1J6QA

Solution structure and characterization of the heme chaperone ccme
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
100
structure length
100
Chain Sequence
SNLNLFYTPSEIVNGKTDTGVKPEAGQRIRVGGMVTVGSMVRDPNSLHVQFAVHDSLGGEILVTYDDLLPDLFREGQGIVAQGVLGEDGKLAATEVLAKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cytochrome c maturation protein E
publication title Solution structure and characterization of the heme chaperone CcmE
pubmed doi rcsb
source organism Shewanella putrefaciens
molecule tags Chaperone
total genus 18
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2002-04-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1j6qA00
3HKZE 4IPHA 2VL6A 1HH2P 1BBWA 1EWIA 1N8RC 1EIYB 2QA4A 4AQYL 5GQOA 1HNXQ 4A3GG 1VQHA 1MJEA 2HHHQ 4IFDJ 2ZJQA 5IYBG 2ZM6L 1PYBA 1Q1BA 3RLNA 3STBC 1QVGA 5LMUL 1N33L 3A74A 1PV4A 2JA9A 1PFSA 2PI2A 2JQOA 3HOUH 2OQKA 1MIUA 4GN4B 4JYAL 4XTCS 3TS2A 3G4SA 1GKHA 4MZ9A 1IYJB 4A93H 4LNQA 1IBML 2A19A 2ZTCA 1WJJA 1XJVA 3U50C 4DR4L 2UXBQ 4DV0L 2F4VQ 4GLVB 1L0WA 1PHJA 2VQFL 4A3BG 1E7ZA 3CPFA 3HOXH 1AH9A 2UU9L 2UUBQ 2B3GA 4DV5Q 2NVYH 4P74A 1C7YA 2Z6KA 4X65Q 1UE7A 3VDYA 1CSPA 4B3SL 3I55A 4BBRH 1UEBA 3TREA 2YV5A 1CKOA 2CCZA 1A0IA 1G6PA 1OTCA 3RZDH 1M1KC 1HNXL 2NVTH 3PF5A 2AWOA 3J81c 1YJ9A 5C0XI 4DV1Q 1QZHA 3J7A5 5C3EH 2Z0SA 1SLJA 1OXVA 2CFMA 2UUCQ 4GOPB 3JAMc 3E9IA 1QVCA 1VQ9A 3FKIH 3KLWA 4GNXB 3GTJH 1CKNA 1Q12A 2I0QA 2WB1G 1RL2A 4LWCA 3HOUG 4BY7H 2YTVA 2UXBL 2BA0A 1VQEA 2F4VL 4JC0A 2NVQH 1B70B 4A93G 1E1OA 1FGUA 1C0AA 4DR6Q 4IJLA 3IRBA 3MXNB 1EUJA 4IJHA 2UUBL 4JI4Q 5C4XH 1Q82C 2JA5H 5FLXc 4DUYQ 2K52A 2R6GA 5AJ3Q 5LMNW 1S40A 4C3JH 4PZ7A 3J80i 4DV2L 2CQOA 1YITA 3GTMH 4GKKQ 3JC66 2YU9H 4B3TQ 1IBLQ 3HOWH 2MO0A 4APVA 4BBRG 2HQLA 4P72A 4YCVA 4DAYB 1PH9A 4LF6Q 1NY4A 1YIJA 2JA8H 4GLAC 1B7YB 3CCRA 3J7ZC 2N3SA 3RN2A 4LF7L 4QQBX 2K50A 3BU2A 2UXDQ 4DV1L 4KI0A 1TWAH 1BVSA 2ZTEA 3SGIA 3M7NA 4JI3Q 1E3PA 2UUCL 4JI5Q 2DGYA 3AEVA 1E1TA 5C3EG 4A3LH 1HNWQ 3ULLA 1IL2A 1Q7YC 1HNZQ 1V1QA 4R4IA 5C4JH 2FXQA 2Z6KC 1KD1C 2NN6I 3S1RH 1VQFA 4B3MQ 1HZAA 4QL5A 2MQHA 1XTDA 3FKIG 4IOCA 3EBEA 2N49A 1XNRQ 4A75A 2ALYB 1L1OB 3L2PA 1K73C 3GTQH 1I5FA 1VQGA 3CF5A 4BY7G 3M4PA 1YEZA 2PI2E 1GVPA 2V1CC 3E9HA 3CCLA 1TXYA 5AJ3L 1V43A 5C4XG 2Q2IA 2JA5G 2OWOA 4GS3A 4PMWA 2UXCQ 2D0OA 4GOPC 3AQQA 2XGTA 5GAGC 3CCQA 1OXTA 3J81j 5M5WH 1YHBA 4DR2Q 3Q8DA 4GN5A 2IT1A 2E2IH 1VQKA 3HKZG 4HIMA 5FLMH 1XPRA 1W3SA 4LF6L 4POFA 2UXDL 4JI6Q 1D7QA 3HOWG 1NTGA 2LXKA 2N8NA 2HT1A 3PO3H 2JA8G 4DAMA 4JI3L 4NXNL 1R9TH 4IPGA 1J5EL 4ALPA 1JJGA 4WJ3M 2KENA 1M90C 3I2ZA 2YYZA 5GROA 4B3ML 3BZKA 1HR0L 3UDXA 4A3LG 1IBKQ 1KXLA 3UDFA 3K0XA 5M3MH 2E5LQ 5IT9c 5JJIA 4OONA 4HIKA 2R93H 3FHWA 3KF6B 3KF8B 3UE1A 3F2CA 3KDFB 4NXMQ 4JBJA 3I4MH 1VQ4A 2F52A 3G71A 2L15A 4R4QA 5IY0A 4QJFA 2E2HH 2CKZB 3AYHB 1VQ5A 4LUOA 2HIVA 4JI8L 1TWCH 3PUVA 4A3JH 4UP8A 2A1AA 1IXRA 2UXCL 3S17H 4EX5A 4DR2L 3M9BA 1QUQB 3CMEA 2B63H 2OTJA 3AFQA 1VQ6A 3NBHB 4A3DH 3PUWA 4JI6L 3RZOH 3K7AH 3GTGH 1I50H 1VS0A 2AWNA 2EXDA 5FLMG 1VQIA 1PH4A 4JV5Q 3DLLA 1X55A 3OTOQ 4R1JA 4DPGA 3PIOA 4L5RC 4DV7Q 2MNAA 2VY3A 3HOYH 3PO3G 3I4NH 1EQRA 3A0JA 2KHJA 4DV4Q 4A76A 1VQ8A 4WJ4A 2KCTA 4YWMA 3GTLH 3M4QA 4HJ9A 1IBKL 1J6QA 3PUXA 1Y1WH 3I4OA 4L5QA 1JJ2A 1ASYA 1OXSC 2MFIA 2E5LL 3CP0A 2NVXH 1AE2A 3CMAA 4UP7A 4GN3B 4BBSH 3W5OA 4DV2Q 4LFBL 5M3MG 5JJKA 3PIPA 4NXML 2EQSA 4RG1A 5GAEC 5C0XG 2R93G 1NMGA 1KAWA 5EAYA 2RF4A 4JBKA 3PUZA 1PA6A 3K7UC 1Q86C 4JI2L 4ME3A 4OWWB 4DK3C 4LF7Q 3I4MG 2VW9A 3UE0A 1KRSA 2R7DA 4MNOA 4X64Q 2I5MX 4DR1L 1WOCA 2WFWA 3F8TA 2RHQB 4DNIA 4YHHQ 1Q81C 1YZ6A 2JK8A 1NMFA 4A3JG 1FL0A 4LUVA 5C0XJ 4GOPA 2VZAA 2JA7H 5IYDH 2B63G 4GNXA 3A5UA 3H0GH 3PUYA 3UDGA 4JOIA 1DGSA 4JV5L 4A3DG 3RR5A 4R4CA 3OTOL 4KHPQ 4A3FH 1EQQA 4DV7L 2QEXA 1YHQA 4TVAB 4HIDA 4OWXB 2GN5A 2LXJA 3CAMA 4DV4L 2PNHA 4LW1A 4JI1L 2Q2TA 3CCJA 4LF9Q 4C3IH 3HOYG 1QZGA 3S1MH 4POGA 3I4NG 1VQDA 1KC8C 2VUMH 5IYCH 5GAHC 1XPOA 5JJLA 1Y1WG 1JMCA 4AYBG 2K5VA 4PG3A 1YVCA 5M3FH 3UDIA 1SFOH 4BBSG 1Q8KA 3D0FA 4DKAC 1PH8A 3PV0A 3S1QH 2R7FA 2BH8A 4YY3Q 2K4KA 4DV6Q 2GVBA 4K0KQ 1XMOQ 1EYGA 3CXCA 4FDBA 1PVOA 4X64L 3PCOB 2NN6G 2K75A 4YCWA 4YHHL 4NXNQ 1LYLA 1T9HA 2YTYA 1D8LA 3W1BA 3J80c 1J5EQ 4OX9Q 1N9WA 4DK6C 2E8GA 4UP9A 3KFUA 1WI5A 1N34Q 1HR0Q 1ASZA 3GTOH 3W1GA 3HFZB 2ZJPA 4KHPL 2JA7G 5IYDG 3HKSA 3H0GG 1S3OA 4DV3Q 3M3YH 4K0KL 4KLKA 3F1ZA 4X66L 4A3FG 1L1OA 2R7ZH 4JI7Q 4LF9L 1JJCB 4XIGS 1QVFA 4Y52H 4LFAL 1VQPA 2EIFA 3S24A 3A5ZB 3GDEA 3BJUA 5IP7H 4JI8Q 1FVIA 3H15A 3OW2A 2C35B 1GO3E 2VUMG 1SRUA 4P75A 1UE6A 5IYCG 3PSIA 4QIWE 5BR8L 3S16H 3S2HH 4GNXC 2A8VA 5C44H 1NE3A 3KOJA 4JOIC 4AH6A 1Q1EA 2ID0A 1IZ6A 1LUZA 4YY3L 5M3FG 4DV6L 5E7NA 1XMOL 4LF4Q 4BA2I 3CW2C 1GM5A 4OXPA 5GADC 1VQNA 5IWAL 1PH7A 4OX9L 1N32Q 3I7FA 1SR3A 1WFQA 2WAQE 3L0OA 1JB7A 1EFWA 1VQAA 2PMZE 3S1NH 1N34L 1SROA 4OO1I 1HJPA 2ZJRA 3NELA 5IE8A 4A4IA 1X6OA 1UWVA 1JT8A 4B3RQ 1NJIC 4DV3L 4LFBQ 1VQJA 1I3QH 4NPSA 1W2BA 5J3BA 2D0PA 3KF6A 2PQAB 4JI7L 4UY8C 1N36Q 1YBYA 4A3MH 1PH6A 3KDFA 1YHAA 4JI2Q 2R7ZG 2JE6I 3ZJYC 3CCUA 1X3GA 2Y0SE 4DR1Q 2D62A 2AHOB 1Y14B 5IP7G 4A3EH 5ELNA 1A63A 1P8LA 1RIPA 1Z47A 3KYHC 1X65A 3NEMA 2VQEQ 3B6YA 3CCSA 1QUQA 3D31A 3EIVA 4LF4L 3U4VA 4C2MH 2JA6H 4H02A 5C44G 1YI2A 2Q2UA 2BH2A 2GVAA 2KCMA 2YTXA 1PH2A 3K8AA 1L1OC 3MEFA 1PH3A 1A8VA 5FJ8H 3TEHB 1N32L 3T1YQ 3EN2A 4IFDI 5DLQE 1K9MC 4DR5L 4JI1Q 3RN5A 2AKWB 1TWGH 4JI0Q 1C9OA 1X56A 5H1SE 1WCMH 4LF8Q 2ASBA 4HJ8A 3PF4A 4B3RL 3GO5A 2XTIA 2E2JH 3T1HQ 1GD7A 1KL9A 4BA1I 3WWVA 3ERSX 4QY7A 5ELOA 3CCVA 3GTKH 1N36L 1VCIA 3H3VI 1L2FA 4X62Q 3TS0A 4L5SA 3OYYA 2KBNA 3HOVH 5HY6A 4O0AA 1Q46A 1E24A 4A3MG 4J15A 4BY1H 2VNUD 3CCEA 2IX0A 4JCVE 3RNUA 1PH1A 4P71A 1TWFH 3LGJA 2VQEL 2OTLA 4Y7NH 3ULJA 1OXXK 5M5YH 3PO2H 2NZOA 1G51A 4YCUA 1KIXA 3M85A 3J81i 2K14A 1A62A 4A3EG 1UE1A 1XNQQ 3F2BA 2ZTDA 2OQ0A 3CPWA 4A3KH 3TQYA 4X6AH 2I5HA 4RMFA 3JAMi 1CSQA 1O7IA 2AMCB 3ICEA 2JA6G 3U58A 3S2DH 1K3RA 2I5LX 4HJAA 3T1YL 2JEAI 3GD7A 1OXUA 4L5TA 1UE5A 4X66Q 1P16A 3G6EA 1S72A 5HGQA 2R92H 3S15H 5FJ8G 2HHHL 4JI0L 1JE5A 4LFAQ 1BKBA 1VQCA 1YJWA 4LF8L 2UUAQ 3CC4A 3TRZA 2IX1A 4GLXA 1XMQQ 1CKNB 3U4ZA 3CC2A 1SE8A 3T1HL 2LSSA 1I6HH 5IWAQ 1WCMG 3KJPA 5BR8Q 3HOZH 2HIXA 4B3TL 3NENA 4R4TA 1LM0A 2H5XA 3CQZH 4X62L 3ER0A 5LMNQ 3K80C 4KHZA 1K8GA 4HIOA 3ULPA 1VQBA 5JEAG 1XPUA 1G291 3HOVG 4LFCQ 4UPAA 4LF5Q 4BY1G 3AFPA 1H95A 3E0EA 1TWHH 4MTNA 3L7ZC 2B29A 4PZ8A 5M5XH 4DV5L 1XNQL 4P73A 3HOXG 2IHEA 3PGZA 4X65L 4BXXH 4A3CH 3KJOA 1I94Q 5JEAJ 4IO9A 3PO2G 4DR3Q 1VQMA 2JJQA 5IP9H 4A3KG 4JBWA 1LTLA 2JEBI 1MJCA 4JBMA 1HZ9A 3CCMA 1HZBA 1CKMA 2WB1E 4EQ5A 4DR7Q 2ES2A 1E22A 2WAQG 1HR0W 5K36G 1K83H 4A3IH 2R92G 4PZ6A 2UUAL 3S14H 4IPCA 1XMQL 1BBUA 1Y1VH 2IHFA 1MKHA 1K0RA 1X3FA 1X54A 1AE3A 2OCEA 2BA1A 3DM3A 4O2DA 4YWKA 4GKJQ 1X9NA 3BZCA 1KRTA 1X3EA 5LMNL 1YJNA 3HOZG 4AYBE 2CWPA 2K5NA 4HJ5A 1EOVA 1CUKA 4DUZQ 2ATWA 1FJGQ 2K5HA 4R4OA 4DR6L 4LFCL 4OO1G 2Y0SG 4NB3A 4A3GH 4LF5L 4JG2A 3RLFA 3F2DA 4JI4L 1K8AC 4C3HH 5IYBH 2QGQA 4DUYL 4IPDA 1KHIA 2VS1A 4DR5Q 4AQYQ 1SN8A 3H3VH 1I94L 1PH5A 3STBD 4DR3L 1VQ7A 2ZM6Q 4AIMA 4GKKL 3CD6A 4BXXG 4A3CG 3CC7A 3I56A 2NZHA 5LMUQ 1VQOA 1IBLL 1N33Q 2RHSB 4HJ7A 2F3IA 5IP9G 3M4OH 4IOAA 1V9PA 2N78A 1KQSA 4DR7L 4JYAQ 1PYSB 1NBWA 4A3BH 2MO1A 2PQAA 2CWAA 1IBMQ 3RLOA 4JI5L 4DR4Q 1YNXA 1Z9FA 4DV0Q 4A3IG 4QGUA 3GTPH 2VQFQ 1HNWL 1HNZL 2WP8J 1U5KA 4YWLA 2UU9Q 1EIFA 4GKJL 1B8AA 2Q2HA 4TQUS 1VQLA 1WYDA 1Y1VG 3G48A 4OWTB 2DUDA 1SMXA 1U0LA 4LUZA 2RCNA 2KHIA 1HZCA 3FP9A 4IFDG 1XNRL 4B3SQ 4DUZL 2IY5B 3K81C 1FJGL
chains in the Genus database with same CATH superfamily
4IPHA 1HH2P 1EWIA 3WOEA 2QA4A 4KTAA 3P7JA 2B2UA 1F2ZA 3J7YW 1NSNS 1BF4A 1N33L 3QWNA 1PV4A 1K8MA 5G3LF 2OQKA 3TS2A 3FVQA 3A56A 3HOVB 4BY1B 1TS2A 4K14A 2KEEA 3HZXA 2SDFA 3HRZC 1FR3A 2N55A 4DV5Q 1C7YA 1CSPA 3I55A 3TREA 5FOBB 2EY2A 1A0IA 2FMMA 1HTLD 2PMZB 5JJZA 1OTCA 3S15B 2XSCA 3C3LA 1YJ9A 5C0XI 2DJFC 1SLJA 2CFMA 2UUCQ 3JAMc 2ICIA 3A7AB 4GNXB 2F0FA 1TU2B 3V2TA 3CQZB 4KHVA 1K0SA 4LWCA 4BY7H 4N9PA 3K6OA 5CV5A 2NVQH 4JC0A 1E1OA 1FGUA 3IRBA 4IJHA 2UUBL 5C4XH 5C6AA 5M5XB 1Q82C 5DM73 5FLXc 1XXGA 1WVLA 2R6GA 4FF2A 2TSSA 1D5XC 2IPKD 4C56C 4H44C 4PZ7A 1U4LA 4XXEA 3HOWH 2MO0A 1EU4A 3VR3A 4APVA 1PH9A 4YCVA 3WOFA 4ZAIA 4QQBX 3RN2A 2N3SA 4CJ2C 3R8BA 3SGIA 1TWAH 1BVSA 2OXPA 4JI5Q 1E1TA 3C1FA 1V1QA 2B2WA 4RFBA 1EFID 2SNMA 1KD1C 3DHQA 4HTHA 1SNDA 4U673 1STAA 5C5LA 2KECA 2XRSD 2N49A 1XNRQ 4A75A 3GTQH 4BY7G 3M4PA 1PFMA 2L12A 4C3HB 1TVXA 5C4XG 3K5OA 4GS3A 3BDLA 2XGTA 1DOKA 5GAGC 1L0XB 3CCQA 3J81j 1S4ZA 4B3TL 4GN5A 1M4VA 1CZWA 2J7ZA 1W3SA 4E6IA 1CQVA 4POFA 2UXDL 3HOWG 4XT1B 2LXKA 1ZXTA 3T51B 1JE4A 3SEBA 4NXNL 1J5EL 3GTPB 1ONLA 3I2ZA 1F77A 3L3OC 4J1MA 3K0XA 2E5LQ 5JJIA 1C4QA 2RBMA 1PTOD 3F2CA 1MSHA 1VQ4A 2F52A 3OHXC 2EYMA 3AYHB 1IXRA 3ERQA 2B2WC 2NYZD 2B63H 2WB1B 1VQ6A 4O1NA 4IUVA 1KAAA 1ET9A 4A93B 1VQIA 3DWQA 3DLLA 2FJ2A 4R1JA 1G6ZA 4DPGA 1JICA 1MI2A 2RDFA 1EQRA 3A0JA 4DV4Q 1VQ8A 3BDOA 2KCTA 4YWMA 2X6LA 1Y1WH 3I70A 3I4OA 2F0PA 1JJ2A 2NVXH 1G91A 3CMAA 4UP7A 4M1UB 4BBRB 1PTOC 4RG1A 5GAEC 1KAWA 4JBKA 2NN6H 4DK3C 4X64Q 4MNOA 2I5MX 4KN7C 4RH6A 1Q81C 1B44D 1NMFA 5C0XJ 2NWGA 2VXWA 2B63G 4GNXA 3DM1A 4JOIA 1DGSA 1LTAD 2DN8A 1EQQA 2QEXA 2Z6BA 5EPKA 2FFKB 4OWXB 2GN5A 4LF9Q 1QJOA 4C3IH 1QZGA 5LL6S 1SNQA 4C3JB 3HP3A 5JJLA 4LAAA 1Y1WG 5M3FH 5LL6X 1SFOH 4DKAC 2B8FA 5KNBA 1LTID 2R7FA 