2EXDA

The solution structure of the c-terminal domain of a nfed homolog from pyrococcus horikoshii
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
74
structure length
74
Chain Sequence
RRETTDIGGGKYTFELKGKVGKVVKIAEDHYLVEVEGDKWIAYSDEKLSLGDRVMVVDVDGLKLKVKRIPPQLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Membrane protein
molecule keywords nfeD short homolog
publication title The solution structure of the C-terminal domain of NfeD reveals a novel membrane-anchored OB-fold.
pubmed doi rcsb
source organism Pyrococcus horikoshii
total genus 6
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2005-11-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2exdA00
3CP0A 4LF9Q 4HIKA 2IHFA 1TWFH 3G6EA 3M4PA 4HJ8A 1YJWA 4LFCQ 1FJGQ 1EQQA 2GVBA 4R4IA 4JI2Q 1GKHA 1JE5A 4UY8C 1U0LA 2DGYA 2MNAA 4DV1L 3E0EA 4A3GG 2I0QA 4QGUA 4P75A 2Y0SG 4A75A 3GDEA 4XTCS 1OXSC 3B6YA 1N36L 4O0AA 3S17H 1C0AA 1ASZA 3NEMA 3UE1A 4GNXA 2WB1G 1SLJA 4J15A 4A4IA 1C7YA 4JI4Q 2VQFL 2YV5A 1EIFA 3PO2G 4DR6L 4GKJQ 1CSQA 1KRSA 2OCEA 3CPFA 1E1TA 3A5ZB 2EIFA 1LTLA 4JBKA 5IYBG 5C0XG 4DUZQ 1YIJA 2IX0A 2JA8H 2JA5G 4HJ7A 4JYAL 2V1CC 4HIOA 4OO1I 2PMZE 1WI5A 4DV0Q 4DR1L 2VQEQ 2KCMA 1QVCA 4X62Q 4A3FH 4LF5Q 4IFDG 1X55A 4DR2Q 4B3SQ 1KC8C 5IYBH 1VQDA 5HGQA 3CC2A 2AWNA 4JC0A 3CCRA 2Q2HA 3BZCA 1E22A 1XNQQ 2K5HA 1UE5A 4X66L 3DLLA 1VQOA 1MIUA 1UEBA 1OXXK 2PQAA 1X3FA 5LMNL 1YZ6A 4HIMA 4DV7Q 2A8VA 1I3QH 3PIOA 2KBNA 1U5KA 5AJ3L 1J5EL 3S14H 4GLVB 4A76A 3S1NH 1G6PA 3HOYH 3HKSA 1XMOQ 1K3RA 4AYBG 4WJ4A 4DR5Q 2JEBI 1G51A 2Z6KA 3HOVH 2PI2A 3KJOA 4OWXB 4L5SA 3KOJA 1NTGA 3F2DA 3ULJA 3A0JA 4POFA 1WYDA 2CQOA 4Y52H 3HOWG 5M3MH 4JI5L 1HH2P 4JV5Q 3BU2A 4DK6C 4DV4L 4KHPQ 2H5XA 2YTYA 1IBML 1KD1C 1XNRQ 3RLOA 3HOXG 1NMGA 5M3FG 4X6AH 1YJ9A 1X54A 1Q86C 2HHHQ 4JOIC 4A3LG 1H95A 1KXLA 2KHIA 4PZ8A 3OTOQ 1IBKQ 2E5LQ 1OTCA 2UU9Q 4B3MQ 2LSSA 1BBWA 4R4CA 3JAMc 2UXCL 3HOWH 2NZOA 4L5QA 3CCVA 2ES2A 3KYHC 5GQOA 5IP9G 4GKJL 2R93G 1VQFA 3GTLH 5ELNA 4DR3Q 2Q2TA 3NELA 4A3LH 3KFUA 1EFWA 4GNXB 4A3CH 1BVSA 2K50A 1NJIC 4JI8Q 5IYDG 1SMXA 1YHBA 3EBEA 2AHOB 1PH3A 4NXMQ 2R93H 2CWAA 4OXPA 5IY0A 5GAGC 4A3MG 4R1JA 3M3YH 2UUCL 1Y14B 4DK3C 4B3TL 3CMEA 4BBRG 4LF9L 2UUAQ 4LF6Q 3TREA 3FHWA 2N3SA 1FJGL 3GTGH 4DV5L 3HKZE 4JBJA 3F1ZA 4H02A 3DM3A 4YCVA 2VW9A 1VQ4A 3U4VA 4A3MH 1AE2A 4DV2Q 4OX9Q 4JBWA 1OXVA 2BA1A 3STBD 1JJ2A 4IFDI 4YY3Q 3TS0A 1EUJA 5LMUQ 2MFIA 2YYZA 1YBYA 3KF8B 4DV6Q 2NVQH 2HQLA 2PQAB 3RR5A 4A3BG 3M7NA 4P73A 2JJQA 5C0XJ 4GS3A 3Q8DA 3H0GG 4DV3Q 2JA7G 4DUYL 1SR3A 4AIMA 4UP8A 3F8TA 4OWTB 1VQ8A 4PZ6A 1QUQA 4IJHA 1DGSA 1CUKA 1VQGA 3F2CA 4LF8Q 1JJGA 3K0XA 3UDXA 1HZAA 5DLQE 4B3RQ 1Q1EA 1HZBA 4P72A 4JI1Q 4L5RC 2YTXA 2D0OA 2OQ0A 3H0GH 3RLNA 3RLFA 2JA7H 1J6QA 2OTJA 3UDIA 4LF4Q 1Q8KA 3D0FA 3T1HQ 5JEAJ 4RG1A 3I55A 1S40A 2A1AA 4PZ7A 4UPAA 2WAQG 1XPRA 4JI6Q 1PH4A 2OTLA 3ERSX 2E2HH 2QGQA 4KI0A 1HZCA 2ZJQA 2LXJA 1KQSA 4K0KL 2F3IA 2NVYH 5K36G 5FJ8G 3S24A 1HNZL 4MTNA 1FGUA 1YVCA 3UDGA 5JJLA 1VQEA 4BA2I 4PG3A 1HR0W 1L1OA 3K80C 3J7A5 1I6HH 3EN2A 2CFMA 1Q82C 3NBHB 3NENA 2F4VL 1IBLQ 1VQ5A 2F52A 2NVTH 5FJ8H 4FDBA 1HNWQ 1E1OA 2WFWA 1B70B 5IP7H 2IHEA 3FKIG 3T1YQ 1P8LA 4GNXC 3PSIA 2JA8G 1XJVA 3AYHB 4JI0L 1XMQQ 4A3IG 1EIYB 2IX1A 4X65Q 4KHZA 3PGZA 1B8AA 1M1KC 3OTOL 3CCQA 1VQJA 2VL6A 4A3FG 1PH1A 4LF7Q 2IY5B 4NXNL 3FKIH 4DKAC 2ZM6Q 4L5TA 4DPGA 3OYYA 1P16A 5FLMG 4IOAA 2HIXA 2Q2UA 4LNQA 4A3IH 1XTDA 5GAHC 1MJEA 3GTOH 1N34Q 3GO5A 3J81c 1HNXQ 4B3SL 1UE7A 3ULLA 4IPDA 5M5XH 2ID0A 3E9IA 2AMCB 1I94Q 3I4NG 1K83H 4GOPA 3SGIA 3U58A 4P74A 1SROA 3D31A 4YCUA 4C3HH 1UE1A 2N49A 4HIDA 5FLMH 2JQOA 4APVA 2NVXH 1QUQB 3HOYG 3HOUG 4QIWE 3PO2H 1N32L 2R7FA 2YTVA 3HOVG 1X3GA 1WOCA 5ELOA 1X6OA 3M4OH 3I4NH 1W2BA 3K81C 4QL5A 1RL2A 5M3MG 1K73C 3OW2A 3L2PA 1TWGH 2JA9A 3HOUH 4IFDJ 5H1SE 2MO0A 2CWPA 4LWCA 1K8GA 1Z9FA 1KRTA 3UDFA 4DR7L 1KL9A 2Z6KC 4BY7G 4YY3L 1EWIA 5C3EG 1EYGA 3PV0A 4O2DA 1HR0Q 4OWWB 5LMNW 2E2IH 1S72A 2B63G 4JCVE 1IL2A 1A62A 2NN6I 1UE6A 5BR8Q 4A93G 2UXDQ 1NY4A 2KCTA 1PH2A 4JI7L 4QQBX 4EX5A 4C3JH 2RF4A 4BY7H 4ME3A 1SFOH 4GN4B 5C3EH 1L1OB 2ALYB 4X64L 2UUBQ 4BY1H 4LFBQ 1LYLA 4QJFA 2VS1A 2B63H 3I56A 4UP7A 4AQYL 4DV1Q 2ASBA 1IYJB 4A93H 1VQCA 3RN2A 3FP9A 4R4TA 1N8RC 3CD6A 3TQYA 3S15H 4GN3B 2Z0SA 1TWCH 3W5OA 1N36Q 2EXDA 4LFAL 1XPOA 3CCEA 4LUOA 2ZJRA 4JI6L 3S16H 4PMWA 1L2FA 1K9MC 3S2DH 4C3IH 1VQ7A 3GTMH 2VQFQ 1N33L 4DR6Q 2WP8J 3BZKA 3M85A 1VQ6A 5J3BA 1MKHA 1AH9A 1CKOA 1YI2A 4LFCL 1A63A 3U4ZA 1KIXA 4P71A 4WJ3M 2CCZA 4DAMA 4JI2L 3STBC 4JYAQ 2HT1A 1W3SA 4GOPB 1I5FA 2I5HA 1YITA 5IT9c 4DR1Q 1BKBA 5C44G 1VQAA 4NPSA 4BA1I 1QVFA 3ULPA 4A3DG 2PNHA 1VQHA 3GD7A 4JI3Q 3I7FA 5LMNQ 4JI4L 5C4JH 2Y0SE 1A0IA 1T9HA 1VS0A 2GVAA 1AE3A 1TWHH 2VY3A 5C44H 5AJ3Q 2JK8A 1VQNA 4LF7L 3JAMi 1YHAA 2R7DA 1E3PA 3E9HA 1C9OA 3WWVA 4DUZL 1PH5A 2A19A 4POGA 2ATWA 4A3DH 3S2HH 1A8VA 1Q7YC 1Y1WG 2VZAA 4DR4L 1PA6A 4DV0L 4GLAC 3MXNB 1QZGA 4IO9A 2RHQB 4R4QA 3ZJYC 4X62L 2VQEL 1VQLA 4LF5L 5JJKA 4QY7A 4DR2L 1Y1VG 4JI5Q 3GTKH 1YJNA 1NE3A 3J80c 4DV4Q 2VNUD 3H3VH 1UWVA 1SE8A 1Y1WH 2GN5A 5HY6A 1B7YB 1V1QA 2K75A 1VCIA 1WFQA 2NN6G 2RHSB 2L15A 2MQHA 3M9BA 4MZ9A 5FLXc 1QVGA 1GM5A 1IXRA 4DV7L 3S1QH 4EQ5A 2UXCQ 3S1MH 1Y1VH 5IP7G 3G71A 1L1OC 3PUVA 1IBMQ 2CKZB 1XMOL 1L0WA 1PHJA 4A3CG 1Q1BA 4R4OA 4DR5L 2R7ZG 1PH6A 4BXXH 4HJ5A 2K5VA 2JA6G 3ICEA 1D8LA 1VQIA 3HKZG 4A3EH 1FVIA 5C4XH 1VQBA 4JV5L 3L0OA 1PH9A 1NBWA 4KHPL 3PO3H 1GD7A 2I5LX 1G291 2ZTDA 2UUCQ 1FL0A 1XNRL 1JMCA 2R7ZH 3PUYA 4AYBE 4B3TQ 1D7QA 2HHHL 2JA6H 1HJPA 1E24A 3PCOB 2E5LL 1IBKL 2UUBL 2UU9L 4B3ML 3CCMA 4LFBL 2K4KA 3HFZB 4DV5Q 1IZ6A 4YHHQ 3RZOH 1YNXA 2UXBQ 2R92G 3I4MG 2R6GA 3TRZA 4BBSH 2PI2E 4DR3L 2EQSA 4HJAA 3A74A 2K5NA 3KJPA 1RIPA 2AKWB 3LGJA 4GOPC 4Y7NH 2E2JH 4JG2A 1CKMA 4JI8L 3RNUA 4GKKQ 3JC66 1TWAH 5GROA 3PF4A 2R92H 3J80i 3I4MH 4NXML 4A3GH 3KDFA 1GVPA 3J81j 3CC4A 1VQ9A 4DUYQ 2UXDL 2FXQA 4YWLA 4DR4Q 3CXCA 1KHIA 3F2BA 2K52A 2UUAL 1BBUA 4LF6L 1YEZA 1KAWA 2OQKA 1XPUA 3GTJH 3H3VI 2AWOA 3CAMA 1JT8A 4UP9A 2B3GA 3GTPH 2NZHA 4OX9L 3W1BA 4DV2L 2I5MX 2K14A 1CKNA 3PF5A 5LMUL 3RN5A 4BY1G 3CCSA 1R9TH 2Q2IA 5IWAQ 4DV6L 3G4SA 1PFSA 2JA5H 4IPCA 1M90C 1GO3E 1JJCB 3KF6A 4JI3L 5JEAG 1EQRA 4IPGA 4DV3L 1SRUA 4K0KQ 1PH8A 2IT1A 3K7AH 3VDYA 1V43A 1HNZQ 3EIVA 1YHQA 1WCMG 4LF8L 3U50C 3PIPA 4B3RL 2ZJPA 3RZDH 3PUZA 4JI1L 3I4OA 3CC7A 4IJLA 2F4VQ 1TXYA 3J81i 4ALPA 4LF4L 3T1HL 2VUMG 5GADC 3I2ZA 5M5WH 3L7ZC 4A3KG 1OXUA 1WCMH 1X9NA 2QEXA 1CSPA 5GAEC 4JI0Q 2YU9H 1SN8A 1V9PA 3M4QA 4JOIA 2D62A 3AFQA 1EOVA 4MNOA 3CF5A 2QA4A 2MO1A 2BH2A 4YWKA 2VUMH 1Q46A 1PVOA 4DNIA 4A3KH 3PUXA 4NXNQ 1N9WA 1O7IA 2LXKA 3BJUA 4TQUS 2WAQE 2XGTA 3CCJA 3HOXH 5M3FH 3J7ZC 4LW1A 4NB3A 3CQZH 2RCNA 4RMFA 5EAYA 3CMAA 1JB7A 1X65A 2KHJA 2KENA 1LM0A 1VQKA 1IBLL 3CCLA 2DUDA 3KDFB 3K7UC 4A3JG 1HNWL 1NMFA 1K8AC 3K8AA 4GLXA 5IP9H 3T1YL 3TS2A 1N32Q 4X66Q 4YCWA 1VQPA 1X56A 1XMQL 3UE0A 3IRBA 2D0PA 3ER0A 1WJJA 4X65L 3AEVA 4A3JH 5C0XI 5IYDH 2E8GA 1J5EQ 1K0RA 1S3OA 2UXBL 4YHHL 2ZM6L 1CKNB 2JE6I 3CCUA 1PV4A 1X3EA 3GTQH 4DR7Q 2BA0A 2WB1E 1N34L 1HNXL 4OO1G 4BBRH 4HJ9A 4LUZA 2BH8A 1I94L 1I50H 3KF6B 5JJIA 4GKKL 3W1GA 3CW2C 3H15A 4YWMA 1E7ZA 1MJCA 1PH7A 4GN5A 4JI7Q 3HOZG 2ZTCA 2N78A 2ZTEA 1QZHA 4BXXG 4AH6A 4X64Q 1Q12A 4JBMA 2OWOA 2XTIA 3AFPA 4A3EG 3PUWA 3KLWA 4A3BH 1XNQL 4TVAB 5C4XG 4IPHA 3A5UA 3G48A 4AQYQ 2JEAI 3CPWA 1Z47A 1OXTA 5M5YH 5IYCG 4IOCA 1VQMA 3PO3G 3HOZH 3S1RH 2C35B 1Q81C 4LFAQ 5E7NA 3AQQA 4KLKA 4OONA 4DAYB 1PYSB 1HR0L 1ASYA 5IWAL 2B29A 1PYBA 1HZ9A 2N8NA 4LUVA 3MEFA 4C2MH 5IE8A 5IYCH 3TEHB 5BR8L 4XIGS 1N33Q 4BBSG 1LUZA 2HIVA
chains in the Genus database with same CATH superfamily
2FFKB 4HIKA 2IHFA 3G6EA 1YJWA 3K0YA 1NUCA 1U0LA 1DOLA 2I0QA 1DZ1A 1XX8A 3B6YA 3S17H 4O0AA 3H91A 1I50B 4JPBW 1ASZA 3FPPA 1S5FD 5A35A 3UE1A 2M2LA 1SLJA 2PNRC 2AUKA 3R3OA 1EIFA 5L37A 3A54A 1SYBA 1A15A 3A5ZB 5IYBG 4QF4A 1HA6A 5M5YB 4JYAL 4OO1I 2QKIC 1WI5A 4DV0Q 3EQLC 4IFDG 4X3UA 1X55A 1Z6HA 4ZAIA 2X6LA 2N88A 4CJ0B 3CD6A 1UEBA 1OXXK 3TBIB 1EZ6A 4DV7Q 3R8BA 3PIOA 5AJ3L 1TY2A 2F0GA 1MSGA 1DCZA 4Z9CB 4BBSB 2PZTA 2JEBI 1G51A 1ILQA 3DWAA 2PI2A 4K6LA 1HA5A 1NTGA 3F2DA 3ULJA 3QIAA 1CA5A 3HOWG 1TWAB 1HH2P 4KHPQ 1KD1C 1EEID 1KXLA 3DUZA 4JOIC 4PQXA 1F2ZA 2FMCA 4K14A 2LSSA 1BCPD 4G4KA 1D5XC 1BQQT 4L5QA 3CCVA 3VR6A 1F9PA 5IP9G 2R93G 1LT5D 5ELNA 1I4HA 2Q2TA 3KFUA 4A3CH 1BVSA 2JXMB 1B44D 4JI8Q 1AW7A 4IUPA 3NBHA 1SBBB 1GUNA 3S9WA 4NXMQ 4OXPA 5IY0A 1Y14B 4PNYA 1B3QA 4LF6Q 3DXJC 2HQEA 3BYTB 5I9PA 3HGBA 3DM3A 3I91A 4DV2Q 3HEJA 1K8MA 2MFIA 4M8AA 5LMUQ 1YBYA 3NWSA 5DEHA 3RR5A 1UEAB 1CZWA 2EYJA 3Q8DA 1STNA 4DV3Q 1SR3A 4I7ZC 1ESRA 5ELEA 4UP8A 4AIMA 4OL7A 1SNPA 4OWTB 1QUQA 3HOWB 1VQGA 2NB0A 1D1KA 4UHVA 1Q1EA 3M4YA 1EFID 3GTLB 2EYHA 2YTXA 3H0GH 4R9WA 3RLNA 2OTJA 3T1HQ 3D0FA 5CC4A 3EVQA 1S40A 1JB3A 2A1AA 1Y8PB 1YNJD 3CU7A 1PH4A 2R93B 3FMCA 3ERSX 2E2HH 2QGQA 4TSSA 3M3YB 1TKWB 2F3IA 2NVYH 5IIFA 1HNZL 2RA4A 4MTNA 2F3VA 3UDGA 5JJLA 1ZXTA 4BA2I 1L1OA 4FP5D 5EPKA 1MD2D 1G2SA 3NBHB 3OPOA 5D65A 1WTOA 2F52A 5FJ8H 2DY7A 2K01A 2NVQB 3QG1A 2OXPA 1P8LA 3PSIA 4JI0L 4FF3A 4FNFA 3J80L 2A6ED 3ND8A 1B8AA 3CCQA 1PH1A 2IY5B 3FKIH 4L8JA 4L5TA 4DPGA 2SNMA 1F9QA 2HIXA 2L55A 3PMFA 1N34Q 1HNXQ 3DWPA 2A73B 3E9IA 4BS9A 1K83H 1VF7A 1UE1A 4HIDA 2G5DA 1ZEQX 4APVA 2NVXH 1QUQB 3N52A 3PO2H 1HQRD 5A2QL 4WRDA 1TU2B 5D14A 1K73C 5CORA 5H1SE 2MO0A 4ME5A 1STAA 3UDFA 3O13A 4KKTA 2NVTB 4FXGC 4K8IA 