3NXWA

Crystal structure of staphylococcal nuclease variant delta+phs l125a at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLARKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cavities determine the pressure unfolding of proteins.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2010-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3nxwA00
4NDXA 2SOBA 5C6AA 2EYOA 3EJIA 3TP5A 3SR1A 3R3OA 3VA5A 5CV5A 1NUCA 5IGEA 3BDCA 4KY7A 1A2TA 3QOJA 3SXHA 4ZUIA 4N9PA 2OF1A 4KTAA 2F0NA 4NMZA 2F0VA 5IGBA 3MXPA 4KD4A 4LAAA 3D4WA 4K5VA 1KDCA 5C5LA 1SNPA 4PMCA 4KJNA 2F0KA 4K8JA 5IIFA 3HZXA 2PW5A 3MHBA 2KQ3A 2O4XA 2F0HA 5CR3A 4KD3A 5IGCA 1II3A 1SYFA 3OWFA 1EY8A 3SK6A 2F0WA 1EY0A 2F0LA 5I6WA 1SNDA 2PYKA 4KY6A 2PZTA 2PZWA 4KHVA 1JOQA 5C4HA 4PNYA 1EYDA 2EYHA 2WACA 5CGKA 2F0IA 2M00A 2NUCA 2EYLA 2F0QA 3P75A 4QMGA 4K5XA 4HTHA 3T13A 4IZ8A 3NXWA 3OMGA 4YIJA 5I9OA 2EYJA 4EQNA 5KYIA 3S9WA 4ODGA 5JOBA 1EY6A 2F0OA 4F8MA 1F2MA 1STAA 4IALA 3C1FA 3SK5A 4DFAA 1JOKA 5DEHA 2F0FA 2EYPA 4R8NA 4KJOA 1KAAA 3ITPA 4QF4A 4WRDA 3NHHA 2RKSA 5CV4A 1TQOA 2F0DA 4B9WA 3MEHA 5K5PA 5C5MA 2EY5A 5CC4A 4EQOA 4E6IA 1F2ZA 4ME5A 5HGTA 2F0SA 4MIUA 1U9RA 3EROA 1RKNA 1STHA 3NP8A 4J6HA 4J1MA 4K14A 3H6MA 4K5WA 5M9OA 5J1ZA 1SYEA 1STGA 4HMIA 1A3UA 2ENBA 5I9PA 5ISRA 1KDBA 4ZQ3A 5E3FA 3RUZA 3V2TA 4NKLA 5IGGA 3DMUA 3U9OA 1EY4A 1SYBA 2KHSA 4DF7A 1SYDA 5C3XA 4K6DA 4HMJA 4K2KA 5CV9A 2EY2A 2EXZA 3QOLA 1SYCA 4QB4A 1EYCA 3TP6A 1SNCA 1F2YA 2F3VA 4KV6A 4EVOA 2F0EA 1JORA 3NUCA 2F0JA 1JOOA 4OL7A 2EY1A 4N9TA 3TP7A 2LKVA 3QB3A 4K8IA 3D8GA 3OSOA 3MVVA 4I65A 2OXPA 2F0TA 5E1FA 3SHLA 3BDLA 3SK8A 2F0UA 1ENAA 1STBA 2SNMA 5CV6A 3EVQA 4H7BA 4PMBA 2EYMA 1STYA 1EY9A 4F7XA 2RDFA 4B9XA 5JAVA 5IOCA 5C3WA 2QDBA 1A2UA 1SNQA 2SNSA 3NK9A 2HQEA 4KY5A 5CV7A 3SK4A 2PQEA 3TMEA 1EQVA 5DAUA 1EZ8A 2RBMA 5IGDA 4RKLA 5IODA 5J22A 4WORA 5C4ZA 5KEEA 5KRUA 2EY6A 3NQTA 1TT2A 4EQPA 5KYLA 5F2DA 1TR5A 1KABA 1SNOA 1EY7A 1NSNS 1STNA 2F3WA 5EKKA 1A3TA 2PZUA 5HURA 1EY5A 3ERQA 3LX0A 5EGTA 2OEOA 4ZUJA 3T16A 4DU9A 1A3VA 1ENCA 5KIXA 1SYGA 5J39A 1SNMA 3OMCA 3TP8A 4RKBA 2PW7A 1IHZA 1EZ6A 3D6CA 5NUCA 4IUNA 3DHQA 4S3SA 2F0GA 3C1EA 3HEJA 4ID6A 4K2LA 5CV8A 5EKLA 5KGUA 4G57A 1AEXA 3D4DA 5I6YA 2EYFA 2F0MA 3PMFA 4NP5A 2F0PA 4DGZA 3P1HA 1EYAA 3E5SA 5IGFA 4TRDA 3MZ5A 1KDAA
chains in the Genus database with same CATH superfamily
4NDXA 3NQIA 1EU4A 2KHJA 1G51A 2IJ0A 4N9PA 4JOIC 1JR0D 1GVPA 3W5OA 2CH4A 3CRKC 3DWPA 3PUXA 1PV4A 1N36L 1U5KA 2L1BA 3I56A 1XMQQ 2A6EC 3D0FA 1XMOQ 4O42A 2NVQB 4ZLTF 5FLXL 2RSNA 1NAPA 3M85A 5IYCH 3UE0A 5LMNQ 4JBMA 1YNNC 1EEID 2WACA 2B2UA 2DNCA 2HCIA 4KKTA 3NXWA 3MFYA 4GKKQ 3S9WA 2B2TC 3DXJC 2F0OA 5IP9H 1IXRA 1S5FD 2VUMB 3KUPA 1FJGQ 2A6ED 4QF4A 3NHHA 2KCNA 1D5ZC 2UUCQ 1CA5A 2R92H 3S1MH 3NP8A 1PRTD 4X64L 2NWGA 3RZDH 1NJIC 1OXVA 3U4VA 3T1YL 2KCTA 1SYBA 4IUUA 1I4XA 1VQEA 3GV3A 5IT9E 2K5HA 2V4DA 4K2KA 5T1GA 4L8JA 4K0KQ 1D2BA 1LTTD 4FYDA 3PO3H 1QILA 2XWBB 4A3IG 5DLQE 4OL7A 3HOZG 4JI6Q 5E1FA 2LXKA 2D2CC 1STYA 4DNTB 4B9XA 3ERSX 5FKAC 1I50H 3I73A 1FNUA 1RCVD 3UDGA 2Q2UA 2J4XA 4M8AA 4A3LH 1QB5D 5KEEA 2OQ0A 1T9HA 4GS3A 4OONA 4A3CG 3FDTA 1VMPA 4A3EB 3K5OA 2Z0SA 1PTOC 2XRQD 1WD0A 3E3XA 1HZ9A 4G7OC 4RGNA 1AE2A 2HIXA 5NUCA 5IYCG 4GZYC 4KHPQ 1WYDA 1IYVA 2VW9A 2KHIA 1LV9A 4DR5Q 3K5NA 4KN7C 2LMCB 4IUQA 4B3RQ 5C3EG 1AE3A 1CK1A 2M2LA 1D5MC 4XYQA 2ZM6L 2V1CC 2PO4A 1Y1WB 2IT1A 3L7ZC 2EVBA 2QILA 5FLMH 3CC4A 3H3VH 3J80i 1UE5A 4K8JA 1TWHB 1HR0Q 3VYUA 2X6GA 5HGQA 2DN8A 4ZYSA 4OWWB 5C4XB 1TS3A 4DR6L 4X64Q 1VQ5A 3HKZG 2JQOA 3CMEA 2K5WA 5M5YB 2MJ8A 2QCPX 1TWAB 2RCNA 2M00A 3PSIA 1YIJA 1G6PA 2F0QA 1XPUA 5EQ0A 1GHKA 4GNXA 1YI2A 1VDZA 3OYYA 2EYJA 3PO2B 4U68A 3CAMA 3PO2H 5E4XA 1SMXA 1D8LA 3G6EA 4POFA 1KAAA 1CQVA 5GROA 5EBDA 5CC4A 4DUYQ 2G9DA 2DJGC 4A3FG 1K8OA 4H44C 5FO8B 4OEMB 1O80A 1JC7A 1N36Q 3LNNA 1CZWA 4C3IB 4A3FB 3PUZA 1SYCA 2IX0A 2JA9A 1N34Q 4JI4Q 5I2YA 2IL8A 2WKCA 3HKZE 2KJXA 4XQJA 3A5UA 3JAML 5M5WB 3QB3A 3U58A 2WB1E 1B2TA 1JE5A 3KDFB 5IE8A 2YU9B 5M3MB 1LO5D 3PIO3 1HFGA 5C0XI 3CC2A 2PQEA 3NSWA 1HNXQ 3GTQH 3CF5A 1D5XC 3G71A 5IY0A 1Y8OB 4Q5VA 1AZQA 3NTHA 2K04A 3S2HH 1EY5A 4EQ5A 3S15H 1KRSA 2FFKB 2N88A 4IQZA 3STBC 4L5RC 3K7AB 3S14H 4DR4L 1TS2A 5FO9B 1U4PA 2E74C 4ALPA 4IPGA 2F0PA 3P1HA 3TBIB 2JN4A 2JA8G 2Z4IA 1QNUA 3K59A 4AQYQ 1WFQA 5C6AA 2F52A 1MGSA 1SR3A 3SEBA 4DR3Q 3CHBD 3CU7A 1HR0L 4FVMA 2ZJPA 4JI7L 1I4RA 3UDFA 4BS9A 1PH1A 1G8ZD 3OWEB 4C1NK 1SNPA 5KNBA 4GLXA 4A3EG 1LTGD 3K5MA 2F0WA 1N34L 3CXCA 4KHVA 2VZAA 2PNHA 3ULPA 4CKCA 1H9SA 4O0AA 4BBSH 1NR4A 1E1OA 4AH6A 4A3GB 4ODGA 4FO2A 1E3PA 3DM1A 4X3UA 4NW2A 2H4OA 1L0WA 4A3DH 2L12A 5M3MG 1MJCA 3ITPA 4DV3L 5JJZA 2UXBL 4DV2Q 1VQPA 4DA2A 1YJWA 3IFDA 3ULLA 4OO1G 4KI0A 1SSOA 1BQQT 1F2ZA 2F0SA 1IW7C 1U9RA 2KEDA 1S5DD 3DM3A 2XVSA 4R4IA 1STGA 3M7GA 2RVLA 3HOVB 2KECA 1O7YA 1AH9A 1JWUD 2GA4B 3QWNA 5FO7B 1QNKA 3S2HB 3QOLA 3F2BA 1BXTA 1PXUA 2VB2X 1EU3A 2N8NA 5C44H 3HOYB 2MO0A 3W2DA 1PTOD 4JI8Q 4BY7B 1UNSA 2R7DA 4Y7NH 4PZ8A 4KMUC 4A3KG 5JAVA 4EX5A 1J5EL 1O7ZA 1T5EA 3SK4A 4KY5A 3VR5A 2HQEA 4BWGB 3GTPH 2QDLA 4RGMA 3UDIA 5JVG3 4DUZQ 4UY8C 1I94Q 4QIWB 1TWFH 4R4OA 3GTJB 1VQBA 3KFUA 2P5ZX 3EIVA 3H15A 1GHJA 2Y0SB 1HTPA 5IYBH 4CDEC 2JYOA 3ERQA 4XXEA 1CKNB 4A3CH 1LT6D 1QG7A 1SYGA 1UEBA 1HJPA 3EBEA 1Q81C 3GTLH 1GO3E 1S3OA 2EJGC 2N3SA 4YHHL 3DHQA 4GOPB 1UAPA 2JA8H 2CH4W 2AQ2B 2LY7A 1HR0W 4DV7Q 4MTKA 4X62Q 3I72A 4TRDA 4A3GG 3OOCA 1I3QH 4A3MB 4HSVA 1TXYA 1L0XB 2HDLA 1ZYRC 2OF1A 1VQHA 1KLGD 4EGVA 4JBWA 3EFXD 3IL8A 1JE4A 1CFMA 2MPMA 1SE2A 3HZXA 1SDFA 1HFNA 5FLMG 1Y1WG 1FNWA 1GUTA 1WTWA 1S72A 1BUVT 1A8VA 1B1ZA 4HJ8A 4LUZA 1EYDA 4LF9L 3ZYYX 1XPOA 3GTQB 2F0IA 3P75A 1ZYRD 4C3HG 1Q1BA 4WJWA 5IYDH 4CDDC 2K75A 2JA6B 1F2MA 2CW0C 4DFAA 4B3SQ 2FMCA 3S2DH 2B2WC 1B3AA 1B3QA 3CCVA 4UHVA 3S1NH 4WJ3M 2BA1A 2F4VQ 2F4VL 4B9WA 2ES2A 2K28A 1VQGA 2DY8A 4DPGA 1EUJA 3RR5A 5BR8Q 4P74A 5IP7G 2K50A 1ENFA 1VMCA 4RFBA 5J1ZA 1B8AA 2YYZA 2B29A 5E3FA 1XNRL 1SYDA 2DJFC 2K6AA 4LF9Q 3GTMH 5C44G 4QB4A 3TS0A 1F2YA 1RDPD 4KV6A 2ZT9C 5EAYA 2F0JA 4OO1I 1YNXA 3T4AC 4R1JA 4QGUA 2LKVA 2Q8RE 3MVVA 1TS4A 2F0TA 2MO1A 1YBYA 4A3IH 4JI1L 4OHJA 4JBKA 2XGTA 2E2DC 3K80C 1C7YA 1HHVA 1HQRD 4HCSA 1WI5A 1PH2A 4B3TQ 4JI5L 3CKIB 4XTCS 4IFDH 2XTIA 2NVXH 2R3ZA 2ICIA 5EGTA 3N52A 2FXQA 1G2SA 3RLNA 1HNWL 1JWMD 3M4PA 4I7AA 4LF4Q 4JC0A 5EKLA 2B2WA 3PF5A 1VQIA 1IBML 4BY7G 3KOJA 4DGZA 4DV6L 4RWSC 4TKOB 2GVBA 1ZEQX 3BVZA 1CA6A 3A7LA 4ZUIA 5C0XJ 5CMDA 2JA6H 3BVMA 1N9WA 3U50C 1B50A 1X6OA 4DAVA 2B63G 2DUDA 3A56A 4IPHA 1ILPA 2XN9C 1EY8A 1HXYD 2R7ZH 4A3JB 4ULLA 2PYKA 4KY6A 2B39A 4CJ0B 3OIQA 3A8IE 2ZXOA 2UUCL 2NUCA 3NE5B 1AW7A 5EJWA 2VS1A 3OPOA 3NPPA 1N32L 4IZ8A 5LL6S 3JAMi 4UP7A 5C0XG 4KHPL 3PF4A 1DONA 4F8MA 4X66Q 4GOPA 2F0FA 3CCLA 1R9TH 2EY5A 1B53A 1U4MA 3R2TA 4DV5Q 2YV5A 4BBSG 2A68C 2R93H 4IFDI 1B70B 5ISRA 3VR2A 4A3BB 3DMUA 3QO2A 1EIYB 3GTGB 3PGZA 5CV9A 4DV2L 1PHJA 2HDMA 1V8QA 3QJYA 2NVTB 4EVOA 1JJGA 1BO0A 1YNJD 3GTOB 1JOOA 2B8FA 3FPUB 3IFTA 3TREA 1DYQA 1GJXA 2L9HA 4FP5D 2K7VA 1D1IA 2PCFB 4OIKA 5C3WA 3KBGA 5CV7A 3RLOA 5C4JH 5AJ3L 3TQYA 2DNEA 5E7NA 1Y1WH 3F1ZA 3TN2A 1PDQA 4HEDA 4LWCA 3NQTA 4K6LA 1JMCA 4NXNL 3GTKH 3S1RB 1CUKA 1EY7A 2JSOA 1WD1A 3AU7A 3UE1A 1I50B 3LX0A 4CBVA 4QCLA 4ZKBB 1PA6A 4RKBA 3E6ZX 4F87A 1E7ZA 5JEAJ 1TY0A 4ZKCB 1DJRD 3S24A 4ID6A 1W3SA 4G57A 5I6YA 3VDYA 1VQCA 3A5ZB 2HIVA 2QGQA 2PMZE 1PTOB 1H9SB 4JBJA 3EJIA 3PV0A 1JWSD 1FL0A 4XIGS 2A5HA 3PUYA 2CWPA 4KD4A 1QVGA 2AHOB 3I55A 3AQQA 1Y1VB 2LXJA 1JT8A 4HCEA 3NBIA 1B9MA 4YY3Q 1HZBA 1BCPB 2DY7A 2F0LA 4JK1C 1WCMB 1NBWA 3CCUA 2GVAA 2PZTA 3CC7A 1VCIA 2UUAQ 1Q8KA 1I4HA 3I70A 4YCWA 2EYLA 2Q2TA 5EBCA 3T13A 3E9IA 3OMGA 2IW3A 4FDBA 1R4PB 1VF7A 2KENA 4IUPA 3OW2A 3G6JB 4C3HB 3I4MG 1ONLA 1YHQA 2K14A 3S1NB 3WWVA 1L1OB 1F9SA 1SE4A 4P2CB 4YWKA 3NENA 1A3UA 2C5CA 1KDBA 3A8KE 4NKLA 3S15B 4DNRB 3D3RA 1EIFA 4DV5L 1ILQA 4LUVA 1KXLA 1E22A 5M3MH 4A93H 1BCPF 3CCMA 5M5YH 1JORA 1DZ1A 3EN2A 3H91A 3VA7A 3E9HA 4N9TA 4I65A 3RD4A 1W6JA 2WAQB 1STBA 2A6HC 1V1PA 4JI1Q 4DR1Q 5FJ8H 4F7XA 5IOCA 1MIUA 4C2MH 4BBRB 2B2UC 3NTIA 4FNFA 4YCVA 1EZ8A 1VQ9A 3FEWX 1A3TA 2PZUA 5KIXA 4ILWA 1AZPA 3OMCA 1KD1C 1IHZA 1QZGA 4DR4Q 2J0TD 1N33L 2NVYB 1X55A 4C3JB 3D4DA 2VQFL 4JV5L 1I4QA 1M90C 4B3SL 4JYAL 1KNAA 2RQXA 3HOUB 1YHBA 3DEOA 3K8AA 3HOUH 1BBUA 2JXMB 1BDOA 1CSQA 1GM5A 4LNQA 2F0VA 3CQZH 5C5LA 3I90A 3CP0A 5D14A 3BG3A 1TWAH 5IIFA 3OW7A 1SXTA 3KJPA 2H1EA 3KLSX 4FF2A 3JC66 1K73C 4DNIA 1CM9A 2D62A 1N8RC 3HOYH 2F03A 5H1SE 2PPBC 2AWNA 1XWEA 4DV0Q 1PFNA 1QUQA 5C44B 4QMGA 4A93B 3BDOA 