3T1YL

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human anti-codon stem loop (hasl) of transfer rna lysine 3 (trnalys3) bound to an mrna with an aag-codon in the a-site and paromomycin
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Human tRNA(Lys3)(UUU) Is Pre-Structured by Natural Modifications for Cognate and Wobble Codon Binding through Keto-Enol Tautomerism.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 16
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2011-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3t1yL00
2BH2A 4BXXG 1UE7A 3M85A 2UXDQ 1K0RA 4DR1L 1PH1A 4DUZL 4LF8Q 5JEAG 1KAWA 2PMZE 4LNQA 4NXNL 4QQBX 3GTJH 4DPGA 5M5YH 4ALPA 1YIJA 4BA2I 3M4OH 2B3GA 1K8AC 4GOPC 2A8VA 4PG3A 1QUQA 1XNRQ 1PH8A 3GTGH 3HOUH 5C44G 2R92G 1NE3A 1D8LA 2NZOA 3PUZA 2B63H 3I4OA 3T1HL 4UP7A 1H95A 4YWLA 4DV7Q 1W3SA 4GN4B 4NB3A 4A3BH 1A8VA 1VQAA 1YVCA 4A3FH 5IY0A 4JOIA 1X3GA 3OTOL 1XMQL 2N49A 2OQKA 4A3MG 2JA7H 4A4IA 2I5MX 2E8GA 4GKKQ 2CWPA 4DR5L 2YTXA 4A3DH 2CWAA 2D0OA 1TWAH 2K5NA 5IYDH 3CAMA 2VZAA 4AQYQ 2R93G 4XTCS 1HR0L 5C4XG 4LUVA 1P16A 3MXNB 4X62L 1GD7A 2ZJQA 4BY1H 3D31A 4OO1I 1J6QA 2VNUD 4A3CH 3ERSX 5C44H 1KHIA 2ES2A 1GVPA 1UE1A 2HIVA 4B3RQ 5IP7G 3HOZH 4BY7H 4WJ4A 1OXVA 1XJVA 1PH6A 2N3SA 3CXCA 5LMNW 1SRUA 1A62A 1Q1BA 3GDEA 1FVIA 4HIMA 4JV5Q 1UWVA 3UE0A 4LFBQ 5HGQA 1Y14B 5C0XI 5M3MH 1WI5A 2KBNA 2PQAB 3CCMA 4GLVB 4DR3L 1IBML 2JA8G 4BA1I 1IXRA 3L2PA 3AFPA 4OO1G 4YWKA 1VS0A 4LF4Q 1K73C 4OWWB 1NBWA 2ZJPA 1I3QH 2Z6KA 4LF5L 2VW9A 4L5RC 2HHHQ 2R93H 3AQQA 2Q2IA 2WAQE 5C4XH 1ASZA 1HNWQ 1Q86C 3TEHB 3MEFA 1Y1WH 1CKMA 2R7FA 1IYJB 4DV6L 3BJUA 1GKHA 1VQIA 3STBD 3GD7A 2ZTDA 1YJNA 3KOJA 1YNXA 5IP7H 3I4NH 1VQOA 1XTDA 2JA5G 1FGUA 1KRTA 4DR1Q 4DR2L 1E24A 4DUZQ 1PH9A 1JB7A 3RNUA 1K3RA 4NXNQ 1YHBA 4DAMA 4YCWA 4JI4L 3HKZE 3KLWA 4JBJA 2VY3A 1SLJA 5IP9G 2I0QA 1CUKA 1Y1VH 3I7FA 2L15A 2A1AA 4QIWE 1YJWA 1S40A 1JMCA 1DGSA 2QA4A 1MKHA 2NVYH 4DUYL 4L5QA 3T1HQ 4DR6Q 1Z9FA 4IFDI 3B6YA 4PZ6A 1HNXL 1XMQQ 3OTOQ 5IYCG 2VQFL 1X55A 4IPCA 3CC7A 4A3EG 5C3EH 4IOCA 1VQCA 1NMFA 4PZ7A 1N8RC 3PCOB 1MJCA 2JQOA 1J5EL 1AH9A 4XIGS 2JA5H 4JYAL 4C3JH 2E2IH 3A5ZB 1SE8A 1HR0Q 2V1CC 3CC2A 3JAMi 1CKNA 2CQOA 2JK8A 1PA6A 3ICEA 4X62Q 2XGTA 4H02A 2HQLA 2RHQB 3I2ZA 1V1QA 3PF5A 5K36G 4LFCQ 1L1OA 2AHOB 3KYHC 3M4PA 4HJ9A 4LFAL 3HOUG 3PF4A 5FJ8H 1CSPA 1VQ7A 2YTYA 1JE5A 3CCSA 1HH2P 2PI2E 3DLLA 5AJ3L 2B63G 1UE5A 4DV1L 2QGQA 4KHPL 4A3EH 1E22A 5IWAL 1IBLL 4A3BG 3CPWA 4AIMA 3H3VH 3CCQA 2RF4A 4DR3Q 4A3FG 1Q82C 4JBMA 4NXML 4MZ9A 3HKSA 4A76A 1K83H 4YCVA 4A3DG 1QVCA 4YCUA 1KQSA 3BZKA 3CC4A 4LF5Q 2BA1A 4DV3L 2GVBA 4GNXC 3H0GH 4AYBG 2K50A 4JOIC 2UUBL 3GTMH 3U4ZA 1XMOL 2CCZA 3FKIH 2VUMH 4JI1L 4JI6L 1VQHA 4JBKA 3K0XA 4BY1G 4B3TQ 3NENA 5LMNL 4P72A 2EIFA 1X9NA 4A3CG 3FHWA 3S1RH 4RMFA 4A3IH 2Z0SA 1L2FA 3M9BA 3CCUA 4DR2Q 3HOZG 3K81C 2RCNA 4BY7G 3HOYG 1Q1EA 1B70B 5ELOA 4IJHA 3U50C 2K52A 4JI4Q 1SR3A 4MNOA 4C2MH 4YY3L 2R7DA 4J15A 1RL2A 3BZCA 3KDFB 5M3MG 1NY4A 1OXSC 4QY7A 1VQFA 1YITA 4GKJL 1PVOA 1D7QA 3F2DA 3CCEA 1R9TH 2MFIA 4JBWA 4UP8A 4BBRH 4DUYQ 2UU9Q 1N36L 5GAEC 2OTLA 4JI8L 2NZHA 1P8LA 4APVA 3D0FA 1HNXQ 3ER0A 1EYGA 1NMGA 4GS3A 2VQFQ 5J3BA 4LF9L 3W1BA 3HOVG 3M3YH 2ZJRA 1X6OA 5GAHC 4DKAC 2JJQA 2K14A 1Y1WG 4QJFA 4DV2L 3S14H 3PUXA 2YYZA 5LMUL 2IY5B 3TQYA 1J5EQ 3GTPH 4BBSG 2Z6KC 1VQ9A 3KJOA 4JYAQ 4HJAA 4JCVE 2PNHA 5M5XH 3HOXH 3HOYH 3I4NG 2PQAA 1BBWA 3G4SA 4GOPB 3S15H 4GNXB 3UDXA 1EFWA 5JEAJ 4IOAA 2BH8A 4YWMA 3UDIA 5M5WH 1G51A 3CCVA 3GTOH 2YTVA 2K5VA 4LFAQ 4LUOA 3J81c 1VQEA 5JJKA 1Y1VG 4P71A 4GLAC 1KL9A 2JE6I 3I56A 1JJCB 1HZ9A 4YHHL 1ASYA 2Q2TA 5AJ3Q 4LF7L 1TWFH 1WYDA 4UPAA 4OWXB 1AE3A 3PO3H 3A0JA 4IPGA 4RG1A 4X65L 2JEBI 4DV1Q 3HOVH 2IT1A 4KHPQ 3I55A 4JI7L 5JJIA 4OXPA 3PSIA 5IWAQ 1IBLQ 1JT8A 4P73A 4NXMQ 4EQ5A 5C3EG 3CF5A 1XPOA 1FL0A 1HZCA 1E3PA 2YV5A 3SGIA 1X56A 5C0XG 1W2BA 4BBSH 4DV3Q 2R6GA 2Q2HA 1U0LA 4IPHA 4DK3C 2HT1A 3A5UA 1VCIA 1YEZA 5DLQE 5ELNA 2UUBQ 3S2DH 1PV4A 1XMOQ 3H3VI 4JI1Q 1JJ2A 4JI6Q 4B3ML 3UE1A 2Y0SE 4TVAB 2OQ0A 4A3JH 1WOCA 3TREA 5LMNQ 1VQBA 2UUCL 1QVFA 4K0KL 3E9HA 1WJJA 3IRBA 1Z47A 5GADC 3F8TA 1QZHA 2VQEL 1GO3E 1PH7A 2NVXH 3T1YL 2UXDL 5FJ8G 1YHAA 4R4QA 2CKZB 3JC66 1KIXA 2D0PA 4AH6A 2R7ZG 2IHEA 4X64L 4A93H 3CPFA 4PZ8A 5GROA 5HY6A 3TRZA 4KI0A 3F2CA 4FDBA 4YY3Q 2ZTEA 1PH5A 4HIDA 4GKJQ 1L1OC 1MIUA 1QZGA 3CQZH 4DV0L 4DR5Q 1IZ6A 4WJ3M 2XTIA 2VS1A 3PUWA 1LTLA 2Q2UA 1N36Q 4JI8Q 3PGZA 2AWNA 2F4VL 1BVSA 3K7AH 2WP8J 1X3EA 1B7YB 3HFZB 3CW2C 2F52A 3H0GG 4LF6L 4LF9Q 1KC8C 4HIKA 1V9PA 1VQLA 1I94L 1PH4A 1LM0A 4IFDG 3FKIG 5E7NA 1BKBA 5LMUQ 4LWCA 5H1SE 1SFOH 2VUMG 2NN6I 4HJ7A 5EAYA 1XNQL 3U58A 2JEAI 1TWCH 3KF6A 4IJLA 4A3IG 2R7ZH 3HOWH 3TS2A 4OX9L 4JI3L 3S1NH 1CKOA 2JA9A 4C3IH 2K4KA 5M3FH 1VQDA 1YI2A 2MNAA 4LUZA 4AYBE 2A19A 1IBMQ 1FJGL 5BR8L 4A75A 2KCTA 4A3KG 1YHQA 4POGA 3PUVA 4B3SL 2JA6H 2NN6G 4O0AA 4OONA 1VQKA 4LF7Q 3K8AA 4DV5L 4BBRG 1VQ8A 3RR5A 4X65Q 4L5TA 4JI7Q 2D62A 4X66L 1YZ6A 1N9WA 3AYHB 3KF8B 3JAMc 3CMEA 4DV6Q 4HJ5A 2DUDA 3CD6A 1UE6A 3RLFA 2NVTH 2LSSA 1L1OB 1C0AA 1G6PA 1Q81C 1XPRA 4Y7NH 1PYSB 3E9IA 3M4QA 2IHFA 1N32L 1HNZL 5IT9c 3KDFA 1EIFA 3HOXG 3UDGA 3GO5A 3I4MG 1RIPA 2OCEA 4UY8C 4B3MQ 1HJPA 3J80c 2UUCQ 4ME3A 4K0KQ 2C35B 4Y52H 3LGJA 1PH3A 4A3LH 4A3KH 1VQ6A 1EQRA 1HZBA 2KCMA 2VQEQ 1PH2A 2YU9H 3T1YQ 2H5XA 3PO2H 4HJ8A 3CP0A 1EQQA 4POFA 4X64Q 3F2BA 2IX1A 3EN2A 3AFQA 4JC0A 2I5HA 3PO3G 2WB1G 4A3GH 3OYYA 4KLKA 1B8AA 1VQ4A 4DNIA 1I6HH 4DV0Q 3KJPA 1GM5A 1AE2A 4IO9A 1N33L 1SROA 5FLMH 5GQOA 4GOPA 1QUQB 4DR6L 4GNXA 3CCLA 1OXUA 3J81i 2UUAL 4QL5A 3W1GA 2ZTCA 2E5LL 1IBKL 2F4VQ 4NPSA 4DR7L 2AWOA 4LF6Q 3I4MH 4GLXA 3GTKH 1OXTA 3EBEA 2ZM6L 2NVQH 1I94Q 3A74A 1WCMG 3RLNA 1S72A 3S24A 4JI2L 4BXXH 5JJLA 4JI0L 4A3JG 1EWIA 1JJGA 4P75A 3ULJA 1XNQQ 2MO0A 3ULLA 1M1KC 4L5SA 1KXLA 4DV4L 1Q8KA 1EOVA 1C7YA 1X3FA 4OX9Q 1E7ZA 4JI3Q 4X6AH 2UXCL 4JI5L 3NELA 1MJEA 1SN8A 1PHJA 4A93G 2AKWB 2R92H 4JG2A 4LFCL 1X65A 3RZOH 1T9HA 4R4OA 4QGUA 4IPDA 1EUJA 3VDYA 1FJGQ 3CCJA 2PI2A 5BR8Q 1VQNA 1S3OA 1A63A 4B3SQ 1VQ5A 2KHJA 3W5OA 2IX0A 1WFQA 2VL6A 1N34L 4DV5Q 1OXXK 3M7NA 2UXBL 4A3MH 1NTGA 1YBYA 4DK6C 4GN5A 3CCRA 1X54A 3U4VA 4X66Q 4GN3B 2F3IA 1WCMH 1KRSA 2DGYA 1LYLA 4DR4L 3TS0A 1HZAA 3NBHB 2BA0A 2N78A 1BBUA 3UDFA 1TXYA 4UP9A 4LF8L 1N32Q 1E1TA 1NJIC 1HNZQ 2ASBA 1C9OA 3S17H 3F1ZA 3Q8DA 1V43A 2MQHA 3HOWG 2OTJA 1HR0W 3K80C 3ULPA 4B3TL 2ID0A 1XNRL 1O7IA 4O2DA 3S1QH 5M3FG 2HIXA 2WAQG 3PV0A 3ZJYC 3RN5A 4P74A 4R4IA 2GN5A 1Q46A 3FP9A 4MTNA 1Q7YC 2JA6G 2K75A 2GVAA 1PFSA 3PUYA 3H15A 3NEMA 4DV7L 2RHSB 1G291 4OWTB 1KD1C 2JA8H 1EIYB 2E2HH 5IYBG 4GKKL 3GTLH 3RN2A 3G6EA 5GAGC 1TWGH 3PIOA 3CMAA 3KFUA 4DV2Q 1N33Q 1VQMA 3J81j 2UU9L 3WWVA 3S2HH 5IE8A 4HIOA 5C0XJ 3HKZG 4KHZA 4LW1A 4AQYL 2UUAQ 2FXQA 2Y0SG 2E5LQ 1IBKQ 3PIPA 3G71A 1YJ9A 2WFWA 1CSQA 4DR7Q 3E0EA 1XPUA 2ZM6Q 2OWOA 3L0OA 4IFDJ 3RZDH 3G48A 2EXDA 1LUZA 4TQUS 4JI2Q 1I50H 3AEVA 4JI0Q 3S1MH 4B3RL 4DAYB 4A3LG 4DV4Q 2ALYB 1SMXA 1VQJA 4YHHQ 2K5HA 1OTCA 5FLXc 3PO2G 4JV5L 4LFBL 1PYBA 1VQGA 2UXCQ 4JI5Q 5IP9H 3OW2A 1E1OA 1A0IA 3L7ZC 5IYBH 1CKNB 1IL2A 2LXJA 4R4TA 4PMWA 4C3HH 1I5FA 2E2JH 4A3GG 2I5LX 2AMCB 2LXKA 1VQPA 3RLOA 4LF4L 2ATWA 3S16H 1TWHH 3J80i 1K9MC 5FLMG 1QVGA 2HHHL 1N34Q 3GTQH 2CFMA 2B29A 2N8NA 5IYCH 5C4JH 3J7ZC 1HNWL 2MO1A 3K7UC 4EX5A 2KHIA 2UXBQ 3KF6B 4R1JA 4R4CA 2KENA 1K8GA 3BU2A 2JA7G 1L0WA 3STBC 3J7A5 2EQSA 1U5KA 3EIVA 4DR4Q 3DM3A 2QEXA 5IYDG 1UEBA 1Q12A 1M90C 2WB1E
chains in the Genus database with same CATH superfamily
2FMCA 1C4QA 2L5TA 3MEHA 1RD9D 2PMZE 1ZKOA 5FO7B 4IQZA 5EBDA 1YNJD 2DJFC 1QUQA 1TWCB 2R7ZB 1UEAB 2R92G 4RGNA 1KDBA 1MSHA 2B63H 1DCZA 3T1HL 4OELB 5TSSA 1W3SA 1A8VA 4A3FH 3OTOL 3OWEB 5IIFA 1GOZA 2D0OA 2DNEA 2VZAA 4ZKBB 1HQMC 3IL8A 4AQYQ 2R93G 1V1PB 3RUZA 2ZJQA 1EQVA 1J6QA 4A3CH 3A7LA 1KHIA 1UE1A 1CT1D 1X3QA 1OXVA 1A62A 5COYA 4HCSA 1FVIA 1DOKA 3NP8A 3V2TA 4LFBQ 1Y14B 4A3KB 2YU9B 4C1NI 2PQAB 4GLVB 2JA8G 3KK7A 1IXRA 4BBRB 3KBXA 1K73C 4LF4Q 2A6EC 2H4OA 3AQQA 4C1NK 2Q2IA 1V8QA 4KJNA 1HNWQ 1SJHD 1Q86C 3TEHB 1XWEA 3HEJA 4L8JA 4XYQA 1HCZA 2NB0A 1D5ZC 3CRKC 3H94A 4X3TA 4IURA 2F0LA 1E24A 5KNDA 1ESFA 3VYTA 4KV6A 4QUFA 1WTWA 4JBJA 5IP9G 3I7FA 2A1AA 2XRSD 4OIKA 1DGSA 3PO3B 5DM73 1DD2A 3T1HQ 1LTGD 2Z8LA 2Z4IA 1I4GA 4IFDI 4PZ6A 3OTOQ 3K57A 2K04A 4A3EG 3WOFA 3KUPA 5C3EH 2F0WA 1VQCA 1A2TA 4CDEC 1DONA 1SNDA 4JYAL 3S2DB 2E2IH 2XN9C 3A5ZB 1XX8A 1EFID 5CBAE 3K5MA 2IPKD 4A3JB 3ICEA 2RHQB 3DHQA 3VYUA 1FD7D 1L1OA 4LFAL 1X3PA 3P1HA 1VQ7A 1JE5A 5FO9B 1HH2P 4TKOB 1T5XD 4DV1L 3FPUB 2QGQA 1H9SB 3A7AB 1E22A 5IWAL 1IBLL 4A3BG 3CPWA 3H3VH 2RF4A 4NXML 4MZ9A 3HKSA 4A3DG 4LK1C 2ICIA 3BZKA 3CC4A 2BA1A 2GVBA 1SBBB 2A6ED 4B9XA 2K50A 4IFDH 2CCZA 1NNXA 2ZXOA 5BN4A 4JI1L 5EPKA 1RTOA 3NENA 2EIFA 2QILA 1EZ8A 4RMFA 4A3IH 2EE1A 4NMZA 3S1NB 1EZ6A 3K81C 3HOZG 3U50C 2K52A 2FINB 1S5CD 1WVLA 5M3MG 1A3VA 1JC7A 2WV6D 3MXNA 4DXFA 2MFIA 4UP8A 4UDUC 1R9TH 5NUCA 2EZVA 2NZHA 1LABA 4M1UB 2B2WC 3W1BA 2JJQA 2J4XA 1Y1WG 1BCPF 3S14H 5FOBB 3JAML 3TQYA 2Z6KC 1VQ9A 3KJOA 4JYAQ 4JCVE 5M5XH 3I4NG 2PQEA 3EQLC 5IT9L 3S15H 3UDXA 1G51A 1SJED 3GTOH 3J80L 3PO2B 4LFAQ 5JJKA 1A6XA 1Y1VG 4GLAC 4KD4A 2JE6I 5CV5A 1ASYA 3I73A 1TWFH 4OWXB 4IPGA 4X65L 4DV1Q 5D3DA 3HOVH 3O13A 3T4AC 4RHSA 5IWAQ 4G7HC 1IBLQ 5JJIA 2A5HA 4NXMQ 2VB2X 3CF5A 1FL0A 1B4OA 4BBSH 3H6MA 2QKIC 3MZ5A 2R6GA 3BDCA 2EYMA 4IPHA 1JOQA 1KNAA 4C3JG 3A5UA 