3NXWA

Crystal structure of staphylococcal nuclease variant delta+phs l125a at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLARKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Cavities determine the pressure unfolding of proteins.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2010-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3nxwA00
4ODGA 5CV5A 4KTAA 4KJOA 4K6DA 1EYAA 2RKSA 1NSNS 3PMFA 3E5SA 4LAAA 4K5XA 2EXZA 5IODA 3NQTA 2EY5A 2EYOA 3NP8A 4N9TA 4PMBA 1A3UA 5CV4A 3U9OA 4J6HA 4K2LA 1II3A 1EYCA 1STNA 3MHBA 4F7XA 1EY8A 4N9PA 4NP5A 3RUZA 5E3FA 3ITPA 5IIFA 1JOKA 3T16A 4F8MA 4ZQ3A 1A2TA 2F0NA 5IGGA 3SHLA 4H7BA 3R3OA 4R8NA 2PW5A 1KABA 3ERQA 5C5MA 4E6IA 3OSOA 5IGEA 2PW7A 1STHA 5I6YA 2EY2A 2RBMA 4ID6A 4I65A 4K5VA 4K5WA 4ME5A 5KIXA 4OL7A 3SXHA 5IGFA 1SNOA 2EYMA 2F0SA 3NHHA 5KYLA 2EY6A 1KAAA 4HMIA 4QB4A 4QF4A 3SK6A 1SYGA 2KQ3A 4PMCA 5J39A 3OWFA 5K5PA 3C1EA 3C1FA 3H6MA 4B9XA 1F2ZA 2F0JA 2EYLA 5ISRA 1EY0A 1SYBA 1U9RA 2F0VA 1JORA 4KV6A 4EQOA 2M00A 2F0KA 4HTHA 1EZ8A 4TRDA 3OMCA 2F0QA 3P1HA 4KY6A 5EKKA 2PZWA 2PZUA 3D4WA 1SYCA 5KRUA 4WRDA 3EVQA 1EY5A 3DMUA 3HZXA 4IZ8A 1JOQA 5I9OA 2EY1A 3MZ5A 2O4XA 3D6CA 3SK8A 2F3WA 4IALA 1EQVA 3MXPA 4K8JA 4RKLA 4B9WA 4DF7A 4KD3A 3S9WA 5EGTA 1EY4A 4WORA 1ENCA 5NUCA 5C6AA 4EQPA 1A3TA 4J1MA 1EY9A 1STGA 3V2TA 5C3WA 4ZUIA 5I9PA 3VA5A 1AEXA 3P75A 4DGZA 2F0OA 1SNMA 4KJNA 1SYEA 2LKVA 3SR1A 2QDBA 4EQNA 5IGDA 2OEOA 5KYIA 5CC4A 5I6WA 5CV7A 5HGTA 2F0GA 3TP5A 5KGUA 4G57A 4S3SA 2SNMA 3QOLA 4EVOA 2F0FA 5KEEA 2EYPA 3TP8A 5C3XA 2WACA 4PNYA 4DFAA 3DHQA 5CV8A 2SNSA 5DEHA 1ENAA 2HQEA 1TR5A 4NKLA 1SNQA 1TT2A 5IGCA 1F2MA 2RDFA 3SK4A 1KDBA 2ENBA 3NK9A 3EROA 1KDCA 1SNCA 1STBA 1TQOA 3QB3A 4RKBA 4YIJA 1A3VA 3MVVA 3SK5A 3HEJA 1KDAA 3NUCA 3QOJA 5F2DA 5IOCA 4IUNA 5CV9A 3NXWA 3TP7A 3BDLA 5CR3A 1F2YA 1EYDA 4KHVA 2OXPA 2PQEA 4KD4A 4NDXA 2F0TA 4QMGA 5E1FA 5C4ZA 1SNPA 3MEHA 4HMJA 4K8IA 3D8GA 5EKLA 1IHZA 1RKNA 2F0DA 2F3VA 5J1ZA 5C5LA 2SOBA 3OMGA 3EJIA 2KHSA 1EY7A 4K2KA 2F0EA 4MIUA 3TP6A 2OF1A 2PZTA 1STYA 2F0MA 2EYHA 2F0PA 3LX0A 2F0UA 2F0HA 2F0LA 3T13A 2NUCA 1EY6A 4DU9A 5JAVA 5J22A 5IGBA 1SNDA 1SYDA 1NUCA 2F0WA 1EZ6A 1SYFA 3BDCA 4KY5A 5DAUA 5JOBA 3D4DA 5CGKA 1JOOA 3TMEA 5HURA 4KY7A 2EYFA 2F0IA 4NMZA 2EYJA 4K14A 5CV6A 2PYKA 4ZUJA 1STAA 5M9OA 1A2UA 5C4HA
chains in the Genus database with same CATH superfamily
2EJGC 2R93G 5IY0A 2CW0C 3LNNA 4YHHL 1N36L 3CC4A 1XX8A 2WAQG 2K4KA 3GTPB 4KHPQ 3CCUA 1YNND 5BR8Q 5M5YH 2NVYH 1AZQA 5IYCH 1YHQA 3T16A 3TREA 2PW5A 1OTCA 3P20A 4DV5L 2JEAI 2GVAA 2AQ2B 4JI1L 3GD7A 2CQAA 4RFBA 2R92G 3NHHA 1I4QA 4B3TL 4QF4A 1RL2A 2RQXA 1TY2A 3HG9A 1RIPA 2UXBL 5C44B 3OIPA 4LFAQ 5KNDA 3BS1A 3A7AB 3CRKC 2L15A 1IBLQ 4OIKA 1BCPD 1OO9B 3H0GG 4V190 4GKJL 4A3EG 3CQZH 3C3LA 3S1RB 2B63G 3MXPA 1XMOQ 3S1MB 1CSQA 5COYA 2H1EA 4A3IH 4JYAQ 3NSWA 1VQ7A 1SE3A 1X3EA 3K7AH 4P72A 3U4VA 4CDCC 4G7HC 5I9PA 3E6ZX 4JBMA 3T51B 3VA5A 5IGDA 4EQNA 5KYIA 4UHVA 1Q7YC 1AW7A 1B9MA 2QKIC 2UU9Q 3RN2A 4UY8C 2NVXH 3I73A 2M2LA 4LUVA 2A6HC 3AEVA 1SNQA 1GUSA 1YNJC 3K8AA 5IGCA 3VDYA 3C2PA 4ZCKA 2RF4A 2ZTDA 1A63A 4DR5Q 2AWNA 1G2TA 1NE3A 3KLWA 1S40A 1HZAA 3AFQA 1F2YA 2B8FA 5JEAJ 2L55A 3T4AC 4JBJA 3GTQB 2FJ2A 1L2FA 2B8GA 5T1GA 2ZJQA 3M7GA 3T13A 5C4JB 4DU9A 1D1KA 1EY6A 1JWUD 5J22A 1YJ9A 1SNDA 1RHPA 1PH6A 3BDCA 1CK1A 4P71A 5JOBA 1MHWC 2I5MX 2YTVA 2NBFA 2EYJA 4LF5Q 4DUYQ 5M9OA 3E3XA 3MC0B 2MO0A 1H9MA 3D6WA 3E0EA 3VYSA 4IQZA 3R2IA 1YIJA 1XYIA 4DAYB 2Q2IA 5IIFA 1SLJA 3CMEA 4X6AH 1A2TA 2BA0A 3KBGA 4WFN3 1HR0W 1O78A 3J81E 2VQFL 3T1HQ 1HNZL 3GDEA 1Y1VG 2PNHA 4OL7A 4QQBX 4A3FG 2CWPA 4FYDA 2EZVA 1PRTB 4Q5VA 5C4XB 3A56A 3OWFA 1TWCH 3A8KE 3TZDA 1JMCA 4B9XA 1JWMD 4A76A 1F2ZA 1FGUA 2G5DA 3HOUH 1IYVA 3BG3A 3Q23A 1JICA 5FO7B 3ZJYC 5EKKA 3OTOL 2B2VA 2UXCQ 2UUCL 1PH8A 5FJ8G 5CORA 1TS2A 5IP9G 2Z6BA 4K0KQ 3KYHC 3IFDA 1Y1WB 4DR3Q 3IRBA 3S9WA 4OGQC 2NN6H 4A3KB 2CCZA 1DD2A 1L1OA 3OYYA 1F77A 2B2UA 1HA6A 1L0WA 3NWSA 1PH2A 5K5PA 3DM1A 3U9SA 3CCJA 2NB0A 4UP9A 2QILA 2B39A 1VQIA 2F0GA 2WFWA 2YTXA 4PZ6A 4GOPC 2VL6A 2DN8A 5ELOA 5JJLA 2BE5C 4AQYQ 4OX9Q 1BO0A 4IUVA 4RHSA 3HOZG 2JQOA 2MQHA 1KDCA 3RZOB 1TQOA 4OONA 3J7A5 1HJPA 3HEJA 5GROA 3TRZA 1CQFA 1BKBA 3TP7A 2Q8TA 1BBWA 1EFID 1GO3E 4MN3A 4PMWA 1IHZA 4LFBL 1UE7A 2KEDA 1MI2A 4DR4L 2EYHA 2HDLA 2BDNA 3FDTA 1F9PA 1FD7D 2VUMH 5IGBA 4LF9Q 1EZ6A 5FOBB 2XSCA 4QUFA 3MWYW 1WD0A 3HGBA 1AZPA 1KNEA 5C4HA 4A3EH 2KOLA 4GKKQ 3BYYB 4L5RC 1BUVT 4KJOA 1D2BA 1TWGB 1S72A 2B63H 2N78A 2EXZA 2DY7A 1C9OA 5IWAQ 4LWCA 4J6HA 2KHIA 1STNA 2ZXPA 3KOJA 4C3IB 5T1IA 5IGGA 3L9AX 1EIFA 2XRQD 4JI4Q 4CDEC 3QIAA 1S5FD 3OSOA 1VQKA 1XNRQ 1NMFA 2OQKA 2UXDL 4BY7H 3MXNB 4X3TA 1DGSA 1WTWA 1BNZA 3V05A 4C2MH 1XXGA 2EQSA 1QZGA 4TSSA 3C1FA 1SYBA 2F0VA 1S3OA 1Q81C 3FVQA 5M5XH 3OW7A 2IX1A 1GUNA 3NBHB 1WJJA 1VQGA 2WAQB 2R7ZG 3GV6A 3D6CA 4X64Q 3D4RA 4LUZA 1HPCA 1LT6D 2QW7A 1EY9A 2NTTA 1C4QA 1SAPA 5C3WA 1LTTD 2A5HA 1AEXA 4HN7A 3F2UA 5LMUL 2CVRA 3C46A 2J7ZA 4LF8Q 2I5HA 3RMHA 1AN8A 4OO1H 1DM0B 3ND9A 4JI3Q 2B3GA 1TWHH 1CZGA 5DEHA 1KAWA 3PUXA 3GTOH 1QNKA 1PTOF 1O7ZA 4MHEA 3Q0AA 2ZM6Q 3ONAB 3TZUA 5AJ3L 3NXWA 1TS3A 1PRTC 1K8MA 2RDGA 3S16B 4X62L 4HMJA 3PGZA 4JI2Q 4JI8L 2F3VA 4A3FH 3TS2A 1MGSA 2KHSA 5D65A 4DR2L 2QCPX 1GUOA 2EJFC 5C0XG 4LUOA 1F2LA 1YNXA 2HHHL 4FXGC 4JW0A 5CGKA 2VQEQ 2M9VA 1X6OA 1IBML 3AMUA 2F4IA 3EBEA 3NEMA 5IODA 1YVCA 2L0CA 4P75A 4ALPA 3F8TA 2OTLA 3PMFA 4GZYC 4FXKC 4A3CH 3CPWA 4PMBA 4Z9CB 3IKJA 1EIYB 1EY8A 1QVCA 2B2YA 4PZ8A 2JA7G 3ITPA 4ME3A 1RTNA 3LWEA 5M3MG 2RBMA 3M4QA 4K5WA 4ME5A 4EX5A 1D1IA 1NR2A 1JJCB 3TBIB 2K5DA 3CCLA 4CDFC 1XMQL 3HOZH 5EPJA 2F4VL 3HOVG 3I3CA 3W3AA 1EY0A 3NE5B 2N8NA 4A3JG 1JCKB 3KF6A 2FHTA 1EOTA 1WOCA 3EFXD 4RCNA 3EVQA 1EY5A 2X69A 2A6ED 2KCTA 2E8GA 3VR6A 2UUBL 3H3VI 2EXDA 1HA5A 2F3WA 5JJIA 3PUWA 1L0YB 1UEBA 2CHBD 4O1NA 5BN4A 1B70B 3KLSA 2B2TC 1ILPA 3MFYA 4HSPA 4CBVA 1PH5A 2RSNA 1IZ6A 4B3SQ 4DV2L 2HT1A 4UDUC 1C7YA 3PO2B 1Q3LA 3QOLA 2VXWA 1SR3A 2FFKB 4HCEA 4IUPA 4ULLA 3HKSA 4YCVA 4PNYA 3D3RA 5EBCA 2HQEA 4IOAA 3NTHA 2UUAQ 2QEXA 4A3MH 3TDQA 1KDAA 1MJEA 4YY3L 4O2DA 4QMGA 1EYDA 4KHVA 5IYCG 2LXJA 3A5UA 1I50B 3QG1A 2QGQA 1X54A 2VW9A 3J81i 3AU7A 4KN7C 1KNAA 3IL8A 2JK8A 4KHPL 2B29A 2HDMA 2LFNA 1T9HA 3S24A 5BR8L 4DAPA 3M9BA 3CU7A 4CJ1B 2R7DA 1JC7A 1UEAB 1KHIA 1YNNC 3N52A 2NVTB 3P7JA 2HCIA 2XIWA 1EYAA 1B1ZA 5A35A 4K5XA 1Q86C 4X3SA 3NQTA 4NXNL 3HOXB 2VB2X 1C48A 3I4OA 4BA1I 3MHBA 4IOCA 1HFGA 4LFAL 3RUZA 2QEJC 2F0NA 1IBLL 2J0TD 1FYCA 4Y7NB 5DM73 4RGTA 5CYUA 3H09A 2ICIA 4K5VA 1FJGL 2O2LD 3SXHA 1VQBA 1I3QB 1SNOA 2B2WA 3UDGA 1L0XB 4IUUA 4A3GB 1KAAA 1HNXQ 1XMOL 3A74A 4J15A 4JYAL 4WJ3M 1PH9A 4L5TA 1YJWA 2I46A 4ZRZA 1H9SA 3UDFA 3KLRA 2MHVA 2E2HB 1X3FA 1JWSD 2D0OA 3R93A 2BDOA 1WTQA 2UU9L 3CW2C 4IPGA 4R4OA 1DJRD 2K05A 1ENFA 4K8JA 1K73C 1N32Q 4DF7A 4HJ9A 1HQRD 2ASBA 1FR3A 3S2HH 4KI0A 4B3MQ 2OT2A 4DR5L 4HEDA 2H5XA 1GUTA 2MUYA 1LUZA 2Z1CA 1B3QA 2DJGC 4X65L 3BZKA 2A68C 2K5WA 3HFZB 2B2VC 3S14H 3S15B 2O5JC 1FNWA 2JA6H 2JJQA 2ES2A 1CKMA 4C1NK 5FLXE 3A54A 2JA7H 4L5QA 2C5CA 4LW1A 1QG7A 2GN5A 4LF5L 5CR3A 2OXPA 4DUYL 2N3SA 2R7ZB 1WYDA 2ZXRA 1XPUA 5ELCA 3TSSA 4DAYA 1FL0A 4RGOS 1WCMG 1WVLA 1PH7A 1STYA 2F0MA 2F0UA 3M4PA 4JBKA 4OXPA 4LF6Q 4XT3B 1UE5A 3RZDH 1SYDA 3OHXC 4XYOA 4DV1Q 2WB1B 1F9QA 1IW7C 4N8FA 3CF5A 3HOUG 5JJKA 3LGJA 1SFOH 3S2DH 2VNUD 1IBKL 1A3UA 3U9OA 4A3BG 4A3DB 5C3EH 2HD3A 4CHTB 5J3BA 3FPPA 1K8GA 2NN6G 3FKIH 1PYSB 3K81C 5IGEA 4RHRA 4IFDH 2ZXOA 3S1MH 4YCUA 2UXCL 3ND8A 2IPKD 3HOWB 4JOIA 5LL6S 3CCSA 4K0KL 4DR3L 1SYGA 4JBWA 4DV7L 1DOMA 4TVAB 2KENA 4POFA 3OW2A 4GLAC 3X3MA 2F0JA 2L1BA 4GOPB 4NXMQ 3DEPA 4XXEA 1ZYRD 1ML0D 2F1MA 2WB1E 4IZ8A 1NBWA 3I4NH 4BBSB 4CKEA 1HRJA 4MZ9A 4AQYL 2DY8A 4OX9L 4YWMA 4EGVA 3WDNA 5LL6X 5LMNL 1PXUA 4DN4M 1PTOC 1VQ9A 1D8LA 4JI6Q 2VUMG 3GTQH 4OEMB 4DK1A 4PQXA 3ULLA 1BDOA 2F0FA 1TWFH 2JA8H 4C3JG 5CV8A 2DJFC 1GUGA 3HOVB 1ONLA 1F2MA 1W6JA 5D14A 3CKIB 1X3GA 3NK9A 5C0XJ 1PH1A 4LF9L 5M3FG 2XN9C 3G6JB 4IUNA 5A2QE 3HKZG 1SNPA 2PI2E 1I4RA 2CFMA 1PZKD 4DAMA 4BY7G 3J7YW 4FXDA 2PMZB 1LTID 1VQPA 3JAME 1UE1A 1VMCA 5DAUA 4BBRB 4CJ0B 1HCZA 1PFMA 4JI4L 4NMZA 3I72A 1G6PA 1XNRL 4DXGA 5C4XH 1AH9A 4KKSA 4AYBG 1KQSA 1SJED 2D62A 1UUPA 2EE1A 2LS01 2J4XA 3GTMB 4IJLA 1XPRA 3KDFB 1B53A 2NVYB 5E3FA 2I5LX 1ET9A 5IT9E 3I2ZA 1VCIA 3VYTA 3NBHA 4C3HB 1Y1WH 1WD1A 1U4MA 2IT1A 1TU2B 4A3KH 1QILA 3H94A 3STBC 3X3NA 1J6QA 2AQ3B 2K1BA 4OIJA 2IY5B 5CMDA 4X64L 4DNIA 4OO1G 4L8JA 1PHJA 3GTGH 3CP0A 3H6MA 4H02A 3NQIA 2Z4IA 4QUCA 2AMCB 1IL8A 3WOFA 1V43A 4KV6A 1Q1BA 5A2QL 4YWKA 3KK7A 3PUVA 