3T1YL

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human anti-codon stem loop (hasl) of transfer rna lysine 3 (trnalys3) bound to an mrna with an aag-codon in the a-site and paromomycin
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title Human tRNA(Lys3)(UUU) Is Pre-Structured by Natural Modifications for Cognate and Wobble Codon Binding through Keto-Enol Tautomerism.
pubmed doi rcsb
total genus 16
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2011-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3t1yL00
2QGQA 1J6QA 1PH2A 3U4ZA 4DV0L 2Q2TA 1E22A 2IX0A 1T9HA 4YCVA 2R7ZH 2VUMG 1VQ4A 1FJGL 1B7YB 3CXCA 1L0WA 2UXDQ 4GN3B 3STBC 3L7ZC 3W5OA 5IE8A 2PQAB 3RN2A 1QZGA 5GAGC 3EN2A 3HOVH 3A74A 4EX5A 2GVBA 2KCTA 5IP9G 3JAMi 4DR6Q 1Q8KA 4BY1G 1K73C 1IBML 1N34L 1Z47A 3AQQA 5LMUQ 1YEZA 1L1OA 1N9WA 4JI1L 4A93H 4X62Q 4OO1G 5C4XG 1X56A 1A63A 4NXNQ 2E5LL 1Y1VG 5IYDH 5H1SE 2NVYH 4GLVB 3AFQA 3DM3A 5M5YH 2F4VQ 5K36G 3TRZA 2AKWB 1KHIA 4BA2I 3F2DA 3GTQH 1BKBA 1X65A 1EIFA 4MZ9A 1PA6A 2K5HA 2OQ0A 4LW1A 2N3SA 3W1GA 1HZBA 3S24A 1HNXL 3OTOL 1PYBA 2DGYA 2JE6I 3B6YA 5IP7H 1NE3A 2ASBA 2Q2HA 4AH6A 4A3IH 1K9MC 1XNQQ 1S72A 3PIOA 5AJ3L 2UUBL 3TQYA 3KDFA 3T1HL 1EYGA 4DUZQ 3KF6B 4OWTB 2NVTH 4LF9Q 1Q1EA 5LMNL 5IY0A 1LYLA 2WFWA 4LUVA 1JJCB 1KL9A 2GN5A 1CSPA 4JYAQ 2E2HH 2NVXH 4DR4Q 4A4IA 1SROA 2CKZB 2GVAA 1LTLA 2ZJQA 5FLXc 1NY4A 2F3IA 3CC7A 1PH5A 4R4CA 3S16H 4GN5A 4UY8C 4JI3Q 5M3MG 3UDXA 2MO0A 5FLMH 4BBSH 2ZTEA 2UUCL 4NPSA 1KAWA 1KRTA 4A3BG 3S1MH 3H15A 3NENA 1HNZL 4GN4B 3ULLA 3A5UA 4IO9A 4DR1Q 3CCMA 3H3VI 4BXXH 2UXBQ 3J7A5 3HFZB 4YWLA 1YIJA 4JI2Q 1GKHA 5IWAL 2VW9A 4C3HH 4B3TQ 2K5VA 3J81i 3BZCA 4JBJA 4H02A 4JOIC 2WB1G 4A76A 1YHQA 4LFBQ 4OWXB 4A3FH 3TS0A 4R4IA 4RMFA 3WWVA 2I5HA 4JI7Q 1VQ8A 5HGQA 4AQYQ 4BY1H 2JA7G 2JEAI 1I3QH 3S14H 1KXLA 2VQFL 3Q8DA 3JAMc 4OO1I 4JI0L 2VQEL 1K83H 1JB7A 1VQGA 4UP9A 5C4XH 1TWCH 3EIVA 3U4VA 1Q86C 1HR0W 4ALPA 1Y1VH 2BH8A 3M85A 4GLXA 4XTCS 3T1YQ 1G291 5C0XI 1QVFA 3I7FA 2R7ZG 4YHHQ 4DUYL 1A0IA 4LF6L 1P16A 1O7IA 4DR6L 1V9PA 3K0XA 2R7FA 1NJIC 3CQZH 2UXCQ 1IBLQ 4JBKA 3PUWA 4X64Q 4DK6C 1YJ9A 2B63H 1VQFA 3CAMA 4C3JH 2F52A 3CCVA 3CD6A 1E3PA 4LFCL 1YJWA 2HHHQ 1N32Q 4X66L 3J80i 2OQKA 1LUZA 2YTXA 4R4OA 4DV4L 2N78A 1XPOA 4LFAQ 2NVQH 1EFWA 3NBHB 3UDIA 4DV7L 4JBMA 2CQOA 4B3RL 2E8GA 1X3FA 4JI4L 4DR5Q 4LF7L 4LF4L 4EQ5A 1V43A 3VDYA 5IT9c 1YHAA 3GTPH 2VZAA 1UWVA 3SGIA 4B3SL 5M3MH 1CSQA 1L1OB 1Q12A 4QGUA 4A3JH 4QJFA 1VQPA 2F4VL 3S2DH 1IXRA 5JJKA 5IP7G 5JEAG 1S40A 1HR0Q 2OWOA 3KOJA 4A3IG 4PMWA 1XMQL 3M4QA 1IL2A 4IOAA 3J81j 2D0OA 3PO2H 1I94L 4DR7Q 3F2CA 4PZ6A 4JI8Q 4NXMQ 4YY3Q 1AE3A 2JQOA 3ERSX 4B3MQ 2HIXA 1K0RA 3J81c 3CCSA 1JJ2A 1E1TA 3CW2C 4QIWE 2JA6H 1PH1A 2JA7H 1SMXA 5E7NA 1M90C 3KDFB 3NELA 3PUXA 4L5QA 4DV6Q 2AWNA 3GDEA 4HJ5A 5FLMG 4MTNA 1YVCA 1WCMG 2PI2E 2Z6KC 4LF5L 4BXXG 1FL0A 2K50A 2CFMA 2KHJA 4AYBG 3U58A 2D62A 3CMAA 4UPAA 1YI2A 2FXQA 2UU9L 4KI0A 4X6AH 5C3EH 5C0XJ 3ULJA 4A3FG 4JI5Q 3G6EA 3CCEA 2K14A 1VQEA 3RZDH 4TQUS 3AFPA 1SFOH 4DV3Q 3K7UC 4DNIA 2IT1A 2MO1A 4BBRH 3S1RH 1W2BA 4K0KL 4JOIA 1UE7A 4IFDI 3J80c 1Q82C 3DLLA 3I4MH 4BBSG 5GAHC 3MEFA 1S3OA 1QVGA 1YBYA 3ER0A 4HIMA 1V1QA 1VQMA 4Y52H 2K52A 3PGZA 2K5NA 4A3EG 1ASZA 4A75A 4OX9Q 3FHWA 1E1OA 5M5WH 1U0LA 1SRUA 4HJ7A 4DPGA 4HJAA 4UP7A 3UDFA 1XMOQ 2WB1E 2ID0A 3FP9A 4PZ7A 3U50C 1K3RA 4RG1A 3FKIH 1VQ9A 2YYZA 2NZHA 1HZAA 1WYDA 2B63G 4GKJL 1D7QA 2YV5A 4DV2L 4A3DH 3UE0A 1RL2A 1X6OA 4P75A 2UUAQ 1N33Q 3CCQA 3GTKH 5M5XH 1VS0A 5BR8L 1W3SA 3I56A 1VQCA 1KD1C 1XNRQ 4GNXB 2ZM6Q 4GKKQ 1HZCA 2MFIA 2LXKA 1TWHH 4YWKA 3NEMA 3G48A 2L15A 3I4MG 4A3JG 1N36L 1VQLA 1WCMH 2K4KA 2RHQB 4TVAB 3OYYA 4POFA 1PV4A 1J5EL 2AMCB 3CC2A 2OCEA 2Z0SA 4X65Q 3PO2G 3PUZA 4P74A 4YCWA 1KIXA 4DV5L 1VQAA 4LF8Q 4DR3Q 2BH2A 1PH9A 4DV1L 1HNWQ 4GOPC 1NMFA 1PHJA 3I4NG 4A3GH 2XGTA 2MQHA 3KF8B 3LGJA 1UEBA 3KFUA 4A3LG 3PUYA 4P72A 4JI6Q 2JA6G 4DAMA 1EWIA 3ZJYC 1Y1WG 3PCOB 3TS2A 4DV0Q 1Z9FA 1IBKL 2V1CC 4WJ3M 4JV5L 4IPCA 4IJHA 4JC0A 3GO5A 5M3FG 1FJGQ 5LMNW 1PVOA 4IPHA 3PIPA 4A3CH 1TWGH 4IFDJ 3M9BA 2HIVA 3PF4A 3KJPA 2E2IH 4A3EH 1PH7A 3HKSA 1IBMQ 1P8LA 5C3EG 1N34Q 2RCNA 3L0OA 2N49A 3CMEA 1PH8A 5ELOA 4JI1Q 2Y0SG 2Z6KA 4LNQA 5JJLA 2UXDL 2E5LQ 2CWPA 1CUKA 1XTDA 1UE1A 3BU2A 4BBRG 3KLWA 1AH9A 1I5FA 2R7DA 1WJJA 1HNXQ 5LMUL 3OTOQ 1NMGA 1GVPA 4X62L 1SE8A 1FGUA 1QVCA 1WI5A 2IHFA 5GROA 4NXNL 5AJ3Q 2UUBQ 4AYBE 2R92G 3T1HQ 1I6HH 1AE2A 3PO3H 2EQSA 4C2MH 4R4TA 5C44G 5LMNQ 1KC8C 2VS1A 3FKIG 3CPFA 1XPRA 4A3DG 4HJ9A 1E7ZA 2CWAA 1PH6A 1D8LA 2VL6A 4YWMA 1VQOA 4DK3C 4MNOA 3S1NH 1XNQL 1XPUA 3I4NH 1JJGA 1C0AA 1PFSA 2Q2UA 4A3LH 4HIDA 4DUZL 3M4OH 1NTGA 2RHSB 4L5RC 4LF9L 4QQBX 2UUCQ 3S2HH 4DKAC 1A8VA 4OXPA 4HIKA 1HNZQ 1Y1WH 5JJIA 2A1AA 1VQNA 4JYAL 3ICEA 4DR4L 5M3FH 5IWAQ 1JMCA 3S1QH 1NBWA 1VQ6A 1PH3A 5IYCH 3F1ZA 4OWWB 4L5TA 1X9NA 4JI3L 2A8VA 3CCJA 1I50H 4IJLA 3OW2A 2LXJA 2VQFQ 4R4QA 5J3BA 4A3GG 4DR1L 2WAQG 4JI0Q 2UXBL 2YTVA 1H95A 2VQEQ 2PNHA 4JI2L 2DUDA 4B3TL 3BZKA 4LFBL 3A5ZB 3M3YH 2R93H 2VY3A 1E24A 3S15H 1JT8A 4DUYQ 2AWOA 1HH2P 4Y7NH 3RN5A 4JI7L 4LF6Q 4GNXC 4HIOA 4GOPA 4AQYL 2CCZA 3G4SA 3I55A 3CC4A 2ALYB 3K81C 4DAYB 4A3CG 4KHPQ 3PV0A 1EOVA 2K75A 2BA0A 1QUQA 4QL5A 3GTJH 2B29A 1VCIA 2MNAA 2R92H 3HOUH 2NN6G 3EBEA 4LFCQ 1CKNA 3HOZG 3T1YL 4X66Q 3RNUA 5C44H 1TWAH 4YHHL 3I2ZA 3G71A 4DV4Q 5ELNA 2LSSA 4DR2Q 2N8NA 1OTCA 1OXSC 4KLKA 4APVA 4DV7Q 1C7YA 3D31A 4AIMA 4B3RQ 3HKZG 2UXCL 1WFQA 1B8AA 1IBLL 4JI4Q 4IPDA 4JCVE 3CP0A 4LF4Q 4LF7Q 2ZJPA 4X64L 2C35B 4UP8A 1XJVA 1OXXK 3RLOA 1ASYA 4PG3A 1KQSA 3STBD 2HHHL 1YJNA 4B3SQ 1N32L 1A62A 1Y14B 3HOWH 5HY6A 1VQ7A 1X55A 1X3EA 4O2DA 5IYBH 3ULPA 1VQ5A 4LFAL 5C0XG 5C4JH 1IZ6A 3J7ZC 1XMQQ 3RZOH 2PMZE 1EQRA 3CPWA 1I94Q 3JC66 2JA8G 3PO3G 1G51A 1LM0A 4QY7A 5FJ8H 4DR5L 2ES2A 1VQDA 3S17H 1N8RC 2B3GA 2YU9H 3PSIA 1BBUA 2I5LX 3A0JA 1K8GA 4YCUA 2Y0SE 1SLJA 1UE6A 3K7AH 4HJ8A 2JA9A 1Q81C 3HOXH 2R6GA 4C3IH 3E0EA 3I4OA 4A3MG 1HR0L 4L5SA 1IYJB 2H5XA 3GTGH 2E2JH 2JA5G 4JBWA 1GD7A 2JEBI 2YTYA 3CCUA 4DR7L 4JI8L 2WP8J 4NXML 4YY3L 4LWCA 5GADC 4IOCA 3CCLA 2IHEA 4B3ML 4LF5Q 3PF5A 1PYSB 1SN8A 1Q7YC 1SR3A 2Q2IA 1TWFH 1L2FA 2PQAA 3KJOA 3GTMH 2UU9Q 2PI2A 1OXVA 2KHIA 4POGA 5IYCG 4A3KG 2ZTDA 1VQHA 2IX1A 2NN6I 4DV6L 2VUMH 5DLQE 3H3VH 1L1OC 5GAEC 2I0QA 3HOYG 1TXYA 3PUVA 3H0GG 3HOZH 1CKOA 1M1KC 1X3GA 1MKHA 4K0KQ 4FDBA 5IP9H 3MXNB 1EUJA 1VQKA 1HZ9A 1UE5A 1VQIA 5JEAJ 3F2BA 4LUZA 2A19A 1YZ6A 3K8AA 3RLFA 2R93G 4XIGS 1YHBA 4KHZA 3E9HA 4JI5L 4BY7G 4OONA 4P71A 1VQBA 3IRBA 4GS3A 5EAYA 1WOCA 3L2PA 3RR5A 2JJQA 1BVSA 4P73A 4DV3L 4J15A 2D0PA 2OTJA 1MIUA 3KF6A 4JG2A 1EIYB 1MJCA 3HOUG 4GKJQ 4KHPL 2BA1A 2RF4A 4DV2Q 1Q1BA 2KBNA 3UE1A 2JA8H 1RIPA 1HJPA 3HOVG 4GNXA 4GOPB 3D0FA 2HT1A 3UDGA 2AHOB 2EIFA 2WAQE 4OX9L 1QUQB 2JK8A 5BR8Q 1X54A 3AYHB 2NZOA 5GQOA 3M7NA 1XMOL 4A3MH 1PH4A 3RLNA 2VNUD 1MJEA 4A93G 4WJ4A 1CKNB 4DR2L 2JA5H 1G6PA 1VQJA 3CF5A 5IYDG 4IFDG 3HOWG 2EXDA 1N36Q 3K80C 2XTIA 2OTLA 2UUAL 1GM5A 3TREA 1N33L 1JE5A 4LUOA 5IYBG 1J5EQ 3GD7A 1OXTA 2I5MX 4PZ8A 2IY5B 1XNRL 3CCRA 4DV5Q 4O0AA 3KYHC 5FJ8G 2ZM6L 1GO3E 4A3BH 1C9OA 1CKMA 1Q46A 4DV1Q 4A3KH 2ZTCA 3AEVA 4GKKL 1BBWA 4ME3A 2KENA 3GTLH 4R1JA 1YNXA 3M4PA 3F8TA 1B70B 1QZHA 1DGSA 3HOXG 2QEXA 3BJUA 3H0GH 4BA1I 3HOYH 3HKZE 1YITA 1KRSA 1IBKQ 4X65L 2ATWA 3GTOH 4JV5Q 4IPGA 4LF8L 4DR3L 1K8AC 2KCMA 2QA4A 2ZJRA 1R9TH 2HQLA 1OXUA 1FVIA 1U5KA 1HNWL 3E9IA 3TEHB 4NB3A 4BY7H 3W1BA 1EQQA 4GLAC 4JI6L
chains in the Genus database with same CATH superfamily
1SYBA 1J6QA 1I4QA 4QB4A 3KBGA 2R7ZH 2VUMG 1UNSA 1B7YB 3LWEA 1NR2A 3W5OA 3C1EA 2PQAB 2F0MA 4EX5A 5KNCA 4DNTB 4M8AA 1K73C 3OIQA 4HCEA 1Z47A 2HCIA 1N9WA 4JI1L 5C4XG 1X56A 1HXYD 2E5LL 4RKBA 5IYDH 1UAPA 2DN8A 2NVYH 2F4VQ 5EKLA 1KHIA 2MJ8A 1BKBA 1X65A 1EIFA 3RMHA 2K5HA 2OQ0A 4LW1A 3W1GA 2JYOA 3OTOL 1B9MA 3B6YA 2ASBA 1S72A 4A3BB 1SYFA 3PIOA 3TQYA 2RQXA 1EYGA 1B44D 1BBXC 2NVTH 2EYOA 4CDEC 5IY0A 4LUVA 3H0GB 2AQ3B 1SROA 2A6HC 2GVAA 5FLXc 1H9SA 1NY4A 2F3IA 1HA5A 2EYHA 1PH5A 4R4CA 4Q5VA 5M3MG 2M00A 5I4DA 4BY7B 3H15A 4RGOS 3A8IE 3I70A 5LL6X 1STNA 1R4QB 4DR1Q 2UXBQ 4YWLA 4JI2Q 5IWAL 4CHTB 4C3HH 3J81i 4OWXB 4IALA 1EY4A 4RMFA 4R8IA 4BY1H 2JEAI 1ESRA 1EY5A 5I2XA 3Q8DA 1ZEQX 4JI0L 2VQEL 1K83H 1JB7A 4L63B 4UP9A 1Q86C 3U4VA 2BH8A 4A93B 3PQIA 4XTCS 4GLXA 3T1YQ 5G3LD 2WACA 5K36H 4DUYL 4CJ2C 2RA4A 3Q24A 1V9PA 1EL0A 1TIID 3CQZH 3IL8A 2F0KA 4JBKA 4RGTA 4IUVA 3BDOA 4X66L 3K7AB 2A69D 3I8ZA 1X3FA 4N9PA 2WINB 4EQ5A 3TP5A 5IT9c 1WTPA 3SGIA 1UWVA 1VQPA 1L1OB 2BDNA 4A3JH 2DJFC 5JEAG 3NTIA 3J81j 2D0OA 4JI8Q 4NXMQ 1HFGA 2I46A 2JQOA 1X3QA 1E1TA 2PCFB 1EEID 1M90C 1CA6A 3VR6A 1C8CA 3OIPA 2AWNA 3CU7A 5EGTA 2KVMA 1TR5A 1KNEA 2K50A 3K5NA 1STAA 2CFMA 1Y1VB 3U58A 4AYBG 4UPAA 1KNAA 2FXQA 2ICEC 2O2LD 5DM63 2LMCB 1Z6HA 3G6EA 2K14A 3KK7A 4TQUS 2NB0A 1PTOB 3K7UC 4KKUA 4K0KL 4BBRH 1W2BA 1UE7A 1LO5D 4IFDI 4MHEA 4BBSG 2NVQB 1MSGA 1QVGA 1YBYA 3O13A 4HIMA 1VQMA 2A6ED 4Y52H 3PGZA 1L0XB 4A75A 1SRUA 1F2ZA 3T16A 1XMOQ 4KK7A 3U50C 1VQ9A 4RG1A 3S2DB 1D7QA 2B63G 2NZHA 3RD4A 1EY8A 1BUVT 4C3JG 4KHVA 4DV2L 1SNQA 1X6OA 4P75A 1SJED 1D6EC 2HDMA 1ML0D 1V1OA 4KN7C 3CCQA 3GTKH 2WB1B 5M5XH 1KD1C 3I56A 5C4HA 1XNRQ 3MEHA 1B2TA 3EROA 1Z7TA 5KRUA 2XVSA 2JA7B 3NTKA 3TZUA 1JWUD 3I4MG 1VQLA 1WCMH 1RDPD 1W6KA 2ZT9C 4E6IA 1PV4A 3I90A 4POFA 2AMCB 4LF8Q 1VQAA 4RFBA 2BH2A 2PO4A 2EYJA 2R7ZB 3CRKC 4WFN3 4DV1L 1HNWQ 3I4NG 4A3GH 