3NXWA

Crystal structure of staphylococcal nuclease variant delta+phs l125a at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLARKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cavities determine the pressure unfolding of proteins.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2010-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3nxwA00
1SYFA 3TP7A 2EYFA 5KGUA 1SYCA 3OSOA 5EGTA 4ODGA 3RUZA 2RBMA 4HMJA 1TT2A 5IGDA 5IGFA 2KHSA 2O4XA 4MIUA 4OL7A 4IALA 3ERQA 5EKLA 4TRDA 4E6IA 4ID6A 4KJOA 2F0OA 5IODA 2EY2A 2SNSA 3NQTA 3MEHA 5DAUA 3MVVA 1STNA 5CC4A 5KYIA 4RKLA 4R8NA 5C3XA 4QF4A 4N9TA 4ZUJA 5IIFA 2F0DA 3C1FA 3NUCA 2WACA 4KV6A 4F7XA 1TQOA 1EYAA 5KIXA 5CV9A 5NUCA 2F0JA 5CGKA 1EY5A 4KHVA 4B9XA 3NP8A 4KD4A 1SYEA 3VA5A 4I65A 4PMCA 1SNOA 5I6WA 2EYHA 2RKSA 3QOLA 4HMIA 1KDAA 1RKNA 2F0SA 1A3UA 1SYBA 4KY6A 1U9RA 5JAVA 1NUCA 1NSNS 4K2KA 4YIJA 5M9OA 3OWFA 4NDXA 5C4HA 5C4ZA 1EZ6A 1EY4A 1STYA 3D4DA 3DHQA 4QMGA 4WORA 5J1ZA 1SNCA 3SK4A 1A2UA 4K6DA 1F2MA 4EQNA 2F0EA 4ME5A 4QB4A 2F3VA 1SYGA 3SR1A 5IGBA 1EZ8A 4KD3A 1ENCA 3SK6A 3NK9A 5I9PA 2SNMA 2EY1A 1STGA 1TR5A 4NP5A 3OMGA 4F8MA 3C1EA 1EQVA 1EY0A 2F0IA 5DEHA 4K5WA 1A3VA 2EYPA 1JOKA 1SNPA 4DGZA 4EQPA 3TMEA 3D4WA 3D8GA 4IUNA 3MZ5A 3OMCA 3TP8A 4EVOA 2F0MA 2QDBA 4NKLA 4IZ8A 2PW5A 3ITPA 2OEOA 4N9PA 3TP6A 4DU9A 5HGTA 5KYLA 3PMFA 3SK8A 2F0GA 4KJNA 4KY5A 1AEXA 4B9WA 5I9OA 2EYOA 4K2LA 5I6YA 5C5LA 2F0WA 2F0QA 3H6MA 2F0VA 2ENBA 2EXZA 5CV7A 4H7BA 4K8JA 5EKKA 2PZUA 5IGEA 3MXPA 1JORA 3R3OA 2EY5A 1KABA 4PMBA 3TP5A 3NXWA 3DMUA 3P1HA 2PQEA 1EY7A 5IOCA 1JOOA 2EYMA 3E5SA 4J1MA 5J22A 2F0HA 4LAAA 3BDLA 3SXHA 3T16A 2F0UA 3EJIA 4RKBA 3SK5A 1JOQA 1F2ZA 1SNDA 3NHHA 3QOJA 5CV5A 3SHLA 5KEEA 4HTHA 1STAA 1SNQA 2EYJA 3BDCA 4WRDA 3D6CA 5J39A 2M00A 4K8IA 1II3A 4DFAA 1IHZA 1STBA 1A2TA 2OF1A 4KY7A 5CR3A 5JOBA 1KDBA 5KRUA 4PNYA 2PYKA 1KAAA 3HEJA 2F0LA 2EYLA 2LKVA 3HZXA 3MHBA 2KQ3A 2PZWA 5CV4A 5E3FA 3EROA 3QB3A 1STHA 4K5XA 2F0FA 1KDCA 2PZTA 5F2DA 3P75A 4DF7A 3T13A 1EY8A 2F0TA 4K14A 1EY9A 5IGGA 4EQOA 5C3WA 3S9WA 2NUCA 1A3TA 5K5PA 5CV6A 3LX0A 2F3WA 5E1FA 3V2TA 5IGCA 5C5MA 5ISRA 1SNMA 2OXPA 5C6AA 4NMZA 2PW7A 1EYDA 5HURA 4KTAA 1SYDA 2F0KA 4K5VA 4J6HA 2F0PA 2F0NA 5CV8A 4S3SA 3U9OA 1F2YA 2SOBA 4ZQ3A 2HQEA 2RDFA 1ENAA 4ZUIA 2EY6A 3EVQA 1EYCA 4G57A 1EY6A
chains in the Genus database with same CATH superfamily
3MXGA 3RZOB 4U68A 4OIKA 4CBVA 2A73B 1D7QA 1UE6A 2JEAI 4MZ9A 4DNTB 3MEHA 4V0BA 2HIXA 1D6EC 1TY2A 4HEDA 3NTIA 2PI2E 3C1FA 2DGYA 1EEID 1N36Q 2IX1A 1EYAA 4DNRB 3JAML 1LACA 4Q0FA 4BBSB 4A3JH 1PTOC 1G91A 1OXTA 4CDCC 1KDAA 3TRZA 1Z9FA 2A8VA 4NDXA 1CQFA 1E3PA 1QB5D 1CQVA 3AQQA 2Y0SG 5M5YH 1QZHA 1HR0W 3S16H 3S17B 4LUOA 2B2YA 2R7ZH 3QG1A 3CP0A 2JXMB 5LMNL 2R92G 2CH4A 1ENCA 1EYGA 3K7AB 2D62A 2AQ3B 2RHQB 2AUJD 4A93H 2RVLA 3TP8A 2PW5A 4BBRB 2EE1A 3S1NB 3SK8A 3FPPA 1C8CA 1DOMA 3UE1A 2PMZB 1N33L 2I5MX 4CJ0B 1RCVD 3CCVA 2HQLA 1TY0A 5FOBB 5ELOA 4RWSC 3E5SA 5J22A 1E7ZA 3T16A 1O80A 2D0OA 3NQIA 5IYDG 1SNDA 3QR8A 4A3KG 4POGA 3GTKB 1M90C 3BDCA 4HJAA 3R2TA 1H9JA 2K6AA 1SE2A 4IPHA 1CM9A 3T1YQ 3PUZA 1UUPA 4IFDJ 3QB3A 1KDCA 4H44C 1MSHA 1RDPD 4X3UA 1E2VA 2OTJA 3EN2A 5ELNA 1BCPD 3DWQA 3E6ZX 2E74C 2EQSA 5EBCA 4JI1Q 3RR5A 3CCJA 2MQHA 3RZDB 1RHPA 2B8GA 4B3SL 3U9OA 4NPSA 3EVQA 1M1KC 1PH2A 1VF7A 3VR3A 1SYCA 5EGTA 1TWCH 2DJGC 1JB7A 1TT2A 2LFNA 4IPCA 4IALA 2K5HA 5C4XG 2ZTCA 1SMYD 3WOFA 4LJZC 2NVXH 3PIO3 3M4PA 3UDFA 2FINB 4C3IH 1MD2D 3K6OA 1SEBD 1FNVA 4OEMB 3GTMB 5CGKA 1GUGA 2F03A 3W5OA 4GLXA 1CUKA 1VQLA 1H9KA 4N8FA 1TWFB 1SYBA 2AQ2B 5JAVA 1B1ZA 5JPMC 1PVOA 1AN8A 4DR5Q 4JW0A 3GTKH 4A4IA 3DHQA 2AMCB 2R92B 2K1BA 2KUMA 1XWEA 2H5XA 2R61A 3SR1A 3J7A5 4DUZQ 1XJVA 4DV4L 3J81E 2UUBQ 5T1GA 1HFGA 4CDDC 1FNWA 1JJ2A 2F0IA 4C3IG 1SNPA 3VA7A 4C3HH 2I07B 5GAHC 5M5YB 1CT1D 2JA9A 4OELB 1D2BA 1EQQA 4KY5A 2XN9C 4B9WA 1YNNC 2RSNA 5I9OA 2CW0D 3J80L 3HRZC 4H0LC 3QIAA 3FEWX 5C5LA 1IW7C 3AYHB 5CV7A 1CKNB 4BWGB 1X56A 2MPMA 2VQFQ 1VQ9A 4HIMA 3GTQB 1PYWD 1XPUA 1C9OA 2R3ZA 3VR2A 4LAAA 4JI2Q 4UAIA 1F2ZA 1QUQA 1L1OA 2RA4A 2HDLA 3L7ZC 2H1EA 5EBDA 1ILPA 1XNQQ 4A3LH 4OIJA 4L5TA 4PNYA 1JWUD 4FVMA 4IOCA 1X9NA 2C9OA 2Q2TA 4DF7A 4XXEA 1V1PA 1A3TA 3GTQH 3MFGA 4P73A 1HR0Q 4JI7Q 3DXJC 5C6AA 3N6RA 3K58A 4RCNA 3A54A 4K5VA 3S1QB 3OW7A 2BOSA 4X3KA 2BDOA 3A8JE 1X3QA 4P75A 1SYFA 1S5CD 3CCLA 4B3RL 5C0XG 4IUQA 4ABNA 4GN3B 3UDGA 5FO9B 1Q81C 4Y52H 4UP9A 1W6JA 5DAUA 2CCZA 4HIDA 5C3XA 1Y1VG 4DR2L 1T5XD 1GUTA 1TQOA 4C3IB 4ZKCB 4IPDA 1DJRD 2XWJB 3A8IE 1P16A 4ZLTF 1TS4A 4DV5Q 2UXCL 3CPWA 2KECA 1DGSA 1NUCA 2B2TA 2KEDA 1VS0A 1BR9A 2JA6G 1DM0B 1EZ6A 3Q23A 1STYA 4WFN3 3WDNA 3R93A 1EWHA 3CD6A 5AFWA 4ME5A 5H1SE 1CA6A 2CQOA 3BYTB 1Q90A 5I9PA 4LF7Q 1SAPA 2EY1A 4DAMA 4F8MA 1L0YB 1EQVA 2JQOA 4EQPA 1IBML 2GA4B 1N33Q 3J7AF 3DM3A 5KYLA 3DM1A 3F1ZA 3U4VA 4LUVA 1V1QA 1SLJA 3PMFA 2WKDA 1SDFA 4JBJA 5A2QL 2ICEC 1IBKL 5EKIA 4AYBG 2NN6H 1PH8A 4RH6A 2EXZA 1N32Q 3CAMA 3V96A 3HKSA 4GOPC 3DMUA 2EDGA 2NTTA 2VS1A 2Q8IB 1LT6D 4JYAL 1I5FA 4A3EG 5IYDH 5KEEA 3KDFA 2JP1A 4AQYQ 2N78A 2CWPA 2VL6A 5HY6A 4QL5A 4X6AH 1SMYC 2ZJRA 3J7YW 2CVRA 4BY1B 3M7NA 4JI0L 1CFMA 1Y1WH 1STHA 1WCMG 5F2DA 4P72A 2F0TA 1GOZA 1EY9A 2O5IC 3KJOA 1PFSA 5D3IB 2SDFA 1T5EA 4JBWA 1K8GA 1S4ZA 1JQYD 4H02A 4LFAQ 4DXFA 4R4QA 1A15A 4FYDA 5HURA 2MO1A 3WOEA 3J7ZC 2F0NA 1SRUA 3FMCA 1HA6A 1O7LA 5KNCA 2K5DA 2Z4IA 1K8MA 1SJHD 1E1TA 4OO1H 1UWVA 1KRSA 3HOXB 2D2CC 2QA4A 1FGUA 2Z6BA 2HCCA 1YJWA 3K57A 2R7DA 1FL0A 5FO7B 4ZAIA 2BE5C 2HCIA 5K36G 2XWBB 3CQZB 3I2ZA 3K7AH 5EPJA 4XIGS 3MFYA 4IUUA 4CKCA 4A3LG 3PSIA 4RMFA 1IBLQ 4KV6A 1EFID 4C1NK 1Q1BA 1CSQA 1Z47A 2CW0C 1PFNA 3O13A 4KHVA 1VQ8A 4DV3L 3I4MH 3VA5A 4I65A 1KHIA 1FNUA 3GV3A 3KLSX 5D14A 5C4JB 4B3MQ 2Y0SB 1EY4A 3SK4A 3T1YL 4A3DB 2A69C 3F2CA 1EOVA 3BZCA 3DEOA 3H15A 1H9RA 1EZ8A 2JA5B 2K7VA 4LF8Q 4KHZA 1C48A 5AJ3L 1JMCA 2SNMA 4IUTA 1ICWA 1KNEA 3KF6A 3TZDA 3C3LA 4XYQA 1EY0A 3STBC 4K5WA 2E2HB 1I4PA 3TN2A 3NE5B 3E9IA 4RGNA 3M3YH 1I4RA 3I4NH 4OGQC 2DY8A 1QVGA 2B8FA 2L1BA 4K2LA 5I6YA 1TXYA 4JI3Q 3MXPA 1AW7A 2ZJQA 2A1AA 4FNFA 1Q12A 1WTOA 2L11A 2VQFL 3IFDA 3H0GB 1YIJA 1QCBD 4JI4Q 1JOOA 3UI2A 2IT1A 2X6LA 2XTIA 2E2HH 1MIUA 1JWSD 2EYJA 1MBYA 1M4VA 2WKCA 1I6VC 1STBA 1XMQL 2OCEA 4L5QA 1XX8A 5IWAQ 2NYZD 3EIVA 3HZXA 3RLFA 3GTOH 3HOWB 3TSSA 1IBMQ 1WYDA 4B3TL 3I91A 2UU9L 2HHHQ 3X3NA 3EFXD 1QILA 1UEAB 3V2TA 3S1MH 2L12A 5ISRA 2OT2A 4C3JG 2XVSA 3FPUB 4A3EB 1ICFB 5ELDA 1OXUA 1AH9A 4A93G 1ENAA 5I2YA 2NB0A 1U4LA 4C3JH 1IYVA 2PNRC 2VUMB 1XPRA 5JPNC 3IKJA 2PPBC 1VQOA 2IJ0A 4TKOB 2F3IA 3MVVA 2NVQH 3H3VC 4JOIC 3VDYA 1BO0A 4DR2Q 1HUNA 1X65A 3CC2A 3TS2A 1YNJC 3S14B 3K59A 3L0OA 2ICIA 2KEEA 1LTGD 1BDOA 5IY0A 2GVAA 4X62Q 4P2CB 4HJ8A 2K01A 4ZRZA 3M7GA 1PLFA 4J15A 4IO9A 2JA8H 3J80c 1QVCA 4KHPL 4LFAL 4GKKQ 2QEXA 2J4XA 4EX5A 4IFDG 5KNBA 2Z8LA 1Y1WB 1XXGA 1VF5C 3PO3G 1IZ6A 2JEBI 4OWTB 1TWFH 3SK6A 4CKBA 2VQEL 2NTSA 5IYCG 2EXDA 5DEHA 4DUZL 5FLMG 3VR5A 4AH6A 1FGBD 2EZVA 1Y1VB 1B4OA 4DNIA 3A7AB 1I6HH 3A55A 4DR6L 3PIPA 1PH9A 3S15B 5IGEA 1OXVA 2KBNA 2JYOA 4YHHQ 1O7YA 2R7FA 3R3OA 1TWCB 3NBHB 3P7JA 2A68C 4DV0Q 4JI2L 1U5KA 3SXHA 1H9SA 3EJIA 5FJ8H 4DK3C 2FJ2A 4MTKA 1QUQB 3A7LA 3OWEB 4LF9L 4CGYB 4LMQD 4R4IA 1S40A 1K83H 4NXNQ 1YNND 1KLGD 1LV9A 2PZWA 5E3FA 1VQHA 4K5XA 3BVGA 2PZTA 2JE6I 4XDXA 3S2DH 1PTOD 1YZ6A 1D5ZC 3FKIB 1GHKA 4R1JA 3HKZG 4DV4Q 4UPAA 1I6HB 2E5LL 3FDTA 1Z7TA 5FLXL 3BG3A 4XYOA 4RGOS 1KC8C 2LS01 3K5NA 4GKJL 2F0OA 1X3PA 3AEVA 2BH8A 1L0XB 1XMQQ 4R8NA 4JYAQ 1CHQD 4PV1C 3IL8A 1X3FA 4MN3A 4A3MB 5GADC 3NP8A 4UDUC 2IL8A 4BY1H 3PCOB 1SNOA 4IUPA 1QVFA 2ZTEA 3NSWA 3QOLA 2DN8A 2XSCA 3G6EA 2F0SA 3E9HA 2NVYB 1JCKB 5M5WH 2Z6KA 4ALPA 4CJ2C 1WTPA 1F9PA 2QILA 1QWYA 1Y8OB 1S5FD 4RHRA 1JC7A 1IKMA 4QMGA 3KF6B 3T1HQ 3W2DA 1A2UA 4NW2A 4DR1L 3CMAA 5JJIA 2B63B 4X66L 4LF7L 1BUVT 1I3QB 1TR5A 1HNWL 4KKTA 4BBSH 3I70A 1RJTA 1WTHA 4IUNA 1TIID 1L1OC 1ZYRC 3MZ5A 3KFUA 2QDBA 1B70B 3NWTA 4N9PA 1JB3A 3Q22A 2Z6KC 2AKWB 1WOCA 1QE6A 4HJ5A 5C4XB 4A3BH 3RNUA 2ENBA 2PQEA 5IOCA 1ET6A 5IT9c 3U4ZA 2ALYB 2N49A 2F0UA 2B2WC 4DV3Q 3KLSA 2ZJPA 3QOJA 3S24A 1GVPA 3HOWH 1SNQA 4R8IA 1U4PA 1K3BC 1IHZA 1HNZL 4A3EH 3LGJA 1GHJA 1ESFA 2F0LA 4B9XA 1BF4A 3Q24A 4A3CG 3EROA 1B9MA 5CBEE 1PTOF 4B08A 4Z9CB 5K5PA 2B2WA 3K0YA 2OXPA 1V9PA 3GV6A 4A3KB 5C0XH 1UEBA 4BY7B 1Q46A 1PZJD 2IW3A 3HGBA 1N8RC 3U9SA 1CSPA 5DNFA 5KIXA 2WFWA 3MWYW 3OSOA 3I72A 2A6HD 1I94L 2WB1G 4L8JA 2WP8J 3S1QH 5LL6S 4RG1A 1KXLA 3RN2A 3N52A 4UY8C 3E3XA 4BBRG 4LF4Q 4BA2I 1KRTA 4RA8A 1PA6A 1N36L 1GUSA 1SN8A 3SVMA 4XQJA 3A74A 4HJ9A 2IHEA 1A62A 1X55A 2B63H 