1EYGA 4O2DA 4OWWB 3VR2A 4L6TB 1S72A 5I6YA 3MXNA 1PFNA 1IL2A 4NMZA 1PH2A 1BR9A 2RF4A 3IAYA 3T56B 1L1OB 1M4VA 4KN7C 2VS1A 2B63H 1DONA 1IYJB 5FO7B 3QJYA 3KUPA 1SMYC 3TQYA 1Y69U 4GN3B 1N36Q 4LFAL 2EXDA 4LUOA 1SMYD 4ULLA 3ND9A 4F7XA 1K9MC 4C3IH 3GTMH 2VQFQ 4DR6Q 5J3BA 3I70A 4XDXA 5C6AA 5D3IB 2E76C 4LFCL 1A63A 1IKLA 2HT1A 3K57A 2HD3A 1I5FA 1JWMD 5CV8A 1WTHA 2NYZD 4DR1Q 3NPPA 2L5TA 1G91A 2LKVA 5C44G 2E2IB 1VQAA 1QVFA 4A3DG 5JAVA 3GD7A 4JI3Q 1CA6A 4C3JB 4NDXA 4GKJL 1A0IA 2VY3A 1VQNA 2ATWA 4IQZA 3S2HH 1A8VA 3S15B 1U4LA 2LMCB 3HS0C 1KLGD 1B4OA 3MXNB 1QZGA 1LTID 2NTSA 3MTSA 2F0FA 3ZJYC 4DR2L 4JI5Q 3GTKH 1YJNA 1NE3A 4DV4Q 2SOBA 3H94A 1SE8A 1Y1WH 5HY6A 3GQBA 3DEPA 1PTOB 2L15A 1GM5A 2PCFB 1IXRA 4OIJA 4EQ5A 3R2TA 1U4RA 3VYUA 3W2DA 2H1EA 3G71A 1L1OC 2XSCA 1UUPA 2CKZB 1L0WA 5HURA 4QUCA 4LJZC 4BXXH 4HJ5A 2K5VA 2JA6G 2I46A 2F0QA 3HKZG 3TZUA 2PPBC 1R4QB 4N8FA 5FKAC 5C4XH 4QIWB 2EYPA 3L0OA 4H44C 3K58A 3GTQH 3T13A 1FL0A 5E3FA 5C4JB 2ICIA 3PUYA 1QJOA 4B3TQ 3C3LA 3G7LA 1IW7D 5C44B 4OHJA 2SDFA 2E5LL 3HFZB 4DV5Q 4A3DB 5JVG3 1BNZA 2BE5C 2L12A 4KJNA 2K33A 2QEJC 3FPUB 2PI2E 4YIJA 2EQSA 4HJAA 3A74A 1PRTB 2K5NA 1GUGA 3LGJA 2E2JH 4DK1A 4JG2A 1CHPD 1CKMA 4IUQA 1D6EC 1SYFA 3J81j 4DUYQ 4YWLA 3S1QB 3CXCA 3SR1A 2UUAL 4K2LA 3H3VI 1FR3A 3CAMA 1GHJA 1RHPA 3OIPA 1JT8A 3GTPH 4OX9L 3W1BA 4UDUC 1ML0D 1WTWA 2F0UA 3CCSA 2Q2IA 4ZCKA 1WTPA 4J1MA 1PFSA 4IPCA 1M90C 1SNOA 4JI3L 1EQRA 1SRUA 2JA6B 4K0KQ 2IT1A 2HUGA 3HKZB 1AP0A 4FF1A 3SXHA 2CW0D 4CKCA 1PTOC 3RZOB 4RHSA 5C4HA 1TVXA 2ZJPA 4C3IG 3RZDH 3PUZA 3I4OA 2MGSA 3CC7A 3J81i 2F0KA 4LF4L 4Y7NB 5ELBA 1WCMH 4DFAA 4DAYA 1CT1D 2YU9H 1SN8A 1V9PA 3M4QA 1EOVA 1CQVA 4MNOA 2BH2A 1ET6A 1PVOA 2QDBA 3SK5A 3PUXA 1UAPA 3P7JA 1ZYRC 1IYUA 4CDCC 3IFDA 4B3SQ 3J7ZC 4DNRB 5D3DA 2RCNA 1EYAA 2KHJA 1LM0A 1BOSA 2KEEA 3DWQA 1HNWL 1NMFA 1H9KA 3K8AA 4GLXA 1N32Q 1X56A 1XMQL 2C5CA 1YNND 3QOJA 1WJJA 3K7AB 4V0BA 5LL6X 5IYDH 1K0RA 1O7ZA 1S3OA 4CJ1B 1ILPA 2ZM6L 2JE6I 5KYLA 3L9AX 3T4AC 4DR7Q 1E0BA 4X3SA 4HN7A 2HCIA 4LUZA 5IGGA 2Z8LA 3WOFA 1I50H 4KKUA 1DYQA 5JJIA 2MPMA 4C3IB 4YWMA 3GTMB 1H9RA 1E2VA 4BXXG 1QZHA 4AH6A 2B2UA 2D5DA 2XTIA 4IUUA 3KLWA 5C4XG 2EDGA 4AQYQ 3M7GA 2NWGA 5M5YH 3OW7A 1Q81C 4RCNA 1IKMA 5E7NA 1G6ZA 4DAYB 1FNUA 1U9RA 3AU7A 1HZ9A 1XWEA 5IYCH 3TEHB 5BR8L 4LF9Q 2DNEA 2O4XA 3M4PA 3VR5A 5FLXE 2DNCA 4J8QA 4JI2Q 3S2HB 5CV7A 4MHEA 1PLFA 3E0EA 1WD1A 4BBRB 2RBMA 1C0AA 1SE3A 3EJIA 2EYLA 3NEMA 4K5XA 1SJHD 3DMUA 1KRSA 2K6AA 2EIFA 4DUZQ 2QW7A 2D2CC 2IX0A 4HJ7A 2V1CC 3IL8A 4HIOA 2RDHA 2IJ0A 1KNAA 5FO8B 4X62Q 2VQEQ 4A3FH 4LF5Q 1O7LA 5C4XB 4IN3A 1HUNA 5IYBH 2AWNA 2KECA 4C2MB 3BZCA 5IGFA 1XNQQ 2PO4A 3GTQB 3DLLA 2KJXA 1VQOA 1MIUA 4HAEA 5LMNL 1BXTA 2A8VA 4IFDH 1I3QH 1U5KA 2WAQB 1CFMA 3HOYH 3HKSA 1XMOQ 1K3RA 3AMUA 4DR5Q 3IKJA 4L5SA 3F2UA 3NQTA 1WYDA 2CQOA 5IGEA 4JV5Q 1FD7D 3KBXA 1NNXA 2YTYA 1J9OA 4JK1C 3RLOA 2F0WA 1YJ9A 3Q6SA 4KKSA 3DM1A 4PZ8A 1IBKQ 4B3MQ 1OTCA 2UU9Q 3HOWH 1F77A 5GQOA 5IGCA 1VQFA 4EGVA 3GTLH 3NELA 2IL8A 4NP5A 1BF4A 1EFWA 5IYDG 4XQQA 1SMXA 1YHBA 2N55A 3EBEA 3H6MA 1SXTA 1EYCA 2AHOB 4OEMB 2R93H 5GAGC 4R1JA 3M3YH 4U68A 4WJWA 4LF9L 5FOBB 2L0CA 3TREA 3GP7A 4N9PA 2EY5A 3SVMA 3S14B 2JN4A 4K8JA 3HKZE 3F1ZA 3JAML 1TIID 3U4VA 1OXVA 2A69C 2BA1A 3STBD 3U9OA 2E74C 1B3AA 4YY3Q 2YYZA 4DV6Q 2NVQH 5M3MB 1ENCA 4IALA 1EYDA 2F0TA 2RSNA 1QNUA 1SNCA 5C0XJ 4GS3A 2YU9B 4HCSA 2B2UC 3BVMA 4PZ6A 1DGSA 1CUKA 1LO5D 1IYVA 1JJGA 4IUTA 5DLQE 1DJRD 4JI1Q 1VDZA 4L5RC 2D0OA 3RLFA 1J6QA 3UDIA 3Q0AA 4JI6Q 1B53A 4XYOA 1WTQA 1XPRA 2V4DA 1BCPB 2E2DC 2IX3A 1PZKD 2EXZA 2H4OA 2LXJA 4RAUC 4I7AA 1Q3LA 2HDMA 1FGUA 2RSOA 1KDCA 1VQEA 1DOKA 4PG3A 1NCVA 1HR0W 1Y8OB 3J7A5 3BYYB 1H9JA 1LACA 1IBLQ 1SYDA 2NVTH 2B8GA 3TP6A 5IP7H 2EY6A 2IHEA 1STEA 3T1YQ 3AYHB 3CKIB 3L3OC 1FNVA 2A68C 4KHZA 1FNWA 3NP8A 3PGZA 1M1KC 2A68D 5EGTA 4A3FG 2VL6A 5I2YA 4C3HG 4NXNL 1QOHA 4LNQA 1II3A 1XTDA 3VR3A 4DR4Q 5JJKA 3J81c 4ZRZA 3I4NG 3U58A 4YCUA 3I8ZA 4U673 4E6IA 4JVZA 1FYCA 2F0HA 2JQOA 3HOYG 1EZ8A 3MHBA 2R7FA 5ELOA 1X6OA 3M4OH 1BUVT 2EVBA 1RL2A 1RKNA 2QDLA 1I6HB 1KAAA 1TT2A 1K8GA 3ONAB 1LTRD 4BY7G 4YY3L 2F0OA 3PV0A 4X3KA 3SHLA 2E2IH 2BCOA 2F3WA 4NW2A 3OIQA 1NR2A 1STYA 2KCTA 1HHVA 4EX5A 4C3JH 1BCPC 2ZXPA 4ME3A 4X64L 2ALYB 5ISRA 2UUBQ 1CI3M 2EOTA 1B2TA 4UP7A 4DV1Q 3IFTA 3FP9A 5M5XB 5DM73 3S15H 2Z0SA 3MEHA 4A3FB 4C3HB 1MSHA 1AFPA 1V8QA 4JI6L 4PMWA 2B2YA 3V2TA 1PTOH 1I3QB 4LAAA 3I4NB 1AH9A 1CKOA 1YI2A 2PW7A 1KIXA 4WJ3M 1TWGB 3HOYB 1X32A 4R8IA 3R93A 4R8NA 5BN5A 2EE1A 3NWTA 4BA1I 1EOTA 1SYEA 2Z4IA 3I7FA 2KA7A 4BY7B 2IWHA 5C4JH 2A6HD 4BY1B 1KABA 1TWHH 5C44H 4KD3A 2JK8A 1PDQA 3E9HA 4EVOA 3WWVA 1PH5A 4A3DH 1ENFA 4DR4L 5FO9B 4DV0L 4GLAC 1YNJC 1S5CD 2FMMA 1Y1VG 3S2DB 1SYCA 5IT9c 2RHSB 1VCIA 3OW2A 3HP3A 5FLXc 4DV7L 3S1QH 1PXUA 2UXCQ 1EQVA 5IP7G 5JPNC 2OF1A 2F03A 5EKIA 3PUVA 5CV5A 1EU4A 1Q1BA 1PH6A 2WINB 3ICEA 3LNNA 1D8LA 3NE5B 1EY8A 2RDGA 4A3EH 1O78A 3URYA 1PH9A 1NBWA 4KHPL 3PO3H 1GD7A 1JQYD 1G291 2A6EC 2ZTDA 2UUCQ 1D7QA 2JA6H 1H9SA 1EQTA 1BCPF 2EYFA 2UUBL 3TMEA 2UXBQ 3X3NA 3RZOH 4MTKA 3I4MG 2DJFC 1SDFA 3TRZA 1HFNA 3MFGA 3VYTA 2AKWB 2X69A 4Y7NH 3V96A 4JI8L 1S4ZA 3J80i 1WTVA 5IGDA 4NXML 2A5HA 4FVMA 4A3GH 1GVPA 2UXDL 3CC4A 1LTBD 4DF7A 2ENBA 2K52A 1Y1VB 4LF6L 1L0XB 3S1MB 1KAWA 5JOBA 1LABA 1GUTA 3SE0A 1XPUA 2WIIB 5KYIA 3LWUA 4UP9A 1HQMC 1SEBD 3VYSA 2NZHA 3BDOA 4DV2L 3KLSA 4BWGB 4C3JG 5LMUL 1R9TH 3G4SA 1K28A 2L1BA 4FXKC 2DY8A 4UAIA 1CTMA 4DV3L 1PH8A 3VYRA 3K7AH 1V43A 1W6KA 4RGMA 3OHXC 1YHQA 3TSSA 1A2TA 4IJLA 2F4VQ 1TXYA 4ALPA 3BG3A 3NQIA 4F88A 3T1HL 2VUMG 4IUNA 1OXUA 1GOZA 3I4MB 4DXFA 1H9SB 1EY9A 4CBVA 2B2YC 3OWFA 2XNAC 1E2ZA 1Z7TA 3M4OB 4YWKA 1Q46A 1O7IA 2LXKA 5CV6A 2K5QA 1JC7A 5T1IA 2QF7A 4RMFA 4NB3A 5EAYA 4PV1C 2Q8TA 3K59A 1JB7A 2KENA 1JWUD 3K7UC 4A3JG 4KD4A 4PMBA 1EY4A 2KCCA 4X66Q 4YCWA 1VQPA 2XRSD 1DD2A 3AEVA 1J5EQ 2NZ1D 2UXBL 3BS1A 1PV4A 1H9MA 2O5JC 4KN4C 1N34L 1HNXL 4OO1G 4BBRH 2B39A 2BH8A 2WV6D 5J1ZA 4RA8A 3QO2A 3H15A 1E7ZA 1MJCA 2AQ1B 4JI7Q 2VUMB 2L4NA 3A55A 4JBMA 2OWOA 4B08A 4RKBA 4A3EG 2ZT9C 4A3BH 2I07B 1MI2A 3A5UA 2JEAI 3CPWA 1Z47A 1JCKB 3CQZB 3PO3G 2FHTA 3AQQA 3NTIA 4OONA 2B29A 1GUOA 2N8NA 4LUVA 3MEFA 4C2MH 1GUSA 4DXGA 1IW7C 1G8ZD 1QCBD 1N33Q 4KHVA 2HIVA 4XQJA 1LTSD 1TWHB 4XT1B 4HJ8A 4A3JB 1EQQA 2B2TA 2GVBA 5BN3A 3HZXA 1GKHA 1BBXC 2DGYA 4A3GG 4QGUA 4P75A 2Y0SG 4A75A 3BVZA 1A6XA 4XTCS 1N36L 3T51B 5EQ0A 4PMCA 4GNXA 2WB1G 4RGTA 4A4IA 4JI4Q 2VQFL 4DR6L 2WACA 1CSQA 3CPFA 1LTLA 4JBKA 5F2DA 1YIJA 1IHZA 2JA8H 3HG9A 4NKLA 4FO2A 3MZ5A 4H0LC 4DR1L 1QVCA 3BZDB 4A3EB 3J81E 1KC8C 5HGQA 1WTRA 3CCRA 2Q2HA 3PO3B 2K5HA 4X66L 2CW0C 2M00A 3C1EA 1TWFB 1JOKA 2AQ3B 1PMRA 3E6ZX 2WKDA 1J5EL 3S14H 4A76A 4QUFA 1G6PA 4C56C 4AYBG 4DAVA 3KJOA 4OWXB 3KOJA 3A0JA 3J81L 4POFA 3NTKA 3A8JE 4EQOA 5M3MH 4JI5L 1J8IA 3WOEA 4DV4L 4A3GB 2H5XA 2O2LD 2Y0SB 1XNRQ 4ZYSA 1NMGA 2F0PA 4A3LG 1Q86C 2HHHQ 1H95A 2DN8A 3NUCA 1ONLA 3OTOQ 4WJ4A 3E0JA 2WB1B 4I65A 4DR3Q 1F9SA 3VR4A 4KK7A 4GNXB 2K50A 1R9TB 2K7VA 1PYWD 1YNNC 2CWAA 4A3MG 3I72A 4DK3C 4B3TL 4BBRG 4V190 3FHWA 4HSPA 3GTGH 4DV5L 2RCFA 4YCVA 1VQ4A 1AE2A 4IFDI 1SSOA 3TS0A 1EL0A 1DOMA 4HEDA 3PIP3 4A3BG 4IUVA 4Q0FA 3M7NA 3SDZA 4P73A 2XWBB 4AYBB 2J4XA 2JA7G 4DUYL 4EQNA 1FGBD 1BDOA 2KQ3A 5EKLA 1VQ8A 1JOQA 3MC0B 4LF8Q 4L63B 4B3RQ 1A2UA 1ICFB 4P72A 1SNMA 2F1MA 1Q8KA 4C1NI 5JEAJ 3I55A 3A8IE 4UPAA 1RTNA 2WAQG 1B50A 2C9OA 1C8CA 5KRUA 4KI0A 1D5ZC 2MUYA 2ZJQA 1KQSA 4K0KL 1SAPA 3D3RA 5K36G 3K6OA 5IT9E 2BDNA 4KV6A 2Z4HA 2Z9HA 2B2TC 1YVCA 3SEBA 3KK7A 2P5ZX 3K80C 1QG7A 1I6HH 4A3MB 3EN2A 2NN6H 1Q82C 4ZK9B 5K5PA 2VB2X 2Z1CA 3J7AF 2K28A 1QB5D 4FDBA 5E1FA 2WFWA 1B70B 1S5ED 4GNXC 2JA8G 1XJVA 5E4XA 4A3IG 4P2CB 2IX1A 1XTCD 4X65Q 1D2BA 3D4DA 3W3AA 3OTOL 4A3BB 5FLXL 4LF7Q 4DKAC 2B8FA 5FLMG 2Q2UA 5GAHC 1MJEA 2JA7B 1QNKA 4B3SL 1RTOA 1UE7A 3ULLA 4IPDA 1HUMA 5M5XH 2ID0A 2AMCB 1I94Q 4GOPA 3SGIA 1TS3A 4P74A 1SROA 4C3HH 2PW5A 2N49A 1SE4A 4QIWE 3HOUG 1N32L 2YTVA 4XT3B 5I9OA 1WOCA 4F8MA 3I4NH 5I4DA 4QL5A 5M3MG 3L2PA 3CRKC 1TWGH 3DEOA 2XIWA 1EY5A 2Q8IB 2CWPA 4DR7L 1KL9A 1JWSD 4B9XA 1I4XA 1EWIA 5C3EG 2Z6BA 1G2TA 1HR0Q 5I6WA 5LMNW 1RF2D 2LFNA 1TS4A 2F4IA 4A93G 2UXDQ 1ENAA 4BY7H 4GN4B 4BY1H 4LFBQ 1LYLA 5C5MA 3I56A 2JA8B 4AQYL 4A3IB 2ASBA 1VQCA 4RGNA 1N8RC 3J7YW 2NUCA 1EY0A 3CCEA 4F87A 2X6GA 3S16H 3NBIA 3S2DH 1VQ7A 3K5OA 2WP8J 1I6VC 4MN3A 3M85A 5TSSA 1MKHA 5KEEA 2CCZA 4DAMA 4JI2L 3STBC 4JYAQ 3HOUB 1W3SA 4GOPB 2I5HA 1YITA 4FF4A 1S5BD 4QB4A 1V1PA 1NAPA 1I4PA 1MBYA 4KTAA 4NPSA 2K32A 1XYIA 4KJOA 5IOCA 3ULPA 4OGQC 1VQHA 4ABNA 3EFXD 2EPBA 1SFOB 5C3EB 2Y0SE 3PQIA 4CGYB 2GVAA 1AE3A 5AJ3Q 4G7HC 4LF7L 2PZWA 3JAMi 4KY5A 2R7DA 1C9OA 4DUZL 4POGA 5IODA 4A93B 1AN8A 1Q7YC 3QB3A 4ODGA 1TWCB 1ESFA 5M9OA 3SK8A 4IO9A 2VQEL 4R4QA 4X62L 4LF5L 4QY7A 3D6WA 1KDBA 1SJED 2GN5A 1XNQL 1B7YB 2NN6G 4KY6A 1WFQA 4MZ9A 1QVGA 2MQHA 1HTLD 1EY6A 3GTGB 1I4QA 3S1MH 1Y1VH 2PMZB 2XN9C 1E2WA 3NXWA 1IBMQ 5EPLA 5ELFA 1XMOL 4DR5L 2R7ZG 1VQIA 1A3UA 1VQBA 2TSSA 4JV5L 5C4ZA 2K05A 4ZKCB 4AYBE 1HJPA 1E24A 1SE2A 1SNDA 3PCOB 3I73A 1IBKL 4B3ML 2UU9L 4LFBL 4HMJA 5AFWA 1IZ6A 2VB3X 1CK1A 1QE6A 2F0SA 4YHHQ 3I90A 2L9HA 2R92G 1O80A 5BN4A 1V1PB 2QILA 2R6GA 5E4WC 1HRJA 3LX0A 4EQPA 3KJPA 4GOPC 2K03A 3JC66 5GROA 3PF4A 4N8X1 3I4MH 1VQ9A 3RMHA 3KLSX 3QOLA 3F2BA 2F0EA 3CHBD 3H09A 1YEZA 2OQKA 2LY7A 2F0IA 2AWOA 3EROA 2B3GA 1LT4D 3A7AB 2I5MX 2K14A 3C2PA 2OEOA 3PF5A 3RUZA 4BY1G 3RN5A 5EBDA 4DV6L 