3R2IA 1YEZA 1I6HH 2IHEA 1S5ED 2BDOA 3ONAB 2ZTDA 3HOVH 4DV1L 2C9OA 5GADC 4XQNA 2AUJD 1H9RA 1TQOA 3BU2A 3WDNA 1LT3D 1H9MA 2BE5C 3MC0B 1DD2A 4KLKA 3H6MA 2OT2A 5M9OA 5A35A 2A69C 4IUVA 4YWLA 2L55A 1HNXL 4A3IB 1ASZA 1LTID 3BS1A 1CHQD 1PLFA 1JB3A 3HOXB 3VR4A 1KAWA 3PO3B 2XSCA 3IAYA 2UXCQ 5IGDA 3CCQA 1HUMA 1TS5A 2A74C 4H13C 1CKMA 2K5QA 3L3OC 2RDFA 3J80E 2BOSA 1IBKQ 1F9PA 1QOHA 4DR7Q 1SNQA 4OO1H 1WTRA 2QKIC 5CBEE 2SEBD 2NN6I 1EOVA 3CCJA 4A3DG 2R92B 1KC8C 3ND8A 4LFAQ 4FF4A 1MD2D 5EKKA 3J81L 5EPLA 1MJEA 4IJLA 4DU9A 4OWXB 1IBKL 1SJED 5BN4A 1VQJA 2KCCA 3AEVA 3Q24A 3I4MH 1NNXA 4P75A 3M9BA 5IP9G 1MBYA 1CSPA 3HEJA 5KGUA 1SMYD 3OTOQ 1NMFA 3PMFA 4B3ML 3FKIG 4X62L 3SGIA 4BY7H 2FHTA 3I8ZA 3S2DB 1PTOH 3KLWA 4A3JH 5CV5A 5IGEA 3M7NA 2F0NA 3K81C 2AWOA 2VNUD 5C3EB 1WTQA 1TU2B 5C4JB 3WOFA 3EQLC 3I7FA 5ELEA 4JI2L 1BF4A 4GN5A 1ZXTA 1N32Q 3E0EA 3VYSA 2I5MX 5FJ8G 1GXDC 5FK9C 4R4QA 1WCMG 3HOXG 2E2JH 3CPWA 3T53B 3HOZH 4CJ1B 1PH5A 4JVZA 3SK5A 5DEHA 4R8NA 4QL5A 2K01A 4IPCA 4PZ6A 4C56C 4JOIA 4DXGA 4EQOA 1CKNA 4ME5A 1XJVA 5ELBA 4ZK9B 1X3FA 1JQYD 1SYEA 3JAME 2ENBA 2R92G 2RA4A 4GNXB 4IN3A 4LJZC 4DV6Q 2J7ZA 4DF7A 1ZKOA 3Q22A 1R4QB 2KCMA 5KNDA 5HY6A 1EQRA 1QCBD 4POGA 4DV7L 1P8LA 3NBHA 1BNZA 2EE1A 1MSHA 2PMZB 1HA5A 2EY1A 3MXNB 4B3TL 3SHLA 1WTXA 5GAHC 5M5XH 5A2QL 5CV6A 4PMBA 2N49A 3EA6A 2JP1A 1M4VA 2QDBA 1QVFA 4A3LG 1RL2A 2QW7A 5GAGC 2QA4A 2R93G 1F9QA 1K0RA 3MAQA 3MEFA 3Q8DA 1J6QA 1D6EC 1ENCA 5G3LF 3OHXC 3VR6A 1EZ6A 1I6HB 2I46A 5CV8A 4JG2A 2N78A 3HOWH 1EYAA 3E5SA 3I4OA 2EYOA 5ELNA 1K9MC 1IL2A 4DAYB 2ID0A 4X3TA 2JEBI 3KF6B 1FJGL 4NMZA 1Y14B 4LAAA 4YWMA 4N8FA 2VQEQ 3GTGH 1K3BC 2Y0SG 1F2LA 1FNVA 1H95A 1DXMA 4H0LC 1LT4D 2K1BA 2JA5G 2BE5D 2MUYA 1YZ6A 2PI2E 3GTOH 4UP9A 4DV0L 2B8GA 2R6GA 3CCRA 1ESFA 1QUQB 2K5NA 4YIJA 4EQNA 4HIDA 4NXMQ 3C1FA 1JOKA 1X3GA 1V1QA 2RCFA 4NPSA 5CV4A 2FMMA 2BCOA 3HRZC 1WOCA 3S16B 1OXTA 3NBHB 1C8CA 3G48A 5TSSA 1RKNA 1K28A 4PG3A 2UXCL 5C4XH 2DGYA 1X32A 1M8AA 4RHRA 1BBXC 2IX1A 1FVIA 1D1KA 2LSSA 3NEMA 4K6DA 3HOZB 1S40A 1X3PA 3LWUA 1WTVA 1BCPD 4G7ZC 2ZXPA 1Q86C 2NN6G 4K8IA 4HN7A 4C3JG 3BDLA 4BY1G 1NE3A 2CFMA 1WVLA 3HKSA 3HOUG 3PIPA 2OCEA 5KNCA 1J5EQ 4ME3A 2HD3A 5M3FG 3M3YH 3A74A 4OIJA 4JCVE 5J22A 4JI8L 2LS01 4A3EH 1TR5A 1STNA 1A63A 3KF8A 2M9VA 1IKMA 3QIAA 1LTBD 3VR3A 1A3VA 1TKWB 1K8AC 2B2YA 1KTKA 1SNMA 1EWIA 1IBLL 3KK7A 1STEA 4IUNA 5JJIA 1C0AA 1J8IA 1GUGA 1X56A 2JA7B 1PRTC 4JW0A 4LF8Q 1OXUA 3R93A 3DWAA 1J9OA 4MNOA 3SXHA 2UXDL 2L0CA 1PMRA 4KTAA 1JB7A 5BN5A 3F2CA 4CGYB 1W2BA 3D4WA 4K5VA 1VQOA 4HIOA 4XT1B 5JPMC 4KJNA 2F0KA 4Z9CB 1E2ZA 2F0HA 3T51B 5I2XA 1E2WA 2D0PA 3PIP3 4GKJL 3J7AV 1CHPD 2UXDQ 2PZWA 2ZTCA 4RCOA 2JA7H 1DM0B 1HPCA 1K3RA 4DK3C 2I5HA 1PH7A 3J7A5 2K5VA 1YNND 2IPKD 5C4XG 1YITA 1EL0A 2Z4HA 1DGSA 5G3LD 4TQUS 1PFMA 4LFAL 1UWVA 1EQQA 1HRJA 1L0YB 4GLAC 2O5JC 5JOBA 4UAIA 2B63H 4XT3B 1BBWA 2N55A 3I4NH 1IKLA 2JA6G 4DR1L 3AFPA 2F0DA 2PQAB 4F88A 4JI3Q 1CQFA 3TSSA 1TWGB 4E6IA 3T1YQ 1OTCA 1LM0A 3MTSA 4K5WA 4J1MA 5M3FB 2NZ1D 1Y1VH 5JEAG 3KDFA 4DAYA 2CQAA 4A3FH 3GQBA 5IGGA 4L5TA 3K0YA 1IL8A 2KUMA 2EY2A 4P73A 4HJ5A 4A3MH 4LFBL 3F2UA 5M5WH 2IY5B 4U673 3R8BA 1GOZA 4LF4L 2HT1A 4DXFA 3GDEA 4DR6Q 2SNMA 4GKKL 4FF1A 1EEFD 1PFBA 3PUVA 1I4PA 3V96A 1I5FA 3S17H 2CW0D 4IURA 3WOEA 3TMEA 4A75A 4C1NI 3HOWG 5IT9c 1KRTA 3H0GH 4QJFA 4ZAIA 1UE6A 2C35B 1RTOA 1OXSC 1TT2A 3KLRA 4C3JH 1EFID 5HURA 4BBRH 5GAEC 1Q82C 1A6XA 2NB0A 1PVOA 1V43A 4JI4L 1W6KA 2MQHA 1Q3LA 1RIPA 3CW2C 3L0OA 2F0GA 1SFOB 1E1TA 4K2LA 5C3EH 4CDFC 3SVMA 2WINB 2EYFA 1E24A 1RTNA 5BN3A 4A3KB 3MZ5A 1CTMA 2ASBA 4DR3L 3R3OA 1QJOA 1D7QA 5GQOA 2B63B 3W1BA 3GTJH 4DAPA 2E8GA 1XNQL 5EKIA 3L2PA 4IUTA 1BKBA 1Q8IA 4KKUA 3U4ZA 4A3JG 5K36H 1LUZA 2A1AA 3MHBA 3J81i 1Y8NB 1YJ9A 3S1QB 3OWFA 1TIID 1XXGA 3CMAA 1X54A 1A0IA 1KIXA 4C3IG 1JOQA 3J81c 4C3HH 1N33Q 3N6RA 3CRLC 3SE0A 2JA5B 4RH6A 2MGSA 3NELA 1IBLQ 4LF6L 4K0KL 1B4OA 1E2VA 4V0BA 4OELB 3KF6A 5JVH3 2UU9L 1Z9FA 2B3GA 1TVXA 5D3IB 1SE8A 4A93G 1CI3M 1R9TB 2Z1CA 2LFNA 4RAUC 1VQLA 2ZM6Q 3VYRA 3S16H 5HGTA 2WFWA 3EROA 4J6HA 1STHA 3HOXH 3S17B 4X3KA 1SLJA 4A4IA 4DR5L 1EOTA 1XX8A 3V2TA 3B6YA 3M4OB 4GN3B 3X3MA 4KHZA 4JI2Q 5C3XA 4MTNA 5M5XB 1SNCA 2F3VA 2I5LX 3TRZA 4O1NA 1L1OA 4LFCQ 1ESRA 4LUOA 1H9JA 2OXPA 2AKWB 3HG9A 5E4WC 2BH2A 2E75C 4CDCC 1QWYA 4OXPA 5IYBG 4H7BA 2L11A 1EY9A 1CZGA 3U9SA 3BYTB 1HH2P 3D6WA 4NB3A 4L5QA 2AMCB 4FXGC 5AFWA 1BOSA 4HR7B 1AN8A 2RBMA 3E0JA 4DV4Q 2MP1A 4A3KH 1KHIA 4WORA 5K36G 2Z6KC 3PIOA 1PTOF 3RMHA 1BR9A 1GKHA 1L2FA 5I9PA 3I4NB 5IYDG 2EOTA 2WKDA 1GUWA 1G6ZA 3KLSA 4RCNA 4IFDG 2YU9H 4MZ9A 5M3FH 2UUAL 1BCPC 3Q0AA 1WTPA 2UU9Q 4WFN3 5C0XH 2WAQG 3LGJA 1IW7D 2VL6A 2WB1B 4LF7L 3C3LA 5IGFA 4YY3L 1PYWD 5IT9L 1PH3A 4LF6Q 1PH9A 1MHWC 1TWCH 3VA5A 3GTMB 3J7AF 1X3EA 1A2TA 2NN6H 2WB1G 4A76A 4XYOA 2K4KA 1VQ7A 3KBXA 2NVYH 2R61A 3MXPA 2Q8IB 4ZCKA 1WTHA 5CR3A 5FOBB 2KVMA 1L1OC 1WCMH 2NTSA 1K8MA 1SNDA 1SRUA 2CVRA 1G2TA 2ZTEA 4P72A 1C48A 3P7JA 3FMCA 1XMOL 4DV1Q 2IX3A 4K5XA 1KQSA 3K0XA 2F3IA 3A7AB 4R8IA 5ELDA 4DK0A 4HJAA 1HCZA 1STAA 2B2YC 4IALA 3J80L 2XWJB 1LTRD 2CHBD 1U0LA 2OTJA 3FHWA 1PRTF 3M4YA 1G91A 4RGTA 4MHEA 1OXXK 3GTPB 2R7ZB 5D65A 1XTCD 2VUMH 4GKJQ 2D9UA 2ZXRA 3A0JA 2L5TA 1LT5D 1EYGA 2JA5H 2KBNA 3U9OA 1UEAB 4LW1A 1XNRQ 1A62A 2BH8A 4GLVB 3I4NG 4YHHQ 2XRSD 1M1KC 5DM63 1KNEA 2B2VC 3H3VI 4APVA 3J80c 3TP7A 4HJ9A 4BBRG 1ENAA 5CYUA 2VQEL 1EIHA 2WIIB 1WJJA 3CPFA 1HTLD 2Z6BA 3QG1A 2JA7G 4JV5Q 4GOPC 2R93B 4DUYL 1LTAD 2O2LD 1O7IA 2G5DA 2NZHA 1I3QB 2EJFC 2NTTA 4BBSB 1PZKD 1Q90A 1RF2D 1V1OA 3K5LA 2CWAA 1TWCB 2NVTH 1ICWA 2IWHA 2VXWA 2Q2HA 1K83H 4G7HC 4QUFA 1V1PB 3T16A 3HGBA 2HQLA 5J39A 3TP8A 2PW7A 3D6CA 1LABA 4X65L 3ND9A 5LMUQ 1I6VC 1SEBD 2A68D 2AQ1B 3MFGA 4RGOS 4H02A 4HSPA 4UP8A 4DAMA 2PQAA 3AFQA 3P20A 2OQKA 3CCEA 1TY2A 5L37A 2I07B 2SOBA 1NUCA 3BDCA 4KY7A 1A15A 3DLLA 1SN8A 2QEJC 1AP0A 3RZDB 1KDCA 1XYIA 1NTGA 1HNZL 2K52A 5IGCA 1SYFA 4DV4L 4LFCL 3SK6A 3FPPA 2K5DA 1QZHA 4AYBG 2GN5A 1NY4A 3HS0C 3CD6A 1VQNA 3TZDA 3ICEA 1LLRD 5C4HA 1PH4A 4OWTB 1QE6A 4L5SA 1GUNA 4LF8L 4HIKA 2CCZA 4HTHA 5COYA 3K7AH 1HNZQ 1Z6HA 1I94L 5KYIA 3BZCA 2WP8J 3SDZA 4HAEA 4NXML 4XDXA 5IWAL 2HHHL 3J7ZC 2MNAA 3VYTA 2KA7A 1PZID 5C5MA 2AUKA 2VUMG 2UUBQ 3I4LA 2CQOA 4OGQC 2E2IB 4B08A 5IP7H 2KOLA 1NR2A 4DR2L 3S1QH 2TSSA 1U4LA 1EY4A 2OWOA 5ELOA 3CCSA 5LMUL 4A3BH 2Q8TA 2L15A 3W1GA 4X6AH 1AFPA 1EYCA 1XTDA 2HCCA 2Z8LA 3URYA 3NUCA 4J15A 1PYSB 3H09A 3SK8A 2QEXA 1G291 1UUPA 2UXBQ 1HUNA 2EYMA 4M1UB 4CKEA 2NYZD 1K0SA 2SNSA 3NK9A 1JJCB 3JAMc 4IOAA 5ELFA 1CKOA 3S1MB 3J7YW 1OO9B 5KRUA 5C4ZA 4V190 1LTLA 2EY6A 5J3BA 4EQPA 3HP3A 4JI0Q 1FD7D 5FLXc 3RN5A 4ABNA 1UE1A 2OEOA 4ZUJA 3LWEA 4AYBB 1NCVA 3TDQA 3F2DA 5AJ3Q 2EDGA 2UUBL 1S4ZA 1KL9A 3GTLB 3DEPA 4BA2I 2FINB 3H3VC 3C46A 4JI3L 1HQMC 1AEXA 4NP5A 1HA6A 3BZDB 4DKAC 2E2HB 1VQDA 1YHAA 1HZAA 3ZJYC 4LF5Q 1P16A 3QOJA 1F77A 3HOWB 3KYHC 5IGBA 3T1HQ 2WV6D 1Q1EA 3X3NA 2KQ3A 2O4XA 3BYYB 3MWYW 5A2QE 4A3BG 1DOKA 2K03A 2PNRC 2ALYB 2XNAC 2L4NA 4IO9A 4TSSA 4RHSA 4X66L 1CT1D 5CBAE 1Z47A 3I4MB 2YTYA 1VF5C 1KLUD 1PRTB 1EY6A 1GD7A 1FYCA 3RZOH 1RODA 4KJOA 2MFIA 1UE7A 3PO2G 5K5PA 4RMFA 4XQQA 4NXNQ 4MIUA 3H0GB 1ET6A 4K14A 4B3RL 4C2MB 4A3DB 4OX9L 2VB3X 3MA2B 3T56B 3DWQA 3NTKA 4LK1C 2SDFA 1LYLA 2EXZA 2I0QA 1DOLA 3AMUA 1ML0D 4J8QA 2Z9HA 3ER0A 2Q2IA 2F0EA 4RG1A 3OSOA 2EXDA 1Y69U 4R9WA 3FKIB 4N8X1 3G7LA 2ZJQA 1MI2A 3OTOL 4B3MQ 4QQBX 3UDXA 4A3MG 3V05A 1PH6A 3T1HL 1FR3A 3OIPA 3UI2A 1HNWQ 3MXNA 4RKLA 1GUOA 1I4GA 2K33A 4BXXG 2QF7A 1SNOA 1Z7TA 2F3WA 2B2TA 2K32A 3NWSA 3RZOB 3BJUA 3M3YB 1Q12A 5DNFA 1PZJD 3L9AX 4CJ2C 1SMYC 2EIFA 1NMGA 5JJLA 1O78A 3F8TA 3I3CA 4DUZL 5T1IA 3RLFA 3K58A 1C4QA 1T5XD 2B2VA 3KF8B 3TP5A 4BY1H 4P71A 1JCKB 5FLXE 4PMCA 2X69A 2PW5A 1EIGA 3A8JE 4KD3A 3D4RA 4AQYL 1ICFB 2A73B 5EPJA 4TVAB 1EY0A 4PZ7A 5I6WA 5BR8L 2E5LL 2JJQA 1VS0A 2F1MA 4LMQD 2WAQE 1YNJC 1S5CD 1X3QA 2K05A 2XIWA 4PNYA 4PMWA 5JPNC 2FJ2A 1V9PA 1C9OA 3S14B 1SFOH 3QR8A 1EFWA 4LFBQ 1VQKA 2JK8A 1JJ2A 4L6TB 1S5BD 5LL6X 1VQ8A 2EYPA 3FRPB 4DV3Q 2OTLA 2RKSA 3MXUA 2RSOA 5D3DA 3MEHA 2TMPA 4FF3A 2X6LA 2CKZB 3GO5A 5JJKA 1RHPA 1X65A 1Q7YC 1XPRA 1XMQL 1IYUA 4BXXH 2YTXA 2G9HD 2E2JB 4IOCA 4X3SA 4ZQ3A 5IWAQ 3RUZA 3GV6A 1EWHA 1YJNA 2R7FA 1H9KA 3GP7A 2H5XA 4GN4B 4I7ZC 3HOVG 3TP6A 3ULJA 2IHFA 4BY1B 3O13A 4KK7A 4G4KA 1SBBB 4DK1A 2RHSB 2RDGA 3D8GA 3GD7A 3TEHB 4X65Q 3A55A 4JI0L 4Y52H 3EVQA 4JI7Q 4UDUC 2A6HD 2Y0SE 1VQ4A 4A3GH 3A54A 1A2UA 1LACA 2NVXB 4JPBW 4Q0FA 2EJMA 1EQVA 2R7ZG 4QIWE 1PH8A 2EPBA 1YVCA 5KYLA 3AYHB 5F2DA 4GNXC 2E76C 3GTKB 4O2DA 3HFZB 5LMNL 1NSNS 3C2PA 3RN2A 3M4OH 3K7UC 3I91A 4QY7A 4S3SA 1MSGA 2D0OA 2ZJRA 2E5LQ 2EZVA 4KN4C 1U4RA 3Q6SA 4HJ7A 4DR2Q 4LF7Q 2HUGA 1VQFA 1KDAA 2E2HH 2A69D 5EPKA 1LTSD 3SR1A 1Y1VG 3M4QA 1EWCA 4MN3A 4RA8A 2NZOA 5JEAH 3Q23A 3STBD 3MXGA 4PQXA 1E0BA 4QUCA 1VQ6A 4Y7NB 1FGBD 1PYBA 4R4TA 1ASYA 3NWTA 2Z6KA 3FKIH 3PCOB 1II3A 1F9RA 2ATWA 5LHY1 2D5DA 2RF4A 2KEEA 3FVQA 2AQ3B 3IKJA 4FXKC 1IBMQ 3PQIA 2ICEC 2EYHA 5CGKA 4JYAQ 1Y8PB 3H94A 2JA8B 5I9OA 1FGUA 2VQFQ 4AIMA 2MHVA 3RNUA 4JI5Q 3H0GG 4IJHA 4CHTB 2E2IH 2A8VA 4WRDA 1JICA 1B44D 5I4DA 2NVQH 1X9NA 3W3AA 3AB9A 1TWGH 1MKHA 4UPAA 1B9NA 1QVCA 1IYJB 2JEAI 2PI2A 4IFDJ 1SROA 3TS2A 3J81j 4HMIA 5LMNW 4OX9Q 1PFSA 1TWHH 4C3IH 2KHSA 2RHQB 4JI6L 4PV1C 3KJOA 2EQSA 4HMJA 3CQZB 1VQMA 2YTVA 3D31A 4CKBA 4DR7L 1RJTA 1IZ6A 3PUWA 2O5IC 1SAPA 2F0UA 3FP9A 3IRBA 2BDNA 1DOMA 1K8GA 3I2ZA 3J81E 2HHHQ 5ELCA 4DK6C 4ZRZA 2BA0A 4AYBE 5DAUA 1DCZA 4WJ4A 5IODA 4HIMA 1RD9D 1KABA 1ET9A 4YCUA 2RDHA 1BVSA 4BA1I 1Q46A 1TWFB 3BVGA 3TZUA 5DM73 2A19A 3PO3G 2JE6I 1XNQQ 3HKZB 3K6OA 3HOYG 4FXDA 1O7LA 4R4CA 4L63B 1GUSA 1EQTA 3C1EA 1HZCA 4KKSA 5CORA 4DN4M 3K57A 3S1RH 4LF5L 4IPDA 2F0MA 1SJHD 2NBFA 3BZKA 1B7YB 3G4SA 1K83B 1WTOA 2VY3A 2F4IA 1SE3A 3DUZA 1VQAA