2E2IB 1K28A 4GN4B 1N34Q 4F88A 2RQXA 5C4ZA 3I4MB 1ML0D 2V1CC 1C4QA 1IYJB 3KYHC 1MJCA 1SROA 2JA7H 3NELA 1PFMA 2UUBL 4POFA 4NP5A 4XTCS 2RDGA 4A3MH 3OMCA 2VY3A 3M9BA 4UP7A 5IYBG 5HGTA 1SFOH 4G7ZC 1GM5A 2GN5A 1LM0A 2KHJA 4BA1I 4LF5L 5M5WB 2PI2A 1JE4A 3M85A 4CHTB 4WJ4A 2UUAL 2PMZE 1LTBD 1GKHA 5M3MH 2K5QA 2LXKA 2UXCQ 1DD2A 3S1NH 4F87A 5IP9G 4DAPA 2O5JC 4QJFA 4IPGA 2NVTH 4WJWA 5CV5A 1LYLA 1S5BD 4JG2A 1EU3A 1QNUA 1O78A 2NBFA 4XQQA 3JAME 4YWMA 3S2HB 1DXMA 4GKKL 4LF4L 3I7FA 3IFTA 1W2BA 3A0JA 5LL6X 2R7ZB 2PYKA 1KAAA 2VNUD 3S2DB 1KQSA 3LWUA 1PH7A 2MGSA 3S16B 3BJUA 2I0QA 4JPBW 4K14A 2XGTA 2RCNA 1VQNA 2WINB 2R93B 3BVMA 2WAQB 2L55A 3LX0A 1BCPB 4MNOA 1HNXQ 2A6EC 2F0KA 1GUWA 3I56A 1TS3A 1TU2B 1AE3A 3OIQA 1CZGA 2EY6A 1TWAB 2VXWA 3IRBA 1K83B 4KMUC 2KHSA 4OL7A 2RCFA 3QJYA 4IURA 4UHVA 3DUZA 3U58A 5FK9C 4C2MH 5IODA 2SNSA 5M3FB 2NWGA 5KYIA 3HOYG 2E2JB 5M3FH 2DUDA 3QO2A 5COYA 1HNZQ 2JA8G 1JJGA 5IE8A 3NBHA 3U50C 3Q6SA 1P8LA 4DA2A 2C5CA 1HFNA 5CV9A 4X62L 2Q2UA 4HAEA 2K50A 1EL0A 1IL2A 1E22A 3F2DA 4KHPQ 1RKNA 1HTPA 3KBXA 3CF5A 3ZYYX 3RZDH 4R4CA 2K5NA 1L0WA 4JV5L 1TVXA 5G3LF 1VQJA 4EQNA 1DCZA 2CH4W 2A19A 1LTID 3H91A 3JAMc 2F4VL 3OOCA 2IWHA 1AZQA 4PQXA 2D0PA 1XYIA 4R9WA 2E5LQ 3C46A 1HNWQ 2FMCA 1A3VA 3S2HH 2NZ1D 1A6XA 3OPOA 2F0MA 4DUYQ 2HHHL 4QIWE 5C3EG 2NVQB 1W3SA 1KLUD 1BCPF 2NVTB 1G2SA 2EYOA 4CDEC 4CDFC 2F0VA 5EKKA 2YTYA 4A3BB 2KVMA 2JA8B 4PG3A 5FO8B 4OO1G 1KABA 5M3MB 2XRQD 5M3FG 2SEBD 4GLVB 2B2YC 3NHHA 1I4QA 4DR3Q 3HKZE 1V1PB 4GLAC 2NZHA 4DFAA 1DOLA 4KN4C 1R9TH 2VUMH 2DY7A 4CKEA 1C0AA 1KL9A 2VB2X 3A5ZB 2WAQG 2XRSD 4JCVE 1XNRQ 1GUOA 2R93G 2A5HA 2NVYH 1C7YA 4LK1C 4EQOA 4HSPA 3GTJH 1U4MA 1BOSA 2K14A 3DWAA 5CV6A 1J9OA 4L5SA 4X3SA 2MUYA 1WTVA 4I7ZC 1Q8IA 1J8IA 1I50B 3OYYA 3DLLA 4QY7A 5FLMH 1VDZA 1VQKA 2JJQA 2QF7A 3GTOB 3D0FA 3K7UC 3AB9A 2EJGC 2EY2A 2KENA 3I55A 3CCQA 1ONLA 1K8AC 1STNA 1D1IA 5K36H 1GJXA 3KBGA 4QF4A 4ZUJA 3K81C 5JEAJ 2DJFC 2DNCA 4C3HB 3MTSA 2EYHA 1UNSA 2RKSA 5CORA 4FO2A 1EQTA 2JA5H 1VQDA 4KY6A 1U9RA 1PH6A 5LMUL 1ASYA 3PO2G 2EIFA 3OWFA 3ULPA 1NJIC 3M3YB 5M5XB 1ZEQX 5J1ZA 4GNXB 4NXMQ 2F0EA 3AFPA 1HZBA 2F3VA 4LF9Q 4R4TA 3NK9A 4TVAB 1PV4A 1NNXA 3OMGA 4BXXH 1WD1A 3C1EA 3Q0AA 2E8GA 1D5MC 4YWLA 4V190 3D6WA 5I4DA 1YHBA 4L63B 2UUAQ 3RLNA 2B2TC 4IZ8A 4DU9A 3SEBA 3M4YA 4LF5Q 4XT1B 2CWAA 4KJNA 4JI7L 4TQUS 3GTLB 4K6LA 2B29A 4K8JA 4FP5D 3HOUH 4RAUC 2EY5A 1XMOQ 5ELBA 3TP5A 3PIOA 3TDQA 3HOXH 2UXDQ 1LTTD 2IX3A 2OQ0A 1JICA 4FXGC 2KA7A 4HTHA 1ASZA 2Z1CA 2Q8TA 1II3A 2NN6I 1I4XA 1TS2A 4BY7G 3S15H 4DV6Q 1AZPA 4AIMA 1VMCA 2WAQE 2ES2A 3HOZB 1YJ9A 4DV6L 4FXDA 3S1RH 2RHSB 5GAGC 4JI1L 3GDEA 1LTRD 1OXSC 3TZUA 3I4NG 3GTPH 4OWWB 5CV8A 1LLRD 1F2YA 2SOBA 1G8ZD 1HXYD 3S14H 3PF5A 1EYCA 5JOBA 5KGUA 4LF8L 3HOZH 3BDOA 4O42A 2ZXPA 2RBMA 1I94Q 1F9SA 5IGFA 1A8VA 2OTLA 5EKLA 1BBXC 2LY7A 4DXGA 1ENFA 4DKAC 1WTQA 5DLQE 2UUCQ 4QUFA 1BXTA 1WCMH 3CMEA 2X69A 3I8ZA 3CCUA 3ND8A 1EQRA 4RFBA 1YI2A 1N32L 3HOUB 3VYTA 1IBLL 2NN6G 3IAYA 1EIHA 4A3GG 3KF8A 5EPKA 3TBIB 4A3JB 2ZXRA 1NMGA 2PQAA 4DAVA 1HHVA 1SYGA 3EQLC 1K73C 2KOLA 2IPKD 1WJJA 3P20A 3NEMA 2UXBQ 3S1MB 1NMFA 1EIYB 3PO2B 4DAYA 1PH1A 1H9MA 4IJLA 5LMNQ 4EGVA 3K5OA 4A3IG 4X65Q 1NAPA 2ZM6Q 4B3SQ 4QCLA 4JBMA 3RZOH 3OIPA 1HA5A 5IP9H 2AUKA 1SE8A 2BA1A 2ASBA 2MFIA 4JI8L 1S5ED 3F8TA 4Y7NH 1HJPA 1PH5A 3F2BA 1EWIA 2ZTDA 3T51B 4KKUA 2EYMA 2FHTA 1O7IA 4J1MA 2F0HA 3BDLA 3VR4A 4MHEA 3HP3A 1YNXA 1GXDC 1Y1VH 5JJKA 1LT5D 1BQQT 4DK6C 1A0IA 3MA2B 5EAYA 4JV5Q 3PO3H 1KAWA 1CA5A 2A69D 1AFPA 2EJFC 3MHBA 3PIP3 1CKNA 3BZDB 5LMNW 3MXUA 1WD0A 5E4WC 3V05A 4DR4Q 1HR0L 1TWHB 3SDZA 3TQYA 4A3FB 4HJ7A 4L5RC 2J0TD 5BN5A 1F9QA 4GKJQ 1XMOL 4A3DH 3STBD 1EIFA 2KCCA 4JK1C 5C4JH 2O4XA 2IHFA 2JN4A 3I4OA 1B3AA 4TRDA 1ET9A 1VQIA 2KHIA 1I50H 2G5DA 4OONA 3K8AA 5CC4A 3M4OH 5EJWA 5IIFA 3CXCA 5JJZA 3NUCA 4AQYL 3JAMi 4JI8Q 4OO1I 1EY5A 1VMPA 1S5DD 5C3EB 1VQPA 1SYEA 3FRPB 5JJLA 3CRLC 2PO4A 3FHWA 2DNEA 5E7NA 4K2KA 3T53B 1LTLA 1YVCA 4G7OC 4WORA 1F2MA 3T4AC 1GD7A 1K8OA 2BDNA 2F4IA 1DOKA 4DR1Q 1PRTB 2I5HA 4KD3A 1Y1WG 1RL2A 1AP0A 2IX0A 4OXPA 1OXXK 1STGA 1CKOA 2IY5B 2O2LD 4R4OA 3MXNB 1BCPC 3RD4A 1IBKQ 1JE5A 2Z4HA 2ZT9C 5L37A 3D31A 1AEXA 4P71A 4PZ8A 3GTGH 1QOHA 2PZUA 4X64L 3I73A 1PYSB 3KLRA 3CKIB 3NXWA 2FFKB 3CU7A 1HRJA 2A6HC 2F1MA 4A3GH 4IOAA 3I4NB 1NTGA 1NCVA 3D6CA 4LFCL 3LNNA 1GO3E 2M00A 1G51A 5AJ3Q 1PZKD 2B2UA 2Q2IA 4M1UB 1B7YB 3T1HL 4DN4M 3I3CA 2EJMA 2LKVA 3HOZG 1L2FA 1TWGH 4ME3A 2ZM6L 1XPOA 5J3BA 5FKAC 2B39A 1MSGA 2OQKA 5C3WA 4KN7C 2NUCA 3S9WA 4K0KQ 3OTOL 2E2JH 3G4SA 4NMZA 1VQ4A 5D3DA 1MJEA 4O1NA 1LUZA 3L9AX 1UAPA 3J81i 1AE2A 1VQFA 1YHAA 3CQZH 2K33A 3CCRA 1XNQL 4N9TA 1RTNA 5C44G 2JA7G 5FJ8G 4F7XA 2K05A 1XTDA 4B3TQ 3H09A 4PMCA 5I6WA 3F2UA 4X64Q 1QJOA 4IFDI 2N55A 4Q5VA 2M2LA 1VQAA 2EPBA 1JT8A 1LABA 2WB1E 4GN5A 3UDXA 5LMUQ 2KCTA 1FD7D 1X3EA 2KCMA 4A3DG 3I4MG 4C3HG 5BN3A 1Q82C 3H3VI 4K0KL 1Y8NB 1Y14B 4NXML 2HDMA 1HZCA 5A35A 4GOPB 1PXUA 1VQBA 2JA7B 5C44B 4KI0A 1Q1EA 2RSOA 3HOYH 4G7HC 2YYZA 2VW9A 1B3QA 2CFMA 4GS3A 3H6MA 4KLKA 3NBIA 5BN4A 4I7AA 4H13C 4TSSA 2K5VA 3I4LA 3SHLA 2AHOB 2CKZB 3PUXA 1RD9D 3UE0A 1OO9B 4WRDA 5J39A 4A3FH 1DONA 1E0BA 1E2WA 1A2TA 5CR3A 1HTLD 2LMCB 1EU4A 1SBBB 1SR3A 4GNXA 4QIWB 4DK1A 1HNXL 1N34L 3H3VH 1EY8A 3KUPA 1E2ZA 2TMPA 2FXQA 1G6ZA 1SNMA 4GZYC 3J80i 2HIVA 2KJXA 2YV5A 3G6JB 3CCEA 3MXNA 5JEAH 1PDQA 5A2QE 5CYUA 4L6TB 4APVA 1G291 3JC66 1EY6A 2EOTA 3TP7A 2EYFA 5IYCH 3M4QA 5M3MG 1R4PB 3RUZA 2NVXB 1H95A 1HZ9A 1XTCD 4MIUA 3HFZB 3VYSA 1JJCB 2MP1A 1PRTF 3E0JA 1V1OA 4PZ7A 4A3KH 4OX9L 2JK8A 1CK1A 4YCVA 2OWOA 3E0EA 3MAQA 4XT3B 1PMRA 4J8QA 4AYBB 4OX9Q 3EBEA 2R6GA 1ESRA 2H4OA 2ATWA 1B9NA 1LT4D 3ND9A 5FLXc 3K5MA 5C4XH 2BCOA 4KK7A 5C4HA 4ULLA 1TWAH 3OHXC 2B63G 3CCMA 4K6DA 1HPCA 2QGQA 3KJPA 1J6QA 3URYA 1Q8KA 2JA6B 4DR4L 1PRTC 1VQCA 4YWKA 4FDBA 4QUCA 2CHBD 1Z6HA 2KCNA 3VYRA 1B8AA 4O2DA 4QQBX 1K0SA 1QZGA 2QW7A 5ELEA 3TP6A 3UDIA 3HOYB 1MGSA 1CI3M 4M8AA 4JI6L 3DWPA 2BH2A 1VQ6A 4JI5Q 1D8LA 3ULJA 1JORA 4FXKC 1U4RA 1K9MC 4FF1A 3DEPA 1SE3A 4DK0A 4BBRH 4WJ3M 3TS0A 1PTOB 2N88A 2L15A 4JVZA 1CZWA 1VQEA 4DV1Q 1PRTD 2AWNA 5T1IA 4A3FG 3CRKC 4RGTA 1Q3LA 1WTXA 3A56A 4KY7A 3BS1A 2BA0A 3A8KE 4DAYB 2K75A 2FMMA 1OTCA 3HEJA 1F2LA 2EYLA 5CV4A 5GQOA 4P74A 2F0FA 4LNQA 2R7ZG 4C56C 3P75A 5CBAE 3FKIG 4G4KA 2Q2HA 5IT9L 4DR5L 1YJNA 1PYBA 1O7ZA 3ULLA 5E1FA 3PUYA 3OTOQ 3VYUA 4LFBL 4LFBQ 1E24A 1VCIA 2CQAA 1BBUA 4HCEA 3H94A 5JEAG 4LF6L 4BS9A 2YTVA 1K0RA 2HQEA 1VQ7A 3L2PA 2ZXOA 5BR8Q 5BR8L 1ZKOA 4XQNA 2C35B 4B3RQ 1FR3A 4LF6Q 4HMJA 3G71A 2L5TA 4E6IA 2N3SA 3R2IA 1F9RA 2NZOA 1CHPD 1LO5D 3AFQA 4KJOA 2E2IH 3GTLH 4YCWA 3NQTA 1PH4A 3T56B 3EA6A 1MI2A 3FKIH 1BBWA 1X3GA 4A3IB 1S72A 1YBYA 3K5LA 3AU7A 4N8X1 1TWGB 4FF2A 4YY3L 2K32A 2VZAA 4KD4A 3TREA 4IQZA 2UU9Q 1BNZA 3B6YA 4LUZA 4DV5L 1A3UA 1X54A 4ZCKA 4JC0A 3X3MA 3HOVH 4A3JG 1T9HA 4A3GB 1YHQA 3CHBD 3PGZA 4QB4A 3PO3B 1XNRL 2A6ED 1Y8PB 3HOUG 2WV6D 1RF2D 1TKWB 4DV7Q 3GTGB 2B2UC 3CCSA 3LWEA 1NBWA 4NB3A 4EVOA 3G7LA 4DR7Q 1EIGA 2D5DA 2OEOA 3KK7A 1HZAA 3BU2A 3MEFA 3GQBA 2Q8RE 1B44D 2K28A 2B3GA 1A63A 3BZKA 3A5UA 4H7BA 3PQIA 3TEHB 2WB1B 4Y7NB 2N8NA 1RODA 2D9UA 1YNJD 4RGMA 2UXDL 3NWSA 3KF8B 2L9HA 4ILWA 3AMUA 4RKBA 1X6OA 3SK5A 1H9SB 3GP7A 2RDHA 4YCUA 1YEZA 2QCPX 2RF4A 3PO2H 3D3RA 1ZXTA 4LFCQ 1WTRA 4A93B 1NY4A 2OF1A 4DPGA 5JVH3 1WTWA 1LT3D 1UE5A 4C3JB 1FVIA 5GAEC 4RCOA 2KQ3A 1PZID 2PQAB 4IFDH 3G48A 1HUMA 2Y0SE 1RIPA 5LHY1 1R9TB 3S17H 1MHWC 4JOIA 2F3WA 4CJ1B 1I4GA 4JI6Q 3CW2C 2MJ8A 1I3QH 2BE5D 1FJGQ 3R8BA 3C2PA 1N9WA 4KTAA 4J6HA 5IP7H 2E76C 4S3SA 4EQ5A 4ZQ3A 1WI5A 3PUVA 3T13A 4ZUIA 3I90A 2GVBA 2PW7A 5C3EH 5GROA 1EUJA 5EPLA 4OHJA 4A3CH 3PV0A 4ODGA 4GNXC 1PFBA 5IGDA 5C44H 2MHVA 3W3AA 4C1NI 4ID6A 1IXRA 2F52A 2A68D 3M4OB 3H0GG 4LW1A 1YITA 3L3OC 4JI3L 2PNHA 4DUYL 3KOJA 4PZ6A 2K52A 2F0DA 4ZK9B 2WACA 1TS5A 2P5ZX 5NUCA 2F0JA 4FF4A 4LWCA 5C0XJ 1IYUA 2EVBA 3RLOA 2PCFB 1F77A 3OW2A 1EEFD 4HMIA 1NSNS 1GUNA 5D65A 5IT9E 1L1OB 3SE0A 2F4VQ 2ID0A 4BXXG 5ELCA 2V4DA 5KNDA 1SNCA 2JA5G 1SJED 2E2DC 3NTHA 2R92H 1U0LA 2A74C 1ILQA 3D4RA 2QKIC 2UXBL 1NR4A 2YU9B 3RMHA 1WVLA 5FLXE 1R4QB 2XNAC 5DM73 4A3MG 1B50A 2EYPA 1JOKA 1PH3A 3TMEA 1IL8A 4A3IH 3K80C 3ITPA 4DV2L 4ZKBB 4HN7A 3PF4A 3GTMH 4BBSG 2M9VA 3HG9A 5JVG3 3ER0A 4C2MB 1QG7A 5EQ0A 3FVQA 1LTSD 3J7AV 4PMBA 2Z0SA 3MC0B 3KLWA 2HUGA 4HSVA 1BKBA 4JI4L 3NTKA 2UUCL 1KTKA 1PHJA 4DV1L 1CKMA 5IYBH 1MKHA 1STAA 2X6GA 3HOXG 3HKZB 1HQMC 1ZYRD 3J81c 3J81j 2R93H 2E75C 5KRUA 1Q7YC 5IWAL 3WWVA 4B3ML 2L0CA 4HCSA 3HOVG 1BVSA 1B53A 1UE7A 1WCMB 4O0AA 2Z9HA 4OWXB 5IGCA 5C5MA 2YU9H 1S3OA 1E1OA 4PMWA 1G2TA 4BY1G 1D5XC 4JI5L 1SYDA 4MTNA 1SSOA 2F0PA 1JWMD 1SMXA 3NPPA 2RDFA 4JBKA 1VQGA 3PUWA 4IJHA 1VQMA 4DV0L 4KKSA 1FJGL 3FP9A 4A3BG 5I2XA 4DV2Q 3ERQA 2MO0A 4A76A 1M8AA 1KD1C 4DR3L 3GTPB 5G3LD 2HD3A 3W1BA 1B2TA 4HIOA 1V8QA 4RKLA 3VR6A 5CMDA 3CC4A 4IUVA 1HH2P 1SFOB 1HQRD 1PTOH 3HS0C 2QDLA 2JA6H 5HGQA 1UE1A 3SGIA 3KDFB 4HR7B 2K04A 4X3TA 3CPFA 4UP8A 3BYYB 3GTJB 1EWCA 4U673 4YIJA 5M9OA 3K0XA 2LSSA 3S1RB 1D1KA 3D4DA 3ERSX 4NXNL 3ZJYC 3J80E 2QEJC 5IGBA 1JR0D 3RN5A 1NE3A 2I46A 2VQEQ 4DR7L 3W1GA 3GD7A 4A75A 2MNAA 5DM63 4DV7L 2J7ZA 4DGZA 1Y69U 5TSSA 3D8GA 4X65L 4RHSA 4HIKA 2TSSA 1J5EL 2K03A 4NKLA 1W6KA 3QWNA 1VQ5A 2F0GA 2JSOA 5E4XA 1EFWA 4QGUA 2F0WA 2F0QA 5IP7G 4DR6Q 2YTXA 1J5EQ 2VUMG 1DZ1A 1LTAD 5ELFA 2G9DA 1SE4A 3P1HA 1EY7A 1QNKA 2WIIB 2B2VC 1JOQA 1EOTA 3ICEA 4YHHL 2I5LX 4BY7H 2AWOA 5M5XH 1SXTA 3CC7A 1I4HA 1CTMA 4ZYSA 4K8IA 4YY3Q 3ONAB 5C0XI 1FYCA 1KDBA 1WFQA 4JI0Q 4FF3A 1TWHH 1STEA 3HOWG 2G9HD 3GO5A 1HCZA 4X66Q 1X32A 3BVZA 3HOVB 1Q86C 5IGGA 1V43A 2K5WA 4AYBE 2B2VA 1KNAA 3H0GH 1KIXA 3NENA 2L4NA 1NR2A 1IW7D 2HT1A 4IN3A 1EYDA 2XIWA 2K4KA 4GOPA 3J81L 2VB3X 2AQ1B 1DYQA 1IKLA 1K3RA 3Q8DA 1RTOA 1G6PA 2LXJA 3D4WA 4G57A