4V0BA 3G71A 1VDZA 2PMZE 4CDDC 4LF8L 4P73A 5KRUA 2L11A 1JOQA 3CQZB 4JI3L 2AQ1B 4POGA 1F9RA 1WCMH 1ZXTA 3E9IA 1SN8A 1NCVA 5C6AA 1JT8A 3M4OH 4LMQD 3K5LA 1AE3A 4A3IB 1FNUA 5LHY1 4GN5A 1ESFA 3K7AB 1CZWA 1D6EC 4KJNA 3I90A 3CC2A 5C0XI 4XIGS 1HNWQ 4EVOA 4JI2L 3J81c 3FEWX 1CKNB 3DHQA 1S5ED 3R2TA 2KECA 3K0XA 3MXUA 4MTNA 4KN4C 1H9KA 1VQLA 4A3BH 3SK4A 3J7ZC 1K0RA 2Y0SB 1M8AA 1K83B 3NPPA 1BCPF 5FK9C 4A3CG 2VY3A 2G9DA 3QJYA 3W5OA 2EOTA 1YEZA 2JA5G 1E2VA 4UPAA 3MEHA 4A93G 3PO3H 5AFWA 5C5LA 4QCLA 2SOBA 4C3IH 2CW0D 1TWAH 2PZTA 2NVQH 3RD4A 1WI5A 1M1KC 3CC7A 1HR0L 4BXXG 2WIIB 3QR8A 1JOOA 4O0AA 5HGQA 2PYKA 2XRSD 2R61A 3J81L 2BA1A 4H13C 1CI3M 3UDIA 3UE0A 2A69C 1VMPA 1D7QA 4ZLTF 1II3A 2IW3A 3JC66 5K36H 3W2DA 4HAEA 4QJFA 5EPLA 1X9NA 2Z0SA 2K03A 3R3OA 1YBYA 4OWWB 2DUDA 3I91A 2E5LQ 2Y0SE 2OQ0A 3I56A 1LV9A 4C3JH 3FP9A 2BH8A 3MFGA 2ALYB 2AUJD 2JE6I 2NWGA 4JG2A 2X6GA 5BN5A 3C1EA 4M8AA 1KXLA 3G48A 2KCCA 1VQ6A 1IYUA 5M3FH 1PFBA 4IPDA 4A3MG 4RAUC 4B3SL 2K50A 2K33A 4DV0Q 3FPUB 1G6ZA 2EDGA 3DUZA 5I9OA 3CAMA 4UP7A 4RGNA 1JJGA 3V96A 1LTSD 2A6HD 1NR4A 1YNJD 4J8QA 2JSOA 2I07B 3J7AF 2E2IH 1GD7A 4DV4Q 3SR1A 3HS0C 1VQEA 2OEOA 2KCNA 1IXRA 1DOKA 1I6HH 1RODA 5HGTA 1CM9A 1SEBD 4G4KA 4GNXC 1YJNA 4G57A 1UNSA 1S4ZA 1EEFD 2R93B 2SNSA 1QVFA 4Q0FA 1BBXC 4LK1C 3VYRA 1STBA 3SGIA 4C1NI 1SJHD 3QOJA 2Z9HA 1E3PA 5CV9A 3PQIA 4R4CA 4NDXA 4BY1H 3KJPA 1KRSA 4R4QA 5EKLA 2Z6KC 1QWYA 4YCWA 1LO5D 2WP8J 3TP6A 2ZTCA 4IPCA 1H9JA 2R92B 2NZHA 3RR5A 3VA7A 3PIP3 2VUMB 3T1YL 1SSOA 5ELFA 1HZ9A 4K14A 2D2CC 3H0GB 1EQQA 2G9HD 4A3EB 2YU9H 2PQAB 5JPNC 2HIVA 4DAVA 1HNXL 4DK0A 3K5OA 1LLRD 4XQNA 2B63B 3NP8A 2V1CC 3A55A 2N49A 4IUTA 3U50C 3MA2B 1EOVA 5BN3A 1BBUA 1JR0D 4ZKCB 4B08A 2WAQE 4RGMA 1STHA 1FVIA 4KHZA 4DUZQ 4RG1A 1PFSA 4RWSC 2OWOA 4BA2I 5JVH3 1VQFA 3J80E 3Q8DA 3K7UC 1F9SA 5J39A 4U68A 3OOCA 1BQQT 1G8ZD 1V1PA 1KLGD 3M3YH 4B3ML 1SXTA 1YHBA 2EYLA 3S1QH 2JA6G 2UUCQ 2PPBC 1VQOA 1SE8A 1SMYC 1K9MC 3GTLH 5M5XB 4AYBB 1B50A 1D5MC 4AIMA 1C8CA 3A8JE 2JA5H 4A93H 1EQVA 2BE5D 2ZJPA 4KD3A 2A19A 2HCCA 2K5VA 1X3QA 1Z6HA 1STGA 2DNEA 1E24A 4CKBA 4BXXH 2Q2TA 4B3RL 2I0QA 2F03A 4JK1C 1QZHA 1K8AC 3Q24A 3JAMi 1A0IA 5KEEA 1GM5A 2XWBB 1K28A 4DFAA 3K80C 3MEFA 5C44G 1GKHA 2RDFA 4LF6L 3CD6A 3W1GA 1SNCA 4DV1L 1A3VA 1XTCD 1OXXK 2K52A 4LFBQ 5C3EG 3BDLA 3FKIG 3GTKH 4JI5Q 3L7ZC 3Q6SA 3VYUA 4IFDG 4HJ5A 1EL0A 1Y1VB 2NN6I 4A3FB 4G7ZC 3L2PA 5JAVA 2NUCA 2NYZD 3N6RA 3TEHB 1QUQA 3S17H 5M5WB 3NENA 4I7ZC 1BXTA 2F0WA 1SYFA 1KTKA 1N8RC 1I3QH 2K5HA 4KKTA 5DLQE 4A3GH 2E2JH 3K6OA 1E2ZA 3HRZC 4X3KA 4HCSA 2EVBA 1E1TA 1CHQD 4DK6C 4KTAA 1LACA 1BF4A 4HR7B 3I4MH 2E75C 3I4NG 4GOPA 2PI2A 4K2LA 1V9PA 1EYCA 5DNFA 3HOYH 4NXML 4FF1A 2UXDQ 1X3PA 5EPKA 4LFCQ 1PZJD 4H7BA 5IYDH 1ICWA 2HUGA 1WFQA 3K0YA 1ICFB 5D3DA 2F3IA 4R1JA 4DV3Q 4KKUA 2RA4A 3OPOA 3KBXA 1PTOB 3I8ZA 2JA8G 3FRPB 1GJXA 4JI0Q 3HOZB 1ZKOA 2MO1A 1H95A 1HHVA 2F0KA 4HTHA 1NTGA 2TSSA 4TRDA 3OMCA 1CA6A 1SROA 4KY6A 2PZWA 4P2CB 3D4WA 1U4PA 5JVG3 4BWGB 4HJ7A 3BYTB 3SE0A 3VR4A 3RNUA 3DEOA 1O80A 3G7LA 2L12A 1Y8OB 3M4YA 4QY7A 4DR7Q 3I4LA 3V2TA 1NY4A 1A15A 1XJVA 1BCPC 2LKVA 2QDBA 3ULPA 1Y69U 4FO2A 4HSVA 2KEEA 4XQJA 1HTPA 3RLOA 1SBBB 1PRTD 2QDLA 1TS4A 2IX3A 2EYPA 1VQNA 3TP8A 4KK7A 1CKOA 5C4XG 1G291 2H4OA 3T53B 3EQLC 2A73B 1PH3A 4CGYB 2JN4A 3ERSX 3GTJB 2JA9A 1MD2D 2ENBA 4APVA 5H1SE 4A3MB 4X62Q 1MSGA 1Y8NB 4R8IA 1SE2A 1Q82C 4H44C 2KJXA 5C4ZA 5FLMH 1EFWA 4DR2Q 1RF2D 1QJOA 5EJWA 1AE2A 3I55A 1P8LA 1Y1WG 1B7YB 3KJOA 1Q90A 4A3KG 4TQUS 3R8BA 3RLFA 2HHHQ 4DA2A 1VF7A 2CWAA 1YHAA 2O5IC 2LY7A 3HOWH 4KY5A 1KC8C 5HURA 3TMEA 4OO1I 4M1UB 5CBAE 3F2BA 2DNCA 1L1OC 3L0OA 2B2UC 2IL8A 2MPMA 4PV1C 3GTPH 3E5SA 1TXYA 5CV4A 3PIO3 2E74C 5IYBG 1LTRD 3M85A 3G4SA 3GP7A 4BBSH 4QGUA 4F8MA 2GVBA 4ZQ3A 1HZCA 3BDOA 1MBYA 1KABA 5FLXc 1N34Q 2SEBD 5I6YA 1Z47A 3A7LA 5KIXA 1XMQQ 3H15A 1HTLD 4Y52H 3T1HL 2DGYA 5KYLA 4XYQA 3I70A 3LWUA 2KQ3A 5C44H 5G3LD 2XTIA 5JEAH 3E0JA 1U9RA 4L5SA 3KF6B 1FNVA 1MSHA 1EZ8A 1WTRA 4QL5A 2BOSA 3B6YA 3K58A 3Q22A 2LSSA 4WJWA 1N33Q 1LTLA 1QCBD 1HNWL 4WRDA 3S1RH 1YITA 4A4IA 3VR5A 2K5NA 2O4XA 3SK8A 4B9WA 1VQCA 3PO3G 4IUQA 1ENCA 1VQ4A 1I4XA 2VS1A 2K04A 4C3IG 2MGSA 1R9TB 3BVZA 1QOHA 3I7FA 2F0OA 4ZKBB 1SYEA 2KVMA 5FLXL 1W3SA 3G6EA 5I2YA 5CV7A 3CCQA 4DKAC 4HIDA 1RJTA 4O42A 2BCOA 4DV6Q 4IO9A 1FGBD 3S14B 3DM3A 1ASZA 4XTCS 2XNAC 1DYQA 4YY3Q 1RD9D 2Z8LA 4MTKA 1VQJA 3URYA 2JA7B 5FO8B 5K36G 4ZYSA 1YZ6A 1RDPD 4GN4B 2IHFA 3GTMH 1GXDC 1Y8PB 3D8GA 4XQQA 5M3MB 2F0DA 1XTDA 3NTKA 3NBIA 5FKAC 4ABNA 5C4JH 5EQ0A 4IJHA 3GV3A 4U673 4C3HH 4IPHA 1I4PA 2FINB 3RZDB 2OTJA 1X56A 2EPBA 4FP5D 3J80i 1CUKA 4DK3C 5IP7H 1XNQQ 4RMFA 1LT4D 1S5DD 4NW2A 2E5LL 4ZUJA 4A3JB 2ZT9C 4LF4Q 4ODGA 1JORA 1DXMA 1I5FA 2K32A 5CV5A 4NXNQ 5TSSA 1G2SA 2JXMB 2RKSA 1LABA 1SDFA 2B2TA 1JB7A 5DM63 1SFOB 4DPGA 1IKMA 2Q8IB 4GKKL 2EY5A 4HIOA 3S2DB 3S1NB 3KLSX 4X66Q 5ELNA 1Q8KA 1OXTA 4DNTB 5IWAL 5C3EB 1FJGQ 1AP0A 4R8NA 3ERQA 3FKIB 1WTHA 3OWEB 4DV0L 2R7FA 2Q8RE 4ID6A 2KA7A 4I7AA 1AFPA 2VB3X 3MAQA 3MXNA 4ZAIA 3SK6A 4DR1Q 2AWOA 4PMCA 2VZAA 5D3IB 2L9HA 3KF8B 5GQOA 3PUYA 4GNXB 1H9SB 3CRLC 3D31A 3W1BA 4DV4L 3AB9A 1I4GA 3K59A 3JAMc 5G3LF 1Q8IA 5M5YB 1I94Q 2D9UA 2A68D 4DR6Q 1K83H 1KRTA 4BY1G 2MNAA 1N9WA 3I4NB 2CKZB 1RCVD 1EEID 4P74A 1E0BA 4JI7Q 1HQMC 3PIPA 1Q46A 5EGTA 1WTPA 2EIFA 4X65Q 1E2WA 4J1MA 2ATWA 5ELEA 3J7AV 5EAYA 4DGZA 1TKWB 2IHEA 1W2BA 4FF3A 5CC4A 4ZK9B 3PF5A 1EWIA 3TP5A 5IT9c 5KGUA 1V1OA 3FMCA 2B2YC 5C3XA 1G51A 1G91A 3A8IE 1TWFB 2JA8B 4IFDJ 2MP1A 4NKLA 1J5EQ 1E7ZA 1PMRA 3RZOH 1B4OA 1U4LA 1V8QA 2K7VA 5IYBH 3QB3A 4RKBA 1GUWA 1H9RA 1KL9A 1JB3A 3ER0A 5IOCA 1PLFA 3JAML 1IW7D 3RLNA 5GAGC 2PQAA 2ZM6L 4K8IA 4HJ8A 1QNUA 4EQ5A 1SE4A 4JCVE 1P16A 2OF1A 2F0HA 3SEBA 1SRUA 2NVXB 3BZDB 1IYJB 4DXFA 1X55A 2YYZA 4QIWB 3PO2G 5CV6A 3OIQA 5IT9L 1STAA 1PFNA 1KD1C 1IBKQ 4DUZL 4GLVB 2VQEL 3PF4A 3DWPA 1TWGH 4L63B 5CBEE 4LF7Q 5JJZA 4N9TA 3H3VH 1CFMA 3ICEA 4PG3A 4L6TB 4KLKA 1JOKA 2RDHA 4R4TA 4JV5Q 5C5MA 4E6IA 2PW7A 3M7NA 1KIXA 5ELDA 4DV7Q 2IX0A 1HXYD 1LT5D 4YHHQ 1N36Q 4HMIA 4QB4A 4N8X1 3GTGB 2WKDA 3KFUA 4EQOA 2N55A 1PTOD 2R93H 3IAYA 1SMXA 4DV5Q 2PZUA 3UE1A 4LJZC 4JI1Q 1MIUA 3SDZA 3MTSA 2EY1A 1ZEQX 3H91A 4QIWE 3PV0A 4RKLA 3HOXG 5LMNQ 4B3TQ 3ULJA 1WCMB 2UXBQ 3EA6A 4EQPA 1A3TA 1OXVA 1NMGA 1EQRA 4IFDI 4ZUIA 3M4OB 1SNMA 1ET6A 2IJ0A 5I6WA 1TWCB 2R92H 4GKJQ 4A3GG 4JI5L 1TS5A 2A6EC 3PCOB 3K5MA 3HOUB 2AKWB 2WACA 4HIKA 1ENAA 1PYWD 1TR5A 2XGTA 1TT2A 1B8AA 1KDBA 3TQYA 4A3BB 3H0GH 3I4MG 2B2WC 4CJ2C 4UP8A 2UUAL 4GLXA 3HOYG 1KLUD 3S16H 1Q1EA 4OWXB 3K5NA 2K14A 1VQ8A 4KD4A 5KNBA 2KCMA 3U58A 5IYDG 4R9WA 4OHJA 3PO3B 3OMGA 5E4WC 3BVGA 2KUMA 4PZ7A 2RCNA 1E1OA 4RH6A 1NJIC 1TWAB 2NVQB 5I4DA 2ZJRA 1LTAD 4K6LA 1T5EA 4UAIA 1CA5A 4LFCL 4KY7A 2EYFA 1A6XA 2N88A 1NNXA 1Z7TA 3SVMA 1U5KA 3O13A 1B3AA 1VQAA 4FNFA 4DV3L 3STBD 2RHQB 4HIMA 1EUJA 4OWTB 1IKLA 5KNCA 4JI0L 4F7XA 1VF5C 1X65A 3VR2A 5I2XA 1XWEA 2L5TA 3F2DA 1ILQA 2EY2A 1CT1D 1WTOA 2Z4HA 1CTMA 2EYMA 3PSIA 1LTBD 1VQMA 4C3JB 2RSOA 2YTYA 1GOZA 1STEA 2WB1G 1BCPB 3CPFA 1QE6A 4DR7L 2X6LA 1TIID 1Y14B 3CCMA 2GA4B 1QVGA 3MXGA 1LM0A 2M00A 2A1AA 4JVZA 4BS9A 2F0QA 5M3FB 2VQFQ 1HNZQ 2K5QA 2K6AA 3WWVA 2Q2HA 1CSPA 3HKZB 4KMUC 3DMUA 2ICEC 5FLMG 4A3DG 4IURA 1EY4A 1HZBA 1PV4A 2MJ8A 4BY7B 3CXCA 2L4NA 1ASYA 1I6VC 1N32L 5L37A 2F52A 1Y1VH 2D5DA 4X3UA 4GN3B 4C2MB 2E2IB 3PO2H 1UAPA 2EJMA 3OTOQ 3HOWG 4RA8A 3AQQA 1I6HB 3BVMA 4S3SA 2SNMA 2K28A 1B2TA 1HFNA 5M5WH 1M4VA 2WINB 1QB5D 4OELB 3PIOA 2R6GA 4JPBW 4CKCA 3UI2A 4A3LG 1X32A 1B44D 3J80c 2QF7A 4JOIC 4YIJA 1O7LA 3SK5A 2JYOA 3NUCA 5F2DA 1I4HA 1L1OB 5FJ8H 2NZ1D 2C35B 2QA4A 5IP9H 2ZTEA 2BH2A 1JE5A 1I50H 1CQVA 2F0TA 2PQEA 3PUZA 4BBSG 4LNQA 4BY1B 5J1ZA 1Q12A 1BR9A 2XVSA 1HR0Q 3LX0A 2A69D 3GQBA 2F0LA 2WKCA 3HKZE 5FO9B 5E7NA 1K0SA 2CH4A 1NUCA 4TKOB 1DZ1A 1TWHB 1PA6A 1K8OA 1EIGA 5JEAG 3GTOB 3T56B 1PTOH 2NVTH 1N34L 1WTXA 3CMAA 2YV5A 1NSNS 3DXJC 2YU9B 3HOXH 4DR4Q 1TY0A 5ELBA 2E2DC 1LYLA 3J80L 2XWJB 4N9PA 4AYBE 4Y7NH 1N33L 4YWLA 1DCZA 4I65A 1R4QB 2F0SA 4GS3A 4H0LC 1RTOA 2K75A 1BOSA 3WOEA 1EQTA 1R4PB 1CHPD 4BBRG 5ISRA 3EN2A 1C0AA 3HP3A 3M3YB 2IWHA 3S1QB 3E9HA 2E2HH 2K01A 3H3VC 4FDBA 1V1QA 2FMMA 3DWAA 2SDFA 1SYCA 3GTJH 3GTLB 1MJCA 3HZXA 1WTVA 2NZOA 4DV6L 2JA5B 4WJ4A 1ESRA 3CHBD 4A93B 3KUPA 4R4IA 1PZID 4WORA 2FMCA 2Q2UA 1OXSC 4C3HG 3DWQA 1J9OA 4NPSA 3NELA 1ZYRC 2PCFB 1T5XD 3BU2A 1BVSA 1LTGD 3AFPA 4NB3A 5IP7G 4JI6L 3S15H 1GHKA 2PO4A 2AHOB 2C9OA 1TVXA 4JC0A 5GADC 2HQLA 4MNOA 3UDXA 1DONA 3QO2A 3QWNA 1XNQL 4XT1B 5LMUQ 3CCVA 1NAPA 2R7ZH 5GAHC 5E1FA 4LF4L 1EU4A 3U4ZA 1LT3D 1RKNA 3GTKB 1PVOA 4MIUA 1DOLA 3EJIA 1EY7A 2F0EA 3T1YQ 3RN5A 1EIHA 5EKIA 3F1ZA 4A3IG 1A62A 4X66L 1VQDA 4AH6A 3S17B 3D4DA 1S5BD 1Z9FA 2HIXA 5AJ3Q 2F0IA 5HY6A 4F88A 1PH4A 2E2JB 2JEBI 1J8IA 3CCRA 1PYBA 4JI8Q 3K57A 4K6DA 1B9NA 4LAAA 3KF8A 4DR1L 2EYOA 2Y0SG 3L3OC 4GNXA 4A3DH 2NTSA 3I4MB 2KBNA 1U0LA 1JJ2A 4NP5A 1OXUA 3HOYB 3KDFA 1E22A 3CCEA 4IN3A 3SHLA 1IBMQ 1UWVA 1HH2P 2RCFA 1I94L 1SMYD 4DR6L 3VR3A 5IGFA 4RCOA 5C0XH 1R9TH 1JE4A 3NTIA 2EY6A 3IFTA 3TN2A 1V1PB 4JI7L 1K3BC 2RVLA 3TS0A 2AUKA 2D0PA 4A3LH 1PDQA 2Z6KA 1GHJA 2LXKA 1S5CD 1O7IA 2A74C 3A0JA 4DNRB 3BJUA 3P1HA 4FVMA 2KHJA 1UE6A 2CQOA 4ILWA 1EU3A 3MZ5A 3A5ZB 2FXQA 2R3ZA 4IALA 4FF4A 2LMCB 1D5XC 3GO5A 1J5EL 1M90C 4B3RQ 5NUCA 2F4VQ 1VQHA 3DLLA 1VQ5A 3P75A 5M3MH 2A8VA 4XDXA 1VS0A 1YI2A 2ID0A 1D5ZC 4C56C 1IL2A 1GVPA 1O7YA 1W6KA 2UUBQ 3F2CA 3HOVH 4G7OC 1U4RA 1CKNA 2RHSB 2WV6D 1MKHA 2JP1A 4A3JH 3FHWA 4HJAA 3EROA 2TMPA 3MVVA 5IE8A 1HUMA 5LMNW 4DV2Q 3S2HB 3S1NH 2P5ZX 2E76C 2PNRC 1A8VA 3D0FA 1XPOA 1JQYD 5GAEC 4K2KA 4LF7L 2OCEA 3ZYYX 5JPMC 3EIVA 2F0PA 4F87A 1EWCA 1QUQB 2V4DA 4BBRH 1EYGA 4JV5L 1K3RA 2MFIA 5E4XA 5EBDA 1PRTF 4FF2A 2JA6B 2CH4W 3BZCA 1EWHA 3AYHB 4A75A 1HUNA 3NWTA 3J81j 1A2UA