2HT1A 1VCIA 1YEZA 3R93A 1AEXA 1EY6A 2WINB 4JI1Q 1JJ2A 3MC0B 3UE1A 2OQ0A 2WKCA 1WOCA 3TREA 2R3ZA 5GADC 3F8TA 2VQEL 2FFKB 3T1YL 3K5OA 1YHAA 3TMEA 1SNCA 2E2DC 2LS01 2R7ZG 1A3TA 4X64L 3FVQA 3MXPA 5GROA 5HY6A 3F2CA 1K3BC 1IKMA 4DV0L 1IZ6A 4CHTB 3LWUA 2EY1A 2VS1A 3PUWA 1LTLA 2EYOA 3BDLA 2AWNA 2F4VL 3K7AH 1X3EA 1B7YB 1PZJD 3HFZB 3H0GG 5G3LD 1RCVD 1PLFA 4HIKA 1LM0A 5CC4A 3LNNA 4LWCA 5DM63 1STNA 4HEDA 4HJ7A 3MXGA 1F9RA 1XNQL 1SYFA 2JEAI 1K0SA 3KF6A 3HOWH 2XWJB 1ZXTA 1VQDA 1YI2A 2I07B 2A73B 1MGSA 2K03A 2KCTA 4A3KG 1E0BA 2JA6H 3PUVA 1TT2A 4Z9CB 5A2QE 3D4RA 4KY7A 4BBRG 5IGFA 5IGBA 4X65Q 1CK1A 1TWGB 4L5TA 1IYUA 3VA5A 3NPPA 1YZ6A 2CH4A 4DV6Q 4HJ5A 3RLFA 2A69D 4K2LA 3TZDA 1G6PA 5C3EB 1XPRA 3M4QA 1HNZL 3KDFA 4C56C 3RZDB 4JPBW 1I50B 2BCOA 2OCEA 1JB3A 4ME3A 2EYLA 3LGJA 4PNYA 1EQRA 1VMCA 2VQEQ 3T1YQ 5FLXE 3VR3A 1EOTA 3CP0A 4X64Q 5FKAC 2E2JB 2IX1A 1R4QB 3EN2A 3PO3G 2WB1G 2NBFA 2R61A 4KLKA 2EYJA 4FXKC 1TWHB 1HA5A 4DV0Q 1GM5A 1AE2A 2SNMA 5C4JB 5GQOA 1QUQB 4DR6L 5CORA 3J81i 2UUAL 2F0IA 4QL5A 2E5LL 4DN4M 2F4VQ 4DR7L 3I4MH 4B08A 3GTKH 2K5QA 4F87A 4FVMA 3QB3A 3RLNA 4JI2L 4BXXH 4A3JG 1EWIA 4P75A 3ULJA 1XNQQ 1KXLA 1SYBA 4DV4L 4G7OC 2E75C 1Q8KA 5CV4A 1JE4A 1EOVA 1C7YA 3HOUB 1E7ZA 1BDOA 3GTGB 2KEEA 4LFCL 2WACA 1GUWA 4IPDA 3VDYA 3DM1A 3VR4A 1S3OA 1LTAD 5D65A 2XVSA 1WFQA 1OXXK 1C8CA 2UXBL 2B2WA 4A3MH 1SE4A 3CCRA 1D1IA 1VF5C 4LMQD 3U4VA 2DGYA 1LYLA 3TS0A 3PQIA 3NBHB 3HZXA 5ISRA 3MVVA 3S14B 1TXYA 4UP9A 1D1KA 4BY1B 1E1TA 1HNZQ 2ASBA 4XXEA 3NSWA 2RVLA 1QNKA 2RCFA 4B3TL 5M5XB 4O2DA 3S1QH 4C3IG 5M3FG 5KYIA 1LT3D 2GN5A 3FP9A 1B9MA 2GVAA 5JVG3 3M4YA 3NEMA 1II3A 4R8IA 2Q8TA 1QWYA 3QWNA 3RN2A 3BG3A 3D3RA 3CMAA 1NCVA 1VQMA 3HOVB 2UU9L 3E3XA 4HIOA 1NR4A 4LW1A 2UUAQ 2E5LQ 2F0KA 2ZT9C 3MWYW 5EPLA 4JW0A 4ZYSA 1B3AA 3C3LA 4DR7Q 4BBSB 3E0EA 2F0PA 2OWOA 3L0OA 3OIQA 3VYRA 3J7AF 1CZWA 1FNWA 4JI2Q 1E2ZA 4I65A 3TP8A 3H3VC 4DV4Q 1VQJA 1SMYC 5FLXc 3PO2G 1QILA 3KF8A 1ESRA 5IYBH 3T51B 1K28A 4ZRZA 5KGUA 1E2VA 2EY5A 3TP7A 2HHHL 1QVGA 2EJMA 1H9JA 2UXBQ 2K5WA 3DUZA 4R4CA 4KD3A 3BU2A 1JR0D 1PRTC 1SSOA 3STBC 5DNFA 3QOJA 3EIVA 2AUJD 3DM3A 1UEBA 1Q12A 1QZHA 4GOPC 3D4WA 3A8KE 1LLRD 3GQBA 5EGTA 2O5IC 1TQOA 1H9RA 5D3IB 5C5MA 4QQBX 5EPJA 4DPGA 5M5YH 4IUVA 5C3XA 1K8AC 1FNVA 2JXMB 1WD0A 3HOWB 5I2YA 1O78A 1NE3A 3T56B 2B2YC 2NZOA 3I4OA 5J39A 4UP7A 4YWLA 1AP0A 3Q23A 4GN4B 3SK4A 4CKBA 4CKCA 3RZOH 1YVCA 4DNTB 5IY0A 4JOIA 2OQKA 2CWPA 3SDZA 4DR5L 1IKLA 2L1BA 4HSPA 3X3MA 5IYDH 4H44C 3CAMA 4QCLA 2B2UC 2KEDA 3GTMB 3FKIB 4HR7B 1HR0L 2F0FA 2VUMB 5T1GA 1P16A 3MXNB 4K8JA 1BUVT 1GJXA 3D31A 2TSSA 2KJXA 3CRLC 4F88A 3HG9A 1BOSA 1U4LA 2MHVA 4BY7H 1PH6A 2N3SA 1SRUA 1UWVA 5C0XI 5EBCA 4KKUA 1IBML 4BA1I 5C5LA 2KECA 4OWWB 5JPNC 4HSVA 2ZJPA 1ZEQX 1W6JA 4LF5L 2HHHQ 5C4XH 1ASZA 1PDQA 3MEFA 1PRTD 1GKHA 1LTTD 3STBD 3GD7A 1PFNA 3HOXB 3I4MB 1VQOA 1XTDA 4OEMB 1FNUA 4KK7A 1KRTA 2OF1A 1JB7A 4ID6A 1JWMD 1YHBA 5G3LF 4DAMA 5M5WB 3Q6SA 2VY3A 2D9UA 1I4QA 2I0QA 4K5WA 2L15A 4R8NA 1R4PB 2RDFA 2NVYH 4QF4A 1F9QA 2KUMA 5IYCG 1X55A 4IPCA 3CC7A 5JJZA 4IOCA 5C0XH 1NMFA 4DAYA 1PZID 4X3UA 1EY5A 3GV6A 3PCOB 1MJCA 2JQOA 4XIGS 4PMBA 1SE8A 1HR0Q 2V1CC 3JAMi 1CKNA 4KKTA 1TS3A 2QDLA 2HUGA 2RKSA 4O42A 1Q8IA 2CVRA 3PF5A 5K36G 1QJOA 2A68C 3M4PA 4HJ9A 4ZUIA 1CA6A 3HOUG 5FJ8H 1CSPA 1DXMA 4A93B 2HCIA 3CCSA 5ELBA 2PI2E 3SE0A 5AJ3L 2OXPA 1BNZA 1PTOH 3MXUA 2P5ZX 4KHPL 1HTPA 5ELDA 2L12A 3KBGA 4YIJA 1XXGA 2QCPX 4NP5A 4A76A 4YCVA 1QVCA 2CHBD 2PW7A 4YCUA 4LF5Q 4DV3L 4GNXC 1NSNS 5CMDA 4J6HA 1ILPA 2EVBA 4JBKA 4BY1G 3OIPA 1X9NA 4P72A 5FO8B 1Q90A 4FF4A 3M9BA 1JOOA 4K6DA 1RTNA 5I6WA 5KRUA 4MNOA 4C2MH 1SEBD 4YY3L 2R7DA 2LKVA 3KDFB 1RKNA 3BZCA 1PVOA 1OXSC 4QY7A 4FF1A 1D7QA 4XDXA 5GAEC 4B9WA 2K1BA 3ER0A 3HOVG 4LF9L 5BN5A 3M3YH 2NVTB 5GAHC 4IUUA 2Y0SB 4DV2L 3PUXA 2IY5B 4BBSG 3T53B 1B44D 3NBIA 4CDFC 4HJAA 3HOYH 1QE6A 1CZGA 1BBWA 1ZYRC 4KN4C 3HP3A 4XQJA 2RQXA 4IOAA 5JEAJ 3NBHA 2F0OA 2K5VA 3DEPA 2NZ1D 4P71A 1JJCB 1HZ9A 1AZPA 4LF7L 2Q2TA 5AJ3Q 3ND8A 4RG1A 2IL8A 2IT1A 1YNND 1KTKA 3L9AX 3I55A 4KHPQ 5IGDA 4P73A 2EYHA 2KVMA 1SDFA 4DAVA 2BDNA 4ZUJA 3SGIA 1E3PA 2F0GA 3BS1A 4DV3Q 2Q2HA 1U0LA 4DK3C 1IYVA 5ELNA 5DLQE 3H3VI 2Z1CA 2Y0SE 4TVAB 1PXUA 3E9HA 4MTKA 3IRBA 1TS4A 1Z47A 5CYUA 3J7AV 1NUCA 5EJWA 4DFAA 1STAA 2UXDL 3R2TA 4R4QA 2B2TC 1KIXA 5ELFA 2AQ1B 4N9PA 4PZ8A 2G9DA 3IFDA 4YY3Q 2ZTEA 1TU2B 4WRDA 3CQZH 1IW7C 5T1IA 4H7BA 1BQQT 4EQNA 2SDFA 4LF9Q 4LF6L 4CJ0B 4KY5A 5AFWA 1V9PA 4KN7C 3FKIG 3RD4A 5C4XB 3P7JA 2VUMG 2XNAC 2NN6I 3BDOA 1WTQA 1XYIA 3BYTB 3S17B 3U58A 5F2DA 4IJLA 3TS2A 1UAPA 3VR5A 4OX9L 4RH6A 1LTID 1CKOA 2JA9A 3R3OA 2K4KA 1JORA 4AYBE 1FJGL 4E6IA 4POGA 2BOSA 2G5DA 4IUNA 4O0AA 1VQKA 4LF7Q 2J0TD 3RR5A 2F4IA 5CR3A 5CV9A 2KQ3A 3TP6A 2NVYB 5KEEA 2D62A 4X66L 4ULLA 3S2HB 3KF8B 1K8OA 2F0EA 1ENCA 2DUDA 1Q81C 2EOTA 3TZUA 3E9IA 3HOXG 3UDGA 3HGBA 3I4MG 5IGCA 4HMJA 4FNFA 2C35B 3I90A 1BF4A 1VQ6A 2KCMA 3SK6A 1V1OA 2NN6H 1TVXA 3P75A 2GA4B 1EQQA 2ZXRA 4C3HB 3TN2A 2NWGA 3LX0A 3R2IA 4A3GH 1DJRD 1ENAA 1I6HH 3KJPA 1LTSD 5FLMH 4K2KA 4GNXA 1Y8PB 3W1GA 1IBKL 4NPSA 3VA7A 3OSOA 4LF6Q 1OXTA 2ZM6L 5I6YA 1HHVA 2B39A 4JI0L 1PMRA 4NKLA 4EQPA 4OX9Q 1PRTF 4A93G 2L11A 2R92H 4JG2A 3WDNA 2B63B 5E4WC 1EUJA 2I46A 1FJGQ 2PI2A 1PZKD 1WTHA 4C2MB 1GHKA 1VQ5A 3D6WA 1HTLD 3VYSA 4A3FB 2IX0A 3M7NA 2J7ZA 1NTGA 2K32A 4GN5A 5JOBA 1TS5A 4X66Q 1AZQA 5DAUA 2RDHA 1EY0A 2BA0A 4RHRA 1LV9A 3M3YB 3UDFA 3T16A 1UUPA 2RSOA 3F1ZA 2MQHA 1PFBA 4OGQC 3K80C 3ULPA 3HOYB 1O7IA 1WTOA 3P20A 1STEA 3NWTA 1Q7YC 4TRDA 2K75A 4X3KA 1PFSA 3PUYA 3H15A 4DV7L 1F2MA 1SXTA 1O7LA 1KD1C 2OT2A 2JA8H 3J81E 4GKKL 2E2HH 5IYBG 3SR1A 3GTLH 2X69A 4M8AA 1BBXC 3KFUA 4N9TA 4ZLTF 4XQNA 3J81j 3WWVA 2PNRC 1SYDA 2Y0SG 1NAPA 1IBKQ 3G71A 4P2CB 3KLRA 2WKDA 2ZM6Q 1UNSA 3G48A 1PTOC 2C9OA 1ML0D 1LUZA 1VF7A 2EXDA 3S1MH 3BVGA 4JI0Q 4B3RL 4DAYB 1EL0A 4A3LG 2HDLA 2B2TA 3T13A 2CQAA 2FMMA 4KKSA 4K14A 4JV5L 4EGVA 3TBIB 5IP9H 3OW2A 1SYEA 1CKNB 4R4TA 4PMWA 4CDDC 5C6AA 1KLGD 3A54A 1MBYA 2BE5C 1C48A 1LT6D 1K9MC 2F0NA 2CFMA 2N8NA 3CQZB 3K7UC 2KHIA 1L0YB 3LWEA 4RFBA 1K8GA 3FRPB 1W6KA 1L0WA 5J1ZA 2M2LA 2QDBA 3J7A5 1U5KA 2E2IB 5IYDG 4IFDJ 1M90C 1G8ZD 4RCNA 2BH2A 1UE7A 3M85A 4DR1L 3DEOA 5JEAG 1TR5A 1KAWA 5E3FA 3NTHA 4ZQ3A 4NXNL 3VR6A 3GTJH 5I2XA 4DGZA 3M4OH 2PO4A 1JQYD 2PZWA 1WTRA 3SXHA 3S9WA 1D8LA 1U4MA 3HRZC 2KOLA 1H95A 4L6TB 1KDCA 1ILQA 5CGKA 1EY7A 5C3WA 4DV7Q 4NB3A 4BS9A 4A3BH 1VQAA 2JA7H 2N49A 4GKKQ 3OPOA 2I5MX 2E8GA 4K6LA 4A3DH 2CWAA 2M00A 5I4DA 2L4NA 4XTCS 2AQ3B 5C4XG 4LUVA 4OHJA 1CA5A 1GD7A 3SVMA 1U4PA 4OO1I 1QNUA 3ERSX 4A3IB 5C44H 1PRTB 2ES2A 1PTOD 4B3RQ 3HOZH 1EEFD 1XJVA 3CXCA 5LMNW 4JV5Q 3UE0A 3ITPA 5HGQA 5M3MH 2KBNA 1U9RA 2N88A 2O2LD 2PYKA 2RA4A 4DR3L 1R9TB 2DNCA 5IOCA 3L2PA 4YWKA 4FXGC 3DXJC 1ET9A 1I3QH 2Z6KA 2WAQE 1SYCA 4PQXA 1Y1WH 2R7FA 3BJUA 1G6ZA 3TP5A 1YJNA 3KOJA 3UI2A 1YNXA 5IP7H 2C5CA 2ENBA 3I4NH 3S15B 1FGUA 2F0TA 3QG1A 4DR1Q 1PH9A 4NXNQ 4ILWA 3GTOB 4YCWA 3HKZE 3KLWA 2EYFA 4JK1C 4V0BA 2RSNA 1SLJA 1CUKA 1Y1VH 4QIWE 5E1FA 5ELEA 1S40A 4N8X1 1JMCA 1TWFB 4C3HG 2SNSA 4RAUC 4OO1H 2QA4A 1MKHA 4IUQA 1I6VC 4DR6Q 2D5DA 3B6YA 4ZK9B 1HNXL 2VQFL 2EPBA 2CH4W 1SNQA 4PZ7A 1STYA 1N8RC 3I72A 1J5EL 2JA5H 4C3JH 2CQOA 3GV3A 4DU9A 5CV8A 4MN3A 2XGTA 5K5PA 1G2TA 2HQLA 1EU4A 3I2ZA 4LFCQ 2JN4A 3KYHC 2YTYA 3I70A 2B63G 1UE5A 4RGMA 1STGA 1TS2A 1QOHA 5KYLA 4AIMA 4EQOA 1BCPC 1LTBD 1S5DD 3CCQA 4DR3Q 4A3FG 1Q82C 1TY2A 4JBMA 3GP7A 1K83H 3K7AB 1KQSA 2E2HB 2AQ2B 4O1NA 2HQEA 3H0GH 1Q3LA 4K5XA 2A6HC 1B1ZA 3U4ZA 4DNRB 1XMOL 2DY8A 4JI6L 1VQHA 4B3TQ 3ONAB 1B53A 1KLUD 4A3CG 3FHWA 4I7ZC 1CFMA 3CCUA 1L2FA 5ELCA 3HOYG 1Q1EA 1B70B 5ELOA 1SR3A 2O4XA 1T5EA 3E5SA 3H09A 3TDQA 4J15A 2JA6B 1YITA 2RBMA 3EVQA 3F2DA 2F1MA 2F0JA 4JBWA 2EY6A 4BBRH 2UU9Q 2OTLA 4NW2A 1HNXQ 1NMGA 4GS3A 2VQFQ 1X6OA 3FMCA 3JAME 4DKAC 2K14A 1WTXA 4QJFA 2EJGC 1J5EQ 2F3VA 3FDTA 2A74C 4ZKCB 5IT9E 2FHTA 2QEJC 1S5BD 2RDGA 2PCFB 3BZDB 4GNXB 3ZYYX 2BH8A 1SMYD 3J80E 3UDIA 3CCVA 3N6RA 4IALA 3KLSX 1KL9A 4YHHL 1AE3A 3PO3H 3A0JA 2HCCA 1O7YA 2B2VC 2MJ8A 3PSIA 3I4LA 1SE3A 4OXPA 4JI7L 1JT8A 4JVZA 5C3EG 1J9OA 5CBEE 1HZCA 2YV5A 1ICFB 1WTVA 1D2BA 1FYCA 2JA7B 3GTKB 3S2DH 1PV4A 1XMOQ 2A6HD 4RCOA 3E6ZX 1Z7TA 4JI6Q 2NVQH 4A3JH 4ODGA 1QVFA 2UUCL 1VQBA 3GTPH 4CKEA 3EFXD 1PH7A 4FF2A 2DY7A 3JC66 5C44B 2D0PA 3HOZB 3TRZA 4FDBA 4OIJA 1PH5A 1L1OC 1MIUA 3K58A 1QZGA 4DR5Q 4WJ3M 2XTIA 4R9WA 4A3MB 2Q2UA 2Z9HA 3C46A 3PGZA 4J1MA 2Q8IB 1BVSA 2WP8J 3DMUA 2F52A 2ICEC 1EWCA 1KDAA 4IFDG 5E7NA 1SNMA 1SFOH 3NTIA 1EY8A 4XYOA 4A3IG 1SNOA 2X6LA 3S1QB 4JI3L 3S1NH 4C3IH 5M3FH 3V96A 4LUZA 2A19A 1S5ED 1IBMQ 2DJGC 5IODA 5BR8L 3Q22A 1B3QA 2NN6G 2F3WA 2ZXPA 1I4HA 5A2QL 2MP1A 4QB4A 2VB3X 4JI7Q 3OHXC 2TMPA 3BVZA 3JAMc 3CMEA 3IKJA 2LSSA 3G7LA 3C1EA 4DXGA 5JAVA 2M9VA 4Y7NH 1PYSB 2IHFA 2E74C 5IT9c 2O5JC 1CQVA 2JA5B 3MFYA 4UY8C 1HJPA 3SK5A 2MUYA 3J80c 2UUCQ 2Z6BA 1HZBA 4IUPA 1LO5D 3PO2H 1EY4A 1GHJA 4HJ8A 5FLXL 3F2BA 1IL8A 4JC0A 1GXDC 3NQIA 3AFQA 3OWFA 1PTOF 2NTTA 4DNIA 3Q24A 1VQ4A 4DK1A 1STBA 1CHQD 2H1EA 4GOPA 2K7VA 1EIGA 3AMUA 3CCLA 1OXUA 3NXWA 2ZTCA 2KHSA 3M7GA 3A8IE 2AWOA 1K83B 3FPPA 2VXWA 4X3SA 2KA7A 3H0GB 1S72A 4G7ZC 1WTPA 1JJGA 2B2YA 3BVMA 3RMHA 3ULLA 2A68D 5M5YB 4L5SA 4IN3A 1KNEA 1X3FA 2HD3A 1MD2D 4JI3Q 1EYDA 4JI5L 1MJEA 1PHJA 2IW3A 2AKWB 4OL7A 4CBVA 2SEBD 1T9HA 2JYOA 5BR8Q 1VQNA 3CKIB 4Q0FA 2SOBA 2KHJA 3RZOB 2B2UA 5I9PA 2VL6A 4RWSC 4DK6C 3IAYA 1X54A 