2EXDA

The solution structure of the c-terminal domain of a nfed homolog from pyrococcus horikoshii
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
74
structure length
74
Chain Sequence
RRETTDIGGGKYTFELKGKVGKVVKIAEDHYLVEVEGDKWIAYSDEKLSLGDRVMVVDVDGLKLKVKRIPPQLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The solution structure of the C-terminal domain of NfeD reveals a novel membrane-anchored OB-fold.
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Membrane protein
molecule keywords nfeD short homolog
total genus 6
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2005-11-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2exdA00
3F1ZA 1IBLQ 1OTCA 4P71A 4QL5A 4YY3Q 1D7QA 3CCLA 4J15A 3PUZA 2VUMG 4JI4L 1O7IA 1EYGA 1V43A 1TWFH 3K7UC 1SN8A 4LF9L 4JBMA 1HR0L 3PSIA 1HNWL 2K5NA 5C4JH 2ZTEA 4L5TA 1VQDA 1Y1VG 3HOWH 1U0LA 3K80C 3JAMc 3UDGA 1L1OA 4UPAA 2A1AA 2WB1G 1FL0A 3E0EA 3AYHB 4X66L 2IHEA 3DLLA 4DV2L 2IX0A 4DV6L 4GNXB 2B3GA 4NXNL 2JA6H 3AFPA 3HOZH 2R93G 3LGJA 4OONA 4R4TA 5JEAG 1IBML 2V1CC 4IPHA 4LF5Q 4PZ6A 1SRUA 2VQFQ 4A4IA 4UP7A 4DV1Q 3GTPH 5JJLA 4A3BG 3U50C 4DR5Q 4GKJL 1VQCA 4GLVB 2ZTCA 1WJJA 1X3FA 4AYBG 4A75A 1SMXA 2AWOA 4LFBQ 1E24A 1Q8KA 1E1TA 1E7ZA 1SE8A 2UU9Q 3HOYH 2MO1A 1MIUA 2JK8A 3H0GG 4JBKA 5J3BA 1PH9A 3PO2G 1Y14B 1HZBA 4YHHQ 3GTKH 4DV3L 2K5HA 4HJAA 1OXSC 4IJLA 5IYDG 2JA8H 1PHJA 1VQPA 3KDFA 4DNIA 3H15A 1CKMA 2PQAB 5LMNW 3EIVA 2NVTH 1ASYA 2E5LQ 1JJGA 4YHHL 3S2HH 2F3IA 2HT1A 1J5EL 5IP9H 2I5HA 3GO5A 1MJEA 4UY8C 1NE3A 1YBYA 3GTLH 5C44G 1IBKL 3RZOH 2WFWA 2VQEQ 1Q86C 1K9MC 5FLXc 2QA4A 5ELOA 2NVXH 1X6OA 1TXYA 1VQHA 2B29A 3RLOA 1HZCA 3CF5A 2KHIA 4AQYQ 4B3SL 3I4NH 4DAMA 1N36L 3CD6A 3G6EA 1S40A 2CQOA 4DK6C 3GTJH 4ALPA 3J80c 1NMFA 3NENA 4LF4L 4PZ7A 4WJ4A 3K0XA 2K52A 1UE1A 1WFQA 1VQKA 4LWCA 4DPGA 5E7NA 1G6PA 4X66Q 4DR1L 4YCVA 4IFDG 1YHAA 2FXQA 4DV5L 2UXDL 2R92H 1GKHA 2HIVA 1YNXA 1X54A 3S1QH 1A63A 1LYLA 2RF4A 3TEHB 2RHQB 5IWAL 4HIDA 4K0KL 4X6AH 3S24A 3H3VH 5M3MH 4JI0L 2OWOA 1PH6A 4BBRG 3FKIG 3KJOA 3CCSA 1I3QH 2BH8A 2EIFA 3GTQH 4GNXC 1KD1C 1GM5A 3GTGH 1JJCB 5JJKA 1NMGA 1PVOA 3CAMA 4A3LH 3L7ZC 5FLMG 4PG3A 1K8GA 4A3CG 5LMNL 4H02A 4DUZQ 3T1HL 4IO9A 5EAYA 1XNQL 1N34Q 5C0XJ 2VL6A 3CP0A 4GLXA 4B3TQ 2JA9A 1XMOL 2L15A 5IY0A 2N8NA 4DUZL 2KENA 1YEZA 1B8AA 3PUWA 4QIWE 4R4QA 1YIJA 3CMEA 1E3PA 5LMUQ 4GOPB 2Q2IA 1S72A 4JI3L 1HNXL 1VQFA 4NXML 3I2ZA 3RLNA 5HGQA 1QVGA 1KC8C 2Q2TA 1S3OA 3I56A 4O2DA 4AH6A 2VW9A 4L5SA 1VQNA 1JE5A 1RIPA 1K83H 3I4OA 1FGUA 3D31A 2R6GA 3ERSX 4IOCA 3AEVA 2CKZB 1BVSA 4A3DG 1OXVA 4B3TL 3K81C 1EIFA 3I4MG 4BBRH 1EFWA 2HIXA 1L0WA 4JC0A 3J7A5 4DR4L 4BA1I 3UE1A 5LMUL 2PMZE 2NZOA 3I55A 1YHQA 2ES2A 4JI3Q 2CFMA 4GN3B 4IFDJ 2Z0SA 4LF4Q 4FDBA 3PUYA 5GAEC 1X3GA 4HIOA 3AFQA 4L5RC 1C0AA 1YJNA 1N34L 4B3RL 3NEMA 1HR0Q 2IY5B 2VQFL 2OCEA 3U58A 3KDFB 2RHSB 3HOZG 2R93H 2GN5A 2JA6G 1Q7YC 3MEFA 3AQQA 2ZM6Q 4UP8A 1PA6A 1NJIC 4DV6Q 1PH1A 3I4NG 2AHOB 2OQKA 4LF7L 1GVPA 4A3JG 2F4VQ 1VQGA 1Y1VH 2YV5A 1KQSA 4JI7L 4KI0A 3G4SA 1Q82C 4LFAL 4OWXB 1GO3E 1M1KC 2N3SA 5AJ3Q 1FJGQ 1XNQQ 3PUVA 2UUCQ 5H1SE 2Y0SE 1LTLA 3KF8B 4JOIA 2YTXA 4DAYB 1KL9A 4TQUS 3J80i 2KCTA 3S14H 2E8GA 2ZTDA 4DR2L 1HNZQ 3KOJA 2H5XA 1UWVA 1EQRA 1X65A 2CWAA 3UDXA 2ZM6L 3TS0A 1P8LA 1N36Q 2UU9L 4GKKQ 3PUXA 2R7ZH 3HOXH 4XTCS 2LXJA 5M3MG 4EQ5A 1JB7A 5M3FH 3UDFA 1PH5A 3PGZA 1NBWA 3HFZB 3MXNB 1XJVA 1SLJA 1VQMA 1PV4A 1WCMH 1M90C 4GKKL 1WCMG 3BZKA 2UUAL 2Z6KC 1MKHA 1I94Q 3I4MH 4QQBX 2E5LL 4MZ9A 5M3FG 4C3JH 3OTOQ 1IBKQ 4GN4B 4OX9L 5GADC 4DUYQ 4DV0L 1ASZA 3T1YL 3D0FA 4B3ML 1EIYB 1KRTA 1QVCA 3CC7A 3HOWG 1UEBA 2PI2E 5M5WH 3BU2A 4BY7G 4IPGA 1KHIA 1E22A 1N9WA 3UDIA 3FP9A 3CCEA 3RZDH 3EBEA 2I0QA 2UXBL 1IYJB 1AE2A 4ME3A 4NB3A 5C44H 2E2IH 4LFCQ 1N33L 1H95A 1Q12A 1TWHH 3I7FA 3KJPA 3ULJA 1RL2A 2Z6KA 4OWWB 3T1YQ 1UE5A 2JE6I 3STBD 4BA2I 1N33Q 2JA8G 5IYDH 3NELA 4GLAC 2YTYA 4JI5L 1IZ6A 2D0OA 3JAMi 4DV4Q 5HY6A 3H0GH 3HOYG 2JQOA 1K0RA 2WP8J 2JA7H 2WAQE 4R4OA 1U5KA 4P73A 2JA7G 1N32L 1LUZA 3GD7A 4DV2Q 1PFSA 4JI2Q 4R4CA 1QZGA 4RG1A 4DUYL 4DV0Q 2LSSA 2OTLA 3GTOH 1JT8A 2I5LX 3HOXG 2AWNA 2VY3A 2ZJQA 3J7ZC 5IT9c 4P74A 1XPOA 4LF6L 1UE7A 2B63G 3H3VI 2MFIA 1E1OA 1HZAA 5LMNQ 1I94L 5M5YH 1BBWA 1CKNB 5IP7H 1K3RA 4KLKA 1AE3A 1NTGA 2JEAI 4C2MH 3G71A 1VCIA 2R7FA 4LW1A 3F2DA 1TWAH 4DV7Q 4KHZA 2YU9H 3ER0A 4A3EH 4AYBE 4A3FG 3CCUA 4A3EG 3CCVA 3S1MH 2YYZA 4BY7H 1L1OC 2D62A 3CPWA 1YVCA 4A3JH 2HQLA 1TWCH 2DUDA 1AH9A 2VUMH 4JG2A 1D8LA 5BR8L 2YTVA 1IXRA 2JEBI 1VQEA 4YY3L 1XMQL 1KRSA 2OTJA 4DR3L 1YI2A 3PO3G 3Q8DA 3KF6A 4QY7A 3W1BA 2QGQA 2NVYH 1CUKA 4A3LG 1Q1BA 4POGA 4JI7Q 3FKIH 2VNUD 3HKSA 4YCWA 1Y1WG 2XTIA 3IRBA 4YWKA 2N49A 4POFA 3RN5A 2UXCQ 4YWLA 4C3HH 2LXKA 1PH8A 2HHHQ 3CXCA 1EOVA 1YHBA 2NN6G 4GS3A 3DM3A 3SGIA 4JI6Q 2R7ZG 1VQIA 2NZHA 2D0PA 3TQYA 4PZ8A 4B3RQ 5GAGC 4DR7L 2K50A 4TVAB 4JV5Q 1MJCA 4BY1H 3F8TA 2NVQH 1WYDA 2JJQA 1G51A 1VQ9A 2VZAA 4GN5A 3HKZE 2AMCB 1QUQA 1I6HH 1N32Q 4AQYL 4A3KH 3S15H 3ULLA 3CMAA 1I50H 1X3EA 2WB1E 3OYYA 2C35B 4JOIC 3CCRA 4X64L 5C0XI 4BBSG 3E9HA 1WOCA 2Q2HA 3KF6B 3RLFA 1A8VA 3A5UA 2VS1A 3PIOA 4R1JA 1B7YB 1XPUA 2IX1A 3B6YA 4A3GH 1EWIA 3CC2A 4WJ3M 5GROA 4C3IH 4LFCL 1PYBA 5FJ8G 3PCOB 1YJWA 2K75A 2RCNA 1YZ6A 3W5OA 5BR8Q 4JBJA 1KAWA 4GKJQ 4IJHA 2BH2A 1OXUA 3TREA 5ELNA 3CC4A 5JJIA 3CW2C 2KCMA 3L2PA 1FVIA 3KLWA 2BA0A 3PIPA 4Y7NH 1PH3A 3TS2A 2R92G 1VQLA 4DR3Q 3M85A 1CSPA 5GQOA 1HNXQ 4A3BH 1FJGL 5IYBG 2KBNA 1T9HA 4A3DH 2F52A 1W3SA 4NXNQ 1UE6A 3RR5A 2ASBA 4A3MG 2UUBL 2EQSA 4MNOA 1IL2A 1BKBA 3EN2A 1Q46A 4JI1L 3W1GA 4JI0Q 1HJPA 1HNWQ 4LUOA 1GD7A 4DV5Q 4AIMA 5C3EG 2UXDQ 4QJFA 3CQZH 4A3IH 1K73C 3HOUG 5C4XH 4HJ5A 3UE0A 4DR2Q 1HNZL 4JYAL 1VQ6A 1V1QA 5IP9G 4HJ9A 3S16H 2CCZA 1IBLL 2I5MX 3GTMH 4A3CH 3CCQA 4XIGS 4HJ8A 1C7YA 5IE8A 1K8AC 4R4IA 4DV7L 4RMFA 1CKOA 4A3IG 4GNXA 2JA5G 1DGSA 3PF4A 2HHHL 1HR0W 2R7DA 4DK3C 4JI6L 4A3KG 1XTDA 2IT1A 2GVAA 2XGTA 3ZJYC 1QZHA 4DR6L 4QGUA 4JBWA 2K4KA 1L2FA 4DV3Q 4HIMA 5IYBH 1W2BA 4LF5L 2CWPA 1G291 4JI1Q 5C0XG 1OXTA 4GOPC 1PH4A 2Y0SG 1KIXA 4LF7Q 1VQ5A 2F4VL 4DR1Q 4BXXG 1TWGH 1VQBA 1Z9FA 1EQQA 2MQHA 1Q81C 3J81i 3S2DH 1PYSB 3M9BA 4EX5A 4GOPA 2PNHA 3RNUA 4LFBL 1PH7A 3PF5A 2NN6I 3M3YH 4DV1L 4DR5L 4OO1G 2KHJA 3K8AA 3PV0A 5M5XH 1B70B 4UP9A 4B3SQ 4LF9Q 5FJ8H 3M4OH 4HJ7A 4A93G 1I5FA 4X62Q 1KXLA 4NXMQ 4OX9Q 2UUBQ 2GVBA 1XNRQ 4JI8Q 4KHPL 3L0OA 4A3GG 5FLMH 3NBHB 3RN2A 4OO1I 5C4XG 1P16A 4X62L 4JYAQ 3U4ZA 3HOUH 4DV4L 3A0JA 4PMWA 1VQ4A 1PH2A 3GDEA 2K14A 1XMOQ 4JI8L 4KHPQ 1BBUA 4OXPA 3PO2H 2AKWB 4YCUA 3M7NA 1SR3A 1SROA 1IBMQ 4YWMA 1V9PA 4JI2L 3J81j 4LNQA 4DR7Q 4JV5L 3BJUA 4LF8L 5GAHC 4A3MH 4MTNA 1XNRL 2PI2A 1HH2P 1OXXK 2MO0A 4LUVA 3OTOL 2Q2UA 4A76A 4IPCA 4LUZA 4JI5Q 2UUCL 1VQJA 5JEAJ 2E2HH 3STBC 1QVFA 4B3MQ 4DR6Q 3JC66 3HOVH 5K36G 1QUQB 1VQ8A 4IFDI 4JI4Q 2A19A 2BA1A 2ZJRA 2A8VA 1VQOA 2VQEL 3ULPA 2JA5H 1SFOH 3KFUA 2K5VA 3S17H 1XMQQ 1Z47A 2ALYB 4DKAC 1R9TH 2WAQG 4DR4Q 4P75A 1NY4A 4X65Q 3HKZG 3S1RH 4O0AA 2QEXA 3PO3H 5IWAQ 1LM0A 4K0KQ 1CSQA 3M4QA 3CCJA 2N78A 2ZJPA 5DLQE 3T1HQ 3OW2A 1JJ2A 3F2BA 1C9OA 5IYCG 2ATWA 1VQAA 1A62A 5C3EH 1WI5A 1VQ7A 4BBSH 4A93H 4L5QA 1XPRA 3S1NH 3FHWA 4X64Q 3BZCA 4A3FH 2PQAA 4APVA 2E2JH 1A0IA 2UXCL 2UXBQ 3WWVA 1N8RC 2EXDA 1X9NA 2MNAA 3U4VA 3KYHC 1J6QA 5AJ3L 5IP7G 2UUAQ 1X55A 3J81c 1Q1EA 3HOVG 4IOAA 4LFAQ 4BY1G 4BXXH 3A74A 2B63H 3M4PA 1JMCA 4JCVE 2ID0A 3VDYA 2IHFA 4NPSA 4HIKA 3K7AH 3E9IA 4LF8Q 4X65L 3CCMA 1CKNA 1Y1WH 4OWTB 1J5EQ 3F2CA 1EUJA 1X56A 4Y52H 3TRZA 2DGYA 1YITA 1HZ9A 2OQ0A 4IPDA 5IYCH 1L1OB 3G48A 3ICEA 1YJ9A 4LF6Q 3A5ZB 3CPFA 4P72A 1VS0A
chains in the Genus database with same CATH superfamily
4DAYA 1IKMA 3NK9A 2FHTA 3PUZA 3NSWA 1EYGA 2JA7B 1HR0L 3HOUB 1HNWL 1KLGD 2K5NA 4L5TA 3R8BA 4DXFA 3AYHB 4X66L 4DV6L 4GNXB 2IX0A 2B3GA 2F0HA 4NXNL 2JA6H 3S14B 3DHQA 3HOZH 4S3SA 3LNNA 3LGJA 4OONA 1IBML 2V1CC 5C5LA 4LF5Q 1G91A 4RKBA 4G7OC 1YNJD 4DR5Q 4GKJL 2ZTCA 1X3FA 3MVVA 5IGCA 1BCPF 1I4HA 2AWOA 1E1TA 1SE8A 2EPBA 3VR5A 4EGVA 2OT2A 3OSOA 2EY2A 2J0TD 5IGDA 3GTKH 4CJ2C 4HJAA 1OXSC 4IJLA 5IYDG 1M4VA 1CKMA 4C3IG 5LMNW 4K6LA 1JJGA 1EY8A 4XT3B 1J5EL 3GO5A 4UY8C 4X3TA 2VQEQ 1LTSD 5M3MB 1VDZA 2B29A 4DGZA 1S40A 4DK6C 2F0JA 4A3IB 4LF4L 4WJ4A 4HCSA 2F0PA 5E7NA 2K6AA 3K7AB 1HXYD 4OIJA 4X66Q 4UDUC 4DV5L 3G6JB 1FNVA 1SEBD 3BS1A 3EJIA 4HIDA 3SE0A 4G7ZC 5M3MH 1PH6A 3KJOA 4CDFC 1ENCA 2BH8A 2A69C 4GNXC 1KD1C 1GM5A 1PVOA 3CAMA 5DNFA 1EOTA 3L7ZC 2JSOA 2F1MA 4V190 3K59A 1K8GA 1J9OA 5LMNL 4H02A 4DUZQ 2K01A 1CFMA 4IO9A 1N34Q 5C0XJ 3CP0A 3KLSX 2JA9A 4X3KA 2N8NA 3D6WA 4DUZL 4XQJA 2KENA 1YEZA 1UUPA 3DMUA 1WTRA 4R4QA 1EIHA 5LMUQ 5CV8A 1VQFA 3X3NA 1C0AA 3I2ZA 4AH6A 5FLXL 1PZID 1JE5A 2EXZA 5KRUA 3I4OA 3AEVA 3ERSX 2CKZB 4ID6A 3RUZA 4B3TL 3KLRA 1R4QB 2B2TC 4WRDA 5M3FB 5FO8B 3TSSA 2PMZE 3VYTA 3I55A 2ES2A 2F0KA 4BBSB 3I3CA 4IFDJ 1EY5A 1U4MA 4FDBA 1AW7A 2VB3X 3HEJA 2OCEA 3U58A 3KDFB 2R93H 1L0XB 2GN5A 4H44C 3MXNA 2ZM6Q 1PH1A 3I4NG 5ELEA 4CDDC 1VQGA 2YV5A 3OWEB 1IW7C 2A74C 1FNWA 4KI0A 1PTOF 2AQ1B 2E2DC 1PXUA 1GO3E 3V2TA 1TWHB 2N3SA 4K6DA 4EQPA 5D14A 1KL9A 4OELB 3DWQA 2E8GA 1HNZQ 4DN4M 1UWVA 1EQRA 1X65A 2JXMB 3T51B 2LXJA 2XVSA 5M3FH 5IT9L 4KJNA 1XJVA 2NB0A 2EYJA 1SLJA 4LMQD 1WCMG 3BZKA 2UUAL 2RVLA 1R4PB 2E5LL 5C4HA 3OTOQ 1E2WA 3RD4A 5KEEA 5A2QL 1IBKQ 4OX9L 4QF4A 2L55A 2NVYB 4ZYSA 1CT1D 4DUYQ 1ASZA 2DJFC 2EYPA 4B3ML 2CH4W 5AFWA 4XQQA 3VYUA 1STYA 1EIYB 2QF7A 4IPGA 1N9WA 1F2MA 1IYJB 