2HHHL

Crystal structure of kasugamycin bound to the 30s ribosomal subunit
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The antibiotic kasugamycin mimics mRNA nucleotides to destabilize tRNA binding and inhibit canonical translation initiation.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 13
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2006-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2hhhL00
3KLWA 1WJJA 4NB3A 3PF5A 1UE5A 2VQEQ 1J5EQ 5JJIA 4A3DH 3J81j 4J15A 1MJEA 3HOYH 3PIOA 1WOCA 1S40A 4C3HH 2CQOA 2IX0A 3CPWA 4A3MH 1IBKQ 1VQ4A 3I4MH 4A3BH 3TEHB 3GDEA 1XMQL 4DKAC 4DR2L 2WB1G 1Q12A 1Q1BA 2A19A 1B8AA 3D0FA 1KRTA 5H1SE 4DV7L 3HOUH 4A3BG 4JBKA 2MNAA 1CSQA 4QIWE 4GKKQ 3CD6A 4LF4Q 3PUZA 1S3OA 1Q1EA 1XJVA 2A8VA 3UDXA 4A3DG 1BVSA 1YNXA 1VQPA 3HKZE 3A5UA 2OCEA 1HNXQ 3PUYA 4GNXA 3CC4A 3H0GG 5EAYA 5AJ3L 2JA5H 2PI2A 1AE3A 1E1OA 4KHZA 1A0IA 4R4TA 2Q2TA 3PCOB 3S2DH 1BKBA 1BBWA 5C4JH 4JYAL 4IPHA 3M4PA 4DNIA 1BBUA 4LF6Q 4LF7L 3S2HH 3CQZH 3PGZA 4A3KH 3CC2A 1YJWA 3HOVH 2GN5A 1HJPA 2BA0A 2NVYH 2ZTEA 3KF8B 1HR0W 3CP0A 4L5TA 4IFDJ 4OO1I 3HKZG 1PV4A 2GVBA 2B63G 4DR1L 4MZ9A 3CCEA 1XNRL 4LF8L 2YYZA 4A3GG 3M9BA 1Q7YC 1SE8A 2PQAB 3NENA 1PH2A 1W3SA 1VQ7A 4YHHL 2DUDA 4A3EG 3KF6B 3F2DA 4OONA 4BY7G 1KXLA 1CKNA 2WB1E 4LF7Q 1RL2A 4HIOA 5C4XG 5JJKA 2K4KA 1CKOA 4JBWA 2E2HH 1YVCA 3L2PA 4JI0Q 4JI0L 4BXXH 2JE6I 3PUXA 3W1GA 1NBWA 5GAHC 3KOJA 5M3FH 1I6HH 3J80i 3UDFA 4DUZQ 4A3IG 4BY1H 2RCNA 3CMEA 1EWIA 4APVA 1EFWA 1XMOQ 5C44H 2K14A 3A0JA 1EQQA 4HIKA 3W5OA 4A3IH 1VQIA 1UEBA 2WAQE 4DV7Q 3L7ZC 4A3FG 5IE8A 4OX9L 2F4VQ 2JEAI 3J7ZC 1M1KC 5JEAJ 4DR1Q 1PYBA 4JI3L 1FVIA 3HOZH 2ZJPA 4XIGS 4AIMA 3HOWG 2LSSA 3A74A 1IBKL 1VQ8A 1X56A 3T1HQ 1T9HA 2PMZE 4P75A 3STBD 5GAEC 1FJGL 2VQFQ 4LF5L 4YWKA 2AHOB 4DV1L 2CKZB 1NTGA 1YIJA 5FJ8H 1R9TH 3LGJA 3K7UC 4P71A 3MEFA 3CCRA 1IZ6A 2VL6A 4A93G 1Z47A 1E22A 2EXDA 2B63H 3NEMA 2PQAA 3RLNA 3U4ZA 1GO3E 2JJQA 3ER0A 2JA6H 2LXKA 2AKWB 4X64Q 1XPUA 3HOZG 4JV5L 3CCLA 1VQFA 1CSPA 4L5RC 3S24A 3OW2A 1IL2A 4WJ3M 4FDBA 4C2MH 3UDIA 2OWOA 2HHHL 1HNZQ 1VQDA 3SGIA 4HJ8A 1QZGA 2OQKA 1U0LA 1VCIA 2FXQA 1LTLA 4DR4L 1QVFA 3S1QH 1K8AC 1KAWA 4R4QA 5IWAL 3GTPH 4EX5A 2K75A 1JE5A 1VQHA 3KDFB 4L5SA 4DV0Q 3G48A 2UXDL 1JJGA 3TS0A 4A3JG 2UUBL 5IYBG 1XNQQ 3PO2G 2OTJA 3HOXH 1RIPA 4GKJL 1PHJA 3G4SA 2IY5B 1HZCA 4O0AA 4OWWB 2UXCL 4JOIC 4A3EH 2HIXA 2E8GA 3I7FA 2OTLA 1X54A 2HT1A 2N3SA 4A3MG 1VQAA 4JG2A 2MQHA 1C0AA 5E7NA 2Z6KA 2QEXA 2KENA 3DM3A 1A63A 1UE1A 3MXNB 4DR5Q 1PH4A 2R92G 4DV3Q 4NPSA 4DAYB 1E1TA 4QL5A 3NELA 3GTLH 3KJOA 4Y52H 4PZ8A 1VQCA 4B3MQ 4LFAQ 4DV4Q 4JI5Q 2OQ0A 2K5NA 3U50C 3S17H 5M3FG 1V43A 3IRBA 4UP9A 4OXPA 3GTJH 1Y1VG 4X62Q 2CWAA 1SROA 1V1QA 3CC7A 4B3RQ 1PVOA 5IY0A 4UP7A 2CFMA 3K8AA 1CKNB 1HR0Q 3H3VI 3PO3G 5GQOA 1PA6A 4KHPQ 1HR0L 1B70B 4LUOA 3I56A 2CCZA 5M3MH 1TWCH 3CCVA 1EQRA 4BBRH 1L1OA 3ULLA 4POFA 3M7NA 2H5XA 3JAMc 5C0XG 3CCMA 3K0XA 1L1OC 1N33L 3I4NH 3PO2H 5C3EH 2JK8A 3RR5A 4JI7Q 4IJLA 4DUYQ 1XPRA 2UU9L 2K50A 3J81i 4A3LH 1MJCA 1PH6A 2MFIA 4A4IA 4X66Q 4HJ7A 1QZHA 4LF9L 4A3LG 2EIFA 2JA8G 3H0GH 5GROA 4LWCA 4DV5Q 4GLXA 1K8GA 1TWGH 2JA9A 3FP9A 3EBEA 4R1JA 2K5VA 4X65Q 4B3SQ 4JI2L 1P16A 3AEVA 1N32Q 2RF4A 1OXTA 3F2BA 3HFZB 4DR3Q 2ES2A 4JI4Q 4LFBL 2UXDQ 1AH9A 1IYJB 1PFSA 2Q2HA 2VY3A 3WWVA 4GKJQ 4YWLA 2V1CC 2JA6G 4OWXB 1TWFH 3TREA 1E24A 2Z6KC 5DLQE 1EUJA 3CF5A 4DV5L 5JEAG 4BBSH 4ALPA 1PH1A 4LW1A 2VZAA 3K81C 5C0XJ 4DR5L 2KCMA 2JQOA 3RZDH 1KL9A 3PF4A 2D0PA 4DK6C 4A3CH 2VUMG 4GS3A 5M5YH 1K9MC 1Z9FA 1X3FA 1N33Q 1XNRQ 3NBHB 3M3YH 4DAMA 5BR8L 2UXCQ 1X3GA 2E2JH 4JI8L 5ELOA 1PH5A 4IFDI 1NJIC 1K0RA 1E3PA 1UWVA 3K80C 4JCVE 3M85A 3M4OH 1G6PA 4BY1G 2JA7G 2L15A 3UDGA 1I5FA 3I4OA 4A3CG 3TS2A 1QUQB 2R7FA 3J7A5 4DR7Q 2HQLA 1XTDA 1S72A 4YCWA 3H15A 2N49A 3CAMA 1H95A 1NE3A 4BBSG 4IOCA 1HNXL 2UUAQ 4R4OA 1YBYA 2NN6G 4BY7H 1Q82C 1JJ2A 1IBMQ 5IYCH 1IBLQ 5IP7G 4LF4L 4GKKL 1JJCB 2K52A 3BZKA 5M5XH 3PUVA 4JI1Q 4AYBG 1G291 2C35B 5IYDG 1WCMH 1N9WA 2NVQH 3FKIG 2MO1A 1GD7A 1SRUA 2YTYA 1Q81C 1VQNA 4JOIA 4LUZA 4A3KG 1FJGQ 2PNHA 4A76A 4X6AH 3D31A 2ZJQA 3GTOH 3ERSX 3GTQH 3CCJA 1WCMG 3KYHC 2AWOA 1LUZA 2E2IH 1OXSC 2JA5G 3ZJYC 4A93H 1X9NA 2F4VL 1NMFA 2VS1A 3RNUA 4OX9Q 5IYCG 2XTIA 4PMWA 4DV0L 3S1NH 1N8RC 2Y0SG 1NMGA 2R7ZG 1TWHH 4R4CA 1AE2A 4JYAQ 4RG1A 1QUQA 4DUZL 2KHJA 4A75A 3ULPA 3E0EA 2RHQB 2KHIA 4LUVA 4JI1L 3CXCA 3G6EA 1YHAA 2R93H 5J3BA 2JA7H 1L1OB 4GN4B 3S1MH 5C0XI 3HOYG 4QJFA 4OO1G 1HZAA 3S16H 2WP8J 2UUAL 3GO5A 1IXRA 1K83H 4YWMA 2ALYB 1XPOA 4GNXC 4LF8Q 2DGYA 1A62A 3EIVA 2R7DA 4KLKA 1LM0A 2ZTDA 1PH7A 1E7ZA 2ASBA 4BXXG 2B3GA 5IP9G 4DV1Q 4HJ9A 3ICEA 2HIVA 2VQFL 5LMUL 1PH8A 1EIFA 4C3JH 1Q86C 4LF5Q 2AMCB 1UE6A 5C3EG 3B6YA 3GTKH 3ULJA 1J5EL 4UY8C 3OYYA 5FLMG 4LF6L 3EN2A 4JI3Q 3W1BA 1YHBA 4JI8Q 3Q8DA 3K7AH 5ELNA 5BR8Q 1V9PA 2IHFA 3KDFA 1P8LA 1KHIA 2JEBI 1ASZA 4QQBX 4WJ4A 2XGTA 4YCUA 2YTXA 1IBML 2K5HA 4JBMA 5GADC 2QA4A 4AQYQ 1VQKA 3U58A 4NXMQ 4YY3L 3F2CA 4A3JH 4P74A 2I5LX 3L0OA 1VQEA 1YZ6A 4IOAA 4GOPA 4H02A 1XMQQ 3OTOL 1PH3A 4IFDG 1HZ9A 2B29A 1KRSA 2EQSA 4GN5A 4O2DA 2A1AA 3BU2A 3M4QA 1VQOA 4YHHQ 4JI6Q 4MNOA 2VQEL 2N78A 1EOVA 1HH2P 1KIXA 2R92H 5JJLA 1SN8A 4JI2Q 4X65L 4B3SL 4DR7L 5K36G 3HOUG 3PIPA 1OXUA 1HNWL 2NN6I 4NXNQ 1DGSA 2N8NA 1KD1C 1N34Q 4KI0A 4K0KQ 3E9IA 2YV5A 5FLXc 1Q8KA 1LYLA 4BBRG 5FJ8G 2NZOA 2R6GA 4UP8A 1WI5A 1W2BA 1B7YB 1GKHA 5IYBH 3E9HA 2YU9H 2Y0SE 3F8TA 1CKMA 4HJ5A 4JI7L 4ME3A 1J6QA 1KQSA 4AH6A 1U5KA 1YEZA 4QY7A 1FGUA 1ASYA 3STBC 2BH2A 3PO3H 4DK3C 5AJ3Q 3CPFA 1HZBA 1YI2A 4LNQA 2BH8A 2ZM6Q 3CMAA 5IP9H 1IBLL 4PZ6A 1EYGA 3CCQA 3T1YQ 2F52A 3GTGH 1UE7A 4DV2L 2ID0A 1K73C 4B3TL 1SR3A 1JB7A 1VQGA 4P73A 3AFQA 1JMCA 1MKHA 5M5WH 3RZOH 3PUWA 2UXBQ 4DR2Q 1VS0A 2E5LL 2E5LQ 3TQYA 1VQ9A 2PI2E 1I50H 4GLAC 1VQBA 4AYBE 2R93G 1OXVA 3CCUA 5HY6A 1M90C 4B3TQ 1C9OA 2KBNA 4GLVB 2NVXH 3J80c 2VW9A 1CUKA 2UU9Q 4DV4L 1YJ9A 4B3ML 4LFAL 1SMXA 4P72A 5FLMH 2IHEA 3AFPA 2Q2IA 1JT8A 4GNXB 1I94L 1VQ6A 3HOXG 4DV3L 1X6OA 4LF9Q 4A3GH 4X66L 3KF6A 2YTVA 3HOWH 1QVCA 4HJAA 2UUCQ 2NZHA 1L2FA 4LFCQ 3G71A 4JBJA 5LMNQ 3KJPA 1K3RA 2ZJRA 2AWNA 4DUYL 4UPAA 3HOVG 5GAGC 3UE1A 1N34L 4HIMA 3F1ZA 4JC0A 4NXNL 3UE0A 3A5ZB 3JAMi 3GTMH 1N36Q 4KHPL 2I5HA 1XNQL 5IYDH 3AQQA 4X62L 1Q46A 4XTCS 4DR3L 4JI4L 1WYDA 4LFBQ 3RLOA 4JI5L 4DR4Q 4IPDA 2RHSB 5IP7H 1N32L 4TQUS 1OTCA 2BA1A 1NY4A 5LMNW 2UXBL 3PV0A 4DR6Q 2R7ZH 4RMFA 3J81c 3AYHB 1SLJA 1KC8C 2IT1A 4R4IA 1PH9A 4IJHA 2CWPA 2F3IA 4IPGA 4TVAB 4DV6L 4GOPB 3S15H 5LMNL 3BZCA 4DV2Q 1YJNA 4AQYL 4LFCL 3T1YL 1X3EA 4GOPC 3I4MG 4JV5Q 1EIYB 1O7IA 2ATWA 2D0OA 1D7QA 4EQ5A 1TXYA 2KCTA 3RN5A 1I94Q 1C7YA 4HIDA 2GVAA 3U4VA 4IPCA 2I5MX 4A3FH 1VQLA 1Y14B 3S14H 1FL0A 3FKIH 2UUBQ 5C44G 4IO9A 1G51A 3H3VH 4DV6Q 5IWAQ 4Y7NH 1WFQA 4BA1I 4OWTB 4DPGA 5LMUQ 3PSIA 3KFUA 4POGA 3S1RH 3I4NG 4QGUA 4DR6L 4MTNA 2IX1A 3BJUA 1HNWQ 3GD7A 3RLFA 1I3QH 1Y1WH 4B3RL 2WFWA 3DLLA 4C3IH 1PYSB 1X65A 5C4XH 2ZTCA 4JI6L 2Z0SA 1XMOL 2I0QA 1TWAH 1OXXK 4BA2I 3RN2A 1D8LA 2Q2UA 3TRZA 3FHWA 4X64L 2ZM6L 3OTOQ 5M3MG 3VDYA 1YHQA 1N36L 1SFOH 2VNUD 4GN3B 3JC66 4PZ7A 1L0WA 3HKSA 3CCSA 1GM5A 2QGQA 1HNZL 2HHHQ 1MIUA 1VQMA 4YCVA 4YY3Q 1Y1WG 2MO0A 4PG3A 5HGQA 1VQ5A 4NXML 1QVGA 1Y1VH 3I55A 2UUCL 3I2ZA 1X55A 5IT9c 1YITA 3T1HL 2JA8H 1A8VA 1VQJA 4K0KL 2WAQG 3CW2C 4L5QA 1GVPA 2NVTH 2VUMH 2D62A 2LXJA
chains in the Genus database with same CATH superfamily
3KLWA 1J5EQ 5JJIA 1JOQA 5CV7A 1MJEA 1HQRD 1PFMA 3O13A 4A3MH 5F2DA 2Y0SB 1K3BC 4OIJA 1CK1A 1CT1D 1PXUA 4A3BG 4JBKA 4QIWE 4G57A 2A8VA 1STGA 3HKZE 3A5UA 3QIAA 5FLXL 3PUYA 1HNXQ 1R4QB 5KNDA 2A73B 4HAEA 1H9MA 1E1OA 4OIKA 1A0IA 3GTMB 1BBWA 5C4JH 1SSOA 1TQOA 3PGZA 1VF7A 4A3KH 2XSCA 3EFXD 3HOVH 1HJPA 2NVYH 1M4VA 1HR0W 4L5TA 2B63G 4A3GG 2YYZA 2PQAB 1JWSD 3F2UA 2DUDA 4QIWB 3KF6B 4YHHL 1CKNA 2WB1E 4LF7Q 3RD4A 5C4XG 5JJKA 3MWYW 3CHBD 1EL0A 1ESFA 5J1ZA 5GAHC 5M3FH 2K04A 1A3TA 2M9VA 4LMQD 2RCNA 5JJZA 1EWIA 3S2DB 5C44H 2K14A 4A3IH 1UEBA 3MEHA 4X3TA 3J7ZC 1M1KC 5JEAJ 1PYBA 1FVIA 4PMBA 1PRTC 2JXMB 4L8JA 1BO0A 1VQ8A 1X56A 3T1HQ 3AB9A 2VB2X 5EKIA 3STBD 5GAEC 2VQFQ 2KECA 2L1BA 2AHOB 4YWKA 4DV1L 2F03A 5M3MB 1E22A 5JAVA 1G8ZD 2PQAA 2RA4A 3R93A 3RLNA 4C3JB 5COYA 1SE2A 1TY2A 2XIWA 3PMFA 5IGDA 1CSPA 4L5RC 1IL2A 3P1HA 2WAQB 5G3LF 1NUCA 2FXQA 1LTLA 3H09A 3SR1A 1BCPD 1GUNA 3EQLC 3FEWX 4DNTB 4EX5A 2K75A 2F1MA 1QOHA 2UXDL 3TS0A 3VR4A 5E4XA 1XNQQ 3SEBA 1PHJA 4F87A 5CV9A 3I7FA 2OTLA 3J80E 1SYDA 2E2IB 2QEXA 2QEJC 4DV3Q 3S17B 4DAYB 4QL5A 2F0DA 1VQCA 4LFAQ 5BN3A 5IIFA 3U9SA 1BR9A 2K5NA 3U50C 1I4QA 1V43A 4ZYSA 2EYMA 1V1QA 3K8AA 1HR0Q 3WOFA 3DWQA 2N88A 1GHJA 5ISRA 3ULLA 3AU7A 4BBSB 1I4HA 1SNCA 1N33L 3I4NH 4EQOA 4IJLA 3NBIA 1KDCA 3GTQB 4A4IA 2A5HA 2EIFA 3A8JE 5GROA 3BDLA 4E6IA 4GLXA 1X32A 1B3QA 1YNJD 2A6HD 3FPPA 3KLSA 1GUSA 4DR3Q 2UXDQ 2L11A 1IYJB 3G6JB 4YWLA 2V1CC 2HD3A 1TWFH 1E24A 2Z6KC 3CF5A 4DV5L 3NQTA 5JOBA 4ALPA 1PH1A 4LW1A 4DAYA 5C0XJ 3K81C 2OT2A 2DJGC 4FXGC 2D0PA 2VUMG 5M5YH 3I4LA 4NW2A 1XWEA 2ZT9C 2UXCQ 3MC0B 4JW0A 1LTBD 2IW3A 1E3PA 4JCVE 1CZGA 1G6PA 1F9QA 3I4OA 1Y8OB 3HS0C 1LO5D 2R7FA 3J7A5 1MI2A 3OIQA 5DM73 3AMUA 2NYZD 4EQNA 2CVRA 1EU3A 5JVG3 1RTOA 2UUAQ 1YBYA 5D3DA 1JJ2A 4B9WA 1IBMQ 1IBLQ 3JAML 2EY5A 1JJCB 4Q0FA 2F0TA 5CGKA 4GKKL 2F0SA 4QCLA 5L37A 3PUVA 1WTHA 2A68C 4JI1Q 3SK8A 2C35B 5EKLA 4LUZA 5A2QL 1QB5D 3M3YB 3D31A 2PCFB 2ZJQA 4NDXA 3ERSX 1U4LA 3CCJA 2AWOA 1U4PA 