR Q;  1IBL L;  3UDF A;  4IPC A;  4RHR A;  2VUM G;  1C0A A;  2ZTC A;  2KA7 A;  2VNU D;  2NZO A;  1KDC A;  2RHS B;  1BBU A;  5IY0 A;  3I55 A;  3C3L A;  3MVV A;  4B3R Q;  1NE3 A;  1LO5 D;  2Q2U A;  3KDF B;  5EPL A;  1LYL A;  3Q22 A;  1HHV A;  3OWE B;  2UXB Q;  5M5X B;  4P73 A;  1KLG D;  2I5L X;  2EE1 A;  4DV5 L;  4HID A;  2F3I A;  5GRO A;  1IKM A;  1FD7 D;  2PZT A;  1SYD A;  2CWP A;  1GHK A;  1RDP D;  5GAE C;  4GKJ Q;  4YWL A;  4GKK L;  1NMG A;  3H0G H;  1V1P A;  4DPG A;  3J81 E;  2ZJP A;  4K0K Q;  2XSC A;  3PIP 3;  3MA2 B;  5M3M G;  4DV7 L;  1VQ6 A;  4ODG A;  2ZJR A;  1A2U A;  3EQL C;  3W2D A;  1PXU A;  3CCL A;  5IYD H;  2NVT H;  3J7Y W;  1GO3 E;  1MIU A;  4X64 Q;  2N55 A;  1BNZ A;  2R7Z G;  1K9M C;  4X66 Q;  4IJH A;  1KD1 C;  2H5X A;  3ER0 A;  1K8A C;  4A3I B;  3CCM A;  5CR3 A;  2EJM A;  2WKD A;  5LMU Q;  3FKI B;  1ESF A;  2Z6K A;  1O7Y A;  3SE0 A;  4XIG S;  1QZG A;  4YCU A;  1SYG A;  3I56 A;  1TS5 A;  3BDL A;  2F0K A;  1E2W A;  1E1O A;  2RVL A;  4A4I A;  5E3F A;  1LT5 D;  4CGY B;  1TQO A;  3E0J A;  1OTC A;  3G6E A;  1VQL A;  3HOV G;  5GAH C;  4DAV A;  2AUJ D;  4DAP A;  4LF9 L;  2E2J B;  5FLM H;  1L1O C;  1BO0 A;  2D62 A;  3S17 B;  1GJX A;  3URY A;  1T5E A;  4FYD A;  4KJO A;  1YJ9 A;  4PNY A;  2JP1 A;  4K8J A;  1SYC A;  2EY6 A;  3DM3 A;  3PIP A;  3AB9 A;  4N8F A;  2IWH A;  4K6D A;  4Y7N H;  4QQB X;  1UWV A;  5EPK A;  2M9V A;  3NWT A;  3HOY H;  1Q3L A;  4LFB L;  3GO5 A;  1K0R A;  1MHW C;  2F0D A;  1Q90 A;  2RSO A;  3S15 B;  2K33 A;  1X56 A;  3CPW A;  1YNN C;  5IP7 G;  3VR2 A;  1VQ8 A;  3G4S A;  2B8F A;  4OGQ C;  4U68 A;  4XT3 B;  1WTO A;  2B2W C;  1XMQ L;  1HTP A;  2JE6 I;  4ZKB B;  1C9O A;  4MIU A;  4NW2 A;  3S2H H;  3WWV A;  3VR5 A;  3M3Y B;  4QJF A;  1II3 A;  3WDN A;  2AWN A;  3FEW X;  3NK9 A;  3DXJ C;  1JJ2 A;  4RHS A;  3I72 A;  1AEX A;  4GZY C;  2F4I A;  2NVY B;  4A3E B;  1FL0 A;  2EOT A;  1TXY A;  2EYM A;  3E9H A;  3MFY A;  2JA5 B;  3M7N A;  3HOW G;  3S1N H;  4A93 G;  1E7Z A;  1Q8I