1WCMH 1KRSA 5BN3A 4AYBB 3MHBA 5FK9C 3D8GA 4HAEA 1BBUA 2L0CA 1NR2A 4LF8L 4RGTA 1C9OA 3HOWG 1JOKA 2ID0A 1XNRL 4BY7B 5C4ZA 3NK9A 2HIXA 1U4RA 4P74A 1Q46A 1B2TA 4MTNA 2JA6G 3J7YW 4CGYB 4LAAA 4OWTB 2B2VA 3URYA 1LACA 3KLSA 3G6EA 5GAGC 1TWGH 2WB1B 4DV2Q 2BDOA 5DEHA 5IE8A 5C0XJ 1M4VA 4KHZA 1AN8A 4PV1C 3PIPA 1YJ9A 2WFWA 1CSQA 1O7ZA 4MIUA 5CV6A 1ZYRD 5A35A 3RZDH 1LT4D 1I50H 3L3OC 3V05A 4FP5D 4FYDA 2NVQB 1SMXA 1RJTA 3E0JA 1Z6HA 1PYBA 1VQGA 3QIAA 4JI5Q 3GTPB 1E1OA 1A0IA 3C1FA 1IL2A 1MSGA 3K5LA 2E2JH 1I5FA 5LL6X 2PPBC 1EWHA 1VQPA 3RLOA 4K8IA 2AUKA 2K6AA 3S16H 1TWHH 3GTQH 5IYCH 2JSOA 1EU3A 5C4JH 2MO1A 2QF7A 1D5MC 4R1JA 1TY0A 1F77A 2JA7G 2EQSA 3MA2B 1ENFA 2WB1E 3D4DA 4BXXG 2UXDQ 1K0RA 1PH1A 4LF8Q 4DUZL 1D6EC 1SFOB 4LNQA 5KNBA 3PIP3 4ALPA 1TKWB 3QJYA 1YIJA 4BA2I 5K36H 2B3GA 4DK0A 2Z4HA 2A8VA 1XNRQ 4PG3A 3HOUH 1MI2A 1PH8A 4PMCA 3GTGH 5C44G 1CHPD 1PTOB 3OMGA 3PUZA 1CI3M 4C3IB 1IW7D 4ME5A 5M3FB 2B8GA 2G9HD 1XMQL 5I9OA 1X3GA 4A3MG 4A4IA 1JCKB 2YTXA 1L0XB 1TWAH 3MTSA 2K5NA 2PZTA 5LL6S 3NTKA 1VMPA 3K0YA 4X62L 4BY1H 2VNUD 4Y7NB 2JP1A 1GVPA 1H9MA 1WD1A 2HIVA 5IP7G 4WJ4A 4ZAIA 1Q1BA 3GDEA 4HIMA 2L55A 1WI5A 3CCMA 3I8ZA 1GUNA 3AFPA 4OO1G 1VS0A 1CQFA 1NBWA 2VW9A 4L5RC 2R93H 4WJWA 1CKMA 2A69C 1IYJB 4DV6L 1VQIA 2ZTDA 1EIHA 3ND9A 1QCBD 1F9SA 4WORA 2JA5G 3SHLA 4KHVA 4DR2L 4DUZQ 2IWHA 3RNUA 1K3RA 1RHPA 1F2YA 4JI4L 2IX3A 1RF2D 2MGSA 3G6JB 5C4HA 1A3UA 4QUCA 1YJWA 4FF3A 5HGTA 4DUYL 4L5QA 1Z9FA 1E2WA 1XMQQ 1HUNA 4G4KA 5EKIA 2XSCA 1HUMA 5IGEA 1AH9A 4RKLA 5L37A 1A15A 1WCMB 5CV7A 3CC2A 2JK8A 1PA6A 4FO2A 2QW7A 4X62Q 4H02A 4BWGB 1I4RA 1V1QA 1QG7A 3NHHA 2AHOB 4IZ8A 3PF4A 3NWSA 4QMGA 1JWSD 2LY7A 3DLLA 4KTAA 1G2SA 4A3EH 4HMIA 1KABA 4F8MA 2F03A 2XIWA 1B50A 1HQRD 3DWQA 1KAAA 4AYBG 4UHVA 4JOIC 2UUBL 2K05A 3GTMH 3FKIH 3Q0AA 2VUMH 2WIIB 3K0XA 1HA6A 1XTCD 5LMNL 1LT5D 5D14A 3X3NA 3S1RH 4LJZC 2Z0SA 1AW7A 4HTHA 4DR2Q 2RCNA 4BY7G 2WAQB 4IJHA 4GZYC 2NTSA 1GUSA 1Y8OB 4JI4Q 3I3CA 1IHZA 3CHBD 1RL2A 4GKJL 1NY4A 1PFMA 1VQFA 1V1PA 1Y8NB 3CCEA 3MAQA 4DUYQ 1N36L 4H13C 4JI8L 1P8LA 4APVA 3NUCA 1G91A 3D0FA 1EYGA 2DN8A 1F9PA 3H91A 4N8FA 5J3BA 4ABNA 4HN7A 3HKZB 2ZJRA 3S16B 1HFNA 3GTQB 1JWUD 4DAPA 2F0VA 2YYZA 5LMUL 4QIWB 1BCPB 2XWBB 2PNHA 4FXDA 3HOXH 3EROA 2N55A 2PQAA 3G4SA 1AFPA 4GOPB 3U9SA 1TIID 1EFWA 3SEBA 2K28A 4YWMA 5M5WH 2YTVA 3J81c 4LUOA 1VQEA 4G57A 3I56A 3K6OA 4A3GB 3IFTA 1WYDA 4UPAA 2BE5D 4RGOS 2JEBI 1I6HB 3K5NA 3QO2A 5JVH3 2F0MA 5LHY1 4EQ5A 1XPOA 1W2BA 1FR3A 5C0XG 1ICWA 1K8MA 1X56A 1LTRD 3ERQA 4DA2A 3OOCA 1TWAB 1RDPD 2UUBQ 2L9HA 1DZ1A 4B3ML 2LFNA 5LMNQ 4K0KL 1WJJA 5EKKA 2NVXH 1GO3E 5FJ8G 2CKZB 2CW0C 2R92B 4AH6A 2IHEA 4A93H 3CPFA 4KI0A 4HIDA 1BR9A 1VDZA 4GKJQ 1RODA 4TSSA 4XT3B 4CJ1B 1HXYD 3AU7A 1N36Q 4JI8Q 1GUOA 2KCNA 2OEOA 4KMUC 5KNCA 3CW2C 1KC8C 2FJ2A 1VQLA 2R93B 1I94L 1PH4A 2LMCB 1ONLA 1BKBA 5LMUQ 5H1SE 4ZCKA 5EAYA 4S3SA 1EY9A 1H9SA 1TWCH 2R7ZH 4H0LC 2MPMA 2MNAA 1GUTA 1EQTA 3F2UA 4A75A 1YHQA 4EVOA 1J8IA 4B3SL 3DWPA 3MFGA 4OONA 2JA8B 3K8AA 4DV5L 1VQ8A 3GTLB 4F7XA 1Y69U 1N9WA 2E76C 3AYHB 3CD6A 1BO0A 3R8BA 1UE6A 2NVTH 1C0AA 1L1OB 1D5XC 3A55A 1N32L 3A56A 1EIFA 1BXTA 2EY2A 3GO5A 3S1MB 1RIPA 4B3MQ 1X32A 2Q8RE 3FEWX 4Y52H 4K0KQ 1PH3A 4A3LH 4A3KH 2F0HA 1GUGA 1I4PA 2NYZD 1PH2A 2YU9H 2H5XA 1SE2A 1CTMA 3DWAA 4POFA 2CW0D 4V190 4KJOA 3CU7A 2I5HA 2F0QA 1DM0B 3OYYA 1B8AA 4Q5VA 3W2DA 2EYPA 4IO9A 1N33L 1SROA 4A3EB 4WFN3 2PZUA 4CJ2C 2KCCA 3HS0C 2B8FA 4GLXA 2IJ0A 3N52A 3OW7A 3EBEA 1O80A 4MHEA 1I94Q 5E4XA 3A74A 1WCMG 1HRJA 2XRQD 5JPMC 4U673 3S24A 5JJLA 5JEAH 2MO0A 1M1KC 3GTJB 1SYGA 2V4DA 3M4OB 4J8QA 4KY6A 2F0SA 4NDXA 4X6AH 2UXCL 3NELA 1F2ZA 3K59A 1SN8A 2PW5A 3S1RB 4RKBA 2NUCA 1X65A 4R4OA 1M8AA 4QGUA 3CCJA 1BCPD 1A63A 4B3SQ 4A3BB 3W5OA 3I91A 3NE5B 4XQQA 1N34L 4DV5Q 4A3DB 1YBYA 1HFGA 4GN3B 2F3IA 3PMFA 4DR4L 2HDMA 1HZAA 2N78A 4K5VA 1DOMA 1N32Q 1NJIC 2K01A 1ET6A 1QB5D 3QOLA 4UAIA 3S17H 1YNJC 3Q8DA 1HPCA 1V43A 1A2UA 2EJFC 5IGGA 2OTJA 1EEID 1DYQA 1HR0W 5EKLA 3QR8A 3PV0A 2WAQG 2X6GA 3ZJYC 3RN5A 4R4IA 3EJIA 1F2LA 5M3MB 2EDGA 3OMCA 4XT1B 2D2CC 4I7AA 1JICA 2RHSB 1G291 1SNPA 5HURA 1EIYB 3EA6A 2EXZA 2K33A 1I3QB 3J81L 2F0DA 3PIOA 1MHWC 1FGBD 1N33Q 1STHA 3WOEA 3S2HH 1H9KA 1EYCA 3BYYB 3HKZG 4AQYL 1Y1WB 2FXQA 2PMZB 3AB9A 4RA8A 1S5FD 4IUTA 1XPUA 3W3AA 5J22A 3I4NB 4DF7A 5M9OA 4TQUS 3AEVA 3U9OA 3A8JE 1I4XA 2K5DA 2ALYB 4YHHQ 4CDCC 2K5HA 1OTCA 3C2PA 4LFBL 1Y1VB 2UXCQ 4L63B 2NVXB 3L7ZC 2LXJA 4C3HH 4A3GG 2I5LX 2AMCB 2LXKA 1PYWD 2F0UA 4LF4L 2ATWA 3J80i 1B9NA 5FLMG 1YNNC 1N34Q 2B29A 4HCEA 3D6CA 3TSSA 3J7ZC 1HNWL 4EX5A 3KF6B 4U68A 1OO9B 5KIXA 2KENA 5EQ0A 1EYAA 3NQTA 1SAPA 4C3JB 1CM9A 4DR4Q 3VR2A 3SK8A 2QEXA 1DOLA 3PIO3 1S4ZA
chains in the Genus database with same CATH topology
2BH2A 4BXXG 1UE7A 3M85A 2UXDQ 1K0RA 4DR1L 1PH1A 4DUZL 4LF8Q 5JEAG 1KAWA 2PMZE 4LNQA 4NXNL 4QQBX 3GTJH 4DPGA 5M5YH 4ALPA 1YIJA 4BA2I 3M4OH 2B3GA 1K8AC 4GOPC 2A8VA 4PG3A 1QUQA 1XNRQ 1PH8A 3GTGH 3HOUH 5C44G 2R92G 1NE3A 1D8LA 2NZOA 3PUZA 2B63H 3I4OA 3T1HL 4UP7A 1H95A 4YWLA 4DV7Q 1W3SA 4GN4B 4NB3A 4A3BH 1A8VA 1VQAA 1YVCA 4A3FH 5IY0A 4JOIA 1X3GA 3OTOL 1XMQL 2N49A 2OQKA 4A3MG 2JA7H 4A4IA 2I5MX 2E8GA 4GKKQ 2CWPA 4DR5L 2YTXA 4A3DH 2CWAA 2D0OA 1TWAH 2K5NA 5IYDH 3CAMA 2VZAA 4AQYQ 2R93G 4XTCS 1HR0L 5C4XG 4LUVA 1P16A 3MXNB 4X62L 1GD7A 2ZJQA 4BY1H 3D31A 4OO1I 1J6QA 2VNUD 4A3CH 3ERSX 5C44H 1KHIA 2ES2A 1GVPA 1UE1A 2HIVA 4B3RQ 5IP7G 3HOZH 4BY7H 4WJ4A 1OXVA 1XJVA 1PH6A 2N3SA 3CXCA 5LMNW 1SRUA 1A62A 1Q1BA 3GDEA 1FVIA 4HIMA 4JV5Q 1UWVA 3UE0A 4LFBQ 5HGQA 1Y14B 5C0XI 5M3MH 1WI5A 2KBNA 2PQAB 3CCMA 4GLVB 4DR3L 1IBML 2JA8G 4BA1I 1IXRA 3L2PA 3AFPA 4OO1G 4YWKA 1VS0A 4LF4Q 1K73C 4OWWB 1NBWA 2ZJPA 1I3QH 2Z6KA 4LF5L 2VW9A 4L5RC 2HHHQ 2R93H 3AQQA 2Q2IA 2WAQE 5C4XH 1ASZA 1HNWQ 1Q86C 3TEHB 3MEFA 1Y1WH 1CKMA 2R7FA 1IYJB 4DV6L 3BJUA 1GKHA 1VQIA 3STBD 3GD7A 2ZTDA 1YJNA 3KOJA 1YNXA 5IP7H 3I4NH 1VQOA 1XTDA 2JA5G 1FGUA 1KRTA 4DR1Q 4DR2L 1E24A 4DUZQ 1PH9A 1JB7A 3RNUA 1K3RA 4NXNQ 1YHBA 4DAMA 4YCWA 4JI4L 3HKZE 3KLWA 4JBJA 2VY3A 1SLJA 5IP9G 2I0QA 1CUKA 1Y1VH 3I7FA 2L15A 2A1AA 4QIWE 1YJWA 1S40A 1JMCA 1DGSA 2QA4A 1MKHA 2NVYH 4DUYL 4L5QA 3T1HQ 4DR6Q 1Z9FA 4IFDI 3B6YA 4PZ6A 1HNXL 1XMQQ 3OTOQ 5IYCG 2VQFL 1X55A 4IPCA 3CC7A 4A3EG 5C3EH 4IOCA 1VQCA 1NMFA 4PZ7A 1N8RC 3PCOB 1MJCA 2JQOA 1J5EL 1AH9A 4XIGS 2JA5H 4JYAL 4C3JH 2E2IH 3A5ZB 1SE8A 1HR0Q 2V1CC 3CC2A 3JAMi 1CKNA 2CQOA 2JK8A 1PA6A 3ICEA 4X62Q 2XGTA 4H02A 2HQLA 2RHQB 3I2ZA 1V1QA 3PF5A 5K36G 4LFCQ 1L1OA 2AHOB 3KYHC 3M4PA 4HJ9A 4LFAL 3HOUG 3PF4A 5FJ8H 1CSPA 1VQ7A 2YTYA 1JE5A 3CCSA 1HH2P 2PI2E 3DLLA 5AJ3L 2B63G 1UE5A 4DV1L 2QGQA 4KHPL 4A3EH 1E22A 5IWAL 1IBLL 4A3BG 3CPWA 4AIMA 3H3VH 3CCQA 2RF4A 4DR3Q 4A3FG 1Q82C 4JBMA 4NXML 4MZ9A 3HKSA 4A76A 1K83H 4YCVA 4A3DG 1QVCA 4YCUA 1KQSA 3BZKA 3CC4A 4LF5Q 2BA1A 4DV3L 2GVBA 4GNXC 3H0GH 4AYBG 2K50A 4JOIC 2UUBL 3GTMH 3U4ZA 1XMOL 2CCZA 3FKIH 2VUMH 4JI1L 4JI6L 1VQHA 4JBKA 3K0XA 4BY1G 4B3TQ 3NENA 5LMNL 4P72A 2EIFA 1X9NA 4A3CG 3FHWA 3S1RH 4RMFA 4A3IH 2Z0SA 1L2FA 3M9BA 3CCUA 4DR2Q 3HOZG 3K81C 2RCNA 4BY7G 3HOYG 1Q1EA 1B70B 5ELOA 4IJHA 3U50C 2K52A 4JI4Q 1SR3A 4MNOA 4C2MH 4YY3L 2R7DA 4J15A 1RL2A 3BZCA 3KDFB 5M3MG 1NY4A 1OXSC 4QY7A 1VQFA 1YITA 4GKJL 1PVOA 1D7QA 3F2DA 3CCEA 1R9TH 2MFIA 4JBWA 4UP8A 4BBRH 4DUYQ 2UU9Q 1N36L 5GAEC 2OTLA 4JI8L 2NZHA 1P8LA 4APVA 3D0FA 1HNXQ 3ER0A 1EYGA 1NMGA 4GS3A 2VQFQ 5J3BA 4LF9L 3W1BA 3HOVG 3M3YH 2ZJRA 1X6OA 5GAHC 4DKAC 2JJQA 2K14A 1Y1WG 4QJFA 4DV2L 3S14H 3PUXA 2YYZA 5LMUL 2IY5B 3TQYA 1J5EQ 3GTPH 4BBSG 2Z6KC 1VQ9A 3KJOA 4JYAQ 4HJAA 4JCVE 2PNHA 5M5XH 3HOXH 3HOYH 3I4NG 2PQAA 1BBWA 3G4SA 4GOPB 3S15H 4GNXB 3UDXA 1EFWA 5JEAJ 4IOAA 2BH8A 4YWMA 3UDIA 5M5WH 1G51A 3CCVA 3GTOH 2YTVA 2K5VA 4LFAQ 4LUOA 3J81c 1VQEA 5JJKA 1Y1VG 4P71A 4GLAC 1KL9A 2JE6I 3I56A 1JJCB 1HZ9A 4YHHL 1ASYA 2Q2TA 5AJ3Q 4LF7L 1TWFH 1WYDA 4UPAA 4OWXB 1AE3A 3PO3H 3A0JA 4IPGA 4RG1A 4X65L 2JEBI 4DV1Q 3HOVH 2IT1A 4KHPQ 3I55A 4JI7L 5JJIA 4OXPA 3PSIA 5IWAQ 1IBLQ 1JT8A 4P73A 4NXMQ 4EQ5A 5C3EG 3CF5A 1XPOA 1FL0A 1HZCA 1E3PA 2YV5A 3SGIA 1X56A 5C0XG 1W2BA 4BBSH 4DV3Q 2R6GA 2Q2HA 1U0LA 4IPHA 4DK3C 2HT1A 3A5UA 1VCIA 1YEZA 5DLQE 5ELNA 2UUBQ 3S2DH 1PV4A 1XMOQ 3H3VI 4JI1Q 1JJ2A 4JI6Q 4B3ML 3UE1A 2Y0SE 4TVAB 2OQ0A 4A3JH 1WOCA 3TREA 5LMNQ 1VQBA 2UUCL 1QVFA 4K0KL 3E9HA 1WJJA 3IRBA 1Z47A 5GADC 3F8TA 1QZHA 2VQEL 1GO3E 1PH7A 2NVXH 3T1YL 2UXDL 5FJ8G 1YHAA 4R4QA 2CKZB 3JC66 1KIXA 2D0PA 4AH6A 2R7ZG 2IHEA 4X64L 4A93H 3CPFA 4PZ8A 5GROA 5HY6A 3TRZA 4KI0A 3F2CA 4FDBA 4YY3Q 2ZTEA 1PH5A 4HIDA 4GKJQ 1L1OC 1MIUA 1QZGA 3CQZH 4DV0L 4DR5Q 1IZ6A 4WJ3M 2XTIA 2VS1A 3PUWA 1LTLA 2Q2UA 1N36Q 4JI8Q 3PGZA 2AWNA 2F4VL 1BVSA 3K7AH 2WP8J 1X3EA 1B7YB 3HFZB 3CW2C 2F52A 3H0GG 4LF6L 4LF9Q 1KC8C 4HIKA 1V9PA 1VQLA 1I94L 1PH4A 1LM0A 4IFDG 3FKIG 5E7NA 1BKBA 5LMUQ 4LWCA 5H1SE 1SFOH 2VUMG 2NN6I 4HJ7A 5EAYA 1XNQL 3U58A 2JEAI 1TWCH 3KF6A 4IJLA 4A3IG 2R7ZH 3HOWH 3TS2A 4OX9L 4JI3L 3S1NH 1CKOA 2JA9A 4C3IH 2K4KA 5M3FH 1VQDA 1YI2A 2MNAA 4LUZA 4AYBE 2A19A 1IBMQ 1FJGL 5BR8L 4A75A 2KCTA 4A3KG 1YHQA 4POGA 3PUVA 4B3SL 2JA6H 2NN6G 4O0AA 4OONA 1VQKA 4LF7Q 3K8AA 4DV5L 4BBRG 1VQ8A 3RR5A 4X65Q 4L5TA 4JI7Q 2D62A 4X66L 1YZ6A 1N9WA 3AYHB 3KF8B 3JAMc 3CMEA 4DV6Q 4HJ5A 2DUDA 3CD6A 1UE6A 3RLFA 2NVTH 2LSSA 1L1OB 1C0AA 1G6PA 1Q81C 1XPRA 4Y7NH 1PYSB 3E9IA 3M4QA 2IHFA 1N32L 1HNZL 5IT9c 3KDFA 1EIFA 3HOXG 3UDGA 3GO5A 3I4MG 1RIPA 2OCEA 4UY8C 4B3MQ 1HJPA 3J80c 2UUCQ 4ME3A 4K0KQ 