1J6QA

Solution structure and characterization of the heme chaperone ccme
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
100
structure length
100
Chain Sequence
SNLNLFYTPSEIVNGKTDTGVKPEAGQRIRVGGMVTVGSMVRDPNSLHVQFAVHDSLGGEILVTYDDLLPDLFREGQGIVAQGVLGEDGKLAATEVLAKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords cytochrome c maturation protein E
publication title Solution structure and characterization of the heme chaperone CcmE
pubmed doi rcsb
source organism Shewanella putrefaciens
total genus 18
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2002-04-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1j6qA00
1JB7A 4LUOA 4DR7L 1J6QA 4GLAC 4UP7A 4A3EH 3RN2A 3CCSA 1LUZA 2CQOA 1I50H 1V43A 3F1ZA 4QJFA 1IBKL 3T1HL 1SRUA 4DV7Q 2CCZA 3CPFA 3E0EA 4DK6C 4B3RL 4R4OA 1PV4A 1VQFA 1LTLA 2OCEA 2ZTDA 5JJLA 1X6OA 2HQLA 4JI5L 5M3FH 4A3KH 3M4PA 1Q46A 4GKJQ 4A3BH 3PO2H 1NMGA 2BH8A 1IBLL 1X9NA 4KHPL 1UWVA 3D31A 4YCWA 2I5MX 4A4IA 2UUBL 4A3GH 1Q86C 4A93H 4GLVB 1UEBA 5LMNQ 2OQKA 1EIFA 1T9HA 3UDFA 2QEXA 4AQYL 1HNZQ 1HNWL 2R7FA 3U4VA 3HOWG 1EIYB 4NXNL 4GLXA 1A62A 4DNIA 3S1RH 1MKHA 4LUZA 1X56A 4KI0A 4UPAA 1RIPA 2DGYA 4LF8Q 3K81C 4GOPB 5EAYA 2OTLA 1PFSA 4IPDA 2N3SA 1E1OA 1M90C 2UUAL 1KD1C 1BBWA 1Z9FA 4POGA 4DR6L 2UXCL 5IWAL 1VQGA 2GVBA 5E7NA 3L2PA 2YV5A 4GS3A 2F3IA 4LFAQ 1GO3E 3G6EA 3EBEA 3J81c 4IJLA 1GD7A 2PQAB 1CSQA 4HIOA 4OXPA 2ZJPA 3FP9A 4A3LG 3I4MH 3GTGH 3CP0A 2ZTEA 1I6HH 2D0OA 1Q1BA 4JBJA 1WOCA 1HR0L 4A3BG 5GAGC 3M85A 3PO2G 4OWTB 1OXVA 4H02A 4DR3L 1KQSA 1NTGA 1KHIA 4JI4Q 1XNRL 1Q1EA 4X66L 1CKOA 2JK8A 4A3GG 3CPWA 4LFBL 3AFQA 1U5KA 4OX9L 3K8AA 2VNUD 4DV6Q 5M3MG 4BBSH 4DUZL 2KCTA 3GTKH 3PUXA 1N32L 1PH9A 3HOXG 4DR5Q 2E2HH 4WJ4A 3KYHC 3S1QH 2ID0A 2R92G 4NXMQ 3H3VH 4K0KL 2E2JH 3PGZA 2B3GA 5AJ3Q 4OWXB 3A5UA 3HOVH 3KLWA 1S40A 3M3YH 1SE8A 1PVOA 2C35B 2QGQA 4L5TA 2UXBL 1C0AA 1VQMA 3GD7A 1JJCB 1PYBA 2LSSA 4YWMA 1EFWA 5K36G 3RLNA 1Q12A 3CCJA 4GOPC 2R93G 1CSPA 1FJGQ 3E9HA 4B3SL 4DR4Q 4GN3B 3JC66 2XTIA 1L1OB 2DUDA 5FJ8H 3DLLA 4HJAA 2ZTCA 4A3MG 1PH6A 1UE6A 2CWPA 3H15A 3K7UC 4HIDA 4A3CG 4LF6L 3I2ZA 1OXUA 1RL2A 3MEFA 4DV5Q 1YJWA 4JG2A 1I3QH 2LXKA 1K8AC 2UUCQ 5DLQE 4BBSG 4GKKL 4P74A 1X54A 4DV0L 1VCIA 1EYGA 4LFCQ 3HKZE 3CAMA 3GTOH 3PO3H 3OYYA 3CCMA 1L2FA 2VQFL 4DR1L 5GADC 2JA5H 2MFIA 5JJKA 2NVXH 4JC0A 4KLKA 2PI2A 4X62Q 2F4VQ 5C3EG 2K5HA 4AH6A 3CW2C 1HZBA 2K5VA 4XIGS 4JI6Q 2IX1A 1KXLA 1SR3A 3F8TA 3G48A 2CWAA 3S2HH 3J7ZC 1IBMQ 5IYCG 2VZAA 4DR7Q 1KAWA 1VQDA 4UP8A 4DV3L 1XPOA 2I5HA 1SROA 4JYAL 4YHHQ 1TXYA 3CCQA 1Y1VH 1VQ5A 4GN5A 3T1HQ 2VQEL 4Y52H 2Q2IA 1XMQL 1E1TA 2VUMH 4A3FH 4B3RQ 3FKIG 4XTCS 4HJ8A 4JI7Q 3A74A 5H1SE 2PMZE 3H0GG 1X3EA 4GNXA 3HOUH 1PH8A 4GN4B 1OXXK 4R4CA 5LMNW 5ELOA 2D0PA 4A76A 1VQPA 2ZJQA 4R1JA 4LF7L 1V9PA 4YCVA 4X65Q 4JI1L 2UUBQ 2Z0SA 4DR2L 5IT9c 2WB1G 1N36L 1CKNA 3FHWA 2ZJRA 3AYHB 4TVAB 1HNXQ 1MJEA 3J80c 4R4QA 3KF6B 1HNWQ 1A63A 2JA5G 1PH7A 3S14H 3PF4A 1PHJA 4NXNQ 4POFA 3CCUA 2VY3A 1YITA 2K5NA 2IY5B 2UU9L 4BXXG 1CUKA 3UDXA 4BBRG 1YHQA 5IP7G 3I56A 4B3ML 2UUAQ 3PUWA 2AHOB 3GTJH 1Y14B 1X3FA 3UDGA 1UE7A 4DAMA 4DR6Q 2UXCQ 5IWAQ 3TS2A 1MIUA 3J81i 2R7ZH 1C9OA 4DUYQ 4NPSA 3U58A 1YJ9A 2N49A 3J81j 1WYDA 1QZHA 1Q82C 3TRZA 1SN8A 4A3IH 2A1AA 4DPGA 5FLMH 2IHFA 1GVPA 2KENA 1L0WA 2EXDA 2QA4A 2NN6G 1QUQA 2CFMA 2I5LX 1QZGA 3RN5A 1XPUA 3SGIA 3L7ZC 1EQQA 1XJVA 1G291 1SLJA 3M9BA 5IY0A 1A8VA 3CXCA 4A3EG 3EIVA 4JI0L 2NZHA 2CKZB 3HFZB 2ATWA 1ASZA 5IYDH 3GTQH 5JJIA 1VQJA 4DR3Q 1QVFA 1O7IA 3CC2A 1OXTA 4GKJL 1Y1WH 1XNRQ 1KIXA 2AWNA 3M7NA 2Q2TA 4DKAC 1Q7YC 1Z47A 1NBWA 2E5LL 4LFBQ 3IRBA 4YWLA 4DV4Q 4BY7H 2RHSB 1N33L 5M5XH 1VQLA 4DV2L 5C4XH 5M3FG 4A3KG 3I4NH 1MJCA 2K14A 1EOVA 1EUJA 2JEAI 3GTPH 3CD6A 1HNZL 5JEAJ 3RLOA 2AKWB 1TWHH 3OTOQ 2OQ0A 3RR5A 1PH3A 1S3OA 2A8VA 4A93G 1PH4A 1YZ6A 3AFPA 2KBNA 4LF4L 1YI2A 1SFOH 4LF8L 2ZM6L 3KDFA 4HJ9A 2HHHQ 2NVYH 2HIVA 1VQNA 2JA6H 4DV1L 3CCLA 2NVTH 2GVAA 1VQCA 1WJJA 1I94L 1JMCA 2UXDL 4MNOA 5FLMG 1XMOL 1AE2A 1WCMH 5LMUQ 3HOYH 2N8NA 1VQ4A 4JI2L 4YY3L 1TWCH 1WFQA 3TREA 3KJOA 3PCOB 3JAMc 3ULPA 1JJ2A 4B3SQ 5ELNA 2Y0SG 1YNXA 1YVCA 2JA9A 1DGSA 2WFWA 1S72A 2R6GA 1VQ8A 2E2IH 4WJ3M 4JBMA 2NN6I 4YCUA 3I4MG 1HZAA 1XPRA 1VQ6A 1HZ9A 4KHZA 1XNQL 4JBWA 1EQRA 4BY1H 1QUQB 3CF5A 3I4NG 4LW1A 3OW2A 2YTVA 2YTYA 3KF8B 1KRTA 4DV6L 3CC7A 4LUVA 2WP8J 4L5QA 3STBC 4LF5Q 4X64Q 1UE1A 4BA1I 1K73C 4DR5L 3TQYA 2MO1A 1EWIA 2B63H 2JA8H 3UE0A 4NXML 2EIFA 4PZ6A 5C0XI 1P16A 2JA6G 1VQKA 2Q2UA 3BJUA 5AJ3L 3S15H 1OTCA 5JEAG 4NB3A 1XTDA 5IE8A 1B8AA 4JYAQ 3HOVG 2OTJA 1JJGA 5C44H 2NVQH 1SMXA 2VQEQ 3GDEA 2JJQA 1XMQQ 2NZOA 5BR8L 2E8GA 1X55A 4MTNA 4A75A 2VL6A 3VDYA 2KHJA 4JV5L 4DK3C 2BH2A 1VQBA 1YIJA 1IBKQ 1FJGL 4DR4L 2JE6I 2F52A 1K9MC 3DM3A 4LF7Q 2OWOA 2IT1A 1PH2A 1FGUA 4JI1Q 5FJ8G 4GOPA 1K3RA 3J80i 3CMAA 1N8RC 4B3TL 3ICEA 1KRSA 1NJIC 4DR2Q 4IPCA 1N36Q 3PUZA 5C0XJ 1Q8KA 4J15A 2WB1E 2UUCL 3ERSX 4IOAA 3PIOA 1Q81C 4JI5Q 2IHEA 3BU2A 4LFCL 3CCRA 3UE1A 1IBLQ 3RZOH 3T1YL 2AWOA 4JI3L 2UU9Q 4KHPQ 4QQBX 4AIMA 4LNQA 3HOWH 1YJNA 5C4JH 2PQAA 1PA6A 3GTMH 2HIXA 4UP9A 4ALPA 1PH1A 4C3JH 1YEZA 3S1NH 1L1OC 4TQUS 3CCEA 3ULLA 4AQYQ 3PO3G 2GN5A 2RCNA 3B6YA 1YHBA 3K0XA 4A3DH 1IXRA 1FL0A 3HOZG 1E22A 2H5XA 4LF9L 5C44G 3F2CA 4JI8L 2K50A 4P71A 3F2DA 1G6PA 3W1GA 5GAEC 1HR0W 1C7YA 1AH9A 1HZCA 4YHHL 2R7DA 4JV5Q 3AEVA 1QVGA 1UE5A 5GQOA 2HT1A 4JI0Q 3PSIA 3H3VI 1HH2P 1PYSB 4QL5A 1N34L 1HJPA 2ES2A 4IOCA 4A3LH 1Y1VG 3ER0A 4JI7L 1W2BA 3S1MH 1KL9A 4O0AA 3M4OH 5IYBH 1VQEA 3GO5A 3CMEA 3STBD 1ASYA 3PV0A 3KFUA 2VUMG 1D7QA 4PMWA 4A3FG 4A3JH 2E5LQ 4R4TA 4DV7L 4X65L 3A5ZB 1N33Q 3HOUG 1LYLA 4OONA 4DV2Q 2RHQB 2YTXA 1HR0Q 5M5YH 1GKHA 3NEMA 1LM0A 5HY6A 3I55A 2V1CC 1TWGH 5M3MH 1HNXL 4Y7NH 4X66Q 2I0QA 4ME3A 3HOXH 1G51A 4OX9Q 3BZCA 1I5FA 5GROA 4DAYB 4LF4Q 4HJ5A 5C0XG 2ZM6Q 2R92H 4QY7A 4DUZQ 4A3DG 2AMCB 1N32Q 5LMNL 2JEBI 2YU9H 1L1OA 1E3PA 4DV1Q 4QIWE 4RG1A 1I94Q 4GNXB 4OO1G 2EQSA 4JOIC 4K0KQ 5IP9H 1VQ7A 2UXDQ 1TWAH 1XMOQ 4DUYL 4IFDI 3I7FA 4HIMA 3JAMi 4LWCA 2ASBA 3J7A5 2VW9A 1H95A 2Z6KC 4JI2Q 1JE5A 4YY3Q 2JA7H 4HJ7A 2R7ZG 4AYBE 3NENA 1CKNB 4PZ8A 4IPHA 2UXBQ 2L15A 4A3IG 3W5OA 2BA0A 3MXNB 4EX5A 1W3SA 2Y0SE 5FLXc 2R93H 1FVIA 3M4QA 2WAQE 3S24A 5IYBG 3RNUA 3RZDH 3KOJA 1J5EQ 1VQOA 4P75A 4LFAL 3HOZH 4AYBG 4A3JG 4A3MH 1VS0A 1U0LA 2XGTA 5IYDG 4A3CH 2Q2HA 4PZ7A 1XNQQ 1JT8A 2IX0A 5HGQA 4HIKA 1M1KC 2WAQG 1A0IA 4DV4L 2PI2E 2A19A 4IO9A 3LGJA 1Y1WG 1E7ZA 4LF6Q 3PF5A 4X6AH 2K52A 1IYJB 2RF4A 3PUVA 4BY7G 1YBYA 3CCVA 1AE3A 4JI4L 4IFDJ 3A0JA 3OTOL 1K0RA 5C4XG 2KHIA 4GKKQ 1KC8C 3WWVA 1B7YB 1VQAA 1VQHA 3I4OA 4DV0Q 4L5SA 5J3BA 2N78A 5C3EH 2JQOA 3EN2A 5GAHC 2MNAA 3S17H 2HHHL 1BVSA 1X65A 2VQFQ 1VQIA 4DR1Q 1E24A 5IP9G 4JBKA 4IPGA 1BBUA 3BZKA 3PUYA 2PNHA 3U4ZA 4IJHA 5IYCH 3AQQA 4JOIA 2BA1A 1VQ9A 2JA7G 3UDIA 5LMUL 3KJPA 1BKBA 1NE3A 4FDBA 3F2BA 5BR8Q 2Z6KA 4MZ9A 1B70B 1NMFA 4QGUA 1CKMA 3K80C 1D8LA 4OO1I 1QVCA 4DV3Q 4O2DA 3KF6A 1WCMG 4RMFA 3CQZH 3U50C 1TWFH 2VS1A 4GNXC 2LXJA 1K83H 4JCVE 3HOYG 3FKIH 4EQ5A 3H0GH 4C3HH 4UY8C 4APVA 1P8LA 2YYZA 3G71A 4B3TQ 3KDFB 3D0FA 1N9WA 1YHAA 1IZ6A 3HKSA 1J5EL 1V1QA 3E9IA 3S2DH 4C3IH 1WI5A 1OXSC 3GTLH 3T1YQ 1NY4A 4JI3Q 4BY1G 4LF5L 4X64L 4DV5L 3Q8DA 2K4KA 2KCMA 2B29A 3CC4A 4L5RC 4BXXH 3PIPA 4BBRH 3TS0A 5M5WH 5IP7H 4P73A 3ULJA 3HKZG 1X3GA 3G4SA 1K8GA 2ALYB 4YWKA 4BA2I 2B63G 3TEHB 2JA8G 2FXQA 2K75A 3W1BA 3ZJYC 4P72A 3RLFA 4LF9Q 4OWWB 4B3MQ 4R4IA 4IFDG 4JI8Q 4X62L 2F4VL 1GM5A 3L0OA 3NBHB 3NELA 4C2MH 4JI6L 1R9TH 1IL2A 2D62A 3S16H 1PH5A 3K7AH 2MO0A 2MQHA 4PG3A 1N34Q 1IBML
chains in the Genus database with same CATH superfamily
4K8IA 2Z9HA 3V96A 2CQOA 1ZXTA 1GHJA 2EY2A 2SOBA 4MTKA 4KD3A 1PRTB 1Y1WB 1ZYRD 1VQFA 2WIIB 5M5XB 4GKJQ 3D6CA 4IUUA 3M4PA 1Q46A 4A3BH 3PO2H 2XVSA 1IBLL 3OSOA 3P1HA 3D31A 2F0LA 2OQKA 1HA5A 4FXGC 1X56A 1S5FD 4HN7A 3K81C 2VB2X 5EAYA 5IGEA 2J0TD 4IPDA 2LY7A 1PFNA 1KD1C 1A3VA 1BBWA 3EFXD 5E7NA 2GVBA 3KBXA 3J81c 5KNBA 2HQEA 1ET9A 2P5ZX 2D5DA 1CA5A 4A3LG 3VYUA 3I4MH 1CHPD 2EY6A 3VYTA 1HR0L 1G8ZD 4OWTB 1OXVA 4DR3L 1KQSA 1NTGA 5JJZA 1EYDA 2H1EA 3HKZB 3MXGA 5NUCA 4FVMA 4DV6Q 1SYCA 2KCTA 3PUXA 1N32L 1BCPC 3HOXG 2E2HH 4NXMQ 5JEAH 2EYPA 2E2JH 2R61A 3DWPA 4WJWA 1XWEA 4F8MA 3JAML 3A5UA 3HOVH 2B2VC 2NVQB 3K6OA 1S40A 1JICA 1JWUD 3M3YH 3GP7A 1PVOA 2QGQA 4L5TA 1RF2D 2RA4A 4CDCC 1PYBA 3H3VC 3H09A 1Q3LA 1Q12A 3CCJA 4GOPC 1SAPA 1LTRD 1AFPA 2RSNA 4B3SL 4DR4Q 4GN3B 2GA4B 1L1OB 2A5HA 3PIO3 4A3MG 1UE6A 3GV6A 4A3CG 4OIJA 3OPOA 3I2ZA 1OXUA 1LTBD 2RSOA 2QEJC 4JG2A 2KECA 2UUCQ 3HOWB 4BBSG 4GKKL 1B3QA 4N9TA 3PO3H 3CCMA 2F0VA 4JC0A 2PI2A 4X62Q 2F4VQ 1MHWC 3CW2C 5A2QE 1CZWA 1SNCA 5EJWA 3NWTA 2EYMA 1I50B 1SNPA 3G48A 3MC0B 5IYCG 2B2VA 1KAWA 1LV9A 1VQDA 4UP8A 3K5MA 1DONA 1XPOA 5ELFA 4S3SA 4XYQA 2PYKA 2Z4IA 1Y1VH 4GN5A 4Y52H 3P20A 4RGNA 4A3FH 4XTCS 2OXPA 3GQBA 4JI7Q 2PMZE 4FO2A 1PTOC 4C3HG 4H0LC 2HDMA 3KLRA 4XDXA 2SDFA 4GN4B 1OXXK 4R4CA 1PLFA 5CBAE 4A76A 4R1JA 1V9PA 2KUMA 4JI1L 1GXDC 4DR2L 1D5XC 1N36L 1STBA 2R92B 1HNXQ 3KF6B 2G9DA 3A8JE 5C0XH 1PH7A 1A63A 3S14H 2E75C 4KMUC 5FOBB 2VY3A 4BXXG 1E0BA 4B3ML 1A2UA 5DEHA 2AHOB 1X3FA 3UDGA 1UE7A 2F3WA 2EYHA 5E1FA 4XYOA 4XXEA 1YJ9A 1QZHA 3HOZB 5CGKA 2I5LX 1HFNA 3RN5A 4DNRB 1XJVA 3SE0A 2E76C 2FMCA 3EIVA 1VQJA 5KYLA 2F0JA 4DR3Q 5CV4A 2Z1CA 1QVFA 3EROA 4KHVA 3M7NA 3MXPA 3MVVA 4YWLA 4YIJA 3K5OA 4IUVA 1G2SA 2SEBD 5IGGA 4ZK9B 2EXZA 5KEEA 3I4LA 5C3EB 3S17B 3GTPH 1HNZL 