A;  4P75 A;  2O5J C;  1QNU A;  1L2F A;  5L37 A;  4JI7 L;  3OW2 A;  3AYH B;  3QJY A;  1M90 C;  3GTM H;  2WII B;  4C3I H;  2QKI C;  4DAM A;  4LW1 A;  1SBB B;  1Y8O B;  2XWB B;  3DEP A;  1SRO A;  3AFQ A;  2Q2I A;  1ZKO A;  3I4M H;  3NP8 A;  1KHI A;  2GA4 B;  3QB3 A;  5CV8 A;  3RNU A;  2E2H B;  1A3V A;  4CKE A;  2ICE C;  1GUN A;  1VF5 C;  2CH4 W;  4CDD C;  3RMH A;  1G2S A;  2E2I H;  4LF8 Q;  1TY2 A;  4DR1 L;  3HFZ B;  4LF7 L;  1N32 L;  4IOA A;  2VB2 X;  2CKZ B;  4L5Q A;  4DFA A;  4YCV A;  2KCC A;  3CU7 A;  2OQK A;  2GVA A;  1ZYR D;  3H0G G;  1GUT A;  3NUC A;  1BDO A;  5J3B A;  1YIT A;  1VQ5 A;  5I6Y A;  2EYL A;  3DEO A;  3BZK A;  3H91 A;  2N3S A;  3MXN B;  1LTT D;  4ZUJ A;  1JIC A;  3ZJY C;  1ESR A;  4R4C A;  3AEV A;  3V96 A;  3OIQ A;  1EIG A;  1IXR A;  4DV1 Q;  4A3J B;  3ZYY X;  2KVM A;  4G7O C;  3MZ5 A;  4DR3 Q;  2OF1 A;  1I3Q B;  2R92 G;  3K81 C;  2B39 A;  3D4R A;  3BJU A;  2QW7 A;  5DLQ E;  4P71 A;  1IYU A;  3J81 L;  2EYP A;  4RFB A;  1A6X A;  3S2D B;  4K6L A;  1NUC A;  3CXC A;  2B2U A;  5IOD A;  3PF5 A;  1J8I A;  2LXJ A;  2F0U A;  1DOK A;  4A3M B;  1CQF A;  2KEC A;  3BVM A;  1CA6 A;  4Q5V A;  4H44 C;  3MC0 B;  2KED A;  1BBX C;  4K5W A;  4LNQ A;  1PZK D;  4RA8 A;  3KUP A;  1STE A;  4DAY B;  5M5W B;  2AKW B;  1QNK A;  3L0O A;  4BBR B;  2KCM A;  4IO9 A;  2QA4 A;  1I6V C;  1B1Z A;  1S4Z A;  2NN6 I;  3KK7 A;  1FJG L;  2K05 A;  1IZ6 A;  4DUY Q;  1STN A;  1TY0 A;  4L8J A;  4MN3 A;  5E7N A;  4JI1 L;  2R7D A;  3S1M H;  3TQY A;  2Z6K C;  5D3I B;  4I7A A;  3SXH A;  4PV1 C;  1IYV A;  1XTC D;  5IYB H;  3KLR A;  2B63 B;  3HOY G;  1QZH A;  3Q24 A;  4C1N I;  3SDZ A;  4JW0 A;  3SK8 A;  2LKV A;  3VYU A;  3EN2 A;  3QIA A;  5KIX A;  5BN5 A;  2BE5 C;  2E5L L;  1JWS D;  3KF6 A;  1WTX A;  3T1H Q;  3ERS X;  4IPG A;  5AJ3 Q;  4OWW B;  2HQE A;  3GV6 A;  1DCZ A;  1SEB D;  3I3C A;  4IPD A;  4OX9 Q;  3K0Y A;  4NXN Q;  2F0H A;  1N34 L;  1CKN B;  1TR5 A;  2XN9 C;  2PQA A;  1S5F D;  1R9T H;  3L9A X;  2VUM B;  2MQH