chains in the Genus database with same CATH topology
2EJGC 2CW0C 3LNNA 1XX8A 3GTPB 1YNND 1AZQA 3T16A 2PW5A 3P20A 2JEAI 2AQ2B 3GD7A 2CQAA 4RFBA 3NHHA 1I4QA 4QF4A 2RQXA 1TY2A 3HG9A 5C44B 3OIPA 5KNDA 3BS1A 3A7AB 3CRKC 4OIKA 1BCPD 1OO9B 4V190 3C3LA 3S1RB 3MXPA 3S1MB 5COYA 2H1EA 3NSWA 1SE3A 4G7HC 5I9PA 3E6ZX 3T51B 3VA5A 5IGDA 4EQNA 5KYIA 1AW7A 1B9MA 2QKIC 3I73A 2M2LA 2A6HC 1SNQA 1GUSA 1YNJC 5IGCA 3C2PA 2AWNA 1G2TA 1F2YA 2B8FA 5JEAJ 2L55A 3T4AC 3GTQB 2FJ2A 2B8GA 5T1GA 3M7GA 3T13A 5C4JB 4DU9A 1D1KA 1EY6A 1JWUD 5J22A 1SNDA 1RHPA 3BDCA 1CK1A 5JOBA 2NBFA 2EYJA 5M9OA 3MC0B 1H9MA 3D6WA 3VYSA 4IQZA 3R2IA 1XYIA 5IIFA 1A2TA 2BA0A 3KBGA 4WFN3 1O78A 3J81E 4OL7A 4FYDA 2EZVA 1PRTB 4Q5VA 5C4XB 3A56A 3OWFA 3A8KE 3TZDA 4B9XA 1JWMD 1F2ZA 1IYVA 3BG3A 3Q23A 1JICA 5FO7B 5EKKA 2B2VA 5CORA 1TS2A 3IFDA 1Y1WB 3S9WA 4OGQC 2NN6H 4A3KB 1DD2A 1F77A 2B2UA 1HA6A 3NWSA 5K5PA 3DM1A 3U9SA 2NB0A 2QILA 2B39A 2F0GA 2DN8A 2BE5C 1BO0A 4IUVA 4RHSA 1KDCA 3RZOB 1TQOA 3HEJA 1CQFA 3TP7A 2Q8TA 1EFID 4MN3A 4PMWA 1IHZA 2KEDA 1MI2A 2EYHA 2HDLA 2BDNA 3FDTA 1F9PA 1FD7D 5IGBA 5FOBB 1EZ6A 2XSCA 4QUFA 3MWYW 1WD0A 3HGBA 1AZPA 1KNEA 5C4HA 2KOLA 3BYYB 1BUVT 4KJOA 1D2BA 1TWGB 2EXZA 2DY7A 4J6HA 2ZXPA 1STNA 4C3IB 5T1IA 5IGGA 3L9AX 2XRQD 3QIAA 1S5FD 3OSOA 4X3TA 1WTWA 1BNZA 3V05A 1XXGA 4TSSA 3C1FA 1SYBA 2F0VA 3FVQA 3OW7A 2IX1A 1GUNA 2WAQB 3GV6A 3D6CA 3D4RA 1HPCA 1LT6D 1EY9A 2NTTA 1C4QA 1SAPA 5C3WA 1LTTD 2A5HA 1AEXA 4HN7A 3F2UA 3C46A 2CVRA 2J7ZA 3RMHA 1AN8A 4OO1H 1DM0B 3ND9A 1CZGA 5DEHA 3PUXA 1QNKA 1PTOF 1O7ZA 4MHEA 3Q0AA 3ONAB 3TZUA 3NXWA 1TS3A 1PRTC 1K8MA 2RDGA 3S16B 4HMJA 2F3VA 1MGSA 2KHSA 5D65A 2QCPX 1GUOA 2EJFC 5C0XG 1F2LA 4FXGC 5CGKA 2M9VA 3AMUA 2F4IA 5IODA 2L0CA 3PMFA 4GZYC 4FXKC 4PMBA 4Z9CB 3IKJA 1EY8A 2B2YA 3ITPA 1RTNA 3LWEA 2RBMA 4ME5A 4K5WA 1D1IA 1NR2A 3TBIB 2K5DA 5EPJA 3I3CA 3W3AA 1EY0A 3NE5B 1JCKB 2FHTA 1EOTA 3EFXD 4RCNA 3EVQA 1EY5A 2X69A 2A6ED 3VR6A 1HA5A 2F3WA 3PUWA 1L0YB 2CHBD 4O1NA 5BN4A 3KLSA 2B2TC 1ILPA 3MFYA 4HSPA 4CBVA 2RSNA 4UDUC 3PO2B 1Q3LA 3QOLA 2VXWA 2FFKB 4HCEA 4IUPA 4ULLA 4PNYA 3D3RA 5EBCA 2HQEA 3NTHA 3TDQA 1KDAA 4QMGA 1EYDA 4KHVA 1I50B 3QG1A 3AU7A 4KN7C 1KNAA 3IL8A 2HDMA 2LFNA 4DAPA 3CU7A 4CJ1B 1JC7A 1UEAB 1YNNC 3N52A 2NVTB 3P7JA 2HCIA 2XIWA 1EYAA 1B1ZA 5A35A 4K5XA 4X3SA 3NQTA 3HOXB 2VB2X 1C48A 4BA1I 3MHBA 1HFGA 3RUZA 2QEJC 2F0NA 2J0TD 1FYCA 4Y7NB 5DM73 4RGTA 5CYUA 3H09A 2ICIA 4K5VA 2O2LD 3SXHA 1I3QB 1SNOA 2B2WA 4A3GB 1L0XB 4IUUA 1KAAA 2I46A 4ZRZA 1H9SA 3KLRA 2MHVA 2E2HB 1JWSD 3R93A 2BDOA 1WTQA 1DJRD 2K05A 1ENFA 4K8JA 4DF7A 1HQRD 1FR3A 4KI0A 2OT2A 4HEDA 1GUTA 2MUYA 2Z1CA 2A68C 2K5WA 2B2VC 3S15B 2O5JC 1FNWA 4C1NK 5FLXE 3A54A 2C5CA 1QG7A 5CR3A 2OXPA 2R7ZB 2ZXRA 5ELCA 3TSSA 4DAYA 4RGOS 1WVLA 1STYA 2F0MA 2F0UA 4XT3B 1SYDA 4XYOA 3OHXC 2WB1B 1F9QA 1IW7C 2VNUD 1A3UA 3U9OA 4A3DB 4CHTB 3FPPA 2NN6G 5IGEA 4RHRA 4IFDH 2ZXOA 3ND8A 2IPKD 3HOWB 5LL6S 1SYGA 4JBWA 1DOMA 3X3MA 2F0JA 2L1BA 3DEPA 4XXEA 1ZYRD 1ML0D 2F1MA 4IZ8A 4BBSB 4CKEA 1HRJA 2DY8A 4EGVA 3WDNA 5LL6X 1PXUA 4DN4M 1PTOC 4DK1A 4PQXA 1BDOA 2F0FA 4C3JG 5CV8A 1GUGA 3HOVB 1ONLA 1F2MA 1W6JA 5D14A 3CKIB 3NK9A 5C0XJ 2XN9C 3G6JB 4IUNA 5A2QE 1SNPA 1I4RA 1PZKD 3J7YW 4FXDA 2PMZB 1LTID 3JAME 1VMCA 5DAUA 4BBRB 4CJ0B 1HCZA 1PFMA 4NMZA 3I72A 4DXGA 4KKSA 1SJED 2D62A 1UUPA 2EE1A 2LS01 2J4XA 3GTMB 1B53A 2NVYB 5E3FA 1ET9A 5IT9E 1VCIA 3VYTA 3NBHA 4C3HB 1WD1A 1U4MA 2IT1A 1TU2B 1QILA 3H94A 3X3NA 2AQ3B 2K1BA 4OIJA 5CMDA 4OO1G 4L8JA 3H6MA 3NQIA 2Z4IA 4QUCA 1IL8A 3WOFA 1V43A 4KV6A 1Q1BA 5A2QL 3KK7A 3PUVA 4V0BA 1VDZA 5KRUA 2L11A 1JOQA 3CQZB 2AQ1B 1F9RA 1ZXTA 1NCVA 5C6AA 4LMQD 3K5LA 4A3IB 1FNUA 5LHY1 1ESFA 3K7AB 1CZWA 1D6EC 4KJNA 3I90A 5C0XI 4XIGS 4EVOA 3FEWX 3DHQA 1S5ED 3R2TA 2KECA 3MXUA 4KN4C 1H9KA 3SK4A 2Y0SB 3NPPA 1M8AA 1K83B 1BCPF 5FK9C 2G9DA 3QJYA 2EOTA 1E2VA 3MEHA 5AFWA 5C5LA 4QCLA 2SOBA 2CW0D 2PZTA 3RD4A 2WIIB 1JOOA 2PYKA 2XRSD 2R61A 3J81L 2BA1A 4H13C 1CI3M 2A69C 1VMPA 4ZLTF 1II3A 2IW3A 5K36H 3W2DA 4HAEA 5EPLA 2K03A 3R3OA 3I91A 1LV9A 3MFGA 2AUJD 2JE6I 2NWGA 5BN5A 2X6GA 3C1EA 4M8AA 2KCCA 1IYUA 1PFBA 4RAUC 2K33A 3FPUB 1G6ZA 2EDGA 3DUZA 5I9OA 4RGNA 3V96A 1LTSD 2A6HD 1NR4A 1YNJD 4J8QA 2JSOA 2I07B 3J7AF 3SR1A 3HS0C 2OEOA 2KCNA 1DOKA 1RODA 5HGTA 1CM9A 1SEBD 4G4KA 4G57A 1UNSA 1S4ZA 1EEFD 2R93B 2SNSA 4Q0FA 1BBXC 4LK1C 3VYRA 1STBA 4C1NI 1SJHD 3QOJA 5CV9A 4NDXA 5EKLA 1QWYA 1LO5D 2WP8J 3TP6A 1H9JA 2R92B 3VA7A 3PIP3 2VUMB 1SSOA 5ELFA 4K14A 2D2CC 3H0GB 2G9HD 4A3EB 5JPNC 4DAVA 4DK0A 3K5OA 1LLRD 4XQNA 2B63B 3NP8A 3A55A 4IUTA 3MA2B 5BN3A 1JR0D 4ZKCB 4B08A 4RGMA 1STHA 4KHZA 4RWSC 4BA2I 5JVH3 3J80E 5J39A 1F9SA 4U68A 3OOCA 1BQQT 1G8ZD 1V1PA 1KLGD 1SXTA 2EYLA 2PPBC 1SMYC 5M5XB 4AYBB 1B50A 1D5MC 1C8CA 3A8JE 1EQVA 2BE5D 4KD3A 2HCCA 1X3QA 1Z6HA 1STGA 2DNEA 4CKBA 2F03A 4JK1C 3Q24A 5KEEA 2XWBB 4DFAA 2RDFA 1SNCA 1A3VA 1XTCD 1OXXK 3BDLA 3L7ZC 3Q6SA 3VYUA 4IFDG 1EL0A 1Y1VB 2NN6I 4A3FB 4G7ZC 5JAVA 2NUCA 2NYZD 3N6RA 5M5WB 4I7ZC 1BXTA 2F0WA 1SYFA 1KTKA 4KKTA 3K6OA 1E2ZA 3HRZC 4X3KA 4HCSA 2EVBA 1CHQD 4KTAA 1LACA 1BF4A 4HR7B 2E75C 4K2LA 5DNFA 1EYCA 4FF1A 1X3PA 5EPKA 1PZJD 4H7BA 1ICWA 2HUGA 3K0YA 5D3DA 4KKUA 2RA4A 3KBXA 3OPOA 1PTOB 3I8ZA 3FRPB 1GJXA 3HOZB 1ZKOA 1HHVA 2F0KA 4HTHA 2TSSA 4TRDA 1CA6A 3OMCA 4KY6A 2PZWA 4P2CB 3D4WA 1U4PA 5JVG3 4BWGB 3BYTB 3SE0A 3VR4A 3DEOA 1O80A 3G7LA 2L12A 1Y8OB 3M4YA 3I4LA 3V2TA 1A15A 1BCPC 2LKVA 2QDBA 1Y69U 4FO2A 4HSVA 2KEEA 4XQJA 1HTPA 1SBBB 1PRTD 1TS4A 2IX3A 2EYPA 3TP8A 4KK7A 1G291 2H4OA 3T53B 3EQLC 2A73B 4CGYB 3GTJB 1MD2D 2ENBA 4A3MB 1MSGA 1Y8NB 4R8IA 1SE2A 4H44C 2KJXA 5C4ZA 1RF2D 1QJOA 5EJWA 1Q90A 4TQUS 3R8BA 3RLFA 4DA2A 1VF7A 2O5IC 2LY7A 4KY5A 5HURA 3TMEA 4OO1I 4M1UB 5CBAE 2DNCA 2B2UC 2IL8A 2MPMA 4PV1C 3E5SA 5CV4A 3PIO3 2E74C 1LTRD 3M85A 3GP7A 4F8MA 4ZQ3A 3BDOA 1MBYA 1KABA 2SEBD 5I6YA 1Z47A 3A7LA 5KIXA 1HTLD 5KYLA 4XYQA 3I70A 3LWUA 2KQ3A 5G3LD 5JEAH 3E0JA 1U9RA 1FNVA 1MSHA 1EZ8A 1WTRA 2BOSA 3K58A 3Q22A 4WJWA 1QCBD 4WRDA 3VR5A 2O4XA 3SK8A 4B9WA 4IUQA 1ENCA 1I4XA 2K04A 4C3IG 2MGSA 1R9TB 3BVZA 1QOHA 2F0OA 4ZKBB 1SYEA 2KVMA 5FLXL 5I2YA 5CV7A 1RJTA 4O42A 2BCOA 1FGBD 3S14B 4XTCS 2XNAC 1DYQA 1RD9D 2Z8LA 3URYA 2JA7B 5FO8B 5K36G 4ZYSA 1RDPD 1GXDC 1Y8PB 3D8GA 4XQQA 5M3MB 2F0DA 3NTKA 3NBIA 5FKAC 4ABNA 5EQ0A 3GV3A 4U673 1I4PA 2FINB 3RZDB 2EPBA 4FP5D 1LT4D 1S5DD 4NW2A 4ZUJA 4A3JB 2ZT9C 1JORA 4ODGA 1DXMA 2K32A 5CV5A 5TSSA 1G2SA 2JXMB 2RKSA 1LABA 1SDFA 2B2TA 5DM63 1SFOB 1IKMA 2Q8IB 2EY5A 3S2DB 3S1NB 3KLSX 1OXTA 4DNTB 5C3EB 1AP0A 4R8NA 3ERQA 3FKIB 3OWEB 2Q8RE 4ID6A 2KA7A 1AFPA 2VB3X 3MAQA 3MXNA 4ZAIA 3SK6A 2AWOA 4PMCA 5D3IB 2L9HA 3PUYA 1H9SB 3CRLC 3D31A 3AB9A 1I4GA 3K59A 5G3LF 1Q8IA 5M5YB 2D9UA 2A68D 3I4NB 1RCVD 1EEID 1E0BA 1HQMC 1WTPA 5EGTA 1E2WA 4J1MA 5ELEA 3J7AV 4DGZA 1TKWB 4FF3A 5CC4A 4ZK9B 3TP5A 5KGUA 1V1OA 3FMCA 2B2YC 5C3XA 1G91A 3A8IE 1TWFB 2JA8B 4IFDJ 2MP1A 4NKLA 1PMRA 1B4OA 1U4LA 1V8QA 2K7VA 3QB3A 4RKBA 1GUWA 1H9RA 1JB3A 5IOCA 1PLFA 3JAML 1IW7D 4K8IA 1QNUA 1SE4A 2OF1A 2F0HA 3SEBA 2NVXB 3BZDB 4DXFA 2YYZA 4QIWB 5CV6A 3OIQA 5IT9L 1STAA 1PFNA 3DWPA 4L63B 5CBEE 5JJZA 4N9TA 1CFMA 4L6TB 1JOKA 2RDHA 5C5MA 4E6IA 2PW7A 3M7NA 5ELDA 2IX0A 1HXYD 1LT5D 4HMIA 4QB4A 3GTGB 2WKDA 4EQOA 2N55A 1PTOD 3IAYA 2PZUA 4LJZC 3SDZA 3MTSA 2EY1A 1ZEQX 3H91A 3PV0A 4RKLA 1WCMB 3EA6A 4EQPA 1A3TA 1OXVA 4IFDI 4ZUIA 3M4OB 1SNMA 1ET6A 2IJ0A 