chains in the Genus database with same CATH topology
4NDXA 3NQIA 1EU4A 2IJ0A 4N9PA 1JR0D 3CRKC 3DWPA 3PUXA 2L1BA 2A6EC 4O42A 2NVQB 4ZLTF 5FLXL 2RSNA 1NAPA 3M85A 1YNNC 1EEID 2WACA 2B2UA 2DNCA 2HCIA 4KKTA 3NXWA 3MFYA 3S9WA 2B2TC 3DXJC 2F0OA 1S5FD 2VUMB 3KUPA 2A6ED 4QF4A 3NHHA 2KCNA 1D5ZC 1CA5A 3NP8A 1PRTD 2NWGA 1OXVA 4IUUA 1SYBA 1I4XA 3GV3A 5IT9E 4K2KA 2V4DA 5T1GA 4L8JA 1D2BA 1LTTD 4FYDA 1QILA 2XWBB 4OL7A 5E1FA 2D2CC 1STYA 4DNTB 4B9XA 5FKAC 3I73A 1FNUA 1RCVD 2J4XA 4M8AA 1QB5D 5KEEA 3FDTA 1VMPA 4A3EB 3K5OA 1PTOC 2XRQD 1WD0A 4G7OC 4RGNA 5NUCA 4GZYC 1IYVA 1LV9A 3K5NA 4KN7C 2LMCB 4IUQA 1CK1A 2M2LA 1D5MC 4XYQA 2PO4A 1Y1WB 2IT1A 3L7ZC 2EVBA 2QILA 4K8JA 1TWHB 3VYUA 2X6GA 2DN8A 4ZYSA 5C4XB 1TS3A 2K5WA 5M5YB 2MJ8A 2QCPX 1TWAB 2M00A 2F0QA 5EQ0A 1GHKA 1VDZA 2EYJA 3PO2B 4U68A 5E4XA 1KAAA 1CQVA 5EBDA 5CC4A 2G9DA 1K8OA 4H44C 5FO8B 1O80A 1JC7A 3LNNA 1CZWA 4C3IB 4A3FB 3PUZA 1SYCA 2IX0A 5I2YA 2IL8A 2WKCA 2KJXA 4XQJA 5M5WB 3JAML 3QB3A 1B2TA 2YU9B 5M3MB 1LO5D 3PIO3 1HFGA 5C0XI 2PQEA 3NSWA 1D5XC 1Y8OB 4Q5VA 1AZQA 3NTHA 2K04A 1EY5A 2FFKB 2N88A 4IQZA 3K7AB 1TS2A 5FO9B 1U4PA 2E74C 2F0PA 3P1HA 3TBIB 2Z4IA 1QNUA 3K59A 5C6AA 1MGSA 3SEBA 3CHBD 3CU7A 4FVMA 1I4RA 4BS9A 1G8ZD 3OWEB 4C1NK 1SNPA 5KNBA 1LTGD 3K5MA 2F0WA 4KHVA 4CKCA 1H9SA 1NR4A 4A3GB 4ODGA 4FO2A 3DM1A 4X3UA 4NW2A 2H4OA 2L12A 3ITPA 5JJZA 4DA2A 3IFDA 4OO1G 4KI0A 1SSOA 1BQQT 1F2ZA 2F0SA 1IW7C 1U9RA 2KEDA 1S5DD 2XVSA 1STGA 3M7GA 2RVLA 3HOVB 2KECA 1O7YA 1JWUD 2GA4B 3QWNA 5FO7B 1QNKA 3S2HB 3QOLA 1BXTA 1PXUA 2VB2X 1EU3A 3HOYB 3W2DA 1PTOD 4BY7B 1UNSA 4KMUC 5JAVA 1O7ZA 1T5EA 3SK4A 4KY5A 3VR5A 4BWGB 2HQEA 4RGMA 5JVG3 4QIWB 3GTJB 1GHJA 2Y0SB 1HTPA 2JYOA 3ERQA 4XXEA 1LT6D 1QG7A 1SYGA 2EJGC 3DHQA 1UAPA 2AQ2B 2LY7A 3I72A 4TRDA 3OOCA 4A3MB 4HSVA 1L0XB 2HDLA 1ZYRC 2OF1A 1KLGD 4EGVA 4JBWA 3EFXD 3IL8A 1JE4A 1CFMA 2MPMA 1SE2A 3HZXA 1SDFA 1HFNA 1FNWA 1GUTA 1WTWA 1BUVT 1B1ZA 1EYDA 3ZYYX 3GTQB 2F0IA 3P75A 1ZYRD 4C3HG 1Q1BA 4WJWA 2JA6B 1F2MA 2CW0C 4DFAA 2FMCA 2B2WC 1B3AA 2BA1A 4B9WA 2K28A 2DY8A 1ENFA 1VMCA 4RFBA 5J1ZA 2YYZA 5E3FA 1SYDA 2K6AA 4QB4A 1F2YA 1RDPD 4KV6A 2ZT9C 2F0JA 4OO1I 3T4AC 2LKVA 2Q8RE 3MVVA 1TS4A 2F0TA 4OHJA 2E2DC 1HHVA 1HQRD 4HCSA 3CKIB 4XTCS 4IFDH 2R3ZA 2ICIA 5EGTA 3N52A 1G2SA 1JWMD 5EKLA 2B2WA 4DGZA 4RWSC 4TKOB 1ZEQX 3BVZA 1CA6A 3A7LA 4ZUIA 5C0XJ 5CMDA 3BVMA 1B50A 4DAVA 3A56A 1ILPA 2XN9C 1EY8A 1HXYD 4A3JB 4ULLA 2PYKA 4KY6A 2B39A 4CJ0B 3OIQA 3A8IE 2ZXOA 2NUCA 3NE5B 1AW7A 5EJWA 3OPOA 3NPPA 4IZ8A 5LL6S 5C0XG 1DONA 4F8MA 2F0FA 2EY5A 1B53A 1U4MA 3R2TA 2A68C 4IFDI 5ISRA 3VR2A 4A3BB 3DMUA 3QO2A 3GTGB 5CV9A 2HDMA 1V8QA 3QJYA 2NVTB 4EVOA 1BO0A 1YNJD 3GTOB 1JOOA 2B8FA 3FPUB 3IFTA 1DYQA 1GJXA 2L9HA 4FP5D 2K7VA 1D1IA 2PCFB 4OIKA 5C3WA 3KBGA 5CV7A 2DNEA 3TN2A 1PDQA 4HEDA 3NQTA 4K6LA 3S1RB 1EY7A 2JSOA 1WD1A 3AU7A 1I50B 3LX0A 4CBVA 4QCLA 4ZKBB 4RKBA 3E6ZX 4F87A 5JEAJ 1TY0A 4ZKCB 1DJRD 4ID6A 4G57A 5I6YA 1PTOB 1H9SB 3EJIA 3PV0A 1JWSD 4XIGS 2A5HA 3PUYA 4KD4A 1Y1VB 4HCEA 3NBIA 1B9MA 1BCPB 2DY7A 2F0LA 4JK1C 1WCMB 2PZTA 1VCIA 1I4HA 3I70A 2EYLA 5EBCA 3T13A 3OMGA 2IW3A 1R4PB 1VF7A 4IUPA 3G6JB 4C3HB 1ONLA 3S1NB 1F9SA 1SE4A 4P2CB 1A3UA 2C5CA 1KDBA 3A8KE 4NKLA 3S15B 4DNRB 3D3RA 1ILQA 1BCPF 1JORA 1DZ1A 3H91A 3VA7A 4N9TA 4I65A 3RD4A 1W6JA 2WAQB 1STBA 2A6HC 1V1PA 4F7XA 5IOCA 4BBRB 2B2UC 3NTIA 4FNFA 1EZ8A 3FEWX 1A3TA 2PZUA 5KIXA 4ILWA 1AZPA 3OMCA 1IHZA 2J0TD 2NVYB 4C3JB 3D4DA 1I4QA 1KNAA 2RQXA 3HOUB 3DEOA 2JXMB 1BDOA 2F0VA 5C5LA 3I90A 5D14A 3BG3A 5IIFA 3OW7A 1SXTA 2H1EA 3KLSX 4FF2A 1CM9A 2D62A 2F03A 2PPBC 2AWNA 1XWEA 1PFNA 5C44B 4QMGA 4A93B 3BDOA 3R2IA 1S5ED 2BDOA 3ONAB 2C9OA 4XQNA 2AUJD 1H9RA 1TQOA 3WDNA 1LT3D 1H9MA 2BE5C 3MC0B 1DD2A 3H6MA 2OT2A 5M9OA 5A35A 2A69C 4IUVA 2L55A 4A3IB 1LTID 3BS1A 1CHQD 1PLFA 1JB3A 3HOXB 3VR4A 3PO3B 2XSCA 3IAYA 5IGDA 1HUMA 1TS5A 2A74C 4H13C 2K5QA 3L3OC 2RDFA 3J80E 2BOSA 1F9PA 1QOHA 1SNQA 4OO1H 1WTRA 2QKIC 5CBEE 2SEBD 2NN6I 2R92B 3ND8A 4FF4A 1MD2D 5EKKA 3J81L 5EPLA 4DU9A 1SJED 5BN4A 2KCCA 3Q24A 1MBYA 3HEJA 5KGUA 1SMYD 3PMFA 2FHTA 3I8ZA 3S2DB 1PTOH 5CV5A 5IGEA 3M7NA 2F0NA 2AWOA 2VNUD 5C3EB 1WTQA 1TU2B 5C4JB 3WOFA 3EQLC 5ELEA 1BF4A 1ZXTA 3VYSA 1GXDC 5FK9C 3T53B 4CJ1B 3SK5A 5DEHA 4R8NA 2K01A 4C56C 4DXGA 4EQOA 4ME5A 5ELBA 4ZK9B 1JQYD 1SYEA 3JAME 2ENBA 2RA4A 4IN3A 4LJZC 2J7ZA 4DF7A 1ZKOA 3Q22A 1R4QB 5KNDA 1QCBD 3NBHA 1BNZA 2EE1A 1MSHA 2PMZB 1HA5A 2EY1A 3SHLA 1WTXA 5A2QL 5CV6A 4PMBA 3EA6A 2JP1A 1M4VA 2QDBA 1F9QA 3MAQA 1D6EC 1ENCA 5G3LF 3OHXC 3VR6A 1EZ6A 1I6HB 2I46A 5CV8A 1EYAA 3E5SA 2EYOA 2ID0A 4X3TA 2JEBI 4NMZA 4LAAA 1F2LA 1FNVA 1DXMA 4H0LC 1LT4D 2K1BA 2BE5D 2MUYA 2B8GA 2R6GA 1ESFA 4YIJA 4EQNA 3C1FA 1JOKA 5CV4A 2FMMA 2BCOA 3HRZC 3S16B 1OXTA 1C8CA 5TSSA 1RKNA 1X32A 1M8AA 4RHRA 1BBXC 2IX1A 1D1KA 4K6DA 3HOZB 1X3PA 3LWUA 1WTVA 1BCPD 4G7ZC 2ZXPA 2NN6G 4K8IA 4HN7A 4C3JG 3BDLA 1WVLA 5KNCA 4OIJA 5J22A 2LS01 1TR5A 1STNA 3KF8A 2M9VA 1IKMA 1LTBD 3QIAA 3VR3A 1A3VA 1TKWB 2B2YA 1KTKA 1SNMA 3KK7A 1STEA 4IUNA 1J8IA 1GUGA 2JA7B 1PRTC 1OXUA 3R93A 3DWAA 1J9OA 3SXHA 2L0CA 1PMRA 4KTAA 5BN5A 4CGYB 3D4WA 4K5VA 4XT1B 5JPMC 4KJNA 2F0KA 4Z9CB 1E2ZA 2F0HA 3T51B 5I2XA 1E2WA 3PIP3 3J7AV 1CHPD 2PZWA 4RCOA 1DM0B 1HPCA 1YNND 2IPKD 1EL0A 2Z4HA 5G3LD 4TQUS 1PFMA 1HRJA 1L0YB 2O5JC 5JOBA 4UAIA 4XT3B 2N55A 1IKLA 2F0DA 4F88A 1CQFA 3TSSA 1TWGB 4E6IA 3MTSA 4K5WA 4J1MA 5M3FB 2NZ1D 5JEAG 4DAYA 2CQAA 3GQBA 5IGGA 3K0YA 1IL8A 2KUMA 2EY2A 3F2UA 4U673 3R8BA 1GOZA 4DXFA 2SNMA 4FF1A 1EEFD 1PFBA 3PUVA 1I4PA 3V96A 2CW0D 4IURA 3WOEA 3TMEA 4C1NI 4ZAIA 1RTOA 1OXSC 1TT2A 3KLRA 1EFID 5HURA 1A6XA 2NB0A 1V43A 1W6KA 1Q3LA 2F0GA 1SFOB 4K2LA 3SVMA 2WINB 2EYFA 1RTNA 5BN3A 4A3KB 3MZ5A 1CTMA 3R3OA 1QJOA 2B63B 4DAPA 5EKIA 4IUTA 1Q8IA 4KKUA 5K36H 3S1QB 3MHBA 1Y8NB 3OWFA 1TIID 1XXGA 4C3IG 1JOQA 3N6RA 3CRLC 3SE0A 2JA5B 4RH6A 2MGSA 1B4OA 1E2VA 4V0BA 5JVH3 1TVXA 5D3IB 1CI3M 1R9TB 2Z1CA 2LFNA 4RAUC 3VYRA 5HGTA 3EROA 4J6HA 1STHA 3S17B 4X3KA 1EOTA 1XX8A 3V2TA 3M4OB 3X3MA 4KHZA 5C3XA 5M5XB 1SNCA 2F3VA 4O1NA 1ESRA 1H9JA 2OXPA 3HG9A 5E4WC 2E75C 1QWYA 4H7BA 2L11A 1EY9A 1CZGA 3U9SA 3BYTB 3D6WA 4FXGC 5AFWA 1BOSA 4HR7B 1AN8A 2RBMA 3E0JA 2MP1A 4WORA 5K36G 1PTOF 3RMHA 1BR9A 5I9PA 3I4NB 2EOTA 2WKDA 1GUWA 1G6ZA 3KLSA 4RCNA 4IFDG 1BCPC 3Q0AA 1WTPA 4WFN3 5C0XH 1IW7D 2WB1B 3C3LA 5IGFA 1PYWD 5IT9L 3VA5A 3GTMB 3J7AF 1A2TA 2NN6H 4XYOA 3KBXA 2R61A 3MXPA 2Q8IB 5CR3A 5FOBB 2KVMA 2NTSA 1K8MA 1SNDA 2CVRA 1G2TA 1C48A 3P7JA 3FMCA 2IX3A 4K5XA 3A7AB 4R8IA 5ELDA 4DK0A 1HCZA 1STAA 2B2YC 4IALA 3J80L 2XWJB 1LTRD 2CHBD 1PRTF 3M4YA 1G91A 4RGTA 4MHEA 1OXXK 3GTPB 2R7ZB 5D65A 1XTCD 2D9UA 2ZXRA 2L5TA 1LT5D 3U9OA 1UEAB 2XRSD 5DM63 1KNEA 2B2VC 3TP7A 1ENAA 5CYUA 1EIHA 2WIIB 3QG1A 1HTLD 2R93B 1LTAD 2O2LD 1I3QB 2EJFC 2NTTA 4BBSB 1PZKD 1Q90A 1RF2D 1V1OA 3K5LA 1TWCB 1ICWA 2IWHA 2VXWA 4G7HC 4QUFA 1V1PB 3T16A 3HGBA 5J39A 3TP8A 2PW7A 3D6CA 1LABA 3ND9A 1I6VC 1SEBD 2A68D 2AQ1B 3MFGA 4RGOS 4HSPA 3P20A 1TY2A 2I07B 2SOBA 1NUCA 3BDCA 4KY7A 1A15A 2QEJC 1AP0A 3RZDB 1KDCA 1XYIA 5IGCA 1SYFA 3SK6A 3FPPA 2K5DA 3HS0C 3TZDA 1LLRD 5C4HA 1QE6A 1GUNA 4HTHA 5COYA 1Z6HA 5KYIA 2WP8J 3SDZA 4HAEA 4XDXA 3VYTA 2KA7A 1PZID 5C5MA 2AUKA 3I4LA 4OGQC 2E2IB 4B08A 2KOLA 1NR2A 2TSSA 1U4LA 1EY4A 2Q8TA 1AFPA 1EYCA 2HCCA 2Z8LA 3URYA 3NUCA 3H09A 3SK8A 1G291 1UUPA 1HUNA 2EYMA 4M1UB 4CKEA 2NYZD 2SNSA 3NK9A 5ELFA 3S1MB 