5C44H 1I6VC 5LL6S 1CZGA 1Q12A 1TWHH 3EROA 3I7FA 1SYCA 4OWWB 2EDGA 2RQXA 3T1YQ 2CHBD 3NTKA 3LWUA 2B2UC 2VXWA 5DM73 2B2WC 4LJZC 2JA8G 2H4OA 3NELA 3J81L 2YTYA 1B1ZA 1TS2A 1IZ6A 4CJ1B 3GTPB 3J80L 5HY6A 1K0RA 2F0OA 1DD2A 4ZRZA 4CHTB 1GUOA 4JI2Q 4R8NA 1AZQA 4ZLTF 2LSSA 2OTLA 3MHBA 4QIWB 3HOXG 3J7ZC 4K5WA 4B08A 4LF6L 4RGMA 4ZAIA 3K57A 1DOLA 5M5YH 2B2VC 5ELBA 2JEAI 1AE3A 1NTGA 2MHVA 1SNCA 4C2MH 2CW0D 3F2DA 4LW1A 3D3RA 2PQEA 2BCOA 4NP5A 4A3EH 4AYBE 3CKIB 3CCUA 3CCVA 3S1MH 2E74C 4BY7H 4A3JH 3IAYA 2HDMA 1ENAA 2VUMH 4JG2A 1WTVA 5J22A 1PYWD 4YY3L 2RBMA 1XMQL 1LLRD 1KRSA 2OTJA 4DR3L 1K8MA 5CORA 5E1FA 3VR6A 4JI7Q 3BVMA 4RFBA 2VNUD 1IHZA 1VMCA 1HPCA 1H9MA 1EOVA 3DM3A 4IUUA 4FF4A 4DR7L 2IW3A 2N55A 4OL7A 2EJGC 2NVQH 1WYDA 2JJQA 3NTIA 1VQ9A 3HKZE 1N32Q 1CA6A 2MUYA 3ULLA 3TN2A 5C0XI 4FXGC 1B3AA 5KNDA 3NHHA 2Z8LA 3OHXC 3B6YA 1HA6A 1S5ED 4LFCL 2PO4A 5KIXA 3PCOB 1TVXA 3A7AB 4IJHA 5C3XA 1MSHA 2BH2A 5A35A 4R8IA 3CC4A 1PZKD 3I90A 3KLWA 1HTPA 1PH3A 2HD3A 4A3GB 4ZQ3A 3MZ5A 1LT3D 5GQOA 4MTKA 1GHKA 5FK9C 3L9AX 2KBNA 2F52A 3SK6A 1W3SA 4KD4A 1UE6A 3RR5A 4X3SA 4NXNQ 2ASBA 2E2JB 2UUBL 4K5VA 1STGA 2K28A 3MWYW 1JWMD 1ET9A 3HZXA 4JI0Q 3FKIB 3QOJA 4LUOA 4IUPA 4A3IH 3UE0A 4DR2Q 4IALA 1C4QA 2B8FA 2F0WA 1V1QA 5I6WA 3FMCA 4PMCA 5DEHA 1B53A 5IE8A 2F0GA 1CKOA 4IURA 4GNXA 2JA5G 2D5DA 4RGTA 3Q6SA 2BE5C 4DK3C 3AMUA 3OMCA 1BBXC 4XT1B 2Z4HA 3C2PA 2GVAA 4DR6L 5IYBH 2IPKD 3I4LA 4ME5A 4RCNA 1BR9A 1KAAA 4FVMA 3S2DH 3URYA 3GTJB 4DR5L 3K8AA 1Q8IA 5BN5A 5M5XH 4UP9A 1KDBA 5T1IA 1I5FA 1EYDA 1JOKA 1QWYA 1T5EA 1W6JA 4RH6A 4JI8Q 5FLMH 4A3GG 3RN2A 3HOUH 3GDEA 1AP0A 5JPMC 4JI8L 1RTNA 2Q8RE 2AKWB 4YCUA 1XYIA 1IBMQ 4QUCA 4YWMA 2EYOA 4JV5L 2D9UA 3J81j 2EY5A 3E5SA 3BJUA 2Z1CA 4MTNA 1EZ8A 4HEDA 2PI2A 1OXXK 2MO0A 2B2UA 2PZUA 2IJ0A 4LUZA 3A54A 1A2UA 3QG1A 3STBC 4HSVA 4DR6Q 1A3UA 4A3KB 5CYUA 1EU4A 2VQEL 2A6ED 3KFUA 1PRTD 2WAQG 4QCLA 4P75A 5DAUA 5HGTA 4RHRA 3S1RH 2QEXA 4H7BA 2C5CA 3A8KE 1JJ2A 3F2BA 4A93B 1SE3A 3W2DA 3FHWA 2MNAA 1HTLD 3U4VA 3MFYA 1J6QA 5M5WB 5AJ3L 1BF4A 4BY1G 3M4PA 5JEAH 2QDBA 5FOBB 3U9SA 1NAPA 1CM9A 1Y1WH 4OWTB 1X56A 1K83B 1JCKB 2DGYA 1YITA 3G48A 2TSSA 3EA6A 1CK1A 4P72A 4P71A 4QL5A 1D7QA 2VUMG 4JI4L 1V43A 1TWFH 4JBMA 1S5CD 2EOTA 3T16A 2ENBA 1Y1VG 4IZ8A 2A1AA 4F87A 1FJGQ 3DLLA 2N88A 4CDCC 4P2CB 2R93G 1I3QB 4OIKA 4A4IA 5IGEA 5JJLA 1SE2A 1WJJA 3FPUB 2NTTA 1SMXA 4LFBQ 2K32A 3HOYH 2MO1A 1MIUA 3PO2G 1Y14B 2K1BA 1HZBA 4DV3L 1K8OA 2LKVA 3PIP3 1PHJA 1VQPA 1H9SB 1A3TA 2PQAB 1JR0D 2E5LQ 1JICA 2F3IA 2O2LD 1WCMB 5IP9H 1G6ZA 2B2WA 1NE3A 3GTLH 1IBKL 1Q86C 2NVXB 4OO1H 1KNAA 1F9QA 4N8X1 2FMCA 5J1ZA 1TXYA 5JJZA 1HZCA 1CQFA 4PV1C 4AQYQ 4DAMA 2NUCA 5C3WA 2ICEC 3GTJH 2EJMA 3J80c 3DEPA 1NMFA 4HR7B 5C0XH 2JYOA 4LWCA 1G6PA 4DR1L 5NUCA 1HHVA 4IFDG 2UXDL 1X54A 4FF2A 2B8GA 3S1QH 2RHQB 3H3VH 4QB4A 1K0SA 2X6LA 3FKIG 4C3HB 2EIFA 5JJKA 2Q8IB 3C1FA 4Y7NB 4A3LH 5FLMG 1IW7D 4PG3A 3WOFA 4RAUC 3T1HL 1XNQL 2VL6A 3MXPA 4GLXA 4B3TQ 1XMOL 2L15A 3DEOA 4EVOA 2HCIA 1YIJA 1E3PA 1TY2A 3VR2A 3S1NH 1QVGA 1KC8C 3I56A 2O4XA 2FJ2A 1RIPA 2LS01 1I4RA 1FGUA 3DXJC 1BVSA 5ISRA 3OOCA 3S1RB 3I4MG 1SYBA 3V96A 3SEBA 4BBRH 1EFWA 2HIXA 3J7A5 4DR4L 4BA1I 5I2XA 4JI3Q 2NZOA 1SAPA 1EY9A 1SNDA 3NQIA 4GN3B 2R3ZA 2RA4A 1JOOA 5I9PA 5GAEC 4HIOA 4L5RC 3AFQA 4CKCA 3IFDA 1DOKA 1MSGA 3NQTA 4B3RL 2VQFL 4ABNA 1QE6A 2JA6G 3PMFA 1B44D 5KYIA 4ZUIA 2DY7A 1Q7YC 3MEFA 1GUTA 1CI3M 4A3JG 1UNSA 4JI7L 4KJOA 3H94A 1M1KC 1MI2A 1XNQQ 2UUCQ 1DJRD 2WIIB 1C8CA 1H9KA 4DAYB 1LTLA 2NWGA 4JOIA 3OMGA 1R9TB 2KCTA 1JC7A 4DR2L 3KOJA 1HNXL 2CWAA 1G2TA 3HOXH 4EQ5A 1JB7A 1U4LA 1PH5A 4J6HA 3PGZA 1PRTB 1QNUA 3HFZB 1PV4A 1BCPD 4FXKC 1M8AA 2JN4A 3VA5A 1I94Q 3I4MH 2SOBA 1WTOA 1CHQD 1K28A 3T1YL 3D0FA 1PTOB 3NXWA 1PTOD 1WTHA 1BUVT 4CJ0B 3D4WA 1QVCA 1Y69U 3HOWG 1GUWA 3BU2A 1KNEA 3CCEA 3D8GA 1AE2A 2F0DA 4ME3A 4U673 4LFCQ 1ET6A 3ULJA 1RL2A 1XTCD 2JA6B 3HOYB 1F9SA 1SYDA 2SNSA 4BA2I 5IYDH 4KMUC 4TSSA 3M3YB 2D0OA 4DV4Q 4C3HG 3H0GH 1RCVD 5KNCA 2WAQE 4R4OA 4P73A 3J80E 2JA7G 4DV2Q 4DV0Q 4IUQA 4JPBW 2EE1A 1TS3A 2XWBB 2VY3A 3HG9A 1XPOA 3H3VI 1HZAA 2EYLA 1I94L 1CKNB 4CGYB 1AEXA 3G71A 2R7FA 1TWAB 1LV9A 5CMDA 2YYZA 2D62A 3CPWA 2SDFA 5C44B 1AH9A 5FLXE 1QILA 1D8LA 2XSCA 1H9RA 1VQEA 3GTMB 3MXUA 3ONAB 1YI2A 3PO3G 1II3A 4DK0A 3ND8A 2K5DA 2DJGC 2F0SA 3FKIH 1GUSA 2A6EC 3NE5B 1JOQA 3IRBA 2BE5D 3A8IE 1V1PB 4KKTA 4POFA 3RN5A 4YWLA 3NTHA 1PH8A 4OGQC 1VMPA 3SGIA 4G7HC 3I4NB 2EY1A 2NZHA 4PZ8A 3VYSA 4JV5Q 2K50A 4TVAB 5FO7B 3F8TA 2AQ3B 1QUQA 1X32A 4A3KH 3S15H 2WB1E 3I70A 3KBGA 1Z6HA 3QOLA 4O1NA 1HQRD 2Q2HA 3KF6B 3RLFA 2J7ZA 3A5UA 2VS1A 1O7LA 3ERQA 1XPUA 4A3GH 1ILQA 1G8ZD 5GROA 1PYBA 4KY7A 5FJ8G 2RCNA 4Q0FA 1RD9D 4ODGA 4GKJQ 1OXUA 3TREA 5ELNA 3CW2C 2KCMA 3JAML 3S15B 2L12A 3L2PA 3TS2A 5K5PA 2R92G 3MAQA 5DM63 1WTXA 2WKDA 1FJGL 5IYBG 4K2LA 3MTSA 3Q0AA 4IUTA 1EZ6A 2R93B 4A3MG 3NWTA 1RJTA 1TQOA 1BKBA 5IGFA 1HNWQ 4DV5Q 4AIMA 1EYCA 3SK8A 1K73C 4DXGA 2ZXOA 4JYAL 3S16B 1Y8NB 5EPLA 2NTSA 3GTMH 3R3OA 4XIGS 4KD3A 1TWFB 4DV7L 3RZOB 4RA8A 3LWEA 4BWGB 1JQYD 3PF4A 1SYGA 4FNFA 5M5YB 5F2DA 4A3KG 4C2MB 1GHJA 3ZJYC 1W2BA 4LF5L 3BVGA 5FKAC 4JI1Q 5C0XG 4N9PA 4LF7Q 2Y0SG 1TR5A 1KIXA 2F4VL 2R61A 3KLSA 3J81i 3M9BA 2PNHA 3RNUA 1PFMA 5C6AA 1PH7A 3M3YH 1PZJD 2F0IA 2KHJA 2J4XA 3H0GB 3PV0A 4DNTB 3M4OH 4X62Q 2CW0C 4KV6A 1B3QA 4NDXA 3DUZA 2F0QA 4X62L 3U4ZA 4JYAQ 3QWNA 1DONA 2BOSA 1PH2A 2K14A 3SR1A 3PO2H 4IUVA 3OIPA 3M7NA 5E3FA 3MA2B 4TKOB 4JI2L 4WFN3 2L0CA 2K03A 4H13C 1TY0A 4R9WA 4A3MH 1XNRL 1ICFB 1NSNS 3O13A 4IPCA 2QILA 4JI5Q 5JEAJ 2L1BA 2E2HH 3R93A 3JC66 5K36G 3A56A 1VQ8A 2QW7A 5KGUA 2K5QA 1LTTD 1Z47A 2ALYB 1R9TH 4DR4Q 1EY6A 5C4XB 4G4KA 4O0AA 5CR3A 4RHSA 1GUNA 3BYTB 1E2VA 1F77A 2MGSA 3CCJA 2M2LA 2KHSA 2MJ8A 1A62A 4X64Q 2E2JH 2PQAA 4APVA 1A0IA 1X9NA 3WDNA 3PO3B 5IP7G 2UUAQ 5ELDA 5C5MA 1X55A 3HOVG 1Q1EA 3PQIA 4IOAA 3GV3A 2A6HD 1LABA 4DU9A 3A74A 2L9HA 2IHFA 4NPSA 3HS0C 4A3EB 1LT5D 4X65L 1J5EQ 1EL0A 1NR2A 2F0FA 1E2ZA 3QR8A 5CV9A 4IPDA 2OQ0A 4Q5VA 3M4OB 1YJ9A 4LF6Q 3A5ZB 3CPFA 1VS0A 4WJWA 1IBLQ 1EYAA 1OTCA 2Z9HA 3L3OC 3MFGA 1SMYD 1O7IA 4LF9L 1SN8A 1PRTC 1CQVA 3IL8A 3PSIA 1QG7A 1E0BA 2ICIA 2ZTEA 4ZK9B 1U0LA 3K80C 4BS9A 3JAMc 4UPAA 3UDGA 1FL0A 1SJHD 1ZYRD 3E0EA 1IYVA 1STBA 1EQTA 1SMYC 5IGBA 3AFPA 1NUCA 2NVTB 4R4TA 4XXEA 4PZ6A 1SRUA 2VQFQ 5D3IB 4UP7A 4DV1Q 1EIGA 5JOBA 1VQCA 4DA2A 1B2TA 1PFNA 1Z7TA 4A75A 2DNCA 1XX8A 1E24A 1Y1WB 2E76C 4JBKA 3H0GG 2K5HA 2KJXA 1V8QA 3HP3A 3KDFA 3H15A 4RGOS 2A6HC 2M00A 2NVTH 4CBVA 3S2HH 2HT1A 4U68A 1MJEA 2NBFA 5KNBA 3K6OA 3MXGA 2WFWA 1SBBB 1X6OA 4B3SL 3I4NH 1F9RA 4FP5D 3RLOA 2KHIA 4C56C 4ALPA 5EBCA 1I4QA 4KHVA 3NENA 1Q3LA 4PZ7A 5EPKA 2OXPA 3K0XA 1UE1A 3MC0B 2F3WA 4DPGA 3HOXB 2R7ZB 4YCVA 1YHAA 2E2IB 2MPMA 2R92H 4F8MA 3ND9A 1D5XC 2M9VA 1A63A 4X6AH 5IWAL 5EKKA 4K0KL 3S24A 4JW0A 1SFOB 3CCSA 1SNMA 4IFDH 3GTQH 5C4ZA 3GTGH 1JJCB 4MN3A 1AN8A 5I9OA 4DK1A 2ZXRA 4MHEA 4ZKCB 1SYEA 2EYMA 2R92B 2PZWA 3C3LA 2PCFB 3PUWA 4BY7B 3BVZA 3CMEA 3H91A 4XQNA 2Q2IA 4GOPB 4JI3L 3VA7A 3RLNA 4NXML 5HGQA 5JPNC 3S9WA 2VW9A 1FR3A 3VR4A 1TIID 3GTGB 1VF7A 1K83H 2B63B 2R6GA 3D31A 4IOCA 4C3JG 4X3UA 1I50B 2A73B 3K81C 1JWUD 1QOHA 1EU3A 4JK1C 1KTKA 4JC0A 3G7LA 1GOZA 2HCCA 1BOSA 1YHQA 5CV6A 2LFNA 1UAPA 4C1NI 4LF4Q 1YJNA 2F0LA 3NEMA 2JA8B 1KLUD 3TDQA 4HCEA 4CKEA 1BCPC 3FEWX 1I4XA 1PA6A 3AQQA 1SJED 1NJIC 1GVPA 1Y1VH 4KKSA 3G4SA 1Q82C 2Z4IA 4LFAL 4OWXB 1HRJA 4O42A 5AJ3Q 2K05A 3K0YA 1DOMA 3KBXA 2Y0SE 4DNIA 3S14H 1IKLA 2O5JC 3UDXA 2H5XA 4GKKQ 3FRPB 2Z6BA 1N36Q 2UU9L 4H0LC 3Q24A 2R7ZH 4XTCS 3V05A 1PTOH 3UDFA 1SNQA 1NBWA 3MXNB 4PMBA 3EFXD 4GKKL 1ICWA 1SE4A 1WCMH 1VQMA 5KYLA 4QQBX 4MZ9A 5M3FG 4C3JH 4DFAA 1PFBA 3EQLC 4GN4B 1EY0A 2BDOA 4DV0L 3SVMA 2IL8A 2X6GA 1UEBA 2F0NA 5M5WH 4BY7G 4I65A 1E22A 4OHJA 3RZDH 3EBEA 1ZEQX 2UXBL 1MD2D 4XYQA 3A7LA 1RKNA 1ZYRC 3SK4A 2SEBD 3KJPA 1A2TA 2Z6KA 5EPJA 4IN3A 1LACA 3STBD 1X3PA 2RDHA 4GLAC 1O7ZA 3P75A 2OEOA 1LT4D 3I91A 3HOYG 1N32L 1XWEA 1LUZA 3GD7A 4DF7A 3GTOH 3J81E 2DY8A 4XDXA 1JT8A 3K5MA 2AWNA 3HOWB 4JVZA 4P74A 1UE7A 2B63G 3BDLA 2MFIA 1ONLA 5LMNQ 1HFGA 3SHLA 2NZ1D 3SK5A 5IP7H 1K3RA 4KLKA 3S2DB 2LY7A 4LAAA 4WORA 4DV7Q 3AU7A 4KHZA 2YU9H 2QEJC 1TU2B 1A6XA 4F88A 1YVCA 2E75C 2HQLA 3FVQA 1TWCH 2DUDA 4G57A 5G3LD 5IGGA 1YNND 5BR8L 3R2TA 2F0EA 1IXRA 2JEBI 4C3IB 4ZKBB 4KKUA 3Q8DA 1QCBD 2RSNA 1LTGD 4QY7A 3W1BA 2QGQA 5E4XA 1CUKA 2ZT9C 3W3AA 1Q1BA 4POGA 2F0UA 1UEAB 3HKSA 5EBDA 2XTIA 1Y1WG 3P20A 2DN8A 4YWKA 1ML0D 4QUFA 1STEA 2N49A 4C3HH 1SSOA 2LXKA 2HHHQ 2R7ZG 2NN6G 2RDFA 3HKZB 3TQYA 1Y8PB 5GAGC 1MJCA 4BY1H 2XRQD 1G51A 3OIQA 1I6HH 2AMCB 2A68C 1LT6D 1RHPA 5EKIA 4ILWA 2EY6A 1I50H 3OYYA 4JOIC 3CCRA 1YNJC 2C35B 1GUGA 2G5DA 2YU9B 3X3MA 4OEMB 4KK7A 1WVLA 4KY5A 1A8VA 3QB3A 4HAEA 2OF1A 4C3IH 4WJ3M 1YJWA 4HMIA 2K7VA 2L5TA 3W5OA 5BR8Q 1KAWA 1LTRD 2EVBA 1I6HB 2GA4B 4N9TA 3K5NA 1DZ1A 4J8QA 1O78A 4PNYA 1FVIA 3QO2A 2BA0A 4QMGA 4Y7NH 2EJFC 1VQLA 5D3DA 4DR3Q 3M85A 1CSPA 5EGTA 2B2TA 2RDGA 1QNKA 1T9HA 1GJXA 1F2LA 3KF8A 2EQSA 4MNOA 2FMMA 3EN2A 1Q46A 2B39A 4JI1L 1D6EC 3W1GA 4B9WA 1G2SA 2UXDQ 1GD7A 1BCPB 4KN4C 4QJFA 3A55A 3HOUG 5C4XH 4HJ5A 1VQ6A 5IP9G 3VR3A 4EQNA 1BO0A 4M1UB 5CBEE 1SXTA 3NP8A 1PRTF 1VF5C 1C7YA 4I7AA 1DGSA 2HHHL 2F4IA 3GTQB 1DM0B 1W6KA 1XTDA 2IT1A 3CHBD 2XGTA 5ELFA 1QZHA 2K4KA 1HFNA 1L2FA 1S5DD 3H6MA 2QCPX 3ZYYX 4DV3Q 2PW7A 2CWPA 1G291 2SNMA 3TMEA 4Z9CB 1OXTA 4GOPC 4BXXG 3D4RA 1Z9FA 1EQQA 2MQHA 2XNAC 1Q81C 3HOVB 4N8FA 