1A3TA 3KFUA 1QE6A 1QG7A 1UEBA 2JA6G 1NNXA 4DAMA 3BDCA 3ZJYC 1QWYA 3TS2A 4WJ3M 1DYQA 2V1CC 2K1BA 2TMPA 4IPCA 1E2VA 5FO8B 4JC0A 3GO5A 1DOLA 3J81L 1FJGQ 3NQIA 4IPHA 3PIPA 1H9RA 2F0TA 1TWGH 1EU3A 4IFDJ 1BNZA 3HKSA 2A69C 4R9WA 2RCNA 3CMEA 2JXMB 1PH8A 4FXDA 2X6LA 2N55A 5CV5A 3HGBA 3FKIB 1CUKA 5CGKA 3H3VC 4XQQA 3P20A 1EZ8A 1AH9A 2F0SA 2EDGA 1FYCA 1KDBA 5KNBA 1GVPA 5KYIA 5IODA 1SE8A 5ISRA 2R3ZA 4ZYSA 1I6HH 4KJNA 3PO3H 2EQSA 2L4NA 4ODGA 3AB9A 1FNVA 4XDXA 4HJ9A 2X6GA 1D8LA 4YWMA 2Z4IA 4DK3C 2L12A 1LT5D 2K28A 2IX3A 5E1FA 1PFSA 3DWPA 4A3LH 3C1FA 3DHQA 4MIUA 2WAQB 5C5MA 4DKAC 1A8VA 1HQRD 2F0JA 4OXPA 4HIKA 5JJIA 2KECA 5CMDA 4JYAL 4DR4L 1G8ZD 3NWTA 4O42A 4QF4A 3UI2A 5IYCH 3F1ZA 4L5TA 4KV6A 1ZXTA 2A8VA 3CCJA 1H9SB 1I50H 5G3LF 1PTOD 4DFAA 3OW2A 3D3RA 2VQFQ 1SNPA 2QF7A 2MP1A 1H95A 1A3UA 2B2UC 4RH6A 2PNHA 2PZWA 3J7AF 3CQZB 2A6EC 3BZKA 3M3YH 5NUCA 1E24A 4Y7NH 1E0BA 4JI7L 4LF6Q 3HKZB 1K0SA 5KEEA 3I55A 4DAYB 3GTJH 2BA0A 1JE4A 4HSPA 3DXJC 4CJ1B 5JVG3 4KY6A 1LTSD 4QCLA 5C44H 3NHHA 4DV4Q 5ELNA 2LSSA 4DK0A 4APVA 4DV7Q 2UXCL 3CP0A 4G4KA 4RHRA 1D5ZC 2C35B 4JW0A 1ASYA 4PG3A 3STBD 1EZ6A 1YJNA 1ENFA 1HUMA 1I4HA 1Y14B 4DAVA 3HOWH 2LFNA 2B2WC 2MGSA 1KDCA 2RCFA 5C0XG 5C4JH 1RJTA 3LX0A 1XMQQ 1TY0A 1A2TA 2AUJD 4B08A 1EQRA 1Y1WB 4IUTA 3T4AC 1I94Q 3TP6A 1GXDC 1LM0A 4QY7A 5FJ8H 5IGFA 1VQDA 4ZRZA 2O5IC 1K8GA 1U9RA 2F0UA 5EPJA 1SLJA 2ZXOA 2JA9A 5TSSA 4C3IH 3J81E 1IYJB 4IUUA 2JA5G 3CCUA 4DR7L 3KLRA 4LWCA 5GADC 1V8QA 3CCLA 2IHEA 1D5MC 1SR3A 4K2LA 4JVZA 2PQAA 3KJOA 4XXEA 3GTMH 2NTSA 5IIFA 2RVLA 4A3KG 2IW3A 2ZTDA 3K5MA 1PZJD 3H3VH 1L1OC 5GAEC 3HOYG 3HOZH 2R92B 5IOCA 3W2DA 1MKHA 2Z8LA 4FDBA 1VQIA 3FRPB 5JEAJ 4HCSA 4IUPA 3RLFA 2R93G 1YHBA 3P7JA 4OO1H 1LTRD 1BVSA 4IURA 1VMPA 1LT3D 2B2UA 3GTKB 3ERQA 5M5XB 2WV6D 2R61A 2BA1A 2RF4A 2B39A 1Q1BA 3BVGA 1AP0A 1RIPA 2EJFC 1HJPA 1QCBD 1NCVA 2WAQE 4OX9L 1QUQB 3S17B 1X54A 5GQOA 4F7XA 3RLNA 1MJEA 1VQJA 5IYDG 2Q8IB 3GTGB 2XWBB 2OTLA 1PTOC 2F3WA 2I5MX 4IUQA 2A74C 2ZM6L 4A3BH 1YNJD 1BBWA 2KENA 2B2WA 2Z4HA 1YNXA 4R1JA 3TP8A 2KCCA 4J6HA 3HOXG 3H0GH 4BA1I 3HKZE 4IN3A 1Q90A 2EYLA 2KOLA 3L9AX 3U9OA 3E9IA 2DJGC 4NB3A 4BY7H 1EQQA 4L6TB 2QGQA 5IGEA 4J8QA 1S5CD 3U4ZA 4DV0L 4FF2A 4ZKBB 1VQ4A 4RGNA 3CXCA 1L0WA 2UXDQ 1VF5C 3BG3A 3STBC 1HRJA 3RN2A 1QZGA 1CHPD 3ONAB 1I6HB 2KCTA 5JVH3 3JAMi 1Q8KA 2KEEA 4BY1G 1IBML 1JORA 1QB5D 3AQQA 5I6YA 1L1OA 2KEDA 4A93H 5D3DA 4GLVB 2EVBA 2EOTA 3DM3A 3GV3A 5IGDA 5K36G 3IAYA 3TRZA 4BA2I 3F2DA 1B3QA 4CKCA 1HZBA 3KUPA 4I7AA 1NE3A 4CDCC 2Q2HA 3E3XA 1XNQQ 2KQ3A 5AJ3L 2UUBL 3T1HL 4OWTB 1J8IA 1PTOF 1LYLA 3NP8A 1JC7A 1RCVD 1CSPA 1H9MA 3D4WA 4A4IA 1STEA 2SNSA 3QOLA 1A3VA 2K05A 4IUNA 1XYIA 1MSHA 2RKSA 3NWSA 4GN5A 1HA6A 4JI3Q 2MO0A 1ENAA 2ZTEA 2UUCL 1KAWA 1L0YB 3IKJA 3MXGA 1U4RA 3NENA 4C56C 4Y7NB 4GN4B 4BXXH 3H6MA 2B2VC 3J7A5 2A5HA 3HFZB 1YIJA 2TSSA 2VW9A 4B3TQ 2K5VA 2K01A 1YHQA 4A76A 4LFBQ 3VR2A 2E74C 5ELFA 4A3FH 1SE3A 3TS0A 4R4IA 1Y8OB 4AQYQ 2RDHA 3HOVB 3NTHA 1KLUD 1VQGA 4FF1A 3EIVA 1HR0W 4ALPA 1Y1VH 1G291 5C0XI 3I7FA 4YHHQ 5M5YB 3FEWX 2R7FA 5C4JB 1IBLQ 1YJ9A 3N52A 2JN4A 4X64Q 3CD6A 1PTOH 3CCVA 4LFCL 2HHHQ 1N32Q 3QG1A 3G6JB 2F0DA 3G7LA 2YTXA 1ESFA 4R4OA 1XPOA 4LFAQ 1YNJC 2NVQH 4OHJA 1PYWD 4QMGA 4B3RL 1B3AA 4DR5Q 2E2HB 3HRZC 3I73A 2VZAA 5CV7A 4XYQA 3S2DH 4QGUA 4QJFA 2Z1CA 2F4VL 5JJKA 1IXRA 2F0FA 5IP7G 1HR0Q 1F2YA 3KOJA 4A3IG 4PMWA 2VB2X 5FOBB 3S1MB 2F0NA 4PZ6A 4YY3Q 4U673 4B3MQ 1ICFB 3J81c 1WTRA 1I4RA 3CW2C 1WVLA 2JA7H 1SMXA 3PMFA 3KDFB 3S14B 2HUGA 3HP3A 3PUXA 4L5QA 5CR3A 3GDEA 3GV6A 4DV6Q 5FLMG 4MTNA 1HPCA 1WCMG 1YVCA 3M4YA 4PV1C 4LF5L 3NQTA 1TWCB 1FGBD 1FL0A 3TZDA 3LNNA 1SSOA 1O7ZA 1SAPA 2D62A 3SDZA 2F0IA 3CMAA 2UU9L 4X6AH 2AQ2B 5C3EH 5C0XJ 1EY9A 3ULJA 5JJZA 4KD3A 3RZDH 4DV3Q 1S5BD 1STGA 2B2VA 2B63B 4DNIA 1Q82C 1EY0A 1FNWA 5GAHC 1S3OA 5JAVA 1B53A 2PYKA 3JAML 3HS0C 1ASZA 3MXPA 1UUPA 1U0LA 4HJ7A 2P5ZX 3GTPB 4PZ7A 3FKIH 4PQXA 1HZAA 1WYDA 4GKJL 4KY7A 2WKDA 3UE0A 1RL2A 4YIJA 1RHPA 4XT3B 2F0EA 2Q8TA 1VQCA 1AZPA 1Q3LA 2SEBD 4GKKQ 3QO2A 2MFIA 1NUCA 2LXKA 4UAIA 3NEMA 1N36L 3QJYA 2K4KA 4S3SA 3OYYA 2RBMA 3CC2A 2OCEA 3W3AA 3PO2G 4P74A 1TY2A 3WDNA 4DV5L 4DR3Q 1DOMA 1PFBA 1VDZA 4L8JA 1C48A 2KA7A 4X3SA 4DAYA 4GZYC 4A3LG 3LGJA 3J7AV 3E0JA 4H0LC 4P72A 4JI6Q 4B9XA 3NBIA 4F87A 1BXTA 2GA4B 1IBKL 4JV5L 4G7HC 1SFOB 5KNDA 4RCNA 3SK4A 3S1RB 2I07B 3QB3A 4A3CH 1MI2A 3SK8A 3M9BA 3PF4A 3KJPA 2NN6H 5ELDA 1J9OA 1JOKA 2BDOA 4O1NA 2Z9HA 5M5WB 1BCPB 5D3IB 4JI1Q 2Y0SG 1DZ1A 2E5LQ 1EU4A 1ET9A 1UE1A 3BU2A 3KLWA 1I5FA 1SE4A 2PPBC 2X69A 5LMUL 3OTOQ 3FPPA 4X62L 1FGUA 2IHFA 4NP5A 4NXNL 2LKVA 4HEDA 4AYBE 5D65A 5C44G 1KC8C 1HUNA 4WRDA 2F0GA 4A3DG 1E7ZA 2K5DA 1SNDA 3URYA 4DGZA 1DJRD 4DUZL 4A3FB 4LF9L 3MWYW 4G7ZC 1EY6A 1Y1WH 2A1AA 2FINB 3ICEA 3K6OA 5IWAQ 1SBBB 1NBWA 1AEXA 2BCOA 1X9NA 4KKSA 2C5CA 4C3IG 2J0TD 2E2IB 1DD2A 4A3EB 3L3OC 4JI0Q 2YTVA 2F4IA 3A8JE 2VQEQ 3NSWA 1NR4A 1LTTD 3JAME 3A5ZB 2PW5A 3EQLC 2VY3A 1JT8A 1HTPA 4DUYQ 3SK6A 1CZGA 1M8AA 3FVQA 4GNXC 3CC4A 1F9PA 2CCZA 3G4SA 4KHPQ 3K81C 3F2UA 1ILPA 1QUQA 2B29A 2O4XA 1KLGD 3MVVA 2QDBA 1ZKOA 1G2TA 2R92H 3R3OA 3HOZG 4X66Q 2OT2A 3I2ZA 2D2CC 5C6AA 3G71A 2DY8A 4C2MB 1U4LA 4DR2Q 1OXSC 3ZYYX 4F8MA 1T5XD 3D31A 1WFQA 4RWSC 2CQAA 4UP8A 1CHQD 4QUFA 1WD0A 3S1NB 1EYAA 2QCPX 1VQ7A 4O2DA 5IYBH 3S2HB 1GUGA 1IW7D 4X3KA 1EFID 1G51A 3GP7A 4K2KA 3S17H 1N8RC 2CVRA 5M3FB 2B3GA 2KUMA 2YU9H 3PSIA 1GUOA 2I5LX 4YCUA 1QOHA 2R6GA 3GTGH 2H5XA 5C3EB 2JEBI 2WP8J 5CV8A 1BQQT 1U4PA 1ZYRD 3PF5A 1SN8A 3RZDB 5EQ0A 3MTSA 5KIXA 4ULLA 1BCPD 1OXVA 5DNFA 5CYUA 1LT6D 4C1NI 1VQHA 4ZCKA 2XRSD 2IX1A 2VUMH 1WTXA 3FPUB 3H0GG 2XN9C 1X3GA 4K0KQ 1VQKA 4OIJA 1I4GA 4HAEA 3F2BA 3K58A 2A19A 5IGCA 1YZ6A 1WD1A 2KJXA 4JI5L 4BY7G 3DMUA 4FXKC 1JWSD 3DM1A 3IRBA 4WJWA 1CI3M 5EAYA 1WOCA 2DY7A 3L2PA 4P73A 4J15A 1WTHA 2OTJA 1MIUA 2L5TA 4JG2A 1MJCA 1TS5A 3HOUG 4DV2Q 2KBNA 3CHBD 1AFPA 4GNXA 2HT1A 1LV9A 4DA2A 4N8X1 2AHOB 3K57A 2PW7A 5CV9A 3M7NA 1S5FD 3TBIB 4WJ4A 4A93G 1CKNB 3BVZA 3HOXB 1G6PA 1F9RA 1ONLA 4N9TA 5EPKA 2DNCA 2UUAL 1N33L 1UEAB 2L0CA 1OXTA 4PZ8A 2IY5B 4CJ0B 4O0AA 3K59A 1SDFA 3KF8A 1TWFB 3ND9A 5K5PA 2L11A 1B1ZA 1C9OA 4DV1Q 5ELBA 4ME3A 3F8TA 1QZHA 1STHA 1DGSA 5JPNC 3LWUA 3GTOH 3KBXA 4X65L 4ID6A 1SYGA 1JICA 2QA4A 1SYDA 2ZJRA 2HQLA 3M7GA 4JK1C 1PH2A 4NW2A 2Q2TA 2IX0A 1T9HA 1E2WA 4YCVA 2AQ1B 2EJGC 1BF4A 4UDUC 4GN3B 5IE8A 3VA7A 5CV6A 3EN2A 5ELEA 3X3MA 3HOVH 5IP9G 2JA8B 1CZWA 1N34L 1IW7C 1PFNA 1YEZA 5I6WA 4HR7B 1IKMA 4A3MB 1Y1VG 2H4OA 3AFQA 5M5YH 5LHY1 2AKWB 3GTQH 4KJOA 4K6LA 2D9UA 2ICIA 3TSSA 4CGYB 1HNXL 1PYBA 2JE6I 4EQPA 1ZYRC 3T53B 4IQZA 1F2LA 3D6WA 3KDFA 3OWEB 3KF6B 5LMNL 3GTLB 2WFWA 4ZUJA 1BCPC 1KL9A 2CH4A 2GN5A 4JYAQ 2E2HH 4DR4Q 2CKZB 1HTLD 1LTLA 1YNND 4FYDA 4OIKA 2HCCA 1WTWA 3WOEA 4NPSA 1F77A 1SEBD 3S1MH 1HNZL 4U68A 1A15A 3ULLA 4IO9A 3CCMA 3H3VI 3VYUA 1CA5A 5BN4A 1GKHA 3OSOA 5IT9L 3BZCA 4KY5A 4H02A 2WB1G 4K6DA 2VXWA 3WWVA 4JI7Q 4CKEA 1VQ8A 1EIHA 3D4DA 3R8BA 1I3QH 2JA7G 3S14H 2NYZD 4RKLA 4LAAA 2J4XA 3JAMc 4OO1I 1KABA 4I65A 4P2CB 1TVXA 1RKNA 2L1BA 1TWCH 3Q23A 2OXPA 4XYOA 2R7ZG 1P16A 1S5ED 1O7IA 4DR6L 2G9HD 1LTGD 2EY2A 4CDFC 1NJIC 2UXCQ 1TQOA 3PIO3 3C3LA 5E3FA 2G9DA 2B63H 3CAMA 4C3JH 2F52A 1YJWA 4A3IB 3J80i 2OQKA 1LUZA 1JWMD 2YU9B 3TDQA 1RODA 2N78A 1BR9A 1IHZA 1EFWA 3UDIA 2CQOA 3R2IA 3SE0A 4JI4L 4LF7L 4LF4L 3BYYB 1JQYD 1XX8A 1V43A 1YHAA 3GTPH 4B3SL 3I4MH 2F0HA 1CSQA 1Q12A 2ZXRA 3S16B 4C1NK 1PMRA 4IZ8A 1MHWC 3WOFA 4BBSB 3M4QA 1BCPF 1HCZA 4DR7Q 1PRTF 3F2CA 4G57A 4NMZA 1PZID 5IGBA 1AE3A 2VUMB 3ERSX 2HIXA 2BE5D 5EJWA 2K33A 1JOOA 2JA6H 5E7NA 5T1GA 2J7ZA 4FXGC 4HJ5A 2PI2E 5C4XB 3I91A 1Y8NB 2Q8RE 1A2UA 3R93A 3D8GA 1GUSA 5IGGA 4C3HG 1YI2A 5EBCA 1EYCA 3CCEA 1VQEA 4H7BA 1LTAD 1SFOH 1O7LA 2B8GA 2MO1A 3HEJA 3S1RH 4FNFA 4LK1C 3BZDB 1I4XA 2F0WA 2KCNA 1V1QA 1V1PB 1MGSA 5E4XA 5FO9B 1AZQA 2K5NA 4OX9Q 5M5WH 3Q22A 1B50A 3UDFA 5EBDA 2ID0A 2OF1A 5M3MB 4K8IA 1YNNC 4DAPA 2A73B 1MD2D 3PO2B 3BS1A 3VYRA 1F9SA 2FFKB 3EFXD 5BR8L 1W3SA 4QUCA 1AN8A 1WTOA 4GNXB 3GTOB 2ZM6Q 3OOCA 1TWHH 3G48A 4A3JG 2NUCA 2RHQB 1J5EL 2Z0SA 1EQTA 1CM9A 4UHVA 1XXGA 3HZXA 1R4PB 2HQEA 1IL8A 1NMFA 2JSOA 3HG9A 5BN5A 1CT1D 2XGTA 2MQHA 3KF8B 1SNMA 4WORA 3PUYA 2NWGA 4DNRB 4V0BA 1Y1WG 1EEFD 4DV0Q 1Z9FA 1BOSA 4KKTA 4ABNA 1I4PA 1PVOA 1XWEA 3AU7A 1KAAA 1LACA 5JPMC 2HIVA 2PQEA 1OO9B 4PMBA 2E2IH 4A3EH 1PH7A 1IBMQ 1P8LA 2OEOA 3L0OA 3GTQB 1QJOA 1H9JA 4LNQA 5JJLA 4DXGA 3QR8A 2CWPA 1XTDA 1BO0A 4BBRG 5FO7B 1A6XA 4FF3A 2M9VA 2K04A 1WJJA 4BS9A 2RSOA 1PZKD 2EE1A 1NMGA 3SK5A 1WI5A 1QVCA 2R92G 2UUBQ 5AJ3Q 1W6JA 2BE5C 3T1HQ 3J80L 4C2MH 4R4TA 2C9OA 3TP7A 1TS2A 3CPFA 2PNRC 3V96A 1Y69U 1PH6A 1PLFA 1ILQA 4AYBB 4MNOA 3S1NH 4OELB 2A68D 2Q2UA 4HIDA 1NTGA 4L5RC 4QQBX 2UUCQ 3S2HH 3TN2A 3KLSX 2L9HA 1VQNA 1I3QB 3PIP3 2F0VA 2QEJC 5M3FH 4RCOA 1JMCA 2IWHA 1VQ6A 2QILA 1EQVA 4IJLA 3IFTA 4FF4A 2V4DA 2LXJA 4A3GG 2CW0D 4DR1L 2UXBL 4JI2L 2R93H 1DONA 4C3JB 4X3TA 3D6CA 3RN5A 1HH2P 1U4MA 3QOJA 3BVMA 3PV0A 1EOVA 1HHVA 1O80A 4QL5A 3QWNA 1S4ZA 1VCIA 2MNAA 1IKLA 2H1EA 3EBEA 4LFCQ 1EWCA 1CKNA 4M1UB 3T1YL 1WTVA 3NBHA 3I4MB 2FJ2A 2CH4W 2N8NA 1OTCA 4AIMA 4B3RQ 1B8AA 2ZJPA 1JOQA 1LTID 1KQSA 1SE2A 1A62A 3I4NB 1X55A 3ULPA 3M4OB 3OW7A 5I2YA 2JA6B 3RZOH 3I4LA 4FVMA 4EQOA 3CPWA 1F2MA 2E76C 3JC66 3PO3G 3K5OA 2ES2A 1TS3A 1DXMA 1LT4D 3S1QB 3A0JA 1IYUA 2Y0SE 1UE6A 3HOXH 1LABA 4JBWA 1GD7A 4LJZC 4JI8L 2F0QA 4NXML 4IOCA 4LMQD 2RSNA 4LF5Q 1Q7YC 