chains in the Genus database with same CATH topology
3MXGA 3RZOB 4U68A 4OIKA 4CBVA 2A73B 2JEAI 4DNTB 3MEHA 4V0BA 1D6EC 1TY2A 4HEDA 3NTIA 3C1FA 1EEID 2IX1A 1EYAA 4DNRB 3JAML 1LACA 4Q0FA 4BBSB 1PTOC 1G91A 1OXTA 1KDAA 4NDXA 1CQFA 1QB5D 1CQVA 3S17B 2B2YA 3QG1A 2JXMB 1ENCA 3K7AB 2D62A 2AQ3B 2AUJD 2RVLA 3TP8A 2PW5A 4BBRB 2EE1A 3S1NB 3SK8A 3FPPA 1C8CA 1DOMA 2PMZB 4CJ0B 1RCVD 1TY0A 5FOBB 4RWSC 3E5SA 5J22A 3T16A 1O80A 3NQIA 1SNDA 3GTKB 3BDCA 3R2TA 1H9JA 2K6AA 1SE2A 1CM9A 3PUZA 1UUPA 4IFDJ 3QB3A 1KDCA 4H44C 1MSHA 1RDPD 4X3UA 1E2VA 1BCPD 3DWQA 3E6ZX 2E74C 5EBCA 3RZDB 1RHPA 2B8GA 3U9OA 3EVQA 1VF7A 3VR3A 1SYCA 5EGTA 1TT2A 2LFNA 4IALA 1SMYD 3WOFA 4LJZC 3PIO3 2FINB 1MD2D 3K6OA 1SEBD 1FNVA 3GTMB 5CGKA 1GUGA 2F03A 1H9KA 1TWFB 1SYBA 2AQ2B 5JAVA 1B1ZA 5JPMC 1AN8A 3DHQA 2R92B 2K1BA 2KUMA 1XWEA 2R61A 3SR1A 3J81E 5T1GA 1HFGA 1FNWA 2F0IA 4C3IG 1SNPA 3VA7A 2I07B 5M5YB 1CT1D 1D2BA 4KY5A 2XN9C 4B9WA 1YNNC 2RSNA 5I9OA 2CW0D 3J80L 3HRZC 4H0LC 3QIAA 3FEWX 5C5LA 1IW7C 5CV7A 4BWGB 2MPMA 3GTQB 1PYWD 3VR2A 2R3ZA 4LAAA 4UAIA 1F2ZA 2RA4A 2HDLA 3L7ZC 2H1EA 5EBDA 1ILPA 4OIJA 4PNYA 1JWUD 4FVMA 2C9OA 4DF7A 4XXEA 1V1PA 1A3TA 3MFGA 3DXJC 5C6AA 3N6RA 3K58A 4RCNA 3A54A 4K5VA 3S1QB 3OW7A 2BOSA 4X3KA 2BDOA 3A8JE 1X3QA 1SYFA 1S5CD 5C0XG 4IUQA 4ABNA 5FO9B 1W6JA 5DAUA 5C3XA 1T5XD 1GUTA 1TQOA 4C3IB 4ZKCB 1DJRD 2XWJB 3A8IE 4ZLTF 1TS4A 2KECA 1NUCA 2B2TA 2KEDA 1BR9A 1DM0B 1EZ6A 3Q23A 1STYA 4WFN3 3WDNA 3R93A 1EWHA 5AFWA 4ME5A 1CA6A 3BYTB 1Q90A 5I9PA 1SAPA 2EY1A 4F8MA 1L0YB 1EQVA 4EQPA 2GA4B 3J7AF 5KYLA 3DM1A 3PMFA 2WKDA 1SDFA 5A2QL 2ICEC 5EKIA 2NN6H 4RH6A 2EXZA 3V96A 3DMUA 2EDGA 2NTTA 2Q8IB 1LT6D 5KEEA 2JP1A 1SMYC 3J7YW 2CVRA 4BY1B 3M7NA 1CFMA 1STHA 5F2DA 2F0TA 1GOZA 1EY9A 2O5IC 5D3IB 2SDFA 1T5EA 4JBWA 1S4ZA 1JQYD 4DXFA 1A15A 4FYDA 5HURA 3WOEA 2F0NA 1HA6A 3FMCA 1O7LA 5KNCA 2K5DA 2Z4IA 1K8MA 1SJHD 4OO1H 3HOXB 2D2CC 2HCCA 3K57A 5FO7B 4ZAIA 2BE5C 2HCIA 5K36G 2XWBB 3CQZB 5EPJA 4XIGS 3MFYA 4IUUA 4CKCA 4KV6A 1EFID 4C1NK 1Q1BA 1Z47A 2CW0C 1PFNA 3O13A 4KHVA 3VA5A 4I65A 1FNUA 3GV3A 3KLSX 5D14A 5C4JB 2Y0SB 1EY4A 3SK4A 4A3DB 2A69C 3DEOA 1H9RA 1EZ8A 2JA5B 2K7VA 4KHZA 1C48A 2SNMA 4IUTA 1ICWA 1KNEA 3TZDA 3C3LA 4XYQA 1EY0A 4K5WA 2E2HB 1I4PA 3TN2A 3NE5B 4RGNA 1I4RA 4OGQC 2DY8A 2B8FA 2L1BA 4K2LA 5I6YA 3MXPA 1AW7A 1WTOA 4FNFA 1Q12A 2L11A 3IFDA 3H0GB 1QCBD 1JOOA 3UI2A 2IT1A 2X6LA 1JWSD 2EYJA 1MBYA 1M4VA 2WKCA 1I6VC 1STBA 1XX8A 2NYZD 3HZXA 3RLFA 3HOWB 3TSSA 3I91A 3X3NA 3EFXD 1QILA 1UEAB 3V2TA 2L12A 5ISRA 2OT2A 4C3JG 2XVSA 3FPUB 4A3EB 5ELDA 1OXUA 1ENAA 5I2YA 2NB0A 1U4LA 1IYVA 2PNRC 2VUMB 5JPNC 3IKJA 2PPBC 2IJ0A 4TKOB 3MVVA 3H3VC 1BO0A 1HUNA 1YNJC 3S14B 3K59A 2ICIA 2KEEA 1LTGD 1BDOA 4P2CB 2K01A 4ZRZA 3M7GA 1PLFA 2J4XA 4IFDG 5KNBA 2Z8LA 1Y1WB 1XXGA 1VF5C 2JEBI 3SK6A 4CKBA 2NTSA 5DEHA 3VR5A 1FGBD 2EZVA 1Y1VB 1B4OA 3A7AB 3A55A 3S15B 5IGEA 1OXVA 2JYOA 1O7YA 3R3OA 1TWCB 3P7JA 2A68C 3SXHA 1H9SA 3EJIA 2FJ2A 3A7LA 3OWEB 4CGYB 4LMQD 1YNND 1KLGD 1LV9A 2PZWA 5E3FA 4K5XA 3BVGA 2PZTA 2JE6I 4XDXA 1PTOD 1D5ZC 3FKIB 1GHKA 1I6HB 3FDTA 1Z7TA 5FLXL 3BG3A 4XYOA 4RGOS 2LS01 3K5NA 2F0OA 1X3PA 1L0XB 4R8NA 1CHQD 4PV1C 3IL8A 4MN3A 4A3MB 3NP8A 4UDUC 2IL8A 1SNOA 4IUPA 3NSWA 3QOLA 2DN8A 2XSCA 2F0SA 2NVYB 1JCKB 1WTPA 4CJ2C 1F9PA 2QILA 1QWYA 1Y8OB 1S5FD 4RHRA 1JC7A 1IKMA 4QMGA 3W2DA 1A2UA 4NW2A 2B63B 1BUVT 1I3QB 1TR5A 4KKTA 3I70A 1RJTA 4IUNA 1TIID 3MZ5A 1ZYRC 2QDBA 3NWTA 1JB3A 4N9PA 3Q22A 1QE6A 5C4XB 2ENBA 2PQEA 5IOCA 1ET6A 2F0UA 2B2WC 3KLSA 3QOJA 1SNQA 4R8IA 1U4PA 1IHZA 1GHJA 1ESFA 2F0LA 4B9XA 1BF4A 3Q24A 3EROA 1B9MA 5CBEE 1PTOF 4B08A 4Z9CB 5K5PA 2B2WA 3K0YA 2OXPA 3GV6A 4A3KB 5C0XH 4BY7B 1PZJD 2IW3A 3HGBA 3U9SA 5DNFA 5KIXA 3MWYW 3OSOA 3I72A 2A6HD 4L8JA 2WP8J 5LL6S 3N52A 4BA2I 4RA8A 1GUSA 3SVMA 4XQJA 2E2IB 4F88A 2RQXA 5C4ZA 3I4MB 1ML0D 1C4QA 1PFMA 4NP5A 4XTCS 2RDGA 3OMCA 5HGTA 4G7ZC 4BA1I 5M5WB 1JE4A 3M85A 4CHTB 1LTBD 2K5QA 1DD2A 4F87A 4DAPA 2O5JC 4WJWA 5CV5A 1S5BD 1EU3A 1QNUA 1O78A 2NBFA 4XQQA 3JAME 3S2HB 1DXMA 3IFTA 5LL6X 2R7ZB 2PYKA 1KAAA 2VNUD 3S2DB 3LWUA 2MGSA 3S16B 4K14A 2WINB 2R93B 3BVMA 2WAQB 2L55A 3LX0A 1BCPB 2A6EC 2F0KA 1GUWA 1TS3A 1TU2B 3OIQA 1CZGA 2EY6A 1TWAB 2VXWA 1K83B 4KMUC 2KHSA 4OL7A 3QJYA 4IURA 3DUZA 5FK9C 5IODA 2SNSA 5M3FB 2NWGA 5KYIA 2E2JB 3QO2A 5COYA 3NBHA 3Q6SA 4DA2A 2C5CA 1HFNA 5CV9A 4HAEA 1EL0A 1RKNA 1HTPA 3KBXA 3ZYYX 1TVXA 5G3LF 4EQNA 1DCZA 1LTID 3H91A 3OOCA 2IWHA 1AZQA 4PQXA 1XYIA 4R9WA 3C46A 2FMCA 1A3VA 2NZ1D 1A6XA 3OPOA 2F0MA 2NVQB 1KLUD 1BCPF 2NVTB 1G2SA 2EYOA 2F0VA 5EKKA 4A3BB 2KVMA 2JA8B 5FO8B 4OO1G 1KABA 5M3MB 2XRQD 2SEBD 2B2YC 3NHHA 1I4QA 1V1PB 4DFAA 1DOLA 4KN4C 2DY7A 4CKEA 2VB2X 2XRSD 1GUOA 2A5HA 4LK1C 4EQOA 4HSPA 1U4MA 1BOSA 3DWAA 5CV6A 1J9OA 4X3SA 2MUYA 1WTVA 4I7ZC 1Q8IA 1J8IA 1I50B 1VDZA 2QF7A 3GTOB 3AB9A 2EJGC 2EY2A 1ONLA 1STNA 1D1IA 5K36H 1GJXA 3KBGA 4QF4A 4ZUJA 5JEAJ 2DNCA 4C3HB 3MTSA 2EYHA 1UNSA 2RKSA 5CORA 4FO2A 1EQTA 4KY6A 1U9RA 3OWFA 3M3YB 5M5XB 1ZEQX 5J1ZA 2F0EA 2F3VA 3NK9A 3OMGA 1WD1A 3C1EA 3Q0AA 1D5MC 4V190 3D6WA 5I4DA 4L63B 2B2TC 4IZ8A 4DU9A 3SEBA 3M4YA 4XT1B 4KJNA 4TQUS 3GTLB 4K6LA 4K8JA 4FP5D 4RAUC 2EY5A 5ELBA 3TP5A 3TDQA 1LTTD 2IX3A 1JICA 4FXGC 2KA7A 4HTHA 2Z1CA 2Q8TA 1II3A 2NN6I 1I4XA 1TS2A 1AZPA 1VMCA 3HOZB 4FXDA 1LTRD 1OXSC 3TZUA 5CV8A 1LLRD 1F2YA 2SOBA 1G8ZD 1HXYD 1EYCA 5JOBA 5KGUA 3BDOA 4O42A 2ZXPA 2RBMA 1F9SA 5IGFA 5EKLA 1BBXC 2LY7A 4DXGA 1ENFA 1WTQA 4QUFA 1BXTA 2X69A 3I8ZA 3ND8A 4RFBA 3HOUB 3VYTA 2NN6G 3IAYA 1EIHA 3KF8A 5EPKA 3TBIB 4A3JB 2ZXRA 4DAVA 1HHVA 1SYGA 3EQLC 2KOLA 2IPKD 3P20A 3S1MB 3PO2B 4DAYA 1H9MA 4EGVA 3K5OA 1NAPA 4QCLA 3OIPA 1HA5A 2AUKA 2BA1A 1S5ED 3T51B 4KKUA 2EYMA 2FHTA 4J1MA 2F0HA 3BDLA 3VR4A 4MHEA 3HP3A 1GXDC 1LT5D 1BQQT 3MA2B 1CA5A 1AFPA 2A69D 2EJFC 3MHBA 3PIP3 3BZDB 3MXUA 1WD0A 5E4WC 3V05A 1TWHB 3SDZA 4A3FB 2J0TD 5BN5A 1F9QA 2KCCA 4JK1C 2O4XA 4TRDA 1B3AA 1ET9A 5CC4A 5EJWA 5IIFA 5JJZA 3NUCA 4OO1I 1EY5A 1VMPA 1S5DD 5C3EB 1SYEA 3FRPB 3CRLC 2PO4A 2DNEA 4K2KA 3T53B 4G7OC 4WORA 1F2MA 3T4AC 1K8OA 2BDNA 2F4IA 1DOKA 1PRTB 4KD3A 1AP0A 2IX0A 1OXXK 1STGA 2O2LD 1BCPC 3RD4A 2Z4HA 2ZT9C 3D31A 1AEXA 1QOHA 2PZUA 3I73A 3KLRA 3CKIB 3NXWA 2FFKB 3CU7A 1HRJA 2A6HC 2F1MA 3I4NB 1NCVA 3D6CA 3LNNA 2M00A 1PZKD 2B2UA 4M1UB 4DN4M 3I3CA 2EJMA 2LKVA 5FKAC 5C3WA 3S9WA 2B39A 1MSGA 2NUCA 4KN7C 4NMZA 5D3DA 4O1NA 3L9AX 1UAPA 2K33A 4N9TA 1RTNA 4F7XA 2K05A 3H09A 4PMCA 5I6WA 3F2UA 1QJOA 4IFDI 2N55A 4Q5VA 2M2LA 2EPBA 1LABA 1FD7D 4C3HG 5BN3A 1Y8NB 2HDMA 5A35A 1PXUA 2JA7B 5C44B 4KI0A 1Q1EA 2RSOA 4G7HC 2YYZA 3H6MA 3NBIA 5BN4A 4H13C 4TSSA 3I4LA 3SHLA 3PUXA 1RD9D 1OO9B 4WRDA 5J39A 1DONA 1E0BA 1E2WA 1A2TA 5CR3A 1HTLD 2LMCB 1EU4A 1SBBB 4QIWB 4DK1A 1EY8A 3KUPA 1E2ZA 2TMPA 1G6ZA 1SNMA 4GZYC 2KJXA 3G6JB 3MXNA 5JEAH 1PDQA 5A2QE 5CYUA 4L6TB 1EY6A 1G291 2EOTA 3TP7A 2EYFA 2NVXB 1R4PB 3RUZA 1XTCD 4MIUA 3VYSA 2MP1A 1PRTF 3E0JA 1V1OA 1CK1A 3MAQA 4XT3B 1PMRA 4J8QA 4AYBB 2R6GA 1ESRA 2H4OA 1B9NA 1LT4D 3ND9A 3K5MA 2BCOA 4KK7A 5C4HA 4ULLA 3OHXC 4K6DA 1HPCA 3URYA 2JA6B 1PRTC 4QUCA 2CHBD 1Z6HA 2KCNA 3VYRA 3TP6A 5ELEA 3HOYB 1MGSA 1CI3M 4M8AA 3DWPA 1JORA 4FXKC 1U4RA 4FF1A 3DEPA 1SE3A 4DK0A 1PTOB 2N88A 1CZWA 1PRTD 2AWNA 5T1IA 3CRKC 4RGTA 1Q3LA 1WTXA 3A56A 4KY7A 3BS1A 2BA0A 3A8KE 2FMMA 3HEJA 1F2LA 2EYLA 5CV4A 2F0FA 4C56C 3P75A 5CBAE 4G4KA 5IT9L 1O7ZA 5E1FA 3PUYA 3VYUA 2CQAA 1VCIA 4HCEA 