1J6QA

Solution structure and characterization of the heme chaperone ccme
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
100
structure length
100
Chain Sequence
b'SNLNLFYTPSEIVNGKTDTGVKPEAGQRIRVGGMVTVGSMVRDPNSLHVQFAVHDSLGGEILVTYDDLLPDLFREGQGIVAQGVLGEDGKLAATEVLAKH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cytochrome c maturation protein E
publication title Solution structure and characterization of the heme chaperone CcmE
pubmed doi rcsb
source organism Shewanella putrefaciens
molecule tags Chaperone
total genus 18
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2002-04-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1j6qA00
2HHHL 3EIVA 3I56A 1EQRA 1H95A 3PUXA 4LUOA 3ULLA 2JE6I 2JA5G 4R4QA 2K5HA 1CUKA 1QZHA 5IP9G 4PZ7A 4R4IA 4YWLA 2AHOB 3CCMA 1XNRQ 3GTGH 3M4QA 1TXYA 4GNXC 2Z0SA 3M3YH 5GROA 3F2DA 4KHPQ 4DV5L 4LF6Q 4JI0Q 4JI7L 1OTCA 1WCMH 4MTNA 1XJVA 4DUZQ 1X9NA 2CWAA 1YEZA 4B3RQ 1HNXQ 3OTOQ 1DGSA 1YJWA 3J7A5 2MFIA 1IL2A 2K4KA 3KOJA 2ZJRA 1SMXA 4DV6L 2IY5B 2GVBA 3S2HH 2UXCQ 4IPGA 5ELNA 1EYGA 5LMUQ 5C3EH 3CCUA 4YHHL 2Z6KA 1ASYA 4NXNQ 2MO0A 1VQFA 4DR3L 1EWIA 4UP9A 2UUBQ 4A4IA 4A3GH 1N33L 2EIFA 5C4XH 1YI2A 4DR5L 1HNZL 4LF4Q 4YCWA 1NMGA 2JJQA 1VQEA 3E0EA 1YVCA 3H3VH 3NENA 3I4MH 5IP7H 4B3SQ 3L2PA 2JEAI 1OXXK 4B3TL 1UEBA 5IYBH 3GTPH 1Y1VH 3KF6A 5J3BA 1J5EQ 1OXVA 1Q12A 1PV4A 3UDFA 4X66Q 3KFUA 1KXLA 3J7ZC 2VS1A 4FDBA 2UXDL 3AFQA 2D0PA 1LYLA 2UU9Q 4H02A 5JJKA 1XNQL 3WWVA 2WAQG 3K7UC 4BXXG 4EQ5A 2R7ZH 2JA7H 2B63H 2MO1A 3NEMA 4A76A 1IBLL 4GN4B 3PF5A 4DKAC 2K5NA 4JI3Q 4LFCL 1K9MC 2MNAA 1S72A 4DR2Q 2JA8G 3G4SA 2VY3A 2NVQH 5H1SE 3CCSA 3CF5A 1PH6A 1QUQA 1RIPA 1C0AA 1YZ6A 1VQ6A 3PGZA 4B3RL 3OTOL 3IRBA 2D0OA 2OQKA 4DAYB 2F3IA 5C0XJ 4GKJQ 3RR5A 4DK3C 4GOPC 5GQOA 4DNIA 1Y1WH 4OWTB 1M1KC 1NTGA 5C44H 4A75A 4BA2I 4A3EH 4NXNL 1HNWQ 1BKBA 4A3IH 2F52A 2WB1G 2ASBA 4IOAA 4LFBL 4DR6Q 1Q86C 2CWPA 3FHWA 3RLFA 4HJ7A 2UUBL 3S1NH 3M9BA 4AYBG 4OWWB 2VNUD 3KLWA 4LF4L 1BBWA 1VQ8A 3G48A 4DAMA 3CAMA 4JV5Q 3RLNA 5JJIA 1FL0A 3U50C 1XPOA 3M4OH 3AQQA 5FLMG 3K0XA 5GAGC 4PMWA 4X62Q 4HIOA 4JI3L 3HKZG 4GKKL 4KI0A 1OXSC 4KHZA 4P75A 1Z9FA 5JEAG 3A5UA 3GTOH 2R93H 4A3MH 4DR4Q 2UUCQ 4IPCA 3G6EA 4AQYQ 1JJ2A 3GD7A 4X64Q 4L5RC 1QVCA 1SR3A 4P72A 2EXDA 3ULJA 4OO1I 1VQJA 4B3ML 3HOYH 1XMQQ 2KCMA 3KDFB 1GD7A 4UP7A 4A3CG 2PQAB 3KJPA 3J81c 2ZJQA 4BBSG 1XTDA 1YIJA 1YNXA 4LF7Q 1X55A 1Q81C 4NPSA 1YHBA 5GAEC 1N36Q 4DV4Q 3U4ZA 3T1YQ 3CCQA 1K8GA 5C0XI 1IBKQ 2PI2E 3EBEA 4JI6Q 2JA6G 2VUMG 4LF8Q 4NXMQ 2ZM6L 1YHAA 1E24A 3H3VI 2YYZA 2AKWB 3A0JA 4BY1G 3W1GA 3JAMi 3HFZB 1P16A 3PO2H 4YY3Q 2UXBL 2A8VA 4GNXA 3S16H 4IOCA 2YTXA 1KD1C 1YBYA 2IX1A 2HIXA 3L0OA 2I5HA 2NZOA 1G291 2YTYA 1PYBA 1YITA 3J81i 2E2JH 3H15A 1KQSA 1VQLA 3PO3G 4DV7Q 1Q82C 1VQCA 4JI8Q 1UWVA 2I0QA 4J15A 4A3LG 2IHFA 2IT1A 5GADC 1K8AC 1NE3A 4IPHA 3UDIA 3JC66 3HOZG 2OTLA 2JA9A 1PH7A 1X54A 3PUVA 4MNOA 1VQMA 1HR0L 2N78A 5BR8L 2NN6I 4POFA 1K83H 4DUYL 1L1OC 4QGUA 1LUZA 4HJ5A 2Q2HA 4BXXH 1V1QA 4A3KH 4LF9Q 4IPDA 1MJCA 2GVAA 1PH3A 4AIMA 2XGTA 2YTVA 3AYHB 3FKIH 4JCVE 2A19A 4OX9Q 2R7FA 1VQAA 1HZAA 2D62A 1N32Q 2VUMH 4A3BH 4A3JH 4UP8A 1O7IA 1TWGH 3VDYA 4XTCS 3D31A 4QJFA 4KLKA 4BBRG 1I94L 2WP8J 4DV4L 2Q2TA 3S1QH 5JJLA 2GN5A 1WYDA 2Y0SG 2YV5A 1R9TH 1MJEA 1FJGQ 4JI4Q 4NXML 1X56A 2ZTCA 3F1ZA 1A8VA 2VQEQ 2VQFQ 1EQQA 4LF5Q 2K5VA 1TWAH 2I5LX 5ELOA 1I50H 5IYDH 5K36G 1B70B 2UUAL 2ALYB 1KHIA 4LW1A 4LNQA 4BY7G 4JBKA 3K7AH 1IXRA 4TVAB 5LMNW 1UE7A 1S40A 3I4NG 3TREA 4DV7L 1V43A 1SROA 4OWXB 5AJ3Q 2CCZA 4GN5A 2IHEA 4DK6C 1W3SA 1IBMQ 4GOPA 1VQ5A 3CC4A 2OCEA 1JJCB 4QQBX 5FLMH 4JI5Q 1CKOA 3LGJA 2F4VL 5LMNQ 1X3GA 4HJ8A 1VQHA 2NVXH 3GTJH 3CXCA 1A62A 3NELA 4DV2Q 3KF6B 1CKNA 2N49A 3U4VA 2WAQE 1PA6A 1NJIC 1VQKA 1QZGA 4DPGA 3CCRA 5HY6A 1GVPA 1XNRL 5IWAQ 3I2ZA 4OX9L 4DV1Q 2QA4A 3S1MH 3CD6A 4KHPL 4DR7Q 4LF6L 1UE1A 4IFDJ 3RN2A 4JI0L 4A3CH 4R4OA 3RZDH 3CMEA 4BBSH 4DUZL 1QUQB 5M3MH 3ERSX 3H0GH 1HNXL 3E9HA 4JYAQ 1Q1EA 1SRUA 3T1HQ 3HOWH 1IZ6A 4L5SA 1VQPA 2UXCL 1KRTA 2VQEL 1KAWA 3PV0A 3PIPA 4GS3A 5LMUL 1YHQA 1XPUA 2WFWA 2WB1E 1HZBA 1J6QA 2IX0A 1G6PA 3S2DH 4AYBE 1L2FA 4EX5A 1VCIA 1N34Q 1EFWA 1EIYB 1PH2A 4POGA 1NY4A 3HOVG 4GLVB 3Q8DA 3FP9A 1U0LA 1EIFA 5IT9c 1WCMG 3K80C 3CPWA 4JBMA 1NMFA 1S3OA 1X3EA 1PHJA 4X6AH 1HH2P 4B3SL 1FGUA 4A3FH 2KHIA 3HKZE 4JI5L 4WJ4A 1JT8A 1J5EL 4DV2L 4OO1G 4X66L 1LTLA 3CCJA 1PH4A 2UU9L 4QIWE 2LXJA 4DV3Q 1PVOA 2JA5H 1X65A 3KYHC 3M7NA 4P71A 5IP9H 3S17H 3S14H 1SLJA 5C4JH 3I55A 2E5LQ 2RCNA 3AEVA 3M4PA 1I3QH 1K73C 1MIUA 4A3GG 4K0KQ 1I5FA 1HJPA 2AWOA 2I5MX 5C0XG 4DR2L 1PH5A 2FXQA 3F2BA 4O0AA 4IFDI 1YJNA 1VQ9A 4X65Q 1E1OA 2QEXA 1E7ZA 3CC2A 5M3FG 4JI2Q 4BA1I 2CFMA 4GKJL 1E1TA 5IYBG 1UE5A 1WJJA 5FJ8G 1L1OA 2ID0A 3J80c 2HHHQ 1HNWL 3UDGA 3BZCA 3PF4A 1E22A 4L5QA 3G71A 3STBC 1U5KA 4DR6L 1M90C 2JA7G 2B63G 2B3GA 4GNXB 1I6HH 3MEFA 4QL5A 1B7YB 2YU9H 2VZAA 4JOIC 4JV5L 4P73A 4DV5Q 2NN6G 4JI7Q 1EOVA 3RZOH 4C3JH 3J80i 4ME3A 3UDXA 3CQZH 3UE1A 2E8GA 4X62L 4JC0A 2HIVA 1E3PA 1Y1WG 5C44G 4JI1Q 5GAHC 4DR4L 2PNHA 2CKZB 2RHSB 2UUCL 3PUWA 4AQYL 3M85A 2Q2UA 4YHHQ 4A3IG 4X64L 1X3FA 4QY7A 4GLXA 2K75A 2E5LL 4DR3Q 2AMCB 4C2MH 4R4TA 4C3HH 3CP0A 1XMQL 1N33Q 2JA8H 1EUJA 4HJ9A 4DR5Q 3PCOB 1HNZQ 4RG1A 4A93G 2MQHA 3UE0A 3ZJYC 4ALPA 4Y52H 3HOXG 4LF7L 2KCTA 1N36L 2Y0SE 4R4CA 2BH8A 1C7YA 1WI5A 3ER0A 3T1YL 1W2BA 1IBKL 2R92G 1PFSA 4JI6L 2PMZE 1PYSB 4B3TQ 4LF8L 3STBD 4DR1Q 1JJGA 2R93G 2JK8A 4GLAC 3KJOA 3BJUA 3PUYA 4A3MG 4LUZA 1PH9A 2UXDQ 1IYJB 3CW2C 4YY3L 4YWKA 1XNQQ 4HIKA 3GTLH 4HJAA 1N8RC 4YCUA 2QGQA 4MZ9A 1IBLQ 1XMOQ 3W5OA 4C3IH 3HOUG 1A0IA 2C35B 2KHJA 2N3SA 3I7FA 3K81C 4LFCQ 4R1JA 2L15A 3HOVH 3HOYG 3OYYA 5E7NA 4JI8L 1VS0A 1GKHA 3S15H 3TS0A 4HIMA 3CCEA 3EN2A 3E9IA 4OONA 2LXKA 4A3DG 4GOPB 2KBNA 3BU2A 1K3RA 4XIGS 2K14A 3PUZA 4JI1L 2B29A 2EQSA 1KRSA 3ULPA 1BBUA 3U58A 1CKNB 3L7ZC 4LFAQ 1KC8C 3PO2G 4LF9L 4JBJA 1AE2A 1HZCA 2Q2IA 3A74A 4LFBQ 1KIXA 4WJ3M 3I4OA 2K50A 3S1RH 3TRZA 3PIOA 1Q1BA 1N32L 2E2IH 1V9PA 1XPRA 5IE8A 1VQGA 2BH2A 4RMFA 1WOCA 5M3FH 2RHQB 1K0RA 4HIDA 2KENA 1JMCA 3GTKH 5IYCG 4GN3B 1FJGL 4JI4L 5FJ8H 3D0FA 4P74A 1ASZA 1X6OA 3RLOA 2VQFL 4DR1L 4YCVA 3CCLA 2N8NA 3F8TA 4IJHA 3KF8B 4LF5L 4YWMA 3GTQH 4GKKQ 4BY1H 3GO5A 2AWNA 4A3KG 1AE3A 4PG3A 1PH8A 2Z6KC 2NVTH 5M5WH 1XMOL 3FKIG 5JEAJ 3DLLA 2JA6H 2DUDA 2H5XA 2E2HH 3PSIA 3SGIA 4B3MQ 3DM3A 5AJ3L 3PO3H 1KL9A 3RN5A 3TS2A 1CSQA 1CKMA 4A3BG 4A3JG 1IBML 5EAYA 3CC7A 4A3LH 1TWHH 3K8AA 1Q46A 4JBWA 1Z47A 1MKHA 3BZKA 3RNUA 3HOZH 4TQUS 1CSPA 3GTMH 5LMNL 1FVIA 2V1CC 1SE8A 1Q7YC 2PI2A 2F4VQ 2ATWA 1JE5A 4OXPA 5M5YH 2ES2A 2ZM6Q 2A1AA 2RF4A 3OW2A 5C3EG 1VQOA 4LFAL 5IYDG 3NBHB 2OWOA 1TWFH 4IFDG 2UXBQ 1VQ4A 3TEHB 5IWAL 1QVFA 4JOIA 1HZ9A 4PZ6A 4DV1L 1YJ9A 1OXTA 4DV0Q 2LSSA 3MXNB 4DR7L 5C4XG 1AH9A 2NVYH 3CPFA 5HGQA 1HR0W 4A93H 4AH6A 4APVA 3HOXH 1VQNA 4PZ8A 1VQBA 4NB3A 4JYAL 1D7QA 1LM0A 4JG2A 4BBRH 3I4MG 3GDEA 1SFOH 5M5XH 5IP7G 3T1HL 2R92H 1VQ7A 1G51A 4IO9A 1Y1VG 1NBWA 2NZHA 1QVGA 3TQYA 5BR8Q 3W1BA 2VW9A 1HR0Q 1L1OB 1GM5A 2BA1A 2ZTEA 1L0WA 4DUYQ 4O2DA 1Y14B 3HKSA 2R7ZG 3J81j 5IY0A 2HQLA 2K52A 2OTJA 2VL6A 1N34L 4BY7H 3A5ZB 2DGYA 3JAMc 1WFQA 3HOUH 1P8LA 3B6YA 3KDFA 1PH1A 3I4NH 2PQAA 4UPAA 3CMAA 1Q8KA 4UY8C 1UE6A 1VQIA 4Y7NH 2JQOA 5M3MG 3H0GG 4A3DH 1I94Q 2HT1A 1RL2A 2CQOA 3HOWG 1JB7A 4DV6Q 1SN8A 1OXUA 1A63A 2JEBI 2R6GA 4A3EG 1VQDA 1D8LA 4DV3L 1C9OA 2ZJPA 1TWCH 1B8AA 2UUAQ 1GO3E 5FLXc 1BVSA 2R7DA 4DV0L 4K0KL 3F2CA 3AFPA 4IJLA 3ICEA 1T9HA 4X65L 2OQ0A 2XTIA 4JI2L 2BA0A 3S24A 5DLQE 5IYCH 4A3FG 2ZTDA 4LWCA 1N9WA 4LUVA 3CCVA 4L5TA
chains in the Genus database with same CATH superfamily
1YNJD 3WDNA 5I6WA 5CGKA 1FNUA 2Z9HA 1B50A 2JE6I 1CI3M 1W6KA 4R4IA 4YWLA 4C3HB 3GTGH 1TXYA 3M3YH 2JA8B 3A55A 1EYDA 3BDLA 4LF6Q 2EYOA 5IGBA 4MTNA 1XJVA 1X9NA 2CWAA 2L5TA 3J7A5 2WIIB 1R9TB 2K4KA 3BDCA 3E0JA 5LMUQ 5C3EH 1ASYA 5IT9E 2WB1B 2MO0A 4DR3L 4RH6A 2UUBQ 2RDFA 4A3GH 4C3IB 5IT9L 5C0XH 4DR5L 2XIWA 1F9QA 1YVCA 4N8X1 4OGQC 4B3SQ 3NHHA 3M4YA 4TRDA 1PTOF 3EROA 3HKZB 2NVXB 5C5MA 1J5EQ 1OXVA 2ZXRA 3UDFA 3V05A 1HUNA 4Z9CB 1TS4A 2R7ZH 2JA7H 3PF5A 4F87A 3S1MB 1SNOA 1Z6HA 2VY3A 5DAUA 2B2VC 5G3LD 3URYA 2XWJB 2OQKA 1F9SA 4DAYB 2F3IA 4GKJQ 5GQOA 4K8JA 3GTQB 4BA2I 1BKBA 5I4DA 2F52A 4DR6Q 1Q86C 2CWPA 3FHWA 4HCEA 2F3VA 3RLFA 3ZYYX 4B9WA 4C1NK 4HJ7A 1VF5C 3M9BA 5J39A 1EZ8A 1BDOA 1BBWA 1C4QA 1SMYC 2MP1A 1JB3A 2L9HA 5IGGA 2OF1A 4CKBA 2K5QA 3U50C 3M4OH 1E2VA 2F0KA 3A8JE 5FLXE 3IFDA 4X62Q 4KD4A 4P75A 1OXSC 4KHZA 2R61A 3A5UA 4PMBA 3BS1A 1TWFB 4KJOA 2PW5A 3L3OC 4L5RC 4N8FA 3S17B 5ELCA 4RA8A 3ULJA 3Q22A 3VR4A 3KDFB 3KJPA 1KNAA 2ZJQA 4BBSG 1XTDA 1EY8A 2I07B 3I70A 1SFOB 1TY0A 1YHBA 5GAEC 2KVMA 4M8AA 5C0XI 3LNNA 4BY1G 3H6MA 3PO2H 4GNXA 1KD1C 2IX1A 3L0OA 2I5HA 2NZOA 4R8NA 3QWNA 1VQCA 3HRZC 1NE3A 4KK7A 1HR0L 5BR8L 4X3KA 3Q0AA 4ULLA 5F2DA 2F0OA 1V1QA 1MJCA 3FPUB 3AYHB 4JCVE 3C46A 4ZRZA 2X6GA 2X69A 1TWGH 1STNA 4XTCS 4MN3A 4BBRG 1WTOA 2Y0SG 1WYDA 1MJEA 1EY9A 1FJGQ 4FO2A 4JI4Q 4NKLA 1X56A 2CW0D 1EQQA 3T53B 2K5VA 2QW7A 1TWAH 4IUTA 2EJMA 2EYLA 4DNTB 2EY6A 2M00A 2FMMA 2A68D 2UUAL 1KHIA 4LW1A 4PMCA 1KDAA 1ENCA 3K7AH 1IXRA 5TSSA 3HOVB 3UI2A 5HGTA 2HUGA 2B2UC 3AMUA 5E4XA 5AJ3Q 5FOBB 1L0XB 2IHEA 4DK6C 1IBMQ 1T5XD 2L1BA 3K5OA 4B08A 2F4VL 1LABA 1IW7D 1VQHA 2PNRC 3E3XA 3NELA 4DV2Q 3KF6B 2X6LA 2N49A 1PA6A 3R2IA 3CCRA 2XSCA 5IWAQ 3I2ZA 4HSPA 4DR7Q 4IFDJ 4R4OA 4BBSH 1HRJA 3H0GH 5EJWA 1Q1EA 