1PYSB 4LFBL 2KEEA 1WTPA 2NN6I 3D4DA 4DV1L 2IWHA 3N52A 5FJ8H 4LF9Q 4HJ7A 1KXLA 4OX9Q 1PMRA 1U9RA 2GVBA 2UUBQ 1QB5D 1XNRQ 3L0OA 2B2YC 5C4XG 4DV4L 3A0JA 1LTAD 4OXPA 3TBIB 1NCVA 4L63B 1HCZA 1DCZA 3CQZB 4K14A 1SDFA 1HH2P 2Q2UA 3OTOL 5JAVA 2B2YA 4RWSC 1XXGA 1L0YB 3LX0A 1MHWC 5CGKA 2UUCL 1VQJA 1MBYA 1QVFA 4ZUJA 1F2ZA 4B3MQ 2RCFA 1FYCA 3QJYA 1QUQB 4NMZA 1GXDC 3JAME 4JI4Q 2A19A 2X69A 1IL8A 2BA1A 2ZJRA 2A8VA 1S5FD 4DKAC 1NY4A 4X65Q 2XN9C 3HKZG 3PO3H 5IWAQ 4K0KQ 1JE4A 5L37A 2N78A 3Q23A 3FDTA 3T1HQ 3OW2A 1C9OA 2WINB 5IYCG 2ATWA 5C3EH 2HUGA 4A93H 4BY1B 4L5QA 4A3FH 2UXCL 3J7AF 1N8RC 2EXDA 3CU7A 2JP1A 1RTOA 3TZDA 2RSOA 3KUPA 3J81c 3DM1A 3UI2A 4A3MB 4LFAQ 5TSSA 4NW2A 1JMCA 4JCVE 3VDYA 1B9NA 3I73A 1NR4A 3GP7A 1JORA 1B4OA 3E9IA 3RZDB 4HN7A 2HDLA 1CKNA 4DAVA 3BDOA 3F2CA 5IOCA 4FO2A 3I8ZA 1YNNC 2G9DA 1HZ9A 3QIAA 3ICEA 3J7AV 2FINB 3F1ZA 4UHVA 1D5ZC 4YY3Q 3CCLA 4J15A 3K7UC 1EEID 2V4DA 5C4JH 3KK7A 1VQDA 4KTAA 3HOWH 1D1KA 1L1OA 2WB1G 4DV2L 2IHEA 2CH4A 3D6CA 5LL6X 4TRDA 4E6IA 2XRSD 3S1MB 4EQOA 5JEAG 3K58A 4IPHA 3BDCA 1RF2D 3GTPH 4A3BG 3U50C 4GLVB 4AYBG 1A15A 3GV6A 4GZYC 3WOEA 1Q8KA 1E7ZA 2UU9Q 2JK8A 5C4JB 3RMHA 5J3BA 1PH9A 4L8JA 1B50A 4YHHQ 5BN3A 5FO9B 2JA8H 2H1EA 1BXTA 3EIVA 1AFPA 4RKLA 1ASYA 4YHHL 1FGBD 1CZWA 2I5HA 1YBYA 3RZOH 5C44G 1KDAA 3GTLB 2A69D 1K9MC 4A3FB 5FLXc 2QA4A 5ELOA 5CBAE 5J39A 2KCCA 2NVXH 1VQHA 3CF5A 5BN4A 1N36L 3CD6A 2AUKA 3A8JE 1V1PA 3G6EA 2KCNA 2CQOA 2F0MA 5A2QE 2K52A 1WFQA 1VQKA 5M9OA 2TMPA 2FXQA 3OW7A 1GKHA 2HIVA 1YNXA 1LYLA 2RF4A 3TEHB 4JI0L 2OWOA 3S17B 4BBRG 1I3QH 1NMGA 1BDOA 1FNUA 5IODA 1O7YA 4A3CG 2NVQB 4K8JA 5CV5A 3F2UA 4M8AA 5EAYA 2PPBC 2K33A 5IY0A 4FF3A 1B8AA 2O5IC 4QIWE 3TP6A 1S72A 2L4NA 3J7YW 1TWCB 4HSPA 3I72A 1FD7D 1TS4A 1U4RA 3NPPA 2Q2TA 4L5SA 1S3OA 4O2DA 1VQNA 2PNRC 3S1NB 2KECA 2WV6D 4A3DG 1HQMC 1PDQA 1LO5D 1OXVA 2E2HB 1EIFA 2EYFA 1L0WA 3UE1A 5LMUL 3K5OA 4FYDA 2CFMA 2Z0SA 2MP1A 3PUYA 1X3GA 3EVQA 1N34L 1ILPA 1HR0Q 2IY5B 4UAIA 1EWHA 1H9SA 2RHSB 5D65A 3HOZG 2EYHA 3VYRA 2EZVA 3S1QB 4UP8A 4DV6Q 2AHOB 2OQKA 4K5XA 2C9OA 3GQBA 1D5MC 1KQSA 4LF7L 2F4VQ 2G9HD 5JVG3 3GTOB 2XIWA 1AZPA 1WD1A 2F0TA 3PUVA 4J1MA 5H1SE 5LHY1 3NBHA 3HOZB 3KF8B 2YTXA 4TQUS 3J80i 2F03A 1SYFA 2ZTDA 5CV4A 5IIFA 2ZM6L 2KUMA 3TS0A 1P8LA 3PUXA 2XWJB 5M3MG 1PTOC 2K5WA 1IYUA 3BG3A 1M90C 5E4WC 2WACA 2Z6KC 5I2YA 1MKHA 1WD0A 1MGSA 3I4MB 2I07B 4B9XA 3OWFA 1BQQT 3IKJA 5GADC 3P1HA 4NKLA 3T13A 3K5LA 2PW5A 2P5ZX 1J8IA 1KRTA 3CC7A 2PI2E 1H9JA 1S5BD 1KHIA 3UDIA 2I0QA 3FP9A 3OPOA 1X3QA 2E2IH 4NB3A 4A3JB 1N33L 1HUNA 1H95A 1I4PA 2A5HA 1UE5A 4RCOA 1NNXA 2JE6I 1OO9B 1N33Q 4FF1A 2F0VA 4JI5L 1QJOA 3JAMi 3N6RA 2JQOA 1SNOA 2WP8J 2JA7H 1U5KA 1BNZA 1QZGA 1PFSA 4K8IA 4R4CA 4RG1A 4DUYL 3M4YA 2I5LX 3T4AC 4C1NK 2ZJQA 4IQZA 4K2KA 4ZCKA 5IT9c 4A3DB 3TZUA 1E1OA 2DNEA 1EY7A 1BBWA 2CVRA 1VCIA 3Q22A 1TWAH 3E0JA 3ER0A 1D1IA 1Q90A 4A3FG 4A3EG 4L6TB 1L1OC 1JB3A 3BYYB 2CQAA 5EJWA 2YTVA 1KABA 2RKSA 4DAPA 2ZXPA 1B9MA 3KF6A 5CC4A 4A3LG 2NVYH 5EKLA 2LMCB 1TKWB 4BBRB 3PO2B 5IT9E 1HA5A 4YCWA 4HTHA 1CTMA 4V0BA 4AYBB 2UXCQ 3T53B 4A3BB 1ESFA 3CXCA 1YHBA 4JI6Q 4GS3A 2KOLA 1VQIA 2D0PA 4B3RQ 2I46A 5ELCA 5HURA 2NYZD 1LTID 2VZAA 4GN5A 1CA5A 4AQYL 3E6ZX 1HUMA 1RDPD 3CMAA 1X3EA 3CRKC 1D2BA 1ZXTA 4X64L 4BBSG 3E9HA 1WOCA 1CHPD 3FPPA 3PIOA 4R1JA 1B7YB 3P7JA 2IX1A 1EWIA 3CC2A 5T1GA 4C3JB 2K75A 1YZ6A 1ENFA 1K3BC 4JBJA 1WTQA 5JJIA 3T56B 5K36H 3PIPA 3E3XA 2KQ3A 1A3VA 4HMJA 1TT2A 1HNXQ 4A3BH 4A3DH 3ITPA 1U4PA 2KEDA 3DWAA 2K04A 2WB1B 1IL2A 2B2VA 1Y1VB 3M7GA 1HJPA 4YIJA 5C3EG 1EWCA 3CQZH 2Y0SB 2AQ2B 1WTWA 1HNZL 2KVMA 4I7ZC 2VUMB 3HRZC 2A68D 4HJ9A 3S16H 1DXMA 1IBLL 4CKBA 2CCZA 2I5MX 2PYKA 4A3CH 3CCQA 5CV7A 4HJ8A 2FFKB 4R4IA 1K8AC 4RMFA 4A3IG 4RGNA 1KDCA 2IX3A 4F7XA 2R7DA 1HR0W 4JI6L 2HQEA 1F2YA 3BZDB 2WKCA 2D2CC 2F3VA 3SXHA 4QGUA 4JBWA 2BDNA 3DWPA 4HIMA 1PH4A 4CDEC 1VQ5A 1T5XD 5C3EB 1TWGH 1VQBA 3AB9A 4DR1Q 2AUJD 4EX5A 4GOPA 3C46A 1F9PA 3CRLC 3PF5A 1ESRA 2QDLA 4PQXA 1DYQA 4OO1G 2PMZB 1B70B 2Q8TA 4IUNA 4B3SQ 4A93G 1EQVA 4NXMQ 5G3LF 3NUCA 4MIUA 4KHPL 3NBHB 3S2HB 4OO1I 1P16A 2KA7A 4LK1C 2WAQB 3NBIA 4PMWA 1VQ4A 1TWGB 4DNRB 1XMOQ 3SDZA 1S4ZA 4KHPQ 1BBUA 1LTBD 1RODA 1SR3A 1SROA 3NWSA 1V9PA 4LNQA 1STAA 1EY4A 4DR7Q 3TP8A 4LF8L 5GAHC 4LUVA 4A76A 3IFTA 2NN6H 1STHA 1STNA 3HOVH 2L11A 3PIO3 4IFDI 2QKIC 3U9OA 1VQOA 3ULPA 2JA5H 1SFOH 2K5VA 3S17H 1XMQQ 4FXDA 3TP7A 5JVH3 1PLFA 1C48A 1O80A 1LM0A 1ZKOA 1CSQA 1TS5A 3M4QA 3TP5A 5COYA 2PZTA 2ZJPA 5DLQE 3H09A 3H3VC 1VQAA 1VQ7A 1WI5A 4BBSH 2VB2X 1XPRA 5I6YA 3BZCA 2UXBQ 3WWVA 1JWSD 1I4GA 3R2IA 3KYHC 1Y8OB 5M5XB 5I4DA 1SNPA 4ULLA 4BXXH 2B63H 2ID0A 4XYOA 4HIKA 3K7AH 1V1OA 1EEFD 5EQ0A 4LF8Q 3CCMA 3C1EA 1EUJA 4KY6A 3MEHA 3GTKB 4Y52H 3TRZA 3HGBA 2JA5B 4KN7C 5IYCH 1L1OB 1EFID
chains in the Genus database with same CATH topology
3F1ZA 1IBLQ 1OTCA 4P71A 4QL5A 4YY3Q 1D7QA 3CCLA 4J15A 3PUZA 2VUMG 4JI4L 1O7IA 1EYGA 1V43A 1TWFH 3K7UC 1SN8A 4LF9L 4JBMA 1HR0L 3PSIA 1HNWL 2K5NA 5C4JH 2ZTEA 4L5TA 1VQDA 1Y1VG 3HOWH 1U0LA 3K80C 3JAMc 3UDGA 1L1OA 4UPAA 2A1AA 2WB1G 1FL0A 3E0EA 3AYHB 4X66L 2IHEA 3DLLA 4DV2L 2IX0A 4DV6L 4GNXB 2B3GA 4NXNL 2JA6H 3AFPA 3HOZH 2R93G 3LGJA 4OONA 4R4TA 5JEAG 1IBML 2V1CC 4IPHA 4LF5Q 4PZ6A 1SRUA 2VQFQ 4A4IA 4UP7A 4DV1Q 3GTPH 5JJLA 4A3BG 3U50C 4DR5Q 4GKJL 1VQCA 4GLVB 2ZTCA 1WJJA 1X3FA 4AYBG 4A75A 1SMXA 2AWOA 4LFBQ 1E24A 1Q8KA 1E1TA 1E7ZA 1SE8A 2UU9Q 3HOYH 2MO1A 1MIUA 2JK8A 3H0GG 4JBKA 5J3BA 1PH9A 3PO2G 1Y14B 1HZBA 4YHHQ 3GTKH 4DV3L 2K5HA 4HJAA 1OXSC 4IJLA 5IYDG 2JA8H 1PHJA 1VQPA 3KDFA 4DNIA 3H15A 1CKMA 2PQAB 5LMNW 3EIVA 2NVTH 1ASYA 2E5LQ 1JJGA 4YHHL 3S2HH 2F3IA 2HT1A 1J5EL 5IP9H 2I5HA 3GO5A 1MJEA 4UY8C 1NE3A 1YBYA 3GTLH 5C44G 1IBKL 3RZOH 2WFWA 2VQEQ 1Q86C 1K9MC 5FLXc 2QA4A 5ELOA 2NVXH 1X6OA 1TXYA 1VQHA 2B29A 3RLOA 1HZCA 3CF5A 2KHIA 4AQYQ 4B3SL 3I4NH 4DAMA 1N36L 3CD6A 3G6EA 1S40A 2CQOA 4DK6C 3GTJH 4ALPA 3J80c 1NMFA 3NENA 4LF4L 4PZ7A 4WJ4A 3K0XA 2K52A 1UE1A 1WFQA 1VQKA 4LWCA 4DPGA 5E7NA 1G6PA 4X66Q 4DR1L 4YCVA 4IFDG 1YHAA 2FXQA 4DV5L 2UXDL 2R92H 1GKHA 2HIVA 1YNXA 1X54A 3S1QH 1A63A 1LYLA 2RF4A 3TEHB 2RHQB 5IWAL 4HIDA 4K0KL 4X6AH 3S24A 3H3VH 5M3MH 4JI0L 2OWOA 1PH6A 4BBRG 3FKIG 3KJOA 3CCSA 1I3QH 2BH8A 2EIFA 3GTQH 4GNXC 1KD1C 1GM5A 3GTGH 1JJCB 5JJKA 1NMGA 1PVOA 3CAMA 4A3LH 3L7ZC 5FLMG 4PG3A 1K8GA 4A3CG 5LMNL 4H02A 4DUZQ 3T1HL 4IO9A 5EAYA 1XNQL 1N34Q 5C0XJ 2VL6A 3CP0A 4GLXA 4B3TQ 2JA9A 1XMOL 2L15A 5IY0A 2N8NA 4DUZL 2KENA 1YEZA 1B8AA 3PUWA 4QIWE 4R4QA 1YIJA 3CMEA 1E3PA 5LMUQ 4GOPB 2Q2IA 1S72A 4JI3L 1HNXL 1VQFA 4NXML 3I2ZA 3RLNA 5HGQA 1QVGA 1KC8C 2Q2TA 1S3OA 3I56A 4O2DA 4AH6A 2VW9A 4L5SA 1VQNA 1JE5A 1RIPA 1K83H 3I4OA 1FGUA 3D31A 2R6GA 3ERSX 4IOCA 3AEVA 2CKZB 1BVSA 4A3DG 1OXVA 4B3TL 3K81C 1EIFA 3I4MG 4BBRH 1EFWA 2HIXA 1L0WA 4JC0A 3J7A5 4DR4L 4BA1I 3UE1A 5LMUL 2PMZE 2NZOA 3I55A 1YHQA 2ES2A 4JI3Q 2CFMA 4GN3B 4IFDJ 2Z0SA 4LF4Q 4FDBA 3PUYA 5GAEC 1X3GA 4HIOA 3AFQA 4L5RC 1C0AA 1YJNA 1N34L 4B3RL 3NEMA 1HR0Q 2IY5B 2VQFL 2OCEA 3U58A 3KDFB 2RHSB 3HOZG 2R93H 2GN5A 2JA6G 1Q7YC 3MEFA 3AQQA 2ZM6Q 4UP8A 1PA6A 1NJIC 4DV6Q 1PH1A 3I4NG 2AHOB 2OQKA 4LF7L 1GVPA 4A3JG 2F4VQ 1VQGA 1Y1VH 2YV5A 1KQSA 4JI7L 4KI0A 3G4SA 1Q82C 4LFAL 4OWXB 1GO3E 1M1KC 2N3SA 5AJ3Q 1FJGQ 1XNQQ 3PUVA 2UUCQ 5H1SE 2Y0SE 1LTLA 3KF8B 4JOIA 2YTXA 4DAYB 1KL9A 4TQUS 3J80i 2KCTA 3S14H 2E8GA 2ZTDA 4DR2L 1HNZQ 3KOJA 2H5XA 1UWVA 1EQRA 1X65A 2CWAA 3UDXA 2ZM6L 3TS0A 1P8LA 1N36Q 2UU9L 4GKKQ 3PUXA 2R7ZH 3HOXH 4XTCS 2LXJA 5M3MG 4EQ5A 1JB7A 5M3FH 3UDFA 1PH5A 3PGZA 1NBWA 3HFZB 3MXNB 1XJVA 1SLJA 1VQMA 1PV4A 1WCMH 1M90C 4GKKL 1WCMG 3BZKA 2UUAL 2Z6KC 1MKHA 1I94Q 3I4MH 4QQBX 2E5LL 4MZ9A 5M3FG 4C3JH 3OTOQ 1IBKQ 4GN4B 4OX9L 5GADC 4DUYQ 4DV0L 1ASZA 3T1YL 3D0FA 4B3ML 1EIYB 1KRTA 1QVCA 3CC7A 3HOWG 1UEBA 2PI2E 5M5WH 3BU2A 4BY7G 4IPGA 1KHIA 1E22A 1N9WA 3UDIA 3FP9A 3CCEA 3RZDH 3EBEA 2I0QA 2UXBL 1IYJB 1AE2A 4ME3A 4NB3A 5C44H 2E2IH 4LFCQ 1N33L 1H95A 1Q12A 1TWHH 3I7FA 3KJPA 3ULJA 1RL2A 2Z6KA 4OWWB 3T1YQ 1UE5A 2JE6I 3STBD 4BA2I 1N33Q 2JA8G 5IYDH 3NELA 4GLAC 2YTYA 4JI5L 1IZ6A 2D0OA 3JAMi 4DV4Q 5HY6A 3H0GH 3HOYG 2JQOA 1K0RA 2WP8J 2JA7H 2WAQE 4R4OA 1U5KA 4P73A 2JA7G 1N32L 1LUZA 3GD7A 4DV2Q 1PFSA 4JI2Q 4R4CA 1QZGA 4RG1A 4DUYL 4DV0Q 2LSSA 2OTLA 3GTOH 1JT8A 2I5LX 3HOXG 2AWNA 2VY3A 2ZJQA 3J7ZC 5IT9c 4P74A 1XPOA 4LF6L 1UE7A 2B63G 3H3VI 2MFIA 1E1OA 1HZAA 5LMNQ 1I94L 5M5YH 1BBWA 1CKNB 5IP7H 1K3RA 4KLKA 1AE3A 1NTGA 2JEAI 4C2MH 3G71A 1VCIA 2R7FA 4LW1A 3F2DA 1TWAH 4DV7Q 4KHZA 2YU9H 3ER0A 4A3EH 4AYBE 4A3FG 3CCUA 4A3EG 3CCVA 3S1MH 2YYZA 4BY7H 1L1OC 2D62A 3CPWA 1YVCA 4A3JH 2HQLA 1TWCH 2DUDA 1AH9A 2VUMH 4JG2A 1D8LA 5BR8L 2YTVA 1IXRA 2JEBI 1VQEA 4YY3L 1XMQL 1KRSA 2OTJA 4DR3L 1YI2A 3PO3G 3Q8DA 3KF6A 4QY7A 3W1BA 2QGQA 2NVYH 1CUKA 4A3LG 1Q1BA 4POGA 4JI7Q 3FKIH 2VNUD 3HKSA 4YCWA 1Y1WG 2XTIA 3IRBA 4YWKA 2N49A 4POFA 3RN5A 2UXCQ 4YWLA 4C3HH 2LXKA 1PH8A 2HHHQ 3CXCA 1EOVA 1YHBA 2NN6G 4GS3A 3DM3A 3SGIA 4JI6Q 2R7ZG 1VQIA 2NZHA 2D0PA 3TQYA 4PZ8A 4B3RQ 5GAGC 4DR7L 2K50A 4TVAB 4JV5Q 1MJCA 4BY1H 3F8TA 2NVQH 1WYDA 2JJQA 1G51A 1VQ9A 2VZAA 4GN5A 3HKZE 2AMCB 1QUQA 1I6HH 1N32Q 4AQYL 4A3KH 3S15H 3ULLA 3CMAA 1I50H 1X3EA 2WB1E 3OYYA 2C35B 4JOIC 3CCRA 4X64L 5C0XI 4BBSG 3E9HA 1WOCA 2Q2HA 3KF6B 3RLFA 1A8VA 3A5UA 2VS1A 3PIOA 4R1JA 1B7YB 1XPUA 2IX1A 3B6YA 4A3GH 1EWIA 3CC2A 4WJ3M 5GROA 4C3IH 4LFCL 1PYBA 5FJ8G 3PCOB 1YJWA 2K75A 2RCNA 1YZ6A 3W5OA 5BR8Q 4JBJA 1KAWA 4GKJQ 4IJHA 2BH2A 1OXUA 3TREA 