4YY3Q 1EY4A 2K4KA 4K0KQ 2MPMA 4FDBA 4DXFA 1SE4A 4RGOS 4IZ8A 2NN6G 2K75A 3QJYA 3MXUA 1BOSA 1T9HA 1FNWA 4LJZC 5FKAC 1N9WA 1GHKA 3GTOH 2Q8TA 1EQVA 4KHPL 1SEBD 3V05A 1Q8IA 1E2ZA 2FINB 4X66L 5KGUA 1JJCB 4XIGS 4Y52H 1VQPA 2EIFA 3S24A 3A5ZB 1G8ZD 4MN3A 4C3IG 3JAML 1GO3E 2CVRA 3MXPA 4JVZA 1SRUA 4P75A 3I72A 2E2IB 5JVH3 2EYHA 5BR8L 2AQ2B 4GNXC 4L63B 4JOIC 5M3FG 4NKLA 1IZ6A 4BA2I 4OL7A 1LABA 1GJXA 1GUTA 1VDZA 4OX9L 1N32Q 1EQTA 3MTSA 1SR3A 3Q23A 1VQAA 2PMZE 5FLXL 1N34L 4N8FA 2R61A 3NTIA 4BS9A 2ZJRA 2H1EA 4DV3L 1EU3A 2ZXRA 2D0PA 2PQAB 2DY8A 1YBYA 5G3LD 2JE6I 5D14A 4WORA 3CCUA 3MHBA 2FMCA 4V190 4EVOA 4XYQA 1Y14B 1A63A 1P8LA 4G7ZC 2EYJA 1QILA 4KD4A 5CYUA 5CBEE 3RZOB 4QUCA 4LF4L 2PZTA 2JA6H 1A6XA 5ELEA 4IQZA 2BH2A 1ET6A 5K5PA 3K8AA 5E3FA 3TEHB 2LS01 3HOYB 1F2LA 2M9VA 3EN2A 3VR5A 3I4NB 1PFBA 1QE6A 4JI0Q 3K58A 4AYBB 4KKUA 1PRTB 2F0UA 2ASBA 4LF8Q 4QF4A 4B3RL 4X3SA 1W6JA 3T1HQ 1CT1D 1VCIA 3OMCA 2HDMA 2EVBA 3OYYA 3HOVH 4O0AA 4NW2A 4J15A 4BY1H 4QCLA 2XN9C 4JCVE 3P75A 3CCEA 4P71A 1ENFA 2EYOA 1ZKOA 1VF5C 2PZWA 2JYOA 3F2BA 3CPWA 4HSPA 3TQYA 4X6AH 3JAMi 3FDTA 4A3FB 2AMCB 2JA6G 1FNUA 3T1YL 5K36H 4L5TA 1P16A 2RCFA 3S15H 3S1MB 1ESFA 1NAPA 4YIJA 4LFAQ 3R2TA 1LTGD 2K01A 1AEXA 1HPCA 3PIP3 3H94A 4GLXA 1SE8A 1HHVA 1U4MA 2D5DA 3TP7A 2H5XA 3CQZH 4X62L 3ULPA 4OO1H 1XPUA 3SE0A 1Y8NB 3FPPA 1A2UA 3HOVG 5COYA 1SYCA 1D2BA 4BY1G 1LV9A 1MHWC 1RKNA 2B29A 5M5XH 4CHTB 3FPUB 3PGZA 5JEAJ 4IO9A 5IP9H 2JEBI 3NSWA 3DWAA 2PCFB 1PDQA 3CCMA 2WB1E 4EQ5A 4RGMA 3FRPB 5K36G 5CV4A 2RSOA 3U9SA 2D9UA 1BDOA 5IWAL 3S2HB 3ND8A 4HR7B 4FVMA 5LMNL 3RD4A 1I4GA 1KABA 1UEAB 1RCVD 1FYCA 4OO1G 1HQRD 1BCPF 1K8AC 4C3HH 1JWMD 4IPDA 1KHIA 4OIJA 1SN8A 5C4ZA 3H3VH 1SYFA 3D8GA 4N9TA 3STBD 4DR3L 5C5MA 4AIMA 3VA5A 5CBAE 2F03A 2NZHA 1N33Q 1IBLL 4H0LC 1I3QB 2RHSB 3K5MA 5FO8B 4HJ7A 2SOBA 5IP9G 4HSVA 3N6RA 1V9PA 1KQSA 4A3MB 4DR7L 2F3VA 4G4KA 4A3BH 2MO1A 2PQAA 1JWUD 1CTMA 3GTPH 2WP8J 4OHJA 1SE2A 1TR5A 4GKJL 2AQ3B 1WYDA 2KUMA 2DUDA 1AFPA 2MGSA 1HZCA 3FP9A 2J0TD 5M9OA 1STGA 4S3SA 4DUZL 2L5TA 3MA2B 1N8RC 1U4PA 4EGVA 1EIYB 4AQYL 1VQHA 3BYTB 1TWGB 2BCOA 4B9XA 4C3HG 1Q1BA 2QEJC 3STBC 2B2YC 2A6HC 2KOLA 5LMUL 1QVGA 1SMYD 3I91A 2E2JB 1PFSA 2MUYA 1NUCA 5TSSA 4GN4B 1MIUA 3QIAA 4CKEA 4KKTA 2ZT9C 1GKHA 4MZ9A 4A93H 1DCZA 2A19A 2ZTCA 4DR4L 1IKLA 4DV0L 4B9WA 4A3BG 1SAPA 1PHJA 2VQFL 3NWTA 4Z9CB 3CPFA 1AH9A 2UU9L 4HAEA 5KRUA 2UUBQ 3PO2B 5M5YB 4OGQC 4X65Q 1SYBA 1WTRA 1XTCD 4BBRH 1UUPA 1LT3D 1UEBA 2YV5A 1CKOA 1IYVA 4FXKC 1G6PA 1HNXL 1KTKA 4LK1C 3J7A5 4CJ1B 1OXVA 3E9IA 3KK7A 1IKMA 4QMGA 3KLWA 1Q12A 1HQMC 2WB1G 1RL2A 2CW0D 2Y0SB 1QNUA 2UXBL 1VQEA 1UNSA 1B70B 4A93G 4DR6Q 4IJLA 3T4AC 5J22A 3J7AV 4DUYQ 4X3TA 1S40A 4C3JH 4DV2L 2WKCA 4GKKQ 3JC66 4B3TQ 4F7XA 1GUOA 2RQXA 2FHTA 4BBRG 1YIJA 4GLAC 3CCRA 3J7ZC 4LF7L 2UXDQ 1K83B 2K50A 4A3IB 2O4XA 4DV1L 2ZTEA 1CZGA 3S14B 1K8OA 2Z4IA 3ULLA 1Q7YC 2EYLA 1HNZQ 1IL2A 4K8IA 1HZAA 3O13A 1KNEA 1T5XD 2IX3A 3EBEA 2CW0C 5DNFA 4K2LA 1L1OB 1I5FA 1YEZA 4A3GB 1GVPA 1I4PA 5IGCA 1D1KA 3I3CA 3NWSA 1V43A 3TP5A 2Q2IA 4CBVA 3AQQA 2E2IH 1PTOB 4C3JG 1XPRA 3M4OB 4KJOA 2C9OA 1B9NA 4ZKCB 5AFWA 2HT1A 4KY6A 4JI3L 3GV3A 5GROA 4B3ML 5ELCA 1I4XA 3UDXA 1KXLA 2EJFC 3FHWA 3KF6B 3MFYA 1LTSD 4JBJA 2F0IA 2PPBC 2L15A 4IUTA 3CRKC 2E2HH 2CKZB 4LUOA 4JI8L 2F0NA 4HCEA 2A1AA 2UXCL 3BVMA 4EX5A 4DXGA 4BWGB 3CMEA 4LMQD 5ELBA 4JI6L 3RZOH 2AWNA 4MIUA 1PH4A 2EXDA 3AMUA 5IGGA 3SK4A 5J39A 3PIOA 2BE5D 4L5RC 3MVVA 1EY7A 3HOYH 1II3A 2EY6A 1CFMA 3I4NH 4WJ4A 1S5FD 1E0BA 5DM63 1IBKL 1Y8PB 3EA6A 3PUXA 4L5QA 1ASYA 1OXSC 1HUMA 3CP0A 1AE2A 2EJGC 1KDBA 4LFBL 1JR0D 4NXML 3GP7A 1LTRD 2RF4A 3MEHA 3RZDB 2NVTB 3PUZA 1YNND 1B53A 3K7UC 4OWWB 1SNPA 4JPBW 1KRSA 1STEA 3EQLC 5C3EB 1ILPA 4DR1L 5I9OA 1WOCA 2WFWA 3VYUA 5IGBA 3JAME 2JP1A 5BN3A 4H7BA 3FKIB 1QG7A 3GTJB 1DD2A 3PUYA 3UDGA 4JV5L 4KHPQ 4R4CA 4TRDA 4A3FH 4DV7L 4KMUC 2TMPA 2LXJA 4LW1A 5FLXE 2BOSA 1A3VA 3HOYG 1QB5D 3S1MH 1LT5D 3I90A 3I4NG 1VQDA 1JB3A 2ZXOA 5IYCH 2NTTA 2F0OA 3HKZB 4AYBG 3GTMB 2MP1A 1YNJD 2YU9B 2HQEA 2KJXA 1AP0A 1A3TA 1XWEA 1EYGA 1YNNC 1PLFA 3VR2A 1TIID 4YCWA 1DYQA 3J80c 1WTVA 4OX9Q 2EXZA 2EY5A 1GUWA 2CHBD 3BG3A 3CHBD 4UP9A 5C4JB 3KFUA 3L9AX 1N34Q 1HR0Q 1ASZA 1DM0B 1BCPD 5I4DA 2ZJPA 2F0GA 2NTSA 1HTPA 4IUQA 4WRDA 1S3OA 4DV3Q 3A8KE 2KEDA 3F1ZA 3SDZA 1L1OA 3DWPA 4RKBA 4A3FG 2PYKA 2CQAA 3GDEA 2NUCA 1CQFA 1J9OA 2C35B 1I4RA 5IYCG 3PSIA 3S2HH 4ULLA 3U9OA 3KOJA 3LNNA 4LF4Q 1XMOL 5E7NA 1XX8A 4A3BB 3CW2C 3K5LA 3PO3B 2O2LD 5GADC 1BQQT 1EFWA 5I9PA 5NUCA 1SROA 2A68D 5ELFA 1WTPA 1HJPA 1NNXA 4A4IA 1BCPC 1JT8A 4B3RQ 1VQJA 1I3QH 4RWSC 1HFNA 3KF6A 4JI7L 4UY8C 4JK1C 3TN2A 3E5SA 4A3MH 2RKSA 1YHAA 2G9HD 4JI2Q 4A3JB 1X3GA 1UAPA 2Y0SE 2PNRC 5EBDA 5ELNA 1CK1A 3NEMA 4DNTB 2QILA 2PO4A 2NZ1D 3D31A 3GTGB 5F2DA 1YI2A 4ZCKA 2YTXA 3FEWX 2VB2X 1L1OC 3MEFA 4ID6A 5FJ8H 4X3KA 3SVMA 5I6WA 3T1YQ 4IFDI 5DLQE 4JI1Q 1K28A 1TWGH 4OELB 1O7LA 2A68C 1C9OA 1X56A 3TDQA 1KDCA 4HJ8A 3F2UA 2XTIA 2E2JH 3OOCA 1SJED 4CJ0B 1LLRD 2X69A 4X62Q 2KBNA 3OWEB 1X32A 4A3MG 2VNUD 3RNUA 2IX0A 3H09A 1CA5A 1PH1A 5CV7A 3H6MA 1W6KA 1SNOA 5M5YH 2XRQD 3PO2H 1B2TA 2K5WA 2K14A 4HN7A 1Y69U 4RMFA 1SSOA 4G7HC 3ICEA 1DONA 1PMRA 1B3AA 1Y8OB 3GD7A 1UE5A 5HGQA 1D6EC 5FJ8G 2B8GA 1LT4D 4FXDA 1J8IA 1Q3LA 1EL0A 2IW3A 3N52A 3CC4A 4J8QA 2L0CA 1CKNB 2LSSA 5IWAQ 1DJRD 5LMNQ 3ER0A 3K80C 4KHZA 3R2IA 4ABNA 4HIOA 1G291 2L55A 3MWYW 2VB3X 1BBXC 1E2WA 5CV9A 3EJIA 2L1BA 3AFPA 3E0EA 4DV5L 4ZRZA 1XNQL 2K5QA 3HOXG 2OT2A 3QOJA 4K5VA 3KJOA 3PO2G 4Q0FA 4DR3Q 4I7AA 1H9RA 1VQMA 3VYRA 2HDLA 2JJQA 1KLGD 4XYOA 3M3YB 1HZBA 1HRJA 2A6ED 4DR7Q 1E22A 1HR0W 1K83H 4A3IH 1TS5A 1F9PA 1EYAA 4XQJA 3E6ZX 2CH4A 1O7YA 3AB9A 3S14H 1BBUA 1K0RA 1MKHA 1AE3A 4DGZA 4GKJQ 1X9NA 5C44B 1V1OA 2X6GA 4FF3A 3K57A 5C3XA 1H9SB 1EOVA 2F0JA 1TKWB 4DUZQ 2ATWA 1WTHA 4R4OA 4LFCL 1D5MC 2Y0SG 4NB3A 4A3GH 4LF5L 3F2DA 2K28A 3S1NB 1CM9A 4ZLTF 4DR5Q 3Q24A 5EKIA 4AQYQ 1I94L 2J4XA 5FK9C 3CC7A 3I56A 5LMUQ 1WTWA 1PTOH 3M4OH 3CU7A 3IFTA 2E2HB 1NBWA 2A6EC 5JPNC 2CWAA 4ZYSA 3RLOA 4JI5L 4IALA 4DR4Q 1YNXA 1Z9FA 4KY7A 4XDXA 4DV0Q 4A3IG 1GUSA 3T56B 3HS0C 2VQFQ 5T1GA 3J80L 2AUJD 4A3EB 4ILWA 2UU9Q 1EIFA 3NE5B 1B8AA 1VQLA 4QUFA 4C2MB 1GUGA 1V1PB 2Q8RE 4L8JA 1XNRL 1SJHD 2IY5B 3HKZE 2RVLA 4O42A 1HNXQ 4A3GG 3OPOA 1MJEA 2HHHQ 4OEMB 4IFDJ 2ZJQA 3SR1A 3DEPA 1WCMB 1PYBA 5I6YA 3RLNA 4DA2A 3A74A 1L0YB 4CDDC 3OWFA 1AN8A 3GTKB 1RD9D 2B2VC 4JYAL 1EWCA 2OF1A 1IYJB 2A5HA 5FO7B 1WJJA 3TP8A 3U50C 2UXBQ 4NP5A 4GLVB 1L0WA 4L6TB 2KCNA 4P2CB 2B3GA 3Q0AA 4P74A 2I07B 1Q90A 2Z6KA 1GHJA 1UE7A 3VDYA 1SYDA 4R8IA 1TQOA 2CCZA 3WDNA 4R8NA 3RZDH 2NVTH 4G57A 2AWOA 4H13C 3J81E 3J81c 4DV1Q 2QKIC 5C3EH 5IOCA 2OEOA 2ICEC 1I6HB 1VQ9A 3FKIH 3HOZB 3GTJH 1CKNA 4RKLA 2YTVA 2BA0A 3LWEA 2F4VL 4JI4Q 1O78A 5E4WC 4RAUC 5LMNW 3A8JE 5LHY1 1I4QA 2KQ3A 1EY0A 3J80i 1AZPA 1YITA 3GTMH 2YU9H 1D1IA 2HQLA 2BDNA 4DAYA 3BU2A 1EEFD 1ZYRD 3M7NA 4JI3Q 1LO5D 2DGYA 3BVGA 5C3EG 4A3LH 1HNWQ 2B2YA 1JORA 4R4IA 5C4JH 2FXQA 2Z6KC 4B3MQ 2NN6I 1VQFA 2KHSA 2K03A 4QL5A 2MQHA 5E1FA 3FKIG 5KYLA 4K6DA 2G9DA 1H9SA 1X3QA 2V1CC 2A73B 5EJWA 2DNCA 5DEHA 3CCLA 1TXYA 4X3UA 3OIPA 5C3WA 5CC4A 5AJ3L 4DK1A 2I46A 2UXCQ 4GOPC 3DXJC 2F0QA 1PZJD 1YHBA 2K6AA 3Q8DA 1ICFB 1SBBB 2IT1A 3HKZG 4HIMA 4LF6L 4NDXA 1EOTA 4JI6Q 4PNYA 1BR9A 1NTGA 1ILQA 2N8NA 3RUZA 3PO3H 4CDCC 3SK6A 1SYEA 4IPGA 2KENA 3BZKA 2E76C 4A3LG 4K8JA 1IBKQ 3NTKA 3T13A 4KV6A 3UDFA 5IGDA 4OONA 4RA8A 5C0XH 1PYWD 3KF8B 1V1PA 2XWBB 3KLRA 3UE1A 3VR4A 4EQPA 3KDFB 4NXMQ 2QF7A 1GXDC 3G71A 4R4QA 5IY0A 2BDOA 2HIVA 1RF2D 4DAVA 1HA5A 4ME5A 4A3JH 4UP8A 3S17H 1TS3A 1FGBD 2LMCB 5A2QL 4DR2L 1QUQB 2OTJA 3AFQA 5KNCA 3HOUB 4U68A 3GTGH 4CDFC 1VS0A 3NBHA 4JV5Q 3GV6A 2XNAC 3NBIA 4DV7Q 2VY3A 1TY0A 3PO3G 3HOXB 4HJ9A 2NVYB 1LT6D 1J6QA 1PTOF 1O7ZA 2MFIA 2XVSA 5IIFA 4GN3B 1RJTA 5JJKA 1JOOA 2KA7A 1H9MA 5C0XG 1B50A 1NMGA 5EAYA 1WD1A 1MBYA 1PA6A 1Q86C 4ME3A 3UE0A 3KBXA 2RHQB 2WV6D 1PZID 4IUPA 4A3JG 1U9RA 3I4LA 1SMYC 5IYDH 4XQQA 5C4HA 2XIWA 3A5UA 3MZ5A 2DJGC 3G7LA 3OTOL 1Z7TA 1EY8A 4HIDA 3C46A 2K04A 1SNCA 2PNHA 3M4YA 2Q2TA 2F0KA 2JA5B 4POGA 3IKJA 1H9JA 1KC8C 2VUMH 1BCPB 5GAHC 1JMCA 2K5VA 1YVCA 3UDIA 1WTQA 2A69D 3PV0A 2JA8B 3E0JA 4MHEA 2GVBA 1XMOQ 1PVOA 1SDFA 3TZUA 4QB4A 1NR4A 4YHHL 4NXNQ 1LYLA 2YTYA 3NXWA 1J5EQ 1DOMA 1RTOA 2E74C 1ESRA 3S1RB 1A2TA 4F8MA 5DAUA 3DUZA 2O5JC 3W1GA 4IN3A 3HFZB 5IYDG 4F88A 2M2LA 3M3YH 1VMCA 4KLKA 3BYYB 3EVQA 2R7ZH 4JI7Q 3EFXD 1QVFA 2B2TC 4LFAL 3J81L 4UHVA 3VYTA 4KN4C 5IP7H 4UDUC 1JOKA 3QOLA 2VUMG 5M5WB 1UE6A 2A8VA 5C44H 1NE3A 4AH6A 4WJWA 4DV6L 1Q1EA 1LUZA 4F87A 3LX0A 3D6WA 1SE3A 4OXPA 1R9TB 1I6VC 3I7FA 1WFQA 3S1NH 2K33A 3L0OA 2LFNA 4OO1I 5M3MB 1X6OA 2R93B 1UWVA 2AUKA 1NJIC 3TP6A 3I4MB 3KF8A 3NK9A 3QG1A 4CDEC 1LTBD 3KDFA 2R7ZG 2HD3A 1TWCB 3ZJYC 3A7LA 4KY5A 2D62A 4N8X1 2AHOB 1EIHA 5IP7G 4A3EH 3CRLC 1Z47A 3OMGA 2R3ZA 3B6YA 3CCSA 1QUQA 4A3DB 3K7AB 1I50B 4C2MH 1EYDA 5C44G 2KCMA 2NB0A 1PH3A 1A8VA 3DEOA 3K0YA 1K9MC 3GTLB 4HCSA 1IYUA 3J7AF 2WIIB 3C2PA 1A3UA 2F0LA 5H1SE 1WCMH 2KVMA 4BBSB 1XYIA 3SK5A 4CKCA 1GD7A 1SNMA 1ML0D 3WWVA 3ERSX 3GTKH 1TT2A 2L11A 5JEAH 3CCVA 1N36L 3H3VI 5CGKA 1L2FA 2LKVA 1AZQA 3VYSA 5HY6A 1JC7A 1E24A 4PMBA 5BN5A 3URYA 3X3MA 2MHVA 2VQEL 1QWYA 3ULJA 2NZOA 2JA7B 5L37A 3J81i 1XNQQ 4A3EG 1UE1A 1Z6HA 3H0GB 3PIO3 2I5HA 1CSQA 1O7IA 2I5LX 5D3IB 2F0MA 2D2CC 2BE5C 1OXUA 4X66Q 5CV6A 4ZKBB 1DXMA 3D3RA 1BKBA 1YJWA 1SYGA 3IL8A 3CC2A 1I6HH 1WCMG 5BR8Q 