5I6WA 1TWCB 1TS5A 2A6EC 3K5MA 3HOUB 2WACA 1ENAA 1PYWD 1TR5A 1TT2A 1KDBA 4A3BB 2B2WC 4CJ2C 1KLUD 1Q1EA 3K5NA 4KD4A 5KNBA 4R9WA 4OHJA 3PO3B 3OMGA 5E4WC 3BVGA 2KUMA 4RH6A 1TWAB 2NVQB 5I4DA 1LTAD 4K6LA 1T5EA 4UAIA 1CA5A 4KY7A 2EYFA 1A6XA 2N88A 1Z7TA 3SVMA 3O13A 1B3AA 4FNFA 1IKLA 5KNCA 4F7XA 1VF5C 3VR2A 5I2XA 1XWEA 2L5TA 1ILQA 2EY2A 1CT1D 1WTOA 2Z4HA 1CTMA 2EYMA 1LTBD 4C3JB 2RSOA 1GOZA 1STEA 1BCPB 1QE6A 2X6LA 1TIID 2GA4B 3MXGA 2M00A 4BS9A 2F0QA 5M3FB 2K5QA 2K6AA 3HKZB 4KMUC 3DMUA 2ICEC 4IURA 1EY4A 2MJ8A 4BY7B 2L4NA 1I6VC 2D5DA 4X3UA 4C2MB 2E2IB 1UAPA 2EJMA 4RA8A 1I6HB 3BVMA 4S3SA 2SNMA 2K28A 1B2TA 1HFNA 1M4VA 2WINB 1QB5D 2R6GA 4CKCA 3UI2A 1X32A 1B44D 2QF7A 4YIJA 1O7LA 3SK5A 5F2DA 2JYOA 3NUCA 1I4HA 2NZ1D 2PQEA 1CQVA 2F0TA 3PUZA 4BY1B 5J1ZA 1Q12A 1BR9A 2XVSA 3LX0A 2A69D 3GQBA 2F0LA 2WKCA 5FO9B 1NUCA 4TKOB 1DZ1A 1TWHB 1K8OA 1EIGA 5JEAG 3GTOB 3T56B 1PTOH 1WTXA 1NSNS 3DXJC 2YU9B 1TY0A 5ELBA 2E2DC 3J80L 2XWJB 4N9PA 1DCZA 4I65A 1R4QB 2F0SA 4H0LC 1RTOA 1BOSA 3WOEA 1EQTA 1R4PB 1CHPD 5ISRA 3HP3A 3M3YB 2IWHA 3S1QB 2K01A 3H3VC 2FMMA 3DWAA 2SDFA 1SYCA 3GTLB 3HZXA 1WTVA 2JA5B 1ESRA 3CHBD 4A93B 3KUPA 1PZID 4WORA 2FMCA 1OXSC 4C3HG 3DWQA 1J9OA 1ZYRC 2PCFB 1T5XD 1LTGD 1GHKA 2PO4A 2C9OA 1TVXA 1DONA 3QO2A 3QWNA 4XT1B 1NAPA 5E1FA 1EU4A 1LT3D 1RKNA 3GTKB 4MIUA 1DOLA 3EJIA 1EY7A 2F0EA 1EIHA 5EKIA 3S17B 3D4DA 1S5BD 2F0IA 4F88A 2E2JB 2JEBI 1J8IA 3K57A 4K6DA 1B9NA 4LAAA 3KF8A 2EYOA 3L3OC 2NTSA 3I4MB 4NP5A 1OXUA 3HOYB 4IN3A 3SHLA 1SMYD 3VR3A 5IGFA 4RCOA 5C0XH 1JE4A 3NTIA 2EY6A 3IFTA 3TN2A 1V1PB 2RVLA 2AUKA 1PDQA 1GHJA 1S5CD 4DNRB 2A74C 3P1HA 4FVMA 4ILWA 1EU3A 3MZ5A 2R3ZA 4IALA 4FF4A 2LMCB 1D5XC 3GO5A 5NUCA 3P75A 4XDXA 2ID0A 1D5ZC 4C56C 1O7YA 1W6KA 4G7OC 1U4RA 2WV6D 2JP1A 3EROA 2TMPA 3MVVA 1HUMA 3S2HB 2E76C 2PNRC 1JQYD 4K2KA 3ZYYX 5JPMC 4F87A 2F0PA 1EWCA 2V4DA 5E4XA 5EBDA 1PRTF 4FF2A 2JA6B 1EWHA 1HUNA 3NWTA 1A2UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ODG A;  5CV5 A;  4KTA A;  4KJO A;  4K6D A;  1EYA A;  2RKS A;  1NSN S;  3PMF A;  3E5S A;  4LAA A;  4K5X A;  2EXZ A;  5IOD A;  3NQT A;  2EY5 A;  2EYO A;  3NP8 A;  4N9T A;  4PMB A;  1A3U A;  5CV4 A;  3U9O A;  4J6H A;  4K2L A;  1II3 A;  1EYC A;  1STN A;  3MHB A;  4F7X A;  1EY8 A;  4N9P A;  4NP5 A;  3RUZ A;  5E3F A;  3ITP A;  5IIF A;  1JOK A;  3T16 A;  4F8M A;  4ZQ3 A;  1A2T A;  2F0N A;  5IGG A;  3SHL A;  4H7B A;  3R3O A;  4R8N A;  2PW5 A;  1KAB A;  3ERQ A;  5C5M A;  4E6I A;  3OSO A;  5IGE A;  2PW7 A;  1STH A;  5I6Y A;  2EY2 A;  2RBM A;  4ID6 A;  4I65 A;  4K5V A;  4K5W A;  4ME5 A;  5KIX A;  4OL7 A;  3SXH A;  5IGF A;  1SNO A;  2EYM A;  2F0S A;  3NHH A;  5KYL A;  2EY6 A;  1KAA A;  4HMI A;  4QB4 A;  4QF4 A;  3SK6 A;  1SYG A;  2KQ3 A;  4PMC A;  5J39 A;  3OWF A;  5K5P A;  3C1E A;  3C1F A;  3H6M A;  4B9X A;  1F2Z A;  2F0J A;  2EYL A;  5ISR A;  1EY0 A;  1SYB A;  1U9R A;  2F0V A;  1JOR A;  4KV6 A;  4EQO A;  2M00 A;  2F0K A;  4HTH A;  1EZ8 A;  4TRD A;  3OMC A;  2F0Q A;  3P1H A;  4KY6 A;  5EKK A;  2PZW A;  2PZU A;  3D4W A;  1SYC A;  5KRU A;  4WRD A;  3EVQ A;  1EY5 A;  3DMU A;  3HZX A;  4IZ8 A;  1JOQ A;  5I9O A;  2EY1 A;  3MZ5 A;  2O4X A;  3D6C A;  3SK8 A;  2F3W A;  4IAL A;  1EQV A;  3MXP A;  4K8J A;  4RKL A;  4B9W A;  4DF7 A;  4KD3 A;  3S9W A;  5EGT A;  1EY4 A;  4WOR A;  1ENC A;  5NUC A;  5C6A A;  4EQP A;  1A3T A;  4J1M A;  1EY9 A;  1STG A;  3V2T A;  5C3W A;  4ZUI A;  5I9P A;  3VA5 A;  1AEX A;  3P75 A;  4DGZ A;  2F0O A;  1SNM A;  4KJN A;  1SYE A;  2LKV A;  3SR1 A;  2QDB A;  4EQN A;  5IGD A;  2OEO A;  5KYI A;  5CC4 A;  5I6W A;  5CV7 A;  5HGT A;  2F0G A;  3TP5 A;  5KGU A;  4G57 A;  4S3S A;  2SNM A;  3QOL A;  4EVO A;  2F0F A;  5KEE A;  2EYP A;  3TP8 A;  5C3X A;  2WAC A;  4PNY A;  4DFA A;  3DHQ A;  5CV8 A;  2SNS A;  5DEH A;  1ENA A;  2HQE A;  1TR5 A;  4NKL A;  1SNQ A;  1TT2 A;  5IGC A;  1F2M A;  2RDF A;  3SK4 A;  1KDB A;  2ENB A;  3NK9 A;  3ERO A;  1KDC A;  1SNC A;  1STB A;  1TQO A;  3QB3 A;  4RKB A;  4YIJ A;  1A3V A;  3MVV A;  3SK5 A;  3HEJ A;  1KDA A;  3NUC A;  3QOJ A;  5F2D A;  5IOC A;  4IUN A;  5CV9 A;  3NXW A;  3TP7 A;  3BDL A;  5CR3 A;  1F2Y A;  1EYD A;  4KHV A;  2OXP A;  2PQE A;  4KD4 A;  4NDX A;  2F0T A;  4QMG A;  5E1F A;  5C4Z A;  1SNP A;  3MEH A;  4HMJ A;  4K8I A;  3D8G A;  5EKL A;  1IHZ A;  1RKN A;  2F0D A;  2F3V A;  5J1Z A;  5C5L A;  2SOB A;  3OMG A;  3EJI A;  2KHS A;  1EY7 A;  4K2K A;  2F0E A;  4MIU A;  3TP6 A;  2OF1 A;  2PZT A;  1STY A;  2F0M A;  2EYH A;  2F0P A;  3LX0 A;  2F0U A;  2F0H A;  2F0L A;  3T13 A;  2NUC A;  1EY6 A;  4DU9 A;  5JAV A;  5J22 A;  5IGB A;  1SND A;  1SYD A;  1NUC A;  2F0W A;  1EZ6 A;  1SYF A;  3BDC A;  4KY5 A;  5DAU A;  5JOB A;  3D4D A;  5CGK A;  1JOO A;  3TME A;  5HUR A;  4KY7 A;  2EYF A;  2F0I A;  4NMZ A;  2EYJ A;  4K14 A;  5CV6 A;  2PYK A;  4ZUJ A;  1STA A;  5M9O A;  1A2U A;  5C4H A; 
#chains in the Genus database with same CATH topology
 2EJG C;  2R93 G;  5IY0 A;  2CW0 C;  3LNN A;  4YHH L;  1N36 L;  3CC4 A;  1XX8 A;  2WAQ G;  2K4K A;  3GTP B;  4KHP Q;  3CCU A;  1YNN D;  5BR8 Q;  5M5Y H;  2NVY H;  1AZQ A;  5IYC H;  1YHQ A;  3T16 A;  3TRE A;  2PW5 A;  1OTC A;  3P20 A;  4DV5 L;  2JEA I;  2GVA A;  2AQ2 B;  4JI1 L;  3GD7 A;  2CQA A;  4RFB A;  2R92 G;  3NHH A;  1I4Q A;  4B3T L;  4QF4 A;  1RL2 A;  2RQX A;  1TY2 A;  3HG9 A;  1RIP A;  2UXB L;  5C44 B;  3OIP A;  4LFA Q;  5KND A;  3BS1 A;  3A7A B;  3CRK C;  2L15 A;  1IBL Q;  4OIK A;  1BCP D;  1OO9 B;  3H0G G;  4V19 0;  4GKJ L;  4A3E G;  3CQZ H;  3C3L A;  3S1R B;  2B63 G;  3MXP A;  1XMO Q;  3S1M B;  1CSQ A;  5COY A;  2H1E A;  4A3I H;  4JYA Q;  3NSW A;  1VQ7 A;  1SE3 A;  1X3E A;  3K7A H;  4P72 A;  3U4V A;  4CDC C;  4G7H C;  5I9P A;  3E6Z X;  4JBM A;  3T51 B;  3VA5 A;  5IGD A;  4EQN A;  5KYI A;  4UHV A;  1Q7Y C;  1AW7 A;  1B9M A;  2QKI C;  2UU9 Q;  3RN2 A;  4UY8 C;  2NVX H;  3I73 A;  2M2L A;  4LUV A;  2A6H C;  3AEV A;  1SNQ A;  1GUS A;  1YNJ C;  3K8A A;  5IGC A;  3VDY A;  3C2P A;  4ZCK A;  2RF4 A;  2ZTD A;  1A63 A;  4DR5 Q;  2AWN A;  1G2T A;  1NE3 A;  3KLW A;  1S40 A;  1HZA A;  3AFQ A;  1F2Y A;  2B8F A;  5JEA J;  2L55 A;  3T4A C;  4JBJ A;  3GTQ B;  2FJ2 A;  1L2F A;  2B8G A;  5T1G A;  2ZJQ A;  3M7G A;  3T13 A;  5C4J B;  4DU9 A;  1D1K A;  1EY6 A;  1JWU D;  5J22 A;  1YJ9 A;  1SND A;  1RHP A;  1PH6 A;  3BDC A;  1CK1 A;  4P71 A;  5JOB A;  1MHW C;  2I5M X;  2YTV A;  2NBF A;  2EYJ A;  4LF5 Q;  4DUY Q;  5M9O A;  3E3X A;  3MC0 B;  2MO0 A;  1H9M A;  3D6W A;  3E0E A;  3VYS A;  4IQZ A;  3R2I A;  1YIJ A;  1XYI A;  4DAY B;  2Q2I A;  5IIF A;  1SLJ A;  3CME A;  4X6A H;  1A2T A;  2BA0 A;  3KBG A;  4WFN 3;  1HR0 W;  1O78 A;  3J81 E;  2VQF L;  3T1H Q;  1HNZ L;  3GDE A;  1Y1V G;  2PNH A;  4OL7 A;  4QQB X;  4A3F G;  2CWP A;  4FYD A;  2EZV A;  1PRT B;  4Q5V A;  5C4X B;  3A56 A;  3OWF A;  1TWC H;  3A8K E;  3TZD A;  1JMC A;  4B9X A;  1JWM D;  4A76 A;  1F2Z A;  1FGU A;  2G5D A;  3HOU H;  1IYV A;  3BG3 A;  3Q23 A;  1JIC A;  5FO7 B;  3ZJY C;  5EKK A;  3OTO L;  2B2V A;  2UXC Q;  2UUC L;  1PH8 A;  5FJ8 G;  5COR A;  1TS2 A;  5IP9 G;  2Z6B A;  4K0K Q;  3KYH C;  3IFD A;  1Y1W B;  4DR3 Q;  3IRB A;  3S9W A;  4OGQ C;  2NN6 H;  4A3K B;  2CCZ A;  1DD2 A;  1L1O A;  3OYY A;  1F77 A;  2B2U A;  1HA6 A;  1L0W A;  3NWS A;  1PH2 A;  5K5P A;  3DM1 A;  3U9S A;  3CCJ A;  2NB0 A;  4UP9 A;  2QIL A;  2B39 A;  1VQI A;  2F0G A;  2WFW A;  2YTX A;  4PZ6 A;  4GOP C;  2VL6 A;  2DN8 A;  5ELO A;  5JJL A;  2BE5 C;  4AQY Q;  4OX9 Q;  1BO0 A;  4IUV A;  4RHS A;  3HOZ G;  2JQO A;  2MQH A;  1KDC A;  3RZO B;  1TQO A;  4OON A;  3J7A 5;  1HJP A;  3HEJ A;  5GRO A;  3TRZ A;  1CQF A;  1BKB A;  3TP7 A;  2Q8T A;  1BBW A;  1EFI D;  1GO3 E;  4MN3 A;  4PMW A;  1IHZ A;  4LFB L;  1UE7 A;  2KED A;  1MI2 A;  4DR4 L;  2EYH A;  2HDL A;  2BDN A;  3FDT A;  1F9P A;  1FD7 D;  2VUM H;  5IGB A;  4LF9 Q;  1EZ6 A;  5FOB B;  2XSC A;  4QUF A;  3MWY W;  1WD0 A;  3HGB A;  1AZP A;  1KNE A;  5C4H A;  4A3E H;  2KOL A;  4GKK Q;  3BYY B;  4L5R C;  1BUV T;  4KJO A;  1D2B A;  1TWG B;  1S72 A;  2B63 H;  2N78 A;  2EXZ A;  2DY7 A;  1C9O A;  5IWA Q;  4LWC A;  4J6H A;  2KHI A;  1STN A;  2ZXP A;  3KOJ A;  4C3I B;  5T1I A;  5IGG A;  3L9A X;  1EIF A;  2XRQ D;  4JI4 Q;  4CDE C;  3QIA A;  1S5F D;  3OSO A;  1VQK A;  1XNR Q;  1NMF A;  2OQK A;  2UXD L;  4BY7 H;  3MXN B;  4X3T A;  1DGS A;  1WTW A;  1BNZ A;  3V05 A;  4C2M H;  1XXG A;  2EQS A;  1QZG A;  4TSS A;  3C1F A;  1SYB A;  2F0V A;  1S3O A;  1Q81 C;  3FVQ A;  5M5X H;  3OW7 A;  2IX1 