2C35B 4Y52H 3LGJA 1PH3A 4A3LH 4A3KH 1VQ6A 1EQRA 1HZBA 2KCMA 2VQEQ 1PH2A 2YU9H 3T1YQ 2H5XA 3PO2H 4HJ8A 3CP0A 1EQQA 4POFA 4X64Q 3F2BA 2IX1A 3EN2A 3AFQA 4JC0A 2I5HA 3PO3G 2WB1G 4A3GH 3OYYA 4KLKA 1B8AA 1VQ4A 4DNIA 1I6HH 4DV0Q 3KJPA 1GM5A 1AE2A 4IO9A 1N33L 1SROA 5FLMH 5GQOA 4GOPA 1QUQB 4DR6L 4GNXA 3CCLA 1OXUA 3J81i 2UUAL 4QL5A 3W1GA 2ZTCA 2E5LL 1IBKL 2F4VQ 4NPSA 4DR7L 2AWOA 4LF6Q 3I4MH 4GLXA 3GTKH 1OXTA 3EBEA 2ZM6L 2NVQH 1I94Q 3A74A 1WCMG 3RLNA 1S72A 3S24A 4JI2L 4BXXH 5JJLA 4JI0L 4A3JG 1EWIA 1JJGA 4P75A 3ULJA 1XNQQ 2MO0A 3ULLA 1M1KC 4L5SA 1KXLA 4DV4L 1Q8KA 1EOVA 1C7YA 1X3FA 4OX9Q 1E7ZA 4JI3Q 4X6AH 2UXCL 4JI5L 3NELA 1MJEA 1SN8A 1PHJA 4A93G 2AKWB 2R92H 4JG2A 4LFCL 1X65A 3RZOH 1T9HA 4R4OA 4QGUA 4IPDA 1EUJA 3VDYA 1FJGQ 3CCJA 2PI2A 5BR8Q 1VQNA 1S3OA 1A63A 4B3SQ 1VQ5A 2KHJA 3W5OA 2IX0A 1WFQA 2VL6A 1N34L 4DV5Q 1OXXK 3M7NA 2UXBL 4A3MH 1NTGA 1YBYA 4DK6C 4GN5A 3CCRA 1X54A 3U4VA 4X66Q 4GN3B 2F3IA 1WCMH 1KRSA 2DGYA 1LYLA 4DR4L 3TS0A 1HZAA 3NBHB 2BA0A 2N78A 1BBUA 3UDFA 1TXYA 4UP9A 4LF8L 1N32Q 1E1TA 1NJIC 1HNZQ 2ASBA 1C9OA 3S17H 3F1ZA 3Q8DA 1V43A 2MQHA 3HOWG 2OTJA 1HR0W 3K80C 3ULPA 4B3TL 2ID0A 1XNRL 1O7IA 4O2DA 3S1QH 5M3FG 2HIXA 2WAQG 3PV0A 3ZJYC 3RN5A 4P74A 4R4IA 2GN5A 1Q46A 3FP9A 4MTNA 1Q7YC 2JA6G 2K75A 2GVAA 1PFSA 3PUYA 3H15A 3NEMA 4DV7L 2RHSB 1G291 4OWTB 1KD1C 2JA8H 1EIYB 2E2HH 5IYBG 4GKKL 3GTLH 3RN2A 3G6EA 5GAGC 1TWGH 3PIOA 3CMAA 3KFUA 4DV2Q 1N33Q 1VQMA 3J81j 2UU9L 3WWVA 3S2HH 5IE8A 4HIOA 5C0XJ 3HKZG 4KHZA 4LW1A 4AQYL 2UUAQ 2FXQA 2Y0SG 2E5LQ 1IBKQ 3PIPA 3G71A 1YJ9A 2WFWA 1CSQA 4DR7Q 3E0EA 1XPUA 2ZM6Q 2OWOA 3L0OA 4IFDJ 3RZDH 3G48A 2EXDA 1LUZA 4TQUS 4JI2Q 1I50H 3AEVA 4JI0Q 3S1MH 4B3RL 4DAYB 4A3LG 4DV4Q 2ALYB 1SMXA 1VQJA 4YHHQ 2K5HA 1OTCA 5FLXc 3PO2G 4JV5L 4LFBL 1PYBA 1VQGA 2UXCQ 4JI5Q 5IP9H 3OW2A 1E1OA 1A0IA 3L7ZC 5IYBH 1CKNB 1IL2A 2LXJA 4R4TA 4PMWA 4C3HH 1I5FA 2E2JH 4A3GG 2I5LX 2AMCB 2LXKA 1VQPA 3RLOA 4LF4L 2ATWA 3S16H 1TWHH 3J80i 1K9MC 5FLMG 1QVGA 2HHHL 1N34Q 3GTQH 2CFMA 2B29A 2N8NA 5IYCH 5C4JH 3J7ZC 1HNWL 2MO1A 3K7UC 4EX5A 2KHIA 2UXBQ 3KF6B 4R1JA 4R4CA 2KENA 1K8GA 3BU2A 2JA7G 1L0WA 3STBC 3J7A5 2EQSA 1U5KA 3EIVA 4DR4Q 3DM3A 2QEXA 5IYDG 1UEBA 1Q12A 1M90C 2WB1E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BH2 A;  4BXX G;  1UE7 A;  3M85 A;  2UXD Q;  1K0R A;  4DR1 L;  1PH1 A;  4DUZ L;  4LF8 Q;  5JEA G;  1KAW A;  2PMZ E;  4LNQ A;  4NXN L;  4QQB X;  3GTJ H;  4DPG A;  5M5Y H;  4ALP A;  1YIJ A;  4BA2 I;  3M4O H;  2B3G A;  1K8A C;  4GOP C;  2A8V A;  4PG3 A;  1QUQ A;  1XNR Q;  1PH8 A;  3GTG H;  3HOU H;  5C44 G;  2R92 G;  1NE3 A;  1D8L A;  2NZO A;  3PUZ A;  2B63 H;  3I4O A;  3T1H L;  4UP7 A;  1H95 A;  4YWL A;  4DV7 Q;  1W3S A;  4GN4 B;  4NB3 A;  4A3B H;  1A8V A;  1VQA A;  1YVC A;  4A3F H;  5IY0 A;  4JOI A;  1X3G A;  3OTO L;  1XMQ L;  2N49 A;  2OQK A;  4A3M G;  2JA7 H;  4A4I A;  2I5M X;  2E8G A;  4GKK Q;  2CWP A;  4DR5 L;  2YTX A;  4A3D H;  2CWA A;  2D0O A;  1TWA H;  2K5N A;  5IYD H;  3CAM A;  2VZA A;  4AQY Q;  2R93 G;  4XTC S;  1HR0 L;  5C4X G;  4LUV A;  1P16 A;  3MXN B;  4X62 L;  1GD7 A;  2ZJQ A;  4BY1 H;  3D31 A;  4OO1 I;  1J6Q A;  2VNU D;  4A3C H;  3ERS X;  5C44 H;  1KHI A;  2ES2 A;  1GVP A;  1UE1 A;  2HIV A;  4B3R Q;  5IP7 G;  3HOZ H;  4BY7 H;  4WJ4 A;  1OXV A;  1XJV A;  1PH6 A;  2N3S A;  3CXC A;  5LMN W;  1SRU A;  1A62 A;  1Q1B A;  3GDE A;  1FVI A;  4HIM A;  4JV5 Q;  1UWV A;  3UE0 A;  4LFB Q;  5HGQ A;  1Y14 B;  5C0X I;  5M3M H;  1WI5 A;  2KBN A;  2PQA B;  3CCM A;  4GLV B;  4DR3 L;  1IBM L;  2JA8 G;  4BA1 I;  1IXR A;  3L2P A;  3AFP A;  4OO1 G;  4YWK A;  1VS0 A;  4LF4 Q;  1K73 C;  4OWW B;  1NBW A;  2ZJP A;  1I3Q H;  2Z6K A;  4LF5 L;  2VW9 A;  4L5R C;  2HHH Q;  2R93 H;  3AQQ A;  2Q2I A;  2WAQ E;  5C4X H;  1ASZ A;  1HNW Q;  1Q86 C;  3TEH B;  3MEF A;  1Y1W H;  1CKM A;  2R7F A;  1IYJ B;  4DV6 L;  3BJU A;  1GKH A;  1VQI A;  3STB D;  3GD7 A;  2ZTD A;  1YJN A;  3KOJ A;  1YNX A;  5IP7 H;  3I4N H;  1VQO A;  1XTD A;  2JA5 G;  1FGU A;  1KRT A;  4DR1 Q;  4DR2 L;  1E24 A;  4DUZ Q;  1PH9 A;  1JB7 A;  3RNU A;  1K3R A;  4NXN Q;  1YHB A;  4DAM A;  4YCW A;  4JI4 L;  3HKZ E;  3KLW A;  4JBJ A;  2VY3 A;  1SLJ A;  5IP9 G;  2I0Q A;  1CUK A;  1Y1V H;  3I7F A;  2L15 A;  2A1A A;  4QIW E;  1YJW A;  1S40 A;  1JMC A;  1DGS A;  2QA4 A;  1MKH A;  2NVY H;  4DUY L;  4L5Q A;  3T1H Q;  4DR6 Q;  1Z9F A;  4IFD I;  3B6Y A;  4PZ6 A;  1HNX L;  1XMQ Q;  3OTO Q;  5IYC G;  2VQF L;  1X55 A;  4IPC A;  3CC7 A;  4A3E G;  5C3E H;  4IOC A;  1VQC A;  1NMF A;  4PZ7 A;  1N8R C;  3PCO B;  1MJC A;  2JQO A;  1J5E L;  1AH9 A;  4XIG S;  2JA5 H;  4JYA L;  4C3J H;  2E2I H;  3A5Z B;  1SE8 A;  1HR0 Q;  2V1C C;  3CC2 A;  3JAM i;  1CKN A;  2CQO A;  2JK8 A;  1PA6 A;  3ICE A;  4X62 Q;  2XGT A;  4H02 A;  2HQL A;  2RHQ B;  3I2Z A;  1V1Q A;  3PF5 A;  5K36 G;  4LFC Q;  1L1O A;  2AHO B;  3KYH C;  3M4P A;  4HJ9 A;  4LFA L;  3HOU G;  3PF4 A;  5FJ8 H;  1CSP A;  1VQ7 A;  2YTY A;  1JE5 A;  3CCS A;  1HH2 P;  2PI2 E;  3DLL A;  5AJ3 L;  2B63 G;  1UE5 A;  4DV1 L;  2QGQ A;  4KHP L;  4A3E H;  1E22 A;  5IWA L;  1IBL L;  4A3B G;  3CPW A;  4AIM A;  3H3V H;  3CCQ A;  2RF4 A;  4DR3 Q;  4A3F G;  1Q82 C;  4JBM A;  4NXM L;  4MZ9 A;  3HKS A;  4A76 A;  1K83 H;  4YCV A;  4A3D G;  1QVC A;  4YCU A;  1KQS A;  3BZK A;  3CC4 A;  4LF5 Q;  2BA1 A;  4DV3 L;  2GVB A;  4GNX C;  3H0G H;  4AYB G;  2K50 A;  4JOI C;  2UUB L;  3GTM H;  3U4Z A;  1XMO L;  2CCZ A;  3FKI H;  2VUM H;  4JI1 L;  4JI6 L;  1VQH A;  4JBK A;  3K0X A;  4BY1 G;  4B3T Q;  3NEN A;  5LMN L;  4P72 A;  2EIF A;  1X9N A;  4A3C G;  3FHW A;  3S1R H;  4RMF A;  4A3I H;  2Z0S A;  1L2F A;  3M9B A;  3CCU A;  4DR2 Q;  3HOZ G;  3K81 C;  2RCN A;  4BY7 G;  3HOY G;  1Q1E A;  1B70 B;  5ELO A;  4IJH A;  3U50 C;  2K52 A;  4JI4 Q;  1SR3 A;  4MNO A;  4C2M H;  4YY3 L;  2R7D A;  4J15 A;  1RL2 A;  3BZC A;  3KDF B;  5M3M G;  1NY4 A;  1OXS C;  4QY7 A;  1VQF A;  1YIT A;  4GKJ L;  1PVO A;  1D7Q A;  3F2D A;  3CCE A;  1R9T H;  2MFI A;  4JBW A;  4UP8 A;  4BBR H;  4DUY Q;  2UU9 Q;  1N36 L;  5GAE C;  2OTL A;  4JI8 L;  2NZH A;  1P8L A;  4APV A;  3D0F A;  1HNX Q;  3ER0 A;  1EYG A;  1NMG A;  4GS3 A;  2VQF Q;  5J3B A;  4LF9 L;  3W1B A;  3HOV G;  3M3Y H;  2ZJR A;  1X6O A;  5GAH C;  4DKA C;  2JJQ A;  2K14 A;  1Y1W G;  4QJF A;  4DV2 L;  3S14 H;  3PUX A;  2YYZ A;  5LMU L;  2IY5 B;  3TQY A;  1J5E Q;  3GTP H;  4BBS G;  2Z6K C;  1VQ9 A;  3KJO A;  4JYA Q;  4HJA A;  4JCV E;  2PNH A;  5M5X H;  3HOX H;  3HOY H;  3I4N G;  2PQA A;  1BBW A;  3G4S A;  4GOP B;  3S15 H;  4GNX B;  3UDX A;  1EFW A;  5JEA J;  4IOA A;  2BH8 A;  4YWM A;  3UDI A;  5M5W H;  1G51 A;  3CCV A;  3GTO H;  2YTV A;  2K5V A;  4LFA Q;  4LUO A;  3J81 c;  1VQE A;  5JJK A;  1Y1V G;  4P71 A;  4GLA C;  1KL9 A;  2JE6 I;  3I56 A;  1JJC B;  1HZ9 A;  4YHH L;  1ASY A;  2Q2T A;  5AJ3 Q;  4LF7 L;  1TWF H;  1WYD A;  4UPA A;  4OWX B;  1AE3 A;  3PO3 H;  3A0J A;  4IPG A;  4RG1 A;  4X65 L;  2JEB I;  4DV1 Q;  3HOV H;  2IT1 A;  4KHP Q;  3I55 A;  4JI7 L;  5JJI A;  4OXP A;  3PSI A;  5IWA Q;  1IBL Q;  1JT8 A;  4P73 A;  4NXM Q;  4EQ5 A;  5C3E G;  3CF5 A;  1XPO A;  1FL0 A;  1HZC A;  1E3P A;  2YV5 A;  3SGI A;  1X56 A;  5C0X G;  1W2B A;  4BBS H;  4DV3 Q;  2R6G A;  2Q2H A;  1U0L A;  4IPH A;  4DK3 C;  2HT1 A;  3A5U A;  1VCI A;  1YEZ A;  5DLQ E;  5ELN A;  2UUB Q;  3S2D H;  1PV4 A;  1XMO Q;  3H3V I;  4JI1 Q;  1JJ2 A;  4JI6 Q;  4B3M L;  3UE1 A;  2Y0S E;  4TVA B;  2OQ0 A;  4A3J H;  1WOC A;  3TRE A;  5LMN Q;  1VQB A;  2UUC L;  1QVF A;  4K0K L;  3E9H A;  1WJJ A;  3IRB A;  1Z47 A;  5GAD C;  3F8T A;  1QZH A;  2VQE L;  1GO3 E;  1PH7 A;  2NVX H;  3T1Y L;  2UXD L;  5FJ8 G;  1YHA A;  4R4Q A;  2CKZ B;  3JC6 6;  1KIX A;  2D0P A;  4AH6 A;  2R7Z G;  2IHE A;  4X64 L;  4A93 H;  3CPF A;  4PZ8 A;  5GRO A;  5HY6 A;  3TRZ A;  4KI0 A;  3F2C A;  4FDB A;  4YY3 Q;  2ZTE A;  1PH5 A;  4HID A;  4GKJ Q;  1L1O C;  1MIU A;  1QZG A;  3CQZ H;  4DV0 L;  4DR5 Q;  1IZ6 A;  4WJ3 M;  2XTI A;  2VS1 A;  3PUW A;  1LTL A;  2Q2U A;  1N36 Q;  4JI8 Q;  3PGZ A;  2AWN A;  2F4V L;  1BVS A;  3K7A H;  2WP8 J;  1X3E A;  1B7Y B;  3HFZ B;  3CW2 C;  2F52 A;  3H0G G;  4LF6 L;  4LF9 Q;  1KC8 C;  4HIK A;  1V9P A;  1VQL A;  1I94 L;  1PH4 A;  1LM0 A;  4IFD G;  3FKI G;  5E7N A;  1BKB A;  5LMU Q;  4LWC A;  5H1S E;  1SFO H;  2VUM G;  2NN6 I;  4HJ7 A;  5EAY A;  1XNQ L;  3U58 A;  2JEA I;  1TWC H;  3KF6 A;  4IJL A;  4A3I G;  2R7Z H;  3HOW H;  3TS2 A;  4OX9 L;  4JI3 L;  3S1N H;  1CKO A;  2JA9 A;  4C3I H;  2K4K A;  5M3F H;  1VQD A;  1YI2 A;  2MNA A;  4LUZ A;  4AYB E;  2A19 A;  1IBM Q;  1FJG L;  5BR8 L;  4A75 A;  2KCT A;  4A3K G;  1YHQ A;  4POG A;  3PUV A;  4B3S L;  2JA6 H;  2NN6 G;  4O0A A;  4OON A;  1VQK A;  4LF7 Q;  3K8A A;  4DV5 L;  4BBR G;  1VQ8 A;  3RR5 A;  4X65 Q;  4L5T A;  4JI7 Q;  2D62 A;  4X66 L;  1YZ6 A;  1N9W A;  3AYH B;  3KF8 B;  3JAM c;  3CME A;  4DV6 Q;  4HJ5 A;  2DUD A;  3CD6 A;  1UE6 A;  3RLF A;  2NVT H;  2LSS A;  1L1O B;  1C0A A;  1G6P A;  1Q81 C;  1XPR A;  4Y7N H;  1PYS B;  3E9I A;  3M4Q A;  2IHF A;  1N32 L;  1HNZ L;  5IT9 c;  3KDF A;  1EIF A;  3HOX G;  3UDG A;  3GO5 A;  3I4M G;  1RIP A;  2OCE A;  4UY8 C;  4B3M Q;  1HJP A;  3J80 c;  2UUC Q;  4ME3 A;  4K0K Q;  2C35 B;  4Y52 H;  3LGJ A;  1PH3 A;  4A3L H;  4A3K H;  1VQ6 A;  1EQR A;  1HZB A;  2KCM A;  2VQE Q;  1PH2 A;  2YU9 H;  3T1Y Q;  2H5X