5ELNA 3CC4A 5JJIA 3CW2C 2KCMA 3L2PA 1FVIA 3KLWA 2BA0A 3PIPA 4Y7NH 1PH3A 3TS2A 2R92G 1VQLA 4DR3Q 3M85A 1CSPA 5GQOA 1HNXQ 4A3BH 1FJGL 5IYBG 2KBNA 1T9HA 4A3DH 2F52A 1W3SA 4NXNQ 1UE6A 3RR5A 2ASBA 4A3MG 2UUBL 2EQSA 4MNOA 1IL2A 1BKBA 3EN2A 1Q46A 4JI1L 3W1GA 4JI0Q 1HJPA 1HNWQ 4LUOA 1GD7A 4DV5Q 4AIMA 5C3EG 2UXDQ 4QJFA 3CQZH 4A3IH 1K73C 3HOUG 5C4XH 4HJ5A 3UE0A 4DR2Q 1HNZL 4JYAL 1VQ6A 1V1QA 5IP9G 4HJ9A 3S16H 2CCZA 1IBLL 2I5MX 3GTMH 4A3CH 3CCQA 4XIGS 4HJ8A 1C7YA 5IE8A 1K8AC 4R4IA 4DV7L 4RMFA 1CKOA 4A3IG 4GNXA 2JA5G 1DGSA 3PF4A 2HHHL 1HR0W 2R7DA 4DK3C 4JI6L 4A3KG 1XTDA 2IT1A 2GVAA 2XGTA 3ZJYC 1QZHA 4DR6L 4QGUA 4JBWA 2K4KA 1L2FA 4DV3Q 4HIMA 5IYBH 1W2BA 4LF5L 2CWPA 1G291 4JI1Q 5C0XG 1OXTA 4GOPC 1PH4A 2Y0SG 1KIXA 4LF7Q 1VQ5A 2F4VL 4DR1Q 4BXXG 1TWGH 1VQBA 1Z9FA 1EQQA 2MQHA 1Q81C 3J81i 3S2DH 1PYSB 3M9BA 4EX5A 4GOPA 2PNHA 3RNUA 4LFBL 1PH7A 3PF5A 2NN6I 3M3YH 4DV1L 4DR5L 4OO1G 2KHJA 3K8AA 3PV0A 5M5XH 1B70B 4UP9A 4B3SQ 4LF9Q 5FJ8H 3M4OH 4HJ7A 4A93G 1I5FA 4X62Q 1KXLA 4NXMQ 4OX9Q 2UUBQ 2GVBA 1XNRQ 4JI8Q 4KHPL 3L0OA 4A3GG 5FLMH 3NBHB 3RN2A 4OO1I 5C4XG 1P16A 4X62L 4JYAQ 3U4ZA 3HOUH 4DV4L 3A0JA 4PMWA 1VQ4A 1PH2A 3GDEA 2K14A 1XMOQ 4JI8L 4KHPQ 1BBUA 4OXPA 3PO2H 2AKWB 4YCUA 3M7NA 1SR3A 1SROA 1IBMQ 4YWMA 1V9PA 4JI2L 3J81j 4LNQA 4DR7Q 4JV5L 3BJUA 4LF8L 5GAHC 4A3MH 4MTNA 1XNRL 2PI2A 1HH2P 1OXXK 2MO0A 4LUVA 3OTOL 2Q2UA 4A76A 4IPCA 4LUZA 4JI5Q 2UUCL 1VQJA 5JEAJ 2E2HH 3STBC 1QVFA 4B3MQ 4DR6Q 3JC66 3HOVH 5K36G 1QUQB 1VQ8A 4IFDI 4JI4Q 2A19A 2BA1A 2ZJRA 2A8VA 1VQOA 2VQEL 3ULPA 2JA5H 1SFOH 3KFUA 2K5VA 3S17H 1XMQQ 1Z47A 2ALYB 4DKAC 1R9TH 2WAQG 4DR4Q 4P75A 1NY4A 4X65Q 3HKZG 3S1RH 4O0AA 2QEXA 3PO3H 5IWAQ 1LM0A 4K0KQ 1CSQA 3M4QA 3CCJA 2N78A 2ZJPA 5DLQE 3T1HQ 3OW2A 1JJ2A 3F2BA 1C9OA 5IYCG 2ATWA 1VQAA 1A62A 5C3EH 1WI5A 1VQ7A 4BBSH 4A93H 4L5QA 1XPRA 3S1NH 3FHWA 4X64Q 3BZCA 4A3FH 2PQAA 4APVA 2E2JH 1A0IA 2UXCL 2UXBQ 3WWVA 1N8RC 2EXDA 1X9NA 2MNAA 3U4VA 3KYHC 1J6QA 5AJ3L 5IP7G 2UUAQ 1X55A 3J81c 1Q1EA 3HOVG 4IOAA 4LFAQ 4BY1G 4BXXH 3A74A 2B63H 3M4PA 1JMCA 4JCVE 2ID0A 3VDYA 2IHFA 4NPSA 4HIKA 3K7AH 3E9IA 4LF8Q 4X65L 3CCMA 1CKNA 1Y1WH 4OWTB 1J5EQ 3F2CA 1EUJA 1X56A 4Y52H 3TRZA 2DGYA 1YITA 1HZ9A 2OQ0A 4IPDA 5IYCH 1L1OB 3G48A 3ICEA 1YJ9A 4LF6Q 3A5ZB 3CPFA 4P72A 1VS0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F1Z A;  1IBL Q;  1OTC A;  4P71 A;  4QL5 A;  4YY3 Q;  1D7Q A;  3CCL A;  4J15 A;  3PUZ A;  2VUM G;  4JI4 L;  1O7I A;  1EYG A;  1V43 A;  1TWF H;  3K7U C;  1SN8 A;  4LF9 L;  4JBM A;  1HR0 L;  3PSI A;  1HNW L;  2K5N A;  5C4J H;  2ZTE A;  4L5T A;  1VQD A;  1Y1V G;  3HOW H;  1U0L A;  3K80 C;  3JAM c;  3UDG A;  1L1O A;  4UPA A;  2A1A A;  2WB1 G;  1FL0 A;  3E0E A;  3AYH B;  4X66 L;  2IHE A;  3DLL A;  4DV2 L;  2IX0 A;  4DV6 L;  4GNX B;  2B3G A;  4NXN L;  2JA6 H;  3AFP A;  3HOZ H;  2R93 G;  3LGJ A;  4OON A;  4R4T A;  5JEA G;  1IBM L;  2V1C C;  4IPH A;  4LF5 Q;  4PZ6 A;  1SRU A;  2VQF Q;  4A4I A;  4UP7 A;  4DV1 Q;  3GTP H;  5JJL A;  4A3B G;  3U50 C;  4DR5 Q;  4GKJ L;  1VQC A;  4GLV B;  2ZTC A;  1WJJ A;  1X3F A;  4AYB G;  4A75 A;  1SMX A;  2AWO A;  4LFB Q;  1E24 A;  1Q8K A;  1E1T A;  1E7Z A;  1SE8 A;  2UU9 Q;  3HOY H;  2MO1 A;  1MIU A;  2JK8 A;  3H0G G;  4JBK A;  5J3B A;  1PH9 A;  3PO2 G;  1Y14 B;  1HZB A;  4YHH Q;  3GTK H;  4DV3 L;  2K5H A;  4HJA A;  1OXS C;  4IJL A;  5IYD G;  2JA8 H;  1PHJ A;  1VQP A;  3KDF A;  4DNI A;  3H15 A;  1CKM A;  2PQA B;  5LMN W;  3EIV A;  2NVT H;  1ASY A;  2E5L Q;  1JJG A;  4YHH L;  3S2H H;  2F3I A;  2HT1 A;  1J5E L;  5IP9 H;  2I5H A;  3GO5 A;  1MJE A;  4UY8 C;  1NE3 A;  1YBY A;  3GTL H;  5C44 G;  1IBK L;  3RZO H;  2WFW A;  2VQE Q;  1Q86 C;  1K9M C;  5FLX c;  2QA4 A;  5ELO A;  2NVX H;  1X6O A;  1TXY A;  1VQH A;  2B29 A;  3RLO A;  1HZC A;  3CF5 A;  2KHI A;  4AQY Q;  4B3S L;  3I4N H;  4DAM A;  1N36 L;  3CD6 A;  3G6E A;  1S40 A;  2CQO A;  4DK6 C;  3GTJ H;  4ALP A;  3J80 c;  1NMF A;  3NEN A;  4LF4 L;  4PZ7 A;  4WJ4 A;  3K0X A;  2K52 A;  1UE1 A;  1WFQ A;  1VQK A;  4LWC A;  4DPG A;  5E7N A;  1G6P A;  4X66 Q;  4DR1 L;  4YCV A;  4IFD G;  1YHA A;  2FXQ A;  4DV5 L;  2UXD L;  2R92 H;  1GKH A;  2HIV A;  1YNX A;  1X54 A;  3S1Q H;  1A63 A;  1LYL A;  2RF4 A;  3TEH B;  2RHQ B;  5IWA L;  4HID A;  4K0K L;  4X6A H;  3S24 A;  3H3V H;  5M3M H;  4JI0 L;  2OWO A;  1PH6 A;  4BBR G;  3FKI G;  3KJO A;  3CCS A;  1I3Q H;  2BH8 A;  2EIF A;  3GTQ H;  4GNX C;  1KD1 C;  1GM5 A;  3GTG H;  1JJC B;  5JJK A;  1NMG A;  1PVO A;  3CAM A;  4A3L H;  3L7Z C;  5FLM G;  4PG3 A;  1K8G A;  4A3C G;  5LMN L;  4H02 A;  4DUZ Q;  3T1H L;  4IO9 A;  5EAY A;  1XNQ L;  1N34 Q;  5C0X J;  2VL6 A;  3CP0 A;  4GLX A;  4B3T Q;  2JA9 A;  1XMO L;  2L15 A;  5IY0 A;  2N8N A;  4DUZ L;  2KEN A;  1YEZ A;  1B8A A;  3PUW A;  4QIW E;  4R4Q A;  1YIJ A;  3CME A;  1E3P A;  5LMU Q;  4GOP B;  2Q2I A;  1S72 A;  4JI3 L;  1HNX L;  1VQF A;  4NXM L;  3I2Z A;  3RLN A;  5HGQ A;  1QVG A;  1KC8 C;  2Q2T A;  1S3O A;  3I56 A;  4O2D A;  4AH6 A;  2VW9 A;  4L5S A;  1VQN A;  1JE5 A;  1RIP A;  1K83 H;  3I4O A;  1FGU A;  3D31 A;  2R6G A;  3ERS X;  4IOC A;  3AEV A;  2CKZ B;  1BVS A;  4A3D G;  1OXV A;  4B3T L;  3K81 C;  1EIF A;  3I4M G;  4BBR H;  1EFW A;  2HIX A;  1L0W A;  4JC0 A;  3J7A 5;  4DR4 L;  4BA1 I;  3UE1 A;  5LMU L;  2PMZ E;  2NZO A;  3I55 A;  1YHQ A;  2ES2 A;  4JI3 Q;  2CFM A;  4GN3 B;  4IFD J;  2Z0S A;  4LF4 Q;  4FDB A;  3PUY A;  5GAE C;  1X3G A;  4HIO A;  3AFQ A;  4L5R C;  1C0A A;  1YJN A;  1N34 L;  4B3R L;  3NEM A;  1HR0 Q;  2IY5 B;  2VQF L;  2OCE A;  3U58 A;  3KDF B;  2RHS B;  3HOZ G;  2R93 H;  2GN5 A;  2JA6 G;  1Q7Y C;  3MEF A;  3AQQ A;  2ZM6 Q;  4UP8 A;  1PA6 A;  1NJI C;  4DV6 Q;  1PH1 A;  3I4N G;  2AHO B;  2OQK A;  4LF7 L;  1GVP A;  4A3J G;  2F4V Q;  1VQG A;  1Y1V H;  2YV5 A;  1KQS A;  4JI7 L;  4KI0 A;  3G4S A;  1Q82 C;  4LFA L;  4OWX B;  1GO3 E;  1M1K C;  2N3S A;  5AJ3 Q;  1FJG Q;  1XNQ Q;  3PUV A;  2UUC Q;  5H1S E;  2Y0S E;  1LTL A;  3KF8 B;  4JOI A;  2YTX A;  4DAY B;  1KL9 A;  4TQU S;  3J80 i;  2KCT A;  3S14 H;  2E8G A;  2ZTD A;  4DR2 L;  1HNZ Q;  3KOJ A;  2H5X A;  1UWV A;  1EQR A;  1X65 A;  2CWA A;  3UDX A;  2ZM6 L;  3TS0 A;  1P8L A;  1N36 Q;  2UU9 L;  4GKK Q;  3PUX A;  2R7Z H;  3HOX H;  4XTC S;  2LXJ A;  5M3M G;  4EQ5 A;  1JB7 A;  5M3F H;  3UDF A;  1PH5 A;  3PGZ A;  1NBW A;  3HFZ B;  3MXN B;  1XJV A;  1SLJ A;  1VQM A;  1PV4 A;  1WCM H;  1M90 C;  4GKK L;  1WCM G;  3BZK A;  2UUA L;  2Z6K C;  1MKH A;  1I94 Q;  3I4M H;  4QQB X;  2E5L L;  4MZ9 A;  5M3F G;  4C3J H;  3OTO Q;  1IBK Q;  4GN4 B;  4OX9 L;  5GAD C;  4DUY Q;  4DV0 L;  1ASZ A;  3T1Y L;  3D0F A;  4B3M L;  1EIY B;  1KRT A;  1QVC A;  3CC7 A;  3HOW G;  1UEB A;  2PI2 E;  5M5W H;  3BU2 A;  4BY7 G;  4IPG A;  1KHI A;  1E22 A;  1N9W A;  3UDI A;  3FP9 A;  3CCE A;  3RZD H;  3EBE A;  2I0Q A;  2UXB L;  1IYJ B;  1AE2 A;  4ME3 A;  4NB3 A;  5C44 H;  2E2I H;  4LFC Q;  1N33 L;  1H95 A;  1Q12 A;  1TWH H;  3I7F A;  3KJP A;  3ULJ A;  1RL2 A;  2Z6K A;  4OWW B;  3T1Y Q;  1UE5 A;  2JE6 I;  3STB D;  4BA2 I;  1N33 Q;  2JA8 G;  5IYD H;  3NEL A;  4GLA C;  2YTY A;  4JI5 L;  1IZ6 A;  2D0O A;  3JAM i;  4DV4 Q;  5HY6 A;  3H0G H;  3HOY G;  2JQO A;  1K0R A;  2WP8 J;  2JA7 H;  2WAQ E;  4R4O A;  1U5K A;  4P73 A;  2JA7 G;  1N32 L;  1LUZ A;  3GD7 A;  4DV2 Q;  1PFS A;  4JI2 Q;  4R4C A;  1QZG A;  4RG1 A;  4DUY L;  4DV0 Q;  2LSS A;  2OTL A;  3GTO H;  1JT8 A;  2I5L X;  3HOX G;  2AWN A;  2VY3 A;  2ZJQ A;  3J7Z C;  5IT9 c;  4P74 A;  1XPO A;  4LF6 L;  1UE7 A;  2B63 G;  3H3V I;  2MFI A;  1E1O A;  1HZA A;  5LMN Q;  1I94 L;  5M5Y H;  1BBW A;  1CKN B;  5IP7 H;  1K3R A;  4KLK A;  1AE3 A;  1NTG A;  2JEA I;  4C2M H;  3G71 A;  1VCI A;  2R7F A;  4LW1 A;  3F2D A;  1TWA H;  4DV7 Q;  4KHZ A;  2YU9 H;  3ER0 A;  4A3E H;  4AYB E;  4A3F G;  3CCU A;  4A3E G;  3CCV A;  3S1M H;  2YYZ A;  4BY7 H;  1L1O C;  2D62 A;  3CPW A;  1YVC A;  4A3J H;  2HQL A;  1TWC H;  2DUD A;  1AH9 A;  2VUM H;  4JG2 A;  1D8L A;  5BR8 L;  2YTV A;  1IXR A;  2JEB I;  1VQE A;  4YY3 L;  1XMQ L;  1KRS A;  2OTJ A;  4DR3 L;  1YI2 A;  3PO3 G;  3Q8D A;  3KF6 A;  4QY7 A;  3W1B A;  2QGQ A;  2NVY H;  1CUK A;  4A3L G;  1Q1B A;  4POG A;  4JI7 Q;  3FKI H;  2VNU D;  3HKS A;  4YCW A;  1Y1W G;  2XTI A;  3IRB A;  4YWK A;  2N49 A;  4POF A;  3RN5 A;  2UXC Q;  4YWL A;  4C3H H;  2LXK A;  1PH8 A;  2HHH Q;  3CXC A;  1EOV A;  1YHB A;  2NN6 G;  4GS3 A;  3DM3 A;  3SGI A;  4JI6 Q;  2R7Z G;  1VQI A;  2NZH A;  2D0P A;  3TQY A;  4PZ8 A;  4B3R Q;  5GAG C;  4DR7 L;  2K50 A;  4TVA B;  4JV5 Q;  1MJC A;  4BY1 H;  3F8T A;  2NVQ H;  1WYD A;  2JJQ A;  1G51 A;  1VQ9 A;  2VZA A;  4GN5 A;  3HKZ E;  2AMC B;  1QUQ A;  1I6H H;  1N32 Q;  4AQY L;  4A3K H;  3S15 H;  3ULL A;  3CMA A;  1I50 H;  1X3E A;  2WB1 E;  3OYY A;  2C35 B;  4JOI C;  3CCR A;  4X64 L;  5C0X I;  4BBS G;  3E9H A;  1WOC A;  2Q2H A;  3KF6 B;  3RLF A;  1A8V A;  3A5U A;  2VS1 A;  3PIO A;  4R1J A;  1B7Y B;  1XPU A;  2IX1 A;  3B6Y A;  4A3G H;  1EWI A;  3CC2 A;  4WJ3 M;  5GRO A;  4C3I H;  4LFC L;  1PYB A;  5FJ8 G;  3PCO B;  1YJW A;  2K75 A;  2RCN A;  1YZ6 A;  3W5O A;  5BR8 Q;  4JBJ A;  1KAW A;  4GKJ Q;  4IJH A;  2BH2 A;  1OXU A;  3TRE A;  5ELN A;  3CC4 A;  5JJI A;  3CW2 C;  2KCM A;  3L2P A;  1FVI A;  3KLW A;  2BA0 A;  3PIP A;  4Y7N H;  1PH3 A;  3TS2 A;  2R92 G;  1VQL A;  4DR3 Q;  3M85 A;  1CSP A;  5GQO A;  1HNX