A;  1GUN A;  3NBH B;  1WJJ A;  1VQG A;  2WAQ B;  2R7Z G;  3GV6 A;  3D6C A;  4X64 Q;  3D4R A;  4LUZ A;  1HPC A;  1LT6 D;  2QW7 A;  1EY9 A;  2NTT A;  1C4Q A;  1SAP A;  5C3W A;  1LTT D;  2A5H A;  1AEX A;  4HN7 A;  3F2U A;  5LMU L;  2CVR A;  3C46 A;  2J7Z A;  4LF8 Q;  2I5H A;  3RMH A;  1AN8 A;  4OO1 H;  1DM0 B;  3ND9 A;  4JI3 Q;  2B3G A;  1TWH H;  1CZG A;  5DEH A;  1KAW A;  3PUX A;  3GTO H;  1QNK A;  1PTO F;  1O7Z A;  4MHE A;  3Q0A A;  2ZM6 Q;  3ONA B;  3TZU A;  5AJ3 L;  3NXW A;  1TS3 A;  1PRT C;  1K8M A;  2RDG A;  3S16 B;  4X62 L;  4HMJ A;  3PGZ A;  4JI2 Q;  4JI8 L;  2F3V A;  4A3F H;  3TS2 A;  1MGS A;  2KHS A;  5D65 A;  4DR2 L;  2QCP X;  1GUO A;  2EJF C;  5C0X G;  4LUO A;  1F2L A;  1YNX A;  2HHH L;  4FXG C;  4JW0 A;  5CGK A;  2VQE Q;  2M9V A;  1X6O A;  1IBM L;  3AMU A;  2F4I A;  3EBE A;  3NEM A;  5IOD A;  1YVC A;  2L0C A;  4P75 A;  4ALP A;  3F8T A;  2OTL A;  3PMF A;  4GZY C;  4FXK C;  4A3C H;  3CPW A;  4PMB A;  4Z9C B;  3IKJ A;  1EIY B;  1EY8 A;  1QVC A;  2B2Y A;  4PZ8 A;  2JA7 G;  3ITP A;  4ME3 A;  1RTN A;  3LWE A;  5M3M G;  2RBM A;  3M4Q A;  4K5W A;  4ME5 A;  4EX5 A;  1D1I A;  1NR2 A;  1JJC B;  3TBI B;  2K5D A;  3CCL A;  4CDF C;  1XMQ L;  3HOZ H;  5EPJ A;  2F4V L;  3HOV G;  3I3C A;  3W3A A;  1EY0 A;  3NE5 B;  2N8N A;  4A3J G;  1JCK B;  3KF6 A;  2FHT A;  1EOT A;  1WOC A;  3EFX D;  4RCN A;  3EVQ A;  1EY5 A;  2X69 A;  2A6E D;  2KCT A;  2E8G A;  3VR6 A;  2UUB L;  3H3V I;  2EXD A;  1HA5 A;  2F3W A;  5JJI A;  3PUW A;  1L0Y B;  1UEB A;  2CHB D;  4O1N A;  5BN4 A;  1B70 B;  3KLS A;  2B2T C;  1ILP A;  3MFY A;  4HSP A;  4CBV A;  1PH5 A;  2RSN A;  1IZ6 A;  4B3S Q;  4DV2 L;  2HT1 A;  4UDU C;  1C7Y A;  3PO2 B;  1Q3L A;  3QOL A;  2VXW A;  1SR3 A;  2FFK B;  4HCE A;  4IUP A;  4ULL A;  3HKS A;  4YCV A;  4PNY A;  3D3R A;  5EBC A;  2HQE A;  4IOA A;  3NTH A;  2UUA Q;  2QEX A;  4A3M H;  3TDQ A;  1KDA A;  1MJE A;  4YY3 L;  4O2D A;  4QMG A;  1EYD A;  4KHV A;  5IYC G;  2LXJ A;  3A5U A;  1I50 B;  3QG1 A;  2QGQ A;  1X54 A;  2VW9 A;  3J81 i;  3AU7 A;  4KN7 C;  1KNA A;  3IL8 A;  2JK8 A;  4KHP L;  2B29 A;  2HDM A;  2LFN A;  1T9H A;  3S24 A;  5BR8 L;  4DAP A;  3M9B A;  3CU7 A;  4CJ1 B;  2R7D A;  1JC7 A;  1UEA B;  1KHI A;  1YNN C;  3N52 A;  2NVT B;  3P7J A;  2HCI A;  2XIW A;  1EYA A;  1B1Z A;  5A35 A;  4K5X A;  1Q86 C;  4X3S A;  3NQT A;  4NXN L;  3HOX B;  2VB2 X;  1C48 A;  3I4O A;  4BA1 I;  3MHB A;  4IOC A;  1HFG A;  4LFA L;  3RUZ A;  2QEJ C;  2F0N A;  1IBL L;  2J0T D;  1FYC A;  4Y7N B;  5DM7 3;  4RGT A;  5CYU A;  3H09 A;  2ICI A;  4K5V A;  1FJG L;  2O2L D;  3SXH A;  1VQB A;  1I3Q B;  1SNO A;  2B2W A;  3UDG A;  1L0X B;  4IUU A;  4A3G B;  1KAA A;  1HNX Q;  1XMO L;  3A74 A;  4J15 A;  4JYA L;  4WJ3 M;  1PH9 A;  4L5T A;  1YJW A;  2I46 A;  4ZRZ A;  1H9S A;  3UDF A;  3KLR A;  2MHV A;  2E2H B;  1X3F A;  1JWS D;  2D0O A;  3R93 A;  2BDO A;  1WTQ A;  2UU9 L;  3CW2 C;  4IPG A;  4R4O A;  1DJR D;  2K05 A;  1ENF A;  4K8J A;  1K73 C;  1N32 Q;  4DF7 A;  4HJ9 A;  1HQR D;  2ASB A;  1FR3 A;  3S2H H;  4KI0 A;  4B3M Q;  2OT2 A;  4DR5 L;  4HED A;  2H5X A;  1GUT A;  2MUY A;  1LUZ A;  2Z1C A;  1B3Q A;  2DJG C;  4X65 L;  3BZK A;  2A68 C;  2K5W A;  3HFZ B;  2B2V C;  3S14 H;  3S15 B;  2O5J C;  1FNW A;  2JA6 H;  2JJQ A;  2ES2 A;  1CKM A;  4C1N K;  5FLX E;  3A54 A;  2JA7 H;  4L5Q A;  2C5C A;  4LW1 A;  1QG7 A;  2GN5 A;  4LF5 L;  5CR3 A;  2OXP A;  4DUY L;  2N3S A;  2R7Z B;  1WYD A;  2ZXR A;  1XPU A;  5ELC A;  3TSS A;  4DAY A;  1FL0 A;  4RGO S;  1WCM G;  1WVL A;  1PH7 A;  1STY A;  2F0M A;  2F0U A;  3M4P A;  4JBK A;  4OXP A;  4LF6 Q;  4XT3 B;  1UE5 A;  3RZD H;  1SYD A;  3OHX C;  4XYO A;  4DV1 Q;  2WB1 B;  1F9Q A;  1IW7 C;  4N8F A;  3CF5 A;  3HOU G;  5JJK A;  3LGJ A;  1SFO H;  3S2D H;  2VNU D;  1IBK L;  1A3U A;  3U9O A;  4A3B G;  4A3D B;  5C3E H;  2HD3 A;  4CHT B;  5J3B A;  3FPP A;  1K8G A;  2NN6 G;  3FKI H;  1PYS B;  3K81 C;  5IGE A;  4RHR A;  4IFD H;  2ZXO A;  3S1M H;  4YCU A;  2UXC L;  3ND8 A;  2IPK D;  3HOW B;  4JOI A;  5LL6 S;  3CCS A;  4K0K L;  4DR3 L;  1SYG A;  4JBW A;  4DV7 L;  1DOM A;  4TVA B;  2KEN A;  4POF A;  3OW2 A;  4GLA C;  3X3M A;  2F0J A;  2L1B A;  4GOP B;  4NXM Q;  3DEP A;  4XXE A;  1ZYR D;  1ML0 D;  2F1M A;  2WB1 E;  4IZ8 A;  1NBW A;  3I4N H;  4BBS B;  4CKE A;  1HRJ A;  4MZ9 A;  4AQY L;  2DY8 A;  4OX9 L;  4YWM A;  4EGV A;  3WDN A;  5LL6 X;  5LMN L;  1PXU A;  4DN4 M;  1PTO C;  1VQ9 A;  1D8L A;  4JI6 Q;  2VUM G;  3GTQ H;  4OEM B;  4DK1 A;  4PQX A;  3ULL A;  1BDO A;  2F0F A;  1TWF H;  2JA8 H;  4C3J G;  5CV8 A;  2DJF C;  1GUG A;  3HOV B;  1ONL A;  1F2M A;  1W6J A;  5D14 A;  3CKI B;  1X3G A;  3NK9 A;  5C0X J;  1PH1 A;  4LF9 L;  5M3F G;  2XN9 C;  3G6J B;  4IUN A;  5A2Q E;  3HKZ G;  1SNP A;  2PI2 E;  1I4R A;  2CFM A;  1PZK D;  4DAM A;  4BY7 G;  3J7Y W;  4FXD A;  2PMZ B;  1LTI D;  1VQP A;  3JAM E;  1UE1 A;  1VMC A;  5DAU A;  4BBR B;  4CJ0 B;  1HCZ A;  1PFM A;  4JI4 L;  4NMZ A;  3I72 A;  1G6P A;  1XNR L;  4DXG A;  5C4X H;  1AH9 A;  4KKS A;  4AYB G;  1KQS A;  1SJE D;  2D62 A;  1UUP A;  2EE1 A;  2LS0 1;  2J4X A;  3GTM B;  4IJL A;  1XPR A;  3KDF B;  1B53 A;  2NVY B;  5E3F A;  2I5L X;  1ET9 A;  5IT9 E;  3I2Z A;  1VCI A;  3VYT A;  3NBH A;  4C3H B;  1Y1W H;  1WD1 A;  1U4M A;  2IT1 A;  1TU2 B;  4A3K H;  1QIL A;  3H94 A;  3STB C;  3X3N A;  1J6Q A;  2AQ3 B;  2K1B A;  4OIJ A;  2IY5 B;  5CMD A;  4X64 L;  4DNI A;  4OO1 G;  4L8J A;  1PHJ A;  3GTG H;  3CP0 A;  3H6M A;  4H02 A;  3NQI A;  2Z4I A;  4QUC A;  2AMC B;  1IL8 A;  3WOF A;  1V43 A;  4KV6 A;  1Q1B A;  5A2Q L;  4YWK A;  3KK7 A;  3PUV A;  4V0B A;  3G71 A;  1VDZ A;  2PMZ E;  4CDD C;  4LF8 L;  4P73 A;  5KRU A;  2L11 A;  1JOQ A;  3CQZ B;  4JI3 L;  2AQ1 B;  4POG A;  1F9R A;  1WCM H;  1ZXT A;  3E9I A;  1SN8 A;  1NCV A;  5C6A A;  1JT8 A;  3M4O H;  4LMQ D;  3K5L A;  1AE3 A;  4A3I B;  1FNU A;  5LHY 1;  4GN5 A;  1ESF A;  3K7A B;  1CZW A;  1D6E C;  4KJN A;  3I90 A;  3CC2 A;  5C0X I;  4XIG S;  1HNW Q;  4EVO A;  4JI2 L;  3J81 c;  3FEW X;  1CKN B;  3DHQ A;  1S5E D;  3R2T A;  2KEC A;  3K0X A;  3MXU A;  4MTN A;  4KN4 C;  1H9K A;  1VQL A;  4A3B H;  3SK4 A;  3J7Z C;  1K0R A;  2Y0S B;  1M8A A;  1K83 B;  3NPP A;  1BCP F;  5FK9 C;  4A3C G;  2VY3 A;  2G9D A;  3QJY A;  3W5O A;  2EOT A;  1YEZ A;  2JA5 G;  1E2V A;  4UPA A;  3MEH A;  4A93 G;  3PO3 H;  5AFW A;  5C5L A;  4QCL A;  2SOB A;  4C3I H;  2CW0 D;  1TWA H;  2PZT A;  2NVQ H;  3RD4 A;  1WI5 A;  1M1K C;  3CC7 A;  1HR0 L;  4BXX G;  2WII B;  3QR8 A;  1JOO A;  4O0A A;  5HGQ A;  2PYK A;  2XRS D;  2R61 A;  3J81 L;  2BA1 A;  4H13 C;  1CI3 M;  3UDI A;  3UE0 A;  2A69 C;  1VMP A;  1D7Q A;  4ZLT F;  1II3 A;  2IW3 A;  3JC6 6;  5K36 H;  3W2D A;  4HAE A;  4QJF A;  5EPL A;  1X9N A;  2Z0S A;  2K03 A;  3R3O A;  1YBY A;  4OWW B;  2DUD A;  3I91 A;  2E5L Q;  2Y0S E;  2OQ0 A;  3I56 A;  1LV9 A;  4C3J H;  3FP9 A;  2BH8 A;  3MFG A;  2ALY B;  2AUJ D;  2JE6 I;  2NWG A;  4JG2 A;  2X6G A;  5BN5 A;  3C1E A;  4M8A A;  1KXL A;  3G48 A;  2KCC A;  1VQ6 A;  1IYU A;  5M3F H;  1PFB A;  4IPD A;  4A3M G;  4RAU C;  4B3S L;  2K50 A;  2K33 A;  4DV0 Q;  3FPU B;  1G6Z A;  2EDG A;  3DUZ A;  5I9O A;  3CAM A;  4UP7 A;  4RGN A;  1JJG A;  3V96 A;  1LTS D;  2A6H D;  1NR4 A;  1YNJ D;  4J8Q A;  2JSO A;  2I07 B;  3J7A F;  2E2I H;  1GD7 A;  4DV4 Q;  3SR1 A;  3HS0 C;  1VQE A;  2OEO A;  2KCN A;  1IXR A;  1DOK A;  1I6H H;  1ROD A;  5HGT A;  1CM9 A;  1SEB D;  4G4K A;  4GNX C;  1YJN A;  4G57 A;  1UNS A;  1S4Z A;  1EEF D;  2R93 B;  2SNS A;  1QVF A;  4Q0F A;  1BBX C;  4LK1 C;  3VYR A;  1STB A;  3SGI A;  4C1N I;  1SJH D;  3QOJ A;  2Z9H A;  1E3P A;  5CV9 A;  3PQI A;  4R4C A;  4NDX A;  4BY1 H;  3KJP A;  1KRS A;  4R4Q A;  5EKL A;  2Z6K C;  1QWY A;  4YCW A;  1LO5 D;  2WP8 J;  3TP6 A;  2ZTC A;  4IPC A;  1H9J A;  2R92 B;  2NZH A;  3RR5 A;  3VA7 A;  3PIP 3;  2VUM B;  3T1Y L;  1SSO A;  5ELF A;  1HZ9 A;  4K14 A;  2D2C C;  3H0G B;  1EQQ A;  2G9H D;  4A3E B;  2YU9 H;  2PQA B;  5JPN C;  2HIV A;  4DAV A;  1HNX L;  4DK0 A;  3K5O A;  1LLR D;  4XQN A;  2B63 B;  3NP8 A;  2V1C C;  3A55 A;  2N49 A;  4IUT A;  3U50 C;  3MA2 B;  1EOV A;  5BN3 A;  1BBU A;  1JR0 D;  4ZKC B;  4B08 A;  2WAQ E;  4RGM A;  1STH A;  1FVI A;  4KHZ A;  4DUZ Q;  4RG1 A;  1PFS A;  4RWS C;  2OWO A;  4BA2 I;  5JVH 3;  1VQF A;  3J80 E;  3Q8D A;  3K7U C;  1F9S A;  5J39 A;  4U68 A;  3OOC A;  1BQQ T;  1G8Z D;  1V1P A;  1KLG D;  3M3Y H;  4B3M L;  1SXT A;  1YHB A;  2EYL A;  3S1Q H;  2JA6 G;  2UUC Q;  2PPB C;  