5D65A 1S5BD 2HIXA 3HOZH 3DMUA 4R4TA 2B39A 5JOBA 3S1QB 1LM0A 3SHLA 1K8GA 1FD7D 1VQBA 5JEAG 5E4XA 4TKOB 3J80E 4LFCQ 4UPAA 4LF5Q 4MTNA 5EBCA 3VR6A 2B2UC 3L7ZC 3NP8A 4PZ8A 4P73A 4BXXH 2IHEA 4X65L 4A3CH 1I94Q 1I4HA 3TSSA 2P5ZX 1F9QA 5EPLA 1HZ9A 4RGNA 3I8ZA 3D6CA 4DAPA 2F0SA 2F0DA 2UUAL 4NMZA 1XMQL 1HCZA 1U4RA 2BA1A 2IHFA 3S16B 2OCEA 4YWKA 1YNJC 3BZCA 1KRTA 5CMDA 2O5IC 3HOZG 2CWPA 2K5NA 2F4IA 5A35A 1CUKA 1CA6A 4DU9A 2K5HA 4DR6L 4JG2A 1K3BC 3MC0B 3W2DA 5IYBH 2QGQA 4DUYL 3K5NA 2L9HA 1PFNA 1PH5A 4KJNA 1VQ7A 2QDBA 4GKKL 3CD6A 1EZ6A 4BXXG 4A3CG 3T53B 5JAVA 2E2DC 1T5EA 2HCCA 1S5CD 2F3IA 3G6JB 4IOAA 2N78A 4JYAQ 4M8AA 5EPJA 3S17B 2EYPA 5ELDA 2LY7A 1HNZL 1U5KA 3BZDB 2Q2HA 4TQUS 1KLUD 1TS4A 4OWTB 4EQNA 1SMXA 2RCNA 2KHIA 5CV8A 2EYFA 1EWHA 1FJGL 3H91A 2VL6A 1BBWA 2EE1A 2F0WA 5GQOA 4HMJA 3D4WA 3PMFA 5IYBG 2ZM6L 2Z1CA 3HEJA 5IODA 2JA9A 3IFDA 2PI2A 2JQOA 2IWHA 3HOUH 4XTCS 3KLSX 3G4SA 4LNQA 1IBML 4RHSA 1HUNA 1XJVA 2F4VQ 4QIWB 1E7ZA 1TWFB 3HOXH 4Y7NB 1HFGA 4JW0A 2NVYH 3D4RA 2AQ1B 4A3KB 4B3SL 1EYCA 3V96A 4GZYC 5EGTA 1C8CA 4PMCA 3S2DB 4IUNA 2XWJB 2WAQB 3S9WA 2R92B 2RDHA 1M1KC 2Z9HA 3PF5A 1QZHA 3NTHA 5KEEA 2VUMB 2EY1A 2Z0SA 2F0EA 1JWSD 4GOPB 1QVCA 3FMCA 5EQ0A 1BXTA 2I0QA 5D3DA 1B1ZA 1F9RA 1MD2D 3HOUG 3KUPA 5IGEA 2DNEA 1C0AA 1PRTF 3MXNB 1EUJA 1JQYD 1TWHB 4DF7A 2JA5H 3KBGA 2K52A 5AJ3Q 4CKBA 1X3PA 2CQOA 1R4PB 1IBLQ 3I73A 2R7ZB 4P72A 4LF6Q 4DAYB 2QDLA 4DFAA 1NY4A 2JA8H 1B7YB 1STHA 2RA4A 1TY2A 4KI0A 1E3PA 2UUCL 5A2QE 1Y1VB 3AEVA 1F9SA 3LWUA 1BO0A 2JSOA 5KYIA 3S1RH 1PZKD 4KK7A 1XTDA 4IOCA 2B2VA 4RHRA 3NQIA 4WFN3 2ALYB 5HURA 1K73C 3L2PA 3EROA 4DN4M 1VQGA 3CF5A 4XQNA 2PI2E 4C1NK 3E9HA 5KNDA 1S5DD 3HG9A 2Z8LA 4FP5D 2F3WA 2JA5G 2OWOA 4PMWA 4TSSA 2D0OA 5IGFA 1H9KA 4KKSA 1OXTA 4DR2Q 5M5WH 2HCIA 1VQKA 2ENBA 3OIQA 5FLMH 3RMHA 1WD0A 1EY5A 1B9MA 1D7QA 4RCNA 3KLSA 2JA8G 4DAMA 1R9TH 4ALPA 1JJGA 4WJ3M 1G2SA 1DZ1A 3QR8A 1M90C 4K5WA 2YYZA 1NR2A 1HR0L 1B4OA 4I65A 5IT9E 5M3MH 5IT9c 4HIKA 2R93H 2EDGA 2IL8A 1RODA 4ZQ3A 3I4MH 4QJFA 2K05A 1VQ5A 1TWCH 3PUVA 2F0HA 2JN4A 1HXYD 1STNA 3X3NA 3M9BA 1CHPD 3NBHB 4A3DH 3PUWA 3K7AH 4ODGA 1I50H 5FLMG 3QB3A 3HGBA 1X55A 3UI2A 3OTOQ 3BVZA 2L4NA 5T1IA 2MNAA 1DOLA 1GOZA 1AW7A 2KHJA 4R9WA 4A76A 3GTLH 1GUNA 1KDAA 3M4QA 3H3VC 4RCOA 2E5LL 4BBSH 3MXGA 3W5OA 4DV2Q 5M3MG 2Q8IB 3VA7A 3PIPA 2EQSA 2R93G 1R4QB 2GA4B 3CKIB 4JI2L 4LF7Q 3I4MG 2VW9A 2R7DA 4DNIA 3F8TA 1IHZA 4YHHQ 1YZ6A 2JK8A 1CI3M 1FL0A 4LUVA 4GOPA 1EY9A 1LTTD 2VZAA 2JA7H 3NUCA 2K7VA 3H0GH 5HGTA 4BY7B 4A3DG 3RR5A 1WTOA 2EPBA 2NVQB 2C5CA 1YHQA 4TVAB 4C1NI 2E75C 3CAMA 4DV4L 4UAIA 4JI1L 3CCJA 5C4XB 3Q22A 3OSOA 2EJMA 1LACA 1A15A 3MXNA 4HMIA 2RDGA 1XPOA 3A54A 2WACA 4PG3A 4EQOA 1QNKA 5EKLA 2HUGA 3HOWB 4BBSG 1KNAA 1Q8KA 3D0FA 1PH8A 3NHHA 3S1QH 2BH8A 2PZUA 4DV6Q 1BNZA 3CXCA 4B08A 4X64L 1TWAB 2G5DA 3PCOB 1PXUA 4ZUIA 1D8LA 3W1BA 1QCBD 4DK6C 2E8GA 2WINB 1RTNA 1WI5A 5KIXA 2JA7G 4IUUA 3W3AA 3HKSA 3GTQB 3H0GG 1RHPA 1JOQA 4LF9L 3D4DA 3MAQA 1F2MA 3BJUA 3R93A 4JI8Q 3SXHA 3NPPA 1FVIA 3H15A 3OW2A 5I2YA 4QIWE 3S16H 3ZYYX 1NCVA 1STBA 3TMEA 4YY3L 2ID0A 4K0KL 2F0TA 3E3XA 1CHQD 1GM5A 4FYDA 2JXMB 1ZYRC 1VQNA 2V4DA 4HEDA 1PH7A 2WAQE 1JB7A 2PW7A 4V0BA 3K59A 3ITPA 2QCPX 2DY7A 3NELA 3ONAB 5IE8A 1SXTA 2A6HD 1WTXA 4LFBQ 4FNFA 4NPSA 1W2BA 5J3BA 2IJ0A 4PV1C 1N36Q 1ENCA 1PH6A 4FF4A 2SEBD 4DR1Q 1ENAA 2B63B 3P1HA 4PQXA 1RIPA 3KYHC 2VQEQ 1X65A 4ZUJA 3EIVA 4FXGC 3U4VA 3Q6SA 4H02A 2KCCA 3IAYA 1VF7A 2Q2UA 2GVAA 1PH2A 1F2YA 1N32L 4DR5L 3RN5A 2AKWB 1STYA 1Y1WB 2NVXB 3PF4A 1O80A 2H4OA 3GO5A 1KL9A 4BA1I 4QY7A 5ELOA 1HA6A 1QOHA 4I7ZC 2MJ8A 2WKDA 3TS0A 4L5SA 4G7OC 1Q46A 2B2TA 1OO9B 1TWFH 3LGJA 5CORA 2OTLA 1BUVT 4Y7NH 1OXXK 1ICWA 1KIXA 1G51A 4YCUA 3M85A 1A62A 1PRTD 4A3KH 2ZTDA 2OQ0A 5IT9L 4Q5VA 2PQEA 5CR3A 4XT3B 4IURA 3NQTA 3S2DH 3U58A 1K3RA 1G2TA 3QO2A 5JPMC 4HJAA 2JEAI 1S72A 3G6EA 2R92H 5EKKA 4K2KA 1B3QA 4C3IB 2HHHL 4JI0L 1JE5A 1VQCA 2RSNA 1VMPA 4LF8L 3TRZA 2Z4HA 3R3OA 1EEID 4OIKA 2UUAQ 2CH4W 2N88A 2IX1A 1E2VA 1XMQQ 3ND9A 3U4ZA 5M3FB 3T1HL 1SFOB 2NBFA 3KJPA 3GQBA 3NENA 4CGYB 4DK0A 3AU7A 1IW7D 2EZVA 2SNSA 3TZDA 3MFGA 1MGSA 1V8QA 1H95A 1TWHH 1D5ZC 2QW7A 5FO9B 3GTOB 1PRTC 2A74C 3C1EA 5I2XA 4A3KG 4JBWA 1LTLA 2M00A 1MJCA 5JVG3 5BN4A 4JBMA 1CKMA 5J1ZA 2ES2A 2WAQG 4J6HA 2R92G 4PZ6A 1EY6A 4MTKA 4IPCA 1Y1VH 4DNRB 3DM3A 1X54A 1X3FA 2EOTA 4O2DA 1M8AA 4IFDH 1C48A 1EIGA 4K6LA 1X3EA 1YJNA 2ZXPA 2A69C 2K5DA 4ZK9B 4AYBE 4HJ5A 1IW7C 3T16A 1FJGQ 2PW5A 4JI4L 3RLFA 2K32A 3PQIA 2K1BA 2VS1A 3OW7A 3P20A 1JCKB 1EZ8A 3BDCA 3BS1A 1FNVA 2ZM6Q 4FO2A 1S5ED 1IL8A 3A8IE 1VQOA 3M7GA 1ZEQX 2F1MA 1PYSB 1IBMQ 1RDPD 4FF1A 4QGUA 5ISRA 1HNWL 4RGTA 4YWLA 3TBIB 1Y1VG 3A55A 3G48A 4LUZA 1U0LA 1MSGA 2F0VA 4KD3A 2JA6B 4K5XA 4IFDG 3SK8A 4B3SQ 3K81C
chains in the Genus database with same CATH topology
3HKZE 4IPHA 2VL6A 1HH2P 1BBWA 1EWIA 1N8RC 1EIYB 2QA4A 4AQYL 5GQOA 1HNXQ 4A3GG 1VQHA 1MJEA 2HHHQ 4IFDJ 2ZJQA 5IYBG 2ZM6L 1PYBA 1Q1BA 3RLNA 3STBC 1QVGA 5LMUL 1N33L 3A74A 1PV4A 2JA9A 1PFSA 2PI2A 2JQOA 3HOUH 2OQKA 1MIUA 4GN4B 4JYAL 4XTCS 3TS2A 3G4SA 1GKHA 4MZ9A 1IYJB 4A93H 4LNQA 1IBML 2A19A 2ZTCA 1WJJA 1XJVA 3U50C 4DR4L 2UXBQ 4DV0L 2F4VQ 4GLVB 1L0WA 1PHJA 2VQFL 4A3BG 1E7ZA 3CPFA 3HOXH 1AH9A 2UU9L 2UUBQ 2B3GA 4DV5Q 2NVYH 4P74A 1C7YA 2Z6KA 4X65Q 1UE7A 3VDYA 1CSPA 4B3SL 3I55A 4BBRH 1UEBA 3TREA 2YV5A 1CKOA 2CCZA 1A0IA 1G6PA 1OTCA 3RZDH 1M1KC 1HNXL 2NVTH 3PF5A 2AWOA 3J81c 1YJ9A 5C0XI 4DV1Q 1QZHA 3J7A5 5C3EH 2Z0SA 1SLJA 1OXVA 2CFMA 2UUCQ 4GOPB 3JAMc 3E9IA 1QVCA 1VQ9A 3FKIH 3KLWA 4GNXB 3GTJH 1CKNA 1Q12A 2I0QA 2WB1G 1RL2A 4LWCA 3HOUG 4BY7H 2YTVA 2UXBL 2BA0A 1VQEA 2F4VL 4JC0A 2NVQH 1B70B 4A93G 1E1OA 1FGUA 1C0AA 4DR6Q 4IJLA 3IRBA 3MXNB 1EUJA 4IJHA 2UUBL 4JI4Q 5C4XH 1Q82C 2JA5H 5FLXc 4DUYQ 2K52A 2R6GA 5AJ3Q 5LMNW 1S40A 4C3JH 4PZ7A 3J80i 4DV2L 2CQOA 1YITA 3GTMH 4GKKQ 3JC66 2YU9H 4B3TQ 1IBLQ 3HOWH 2MO0A 4APVA 4BBRG 2HQLA 4P72A 4YCVA 4DAYB 1PH9A 4LF6Q 1NY4A 1YIJA 2JA8H 4GLAC 1B7YB 3CCRA 3J7ZC 2N3SA 3RN2A 4LF7L 4QQBX 2K50A 3BU2A 2UXDQ 4DV1L 4KI0A 1TWAH 1BVSA 2ZTEA 3SGIA 3M7NA 4JI3Q 1E3PA 2UUCL 4JI5Q 2DGYA 3AEVA 1E1TA 5C3EG 4A3LH 1HNWQ 3ULLA 1IL2A 1Q7YC 1HNZQ 1V1QA 4R4IA 5C4JH 2FXQA 2Z6KC 1KD1C 2NN6I 3S1RH 1VQFA 4B3MQ 1HZAA 4QL5A 2MQHA 1XTDA 3FKIG 4IOCA 3EBEA 2N49A 1XNRQ 4A75A 2ALYB 1L1OB 3L2PA 1K73C 3GTQH 1I5FA 1VQGA 3CF5A 4BY7G 3M4PA 1YEZA 2PI2E 1GVPA 2V1CC 3E9HA 3CCLA 1TXYA 5AJ3L 1V43A 5C4XG 2Q2IA 2JA5G 2OWOA 4GS3A 4PMWA 2UXCQ 2D0OA 4GOPC 3AQQA 2XGTA 5GAGC 3CCQA 1OXTA 3J81j 5M5WH 1YHBA 4DR2Q 3Q8DA 4GN5A 2IT1A 2E2IH 1VQKA 3HKZG 4HIMA 5FLMH 1XPRA 1W3SA 4LF6L 4POFA 2UXDL 4JI6Q 1D7QA 3HOWG 1NTGA 2LXKA 2N8NA 2HT1A 3PO3H 2JA8G 4DAMA 4JI3L 4NXNL 1R9TH 4IPGA 1J5EL 4ALPA 1JJGA 4WJ3M 2KENA 1M90C 3I2ZA 2YYZA 5GROA 4B3ML 3BZKA 1HR0L 3UDXA 4A3LG 1IBKQ 1KXLA 3UDFA 3K0XA 5M3MH 2E5LQ 5IT9c 5JJIA 4OONA 4HIKA 2R93H 3FHWA 3KF6B 3KF8B 3UE1A 3F2CA 3KDFB 4NXMQ 4JBJA 3I4MH 1VQ4A 2F52A 3G71A 2L15A 4R4QA 5IY0A 4QJFA 2E2HH 2CKZB 3AYHB 1VQ5A 4LUOA 2HIVA 4JI8L 1TWCH 3PUVA 4A3JH 4UP8A 2A1AA 1IXRA 2UXCL 3S17H 4EX5A 4DR2L 3M9BA 1QUQB 3CMEA 2B63H 2OTJA 3AFQA 1VQ6A 3NBHB 4A3DH 3PUWA 4JI6L 3RZOH 3K7AH 3GTGH 1I50H 1VS0A 2AWNA 2EXDA 5FLMG 1VQIA 1PH4A 4JV5Q 3DLLA 1X55A 3OTOQ 4R1JA 4DPGA 3PIOA 4L5RC 4DV7Q 2MNAA 2VY3A 3HOYH 3PO3G 3I4NH 1EQRA 3A0JA 2KHJA 4DV4Q 4A76A 1VQ8A 4WJ4A 2KCTA 4YWMA 3GTLH 3M4QA 4HJ9A 1IBKL 1J6QA 3PUXA 1Y1WH 3I4OA 4L5QA 1JJ2A 1ASYA 1OXSC 2MFIA 2E5LL 3CP0A 2NVXH 1AE2A 3CMAA 4UP7A 4GN3B 4BBSH 3W5OA 4DV2Q 4LFBL 5M3MG 5JJKA 3PIPA 4NXML 2EQSA 4RG1A 5GAEC 5C0XG 2R93G 1NMGA 1KAWA 5EAYA 2RF4A 4JBKA 3PUZA 1PA6A 3K7UC 1Q86C 4JI2L 4ME3A 4OWWB 4DK3C 4LF7Q 3I4MG 2VW9A 3UE0A 1KRSA 2R7DA 4MNOA 4X64Q 2I5MX 4DR1L 1WOCA 2WFWA 3F8TA 2RHQB 4DNIA 4YHHQ 1Q81C 1YZ6A 2JK8A 1NMFA 4A3JG 1FL0A 4LUVA 5C0XJ 4GOPA 2VZAA 2JA7H 5IYDH 2B63G 4GNXA 3A5UA 3H0GH 3PUYA 3UDGA 4JOIA 1DGSA 4JV5L 4A3DG 3RR5A 4R4CA 3OTOL 4KHPQ 4A3FH 1EQQA 4DV7L 2QEXA 1YHQA 4TVAB 4HIDA 4OWXB 2GN5A 2LXJA 3CAMA 4DV4L 2PNHA 4LW1A 4JI1L 2Q2TA 3CCJA 4LF9Q 4C3IH 3HOYG 1QZGA 3S1MH 4POGA 3I4NG 1VQDA 1KC8C 2VUMH 5IYCH 5GAHC 1XPOA 5JJLA 1Y1WG 1JMCA 4AYBG 2K5VA 4PG3A 1YVCA 5M3FH 3UDIA 1SFOH 4BBSG 1Q8KA 3D0FA 4DKAC 1PH8A 3PV0A 3S1QH 2R7FA 2BH8A 4YY3Q 2K4KA 4DV6Q 2GVBA 4K0KQ 1XMOQ 1EYGA 3CXCA 4FDBA 1PVOA 4X64L 3PCOB 2NN6G 2K75A 4YCWA 4YHHL 4NXNQ 1LYLA 1T9HA 2YTYA 1D8LA 3W1BA 3J80c 1J5EQ 4OX9Q 1N9WA 4DK6C 2E8GA 4UP9A 3KFUA 1WI5A 1N34Q 1HR0Q 1ASZA 3GTOH 3W1GA 3HFZB 2ZJPA 4KHPL 2JA7G 5IYDG 3HKSA 3H0GG 1S3OA 4DV3Q 3M3YH 4K0KL 4KLKA 3F1ZA 4X66L 4A3FG 1L1OA 2R7ZH 4JI7Q 4LF9L 1JJCB 4XIGS 1QVFA 4Y52H 4LFAL 1VQPA 2EIFA 3S24A 3A5ZB 3GDEA 3BJUA 5IP7H 4JI8Q 1FVIA 3H15A 3OW2A 2C35B 1GO3E 2VUMG 1SRUA 4P75A 1UE6A 5IYCG 3PSIA 4QIWE 5BR8L 3S16H 3S2HH 4GNXC 2A8VA 5C44H 1NE3A 3KOJA 4JOIC 4AH6A 1Q1EA 2ID0A 1IZ6A 1LUZA 4YY3L 5M3FG 4DV6L 5E7NA 1XMOL 4LF4Q 4BA2I 3CW2C 1GM5A 4OXPA 5GADC 1VQNA 5IWAL 1PH7A 4OX9L 1N32Q 3I7FA 1SR3A 1WFQA 2WAQE 3L0OA 1JB7A 1EFWA 1VQAA 2PMZE 3S1NH 1N34L 1SROA 4OO1I 1HJPA 2ZJRA 3NELA 5IE8A 4A4IA 1X6OA 1UWVA 1JT8A 4B3RQ 1NJIC 4DV3L 4LFBQ 1VQJA 1I3QH 4NPSA 1W2BA 5J3BA 2D0PA 3KF6A 2PQAB 4JI7L 4UY8C 1N36Q 1YBYA 4A3MH 1PH6A 3KDFA 1YHAA 4JI2Q 2R7ZG 2JE6I 3ZJYC 3CCUA 1X3GA 2Y0SE 4DR1Q 2D62A 2AHOB 1Y14B 5IP7G 4A3EH 5ELNA 1A63A 1P8LA 1RIPA 1Z47A 3KYHC 1X65A 3NEMA 2VQEQ 3B6YA 3CCSA 1QUQA 3D31A 3EIVA 4LF4L 3U4VA 4C2MH 2JA6H 4H02A 5C44G 1YI2A 2Q2UA 2BH2A 2GVAA 