1TWFH 1L2FA 2XIWA 1D5XC 1SXTA 2UU9Q 2PI2A 3S15B 2F3VA 2KHIA 3DUZA 5D14A 5EKIA 4POGA 5IYCG 1GJXA 2IL8A 2NN6I 5DLQE 1EY7A 3VYSA 2I0QA 1TXYA 3PUVA 3HOUB 4OGQC 2VB3X 1PDQA 4B9WA 4LUZA 1TWAB 1PRTB 3I3CA 3K8AA 4XIGS 4KHZA 3E9HA 4CKBA 4HMIA 3J80E 4OONA 4P71A 1VQBA 4HSVA 4GS3A 4KMUC 4RGMA 2D0PA 2L55A 5A35A 3KF6A 5EKKA 3MAQA 4GKJQ 4KHPL 3A7AB 2A68C 3UE1A 2JA8H 1TWHB 3HOVG 2EPBA 4GOPB 3MHBA 2PZTA 3ITPA 2JK8A 3AYHB 2NZOA 5CORA 1XMOL 3T13A 4A3MH 1PH4A 3VYTA 2VNUD 4DR2L 2JP1A 3CF5A 3HOWG 1D2BA 2EXDA 1CQVA 3K80C 2XTIA 1N36Q 2E2JB 1JE5A 3GD7A 1DCZA 2CW0C 2MPMA 3N6RA 1XNRL 3CCRA 3K5LA 4DV5Q 3KYHC 5FJ8G 5I9PA 2RDGA 1Q46A 1I6VC 5T1IA 1D1IA 1DM0B 3GTLH 1RD9D 3M4PA 1B70B 3BJUA 1YITA 1KRSA 1IBKQ 4JV5Q 5M9OA 4LF8L 1K8AC 1PFMA 2KCMA 4ZQ3A 3D4RA 4KTAA 4ME5A 1HNWL 2M2LA 3TEHB 3W1BA 4GLAC 4XT1B 1SNCA 1FNUA 1Q8IA 4QIWB 1E22A 2HD3A 5HGTA 4TSSA 1FJGL 3VA5A 3L7ZC 1IYVA 1M4VA 5GAGC 3DWAA 2XWJB 3A74A 2GVBA 5CV4A 2G5DA 4DN4M 5KYLA 5LMUQ 2NZ1D 3NE5B 5FKAC 4X62Q 4OO1G 1A63A 2F0LA 4NXNQ 4G7OC 3OHXC 3A55A 5H1SE 3AMUA 4IFDH 2JA5B 2F03A 5FK9C 3MZ5A 4K5XA 4MZ9A 5C3XA 4R8NA 1PA6A 2N3SA 3S24A 5C3WA 5CBEE 2DGYA 5IP7H 3NPPA 4AH6A 4A3IH 1K9MC 3R2TA 4A3KB 4DUZQ 4LF9Q 1Q1EA 3FDTA 1JJCB 3HOYB 2NVXH 2ZJQA 3VR5A 4EVOA 3CC7A 2CHBD 3P75A 1R9TB 3S16H 2NTTA 4UY8C 3UDXA 3H91A 5FLMH 4BBSH 2R93B 1KRTA 4A3BG 2LY7A 3BYTB 3A5UA 4FO2A 1PRTD 2XNAC 4K8JA 4HTHA 4JBJA 4JOIC 1CTMA 4H13C 2I5HA 1JB3A 2N88A 5HGQA 1KXLA 3K0YA 1V1PA 3SXHA 2EZVA 3SVMA 3MA2B 2VQFL 4F88A 1SJHD 3H09A 1EOTA 1RTOA 2B8FA 3T56B 5C4XH 1G2SA 2K32A 1VMCA 1QNUA 3M85A 1QVFA 1G6ZA 1A0IA 2NVYB 4LF6L 3DEOA 3H94A 2FHTA 3K0XA 2IJ0A 3RZOB 1C4QA 3C46A 4N8FA 3PUWA 4DK6C 1VQFA 1E3PA 3OMGA 3V05A 2SDFA 4DV4L 2KHSA 1DOKA 3P1HA 2NVTB 3NBHB 3QIAA 4DV7L 4JBMA 2F0PA 2E8GA 1GUNA 2FMCA 5AFWA 3VR4A 3VDYA 5JOBA 2EYMA 3MFYA 5M3MH 2ZXPA 1S40A 5L37A 2OWOA 1XMQL 1IL2A 4IOAA 3PO2H 1T5EA 1S5DD 1I94L 5DM73 4C3HB 1K0RA 2SOBA 5LL6S 3CCSA 1JJ2A 4QIWE 1JR0D 3DWQA 4ILWA 4BWGB 1PH1A 3OWFA 1EYDA 3NELA 4J1MA 4BY1B 4K14A 5DEHA 3MXNA 3EVQA 1K83B 2Z6KC 5FLXL 3CKIB 1SNOA 4BXXG 3CRLC 2PZUA 4OEMB 2KHJA 4MN3A 2IPKD 1KDAA 1WTQA 4KI0A 1SYCA 2F1MA 3MC0B 4A3FG 3A7LA 4JI5Q 4ZUIA 2E2DC 3J7YW 2K5QA 3AFPA 2EYFA 1FR3A 2IT1A 5J39A 1HQMC 4JOIA 3J80c 3DLLA 3MEFA 3TMEA 1TU2B 3ER0A 4MTKA 4H44C 2K7VA 1QILA 2K52A 4A3EG 1B4OA 3FHWA 3DEPA 1E1OA 2QKIC 2F0OA 4DPGA 4HJAA 3BDLA 4UP7A 1NAPA 1SMYD 2WB1E 3FP9A 5JEAH 1K3RA 4A3JB 2YYZA 2AUKA 2YV5A 3ND8A 4A3DH 2UUAQ 2B2TC 1N33Q 4Q0FA 1CK1A 1VS0A 1PRTC 5F2DA 4DF7A 1HZCA 4YWKA 5J22A 2L15A 4TVAB 1TT2A 1NSNS 4X65Q 1HFNA 4RHSA 2MUYA 3PUZA 4YCWA 1KIXA 2K6AA 1PH9A 2PMZB 4GOPC 1PHJA 4V190 1CFMA 2SNMA 1EWIA 1ICWA 3PCOB 1G91A 4IJHA 3EJIA 1RF2D 4XQJA 5M3FG 1K28A 4HN7A 4TKOB 4BBRB 5LMNW 4X3UA 5EPLA 3Q0AA 5C3EG 1N34Q 1E2ZA 2N49A 1GHJA 5ELOA 2Z6KA 2UXDL 1O78A 1EIGA 1ENCA 1D1KA 3I72A 2R7DA 3A56A 1HNXQ 5DAUA 3RUZA 5BN3A 2NVXB 2EJMA 5GROA 4DU9A 2EXZA 1AE2A 2K03A 5LMNQ 4FP5D 2VS1A 3FKIG 2LS01 5A2QL 1WCMB 1XPRA 3GQBA 2CWAA 2VL6A 1VQOA 5KGUA 1XNQL 1XPUA 3I4NH 1JJGA 1C0AA 4NKLA 5FLXE 3M4OH 2RHSB 4A3GB 2EY5A 1HNZQ 2B2YC 3OMCA 5ELCA 2B2TA 2E75C 4JPBW 3S1QH 1PH3A 4OWWB 3Q6SA 1JCKB 4JI3L 4KD4A 1MBYA 1TWGB 4I7ZC 3A8KE 4R4QA 5J3BA 2WAQG 3E6ZX 2DUDA 3VR3A 4B3TL 2D5DA 4LFBL 2QW7A 1X32A 3S15H 2XSCA 1K8OA 2AWOA 1SMYC 4RAUC 3IFDA 3SR1A 4DXFA 4HIOA 4GOPA 4AQYL 4DR6Q 5CC4A 2ALYB 1FD7D 3EA6A 5E4WC 3S9WA 1CQFA 4A3CG 4ZKCB 2K75A 4EQNA 2WKCA 3HOUH 2NN6G 4PNYA 4OL7A 5CBAE 3RNUA 1EWHA 3SHLA 1TWAH 2MHVA 5C4ZA 4YHHL 5I9OA 3PO3B 4KLKA 3T51B 1C7YA 2HDLA 2NBFA 3HKZG 4JI4Q 1IBLL 4IPDA 4JCVE 4LF7Q 4LF4Q 3MFGA 4X64L 4ZK9B 1XJVA 1OXXK 3RLOA 2HHHL 4B3SQ 1N32L 1LLRD 4Z9CB 3V2TA 5HY6A 1Y8PB 2BOSA 1X3EA 1VQ5A 5IT9E 4LFAL 1SYEA 1VF7A 4K5VA 3J7ZC 1IZ6A 2PMZE 3FMCA 2JA8G 1H9KA 4DR5L 3C2PA 4ZLTF 1BBUA 2FMMA 3MXUA 3K7AH 4HJ8A 1Q81C 2ENBA 1I50B 4A3MG 3E0EA 3I4OA 1HR0L 4L5SA 2E2JH 1GHKA 2YTYA 4YY3L 5J1ZA 4B3ML 2Y0SB 1PYSB 2Q2IA 3M3YB 1STYA 1RTNA 1XTCD 2A6HD 4DV6L 1BDOA 4KN4C 3GTJB 2B2YA 2DNEA 4CBVA 1CKOA 1M1KC 5IP9H 3MXNB 1EUJA 1HZ9A 1GOZA 1UE5A 5C44B 2K5WA 4K5WA 4A3DB 4DK1A 4RA8A 1KTKA 1QNKA 4DV3L 3RR5A 2JJQA 5A2QE 3NUCA 1EIYB 3HOWB 3E5SA 5C0XH 4HMJA 5HURA 3OPOA 5C5LA 2QDLA 1ET6A 1AW7A 3D0FA 1O7YA 4XQNA 5COYA 3NK9A 3UDGA 2EIFA 5BR8Q 3KLSA 1TKWB 2EY6A 4PMCA 2EYPA 2JA5H 4C3IB 4IFDG 1K8MA 4ZAIA 1STBA 1GM5A 3TREA 4LUOA 5IYBG 3NXWA 1J5EQ 1LTBD 3SEBA 1K3BC 2XRQD 1PXUA 4TRDA 2RDFA 1GO3E 1GUWA 1TS4A 3U9SA 4GKKL 1CKMA 1B9NA 1F9QA 2ZTCA 4A3KH 3AEVA 3GTMB 1X3PA 1II3A 2WIIB 2O5JC 4NDXA 3A54A 2Z6BA 3HOYH 2QEXA 2ATWA 2EY1A 3X3NA 4IPGA 3HOZB 4DR3L 4EGVA 1GUTA 1R9TH 1OXUA 1FVIA 1U5KA 4CDDC 4JI6L
chains in the Genus database with same CATH topology
2QGQA 1J6QA 1PH2A 3U4ZA 4DV0L 2Q2TA 1E22A 2IX0A 1T9HA 4YCVA 2R7ZH 2VUMG 1VQ4A 1FJGL 1B7YB 3CXCA 1L0WA 2UXDQ 4GN3B 3STBC 3L7ZC 3W5OA 5IE8A 2PQAB 3RN2A 1QZGA 5GAGC 3EN2A 3HOVH 3A74A 4EX5A 2GVBA 2KCTA 5IP9G 3JAMi 4DR6Q 1Q8KA 4BY1G 1K73C 1IBML 1N34L 1Z47A 3AQQA 5LMUQ 1YEZA 1L1OA 1N9WA 4JI1L 4A93H 4X62Q 4OO1G 5C4XG 1X56A 1A63A 4NXNQ 2E5LL 1Y1VG 5IYDH 5H1SE 2NVYH 4GLVB 3AFQA 3DM3A 5M5YH 2F4VQ 5K36G 3TRZA 2AKWB 1KHIA 4BA2I 3F2DA 3GTQH 1BKBA 1X65A 1EIFA 4MZ9A 1PA6A 2K5HA 2OQ0A 4LW1A 2N3SA 3W1GA 1HZBA 3S24A 1HNXL 3OTOL 1PYBA 2DGYA 2JE6I 3B6YA 5IP7H 1NE3A 2ASBA 2Q2HA 4AH6A 4A3IH 1K9MC 1XNQQ 1S72A 3PIOA 5AJ3L 2UUBL 3TQYA 3KDFA 3T1HL 1EYGA 4DUZQ 3KF6B 4OWTB 2NVTH 4LF9Q 1Q1EA 5LMNL 5IY0A 1LYLA 2WFWA 4LUVA 1JJCB 1KL9A 2GN5A 1CSPA 4JYAQ 2E2HH 2NVXH 4DR4Q 4A4IA 1SROA 2CKZB 2GVAA 1LTLA 2ZJQA 5FLXc 1NY4A 2F3IA 3CC7A 1PH5A 4R4CA 3S16H 4GN5A 4UY8C 4JI3Q 5M3MG 3UDXA 2MO0A 5FLMH 4BBSH 2ZTEA 2UUCL 4NPSA 1KAWA 1KRTA 4A3BG 3S1MH 3H15A 3NENA 1HNZL 4GN4B 3ULLA 3A5UA 4IO9A 4DR1Q 3CCMA 3H3VI 4BXXH 2UXBQ 3J7A5 3HFZB 4YWLA 1YIJA 4JI2Q 1GKHA 5IWAL 2VW9A 4C3HH 4B3TQ 2K5VA 3J81i 3BZCA 4JBJA 4H02A 4JOIC 2WB1G 4A76A 1YHQA 4LFBQ 4OWXB 4A3FH 3TS0A 4R4IA 4RMFA 3WWVA 2I5HA 4JI7Q 1VQ8A 5HGQA 4AQYQ 4BY1H 2JA7G 2JEAI 1I3QH 3S14H 1KXLA 2VQFL 3Q8DA 3JAMc 4OO1I 4JI0L 2VQEL 1K83H 1JB7A 1VQGA 4UP9A 5C4XH 1TWCH 3EIVA 3U4VA 1Q86C 1HR0W 4ALPA 1Y1VH 2BH8A 3M85A 4GLXA 4XTCS 3T1YQ 1G291 5C0XI 1QVFA 3I7FA 2R7ZG 4YHHQ 4DUYL 1A0IA 4LF6L 1P16A 1O7IA 4DR6L 1V9PA 3K0XA 2R7FA 1NJIC 3CQZH 2UXCQ 1IBLQ 4JBKA 3PUWA 4X64Q 4DK6C 1YJ9A 2B63H 1VQFA 3CAMA 4C3JH 2F52A 3CCVA 3CD6A 1E3PA 4LFCL 1YJWA 2HHHQ 1N32Q 4X66L 3J80i 2OQKA 1LUZA 2YTXA 4R4OA 4DV4L 2N78A 1XPOA 4LFAQ 2NVQH 1EFWA 3NBHB 3UDIA 4DV7L 4JBMA 2CQOA 4B3RL 2E8GA 1X3FA 4JI4L 4DR5Q 4LF7L 4LF4L 4EQ5A 1V43A 3VDYA 5IT9c 1YHAA 3GTPH 2VZAA 1UWVA 3SGIA 4B3SL 5M3MH 1CSQA 1L1OB 1Q12A 4QGUA 4A3JH 4QJFA 1VQPA 2F4VL 3S2DH 1IXRA 5JJKA 5IP7G 5JEAG 1S40A 1HR0Q 2OWOA 3KOJA 4A3IG 4PMWA 1XMQL 3M4QA 1IL2A 4IOAA 3J81j 2D0OA 3PO2H 1I94L 4DR7Q 3F2CA 4PZ6A 4JI8Q 4NXMQ 4YY3Q 1AE3A 2JQOA 3ERSX 4B3MQ 2HIXA 1K0RA 3J81c 3CCSA 1JJ2A 1E1TA 3CW2C 4QIWE 2JA6H 1PH1A 2JA7H 1SMXA 5E7NA 1M90C 3KDFB 3NELA 3PUXA 4L5QA 4DV6Q 2AWNA 3GDEA 4HJ5A 5FLMG 4MTNA 1YVCA 1WCMG 2PI2E 2Z6KC 4LF5L 4BXXG 1FL0A 2K50A 2CFMA 2KHJA 4AYBG 3U58A 2D62A 3CMAA 4UPAA 1YI2A 2FXQA 2UU9L 4KI0A 4X6AH 5C3EH 5C0XJ 3ULJA 4A3FG 4JI5Q 3G6EA 3CCEA 2K14A 1VQEA 3RZDH 4TQUS 3AFPA 1SFOH 4DV3Q 3K7UC 4DNIA 2IT1A 2MO1A 4BBRH 3S1RH 1W2BA 4K0KL 4JOIA 1UE7A 4IFDI 3J80c 1Q82C 3DLLA 3I4MH 4BBSG 5GAHC 3MEFA 1S3OA 1QVGA 1YBYA 3ER0A 4HIMA 1V1QA 1VQMA 4Y52H 2K52A 3PGZA 2K5NA 4A3EG 1ASZA 4A75A 4OX9Q 3FHWA 1E1OA 5M5WH 1U0LA 1SRUA 4HJ7A 4DPGA 4HJAA 4UP7A 3UDFA 1XMOQ 2WB1E 2ID0A 3FP9A 4PZ7A 3U50C 1K3RA 4RG1A 3FKIH 1VQ9A 2YYZA 2NZHA 1HZAA 1WYDA 2B63G 4GKJL 1D7QA 2YV5A 4DV2L 4A3DH 3UE0A 1RL2A 1X6OA 4P75A 2UUAQ 1N33Q 3CCQA 3GTKH 5M5XH 1VS0A 5BR8L 1W3SA 3I56A 1VQCA 1KD1C 1XNRQ 4GNXB 2ZM6Q 4GKKQ 1HZCA 2MFIA 2LXKA 1TWHH 4YWKA 3NEMA 3G48A 2L15A 3I4MG 4A3JG 1N36L 1VQLA 1WCMH 2K4KA 2RHQB 4TVAB 3OYYA 4POFA 1PV4A 1J5EL 2AMCB 3CC2A 2OCEA 2Z0SA 4X65Q 3PO2G 3PUZA 4P74A 4YCWA 1KIXA 4DV5L 1VQAA 4LF8Q 4DR3Q 2BH2A 1PH9A 4DV1L 1HNWQ 4GOPC 1NMFA 1PHJA 3I4NG 4A3GH 2XGTA 2MQHA 3KF8B 3LGJA 1UEBA 3KFUA 4A3LG 3PUYA 4P72A 4JI6Q 2JA6G 4DAMA 1EWIA 3ZJYC 1Y1WG 3PCOB 3TS2A 4DV0Q 1Z9FA 1IBKL 2V1CC 4WJ3M 4JV5L 4IPCA 4IJHA 4JC0A 3GO5A 5M3FG 1FJGQ 5LMNW 1PVOA 4IPHA 3PIPA 4A3CH 1TWGH 4IFDJ 3M9BA 2HIVA 3PF4A 3KJPA 2E2IH 4A3EH 1PH7A 3HKSA 1IBMQ 1P8LA 5C3EG 1N34Q 2RCNA 3L0OA 2N49A 3CMEA 1PH8A 5ELOA 4JI1Q 2Y0SG 2Z6KA 4LNQA 5JJLA 2UXDL 2E5LQ 2CWPA 1CUKA 1XTDA 1UE1A 3BU2A 4BBRG 3KLWA 1AH9A 1I5FA 2R7DA 1WJJA 1HNXQ 5LMUL 3OTOQ 1NMGA 1GVPA 4X62L 1SE8A 1FGUA 1QVCA 1WI5A 2IHFA 5GROA 4NXNL 5AJ3Q 2UUBQ 4AYBE 2R92G 3T1HQ 1I6HH 1AE2A 3PO3H 2EQSA 4C2MH 4R4TA 5C44G 5LMNQ 1KC8C 2VS1A 3FKIG 3CPFA 1XPRA 4A3DG 4HJ9A 1E7ZA 2CWAA 1PH6A 1D8LA 2VL6A 4YWMA 1VQOA 4DK3C 4MNOA 3S1NH 1XNQL 1XPUA 3I4NH 1JJGA 1C0AA 1PFSA 2Q2UA 4A3LH 4HIDA 4DUZL 3M4OH 1NTGA 2RHSB 4L5RC 4LF9L 4QQBX 2UUCQ 3S2HH 4DKAC 1A8VA 4OXPA 4HIKA 1HNZQ 1Y1WH 5JJIA 2A1AA 1VQNA 4JYAL 3ICEA 4DR4L 5M3FH 5IWAQ 1JMCA 3S1QH 1NBWA 1VQ6A 1PH3A 5IYCH 3F1ZA 4OWWB 4L5TA 1X9NA 4JI3L 2A8VA 3CCJA 1I50H 4IJLA 3OW2A 2LXJA 2VQFQ 4R4QA 5J3BA 4A3GG 4DR1L 2WAQG 4JI0Q 2UXBL 2YTVA 1H95A 2VQEQ 2PNHA 4JI2L 2DUDA 4B3TL 3BZKA 4LFBL 3A5ZB 3M3YH 2R93H 2VY3A 1E24A 3S15H 1JT8A 4DUYQ 2AWOA 1HH2P 4Y7NH 3RN5A 4JI7L 4LF6Q 4GNXC 4HIOA 4GOPA 4AQYL 2CCZA 3G4SA 3I55A 3CC4A 2ALYB 3K81C 4DAYB 4A3CG 4KHPQ 3PV0A 1EOVA 2K75A 2BA0A 1QUQA 4QL5A 3GTJH 2B29A 1VCIA 