Q;  4A3B H;  1FJG L;  5IYB G;  2KBN A;  1T9H A;  4A3D H;  2F52 A;  1W3S A;  4NXN Q;  1UE6 A;  3RR5 A;  2ASB A;  4A3M G;  2UUB L;  2EQS A;  4MNO A;  1IL2 A;  1BKB A;  3EN2 A;  1Q46 A;  4JI1 L;  3W1G A;  4JI0 Q;  1HJP A;  1HNW Q;  4LUO A;  1GD7 A;  4DV5 Q;  4AIM A;  5C3E G;  2UXD Q;  4QJF A;  3CQZ H;  4A3I H;  1K73 C;  3HOU G;  5C4X H;  4HJ5 A;  3UE0 A;  4DR2 Q;  1HNZ L;  4JYA L;  1VQ6 A;  1V1Q A;  5IP9 G;  4HJ9 A;  3S16 H;  2CCZ A;  1IBL L;  2I5M X;  3GTM H;  4A3C H;  3CCQ A;  4XIG S;  4HJ8 A;  1C7Y A;  5IE8 A;  1K8A C;  4R4I A;  4DV7 L;  4RMF A;  1CKO A;  4A3I G;  4GNX A;  2JA5 G;  1DGS A;  3PF4 A;  2HHH L;  1HR0 W;  2R7D A;  4DK3 C;  4JI6 L;  4A3K G;  1XTD A;  2IT1 A;  2GVA A;  2XGT A;  3ZJY C;  1QZH A;  4DR6 L;  4QGU A;  4JBW A;  2K4K A;  1L2F A;  4DV3 Q;  4HIM A;  5IYB H;  1W2B A;  4LF5 L;  2CWP A;  1G29 1;  4JI1 Q;  5C0X G;  1OXT A;  4GOP C;  1PH4 A;  2Y0S G;  1KIX A;  4LF7 Q;  1VQ5 A;  2F4V L;  4DR1 Q;  4BXX G;  1TWG H;  1VQB A;  1Z9F A;  1EQQ A;  2MQH A;  1Q81 C;  3J81 i;  3S2D H;  1PYS B;  3M9B A;  4EX5 A;  4GOP A;  2PNH A;  3RNU A;  4LFB L;  1PH7 A;  3PF5 A;  2NN6 I;  3M3Y H;  4DV1 L;  4DR5 L;  4OO1 G;  2KHJ A;  3K8A A;  3PV0 A;  5M5X H;  1B70 B;  4UP9 A;  4B3S Q;  4LF9 Q;  5FJ8 H;  3M4O H;  4HJ7 A;  4A93 G;  1I5F A;  4X62 Q;  1KXL A;  4NXM Q;  4OX9 Q;  2UUB Q;  2GVB A;  1XNR Q;  4JI8 Q;  4KHP L;  3L0O A;  4A3G G;  5FLM H;  3NBH B;  3RN2 A;  4OO1 I;  5C4X G;  1P16 A;  4X62 L;  4JYA Q;  3U4Z A;  3HOU H;  4DV4 L;  3A0J A;  4PMW A;  1VQ4 A;  1PH2 A;  3GDE A;  2K14 A;  1XMO Q;  4JI8 L;  4KHP Q;  1BBU A;  4OXP A;  3PO2 H;  2AKW B;  4YCU A;  3M7N A;  1SR3 A;  1SRO A;  1IBM Q;  4YWM A;  1V9P A;  4JI2 L;  3J81 j;  4LNQ A;  4DR7 Q;  4JV5 L;  3BJU A;  4LF8 L;  5GAH C;  4A3M H;  4MTN A;  1XNR L;  2PI2 A;  1HH2 P;  1OXX K;  2MO0 A;  4LUV A;  3OTO L;  2Q2U A;  4A76 A;  4IPC A;  4LUZ A;  4JI5 Q;  2UUC L;  1VQJ A;  5JEA J;  2E2H H;  3STB C;  1QVF A;  4B3M Q;  4DR6 Q;  3JC6 6;  3HOV H;  5K36 G;  1QUQ B;  1VQ8 A;  4IFD I;  4JI4 Q;  2A19 A;  2BA1 A;  2ZJR A;  2A8V A;  1VQO A;  2VQE L;  3ULP A;  2JA5 H;  1SFO H;  3KFU A;  2K5V A;  3S17 H;  1XMQ Q;  1Z47 A;  2ALY B;  4DKA C;  1R9T H;  2WAQ G;  4DR4 Q;  4P75 A;  1NY4 A;  4X65 Q;  3HKZ G;  3S1R H;  4O0A A;  2QEX A;  3PO3 H;  5IWA Q;  1LM0 A;  4K0K Q;  1CSQ A;  3M4Q A;  3CCJ A;  2N78 A;  2ZJP A;  5DLQ E;  3T1H Q;  3OW2 A;  1JJ2 A;  3F2B A;  1C9O A;  5IYC G;  2ATW A;  1VQA A;  1A62 A;  5C3E H;  1WI5 A;  1VQ7 A;  4BBS H;  4A93 H;  4L5Q A;  1XPR A;  3S1N H;  3FHW A;  4X64 Q;  3BZC A;  4A3F H;  2PQA A;  4APV A;  2E2J H;  1A0I A;  2UXC L;  2UXB Q;  3WWV A;  1N8R C;  2EXD A;  1X9N A;  2MNA A;  3U4V A;  3KYH C;  1J6Q A;  5AJ3 L;  5IP7 G;  2UUA Q;  1X55 A;  3J81 c;  1Q1E A;  3HOV G;  4IOA A;  4LFA Q;  4BY1 G;  4BXX H;  3A74 A;  2B63 H;  3M4P A;  1JMC A;  4JCV E;  2ID0 A;  3VDY A;  2IHF A;  4NPS A;  4HIK A;  3K7A H;  3E9I A;  4LF8 Q;  4X65 L;  3CCM A;  1CKN A;  1Y1W H;  4OWT B;  1J5E Q;  3F2C A;  1EUJ A;  1X56 A;  4Y52 H;  3TRZ A;  2DGY A;  1YIT A;  1HZ9 A;  2OQ0 A;  4IPD A;  5IYC H;  1L1O B;  3G48 A;  3ICE A;  1YJ9 A;  4LF6 Q;  3A5Z B;  3CPF A;  4P72 A;  1VS0 A; 
#chains in the Genus database with same CATH topology
 4DAY A;  1IKM A;  3NK9 A;  2FHT A;  3PUZ A;  3NSW A;  1EYG A;  2JA7 B;  1HR0 L;  3HOU B;  1HNW L;  1KLG D;  2K5N A;  4L5T A;  3R8B A;  4DXF A;  3AYH B;  4X66 L;  4DV6 L;  4GNX B;  2IX0 A;  2B3G A;  2F0H A;  4NXN L;  2JA6 H;  3S14 B;  3DHQ A;  3HOZ H;  4S3S A;  3LNN A;  3LGJ A;  4OON A;  1IBM L;  2V1C C;  5C5L A;  4LF5 Q;  1G91 A;  4RKB A;  4G7O C;  1YNJ D;  4DR5 Q;  4GKJ L;  2ZTC A;  1X3F A;  3MVV A;  5IGC A;  1BCP F;  1I4H A;  2AWO A;  1E1T A;  1SE8 A;  2EPB A;  3VR5 A;  4EGV A;  2OT2 A;  3OSO A;  2EY2 A;  2J0T D;  5IGD A;  3GTK H;  4CJ2 C;  4HJA A;  1OXS C;  4IJL A;  5IYD G;  1M4V A;  1CKM A;  4C3I G;  5LMN W;  4K6L A;  1JJG A;  1EY8 A;  4XT3 B;  1J5E L;  3GO5 A;  4UY8 C;  4X3T A;  2VQE Q;  1LTS D;  5M3M B;  1VDZ A;  2B29 A;  4DGZ A;  1S40 A;  4DK6 C;  2F0J A;  4A3I B;  4LF4 L;  4WJ4 A;  4HCS A;  2F0P A;  5E7N A;  2K6A A;  3K7A B;  1HXY D;  4OIJ A;  4X66 Q;  4UDU C;  4DV5 L;  3G6J B;  1FNV A;  1SEB D;  3BS1 A;  3EJI A;  4HID A;  3SE0 A;  4G7Z C;  5M3M H;  1PH6 A;  3KJO A;  4CDF C;  1ENC A;  2BH8 A;  2A69 C;  4GNX C;  1KD1 C;  1GM5 A;  1PVO A;  3CAM A;  5DNF A;  1EOT A;  3L7Z C;  2JSO A;  2F1M A;  4V19 0;  3K59 A;  1K8G A;  1J9O A;  5LMN L;  4H02 A;  4DUZ Q;  2K01 A;  1CFM A;  4IO9 A;  1N34 Q;  5C0X J;  3CP0 A;  3KLS X;  2JA9 A;  4X3K A;  2N8N A;  3D6W A;  4DUZ L;  4XQJ A;  2KEN A;  1YEZ A;  1UUP A;  3DMU A;  1WTR A;  4R4Q A;  1EIH A;  5LMU Q;  5CV8 A;  1VQF A;  3X3N A;  1C0A A;  3I2Z A;  4AH6 A;  5FLX L;  1PZI D;  1JE5 A;  2EXZ A;  5KRU A;  3I4O A;  3AEV A;  3ERS X;  2CKZ B;  4ID6 A;  3RUZ A;  4B3T L;  3KLR A;  1R4Q B;  2B2T C;  4WRD A;  5M3F B;  5FO8 B;  3TSS A;  2PMZ E;  3VYT A;  3I55 A;  2ES2 A;  2F0K A;  4BBS B;  3I3C A;  4IFD J;  1EY5 A;  1U4M A;  4FDB A;  1AW7 A;  2VB3 X;  3HEJ A;  2OCE A;  3U58 A;  3KDF B;  2R93 H;  1L0X B;  2GN5 A;  4H44 C;  3MXN A;  2ZM6 Q;  1PH1 A;  3I4N G;  5ELE A;  4CDD C;  1VQG A;  2YV5 A;  3OWE B;  1IW7 C;  2A74 C;  1FNW A;  4KI0 A;  1PTO F;  2AQ1 B;  2E2D C;  1PXU A;  1GO3 E;  3V2T A;  1TWH B;  2N3S A;  4K6D A;  4EQP A;  5D14 A;  1KL9 A;  4OEL B;  3DWQ A;  2E8G A;  1HNZ Q;  4DN4 M;  1UWV A;  1EQR A;  1X65 A;  2JXM B;  3T51 B;  2LXJ A;  2XVS A;  5M3F H;  5IT9 L;  4KJN A;  1XJV A;  2NB0 A;  2EYJ A;  1SLJ A;  4LMQ D;  1WCM G;  3BZK A;  2UUA L;  2RVL A;  1R4P B;  2E5L L;  5C4H A;  3OTO Q;  1E2W A;  3RD4 A;  5KEE A;  5A2Q L;  1IBK Q;  4OX9 L;  4QF4 A;  2L55 A;  2NVY B;  4ZYS A;  1CT1 D;  4DUY Q;  1ASZ A;  2DJF C;  2EYP A;  4B3M L;  2CH4 W;  5AFW A;  4XQQ A;  3VYU A;  1STY A;  1EIY B;  2QF7 A;  4IPG A;  1N9W A;  1F2M A;  1IYJ B;  5C44 H;  1I6V C;  5LL6 S;  1CZG A;  1Q12 A;  1TWH H;  3ERO A;  3I7F A;  1SYC A;  4OWW B;  2EDG A;  2RQX A;  3T1Y Q;  2CHB D;  3NTK A;  3LWU A;  2B2U C;  2VXW A;  5DM7 3;  2B2W C;  4LJZ C;  2JA8 G;  2H4O A;  3NEL A;  3J81 L;  2YTY A;  1B1Z A;  1TS2 A;  1IZ6 A;  4CJ1 B;  3GTP B;  3J80 L;  5HY6 A;  1K0R A;  2F0O A;  1DD2 A;  4ZRZ A;  4CHT B;  1GUO A;  4JI2 Q;  4R8N A;  1AZQ A;  4ZLT F;  2LSS A;  2OTL A;  3MHB A;  4QIW B;  3HOX G;  3J7Z C;  4K5W A;  4B08 A;  4LF6 L;  4RGM A;  4ZAI A;  3K57 A;  1DOL A;  5M5Y H;  2B2V C;  5ELB A;  2JEA I;  1AE3 A;  1NTG A;  2MHV A;  1SNC A;  4C2M H;  2CW0 D;  3F2D A;  4LW1 A;  3D3R A;  2PQE A;  2BCO A;  4NP5 A;  4A3E H;  4AYB E;  3CKI B;  3CCU A;  3CCV A;  3S1M H;  2E74 C;  4BY7 H;  4A3J H;  3IAY A;  2HDM A;  1ENA A;  2VUM H;  4JG2 A;  1WTV A;  5J22 A;  1PYW D;  4YY3 L;  2RBM A;  1XMQ L;  1LLR D;  1KRS A;  2OTJ A;  4DR3 L;  1K8M A;  5COR A;  5E1F A;  3VR6 A;  4JI7 Q;  3BVM A;  4RFB A;  2VNU D;  1IHZ A;  1VMC A;  1HPC A;  1H9M A;  1EOV A;  3DM3 A;  4IUU A;  4FF4 A;  4DR7 L;  2IW3 A;  2N55 A;  4OL7 A;  2EJG C;  2NVQ H;  1WYD A;  2JJQ A;  3NTI A;  1VQ9 A;  3HKZ E;  1N32 Q;  1CA6 A;  2MUY A;  3ULL A;  3TN2 A;  5C0X I;  4FXG C;  1B3A A;  5KND A;  3NHH A;  2Z8L A;  3OHX C;  3B6Y A;  1HA6 A;  1S5E D;  4LFC L;  2PO4 A;  5KIX A;  3PCO B;  1TVX A;  3A7A B;  4IJH A;  5C3X A;  1MSH A;  2BH2 A;  5A35 A;  4R8I A;  3CC4 A;  1PZK D;  3I90 A;  3KLW A;  1HTP A;  1PH3 A;  2HD3 A;  4A3G B;  4ZQ3 A;  3MZ5 A;  1LT3 D;  5GQO A;  4MTK A;  1GHK A;  5FK9 C;  3L9A X;  2KBN A;  2F52 A;  3SK6 A;  1W3S A;  4KD4 A;  1UE6 A;  3RR5 A;  4X3S A;  4NXN Q;  2ASB A;  2E2J B;  2UUB L;  4K5V A;  1STG A;  2K28 A;  3MWY W;  1JWM D;  1ET9 A;  3HZX A;  4JI0 Q;  3FKI B;  3QOJ A;  4LUO A;  4IUP A;  4A3I H;  3UE0 A;  4DR2 Q;  4IAL A;  1C4Q A;  2B8F A;  2F0W A;  1V1Q A;  5I6W A;  3FMC A;  4PMC A;  5DEH A;  1B53 A;  5IE8 A;  2F0G A;  1CKO A;  4IUR A;  4GNX A;  2JA5 G;  2D5D A;  4RGT A;  3Q6S A;  2BE5 C;  4DK3 C;  3AMU A;  3OMC A;  1BBX C;  4XT1 B;  2Z4H A;  3C2P A;  2GVA A;  4DR6 L;  5IYB H;  2IPK D;  3I4L A;  4ME5 A;  4RCN A;  1BR9 A;  1KAA A;  4FVM A;  3S2D H;  3URY A;  3GTJ B;  4DR5 L;  3K8A A;  1Q8I A;  5BN5 A;  5M5X H;  4UP9 A;  1KDB A;  5T1I A;  1I5F A;  1EYD A;  1JOK A;  1QWY A;  1T5E A;  1W6J A;  4RH6 A;  4JI8 Q;  5FLM H;  4A3G G;  3RN2 A;  3HOU H;  3GDE A;  1AP0 A;  5JPM C;  4JI8 L;  1RTN A;  2Q8R E;  2AKW B;  4YCU A;  1XYI A;  1IBM Q;  4QUC A;  4YWM A;  2EYO A;  4JV5 L;  2D9U A;  3J81 j;  2EY5 A;  3E5S A;  3BJU A;  2Z1C A;  4MTN A;  1EZ8 A;  4HED A;  2PI2 A;  1OXX K;  2MO0 A;  2B2U A;  2PZU A;  2IJ0 A;  4LUZ A;  3A54 A;  1A2U A;  3QG1 A;  3STB C;  4HSV A;  4DR6 Q;  1A3U A;  4A3K B;  5CYU A;  1EU4 A;  2VQE L;  2A6E D;  3KFU A;  1PRT D;  2WAQ G;  4QCL A;  4P75 A;  5DAU A;  5HGT A;  4RHR A;  3S1R H;  2QEX A;  4H7B A;  2C5C A;  3A8K E;  1JJ2 A;  3F2B A;  4A93 B;  1SE3 A;  3W2D A;  3FHW A;  2MNA A;  1HTL D;  3U4V A;  3MFY A;  1J6Q A;  5M5W B;  5AJ3 L;  1BF4 A;  4BY1 G;  3M4P A;  5JEA H;  2QDB A;  5FOB B;  3U9S A;  1NAP A;  1CM9 A;  1Y1W H;  4OWT B;  1X56 A;  1K83 B;  1JCK B;  2DGY A;  1YIT A;  3G48 A;  2TSS A;  3EA6 A;  1CK1 A;  4P72 A;  4P71 A;  4QL5 A;  1D7Q A;  2VUM G;  4JI4 L;  1V43 A;  1TWF H;  4JBM A;  1S5C D;  2EOT A;  3T16 A;  2ENB A;  1Y1V G;  4IZ8 A;  2A1A A;  4F87 A;  1FJG Q;  3DLL A;  2N88 A;  4CDC