2KCMA 2YTXA 1PH2A 3K8AA 1L1OC 3MEFA 1PH3A 1A8VA 5FJ8H 3TEHB 1N32L 3T1YQ 3EN2A 4IFDI 5DLQE 1K9MC 4DR5L 4JI1Q 3RN5A 2AKWB 1TWGH 4JI0Q 1C9OA 1X56A 5H1SE 1WCMH 4LF8Q 2ASBA 4HJ8A 3PF4A 4B3RL 3GO5A 2XTIA 2E2JH 3T1HQ 1GD7A 1KL9A 4BA1I 3WWVA 3ERSX 4QY7A 5ELOA 3CCVA 3GTKH 1N36L 1VCIA 3H3VI 1L2FA 4X62Q 3TS0A 4L5SA 3OYYA 2KBNA 3HOVH 5HY6A 4O0AA 1Q46A 1E24A 4A3MG 4J15A 4BY1H 2VNUD 3CCEA 2IX0A 4JCVE 3RNUA 1PH1A 4P71A 1TWFH 3LGJA 2VQEL 2OTLA 4Y7NH 3ULJA 1OXXK 5M5YH 3PO2H 2NZOA 1G51A 4YCUA 1KIXA 3M85A 3J81i 2K14A 1A62A 4A3EG 1UE1A 1XNQQ 3F2BA 2ZTDA 2OQ0A 3CPWA 4A3KH 3TQYA 4X6AH 2I5HA 4RMFA 3JAMi 1CSQA 1O7IA 2AMCB 3ICEA 2JA6G 3U58A 3S2DH 1K3RA 2I5LX 4HJAA 3T1YL 2JEAI 3GD7A 1OXUA 4L5TA 1UE5A 4X66Q 1P16A 3G6EA 1S72A 5HGQA 2R92H 3S15H 5FJ8G 2HHHL 4JI0L 1JE5A 4LFAQ 1BKBA 1VQCA 1YJWA 4LF8L 2UUAQ 3CC4A 3TRZA 2IX1A 4GLXA 1XMQQ 1CKNB 3U4ZA 3CC2A 1SE8A 3T1HL 2LSSA 1I6HH 5IWAQ 1WCMG 3KJPA 5BR8Q 3HOZH 2HIXA 4B3TL 3NENA 4R4TA 1LM0A 2H5XA 3CQZH 4X62L 3ER0A 5LMNQ 3K80C 4KHZA 1K8GA 4HIOA 3ULPA 1VQBA 5JEAG 1XPUA 1G291 3HOVG 4LFCQ 4UPAA 4LF5Q 4BY1G 3AFPA 1H95A 3E0EA 1TWHH 4MTNA 3L7ZC 2B29A 4PZ8A 5M5XH 4DV5L 1XNQL 4P73A 3HOXG 2IHEA 3PGZA 4X65L 4BXXH 4A3CH 3KJOA 1I94Q 5JEAJ 4IO9A 3PO2G 4DR3Q 1VQMA 2JJQA 5IP9H 4A3KG 4JBWA 1LTLA 2JEBI 1MJCA 4JBMA 1HZ9A 3CCMA 1HZBA 1CKMA 2WB1E 4EQ5A 4DR7Q 2ES2A 1E22A 2WAQG 1HR0W 5K36G 1K83H 4A3IH 2R92G 4PZ6A 2UUAL 3S14H 4IPCA 1XMQL 1BBUA 1Y1VH 2IHFA 1MKHA 1K0RA 1X3FA 1X54A 1AE3A 2OCEA 2BA1A 3DM3A 4O2DA 4YWKA 4GKJQ 1X9NA 3BZCA 1KRTA 1X3EA 5LMNL 1YJNA 3HOZG 4AYBE 2CWPA 2K5NA 4HJ5A 1EOVA 1CUKA 4DUZQ 2ATWA 1FJGQ 2K5HA 4R4OA 4DR6L 4LFCL 4OO1G 2Y0SG 4NB3A 4A3GH 4LF5L 4JG2A 3RLFA 3F2DA 4JI4L 1K8AC 4C3HH 5IYBH 2QGQA 4DUYL 4IPDA 1KHIA 2VS1A 4DR5Q 4AQYQ 1SN8A 3H3VH 1I94L 1PH5A 3STBD 4DR3L 1VQ7A 2ZM6Q 4AIMA 4GKKL 3CD6A 4BXXG 4A3CG 3CC7A 3I56A 2NZHA 5LMUQ 1VQOA 1IBLL 1N33Q 2RHSB 4HJ7A 2F3IA 5IP9G 3M4OH 4IOAA 1V9PA 2N78A 1KQSA 4DR7L 4JYAQ 1PYSB 1NBWA 4A3BH 2MO1A 2PQAA 2CWAA 1IBMQ 3RLOA 4JI5L 4DR4Q 1YNXA 1Z9FA 4DV0Q 4A3IG 4QGUA 3GTPH 2VQFQ 1HNWL 1HNZL 2WP8J 1U5KA 4YWLA 2UU9Q 1EIFA 4GKJL 1B8AA 2Q2HA 4TQUS 1VQLA 1WYDA 1Y1VG 3G48A 4OWTB 2DUDA 1SMXA 1U0LA 4LUZA 2RCNA 2KHIA 1HZCA 3FP9A 4IFDG 1XNRL 4B3SQ 4DUZL 2IY5B 3K81C 1FJGL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HKZ E;  4IPH A;  2VL6 A;  1HH2 P;  1BBW A;  1EWI A;  1N8R C;  1EIY B;  2QA4 A;  4AQY L;  5GQO A;  1HNX Q;  4A3G G;  1VQH A;  1MJE A;  2HHH Q;  4IFD J;  2ZJQ A;  5IYB G;  2ZM6 L;  1PYB A;  1Q1B A;  3RLN A;  3STB C;  1QVG A;  5LMU L;  1N33 L;  3A74 A;  1PV4 A;  2JA9 A;  1PFS A;  2PI2 A;  2JQO A;  3HOU H;  2OQK A;  1MIU A;  4GN4 B;  4JYA L;  4XTC S;  3TS2 A;  3G4S A;  1GKH A;  4MZ9 A;  1IYJ B;  4A93 H;  4LNQ A;  1IBM L;  2A19 A;  2ZTC A;  1WJJ A;  1XJV A;  3U50 C;  4DR4 L;  2UXB Q;  4DV0 L;  2F4V Q;  4GLV B;  1L0W A;  1PHJ A;  2VQF L;  4A3B G;  1E7Z A;  3CPF A;  3HOX H;  1AH9 A;  2UU9 L;  2UUB Q;  2B3G A;  4DV5 Q;  2NVY H;  4P74 A;  1C7Y A;  2Z6K A;  4X65 Q;  1UE7 A;  3VDY A;  1CSP A;  4B3S L;  3I55 A;  4BBR H;  1UEB A;  3TRE A;  2YV5 A;  1CKO A;  2CCZ A;  1A0I A;  1G6P A;  1OTC A;  3RZD H;  1M1K C;  1HNX L;  2NVT H;  3PF5 A;  2AWO A;  3J81 c;  1YJ9 A;  5C0X I;  4DV1 Q;  1QZH A;  3J7A 5;  5C3E H;  2Z0S A;  1SLJ A;  1OXV A;  2CFM A;  2UUC Q;  4GOP B;  3JAM c;  3E9I A;  1QVC A;  1VQ9 A;  3FKI H;  3KLW A;  4GNX B;  3GTJ H;  1CKN A;  1Q12 A;  2I0Q A;  2WB1 G;  1RL2 A;  4LWC A;  3HOU G;  4BY7 H;  2YTV A;  2UXB L;  2BA0 A;  1VQE A;  2F4V L;  4JC0 A;  2NVQ H;  1B70 B;  4A93 G;  1E1O A;  1FGU A;  1C0A A;  4DR6 Q;  4IJL A;  3IRB A;  3MXN B;  1EUJ A;  4IJH A;  2UUB L;  4JI4 Q;  5C4X H;  1Q82 C;  2JA5 H;  5FLX c;  4DUY Q;  2K52 A;  2R6G A;  5AJ3 Q;  5LMN W;  1S40 A;  4C3J H;  4PZ7 A;  3J80 i;  4DV2 L;  2CQO A;  1YIT A;  3GTM H;  4GKK Q;  3JC6 6;  2YU9 H;  4B3T Q;  1IBL Q;  3HOW H;  2MO0 A;  4APV A;  4BBR G;  2HQL A;  4P72 A;  4YCV A;  4DAY B;  1PH9 A;  4LF6 Q;  1NY4 A;  1YIJ A;  2JA8 H;  4GLA C;  1B7Y B;  3CCR A;  3J7Z C;  2N3S A;  3RN2 A;  4LF7 L;  4QQB X;  2K50 A;  3BU2 A;  2UXD Q;  4DV1 L;  4KI0 A;  1TWA H;  1BVS A;  2ZTE A;  3SGI A;  3M7N A;  4JI3 Q;  1E3P A;  2UUC L;  4JI5 Q;  2DGY A;  3AEV A;  1E1T A;  5C3E G;  4A3L H;  1HNW Q;  3ULL A;  1IL2 A;  1Q7Y C;  1HNZ Q;  1V1Q A;  4R4I A;  5C4J H;  2FXQ A;  2Z6K C;  1KD1 C;  2NN6 I;  3S1R H;  1VQF A;  4B3M Q;  1HZA A;  4QL5 A;  2MQH A;  1XTD A;  3FKI G;  4IOC A;  3EBE A;  2N49 A;  1XNR Q;  4A75 A;  2ALY B;  1L1O B;  3L2P A;  1K73 C;  3GTQ H;  1I5F A;  1VQG A;  3CF5 A;  4BY7 G;  3M4P A;  1YEZ A;  2PI2 E;  1GVP A;  2V1C C;  3E9H A;  3CCL A;  1TXY A;  5AJ3 L;  1V43 A;  5C4X G;  2Q2I A;  2JA5 G;  2OWO A;  4GS3 A;  4PMW A;  2UXC Q;  2D0O A;  4GOP C;  3AQQ A;  2XGT A;  5GAG C;  3CCQ A;  1OXT A;  3J81 j;  5M5W H;  1YHB A;  4DR2 Q;  3Q8D A;  4GN5 A;  2IT1 A;  2E2I H;  1VQK A;  3HKZ G;  4HIM A;  5FLM H;  1XPR A;  1W3S A;  4LF6 L;  4POF A;  2UXD L;  4JI6 Q;  1D7Q A;  3HOW G;  1NTG A;  2LXK A;  2N8N A;  2HT1 A;  3PO3 H;  2JA8 G;  4DAM A;  4JI3 L;  4NXN L;  1R9T H;  4IPG A;  1J5E L;  4ALP A;  1JJG A;  4WJ3 M;  2KEN A;  1M90 C;  3I2Z A;  2YYZ A;  5GRO A;  4B3M L;  3BZK A;  1HR0 L;  3UDX A;  4A3L G;  1IBK Q;  1KXL A;  3UDF A;  3K0X A;  5M3M H;  2E5L Q;  5IT9 c;  5JJI A;  4OON A;  4HIK A;  2R93 H;  3FHW A;  3KF6 B;  3KF8 B;  3UE1 A;  3F2C A;  3KDF B;  4NXM Q;  4JBJ A;  3I4M H;  1VQ4 A;  2F52 A;  3G71 A;  2L15 A;  4R4Q A;  5IY0 A;  4QJF A;  2E2H H;  2CKZ B;  3AYH B;  1VQ5 A;  4LUO A;  2HIV A;  4JI8 L;  1TWC H;  3PUV A;  4A3J H;  4UP8 A;  2A1A A;  1IXR A;  2UXC L;  3S17 H;  4EX5 A;  4DR2 L;  3M9B A;  1QUQ B;  3CME A;  2B63 H;  2OTJ A;  3AFQ A;  1VQ6 A;  3NBH B;  4A3D H;  3PUW A;  4JI6 L;  3RZO H;  3K7A H;  3GTG H;  1I50 H;  1VS0 A;  2AWN A;  2EXD A;  5FLM G;  1VQI A;  1PH4 A;  4JV5 Q;  3DLL A;  1X55 A;  3OTO Q;  4R1J A;  4DPG A;  3PIO A;  4L5R C;  4DV7 Q;  2MNA A;  2VY3 A;  3HOY H;  3PO3 G;  3I4N H;  1EQR A;  3A0J A;  2KHJ A;  4DV4 Q;  4A76 A;  1VQ8 A;  4WJ4 A;  2KCT A;  4YWM A;  3GTL H;  3M4Q A;  4HJ9 A;  1IBK L;  1J6Q A;  3PUX A;  1Y1W H;  3I4O A;  4L5Q A;  1JJ2 A;  1ASY A;  1OXS C;  2MFI A;  2E5L L;  3CP0 A;  2NVX H;  1AE2 A;  3CMA A;  4UP7 A;  4GN3 B;  4BBS H;  3W5O A;  4DV2 Q;  4LFB L;  5M3M G;  5JJK A;  3PIP A;  4NXM L;  2EQS A;  4RG1 A;  5GAE C;  5C0X G;  2R93 G;  1NMG A;  1KAW A;  5EAY A;  2RF4 A;  4JBK A;  3PUZ A;  1PA6 A;  3K7U C;  1Q86 C;  4JI2 L;  4ME3 A;  4OWW B;  4DK3 C;  4LF7 Q;  3I4M G;  2VW9 A;  3UE0 A;  1KRS A;  2R7D A;  4MNO A;  4X64 Q;  2I5M X;  4DR1 L;  1WOC A;  2WFW A;  3F8T A;  2RHQ B;  4DNI A;  4YHH Q;  1Q81 C;  1YZ6 A;  2JK8 A;  1NMF A;  4A3J G;  1FL0 A;  4LUV A;  5C0X J;  4GOP A;  2VZA A;  2JA7 H;  5IYD H;  2B63 G;  4GNX A;  3A5U A;  3H0G H;  3PUY A;  3UDG A;  4JOI A;  1DGS A;  4JV5 L;  4A3D G;  3RR5 A;  4R4C A;  3OTO L;  4KHP Q;  4A3F H;  1EQQ A;  4DV7 L;  2QEX A;  1YHQ A;  4TVA B;  4HID A;  4OWX B;  2GN5 A;  2LXJ A;  3CAM A;  4DV4 L;  2PNH A;  4LW1 A;  4JI1 L;  2Q2T A;  3CCJ A;  4LF9 Q;  4C3I H;  3HOY G;  1QZG A;  3S1M H;  4POG A;  3I4N G;  1VQD A;  1KC8 C;  2VUM H;  5IYC H;  5GAH C;  1XPO A;  5JJL A;  1Y1W G;  1JMC A;  4AYB G;  2K5V A;  4PG3 A;  1YVC A;  5M3F H;  3UDI A;  1SFO H;  4BBS G;  1Q8K A;  3D0F A;  4DKA C;  1PH8 A;  3PV0 A;  3S1Q H;  2R7F A;  2BH8 A;  4YY3 Q;  2K4K A;  4DV6 Q;  2GVB A;  4K0K Q;  1XMO Q;  1EYG A;  3CXC A;  4FDB A;  1PVO A;  4X64 L;  3PCO B;  2NN6 G;  2K75 A;  4YCW A;  4YHH L;  4NXN Q;  1LYL A;  1T9H A;  2YTY A;  1D8L A;  3W1B A;  3J80 c;  1J5E Q;  4OX9 Q;  1N9W A;  4DK6 C;  2E8G A;  4UP9 A;  3KFU A;  1WI5 A;  1N34 Q;  1HR0 Q;  1ASZ A;  3GTO H;  3W1G A;  3HFZ B;  2ZJP A;  4KHP L;  2JA7 G;  5IYD G;  3HKS A;  3H0G G;  1S3O A;  4DV3 Q;  3M3Y H;  4K0K L;  4KLK A;  3F1Z A;  4X66 L;  4A3F G;  1L1O A;  2R7Z H;  4JI7 Q;  4LF9 L;  1JJC B;  4XIG S;  1QVF A;  4Y52 H;  4LFA L;  1VQP A;  2EIF A;  3S24 A;  3A5Z B;  3GDE A;  3BJU A;  5IP7 H;  4JI8 Q;  1FVI A;  3H15 A;  3OW2 A;  2C35 B;  1GO3 E;  2VUM G;  1SRU A;  4P75 A;  1UE6 A;  5IYC G;  3PSI A;  4QIW E;  5BR8 L;  3S16 H;  3S2H H;  4GNX C;  2A8V A;  5C44 H;  1NE3 A;  3KOJ A;  4JOI C;  4AH6 A;  1Q1E A;  2ID0 A;  1IZ6 A;  1LUZ A;  4YY3 L;  5M3F G;  4DV6 L;  5E7N A;  1XMO L;  4LF4 Q;  4BA2 I;  3CW2 C;  1GM5 A;  4OXP A;  5GAD C;  1VQN A;  5IWA L;  1PH7 A;  4OX9 L;  1N32 Q;  3I7F A;  1SR3 A;  1WFQ A;  2WAQ E;  3L0O A;  1JB7 A;  1EFW A;  1VQA A;  2PMZ E;  3S1N H;  1N34 L;  1SRO A;  4OO1 I;  1HJP A;  2ZJR A;  3NEL A;  5IE8 A;  4A4I A;  1X6O A;  1UWV A;  1JT8 A;  4B3R Q;  1NJI C;  4DV3 L;  4LFB Q;  1VQJ A;  1I3Q H;  4NPS A;  1W2B A;  5J3B A;  2D0P A;  3KF6 A;  2PQA B;  4JI7 L;  4UY8 C;  1N36 Q;  1YBY A;  4A3M H;  1PH6 A;  3KDF A;  1YHA A;  4JI2 Q;  2R7Z G;  2JE6 I;  3ZJY C;  3CCU A;  1X3G A;  2Y0S E;  4DR1 Q;  2D62 A;  2AHO B;  1Y14 B;  5IP7 G;  4A3E H;  5ELN A;  1A63 A;  1P8L A;  1RIP A;  1Z47 A;  3KYH C;  1X65 A;  3NEM A;  2VQE Q;  3B6Y A;  3CCS A;  1QUQ A;  3D31 A;  3EIV A;  4LF4 L;  3U4V A;  4C2M H;  2JA6 H;  4H02 A;  5C44 G;  1YI2 A;  2Q2U A;  2BH2 A;  2GVA A;  2KCM A;  2YTX A;  1PH2 A;  3K8A A;  1L1O C;  3MEF A;  1PH3 A;  1A8V A;  5FJ8 H;  3TEH B;  1N32 L;  3T1Y Q;  3EN2 A;  4IFD I;  5DLQ E;  1K9M C;  4DR5 L;  4JI1 Q;  3RN5 A;  