5JEAJ 3RLOA 1BBXC 2AKWB 3OTOQ 1PH3A 4PNYA 3SVMA 1YNJD 1GUOA 3HP3A 1YI2A 1VQNA 5FLXL 3CCLA 2NVTH 2GVAA 1VQCA 2UXDL 1XMOL 1TWFB 3FKIB 3HOYH 3H0GB 4ILWA 3JAMc 1S5CD 4B3SQ 1EL0A 1ZEQX 1YNXA 1YVCA 2JA9A 1Q8IA 1VQ8A 1RD9D 5I9OA 4WJ3M 2KEDA 1I4GA 2EDGA 5IGFA 3I4MG 1K8OA 1VQ6A 3NBHA 1HZ9A 2G5DA 3MWYW 1ZYRC 1H9SA 1JOKA 2K04A 2WP8J 4L5QA 4X64Q 1UE1A 4BA1I 2RCFA 3NP8A 1E2WA 1QILA 2PZTA 5C5MA 2B63H 2XN9C 3JAME 1FGBD 2L9HA 4C2MB 2Q2UA 3BJUA 3S15H 4FF4A 3OMCA 5JEAG 1JJGA 3HOVG 2OTJA 4Q5VA 4A3EB 2JSOA 4XQNA 2Q8RE 3OWFA 5BR8L 1B4OA 2ENBA 2BH2A 1IBKQ 3C3LA 1K9MC 3DM3A 2OWOA 1PH2A 1FGUA 1PRTD 4JI1Q 3NE5B 3TP6A 3CMAA 1N8RC 2EE1A 1BR9A 3ICEA 3TBIB 4DR2Q 3X3NA 4IPCA 1N36Q 3PUZA 5JOBA 1Q8KA 5C0XJ 4IOAA 3PIOA 2RDGA 3RUZA 1Q81C 4JI5Q 4A93B 2IHEA 5G3LD 3BU2A 3T1YL 3I91A 1D5MC 1MD2D 3I8ZA 1YNNC 2PQAA 3GTMH 4UP9A 1EIGA 4C3JH 3FEWX 3PO3G 4U673 1EY0A 4A3DH 1FL0A 3SDZA 4IZ8A 2E2DC 1E22A 4LF9L 5C44G 4NW2A 5C5LA 1G6PA 3F2DA 1E2VA 3W3AA 1RHPA 1U4MA 1HR0W 4YHHL 1UE5A 2HT1A 1PYSB 3DUZA 2ES2A 1Y1VG 3ER0A 3GTGB 1MBYA 4O0AA 3M4OH 3GO5A 3CMEA 5IT9E 1D7QA 2B2UC 4A3FG 4R4TA 4DV7L 2K32A 4UHVA 5EKLA 2JYOA 2RHQB 2YTXA 3AB9A 1STAA 3I55A 1LM0A 1TWGH 3GTKB 3ND8A 2CW0C 4X66Q 4H13C 1SMYC 4ME3A 4OX9Q 3S1QB 3BZCA 2KJXA 1I5FA 4HJ5A 5C0XG 2MUYA 5ELCA 1KNEA 1V1PB 4NP5A 4QIWE 1LT6D 4C1NK 2UXDQ 1VQ7A 1XMOQ 3I90A 3I7FA 2XRSD 2ASBA 1EIHA 1NNXA 1O7ZA 1QB5D 1CM9A 1IKMA 2JA7H 1TS3A 4AYBE 3NENA 1CKNB 1JQYD 4PZ8A 4RGMA 2R93H 5FLXc 1W3SA 1KDCA 4ID6A 1FVIA 2IJ0A 2Q2HA 2AUKA 2B2UA 2CQAA 2IX0A 1M1KC 1FR3A 1I3QB 4IO9A 3LGJA 1XTCD 2F0EA 3CU7A 1LTSD 3MA2B 3PF5A 2K52A 3FPUB 4ZLTF 3PUVA 3NTHA 3CCVA 4RKLA 4JI4L 2JA5B 4KY5A 1K0RA 4LJZC 3WWVA 1VQAA 1VQHA 4DV0Q 3SHLA 5FLXE 1ICFB 2N78A 5DM63 3UI2A 4KKTA 4DR1Q 1VQIA 1B50A 3OOCA 4IPGA 1Y8PB 2A73B 2MHVA 1C4QA 4IJHA 4ZAIA 1PTOF 3AQQA 2Z4HA 3UDIA 3OIPA 1RJTA 1NSNS 1EY9A 5BR8Q 4QGUA 1NR4A 2PW5A 2VUMB 4GNXC 3HOYG 2LXJA 1K83H 5LL6S 3VYRA 1H9MA 4RFBA 1QNKA 3KDFB 3HKSA 1V1QA 4P2CB 3S2DH 1OXSC 3GTLH 1I6VC 1NY4A 3T1YQ 3DMUA 4DV5L 2KCMA 4L5RC 3TS0A 1JC7A 5M5WH 5IP7H 4UAIA 3ULJA 1X3GA 1LTID 1K8GA 3GTJB 3CRLC 2B63G 3TEHB 3DEPA 1M8AA 2K75A 4LF9Q 2LS01 1I4XA 3NTIA 2M00A 2JP1A 2QDBA 1GM5A 1SDFA 3NELA 4ULLA 4A3IB 2FFKB 3S16H 1PH5A 5ELEA 3SXHA 1IBML 3TN2A 4DR7L 1J6QA 4UP7A 3RN2A 2SNMA 2KQ3A 1OO9B 2K33A 3EQLC 1Y69U 4DV7Q 2EJGC 4B3RL 4KJOA 2Q8TA 1PV4A 4BY7B 2BCOA 1LTLA 2ZTDA 3I4NB 1I4RA 2BH8A 3NWSA 1JWSD 4KKSA 1UWVA 4RCOA 2I5MX 1UEBA 1EIFA 2QEXA 4QF4A 4AQYL 1AEXA 5BN4A 1EIYB 2JA6B 4NXNL 4GLXA 1HUMA 3S1RH 1PFBA 1MKHA 2TSSA 4LUZA 4C3JG 2DGYA 2N3SA 1WCMB 1M90C 3QOJA 1CZGA 5IWAL 1VQGA 1II3A 4KY7A 1GO3E 1VF5C 3F2UA 2NYZD 4RGTA 1ILPA 1BXTA 4OXPA 2ZJPA 1WTOA 3FP9A 4CDDC 1I6HH 4BY1B 2B2YC 1WOCA 4H02A 1CA6A 4V0BA 4JI4Q 1XNRL 4LFBL 1PRTC 3E5SA 3AFQA 1U5KA 3QO2A 2JA8B 2VNUD 4BBSH 1JOOA 3H6MA 3D8GA 4HCEA 2K28A 1NR2A 2ID0A 2L12A 4K0KL 1IW7D 3BYTB 4CBVA 4FP5D 5AJ3Q 1UAPA 5E3FA 3PQIA 4EQPA 2C35B 1HTPA 2UXBL 4U68A 1C0AA 3GD7A 1X32A 4YWMA 5KNDA 3RLNA 5IGBA 2R93G 4HSVA 1EY6A 5D3IB 5EPLA 3E9HA 4UDUC 3RZOH 2LMCB 5IOCA 1O78A 4X3UA 2B2YA 1VF7A 2DNCA 1IKLA 4DV5Q 4HMJA 4DAPA 2LXKA 5C4JB 3LNNA 3SK8A 1EYGA 3LX0A 4H7BA 3CAMA 3GTOH 3OYYA 3BG3A 3D4DA 2VQFL 5GADC 2MFIA 5JJKA 2NVXH 2NTTA 4AH6A 1HZBA 1AN8A 4LMQD 2B8GA 1SR3A 3G6JB 3HS0C 3T51B 4IUTA 1IBMQ 3LWUA 4DR7Q 5FKAC 4BS9A 3M7GA 1WD1A 2I5HA 4JYAL 3CCQA 2B2TC 3S1MB 1V1OA 1F2MA 4HJ8A 4B3RQ 1GUGA 3A74A 3HGBA 3MZ5A 5J1ZA 3HOUH 1F9QA 4Z9CB 1PH8A 2RQXA 5TSSA 4X3KA 5ELOA 5M3MB 4X65Q 4Y7NB 3KLSA 1EYAA 3FHWA 2ZJRA 3AYHB 3NBIA 2EZVA 2JA5G 4NXNQ 2YU9B 5JAVA 1CUKA 1UUPA 1YHQA 4MIUA 5IP7G 1TWAB 3VR3A 1ENCA 5CV5A 4NDXA 1HQRD 5IWAQ 4DUYQ 4NPSA 1TQOA 1WYDA 1WTXA 2EY1A 1A15A 4DPGA 2KENA 1L0WA 3RZDB 2EXDA 1XPUA 1QUQA 2CFMA 1EQQA 4RAUC 2B2TA 3CXCA 5IYDH 2NZHA 1XX8A 4I7ZC 2A69C 2FJ2A 4IALA 3KLSX 1Y1WH 1XNRQ 1XYIA 2E74C 2Q2TA 1Z47A 4LFBQ 3E6ZX 4L6TB 4OGQC 5M5XH 1MI2A 5M9OA 1MJCA 1EOVA 1EUJA 1SNOA 1TU2B 1YZ6A 3N52A 4LF4L 4LF8L 4HJ9A 2NVYH 2HIVA 3J81E 4QUFA 5LHY1 2L11A 4EQOA 5FLMG 3CQZB 1AE2A 2RKSA 1VQ4A 1WFQA 4I7AA 3KJOA 3O13A 5BN5A 2J4XA 3PCOB 3DEOA 4K5XA 4HMIA 4EQNA 1ESRA 1HRJA 4EGVA 4C3IB 4JBMA 2WB1B 4YCUA 3TSSA 3BS1A 3Q0AA 2L0CA 1XNQL 1EQRA 3I4NG 1QUQB 4LW1A 3ONAB 5T1GA 3OW2A 2A68D 4BBRB 1TT2A 3R2IA 3STBC 2L5TA 1K73C 4DR5L 5I2YA 1TY2A 4KN7C 2JA6G 5EQ0A 1VQKA 5EKKA 1OTCA 3K7AB 3VA5A 1LABA 1I4HA 4NB3A 4HSPA 1BOSA 1XTDA 5IE8A 1R4PB 4JYAQ 1S5ED 5C44H 4LAAA 2NVQH 4KN4C 1SMXA 5I4DA 3GDEA 2JJQA 3WDNA 2NZOA 3FDTA 2E8GA 1X55A 4EVOA 2VL6A 4DF7A 2KHJA 4JV5L 5JPMC 1EY7A 2XNAC 1FJGL 5KYIA 5FK9C 5M3FB 4A3KB 2O2LD 3GV3A 4GOPA 1K3RA 1KLGD 1G6ZA 2AQ3B 4TKOB 4J15A 3ERSX 4IUPA 4A3GB 1BF4A 4LFCL 3CCRA 1IBLQ 3UE1A 3TMEA 3HOWH 5CBEE 1PH1A 2F0TA 4TQUS 3CCEA 3ULLA 5I6YA 2GN5A 5E4WC 4HCSA 1I4QA 3KK7A 2H5XA 1IW7C 2Y0SB 1AH9A 3IL8A 1PRTF 1HJPA 1W2BA 1KL9A 3BDOA 4DAVA 1BCPB 3KFUA 2F3VA 5G3LF 1VDZA 1CK1A 5KNCA 3HOUG 4KKUA 1HR0Q 5HY6A 1O7LA 3A55A 4LF4Q 1B1ZA 2R92H 2F4IA 3MFGA 4QY7A 5CV6A 2AMCB 1N32Q 5LMNL 1E3PA 3T4AC 1TY0A 4RG1A 4OO1G 2EQSA 4JOIC 5ELBA 4IFDI 4HIMA 4ABNA 2VW9A 2N88A 1JE5A 4RGOS 4HJ7A 2F0DA 4OELB 5K36H 5L37A 4IPHA 2DY7A 2BA0A 3W5OA 4EX5A 4H44C 5IYBG 3M4QA 3S24A 4R8IA 1SEBD 3HOZH 4DXFA 4AYBG 2B8FA 4CKBA 4A3JG 2O5IC 1WTVA 5IYDG 1XNQQ 3T53B 4DV4L 3IKJA 2EOTA 2QW7A 5D14A 1DOKA 1E7ZA 1Y1WG 3AMUA 3K5NA 1JOQA 2QF7A 4X6AH 1IYJB 4G57A 1YBYA 2MPMA 3SK4A 2LFNA 2KHIA 4KTAA 3R93A 4GKKQ 1ET6A 3I4OA 1KAAA 4FXDA 5C3EH 3S17H 1EY5A 2HHHL 4FYDA 4CHTB 4L8JA 1E24A 5IP9G 2F0QA 4JBKA 5FO8B 4PV1C 3VR2A 3S2HB 1BBUA 1DM0B 2C9OA 1SYGA 1PTOB 1HUNA 1EY4A 4JOIA 1EYCA 5LMUL 3SEBA 1K0SA 4FDBA 1B70B 1CKMA 1JCKB 1D8LA 4OO1I 1QVCA 4JV5Q 2F0GA 1TWFH 2VS1A 3FKIH 4EQ5A 3H0GH 4UY8C 1P8LA 2YYZA 1LACA 1N9WA 1IZ6A 1EEID 1J5EL 2QILA 5K5PA 3T13A 1G2TA 1WI5A 3D3RA 4LF5L 1S5DD 2DJGC 2K4KA 3Q24A 1RTNA 3HKZG 1EU4A 4ODGA 4WORA 2FXQA 2NZ1D 3W1BA 4OWWB 2R7ZB 1EEFD 3RLFA 3Q23A 4B3MQ 4R4IA 4K2LA 2KA7A 4K5VA 3D6WA 1H9JA 3NBHB 4K14A 4C2MH 2CHBD 4ZYSA 4JI6L 2D62A 1CQFA 4IQZA 3MXUA 3W2DA 3J7YW 1H9SB 1GUTA 2MQHA 4PG3A 1KNAA 1PXUA 4GLAC 2A6HD 4K2KA 4A3EH 2SNSA 1RDPD 3GTQB 2IL8A 3F1ZA 4QJFA 2WAQB 3BYYB 4HEDA 1PYWD 3T56B 1F2YA 4CKEA 1LT3D 1SRUA 2K05A 1ENAA 2EJFC 2CCZA 4DK6C 4C3IG 3NQTA 2OCEA 5C4XB 1X6OA 2HQLA 3E0JA 4G4KA 2VXWA 1X9NA 4DNTB 1TWHB 4KHPL 2BDNA 4TRDA 2M9VA 4A4IA 2UUBL 4FNFA 1Q86C 4A93H 5LMNQ 1SFOB 1HNZQ 3U4VA 1SNQA 3HOWG 2IPKD 1FNVA 4KI0A 4DA2A 4KY6A 1JORA 3QIAA 4J1MA 3C1EA 1B2TA 2OTLA 1ML0D 1DXMA 1E1OA 1F2LA 1Z9FA 2UXCL 1Z7TA 1IL8A 3M4YA 1TWCB 3KF8A 1A6XA 3G6EA 1RCVD 4IJLA 2PQAB 1F9SA 1CSQA 2E2IB 3EA6A 3A7AB 1A3TA 1B3AA 1VMCA 3GTGH 2ZTEA 4X3TA 2CH4W 3M85A 1KHIA 4ZCKA 1ESFA 1IYUA 3J7AF 1CKOA 4A3GG 1EOTA 4XT1B 3MTSA 1Y8OB 4DUZL 3GTKH 1PH9A 4MHEA 4WJ4A 2K03A 3KYHC 1NUCA 3S1QH 2R92G 1WTWA 3A8IE 4IURA 2B3GA 3KLWA 1RODA 2F0NA 4RCNA 1LTTD 1U4PA 5CV7A 1VQMA 3T16A 1JJCB 1EFWA 2LSSA 1C48A 5K36G 2BE5D 1CSPA 5FJ8H 3DLLA 1J5EQ 2DUDA 3HOZG 2ZTCA 3SK6A 3H15A 1WTRA 4TSSA 2IX3A 4LF6L 5ISRA 3MEFA 4IN3A 1WD0A 3TZDA 4G7ZC 1RKNA 1I3QH 1K8AC 3HG9A 3MHBA 4P74A 1F9RA 1X54A 4K6DA 3S1NB 3FRPB 1TS5A 3HKZE 3L9AX 1L2FA 1AZPA 2JA5H 1MGSA 5C3EG 2BDOA 1J9OA 2K5HA 2K5VA 4XIGS 4JI6Q 2IX1A 2PW7A 2RDFA 3A56A 2CWAA 3DWAA 2VZAA 2F0OA 4DV3L 4K6LA 1YNJC 1E2ZA 1SE4A 4YHHQ 1TXYA 4DAYA 2LKVA 4GZYC 5ELDA 1E1TA 1W6JA 2VUMH 1HCZA 1ICWA 5IIFA 3FKIG 5H1SE 3H0GG 2DNEA 1X3EA 4GNXA 5LMNW 5M5YB 2H4OA 4J8QA 1QCBD 2OEOA 4YCVA 2UUBQ 1K28A 3HOXB 2CVRA 2NWGA 2O5JC 3I72A 3MXNA 3PF4A 2PCFB 3K59A 2K5NA 3I56A 1FD7D 2F0KA 3GTJH 1Y14B 2UXCQ 4DAMA 3TS2A 1MIUA 1H9KA 1C9OA 4C56C 1M4VA 1Q82C 3J81j 4A3IH 2A1AA 5FLMH 1GVPA 2QA4A 5C6AA 4B08A 1QZGA 4A3MB 3L7ZC 3NTKA 1G291 1SLJA 4A3EG 4RWSC 2CKZB 1ASZA 5JJIA 4HAEA 2V4DA 1O7IA 1QOHA 4GKJL 1KIXA 4DKAC 4OEMB 2E5LL 2QDLA 4RHSA 3IRBA 4BY7H 2RHSB 3VA7A 1N33L 1HHVA 2Z6BA 3I4NH 2K14A 1G91A 3CD6A 3RR5A 1S3OA 1X3QA 5I2XA 4A93G 2F0WA 1PH4A 4ZQ3A 3AFPA 2KBNA 1SJED 4O1NA 4RH6A 2PZWA 3H91A 2JA6H 4DV1L 1TIID 2I46A 1IYVA 2F0PA 2EYFA 1WCMH 3ZYYX 5JVG3 2RVLA 4JI2L 4YY3L 3TREA 1DJRD 4C3HB 3ULPA 1JJ2A 2WFWA 1EWCA 2A6HC 2MGSA 2XSCA 1EU3A 3TZUA 1XPRA 3SK5A 4KHZA 4JBWA 2ZXRA 4BY1H 1EZ8A 5E4XA 4CGYB 2YTVA 1QNUA 2XWJB 2D9UA 2YTYA 1A2TA 4DV6L 3CC7A 4LUVA 5KIXA 1IHZA 2NTSA 1TS2A 3P75A 2JA8H 4NXML 4IFDH 1STYA 3K58A 4KJNA 1WVLA 3K57A 1R9TB 3LWEA 5A2QL 1DCZA 4R9WA 1B8AA 2K7VA 2KVMA 5COYA 1S5BD 5KGUA 3BDLA 4MTNA 3U9OA 3VDYA 4BWGB 4OL7A 4DK3C 4DR4L 1VQBA 2JE6I 3C2PA 2IT1A 3SR1A 2DJFC 5FJ8G 4A3BB 3PO2B 3J80i 3EJIA 4M1UB 2K6AA 1NJIC 1SYDA 1EQTA 3MEHA 2UUCL 5EKIA 1B9MA 3Q6SA 2AWOA 4AIMA 4LNQA 1Y8NB 1YJNA 5C4JH 1PA6A 2HIXA 4ALPA 1BUVT 1YEZA 4B9XA 1L1OC 3L3OC 4ZKCB 4AQYQ 2RCNA 1YHBA 3K0XA 1IXRA 3TP5A 4N8FA 2RBMA 4OO1H 4NKLA 1PZKD 2K5DA 5GAEC 1HZCA 3A54A 2L4NA 1PMRA 4O42A 3PSIA 2B2WC 4N8X1 3I4MB 4IOCA 4JI7L 4G7OC 3S1MH 5IYBH 1ASYA 3PV0A 2VUMG 3PMFA 4A3JH 2E5LQ 2BE5C 1SE2A 5CORA 1N33Q 1EY8A 1PFMA 2MJ8A 2BOSA 3HRZC 3QB3A 5JPNC 3NEMA 1HNXL 5M3MH 2N55A 2NVYB 5J22A 2F0SA 4Y7NH 2K5QA 1JE4A 3NQIA 2E2HB 1ONLA 1STNA 4G7HC 4RKBA 3RMHA 4CDFC 5GROA 2E2JB 4Q0FA 2JEBI 2YU9H 1L1OA 1O80A 4DV1Q 2VB3X 3HOVB 4K0KQ 5IP9H 1TWAH 3M3YB 1HQMC 5C3XA 1WTPA 4JI2Q 4YY3Q 1BO0A 1HTLD 2ICIA 2DY8A 2UXBQ 2L15A 4A3IG 1HA6A 2WAQE 2B2WA 3RZDH 1VQOA 4P75A 4LFAL 3QOLA 1VS0A 1YNND 2AQ1B 1F77A 1BDOA 5HGQA 3EVQA 2EJMA 2EVBA 4BY7G 3PO3B 1AE3A 3OMGA 3A0JA 4IFDJ 4K5WA 3OTOL 4L5SA 5A35A 