4DUZQ

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u13c, bound with streptomycin
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
99
structure length
99
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
total genus 18
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4duzQ00
1QUQA 3UDXA 1SE8A 4R4IA 3E0EA 2CWPA 1E22A 4IPCA 5M5XH 3RNUA 4LF5L 5FLMG 4DV2L 1UE6A 2PI2E 3H3VH 3A74A 2ZJQA 2ZM6Q 4JI6Q 1VQ7A 4AYBE 4LF7L 1WCMG 2NVTH 4JI4Q 3HOXH 4GLAC 2VUMH 2MO0A 4NXNL 4BBSH 2YTXA 4IFDI 1K83H 4IFDG 2HQLA 1HZ9A 5DLQE 5IYBG 1Q12A 1B70B 1KRTA 1HR0W 3KF8B 4A3LG 4A3CH 2PMZE 2UUCQ 1QVCA 4P73A 2VQEQ 1YJ9A 3CCQA 1R9TH 3M9BA 1SMXA 3ER0A 1NY4A 2DUDA 2K5VA 1W2BA 1TWFH 1VQ8A 2JEAI 4JI3Q 5C44G 1VQKA 2CQOA 1KAWA 2VL6A 4KHZA 1QZGA 4X66Q 1PH2A 1J5EQ 1IBMQ 3HKZE 4JI5Q 3S16H 1SLJA 4X64Q 1B8AA 4A3EH 2AHOB 2PQAA 3SGIA 4C3JH 2JA8H 5C4XG 1PH7A 1EOVA 1XJVA 3K80C 2AWOA 2JEBI 1VQDA 4DR6Q 2JA5G 1Q8KA 1BVSA 1A0IA 1I94L 2E2JH 5C4JH 4DR5Q 1WJJA 1YHBA 1NE3A 1MKHA 3BJUA 1H95A 2ZM6L 4JI6L 1VQLA 1VQGA 1IBKQ 1N32L 2IY5B 1D7QA 3KJOA 4GNXB 2JA6G 3PUWA 4JC0A 1CSQA 5M3MH 5M3FG 1AE2A 2F4VQ 4HIOA 1Q82C 3JAMc 4GKKQ 2N49A 3S15H 1UWVA 2UUCL 1IZ6A 4DR4Q 3PO2G 1YITA 3HOYH 4R4CA 4B3MQ 4EQ5A 5GADC 4YY3L 2N3SA 3RN5A 4HJAA 3F8TA 4BY7H 1T9HA 3PIOA 4LUOA 2OCEA 4X66L 1YI2A 3CAMA 1IBML 4JI5L 2CWAA 1C9OA 3K7UC 1I3QH 3GTGH 2AWNA 3ZJYC 2QA4A 4BXXG 1Q86C 4GNXA 1YNXA 3J81c 2VS1A 2R7ZH 3RZOH 4DR6L 1XTDA 2MQHA 4KI0A 3GTLH 3A5UA 3U4VA 1PVOA 3FHWA 4GN3B 3T1HQ 1VQ9A 4JG2A 1A63A 3TS2A 3S17H 1IBKL 1X56A 5E7NA 2CKZB 5IP7H 3OW2A 4KLKA 1TWAH 1KC8C 4A93H 4IOAA 1G6PA 4PG3A 3U4ZA 1IBLQ 2UUBQ 3PUZA 4JYAQ 1A8VA 1XNRQ 4MZ9A 1E3PA 1K73C 2B63G 2AMCB 4LW1A 2MNAA 3FKIG 3K0XA 1E24A 2B3GA 3PCOB 3PV0A 3RLNA 1HJPA 3F2CA 3CCRA 3I2ZA 5HGQA 2ZJRA 2HIXA 2UUAQ 1PH3A 1XNQL 3HOZG 3CCLA 4YCVA 1I6HH 1E1TA 1FL0A 1FGUA 1KL9A 2WAQE 4QJFA 3TREA 1BBUA 4B3TL 2RHSB 3CCUA 3KLWA 5IT9c 4WJ4A 5K36G 1Z47A 2I5HA 4QQBX 2D62A 1TXYA 4P71A 4HIMA 3HOVH 1OXTA 4BY1H 3M3YH 3MXNB 3CC7A 1K3RA 1K8AC 5LMUQ 4RMFA 3CCVA 2JA7H 2ATWA 1L2FA 1L0WA 3IRBA 2QEXA 4QL5A 1XMOQ 1VCIA 3M4QA 2EIFA 4DAYB 1VQCA 2ZTDA 3PUVA 2K52A 3KJPA 2RF4A 1IBLL 1Y1WH 2BA0A 3PF5A 1GKHA 2ZTCA 4LUZA 1NTGA 1EYGA 1VQ6A 3AEVA 4BA2I 3HOUH 2UUAL 3BU2A 1HH2P 2K50A 4IO9A 4GN4B 2MO1A 1SRUA 4B3SQ 2HHHQ 2CFMA 2HIVA 4QIWE 5BR8Q 1I94Q 1WFQA 2OTJA 2WAQG 4DUYQ 5IYCG 2XGTA 4HIDA 1X55A 4BBRH 1NBWA 4DV0L 2Q2TA 1N32Q 2RCNA 4QY7A 3M7NA 3ICEA 1OXVA 1TWCH 3PUYA 5C3EH 1SROA 2JK8A 1X3EA 3EIVA 4IFDJ 5GAHC 2K14A 5C0XJ 2I0QA 5LMUL 4KHPQ 3D31A 4AH6A 3S1QH 3H15A 3W5OA 1I50H 5FLXc 3HOWG 2I5LX 4GNXC 4YHHQ 4AQYQ 3DLLA 4A3BH 1PH1A 3BZCA 2UU9L 2Q2HA 5FJ8G 1XMOL 2VW9A 1L1OB 1HNZL 1UE5A 1C7YA 4YY3Q 4BA1I 1O7IA 3GTPH 4K0KQ 2R92G 1W3SA 4PZ8A 5JEAJ 1EFWA 1HNXL 1AH9A 3PUXA 4A3IG 1NMFA 5AJ3Q 3I55A 2ZJPA 4Y7NH 3CMEA 3J7A5 3GD7A 4FDBA 3PO3H 1WI5A 4IPGA 2KENA 4OWWB 1PYBA 1K9MC 2L15A 2VNUD 4OWTB 2Y0SE 4A3KG 4B3SL 1VQEA 4GOPB 1S72A 2HHHL 1CKNB 2N8NA 3KDFB 5BR8L 3H0GH 1QZHA 4JBKA 1VQMA 3ULJA 1X3FA 1EIYB 1U0LA 2NN6G 2OTLA 4O0AA 2NN6I 4DUYL 2K5NA 2UXCQ 1NJIC 3I4MG 3CP0A 2K75A 3U50C 3RR5A 5IYDH 4A3JH 2UXDL 1L1OA 4APVA 4DUZQ 5GAGC 1YIJA 1PV4A 3ERSX 4IPHA 1JMCA 4KHPL 3B6YA 4X6AH 2ES2A 3CXCA 1OXSC 1VQOA 5GAEC 4DK6C 4YHHL 4AQYL 3KFUA 3GDEA 4YWMA 3S1MH 3F2DA 4A3FG 3CCJA 3CD6A 3S1RH 2E5LQ 1Z9FA 2WP8J 5IWAL 1VQNA 1XNQQ 4K0KL 3CW2C 4OXPA 3WWVA 1IYJB 2JJQA 1N33L 3G48A 1WOCA 5AJ3L 2NVYH 4B3TQ 3OYYA 3PSIA 4DAMA 5IP9H 2E2HH 2F52A 1M1KC 4EX5A 2GN5A 2QGQA 4A4IA 3F1ZA 3VDYA 1OXUA 5LMNQ 4OWXB 4A3MG 2NZHA 1VQ4A 3I4NH 1S3OA 3GTQH 3RZDH 2BH8A 4PZ7A 1PA6A 2VZAA 3NEMA 2RHQB 4A3GG 3KF6B 2E8GA 4JV5Q 1P8LA 2KHJA 3L0OA 4UP8A 1VQIA 3PIPA 5FLMH 2KCTA 1VQ5A 4UY8C 2XTIA 3GTJH 3CQZH 2Y0SG 2UXCL 2EXDA 2R7FA 4DV5Q 4ALPA 5HY6A 2HT1A 1WCMH 1N8RC 4MTNA 2R7DA 1CSPA 4GS3A 4DUZL 1IXRA 3UDGA 4LFBL 5IYBH 2F3IA 4LFCQ 2JA9A 3STBC 3AFPA 1RIPA 4HIKA 1EQRA 3OTOQ 3S24A 4B3RL 4A3LH 3S1NH 3H3VI 1KXLA 1Q46A 4LF4Q 4YCUA 1VQBA 2V1CC 3HFZB 3MEFA 3HOXG 2VUMG 4BBSG 4DV3Q 3S14H 2E5LL 3AYHB 5C44H 3CCSA 4DV6L 3BZKA 1N36L 3KF6A 2JE6I 4DR1Q 1PH9A 4LUVA 2OQ0A 4A3CG 3RLFA 3CC4A 5GQOA 3UE0A 4LF9Q 3PF4A 1LYLA 5LMNL 3KOJA 5C4XH 1CUKA 1UEBA 4DV0Q 4LF8L 3J7ZC 3W1GA 1BBWA 1I5FA 1SFOH 5JJKA 2JA5H 2ZTEA 4JV5L 1VQHA 2FXQA 1GD7A 2LSSA 2IHEA 3HKSA 4JBMA 1JT8A 2Q2UA 1KRSA 4X65L 4LWCA 5H1SE 4DV5L 3ULPA 4A3EG 1KHIA 1N34Q 2JA8G 3NBHB 3PO3G 2D0OA 2IT1A 4P72A 2UU9Q 1MIUA 1G291 2JA6H 1HNZQ 1TWHH 2OWOA 3NENA 5M3FH 3L7ZC 1KD1C 1RL2A 2KCMA 4NXML 2BH2A 4LFCL 3CF5A 1Y1VH 4LNQA 1HNXQ 3OTOL 1VQFA 1V1QA 5ELOA 3TQYA 1L1OC 4LF4L 4JI1L 3PO2H 5EAYA 1CKMA 3CPFA 4DV3L 1QUQB 4O2DA 2UXBL 4DV1Q 5M3MG 4Y52H 1JJCB 3K8AA 4JBWA 5J3BA 4PMWA 3STBD 4DR3L 2VQFQ 3G4SA 4DR2L 3CMAA 4C3HH 2ALYB 5JJIA 4DR1L 1XMQQ 3TS0A 5JJLA 2BA1A 5IE8A 4JI8Q 4YWLA 4LF9L 3A0JA 3NELA 5LMNW 3HOYG 1C0AA 4BXXH 4GOPC 2ID0A 1FJGL 4JBJA 4DPGA 2UXDQ 3CCMA 1YHQA 1IL2A 4BY7G 3G6EA 4GKJQ 4J15A 5M5WH 1VQPA 1HZCA 1PH5A 1SN8A 3F2BA 3JC66 1PHJA 1N34L 1A62A 4JI0Q 4R4TA 4DNIA 1GM5A 4MNOA 3UDIA 3M85A 2R7ZG 3W1BA 5IWAQ 3CCEA 1U5KA 1XPRA 4DKAC 1N33Q 2B63H 3CC2A 2PQAB 4P74A 3FKIH 3S2DH 1TWGH 1UE1A 4UPAA 5IP7G 1UE7A 2NZOA 4DV1L 4A93G 4TQUS 1YBYA 1OXXK 5C0XG 5C0XI 3HOZH 