2MNAA 2R92H 3HOUH 2NN6G 3EBEA 4LFCQ 1CKNA 3HOZG 3T1YL 4X66Q 3RNUA 5C44H 1TWAH 4YHHL 3I2ZA 3G71A 4DV4Q 5ELNA 2LSSA 4DR2Q 2N8NA 1OTCA 1OXSC 4KLKA 4APVA 4DV7Q 1C7YA 3D31A 4AIMA 4B3RQ 3HKZG 2UXCL 1WFQA 1B8AA 1IBLL 4JI4Q 4IPDA 4JCVE 3CP0A 4LF4Q 4LF7Q 2ZJPA 4X64L 2C35B 4UP8A 1XJVA 1OXXK 3RLOA 1ASYA 4PG3A 1KQSA 3STBD 2HHHL 1YJNA 4B3SQ 1N32L 1A62A 1Y14B 3HOWH 5HY6A 1VQ7A 1X55A 1X3EA 4O2DA 5IYBH 3ULPA 1VQ5A 4LFAL 5C0XG 5C4JH 1IZ6A 3J7ZC 1XMQQ 3RZOH 2PMZE 1EQRA 3CPWA 1I94Q 3JC66 2JA8G 3PO3G 1G51A 1LM0A 4QY7A 5FJ8H 4DR5L 2ES2A 1VQDA 3S17H 1N8RC 2B3GA 2YU9H 3PSIA 1BBUA 2I5LX 3A0JA 1K8GA 4YCUA 2Y0SE 1SLJA 1UE6A 3K7AH 4HJ8A 2JA9A 1Q81C 3HOXH 2R6GA 4C3IH 3E0EA 3I4OA 4A3MG 1HR0L 4L5SA 1IYJB 2H5XA 3GTGH 2E2JH 2JA5G 4JBWA 1GD7A 2JEBI 2YTYA 3CCUA 4DR7L 4JI8L 2WP8J 4NXML 4YY3L 4LWCA 5GADC 4IOCA 3CCLA 2IHEA 4B3ML 4LF5Q 3PF5A 1PYSB 1SN8A 1Q7YC 1SR3A 2Q2IA 1TWFH 1L2FA 2PQAA 3KJOA 3GTMH 2UU9Q 2PI2A 1OXVA 2KHIA 4POGA 5IYCG 4A3KG 2ZTDA 1VQHA 2IX1A 2NN6I 4DV6L 2VUMH 5DLQE 3H3VH 1L1OC 5GAEC 2I0QA 3HOYG 1TXYA 3PUVA 3H0GG 3HOZH 1CKOA 1M1KC 1X3GA 1MKHA 4K0KQ 4FDBA 5IP9H 3MXNB 1EUJA 1VQKA 1HZ9A 1UE5A 1VQIA 5JEAJ 3F2BA 4LUZA 2A19A 1YZ6A 3K8AA 3RLFA 2R93G 4XIGS 1YHBA 4KHZA 3E9HA 4JI5L 4BY7G 4OONA 4P71A 1VQBA 3IRBA 4GS3A 5EAYA 1WOCA 3L2PA 3RR5A 2JJQA 1BVSA 4P73A 4DV3L 4J15A 2D0PA 2OTJA 1MIUA 3KF6A 4JG2A 1EIYB 1MJCA 3HOUG 4GKJQ 4KHPL 2BA1A 2RF4A 4DV2Q 1Q1BA 2KBNA 3UE1A 2JA8H 1RIPA 1HJPA 3HOVG 4GNXA 4GOPB 3D0FA 2HT1A 3UDGA 2AHOB 2EIFA 2WAQE 4OX9L 1QUQB 2JK8A 5BR8Q 1X54A 3AYHB 2NZOA 5GQOA 3M7NA 1XMOL 4A3MH 1PH4A 3RLNA 2VNUD 1MJEA 4A93G 4WJ4A 1CKNB 4DR2L 2JA5H 1G6PA 1VQJA 3CF5A 5IYDG 4IFDG 3HOWG 2EXDA 1N36Q 3K80C 2XTIA 2OTLA 2UUAL 1GM5A 3TREA 1N33L 1JE5A 4LUOA 5IYBG 1J5EQ 3GD7A 1OXTA 2I5MX 4PZ8A 2IY5B 1XNRL 3CCRA 4DV5Q 4O0AA 3KYHC 5FJ8G 2ZM6L 1GO3E 4A3BH 1C9OA 1CKMA 1Q46A 4DV1Q 4A3KH 2ZTCA 3AEVA 4GKKL 1BBWA 4ME3A 2KENA 3GTLH 4R1JA 1YNXA 3M4PA 3F8TA 1B70B 1QZHA 1DGSA 3HOXG 2QEXA 3BJUA 3H0GH 4BA1I 3HOYH 3HKZE 1YITA 1KRSA 1IBKQ 4X65L 2ATWA 3GTOH 4JV5Q 4IPGA 4LF8L 4DR3L 1K8AC 2KCMA 2QA4A 2ZJRA 1R9TH 2HQLA 1OXUA 1FVIA 1U5KA 1HNWL 3E9IA 3TEHB 4NB3A 4BY7H 3W1BA 1EQQA 4GLAC 4JI6L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QGQ A;  1J6Q A;  1PH2 A;  3U4Z A;  4DV0 L;  2Q2T A;  1E22 A;  2IX0 A;  1T9H A;  4YCV A;  2R7Z H;  2VUM G;  1VQ4 A;  1FJG L;  1B7Y B;  3CXC A;  1L0W A;  2UXD Q;  4GN3 B;  3STB C;  3L7Z C;  3W5O A;  5IE8 A;  2PQA B;  3RN2 A;  1QZG A;  5GAG C;  3EN2 A;  3HOV H;  3A74 A;  4EX5 A;  2GVB A;  2KCT A;  5IP9 G;  3JAM i;  4DR6 Q;  1Q8K A;  4BY1 G;  1K73 C;  1IBM L;  1N34 L;  1Z47 A;  3AQQ A;  5LMU Q;  1YEZ A;  1L1O A;  1N9W A;  4JI1 L;  4A93 H;  4X62 Q;  4OO1 G;  5C4X G;  1X56 A;  1A63 A;  4NXN Q;  2E5L L;  1Y1V G;  5IYD H;  5H1S E;  2NVY H;  4GLV B;  3AFQ A;  3DM3 A;  5M5Y H;  2F4V Q;  5K36 G;  3TRZ A;  2AKW B;  1KHI A;  4BA2 I;  3F2D A;  3GTQ H;  1BKB A;  1X65 A;  1EIF A;  4MZ9 A;  1PA6 A;  2K5H A;  2OQ0 A;  4LW1 A;  2N3S A;  3W1G A;  1HZB A;  3S24 A;  1HNX L;  3OTO L;  1PYB A;  2DGY A;  2JE6 I;  3B6Y A;  5IP7 H;  1NE3 A;  2ASB A;  2Q2H A;  4AH6 A;  4A3I H;  1K9M C;  1XNQ Q;  1S72 A;  3PIO A;  5AJ3 L;  2UUB L;  3TQY A;  3KDF A;  3T1H L;  1EYG A;  4DUZ Q;  3KF6 B;  4OWT B;  2NVT H;  4LF9 Q;  1Q1E A;  5LMN L;  5IY0 A;  1LYL A;  2WFW A;  4LUV A;  1JJC B;  1KL9 A;  2GN5 A;  1CSP A;  4JYA Q;  2E2H H;  2NVX H;  4DR4 Q;  4A4I A;  1SRO A;  2CKZ B;  2GVA A;  1LTL A;  2ZJQ A;  5FLX c;  1NY4 A;  2F3I A;  3CC7 A;  1PH5 A;  4R4C A;  3S16 H;  4GN5 A;  4UY8 C;  4JI3 Q;  5M3M G;  3UDX A;  2MO0 A;  5FLM H;  4BBS H;  2ZTE A;  2UUC L;  4NPS A;  1KAW A;  1KRT A;  4A3B G;  3S1M H;  3H15 A;  3NEN A;  1HNZ L;  4GN4 B;  3ULL A;  3A5U A;  4IO9 A;  4DR1 Q;  3CCM A;  3H3V I;  4BXX H;  2UXB Q;  3J7A 5;  3HFZ B;  4YWL A;  1YIJ A;  4JI2 Q;  1GKH A;  5IWA L;  2VW9 A;  4C3H H;  4B3T Q;  2K5V A;  3J81 i;  3BZC A;  4JBJ A;  4H02 A;  4JOI C;  2WB1 G;  4A76 A;  1YHQ A;  4LFB Q;  4OWX B;  4A3F H;  3TS0 A;  4R4I A;  4RMF A;  3WWV A;  2I5H A;  4JI7 Q;  1VQ8 A;  5HGQ A;  4AQY Q;  4BY1 H;  2JA7 G;  2JEA I;  1I3Q H;  3S14 H;  1KXL A;  2VQF L;  3Q8D A;  3JAM c;  4OO1 I;  4JI0 L;  2VQE L;  1K83 H;  1JB7 A;  1VQG A;  4UP9 A;  5C4X H;  1TWC H;  3EIV A;  3U4V A;  1Q86 C;  1HR0 W;  4ALP A;  1Y1V H;  2BH8 A;  3M85 A;  4GLX A;  4XTC S;  3T1Y Q;  1G29 1;  5C0X I;  1QVF A;  3I7F A;  2R7Z G;  4YHH Q;  4DUY L;  1A0I A;  4LF6 L;  1P16 A;  1O7I A;  4DR6 L;  1V9P A;  3K0X A;  2R7F A;  1NJI C;  3CQZ H;  2UXC Q;  1IBL Q;  4JBK A;  3PUW A;  4X64 Q;  4DK6 C;  1YJ9 A;  2B63 H;  1VQF A;  3CAM A;  4C3J H;  2F52 A;  3CCV A;  3CD6 A;  1E3P A;  4LFC L;  1YJW A;  2HHH Q;  1N32 Q;  4X66 L;  3J80 i;  2OQK A;  1LUZ A;  2YTX A;  4R4O A;  4DV4 L;  2N78 A;  1XPO A;  4LFA Q;  2NVQ H;  1EFW A;  3NBH B;  3UDI A;  4DV7 L;  4JBM A;  2CQO A;  4B3R L;  2E8G A;  1X3F A;  4JI4 L;  4DR5 Q;  4LF7 L;  4LF4 L;  4EQ5 A;  1V43 A;  3VDY A;  5IT9 c;  1YHA A;  3GTP H;  2VZA A;  1UWV A;  3SGI A;  4B3S L;  5M3M H;  1CSQ A;  1L1O B;  1Q12 A;  4QGU A;  4A3J H;  4QJF A;  1VQP A;  2F4V L;  3S2D H;  1IXR A;  5JJK A;  5IP7 G;  5JEA G;  1S40 A;  1HR0 Q;  2OWO A;  3KOJ A;  4A3I G;  4PMW A;  1XMQ L;  3M4Q A;  1IL2 A;  4IOA A;  3J81 j;  2D0O A;  3PO2 H;  1I94 L;  4DR7 Q;  3F2C A;  4PZ6 A;  4JI8 Q;  4NXM Q;  4YY3 Q;  1AE3 A;  2JQO A;  3ERS X;  4B3M Q;  2HIX A;  1K0R A;  3J81 c;  3CCS A;  1JJ2 A;  1E1T A;  3CW2 C;  4QIW E;  2JA6 H;  1PH1 A;  2JA7 H;  1SMX A;  5E7N A;  1M90 C;  3KDF B;  3NEL A;  3PUX A;  4L5Q A;  4DV6 Q;  2AWN A;  3GDE A;  4HJ5 A;  5FLM G;  4MTN A;  1YVC A;  1WCM G;  2PI2 E;  2Z6K C;  4LF5 L;  4BXX G;  1FL0 A;  2K50 A;  2CFM A;  2KHJ A;  4AYB G;  3U58 A;  2D62 A;  3CMA A;  4UPA A;  1YI2 A;  2FXQ A;  2UU9 L;  4KI0 A;  4X6A H;  5C3E H;  5C0X J;  3ULJ A;  4A3F G;  4JI5 Q;  3G6E A;  3CCE A;  2K14 A;  1VQE A;  3RZD H;  4TQU S;  3AFP A;  1SFO H;  4DV3 Q;  3K7U C;  4DNI A;  2IT1 A;  2MO1 A;  4BBR H;  3S1R H;  1W2B A;  4K0K L;  4JOI A;  1UE7 A;  4IFD I;  3J80 c;  1Q82 C;  3DLL A;  3I4M H;  4BBS G;  5GAH C;  3MEF A;  1S3O A;  1QVG A;  1YBY A;  3ER0 A;  4HIM A;  1V1Q A;  1VQM A;  4Y52 H;  2K52 A;  3PGZ A;  2K5N A;  4A3E G;  1ASZ A;  4A75 A;  4OX9 Q;  3FHW A;  1E1O A;  5M5W H;  1U0L A;  1SRU A;  4HJ7 A;  4DPG A;  4HJA A;  4UP7 A;  3UDF A;  1XMO Q;  2WB1 E;  2ID0 A;  3FP9 A;  4PZ7 A;  3U50 C;  1K3R A;  4RG1 A;  3FKI H;  1VQ9 A;  2YYZ A;  2NZH A;  1HZA A;  1WYD A;  2B63 G;  4GKJ L;  1D7Q A;  2YV5 A;  4DV2 L;  4A3D H;  3UE0 A;  1RL2 A;  1X6O A;  4P75 A;  2UUA Q;  1N33 Q;  3CCQ A;  3GTK H;  5M5X H;  1VS0 A;  5BR8 L;  1W3S A;  3I56 A;  1VQC A;  1KD1 C;  1XNR Q;  4GNX B;  2ZM6 Q;  4GKK Q;  1HZC A;  2MFI A;  2LXK A;  1TWH H;  4YWK A;  3NEM A;  3G48 A;  2L15 A;  3I4M G;  4A3J G;  1N36 L;  1VQL A;  1WCM H;  2K4K A;  2RHQ B;  4TVA B;  3OYY A;  4POF A;  1PV4 A;  1J5E L;  2AMC B;  3CC2 A;  2OCE A;  2Z0S A;  4X65 Q;  3PO2 G;  3PUZ A;  4P74 A;  4YCW A;  1KIX A;  4DV5 L;  1VQA A;  4LF8 Q;  4DR3 Q;  2BH2 A;  1PH9 A;  4DV1 L;  1HNW Q;  4GOP C;  1NMF A;  1PHJ A;  3I4N G;  4A3G H;  2XGT A;  2MQH A;  3KF8 B;  3LGJ A;  1UEB A;  3KFU A;  4A3L G;  3PUY A;  4P72 A;  4JI6 Q;  2JA6 G;  4DAM A;  1EWI A;  3ZJY C;  1Y1W G;  3PCO B;  3TS2 A;  4DV0 Q;  1Z9F A;  1IBK L;  2V1C C;  4WJ3 M;  4JV5 L;  4IPC A;  4IJH A;  4JC0 A;  3GO5 A;  5M3F G;  1FJG Q;  5LMN W;  1PVO A;  4IPH A;  3PIP A;  4A3C H;  1TWG H;  4IFD J;  3M9B A;  2HIV A;  3PF4 A;  3KJP A;  2E2I H;  4A3E H;  1PH7 A;  3HKS A;  1IBM Q;  1P8L A;  5C3E G;  1N34 Q;  2RCN A;  3L0O A;  2N49 A;  3CME A;  1PH8 A;  5ELO A;  4JI1 Q;  2Y0S G;  2Z6K A;  4LNQ A;  5JJL A;  2UXD L;  2E5L Q;  2CWP A;  1CUK A;  1XTD A;  1UE1 A;  3BU2 A;  4BBR G;  3KLW A;  1AH9 A;  1I5F A;  2R7D A;  1WJJ A;  1HNX Q;  5LMU L;  3OTO Q;  1NMG A;  1GVP A;  4X62 L;  1SE8 A;  1FGU A;  1QVC A;  1WI5 A;  2IHF A;  5GRO A;  4NXN L;  5AJ3 Q;  2UUB Q;  4AYB E;  2R92 G;  3T1H Q;  1I6H H;  1AE2 A;  3PO3 H;  2EQS A;  4C2M H;  4R4T A;  5C44 G;  5LMN Q;  1KC8 C;  2VS1 A;  3FKI G;  3CPF A;  1XPR A;  4A3D G;  4HJ9 A;  1E7Z A;  2CWA A;  1PH6 A;  1D8L A;  2VL6 A;  4YWM A;  1VQO A;  4DK3 C;  4MNO A;  3S1N H;  1XNQ L;  1XPU A;  3I4N H;  1JJG A;  1C0A A;  1PFS A;  2Q2U A;  4A3L H;  4HID A;  4DUZ L;  3M4O H;  1NTG A;  2RHS B;  4L5R C;  4LF9 L;  4QQB X;  2UUC Q;  3S2H H;  4DKA C;  1A8V A;  4OXP A;  4HIK A;  1HNZ Q;  1Y1W H;  5JJI A;  2A1A A;  1VQN A;  4JYA L;  3ICE A;  4DR4 L;  5M3F H;  5IWA Q;  1JMC A;  3S1Q H;  1NBW A;  1VQ6 A;  1PH3 A;  5IYC H;  3F1Z A;  4OWW B;  4L5T A;  1X9N A;  4JI3 L;  2A8V A;  3CCJ A;  1I50 H;  4IJL A;  3OW2 A;  2LXJ A;  2VQF Q;  4R4Q A;  5J3B A;  4A3G G;  4DR1 L;  2WAQ G;  4JI0 Q;  2UXB L;  2YTV A;  1H95 A;  2VQE Q;  2PNH A;  4JI2 L;  2DUD A;  4B3T L;  3BZK A;  4LFB L;  3A5Z B;  3M3Y H;  2R93 H;  2VY3 A;  1E24 A;  3S15 H;  1JT8 A;  4DUY Q;  2AWO A;  1HH2 P;  4Y7N H;  3RN5 A;  4JI7 L;  4LF6 Q;  4GNX C;  4HIO A;  4GOP A;  4AQY L;  2CCZ A;  3G4S A;  3I55 A;  3CC4 A;  2ALY B;  3K81 C;  4DAY B;  4A3C G;  4KHP Q;  3PV0 A;  1EOV A;  2K75 A;  2BA0 A;  1QUQ A;  4QL5 A;  3GTJ H;  2B29 A;  1VCI A;  2MNA A;  2R92 H;  3HOU H;  2NN6 G;  3EBE A;  4LFC Q;  1CKN A;  3HOZ G;  3T1Y L;  4X66 Q;  3RNU A;  5C44 H;  1TWA H;  4YHH