A;  3PO2 H;  4HJ8 A;  3CP0 A;  1EQQ A;  4POF A;  4X64 Q;  3F2B A;  2IX1 A;  3EN2 A;  3AFQ A;  4JC0 A;  2I5H A;  3PO3 G;  2WB1 G;  4A3G H;  3OYY A;  4KLK A;  1B8A A;  1VQ4 A;  4DNI A;  1I6H H;  4DV0 Q;  3KJP A;  1GM5 A;  1AE2 A;  4IO9 A;  1N33 L;  1SRO A;  5FLM H;  5GQO A;  4GOP A;  1QUQ B;  4DR6 L;  4GNX A;  3CCL A;  1OXU A;  3J81 i;  2UUA L;  4QL5 A;  3W1G A;  2ZTC A;  2E5L L;  1IBK L;  2F4V Q;  4NPS A;  4DR7 L;  2AWO A;  4LF6 Q;  3I4M H;  4GLX A;  3GTK H;  1OXT A;  3EBE A;  2ZM6 L;  2NVQ H;  1I94 Q;  3A74 A;  1WCM G;  3RLN A;  1S72 A;  3S24 A;  4JI2 L;  4BXX H;  5JJL A;  4JI0 L;  4A3J G;  1EWI A;  1JJG A;  4P75 A;  3ULJ A;  1XNQ Q;  2MO0 A;  3ULL A;  1M1K C;  4L5S A;  1KXL A;  4DV4 L;  1Q8K A;  1EOV A;  1C7Y A;  1X3F A;  4OX9 Q;  1E7Z A;  4JI3 Q;  4X6A H;  2UXC L;  4JI5 L;  3NEL A;  1MJE A;  1SN8 A;  1PHJ A;  4A93 G;  2AKW B;  2R92 H;  4JG2 A;  4LFC L;  1X65 A;  3RZO H;  1T9H A;  4R4O A;  4QGU A;  4IPD A;  1EUJ A;  3VDY A;  1FJG Q;  3CCJ A;  2PI2 A;  5BR8 Q;  1VQN A;  1S3O A;  1A63 A;  4B3S Q;  1VQ5 A;  2KHJ A;  3W5O A;  2IX0 A;  1WFQ A;  2VL6 A;  1N34 L;  4DV5 Q;  1OXX K;  3M7N A;  2UXB L;  4A3M H;  1NTG A;  1YBY A;  4DK6 C;  4GN5 A;  3CCR A;  1X54 A;  3U4V A;  4X66 Q;  4GN3 B;  2F3I A;  1WCM H;  1KRS A;  2DGY A;  1LYL A;  4DR4 L;  3TS0 A;  1HZA A;  3NBH B;  2BA0 A;  2N78 A;  1BBU A;  3UDF A;  1TXY A;  4UP9 A;  4LF8 L;  1N32 Q;  1E1T A;  1NJI C;  1HNZ Q;  2ASB A;  1C9O A;  3S17 H;  3F1Z A;  3Q8D A;  1V43 A;  2MQH A;  3HOW G;  2OTJ A;  1HR0 W;  3K80 C;  3ULP A;  4B3T L;  2ID0 A;  1XNR L;  1O7I A;  4O2D A;  3S1Q H;  5M3F G;  2HIX A;  2WAQ G;  3PV0 A;  3ZJY C;  3RN5 A;  4P74 A;  4R4I A;  2GN5 A;  1Q46 A;  3FP9 A;  4MTN A;  1Q7Y C;  2JA6 G;  2K75 A;  2GVA A;  1PFS A;  3PUY A;  3H15 A;  3NEM A;  4DV7 L;  2RHS B;  1G29 1;  4OWT B;  1KD1 C;  2JA8 H;  1EIY B;  2E2H H;  5IYB G;  4GKK L;  3GTL H;  3RN2 A;  3G6E A;  5GAG C;  1TWG H;  3PIO A;  3CMA A;  3KFU A;  4DV2 Q;  1N33 Q;  1VQM A;  3J81 j;  2UU9 L;  3WWV A;  3S2H H;  5IE8 A;  4HIO A;  5C0X J;  3HKZ G;  4KHZ A;  4LW1 A;  4AQY L;  2UUA Q;  2FXQ A;  2Y0S G;  2E5L Q;  1IBK Q;  3PIP A;  3G71 A;  1YJ9 A;  2WFW A;  1CSQ A;  4DR7 Q;  3E0E A;  1XPU A;  2ZM6 Q;  2OWO A;  3L0O A;  4IFD J;  3RZD H;  3G48 A;  2EXD A;  1LUZ A;  4TQU S;  4JI2 Q;  1I50 H;  3AEV A;  4JI0 Q;  3S1M H;  4B3R L;  4DAY B;  4A3L G;  4DV4 Q;  2ALY B;  1SMX A;  1VQJ A;  4YHH Q;  2K5H A;  1OTC A;  5FLX c;  3PO2 G;  4JV5 L;  4LFB L;  1PYB A;  1VQG A;  2UXC Q;  4JI5 Q;  5IP9 H;  3OW2 A;  1E1O A;  1A0I A;  3L7Z C;  5IYB H;  1CKN B;  1IL2 A;  2LXJ A;  4R4T A;  4PMW A;  4C3H H;  1I5F A;  2E2J H;  4A3G G;  2I5L X;  2AMC B;  2LXK A;  1VQP A;  3RLO A;  4LF4 L;  2ATW A;  3S16 H;  1TWH H;  3J80 i;  1K9M C;  5FLM G;  1QVG A;  2HHH L;  1N34 Q;  3GTQ H;  2CFM A;  2B29 A;  2N8N A;  5IYC H;  5C4J H;  3J7Z C;  1HNW L;  2MO1 A;  3K7U C;  4EX5 A;  2KHI A;  2UXB Q;  3KF6 B;  4R1J A;  4R4C A;  2KEN A;  1K8G A;  3BU2 A;  2JA7 G;  1L0W A;  3STB C;  3J7A 5;  2EQS A;  1U5K A;  3EIV A;  4DR4 Q;  3DM3 A;  2QEX A;  5IYD G;  1UEB A;  1Q12 A;  1M90 C;  2WB1 E; 
#chains in the Genus database with same CATH topology
 2FMC A;  1C4Q A;  2L5T A;  3MEH A;  1RD9 D;  2PMZ E;  1ZKO A;  5FO7 B;  4IQZ A;  5EBD A;  1YNJ D;  2DJF C;  1QUQ A;  1TWC B;  2R7Z B;  1UEA B;  2R92 G;  4RGN A;  1KDB A;  1MSH A;  2B63 H;  1DCZ A;  3T1H L;  4OEL B;  5TSS A;  1W3S A;  1A8V A;  4A3F H;  3OTO L;  3OWE B;  5IIF A;  1GOZ A;  2D0O A;  2DNE A;  2VZA A;  4ZKB B;  1HQM C;  3IL8 A;  4AQY Q;  2R93 G;  1V1P B;  3RUZ A;  2ZJQ A;  1EQV A;  1J6Q A;  4A3C H;  3A7L A;  1KHI A;  1UE1 A;  1CT1 D;  1X3Q A;  1OXV A;  1A62 A;  5COY A;  4HCS A;  1FVI A;  1DOK A;  3NP8 A;  3V2T A;  4LFB Q;  1Y14 B;  4A3K B;  2YU9 B;  4C1N I;  2PQA B;  4GLV B;  2JA8 G;  3KK7 A;  1IXR A;  4BBR B;  3KBX A;  1K73 C;  4LF4 Q;  2A6E C;  2H4O A;  3AQQ A;  4C1N K;  2Q2I A;  1V8Q A;  4KJN A;  1HNW Q;  1SJH D;  1Q86 C;  3TEH B;  1XWE A;  3HEJ A;  4L8J A;  4XYQ A;  1HCZ A;  2NB0 A;  1D5Z C;  3CRK C;  3H94 A;  4X3T A;  4IUR A;  2F0L A;  1E24 A;  5KND A;  1ESF A;  3VYT A;  4KV6 A;  4QUF A;  1WTW A;  4JBJ A;  5IP9 G;  3I7F A;  2A1A A;  2XRS D;  4OIK A;  1DGS A;  3PO3 B;  5DM7 3;  1DD2 A;  3T1H Q;  1LTG D;  2Z8L A;  2Z4I A;  1I4G A;  4IFD I;  4PZ6 A;  3OTO Q;  3K57 A;  2K04 A;  4A3E G;  3WOF A;  3KUP A;  5C3E H;  2F0W A;  1VQC A;  1A2T A;  4CDE C;  1DON A;  1SND A;  4JYA L;  3S2D B;  2E2I H;  2XN9 C;  3A5Z B;  1XX8 A;  1EFI D;  5CBA E;  3K5M A;  2IPK D;  4A3J B;  3ICE A;  2RHQ B;  3DHQ A;  3VYU A;  1FD7 D;  1L1O A;  4LFA L;  1X3P A;  3P1H A;  1VQ7 A;  1JE5 A;  5FO9 B;  1HH2 P;  4TKO B;  1T5X D;  4DV1 L;  3FPU B;  2QGQ A;  1H9S B;  3A7A B;  1E22 A;  5IWA L;  1IBL L;  4A3B G;  3CPW A;  3H3V H;  2RF4 A;  4NXM L;  4MZ9 A;  3HKS A;  4A3D G;  4LK1 C;  2ICI A;  3BZK A;  3CC4 A;  2BA1 A;  2GVB A;  1SBB B;  2A6E D;  4B9X A;  2K50 A;  4IFD H;  2CCZ A;  1NNX A;  2ZXO A;  5BN4 A;  4JI1 L;  5EPK A;  1RTO A;  3NEN A;  2EIF A;  2QIL A;  1EZ8 A;  4RMF A;  4A3I H;  2EE1 A;  4NMZ A;  3S1N B;  1EZ6 A;  3K81 C;  3HOZ G;  3U50 C;  2K52 A;  2FIN B;  1S5C D;  1WVL A;  5M3M G;  1A3V A;  1JC7 A;  2WV6 D;  3MXN A;  4DXF A;  2MFI A;  4UP8 A;  4UDU C;  1R9T H;  5NUC A;  2EZV A;  2NZH A;  1LAB A;  4M1U B;  2B2W C;  3W1B A;  2JJQ A;  2J4X A;  1Y1W G;  1BCP F;  3S14 H;  5FOB B;  3JAM L;  3TQY A;  2Z6K C;  1VQ9 A;  3KJO A;  4JYA Q;  4JCV E;  5M5X H;  3I4N G;  2PQE A;  3EQL C;  5IT9 L;  3S15 H;  3UDX A;  1G51 A;  1SJE D;  3GTO H;  3J80 L;  3PO2 B;  4LFA Q;  5JJK A;  1A6X A;  1Y1V G;  4GLA C;  4KD4 A;  2JE6 I;  5CV5 A;  1ASY A;  3I73 A;  1TWF H;  4OWX B;  4IPG A;  4X65 L;  4DV1 Q;  5D3D A;  3HOV H;  3O13 A;  3T4A C;  4RHS A;  5IWA Q;  4G7H C;  1IBL Q;  5JJI A;  2A5H A;  4NXM Q;  2VB2 X;  3CF5 A;  1FL0 A;  1B4O A;  4BBS H;  3H6M A;  2QKI C;  3MZ5 A;  2R6G A;  3BDC A;  2EYM A;  4IPH A;  1JOQ A;  1KNA A;  4C3J G;  3A5U A;  2HT1 A;  1VCI A;  1YEZ A;  3R93 A;  1AEX A;  1EY6 A;  2WIN B;  4JI1 Q;  1JJ2 A;  3MC0 B;  3UE1 A;  2OQ0 A;  2WKC A;  1WOC A;  3TRE A;  2R3Z A;  5GAD C;  3F8T A;  2VQE L;  2FFK B;  3T1Y L;  3K5O A;  1YHA A;  3TME A;  1SNC A;  2E2D C;  2LS0 1;  2R7Z G;  1A3T A;  4X64 L;  3FVQ A;  3MXP A;  5GRO A;  5HY6 A;  3F2C A;  1K3B C;  1IKM A;  4DV0 L;  1IZ6 A;  4CHT B;  3LWU A;  2EY1 A;  2VS1 A;  3PUW A;  1LTL A;  2EYO A;  3BDL A;  2AWN A;  2F4V L;  3K7A H;  1X3E A;  1B7Y B;  1PZJ D;  3HFZ B;  3H0G G;  5G3L D;  1RCV D;  1PLF A;  4HIK A;  1LM0 A;  5CC4 A;  3LNN A;  4LWC A;  5DM6 3;  1STN A;  4HED A;  4HJ7 A;  3MXG A;  1F9R A;  1XNQ L;  1SYF A;  2JEA I;  1K0S A;  3KF6 A;  3HOW H;  2XWJ B;  1ZXT A;  1VQD A;  1YI2 A;  2I07 B;  2A73 B;  1MGS A;  2K03 A;  2KCT A;  4A3K G;  1E0B A;  2JA6 H;  3PUV A;  1TT2 A;  4Z9C B;  5A2Q E;  3D4R A;  4KY7 A;  4BBR G;  5IGF A;  5IGB A;  4X65 Q;  1CK1 A;  1TWG B;  4L5T A;  1IYU A;  3VA5 A;  3NPP A;  1YZ6 A;  2CH4 A;  4DV6 Q;  4HJ5 A;  3RLF A;  2A69 D;  4K2L A;  3TZD A;  1G6P A;  5C3E B;  1XPR A;  3M4Q A;  1HNZ L;  3KDF A;  4C56 C;  3RZD B;  4JPB W;  1I50 B;  2BCO A;  2OCE A;  1JB3 A;  4ME3 A;  2EYL A;  3LGJ A;  4PNY A;  1EQR A;  1VMC A;  2VQE Q;  3T1Y Q;  5FLX E;  3VR3 A;  1EOT A;  3CP0 A;  4X64 Q;  5FKA C;  2E2J B;  2IX1 A;  1R4Q B;  3EN2 A;  3PO3 G;  2WB1 G;  2NBF A;  2R61 A;  4KLK A;  2EYJ A;  4FXK C;  1TWH B;  1HA5 A;  4DV0 Q;  1GM5 A;  1AE2 A;  2SNM A;  5C4J B;  5GQO A;  1QUQ B;  4DR6 L;  5COR A;  3J81 i;  2UUA L;  2F0I A;  4QL5 A;  2E5L L;  4DN4 M;  2F4V Q;  4DR7 L;  3I4M H;  4B08 A;  3GTK H;  2K5Q A;  4F87 A;  4FVM A;  3QB3 A;  3RLN A;  4JI2 L;  4BXX H;  4A3J G;  1EWI A;  4P75 A;  3ULJ A;  1XNQ Q;  1KXL A;  1SYB A;  4DV4 L;  4G7O C;  2E75 C;  1Q8K A;  5CV4 A;  1JE4 A;  1EOV A;  1C7Y A;  3HOU B;  1E7Z A;  1BDO A;  3GTG B;  2KEE A;  4LFC L;  2WAC A;  1GUW A;  4IPD A;  3VDY A;  3DM1 A;  3VR4 A;  1S3O A;  1LTA D;  5D65 A;  2XVS A;  1WFQ A;  1OXX K;  1C8C A;  2UXB L;  2B2W A;  4A3M H;  1SE4 A;  3CCR A;  1D1I A;  1VF5 C;  4LMQ D;  3U4V A;  2DGY A;  1LYL A;  3TS0 A;  3PQI A;  3NBH B;  3HZX A;  5ISR A;  3MVV A;  3S14 B;  1TXY A;  4UP9 A;  1D1K A;  4BY1 B;  1E1T A;  1HNZ Q;  2ASB A;  4XXE A;  3NSW A;  2RVL A;  1QNK A;  2RCF A;  4B3T L;  5M5X B;  4O2D A;  3S1Q H;  4C3I G;  5M3F G;  5KYI A;  1LT3 D;  2GN5 A;  3FP9 A;  1B9M A;  2GVA A;  5JVG 3;  3M4Y A;  3NEM A;  1II3 A;  4R8I A;  2Q8T A;  1QWY A;  3QWN A;  3RN2 A;  3BG3 A;  3D3R A;  3CMA A;  1NCV A;  1VQM A;  3HOV B;  2UU9 L;  3E3X A;  4HIO A;  1NR4 A;  4LW1 A;  2UUA Q;  2E5L Q;  2F0K A;  2ZT9 C;  3MWY W;  5EPL A;  4JW0 A;  4ZYS A;  1B3A A;  3C3L A;  4DR7 Q;  4BBS B;  3E0E A;  2F0P A;  2OWO A;  3L0O A;  3OIQ A;  3VYR A;  3J7A F;  1CZW A;  1FNW A;  4JI2 Q;  1E2Z A;  4I65 A;  3TP8 A;  3H3V C;  4DV4 Q;  1VQJ A;  1SMY C;  5FLX c;  3PO2 G;  1QIL A;  3KF8 A;  1ESR A;  5IYB H;  3T51 B;  1K28 A;  4ZRZ A;  5KGU A;  1E2V A;  2EY5 A;  3TP7 A;  2HHH L;  1QVG A;  2EJM A;  1H9J A;  2UXB Q;  2K5W A;  3DUZ A;  4R4C A;  4KD3 A;  3BU2 A;  1JR0 D;  1PRT C;  1SSO A;  3STB C;  5DNF A;  3QOJ A;  3EIV A;  2AUJ D;  3DM3 A;  1UEB A;  1Q12 A;  1QZH A;  4GOP C;  3D4W A;  3A8K E;  1LLR D;  3GQB A;  5EGT A;  2O5I C;  1TQO A;  1H9R A;  5D3I B;  5C5M A;  4QQB