1MD2D 2JA5B 4K8JA 1NMFA 2VS1A 3RNUA 4RHRA 4DV0L 1MGSA 4J1MA 2R7ZG 2RSOA 2RDHA 5EJWA 3A7AB 3GQBA 4PV1C 3E0EA 2QF7A 1O78A 4B08A 5E1FA 4LUVA 3S1NB 1IHZA 3OW7A 4RH6A 4GN4B 3S1MH 3R8BA 1HZAA 1SE4A 1IXRA 5M5WB 2ALYB 2R7DA 1LM0A 1ZKOA 2ASBA 4LF5Q 3GTGB 1PH8A 1EIFA 2RVLA 1J5EL 4UY8C 1F9PA 4Z9CB 2H1EA 4JI3Q 3W1BA 1YHBA 1SYGA 1ASZA 3PQIA 2RSNA 1K28A 2K5HA 4K5WA 5GADC 3LWUA 3U58A 4YY3L 4P74A 2K5WA 3ONAB 4RGOS 1JWMD 5JVH3 5IGCA 3NE5B 1STBA 1PH3A 1XMQQ 5EBCA 2P5ZX 2L4NA 1FD7D 4O2DA 3M4YA 4GN5A 2A1AA 2CW0C 1VQOA 5KRUA 4V190 2KVMA 1EY0A 2VQEL 1EOVA 4JVZA 2AQ2B 1SEBD 1SN8A 5FO8B 4X65L 5K36G 1OXUA 3HOUB 1ZXTA 2NN6I 4NXNQ 1KD1C 3TP5A 1N34Q 4KI0A 3NTIA 2YV5A 1ML0D 2Z1CA 5FLXc 4BBRB 3D4DA 1S4ZA 3MXUA 3HOXB 2Y0SE 3F8TA 1TIID 1J6QA 1KQSA 4AH6A 1YEZA 3I8ZA 4CJ2C 4LNQA 1ESRA 1VMPA 5IP9H 1EIHA 5IGFA 4HTHA 2V4DA 1IBLL 2D5DA 4B3TL 2EY2A 1VQGA 3TP6A 5M5YB 4DR2Q 2E5LQ 3NPPA 1KDAA 1SMYC 2PI2E 5KGUA 1DZ1A 4KKSA 5HY6A 1LTID 4B3TQ 1RDPD 1SFOB 2F0LA 3MHBA 1SYCA 2UU9Q 1YJ9A 1TWFB 4FXDA 1SMXA 1W6KA 2E76C 3NTHA 2IHEA 5LHY1 5IODA 4GNXB 4BS9A 1VQ6A 4N8X1 4LAAA 2PO4A 1TWCB 4LF9Q 3QOLA 4FF2A 4X66L 2YTVA 2DJFC 1STHA 4LFCQ 5LMNQ 3KJPA 1K3RA 2ZJRA 4DUYL 5K5PA 3UE1A 2G9DA 4JC0A 4NXNL 3JAMi 3A5ZB 3R2IA 2NTTA 2FMCA 4BWGB 4TKOB 1S5CD 3BYTB 3A8IE 4XTCS 1RJTA 2B2UC 4DR3L 1WYDA 4JI5L 1NY4A 2DN8A 1D5MC 5LMNW 1TS4A 1ICWA 4R4IA 1PH9A 2QCPX 2CWPA 2F3IA 2J4XA 3OWEB 1QJOA 3SHLA 3S15H 4A93B 2B2TC 1Y8NB 2KOLA 5LL6X 1LTTD 3GTKB 1H9RA 1HA6A 5JPNC 2F3WA 1O7YA 2GVAA 4A3FH 3IAYA 3FKIH 1AFPA 1A3VA 1G51A 2K01A 1EZ8A 5FK9C 5IWAQ 4BA1I 2K7VA 4OWTB 5LMUQ 4HCEA 1PTOC 3S1RH 4QGUA 4DR6L 3VA5A 3GD7A 1HFNA 2HDMA 2WFWA 3DLLA 1X65A 2ZTCA 1G6ZA 2Z0SA 2I0QA 3D4WA 1PZJD 3J80L 1ILQA 1D8LA 3FHWA 2QDBA 3VDYA 5KYLA 1IYUA 2VNUD 4OEMB 3JAME 3JC66 1GM5A 2QGQA 4CBVA 2MO0A 1VQ5A 4NXML 1SBBB 1Y1VH 3I55A 4XT3B 3I2ZA 5KYIA 5IT9c 1YITA 1K83B 1VQJA 5T1IA 2D62A 2B8GA 1EEID 2JEAI 4GKJQ 1EZ6A 2JA7B 1EY5A 2R93B 5FOBB 4A3DH 3HOYH 2F0VA 1CA5A 1WOCA 3N6RA 2K6AA 4C3HH 3CPWA 1IBKQ 1WD0A 1H9SA 4DKAC 2WB1G 4DV7L 1I4GA 2K05A 5H1SE 1CSQA 2MUYA 4CGYB 4GKKQ 4NP5A 3CD6A 1XJVA 2OXPA 2ZXPA 3H0GG 5AJ3L 1MBYA 4KY6A 2JA5H 3VA7A 1PZID 5C44B 3S2DH 3PCOB 2JA8B 1BKBA 2R61A 2SOBA 1HXYD 3M4PA 1BBUA 2IJ0A 5C3XA 1GJXA 3S2HH 3CQZH 4HMIA 4IFDJ 3CP0A 3HKZG 1LTRD 1CFMA 4LF8L 1Q7YC 1SE8A 4J8QA 3BDOA 4BY7G 1KXLA 2B2VC 2IWHA 1EYDA 4HIOA 1CKOA 4DK0A 2DNEA 2PZTA 2NVXB 4DN4M 3L2PA 2JE6I 3W1GA 4RCOA 3C1FA 1D1KA 3J80i 4DUZQ 4BY1H 4APVA 5G3LD 1RKNA 1XMOQ 1TT2A 1W6JA 2X6GA 3EJIA 2RQXA 1EQQA 1EQVA 5CMDA 2WAQE 4A3FG 3L7ZC 1PRTB 2F4VQ 1JICA 1SXTA 1IW7D 2ZJPA 3HOWG 1PTOB 2LSSA 3TP8A 5J39A 2VXWA 1IBKL 3OOCA 1FJGL 2TMPA 4G7ZC 1FGBD 4Q5VA 1YIJA 1SJED 5JEAH 3K7UC 3H91A 1IZ6A 4A93G 3GV3A 1SYBA 1TY0A 2JJQA 3ER0A 2OEOA 3HOZG 4JV5L 1I50B 4TSSA 2K5QA 1SMYD 1VQFA 2XRQD 2B2UA 4WJ3M 3GP7A 4FDBA 2L0CA 4CDEC 1D5XC 2EE1A 5IGGA 1VQDA 3SGIA 4HJ8A 1QZGA 3DUZA 3K5NA 1VCIA 2AQ1B 1JC7A 1K8AC 1KAWA 4R4QA 3KBXA 1VQHA 3PO2G 5EBDA 1RIPA 4GKJL 2WV6D 1HZCA 4O0AA 3Q6SA 4JOIC 2WB1B 1LTGD 4J6HA 3R2TA 4ZQ3A 5KIXA 4C3IB 4JG2A 2Z6KA 2HCIA 4ODGA 4DR5Q 2B8FA 4ZAIA 1B44D 3GTLH 2R3ZA 4PZ8A 2Z6BA 4B3MQ 3NWSA 3OIPA 4JI5Q 5AFWA 3S17H 4UP9A 3E6ZX 5ELCA 2WACA 1KAAA 1Y1VG 2KA7A 1SROA 1Q90A 4ZLTF 3CC7A 4B3RQ 1PVOA 4UP7A 2CFMA 3PO3G 4KHPQ 4UAIA 3P75A 3HZXA 3HKZB 4LUOA 4QUCA 3I56A 1HR0L 2CCZA 2LMCB 1QWYA 1TWCH 1L1OA 2Z9HA 2F0EA 4RCNA 5C0XG 2E2DC 4A3BB 3CCMA 3I4MB 2H4OA 4F88A 5K36H 1O7LA 5C3EH 2F0NA 1BUVT 4DUYQ 2EY1A 1CM9A 1UAPA 4K8IA 1F9SA 1TWGB 1PH6A 1PTOF 2MFIA 4X66Q 2JA8G 2NUCA 1JOKA 2F0PA 1DYQA 1TWGH 2JA9A 1HCZA 3EBEA 4JI2L 2K5VA 3P20A 1P16A 3AEVA 3HRZC 4JI4Q 4LFBL 2Q2HA 1G91A 2JA6G 2F0UA 4NKLA 2Z4IA 4BY7B 2SNMA 2VZAA 1NCVA 2KCMA 4UHVA 3VR2A 2R92B 1KL9A 3HOZB 1PTOD 3PF4A 4DK6C 3Q24A 4GS3A 3X3MA 2O4XA 3L3OC 3SXHA 3HOVB 4XQQA 3NBHB 3M3YH 1X3GA 1TS5A 1LT5D 5CV5A 5ELOA 5C4JB 3M4OH 3K80C 3ND9A 2F0MA 4EGVA 1QUQB 4ZKCB 1IKMA 1CQVA 2HUGA 3K57A 3C2PA 2K03A 1KNEA 3MXPA 4V0BA 1HNXL 2EOTA 1SNMA 4R4OA 4PMCA 1B2TA 4ZCKA 1SNOA 5M5XH 2F0QA 2A69C 4DXFA 3BVZA 1G291 3CU7A 3HGBA 3MXNA 5C4HA 2PNHA 1O80A 4LK1C 1I4RA 3A8KE 3MTSA 3GTQH 1AN8A 1LUZA 2JN4A 5DNFA 3HOWB 1WTVA 2KEEA 2MPMA 4OX9Q 4ZKBB 3WDNA 4KN4C 2YU9B 4CJ0B 3K7AB 2Y0SG 1NMGA 3FMCA 5ELFA 3HG9A 2HCCA 3WOEA 1AE2A 4JYAQ 4RG1A 3ULPA 2KHIA 1EWCA 3CXCA 5J3BA 1L1OB 1PTOH 5C0XI 1HTLD 4QJFA 2DNCA 4OO1G 3S16H 3GO5A 1K83H 3PIP3 1DCZA 2EYLA 1XPOA 3ZYYX 1AP0A 2DGYA 3SE0A 1ENCA 4ZRZA 1A62A 3EIVA 4CHTB 1LT4D 1U4RA 2ZTDA 4BXXG 4BY1B 5LMUL 1Q86C 2AMCB 1UE6A 1ZYRC 3GTKH 2J0TD 3PO3B 3D6CA 3EA6A 3ULJA 2KJXA 3OYYA 4LF6L 5CBEE 3QWNA 4GZYC 1SDFA 4ILWA 4JI8Q 4KTAA 3K7AH 5BR8Q 1VF5C 1V9PA 5E3FA 3KDFA 4HN7A 1SJHD 2PW7A 2XGTA 1HQMC 4AQYQ 4IUTA 1WTOA 4DAVA 2I5LX 1V8QA 1I6VC 2JP1A 3W2DA 3KF8A 4MHEA 4C1NK 4IFDH 1WCMB 4OHJA 3M4QA 3IL8A 1IL8A 1HHVA 3BG3A 4OO1H 2D2CC 3VR3A 4JI6Q 1UEAB 4S3SA 1HH2P 1KIXA 2R92H 4JI2Q 3HOUG 3PIPA 1NNXA 4K0KQ 3SK5A 1Q8KA 4KD3A 3U9OA 1FNUA 3MA2B 4UP8A 5NUCA 1B7YB 5IYBH 1ZYRD 3E9HA 4JI7L 2BH2A 1FGUA 3PO3H 1NAPA 4KY5A 5AJ3Q 3VYTA 2ZM6Q 3HP3A 3S1QB 3S2HB 4PZ6A 3LX0A 1PZKD 1KABA 2BE5C 4EVOA 3CCQA 4DV2L 2ID0A 3AFQA 3RZOH 3S16B 2E5LL 2B2TA 1PMRA 1VQBA 2R93G 2EJMA 4P2CB 3QO2A 4KJNA 4TRDA 4XYQA 2KEDA 1C9OA 2KBNA 5IGEA 2VW9A 1CUKA 4DV4L 4DGZA 4B3ML 3AFPA 2Q2IA 2G9HD 1X6OA 1STNA 4HJAA 1PRTD 2NZHA 3G7LA 2VUMB 1TVXA 4OGQC 4A3IB 2AWNA 4IUVA 3HOVG 5HURA 4RFBA 1N34L 3GTMH 3UE0A 3QR8A 4KHPL 2LY7A 3AQQA 1J9OA 1FNVA 2HDLA 1RF2D 5IP7H 1CHPD 4TQUS 1II3A 2BA1A 3GV6A 2UXBL 4DR6Q 3Q22A 1UNSA 5EKKA 1SLJA 2K32A 4GOPB 3BZCA 4A3MB 2EYFA 1X3EA 1IW7C 4XDXA 1HRJA 2D0OA 3GTOB 1C7YA 1I94Q 1A2TA 4NMZA 3U4VA 1VQLA 4QB4A 5I6YA 5C44G 2EY6A 3FVQA 1RTNA 3H3VH 1LLRD 2KCCA 1TR5A 4XQJA 1HNWQ 5C3WA 5M5XB 1I3QH 5LL6S 5C4XH 5C0XH 1PRTF 1F2ZA 2MGSA 3DEOA 1TWAH 1OXXK 2VB3X 4JK1C 4U68A 1XMOL 1AW7A 2Q2UA 1KNAA 4IUNA 3OTOQ 4GN3B 5EPLA 2A6ED 3HKSA 3A55A 4YCVA 1VQMA 2TSSA 4HMJA 4PG3A 1GUWA 2EYHA 1IYVA 1QILA 1X55A 2M00A 4K0KL 3CW2C 2K28A 2VUMH 2Z8LA 2RBMA 1KLGD 1WJJA 4NB3A 3PF5A 1UE5A 1GUTA 1S5DD 4KY7A 2X69A 2NWGA 4J15A 3PIOA 2Q8TA 1DOMA 1VQ4A 4A3BH 2B2WA 5I4DA 4DR2L 2WIIB 1Q12A 1Q1BA 2A19A 1B8AA 2I07B 3D0FA 3NUCA 2ICEC 4RKBA 2C9OA 1STEA 3PUZA 1S3OA 2JYOA 4A3DG 1BVSA 1YNXA 1Y1WB 2E74C 2OCEA 3CC4A 4GNXA 2PPBC 5EAYA 5CC4A 4A3KB 2PI2A 3CRLC 2EPBA 4KHZA 4R4TA 2Q2TA 3Q0AA 3C1EA 2XWJB 4IPHA 4DNIA 4LF6Q 2EYOA 4LF7L 2B2VA 2A6EC 2EVBA 2F0GA 4L6TB 3K5LA 3CC2A 3R3OA 1IKLA 3TZUA 2GN5A 2BA0A 3T4AC 2E75C 4OO1I 5D14A 1PV4A 4DR1L 2QILA 1XXGA 2XN9C 2R7ZB 3LWEA 1EYAA 4K2KA 1JE4A 1PH2A 2NN6H 3CKIB 3F2DA 4A3EG 5J22A 1E2ZA 1A2UA 1RL2A 4PQXA 3RUZA 4C3IG 2K4KA 2F0FA 4JBWA 2E2HH 3GTPB 1YVCA 4JI0Q 1NBWA 5IT9L 3KOJA 4FVMA 3NTKA 5DAUA 3UDFA 3A54A 4A3IG 1AEXA 1BCPB 4IALA 5ELEA 1EFWA 2N55A 1ILPA 4QMGA 4HIKA 4OX9L 3GTLB 1Y1VB 4DV7Q 2MHVA 5IE8A 1MSGA 4DNRB 1B53A 1HFGA 2F0KA 2B2WC 4XIGS 3A74A 3V2TA 4AIMA 5HGTA 1H9JA 3S1MB 4RGTA 4P75A 2JA6B 4LF5L 1FYCA 1EWHA 1NTGA 3LGJA 4P71A 3VYRA 5FLXE 2VL6A 4CKBA 2EXDA 2L55A 3S9WA 2B63H 3U4ZA 2JA6H 1GO3E 3KLSX 3NBHA 1XPUA 1B4OA 3OW2A 3VYUA 4C2MH 1WTPA 3UDIA 2OWOA 5D65A 1QNKA 2HHHL 1HNZQ 1D1IA 3GTJB 1CQFA 3S1QH 1EY4A 3GTPH 2F0IA 5IWAL 1JE5A 3KDFB 4K6LA 3T56B 4DV0Q 3G48A 3SK6A 1JJGA 5IYBG 2K33A 1K8OA 2IY5B 4OWWB 1F77A 1WVLA 4A3EH 2IL8A 2HIXA 3IFDA 1X54A 4A3MG 1Y8PB 1VQAA 2MQHA 5E7NA 1A63A 1UE1A 3MXNB 4K5VA 2L5TA 1EIGA 3P7JA 1E1TA 4IUUA 3DXJC 3QG1A 4WORA 3KUPA 4I7AA 4DA2A 4DV4Q 2SNSA 1GHKA 2OQ0A 5M3FG 4OXPA 4IUPA 1CI3M 2CWAA 3HEJA 2J7ZA 5IY0A 3H3VI 2FINB 3RZDB 1PA6A 1B70B 1Z6HA 3DHQA 5M3MH 1WTWA 4M1UB 1EQRA 4A3EB 1QE6A 4FNFA 3FPUB 3JAMc 3OPOA 2BCOA 4C3HB 3K0XA 2RDGA 3PO2H 3RR5A 4JI7Q 3RMHA 1XPRA 3TZDA 2UU9L 2K50A 3J81i 4A3LH 4CKCA 1MJCA 2Q8RE 1DM0B 4M8AA 1QZHA 4HJ7A 4IUQA 5I9PA 4LF9L 4A3LG 3H0GH 4DV5Q 2IPKD 1K8GA 3FP9A 4X65Q 1QCBD 1EU4A 1N32Q 2RF4A 1OXTA 3F2BA 1ENFA 1ENAA 1MSHA 3MVVA 3E3XA 1GXDC 1PYWD 4OWXB 3K58A 3TREA 2GA4B 5DLQE 1EUJA 1WD1A 1R9TB 3FDTA 4IURA 3OWFA 4A3DB 3RZDH 1M8AA 4ULLA 2O5JC 1K9MC 2F0OA 4DAMA 5BR8L 2E2JH 4JI8L 2G5DA 1BF4A 1PH5A 1NJIC 1K0RA 3C46A 1UWVA 3M85A 2EXZA 3EROA 3UDGA 1F2YA 1I5FA 4RGMA 2HQLA 3OHXC 3H3VC 1XTDA 4YCWA 2X6LA 3CAMA 4L63B 3S15B 1NE3A 4RWSC 1STAA 3J81E 4IOCA 2NN6G 2MJ8A 2XNAC 1JORA 5IYCH 2DY8A 1C48A 3T53B 3K59A 2K52A 5FO7B 5CORA 3S1RB 4AYBG 2F4IA 5IYDG 2NVQH 3FKIG 2YTYA 1SRUA 1VQNA 4JOIA 3GTOH 2A68D 1WCMG 1OXSC 2JA5G 3ZJYC 2KHSA 3A7LA 2F4VL 4F8MA 3NHHA 1Y69U 1XX8A 4PMWA 3BDCA 1EOTA 4HEDA 4R8NA 1JOOA 1TWHH 4R4CA 5ELBA 4ZUJA 2RCFA 1RHPA 1PFNA 4A75A 2NBFA 3G6EA 1YHAA 2EJGC 5BN5A 3HOYG 2UUAL 4YWMA 2NVTB 4CDFC 3M7GA 1PH7A 1E7ZA 1A15A 2PZUA 2B3GA 4DV1Q 4HJ9A 3ICEA 2VQFL 2EYPA 2PZWA 5C3EG 3B6YA 4F7XA 1ZEQX 5FLMG 4MN3A 1PDQA 1L0XB 1CTMA 1EFID 2IHFA 1P8LA 1STYA 2JEBI 4WJ4A 2FMMA 4YCUA 2A6HC 2YTXA 1IBML 4JBMA 1EYCA 1VQKA 4A3JH 2B2YC 3L0OA 4IOAA 1TU2B 4GOPA 1WTXA 4H02A 3OTOL 4IFDG 1HZ9A 3LNNA 1KRSA 2EQSA 5CBAE 1HUMA 5C5LA 5C5MA 2N78A 3KLRA 3J7AV 4HR7B 4H0LC 3D8GA 4IN3A 4HSPA 1LYLA 5E4WC 2NZOA 1WI5A 1W2BA 3PIO3 1GKHA 4HJ5A 1ASYA 3STBC 1YI2A 3CPFA 4MIUA 1CA6A 3CMAA 1EYGA 3T1YQ 1D2BA 2PYKA 1K73C 1SR3A 4JPBW 1JMCA 4ABNA 1MKHA 5M5WH 1I6HB 3PUWA 2UXBQ 3TQYA 4FO2A 2LFNA 4K6DA 1I50H 4GLAC 1OXVA 3CCUA 4ID6A 4GLVB 2E2HB 2O2LD 1TWHB 2PNRC 2I46A 4P72A 4PNYA 1JT8A 1I94L 3HOXG 4DV3L 4A3GH 4C3JG 3KF6A 3FRPB 1QVCA 2UUCQ 3G71A 1A6XA 4JBJA 1SNPA 