2K4KA 4AIMA 4A76A 2VQFL 2A19A 1BKBA 3J80i 4HJ7A 3PGZA 2R6GA 4OX9L 4XIGS 1XMQL 1PFSA 4YWKA 4OONA 1E1OA 4JI8L 2VY3A 2E2IH 4POGA 5M5YH 2YTVA 4DV7Q 3TRZA 1MJCA 2WB1G 1HZAA 1YZ6A 3RLOA 4LF6Q 2KHIA 2Z0SA 2PI2A 2YTYA 3DM3A 2KBNA 5JEAG 3T1YQ 2R93H 2B29A 3RN2A 1EQQA 4GKJL 2AKWB 4JOIA 4LFBQ 4UP9A 4JI2Q 4ME3A 3J81j 4L5QA 4JI7Q 4A3DH 3GTOH 4B3RQ 3A5ZB 4JI0L 3M4OH 2LXKA 3HOVG 2Z6KC 1FVIA 3E9HA 1OTCA 2DGYA 4BY1G 1XPOA 3D0FA 5ELNA 2YU9H 4DV6Q 2JA7G 1G51A 4GOPA 3AQQA 1N36Q 1V43A 1CKNA 3KDFA 4C2MH 1K0RA 1HNWQ 3K7AH 1X6OA 4L5TA 4H02A 3GO5A 4IPDA 4JI4L 1K8GA 3EN2A 1YJWA 1KIXA 1M90C 4R4OA 4POFA 4LF8Q 3M4PA 4UP7A 3I7FA 1D8LA 3U58A 4DR7Q 4AYBG 1NMGA 3UE1A 4IOCA 1Y1WG 3AFQA 4DK3C 1Y1VG 3GTKH 1P16A 2GVAA 2VQEL 4GLXA 1CKOA 4X65Q 4DV7L 2N78A 2MFIA 5IYCH 2ASBA 3HOUG 4LF6L 2YYZA 1J6QA 4LFAQ 4JI3L 1KQSA 2I5MX 3T1YL 1JJ2A 1VQJA 1PYSB 4IJLA 4XTCS 1J5EL 4NXMQ 3G71A 4JI2L 4JCVE 1X9NA 4JI7L 4X64L 3HOWH 4A75A 2D0PA 4BBRG 1E7ZA 2NVXH 2C35B 3HKZG 4JI1Q 1QVGA 1AE3A 5FJ8H 1LTLA 5C3EG 3GTMH 2UXBQ 1Q7YC 2H5XA 2YV5A 2R92H 4DR3Q 1V9PA 4X62Q 4DR5L 4DR2Q 4A3IH 1HNWL 1HR0Q 2PNHA 4A3BG 3E9IA 3KYHC 1Q1EA 1HZBA 1YJNA 4DR7L 1GO3E 4DV4Q 1S40A 1FJGQ 2F4VL 1SR3A 4A3KH 1PH8A 3FP9A 4P75A 4GKKL 2Z6KA 2IX1A 3Q8DA 1X54A 2OQKA 3TEHB 1VS0A 4DR4L 5GROA 4C3IH 3CPWA 4B3ML 3JAMi 1YEZA 2GVBA 4IJHA 4TVAB 3I4MH 4HJ5A 4LFAL 3L2PA 4HJ8A 1XPUA 4WJ3M 2EQSA 1YHAA 1ASYA 1JE5A 4LF5Q 3H0GG 4DV2Q 2NVQH 4RG1A 1WYDA 4QGUA 5IY0A 1PH6A 4LF7Q 4R1JA 3J80c 4A3FH 1N9WA 4NB3A 4JOIC 3I4OA 5IYDG 4A3JG 3LGJA 1JB7A 4NXNQ 2R93G 2K5HA 2JQOA 1LUZA 2IHFA 3I56A 1MJEA 1JJGA 1GVPA 1Q1BA 1EUJA 4PZ6A 4X62L 3T1HL 4L5SA 1X65A 4GLVB 4A3DG 4OX9Q 4NPSA 3J81i 2WB1E 1HR0L 1LM0A 4YCWA 2CCZA 2A8VA 1Y14B 1DGSA 4A3MH 1ASZA 1EWIA 1B7YB 4GN5A 4DV4L 3S2HH 1VQAA 2UUBL 1QVFA 1Q81C 3ULLA 4HJ9A 1PH4A 4L5RC 1XNRL 3UDFA 4A3GH 3EBEA 4JYAL 2A1AA 5IP9G 4R4QA 2WFWA 3K81C 1EIFA 1YVCA 3I4NG 2Q2IA 2LXJA 1X3GA 4OO1G 4OO1I 2IX0A
chains in the Genus database with same CATH superfamily
2XSCA 1H9JA 1QUQA 1SE8A 4R4IA 1Y69U 4LF5L 5FLMG 1O7ZA 3TP6A 1UE6A 3NQIA 3HP3A 4OL7A 4JI6Q 4AYBE 1WCMG 5CC4A 4JI4Q 2VUMH 2MO0A 4BBSH 5IIFA 1K83H 4TSSA 2HQLA 5FO8B 2XVSA 1B9MA 1I4QA 5DLQE 1STHA 1B70B 4A3LG 1HR0W 1QVCA 1TY2A 3CCQA 1HCZA 3M9BA 1LACA 5CYUA 2DUDA 3T56B 4FF2A 4AYBB 1GJXA 1KAWA 4KD3A 1J5EQ 1IBMQ 3NE5B 4JI5Q 3S16H 5FLXE 1SLJA 2PQAA 3X3NA 2JA8H 1PH7A 2JP1A 3KLSX 3BYYB 1QNKA 1I4RA 1VQDA 2K5WA 5EGTA 1DJRD 4F8MA 1H9RA 4K5VA 4BBRB 4CKCA 4GNXB 1TIID 5M3FG 2WKDA 1LTSD 4RWSC 5DM73 2EJMA 1I50B 1A6XA 5JOBA 1IZ6A 2EXZA 4RKLA 4DR4Q 3PQIA 3NWSA 4B3MQ 4XQJA 1U4LA 4YY3L 2N3SA 4HJAA 5ELBA 3AU7A 2OCEA 1QNUA 1WTWA 4Y7NB 1KAAA 2A6EC 1I3QH 3GTGH 2AWNA 3ZJYC 2QA4A 3C1FA 1BUVT 4GNXA 5E1FA 2VS1A 1FYCA 1XTDA 3U4VA 3H0GB 1BCPB 4HMIA 1VQ9A 4LK1C 2K32A 1IBKL 4ZLTF 5IP7H 2QDLA 1G8ZD 3E3XA 3U4ZA 4MZ9A 4ULLA 1K73C 3NUCA 5C6AA 2EJGC 4MHEA 1HJPA 2XRQD 2ZJRA 2EZVA 4YCVA 5JEAH 2WAQE 2EDGA 3I91A 3GV3A 2K03A 3TREA 1BBUA 3I70A 2PO4A 3VR4A 2K04A 3CCUA 2E2HB 5C4HA 1TKWB 4HAEA 3GTGB 3I4NB 1IYVA 2R61A 3GTQB 5D14A 4O42A 3I90A 3OMCA 3M3YH 4RHRA 2HDLA 3D6CA 3CCVA 3DEPA 4IUQA 2ATWA 3FPUB 1CM9A 2A68C 1G2TA 1XMOQ 1HXYD 4DXFA 3M4QA 2ZTDA 2RF4A 1IBLL 1VQ6A 1JWUD 3BU2A 5C44B 4IO9A 1SRUA 2NUCA 2HHHQ 2HIVA 4E6IA 1B1ZA 2BOSA 2WAQG 2XGTA 5J1ZA 1EY9A 4DV0L 5LHY1 3MXGA 1OXVA 4IUPA 5C3EH 2K14A 4OHJA 1R4PB 1SFOB 2I0QA 3BVMA 3KBGA 5LMUL 2Z6BA 3D31A 3ZYYX 4AH6A 3W5OA 3MZ5A 4ABNA 3HOWG 2I5LX 4GNXC 4KHVA 1STGA 1QB5D 3DLLA 1R4QB 4AQYQ 2DY8A 1PYWD 1C7YA 4YY3Q 1O7IA 2R92G 1W3SA 4KK7A 1HNXL 3KLRA 1Y1VB 2A6HD 3K0YA 3N52A 2PZWA 3K59A 3IAYA 3J7YW 4IPGA 2KENA 2L4NA 2Z8LA 2L15A 2D2CC 2CVRA 4PV1C 4GOPB 1S72A 1CKNB 5BR8L 3ULJA 1X3FA 2OTLA 3DWQA 5I9PA 2UXCQ 2NN6I 4DUYL 1NJIC 2K75A 3HKZB 4K8IA 1AN8A 1SMYC 4IPHA 1LABA 4KHPL 3VR5A 1PTOF 4DK6C 3A7AB 4YHHL 5FKAC 3CD6A 2IW3A 2CW0D 2WP8J 3P20A 5IGEA 4EVOA 5A2QL 3A8JE 5AJ3L 2BDOA 2NVYH 3OYYA 1OXUA 1TWGB 2NZHA 1VQ4A 1SXTA 1S3OA 1WD1A 4CJ0B 3BZDB 2TSSA 4K6LA 4N9PA 1HFGA 1X3PA 1GHKA 2E2IB 2R7FA 4C1NI 5HY6A 5JJZA 3QR8A 2IX3A 2DJGC 2F0NA 4GS3A 2R93B 4QCLA 2F0KA 4LFCQ 2JA9A 3OTOQ 3S1NH 1Q46A 5K5PA 4ZRZA 1VQBA 4LF4Q 2EY6A 3FVQA 3HFZB 3MEFA 4DV3Q 4FF1A 3S14H 2E5LL 3RD4A 2JE6I 3RLFA 2F1MA 3UE0A 4FF3A 5A35A 5LMNL 4XYQA 3KOJA 3EJIA 1CUKA 4DV0Q 2KEEA 1LTBD 5ELCA 5A2QE 3K57A 1U4RA 1BBWA 1I5FA 2JA5H 4CBVA 2A5HA 3ULPA 2A6HC 3R2TA 2OWOA 3NENA 1TS5A 3L7ZC 2QEJC 2XWBB 3CF5A 2MPMA 1HNXQ 1V1QA 3N6RA 2EYHA 3PO2H 1CKMA 1EEFD 3HEJA 4O2DA 5KNCA 4DV1Q 2L0CA 5M3MG 4Y52H 2EVBA 5J3BA 4PMWA 3STBD 4DR3L 2VQFQ 2A73B 4C3HH 5ISRA 5JJIA 4DR1L 1XMQQ 2EY2A 2BA1A 4JI8Q 4YWLA 2Z9HA 1FD7D 4UDUC 2RCFA 4GOPC 3EA6A 1WTQA 5M5WH 2RDHA 4OELB 1HZCA 1E2VA 1SN8A 1A62A 2B8FA 2Z4HA 4DU9A 2N55A 3W1BA 1F2YA 1IKLA 4KN7C 4V0BA 1H9SA 4KV6A 2B63H 3S2DH 4P74A 3FKIH 5T1GA 4WORA 3OSOA 1IYUA 2F0OA 3HOZH 4A76A 2A19A 2R6GA 4ZKBB 4OONA 4A3MB 3RLOA 4CHTB 5EJWA 2PI2A 2KBNA 1V1OA 2R3ZA 2B29A 3R93A 4A3GB 1F9RA 2VXWA 2J7ZA 4M8AA 3GTOH 4JI0L 2I46A 1OTCA 4BY1G 2KJXA 5ELNA 2YU9H 1NUCA 2K6AA 3J81L 3MC0B 5KIXA 4IUUA 3AQQA 3K7AH 4L5TA 3DMUA 1EY6A 3EN2A 2KVMA 1M90C 4HCSA 4R4OA 2IPKD 4UP7A 3I7FA 1K8MA 1DONA 2NB0A 5FO7B 1CI3M 1P16A 5IGGA 4DV7L 5CGKA 3OIQA 5COYA 4KD4A 4LF6L 