3J7YW 1OO9B 5KRUA 5C4ZA 4V190 2EY6A 4EQPA 3HP3A 1FD7D 4ABNA 2OEOA 4ZUJA 3LWEA 4AYBB 1NCVA 3TDQA 2EDGA 1S4ZA 3GTLB 3DEPA 4BA2I 2FINB 3H3VC 3C46A 1HQMC 1AEXA 4NP5A 1HA6A 3BZDB 2E2HB 3QOJA 1F77A 3HOWB 5IGBA 2WV6D 1Q1EA 3X3NA 2KQ3A 2O4XA 3BYYB 3MWYW 5A2QE 1DOKA 2K03A 2PNRC 2XNAC 2L4NA 4TSSA 4RHSA 1CT1D 5CBAE 1Z47A 3I4MB 1VF5C 1KLUD 1PRTB 1EY6A 1FYCA 1RODA 4KJOA 5K5PA 4XQQA 4MIUA 3H0GB 1ET6A 4K14A 4C2MB 4A3DB 2VB3X 3MA2B 3T56B 3DWQA 3NTKA 4LK1C 2SDFA 2EXZA 1DOLA 3AMUA 1ML0D 4J8QA 2F0EA 3OSOA 1Y69U 4R9WA 3FKIB 3G7LA 1MI2A 3V05A 1FR3A 3OIPA 3UI2A 3MXNA 4RKLA 1GUOA 1I4GA 2K33A 2QF7A 1SNOA 1Z7TA 2F3WA 2B2TA 2K32A 3NWSA 3RZOB 3M3YB 1Q12A 5DNFA 1PZJD 3L9AX 4CJ2C 1SMYC 1O78A 3I3CA 5T1IA 3RLFA 3K58A 1C4QA 1T5XD 2B2VA 3TP5A 1JCKB 5FLXE 4PMCA 2X69A 2PW5A 1EIGA 3A8JE 4KD3A 3D4RA 2A73B 5EPJA 1EY0A 5I6WA 2F1MA 4LMQD 1YNJC 1S5CD 1X3QA 2K05A 2XIWA 4PNYA 4PMWA 5JPNC 2FJ2A 3S14B 4L6TB 1S5BD 5LL6X 2EYPA 3FRPB 2RKSA 3MXUA 2RSOA 5D3DA 3MEHA 4FF3A 2TMPA 2X6LA 3GO5A 1RHPA 1IYUA 2G9HD 2E2JB 4X3SA 4ZQ3A 3RUZA 3GV6A 1EWHA 1H9KA 3GP7A 4I7ZC 3TP6A 4BY1B 3O13A 4KK7A 4G4KA 1SBBB 4DK1A 2RDGA 3D8GA 3GD7A 3A55A 3EVQA 4UDUC 2A6HD 3A54A 1A2UA 1LACA 2NVXB 4Q0FA 2EJMA 1EQVA 2EPBA 5KYLA 5F2DA 2E76C 3GTKB 3C2PA 1NSNS 3I91A 4S3SA 1MSGA 2EZVA 4KN4C 1U4RA 3Q6SA 2HUGA 1KDAA 2A69D 5EPKA 1LTSD 3SR1A 5JEAH 4MN3A 1EWCA 4RA8A 3Q23A 3MXGA 4PQXA 1E0BA 4QUCA 4Y7NB 1FGBD 3NWTA 1II3A 1F9RA 5LHY1 2D5DA 2KEEA 3FVQA 2AQ3B 3IKJA 4FXKC 2ICEC 2EYHA 5CGKA 1Y8PB 3H94A 2JA8B 5I9OA 2MHVA 4CHTB 4WRDA 1JICA 1B44D 5I4DA 3W3AA 3AB9A 1B9NA 2JEAI 4IFDJ 4HMIA 2KHSA 4PV1C 4HMJA 3CQZB 3D31A 4CKBA 1RJTA 3PUWA 2O5IC 1SAPA 2F0UA 2BDNA 1DOMA 3J81E 5ELCA 4ZRZA 2BA0A 5DAUA 1DCZA 5IODA 1RD9D 1KABA 1ET9A 2RDHA 4BA1I 1TWFB 3BVGA 3TZUA 5DM73 2JE6I 3HKZB 3K6OA 4FXDA 1O7LA 3K57A 1GUSA 4DN4M 1EQTA 3C1EA 4KKSA 4L63B 5CORA 2F0MA 1SJHD 2NBFA 1K83B 1WTOA 2F4IA 1SE3A 3DUZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NDX A;  2SOB A;  5C6A A;  2EYO A;  3EJI A;  3TP5 A;  3SR1 A;  3R3O A;  3VA5 A;  5CV5 A;  1NUC A;  5IGE A;  3BDC A;  4KY7 A;  1A2T A;  3QOJ A;  3SXH A;  4ZUI A;  4N9P A;  2OF1 A;  4KTA A;  2F0N A;  4NMZ A;  2F0V A;  5IGB A;  3MXP A;  4KD4 A;  4LAA A;  3D4W A;  4K5V A;  1KDC A;  5C5L A;  1SNP A;  4PMC A;  4KJN A;  2F0K A;  4K8J A;  5IIF A;  3HZX A;  2PW5 A;  3MHB A;  2KQ3 A;  2O4X A;  2F0H A;  5CR3 A;  4KD3 A;  5IGC A;  1II3 A;  1SYF A;  3OWF A;  1EY8 A;  3SK6 A;  2F0W A;  1EY0 A;  2F0L A;  5I6W A;  1SND A;  2PYK A;  4KY6 A;  2PZT A;  2PZW A;  4KHV A;  1JOQ A;  5C4H A;  4PNY A;  1EYD A;  2EYH A;  2WAC A;  5CGK A;  2F0I A;  2M00 A;  2NUC A;  2EYL A;  2F0Q A;  3P75 A;  4QMG A;  4K5X A;  4HTH A;  3T13 A;  4IZ8 A;  3NXW A;  3OMG A;  4YIJ A;  5I9O A;  2EYJ A;  4EQN A;  5KYI A;  3S9W A;  4ODG A;  5JOB A;  1EY6 A;  2F0O A;  4F8M A;  1F2M A;  1STA A;  4IAL A;  3C1F A;  3SK5 A;  4DFA A;  1JOK A;  5DEH A;  2F0F A;  2EYP A;  4R8N A;  4KJO A;  1KAA A;  3ITP A;  4QF4 A;  4WRD A;  3NHH A;  2RKS A;  5CV4 A;  1TQO A;  2F0D A;  4B9W A;  3MEH A;  5K5P A;  5C5M A;  2EY5 A;  5CC4 A;  4EQO A;  4E6I A;  1F2Z A;  4ME5 A;  5HGT A;  2F0S A;  4MIU A;  1U9R A;  3ERO A;  1RKN A;  1STH A;  3NP8 A;  4J6H A;  4J1M A;  4K14 A;  3H6M A;  4K5W A;  5M9O A;  5J1Z A;  1SYE A;  1STG A;  4HMI A;  1A3U A;  2ENB A;  5I9P A;  5ISR A;  1KDB A;  4ZQ3 A;  5E3F A;  3RUZ A;  3V2T A;  4NKL A;  5IGG A;  3DMU A;  3U9O A;  1EY4 A;  1SYB A;  2KHS A;  4DF7 A;  1SYD A;  5C3X A;  4K6D A;  4HMJ A;  4K2K A;  5CV9 A;  2EY2 A;  2EXZ A;  3QOL A;  1SYC A;  4QB4 A;  1EYC A;  3TP6 A;  1SNC A;  1F2Y A;  2F3V A;  4KV6 A;  4EVO A;  2F0E A;  1JOR A;  3NUC A;  2F0J A;  1JOO A;  4OL7 A;  2EY1 A;  4N9T A;  3TP7 A;  2LKV A;  3QB3 A;  4K8I A;  3D8G A;  3OSO A;  3MVV A;  4I65 A;  2OXP A;  2F0T A;  5E1F A;  3SHL A;  3BDL A;  3SK8 A;  2F0U A;  1ENA A;  1STB A;  2SNM A;  5CV6 A;  3EVQ A;  4H7B A;  4PMB A;  2EYM A;  1STY A;  1EY9 A;  4F7X A;  2RDF A;  4B9X A;  5JAV A;  5IOC A;  5C3W A;  2QDB A;  1A2U A;  1SNQ A;  2SNS A;  3NK9 A;  2HQE A;  4KY5 A;  5CV7 A;  3SK4 A;  2PQE A;  3TME A;  1EQV A;  5DAU A;  1EZ8 A;  2RBM A;  5IGD A;  4RKL A;  5IOD A;  5J22 A;  4WOR A;  5C4Z A;  5KEE A;  5KRU A;  2EY6 A;  3NQT A;  1TT2 A;  4EQP A;  5KYL A;  5F2D A;  1TR5 A;  1KAB A;  1SNO A;  1EY7 A;  1NSN S;  1STN A;  2F3W A;  5EKK A;  1A3T A;  2PZU A;  5HUR A;  1EY5 A;  3ERQ A;  3LX0 A;  5EGT A;  2OEO A;  4ZUJ A;  3T16 A;  4DU9 A;  1A3V A;  1ENC A;  5KIX A;  1SYG A;  5J39 A;  1SNM A;  3OMC A;  3TP8 A;  4RKB A;  2PW7 A;  1IHZ A;  1EZ6 A;  3D6C A;  5NUC A;  4IUN A;  3DHQ A;  4S3S A;  2F0G A;  3C1E A;  3HEJ A;  4ID6 A;  4K2L A;  5CV8 A;  5EKL A;  5KGU A;  4G57 A;  1AEX A;  3D4D A;  5I6Y A;  2EYF A;  2F0M A;  3PMF A;  4NP5 A;  2F0P A;  4DGZ A;  3P1H A;  1EYA A;  3E5S A;  5IGF A;  4TRD A;  3MZ5 A;  1KDA A; 
#chains in the Genus database with same CATH topology
 4NDX A;  3NQI A;  1EU4 A;  2KHJ A;  1G51 A;  2IJ0 A;  4N9P A;  4JOI C;  1JR0 D;  1GVP A;  3W5O A;  2CH4 A;  3CRK C;  3DWP A;  3PUX A;  1PV4 A;  1N36 L;  1U5K A;  2L1B A;  3I56 A;  1XMQ Q;  2A6E C;  3D0F A;  1XMO Q;  4O42 A;  2NVQ B;  4ZLT F;  5FLX L;  2RSN A;  1NAP A;  3M85 A;  5IYC H;  3UE0 A;  5LMN Q;  4JBM A;  1YNN C;  1EEI D;  2WAC A;  2B2U A;  2DNC A;  2HCI A;  4KKT A;  3NXW A;  3MFY A;  4GKK Q;  3S9W A;  2B2T C;  3DXJ C;  2F0O A;  5IP9 H;  1IXR A;  1S5F D;  2VUM B;  3KUP A;  1FJG Q;  2A6E D;  4QF4 A;  3NHH A;  2KCN A;  1D5Z C;  2UUC Q;  1CA5 A;  2R92 H;  3S1M H;  3NP8 A;  1PRT D;  4X64 L;  2NWG A;  3RZD H;  1NJI C;  1OXV A;  3U4V A;  3T1Y L;  2KCT A;  1SYB A;  4IUU A;  1I4X A;  1VQE A;  3GV3 A;  5IT9 E;  2K5H A;  2V4D A;  4K2K A;  5T1G A;  4L8J A;  4K0K Q;  1D2B A;  1LTT D;  4FYD A;  3PO3 H;  1QIL A;  2XWB B;  4A3I G;  5DLQ E;  4OL7 A;  3HOZ G;  4JI6 Q;  5E1F A;  2LXK A;  2D2C C;  1STY A;  4DNT B;  4B9X A;  3ERS X;  5FKA C;  1I50 H;  3I73 A;  1FNU A;  1RCV D;  3UDG A;  2Q2U A;  2J4X A;  4M8A A;  4A3L H;  1QB5 D;  5KEE A;  2OQ0 A;  1T9H A;  4GS3 A;  4OON A;  4A3C G;  3FDT A;  1VMP A;  4A3E B;  3K5O A;  2Z0S A;  1PTO C;  2XRQ D;  1WD0 A;  3E3X A;  1HZ9 A;  4G7O C;  4RGN A;  1AE2 A;  2HIX A;  5NUC A;  5IYC G;  4GZY C;  4KHP Q;  1WYD A;  1IYV A;  2VW9 A;  2KHI A;  1LV9 A;  4DR5 Q;  3K5N A;  4KN7 C;  2LMC B;  4IUQ A;  4B3R Q;  5C3E G;  1AE3 A;  1CK1 A;  2M2L A;  1D5M C;  4XYQ A;  2ZM6 L;  2V1C C;  2PO4 A;  1Y1W B;  2IT1 A;  3L7Z C;  2EVB A;  2QIL A;  5FLM H;  3CC4 A;  3H3V H;  3J80 i;  1UE5 A;  4K8J A;  1TWH B;  1HR0 Q;  3VYU A;  2X6G A;  5HGQ A;  2DN8 A;  4ZYS A;  4OWW B;  5C4X B;  1TS3 A;  4DR6 L;  4X64 Q;  1VQ5 A;  3HKZ G;  2JQO A;  3CME A;  2K5W A;  5M5Y B;  2MJ8 A;  2QCP X;  1TWA B;  2RCN A;  2M00 A;  3PSI A;  1YIJ A;  1G6P A;  2F0Q A;  1XPU A;  5EQ0 A;  1GHK A;  4GNX A;  1YI2 A;  1VDZ A;  3OYY A;  2EYJ A;  3PO2 B;  4U68 A;  3CAM A;  3PO2 H;  5E4X A;  1SMX A;  1D8L A;  3G6E A;  4POF A;  1KAA A;  1CQV A;  5GRO A;  5EBD A;  5CC4 A;  4DUY Q;  2G9D A;  2DJG C;  4A3F G;  1K8O A;  4H44 C;  5FO8 B;  4OEM B;  1O80 A;  1JC7 A;  1N36 Q;  3LNN A;  1CZW A;  4C3I B;  4A3F B;  3PUZ A;  1SYC A;  2IX0 A;  2JA9 A;  1N34 Q;  4JI4 Q;  5I2Y A;  2IL8 A;  2WKC A;  3HKZ E;  2KJX A;  4XQJ A;  3A5U A;  3JAM L;  5M5W B;  3QB3 A;  3U58 A;  2WB1 E;  1B2T A;  1JE5 A;  3KDF B;  5IE8 A;  2YU9 B;  5M3M B;  1LO5 D;  3PIO 3;  1HFG A;  5C0X I;  3CC2 A;  2PQE A;  3NSW A;  1HNX Q;  3GTQ H;  3CF5 A;  1D5X C;  3G71 A;  5IY0 A;  1Y8O B;  4Q5V A;  1AZQ A;  3NTH A;  2K04 A;  3S2H H;  1EY5 A;  4EQ5 A;  3S15 H;  1KRS A;  2FFK B;  2N88 A;  4IQZ A;  3STB C;  4L5R C;  3K7A B;  3S14 H;  4DR4 L;  1TS2 A;  5FO9 B;  1U4P A;  2E74 C;  4ALP A;  4IPG A;  2F0P A;  3P1H A;  3TBI B;  2JN4 A;  2JA8 G;  2Z4I A;  1QNU A;  3K59 A;  4AQY Q;  1WFQ A;  5C6A A;  2F52 A;  1MGS A;  1SR3 A;  3SEB A;  4DR3 Q;  3CHB D;  3CU7 A;  1HR0 L;  4FVM A;  2ZJP A;  4JI7 L;  1I4R A;  3UDF A;  4BS9 A;  1PH1 A;  1G8Z D;  3OWE B;  4C1N K;  1SNP A;  5KNB A;  4GLX A;  4A3E G;  1LTG D;  3K5M A;  2F0W A;  1N34 L;  3CXC A;  4KHV A;  2VZA A;  2PNH A;  3ULP A;  4CKC A;  1H9S A;  4O0A A;  4BBS H;  1NR4 A;  1E1O A;  4AH6 A;  4A3G B;  4ODG A;  4FO2 A;  1E3P A;  3DM1 A;  4X3U A;  4NW2 A;  2H4O A;  1L0W A;  4A3D H;  2L12 A;  5M3M G;  1MJC A;  3ITP A;  4DV3 L;  5JJZ A;  2UXB L;  4DV2 Q;  1VQP A;  4DA2 A;  1YJW A;  3IFD A;  3ULL A;  4OO1 G;  4KI0 A;  1SSO A;  1BQQ T;  1F2Z A;  2F0S A;  1IW7 C;  1U9R A;  2KED A;  1S5D