3FKIB 1NR4A 3F1ZA 2E2JB 2IX3A 4KN7C 1YNNC 1XNQL 5IYDH 1JCKB 3I90A 1ONLA 5C4ZA 4X62L 1Q46A 2NZ1D 1DOKA 1HUNA 1OO9B 3RLOA 2RHSB 1OTCA 4KKTA 3C3LA 2R7ZH 4RMFA 3I91A 3AYHB 1RODA 2IT1A 3TN2A 1LABA 1HA5A 4IPGA 3D3RA 5LMNL 3T1YL 3ND8A 1R4PB 4GOPC 4JV5Q 1EIYB 1E2WA 3BVMA 2ATWA 4RGNA 4EQ5A 3RN5A 5CV4A 2AUKA 4HIDA 2K1BA 1Y14B 3S14H 1FL0A 2UUBQ 1B3AA 3V05A 4Y7NH 1JR0D 1WFQA 4I7ZC 3KFUA 1TS3A 4XQNA 3I4NG 4MTNA 2IX1A 3BJUA 2KCNA 5CV8A 4A3JB 1AZPA 1TKWB 1Y1WH 3UI2A 3T51B 3IKJA 4BA2I 3RN2A 3KBGA 5CR3A 3TRZA 4X64L 2ZM6L 1YHQA 1N36L 2PW5A 1BQQT 4R8IA 3J7AF 1F9RA 1LT6D 3K6OA 1KDBA 1E2VA 1F2MA 1YNJC 3T1HL 1H9KA 1Q8IA 1A8VA 2JA8H 4XYOA 3S14B 4L5QA 2NVTH 2XVSA 2VQEQ 3J81j 4H44C 1S40A 1NSNS 2CQOA 2IX0A 2B2YA 3I4MH 3TEHB 2ZXOA 1EY8A 3GDEA 1XMQL 4H13C 1KRTA 3HOUH 1K0SA 2MNAA 4LF4Q 1Q1EA 2EZVA 4I65A 3UDXA 1VQPA 4WFN3 1JB3A 3CQZB 1AE3A 1BBXC 4JYAL 4XT1B 3J7YW 4A3FB 3DM1A 1YJWA 2ZTEA 3KF8B 4CDDC 2A74C 4XXEA 2F3VA 4R9WA 2GVBA 4DAPA 5EQ0A 1HTPA 4MZ9A 3CCEA 1XNRL 3M9BA 4U673 3NENA 1VQ7A 1W3SA 2PMZB 2F0WA 4OONA 1H9SB 5IOCA 3E5SA 3NSWA 4BXXH 4JI0L 3PUXA 3M4OB 1I6HH 1S5ED 2CQAA 5I2YA 3DWAA 3CMEA 2WKCA 3A0JA 4H7BA 4UDUC 3W5OA 1Z7TA 1EY7A 1VQIA 2KUMA 2EYJA 4QUFA 4FP5D 4DR1Q 2AQ3B 3T16A 3TMEA 4JI3L 3HOZH 1GOZA 1T9HA 2PMZE 4K14A 3I70A 2CKZB 2QKIC 4DU9A 5FJ8H 1R9TH 3CCRA 1GUOA 3MEFA 3SVMA 1Z47A 1T5EA 3NEMA 4O1NA 3VR6A 4O42A 5M9OA 3ERQA 2LXKA 2AKWB 4N9PA 5KNBA 4X64Q 3H0GB 3CCLA 3SK4A 3S24A 3QB3A 4N9TA 1AZQA 4FF4A 4RKLA 2OQKA 5FO9B 1U0LA 4KKUA 4DR4L 1QVFA 1DOLA 4L5SA 3VR5A 3SDZA 3PO2B 4A3JG 1L0YB 2UUBL 2OTJA 3HOXH 3G4SA 1RCVD 2UXCL 2XWBB 1LT3D 2E8GA 1D6EC 1SE3A 1EEFD 2HT1A 2N3SA 3E0JA 5C4XB 1S5BD 1C0AA 4KD4A 2KENA 3DM3A 1PH4A 1XTCD 3IFTA 2R92G 1X3PA 4NPSA 3NELA 3KJOA 2PQEA 4Y52H 4MTKA 1ET9A 4K2LA 3IRBA 4ZK9B 3GTJH 2CHBD 4X62Q 2MP1A 2K5DA 3KK7A 1SYFA 1CKNB 1EQTA 5GQOA 3DMUA 1B50A 1T5XD 4A3GB 3CCVA 4BBRH 4POFA 1TWAB 3M7NA 2H5XA 1BCPF 2ZXRA 4C3HG 3D4RA 2O5IC 1L1OC 2CW0D 1I3QB 2NVYB 2SDFA 2JK8A 1PFBA 3NQIA 3K5OA 3I72A 4OELB 1U9RA 5IT9E 1J8IA 1GUGA 4DFAA 4EQPA 2B39A 1BNZA 4LWCA 1DJRD 4LJZC 4FXKC 4C2MB 4R1JA 4B3SQ 1V1PB 2FJ2A 2ES2A 3HFZB 1AH9A 2OF1A 1PFSA 1C4QA 2VY3A 3WWVA 5BN4A 3TP7A 4HCSA 5A35A 1S5FD 3MAQA 5JEAG 4BBSH 5ELDA 1B1ZA 4X3KA 4DR5L 4X3UA 1QNUA 4C56C 2JQOA 1B9MA 1BCPC 4A3CH 5I9OA 2Z4HA 1Z9FA 5A2QE 1X3FA 1N33Q 1XNRQ 1F2LA 4IQZA 1KLUD 4YIJA 4IFDI 2C5CA 1KTKA 4DK1A 3DWPA 4BY1G 2JA7G 2L15A 1UUPA 4A3CG 3TS2A 4RA8A 1EY9A 4DR7Q 2BE5D 5DEHA 1S72A 3H15A 1H95A 1SNQA 2N49A 4OL7A 4BBSG 1MHWC 4BY7H 1Q82C 5IP7G 4LF4L 2D9UA 1QG7A 3BZKA 3URYA 1JQYD 4WJWA 3MXGA 1WTRA 4KHVA 2RKSA 1WCMH 1N9WA 3I3CA 4C1NI 2MO1A 1GD7A 3DEPA 3Q23A 1Q81C 4KK7A 4A3KG 4KMUC 1FJGQ 4A76A 4X6AH 5EGTA 1TS2A 3W3AA 5FKAC 3KYHC 4CKEA 4CDCC 1LACA 3QJYA 2E2IH 1BOSA 4A93H 4RAUC 1X9NA 4HSVA 5IYCG 2NTSA 2XTIA 2QW7A 3S1NH 1N8RC 4X3SA 2BDNA 1QUQA 4DUZL 1G2SA 2KHJA 2AUJD 2WKDA 2F0JA 2RHQB 4JI1L 3NP8A 1LTAD 2R93H 2JA7H 1LV9A 3RZOB 2NB0A 2WP8J 2CH4A 2EJFC 5I2XA 3VYSA 5C6AA 4CJ1B 4GNXC 4LF8Q 5I6WA 4KLKA 5M3FB 5IP9G 2HIVA 5JJLA 1DD2A 1Q3LA 3TSSA 4C3JH 1G2TA 3BVGA 3TBIB 3X3NA 5EPKA 3EN2A 1SYEA 3Q8DA 5ELNA 1BXTA 1KHIA 4QQBX 4KJOA 1LTSD 2ENBA 4G7HC 2QDLA 2QA4A 4NXMQ 4FF3A 2L9HA 4QF4A 3F2CA 1VQEA 1YZ6A 1NR2A 1DONA 2B29A 3BU2A 3NWTA 4YHHQ 2NVQB 4MNOA 5D3IB 3BZDB 4B3SL 1DXMA 4DR7L 3H94A 1HNWL 2B63B 1DGSA 2N8NA 1PLFA 3E9IA 4FYDA 4K5XA 2FFKB 2BOSA 3CRKC 2WINB 4DF7A 4BBRG 5FJ8G 3J81L 5KNCA 2R6GA 2YU9H 1CKMA 3BYYB 4ME3A 1U5KA 4QY7A 1HPCA 2JSOA 4DK3C 1HZBA 2BH8A 2SEBD 3MFYA 1V1PA 4WRDA 2F52A 3GTGH 1UE7A 3NXWA 1JB7A 1D5ZC 4P73A 5DM63 1VDZA 1SAPA 3OMGA 4DXGA 1VS0A 1VQ9A 2LKVA 4AYBE 3I4NB 2A69D 3A56A 4FF1A 1M90C 1ICFB 3OMCA 5IGBA 3OSOA 3NK9A 2NVXH 3J80c 4LFAL 1U4MA 1O7ZA 1I4XA 5FLMH 2HQEA 3T13A 5JPMC 3HOWH 2CH4W 1L2FA 1B9NA 4UPAA 1FR3A 5GAGC 2DY7A 4HIMA 3TDQA 1WTQA 1ET6A 3V96A 1N36Q 2I5HA 2M2LA 2EDGA 3MFGA 1I4PA 4RHSA 4JI4L 4LFBQ 4DR4Q 4IPDA 1N32L 4ME5A 3QOJA 2L12A 3PV0A 3J81c 3L9AX 1KC8C 3K0YA 5CYUA 4IJHA 3H6MA 4TVAB 4DV6L 5EPJA 4DV2Q 4AQYL 3EVQA 4LFCL 1YJNA 1YNND 4G7OC 1XYIA 3I4MG 3ITPA 1O7IA 1D7QA 1TXYA 2KCTA 4AYBB 5CV6A 3HOYB 2RDFA 1SNDA 1BDOA 4IPCA 2I5MX 3N52A 4Y7NB 4KV6A 1K8MA 2KQ3A 2LS01 2FHTA 4IO9A 4B9XA 4DV6Q 1RD9D 3K5MA 2BDOA 1CZWA 4DPGA 2XRSD 3PSIA 4POGA 3BS1A 5T1GA 1V1OA 5C3EB 4G4KA 3RLFA 2F0HA 1EY6A 4B3RL 4C3IH 1PYSB 4ZUIA 4JI6L 5KEEA 2Q8IB 1VMCA 5TSSA 5M3MG 1SFOH 1CHQD 4PZ7A 3I73A 1L0WA 3CCSA 1HNZL 2HHHQ 1MIUA 3MZ5A 4YY3Q 1Y1WG 5HGQA 1QVGA 4IZ8A 3D6WA 2UUCL 1JWUD 2ICIA 1C8CA 1A3UA 2WAQG 1X3QA 1E0BA 1GVPA 1FNWA 4N8FA 2LXJA
chains in the Genus database with same CATH topology
3KLWA 1WJJA 4NB3A 3PF5A 1UE5A 2VQEQ 1J5EQ 5JJIA 4A3DH 3J81j 4J15A 1MJEA 3HOYH 3PIOA 1WOCA 1S40A 4C3HH 2CQOA 2IX0A 3CPWA 4A3MH 1IBKQ 1VQ4A 3I4MH 4A3BH 3TEHB 3GDEA 1XMQL 4DKAC 4DR2L 2WB1G 1Q12A 1Q1BA 2A19A 1B8AA 3D0FA 1KRTA 5H1SE 4DV7L 3HOUH 4A3BG 4JBKA 2MNAA 1CSQA 4QIWE 4GKKQ 3CD6A 4LF4Q 3PUZA 1S3OA 1Q1EA 1XJVA 2A8VA 3UDXA 4A3DG 1BVSA 1YNXA 1VQPA 3HKZE 3A5UA 2OCEA 1HNXQ 3PUYA 4GNXA 3CC4A 3H0GG 5EAYA 5AJ3L 2JA5H 2PI2A 1AE3A 1E1OA 4KHZA 1A0IA 4R4TA 2Q2TA 3PCOB 3S2DH 1BKBA 1BBWA 5C4JH 4JYAL 4IPHA 3M4PA 4DNIA 1BBUA 4LF6Q 4LF7L 3S2HH 3CQZH 3PGZA 4A3KH 3CC2A 1YJWA 3HOVH 2GN5A 1HJPA 2BA0A 2NVYH 2ZTEA 3KF8B 1HR0W 3CP0A 4L5TA 4IFDJ 4OO1I 3HKZG 1PV4A 2GVBA 2B63G 4DR1L 4MZ9A 3CCEA 1XNRL 4LF8L 2YYZA 4A3GG 3M9BA 1Q7YC 1SE8A 2PQAB 3NENA 1PH2A 1W3SA 1VQ7A 4YHHL 2DUDA 4A3EG 3KF6B 3F2DA 4OONA 4BY7G 1KXLA 1CKNA 2WB1E 4LF7Q 1RL2A 4HIOA 5C4XG 5JJKA 2K4KA 1CKOA 4JBWA 2E2HH 1YVCA 3L2PA 4JI0Q 4JI0L 4BXXH 2JE6I 3PUXA 3W1GA 1NBWA 5GAHC 3KOJA 5M3FH 1I6HH 3J80i 3UDFA 4DUZQ 4A3IG 4BY1H 2RCNA 3CMEA 1EWIA 4APVA 1EFWA 1XMOQ 5C44H 2K14A 3A0JA 1EQQA 4HIKA 3W5OA 4A3IH 1VQIA 1UEBA 2WAQE 4DV7Q 3L7ZC 4A3FG 5IE8A 4OX9L 2F4VQ 2JEAI 3J7ZC 1M1KC 5JEAJ 4DR1Q 1PYBA 4JI3L 1FVIA 3HOZH 2ZJPA 4XIGS 4AIMA 3HOWG 2LSSA 3A74A 1IBKL 1VQ8A 1X56A 3T1HQ 1T9HA 2PMZE 4P75A 3STBD 5GAEC 1FJGL 2VQFQ 4LF5L 4YWKA 2AHOB 4DV1L 2CKZB 1NTGA 1YIJA 5FJ8H 1R9TH 3LGJA 3K7UC 4P71A 3MEFA 3CCRA 1IZ6A 2VL6A 4A93G 1Z47A 1E22A 2EXDA 2B63H 3NEMA 2PQAA 3RLNA 3U4ZA 1GO3E 2JJQA 3ER0A 2JA6H 2LXKA 2AKWB 4X64Q 1XPUA 3HOZG 4JV5L 3CCLA 1VQFA 1CSPA 4L5RC 3S24A 3OW2A 1IL2A 4WJ3M 4FDBA 4C2MH 3UDIA 2OWOA 2HHHL 1HNZQ 1VQDA 3SGIA 4HJ8A 1QZGA 2OQKA 1U0LA 1VCIA 2FXQA 1LTLA 4DR4L 1QVFA 3S1QH 1K8AC 1KAWA 4R4QA 5IWAL 3GTPH 4EX5A 2K75A 1JE5A 1VQHA 3KDFB 4L5SA 4DV0Q 3G48A 2UXDL 1JJGA 3TS0A 4A3JG 2UUBL 5IYBG 1XNQQ 3PO2G 2OTJA 3HOXH 1RIPA 4GKJL 1PHJA 3G4SA 2IY5B 1HZCA 4O0AA 4OWWB 2UXCL 4JOIC 4A3EH 2HIXA 2E8GA 3I7FA 2OTLA 1X54A 2HT1A 2N3SA 4A3MG 1VQAA 4JG2A 2MQHA 1C0AA 5E7NA 2Z6KA 2QEXA 2KENA 3DM3A 1A63A 1UE1A 3MXNB 4DR5Q 1PH4A 2R92G 4DV3Q 4NPSA 4DAYB 1E1TA 4QL5A 3NELA 3GTLH 3KJOA 4Y52H 4PZ8A 1VQCA 4B3MQ 4LFAQ 4DV4Q 4JI5Q 2OQ0A 2K5NA 3U50C 3S17H 5M3FG 1V43A 3IRBA 4UP9A 4OXPA 3GTJH 1Y1VG 4X62Q 2CWAA 1SROA 1V1QA 3CC7A 4B3RQ 1PVOA 5IY0A 4UP7A 2CFMA 3K8AA 1CKNB 1HR0Q 3H3VI 3PO3G 5GQOA 1PA6A 4KHPQ 1HR0L 1B70B 4LUOA 3I56A 2CCZA 5M3MH 1TWCH 3CCVA 1EQRA 4BBRH 1L1OA 3ULLA 4POFA 3M7NA 2H5XA 3JAMc 5C0XG 3CCMA 3K0XA 1L1OC 1N33L 3I4NH 3PO2H 5C3EH 2JK8A 3RR5A 4JI7Q 4IJLA 4DUYQ 1XPRA 2UU9L 2K50A 3J81i 4A3LH 1MJCA 1PH6A 2MFIA 4A4IA 4X66Q 4HJ7A 1QZHA 4LF9L 4A3LG 2EIFA 2JA8G 3H0GH 5GROA 4LWCA 4DV5Q 4GLXA 1K8GA 1TWGH 2JA9A 3FP9A 3EBEA 4R1JA 2K5VA 4X65Q 4B3SQ 4JI2L 1P16A 3AEVA 1N32Q 2RF4A 1OXTA 3F2BA 3HFZB 4DR3Q 2ES2A 4JI4Q 4LFBL 2UXDQ 1AH9A 1IYJB 1PFSA 2Q2HA 2VY3A 3WWVA 4GKJQ 4YWLA 2V1CC 2JA6G 4OWXB 1TWFH 3TREA 1E24A 2Z6KC 5DLQE 1EUJA 3CF5A 4DV5L 5JEAG 4BBSH 4ALPA 1PH1A 4LW1A 2VZAA 3K81C 5C0XJ 4DR5L 2KCMA 2JQOA 3RZDH 1KL9A 3PF4A 2D0PA 4DK6C 4A3CH 2VUMG 4GS3A 5M5YH 1K9MC 1Z9FA 1X3FA 1N33Q 1XNRQ 3NBHB 3M3YH 4DAMA 5BR8L 2UXCQ 1X3GA 2E2JH 4JI8L 5ELOA 1PH5A 4IFDI 1NJIC 1K0RA 1E3PA 1UWVA 3K80C 4JCVE 3M85A 3M4OH 1G6PA 4BY1G 2JA7G 2L15A 3UDGA 1I5FA 3I4OA 4A3CG 3TS2A 1QUQB 2R7FA 3J7A5 4DR7Q 2HQLA 1XTDA 1S72A 4YCWA 3H15A 2N49A 3CAMA 1H95A 1NE3A 4BBSG 4IOCA 1HNXL 2UUAQ 4R4OA 1YBYA 2NN6G 4BY7H 1Q82C 1JJ2A 1IBMQ 5IYCH 1IBLQ 5IP7G 4LF4L 4GKKL 1JJCB 2K52A 3BZKA 5M5XH 3PUVA 4JI1Q 4AYBG 1G291 2C35B 5IYDG 1WCMH 1N9WA 2NVQH 3FKIG 2MO1A 1GD7A 1SRUA 2YTYA 1Q81C 1VQNA 4JOIA 4LUZA 4A3KG 1FJGQ 2PNHA 4A76A 4X6AH 3D31A 2ZJQA 3GTOH 3ERSX 3GTQH 3CCJA 1WCMG 3KYHC 2AWOA 1LUZA 2E2IH 1OXSC 2JA5G 3ZJYC 4A93H 1X9NA 2F4VL 1NMFA 2VS1A 3RNUA 4OX9Q 5IYCG 2XTIA 4PMWA 4DV0L 3S1NH 1N8RC 2Y0SG 1NMGA 2R7ZG 1TWHH 4R4CA 1AE2A 4JYAQ 4RG1A 1QUQA 4DUZL 2KHJA 4A75A 3ULPA 3E0EA 2RHQB 2KHIA 4LUVA 4JI1L 3CXCA 3G6EA 1YHAA 2R93H 5J3BA 2JA7H 1L1OB 4GN4B 3S1MH 5C0XI 3HOYG 4QJFA 4OO1G 1HZAA 3S16H 2WP8J 2UUAL 3GO5A 1IXRA 1K83H 4YWMA 2ALYB 1XPOA 4GNXC 4LF8Q 2DGYA 1A62A 3EIVA 2R7DA 4KLKA 1LM0A 2ZTDA 1PH7A 1E7ZA 2ASBA 4BXXG 2B3GA 5IP9G 4DV1Q 4HJ9A 3ICEA 2HIVA 2VQFL 5LMUL 1PH8A 1EIFA 4C3JH 1Q86C 4LF5Q 2AMCB 1UE6A 5C3EG 3B6YA 3GTKH 3ULJA 1J5EL 4UY8C 3OYYA 5FLMG 4LF6L 3EN2A 4JI3Q 3W1BA 1YHBA 4JI8Q 3Q8DA 3K7AH 5ELNA 5BR8Q 1V9PA 2IHFA 3KDFA 1P8LA 1KHIA 2JEBI 1ASZA 4QQBX 4WJ4A 2XGTA 4YCUA 2YTXA 1IBML 2K5HA 4JBMA 5GADC 2QA4A 4AQYQ 1VQKA 3U58A 4NXMQ 4YY3L 3F2CA 4A3JH 4P74A 2I5LX 3L0OA 1VQEA 1YZ6A 4IOAA 4GOPA 4H02A 1XMQQ 3OTOL 1PH3A 4IFDG 1HZ9A 2B29A 1KRSA 2EQSA 4GN5A 4O2DA 2A1AA 3BU2A 3M4QA 1VQOA 4YHHQ 4JI6Q 4MNOA 2VQEL 2N78A 1EOVA 1HH2P 1KIXA 2R92H 5JJLA 1SN8A 4JI2Q 