L;  3I2Z A;  3G71 A;  4DV4 Q;  5ELN A;  2LSS A;  4DR2 Q;  2N8N A;  1OTC A;  1OXS C;  4KLK A;  4APV A;  4DV7 Q;  1C7Y A;  3D31 A;  4AIM A;  4B3R Q;  3HKZ G;  2UXC L;  1WFQ A;  1B8A A;  1IBL L;  4JI4 Q;  4IPD A;  4JCV E;  3CP0 A;  4LF4 Q;  4LF7 Q;  2ZJP A;  4X64 L;  2C35 B;  4UP8 A;  1XJV A;  1OXX K;  3RLO A;  1ASY A;  4PG3 A;  1KQS A;  3STB D;  2HHH L;  1YJN A;  4B3S Q;  1N32 L;  1A62 A;  1Y14 B;  3HOW H;  5HY6 A;  1VQ7 A;  1X55 A;  1X3E A;  4O2D A;  5IYB H;  3ULP A;  1VQ5 A;  4LFA L;  5C0X G;  5C4J H;  1IZ6 A;  3J7Z C;  1XMQ Q;  3RZO H;  2PMZ E;  1EQR A;  3CPW A;  1I94 Q;  3JC6 6;  2JA8 G;  3PO3 G;  1G51 A;  1LM0 A;  4QY7 A;  5FJ8 H;  4DR5 L;  2ES2 A;  1VQD A;  3S17 H;  1N8R C;  2B3G A;  2YU9 H;  3PSI A;  1BBU A;  2I5L X;  3A0J A;  1K8G A;  4YCU A;  2Y0S E;  1SLJ A;  1UE6 A;  3K7A H;  4HJ8 A;  2JA9 A;  1Q81 C;  3HOX H;  2R6G A;  4C3I H;  3E0E A;  3I4O A;  4A3M G;  1HR0 L;  4L5S A;  1IYJ B;  2H5X A;  3GTG H;  2E2J H;  2JA5 G;  4JBW A;  1GD7 A;  2JEB I;  2YTY A;  3CCU A;  4DR7 L;  4JI8 L;  2WP8 J;  4NXM L;  4YY3 L;  4LWC A;  5GAD C;  4IOC A;  3CCL A;  2IHE A;  4B3M L;  4LF5 Q;  3PF5 A;  1PYS B;  1SN8 A;  1Q7Y C;  1SR3 A;  2Q2I A;  1TWF H;  1L2F A;  2PQA A;  3KJO A;  3GTM H;  2UU9 Q;  2PI2 A;  1OXV A;  2KHI A;  4POG A;  5IYC G;  4A3K G;  2ZTD A;  1VQH A;  2IX1 A;  2NN6 I;  4DV6 L;  2VUM H;  5DLQ E;  3H3V H;  1L1O C;  5GAE C;  2I0Q A;  3HOY G;  1TXY A;  3PUV A;  3H0G G;  3HOZ H;  1CKO A;  1M1K C;  1X3G A;  1MKH A;  4K0K Q;  4FDB A;  5IP9 H;  3MXN B;  1EUJ A;  1VQK A;  1HZ9 A;  1UE5 A;  1VQI A;  5JEA J;  3F2B A;  4LUZ A;  2A19 A;  1YZ6 A;  3K8A A;  3RLF A;  2R93 G;  4XIG S;  1YHB A;  4KHZ A;  3E9H A;  4JI5 L;  4BY7 G;  4OON A;  4P71 A;  1VQB A;  3IRB A;  4GS3 A;  5EAY A;  1WOC A;  3L2P A;  3RR5 A;  2JJQ A;  1BVS A;  4P73 A;  4DV3 L;  4J15 A;  2D0P A;  2OTJ A;  1MIU A;  3KF6 A;  4JG2 A;  1EIY B;  1MJC A;  3HOU G;  4GKJ Q;  4KHP L;  2BA1 A;  2RF4 A;  4DV2 Q;  1Q1B A;  2KBN A;  3UE1 A;  2JA8 H;  1RIP A;  1HJP A;  3HOV G;  4GNX A;  4GOP B;  3D0F A;  2HT1 A;  3UDG A;  2AHO B;  2EIF A;  2WAQ E;  4OX9 L;  1QUQ B;  2JK8 A;  5BR8 Q;  1X54 A;  3AYH B;  2NZO A;  5GQO A;  3M7N A;  1XMO L;  4A3M H;  1PH4 A;  3RLN A;  2VNU D;  1MJE A;  4A93 G;  4WJ4 A;  1CKN B;  4DR2 L;  2JA5 H;  1G6P A;  1VQJ A;  3CF5 A;  5IYD G;  4IFD G;  3HOW G;  2EXD A;  1N36 Q;  3K80 C;  2XTI A;  2OTL A;  2UUA L;  1GM5 A;  3TRE A;  1N33 L;  1JE5 A;  4LUO A;  5IYB G;  1J5E Q;  3GD7 A;  1OXT A;  2I5M X;  4PZ8 A;  2IY5 B;  1XNR L;  3CCR A;  4DV5 Q;  4O0A A;  3KYH C;  5FJ8 G;  2ZM6 L;  1GO3 E;  4A3B H;  1C9O A;  1CKM A;  1Q46 A;  4DV1 Q;  4A3K H;  2ZTC A;  3AEV A;  4GKK L;  1BBW A;  4ME3 A;  2KEN A;  3GTL H;  4R1J A;  1YNX A;  3M4P A;  3F8T A;  1B70 B;  1QZH A;  1DGS A;  3HOX G;  2QEX A;  3BJU A;  3H0G H;  4BA1 I;  3HOY H;  3HKZ E;  1YIT A;  1KRS A;  1IBK Q;  4X65 L;  2ATW A;  3GTO H;  4JV5 Q;  4IPG A;  4LF8 L;  4DR3 L;  1K8A C;  2KCM A;  2QA4 A;  2ZJR A;  1R9T H;  2HQL A;  1OXU A;  1FVI A;  1U5K A;  1HNW L;  3E9I A;  3TEH B;  4NB3 A;  4BY7 H;  3W1B A;  1EQQ A;  4GLA C;  4JI6 L; 
#chains in the Genus database with same CATH topology
 1SYB A;  1J6Q A;  1I4Q A;  4QB4 A;  3KBG A;  2R7Z H;  2VUM G;  1UNS A;  1B7Y B;  3LWE A;  1NR2 A;  3W5O A;  3C1E A;  2PQA B;  2F0M A;  4EX5 A;  5KNC A;  4DNT B;  4M8A A;  1K73 C;  3OIQ A;  4HCE A;  1Z47 A;  2HCI A;  1N9W A;  4JI1 L;  5C4X G;  1X56 A;  1HXY D;  2E5L L;  4RKB A;  5IYD H;  1UAP A;  2DN8 A;  2NVY H;  2F4V Q;  5EKL A;  1KHI A;  2MJ8 A;  1BKB A;  1X65 A;  1EIF A;  3RMH A;  2K5H A;  2OQ0 A;  4LW1 A;  3W1G A;  2JYO A;  3OTO L;  1B9M A;  3B6Y A;  2ASB A;  1S72 A;  4A3B B;  1SYF A;  3PIO A;  3TQY A;  2RQX A;  1EYG A;  1B44 D;  1BBX C;  2NVT H;  2EYO A;  4CDE C;  5IY0 A;  4LUV A;  3H0G B;  2AQ3 B;  1SRO A;  2A6H C;  2GVA A;  5FLX c;  1H9S A;  1NY4 A;  2F3I A;  1HA5 A;  2EYH A;  1PH5 A;  4R4C A;  4Q5V A;  5M3M G;  2M00 A;  5I4D A;  4BY7 B;  3H15 A;  4RGO S;  3A8I E;  3I70 A;  5LL6 X;  1STN A;  1R4Q B;  4DR1 Q;  2UXB Q;  4YWL A;  4JI2 Q;  5IWA L;  4CHT B;  4C3H H;  3J81 i;  4OWX B;  4IAL A;  1EY4 A;  4RMF A;  4R8I A;  4BY1 H;  2JEA I;  1ESR A;  1EY5 A;  5I2X A;  3Q8D A;  1ZEQ X;  4JI0 L;  2VQE L;  1K83 H;  1JB7 A;  4L63 B;  4UP9 A;  1Q86 C;  3U4V A;  2BH8 A;  4A93 B;  3PQI A;  4XTC S;  4GLX A;  3T1Y Q;  5G3L D;  2WAC A;  5K36 H;  4DUY L;  4CJ2 C;  2RA4 A;  3Q24 A;  1V9P A;  1EL0 A;  1TII D;  3CQZ H;  3IL8 A;  2F0K A;  4JBK A;  4RGT A;  4IUV A;  3BDO A;  4X66 L;  3K7A B;  2A69 D;  3I8Z A;  1X3F A;  4N9P A;  2WIN B;  4EQ5 A;  3TP5 A;  5IT9 c;  1WTP A;  3SGI A;  1UWV A;  1VQP A;  1L1O B;  2BDN A;  4A3J H;  2DJF C;  5JEA G;  3NTI A;  3J81 j;  2D0O A;  4JI8 Q;  4NXM Q;  1HFG A;  2I46 A;  2JQO A;  1X3Q A;  1E1T A;  2PCF B;  1EEI D;  1M90 C;  1CA6 A;  3VR6 A;  1C8C A;  3OIP A;  2AWN A;  3CU7 A;  5EGT A;  2KVM A;  1TR5 A;  1KNE A;  2K50 A;  3K5N A;  1STA A;  2CFM A;  1Y1V B;  3U58 A;  4AYB G;  4UPA A;  1KNA A;  2FXQ A;  2ICE C;  2O2L D;  5DM6 3;  2LMC B;  1Z6H A;  3G6E A;  2K14 A;  3KK7 A;  4TQU S;  2NB0 A;  1PTO B;  3K7U C;  4KKU A;  4K0K L;  4BBR H;  1W2B A;  1UE7 A;  1LO5 D;  4IFD I;  4MHE A;  4BBS G;  2NVQ B;  1MSG A;  1QVG A;  1YBY A;  3O13 A;  4HIM A;  1VQM A;  2A6E D;  4Y52 H;  3PGZ A;  1L0X B;  4A75 A;  1SRU A;  1F2Z A;  3T16 A;  1XMO Q;  4KK7 A;  3U50 C;  1VQ9 A;  4RG1 A;  3S2D B;  1D7Q A;  2B63 G;  2NZH A;  3RD4 A;  1EY8 A;  1BUV T;  4C3J G;  4KHV A;  4DV2 L;  1SNQ A;  1X6O A;  4P75 A;  1SJE D;  1D6E C;  2HDM A;  1ML0 D;  1V1O A;  4KN7 C;  3CCQ A;  3GTK H;  2WB1 B;  5M5X H;  1KD1 C;  3I56 A;  5C4H A;  1XNR Q;  3MEH A;  1B2T A;  3ERO A;  1Z7T A;  5KRU A;  2XVS A;  2JA7 B;  3NTK A;  3TZU A;  1JWU D;  3I4M G;  1VQL A;  1WCM H;  1RDP D;  1W6K A;  2ZT9 C;  4E6I A;  1PV4 A;  3I90 A;  4POF A;  2AMC B;  4LF8 Q;  1VQA A;  4RFB A;  2BH2 A;  2PO4 A;  2EYJ A;  2R7Z B;  3CRK C;  4WFN 3;  4DV1 L;  1HNW Q;  3I4N G;  4A3G H;  1A3T A;  3KFU A;  1QE6 A;  1QG7 A;  1UEB A;  2JA6 G;  1NNX A;  4DAM A;  3BDC A;  3ZJY C;  1QWY A;  3TS2 A;  4WJ3 M;  1DYQ A;  2V1C C;  2K1B A;  2TMP A;  4IPC A;  1E2V A;  5FO8 B;  4JC0 A;  3GO5 A;  1DOL A;  3J81 L;  1FJG Q;  3NQI A;  4IPH A;  3PIP A;  1H9R A;  2F0T A;  1TWG H;  1EU3 A;  4IFD J;  1BNZ A;  3HKS A;  2A69 C;  4R9W A;  2RCN A;  3CME A;  2JXM B;  1PH8 A;  4FXD A;  2X6L A;  2N55 A;  5CV5 A;  3HGB A;  3FKI B;  1CUK A;  5CGK A;  3H3V C;  4XQQ A;  3P20 A;  1EZ8 A;  1AH9 A;  2F0S A;  2EDG A;  1FYC A;  1KDB A;  5KNB A;  1GVP A;  5KYI A;  5IOD A;  1SE8 A;  5ISR A;  2R3Z A;  4ZYS A;  1I6H H;  4KJN A;  3PO3 H;  2EQS A;  2L4N A;  4ODG A;  3AB9 A;  1FNV A;  4XDX A;  4HJ9 A;  2X6G A;  1D8L A;  4YWM A;  2Z4I A;  4DK3 C;  2L12 A;  1LT5 D;  2K28 A;  2IX3 A;  5E1F A;  1PFS A;  3DWP A;  4A3L H;  3C1F A;  3DHQ A;  4MIU A;  2WAQ B;  5C5M A;  4DKA C;  1A8V A;  1HQR D;  2F0J A;  4OXP A;  4HIK A;  5JJI A;  2KEC A;  5CMD A;  4JYA L;  4DR4 L;  1G8Z D;  3NWT A;  4O42 A;  4QF4 A;  3UI2 A;  5IYC H;  3F1Z A;  4L5T A;  4KV6 A;  1ZXT A;  2A8V A;  3CCJ A;  1H9S B;  1I50 H;  5G3L F;  1PTO D;  4DFA A;  3OW2 A;  3D3R A;  2VQF Q;  1SNP A;  2QF7 A;  2MP1 A;  1H95 A;  1A3U A;  2B2U C;  4RH6 A;  2PNH A;  2PZW A;  3J7A F;  3CQZ B;  2A6E C;  3BZK A;  3M3Y H;  5NUC A;  1E24 A;  4Y7N H;  1E0B A;  4JI7 L;  4LF6 Q;  3HKZ B;  1K0S A;  5KEE A;  3I55 A;  4DAY B;  3GTJ H;  2BA0 A;  1JE4 A;  4HSP A;  3DXJ C;  4CJ1 B;  5JVG 3;  4KY6 A;  1LTS D;  4QCL A;  5C44 H;  3NHH A;  4DV4 Q;  5ELN A;  2LSS A;  4DK0 A;  4APV A;  4DV7 Q;  2UXC L;  3CP0 A;  4G4K A;  4RHR A;  1D5Z C;  2C35 B;  4JW0 A;  1ASY A;  4PG3 A;  3STB D;  1EZ6 A;  1YJN A;  1ENF A;  1HUM A;  1I4H A;  1Y14 B;  4DAV A;  3HOW H;  2LFN A;  2B2W C;  2MGS A;  1KDC A;  2RCF A;  5C0X G;  5C4J H;  1RJT A;  3LX0 A;  1XMQ Q;  1TY0 A;  1A2T A;  2AUJ D;  4B08 A;  1EQR A;  1Y1W B;  4IUT A;  3T4A C;  1I94 Q;  3TP6 A;  1GXD C;  1LM0 A;  4QY7 A;  5FJ8 H;  5IGF A;  1VQD A;  4ZRZ A;  2O5I C;  1K8G A;  1U9R A;  2F0U A;  5EPJ A;  1SLJ A;  2ZXO A;  2JA9 A;  5TSS A;  4C3I H;  3J81 E;  1IYJ B;  4IUU A;  2JA5 G;  3CCU A;  4DR7 L;  3KLR A;  4LWC A;  5GAD C;  1V8Q A;  3CCL A;  2IHE A;  1D5M C;  1SR3 A;  4K2L A;  4JVZ A;  2PQA A;  3KJO A;  4XXE A;  3GTM H;  2NTS A;  5IIF A;  2RVL A;  4A3K G;  2IW3 A;  2ZTD A;  3K5M A;  1PZJ D;  3H3V H;  1L1O C;  5GAE C;  3HOY G;  3HOZ H;  2R92 B;  5IOC A;  3W2D A;  1MKH A;  2Z8L A;  4FDB A;  1VQI A;  3FRP B;  5JEA J;  4HCS A;  4IUP A;  3RLF A;  2R93 G;  1YHB A;  3P7J A;  4OO1 H;  1LTR D;  1BVS A;  4IUR A;  1VMP A;  1LT3 D;  2B2U A;  3GTK B;  3ERQ A;  5M5X B;  2WV6 D;  2R61 A;  2BA1 A;  2RF4 A;  2B39 A;  1Q1B A;  3BVG A;  1AP0 A;  1RIP A;  2EJF C;  1HJP A;  1QCB D;  1NCV A;  2WAQ E;  4OX9 L;  1QUQ B;  3S17 B;  1X54 A;  5GQO A;  4F7X A;  3RLN A;  1MJE A;  1VQJ A;  5IYD G;  2Q8I B;  3GTG B;  2XWB B;  2OTL A;  1PTO C;  2F3W A;  2I5M X;  4IUQ A;  2A74 C;  2ZM6 L;  4A3B H;  1YNJ D;  1BBW A;  2KEN A;  2B2W A;  2Z4H A;  1YNX A;  4R1J A;  3TP8 A;  2KCC A;  4J6H A;  3HOX G;  3H0G H;  4BA1 I;  3HKZ E;  4IN3 A;  1Q90 A;  2EYL A;  2KOL A;  3L9A X;  3U9O A;  3E9I A;  2DJG C;  4NB3 A;  4BY7 H;  1EQQ A;  4L6T B;  2QGQ A;  5IGE A;  4J8Q A;  1S5C D;  3U4Z A;  4DV0 L;  4FF2 