3I70A 2JQOA 3EN2A 2MNAA 3DXJC 5C44B 3K0YA 1BNZA 1BVSA 1X65A 2F0UA 3A7LA 4FXKC 2VQFQ 4HTHA 3TP7A 3N6RA 3QR8A 3BZKA 2PNHA 2HDLA 2IWHA 2EY5A 1VQ9A 1DOMA 3DM1A 1JWMD 5T1IA 5DM73 1BKBA 1Y1VB 3F2BA 4MZ9A 2F1MA 1NMFA 5IODA 3K80C 3K5LA 4O2DA 3KF6A 1KTKA 1WCMG 3CQZH 3U50C 4A3FB 2RDHA 4JCVE 1GUWA 1FYCA 1GJXA 2AQ2B 2CW0D 5D65A 4APVA 1QWYA 1SMYD 1LTAD 4CJ2C 3G71A 2WV6D 2EPBA 1YHAA 2NB0A 4C3IH 1KDAA 2WKCA 3E3XA 1DYQA 4L63B 3S14B 4BY1G 3VR4A 4DN4M 1SE3A 4X64L 1U9RA 4QB4A 1J8IA 3Q8DA 1SNDA 1CQVA 2B29A 4JW0A 4PMBA 3CC4A 4BBRH 1PZJD 1LLRD 3G4SA 1LT5D 2ALYB 4IUQA 5BN3A 5HURA 4BA2I 2JA8G 1F9PA 3HEJA 3ZJYC 4IFDG 4ME5A 3OW7A 4HR7B 3L0OA 2G9HD 2PQEA 3K7AH 2NN6H 4MN3A 1HFGA 1JB7A 4LUOA 5I9PA 1T5EA 3FPPA 1L0XB 3CCSA 1LUZA 1CI3M 1I50H 1V43A 1IBKL 4X3SA 3T1HL 1K8MA 5IT9L 3CPFA 3E0EA 3QJYA 4PQXA 4R4OA 3J80L 3D4WA 5JJLA 4JI5L 5M3FH 3S9WA 4A3KH 5J39A 1NMGA 2EYLA 3GTPB 4C1NI 4YCWA 3KBGA 1SYEA 3TDQA 3J7AV 4A3GH 4GLVB 4NMZA 5AFWA 1T9HA 3UDFA 1HNWL 3DHQA 4WRDA 2R7FA 3VR6A 4ZKBB 3BVGA 4ZUJA 1A62A 4DNIA 2NVTB 5LL6X 4OIKA 1RIPA 4UPAA 4LF8Q 1W6KA 3VYSA 1ZKOA 2HCCA 4GOPB 1PFSA 4QCLA 4JPBW 5C3WA 2UUAL 3HOYB 4POGA 1A3UA 4DR6L 3L2PA 1U4LA 2YV5A 4GS3A 2F3IA 4LFAQ 3EBEA 2B39A 3ITPA 1Q90A 1GD7A 4M8AA 4HIOA 5IGCA 2Z8LA 4RHRA 2TMPA 3CP0A 5CYUA 2D0OA 1Q1BA 4JBJA 1GUSA 5GAGC 3PO2G 4A3BG 4ZUIA 5IGDA 1Q1EA 4X66L 1FNUA 3TP8A 2JK8A 1GOZA 3CPWA 4OX9L 4FF2A 2B63B 3K8AA 5M3MG 5EPJA 4DR5Q 3S15B 1MSGA 4PMCA 3H3VH 1WTHA 2F0FA 1QJOA 3PGZA 4OWXB 1QG7A 1SJHD 2KCCA 1SE8A 3ND9A 1EFID 4IUNA 1STEA 1SYBA 3NK9A 4CJ0B 1EQVA 1T5XD 3JC66 2XTIA 1PZID 4HJAA 1FJGQ 2NBFA 1PH6A 2CWPA 2F0HA 4HIDA 4DFAA 2F0MA 1RL2A 1YJWA 4QUCA 1UNSA 1X3PA 2KOLA 5DLQE 3OWEB 2OT2A 3GTMB 5CC4A 4C3JB 5C4ZA 1VCIA 1Z6HA 4DV0L 4LFCQ 2HCIA 3V05A 4A3DB 4DR1L 1O7YA 4KLKA 1KXLA 3F8TA 2EYOA 4JK1C 4QMGA 3C1FA 2JXMB 3S2HH 3J7ZC 1PTOH 2EYJA 2K5WA 1GUNA 1CT1D 5F2DA 3G7LA 1AZQA 1SROA 5JVH3 5EGTA 3M4OB 1VQ5A 3IFTA 3T1HQ 2VQEL 2Q2IA 1XMQL 2A6ED 1V1PA 2FMMA 1C8CA 4XQQA 3HZXA 1JB3A 2X6LA 2D0PA 2OF1A 1VQPA 2ZJQA 1TWGB 3R2TA 4LF7L 3P7JA 3NSWA 1ENFA 2WINB 5EBDA 4F87A 2Z0SA 5IT9c 2WB1G 1D6EC 1CKNA 2PZUA 4TVAB 1MJEA 3J80c 4R4QA 1HNWQ 3WOEA 1PHJA 3OIQA 4POFA 3CCUA 1CHQD 1HPCA 3BVMA 1YITA 2UU9L 2IY5B 4BBRG 3UDXA 1D2BA 4DGZA 2O4XA 2UUAQ 2A68C 3PUWA 4DR6Q 2JA7B 3J81i 2R7ZH 3U58A 2HD3A 2N49A 3TRZA 2R93B 2ZXPA 1JR0D 1SN8A 2C5CA 2IHFA 2NN6G 2KCNA 1BCPF 1CTMA 3SGIA 1PDQA 3J80E 3M9BA 4XT3B 5IY0A 1A8VA 4JI0L 2ATWA 2XWBB 3HFZB 3GTQH 3R3OA 4KV6A 3I73A 1AW7A 5D3DA 3CC2A 1OXTA 3QG1A 2AWNA 1Q7YC 1NBWA 4DV4Q 1VQLA 1ILQA 1EWHA 4DU9A 5C4XH 5M3FG 4DV2L 4A3KG 5CV8A 1K3BC 1LO5D 2KHSA 2K01A 2JEAI 5CV9A 3ERQA 3NHHA 1TWHH 2OQ0A 2A8VA 1SFOH 2ZM6L 2ZXOA 3KDFA 2HHHQ 1FNWA 3C46A 1D5ZC 2ICEC 1WJJA 3X3MA 1D1KA 1I94L 1JMCA 4MNOA 5LMUQ 1K83B 3NXWA 2N8NA 5DNFA 3R8BA 1TWCH 4LK1C 2F03A 5KRUA 1LTGD 5ELNA 2Y0SG 1KABA 1KLUD 4KD4A 1DGSA 1S72A 2R6GA 3S2DB 2PMZB 2E2IH 2NN6I 1DOLA 1HZAA 1RTOA 3GTLB 1SNMA 3CF5A 3PIP3 2J7ZA 3KF8B 5M5WB 1KRTA 4DXGA 4F7XA 4LF5Q 1D1IA 3TQYA 2MO1A 3V2TA 1EWIA 2D2CC 2X69A 3UE0A 2EIFA 3D4RA 4PZ6A 2NUCA 5C0XI 1P16A 4F88A 5AJ3L 3S16B 4N9PA 4FF3A 2A69D 1STHA 5CR3A 3KUPA 2VQEQ 1B44D 1XMQQ 4JVZA 3A8KE 1AP0A 4OHJA 4A75A 3MAQA 3CKIB 4R8NA 1YIJA 3QWNA 4B9WA 2F52A 4LF7Q 1SBBB 1TVXA 3WOFA 4B3TL 1KRSA 2QCPX 2X6GA 1STGA 2WB1E 3CHBD 3IAYA 1BCPD 2IW3A 3AU7A 3FMCA 4JI3L 2UU9Q 2QKIC 4KHPQ 4QQBX 2PO4A 3S1RB 4ZRZA 3S1NH 3U9SA 3B6YA 2I07B 3BDCA 1NCVA 4I65A 3BVZA 1BQQT 3F2CA 4JI8L 4E6IA 2K50A 3CRKC 2L1BA 4P71A 3W1GA 1SXTA 2KEEA 1C7YA 2R7DA 3AEVA 1QVGA 1DD2A 5GQOA 2AUJD 2CH4A 4FF1A 1L0YB 4JI0Q 3H3VI 1HH2P 1MSHA 4QL5A 1N34L 4KK7A 4K8JA 4A3LH 1VMPA 1I6HB 1VQEA 1GHKA 3STBD 4PMWA 5FO9B 4X65L 3A5ZB 1LYLA 4OONA 4DV2Q 2PPBC 3NPPA 5M5YH 1GKHA 4CJ1B 4BBSB 2V1CC 2I0QA 2Q8IB 3HOXH 1G51A 2MP1A 4DAYB 2ZM6Q 4DUZQ 4A3DG 2XIWA 1S4ZA 3H94A 3BZDB 4CDEC 3I3CA 3NUCA 4CKCA 1I94Q 4GNXB 2PNRC 5DAUA 3J81L 4DUYL 2M2LA 3J7A5 3JAMi 4LWCA 4DK1A 1H95A 1F2ZA 2Z6KC 2R7ZG 4XQJA 1PTOD 3MXNB 2Y0SE 2JN4A 1B9NA 3RNUA 3RZOB 3KOJA 4A3MH 3RD4A 1U0LA 2XGTA 4A3CH 4PZ7A 2WACA 1U4RA 1JT8A 2A6EC 4HIKA 2WAQG 1A0IA 2PI2E 2A19A 1WTQA 3DWQA 1SYFA 4LF6Q 2ZT9C 1HXYD 2RF4A 1QE6A 3GTOB 5C4XG 5EPKA 1KC8C 2F0IA 2NVXB 1B7YB 5J3BA 2WKDA 5GAHC 3PUYA 3U4ZA 3URYA 1UEAB 2FINB 2BA1A 5IYCH 2JA7G 2HUGA 5I6WA 1SSOA 3KJPA 5CMDA 1NE3A 2Z6KA 4DV3Q 4RMFA 3Q22A 4RA8A 3FVQA 1EZ6A 1TKWB 3HOUB 4C3HH 5EBCA 1LT4D 4B3TQ 3D0FA 1I4PA 1B53A 3OHXC 1TS4A 3E9IA 2XRQD 1CFMA 4DK0A 2A74C 4J6HA 4JI3Q 1NAPA 1XXGA 4V190 4BXXH 3PIPA 4P73A 1KDBA 2K1BA 1H9RA 1V8QA 4WFN3 4YWKA 2R3ZA 3IFDA 5HGTA 4P72A 2FHTA 2DN8A 4QIWB 4JI8Q 4X62L 2F4VL 5C4HA 3MFYA 5FO7B 1IL2A 1R9TH 1N34Q 1TR5A 1DZ1A 2MO0A 2L55A 3K7UC 3VR5A 1R4QB 4AYBB 4A3JB
chains in the Genus database with same CATH topology
1JB7A 4LUOA 4DR7L 1J6QA 4GLAC 4UP7A 4A3EH 3RN2A 3CCSA 1LUZA 2CQOA 1I50H 1V43A 3F1ZA 4QJFA 1IBKL 3T1HL 1SRUA 4DV7Q 2CCZA 3CPFA 3E0EA 4DK6C 4B3RL 4R4OA 1PV4A 1VQFA 1LTLA 2OCEA 2ZTDA 5JJLA 1X6OA 2HQLA 4JI5L 5M3FH 4A3KH 3M4PA 1Q46A 4GKJQ 4A3BH 3PO2H 1NMGA 2BH8A 1IBLL 1X9NA 4KHPL 1UWVA 3D31A 4YCWA 2I5MX 4A4IA 2UUBL 4A3GH 1Q86C 4A93H 4GLVB 1UEBA 5LMNQ 2OQKA 1EIFA 1T9HA 3UDFA 2QEXA 4AQYL 1HNZQ 1HNWL 2R7FA 3U4VA 3HOWG 1EIYB 4NXNL 4GLXA 1A62A 4DNIA 3S1RH 1MKHA 4LUZA 1X56A 4KI0A 4UPAA 1RIPA 2DGYA 4LF8Q 3K81C 4GOPB 5EAYA 2OTLA 1PFSA 4IPDA 2N3SA 1E1OA 1M90C 2UUAL 1KD1C 1BBWA 1Z9FA 4POGA 4DR6L 2UXCL 5IWAL 1VQGA 2GVBA 5E7NA 3L2PA 2YV5A 4GS3A 2F3IA 4LFAQ 1GO3E 3G6EA 3EBEA 3J81c 4IJLA 1GD7A 2PQAB 1CSQA 4HIOA 4OXPA 2ZJPA 3FP9A 4A3LG 3I4MH 3GTGH 3CP0A 2ZTEA 1I6HH 2D0OA 1Q1BA 4JBJA 1WOCA 1HR0L 4A3BG 5GAGC 3M85A 3PO2G 4OWTB 1OXVA 4H02A 4DR3L 1KQSA 1NTGA 1KHIA 4JI4Q 1XNRL 1Q1EA 4X66L 1CKOA 2JK8A 4A3GG 3CPWA 4LFBL 3AFQA 1U5KA 4OX9L 3K8AA 2VNUD 4DV6Q 5M3MG 4BBSH 4DUZL 2KCTA 3GTKH 3PUXA 1N32L 1PH9A 3HOXG 4DR5Q 2E2HH 4WJ4A 3KYHC 3S1QH 2ID0A 2R92G 4NXMQ 3H3VH 4K0KL 2E2JH 3PGZA 2B3GA 5AJ3Q 4OWXB 3A5UA 3HOVH 3KLWA 1S40A 3M3YH 1SE8A 1PVOA 2C35B 2QGQA 4L5TA 2UXBL 1C0AA 1VQMA 3GD7A 1JJCB 1PYBA 2LSSA 4YWMA 1EFWA 5K36G 3RLNA 1Q12A 3CCJA 4GOPC 2R93G 1CSPA 1FJGQ 3E9HA 4B3SL 4DR4Q 4GN3B 3JC66 2XTIA 1L1OB 2DUDA 5FJ8H 3DLLA 4HJAA 2ZTCA 4A3MG 1PH6A 1UE6A 2CWPA 3H15A 3K7UC 4HIDA 4A3CG 4LF6L 3I2ZA 1OXUA 1RL2A 3MEFA 4DV5Q 1YJWA 4JG2A 1I3QH 2LXKA 1K8AC 2UUCQ 5DLQE 4BBSG 4GKKL 4P74A 1X54A 4DV0L 1VCIA 1EYGA 4LFCQ 3HKZE 3CAMA 3GTOH 3PO3H 3OYYA 3CCMA 1L2FA 2VQFL 4DR1L 5GADC 2JA5H 2MFIA 5JJKA 2NVXH 4JC0A 4KLKA 2PI2A 4X62Q 2F4VQ 5C3EG 2K5HA 4AH6A 3CW2C 1HZBA 2K5VA 4XIGS 4JI6Q 2IX1A 1KXLA 1SR3A 3F8TA 3G48A 2CWAA 3S2HH 3J7ZC 1IBMQ 5IYCG 2VZAA 4DR7Q 1KAWA 1VQDA 4UP8A 4DV3L 1XPOA 2I5HA 1SROA 4JYAL 4YHHQ 1TXYA 3CCQA 1Y1VH 1VQ5A 4GN5A 3T1HQ 2VQEL 4Y52H 2Q2IA 1XMQL 1E1TA 2VUMH 4A3FH 4B3RQ 3FKIG 4XTCS 4HJ8A 4JI7Q 3A74A 5H1SE 2PMZE 3H0GG 1X3EA 4GNXA 3HOUH 1PH8A 4GN4B 1OXXK 4R4CA 5LMNW 5ELOA 2D0PA 4A76A 1VQPA 2ZJQA 4R1JA 4LF7L 1V9PA 4YCVA 4X65Q 4JI1L 2UUBQ 2Z0SA 4DR2L 5IT9c 2WB1G 1N36L 1CKNA 3FHWA 2ZJRA 3AYHB 4TVAB 1HNXQ 1MJEA 3J80c 4R4QA 3KF6B 1HNWQ 1A63A 2JA5G 1PH7A 3S14H 3PF4A 1PHJA 4NXNQ 4POFA 3CCUA 2VY3A 1YITA 2K5NA 2IY5B 2UU9L 4BXXG 1CUKA 3UDXA 4BBRG 1YHQA 5IP7G 3I56A 4B3ML 2UUAQ 3PUWA 2AHOB 3GTJH 1Y14B 1X3FA 3UDGA 1UE7A 4DAMA 4DR6Q 2UXCQ 5IWAQ 3TS2A 1MIUA 3J81i 2R7ZH 1C9OA 4DUYQ 4NPSA 3U58A 1YJ9A 2N49A 3J81j 1WYDA 1QZHA 1Q82C 3TRZA 1SN8A 4A3IH 2A1AA 4DPGA 5FLMH 2IHFA 1GVPA 2KENA 1L0WA 2EXDA 2QA4A 2NN6G 1QUQA 2CFMA 2I5LX 1QZGA 3RN5A 1XPUA 3SGIA 3L7ZC 1EQQA 1XJVA 1G291 1SLJA 3M9BA 5IY0A 1A8VA 3CXCA 4A3EG 3EIVA 4JI0L 2NZHA 2CKZB 3HFZB 2ATWA 1ASZA 5IYDH 3GTQH 5JJIA 1VQJA 4DR3Q 1QVFA 1O7IA 3CC2A 1OXTA 4GKJL 1Y1WH 1XNRQ 1KIXA 2AWNA 3M7NA 2Q2TA 4DKAC 1Q7YC 1Z47A 1NBWA 2E5LL 4LFBQ 3IRBA 4YWLA 4DV4Q 4BY7H 2RHSB 1N33L 5M5XH 1VQLA 4DV2L 5C4XH 5M3FG 4A3KG 3I4NH 1MJCA 2K14A 1EOVA 1EUJA 2JEAI 3GTPH 3CD6A 1HNZL 5JEAJ 3RLOA 2AKWB 1TWHH 3OTOQ 2OQ0A 3RR5A 1PH3A 1S3OA 2A8VA 4A93G 1PH4A 1YZ6A 3AFPA 2KBNA 4LF4L 1YI2A 1SFOH 4LF8L 2ZM6L 3KDFA 4HJ9A 2HHHQ 2NVYH 2HIVA 1VQNA 2JA6H 4DV1L 3CCLA 2NVTH 2GVAA 1VQCA 1WJJA 1I94L 1JMCA 2UXDL 4MNOA 5FLMG 1XMOL 1AE2A 1WCMH 5LMUQ 3HOYH 2N8NA 1VQ4A 4JI2L 4YY3L 1TWCH 1WFQA 3TREA 3KJOA 3PCOB 3JAMc 3ULPA 1JJ2A 4B3SQ 5ELNA 2Y0SG 1YNXA 1YVCA 2JA9A 1DGSA 2WFWA 1S72A 2R6GA 1VQ8A 2E2IH 4WJ3M 4JBMA 2NN6I 4YCUA 3I4MG 1HZAA 1XPRA 1VQ6A 1HZ9A 4KHZA 1XNQL 4JBWA 1EQRA 4BY1H 1QUQB 3CF5A 3I4NG 4LW1A 3OW2A 2YTVA 2YTYA 3KF8B 1KRTA 4DV6L 3CC7A 4LUVA 2WP8J 4L5QA 3STBC 4LF5Q 4X64Q 1UE1A 4BA1I 1K73C 4DR5L 3TQYA 2MO1A 1EWIA 2B63H 2JA8H 3UE0A 4NXML 2EIFA 4PZ6A 5C0XI 1P16A 2JA6G 1VQKA 2Q2UA 3BJUA 5AJ3L 3S15H 1OTCA 5JEAG 4NB3A 1XTDA 5IE8A 1B8AA 4JYAQ 3HOVG 2OTJA 1JJGA 5C44H 2NVQH 1SMXA 2VQEQ 3GDEA 2JJQA 1XMQQ 2NZOA 5BR8L 2E8GA 1X55A 4MTNA 4A75A 2VL6A 3VDYA 2KHJA 4JV5L 4DK3C 2BH2A 1VQBA 1YIJA 1IBKQ 1FJGL 4DR4L 2JE6I 2F52A 1K9MC 3DM3A 4LF7Q 2OWOA 2IT1A 1PH2A 1FGUA 4JI1Q 5FJ8G 4GOPA 1K3RA 3J80i 3CMAA 1N8RC 4B3TL 3ICEA 1KRSA 1NJIC 4DR2Q 4IPCA 1N36Q 3PUZA 5C0XJ 1Q8KA 4J15A 2WB1E 2UUCL 3ERSX 4IOAA 3PIOA 1Q81C 4JI5Q 2IHEA 3BU2A 4LFCL 3CCRA 3UE1A 1IBLQ 3RZOH 3T1YL 2AWOA 4JI3L 2UU9Q 4KHPQ 4QQBX 4AIMA 4LNQA 3HOWH 1YJNA 5C4JH 2PQAA 1PA6A 3GTMH 2HIXA 4UP9A 4ALPA 1PH1A 4C3JH 1YEZA 3S1NH 1L1OC 4TQUS 3CCEA 3ULLA 4AQYQ 3PO3G 2GN5A 2RCNA 3B6YA 1YHBA 3K0XA 4A3DH 1IXRA 1FL0A 3HOZG 1E22A 2H5XA 4LF9L 5C44G 3F2CA 4JI8L 2K50A 4P71A 3F2DA 1G6PA 