1VQO A;  1SE8 A;  1SMY C;  1K9M C;  3GTL H;  5M5X B;  4AYB B;  1B50 A;  1D5M C;  4AIM A;  1C8C A;  3A8J E;  2JA5 H;  4A93 H;  1EQV A;  2BE5 D;  2ZJP A;  4KD3 A;  2A19 A;  2HCC A;  2K5V A;  1X3Q A;  1Z6H A;  1STG A;  2DNE A;  1E24 A;  4CKB A;  4BXX H;  2Q2T A;  4B3R L;  2I0Q A;  2F03 A;  4JK1 C;  1QZH A;  1K8A C;  3Q24 A;  3JAM i;  1A0I A;  5KEE A;  1GM5 A;  2XWB B;  1K28 A;  4DFA A;  3K80 C;  3MEF A;  5C44 G;  1GKH A;  2RDF A;  4LF6 L;  3CD6 A;  3W1G A;  1SNC A;  4DV1 L;  1A3V A;  1XTC D;  1OXX K;  2K52 A;  4LFB Q;  5C3E G;  3BDL A;  3FKI G;  3GTK H;  4JI5 Q;  3L7Z C;  3Q6S A;  3VYU A;  4IFD G;  4HJ5 A;  1EL0 A;  1Y1V B;  2NN6 I;  4A3F B;  4G7Z C;  3L2P A;  5JAV A;  2NUC A;  2NYZ D;  3N6R A;  3TEH B;  1QUQ A;  3S17 H;  5M5W B;  3NEN A;  4I7Z C;  1BXT A;  2F0W A;  1SYF A;  1KTK A;  1N8R C;  1I3Q H;  2K5H A;  4KKT A;  5DLQ E;  4A3G H;  2E2J H;  3K6O A;  1E2Z A;  3HRZ C;  4X3K A;  4HCS A;  2EVB A;  1E1T A;  1CHQ D;  4DK6 C;  4KTA A;  1LAC A;  1BF4 A;  4HR7 B;  3I4M H;  2E75 C;  3I4N G;  4GOP A;  2PI2 A;  4K2L A;  1V9P A;  1EYC A;  5DNF A;  3HOY H;  4NXM L;  4FF1 A;  2UXD Q;  1X3P A;  5EPK A;  4LFC Q;  1PZJ D;  4H7B A;  5IYD H;  1ICW A;  2HUG A;  1WFQ A;  3K0Y A;  1ICF B;  5D3D A;  2F3I A;  4R1J A;  4DV3 Q;  4KKU A;  2RA4 A;  3OPO A;  3KBX A;  1PTO B;  3I8Z A;  2JA8 G;  3FRP B;  1GJX A;  4JI0 Q;  3HOZ B;  1ZKO A;  2MO1 A;  1H95 A;  1HHV A;  2F0K A;  4HTH A;  1NTG A;  2TSS A;  4TRD A;  3OMC A;  1CA6 A;  1SRO A;  4KY6 A;  2PZW A;  4P2C B;  3D4W A;  1U4P A;  5JVG 3;  4BWG B;  4HJ7 A;  3BYT B;  3SE0 A;  3VR4 A;  3RNU A;  3DEO A;  1O80 A;  3G7L A;  2L12 A;  1Y8O B;  3M4Y A;  4QY7 A;  4DR7 Q;  3I4L A;  3V2T A;  1NY4 A;  1A15 A;  1XJV A;  1BCP C;  2LKV A;  2QDB A;  3ULP A;  1Y69 U;  4FO2 A;  4HSV A;  2KEE A;  4XQJ A;  1HTP A;  3RLO A;  1SBB B;  1PRT D;  2QDL A;  1TS4 A;  2IX3 A;  2EYP A;  1VQN A;  3TP8 A;  4KK7 A;  1CKO A;  5C4X G;  1G29 1;  2H4O A;  3T53 B;  3EQL C;  2A73 B;  1PH3 A;  4CGY B;  2JN4 A;  3ERS X;  3GTJ B;  2JA9 A;  1MD2 D;  2ENB A;  4APV A;  5H1S E;  4A3M B;  4X62 Q;  1MSG A;  1Y8N B;  4R8I A;  1SE2 A;  1Q82 C;  4H44 C;  2KJX A;  5C4Z A;  5FLM H;  1EFW A;  4DR2 Q;  1RF2 D;  1QJO A;  5EJW A;  1AE2 A;  3I55 A;  1P8L A;  1Y1W G;  1B7Y B;  3KJO A;  1Q90 A;  4A3K G;  4TQU S;  3R8B A;  3RLF A;  2HHH Q;  4DA2 A;  1VF7 A;  2CWA A;  1YHA A;  2O5I C;  2LY7 A;  3HOW H;  4KY5 A;  1KC8 C;  5HUR A;  3TME A;  4OO1 I;  4M1U B;  5CBA E;  3F2B A;  2DNC A;  1L1O C;  3L0O A;  2B2U C;  2IL8 A;  2MPM A;  4PV1 C;  3GTP H;  3E5S A;  1TXY A;  5CV4 A;  3PIO 3;  2E74 C;  5IYB G;  1LTR D;  3M85 A;  3G4S A;  3GP7 A;  4BBS H;  4QGU A;  4F8M A;  2GVB A;  4ZQ3 A;  1HZC A;  3BDO A;  1MBY A;  1KAB A;  5FLX c;  1N34 Q;  2SEB D;  5I6Y A;  1Z47 A;  3A7L A;  5KIX A;  1XMQ Q;  3H15 A;  1HTL D;  4Y52 H;  3T1H L;  2DGY A;  5KYL A;  4XYQ A;  3I70 A;  3LWU A;  2KQ3 A;  5C44 H;  5G3L D;  2XTI A;  5JEA H;  3E0J A;  1U9R A;  4L5S A;  3KF6 B;  1FNV A;  1MSH A;  1EZ8 A;  1WTR A;  4QL5 A;  2BOS A;  3B6Y A;  3K58 A;  3Q22 A;  2LSS A;  4WJW A;  1N33 Q;  1LTL A;  1QCB D;  1HNW L;  4WRD A;  3S1R H;  1YIT A;  4A4I A;  3VR5 A;  2K5N A;  2O4X A;  3SK8 A;  4B9W A;  1VQC A;  3PO3 G;  4IUQ A;  1ENC A;  1VQ4 A;  1I4X A;  2VS1 A;  2K04 A;  4C3I G;  2MGS A;  1R9T B;  3BVZ A;  1QOH A;  3I7F A;  2F0O A;  4ZKB B;  1SYE A;  2KVM A;  5FLX L;  1W3S A;  3G6E A;  5I2Y A;  5CV7 A;  3CCQ A;  4DKA C;  4HID A;  1RJT A;  4O42 A;  2BCO A;  4DV6 Q;  4IO9 A;  1FGB D;  3S14 B;  3DM3 A;  1ASZ A;  4XTC S;  2XNA C;  1DYQ A;  4YY3 Q;  1RD9 D;  2Z8L A;  4MTK A;  1VQJ A;  3URY A;  2JA7 B;  5FO8 B;  5K36 G;  4ZYS A;  1YZ6 A;  1RDP D;  4GN4 B;  2IHF A;  3GTM H;  1GXD C;  1Y8P B;  3D8G A;  4XQQ A;  5M3M B;  2F0D A;  1XTD A;  3NTK A;  3NBI A;  5FKA C;  4ABN A;  5C4J H;  5EQ0 A;  4IJH A;  3GV3 A;  4U67 3;  4C3H H;  4IPH A;  1I4P A;  2FIN B;  3RZD B;  2OTJ A;  1X56 A;  2EPB A;  4FP5 D;  3J80 i;  1CUK A;  4DK3 C;  5IP7 H;  1XNQ Q;  4RMF A;  1LT4 D;  1S5D D;  4NW2 A;  2E5L L;  4ZUJ A;  4A3J B;  2ZT9 C;  4LF4 Q;  4ODG A;  1JOR A;  1DXM A;  1I5F A;  2K32 A;  5CV5 A;  4NXN Q;  5TSS A;  1G2S A;  2JXM B;  2RKS A;  1LAB A;  1SDF A;  2B2T A;  1JB7 A;  5DM6 3;  1SFO B;  4DPG A;  1IKM A;  2Q8I B;  4GKK L;  2EY5 A;  4HIO A;  3S2D B;  3S1N B;  3KLS X;  4X66 Q;  5ELN A;  1Q8K A;  1OXT A;  4DNT B;  5IWA L;  5C3E B;  1FJG Q;  1AP0 A;  4R8N A;  3ERQ A;  3FKI B;  1WTH A;  3OWE B;  4DV0 L;  2R7F A;  2Q8R E;  4ID6 A;  2KA7 A;  4I7A A;  1AFP A;  2VB3 X;  3MAQ A;  3MXN A;  4ZAI A;  3SK6 A;  4DR1 Q;  2AWO A;  4PMC A;  2VZA A;  5D3I B;  2L9H A;  3KF8 B;  5GQO A;  3PUY A;  4GNX B;  1H9S B;  3CRL C;  3D31 A;  3W1B A;  4DV4 L;  3AB9 A;  1I4G A;  3K59 A;  3JAM c;  5G3L F;  1Q8I A;  5M5Y B;  1I94 Q;  2D9U A;  2A68 D;  4DR6 Q;  1K83 H;  1KRT A;  4BY1 G;  2MNA A;  1N9W A;  3I4N B;  2CKZ B;  1RCV D;  1EEI D;  4P74 A;  1E0B A;  4JI7 Q;  1HQM C;  3PIP A;  1Q46 A;  5EGT A;  1WTP A;  2EIF A;  4X65 Q;  1E2W A;  4J1M A;  2ATW A;  5ELE A;  3J7A V;  5EAY A;  4DGZ A;  1TKW B;  2IHE A;  1W2B A;  4FF3 A;  5CC4 A;  4ZK9 B;  3PF5 A;  1EWI A;  3TP5 A;  5IT9 c;  5KGU A;  1V1O A;  3FMC A;  2B2Y C;  5C3X A;  1G51 A;  1G91 A;  3A8I E;  1TWF B;  2JA8 B;  4IFD J;  2MP1 A;  4NKL A;  1J5E Q;  1E7Z A;  1PMR A;  3RZO H;  1B4O A;  1U4L A;  1V8Q A;  2K7V A;  5IYB H;  3QB3 A;  4RKB A;  1GUW A;  1H9R A;  1KL9 A;  1JB3 A;  3ER0 A;  5IOC A;  1PLF A;  3JAM L;  1IW7 D;  3RLN A;  5GAG C;  2PQA A;  2ZM6 L;  4K8I A;  4HJ8 A;  1QNU A;  4EQ5 A;  1SE4 A;  4JCV E;  1P16 A;  2OF1 A;  2F0H A;  3SEB A;  1SRU A;  2NVX B;  3BZD B;  1IYJ B;  4DXF A;  1X55 A;  2YYZ A;  4QIW B;  3PO2 G;  5CV6 A;  3OIQ A;  5IT9 L;  1STA A;  1PFN A;  1KD1 C;  1IBK Q;  4DUZ L;  4GLV B;  2VQE L;  3PF4 A;  3DWP A;  1TWG H;  4L63 B;  5CBE E;  4LF7 Q;  5JJZ A;  4N9T A;  3H3V H;  1CFM A;  3ICE A;  4PG3 A;  4L6T B;  4KLK A;  1JOK A;  2RDH A;  4R4T A;  4JV5 Q;  5C5M A;  4E6I A;  2PW7 A;  3M7N A;  1KIX A;  5ELD A;  4DV7 Q;  2IX0 A;  1HXY D;  1LT5 D;  4YHH Q;  1N36 Q;  4HMI A;  4QB4 A;  4N8X 1;  3GTG B;  2WKD A;  3KFU A;  4EQO A;  2N55 A;  1PTO D;  2R93 H;  3IAY A;  1SMX A;  4DV5 Q;  2PZU A;  3UE1 A;  4LJZ C;  4JI1 Q;  1MIU A;  3SDZ A;  3MTS A;  2EY1 A;  1ZEQ X;  3H91 A;  4QIW E;  3PV0 A;  4RKL A;  3HOX G;  5LMN Q;  4B3T Q;  3ULJ A;  1WCM B;  2UXB Q;  3EA6 A;  4EQP A;  1A3T A;  1OXV A;  1NMG A;  1EQR A;  4IFD I;  4ZUI A;  3M4O B;  1SNM A;  1ET6 A;  2IJ0 A;  5I6W A;  1TWC B;  2R92 H;  4GKJ Q;  4A3G G;  4JI5 L;  1TS5 A;  2A6E C;  3PCO B;  3K5M A;  3HOU B;  2AKW B;  2WAC A;  4HIK A;  1ENA A;  1PYW D;  1TR5 A;  2XGT A;  1TT2 A;  1B8A A;  1KDB A;  3TQY A;  4A3B B;  3H0G H;  3I4M G;  2B2W C;  4CJ2 C;  4UP8 A;  2UUA L;  4GLX A;  3HOY G;  1KLU D;  3S16 H;  1Q1E A;  4OWX B;  3K5N A;  2K14 A;  1VQ8 A;  4KD4 A;  5KNB A;  2KCM A;  3U58 A;  5IYD G;  4R9W A;  4OHJ A;  3PO3 B;  3OMG A;  5E4W C;  3BVG A;  2KUM A;  4PZ7 A;  2RCN A;  1E1O A;  4RH6 A;  1NJI C;  1TWA B;  2NVQ B;  5I4D A;  2ZJR A;  1LTA D;  4K6L A;  1T5E A;  4UAI A;  1CA5 A;  4LFC L;  4KY7 A;  2EYF A;  1A6X A;  2N88 A;  1NNX A;  1Z7T A;  3SVM A;  1U5K A;  3O13 A;  1B3A A;  1VQA A;  4FNF A;  4DV3 L;  3STB D;  2RHQ B;  4HIM A;  1EUJ A;  4OWT B;  1IKL A;  5KNC A;  4JI0 L;  4F7X A;  1VF5 C;  1X65 A;  3VR2 A;  5I2X A;  1XWE A;  2L5T A;  3F2D A;  1ILQ A;  2EY2 A;  1CT1 D;  1WTO A;  2Z4H A;  1CTM A;  2EYM A;  3PSI A;  1LTB D;  1VQM A;  4C3J B;  2RSO A;  2YTY A;  1GOZ A;  1STE A;  2WB1 G;  1BCP B;  3CPF A;  1QE6 A;  4DR7 L;  2X6L A;  1TII D;  1Y14 B;  3CCM A;  2GA4 B;  1QVG A;  3MXG A;  1LM0 A;  2M00 A;  2A1A A;  4JVZ A;  4BS9 A;  2F0Q A;  5M3F B;  2VQF Q;  1HNZ Q;  2K5Q A;  2K6A A;  3WWV A;  2Q2H A;  1CSP A;  3HKZ B;  4KMU C;  3DMU A;  2ICE C;  5FLM G;  4A3D G;  4IUR A;  1EY4 A;  1HZB A;  1PV4 A;  2MJ8 A;  4BY7 B;  3CXC A;  2L4N A;  1ASY A;  1I6V C;  1N32 L;  5L37 A;  2F52 A;  1Y1V H;  2D5D A;  4X3U A;  4GN3 B;  4C2M B;  2E2I B;  3PO2 H;  1UAP A;  2EJM A;  3OTO Q;  3HOW G;  4RA8 A;  3AQQ A;  1I6H B;  3BVM A;  4S3S A;  2SNM A;  2K28 A;  1B2T A;  1HFN A;  5M5W H;  1M4V A;  2WIN B;  1QB5 D;  4OEL B;  3PIO A;  2R6G A;  4JPB W;  4CKC A;  3UI2 A;  4A3L G;  1X32 A;  1B44 D;  3J80 c;  2QF7 A;  4JOI C;  4YIJ A;  1O7L A;  3SK5 A;  2JYO A;  3NUC A;  5F2D A;  1I4H A;  1L1O B;  5FJ8 H;  2NZ1 D;  2C35 B;  2QA4 A;  5IP9 H;  2ZTE A;  2BH2 A;  1JE5 A;  1I50 H;  1CQV A;  2F0T