3GTKB 1IZ6A 4L5SA 1VQPA 2UXCL 1KRTA 3HGBA 1KAWA 4GS3A 3T13A 1YHQA 4IUVA 5D3IB 1J6QA 1PRTF 4UDUC 4AYBE 4CBVA 4DXGA 1I4QA 4EGVA 1RJTA 1PH2A 2K32A 3FP9A 1IYVA 1EIFA 3MXUA 1QCBD 1WCMG 3K80C 4U673 1PHJA 1HH2P 4A3FH 4KJNA 4WJ4A 3NPPA 4OELB 4DV2L 5C44B 1LACA 2K5DA 5JAVA 3A54A 2LXJA 4DV3Q 4A3IB 1X65A 5IP9H 3S14H 5C4JH 3I55A 2E5LQ 3S1NB 4RCOA 1WTQA 2K28A 4K0KQ 1HJPA 2AWOA 2NVYB 4JK1C 1YJNA 4FF1A 1E7ZA 1UAPA 5M3FG 3ONAB 2KCNA 3K5NA 1FYCA 1L1OA 1HNWL 1STBA 1O78A 3BZCA 1BOSA 4L5QA 4MHEA 2HDMA 1YNJC 2LMCB 1M90C 2B63G 2SNSA 3MEFA 4QL5A 4HCSA 2YU9H 2VZAA 4EQPA 2NN6G 3CRKC 4JI7Q 4Y7NB 3RZOH 3UDXA 4XT1B 1Y8OB 4FF2A 1TS3A 4DR4L 1BUVT 2CHBD 2BDNA 1QNKA 2EVBA 1G6ZA 1X3FA 2K75A 4V190 2E5LL 1EEFD 4C3HH 3CP0A 4ZAIA 3D6CA 2QF7A 2JA8H 1HA5A 1EUJA 1HNZQ 2MQHA 3UE0A 3ZJYC 4ALPA 1IKMA 4LF7L 1EY6A 4K14A 3TP8A 1EL0A 1N36L 4R4CA 1LO5D 1WI5A 3T1YL 1IBKL 2J0TD 2K03A 4DR1Q 2R93G 3DWQA 4GLAC 1A6XA 1H9MA 1IYJB 4YY3L 1A15A 1RODA 4C3IH 3HOUG 1KABA 3K81C 2L15A 1SBBB 5E7NA 4JI8L 2AQ3B 3CHBD 1O80A 2K5WA 5ELDA 1K28A 4Q0FA 4U68A 5FKAC 3TS0A 2EY2A 1ZEQX 3EN2A 3CCEA 4GOPB 2KBNA 4YIJA 5I9PA 3BU2A 2ICIA 1QILA 3D6WA 2AQ1B 3QJYA 4ZUIA 4ID6A 5C3EB 3U58A 1KC8C 4LF9L 4JBJA 3A74A 3A7AB 2BDOA 3TBIB 1F2LA 1N32L 1V9PA 1UUPA 5M3FH 1D5MC 1F2MA 1K0RA 5C5LA 4HIDA 1TKWB 1U9RA 4IURA 2VUMH 4DR1L 3RLOA 4YCVA 1L0YB 3GTQH 4YWMA 1DZ1A 2R7ZB 1G2SA 5M5WH 3DLLA 3T51B 2H5XA 3PSIA 3RN5A 3TS2A 1CSQA 3W3AA 4A3BG 4A3JG 4R8IA 3DHQA 5A2QE 2K1BA 1CSPA 5LMNL 1FNVA 1JE5A 4OXPA 3U9SA 4IFDG 1LTBD 1TWFH 4KHVA 2UXBQ 1LLRD 4DV1L 1OXTA 1B9NA 3MXNB 4NW2A 4J1MA 3WOEA 1H9JA 3I4LA 5FO8B 4NB3A 4JW0A 3M4OB 1D7QA 4JG2A 3H3VC 1SFOH 4UHVA 1T5EA 1G51A 3SR1A 1CA6A 2A69D 2NZHA 1QVGA 3TQYA 2VW9A 1ESRA 3W1BA 2PZWA 4ZKCB 5IY0A 5L37A 1QWYA 3BZDB 1I3QB 5CORA 2DGYA 3JAMc 1WFQA 2PQEA 3HOUH 1PH1A 3I4NH 2F0QA 2PQAA 4UPAA 3CMAA 5JJZA 1GUNA 1UE6A 2L12A 2L55A 5LHY1 2ICEC 5BN4A 3HP3A 2V4DA 3P7JA 5EPJA 1D8LA 1U4LA 3BYYB 2CW0C 1C8CA 3EQLC 5FLXc 1BVSA 1WD0A 1CZGA 3I3CA 2NZ1D 3ICEA 2A68C 4X65L 1SXTA 2MGSA 2KECA 2BA0A 1PZJD 2F0EA 2QDLA 4EQNA 2EYFA 1B1ZA 4HSVA 1MGSA 1R4QB 4LWCA 1N9WA 2I46A 1CK1A 2RDHA 4L5TA 1BCPD 1BO0A 2HCIA 4K2LA 3PUXA 1H9RA 3ULLA 2JA5G 2PZUA 3AU7A 2K01A 4HMIA 4PZ7A 1DOMA 1J9OA 5CC4A 1RTOA 4DV5L 1GXDC 5K5PA 4R9WA 4JI0Q 1WTPA 1TWGB 3OTOQ 2QEJC 1CM9A 1IL2A 2ZJRA 2EY1A 4LK1C 4OO1H 3S2HH 3K0YA 5ELNA 1TWAB 3CCUA 4YHHL 4IQZA 3KBGA 3GTLB 1CHPD 1EWIA 4UP9A 4QCLA 2K04A 3MZ5A 4QB4A 2EIFA 1N33L 1YI2A 4LF4Q 4YCWA 3E0EA 5KRUA 3H94A 2CVRA 3E5SA 3CKIB 3H3VH 5T1IA 4C3JG 1B53A 2O4XA 3NTHA 1UEBA 1SE2A 5IYBH 4B3TL 3GTPH 3V2TA 1BR9A 1GUTA 1Q12A 1PV4A 5CV6A 5C6AA 2UXDL 3AFQA 2D0PA 2UU9Q 4KKSA 2WAQG 5J1ZA 3TN2A 4GN4B 4LFCL 2MNAA 1S72A 4DR2Q 3G4SA 5D14A 2NVQH 3CCSA 4FP5D 1RIPA 3OMCA 1PH6A 1SYDA 4BBSB 3H0GB 3PGZA 3OTOL 2D0OA 5E3FA 3RR5A 3P20A 4DK3C 1MI2A 4GOPC 1Y1WH 1M1KC 5C44H 1AZQA 2B2YC 5EPKA 1WVLA 4A3IH 5FO9B 2WKDA 4QF4A 4IOAA 5LL6S 2F0GA 3S1NH 4LF4L 1B4OA 3G48A 4GZYC 4JV5Q 4HMJA 1FL0A 1IYUA 1TWHB 3AQQA 2ENBA 1HXYD 3K0XA 4HIOA 2G9HD 4GKKL 2IW3A 1Z9FA 3GTOH 4XQNA 4F8MA 1QJOA 1JJ2A 4X64Q 3S14B 1SJED 2EXDA 4OO1I 1B2TA 4WJWA 5G3LF 2F0LA 2MPMA 1LV9A 4NPSA 4P2CB 3U4ZA 2Y0SB 3CCQA 1K8GA 2PI2E 4LF8Q 2ZM6L 3DWAA 3H3VI 2AKWB 3JAMi 2A8VA 4NDXA 3MXGA 1G291 1PYBA 2YU9B 3X3NA 3PO3G 4DV7Q 1Q82C 4K6DA 3RZOB 1UWVA 5KNDA 1YNND 2IT1A 3NWTA 4IPHA 3HOZG 4DXFA 3QIAA 4PNYA 4DUYL 5ISRA 4QGUA 4XXEA 1LUZA 4RGNA 2Q2HA 2D2CC 4IPDA 2GVAA 1PH3A 4AIMA 4CJ2C 3I90A 2A19A 4OEMB 1VQAA 1HZAA 1FGBD 1HPCA 5BN5A 2IWHA 2NTTA 1I94L 4KLKA 1V1PB 1D6EC 3K5LA 1H9SA 4HN7A 2IJ0A 2KUMA 2ZTCA 1A8VA 4K5VA 5CBAE 4LF5Q 1DCZA 5IYDH 2O5IC 2XN9C 2ALYB 3DMUA 5NUCA 4BY7G 1RD9D 2B2VA 1TT2A 1UE7A 2Q8TA 4DV7L 1V43A 1SROA 2Z8LA 4IN3A 3NQIA 1EWHA 2F0PA 2OCEA 4S3SA 4JI5Q 1CKOA 1SE4A 3TMEA 3CXCA 3MC0B 1CKNA 4IUNA 1VQKA 2O5JC 5IGCA 1PFMA 4DPGA 1LTTD 1TS2A 1NR4A 3A8KE 1ENFA 4DN4M 3DEOA 4LF6L 4HTHA 3N6RA 1XXGA 5M3FB 1QUQB 3ERSX 3E9HA 1EYAA 2RBMA 4KN4C 3T1HQ 3HOWH 2ZT9C 3JAME 2VUMB 3KF8A 1NCVA 3PIPA 1XPUA 5LMUL 2WFWA 2WB1E 1HZBA 2WKCA 1UEAB 3JAML 1L2FA 2QCPX 1Y69U 2BOSA 4EX5A 5M5WB 5I9OA 1N34Q 1TY2A 4GLVB 5C3WA 4F88A 1O7LA 1F77A 2SNMA 2HCCA 4ZUJA 4X6AH 1X3EA 4B3SL 1I4GA 3HKZE 4JI5L 4Q5VA 1J5EL 2XVSA 3NBHA 5FLXL 1PVOA 4JPBW 3M7NA 5BN3A 1EIGA 3AEVA 3M4PA 1I3QH 3NXWA 1MIUA 4F7XA 4O0AA 1EY7A 4CKCA 4RKBA 4JI2Q 4XQQA 5C4ZA 5EBDA 4GKJL 5EQ0A 1ILPA 5FJ8G 2HHHQ 2PMZB 3SHLA 2PYKA 3UDGA 2R93B 2P5ZX 2EXZA 3G71A 4DR6L 3TSSA 3HOUB 1B7YB 3KLSA 3I4NB 4CDCC 4XQJA 3ND9A 4DNRB 4JVZA 3J80i 3CQZH 2DY7A 1F9RA 4BWGB 4X62L 4JC0A 2HIVA 4QUCA 4JI1Q 5GAHC 2CKZB 1TU2B 2RHSB 3PUWA 4FXDA 1EZ6A 2KHSA 1A3UA 5DM63 1LTGD 3BDOA 1JCKB 1MBYA 1ML0D 2B2UA 4C2MH 1S4ZA 3PMFA 4A93G 3HOXG 2KCTA 1HQMC 2KEEA 1SE3A 1PFSA 3VYUA 1CQVA 2PMZE 3DM1A 3STBD 2NB0A 1STYA 2EYHA 2M2LA 3KJOA 4A3MG 4LUZA 1KTKA 4YWKA 1XNQQ 4HIKA 3GTLH 1VMPA 1KDCA 4YCUA 1IBLQ 3W5OA 1A0IA 3HOYG 2WINB 4R1JA 4A3JB 4DK1A 1A2TA 1WTXA 3E9IA 4LAAA 2LXKA 4OONA 1K3RA 2F0SA 3D4DA 2K14A 3EVQA 5EGTA 3PUZA 3MWYW 4JI1L 3S2HB 1AP0A 2B29A 1DD2A 1ENAA 1KRSA 1EWCA 4IZ8A 4LFAQ 4OL7A 2Q2IA 4LFBQ 1KLUD 3I4OA 1NUCA 3S1RH 3TRZA 1PDQA 4I7AA 4IUQA 1QOHA 3SEBA 2E2IH 2KA7A 1XPRA 1ILQA 5IE8A 5E4WC 2BH2A 5DNFA 5JOBA 3OHXC 3V96A 1BXTA 2FMCA 5DEHA 4RAUC 1FJGL 4JI4L 3GTPB 5FJ8H 1ASZA 4JI3Q 1X6OA 3QOJA 4K8IA 4WORA 3CCLA 1TIID 5CV5A 4RKLA 5T1GA 1LT3D 4BY1H 2AWNA 4A3KG 1AE3A 4PG3A 1WTWA 1PH8A 2Z6KC 2N55A 2EE1A 3FKIG 5JEAJ 3J80E 4B3MQ 1W6JA 5AJ3L 2NVQB 2HQEA 1JE4A 2EDGA 1IBML 2E76C 4LMQD 5EAYA 3CC7A 1TWHH 4DAYA 3BZKA 3RNUA 4TQUS 1IHZA 3GTMH 2V1CC 1Y1WB 1D5XC 2IPKD 2ES2A 2A1AA 2RF4A 1KAAA 4LFAL 1STHA 2K05A 1KDBA 4OHJA 5IWAL 4RCNA 1ET6A 2SEBD 1HZ9A 4PZ6A 1S5BD 1YJ9A 3IAYA 1QG7A 4DR7L 3CPFA 3IL8A 1HR0W 4A93H 4AH6A 1EYCA 3HOXH 4ODGA 1XWEA 3D8GA 4BBRH 2JP1A 5IP7G 1Y1VG 1NBWA 1YNNC 1DJRD 3GTOB 1E0BA 4O2DA 3FDTA 5LL6X 1Y14B 1TR5A 2HQLA 4ZLTF 3KDFA 3VA5A 1JQYD 1EU3A 3R93A 1OO9B 1Q8KA 2F0VA 1VQIA 2JQOA 1EY5A 5I2YA 5M3MG 4RGMA 5HURA 3D4RA 3A7LA 4FVMA 1SSOA 4DV6Q 1TQOA 5I6YA 1GOZA 4DGZA 2R6GA 4X3SA 3K58A 4DV3L 1C9OA 1TWCH 1I6HB 4K0KL 2R7DA 2RCFA 2MUYA 3F2CA 2TMPA 3AFPA 3QR8A 4EVOA 4O1NA 1PZKD 1HTLD 2KJXA 2KEDA 2OQ0A 4C3JB 1M4VA 3S24A 4E6IA 2ZTDA 3CCVA 5IOCA 2R3ZA 2QKIC 3EIVA 1EQRA 2EYPA 3KUPA 3OIPA 2K5HA 2AHOB 3CCMA 1XNRQ 3FEWX 1EEID 5GROA 3F2DA 4KHPQ 4JI7L 1OTCA 3KK7A 2E74C 1WCMH 5KNBA 4DUZQ 1YEZA 4B3RQ 1HNXQ 2MFIA 2OT2A 2A73B 3CRLC 3KOJA 4DAVA 4DV6L 3SK5A 4ZQ3A 3DWPA 4IPGA 1EYGA 1VQFA 1S5FD 4A4IA 4DK0A 1HNZL 2TSSA 1NMGA 2JJQA 1VQEA 3S15B 1C48A 4L6TB 5COYA 1BCPF 5IP7H 1HUMA 4J8QA 4V0BA 1Y1VH 3KF6A 5C4HA 5J3BA 4X66Q 2Q8RE 2N88A 1LYLA 3PIO3 3WWVA 4BXXG 4QIWB 4EQ5A 4KKUA 2B63H 3NEMA 4A76A 1VF7A 1BNZA 2B8FA 3CF5A 2NN6H 1JWUD 1YZ6A 5KIXA 4B3RL 2DY8A 1IKLA 1S5CD 3LWEA 3GP7A 2D9UA 5C0XJ 1B3QA 3HOWB 1MD2D 1NTGA 3Q24A 5A2QL 2FJ2A 3TDQA 2ASBA 2NVTB 4AYBG 2VNUD 1JR0D 3KLWA 2E2HB 1ZKOA 2DN8A 1VQ8A 3PO3B 4DAMA 3CAMA 3RLNA 1RDPD 3R2TA 1XPOA 3HOZB 5IIFA 5EKKA 5GAGC 3HZXA 3IFTA 1JC7A 4KI0A 5JEAG 2R93H 3GV6A 2UUCQ 3G6EA 4AQYQ 2OEOA 2QDBA 3BVMA 3GD7A 1SYFA 4P72A 2ZXOA 1VQJA 2B8GA 1XMQQ 2KCMA 3HG9A 4A3CG 2CQAA 2B2WC 1UNSA 1YNXA 5CV8A 1X55A 4G57A 1RKNA 3F2UA 3EBEA 4JI6Q 2JA6G 4NXMQ 1YHAA 2UXBL 1PZID 3AB9A 3S16H 2YTXA 1YBYA 1DONA 2HIXA 1PFNA 1YITA 2E2JH 3J81i 1KQSA 4CHTB 1VQLA 1HFNA 3L9AX 3Q6SA 4K2KA 2I0QA 4A3LG 3CQZB 2B2TC 5GADC 1HHVA 3UDIA 4RHRA 3JC66 2OTLA 3PUVA 4MNOA 3BVZA 3VYRA 2N78A 2NN6I 4POFA 1IW7C 2CH4W 4BXXH 3FVQA 4KV6A 2RSNA 5CV4A 2F0JA 1U4PA 4C2MB 2XGTA 1Q90A 2R7FA 1NAPA 1GUSA 3W2DA 2WACA 4A3BH 4A3JH 1B44D 4UP8A 3S1QH 2Q2TA 4KN7C 2WP8J 3K59A 5JJLA 1XYIA 2YV5A 2HD3A 4ZYSA 3LWUA 4NXML 2VQFQ 2I5LX 4IFDH 5ELOA 1PLFA 5K36G 1B70B 4DAPA 1STGA 4LJZC 4TVAB 3RUZA 5LMNW 3SXHA 2F1MA 3D3RA 3NTKA 3TREA 1JORA 2CCZA 3A8IE 2JN4A 1HQRD 4GOPA 3CC4A 1JJCB 4QQBX 3E6ZX 3C3LA 2B2YA 1X3GA 4HJ8A 4DU9A 5CBEE 1HA6A 1A62A 3OW7A 2Z4IA 2MHVA 1QZGA 2WV6D 1GVPA 1ZYRD 3S1RB 3EJIA 4RGOS 3CD6A 1UE1A 4FF4A 4JI0L 3X3MA 2E2IB 4A3CH 3O13A 3RZDH 2M9VA 3CMEA 3OOCA 2LKVA 4JYAQ 1CTMA 1SRUA 1WTVA 1F2YA 1QNUA 1EQVA 3PV0A 4H0LC 1BCPB 4BY1B 3Q23A 1A3VA 4EQOA 2IX0A 3J81E 3S2DH 2PO4A 3CU7A 1EIYB 4POGA 1EFWA 2F0FA 4RWSC 1NY4A 2BCOA 1WTRA 2Z6BA 5A35A 5EKLA 2EJFC 3NBIA 4JBMA 1NMFA 1S3OA 3PIP3 1FGUA 1JT8A 2KHIA 3GTMB 1AEXA 3C2PA 3OMGA 5KGUA 2LFNA 1JICA 3SK4A 1PH4A 2UU9L 3MFGA 4KKTA 2JA5H 3KYHC 3S9WA 5E1FA 1I4HA 4WFN3 1SLJA 2A74C 3J7AV 1LT6D 2RCNA 3MXNA 1K73C 3FMCA 4A3GG 4DR2L 1PH5A 5C0XG 1I4XA 5CYUA 2FXQA 3F2BA 4A93B 1RF2D 4IFDI 1VQ9A 1E1OA 3HOXB 1AZPA 3K57A 4XYOA 4BBRB 4BA1I 1E1TA 4CDFC 2J4XA 1UE5A 3J80c 4A3MB 4HAEA 1E22A 4BS9A 5FK9C 4IUPA 2JA7G 2B3GA 3I73A 3VR2A 4GNXB 1I6HH 1EY4A 1XX8A 3FPPA 3HOYB 4JOIC 4JV5L 1Q3LA 4P73A 4X3TA 4C3JH 1CZWA 2F0WA 1A3TA 3UE1A 2E8GA 2Z4HA 1E2WA 1ICFB 1E3PA 2XNAC 2B39A 1EY0A 1CHQD 1TWCB 2F4IA 4X64L 4QY7A 4DR3Q 2AMCB 2IX3A 4WRDA 4R4TA 2K6AA 4XYQA 4HJ9A 4DR5Q 1AW7A 2FFKB 2Y0SE 2BH8A 1C7YA 3ER0A 2R92G 4LF8L 1DYQA 2G9DA 3BYTB 1K83B 2PCFB 3BJUA 1PH9A 2E2DC 3OWEB 4KTAA 4A3KB 3FKIB 4HEDA 1PMRA 4MZ9A 2KHJA 2DJGC 1GKHA 1WCMB 3S15H 4A3DG 4XIGS 1G91A 5JPMC 3MVVA 1BBXC 2EYJA 1MSHA 2A5HA 3SK8A 2EQSA 1I50B 3PO2G 4ME5A 1AE2A 1HZCA 3NK9A 4TKOB 4RFBA 1Y8NB 1FD7D 1WOCA 2RHQB 1JMCA 4GN3B 1Y1VB 3D0FA 3GTJB 1K3BC 1G6PA 4LF5L 3F8TA 4IJHA 3T4AC 1R4PB 3MEHA 1RCVD 2A69C 2VB3X 3TZUA 4XT3B 1AFPA 3K5MA 2B63B 2NVTH 1CQFA 1QE6A 2DUDA 2E2HH 1JOQA 