3W1GA 5GAEC 1HR0W 1C7YA 1AH9A 1HZCA 4YHHL 2R7DA 4JV5Q 3AEVA 1QVGA 1UE5A 5GQOA 2HT1A 4JI0Q 3PSIA 3H3VI 1HH2P 1PYSB 4QL5A 1N34L 1HJPA 2ES2A 4IOCA 4A3LH 1Y1VG 3ER0A 4JI7L 1W2BA 3S1MH 1KL9A 4O0AA 3M4OH 5IYBH 1VQEA 3GO5A 3CMEA 3STBD 1ASYA 3PV0A 3KFUA 2VUMG 1D7QA 4PMWA 4A3FG 4A3JH 2E5LQ 4R4TA 4DV7L 4X65L 3A5ZB 1N33Q 3HOUG 1LYLA 4OONA 4DV2Q 2RHQB 2YTXA 1HR0Q 5M5YH 1GKHA 3NEMA 1LM0A 5HY6A 3I55A 2V1CC 1TWGH 5M3MH 1HNXL 4Y7NH 4X66Q 2I0QA 4ME3A 3HOXH 1G51A 4OX9Q 3BZCA 1I5FA 5GROA 4DAYB 4LF4Q 4HJ5A 5C0XG 2ZM6Q 2R92H 4QY7A 4DUZQ 4A3DG 2AMCB 1N32Q 5LMNL 2JEBI 2YU9H 1L1OA 1E3PA 4DV1Q 4QIWE 4RG1A 1I94Q 4GNXB 4OO1G 2EQSA 4JOIC 4K0KQ 5IP9H 1VQ7A 2UXDQ 1TWAH 1XMOQ 4DUYL 4IFDI 3I7FA 4HIMA 3JAMi 4LWCA 2ASBA 3J7A5 2VW9A 1H95A 2Z6KC 4JI2Q 1JE5A 4YY3Q 2JA7H 4HJ7A 2R7ZG 4AYBE 3NENA 1CKNB 4PZ8A 4IPHA 2UXBQ 2L15A 4A3IG 3W5OA 2BA0A 3MXNB 4EX5A 1W3SA 2Y0SE 5FLXc 2R93H 1FVIA 3M4QA 2WAQE 3S24A 5IYBG 3RNUA 3RZDH 3KOJA 1J5EQ 1VQOA 4P75A 4LFAL 3HOZH 4AYBG 4A3JG 4A3MH 1VS0A 1U0LA 2XGTA 5IYDG 4A3CH 2Q2HA 4PZ7A 1XNQQ 1JT8A 2IX0A 5HGQA 4HIKA 1M1KC 2WAQG 1A0IA 4DV4L 2PI2E 2A19A 4IO9A 3LGJA 1Y1WG 1E7ZA 4LF6Q 3PF5A 4X6AH 2K52A 1IYJB 2RF4A 3PUVA 4BY7G 1YBYA 3CCVA 1AE3A 4JI4L 4IFDJ 3A0JA 3OTOL 1K0RA 5C4XG 2KHIA 4GKKQ 1KC8C 3WWVA 1B7YB 1VQAA 1VQHA 3I4OA 4DV0Q 4L5SA 5J3BA 2N78A 5C3EH 2JQOA 3EN2A 5GAHC 2MNAA 3S17H 2HHHL 1BVSA 1X65A 2VQFQ 1VQIA 4DR1Q 1E24A 5IP9G 4JBKA 4IPGA 1BBUA 3BZKA 3PUYA 2PNHA 3U4ZA 4IJHA 5IYCH 3AQQA 4JOIA 2BA1A 1VQ9A 2JA7G 3UDIA 5LMUL 3KJPA 1BKBA 1NE3A 4FDBA 3F2BA 5BR8Q 2Z6KA 4MZ9A 1B70B 1NMFA 4QGUA 1CKMA 3K80C 1D8LA 4OO1I 1QVCA 4DV3Q 4O2DA 3KF6A 1WCMG 4RMFA 3CQZH 3U50C 1TWFH 2VS1A 4GNXC 2LXJA 1K83H 4JCVE 3HOYG 3FKIH 4EQ5A 3H0GH 4C3HH 4UY8C 4APVA 1P8LA 2YYZA 3G71A 4B3TQ 3KDFB 3D0FA 1N9WA 1YHAA 1IZ6A 3HKSA 1J5EL 1V1QA 3E9IA 3S2DH 4C3IH 1WI5A 1OXSC 3GTLH 3T1YQ 1NY4A 4JI3Q 4BY1G 4LF5L 4X64L 4DV5L 3Q8DA 2K4KA 2KCMA 2B29A 3CC4A 4L5RC 4BXXH 3PIPA 4BBRH 3TS0A 5M5WH 5IP7H 4P73A 3ULJA 3HKZG 1X3GA 3G4SA 1K8GA 2ALYB 4YWKA 4BA2I 2B63G 3TEHB 2JA8G 2FXQA 2K75A 3W1BA 3ZJYC 4P72A 3RLFA 4LF9Q 4OWWB 4B3MQ 4R4IA 4IFDG 4JI8Q 4X62L 2F4VL 1GM5A 3L0OA 3NBHB 3NELA 4C2MH 4JI6L 1R9TH 1IL2A 2D62A 3S16H 1PH5A 3K7AH 2MO0A 2MQHA 4PG3A 1N34Q 1IBML
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JB7 A;  4LUO A;  4DR7 L;  1J6Q A;  4GLA C;  4UP7 A;  4A3E H;  3RN2 A;  3CCS A;  1LUZ A;  2CQO A;  1I50 H;  1V43 A;  3F1Z A;  4QJF A;  1IBK L;  3T1H L;  1SRU A;  4DV7 Q;  2CCZ A;  3CPF A;  3E0E A;  4DK6 C;  4B3R L;  4R4O A;  1PV4 A;  1VQF A;  1LTL A;  2OCE A;  2ZTD A;  5JJL A;  1X6O A;  2HQL A;  4JI5 L;  5M3F H;  4A3K H;  3M4P A;  1Q46 A;  4GKJ Q;  4A3B H;  3PO2 H;  1NMG A;  2BH8 A;  1IBL L;  1X9N A;  4KHP L;  1UWV A;  3D31 A;  4YCW A;  2I5M X;  4A4I A;  2UUB L;  4A3G H;  1Q86 C;  4A93 H;  4GLV B;  1UEB A;  5LMN Q;  2OQK A;  1EIF A;  1T9H A;  3UDF A;  2QEX A;  4AQY L;  1HNZ Q;  1HNW L;  2R7F A;  3U4V A;  3HOW G;  1EIY B;  4NXN L;  4GLX A;  1A62 A;  4DNI A;  3S1R H;  1MKH A;  4LUZ A;  1X56 A;  4KI0 A;  4UPA A;  1RIP A;  2DGY A;  4LF8 Q;  3K81 C;  4GOP B;  5EAY A;  2OTL A;  1PFS A;  4IPD A;  2N3S A;  1E1O A;  1M90 C;  2UUA L;  1KD1 C;  1BBW A;  1Z9F A;  4POG A;  4DR6 L;  2UXC L;  5IWA L;  1VQG A;  2GVB A;  5E7N A;  3L2P A;  2YV5 A;  4GS3 A;  2F3I A;  4LFA Q;  1GO3 E;  3G6E A;  3EBE A;  3J81 c;  4IJL A;  1GD7 A;  2PQA B;  1CSQ A;  4HIO A;  4OXP A;  2ZJP A;  3FP9 A;  4A3L G;  3I4M H;  3GTG H;  3CP0 A;  2ZTE A;  1I6H H;  2D0O A;  1Q1B A;  4JBJ A;  1WOC A;  1HR0 L;  4A3B G;  5GAG C;  3M85 A;  3PO2 G;  4OWT B;  1OXV A;  4H02 A;  4DR3 L;  1KQS A;  1NTG A;  1KHI A;  4JI4 Q;  1XNR L;  1Q1E A;  4X66 L;  1CKO A;  2JK8 A;  4A3G G;  3CPW A;  4LFB L;  3AFQ A;  1U5K A;  4OX9 L;  3K8A A;  2VNU D;  4DV6 Q;  5M3M G;  4BBS H;  4DUZ L;  2KCT A;  3GTK H;  3PUX A;  1N32 L;  1PH9 A;  3HOX G;  4DR5 Q;  2E2H H;  4WJ4 A;  3KYH C;  3S1Q H;  2ID0 A;  2R92 G;  4NXM Q;  3H3V H;  4K0K L;  2E2J H;  3PGZ A;  2B3G A;  5AJ3 Q;  4OWX B;  3A5U A;  3HOV H;  3KLW A;  1S40 A;  3M3Y H;  1SE8 A;  1PVO A;  2C35 B;  2QGQ A;  4L5T A;  2UXB L;  1C0A A;  1VQM A;  3GD7 A;  1JJC B;  1PYB A;  2LSS A;  4YWM A;  1EFW A;  5K36 G;  3RLN A;  1Q12 A;  3CCJ A;  4GOP C;  2R93 G;  1CSP A;  1FJG Q;  3E9H A;  4B3S L;  4DR4 Q;  4GN3 B;  3JC6 6;  2XTI A;  1L1O B;  2DUD A;  5FJ8 H;  3DLL A;  4HJA A;  2ZTC A;  4A3M G;  1PH6 A;  1UE6 A;  2CWP A;  3H15 A;  3K7U C;  4HID A;  4A3C G;  4LF6 L;  3I2Z A;  1OXU A;  1RL2 A;  3MEF A;  4DV5 Q;  1YJW A;  4JG2 A;  1I3Q H;  2LXK A;  1K8A C;  2UUC Q;  5DLQ E;  4BBS G;  4GKK L;  4P74 A;  1X54 A;  4DV0 L;  1VCI A;  1EYG A;  4LFC Q;  3HKZ E;  3CAM A;  3GTO H;  3PO3 H;  3OYY A;  3CCM A;  1L2F A;  2VQF L;  4DR1 L;  5GAD C;  2JA5 H;  2MFI A;  5JJK A;  2NVX H;  4JC0 A;  4KLK A;  2PI2 A;  4X62 Q;  2F4V Q;  5C3E G;  2K5H A;  4AH6 A;  3CW2 C;  1HZB A;  2K5V A;  4XIG S;  4JI6 Q;  2IX1 A;  1KXL A;  1SR3 A;  3F8T A;  3G48 A;  2CWA A;  3S2H H;  3J7Z C;  1IBM Q;  5IYC G;  2VZA A;  4DR7 Q;  1KAW A;  1VQD A;  4UP8 A;  4DV3 L;  1XPO A;  2I5H A;  1SRO A;  4JYA L;  4YHH Q;  1TXY A;  3CCQ A;  1Y1V H;  1VQ5 A;  4GN5 A;  3T1H Q;  2VQE L;  4Y52 H;  2Q2I A;  1XMQ L;  1E1T A;  2VUM H;  4A3F H;  4B3R Q;  3FKI G;  4XTC S;  4HJ8 A;  4JI7 Q;  3A74 A;  5H1S E;  2PMZ E;  3H0G G;  1X3E A;  4GNX A;  3HOU H;  1PH8 A;  4GN4 B;  1OXX K;  4R4C A;  5LMN W;  5ELO A;  2D0P A;  4A76 A;  1VQP A;  2ZJQ A;  4R1J A;  4LF7 L;  1V9P A;  4YCV A;  4X65 Q;  4JI1 L;  2UUB Q;  2Z0S A;  4DR2 L;  5IT9 c;  2WB1 G;  1N36 L;  1CKN A;  3FHW A;  2ZJR A;  3AYH B;  4TVA B;  1HNX Q;  1MJE A;  3J80 c;  4R4Q A;  3KF6 B;  1HNW Q;  1A63 A;  2JA5 G;  1PH7 A;  3S14 H;  3PF4 A;  1PHJ A;  4NXN Q;  4POF A;  3CCU A;  2VY3 A;  1YIT A;  2K5N A;  2IY5 B;  2UU9 L;  4BXX G;  1CUK A;  3UDX A;  4BBR G;  1YHQ A;  5IP7 G;  3I56 A;  4B3M L;  2UUA Q;  3PUW A;  2AHO B;  3GTJ H;  1Y14 B;  1X3F A;  3UDG A;  1UE7 A;  4DAM A;  4DR6 Q;  2UXC Q;  5IWA Q;  3TS2 A;  1MIU A;  3J81 i;  2R7Z H;  1C9O A;  4DUY Q;  4NPS A;  3U58 A;  1YJ9 A;  2N49 A;  3J81 j;  1WYD A;  1QZH A;  1Q82 C;  3TRZ A;  1SN8 A;  4A3I H;  2A1A A;  4DPG A;  5FLM H;  2IHF A;  1GVP A;  2KEN A;  1L0W A;  2EXD A;  2QA4 A;  2NN6 G;  1QUQ A;  2CFM A;  2I5L X;  1QZG A;  3RN5 A;  1XPU A;  3SGI A;  3L7Z C;  1EQQ A;  1XJV A;  1G29 1;  1SLJ A;  3M9B A;  5IY0 A;  1A8V A;  3CXC A;  4A3E G;  3EIV A;  4JI0 L;  2NZH A;  2CKZ B;  3HFZ B;  2ATW A;  1ASZ A;  5IYD H;  3GTQ H;  5JJI A;  1VQJ A;  4DR3 Q;  1QVF A;  1O7I A;  3CC2 A;  1OXT A;  4GKJ L;  1Y1W H;  1XNR Q;  1KIX A;  2AWN A;  3M7N A;  2Q2T A;  4DKA C;  1Q7Y C;  1Z47 A;  1NBW A;  2E5L L;  4LFB Q;  3IRB A;  4YWL A;  4DV4 Q;  4BY7 H;  2RHS B;  1N33 L;  5M5X H;  1VQL A;  4DV2 L;  5C4X H;  5M3F G;  4A3K G;  3I4N H;  1MJC A;  2K14 A;  1EOV A;  1EUJ A;  2JEA I;  3GTP H;  3CD6 A;  1HNZ L;  5JEA J;  3RLO A;  2AKW B;  1TWH H;  3OTO Q;  2OQ0 A;  3RR5 A;  1PH3 A;  1S3O A;  2A8V A;  4A93 G;  1PH4 A;  1YZ6 A;  3AFP A;  2KBN A;  4LF4 L;  1YI2 A;  1SFO H;  4LF8 L;  2ZM6 L;  3KDF A;  4HJ9 A;  2HHH Q;  2NVY H;  2HIV A;  1VQN A;  2JA6 H;  4DV1 L;  3CCL A;  2NVT H;  2GVA A;  1VQC A;  1WJJ A;  1I94 L;  1JMC A;  2UXD L;  4MNO A;  5FLM G;  1XMO L;  1AE2 A;  1WCM H;  5LMU Q;  3HOY H;  2N8N A;  1VQ4 A;  4JI2 L;  4YY3 L;  1TWC H;  1WFQ A;  3TRE A;  3KJO A;  3PCO B;  3JAM c;  3ULP A;  1JJ2 A;  4B3S Q;  5ELN A;  2Y0S G;  1YNX A;  1YVC A;  2JA9 A;  1DGS A;  2WFW A;  1S72 A;  2R6G A;  1VQ8 A;  2E2I H;  4WJ3 M;  4JBM A;  2NN6 I;  4YCU A;  3I4M G;  1HZA A;  1XPR A;  1VQ6 A;  1HZ9 A;  4KHZ A;  1XNQ L;  4JBW A;  1EQR A;  4BY1 H;  1QUQ B;  3CF5 A;  3I4N G;  4LW1 A;  3OW2 A;  2YTV A;  2YTY A;  3KF8 B;  1KRT A;  4DV6 L;  3CC7 A;  4LUV A;  2WP8 J;  4L5Q A;  3STB C;  4LF5 Q;  4X64 Q;  1UE1 A;  4BA1 I;  1K73 C;  4DR5 L;  3TQY A;  2MO1 A;  1EWI A;  2B63 H;  2JA8 H;  3UE0 A;  4NXM L;  2EIF A;  4PZ6 A;  5C0X I;  1P16 A;  2JA6 G;  1VQK A;  2Q2U A;  3BJU A;  5AJ3 L;  3S15 H;  1OTC A;  5JEA G;  4NB3 A;  1XTD A;  5IE8 A;  1B8A A;  4JYA Q;  3HOV G;  2OTJ A;  1JJG A;  5C44 H;  2NVQ H;  1SMX A;  2VQE Q;  3GDE A;  2JJQ A;  1XMQ Q;  2NZO A;  5BR8 L;  2E8G A;  1X55 A;  4MTN A;  4A75 A;  2VL6 A;  3VDY A;  2KHJ A;  4JV5 L;  4DK3 C;  2BH2 A;  1VQB A;  1YIJ A;  1IBK Q;  1FJG L;  4DR4 L;  2JE6 I;  2F52 A;  1K9M C;  3DM3 A;  4LF7 Q;  2OWO A;  2IT1 A;  1PH2 A;  1FGU A;  4JI1 Q;  5FJ8 G;  4GOP A;  1K3R A;  3J80 i;  3CMA A;  1N8R C;  4B3T L;  3ICE A;  1KRS A;  1NJI C;  4DR2 Q;  4IPC A;  1N36 Q;  3PUZ A;  5C0X J;  1Q8K A;  4J15 A;  2WB1 E;  2UUC L;  3ERS X;  4IOA A;  3PIO A;  1Q81 C;  4JI5 Q;  2IHE A;  3BU2 A;  4LFC L;  3CCR A;  3UE1 A;  1IBL Q;  3RZO H;  3T1Y L;  2AWO A;  4JI3 L;  2UU9 Q;  4KHP Q;  4QQB X;  4AIM A;  4LNQ A;  3HOW H;  1YJN A;  5C4J H;  2PQA A;  1PA6 A;  3GTM H;  2HIX A;  4UP9 A;  4ALP A;  1PH1 A;  4C3J H;  1YEZ A;  3S1N H;  1L1O C;  4TQU S;  3CCE A;  3ULL A;  4AQY Q;  3PO3 G;  2GN5 A;  2RCN A;  3B6Y A;  1YHB A;  3K0X A;  4A3D H;  1IXR A;  1FL0 A;  3HOZ G;  1E22 A;  2H5X A;  4LF9 L;  5C44 G;  3F2C A;  4JI8 L;  2K50 A;  4P71 A;  3F2D A;  1G6P A;  3W1G A;  5GAE C;  1HR0 W;  1C7Y A;  1AH9 A;  1HZC A;  4YHH L;  2R7D A;  4JV5 Q;  3AEV A;  1QVG A;  1UE5 A;  5GQO A;  2HT1 A;  4JI0 Q;  3PSI A;  3H3V I;  1HH2 P;  