C;  4P2C B;  2R93 G;  1I3Q B;  4OIK A;  4A4I A;  5IGE A;  5JJL A;  1SE2 A;  1WJJ A;  3FPU B;  2NTT A;  1SMX A;  4LFB Q;  2K32 A;  3HOY H;  2MO1 A;  1MIU A;  3PO2 G;  1Y14 B;  2K1B A;  1HZB A;  4DV3 L;  1K8O A;  2LKV A;  3PIP 3;  1PHJ A;  1VQP A;  1H9S B;  1A3T A;  2PQA B;  1JR0 D;  2E5L Q;  1JIC A;  2F3I A;  2O2L D;  1WCM B;  5IP9 H;  1G6Z A;  2B2W A;  1NE3 A;  3GTL H;  1IBK L;  1Q86 C;  2NVX B;  4OO1 H;  1KNA A;  1F9Q A;  4N8X 1;  2FMC A;  5J1Z A;  1TXY A;  5JJZ A;  1HZC A;  1CQF A;  4PV1 C;  4AQY Q;  4DAM A;  2NUC A;  5C3W A;  2ICE C;  3GTJ H;  2EJM A;  3J80 c;  3DEP A;  1NMF A;  4HR7 B;  5C0X H;  2JYO A;  4LWC A;  1G6P A;  4DR1 L;  5NUC A;  1HHV A;  4IFD G;  2UXD L;  1X54 A;  4FF2 A;  2B8G A;  3S1Q H;  2RHQ B;  3H3V H;  4QB4 A;  1K0S A;  2X6L A;  3FKI G;  4C3H B;  2EIF A;  5JJK A;  2Q8I B;  3C1F A;  4Y7N B;  4A3L H;  5FLM G;  1IW7 D;  4PG3 A;  3WOF A;  4RAU C;  3T1H L;  1XNQ L;  2VL6 A;  3MXP A;  4GLX A;  4B3T Q;  1XMO L;  2L15 A;  3DEO A;  4EVO A;  2HCI A;  1YIJ A;  1E3P A;  1TY2 A;  3VR2 A;  3S1N H;  1QVG A;  1KC8 C;  3I56 A;  2O4X A;  2FJ2 A;  1RIP A;  2LS0 1;  1I4R A;  1FGU A;  3DXJ C;  1BVS A;  5ISR A;  3OOC A;  3S1R B;  3I4M G;  1SYB A;  3V96 A;  3SEB A;  4BBR H;  1EFW A;  2HIX A;  3J7A 5;  4DR4 L;  4BA1 I;  5I2X A;  4JI3 Q;  2NZO A;  1SAP A;  1EY9 A;  1SND A;  3NQI A;  4GN3 B;  2R3Z A;  2RA4 A;  1JOO A;  5I9P A;  5GAE C;  4HIO A;  4L5R C;  3AFQ A;  4CKC A;  3IFD A;  1DOK A;  1MSG A;  3NQT A;  4B3R L;  2VQF L;  4ABN A;  1QE6 A;  2JA6 G;  3PMF A;  1B44 D;  5KYI A;  4ZUI A;  2DY7 A;  1Q7Y C;  3MEF A;  1GUT A;  1CI3 M;  4A3J G;  1UNS A;  4JI7 L;  4KJO A;  3H94 A;  1M1K C;  1MI2 A;  1XNQ Q;  2UUC Q;  1DJR D;  2WII B;  1C8C A;  1H9K A;  4DAY B;  1LTL A;  2NWG A;  4JOI A;  3OMG A;  1R9T B;  2KCT A;  1JC7 A;  4DR2 L;  3KOJ A;  1HNX L;  2CWA A;  1G2T A;  3HOX H;  4EQ5 A;  1JB7 A;  1U4L A;  1PH5 A;  4J6H A;  3PGZ A;  1PRT B;  1QNU A;  3HFZ B;  1PV4 A;  1BCP D;  4FXK C;  1M8A A;  2JN4 A;  3VA5 A;  1I94 Q;  3I4M H;  2SOB A;  1WTO A;  1CHQ D;  1K28 A;  3T1Y L;  3D0F A;  1PTO B;  3NXW A;  1PTO D;  1WTH A;  1BUV T;  4CJ0 B;  3D4W A;  1QVC A;  1Y69 U;  3HOW G;  1GUW A;  3BU2 A;  1KNE A;  3CCE A;  3D8G A;  1AE2 A;  2F0D A;  4ME3 A;  4U67 3;  4LFC Q;  1ET6 A;  3ULJ A;  1RL2 A;  1XTC D;  2JA6 B;  3HOY B;  1F9S A;  1SYD A;  2SNS A;  4BA2 I;  5IYD H;  4KMU C;  4TSS A;  3M3Y B;  2D0O A;  4DV4 Q;  4C3H G;  3H0G H;  1RCV D;  5KNC A;  2WAQ E;  4R4O A;  4P73 A;  3J80 E;  2JA7 G;  4DV2 Q;  4DV0 Q;  4IUQ A;  4JPB W;  2EE1 A;  1TS3 A;  2XWB B;  2VY3 A;  3HG9 A;  1XPO A;  3H3V I;  1HZA A;  2EYL A;  1I94 L;  1CKN B;  4CGY B;  1AEX A;  3G71 A;  2R7F A;  1TWA B;  1LV9 A;  5CMD A;  2YYZ A;  2D62 A;  3CPW A;  2SDF A;  5C44 B;  1AH9 A;  5FLX E;  1QIL A;  1D8L A;  2XSC A;  1H9R A;  1VQE A;  3GTM B;  3MXU A;  3ONA B;  1YI2 A;  3PO3 G;  1II3 A;  4DK0 A;  3ND8 A;  2K5D A;  2DJG C;  2F0S A;  3FKI H;  1GUS A;  2A6E C;  3NE5 B;  1JOQ A;  3IRB A;  2BE5 D;  3A8I E;  1V1P B;  4KKT A;  4POF A;  3RN5 A;  4YWL A;  3NTH A;  1PH8 A;  4OGQ C;  1VMP A;  3SGI A;  4G7H C;  3I4N B;  2EY1 A;  2NZH A;  4PZ8 A;  3VYS A;  4JV5 Q;  2K50 A;  4TVA B;  5FO7 B;  3F8T A;  2AQ3 B;  1QUQ A;  1X32 A;  4A3K H;  3S15 H;  2WB1 E;  3I70 A;  3KBG A;  1Z6H A;  3QOL A;  4O1N A;  1HQR D;  2Q2H A;  3KF6 B;  3RLF A;  2J7Z A;  3A5U A;  2VS1 A;  1O7L A;  3ERQ A;  1XPU A;  4A3G H;  1ILQ A;  1G8Z D;  5GRO A;  1PYB A;  4KY7 A;  5FJ8 G;  2RCN A;  4Q0F A;  1RD9 D;  4ODG A;  4GKJ Q;  1OXU A;  3TRE A;  5ELN A;  3CW2 C;  2KCM A;  3JAM L;  3S15 B;  2L12 A;  3L2P A;  3TS2 A;  5K5P A;  2R92 G;  3MAQ A;  5DM6 3;  1WTX A;  2WKD A;  1FJG L;  5IYB G;  4K2L A;  3MTS A;  3Q0A A;  4IUT A;  1EZ6 A;  2R93 B;  4A3M G;  3NWT A;  1RJT A;  1TQO A;  1BKB A;  5IGF A;  1HNW Q;  4DV5 Q;  4AIM A;  1EYC A;  3SK8 A;  1K73 C;  4DXG A;  2ZXO A;  4JYA L;  3S16 B;  1Y8N B;  5EPL A;  2NTS A;  3GTM H;  3R3O A;  4XIG S;  4KD3 A;  1TWF B;  4DV7 L;  3RZO B;  4RA8 A;  3LWE A;  4BWG B;  1JQY D;  3PF4 A;  1SYG A;  4FNF A;  5M5Y B;  5F2D A;  4A3K G;  4C2M B;  1GHJ A;  3ZJY C;  1W2B A;  4LF5 L;  3BVG A;  5FKA C;  4JI1 Q;  5C0X G;  4N9P A;  4LF7 Q;  2Y0S G;  1TR5 A;  1KIX A;  2F4V L;  2R61 A;  3KLS A;  3J81 i;  3M9B A;  2PNH A;  3RNU A;  1PFM A;  5C6A A;  1PH7 A;  3M3Y H;  1PZJ D;  2F0I A;  2KHJ A;  2J4X A;  3H0G B;  3PV0 A;  4DNT B;  3M4O H;  4X62 Q;  2CW0 C;  4KV6 A;  1B3Q A;  4NDX A;  3DUZ A;  2F0Q A;  4X62 L;  3U4Z A;  4JYA Q;  3QWN A;  1DON A;  2BOS A;  1PH2 A;  2K14 A;  3SR1 A;  3PO2 H;  4IUV A;  3OIP A;  3M7N A;  5E3F A;  3MA2 B;  4TKO B;  4JI2 L;  4WFN 3;  2L0C A;  2K03 A;  4H13 C;  1TY0 A;  4R9W A;  4A3M H;  1XNR L;  1ICF B;  1NSN S;  3O13 A;  4IPC A;  2QIL A;  4JI5 Q;  5JEA J;  2L1B A;  2E2H H;  3R93 A;  3JC6 6;  5K36 G;  3A56 A;  1VQ8 A;  2QW7 A;  5KGU A;  2K5Q A;  1LTT D;  1Z47 A;  2ALY B;  1R9T H;  4DR4 Q;  1EY6 A;  5C4X B;  4G4K A;  4O0A A;  5CR3 A;  4RHS A;  1GUN A;  3BYT B;  1E2V A;  1F77 A;  2MGS A;  3CCJ A;  2M2L A;  2KHS A;  2MJ8 A;  1A62 A;  4X64 Q;  2E2J H;  2PQA A;  4APV A;  1A0I A;  1X9N A;  3WDN A;  3PO3 B;  5IP7 G;  2UUA Q;  5ELD A;  5C5M A;  1X55 A;  3HOV G;  1Q1E A;  3PQI A;  4IOA A;  3GV3 A;  2A6H D;  1LAB A;  4DU9 A;  3A74 A;  2L9H A;  2IHF A;  4NPS A;  3HS0 C;  4A3E B;  1LT5 D;  4X65 L;  1J5E Q;  1EL0 A;  1NR2 A;  2F0F A;  1E2Z A;  3QR8 A;  5CV9 A;  4IPD A;  2OQ0 A;  4Q5V A;  3M4O B;  1YJ9 A;  4LF6 Q;  3A5Z B;  3CPF A;  1VS0 A;  4WJW A;  1IBL Q;  1EYA A;  1OTC A;  2Z9H A;  3L3O C;  3MFG A;  1SMY D;  1O7I A;  4LF9 L;  1SN8 A;  1PRT C;  1CQV A;  3IL8 A;  3PSI A;  1QG7 A;  1E0B A;  2ICI A;  2ZTE A;  4ZK9 B;  1U0L A;  3K80 C;  4BS9 A;  3JAM c;  4UPA A;  3UDG A;  1FL0 A;  1SJH D;  1ZYR D;  3E0E A;  1IYV A;  1STB A;  1EQT A;  1SMY C;  5IGB A;  3AFP A;  1NUC A;  2NVT B;  4R4T A;  4XXE A;  4PZ6 A;  1SRU A;  2VQF Q;  5D3I B;  4UP7 A;  4DV1 Q;  1EIG A;  5JOB A;  1VQC A;  4DA2 A;  1B2T A;  1PFN A;  1Z7T A;  4A75 A;  2DNC A;  1XX8 A;  1E24 A;  1Y1W B;  2E76 C;  4JBK A;  3H0G G;  2K5H A;  2KJX A;  1V8Q A;  3HP3 A;  3KDF A;  3H15 A;  4RGO S;  2A6H C;  2M00 A;  2NVT H;  4CBV A;  3S2H H;  2HT1 A;  4U68 A;  1MJE A;  2NBF A;  5KNB A;  3K6O A;  3MXG A;  2WFW A;  1SBB B;  1X6O A;  4B3S L;  3I4N H;  1F9R A;  4FP5 D;  3RLO A;  2KHI A;  4C56 C;  4ALP A;  5EBC A;  1I4Q A;  4KHV A;  3NEN A;  1Q3L A;  4PZ7 A;  5EPK A;  2OXP A;  3K0X A;  1UE1 A;  3MC0 B;  2F3W A;  4DPG A;  3HOX B;  2R7Z B;  4YCV A;  1YHA A;  2E2I B;  2MPM A;  2R92 H;  4F8M A;  3ND9 A;  1D5X C;  2M9V A;  1A63 A;  4X6A H;  5IWA L;  5EKK A;  4K0K L;  3S24 A;  4JW0 A;  1SFO B;  3CCS A;  1SNM A;  4IFD H;  3GTQ H;  5C4Z A;  3GTG H;  1JJC B;  4MN3 A;  1AN8 A;  5I9O A;  4DK1 A;  2ZXR A;  4MHE A;  4ZKC B;  1SYE A;  2EYM A;  2R92 B;  2PZW A;  3C3L A;  2PCF B;  3PUW A;  4BY7 B;  3BVZ A;  3CME A;  3H91 A;  4XQN A;  2Q2I A;  4GOP B;  4JI3 L;  3VA7 A;  3RLN A;  4NXM L;  5HGQ A;  5JPN C;  3S9W A;  2VW9 A;  1FR3 A;  3VR4 A;  1TII D;  3GTG B;  1VF7 A;  1K83 H;  2B63 B;  2R6G A;  3D31 A;  4IOC A;  4C3J G;  4X3U A;  1I50 B;  2A73 B;  3K81 C;  1JWU D;  1QOH A;  1EU3 A;  4JK1 C;  1KTK A;  4JC0 A;  3G7L A;  1GOZ A;  2HCC A;  1BOS A;  1YHQ A;  5CV6 A;  2LFN A;  1UAP A;  4C1N I;  4LF4 Q;  1YJN A;  2F0L A;  3NEM A;  2JA8 B;  1KLU D;  3TDQ A;  4HCE A;  4CKE A;  1BCP C;  3FEW X;  1I4X A;  1PA6 A;  3AQQ A;  1SJE D;  1NJI C;  1GVP A;  1Y1V H;  4KKS A;  3G4S A;  1Q82 C;  2Z4I A;  4LFA L;  4OWX B;  1HRJ A;  4O42 A;  5AJ3 Q;  2K05 A;  3K0Y A;  1DOM A;  3KBX A;  2Y0S E;  4DNI A;  3S14 H;  1IKL A;  2O5J C;  3UDX A;  2H5X A;  4GKK Q;  3FRP B;  2Z6B A;  1N36 Q;  2UU9 L;  4H0L C;  3Q24 A;  2R7Z H;  4XTC S;  3V05 A;  1PTO H;  3UDF A;  1SNQ A;  1NBW A;  3MXN B;  4PMB A;  3EFX D;  4GKK L;  1ICW A;  1SE4 A;  1WCM H;  1VQM A;  5KYL A;  4QQB X;  4MZ9 A;  5M3F G;  4C3J H;  4DFA A;  1PFB A;  3EQL C;  4GN4 B;  1EY0 A;  2BDO A;  4DV0 L;  3SVM A;  2IL8 A;  2X6G A;  1UEB A;  2F0N A;  5M5W H;  4BY7 G;  4I65 A;  1E22 A;  4OHJ A;  3RZD H;  3EBE A;  1ZEQ X;  2UXB L;  1MD2 D;  4XYQ A;  3A7L A;  1RKN A;  1ZYR C;  3SK4 A;  2SEB D;  3KJP A;  1A2T A;  2Z6K A;  5EPJ A;  4IN3 A;  1LAC A;  3STB D;  1X3P A;  2RDH A;  4GLA C;  1O7Z A;  3P75 A;  2OEO A;  1LT4 D;  3I91 A;  3HOY G;  1N32 L;  1XWE A;  1LUZ A;  3GD7 A;  4DF7 A;  3GTO H;  3J81 E;  2DY8 A;  4XDX A;  1JT8 A;  3K5M A;  2AWN A;  3HOW B;  4JVZ A;  4P74 A;  1UE7 A;  2B63 G;  3BDL A;  2MFI A;  1ONL A;  5LMN Q;  1HFG A;  3SHL A;  2NZ1 D;  3SK5 A;  5IP7 H;  1K3R A;  4KLK A;  3S2D B;  2LY7 A;  4LAA A;  4WOR A;  4DV7 Q;  3AU7 A;  4KHZ A;  2YU9 H;  2QEJ C;  1TU2 B;  1A6X A;  4F88 A;  1YVC A;  2E75 C;  2HQL A;  3FVQ A;  1TWC H;  2DUD A;  4G57 A;  5G3L D;  5IGG A;  1YNN D;  5BR8 L;  3R2T A;  2F0E A;  1IXR A;  2JEB I;  4C3I B;  4ZKB B;  4KKU A;  3Q8D A;  1QCB D;  2RSN A;  1LTG D;  4QY7 A;  3W1B A;  2QGQ A;  5E4X A;  1CUK A;  2ZT9 C;  3W3A A;  1Q1B A;  4POG A;  2F0U A;  1UEA B;  3HKS A;  5EBD A;  2XTI A;  1Y1W G;  3P20 A;  2DN8 A;  4YWK A;  1ML0 D;  4QUF A;  1STE A;  2N49 A;  4C3H H;  1SSO A;  2LXK A;  2HHH Q;  2R7Z G;  2NN6 G;  2RDF A;  3HKZ B;  3TQY A;  1Y8P B;  5GAG C;  1MJC A;  4BY1 H;  2XRQ D;  1G51 A;  3OIQ A;  1I6H H;  2AMC B;  2A68 C;  