A;  2PQE A;  3PUZ A;  4BBS G;  4LNQ A;  4BY1 B;  5J1Z A;  1Q12 A;  1BR9 A;  2XVS A;  1HR0 Q;  3LX0 A;  2A69 D;  3GQB A;  2F0L A;  2WKC A;  3HKZ E;  5FO9 B;  5E7N A;  1K0S A;  2CH4 A;  1NUC A;  4TKO B;  1DZ1 A;  1TWH B;  1PA6 A;  1K8O A;  1EIG A;  5JEA G;  3GTO B;  3T56 B;  1PTO H;  2NVT H;  1N34 L;  1WTX A;  3CMA A;  2YV5 A;  1NSN S;  3DXJ C;  2YU9 B;  3HOX H;  4DR4 Q;  1TY0 A;  5ELB A;  2E2D C;  1LYL A;  3J80 L;  2XWJ B;  4N9P A;  4AYB E;  4Y7N H;  1N33 L;  4YWL A;  1DCZ A;  4I65 A;  1R4Q B;  2F0S A;  4GS3 A;  4H0L C;  1RTO A;  2K75 A;  1BOS A;  3WOE A;  1EQT A;  1R4P B;  1CHP D;  4BBR G;  5ISR A;  3EN2 A;  1C0A A;  3HP3 A;  3M3Y B;  2IWH A;  3S1Q B;  3E9H A;  2E2H H;  2K01 A;  3H3V C;  4FDB A;  1V1Q A;  2FMM A;  3DWA A;  2SDF A;  1SYC A;  3GTJ H;  3GTL B;  1MJC A;  3HZX A;  1WTV A;  2NZO A;  4DV6 L;  2JA5 B;  4WJ4 A;  1ESR A;  3CHB D;  4A93 B;  3KUP A;  4R4I A;  1PZI D;  4WOR A;  2FMC A;  2Q2U A;  1OXS C;  4C3H G;  3DWQ A;  1J9O A;  4NPS A;  3NEL A;  1ZYR C;  2PCF B;  1T5X D;  3BU2 A;  1BVS A;  1LTG D;  3AFP A;  4NB3 A;  5IP7 G;  4JI6 L;  3S15 H;  1GHK A;  2PO4 A;  2AHO B;  2C9O A;  1TVX A;  4JC0 A;  5GAD C;  2HQL A;  4MNO A;  3UDX A;  1DON A;  3QO2 A;  3QWN A;  1XNQ L;  4XT1 B;  5LMU Q;  3CCV A;  1NAP A;  2R7Z H;  5GAH C;  5E1F A;  4LF4 L;  1EU4 A;  3U4Z A;  1LT3 D;  1RKN A;  3GTK B;  1PVO A;  4MIU A;  1DOL A;  3EJI A;  1EY7 A;  2F0E A;  3T1Y Q;  3RN5 A;  1EIH A;  5EKI A;  3F1Z A;  4A3I G;  1A62 A;  4X66 L;  1VQD A;  4AH6 A;  3S17 B;  3D4D A;  1S5B D;  1Z9F A;  2HIX A;  5AJ3 Q;  2F0I A;  5HY6 A;  4F88 A;  1PH4 A;  2E2J B;  2JEB I;  1J8I A;  3CCR A;  1PYB A;  4JI8 Q;  3K57 A;  4K6D A;  1B9N A;  4LAA A;  3KF8 A;  4DR1 L;  2EYO A;  2Y0S G;  3L3O C;  4GNX A;  4A3D H;  2NTS A;  3I4M B;  2KBN A;  1U0L A;  1JJ2 A;  4NP5 A;  1OXU A;  3HOY B;  3KDF A;  1E22 A;  3CCE A;  4IN3 A;  3SHL A;  1IBM Q;  1UWV A;  1HH2 P;  2RCF A;  1I94 L;  1SMY D;  4DR6 L;  3VR3 A;  5IGF A;  4RCO A;  5C0X H;  1R9T H;  1JE4 A;  3NTI A;  2EY6 A;  3IFT A;  3TN2 A;  1V1P B;  4JI7 L;  1K3B C;  2RVL A;  3TS0 A;  2AUK A;  2D0P A;  4A3L H;  1PDQ A;  2Z6K A;  1GHJ A;  2LXK A;  1S5C D;  1O7I A;  2A74 C;  3A0J A;  4DNR B;  3BJU A;  3P1H A;  4FVM A;  2KHJ A;  1UE6 A;  2CQO A;  4ILW A;  1EU3 A;  3MZ5 A;  3A5Z B;  2FXQ A;  2R3Z A;  4IAL A;  4FF4 A;  2LMC B;  1D5X C;  3GO5 A;  1J5E L;  1M90 C;  4B3R Q;  5NUC A;  2F4V Q;  1VQH A;  3DLL A;  1VQ5 A;  3P75 A;  5M3M H;  2A8V A;  4XDX A;  1VS0 A;  1YI2 A;  2ID0 A;  1D5Z C;  4C56 C;  1IL2 A;  1GVP A;  1O7Y A;  1W6K A;  2UUB Q;  3F2C A;  3HOV H;  4G7O C;  1U4R A;  1CKN A;  2RHS B;  2WV6 D;  1MKH A;  2JP1 A;  4A3J H;  3FHW A;  4HJA A;  3ERO A;  2TMP A;  3MVV A;  5IE8 A;  1HUM A;  5LMN W;  4DV2 Q;  3S2H B;  3S1N H;  2P5Z X;  2E76 C;  2PNR C;  1A8V A;  3D0F A;  1XPO A;  1JQY D;  5GAE C;  4K2K A;  4LF7 L;  2OCE A;  3ZYY X;  5JPM C;  3EIV A;  2F0P A;  4F87 A;  1EWC A;  1QUQ B;  2V4D A;  4BBR H;  1EYG A;  4JV5 L;  1K3R A;  2MFI A;  5E4X A;  5EBD A;  1PRT F;  4FF2 A;  2JA6 B;  2CH4 W;  3BZC A;  1EWH A;  3AYH B;  4A75 A;  1HUN A;  3NWT A;  3J81 j;  1A2U A; 
#chains in the Genus database with same CATH homology
 2EJG C;  2CW0 C;  3LNN A;  1XX8 A;  3GTP B;  1YNN D;  1AZQ A;  3T16 A;  2PW5 A;  3P20 A;  2JEA I;  2AQ2 B;  3GD7 A;  2CQA A;  4RFB A;  3NHH A;  1I4Q A;  4QF4 A;  2RQX A;  1TY2 A;  3HG9 A;  5C44 B;  3OIP A;  5KND A;  3BS1 A;  3A7A B;  3CRK C;  4OIK A;  1BCP D;  1OO9 B;  4V19 0;  3C3L A;  3S1R B;  3MXP A;  3S1M B;  5COY A;  2H1E A;  3NSW A;  1SE3 A;  4G7H C;  5I9P A;  3E6Z X;  3T51 B;  3VA5 A;  5IGD A;  4EQN A;  5KYI A;  1AW7 A;  1B9M A;  2QKI C;  3I73 A;  2M2L A;  2A6H C;  1SNQ A;  1GUS A;  1YNJ C;  5IGC A;  3C2P A;  2AWN A;  1G2T A;  1F2Y A;  2B8F A;  5JEA J;  2L55 A;  3T4A C;  3GTQ B;  2FJ2 A;  2B8G A;  5T1G A;  3M7G A;  3T13 A;  5C4J B;  4DU9 A;  1D1K A;  1EY6 A;  1JWU D;  5J22 A;  1SND A;  1RHP A;  3BDC A;  1CK1 A;  5JOB A;  2NBF A;  2EYJ A;  5M9O A;  3MC0 B;  1H9M A;  3D6W A;  3VYS A;  4IQZ A;  3R2I A;  1XYI A;  5IIF A;  1A2T A;  2BA0 A;  3KBG A;  4WFN 3;  1O78 A;  3J81 E;  4OL7 A;  4FYD A;  2EZV A;  1PRT B;  4Q5V A;  5C4X B;  3A56 A;  3OWF A;  3A8K E;  3TZD A;  4B9X A;  1JWM D;  1F2Z A;  1IYV A;  3BG3 A;  3Q23 A;  1JIC A;  5FO7 B;  5EKK A;  2B2V A;  5COR A;  1TS2 A;  3IFD A;  1Y1W B;  3S9W A;  4OGQ C;  2NN6 H;  4A3K B;  1DD2 A;  1F77 A;  2B2U A;  1HA6 A;  3NWS A;  5K5P A;  3DM1 A;  3U9S A;  2NB0 A;  2QIL A;  2B39 A;  2F0G A;  2DN8 A;  2BE5 C;  1BO0 A;  4IUV A;  4RHS A;  1KDC A;  3RZO B;  1TQO A;  3HEJ A;  1CQF A;  3TP7 A;  2Q8T A;  1EFI D;  4MN3 A;  4PMW A;  1IHZ A;  2KED A;  1MI2 A;  2EYH A;  2HDL A;  2BDN A;  3FDT A;  1F9P A;  1FD7 D;  5IGB A;  5FOB B;  1EZ6 A;  2XSC A;  4QUF A;  3MWY W;  1WD0 A;  3HGB A;  1AZP A;  1KNE A;  5C4H A;  2KOL A;  3BYY B;  1BUV T;  4KJO A;  1D2B A;  1TWG B;  2EXZ A;  2DY7 A;  4J6H A;  2ZXP A;  1STN A;  4C3I B;  5T1I A;  5IGG A;  3L9A X;  2XRQ D;  3QIA A;  1S5F D;  3OSO A;  4X3T A;  1WTW A;  1BNZ A;  3V05 A;  1XXG A;  4TSS A;  3C1F A;  1SYB A;  2F0V A;  3FVQ A;  3OW7 A;  2IX1 A;  1GUN A;  2WAQ B;  3GV6 A;  3D6C A;  3D4R A;  1HPC A;  1LT6 D;  1EY9 A;  2NTT A;  1C4Q A;  1SAP A;  5C3W A;  1LTT D;  2A5H A;  1AEX A;  4HN7 A;  3F2U A;  3C46 A;  2CVR A;  2J7Z A;  3RMH A;  1AN8 A;  4OO1 H;  1DM0 B;  3ND9 A;  1CZG A;  5DEH A;  3PUX A;  1QNK A;  1PTO F;  1O7Z A;  4MHE A;  3Q0A A;  3ONA B;  3TZU A;  3NXW A;  1TS3 A;  1PRT C;  1K8M A;  2RDG A;  3S16 B;  4HMJ A;  2F3V A;  1MGS A;  2KHS A;  5D65 A;  2QCP X;  1GUO A;  2EJF C;  5C0X G;  1F2L A;  4FXG C;  5CGK A;  2M9V A;  3AMU A;  2F4I A;  5IOD A;  2L0C A;  3PMF A;  4GZY C;  4FXK C;  4PMB A;  4Z9C B;  3IKJ A;  1EY8 A;  2B2Y A;  3ITP A;  1RTN A;  3LWE A;  2RBM A;  4ME5 A;  4K5W A;  1D1I A;  1NR2 A;  3TBI B;  2K5D A;  5EPJ A;  3I3C A;  3W3A A;  1EY0 A;  3NE5 B;  1JCK B;  2FHT A;  1EOT A;  3EFX D;  4RCN A;  3EVQ A;  1EY5 A;  2X69 A;  2A6E D;  3VR6 A;  1HA5 A;  2F3W A;  3PUW A;  1L0Y B;  2CHB D;  4O1N A;  5BN4 A;  3KLS A;  2B2T C;  1ILP A;  3MFY A;  4HSP A;  4CBV A;  2RSN A;  4UDU C;  3PO2 B;  1Q3L A;  3QOL A;  2VXW A;  2FFK B;  4HCE A;  4IUP A;  4ULL A;  4PNY A;  3D3R A;  5EBC A;  2HQE A;  3NTH A;  3TDQ A;  1KDA A;  4QMG A;  1EYD A;  4KHV A;  1I50 B;  3QG1 A;  3AU7 A;  4KN7 C;  1KNA A;  3IL8 A;  2HDM A;  2LFN A;  4DAP A;  3CU7 A;  4CJ1 B;  1JC7 A;  1UEA B;  1YNN C;  3N52 A;  2NVT B;  3P7J A;  2HCI A;  2XIW A;  1EYA A;  1B1Z A;  5A35 A;  4K5X A;  4X3S A;  3NQT A;  3HOX B;  2VB2 X;  1C48 A;  4BA1 I;  3MHB A;  1HFG A;  3RUZ A;  2QEJ C;  2F0N A;  2J0T D;  1FYC A;  4Y7N B;  5DM7 3;  4RGT A;  5CYU A;  3H09 A;  2ICI A;  4K5V A;  2O2L D;  3SXH A;  1I3Q B;  1SNO A;  2B2W A;  4A3G B;  1L0X B;  4IUU A;  1KAA A;  2I46 A;  4ZRZ A;  1H9S A;  3KLR A;  2MHV A;  2E2H B;  1JWS D;  3R93 A;  2BDO A;  1WTQ A;  1DJR D;  2K05 A;  1ENF A;  4K8J A;  4DF7 A;  1HQR D;  1FR3 A;  4KI0 A;  2OT2 A;  4HED A;  1GUT A;  2MUY A;  2Z1C A;  2A68 C;  2K5W A;  2B2V C;  3S15 B;  2O5J C;  1FNW A;  4C1N K;  5FLX E;  3A54 A;  2C5C A;  1QG7 A;  5CR3 A;  2OXP A;  2R7Z B;  2ZXR A;  5ELC A;  3TSS A;  4DAY A;  4RGO S;  1WVL A;  1STY A;  2F0M A;  2F0U A;  4XT3 B;  1SYD A;  4XYO A;  3OHX C;  2WB1 B;  1F9Q A;  1IW7 C;  2VNU D;  1A3U A;  3U9O A;  4A3D B;  4CHT B;  3FPP A;  2NN6 G;  5IGE A;  4RHR A;  4IFD H;  2ZXO A;  3ND8 A;  2IPK D;  3HOW B;  5LL6 S;  1SYG A;  4JBW A;  1DOM A;  3X3M A;  2F0J A;  2L1B A;  3DEP A;  4XXE A;  1ZYR D;  1ML0 D;  2F1M A;  4IZ8 A;  4BBS B;  4CKE A;  1HRJ A;  2DY8 A;  4EGV A;  3WDN A;  5LL6 X;  1PXU A;  4DN4 M;  1PTO C;  4DK1 A;  4PQX A;  1BDO A;  2F0F A;  4C3J G;  5CV8 A;  1GUG A;  3HOV B;  1ONL A;  1F2M A;  1W6J A;  5D14 A;  3CKI B;  3NK9 A;  5C0X J;  2XN9 C;  3G6J B;  4IUN A;  5A2Q E;  1SNP A;  1I4R A;  1PZK D;  3J7Y W;  4FXD A;  2PMZ B;  1LTI D;  3JAM E;  1VMC A;  5DAU A;  4BBR B;  4CJ0 B;  1HCZ A;  1PFM A;  4NMZ A;  3I72 A;  4DXG A;  4KKS A;  1SJE D;  2D62 A;  1UUP A;  2EE1 A;  2LS0 1;  2J4X A;  3GTM B;  1B53 A;  2NVY B;  5E3F A;  1ET9 A;  5IT9 E;  1VCI A;  3VYT A;  3NBH A;  4C3H B;  1WD1 A;  1U4M A;  2IT1 A;  1TU2 B;  1QIL A;  3H94 A;  3X3N A;  2AQ3 B;  2K1B A;  4OIJ A;  5CMD A;  4OO1 G;  4L8J A;  3H6M A;  3NQI A;  2Z4I A;  4QUC A;  1IL8 A;  3WOF A;  1V43 A;  4KV6 A;  1Q1B A;  5A2Q L;  3KK7 A;  3PUV A;  4V0B A;  1VDZ A;  5KRU A;  2L11 A;  1JOQ A;  3CQZ B;  2AQ1 B;  