X;  5EPJ A;  4DPG A;  5M5Y H;  4IUV A;  5C3X A;  1K8A C;  1FNV A;  2JXM B;  1WD0 A;  3HOW B;  5I2Y A;  1O78 A;  1NE3 A;  3T56 B;  2B2Y C;  2NZO A;  3I4O A;  5J39 A;  4UP7 A;  4YWL A;  1AP0 A;  3Q23 A;  4GN4 B;  3SK4 A;  4CKB A;  4CKC A;  3RZO H;  1YVC A;  4DNT B;  5IY0 A;  4JOI A;  2OQK A;  2CWP A;  3SDZ A;  4DR5 L;  1IKL A;  2L1B A;  4HSP A;  3X3M A;  5IYD H;  4H44 C;  3CAM A;  4QCL A;  2B2U C;  2KED A;  3GTM B;  3FKI B;  4HR7 B;  1HR0 L;  2F0F A;  2VUM B;  5T1G A;  1P16 A;  3MXN B;  4K8J A;  1BUV T;  1GJX A;  3D31 A;  2TSS A;  2KJX A;  3CRL C;  4F88 A;  3HG9 A;  1BOS A;  1U4L A;  2MHV A;  4BY7 H;  1PH6 A;  2N3S A;  1SRU A;  1UWV A;  5C0X I;  5EBC A;  4KKU A;  1IBM L;  4BA1 I;  5C5L A;  2KEC A;  4OWW B;  5JPN C;  4HSV A;  2ZJP A;  1ZEQ X;  1W6J A;  4LF5 L;  2HHH Q;  5C4X H;  1ASZ A;  1PDQ A;  3MEF A;  1PRT D;  1GKH A;  1LTT D;  3STB D;  3GD7 A;  1PFN A;  3HOX B;  3I4M B;  1VQO A;  1XTD A;  4OEM B;  1FNU A;  4KK7 A;  1KRT A;  2OF1 A;  1JB7 A;  4ID6 A;  1JWM D;  1YHB A;  5G3L F;  4DAM A;  5M5W B;  3Q6S A;  2VY3 A;  2D9U A;  1I4Q A;  2I0Q A;  4K5W A;  2L15 A;  4R8N A;  1R4P B;  2RDF A;  2NVY H;  4QF4 A;  1F9Q A;  2KUM A;  5IYC G;  1X55 A;  4IPC A;  3CC7 A;  5JJZ A;  4IOC A;  5C0X H;  1NMF A;  4DAY A;  1PZI D;  4X3U A;  1EY5 A;  3GV6 A;  3PCO B;  1MJC A;  2JQO A;  4XIG S;  4PMB A;  1SE8 A;  1HR0 Q;  2V1C C;  3JAM i;  1CKN A;  4KKT A;  1TS3 A;  2QDL A;  2HUG A;  2RKS A;  4O42 A;  1Q8I A;  2CVR A;  3PF5 A;  5K36 G;  1QJO A;  2A68 C;  3M4P A;  4HJ9 A;  4ZUI A;  1CA6 A;  3HOU G;  5FJ8 H;  1CSP A;  1DXM A;  4A93 B;  2HCI A;  3CCS A;  5ELB A;  2PI2 E;  3SE0 A;  5AJ3 L;  2OXP A;  1BNZ A;  1PTO H;  3MXU A;  2P5Z X;  4KHP L;  1HTP A;  5ELD A;  2L12 A;  3KBG A;  4YIJ A;  1XXG A;  2QCP X;  4NP5 A;  4A76 A;  4YCV A;  1QVC A;  2CHB D;  2PW7 A;  4YCU A;  4LF5 Q;  4DV3 L;  4GNX C;  1NSN S;  5CMD A;  4J6H A;  1ILP A;  2EVB A;  4JBK A;  4BY1 G;  3OIP A;  1X9N A;  4P72 A;  5FO8 B;  1Q90 A;  4FF4 A;  3M9B A;  1JOO A;  4K6D A;  1RTN A;  5I6W A;  5KRU A;  4MNO A;  4C2M H;  1SEB D;  4YY3 L;  2R7D A;  2LKV A;  3KDF B;  1RKN A;  3BZC A;  1PVO A;  1OXS C;  4QY7 A;  4FF1 A;  1D7Q A;  4XDX A;  5GAE C;  4B9W A;  2K1B A;  3ER0 A;  3HOV G;  4LF9 L;  5BN5 A;  3M3Y H;  2NVT B;  5GAH C;  4IUU A;  2Y0S B;  4DV2 L;  3PUX A;  2IY5 B;  4BBS G;  3T53 B;  1B44 D;  3NBI A;  4CDF C;  4HJA A;  3HOY H;  1QE6 A;  1CZG A;  1BBW A;  1ZYR C;  4KN4 C;  3HP3 A;  4XQJ A;  2RQX A;  4IOA A;  5JEA J;  3NBH A;  2F0O A;  2K5V A;  3DEP A;  2NZ1 D;  4P71 A;  1JJC B;  1HZ9 A;  1AZP A;  4LF7 L;  2Q2T A;  5AJ3 Q;  3ND8 A;  4RG1 A;  2IL8 A;  2IT1 A;  1YNN D;  1KTK A;  3L9A X;  3I55 A;  4KHP Q;  5IGD A;  4P73 A;  2EYH A;  2KVM A;  1SDF A;  4DAV A;  2BDN A;  4ZUJ A;  3SGI A;  1E3P A;  2F0G A;  3BS1 A;  4DV3 Q;  2Q2H A;  1U0L A;  4DK3 C;  1IYV A;  5ELN A;  5DLQ E;  3H3V I;  2Z1C A;  2Y0S E;  4TVA B;  1PXU A;  3E9H A;  4MTK A;  3IRB A;  1TS4 A;  1Z47 A;  5CYU A;  3J7A V;  1NUC A;  5EJW A;  4DFA A;  1STA A;  2UXD L;  3R2T A;  4R4Q A;  2B2T C;  1KIX A;  5ELF A;  2AQ1 B;  4N9P A;  4PZ8 A;  2G9D A;  3IFD A;  4YY3 Q;  2ZTE A;  1TU2 B;  4WRD A;  3CQZ H;  1IW7 C;  5T1I A;  4H7B A;  1BQQ T;  4EQN A;  2SDF A;  4LF9 Q;  4LF6 L;  4CJ0 B;  4KY5 A;  5AFW A;  1V9P A;  4KN7 C;  3FKI G;  3RD4 A;  5C4X B;  3P7J A;  2VUM G;  2XNA C;  2NN6 I;  3BDO A;  1WTQ A;  1XYI A;  3BYT B;  3S17 B;  3U58 A;  5F2D A;  4IJL A;  3TS2 A;  1UAP A;  3VR5 A;  4OX9 L;  4RH6 A;  1LTI D;  1CKO A;  2JA9 A;  3R3O A;  2K4K A;  1JOR A;  4AYB E;  1FJG L;  4E6I A;  4POG A;  2BOS A;  2G5D A;  4IUN A;  4O0A A;  1VQK A;  4LF7 Q;  2J0T D;  3RR5 A;  2F4I A;  5CR3 A;  5CV9 A;  2KQ3 A;  3TP6 A;  2NVY B;  5KEE A;  2D62 A;  4X66 L;  4ULL A;  3S2H B;  3KF8 B;  1K8O A;  2F0E A;  1ENC A;  2DUD A;  1Q81 C;  2EOT A;  3TZU A;  3E9I A;  3HOX G;  3UDG A;  3HGB A;  3I4M G;  5IGC A;  4HMJ A;  4FNF A;  2C35 B;  3I90 A;  1BF4 A;  1VQ6 A;  2KCM A;  3SK6 A;  1V1O A;  2NN6 H;  1TVX A;  3P75 A;  2GA4 B;  1EQQ A;  2ZXR A;  4C3H B;  3TN2 A;  2NWG A;  3LX0 A;  3R2I A;  4A3G H;  1DJR D;  1ENA A;  1I6H H;  3KJP A;  1LTS D;  5FLM H;  4K2K A;  4GNX A;  1Y8P B;  3W1G A;  1IBK L;  4NPS A;  3VA7 A;  3OSO A;  4LF6 Q;  1OXT A;  2ZM6 L;  5I6Y A;  1HHV A;  2B39 A;  4JI0 L;  1PMR A;  4NKL A;  4EQP A;  4OX9 Q;  1PRT F;  4A93 G;  2L11 A;  2R92 H;  4JG2 A;  3WDN A;  2B63 B;  5E4W C;  1EUJ A;  2I46 A;  1FJG Q;  2PI2 A;  1PZK D;  1WTH A;  4C2M B;  1GHK A;  1VQ5 A;  3D6W A;  1HTL D;  3VYS A;  4A3F B;  2IX0 A;  3M7N A;  2J7Z A;  1NTG A;  2K32 A;  4GN5 A;  5JOB A;  1TS5 A;  4X66 Q;  1AZQ A;  5DAU A;  2RDH A;  1EY0 A;  2BA0 A;  4RHR A;  1LV9 A;  3M3Y B;  3UDF A;  3T16 A;  1UUP A;  2RSO A;  3F1Z A;  2MQH A;  1PFB A;  4OGQ C;  3K80 C;  3ULP A;  3HOY B;  1O7I A;  1WTO A;  3P20 A;  1STE A;  3NWT A;  1Q7Y C;  4TRD A;  2K75 A;  4X3K A;  1PFS A;  3PUY A;  3H15 A;  4DV7 L;  1F2M A;  1SXT A;  1O7L A;  1KD1 C;  2OT2 A;  2JA8 H;  3J81 E;  4GKK L;  2E2H H;  5IYB G;  3SR1 A;  3GTL H;  2X69 A;  4M8A A;  1BBX C;  3KFU A;  4N9T A;  4ZLT F;  4XQN A;  3J81 j;  3WWV A;  2PNR C;  1SYD A;  2Y0S G;  1NAP A;  1IBK Q;  3G71 A;  4P2C B;  3KLR A;  2WKD A;  2ZM6 Q;  1UNS A;  3G48 A;  1PTO C;  2C9O A;  1ML0 D;  1LUZ A;  1VF7 A;  2EXD A;  3S1M H;  3BVG A;  4JI0 Q;  4B3R L;  4DAY B;  1EL0 A;  4A3L G;  2HDL A;  2B2T A;  3T13 A;  2CQA A;  2FMM A;  4KKS A;  4K14 A;  4JV5 L;  4EGV A;  3TBI B;  5IP9 H;  3OW2 A;  1SYE A;  1CKN B;  4R4T A;  4PMW A;  4CDD C;  5C6A A;  1KLG D;  3A54 A;  1MBY A;  2BE5 C;  1C48 A;  1LT6 D;  1K9M C;  2F0N A;  2CFM A;  2N8N A;  3CQZ B;  3K7U C;  2KHI A;  1L0Y B;  3LWE A;  4RFB A;  1K8G A;  3FRP B;  1W6K A;  1L0W A;  5J1Z A;  2M2L A;  2QDB A;  3J7A 5;  1U5K A;  2E2I B;  5IYD G;  4IFD J;  1M90 C;  1G8Z D;  4RCN A;  2BH2 A;  1UE7 A;  3M85 A;  4DR1 L;  3DEO A;  5JEA G;  1TR5 A;  1KAW A;  5E3F A;  3NTH A;  4ZQ3 A;  4NXN L;  3VR6 A;  3GTJ H;  5I2X A;  4DGZ A;  3M4O H;  2PO4 A;  1JQY D;  2PZW A;  1WTR A;  3SXH A;  3S9W A;  1D8L A;  1U4M A;  3HRZ C;  2KOL A;  1H95 A;  4L6T B;  1KDC A;  1ILQ A;  5CGK A;  1EY7 A;  5C3W A;  4DV7 Q;  4NB3 A;  4BS9 A;  4A3B H;  1VQA A;  2JA7 H;  2N49 A;  4GKK Q;  3OPO A;  2I5M X;  2E8G A;  4K6L A;  4A3D H;  2CWA A;  2M00 A;  5I4D A;  2L4N A;  4XTC S;  2AQ3 B;  5C4X G;  4LUV A;  4OHJ A;  1CA5 A;  1GD7 A;  3SVM A;  1U4P A;  4OO1 I;  1QNU A;  3ERS X;  4A3I B;  5C44 H;  1PRT B;  2ES2 A;  1PTO D;  4B3R Q;  3HOZ H;  1EEF D;  1XJV A;  3CXC A;  5LMN W;  4JV5 Q;  3UE0 A;  3ITP A;  5HGQ A;  5M3M H;  2KBN A;  1U9R A;  2N88 A;  2O2L D;  2PYK A;  2RA4 A;  4DR3 L;  1R9T B;  2DNC A;  5IOC A;  3L2P A;  4YWK A;  4FXG C;  3DXJ C;  1ET9 A;  1I3Q H;  2Z6K A;  2WAQ E;  1SYC A;  4PQX A;  1Y1W H;  2R7F A;  3BJU A;  1G6Z A;  3TP5 A;  1YJN A;  3KOJ A;  3UI2 A;  1YNX A;  5IP7 H;  2C5C A;  2ENB A;  3I4N H;  3S15 B;  1FGU A;  2F0T A;  3QG1 A;  4DR1 Q;  1PH9 A;  4NXN Q;  4ILW A;  3GTO B;  4YCW A;  3HKZ E;  3KLW A;  2EYF A;  4JK1 C;  4V0B A;  2RSN A;  1SLJ A;  1CUK A;  1Y1V H;  4QIW E;  5E1F A;  5ELE A;  1S40 A;  4N8X 1;  1JMC A;  1TWF B;  4C3H G;  2SNS A;  4RAU C;  4OO1 H;  2QA4 A;  1MKH A;  4IUQ A;  1I6V C;  4DR6 Q;  2D5D A;  3B6Y A;  4ZK9 B;  1HNX L;  2VQF L;  2EPB A;  2CH4 W;  1SNQ A;  4PZ7 A;  1STY A;  1N8R C;  3I72 A;  1J5E L;  2JA5 H;  4C3J H;  2CQO A;  3GV3 A;  4DU9 A;  5CV8 A;  4MN3 A;  2XGT A;  5K5P A;  1G2T A;  2HQL A;  1EU4 A;  3I2Z A;  4LFC Q;  2JN4 A;  3KYH C;  2YTY A;  3I70 A;  2B63 G;  1UE5 A;  4RGM A;  1STG A;  1TS2 A;  1QOH A;  5KYL A;  4AIM A;  4EQO A;  1BCP C;  1LTB D;  1S5D D;  3CCQ A;  4DR3 Q;  4A3F G;  1Q82 C;  1TY2 A;  4JBM A;  3GP7 A;  1K83 H;  3K7A B;  1KQS A;  2E2H B;  2AQ2 B;  4O1N A;  2HQE A;  3H0G H;  1Q3L A;  4K5X A;  2A6H C;  1B1Z A;  3U4Z A;  4DNR B;  1XMO L;  2DY8 A;  4JI6 L;  1VQH A;  4B3T Q;  3ONA B;  1B53 A;  1KLU D;  4A3C G;  3FHW A;  4I7Z C;  1CFM A;  3CCU A;  1L2F A;  5ELC A;  3HOY G;  1Q1E A;  1B70 B;  5ELO A;  1SR3 A;  2O4X A;  1T5E A;  3E5S A;  3H09 A;  3TDQ A;  4J15 A;  2JA6 B;  1YIT A;  2RBM A;  3EVQ A;  3F2D A;  2F1M A;  2F0J A;  4JBW A;  2EY6 A;  4BBR H;  2UU9 Q;  2OTL A;  4NW2 A;  1HNX Q;  1NMG A;  4GS3 A;  2VQF Q;  1X6O A;  3FMC A;  3JAM E;  4DKA C;  2K14 A;  1WTX A;  4QJF A;  2EJG C;  1J5E Q;  2F3V A;  3FDT A;  2A74 C;  4ZKC B;  5IT9 E;  2FHT A;  2QEJ C;  1S5B D;  2RDG A;  2PCF B;  3BZD B;  4GNX B;  3ZYY X;  2BH8 A;  1SMY D;  3J80 E;  3UDI A;  3CCV A;  3N6R A;  4IAL A;  3KLS X;  1KL9 A;  4YHH L;  1AE3 A;  3PO3 H;  3A0J A;  2HCC A;  1O7Y A;  2B2V C;  2MJ8 A;  3PSI A;  3I4L A;  1SE3 A;  4OXP A;  4JI7 L;  1JT8 A;  4JVZ A;  5C3E G;  1J9O A;  5CBE E;  1HZC A;  2YV5 A;  1ICF B;  1WTV A;  1D2B A;  1FYC A;  2JA7 B;  3GTK B;  3S2D H;  1PV4 A;  1XMO Q;  2A6H D;  4RCO A;  3E6Z X;  1Z7T A;  4JI6 Q;  2NVQ H;  4A3J H;  4ODG A;  1QVF A;  2UUC L;  1VQB A;  3GTP H;  4CKE A;  3EFX D;  1PH7 A;  4FF2 A;  2DY7 A;  3JC6 6;  5C44 B;  2D0P A;  3HOZ B;  3TRZ A;  4FDB A;  4OIJ A;  1PH5 A;  1L1O C;  1MIU A;  3K58 A;  1QZG A;  4DR5 Q;  4WJ3 M;  2XTI A;  4R9W A;  4A3M B;  2Q2U A;  2Z9H A;  3C46 A;  3PGZ A;  4J1M A;  2Q8I B;  1BVS A;  2WP8 J;  3DMU A;  2F52 A;  2ICE C;  1EWC A;  1KDA A;  4IFD G;  5E7N A;  1SNM A;  1SFO H;  3NTI A;  