4XXEA 5C0XH 4DAPA 1JOOA 5M3FH 4FF2A 2JA5H 5KNBA 1GO3E 1JJCB 3VA5A 5JEAG 2R7ZB 5CR3A 4IPGA 4KMUC 3VDYA 1HNZQ 1QWYA 3A7LA 3U50C 4JI1L 2EY1A 2KVMA 4A3KG 1X9NA 2R92B 1CSPA 5GAEC 2AUJD 4JI0Q 3OMCA 4RHRA 2D62A 2B2WA 4WFN3 2VUMH 1ET9A 5JJZA 1N9WA 4M1UB 3GTJB 4TQUS 2WAQE 1IBML 3HOXH 1EU3A 3A56A 1KNEA 3D4RA 3CQZH 4K5VA 2J7ZA 4LW1A 4ZQ3A 3CMAA 5COYA 1X65A 3CCLA 1IBLL 3Q23A 3T1YL 2EY2A 3TS2A 2A6HC 3QWNA 3N6RA 4HMIA 3IRBA 4KY7A 2XRQD 3ER0A 3H3VC 4A3JH 1D5MC 3P20A 2XWJB 4YHHL 3CCUA 1RODA 1GUWA 1HCZA 1K3BC 1LV9A 2RQXA 1LT6D 5M5WB 1V1OA 3S16B 5J39A 3TN2A 1EWCA 1PH7A 3HOZG 2ZTCA 4OO1H 2N78A 4ZUIA 1Q12A 1LLRD 4RKLA 4A3KB 1CQFA 4IZ8A 1CHQD 3LWEA 1VQMA 4H7BA 2C35B 3S1RH 1W6JA 4LFAQ 4G7OC 4KLKA 1ASYA 1VF5C 4LK1C 5IE8A 4XIGS 5CV4A 3E3XA 5G3LD 1LUZA 5KGUA 3J80E 3CP0A 1TWFH 4TRDA 4LFCQ 2E75C 1FJGQ 1D1IA 3Q22A 4R4IA 2HDLA 1JE5A 3CRLC 4UY8C 3K5MA 2G9DA 2MNAA 4DV1L 5NUCA 3GDEA 1OXSC 1B1ZA 1KTKA 1EIGA 1O7YA 5C5LA 1BO0A 5HGTA 4J15A 4S3SA 1C7YA 5A2QE 2YV5A 3QR8A 5KIXA 4GKJQ 2OCEA 1E1TA 5C0XG 3MAQA 1B9MA 2JA5G 1UNSA 3HOZB 5ELDA 4ZLTF 2PMZE 3UI2A 2EJGC 4X3TA 2SEBD 2RDFA 2KCMA 2F0DA 4DR2Q 1VQDA 3A8KE 3CC2A 4JC0A 3NTHA 1E22A 3KF8A 1UE5A 2F0LA 1LTAD 2PQAA 4HIMA 1X3FA 1YZ6A 1X3QA 2TMPA 2KBNA 3D8GA 5EJWA 1ICWA 4GLVB 3S1NH 2BOSA 3MFYA 2Q8RE 2Z6KA 5FK9C 3HOVH 3S17B 2RKSA 2J0TD 4XQNA 4HSVA 1WVLA 4Y52H 1U4MA 3BU2A 4DK6C 4MIUA 1PFBA 1VMPA 3HOXG 5M3FG 4X6AH 1X54A 3P1HA 2B2WC 2KHIA 4A3CG 2E5LQ 4R4CA 1BBWA 3JAMc 2M9VA 3C46A 2UXCL 2NZOA 2ES2A 3KYHC 5CV9A 4A3LH 2AQ2B 2LS01 4ZUJA 1NJIC 4C1NK 3HRZC 2JA5B 3D4WA 1PH3A 3FDTA 1B9NA 1MGSA 5G3LF 3TP8A 1WTXA 5JVH3 2UUCL 1QILA 3CMEA 3MXPA 4FYDA 2UUAQ 2N3SA 4CDEC 1FJGL 4JBJA 4H02A 2VW9A 3K5LA 1DXMA 2GA4B 3OWEB 4A3MH 4OX9Q 4JBWA 1JJ2A 1I4RA 1EUJA 3MXUA 3KF8B 2HQLA 2PQAB 3DHQA 4JW0A 2PYKA 3ERQA 2JJQA 4QMGA 3H0GG 4N9TA 2F0JA 2F0NA 4LMQD 3F8TA 4H13C 4IJHA 2K5DA 3F2CA 3G6JB 3K0XA 3UDXA 1HZAA 1CZGA 1HZBA 1JR0D 4O42A 5M3FB 3HOXB 2OQ0A 2JA7H 4LF4Q 2EZVA 5C3XA 1TR5A 4RG1A 1LT3D 2PZUA 4PZ7A 2JSOA 1S5DD 2OTLA 3BVGA 3WDNA 1HZCA 2A74C 1PFMA 3TP5A 5FJ8G 3S24A 1JORA 2B2VA 1AZPA 1HFGA 3X3MA 2CFMA 3NENA 2F4VL 1VQ5A 2XVSA 5K36H 1XXGA 1HNWQ 1E1OA 4DN4M 2RVLA 3TP7A 2MJ8A 2BDOA 3C1FA 3FKIG 5CGKA 3J7AV 3U9SA 1LTGD 4K5WA 4RWSC 5LL6S 1XMQQ 1EIYB 1RCVD 3EA6A 4RH6A 1C4QA 1VQJA 1TY0A 2ZM6Q 1RDPD 3OYYA 1P16A 4IOAA 2CH4A 3H0GB 4A3IH 3GTOH 3S1RB 3OOCA 2BE5D 3GO5A 3Q24A 3PO2G 2EJFC 5I2XA 4K2KA 1NR4A 3NSWA 3SK6A 5LHY1 3D31A 2MP1A 1C48A 3KBGA 2K1BA 5FLMH 4CKBA 2FJ2A 3OMGA 2E2HB 2NVYB 3HOVG 2VXWA 1X3GA 3GV6A 3AB9A 1KLUD 4O1NA 3K81C 2IW3A 3T16A 4RCOA 2JA9A 1GJXA 3HOUH 1DM0B 2R61A 4LWCA 5KNDA 1Z9FA 1KRTA 3RD4A 1A3VA 2Z6KC 4CJ2C 1K8OA 4DU9A 2B63G 1IL8A 4JCVE 1A62A 2NN6I 1UE6A 4ID6A 5BR8Q 1NY4A 4QQBX 4JI7L 4RGOS 1SFOH 1ZKOA 5C3EH 3E5SA 1STBA 3FKIB 4QJFA 1PZID 5JPMC 1HXYD 1PTOD 4A93H 1F2MA 3RN2A 4R4TA 5DM63 1VMCA 1TWCH 3W5OA 1XPOA 1K83B 2OT2A 1STHA 2ZJRA 5DAUA 3D6CA 5EKKA 1L2FA 2SNSA 2NVXB 3MA2B 3PO2B 1N33L 2ICEC 3BZKA 1VQ6A 3FRPB 3U4ZA 3T53B 4P71A 3S1NB 1KDAA 4QCLA 3R2IA 4G7ZC 3HOVB 1ZYRD 1T5XD 2F0MA 1BKBA 4OIKA 1PRTC 2D9UA 2PNHA 1I4GA 1PRTD 5LMNQ 4JI4L 3TZDA 1VS0A 1T9HA 5J22A 1M8AA 4HCEA 2KHSA 2B63B 1YHAA 4IFDJ 1E3PA 3TDQA 2A19A 1Y1WG 2VZAA 1PA6A 2ZXRA 2WKCA 2RHQB 1U4PA 1VQLA 1EIHA 2KEDA 3J80c 2VNUD 1SNQA 3H3VH 1UWVA 1V1QA 2K75A 5CMDA 4WORA 3M9BA 4CDFC 1R4PB 4CKEA 2IPKD 2B2VC 2CHBD 1CM9A 2K5WA 1PHJA 4R4OA 3ITPA 1Q90A 1FVIA 5EBCA 1TS5A 1HTPA 2DJGC 1EEFD 2I5LX 5CYUA 1F9RA 1XNRL 1JMCA 2R7ZH 3MVVA 2HHHL 5IT9L 1SYGA 5DNFA 3CCMA 2K4KA 1HPCA 1WD0A 4FXDA 4ILWA 1YNXA 1PTOF 2KOLA 2O5IC 4IURA 4BBSH 4DR3L 1RIPA 1F2YA 3GTKB 1STGA 2R3ZA 3RNUA 4GKKQ 1TWAH 4DA2A 1OO9B 5CBEE 2R92H 1Y1WB 1JICA 3KDFA 2FXQA 4Q5VA 3MXGA 1GXDC 1KHIA 4CDDC 3NHHA 1RD9D 1BBUA 2PQEA 4J6HA 1X3PA 2ZXOA 3GTJH 2CVRA 3FEWX 5CBAE 4ZKBB 1CKNA 4TKOB 1AEXA 4K6DA 2NBFA 5IWAQ 1F2LA 3OSOA 4HR7B 1PRTF 1EY7A 3KF6A 5KNCA 1K0SA 4HTHA 5T1GA 3EIVA 2G9HD 1WCMG 4LF8L 4GZYC 3PIPA 4B3RL 3GTOB 5JEAH 4B9WA 5EPJA 1RJTA 5GADC 4OELB 3I2ZA 3KLRA 2E2JB 5M5WH 3L7ZC 3GV3A 2QEXA 1A3TA 2CQAA 3CF5A 4JOIA 2QA4A 3AFQA 2MO1A 4XYQA 3SK4A 2FINB 4DNIA 4A3KH 4NXNQ 3BJUA 2KUMA 1MHWC 3GTPB 2XGTA 3NK9A 3JAME 3CCJA 1W2BA 3PIO3 3ZYYX 1VQKA 5ELCA 4DGZA 2DUDA 3V05A 1TQOA 2EYOA 3KDFB 1K8AC 4DNTB 5IP9H 2EYMA 1GHKA 1T5EA 3UE0A 2D0PA 4G57A 4X65L 5C0XI 2JYOA 1TS2A 1EWHA 2E8GA 1JE4A 2EJMA 3I3CA 1CKNB 3RZDB 1NSNS 1X3EA 3BDLA 5IGBA 2BA0A 2WB1E 4HJ9A 1L0YB 2A69D 1I94L 3FVQA 1WCMB 3KF6B 2NTTA 4GKKL 3W1GA 1PZJD 3CW2C 2K04A 4GN5A 2ZTEA 4CHTB 4X64Q 2JP1A 2HCCA 3MWYW 3AFPA 3PUWA 3BDCA 4TVAB 4RFBA 2QCPX 4IPHA 3G48A 1LTTD 3I4LA 3P75A 1OXTA 5IYCG 4DK0A 4IOCA 3HOZH 1AZQA 3K5NA 5C3WA 1PYSB 1HR0L 5IWAL 2F0VA 1PYBA 1Q8IA 2MHVA 3VA7A 2CH4W 1Y8NB 2KCNA 4BBSG 2L11A
chains in the Genus database with same CATH topology
3CP0A 4LF9Q 4HIKA 2IHFA 1TWFH 3G6EA 3M4PA 4HJ8A 1YJWA 4LFCQ 1FJGQ 1EQQA 2GVBA 4R4IA 4JI2Q 1GKHA 1JE5A 4UY8C 1U0LA 2DGYA 2MNAA 4DV1L 3E0EA 4A3GG 2I0QA 4QGUA 4P75A 2Y0SG 4A75A 3GDEA 4XTCS 1OXSC 3B6YA 1N36L 4O0AA 3S17H 1C0AA 1ASZA 3NEMA 3UE1A 4GNXA 2WB1G 1SLJA 4J15A 4A4IA 1C7YA 4JI4Q 2VQFL 2YV5A 1EIFA 3PO2G 4DR6L 4GKJQ 1CSQA 1KRSA 2OCEA 3CPFA 1E1TA 3A5ZB 2EIFA 1LTLA 4JBKA 5IYBG 5C0XG 4DUZQ 1YIJA 2IX0A 2JA8H 2JA5G 4HJ7A 4JYAL 2V1CC 4HIOA 4OO1I 2PMZE 1WI5A 4DV0Q 4DR1L 2VQEQ 2KCMA 1QVCA 4X62Q 4A3FH 4LF5Q 4IFDG 1X55A 4DR2Q 4B3SQ 1KC8C 5IYBH 1VQDA 5HGQA 3CC2A 2AWNA 4JC0A 3CCRA 2Q2HA 3BZCA 1E22A 1XNQQ 2K5HA 1UE5A 4X66L 3DLLA 1VQOA 1MIUA 1UEBA 1OXXK 2PQAA 1X3FA 5LMNL 1YZ6A 4HIMA 4DV7Q 2A8VA 1I3QH 3PIOA 2KBNA 1U5KA 5AJ3L 1J5EL 3S14H 4GLVB 4A76A 3S1NH 1G6PA 3HOYH 3HKSA 1XMOQ 1K3RA 4AYBG 4WJ4A 4DR5Q 2JEBI 1G51A 2Z6KA 3HOVH 2PI2A 3KJOA 4OWXB 4L5SA 3KOJA 1NTGA 3F2DA 3ULJA 3A0JA 4POFA 1WYDA 2CQOA 4Y52H 3HOWG 5M3MH 4JI5L 1HH2P 4JV5Q 3BU2A 4DK6C 4DV4L 4KHPQ 2H5XA 2YTYA 1IBML 1KD1C 1XNRQ 3RLOA 3HOXG 1NMGA 5M3FG 4X6AH 1YJ9A 1X54A 1Q86C 2HHHQ 4JOIC 4A3LG 1H95A 1KXLA 2KHIA 4PZ8A 3OTOQ 1IBKQ 2E5LQ 1OTCA 2UU9Q 4B3MQ 2LSSA 1BBWA 4R4CA 3JAMc 2UXCL 3HOWH 2NZOA 4L5QA 3CCVA 2ES2A 3KYHC 5GQOA 5IP9G 4GKJL 2R93G 1VQFA 3GTLH 5ELNA 4DR3Q 2Q2TA 3NELA 4A3LH 3KFUA 1EFWA 4GNXB 4A3CH 1BVSA 2K50A 1NJIC 4JI8Q 5IYDG 1SMXA 1YHBA 3EBEA 2AHOB 1PH3A 4NXMQ 2R93H 2CWAA 4OXPA 5IY0A 5GAGC 4A3MG 4R1JA 3M3YH 2UUCL 1Y14B 4DK3C 4B3TL 3CMEA 4BBRG 4LF9L 2UUAQ 4LF6Q 3TREA 3FHWA 2N3SA 1FJGL 3GTGH 4DV5L 3HKZE 4JBJA 3F1ZA 4H02A 3DM3A 4YCVA 2VW9A 1VQ4A 3U4VA 4A3MH 1AE2A 4DV2Q 4OX9Q 4JBWA 1OXVA 2BA1A 3STBD 1JJ2A 4IFDI 4YY3Q 3TS0A 1EUJA 5LMUQ 2MFIA 2YYZA 1YBYA 3KF8B 4DV6Q 2NVQH 2HQLA 2PQAB 3RR5A 4A3BG 3M7NA 4P73A 2JJQA 5C0XJ 4GS3A 3Q8DA 3H0GG 4DV3Q 2JA7G 4DUYL 1SR3A 4AIMA 4UP8A 3F8TA 4OWTB 1VQ8A 4PZ6A 1QUQA 4IJHA 1DGSA 1CUKA 1VQGA 3F2CA 4LF8Q 1JJGA 3K0XA 3UDXA 1HZAA 5DLQE 4B3RQ 1Q1EA 1HZBA 4P72A 4JI1Q 4L5RC 2YTXA 2D0OA 2OQ0A 3H0GH 3RLNA 3RLFA 2JA7H 1J6QA 2OTJA 3UDIA 4LF4Q 1Q8KA 3D0FA 3T1HQ 5JEAJ 4RG1A 3I55A 1S40A 2A1AA 4PZ7A 4UPAA 2WAQG 1XPRA 4JI6Q 1PH4A 2OTLA 3ERSX 2E2HH 2QGQA 4KI0A 1HZCA 2ZJQA 2LXJA 1KQSA 4K0KL 2F3IA 2NVYH 5K36G 5FJ8G 3S24A 1HNZL 4MTNA 1FGUA 1YVCA 3UDGA 5JJLA 1VQEA 4BA2I 4PG3A 1HR0W 1L1OA 3K80C 3J7A5 1I6HH 3EN2A 2CFMA 1Q82C 3NBHB 3NENA 2F4VL 1IBLQ 1VQ5A 2F52A 2NVTH 5FJ8H 4FDBA 1HNWQ 1E1OA 2WFWA 1B70B 5IP7H 2IHEA 3FKIG 3T1YQ 1P8LA 4GNXC 3PSIA 2JA8G 1XJVA 3AYHB 4JI0L 1XMQQ 4A3IG 1EIYB 2IX1A 4X65Q 4KHZA 3PGZA 1B8AA 1M1KC 3OTOL 3CCQA 1VQJA 2VL6A 4A3FG 1PH1A 4LF7Q 2IY5B 4NXNL 3FKIH 4DKAC 2ZM6Q 4L5TA 4DPGA 3OYYA 1P16A 5FLMG 4IOAA 2HIXA 2Q2UA 4LNQA 4A3IH 1XTDA 5GAHC 1MJEA 3GTOH 1N34Q 3GO5A 3J81c 1HNXQ 4B3SL 1UE7A 3ULLA 4IPDA 5M5XH 2ID0A 3E9IA 2AMCB 1I94Q 3I4NG 1K83H 4GOPA 3SGIA 3U58A 4P74A 1SROA 3D31A 4YCUA 4C3HH 1UE1A 2N49A 4HIDA 5FLMH 2JQOA 4APVA 2NVXH 1QUQB 3HOYG 3HOUG 4QIWE 3PO2H 1N32L 2R7FA 2YTVA 3HOVG 1X3GA 1WOCA 5ELOA 1X6OA 3M4OH 3I4NH 1W2BA 3K81C 4QL5A 1RL2A 5M3MG 1K73C 3OW2A 3L2PA 1TWGH 2JA9A 3HOUH 4IFDJ 5H1SE 2MO0A 2CWPA 4LWCA 1K8GA 1Z9FA 1KRTA 3UDFA 4DR7L 1KL9A 2Z6KC 4BY7G 4YY3L 1EWIA 5C3EG 1EYGA 3PV0A 4O2DA 1HR0Q 4OWWB 5LMNW 2E2IH 1S72A 2B63G 4JCVE 1IL2A 1A62A 2NN6I 1UE6A 5BR8Q 4A93G 2UXDQ 1NY4A 2KCTA 1PH2A 4JI7L 4QQBX 4EX5A 4C3JH 2RF4A 4BY7H 4ME3A 1SFOH 4GN4B 5C3EH 1L1OB 2ALYB 4X64L 2UUBQ 4BY1H 4LFBQ 1LYLA 4QJFA 2VS1A 2B63H 3I56A 4UP7A 4AQYL 4DV1Q 2ASBA 1IYJB 4A93H 1VQCA 3RN2A 3FP9A 4R4TA 1N8RC 3CD6A 3TQYA 3S15H 4GN3B 2Z0SA 1TWCH 3W5OA 1N36Q 2EXDA 4LFAL 1XPOA 3CCEA 4LUOA 2ZJRA 4JI6L 3S16H 4PMWA 1L2FA 1K9MC 3S2DH 4C3IH 1VQ7A 3GTMH 2VQFQ 1N33L 4DR6Q 2WP8J 3BZKA 3M85A 1VQ6A 5J3BA 1MKHA 1AH9A 1CKOA 1YI2A 4LFCL 1A63A 3U4ZA 1KIXA 4P71A 4WJ3M 2CCZA 4DAMA 4JI2L 3STBC 4JYAQ 2HT1A 1W3SA 4GOPB 1I5FA 2I5HA 1YITA 5IT9c 4DR1Q 1BKBA 5C44G 1VQAA 4NPSA 4BA1I 1QVFA 3ULPA 4A3DG 2PNHA 1VQHA 3GD7A 4JI3Q 3I7FA 5LMNQ 4JI4L 5C4JH 2Y0SE 1A0IA 1T9HA 1VS0A 2GVAA 1AE3A 1TWHH 2VY3A 5C44H 5AJ3Q 2JK8A 1VQNA 4LF7L 3JAMi 1YHAA 2R7DA 1E3PA 3E9HA 1C9OA 3WWVA 4DUZL 1PH5A 2A19A 4POGA 2ATWA 4A3DH 3S2HH 1A8VA 1Q7YC 1Y1WG 2VZAA 4DR4L 1PA6A 4DV0L 4GLAC 3MXNB 1QZGA 4IO9A 2RHQB 4R4QA 3ZJYC 4X62L 2VQEL 1VQLA 4LF5L 5JJKA 4QY7A 4DR2L 1Y1VG 4JI5Q 3GTKH 1YJNA 1NE3A 3J80c 4DV4Q 2VNUD 3H3VH 1UWVA 1SE8A 1Y1WH 2GN5A 5HY6A 1B7YB 1V1QA 2K75A 1VCIA 1WFQA 2NN6G 2RHSB 2L15A 2MQHA 3M9BA 4MZ9A 5FLXc 1QVGA 1GM5A 1IXRA 4DV7L 3S1QH 4EQ5A 2UXCQ 3S1MH 1Y1VH 5IP7G 3G71A 1L1OC 3PUVA 1IBMQ 2CKZB 1XMOL 1L0WA 1PHJA 4A3CG 1Q1BA 4R4OA 