1LT6 D;  1RHP A;  5EKI A;  4ILW A;  2EY6 A;  1I50 H;  3OYY A;  4JOI C;  3CCR A;  1YNJ C;  2C35 B;  1GUG A;  2G5D A;  2YU9 B;  3X3M A;  4OEM B;  4KK7 A;  1WVL A;  4KY5 A;  1A8V A;  3QB3 A;  4HAE A;  2OF1 A;  4C3I H;  4WJ3 M;  1YJW A;  4HMI A;  2K7V A;  2L5T A;  3W5O A;  5BR8 Q;  1KAW A;  1LTR D;  2EVB A;  1I6H B;  2GA4 B;  4N9T A;  3K5N A;  1DZ1 A;  4J8Q A;  1O78 A;  4PNY A;  1FVI A;  3QO2 A;  2BA0 A;  4QMG A;  4Y7N H;  2EJF C;  1VQL A;  5D3D A;  4DR3 Q;  3M85 A;  1CSP A;  5EGT A;  2B2T A;  2RDG A;  1QNK A;  1T9H A;  1GJX A;  1F2L A;  3KF8 A;  2EQS A;  4MNO A;  2FMM A;  3EN2 A;  1Q46 A;  2B39 A;  4JI1 L;  1D6E C;  3W1G A;  4B9W A;  1G2S A;  2UXD Q;  1GD7 A;  1BCP B;  4KN4 C;  4QJF A;  3A55 A;  3HOU G;  5C4X H;  4HJ5 A;  1VQ6 A;  5IP9 G;  3VR3 A;  4EQN A;  1BO0 A;  4M1U B;  5CBE E;  1SXT A;  3NP8 A;  1PRT F;  1VF5 C;  1C7Y A;  4I7A A;  1DGS A;  2HHH L;  2F4I A;  3GTQ B;  1DM0 B;  1W6K A;  1XTD A;  2IT1 A;  3CHB D;  2XGT A;  5ELF A;  1QZH A;  2K4K A;  1HFN A;  1L2F A;  1S5D D;  3H6M A;  2QCP X;  3ZYY X;  4DV3 Q;  2PW7 A;  2CWP A;  1G29 1;  2SNM A;  3TME A;  4Z9C B;  1OXT A;  4GOP C;  4BXX G;  3D4R A;  1Z9F A;  1EQQ A;  2MQH A;  2XNA C;  1Q81 C;  3HOV B;  4N8F A;  1PYS B;  4LFB L;  2KEE A;  1WTP A;  2NN6 I;  3D4D A;  4DV1 L;  2IWH A;  3N52 A;  5FJ8 H;  4LF9 Q;  4HJ7 A;  1KXL A;  4OX9 Q;  1PMR A;  1U9R A;  2GVB A;  2UUB Q;  1QB5 D;  1XNR Q;  3L0O A;  2B2Y C;  5C4X G;  4DV4 L;  3A0J A;  1LTA D;  4OXP A;  3TBI B;  1NCV A;  4L63 B;  1HCZ A;  1DCZ A;  3CQZ B;  4K14 A;  1SDF A;  1HH2 P;  2Q2U A;  3OTO L;  5JAV A;  2B2Y A;  4RWS C;  1XXG A;  1L0Y B;  3LX0 A;  1MHW C;  5CGK A;  2UUC L;  1VQJ A;  1MBY A;  1QVF A;  4ZUJ A;  1F2Z A;  4B3M Q;  2RCF A;  1FYC A;  3QJY A;  1QUQ B;  4NMZ A;  1GXD C;  3JAM E;  4JI4 Q;  2A19 A;  2X69 A;  1IL8 A;  2BA1 A;  2ZJR A;  2A8V A;  1S5F D;  4DKA C;  1NY4 A;  4X65 Q;  2XN9 C;  3HKZ G;  3PO3 H;  5IWA Q;  4K0K Q;  1JE4 A;  5L37 A;  2N78 A;  3Q23 A;  3FDT A;  3T1H Q;  3OW2 A;  1C9O A;  2WIN B;  5IYC G;  2ATW A;  5C3E H;  2HUG A;  4A93 H;  4BY1 B;  4L5Q A;  4A3F H;  2UXC L;  3J7A F;  1N8R C;  2EXD A;  3CU7 A;  2JP1 A;  1RTO A;  3TZD A;  2RSO A;  3KUP A;  3J81 c;  3DM1 A;  3UI2 A;  4A3M B;  4LFA Q;  5TSS A;  4NW2 A;  1JMC A;  4JCV E;  3VDY A;  1B9N A;  3I73 A;  1NR4 A;  3GP7 A;  1JOR A;  1B4O A;  3E9I A;  3RZD B;  4HN7 A;  2HDL A;  1CKN A;  4DAV A;  3BDO A;  3F2C A;  5IOC A;  4FO2 A;  3I8Z A;  1YNN C;  2G9D A;  1HZ9 A;  3QIA A;  3ICE A;  3J7A V;  2FIN B;  3F1Z A;  4UHV A;  1D5Z C;  4YY3 Q;  3CCL A;  4J15 A;  3K7U C;  1EEI D;  2V4D A;  5C4J H;  3KK7 A;  1VQD A;  4KTA A;  3HOW H;  1D1K A;  1L1O A;  2WB1 G;  4DV2 L;  2IHE A;  2CH4 A;  3D6C A;  5LL6 X;  4TRD A;  4E6I A;  2XRS D;  3S1M B;  4EQO A;  5JEA G;  3K58 A;  4IPH A;  3BDC A;  1RF2 D;  3GTP H;  4A3B G;  3U50 C;  4GLV B;  4AYB G;  1A15 A;  3GV6 A;  4GZY C;  3WOE A;  1Q8K A;  1E7Z A;  2UU9 Q;  2JK8 A;  5C4J B;  3RMH A;  5J3B A;  1PH9 A;  4L8J A;  1B50 A;  4YHH Q;  5BN3 A;  5FO9 B;  2JA8 H;  2H1E A;  1BXT A;  3EIV A;  1AFP A;  4RKL A;  1ASY A;  4YHH L;  1FGB D;  1CZW A;  2I5H A;  1YBY A;  3RZO H;  5C44 G;  1KDA A;  3GTL B;  2A69 D;  1K9M C;  4A3F B;  5FLX c;  2QA4 A;  5ELO A;  5CBA E;  5J39 A;  2KCC A;  2NVX H;  1VQH A;  3CF5 A;  5BN4 A;  1N36 L;  3CD6 A;  2AUK A;  3A8J E;  1V1P A;  3G6E A;  2KCN A;  2CQO A;  2F0M A;  5A2Q E;  2K52 A;  1WFQ A;  1VQK A;  5M9O A;  2TMP A;  2FXQ A;  3OW7 A;  1GKH A;  2HIV A;  1YNX A;  1LYL A;  2RF4 A;  3TEH B;  4JI0 L;  2OWO A;  3S17 B;  4BBR G;  1I3Q H;  1NMG A;  1BDO A;  1FNU A;  5IOD A;  1O7Y A;  4A3C G;  2NVQ B;  4K8J A;  5CV5 A;  3F2U A;  4M8A A;  5EAY A;  2PPB C;  2K33 A;  5IY0 A;  4FF3 A;  1B8A A;  2O5I C;  4QIW E;  3TP6 A;  1S72 A;  2L4N A;  3J7Y W;  1TWC B;  4HSP A;  3I72 A;  1FD7 D;  1TS4 A;  1U4R A;  3NPP A;  2Q2T A;  4L5S A;  1S3O A;  4O2D A;  1VQN A;  2PNR C;  3S1N B;  2KEC A;  2WV6 D;  4A3D G;  1HQM C;  1PDQ A;  1LO5 D;  1OXV A;  2E2H B;  1EIF A;  2EYF A;  1L0W A;  3UE1 A;  5LMU L;  3K5O A;  4FYD A;  2CFM A;  2Z0S A;  2MP1 A;  3PUY A;  1X3G A;  3EVQ A;  1N34 L;  1ILP A;  1HR0 Q;  2IY5 B;  4UAI A;  1EWH A;  1H9S A;  2RHS B;  5D65 A;  3HOZ G;  2EYH A;  3VYR A;  2EZV A;  3S1Q B;  4UP8 A;  4DV6 Q;  2AHO B;  2OQK A;  4K5X A;  2C9O A;  3GQB A;  1D5M C;  1KQS A;  4LF7 L;  2F4V Q;  2G9H D;  5JVG 3;  3GTO B;  2XIW A;  1AZP A;  1WD1 A;  2F0T A;  3PUV A;  4J1M A;  5H1S E;  5LHY 1;  3NBH A;  3HOZ B;  3KF8 B;  2YTX A;  4TQU S;  3J80 i;  2F03 A;  1SYF A;  2ZTD A;  5CV4 A;  5IIF A;  2ZM6 L;  2KUM A;  3TS0 A;  1P8L A;  3PUX A;  2XWJ B;  5M3M G;  1PTO C;  2K5W A;  1IYU A;  3BG3 A;  1M90 C;  5E4W C;  2WAC A;  2Z6K C;  5I2Y A;  1MKH A;  1WD0 A;  1MGS A;  3I4M B;  2I07 B;  4B9X A;  3OWF A;  1BQQ T;  3IKJ A;  5GAD C;  3P1H A;  4NKL A;  3T13 A;  3K5L A;  2PW5 A;  2P5Z X;  1J8I A;  1KRT A;  3CC7 A;  2PI2 E;  1H9J A;  1S5B D;  1KHI A;  3UDI A;  2I0Q A;  3FP9 A;  3OPO A;  1X3Q A;  2E2I H;  4NB3 A;  4A3J B;  1N33 L;  1HUN A;  1H95 A;  1I4P A;  2A5H A;  1UE5 A;  4RCO A;  1NNX A;  2JE6 I;  1OO9 B;  1N33 Q;  4FF1 A;  2F0V A;  4JI5 L;  1QJO A;  3JAM i;  3N6R A;  2JQO A;  1SNO A;  2WP8 J;  2JA7 H;  1U5K A;  1BNZ A;  1QZG A;  1PFS A;  4K8I A;  4R4C A;  4RG1 A;  4DUY L;  3M4Y A;  2I5L X;  3T4A C;  4C1N K;  2ZJQ A;  4IQZ A;  4K2K A;  4ZCK A;  5IT9 c;  4A3D B;  3TZU A;  1E1O A;  2DNE A;  1EY7 A;  1BBW A;  2CVR A;  1VCI A;  3Q22 A;  1TWA H;  3E0J A;  3ER0 A;  1D1I A;  1Q90 A;  4A3F G;  4A3E G;  4L6T B;  1L1O C;  1JB3 A;  3BYY B;  2CQA A;  5EJW A;  2YTV A;  1KAB A;  2RKS A;  4DAP A;  2ZXP A;  1B9M A;  3KF6 A;  5CC4 A;  4A3L G;  2NVY H;  5EKL A;  2LMC B;  1TKW B;  4BBR B;  3PO2 B;  5IT9 E;  1HA5 A;  4YCW A;  4HTH A;  1CTM A;  4V0B A;  4AYB B;  2UXC Q;  3T53 B;  4A3B B;  1ESF A;  3CXC A;  1YHB A;  4JI6 Q;  4GS3 A;  2KOL A;  1VQI A;  2D0P A;  4B3R Q;  2I46 A;  5ELC A;  5HUR A;  2NYZ D;  1LTI D;  2VZA A;  4GN5 A;  1CA5 A;  4AQY L;  3E6Z X;  1HUM A;  1RDP D;  3CMA A;  1X3E A;  3CRK C;  1D2B A;  1ZXT A;  4X64 L;  4BBS G;  3E9H A;  1WOC A;  1CHP D;  3FPP A;  3PIO A;  4R1J A;  1B7Y B;  3P7J A;  2IX1 A;  1EWI A;  3CC2 A;  5T1G A;  4C3J B;  2K75 A;  1YZ6 A;  1ENF A;  1K3B C;  4JBJ A;  1WTQ A;  5JJI A;  3T56 B;  5K36 H;  3PIP A;  3E3X A;  2KQ3 A;  1A3V A;  4HMJ A;  1TT2 A;  1HNX Q;  4A3B H;  4A3D H;  3ITP A;  1U4P A;  2KED A;  3DWA A;  2K04 A;  2WB1 B;  1IL2 A;  2B2V A;  1Y1V B;  3M7G A;  1HJP A;  4YIJ A;  5C3E G;  1EWC A;  3CQZ H;  2Y0S B;  2AQ2 B;  1WTW A;  1HNZ L;  2KVM A;  4I7Z C;  2VUM B;  3HRZ C;  2A68 D;  4HJ9 A;  3S16 H;  1DXM A;  1IBL L;  4CKB A;  2CCZ A;  2I5M X;  2PYK A;  4A3C H;  3CCQ A;  5CV7 A;  4HJ8 A;  2FFK B;  4R4I A;  1K8A C;  4RMF A;  4A3I G;  4RGN A;  1KDC A;  2IX3 A;  4F7X A;  2R7D A;  1HR0 W;  4JI6 L;  2HQE A;  1F2Y A;  3BZD B;  2WKC A;  2D2C C;  2F3V A;  3SXH A;  4QGU A;  4JBW A;  2BDN A;  3DWP A;  4HIM A;  1PH4 A;  4CDE C;  1VQ5 A;  1T5X D;  5C3E B;  1TWG H;  1VQB A;  3AB9 A;  4DR1 Q;  2AUJ D;  4EX5 A;  4GOP A;  3C46 A;  1F9P A;  3CRL C;  3PF5 A;  1ESR A;  2QDL A;  4PQX A;  1DYQ A;  4OO1 G;  2PMZ B;  1B70 B;  2Q8T A;  4IUN A;  4B3S Q;  4A93 G;  1EQV A;  4NXM Q;  5G3L F;  3NUC A;  4MIU A;  4KHP L;  3NBH B;  3S2H B;  4OO1 I;  1P16 A;  2KA7 A;  4LK1 C;  2WAQ B;  3NBI A;  4PMW A;  1VQ4 A;  1TWG B;  4DNR B;  1XMO Q;  3SDZ A;  1S4Z A;  4KHP Q;  1BBU A;  1LTB D;  1ROD A;  1SR3 A;  1SRO A;  3NWS A;  1V9P A;  4LNQ A;  1STA A;  1EY4 A;  4DR7 Q;  3TP8 A;  4LF8 L;  5GAH C;  4LUV A;  4A76 A;  3IFT A;  2NN6 H;  1STH A;  1STN A;  3HOV H;  2L11 A;  3PIO 3;  4IFD I;  2QKI C;  3U9O A;  1VQO A;  3ULP A;  2JA5 H;  1SFO H;  2K5V A;  3S17 H;  1XMQ Q;  4FXD A;  3TP7 A;  5JVH 3;  1PLF A;  1C48 A;  1O80 A;  1LM0 A;  1ZKO A;  1CSQ A;  1TS5 A;  3M4Q A;  3TP5 A;  5COY A;  2PZT A;  2ZJP A;  5DLQ E;  3H09 A;  3H3V C;  1VQA A;  1VQ7 A;  1WI5 A;  4BBS H;  2VB2 X;  1XPR A;  5I6Y A;  3BZC A;  2UXB Q;  3WWV A;  1JWS D;  1I4G A;  3R2I A;  3KYH C;  1Y8O B;  5M5X B;  5I4D A;  1SNP A;  4ULL A;  4BXX H;  2B63 H;  2ID0 A;  4XYO A;  4HIK A;  3K7A H;  1V1O A;  1EEF D;  5EQ0 A;  4LF8 Q;  3CCM A;  3C1E A;  1EUJ A;  4KY6 A;  3MEH A;  3GTK B;  4Y52 H;  3TRZ A;  3HGB A;  2JA5 B;  4KN7 C;  5IYC H;  1L1O B;  1EFI D; 
#chains in the Genus database with same CATH homology