1F9R A;  1ZXT A;  1NCV A;  5C6A A;  4LMQ D;  3K5L A;  4A3I B;  1FNU A;  5LHY 1;  1ESF A;  3K7A B;  1CZW A;  1D6E C;  4KJN A;  3I90 A;  5C0X I;  4XIG S;  4EVO A;  3FEW X;  3DHQ A;  1S5E D;  3R2T A;  2KEC A;  3MXU A;  4KN4 C;  1H9K A;  3SK4 A;  2Y0S B;  3NPP A;  1M8A A;  1K83 B;  1BCP F;  5FK9 C;  2G9D A;  3QJY A;  2EOT A;  1E2V A;  3MEH A;  5AFW A;  5C5L A;  4QCL A;  2SOB A;  2CW0 D;  2PZT A;  3RD4 A;  2WII B;  1JOO A;  2PYK A;  2XRS D;  2R61 A;  3J81 L;  2BA1 A;  4H13 C;  1CI3 M;  2A69 C;  1VMP A;  4ZLT F;  1II3 A;  2IW3 A;  5K36 H;  3W2D A;  4HAE A;  5EPL A;  2K03 A;  3R3O A;  3I91 A;  1LV9 A;  3MFG A;  2AUJ D;  2JE6 I;  2NWG A;  5BN5 A;  2X6G A;  3C1E A;  4M8A A;  2KCC A;  1IYU A;  1PFB A;  4RAU C;  2K33 A;  3FPU B;  1G6Z A;  2EDG A;  3DUZ A;  5I9O A;  4RGN A;  3V96 A;  1LTS D;  2A6H D;  1NR4 A;  1YNJ D;  4J8Q A;  2JSO A;  2I07 B;  3J7A F;  3SR1 A;  3HS0 C;  2OEO A;  2KCN A;  1DOK A;  1ROD A;  5HGT A;  1CM9 A;  1SEB D;  4G4K A;  4G57 A;  1UNS A;  1S4Z A;  1EEF D;  2R93 B;  2SNS A;  4Q0F A;  1BBX C;  4LK1 C;  3VYR A;  1STB A;  4C1N I;  1SJH D;  3QOJ A;  5CV9 A;  4NDX A;  5EKL A;  1QWY A;  1LO5 D;  2WP8 J;  3TP6 A;  1H9J A;  2R92 B;  3VA7 A;  3PIP 3;  2VUM B;  1SSO A;  5ELF A;  4K14 A;  2D2C C;  3H0G B;  2G9H D;  4A3E B;  5JPN C;  4DAV A;  4DK0 A;  3K5O A;  1LLR D;  4XQN A;  2B63 B;  3NP8 A;  3A55 A;  4IUT A;  3MA2 B;  5BN3 A;  1JR0 D;  4ZKC B;  4B08 A;  4RGM A;  1STH A;  4KHZ A;  4RWS C;  4BA2 I;  5JVH 3;  3J80 E;  5J39 A;  1F9S A;  4U68 A;  3OOC A;  1BQQ T;  1G8Z D;  1V1P A;  1KLG D;  1SXT A;  2EYL A;  2PPB C;  1SMY C;  5M5X B;  4AYB B;  1B50 A;  1D5M C;  1C8C A;  3A8J E;  1EQV A;  2BE5 D;  4KD3 A;  2HCC A;  1X3Q A;  1Z6H A;  1STG A;  2DNE A;  4CKB A;  2F03 A;  4JK1 C;  3Q24 A;  5KEE A;  2XWB B;  4DFA A;  2RDF A;  1SNC A;  1A3V A;  1XTC D;  1OXX K;  3BDL A;  3L7Z C;  3Q6S A;  3VYU A;  4IFD G;  1EL0 A;  1Y1V B;  2NN6 I;  4A3F B;  4G7Z C;  5JAV A;  2NUC A;  2NYZ D;  3N6R A;  5M5W B;  4I7Z C;  1BXT A;  2F0W A;  1SYF A;  1KTK A;  4KKT A;  3K6O A;  1E2Z A;  3HRZ C;  4X3K A;  4HCS A;  2EVB A;  1CHQ D;  4KTA A;  1LAC A;  1BF4 A;  4HR7 B;  2E75 C;  4K2L A;  5DNF A;  1EYC A;  4FF1 A;  1X3P A;  5EPK A;  1PZJ D;  4H7B A;  1ICW A;  2HUG A;  3K0Y A;  5D3D A;  4KKU A;  2RA4 A;  3KBX A;  3OPO A;  1PTO B;  3I8Z A;  3FRP B;  1GJX A;  3HOZ B;  1ZKO A;  1HHV A;  2F0K A;  4HTH A;  2TSS A;  4TRD A;  1CA6 A;  3OMC A;  4KY6 A;  2PZW A;  4P2C B;  3D4W A;  1U4P A;  5JVG 3;  4BWG B;  3BYT B;  3SE0 A;  3VR4 A;  3DEO A;  1O80 A;  3G7L A;  2L12 A;  1Y8O B;  3M4Y A;  3I4L A;  3V2T A;  1A15 A;  1BCP C;  2LKV A;  2QDB A;  1Y69 U;  4FO2 A;  4HSV A;  2KEE A;  4XQJ A;  1HTP A;  1SBB B;  1PRT D;  1TS4 A;  2IX3 A;  2EYP A;  3TP8 A;  4KK7 A;  1G29 1;  2H4O A;  3T53 B;  3EQL C;  2A73 B;  4CGY B;  3GTJ B;  1MD2 D;  2ENB A;  4A3M B;  1MSG A;  1Y8N B;  4R8I A;  1SE2 A;  4H44 C;  2KJX A;  5C4Z A;  1RF2 D;  1QJO A;  5EJW A;  1Q90 A;  4TQU S;  3R8B A;  3RLF A;  4DA2 A;  1VF7 A;  2O5I C;  2LY7 A;  4KY5 A;  5HUR A;  3TME A;  4OO1 I;  4M1U B;  5CBA E;  2DNC A;  2B2U C;  2IL8 A;  2MPM A;  4PV1 C;  3E5S A;  5CV4 A;  3PIO 3;  2E74 C;  1LTR D;  3M85 A;  3GP7 A;  4F8M A;  4ZQ3 A;  3BDO A;  1MBY A;  1KAB A;  2SEB D;  5I6Y A;  1Z47 A;  3A7L A;  5KIX A;  1HTL D;  5KYL A;  4XYQ A;  3I70 A;  3LWU A;  2KQ3 A;  5G3L D;  5JEA H;  3E0J A;  1U9R A;  1FNV A;  1MSH A;  1EZ8 A;  1WTR A;  2BOS A;  3K58 A;  3Q22 A;  4WJW A;  1QCB D;  4WRD A;  3VR5 A;  2O4X A;  3SK8 A;  4B9W A;  4IUQ A;  1ENC A;  1I4X A;  2K04 A;  4C3I G;  2MGS A;  1R9T B;  3BVZ A;  1QOH A;  2F0O A;  4ZKB B;  1SYE A;  2KVM A;  5FLX L;  5I2Y A;  5CV7 A;  1RJT A;  4O42 A;  2BCO A;  1FGB D;  3S14 B;  4XTC S;  2XNA C;  1DYQ A;  1RD9 D;  2Z8L A;  3URY A;  2JA7 B;  5FO8 B;  5K36 G;  4ZYS A;  1RDP D;  1GXD C;  1Y8P B;  3D8G A;  4XQQ A;  5M3M B;  2F0D A;  3NTK A;  3NBI A;  5FKA C;  4ABN A;  5EQ0 A;  3GV3 A;  4U67 3;  1I4P A;  2FIN B;  3RZD B;  2EPB A;  4FP5 D;  1LT4 D;  1S5D D;  4NW2 A;  4ZUJ A;  4A3J B;  2ZT9 C;  1JOR A;  4ODG A;  1DXM A;  2K32 A;  5CV5 A;  5TSS A;  1G2S A;  2JXM B;  2RKS A;  1LAB A;  1SDF A;  2B2T A;  5DM6 3;  1SFO B;  1IKM A;  2Q8I B;  2EY5 A;  3S2D B;  3S1N B;  3KLS X;  1OXT A;  4DNT B;  5C3E B;  1AP0 A;  4R8N A;  3ERQ A;  3FKI B;  3OWE B;  2Q8R E;  4ID6 A;  2KA7 A;  1AFP A;  2VB3 X;  3MAQ A;  3MXN A;  4ZAI A;  3SK6 A;  2AWO A;  4PMC A;  5D3I B;  2L9H A;  3PUY A;  1H9S B;  3CRL C;  3D31 A;  3AB9 A;  1I4G A;  3K59 A;  5G3L F;  1Q8I A;  5M5Y B;  2D9U A;  2A68 D;  3I4N B;  1RCV D;  1EEI D;  1E0B A;  1HQM C;  1WTP A;  5EGT A;  1E2W A;  4J1M A;  5ELE A;  3J7A V;  4DGZ A;  1TKW B;  4FF3 A;  5CC4 A;  4ZK9 B;  3TP5 A;  5KGU A;  1V1O A;  3FMC A;  2B2Y C;  5C3X A;  1G91 A;  3A8I E;  1TWF B;  2JA8 B;  4IFD J;  2MP1 A;  4NKL A;  1PMR A;  1B4O A;  1U4L A;  1V8Q A;  2K7V A;  3QB3 A;  4RKB A;  1GUW A;  1H9R A;  1JB3 A;  5IOC A;  1PLF A;  3JAM L;  1IW7 D;  4K8I A;  1QNU A;  1SE4 A;  2OF1 A;  2F0H A;  3SEB A;  2NVX B;  3BZD B;  4DXF A;  2YYZ A;  4QIW B;  5CV6 A;  3OIQ A;  5IT9 L;  1STA A;  1PFN A;  3DWP A;  4L63 B;  5CBE E;  5JJZ A;  4N9T A;  1CFM A;  4L6T B;  1JOK A;  2RDH A;  5C5M A;  4E6I A;  2PW7 A;  3M7N A;  5ELD A;  2IX0 A;  1HXY D;  1LT5 D;  4HMI A;  4QB4 A;  3GTG B;  2WKD A;  4EQO A;  2N55 A;  1PTO D;  3IAY A;  2PZU A;  4LJZ C;  3SDZ A;  3MTS A;  2EY1 A;  1ZEQ X;  3H91 A;  3PV0 A;  4RKL A;  1WCM B;  3EA6 A;  4EQP A;  1A3T A;  1OXV A;  4IFD I;  4ZUI A;  3M4O B;  1SNM A;  1ET6 A;  2IJ0 A;  5I6W A;  1TWC B;  1TS5 A;  2A6E C;  3K5M A;  3HOU B;  2WAC A;  1ENA A;  1PYW D;  1TR5 A;  1TT2 A;  1KDB A;  4A3B B;  2B2W C;  4CJ2 C;  1KLU D;  1Q1E A;  3K5N A;  4KD4 A;  5KNB A;  4R9W A;  4OHJ A;  3PO3 B;  3OMG A;  5E4W C;  3BVG A;  2KUM A;  4RH6 A;  1TWA B;  2NVQ B;  5I4D A;  1LTA D;  4K6L A;  1T5E A;  4UAI A;  1CA5 A;  4KY7 A;  2EYF A;  1A6X A;  2N88 A;  1Z7T A;  3SVM A;  3O13 A;  1B3A A;  4FNF A;  1IKL A;  5KNC A;  4F7X A;  1VF5 C;  3VR2 A;  5I2X A;  1XWE A;  2L5T A;  1ILQ A;  2EY2 A;  1CT1 D;  1WTO A;  2Z4H A;  1CTM A;  2EYM A;  1LTB D;  4C3J B;  2RSO A;  1GOZ A;  1STE A;  1BCP B;  1QE6 A;  2X6L A;  1TII D;  2GA4 B;  3MXG A;  2M00 A;  4BS9 A;  2F0Q A;  5M3F B;  2K5Q A;  2K6A A;  3HKZ B;  4KMU C;  3DMU A;  2ICE C;  4IUR A;  1EY4 A;  2MJ8 A;  4BY7 B;  2L4N A;  1I6V C;  2D5D A;  4X3U A;  4C2M B;  2E2I B;  1UAP A;  2EJM A;  4RA8 A;  1I6H B;  3BVM A;  4S3S A;  2SNM A;  2K28 A;  1B2T A;  1HFN A;  1M4V A;  2WIN B;  1QB5 D;  2R6G A;  4CKC A;  3UI2 A;  1X32 A;  1B44 D;  2QF7 A;  4YIJ A;  1O7L A;  3SK5 A;  5F2D A;  2JYO A;  3NUC A;  1I4H A;  2NZ1 D;  2PQE A;  1CQV A;  2F0T A;  3PUZ A;  4BY1 B;  5J1Z A;  1Q12 A;  1BR9 A;  2XVS A;  3LX0 A;  2A69 D;  3GQB A;  2F0L A;  2WKC A;  5FO9 B;  1NUC A;  4TKO B;  1DZ1 A;  1TWH B;  1K8O A;  1EIG A;  5JEA G;  3GTO B;  3T56 B;  1PTO H;  1WTX A;  1NSN S;  3DXJ C;  2YU9 B;  1TY0 A;  5ELB A;  2E2D C;  3J80 L;  2XWJ B;  4N9P A;  1DCZ A;  4I65 A;  1R4Q B;  2F0S A;  4H0L C;  1RTO A;  1BOS A;  3WOE A;  1EQT A;  1R4P B;  1CHP D;  5ISR A;  3HP3 A;  3M3Y B;  2IWH A;  3S1Q B;  2K01 A;  3H3V C;  2FMM A;  3DWA A;  2SDF A;  1SYC A;  3GTL B;  3HZX A;  1WTV A;  2JA5 B;  1ESR A;  3CHB D;  4A93 B;  3KUP A;  1PZI D;  4WOR A;  2FMC A;  1OXS C;  4C3H G;  3DWQ A;  1J9O A;  1ZYR C;  2PCF B;  1T5X D;  1LTG D;  1GHK A;  2PO4 A;  2C9O A;  1TVX A;  1DON A;  3QO2 A;  3QWN A;  4XT1 B;  1NAP A;  5E1F A;  1EU4 A;  1LT3 D;  1RKN A;  3GTK B;  4MIU A;  1DOL A;  3EJI A;  1EY7 A;  2F0E A;  1EIH A;  5EKI A;  3S17 B;  3D4D A;  1S5B D;  2F0I A;  4F88 A;  2E2J B;  2JEB I;  1J8I A;  3K57 A;  4K6D A;  1B9N A;  4LAA A;  3KF8 A;  2EYO A;  3L3O C;  2NTS A;  3I4M B;  4NP5 A;  1OXU A;  3HOY B;  4IN3 A;  3SHL A;  1SMY D;  3VR3 A;  5IGF A;  4RCO A;  5C0X H;  1JE4 A;  3NTI A;  2EY6 A;  3IFT A;  3TN2 A;  1V1P B;  2RVL A;  2AUK A;  1PDQ A;  1GHJ A;  1S5C D;  4DNR B;  2A74 C;  3P1H A;  4FVM A;  4ILW A;  1EU3 A;  3MZ5 A;  2R3Z A;  4IAL A;  4FF4 A;  2LMC B;  1D5X C;  3GO5 A;  5NUC A;  3P75 A;  4XDX A;  2ID0 A;  1D5Z C;  4C56 C;  1O7Y A;  1W6K A;  4G7O C;  1U4R A;  2WV6 D;  2JP1 A;  3ERO A;  2TMP A;  3MVV A;  1HUM A;  3S2H B;  2E76 C;  2PNR C;  1JQY D;  4K2K A;  3ZYY X;  5JPM C;  4F87 A;  2F0P A;  1EWC A;  2V4D A;  5E4X A;  5EBD A;  1PRT F;  4FF2 A;  2JA6 B;  1EWH A;  1HUN A;  3NWT A;  1A2U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...