4DR5L 2R7ZG 1PH6A 4BXXH 4HJ5A 2K5VA 2JA6G 3ICEA 1D8LA 1VQIA 3HKZG 4A3EH 1FVIA 5C4XH 1VQBA 4JV5L 3L0OA 1PH9A 1NBWA 4KHPL 3PO3H 1GD7A 2I5LX 1G291 2ZTDA 2UUCQ 1FL0A 1XNRL 1JMCA 2R7ZH 3PUYA 4AYBE 4B3TQ 1D7QA 2HHHL 2JA6H 1HJPA 1E24A 3PCOB 2E5LL 1IBKL 2UUBL 2UU9L 4B3ML 3CCMA 4LFBL 2K4KA 3HFZB 4DV5Q 1IZ6A 4YHHQ 3RZOH 1YNXA 2UXBQ 2R92G 3I4MG 2R6GA 3TRZA 4BBSH 2PI2E 4DR3L 2EQSA 4HJAA 3A74A 2K5NA 3KJPA 1RIPA 2AKWB 3LGJA 4GOPC 4Y7NH 2E2JH 4JG2A 1CKMA 4JI8L 3RNUA 4GKKQ 3JC66 1TWAH 5GROA 3PF4A 2R92H 3J80i 3I4MH 4NXML 4A3GH 3KDFA 1GVPA 3J81j 3CC4A 1VQ9A 4DUYQ 2UXDL 2FXQA 4YWLA 4DR4Q 3CXCA 1KHIA 3F2BA 2K52A 2UUAL 1BBUA 4LF6L 1YEZA 1KAWA 2OQKA 1XPUA 3GTJH 3H3VI 2AWOA 3CAMA 1JT8A 4UP9A 2B3GA 3GTPH 2NZHA 4OX9L 3W1BA 4DV2L 2I5MX 2K14A 1CKNA 3PF5A 5LMUL 3RN5A 4BY1G 3CCSA 1R9TH 2Q2IA 5IWAQ 4DV6L 3G4SA 1PFSA 2JA5H 4IPCA 1M90C 1GO3E 1JJCB 3KF6A 4JI3L 5JEAG 1EQRA 4IPGA 4DV3L 1SRUA 4K0KQ 1PH8A 2IT1A 3K7AH 3VDYA 1V43A 1HNZQ 3EIVA 1YHQA 1WCMG 4LF8L 3U50C 3PIPA 4B3RL 2ZJPA 3RZDH 3PUZA 4JI1L 3I4OA 3CC7A 4IJLA 2F4VQ 1TXYA 3J81i 4ALPA 4LF4L 3T1HL 2VUMG 5GADC 3I2ZA 5M5WH 3L7ZC 4A3KG 1OXUA 1WCMH 1X9NA 2QEXA 1CSPA 5GAEC 4JI0Q 2YU9H 1SN8A 1V9PA 3M4QA 4JOIA 2D62A 3AFQA 1EOVA 4MNOA 3CF5A 2QA4A 2MO1A 2BH2A 4YWKA 2VUMH 1Q46A 1PVOA 4DNIA 4A3KH 3PUXA 4NXNQ 1N9WA 1O7IA 2LXKA 3BJUA 4TQUS 2WAQE 2XGTA 3CCJA 3HOXH 5M3FH 3J7ZC 4LW1A 4NB3A 3CQZH 2RCNA 4RMFA 5EAYA 3CMAA 1JB7A 1X65A 2KHJA 2KENA 1LM0A 1VQKA 1IBLL 3CCLA 2DUDA 3KDFB 3K7UC 4A3JG 1HNWL 1NMFA 1K8AC 3K8AA 4GLXA 5IP9H 3T1YL 3TS2A 1N32Q 4X66Q 4YCWA 1VQPA 1X56A 1XMQL 3UE0A 3IRBA 2D0PA 3ER0A 1WJJA 4X65L 3AEVA 4A3JH 5C0XI 5IYDH 2E8GA 1J5EQ 1K0RA 1S3OA 2UXBL 4YHHL 2ZM6L 1CKNB 2JE6I 3CCUA 1PV4A 1X3EA 3GTQH 4DR7Q 2BA0A 2WB1E 1N34L 1HNXL 4OO1G 4BBRH 4HJ9A 4LUZA 2BH8A 1I94L 1I50H 3KF6B 5JJIA 4GKKL 3W1GA 3CW2C 3H15A 4YWMA 1E7ZA 1MJCA 1PH7A 4GN5A 4JI7Q 3HOZG 2ZTCA 2N78A 2ZTEA 1QZHA 4BXXG 4AH6A 4X64Q 1Q12A 4JBMA 2OWOA 2XTIA 3AFPA 4A3EG 3PUWA 3KLWA 4A3BH 1XNQL 4TVAB 5C4XG 4IPHA 3A5UA 3G48A 4AQYQ 2JEAI 3CPWA 1Z47A 1OXTA 5M5YH 5IYCG 4IOCA 1VQMA 3PO3G 3HOZH 3S1RH 2C35B 1Q81C 4LFAQ 5E7NA 3AQQA 4KLKA 4OONA 4DAYB 1PYSB 1HR0L 1ASYA 5IWAL 2B29A 1PYBA 1HZ9A 2N8NA 4LUVA 3MEFA 4C2MH 5IE8A 5IYCH 3TEHB 5BR8L 4XIGS 1N33Q 4BBSG 1LUZA 2HIVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CP0 A;  4LF9 Q;  4HIK A;  2IHF A;  1TWF H;  3G6E A;  3M4P A;  4HJ8 A;  1YJW A;  4LFC Q;  1FJG Q;  1EQQ A;  2GVB A;  4R4I A;  4JI2 Q;  1GKH A;  1JE5 A;  4UY8 C;  1U0L A;  2DGY A;  2MNA A;  4DV1 L;  3E0E A;  4A3G G;  2I0Q A;  4QGU A;  4P75 A;  2Y0S G;  4A75 A;  3GDE A;  4XTC S;  1OXS C;  3B6Y A;  1N36 L;  4O0A A;  3S17 H;  1C0A A;  1ASZ A;  3NEM A;  3UE1 A;  4GNX A;  2WB1 G;  1SLJ A;  4J15 A;  4A4I A;  1C7Y A;  4JI4 Q;  2VQF L;  2YV5 A;  1EIF A;  3PO2 G;  4DR6 L;  4GKJ Q;  1CSQ A;  1KRS A;  2OCE A;  3CPF A;  1E1T A;  3A5Z B;  2EIF A;  1LTL A;  4JBK A;  5IYB G;  5C0X G;  4DUZ Q;  1YIJ A;  2IX0 A;  2JA8 H;  2JA5 G;  4HJ7 A;  4JYA L;  2V1C C;  4HIO A;  4OO1 I;  2PMZ E;  1WI5 A;  4DV0 Q;  4DR1 L;  2VQE Q;  2KCM A;  1QVC A;  4X62 Q;  4A3F H;  4LF5 Q;  4IFD G;  1X55 A;  4DR2 Q;  4B3S Q;  1KC8 C;  5IYB H;  1VQD A;  5HGQ A;  3CC2 A;  2AWN A;  4JC0 A;  3CCR A;  2Q2H A;  3BZC A;  1E22 A;  1XNQ Q;  2K5H A;  1UE5 A;  4X66 L;  3DLL A;  1VQO A;  1MIU A;  1UEB A;  1OXX K;  2PQA A;  1X3F A;  5LMN L;  1YZ6 A;  4HIM A;  4DV7 Q;  2A8V A;  1I3Q H;  3PIO A;  2KBN A;  1U5K A;  5AJ3 L;  1J5E L;  3S14 H;  4GLV B;  4A76 A;  3S1N H;  1G6P A;  3HOY H;  3HKS A;  1XMO Q;  1K3R A;  4AYB G;  4WJ4 A;  4DR5 Q;  2JEB I;  1G51 A;  2Z6K A;  3HOV H;  2PI2 A;  3KJO A;  4OWX B;  4L5S A;  3KOJ A;  1NTG A;  3F2D A;  3ULJ A;  3A0J A;  4POF A;  1WYD A;  2CQO A;  4Y52 H;  3HOW G;  5M3M H;  4JI5 L;  1HH2 P;  4JV5 Q;  3BU2 A;  4DK6 C;  4DV4 L;  4KHP Q;  2H5X A;  2YTY A;  1IBM L;  1KD1 C;  1XNR Q;  3RLO A;  3HOX G;  1NMG A;  5M3F G;  4X6A H;  1YJ9 A;  1X54 A;  1Q86 C;  2HHH Q;  4JOI C;  4A3L G;  1H95 A;  1KXL A;  2KHI A;  4PZ8 A;  3OTO Q;  1IBK Q;  2E5L Q;  1OTC A;  2UU9 Q;  4B3M Q;  2LSS A;  1BBW A;  4R4C A;  3JAM c;  2UXC L;  3HOW H;  2NZO A;  4L5Q A;  3CCV A;  2ES2 A;  3KYH C;  5GQO A;  5IP9 G;  4GKJ L;  2R93 G;  1VQF A;  3GTL H;  5ELN A;  4DR3 Q;  2Q2T A;  3NEL A;  4A3L H;  3KFU A;  1EFW A;  4GNX B;  4A3C H;  1BVS A;  2K50 A;  1NJI C;  4JI8 Q;  5IYD G;  1SMX A;  1YHB A;  3EBE A;  2AHO B;  1PH3 A;  4NXM Q;  2R93 H;  2CWA A;  4OXP A;  5IY0 A;  5GAG C;  4A3M G;  4R1J A;  3M3Y H;  2UUC L;  1Y14 B;  4DK3 C;  4B3T L;  3CME A;  4BBR G;  4LF9 L;  2UUA Q;  4LF6 Q;  3TRE A;  3FHW A;  2N3S A;  1FJG L;  3GTG H;  4DV5 L;  3HKZ E;  4JBJ A;  3F1Z A;  4H02 A;  3DM3 A;  4YCV A;  2VW9 A;  1VQ4 A;  3U4V A;  4A3M H;  1AE2 A;  4DV2 Q;  4OX9 Q;  4JBW A;  1OXV A;  2BA1 A;  3STB D;  1JJ2 A;  4IFD I;  4YY3 Q;  3TS0 A;  1EUJ A;  5LMU Q;  2MFI A;  2YYZ A;  1YBY A;  3KF8 B;  4DV6 Q;  2NVQ H;  2HQL A;  2PQA B;  3RR5 A;  4A3B G;  3M7N A;  4P73 A;  2JJQ A;  5C0X J;  4GS3 A;  3Q8D A;  3H0G G;  4DV3 Q;  2JA7 G;  4DUY L;  1SR3 A;  4AIM A;  4UP8 A;  3F8T A;  4OWT B;  1VQ8 A;  4PZ6 A;  1QUQ A;  4IJH A;  1DGS A;  1CUK A;  1VQG A;  3F2C A;  4LF8 Q;  1JJG A;  3K0X A;  3UDX A;  1HZA A;  5DLQ E;  4B3R Q;  1Q1E A;  1HZB A;  4P72 A;  4JI1 Q;  4L5R C;  2YTX A;  2D0O A;  2OQ0 A;  3H0G H;  3RLN A;  3RLF A;  2JA7 H;  1J6Q A;  2OTJ A;  3UDI A;  4LF4 Q;  1Q8K A;  3D0F A;  3T1H Q;  5JEA J;  4RG1 A;  3I55 A;  1S40 A;  2A1A A;  4PZ7 A;  4UPA A;  2WAQ G;  1XPR A;  4JI6 Q;  1PH4 A;  2OTL A;  3ERS X;  2E2H H;  2QGQ A;  4KI0 A;  1HZC A;  2ZJQ A;  2LXJ A;  1KQS A;  4K0K L;  2F3I A;  2NVY H;  5K36 G;  5FJ8 G;  3S24 A;  1HNZ L;  4MTN A;  1FGU A;  1YVC A;  3UDG A;  5JJL A;  1VQE A;  4BA2 I;  4PG3 A;  1HR0 W;  1L1O A;  3K80 C;  3J7A 5;  1I6H H;  3EN2 A;  2CFM A;  1Q82 C;  3NBH B;  3NEN A;  2F4V L;  1IBL Q;  1VQ5 A;  2F52 A;  2NVT H;  5FJ8 H;  4FDB A;  1HNW Q;  1E1O A;  2WFW A;  1B70 B;  5IP7 H;  2IHE A;  3FKI G;  3T1Y Q;  1P8L A;  4GNX C;  3PSI A;  2JA8 G;  1XJV A;  3AYH B;  4JI0 L;  1XMQ Q;  4A3I G;  1EIY B;  2IX1 A;  4X65 Q;  4KHZ A;  3PGZ A;  1B8A A;  1M1K C;  3OTO L;  3CCQ A;  1VQJ A;  2VL6 A;  4A3F G;  1PH1 A;  4LF7 Q;  2IY5 B;  4NXN L;  3FKI H;  4DKA C;  2ZM6 Q;  4L5T A;  4DPG A;  3OYY A;  1P16 A;  5FLM G;  4IOA A;  2HIX A;  2Q2U A;  4LNQ A;  4A3I H;  1XTD A;  5GAH C;  1MJE A;  3GTO H;  1N34 Q;  3GO5 A;  3J81 c;  1HNX Q;  4B3S L;  1UE7 A;  3ULL A;  4IPD A;  5M5X H;  2ID0 A;  3E9I A;  2AMC B;  1I94 Q;  3I4N G;  1K83 H;  4GOP A;  3SGI A;  3U58 A;  4P74 A;  1SRO A;  3D31 A;  4YCU A;  4C3H H;  1UE1 A;  2N49 A;  4HID A;  5FLM H;  2JQO A;  4APV A;  2NVX H;  1QUQ B;  3HOY G;  3HOU G;  4QIW E;  3PO2 H;  1N32 L;  2R7F A;  2YTV A;  3HOV G;  1X3G A;  1WOC A;  5ELO A;  1X6O A;  3M4O H;  3I4N H;  1W2B A;  3K81 C;  4QL5 A;  1RL2 A;  5M3M G;  1K73 C;  3OW2 A;  3L2P A;  1TWG H;  2JA9 A;  3HOU H;  4IFD J;  5H1S E;  2MO0 A;  2CWP A;  4LWC A;  1K8G A;  1Z9F A;  1KRT A;  3UDF A;  4DR7 L;  1KL9 A;  2Z6K C;  4BY7 G;  4YY3 L;  1EWI A;  5C3E G;  1EYG A;  3PV0 A;  4O2D A;  1HR0 Q;  4OWW B;  5LMN W;  2E2I H;  1S72 A;  2B63 G;  4JCV E;  1IL2 A;  1A62 A;  2NN6 I;  1UE6 A;  5BR8 Q;  4A93 G;  2UXD Q;  1NY4 A;  2KCT A;  1PH2 A;  4JI7 L;  4QQB X;  4EX5 A;  4C3J H;  2RF4 A;  4BY7 H;  4ME3 A;  1SFO H;  4GN4 B;  5C3E H;  1L1O B;  2ALY B;  4X64 L;  2UUB Q;  4BY1 H;  4LFB Q;  1LYL A;  4QJF A;  2VS1 A;  2B63 H;  3I56 A;  4UP7 A;  4AQY L;  4DV1 Q;  2ASB A;  1IYJ B;  4A93 H;  1VQC A;  3RN2 A;  3FP9 A;  4R4T A;  1N8R C;  3CD6 A;  3TQY A;  3S15 H;  4GN3 B;  2Z0S A;  1TWC H;  3W5O A;  1N36 Q;  2EXD A;  4LFA L;  1XPO A;  3CCE A;  4LUO A;  2ZJR A;  4JI6 L;  3S16 H;  4PMW A;  1L2F A;  1K9M C;  3S2D H;  4C3I H;  1VQ7 A;  3GTM H;  2VQF Q;  1N33 L;  4DR6 Q;  2WP8 J;  3BZK A;  3M85 A;  1VQ6 A;  5J3B A;  1MKH A;  1AH9 A;  1CKO A;  1YI2 A;  4LFC L;  1A63 A;  3U4Z A;  1KIX A;  4P71 A;  4WJ3 M;  2CCZ A;  4DAM A;  4JI2 L;  3STB C;  4JYA Q;  2HT1 A;  1W3S A;  4GOP B;  1I5F A;  2I5H A;  1YIT A;  5IT9 c;  4DR1 Q;  1BKB A;  5C44 G;  1VQA A;  4NPS A;  4BA1 I;  1QVF A;  3ULP A;  4A3D G;  2PNH A;  1VQH A;  3GD7 A;  4JI3 Q;  3I7F A;  5LMN Q;  4JI4 L;  5C4J H;  2Y0S E;  1A0I A;  1T9H A;  1VS0 A;  2GVA A;  1AE3 A;  1TWH H;  2VY3 A;  5C44 H;  5AJ3 Q;  2JK8 A;  1VQN A;  4LF7 L;  3JAM i;  1YHA A;  2R7D A;  1E3P A;  3E9H A;  1C9O A;  3WWV A;  4DUZ L;  1PH5 A;  2A19 A;  4POG A;  2ATW A;  4A3D H;  3S2H H;  1A8V A;  1Q7Y C;  1Y1W G;  2VZA A;  4DR4 L;  1PA6 A;  4DV0 L;  4GLA C;  3MXN B;  1QZG A;  4IO9 A;  2RHQ B;  4R4Q A;  3ZJY C;  4X62 L;  2VQE L;  1VQL A;  4LF5 L;  5JJK A;  4QY7 A;  4DR2 L;  1Y1V G;  4JI5 Q;  3GTK H;  1YJN A;  1NE3 A;  3J80 c;  4DV4 Q;  2VNU D;  3H3V H;  1UWV A;  1SE8 A;  1Y1W H;  2GN5 A;  5HY6 A;  1B7Y B;  1V1Q A;  2K75 A;  1VCI A;  1WFQ A;  2NN6 G;  2RHS B;  2L15 A;  2MQH A;  3M9B A;  4MZ9 A;  5FLX c;  1QVG A;  1GM5 A;  1IXR A;  4DV7 L;  3S1Q H;  4EQ5 A;  2UXC Q;  3S1M H;  1Y1V H;  5IP7 G;  3G71 A;  1L1O C;  3PUV A;  1IBM Q;  2CKZ B;  1XMO L;  1L0W A;  1PHJ A;  4A3C G;  1Q1B A;  4R4O A;  4DR5 L;  2R7Z G;  1PH6 A;  4BXX H;  4HJ5 A;  2K5V A;  2JA6 G;  3ICE A;  1D8L A;  1VQI A;  3HKZ G;  4A3E H;  1FVI A;  5C4X H;  1VQB A;  4JV5 L;  3L0O A;  1PH9 A;  1NBW A;  4KHP L;  3PO3 