3H94A 5JEAG 4BS9A 2HQEA 2ZXOA 1ZKOA 4XQNA 1FR3A 4HMJA 2L5TA 4E6IA 3R2IA 1F9RA 1CHPD 1LO5D 4KJOA 3NQTA 3T56B 3EA6A 1MI2A 4A3IB 3K5LA 3AU7A 1TWGB 4FF2A 2K32A 4KD4A 4IQZA 1BNZA 1A3UA 3X3MA 4A3GB 3CHBD 4QB4A 3PO3B 2A6ED 1Y8PB 2WV6D 1RF2D 1TKWB 3GTGB 2B2UC 3LWEA 4EVOA 3G7LA 1EIGA 2D5DA 2OEOA 3KK7A 3GQBA 2Q8RE 1B44D 2K28A 4H7BA 4Y7NB 2WB1B 1RODA 2D9UA 1YNJD 4RGMA 3NWSA 2L9HA 4ILWA 3AMUA 4RKBA 3SK5A 1H9SB 3GP7A 2RDHA 2QCPX 3D3RA 1ZXTA 4A93B 1WTRA 2OF1A 5JVH3 1WTWA 1LT3D 4C3JB 4RCOA 2KQ3A 1PZID 4IFDH 1HUMA 5LHY1 1R9TB 2F3WA 4CJ1B 1I4GA 2MJ8A 2BE5D 3R8BA 3C2PA 4KTAA 4J6HA 2E76C 4S3SA 4ZQ3A 3PUVA 3T13A 4ZUIA 3I90A 2PW7A 5EPLA 4OHJA 3PV0A 4ODGA 1PFBA 5IGDA 2MHVA 3W3AA 4C1NI 4ID6A 2A68D 3M4OB 3L3OC 2F0DA 4ZK9B 2WACA 1TS5A 5NUCA 2F0JA 4FF4A 5C0XJ 1IYUA 2EVBA 2PCFB 1F77A 1EEFD 4HMIA 1NSNS 1GUNA 5D65A 5IT9E 3SE0A 2ID0A 5ELCA 2V4DA 5KNDA 1SNCA 1SJED 2E2DC 3NTHA 2A74C 1ILQA 3D4RA 2QKIC 1NR4A 2YU9B 3RMHA 1WVLA 5FLXE 1R4QB 2XNAC 5DM73 1B50A 2EYPA 1JOKA 3TMEA 1IL8A 3ITPA 4ZKBB 4HN7A 2M9VA 3HG9A 5JVG3 4C2MB 1QG7A 5EQ0A 3FVQA 1LTSD 3J7AV 4PMBA 3MC0B 2HUGA 4HSVA 3NTKA 1KTKA 1STAA 2X6GA 3HKZB 1HQMC 1ZYRD 2E75C 5KRUA 2L0CA 4HCSA 1B53A 1WCMB 5IGCA 5C5MA 4PMWA 1G2TA 1D5XC 1SYDA 1SSOA 2F0PA 1JWMD 3NPPA 2RDFA 3PUWA 4KKSA 5I2XA 3ERQA 1M8AA 3GTPB 5G3LD 1B2TA 1V8QA 4RKLA 3VR6A 5CMDA 4IUVA 1SFOB 1HQRD 1PTOH 3HS0C 4HR7B 2K04A 4X3TA 3GTJB 3BYYB 1EWCA 4U673 4YIJA 5M9OA 3S1RB 1D1KA 3D4DA 3J80E 2QEJC 5IGBA 1JR0D 2I46A 3GD7A 5DM63 2J7ZA 4DGZA 1Y69U 5TSSA 3D8GA 4RHSA 2TSSA 2K03A 4NKLA 1W6KA 3QWNA 2F0GA 2JSOA 5E4XA 2F0WA 2F0QA 1DZ1A 1LTAD 5ELFA 2G9DA 1SE4A 3P1HA 1EY7A 1QNKA 2WIIB 2B2VC 1JOQA 1EOTA 2AWOA 1SXTA 1I4HA 1CTMA 4ZYSA 4K8IA 3ONAB 5C0XI 1FYCA 1KDBA 4FF3A 1STEA 2G9HD 3GO5A 1HCZA 1X32A 3BVZA 3HOVB 5IGGA 1V43A 2K5WA 2B2VA 1KNAA 2L4NA 1NR2A 1IW7D 1EYDA 2XIWA 4IN3A 3J81L 2VB3X 2AQ1B 1DYQA 1IKLA 1RTOA 3D4WA 4G57A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SYF A;  3TP7 A;  2EYF A;  5KGU A;  1SYC A;  3OSO A;  5EGT A;  4ODG A;  3RUZ A;  2RBM A;  4HMJ A;  1TT2 A;  5IGD A;  5IGF A;  2KHS A;  2O4X A;  4MIU A;  4OL7 A;  4IAL A;  3ERQ A;  5EKL A;  4TRD A;  4E6I A;  4ID6 A;  4KJO A;  2F0O A;  5IOD A;  2EY2 A;  2SNS A;  3NQT A;  3MEH A;  5DAU A;  3MVV A;  1STN A;  5CC4 A;  5KYI A;  4RKL A;  4R8N A;  5C3X A;  4QF4 A;  4N9T A;  4ZUJ A;  5IIF A;  2F0D A;  3C1F A;  3NUC A;  2WAC A;  4KV6 A;  4F7X A;  1TQO A;  1EYA A;  5KIX A;  5CV9 A;  5NUC A;  2F0J A;  5CGK A;  1EY5 A;  4KHV A;  4B9X A;  3NP8 A;  4KD4 A;  1SYE A;  3VA5 A;  4I65 A;  4PMC A;  1SNO A;  5I6W A;  2EYH A;  2RKS A;  3QOL A;  4HMI A;  1KDA A;  1RKN A;  2F0S A;  1A3U A;  1SYB A;  4KY6 A;  1U9R A;  5JAV A;  1NUC A;  1NSN S;  4K2K A;  4YIJ A;  5M9O A;  3OWF A;  4NDX A;  5C4H A;  5C4Z A;  1EZ6 A;  1EY4 A;  1STY A;  3D4D A;  3DHQ A;  4QMG A;  4WOR A;  5J1Z A;  1SNC A;  3SK4 A;  1A2U A;  4K6D A;  1F2M A;  4EQN A;  2F0E A;  4ME5 A;  4QB4 A;  2F3V A;  1SYG A;  3SR1 A;  5IGB A;  1EZ8 A;  4KD3 A;  1ENC A;  3SK6 A;  3NK9 A;  5I9P A;  2SNM A;  2EY1 A;  1STG A;  1TR5 A;  4NP5 A;  3OMG A;  4F8M A;  3C1E A;  1EQV A;  1EY0 A;  2F0I A;  5DEH A;  4K5W A;  1A3V A;  2EYP A;  1JOK A;  1SNP A;  4DGZ A;  4EQP A;  3TME A;  3D4W A;  3D8G A;  4IUN A;  3MZ5 A;  3OMC A;  3TP8 A;  4EVO A;  2F0M A;  2QDB A;  4NKL A;  4IZ8 A;  2PW5 A;  3ITP A;  2OEO A;  4N9P A;  3TP6 A;  4DU9 A;  5HGT A;  5KYL A;  3PMF A;  3SK8 A;  2F0G A;  4KJN A;  4KY5 A;  1AEX A;  4B9W A;  5I9O A;  2EYO A;  4K2L A;  5I6Y A;  5C5L A;  2F0W A;  2F0Q A;  3H6M A;  2F0V A;  2ENB A;  2EXZ A;  5CV7 A;  4H7B A;  4K8J A;  5EKK A;  2PZU A;  5IGE A;  3MXP A;  1JOR A;  3R3O A;  2EY5 A;  1KAB A;  4PMB A;  3TP5 A;  3NXW A;  3DMU A;  3P1H A;  2PQE A;  1EY7 A;  5IOC A;  1JOO A;  2EYM A;  3E5S A;  4J1M A;  5J22 A;  2F0H A;  4LAA A;  3BDL A;  3SXH A;  3T16 A;  2F0U A;  3EJI A;  4RKB A;  3SK5 A;  1JOQ A;  1F2Z A;  1SND A;  3NHH A;  3QOJ A;  5CV5 A;  3SHL A;  5KEE A;  4HTH A;  1STA A;  1SNQ A;  2EYJ A;  3BDC A;  4WRD A;  3D6C A;  5J39 A;  2M00 A;  4K8I A;  1II3 A;  4DFA A;  1IHZ A;  1STB A;  1A2T A;  2OF1 A;  4KY7 A;  5CR3 A;  5JOB A;  1KDB A;  5KRU A;  4PNY A;  2PYK A;  1KAA A;  3HEJ A;  2F0L A;  2EYL A;  2LKV A;  3HZX A;  3MHB A;  2KQ3 A;  2PZW A;  5CV4 A;  5E3F A;  3ERO A;  3QB3 A;  1STH A;  4K5X A;  2F0F A;  1KDC A;  2PZT A;  5F2D A;  3P75 A;  4DF7 A;  3T13 A;  1EY8 A;  2F0T A;  4K14 A;  1EY9 A;  5IGG A;  4EQO A;  5C3W A;  3S9W A;  2NUC A;  1A3T A;  5K5P A;  5CV6 A;  3LX0 A;  2F3W A;  5E1F A;  3V2T A;  5IGC A;  5C5M A;  5ISR A;  1SNM A;  2OXP A;  5C6A A;  4NMZ A;  2PW7 A;  1EYD A;  5HUR A;  4KTA A;  1SYD A;  2F0K A;  4K5V A;  4J6H A;  2F0P A;  2F0N A;  5CV8 A;  4S3S A;  3U9O A;  1F2Y A;  2SOB A;  4ZQ3 A;  2HQE A;  2RDF A;  1ENA A;  4ZUI A;  2EY6 A;  3EVQ A;  1EYC A;  4G57 A;  1EY6 A; 
#chains in the Genus database with same CATH topology
 3MXG A;  3RZO B;  4U68 A;  4OIK A;  4CBV A;  2A73 B;  1D7Q A;  1UE6 A;  2JEA I;  4MZ9 A;  4DNT B;  3MEH A;  4V0B A;  2HIX A;  1D6E C;  1TY2 A;  4HED A;  3NTI A;  2PI2 E;  3C1F A;  2DGY A;  1EEI D;  1N36 Q;  2IX1 A;  1EYA A;  4DNR B;  3JAM L;  1LAC A;  4Q0F A;  4BBS B;  4A3J H;  1PTO C;  1G91 A;  1OXT A;  4CDC C;  1KDA A;  3TRZ A;  1Z9F A;  2A8V A;  4NDX A;  1CQF A;  1E3P A;  1QB5 D;  1CQV A;  3AQQ A;  2Y0S G;  5M5Y H;  1QZH A;  1HR0 W;  3S16 H;  3S17 B;  4LUO A;  2B2Y A;  2R7Z H;  3QG1 A;  3CP0 A;  2JXM B;  5LMN L;  2R92 G;  2CH4 A;  1ENC A;  1EYG A;  3K7A B;  2D62 A;  2AQ3 B;  2RHQ B;  2AUJ D;  4A93 H;  2RVL A;  3TP8 A;  2PW5 A;  4BBR B;  2EE1 A;  3S1N B;  3SK8 A;  3FPP A;  1C8C A;  1DOM A;  3UE1 A;  2PMZ B;  1N33 L;  2I5M X;  4CJ0 B;  1RCV D;  3CCV A;  2HQL A;  1TY0 A;  5FOB B;  5ELO A;  4RWS C;  3E5S A;  5J22 A;  1E7Z A;  3T16 A;  1O80 A;  2D0O A;  3NQI A;  5IYD G;  1SND A;  3QR8 A;  4A3K G;  4POG A;  3GTK B;  1M90 C;  3BDC A;  4HJA A;  3R2T A;  1H9J A;  2K6A A;  1SE2 A;  4IPH A;  1CM9 A;  3T1Y Q;  3PUZ A;  1UUP A;  4IFD J;  3QB3 A;  1KDC A;  4H44 C;  1MSH A;  1RDP D;  4X3U A;  1E2V A;  2OTJ A;  3EN2 A;  5ELN A;  1BCP D;  3DWQ A;  3E6Z X;  2E74 C;  2EQS A;  5EBC A;  4JI1 Q;  3RR5 A;  3CCJ A;  2MQH A;  3RZD B;  1RHP A;  2B8G A;  4B3S L;  3U9O A;  4NPS A;  3EVQ A;  1M1K C;  1PH2 A;  1VF7 A;  3VR3 A;  1SYC A;  5EGT A;  1TWC H;  2DJG C;  1JB7 A;  1TT2 A;  2LFN A;  4IPC A;  4IAL A;  2K5H A;  5C4X G;  2ZTC A;  1SMY D;  3WOF A;  4LJZ C;  2NVX H;  3PIO 3;  3M4P A;  3UDF A;  2FIN B;  4C3I H;  1MD2 D;  3K6O A;  1SEB D;  1FNV A;  4OEM B;  3GTM B;  5CGK A;  1GUG A;  2F03 A;  3W5O A;  4GLX A;  1CUK A;  1VQL A;  1H9K A;  4N8F A;  1TWF B;  1SYB A;  2AQ2 B;  5JAV A;  1B1Z A;  5JPM C;  1PVO A;  1AN8 A;  4DR5 Q;  4JW0 A;  3GTK H;  4A4I A;  3DHQ A;  2AMC B;  2R92 B;  2K1B A;  2KUM A;  1XWE A;  2H5X A;  2R61 A;  3SR1 A;  3J7A 5;  4DUZ Q;  1XJV A;  4DV4 L;  3J81 E;  2UUB Q;  5T1G A;  1HFG A;  4CDD C;  1FNW A;  1JJ2 A;  2F0I A;  4C3I G;  1SNP A;  3VA7 A;  4C3H H;  2I07 B;  5GAH C;  5M5Y B;  1CT1 D;  2JA9 A;  4OEL B;  1D2B A;  1EQQ A;  4KY5 A;  2XN9 C;  4B9W A;  1YNN C;  2RSN A;  5I9O A;  2CW0 D;  3J80 L;  3HRZ C;  4H0L C;  3QIA A;  3FEW X;  5C5L A;  1IW7 C;  3AYH B;  5CV7 A;  1CKN B;  4BWG B;  1X56 A;  2MPM A;  2VQF Q;  1VQ9 A;  4HIM A;  3GTQ B;  1PYW D;  1XPU A;  1C9O A;  2R3Z A;  3VR2 A;  4LAA A;  4JI2 Q;  4UAI A;  1F2Z A;  1QUQ A;  1L1O A;  2RA4 A;  2HDL A;  3L7Z C;  2H1E A;  5EBD A;  1ILP A;  1XNQ Q;  4A3L H;  4OIJ A;  4L5T A;  4PNY A;  1JWU D;  4FVM A;  4IOC A;  1X9N A;  2C9O A;  2Q2T A;  4DF7 A;  4XXE A;  1V1P A;  1A3T A;  3GTQ H;  3MFG A;  4P73 A;  1HR0 Q;  4JI7 Q;  3DXJ C;  5C6A A;  3N6R A;  3K58 A;  4RCN A;  3A54 A;  4K5V A;  3S1Q B;  3OW7 A;  2BOS A;  4X3K A;  2BDO A;  3A8J E;  1X3Q A;  4P75 A;  1SYF A;  1S5C D;  3CCL A;  4B3R L;  5C0X G;  4IUQ A;  4ABN A;  4GN3 B;  3UDG A;  5FO9 B;  1Q81 C;  4Y52 H;  4UP9 A;  1W6J A;  5DAU A;  2CCZ A;  4HID A;  5C3X A;  1Y1V G;  4DR2 L;  1T5X D;  1GUT A;  1TQO A;  4C3I B;  4ZKC B;  4IPD A;  1DJR D;  2XWJ B;  3A8I E;  1P16 A;  4ZLT F;  1TS4 A;  4DV5 Q;  2UXC L;  3CPW A;  2KEC A;  1DGS A;  1NUC A;  2B2T A;  2KED A;  1VS0 A;  1BR9 A;  2JA6 G;  1DM0 B;  1EZ6 A;  3Q23 A;  1STY A;  4WFN 3;  3WDN A;  3R93 A;  1EWH A;  3CD6 A;  5AFW A;  4ME5 A;  5H1S E;  1CA6 A;  2CQO A;  3BYT B;  1Q90 A;  5I9P A;  4LF7 Q;  1SAP A;  2EY1 A;  4DAM A;  4F8M A;  1L0Y B;  1EQV A;  2JQO A;  4EQP A;  1IBM L;  2GA4 B;  1N33 Q;  3J7A