A;  1EQV A;  1VMC A;  3QR8 A;  2O5I C;  5DM7 3;  3TME A;  4YY3 L;  4C3I G;  5EBD A;  4LF4 L;  2NBF A;  2F0S A;  4IUN A;  2WAQ G;  1XPR A;  5I6W A;  2SEB D;  4B3T Q;  1AE2 A;  1HR0 Q;  2Q8I B;  3I4M G;  1WD1 A;  2F0L A;  4QF4 A;  3J80 c;  2BA0 A;  4DK0 A;  3OTO Q;  1CKO A;  3JAM L;  1T9H A;  3G48 A;  4CKB A;  2F03 A;  1SR3 A;  3EBE A;  1Q8K A;  2AUK A;  1DZ1 A;  3MXP A;  1FNU A;  5IIF A;  5M3M B;  1IKL A;  4KJN A;  5HUR A;  3J7Z C;  4KN4 C;  5JVH 3;  2QEJ C;  2KOL A;  5T1I A;  3GTG H;  1X3F A;  1LUZ A;  3RD4 A;  3D4W A;  1PH1 A;  1GUO A;  4A3G H;  3S1R H;  4FF2 A;  1BVS A;  1A8V A;  1MSH A;  2K7V A;  2EYF A;  5C44 H;  3OHX C;  2R7Z B;  3R8B A;  1XTD A;  4S3S A;  3UE1 A;  5JPM C;  1STG A;  1UUP A;  1JB3 A;  2TMP A;  2VZA A;  4UHV A;  1VQB A;  2DGY A;  3CCV A;  4HJ7 A;  2HDL A;  4GN4 B;  1B4O A;  1C7Y A;  4R4T A;  4L5S A;  1VQK A;  1TWF H;  1A63 A;  4OEM B;  2NN6 H;  1VMP A;  3TDQ A;  3CCR A;  1ASZ A;  1U0L A;  4KY7 A;  2RHQ B;  3HOV B;  4PZ6 A;  5BN4 A;  1F77 A;  4JI2 L;  3GP7 A;  3R3O A;  2R7F A;  1VQD A;  2HHH Q;  1EUJ A;  2G9H D;  3K58 A;  3QG1 A;  1Q7Y C;  4JI0 Q;  4JI6 Q;  1Y1V H;  2O4X A;  1EY9 A;  3CF5 A;  2A6E C;  4IUU A;  4OIJ A;  4EQ5 A;  3GTP H;  2Z4H A;  3S1Q B;  1SXT A;  2F0F A;  1B9M A;  5CV7 A;  3KLS A;  4E6I A;  1I4Q A;  1YNX A;  2KUM A;  2B2U C;  4JI3 L;  1Z47 A;  1EY7 A;  2HCC A;  5IYB G;  1W6J A;  4V0B A;  4DV4 L;  1WYD A;  2EPB A;  2CFM A;  1MSG A;  3GTK H;  2LMC B;  1LAB A;  1E2V A;  1XPU A;  1STA A;  1GM5 A;  1IBM L;  3VR3 A;  3BVG A;  3BZC A;  3BZD B;  4HIM A;  2EYO A;  1LM0 A;  4RKL A;  5T1G A;  3VYR A;  3K8A A;  1ASY A;  3M4P A;  3P75 A;  1H9M A;  1STY A;  5ELN A;  1HA6 A;  1WTQ A;  1QVC A;  2AQ3 B;  2TSS A;  5C5M A;  4KY6 A;  3DM1 A;  3BG3 A;  3U4V A; 
#chains in the Genus database with same CATH homology