4JI3L 2I5MX 1JJ2A 1YNND 3CRKC 4IJLA 1HQRD 1NCVA 2LS01 4A3EB 3TZDA 3UI2A 2NVXH 1PZID 2C35B 5FJ8H 5KYLA 1Q7YC 4DR3Q 4DR5L 2E2JB 4XT1B 1HZBA 2O5JC 4DR7L 3J81E 2F4VL 2JN4A 1L0YB 1SR3A 4A3KH 4P75A 3LX0A 2EYPA 2OQKA 5GROA 4C3IH 3CPWA 3I4MH 1YEZA 4TVAB 4LFAL 4I65A 3L2PA 4X3SA 4HJ8A 1JE5A 1LT6D 4RG1A 4QGUA 4LF7Q 1EY7A 2NVXB 3J80c 4A3FH 1N9WA 1S5FD 5IYDG 1HTLD 3LGJA 2H1EA 4NXNQ 1LUZA 2IJ0A 1Q1BA 4PZ6A 1EWCA 3J81i 5EPKA 1XXGA 1HR0L 1XTCD 4YCWA 1F2LA 3NBHA 4B08A 1ASZA 4A93B 3C1EA 3S2HH 4DNTB 2UUBL 2F03A 1MSHA 4HJ9A 3UDFA 1G2SA 5C5MA 3T13A 5IP9G 2WFWA 3K81C 2A69D 4TKOB 4C3IB 3GD7A 1I6HB 5M5XH 1GUTA 3MTSA 1EY4A 1LT3D 1WTVA 1SE3A 1VF5C 1STNA 4TRDA 2NVTH 2ZM6Q 1EIGA 2SEBD 4RFBA 2YTXA 2JA7B 2VB3X 3KF8B 4A3CH 3JAML 1MHWC 5EKLA 1YJ9A 1R9TH 1JOOA 1SMXA 5ELEA 1JWMD 2K5VA 2EE1A 2SDFA 1TWFH 4KTAA 2JEAI 4JI3Q 3S2HB 1VQKA 2CQOA 2VL6A 2F0HA 1I4XA 3AB9A 3AMUA 2AHOB 5C4XG 1STEA 1KDBA 3HOUB 4KY6A 4HR7B 1BVSA 4FF4A 2B2VA 4DR5Q 4CKBA 3A8KE 2F4IA 3KF8A 1SSOA 1NE3A 2ZXRA 1H95A 4JI6L 1VQGA 2JA6G 1TWCB 4JC0A 2O5IC 2F4VQ 3JAMc 2N49A 1UWVA 4A3BB 3LWEA 3HOYH 3F8TA 4BY7H 4X3UA 4NDXA 1YI2A 3CAMA 1IBML 4JI5L 4K5XA 5I9OA 2CH4A 5NUCA 5IT9L 1Q86C 3QOLA 1HTPA 1YNXA 3KUPA 2R7ZH 3RZOH 1U4PA 2MQHA 1NR2A 3D4DA 3FHWA 4GN3B 4Z9CB 5E4XA 1PVOA 1LTID 4JG2A 3U9OA 5JPNC 1GUNA 1UUPA 2B39A 5E7NA 1K3BC 2K05A 3OW2A 4A3JB 4KLKA 3K58A 1O7LA 1KC8C 2UUBQ 3PUZA 2L1BA 1SNMA 2AMCB 3VR3A 2MNAA 1E24A 4FP5D 3S1MB 1Y8OB 3HOYB 3GV6A 2HIXA 3S1RB 2UUAQ 1PH3A 1XX8A 1FNUA 2K1BA 4B3TL 4DGZA 5IT9c 5K36G 1Z47A 3A7LA 1TXYA 4P71A 4HIMA 3HOVH 4EQNA 2B8GA 5AFWA 1OXTA 2RSOA 4XDXA 1K8AC 3SVMA 3CQZB 2OEOA 3IRBA 1J9OA 4PMBA 2B2VC 5FOBB 1VCIA 3QIAA 1PRTB 4UHVA 3I73A 2Q8TA 5T1IA 2F0QA 1Y1WH 2HD3A 2X69A 3PF5A 4N9TA 3FPPA 1M8AA 1GKHA 5DM63 4LUZA 3NQTA 2HDMA 3AEVA 4BA2I 1UNSA 3J7AF 3IFTA 5I6WA 5JVH3 1HH2P 3E6ZX 4FXGC 3VA5A 4QUFA 1SNOA 2CFMA 2OTJA 2Q2TA 4HIDA 4BBRH 5G3LD 4QY7A 4DA2A 3HOVB 1SROA 5GAHC 1MGSA 5C0XJ 1I50H 5FLXc 1CA5A 3BZCA 2Q2HA 3VYSA 1XMOL 2VW9A 5EBCA 1UE5A 1TWHB 5M3FB 4NMZA 2K5QA 1H9MA 1Y1WB 3CRLC 4A3IG 3BYTB 1OO9B 5IGCA 4Y7NH 2AQ3B 3BVZA 4ZUIA 3CMEA 2A68D 2JYOA 4FXKC 2E75C 1CTMA 5EKKA 1BR9A 1PYBA 4OWWB 4KKUA 2HHHL 1I6VC 3KDFB 4IUNA 3H0GH 2FHTA 5ELFA 4JBKA 1VQMA 3MWYW 1EIYB 1DOLA 1U0LA 2NN6G 1DM0B 3VYTA 4NP5A 3U50C 2F0IA 2ZT9C 2G9HD 4G57A 5KEEA 4DUZQ 1JMCA 1EEID 2KEDA 4EQOA 1A2UA 3CXCA 1OXSC 1JOKA 5GAEC 2WINB 1EYAA 5C3WA 4AQYL 3GDEA 3FEWX 2XNAC 1O80A 1Z9FA 3CW2C 4OXPA 2XRSD 1IYJB 2JJQA 1DCZA 3G48A 1WOCA 4B3TQ 3PSIA 4DAMA 4N8X1 2E2HH 1RCVD 1TS3A 2GN5A 2QGQA 4A4IA 1PLFA 1FR3A 3I4NH 3GTQH 5IGFA 3NTHA 5BN5A 1AEXA 3KF6B 1P8LA 1U4MA 2KHJA 3E5SA 2KCTA 2XTIA 2UXCL 4DV5Q 4IUVA 2FINB 5M5YB 1T5XD 4MTNA 4IFDH 2KCCA 1IXRA 5IYBH 2F3IA 4HIKA 1KXLA 4YIJA 5EKIA 1PRTC 1BCPD 2VUMG 4BBSG 1EL0A 1SMYD 3AYHB 3OWFA 5C44H 4C1NK 2LY7A 3BZKA 1N36L 3KF6A 3CC4A 5GQOA 4LF9Q 4H7BA 2QCPX 1B2TA 4K2LA 4NW2A 3J7ZC 2AUJD 5E3FA 1SFOH 5JJKA 2ZTEA 1HA6A 1VQHA 2FXQA 3WOEA 2LSSA 2IHEA 1JT8A 1JWSD 1LT5D 4LWCA 2WAQB 5H1SE 2JA8G 2QILA 3CU7A 1M4VA 1GUOA 5EPLA 2PQEA 1DOKA 3L3OC 5CMDA 4H44C 5C3XA 4LFCL 1EIHA 1Y1VH 3SK8A 4LNQA 3OTOL 1HUMA 5M9OA 1VQFA 3TQYA 3HOWB 4LF4L 4JI1L 2CQAA 3I8ZA 4DV3L 2UXBL 1HFNA 1JCKB 1LO5D 3K8AA 4JBWA 2FFKB 3CMAA 3TS0A 1GXDC 1QJOA 1ENCA 3S9WA 4ILWA 4BXXH 1C0AA 5EQ0A 3HRZC 4JBJA 4DPGA 1YHQA 4HMJA 2BDNA 4HSPA 1VQPA 3O13A 1PH5A 3JC66 3NXWA 1Q90A 5L37A 2NWGA 3CCEA 2E74C 2BE5C 3MEHA 4RKBA 1VMPA 2L9HA 1TWGH 4UPAA 5IP7G 1UE7A 4DV1L 4TQUS 1YBYA 1DOMA 1ENAA 4WFN3 2VQFL 1IKMA 3PGZA 3GP7A 3VR2A 1XMQL 4YWKA 1E1OA 2F0DA 4JI8L 2VY3A 2E2IH 5KYIA 2YTVA 3TRZA 2WB1G 3DM1A 1YZ6A 2G5DA 2YTYA 5JEAG 1BCPC 2R93H 4Q0FA 4ZCKA 2AKWB 4JOIA 4UP9A 3SHLA 4N8FA 4JI2Q 4ME3A 3J81j 2RDGA 4L5QA 4XQNA 2NBFA 3A5ZB 3D6WA 2NTTA 2LXKA 1PZJD 1FVIA 4CJ2C 5CV5A 1XPOA 3D0FA 1EU3A 3MXPA 4GOPA 3T4AC 1N36Q 1CKNA 2PNRC 2B2UC 3GO5A 1K8GA 1KIXA 1YJWA 4OIJA 4POFA 1SE2A 3U58A 1D8LA 2SOBA 1NMGA 3UE1A 2OF1A 4DK3C 1Y1VG 4ZQ3A 4C56C 4KJNA 3SK5A 1EQTA 5IYCH 2YYZA 1B9NA 1IHZA 3DEOA 3I72A 1STAA 2E2DC 3SR1A 1V1PB 2J0TD 2SNMA 3R8BA 4C3JB 3HKZG 3Q22A 4JI1Q 1QVGA 1AE3A 5C3EG 1LTLA 2UXBQ 4L6TB 5D3DA 1F9PA 1V9PA 4X62Q 4FYDA 4FNFA 3KYHC 1KLUD 3NTIA 2EYLA 1ILQA 3K5NA 1YJNA 1CHPD 2X6GA 1GO3E 1SJHD 5M3MB 4DV4Q 1S40A 5C5LA 1SBBB 3S15B 4OIKA 2RA4A 1EZ8A 1V1PA 3V05A 1O7YA 4IJHA 1II3A 3VR6A 5HURA 2Z1CA 1XPUA 4QB4A 4FXDA 1B44D 1DZ1A 2F0GA 2K28A 3H6MA 4DV2Q 5IY0A 4LJZC 3GQBA 4NB3A 4JOIC 1JB7A 3L9AX 2R93G 2K5HA 3OWEB 2JQOA 2IHFA 1MJEA 1JJGA 3GTLB 1EUJA 3T1HL 2ZXOA 1LM0A 2K01A 2A8VA 1Y14B 3S17B 5TSSA 2D9UA 2KHSA 2PW7A 3IKJA 4A3MH 1TWAB 1ZKOA 1QVFA 4G7OC 1Q81C 4A3GH 4JYAL 4HCEA 3A54A 3WDNA 4DXGA 1UEAB 1KNEA 1JOQA 1EIFA 1B53A 2IX0A 3UDXA 3DXJC 1SEBD 4M1UB 2PI2E 1PFNA 1SYFA 3A74A 3OOCA 4LF7L 3HOXH 4GLAC 2F0TA 4NXNL 4IFDI 3NK9A 4BY1B 4P2CB 1HZ9A 3H3VC 1Q12A 4ZUJA 4KY5A 2UUCQ 4PMCA 2DN8A 3WOFA 2JXMB 1NY4A 3EVQA 1W2BA 3F2UA 4KKTA 3Q23A 1QZGA 1GUSA 4X66Q 1EZ6A 2LKVA 4I7ZC 1B8AA 2K7VA 4ODGA 4A3EH 4U68A 1EOVA 3K80C 2AWOA 2HQEA 2JEBI 3TN2A 4DR6Q 2JA5G 1Q8KA 1A0IA 3QWNA 2E2JH 5C4JH 1G6ZA 1MKHA 2ZM6L 1VQLA 4ZYSA 3KJOA 3HOXB 1RODA 1CSQA 1AE2A 3LWUA 3Q24A 1SYCA 1TS2A 1A3VA 1F9SA 3SXHA 3PO2G 1YITA 4R4CA 1RTNA 4S3SA 3RN5A 