1F2ZA 2F0IA 2K33A 3DM3A 3EA6A 3PO3H 1CKMA 2LS01 4KMUC 5M3MB 3K8AA 1Q46A 1Z47A 3R3OA 3HOZH 1CT1D 2L4NA 3RMHA 1SE8A 1Q7YC 2PI2A 2ATWA 1GJXA 5M5YH 3J7YW 1VQOA 4M1UB 1Y8PB 2PW7A 2G5DA 3A56A 1EU4A 4KY5A 3VR6A 4L8JA 5C4XG 4CDDC 5HGQA 1EQTA 2H1EA 1IL8A 5D65A 4PZ8A 1VQBA 3NQTA 3T56B 2UUBL 3I4MG 3NTIA 5M5XH 3T1HL 2R92H 2AUJD 1HR0Q 5BR8Q 1J8IA 3BG3A 1L1OB 2BA1A 3H09A 1BCPC 1O7YA 3J81j 2VL6A 3OWFA 4PV1C 3TP5A 1N34L 4BY7H 3A5ZB 1HTPA 4PQXA 2EJGC 2JXMB 4UY8C 1ZXTA 3H91A 3H0GG 4A3DH 4K5WA 2OXPA 1JB7A 3OPOA 1GUWA 2A6HD 1VQDA 4H13C 4A3EG 5FO7B 5IGDA 2F03A 3MXPA 4O42A 3S16B 1CA5A 2UUAQ 1E2ZA 4G7ZC 2E2JB 1SNDA 1CFMA 1T9HA 3DUZA 1V8QA 2A6ED 5EKIA 4JI2L 1TVXA 4A3FG 3I91A 2F0UA 2O2LD 3WOFA 2E75C 2F4VQ 2HHHL 1MSGA 4C1NI 3I56A 3G7LA 1H95A 2AUKA 1PTOD 4ZKBB 4LUOA 4R4QA 1QZHA 1CUKA 5IP9G 1H9KA 3KLRA 3M4QA 4GNXC 2Z0SA 5JVH3 2PZTA 1ZYRC 3HEJA 3GV3A 4A3BB 2RVLA 1V1PA 3S1QB 1YJWA 1DGSA 1SNCA 2BE5D 3R8BA 3VYTA 1SMXA 2RKSA 1SNMA 2IY5B 2GVBA 1K8MA 2UXCQ 4CGYB 3ERQA 4NXNQ 2Z6KA 1I6VC 3OIQA 4N9TA 2NTSA 4AYBB 5C4XH 5IGFA 1JWMD 2HDLA 3M7GA 3NENA 4DA2A 2XRSD 3VA7A 3I4MH 1LTAD 3L2PA 5CMDA 1OXXK 2JEAI 2F0HA 1KXLA 2JSOA 3KFUA 3J7ZC 2VS1A 4FDBA 1DOKA 5JJKA 4H02A 4H44C 1XNQL 3K7UC 1NR2A 1HFGA 4KY7A 2MO1A 1IBLL 4HR7B 3OSOA 4DKAC 2K5NA 4C3HG 1K9MC 1SAPA 2JA8G 1FR3A 1PYWD 5H1SE 1QUQA 3RZDB 2AQ2B 1C0AA 1VQ6A 3J80L 3IRBA 2QILA 4NP5A 2H4OA 4DNIA 2JA6B 3P1HA 4OWTB 4X3UA 3SE0A 1WTHA 4A75A 2C9OA 4NXNL 4A3EH 1HNWQ 4CDEC 3S2DB 1PTOB 2WB1G 4LFBL 5EBCA 5EPLA 4OWWB 3I72A 5AFWA 2Q8IB 4C3IG 5KYIA 2LY7A 2EOTA 5JJIA 4I65A 1X3QA 1F9PA 5FLMG 1JOOA 4PMWA 2K7VA 5CR3A 4J6HA 4JI3L 1ICWA 3HKZG 1ESFA 4A3MH 4DR4Q 4IPCA 2J7ZA 1II3A 2JA5B 1QVCA 1SR3A 4B3ML 3HOYH 3SVMA 1GD7A 4UP7A 2PQAB 1LTSD 3J81c 1KLGD 1YIJA 4LF7Q 2NYZD 1Q81C 1N36Q 4DV4Q 1D1KA 3T1YQ 1IBKQ 2SDFA 5J22A 2VUMG 1E24A 1AN8A 2MJ8A 2VB2X 2YYZA 3A0JA 3W1GA 5ELEA 3HFZB 1P16A 5KNCA 4YY3Q 4IOCA 2ZXPA 1EFID 3MFYA 2YTYA 4ZCKA 3H15A 4JI8Q 4QUFA 4J15A 1V1OA 2IHFA 4NMZA 5CV7A 3T16A 1K8AC 2JA9A 1PH7A 1X54A 3BVGA 1VQMA 1GHKA 3QOLA 1K83H 1L1OC 4HJ5A 2WAQB 2L0CA 4LF9Q 4A3KH 1FNWA 2YTVA 3FKIH 4OX9Q 3DEPA 3I8ZA 1SEBD 4UAIA 5D3DA 2D62A 1N32Q 3RD4A 3KBXA 5C3XA 1O7IA 3VDYA 3D31A 4QJFA 4DV4L 2GN5A 1R9TH 1O7ZA 1SYBA 3F1ZA 3MA2B 2VQEQ 2EY5A 1B9MA 1I50H 1HCZA 4LNQA 1GUOA 3GTGB 1PRTD 4JBKA 3M3YB 1EOTA 3SDZA 1LT4D 1S40A 3I4NG 4OWXB 4G4KA 1NSNS 2XRQD 4GN5A 1W3SA 1VQ5A 5FLMH 2NUCA 3LGJA 5LMNQ 1Z7TA 2NVXH 3GTJH 1U4MA 3U4VA 2WAQE 1NJIC 2JYOA 3G6JB 1VMCA 4C56C 5I2XA 5HY6A 1GUGA 1XNRL 4OX9L 4DV1Q 2QA4A 4A3GB 4FNFA 3S1MH 3NUCA 2NBFA 4KHPL 1G8ZD 3RN2A 2DNCA 1DOLA 4CKEA 2D5DA 2XWBB 4DUZL 5M3MH 1HNXL 3NSWA 2KOLA 2VQEL 3KLSX 1JOKA 2JA7B 1RTNA 1VCIA 4RHSA 3HOVG 3Q8DA 2B2WA 1B3AA 1SDFA 1U0LA 5IT9c 1S5ED 3CPWA 2FINB 4OO1G 4X66L 1LTLA 2FHTA 3CCJA 5M5YB 2EZVA 3TP6A 1SNPA 4QIWE 3ITPA 3MAQA 2RSOA 2F0NA 4P71A 2DJFC 5IODA 3S17H 4B9XA 2A6HC 1I5FA 2I5MX 1PRTB 1STAA 2IL8A 2KCCA 2B2TA 5JVG3 2Z1CA 4X65Q 2QEXA 1BF4A 2L11A 5M9OA 3CC2A 2CFMA 5M5XB 2R92B 3SK6A 4ZK9B 2A6EC 3K6OA 5IYBG 1WJJA 2ID0A 3QB3A 1SJHD 4CJ1B 3PF4A 1MHWC 1TS5A 4FXGC 3STBC 1U5KA 1SMYD 1PTOC 3TP7A 4BY7B 1D1IA 3TZDA 4DV5Q 1A2UA 3GQBA 4RGTA 1EOVA 2PPBC 3NWSA 4ME3A 1VDZA 4A3DB 5DM73 3D4WA 4I7ZC 1Y1WG 4DFAA 5C44G 2BE5C 1DM0B 1GHJA 2PNHA 2UUCL 1G2TA 4AQYL 3M85A 2Q2UA 3PO2B 3P75A 1JWSD 4YHHQ 4A3IG 4GLXA 1D5ZC 1XMQL 1N33Q 1PFBA 3PCOB 4RG1A 3U9OA 4Y52H 3QO2A 3IKJA 1W2BA 2C5CA 4JI6L 1PYSB 4B3TQ 4G7OC 1JJGA 1H9SB 2JK8A 1S5DD 3PUYA 4FYDA 3MHBA 1WD1A 2UXDQ 3CW2C 4HJAA 1SNQA 2SOBA 2QGQA 4KD3A 1N8RC 2CH4A 3PQIA 1XMOQ 3I7FA 2C35B 2N3SA 4LFCQ 3HOVH 4MTKA 3OYYA 2RDGA 3J7AF 1VS0A 1SYGA 3QG1A 4HIMA 2KQ3A 4XDXA 1D2BA 1M8AA 4FF3A 2F0MA 2RA4A 5JEAH 3ULPA 4TSSA 1BBUA 1CKNB 1BQQT 3L7ZC 4WJ3M 2VXWA 1KIXA 2F0DA 2K50A 3PIOA 4OIKA 1K8OA 3K7AB 5C4XB 1Q1BA 5ELFA 3MTSA 1STEA 2GA4B 1VQGA 4H7BA 4RMFA 5CV9A 3I4MB 2KENA 3GTKH 5IYCG 4K6LA 2DNEA 2RQXA 2JA6H 4P74A 2VQFL 5IGEA 4GKKQ 2N8NA 1EIHA 3KF8B 2F3WA 5KEEA 2EYMA 3GO5A 1PTOH 1XMOL 1RHPA 3J81L 3SGIA 1KL9A 1LTID 4G7HC 5ELBA 4A3LH 1K0SA 4FXKC 4JBWA 1MKHA 1FVIA 4ILWA 3LX0A 1I4PA 1XTCD 3HS0C 2ZM6Q 4A3EB 1U4RA 3OW2A 5C3EG 5IYDG 3NBHB 5JPNC 2OWOA 1ET9A 3NP8A 1VQ4A 3TEHB 1QVFA 3C1FA 4JOIA 1LTRD 4DV0Q 2LSSA 1AH9A 2NVYH 4ABNA 2EPBA 3VR3A 4APVA 1VQNA 3FRPB 4JYAL 3VYSA 1LM0A 4KY6A 3GDEA 4A3FB 1Q8IA 1LT5D 1SYEA 1VQ7A 4IO9A 4DF7A 1X3PA 1GM5A 2ZTEA 1L0WA 3N52A 4DUYQ 2NWGA 5K36H 3HKSA 2R7ZG 4L63B 2OTJA 2K52A 5C4JB 1PXUA 4IUUA 1P8LA 3B6YA 5KYLA 3DXJC 1QB5D 1ONLA 2F0TA 4Y7NH 3ND8A 4K5XA 1I94Q 2HT1A 1RL2A 2CQOA 3HOWG 3NE5B 1SN8A 1OXUA 1A63A 2JEBI 1NNXA 1X32A 3EFXD 2ZJPA 1SYCA 4IALA 1I4RA 1DXMA 1B8AA 4OIJA 1GO3E 4DV0L 4N9PA 4IJLA 3VR5A 4CJ0B 1PRTC 2XTIA 5DLQE 1KNEA 5IYCH 4QMGA 4MIUA 3C1EA 4LUVA
chains in the Genus database with same CATH topology
2HHHL 3EIVA 3I56A 1EQRA 1H95A 3PUXA 4LUOA 3ULLA 2JE6I 2JA5G 4R4QA 2K5HA 1CUKA 1QZHA 5IP9G 4PZ7A 4R4IA 4YWLA 2AHOB 3CCMA 1XNRQ 3GTGH 3M4QA 1TXYA 4GNXC 2Z0SA 3M3YH 5GROA 3F2DA 4KHPQ 4DV5L 4LF6Q 4JI0Q 4JI7L 1OTCA 1WCMH 4MTNA 1XJVA 4DUZQ 1X9NA 2CWAA 1YEZA 4B3RQ 1HNXQ 3OTOQ 1DGSA 1YJWA 3J7A5 2MFIA 1IL2A 2K4KA 3KOJA 2ZJRA 1SMXA 4DV6L 2IY5B 2GVBA 3S2HH 2UXCQ 4IPGA 5ELNA 1EYGA 5LMUQ 5C3EH 3CCUA 4YHHL 2Z6KA 1ASYA 4NXNQ 2MO0A 1VQFA 4DR3L 1EWIA 4UP9A 2UUBQ 4A4IA 4A3GH 1N33L 2EIFA 5C4XH 1YI2A 4DR5L 1HNZL 4LF4Q 4YCWA 1NMGA 2JJQA 1VQEA 3E0EA 1YVCA 3H3VH 3NENA 3I4MH 5IP7H 4B3SQ 3L2PA 2JEAI 1OXXK 4B3TL 1UEBA 5IYBH 3GTPH 1Y1VH 3KF6A 5J3BA 1J5EQ 1OXVA 1Q12A 1PV4A 3UDFA 4X66Q 3KFUA 1KXLA 3J7ZC 2VS1A 4FDBA 2UXDL 3AFQA 2D0PA 1LYLA 2UU9Q 4H02A 5JJKA 1XNQL 3WWVA 2WAQG 3K7UC 4BXXG 4EQ5A 2R7ZH 2JA7H 2B63H 2MO1A 3NEMA 4A76A 1IBLL 4GN4B 3PF5A 4DKAC 2K5NA 4JI3Q 4LFCL 1K9MC 2MNAA 1S72A 4DR2Q 2JA8G 3G4SA 2VY3A 2NVQH 5H1SE 3CCSA 3CF5A 1PH6A 1QUQA 1RIPA 1C0AA 1YZ6A 1VQ6A 3PGZA 4B3RL 3OTOL 3IRBA 2D0OA 2OQKA 4DAYB 2F3IA 5C0XJ 4GKJQ 3RR5A 4DK3C 4GOPC 5GQOA 4DNIA 1Y1WH 4OWTB 1M1KC 1NTGA 5C44H 4A75A 4BA2I 4A3EH 4NXNL 1HNWQ 1BKBA 4A3IH 2F52A 2WB1G 2ASBA 4IOAA 4LFBL 4DR6Q 1Q86C 2CWPA 3FHWA 3RLFA 4HJ7A 2UUBL 3S1NH 3M9BA 4AYBG 4OWWB 2VNUD 3KLWA 4LF4L 1BBWA 1VQ8A 3G48A 4DAMA 3CAMA 4JV5Q 3RLNA 5JJIA 1FL0A 3U50C 1XPOA 3M4OH 3AQQA 5FLMG 3K0XA 5GAGC 4PMWA 4X62Q 4HIOA 4JI3L 3HKZG 4GKKL 4KI0A 1OXSC 4KHZA 4P75A 1Z9FA 5JEAG 3A5UA 3GTOH 2R93H 4A3MH 4DR4Q 2UUCQ 4IPCA 3G6EA 4AQYQ 1JJ2A 3GD7A 4X64Q 4L5RC 1QVCA 1SR3A 4P72A 2EXDA 3ULJA 4OO1I 1VQJA 4B3ML 3HOYH 1XMQQ 2KCMA 3KDFB 1GD7A 4UP7A 4A3CG 2PQAB 3KJPA 3J81c 2ZJQA 4BBSG 1XTDA 1YIJA 1YNXA 4LF7Q 1X55A 1Q81C 4NPSA 1YHBA 5GAEC 1N36Q 4DV4Q 3U4ZA 3T1YQ 3CCQA 1K8GA 5C0XI 1IBKQ 2PI2E 3EBEA 4JI6Q 2JA6G 2VUMG 4LF8Q 4NXMQ 2ZM6L 1YHAA 1E24A 3H3VI 2YYZA 2AKWB 3A0JA 4BY1G 3W1GA 3JAMi 3HFZB 1P16A 3PO2H 4YY3Q 2UXBL 2A8VA 4GNXA 3S16H 4IOCA 2YTXA 1KD1C 1YBYA 2IX1A 2HIXA 3L0OA 2I5HA 2NZOA 1G291 2YTYA 1PYBA 1YITA 3J81i 2E2JH 3H15A 1KQSA 1VQLA 3PO3G 4DV7Q 1Q82C 1VQCA 4JI8Q 1UWVA 2I0QA 4J15A 4A3LG 2IHFA 2IT1A 5GADC 1K8AC 1NE3A 4IPHA 3UDIA 3JC66 3HOZG 2OTLA 2JA9A 1PH7A 1X54A 3PUVA 4MNOA 1VQMA 1HR0L 2N78A 5BR8L 2NN6I 4POFA 1K83H 4DUYL 1L1OC 4QGUA 1LUZA 4HJ5A 2Q2HA 4BXXH 1V1QA 4A3KH 4LF9Q 4IPDA 1MJCA 2GVAA 1PH3A 4AIMA 2XGTA 2YTVA 3AYHB 3FKIH 4JCVE 2A19A 4OX9Q 2R7FA 1VQAA 1HZAA 2D62A 1N32Q 2VUMH 4A3BH 4A3JH 4UP8A 1O7IA 1TWGH 3VDYA 4XTCS 3D31A 4QJFA 4KLKA 4BBRG 1I94L 2WP8J 4DV4L 2Q2TA 3S1QH 5JJLA 2GN5A 1WYDA 2Y0SG 2YV5A 1R9TH 1MJEA 1FJGQ 4JI4Q 4NXML 1X56A 2ZTCA 3F1ZA 1A8VA 2VQEQ 2VQFQ 1EQQA 4LF5Q 2K5VA 1TWAH 2I5LX 5ELOA 1I50H 5IYDH 5K36G 1B70B 2UUAL 2ALYB 1KHIA 4LW1A 4LNQA 4BY7G 4JBKA 3K7AH 1IXRA 4TVAB 5LMNW 1UE7A 1S40A 3I4NG 3TREA 4DV7L 1V43A 1SROA 4OWXB 5AJ3Q 2CCZA 4GN5A 2IHEA 4DK6C 1W3SA 1IBMQ 4GOPA 1VQ5A 3CC4A 2OCEA 1JJCB 4QQBX 5FLMH 4JI5Q 1CKOA 3LGJA 2F4VL 5LMNQ 1X3GA 4HJ8A 1VQHA 2NVXH 3GTJH 3CXCA 1A62A 3NELA 4DV2Q 3KF6B 1CKNA 2N49A 3U4VA 2WAQE 1PA6A 1NJIC 1VQKA 1QZGA 4DPGA 3CCRA 5HY6A 1GVPA 1XNRL 5IWAQ 3I2ZA 4OX9L 4DV1Q 2QA4A 3S1MH 3CD6A 4KHPL 4DR7Q 4LF6L 1UE1A 4IFDJ 3RN2A 4JI0L 4A3CH 4R4OA 3RZDH 3CMEA 4BBSH 4DUZL 1QUQB 5M3MH 3ERSX 3H0GH 1HNXL 3E9HA 4JYAQ 1Q1EA 1SRUA 3T1HQ 3HOWH 1IZ6A 4L5SA 1VQPA 2UXCL 1KRTA 2VQEL 1KAWA 3PV0A 3PIPA 4GS3A 5LMUL 1YHQA 1XPUA 2WFWA 2WB1E 1HZBA 1J6QA 2IX0A 1G6PA 3S2DH 4AYBE 1L2FA 4EX5A 1VCIA 1N34Q 1EFWA 1EIYB 1PH2A 4POGA 1NY4A 3HOVG 4GLVB 3Q8DA 3FP9A 1U0LA 1EIFA 5IT9c 1WCMG 3K80C 3CPWA 4JBMA 1NMFA 1S3OA 1X3EA 1PHJA 4X6AH 1HH2P 4B3SL 1FGUA 4A3FH 2KHIA 3HKZE 4JI5L 4WJ4A 1JT8A 1J5EL 4DV2L 4OO1G 4X66L 1LTLA 3CCJA 1PH4A 2UU9L 4QIWE 2LXJA 4DV3Q 1PVOA 2JA5H 1X65A 3KYHC 3M7NA 4P71A 5IP9H 3S17H 3S14H 1SLJA 5C4JH 3I55A 2E5LQ 2RCNA 3AEVA 3M4PA 1I3QH 1K73C 1MIUA 4A3GG 4K0KQ 1I5FA 1HJPA 2AWOA 2I5MX 5C0XG 4DR2L 1PH5A 2FXQA 3F2BA 4O0AA 4IFDI 1YJNA 1VQ9A 4X65Q 1E1OA 2QEXA 1E7ZA 3CC2A 5M3FG 4JI2Q 4BA1I 2CFMA 4GKJL 1E1TA 5IYBG 1UE5A 1WJJA 5FJ8G 1L1OA 2ID0A 3J80c 2HHHQ 1HNWL 3UDGA 3BZCA 3PF4A 1E22A 4L5QA 3G71A 3STBC 1U5KA 4DR6L 1M90C 2JA7G 2B63G 2B3GA 4GNXB 1I6HH 3MEFA 4QL5A 1B7YB 2YU9H 2VZAA 4JOIC 4JV5L 4P73A 4DV5Q 2NN6G 4JI7Q 1EOVA 3RZOH 4C3JH 3J80i 4ME3A 3UDXA 3CQZH 3UE1A 2E8GA 4X62L 4JC0A 2HIVA 1E3PA 1Y1WG 5C44G 4JI1Q 5GAHC 4DR4L 2PNHA 2CKZB 2RHSB 2UUCL 3PUWA 4AQYL 3M85A 2Q2UA 4YHHQ 4A3IG 4X64L 1X3FA 4QY7A 4GLXA 2K75A 2E5LL 4DR3Q 2AMCB 4C2MH 4R4TA 4C3HH 3CP0A 1XMQL 1N33Q 2JA8H 1EUJA 4HJ9A 4DR5Q 3PCOB 1HNZQ 4RG1A 4A93G 2MQHA 3UE0A 3ZJYC 4ALPA 4Y52H 