H;  1GD7 A;  2I5L X;  1G29 1;  2ZTD A;  2UUC Q;  1FL0 A;  1XNR L;  1JMC A;  2R7Z H;  3PUY A;  4AYB E;  4B3T Q;  1D7Q A;  2HHH L;  2JA6 H;  1HJP A;  1E24 A;  3PCO B;  2E5L L;  1IBK L;  2UUB L;  2UU9 L;  4B3M L;  3CCM A;  4LFB L;  2K4K A;  3HFZ B;  4DV5 Q;  1IZ6 A;  4YHH Q;  3RZO H;  1YNX A;  2UXB Q;  2R92 G;  3I4M G;  2R6G A;  3TRZ A;  4BBS H;  2PI2 E;  4DR3 L;  2EQS A;  4HJA A;  3A74 A;  2K5N A;  3KJP A;  1RIP A;  2AKW B;  3LGJ A;  4GOP C;  4Y7N H;  2E2J H;  4JG2 A;  1CKM A;  4JI8 L;  3RNU A;  4GKK Q;  3JC6 6;  1TWA H;  5GRO A;  3PF4 A;  2R92 H;  3J80 i;  3I4M H;  4NXM L;  4A3G H;  3KDF A;  1GVP A;  3J81 j;  3CC4 A;  1VQ9 A;  4DUY Q;  2UXD L;  2FXQ A;  4YWL A;  4DR4 Q;  3CXC A;  1KHI A;  3F2B A;  2K52 A;  2UUA L;  1BBU A;  4LF6 L;  1YEZ A;  1KAW A;  2OQK A;  1XPU A;  3GTJ H;  3H3V I;  2AWO A;  3CAM A;  1JT8 A;  4UP9 A;  2B3G A;  3GTP H;  2NZH A;  4OX9 L;  3W1B A;  4DV2 L;  2I5M X;  2K14 A;  1CKN A;  3PF5 A;  5LMU L;  3RN5 A;  4BY1 G;  3CCS A;  1R9T H;  2Q2I A;  5IWA Q;  4DV6 L;  3G4S A;  1PFS A;  2JA5 H;  4IPC A;  1M90 C;  1GO3 E;  1JJC B;  3KF6 A;  4JI3 L;  5JEA G;  1EQR A;  4IPG A;  4DV3 L;  1SRU A;  4K0K Q;  1PH8 A;  2IT1 A;  3K7A H;  3VDY A;  1V43 A;  1HNZ Q;  3EIV A;  1YHQ A;  1WCM G;  4LF8 L;  3U50 C;  3PIP A;  4B3R L;  2ZJP A;  3RZD H;  3PUZ A;  4JI1 L;  3I4O A;  3CC7 A;  4IJL A;  2F4V Q;  1TXY A;  3J81 i;  4ALP A;  4LF4 L;  3T1H L;  2VUM G;  5GAD C;  3I2Z A;  5M5W H;  3L7Z C;  4A3K G;  1OXU A;  1WCM H;  1X9N A;  2QEX A;  1CSP A;  5GAE C;  4JI0 Q;  2YU9 H;  1SN8 A;  1V9P A;  3M4Q A;  4JOI A;  2D62 A;  3AFQ A;  1EOV A;  4MNO A;  3CF5 A;  2QA4 A;  2MO1 A;  2BH2 A;  4YWK A;  2VUM H;  1Q46 A;  1PVO A;  4DNI A;  4A3K H;  3PUX A;  4NXN Q;  1N9W A;  1O7I A;  2LXK A;  3BJU A;  4TQU S;  2WAQ E;  2XGT A;  3CCJ A;  3HOX H;  5M3F H;  3J7Z C;  4LW1 A;  4NB3 A;  3CQZ H;  2RCN A;  4RMF A;  5EAY A;  3CMA A;  1JB7 A;  1X65 A;  2KHJ A;  2KEN A;  1LM0 A;  1VQK A;  1IBL L;  3CCL A;  2DUD A;  3KDF B;  3K7U C;  4A3J G;  1HNW L;  1NMF A;  1K8A C;  3K8A A;  4GLX A;  5IP9 H;  3T1Y L;  3TS2 A;  1N32 Q;  4X66 Q;  4YCW A;  1VQP A;  1X56 A;  1XMQ L;  3UE0 A;  3IRB A;  2D0P A;  3ER0 A;  1WJJ A;  4X65 L;  3AEV A;  4A3J H;  5C0X I;  5IYD H;  2E8G A;  1J5E Q;  1K0R A;  1S3O A;  2UXB L;  4YHH L;  2ZM6 L;  1CKN B;  2JE6 I;  3CCU A;  1PV4 A;  1X3E A;  3GTQ H;  4DR7 Q;  2BA0 A;  2WB1 E;  1N34 L;  1HNX L;  4OO1 G;  4BBR H;  4HJ9 A;  4LUZ A;  2BH8 A;  1I94 L;  1I50 H;  3KF6 B;  5JJI A;  4GKK L;  3W1G A;  3CW2 C;  3H15 A;  4YWM A;  1E7Z A;  1MJC A;  1PH7 A;  4GN5 A;  4JI7 Q;  3HOZ G;  2ZTC A;  2N78 A;  2ZTE A;  1QZH A;  4BXX G;  4AH6 A;  4X64 Q;  1Q12 A;  4JBM A;  2OWO A;  2XTI A;  3AFP A;  4A3E G;  3PUW A;  3KLW A;  4A3B H;  1XNQ L;  4TVA B;  5C4X G;  4IPH A;  3A5U A;  3G48 A;  4AQY Q;  2JEA I;  3CPW A;  1Z47 A;  1OXT A;  5M5Y H;  5IYC G;  4IOC A;  1VQM A;  3PO3 G;  3HOZ H;  3S1R H;  2C35 B;  1Q81 C;  4LFA Q;  5E7N A;  3AQQ A;  4KLK A;  4OON A;  4DAY B;  1PYS B;  1HR0 L;  1ASY A;  5IWA L;  2B29 A;  1PYB A;  1HZ9 A;  2N8N A;  4LUV A;  3MEF A;  4C2M H;  5IE8 A;  5IYC H;  3TEH B;  5BR8 L;  4XIG S;  1N33 Q;  4BBS G;  1LUZ A;  2HIV A; 
#chains in the Genus database with same CATH topology
 2FFK B;  4HIK A;  2IHF A;  3G6E A;  1YJW A;  3K0Y A;  1NUC A;  1U0L A;  1DOL A;  2I0Q A;  1DZ1 A;  1XX8 A;  3B6Y A;  3S17 H;  4O0A A;  3H91 A;  1I50 B;  4JPB W;  1ASZ A;  3FPP A;  1S5F D;  5A35 A;  3UE1 A;  2M2L A;  1SLJ A;  2PNR C;  2AUK A;  3R3O A;  1EIF A;  5L37 A;  3A54 A;  1SYB A;  1A15 A;  3A5Z B;  5IYB G;  4QF4 A;  1HA6 A;  5M5Y B;  4JYA L;  4OO1 I;  2QKI C;  1WI5 A;  4DV0 Q;  3EQL C;  4IFD G;  4X3U A;  1X55 A;  1Z6H A;  4ZAI A;  2X6L A;  2N88 A;  4CJ0 B;  3CD6 A;  1UEB A;  1OXX K;  3TBI B;  1EZ6 A;  4DV7 Q;  3R8B A;  3PIO A;  5AJ3 L;  1TY2 A;  2F0G A;  1MSG A;  1DCZ A;  4Z9C B;  4BBS B;  2PZT A;  2JEB I;  1G51 A;  1ILQ A;  3DWA A;  2PI2 A;  4K6L A;  1HA5 A;  1NTG A;  3F2D A;  3ULJ A;  3QIA A;  1CA5 A;  3HOW G;  1TWA B;  1HH2 P;  4KHP Q;  1KD1 C;  1EEI D;  1KXL A;  3DUZ A;  4JOI C;  4PQX A;  1F2Z A;  2FMC A;  4K14 A;  2LSS A;  1BCP D;  4G4K A;  1D5X C;  1BQQ T;  4L5Q A;  3CCV A;  3VR6 A;  1F9P A;  5IP9 G;  2R93 G;  1LT5 D;  5ELN A;  1I4H A;  2Q2T A;  3KFU A;  4A3C H;  1BVS A;  2JXM B;  1B44 D;  4JI8 Q;  1AW7 A;  4IUP A;  3NBH A;  1SBB B;  1GUN A;  3S9W A;  4NXM Q;  4OXP A;  5IY0 A;  1Y14 B;  4PNY A;  1B3Q A;  4LF6 Q;  3DXJ C;  2HQE A;  3BYT B;  5I9P A;  3HGB A;  3DM3 A;  3I91 A;  4DV2 Q;  3HEJ A;  1K8M A;  2MFI A;  4M8A A;  5LMU Q;  1YBY A;  3NWS A;  5DEH A;  3RR5 A;  1UEA B;  1CZW A;  2EYJ A;  3Q8D A;  1STN A;  4DV3 Q;  1SR3 A;  4I7Z C;  1ESR A;  5ELE A;  4UP8 A;  4AIM A;  4OL7 A;  1SNP A;  4OWT B;  1QUQ A;  3HOW B;  1VQG A;  2NB0 A;  1D1K A;  4UHV A;  1Q1E A;  3M4Y A;  1EFI D;  3GTL B;  2EYH A;  2YTX A;  3H0G H;  4R9W A;  3RLN A;  2OTJ A;  3T1H Q;  3D0F A;  5CC4 A;  3EVQ A;  1S40 A;  1JB3 A;  2A1A A;  1Y8P B;  1YNJ D;  3CU7 A;  1PH4 A;  2R93 B;  3FMC A;  3ERS X;  2E2H H;  2QGQ A;  4TSS A;  3M3Y B;  1TKW B;  2F3I A;  2NVY H;  5IIF A;  1HNZ L;  2RA4 A;  4MTN A;  2F3V A;  3UDG A;  5JJL A;  1ZXT A;  4BA2 I;  1L1O A;  4FP5 D;  5EPK A;  1MD2 D;  1G2S A;  3NBH B;  3OPO A;  5D65 A;  1WTO A;  2F52 A;  5FJ8 H;  2DY7 A;  2K01 A;  2NVQ B;  3QG1 A;  2OXP A;  1P8L A;  3PSI A;  4JI0 L;  4FF3 A;  4FNF A;  3J80 L;  2A6E D;  3ND8 A;  1B8A A;  3CCQ A;  1PH1 A;  2IY5 B;  3FKI H;  4L8J A;  4L5T A;  4DPG A;  2SNM A;  1F9Q A;  2HIX A;  2L55 A;  3PMF A;  1N34 Q;  1HNX Q;  3DWP A;  2A73 B;  3E9I A;  4BS9 A;  1K83 H;  1VF7 A;  1UE1 A;  4HID A;  2G5D A;  1ZEQ X;  4APV A;  2NVX H;  1QUQ B;  3N52 A;  3PO2 H;  1HQR D;  5A2Q L;  4WRD A;  1TU2 B;  5D14 A;  1K73 C;  5COR A;  5H1S E;  2MO0 A;  4ME5 A;  1STA A;  3UDF A;  3O13 A;  4KKT A;  2NVT B;  4FXG C;  4K8I A;  1EYG A;  4O2D A;  4OWW B;  3VR2 A;  4L6T B;  1S72 A;  5I6Y A;  3MXN A;  1PFN A;  1IL2 A;  4NMZ A;  1PH2 A;  1BR9 A;  2RF4 A;  3IAY A;  3T56 B;  1L1O B;  1M4V A;  4KN7 C;  2VS1 A;  2B63 H;  1DON A;  1IYJ B;  5FO7 B;  3QJY A;  3KUP A;  1SMY C;  3TQY A;  1Y69 U;  4GN3 B;  1N36 Q;  4LFA L;  2EXD A;  4LUO A;  1SMY D;  4ULL A;  3ND9 A;  4F7X A;  1K9M C;  4C3I H;  3GTM H;  2VQF Q;  4DR6 Q;  5J3B A;  3I70 A;  4XDX A;  5C6A A;  5D3I B;  2E76 C;  4LFC L;  1A63 A;  1IKL A;  2HT1 A;  3K57 A;  2HD3 A;  1I5F A;  1JWM D;  5CV8 A;  1WTH A;  2NYZ D;  4DR1 Q;  3NPP A;  2L5T A;  1G91 A;  2LKV A;  5C44 G;  2E2I B;  1VQA A;  1QVF A;  4A3D G;  5JAV A;  3GD7 A;  4JI3 Q;  1CA6 A;  4C3J B;  4NDX A;  4GKJ L;  1A0I A;  2VY3 A;  1VQN A;  2ATW A;  4IQZ A;  3S2H H;  1A8V A;  3S15 B;  1U4L A;  2LMC B;  3HS0 C;  1KLG D;  1B4O A;  3MXN B;  1QZG A;  1LTI D;  2NTS A;  3MTS A;  2F0F A;  3ZJY C;  4DR2 L;  4JI5 Q;  3GTK H;  1YJN A;  1NE3 A;  4DV4 Q;  2SOB A;  3H94 A;  1SE8 A;  1Y1W H;  5HY6 A;  3GQB A;  3DEP A;  1PTO B;  2L15 A;  1GM5 A;  2PCF B;  1IXR A;  4OIJ A;  4EQ5 A;  3R2T A;  1U4R A;  3VYU A;  3W2D A;  2H1E A;  3G71 A;  1L1O C;  2XSC A;  1UUP A;  2CKZ B;  1L0W A;  5HUR A;  4QUC A;  4LJZ C;  4BXX H;  4HJ5 A;  2K5V A;  2JA6 G;  2I46 A;  2F0Q A;  3HKZ G;  3TZU A;  2PPB C;  1R4Q B;  4N8F A;  5FKA C;  5C4X H;  4QIW B;  2EYP A;  3L0O A;  4H44 C;  3K58 A;  3GTQ H;  3T13 A;  1FL0 A;  5E3F A;  5C4J B;  2ICI A;  3PUY A;  1QJO A;  4B3T Q;  3C3L A;  3G7L A;  1IW7 D;  5C44 B;  4OHJ A;  2SDF A;  2E5L L;  3HFZ B;  4DV5 Q;  4A3D B;  5JVG 3;  1BNZ A;  2BE5 C;  2L12 A;  4KJN A;  2K33 A;  2QEJ C;  3FPU B;  2PI2 E;  4YIJ A;  2EQS A;  4HJA A;  3A74 A;  1PRT B;  2K5N A;  1GUG A;  3LGJ A;  2E2J H;  4DK1 A;  4JG2 A;  1CHP D;  1CKM A;  4IUQ A;  1D6E C;  1SYF A;  3J81 j;  4DUY Q;  4YWL A;  3S1Q B;  3CXC A;  3SR1 A;  2UUA L;  4K2L A;  3H3V I;  1FR3 A;  3CAM A;  1GHJ A;  1RHP A;  3OIP A;  1JT8 A;  3GTP H;  4OX9 L;  3W1B A;  4UDU C;  1ML0 D;  1WTW A;  2F0U A;  3CCS A;  2Q2I A;  4ZCK A;  1WTP A;  4J1M A;  1PFS A;  4IPC A;  1M90 C;  1SNO A;  4JI3 L;  1EQR A;  1SRU A;  2JA6 B;  4K0K Q;  2IT1 A;  2HUG A;  3HKZ B;  1AP0 A;  4FF1 A;  3SXH A;  2CW0 D;  4CKC A;  1PTO C;  3RZO B;  4RHS A;  5C4H A;  1TVX A;  2ZJP A;  4C3I G;  3RZD H;  3PUZ A;  3I4O A;  2MGS A;  3CC7 A;  3J81 i;  2F0K A;  4LF4 L;  4Y7N B;  5ELB A;  1WCM H;  4DFA A;  4DAY A;  1CT1 D;  2YU9 H;  1SN8 A;  1V9P A;  3M4Q A;  1EOV A;  1CQV A;  4MNO A;  2BH2 A;  1ET6 A;  1PVO A;  2QDB A;  3SK5 A;  3PUX A;  1UAP A;  3P7J A;  1ZYR C;  1IYU A;  4CDC C;  3IFD A;  4B3S Q;  3J7Z C;  4DNR B;  5D3D A;  2RCN A;  1EYA A;  2KHJ A;  1LM0 A;  1BOS A;  2KEE A;  3DWQ A;  1HNW L;  1NMF A;  1H9K A;  3K8A A;  4GLX A;  1N32 Q;  1X56 A;  1XMQ L;  2C5C A;  1YNN D;  3QOJ A;  1WJJ A;  3K7A B;  4V0B A;  5LL6 X;  5IYD H;  1K0R A;  1O7Z A;  1S3O A;  4CJ1 B;  1ILP A;  2ZM6 L;  2JE6 I;  5KYL A;  3L9A X;  3T4A C;  4DR7 Q;  1E0B A;  4X3S A;  4HN7 A;  2HCI A;  4LUZ A;  5IGG A;  2Z8L A;  3WOF A;  1I50 H;  4KKU A;  1DYQ A;  5JJI A;  2MPM A;  4C3I B;  4YWM A;  3GTM B;  1H9R A;  1E2V A;  4BXX G;  1QZH A;  4AH6 A;  2B2U A;  2D5D A;  2XTI A;  4IUU A;  3KLW A;  5C4X G;  2EDG A;  4AQY Q;  3M7G A;  2NWG A;  5M5Y H;  3OW7 A;  1Q81 C;  4RCN A;  1IKM A;  5E7N A;  1G6Z A;  4DAY B;  1FNU A;  1U9R A;  3AU7 A;  1HZ9 A;  1XWE A;  5IYC H;  3TEH B;  5BR8 L;  4LF9 