2AKW B;  1TWG H;  4JI0 Q;  1C9O A;  1X56 A;  5H1S E;  1WCM H;  4LF8 Q;  2ASB A;  4HJ8 A;  3PF4 A;  4B3R L;  3GO5 A;  2XTI A;  2E2J H;  3T1H Q;  1GD7 A;  1KL9 A;  4BA1 I;  3WWV A;  3ERS X;  4QY7 A;  5ELO A;  3CCV A;  3GTK H;  1N36 L;  1VCI A;  3H3V I;  1L2F A;  4X62 Q;  3TS0 A;  4L5S A;  3OYY A;  2KBN A;  3HOV H;  5HY6 A;  4O0A A;  1Q46 A;  1E24 A;  4A3M G;  4J15 A;  4BY1 H;  2VNU D;  3CCE A;  2IX0 A;  4JCV E;  3RNU A;  1PH1 A;  4P71 A;  1TWF H;  3LGJ A;  2VQE L;  2OTL A;  4Y7N H;  3ULJ A;  1OXX K;  5M5Y H;  3PO2 H;  2NZO A;  1G51 A;  4YCU A;  1KIX A;  3M85 A;  3J81 i;  2K14 A;  1A62 A;  4A3E G;  1UE1 A;  1XNQ Q;  3F2B A;  2ZTD A;  2OQ0 A;  3CPW A;  4A3K H;  3TQY A;  4X6A H;  2I5H A;  4RMF A;  3JAM i;  1CSQ A;  1O7I A;  2AMC B;  3ICE A;  2JA6 G;  3U58 A;  3S2D H;  1K3R A;  2I5L X;  4HJA A;  3T1Y L;  2JEA I;  3GD7 A;  1OXU A;  4L5T A;  1UE5 A;  4X66 Q;  1P16 A;  3G6E A;  1S72 A;  5HGQ A;  2R92 H;  3S15 H;  5FJ8 G;  2HHH L;  4JI0 L;  1JE5 A;  4LFA Q;  1BKB A;  1VQC A;  1YJW A;  4LF8 L;  2UUA Q;  3CC4 A;  3TRZ A;  2IX1 A;  4GLX A;  1XMQ Q;  1CKN B;  3U4Z A;  3CC2 A;  1SE8 A;  3T1H L;  2LSS A;  1I6H H;  5IWA Q;  1WCM G;  3KJP A;  5BR8 Q;  3HOZ H;  2HIX A;  4B3T L;  3NEN A;  4R4T A;  1LM0 A;  2H5X A;  3CQZ H;  4X62 L;  3ER0 A;  5LMN Q;  3K80 C;  4KHZ A;  1K8G A;  4HIO A;  3ULP A;  1VQB A;  5JEA G;  1XPU A;  1G29 1;  3HOV G;  4LFC Q;  4UPA A;  4LF5 Q;  4BY1 G;  3AFP A;  1H95 A;  3E0E A;  1TWH H;  4MTN A;  3L7Z C;  2B29 A;  4PZ8 A;  5M5X H;  4DV5 L;  1XNQ L;  4P73 A;  3HOX G;  2IHE A;  3PGZ A;  4X65 L;  4BXX H;  4A3C H;  3KJO A;  1I94 Q;  5JEA J;  4IO9 A;  3PO2 G;  4DR3 Q;  1VQM A;  2JJQ A;  5IP9 H;  4A3K G;  4JBW A;  1LTL A;  2JEB I;  1MJC A;  4JBM A;  1HZ9 A;  3CCM A;  1HZB A;  1CKM A;  2WB1 E;  4EQ5 A;  4DR7 Q;  2ES2 A;  1E22 A;  2WAQ G;  1HR0 W;  5K36 G;  1K83 H;  4A3I H;  2R92 G;  4PZ6 A;  2UUA L;  3S14 H;  4IPC A;  1XMQ L;  1BBU A;  1Y1V H;  2IHF A;  1MKH A;  1K0R A;  1X3F A;  1X54 A;  1AE3 A;  2OCE A;  2BA1 A;  3DM3 A;  4O2D A;  4YWK A;  4GKJ Q;  1X9N A;  3BZC A;  1KRT A;  1X3E A;  5LMN L;  1YJN A;  3HOZ G;  4AYB E;  2CWP A;  2K5N A;  4HJ5 A;  1EOV A;  1CUK A;  4DUZ Q;  2ATW A;  1FJG Q;  2K5H A;  4R4O A;  4DR6 L;  4LFC L;  4OO1 G;  2Y0S G;  4NB3 A;  4A3G H;  4LF5 L;  4JG2 A;  3RLF A;  3F2D A;  4JI4 L;  1K8A C;  4C3H H;  5IYB H;  2QGQ A;  4DUY L;  4IPD A;  1KHI A;  2VS1 A;  4DR5 Q;  4AQY Q;  1SN8 A;  3H3V H;  1I94 L;  1PH5 A;  3STB D;  4DR3 L;  1VQ7 A;  2ZM6 Q;  4AIM A;  4GKK L;  3CD6 A;  4BXX G;  4A3C G;  3CC7 A;  3I56 A;  2NZH A;  5LMU Q;  1VQO A;  1IBL L;  1N33 Q;  2RHS B;  4HJ7 A;  2F3I A;  5IP9 G;  3M4O H;  4IOA A;  1V9P A;  2N78 A;  1KQS A;  4DR7 L;  4JYA Q;  1PYS B;  1NBW A;  4A3B H;  2MO1 A;  2PQA A;  2CWA A;  1IBM Q;  3RLO A;  4JI5 L;  4DR4 Q;  1YNX A;  1Z9F A;  4DV0 Q;  4A3I G;  4QGU A;  3GTP H;  2VQF Q;  1HNW L;  1HNZ L;  2WP8 J;  1U5K A;  4YWL A;  2UU9 Q;  1EIF A;  4GKJ L;  1B8A A;  2Q2H A;  4TQU S;  1VQL A;  1WYD A;  1Y1V G;  3G48 A;  4OWT B;  2DUD A;  1SMX A;  1U0L A;  4LUZ A;  2RCN A;  2KHI A;  1HZC A;  3FP9 A;  4IFD G;  1XNR L;  4B3S Q;  4DUZ L;  2IY5 B;  3K81 C;  1FJG L; 
#chains in the Genus database with same CATH topology
 4IPH A;  1HH2 P;  1EWI A;  3WOE A;  2QA4 A;  4KTA A;  3P7J A;  2B2U A;  1F2Z A;  3J7Y W;  1NSN S;  1BF4 A;  1N33 L;  3QWN A;  1PV4 A;  1K8M A;  5G3L F;  2OQK A;  3TS2 A;  3FVQ A;  3A56 A;  3HOV B;  4BY1 B;  1TS2 A;  4K14 A;  2KEE A;  3HZX A;  2SDF A;  3HRZ C;  1FR3 A;  2N55 A;  4DV5 Q;  1C7Y A;  1CSP A;  3I55 A;  3TRE A;  5FOB B;  2EY2 A;  1A0I A;  2FMM A;  1HTL D;  2PMZ B;  5JJZ A;  1OTC A;  3S15 B;  2XSC A;  3C3L A;  1YJ9 A;  5C0X I;  2DJF C;  1SLJ A;  2CFM A;  2UUC Q;  3JAM c;  2ICI A;  3A7A B;  4GNX B;  2F0F A;  1TU2 B;  3V2T A;  3CQZ B;  4KHV A;  1K0S A;  4LWC A;  4BY7 H;  4N9P A;  3K6O A;  5CV5 A;  2NVQ H;  4JC0 A;  1E1O A;  1FGU A;  3IRB A;  4IJH A;  2UUB L;  5C4X H;  5C6A A;  5M5X B;  1Q82 C;  5DM7 3;  5FLX c;  1XXG A;  1WVL A;  2R6G A;  4FF2 A;  2TSS A;  1D5X C;  2IPK D;  4C56 C;  4H44 C;  4PZ7 A;  1U4L A;  4XXE A;  3HOW H;  2MO0 A;  1EU4 A;  3VR3 A;  4APV A;  1PH9 A;  4YCV A;  3WOF A;  4ZAI A;  4QQB X;  3RN2 A;  2N3S A;  4CJ2 C;  3R8B A;  3SGI A;  1TWA H;  1BVS A;  2OXP A;  4JI5 Q;  1E1T A;  3C1F A;  1V1Q A;  2B2W A;  4RFB A;  1EFI D;  2SNM A;  1KD1 C;  3DHQ A;  4HTH A;  1SND A;  4U67 3;  1STA A;  5C5L A;  2KEC A;  2XRS D;  2N49 A;  1XNR Q;  4A75 A;  3GTQ H;  4BY7 G;  3M4P A;  1PFM A;  2L12 A;  4C3H B;  1TVX A;  5C4X G;  3K5O A;  4GS3 A;  3BDL A;  2XGT A;  1DOK A;  5GAG C;  1L0X B;  3CCQ A;  3J81 j;  1S4Z A;  4B3T L;  4GN5 A;  1M4V A;  1CZW A;  2J7Z A;  1W3S A;  4E6I A;  1CQV A;  4POF A;  2UXD L;  3HOW G;  4XT1 B;  2LXK A;  1ZXT A;  3T51 B;  1JE4 A;  3SEB A;  4NXN L;  1J5E L;  3GTP B;  1ONL A;  3I2Z A;  1F77 A;  3L3O C;  4J1M A;  3K0X A;  2E5L Q;  5JJI A;  1C4Q A;  2RBM A;  1PTO D;  3F2C A;  1MSH A;  1VQ4 A;  2F52 A;  3OHX C;  2EYM A;  3AYH B;  1IXR A;  3ERQ A;  2B2W C;  2NYZ D;  2B63 H;  2WB1 B;  1VQ6 A;  4O1N A;  4IUV A;  1KAA A;  1ET9 A;  4A93 B;  1VQI A;  3DWQ A;  3DLL A;  2FJ2 A;  4R1J A;  1G6Z A;  4DPG A;  1JIC A;  1MI2 A;  2RDF A;  1EQR A;  3A0J A;  4DV4 Q;  1VQ8 A;  3BDO A;  2KCT A;  4YWM A;  2X6L A;  1Y1W H;  3I70 A;  3I4O A;  2F0P A;  1JJ2 A;  2NVX H;  1G91 A;  3CMA A;  4UP7 A;  4M1U B;  4BBR B;  1PTO C;  4RG1 A;  5GAE C;  1KAW A;  4JBK A;  2NN6 H;  4DK3 C;  4X64 Q;  4MNO A;  2I5M X;  4KN7 C;  4RH6 A;  1Q81 C;  1B44 D;  1NMF A;  5C0X J;  2NWG A;  2VXW A;  2B63 G;  4GNX A;  3DM1 A;  4JOI A;  1DGS A;  1LTA D;  2DN8 A;  1EQQ A;  2QEX A;  2Z6B A;  5EPK A;  2FFK B;  4OWX B;  2GN5 A;  4LF9 Q;  1QJO A;  4C3I H;  1QZG A;  5LL6 S;  1SNQ A;  4C3J B;  3HP3 A;  5JJL A;  4LAA A;  1Y1W G;  5M3F H;  5LL6 X;  1SFO H;  4DKA C;  2B8F A;  5KNB A;  1LTI D;  2R7F A;  4YY3 Q;  1EY4 A;  2K4K A;  4K0K Q;  2MPM A;  4FDB A;  4DXF A;  1SE4 A;  4RGO S;  4IZ8 A;  2NN6 G;  2K75 A;  3QJY A;  3MXU A;  1BOS A;  1T9H A;  1FNW A;  4LJZ C;  5FKA C;  1N9W A;  1GHK A;  3GTO H;  2Q8T A;  1EQV A;  4KHP L;  1SEB D;  3V05 A;  1Q8I A;  1E2Z A;  2FIN B;  4X66 L;  5KGU A;  1JJC B;  4XIG S;  4Y52 H;  1VQP A;  2EIF A;  3S24 A;  3A5Z B;  1G8Z D;  4MN3 A;  4C3I G;  3JAM L;  1GO3 E;  2CVR A;  3MXP A;  4JVZ A;  1SRU A;  4P75 A;  3I72 A;  2E2I B;  5JVH 3;  2EYH A;  5BR8 L;  2AQ2 B;  4GNX C;  4L63 B;  4JOI C;  5M3F G;  4NKL A;  1IZ6 A;  4BA2 I;  4OL7 A;  1LAB A;  1GJX A;  1GUT A;  1VDZ A;  4OX9 L;  1N32 Q;  1EQT A;  3MTS A;  1SR3 A;  3Q23 A;  1VQA A;  2PMZ E;  5FLX L;  1N34 L;  4N8F A;  2R61 A;  3NTI A;  4BS9 A;  2ZJR A;  2H1E A;  4DV3 L;  1EU3 A;  2ZXR A;  2D0P A;  2PQA B;  2DY8 A;  1YBY A;  5G3L D;  2JE6 I;  5D14 A;  4WOR A;  3CCU A;  3MHB A;  2FMC A;  4V19 0;  4EVO A;  4XYQ A;  1Y14 B;  1A63 A;  1P8L A;  4G7Z C;  2EYJ A;  1QIL A;  4KD4 A;  5CYU A;  5CBE E;  3RZO B;  4QUC A;  4LF4 L;  2PZT A;  2JA6 H;  1A6X A;  5ELE A;  4IQZ A;  2BH2 A;  1ET6 A;  5K5P A;  3K8A A;  5E3F A;  3TEH B;  2LS0 1;  3HOY B;  1F2L A;  2M9V A;  3EN2 A;  3VR5 A;  3I4N B;  1PFB A;  1QE6 A;  4JI0 Q;  3K58 A;  4AYB B;  4KKU A;  1PRT B;  2F0U A;  2ASB A;  4LF8 Q;  4QF4 A;  4B3R L;  4X3S A;  1W6J A;  3T1H Q;  1CT1 D;  1VCI A;  3OMC A;  2HDM A;  2EVB A;  3OYY A;  3HOV H;  4O0A A;  4NW2 A;  4J15 A;  4BY1 H;  4QCL A;  2XN9 C;  4JCV E;  3P75 A;  3CCE A;  4P71 A;  1ENF A;  2EYO A;  1ZKO A;  1VF5 C;  2PZW A;  2JYO A;  3F2B A;  3CPW A;  4HSP A;  3TQY A;  4X6A H;  3JAM i;  3FDT A;  4A3F B;  2AMC B;  2JA6 G;  1FNU A;  3T1Y L;  5K36 H;  4L5T A;  1P16 A;  2RCF A;  3S15 H;  3S1M B;  1ESF A;  1NAP A;  4YIJ A;  4LFA Q;  3R2T A;  1LTG D;  2K01 A;  1AEX A;  1HPC A;  3PIP 3;  3H94 A;  4GLX A;  1SE8 A;  1HHV A;  1U4M A;  2D5D A;  3TP7 A;  2H5X A;  3CQZ H;  4X62 L;  3ULP A;  4OO1 H;  1XPU A;  3SE0 A;  1Y8N B;  3FPP A;  1A2U A;  3HOV G;  5COY A;  1SYC A;  1D2B A;  4BY1 G;  1LV9 A;  1MHW C;  1RKN A;  2B29 A;  5M5X H;  4CHT B;  3FPU B;  3PGZ A;  5JEA J;  4IO9 A;  5IP9 H;  2JEB I;  3NSW A;  3DWA A;  2PCF B;  1PDQ A;  3CCM A;  2WB1 E;  4EQ5 A;  4RGM A;  3FRP B;  5K36 G;  5CV4 A;  2RSO A;  3U9S A;  2D9U A;  1BDO A;  5IWA L;  3S2H B;  3ND8 A;  4HR7 B;  4FVM A;  5LMN L;  3RD4 A;  1I4G A;  1KAB A;  1UEA B;  1RCV D;  1FYC A;  4OO1 G;  1HQR D;  1BCP F;  1K8A C;  4C3H H;  1JWM D;  4IPD A;  1KHI A;  4OIJ A;  1SN8 A;  5C4Z A;  3H3V H;  1SYF A;  3D8G A;  4N9T A;  3STB D;  4DR3 L;  5C5M A;  4AIM A;  3VA5 A;  5CBA E;  2F03 A;  2NZH A;  1N33 Q;  1IBL L;  4H0L C;  1I3Q B;  2RHS B;  3K5M A;  5FO8 B;  4HJ7 A;  2SOB A;  5IP9 G;  4HSV A;  3N6R A;  1V9P A;  1KQS A;  4A3M B;  4DR7 L;  2F3V A;  4G4K A;  4A3B H;  2MO1 A;  2PQA A;  1JWU D;  1CTM A;  3GTP H;  2WP8 J;  4OHJ A;  1SE2 A;  1TR5 A;  4GKJ L;  2AQ3 B;  1WYD A;  2KUM A;  2DUD A;  1AFP A;  2MGS A;  1HZC A;  3FP9 A;  2J0T D;  5M9O A;  1STG A;  4S3S A;  4DUZ L;  2L5T A;  3MA2 B;  1N8R C;  1U4P A;  4EGV A;  1EIY B;  4AQY L;  1VQH A;  3BYT B;  1TWG B;  2BCO A;  4B9X A;  4C3H G;  1Q1B A;  2QEJ C;  3STB C;  2B2Y C;  2A6H C;  2KOL A;  5LMU L;  1QVG A;  1SMY D;  3I91 A;  2E2J B;  1PFS A;  2MUY A;  1NUC A;  5TSS A;  4GN4 B;  1MIU A;  3QIA A;  4CKE A;  4KKT A;  2ZT9 C;  1GKH A;  4MZ9 A;  4A93 H;  1DCZ A;  2A19 