1T9HA 4C3HG 4LUOA 1O78A 4IURA 2CWAA 3W2DA 1JICA 5G3LF 1SAPA 3PO3B 2I07B 2PYKA 3J81c 4KI0A 3A5UA 1EY0A 2N88A 3T1HQ 5C4JB 2KA7A 2Z4IA 3TS2A 2E76C 1X56A 1RJTA 4A93H 5C0XH 4IOAA 3C2PA 1G6PA 3V2TA 1LTGD 4JYAQ 1A8VA 2KOLA 4MIUA 4KJOA 2B63G 3FKIG 3K0XA 3PV0A 3F2CA 1B3QA 3CCRA 2X6LA 3R3OA 3I2ZA 2F3WA 1XNQL 3HOZG 3BDOA 1I6HH 1KL9A 1FGUA 3QB3A 1Z6HA 2PZTA 3KLWA 4WJ4A 2F0MA 1MBYA 2D62A 1BQQT 3KLSA 4K5WA 2O4XA 3MA2B 1Y8PB 3MXNB 1PTOB 3TSSA 3CC7A 2JA7H 1L0WA 2D5DA 4K2KA 2QEXA 3K5LA 1VQCA 3PUVA 2K52A 5BN3A 3KJPA 5KRUA 1A2TA 2H4OA 4QUCA 2BA0A 2ZXPA 2ZTCA 1NTGA 1EYGA 1F9QA 4JPBW 4KN4C 2L5TA 3HOUH 1CZGA 2UUAL 3VYUA 4MN3A 5KNDA 4GN4B 2MO1A 1Y8NB 3MXNA 4B3SQ 4QIWE 1WFQA 3J7AV 4IN3A 3R2IA 2F0VA 1A3TA 2RCNA 3M7NA 1TWCH 2JK8A 1X3EA 3EIVA 5CV4A 2AQ1B 1WTXA 4G7ZC 2PCFB 4A3BH 3PIO3 1PH1A 4QIWB 1BCPF 2UU9L 3SK6A 2NYZD 5FJ8G 1HNZL 1L1OB 2JA6B 2O2LD 4K0KQ 2F0LA 4ME5A 4JW0A 1AFPA 4PZ8A 4RCNA 1EY5A 3PUXA 2ZJPA 1F2ZA 3I55A 1DYQA 3J7A5 3BDLA 1K28A 2RBMA 2RVLA 4FO2A 1WTHA 2Y0SE 4A3KG 2N8NA 2ICEC 2K5NA 4C3IG 5CV9A 3I4MG 3CP0A 1AZQA 2EOTA 4A3JH 2UXDL 1L1OA 3CHBD 3BG3A 5GAGC 1EQVA 3ERSX 3B6YA 4X6AH 4X3TA 1VQOA 2C5CA 2L12A 3U9SA 3KFUA 2LMCB 4YWMA 3S1MH 4A3FG 1UAPA 1S5DD 3CCJA 3S1RH 1VQNA 1XNQQ 3BVGA 2F0WA 1GOZA 1LT4D 1M1KC 4EX5A 4L63B 1FNWA 5CV8A 4OO1H 1SNPA 4EGVA 2BH8A 4PZ7A 1PA6A 3I3CA 2RHQB 4JV5Q 2FMMA 1MSGA 3HZXA 3L0OA 2P5ZX 4UP8A 5FLMH 1VQ5A 4UY8C 4DK0A 1EU4A 3CQZH 2B2YA 2Y0SG 1L0XB 2EXDA 2FMCA 4RAUC 4PNYA 2HT1A 1PTOC 1WCMH 1N8RC 1CT1D 4DFAA 1CSPA 4DUZL 4RGMA 2K5DA 4LFBL 1JE4A 1SNCA 4A3LH 1EQRA 4A3DB 4YCUA 4OGQC 3BDCA 1E2WA 1ONLA 1E0BA 3CCSA 4DV6L 1SJED 3P1HA 2WACA 4A3CG 2OQ0A 4C2MB 1XWEA 2KQ3A 3RUZA 3W1GA 5FK9C 4JBMA 1GD7A 3HKSA 4X65L 5IOCA 4DV5L 1N34Q 2IT1A 2UU9Q 1EY8A 1MIUA 1WCMB 3IFDA 1TWHH 1HNZQ 5M3FH 2PZUA 1RL2A 2KCMA 2M2LA 5CV7A 3MHBA 3OMGA 4F88A 3Q0AA 5CV6A 1L1OC 1TVXA 1ICFB 1VDZA 3CPFA 1QUQB 3GTMB 2L11A 3FMCA 5IGBA 3G4SA 4DR2L 4A3IB 5JJLA 2QW7A 1ESRA 1PRTD 2Q8IB 1RKNA 2VB2X 4LF9L 2Q8RE 3HOYG 4FVMA 3EROA 1D1KA 2ID0A 1D2BA 2F0SA 2RQXA 2UXDQ 3CCMA 1IL2A 4BY7G 4GKJQ 3K5OA 3K5MA 1V8QA 3D8GA 2V4DA 5BN4A 3LNNA 5F2DA 1QCBD 2R7ZG 2B2YC 4RGNA 1U5KA 3URYA 4DKAC 1WTOA 2NVQB 1Q3LA 2PQAB 2F0UA 1KLGD 3PIP3 1UE1A 3NTKA 1LLRD 2HCIA 2NZOA 3T53B 5C0XI 3NSWA 2K4KA 2DNEA 4HJ7A 1NSNS 2CH4W 4XIGS 3MAQA 4POGA 5M5YH 2OT2A 1MJCA 1HZAA 4RCOA 1GUWA 2NZ1D 2KHIA 2WKCA 1SE4A 2Z0SA 3DM3A 4XT3B 3T1YQ 1IW7D 1EQQA 5DEHA 4LFBQ 4XYOA 4JI7Q 3A55A 2HUGA 3M4OH 3HOVG 2Z6KC 1WTRA 2DGYA 4IUTA 4DV6Q 4ZK9B 3NP8A 1SNQA 1V43A 3QO2A 3KDFA 1BOSA 1K0RA 1HNWQ 3G7LA 4KMUC 2F0EA 2VUMB 4BBSB 3M4PA 1K83B 2B2WA 4AYBG 4IOCA 2BE5D 1Y1WG 3AFQA 3GTKH 2EYOA 2VQEL 4GLXA 4X65Q 1YNJD 2ASBA 1ENFA 2XN9C 1J6QA 4J8QA 1KQSA 4CKEA 4V190 1T5EA 1PYSB 4RA8A 1STBA 1CQVA 4JI2L 1X9NA 4X64L 3HOWH 3S16B 2D0PA 2J4XA 4BBRG 1E7ZA 2JA8B 3M4OB 1VF7A 1HHVA 5IGDA 3I4LA 2R92H 3H09A 4DR2Q 2FJ2A 2PNHA 3E9IA 1Q1EA 5J22A 4LMQD 3FP9A 2GA4B 1B4OA 4WJWA 4GKKL 1C4QA 2IX1A 3GTKB 3Q8DA 3D3RA 1SYEA 3TEHB 1VS0A 2KECA 3OW7A 1PDQA 2EYJA 1QOHA 2B2UA 3DWAA 5JAVA 4LF5Q 4IALA 4HTHA 3H0GG 3D4WA 1I3QB 1PH6A 2LFNA 3NHHA 4R1JA 1GHJA 3CKIB 3I4OA 3A8IE 3SE0A 3I56A 1GVPA 4L5SA 2R92B 4X62L 1X65A 4GLVB 1IW7C 4NPSA 2EPBA 2WB1E 2EYMA 2CCZA 4RGOS 1ICWA 4DNRB 5CR3A 5LL6X 1PMRA 1B50A 5EPJA 1B7YB 4DK1A 4DV4L 1ILPA 4BWGB 3ULLA 4HEDA 1XNRL 3EBEA 2XWJB 3V96A 2B2WC 1YVCA 3I4NG 2Q2IA 2WB1B 2LXJA 1X3GA 5KGUA 4B9XA 1CK1A 3PCOB 4OO1I 1BF4A 1IL8A 3E0EA 2CWPA 1E22A 2MGSA 4IPCA 1S5BD 3RNUA 1DD2A 4DV2L 4CDFC 3H3VH 1CHQD 1W6KA 2ZJQA 1VQ7A 4NKLA 4RGTA 2MJ8A 4IFDG 1AZPA 3TBIB 1YNJC 3M3YB 4OEMB 1S5ED 3QJYA 5IYBG 2MP1A 1KRTA 3ND9A 1ZXTA 2PMZE 3OIPA 4P73A 2VQEQ 2F0FA 4QMGA 3ER0A 5I2XA 1RTOA 5C4ZA 2A74C 1VQ8A 5C44G 4KHZA 1PH2A 2BCOA 3HKZE 4DAPA 2EY1A 4X64Q 3SGIA 4C3JH 1JQYD 1XJVA 5JPMC 2PMZB 2QKIC 1SYGA 1PFBA 3ERQA 1I94L 1WJJA 1YHBA 3BJUA 1N32L 2IY5B 1D7QA 1IBKQ 1FNVA 4RHSA 5CBAE 3PUWA 5C3EB 5M3MH 2CHBD 1SYDA 4HIOA 1Q82C 3D4RA 1E2ZA 4GKKQ 3S15H 4U673 2UUCL 5I2YA 2XIWA 4B9WA 3BS1A 3M7GA 4EQ5A 5GADC 1GUGA 1D6EC 3OHXC 3PIOA 4X66L 1KABA 4Q5VA 3VYRA 1C9OA 4O1NA 3K7UC 1HUNA 3C3LA 4BXXG 1QE6A 1I4GA 2F3VA 4DR6L 3DUZA 3GTLH 3SK4A 1A63A 4JVZA 3S17H 1RHPA 2CKZB 1TWAH 2M00A 4PG3A 4J6HA 5LL6S 5E4WC 1IBLQ 1LTAD 5DAUA 1XNRQ 1NAPA 1E3PA 4LW1A 1WTPA 2RKSA 2B3GA 4WRDA 2MUYA 3RLNA 5HGQA 1W6JA 1TY0A 1RD9D 1EOTA 3CCLA 5CORA 1E1TA 1FL0A 4QJFA 1TS4A 1STYA 1FGBD 1I4PA 2NVYB 2RHSB 2ENBA 2I5HA 4QQBX 1AP0A 2IWHA 4BY1H 2OXPA 2K33A 3SEBA 3H94A 4H13C 1K3RA 1PXUA 4DN4M 5LMUQ 4RMFA 1S4ZA 4ZKCB 4C3JG 1L2FA 1X32A 1D5ZC 4QL5A 3OPOA 2EIFA 4DAYB 1K0SA 4MTKA 1I4HA 1K8OA 3TP8A 3S1NB 3W3AA 3K6OA 4F7XA 3S14B 2K50A 1BO0A 1TU2B 1H9SB 1SDFA 5HGTA 5BR8Q 1I94Q 4ZAIA 2AQ2B 4DUYQ 5IYCG 1X55A 1NBWA 1N32Q 4JK1C 3ICEA 3PUYA 4IFDJ 4DAYA 3M4YA 2KCNA 2JA5B 2CW0C 4KHPQ 3TP7A 3S1QH 3H15A 4HN7A 2EYFA 4KY7A 4YHHQ 1H9KA 4J1MA 3GTPH 4BA1I 4ID6A 4EQPA 5JEAJ 1EFWA 1AH9A 1NMFA 1ET6A 4CDEC 5AJ3Q 1U9RA 2MHVA 4FDBA 3RMHA 3PO2B 3PO3H 1JR0D 1BDOA 1WI5A 5DNFA 2VNUD 1K9MC 4OWTB 3EQLC 4B3SL 1VQEA 4C3HB 1QZHA 1PZKD 3HGBA 4O0AA 2SNSA 3TP5A 2WIIB 2KUMA 4G7HC 4XXEA 3RR5A 5IYDH 1Q8IA 2PW5A 4APVA 1YIJA 1PV4A 5M5WB 4K8JA 2ES2A 1RDPD 3S1QB 1D1IA 3MFGA 3F2DA 1S5CD 1ML0D 