 3F1Z A;  1IBL Q;  1OTC A;  4P71 A;  4QL5 A;  4YY3 Q;  1D7Q A;  3CCL A;  4J15 A;  3PUZ A;  2VUM G;  4JI4 L;  1O7I A;  1EYG A;  1V43 A;  1TWF H;  3K7U C;  1SN8 A;  4LF9 L;  4JBM A;  1HR0 L;  3PSI A;  1HNW L;  2K5N A;  5C4J H;  2ZTE A;  4L5T A;  1VQD A;  1Y1V G;  3HOW H;  1U0L A;  3K80 C;  3JAM c;  3UDG A;  1L1O A;  4UPA A;  2A1A A;  2WB1 G;  1FL0 A;  3E0E A;  3AYH B;  4X66 L;  2IHE A;  3DLL A;  4DV2 L;  2IX0 A;  4DV6 L;  4GNX B;  2B3G A;  4NXN L;  2JA6 H;  3AFP A;  3HOZ H;  2R93 G;  3LGJ A;  4OON A;  4R4T A;  5JEA G;  1IBM L;  2V1C C;  4IPH A;  4LF5 Q;  4PZ6 A;  1SRU A;  2VQF Q;  4A4I A;  4UP7 A;  4DV1 Q;  3GTP H;  5JJL A;  4A3B G;  3U50 C;  4DR5 Q;  4GKJ L;  1VQC A;  4GLV B;  2ZTC A;  1WJJ A;  1X3F A;  4AYB G;  4A75 A;  1SMX A;  2AWO A;  4LFB Q;  1E24 A;  1Q8K A;  1E1T A;  1E7Z A;  1SE8 A;  2UU9 Q;  3HOY H;  2MO1 A;  1MIU A;  2JK8 A;  3H0G G;  4JBK A;  5J3B A;  1PH9 A;  3PO2 G;  1Y14 B;  1HZB A;  4YHH Q;  3GTK H;  4DV3 L;  2K5H A;  4HJA A;  1OXS C;  4IJL A;  5IYD G;  2JA8 H;  1PHJ A;  1VQP A;  3KDF A;  4DNI A;  3H15 A;  1CKM A;  2PQA B;  5LMN W;  3EIV A;  2NVT H;  1ASY A;  2E5L Q;  1JJG A;  4YHH L;  3S2H H;  2F3I A;  2HT1 A;  1J5E L;  5IP9 H;  2I5H A;  3GO5 A;  1MJE A;  4UY8 C;  1NE3 A;  1YBY A;  3GTL H;  5C44 G;  1IBK L;  3RZO H;  2WFW A;  2VQE Q;  1Q86 C;  1K9M C;  5FLX c;  2QA4 A;  5ELO A;  2NVX H;  1X6O A;  1TXY A;  1VQH A;  2B29 A;  3RLO A;  1HZC A;  3CF5 A;  2KHI A;  4AQY Q;  4B3S L;  3I4N H;  4DAM A;  1N36 L;  3CD6 A;  3G6E A;  1S40 A;  2CQO A;  4DK6 C;  3GTJ H;  4ALP A;  3J80 c;  1NMF A;  3NEN A;  4LF4 L;  4PZ7 A;  4WJ4 A;  3K0X A;  2K52 A;  1UE1 A;  1WFQ A;  1VQK A;  4LWC A;  4DPG A;  5E7N A;  1G6P A;  4X66 Q;  4DR1 L;  4YCV A;  4IFD G;  1YHA A;  2FXQ A;  4DV5 L;  2UXD L;  2R92 H;  1GKH A;  2HIV A;  1YNX A;  1X54 A;  3S1Q H;  1A63 A;  1LYL A;  2RF4 A;  3TEH B;  2RHQ B;  5IWA L;  4HID A;  4K0K L;  4X6A H;  3S24 A;  3H3V H;  5M3M H;  4JI0 L;  2OWO A;  1PH6 A;  4BBR G;  3FKI G;  3KJO A;  3CCS A;  1I3Q H;  2BH8 A;  2EIF A;  3GTQ H;  4GNX C;  1KD1 C;  1GM5 A;  3GTG H;  1JJC B;  5JJK A;  1NMG A;  1PVO A;  3CAM A;  4A3L H;  3L7Z C;  5FLM G;  4PG3 A;  1K8G A;  4A3C G;  5LMN L;  4H02 A;  4DUZ Q;  3T1H L;  4IO9 A;  5EAY A;  1XNQ L;  1N34 Q;  5C0X J;  2VL6 A;  3CP0 A;  4GLX A;  4B3T Q;  2JA9 A;  1XMO L;  2L15 A;  5IY0 A;  2N8N A;  4DUZ L;  2KEN A;  1YEZ A;  1B8A A;  3PUW A;  4QIW E;  4R4Q A;  1YIJ A;  3CME A;  1E3P A;  5LMU Q;  4GOP B;  2Q2I A;  1S72 A;  4JI3 L;  1HNX L;  1VQF A;  4NXM L;  3I2Z A;  3RLN A;  5HGQ A;  1QVG A;  1KC8 C;  2Q2T A;  1S3O A;  3I56 A;  4O2D A;  4AH6 A;  2VW9 A;  4L5S A;  1VQN A;  1JE5 A;  1RIP A;  1K83 H;  3I4O A;  1FGU A;  3D31 A;  2R6G A;  3ERS X;  4IOC A;  3AEV A;  2CKZ B;  1BVS A;  4A3D G;  1OXV A;  4B3T L;  3K81 C;  1EIF A;  3I4M G;  4BBR H;  1EFW A;  2HIX A;  1L0W A;  4JC0 A;  3J7A 5;  4DR4 L;  4BA1 I;  3UE1 A;  5LMU L;  2PMZ E;  2NZO A;  3I55 A;  1YHQ A;  2ES2 A;  4JI3 Q;  2CFM A;  4GN3 B;  4IFD J;  2Z0S A;  4LF4 Q;  4FDB A;  3PUY A;  5GAE C;  1X3G A;  4HIO A;  3AFQ A;  4L5R C;  1C0A A;  1YJN A;  1N34 L;  4B3R L;  3NEM A;  1HR0 Q;  2IY5 B;  2VQF L;  2OCE A;  3U58 A;  3KDF B;  2RHS B;  3HOZ G;  2R93 H;  2GN5 A;  2JA6 G;  1Q7Y C;  3MEF A;  3AQQ A;  2ZM6 Q;  4UP8 A;  1PA6 A;  1NJI C;  4DV6 Q;  1PH1 A;  3I4N G;  2AHO B;  2OQK A;  4LF7 L;  1GVP A;  4A3J G;  2F4V Q;  1VQG A;  1Y1V H;  2YV5 A;  1KQS A;  4JI7 L;  4KI0 A;  3G4S A;  1Q82 C;  4LFA L;  4OWX B;  1GO3 E;  1M1K C;  2N3S A;  5AJ3 Q;  1FJG Q;  1XNQ Q;  3PUV A;  2UUC Q;  5H1S E;  2Y0S E;  1LTL A;  3KF8 B;  4JOI A;  2YTX A;  4DAY B;  1KL9 A;  4TQU S;  3J80 i;  2KCT A;  3S14 H;  2E8G A;  2ZTD A;  4DR2 L;  1HNZ Q;  3KOJ A;  2H5X A;  1UWV A;  1EQR A;  1X65 A;  2CWA A;  3UDX A;  2ZM6 L;  3TS0 A;  1P8L A;  1N36 Q;  2UU9 L;  4GKK Q;  3PUX A;  2R7Z H;  3HOX H;  4XTC S;  2LXJ A;  5M3M G;  4EQ5 A;  1JB7 A;  5M3F H;  3UDF A;  1PH5 A;  3PGZ A;  1NBW A;  3HFZ B;  3MXN B;  1XJV A;  1SLJ A;  1VQM A;  1PV4 A;  1WCM H;  1M90 C;  4GKK L;  1WCM G;  3BZK A;  2UUA L;  2Z6K C;  1MKH A;  1I94 Q;  3I4M H;  4QQB X;  2E5L L;  4MZ9 A;  5M3F G;  4C3J H;  3OTO Q;  1IBK Q;  4GN4 B;  4OX9 L;  5GAD C;  4DUY Q;  4DV0 L;  1ASZ A;  3T1Y L;  3D0F A;  4B3M L;  1EIY B;  1KRT A;  1QVC A;  3CC7 A;  3HOW G;  1UEB A;  2PI2 E;  5M5W H;  3BU2 A;  4BY7 G;  4IPG A;  1KHI A;  1E22 A;  1N9W A;  3UDI A;  3FP9 A;  3CCE A;  3RZD H;  3EBE A;  2I0Q A;  2UXB L;  1IYJ B;  1AE2 A;  4ME3 A;  4NB3 A;  5C44 H;  2E2I H;  4LFC Q;  1N33 L;  1H95 A;  1Q12 A;  1TWH H;  3I7F A;  3KJP A;  3ULJ A;  1RL2 A;  2Z6K A;  4OWW B;  3T1Y Q;  1UE5 A;  2JE6 I;  3STB D;  4BA2 I;  1N33 Q;  2JA8 G;  5IYD H;  3NEL A;  4GLA C;  2YTY A;  4JI5 L;  1IZ6 A;  2D0O A;  3JAM i;  4DV4 Q;  5HY6 A;  3H0G H;  3HOY G;  2JQO A;  1K0R A;  2WP8 J;  2JA7 H;  2WAQ E;  4R4O A;  1U5K A;  4P73 A;  2JA7 G;  1N32 L;  1LUZ A;  3GD7 A;  4DV2 Q;  1PFS A;  4JI2 Q;  4R4C A;  1QZG A;  4RG1 A;  4DUY L;  4DV0 Q;  2LSS A;  2OTL A;  3GTO H;  1JT8 A;  2I5L X;  3HOX G;  2AWN A;  2VY3 A;  2ZJQ A;  3J7Z C;  5IT9 c;  4P74 A;  1XPO A;  4LF6 L;  1UE7 A;  2B63 G;  3H3V I;  2MFI A;  1E1O A;  1HZA A;  5LMN Q;  1I94 L;  5M5Y H;  1BBW A;  1CKN B;  5IP7 H;  1K3R A;  4KLK A;  1AE3 A;  1NTG A;  2JEA I;  4C2M H;  3G71 A;  1VCI A;  2R7F A;  4LW1 A;  3F2D A;  1TWA H;  4DV7 Q;  4KHZ A;  2YU9 H;  3ER0 A;  4A3E H;  4AYB E;  4A3F G;  3CCU A;  4A3E G;  3CCV A;  3S1M H;  2YYZ A;  4BY7 H;  1L1O C;  2D62 A;  3CPW A;  1YVC A;  4A3J H;  2HQL A;  1TWC H;  2DUD A;  1AH9 A;  2VUM H;  4JG2 A;  1D8L A;  5BR8 L;  2YTV A;  1IXR A;  2JEB I;  1VQE A;  4YY3 L;  1XMQ L;  1KRS A;  2OTJ A;  4DR3 L;  1YI2 A;  3PO3 G;  3Q8D A;  3KF6 A;  4QY7 A;  3W1B A;  2QGQ A;  2NVY H;  1CUK A;  4A3L G;  1Q1B A;  4POG A;  4JI7 Q;  3FKI H;  2VNU D;  3HKS A;  4YCW A;  1Y1W G;  2XTI A;  3IRB A;  4YWK A;  2N49 A;  4POF A;  3RN5 A;  2UXC Q;  4YWL A;  4C3H H;  2LXK A;  1PH8 A;  2HHH Q;  3CXC A;  1EOV A;  1YHB A;  2NN6 G;  4GS3 A;  3DM3 A;  3SGI A;  4JI6 Q;  2R7Z G;  1VQI A;  2NZH A;  2D0P A;  3TQY A;  4PZ8 A;  4B3R Q;  5GAG C;  4DR7 L;  2K50 A;  4TVA B;  4JV5 Q;  1MJC A;  4BY1 H;  3F8T A;  2NVQ H;  1WYD A;  2JJQ A;  1G51 A;  1VQ9 A;  2VZA A;  4GN5 A;  3HKZ E;  2AMC B;  1QUQ A;  1I6H H;  1N32 Q;  4AQY L;  4A3K H;  3S15 H;  3ULL A;  3CMA A;  1I50 H;  1X3E A;  2WB1 E;  3OYY A;  2C35 B;  4JOI C;  3CCR A;  4X64 L;  5C0X I;  4BBS G;  3E9H A;  1WOC A;  2Q2H A;  3KF6 B;  3RLF A;  1A8V A;  3A5U A;  2VS1 A;  3PIO A;  4R1J A;  1B7Y B;  1XPU A;  2IX1 A;  3B6Y A;  4A3G H;  1EWI A;  3CC2 A;  4WJ3 M;  5GRO A;  4C3I H;  4LFC L;  1PYB A;  5FJ8 G;  3PCO B;  1YJW A;  2K75 A;  2RCN A;  1YZ6 A;  3W5O A;  5BR8 Q;  4JBJ A;  1KAW A;  4GKJ Q;  4IJH A;  2BH2 A;  1OXU A;  3TRE A;  5ELN A;  3CC4 A;  5JJI A;  3CW2 C;  2KCM A;  3L2P A;  1FVI A;  3KLW A;  2BA0 A;  3PIP A;  4Y7N H;  1PH3 A;  3TS2 A;  2R92 G;  1VQL A;  4DR3 Q;  3M85 A;  1CSP A;  5GQO A;  1HNX Q;  4A3B H;  1FJG L;  5IYB G;  2KBN A;  1T9H A;  4A3D H;  2F52 A;  1W3S A;  4NXN Q;  1UE6 A;  3RR5 A;  2ASB A;  4A3M G;  2UUB L;  2EQS A;  4MNO A;  1IL2 A;  1BKB A;  3EN2 A;  1Q46 A;  4JI1 L;  3W1G A;  4JI0 Q;  1HJP A;  1HNW Q;  4LUO A;  1GD7 A;  4DV5 Q;  4AIM A;  5C3E G;  2UXD Q;  4QJF A;  3CQZ H;  4A3I H;  1K73 C;  3HOU G;  5C4X H;  4HJ5 A;  3UE0 A;  4DR2 Q;  1HNZ L;  4JYA L;  1VQ6 A;  1V1Q A;  5IP9 G;  4HJ9 A;  3S16 H;  2CCZ A;  1IBL L;  2I5M X;  3GTM H;  4A3C H;  3CCQ A;  4XIG S;  4HJ8 A;  1C7Y A;  5IE8 A;  1K8A C;  4R4I A;  4DV7 L;  4RMF A;  1CKO A;  4A3I G;  4GNX A;  2JA5 G;  1DGS A;  3PF4 A;  2HHH L;  1HR0 W;  2R7D A;  4DK3 C;  4JI6 L;  4A3K G;  1XTD A;  2IT1 A;  2GVA A;  2XGT A;  3ZJY C;  1QZH A;  4DR6 L;  4QGU A;  4JBW A;  2K4K A;  1L2F A;  4DV3 Q;  4HIM A;  5IYB H;  1W2B A;  4LF5 L;  2CWP A;  1G29 1;  4JI1 Q;  5C0X G;  1OXT A;  4GOP C;  1PH4 A;  2Y0S G;  1KIX A;  4LF7 Q;  1VQ5 A;  2F4V L;  4DR1 Q;  4BXX G;  1TWG H;  1VQB A;  1Z9F A;  1EQQ A;  2MQH A;  1Q81 C;  3J81 i;  3S2D H;  1PYS B;  3M9B A;  4EX5 A;  4GOP A;  2PNH A;  3RNU A;  4LFB L;  1PH7 A;  3PF5 A;  2NN6 I;  3M3Y H;  4DV1 L;  4DR5 L;  4OO1 G;  2KHJ A;  3K8A A;  3PV0 A;  5M5X H;  1B70 B;  4UP9 A;  4B3S Q;  4LF9 Q;  5FJ8 H;  3M4O H;  4HJ7 A;  4A93 G;  1I5F A;  4X62 Q;  1KXL A;  4NXM Q;  4OX9 Q;  2UUB Q;  2GVB A;  1XNR Q;  4JI8 Q;  4KHP L;  3L0O A;  4A3G G;  5FLM H;  3NBH B;  3RN2 A;  4OO1 I;  5C4X G;  1P16 A;  4X62 L;  4JYA Q;  3U4Z A;  3HOU H;  4DV4 L;  3A0J A;  4PMW A;  1VQ4 A;  1PH2 A;  3GDE A;  2K14 A;  1XMO Q;  4JI8 L;  4KHP Q;  1BBU A;  4OXP A;  3PO2 H;  2AKW B;  4YCU A;  3M7N A;  1SR3 A;  1SRO A;  1IBM Q;  4YWM A;  1V9P A;  4JI2 L;  3J81 j;  4LNQ A;  4DR7 Q;  4JV5 L;  3BJU A;  4LF8 L;  5GAH C;  4A3M H;  4MTN A;  1XNR L;  2PI2 A;  1HH2 P;  1OXX K;  2MO0 A;  4LUV A;  3OTO L;  2Q2U A;  4A76 A;  4IPC A;  4LUZ A;  4JI5 Q;  2UUC L;  1VQJ A;  5JEA J;  2E2H H;  3STB C;  1QVF A;  4B3M Q;  4DR6 Q;  3JC6 6;  3HOV H;  5K36 G;  1QUQ B;  1VQ8 A;  4IFD I;  4JI4 Q;  2A19 A;  2BA1 A;  2ZJR A;  2A8V A;  1VQO A;  2VQE L;  3ULP A;  2JA5 H;  1SFO H;  3KFU A;  2K5V A;  3S17 H;  1XMQ Q;  1Z47 A;  2ALY B;  4DKA C;  1R9T H;  2WAQ G;  4DR4 Q;  4P75 A;  1NY4 A;  4X65 Q;  3HKZ G;  3S1R H;  4O0A A;  2QEX A;  3PO3 H;  5IWA Q;  1LM0 A;  4K0K Q;  1CSQ A;  3M4Q A;  3CCJ A;  2N78 A;  2ZJP A;  5DLQ E;  3T1H Q;  3OW2 A;  1JJ2 A;  3F2B A;  1C9O A;  5IYC G;  2ATW A;  1VQA A;  1A62 A;  5C3E H;  1WI5 A;  1VQ7 A;  4BBS H;  4A93 H;  4L5Q A;  1XPR A;  3S1N H;  3FHW A;  4X64 Q;  3BZC A;  4A3F H;  2PQA A;  4APV A;  2E2J H;  1A0I A;  2UXC L;  2UXB Q;  3WWV A;  1N8R C;  2EXD A;  1X9N A;  2MNA A;  3U4V A;  3KYH C;  1J6Q A;  5AJ3 L;  5IP7 G;  2UUA Q;  1X55 A;  3J81 c;  1Q1E A;  3HOV G;  4IOA A;  4LFA Q;  4BY1 G;  4BXX H;  3A74 A;  2B63 H;  3M4P A;  1JMC A;  4JCV E;  2ID0 A;  3VDY A;  2IHF A;  4NPS A;  4HIK A;  3K7A H;  3E9I A;  4LF8 Q;  4X65 L;  3CCM A;  1CKN A;  1Y1W H;  4OWT B;  1J5E Q;  3F2C A;  1EUJ A;  1X56 A;  4Y52 H;  3TRZ A;  2DGY A;  1YIT A;  1HZ9 A;  2OQ0 A;  4IPD A;  5IYC H;  1L1O B;  3G48 A;  3ICE A;  1YJ9 A;  4LF6 Q;  3A5Z B;  3CPF A;  4P72 A;  1VS0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...