3HOXG 4LF7L 2KCTA 1N36L 2Y0SE 4R4CA 2BH8A 1C7YA 1WI5A 3ER0A 3T1YL 1W2BA 1IBKL 2R92G 1PFSA 4JI6L 2PMZE 1PYSB 4B3TQ 4LF8L 3STBD 4DR1Q 1JJGA 2R93G 2JK8A 4GLAC 3KJOA 3BJUA 3PUYA 4A3MG 4LUZA 1PH9A 2UXDQ 1IYJB 3CW2C 4YY3L 4YWKA 1XNQQ 4HIKA 3GTLH 4HJAA 1N8RC 4YCUA 2QGQA 4MZ9A 1IBLQ 1XMOQ 3W5OA 4C3IH 3HOUG 1A0IA 2C35B 2KHJA 2N3SA 3I7FA 3K81C 4LFCQ 4R1JA 2L15A 3HOVH 3HOYG 3OYYA 5E7NA 4JI8L 1VS0A 1GKHA 3S15H 3TS0A 4HIMA 3CCEA 3EN2A 3E9IA 4OONA 2LXKA 4A3DG 4GOPB 2KBNA 3BU2A 1K3RA 4XIGS 2K14A 3PUZA 4JI1L 2B29A 2EQSA 1KRSA 3ULPA 1BBUA 3U58A 1CKNB 3L7ZC 4LFAQ 1KC8C 3PO2G 4LF9L 4JBJA 1AE2A 1HZCA 2Q2IA 3A74A 4LFBQ 1KIXA 4WJ3M 3I4OA 2K50A 3S1RH 3TRZA 3PIOA 1Q1BA 1N32L 2E2IH 1V9PA 1XPRA 5IE8A 1VQGA 2BH2A 4RMFA 1WOCA 5M3FH 2RHQB 1K0RA 4HIDA 2KENA 1JMCA 3GTKH 5IYCG 4GN3B 1FJGL 4JI4L 5FJ8H 3D0FA 4P74A 1ASZA 1X6OA 3RLOA 2VQFL 4DR1L 4YCVA 3CCLA 2N8NA 3F8TA 4IJHA 3KF8B 4LF5L 4YWMA 3GTQH 4GKKQ 4BY1H 3GO5A 2AWNA 4A3KG 1AE3A 4PG3A 1PH8A 2Z6KC 2NVTH 5M5WH 1XMOL 3FKIG 5JEAJ 3DLLA 2JA6H 2DUDA 2H5XA 2E2HH 3PSIA 3SGIA 4B3MQ 3DM3A 5AJ3L 3PO3H 1KL9A 3RN5A 3TS2A 1CSQA 1CKMA 4A3BG 4A3JG 1IBML 5EAYA 3CC7A 4A3LH 1TWHH 3K8AA 1Q46A 4JBWA 1Z47A 1MKHA 3BZKA 3RNUA 3HOZH 4TQUS 1CSPA 3GTMH 5LMNL 1FVIA 2V1CC 1SE8A 1Q7YC 2PI2A 2F4VQ 2ATWA 1JE5A 4OXPA 5M5YH 2ES2A 2ZM6Q 2A1AA 2RF4A 3OW2A 5C3EG 1VQOA 4LFAL 5IYDG 3NBHB 2OWOA 1TWFH 4IFDG 2UXBQ 1VQ4A 3TEHB 5IWAL 1QVFA 4JOIA 1HZ9A 4PZ6A 4DV1L 1YJ9A 1OXTA 4DV0Q 2LSSA 3MXNB 4DR7L 5C4XG 1AH9A 2NVYH 3CPFA 5HGQA 1HR0W 4A93H 4AH6A 4APVA 3HOXH 1VQNA 4PZ8A 1VQBA 4NB3A 4JYAL 1D7QA 1LM0A 4JG2A 4BBRH 3I4MG 3GDEA 1SFOH 5M5XH 5IP7G 3T1HL 2R92H 1VQ7A 1G51A 4IO9A 1Y1VG 1NBWA 2NZHA 1QVGA 3TQYA 5BR8Q 3W1BA 2VW9A 1HR0Q 1L1OB 1GM5A 2BA1A 2ZTEA 1L0WA 4DUYQ 4O2DA 1Y14B 3HKSA 2R7ZG 3J81j 5IY0A 2HQLA 2K52A 2OTJA 2VL6A 1N34L 4BY7H 3A5ZB 2DGYA 3JAMc 1WFQA 3HOUH 1P8LA 3B6YA 3KDFA 1PH1A 3I4NH 2PQAA 4UPAA 3CMAA 1Q8KA 4UY8C 1UE6A 1VQIA 4Y7NH 2JQOA 5M3MG 3H0GG 4A3DH 1I94Q 2HT1A 1RL2A 2CQOA 3HOWG 1JB7A 4DV6Q 1SN8A 1OXUA 1A63A 2JEBI 2R6GA 4A3EG 1VQDA 1D8LA 4DV3L 1C9OA 2ZJPA 1TWCH 1B8AA 2UUAQ 1GO3E 5FLXc 1BVSA 2R7DA 4DV0L 4K0KL 3F2CA 3AFPA 4IJLA 3ICEA 1T9HA 4X65L 2OQ0A 2XTIA 4JI2L 2BA0A 3S24A 5DLQE 5IYCH 4A3FG 2ZTDA 4LWCA 1N9WA 4LUVA 3CCVA 4L5TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HHH L;  3EIV A;  3I56 A;  1EQR A;  1H95 A;  3PUX A;  4LUO A;  3ULL A;  2JE6 I;  2JA5 G;  4R4Q A;  2K5H A;  1CUK A;  1QZH A;  5IP9 G;  4PZ7 A;  4R4I A;  4YWL A;  2AHO B;  3CCM A;  1XNR Q;  3GTG H;  3M4Q A;  1TXY A;  4GNX C;  2Z0S A;  3M3Y H;  5GRO A;  3F2D A;  4KHP Q;  4DV5 L;  4LF6 Q;  4JI0 Q;  4JI7 L;  1OTC A;  1WCM H;  4MTN A;  1XJV A;  4DUZ Q;  1X9N A;  2CWA A;  1YEZ A;  4B3R Q;  1HNX Q;  3OTO Q;  1DGS A;  1YJW A;  3J7A 5;  2MFI A;  1IL2 A;  2K4K A;  3KOJ A;  2ZJR A;  1SMX A;  4DV6 L;  2IY5 B;  2GVB A;  3S2H H;  2UXC Q;  4IPG A;  5ELN A;  1EYG A;  5LMU Q;  5C3E H;  3CCU A;  4YHH L;  2Z6K A;  1ASY A;  4NXN Q;  2MO0 A;  1VQF A;  4DR3 L;  1EWI A;  4UP9 A;  2UUB Q;  4A4I A;  4A3G H;  1N33 L;  2EIF A;  5C4X H;  1YI2 A;  4DR5 L;  1HNZ L;  4LF4 Q;  4YCW A;  1NMG A;  2JJQ A;  1VQE A;  3E0E A;  1YVC A;  3H3V H;  3NEN A;  3I4M H;  5IP7 H;  4B3S Q;  3L2P A;  2JEA I;  1OXX K;  4B3T L;  1UEB A;  5IYB H;  3GTP H;  1Y1V H;  3KF6 A;  5J3B A;  1J5E Q;  1OXV A;  1Q12 A;  1PV4 A;  3UDF A;  4X66 Q;  3KFU A;  1KXL A;  3J7Z C;  2VS1 A;  4FDB A;  2UXD L;  3AFQ A;  2D0P A;  1LYL A;  2UU9 Q;  4H02 A;  5JJK A;  1XNQ L;  3WWV A;  2WAQ G;  3K7U C;  4BXX G;  4EQ5 A;  2R7Z H;  2JA7 H;  2B63 H;  2MO1 A;  3NEM A;  4A76 A;  1IBL L;  4GN4 B;  3PF5 A;  4DKA C;  2K5N A;  4JI3 Q;  4LFC L;  1K9M C;  2MNA A;  1S72 A;  4DR2 Q;  2JA8 G;  3G4S A;  2VY3 A;  2NVQ H;  5H1S E;  3CCS A;  3CF5 A;  1PH6 A;  1QUQ A;  1RIP A;  1C0A A;  1YZ6 A;  1VQ6 A;  3PGZ A;  4B3R L;  3OTO L;  3IRB A;  2D0O A;  2OQK A;  4DAY B;  2F3I A;  5C0X J;  4GKJ Q;  3RR5 A;  4DK3 C;  4GOP C;  5GQO A;  4DNI A;  1Y1W H;  4OWT B;  1M1K C;  1NTG A;  5C44 H;  4A75 A;  4BA2 I;  4A3E H;  4NXN L;  1HNW Q;  1BKB A;  4A3I H;  2F52 A;  2WB1 G;  2ASB A;  4IOA A;  4LFB L;  4DR6 Q;  1Q86 C;  2CWP A;  3FHW A;  3RLF A;  4HJ7 A;  2UUB L;  3S1N H;  3M9B A;  4AYB G;  4OWW B;  2VNU D;  3KLW A;  4LF4 L;  1BBW A;  1VQ8 A;  3G48 A;  4DAM A;  3CAM A;  4JV5 Q;  3RLN A;  5JJI A;  1FL0 A;  3U50 C;  1XPO A;  3M4O H;  3AQQ A;  5FLM G;  3K0X A;  5GAG C;  4PMW A;  4X62 Q;  4HIO A;  4JI3 L;  3HKZ G;  4GKK L;  4KI0 A;  1OXS C;  4KHZ A;  4P75 A;  1Z9F A;  5JEA G;  3A5U A;  3GTO H;  2R93 H;  4A3M H;  4DR4 Q;  2UUC Q;  4IPC A;  3G6E A;  4AQY Q;  1JJ2 A;  3GD7 A;  4X64 Q;  4L5R C;  1QVC A;  1SR3 A;  4P72 A;  2EXD A;  3ULJ A;  4OO1 I;  1VQJ A;  4B3M L;  3HOY H;  1XMQ Q;  2KCM A;  3KDF B;  1GD7 A;  4UP7 A;  4A3C G;  2PQA B;  3KJP A;  3J81 c;  2ZJQ A;  4BBS G;  1XTD A;  1YIJ A;  1YNX A;  4LF7 Q;  1X55 A;  1Q81 C;  4NPS A;  1YHB A;  5GAE C;  1N36 Q;  4DV4 Q;  3U4Z A;  3T1Y Q;  3CCQ A;  1K8G A;  5C0X I;  1IBK Q;  2PI2 E;  3EBE A;  4JI6 Q;  2JA6 G;  2VUM G;  4LF8 Q;  4NXM Q;  2ZM6 L;  1YHA A;  1E24 A;  3H3V I;  2YYZ A;  2AKW B;  3A0J A;  4BY1 G;  3W1G A;  3JAM i;  3HFZ B;  1P16 A;  3PO2 H;  4YY3 Q;  2UXB L;  2A8V A;  4GNX A;  3S16 H;  4IOC A;  2YTX A;  1KD1 C;  1YBY A;  2IX1 A;  2HIX A;  3L0O A;  2I5H A;  2NZO A;  1G29 1;  2YTY A;  1PYB A;  1YIT A;  3J81 i;  2E2J H;  3H15 A;  1KQS A;  1VQL A;  3PO3 G;  4DV7 Q;  1Q82 C;  1VQC A;  4JI8 Q;  1UWV A;  2I0Q A;  4J15 A;  4A3L G;  2IHF A;  2IT1 A;  5GAD C;  1K8A C;  1NE3 A;  4IPH A;  3UDI A;  3JC6 6;  3HOZ G;  2OTL A;  2JA9 A;  1PH7 A;  1X54 A;  3PUV A;  4MNO A;  1VQM A;  1HR0 L;  2N78 A;  5BR8 L;  2NN6 I;  4POF A;  1K83 H;  4DUY L;  1L1O C;  4QGU A;  1LUZ A;  4HJ5 A;  2Q2H A;  4BXX H;  1V1Q A;  4A3K H;  4LF9 Q;  4IPD A;  1MJC A;  2GVA A;  1PH3 A;  4AIM A;  2XGT A;  2YTV A;  3AYH B;  3FKI H;  4JCV E;  2A19 A;  4OX9 Q;  2R7F A;  1VQA A;  1HZA A;  2D62 A;  1N32 Q;  2VUM H;  4A3B H;  4A3J H;  4UP8 A;  1O7I A;  1TWG H;  3VDY A;  4XTC S;  3D31 A;  4QJF A;  4KLK A;  4BBR G;  1I94 L;  2WP8 J;  4DV4 L;  2Q2T A;  3S1Q H;  5JJL A;  2GN5 A;  1WYD A;  2Y0S G;  2YV5 A;  1R9T H;  1MJE A;  1FJG Q;  4JI4 Q;  4NXM L;  1X56 A;  2ZTC A;  3F1Z A;  1A8V A;  2VQE Q;  2VQF Q;  1EQQ A;  4LF5 Q;  2K5V A;  1TWA H;  2I5L X;  5ELO A;  1I50 H;  5IYD H;  5K36 G;  1B70 B;  2UUA L;  2ALY B;  1KHI A;  4LW1 A;  4LNQ A;  4BY7 G;  4JBK A;  3K7A H;  1IXR A;  4TVA B;  5LMN W;  1UE7 A;  1S40 A;  3I4N G;  3TRE A;  4DV7 L;  1V43 A;  1SRO A;  4OWX B;  5AJ3 Q;  2CCZ A;  4GN5 A;  2IHE A;  4DK6 C;  1W3S A;  1IBM Q;  4GOP A;  1VQ5 A;  3CC4 A;  2OCE A;  1JJC B;  4QQB X;  5FLM H;  4JI5 Q;  1CKO A;  3LGJ A;  2F4V L;  5LMN Q;  1X3G A;  4HJ8 A;  1VQH A;  2NVX H;  3GTJ H;  3CXC A;  1A62 A;  3NEL A;  4DV2 Q;  3KF6 B;  1CKN A;  2N49 A;  3U4V A;  2WAQ E;  1PA6 A;  1NJI C;  1VQK A;  1QZG A;  4DPG A;  3CCR A;  5HY6 A;  1GVP A;  1XNR L;  5IWA Q;  3I2Z A;  4OX9 L;  4DV1 Q;  2QA4 A;  3S1M H;  3CD6 A;  4KHP L;  4DR7 Q;  4LF6 L;  1UE1 A;  4IFD J;  3RN2 A;  4JI0 L;  4A3C H;  4R4O A;  3RZD H;  3CME A;  4BBS H;  4DUZ L;  1QUQ B;  5M3M H;  3ERS X;  3H0G H;  1HNX L;  3E9H A;  4JYA Q;  1Q1E A;  1SRU A;  3T1H Q;  3HOW H;  1IZ6 A;  4L5S A;  1VQP A;  2UXC L;  1KRT A;  2VQE L;  1KAW A;  3PV0 A;  3PIP A;  4GS3 A;  5LMU L;  1YHQ A;  1XPU A;  2WFW A;  2WB1 E;  1HZB A;  1J6Q A;  2IX0 A;  1G6P A;  3S2D H;  4AYB E;  1L2F A;  4EX5 A;  1VCI A;  1N34 Q;  1EFW A;  1EIY B;  1PH2 A;  4POG A;  1NY4 A;  3HOV G;  4GLV B;  3Q8D A;  3FP9 A;  1U0L A;  1EIF A;  5IT9 c;  1WCM G;  3K80 C;  3CPW A;  4JBM A;  1NMF A;  1S3O A;  1X3E A;  1PHJ A;  4X6A H;  1HH2 P;  4B3S L;  1FGU A;  4A3F H;  2KHI A;  3HKZ E;  4JI5 L;  4WJ4 A;  1JT8 A;  1J5E L;  4DV2 L;  4OO1 G;  4X66 L;  1LTL A;  3CCJ A;  1PH4 A;  2UU9 L;  4QIW E;  2LXJ A;  4DV3 Q;  1PVO A;  2JA5 H;  1X65 A;  3KYH C;  3M7N A;  4P71 A;  5IP9 H;  3S17 H;  3S14 H;  1SLJ A;  5C4J H;  3I55 A;  2E5L Q;  2RCN A;  3AEV A;  3M4P A;  1I3Q H;  1K73 C;  1MIU A;  4A3G G;  4K0K Q;  1I5F A;  1HJP A;  2AWO A;  2I5M X;  5C0X G;  4DR2 L;  1PH5 A;  2FXQ A;  3F2B A;  4O0A A;  4IFD I;  1YJN A;  1VQ9 A;  4X65 Q;  1E1O A;  2QEX A;  1E7Z A;  3CC2 A;  5M3F G;  4JI2 Q;  4BA1 I;  2CFM A;  4GKJ L;  1E1T A;  5IYB G;  1UE5 A;  1WJJ A;  5FJ8 G;  1L1O A;  2ID0 A;  3J80 c;  2HHH Q;  1HNW L;  3UDG A;  3BZC A;  3PF4 A;  1E22 A;  4L5Q A;  3G71 A;  3STB C;  1U5K A;  4DR6 L;  1M90 C;  2JA7 G;  2B63 G;  2B3G A;  4GNX B;  1I6H H;  3MEF A;  4QL5 A;  1B7Y B;  2YU9 H;  2VZA A;  4JOI C;  4JV5 L;  4P73 A;  4DV5 Q;  2NN6 G;  4JI7 Q;  1EOV A;  3RZO H;  4C3J H;  3J80 i;  4ME3 A;  3UDX A;  3CQZ H;  3UE1 A;  2E8G A;  4X62 L;  4JC0 A;  2HIV A;  1E3P A;  1Y1W G;  5C44 G;  4JI1 Q;  5GAH C;  4DR4 L;  2PNH A;  2CKZ B;  2RHS B;  2UUC L;  3PUW A;  4AQY L;  3M85 A;  2Q2U A;  4YHH Q;  4A3I G;  4X64 L;  1X3F A;  4QY7 A;  4GLX A;  2K75 A;  2E5L L;  4DR3 Q;  2AMC B;  4C2M H;  4R4T A;  4C3H H;  3CP0 A;  1XMQ L;  1N33 Q;  2JA8 H;  1EUJ A;  4HJ9 A;  4DR5 Q;  3PCO B;  1HNZ Q;  4RG1 A;  4A93 G;  2MQH A;  3UE0 A;  3ZJY C;  4ALP A;  4Y52 H;  3HOX G;  4LF7 L;  2KCT A;  1N36 L;  2Y0S E;  4R4C A;  2BH8 A;  1C7Y A;  1WI5 A;  3ER0 A;  3T1Y L;  1W2B A;  1IBK L;  2R92 G;  1PFS A;  4JI6 L;  2PMZ E;  1PYS B;  4B3T Q;  4LF8 