A;  4ZKB B;  1VQ4 A;  4RGN A;  3CXC A;  1L0W A;  2UXD Q;  1VF5 C;  3BG3 A;  3STB C;  1HRJ A;  3RN2 A;  1QZG A;  1CHP D;  3ONA B;  1I6H B;  2KCT A;  5JVH 3;  3JAM i;  1Q8K A;  2KEE A;  4BY1 G;  1IBM L;  1JOR A;  1QB5 D;  3AQQ A;  5I6Y A;  1L1O A;  2KED A;  4A93 H;  5D3D A;  4GLV B;  2EVB A;  2EOT A;  3DM3 A;  3GV3 A;  5IGD A;  5K36 G;  3IAY A;  3TRZ A;  4BA2 I;  3F2D A;  1B3Q A;  4CKC A;  1HZB A;  3KUP A;  4I7A A;  1NE3 A;  4CDC C;  2Q2H A;  3E3X A;  1XNQ Q;  2KQ3 A;  5AJ3 L;  2UUB L;  3T1H L;  4OWT B;  1J8I A;  1PTO F;  1LYL A;  3NP8 A;  1JC7 A;  1RCV D;  1CSP A;  1H9M A;  3D4W A;  4A4I A;  1STE A;  2SNS A;  3QOL A;  1A3V A;  2K05 A;  4IUN A;  1XYI A;  1MSH A;  2RKS A;  3NWS A;  4GN5 A;  1HA6 A;  4JI3 Q;  2MO0 A;  1ENA A;  2ZTE A;  2UUC L;  1KAW A;  1L0Y B;  3IKJ A;  3MXG A;  1U4R A;  3NEN A;  4C56 C;  4Y7N B;  4GN4 B;  4BXX H;  3H6M A;  2B2V C;  3J7A 5;  2A5H A;  3HFZ B;  1YIJ A;  2TSS A;  2VW9 A;  4B3T Q;  2K5V A;  2K01 A;  1YHQ A;  4A76 A;  4LFB Q;  3VR2 A;  2E74 C;  5ELF A;  4A3F H;  1SE3 A;  3TS0 A;  4R4I A;  1Y8O B;  4AQY Q;  2RDH A;  3HOV B;  3NTH A;  1KLU D;  1VQG A;  4FF1 A;  3EIV A;  1HR0 W;  4ALP A;  1Y1V H;  1G29 1;  5C0X I;  3I7F A;  4YHH Q;  5M5Y B;  3FEW X;  2R7F A;  5C4J B;  1IBL Q;  1YJ9 A;  3N52 A;  2JN4 A;  4X64 Q;  3CD6 A;  1PTO H;  3CCV A;  4LFC L;  2HHH Q;  1N32 Q;  3QG1 A;  3G6J B;  2F0D A;  3G7L A;  2YTX A;  1ESF A;  4R4O A;  1XPO A;  4LFA Q;  1YNJ C;  2NVQ H;  4OHJ A;  1PYW D;  4QMG A;  4B3R L;  1B3A A;  4DR5 Q;  2E2H B;  3HRZ C;  3I73 A;  2VZA A;  5CV7 A;  4XYQ A;  3S2D H;  4QGU A;  4QJF A;  2Z1C A;  2F4V L;  5JJK A;  1IXR A;  2F0F A;  5IP7 G;  1HR0 Q;  1F2Y A;  3KOJ A;  4A3I G;  4PMW A;  2VB2 X;  5FOB B;  3S1M B;  2F0N A;  4PZ6 A;  4YY3 Q;  4U67 3;  4B3M Q;  1ICF B;  3J81 c;  1WTR A;  1I4R A;  3CW2 C;  1WVL A;  2JA7 H;  1SMX A;  3PMF A;  3KDF B;  3S14 B;  2HUG A;  3HP3 A;  3PUX A;  4L5Q A;  5CR3 A;  3GDE A;  3GV6 A;  4DV6 Q;  5FLM G;  4MTN A;  1HPC A;  1WCM G;  1YVC A;  3M4Y A;  4PV1 C;  4LF5 L;  3NQT A;  1TWC B;  1FGB D;  1FL0 A;  3TZD A;  3LNN A;  1SSO A;  1O7Z A;  1SAP A;  2D62 A;  3SDZ A;  2F0I A;  3CMA A;  2UU9 L;  4X6A H;  2AQ2 B;  5C3E H;  5C0X J;  1EY9 A;  3ULJ A;  5JJZ A;  4KD3 A;  3RZD H;  4DV3 Q;  1S5B D;  1STG A;  2B2V A;  2B63 B;  4DNI A;  1Q82 C;  1EY0 A;  1FNW A;  5GAH C;  1S3O A;  5JAV A;  1B53 A;  2PYK A;  3JAM L;  3HS0 C;  1ASZ A;  3MXP A;  1UUP A;  1U0L A;  4HJ7 A;  2P5Z X;  3GTP B;  4PZ7 A;  3FKI H;  4PQX A;  1HZA A;  1WYD A;  4GKJ L;  4KY7 A;  2WKD A;  3UE0 A;  1RL2 A;  4YIJ A;  1RHP A;  4XT3 B;  2F0E A;  2Q8T A;  1VQC A;  1AZP A;  1Q3L A;  2SEB D;  4GKK Q;  3QO2 A;  2MFI A;  1NUC A;  2LXK A;  4UAI A;  3NEM A;  1N36 L;  3QJY A;  2K4K A;  4S3S A;  3OYY A;  2RBM A;  3CC2 A;  2OCE A;  3W3A A;  3PO2 G;  4P74 A;  1TY2 A;  3WDN A;  4DV5 L;  4DR3 Q;  1DOM A;  1PFB A;  1VDZ A;  4L8J A;  1C48 A;  2KA7 A;  4X3S A;  4DAY A;  4GZY C;  4A3L G;  3LGJ A;  3J7A V;  3E0J A;  4H0L C;  4P72 A;  4JI6 Q;  4B9X A;  3NBI A;  4F87 A;  1BXT A;  2GA4 B;  1IBK L;  4JV5 L;  4G7H C;  1SFO B;  5KND A;  4RCN A;  3SK4 A;  3S1R B;  2I07 B;  3QB3 A;  4A3C H;  1MI2 A;  3SK8 A;  3M9B A;  3PF4 A;  3KJP A;  2NN6 H;  5ELD A;  1J9O A;  1JOK A;  2BDO A;  4O1N A;  2Z9H A;  5M5W B;  1BCP B;  5D3I B;  4JI1 Q;  2Y0S G;  1DZ1 A;  2E5L Q;  1EU4 A;  1ET9 A;  1UE1 A;  3BU2 A;  3KLW A;  1I5F A;  1SE4 A;  2PPB C;  2X69 A;  5LMU L;  3OTO Q;  3FPP A;  4X62 L;  1FGU A;  2IHF A;  4NP5 A;  4NXN L;  2LKV A;  4HED A;  4AYB E;  5D65 A;  5C44 G;  1KC8 C;  1HUN A;  4WRD A;  2F0G A;  4A3D G;  1E7Z A;  2K5D A;  1SND A;  3URY A;  4DGZ A;  1DJR D;  4DUZ L;  4A3F B;  4LF9 L;  3MWY W;  4G7Z C;  1EY6 A;  1Y1W H;  2A1A A;  2FIN B;  3ICE A;  3K6O A;  5IWA Q;  1SBB B;  1NBW A;  1AEX A;  2BCO A;  1X9N A;  4KKS A;  2C5C A;  4C3I G;  2J0T D;  2E2I B;  1DD2 A;  4A3E B;  3L3O C;  4JI0 Q;  2YTV A;  2F4I A;  3A8J E;  2VQE Q;  3NSW A;  1NR4 A;  1LTT D;  3JAM E;  3A5Z B;  2PW5 A;  3EQL C;  2VY3 A;  1JT8 A;  1HTP A;  4DUY Q;  3SK6 A;  1CZG A;  1M8A A;  3FVQ A;  4GNX C;  3CC4 A;  1F9P A;  2CCZ A;  3G4S A;  4KHP Q;  3K81 C;  3F2U A;  1ILP A;  1QUQ A;  2B29 A;  2O4X A;  1KLG D;  3MVV A;  2QDB A;  1ZKO A;  1G2T A;  2R92 H;  3R3O A;  3HOZ G;  4X66 Q;  2OT2 A;  3I2Z A;  2D2C C;  5C6A A;  3G71 A;  2DY8 A;  4C2M B;  1U4L A;  4DR2 Q;  1OXS C;  3ZYY X;  4F8M A;  1T5X D;  3D31 A;  1WFQ A;  4RWS C;  2CQA A;  4UP8 A;  1CHQ D;  4QUF A;  1WD0 A;  3S1N B;  1EYA A;  2QCP X;  1VQ7 A;  4O2D A;  5IYB H;  3S2H B;  1GUG A;  1IW7 D;  4X3K A;  1EFI D;  1G51 A;  3GP7 A;  4K2K A;  3S17 H;  1N8R C;  2CVR A;  5M3F B;  2B3G A;  2KUM A;  2YU9 H;  3PSI A;  1GUO A;  2I5L X;  4YCU A;  1QOH A;  2R6G A;  3GTG H;  2H5X A;  5C3E B;  2JEB I;  2WP8 J;  5CV8 A;  1BQQ T;  1U4P A;  1ZYR D;  3PF5 A;  1SN8 A;  3RZD B;  5EQ0 A;  3MTS A;  5KIX A;  4ULL A;  1BCP D;  1OXV A;  5DNF A;  5CYU A;  1LT6 D;  4C1N I;  1VQH A;  4ZCK A;  2XRS D;  2IX1 A;  2VUM H;  1WTX A;  3FPU B;  3H0G G;  2XN9 C;  1X3G A;  4K0K Q;  1VQK A;  4OIJ A;  1I4G A;  4HAE A;  3F2B A;  3K58 A;  2A19 A;  5IGC A;  1YZ6 A;  1WD1 A;  2KJX A;  4JI5 L;  4BY7 G;  3DMU A;  4FXK C;  1JWS D;  3DM1 A;  3IRB A;  4WJW A;  1CI3 M;  5EAY A;  1WOC A;  2DY7 A;  3L2P A;  4P73 A;  4J15 A;  1WTH A;  2OTJ A;  1MIU A;  2L5T A;  4JG2 A;  1MJC A;  1TS5 A;  3HOU G;  4DV2 Q;  2KBN A;  3CHB D;  1AFP A;  4GNX A;  2HT1 A;  1LV9 A;  4DA2 A;  4N8X 1;  2AHO B;  3K57 A;  2PW7 A;  5CV9 A;  3M7N A;  1S5F D;  3TBI B;  4WJ4 A;  4A93 G;  1CKN B;  3BVZ A;  3HOX B;  1G6P A;  1F9R A;  1ONL A;  4N9T A;  5EPK A;  2DNC A;  2UUA L;  1N33 L;  1UEA B;  2L0C A;  1OXT A;  4PZ8 A;  2IY5 B;  4CJ0 B;  4O0A A;  3K59 A;  1SDF A;  3KF8 A;  1TWF B;  3ND9 A;  5K5P A;  2L11 A;  1B1Z A;  1C9O A;  4DV1 Q;  5ELB A;  4ME3 A;  3F8T A;  1QZH A;  1STH A;  1DGS A;  5JPN C;  3LWU A;  3GTO H;  3KBX A;  4X65 L;  4ID6 A;  1SYG A;  1JIC A;  2QA4 A;  1SYD A;  2ZJR A;  2HQL A;  3M7G A;  4JK1 C;  1PH2 A;  4NW2 A;  2Q2T A;  2IX0 A;  1T9H A;  1E2W A;  4YCV A;  2AQ1 B;  2EJG C;  1BF4 A;  4UDU C;  4GN3 B;  5IE8 A;  3VA7 A;  5CV6 A;  3EN2 A;  5ELE A;  3X3M A;  3HOV H;  5IP9 G;  2JA8 B;  1CZW A;  1N34 L;  1IW7 C;  1PFN A;  1YEZ A;  5I6W A;  4HR7 B;  1IKM A;  4A3M B;  1Y1V G;  2H4O A;  3AFQ A;  5M5Y H;  5LHY 1;  2AKW B;  3GTQ H;  4KJO A;  4K6L A;  2D9U A;  2ICI A;  3TSS A;  4CGY B;  1HNX L;  1PYB A;  2JE6 I;  4EQP A;  1ZYR C;  3T53 B;  4IQZ A;  1F2L A;  3D6W A;  3KDF A;  3OWE B;  3KF6 B;  5LMN L;  3GTL B;  2WFW A;  4ZUJ A;  1BCP C;  1KL9 A;  2CH4 A;  2GN5 A;  4JYA Q;  2E2H H;  4DR4 Q;  2CKZ B;  1HTL D;  1LTL A;  1YNN D;  4FYD A;  4OIK A;  2HCC A;  1WTW A;  3WOE A;  4NPS A;  1F77 A;  1SEB D;  3S1M H;  1HNZ L;  4U68 A;  1A15 A;  3ULL A;  4IO9 A;  3CCM A;  3H3V I;  3VYU A;  1CA5 A;  5BN4 A;  1GKH A;  3OSO A;  5IT9 L;  3BZC A;  4KY5 A;  4H02 A;  2WB1 G;  4K6D A;  2VXW A;  3WWV A;  4JI7 Q;  4CKE A;  1VQ8 A;  1EIH A;  3D4D A;  3R8B A;  1I3Q H;  2JA7 G;  3S14 H;  2NYZ D;  4RKL A;  4LAA A;  2J4X A;  3JAM c;  4OO1 I;  1KAB A;  4I65 A;  4P2C B;  1TVX A;  1RKN A;  2L1B A;  1TWC H;  3Q23 A;  2OXP A;  4XYO A;  2R7Z G;  1P16 A;  1S5E D;  1O7I A;  4DR6 L;  2G9H D;  1LTG D;  2EY2 A;  4CDF C;  1NJI C;  2UXC Q;  1TQO A;  3PIO 3;  3C3L A;  5E3F A;  2G9D A;  2B63 H;  3CAM A;  4C3J H;  2F52 A;  1YJW A;  4A3I B;  3J80 i;  2OQK A;  1LUZ A;  1JWM D;  2YU9 B;  3TDQ A;  1ROD A;  2N78 A;  1BR9 A;  1IHZ A;  1EFW A;  3UDI A;  2CQO A;  3R2I A;  3SE0 A;  4JI4 L;  4LF7 L;  4LF4 L;  3BYY B;  1JQY D;  1XX8 A;  1V43 A;  1YHA A;  3GTP H;  4B3S L;  3I4M H;  2F0H A;  1CSQ A;  1Q12 A;  2ZXR A;  3S16 B;  4C1N K;  1PMR A;  4IZ8 A;  1MHW C;  3WOF A;  4BBS B;  3M4Q A;  1BCP F;  1HCZ A;  4DR7 Q;  1PRT F;  3F2C A;  4G57 A;  4NMZ A;  1PZI D;  5IGB A;  1AE3 A;  2VUM B;  3ERS X;  2HIX A;  2BE5 D;  5EJW A;  2K33 A;  1JOO A;  2JA6 H;  5E7N A;  5T1G A;  2J7Z A;  4FXG C;  4HJ5 A;  2PI2 E;  5C4X B;  3I91 A;  1Y8N B;  2Q8R E;  1A2U A;  3R93 A;  3D8G A;  1GUS A;  5IGG A;  4C3H G;  1YI2 A;  5EBC A;  1EYC A;  3CCE A;  1VQE A;  4H7B A;  1LTA D;  1SFO H;  1O7L A;  2B8G A;  2MO1 A;  3HEJ A;  3S1R H;  4FNF A;  4LK1 C;  3BZD B;  1I4X A;  2F0W A;  2KCN A;  1V1Q A;  1V1P B;  1MGS A;  5E4X A;  5FO9 B;  1AZQ A;  2K5N A;  4OX9 Q;  5M5W H;  3Q22 A;  1B50 A;  3UDF A;  5EBD A;  2ID0 A;  2OF1 A;  5M3M B;  4K8I A;  1YNN C;  4DAP A;  2A73 B;  1MD2 D;  3PO2 B;  3BS1 A;  3VYR A;  1F9S A;  2FFK B;  3EFX D;  5BR8 L;  1W3S A;  4QUC A;  1AN8 A;  1WTO A;  4GNX B;  3GTO B;  2ZM6 Q;  3OOC A;  1TWH H;  3G48 A;  4A3J G;  2NUC A;  2RHQ B;  1J5E L;  2Z0S A;  1EQT A;  1CM9 A;  4UHV A;  1XXG A;  3HZX A;  1R4P B;  2HQE A;  1IL8 A;  1NMF A;  2JSO A;  3HG9 A;  5BN5 A;  1CT1 D;  2XGT A;  2MQH A;  3KF8 B;  1SNM A;  4WOR A;  3PUY A;  2NWG A;  4DNR B;  4V0B A;  1Y1W G;  1EEF D;  4DV0 Q;  1Z9F A;  1BOS A;  4KKT A;  4ABN A;  1I4P A;  1PVO A;  1XWE A;  3AU7 A;  1KAA A;  1LAC A;  5JPM C;  2HIV A;  2PQE A;  1OO9 B;  4PMB A;  2E2I H;  4A3E H;  1PH7 A;  1IBM Q;  1P8L A;  2OEO A;  3L0O A;  3GTQ B;  1QJO A;  1H9J A;  4LNQ A;  5JJL A;  4DXG A;  3QR8 A;  2CWP A;  1XTD A;  1BO0 A;  4BBR G;  5FO7 B;  1A6X A;  4FF3 A;  2M9V A;  2K04 A;  1WJJ A;  4BS9 A;  2RSO A;  1PZK D;  2EE1 A;  1NMG A;  3SK5 A;  1WI5 A;  1QVC A;  2R92 G;  2UUB Q;  5AJ3 Q;  1W6J A;  2BE5 C;  3T1H Q;  3J80 L;  4C2M H;  4R4T A;  2C9O A;  3TP7 A;  1TS2 A;  3CPF A;  2PNR C;  3V96 A;  1Y69 U;  1PH6 A;  1PLF A;  1ILQ A;  4AYB B;  4MNO A;  3S1N H;  4OEL B;  2A68 D;  2Q2U A;  4HID A;  1NTG A;  4L5R C;  4QQB X;  2UUC Q;  3S2H H;  3TN2 A;  3KLS X;  2L9H A;  1VQN A;  1I3Q B;  3PIP 3;  2F0V A;  2QEJ C;  5M3F H;  4RCO A;  1JMC A;  2IWH A;  1VQ6 A;  2QIL A;  1EQV A;  4IJL A;  3IFT A;  4FF4 A;  2V4D A;  2LXJ A;  4A3G G;  2CW0 D;  4DR1 L;  2UXB L;  4JI2 L;  2R93 H;  1DON A;  4C3J B;  4X3T A;  3D6C A;  3RN5 A;  1HH2 P;  1U4M A;  3QOJ A;  3BVM A;  3PV0 A;  1EOV A;  1HHV A;  1O80 A;  4QL5 A;  3QWN A;  1S4Z A;  1VCI A;  2MNA A;  1IKL A;  2H1E A;  3EBE A;  4LFC Q;  1EWC A;  1CKN A;  4M1U B;  3T1Y L;  1WTV A;  3NBH A;  3I4M B;  2FJ2 A;  2CH4 W;  2N8N A;  1OTC A;  4AIM A;  4B3R Q;  1B8A A;  2ZJP A;  1JOQ A;  1LTI D;  1KQS A;  1SE2 A;  1A62 A;  3I4N B;  1X55 A;  3ULP A;  3M4O B;  3OW7 A;  5I2Y A;  2JA6 B;  3RZO H;  3I4L A;  4FVM A;  4EQO A;  3CPW A;  1F2M A;  2E76 C;  3JC6 6;  3PO3 G;  3K5O A;  2ES2 A;  1TS3 A;  1DXM A;  1LT4 D;  3S1Q B;  3A0J A;  1IYU A;  2Y0S E;  1UE6 A;  3HOX H;  1LAB A;  4JBW A;  1GD7 A;  4LJZ C;  4JI8 L;  2F0Q A;  4NXM L;  4IOC A;  4LMQ D;  2RSN A;  4LF5 Q;  1Q7Y C;  1TWF H;  1L2F A;  2XIW A;  1D5X C;  1SXT A;  2UU9 Q;  2PI2 A;  3S15 B;  2F3V A;  2KHI A;  3DUZ A;  5D14 A;  5EKI A;  4POG A;  5IYC G;  1GJX A;  2IL8 A;  2NN6 I;  5DLQ E;  1EY7 A;  3VYS A;  2I0Q A;  1TXY A;  3PUV A;  3HOU B;  4OGQ C;  2VB3 X;  1PDQ A;  4B9W A;  4LUZ A;  1TWA B;  1PRT B;  3I3C A;  3K8A A;  4XIG S;  4KHZ A;  3E9H A;  4CKB A;  4HMI A;  3J80 E;  4OON A;  4P71 A;  1VQB A;  4HSV A;  4GS3 A;  4KMU C;  4RGM A;  2D0P A;  2L55 A;  5A35 A;  3KF6 A;  5EKK A;  3MAQ A;  4GKJ Q;  4KHP L;  3A7A B;  2A68 C;  3UE1 A;  2JA8 H;  1TWH B;  3HOV G;  2EPB A;  4GOP B;  3MHB A;  2PZT A;  3ITP A;  2JK8 A;  3AYH B;  2NZO A;  5COR A;  1XMO L;  3T13 A;  4A3M H;  1PH4 A;  3VYT A;  2VNU D;  4DR2 L;  2JP1 A;  3CF5 A;  3HOW G;  1D2B A;  2EXD A;  1CQV A;  3K80 C;  2XTI A;  1N36 Q;  2E2J B;  1JE5 A;  3GD7 A;  1DCZ A;  2CW0 C;  2MPM A;  3N6R A;  1XNR L;  3CCR A;  3K5L A;  4DV5 Q;  3KYH C;  5FJ8 G;  5I9P A;  2RDG A;  1Q46 A;  1I6V C;  5T1I A;  1D1I A;  1DM0 B;  3GTL H;  1RD9 D;  3M4P A;  1B70 B;  3BJU A;  1YIT A;  1KRS A;  1IBK Q;  4JV5 Q;  5M9O A;  4LF8 L;  1K8A C;  1PFM A;  2KCM A;  4ZQ3 A;  3D4R A;  4KTA A;  4ME5 A;  1HNW L;  2M2L A;  3TEH B;  3W1B A;  4GLA C;  4XT1 B;  1SNC A;  1FNU A;  1Q8I A;  4QIW B;  1E22 A;  2HD3 A;  5HGT A;  4TSS A;  1FJG L;  3VA5 A;  3L7Z C;  1IYV A;  1M4V A;  5GAG C;  3DWA A;  2XWJ B;  3A74 A;  2GVB A;  5CV4 A;  2G5D A;  4DN4 M;  5KYL A;  5LMU Q;  2NZ1 D;  3NE5 B;  5FKA C;  4X62 Q;  4OO1 G;  1A63 A;  2F0L A;  4NXN Q;  4G7O C;  3OHX C;  3A55 A;  5H1S E;  3AMU A;  4IFD H;  2JA5 B;  2F03 A;  5FK9 C;  3MZ5 A;  4K5X A;  4MZ9 A;  5C3X A;  4R8N A;  1PA6 A;  2N3S A;  3S24 A;  5C3W A;  5CBE E;  2DGY A;  5IP7 H;  3NPP A;  4AH6 A;  4A3I H;  1K9M C;  3R2T A;  4A3K B;  4DUZ Q;  4LF9 Q;  1Q1E A;  3FDT A;  1JJC B;  3HOY B;  2NVX H;  2ZJQ A;  3VR5 A;  4EVO A;  3CC7 A;  2CHB D;  3P75 A;  1R9T B;  3S16 H;  2NTT A;  4UY8 C;  3UDX A;  3H91 A;  5FLM H;  4BBS H;  2R93 B;  1KRT A;  4A3B G;  2LY7 A;  3BYT B;  3A5U A;  4FO2 A;  1PRT D;  2XNA C;  4K8J A;  4HTH A;  4JBJ A;  4JOI C;  1CTM A;  4H13 C;  2I5H A;  1JB3 A;  2N88 A;  5HGQ A;  1KXL A;  3K0Y A;  1V1P A;  3SXH A;  2EZV A;  3SVM A;  3MA2 B;  2VQF L;  4F88 A;  1SJH D;  3H09 A;  1EOT A;  1RTO A;  2B8F A;  3T56 B;  5C4X H;  1G2S A;  2K32 A;  1VMC A;  1QNU A;  3M85 A;  1QVF A;  1G6Z A;  1A0I A;  2NVY B;  4LF6 L;  3DEO A;  3H94 A;  2FHT A;  3K0X A;  2IJ0 A;  3RZO B;  1C4Q A;  3C46 A;  4N8F A;  3PUW A;  4DK6 C;  1VQF A;  1E3P A;  3OMG A;  3V05 A;  2SDF A;  4DV4 L;  2KHS A;  1DOK A;  3P1H A;  2NVT B;  3NBH B;  3QIA A;  4DV7 L;  4JBM A;  2F0P A;  2E8G A;  1GUN A;  2FMC A;  5AFW A;  3VR4 A;  3VDY A;  5JOB A;  2EYM A;  3MFY A;  5M3M H;  2ZXP A;  1S40 A;  5L37 A;  2OWO A;  1XMQ L;  1IL2 A;  4IOA A;  3PO2 H;  1T5E A;  1S5D D;  1I94 L;  5DM7 3;  4C3H B;  1K0R A;  2SOB A;  5LL6 S;  3CCS A;  1JJ2 A;  4QIW E;  1JR0 D;  3DWQ A;  4ILW A;  4BWG B;  1PH1 A;  3OWF A;  1EYD A;  3NEL A;  4J1M A;  4BY1 B;  4K14 A;  5DEH A;  3MXN A;  3EVQ A;  1K83 B;  2Z6K C;  5FLX L;  3CKI B;  1SNO A;  4BXX G;  3CRL C;  2PZU A;  4OEM B;  2KHJ A;  4MN3 A;  2IPK D;  1KDA A;  1WTQ A;  4KI0 A;  1SYC A;  2F1M A;  3MC0 B;  4A3F G;  3A7L A;  4JI5 Q;  4ZUI A;  2E2D C;  3J7Y W;  2K5Q A;  3AFP A;  2EYF A;  1FR3 A;  2IT1 A;  5J39 A;  1HQM C;  4JOI A;  3J80 c;  3DLL A;  3MEF A;  3TME A;  1TU2 B;  3ER0 A;  4MTK A;  4H44 C;  2K7V A;  1QIL A;  2K52 A;  4A3E G;  1B4O A;  3FHW A;  3DEP A;  1E1O A;  2QKI C;  2F0O A;  4DPG A;  4HJA A;  3BDL A;  4UP7 A;  1NAP A;  1SMY D;  2WB1 E;  3FP9 A;  5JEA H;  1K3R A;  4A3J B;  2YYZ A;  2AUK A;  2YV5 A;  3ND8 A;  4A3D H;  2UUA Q;  2B2T C;  1N33 Q;  4Q0F A;  1CK1 A;  1VS0 A;  1PRT C;  5F2D A;  4DF7 A;  1HZC A;  4YWK A;  5J22 A;  2L15 A;  4TVA B;  1TT2 A;  1NSN S;  4X65 Q;  1HFN A;  4RHS A;  2MUY A;  3PUZ A;  4YCW A;  1KIX A;  2K6A A;  1PH9 A;  2PMZ B;  4GOP C;  1PHJ A;  4V19 0;  1CFM A;  2SNM A;  1EWI A;  1ICW A;  3PCO B;  1G91 A;  4IJH A;  3EJI A;  1RF2 D;  4XQJ A;  5M3F G;  1K28 A;  4HN7 A;  4TKO B;  4BBR B;  5LMN W;  4X3U A;  5EPL A;  3Q0A A;  5C3E G;  1N34 Q;  1E2Z A;  2N49 A;  1GHJ A;  5ELO A;  2Z6K A;  2UXD L;  1O78 A;  1EIG A;  1ENC A;  1D1K A;  3I72 A;  2R7D A;  3A56 A;  1HNX Q;  5DAU A;  3RUZ A;  5BN3 A;  2NVX B;  2EJM A;  5GRO A;  4DU9 A;  2EXZ A;  1AE2 A;  2K03 A;  5LMN Q;  4FP5 D;  2VS1 A;  3FKI G;  2LS0 1;  5A2Q L;  1WCM B;  1XPR A;  3GQB A;  2CWA A;  2VL6 A;  1VQO A;  5KGU A;  1XNQ L;  1XPU A;  3I4N H;  1JJG A;  1C0A A;  4NKL A;  5FLX E;  3M4O H;  2RHS B;  4A3G B;  2EY5 A;  1HNZ Q;  2B2Y C;  3OMC A;  5ELC A;  2B2T A;  2E75 C;  4JPB W;  3S1Q H;  1PH3 A;  4OWW B;  3Q6S A;  1JCK B;  4JI3 L;  4KD4 A;  1MBY A;  1TWG B;  4I7Z C;  3A8K E;  4R4Q A;  5J3B A;  2WAQ G;  3E6Z X;  2DUD A;  3VR3 A;  4B3T L;  2D5D A;  4LFB L;  2QW7 A;  1X32 A;  3S15 H;  2XSC A;  1K8O A;  2AWO A;  1SMY C;  4RAU C;  3IFD A;  3SR1 A;  4DXF A;  4HIO A;  4GOP A;  4AQY L;  4DR6 Q;  5CC4 A;  2ALY B;  1FD7 D;  3EA6 A;  5E4W C;  3S9W A;  1CQF A;  4A3C G;  4ZKC B;  2K75 A;  4EQN A;  2WKC A;  3HOU H;  2NN6 G;  4PNY A;  4OL7 A;  5CBA E;  3RNU A;  1EWH A;  3SHL A;  1TWA H;  2MHV A;  5C4Z A;  4YHH L;  5I9O A;  3PO3 B;  4KLK A;  3T51 B;  1C7Y A;  2HDL A;  2NBF A;  3HKZ G;  4JI4 Q;  1IBL L;  4IPD A;  4JCV E;  4LF7 Q;  4LF4 Q;  3MFG A;  4X64 L;  4ZK9 B;  1XJV A;  1OXX K;  3RLO A;  2HHH L;  4B3S Q;  1N32 L;  1LLR D;  4Z9C B;  3V2T A;  5HY6 A;  1Y8P B;  2BOS A;  1X3E A;  1VQ5 A;  5IT9 E;  4LFA L;  1SYE A;  1VF7 A;  4K5V A;  3J7Z C;  1IZ6 A;  2PMZ E;  3FMC A;  2JA8 G;  1H9K A;  4DR5 L;  3C2P A;  4ZLT F;  1BBU A;  2FMM A;  3MXU A;  3K7A H;  4HJ8 A;  1Q81 C;  2ENB A;  1I50 B;  4A3M G;  3E0E A;  3I4O A;  1HR0 L;  4L5S A;  2E2J H;  1GHK A;  2YTY A;  4YY3 L;  5J1Z A;  4B3M L;  2Y0S B;  1PYS B;  2Q2I A;  3M3Y B;  1STY A;  1RTN A;  1XTC D;  2A6H D;  4DV6 L;  1BDO A;  4KN4 C;  3GTJ B;  2B2Y A;  2DNE A;  4CBV A;  1CKO A;  1M1K C;  5IP9 H;  3MXN B;  1EUJ A;  1HZ9 A;  1GOZ A;  1UE5 A;  5C44 B;  2K5W A;  4K5W A;  4A3D B;  4DK1 A;  4RA8 A;  1KTK A;  1QNK A;  4DV3 L;  3RR5 A;  2JJQ A;  5A2Q E;  3NUC A;  1EIY B;  3HOW B;  3E5S A;  5C0X H;  4HMJ A;  5HUR A;  3OPO A;  5C5L A;  2QDL A;  1ET6 A;  1AW7 A;  3D0F A;  1O7Y A;  4XQN A;  5COY A;  3NK9 A;  3UDG A;  2EIF A;  5BR8 Q;  3KLS A;  1TKW B;  2EY6 A;  4PMC A;  2EYP A;  2JA5 H;  4C3I B;  4IFD G;  1K8M A;  4ZAI A;  1STB A;  1GM5 A;  3TRE A;  4LUO A;  5IYB G;  3NXW A;  1J5E Q;  1LTB D;  3SEB A;  1K3B C;  2XRQ D;  1PXU A;  4TRD A;  2RDF A;  1GO3 E;  1GUW A;  1TS4 A;  3U9S A;  4GKK L;  1CKM A;  1B9N A;  1F9Q A;  2ZTC A;  4A3K H;  3AEV A;  3GTM B;  1X3P A;  1II3 A;  2WII B;  2O5J C;  4NDX A;  3A54 A;  2Z6B A;  3HOY H;  2QEX A;  2ATW A;  2EY1 A;  3X3N A;  4IPG A;  3HOZ B;  4DR3 L;  4EGV A;  1GUT A;  1R9T H;  1OXU A;  1FVI A;  1U5K A;  4CDD C;  4JI6 L; 
#chains in the Genus database with same CATH homology