4X65L 4B3SL 4DR7L 5K36G 3HOUG 3PIPA 1OXUA 1HNWL 2NN6I 4NXNQ 1DGSA 2N8NA 1KD1C 1N34Q 4KI0A 4K0KQ 3E9IA 2YV5A 5FLXc 1Q8KA 1LYLA 4BBRG 5FJ8G 2NZOA 2R6GA 4UP8A 1WI5A 1W2BA 1B7YB 1GKHA 5IYBH 3E9HA 2YU9H 2Y0SE 3F8TA 1CKMA 4HJ5A 4JI7L 4ME3A 1J6QA 1KQSA 4AH6A 1U5KA 1YEZA 4QY7A 1FGUA 1ASYA 3STBC 2BH2A 3PO3H 4DK3C 5AJ3Q 3CPFA 1HZBA 1YI2A 4LNQA 2BH8A 2ZM6Q 3CMAA 5IP9H 1IBLL 4PZ6A 1EYGA 3CCQA 3T1YQ 2F52A 3GTGH 1UE7A 4DV2L 2ID0A 1K73C 4B3TL 1SR3A 1JB7A 1VQGA 4P73A 3AFQA 1JMCA 1MKHA 5M5WH 3RZOH 3PUWA 2UXBQ 4DR2Q 1VS0A 2E5LL 2E5LQ 3TQYA 1VQ9A 2PI2E 1I50H 4GLAC 1VQBA 4AYBE 2R93G 1OXVA 3CCUA 5HY6A 1M90C 4B3TQ 1C9OA 2KBNA 4GLVB 2NVXH 3J80c 2VW9A 1CUKA 2UU9Q 4DV4L 1YJ9A 4B3ML 4LFAL 1SMXA 4P72A 5FLMH 2IHEA 3AFPA 2Q2IA 1JT8A 4GNXB 1I94L 1VQ6A 3HOXG 4DV3L 1X6OA 4LF9Q 4A3GH 4X66L 3KF6A 2YTVA 3HOWH 1QVCA 4HJAA 2UUCQ 2NZHA 1L2FA 4LFCQ 3G71A 4JBJA 5LMNQ 3KJPA 1K3RA 2ZJRA 2AWNA 4DUYL 4UPAA 3HOVG 5GAGC 3UE1A 1N34L 4HIMA 3F1ZA 4JC0A 4NXNL 3UE0A 3A5ZB 3JAMi 3GTMH 1N36Q 4KHPL 2I5HA 1XNQL 5IYDH 3AQQA 4X62L 1Q46A 4XTCS 4DR3L 4JI4L 1WYDA 4LFBQ 3RLOA 4JI5L 4DR4Q 4IPDA 2RHSB 5IP7H 1N32L 4TQUS 1OTCA 2BA1A 1NY4A 5LMNW 2UXBL 3PV0A 4DR6Q 2R7ZH 4RMFA 3J81c 3AYHB 1SLJA 1KC8C 2IT1A 4R4IA 1PH9A 4IJHA 2CWPA 2F3IA 4IPGA 4TVAB 4DV6L 4GOPB 3S15H 5LMNL 3BZCA 4DV2Q 1YJNA 4AQYL 4LFCL 3T1YL 1X3EA 4GOPC 3I4MG 4JV5Q 1EIYB 1O7IA 2ATWA 2D0OA 1D7QA 4EQ5A 1TXYA 2KCTA 3RN5A 1I94Q 1C7YA 4HIDA 2GVAA 3U4VA 4IPCA 2I5MX 4A3FH 1VQLA 1Y14B 3S14H 1FL0A 3FKIH 2UUBQ 5C44G 4IO9A 1G51A 3H3VH 4DV6Q 5IWAQ 4Y7NH 1WFQA 4BA1I 4OWTB 4DPGA 5LMUQ 3PSIA 3KFUA 4POGA 3S1RH 3I4NG 4QGUA 4DR6L 4MTNA 2IX1A 3BJUA 1HNWQ 3GD7A 3RLFA 1I3QH 1Y1WH 4B3RL 2WFWA 3DLLA 4C3IH 1PYSB 1X65A 5C4XH 2ZTCA 4JI6L 2Z0SA 1XMOL 2I0QA 1TWAH 1OXXK 4BA2I 3RN2A 1D8LA 2Q2UA 3TRZA 3FHWA 4X64L 2ZM6L 3OTOQ 5M3MG 3VDYA 1YHQA 1N36L 1SFOH 2VNUD 4GN3B 3JC66 4PZ7A 1L0WA 3HKSA 3CCSA 1GM5A 2QGQA 1HNZL 2HHHQ 1MIUA 1VQMA 4YCVA 4YY3Q 1Y1WG 2MO0A 4PG3A 5HGQA 1VQ5A 4NXML 1QVGA 1Y1VH 3I55A 2UUCL 3I2ZA 1X55A 5IT9c 1YITA 3T1HL 2JA8H 1A8VA 1VQJA 4K0KL 2WAQG 3CW2C 4L5QA 1GVPA 2NVTH 2VUMH 2D62A 2LXJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KLW A;  1WJJ A;  4NB3 A;  3PF5 A;  1UE5 A;  2VQE Q;  1J5E Q;  5JJI A;  4A3D H;  3J81 j;  4J15 A;  1MJE A;  3HOY H;  3PIO A;  1WOC A;  1S40 A;  4C3H H;  2CQO A;  2IX0 A;  3CPW A;  4A3M H;  1IBK Q;  1VQ4 A;  3I4M H;  4A3B H;  3TEH B;  3GDE A;  1XMQ L;  4DKA C;  4DR2 L;  2WB1 G;  1Q12 A;  1Q1B A;  2A19 A;  1B8A A;  3D0F A;  1KRT A;  5H1S E;  4DV7 L;  3HOU H;  4A3B G;  4JBK A;  2MNA A;  1CSQ A;  4QIW E;  4GKK Q;  3CD6 A;  4LF4 Q;  3PUZ A;  1S3O A;  1Q1E A;  1XJV A;  2A8V A;  3UDX A;  4A3D G;  1BVS A;  1YNX A;  1VQP A;  3HKZ E;  3A5U A;  2OCE A;  1HNX Q;  3PUY A;  4GNX A;  3CC4 A;  3H0G G;  5EAY A;  5AJ3 L;  2JA5 H;  2PI2 A;  1AE3 A;  1E1O A;  4KHZ A;  1A0I A;  4R4T A;  2Q2T A;  3PCO B;  3S2D H;  1BKB A;  1BBW A;  5C4J H;  4JYA L;  4IPH A;  3M4P A;  4DNI A;  1BBU A;  4LF6 Q;  4LF7 L;  3S2H H;  3CQZ H;  3PGZ A;  4A3K H;  3CC2 A;  1YJW A;  3HOV H;  2GN5 A;  1HJP A;  2BA0 A;  2NVY H;  2ZTE A;  3KF8 B;  1HR0 W;  3CP0 A;  4L5T A;  4IFD J;  4OO1 I;  3HKZ G;  1PV4 A;  2GVB A;  2B63 G;  4DR1 L;  4MZ9 A;  3CCE A;  1XNR L;  4LF8 L;  2YYZ A;  4A3G G;  3M9B A;  1Q7Y C;  1SE8 A;  2PQA B;  3NEN A;  1PH2 A;  1W3S A;  1VQ7 A;  4YHH L;  2DUD A;  4A3E G;  3KF6 B;  3F2D A;  4OON A;  4BY7 G;  1KXL A;  1CKN A;  2WB1 E;  4LF7 Q;  1RL2 A;  4HIO A;  5C4X G;  5JJK A;  2K4K A;  1CKO A;  4JBW A;  2E2H H;  1YVC A;  3L2P A;  4JI0 Q;  4JI0 L;  4BXX H;  2JE6 I;  3PUX A;  3W1G A;  1NBW A;  5GAH C;  3KOJ A;  5M3F H;  1I6H H;  3J80 i;  3UDF A;  4DUZ Q;  4A3I G;  4BY1 H;  2RCN A;  3CME A;  1EWI A;  4APV A;  1EFW A;  1XMO Q;  5C44 H;  2K14 A;  3A0J A;  1EQQ A;  4HIK A;  3W5O A;  4A3I H;  1VQI A;  1UEB A;  2WAQ E;  4DV7 Q;  3L7Z C;  4A3F G;  5IE8 A;  4OX9 L;  2F4V Q;  2JEA I;  3J7Z C;  1M1K C;  5JEA J;  4DR1 Q;  1PYB A;  4JI3 L;  1FVI A;  3HOZ H;  2ZJP A;  4XIG S;  4AIM A;  3HOW G;  2LSS A;  3A74 A;  1IBK L;  1VQ8 A;  1X56 A;  3T1H Q;  1T9H A;  2PMZ E;  4P75 A;  3STB D;  5GAE C;  1FJG L;  2VQF Q;  4LF5 L;  4YWK A;  2AHO B;  4DV1 L;  2CKZ B;  1NTG A;  1YIJ A;  5FJ8 H;  1R9T H;  3LGJ A;  3K7U C;  4P71 A;  3MEF A;  3CCR A;  1IZ6 A;  2VL6 A;  4A93 G;  1Z47 A;  1E22 A;  2EXD A;  2B63 H;  3NEM A;  2PQA A;  3RLN A;  3U4Z A;  1GO3 E;  2JJQ A;  3ER0 A;  2JA6 H;  2LXK A;  2AKW B;  4X64 Q;  1XPU A;  3HOZ G;  4JV5 L;  3CCL A;  1VQF A;  1CSP A;  4L5R C;  3S24 A;  3OW2 A;  1IL2 A;  4WJ3 M;  4FDB A;  4C2M H;  3UDI A;  2OWO A;  2HHH L;  1HNZ Q;  1VQD A;  3SGI A;  4HJ8 A;  1QZG A;  2OQK A;  1U0L A;  1VCI A;  2FXQ A;  1LTL A;  4DR4 L;  1QVF A;  3S1Q H;  1K8A C;  1KAW A;  4R4Q A;  5IWA L;  3GTP H;  4EX5 A;  2K75 A;  1JE5 A;  1VQH A;  3KDF B;  4L5S A;  4DV0 Q;  3G48 A;  2UXD L;  1JJG A;  3TS0 A;  4A3J G;  2UUB L;  5IYB G;  1XNQ Q;  3PO2 G;  2OTJ A;  3HOX H;  1RIP A;  4GKJ L;  1PHJ A;  3G4S A;  2IY5 B;  1HZC A;  4O0A A;  4OWW B;  2UXC L;  4JOI C;  4A3E H;  2HIX A;  2E8G A;  3I7F A;  2OTL A;  1X54 A;  2HT1 A;  2N3S A;  4A3M G;  1VQA A;  4JG2 A;  2MQH A;  1C0A A;  5E7N A;  2Z6K A;  2QEX A;  2KEN A;  3DM3 A;  1A63 A;  1UE1 A;  3MXN B;  4DR5 Q;  1PH4 A;  2R92 G;  4DV3 Q;  4NPS A;  4DAY B;  1E1T A;  4QL5 A;  3NEL A;  3GTL H;  3KJO A;  4Y52 H;  4PZ8 A;  1VQC A;  4B3M Q;  4LFA Q;  4DV4 Q;  4JI5 Q;  2OQ0 A;  2K5N A;  3U50 C;  3S17 H;  5M3F G;  1V43 A;  3IRB A;  4UP9 A;  4OXP A;  3GTJ H;  1Y1V G;  4X62 Q;  2CWA A;  1SRO A;  1V1Q A;  3CC7 A;  4B3R Q;  1PVO A;  5IY0 A;  4UP7 A;  2CFM A;  3K8A A;  1CKN B;  1HR0 Q;  3H3V I;  3PO3 G;  5GQO A;  1PA6 A;  4KHP Q;  1HR0 L;  1B70 B;  4LUO A;  3I56 A;  2CCZ A;  5M3M H;  1TWC H;  3CCV A;  1EQR A;  4BBR H;  1L1O A;  3ULL A;  4POF A;  3M7N A;  2H5X A;  3JAM c;  5C0X G;  3CCM A;  3K0X A;  1L1O C;  1N33 L;  3I4N H;  3PO2 H;  5C3E H;  2JK8 A;  3RR5 A;  4JI7 Q;  4IJL A;  4DUY Q;  1XPR A;  2UU9 L;  2K50 A;  3J81 i;  4A3L H;  1MJC A;  1PH6 A;  2MFI A;  4A4I A;  4X66 Q;  4HJ7 A;  1QZH A;  4LF9 L;  4A3L G;  2EIF A;  2JA8 G;  3H0G H;  5GRO A;  4LWC A;  4DV5 Q;  4GLX A;  1K8G A;  1TWG H;  2JA9 A;  3FP9 A;  3EBE A;  4R1J A;  2K5V A;  4X65 Q;  4B3S Q;  4JI2 L;  1P16 A;  3AEV A;  1N32 Q;  2RF4 A;  1OXT A;  3F2B A;  3HFZ B;  4DR3 Q;  2ES2 A;  4JI4 Q;  4LFB L;  2UXD Q;  1AH9 A;  1IYJ B;  1PFS A;  2Q2H A;  2VY3 A;  3WWV A;  4GKJ Q;  4YWL A;  2V1C C;  2JA6 G;  4OWX B;  1TWF H;  3TRE A;  1E24 A;  2Z6K C;  5DLQ E;  1EUJ A;  3CF5 A;  4DV5 L;  5JEA G;  4BBS H;  4ALP A;  1PH1 A;  4LW1 A;  2VZA A;  3K81 C;  5C0X J;  4DR5 L;  2KCM A;  2JQO A;  3RZD H;  1KL9 A;  3PF4 A;  2D0P A;  4DK6 C;  4A3C H;  2VUM G;  4GS3 A;  5M5Y H;  1K9M C;  1Z9F A;  1X3F A;  1N33 Q;  1XNR Q;  3NBH B;  3M3Y H;  4DAM A;  5BR8 L;  2UXC Q;  1X3G A;  2E2J H;  4JI8 L;  5ELO A;  1PH5 A;  4IFD I;  1NJI C;  1K0R A;  1E3P A;  1UWV A;  3K80 C;  4JCV E;  3M85 A;  3M4O H;  1G6P A;  4BY1 G;  2JA7 G;  2L15 A;  3UDG A;  1I5F A;  3I4O A;  4A3C G;  3TS2 A;  1QUQ B;  2R7F A;  3J7A 5;  4DR7 Q;  2HQL A;  1XTD A;  1S72 A;  4YCW A;  3H15 A;  2N49 A;  3CAM A;  1H95 A;  1NE3 A;  4BBS G;  4IOC A;  1HNX L;  2UUA Q;  4R4O A;  1YBY A;  2NN6 G;  4BY7 H;  1Q82 C;  1JJ2 A;  1IBM Q;  5IYC H;  1IBL Q;  5IP7 G;  4LF4 L;  4GKK L;  1JJC B;  2K52 A;  3BZK A;  5M5X H;  3PUV A;  4JI1 Q;  4AYB G;  1G29 1;  2C35 B;  5IYD G;  1WCM H;  1N9W A;  2NVQ H;  3FKI G;  2MO1 A;  1GD7 A;  1SRU A;  2YTY A;  1Q81 C;  1VQN A;  4JOI A;  4LUZ A;  4A3K G;  1FJG Q;  2PNH A;  4A76 A;  4X6A H;  3D31 A;  2ZJQ A;  3GTO H;  3ERS X;  3GTQ H;  3CCJ A;  1WCM G;  3KYH C;  2AWO A;  1LUZ A;  2E2I H;  1OXS C;  2JA5 G;  3ZJY C;  4A93 H;  1X9N A;  2F4V L;  1NMF A;  2VS1 A;  3RNU A;  4OX9 Q;  5IYC G;  2XTI A;  4PMW A;  4DV0 L;  3S1N H;  1N8R C;  2Y0S G;  1NMG A;  2R7Z G;  1TWH H;  4R4C A;  1AE2 A;  4JYA Q;  4RG1 A;  1QUQ A;  4DUZ L;  2KHJ A;  4A75 A;  3ULP A;  3E0E A;  2RHQ B;  2KHI A;  4LUV A;  4JI1 L;  3CXC A;  3G6E A;  1YHA A;  2R93 H;  5J3B A;  2JA7 H;  1L1O B;  4GN4 B;  3S1M H;  5C0X I;  3HOY G;  4QJF A;  4OO1 G;  1HZA A;  3S16 H;  2WP8 J;  2UUA L;  3GO5 A;  1IXR A;  1K83 H;  4YWM A;  2ALY B;  1XPO A;  4GNX C;  4LF8 Q;  2DGY A;  1A62 A;  3EIV A;  2R7D A;  4KLK A;  1LM0 A;  2ZTD A;  1PH7 A;  1E7Z A;  2ASB A;  4BXX G;  2B3G A;  5IP9 G;  4DV1 Q;  4HJ9 A;  3ICE A;  2HIV A;  2VQF L;  5LMU L;  1PH8 A;  1EIF A;  4C3J H;  1Q86 C;  4LF5 Q;  2AMC B;  1UE6 A;  5C3E G;  3B6Y A;  3GTK H;  3ULJ A;  1J5E L;  4UY8 C;  3OYY A;  5FLM G;  4LF6 L;  3EN2 A;  4JI3 Q;  3W1B A;  1YHB A;  4JI8 Q;  3Q8D A;  3K7A H;  5ELN A;  5BR8 Q;  1V9P A;  2IHF A;  3KDF A;  1P8L A;  1KHI A;  2JEB I;  1ASZ A;  4QQB X;  4WJ4 A;  2XGT A;  4YCU A;  2YTX A;  1IBM L;  2K5H A;  4JBM A;  5GAD C;  2QA4 A;  4AQY Q;  1VQK A;  3U58 A;  4NXM Q;  4YY3 L;  3F2C A;  4A3J H;  4P74 A;  2I5L X;  3L0O A;  1VQE A;  1YZ6 A;  4IOA A;  4GOP A;  4H02 A;  1XMQ Q;  3OTO L;  1PH3 A;  4IFD G;  1HZ9 A;  2B29 A;  1KRS A;  2EQS A;  4GN5 A;  4O2D A;  2A1A A;  3BU2 A;  3M4Q A;  1VQO A;  4YHH Q;  4JI6 Q;  4MNO A;  2VQE L;  2N78 A;  1EOV A;  1HH2 P;  1KIX A;  2R92 H;  5JJL A;  1SN8 A;  4JI2 Q;  4X65 L;  4B3S L;  4DR7 L;  5K36 G;  3HOU G;  3PIP A;  1OXU A;  1HNW L;  2NN6 