L;  3STB D;  4DR1 Q;  1JJG A;  2R93 G;  2JK8 A;  4GLA C;  3KJO A;  3BJU A;  3PUY A;  4A3M G;  4LUZ A;  1PH9 A;  2UXD Q;  1IYJ B;  3CW2 C;  4YY3 L;  4YWK A;  1XNQ Q;  4HIK A;  3GTL H;  4HJA A;  1N8R C;  4YCU A;  2QGQ A;  4MZ9 A;  1IBL Q;  1XMO Q;  3W5O A;  4C3I H;  3HOU G;  1A0I A;  2C35 B;  2KHJ A;  2N3S A;  3I7F A;  3K81 C;  4LFC Q;  4R1J A;  2L15 A;  3HOV H;  3HOY G;  3OYY A;  5E7N A;  4JI8 L;  1VS0 A;  1GKH A;  3S15 H;  3TS0 A;  4HIM A;  3CCE A;  3EN2 A;  3E9I A;  4OON A;  2LXK A;  4A3D G;  4GOP B;  2KBN A;  3BU2 A;  1K3R A;  4XIG S;  2K14 A;  3PUZ A;  4JI1 L;  2B29 A;  2EQS A;  1KRS A;  3ULP A;  1BBU A;  3U58 A;  1CKN B;  3L7Z C;  4LFA Q;  1KC8 C;  3PO2 G;  4LF9 L;  4JBJ A;  1AE2 A;  1HZC A;  2Q2I A;  3A74 A;  4LFB Q;  1KIX A;  4WJ3 M;  3I4O A;  2K50 A;  3S1R H;  3TRZ A;  3PIO A;  1Q1B A;  1N32 L;  2E2I H;  1V9P A;  1XPR A;  5IE8 A;  1VQG A;  2BH2 A;  4RMF A;  1WOC A;  5M3F H;  2RHQ B;  1K0R A;  4HID A;  2KEN A;  1JMC A;  3GTK H;  5IYC G;  4GN3 B;  1FJG L;  4JI4 L;  5FJ8 H;  3D0F A;  4P74 A;  1ASZ A;  1X6O A;  3RLO A;  2VQF L;  4DR1 L;  4YCV A;  3CCL A;  2N8N A;  3F8T A;  4IJH A;  3KF8 B;  4LF5 L;  4YWM A;  3GTQ H;  4GKK Q;  4BY1 H;  3GO5 A;  2AWN A;  4A3K G;  1AE3 A;  4PG3 A;  1PH8 A;  2Z6K C;  2NVT H;  5M5W H;  1XMO L;  3FKI G;  5JEA J;  3DLL A;  2JA6 H;  2DUD A;  2H5X A;  2E2H H;  3PSI A;  3SGI A;  4B3M Q;  3DM3 A;  5AJ3 L;  3PO3 H;  1KL9 A;  3RN5 A;  3TS2 A;  1CSQ A;  1CKM A;  4A3B G;  4A3J G;  1IBM L;  5EAY A;  3CC7 A;  4A3L H;  1TWH H;  3K8A A;  1Q46 A;  4JBW A;  1Z47 A;  1MKH A;  3BZK A;  3RNU A;  3HOZ H;  4TQU S;  1CSP A;  3GTM H;  5LMN L;  1FVI A;  2V1C C;  1SE8 A;  1Q7Y C;  2PI2 A;  2F4V Q;  2ATW A;  1JE5 A;  4OXP A;  5M5Y H;  2ES2 A;  2ZM6 Q;  2A1A A;  2RF4 A;  3OW2 A;  5C3E G;  1VQO A;  4LFA L;  5IYD G;  3NBH B;  2OWO A;  1TWF H;  4IFD G;  2UXB Q;  1VQ4 A;  3TEH B;  5IWA L;  1QVF A;  4JOI A;  1HZ9 A;  4PZ6 A;  4DV1 L;  1YJ9 A;  1OXT A;  4DV0 Q;  2LSS A;  3MXN B;  4DR7 L;  5C4X G;  1AH9 A;  2NVY H;  3CPF A;  5HGQ A;  1HR0 W;  4A93 H;  4AH6 A;  4APV A;  3HOX H;  1VQN A;  4PZ8 A;  1VQB A;  4NB3 A;  4JYA L;  1D7Q A;  1LM0 A;  4JG2 A;  4BBR H;  3I4M G;  3GDE A;  1SFO H;  5M5X H;  5IP7 G;  3T1H L;  2R92 H;  1VQ7 A;  1G51 A;  4IO9 A;  1Y1V G;  1NBW A;  2NZH A;  1QVG A;  3TQY A;  5BR8 Q;  3W1B A;  2VW9 A;  1HR0 Q;  1L1O B;  1GM5 A;  2BA1 A;  2ZTE A;  1L0W A;  4DUY Q;  4O2D A;  1Y14 B;  3HKS A;  2R7Z G;  3J81 j;  5IY0 A;  2HQL A;  2K52 A;  2OTJ A;  2VL6 A;  1N34 L;  4BY7 H;  3A5Z B;  2DGY A;  3JAM c;  1WFQ A;  3HOU H;  1P8L A;  3B6Y A;  3KDF A;  1PH1 A;  3I4N H;  2PQA A;  4UPA A;  3CMA A;  1Q8K A;  4UY8 C;  1UE6 A;  1VQI A;  4Y7N H;  2JQO A;  5M3M G;  3H0G G;  4A3D H;  1I94 Q;  2HT1 A;  1RL2 A;  2CQO A;  3HOW G;  1JB7 A;  4DV6 Q;  1SN8 A;  1OXU A;  1A63 A;  2JEB I;  2R6G A;  4A3E G;  1VQD A;  1D8L A;  4DV3 L;  1C9O A;  2ZJP A;  1TWC H;  1B8A A;  2UUA Q;  1GO3 E;  5FLX c;  1BVS A;  2R7D A;  4DV0 L;  4K0K L;  3F2C A;  3AFP A;  4IJL A;  3ICE A;  1T9H A;  4X65 L;  2OQ0 A;  2XTI A;  4JI2 L;  2BA0 A;  3S24 A;  5DLQ E;  5IYC H;  4A3F G;  2ZTD A;  4LWC A;  1N9W A;  4LUV A;  3CCV A;  4L5T A; 
#chains in the Genus database with same CATH topology
 1YNJ D;  3WDN A;  5I6W A;  5CGK A;  1FNU A;  2Z9H A;  1B50 A;  2JE6 I;  1CI3 M;  1W6K A;  4R4I A;  4YWL A;  4C3H B;  3GTG H;  1TXY A;  3M3Y H;  2JA8 B;  3A55 A;  1EYD A;  3BDL A;  4LF6 Q;  2EYO A;  5IGB A;  4MTN A;  1XJV A;  1X9N A;  2CWA A;  2L5T A;  3J7A 5;  2WII B;  1R9T B;  2K4K A;  3BDC A;  3E0J A;  5LMU Q;  5C3E H;  1ASY A;  5IT9 E;  2WB1 B;  2MO0 A;  4DR3 L;  4RH6 A;  2UUB Q;  2RDF A;  4A3G H;  4C3I B;  5IT9 L;  5C0X H;  4DR5 L;  2XIW A;  1F9Q A;  1YVC A;  4N8X 1;  4OGQ C;  4B3S Q;  3NHH A;  3M4Y A;  4TRD A;  1PTO F;  3ERO A;  3HKZ B;  2NVX B;  5C5M A;  1J5E Q;  1OXV A;  2ZXR A;  3UDF A;  3V05 A;  1HUN A;  4Z9C B;  1TS4 A;  2R7Z H;  2JA7 H;  3PF5 A;  4F87 A;  3S1M B;  1SNO A;  1Z6H A;  2VY3 A;  5DAU A;  2B2V C;  5G3L D;  3URY A;  2XWJ B;  2OQK A;  1F9S A;  4DAY B;  2F3I A;  4GKJ Q;  5GQO A;  4K8J A;  3GTQ B;  4BA2 I;  1BKB A;  5I4D A;  2F52 A;  4DR6 Q;  1Q86 C;  2CWP A;  3FHW A;  4HCE A;  2F3V A;  3RLF A;  3ZYY X;  4B9W A;  4C1N K;  4HJ7 A;  1VF5 C;  3M9B A;  5J39 A;  1EZ8 A;  1BDO A;  1BBW A;  1C4Q A;  1SMY C;  2MP1 A;  1JB3 A;  2L9H A;  5IGG A;  2OF1 A;  4CKB A;  2K5Q A;  3U50 C;  3M4O H;  1E2V A;  2F0K A;  3A8J E;  5FLX E;  3IFD A;  4X62 Q;  4KD4 A;  4P75 A;  1OXS C;  4KHZ A;  2R61 A;  3A5U A;  4PMB A;  3BS1 A;  1TWF B;  4KJO A;  2PW5 A;  3L3O C;  4L5R C;  4N8F A;  3S17 B;  5ELC A;  4RA8 A;  3ULJ A;  3Q22 A;  3VR4 A;  3KDF B;  3KJP A;  1KNA A;  2ZJQ A;  4BBS G;  1XTD A;  1EY8 A;  2I07 B;  3I70 A;  1SFO B;  1TY0 A;  1YHB A;  5GAE C;  2KVM A;  4M8A A;  5C0X I;  3LNN A;  4BY1 G;  3H6M A;  3PO2 H;  4GNX A;  1KD1 C;  2IX1 A;  3L0O A;  2I5H A;  2NZO A;  4R8N A;  3QWN A;  1VQC A;  3HRZ C;  1NE3 A;  4KK7 A;  1HR0 L;  5BR8 L;  4X3K A;  3Q0A A;  4ULL A;  5F2D A;  2F0O A;  1V1Q A;  1MJC A;  3FPU B;  3AYH B;  4JCV E;  3C46 A;  4ZRZ A;  2X6G A;  2X69 A;  1TWG H;  1STN A;  4XTC S;  4MN3 A;  4BBR G;  1WTO A;  2Y0S G;  1WYD A;  1MJE A;  1EY9 A;  1FJG Q;  4FO2 A;  4JI4 Q;  4NKL A;  1X56 A;  2CW0 D;  1EQQ A;  3T53 B;  2K5V A;  2QW7 A;  1TWA H;  4IUT A;  2EJM A;  2EYL A;  4DNT B;  2EY6 A;  2M00 A;  2FMM A;  2A68 D;  2UUA L;  1KHI A;  4LW1 A;  4PMC A;  1KDA A;  1ENC A;  3K7A H;  1IXR A;  5TSS A;  3HOV B;  3UI2 A;  5HGT A;  2HUG A;  2B2U C;  3AMU A;  5E4X A;  5AJ3 Q;  5FOB B;  1L0X B;  2IHE A;  4DK6 C;  1IBM Q;  1T5X D;  2L1B A;  3K5O A;  4B08 A;  2F4V L;  1LAB A;  1IW7 D;  1VQH A;  2PNR C;  3E3X A;  3NEL A;  4DV2 Q;  3KF6 B;  2X6L A;  2N49 A;  1PA6 A;  3R2I A;  3CCR A;  2XSC A;  5IWA Q;  3I2Z A;  4HSP A;  4DR7 Q;  4IFD J;  4R4O A;  4BBS H;  1HRJ A;  3H0G H;  5EJW A;  1Q1E A;  3GTK B;  1IZ6 A;  4L5S A;  1VQP A;  2UXC L;  1KRT A;  3HGB A;  1KAW A;  4GS3 A;  3T13 A;  1YHQ A;  4IUV A;  5D3I B;  1J6Q A;  1PRT F;  4UDU C;  4AYB E;  4CBV A;  4DXG A;  1I4Q A;  4EGV A;  1RJT A;  1PH2 A;  2K32 A;  3FP9 A;  1IYV A;  1EIF A;  3MXU A;  1QCB D;  1WCM G;  3K80 C;  4U67 3;  1PHJ A;  1HH2 P;  4A3F H;  4KJN A;  4WJ4 A;  3NPP A;  4OEL B;  4DV2 L;  5C44 B;  1LAC A;  2K5D A;  5JAV A;  3A54 A;  2LXJ A;  4DV3 Q;  4A3I B;  1X65 A;  5IP9 H;  3S14 H;  5C4J H;  3I55 A;  2E5L Q;  3S1N B;  4RCO A;  1WTQ A;  2K28 A;  4K0K Q;  1HJP A;  2AWO A;  2NVY B;  4JK1 C;  1YJN A;  4FF1 A;  1E7Z A;  1UAP A;  5M3F G;  3ONA B;  2KCN A;  3K5N A;  1FYC A;  1L1O A;  1HNW L;  1STB A;  1O78 A;  3BZC A;  1BOS A;  4L5Q A;  4MHE A;  2HDM A;  1YNJ C;  2LMC B;  1M90 C;  2B63 G;  2SNS A;  3MEF A;  4QL5 A;  4HCS A;  2YU9 H;  2VZA A;  4EQP A;  2NN6 G;  3CRK C;  4JI7 Q;  4Y7N B;  3RZO H;  3UDX A;  4XT1 B;  1Y8O B;  4FF2 A;  1TS3 A;  4DR4 L;  1BUV T;  2CHB D;  2BDN A;  1QNK A;  2EVB A;  1G6Z A;  1X3F A;  2K75 A;  4V19 0;  2E5L L;  1EEF D;  4C3H H;  3CP0 A;  4ZAI A;  3D6C A;  2QF7 A;  2JA8 H;  1HA5 A;  1EUJ A;  1HNZ Q;  2MQH A;  3UE0 A;  3ZJY C;  4ALP A;  1IKM A;  4LF7 L;  1EY6 A;  4K14 A;  3TP8 A;  1EL0 A;  1N36 L;  4R4C A;  1LO5 D;  1WI5 A;  3T1Y L;  1IBK L;  2J0T D;  2K03 A;  4DR1 Q;  2R93 G;  3DWQ A;  4GLA C;  1A6X A;  1H9M A;  1IYJ B;  4YY3 L;  1A15 A;  1ROD A;  4C3I H;  3HOU G;  1KAB A;  3K81 C;  2L15 A;  1SBB B;  5E7N A;  4JI8 L;  2AQ3 B;  3CHB D;  1O80 A;  2K5W A;  5ELD A;  1K28 A;  4Q0F A;  4U68 A;  5FKA C;  3TS0 A;  2EY2 A;  1ZEQ X;  3EN2 A;  3CCE A;  4GOP B;  2KBN A;  4YIJ A;  5I9P A;  3BU2 A;  2ICI A;  1QIL A;  3D6W A;  2AQ1 B;  3QJY A;  4ZUI A;  4ID6 A;  5C3E B;  3U58 A;  1KC8 C;  4LF9 L;  4JBJ A;  3A74 A;  3A7A B;  2BDO A;  3TBI B;  1F2L A;  1N32 L;  1V9P A;  1UUP A;  5M3F H;  1D5M C;  1F2M A;  1K0R A;  5C5L A;  4HID A;  1TKW B;  1U9R A;  4IUR A;  2VUM H;  4DR1 L;  3RLO A;  4YCV A;  1L0Y B;  3GTQ H;  4YWM A;  1DZ1 A;  2R7Z B;  1G2S A;  5M5W H;  3DLL A;  3T51 B;  2H5X A;  3PSI A;  3RN5 A;  3TS2 A;  1CSQ A;  3W3A A;  4A3B G;  4A3J G;  4R8I A;  3DHQ A;  5A2Q E;  2K1B A;  1CSP A;  5LMN L;  1FNV A;  1JE5 A;  4OXP A;  3U9S A;  4IFD G;  1LTB D;  1TWF H;  4KHV A;  2UXB Q;  1LLR D;  4DV1 L;  1OXT A;  1B9N A;  3MXN B;  4NW2 A;  4J1M A;  3WOE A;  1H9J A;  3I4L A;  5FO8 B;  4NB3 A;  4JW0 A;  3M4O B;  1D7Q A;  4JG2 A;  3H3V C;  1SFO H;  4UHV A;  1T5E A;  1G51 A;  3SR1 A;  1CA6 A;  2A69 D;  2NZH A;  1QVG A;  3TQY A;  2VW9 A;  1ESR A;  3W1B A;  2PZW A;  4ZKC B;  5IY0 A;  5L37 A;  1QWY A;  3BZD B;  1I3Q B;  5COR A;  2DGY A;  3JAM c;  1WFQ A;  2PQE A;  3HOU H;  1PH1 A;  3I4N H;  2F0Q A;  2PQA A;  4UPA A;  3CMA A;  5JJZ A;  1GUN A;  1UE6 A;  2L12 A;  2L55 A;  5LHY 1;  2ICE C;  5BN4 A;  3HP3 A;  2V4D A;  3P7J A;  5EPJ A;  1D8L A;  1U4L A;  3BYY B;  2CW0 C;  1C8C A;  3EQL C;  5FLX c;  1BVS A;  1WD0 A;  1CZG A;  3I3C A;  2NZ1 D;  3ICE A;  2A68 C;  4X65 L;  1SXT A;  2MGS A;  2KEC A;  2BA0 A;  1PZJ D;  2F0E A;  2QDL A;  4EQN A;  2EYF A;  1B1Z A;  4HSV A;  1MGS A;  1R4Q B;  4LWC A;  1N9W A;  2I46 A;  1CK1 A;  2RDH A;  4L5T A;  1BCP D;  1BO0 A;  2HCI A;  4K2L A;  3PUX A;  1H9R A;  3ULL A;  2JA5 G;  2PZU A;  3AU7 A;  2K01 A;  4HMI A;  4PZ7 A;  1DOM A;  1J9O A;  5CC4 A;  1RTO A;  4DV5 L;  1GXD C;  5K5P A;  4R9W A;  4JI0 Q;  1WTP