F;  3DM3 A;  5KYL A;  3DM1 A;  3F1Z A;  3U4V A;  4LUV A;  1V1Q A;  1SLJ A;  3PMF A;  2WKD A;  1SDF A;  4JBJ A;  5A2Q L;  2ICE C;  1IBK L;  5EKI A;  4AYB G;  2NN6 H;  1PH8 A;  4RH6 A;  2EXZ A;  1N32 Q;  3CAM A;  3V96 A;  3HKS A;  4GOP C;  3DMU A;  2EDG A;  2NTT A;  2VS1 A;  2Q8I B;  1LT6 D;  4JYA L;  1I5F A;  4A3E G;  5IYD H;  5KEE A;  3KDF A;  2JP1 A;  4AQY Q;  2N78 A;  2CWP A;  2VL6 A;  5HY6 A;  4QL5 A;  4X6A H;  1SMY C;  2ZJR A;  3J7Y W;  2CVR A;  4BY1 B;  3M7N A;  4JI0 L;  1CFM A;  1Y1W H;  1STH A;  1WCM G;  5F2D A;  4P72 A;  2F0T A;  1GOZ A;  1EY9 A;  2O5I C;  3KJO A;  1PFS A;  5D3I B;  2SDF A;  1T5E A;  4JBW A;  1K8G A;  1S4Z A;  1JQY D;  4H02 A;  4LFA Q;  4DXF A;  4R4Q A;  1A15 A;  4FYD A;  5HUR A;  2MO1 A;  3WOE A;  3J7Z C;  2F0N A;  1SRU A;  3FMC A;  1HA6 A;  1O7L A;  5KNC A;  2K5D A;  2Z4I A;  1K8M A;  1SJH D;  1E1T A;  4OO1 H;  1UWV A;  1KRS A;  3HOX B;  2D2C C;  2QA4 A;  1FGU A;  2Z6B A;  2HCC A;  1YJW A;  3K57 A;  2R7D A;  1FL0 A;  5FO7 B;  4ZAI A;  2BE5 C;  2HCI A;  5K36 G;  2XWB B;  3CQZ B;  3I2Z A;  3K7A H;  5EPJ A;  4XIG S;  3MFY A;  4IUU A;  4CKC A;  4A3L G;  3PSI A;  4RMF A;  1IBL Q;  4KV6 A;  1EFI D;  4C1N K;  1Q1B A;  1CSQ A;  1Z47 A;  2CW0 C;  1PFN A;  3O13 A;  4KHV A;  1VQ8 A;  4DV3 L;  3I4M H;  3VA5 A;  4I65 A;  1KHI A;  1FNU A;  3GV3 A;  3KLS X;  5D14 A;  5C4J B;  4B3M Q;  2Y0S B;  1EY4 A;  3SK4 A;  3T1Y L;  4A3D B;  2A69 C;  3F2C A;  1EOV A;  3BZC A;  3DEO A;  3H15 A;  1H9R A;  1EZ8 A;  2JA5 B;  2K7V A;  4LF8 Q;  4KHZ A;  1C48 A;  5AJ3 L;  1JMC A;  2SNM A;  4IUT A;  1ICW A;  1KNE A;  3KF6 A;  3TZD A;  3C3L A;  4XYQ A;  1EY0 A;  3STB C;  4K5W A;  2E2H B;  1I4P A;  3TN2 A;  3NE5 B;  3E9I A;  4RGN A;  3M3Y H;  1I4R A;  3I4N H;  4OGQ C;  2DY8 A;  1QVG A;  2B8F A;  2L1B A;  4K2L A;  5I6Y A;  1TXY A;  4JI3 Q;  3MXP A;  1AW7 A;  2ZJQ A;  2A1A A;  4FNF A;  1Q12 A;  1WTO A;  2L11 A;  2VQF L;  3IFD A;  3H0G B;  1YIJ A;  1QCB D;  4JI4 Q;  1JOO A;  3UI2 A;  2IT1 A;  2X6L A;  2XTI A;  2E2H H;  1MIU A;  1JWS D;  2EYJ A;  1MBY A;  1M4V A;  2WKC A;  1I6V C;  1STB A;  1XMQ L;  2OCE A;  4L5Q A;  1XX8 A;  5IWA Q;  2NYZ D;  3EIV A;  3HZX A;  3RLF A;  3GTO H;  3HOW B;  3TSS A;  1IBM Q;  1WYD A;  4B3T L;  3I91 A;  2UU9 L;  2HHH Q;  3X3N A;  3EFX D;  1QIL A;  1UEA B;  3V2T A;  3S1M H;  2L12 A;  5ISR A;  2OT2 A;  4C3J G;  2XVS A;  3FPU B;  4A3E B;  1ICF B;  5ELD A;  1OXU A;  1AH9 A;  4A93 G;  1ENA A;  5I2Y A;  2NB0 A;  1U4L A;  4C3J H;  1IYV A;  2PNR C;  2VUM B;  1XPR A;  5JPN C;  3IKJ A;  2PPB C;  1VQO A;  2IJ0 A;  4TKO B;  2F3I A;  3MVV A;  2NVQ H;  3H3V C;  4JOI C;  3VDY A;  1BO0 A;  4DR2 Q;  1HUN A;  1X65 A;  3CC2 A;  3TS2 A;  1YNJ C;  3S14 B;  3K59 A;  3L0O A;  2ICI A;  2KEE A;  1LTG D;  1BDO A;  5IY0 A;  2GVA A;  4X62 Q;  4P2C B;  4HJ8 A;  2K01 A;  4ZRZ A;  3M7G A;  1PLF A;  4J15 A;  4IO9 A;  2JA8 H;  3J80 c;  1QVC A;  4KHP L;  4LFA L;  4GKK Q;  2QEX A;  2J4X A;  4EX5 A;  4IFD G;  5KNB A;  2Z8L A;  1Y1W B;  1XXG A;  1VF5 C;  3PO3 G;  1IZ6 A;  2JEB I;  4OWT B;  1TWF H;  3SK6 A;  4CKB A;  2VQE L;  2NTS A;  5IYC G;  2EXD A;  5DEH A;  4DUZ L;  5FLM G;  3VR5 A;  4AH6 A;  1FGB D;  2EZV A;  1Y1V B;  1B4O A;  4DNI A;  3A7A B;  1I6H H;  3A55 A;  4DR6 L;  3PIP A;  1PH9 A;  3S15 B;  5IGE A;  1OXV A;  2KBN A;  2JYO A;  4YHH Q;  1O7Y A;  2R7F A;  3R3O A;  1TWC B;  3NBH B;  3P7J A;  2A68 C;  4DV0 Q;  4JI2 L;  1U5K A;  3SXH A;  1H9S A;  3EJI A;  5FJ8 H;  4DK3 C;  2FJ2 A;  4MTK A;  1QUQ B;  3A7L A;  3OWE B;  4LF9 L;  4CGY B;  4LMQ D;  4R4I A;  1S40 A;  1K83 H;  4NXN Q;  1YNN D;  1KLG D;  1LV9 A;  2PZW A;  5E3F A;  1VQH A;  4K5X A;  3BVG A;  2PZT A;  2JE6 I;  4XDX A;  3S2D H;  1PTO D;  1YZ6 A;  1D5Z C;  3FKI B;  1GHK A;  4R1J A;  3HKZ G;  4DV4 Q;  4UPA A;  1I6H B;  2E5L L;  3FDT A;  1Z7T A;  5FLX L;  3BG3 A;  4XYO A;  4RGO S;  1KC8 C;  2LS0 1;  3K5N A;  4GKJ L;  2F0O A;  1X3P A;  3AEV A;  2BH8 A;  1L0X B;  1XMQ Q;  4R8N A;  4JYA Q;  1CHQ D;  4PV1 C;  3IL8 A;  1X3F A;  4MN3 A;  4A3M B;  5GAD C;  3NP8 A;  4UDU C;  2IL8 A;  4BY1 H;  3PCO B;  1SNO A;  4IUP A;  1QVF A;  2ZTE A;  3NSW A;  3QOL A;  2DN8 A;  2XSC A;  3G6E A;  2F0S A;  3E9H A;  2NVY B;  1JCK B;  5M5W H;  2Z6K A;  4ALP A;  4CJ2 C;  1WTP A;  1F9P A;  2QIL A;  1QWY A;  1Y8O B;  1S5F D;  4RHR A;  1JC7 A;  1IKM A;  4QMG A;  3KF6 B;  3T1H Q;  3W2D A;  1A2U A;  4NW2 A;  4DR1 L;  3CMA A;  5JJI A;  2B63 B;  4X66 L;  4LF7 L;  1BUV T;  1I3Q B;  1TR5 A;  1HNW L;  4KKT A;  4BBS H;  3I70 A;  1RJT A;  1WTH A;  4IUN A;  1TII D;  1L1O C;  1ZYR C;  3MZ5 A;  3KFU A;  2QDB A;  1B70 B;  3NWT A;  4N9P A;  1JB3 A;  3Q22 A;  2Z6K C;  2AKW B;  1WOC A;  1QE6 A;  4HJ5 A;  5C4X B;  4A3B H;  3RNU A;  2ENB A;  2PQE A;  5IOC A;  1ET6 A;  5IT9 c;  3U4Z A;  2ALY B;  2N49 A;  2F0U A;  2B2W C;  4DV3 Q;  3KLS A;  2ZJP A;  3QOJ A;  3S24 A;  1GVP A;  3HOW H;  1SNQ A;  4R8I A;  1U4P A;  1K3B C;  1IHZ A;  1HNZ L;  4A3E H;  3LGJ A;  1GHJ A;  1ESF A;  2F0L A;  4B9X A;  1BF4 A;  3Q24 A;  4A3C G;  3ERO A;  1B9M A;  5CBE E;  1PTO F;  4B08 A;  4Z9C B;  5K5P A;  2B2W A;  3K0Y A;  2OXP A;  1V9P A;  3GV6 A;  4A3K B;  5C0X H;  1UEB A;  4BY7 B;  1Q46 A;  1PZJ D;  2IW3 A;  3HGB A;  1N8R C;  3U9S A;  1CSP A;  5DNF A;  5KIX A;  2WFW A;  3MWY W;  3OSO A;  3I72 A;  2A6H D;  1I94 L;  2WB1 G;  4L8J A;  2WP8 J;  3S1Q H;  5LL6 S;  4RG1 A;  1KXL A;  3RN2 A;  3N52 A;  4UY8 C;  3E3X A;  4BBR G;  4LF4 Q;  4BA2 I;  1KRT A;  4RA8 A;  1PA6 A;  1N36 L;  1GUS A;  1SN8 A;  3SVM A;  4XQJ A;  3A74 A;  4HJ9 A;  2IHE A;  1A62 A;  1X55 A;  2B63 H;  2E2I B;  1K28 A;  4GN4 B;  1N34 Q;  4F88 A;  2RQX A;  5C4Z A;  3I4M B;  1ML0 D;  2V1C C;  1C4Q A;  1IYJ B;  3KYH C;  1MJC A;  1SRO A;  2JA7 H;  3NEL A;  1PFM A;  2UUB L;  4POF A;  4NP5 A;  4XTC S;  2RDG A;  4A3M H;  3OMC A;  2VY3 A;  3M9B A;  4UP7 A;  5IYB G;  5HGT A;  1SFO H;  4G7Z C;  1GM5 A;  2GN5 A;  1LM0 A;  2KHJ A;  4BA1 I;  4LF5 L;  5M5W B;  2PI2 A;  1JE4 A;  3M85 A;  4CHT B;  4WJ4 A;  2UUA L;  2PMZ E;  1LTB D;  1GKH A;  5M3M H;  2K5Q A;  2LXK A;  2UXC Q;  1DD2 A;  3S1N H;  4F87 A;  5IP9 G;  4DAP A;  2O5J C;  4QJF A;  4IPG A;  2NVT H;  4WJW A;  5CV5 A;  1LYL A;  1S5B D;  4JG2 A;  1EU3 A;  1QNU A;  1O78 A;  2NBF A;  4XQQ A;  3JAM E;  4YWM A;  3S2H B;  1DXM A;  4GKK L;  4LF4 L;  3I7F A;  3IFT A;  1W2B A;  3A0J A;  5LL6 X;  2R7Z B;  2PYK A;  1KAA A;  2VNU D;  3S2D B;  1KQS A;  3LWU A;  1PH7 A;  2MGS A;  3S16 B;  3BJU A;  2I0Q A;  4JPB W;  4K14 A;  2XGT A;  2RCN A;  1VQN A;  2WIN B;  2R93 B;  3BVM A;  2WAQ B;  2L55 A;  3LX0 A;  1BCP B;  4MNO A;  1HNX Q;  2A6E C;  2F0K A;  1GUW A;  3I56 A;  1TS3 A;  1TU2 B;  1AE3 A;  3OIQ A;  1CZG A;  2EY6 A;  1TWA B;  2VXW A;  3IRB A;  1K83 B;  4KMU C;  2KHS A;  4OL7 A;  2RCF A;  3QJY A;  4IUR A;  4UHV A;  3DUZ A;  3U58 A;  5FK9 C;  4C2M H;  5IOD A;  2SNS A;  5M3F B;  2NWG A;  5KYI A;  3HOY G;  2E2J B;  5M3F H;  2DUD A;  3QO2 A;  5COY A;  1HNZ Q;  2JA8 G;  1JJG A;  5IE8 A;  3NBH A;  3U50 C;  3Q6S A;  1P8L A;  4DA2 A;  2C5C A;  1HFN A;  5CV9 A;  4X62 L;  2Q2U A;  4HAE A;  2K50 A;  1EL0 A;  1IL2 A;  1E22 A;  3F2D A;  4KHP Q;  1RKN A;  1HTP A;  3KBX A;  3CF5 A;  3ZYY X;  3RZD H;  4R4C A;  2K5N A;  1L0W A;  4JV5 L;  1TVX A;  5G3L F;  1VQJ A;  4EQN A;  1DCZ A;  2CH4 W;  2A19 A;  1LTI D;  3H91 A;  3JAM c;  2F4V L;  3OOC A;  2IWH A;  1AZQ A;  4PQX A;  2D0P A;  1XYI A;  4R9W A;  2E5L Q;  3C46 A;  1HNW Q;  2FMC A;  1A3V A;  3S2H H;  2NZ1 D;  1A6X A;  3OPO A;  2F0M A;  4DUY Q;  2HHH L;  4QIW E;  5C3E G;  2NVQ B;  1W3S A;  1KLU D;  1BCP F;  2NVT B;  1G2S A;  2EYO A;  4CDE C;  4CDF C;  2F0V A;  5EKK A;  2YTY A;  4A3B B;  2KVM A;  2JA8 B;  4PG3 A;  5FO8 B;  4OO1 G;  1KAB A;  5M3M B;  2XRQ D;  5M3F G;  2SEB D;  4GLV B;  2B2Y C;  3NHH A;  1I4Q A;  4DR3 Q;  3HKZ E;  1V1P B;  4GLA C;  2NZH A;  4DFA A;  1DOL A;  4KN4 C;  1R9T H;  2VUM H;  2DY7 A;  4CKE A;  1C0A A;  1KL9 A;  2VB2 X;  3A5Z B;  2WAQ G;  2XRS D;  4JCV E;  1XNR Q;  1GUO A;  2R93 G;  2A5H A;  2NVY H;  1C7Y A;  4LK1 C;  4EQO A;  4HSP A;  3GTJ H;  1U4M A;  1BOS A;  2K14 A;  3DWA A;  5CV6 A;  1J9O A;  4L5S A;  4X3S A;  2MUY A;  1WTV A;  4I7Z C;  1Q8I A;  1J8I A;  1I50 B;  3OYY A;  3DLL A;  4QY7 A;  5FLM H;  1VDZ A;  1VQK A;  2JJQ A;  2QF7 A;  3GTO B;  3D0F A;  3K7U C;  3AB9 A;  2EJG C;  2EY2 A;  2KEN A;  3I55 A;  3CCQ A;  1ONL A;  1K8A C;  1STN A;  1D1I A;  5K36 H;  1GJX A;  3KBG A;  4QF4 A;  4ZUJ A;  3K81 C;  5JEA