1PYS B;  4QL5 A;  1N34 L;  1HJP A;  2ES2 A;  4IOC A;  4A3L H;  1Y1V G;  3ER0 A;  4JI7 L;  1W2B A;  3S1M H;  1KL9 A;  4O0A A;  3M4O H;  5IYB H;  1VQE A;  3GO5 A;  3CME A;  3STB D;  1ASY A;  3PV0 A;  3KFU A;  2VUM G;  1D7Q A;  4PMW A;  4A3F G;  4A3J H;  2E5L Q;  4R4T A;  4DV7 L;  4X65 L;  3A5Z B;  1N33 Q;  3HOU G;  1LYL A;  4OON A;  4DV2 Q;  2RHQ B;  2YTX A;  1HR0 Q;  5M5Y H;  1GKH A;  3NEM A;  1LM0 A;  5HY6 A;  3I55 A;  2V1C C;  1TWG H;  5M3M H;  1HNX L;  4Y7N H;  4X66 Q;  2I0Q A;  4ME3 A;  3HOX H;  1G51 A;  4OX9 Q;  3BZC A;  1I5F A;  5GRO A;  4DAY B;  4LF4 Q;  4HJ5 A;  5C0X G;  2ZM6 Q;  2R92 H;  4QY7 A;  4DUZ Q;  4A3D G;  2AMC B;  1N32 Q;  5LMN L;  2JEB I;  2YU9 H;  1L1O A;  1E3P A;  4DV1 Q;  4QIW E;  4RG1 A;  1I94 Q;  4GNX B;  4OO1 G;  2EQS A;  4JOI C;  4K0K Q;  5IP9 H;  1VQ7 A;  2UXD Q;  1TWA H;  1XMO Q;  4DUY L;  4IFD I;  3I7F A;  4HIM A;  3JAM i;  4LWC A;  2ASB A;  3J7A 5;  2VW9 A;  1H95 A;  2Z6K C;  4JI2 Q;  1JE5 A;  4YY3 Q;  2JA7 H;  4HJ7 A;  2R7Z G;  4AYB E;  3NEN A;  1CKN B;  4PZ8 A;  4IPH A;  2UXB Q;  2L15 A;  4A3I G;  3W5O A;  2BA0 A;  3MXN B;  4EX5 A;  1W3S A;  2Y0S E;  5FLX c;  2R93 H;  1FVI A;  3M4Q A;  2WAQ E;  3S24 A;  5IYB G;  3RNU A;  3RZD H;  3KOJ A;  1J5E Q;  1VQO A;  4P75 A;  4LFA L;  3HOZ H;  4AYB G;  4A3J G;  4A3M H;  1VS0 A;  1U0L A;  2XGT A;  5IYD G;  4A3C H;  2Q2H A;  4PZ7 A;  1XNQ Q;  1JT8 A;  2IX0 A;  5HGQ A;  4HIK A;  1M1K C;  2WAQ G;  1A0I A;  4DV4 L;  2PI2 E;  2A19 A;  4IO9 A;  3LGJ A;  1Y1W G;  1E7Z A;  4LF6 Q;  3PF5 A;  4X6A H;  2K52 A;  1IYJ B;  2RF4 A;  3PUV A;  4BY7 G;  1YBY A;  3CCV A;  1AE3 A;  4JI4 L;  4IFD J;  3A0J A;  3OTO L;  1K0R A;  5C4X G;  2KHI A;  4GKK Q;  1KC8 C;  3WWV A;  1B7Y B;  1VQA A;  1VQH A;  3I4O A;  4DV0 Q;  4L5S A;  5J3B A;  2N78 A;  5C3E H;  2JQO A;  3EN2 A;  5GAH C;  2MNA A;  3S17 H;  2HHH L;  1BVS A;  1X65 A;  2VQF Q;  1VQI A;  4DR1 Q;  1E24 A;  5IP9 G;  4JBK A;  4IPG A;  1BBU A;  3BZK A;  3PUY A;  2PNH A;  3U4Z A;  4IJH A;  5IYC H;  3AQQ A;  4JOI A;  2BA1 A;  1VQ9 A;  2JA7 G;  3UDI A;  5LMU L;  3KJP A;  1BKB A;  1NE3 A;  4FDB A;  3F2B A;  5BR8 Q;  2Z6K A;  4MZ9 A;  1B70 B;  1NMF A;  4QGU A;  1CKM A;  3K80 C;  1D8L A;  4OO1 I;  1QVC A;  4DV3 Q;  4O2D A;  3KF6 A;  1WCM G;  4RMF A;  3CQZ H;  3U50 C;  1TWF H;  2VS1 A;  4GNX C;  2LXJ A;  1K83 H;  4JCV E;  3HOY G;  3FKI H;  4EQ5 A;  3H0G H;  4C3H H;  4UY8 C;  4APV A;  1P8L A;  2YYZ A;  3G71 A;  4B3T Q;  3KDF B;  3D0F A;  1N9W A;  1YHA A;  1IZ6 A;  3HKS A;  1J5E L;  1V1Q A;  3E9I A;  3S2D H;  4C3I H;  1WI5 A;  1OXS C;  3GTL H;  3T1Y Q;  1NY4 A;  4JI3 Q;  4BY1 G;  4LF5 L;  4X64 L;  4DV5 L;  3Q8D A;  2K4K A;  2KCM A;  2B29 A;  3CC4 A;  4L5R C;  4BXX H;  3PIP A;  4BBR H;  3TS0 A;  5M5W H;  5IP7 H;  4P73 A;  3ULJ A;  3HKZ G;  1X3G A;  3G4S A;  1K8G A;  2ALY B;  4YWK A;  4BA2 I;  2B63 G;  3TEH B;  2JA8 G;  2FXQ A;  2K75 A;  3W1B A;  3ZJY C;  4P72 A;  3RLF A;  4LF9 Q;  4OWW B;  4B3M Q;  4R4I A;  4IFD G;  4JI8 Q;  4X62 L;  2F4V L;  1GM5 A;  3L0O A;  3NBH B;  3NEL A;  4C2M H;  4JI6 L;  1R9T H;  1IL2 A;  2D62 A;  3S16 H;  1PH5 A;  3K7A H;  2MO0 A;  2MQH A;  4PG3 A;  1N34 Q;  1IBM L; 
#chains in the Genus database with same CATH topology
 4K8I A;  2Z9H A;  3V96 A;  2CQO A;  1ZXT A;  1GHJ A;  2EY2 A;  2SOB A;  4MTK A;  4KD3 A;  1PRT B;  1Y1W B;  1ZYR D;  1VQF A;  2WII B;  5M5X B;  4GKJ Q;  3D6C A;  4IUU A;  3M4P A;  1Q46 A;  4A3B H;  3PO2 H;  2XVS A;  1IBL L;  3OSO A;  3P1H A;  3D31 A;  2F0L A;  2OQK A;  1HA5 A;  4FXG C;  1X56 A;  1S5F D;  4HN7 A;  3K81 C;  2VB2 X;  5EAY A;  5IGE A;  2J0T D;  4IPD A;  2LY7 A;  1PFN A;  1KD1 C;  1A3V A;  1BBW A;  3EFX D;  5E7N A;  2GVB A;  3KBX A;  3J81 c;  5KNB A;  2HQE A;  1ET9 A;  2P5Z X;  2D5D A;  1CA5 A;  4A3L G;  3VYU A;  3I4M H;  1CHP D;  2EY6 A;  3VYT A;  1HR0 L;  1G8Z D;  4OWT B;  1OXV A;  4DR3 L;  1KQS A;  1NTG A;  5JJZ A;  1EYD A;  2H1E A;  3HKZ B;  3MXG A;  5NUC A;  4FVM A;  4DV6 Q;  1SYC A;  2KCT A;  3PUX A;  1N32 L;  1BCP C;  3HOX G;  2E2H H;  4NXM Q;  5JEA H;  2EYP A;  2E2J H;  2R61 A;  3DWP A;  4WJW A;  1XWE A;  4F8M A;  3JAM L;  3A5U A;  3HOV H;  2B2V C;  2NVQ B;  3K6O A;  1S40 A;  1JIC A;  1JWU D;  3M3Y H;  3GP7 A;  1PVO A;  2QGQ A;  4L5T A;  1RF2 D;  2RA4 A;  4CDC C;  1PYB A;  3H3V C;  3H09 A;  1Q3L A;  1Q12 A;  3CCJ A;  4GOP C;  1SAP A;  1LTR D;  1AFP A;  2RSN A;  4B3S L;  4DR4 Q;  4GN3 B;  2GA4 B;  1L1O B;  2A5H A;  3PIO 3;  4A3M G;  1UE6 A;  3GV6 A;  4A3C G;  4OIJ A;  3OPO A;  3I2Z A;  1OXU A;  1LTB D;  2RSO A;  2QEJ C;  4JG2 A;  2KEC A;  2UUC Q;  3HOW B;  4BBS G;  4GKK L;  1B3Q A;  4N9T A;  3PO3 H;  3CCM A;  2F0V A;  4JC0 A;  2PI2 A;  4X62 Q;  2F4V Q;  1MHW C;  3CW2 C;  5A2Q E;  1CZW A;  1SNC A;  5EJW A;  3NWT A;  2EYM A;  1I50 B;  1SNP A;  3G48 A;  3MC0 B;  5IYC G;  2B2V A;  1KAW A;  1LV9 A;  1VQD A;  4UP8 A;  3K5M A;  1DON A;  1XPO A;  5ELF A;  4S3S A;  4XYQ A;  2PYK A;  2Z4I A;  1Y1V H;  4GN5 A;  4Y52 H;  3P20 A;  4RGN A;  4A3F H;  4XTC S;  2OXP A;  3GQB A;  4JI7 Q;  2PMZ E;  4FO2 A;  1PTO C;  4C3H G;  4H0L C;  2HDM A;  3KLR A;  4XDX A;  2SDF A;  4GN4 B;  1OXX K;  4R4C A;  1PLF A;  5CBA E;  4A76 A;  4R1J A;  1V9P A;  2KUM A;  4JI1 L;  1GXD C;  4DR2 L;  1D5X C;  1N36 L;  1STB A;  2R92 B;  1HNX Q;  3KF6 B;  2G9D A;  3A8J E;  5C0X H;  1PH7 A;  1A63 A;  3S14 H;  2E75 C;  4KMU C;  5FOB B;  2VY3 A;  4BXX G;  1E0B A;  4B3M L;  1A2U A;  5DEH A;  2AHO B;  1X3F A;  3UDG A;  1UE7 A;  2F3W A;  2EYH A;  5E1F A;  4XYO A;  4XXE A;  1YJ9 A;  1QZH A;  3HOZ B;  5CGK A;  2I5L X;  1HFN A;  3RN5 A;  4DNR B;  1XJV A;  3SE0 A;  2E76 C;  2FMC A;  3EIV A;  1VQJ A;  5KYL A;  2F0J A;  4DR3 Q;  5CV4 A;  2Z1C A;  1QVF A;  3ERO A;  4KHV A;  3M7N A;  3MXP A;  3MVV A;  4YWL A;  4YIJ A;  3K5O A;  4IUV A;  1G2S A;  2SEB D;  5IGG A;  4ZK9 B;  2EXZ A;  5KEE A;  3I4L A;  5C3E B;  3S17 B;  3GTP H;  1HNZ L;  5JEA J;  3RLO A;  1BBX C;  2AKW B;  3OTO Q;  1PH3 A;  4PNY A;  3SVM A;  1YNJ D;  1GUO A;  3HP3 A;  1YI2 A;  1VQN A;  5FLX L;  3CCL A;  2NVT H;  2GVA A;  1VQC A;  2UXD L;  1XMO L;  1TWF B;  3FKI B;  3HOY H;  3H0G B;  4ILW A;  3JAM c;  1S5C D;  4B3S Q;  1EL0 A;  1ZEQ X;  1YNX A;  1YVC A;  2JA9 A;  1Q8I A;  1VQ8 A;  1RD9 D;  5I9O A;  4WJ3 M;  2KED A;  1I4G A;  2EDG A;  5IGF A;  3I4M G;  1K8O A;  1VQ6 A;  3NBH A;  1HZ9 A;  2G5D A;  3MWY W;  1ZYR C;  1H9S A;  1JOK A;  2K04 A;  2WP8 J;  4L5Q A;  4X64 Q;  1UE1 A;  4BA1 I;  2RCF A;  3NP8 A;  1E2W A;  1QIL A;  2PZT A;  5C5M A;  2B63 H;  2XN9 C;  3JAM E;  1FGB D;  2L9H A;  4C2M B;  2Q2U A;  3BJU A;  3S15 H;  4FF4 A;  3OMC A;  5JEA G;  1JJG A;  3HOV G;  2OTJ A;  4Q5V A;  4A3E B;  2JSO A;  4XQN A;  2Q8R E;  3OWF A;  5BR8 L;  1B4O A;  2ENB A;  2BH2 A;  1IBK Q;  3C3L A;  1K9M C;  3DM3 A;  2OWO A;  1PH2 A;  1FGU A;  1PRT D;  4JI1 Q;  3NE5 B;  3TP6 A;  3CMA A;  1N8R C;  2EE1 A;  1BR9 A;  3ICE A;  3TBI B;  4DR2 Q;  3X3N A;  4IPC A;  1N36 Q;  3PUZ A;  5JOB A;  1Q8K A;  5C0X J;  4IOA A;  3PIO A;  2RDG A;  3RUZ A;  1Q81 C;  4JI5 Q;  4A93 B;  2IHE A;  5G3L D;  3BU2 A;  3T1Y L;  3I91 A;  1D5M C;  1MD2 D;  3I8Z A;  1YNN C;  2PQA A;  3GTM H;  4UP9 A;  1EIG A;  4C3J H;  3FEW X;  3PO3 G;  4U67 3;  1EY0 A;  4A3D H;  1FL0 A;  3SDZ A;  4IZ8 A;  2E2D C;  1E22 A;  4LF9 L;  5C44 G;  4NW2 A;  5C5L A;  1G6P A;  3F2D A;  1E2V A;  3W3A A;  1RHP A;  1U4M A;  1HR0 W;  4YHH L;  1UE5 A;  2HT1 A;  1PYS B;  3DUZ A;  2ES2 A;  1Y1V G;  3ER0 A;  3GTG B;  1MBY A;  4O0A A;  3M4O H;  3GO5 A;  3CME A;  5IT9 E;  1D7Q A;  2B2U C;  4A3F G;  4R4T A;  4DV7 L;  2K32 A;  4UHV A;  5EKL A;  2JYO A;  2RHQ B;  2YTX A;  3AB9 A;  1STA A;  3I55 A;  1LM0 A;  1TWG H;  3GTK B;  3ND8 A;  2CW0 C;  4X66 Q;  4H13 C;  1SMY C;  4ME3 A;  4OX9 Q;  3S1Q B;  3BZC A;  2KJX A;  1I5F A;  4HJ5 A;  5C0X G;  2MUY A;  5ELC A;  1KNE A;  1V1P B;  4NP5 A;  4QIW E;  1LT6 D;  4C1N K;  2UXD Q;  1VQ7 A;  1XMO Q;  3I90 A;  3I7F A;  2XRS D;  2ASB A;  1EIH A;  1NNX A;  1O7Z A;  1QB5 D;  1CM9 A;  1IKM A;  2JA7 H;  1TS3 A;  4AYB E;  3NEN A;  1CKN B;  1JQY D;  4PZ8 A;  4RGM A;  2R93 H;  5FLX c;  1W3S A;  1KDC A;  4ID6 A;  1FVI A;  2IJ0 A;  2Q2H A;  2AUK A;  2B2U A;  2CQA A;  2IX0 A;  1M1K C;  1FR3 A;  1I3Q B;  4IO9 A;  3LGJ A;  1XTC D;  2F0E A;  3CU7 A;  1LTS D;  3MA2 B;  3PF5 A;  2K52 A;  3FPU B;  4ZLT F;  3PUV A;  3NTH A;  3CCV A;  4RKL A;  4JI4 L;  2JA5 B;  4KY5 A;  1K0R A;  4LJZ C;  3WWV A;  1VQA A;  1VQH A;  4DV0 Q;  3SHL A;  5FLX E;  1ICF B;  2N78 A;  5DM6 3;  3UI2 A;  4KKT A;  4DR1 Q;  1VQI A;  1B50 A;  3OOC A;  4IPG A;  1Y8P B;  2A73 B;  2MHV A;  1C4Q A;  4IJH A;  4ZAI A;  1PTO F;  3AQQ A;  2Z4H A;  3UDI A;  3OIP A;  1RJT A;  1NSN S;  1EY9 A;  5BR8 Q;  4QGU A;  1NR4 A;  2PW5 A;  2VUM B;  4GNX C;  3HOY G;  2LXJ A;  1K83 H;  5LL6 S;  3VYR A;  1H9M A;  4RFB A;  1QNK A;  3KDF B;  3HKS A;  1V1Q A;  4P2C B;  3S2D H;  1OXS C;  3GTL H;  1I6V C;  1NY4 A;  3T1Y Q;  3DMU A;  4DV5 L;  2KCM A;  4L5R C;  3TS0 A;  1JC7 A;  5M5W H;  5IP7 H;  4UAI A;  3ULJ A;  1X3G A;  1LTI D;  1K8G A;  3GTJ B;  3CRL C;  2B63 G;  3TEH B;  3DEP A;  1M8A A;  2K75 A;  4LF9 Q;  2LS0 1;  1I4X A;  3NTI A;  2M00 A;  2JP1 A;  2QDB A;  1GM5 A;  1SDF A;  3NEL A;  4ULL A;  4A3I B;  2FFK B;  3S16 H;  1PH5 A;  5ELE A;  3SXH A;  1IBM L;  3TN2 A;  4DR7 