A;  2ZTC A;  4DR4 L;  1IKL A;  4DV0 L;  4B9W A;  4A3B G;  1SAP A;  1PHJ A;  2VQF L;  3NWT A;  4Z9C B;  3CPF A;  1AH9 A;  2UU9 L;  4HAE A;  5KRU A;  2UUB Q;  3PO2 B;  5M5Y B;  4OGQ C;  4X65 Q;  1SYB A;  1WTR A;  1XTC D;  4BBR H;  1UUP A;  1LT3 D;  1UEB A;  2YV5 A;  1CKO A;  1IYV A;  4FXK C;  1G6P A;  1HNX L;  1KTK A;  4LK1 C;  3J7A 5;  4CJ1 B;  1OXV A;  3E9I A;  3KK7 A;  1IKM A;  4QMG A;  3KLW A;  1Q12 A;  1HQM C;  2WB1 G;  1RL2 A;  2CW0 D;  2Y0S B;  1QNU A;  2UXB L;  1VQE A;  1UNS A;  1B70 B;  4A93 G;  4DR6 Q;  4IJL A;  3T4A C;  5J22 A;  3J7A V;  4DUY Q;  4X3T A;  1S40 A;  4C3J H;  4DV2 L;  2WKC A;  4GKK Q;  3JC6 6;  4B3T Q;  4F7X A;  1GUO A;  2RQX A;  2FHT A;  4BBR G;  1YIJ A;  4GLA C;  3CCR A;  3J7Z C;  4LF7 L;  2UXD Q;  1K83 B;  2K50 A;  4A3I B;  2O4X A;  4DV1 L;  2ZTE A;  1CZG A;  3S14 B;  1K8O A;  2Z4I A;  3ULL A;  1Q7Y C;  2EYL A;  1HNZ Q;  1IL2 A;  4K8I A;  1HZA A;  3O13 A;  1KNE A;  1T5X D;  2IX3 A;  3EBE A;  2CW0 C;  5DNF A;  4K2L A;  1L1O B;  1I5F A;  1YEZ A;  4A3G B;  1GVP A;  1I4P A;  5IGC A;  1D1K A;  3I3C A;  3NWS A;  1V43 A;  3TP5 A;  2Q2I A;  4CBV A;  3AQQ A;  2E2I H;  1PTO B;  4C3J G;  1XPR A;  3M4O B;  4KJO A;  2C9O A;  1B9N A;  4ZKC B;  5AFW A;  2HT1 A;  4KY6 A;  4JI3 L;  3GV3 A;  5GRO A;  4B3M L;  5ELC A;  1I4X A;  3UDX A;  1KXL A;  2EJF C;  3FHW A;  3KF6 B;  3MFY A;  1LTS D;  4JBJ A;  2F0I A;  2PPB C;  2L15 A;  4IUT A;  3CRK C;  2E2H H;  2CKZ B;  4LUO A;  4JI8 L;  2F0N A;  4HCE A;  2A1A A;  2UXC L;  3BVM A;  4EX5 A;  4DXG A;  4BWG B;  3CME A;  4LMQ D;  5ELB A;  4JI6 L;  3RZO H;  2AWN A;  4MIU A;  1PH4 A;  2EXD A;  3AMU A;  5IGG A;  3SK4 A;  5J39 A;  3PIO A;  2BE5 D;  4L5R C;  3MVV A;  1EY7 A;  3HOY H;  1II3 A;  2EY6 A;  1CFM A;  3I4N H;  4WJ4 A;  1S5F D;  1E0B A;  5DM6 3;  1IBK L;  1Y8P B;  3EA6 A;  3PUX A;  4L5Q A;  1ASY A;  1OXS C;  1HUM A;  3CP0 A;  1AE2 A;  2EJG C;  1KDB A;  4LFB L;  1JR0 D;  4NXM L;  3GP7 A;  1LTR D;  2RF4 A;  3MEH A;  3RZD B;  2NVT B;  3PUZ A;  1YNN D;  1B53 A;  3K7U C;  4OWW B;  1SNP A;  4JPB W;  1KRS A;  1STE A;  3EQL C;  5C3E B;  1ILP A;  4DR1 L;  5I9O A;  1WOC A;  2WFW A;  3VYU A;  5IGB A;  3JAM E;  2JP1 A;  5BN3 A;  4H7B A;  3FKI B;  1QG7 A;  3GTJ B;  1DD2 A;  3PUY A;  3UDG A;  4JV5 L;  4KHP Q;  4R4C A;  4TRD A;  4A3F H;  4DV7 L;  4KMU C;  2TMP A;  2LXJ A;  4LW1 A;  5FLX E;  2BOS A;  1A3V A;  3HOY G;  1QB5 D;  3S1M H;  1LT5 D;  3I90 A;  3I4N G;  1VQD A;  1JB3 A;  2ZXO A;  5IYC H;  2NTT A;  2F0O A;  3HKZ B;  4AYB G;  3GTM B;  2MP1 A;  1YNJ D;  2YU9 B;  2HQE A;  2KJX A;  1AP0 A;  1A3T A;  1XWE A;  1EYG A;  1YNN C;  1PLF A;  3VR2 A;  1TII D;  4YCW A;  1DYQ A;  3J80 c;  1WTV A;  4OX9 Q;  2EXZ A;  2EY5 A;  1GUW A;  2CHB D;  3BG3 A;  3CHB D;  4UP9 A;  5C4J B;  3KFU A;  3L9A X;  1N34 Q;  1HR0 Q;  1ASZ A;  1DM0 B;  1BCP D;  5I4D A;  2ZJP A;  2F0G A;  2NTS A;  1HTP A;  4IUQ A;  4WRD A;  1S3O A;  4DV3 Q;  3A8K E;  2KED A;  3F1Z A;  3SDZ A;  1L1O A;  3DWP A;  4RKB A;  4A3F G;  2PYK A;  2CQA A;  3GDE A;  2NUC A;  1CQF A;  1J9O A;  2C35 B;  1I4R A;  5IYC G;  3PSI A;  3S2H H;  4ULL A;  3U9O A;  3KOJ A;  3LNN A;  4LF4 Q;  1XMO L;  5E7N A;  1XX8 A;  4A3B B;  3CW2 C;  3K5L A;  3PO3 B;  2O2L D;  5GAD C;  1BQQ T;  1EFW A;  5I9P A;  5NUC A;  1SRO A;  2A68 D;  5ELF A;  1WTP A;  1HJP A;  1NNX A;  4A4I A;  1BCP C;  1JT8 A;  4B3R Q;  1VQJ A;  1I3Q H;  4RWS C;  1HFN A;  3KF6 A;  4JI7 L;  4UY8 C;  4JK1 C;  3TN2 A;  3E5S A;  4A3M H;  2RKS A;  1YHA A;  2G9H D;  4JI2 Q;  4A3J B;  1X3G A;  1UAP A;  2Y0S E;  2PNR C;  5EBD A;  5ELN A;  1CK1 A;  3NEM A;  4DNT B;  2QIL A;  2PO4 A;  2NZ1 D;  3D31 A;  3GTG B;  5F2D A;  1YI2 A;  4ZCK A;  2YTX A;  3FEW X;  2VB2 X;  1L1O C;  3MEF A;  4ID6 A;  5FJ8 H;  4X3K A;  3SVM A;  5I6W A;  3T1Y Q;  4IFD I;  5DLQ E;  4JI1 Q;  1K28 A;  1TWG H;  4OEL B;  1O7L A;  2A68 C;  1C9O A;  1X56 A;  3TDQ A;  1KDC A;  4HJ8 A;  3F2U A;  2XTI A;  2E2J H;  3OOC A;  1SJE D;  4CJ0 B;  1LLR D;  2X69 A;  4X62 Q;  2KBN A;  3OWE B;  1X32 A;  4A3M G;  2VNU D;  3RNU A;  2IX0 A;  3H09 A;  1CA5 A;  1PH1 A;  5CV7 A;  3H6M A;  1W6K A;  1SNO A;  5M5Y H;  2XRQ D;  3PO2 H;  1B2T A;  2K5W A;  2K14 A;  4HN7 A;  1Y69 U;  4RMF A;  1SSO A;  4G7H C;  3ICE A;  1DON A;  1PMR A;  1B3A A;  1Y8O B;  3GD7 A;  1UE5 A;  5HGQ A;  1D6E C;  5FJ8 G;  2B8G A;  1LT4 D;  4FXD A;  1J8I A;  1Q3L A;  1EL0 A;  2IW3 A;  3N52 A;  3CC4 A;  4J8Q A;  2L0C A;  1CKN B;  2LSS A;  5IWA Q;  1DJR D;  5LMN Q;  3ER0 A;  3K80 C;  4KHZ A;  3R2I A;  4ABN A;  4HIO A;  1G29 1;  2L55 A;  3MWY W;  2VB3 X;  1BBX C;  1E2W A;  5CV9 A;  3EJI A;  2L1B A;  3AFP A;  3E0E A;  4DV5 L;  4ZRZ A;  1XNQ L;  2K5Q A;  3HOX G;  2OT2 A;  3QOJ A;  4K5V A;  3KJO A;  3PO2 G;  4Q0F A;  4DR3 Q;  4I7A A;  1H9R A;  1VQM A;  3VYR A;  2HDL A;  2JJQ A;  1KLG D;  4XYO A;  3M3Y B;  1HZB A;  1HRJ A;  2A6E D;  4DR7 Q;  1E22 A;  1HR0 W;  1K83 H;  4A3I H;  1TS5 A;  1F9P A;  1EYA A;  4XQJ A;  3E6Z X;  2CH4 A;  1O7Y A;  3AB9 A;  3S14 H;  1BBU A;  1K0R A;  1MKH A;  1AE3 A;  4DGZ A;  4GKJ Q;  1X9N A;  5C44 B;  1V1O A;  2X6G A;  4FF3 A;  3K57 A;  5C3X A;  1H9S B;  1EOV A;  2F0J A;  1TKW B;  4DUZ Q;  2ATW A;  1WTH A;  4R4O A;  4LFC L;  1D5M C;  2Y0S G;  4NB3 A;  4A3G H;  4LF5 L;  3F2D A;  2K28 A;  3S1N B;  1CM9 A;  4ZLT F;  4DR5 Q;  3Q24 A;  5EKI A;  4AQY Q;  1I94 L;  2J4X A;  5FK9 C;  3CC7 A;  3I56 A;  5LMU Q;  1WTW A;  1PTO H;  3M4O H;  3CU7 A;  3IFT A;  2E2H B;  1NBW A;  2A6E C;  5JPN C;  2CWA A;  4ZYS A;  3RLO A;  4JI5 L;  4IAL A;  4DR4 Q;  1YNX A;  1Z9F A;  4KY7 A;  4XDX A;  4DV0 Q;  4A3I G;  1GUS A;  3T56 B;  3HS0 C;  2VQF Q;  5T1G A;  3J80 L;  2AUJ D;  4A3E B;  4ILW A;  2UU9 Q;  1EIF A;  3NE5 B;  1B8A A;  1VQL A;  4QUF A;  4C2M B;  1GUG A;  1V1P B;  2Q8R E;  4L8J A;  1XNR L;  1SJH D;  2IY5 B;  3HKZ E;  2RVL A;  4O42 A;  1HNX Q;  4A3G G;  3OPO A;  1MJE A;  2HHH Q;  4OEM B;  4IFD J;  2ZJQ A;  3SR1 A;  3DEP A;  1WCM B;  1PYB A;  5I6Y A;  3RLN A;  4DA2 A;  3A74 A;  1L0Y B;  4CDD C;  3OWF A;  1AN8 A;  3GTK B;  1RD9 D;  2B2V C;  4JYA L;  1EWC A;  2OF1 A;  1IYJ B;  2A5H A;  5FO7 B;  1WJJ A;  3TP8 A;  3U50 C;  2UXB Q;  4NP5 A;  4GLV B;  1L0W A;  4L6T B;  2KCN A;  4P2C B;  2B3G A;  3Q0A A;  4P74 A;  2I07 B;  1Q90 A;  2Z6K A;  1GHJ A;  1UE7 A;  3VDY A;  1SYD A;  4R8I A;  1TQO A;  2CCZ A;  3WDN A;  4R8N A;  3RZD H;  2NVT H;  4G57 A;  2AWO A;  4H13 C;  3J81 E;  3J81 c;  4DV1 Q;  2QKI C;  5C3E H;  5IOC A;  2OEO A;  2ICE C;  1I6H B;  1VQ9 A;  3FKI H;  3HOZ B;  3GTJ H;  1CKN A;  4RKL A;  2YTV A;  2BA0 A;  3LWE A;  2F4V L;  4JI4 Q;  1O78 A;  5E4W C;  4RAU C;  5LMN W;  3A8J E;  5LHY 1;  1I4Q A;  2KQ3 A;  1EY0 A;  3J80 i;  1AZP A;  1YIT A;  3GTM H;  2YU9 H;  1D1I A;  2HQL A;  2BDN A;  4DAY A;  3BU2 A;  1EEF D;  1ZYR D;  3M7N A;  4JI3 Q;  1LO5 D;  2DGY A;  3BVG A;  5C3E G;  4A3L H;  1HNW Q;  2B2Y A;  1JOR A;  4R4I A;  5C4J H;  2FXQ A;  2Z6K C;  4B3M Q;  2NN6 I;  1VQF A;  2KHS A;  2K03 A;  4QL5 A;  2MQH A;  5E1F A;  3FKI G;  5KYL A;  4K6D A;  2G9D A;  1H9S A;  1X3Q A;  2V1C C;  2A73 B;  5EJW A;  2DNC A;  5DEH A;  3CCL A;  1TXY A;  4X3U A;  3OIP A;  5C3W A;  5CC4 A;  5AJ3 L;  4DK1 A;  2I46 A;  2UXC Q;  4GOP C;  3DXJ C;  2F0Q A;  1PZJ D;  1YHB A;  2K6A A;  3Q8D A;  1ICF B;  1SBB B;  2IT1 A;  3HKZ G;  4HIM A;  4LF6 L;  4NDX A;  1EOT A;  4JI6 Q;  4PNY A;  1BR9 A;  1NTG A;  1ILQ A;  2N8N A;  3RUZ A;  3PO3 H;  4CDC C;  3SK6 A;  1SYE A;  4IPG A;  2KEN A;  3BZK A;  2E76 C;  4A3L G;  4K8J A;  1IBK Q;  3NTK A;  3T13 A;  4KV6 A;  3UDF A;  5IGD A;  4OON A;  4RA8 A;  5C0X H;  1PYW D;  3KF8 B;  1V1P A;  2XWB B;  3KLR A;  3UE1 A;  3VR4 A;  4EQP A;  3KDF B;  4NXM Q;  2QF7 A;  1GXD C;  3G71 A;  4R4Q A;  5IY0 A;  2BDO A;  2HIV A;  1RF2 D;  4DAV A;  1HA5 A;  4ME5 A;  4A3J H;  4UP8 A;  3S17 H;  1TS3 A;  1FGB D;  2LMC B;  5A2Q L;  4DR2 L;  1QUQ B;  2OTJ A;  3AFQ A;  5KNC A;  3HOU B;  4U68 A;  3GTG H;  4CDF C;  1VS0 A;  3NBH A;  4JV5 Q;  3GV6 A;  2XNA C;  3NBI A;  4DV7 Q;  2VY3 A;  1TY0 A;  3PO3 G;  3HOX B;  4HJ9 A;  2NVY B;  1LT6 D;  1J6Q A;  1PTO F;  1O7Z A;  2MFI A;  2XVS A;  5IIF A;  4GN3 B;  1RJT A;  5JJK A;  1JOO A;  2KA7 A;  1H9M A;  5C0X G;  1B50 A;  1NMG A;  5EAY A;  1WD1 A;  1MBY A;  1PA6 A;  1Q86 C;  4ME3 A;  3UE0 A;  3KBX A;  2RHQ B;  2WV6 D;  1PZI D;  4IUP A;  4A3J G;  1U9R A;  3I4L A;  1SMY C;  5IYD H;  4XQQ A;  5C4H A;  2XIW A;  3A5U A;  3MZ5 A;  2DJG C;  3G7L A;  3OTO L;  1Z7T A;  1EY8 A;  4HID A;  3C46 A;  2K04 A;  1SNC A;  2PNH A;  3M4Y A;  2Q2T A;  2F0K A;  2JA5 B;  4POG A;  3IKJ A;  1H9J A;  1KC8 C;  2VUM H;  1BCP B;  5GAH C;  1JMC A;  2K5V A;  1YVC A;  3UDI A;  1WTQ A;  2A69 D;  3PV0 A;  2JA8 B;  3E0J A;  4MHE A;  2GVB A;  1XMO Q;  1PVO A;  1SDF A;  3TZU A;  4QB4 A;  1NR4 A;  4YHH L;  4NXN Q;  1LYL A;  2YTY A;  3NXW A;  1J5E Q;  1DOM A;  1RTO A;  2E74 C;  1ESR A;  3S1R B;  1A2T A;  4F8M A;  5DAU A;  3DUZ A;  2O5J C;  3W1G A;  4IN3 A;  3HFZ B;  5IYD G;  4F88 A;  2M2L A;  3M3Y H;  1VMC A;  4KLK A;  3BYY B;  3EVQ A;  2R7Z H;  4JI7 Q;  3EFX D;  1QVF A;  2B2T C;  4LFA L;  3J81 L;  4UHV A;  3VYT A;  4KN4 C;  5IP7 H;  4UDU C;  1JOK A;  3QOL A;  2VUM G;  5M5W B;  1UE6 A;  2A8V A;  5C44 H;  1NE3 A;  4AH6 A;  4WJW A;  4DV6 L;  1Q1E A;  1LUZ A;  4F87 A;  3LX0 A;  3D6W A;  1SE3 