J;  2DJF C;  2DNC A;  4C3H B;  3MTS A;  2EYH A;  1UNS A;  2RKS A;  5COR A;  4FO2 A;  1EQT A;  2JA5 H;  1VQD A;  4KY6 A;  1U9R A;  1PH6 A;  5LMU L;  1ASY A;  3PO2 G;  2EIF A;  3OWF A;  3ULP A;  1NJI C;  3M3Y B;  5M5X B;  1ZEQ X;  5J1Z A;  4GNX B;  4NXM Q;  2F0E A;  3AFP A;  1HZB A;  2F3V A;  4LF9 Q;  4R4T A;  3NK9 A;  4TVA B;  1PV4 A;  1NNX A;  3OMG A;  4BXX H;  1WD1 A;  3C1E A;  3Q0A A;  2E8G A;  1D5M C;  4YWL A;  4V19 0;  3D6W A;  5I4D A;  1YHB A;  4L63 B;  2UUA Q;  3RLN A;  2B2T C;  4IZ8 A;  4DU9 A;  3SEB A;  3M4Y A;  4LF5 Q;  4XT1 B;  2CWA A;  4KJN A;  4JI7 L;  4TQU S;  3GTL B;  4K6L A;  2B29 A;  4K8J A;  4FP5 D;  3HOU H;  4RAU C;  2EY5 A;  1XMO Q;  5ELB A;  3TP5 A;  3PIO A;  3TDQ A;  3HOX H;  2UXD Q;  1LTT D;  2IX3 A;  2OQ0 A;  1JIC A;  4FXG C;  2KA7 A;  4HTH A;  1ASZ A;  2Z1C A;  2Q8T A;  1II3 A;  2NN6 I;  1I4X A;  1TS2 A;  4BY7 G;  3S15 H;  4DV6 Q;  1AZP A;  4AIM A;  1VMC A;  2WAQ E;  2ES2 A;  3HOZ B;  1YJ9 A;  4DV6 L;  4FXD A;  3S1R H;  2RHS B;  5GAG C;  4JI1 L;  3GDE A;  1LTR D;  1OXS C;  3TZU A;  3I4N G;  3GTP H;  4OWW B;  5CV8 A;  1LLR D;  1F2Y A;  2SOB A;  1G8Z D;  1HXY D;  3S14 H;  3PF5 A;  1EYC A;  5JOB A;  5KGU A;  4LF8 L;  3HOZ H;  3BDO A;  4O42 A;  2ZXP A;  2RBM A;  1I94 Q;  1F9S A;  5IGF A;  1A8V A;  2OTL A;  5EKL A;  1BBX C;  2LY7 A;  4DXG A;  1ENF A;  4DKA C;  1WTQ A;  5DLQ E;  2UUC Q;  4QUF A;  1BXT A;  1WCM H;  3CME A;  2X69 A;  3I8Z A;  3CCU A;  3ND8 A;  1EQR A;  4RFB A;  1YI2 A;  1N32 L;  3HOU B;  3VYT A;  1IBL L;  2NN6 G;  3IAY A;  1EIH A;  4A3G G;  3KF8 A;  5EPK A;  3TBI B;  4A3J B;  2ZXR A;  1NMG A;  2PQA A;  4DAV A;  1HHV A;  1SYG A;  3EQL C;  1K73 C;  2KOL A;  2IPK D;  1WJJ A;  3P20 A;  3NEM A;  2UXB Q;  3S1M B;  1NMF A;  1EIY B;  3PO2 B;  4DAY A;  1PH1 A;  1H9M A;  4IJL A;  5LMN Q;  4EGV A;  3K5O A;  4A3I G;  4X65 Q;  1NAP A;  2ZM6 Q;  4B3S Q;  4QCL A;  4JBM A;  3RZO H;  3OIP A;  1HA5 A;  5IP9 H;  2AUK A;  1SE8 A;  2BA1 A;  2ASB A;  2MFI A;  4JI8 L;  1S5E D;  3F8T A;  4Y7N H;  1HJP A;  1PH5 A;  3F2B A;  1EWI A;  2ZTD A;  3T51 B;  4KKU A;  2EYM A;  2FHT A;  1O7I A;  4J1M A;  2F0H A;  3BDL A;  3VR4 A;  4MHE A;  3HP3 A;  1YNX A;  1GXD C;  1Y1V H;  5JJK A;  1LT5 D;  1BQQ T;  4DK6 C;  1A0I A;  3MA2 B;  5EAY A;  4JV5 Q;  3PO3 H;  1KAW A;  1CA5 A;  2A69 D;  1AFP A;  2EJF C;  3MHB A;  3PIP 3;  1CKN A;  3BZD B;  5LMN W;  3MXU A;  1WD0 A;  5E4W C;  3V05 A;  4DR4 Q;  1HR0 L;  1TWH B;  3SDZ A;  3TQY A;  4A3F B;  4HJ7 A;  4L5R C;  2J0T D;  5BN5 A;  1F9Q A;  4GKJ Q;  1XMO L;  4A3D H;  3STB D;  1EIF A;  2KCC A;  4JK1 C;  5C4J H;  2O4X A;  2IHF A;  2JN4 A;  3I4O A;  1B3A A;  4TRD A;  1ET9 A;  1VQI A;  2KHI A;  1I50 H;  2G5D A;  4OON A;  3K8A A;  5CC4 A;  3M4O H;  5EJW A;  5IIF A;  3CXC A;  5JJZ A;  3NUC A;  4AQY L;  3JAM i;  4JI8 Q;  4OO1 I;  1EY5 A;  1VMP A;  1S5D D;  5C3E B;  1VQP A;  1SYE A;  3FRP B;  5JJL A;  3CRL C;  2PO4 A;  3FHW A;  2DNE A;  5E7N A;  4K2K A;  3T53 B;  1LTL A;  1YVC A;  4G7O C;  4WOR A;  1F2M A;  3T4A C;  1GD7 A;  1K8O A;  2BDN A;  2F4I A;  1DOK A;  4DR1 Q;  1PRT B;  2I5H A;  4KD3 A;  1Y1W G;  1RL2 A;  1AP0 A;  2IX0 A;  4OXP A;  1OXX K;  1STG A;  1CKO A;  2IY5 B;  2O2L D;  4R4O A;  3MXN B;  1BCP C;  3RD4 A;  1IBK Q;  1JE5 A;  2Z4H A;  2ZT9 C;  5L37 A;  3D31 A;  1AEX A;  4P71 A;  4PZ8 A;  3GTG H;  1QOH A;  2PZU A;  4X64 L;  3I73 A;  1PYS B;  3KLR A;  3CKI B;  3NXW A;  2FFK B;  3CU7 A;  1HRJ A;  2A6H C;  2F1M A;  4A3G H;  4IOA A;  3I4N B;  1NTG A;  1NCV A;  3D6C A;  4LFC L;  3LNN A;  1GO3 E;  2M00 A;  1G51 A;  5AJ3 Q;  1PZK D;  2B2U A;  2Q2I A;  4M1U B;  1B7Y B;  3T1H L;  4DN4 M;  3I3C A;  2EJM A;  2LKV A;  3HOZ G;  1L2F A;  1TWG H;  4ME3 A;  2ZM6 L;  1XPO A;  5J3B A;  5FKA C;  2B39 A;  1MSG A;  2OQK A;  5C3W A;  4KN7 C;  2NUC A;  3S9W A;  4K0K Q;  3OTO L;  2E2J H;  3G4S A;  4NMZ A;  1VQ4 A;  5D3D A;  1MJE A;  4O1N A;  1LUZ A;  3L9A X;  1UAP A;  3J81 i;  1AE2 A;  1VQF A;  1YHA A;  3CQZ H;  2K33 A;  3CCR A;  1XNQ L;  4N9T A;  1RTN A;  5C44 G;  2JA7 G;  5FJ8 G;  4F7X A;  2K05 A;  1XTD A;  4B3T Q;  3H09 A;  4PMC A;  5I6W A;  3F2U A;  4X64 Q;  1QJO A;  4IFD I;  2N55 A;  4Q5V A;  2M2L A;  1VQA A;  2EPB A;  1JT8 A;  1LAB A;  2WB1 E;  4GN5 A;  3UDX A;  5LMU Q;  2KCT A;  1FD7 D;  1X3E A;  2KCM A;  4A3D G;  3I4M G;  4C3H G;  5BN3 A;  1Q82 C;  3H3V I;  4K0K L;  1Y8N B;  1Y14 B;  4NXM L;  2HDM A;  1HZC A;  5A35 A;  4GOP B;  1PXU A;  1VQB A;  2JA7 B;  5C44 B;  4KI0 A;  1Q1E A;  2RSO A;  3HOY H;  4G7H C;  2YYZ A;  2VW9 A;  1B3Q A;  2CFM A;  4GS3 A;  3H6M A;  4KLK A;  3NBI A;  5BN4 A;  4I7A A;  4H13 C;  4TSS A;  2K5V A;  3I4L A;  3SHL A;  2AHO B;  2CKZ B;  3PUX A;  1RD9 D;  3UE0 A;  1OO9 B;  4WRD A;  5J39 A;  4A3F H;  1DON A;  1E0B A;  1E2W A;  1A2T A;  5CR3 A;  1HTL D;  2LMC B;  1EU4 A;  1SBB B;  1SR3 A;  4GNX A;  4QIW B;  4DK1 A;  1HNX L;  1N34 L;  3H3V H;  1EY8 A;  3KUP A;  1E2Z A;  2TMP A;  2FXQ A;  1G6Z A;  1SNM A;  4GZY C;  3J80 i;  2HIV A;  2KJX A;  2YV5 A;  3G6J B;  3CCE A;  3MXN A;  5JEA H;  1PDQ A;  5A2Q E;  5CYU A;  4L6T B;  4APV A;  1G29 1;  3JC6 6;  1EY6 A;  2EOT A;  3TP7 A;  2EYF A;  5IYC H;  3M4Q A;  5M3M G;  1R4P B;  3RUZ A;  2NVX B;  1H95 A;  1HZ9 A;  1XTC D;  4MIU A;  3HFZ B;  3VYS A;  1JJC B;  2MP1 A;  1PRT F;  3E0J A;  1V1O A;  4PZ7 A;  4A3K H;  4OX9 L;  2JK8 A;  1CK1 A;  4YCV A;  2OWO A;  3E0E A;  3MAQ A;  4XT3 B;  1PMR A;  4J8Q A;  4AYB B;  4OX9 Q;  3EBE A;  2R6G A;  1ESR A;  2H4O A;  2ATW A;  1B9N A;  1LT4 D;  3ND9 A;  5FLX c;  3K5M A;  5C4X H;  2BCO A;  4KK7 A;  5C4H A;  4ULL A;  1TWA H;  3OHX C;  2B63 G;  3CCM A;  4K6D A;  1HPC A;  2QGQ A;  3KJP A;  1J6Q A;  3URY A;  1Q8K A;  2JA6 B;  4DR4 L;  1PRT C;  1VQC A;  4YWK A;  4FDB A;  4QUC A;  2CHB D;  1Z6H A;  2KCN A;  3VYR A;  1B8A A;  4O2D A;  4QQB X;  1K0S A;  1QZG A;  2QW7 A;  5ELE A;  3TP6 A;  3UDI A;  3HOY B;  1MGS A;  1CI3 M;  4M8A A;  4JI6 L;  3DWP A;  2BH2 A;  1VQ6 A;  4JI5 Q;  1D8L A;  3ULJ A;  1JOR A;  4FXK C;  1U4R A;  1K9M C;  4FF1 A;  3DEP A;  1SE3 A;  4DK0 A;  4BBR H;  4WJ3 M;  3TS0 A;  1PTO B;  2N88 A;  2L15 A;  4JVZ A;  1CZW A;  1VQE A;  4DV1 Q;  1PRT D;  2AWN A;  5T1I A;  4A3F G;  3CRK C;  4RGT A;  1Q3L A;  1WTX A;  3A56 A;  4KY7 A;  3BS1 A;  2BA0 A;  3A8K E;  4DAY B;  2K75 A;  2FMM A;  1OTC A;  3HEJ A;  1F2L A;  2EYL A;  5CV4 A;  5GQO A;  4P74 A;  2F0F A;  4LNQ A;  2R7Z G;  4C56 C;  3P75 A;  5CBA E;  3FKI G;  4G4K A;  2Q2H A;  5IT9 L;  4DR5 L;  1YJN A;  1PYB A;  1O7Z A;  3ULL A;  5E1F A;  3PUY A;  3OTO Q;  3VYU A;  4LFB L;  4LFB Q;  1E24 A;  1VCI A;  2CQA A;  1BBU A;  4HCE A;  3H94 A;  5JEA G;  4LF6 L;  4BS9 A;  2YTV A;  1K0R A;  2HQE A;  1VQ7 A;  3L2P A;  2ZXO A;  5BR8 Q;  5BR8 L;  1ZKO A;  4XQN A;  2C35 B;  4B3R Q;  1FR3 A;  4LF6 Q;  4HMJ A;  3G71 A;  2L5T A;  4E6I A;  2N3S A;  3R2I A;  1F9R A;  2NZO A;  1CHP D;  1LO5 D;  3AFQ A;  4KJO A;  2E2I H;  3GTL H;  4YCW A;  3NQT A;  1PH4 A;  3T56 B;  3EA6 A;  1MI2 A;  3FKI H;  1BBW A;  1X3G A;  4A3I B;  1S72 A;  1YBY A;  3K5L A;  3AU7 A;  4N8X 1;  1TWG B;  4FF2 A;  4YY3 L;  2K32 A;  2VZA A;  4KD4 A;  3TRE A;  4IQZ A;  2UU9 Q;  1BNZ A;  3B6Y A;  4LUZ A;  4DV5 L;  1A3U A;  1X54 A;  4ZCK A;  4JC0 A;  3X3M A;  3HOV H;  4A3J G;  1T9H A;  4A3G B;  1YHQ A;  3CHB D;  3PGZ A;  4QB4 A;  3PO3 B;  1XNR L;  2A6E D;  1Y8P B;  3HOU G;  2WV6 D;  1RF2 D;  1TKW B;  4DV7 Q;  3GTG B;  2B2U C;  3CCS A;  3LWE A;  1NBW A;  4NB3 A;  4EVO A;  3G7L A;  4DR7 Q;  1EIG A;  2D5D A;  2OEO A;  3KK7 A;  1HZA A;  3BU2 A;  3MEF A;  3GQB A;  2Q8R E;  1B44 D;  2K28 A;  2B3G A;  1A63 A;  3BZK A;  3A5U A;  4H7B A;  3PQI A;  3TEH B;  2WB1 B;  4Y7N B;  2N8N A;  1ROD A;  2D9U A;  1YNJ D;  4RGM A;  2UXD L;  3NWS A;  3KF8 B;  2L9H A;  4ILW A;  3AMU A;  4RKB A;  1X6O A;  3SK5 A;  1H9S B;  3GP7 A;  2RDH A;  4YCU A;  1YEZ A;  2QCP X;  2RF4 A;  3PO2 H;  3D3R A;  1ZXT A;  4LFC Q;  1WTR A;  4A93 B;  1NY4 A;  2OF1 A;  4DPG A;  5JVH 3;  1WTW A;  1LT3 D;  1UE5 A;  4C3J B;  1FVI A;  5GAE C;  4RCO A;  2KQ3 A;  1PZI D;  2PQA B;  4IFD H;  3G48 A;  1HUM A;  2Y0S E;  1RIP A;  5LHY 1;  1R9T B;  3S17 H;  1MHW C;  4JOI A;  2F3W A;  4CJ1 B;  1I4G A;  4JI6 Q;  3CW2 C;  2MJ8 A;  1I3Q H;  2BE5 D;  1FJG Q;  3R8B A;  3C2P A;  1N9W A;  4KTA A;  4J6H A;  5IP7 H;  2E76 C;  4S3S A;  4EQ5 A;  4ZQ3 A;  1WI5 A;  3PUV A;  3T13 A;  4ZUI A;  3I90 A;  2GVB A;  2PW7 A;  5C3E H;  5GRO A;  1EUJ A;  5EPL A;  4OHJ A;  4A3C H;  3PV0 A;  