L;  1J6Q A;  4UP7 A;  3RN2 A;  2SNM A;  2KQ3 A;  1OO9 B;  2K33 A;  3EQL C;  1Y69 U;  4DV7 Q;  2EJG C;  4B3R L;  4KJO A;  2Q8T A;  1PV4 A;  4BY7 B;  2BCO A;  1LTL A;  2ZTD A;  3I4N B;  1I4R A;  2BH8 A;  3NWS A;  1JWS D;  4KKS A;  1UWV A;  4RCO A;  2I5M X;  1UEB A;  1EIF A;  2QEX A;  4QF4 A;  4AQY L;  1AEX A;  5BN4 A;  1EIY B;  2JA6 B;  4NXN L;  4GLX A;  1HUM A;  3S1R H;  1PFB A;  1MKH A;  2TSS A;  4LUZ A;  4C3J G;  2DGY A;  2N3S A;  1WCM B;  1M90 C;  3QOJ A;  1CZG A;  5IWA L;  1VQG A;  1II3 A;  4KY7 A;  1GO3 E;  1VF5 C;  3F2U A;  2NYZ D;  4RGT A;  1ILP A;  1BXT A;  4OXP A;  2ZJP A;  1WTO A;  3FP9 A;  4CDD C;  1I6H H;  4BY1 B;  2B2Y C;  1WOC A;  4H02 A;  1CA6 A;  4V0B A;  4JI4 Q;  1XNR L;  4LFB L;  1PRT C;  3E5S A;  3AFQ A;  1U5K A;  3QO2 A;  2JA8 B;  2VNU D;  4BBS H;  1JOO A;  3H6M A;  3D8G A;  4HCE A;  2K28 A;  1NR2 A;  2ID0 A;  2L12 A;  4K0K L;  1IW7 D;  3BYT B;  4CBV A;  4FP5 D;  5AJ3 Q;  1UAP A;  5E3F A;  3PQI A;  4EQP A;  2C35 B;  1HTP A;  2UXB L;  4U68 A;  1C0A A;  3GD7 A;  1X32 A;  4YWM A;  5KND A;  3RLN A;  5IGB A;  2R93 G;  4HSV A;  1EY6 A;  5D3I B;  5EPL A;  3E9H A;  4UDU C;  3RZO H;  2LMC B;  5IOC A;  1O78 A;  4X3U A;  2B2Y A;  1VF7 A;  2DNC A;  1IKL A;  4DV5 Q;  4HMJ A;  4DAP A;  2LXK A;  5C4J B;  3LNN A;  3SK8 A;  1EYG A;  3LX0 A;  4H7B A;  3CAM A;  3GTO H;  3OYY A;  3BG3 A;  3D4D A;  2VQF L;  5GAD C;  2MFI A;  5JJK A;  2NVX H;  2NTT A;  4AH6 A;  1HZB A;  1AN8 A;  4LMQ D;  2B8G A;  1SR3 A;  3G6J B;  3HS0 C;  3T51 B;  4IUT A;  1IBM Q;  3LWU A;  4DR7 Q;  5FKA C;  4BS9 A;  3M7G A;  1WD1 A;  2I5H A;  4JYA L;  3CCQ A;  2B2T C;  3S1M B;  1V1O A;  1F2M A;  4HJ8 A;  4B3R Q;  1GUG A;  3A74 A;  3HGB A;  3MZ5 A;  5J1Z A;  3HOU H;  1F9Q A;  4Z9C B;  1PH8 A;  2RQX A;  5TSS A;  4X3K A;  5ELO A;  5M3M B;  4X65 Q;  4Y7N B;  3KLS A;  1EYA A;  3FHW A;  2ZJR A;  3AYH B;  3NBI A;  2EZV A;  2JA5 G;  4NXN Q;  2YU9 B;  5JAV A;  1CUK A;  1UUP A;  1YHQ A;  4MIU A;  5IP7 G;  1TWA B;  3VR3 A;  1ENC A;  5CV5 A;  4NDX A;  1HQR D;  5IWA Q;  4DUY Q;  4NPS A;  1TQO A;  1WYD A;  1WTX A;  2EY1 A;  1A15 A;  4DPG A;  2KEN A;  1L0W A;  3RZD B;  2EXD A;  1XPU A;  1QUQ A;  2CFM A;  1EQQ A;  4RAU C;  2B2T A;  3CXC A;  5IYD H;  2NZH A;  1XX8 A;  4I7Z C;  2A69 C;  2FJ2 A;  4IAL A;  3KLS X;  1Y1W H;  1XNR Q;  1XYI A;  2E74 C;  2Q2T A;  1Z47 A;  4LFB Q;  3E6Z X;  4L6T B;  4OGQ C;  5M5X H;  1MI2 A;  5M9O A;  1MJC A;  1EOV A;  1EUJ A;  1SNO A;  1TU2 B;  1YZ6 A;  3N52 A;  4LF4 L;  4LF8 L;  4HJ9 A;  2NVY H;  2HIV A;  3J81 E;  4QUF A;  5LHY 1;  2L11 A;  4EQO A;  5FLM G;  3CQZ B;  1AE2 A;  2RKS A;  1VQ4 A;  1WFQ A;  4I7A A;  3KJO A;  3O13 A;  5BN5 A;  2J4X A;  3PCO B;  3DEO A;  4K5X A;  4HMI A;  4EQN A;  1ESR A;  1HRJ A;  4EGV A;  4C3I B;  4JBM A;  2WB1 B;  4YCU A;  3TSS A;  3BS1 A;  3Q0A A;  2L0C A;  1XNQ L;  1EQR A;  3I4N G;  1QUQ B;  4LW1 A;  3ONA B;  5T1G A;  3OW2 A;  2A68 D;  4BBR B;  1TT2 A;  3R2I A;  3STB C;  2L5T A;  1K73 C;  4DR5 L;  5I2Y A;  1TY2 A;  4KN7 C;  2JA6 G;  5EQ0 A;  1VQK A;  5EKK A;  1OTC A;  3K7A B;  3VA5 A;  1LAB A;  1I4H A;  4NB3 A;  4HSP A;  1BOS A;  1XTD A;  5IE8 A;  1R4P B;  4JYA Q;  1S5E D;  5C44 H;  4LAA A;  2NVQ H;  4KN4 C;  1SMX A;  5I4D A;  3GDE A;  2JJQ A;  3WDN A;  2NZO A;  3FDT A;  2E8G A;  1X55 A;  4EVO A;  2VL6 A;  4DF7 A;  2KHJ A;  4JV5 L;  5JPM C;  1EY7 A;  2XNA C;  1FJG L;  5KYI A;  5FK9 C;  5M3F B;  4A3K B;  2O2L D;  3GV3 A;  4GOP A;  1K3R A;  1KLG D;  1G6Z A;  2AQ3 B;  4TKO B;  4J15 A;  3ERS X;  4IUP A;  4A3G B;  1BF4 A;  4LFC L;  3CCR A;  1IBL Q;  3UE1 A;  3TME A;  3HOW H;  5CBE E;  1PH1 A;  2F0T A;  4TQU S;  3CCE A;  3ULL A;  5I6Y A;  2GN5 A;  5E4W C;  4HCS A;  1I4Q A;  3KK7 A;  2H5X A;  1IW7 C;  2Y0S B;  1AH9 A;  3IL8 A;  1PRT F;  1HJP A;  1W2B A;  1KL9 A;  3BDO A;  4DAV A;  1BCP B;  3KFU A;  2F3V A;  5G3L F;  1VDZ A;  1CK1 A;  5KNC A;  3HOU G;  4KKU A;  1HR0 Q;  5HY6 A;  1O7L A;  3A55 A;  4LF4 Q;  1B1Z A;  2R92 H;  2F4I A;  3MFG A;  4QY7 A;  5CV6 A;  2AMC B;  1N32 Q;  5LMN L;  1E3P A;  3T4A C;  1TY0 A;  4RG1 A;  4OO1 G;  2EQS A;  4JOI C;  5ELB A;  4IFD I;  4HIM A;  4ABN A;  2VW9 A;  2N88 A;  1JE5 A;  4RGO S;  4HJ7 A;  2F0D A;  4OEL B;  5K36 H;  5L37 A;  4IPH A;  2DY7 A;  2BA0 A;  3W5O A;  4EX5 A;  4H44 C;  5IYB G;  3M4Q A;  3S24 A;  4R8I A;  1SEB D;  3HOZ H;  4DXF A;  4AYB G;  2B8F A;  4CKB A;  4A3J G;  2O5I C;  1WTV A;  5IYD G;  1XNQ Q;  3T53 B;  4DV4 L;  3IKJ A;  2EOT A;  2QW7 A;  5D14 A;  1DOK A;  1E7Z A;  1Y1W G;  3AMU A;  3K5N A;  1JOQ A;  2QF7 A;  4X6A H;  1IYJ B;  4G57 A;  1YBY A;  2MPM A;  3SK4 A;  2LFN A;  2KHI A;  4KTA A;  3R93 A;  4GKK Q;  1ET6 A;  3I4O A;  1KAA A;  4FXD A;  5C3E H;  3S17 H;  1EY5 A;  2HHH L;  4FYD A;  4CHT B;  4L8J A;  1E24 A;  5IP9 G;  2F0Q A;  4JBK A;  5FO8 B;  4PV1 C;  3VR2 A;  3S2H B;  1BBU A;  1DM0 B;  2C9O A;  1SYG A;  1PTO B;  1HUN A;  1EY4 A;  4JOI A;  1EYC A;  5LMU L;  3SEB A;  1K0S A;  4FDB A;  1B70 B;  1CKM A;  1JCK B;  1D8L A;  4OO1 I;  1QVC A;  4JV5 Q;  2F0G A;  1TWF H;  2VS1 A;  3FKI H;  4EQ5 A;  3H0G H;  4UY8 C;  1P8L A;  2YYZ A;  1LAC A;  1N9W A;  1IZ6 A;  1EEI D;  1J5E L;  2QIL A;  5K5P A;  3T13 A;  1G2T A;  1WI5 A;  3D3R A;  4LF5 L;  1S5D D;  2DJG C;  2K4K A;  3Q24 A;  1RTN A;  3HKZ G;  1EU4 A;  4ODG A;  4WOR A;  2FXQ A;  2NZ1 D;  3W1B A;  4OWW B;  2R7Z B;  1EEF D;  3RLF A;  3Q23 A;  4B3M Q;  4R4I A;  4K2L A;  2KA7 A;  4K5V A;  3D6W A;  1H9J A;  3NBH B;  4K14 A;  4C2M H;  2CHB D;  4ZYS A;  4JI6 L;  2D62 A;  1CQF A;  4IQZ A;  3MXU A;  3W2D A;  3J7Y W;  1H9S B;  1GUT A;  2MQH A;  4PG3 A;  1KNA A;  1PXU A;  4GLA C;  2A6H D;  4K2K A;  4A3E H;  2SNS A;  1RDP D;  3GTQ B;  2IL8 A;  3F1Z A;  4QJF A;  2WAQ B;  3BYY B;  4HED A;  1PYW D;  3T56 B;  1F2Y A;  4CKE A;  1LT3 D;  1SRU A;  2K05 A;  1ENA A;  2EJF C;  2CCZ A;  4DK6 C;  4C3I G;  3NQT A;  2OCE A;  5C4X B;  1X6O A;  2HQL A;  3E0J A;  4G4K A;  2VXW A;  1X9N A;  4DNT B;  1TWH B;  4KHP L;  2BDN A;  4TRD A;  2M9V A;  4A4I A;  2UUB L;  4FNF A;  1Q86 C;  4A93 H;  5LMN Q;  1SFO B;  1HNZ Q;  3U4V A;  1SNQ A;  3HOW G;  2IPK D;  1FNV A;  4KI0 A;  4DA2 A;  4KY6 A;  1JOR A;  3QIA A;  4J1M A;  3C1E A;  1B2T A;  2OTL A;  1ML0 D;  1DXM A;  1E1O A;  1F2L A;  1Z9F A;  2UXC L;  1Z7T A;  1IL8 A;  3M4Y A;  1TWC B;  3KF8 A;  1A6X A;  3G6E A;  1RCV D;  4IJL A;  2PQA B;  1F9S A;  1CSQ A;  2E2I B;  3EA6 A;  3A7A B;  1A3T A;  1B3A A;  1VMC A;  3GTG H;  2ZTE A;  4X3T A;  2CH4 W;  3M85 A;  1KHI A;  4ZCK A;  1ESF A;  1IYU A;  3J7A F;  1CKO A;  4A3G G;  1EOT A;  4XT1 B;  3MTS A;  1Y8O B;  4DUZ L;  3GTK H;  1PH9 A;  4MHE A;  4WJ4 A;  2K03 A;  3KYH C;  1NUC A;  3S1Q H;  2R92 G;  1WTW A;  3A8I E;  4IUR A;  2B3G A;  3KLW A;  1ROD A;  2F0N A;  4RCN A;  1LTT D;  1U4P A;  5CV7 A;  1VQM A;  3T16 A;  1JJC B;  1EFW A;  2LSS A;  1C48 A;  5K36 G;  2BE5 D;  1CSP A;  5FJ8 H;  3DLL A;  1J5E Q;  2DUD A;  3HOZ G;  2ZTC A;  3SK6 A;  3H15 A;  1WTR A;  4TSS A;  2IX3 A;  4LF6 L;  5ISR A;  3MEF A;  4IN3 A;  1WD0 A;  3TZD A;  4G7Z C;  1RKN A;  1I3Q H;  1K8A C;  3HG9 A;  3MHB A;  4P74 A;  1F9R A;  1X54 A;  4K6D A;  3S1N B;  3FRP B;  1TS5 A;  3HKZ E;  3L9A X;  1L2F A;  1AZP A;  2JA5 H;  1MGS A;  5C3E G;  2BDO A;  1J9O A;  2K5H A;  2K5V A;  4XIG S;  4JI6 Q;  2IX1 A;  2PW7 A;  2RDF A;  3A56 A;  2CWA A;  3DWA A;  2VZA A;  2F0O A;  4DV3 L;  4K6L A;  1YNJ C;  1E2Z A;  1SE4 A;  4YHH Q;  1TXY A;  4DAY A;  2LKV A;  4GZY C;  5ELD A;  1E1T A;  1W6J A;  2VUM H;  1HCZ A;  1ICW A;  5IIF A;  3FKI G;  5H1S E;  3H0G G;  2DNE A;  1X3E A;  4GNX A;  5LMN W;  5M5Y B;  2H4O A;  4J8Q A;  1QCB D;  2OEO A;  4YCV A;  2UUB Q;  1K28 A;  3HOX B;  2CVR A;  2NWG A;  2O5J C;  3I72 A;  3MXN A;  3PF4 A;  2PCF B;  3K59 A;  2K5N A;  3I56 A;  1FD7 D;  2F0K A;  3GTJ H;  1Y14 B;  2UXC Q;  4DAM A;  3TS2 A;  1MIU A;  1H9K A;  1C9O A;  4C56 C;  1M4V A;  1Q82 C;  3J81 j;  4A3I H;  2A1A A;  5FLM H;  1GVP A;  2QA4 A;  5C6A A;  4B08 A;  1QZG A;  4A3M B;  3L7Z C;  3NTK A;  1G29 1;  1SLJ A;  4A3E G;  4RWS C;  2CKZ B;  1ASZ A;  5JJI A;  4HAE A;  2V4D A;  1O7I A;  1QOH A;  4GKJ L;  1KIX A;  4DKA C;  4OEM B;  2E5L L;  2QDL A;  4RHS A;  3IRB A;  4BY7 H;  2RHS B;  3VA7 A;  1N33 L;  1HHV A;  2Z6B A;  3I4N H;  2K14 A;  1G91 A;  3CD6 A;  3RR5 A;  1S3O A;  1X3Q A;  5I2X A;  4A93 G;  2F0W A;  1PH4 A;  4ZQ3 A;  3AFP A;  2KBN A;  1SJE D;  4O1N A;  4RH6 A;  2PZW A;  3H91 A;  2JA6 H;  4DV1 L;  1TII D;  2I46 A;  1IYV A;  2F0P A;  2EYF A;  1WCM H;  3ZYY X;  5JVG 3;  2RVL A;  4JI2 L;  4YY3 L;  3TRE A;  1DJR D;  4C3H B;  3ULP A;  1JJ2 A;  2WFW A;  1EWC A;  2A6H C;  2MGS A;  2XSC A;  1EU3 A;  3TZU A;  1XPR A;  3SK5 A;  4KHZ A;  4JBW A;  2ZXR A;  4BY1 H;  1EZ8 A;  5E4X A;  4CGY B;  2YTV A;  1QNU A;  2XWJ B;  2D9U A;  2YTY A;  1A2T A;  4DV6 L;  3CC7 A;  4LUV A;  5KIX A;  1IHZ A;  2NTS A;  1TS2 A;  3P75 A;  2JA8 H;  4NXM L;  4IFD H;  1STY A;  3K58 A;  4KJN A;  1WVL A;  3K57 A;  1R9T B;  3LWE A;  5A2Q L;  1DCZ A;  4R9W A;  1B8A A;  2K7V A;  2KVM A;  5COY A;  1S5B D;  5KGU A;  3BDL A;  4MTN A;  3U9O A;  3VDY A;  4BWG B;  4OL7 A;  4DK3 C;  4DR4 L;  1VQB A;  2JE6 I;  3C2P A;  2IT1 A;  3SR1 A;  2DJF C;  5FJ8 G;  4A3B B;  3PO2 B;  3J80 i;  3EJI A;  4M1U B;  2K6A A;  1NJI C;  1SYD A;  1EQT A;  3MEH A;  2UUC L;  