2E5LQ 3GTPB 4K0KL 5IWAL 3WWVA 1N33L 1KDAA 1PRTF 1EYDA 5IP9H 2B63B 1HPCA 2F52A 3S2DB 3FKIB 4GZYC 3QG1A 3F1ZA 3VDYA 5LMNQ 4OWXB 4A3MG 1TR5A 1HRJA 3RZDH 3HOZB 2DY7A 4DAVA 2VZAA 3NEMA 1PTOH 4A3GG 2E8GA 3PIPA 1VQIA 3GTJH 3FRPB 1NR4A 5I6YA 2EY5A 1D5MC 4ALPA 1ZYRD 2R7DA 1BBXC 1KNAA 3UDGA 4IQZA 3STBC 3AFPA 1RIPA 4B3RL 3S24A 1DXMA 3GTOB 3H3VI 1TQOA 2V1CC 3HOXG 4DF7A 1CFMA 2WV6D 3J80L 1XYIA 2YU9B 4DR1Q 1PH9A 4LUVA 3K7AB 3PF4A 1WD0A 1LYLA 5D3IB 5C4XH 1UEBA 4LF8L 3RZDB 1LV9A 4RH6A 4JV5L 1A3UA 2Q2UA 1KRSA 3MFYA 3GTJB 4A3EG 1KHIA 2TMPA 3PO3G 3NBHB 1J8IA 2D0OA 1ZEQX 4P72A 4X3KA 1G291 2JA6H 1HA5A 3C46A 2RDFA 1KD1C 1PFMA 4NXML 2BH2A 1SYBA 5ELOA 1PTOD 5CBEE 5EAYA 3ITPA 2C9OA 1JJCB 1LTTD 4QF4A 3VA7A 2M9VA 3TMEA 1CQFA 2ALYB 1CA6A 3MXUA 3IL8A 5IE8A 5FO9B 1EWHA 3A0JA 3NELA 4KKSA 5LMNW 1Z7TA 3J80E 1EFID 5C4XB 1FJGL 3HG9A 3Q6SA 1QG7A 3G6EA 4J15A 4A3KB 4PQXA 1MI2A 1VMCA 1PHJA 1AW7A 3KBXA 3F2BA 1N34L 3E0JA 4JI0Q 1WVLA 4R4TA 4DNIA 3EFXD 1GM5A 3I4MB 4MNOA 1CZWA 3SDZA 3HS0C 4I7AA 3UDIA 3M85A 5IWAQ 4IZ8A 2B2TA 2JSOA 1XPRA 2G9DA 1N33Q 4BS9A 3CC2A 1EYCA 1BXTA 1X3QA 1KDCA 4A3FB 2QF7A 4A93G 5C0XG 1OXXK 4R8NA 5EBDA 3ND8A 4AIMA 3DHQA 1ZYRC 1BKBA 1QWYA 3J80i 1G91A 4OX9L 1YNNC 1PFSA 5K36H 4DV7Q 1NNXA 1KTKA 4G4KA 4LF6Q 2F0PA 1RF2D 2NTSA 4GKJL 2F0JA 3RN2A 2QDBA 1JB3A 4A3DH 3NWTA 2AUKA 2Y0SB 4B3RQ 2DJFC 3X3MA 1B3AA 3E9HA 3DWPA 4CJ1B 1JC7A 5M5XB 2JA7G 1G51A 1C48A 4C2MH 1X6OA 4H02A 4IPDA 2NVTB 4JI4L 1F2MA 1MD2D 2RSNA 4LF8Q 4DR7Q 2L55A 1ET9A 1ESFA 4R8IA 5I4DA 3NBIA 2GVAA 1CKOA 3H91A 2N78A 2MFIA 4K6DA 1R9TB 3PMFA 3HOUG 4LFAQ 1TWFB 3MVVA 3T1YL 1VQJA 1TT2A 4XTCS 1C8CA 3T51B 1J5EL 3JAME 3G71A 4JCVE 4R9WA 1BNZA 4NXMQ 4JI7L 4A75A 1JORA 2ICIA 4CGYB 3QOJA 5ELDA 2DNCA 3GTMH 1HQMC 3P7JA 1F77A 2H5XA 2YV5A 3A56A 4CDDC 3TDQA 4A3IH 1HNWL 1A15A 1HR0Q 4A3BG 5IODA 2IL8A 2EJFC 2B2TC 2PPBC 2A69C 1FJGQ 4K14A 4L8JA 1PH8A 2Z6KA 1X54A 2HCCA 4DR4L 2NN6H 3KK7A 3JAMi 4B3ML 2GVBA 4HJ5A 3FDTA 3G6JB 4WJ3M 4HSVA 1LTRD 2EQSA 4BY7B 1YHAA 1ASYA 5KNBA 2NVQH 1WYDA 1D5XC 3ONAB 3T16A 5J39A 4H0LC 4A3JG 4CDCC 3RZOB 2R7ZB 4XQQA 2A6ED 4A3DG 4OX9Q 4LAAA 3TZUA 5IT9E 1SNDA 1DGSA 4UAIA 5FLXL 3NPPA 4F87A 1EWIA 1QILA 4GN5A 1VQAA 3P75A 1PH4A 4L5RC 2A1AA 5D65A 4R4QA 5JVG3 4OO1G
chains in the Genus database with same CATH topology
1QUQA 3UDXA 1SE8A 4R4IA 3E0EA 2CWPA 1E22A 4IPCA 5M5XH 3RNUA 4LF5L 5FLMG 4DV2L 1UE6A 2PI2E 3H3VH 3A74A 2ZJQA 2ZM6Q 4JI6Q 1VQ7A 4AYBE 4LF7L 1WCMG 2NVTH 4JI4Q 3HOXH 4GLAC 2VUMH 2MO0A 4NXNL 4BBSH 2YTXA 4IFDI 1K83H 4IFDG 2HQLA 1HZ9A 5DLQE 5IYBG 1Q12A 1B70B 1KRTA 1HR0W 3KF8B 4A3LG 4A3CH 2PMZE 2UUCQ 1QVCA 4P73A 2VQEQ 1YJ9A 3CCQA 1R9TH 3M9BA 1SMXA 3ER0A 1NY4A 2DUDA 2K5VA 1W2BA 1TWFH 1VQ8A 2JEAI 4JI3Q 5C44G 1VQKA 2CQOA 1KAWA 2VL6A 4KHZA 1QZGA 4X66Q 1PH2A 1J5EQ 1IBMQ 3HKZE 4JI5Q 3S16H 1SLJA 4X64Q 1B8AA 4A3EH 2AHOB 2PQAA 3SGIA 4C3JH 2JA8H 5C4XG 1PH7A 1EOVA 1XJVA 3K80C 2AWOA 2JEBI 1VQDA 4DR6Q 2JA5G 1Q8KA 1BVSA 1A0IA 1I94L 2E2JH 5C4JH 4DR5Q 1WJJA 1YHBA 1NE3A 1MKHA 3BJUA 1H95A 2ZM6L 4JI6L 1VQLA 1VQGA 1IBKQ 1N32L 2IY5B 1D7QA 3KJOA 4GNXB 2JA6G 3PUWA 4JC0A 1CSQA 5M3MH 5M3FG 1AE2A 2F4VQ 4HIOA 1Q82C 3JAMc 4GKKQ 2N49A 3S15H 1UWVA 2UUCL 1IZ6A 4DR4Q 3PO2G 1YITA 3HOYH 4R4CA 4B3MQ 4EQ5A 5GADC 4YY3L 2N3SA 3RN5A 4HJAA 3F8TA 4BY7H 1T9HA 3PIOA 4LUOA 2OCEA 4X66L 1YI2A 3CAMA 1IBML 4JI5L 2CWAA 1C9OA 3K7UC 1I3QH 3GTGH 2AWNA 3ZJYC 2QA4A 4BXXG 1Q86C 4GNXA 1YNXA 3J81c 2VS1A 2R7ZH 3RZOH 4DR6L 1XTDA 2MQHA 4KI0A 3GTLH 3A5UA 3U4VA 1PVOA 3FHWA 4GN3B 3T1HQ 1VQ9A 4JG2A 1A63A 3TS2A 3S17H 1IBKL 1X56A 5E7NA 2CKZB 5IP7H 3OW2A 4KLKA 1TWAH 1KC8C 4A93H 4IOAA 1G6PA 4PG3A 3U4ZA 1IBLQ 2UUBQ 3PUZA 4JYAQ 1A8VA 1XNRQ 4MZ9A 1E3PA 1K73C 2B63G 2AMCB 4LW1A 2MNAA 3FKIG 3K0XA 1E24A 2B3GA 3PCOB 3PV0A 3RLNA 1HJPA 3F2CA 3CCRA 3I2ZA 5HGQA 2ZJRA 2HIXA 2UUAQ 1PH3A 1XNQL 3HOZG 3CCLA 4YCVA 1I6HH 1E1TA 1FL0A 1FGUA 1KL9A 2WAQE 4QJFA 3TREA 1BBUA 4B3TL 2RHSB 3CCUA 3KLWA 5IT9c 4WJ4A 5K36G 1Z47A 2I5HA 4QQBX 2D62A 1TXYA 4P71A 4HIMA 3HOVH 1OXTA 4BY1H 3M3YH 3MXNB 3CC7A 1K3RA 1K8AC 5LMUQ 4RMFA 3CCVA 2JA7H 2ATWA 1L2FA 1L0WA 3IRBA 2QEXA 4QL5A 1XMOQ 1VCIA 3M4QA 2EIFA 4DAYB 1VQCA 2ZTDA 3PUVA 2K52A 3KJPA 2RF4A 1IBLL 1Y1WH 2BA0A 3PF5A 1GKHA 2ZTCA 4LUZA 1NTGA 1EYGA 1VQ6A 3AEVA 4BA2I 3HOUH 2UUAL 3BU2A 1HH2P 2K50A 4IO9A 4GN4B 2MO1A 1SRUA 4B3SQ 2HHHQ 2CFMA 2HIVA 4QIWE 5BR8Q 1I94Q 1WFQA 2OTJA 2WAQG 4DUYQ 5IYCG 2XGTA 4HIDA 1X55A 4BBRH 1NBWA 4DV0L 2Q2TA 1N32Q 2RCNA 4QY7A 3M7NA 3ICEA 1OXVA 1TWCH 3PUYA 5C3EH 1SROA 2JK8A 1X3EA 3EIVA 4IFDJ 5GAHC 2K14A 5C0XJ 2I0QA 5LMUL 4KHPQ 3D31A 4AH6A 3S1QH 3H15A 3W5OA 1I50H 5FLXc 3HOWG 2I5LX 4GNXC 4YHHQ 4AQYQ 3DLLA 4A3BH 1PH1A 3BZCA 2UU9L 2Q2HA 5FJ8G 1XMOL 2VW9A 1L1OB 1HNZL 1UE5A 1C7YA 4YY3Q 4BA1I 1O7IA 3GTPH 4K0KQ 2R92G 1W3SA 4PZ8A 5JEAJ 1EFWA 1HNXL 1AH9A 3PUXA 4A3IG 1NMFA 5AJ3Q 3I55A 2ZJPA 4Y7NH 3CMEA 3J7A5 3GD7A 4FDBA 3PO3H 1WI5A 4IPGA 2KENA 4OWWB 1PYBA 1K9MC 2L15A 2VNUD 4OWTB 2Y0SE 4A3KG 4B3SL 1VQEA 4GOPB 1S72A 2HHHL 1CKNB 2N8NA 3KDFB 5BR8L 3H0GH 1QZHA 4JBKA 1VQMA 3ULJA 1X3FA 1EIYB 1U0LA 2NN6G 2OTLA 4O0AA 2NN6I 4DUYL 2K5NA 2UXCQ 1NJIC 3I4MG 3CP0A 2K75A 3U50C 3RR5A 5IYDH 4A3JH 2UXDL 1L1OA 4APVA 4DUZQ 5GAGC 1YIJA 1PV4A 3ERSX 4IPHA 1JMCA 4KHPL 3B6YA 4X6AH 2ES2A 