D;  3DM3 A;  2XVS A;  4R4I A;  1STG A;  3M7G A;  2RVL A;  3HOV B;  2KEC A;  1O7Y A;  1AH9 A;  1JWU D;  2GA4 B;  3QWN A;  5FO7 B;  1QNK A;  3S2H B;  3QOL A;  3F2B A;  1BXT A;  1PXU A;  2VB2 X;  1EU3 A;  2N8N A;  5C44 H;  3HOY B;  2MO0 A;  3W2D A;  1PTO D;  4JI8 Q;  4BY7 B;  1UNS A;  2R7D A;  4Y7N H;  4PZ8 A;  4KMU C;  4A3K G;  5JAV A;  4EX5 A;  1J5E L;  1O7Z A;  1T5E A;  3SK4 A;  4KY5 A;  3VR5 A;  2HQE A;  4BWG B;  3GTP H;  2QDL A;  4RGM A;  3UDI A;  5JVG 3;  4DUZ Q;  4UY8 C;  1I94 Q;  4QIW B;  1TWF H;  4R4O A;  3GTJ B;  1VQB A;  3KFU A;  2P5Z X;  3EIV A;  3H15 A;  1GHJ A;  2Y0S B;  1HTP A;  5IYB H;  4CDE C;  2JYO A;  3ERQ A;  4XXE A;  1CKN B;  4A3C H;  1LT6 D;  1QG7 A;  1SYG A;  1UEB A;  1HJP A;  3EBE A;  1Q81 C;  3GTL H;  1GO3 E;  1S3O A;  2EJG C;  2N3S A;  4YHH L;  3DHQ A;  4GOP B;  1UAP A;  2JA8 H;  2CH4 W;  2AQ2 B;  2LY7 A;  1HR0 W;  4DV7 Q;  4MTK A;  4X62 Q;  3I72 A;  4TRD A;  4A3G G;  3OOC A;  1I3Q H;  4A3M B;  4HSV A;  1TXY A;  1L0X B;  2HDL A;  1ZYR C;  2OF1 A;  1VQH A;  1KLG D;  4EGV A;  4JBW A;  3EFX D;  3IL8 A;  1JE4 A;  1CFM A;  2MPM A;  1SE2 A;  3HZX A;  1SDF A;  1HFN A;  5FLM G;  1Y1W G;  1FNW A;  1GUT A;  1WTW A;  1S72 A;  1BUV T;  1A8V A;  1B1Z A;  4HJ8 A;  4LUZ A;  1EYD A;  4LF9 L;  3ZYY X;  1XPO A;  3GTQ B;  2F0I A;  3P75 A;  1ZYR D;  4C3H G;  1Q1B A;  4WJW A;  5IYD H;  4CDD C;  2K75 A;  2JA6 B;  1F2M A;  2CW0 C;  4DFA A;  4B3S Q;  2FMC A;  3S2D H;  2B2W C;  1B3A A;  1B3Q A;  3CCV A;  4UHV A;  3S1N H;  4WJ3 M;  2BA1 A;  2F4V Q;  2F4V L;  4B9W A;  2ES2 A;  2K28 A;  1VQG A;  2DY8 A;  4DPG A;  1EUJ A;  3RR5 A;  5BR8 Q;  4P74 A;  5IP7 G;  2K50 A;  1ENF A;  1VMC A;  4RFB A;  5J1Z A;  1B8A A;  2YYZ A;  2B29 A;  5E3F A;  1XNR L;  1SYD A;  2DJF C;  2K6A A;  4LF9 Q;  3GTM H;  5C44 G;  4QB4 A;  3TS0 A;  1F2Y A;  1RDP D;  4KV6 A;  2ZT9 C;  5EAY A;  2F0J A;  4OO1 I;  1YNX A;  3T4A C;  4R1J A;  4QGU A;  2LKV A;  2Q8R E;  3MVV A;  1TS4 A;  2F0T A;  2MO1 A;  1YBY A;  4A3I H;  4JI1 L;  4OHJ A;  4JBK A;  2XGT A;  2E2D C;  3K80 C;  1C7Y A;  1HHV A;  1HQR D;  4HCS A;  1WI5 A;  1PH2 A;  4B3T Q;  4JI5 L;  3CKI B;  4XTC S;  4IFD H;  2XTI A;  2NVX H;  2R3Z A;  2ICI A;  5EGT A;  3N52 A;  2FXQ A;  1G2S A;  3RLN A;  1HNW L;  1JWM D;  3M4P A;  4I7A A;  4LF4 Q;  4JC0 A;  5EKL A;  2B2W A;  3PF5 A;  1VQI A;  1IBM L;  4BY7 G;  3KOJ A;  4DGZ A;  4DV6 L;  4RWS C;  4TKO B;  2GVB A;  1ZEQ X;  3BVZ A;  1CA6 A;  3A7L A;  4ZUI A;  5C0X J;  5CMD A;  2JA6 H;  3BVM A;  1N9W A;  3U50 C;  1B50 A;  1X6O A;  4DAV A;  2B63 G;  2DUD A;  3A56 A;  4IPH A;  1ILP A;  2XN9 C;  1EY8 A;  1HXY D;  2R7Z H;  4A3J B;  4ULL A;  2PYK A;  4KY6 A;  2B39 A;  4CJ0 B;  3OIQ A;  3A8I E;  2ZXO A;  2UUC L;  2NUC A;  3NE5 B;  1AW7 A;  5EJW A;  2VS1 A;  3OPO A;  3NPP A;  1N32 L;  4IZ8 A;  5LL6 S;  3JAM i;  4UP7 A;  5C0X G;  4KHP L;  3PF4 A;  1DON A;  4F8M A;  4X66 Q;  4GOP A;  2F0F A;  3CCL A;  1R9T H;  2EY5 A;  1B53 A;  1U4M A;  3R2T A;  4DV5 Q;  2YV5 A;  4BBS G;  2A68 C;  2R93 H;  4IFD I;  1B70 B;  5ISR A;  3VR2 A;  4A3B B;  3DMU A;  3QO2 A;  1EIY B;  3GTG B;  3PGZ A;  5CV9 A;  4DV2 L;  1PHJ A;  2HDM A;  1V8Q A;  3QJY A;  2NVT B;  4EVO A;  1JJG A;  1BO0 A;  1YNJ D;  3GTO B;  1JOO A;  2B8F A;  3FPU B;  3IFT A;  3TRE A;  1DYQ A;  1GJX A;  2L9H A;  4FP5 D;  2K7V A;  1D1I A;  2PCF B;  4OIK A;  5C3W A;  3KBG A;  5CV7 A;  3RLO A;  5C4J H;  5AJ3 L;  3TQY A;  2DNE A;  5E7N A;  1Y1W H;  3F1Z A;  3TN2 A;  1PDQ A;  4HED A;  4LWC A;  3NQT A;  4K6L A;  1JMC A;  4NXN L;  3GTK H;  3S1R B;  1CUK A;  1EY7 A;  2JSO A;  1WD1 A;  3AU7 A;  3UE1 A;  1I50 B;  3LX0 A;  4CBV A;  4QCL A;  4ZKB B;  1PA6 A;  4RKB A;  3E6Z X;  4F87 A;  1E7Z A;  5JEA J;  1TY0 A;  4ZKC B;  1DJR D;  3S24 A;  4ID6 A;  1W3S A;  4G57 A;  5I6Y A;  3VDY A;  1VQC A;  3A5Z B;  2HIV A;  2QGQ A;  2PMZ E;  1PTO B;  1H9S B;  4JBJ A;  3EJI A;  3PV0 A;  1JWS D;  1FL0 A;  4XIG S;  2A5H A;  3PUY A;  2CWP A;  4KD4 A;  1QVG A;  2AHO B;  3I55 A;  3AQQ A;  1Y1V B;  2LXJ A;  1JT8 A;  4HCE A;  3NBI A;  1B9M A;  4YY3 Q;  1HZB A;  1BCP B;  2DY7 A;  2F0L A;  4JK1 C;  1WCM B;  1NBW A;  3CCU A;  2GVA A;  2PZT A;  3CC7 A;  1VCI A;  2UUA Q;  1Q8K A;  1I4H A;  3I70 A;  4YCW A;  2EYL A;  2Q2T A;  5EBC A;  3T13 A;  3E9I A;  3OMG A;  2IW3 A;  4FDB A;  1R4P B;  1VF7 A;  2KEN A;  4IUP A;  3OW2 A;  3G6J B;  4C3H B;  3I4M G;  1ONL A;  1YHQ A;  2K14 A;  3S1N B;  3WWV A;  1L1O B;  1F9S A;  1SE4 A;  4P2C B;  4YWK A;  3NEN A;  1A3U A;  2C5C A;  1KDB A;  3A8K E;  4NKL A;  3S15 B;  4DNR B;  3D3R A;  1EIF A;  4DV5 L;  1ILQ A;  4LUV A;  1KXL A;  1E22 A;  5M3M H;  4A93 H;  1BCP F;  3CCM A;  5M5Y H;  1JOR A;  1DZ1 A;  3EN2 A;  3H91 A;  3VA7 A;  3E9H A;  4N9T A;  4I65 A;  3RD4 A;  1W6J A;  2WAQ B;  1STB A;  2A6H C;  1V1P A;  4JI1 Q;  4DR1 Q;  5FJ8 H;  4F7X A;  5IOC A;  1MIU A;  4C2M H;  4BBR B;  2B2U C;  3NTI A;  4FNF A;  4YCV A;  1EZ8 A;  1VQ9 A;  3FEW X;  1A3T A;  2PZU A;  5KIX A;  4ILW A;  1AZP A;  3OMC A;  1KD1 C;  1IHZ A;  1QZG A;  4DR4 Q;  2J0T D;  1N33 L;  2NVY B;  1X55 A;  4C3J B;  3D4D A;  2VQF L;  4JV5 L;  1I4Q A;  1M90 C;  4B3S L;  4JYA L;  1KNA A;  2RQX A;  3HOU B;  1YHB A;  3DEO A;  3K8A A;  3HOU H;  1BBU A;  2JXM B;  1BDO A;  1CSQ A;  1GM5 A;  4LNQ A;  2F0V A;  3CQZ H;  5C5L A;  3I90 A;  3CP0 A;  5D14 A;  3BG3 A;  1TWA H;  5IIF A;  3OW7 A;  1SXT A;  3KJP A;  2H1E A;  3KLS X;  4FF2 A;  3JC6 6;  1K73 C;  4DNI A;  1CM9 A;  2D62 A;  1N8R C;  3HOY H;  2F03 A;  5H1S E;  2PPB C;  2AWN A;  1XWE A;  4DV0 Q;  1PFN A;  1QUQ A;  5C44 B;  4QMG A;  4A93 B;  3BDO A;  3R2I A;  1YEZ A;  1I6H H;  2IHE A;  1S5E D;  2BDO A;  3ONA B;  2ZTD A;  3HOV H;  4DV1 L;  2C9O A;  5GAD C;  4XQN A;  2AUJ D;  1H9R A;  1TQO A;  3BU2 A;  3WDN A;  1LT3 D;  1H9M A;  2BE5 C;  3MC0 B;  1DD2 A;  4KLK A;  3H6M A;  2OT2 A;  5M9O A;  5A35 A;  2A69 C;  4IUV A;  4YWL A;  2L55 A;  1HNX L;  4A3I B;  1ASZ A;  1LTI D;  3BS1 A;  1CHQ D;  1PLF A;  1JB3 A;  3HOX B;  3VR4 A;  1KAW A;  3PO3 B;  2XSC A;  3IAY A;  2UXC Q;  5IGD A;  3CCQ A;  1HUM A;  1TS5 A;  2A74 C;  4H13 C;  1CKM A;  2K5Q A;  3L3O C;  2RDF A;  3J80 E;  2BOS A;  1IBK Q;  1F9P A;  1QOH A;  4DR7 Q;  1SNQ A;  4OO1 H;  1WTR A;  2QKI C;  5CBE E;  2SEB D;  2NN6 I;  1EOV A;  3CCJ A;  4A3D G;  2R92 B;  1KC8 C;  3ND8 A;  4LFA Q;  4FF4 A;  1MD2 D;  5EKK A;  3J81 L;  5EPL A;  1MJE A;  4IJL A;  4DU9 A;  4OWX B;  1IBK L;  1SJE D;  5BN4 A;  1VQJ A;  2KCC A;  3AEV A;  3Q24 A;  3I4M H;  1NNX A;  4P75 A;  3M9B A;  5IP9 G;  1MBY A;  1CSP A;  3HEJ A;  5KGU A;  1SMY D;  3OTO Q;  1NMF A;  3PMF A;  4B3M L;  3FKI G;  4X62 L;  3SGI A;  4BY7 H;  2FHT A;  3I8Z A;  3S2D B;  1PTO H;  3KLW A;  4A3J H;  5CV5 A;  5IGE A;  3M7N A;  2F0N A;  3K81 C;  2AWO A;  2VNU D;  5C3E B;  1WTQ A;  1TU2 B;  5C4J B;  3WOF A;  3EQL C;  3I7F A;  5ELE A;  4JI2 L;  1BF4 A;  4GN5 A;  1ZXT A;  1N32 Q;  3E0E A;  3VYS A;  2I5M X;  5FJ8 G;  1GXD C;  5FK9 C;  4R4Q A;  1WCM G;  3HOX G;  2E2J H;  3CPW A;  3T53 B;  3HOZ H;  4CJ1 B;  1PH5 A;  4JVZ A;  3SK5 A;  5DEH A;  4R8N A;  4QL5 A;  2K01 A;  4IPC A;  4PZ6 A;  4C56 C;  4JOI A;  4DXG A;  4EQO A;  1CKN A;  4ME5 A;  1XJV A;  5ELB A;  4ZK9 B;  1X3F A;  1JQY D;  1SYE A;  3JAM E;  2ENB A;  2R92 G;  2RA4 A;  4GNX B;  4IN3 A;  4LJZ C;  4DV6 Q;  2J7Z A;  4DF7 A;  1ZKO A;  3Q22 A;  1R4Q B;  2KCM A;  5KND A;  5HY6 A;  1EQR A;  1QCB D;  4POG A;  4DV7 L;  1P8L A;  3NBH A;  1BNZ A;  2EE1 A;  1MSH A;  2PMZ B;  1HA5 A;  2EY1 A;  3MXN B;  4B3T L;  3SHL A;  1WTX A;  5GAH C;  5M5X H;  5A2Q L;  5CV6 A;  4PMB A;  2N49 A;  3EA6 A;  2JP1 A;  1M4V A;  2QDB A;  1QVF A;  4A3L G;  1RL2 A;  2QW7 A;  5GAG C;  2QA4 A;  2R93 G;  1F9Q A;  1K0R A;  3MAQ A;  3MEF A;  3Q8D A;  1J6Q A;  1D6E C;  1ENC A;  5G3L F;  3OHX C;  3VR6 A;  1EZ6 A;  1I6H B;  2I46 A;  5CV8 A;  4JG2 A;  2N78 A;  3HOW H;  1EYA A;  3E5S A;  3I4O A;  2EYO A;  5ELN A;  1K9M C;  1IL2 A;  4DAY B;  2ID0 A;  4X3T A;  2JEB I;  3KF6 B;  1FJG L;  4NMZ A;  1Y14 B;  4LAA A;  4YWM A;  4N8F A;  2VQE Q;  3GTG H;  1K3B C;  2Y0S G;  1F2L A;  1FNV A;  1H95 A;  1DXM A;  4H0L C;  1LT4 D;  2K1B A;  2JA5 G;  2BE5 D;  2MUY A;  1YZ6 A;  2PI2 E;  3GTO H;  4UP9 A;  4DV0 L;  2B8G A;  2R6G A;  3CCR A;  1ESF A;  1QUQ B;  2K5N A;  4YIJ A;  4EQN A;  4HID A;  4NXM Q;  3C1F A;  1JOK A;  1X3G A;  1V1Q A;  2RCF A;  4NPS A;  5CV4 A;  2FMM A;  2BCO A;  3HRZ C;  1WOC A;  3S16 B;  1OXT A;  3NBH B;  1C8C A;  3G48 A;  5TSS A;  1RKN A;  