Q;  2DNE A;  2O4X A;  3M4P A;  3VR5 A;  5FLX E;  2DNC A;  4J8Q A;  4JI2 Q;  3S2H B;  5CV7 A;  4MHE A;  1PLF A;  3E0E A;  1WD1 A;  4BBR B;  2RBM A;  1C0A A;  1SE3 A;  3EJI A;  2EYL A;  3NEM A;  4K5X A;  1SJH D;  3DMU A;  1KRS A;  2K6A A;  2EIF A;  4DUZ Q;  2QW7 A;  2D2C C;  2IX0 A;  4HJ7 A;  2V1C C;  3IL8 A;  4HIO A;  2RDH A;  2IJ0 A;  1KNA A;  5FO8 B;  4X62 Q;  2VQE Q;  4A3F H;  4LF5 Q;  1O7L A;  5C4X B;  4IN3 A;  1HUN A;  5IYB H;  2AWN A;  2KEC A;  4C2M B;  3BZC A;  5IGF A;  1XNQ Q;  2PO4 A;  3GTQ B;  3DLL A;  2KJX A;  1VQO A;  1MIU A;  4HAE A;  5LMN L;  1BXT A;  2A8V A;  4IFD H;  1I3Q H;  1U5K A;  2WAQ B;  1CFM A;  3HOY H;  3HKS A;  1XMO Q;  1K3R A;  3AMU A;  4DR5 Q;  3IKJ A;  4L5S A;  3F2U A;  3NQT A;  1WYD A;  2CQO A;  5IGE A;  4JV5 Q;  1FD7 D;  3KBX A;  1NNX A;  2YTY A;  1J9O A;  4JK1 C;  3RLO A;  2F0W A;  1YJ9 A;  3Q6S A;  4KKS A;  3DM1 A;  4PZ8 A;  1IBK Q;  4B3M Q;  1OTC A;  2UU9 Q;  3HOW H;  1F77 A;  5GQO A;  5IGC A;  1VQF A;  4EGV A;  3GTL H;  3NEL A;  2IL8 A;  4NP5 A;  1BF4 A;  1EFW A;  5IYD G;  4XQQ A;  1SMX A;  1YHB A;  2N55 A;  3EBE A;  3H6M A;  1SXT A;  1EYC A;  2AHO B;  4OEM B;  2R93 H;  5GAG C;  4R1J A;  3M3Y H;  4U68 A;  4WJW A;  4LF9 L;  5FOB B;  2L0C A;  3TRE A;  3GP7 A;  4N9P A;  2EY5 A;  3SVM A;  3S14 B;  2JN4 A;  4K8J A;  3HKZ E;  3F1Z A;  3JAM L;  1TII D;  3U4V A;  1OXV A;  2A69 C;  2BA1 A;  3STB D;  3U9O A;  2E74 C;  1B3A A;  4YY3 Q;  2YYZ A;  4DV6 Q;  2NVQ H;  5M3M B;  1ENC A;  4IAL A;  1EYD A;  2F0T A;  2RSN A;  1QNU A;  1SNC A;  5C0X J;  4GS3 A;  2YU9 B;  4HCS A;  2B2U C;  3BVM A;  4PZ6 A;  1DGS A;  1CUK A;  1LO5 D;  1IYV A;  1JJG A;  4IUT A;  5DLQ E;  1DJR D;  4JI1 Q;  1VDZ A;  4L5R C;  2D0O A;  3RLF A;  1J6Q A;  3UDI A;  3Q0A A;  4JI6 Q;  1B53 A;  4XYO A;  1WTQ A;  1XPR A;  2V4D A;  1BCP B;  2E2D C;  2IX3 A;  1PZK D;  2EXZ A;  2H4O A;  2LXJ A;  4RAU C;  4I7A A;  1Q3L A;  2HDM A;  1FGU A;  2RSO A;  1KDC A;  1VQE A;  1DOK A;  4PG3 A;  1NCV A;  1HR0 W;  1Y8O B;  3J7A 5;  3BYY B;  1H9J A;  1LAC A;  1IBL Q;  1SYD A;  2NVT H;  2B8G A;  3TP6 A;  5IP7 H;  2EY6 A;  2IHE A;  1STE A;  3T1Y Q;  3AYH B;  3CKI B;  3L3O C;  1FNV A;  2A68 C;  4KHZ A;  1FNW A;  3NP8 A;  3PGZ A;  1M1K C;  2A68 D;  5EGT A;  4A3F G;  2VL6 A;  5I2Y A;  4C3H G;  4NXN L;  1QOH A;  4LNQ A;  1II3 A;  1XTD A;  3VR3 A;  4DR4 Q;  5JJK A;  3J81 c;  4ZRZ A;  3I4N G;  3U58 A;  4YCU A;  3I8Z A;  4U67 3;  4E6I A;  4JVZ A;  1FYC A;  2F0H A;  2JQO A;  3HOY G;  1EZ8 A;  3MHB A;  2R7F A;  5ELO A;  1X6O A;  3M4O H;  1BUV T;  2EVB A;  1RL2 A;  1RKN A;  2QDL A;  1I6H B;  1KAA A;  1TT2 A;  1K8G A;  3ONA B;  1LTR D;  4BY7 G;  4YY3 L;  2F0O A;  3PV0 A;  4X3K A;  3SHL A;  2E2I H;  2BCO A;  2F3W A;  4NW2 A;  3OIQ A;  1NR2 A;  1STY A;  2KCT A;  1HHV A;  4EX5 A;  4C3J H;  1BCP C;  2ZXP A;  4ME3 A;  4X64 L;  2ALY B;  5ISR A;  2UUB Q;  1CI3 M;  2EOT A;  1B2T A;  4UP7 A;  4DV1 Q;  3IFT A;  3FP9 A;  5M5X B;  5DM7 3;  3S15 H;  2Z0S A;  3MEH A;  4A3F B;  4C3H B;  1MSH A;  1AFP A;  1V8Q A;  4JI6 L;  4PMW A;  2B2Y A;  3V2T A;  1PTO H;  1I3Q B;  4LAA A;  3I4N B;  1AH9 A;  1CKO A;  1YI2 A;  2PW7 A;  1KIX A;  4WJ3 M;  1TWG B;  3HOY B;  1X32 A;  4R8I A;  3R93 A;  4R8N A;  5BN5 A;  2EE1 A;  3NWT A;  4BA1 I;  1EOT A;  1SYE A;  2Z4I A;  3I7F A;  2KA7 A;  4BY7 B;  2IWH A;  5C4J H;  2A6H D;  4BY1 B;  1KAB A;  1TWH H;  5C44 H;  4KD3 A;  2JK8 A;  1PDQ A;  3E9H A;  4EVO A;  3WWV A;  1PH5 A;  4A3D H;  1ENF A;  4DR4 L;  5FO9 B;  4DV0 L;  4GLA C;  1YNJ C;  1S5C D;  2FMM A;  1Y1V G;  3S2D B;  1SYC A;  5IT9 c;  2RHS B;  1VCI A;  3OW2 A;  3HP3 A;  5FLX c;  4DV7 L;  3S1Q H;  1PXU A;  2UXC Q;  1EQV A;  5IP7 G;  5JPN C;  2OF1 A;  2F03 A;  5EKI A;  3PUV A;  5CV5 A;  1EU4 A;  1Q1B A;  1PH6 A;  2WIN B;  3ICE A;  3LNN A;  1D8L A;  3NE5 B;  1EY8 A;  2RDG A;  4A3E H;  1O78 A;  3URY A;  1PH9 A;  1NBW A;  4KHP L;  3PO3 H;  1GD7 A;  1JQY D;  1G29 1;  2A6E C;  2ZTD A;  2UUC Q;  1D7Q A;  2JA6 H;  1H9S A;  1EQT A;  1BCP F;  2EYF A;  2UUB L;  3TME A;  2UXB Q;  3X3N A;  3RZO H;  4MTK A;  3I4M G;  2DJF C;  1SDF A;  3TRZ A;  1HFN A;  3MFG A;  3VYT A;  2AKW B;  2X69 A;  4Y7N H;  3V96 A;  4JI8 L;  1S4Z A;  3J80 i;  1WTV A;  5IGD A;  4NXM L;  2A5H A;  4FVM A;  4A3G H;  1GVP A;  2UXD L;  3CC4 A;  1LTB D;  4DF7 A;  2ENB A;  2K52 A;  1Y1V B;  4LF6 L;  1L0X B;  3S1M B;  1KAW A;  5JOB A;  1LAB A;  1GUT A;  3SE0 A;  1XPU A;  2WII B;  5KYI A;  3LWU A;  4UP9 A;  1HQM C;  1SEB D;  3VYS A;  2NZH A;  3BDO A;  4DV2 L;  3KLS A;  4BWG B;  4C3J G;  5LMU L;  1R9T H;  3G4S A;  1K28 A;  2L1B A;  4FXK C;  2DY8 A;  4UAI A;  1CTM A;  4DV3 L;  1PH8 A;  3VYR A;  3K7A H;  1V43 A;  1W6K A;  4RGM A;  3OHX C;  1YHQ A;  3TSS A;  1A2T A;  4IJL A;  2F4V Q;  1TXY A;  4ALP A;  3BG3 A;  3NQI A;  4F88 A;  3T1H L;  2VUM G;  4IUN A;  1OXU A;  1GOZ A;  3I4M B;  4DXF A;  1H9S B;  1EY9 A;  4CBV A;  2B2Y C;  3OWF A;  2XNA C;  1E2Z A;  1Z7T A;  3M4O B;  4YWK A;  1Q46 A;  1O7I A;  2LXK A;  5CV6 A;  2K5Q A;  1JC7 A;  5T1I A;  2QF7 A;  4RMF A;  4NB3 A;  5EAY A;  4PV1 C;  2Q8T A;  3K59 A;  1JB7 A;  2KEN A;  1JWU D;  3K7U C;  4A3J G;  4KD4 A;  4PMB A;  1EY4 A;  2KCC A;  4X66 Q;  4YCW A;  1VQP A;  2XRS D;  1DD2 A;  3AEV A;  1J5E Q;  2NZ1 D;  2UXB L;  3BS1 A;  1PV4 A;  1H9M A;  2O5J C;  4KN4 C;  1N34 L;  1HNX L;  4OO1 G;  4BBR H;  2B39 A;  2BH8 A;  2WV6 D;  5J1Z A;  4RA8 A;  3QO2 A;  3H15 A;  1E7Z A;  1MJC A;  2AQ1 B;  4JI7 Q;  2VUM B;  2L4N A;  3A55 A;  4JBM A;  2OWO A;  4B08 A;  4RKB A;  4A3E G;  2ZT9 C;  4A3B H;  2I07 B;  1MI2 A;  3A5U A;  2JEA I;  3CPW A;  1Z47 A;  1JCK B;  3CQZ B;  3PO3 G;  2FHT A;  3AQQ A;  3NTI A;  4OON A;  2B29 A;  1GUO A;  2N8N A;  4LUV A;  3MEF A;  4C2M H;  1GUS A;  4DXG A;  1IW7 C;  1G8Z D;  1QCB D;  1N33 Q;  4KHV A;  2HIV A;  4XQJ A;  1LTS D;  1TWH B;  4XT1 B;  4HJ8 A;  4A3J B;  1EQQ A;  2B2T A;  2GVB A;  5BN3 A;  3HZX A;  1GKH A;  1BBX C;  2DGY A;  4A3G G;  4QGU A;  4P75 A;  2Y0S G;  4A75 A;  3BVZ A;  1A6X A;  4XTC S;  1N36 L;  3T51 B;  5EQ0 A;  4PMC A;  4GNX A;  2WB1 G;  4RGT A;  4A4I A;  4JI4 Q;  2VQF L;  4DR6 L;  2WAC A;  1CSQ A;  3CPF A;  1LTL A;  4JBK A;  5F2D A;  1YIJ A;  1IHZ A;  2JA8 H;  3HG9 A;  4NKL A;  4FO2 A;  3MZ5 A;  4H0L C;  4DR1 L;  1QVC A;  3BZD B;  4A3E B;  3J81 E;  1KC8 C;  5HGQ A;  1WTR A;  3CCR A;  2Q2H A;  3PO3 B;  2K5H A;  4X66 L;  2CW0 C;  2M00 A;  3C1E A;  1TWF B;  1JOK A;  2AQ3 B;  1PMR A;  3E6Z X;  2WKD A;  1J5E L;  3S14 H;  4A76 A;  4QUF A;  1G6P A;  4C56 C;  4AYB G;  4DAV A;  3KJO A;  4OWX B;  3KOJ A;  3A0J A;  3J81 L;  4POF A;  3NTK A;  3A8J E;  4EQO A;  5M3M H;  4JI5 L;  1J8I A;  3WOE A;  4DV4 L;  4A3G B;  2H5X A;  2O2L D;  2Y0S B;  1XNR Q;  4ZYS A;  1NMG A;  2F0P A;  4A3L G;  1Q86 C;  2HHH Q;  1H95 A;  2DN8 A;  3NUC A;  1ONL A;  3OTO Q;  4WJ4 A;  3E0J A;  2WB1 B;  4I65 A;  4DR3 Q;  1F9S A;  3VR4 A;  4KK7 A;  4GNX B;  2K50 A;  1R9T B;  2K7V A;  1PYW D;  1YNN C;  2CWA A;  4A3M G;  3I72 A;  4DK3 C;  4B3T L;  4BBR G;  4V19 0;  3FHW A;  4HSP A;  3GTG H;  4DV5 L;  2RCF A;  4YCV A;  1VQ4 A;  1AE2 A;  4IFD I;  1SSO A;  3TS0 A;  1EL0 A;  1DOM A;  4HED A;  3PIP 3;  4A3B G;  4IUV A;  4Q0F A;  3M7N A;  3SDZ A;  4P73 A;  2XWB B;  4AYB B;  2J4X A;  2JA7 G;  4DUY L;  4EQN A;  1FGB D;  1BDO A;  2KQ3 A;  5EKL A;  1VQ8 A;  1JOQ A;  3MC0 B;  4LF8 Q;  4L63 B;  4B3R Q;  1A2U A;  1ICF B;  4P72 A;  1SNM A;  2F1M A;  1Q8K A;  4C1N I;  5JEA J;  3I55 A;  3A8I E;  4UPA A;  1RTN A;  2WAQ G;  1B50 A;  2C9O A;  1C8C A;  5KRU A;  4KI0 A;  1D5Z C;  2MUY A;  2ZJQ A;  1KQS A;  4K0K L;  1SAP A;  3D3R A;  5K36 G;  3K6O A;  5IT9 E;  2BDN A;  4KV6 A;  2Z4H A;  2Z9H A;  2B2T C;  1YVC A;  3SEB A;  3KK7 A;  2P5Z X;  3K80 C;  1QG7 A;  1I6H H;  4A3M B;  3EN2 A;  2NN6 H;  1Q82 C;  4ZK9 B;  5K5P A;  2VB2 X;  2Z1C A;  3J7A F;  2K28 A;  1QB5 D;  4FDB A;  5E1F A;  2WFW A;  1B70 B;  1S5E D;  4GNX C;  2JA8 G;  1XJV A;  5E4X A;  4A3I G;  4P2C B;  2IX1 A;  1XTC D;  4X65 Q;  1D2B A;  3D4D A;  3W3A A;  3OTO L;  4A3B B;  5FLX L;  4LF7 Q;  4DKA C;  2B8F A;  5FLM G;  2Q2U A;  5GAH C;  1MJE A;  2JA7 B;  1QNK A;  4B3S L;  1RTO A;  1UE7 A;  3ULL A;  4IPD A;  1HUM A;  5M5X H;  2ID0 A;  2AMC B;  1I94 Q;  4GOP A;  3SGI A;  1TS3 A;  4P74 A;  1SRO A;  4C3H H;  2PW5 A;  2N49 A;  1SE4 A;  4QIW E;  3HOU G;  1N32 L;  2YTV A;  4XT3 B;  5I9O A;  1WOC A;  4F8M A;  3I4N H;  5I4D A;  4QL5 A;  5M3M G;  3L2P A;  3CRK C;  1TWG H;  3DEO A;  2XIW A;  1EY5 A;  2Q8I B;  2CWP A;  4DR7 L;  1KL9 A;  1JWS D;  4B9X A;  1I4X A;  1EWI A;  5C3E G;  2Z6B A;  1G2T A;  1HR0 Q;  5I6W A;  5LMN W;  1RF2 D;  2LFN A;  1TS4 A;  2F4I A;  4A93 G;  2UXD Q;  1ENA A;  4BY7 H;  4GN4 B;  4BY1 H;  4LFB Q;  1LYL A;  5C5M A;  3I56 A;  2JA8 B;  4AQY L;  4A3I B;  2ASB A;  1VQC A;  4RGN A;  1N8R C;  3J7Y W;  2NUC A;  1EY0 A;  3CCE A;  4F87 A;  2X6G A;  3S16 H;  3NBI A;  3S2D H;  1VQ7 A;  3K5O A;  2WP8 J;  1I6V C;  4MN3 A;  3M85 A;  5TSS A;  1MKH A;  5KEE A;  2CCZ A;  4DAM A;  4JI2 L;  3STB C;  4JYA Q;  3HOU B;  1W3S A;  4GOP B;  2I5H A;  1YIT A;  4FF4 A;  1S5B D;  4QB4 A;  1V1P A;  1NAP A;  1I4P A;  1MBY A;  4KTA A;  4NPS A;  2K32 A;  1XYI A;  4KJO A;  5IOC A;  3ULP A;  4OGQ C;  1VQH A;  4ABN A;  3EFX D;  2EPB A;  1SFO B;  5C3E B;  2Y0S E;  3PQI A;  4CGY B;  2GVA