4ODG A;  4GNX C;  1PFB A;  5IGD A;  5C44 H;  2MHV A;  3W3A A;  4C1N I;  4ID6 A;  1IXR A;  2F52 A;  2A68 D;  3M4O B;  3H0G G;  4LW1 A;  1YIT A;  3L3O C;  4JI3 L;  2PNH A;  4DUY L;  3KOJ A;  4PZ6 A;  2K52 A;  2F0D A;  4ZK9 B;  2WAC A;  1TS5 A;  2P5Z X;  5NUC A;  2F0J A;  4FF4 A;  4LWC A;  5C0X J;  1IYU A;  2EVB A;  3RLO A;  2PCF B;  1F77 A;  3OW2 A;  1EEF D;  4HMI A;  1NSN S;  1GUN A;  5D65 A;  5IT9 E;  1L1O B;  3SE0 A;  2F4V Q;  2ID0 A;  4BXX G;  5ELC A;  2V4D A;  5KND A;  1SNC A;  2JA5 G;  1SJE D;  2E2D C;  3NTH A;  2R92 H;  1U0L A;  2A74 C;  1ILQ A;  3D4R A;  2QKI C;  2UXB L;  1NR4 A;  2YU9 B;  3RMH A;  1WVL A;  5FLX E;  1R4Q B;  2XNA C;  5DM7 3;  4A3M G;  1B50 A;  2EYP A;  1JOK A;  1PH3 A;  3TME A;  1IL8 A;  4A3I H;  3K80 C;  3ITP A;  4DV2 L;  4ZKB B;  4HN7 A;  3PF4 A;  3GTM H;  4BBS G;  2M9V A;  3HG9 A;  5JVG 3;  3ER0 A;  4C2M B;  1QG7 A;  5EQ0 A;  3FVQ A;  1LTS D;  3J7A V;  4PMB A;  2Z0S A;  3MC0 B;  3KLW A;  2HUG A;  4HSV A;  1BKB A;  4JI4 L;  3NTK A;  2UUC L;  1KTK A;  1PHJ A;  4DV1 L;  1CKM A;  5IYB H;  1MKH A;  1STA A;  2X6G A;  3HOX G;  3HKZ B;  1HQM C;  1ZYR D;  3J81 c;  3J81 j;  2R93 H;  2E75 C;  5KRU A;  1Q7Y C;  5IWA L;  3WWV A;  4B3M L;  2L0C A;  4HCS A;  3HOV G;  1BVS A;  1B53 A;  1UE7 A;  1WCM B;  4O0A A;  2Z9H A;  4OWX B;  5IGC A;  5C5M A;  2YU9 H;  1S3O A;  1E1O A;  4PMW A;  1G2T A;  4BY1 G;  1D5X C;  4JI5 L;  1SYD A;  4MTN A;  1SSO A;  2F0P A;  1JWM D;  1SMX A;  3NPP A;  2RDF A;  4JBK A;  1VQG A;  3PUW A;  4IJH A;  1VQM A;  4DV0 L;  4KKS A;  1FJG L;  3FP9 A;  4A3B G;  5I2X A;  4DV2 Q;  3ERQ A;  2MO0 A;  4A76 A;  1M8A A;  1KD1 C;  4DR3 L;  3GTP B;  5G3L D;  2HD3 A;  3W1B A;  1B2T A;  4HIO A;  1V8Q A;  4RKL A;  3VR6 A;  5CMD A;  3CC4 A;  4IUV A;  1HH2 P;  1SFO B;  1HQR D;  1PTO H;  3HS0 C;  2QDL A;  2JA6 H;  5HGQ A;  1UE1 A;  3SGI A;  3KDF B;  4HR7 B;  2K04 A;  4X3T A;  3CPF A;  4UP8 A;  3BYY B;  3GTJ B;  1EWC A;  4U67 3;  4YIJ A;  5M9O A;  3K0X A;  2LSS A;  3S1R B;  1D1K A;  3D4D A;  3ERS X;  4NXN L;  3ZJY C;  3J80 E;  2QEJ C;  5IGB A;  1JR0 D;  3RN5 A;  1NE3 A;  2I46 A;  2VQE Q;  4DR7 L;  3W1G A;  3GD7 A;  4A75 A;  2MNA A;  5DM6 3;  4DV7 L;  2J7Z A;  4DGZ A;  1Y69 U;  5TSS A;  3D8G A;  4X65 L;  4RHS A;  4HIK A;  2TSS A;  1J5E L;  2K03 A;  4NKL A;  1W6K A;  3QWN A;  1VQ5 A;  2F0G A;  2JSO A;  5E4X A;  1EFW A;  4QGU A;  2F0W A;  2F0Q A;  5IP7 G;  4DR6 Q;  2YTX A;  1J5E Q;  2VUM G;  1DZ1 A;  1LTA D;  5ELF A;  2G9D A;  1SE4 A;  3P1H A;  1EY7 A;  1QNK A;  2WII B;  2B2V C;  1JOQ A;  1EOT A;  3ICE A;  4YHH L;  2I5L X;  4BY7 H;  2AWO A;  5M5X H;  1SXT A;  3CC7 A;  1I4H A;  1CTM A;  4ZYS A;  4K8I A;  4YY3 Q;  3ONA B;  5C0X I;  1FYC A;  1KDB A;  1WFQ A;  4JI0 Q;  4FF3 A;  1TWH H;  1STE A;  3HOW G;  2G9H D;  3GO5 A;  1HCZ A;  4X66 Q;  1X32 A;  3BVZ A;  3HOV B;  1Q86 C;  5IGG A;  1V43 A;  2K5W A;  4AYB E;  2B2V A;  1KNA A;  3H0G H;  1KIX A;  3NEN A;  2L4N A;  1NR2 A;  1IW7 D;  2HT1 A;  4IN3 A;  1EYD A;  2XIW A;  2K4K A;  4GOP A;  3J81 L;  2VB3 X;  2AQ1 B;  1DYQ A;  1IKL A;  1K3R A;  3Q8D A;  1RTO A;  1G6P A;  2LXJ A;  3D4W A;  4G57 A; 
#chains in the Genus database with same CATH homology
 3MXG A;  3RZO B;  4U68 A;  4OIK A;  4CBV A;  2A73 B;  2JEA I;  4DNT B;  3MEH A;  4V0B A;  1D6E C;  1TY2 A;  4HED A;  3NTI A;  3C1F A;  1EEI D;  2IX1 A;  1EYA A;  4DNR B;  3JAM L;  1LAC A;  4Q0F A;  4BBS B;  1PTO C;  1G91 A;  1OXT A;  1KDA A;  4NDX A;  1CQF A;  1QB5 D;  1CQV A;  3S17 B;  2B2Y A;  3QG1 A;  2JXM B;  1ENC A;  3K7A B;  2D62 A;  2AQ3 B;  2AUJ D;  2RVL A;  3TP8 A;  2PW5 A;  4BBR B;  2EE1 A;  3S1N B;  3SK8 A;  3FPP A;  1C8C A;  1DOM A;  2PMZ B;  4CJ0 B;  1RCV D;  1TY0 A;  5FOB B;  4RWS C;  3E5S A;  5J22 A;  3T16 A;  1O80 A;  3NQI A;  1SND A;  3GTK B;  3BDC A;  3R2T A;  1H9J A;  2K6A A;  1SE2 A;  1CM9 A;  3PUZ A;  1UUP A;  4IFD J;  3QB3 A;  1KDC A;  4H44 C;  1MSH A;  1RDP D;  4X3U A;  1E2V A;  1BCP D;  3DWQ A;  3E6Z X;  2E74 C;  5EBC A;  3RZD B;  1RHP A;  2B8G A;  3U9O A;  3EVQ A;  1VF7 A;  3VR3 A;  1SYC A;  5EGT A;  1TT2 A;  2LFN A;  4IAL A;  1SMY D;  3WOF A;  4LJZ C;  3PIO 3;  2FIN B;  1MD2 D;  3K6O A;  1SEB D;  1FNV A;  3GTM B;  5CGK A;  1GUG A;  2F03 A;  1H9K A;  1TWF B;  1SYB A;  2AQ2 B;  5JAV A;  1B1Z A;  5JPM C;  1AN8 A;  3DHQ A;  2R92 B;  2K1B A;  2KUM A;  1XWE A;  2R61 A;  3SR1 A;  3J81 E;  5T1G A;  1HFG A;  1FNW A;  2F0I A;  4C3I G;  1SNP A;  3VA7 A;  2I07 B;  5M5Y B;  1CT1 D;  1D2B A;  4KY5 A;  2XN9 C;  4B9W A;  1YNN C;  2RSN A;  5I9O A;  2CW0 D;  3J80 L;  3HRZ C;  4H0L C;  3QIA A;  3FEW X;  5C5L A;  1IW7 C;  5CV7 A;  4BWG B;  2MPM A;  3GTQ B;  1PYW D;  3VR2 A;  2R3Z A;  4LAA A;  4UAI A;  1F2Z A;  2RA4 A;  2HDL A;  3L7Z C;  2H1E A;  5EBD A;  1ILP A;  4OIJ A;  4PNY A;  1JWU D;  4FVM A;  2C9O A;  4DF7 A;  4XXE A;  1V1P A;  1A3T A;  3MFG A;  3DXJ C;  5C6A A;  3N6R A;  3K58 A;  4RCN A;  3A54 A;  4K5V A;  3S1Q B;  3OW7 A;  2BOS A;  4X3K A;  2BDO A;  3A8J E;  1X3Q A;  1SYF A;  1S5C D;  5C0X G;  4IUQ A;  4ABN A;  5FO9 B;  1W6J A;  5DAU A;  5C3X A;  1T5X D;  1GUT A;  1TQO A;  4C3I B;  4ZKC B;  1DJR D;  2XWJ B;  3A8I E;  4ZLT F;  1TS4 A;  2KEC A;  1NUC A;  2B2T A;  2KED A;  1BR9 A;  1DM0 B;  1EZ6 A;  3Q23 A;  1STY A;  4WFN 3;  3WDN A;  3R93 A;  1EWH A;  5AFW A;  4ME5 A;  1CA6 A;  3BYT B;  1Q90 A;  5I9P A;  1SAP A;  2EY1 A;  4F8M A;  1L0Y B;  1EQV A;  4EQP A;  2GA4 B;  3J7A F;  5KYL A;  3DM1 A;  3PMF A;  2WKD A;  1SDF A;  5A2Q L;  2ICE C;  5EKI A;  2NN6 H;  4RH6 A;  2EXZ A;  3V96 A;  3DMU A;  2EDG A;  2NTT A;  2Q8I B;  1LT6 D;  5KEE A;  2JP1 A;  1SMY C;  3J7Y W;  2CVR A;  4BY1 B;  3M7N A;  1CFM A;  1STH A;  5F2D A;  2F0T A;  1GOZ A;  1EY9 A;  2O5I C;  5D3I B;  2SDF A;  1T5E A;  4JBW A;  1S4Z A;  1JQY D;  4DXF A;  1A15 A;  4FYD A;  5HUR A;  3WOE A;  2F0N A;  1HA6 A;  3FMC A;  1O7L A;  5KNC A;  2K5D A;  2Z4I A;  1K8M A;  1SJH D;  4OO1 H;  3HOX B;  2D2C C;  2HCC A;  3K57 A;  5FO7 B;  4ZAI A;  2BE5 C;  2HCI A;  5K36 G;  2XWB B;  3CQZ B;  5EPJ A;  4XIG S;  3MFY A;  4IUU A;  4CKC A;  4KV6 A;  1EFI D;  4C1N K;  1Q1B A;  1Z47 A;  2CW0 C;  1PFN A;  3O13 A;  4KHV A;  3VA5 A;  4I65 A;  1FNU A;  3GV3 A;  3KLS X;  5D14 A;  5C4J B;  2Y0S B;  1EY4 A;  3SK4 A;  4A3D B;  2A69 C;  3DEO A;  1H9R A;  1EZ8 A;  2JA5 B;  2K7V A;  4KHZ A;  1C48 A;  2SNM A;  4IUT A;  1ICW A;  1KNE A;  3TZD A;  3C3L A;  4XYQ A;  1EY0 A;  4K5W A;  2E2H B;  1I4P A;  3TN2 A;  3NE5 B;  4RGN A;  1I4R A;  4OGQ C;  2DY8 A;  2B8F A;  2L1B A;  4K2L A;  5I6Y A;  3MXP A;  1AW7 A;  1WTO A;  4FNF A;  1Q12 A;  2L11 A;  3IFD A;  3H0G B;  1QCB D;  1JOO A;  3UI2 A;  2IT1 A;  2X6L A;  1JWS D;  2EYJ A;  1MBY A;  1M4V A;  2WKC A;  1I6V C;  1STB A;  1XX8 A;  2NYZ D;  3HZX A;  3RLF A;  3HOW B;  3TSS A;  3I91 A;  3X3N A;  3EFX D;  1QIL A;  1UEA B;  3V2T A;  2L12 A;  5ISR A;  2OT2 A;  4C3J G;  2XVS A;  3FPU B;  4A3E B;  5ELD A;  1OXU A;  1ENA A;  5I2Y A;  2NB0 A;  1U4L A;  1IYV A;  2PNR C;  2VUM B;  5JPN C;  3IKJ A;  2PPB C;  2IJ0 A;  4TKO B;  3MVV A;  3H3V C;  1BO0 A;  1HUN A;  1YNJ C;  3S14 B;  3K59 A;  2ICI A;  2KEE A;  1LTG D;  1BDO A;  4P2C B;  2K01 A;  4ZRZ A;  3M7G A;  1PLF A;  2J4X A;  4IFD G;  5KNB A;  2Z8L A;  1Y1W B;  1XXG A;  1VF5 C;  2JEB I;  3SK6 A;  4CKB A;  2NTS A;  5DEH A;  3VR5 A;  1FGB D;  2EZV A;  1Y1V B;  1B4O A;  3A7A B;  3A55 A;  3S15 B;  5IGE A;  1OXV A;  2JYO A;  1O7Y A;  3R3O A;  1TWC B;  3P7J A;  2A68 C;  3SXH A;  1H9S A;  3EJI A;  2FJ2 A;  3A7L A;  3OWE B;  4CGY B;  4LMQ D;  1YNN D;  1KLG D;  1LV9 A;  2PZW A;  5E3F A;  4K5X A;  3BVG A;  2PZT A;  2JE6 I;  4XDX A;  1PTO D;  1D5Z C;  3FKI B;  1GHK A;  1I6H B;  3FDT A;  1Z7T A;  5FLX L;  3BG3 A;  4XYO A;  4RGO S;  2LS0 1;  3K5N A;  2F0O A;  1X3P A;  1L0X B;  4R8N A;  1CHQ D;  4PV1 C;  3IL8 A;  4MN3 A;  4A3M B;  3NP8 A;  4UDU C;  2IL8 A;  1SNO A;  4IUP A;  3NSW A;  3QOL A;  2DN8 A;  2XSC A;  2F0S A;  2NVY B;  1JCK B;  1WTP A;  4CJ2 C;  1F9P A;  2QIL A;  1QWY A;  1Y8O B;  1S5F D;  4RHR A;  1JC7 A;  1IKM A;  4QMG A;  3W2D A;  1A2U A;  4NW2 A;  2B63 B;  1BUV T;  1I3Q B;  1TR5 A;  4KKT A;  3I70 A;  1RJT A;  4IUN A;  1TII D;  3MZ5 A;  1ZYR C;  2QDB A;  3NWT A;  1JB3 A;  4N9P A;  3Q22 A;  1QE6 A;  5C4X B;  2ENB A;  2PQE A;  5IOC A;  1ET6 A;  2F0U A;  2B2W C;  3KLS A;  3QOJ A;  1SNQ A;  4R8I A;  1U4P A;  1IHZ A;  1GHJ A;  1ESF A;  2F0L A;  4B9X A;  1BF4 A;  3Q24 A;  3ERO A;  1B9M A;  5CBE E;  1PTO F;  