I;  4NXN Q;  1DGS A;  2N8N A;  1KD1 C;  1N34 Q;  4KI0 A;  4K0K Q;  3E9I A;  2YV5 A;  5FLX c;  1Q8K A;  1LYL A;  4BBR G;  5FJ8 G;  2NZO A;  2R6G A;  4UP8 A;  1WI5 A;  1W2B A;  1B7Y B;  1GKH A;  5IYB H;  3E9H A;  2YU9 H;  2Y0S E;  3F8T A;  1CKM A;  4HJ5 A;  4JI7 L;  4ME3 A;  1J6Q A;  1KQS A;  4AH6 A;  1U5K A;  1YEZ A;  4QY7 A;  1FGU A;  1ASY A;  3STB C;  2BH2 A;  3PO3 H;  4DK3 C;  5AJ3 Q;  3CPF A;  1HZB A;  1YI2 A;  4LNQ A;  2BH8 A;  2ZM6 Q;  3CMA A;  5IP9 H;  1IBL L;  4PZ6 A;  1EYG A;  3CCQ A;  3T1Y Q;  2F52 A;  3GTG H;  1UE7 A;  4DV2 L;  2ID0 A;  1K73 C;  4B3T L;  1SR3 A;  1JB7 A;  1VQG A;  4P73 A;  3AFQ A;  1JMC A;  1MKH A;  5M5W H;  3RZO H;  3PUW A;  2UXB Q;  4DR2 Q;  1VS0 A;  2E5L L;  2E5L Q;  3TQY A;  1VQ9 A;  2PI2 E;  1I50 H;  4GLA C;  1VQB A;  4AYB E;  2R93 G;  1OXV A;  3CCU A;  5HY6 A;  1M90 C;  4B3T Q;  1C9O A;  2KBN A;  4GLV B;  2NVX H;  3J80 c;  2VW9 A;  1CUK A;  2UU9 Q;  4DV4 L;  1YJ9 A;  4B3M L;  4LFA L;  1SMX A;  4P72 A;  5FLM H;  2IHE A;  3AFP A;  2Q2I A;  1JT8 A;  4GNX B;  1I94 L;  1VQ6 A;  3HOX G;  4DV3 L;  1X6O A;  4LF9 Q;  4A3G H;  4X66 L;  3KF6 A;  2YTV A;  3HOW H;  1QVC A;  4HJA A;  2UUC Q;  2NZH A;  1L2F A;  4LFC Q;  3G71 A;  4JBJ A;  5LMN Q;  3KJP A;  1K3R A;  2ZJR A;  2AWN A;  4DUY L;  4UPA A;  3HOV G;  5GAG C;  3UE1 A;  1N34 L;  4HIM A;  3F1Z A;  4JC0 A;  4NXN L;  3UE0 A;  3A5Z B;  3JAM i;  3GTM H;  1N36 Q;  4KHP L;  2I5H A;  1XNQ L;  5IYD H;  3AQQ A;  4X62 L;  1Q46 A;  4XTC S;  4DR3 L;  4JI4 L;  1WYD A;  4LFB Q;  3RLO A;  4JI5 L;  4DR4 Q;  4IPD A;  2RHS B;  5IP7 H;  1N32 L;  4TQU S;  1OTC A;  2BA1 A;  1NY4 A;  5LMN W;  2UXB L;  3PV0 A;  4DR6 Q;  2R7Z H;  4RMF A;  3J81 c;  3AYH B;  1SLJ A;  1KC8 C;  2IT1 A;  4R4I A;  1PH9 A;  4IJH A;  2CWP A;  2F3I A;  4IPG A;  4TVA B;  4DV6 L;  4GOP B;  3S15 H;  5LMN L;  3BZC A;  4DV2 Q;  1YJN A;  4AQY L;  4LFC L;  3T1Y L;  1X3E A;  4GOP C;  3I4M G;  4JV5 Q;  1EIY B;  1O7I A;  2ATW A;  2D0O A;  1D7Q A;  4EQ5 A;  1TXY A;  2KCT A;  3RN5 A;  1I94 Q;  1C7Y A;  4HID A;  2GVA A;  3U4V A;  4IPC A;  2I5M X;  4A3F H;  1VQL A;  1Y14 B;  3S14 H;  1FL0 A;  3FKI H;  2UUB Q;  5C44 G;  4IO9 A;  1G51 A;  3H3V H;  4DV6 Q;  5IWA Q;  4Y7N H;  1WFQ A;  4BA1 I;  4OWT B;  4DPG A;  5LMU Q;  3PSI A;  3KFU A;  4POG A;  3S1R H;  3I4N G;  4QGU A;  4DR6 L;  4MTN A;  2IX1 A;  3BJU A;  1HNW Q;  3GD7 A;  3RLF A;  1I3Q H;  1Y1W H;  4B3R L;  2WFW A;  3DLL A;  4C3I H;  1PYS B;  1X65 A;  5C4X H;  2ZTC A;  4JI6 L;  2Z0S A;  1XMO L;  2I0Q A;  1TWA H;  1OXX K;  4BA2 I;  3RN2 A;  1D8L A;  2Q2U A;  3TRZ A;  3FHW A;  4X64 L;  2ZM6 L;  3OTO Q;  5M3M G;  3VDY A;  1YHQ A;  1N36 L;  1SFO H;  2VNU D;  4GN3 B;  3JC6 6;  4PZ7 A;  1L0W A;  3HKS A;  3CCS A;  1GM5 A;  2QGQ A;  1HNZ L;  2HHH Q;  1MIU A;  1VQM A;  4YCV A;  4YY3 Q;  1Y1W G;  2MO0 A;  4PG3 A;  5HGQ A;  1VQ5 A;  4NXM L;  1QVG A;  1Y1V H;  3I55 A;  2UUC L;  3I2Z A;  1X55 A;  5IT9 c;  1YIT A;  3T1H L;  2JA8 H;  1A8V A;  1VQJ A;  4K0K L;  2WAQ G;  3CW2 C;  4L5Q A;  1GVP A;  2NVT H;  2VUM H;  2D62 A;  2LXJ A; 
#chains in the Genus database with same CATH topology
 3KLW A;  1J5E Q;  5JJI A;  1JOQ A;  5CV7 A;  1MJE A;  1HQR D;  1PFM A;  3O13 A;  4A3M H;  5F2D A;  2Y0S B;  1K3B C;  4OIJ A;  1CK1 A;  1CT1 D;  1PXU A;  4A3B G;  4JBK A;  4QIW E;  4G57 A;  2A8V A;  1STG A;  3HKZ E;  3A5U A;  3QIA A;  5FLX L;  3PUY A;  1HNX Q;  1R4Q B;  5KND A;  2A73 B;  4HAE A;  1H9M A;  1E1O A;  4OIK A;  1A0I A;  3GTM B;  1BBW A;  5C4J H;  1SSO A;  1TQO A;  3PGZ A;  1VF7 A;  4A3K H;  2XSC A;  3EFX D;  3HOV H;  1HJP A;  2NVY H;  1M4V A;  1HR0 W;  4L5T A;  2B63 G;  4A3G G;  2YYZ A;  2PQA B;  1JWS D;  3F2U A;  2DUD A;  4QIW B;  3KF6 B;  4YHH L;  1CKN A;  2WB1 E;  4LF7 Q;  3RD4 A;  5C4X G;  5JJK A;  3MWY W;  3CHB D;  1EL0 A;  1ESF A;  5J1Z A;  5GAH C;  5M3F H;  2K04 A;  1A3T A;  2M9V A;  4LMQ D;  2RCN A;  5JJZ A;  1EWI A;  3S2D B;  5C44 H;  2K14 A;  4A3I H;  1UEB A;  3MEH A;  4X3T A;  3J7Z C;  1M1K C;  5JEA J;  1PYB A;  1FVI A;  4PMB A;  1PRT C;  2JXM B;  4L8J A;  1BO0 A;  1VQ8 A;  1X56 A;  3T1H Q;  3AB9 A;  2VB2 X;  5EKI A;  3STB D;  5GAE C;  2VQF Q;  2KEC A;  2L1B A;  2AHO B;  4YWK A;  4DV1 L;  2F03 A;  5M3M B;  1E22 A;  5JAV A;  1G8Z D;  2PQA A;  2RA4 A;  3R93 A;  3RLN A;  4C3J B;  5COY A;  1SE2 A;  1TY2 A;  2XIW A;  3PMF A;  5IGD A;  1CSP A;  4L5R C;  1IL2 A;  3P1H A;  2WAQ B;  5G3L F;  1NUC A;  2FXQ A;  1LTL A;  3H09 A;  3SR1 A;  1BCP D;  1GUN A;  3EQL C;  3FEW X;  4DNT B;  4EX5 A;  2K75 A;  2F1M A;  1QOH A;  2UXD L;  3TS0 A;  3VR4 A;  5E4X A;  1XNQ Q;  3SEB A;  1PHJ A;  4F87 A;  5CV9 A;  3I7F A;  2OTL A;  3J80 E;  1SYD A;  2E2I B;  2QEX A;  2QEJ C;  4DV3 Q;  3S17 B;  4DAY B;  4QL5 A;  2F0D A;  1VQC A;  4LFA Q;  5BN3 A;  5IIF A;  3U9S A;  1BR9 A;  2K5N A;  3U50 C;  1I4Q A;  1V43 A;  4ZYS A;  2EYM A;  1V1Q A;  3K8A A;  1HR0 Q;  3WOF A;  3DWQ A;  2N88 A;  1GHJ A;  5ISR A;  3ULL A;  3AU7 A;  4BBS B;  1I4H A;  1SNC A;  1N33 L;  3I4N H;  4EQO A;  4IJL A;  3NBI A;  1KDC A;  3GTQ B;  4A4I A;  2A5H A;  2EIF A;  3A8J E;  5GRO A;  3BDL A;  4E6I A;  4GLX A;  1X32 A;  1B3Q A;  1YNJ D;  2A6H D;  3FPP A;  3KLS A;  1GUS A;  4DR3 Q;  2UXD Q;  2L11 A;  1IYJ B;  3G6J B;  4YWL A;  2V1C C;  2HD3 A;  1TWF H;  1E24 A;  2Z6K C;  3CF5 A;  4DV5 L;  3NQT A;  5JOB A;  4ALP A;  1PH1 A;  4LW1 A;  4DAY A;  5C0X J;  3K81 C;  2OT2 A;  2DJG C;  4FXG C;  2D0P A;  2VUM G;  5M5Y H;  3I4L A;  4NW2 A;  1XWE A;  2ZT9 C;  2UXC Q;  3MC0 B;  4JW0 A;  1LTB D;  2IW3 A;  1E3P A;  4JCV E;  1CZG A;  1G6P A;  1F9Q A;  3I4O A;  1Y8O B;  3HS0 C;  1LO5 D;  2R7F A;  3J7A 5;  1MI2 A;  3OIQ A;  5DM7 3;  3AMU A;  2NYZ D;  4EQN A;  2CVR A;  1EU3 A;  5JVG 3;  1RTO A;  2UUA Q;  1YBY A;  5D3D A;  1JJ2 A;  4B9W A;  1IBM Q;  1IBL Q;  3JAM L;  2EY5 A;  1JJC B;  4Q0F A;  2F0T A;  5CGK A;  4GKK L;  2F0S A;  4QCL A;  5L37 A;  3PUV A;  1WTH A;  2A68 C;  4JI1 Q;  3SK8 A;  2C35 B;  5EKL A;  4LUZ A;  5A2Q L;  1QB5 D;  3M3Y B;  3D31 A;  2PCF B;  2ZJQ A;  4NDX A;  3ERS X;  1U4L A;  3CCJ A;  2AWO A;  1U4P A;  1MD2 D;  2JA5 B;  4K8J A;  1NMF A;  2VS1 A;  3RNU A;  4RHR A;  4DV0 L;  1MGS A;  4J1M A;  2R7Z G;  2RSO A;  2RDH A;  5EJW A;  3A7A B;  3GQB A;  4PV1 C;  3E0E A;  2QF7 A;  1O78 A;  4B08 A;  5E1F A;  4LUV A;  3S1N B;  1IHZ A;  3OW7 A;  4RH6 A;  4GN4 B;  3S1M H;  3R8B A;  1HZA A;  1SE4 A;  1IXR A;  5M5W B;  2ALY B;  2R7D A;  1LM0 A;  1ZKO A;  2ASB A;  4LF5 Q;  3GTG B;  1PH8 A;  1EIF A;  2RVL A;  1J5E L;  4UY8 C;  1F9P A;  4Z9C B;  2H1E A;  4JI3 Q;  3W1B A;  1YHB A;  1SYG A;  1ASZ A;  3PQI A;  2RSN A;  1K28 A;  2K5H A;  4K5W A;  5GAD C;  3LWU A;  3U58 A;  4YY3 L;  4P74 A;  2K5W A;  3ONA B;  4RGO S;  1JWM D;  5JVH 3;  5IGC A;  3NE5 B;  1STB A;  1PH3 A;  1XMQ Q;  5EBC A;  2P5Z X;  2L4N A;  1FD7 D;  4O2D A;  3M4Y A;  4GN5 A;  2A1A A;  2CW0 C;  1VQO A;  5KRU A;  4V19 0;  2KVM A;  1EY0 A;  2VQE L;  1EOV A;  4JVZ A;  2AQ2 B;  1SEB D;  1SN8 A;  5FO8 B;  4X65 L;  5K36 G;  1OXU A;  3HOU B;  1ZXT A;  2NN6 I;  4NXN Q;  1KD1 C;  3TP5 A;  1N34 Q;  4KI0 A;  3NTI A;  2YV5 A;  1ML0 D;  2Z1C A;  5FLX c;  4BBR B;  3D4D A;  1S4Z A;  3MXU A;  3HOX B;  2Y0S E;  3F8T A;  1TII D;  1J6Q A;  1KQS A;  4AH6 A;  1YEZ A;  3I8Z A;  4CJ2 C;  4LNQ A;  1ESR A;  1VMP A;  5IP9 H;  1EIH A;  5IGF A;  4HTH A;  2V4D A;  1IBL L;  2D5D A;  4B3T L;  2EY2 A;  1VQG A;  3TP6 A;  5M5Y B;  4DR2 Q;  2E5L Q;  3NPP A;  1KDA A;  1SMY C;  2PI2 E;  5KGU A;  1DZ1 A;  4KKS A;  5HY6 A;  1LTI D;  4B3T Q;  1RDP D;  1SFO B;  2F0L A;  3MHB A;  1SYC A;  2UU9 Q;  1YJ9 A;  1TWF B;  4FXD A;  1SMX A;  1W6K A;  2E76 C;  3NTH A;  2IHE A;  5LHY 1;  5IOD A;  4GNX B;  4BS9 A;  1VQ6 A;  4N8X 1;  4LAA A;  2PO4 A;  1TWC B;  4LF9 Q;  3QOL A;  4FF2 A;  4X66 L;  2YTV A;  2DJF C;  1STH A;  4LFC Q;  5LMN Q;  3KJP A;  1K3R A;  2ZJR A;  4DUY L;  5K5P A;  3UE1 A;  2G9D A;  4JC0 A;  4NXN L;  3JAM i;  3A5Z B;  3R2I A;  2NTT A;  2FMC A;  4BWG B;  4TKO B;  1S5C D;  3BYT B;  3A8I E;  4XTC S;  1RJT A;  2B2U C;  4DR3 L;  1WYD A;  4JI5 L;  1NY4 A;  2DN8 A;  1D5M C;  5LMN W;  1TS4 A;  1ICW A;  4R4I A;  1PH9 A;  2QCP X;  2CWP A;  2F3I A;  2J4X A;  3OWE B;  1QJO A;  3SHL A;  3S15 H;  4A93 B;  2B2T C;  1Y8N B;  2KOL A;  5LL6 X;  1LTT D;  3GTK B;  1H9R A;  1HA6 A;  5JPN C;  2F3W A;  1O7Y A;  2GVA A;  4A3F H;  3IAY A;  3FKI H;  1AFP A;  1A3V A;  1G51 A;  2K01 A;  1EZ8 A;  5FK9 C;  5IWA Q;  4BA1 I;  2K7V A;  4OWT B;  5LMU Q;  4HCE A;  1PTO C;  3S1R H;  4QGU A;  4DR6 L;  3VA5 A;  3GD7 A;  1HFN A;  2HDM A;  2WFW A;  3DLL A;  1X65 A;  2ZTC A;  1G6Z A;  2Z0S A;  2I0Q A;  3D4W A;  1PZJ D;  3J80 L;  1ILQ A;  1D8L A;  3FHW A;  2QDB A;  3VDY A;  5KYL A;  1IYU A;  2VNU D;  4OEM B;  3JAM E;  3JC6 6;  1GM5 A;  2QGQ A;  4CBV A;  2MO0 A;  1VQ5 A;  4NXM L;  1SBB B;  1Y1V H;  3I55 A;  4XT3 B;  3I2Z A;  5KYI A;  5IT9 c;  1YIT A;  1K83 B;  1VQJ A;  5T1I A;  2D62 A;  2B8G A;  1EEI D;  2JEA I;  4GKJ Q;  1EZ6 A;  2JA7 B;  1EY5 A;  2R93 B;  5FOB B;  4A3D H;  3HOY H;  2F0V A;  1CA5 A;  1WOC A;  3N6R A;  2K6A A;  4C3H H;  3CPW A;  1IBK Q;  1WD0 A;  1H9S A;  4DKA C;  2WB1 G;  4DV7 L;  1I4G A;  2K05 A;  5H1S E;  1CSQ A;  2MUY A;  4CGY B;  4GKK Q;  4NP5 A;  3CD6 A;  1XJV A;  2OXP A;  2ZXP A;  3H0G G;  