A;  1AE3 A;  5AJ3 Q;  4G7H C;  4LF7 L;  2PZW A;  3JAM i;  4KY5 A;  2R7D A;  1C9O A;  4DUZ L;  4POG A;  5IOD A;  4A93 B;  1AN8 A;  1Q7Y C;  3QB3 A;  4ODG A;  1TWC B;  1ESF A;  5M9O A;  3SK8 A;  4IO9 A;  2VQE L;  4R4Q A;  4X62 L;  4LF5 L;  4QY7 A;  3D6W A;  1KDB A;  1SJE D;  2GN5 A;  1XNQ L;  1B7Y B;  2NN6 G;  4KY6 A;  1WFQ A;  4MZ9 A;  1QVG A;  2MQH A;  1HTL D;  1EY6 A;  3GTG B;  1I4Q A;  3S1M H;  1Y1V H;  2PMZ B;  2XN9 C;  1E2W A;  3NXW A;  1IBM Q;  5EPL A;  5ELF A;  1XMO L;  4DR5 L;  2R7Z G;  1VQI A;  1A3U A;  1VQB A;  2TSS A;  4JV5 L;  5C4Z A;  2K05 A;  4ZKC B;  4AYB E;  1HJP A;  1E24 A;  1SE2 A;  1SND A;  3PCO B;  3I73 A;  1IBK L;  4B3M L;  2UU9 L;  4LFB L;  4HMJ A;  5AFW A;  1IZ6 A;  2VB3 X;  1CK1 A;  1QE6 A;  2F0S A;  4YHH Q;  3I90 A;  2L9H A;  2R92 G;  1O80 A;  5BN4 A;  1V1P B;  2QIL A;  2R6G A;  5E4W C;  1HRJ A;  3LX0 A;  4EQP A;  3KJP A;  4GOP C;  2K03 A;  3JC6 6;  5GRO A;  3PF4 A;  4N8X 1;  3I4M H;  1VQ9 A;  3RMH A;  3KLS X;  3QOL A;  3F2B A;  2F0E A;  3CHB D;  3H09 A;  1YEZ A;  2OQK A;  2LY7 A;  2F0I A;  2AWO A;  3ERO A;  2B3G A;  1LT4 D;  3A7A B;  2I5M X;  2K14 A;  3C2P A;  2OEO A;  3PF5 A;  3RUZ A;  4BY1 G;  3RN5 A;  5EBD A;  4DV6 L;  4XXE A;  5C0X H;  4DAP A;  1JOO A;  5M3F H;  4FF2 A;  2JA5 H;  5KNB A;  1GO3 E;  1JJC B;  3VA5 A;  5JEA G;  2R7Z B;  5CR3 A;  4IPG A;  4KMU C;  3VDY A;  1HNZ Q;  1QWY A;  3A7L A;  3U50 C;  4JI1 L;  2EY1 A;  2KVM A;  4A3K G;  1X9N A;  2R92 B;  1CSP A;  5GAE C;  2AUJ D;  4JI0 Q;  3OMC A;  4RHR A;  2D62 A;  2B2W A;  4WFN 3;  2VUM H;  1ET9 A;  5JJZ A;  1N9W A;  4M1U B;  3GTJ B;  4TQU S;  2WAQ E;  1IBM L;  3HOX H;  1EU3 A;  3A56 A;  1KNE A;  3D4R A;  3CQZ H;  4K5V A;  2J7Z A;  4LW1 A;  4ZQ3 A;  3CMA A;  5COY A;  1X65 A;  3CCL A;  1IBL L;  3Q23 A;  3T1Y L;  2EY2 A;  3TS2 A;  2A6H C;  3QWN A;  3N6R A;  4HMI A;  3IRB A;  4KY7 A;  2XRQ D;  3ER0 A;  3H3V C;  4A3J H;  1D5M C;  3P20 A;  2XWJ B;  4YHH L;  3CCU A;  1ROD A;  1GUW A;  1HCZ A;  1K3B C;  1LV9 A;  2RQX A;  1LT6 D;  5M5W B;  1V1O A;  3S16 B;  5J39 A;  3TN2 A;  1EWC A;  1PH7 A;  3HOZ G;  2ZTC A;  4OO1 H;  2N78 A;  4ZUI A;  1Q12 A;  1LLR D;  4RKL A;  4A3K B;  1CQF A;  4IZ8 A;  1CHQ D;  3LWE A;  1VQM A;  4H7B A;  2C35 B;  3S1R H;  1W6J A;  4LFA Q;  4G7O C;  4KLK A;  1ASY A;  1VF5 C;  4LK1 C;  5IE8 A;  4XIG S;  5CV4 A;  3E3X A;  5G3L D;  1LUZ A;  5KGU A;  3J80 E;  3CP0 A;  1TWF H;  4TRD A;  4LFC Q;  2E75 C;  1FJG Q;  1D1I A;  3Q22 A;  4R4I A;  2HDL A;  1JE5 A;  3CRL C;  4UY8 C;  3K5M A;  2G9D A;  2MNA A;  4DV1 L;  5NUC A;  3GDE A;  1OXS C;  1B1Z A;  1KTK A;  1EIG A;  1O7Y A;  5C5L A;  1BO0 A;  5HGT A;  4J15 A;  4S3S A;  1C7Y A;  5A2Q E;  2YV5 A;  3QR8 A;  5KIX A;  4GKJ Q;  2OCE A;  1E1T A;  5C0X G;  3MAQ A;  1B9M A;  2JA5 G;  1UNS A;  3HOZ B;  5ELD A;  4ZLT F;  2PMZ E;  3UI2 A;  2EJG C;  4X3T A;  2SEB D;  2RDF A;  2KCM A;  2F0D A;  4DR2 Q;  1VQD A;  3A8K E;  3CC2 A;  4JC0 A;  3NTH A;  1E22 A;  3KF8 A;  1UE5 A;  2F0L A;  1LTA D;  2PQA A;  4HIM A;  1X3F A;  1YZ6 A;  1X3Q A;  2TMP A;  2KBN A;  3D8G A;  5EJW A;  1ICW A;  4GLV B;  3S1N H;  2BOS A;  3MFY A;  2Q8R E;  2Z6K A;  5FK9 C;  3HOV H;  3S17 B;  2RKS A;  2J0T D;  4XQN A;  4HSV A;  1WVL A;  4Y52 H;  1U4M A;  3BU2 A;  4DK6 C;  4MIU A;  1PFB A;  1VMP A;  3HOX G;  5M3F G;  4X6A H;  1X54 A;  3P1H A;  2B2W C;  2KHI A;  4A3C G;  2E5L Q;  4R4C A;  1BBW A;  3JAM c;  2M9V A;  3C46 A;  2UXC L;  2NZO A;  2ES2 A;  3KYH C;  5CV9 A;  4A3L H;  2AQ2 B;  2LS0 1;  4ZUJ A;  1NJI C;  4C1N K;  3HRZ C;  2JA5 B;  3D4W A;  1PH3 A;  3FDT A;  1B9N A;  1MGS A;  5G3L F;  3TP8 A;  1WTX A;  5JVH 3;  2UUC L;  1QIL A;  3CME A;  3MXP A;  4FYD A;  2UUA Q;  2N3S A;  4CDE C;  1FJG L;  4JBJ A;  4H02 A;  2VW9 A;  3K5L A;  1DXM A;  2GA4 B;  3OWE B;  4A3M H;  4OX9 Q;  4JBW A;  1JJ2 A;  1I4R A;  1EUJ A;  3MXU A;  3KF8 B;  2HQL A;  2PQA B;  3DHQ A;  4JW0 A;  2PYK A;  3ERQ A;  2JJQ A;  4QMG A;  3H0G G;  4N9T A;  2F0J A;  2F0N A;  4LMQ D;  3F8T A;  4H13 C;  4IJH A;  2K5D A;  3F2C A;  3G6J B;  3K0X A;  3UDX A;  1HZA A;  1CZG A;  1HZB A;  1JR0 D;  4O42 A;  5M3F B;  3HOX B;  2OQ0 A;  2JA7 H;  4LF4 Q;  2EZV A;  5C3X A;  1TR5 A;  4RG1 A;  1LT3 D;  2PZU A;  4PZ7 A;  2JSO A;  1S5D D;  2OTL A;  3BVG A;  3WDN A;  1HZC A;  2A74 C;  1PFM A;  3TP5 A;  5FJ8 G;  3S24 A;  1JOR A;  2B2V A;  1AZP A;  1HFG A;  3X3M A;  2CFM A;  3NEN A;  2F4V L;  1VQ5 A;  2XVS A;  5K36 H;  1XXG A;  1HNW Q;  1E1O A;  4DN4 M;  2RVL A;  3TP7 A;  2MJ8 A;  2BDO A;  3C1F A;  3FKI G;  5CGK A;  3J7A V;  3U9S A;  1LTG D;  4K5W A;  4RWS C;  5LL6 S;  1XMQ Q;  1EIY B;  1RCV D;  3EA6 A;  4RH6 A;  1C4Q A;  1VQJ A;  1TY0 A;  2ZM6 Q;  1RDP D;  3OYY A;  1P16 A;  4IOA A;  2CH4 A;  3H0G B;  4A3I H;  3GTO H;  3S1R B;  3OOC A;  2BE5 D;  3GO5 A;  3Q24 A;  3PO2 G;  2EJF C;  5I2X A;  4K2K A;  1NR4 A;  3NSW A;  3SK6 A;  5LHY 1;  3D31 A;  2MP1 A;  1C48 A;  3KBG A;  2K1B A;  5FLM H;  4CKB A;  2FJ2 A;  3OMG A;  2E2H B;  2NVY B;  3HOV G;  2VXW A;  1X3G A;  3GV6 A;  3AB9 A;  1KLU D;  4O1N A;  3K81 C;  2IW3 A;  3T16 A;  4RCO A;  2JA9 A;  1GJX A;  3HOU H;  1DM0 B;  2R61 A;  4LWC A;  5KND A;  1Z9F A;  1KRT A;  3RD4 A;  1A3V A;  2Z6K C;  4CJ2 C;  1K8O A;  4DU9 A;  2B63 G;  1IL8 A;  4JCV E;  1A62 A;  2NN6 I;  1UE6 A;  4ID6 A;  5BR8 Q;  1NY4 A;  4QQB X;  4JI7 L;  4RGO S;  1SFO H;  1ZKO A;  5C3E H;  3E5S A;  1STB A;  3FKI B;  4QJF A;  1PZI D;  5JPM C;  1HXY D;  1PTO D;  4A93 H;  1F2M A;  3RN2 A;  4R4T A;  5DM6 3;  1VMC A;  1TWC H;  3W5O A;  1XPO A;  1K83 B;  2OT2 A;  1STH A;  2ZJR A;  5DAU A;  3D6C A;  5EKK A;  1L2F A;  2SNS A;  2NVX B;  3MA2 B;  3PO2 B;  1N33 L;  2ICE C;  3BZK A;  1VQ6 A;  3FRP B;  3U4Z A;  3T53 B;  4P71 A;  3S1N B;  1KDA A;  4QCL A;  3R2I A;  4G7Z C;  3HOV B;  1ZYR D;  1T5X D;  2F0M A;  1BKB A;  4OIK A;  1PRT C;  2D9U A;  2PNH A;  1I4G A;  1PRT D;  5LMN Q;  4JI4 L;  3TZD A;  1VS0 A;  1T9H A;  5J22 A;  1M8A A;  4HCE A;  2KHS A;  2B63 B;  1YHA A;  4IFD J;  1E3P A;  3TDQ A;  2A19 A;  1Y1W G;  2VZA A;  1PA6 A;  2ZXR A;  2WKC A;  2RHQ B;  1U4P A;  1VQL A;  1EIH A;  2KED A;  3J80 c;  2VNU D;  1SNQ A;  3H3V H;  1UWV A;  1V1Q A;  2K75 A;  5CMD A;  4WOR A;  3M9B A;  4CDF C;  1R4P B;  4CKE A;  2IPK D;  2B2V C;  2CHB D;  1CM9 A;  2K5W A;  1PHJ A;  4R4O A;  3ITP A;  1Q90 A;  1FVI A;  5EBC A;  1TS5 A;  1HTP A;  2DJG C;  1EEF D;  2I5L X;  5CYU A;  1F9R A;  1XNR L;  1JMC A;  2R7Z H;  3MVV A;  2HHH L;  5IT9 L;  1SYG A;  5DNF A;  3CCM A;  2K4K A;  1HPC A;  1WD0 A;  4FXD A;  4ILW A;  1YNX A;  1PTO F;  2KOL A;  2O5I C;  4IUR A;  4BBS H;  4DR3 L;  1RIP A;  1F2Y A;  3GTK B;  1STG A;  2R3Z A;  3RNU A;  4GKK Q;  1TWA H;  4DA2 A;  1OO9 B;  5CBE E;  2R92 H;  1Y1W B;  1JIC A;  3KDF A;  2FXQ A;  4Q5V A;  3MXG A;  1GXD C;  1KHI A;  4CDD C;  3NHH A;  1RD9 D;  1BBU A;  2PQE A;  4J6H A;  1X3P A;  2ZXO A;  3GTJ H;  2CVR A;  3FEW X;  5CBA E;  4ZKB B;  1CKN A;  4TKO B;  1AEX A;  4K6D A;  2NBF A;  5IWA Q;  1F2L A;  3OSO A;  4HR7 B;  1PRT F;  1EY7 A;  3KF6 A;  5KNC A;  1K0S A;  4HTH A;  5T1G A;  3EIV A;  2G9H D;  1WCM G;  4LF8 L;  4GZY C;  3PIP A;  4B3R L;  3GTO B;  5JEA H;  4B9W A;  5EPJ A;  1RJT A;  5GAD C;  4OEL B;  3I2Z A;  3KLR A;  2E2J B;  5M5W H;  3L7Z C;  3GV3 A;  2QEX A;  1A3T A;  2CQA A;  3CF5 A;  4JOI A;  2QA4 A;  3AFQ A;  2MO1 A;  4XYQ A;  3SK4 A;  2FIN B;  4DNI A;  4A3K H;  4NXN Q;  3BJU A;  2KUM A;  1MHW C;  3GTP B;  2XGT A;  3NK9 A;  3JAM E;  3CCJ A;  1W2B A;  3PIO 3;  3ZYY X;  1VQK A;  5ELC A;  4DGZ A;  2DUD A;  3V05 A;  1TQO A;  2EYO A;  3KDF B;  1K8A C;  4DNT B;  5IP9 H;  2EYM A;  1GHK A;  1T5E A;  3UE0 A;  2D0P A;  4G57 A;  4X65 L;  5C0X I;  2JYO A;  1TS2 A;  1EWH A;  2E8G A;  1JE4 A;  2EJM A;  3I3C A;  1CKN B;  3RZD B;  1NSN S;  1X3E A;  3BDL A;  5IGB A;  2BA0 A;  2WB1 E;  4HJ9 A;  1L0Y B;  2A69 D;  1I94 L;  3FVQ A;  1WCM B;  3KF6 B;  2NTT A;  4GKK L;  3W1G A;  1PZJ D;  3CW2 C;  2K04 A;  4GN5 A;  2ZTE A;  4CHT B;  4X64 Q;  2JP1 A;  2HCC A;  3MWY W;  3AFP A;  3PUW A;  3BDC A;  4TVA B;  4RFB A;  2QCP X;  4IPH A;  3G48 A;  1LTT D;  3I4L A;  3P75 A;  1OXT A;  5IYC G;  4DK0 A;  4IOC A;  3HOZ H;  1AZQ A;  3K5N A;  5C3W A;  1PYS B;  1HR0 L;  5IWA L;  2F0V A;  1PYB A;  1Q8I A;  2MHV A;  3VA7 A;  2CH4 W;  1Y8N B;  2KCN A;  4BBS G;  2L11 A; 
#chains in the Genus database with same CATH homology