1EY8 A;  4XYO A;  4A3I G;  1SNO A;  2X6L A;  3S1Q B;  4JI3 L;  3S1N H;  4C3I H;  5M3F H;  3V96 A;  4LUZ A;  2A19 A;  1S5E D;  1IBM Q;  2DJG C;  5IOD A;  5BR8 L;  3Q22 A;  1B3Q A;  2NN6 G;  2F3W A;  2ZXP A;  1I4H A;  5A2Q L;  2MP1 A;  4QB4 A;  2VB3 X;  4JI7 Q;  3OHX C;  2TMP A;  3BVZ A;  3JAM c;  3CME A;  3IKJ A;  2LSS A;  3G7L A;  3C1E A;  4DXG A;  5JAV A;  2M9V A;  4Y7N H;  1PYS B;  2IHF A;  2E74 C;  5IT9 c;  2O5J C;  1CQV A;  2JA5 B;  3MFY A;  4UY8 C;  1HJP A;  3SK5 A;  2MUY A;  3J80 c;  2UUC Q;  2Z6B A;  1HZB A;  4IUP A;  1LO5 D;  3PO2 H;  1EY4 A;  1GHJ A;  4HJ8 A;  5FLX L;  3F2B A;  1IL8 A;  4JC0 A;  1GXD C;  3NQI A;  3AFQ A;  3OWF A;  1PTO F;  2NTT A;  4DNI A;  3Q24 A;  1VQ4 A;  4DK1 A;  1STB A;  1CHQ D;  2H1E A;  4GOP A;  2K7V A;  1EIG A;  3AMU A;  3CCL A;  1OXU A;  3NXW A;  2ZTC A;  2KHS A;  3M7G A;  3A8I E;  2AWO A;  1K83 B;  3FPP A;  2VXW A;  4X3S A;  2KA7 A;  3H0G B;  1S72 A;  4G7Z C;  1WTP A;  1JJG A;  2B2Y A;  3BVM A;  3RMH A;  3ULL A;  2A68 D;  5M5Y B;  4L5S A;  4IN3 A;  1KNE A;  1X3F A;  2HD3 A;  1MD2 D;  4JI3 Q;  1EYD A;  4JI5 L;  1MJE A;  1PHJ A;  2IW3 A;  2AKW B;  4OL7 A;  4CBV A;  2SEB D;  1T9H A;  2JYO A;  5BR8 Q;  1VQN A;  3CKI B;  4Q0F A;  2SOB A;  2KHJ A;  3RZO B;  2B2U A;  5I9P A;  2VL6 A;  4RWS C;  4DK6 C;  3IAY A;  1X54 A;  1WCM H;  1KRS A;  5BN3 A;  4AYB B;  3MHB A;  5FK9 C;  3D8G A;  4HAE A;  1BBU A;  2L0C A;  1NR2 A;  4LF8 L;  4RGT A;  1C9O A;  3HOW G;  1JOK A;  2ID0 A;  1XNR L;  4BY7 B;  5C4Z A;  3NK9 A;  2HIX A;  1U4R A;  4P74 A;  1Q46 A;  1B2T A;  4MTN A;  2JA6 G;  3J7Y W;  4CGY B;  4LAA A;  4OWT B;  2B2V A;  3URY A;  1LAC A;  3KLS A;  3G6E A;  5GAG C;  1TWG H;  2WB1 B;  4DV2 Q;  2BDO A;  5DEH A;  5IE8 A;  5C0X J;  1M4V A;  4KHZ A;  1AN8 A;  4PV1 C;  3PIP A;  1YJ9 A;  2WFW A;  1CSQ A;  1O7Z A;  4MIU A;  5CV6 A;  1ZYR D;  5A35 A;  3RZD H;  1LT4 D;  1I50 H;  3L3O C;  3V05 A;  4FP5 D;  4FYD A;  2NVQ B;  1SMX A;  1RJT A;  3E0J A;  1Z6H A;  1PYB A;  1VQG A;  3QIA A;  4JI5 Q;  3GTP B;  1E1O A;  1A0I A;  3C1F A;  1IL2 A;  1MSG A;  3K5L A;  2E2J H;  1I5F A;  5LL6 X;  2PPB C;  1EWH A;  1VQP A;  3RLO A;  4K8I A;  2AUK A;  2K6A A;  3S16 H;  1TWH H;  3GTQ H;  5IYC H;  2JSO A;  1EU3 A;  5C4J H;  2MO1 A;  2QF7 A;  1D5M C;  4R1J A;  1TY0 A;  1F77 A;  2JA7 G;  2EQS A;  3MA2 B;  1ENF A;  2WB1 E;  3D4D A;  4BXX G;  2UXD Q;  1K0R A;  1PH1 A;  4LF8 Q;  4DUZ L;  1D6E C;  1SFO B;  4LNQ A;  5KNB A;  3PIP 3;  4ALP A;  1TKW B;  3QJY A;  1YIJ A;  4BA2 I;  5K36 H;  2B3G A;  4DK0 A;  2Z4H A;  2A8V A;  1XNR Q;  4PG3 A;  3HOU H;  1MI2 A;  1PH8 A;  4PMC A;  3GTG H;  5C44 G;  1CHP D;  1PTO B;  3OMG A;  3PUZ A;  1CI3 M;  4C3I B;  1IW7 D;  4ME5 A;  5M3F B;  2B8G A;  2G9H D;  1XMQ L;  5I9O A;  1X3G A;  4A3M G;  4A4I A;  1JCK B;  2YTX A;  1L0X B;  1TWA H;  3MTS A;  2K5N A;  2PZT A;  5LL6 S;  3NTK A;  1VMP A;  3K0Y A;  4X62 L;  4BY1 H;  2VNU D;  4Y7N B;  2JP1 A;  1GVP A;  1H9M A;  1WD1 A;  2HIV A;  5IP7 G;  4WJ4 A;  4ZAI A;  1Q1B A;  3GDE A;  4HIM A;  2L55 A;  1WI5 A;  3CCM A;  3I8Z A;  1GUN A;  3AFP A;  4OO1 G;  1VS0 A;  1CQF A;  1NBW A;  2VW9 A;  4L5R C;  2R93 H;  4WJW A;  1CKM A;  2A69 C;  1IYJ B;  4DV6 L;  1VQI A;  2ZTD A;  1EIH A;  3ND9 A;  1QCB D;  1F9S A;  4WOR A;  2JA5 G;  3SHL A;  4KHV A;  4DR2 L;  4DUZ Q;  2IWH A;  3RNU A;  1K3R A;  1RHP A;  1F2Y A;  4JI4 L;  2IX3 A;  1RF2 D;  2MGS A;  3G6J B;  5C4H A;  1A3U A;  4QUC A;  1YJW A;  4FF3 A;  5HGT A;  4DUY L;  4L5Q A;  1Z9F A;  1E2W A;  1XMQ Q;  1HUN A;  4G4K A;  5EKI A;  2XSC A;  1HUM A;  5IGE A;  1AH9 A;  4RKL A;  5L37 A;  1A15 A;  1WCM B;  5CV7 A;  3CC2 A;  2JK8 A;  1PA6 A;  4FO2 A;  2QW7 A;  4X62 Q;  4H02 A;  4BWG B;  1I4R A;  1V1Q A;  1QG7 A;  3NHH A;  2AHO B;  4IZ8 A;  3PF4 A;  3NWS A;  4QMG A;  1JWS D;  2LY7 A;  3DLL A;  4KTA A;  1G2S A;  4A3E H;  4HMI A;  1KAB A;  4F8M A;  2F03 A;  2XIW A;  1B50 A;  1HQR D;  3DWQ A;  1KAA A;  4AYB G;  4UHV A;  4JOI C;  2UUB L;  2K05 A;  3GTM H;  3FKI H;  3Q0A A;  2VUM H;  2WII B;  3K0X A;  1HA6 A;  1XTC D;  5LMN L;  1LT5 D;  5D14 A;  3X3N A;  3S1R H;  4LJZ C;  2Z0S A;  1AW7 A;  4HTH A;  4DR2 Q;  2RCN A;  4BY7 G;  2WAQ B;  4IJH A;  4GZY C;  2NTS A;  1GUS A;  1Y8O B;  4JI4 Q;  3I3C A;  1IHZ A;  3CHB D;  1RL2 A;  4GKJ L;  1NY4 A;  1PFM A;  1VQF A;  1V1P A;  1Y8N B;  3CCE A;  3MAQ A;  4DUY Q;  1N36 L;  4H13 C;  4JI8 L;  1P8L A;  4APV A;  3NUC A;  1G91 A;  3D0F A;  1EYG A;  2DN8 A;  1F9P A;  3H91 A;  4N8F A;  5J3B A;  4ABN A;  4HN7 A;  3HKZ B;  2ZJR A;  3S16 B;  1HFN A;  3GTQ B;  1JWU D;  4DAP A;  2F0V A;  2YYZ A;  5LMU L;  4QIW B;  1BCP B;  2XWB B;  2PNH A;  4FXD A;  3HOX H;  3ERO A;  2N55 A;  2PQA A;  3G4S A;  1AFP A;  4GOP B;  3U9S A;  1TII D;  1EFW A;  3SEB A;  2K28 A;  4YWM A;  5M5W H;  2YTV A;  3J81 c;  4LUO A;  1VQE A;  4G57 A;  3I56 A;  3K6O A;  4A3G B;  3IFT A;  1WYD A;  4UPA A;  2BE5 D;  4RGO S;  2JEB I;  1I6H B;  3K5N A;  3QO2 A;  5JVH 3;  2F0M A;  5LHY 1;  4EQ5 A;  1XPO A;  1W2B A;  1FR3 A;  5C0X G;  1ICW A;  1K8M A;  1X56 A;  1LTR D;  3ERQ A;  4DA2 A;  3OOC A;  1TWA B;  1RDP D;  2UUB Q;  2L9H A;  1DZ1 A;  4B3M L;  2LFN A;  5LMN Q;  4K0K L;  1WJJ A;  5EKK A;  2NVX H;  1GO3 E;  5FJ8 G;  2CKZ B;  2CW0 C;  2R92 B;  4AH6 A;  2IHE A;  4A93 H;  3CPF A;  4KI0 A;  4HID A;  1BR9 A;  1VDZ A;  4GKJ Q;  1ROD A;  4TSS A;  4XT3 B;  4CJ1 B;  1HXY D;  3AU7 A;  1N36 Q;  4JI8 Q;  1GUO A;  2KCN A;  2OEO A;  4KMU C;  5KNC A;  3CW2 C;  1KC8 C;  2FJ2 A;  1VQL A;  2R93 B;  1I94 L;  1PH4 A;  2LMC B;  1ONL A;  1BKB A;  5LMU Q;  5H1S E;  4ZCK A;  5EAY A;  4S3S A;  1EY9 A;  1H9S A;  1TWC H;  2R7Z H;  4H0L C;  2MPM A;  2MNA A;  1GUT A;  1EQT A;  3F2U A;  4A75 A;  1YHQ A;  4EVO A;  1J8I A;  4B3S L;  3DWP A;  3MFG A;  4OON A;  2JA8 B;  3K8A A;  4DV5 L;  1VQ8 A;  3GTL B;  4F7X A;  1Y69 U;  1N9W A;  2E76 C;  3AYH B;  3CD6 A;  1BO0 A;  3R8B A;  1UE6 A;  2NVT H;  1C0A A;  1L1O B;  1D5X C;  3A55 A;  1N32 L;  3A56 A;  1EIF A;  1BXT A;  2EY2 A;  3GO5 A;  3S1M B;  1RIP A;  4B3M Q;  1X32 A;  2Q8R E;  3FEW X;  4Y52 H;  4K0K Q;  1PH3 A;  4A3L H;  4A3K H;  2F0H A;  1GUG A;  1I4P A;  2NYZ D;  1PH2 A;  2YU9 H;  2H5X A;  1SE2 A;  1CTM A;  3DWA A;  4POF A;  2CW0 D;  4V19 0;  4KJO A;  3CU7 A;  2I5H A;  2F0Q A;  1DM0 B;  3OYY A;  1B8A A;  4Q5V A;  3W2D A;  2EYP A;  4IO9 A;  1N33 L;  1SRO A;  4A3E B;  4WFN 3;  2PZU A;  4CJ2 C;  2KCC A;  3HS0 C;  2B8F A;  4GLX A;  2IJ0 A;  3N52 A;  3OW7 A;  3EBE A;  1O80 A;  4MHE A;  1I94 Q;  5E4X A;  3A74 A;  1WCM G;  1HRJ A;  2XRQ D;  5JPM C;  4U67 3;  3S24 A;  5JJL A;  5JEA H;  2MO0 A;  1M1K C;  3GTJ B;  1SYG A;  2V4D A;  3M4O B;  4J8Q A;  4KY6 A;  2F0S A;  4NDX A;  4X6A H;  2UXC L;  3NEL A;  1F2Z A;  3K59 A;  1SN8 A;  2PW5 A;  3S1R B;  4RKB A;  2NUC A;  1X65 A;  4R4O A;  1M8A A;  4QGU A;  3CCJ A;  1BCP D;  1A63 A;  4B3S Q;  4A3B B;  3W5O A;  3I91 A;  3NE5 B;  4XQQ A;  1N34 L;  4DV5 Q;  4A3D B;  1YBY A;  1HFG A;  4GN3 B;  2F3I A;  3PMF A;  4DR4 L;  2HDM A;  1HZA A;  2N78 A;  4K5V A;  1DOM A;  1N32 Q;  1NJI C;  2K01 A;  1ET6 A;  1QB5 D;  3QOL A;  4UAI A;  3S17 H;  1YNJ C;  3Q8D A;  1HPC A;  1V43 A;  1A2U A;  2EJF C;  5IGG A;  2OTJ A;  1EEI D;  1DYQ A;  1HR0 W;  5EKL A;  3QR8 A;  3PV0 A;  2WAQ G;  2X6G A;  3ZJY C;  3RN5 A;  4R4I A;  3EJI A;  1F2L A;  5M3M B;  2EDG A;  3OMC A;  4XT1 B;  2D2C C;  4I7A A;  1JIC A;  2RHS B;  1G29 1;  1SNP A;  5HUR A;  1EIY B;  3EA6 A;  2EXZ A;  2K33 A;  1I3Q B;  3J81 L;  2F0D A;  3PIO A;  1MHW C;  1FGB D;  1N33 Q;  1STH A;  3WOE A;  3S2H H;  1H9K A;  1EYC A;  3BYY B;  3HKZ G;  4AQY L;  1Y1W B;  2FXQ A;  2PMZ B;  3AB9 A;  4RA8 A;  1S5F D;  4IUT A;  1XPU A;  3W3A A;  5J22 A;  3I4N B;  4DF7 A;  5M9O A;  4TQU S;  3AEV A;  3U9O A;  3A8J E;  1I4X A;  2K5D A;  2ALY B;  4YHH Q;  4CDC C;  2K5H A;  1OTC A;  3C2P A;  4LFB L;  1Y1V B;  2UXC Q;  4L63 B;  2NVX B;  3L7Z C;  2LXJ A;  4C3H H;  4A3G G;  2I5L X;  2AMC B;  2LXK A;  1PYW D;  2F0U A;  4LF4 L;  2ATW A;  3J80 i;  1B9N A;  5FLM G;  1YNN C;  1N34 Q;  2B29 A;  4HCE A;  3D6C A;  3TSS A;  3J7Z C;  1HNW L;  4EX5 A;  3KF6 B;  4U68 A;  1OO9 B;  5KIX A;  2KEN A;  5EQ0 A;  1EYA A;  3NQT A;  1SAP A;  4C3J B;  1CM9 A;  4DR4 Q;  3VR2 A;  3SK8 A;  2QEX A;  1DOL A;  3PIO 3;  1S4Z A; 
#chains in the Genus database with same CATH homology