5AJ3 L;  1MBY A;  4KY6 A;  2JA5 H;  3VA7 A;  1PZI D;  5C44 B;  3S2D H;  3PCO B;  2JA8 B;  1BKB A;  2R61 A;  2SOB A;  1HXY D;  3M4P A;  1BBU A;  2IJ0 A;  5C3X A;  1GJX A;  3S2H H;  3CQZ H;  4HMI A;  4IFD J;  3CP0 A;  3HKZ G;  1LTR D;  1CFM A;  4LF8 L;  1Q7Y C;  1SE8 A;  4J8Q A;  3BDO A;  4BY7 G;  1KXL A;  2B2V C;  2IWH A;  1EYD A;  4HIO A;  1CKO A;  4DK0 A;  2DNE A;  2PZT A;  2NVX B;  4DN4 M;  3L2P A;  2JE6 I;  3W1G A;  4RCO A;  3C1F A;  1D1K A;  3J80 i;  4DUZ Q;  4BY1 H;  4APV A;  5G3L D;  1RKN A;  1XMO Q;  1TT2 A;  1W6J A;  2X6G A;  3EJI A;  2RQX A;  1EQQ A;  1EQV A;  5CMD A;  2WAQ E;  4A3F G;  3L7Z C;  1PRT B;  2F4V Q;  1JIC A;  1SXT A;  1IW7 D;  2ZJP A;  3HOW G;  1PTO B;  2LSS A;  3TP8 A;  5J39 A;  2VXW A;  1IBK L;  3OOC A;  1FJG L;  2TMP A;  4G7Z C;  1FGB D;  4Q5V A;  1YIJ A;  1SJE D;  5JEA H;  3K7U C;  3H91 A;  1IZ6 A;  4A93 G;  3GV3 A;  1SYB A;  1TY0 A;  2JJQ A;  3ER0 A;  2OEO A;  3HOZ G;  4JV5 L;  1I50 B;  4TSS A;  2K5Q A;  1SMY D;  1VQF A;  2XRQ D;  2B2U A;  4WJ3 M;  3GP7 A;  4FDB A;  2L0C A;  4CDE C;  1D5X C;  2EE1 A;  5IGG A;  1VQD A;  3SGI A;  4HJ8 A;  1QZG A;  3DUZ A;  3K5N A;  1VCI A;  2AQ1 B;  1JC7 A;  1K8A C;  1KAW A;  4R4Q A;  3KBX A;  1VQH A;  3PO2 G;  5EBD A;  1RIP A;  4GKJ L;  2WV6 D;  1HZC A;  4O0A A;  3Q6S A;  4JOI C;  2WB1 B;  1LTG D;  4J6H A;  3R2T A;  4ZQ3 A;  5KIX A;  4C3I B;  4JG2 A;  2Z6K A;  2HCI A;  4ODG A;  4DR5 Q;  2B8F A;  4ZAI A;  1B44 D;  3GTL H;  2R3Z A;  4PZ8 A;  2Z6B A;  4B3M Q;  3NWS A;  3OIP A;  4JI5 Q;  5AFW A;  3S17 H;  4UP9 A;  3E6Z X;  5ELC A;  2WAC A;  1KAA A;  1Y1V G;  2KA7 A;  1SRO A;  1Q90 A;  4ZLT F;  3CC7 A;  4B3R Q;  1PVO A;  4UP7 A;  2CFM A;  3PO3 G;  4KHP Q;  4UAI A;  3P75 A;  3HZX A;  3HKZ B;  4LUO A;  4QUC A;  3I56 A;  1HR0 L;  2CCZ A;  2LMC B;  1QWY A;  1TWC H;  1L1O A;  2Z9H A;  2F0E A;  4RCN A;  5C0X G;  2E2D C;  4A3B B;  3CCM A;  3I4M B;  2H4O A;  4F88 A;  5K36 H;  1O7L A;  5C3E H;  2F0N A;  1BUV T;  4DUY Q;  2EY1 A;  1CM9 A;  1UAP A;  4K8I A;  1F9S A;  1TWG B;  1PH6 A;  1PTO F;  2MFI A;  4X66 Q;  2JA8 G;  2NUC A;  1JOK A;  2F0P A;  1DYQ A;  1TWG H;  2JA9 A;  1HCZ A;  3EBE A;  4JI2 L;  2K5V A;  3P20 A;  1P16 A;  3AEV A;  3HRZ C;  4JI4 Q;  4LFB L;  2Q2H A;  1G91 A;  2JA6 G;  2F0U A;  4NKL A;  2Z4I A;  4BY7 B;  2SNM A;  2VZA A;  1NCV A;  2KCM A;  4UHV A;  3VR2 A;  2R92 B;  1KL9 A;  3HOZ B;  1PTO D;  3PF4 A;  4DK6 C;  3Q24 A;  4GS3 A;  3X3M A;  2O4X A;  3L3O C;  3SXH A;  3HOV B;  4XQQ A;  3NBH B;  3M3Y H;  1X3G A;  1TS5 A;  1LT5 D;  5CV5 A;  5ELO A;  5C4J B;  3M4O H;  3K80 C;  3ND9 A;  2F0M A;  4EGV A;  1QUQ B;  4ZKC B;  1IKM A;  1CQV A;  2HUG A;  3K57 A;  3C2P A;  2K03 A;  1KNE A;  3MXP A;  4V0B A;  1HNX L;  2EOT A;  1SNM A;  4R4O A;  4PMC A;  1B2T A;  4ZCK A;  1SNO A;  5M5X H;  2F0Q A;  2A69 C;  4DXF A;  3BVZ A;  1G29 1;  3CU7 A;  3HGB A;  3MXN A;  5C4H A;  2PNH A;  1O80 A;  4LK1 C;  1I4R A;  3A8K E;  3MTS A;  3GTQ H;  1AN8 A;  1LUZ A;  2JN4 A;  5DNF A;  3HOW B;  1WTV A;  2KEE A;  2MPM A;  4OX9 Q;  4ZKB B;  3WDN A;  4KN4 C;  2YU9 B;  4CJ0 B;  3K7A B;  2Y0S G;  1NMG A;  3FMC A;  5ELF A;  3HG9 A;  2HCC A;  3WOE A;  1AE2 A;  4JYA Q;  4RG1 A;  3ULP A;  2KHI A;  1EWC A;  3CXC A;  5J3B A;  1L1O B;  1PTO H;  5C0X I;  1HTL D;  4QJF A;  2DNC A;  4OO1 G;  3S16 H;  3GO5 A;  1K83 H;  3PIP 3;  1DCZ A;  2EYL A;  1XPO A;  3ZYY X;  1AP0 A;  2DGY A;  3SE0 A;  1ENC A;  4ZRZ A;  1A62 A;  3EIV A;  4CHT B;  1LT4 D;  1U4R A;  2ZTD A;  4BXX G;  4BY1 B;  5LMU L;  1Q86 C;  2AMC B;  1UE6 A;  1ZYR C;  3GTK H;  2J0T D;  3PO3 B;  3D6C A;  3EA6 A;  3ULJ A;  2KJX A;  3OYY A;  4LF6 L;  5CBE E;  3QWN A;  4GZY C;  1SDF A;  4ILW A;  4JI8 Q;  4KTA A;  3K7A H;  5BR8 Q;  1VF5 C;  1V9P A;  5E3F A;  3KDF A;  4HN7 A;  1SJH D;  2PW7 A;  2XGT A;  1HQM C;  4AQY Q;  4IUT A;  1WTO A;  4DAV A;  2I5L X;  1V8Q A;  1I6V C;  2JP1 A;  3W2D A;  3KF8 A;  4MHE A;  4C1N K;  4IFD H;  1WCM B;  4OHJ A;  3M4Q A;  3IL8 A;  1IL8 A;  1HHV A;  3BG3 A;  4OO1 H;  2D2C C;  3VR3 A;  4JI6 Q;  1UEA B;  4S3S A;  1HH2 P;  1KIX A;  2R92 H;  4JI2 Q;  3HOU G;  3PIP A;  1NNX A;  4K0K Q;  3SK5 A;  1Q8K A;  4KD3 A;  3U9O A;  1FNU A;  3MA2 B;  4UP8 A;  5NUC A;  1B7Y B;  5IYB H;  1ZYR D;  3E9H A;  4JI7 L;  2BH2 A;  1FGU A;  3PO3 H;  1NAP A;  4KY5 A;  5AJ3 Q;  3VYT A;  2ZM6 Q;  3HP3 A;  3S1Q B;  3S2H B;  4PZ6 A;  3LX0 A;  1PZK D;  1KAB A;  2BE5 C;  4EVO A;  3CCQ A;  4DV2 L;  2ID0 A;  3AFQ A;  3RZO H;  3S16 B;  2E5L L;  2B2T A;  1PMR A;  1VQB A;  2R93 G;  2EJM A;  4P2C B;  3QO2 A;  4KJN A;  4TRD A;  4XYQ A;  2KED A;  1C9O A;  2KBN A;  5IGE A;  2VW9 A;  1CUK A;  4DV4 L;  4DGZ A;  4B3M L;  3AFP A;  2Q2I A;  2G9H D;  1X6O A;  1STN A;  4HJA A;  1PRT D;  2NZH A;  3G7L A;  2VUM B;  1TVX A;  4OGQ C;  4A3I B;  2AWN A;  4IUV A;  3HOV G;  5HUR A;  4RFB A;  1N34 L;  3GTM H;  3UE0 A;  3QR8 A;  4KHP L;  2LY7 A;  3AQQ A;  1J9O A;  1FNV A;  2HDL A;  1RF2 D;  5IP7 H;  1CHP D;  4TQU S;  1II3 A;  2BA1 A;  3GV6 A;  2UXB L;  4DR6 Q;  3Q22 A;  1UNS A;  5EKK A;  1SLJ A;  2K32 A;  4GOP B;  3BZC A;  4A3M B;  2EYF A;  1X3E A;  1IW7 C;  4XDX A;  1HRJ A;  2D0O A;  3GTO B;  1C7Y A;  1I94 Q;  1A2T A;  4NMZ A;  3U4V A;  1VQL A;  4QB4 A;  5I6Y A;  5C44 G;  2EY6 A;  3FVQ A;  1RTN A;  3H3V H;  1LLR D;  2KCC A;  1TR5 A;  4XQJ A;  1HNW Q;  5C3W A;  5M5X B;  1I3Q H;  5LL6 S;  5C4X H;  5C0X H;  1PRT F;  1F2Z A;  2MGS A;  3DEO A;  1TWA H;  1OXX K;  2VB3 X;  4JK1 C;  4U68 A;  1XMO L;  1AW7 A;  2Q2U A;  1KNA A;  4IUN A;  3OTO Q;  4GN3 B;  5EPL A;  2A6E D;  3HKS A;  3A55 A;  4YCV A;  1VQM A;  2TSS A;  4HMJ A;  4PG3 A;  1GUW A;  2EYH A;  1IYV A;  1QIL A;  1X55 A;  2M00 A;  4K0K L;  3CW2 C;  2K28 A;  2VUM H;  2Z8L A;  2RBM A;  1KLG D;  1WJJ A;  4NB3 A;  3PF5 A;  1UE5 A;  1GUT A;  1S5D D;  4KY7 A;  2X69 A;  2NWG A;  4J15 A;  3PIO A;  2Q8T A;  1DOM A;  1VQ4 A;  4A3B H;  2B2W A;  5I4D A;  4DR2 L;  2WII B;  1Q12 A;  1Q1B A;  2A19 A;  1B8A A;  2I07 B;  3D0F A;  3NUC A;  2ICE C;  4RKB A;  2C9O A;  1STE A;  3PUZ A;  1S3O A;  2JYO A;  4A3D G;  1BVS A;  1YNX A;  1Y1W B;  2E74 C;  2OCE A;  3CC4 A;  4GNX A;  2PPB C;  5EAY A;  5CC4 A;  4A3K B;  2PI2 A;  3CRL C;  2EPB A;  4KHZ A;  4R4T A;  2Q2T A;  3Q0A A;  3C1E A;  2XWJ B;  4IPH A;  4DNI A;  4LF6 Q;  2EYO A;  4LF7 L;  2B2V A;  2A6E C;  2EVB A;  2F0G A;  4L6T B;  3K5L A;  3CC2 A;  3R3O A;  1IKL A;  3TZU A;  2GN5 A;  2BA0 A;  3T4A C;  2E75 C;  4OO1 I;  5D14 A;  1PV4 A;  4DR1 L;  2QIL A;  1XXG A;  2XN9 C;  2R7Z B;  3LWE A;  1EYA A;  4K2K A;  1JE4 A;  1PH2 A;  2NN6 H;  3CKI B;  3F2D A;  4A3E G;  5J22 A;  1E2Z A;  1A2U A;  1RL2 A;  4PQX A;  3RUZ A;  4C3I G;  2K4K A;  2F0F A;  4JBW A;  2E2H H;  3GTP B;  1YVC A;  4JI0 Q;  1NBW A;  5IT9 L;  3KOJ A;  4FVM A;  3NTK A;  5DAU A;  3UDF A;  3A54 A;  4A3I G;  1AEX A;  1BCP B;  4IAL A;  5ELE A;  1EFW A;  2N55 A;  1ILP A;  4QMG A;  4HIK A;  4OX9 L;  3GTL B;  1Y1V B;  4DV7 Q;  2MHV A;  5IE8 A;  1MSG A;  4DNR B;  1B53 A;  1HFG A;  2F0K A;  2B2W C;  4XIG S;  3A74 A;  3V2T A;  4AIM A;  5HGT A;  1H9J A;  3S1M B;  4RGT A;  4P75 A;  2JA6 B;  4LF5 L;  1FYC A;  1EWH A;  1NTG A;  3LGJ A;  4P71 A;  3VYR A;  5FLX E;  2VL6 A;  4CKB A;  2EXD A;  2L55 A;  3S9W A;  2B63 H;  3U4Z A;  2JA6 H;  1GO3 E;  3KLS X;  3NBH A;  1XPU A;  1B4O A;  3OW2 A;  3VYU A;  4C2M H;  1WTP A;  3UDI A;  2OWO A;  5D65 A;  1QNK A;  2HHH L;  1HNZ Q;  1D1I A;  3GTJ B;  1CQF A;  3S1Q H;  1EY4 A;  3GTP H;  2F0I A;  5IWA L;  1JE5 A;  3KDF B;  4K6L A;  3T56 B;  4DV0 Q;  3G48 A;  3SK6 A;  1JJG A;  5IYB G;  2K33 A;  1K8O A;  2IY5 B;  4OWW B;  1F77 A;  1WVL A;  4A3E H;  2IL8 A;  2HIX A;  3IFD A;  1X54 A;  4A3M G;  1Y8P B;  1VQA A;  2MQH A;  5E7N A;  1A63 A;  1UE1 A;  3MXN B;  4K5V A;  2L5T A;  1EIG A;  3P7J A;  1E1T A;  4IUU A;  3DXJ C;  3QG1 A;  4WOR A;  3KUP A;  4I7A A;  4DA2 A;  4DV4 Q;  2SNS A;  1GHK A;  2OQ0 A;  5M3F G;  4OXP A;  4IUP A;  1CI3 M;  2CWA A;  3HEJ A;  2J7Z A;  5IY0 A;  3H3V I;  2FIN B;  3RZD B;  1PA6 A;  1B70 B;  1Z6H A;  3DHQ A;  5M3M H;  1WTW A;  4M1U B;  1EQR A;  4A3E B;  1QE6 A;  4FNF A;  3FPU B;  3JAM c;  3OPO A;  2BCO A;  4C3H B;  3K0X A;  2RDG A;  3PO2 H;  3RR5 A;  4JI7 Q;  3RMH A;  1XPR A;  3TZD A;  2UU9 L;  2K50 A;  3J81 i;  4A3L H;  4CKC A;  1MJC A;  2Q8R E;  1DM0 B;  4M8A A;  1QZH A;  4HJ7 A;  4IUQ A;  5I9P A;  4LF9 L;  4A3L G;  3H0G H;  4DV5 Q;  2IPK D;  1K8G A;  3FP9 A;  4X65 Q;  1QCB D;  1EU4 A;  1N32 Q;  2RF4 A;  1OXT A;  3F2B A;  1ENF A;  1ENA A;  1MSH A;  3MVV A;  3E3X A;  1GXD C;  1PYW D;  4OWX B;  3K58 A;  3TRE A;  2GA4 B;  5DLQ E;  1EUJ A;  1WD1 A;  1R9T B;  3FDT A;  4IUR A;  3OWF A;  4A3D B;  3RZD H;  1M8A A;  4ULL A;  2O5J C;  1K9M C;  2F0O A;  4DAM A;  5BR8 L;  2E2J H;  4JI8 L;  2G5D A;  1BF4 A;  1PH5 A;  1NJI C;  1K0R A;  3C46 A;  1UWV A;  3M85 A;  2EXZ A;  3ERO A;  3UDG A;  1F2Y A;  1I5F A;  4RGM A;  2HQL A;  3OHX C;  3H3V C;  1XTD A;  4YCW A;  2X6L A;  3CAM A;  4L63 B;  3S15 B;  1NE3 A;  4RWS C;  1STA A;  3J81 E;  4IOC A;  2NN6 G;  2MJ8 A;  2XNA C;  1JOR A;  5IYC H;  2DY8 A;  1C48 A;  3T53 B;  3K59 A;  2K52 A;  5FO7 B;  5COR A;  3S1R B;  4AYB G;  2F4I A;  5IYD G;  2NVQ H;  3FKI G;  2YTY A;  1SRU A;  1VQN A;  4JOI A;  3GTO H;  2A68 D;  1WCM G;  1OXS C;  2JA5 