 3U58 A;  1KL9 A;  4LFA L;  2UUC L;  1H95 A;  1X65 A;  4J15 A;  5LMN Q;  4JBJ A;  1PA6 A;  1N36 Q;  3F2B A;  1KRS A;  1YHA A;  4AQY Q;  4JV5 Q;  2PNH A;  1XMO Q;  1M1K C;  4IFD G;  2UUB Q;  3UDG A;  3KF8 B;  1VQ7 A;  3CC4 A;  3RLF A;  4DK6 C;  2F4V L;  2DUD A;  3KOJ A;  3TEH B;  3I4N H;  3BU2 A;  2ZM6 L;  3GD7 A;  4L5R C;  5M3F G;  4DV5 Q;  1PH4 A;  4LF5 L;  2ASB A;  2UU9 Q;  4JCV E;  3I7F A;  4GNX A;  4BXX G;  1PH7 A;  2MNA A;  4JYA Q;  3HOW H;  2UXC Q;  4JI4 L;  4RMF A;  1UE1 A;  3A0J A;  4NPS A;  5H1S E;  3CCQ A;  4GKK Q;  4NXM L;  1GKH A;  1XNR Q;  3HOZ G;  1WCM G;  1IBL L;  3GTQ H;  3UDF A;  4IPC A;  2WB1 E;  4LFC Q;  2VUM G;  1C0A A;  2ZTC A;  1Q81 C;  2VNU D;  1N33 Q;  1VQO A;  2NZO A;  1HNW Q;  1I5F A;  2RHS B;  3GTO H;  4FDB A;  1S3O A;  4NB3 A;  4ME3 A;  4DV7 Q;  1BBW A;  1BBU A;  5IY0 A;  3W1B A;  3I55 A;  1N36 L;  2YU9 H;  3M4O H;  2JA7 G;  3K0X A;  2WB1 G;  3J81 i;  4JG2 A;  2NVY H;  3U4Z A;  1HNX Q;  1P8L A;  2ES2 A;  4B3R Q;  1NE3 A;  4X62 Q;  1VQI A;  1S72 A;  2Q2U A;  3KDF B;  4DR4 L;  4R4O A;  1LYL A;  3RLN A;  1IYJ B;  2UXB Q;  1Q12 A;  3CAM A;  4P73 A;  4LF6 Q;  4EX5 A;  2ZJQ A;  1X55 A;  2I5L X;  3A5Z B;  3KLW A;  4DV5 L;  4HID A;  4GOP A;  4QL5 A;  1Q1B A;  2F3I A;  5GRO A;  4OXP A;  2UU9 L;  4JYA L;  5IE8 A;  2KHJ A;  2N49 A;  2CWP A;  2K5H A;  3ULL A;  3EIV A;  1PH9 A;  5GAE C;  3PSI A;  3TS2 A;  4GKJ Q;  4YWL A;  4GKK L;  1YBY A;  1LTL A;  1NMG A;  3H0G H;  3E0E A;  4IJL A;  4DPG A;  2ZJP A;  2OTL A;  2EXD A;  5C44 G;  4K0K Q;  3NEL A;  4LFC L;  3D31 A;  1IBK Q;  3A5U A;  3F2C A;  2E2H H;  1N33 L;  1MKH A;  4UY8 C;  5M5X H;  5M3M G;  4DV7 L;  3CCE A;  1VQ6 A;  1VQH A;  1K73 C;  1EWI A;  4DNI A;  2ZJR A;  1HNX L;  1GVP A;  2EQS A;  4JI8 Q;  2VW9 A;  4X62 L;  3RLO A;  3CCL A;  5IYD H;  2NVT H;  2ALY B;  1GO3 E;  1MIU A;  3CP0 A;  3G71 A;  4DV4 Q;  1VQ9 A;  3KFU A;  4X64 Q;  2UXB L;  4LF6 L;  2GVB A;  3D0F A;  2NN6 G;  4AH6 A;  4DK3 C;  1K9M C;  2R7Z G;  1D7Q A;  4X66 Q;  4BY7 G;  1KAW A;  3M4Q A;  4A3F G;  4LF8 L;  4A3B G;  4IJH A;  3E9I A;  2JEB I;  1KD1 C;  2H5X A;  4A3C G;  4GNX B;  1IBM Q;  2A8V A;  3ER0 A;  1K8A C;  