5EKI A;  1B9M A;  3Q6S A;  2AWO A;  4AIM A;  4LNQ A;  1Y8N B;  1YJN A;  5C4J H;  1PA6 A;  2HIX A;  4ALP A;  1BUV T;  1YEZ A;  4B9X A;  1L1O C;  3L3O C;  4ZKC B;  4AQY Q;  2RCN A;  1YHB A;  3K0X A;  1IXR A;  3TP5 A;  4N8F A;  2RBM A;  4OO1 H;  4NKL A;  1PZK D;  2K5D A;  5GAE C;  1HZC A;  3A54 A;  2L4N A;  1PMR A;  4O42 A;  3PSI A;  2B2W C;  4N8X 1;  3I4M B;  4IOC A;  4JI7 L;  4G7O C;  3S1M H;  5IYB H;  1ASY A;  3PV0 A;  2VUM G;  3PMF A;  4A3J H;  2E5L Q;  2BE5 C;  1SE2 A;  5COR A;  1N33 Q;  1EY8 A;  1PFM A;  2MJ8 A;  2BOS A;  3HRZ C;  3QB3 A;  5JPN C;  3NEM A;  1HNX L;  5M3M H;  2N55 A;  2NVY B;  5J22 A;  2F0S A;  4Y7N H;  2K5Q A;  1JE4 A;  3NQI A;  2E2H B;  1ONL A;  1STN A;  4G7H C;  4RKB A;  3RMH A;  4CDF C;  5GRO A;  2E2J B;  4Q0F A;  2JEB I;  2YU9 H;  1L1O A;  1O80 A;  4DV1 Q;  2VB3 X;  3HOV B;  4K0K Q;  5IP9 H;  1TWA H;  3M3Y B;  1HQM C;  5C3X A;  1WTP A;  4JI2 Q;  4YY3 Q;  1BO0 A;  1HTL D;  2ICI A;  2DY8 A;  2UXB Q;  2L15 A;  4A3I G;  1HA6 A;  2WAQ E;  2B2W A;  3RZD H;  1VQO A;  4P75 A;  4LFA L;  3QOL A;  1VS0 A;  1YNN D;  2AQ1 B;  1F77 A;  1BDO A;  5HGQ A;  3EVQ A;  2EJM A;  2EVB A;  4BY7 G;  3PO3 B;  1AE3 A;  3OMG A;  3A0J A;  4IFD J;  4K5W A;  3OTO L;  4L5S A;  5A35 A;  3I70 A;  2JQO A;  3EN2 A;  2MNA A;  3DXJ C;  5C44 B;  3K0Y A;  1BNZ A;  1BVS A;  1X65 A;  2F0U A;  3A7L A;  4FXK C;  2VQF Q;  4HTH A;  3TP7 A;  3N6R A;  3QR8 A;  3BZK A;  2PNH A;  2HDL A;  2IWH A;  2EY5 A;  1VQ9 A;  1DOM A;  3DM1 A;  1JWM D;  5T1I A;  5DM7 3;  1BKB A;  1Y1V B;  3F2B A;  4MZ9 A;  2F1M A;  1NMF A;  5IOD A;  3K80 C;  3K5L A;  4O2D A;  3KF6 A;  1KTK A;  1WCM G;  3CQZ H;  3U50 C;  4A3F B;  2RDH A;  4JCV E;  1GUW A;  1FYC A;  1GJX A;  2AQ2 B;  2CW0 D;  5D65 A;  4APV A;  1QWY A;  1SMY D;  1LTA D;  4CJ2 C;  3G71 A;  2WV6 D;  2EPB A;  1YHA A;  2NB0 A;  4C3I H;  1KDA A;  2WKC A;  3E3X A;  1DYQ A;  4L63 B;  3S14 B;  4BY1 G;  3VR4 A;  4DN4 M;  1SE3 A;  4X64 L;  1U9R A;  4QB4 A;  1J8I A;  3Q8D A;  1SND A;  1CQV A;  2B29 A;  4JW0 A;  4PMB A;  3CC4 A;  4BBR H;  1PZJ D;  1LLR D;  3G4S A;  1LT5 D;  2ALY B;  4IUQ A;  5BN3 A;  5HUR A;  4BA2 I;  2JA8 G;  1F9P A;  3HEJ A;  3ZJY C;  4IFD G;  4ME5 A;  3OW7 A;  4HR7 B;  3L0O A;  2G9H D;  2PQE A;  3K7A H;  2NN6 H;  4MN3 A;  1HFG A;  1JB7 A;  4LUO A;  5I9P A;  1T5E A;  3FPP A;  1L0X B;  3CCS A;  1LUZ A;  1CI3 M;  1I50 H;  1V43 A;  1IBK L;  4X3S A;  3T1H L;  1K8M A;  5IT9 L;  3CPF A;  3E0E A;  3QJY A;  4PQX A;  4R4O A;  3J80 L;  3D4W A;  5JJL A;  4JI5 L;  5M3F H;  3S9W A;  4A3K H;  5J39 A;  1NMG A;  2EYL A;  3GTP B;  4C1N I;  4YCW A;  3KBG A;  1SYE A;  3TDQ A;  3J7A V;  4A3G H;  4GLV B;  4NMZ A;  5AFW A;  1T9H A;  3UDF A;  1HNW L;  3DHQ A;  4WRD A;  2R7F A;  3VR6 A;  4ZKB B;  3BVG A;  4ZUJ A;  1A62 A;  4DNI A;  2NVT B;  5LL6 X;  4OIK A;  1RIP A;  4UPA A;  4LF8 Q;  1W6K A;  3VYS A;  1ZKO A;  2HCC A;  4GOP B;  1PFS A;  4QCL A;  4JPB W;  5C3W A;  2UUA L;  3HOY B;  4POG A;  1A3U A;  4DR6 L;  3L2P A;  1U4L A;  2YV5 A;  4GS3 A;  2F3I A;  4LFA Q;  3EBE A;  2B39 A;  3ITP A;  1Q90 A;  1GD7 A;  4M8A A;  4HIO A;  5IGC A;  2Z8L A;  4RHR A;  2TMP A;  3CP0 A;  5CYU A;  2D0O A;  1Q1B A;  4JBJ A;  1GUS A;  5GAG C;  3PO2 G;  4A3B G;  4ZUI A;  5IGD A;  1Q1E A;  4X66 L;  1FNU A;  3TP8 A;  2JK8 A;  1GOZ A;  3CPW A;  4OX9 L;  4FF2 A;  2B63 B;  3K8A A;  5M3M G;  5EPJ A;  4DR5 Q;  3S15 B;  1MSG A;  4PMC A;  3H3V H;  1WTH A;  2F0F A;  1QJO A;  3PGZ A;  4OWX B;  1QG7 A;  1SJH D;  2KCC A;  1SE8 A;  3ND9 A;  1EFI D;  4IUN A;  1STE A;  1SYB A;  3NK9 A;  4CJ0 B;  1EQV A;  1T5X D;  3JC6 6;  2XTI A;  1PZI D;  4HJA A;  1FJG Q;  2NBF A;  1PH6 A;  2CWP A;  2F0H A;  4HID A;  4DFA A;  2F0M A;  1RL2 A;  1YJW A;  4QUC A;  1UNS A;  1X3P A;  2KOL A;  5DLQ E;  3OWE B;  2OT2 A;  3GTM B;  5CC4 A;  4C3J B;  5C4Z A;  1VCI A;  1Z6H A;  4DV0 L;  4LFC Q;  2HCI A;  3V05 A;  4A3D B;  4DR1 L;  1O7Y A;  4KLK A;  1KXL A;  3F8T A;  2EYO A;  4JK1 C;  4QMG A;  3C1F A;  2JXM B;  3S2H H;  3J7Z C;  1PTO H;  2EYJ A;  2K5W A;  1GUN A;  1CT1 D;  5F2D A;  3G7L A;  1AZQ A;  1SRO A;  5JVH 3;  5EGT A;  3M4O B;  1VQ5 A;  3IFT A;  3T1H Q;  2VQE L;  2Q2I A;  1XMQ L;  2A6E D;  1V1P A;  2FMM A;  1C8C A;  4XQQ A;  3HZX A;  1JB3 A;  2X6L A;  2D0P A;  2OF1 A;  1VQP A;  2ZJQ A;  1TWG B;  3R2T A;  4LF7 L;  3P7J A;  3NSW A;  1ENF A;  2WIN B;  5EBD A;  4F87 A;  2Z0S A;  5IT9 c;  2WB1 G;  1D6E C;  1CKN A;  2PZU A;  4TVA B;  1MJE A;  3J80 c;  4R4Q A;  1HNW Q;  3WOE A;  1PHJ A;  3OIQ A;  4POF A;  3CCU A;  1CHQ D;  1HPC A;  3BVM A;  1YIT A;  2UU9 L;  2IY5 B;  4BBR G;  3UDX A;  1D2B A;  4DGZ A;  2O4X A;  2UUA Q;  2A68 C;  3PUW A;  4DR6 Q;  2JA7 B;  3J81 i;  2R7Z H;  3U58 A;  2HD3 A;  2N49 A;  3TRZ A;  2R93 B;  2ZXP A;  1JR0 D;  1SN8 A;  2C5C A;  2IHF A;  2NN6 G;  2KCN A;  1BCP F;  1CTM A;  3SGI A;  1PDQ A;  3J80 E;  3M9B A;  4XT3 B;  5IY0 A;  1A8V A;  4JI0 L;  2ATW A;  2XWB B;  3HFZ B;  3GTQ H;  3R3O A;  4KV6 A;  3I73 A;  1AW7 A;  5D3D A;  3CC2 A;  1OXT A;  3QG1 A;  2AWN A;  1Q7Y C;  1NBW A;  4DV4 Q;  1VQL A;  1ILQ A;  1EWH A;  4DU9 A;  5C4X H;  5M3F G;  4DV2 L;  4A3K G;  5CV8 A;  1K3B C;  1LO5 D;  2KHS A;  2K01 A;  2JEA I;  5CV9 A;  3ERQ A;  3NHH A;  1TWH H;  2OQ0 A;  2A8V A;  1SFO H;  2ZM6 L;  2ZXO A;  3KDF A;  2HHH Q;  1FNW A;  3C46 A;  1D5Z C;  2ICE C;  1WJJ A;  3X3M A;  1D1K A;  1I94 L;  1JMC A;  4MNO A;  5LMU Q;  1K83 B;  3NXW A;  2N8N A;  5DNF A;  3R8B A;  1TWC H;  4LK1 C;  2F03 A;  5KRU A;  1LTG D;  5ELN A;  2Y0S G;  1KAB A;  1KLU D;  4KD4 A;  1DGS A;  1S72 A;  2R6G A;  3S2D B;  2PMZ B;  2E2I H;  2NN6 I;  1DOL A;  1HZA A;  1RTO A;  3GTL B;  1SNM A;  3CF5 A;  3PIP 3;  2J7Z A;  3KF8 B;  5M5W B;  1KRT A;  4DXG A;  4F7X A;  4LF5 Q;  1D1I A;  3TQY A;  2MO1 A;  3V2T A;  1EWI A;  2D2C C;  2X69 A;  3UE0 A;  2EIF A;  3D4R A;  4PZ6 A;  2NUC A;  5C0X I;  1P16 A;  4F88 A;  5AJ3 L;  3S16 B;  4N9P A;  4FF3 A;  2A69 D;  1STH A;  5CR3 A;  3KUP A;  2VQE Q;  1B44 D;  1XMQ Q;  4JVZ A;  3A8K E;  1AP0 A;  4OHJ A;  4A75 A;  3MAQ A;  3CKI B;  4R8N A;  1YIJ A;  3QWN A;  4B9W A;  2F52 A;  4LF7 Q;  1SBB B;  1TVX A;  3WOF A;  4B3T L;  1KRS A;  2QCP X;  2X6G A;  1STG A;  2WB1 E;  3CHB D;  3IAY A;  1BCP D;  2IW3 A;  3AU7 A;  3FMC A;  4JI3 L;  2UU9 Q;  2QKI C;  4KHP Q;  4QQB X;  2PO4 A;  3S1R B;  4ZRZ A;  3S1N H;  3U9S A;  3B6Y A;  2I07 B;  3BDC A;  1NCV A;  4I65 A;  3BVZ A;  1BQQ T;  3F2C A;  4JI8 L;  4E6I A;  2K50 A;  3CRK C;  2L1B A;  4P71 A;  3W1G A;  1SXT A;  2KEE A;  1C7Y A;  2R7D A;  3AEV A;  1QVG A;  1DD2 A;  5GQO A;  2AUJ D;  2CH4 A;  4FF1 A;  1L0Y B;  4JI0 Q;  3H3V I;  1HH2 P;  1MSH A;  4QL5 A;  1N34 L;  4KK7 A;  4K8J A;  4A3L H;  1VMP A;  1I6H B;  1VQE A;  1GHK A;  3STB D;  4PMW A;  5FO9 B;  4X65 L;  3A5Z B;  1LYL A;  4OON A;  4DV2 Q;  2PPB C;  3NPP A;  5M5Y H;  1GKH A;  4CJ1 B;  4BBS B;  2V1C C;  2I0Q A;  2Q8I B;  3HOX H;  1G51 A;  2MP1 A;  4DAY B;  2ZM6 Q;  4DUZ Q;  4A3D G;  2XIW A;  1S4Z A;  3H94 A;  3BZD B;  4CDE C;  3I3C A;  3NUC A;  4CKC A;  1I94 Q;  4GNX B;  2PNR C;  5DAU A;  3J81 L;  4DUY L;  2M2L A;  3J7A 5;  3JAM i;  4LWC A;  4DK1 A;  1H95 A;  1F2Z A;  2Z6K C;  2R7Z G;  4XQJ A;  1PTO D;  3MXN B;  2Y0S E;  2JN4 A;  1B9N A;  3RNU A;  3RZO B;  3KOJ A;  4A3M H;  3RD4 A;  1U0L A;  2XGT A;  4A3C H;  4PZ7 A;  2WAC A;  1U4R A;  1JT8 A;  2A6E C;  4HIK A;  2WAQ G;  1A0I A;  2PI2 E;  2A19 A;  1WTQ A;  3DWQ A;  1SYF A;  4LF6 Q;  2ZT9 C;  1HXY D;  2RF4 A;  1QE6 A;  3GTO B;  5C4X G;  5EPK A;  1KC8 C;  2F0I A;  2NVX B;  1B7Y B;  5J3B A;  2WKD A;  5GAH C;  3PUY A;  3U4Z A;  3URY A;  1UEA B;  2FIN B;  2BA1 A;  5IYC H;  2JA7 G;  2HUG A;  5I6W A;  1SSO A;  3KJP A;  5CMD A;  1NE3 A;  2Z6K A;  4DV3 Q;  4RMF A;  3Q22 A;  4RA8 A;  3FVQ A;  1EZ6 A;  1TKW B;  3HOU B;  4C3H H;  5EBC A;  1LT4 D;  4B3T Q;  3D0F A;  1I4P A;  1B53 A;  3OHX C;  1TS4 A;  3E9I A;  2XRQ D;  1CFM A;  4DK0 A;  2A74 C;  4J6H A;  4JI3 Q;  1NAP A;  1XXG A;  4V19 0;  4BXX H;  3PIP A;  4P73 A;  1KDB A;  2K1B A;  1H9R A;  1V8Q A;  4WFN 3;  4YWK A;  2R3Z A;  3IFD A;  5HGT A;  4P72 A;  2FHT A;  2DN8 A;  4QIW B;  4JI8 Q;  4X62 L;  2F4V L;  5C4H A;  3MFY A;  5FO7 B;  1IL2 A;  1R9T H;  1N34 Q;  1TR5 A;  1DZ1 A;  2MO0 A;  2L55 A;  3K7U C;  3VR5 A;  1R4Q B;  4AYB B;  4A3J B; 
#chains in the Genus database with same CATH homology