G;  3ZJY C;  2KHS A;  3A7L A;  2F4V L;  4F8M A;  3NHH A;  1Y69 U;  1XX8 A;  4PMW A;  3BDC A;  1EOT A;  4HED A;  4R8N A;  1JOO A;  1TWH H;  4R4C A;  5ELB A;  4ZUJ A;  2RCF A;  1RHP A;  1PFN A;  4A75 A;  2NBF A;  3G6E A;  1YHA A;  2EJG C;  5BN5 A;  3HOY G;  2UUA L;  4YWM A;  2NVT B;  4CDF C;  3M7G A;  1PH7 A;  1E7Z A;  1A15 A;  2PZU A;  2B3G A;  4DV1 Q;  4HJ9 A;  3ICE A;  2VQF L;  2EYP A;  2PZW A;  5C3E G;  3B6Y A;  4F7X A;  1ZEQ X;  5FLM G;  4MN3 A;  1PDQ A;  1L0X B;  1CTM A;  1EFI D;  2IHF A;  1P8L A;  1STY A;  2JEB I;  4WJ4 A;  2FMM A;  4YCU A;  2A6H C;  2YTX A;  1IBM L;  4JBM A;  1EYC A;  1VQK A;  4A3J H;  2B2Y C;  3L0O A;  4IOA A;  1TU2 B;  4GOP A;  1WTX A;  4H02 A;  3OTO L;  4IFD G;  1HZ9 A;  3LNN A;  1KRS A;  2EQS A;  5CBA E;  1HUM A;  5C5L A;  5C5M A;  2N78 A;  3KLR A;  3J7A V;  4HR7 B;  4H0L C;  3D8G A;  4IN3 A;  4HSP A;  1LYL A;  5E4W C;  2NZO A;  1WI5 A;  1W2B A;  3PIO 3;  1GKH A;  4HJ5 A;  1ASY A;  3STB C;  1YI2 A;  3CPF A;  4MIU A;  1CA6 A;  3CMA A;  1EYG A;  3T1Y Q;  1D2B A;  2PYK A;  1K73 C;  1SR3 A;  4JPB W;  1JMC A;  4ABN A;  1MKH A;  5M5W H;  1I6H B;  3PUW A;  2UXB Q;  3TQY A;  4FO2 A;  2LFN A;  4K6D A;  1I50 H;  4GLA C;  1OXV A;  3CCU A;  4ID6 A;  4GLV B;  2E2H B;  2O2L D;  1TWH B;  2PNR C;  2I46 A;  4P72 A;  4PNY A;  1JT8 A;  1I94 L;  3HOX G;  4DV3 L;  4A3G H;  4C3J G;  3KF6 A;  3FRP B;  1QVC A;  2UUC Q;  3G71 A;  1A6X A;  4JBJ A;  1SNP A;  3FKI B;  1NR4 A;  3F1Z A;  2E2J B;  2IX3 A;  4KN7 C;  1YNN C;  1XNQ L;  5IYD H;  1JCK B;  3I90 A;  1ONL A;  5C4Z A;  4X62 L;  1Q46 A;  2NZ1 D;  1DOK A;  1HUN A;  1OO9 B;  3RLO A;  2RHS B;  1OTC A;  4KKT A;  3C3L A;  2R7Z H;  4RMF A;  3I91 A;  3AYH B;  1ROD A;  2IT1 A;  3TN2 A;  1LAB A;  1HA5 A;  4IPG A;  3D3R A;  5LMN L;  3T1Y L;  3ND8 A;  1R4P B;  4GOP C;  4JV5 Q;  1EIY B;  1E2W A;  3BVM A;  2ATW A;  4RGN A;  4EQ5 A;  3RN5 A;  5CV4 A;  2AUK A;  4HID A;  2K1B A;  1Y14 B;  3S14 H;  1FL0 A;  2UUB Q;  1B3A A;  3V05 A;  4Y7N H;  1JR0 D;  1WFQ A;  4I7Z C;  3KFU A;  1TS3 A;  4XQN A;  3I4N G;  4MTN A;  2IX1 A;  3BJU A;  2KCN A;  5CV8 A;  4A3J B;  1AZP A;  1TKW B;  1Y1W H;  3UI2 A;  3T51 B;  3IKJ A;  4BA2 I;  3RN2 A;  3KBG A;  5CR3 A;  3TRZ A;  4X64 L;  2ZM6 L;  1YHQ A;  1N36 L;  2PW5 A;  1BQQ T;  4R8I A;  3J7A F;  1F9R A;  1LT6 D;  3K6O A;  1KDB A;  1E2V A;  1F2M A;  1YNJ C;  3T1H L;  1H9K A;  1Q8I A;  1A8V A;  2JA8 H;  4XYO A;  3S14 B;  4L5Q A;  2NVT H;  2XVS A;  2VQE Q;  3J81 j;  4H44 C;  1S40 A;  1NSN S;  2CQO A;  2IX0 A;  2B2Y A;  3I4M H;  3TEH B;  2ZXO A;  1EY8 A;  3GDE A;  1XMQ L;  4H13 C;  1KRT A;  3HOU H;  1K0S A;  2MNA A;  4LF4 Q;  1Q1E A;  2EZV A;  4I65 A;  3UDX A;  1VQP A;  4WFN 3;  1JB3 A;  3CQZ B;  1AE3 A;  1BBX C;  4JYA L;  4XT1 B;  3J7Y W;  4A3F B;  3DM1 A;  1YJW A;  2ZTE A;  3KF8 B;  4CDD C;  2A74 C;  4XXE A;  2F3V A;  4R9W A;  2GVB A;  4DAP A;  5EQ0 A;  1HTP A;  4MZ9 A;  3CCE A;  1XNR L;  3M9B A;  4U67 3;  3NEN A;  1VQ7 A;  1W3S A;  2PMZ B;  2F0W A;  4OON A;  1H9S B;  5IOC A;  3E5S A;  3NSW A;  4BXX H;  4JI0 L;  3PUX A;  3M4O B;  1I6H H;  1S5E D;  2CQA A;  5I2Y A;  3DWA A;  3CME A;  2WKC A;  3A0J A;  4H7B A;  4UDU C;  3W5O A;  1Z7T A;  1EY7 A;  1VQI A;  2KUM A;  2EYJ A;  4QUF A;  4FP5 D;  4DR1 Q;  2AQ3 B;  3T16 A;  3TME A;  4JI3 L;  3HOZ H;  1GOZ A;  1T9H A;  2PMZ E;  4K14 A;  3I70 A;  2CKZ B;  2QKI C;  4DU9 A;  5FJ8 H;  1R9T H;  3CCR A;  1GUO A;  3MEF A;  3SVM A;  1Z47 A;  1T5E A;  3NEM A;  4O1N A;  3VR6 A;  4O42 A;  5M9O A;  3ERQ A;  2LXK A;  2AKW B;  4N9P A;  5KNB A;  4X64 Q;  3H0G B;  3CCL A;  3SK4 A;  3S24 A;  3QB3 A;  4N9T A;  1AZQ A;  4FF4 A;  4RKL A;  2OQK A;  5FO9 B;  1U0L A;  4KKU A;  4DR4 L;  1QVF A;  1DOL A;  4L5S A;  3VR5 A;  3SDZ A;  3PO2 B;  4A3J G;  1L0Y B;  2UUB L;  2OTJ A;  3HOX H;  3G4S A;  1RCV D;  2UXC L;  2XWB B;  1LT3 D;  2E8G A;  1D6E C;  1SE3 A;  1EEF D;  2HT1 A;  2N3S A;  3E0J A;  5C4X B;  1S5B D;  1C0A A;  4KD4 A;  2KEN A;  3DM3 A;  1PH4 A;  1XTC D;  3IFT A;  2R92 G;  1X3P A;  4NPS A;  3NEL A;  3KJO A;  2PQE A;  4Y52 H;  4MTK A;  1ET9 A;  4K2L A;  3IRB A;  4ZK9 B;  3GTJ H;  2CHB D;  4X62 Q;  2MP1 A;  2K5D A;  3KK7 A;  1SYF A;  1CKN B;  1EQT A;  5GQO A;  3DMU A;  1B50 A;  1T5X D;  4A3G B;  3CCV A;  4BBR H;  4POF A;  1TWA B;  3M7N A;  2H5X A;  1BCP F;  2ZXR A;  4C3H G;  3D4R A;  2O5I C;  1L1O C;  2CW0 D;  1I3Q B;  2NVY B;  2SDF A;  2JK8 A;  1PFB A;  3NQI A;  3K5O A;  3I72 A;  4OEL B;  1U9R A;  5IT9 E;  1J8I A;  1GUG A;  4DFA A;  4EQP A;  2B39 A;  1BNZ A;  4LWC A;  1DJR D;  4LJZ C;  4FXK C;  4C2M B;  4R1J A;  4B3S Q;  1V1P B;  2FJ2 A;  2ES2 A;  3HFZ B;  1AH9 A;  2OF1 A;  1PFS A;  1C4Q A;  2VY3 A;  3WWV A;  5BN4 A;  3TP7 A;  4HCS A;  5A35 A;  1S5F D;  3MAQ A;  5JEA G;  4BBS H;  5ELD A;  1B1Z A;  4X3K A;  4DR5 L;  4X3U A;  1QNU A;  4C56 C;  2JQO A;  1B9M A;  1BCP C;  4A3C H;  5I9O A;  2Z4H A;  1Z9F A;  5A2Q E;  1X3F A;  1N33 Q;  1XNR Q;  1F2L A;  4IQZ A;  1KLU D;  4YIJ A;  4IFD I;  2C5C A;  1KTK A;  4DK1 A;  3DWP A;  4BY1 G;  2JA7 G;  2L15 A;  1UUP A;  4A3C G;  3TS2 A;  4RA8 A;  1EY9 A;  4DR7 Q;  2BE5 D;  5DEH A;  1S72 A;  3H15 A;  1H95 A;  1SNQ A;  2N49 A;  4OL7 A;  4BBS G;  1MHW C;  4BY7 H;  1Q82 C;  5IP7 G;  4LF4 L;  2D9U A;  1QG7 A;  3BZK A;  3URY A;  1JQY D;  4WJW A;  3MXG A;  1WTR A;  4KHV A;  2RKS A;  1WCM H;  1N9W A;  3I3C A;  4C1N I;  2MO1 A;  1GD7 A;  3DEP A;  3Q23 A;  1Q81 C;  4KK7 A;  4A3K G;  4KMU C;  1FJG Q;  4A76 A;  4X6A H;  5EGT A;  1TS2 A;  3W3A A;  5FKA C;  3KYH C;  4CKE A;  4CDC C;  1LAC A;  3QJY A;  2E2I H;  1BOS A;  4A93 H;  4RAU C;  1X9N A;  4HSV A;  5IYC G;  2NTS A;  2XTI A;  2QW7 A;  3S1N H;  1N8R C;  4X3S A;  2BDN A;  1QUQ A;  4DUZ L;  1G2S A;  2KHJ A;  2AUJ D;  2WKD A;  2F0J A;  2RHQ B;  4JI1 L;  3NP8 A;  1LTA D;  2R93 H;  2JA7 H;  1LV9 A;  3RZO B;  2NB0 A;  2WP8 J;  2CH4 A;  2EJF C;  5I2X A;  3VYS A;  5C6A A;  4CJ1 B;  4GNX C;  4LF8 Q;  5I6W A;  4KLK A;  5M3F B;  5IP9 G;  2HIV A;  5JJL A;  1DD2 A;  1Q3L A;  3TSS A;  4C3J H;  1G2T A;  3BVG A;  3TBI B;  3X3N A;  5EPK A;  3EN2 A;  1SYE A;  3Q8D A;  5ELN A;  1BXT A;  1KHI A;  4QQB X;  4KJO A;  1LTS D;  2ENB A;  4G7H C;  2QDL A;  2QA4 A;  4NXM Q;  4FF3 A;  2L9H A;  4QF4 A;  3F2C A;  1VQE A;  1YZ6 A;  1NR2 A;  1DON A;  2B29 A;  3BU2 A;  3NWT A;  4YHH Q;  2NVQ B;  4MNO A;  5D3I B;  3BZD B;  4B3S L;  1DXM A;  4DR7 L;  3H94 A;  1HNW L;  2B63 B;  1DGS A;  2N8N A;  1PLF A;  3E9I A;  4FYD A;  4K5X A;  2FFK B;  2BOS A;  3CRK C;  2WIN B;  4DF7 A;  4BBR G;  5FJ8 G;  3J81 L;  5KNC A;  2R6G A;  2YU9 H;  1CKM A;  3BYY B;  4ME3 A;  1U5K A;  4QY7 A;  1HPC A;  2JSO A;  4DK3 C;  1HZB A;  2BH8 A;  2SEB D;  3MFY A;  1V1P A;  4WRD A;  2F52 A;  3GTG H;  1UE7 A;  3NXW A;  1JB7 A;  1D5Z C;  4P73 A;  5DM6 3;  1VDZ A;  1SAP A;  3OMG A;  4DXG A;  1VS0 A;  1VQ9 A;  2LKV A;  4AYB E;  3I4N B;  2A69 D;  3A56 A;  4FF1 A;  1M90 C;  1ICF B;  3OMC A;  5IGB A;  3OSO A;  3NK9 A;  2NVX H;  3J80 c;  4LFA L;  1U4M A;  1O7Z A;  1I4X A;  5FLM H;  2HQE A;  3T13 A;  5JPM C;  3HOW H;  2CH4 W;  1L2F A;  1B9N A;  4UPA A;  1FR3 A;  5GAG C;  2DY7 A;  4HIM A;  3TDQ A;  1WTQ A;  1ET6 A;  3V96 A;  1N36 Q;  2I5H A;  2M2L A;  2EDG A;  3MFG A;  1I4P A;  4RHS A;  4JI4 L;  4LFB Q;  4DR4 Q;  4IPD A;  1N32 L;  4ME5 A;  3QOJ A;  2L12 A;  3PV0 A;  3J81 c;  3L9A X;  1KC8 C;  3K0Y A;  5CYU A;  4IJH A;  3H6M A;  4TVA B;  4DV6 L;  5EPJ A;  4DV2 Q;  4AQY L;  3EVQ A;  4LFC L;  1YJN A;  1YNN D;  4G7O C;  1XYI A;  3I4M G;  3ITP A;  1O7I A;  1D7Q A;  1TXY A;  2KCT A;  4AYB B;  5CV6 A;  3HOY B;  2RDF A;  1SND A;  1BDO A;  4IPC A;  2I5M X;  3N52 A;  4Y7N B;  4KV6 A;  1K8M A;  2KQ3 A;  2LS0 1;  2FHT A;  4IO9 A;  4B9X A;  4DV6 Q;  1RD9 D;  3K5M A;  2BDO A;  1CZW A;  4DPG A;  2XRS D;  3PSI A;  4POG A;  3BS1 A;  5T1G A;  1V1O A;  5C3E B;  4G4K A;  3RLF A;  2F0H A;  1EY6 A;  4B3R L;  4C3I H;  1PYS B;  4ZUI A;  4JI6 L;  5KEE A;  2Q8I B;  1VMC A;  5TSS A;  5M3M G;  1SFO H;  1CHQ D;  4PZ7 A;  3I73 A;  1L0W A;  3CCS A;  1HNZ L;  2HHH Q;  1MIU A;  3MZ5 A;  4YY3 Q;  1Y1W G;  5HGQ A;  1QVG A;  4IZ8 A;  3D6W A;  2UUC L;  1JWU D;  2ICI A;  1C8C A;  1A3U A;  2WAQ G;  1X3Q A;  1E0B A;  1GVP A;  1FNW A;  4N8F A;  2LXJ A; 
#chains in the Genus database with same CATH homology