3CXCA 1OXSC 1VQOA 5GAEC 4DK6C 4YHHL 4AQYL 3KFUA 3GDEA 4YWMA 3S1MH 3F2DA 4A3FG 3CCJA 3CD6A 3S1RH 2E5LQ 1Z9FA 2WP8J 5IWAL 1VQNA 1XNQQ 4K0KL 3CW2C 4OXPA 3WWVA 1IYJB 2JJQA 1N33L 3G48A 1WOCA 5AJ3L 2NVYH 4B3TQ 3OYYA 3PSIA 4DAMA 5IP9H 2E2HH 2F52A 1M1KC 4EX5A 2GN5A 2QGQA 4A4IA 3F1ZA 3VDYA 1OXUA 5LMNQ 4OWXB 4A3MG 2NZHA 1VQ4A 3I4NH 1S3OA 3GTQH 3RZDH 2BH8A 4PZ7A 1PA6A 2VZAA 3NEMA 2RHQB 4A3GG 3KF6B 2E8GA 4JV5Q 1P8LA 2KHJA 3L0OA 4UP8A 1VQIA 3PIPA 5FLMH 2KCTA 1VQ5A 4UY8C 2XTIA 3GTJH 3CQZH 2Y0SG 2UXCL 2EXDA 2R7FA 4DV5Q 4ALPA 5HY6A 2HT1A 1WCMH 1N8RC 4MTNA 2R7DA 1CSPA 4GS3A 4DUZL 1IXRA 3UDGA 4LFBL 5IYBH 2F3IA 4LFCQ 2JA9A 3STBC 3AFPA 1RIPA 4HIKA 1EQRA 3OTOQ 3S24A 4B3RL 4A3LH 3S1NH 3H3VI 1KXLA 1Q46A 4LF4Q 4YCUA 1VQBA 2V1CC 3HFZB 3MEFA 3HOXG 2VUMG 4BBSG 4DV3Q 3S14H 2E5LL 3AYHB 5C44H 3CCSA 4DV6L 3BZKA 1N36L 3KF6A 2JE6I 4DR1Q 1PH9A 4LUVA 2OQ0A 4A3CG 3RLFA 3CC4A 5GQOA 3UE0A 4LF9Q 3PF4A 1LYLA 5LMNL 3KOJA 5C4XH 1CUKA 1UEBA 4DV0Q 4LF8L 3J7ZC 3W1GA 1BBWA 1I5FA 1SFOH 5JJKA 2JA5H 2ZTEA 4JV5L 1VQHA 2FXQA 1GD7A 2LSSA 2IHEA 3HKSA 4JBMA 1JT8A 2Q2UA 1KRSA 4X65L 4LWCA 5H1SE 4DV5L 3ULPA 4A3EG 1KHIA 1N34Q 2JA8G 3NBHB 3PO3G 2D0OA 2IT1A 4P72A 2UU9Q 1MIUA 1G291 2JA6H 1HNZQ 1TWHH 2OWOA 3NENA 5M3FH 3L7ZC 1KD1C 1RL2A 2KCMA 4NXML 2BH2A 4LFCL 3CF5A 1Y1VH 4LNQA 1HNXQ 3OTOL 1VQFA 1V1QA 5ELOA 3TQYA 1L1OC 4LF4L 4JI1L 3PO2H 5EAYA 1CKMA 3CPFA 4DV3L 1QUQB 4O2DA 2UXBL 4DV1Q 5M3MG 4Y52H 1JJCB 3K8AA 4JBWA 5J3BA 4PMWA 3STBD 4DR3L 2VQFQ 3G4SA 4DR2L 3CMAA 4C3HH 2ALYB 5JJIA 4DR1L 1XMQQ 3TS0A 5JJLA 2BA1A 5IE8A 4JI8Q 4YWLA 4LF9L 3A0JA 3NELA 5LMNW 3HOYG 1C0AA 4BXXH 4GOPC 2ID0A 1FJGL 4JBJA 4DPGA 2UXDQ 3CCMA 1YHQA 1IL2A 4BY7G 3G6EA 4GKJQ 4J15A 5M5WH 1VQPA 1HZCA 1PH5A 1SN8A 3F2BA 3JC66 1PHJA 1N34L 1A62A 4JI0Q 4R4TA 4DNIA 1GM5A 4MNOA 3UDIA 3M85A 2R7ZG 3W1BA 5IWAQ 3CCEA 1U5KA 1XPRA 4DKAC 1N33Q 2B63H 3CC2A 2PQAB 4P74A 3FKIH 3S2DH 1TWGH 1UE1A 4UPAA 5IP7G 1UE7A 2NZOA 4DV1L 4A93G 4TQUS 1YBYA 1OXXK 5C0XG 5C0XI 3HOZH 2K4KA 4AIMA 4A76A 2VQFL 2A19A 1BKBA 3J80i 4HJ7A 3PGZA 2R6GA 4OX9L 4XIGS 1XMQL 1PFSA 4YWKA 4OONA 1E1OA 4JI8L 2VY3A 2E2IH 4POGA 5M5YH 2YTVA 4DV7Q 3TRZA 1MJCA 2WB1G 1HZAA 1YZ6A 3RLOA 4LF6Q 2KHIA 2Z0SA 2PI2A 2YTYA 3DM3A 2KBNA 5JEAG 3T1YQ 2R93H 2B29A 3RN2A 1EQQA 4GKJL 2AKWB 4JOIA 4LFBQ 4UP9A 4JI2Q 4ME3A 3J81j 4L5QA 4JI7Q 4A3DH 3GTOH 4B3RQ 3A5ZB 4JI0L 3M4OH 2LXKA 3HOVG 2Z6KC 1FVIA 3E9HA 1OTCA 2DGYA 4BY1G 1XPOA 3D0FA 5ELNA 2YU9H 4DV6Q 2JA7G 1G51A 4GOPA 3AQQA 1N36Q 1V43A 1CKNA 3KDFA 4C2MH 1K0RA 1HNWQ 3K7AH 1X6OA 4L5TA 4H02A 3GO5A 4IPDA 4JI4L 1K8GA 3EN2A 1YJWA 1KIXA 1M90C 4R4OA 4POFA 4LF8Q 3M4PA 4UP7A 3I7FA 1D8LA 3U58A 4DR7Q 4AYBG 1NMGA 3UE1A 4IOCA 1Y1WG 3AFQA 4DK3C 1Y1VG 3GTKH 1P16A 2GVAA 2VQEL 4GLXA 1CKOA 4X65Q 4DV7L 2N78A 2MFIA 5IYCH 2ASBA 3HOUG 4LF6L 2YYZA 1J6QA 4LFAQ 4JI3L 1KQSA 2I5MX 3T1YL 1JJ2A 1VQJA 1PYSB 4IJLA 4XTCS 1J5EL 4NXMQ 3G71A 4JI2L 4JCVE 1X9NA 4JI7L 4X64L 3HOWH 4A75A 2D0PA 4BBRG 1E7ZA 2NVXH 2C35B 3HKZG 4JI1Q 1QVGA 1AE3A 5FJ8H 1LTLA 5C3EG 3GTMH 2UXBQ 1Q7YC 2H5XA 2YV5A 2R92H 4DR3Q 1V9PA 4X62Q 4DR5L 4DR2Q 4A3IH 1HNWL 1HR0Q 2PNHA 4A3BG 3E9IA 3KYHC 1Q1EA 1HZBA 1YJNA 4DR7L 1GO3E 4DV4Q 1S40A 1FJGQ 2F4VL 1SR3A 4A3KH 1PH8A 3FP9A 4P75A 4GKKL 2Z6KA 2IX1A 3Q8DA 1X54A 2OQKA 3TEHB 1VS0A 4DR4L 5GROA 4C3IH 3CPWA 4B3ML 3JAMi 1YEZA 2GVBA 4IJHA 4TVAB 3I4MH 4HJ5A 4LFAL 3L2PA 4HJ8A 1XPUA 4WJ3M 2EQSA 1YHAA 1ASYA 1JE5A 4LF5Q 3H0GG 4DV2Q 2NVQH 4RG1A 1WYDA 4QGUA 5IY0A 1PH6A 4LF7Q 4R1JA 3J80c 4A3FH 1N9WA 4NB3A 4JOIC 3I4OA 5IYDG 4A3JG 3LGJA 1JB7A 4NXNQ 2R93G 2K5HA 2JQOA 1LUZA 2IHFA 3I56A 1MJEA 1JJGA 1GVPA 1Q1BA 1EUJA 4PZ6A 4X62L 3T1HL 4L5SA 1X65A 4GLVB 4A3DG 4OX9Q 4NPSA 3J81i 2WB1E 1HR0L 1LM0A 4YCWA 2CCZA 2A8VA 1Y14B 1DGSA 4A3MH 1ASZA 1EWIA 1B7YB 4GN5A 4DV4L 3S2HH 1VQAA 2UUBL 1QVFA 1Q81C 3ULLA 4HJ9A 1PH4A 4L5RC 1XNRL 3UDFA 4A3GH 3EBEA 4JYAL 2A1AA 5IP9G 4R4QA 2WFWA 3K81C 1EIFA 1YVCA 3I4NG 2Q2IA 2LXJA 1X3GA 4OO1G 4OO1I 2IX0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QUQ A;  3UDX A;  1SE8 A;  4R4I A;  3E0E A;  2CWP A;  1E22 A;  4IPC A;  5M5X H;  3RNU A;  4LF5 L;  5FLM G;  4DV2 L;  1UE6 A;  2PI2 E;  3H3V H;  3A74 A;  2ZJQ A;  2ZM6 Q;  4JI6 Q;  1VQ7 A;  4AYB E;  4LF7 L;  1WCM G;  2NVT H;  4JI4 Q;  3HOX H;  4GLA C;  2VUM H;  2MO0 A;  4NXN L;  4BBS H;  2YTX A;  4IFD I;  1K83 H;  4IFD G;  2HQL A;  1HZ9 A;  5DLQ E;  5IYB G;  1Q12 A;  1B70 B;  1KRT A;  1HR0 W;  3KF8 B;  4A3L G;  4A3C H;  2PMZ E;  2UUC Q;  1QVC A;  4P73 A;  2VQE Q;  1YJ9 A;  3CCQ A;  1R9T H;  3M9B A;  1SMX A;  3ER0 A;  1NY4 A;  2DUD A;  2K5V A;  1W2B A;  1TWF H;  1VQ8 A;  2JEA I;  4JI3 Q;  5C44 G;  1VQK A;  2CQO A;  1KAW A;  2VL6 A;  4KHZ A;  1QZG A;  4X66 Q;  1PH2 A;  1J5E Q;  1IBM Q;  3HKZ E;  4JI5 Q;  3S16 H;  1SLJ A;  4X64 Q;  1B8A A;  4A3E H;  2AHO B;  2PQA A;  3SGI A;  4C3J H;  2JA8 H;  5C4X G;  1PH7 A;  1EOV A;  1XJV A;  3K80 C;  2AWO A;  2JEB I;  1VQD A;  4DR6 Q;  2JA5 G;  1Q8K A;  1BVS A;  1A0I A;  1I94 L;  2E2J H;  5C4J H;  4DR5 Q;  1WJJ A;  1YHB A;  1NE3 A;  1MKH A;  3BJU A;  1H95 A;  2ZM6 L;  4JI6 L;  1VQL A;  1VQG A;  1IBK Q;  1N32 L;  2IY5 B;  1D7Q A;  3KJO A;  4GNX B;  2JA6 G;  3PUW A;  4JC0 A;  1CSQ A;  5M3M H;  5M3F G;  1AE2 A;  