A;  1TWG B;  3OTO Q;  2QEJ C;  1CM9 A;  1IL2 A;  2ZJR A;  2EY1 A;  4LK1 C;  4OO1 H;  3S2H H;  3K0Y A;  5ELN A;  1TWA B;  3CCU A;  4YHH L;  4IQZ A;  3KBG A;  3GTL B;  1CHP D;  1EWI A;  4UP9 A;  4QCL A;  2K04 A;  3MZ5 A;  4QB4 A;  2EIF A;  1N33 L;  1YI2 A;  4LF4 Q;  4YCW A;  3E0E A;  5KRU A;  3H94 A;  2CVR A;  3E5S A;  3CKI B;  3H3V H;  5T1I A;  4C3J G;  1B53 A;  2O4X A;  3NTH A;  1UEB A;  1SE2 A;  5IYB H;  4B3T L;  3GTP H;  3V2T A;  1BR9 A;  1GUT A;  1Q12 A;  1PV4 A;  5CV6 A;  5C6A A;  2UXD L;  3AFQ A;  2D0P A;  2UU9 Q;  4KKS A;  2WAQ G;  5J1Z A;  3TN2 A;  4GN4 B;  4LFC L;  2MNA A;  1S72 A;  4DR2 Q;  3G4S A;  5D14 A;  2NVQ H;  3CCS A;  4FP5 D;  1RIP A;  3OMC A;  1PH6 A;  1SYD A;  4BBS B;  3H0G B;  3PGZ A;  3OTO L;  2D0O A;  5E3F A;  3RR5 A;  3P20 A;  4DK3 C;  1MI2 A;  4GOP C;  1Y1W H;  1M1K C;  5C44 H;  1AZQ A;  2B2Y C;  5EPK A;  1WVL A;  4A3I H;  5FO9 B;  2WKD A;  4QF4 A;  4IOA A;  5LL6 S;  2F0G A;  3S1N H;  4LF4 L;  1B4O A;  3G48 A;  4GZY C;  4JV5 Q;  4HMJ A;  1FL0 A;  1IYU A;  1TWH B;  3AQQ A;  2ENB A;  1HXY D;  3K0X A;  4HIO A;  2G9H D;  4GKK L;  2IW3 A;  1Z9F A;  3GTO H;  4XQN A;  4F8M A;  1QJO A;  1JJ2 A;  4X64 Q;  3S14 B;  1SJE D;  2EXD A;  4OO1 I;  1B2T A;  4WJW A;  5G3L F;  2F0L A;  2MPM A;  1LV9 A;  4NPS A;  4P2C B;  3U4Z A;  2Y0S B;  3CCQ A;  1K8G A;  2PI2 E;  4LF8 Q;  2ZM6 L;  3DWA A;  3H3V I;  2AKW B;  3JAM i;  2A8V A;  4NDX A;  3MXG A;  1G29 1;  1PYB A;  2YU9 B;  3X3N A;  3PO3 G;  4DV7 Q;  1Q82 C;  4K6D A;  3RZO B;  1UWV A;  5KND A;  1YNN D;  2IT1 A;  3NWT A;  4IPH A;  3HOZ G;  4DXF A;  3QIA A;  4PNY A;  4DUY L;  5ISR A;  4QGU A;  4XXE A;  1LUZ A;  4RGN A;  2Q2H A;  2D2C C;  4IPD A;  2GVA A;  1PH3 A;  4AIM A;  4CJ2 C;  3I90 A;  2A19 A;  4OEM B;  1VQA A;  1HZA A;  1FGB D;  1HPC A;  5BN5 A;  2IWH A;  2NTT A;  1I94 L;  4KLK A;  1V1P B;  1D6E C;  3K5L A;  1H9S A;  4HN7 A;  2IJ0 A;  2KUM A;  2ZTC A;  1A8V A;  4K5V A;  5CBA E;  4LF5 Q;  1DCZ A;  5IYD H;  2O5I C;  2XN9 C;  2ALY B;  3DMU A;  5NUC A;  4BY7 G;  1RD9 D;  2B2V A;  1TT2 A;  1UE7 A;  2Q8T A;  4DV7 L;  1V43 A;  1SRO A;  2Z8L A;  4IN3 A;  3NQI A;  1EWH A;  2F0P A;  2OCE A;  4S3S A;  4JI5 Q;  1CKO A;  1SE4 A;  3TME A;  3CXC A;  3MC0 B;  1CKN A;  4IUN A;  1VQK A;  2O5J C;  5IGC A;  1PFM A;  4DPG A;  1LTT D;  1TS2 A;  1NR4 A;  3A8K E;  1ENF A;  4DN4 M;  3DEO A;  4LF6 L;  4HTH A;  3N6R A;  1XXG A;  5M3F B;  1QUQ B;  3ERS X;  3E9H A;  1EYA A;  2RBM A;  4KN4 C;  3T1H Q;  3HOW H;  2ZT9 C;  3JAM E;  2VUM B;  3KF8 A;  1NCV A;  3PIP A;  1XPU A;  5LMU L;  2WFW A;  2WB1 E;  1HZB A;  2WKC A;  1UEA B;  3JAM L;  1L2F A;  2QCP X;  1Y69 U;  2BOS A;  4EX5 A;  5M5W B;  5I9O A;  1N34 Q;  1TY2 A;  4GLV B;  5C3W A;  4F88 A;  1O7L A;  1F77 A;  2SNM A;  2HCC A;  4ZUJ A;  4X6A H;  1X3E A;  4B3S L;  1I4G A;  3HKZ E;  4JI5 L;  4Q5V A;  1J5E L;  2XVS A;  3NBH A;  5FLX L;  1PVO A;  4JPB W;  3M7N A;  5BN3 A;  1EIG A;  3AEV A;  3M4P A;  1I3Q H;  3NXW A;  1MIU A;  4F7X A;  4O0A A;  1EY7 A;  4CKC A;  4RKB A;  4JI2 Q;  4XQQ A;  5C4Z A;  5EBD A;  4GKJ L;  5EQ0 A;  1ILP A;  5FJ8 G;  2HHH Q;  2PMZ B;  3SHL A;  2PYK A;  3UDG A;  2R93 B;  2P5Z X;  2EXZ A;  3G71 A;  4DR6 L;  3TSS A;  3HOU B;  1B7Y B;  3KLS A;  3I4N B;  4CDC C;  4XQJ A;  3ND9 A;  4DNR B;  4JVZ A;  3J80 i;  3CQZ H;  2DY7 A;  1F9R A;  4BWG B;  4X62 L;  4JC0 A;  2HIV A;  4QUC A;  4JI1 Q;  5GAH C;  2CKZ B;  1TU2 B;  2RHS B;  3PUW A;  4FXD A;  1EZ6 A;  2KHS A;  1A3U A;  5DM6 3;  1LTG D;  3BDO A;  1JCK B;  1MBY A;  1ML0 D;  2B2U A;  4C2M H;  1S4Z A;  3PMF A;  4A93 G;  3HOX G;  2KCT A;  1HQM C;  2KEE A;  1SE3 A;  1PFS A;  3VYU A;  1CQV A;  2PMZ E;  3DM1 A;  3STB D;  2NB0 A;  1STY A;  2EYH A;  2M2L A;  3KJO A;  4A3M G;  4LUZ A;  1KTK A;  4YWK A;  1XNQ Q;  4HIK A;  3GTL H;  1VMP A;  1KDC A;  4YCU A;  1IBL Q;  3W5O A;  1A0I A;  3HOY G;  2WIN B;  4R1J A;  4A3J B;  4DK1 A;  1A2T A;  1WTX A;  3E9I A;  4LAA A;  2LXK A;  4OON A;  1K3R A;  2F0S A;  3D4D A;  2K14 A;  3EVQ A;  5EGT A;  3PUZ A;  3MWY W;  4JI1 L;  3S2H B;  1AP0 A;  2B29 A;  1DD2 A;  1ENA A;  1KRS A;  1EWC A;  4IZ8 A;  4LFA Q;  4OL7 A;  2Q2I A;  4LFB Q;  1KLU D;  3I4O A;  1NUC A;  3S1R H;  3TRZ A;  1PDQ A;  4I7A A;  4IUQ A;  1QOH A;  3SEB A;  2E2I H;  2KA7 A;  1XPR A;  1ILQ A;  5IE8 A;  5E4W C;  2BH2 A;  5DNF A;  5JOB A;  3OHX C;  3V96 A;  1BXT A;  2FMC A;  5DEH A;  4RAU C;  1FJG L;  4JI4 L;  3GTP B;  5FJ8 H;  1ASZ A;  4JI3 Q;  1X6O A;  3QOJ A;  4K8I A;  4WOR A;  3CCL A;  1TII D;  5CV5 A;  4RKL A;  5T1G A;  1LT3 D;  4BY1 H;  2AWN A;  4A3K G;  1AE3 A;  4PG3 A;  1WTW A;  1PH8 A;  2Z6K C;  2N55 A;  2EE1 A;  3FKI G;  5JEA J;  3J80 E;  4B3M Q;  1W6J A;  5AJ3 L;  2NVQ B;  2HQE A;  1JE4 A;  2EDG A;  1IBM L;  2E76 C;  4LMQ D;  5EAY A;  3CC7 A;  1TWH H;  4DAY A;  3BZK A;  3RNU A;  4TQU S;  1IHZ A;  3GTM H;  2V1C C;  1Y1W B;  1D5X C;  2IPK D;  2ES2 A;  2A1A A;  2RF4 A;  1KAA A;  4LFA L;  1STH A;  2K05 A;  1KDB A;  4OHJ A;  5IWA L;  4RCN A;  1ET6 A;  2SEB D;  1HZ9 A;  4PZ6 A;  1S5B D;  1YJ9 A;  3IAY A;  1QG7 A;  4DR7 L;  3CPF A;  3IL8 A;  1HR0 W;  4A93 H;  4AH6 A;  1EYC A;  3HOX H;  4ODG A;  1XWE A;  3D8G A;  4BBR H;  2JP1 A;  5IP7 G;  1Y1V G;  1NBW A;  1YNN C;  1DJR D;  3GTO B;  1E0B A;  4O2D A;  3FDT A;  5LL6 X;  1Y14 B;  1TR5 A;  2HQL A;  4ZLT F;  3KDF A;  3VA5 A;  1JQY D;  1EU3 A;  3R93 A;  1OO9 B;  1Q8K A;  2F0V A;  1VQI A;  2JQO A;  1EY5 A;  5I2Y A;  5M3M G;  4RGM A;  5HUR A;  3D4R A;  3A7L A;  4FVM A;  1SSO A;  4DV6 Q;  1TQO A;  5I6Y A;  1GOZ A;  4DGZ A;  2R6G A;  4X3S A;  3K58 A;  4DV3 L;  1C9O A;  1TWC H;  1I6H B;  4K0K L;  2R7D A;  2RCF A;  2MUY A;  3F2C A;  2TMP A;  3AFP A;  3QR8 A;  4EVO A;  4O1N A;  1PZK D;  1HTL D;  2KJX A;  2KED A;  2OQ0 A;  4C3J B;  1M4V A;  3S24 A;  4E6I A;  2ZTD A;  3CCV A;  5IOC A;  2R3Z A;  2QKI C;  3EIV A;  1EQR A;  2EYP A;  3KUP A;  3OIP A;  2K5H A;  2AHO B;  3CCM A;  1XNR Q;  3FEW X;  1EEI D;  5GRO A;  3F2D A;  4KHP Q;  4JI7 L;  1OTC A;  3KK7 A;  2E74 C;  1WCM H;  5KNB A;  4DUZ Q;  1YEZ A;  4B3R Q;  1HNX Q;  2MFI A;  2OT2 A;  2A73 B;  3CRL C;  3KOJ A;  4DAV A;  4DV6 L;  3SK5 A;  4ZQ3 A;  3DWP A;  4IPG A;  1EYG A;  1VQF A;  1S5F D;  4A4I A;  4DK0 A;  1HNZ L;  2TSS A;  1NMG A;  2JJQ A;  1VQE A;  3S15 B;  1C48 A;  4L6T B;  5COY A;  1BCP F;  5IP7 H;  1HUM A;  4J8Q A;  4V0B A;  1Y1V H;  3KF6 A;  5C4H A;  5J3B A;  4X66 Q;  2Q8R E;  2N88 A;  1LYL A;  3PIO 3;  3WWV A;  4BXX G;  4QIW B;  4EQ5 A;  4KKU A;  2B63 H;  3NEM A;  4A76 A;  1VF7 A;  1BNZ A;  2B8F A;  3CF5 A;  2NN6 H;  1JWU D;  1YZ6 A;  5KIX A;  4B3R L;  2DY8 A;  1IKL A;  1S5C D;  3LWE A;  3GP7 A;  2D9U A;  5C0X J;  1B3Q A;  3HOW B;  1MD2 D;  1NTG A;  3Q24 A;  5A2Q L;  2FJ2 A;  3TDQ A;  2ASB A;  2NVT B;  4AYB G;  2VNU D;  1JR0 D;  3KLW A;  2E2H B;  1ZKO A;  2DN8 A;  1VQ8 A;  3PO3 B;  4DAM A;  3CAM A;  3RLN A;  1RDP D;  3R2T A;  1XPO A;  3HOZ B;  5IIF A;  5EKK A;  5GAG C;  3HZX A;  3IFT A;  1JC7 A;  4KI0 A;  5JEA G;  2R93 H;  3GV6 A;  2UUC Q;  3G6E A;  4AQY Q;  2OEO A;  2QDB A;  3BVM A;  3GD7 A;  1SYF A;  4P72 A;  2ZXO A;  1VQJ A;  2B8G A;  1XMQ Q;  2KCM A;  3HG9 A;  4A3C G;  2CQA A;  2B2W C;  1UNS A;  1YNX A;  5CV8 A;  1X55 A;  4G57 A;  1RKN A;  3F2U A;  3EBE A;  4JI6 Q;  2JA6 G;  4NXM Q;  1YHA A;  2UXB L;  1PZI D;  3AB9 A;  3S16 H;  2YTX A;  1YBY A;  1DON A;  2HIX A;  1PFN A;  1YIT A;  2E2J H;  3J81 i;  1KQS A;  4CHT B;  1VQL A;  1HFN A;  3L9A X;  3Q6S A;  4K2K A;  2I0Q A;  4A3L G;  3CQZ B;  2B2T C;  5GAD C;  1HHV A;  3UDI A;  4RHR A;  3JC6 6;  2OTL A;  3PUV A;  4MNO A;  3BVZ A;  3VYR A;  2N78 A;  2NN6 I;  4POF A;  1IW7 C;  2CH4 W;  4BXX H;  3FVQ A;  4KV6 A;  2RSN A;  5CV4 A;  2F0J A;  1U4P A;  4C2M B;  2XGT A;  1Q90 A;  2R7F A;  1NAP A;  1GUS A;  3W2D A;  2WAC A;  4A3B H;  4A3J H;  1B44 D;  4UP8 A;  3S1Q H;  2Q2T A;  4KN7 C;  2WP8 J;  3K59 A;  5JJL A;  1XYI A;  2YV5 A;  2HD3 A;  4ZYS A;  3LWU A;  4NXM L;  2VQF Q;  2I5L X;  4IFD H;  5ELO A;  1PLF A;  5K36 G;  1B70 B;  4DAP A;  1STG A;  4LJZ C;  4TVA B;  3RUZ A;  5LMN W;  3SXH A;  2F1M A;  3D3R A;  3NTK A;  3TRE A;  1JOR A;  2CCZ A;  3A8I E;  2JN4 A;  1HQR D;  4GOP A;  3CC4 A;  1JJC B;  4QQB X;  3E6Z X;  3C3L A;  2B2Y A;  1X3G A;  4HJ8 A;  4DU9 A;  5CBE E;  1HA6 A;  1A62 A;  3OW7 A;  2Z4I A;  2MHV A;  1QZG A;  2WV6 D;  1GVP A;  1ZYR D;  3S1R B;  3EJI A;  4RGO S;  3CD6 A;  1UE1 A;  4FF4 A;  4JI0 L;  3X3M A;  2E2I B;  4A3C H;  3O13 A;  3RZD H;  2M9V A;  3CME A;  3OOC A;  2LKV A;  4JYA Q;  1CTM A;  1SRU A;  1WTV A;  1F2Y A;  1QNU A;  1EQV A;  3PV0 A;  4H0L C;  1BCP B;  4BY1 B;  3Q23 A;  1A3V A;  4EQO A;  2IX0 A;  3J81 E;  3S2D H;  2PO4 A;  3CU7 A;  1EIY B;  4POG A;  1EFW A;  2F0F A;  4RWS C;  1NY4 A;  2BCO A;  1WTR A;  2Z6B A;  5A35 A;  5EKL A;  2EJF C;  3NBI A;  4JBM A;  1NMF A;  1S3O A;  3PIP 3;  1FGU A;  1JT8 A;  2KHI A;  3GTM B;  1AEX A;  3C2P A;  3OMG A;  5KGU A;  2LFN A;  1JIC A;  3SK4 A;  1PH4 A;  2UU9 L;  3MFG A;  4KKT A;  2JA5 H;  3KYH C;  3S9W A;  5E1F A;  1I4H A;  4WFN 3;  1SLJ A;  2A74 C;  3J7A V;  1LT6 D;  2RCN A;  3MXN A;  1K73 C;  3FMC A;  4A3G G;  4DR2 L;  1PH5 A;  5C0X G;  1I4X A;  5CYU A;  2FXQ A;  3F2B A;  4A93 B;  1RF2 D;  4IFD I;  1VQ9 A;  1E1O A;  3HOX B;  1AZP A;  3K57 A;  4XYO A;  4BBR B;  4BA1 I;  