 3KLW A;  1WJJ A;  4NB3 A;  3PF5 A;  1UE5 A;  2VQE Q;  1J5E Q;  5JJI A;  4A3D H;  3J81 j;  4J15 A;  1MJE A;  3HOY H;  3PIO A;  1WOC A;  1S40 A;  4C3H H;  2CQO A;  2IX0 A;  3CPW A;  4A3M H;  1IBK Q;  1VQ4 A;  3I4M H;  4A3B H;  3TEH B;  3GDE A;  1XMQ L;  4DKA C;  4DR2 L;  2WB1 G;  1Q12 A;  1Q1B A;  2A19 A;  1B8A A;  3D0F A;  1KRT A;  5H1S E;  4DV7 L;  3HOU H;  4A3B G;  4JBK A;  2MNA A;  1CSQ A;  4QIW E;  4GKK Q;  3CD6 A;  4LF4 Q;  3PUZ A;  1S3O A;  1Q1E A;  1XJV A;  2A8V A;  3UDX A;  4A3D G;  1BVS A;  1YNX A;  1VQP A;  3HKZ E;  3A5U A;  2OCE A;  1HNX Q;  3PUY A;  4GNX A;  3CC4 A;  3H0G G;  5EAY A;  5AJ3 L;  2JA5 H;  2PI2 A;  1AE3 A;  1E1O A;  4KHZ A;  1A0I A;  4R4T A;  2Q2T A;  3PCO B;  3S2D H;  1BKB A;  1BBW A;  5C4J H;  4JYA L;  4IPH A;  3M4P A;  4DNI A;  1BBU A;  4LF6 Q;  4LF7 L;  3S2H H;  3CQZ H;  3PGZ A;  4A3K H;  3CC2 A;  1YJW A;  3HOV H;  2GN5 A;  1HJP A;  2BA0 A;  2NVY H;  2ZTE A;  3KF8 B;  1HR0 W;  3CP0 A;  4L5T A;  4IFD J;  4OO1 I;  3HKZ G;  1PV4 A;  2GVB A;  2B63 G;  4DR1 L;  4MZ9 A;  3CCE A;  1XNR L;  4LF8 L;  2YYZ A;  4A3G G;  3M9B A;  1Q7Y C;  1SE8 A;  2PQA B;  3NEN A;  1PH2 A;  1W3S A;  1VQ7 A;  4YHH L;  2DUD A;  4A3E G;  3KF6 B;  3F2D A;  4OON A;  4BY7 G;  1KXL A;  1CKN A;  2WB1 E;  4LF7 Q;  1RL2 A;  4HIO A;  5C4X G;  5JJK A;  2K4K A;  1CKO A;  4JBW A;  2E2H H;  1YVC A;  3L2P A;  4JI0 Q;  4JI0 L;  4BXX H;  2JE6 I;  3PUX A;  3W1G A;  1NBW A;  5GAH C;  3KOJ A;  5M3F H;  1I6H H;  3J80 i;  3UDF A;  4DUZ Q;  4A3I G;  4BY1 H;  2RCN A;  3CME A;  1EWI A;  4APV A;  1EFW A;  1XMO Q;  5C44 H;  2K14 A;  3A0J A;  1EQQ A;  4HIK A;  3W5O A;  4A3I H;  1VQI A;  1UEB A;  2WAQ E;  4DV7 Q;  3L7Z C;  4A3F G;  5IE8 A;  4OX9 L;  2F4V Q;  2JEA I;  3J7Z C;  1M1K C;  5JEA J;  4DR1 Q;  1PYB A;  4JI3 L;  1FVI A;  3HOZ H;  2ZJP A;  4XIG S;  4AIM A;  3HOW G;  2LSS A;  3A74 A;  1IBK L;  1VQ8 A;  1X56 A;  3T1H Q;  1T9H A;  2PMZ E;  4P75 A;  3STB D;  5GAE C;  1FJG L;  2VQF Q;  4LF5 L;  4YWK A;  2AHO B;  4DV1 L;  2CKZ B;  1NTG A;  1YIJ A;  5FJ8 H;  1R9T H;  3LGJ A;  3K7U C;  4P71 A;  3MEF A;  3CCR A;  1IZ6 A;  2VL6 A;  4A93 G;  1Z47 A;  1E22 A;  2EXD A;  2B63 H;  3NEM A;  2PQA A;  3RLN A;  3U4Z A;  1GO3 E;  2JJQ A;  3ER0 A;  2JA6 H;  2LXK A;  2AKW B;  4X64 Q;  1XPU A;  3HOZ G;  4JV5 L;  3CCL A;  1VQF A;  1CSP A;  4L5R C;  3S24 A;  3OW2 A;  1IL2 A;  4WJ3 M;  4FDB A;  4C2M H;  3UDI A;  2OWO A;  2HHH L;  1HNZ Q;  1VQD A;  3SGI A;  4HJ8 A;  1QZG A;  2OQK A;  1U0L A;  1VCI A;  2FXQ A;  1LTL A;  4DR4 L;  1QVF A;  3S1Q H;  1K8A C;  1KAW A;  4R4Q A;  5IWA L;  3GTP H;  4EX5 A;  2K75 A;  1JE5 A;  1VQH A;  3KDF B;  4L5S A;  4DV0 Q;  3G48 A;  2UXD L;  1JJG A;  3TS0 A;  4A3J G;  2UUB L;  5IYB G;  1XNQ Q;  3PO2 G;  2OTJ A;  3HOX H;  1RIP A;  4GKJ L;  1PHJ A;  3G4S A;  2IY5 B;  1HZC A;  4O0A A;  4OWW B;  2UXC L;  4JOI C;  4A3E H;  2HIX A;  2E8G A;  3I7F A;  2OTL A;  1X54 A;  2HT1 A;  2N3S A;  4A3M G;  1VQA A;  4JG2 A;  2MQH A;  1C0A A;  5E7N A;  2Z6K A;  2QEX A;  2KEN A;  3DM3 A;  1A63 A;  1UE1 A;  3MXN B;  4DR5 Q;  1PH4 A;  2R92 G;  4DV3 Q;  4NPS A;  4DAY B;  1E1T A;  4QL5 A;  3NEL A;  3GTL H;  3KJO A;  4Y52 H;  4PZ8 A;  1VQC A;  4B3M Q;  4LFA Q;  4DV4 Q;  4JI5 Q;  2OQ0 A;  2K5N A;  3U50 C;  3S17 H;  5M3F G;  1V43 A;  3IRB A;  4UP9 A;  4OXP A;  3GTJ H;  1Y1V G;  4X62 Q;  2CWA A;  1SRO A;  1V1Q A;  3CC7 A;  4B3R Q;  1PVO A;  5IY0 A;  4UP7 A;  2CFM A;  3K8A A;  1CKN B;  1HR0 Q;  3H3V I;  3PO3 G;  5GQO A;  1PA6 A;  4KHP Q;  1HR0 L;  1B70 B;  4LUO A;  3I56 A;  2CCZ A;  5M3M H;  1TWC H;  3CCV A;  1EQR A;  4BBR H;  1L1O A;  3ULL A;  4POF A;  3M7N A;  2H5X A;  3JAM c;  5C0X G;  3CCM A;  3K0X A;  1L1O C;  1N33 L;  3I4N H;  3PO2 H;  5C3E H;  2JK8 A;  3RR5 A;  4JI7 Q;  4IJL A;  4DUY Q;  1XPR A;  2UU9 L;  2K50 A;  3J81 i;  4A3L H;  1MJC A;  1PH6 A;  2MFI A;  4A4I A;  4X66 Q;  4HJ7 A;  1QZH A;  4LF9 L;  4A3L G;  2EIF A;  2JA8 G;  3H0G H;  5GRO A;  4LWC A;  4DV5 Q;  4GLX A;  1K8G A;  1TWG H;  2JA9 A;  3FP9 A;  3EBE A;  4R1J A;  2K5V A;  4X65 Q;  4B3S Q;  4JI2 L;  1P16 A;  3AEV A;  1N32 Q;  2RF4 A;  1OXT A;  3F2B A;  3HFZ B;  4DR3 Q;  2ES2 A;  4JI4 Q;  4LFB L;  2UXD Q;  1AH9 A;  1IYJ B;  1PFS A;  2Q2H A;  2VY3 A;  3WWV A;  4GKJ Q;  4YWL A;  2V1C C;  2JA6 G;  4OWX B;  1TWF H;  3TRE A;  1E24 A;  2Z6K C;  5DLQ E;  1EUJ A;  3CF5 A;  4DV5 L;  5JEA G;  4BBS H;  4ALP A;  1PH1 A;  4LW1 A;  2VZA A;  3K81 C;  5C0X J;  4DR5 L;  2KCM A;  2JQO A;  3RZD H;  1KL9 A;  3PF4 A;  2D0P A;  4DK6 C;  4A3C H;  2VUM G;  4GS3 A;  5M5Y H;  1K9M C;  1Z9F A;  1X3F A;  1N33 Q;  1XNR Q;  3NBH B;  3M3Y H;  4DAM A;  5BR8 L;  2UXC Q;  1X3G A;  2E2J H;  4JI8 L;  5ELO A;  1PH5 A;  4IFD I;  1NJI C;  1K0R A;  1E3P A;  1UWV A;  3K80 C;  4JCV E;  3M85 A;  3M4O H;  1G6P A;  4BY1 G;  2JA7 G;  2L15 A;  3UDG A;  1I5F A;  3I4O A;  4A3C G;  3TS2 A;  1QUQ B;  2R7F A;  3J7A 5;  4DR7 Q;  2HQL A;  1XTD A;  1S72 A;  4YCW A;  3H15 A;  2N49 A;  3CAM A;  1H95 A;  1NE3 A;  4BBS G;  4IOC A;  1HNX L;  2UUA Q;  4R4O A;  1YBY A;  2NN6 G;  4BY7 H;  1Q82 C;  1JJ2 A;  1IBM Q;  5IYC H;  1IBL Q;  5IP7 G;  4LF4 L;  4GKK L;  1JJC B;  2K52 A;  3BZK A;  5M5X H;  3PUV A;  4JI1 Q;  4AYB G;  1G29 1;  2C35 B;  5IYD G;  1WCM H;  1N9W A;  2NVQ H;  3FKI G;  2MO1 A;  1GD7 A;  1SRU A;  2YTY A;  1Q81 C;  1VQN A;  4JOI A;  4LUZ A;  4A3K G;  1FJG Q;  2PNH A;  4A76 A;  4X6A H;  3D31 A;  2ZJQ A;  3GTO H;  3ERS X;  3GTQ H;  3CCJ A;  1WCM G;  3KYH C;  2AWO A;  1LUZ A;  2E2I H;  1OXS C;  2JA5 G;  3ZJY C;  4A93 H;  1X9N A;  2F4V L;  1NMF A;  2VS1 A;  3RNU A;  4OX9 Q;  5IYC G;  2XTI A;  4PMW A;  4DV0 L;  3S1N H;  1N8R C;  2Y0S G;  1NMG A;  2R7Z G;  1TWH H;  4R4C A;  1AE2 A;  4JYA Q;  4RG1 A;  1QUQ A;  4DUZ L;  2KHJ A;  4A75 A;  3ULP A;  3E0E A;  2RHQ B;  2KHI A;  4LUV A;  4JI1 L;  3CXC A;  3G6E A;  1YHA A;  2R93 H;  5J3B A;  2JA7 H;  1L1O B;  4GN4 B;  3S1M H;  5C0X I;  3HOY G;  4QJF A;  4OO1 G;  1HZA A;  3S16 H;  2WP8 J;  2UUA L;  3GO5 A;  1IXR A;  1K83 H;  4YWM A;  2ALY B;  1XPO A;  4GNX C;  4LF8 Q;  2DGY A;  1A62 A;  3EIV A;  2R7D A;  4KLK A;  1LM0 A;  2ZTD A;  1PH7 A;  1E7Z A;  2ASB A;  4BXX G;  2B3G A;  5IP9 G;  4DV1 Q;  4HJ9 A;  3ICE A;  2HIV A;  2VQF L;  5LMU L;  1PH8 A;  1EIF A;  4C3J H;  1Q86 C;  4LF5 Q;  2AMC B;  1UE6 A;  5C3E G;  3B6Y A;  3GTK H;  3ULJ A;  1J5E L;  4UY8 C;  3OYY A;  5FLM G;  4LF6 L;  3EN2 A;  4JI3 Q;  3W1B A;  1YHB A;  4JI8 Q;  3Q8D A;  3K7A H;  5ELN A;  5BR8 Q;  1V9P A;  2IHF A;  3KDF A;  1P8L A;  1KHI A;  2JEB I;  1ASZ A;  4QQB X;  4WJ4 A;  2XGT A;  4YCU A;  2YTX A;  1IBM L;  2K5H A;  4JBM A;  5GAD C;  2QA4 A;  4AQY Q;  1VQK A;  3U58 A;  4NXM Q;  4YY3 L;  3F2C A;  4A3J H;  4P74 A;  2I5L X;  3L0O A;  1VQE A;  1YZ6 A;  4IOA A;  4GOP A;  4H02 A;  1XMQ Q;  3OTO L;  1PH3 A;  4IFD G;  1HZ9 A;  2B29 A;  1KRS A;  2EQS A;  4GN5 A;  4O2D A;  2A1A A;  3BU2 A;  3M4Q A;  1VQO A;  4YHH Q;  4JI6 Q;  4MNO A;  2VQE L;  2N78 A;  1EOV A;  1HH2 P;  1KIX A;  2R92 H;  5JJL A;  1SN8 A;  4JI2 Q;  4X65 L;  4B3S L;  4DR7 L;  5K36 G;  3HOU G;  3PIP A;  1OXU A;  1HNW L;  2NN6 I;  4NXN Q;  1DGS A;  2N8N A;  1KD1 C;  1N34 Q;  4KI0 A;  4K0K Q;  3E9I A;  2YV5 A;  5FLX c;  1Q8K A;  1LYL A;  4BBR G;  5FJ8 G;  2NZO A;  2R6G A;  4UP8 A;  1WI5 A;  1W2B A;  1B7Y B;  1GKH A;  5IYB H;  3E9H A;  2YU9 H;  2Y0S E;  3F8T A;  1CKM A;  4HJ5 A;  4JI7 L;  4ME3 A;  1J6Q A;  1KQS A;  4AH6 A;  1U5K A;  1YEZ A;  4QY7 A;  1FGU A;  1ASY A;  3STB C;  2BH2 A;  3PO3 H;  4DK3 C;  5AJ3 Q;  3CPF A;  1HZB A;  1YI2 A;  4LNQ A;  2BH8 A;  2ZM6 Q;  3CMA A;  5IP9 H;  1IBL L;  4PZ6 A;  1EYG A;  3CCQ A;  3T1Y Q;  2F52 A;  3GTG H;  1UE7 A;  4DV2 L;  2ID0 A;  1K73 C;  4B3T L;  1SR3 A;  1JB7 A;  1VQG A;  4P73 A;  3AFQ A;  1JMC A;  1MKH A;  5M5W H;  3RZO H;  3PUW A;  2UXB Q;  4DR2 Q;  1VS0 A;  2E5L L;  2E5L Q;  3TQY A;  1VQ9 A;  2PI2 E;  1I50 H;  4GLA C;  1VQB A;  4AYB E;  2R93 G;  1OXV A;  3CCU A;  5HY6 A;  1M90 C;  4B3T Q;  1C9O A;  2KBN A;  4GLV B;  2NVX H;  3J80 c;  2VW9 A;  1CUK A;  2UU9 Q;  4DV4 L;  1YJ9 A;  4B3M L;  4LFA L;  1SMX A;  4P72 A;  5FLM H;  2IHE A;  3AFP A;  2Q2I A;  1JT8 A;  4GNX B;  1I94 L;  1VQ6 A;  3HOX G;  4DV3 L;  1X6O A;  4LF9 Q;  4A3G H;  4X66 L;  3KF6 A;  2YTV A;  3HOW H;  1QVC A;  4HJA A;  2UUC Q;  2NZH A;  1L2F A;  4LFC Q;  3G71 A;  4JBJ A;  5LMN Q;  3KJP A;  1K3R A;  2ZJR A;  2AWN A;  4DUY L;  4UPA A;  3HOV G;  5GAG C;  3UE1 A;  1N34 L;  4HIM A;  3F1Z A;  4JC0 A;  4NXN L;  3UE0 A;  3A5Z B;  3JAM i;  3GTM H;  1N36 Q;  4KHP L;  2I5H A;  1XNQ L;  5IYD H;  3AQQ A;  4X62 L;  1Q46 A;  4XTC S;  4DR3 L;  4JI4 L;  1WYD A;  4LFB Q;  3RLO A;  4JI5 L;  4DR4 Q;  4IPD A;  2RHS B;  5IP7 H;  1N32 L;  4TQU S;  1OTC A;  2BA1 A;  1NY4 A;  5LMN W;  2UXB L;  3PV0 A;  4DR6 Q;  2R7Z H;  4RMF A;  3J81 c;  3AYH B;  1SLJ A;  1KC8 C;  2IT1 A;  4R4I A;  1PH9 A;  4IJH A;  2CWP A;  2F3I A;  4IPG A;  4TVA B;  4DV6 L;  4GOP B;  3S15 H;  5LMN L;  3BZC A;  4DV2 Q;  1YJN A;  4AQY L;  4LFC L;  3T1Y L;  1X3E A;  4GOP C;  3I4M G;  4JV5 Q;  1EIY B;  1O7I A;  2ATW A;  2D0O A;  1D7Q A;  4EQ5 A;  1TXY A;  2KCT A;  3RN5 A;  1I94 Q;  1C7Y A;  4HID A;  2GVA A;  3U4V A;  4IPC A;  2I5M X;  4A3F H;  1VQL A;  1Y14 B;  3S14 H;  1FL0 A;  3FKI H;  2UUB Q;  5C44 G;  4IO9 A;  1G51 A;  3H3V H;  4DV6 Q;  5IWA Q;  4Y7N H;  1WFQ A;  4BA1 I;  4OWT B;  4DPG A;  5LMU Q;  3PSI A;  3KFU A;  4POG A;  3S1R H;  3I4N G;  4QGU A;  4DR6 L;  4MTN A;  2IX1 A;  3BJU A;  1HNW Q;  3GD7 A;  3RLF A;  1I3Q H;  1Y1W H;  4B3R L;  2WFW A;  3DLL A;  4C3I H;  1PYS B;  1X65 A;  5C4X H;  2ZTC A;  4JI6 L;  2Z0S A;  1XMO L;  2I0Q A;  1TWA H;  1OXX K;  4BA2 I;  3RN2 A;  1D8L A;  2Q2U A;  3TRZ A;  3FHW A;  4X64 L;  2ZM6 L;  3OTO Q;  5M3M G;  3VDY A;  1YHQ A;  1N36 L;  1SFO H;  2VNU D;  4GN3 B;  3JC6 6;  4PZ7 A;  1L0W A;  3HKS A;  3CCS A;  1GM5 A;  2QGQ A;  1HNZ L;  2HHH Q;  1MIU A;  1VQM A;  4YCV A;  4YY3 Q;  1Y1W G;  2MO0 A;  4PG3 A;  5HGQ A;  1VQ5 A;  4NXM L;  1QVG A;  1Y1V H;  3I55 A;  2UUC L;  3I2Z A;  1X55 A;  5IT9 c;  1YIT A;  3T1H L;  2JA8 H;  1A8V A;  1VQJ A;  4K0K L;  2WAQ G;  3CW2 C;  4L5Q A;  1GVP A;  2NVT H;  2VUM H;  2D62 A;  2LXJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...