 3CP0 A;  4LF9 Q;  4HIK A;  2IHF A;  1TWF H;  3G6E A;  3M4P A;  4HJ8 A;  1YJW A;  4LFC Q;  1FJG Q;  1EQQ A;  2GVB A;  4R4I A;  4JI2 Q;  1GKH A;  1JE5 A;  4UY8 C;  1U0L A;  2DGY A;  2MNA A;  4DV1 L;  3E0E A;  4A3G G;  2I0Q A;  4QGU A;  4P75 A;  2Y0S G;  4A75 A;  3GDE A;  4XTC S;  1OXS C;  3B6Y A;  1N36 L;  4O0A A;  3S17 H;  1C0A A;  1ASZ A;  3NEM A;  3UE1 A;  4GNX A;  2WB1 G;  1SLJ A;  4J15 A;  4A4I A;  1C7Y A;  4JI4 Q;  2VQF L;  2YV5 A;  1EIF A;  3PO2 G;  4DR6 L;  4GKJ Q;  1CSQ A;  1KRS A;  2OCE A;  3CPF A;  1E1T A;  3A5Z B;  2EIF A;  1LTL A;  4JBK A;  5IYB G;  5C0X G;  4DUZ Q;  1YIJ A;  2IX0 A;  2JA8 H;  2JA5 G;  4HJ7 A;  4JYA L;  2V1C C;  4HIO A;  4OO1 I;  2PMZ E;  1WI5 A;  4DV0 Q;  4DR1 L;  2VQE Q;  2KCM A;  1QVC A;  4X62 Q;  4A3F H;  4LF5 Q;  4IFD G;  1X55 A;  4DR2 Q;  4B3S Q;  1KC8 C;  5IYB H;  1VQD A;  5HGQ A;  3CC2 A;  2AWN A;  4JC0 A;  3CCR A;  2Q2H A;  3BZC A;  1E22 A;  1XNQ Q;  2K5H A;  1UE5 A;  4X66 L;  3DLL A;  1VQO A;  1MIU A;  1UEB A;  1OXX K;  2PQA A;  1X3F A;  5LMN L;  1YZ6 A;  4HIM A;  4DV7 Q;  2A8V A;  1I3Q H;  3PIO A;  2KBN A;  1U5K A;  5AJ3 L;  1J5E L;  3S14 H;  4GLV B;  4A76 A;  3S1N H;  1G6P A;  3HOY H;  3HKS A;  1XMO Q;  1K3R A;  4AYB G;  4WJ4 A;  4DR5 Q;  2JEB I;  1G51 A;  2Z6K A;  3HOV H;  2PI2 A;  3KJO A;  4OWX B;  4L5S A;  3KOJ A;  1NTG A;  3F2D A;  3ULJ A;  3A0J A;  4POF A;  1WYD A;  2CQO A;  4Y52 H;  3HOW G;  5M3M H;  4JI5 L;  1HH2 P;  4JV5 Q;  3BU2 A;  4DK6 C;  4DV4 L;  4KHP Q;  2H5X A;  2YTY A;  1IBM L;  1KD1 C;  1XNR Q;  3RLO A;  3HOX G;  1NMG A;  5M3F G;  4X6A H;  1YJ9 A;  1X54 A;  1Q86 C;  2HHH Q;  4JOI C;  4A3L G;  1H95 A;  1KXL A;  2KHI A;  4PZ8 A;  3OTO Q;  1IBK Q;  2E5L Q;  1OTC A;  2UU9 Q;  4B3M Q;  2LSS A;  1BBW A;  4R4C A;  3JAM c;  2UXC L;  3HOW H;  2NZO A;  4L5Q A;  3CCV A;  2ES2 A;  3KYH C;  5GQO A;  5IP9 G;  4GKJ L;  2R93 G;  1VQF A;  3GTL H;  5ELN A;  4DR3 Q;  2Q2T A;  3NEL A;  4A3L H;  3KFU A;  1EFW A;  4GNX B;  4A3C H;  1BVS A;  2K50 A;  1NJI C;  4JI8 Q;  5IYD G;  1SMX A;  1YHB A;  3EBE A;  2AHO B;  1PH3 A;  4NXM Q;  2R93 H;  2CWA A;  4OXP A;  5IY0 A;  5GAG C;  4A3M G;  4R1J A;  3M3Y H;  2UUC L;  1Y14 B;  4DK3 C;  4B3T L;  3CME A;  4BBR G;  4LF9 L;  2UUA Q;  4LF6 Q;  3TRE A;  3FHW A;  2N3S A;  1FJG L;  3GTG H;  4DV5 L;  3HKZ E;  4JBJ A;  3F1Z A;  4H02 A;  3DM3 A;  4YCV A;  2VW9 A;  1VQ4 A;  3U4V A;  4A3M H;  1AE2 A;  4DV2 Q;  4OX9 Q;  4JBW A;  1OXV A;  2BA1 A;  3STB D;  1JJ2 A;  4IFD I;  4YY3 Q;  3TS0 A;  1EUJ A;  5LMU Q;  2MFI A;  2YYZ A;  1YBY A;  3KF8 B;  4DV6 Q;  2NVQ H;  2HQL A;  2PQA B;  3RR5 A;  4A3B G;  3M7N A;  4P73 A;  2JJQ A;  5C0X J;  4GS3 A;  3Q8D A;  3H0G G;  4DV3 Q;  2JA7 G;  4DUY L;  1SR3 A;  4AIM A;  4UP8 A;  3F8T A;  4OWT B;  1VQ8 A;  4PZ6 A;  1QUQ A;  4IJH A;  1DGS A;  1CUK A;  1VQG A;  3F2C A;  4LF8 Q;  1JJG A;  3K0X A;  3UDX A;  1HZA A;  5DLQ E;  4B3R Q;  1Q1E A;  1HZB A;  4P72 A;  4JI1 Q;  4L5R C;  2YTX A;  2D0O A;  2OQ0 A;  3H0G H;  3RLN A;  3RLF A;  2JA7 H;  1J6Q A;  2OTJ A;  3UDI A;  4LF4 Q;  1Q8K A;  3D0F A;  3T1H Q;  5JEA J;  4RG1 A;  3I55 A;  1S40 A;  2A1A A;  4PZ7 A;  4UPA A;  2WAQ G;  1XPR A;  4JI6 Q;  1PH4 A;  2OTL A;  3ERS X;  2E2H H;  2QGQ A;  4KI0 A;  1HZC A;  2ZJQ A;  2LXJ A;  1KQS A;  4K0K L;  2F3I A;  2NVY H;  5K36 G;  5FJ8 G;  3S24 A;  1HNZ L;  4MTN A;  1FGU A;  1YVC A;  3UDG A;  5JJL A;  1VQE A;  4BA2 I;  4PG3 A;  1HR0 W;  1L1O A;  3K80 C;  3J7A 5;  1I6H H;  3EN2 A;  2CFM A;  1Q82 C;  3NBH B;  3NEN A;  2F4V L;  1IBL Q;  1VQ5 A;  2F52 A;  2NVT H;  5FJ8 H;  4FDB A;  1HNW Q;  1E1O A;  2WFW A;  1B70 B;  5IP7 H;  2IHE A;  3FKI G;  3T1Y Q;  1P8L A;  4GNX C;  3PSI A;  2JA8 G;  1XJV A;  3AYH B;  4JI0 L;  1XMQ Q;  4A3I G;  1EIY B;  2IX1 A;  4X65 Q;  4KHZ A;  3PGZ A;  1B8A A;  1M1K C;  3OTO L;  3CCQ A;  1VQJ A;  2VL6 A;  4A3F G;  1PH1 A;  4LF7 Q;  2IY5 B;  4NXN L;  3FKI H;  4DKA C;  2ZM6 Q;  4L5T A;  4DPG A;  3OYY A;  1P16 A;  5FLM G;  4IOA A;  2HIX A;  2Q2U A;  4LNQ A;  4A3I H;  1XTD A;  5GAH C;  1MJE A;  3GTO H;  1N34 Q;  3GO5 A;  3J81 c;  1HNX Q;  4B3S L;  1UE7 A;  3ULL A;  4IPD A;  5M5X H;  2ID0 A;  3E9I A;  2AMC B;  1I94 Q;  3I4N G;  1K83 H;  4GOP A;  3SGI A;  3U58 A;  4P74 A;  1SRO A;  3D31 A;  4YCU A;  4C3H H;  1UE1 A;  2N49 A;  4HID A;  5FLM H;  2JQO A;  4APV A;  2NVX H;  1QUQ B;  3HOY G;  3HOU G;  4QIW E;  3PO2 H;  1N32 L;  2R7F A;  2YTV A;  3HOV G;  1X3G A;  1WOC A;  5ELO A;  1X6O A;  3M4O H;  3I4N H;  1W2B A;  3K81 C;  4QL5 A;  1RL2 A;  5M3M G;  1K73 C;  3OW2 A;  3L2P A;  1TWG H;  2JA9 A;  3HOU H;  4IFD J;  5H1S E;  2MO0 A;  2CWP A;  4LWC A;  1K8G A;  1Z9F A;  1KRT A;  3UDF A;  4DR7 L;  1KL9 A;  2Z6K C;  4BY7 G;  4YY3 L;  1EWI A;  5C3E G;  1EYG A;  3PV0 A;  4O2D A;  1HR0 Q;  4OWW B;  5LMN W;  2E2I H;  1S72 A;  2B63 G;  4JCV E;  1IL2 A;  1A62 A;  2NN6 I;  1UE6 A;  5BR8 Q;  4A93 G;  2UXD Q;  1NY4 A;  2KCT A;  1PH2 A;  4JI7 L;  4QQB X;  4EX5 A;  4C3J H;  2RF4 A;  4BY7 H;  4ME3 A;  1SFO H;  4GN4 B;  5C3E H;  1L1O B;  2ALY B;  4X64 L;  2UUB Q;  4BY1 H;  4LFB Q;  1LYL A;  4QJF A;  2VS1 A;  2B63 H;  3I56 A;  4UP7 A;  4AQY L;  4DV1 Q;  2ASB A;  1IYJ B;  4A93 H;  1VQC A;  3RN2 A;  3FP9 A;  4R4T A;  1N8R C;  3CD6 A;  3TQY A;  3S15 H;  4GN3 B;  2Z0S A;  1TWC H;  3W5O A;  1N36 Q;  2EXD A;  4LFA L;  1XPO A;  3CCE A;  4LUO A;  2ZJR A;  4JI6 L;  3S16 H;  4PMW A;  1L2F A;  1K9M C;  3S2D H;  4C3I H;  1VQ7 A;  3GTM H;  2VQF Q;  1N33 L;  4DR6 Q;  2WP8 J;  3BZK A;  3M85 A;  1VQ6 A;  5J3B A;  1MKH A;  1AH9 A;  1CKO A;  1YI2 A;  4LFC L;  1A63 A;  3U4Z A;  1KIX A;  4P71 A;  4WJ3 M;  2CCZ A;  4DAM A;  4JI2 L;  3STB C;  4JYA Q;  2HT1 A;  1W3S A;  4GOP B;  1I5F A;  2I5H A;  1YIT A;  5IT9 c;  4DR1 Q;  1BKB A;  5C44 G;  1VQA A;  4NPS A;  4BA1 I;  1QVF A;  3ULP A;  4A3D G;  2PNH A;  1VQH A;  3GD7 A;  4JI3 Q;  3I7F A;  5LMN Q;  4JI4 L;  5C4J H;  2Y0S E;  1A0I A;  1T9H A;  1VS0 A;  2GVA A;  1AE3 A;  1TWH H;  2VY3 A;  5C44 H;  5AJ3 Q;  2JK8 A;  1VQN A;  4LF7 L;  3JAM i;  1YHA A;  2R7D A;  1E3P A;  3E9H A;  1C9O A;  3WWV A;  4DUZ L;  1PH5 A;  2A19 A;  4POG A;  2ATW A;  4A3D H;  3S2H H;  1A8V A;  1Q7Y C;  1Y1W G;  2VZA A;  4DR4 L;  1PA6 A;  4DV0 L;  4GLA C;  3MXN B;  1QZG A;  4IO9 A;  2RHQ B;  4R4Q A;  3ZJY C;  4X62 L;  2VQE L;  1VQL A;  4LF5 L;  5JJK A;  4QY7 A;  4DR2 L;  1Y1V G;  4JI5 Q;  3GTK H;  1YJN A;  1NE3 A;  3J80 c;  4DV4 Q;  2VNU D;  3H3V H;  1UWV A;  1SE8 A;  1Y1W H;  2GN5 A;  5HY6 A;  1B7Y B;  1V1Q A;  2K75 A;  1VCI A;  1WFQ A;  2NN6 G;  2RHS B;  2L15 A;  2MQH A;  3M9B A;  4MZ9 A;  5FLX c;  1QVG A;  1GM5 A;  1IXR A;  4DV7 L;  3S1Q H;  4EQ5 A;  2UXC Q;  3S1M H;  1Y1V H;  5IP7 G;  3G71 A;  1L1O C;  3PUV A;  1IBM Q;  2CKZ B;  1XMO L;  1L0W A;  1PHJ A;  4A3C G;  1Q1B A;  4R4O A;  4DR5 L;  2R7Z G;  1PH6 A;  4BXX H;  4HJ5 A;  2K5V A;  2JA6 G;  3ICE A;  1D8L A;  1VQI A;  3HKZ G;  4A3E H;  1FVI A;  5C4X H;  1VQB A;  4JV5 L;  3L0O A;  1PH9 A;  1NBW A;  4KHP L;  3PO3 H;  1GD7 A;  2I5L X;  1G29 1;  2ZTD A;  2UUC Q;  1FL0 A;  1XNR L;  1JMC A;  2R7Z H;  3PUY A;  4AYB E;  4B3T Q;  1D7Q A;  2HHH L;  2JA6 H;  1HJP A;  1E24 A;  3PCO B;  2E5L L;  1IBK L;  2UUB L;  2UU9 L;  4B3M L;  3CCM A;  4LFB L;  2K4K A;  3HFZ B;  4DV5 Q;  1IZ6 A;  4YHH Q;  3RZO H;  1YNX A;  2UXB Q;  2R92 G;  3I4M G;  2R6G A;  3TRZ A;  4BBS H;  2PI2 E;  4DR3 L;  2EQS A;  4HJA A;  3A74 A;  2K5N A;  3KJP A;  1RIP A;  2AKW B;  3LGJ A;  4GOP C;  4Y7N H;  2E2J H;  4JG2 A;  1CKM A;  4JI8 L;  3RNU A;  4GKK Q;  3JC6 6;  1TWA H;  5GRO A;  3PF4 A;  2R92 H;  3J80 i;  3I4M H;  4NXM L;  4A3G H;  3KDF A;  1GVP A;  3J81 j;  3CC4 A;  1VQ9 A;  4DUY Q;  2UXD L;  2FXQ A;  4YWL A;  4DR4 Q;  3CXC A;  1KHI A;  3F2B A;  2K52 A;  2UUA L;  1BBU A;  4LF6 L;  1YEZ A;  1KAW A;  2OQK A;  1XPU A;  3GTJ H;  3H3V I;  2AWO A;  3CAM A;  1JT8 A;  4UP9 A;  2B3G A;  3GTP H;  2NZH A;  4OX9 L;  3W1B A;  4DV2 L;  2I5M X;  2K14 A;  1CKN A;  3PF5 A;  5LMU L;  3RN5 A;  4BY1 G;  3CCS A;  1R9T H;  2Q2I A;  5IWA Q;  4DV6 L;  3G4S A;  1PFS A;  2JA5 H;  4IPC A;  1M90 C;  1GO3 E;  1JJC B;  3KF6 A;  4JI3 L;  5JEA G;  1EQR A;  4IPG A;  4DV3 L;  1SRU A;  4K0K Q;  1PH8 A;  2IT1 A;  3K7A H;  3VDY A;  1V43 A;  1HNZ Q;  3EIV A;  1YHQ A;  1WCM G;  4LF8 L;  3U50 C;  3PIP A;  4B3R L;  2ZJP A;  3RZD H;  3PUZ A;  4JI1 L;  3I4O A;  3CC7 A;  4IJL A;  2F4V Q;  1TXY A;  3J81 i;  4ALP A;  4LF4 L;  3T1H L;  2VUM G;  5GAD C;  3I2Z A;  5M5W H;  3L7Z C;  4A3K G;  1OXU A;  1WCM H;  1X9N A;  2QEX A;  1CSP A;  5GAE C;  4JI0 Q;  2YU9 H;  1SN8 A;  1V9P A;  3M4Q A;  4JOI A;  2D62 A;  3AFQ A;  1EOV A;  4MNO A;  3CF5 A;  2QA4 A;  2MO1 A;  2BH2 A;  4YWK A;  2VUM H;  1Q46 A;  1PVO A;  4DNI A;  4A3K H;  3PUX A;  4NXN Q;  1N9W A;  1O7I A;  2LXK A;  3BJU A;  4TQU S;  2WAQ E;  2XGT A;  3CCJ A;  3HOX H;  5M3F H;  3J7Z C;  4LW1 A;  4NB3 A;  3CQZ H;  2RCN A;  4RMF A;  5EAY A;  3CMA A;  1JB7 A;  1X65 A;  2KHJ A;  2KEN A;  1LM0 A;  1VQK A;  1IBL L;  3CCL A;  2DUD A;  3KDF B;  3K7U C;  4A3J G;  1HNW L;  1NMF A;  1K8A C;  3K8A A;  4GLX A;  5IP9 H;  3T1Y L;  3TS2 A;  1N32 Q;  4X66 Q;  4YCW A;  1VQP A;  1X56 A;  1XMQ L;  3UE0 A;  3IRB A;  2D0P A;  3ER0 A;  1WJJ A;  4X65 L;  3AEV A;  4A3J H;  5C0X I;  5IYD H;  2E8G A;  1J5E Q;  1K0R A;  1S3O A;  2UXB L;  4YHH L;  2ZM6 L;  1CKN B;  2JE6 I;  3CCU A;  1PV4 A;  1X3E A;  3GTQ H;  4DR7 Q;  2BA0 A;  2WB1 E;  1N34 L;  1HNX L;  4OO1 G;  4BBR H;  4HJ9 A;  4LUZ A;  2BH8 A;  1I94 L;  1I50 H;  3KF6 B;  5JJI A;  4GKK L;  3W1G A;  3CW2 C;  3H15 A;  4YWM A;  1E7Z A;  1MJC A;  1PH7 A;  4GN5 A;  4JI7 Q;  3HOZ G;  2ZTC A;  2N78 A;  2ZTE A;  1QZH A;  4BXX G;  4AH6 A;  4X64 Q;  1Q12 A;  4JBM A;  2OWO A;  2XTI A;  3AFP A;  4A3E G;  3PUW A;  3KLW A;  4A3B H;  1XNQ L;  4TVA B;  5C4X G;  4IPH A;  3A5U A;  3G48 A;  4AQY Q;  2JEA I;  3CPW A;  1Z47 A;  1OXT A;  5M5Y H;  5IYC G;  4IOC A;  1VQM A;  3PO3 G;  3HOZ H;  3S1R H;  2C35 B;  1Q81 C;  4LFA Q;  5E7N A;  3AQQ A;  4KLK A;  4OON A;  4DAY B;  1PYS B;  1HR0 L;  1ASY A;  5IWA L;  2B29 A;  1PYB A;  1HZ9 A;  2N8N A;  4LUV A;  3MEF A;  4C2M H;  5IE8 A;  5IYC H;  3TEH B;  5BR8 L;  4XIG S;  1N33 Q;  4BBS G;  1LUZ A;  2HIV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...