1E1T A;  4CDF C;  2J4X A;  1UE5 A;  3J80 c;  4A3M B;  4HAE A;  1E22 A;  4BS9 A;  5FK9 C;  4IUP A;  2JA7 G;  2B3G A;  3I73 A;  3VR2 A;  4GNX B;  1I6H H;  1EY4 A;  1XX8 A;  3FPP A;  3HOY B;  4JOI C;  4JV5 L;  1Q3L A;  4P73 A;  4X3T A;  4C3J H;  1CZW A;  2F0W A;  1A3T A;  3UE1 A;  2E8G A;  2Z4H A;  1E2W A;  1ICF B;  1E3P A;  2XNA C;  2B39 A;  1EY0 A;  1CHQ D;  1TWC B;  2F4I A;  4X64 L;  4QY7 A;  4DR3 Q;  2AMC B;  2IX3 A;  4WRD A;  4R4T A;  2K6A A;  4XYQ A;  4HJ9 A;  4DR5 Q;  1AW7 A;  2FFK B;  2Y0S E;  2BH8 A;  1C7Y A;  3ER0 A;  2R92 G;  4LF8 L;  1DYQ A;  2G9D A;  3BYT B;  1K83 B;  2PCF B;  3BJU A;  1PH9 A;  2E2D C;  3OWE B;  4KTA A;  4A3K B;  3FKI B;  4HED A;  1PMR A;  4MZ9 A;  2KHJ A;  2DJG C;  1GKH A;  1WCM B;  3S15 H;  4A3D G;  4XIG S;  1G91 A;  5JPM C;  3MVV A;  1BBX C;  2EYJ A;  1MSH A;  2A5H A;  3SK8 A;  2EQS A;  1I50 B;  3PO2 G;  4ME5 A;  1AE2 A;  1HZC A;  3NK9 A;  4TKO B;  4RFB A;  1Y8N B;  1FD7 D;  1WOC A;  2RHQ B;  1JMC A;  4GN3 B;  1Y1V B;  3D0F A;  3GTJ B;  1K3B C;  1G6P A;  4LF5 L;  3F8T A;  4IJH A;  3T4A C;  1R4P B;  3MEH A;  1RCV D;  2A69 C;  2VB3 X;  3TZU A;  4XT3 B;  1AFP A;  3K5M A;  2B63 B;  2NVT H;  1CQF A;  1QE6 A;  2DUD A;  2E2H H;  1JOQ A;  1F2Z A;  2F0I A;  2K33 A;  3DM3 A;  3EA6 A;  3PO3 H;  1CKM A;  2LS0 1;  4KMU C;  5M3M B;  3K8A A;  1Q46 A;  1Z47 A;  3R3O A;  3HOZ H;  1CT1 D;  2L4N A;  3RMH A;  1SE8 A;  1Q7Y C;  2PI2 A;  2ATW A;  1GJX A;  5M5Y H;  3J7Y W;  1VQO A;  4M1U B;  1Y8P B;  2PW7 A;  2G5D A;  3A56 A;  1EU4 A;  4KY5 A;  3VR6 A;  4L8J A;  5C4X G;  4CDD C;  5HGQ A;  1EQT A;  2H1E A;  1IL8 A;  5D65 A;  4PZ8 A;  1VQB A;  3NQT A;  3T56 B;  2UUB L;  3I4M G;  3NTI A;  5M5X H;  3T1H L;  2R92 H;  2AUJ D;  1HR0 Q;  5BR8 Q;  1J8I A;  3BG3 A;  1L1O B;  2BA1 A;  3H09 A;  1BCP C;  1O7Y A;  3J81 j;  2VL6 A;  3OWF A;  4PV1 C;  3TP5 A;  1N34 L;  4BY7 H;  3A5Z B;  1HTP A;  4PQX A;  2EJG C;  2JXM B;  4UY8 C;  1ZXT A;  3H91 A;  3H0G G;  4A3D H;  4K5W A;  2OXP A;  1JB7 A;  3OPO A;  1GUW A;  2A6H D;  1VQD A;  4H13 C;  4A3E G;  5FO7 B;  5IGD A;  2F03 A;  3MXP A;  4O42 A;  3S16 B;  1CA5 A;  2UUA Q;  1E2Z A;  4G7Z C;  2E2J B;  1SND A;  1CFM A;  1T9H A;  3DUZ A;  1V8Q A;  2A6E D;  5EKI A;  4JI2 L;  1TVX A;  4A3F G;  3I91 A;  2F0U A;  2O2L D;  3WOF A;  2E75 C;  2F4V Q;  2HHH L;  1MSG A;  4C1N I;  3I56 A;  3G7L A;  1H95 A;  2AUK A;  1PTO D;  4ZKB B;  4LUO A;  4R4Q A;  1QZH A;  1CUK A;  5IP9 G;  1H9K A;  3KLR A;  3M4Q A;  4GNX C;  2Z0S A;  5JVH 3;  2PZT A;  1ZYR C;  3HEJ A;  3GV3 A;  4A3B B;  2RVL A;  1V1P A;  3S1Q B;  1YJW A;  1DGS A;  1SNC A;  2BE5 D;  3R8B A;  3VYT A;  1SMX A;  2RKS A;  1SNM A;  2IY5 B;  2GVB A;  1K8M A;  2UXC Q;  4CGY B;  3ERQ A;  4NXN Q;  2Z6K A;  1I6V C;  3OIQ A;  4N9T A;  2NTS A;  4AYB B;  5C4X H;  5IGF A;  1JWM D;  2HDL A;  3M7G A;  3NEN A;  4DA2 A;  2XRS D;  3VA7 A;  3I4M H;  1LTA D;  3L2P A;  5CMD A;  1OXX K;  2JEA I;  2F0H A;  1KXL A;  2JSO A;  3KFU A;  3J7Z C;  2VS1 A;  4FDB A;  1DOK A;  5JJK A;  4H02 A;  4H44 C;  1XNQ L;  3K7U C;  1NR2 A;  1HFG A;  4KY7 A;  2MO1 A;  1IBL L;  4HR7 B;  3OSO A;  4DKA C;  2K5N A;  4C3H G;  1K9M C;  1SAP A;  2JA8 G;  1FR3 A;  1PYW D;  5H1S E;  1QUQ A;  3RZD B;  2AQ2 B;  1C0A A;  1VQ6 A;  3J80 L;  3IRB A;  2QIL A;  4NP5 A;  2H4O A;  4DNI A;  2JA6 B;  3P1H A;  4OWT B;  4X3U A;  3SE0 A;  1WTH A;  4A75 A;  2C9O A;  4NXN L;  4A3E H;  1HNW Q;  4CDE C;  3S2D B;  1PTO B;  2WB1 G;  4LFB L;  5EBC A;  5EPL A;  4OWW B;  3I72 A;  5AFW A;  2Q8I B;  4C3I G;  5KYI A;  2LY7 A;  2EOT A;  5JJI A;  4I65 A;  1X3Q A;  1F9P A;  5FLM G;  1JOO A;  4PMW A;  2K7V A;  5CR3 A;  4J6H A;  4JI3 L;  1ICW A;  3HKZ G;  1ESF A;  4A3M H;  4DR4 Q;  4IPC A;  2J7Z A;  1II3 A;  2JA5 B;  1QVC A;  1SR3 A;  4B3M L;  3HOY H;  3SVM A;  1GD7 A;  4UP7 A;  2PQA B;  1LTS D;  3J81 c;  1KLG D;  1YIJ A;  4LF7 Q;  2NYZ D;  1Q81 C;  1N36 Q;  4DV4 Q;  1D1K A;  3T1Y Q;  1IBK Q;  2SDF A;  5J22 A;  2VUM G;  1E24 A;  1AN8 A;  2MJ8 A;  2VB2 X;  2YYZ A;  3A0J A;  3W1G A;  5ELE A;  3HFZ B;  1P16 A;  5KNC A;  4YY3 Q;  4IOC A;  2ZXP A;  1EFI D;  3MFY A;  2YTY A;  4ZCK A;  3H15 A;  4JI8 Q;  4QUF A;  4J15 A;  1V1O A;  2IHF A;  4NMZ A;  5CV7 A;  3T16 A;  1K8A C;  2JA9 A;  1PH7 A;  1X54 A;  3BVG A;  1VQM A;  1GHK A;  3QOL A;  1K83 H;  1L1O C;  4HJ5 A;  2WAQ B;  2L0C A;  4LF9 Q;  4A3K H;  1FNW A;  2YTV A;  3FKI H;  4OX9 Q;  3DEP A;  3I8Z A;  1SEB D;  4UAI A;  5D3D A;  2D62 A;  1N32 Q;  3RD4 A;  3KBX A;  5C3X A;  1O7I A;  3VDY A;  3D31 A;  4QJF A;  4DV4 L;  2GN5 A;  1R9T H;  1O7Z A;  1SYB A;  3F1Z A;  3MA2 B;  2VQE Q;  2EY5 A;  1B9M A;  1I50 H;  1HCZ A;  4LNQ A;  1GUO A;  3GTG B;  1PRT D;  4JBK A;  3M3Y B;  1EOT A;  3SDZ A;  1LT4 D;  1S40 A;  3I4N G;  4OWX B;  4G4K A;  1NSN S;  2XRQ D;  4GN5 A;  1W3S A;  1VQ5 A;  5FLM H;  2NUC A;  3LGJ A;  5LMN Q;  1Z7T A;  2NVX H;  3GTJ H;  1U4M A;  3U4V A;  2WAQ E;  1NJI C;  2JYO A;  3G6J B;  1VMC A;  4C56 C;  5I2X A;  5HY6 A;  1GUG A;  1XNR L;  4OX9 L;  4DV1 Q;  2QA4 A;  4A3G B;  4FNF A;  3S1M H;  3NUC A;  2NBF A;  4KHP L;  1G8Z D;  3RN2 A;  2DNC A;  1DOL A;  4CKE A;  2D5D A;  2XWB B;  4DUZ L;  5M3M H;  1HNX L;  3NSW A;  2KOL A;  2VQE L;  3KLS X;  1JOK A;  2JA7 B;  1RTN A;  1VCI A;  4RHS A;  3HOV G;  3Q8D A;  2B2W A;  1B3A A;  1SDF A;  1U0L A;  5IT9 c;  1S5E D;  3CPW A;  2FIN B;  4OO1 G;  4X66 L;  1LTL A;  2FHT A;  3CCJ A;  5M5Y B;  2EZV A;  3TP6 A;  1SNP A;  4QIW E;  3ITP A;  3MAQ A;  2RSO A;  2F0N A;  4P71 A;  2DJF C;  5IOD A;  3S17 H;  4B9X A;  2A6H C;  1I5F A;  2I5M X;  1PRT B;  1STA A;  2IL8 A;  2KCC A;  2B2T A;  5JVG 3;  2Z1C A;  4X65 Q;  2QEX A;  1BF4 A;  2L11 A;  5M9O A;  3CC2 A;  2CFM A;  5M5X B;  2R92 B;  3SK6 A;  4ZK9 B;  2A6E C;  3K6O A;  5IYB G;  1WJJ A;  2ID0 A;  3QB3 A;  1SJH D;  4CJ1 B;  3PF4 A;  1MHW C;  1TS5 A;  4FXG C;  3STB C;  1U5K A;  1SMY D;  1PTO C;  3TP7 A;  4BY7 B;  1D1I A;  3TZD A;  4DV5 Q;  1A2U A;  3GQB A;  4RGT A;  1EOV A;  2PPB C;  3NWS A;  4ME3 A;  1VDZ A;  4A3D B;  5DM7 3;  3D4W A;  4I7Z C;  1Y1W G;  4DFA A;  5C44 G;  2BE5 C;  1DM0 B;  1GHJ A;  2PNH A;  2UUC L;  1G2T A;  4AQY L;  3M85 A;  2Q2U A;  3PO2 B;  3P75 A;  1JWS D;  4YHH Q;  4A3I G;  4GLX A;  1D5Z C;  1XMQ L;  1N33 Q;  1PFB A;  3PCO B;  4RG1 A;  3U9O A;  4Y52 H;  3QO2 A;  3IKJ A;  1W2B A;  2C5C A;  4JI6 L;  1PYS B;  4B3T Q;  4G7O C;  1JJG A;  1H9S B;  2JK8 A;  1S5D D;  3PUY A;  4FYD A;  3MHB A;  1WD1 A;  2UXD Q;  3CW2 C;  4HJA A;  1SNQ A;  2SOB A;  2QGQ A;  4KD3 A;  1N8R C;  2CH4 A;  3PQI A;  1XMO Q;  3I7F A;  2C35 B;  2N3S A;  4LFC Q;  3HOV H;  4MTK A;  3OYY A;  2RDG A;  3J7A F;  1VS0 A;  1SYG A;  3QG1 A;  4HIM A;  2KQ3 A;  4XDX A;  1D2B A;  1M8A A;  4FF3 A;  2F0M A;  2RA4 A;  5JEA H;  3ULP A;  4TSS A;  1BBU A;  1CKN B;  1BQQ T;  3L7Z C;  4WJ3 M;  2VXW A;  1KIX A;  2F0D A;  2K50 A;  3PIO A;  4OIK A;  1K8O A;  3K7A B;  5C4X B;  1Q1B A;  5ELF A;  3MTS A;  1STE A;  2GA4 B;  1VQG A;  4H7B A;  4RMF A;  5CV9 A;  3I4M B;  2KEN A;  3GTK H;  5IYC G;  4K6L A;  2DNE A;  2RQX A;  2JA6 H;  4P74 A;  2VQF L;  5IGE A;  4GKK Q;  2N8N A;  1EIH A;  3KF8 B;  2F3W A;  5KEE A;  2EYM A;  3GO5 A;  1PTO H;  1XMO L;  1RHP A;  3J81 L;  3SGI A;  1KL9 A;  1LTI D;  4G7H C;  5ELB A;  4A3L H;  1K0S A;  4FXK C;  4JBW A;  1MKH A;  1FVI A;  4ILW A;  3LX0 A;  1I4P A;  1XTC D;  3HS0 C;  2ZM6 Q;  4A3E B;  1U4R A;  3OW2 A;  5C3E G;  5IYD G;  3NBH B;  5JPN C;  2OWO A;  1ET9 A;  3NP8 A;  1VQ4 A;  3TEH B;  1QVF A;  3C1F A;  4JOI A;  1LTR D;  4DV0 Q;  2LSS A;  1AH9 A;  2NVY H;  4ABN A;  2EPB A;  3VR3 A;  4APV A;  1VQN A;  3FRP B;  4JYA L;  3VYS A;  1LM0 A;  4KY6 A;  3GDE A;  4A3F B;  1Q8I A;  1LT5 D;  1SYE A;  1VQ7 A;  4IO9 A;  4DF7 A;  1X3P A;  1GM5 A;  2ZTE A;  1L0W A;  3N52 A;  4DUY Q;  2NWG A;  5K36 H;  3HKS A;  2R7Z G;  4L63 B;  2OTJ A;  2K52 A;  5C4J B;  1PXU A;  4IUU A;  1P8L A;  3B6Y A;  5KYL A;  3DXJ C;  1QB5 D;  1ONL A;  2F0T A;  4Y7N H;  3ND8 A;  4K5X A;  1I94 Q;  2HT1 A;  1RL2 A;  2CQO A;  3HOW G;  3NE5 B;  1SN8 A;  1OXU A;  1A63 A;  2JEB I;  1NNX A;  1X32 A;  3EFX D;  2ZJP A;  1SYC A;  4IAL A;  1I4R A;  1DXM A;  1B8A A;  4OIJ A;  1GO3 E;  4DV0 L;  4N9P A;  4IJL A;  3VR5 A;  4CJ0 B;  1PRT C;  2XTI A;  5DLQ E;  1KNE A;  5IYC H;  4QMG A;  4MIU A;  3C1E A;  4LUV A; 
#chains in the Genus database with same CATH homology