A;  4OXP A;  1R9T B;  1I6V C;  3I7F A;  1WFQ A;  3S1N H;  2K33 A;  3L0O A;  2LFN A;  4OO1 I;  5M3M B;  1X6O A;  2R93 B;  1UWV A;  2AUK A;  1NJI C;  3TP6 A;  3I4M B;  3KF8 A;  3NK9 A;  3QG1 A;  4CDE C;  1LTB D;  3KDF A;  2R7Z G;  2HD3 A;  1TWC B;  3ZJY C;  3A7L A;  4KY5 A;  2D62 A;  4N8X 1;  2AHO B;  1EIH A;  5IP7 G;  4A3E H;  3CRL C;  1Z47 A;  3OMG A;  2R3Z A;  3B6Y A;  3CCS A;  1QUQ A;  4A3D B;  3K7A B;  1I50 B;  4C2M H;  1EYD A;  5C44 G;  2KCM A;  2NB0 A;  1PH3 A;  1A8V A;  3DEO A;  3K0Y A;  1K9M C;  3GTL B;  4HCS A;  1IYU A;  3J7A F;  2WII B;  3C2P A;  1A3U A;  2F0L A;  5H1S E;  1WCM H;  2KVM A;  4BBS B;  1XYI A;  3SK5 A;  4CKC A;  1GD7 A;  1SNM A;  1ML0 D;  3WWV A;  3ERS X;  3GTK H;  1TT2 A;  2L11 A;  5JEA H;  3CCV A;  1N36 L;  3H3V I;  5CGK A;  1L2F A;  2LKV A;  1AZQ A;  3VYS A;  5HY6 A;  1JC7 A;  1E24 A;  4PMB A;  5BN5 A;  3URY A;  3X3M A;  2MHV A;  2VQE L;  1QWY A;  3ULJ A;  2NZO A;  2JA7 B;  5L37 A;  3J81 i;  1XNQ Q;  4A3E G;  1UE1 A;  1Z6H A;  3H0G B;  3PIO 3;  2I5H A;  1CSQ A;  1O7I A;  2I5L X;  5D3I B;  2F0M A;  2D2C C;  2BE5 C;  1OXU A;  4X66 Q;  5CV6 A;  4ZKB B;  1DXM A;  3D3R A;  1BKB A;  1YJW A;  1SYG A;  3IL8 A;  3CC2 A;  1I6H H;  1WCM G;  5BR8 Q;  5D65 A;  1S5B D;  2HIX A;  3HOZ H;  3DMU A;  4R4T A;  2B39 A;  5JOB A;  3S1Q B;  1LM0 A;  3SHL A;  1K8G A;  1FD7 D;  1VQB A;  5JEA G;  5E4X A;  4TKO B;  3J80 E;  4LFC Q;  4UPA A;  4LF5 Q;  4MTN A;  5EBC A;  3VR6 A;  2B2U C;  3L7Z C;  3NP8 A;  4PZ8 A;  4P73 A;  4BXX H;  2IHE A;  4X65 L;  4A3C H;  1I94 Q;  1I4H A;  3TSS A;  2P5Z X;  1F9Q A;  5EPL A;  1HZ9 A;  4RGN A;  3I8Z A;  3D6C A;  4DAP A;  2F0S A;  2F0D A;  2UUA L;  4NMZ A;  1XMQ L;  1HCZ A;  1U4R A;  2BA1 A;  2IHF A;  3S16 B;  2OCE A;  4YWK A;  1YNJ C;  3BZC A;  1KRT A;  5CMD A;  2O5I C;  3HOZ G;  2CWP A;  2K5N A;  2F4I A;  5A35 A;  1CUK A;  1CA6 A;  4DU9 A;  2K5H A;  4DR6 L;  4JG2 A;  1K3B C;  3MC0 B;  3W2D A;  5IYB H;  2QGQ A;  4DUY L;  3K5N A;  2L9H A;  1PFN A;  1PH5 A;  4KJN A;  1VQ7 A;  2QDB A;  4GKK L;  3CD6 A;  1EZ6 A;  4BXX G;  4A3C G;  3T53 B;  5JAV A;  2E2D C;  1T5E A;  2HCC A;  1S5C D;  2F3I A;  3G6J B;  4IOA A;  2N78 A;  4JYA Q;  4M8A A;  5EPJ A;  3S17 B;  2EYP A;  5ELD A;  2LY7 A;  1HNZ L;  1U5K A;  3BZD B;  2Q2H A;  4TQU S;  1KLU D;  1TS4 A;  4OWT B;  4EQN A;  1SMX A;  2RCN A;  2KHI A;  5CV8 A;  2EYF A;  1EWH A;  1FJG L;  3H91 A;  2VL6 A;  1BBW A;  2EE1 A;  2F0W A;  5GQO A;  4HMJ A;  3D4W A;  3PMF A;  5IYB G;  2ZM6 L;  2Z1C A;  3HEJ A;  5IOD A;  2JA9 A;  3IFD A;  2PI2 A;  2JQO A;  2IWH A;  3HOU H;  4XTC S;  3KLS X;  3G4S A;  4LNQ A;  1IBM L;  4RHS A;  1HUN A;  1XJV A;  2F4V Q;  4QIW B;  1E7Z A;  1TWF B;  3HOX H;  4Y7N B;  1HFG A;  4JW0 A;  2NVY H;  3D4R A;  2AQ1 B;  4A3K B;  4B3S L;  1EYC A;  3V96 A;  4GZY C;  5EGT A;  1C8C A;  4PMC A;  3S2D B;  4IUN A;  2XWJ B;  2WAQ B;  3S9W A;  2R92 B;  2RDH A;  1M1K C;  2Z9H A;  3PF5 A;  1QZH A;  3NTH A;  5KEE A;  2VUM B;  2EY1 A;  2Z0S A;  2F0E A;  1JWS D;  4GOP B;  1QVC A;  3FMC A;  5EQ0 A;  1BXT A;  2I0Q A;  5D3D A;  1B1Z A;  1F9R A;  1MD2 D;  3HOU G;  3KUP A;  5IGE A;  2DNE A;  1C0A A;  1PRT F;  3MXN B;  1EUJ A;  1JQY D;  1TWH B;  4DF7 A;  2JA5 H;  3KBG A;  2K52 A;  5AJ3 Q;  4CKB A;  1X3P A;  2CQO A;  1R4P B;  1IBL Q;  3I73 A;  2R7Z B;  4P72 A;  4LF6 Q;  4DAY B;  2QDL A;  4DFA A;  1NY4 A;  2JA8 H;  1B7Y B;  1STH A;  2RA4 A;  1TY2 A;  4KI0 A;  1E3P A;  2UUC L;  5A2Q E;  1Y1V B;  3AEV A;  1F9S A;  3LWU A;  1BO0 A;  2JSO A;  5KYI A;  3S1R H;  1PZK D;  4KK7 A;  1XTD A;  4IOC A;  2B2V A;  4RHR A;  3NQI A;  4WFN 3;  2ALY B;  5HUR A;  1K73 C;  3L2P A;  3ERO A;  4DN4 M;  1VQG A;  3CF5 A;  4XQN A;  2PI2 E;  4C1N K;  3E9H A;  5KND A;  1S5D D;  3HG9 A;  2Z8L A;  4FP5 D;  2F3W A;  2JA5 G;  2OWO A;  4PMW A;  4TSS A;  2D0O A;  5IGF A;  1H9K A;  4KKS A;  1OXT A;  4DR2 Q;  5M5W H;  2HCI A;  1VQK A;  2ENB A;  3OIQ A;  5FLM H;  3RMH A;  1WD0 A;  1EY5 A;  1B9M A;  1D7Q A;  4RCN A;  3KLS A;  2JA8 G;  4DAM A;  1R9T H;  4ALP A;  1JJG A;  4WJ3 M;  1G2S A;  1DZ1 A;  3QR8 A;  1M90 C;  4K5W A;  2YYZ A;  1NR2 A;  1HR0 L;  1B4O A;  4I65 A;  5IT9 E;  5M3M H;  5IT9 c;  4HIK A;  2R93 H;  2EDG A;  2IL8 A;  1ROD A;  4ZQ3 A;  3I4M H;  4QJF A;  2K05 A;  1VQ5 A;  1TWC H;  3PUV A;  2F0H A;  2JN4 A;  1HXY D;  1STN A;  3X3N A;  3M9B A;  1CHP D;  3NBH B;  4A3D H;  3PUW A;  3K7A H;  4ODG A;  1I50 H;  5FLM G;  3QB3 A;  3HGB A;  1X55 A;  3UI2 A;  3OTO Q;  3BVZ A;  2L4N A;  5T1I A;  2MNA A;  1DOL A;  1GOZ A;  1AW7 A;  2KHJ A;  4R9W A;  4A76 A;  3GTL H;  1GUN A;  1KDA A;  3M4Q A;  3H3V C;  4RCO A;  2E5L L;  4BBS H;  3MXG A;  3W5O A;  4DV2 Q;  5M3M G;  2Q8I B;  3VA7 A;  3PIP A;  2EQS A;  2R93 G;  1R4Q B;  2GA4 B;  3CKI B;  4JI2 L;  4LF7 Q;  3I4M G;  2VW9 A;  2R7D A;  4DNI A;  3F8T A;  1IHZ A;  4YHH Q;  1YZ6 A;  2JK8 A;  1CI3 M;  1FL0 A;  4LUV A;  4GOP A;  1EY9 A;  1LTT D;  2VZA A;  2JA7 H;  3NUC A;  2K7V A;  3H0G H;  5HGT A;  4BY7 B;  4A3D G;  3RR5 A;  1WTO A;  2EPB A;  2NVQ B;  2C5C A;  1YHQ A;  4TVA B;  4C1N I;  2E75 C;  3CAM A;  4DV4 L;  4UAI A;  4JI1 L;  3CCJ A;  5C4X B;  3Q22 A;  3OSO A;  2EJM A;  1LAC A;  1A15 A;  3MXN A;  4HMI A;  2RDG A;  1XPO A;  3A54 A;  2WAC A;  4PG3 A;  4EQO A;  1QNK A;  5EKL A;  2HUG A;  3HOW B;  4BBS G;  1KNA A;  1Q8K A;  3D0F A;  1PH8 A;  3NHH A;  3S1Q H;  2BH8 A;  2PZU A;  4DV6 Q;  1BNZ A;  3CXC A;  4B08 A;  4X64 L;  1TWA B;  2G5D A;  3PCO B;  1PXU A;  4ZUI A;  1D8L A;  3W1B A;  1QCB D;  4DK6 C;  2E8G A;  2WIN B;  1RTN A;  1WI5 A;  5KIX A;  2JA7 G;  4IUU A;  3W3A A;  3HKS A;  3GTQ B;  3H0G G;  1RHP A;  1JOQ A;  4LF9 L;  3D4D A;  3MAQ A;  1F2M A;  3BJU A;  3R93 A;  4JI8 Q;  3SXH A;  3NPP A;  1FVI A;  3H15 A;  3OW2 A;  5I2Y A;  4QIW E;  3S16 H;  3ZYY X;  1NCV A;  1STB A;  3TME A;  4YY3 L;  2ID0 A;  4K0K L;  2F0T A;  3E3X A;  1CHQ D;  1GM5 A;  4FYD A;  2JXM B;  1ZYR C;  1VQN A;  2V4D A;  4HED A;  1PH7 A;  2WAQ E;  1JB7 A;  2PW7 A;  4V0B A;  3K59 A;  3ITP A;  2QCP X;  2DY7 A;  3NEL A;  3ONA B;  5IE8 A;  1SXT A;  2A6H D;  1WTX A;  4LFB Q;  4FNF A;  4NPS A;  1W2B A;  5J3B A;  2IJ0 A;  4PV1 C;  1N36 Q;  1ENC A;  1PH6 A;  4FF4 A;  2SEB D;  4DR1 Q;  1ENA A;  2B63 B;  3P1H A;  4PQX A;  1RIP A;  3KYH C;  2VQE Q;  1X65 A;  4ZUJ A;  3EIV A;  4FXG C;  3U4V A;  3Q6S A;  4H02 A;  2KCC A;  3IAY A;  1VF7 A;  2Q2U A;  2GVA A;  1PH2 A;  1F2Y A;  1N32 L;  4DR5 L;  3RN5 A;  2AKW B;  1STY A;  1Y1W B;  2NVX B;  3PF4 A;  1O80 A;  2H4O A;  3GO5 A;  1KL9 A;  4BA1 I;  4QY7 A;  5ELO A;  1HA6 A;  1QOH A;  4I7Z C;  2MJ8 A;  2WKD A;  3TS0 A;  4L5S A;  4G7O C;  1Q46 A;  2B2T A;  1OO9 B;  1TWF H;  3LGJ A;  5COR A;  2OTL A;  1BUV T;  4Y7N H;  1OXX K;  1ICW A;  1KIX A;  1G51 A;  4YCU A;  3M85 A;  1A62 A;  1PRT D;  4A3K H;  2ZTD A;  2OQ0 A;  5IT9 L;  4Q5V A;  2PQE A;  5CR3 A;  4XT3 B;  4IUR A;  3NQT A;  3S2D H;  3U58 A;  1K3R A;  1G2T A;  3QO2 A;  5JPM C;  4HJA A;  2JEA I;  1S72 A;  3G6E A;  2R92 H;  5EKK A;  4K2K A;  1B3Q A;  4C3I B;  2HHH L;  4JI0 L;  1JE5 A;  1VQC A;  2RSN A;  1VMP A;  4LF8 L;  3TRZ A;  2Z4H A;  3R3O A;  1EEI D;  4OIK A;  2UUA Q;  2CH4 W;  2N88 A;  2IX1 A;  1E2V A;  1XMQ Q;  3ND9 A;  3U4Z A;  5M3F B;  3T1H L;  1SFO B;  2NBF A;  3KJP A;  3GQB A;  3NEN A;  4CGY B;  4DK0 A;  3AU7 A;  1IW7 D;  2EZV A;  2SNS A;  3TZD A;  3MFG A;  1MGS A;  1V8Q A;  1H95 A;  1TWH H;  1D5Z C;  2QW7 A;  5FO9 B;  3GTO B;  1PRT C;  2A74 C;  3C1E A;  5I2X A;  4A3K G;  4JBW A;  1LTL A;  2M00 A;  1MJC A;  5JVG 3;  5BN4 A;  4JBM A;  1CKM A;  5J1Z A;  2ES2 A;  2WAQ G;  4J6H A;  2R92 G;  4PZ6 A;  1EY6 A;  4MTK A;  4IPC A;  1Y1V H;  4DNR B;  3DM3 A;  1X54 A;  1X3F A;  2EOT A;  4O2D A;  1M8A A;  4IFD H;  1C48 A;  1EIG A;  4K6L A;  1X3E A;  1YJN A;  2ZXP A;  2A69 C;  2K5D A;  4ZK9 B;  4AYB E;  4HJ5 A;  1IW7 C;  3T16 A;  1FJG Q;  2PW5 A;  4JI4 L;  3RLF A;  2K32 A;  3PQI A;  2K1B A;  2VS1 A;  3OW7 A;  3P20 A;  1JCK B;  1EZ8 A;  3BDC A;  3BS1 A;  1FNV A;  2ZM6 Q;  4FO2 A;  1S5E D;  1IL8 A;  3A8I E;  1VQO A;  3M7G A;  1ZEQ X;  2F1M A;  1PYS B;  1IBM Q;  1RDP D;  4FF1 A;  4QGU A;  5ISR A;  1HNW L;  4RGT A;  4YWL A;  3TBI B;  1Y1V G;  3A55 A;  3G48 A;  4LUZ A;  1U0L A;  1MSG A;  2F0V A;  4KD3 A;  2JA6 B;  4K5X A;  4IFD G;  3SK8 A;  4B3S Q;  3K81 C; 
#chains in the Genus database with same CATH homology