1K28 A;  4PG3 A;  2UXC L;  5C4X H;  2DGY A;  1X32 A;  1M8A A;  4RHR A;  1BBX C;  2IX1 A;  1FVI A;  1D1K A;  2LSS A;  3NEM A;  4K6D A;  3HOZ B;  1S40 A;  1X3P A;  3LWU A;  1WTV A;  1BCP D;  4G7Z C;  2ZXP A;  1Q86 C;  2NN6 G;  4K8I A;  4HN7 A;  4C3J G;  3BDL A;  4BY1 G;  1NE3 A;  2CFM A;  1WVL A;  3HKS A;  3HOU G;  3PIP A;  2OCE A;  5KNC A;  1J5E Q;  4ME3 A;  2HD3 A;  5M3F G;  3M3Y H;  3A74 A;  4OIJ A;  4JCV E;  5J22 A;  4JI8 L;  2LS0 1;  4A3E H;  1TR5 A;  1STN A;  1A63 A;  3KF8 A;  2M9V A;  1IKM A;  3QIA A;  1LTB D;  3VR3 A;  1A3V A;  1TKW B;  1K8A C;  2B2Y A;  1KTK A;  1SNM A;  1EWI A;  1IBL L;  3KK7 A;  1STE A;  4IUN A;  5JJI A;  1C0A A;  1J8I A;  1GUG A;  1X56 A;  2JA7 B;  1PRT C;  4JW0 A;  4LF8 Q;  1OXU A;  3R93 A;  3DWA A;  1J9O A;  4MNO A;  3SXH A;  2UXD L;  2L0C A;  1PMR A;  4KTA A;  1JB7 A;  5BN5 A;  3F2C A;  4CGY B;  1W2B A;  3D4W A;  4K5V A;  1VQO A;  4HIO A;  4XT1 B;  5JPM C;  4KJN A;  2F0K A;  4Z9C B;  1E2Z A;  2F0H A;  3T51 B;  5I2X A;  1E2W A;  2D0P A;  3PIP 3;  4GKJ L;  3J7A V;  1CHP D;  2UXD Q;  2PZW A;  2ZTC A;  4RCO A;  2JA7 H;  1DM0 B;  1HPC A;  1K3R A;  4DK3 C;  2I5H A;  1PH7 A;  3J7A 5;  2K5V A;  1YNN D;  2IPK D;  5C4X G;  1YIT A;  1EL0 A;  2Z4H A;  1DGS A;  5G3L D;  4TQU S;  1PFM A;  4LFA L;  1UWV A;  1EQQ A;  1HRJ A;  1L0Y B;  4GLA C;  2O5J C;  5JOB A;  4UAI A;  2B63 H;  4XT3 B;  1BBW A;  2N55 A;  3I4N H;  1IKL A;  2JA6 G;  4DR1 L;  3AFP A;  2F0D A;  2PQA B;  4F88 A;  4JI3 Q;  1CQF A;  3TSS A;  1TWG B;  4E6I A;  3T1Y Q;  1OTC A;  1LM0 A;  3MTS A;  4K5W A;  4J1M A;  5M3F B;  2NZ1 D;  1Y1V H;  5JEA G;  3KDF A;  4DAY A;  2CQA A;  4A3F H;  3GQB A;  5IGG A;  4L5T A;  3K0Y A;  1IL8 A;  2KUM A;  2EY2 A;  4P73 A;  4HJ5 A;  4A3M H;  4LFB L;  3F2U A;  5M5W H;  2IY5 B;  4U67 3;  3R8B A;  1GOZ A;  4LF4 L;  2HT1 A;  4DXF A;  3GDE A;  4DR6 Q;  2SNM A;  4GKK L;  4FF1 A;  1EEF D;  1PFB A;  3PUV A;  1I4P A;  3V96 A;  1I5F A;  3S17 H;  2CW0 D;  4IUR A;  3WOE A;  3TME A;  4A75 A;  4C1N I;  3HOW G;  5IT9 c;  1KRT A;  3H0G H;  4QJF A;  4ZAI A;  1UE6 A;  2C35 B;  1RTO A;  1OXS C;  1TT2 A;  3KLR A;  4C3J H;  1EFI D;  5HUR A;  4BBR H;  5GAE C;  1Q82 C;  1A6X A;  2NB0 A;  1PVO A;  1V43 A;  4JI4 L;  1W6K A;  2MQH A;  1Q3L A;  1RIP A;  3CW2 C;  3L0O A;  2F0G A;  1SFO B;  1E1T A;  4K2L A;  5C3E H;  4CDF C;  3SVM A;  2WIN B;  2EYF A;  1E24 A;  1RTN A;  5BN3 A;  4A3K B;  3MZ5 A;  1CTM A;  2ASB A;  4DR3 L;  3R3O A;  1QJO A;  1D7Q A;  5GQO A;  2B63 B;  3W1B A;  3GTJ H;  4DAP A;  2E8G A;  1XNQ L;  5EKI A;  3L2P A;  4IUT A;  1BKB A;  1Q8I A;  4KKU A;  3U4Z A;  4A3J G;  5K36 H;  1LUZ A;  2A1A A;  3MHB A;  3J81 i;  1Y8N B;  1YJ9 A;  3S1Q B;  3OWF A;  1TII D;  1XXG A;  3CMA A;  1X54 A;  1A0I A;  1KIX A;  4C3I G;  1JOQ A;  3J81 c;  4C3H H;  1N33 Q;  3N6R A;  3CRL C;  3SE0 A;  2JA5 B;  4RH6 A;  2MGS A;  3NEL A;  1IBL Q;  4LF6 L;  4K0K L;  1B4O A;  1E2V A;  4V0B A;  4OEL B;  3KF6 A;  5JVH 3;  2UU9 L;  1Z9F A;  2B3G A;  1TVX A;  5D3I B;  1SE8 A;  4A93 G;  1CI3 M;  1R9T B;  2Z1C A;  2LFN A;  4RAU C;  1VQL A;  2ZM6 Q;  3VYR A;  3S16 H;  5HGT A;  2WFW A;  3ERO A;  4J6H A;  1STH A;  3HOX H;  3S17 B;  4X3K A;  1SLJ A;  4A4I A;  4DR5 L;  1EOT A;  1XX8 A;  3V2T A;  3B6Y A;  3M4O B;  4GN3 B;  3X3M A;  4KHZ A;  4JI2 Q;  5C3X A;  4MTN A;  5M5X B;  1SNC A;  2F3V A;  2I5L X;  3TRZ A;  4O1N A;  1L1O A;  4LFC Q;  1ESR A;  4LUO A;  1H9J A;  2OXP A;  2AKW B;  3HG9 A;  5E4W C;  2BH2 A;  2E75 C;  4CDC C;  1QWY A;  4OXP A;  5IYB G;  4H7B A;  2L11 A;  1EY9 A;  1CZG A;  3U9S A;  3BYT B;  1HH2 P;  3D6W A;  4NB3 A;  4L5Q A;  2AMC B;  4FXG C;  5AFW A;  1BOS A;  4HR7 B;  1AN8 A;  2RBM A;  3E0J A;  4DV4 Q;  2MP1 A;  4A3K H;  1KHI A;  4WOR A;  5K36 G;  2Z6K C;  3PIO A;  1PTO F;  3RMH A;  1BR9 A;  1GKH A;  1L2F A;  5I9P A;  3I4N B;  5IYD G;  2EOT A;  2WKD A;  1GUW A;  1G6Z A;  3KLS A;  4RCN A;  4IFD G;  2YU9 H;  4MZ9 A;  5M3F H;  2UUA L;  1BCP C;  3Q0A A;  1WTP A;  2UU9 Q;  4WFN 3;  5C0X H;  2WAQ G;  3LGJ A;  1IW7 D;  2VL6 A;  2WB1 B;  4LF7 L;  3C3L A;  5IGF A;  4YY3 L;  1PYW D;  5IT9 L;  1PH3 A;  4LF6 Q;  1PH9 A;  1MHW C;  1TWC H;  3VA5 A;  3GTM B;  3J7A F;  1X3E A;  1A2T A;  2NN6 H;  2WB1 G;  4A76 A;  4XYO A;  2K4K A;  1VQ7 A;  3KBX A;  2NVY H;  2R61 A;  3MXP A;  2Q8I B;  4ZCK A;  1WTH A;  5CR3 A;  5FOB B;  2KVM A;  1L1O C;  1WCM H;  2NTS A;  1K8M A;  1SND A;  1SRU A;  2CVR A;  1G2T A;  2ZTE A;  4P72 A;  1C48 A;  3P7J A;  3FMC A;  1XMO L;  4DV1 Q;  2IX3 A;  4K5X A;  1KQS A;  3K0X A;  2F3I A;  3A7A B;  4R8I A;  5ELD A;  4DK0 A;  4HJA A;  1HCZ A;  1STA A;  2B2Y C;  4IAL A;  3J80 L;  2XWJ B;  1LTR D;  2CHB D;  1U0L A;  2OTJ A;  3FHW A;  1PRT F;  3M4Y A;  1G91 A;  4RGT A;  4MHE A;  1OXX K;  3GTP B;  2R7Z B;  5D65 A;  1XTC D;  2VUM H;  4GKJ Q;  2D9U A;  2ZXR A;  3A0J A;  2L5T A;  1LT5 D;  1EYG A;  2JA5 H;  2KBN A;  3U9O A;  1UEA B;  4LW1 A;  1XNR Q;  1A62 A;  2BH8 A;  4GLV B;  3I4N G;  4YHH Q;  2XRS D;  1M1K C;  5DM6 3;  1KNE A;  2B2V C;  3H3V I;  4APV A;  3J80 c;  3TP7 A;  4HJ9 A;  4BBR G;  1ENA A;  5CYU A;  2VQE L;  1EIH A;  2WII B;  1WJJ A;  3CPF A;  1HTL D;  2Z6B A;  3QG1 A;  2JA7 G;  4JV5 Q;  4GOP C;  2R93 B;  4DUY L;  1LTA D;  2O2L D;  1O7I A;  2G5D A;  2NZH A;  1I3Q B;  2EJF C;  2NTT A;  4BBS B;  1PZK D;  1Q90 A;  1RF2 D;  1V1O A;  3K5L A;  2CWA A;  1TWC B;  2NVT H;  1ICW A;  2IWH A;  2VXW A;  2Q2H A;  1K83 H;  4G7H C;  4QUF A;  1V1P B;  3T16 A;  3HGB A;  2HQL A;  5J39 A;  3TP8 A;  2PW7 A;  3D6C A;  1LAB A;  4X65 L;  3ND9 A;  5LMU Q;  1I6V C;  1SEB D;  2A68 D;  2AQ1 B;  3MFG A;  4RGO S;  4H02 A;  4HSP A;  4UP8 A;  4DAM A;  2PQA A;  3AFQ A;  3P20 A;  2OQK A;  3CCE A;  1TY2 A;  5L37 A;  2I07 B;  2SOB A;  1NUC A;  3BDC A;  4KY7 A;  1A15 A;  3DLL A;  1SN8 A;  2QEJ C;  1AP0 A;  3RZD B;  1KDC A;  1XYI A;  1NTG A;  1HNZ L;  2K52 A;  5IGC A;  1SYF A;  4DV4 L;  4LFC L;  3SK6 A;  3FPP A;  2K5D A;  1QZH A;  4AYB G;  2GN5 A;  1NY4 A;  3HS0 C;  3CD6 A;  1VQN A;  3TZD A;  3ICE A;  1LLR D;  5C4H A;  1PH4 A;  4OWT B;  1QE6 A;  4L5S A;  1GUN A;  4LF8 L;  4HIK A;  2CCZ A;  4HTH A;  5COY A;  3K7A H;  1HNZ Q;  1Z6H A;  1I94 L;  5KYI A;  3BZC A;  2WP8 J;  3SDZ A;  4HAE A;  4NXM L;  4XDX A;  5IWA L;  2HHH L;  3J7Z C;  2MNA A;  3VYT A;  2KA7 A;  1PZI D;  5C5M A;  2AUK A;  2VUM G;  2UUB Q;  3I4L A;  2CQO A;  4OGQ C;  2E2I B;  4B08 A;  5IP7 H;  2KOL A;  1NR2 A;  4DR2 L;  3S1Q H;  2TSS A;  1U4L A;  1EY4 A;  2OWO A;  5ELO A;  3CCS A;  5LMU L;  4A3B H;  2Q8T A;  2L15 A;  3W1G A;  4X6A H;  1AFP A;  1EYC A;  1XTD A;  2HCC A;  2Z8L A;  3URY A;  3NUC A;  4J15 A;  1PYS B;  3H09 A;  3SK8 A;  2QEX A;  1G29 1;  1UUP A;  2UXB Q;  1HUN A;  2EYM A;  4M1U B;  4CKE A;  2NYZ D;  1K0S A;  2SNS A;  3NK9 A;  1JJC B;  3JAM c;  4IOA A;  5ELF A;  1CKO A;  3S1M B;  3J7Y W;  1OO9 B;  5KRU A;  5C4Z A;  4V19 0;  1LTL A;  2EY6 A;  5J3B A;  4EQP A;  3HP3 A;  4JI0 Q;  1FD7 D;  5FLX c;  3RN5 A;  4ABN A;  1UE1 A;  2OEO A;  4ZUJ A;  3LWE A;  4AYB B;  1NCV A;  3TDQ A;  3F2D A;  5AJ3 Q;  2EDG A;  2UUB L;  1S4Z A;  1KL9 A;  3GTL B;  3DEP A;  4BA2 I;  2FIN B;  3H3V C;  3C46 A;  4JI3 L;  1HQM C;  1AEX A;  4NP5 A;  1HA6 A;  3BZD B;  4DKA C;  2E2H B;  1VQD A;  1YHA A;  1HZA A;  3ZJY C;  4LF5 Q;  1P16 A;  3QOJ A;  1F77 A;  3HOW B;  3KYH C;  5IGB A;  3T1H Q;  2WV6 D;  1Q1E A;  3X3N A;  2KQ3 A;  2O4X A;  3BYY B;  3MWY W;  5A2Q E;  4A3B G;  1DOK A;  2K03 A;  2PNR C;  2ALY B;  2XNA C;  2L4N A;  4IO9 A;  4TSS A;  4RHS A;  4X66 L;  1CT1 D;  5CBA E;  1Z47 A;  3I4M B;  2YTY A;  1VF5 C;  1KLU D;  1PRT B;  1EY6 A;  1GD7 A;  1FYC A;  3RZO H;  1ROD A;  4KJO A;  2MFI A;  1UE7 A;  3PO2 G;  5K5P A;  4RMF A;  4XQQ A;  4NXN Q;  4MIU A;  3H0G B;  1ET6 A;  4K14 A;  4B3R L;  4C2M B;  4A3D B;  4OX9 L;  2VB3 X;  3MA2 B;  3T56 B;  3DWQ A;  3NTK A;  4LK1 C;  2SDF A;  1LYL A;  2EXZ A;  2I0Q A;  1DOL A;  3AMU A;  1ML0 D;  4J8Q A;  2Z9H A;  3ER0 A;  2Q2I A;  2F0E A;  4RG1 A;  3OSO A;  2EXD A;  1Y69 U;  4R9W A;  3FKI B;  4N8X 1;  3G7L A;  2ZJQ A;  1MI2 A;  3OTO L;  4B3M Q;  4QQB X;  3UDX A;  4A3M G;  3V05 A;  1PH6 A;  3T1H L;  1FR3 A;  3OIP A;  3UI2 A;  1HNW Q;  3MXN A;  4RKL A;  1GUO A;  1I4G A;  2K33 A;  4BXX G;  2QF7 A;  1SNO A;  1Z7T A;  2F3W A;  2B2T A;  2K32 A;  3NWS A;  3RZO B;  3BJU A;  3M3Y B;  1Q12 A;  5DNF A;  1PZJ D;  3L9A X;  4CJ2 C;  1SMY C;  2EIF A;  1NMG A;  5JJL A;  1O78 A;  3F8T A;  3I3C A;  4DUZ L;  5T1I A;  3RLF A;  3K58 