3NEN A;  3CCM A;  1VQM A;  1KIX A;  3RZO H;  5LMU Q;  4MNO A;  2N8N A;  2UUA Q;  2NVQ H;  4GKJ L;  2Z6K A;  1YVC A;  2Y0S G;  2YV5 A;  1E1T A;  4XIG S;  4K0K L;  4HJ9 A;  4YCU A;  1QZG A;  1Y1V G;  2N78 A;  3I56 A;  1S40 A;  2BH2 A;  2IX1 A;  1E1O A;  4PZ7 A;  4A4I A;  2UXD L;  4OO1 I;  1OTC A;  3HOU H;  4LFA Q;  3G6E A;  1VQL A;  2UUC Q;  2K50 A;  3HOV G;  3HOX G;  5GAH C;  1HJP A;  4A3I H;  4LF9 L;  5FLM H;  1L1O C;  2D62 A;  3M9B A;  3KDF A;  4DR3 L;  4POG A;  3S2D H;  4GN3 B;  1YJ9 A;  2VY3 A;  2F4V Q;  4H02 A;  5JEA J;  3DM3 A;  4AYB G;  3PIP A;  3I2Z A;  4KHZ A;  4X66 L;  2ZM6 Q;  4UPA A;  4Y7N H;  4A3M H;  4QQB X;  4LF5 Q;  3TRE A;  2QEX A;  1OXS C;  3FP9 A;  1XPO A;  1UWV A;  2R93 G;  4JI4 Q;  1EFW A;  2ID0 A;  4DV3 L;  1NJI C;  4JBK A;  3HOY H;  1FVI A;  4LFB L;  3GO5 A;  3PUW A;  2E2J H;  3S17 H;  1K0R A;  5C3E H;  1VQ4 A;  4MTN A;  1W2B A;  4DR6 Q;  1PYS B;  3L7Z C;  1IBL Q;  3CME A;  1UE7 A;  4JI7 Q;  4PMW A;  4B3M Q;  2RF4 A;  1X56 A;  3CPW A;  5IP7 G;  1VQ8 A;  3CCS A;  1HZ9 A;  1IL2 A;  3PO2 H;  2OQ0 A;  4KI0 A;  1YJN A;  3G4S A;  5C4J H;  1OXT A;  2LSS A;  1XMQ L;  4LWC A;  3JAM i;  2VL6 A;  4DR4 Q;  2XGT A;  2JE6 I;  3RN2 A;  2IX0 A;  3ICE A;  3H3V I;  1C9O A;  2I5M X;  1V43 A;  4POF A;  4HJ8 A;  3S2H H;  4OWT B;  3DLL A;  1QVF A;  3WWV A;  2B63 H;  1EQQ A;  1JT8 A;  4DUY L;  4QJF A;  4JOI A;  3I4N G;  2AWN A;  2GN5 A;  3ULP A;  1VQE A;  3S15 H;  2KBN A;  4GLV B;  2YYZ A;  1JJ2 A;  4DR1 Q;  4LF7 Q;  1FL0 A;  1TXY A;  3E9H A;  1HZB A;  1SN8 A;  3TRZ A;  1WJJ A;  3M7N A;  3AFP A;  2PI2 A;  4BY1 H;  3HOW G;  1WOC A;  3S1N H;  1E7Z A;  4A93 G;  3J81 j;  1U5K A;  4P75 A;  4RG1 A;  2VQE Q;  4DR6 L;  1N8R C;  3F2D A;  3PV0 A;  1YI2 A;  1L2F A;  2IT1 A;  4JI7 L;  3OW2 A;  3CCU A;  1PH5 A;  3AYH B;  1VQG A;  4B3M L;  1M90 C;  3J7A 5;  3GTM H;  4BBS H;  4C3I H;  2AWO A;  1HH2 P;  3GTJ H;  4QIW E;  4DAM A;  4LW1 A;  4HJA A;  3M3Y H;  2K14 A;  4IFD I;  1SRO A;  3AFQ A;  2Q2I A;  