 3HKZ E;  4IPH A;  2VL6 A;  1HH2 P;  1BBW A;  1EWI A;  1N8R C;  1EIY B;  2QA4 A;  4AQY L;  5GQO A;  1HNX Q;  4A3G G;  1VQH A;  1MJE A;  2HHH Q;  4IFD J;  2ZJQ A;  5IYB G;  2ZM6 L;  1PYB A;  1Q1B A;  3RLN A;  3STB C;  1QVG A;  5LMU L;  1N33 L;  3A74 A;  1PV4 A;  2JA9 A;  1PFS A;  2PI2 A;  2JQO A;  3HOU H;  2OQK A;  1MIU A;  4GN4 B;  4JYA L;  4XTC S;  3TS2 A;  3G4S A;  1GKH A;  4MZ9 A;  1IYJ B;  4A93 H;  4LNQ A;  1IBM L;  2A19 A;  2ZTC A;  1WJJ A;  1XJV A;  3U50 C;  4DR4 L;  2UXB Q;  4DV0 L;  2F4V Q;  4GLV B;  1L0W A;  1PHJ A;  2VQF L;  4A3B G;  1E7Z A;  3CPF A;  3HOX H;  1AH9 A;  2UU9 L;  2UUB Q;  2B3G A;  4DV5 Q;  2NVY H;  4P74 A;  1C7Y A;  2Z6K A;  4X65 Q;  1UE7 A;  3VDY A;  1CSP A;  4B3S L;  3I55 A;  4BBR H;  1UEB A;  3TRE A;  2YV5 A;  1CKO A;  2CCZ A;  1A0I A;  1G6P A;  1OTC A;  3RZD H;  1M1K C;  1HNX L;  2NVT H;  3PF5 A;  2AWO A;  3J81 c;  1YJ9 A;  5C0X I;  4DV1 Q;  1QZH A;  3J7A 5;  5C3E H;  2Z0S A;  1SLJ A;  1OXV A;  2CFM A;  2UUC Q;  4GOP B;  3JAM c;  3E9I A;  1QVC A;  1VQ9 A;  3FKI H;  3KLW A;  4GNX B;  3GTJ H;  1CKN A;  1Q12 A;  2I0Q A;  2WB1 G;  1RL2 A;  4LWC A;  3HOU G;  4BY7 H;  2YTV A;  2UXB L;  2BA0 A;  1VQE A;  2F4V L;  4JC0 A;  2NVQ H;  1B70 B;  4A93 G;  1E1O A;  1FGU A;  1C0A A;  4DR6 Q;  4IJL A;  3IRB A;  3MXN B;  1EUJ A;  4IJH A;  2UUB L;  4JI4 Q;  5C4X H;  1Q82 C;  2JA5 H;  5FLX c;  4DUY Q;  2K52 A;  2R6G A;  5AJ3 Q;  5LMN W;  1S40 A;  4C3J H;  4PZ7 A;  3J80 i;  4DV2 L;  2CQO A;  1YIT A;  3GTM H;  4GKK Q;  3JC6 6;  2YU9 H;  4B3T Q;  1IBL Q;  3HOW H;  2MO0 A;  4APV A;  4BBR G;  2HQL A;  4P72 A;  4YCV A;  4DAY B;  1PH9 A;  4LF6 Q;  1NY4 A;  1YIJ A;  2JA8 H;  4GLA C;  1B7Y B;  3CCR A;  3J7Z C;  2N3S A;  3RN2 A;  4LF7 L;  4QQB X;  2K50 A;  3BU2 A;  2UXD Q;  4DV1 L;  4KI0 A;  1TWA H;  1BVS A;  2ZTE A;  3SGI A;  3M7N A;  4JI3 Q;  1E3P A;  2UUC L;  4JI5 Q;  2DGY A;  3AEV A;  1E1T A;  5C3E G;  4A3L H;  1HNW Q;  3ULL A;  1IL2 A;  1Q7Y C;  1HNZ Q;  1V1Q A;  4R4I A;  5C4J H;  2FXQ A;  2Z6K C;  1KD1 C;  2NN6 I;  3S1R H;  1VQF A;  4B3M Q;  1HZA A;  4QL5 A;  2MQH A;  1XTD A;  3FKI G;  4IOC A;  3EBE A;  2N49 A;  1XNR Q;  4A75 A;  2ALY B;  1L1O B;  3L2P A;  1K73 C;  3GTQ H;  1I5F A;  1VQG A;  3CF5 A;  4BY7 G;  3M4P A;  1YEZ A;  2PI2 E;  1GVP A;  2V1C C;  3E9H A;  3CCL A;  1TXY A;  5AJ3 L;  1V43 A;  5C4X G;  2Q2I A;  2JA5 G;  2OWO A;  4GS3 A;  4PMW A;  2UXC Q;  2D0O A;  4GOP C;  3AQQ A;  2XGT A;  5GAG C;  3CCQ A;  1OXT A;  3J81 j;  5M5W H;  1YHB A;  4DR2 Q;  3Q8D A;  4GN5 A;  2IT1 A;  2E2I H;  1VQK A;  3HKZ G;  4HIM A;  5FLM H;  1XPR A;  1W3S A;  4LF6 L;  4POF A;  2UXD L;  4JI6 Q;  1D7Q A;  3HOW G;  1NTG A;  2LXK A;  2N8N A;  2HT1 A;  3PO3 H;  2JA8 G;  4DAM A;  4JI3 L;  4NXN L;  1R9T H;  4IPG A;  1J5E L;  4ALP A;  1JJG A;  4WJ3 M;  2KEN A;  1M90 C;  3I2Z A;  2YYZ A;  5GRO A;  4B3M L;  3BZK A;  1HR0 L;  3UDX A;  4A3L G;  1IBK Q;  1KXL A;  3UDF A;  3K0X A;  5M3M H;  2E5L Q;  5IT9 c;  5JJI A;  4OON A;  4HIK A;  2R93 H;  3FHW A;  3KF6 B;  3KF8 B;  3UE1 A;  3F2C A;  3KDF B;  4NXM Q;  4JBJ A;  3I4M H;  1VQ4 A;  2F52 A;  3G71 A;  2L15 A;  4R4Q A;  5IY0 A;  4QJF A;  2E2H H;  2CKZ B;  3AYH B;  1VQ5 A;  4LUO A;  2HIV A;  4JI8 L;  1TWC H;  3PUV A;  4A3J H;  4UP8 A;  2A1A A;  1IXR A;  2UXC L;  3S17 H;  4EX5 A;  4DR2 L;  3M9B A;  1QUQ B;  3CME A;  2B63 H;  2OTJ A;  3AFQ A;  1VQ6 A;  3NBH B;  4A3D H;  3PUW A;  4JI6 L;  3RZO H;  3K7A H;  3GTG H;  1I50 H;  1VS0 A;  2AWN A;  2EXD A;  5FLM G;  1VQI A;  1PH4 A;  4JV5 Q;  3DLL A;  1X55 A;  3OTO Q;  4R1J A;  4DPG A;  3PIO A;  4L5R C;  4DV7 Q;  2MNA A;  2VY3 A;  3HOY H;  3PO3 G;  3I4N H;  1EQR A;  3A0J A;  2KHJ A;  4DV4 Q;  4A76 A;  1VQ8 A;  4WJ4 A;  2KCT A;  4YWM A;  3GTL H;  3M4Q A;  4HJ9 A;  1IBK L;  1J6Q A;  3PUX A;  1Y1W H;  3I4O A;  4L5Q A;  1JJ2 A;  1ASY A;  1OXS C;  2MFI A;  2E5L L;  3CP0 A;  2NVX H;  1AE2 A;  3CMA A;  4UP7 A;  4GN3 B;  4BBS H;  3W5O A;  4DV2 Q;  4LFB L;  5M3M G;  5JJK A;  3PIP A;  4NXM L;  2EQS A;  4RG1 A;  5GAE C;  5C0X G;  2R93 G;  1NMG A;  1KAW A;  5EAY A;  2RF4 A;  4JBK A;  3PUZ A;  1PA6 A;  3K7U C;  1Q86 C;  4JI2 L;  4ME3 A;  4OWW B;  4DK3 C;  4LF7 Q;  3I4M G;  2VW9 A;  3UE0 A;  1KRS A;  2R7D A;  4MNO A;  4X64 Q;  2I5M X;  4DR1 L;  1WOC A;  2WFW A;  3F8T A;  2RHQ B;  4DNI A;  4YHH Q;  1Q81 C;  1YZ6 A;  2JK8 A;  1NMF A;  4A3J G;  1FL0 A;  4LUV A;  5C0X J;  4GOP A;  2VZA A;  2JA7 H;  5IYD H;  2B63 G;  4GNX A;  3A5U A;  3H0G H;  3PUY A;  3UDG A;  4JOI A;  1DGS A;  4JV5 L;  4A3D G;  3RR5 A;  4R4C A;  3OTO L;  4KHP Q;  4A3F H;  1EQQ A;  4DV7 L;  2QEX A;  1YHQ A;  4TVA B;  4HID A;  4OWX B;  2GN5 A;  2LXJ A;  3CAM A;  4DV4 L;  2PNH A;  4LW1 A;  4JI1 L;  2Q2T A;  3CCJ A;  4LF9 Q;  4C3I H;  3HOY G;  1QZG A;  3S1M H;  4POG A;  3I4N G;  1VQD A;  1KC8 C;  2VUM H;  5IYC H;  5GAH C;  1XPO A;  5JJL A;  1Y1W G;  1JMC A;  4AYB G;  2K5V A;  4PG3 A;  1YVC A;  5M3F H;  3UDI A;  1SFO H;  4BBS G;  1Q8K A;  3D0F A;  4DKA C;  1PH8 A;  3PV0 A;  3S1Q H;  2R7F A;  2BH8 A;  4YY3 Q;  2K4K A;  4DV6 Q;  2GVB A;  4K0K Q;  1XMO Q;  1EYG A;  3CXC A;  4FDB A;  1PVO A;  4X64 L;  3PCO B;  2NN6 G;  2K75 A;  4YCW A;  4YHH L;  4NXN Q;  1LYL A;  1T9H A;  2YTY A;  1D8L A;  3W1B A;  3J80 c;  1J5E Q;  4OX9 Q;  1N9W A;  4DK6 C;  2E8G A;  4UP9 A;  3KFU A;  1WI5 A;  1N34 Q;  1HR0 Q;  1ASZ A;  3GTO H;  3W1G A;  3HFZ B;  2ZJP A;  4KHP L;  2JA7 G;  5IYD G;  3HKS A;  3H0G G;  1S3O A;  4DV3 Q;  3M3Y H;  4K0K L;  4KLK A;  3F1Z A;  4X66 L;  4A3F G;  1L1O A;  2R7Z H;  4JI7 Q;  4LF9 L;  1JJC B;  4XIG S;  1QVF A;  4Y52 H;  4LFA L;  1VQP A;  2EIF A;  3S24 A;  3A5Z B;  3GDE A;  3BJU A;  5IP7 H;  4JI8 Q;  1FVI A;  3H15 A;  3OW2 A;  2C35 B;  1GO3 E;  2VUM G;  1SRU A;  4P75 A;  1UE6 A;  5IYC G;  3PSI A;  4QIW E;  5BR8 L;  3S16 H;  3S2H H;  4GNX C;  2A8V A;  5C44 H;  1NE3 A;  3KOJ A;  4JOI C;  4AH6 A;  1Q1E A;  2ID0 A;  1IZ6 A;  1LUZ A;  4YY3 L;  5M3F G;  4DV6 L;  5E7N A;  1XMO L;  4LF4 Q;  4BA2 I;  3CW2 C;  1GM5 A;  4OXP A;  5GAD C;  1VQN A;  5IWA L;  1PH7 A;  4OX9 L;  1N32 Q;  3I7F A;  1SR3 A;  1WFQ A;  2WAQ E;  3L0O A;  1JB7 A;  1EFW A;  1VQA A;  2PMZ E;  3S1N H;  1N34 L;  1SRO A;  4OO1 I;  1HJP A;  2ZJR A;  3NEL A;  5IE8 A;  4A4I A;  1X6O A;  1UWV A;  1JT8 A;  4B3R Q;  1NJI C;  4DV3 L;  4LFB Q;  1VQJ A;  1I3Q H;  4NPS A;  1W2B A;  5J3B A;  2D0P A;  3KF6 A;  2PQA B;  4JI7 L;  4UY8 C;  1N36 Q;  1YBY A;  4A3M H;  1PH6 A;  3KDF A;  1YHA A;  4JI2 Q;  2R7Z G;  2JE6 I;  3ZJY C;  3CCU A;  1X3G A;  2Y0S E;  4DR1 Q;  2D62 A;  2AHO B;  1Y14 B;  5IP7 G;  4A3E H;  5ELN A;  1A63 A;  1P8L A;  1RIP A;  1Z47 A;  3KYH C;  1X65 A;  3NEM A;  2VQE Q;  3B6Y A;  3CCS A;  1QUQ A;  3D31 A;  3EIV A;  4LF4 L;  3U4V A;  4C2M H;  2JA6 H;  4H02 A;  5C44 G;  1YI2 A;  2Q2U A;  2BH2 A;  2GVA A;  2KCM A;  2YTX A;  1PH2 A;  3K8A A;  1L1O C;  3MEF A;  1PH3 A;  1A8V A;  5FJ8 H;  3TEH B;  1N32 L;  3T1Y Q;  3EN2 A;  4IFD I;  5DLQ E;  1K9M C;  4DR5 L;  4JI1 Q;  3RN5 A;  2AKW B;  1TWG H;  4JI0 Q;  1C9O A;  1X56 A;  5H1S E;  1WCM H;  4LF8 Q;  2ASB A;  4HJ8 A;  3PF4 A;  4B3R L;  3GO5 A;  2XTI A;  2E2J H;  3T1H Q;  1GD7 A;  1KL9 A;  4BA1 I;  3WWV A;  3ERS X;  4QY7 A;  5ELO A;  3CCV A;  3GTK H;  1N36 L;  1VCI A;  3H3V I;  1L2F A;  4X62 Q;  3TS0 A;  4L5S A;  3OYY A;  2KBN A;  3HOV H;  5HY6 A;  4O0A A;  1Q46 A;  1E24 A;  4A3M G;  4J15 A;  4BY1 H;  2VNU D;  3CCE A;  2IX0 A;  4JCV E;  3RNU A;  1PH1 A;  4P71 A;  1TWF H;  3LGJ A;  2VQE L;  2OTL A;  4Y7N H;  3ULJ A;  1OXX K;  5M5Y H;  3PO2 H;  2NZO A;  1G51 A;  4YCU A;  1KIX A;  3M85 A;  3J81 i;  2K14 A;  1A62 A;  4A3E G;  1UE1 A;  1XNQ Q;  3F2B A;  2ZTD A;  2OQ0 A;  3CPW A;  4A3K H;  3TQY A;  4X6A H;  2I5H A;  4RMF A;  3JAM i;  1CSQ A;  1O7I A;  2AMC B;  3ICE A;  2JA6 G;  3U58 A;  3S2D H;  1K3R A;  2I5L X;  4HJA A;  3T1Y L;  2JEA I;  3GD7 A;  1OXU A;  4L5T A;  1UE5 A;  4X66 Q;  1P16 A;  3G6E A;  1S72 A;  5HGQ A;  2R92 H;  3S15 H;  5FJ8 G;  2HHH L;  4JI0 L;  1JE5 A;  4LFA Q;  1BKB A;  1VQC A;  1YJW A;  4LF8 L;  2UUA Q;  3CC4 A;  3TRZ A;  2IX1 A;  4GLX A;  1XMQ Q;  1CKN B;  3U4Z A;  3CC2 A;  1SE8 A;  3T1H L;  2LSS A;  1I6H H;  5IWA Q;  1WCM G;  3KJP A;  5BR8 Q;  3HOZ H;  2HIX A;  4B3T L;  3NEN A;  4R4T A;  1LM0 A;  2H5X A;  3CQZ H;  4X62 L;  3ER0 A;  5LMN Q;  3K80 C;  4KHZ A;  1K8G A;  4HIO A;  3ULP A;  1VQB A;  5JEA G;  1XPU A;  1G29 1;  3HOV G;  4LFC Q;  4UPA A;  4LF5 Q;  4BY1 G;  3AFP A;  1H95 A;  3E0E A;  1TWH H;  4MTN A;  3L7Z C;  2B29 A;  4PZ8 A;  5M5X H;  4DV5 L;  1XNQ L;  4P73 A;  3HOX G;  2IHE A;  3PGZ A;  4X65 L;  4BXX H;  4A3C H;  3KJO A;  1I94 Q;  5JEA J;  4IO9 A;  3PO2 G;  4DR3 Q;  1VQM A;  2JJQ A;  5IP9 H;  4A3K G;  4JBW A;  1LTL A;  2JEB I;  1MJC A;  4JBM A;  1HZ9 A;  3CCM A;  1HZB A;  1CKM A;  2WB1 E;  4EQ5 A;  4DR7 Q;  2ES2 A;  1E22 A;  2WAQ G;  1HR0 W;  5K36 G;  1K83 H;  4A3I H;  2R92 G;  4PZ6 A;  2UUA L;  3S14 H;  4IPC A;  1XMQ L;  1BBU A;  1Y1V H;  2IHF A;  1MKH A;  1K0R A;  1X3F A;  1X54 A;  1AE3 A;  2OCE A;  2BA1 A;  3DM3 A;  4O2D A;  4YWK A;  4GKJ Q;  1X9N A;  3BZC A;  1KRT A;  1X3E A;  5LMN L;  1YJN A;  3HOZ G;  4AYB E;  2CWP A;  2K5N A;  4HJ5 A;  1EOV A;  1CUK A;  4DUZ Q;  2ATW A;  1FJG Q;  2K5H A;  4R4O A;  4DR6 L;  4LFC L;  4OO1 G;  2Y0S G;  4NB3 A;  4A3G H;  4LF5 L;  4JG2 A;  3RLF A;  3F2D A;  4JI4 L;  1K8A C;  4C3H H;  5IYB H;  2QGQ A;  4DUY L;  4IPD A;  1KHI A;  2VS1 A;  4DR5 Q;  4AQY Q;  1SN8 A;  3H3V H;  1I94 L;  1PH5 A;  3STB D;  4DR3 L;  1VQ7 A;  2ZM6 Q;  4AIM A;  4GKK L;  3CD6 A;  4BXX G;  4A3C G;  3CC7 A;  3I56 A;  2NZH A;  5LMU Q;  1VQO A;  1IBL L;  1N33 Q;  2RHS B;  4HJ7 A;  2F3I A;  5IP9 G;  3M4O H;  4IOA A;  1V9P A;  2N78 A;  1KQS A;  4DR7 L;  4JYA Q;  1PYS B;  1NBW A;  4A3B H;  2MO1 A;  2PQA A;  2CWA A;  1IBM Q;  3RLO A;  4JI5 L;  4DR4 Q;  1YNX A;  1Z9F A;  4DV0 Q;  4A3I G;  4QGU A;  3GTP H;  2VQF Q;  1HNW L;  1HNZ L;  2WP8 J;  1U5K A;  4YWL A;  2UU9 Q;  1EIF A;  4GKJ L;  1B8A A;  2Q2H A;  4TQU S;  1VQL A;  1WYD A;  1Y1V G;  3G48 A;  4OWT B;  2DUD A;  1SMX A;  1U0L A;  4LUZ A;  2RCN A;  2KHI A;  1HZC A;  3FP9 A;  4IFD G;  1XNR L;  4B3S Q;  4DUZ L;  2IY5 B;  3K81 C;  1FJG L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...