 2QGQ A;  1J6Q A;  1PH2 A;  3U4Z A;  4DV0 L;  2Q2T A;  1E22 A;  2IX0 A;  1T9H A;  4YCV A;  2R7Z H;  2VUM G;  1VQ4 A;  1FJG L;  1B7Y B;  3CXC A;  1L0W A;  2UXD Q;  4GN3 B;  3STB C;  3L7Z C;  3W5O A;  5IE8 A;  2PQA B;  3RN2 A;  1QZG A;  5GAG C;  3EN2 A;  3HOV H;  3A74 A;  4EX5 A;  2GVB A;  2KCT A;  5IP9 G;  3JAM i;  4DR6 Q;  1Q8K A;  4BY1 G;  1K73 C;  1IBM L;  1N34 L;  1Z47 A;  3AQQ A;  5LMU Q;  1YEZ A;  1L1O A;  1N9W A;  4JI1 L;  4A93 H;  4X62 Q;  4OO1 G;  5C4X G;  1X56 A;  1A63 A;  4NXN Q;  2E5L L;  1Y1V G;  5IYD H;  5H1S E;  2NVY H;  4GLV B;  3AFQ A;  3DM3 A;  5M5Y H;  2F4V Q;  5K36 G;  3TRZ A;  2AKW B;  1KHI A;  4BA2 I;  3F2D A;  3GTQ H;  1BKB A;  1X65 A;  1EIF A;  4MZ9 A;  1PA6 A;  2K5H A;  2OQ0 A;  4LW1 A;  2N3S A;  3W1G A;  1HZB A;  3S24 A;  1HNX L;  3OTO L;  1PYB A;  2DGY A;  2JE6 I;  3B6Y A;  5IP7 H;  1NE3 A;  2ASB A;  2Q2H A;  4AH6 A;  4A3I H;  1K9M C;  1XNQ Q;  1S72 A;  3PIO A;  5AJ3 L;  2UUB L;  3TQY A;  3KDF A;  3T1H L;  1EYG A;  4DUZ Q;  3KF6 B;  4OWT B;  2NVT H;  4LF9 Q;  1Q1E A;  5LMN L;  5IY0 A;  1LYL A;  2WFW A;  4LUV A;  1JJC B;  1KL9 A;  2GN5 A;  1CSP A;  4JYA Q;  2E2H H;  2NVX H;  4DR4 Q;  4A4I A;  1SRO A;  2CKZ B;  2GVA A;  1LTL A;  2ZJQ A;  5FLX c;  1NY4 A;  2F3I A;  3CC7 A;  1PH5 A;  4R4C A;  3S16 H;  4GN5 A;  4UY8 C;  4JI3 Q;  5M3M G;  3UDX A;  2MO0 A;  5FLM H;  4BBS H;  2ZTE A;  2UUC L;  4NPS A;  1KAW A;  1KRT A;  4A3B G;  3S1M H;  3H15 A;  3NEN A;  1HNZ L;  4GN4 B;  3ULL A;  3A5U A;  4IO9 A;  4DR1 Q;  3CCM A;  3H3V I;  4BXX H;  2UXB Q;  3J7A 5;  3HFZ B;  4YWL A;  1YIJ A;  4JI2 Q;  1GKH A;  5IWA L;  2VW9 A;  4C3H H;  4B3T Q;  2K5V A;  3J81 i;  3BZC A;  4JBJ A;  4H02 A;  4JOI C;  2WB1 G;  4A76 A;  1YHQ A;  4LFB Q;  4OWX B;  4A3F H;  3TS0 A;  4R4I A;  4RMF A;  3WWV A;  2I5H A;  4JI7 Q;  1VQ8 A;  5HGQ A;  4AQY Q;  4BY1 H;  2JA7 G;  2JEA I;  1I3Q H;  3S14 H;  1KXL A;  2VQF L;  3Q8D A;  3JAM c;  4OO1 I;  4JI0 L;  2VQE L;  1K83 H;  1JB7 A;  1VQG A;  4UP9 A;  5C4X H;  1TWC H;  3EIV A;  3U4V A;  1Q86 C;  1HR0 W;  4ALP A;  1Y1V H;  2BH8 A;  3M85 A;  4GLX A;  4XTC S;  3T1Y Q;  1G29 1;  5C0X I;  1QVF A;  3I7F A;  2R7Z G;  4YHH Q;  4DUY L;  1A0I A;  4LF6 L;  1P16 A;  1O7I A;  4DR6 L;  1V9P A;  3K0X A;  2R7F A;  1NJI C;  3CQZ H;  2UXC Q;  1IBL Q;  4JBK A;  3PUW A;  4X64 Q;  4DK6 C;  1YJ9 A;  2B63 H;  1VQF A;  3CAM A;  4C3J H;  2F52 A;  3CCV A;  3CD6 A;  1E3P A;  4LFC L;  1YJW A;  2HHH Q;  1N32 Q;  4X66 L;  3J80 i;  2OQK A;  1LUZ A;  2YTX A;  4R4O A;  4DV4 L;  2N78 A;  1XPO A;  4LFA Q;  2NVQ H;  1EFW A;  3NBH B;  3UDI A;  4DV7 L;  4JBM A;  2CQO A;  4B3R L;  2E8G A;  1X3F A;  4JI4 L;  4DR5 Q;  4LF7 L;  4LF4 L;  4EQ5 A;  1V43 A;  3VDY A;  5IT9 c;  1YHA A;  3GTP H;  2VZA A;  1UWV A;  3SGI A;  4B3S L;  5M3M H;  1CSQ A;  1L1O B;  1Q12 A;  4QGU A;  4A3J H;  4QJF A;  1VQP A;  2F4V L;  3S2D H;  1IXR A;  5JJK A;  5IP7 G;  5JEA G;  1S40 A;  1HR0 Q;  2OWO A;  3KOJ A;  4A3I G;  4PMW A;  1XMQ L;  3M4Q A;  1IL2 A;  4IOA A;  3J81 j;  2D0O A;  3PO2 H;  1I94 L;  4DR7 Q;  3F2C A;  4PZ6 A;  4JI8 Q;  4NXM Q;  4YY3 Q;  1AE3 A;  2JQO A;  3ERS X;  4B3M Q;  2HIX A;  1K0R A;  3J81 c;  3CCS A;  1JJ2 A;  1E1T A;  3CW2 C;  4QIW E;  2JA6 H;  1PH1 A;  2JA7 H;  1SMX A;  5E7N A;  1M90 C;  3KDF B;  3NEL A;  3PUX A;  4L5Q A;  4DV6 Q;  2AWN A;  3GDE A;  4HJ5 A;  5FLM G;  4MTN A;  1YVC A;  1WCM G;  2PI2 E;  2Z6K C;  4LF5 L;  4BXX G;  1FL0 A;  2K50 A;  2CFM A;  2KHJ A;  4AYB G;  3U58 A;  2D62 A;  3CMA A;  4UPA A;  1YI2 A;  2FXQ A;  2UU9 L;  4KI0 A;  4X6A H;  5C3E H;  5C0X J;  3ULJ A;  4A3F G;  4JI5 Q;  3G6E A;  3CCE A;  2K14 A;  1VQE A;  3RZD H;  4TQU S;  3AFP A;  1SFO H;  4DV3 Q;  3K7U C;  4DNI A;  2IT1 A;  2MO1 A;  4BBR H;  3S1R H;  1W2B A;  4K0K L;  4JOI A;  1UE7 A;  4IFD I;  3J80 c;  1Q82 C;  3DLL A;  3I4M H;  4BBS G;  5GAH C;  3MEF A;  1S3O A;  1QVG A;  1YBY A;  3ER0 A;  4HIM A;  1V1Q A;  1VQM A;  4Y52 H;  2K52 A;  3PGZ A;  2K5N A;  4A3E G;  1ASZ A;  4A75 A;  4OX9 Q;  3FHW A;  1E1O A;  5M5W H;  1U0L A;  1SRU A;  4HJ7 A;  4DPG A;  4HJA A;  4UP7 A;  3UDF A;  1XMO Q;  2WB1 E;  2ID0 A;  3FP9 A;  4PZ7 A;  3U50 C;  1K3R A;  4RG1 A;  3FKI H;  1VQ9 A;  2YYZ A;  2NZH A;  1HZA A;  1WYD A;  2B63 G;  4GKJ L;  1D7Q A;  2YV5 A;  4DV2 L;  4A3D H;  3UE0 A;  1RL2 A;  1X6O A;  4P75 A;  2UUA Q;  1N33 Q;  3CCQ A;  3GTK H;  5M5X H;  1VS0 A;  5BR8 L;  1W3S A;  3I56 A;  1VQC A;  1KD1 C;  1XNR Q;  4GNX B;  2ZM6 Q;  4GKK Q;  1HZC A;  2MFI A;  2LXK A;  1TWH H;  4YWK A;  3NEM A;  3G48 A;  2L15 A;  3I4M G;  4A3J G;  1N36 L;  1VQL A;  1WCM H;  2K4K A;  2RHQ B;  4TVA B;  3OYY A;  4POF A;  1PV4 A;  1J5E L;  2AMC B;  3CC2 A;  2OCE A;  2Z0S A;  4X65 Q;  3PO2 G;  3PUZ A;  4P74 A;  4YCW A;  1KIX A;  4DV5 L;  1VQA A;  4LF8 Q;  4DR3 Q;  2BH2 A;  1PH9 A;  4DV1 L;  1HNW Q;  4GOP C;  1NMF A;  1PHJ A;  3I4N G;  4A3G H;  2XGT A;  2MQH A;  3KF8 B;  3LGJ A;  1UEB A;  3KFU A;  4A3L G;  3PUY A;  4P72 A;  4JI6 Q;  2JA6 G;  4DAM A;  1EWI A;  3ZJY C;  1Y1W G;  3PCO B;  3TS2 A;  4DV0 Q;  1Z9F A;  1IBK L;  2V1C C;  4WJ3 M;  4JV5 L;  4IPC A;  4IJH A;  4JC0 A;  3GO5 A;  5M3F G;  1FJG Q;  5LMN W;  1PVO A;  4IPH A;  3PIP A;  4A3C H;  1TWG H;  4IFD J;  3M9B A;  2HIV A;  3PF4 A;  3KJP A;  2E2I H;  4A3E H;  1PH7 A;  3HKS A;  1IBM Q;  1P8L A;  5C3E G;  1N34 Q;  2RCN A;  3L0O A;  2N49 A;  3CME A;  1PH8 A;  5ELO A;  4JI1 Q;  2Y0S G;  2Z6K A;  4LNQ A;  5JJL A;  2UXD L;  2E5L Q;  2CWP A;  1CUK A;  1XTD A;  1UE1 A;  3BU2 A;  4BBR G;  3KLW A;  1AH9 A;  1I5F A;  2R7D A;  1WJJ A;  1HNX Q;  5LMU L;  3OTO Q;  1NMG A;  1GVP A;  4X62 L;  1SE8 A;  1FGU A;  1QVC A;  1WI5 A;  2IHF A;  5GRO A;  4NXN L;  5AJ3 Q;  2UUB Q;  4AYB E;  2R92 G;  3T1H Q;  1I6H H;  1AE2 A;  3PO3 H;  2EQS A;  4C2M H;  4R4T A;  5C44 G;  5LMN Q;  1KC8 C;  2VS1 A;  3FKI G;  3CPF A;  1XPR A;  4A3D G;  4HJ9 A;  1E7Z A;  2CWA A;  1PH6 A;  1D8L A;  2VL6 A;  4YWM A;  1VQO A;  4DK3 C;  4MNO A;  3S1N H;  1XNQ L;  1XPU A;  3I4N H;  1JJG A;  1C0A A;  1PFS A;  2Q2U A;  4A3L H;  4HID A;  4DUZ L;  3M4O H;  1NTG A;  2RHS B;  4L5R C;  4LF9 L;  4QQB X;  2UUC Q;  3S2H H;  4DKA C;  1A8V A;  4OXP A;  4HIK A;  1HNZ Q;  1Y1W H;  5JJI A;  2A1A A;  1VQN A;  4JYA L;  3ICE A;  4DR4 L;  5M3F H;  5IWA Q;  1JMC A;  3S1Q H;  1NBW A;  1VQ6 A;  1PH3 A;  5IYC H;  3F1Z A;  4OWW B;  4L5T A;  1X9N A;  4JI3 L;  2A8V A;  3CCJ A;  1I50 H;  4IJL A;  3OW2 A;  2LXJ A;  2VQF Q;  4R4Q A;  5J3B A;  4A3G G;  4DR1 L;  2WAQ G;  4JI0 Q;  2UXB L;  2YTV A;  1H95 A;  2VQE Q;  2PNH A;  4JI2 L;  2DUD A;  4B3T L;  3BZK A;  4LFB L;  3A5Z B;  3M3Y H;  2R93 H;  2VY3 A;  1E24 A;  3S15 H;  1JT8 A;  4DUY Q;  2AWO A;  1HH2 P;  4Y7N H;  3RN5 A;  4JI7 L;  4LF6 Q;  4GNX C;  4HIO A;  4GOP A;  4AQY L;  2CCZ A;  3G4S A;  3I55 A;  3CC4 A;  2ALY B;  3K81 C;  4DAY B;  4A3C G;  4KHP Q;  3PV0 A;  1EOV A;  2K75 A;  2BA0 A;  1QUQ A;  4QL5 A;  3GTJ H;  2B29 A;  1VCI A;  2MNA A;  2R92 H;  3HOU H;  2NN6 G;  3EBE A;  4LFC Q;  1CKN A;  3HOZ G;  3T1Y L;  4X66 Q;  3RNU A;  5C44 H;  1TWA H;  4YHH L;  3I2Z A;  3G71 A;  4DV4 Q;  5ELN A;  2LSS A;  4DR2 Q;  2N8N A;  1OTC A;  1OXS C;  4KLK A;  4APV A;  4DV7 Q;  1C7Y A;  3D31 A;  4AIM A;  4B3R Q;  3HKZ G;  2UXC L;  1WFQ A;  1B8A A;  1IBL L;  4JI4 Q;  4IPD A;  4JCV E;  3CP0 A;  4LF4 Q;  4LF7 Q;  2ZJP A;  4X64 L;  2C35 B;  4UP8 A;  1XJV A;  1OXX K;  3RLO A;  1ASY A;  4PG3 A;  1KQS A;  3STB D;  2HHH L;  1YJN A;  4B3S Q;  1N32 L;  1A62 A;  1Y14 B;  3HOW H;  5HY6 A;  1VQ7 A;  1X55 A;  1X3E A;  4O2D A;  5IYB H;  3ULP A;  1VQ5 A;  4LFA L;  5C0X G;  5C4J H;  1IZ6 A;  3J7Z C;  1XMQ Q;  3RZO H;  2PMZ E;  1EQR A;  3CPW A;  1I94 Q;  3JC6 6;  2JA8 G;  3PO3 G;  1G51 A;  1LM0 A;  4QY7 A;  5FJ8 H;  4DR5 L;  2ES2 A;  1VQD A;  3S17 H;  1N8R C;  2B3G A;  2YU9 H;  3PSI A;  1BBU A;  2I5L X;  3A0J A;  1K8G A;  4YCU A;  2Y0S E;  1SLJ A;  1UE6 A;  3K7A H;  4HJ8 A;  2JA9 A;  1Q81 C;  3HOX H;  2R6G A;  4C3I H;  3E0E A;  3I4O A;  4A3M G;  1HR0 L;  4L5S A;  1IYJ B;  2H5X A;  3GTG H;  2E2J H;  2JA5 G;  4JBW A;  1GD7 A;  2JEB I;  2YTY A;  3CCU A;  4DR7 L;  4JI8 L;  2WP8 J;  4NXM L;  4YY3 L;  4LWC A;  5GAD C;  4IOC A;  3CCL A;  2IHE A;  4B3M L;  4LF5 Q;  3PF5 A;  1PYS B;  1SN8 A;  1Q7Y C;  1SR3 A;  2Q2I A;  1TWF H;  1L2F A;  2PQA A;  3KJO A;  3GTM H;  2UU9 Q;  2PI2 A;  1OXV A;  2KHI A;  4POG A;  5IYC G;  4A3K G;  2ZTD A;  1VQH A;  2IX1 A;  2NN6 I;  4DV6 L;  2VUM H;  5DLQ E;  3H3V H;  1L1O C;  5GAE C;  2I0Q A;  3HOY G;  1TXY A;  3PUV A;  3H0G G;  3HOZ H;  1CKO A;  1M1K C;  1X3G A;  1MKH A;  4K0K Q;  4FDB A;  5IP9 H;  3MXN B;  1EUJ A;  1VQK A;  1HZ9 A;  1UE5 A;  1VQI A;  5JEA J;  3F2B A;  4LUZ A;  2A19 A;  1YZ6 A;  3K8A A;  3RLF A;  2R93 G;  4XIG S;  1YHB A;  4KHZ A;  3E9H A;  4JI5 L;  4BY7 G;  4OON A;  4P71 A;  1VQB A;  3IRB A;  4GS3 A;  5EAY A;  1WOC A;  3L2P A;  3RR5 A;  2JJQ A;  1BVS A;  4P73 A;  4DV3 L;  4J15 A;  2D0P A;  2OTJ A;  1MIU A;  3KF6 A;  4JG2 A;  1EIY B;  1MJC A;  3HOU G;  4GKJ Q;  4KHP L;  2BA1 A;  2RF4 A;  4DV2 Q;  1Q1B A;  2KBN A;  3UE1 A;  2JA8 H;  1RIP A;  1HJP A;  3HOV G;  4GNX A;  4GOP B;  3D0F A;  2HT1 A;  3UDG A;  2AHO B;  2EIF A;  2WAQ E;  4OX9 L;  1QUQ B;  2JK8 A;  5BR8 Q;  1X54 A;  3AYH B;  2NZO A;  5GQO A;  3M7N A;  1XMO L;  4A3M H;  1PH4 A;  3RLN A;  2VNU D;  1MJE A;  4A93 G;  4WJ4 A;  1CKN B;  4DR2 L;  2JA5 H;  1G6P A;  1VQJ A;  3CF5 A;  5IYD G;  4IFD G;  3HOW G;  2EXD A;  1N36 Q;  3K80 C;  2XTI A;  2OTL A;  2UUA L;  1GM5 A;  3TRE A;  1N33 L;  1JE5 A;  4LUO A;  5IYB G;  1J5E Q;  3GD7 A;  1OXT A;  2I5M X;  4PZ8 A;  2IY5 B;  1XNR L;  3CCR A;  4DV5 Q;  4O0A A;  3KYH C;  5FJ8 G;  2ZM6 L;  1GO3 E;  4A3B H;  1C9O A;  1CKM A;  1Q46 A;  4DV1 Q;  4A3K H;  2ZTC A;  3AEV A;  4GKK L;  1BBW A;  4ME3 A;  2KEN A;  3GTL H;  4R1J A;  1YNX A;  3M4P A;  3F8T A;  1B70 B;  1QZH A;  1DGS A;  3HOX G;  2QEX A;  3BJU A;  3H0G H;  4BA1 I;  3HOY H;  3HKZ E;  1YIT A;  1KRS A;  1IBK Q;  4X65 L;  2ATW A;  3GTO H;  4JV5 Q;  4IPG A;  4LF8 L;  4DR3 L;  1K8A C;  2KCM A;  2QA4 A;  2ZJR A;  1R9T H;  2HQL A;  1OXU A;  1FVI A;  1U5K A;  1HNW L;  3E9I A;  3TEH B;  4NB3 A;  4BY7 H;  3W1B A;  1EQQ A;  4GLA C;  4JI6 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...