 2BH2 A;  4BXX G;  1UE7 A;  3M85 A;  2UXD Q;  1K0R A;  4DR1 L;  1PH1 A;  4DUZ L;  4LF8 Q;  5JEA G;  1KAW A;  2PMZ E;  4LNQ A;  4NXN L;  4QQB X;  3GTJ H;  4DPG A;  5M5Y H;  4ALP A;  1YIJ A;  4BA2 I;  3M4O H;  2B3G A;  1K8A C;  4GOP C;  2A8V A;  4PG3 A;  1QUQ A;  1XNR Q;  1PH8 A;  3GTG H;  3HOU H;  5C44 G;  2R92 G;  1NE3 A;  1D8L A;  2NZO A;  3PUZ A;  2B63 H;  3I4O A;  3T1H L;  4UP7 A;  1H95 A;  4YWL A;  4DV7 Q;  1W3S A;  4GN4 B;  4NB3 A;  4A3B H;  1A8V A;  1VQA A;  1YVC A;  4A3F H;  5IY0 A;  4JOI A;  1X3G A;  3OTO L;  1XMQ L;  2N49 A;  2OQK A;  4A3M G;  2JA7 H;  4A4I A;  2I5M X;  2E8G A;  4GKK Q;  2CWP A;  4DR5 L;  2YTX A;  4A3D H;  2CWA A;  2D0O A;  1TWA H;  2K5N A;  5IYD H;  3CAM A;  2VZA A;  4AQY Q;  2R93 G;  4XTC S;  1HR0 L;  5C4X G;  4LUV A;  1P16 A;  3MXN B;  4X62 L;  1GD7 A;  2ZJQ A;  4BY1 H;  3D31 A;  4OO1 I;  1J6Q A;  2VNU D;  4A3C H;  3ERS X;  5C44 H;  1KHI A;  2ES2 A;  1GVP A;  1UE1 A;  2HIV A;  4B3R Q;  5IP7 G;  3HOZ H;  4BY7 H;  4WJ4 A;  1OXV A;  1XJV A;  1PH6 A;  2N3S A;  3CXC A;  5LMN W;  1SRU A;  1A62 A;  1Q1B A;  3GDE A;  1FVI A;  4HIM A;  4JV5 Q;  1UWV A;  3UE0 A;  4LFB Q;  5HGQ A;  1Y14 B;  5C0X I;  5M3M H;  1WI5 A;  2KBN A;  2PQA B;  3CCM A;  4GLV B;  4DR3 L;  1IBM L;  2JA8 G;  4BA1 I;  1IXR A;  3L2P A;  3AFP A;  4OO1 G;  4YWK A;  1VS0 A;  4LF4 Q;  1K73 C;  4OWW B;  1NBW A;  2ZJP A;  1I3Q H;  2Z6K A;  4LF5 L;  2VW9 A;  4L5R C;  2HHH Q;  2R93 H;  3AQQ A;  2Q2I A;  2WAQ E;  5C4X H;  1ASZ A;  1HNW Q;  1Q86 C;  3TEH B;  3MEF A;  1Y1W H;  1CKM A;  2R7F A;  1IYJ B;  4DV6 L;  3BJU A;  1GKH A;  1VQI A;  3STB D;  3GD7 A;  2ZTD A;  1YJN A;  3KOJ A;  1YNX A;  5IP7 H;  3I4N H;  1VQO A;  1XTD A;  2JA5 G;  1FGU A;  1KRT A;  4DR1 Q;  4DR2 L;  1E24 A;  4DUZ Q;  1PH9 A;  1JB7 A;  3RNU A;  1K3R A;  4NXN Q;  1YHB A;  4DAM A;  4YCW A;  4JI4 L;  3HKZ E;  3KLW A;  4JBJ A;  2VY3 A;  1SLJ A;  5IP9 G;  2I0Q A;  1CUK A;  1Y1V H;  3I7F A;  2L15 A;  2A1A A;  4QIW E;  1YJW A;  1S40 A;  1JMC A;  1DGS A;  2QA4 A;  1MKH A;  2NVY H;  4DUY L;  4L5Q A;  3T1H Q;  4DR6 Q;  1Z9F A;  4IFD I;  3B6Y A;  4PZ6 A;  1HNX L;  1XMQ Q;  3OTO Q;  5IYC G;  2VQF L;  1X55 A;  4IPC A;  3CC7 A;  4A3E G;  5C3E H;  4IOC A;  1VQC A;  1NMF A;  4PZ7 A;  1N8R C;  3PCO B;  1MJC A;  2JQO A;  1J5E L;  1AH9 A;  4XIG S;  2JA5 H;  4JYA L;  4C3J H;  2E2I H;  3A5Z B;  1SE8 A;  1HR0 Q;  2V1C C;  3CC2 A;  3JAM i;  1CKN A;  2CQO A;  2JK8 A;  1PA6 A;  3ICE A;  4X62 Q;  2XGT A;  4H02 A;  2HQL A;  2RHQ B;  3I2Z A;  1V1Q A;  3PF5 A;  5K36 G;  4LFC Q;  1L1O A;  2AHO B;  3KYH C;  3M4P A;  4HJ9 A;  4LFA L;  3HOU G;  3PF4 A;  5FJ8 H;  1CSP A;  1VQ7 A;  2YTY A;  1JE5 A;  3CCS A;  1HH2 P;  2PI2 E;  3DLL A;  5AJ3 L;  2B63 G;  1UE5 A;  4DV1 L;  2QGQ A;  4KHP L;  4A3E H;  1E22 A;  5IWA L;  1IBL L;  4A3B G;  3CPW A;  4AIM A;  3H3V H;  3CCQ A;  2RF4 A;  4DR3 Q;  4A3F G;  1Q82 C;  4JBM A;  4NXM L;  4MZ9 A;  3HKS A;  4A76 A;  1K83 H;  4YCV A;  4A3D G;  1QVC A;  4YCU A;  1KQS A;  3BZK A;  3CC4 A;  4LF5 Q;  2BA1 A;  4DV3 L;  2GVB A;  4GNX C;  3H0G H;  4AYB G;  2K50 A;  4JOI C;  2UUB L;  3GTM H;  3U4Z A;  1XMO L;  2CCZ A;  3FKI H;  2VUM H;  4JI1 L;  4JI6 L;  1VQH A;  4JBK A;  3K0X A;  4BY1 G;  4B3T Q;  3NEN A;  5LMN L;  4P72 A;  2EIF A;  1X9N A;  4A3C G;  3FHW A;  3S1R H;  4RMF A;  4A3I H;  2Z0S A;  1L2F A;  3M9B A;  3CCU A;  4DR2 Q;  3HOZ G;  3K81 C;  2RCN A;  4BY7 G;  3HOY G;  1Q1E A;  1B70 B;  5ELO A;  4IJH A;  3U50 C;  2K52 A;  4JI4 Q;  1SR3 A;  4MNO A;  4C2M H;  4YY3 L;  2R7D A;  4J15 A;  1RL2 A;  3BZC A;  3KDF B;  5M3M G;  1NY4 A;  1OXS C;  4QY7 A;  1VQF A;  1YIT A;  4GKJ L;  1PVO A;  1D7Q A;  3F2D A;  3CCE A;  1R9T H;  2MFI A;  4JBW A;  4UP8 A;  4BBR H;  4DUY Q;  2UU9 Q;  1N36 L;  5GAE C;  2OTL A;  4JI8 L;  2NZH A;  1P8L A;  4APV A;  3D0F A;  1HNX Q;  3ER0 A;  1EYG A;  1NMG A;  4GS3 A;  2VQF Q;  5J3B A;  4LF9 L;  3W1B A;  3HOV G;  3M3Y H;  2ZJR A;  1X6O A;  5GAH C;  4DKA C;  2JJQ A;  2K14 A;  1Y1W G;  4QJF A;  4DV2 L;  3S14 H;  3PUX A;  2YYZ A;  5LMU L;  2IY5 B;  3TQY A;  1J5E Q;  3GTP H;  4BBS G;  2Z6K C;  1VQ9 A;  3KJO A;  4JYA Q;  4HJA A;  4JCV E;  2PNH A;  5M5X H;  3HOX H;  3HOY H;  3I4N G;  2PQA A;  1BBW A;  3G4S A;  4GOP B;  3S15 H;  4GNX B;  3UDX A;  1EFW A;  5JEA J;  4IOA A;  2BH8 A;  4YWM A;  3UDI A;  5M5W H;  1G51 A;  3CCV A;  3GTO H;  2YTV A;  2K5V A;  4LFA Q;  4LUO A;  3J81 c;  1VQE A;  5JJK A;  1Y1V G;  4P71 A;  4GLA C;  1KL9 A;  2JE6 I;  3I56 A;  1JJC B;  1HZ9 A;  4YHH L;  1ASY A;  2Q2T A;  5AJ3 Q;  4LF7 L;  1TWF H;  1WYD A;  4UPA A;  4OWX B;  1AE3 A;  3PO3 H;  3A0J A;  4IPG A;  4RG1 A;  4X65 L;  2JEB I;  4DV1 Q;  3HOV H;  2IT1 A;  4KHP Q;  3I55 A;  4JI7 L;  5JJI A;  4OXP A;  3PSI A;  5IWA Q;  1IBL Q;  1JT8 A;  4P73 A;  4NXM Q;  4EQ5 A;  5C3E G;  3CF5 A;  1XPO A;  1FL0 A;  1HZC A;  1E3P A;  2YV5 A;  3SGI A;  1X56 A;  5C0X G;  1W2B A;  4BBS H;  4DV3 Q;  2R6G A;  2Q2H A;  1U0L A;  4IPH A;  4DK3 C;  2HT1 A;  3A5U A;  1VCI A;  1YEZ A;  5DLQ E;  5ELN A;  2UUB Q;  3S2D H;  1PV4 A;  1XMO Q;  3H3V I;  4JI1 Q;  1JJ2 A;  4JI6 Q;  4B3M L;  3UE1 A;  2Y0S E;  4TVA B;  2OQ0 A;  4A3J H;  1WOC A;  3TRE A;  5LMN Q;  1VQB A;  2UUC L;  1QVF A;  4K0K L;  3E9H A;  1WJJ A;  3IRB A;  1Z47 A;  5GAD C;  3F8T A;  1QZH A;  2VQE L;  1GO3 E;  1PH7 A;  2NVX H;  3T1Y L;  2UXD L;  5FJ8 G;  1YHA A;  4R4Q A;  2CKZ B;  3JC6 6;  1KIX A;  2D0P A;  4AH6 A;  2R7Z G;  2IHE A;  4X64 L;  4A93 H;  3CPF A;  4PZ8 A;  5GRO A;  5HY6 A;  3TRZ A;  4KI0 A;  3F2C A;  4FDB A;  4YY3 Q;  2ZTE A;  1PH5 A;  4HID A;  4GKJ Q;  1L1O C;  1MIU A;  1QZG A;  3CQZ H;  4DV0 L;  4DR5 Q;  1IZ6 A;  4WJ3 M;  2XTI A;  2VS1 A;  3PUW A;  1LTL A;  2Q2U A;  1N36 Q;  4JI8 Q;  3PGZ A;  2AWN A;  2F4V L;  1BVS A;  3K7A H;  2WP8 J;  1X3E A;  1B7Y B;  3HFZ B;  3CW2 C;  2F52 A;  3H0G G;  4LF6 L;  4LF9 Q;  1KC8 C;  4HIK A;  1V9P A;  1VQL A;  1I94 L;  1PH4 A;  1LM0 A;  4IFD G;  3FKI G;  5E7N A;  1BKB A;  5LMU Q;  4LWC A;  5H1S E;  1SFO H;  2VUM G;  2NN6 I;  4HJ7 A;  5EAY A;  1XNQ L;  3U58 A;  2JEA I;  1TWC H;  3KF6 A;  4IJL A;  4A3I G;  2R7Z H;  3HOW H;  3TS2 A;  4OX9 L;  4JI3 L;  3S1N H;  1CKO A;  2JA9 A;  4C3I H;  2K4K A;  5M3F H;  1VQD A;  1YI2 A;  2MNA A;  4LUZ A;  4AYB E;  2A19 A;  1IBM Q;  1FJG L;  5BR8 L;  4A75 A;  2KCT A;  4A3K G;  1YHQ A;  4POG A;  3PUV A;  4B3S L;  2JA6 H;  2NN6 G;  4O0A A;  4OON A;  1VQK A;  4LF7 Q;  3K8A A;  4DV5 L;  4BBR G;  1VQ8 A;  3RR5 A;  4X65 Q;  4L5T A;  4JI7 Q;  2D62 A;  4X66 L;  1YZ6 A;  1N9W A;  3AYH B;  3KF8 B;  3JAM c;  3CME A;  4DV6 Q;  4HJ5 A;  2DUD A;  3CD6 A;  1UE6 A;  3RLF A;  2NVT H;  2LSS A;  1L1O B;  1C0A A;  1G6P A;  1Q81 C;  1XPR A;  4Y7N H;  1PYS B;  3E9I A;  3M4Q A;  2IHF A;  1N32 L;  1HNZ L;  5IT9 c;  3KDF A;  1EIF A;  3HOX G;  3UDG A;  3GO5 A;  3I4M G;  1RIP A;  2OCE A;  4UY8 C;  4B3M Q;  1HJP A;  3J80 c;  2UUC Q;  4ME3 A;  4K0K Q;  2C35 B;  4Y52 H;  3LGJ A;  1PH3 A;  4A3L H;  4A3K H;  1VQ6 A;  1EQR A;  1HZB A;  2KCM A;  2VQE Q;  1PH2 A;  2YU9 H;  3T1Y Q;  2H5X A;  3PO2 H;  4HJ8 A;  3CP0 A;  1EQQ A;  4POF A;  4X64 Q;  3F2B A;  2IX1 A;  3EN2 A;  3AFQ A;  4JC0 A;  2I5H A;  3PO3 G;  2WB1 G;  4A3G H;  3OYY A;  4KLK A;  1B8A A;  1VQ4 A;  4DNI A;  1I6H H;  4DV0 Q;  3KJP A;  1GM5 A;  1AE2 A;  4IO9 A;  1N33 L;  1SRO A;  5FLM H;  5GQO A;  4GOP A;  1QUQ B;  4DR6 L;  4GNX A;  3CCL A;  1OXU A;  3J81 i;  2UUA L;  4QL5 A;  3W1G A;  2ZTC A;  2E5L L;  1IBK L;  2F4V Q;  4NPS A;  4DR7 L;  2AWO A;  4LF6 Q;  3I4M H;  4GLX A;  3GTK H;  1OXT A;  3EBE A;  2ZM6 L;  2NVQ H;  1I94 Q;  3A74 A;  1WCM G;  3RLN A;  1S72 A;  3S24 A;  4JI2 L;  4BXX H;  5JJL A;  4JI0 L;  4A3J G;  1EWI A;  1JJG A;  4P75 A;  3ULJ A;  1XNQ Q;  2MO0 A;  3ULL A;  1M1K C;  4L5S A;  1KXL A;  4DV4 L;  1Q8K A;  1EOV A;  1C7Y A;  1X3F A;  4OX9 Q;  1E7Z A;  4JI3 Q;  4X6A H;  2UXC L;  4JI5 L;  3NEL A;  1MJE A;  1SN8 A;  1PHJ A;  4A93 G;  2AKW B;  2R92 H;  4JG2 A;  4LFC L;  1X65 A;  3RZO H;  1T9H A;  4R4O A;  4QGU A;  4IPD A;  1EUJ A;  3VDY A;  1FJG Q;  3CCJ A;  2PI2 A;  5BR8 Q;  1VQN A;  1S3O A;  1A63 A;  4B3S Q;  1VQ5 A;  2KHJ A;  3W5O A;  2IX0 A;  1WFQ A;  2VL6 A;  1N34 L;  4DV5 Q;  1OXX K;  3M7N A;  2UXB L;  4A3M H;  1NTG A;  1YBY A;  4DK6 C;  4GN5 A;  3CCR A;  1X54 A;  3U4V A;  4X66 Q;  4GN3 B;  2F3I A;  1WCM H;  1KRS A;  2DGY A;  1LYL A;  4DR4 L;  3TS0 A;  1HZA A;  3NBH B;  2BA0 A;  2N78 A;  1BBU A;  3UDF A;  1TXY A;  4UP9 A;  4LF8 L;  1N32 Q;  1E1T A;  1NJI C;  1HNZ Q;  2ASB A;  1C9O A;  3S17 H;  3F1Z A;  3Q8D A;  1V43 A;  2MQH A;  3HOW G;  2OTJ A;  1HR0 W;  3K80 C;  3ULP A;  4B3T L;  2ID0 A;  1XNR L;  1O7I A;  4O2D A;  3S1Q H;  5M3F G;  2HIX A;  2WAQ G;  3PV0 A;  3ZJY C;  3RN5 A;  4P74 A;  4R4I A;  2GN5 A;  1Q46 A;  3FP9 A;  4MTN A;  1Q7Y C;  2JA6 G;  2K75 A;  2GVA A;  1PFS A;  3PUY A;  3H15 A;  3NEM A;  4DV7 L;  2RHS B;  1G29 1;  4OWT B;  1KD1 C;  2JA8 H;  1EIY B;  2E2H H;  5IYB G;  4GKK L;  3GTL H;  3RN2 A;  3G6E A;  5GAG C;  1TWG H;  3PIO A;  3CMA A;  3KFU A;  4DV2 Q;  1N33 Q;  1VQM A;  3J81 j;  2UU9 L;  3WWV A;  3S2H H;  5IE8 A;  4HIO A;  5C0X J;  3HKZ G;  4KHZ A;  4LW1 A;  4AQY L;  2UUA Q;  2FXQ A;  2Y0S G;  2E5L Q;  1IBK Q;  3PIP A;  3G71 A;  1YJ9 A;  2WFW A;  1CSQ A;  4DR7 Q;  3E0E A;  1XPU A;  2ZM6 Q;  2OWO A;  3L0O A;  4IFD J;  3RZD H;  3G48 A;  2EXD A;  1LUZ A;  4TQU S;  4JI2 Q;  1I50 H;  3AEV A;  4JI0 Q;  3S1M H;  4B3R L;  4DAY B;  4A3L G;  4DV4 Q;  2ALY B;  1SMX A;  1VQJ A;  4YHH Q;  2K5H A;  1OTC A;  5FLX c;  3PO2 G;  4JV5 L;  4LFB L;  1PYB A;  1VQG A;  2UXC Q;  4JI5 Q;  5IP9 H;  3OW2 A;  1E1O A;  1A0I A;  3L7Z C;  5IYB H;  1CKN B;  1IL2 A;  2LXJ A;  4R4T A;  4PMW A;  4C3H H;  1I5F A;  2E2J H;  4A3G G;  2I5L X;  2AMC B;  2LXK A;  1VQP A;  3RLO A;  4LF4 L;  2ATW A;  3S16 H;  1TWH H;  3J80 i;  1K9M C;  5FLM G;  1QVG A;  2HHH L;  1N34 Q;  3GTQ H;  2CFM A;  2B29 A;  2N8N A;  5IYC H;  5C4J H;  3J7Z C;  1HNW L;  2MO1 A;  3K7U C;  4EX5 A;  2KHI A;  2UXB Q;  3KF6 B;  4R1J A;  4R4C A;  2KEN A;  1K8G A;  3BU2 A;  2JA7 G;  1L0W A;  3STB C;  3J7A 5;  2EQS A;  1U5K A;  3EIV A;  4DR4 Q;  3DM3 A;  2QEX A;  5IYD G;  1UEB A;  1Q12 A;  1M90 C;  2WB1 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...