4B08 A;  4Z9C B;  5K5P A;  2B2W A;  3K0Y A;  2OXP A;  3GV6 A;  4A3K B;  5C0X H;  4BY7 B;  1PZJ D;  2IW3 A;  3HGB A;  3U9S A;  5DNF A;  5KIX A;  3MWY W;  3OSO A;  3I72 A;  2A6H D;  4L8J A;  2WP8 J;  5LL6 S;  3N52 A;  4BA2 I;  4RA8 A;  1GUS A;  3SVM A;  4XQJ A;  2E2I B;  4F88 A;  2RQX A;  5C4Z A;  3I4M B;  1ML0 D;  1C4Q A;  1PFM A;  4NP5 A;  4XTC S;  2RDG A;  3OMC A;  5HGT A;  4G7Z C;  4BA1 I;  5M5W B;  1JE4 A;  3M85 A;  4CHT B;  1LTB D;  2K5Q A;  1DD2 A;  4F87 A;  4DAP A;  2O5J C;  4WJW A;  5CV5 A;  1S5B D;  1EU3 A;  1QNU A;  1O78 A;  2NBF A;  4XQQ A;  3JAM E;  3S2H B;  1DXM A;  3IFT A;  5LL6 X;  2R7Z B;  2PYK A;  1KAA A;  2VNU D;  3S2D B;  3LWU A;  2MGS A;  3S16 B;  4K14 A;  2WIN B;  2R93 B;  3BVM A;  2WAQ B;  2L55 A;  3LX0 A;  1BCP B;  2A6E C;  2F0K A;  1GUW A;  1TS3 A;  1TU2 B;  3OIQ A;  1CZG A;  2EY6 A;  1TWA B;  2VXW A;  1K83 B;  4KMU C;  2KHS A;  4OL7 A;  3QJY A;  4IUR A;  3DUZ A;  5FK9 C;  5IOD A;  2SNS A;  5M3F B;  2NWG A;  5KYI A;  2E2J B;  3QO2 A;  5COY A;  3NBH A;  3Q6S A;  4DA2 A;  2C5C A;  1HFN A;  5CV9 A;  4HAE A;  1EL0 A;  1RKN A;  1HTP A;  3KBX A;  3ZYY X;  1TVX A;  5G3L F;  4EQN A;  1DCZ A;  1LTI D;  3H91 A;  3OOC A;  2IWH A;  1AZQ A;  4PQX A;  1XYI A;  4R9W A;  3C46 A;  2FMC A;  1A3V A;  2NZ1 D;  1A6X A;  3OPO A;  2F0M A;  2NVQ B;  1KLU D;  1BCP F;  2NVT B;  1G2S A;  2EYO A;  2F0V A;  5EKK A;  4A3B B;  2KVM A;  2JA8 B;  5FO8 B;  4OO1 G;  1KAB A;  5M3M B;  2XRQ D;  2SEB D;  2B2Y C;  3NHH A;  1I4Q A;  1V1P B;  4DFA A;  1DOL A;  4KN4 C;  2DY7 A;  4CKE A;  2VB2 X;  2XRS D;  1GUO A;  2A5H A;  4LK1 C;  4EQO A;  4HSP A;  1U4M A;  1BOS A;  3DWA A;  5CV6 A;  1J9O A;  4X3S A;  2MUY A;  1WTV A;  4I7Z C;  1Q8I A;  1J8I A;  1I50 B;  1VDZ A;  2QF7 A;  3GTO B;  3AB9 A;  2EJG C;  2EY2 A;  1ONL A;  1STN A;  1D1I A;  5K36 H;  1GJX A;  3KBG A;  4QF4 A;  4ZUJ A;  5JEA J;  2DNC A;  4C3H B;  3MTS A;  2EYH A;  1UNS A;  2RKS A;  5COR A;  4FO2 A;  1EQT A;  4KY6 A;  1U9R A;  3OWF A;  3M3Y B;  5M5X B;  1ZEQ X;  5J1Z A;  2F0E A;  2F3V A;  3NK9 A;  3OMG A;  1WD1 A;  3C1E A;  3Q0A A;  1D5M C;  4V19 0;  3D6W A;  5I4D A;  4L63 B;  2B2T C;  4IZ8 A;  4DU9 A;  3SEB A;  3M4Y A;  4XT1 B;  4KJN A;  4TQU S;  3GTL B;  4K6L A;  4K8J A;  4FP5 D;  4RAU C;  2EY5 A;  5ELB A;  3TP5 A;  3TDQ A;  1LTT D;  2IX3 A;  1JIC A;  4FXG C;  2KA7 A;  4HTH A;  2Z1C A;  2Q8T A;  1II3 A;  2NN6 I;  1I4X A;  1TS2 A;  1AZP A;  1VMC A;  3HOZ B;  4FXD A;  1LTR D;  1OXS C;  3TZU A;  5CV8 A;  1LLR D;  1F2Y A;  2SOB A;  1G8Z D;  1HXY D;  1EYC A;  5JOB A;  5KGU A;  3BDO A;  4O42 A;  2ZXP A;  2RBM A;  1F9S A;  5IGF A;  5EKL A;  1BBX C;  2LY7 A;  4DXG A;  1ENF A;  1WTQ A;  4QUF A;  1BXT A;  2X69 A;  3I8Z A;  3ND8 A;  4RFB A;  3HOU B;  3VYT A;  2NN6 G;  3IAY A;  1EIH A;  3KF8 A;  5EPK A;  3TBI B;  4A3J B;  2ZXR A;  4DAV A;  1HHV A;  1SYG A;  3EQL C;  2KOL A;  2IPK D;  3P20 A;  3S1M B;  3PO2 B;  4DAY A;  1H9M A;  4EGV A;  3K5O A;  1NAP A;  4QCL A;  3OIP A;  1HA5 A;  2AUK A;  2BA1 A;  1S5E D;  3T51 B;  4KKU A;  2EYM A;  2FHT A;  4J1M A;  2F0H A;  3BDL A;  3VR4 A;  4MHE A;  3HP3 A;  1GXD C;  1LT5 D;  1BQQ T;  3MA2 B;  1CA5 A;  1AFP A;  2A69 D;  2EJF C;  3MHB A;  3PIP 3;  3BZD B;  3MXU A;  1WD0 A;  5E4W C;  3V05 A;  1TWH B;  3SDZ A;  4A3F B;  2J0T D;  5BN5 A;  1F9Q A;  2KCC A;  4JK1 C;  2O4X A;  4TRD A;  1B3A A;  1ET9 A;  5CC4 A;  5EJW A;  5IIF A;  5JJZ A;  3NUC A;  4OO1 I;  1EY5 A;  1VMP A;  1S5D D;  5C3E B;  1SYE A;  3FRP B;  3CRL C;  2PO4 A;  2DNE A;  4K2K A;  3T53 B;  4G7O C;  4WOR A;  1F2M A;  3T4A C;  1K8O A;  2BDN A;  2F4I A;  1DOK A;  1PRT B;  4KD3 A;  1AP0 A;  2IX0 A;  1OXX K;  1STG A;  2O2L D;  1BCP C;  3RD4 A;  2Z4H A;  2ZT9 C;  3D31 A;  1AEX A;  1QOH A;  2PZU A;  3I73 A;  3KLR A;  3CKI B;  3NXW A;  2FFK B;  3CU7 A;  1HRJ A;  2A6H C;  2F1M A;  3I4N B;  1NCV A;  3D6C A;  3LNN A;  2M00 A;  1PZK D;  2B2U A;  4M1U B;  4DN4 M;  3I3C A;  2EJM A;  2LKV A;  5FKA C;  5C3W A;  3S9W A;  2B39 A;  1MSG A;  2NUC A;  4KN7 C;  4NMZ A;  5D3D A;  4O1N A;  3L9A X;  1UAP A;  2K33 A;  4N9T A;  1RTN A;  4F7X A;  2K05 A;  3H09 A;  4PMC A;  5I6W A;  3F2U A;  1QJO A;  4IFD I;  2N55 A;  4Q5V A;  2M2L A;  2EPB A;  1LAB A;  1FD7 D;  4C3H G;  5BN3 A;  1Y8N B;  2HDM A;  5A35 A;  1PXU A;  2JA7 B;  5C44 B;  4KI0 A;  1Q1E A;  2RSO A;  4G7H C;  2YYZ A;  3H6M A;  3NBI A;  5BN4 A;  4H13 C;  4TSS A;  3I4L A;  3SHL A;  3PUX A;  1RD9 D;  1OO9 B;  4WRD A;  5J39 A;  1DON A;  1E0B A;  1E2W A;  1A2T A;  5CR3 A;  1HTL D;  2LMC B;  1EU4 A;  1SBB B;  4QIW B;  4DK1 A;  1EY8 A;  3KUP A;  1E2Z A;  2TMP A;  1G6Z A;  1SNM A;  4GZY C;  2KJX A;  3G6J B;  3MXN A;  5JEA H;  1PDQ A;  5A2Q E;  5CYU A;  4L6T B;  1EY6 A;  1G29 1;  2EOT A;  3TP7 A;  2EYF A;  2NVX B;  1R4P B;  3RUZ A;  1XTC D;  4MIU A;  3VYS A;  2MP1 A;  1PRT F;  3E0J A;  1V1O A;  1CK1 A;  3MAQ A;  4XT3 B;  1PMR A;  4J8Q A;  4AYB B;  2R6G A;  1ESR A;  2H4O A;  1B9N A;  1LT4 D;  3ND9 A;  3K5M A;  2BCO A;  4KK7 A;  5C4H A;  4ULL A;  3OHX C;  4K6D A;  1HPC A;  3URY A;  2JA6 B;  1PRT C;  4QUC A;  2CHB D;  1Z6H A;  2KCN A;  3VYR A;  3TP6 A;  5ELE A;  3HOY B;  1MGS A;  1CI3 M;  4M8A A;  3DWP A;  1JOR A;  4FXK C;  1U4R A;  4FF1 A;  3DEP A;  1SE3 A;  4DK0 A;  1PTO B;  2N88 A;  1CZW A;  1PRT D;  2AWN A;  5T1I A;  3CRK C;  4RGT A;  1Q3L A;  1WTX A;  3A56 A;  4KY7 A;  3BS1 A;  2BA0 A;  3A8K E;  2FMM A;  3HEJ A;  1F2L A;  2EYL A;  5CV4 A;  2F0F A;  4C56 C;  3P75 A;  5CBA E;  4G4K A;  5IT9 L;  1O7Z A;  5E1F A;  3PUY A;  3VYU A;  2CQA A;  1VCI A;  4HCE A;  3H94 A;  5JEA G;  4BS9 A;  2HQE A;  2ZXO A;  1ZKO A;  4XQN A;  1FR3 A;  4HMJ A;  2L5T A;  4E6I A;  3R2I A;  1F9R A;  1CHP D;  1LO5 D;  4KJO A;  3NQT A;  3T56 B;  3EA6 A;  1MI2 A;  4A3I B;  3K5L A;  3AU7 A;  1TWG B;  4FF2 A;  2K32 A;  4KD4 A;  4IQZ A;  1BNZ A;  1A3U A;  3X3M A;  4A3G B;  3CHB D;  4QB4 A;  3PO3 B;  2A6E D;  1Y8P B;  2WV6 D;  1RF2 D;  1TKW B;  3GTG B;  2B2U C;  3LWE A;  4EVO A;  3G7L A;  1EIG A;  2D5D A;  2OEO A;  3KK7 A;  3GQB A;  2Q8R E;  1B44 D;  2K28 A;  4H7B A;  4Y7N B;  2WB1 B;  1ROD A;  2D9U A;  1YNJ D;  4RGM A;  3NWS A;  2L9H A;  4ILW A;  3AMU A;  4RKB A;  3SK5 A;  1H9S B;  3GP7 A;  2RDH A;  2QCP X;  3D3R A;  1ZXT A;  4A93 B;  1WTR A;  2OF1 A;  5JVH 3;  1WTW A;  1LT3 D;  4C3J B;  4RCO A;  2KQ3 A;  1PZI D;  4IFD H;  1HUM A;  5LHY 1;  1R9T B;  2F3W A;  4CJ1 B;  1I4G A;  2MJ8 A;  2BE5 D;  3R8B A;  3C2P A;  4KTA A;  4J6H A;  2E76 C;  4S3S A;  4ZQ3 A;  3PUV A;  3T13 A;  4ZUI A;  3I90 A;  2PW7 A;  5EPL A;  4OHJ A;  3PV0 A;  4ODG A;  1PFB A;  5IGD A;  2MHV A;  3W3A A;  4C1N I;  4ID6 A;  2A68 D;  3M4O B;  3L3O C;  2F0D A;  4ZK9 B;  2WAC A;  1TS5 A;  5NUC A;  2F0J A;  4FF4 A;  5C0X J;  1IYU A;  2EVB A;  2PCF B;  1F77 A;  1EEF D;  4HMI A;  1NSN S;  1GUN A;  5D65 A;  5IT9 E;  3SE0 A;  2ID0 A;  5ELC A;  2V4D A;  5KND A;  1SNC A;  1SJE D;  2E2D C;  3NTH A;  2A74 C;  1ILQ A;  3D4R A;  2QKI C;  1NR4 A;  2YU9 B;  3RMH A;  1WVL A;  5FLX E;  1R4Q B;  2XNA C;  5DM7 3;  1B50 A;  2EYP A;  1JOK A;  3TME A;  1IL8 A;  3ITP A;  4ZKB B;  4HN7 A;  2M9V A;  3HG9 A;  5JVG 3;  4C2M B;  1QG7 A;  5EQ0 A;  3FVQ A;  1LTS D;  3J7A V;  4PMB A;  3MC0 B;  2HUG A;  4HSV A;  3NTK A;  1KTK A;  1STA A;  2X6G A;  3HKZ B;  1HQM C;  1ZYR D;  2E75 C;  5KRU A;  2L0C A;  4HCS A;  1B53 A;  1WCM B;  5IGC A;  5C5M A;  4PMW A;  1G2T A;  1D5X C;  1SYD A;  1SSO A;  2F0P A;  1JWM D;  3NPP A;  2RDF A;  3PUW A;  4KKS A;  5I2X A;  3ERQ A;  1M8A A;  3GTP B;  5G3L D;  1B2T A;  1V8Q A;  4RKL A;  3VR6 A;  5CMD A;  4IUV A;  1SFO B;  1HQR D;  1PTO H;  3HS0 C;  4HR7 B;  2K04 A;  4X3T A;  3GTJ B;  3BYY B;  1EWC A;  4U67 3;  4YIJ A;  5M9O A;  3S1R B;  1D1K A;  3D4D A;  3J80 E;  2QEJ C;  5IGB A;  1JR0 D;  2I46 A;  3GD7 A;  5DM6 3;  2J7Z A;  4DGZ A;  1Y69 U;  5TSS A;  3D8G A;  4RHS A;  2TSS A;  2K03 A;  4NKL A;  1W6K A;  3QWN A;  2F0G A;  2JSO A;  5E4X A;  2F0W A;  2F0Q A;  1DZ1 A;  1LTA D;  5ELF A;  2G9D A;  1SE4 A;  3P1H A;  1EY7 A;  1QNK A;  2WII B;  2B2V C;  1JOQ A;  1EOT A;  2AWO A;  1SXT A;  1I4H A;  1CTM A;  4ZYS A;  4K8I A;  3ONA B;  5C0X I;  1FYC A;  1KDB A;  4FF3 A;  1STE A;  2G9H D;  3GO5 A;  1HCZ A;  1X32 A;  3BVZ A;  3HOV B;  5IGG A;  1V43 A;  2K5W A;  2B2V A;  1KNA A;  2L4N A;  1NR2 A;  1IW7 D;  1EYD A;  2XIW A;  4IN3 A;  3J81 L;  2VB3 X;  2AQ1 B;  1DYQ A;  1IKL A;  1RTO A;  3D4W A;  4G57 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...