 1JB7 A;  4LUO A;  4DR7 L;  1J6Q A;  4GLA C;  4UP7 A;  4A3E H;  3RN2 A;  3CCS A;  1LUZ A;  2CQO A;  1I50 H;  1V43 A;  3F1Z A;  4QJF A;  1IBK L;  3T1H L;  1SRU A;  4DV7 Q;  2CCZ A;  3CPF A;  3E0E A;  4DK6 C;  4B3R L;  4R4O A;  1PV4 A;  1VQF A;  1LTL A;  2OCE A;  2ZTD A;  5JJL A;  1X6O A;  2HQL A;  4JI5 L;  5M3F H;  4A3K H;  3M4P A;  1Q46 A;  4GKJ Q;  4A3B H;  3PO2 H;  1NMG A;  2BH8 A;  1IBL L;  1X9N A;  4KHP L;  1UWV A;  3D31 A;  4YCW A;  2I5M X;  4A4I A;  2UUB L;  4A3G H;  1Q86 C;  4A93 H;  4GLV B;  1UEB A;  5LMN Q;  2OQK A;  1EIF A;  1T9H A;  3UDF A;  2QEX A;  4AQY L;  1HNZ Q;  1HNW L;  2R7F A;  3U4V A;  3HOW G;  1EIY B;  4NXN L;  4GLX A;  1A62 A;  4DNI A;  3S1R H;  1MKH A;  4LUZ A;  1X56 A;  4KI0 A;  4UPA A;  1RIP A;  2DGY A;  4LF8 Q;  3K81 C;  4GOP B;  5EAY A;  2OTL A;  1PFS A;  4IPD A;  2N3S A;  1E1O A;  1M90 C;  2UUA L;  1KD1 C;  1BBW A;  1Z9F A;  4POG A;  4DR6 L;  2UXC L;  5IWA L;  1VQG A;  2GVB A;  5E7N A;  3L2P A;  2YV5 A;  4GS3 A;  2F3I A;  4LFA Q;  1GO3 E;  3G6E A;  3EBE A;  3J81 c;  4IJL A;  1GD7 A;  2PQA B;  1CSQ A;  4HIO A;  4OXP A;  2ZJP A;  3FP9 A;  4A3L G;  3I4M H;  3GTG H;  3CP0 A;  2ZTE A;  1I6H H;  2D0O A;  1Q1B A;  4JBJ A;  1WOC A;  1HR0 L;  4A3B G;  5GAG C;  3M85 A;  3PO2 G;  4OWT B;  1OXV A;  4H02 A;  4DR3 L;  1KQS A;  1NTG A;  1KHI A;  4JI4 Q;  1XNR L;  1Q1E A;  4X66 L;  1CKO A;  2JK8 A;  4A3G G;  3CPW A;  4LFB L;  3AFQ A;  1U5K A;  4OX9 L;  3K8A A;  2VNU D;  4DV6 Q;  5M3M G;  4BBS H;  4DUZ L;  2KCT A;  3GTK H;  3PUX A;  1N32 L;  1PH9 A;  3HOX G;  4DR5 Q;  2E2H H;  4WJ4 A;  3KYH C;  3S1Q H;  2ID0 A;  2R92 G;  4NXM Q;  3H3V H;  4K0K L;  2E2J H;  3PGZ A;  2B3G A;  5AJ3 Q;  4OWX B;  3A5U A;  3HOV H;  3KLW A;  1S40 A;  3M3Y H;  1SE8 A;  1PVO A;  2C35 B;  2QGQ A;  4L5T A;  2UXB L;  1C0A A;  1VQM A;  3GD7 A;  1JJC B;  1PYB A;  2LSS A;  4YWM A;  1EFW A;  5K36 G;  3RLN A;  1Q12 A;  3CCJ A;  4GOP C;  2R93 G;  1CSP A;  1FJG Q;  3E9H A;  4B3S L;  4DR4 Q;  4GN3 B;  3JC6 6;  2XTI A;  1L1O B;  2DUD A;  5FJ8 H;  3DLL A;  4HJA A;  2ZTC A;  4A3M G;  1PH6 A;  1UE6 A;  2CWP A;  3H15 A;  3K7U C;  4HID A;  4A3C G;  4LF6 L;  3I2Z A;  1OXU A;  1RL2 A;  3MEF A;  4DV5 Q;  1YJW A;  4JG2 A;  1I3Q H;  2LXK A;  1K8A C;  2UUC Q;  5DLQ E;  4BBS G;  4GKK L;  4P74 A;  1X54 A;  4DV0 L;  1VCI A;  1EYG A;  4LFC Q;  3HKZ E;  3CAM A;  3GTO H;  3PO3 H;  3OYY A;  3CCM A;  1L2F A;  2VQF L;  4DR1 L;  5GAD C;  2JA5 H;  2MFI A;  5JJK A;  2NVX H;  4JC0 A;  4KLK A;  2PI2 A;  4X62 Q;  2F4V Q;  5C3E G;  2K5H A;  4AH6 A;  3CW2 C;  1HZB A;  2K5V A;  4XIG S;  4JI6 Q;  2IX1 A;  1KXL A;  1SR3 A;  3F8T A;  3G48 A;  2CWA A;  3S2H H;  3J7Z C;  1IBM Q;  5IYC G;  2VZA A;  4DR7 Q;  1KAW A;  1VQD A;  4UP8 A;  4DV3 L;  1XPO A;  2I5H A;  1SRO A;  4JYA L;  4YHH Q;  1TXY A;  3CCQ A;  1Y1V H;  1VQ5 A;  4GN5 A;  3T1H Q;  2VQE L;  4Y52 H;  2Q2I A;  1XMQ L;  1E1T A;  2VUM H;  4A3F H;  4B3R Q;  3FKI G;  4XTC S;  4HJ8 A;  4JI7 Q;  3A74 A;  5H1S E;  2PMZ E;  3H0G G;  1X3E A;  4GNX A;  3HOU H;  1PH8 A;  4GN4 B;  1OXX K;  4R4C A;  5LMN W;  5ELO A;  2D0P A;  4A76 A;  1VQP A;  2ZJQ A;  4R1J A;  4LF7 L;  1V9P A;  4YCV A;  4X65 Q;  4JI1 L;  2UUB Q;  2Z0S A;  4DR2 L;  5IT9 c;  2WB1 G;  1N36 L;  1CKN A;  3FHW A;  2ZJR A;  3AYH B;  4TVA B;  1HNX Q;  1MJE A;  3J80 c;  4R4Q A;  3KF6 B;  1HNW Q;  1A63 A;  2JA5 G;  1PH7 A;  3S14 H;  3PF4 A;  1PHJ A;  4NXN Q;  4POF A;  3CCU A;  2VY3 A;  1YIT A;  2K5N A;  2IY5 B;  2UU9 L;  4BXX G;  1CUK A;  3UDX A;  4BBR G;  1YHQ A;  5IP7 G;  3I56 A;  4B3M L;  2UUA Q;  3PUW A;  2AHO B;  3GTJ H;  1Y14 B;  1X3F A;  3UDG A;  1UE7 A;  4DAM A;  4DR6 Q;  2UXC Q;  5IWA Q;  3TS2 A;  1MIU A;  3J81 i;  2R7Z H;  1C9O A;  4DUY Q;  4NPS A;  3U58 A;  1YJ9 A;  2N49 A;  3J81 j;  1WYD A;  1QZH A;  1Q82 C;  3TRZ A;  1SN8 A;  4A3I H;  2A1A A;  4DPG A;  5FLM H;  2IHF A;  1GVP A;  2KEN A;  1L0W A;  2EXD A;  2QA4 A;  2NN6 G;  1QUQ A;  2CFM A;  2I5L X;  1QZG A;  3RN5 A;  1XPU A;  3SGI A;  3L7Z C;  1EQQ A;  1XJV A;  1G29 1;  1SLJ A;  3M9B A;  5IY0 A;  1A8V A;  3CXC A;  4A3E G;  3EIV A;  4JI0 L;  2NZH A;  2CKZ B;  3HFZ B;  2ATW A;  1ASZ A;  5IYD H;  3GTQ H;  5JJI A;  1VQJ A;  4DR3 Q;  1QVF A;  1O7I A;  3CC2 A;  1OXT A;  4GKJ L;  1Y1W H;  1XNR Q;  1KIX A;  2AWN A;  3M7N A;  2Q2T A;  4DKA C;  1Q7Y C;  1Z47 A;  1NBW A;  2E5L L;  4LFB Q;  3IRB A;  4YWL A;  4DV4 Q;  4BY7 H;  2RHS B;  1N33 L;  5M5X H;  1VQL A;  4DV2 L;  5C4X H;  5M3F G;  4A3K G;  3I4N H;  1MJC A;  2K14 A;  1EOV A;  1EUJ A;  2JEA I;  3GTP H;  3CD6 A;  1HNZ L;  5JEA J;  3RLO A;  2AKW B;  1TWH H;  3OTO Q;  2OQ0 A;  3RR5 A;  1PH3 A;  1S3O A;  2A8V A;  4A93 G;  1PH4 A;  1YZ6 A;  3AFP A;  2KBN A;  4LF4 L;  1YI2 A;  1SFO H;  4LF8 L;  2ZM6 L;  3KDF A;  4HJ9 A;  2HHH Q;  2NVY H;  2HIV A;  1VQN A;  2JA6 H;  4DV1 L;  3CCL A;  2NVT H;  2GVA A;  1VQC A;  1WJJ A;  1I94 L;  1JMC A;  2UXD L;  4MNO A;  5FLM G;  1XMO L;  1AE2 A;  1WCM H;  5LMU Q;  3HOY H;  2N8N A;  1VQ4 A;  4JI2 L;  4YY3 L;  1TWC H;  1WFQ A;  3TRE A;  3KJO A;  3PCO B;  3JAM c;  3ULP A;  1JJ2 A;  4B3S Q;  5ELN A;  2Y0S G;  1YNX A;  1YVC A;  2JA9 A;  1DGS A;  2WFW A;  1S72 A;  2R6G A;  1VQ8 A;  2E2I H;  4WJ3 M;  4JBM A;  2NN6 I;  4YCU A;  3I4M G;  1HZA A;  1XPR A;  1VQ6 A;  1HZ9 A;  4KHZ A;  1XNQ L;  4JBW A;  1EQR A;  4BY1 H;  1QUQ B;  3CF5 A;  3I4N G;  4LW1 A;  3OW2 A;  2YTV A;  2YTY A;  3KF8 B;  1KRT A;  4DV6 L;  3CC7 A;  4LUV A;  2WP8 J;  4L5Q A;  3STB C;  4LF5 Q;  4X64 Q;  1UE1 A;  4BA1 I;  1K73 C;  4DR5 L;  3TQY A;  2MO1 A;  1EWI A;  2B63 H;  2JA8 H;  3UE0 A;  4NXM L;  2EIF A;  4PZ6 A;  5C0X I;  1P16 A;  2JA6 G;  1VQK A;  2Q2U A;  3BJU A;  5AJ3 L;  3S15 H;  1OTC A;  5JEA G;  4NB3 A;  1XTD A;  5IE8 A;  1B8A A;  4JYA Q;  3HOV G;  2OTJ A;  1JJG A;  5C44 H;  2NVQ H;  1SMX A;  2VQE Q;  3GDE A;  2JJQ A;  1XMQ Q;  2NZO A;  5BR8 L;  2E8G A;  1X55 A;  4MTN A;  4A75 A;  2VL6 A;  3VDY A;  2KHJ A;  4JV5 L;  4DK3 C;  2BH2 A;  1VQB A;  1YIJ A;  1IBK Q;  1FJG L;  4DR4 L;  2JE6 I;  2F52 A;  1K9M C;  3DM3 A;  4LF7 Q;  2OWO A;  2IT1 A;  1PH2 A;  1FGU A;  4JI1 Q;  5FJ8 G;  4GOP A;  1K3R A;  3J80 i;  3CMA A;  1N8R C;  4B3T L;  3ICE A;  1KRS A;  1NJI C;  4DR2 Q;  4IPC A;  1N36 Q;  3PUZ A;  5C0X J;  1Q8K A;  4J15 A;  2WB1 E;  2UUC L;  3ERS X;  4IOA A;  3PIO A;  1Q81 C;  4JI5 Q;  2IHE A;  3BU2 A;  4LFC L;  3CCR A;  3UE1 A;  1IBL Q;  3RZO H;  3T1Y L;  2AWO A;  4JI3 L;  2UU9 Q;  4KHP Q;  4QQB X;  4AIM A;  4LNQ A;  3HOW H;  1YJN A;  5C4J H;  2PQA A;  1PA6 A;  3GTM H;  2HIX A;  4UP9 A;  4ALP A;  1PH1 A;  4C3J H;  1YEZ A;  3S1N H;  1L1O C;  4TQU S;  3CCE A;  3ULL A;  4AQY Q;  3PO3 G;  2GN5 A;  2RCN A;  3B6Y A;  1YHB A;  3K0X A;  4A3D H;  1IXR A;  1FL0 A;  3HOZ G;  1E22 A;  2H5X A;  4LF9 L;  5C44 G;  3F2C A;  4JI8 L;  2K50 A;  4P71 A;  3F2D A;  1G6P A;  3W1G A;  5GAE C;  1HR0 W;  1C7Y A;  1AH9 A;  1HZC A;  4YHH L;  2R7D A;  4JV5 Q;  3AEV A;  1QVG A;  1UE5 A;  5GQO A;  2HT1 A;  4JI0 Q;  3PSI A;  3H3V I;  1HH2 P;  1PYS B;  4QL5 A;  1N34 L;  1HJP A;  2ES2 A;  4IOC A;  4A3L H;  1Y1V G;  3ER0 A;  4JI7 L;  1W2B A;  3S1M H;  1KL9 A;  4O0A A;  3M4O H;  5IYB H;  1VQE A;  3GO5 A;  3CME A;  3STB D;  1ASY A;  3PV0 A;  3KFU A;  2VUM G;  1D7Q A;  4PMW A;  4A3F G;  4A3J H;  2E5L Q;  4R4T A;  4DV7 L;  4X65 L;  3A5Z B;  1N33 Q;  3HOU G;  1LYL A;  4OON A;  4DV2 Q;  2RHQ B;  2YTX A;  1HR0 Q;  5M5Y H;  1GKH A;  3NEM A;  1LM0 A;  5HY6 A;  3I55 A;  2V1C C;  1TWG H;  5M3M H;  1HNX L;  4Y7N H;  4X66 Q;  2I0Q A;  4ME3 A;  3HOX H;  1G51 A;  4OX9 Q;  3BZC A;  1I5F A;  5GRO A;  4DAY B;  4LF4 Q;  4HJ5 A;  5C0X G;  2ZM6 Q;  2R92 H;  4QY7 A;  4DUZ Q;  4A3D G;  2AMC B;  1N32 Q;  5LMN L;  2JEB I;  2YU9 H;  1L1O A;  1E3P A;  4DV1 Q;  4QIW E;  4RG1 A;  1I94 Q;  4GNX B;  4OO1 G;  2EQS A;  4JOI C;  4K0K Q;  5IP9 H;  1VQ7 A;  2UXD Q;  1TWA H;  1XMO Q;  4DUY L;  4IFD I;  3I7F A;  4HIM A;  3JAM i;  4LWC A;  2ASB A;  3J7A 5;  2VW9 A;  1H95 A;  2Z6K C;  4JI2 Q;  1JE5 A;  4YY3 Q;  2JA7 H;  4HJ7 A;  2R7Z G;  4AYB E;  3NEN A;  1CKN B;  4PZ8 A;  4IPH A;  2UXB Q;  2L15 A;  4A3I G;  3W5O A;  2BA0 A;  3MXN B;  4EX5 A;  1W3S A;  2Y0S E;  5FLX c;  2R93 H;  1FVI A;  3M4Q A;  2WAQ E;  3S24 A;  5IYB G;  3RNU A;  3RZD H;  3KOJ A;  1J5E Q;  1VQO A;  4P75 A;  4LFA L;  3HOZ H;  4AYB G;  4A3J G;  4A3M H;  1VS0 A;  1U0L A;  2XGT A;  5IYD G;  4A3C H;  2Q2H A;  4PZ7 A;  1XNQ Q;  1JT8 A;  2IX0 A;  5HGQ A;  4HIK A;  1M1K C;  2WAQ G;  1A0I A;  4DV4 L;  2PI2 E;  2A19 A;  4IO9 A;  3LGJ A;  1Y1W G;  1E7Z A;  4LF6 Q;  3PF5 A;  4X6A H;  2K52 A;  1IYJ B;  2RF4 A;  3PUV A;  4BY7 G;  1YBY A;  3CCV A;  1AE3 A;  4JI4 L;  4IFD J;  3A0J A;  3OTO L;  1K0R A;  5C4X G;  2KHI A;  4GKK Q;  1KC8 C;  3WWV A;  1B7Y B;  1VQA A;  1VQH A;  3I4O A;  4DV0 Q;  4L5S A;  5J3B A;  2N78 A;  5C3E H;  2JQO A;  3EN2 A;  5GAH C;  2MNA A;  3S17 H;  2HHH L;  1BVS A;  1X65 A;  2VQF Q;  1VQI A;  4DR1 Q;  1E24 A;  5IP9 G;  4JBK A;  4IPG A;  1BBU A;  3BZK A;  3PUY A;  2PNH A;  3U4Z A;  4IJH A;  5IYC H;  3AQQ A;  4JOI A;  2BA1 A;  1VQ9 A;  2JA7 G;  3UDI A;  5LMU L;  3KJP A;  1BKB A;  1NE3 A;  4FDB A;  3F2B A;  5BR8 Q;  2Z6K A;  4MZ9 A;  1B70 B;  1NMF A;  4QGU A;  1CKM A;  3K80 C;  1D8L A;  4OO1 I;  1QVC A;  4DV3 Q;  4O2D A;  3KF6 A;  1WCM G;  4RMF A;  3CQZ H;  3U50 C;  1TWF H;  2VS1 A;  4GNX C;  2LXJ A;  1K83 H;  4JCV E;  3HOY G;  3FKI H;  4EQ5 A;  3H0G H;  4C3H H;  4UY8 C;  4APV A;  1P8L A;  2YYZ A;  3G71 A;  4B3T Q;  3KDF B;  3D0F A;  1N9W A;  1YHA A;  1IZ6 A;  3HKS A;  1J5E L;  1V1Q A;  3E9I A;  3S2D H;  4C3I H;  1WI5 A;  1OXS C;  3GTL H;  3T1Y Q;  1NY4 A;  4JI3 Q;  4BY1 G;  4LF5 L;  4X64 L;  4DV5 L;  3Q8D A;  2K4K A;  2KCM A;  2B29 A;  3CC4 A;  4L5R C;  4BXX H;  3PIP A;  4BBR H;  3TS0 A;  5M5W H;  5IP7 H;  4P73 A;  3ULJ A;  3HKZ G;  1X3G A;  3G4S A;  1K8G A;  2ALY B;  4YWK A;  4BA2 I;  2B63 G;  3TEH B;  2JA8 G;  2FXQ A;  2K75 A;  3W1B A;  3ZJY C;  4P72 A;  3RLF A;  4LF9 Q;  4OWW B;  4B3M Q;  4R4I A;  4IFD G;  4JI8 Q;  4X62 L;  2F4V L;  1GM5 A;  3L0O A;  3NBH B;  3NEL A;  4C2M H;  4JI6 L;  1R9T H;  1IL2 A;  2D62 A;  3S16 H;  1PH5 A;  3K7A H;  2MO0 A;  2MQH A;  4PG3 A;  1N34 Q;  1IBM L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...