2F4V Q;  4HIO A;  1Q82 C;  3JAM c;  4GKK Q;  2N49 A;  3S15 H;  1UWV A;  2UUC L;  1IZ6 A;  4DR4 Q;  3PO2 G;  1YIT A;  3HOY H;  4R4C A;  4B3M Q;  4EQ5 A;  5GAD C;  4YY3 L;  2N3S A;  3RN5 A;  4HJA A;  3F8T A;  4BY7 H;  1T9H A;  3PIO A;  4LUO A;  2OCE A;  4X66 L;  1YI2 A;  3CAM A;  1IBM L;  4JI5 L;  2CWA A;  1C9O A;  3K7U C;  1I3Q H;  3GTG H;  2AWN A;  3ZJY C;  2QA4 A;  4BXX G;  1Q86 C;  4GNX A;  1YNX A;  3J81 c;  2VS1 A;  2R7Z H;  3RZO H;  4DR6 L;  1XTD A;  2MQH A;  4KI0 A;  3GTL H;  3A5U A;  3U4V A;  1PVO A;  3FHW A;  4GN3 B;  3T1H Q;  1VQ9 A;  4JG2 A;  1A63 A;  3TS2 A;  3S17 H;  1IBK L;  1X56 A;  5E7N A;  2CKZ B;  5IP7 H;  3OW2 A;  4KLK A;  1TWA H;  1KC8 C;  4A93 H;  4IOA A;  1G6P A;  4PG3 A;  3U4Z A;  1IBL Q;  2UUB Q;  3PUZ A;  4JYA Q;  1A8V A;  1XNR Q;  4MZ9 A;  1E3P A;  1K73 C;  2B63 G;  2AMC B;  4LW1 A;  2MNA A;  3FKI G;  3K0X A;  1E24 A;  2B3G A;  3PCO B;  3PV0 A;  3RLN A;  1HJP A;  3F2C A;  3CCR A;  3I2Z A;  5HGQ A;  2ZJR A;  2HIX A;  2UUA Q;  1PH3 A;  1XNQ L;  3HOZ G;  3CCL A;  4YCV A;  1I6H H;  1E1T A;  1FL0 A;  1FGU A;  1KL9 A;  2WAQ E;  4QJF A;  3TRE A;  1BBU A;  4B3T L;  2RHS B;  3CCU A;  3KLW A;  5IT9 c;  4WJ4 A;  5K36 G;  1Z47 A;  2I5H A;  4QQB X;  2D62 A;  1TXY A;  4P71 A;  4HIM A;  3HOV H;  1OXT A;  4BY1 H;  3M3Y H;  3MXN B;  3CC7 A;  1K3R A;  1K8A C;  5LMU Q;  4RMF A;  3CCV A;  2JA7 H;  2ATW A;  1L2F A;  1L0W A;  3IRB A;  2QEX A;  4QL5 A;  1XMO Q;  1VCI A;  3M4Q A;  2EIF A;  4DAY B;  1VQC A;  2ZTD A;  3PUV A;  2K52 A;  3KJP A;  2RF4 A;  1IBL L;  1Y1W H;  2BA0 A;  3PF5 A;  1GKH A;  2ZTC A;  4LUZ A;  1NTG A;  1EYG A;  1VQ6 A;  3AEV A;  4BA2 I;  3HOU H;  2UUA L;  3BU2 A;  1HH2 P;  2K50 A;  4IO9 A;  4GN4 B;  2MO1 A;  1SRU A;  4B3S Q;  2HHH Q;  2CFM A;  2HIV A;  4QIW E;  5BR8 Q;  1I94 Q;  1WFQ A;  2OTJ A;  2WAQ G;  4DUY Q;  5IYC G;  2XGT A;  4HID A;  1X55 A;  4BBR H;  1NBW A;  4DV0 L;  2Q2T A;  1N32 Q;  2RCN A;  4QY7 A;  3M7N A;  3ICE A;  1OXV A;  1TWC H;  3PUY A;  5C3E H;  1SRO A;  2JK8 A;  1X3E A;  3EIV A;  4IFD J;  5GAH C;  2K14 A;  5C0X J;  2I0Q A;  5LMU L;  4KHP Q;  3D31 A;  4AH6 A;  3S1Q H;  3H15 A;  3W5O A;  1I50 H;  5FLX c;  3HOW G;  2I5L X;  4GNX C;  4YHH Q;  4AQY Q;  3DLL A;  4A3B H;  1PH1 A;  3BZC A;  2UU9 L;  2Q2H A;  5FJ8 G;  1XMO L;  2VW9 A;  1L1O B;  1HNZ L;  1UE5 A;  1C7Y A;  4YY3 Q;  4BA1 I;  1O7I A;  3GTP H;  4K0K Q;  2R92 G;  1W3S A;  4PZ8 A;  5JEA J;  1EFW A;  1HNX L;  1AH9 A;  3PUX A;  4A3I G;  1NMF A;  5AJ3 Q;  3I55 A;  2ZJP A;  4Y7N H;  3CME A;  3J7A 5;  3GD7 A;  4FDB A;  3PO3 H;  1WI5 A;  4IPG A;  2KEN A;  4OWW B;  1PYB A;  1K9M C;  2L15 A;  2VNU D;  4OWT B;  2Y0S E;  4A3K G;  4B3S L;  1VQE A;  4GOP B;  1S72 A;  2HHH L;  1CKN B;  2N8N A;  3KDF B;  5BR8 L;  3H0G H;  1QZH A;  4JBK A;  1VQM A;  3ULJ A;  1X3F A;  1EIY B;  1U0L A;  2NN6 G;  2OTL A;  4O0A A;  2NN6 I;  4DUY L;  2K5N A;  2UXC Q;  1NJI C;  3I4M G;  3CP0 A;  2K75 A;  3U50 C;  3RR5 A;  5IYD H;  4A3J H;  2UXD L;  1L1O A;  4APV A;  4DUZ Q;  5GAG C;  1YIJ A;  1PV4 A;  3ERS X;  4IPH A;  1JMC A;  4KHP L;  3B6Y A;  4X6A H;  2ES2 A;  3CXC A;  1OXS C;  1VQO A;  5GAE C;  4DK6 C;  4YHH L;  4AQY L;  3KFU A;  3GDE A;  4YWM A;  3S1M H;  3F2D A;  4A3F G;  3CCJ A;  3CD6 A;  3S1R H;  2E5L Q;  1Z9F A;  2WP8 J;  5IWA L;  1VQN A;  1XNQ Q;  4K0K L;  3CW2 C;  4OXP A;  3WWV A;  1IYJ B;  2JJQ A;  1N33 L;  3G48 A;  1WOC A;  5AJ3 L;  2NVY H;  4B3T Q;  3OYY A;  3PSI A;  4DAM A;  5IP9 H;  2E2H H;  2F52 A;  1M1K C;  4EX5 A;  2GN5 A;  2QGQ A;  4A4I A;  3F1Z A;  3VDY A;  1OXU A;  5LMN Q;  4OWX B;  4A3M G;  2NZH A;  1VQ4 A;  3I4N H;  1S3O A;  3GTQ H;  3RZD H;  2BH8 A;  4PZ7 A;  1PA6 A;  2VZA A;  3NEM A;  2RHQ B;  4A3G G;  3KF6 B;  2E8G A;  4JV5 Q;  1P8L A;  2KHJ A;  3L0O A;  4UP8 A;  1VQI A;  3PIP A;  5FLM H;  2KCT A;  1VQ5 A;  4UY8 C;  2XTI A;  3GTJ H;  3CQZ H;  2Y0S G;  2UXC L;  2EXD A;  2R7F A;  4DV5 Q;  4ALP A;  5HY6 A;  2HT1 A;  1WCM H;  1N8R C;  4MTN A;  2R7D A;  1CSP A;  4GS3 A;  4DUZ L;  1IXR A;  3UDG A;  4LFB L;  5IYB H;  2F3I A;  4LFC Q;  2JA9 A;  3STB C;  3AFP A;  1RIP A;  4HIK A;  1EQR A;  3OTO Q;  3S24 A;  4B3R L;  4A3L H;  3S1N H;  3H3V I;  1KXL A;  1Q46 A;  4LF4 Q;  4YCU A;  1VQB A;  2V1C C;  3HFZ B;  3MEF A;  3HOX G;  2VUM G;  4BBS G;  4DV3 Q;  3S14 H;  2E5L L;  3AYH B;  5C44 H;  3CCS A;  4DV6 L;  3BZK A;  1N36 L;  3KF6 A;  2JE6 I;  4DR1 Q;  1PH9 A;  4LUV A;  2OQ0 A;  4A3C G;  3RLF A;  3CC4 A;  5GQO A;  3UE0 A;  4LF9 Q;  3PF4 A;  1LYL A;  5LMN L;  3KOJ A;  5C4X H;  1CUK A;  1UEB A;  4DV0 Q;  4LF8 L;  3J7Z C;  3W1G A;  1BBW A;  1I5F A;  1SFO H;  5JJK A;  2JA5 H;  2ZTE A;  4JV5 L;  1VQH A;  2FXQ A;  1GD7 A;  2LSS A;  2IHE A;  3HKS A;  4JBM A;  1JT8 A;  2Q2U A;  1KRS A;  4X65 L;  4LWC A;  5H1S E;  4DV5 L;  3ULP A;  4A3E G;  1KHI A;  1N34 Q;  2JA8 G;  3NBH B;  3PO3 G;  2D0O A;  2IT1 A;  4P72 A;  2UU9 Q;  1MIU A;  1G29 1;  2JA6 H;  1HNZ Q;  1TWH H;  2OWO A;  3NEN A;  5M3F H;  3L7Z C;  1KD1 C;  1RL2 A;  2KCM A;  4NXM L;  2BH2 A;  4LFC L;  3CF5 A;  1Y1V H;  4LNQ A;  1HNX Q;  3OTO L;  1VQF A;  1V1Q A;  5ELO A;  3TQY A;  1L1O C;  4LF4 L;  4JI1 L;  3PO2 H;  5EAY A;  