A;  1C4Q A;  1T5X D;  2B2V A;  3KF8 B;  3TP5 A;  4BY1 H;  4P71 A;  1JCK B;  5FLX E;  4PMC A;  2X69 A;  2PW5 A;  1EIG A;  3A8J E;  4KD3 A;  3D4R A;  4AQY L;  1ICF B;  2A73 B;  5EPJ A;  4TVA B;  1EY0 A;  4PZ7 A;  5I6W A;  5BR8 L;  2E5L L;  2JJQ A;  1VS0 A;  2F1M A;  4LMQ D;  2WAQ E;  1YNJ C;  1S5C D;  1X3Q A;  2K05 A;  2XIW A;  4PNY A;  4PMW A;  5JPN C;  2FJ2 A;  1V9P A;  1C9O A;  3S14 B;  1SFO H;  3QR8 A;  1EFW A;  4LFB Q;  1VQK A;  2JK8 A;  1JJ2 A;  4L6T B;  1S5B D;  5LL6 X;  1VQ8 A;  2EYP A;  3FRP B;  4DV3 Q;  2OTL A;  2RKS A;  3MXU A;  2RSO A;  5D3D A;  3MEH A;  2TMP A;  4FF3 A;  2X6L A;  2CKZ B;  3GO5 A;  5JJK A;  1RHP A;  1X65 A;  1Q7Y C;  1XPR A;  1XMQ L;  1IYU A;  4BXX H;  2YTX A;  2G9H D;  2E2J B;  4IOC A;  4X3S A;  4ZQ3 A;  5IWA Q;  3RUZ A;  3GV6 A;  1EWH A;  1YJN A;  2R7F A;  1H9K A;  3GP7 A;  2H5X A;  4GN4 B;  4I7Z C;  3HOV G;  3TP6 A;  3ULJ A;  2IHF A;  4BY1 B;  3O13 A;  4KK7 A;  4G4K A;  1SBB B;  4DK1 A;  2RHS B;  2RDG A;  3D8G A;  3GD7 A;  3TEH B;  4X65 Q;  3A55 A;  4JI0 L;  4Y52 H;  3EVQ A;  4JI7 Q;  4UDU C;  2A6H D;  2Y0S E;  1VQ4 A;  4A3G H;  3A54 A;  1A2U A;  1LAC A;  2NVX B;  4JPB W;  4Q0F A;  2EJM A;  1EQV A;  2R7Z G;  4QIW E;  1PH8 A;  2EPB A;  1YVC A;  5KYL A;  3AYH B;  5F2D A;  4GNX C;  2E76 C;  3GTK B;  4O2D A;  3HFZ B;  5LMN L;  1NSN S;  3C2P A;  3RN2 A;  3M4O H;  3K7U C;  3I91 A;  4QY7 A;  4S3S A;  1MSG A;  2D0O A;  2ZJR A;  2E5L Q;  2EZV A;  4KN4 C;  1U4R A;  3Q6S A;  4HJ7 A;  4DR2 Q;  4LF7 Q;  2HUG A;  1VQF A;  1KDA A;  2E2H H;  2A69 D;  5EPK A;  1LTS D;  3SR1 A;  1Y1V G;  3M4Q A;  1EWC A;  4MN3 A;  4RA8 A;  2NZO A;  5JEA H;  3Q23 A;  3STB D;  3MXG A;  4PQX A;  1E0B A;  4QUC A;  1VQ6 A;  4Y7N B;  1FGB D;  1PYB A;  4R4T A;  1ASY A;  3NWT A;  2Z6K A;  3FKI H;  3PCO B;  1II3 A;  1F9R A;  2ATW A;  5LHY 1;  2D5D A;  2RF4 A;  2KEE A;  3FVQ A;  2AQ3 B;  3IKJ A;  4FXK C;  1IBM Q;  3PQI A;  2ICE C;  2EYH A;  5CGK A;  4JYA Q;  1Y8P B;  3H94 A;  2JA8 B;  5I9O A;  1FGU A;  2VQF Q;  4AIM A;  2MHV A;  3RNU A;  4JI5 Q;  3H0G G;  4IJH A;  4CHT B;  2E2I H;  2A8V A;  4WRD A;  1JIC A;  1B44 D;  5I4D A;  2NVQ H;  1X9N A;  3W3A A;  3AB9 A;  1TWG H;  1MKH A;  4UPA A;  1B9N A;  1QVC A;  1IYJ B;  2JEA I;  2PI2 A;  4IFD J;  1SRO A;  3TS2 A;  3J81 j;  4HMI A;  5LMN W;  4OX9 Q;  1PFS A;  1TWH H;  4C3I H;  2KHS A;  2RHQ B;  4JI6 L;  4PV1 C;  3KJO A;  2EQS A;  4HMJ A;  3CQZ B;  1VQM A;  2YTV A;  3D31 A;  4CKB A;  4DR7 L;  1RJT A;  1IZ6 A;  3PUW A;  2O5I C;  1SAP A;  2F0U A;  3FP9 A;  3IRB A;  2BDN A;  1DOM A;  1K8G A;  3I2Z A;  3J81 E;  2HHH Q;  5ELC A;  4DK6 C;  4ZRZ A;  2BA0 A;  4AYB E;  5DAU A;  1DCZ A;  4WJ4 A;  5IOD A;  4HIM A;  1RD9 D;  1KAB A;  1ET9 A;  4YCU A;  2RDH A;  1BVS A;  4BA1 I;  1Q46 A;  1TWF B;  3BVG A;  3TZU A;  5DM7 3;  2A19 A;  3PO3 G;  2JE6 I;  1XNQ Q;  3HKZ B;  3K6O A;  3HOY G;  4FXD A;  1O7L A;  4R4C A;  4L63 B;  1GUS A;  1EQT A;  3C1E A;  1HZC A;  4KKS A;  5COR A;  4DN4 M;  3K57 A;  3S1R H;  4LF5 L;  4IPD A;  2F0M A;  1SJH D;  2NBF A;  3BZK A;  1B7Y B;  3G4S A;  1K83 B;  1WTO A;  2VY3 A;  2F4I A;  1SE3 A;  3DUZ A;  1VQA A; 
#chains in the Genus database with same CATH homology
 4NDX A;  3NQI A;  1EU4 A;  2IJ0 A;  4N9P A;  1JR0 D;  3CRK C;  3DWP A;  3PUX A;  2L1B A;  2A6E C;  4O42 A;  2NVQ B;  4ZLT F;  5FLX L;  2RSN A;  1NAP A;  3M85 A;  1YNN C;  1EEI D;  2WAC A;  2B2U A;  2DNC A;  2HCI A;  4KKT A;  3NXW A;  3MFY A;  3S9W A;  2B2T C;  3DXJ C;  2F0O A;  1S5F D;  2VUM B;  3KUP A;  2A6E D;  4QF4 A;  3NHH A;  2KCN A;  1D5Z C;  1CA5 A;  3NP8 A;  1PRT D;  2NWG A;  1OXV A;  4IUU A;  1SYB A;  1I4X A;  3GV3 A;  5IT9 E;  4K2K A;  2V4D A;  5T1G A;  4L8J A;  1D2B A;  1LTT D;  4FYD A;  1QIL A;  2XWB B;  4OL7 A;  5E1F A;  2D2C C;  1STY A;  4DNT B;  4B9X A;  5FKA C;  3I73 A;  1FNU A;  1RCV D;  2J4X A;  4M8A A;  1QB5 D;  5KEE A;  3FDT A;  1VMP A;  4A3E B;  3K5O A;  1PTO C;  2XRQ D;  1WD0 A;  4G7O C;  4RGN A;  5NUC A;  4GZY C;  1IYV A;  1LV9 A;  3K5N A;  4KN7 C;  2LMC B;  4IUQ A;  1CK1 A;  2M2L A;  1D5M C;  4XYQ A;  2PO4 A;  1Y1W B;  2IT1 A;  3L7Z C;  2EVB A;  2QIL A;  4K8J A;  1TWH B;  3VYU A;  2X6G A;  2DN8 A;  4ZYS A;  5C4X B;  1TS3 A;  2K5W A;  5M5Y B;  2MJ8 A;  2QCP X;  1TWA B;  2M00 A;  2F0Q A;  5EQ0 A;  1GHK A;  1VDZ A;  2EYJ A;  3PO2 B;  4U68 A;  5E4X A;  1KAA A;  1CQV A;  5EBD A;  5CC4 A;  2G9D A;  1K8O A;  4H44 C;  5FO8 B;  1O80 A;  1JC7 A;  3LNN A;  1CZW A;  4C3I B;  4A3F B;  3PUZ A;  1SYC A;  2IX0 A;  5I2Y A;  2IL8 A;  2WKC A;  2KJX A;  4XQJ A;  5M5W B;  3JAM L;  3QB3 A;  1B2T A;  2YU9 B;  5M3M B;  1LO5 D;  3PIO 3;  1HFG A;  5C0X I;  2PQE A;  3NSW A;  1D5X C;  1Y8O B;  4Q5V A;  1AZQ A;  3NTH A;  2K04 A;  1EY5 A;  2FFK B;  2N88 A;  4IQZ A;  3K7A B;  1TS2 A;  5FO9 B;  1U4P A;  2E74 C;  2F0P A;  3P1H A;  3TBI B;  2Z4I A;  1QNU A;  3K59 A;  5C6A A;  1MGS A;  3SEB A;  3CHB D;  3CU7 A;  4FVM A;  1I4R A;  4BS9 A;  1G8Z D;  3OWE B;  4C1N K;  1SNP A;  5KNB A;  1LTG D;  3K5M A;  2F0W A;  4KHV A;  4CKC A;  1H9S A;  1NR4 A;  4A3G B;  4ODG A;  4FO2 A;  3DM1 A;  4X3U A;  4NW2 A;  2H4O A;  2L12 A;  3ITP A;  5JJZ A;  4DA2 A;  3IFD A;  4OO1 G;  4KI0 A;  1SSO A;  1BQQ T;  1F2Z A;  2F0S A;  1IW7 C;  1U9R A;  2KED A;  1S5D D;  2XVS A;  1STG A;  3M7G A;  2RVL A;  3HOV B;  2KEC A;  1O7Y A;  1JWU D;  2GA4 B;  3QWN A;  5FO7 B;  1QNK A;  3S2H B;  3QOL A;  1BXT A;  1PXU A;  2VB2 X;  1EU3 A;  3HOY B;  3W2D A;  1PTO D;  4BY7 B;  1UNS A;  4KMU C;  5JAV A;  1O7Z A;  1T5E A;  3SK4 A;  4KY5 A;  3VR5 A;  4BWG B;  2HQE A;  4RGM A;  5JVG 3;  4QIW B;  3GTJ B;  1GHJ A;  2Y0S B;  1HTP A;  2JYO A;  3ERQ A;  4XXE A;  1LT6 D;  1QG7 A;  1SYG A;  2EJG C;  3DHQ A;  1UAP A;  2AQ2 B;  2LY7 A;  3I72 A;  4TRD A;  3OOC A;  4A3M B;  4HSV A;  1L0X B;  2HDL A;  1ZYR C;  2OF1 A;  1KLG D;  4EGV A;  4JBW A;  3EFX D;  3IL8 A;  1JE4 A;  1CFM A;  2MPM A;  1SE2 A;  3HZX A;  1SDF A;  1HFN A;  1FNW A;  1GUT A;  1WTW A;  1BUV T;  1B1Z A;  1EYD A;  3ZYY X;  3GTQ B;  2F0I A;  3P75 A;  1ZYR D;  4C3H G;  1Q1B A;  4WJW A;  2JA6 B;  1F2M A;  2CW0 C;  4DFA A;  2FMC A;  2B2W C;  1B3A A;  2BA1 A;  4B9W A;  2K28 A;  2DY8 A;  1ENF A;  1VMC A;  4RFB A;  5J1Z A;  2YYZ A;  5E3F A;  1SYD A;  2K6A A;  4QB4 A;  1F2Y A;  1RDP D;  4KV6 A;  2ZT9 C;  2F0J A;  4OO1 I;  3T4A C;  2LKV A;  2Q8R E;  3MVV A;  1TS4 A;  2F0T A;  4OHJ A;  2E2D C;  1HHV A;  1HQR D;  4HCS A;  3CKI B;  4XTC S;  4IFD H;  2R3Z A;  2ICI A;  5EGT A;  3N52 A;  1G2S A;  1JWM D;  5EKL A;  2B2W A;  4DGZ A;  4RWS C;  4TKO B;  1ZEQ X;  3BVZ A;  1CA6 A;  3A7L A;  4ZUI A;  5C0X J;  5CMD A;  3BVM A;  1B50 A;  4DAV A;  3A56 A;  1ILP A;  2XN9 C;  1EY8 A;  1HXY D;  4A3J B;  4ULL A;  2PYK A;  4KY6 A;  2B39 A;  4CJ0 B;  3OIQ A;  3A8I E;  2ZXO A;  2NUC A;  3NE5 B;  1AW7 A;  5EJW A;  3OPO A;  3NPP A;  4IZ8 A;  5LL6 S;  5C0X G;  1DON A;  4F8M A;  2F0F A;  2EY5 A;  1B53 A;  1U4M A;  3R2T A;  2A68 C;  4IFD I;  5ISR A;  3VR2 A;  4A3B B;  3DMU A;  3QO2 A;  3GTG B;  5CV9 A;  2HDM A;  1V8Q A;  3QJY A;  2NVT B;  4EVO A;  1BO0 A;  1YNJ D;  3GTO B;  1JOO A;  2B8F A;  3FPU B;  3IFT A;  1DYQ A;  1GJX A;  2L9H A;  4FP5 D;  2K7V A;  1D1I A;  2PCF B;  4OIK A;  5C3W A;  3KBG A;  5CV7 A;  2DNE A;  3TN2 A;  1PDQ A;  4HED A;  3NQT A;  4K6L A;  3S1R B;  1EY7 A;  2JSO A;  1WD1 A;  3AU7 A;  1I50 B;  3LX0 A;  4CBV A;  4QCL A;  4ZKB B;  4RKB A;  3E6Z X;  4F87 A;  5JEA J;  1TY0 A;  4ZKC B;  1DJR D;  4ID6 A;  4G57 A;  5I6Y A;  1PTO B;  1H9S B;  3EJI A;  3PV0 A;  1JWS D;  4XIG S;  2A5H A;  3PUY A;  4KD4 A;  1Y1V B;  4HCE A;  3NBI A;  1B9M A;  1BCP B;  2DY7 A;  2F0L A;  4JK1 C;  1WCM B;  2PZT A;  1VCI A;  1I4H A;  3I70 A;  2EYL A;  5EBC A;  3T13 A;  3OMG A;  2IW3 A;  1R4P B;  1VF7 A;  4IUP A;  3G6J B;  4C3H B;  1ONL A;  3S1N B;  1F9S A;  1SE4 A;  4P2C B;  1A3U A;  2C5C A;  1KDB A;  3A8K E;  4NKL A;  3S15 B;  4DNR B;  3D3R A;  1ILQ A;  1BCP F;  1JOR A;  1DZ1 A;  3H91 A;  3VA7 A;  4N9T A;  4I65 A;  3RD4 A;  1W6J A;  2WAQ B;  1STB A;  2A6H C;  1V1P A;  4F7X A;  5IOC A;  4BBR B;  2B2U C;  3NTI A;  4FNF A;  1EZ8 A;  3FEW X;  1A3T A;  2PZU A;  5KIX A;  4ILW A;  1AZP A;  3OMC A;  1IHZ A;  2J0T D;  2NVY B;  4C3J B;  3D4D A;  1I4Q A;  1KNA A;  2RQX A;  3HOU B;  3DEO A;  2JXM B;  1BDO A;  2F0V A;  5C5L A;  3I90 A;  5D14 A;  3BG3 A;  5IIF A;  3OW7 A;  1SXT A;  2H1E A;  3KLS X;  4FF2 A;  1CM9 A;  2D62 A;  2F03 A;  2PPB C;  2AWN A;  1XWE A;  1PFN A;  5C44 B;  