4A3E H;  4KLK A;  3J80 i;  3PUV A;  2JA5 H;  3KJP A;  1K3R A;  2K75 A;  3F8T A;  1UEB A;  1XNQ L;  3I4M H;  3GDE A;  1KHI A;  3RNU A;  1GD7 A;  1CSP A;  1HZA A;  4A3K H;  3T1H L;  4IFD J;  5FLX c;  3A74 A;  2IHF A;  5IWA L;  5JJL A;  2VUM H;  1HZC A;  4GNX C;  2E2I H;  4HIK A;  4LF8 Q;  4DR1 L;  3HFZ B;  4LF7 L;  1N32 L;  4IOA A;  1EQR A;  1Y14 B;  2CKZ B;  4L5Q A;  1G51 A;  4DKA C;  4YCV A;  4A3G G;  1KXL A;  4NXN L;  2VQE L;  2OQK A;  4QGU A;  1D8L A;  1Y1W H;  1XJV A;  1N9W A;  2GVA A;  1PH2 A;  2Z0S A;  3S14 H;  3H0G G;  1OXX K;  3PCO B;  4A3D H;  2A19 A;  5IP9 H;  5J3B A;  1YIT A;  3PIO A;  3RZD H;  1VQ5 A;  3I4O A;  4R4I A;  2UXD Q;  4A3L H;  3BZK A;  2N3S A;  3MXN B;  1X9N A;  1P16 A;  3PGZ A;  1NY4 A;  3UE0 A;  3W1G A;  3ZJY C;  1YJW A;  4R4C A;  3UDX A;  3AEV A;  2LXK A;  4LF9 Q;  1SLJ A;  4DV1 Q;  1IXR A;  2HT1 A;  2WFW A;  4B3T L;  5FJ8 H;  4DR3 Q;  4GN5 A;  1PVO A;  3KF6 B;  2OCE A;  3ULJ A;  4GS3 A;  4IOC A;  4GOP C;  1EIY B;  4WJ3 M;  1VQF A;  2Y0S E;  1FJG Q;  2A1A A;  2VS1 A;  2R92 G;  1L0W A;  3K81 C;  5C4X H;  4UP9 A;  5DLQ E;  3BJU A;  4P71 A;  3OTO L;  3HKS A;  2L15 A;  3PO3 H;  2OWO A;  3HKZ E;  4DV3 Q;  1NMF A;  2JJQ A;  1YHQ A;  5IYC H;  3CXC A;  4LFB Q;  3CC2 A;  4LUZ A;  4A3J H;  1MJE A;  4ALP A;  3PF5 A;  2LXJ A;  2XTI A;  4YWK A;  5JJI A;  1V9P A;  3HKZ G;  1B70 B;  3CQZ H;  4BY7 H;  1I3Q H;  1PH8 A;  5GAG C;  2BH8 A;  4DR2 L;  1JB7 A;  5C0X G;  4LNQ A;  3HOU G;  4AYB E;  2JEA I;  1RIP A;  4DAY B;  1J5E Q;  1TWH H;  4LUV A;  5GAD C;  4X6A H;  4JBW A;  4DV1 L;  2AKW B;  2FXQ A;  3L0O A;  1KRT A;  2KCM A;  5GQO A;  4IO9 A;  4A3I G;  1YIJ A;  1X6O A;  3RR5 A;  2QA4 A;  1XMQ Q;  4JBM A;  4HIO A;  3FKI G;  1TWC H;  2NN6 I;  1YHB A;  2ZTD A;  1FJG L;  3VDY A;  2JA8 H;  2K4K A;  1IZ6 A;  2EIF A;  4DUY Q;  4IPH A;  1G29 1;  1I50 H;  5E7N A;  4JI1 L;  4DV2 Q;  2R7D A;  2BA1 A;  3TQY A;  3S1M H;  3KYH C;  2Z6K C;  4O2D A;  1I94 Q;  3HOV H;  3AQQ A;  5IYB H;  1UE5 A;  3PUZ A;  3S24 A;  5M5W H;  4BBR H;  1N34 Q;  1QZH A;  3HOY G;  1DGS A;  1PH3 A;  2IHE A;  3RN5 A;  2YTY A;  1YZ6 A;  3LGJ A;  5C3E G;  5BR8 L;  2JA6 H;  2YTV A;  4PG3 A;  3CMA A;  3H3V H;  1YEZ A;  1Q1E A;  3F1Z A;  1OXU A;  5C0X I;  1RL2 A;  1V1Q A;  3EN2 A;  3S1Q H;  2CWA A;  1J5E L;  4A75 A;  4DV0 Q;  4LF4 Q;  3K7U C;  3PO2 G;  1JMC A;  1CKM A;  2Q2T A;  2JK8 A;  3KJO A;  1E24 A;  2HHH L;  5K36 G;  4JI0 L;  1XNQ Q;  2R6G A;  1X3E A;  3IRB A;  2E5L L;  4JI6 L;  1PFS A;  3KF6 A;  3K80 C;  3Q8D A;  1KC8 C;  3T1H Q;  1MJC A;  5IWA Q;  3ERS X;  4TVA B;  4X65 L;  4IPG A;  5AJ3 Q;  4OWW B;  4P74 A;  5HY6 A;  2B3G A;  4DV2 L;  4O0A A;  1N32 Q;  2YTX A;  3T1Y L;  1B8A A;  2HQL A;  2JA9 A;  2Q2H A;  2KEN A;  4IPD A;  4JC0 A;  1I94 L;  2CCZ A;  4OX9 Q;  4L5T A;  1PHJ A;  1JJG A;  4DR7 L;  1NTG A;  4BA1 I;  4NXN Q;  2K5N A;  1CKN B;  4BY1 G;  1N34 L;  1VCI A;  2PQA A;  3NEM A;  1R9T H;  1HNZ L;  3B6Y A;  4BA2 I;  2MQH A;  4MZ9 A;  1Q86 C;  1L1O B;  4R4Q A;  3CPF A;  2WAQ E;  4HJ5 A;  4YY3 L;  4BBS G;  5M3F H;  1KQS A;  2MO1 A;  4DV0 L;  4LF4 L;  1X54 A;  4BXX H;  1JJC B;  1JE5 A;  1CUK A;  4A3E G;  2WAQ G;  2JA5 G;  1XPR A;  4A93 H;  2WP8 J;  1AE2 A;  4YHH L;  1HR0 Q;  4B3T Q;  2C35 B;  3I4M G;  3HOZ H;  4JOI C;  5IT9 c;  1WCM H;  4C3H H;  4LUO A;  4DR5 Q;  4A3K G;  5AJ3 L;  1NBW A;  4OON A;  1VQJ A;  4PZ8 A;  4JI5 L;  1FGU A;  2OTJ A;  3M85 A;  3J81 c;  3STB D;  3J80 c;  4B3S L;  3SGI A;  2BA0 A;  4R1J A;  1W3S A;  2I5H A;  1CKO A;  3OTO Q;  2NVX H;  4OX9 L;  5ELO A;  2JA7 H;  2RCN A;  1T9H A;  3U50 C;  5LMN L;  3G48 A;  4AQY L;  4JV5 L;  1XMO L;  1Y1W G;  1Q82 C;  2UUB L;  3CD6 A;  1SR3 A;  3EBE A;  5HGQ A;  1Q8K A;  1VQC A;  2VQF Q;  4A3D G;  3CW2 C;  5IP9 G;  3PF4 A;  4QY7 A;  1E22 A;  1AE3 A;  1CSQ A;  3J7Z C;  4DR2 Q;  1B7Y B;  4C2M H;  2B29 A;  2KCT A;  3H15 A;  3GTG H;  4A3L G;  1X3F A;  1AH9 A;  1LUZ A;  4JI2 Q;  4YCW A;  1PH1 A;  2UXC L;  4A3G H;  1I6H H;  3S1R H;  4KHP Q;  2ZTE A;  1BVS