 2HHH L;  3EIV A;  3I56 A;  1EQR A;  1H95 A;  3PUX A;  4LUO A;  3ULL A;  2JE6 I;  2JA5 G;  4R4Q A;  2K5H A;  1CUK A;  1QZH A;  5IP9 G;  4PZ7 A;  4R4I A;  4YWL A;  2AHO B;  3CCM A;  1XNR Q;  3GTG H;  3M4Q A;  1TXY A;  4GNX C;  2Z0S A;  3M3Y H;  5GRO A;  3F2D A;  4KHP Q;  4DV5 L;  4LF6 Q;  4JI0 Q;  4JI7 L;  1OTC A;  1WCM H;  4MTN A;  1XJV A;  4DUZ Q;  1X9N A;  2CWA A;  1YEZ A;  4B3R Q;  1HNX Q;  3OTO Q;  1DGS A;  1YJW A;  3J7A 5;  2MFI A;  1IL2 A;  2K4K A;  3KOJ A;  2ZJR A;  1SMX A;  4DV6 L;  2IY5 B;  2GVB A;  3S2H H;  2UXC Q;  4IPG A;  5ELN A;  1EYG A;  5LMU Q;  5C3E H;  3CCU A;  4YHH L;  2Z6K A;  1ASY A;  4NXN Q;  2MO0 A;  1VQF A;  4DR3 L;  1EWI A;  4UP9 A;  2UUB Q;  4A4I A;  4A3G H;  1N33 L;  2EIF A;  5C4X H;  1YI2 A;  4DR5 L;  1HNZ L;  4LF4 Q;  4YCW A;  1NMG A;  2JJQ A;  1VQE A;  3E0E A;  1YVC A;  3H3V H;  3NEN A;  3I4M H;  5IP7 H;  4B3S Q;  3L2P A;  2JEA I;  1OXX K;  4B3T L;  1UEB A;  5IYB H;  3GTP H;  1Y1V H;  3KF6 A;  5J3B A;  1J5E Q;  1OXV A;  1Q12 A;  1PV4 A;  3UDF A;  4X66 Q;  3KFU A;  1KXL A;  3J7Z C;  2VS1 A;  4FDB A;  2UXD L;  3AFQ A;  2D0P A;  1LYL A;  2UU9 Q;  4H02 A;  5JJK A;  1XNQ L;  3WWV A;  2WAQ G;  3K7U C;  4BXX G;  4EQ5 A;  2R7Z H;  2JA7 H;  2B63 H;  2MO1 A;  3NEM A;  4A76 A;  1IBL L;  4GN4 B;  3PF5 A;  4DKA C;  2K5N A;  4JI3 Q;  4LFC L;  1K9M C;  2MNA A;  1S72 A;  4DR2 Q;  2JA8 G;  3G4S A;  2VY3 A;  2NVQ H;  5H1S E;  3CCS A;  3CF5 A;  1PH6 A;  1QUQ A;  1RIP A;  1C0A A;  1YZ6 A;  1VQ6 A;  3PGZ A;  4B3R L;  3OTO L;  3IRB A;  2D0O A;  2OQK A;  4DAY B;  2F3I A;  5C0X J;  4GKJ Q;  3RR5 A;  4DK3 C;  4GOP C;  5GQO A;  4DNI A;  1Y1W H;  4OWT B;  1M1K C;  1NTG A;  5C44 H;  4A75 A;  4BA2 I;  4A3E H;  4NXN L;  1HNW Q;  1BKB A;  4A3I H;  2F52 A;  2WB1 G;  2ASB A;  4IOA A;  4LFB L;  4DR6 Q;  1Q86 C;  2CWP A;  3FHW A;  3RLF A;  4HJ7 A;  2UUB L;  3S1N H;  3M9B A;  4AYB G;  4OWW B;  2VNU D;  3KLW A;  4LF4 L;  1BBW A;  1VQ8 A;  3G48 A;  4DAM A;  3CAM A;  4JV5 Q;  3RLN A;  5JJI A;  1FL0 A;  3U50 C;  1XPO A;  3M4O H;  3AQQ A;  5FLM G;  3K0X A;  5GAG C;  4PMW A;  4X62 Q;  4HIO A;  4JI3 L;  3HKZ G;  4GKK L;  4KI0 A;  1OXS C;  4KHZ A;  4P75 A;  1Z9F A;  5JEA G;  3A5U A;  3GTO H;  2R93 H;  4A3M H;  4DR4 Q;  2UUC Q;  4IPC A;  3G6E A;  4AQY Q;  1JJ2 A;  3GD7 A;  4X64 Q;  4L5R C;  1QVC A;  1SR3 A;  4P72 A;  2EXD A;  3ULJ A;  4OO1 I;  1VQJ A;  4B3M L;  3HOY H;  1XMQ Q;  2KCM A;  3KDF B;  1GD7 A;  4UP7 A;  4A3C G;  2PQA B;  3KJP A;  3J81 c;  2ZJQ A;  4BBS G;  1XTD A;  1YIJ A;  1YNX A;  4LF7 Q;  1X55 A;  1Q81 C;  4NPS A;  1YHB A;  5GAE C;  1N36 Q;  4DV4 Q;  3U4Z A;  3T1Y Q;  3CCQ A;  1K8G A;  5C0X I;  1IBK Q;  2PI2 E;  3EBE A;  4JI6 Q;  2JA6 G;  2VUM G;  4LF8 Q;  4NXM Q;  2ZM6 L;  1YHA A;  1E24 A;  3H3V I;  2YYZ A;  2AKW B;  3A0J A;  4BY1 G;  3W1G A;  3JAM i;  3HFZ B;  1P16 A;  3PO2 H;  4YY3 Q;  2UXB L;  2A8V A;  4GNX A;  3S16 H;  4IOC A;  2YTX A;  1KD1 C;  1YBY A;  2IX1 A;  2HIX A;  3L0O A;  2I5H A;  2NZO A;  1G29 1;  2YTY A;  1PYB A;  1YIT A;  3J81 i;  2E2J H;  3H15 A;  1KQS A;  1VQL A;  3PO3 G;  4DV7 Q;  1Q82 C;  1VQC A;  4JI8 Q;  1UWV A;  2I0Q A;  4J15 A;  4A3L G;  2IHF A;  2IT1 A;  5GAD C;  1K8A C;  1NE3 A;  4IPH A;  3UDI A;  3JC6 6;  3HOZ G;  2OTL A;  2JA9 A;  1PH7 A;  1X54 A;  3PUV A;  4MNO A;  1VQM A;  1HR0 L;  2N78 A;  5BR8 L;  2NN6 I;  4POF A;  1K83 H;  4DUY L;  1L1O C;  4QGU A;  1LUZ A;  4HJ5 A;  2Q2H A;  4BXX H;  1V1Q A;  4A3K H;  4LF9 Q;  4IPD A;  1MJC A;  2GVA A;  1PH3 A;  4AIM A;  2XGT A;  2YTV A;  3AYH B;  3FKI H;  4JCV E;  2A19 A;  4OX9 Q;  2R7F A;  1VQA A;  1HZA A;  2D62 A;  1N32 Q;  2VUM H;  4A3B H;  4A3J H;  4UP8 A;  1O7I A;  1TWG H;  3VDY A;  4XTC S;  3D31 A;  4QJF A;  4KLK A;  4BBR G;  1I94 L;  2WP8 J;  4DV4 L;  2Q2T A;  3S1Q H;  5JJL A;  2GN5 A;  1WYD A;  2Y0S G;  2YV5 A;  1R9T H;  1MJE A;  1FJG Q;  4JI4 Q;  4NXM L;  1X56 A;  2ZTC A;  3F1Z A;  1A8V A;  2VQE Q;  2VQF Q;  1EQQ A;  4LF5 Q;  2K5V A;  1TWA H;  2I5L X;  5ELO A;  1I50 H;  5IYD H;  5K36 G;  1B70 B;  2UUA L;  2ALY B;  1KHI A;  4LW1 A;  4LNQ A;  4BY7 G;  4JBK A;  3K7A H;  1IXR A;  4TVA B;  5LMN W;  1UE7 A;  1S40 A;  3I4N G;  3TRE A;  4DV7 L;  1V43 A;  1SRO A;  4OWX B;  5AJ3 Q;  2CCZ A;  4GN5 A;  2IHE A;  4DK6 C;  1W3S A;  1IBM Q;  4GOP A;  1VQ5 A;  3CC4 A;  2OCE A;  1JJC B;  4QQB X;  5FLM H;  4JI5 Q;  1CKO A;  3LGJ A;  2F4V L;  5LMN Q;  1X3G A;  4HJ8 A;  1VQH A;  2NVX H;  3GTJ H;  3CXC A;  1A62 A;  3NEL A;  4DV2 Q;  3KF6 B;  1CKN A;  2N49 A;  3U4V A;  2WAQ E;  1PA6 A;  1NJI C;  1VQK A;  1QZG A;  4DPG A;  3CCR A;  5HY6 A;  1GVP A;  1XNR L;  5IWA Q;  3I2Z A;  4OX9 L;  4DV1 Q;  2QA4 A;  3S1M H;  3CD6 A;  4KHP L;  4DR7 Q;  4LF6 L;  1UE1 A;  4IFD J;  3RN2 A;  4JI0 L;  4A3C H;  4R4O A;  3RZD H;  3CME A;  4BBS H;  4DUZ L;  1QUQ B;  5M3M H;  3ERS X;  3H0G H;  1HNX L;  3E9H A;  4JYA Q;  1Q1E A;  1SRU A;  3T1H Q;  3HOW H;  1IZ6 A;  4L5S A;  1VQP A;  2UXC L;  1KRT A;  2VQE L;  1KAW A;  3PV0 A;  3PIP A;  4GS3 A;  5LMU L;  1YHQ A;  1XPU A;  2WFW A;  2WB1 E;  1HZB A;  1J6Q A;  2IX0 A;  1G6P A;  3S2D H;  4AYB E;  1L2F A;  4EX5 A;  1VCI A;  1N34 Q;  1EFW A;  1EIY B;  1PH2 A;  4POG A;  1NY4 A;  3HOV G;  4GLV B;  3Q8D A;  3FP9 A;  1U0L A;  1EIF A;  5IT9 c;  1WCM G;  3K80 C;  3CPW A;  4JBM A;  1NMF A;  1S3O A;  1X3E A;  1PHJ A;  4X6A H;  1HH2 P;  4B3S L;  1FGU A;  4A3F H;  2KHI A;  3HKZ E;  4JI5 L;  4WJ4 A;  1JT8 A;  1J5E L;  4DV2 L;  4OO1 G;  4X66 L;  1LTL A;  3CCJ A;  1PH4 A;  2UU9 L;  4QIW E;  2LXJ A;  4DV3 Q;  1PVO A;  2JA5 H;  1X65 A;  3KYH C;  3M7N A;  4P71 A;  5IP9 H;  3S17 H;  3S14 H;  1SLJ A;  5C4J H;  3I55 A;  2E5L Q;  2RCN A;  3AEV A;  3M4P A;  1I3Q H;  1K73 C;  1MIU A;  4A3G G;  4K0K Q;  1I5F A;  1HJP A;  2AWO A;  2I5M X;  5C0X G;  4DR2 L;  1PH5 A;  2FXQ A;  3F2B A;  4O0A A;  4IFD I;  1YJN A;  1VQ9 A;  4X65 Q;  1E1O A;  2QEX A;  1E7Z A;  3CC2 A;  5M3F G;  4JI2 Q;  4BA1 I;  2CFM A;  4GKJ L;  1E1T A;  5IYB G;  1UE5 A;  1WJJ A;  5FJ8 G;  1L1O A;  2ID0 A;  3J80 c;  2HHH Q;  1HNW L;  3UDG A;  3BZC A;  3PF4 A;  1E22 A;  4L5Q A;  3G71 A;  3STB C;  1U5K A;  4DR6 L;  1M90 C;  2JA7 G;  2B63 G;  2B3G A;  4GNX B;  1I6H H;  3MEF A;  4QL5 A;  1B7Y B;  2YU9 H;  2VZA A;  4JOI C;  4JV5 L;  4P73 A;  4DV5 Q;  2NN6 G;  4JI7 Q;  1EOV A;  3RZO H;  4C3J H;  3J80 i;  4ME3 A;  3UDX A;  3CQZ H;  3UE1 A;  2E8G A;  4X62 L;  4JC0 A;  2HIV A;  1E3P A;  1Y1W G;  5C44 G;  4JI1 Q;  5GAH C;  4DR4 L;  2PNH A;  2CKZ B;  2RHS B;  2UUC L;  3PUW A;  4AQY L;  3M85 A;  2Q2U A;  4YHH Q;  4A3I G;  4X64 L;  1X3F A;  4QY7 A;  4GLX A;  2K75 A;  2E5L L;  4DR3 Q;  2AMC B;  4C2M H;  4R4T A;  4C3H H;  3CP0 A;  1XMQ L;  1N33 Q;  2JA8 H;  1EUJ A;  4HJ9 A;  4DR5 Q;  3PCO B;  1HNZ Q;  4RG1 A;  4A93 G;  2MQH A;  3UE0 A;  3ZJY C;  4ALP A;  4Y52 H;  3HOX G;  4LF7 L;  2KCT A;  1N36 L;  2Y0S E;  4R4C A;  2BH8 A;  1C7Y A;  1WI5 A;  3ER0 A;  3T1Y L;  1W2B A;  1IBK L;  2R92 G;  1PFS A;  4JI6 L;  2PMZ E;  1PYS B;  4B3T Q;  4LF8 L;  3STB D;  4DR1 Q;  1JJG A;  2R93 G;  2JK8 A;  4GLA C;  3KJO A;  3BJU A;  3PUY A;  4A3M G;  4LUZ A;  1PH9 A;  2UXD Q;  1IYJ B;  3CW2 C;  4YY3 L;  4YWK A;  1XNQ Q;  4HIK A;  3GTL H;  4HJA A;  1N8R C;  4YCU A;  2QGQ A;  4MZ9 A;  1IBL Q;  1XMO Q;  3W5O A;  4C3I H;  3HOU G;  1A0I A;  2C35 B;  2KHJ A;  2N3S A;  3I7F A;  3K81 C;  4LFC Q;  4R1J A;  2L15 A;  3HOV H;  3HOY G;  3OYY A;  5E7N A;  4JI8 L;  1VS0 A;  1GKH A;  3S15 H;  3TS0 A;  4HIM A;  3CCE A;  3EN2 A;  3E9I A;  4OON A;  2LXK A;  4A3D G;  4GOP B;  2KBN A;  3BU2 A;  1K3R A;  4XIG S;  2K14 A;  3PUZ A;  4JI1 L;  2B29 A;  2EQS A;  1KRS A;  3ULP A;  1BBU A;  3U58 A;  1CKN B;  3L7Z C;  4LFA Q;  1KC8 C;  3PO2 G;  4LF9 L;  4JBJ A;  1AE2 A;  1HZC A;  2Q2I A;  3A74 A;  4LFB Q;  1KIX A;  4WJ3 M;  3I4O A;  2K50 A;  3S1R H;  3TRZ A;  3PIO A;  1Q1B A;  1N32 L;  2E2I H;  1V9P A;  1XPR A;  5IE8 A;  1VQG A;  2BH2 A;  4RMF A;  1WOC A;  5M3F H;  2RHQ B;  1K0R A;  4HID A;  2KEN A;  1JMC A;  3GTK H;  5IYC G;  4GN3 B;  1FJG L;  4JI4 L;  5FJ8 H;  3D0F A;  4P74 A;  1ASZ A;  1X6O A;  3RLO A;  2VQF L;  4DR1 L;  4YCV A;  3CCL A;  2N8N A;  3F8T A;  4IJH A;  3KF8 B;  4LF5 L;  4YWM A;  3GTQ H;  4GKK Q;  4BY1 H;  3GO5 A;  2AWN A;  4A3K G;  1AE3 A;  4PG3 A;  1PH8 A;  2Z6K C;  2NVT H;  5M5W H;  1XMO L;  3FKI G;  5JEA J;  3DLL A;  2JA6 H;  2DUD A;  2H5X A;  2E2H H;  3PSI A;  3SGI A;  4B3M Q;  3DM3 A;  5AJ3 L;  3PO3 H;  1KL9 A;  3RN5 A;  3TS2 A;  1CSQ A;  1CKM A;  4A3B G;  4A3J G;  1IBM L;  5EAY A;  3CC7 A;  4A3L H;  1TWH H;  3K8A A;  1Q46 A;  4JBW A;  1Z47 A;  1MKH A;  3BZK A;  3RNU A;  3HOZ H;  4TQU S;  1CSP A;  3GTM H;  5LMN L;  1FVI A;  2V1C C;  1SE8 A;  1Q7Y C;  2PI2 A;  2F4V Q;  2ATW A;  1JE5 A;  4OXP A;  5M5Y H;  2ES2 A;  2ZM6 Q;  2A1A A;  2RF4 A;  3OW2 A;  5C3E G;  1VQO A;  4LFA L;  5IYD G;  3NBH B;  2OWO A;  1TWF H;  4IFD G;  2UXB Q;  1VQ4 A;  3TEH B;  5IWA L;  1QVF A;  4JOI A;  1HZ9 A;  4PZ6 A;  4DV1 L;  1YJ9 A;  1OXT A;  4DV0 Q;  2LSS A;  3MXN B;  4DR7 L;  5C4X G;  1AH9 A;  2NVY H;  3CPF A;  5HGQ A;  1HR0 W;  4A93 H;  4AH6 A;  4APV A;  3HOX H;  1VQN A;  4PZ8 A;  1VQB A;  4NB3 A;  4JYA L;  1D7Q A;  1LM0 A;  4JG2 A;  4BBR H;  3I4M G;  3GDE A;  1SFO H;  5M5X H;  5IP7 G;  3T1H L;  2R92 H;  1VQ7 A;  1G51 A;  4IO9 A;  1Y1V G;  1NBW A;  2NZH A;  1QVG A;  3TQY A;  5BR8 Q;  3W1B A;  2VW9 A;  1HR0 Q;  1L1O B;  1GM5 A;  2BA1 A;  2ZTE A;  1L0W A;  4DUY Q;  4O2D A;  1Y14 B;  3HKS A;  2R7Z G;  3J81 j;  5IY0 A;  2HQL A;  2K52 A;  2OTJ A;  2VL6 A;  1N34 L;  4BY7 H;  3A5Z B;  2DGY A;  3JAM c;  1WFQ A;  3HOU H;  1P8L A;  3B6Y A;  3KDF A;  1PH1 A;  3I4N H;  2PQA A;  4UPA A;  3CMA A;  1Q8K A;  4UY8 C;  1UE6 A;  1VQI A;  4Y7N H;  2JQO A;  5M3M G;  3H0G G;  4A3D H;  1I94 Q;  2HT1 A;  1RL2 A;  2CQO A;  3HOW G;  1JB7 A;  4DV6 Q;  1SN8 A;  1OXU A;  1A63 A;  2JEB I;  2R6G A;  4A3E G;  1VQD A;  1D8L A;  4DV3 L;  1C9O A;  2ZJP A;  1TWC H;  1B8A A;  2UUA Q;  1GO3 E;  5FLX c;  1BVS A;  2R7D A;  4DV0 L;  4K0K L;  3F2C A;  3AFP A;  4IJL A;  3ICE A;  1T9H A;  4X65 L;  2OQ0 A;  2XTI A;  4JI2 L;  2BA0 A;  3S24 A;  5DLQ E;  5IYC H;  4A3F G;  2ZTD A;  4LWC A;  1N9W A;  4LUV A;  3CCV A;  4L5T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...