4QMG A;  4A93 B;  3BDO A;  3R2I A;  1S5E D;  2BDO A;  3ONA B;  2C9O A;  4XQN A;  2AUJ D;  1H9R A;  1TQO A;  3WDN A;  1LT3 D;  1H9M A;  2BE5 C;  3MC0 B;  1DD2 A;  3H6M A;  2OT2 A;  5M9O A;  5A35 A;  2A69 C;  4IUV A;  2L55 A;  4A3I B;  1LTI D;  3BS1 A;  1CHQ D;  1PLF A;  1JB3 A;  3HOX B;  3VR4 A;  3PO3 B;  2XSC A;  3IAY A;  5IGD A;  1HUM A;  1TS5 A;  2A74 C;  4H13 C;  2K5Q A;  3L3O C;  2RDF A;  3J80 E;  2BOS A;  1F9P A;  1QOH A;  1SNQ A;  4OO1 H;  1WTR A;  2QKI C;  5CBE E;  2SEB D;  2NN6 I;  2R92 B;  3ND8 A;  4FF4 A;  1MD2 D;  5EKK A;  3J81 L;  5EPL A;  4DU9 A;  1SJE D;  5BN4 A;  2KCC A;  3Q24 A;  1MBY A;  3HEJ A;  5KGU A;  1SMY D;  3PMF A;  2FHT A;  3I8Z A;  3S2D B;  1PTO H;  5CV5 A;  5IGE A;  3M7N A;  2F0N A;  2AWO A;  2VNU D;  5C3E B;  1WTQ A;  1TU2 B;  5C4J B;  3WOF A;  3EQL C;  5ELE A;  1BF4 A;  1ZXT A;  3VYS A;  1GXD C;  5FK9 C;  3T53 B;  4CJ1 B;  3SK5 A;  5DEH A;  4R8N A;  2K01 A;  4C56 C;  4DXG A;  4EQO A;  4ME5 A;  5ELB A;  4ZK9 B;  1JQY D;  1SYE A;  3JAM E;  2ENB A;  2RA4 A;  4IN3 A;  4LJZ C;  2J7Z A;  4DF7 A;  1ZKO A;  3Q22 A;  1R4Q B;  5KND A;  1QCB D;  3NBH A;  1BNZ A;  2EE1 A;  1MSH A;  2PMZ B;  1HA5 A;  2EY1 A;  3SHL A;  1WTX A;  5A2Q L;  5CV6 A;  4PMB A;  3EA6 A;  2JP1 A;  1M4V A;  2QDB A;  1F9Q A;  3MAQ A;  1D6E C;  1ENC A;  5G3L F;  3OHX C;  3VR6 A;  1EZ6 A;  1I6H B;  2I46 A;  5CV8 A;  1EYA A;  3E5S A;  2EYO A;  2ID0 A;  4X3T A;  2JEB I;  4NMZ A;  4LAA A;  1F2L A;  1FNV A;  1DXM A;  4H0L C;  1LT4 D;  2K1B A;  2BE5 D;  2MUY A;  2B8G A;  2R6G A;  1ESF A;  4YIJ A;  4EQN A;  3C1F A;  1JOK A;  5CV4 A;  2FMM A;  2BCO A;  3HRZ C;  3S16 B;  1OXT A;  1C8C A;  5TSS A;  1RKN A;  1X32 A;  1M8A A;  4RHR A;  1BBX C;  2IX1 A;  1D1K A;  4K6D A;  3HOZ B;  1X3P A;  3LWU A;  1WTV A;  1BCP D;  4G7Z C;  2ZXP A;  2NN6 G;  4K8I A;  4HN7 A;  4C3J G;  3BDL A;  1WVL A;  5KNC A;  4OIJ A;  5J22 A;  2LS0 1;  1TR5 A;  1STN A;  3KF8 A;  2M9V A;  1IKM A;  1LTB D;  3QIA A;  3VR3 A;  1A3V A;  1TKW B;  2B2Y A;  1KTK A;  1SNM A;  3KK7 A;  1STE A;  4IUN A;  1J8I A;  1GUG A;  2JA7 B;  1PRT C;  1OXU A;  3R93 A;  3DWA A;  1J9O A;  3SXH A;  2L0C A;  1PMR A;  4KTA A;  5BN5 A;  4CGY B;  3D4W A;  4K5V A;  4XT1 B;  5JPM C;  4KJN A;  2F0K A;  4Z9C B;  1E2Z A;  2F0H A;  3T51 B;  5I2X A;  1E2W A;  3PIP 3;  3J7A V;  1CHP D;  2PZW A;  4RCO A;  1DM0 B;  1HPC A;  1YNN D;  2IPK D;  1EL0 A;  2Z4H A;  5G3L D;  4TQU S;  1PFM A;  1HRJ A;  1L0Y B;  2O5J C;  5JOB A;  4UAI A;  4XT3 B;  2N55 A;  1IKL A;  2F0D A;  4F88 A;  1CQF A;  3TSS A;  1TWG B;  4E6I A;  3MTS A;  4K5W A;  4J1M A;  5M3F B;  2NZ1 D;  5JEA G;  4DAY A;  2CQA A;  3GQB A;  5IGG A;  3K0Y A;  1IL8 A;  2KUM A;  2EY2 A;  3F2U A;  4U67 3;  3R8B A;  1GOZ A;  4DXF A;  2SNM A;  4FF1 A;  1EEF D;  1PFB A;  3PUV A;  1I4P A;  3V96 A;  2CW0 D;  4IUR A;  3WOE A;  3TME A;  4C1N I;  4ZAI A;  1RTO A;  1OXS C;  1TT2 A;  3KLR A;  1EFI D;  5HUR A;  1A6X A;  2NB0 A;  1V43 A;  1W6K A;  1Q3L A;  2F0G A;  1SFO B;  4K2L A;  3SVM A;  2WIN B;  2EYF A;  1RTN A;  5BN3 A;  4A3K B;  3MZ5 A;  1CTM A;  3R3O A;  1QJO A;  2B63 B;  4DAP A;  5EKI A;  4IUT A;  1Q8I A;  4KKU A;  5K36 H;  3S1Q B;  3MHB A;  1Y8N B;  3OWF A;  1TII D;  1XXG A;  4C3I G;  1JOQ A;  3N6R A;  3CRL C;  3SE0 A;  2JA5 B;  4RH6 A;  2MGS A;  1B4O A;  1E2V A;  4V0B A;  5JVH 3;  1TVX A;  5D3I B;  1CI3 M;  1R9T B;  2Z1C A;  2LFN A;  4RAU C;  3VYR A;  5HGT A;  3ERO A;  4J6H A;  1STH A;  3S17 B;  4X3K A;  1EOT A;  1XX8 A;  3V2T A;  3M4O B;  3X3M A;  4KHZ A;  5C3X A;  5M5X B;  1SNC A;  2F3V A;  4O1N A;  1ESR A;  1H9J A;  2OXP A;  3HG9 A;  5E4W C;  2E75 C;  1QWY A;  4H7B A;  2L11 A;  1EY9 A;  1CZG A;  3U9S A;  3BYT B;  3D6W A;  4FXG C;  5AFW A;  1BOS A;  4HR7 B;  1AN8 A;  2RBM A;  3E0J A;  2MP1 A;  4WOR A;  5K36 G;  1PTO F;  3RMH A;  1BR9 A;  5I9P A;  3I4N B;  2EOT A;  2WKD A;  1GUW A;  1G6Z A;  3KLS A;  4RCN A;  4IFD G;  1BCP C;  3Q0A A;  1WTP A;  4WFN 3;  5C0X H;  1IW7 D;  2WB1 B;  3C3L A;  5IGF A;  1PYW D;  5IT9 L;  3VA5 A;  3GTM B;  3J7A F;  1A2T A;  2NN6 H;  4XYO A;  3KBX A;  2R61 A;  3MXP A;  2Q8I B;  5CR3 A;  5FOB B;  2KVM A;  2NTS A;  1K8M A;  1SND A;  2CVR A;  1G2T A;  1C48 A;  3P7J A;  3FMC A;  2IX3 A;  4K5X A;  3A7A B;  4R8I A;  5ELD A;  4DK0 A;  1HCZ A;  1STA A;  2B2Y C;  4IAL A;  3J80 L;  2XWJ B;  1LTR D;  2CHB D;  1PRT F;  3M4Y A;  1G91 A;  4RGT A;  4MHE A;  1OXX K;  3GTP B;  2R7Z B;  5D65 A;  1XTC D;  2D9U A;  2ZXR A;  2L5T A;  1LT5 D;  3U9O A;  1UEA B;  2XRS D;  5DM6 3;  1KNE A;  2B2V C;  3TP7 A;  1ENA A;  5CYU A;  1EIH A;  2WII B;  3QG1 A;  1HTL D;  2R93 B;  1LTA D;  2O2L D;  1I3Q B;  2EJF C;  2NTT A;  4BBS B;  1PZK D;  1Q90 A;  1RF2 D;  1V1O A;  3K5L A;  1TWC B;  1ICW A;  2IWH A;  2VXW A;  4G7H C;  4QUF A;  1V1P B;  3T16 A;  3HGB A;  5J39 A;  3TP8 A;  2PW7 A;  3D6C A;  1LAB A;  3ND9 A;  1I6V C;  1SEB D;  2A68 D;  2AQ1 B;  3MFG A;  4RGO S;  4HSP A;  3P20 A;  1TY2 A;  2I07 B;  2SOB A;  1NUC A;  3BDC A;  4KY7 A;  1A15 A;  2QEJ C;  1AP0 A;  3RZD B;  1KDC A;  1XYI A;  5IGC A;  1SYF A;  3SK6 A;  3FPP A;  2K5D A;  3HS0 C;  3TZD A;  1LLR D;  5C4H A;  1QE6 A;  1GUN A;  4HTH A;  5COY A;  1Z6H A;  5KYI A;  2WP8 J;  3SDZ A;  4HAE A;  4XDX A;  3VYT A;  2KA7 A;  1PZI D;  5C5M A;  2AUK A;  3I4L A;  4OGQ C;  2E2I B;  4B08 A;  2KOL A;  1NR2 A;  2TSS A;  1U4L A;  1EY4 A;  2Q8T A;  1AFP A;  1EYC A;  2HCC A;  2Z8L A;  3URY A;  3NUC A;  3H09 A;  3SK8 A;  1G29 1;  1UUP A;  1HUN A;  2EYM A;  4M1U B;  4CKE A;  2NYZ D;  2SNS A;  3NK9 A;  5ELF A;  3S1M B;  3J7Y W;  1OO9 B;  5KRU A;  5C4Z A;  4V19 0;  2EY6 A;  4EQP A;  3HP3 A;  1FD7 D;  4ABN A;  2OEO A;  4ZUJ A;  3LWE A;  4AYB B;  1NCV A;  3TDQ A;  2EDG A;  1S4Z A;  3GTL B;  3DEP A;  4BA2 I;  2FIN B;  3H3V C;  3C46 A;  1HQM C;  1AEX A;  4NP5 A;  1HA6 A;  3BZD B;  2E2H B;  3QOJ A;  1F77 A;  3HOW B;  5IGB A;  2WV6 D;  1Q1E A;  3X3N A;  2KQ3 A;  2O4X A;  3BYY B;  3MWY W;  5A2Q E;  1DOK A;  2K03 A;  2PNR C;  2XNA C;  2L4N A;  4TSS A;  4RHS A;  1CT1 D;  5CBA E;  1Z47 A;  3I4M B;  1VF5 C;  1KLU D;  1PRT B;  1EY6 A;  1FYC A;  1ROD A;  4KJO A;  5K5P A;  4XQQ A;  4MIU A;  3H0G B;  1ET6 A;  4K14 A;  4C2M B;  4A3D B;  2VB3 X;  3MA2 B;  3T56 B;  3DWQ A;  3NTK A;  4LK1 C;  2SDF A;  2EXZ A;  1DOL A;  3AMU A;  1ML0 D;  4J8Q A;  2F0E A;  3OSO A;  1Y69 U;  4R9W A;  3FKI B;  3G7L A;  1MI2 A;  3V05 A;  1FR3 A;  3OIP A;  3UI2 A;  3MXN A;  4RKL A;  1GUO A;  1I4G A;  2K33 A;  2QF7 A;  1SNO A;  1Z7T A;  2F3W A;  2B2T A;  2K32 A;  3NWS A;  3RZO B;  3M3Y B;  1Q12 A;  5DNF A;  1PZJ D;  3L9A X;  4CJ2 C;  1SMY C;  1O78 A;  3I3C A;  5T1I A;  3RLF A;  3K58 A;  1C4Q A;  1T5X D;  2B2V A;  3TP5 A;  1JCK B;  5FLX E;  4PMC A;  2X69 A;  2PW5 A;  1EIG A;  3A8J E;  4KD3 A;  3D4R A;  2A73 B;  5EPJ A;  1EY0 A;  5I6W A;  2F1M A;  4LMQ D;  1YNJ C;  1S5C D;  1X3Q A;  2K05 A;  2XIW A;  4PNY A;  4PMW A;  5JPN C;  2FJ2 A;  3S14 B;  4L6T B;  1S5B D;  5LL6 X;  2EYP A;  3FRP B;  2RKS A;  3MXU A;  2RSO A;  5D3D A;  3MEH A;  4FF3 A;  2TMP A;  2X6L A;  3GO5 A;  1RHP A;  1IYU A;  2G9H D;  2E2J B;  4X3S A;  4ZQ3 A;  3RUZ A;  3GV6 A;  1EWH A;  1H9K A;  3GP7 A;  4I7Z C;  3TP6 A;  4BY1 B;  3O13 A;  4KK7 A;  4G4K A;  1SBB B;  4DK1 A;  2RDG A;  3D8G A;  3GD7 A;  3A55 A;  3EVQ A;  4UDU C;  2A6H D;  3A54 A;  1A2U A;  1LAC A;  2NVX B;  4Q0F A;  2EJM A;  1EQV A;  2EPB A;  5KYL A;  5F2D A;  2E76 C;  3GTK B;  3C2P A;  1NSN S;  3I91 A;  4S3S A;  1MSG A;  2EZV A;  4KN4 C;  1U4R A;  3Q6S A;  2HUG A;  1KDA A;  2A69 D;  5EPK A;  1LTS D;  3SR1 A;  5JEA H;  4MN3 A;  1EWC A;  4RA8 A;  3Q23 A;  3MXG A;  4PQX A;  1E0B A;  4QUC A;  4Y7N B;  1FGB D;  3NWT A;  1II3 A;  1F9R A;  5LHY 1;  2D5D A;  2KEE A;  3FVQ A;  2AQ3 B;  3IKJ A;  4FXK C;  2ICE C;  2EYH A;  5CGK A;  1Y8P B;  3H94 A;  2JA8 B;  5I9O A;  2MHV A;  4CHT B;  4WRD A;  1JIC A;  1B44 D;  5I4D A;  3W3A A;  3AB9 A;  1B9N A;  2JEA I;  4IFD J;  4HMI A;  2KHS A;  4PV1 C;  4HMJ A;  3CQZ B;  3D31 A;  4CKB A;  1RJT A;  3PUW A;  2O5I C;  1SAP A;  2F0U A;  2BDN A;  1DOM A;  3J81 E;  5ELC A;  4ZRZ A;  2BA0 A;  5DAU A;  1DCZ A;  5IOD A;  1RD9 D;  1KAB A;  1ET9 A;  2RDH A;  4BA1 I;  1TWF B;  3BVG A;  3TZU A;  5DM7 3;  2JE6 I;  3HKZ B;  3K6O A;  4FXD A;  1O7L A;  3K57 A;  1GUS A;  4DN4 M;  1EQT A;  3C1E A;  4KKS A;  4L63 B;  5COR A;  2F0M A;  1SJH D;  2NBF A;  1K83 B;  1WTO A;  2F4I A;  1SE3 A;  3DUZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...