A;  5IYD G;  1A8V A;  2MO0 A;  1HR0 L;  4GLA C;  3K7A H;  2IY5 B;  2F52 A;  2V1C C;  5C44 H;  4OWX B;  5FJ8 G;  1X3G A;  4DR5 L;  1XNR L;  1UE6 A;  3CCJ A;  1K83 H;  3UDI A;  1QVG A;  2K52 A;  2NZH A;  1XTD A;  1SRU A;  2HIV A;  4UP8 A;  4A76 A;  3JC6 6;  1QUQ B;  3UE1 A;  5M3M H;  1WI5 A;  4JI1 Q;  1HNW L;  2PMZ E;  5C4X G;  1SMX A;  4OO1 G;  1PH6 A;  2KHI A;  2VZA A;  3PO3 G;  1A0I A;  4JI3 Q;  1VQB A;  2DGY A;  3CCV A;  4HJ7 A;  3GTL H;  4B3R L;  1CKN A;  2PQA B;  1EYG A;  3S16 H;  2HIX A;  4GN4 B;  5JEA G;  5IYC G;  1OXV A;  3FHW A;  1C7Y A;  4R4T A;  4C3J H;  1VQA A;  4A3J G;  2VQF L;  1VQK A;  1TWF H;  2I0Q A;  5BR8 Q;  1L1O A;  4L5S A;  1A63 A;  1SE8 A;  5LMN W;  2R7Z H;  2D0O A;  2D0P A;  3CCR A;  4A3F H;  1U0L A;  2PI2 E;  1ASZ A;  2RHQ B;  2R92 H;  4A3B H;  4A3C H;  2AMC B;  4PZ6 A;  4JI2 L;  2ATW A;  5EAY A;  4GLX A;  1PV4 A;  3PUY A;  2R7F A;  1K8G A;  1VQD A;  2HHH Q;  5FLM G;  1EUJ A;  4AIM A;  1Q7Y C;  4JI0 Q;  4WJ4 A;  4DUZ Q;  4DV6 Q;  1BKB A;  3TS0 A;  4JI6 Q;  2E5L Q;  1PYB A;  1Y1V H;  3CF5 A;  2QGQ A;  1E3P A;  4TQU S;  3NBH B;  4EQ5 A;  4X65 Q;  3GTP H;  1IBK L;  2E8G A;  4YWM A;  2JA8 G;  2MFI A;  3PUX A;  1HR0 W;  4A3M G;  4APV A;  1A62 A;  3T1Y Q;  2K5V A;  1YNX A;  1Q46 A;  3HOX H;  4JI3 L;  1Z47 A;  1VQN A;  4DR7 Q;  1TWA H;  4JI8 L;  2AHO B;  5M5Y H;  5IYB G;  1HNZ Q;  1O7I A;  1WFQ A;  4BBR G;  3FKI H;  4DV4 L;  1WYD A;  1SFO H;  4KHP L;  4Y52 H;  1VQP A;  4X64 L;  4P72 A;  5JJK A;  2JA6 G;  3W5O A;  2CFM A;  3GTK H;  1VS0 A;  4XTC S;  1EOV A;  1XPU A;  4YY3 Q;  1GM5 A;  4GOP B;  1TWG H;  1IBM L;  3L2P A;  2R93 H;  3OYY A;  1Z9F A;  3BZC A;  3MEF A;  5LMU L;  5C0X J;  4DUZ L;  4DV6 L;  4HIM A;  2UUA L;  1LM0 A;  4YHH Q;  1EIF A;  1J6Q A;  2JQO A;  3K8A A;  1ASY A;  3M4P A;  5ELN A;  2B63 G;  4NXM Q;  2CQO A;  1QVC A;  3CC7 A;  4JI5 Q;  4UP7 A;  1QUQ A;  1G6P A;  5IP7 H;  4B3S Q;  3JAM c;  3U4V A;  3STB C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...