1CKM A;  3CPF A;  4DV3 L;  1QUQ B;  4O2D A;  2UXB L;  4DV1 Q;  5M3M G;  4Y52 H;  1JJC B;  3K8A A;  4JBW A;  5J3B A;  4PMW A;  3STB D;  4DR3 L;  2VQF Q;  3G4S A;  4DR2 L;  3CMA A;  4C3H H;  2ALY B;  5JJI A;  4DR1 L;  1XMQ Q;  3TS0 A;  5JJL A;  2BA1 A;  5IE8 A;  4JI8 Q;  4YWL A;  4LF9 L;  3A0J A;  3NEL A;  5LMN W;  3HOY G;  1C0A A;  4BXX H;  4GOP C;  2ID0 A;  1FJG L;  4JBJ A;  4DPG A;  2UXD Q;  3CCM A;  1YHQ A;  1IL2 A;  4BY7 G;  3G6E A;  4GKJ Q;  4J15 A;  5M5W H;  1VQP A;  1HZC A;  1PH5 A;  1SN8 A;  3F2B A;  3JC6 6;  1PHJ A;  1N34 L;  1A62 A;  4JI0 Q;  4R4T A;  4DNI A;  1GM5 A;  4MNO A;  3UDI A;  3M85 A;  2R7Z G;  3W1B A;  5IWA Q;  3CCE A;  1U5K A;  1XPR A;  4DKA C;  1N33 Q;  2B63 H;  3CC2 A;  2PQA B;  4P74 A;  3FKI H;  3S2D H;  1TWG H;  1UE1 A;  4UPA A;  5IP7 G;  1UE7 A;  2NZO A;  4DV1 L;  4A93 G;  4TQU S;  1YBY A;  1OXX K;  5C0X G;  5C0X I;  3HOZ H;  2K4K A;  4AIM A;  4A76 A;  2VQF L;  2A19 A;  1BKB A;  3J80 i;  4HJ7 A;  3PGZ A;  2R6G A;  4OX9 L;  4XIG S;  1XMQ L;  1PFS A;  4YWK A;  4OON A;  1E1O A;  4JI8 L;  2VY3 A;  2E2I H;  4POG A;  5M5Y H;  2YTV A;  4DV7 Q;  3TRZ A;  1MJC A;  2WB1 G;  1HZA A;  1YZ6 A;  3RLO A;  4LF6 Q;  2KHI A;  2Z0S A;  2PI2 A;  2YTY A;  3DM3 A;  2KBN A;  5JEA G;  3T1Y Q;  2R93 H;  2B29 A;  3RN2 A;  1EQQ A;  4GKJ L;  2AKW B;  4JOI A;  4LFB Q;  4UP9 A;  4JI2 Q;  4ME3 A;  3J81 j;  4L5Q A;  4JI7 Q;  4A3D H;  3GTO H;  4B3R Q;  3A5Z B;  4JI0 L;  3M4O H;  2LXK A;  3HOV G;  2Z6K C;  1FVI A;  3E9H A;  1OTC A;  2DGY A;  4BY1 G;  1XPO A;  3D0F A;  5ELN A;  2YU9 H;  4DV6 Q;  2JA7 G;  1G51 A;  4GOP A;  3AQQ A;  1N36 Q;  1V43 A;  1CKN A;  3KDF A;  4C2M H;  1K0R A;  1HNW Q;  3K7A H;  1X6O A;  4L5T A;  4H02 A;  3GO5 A;  4IPD A;  4JI4 L;  1K8G A;  3EN2 A;  1YJW A;  1KIX A;  1M90 C;  4R4O A;  4POF A;  4LF8 Q;  3M4P A;  4UP7 A;  3I7F A;  1D8L A;  3U58 A;  4DR7 Q;  4AYB G;  1NMG A;  3UE1 A;  4IOC A;  1Y1W G;  3AFQ A;  4DK3 C;  1Y1V G;  3GTK H;  1P16 A;  2GVA A;  2VQE L;  4GLX A;  1CKO A;  4X65 Q;  4DV7 L;  2N78 A;  2MFI A;  5IYC H;  2ASB A;  3HOU G;  4LF6 L;  2YYZ A;  1J6Q A;  4LFA Q;  4JI3 L;  1KQS A;  2I5M X;  3T1Y L;  1JJ2 A;  1VQJ A;  1PYS B;  4IJL A;  4XTC S;  1J5E L;  4NXM Q;  3G71 A;  4JI2 L;  4JCV E;  1X9N A;  4JI7 L;  4X64 L;  3HOW H;  4A75 A;  2D0P A;  4BBR G;  1E7Z A;  2NVX H;  2C35 B;  3HKZ G;  4JI1 Q;  1QVG A;  1AE3 A;  5FJ8 H;  1LTL A;  5C3E G;  3GTM H;  2UXB Q;  1Q7Y C;  2H5X A;  2YV5 A;  2R92 H;  4DR3 Q;  1V9P A;  4X62 Q;  4DR5 L;  4DR2 Q;  4A3I H;  1HNW L;  1HR0 Q;  2PNH A;  4A3B G;  3E9I A;  3KYH C;  1Q1E A;  1HZB A;  1YJN A;  4DR7 L;  1GO3 E;  4DV4 Q;  1S40 A;  1FJG Q;  2F4V L;  1SR3 A;  4A3K H;  1PH8 A;  3FP9 A;  4P75 A;  4GKK L;  2Z6K A;  2IX1 A;  3Q8D A;  1X54 A;  2OQK A;  3TEH B;  1VS0 A;  4DR4 L;  5GRO A;  4C3I H;  3CPW A;  4B3M L;  3JAM i;  1YEZ A;  2GVB A;  4IJH A;  4TVA B;  3I4M H;  4HJ5 A;  4LFA L;  3L2P A;  4HJ8 A;  1XPU A;  4WJ3 M;  2EQS A;  1YHA A;  1ASY A;  1JE5 A;  4LF5 Q;  3H0G G;  4DV2 Q;  2NVQ H;  4RG1 A;  1WYD A;  4QGU A;  5IY0 A;  1PH6 A;  4LF7 Q;  4R1J A;  3J80 c;  4A3F H;  1N9W A;  4NB3 A;  4JOI C;  3I4O A;  5IYD G;  4A3J G;  3LGJ A;  1JB7 A;  4NXN Q;  2R93 G;  2K5H A;  2JQO A;  1LUZ A;  2IHF A;  3I56 A;  1MJE A;  1JJG A;  1GVP A;  1Q1B A;  1EUJ A;  4PZ6 A;  4X62 L;  3T1H L;  4L5S A;  1X65 A;  4GLV B;  4A3D G;  4OX9 Q;  4NPS A;  3J81 i;  2WB1 E;  1HR0 L;  1LM0 A;  4YCW A;  2CCZ A;  2A8V A;  1Y14 B;  1DGS A;  4A3M H;  1ASZ A;  1EWI A;  1B7Y B;  4GN5 A;  4DV4 L;  3S2H H;  1VQA A;  2UUB L;  1QVF A;  1Q81 C;  3ULL A;  4HJ9 A;  1PH4 A;  4L5R C;  1XNR L;  3UDF A;  4A3G H;  3EBE A;  4JYA L;  2A1A A;  5IP9 G;  4R4Q A;  2WFW A;  3K81 C;  1EIF A;  1YVC A;  3I4N G;  2Q2I A;  2LXJ A;  1X3G A;  4OO1 G;  4OO1 I;  2IX0 A; 
#chains in the Genus database with same CATH topology
 2XSC A;  1H9J A;  1QUQ A;  1SE8 A;  4R4I A;  1Y69 U;  4LF5 L;  5FLM G;  1O7Z A;  3TP6 A;  1UE6 A;  3NQI A;  3HP3 A;  4OL7 A;  4JI6 Q;  4AYB E;  1WCM G;  5CC4 A;  4JI4 Q;  2VUM H;  2MO0 A;  4BBS H;  5IIF A;  1K83 H;  4TSS A;  2HQL A;  5FO8 B;  2XVS A;  1B9M A;  1I4Q A;  5DLQ E;  1STH A;  1B70 B;  4A3L G;  1HR0 W;  1QVC A;  1TY2 A;  3CCQ A;  1HCZ A;  3M9B A;  1LAC A;  5CYU A;  2DUD A;  3T56 B;  4FF2 A;  4AYB B;  1GJX A;  1KAW A;  4KD3 A;  1J5E Q;  1IBM Q;  3NE5 B;  4JI5 Q;  3S16 H;  5FLX E;  1SLJ A;  2PQA A;  3X3N A;  2JA8 H;  1PH7 A;  2JP1 A;  3KLS X;  3BYY B;  1QNK A;  1I4R A;  1VQD A;  2K5W A;  5EGT A;  1DJR D;  4F8M A;  1H9R A;  4K5V A;  4BBR B;  4CKC A;  4GNX B;  1TII D;  5M3F G;  2WKD A;  1LTS D;  4RWS C;  5DM7 3;  2EJM A;  1I50 B;  1A6X A;  5JOB A;  1IZ6 A;  2EXZ A;  4RKL A;  4DR4 Q;  3PQI A;  3NWS A;  4B3M Q;  4XQJ A;  1U4L A;  4YY3 L;  2N3S A;  4HJA A;  5ELB A;  3AU7 A;  2OCE A;  1QNU A;  1WTW A;  4Y7N B;  1KAA A;  2A6E C;  1I3Q H;  3GTG H;  2AWN A;  3ZJY C;  2QA4 A;  3C1F A;  1BUV T;  4GNX A;  5E1F A;  2VS1 A;  1FYC A;  1XTD A;  3U4V A;  3H0G B;  1BCP B;  4HMI A;  1VQ9 A;  4LK1 C;  2K32 A;  1IBK L;  4ZLT F;  5IP7 H;  2QDL A;  1G8Z D;  3E3X A;  3U4Z A;  4MZ9 A;  4ULL A;  1K73 C;  3NUC A;  5C6A A;  2EJG C;  4MHE A;  1HJP A;  2XRQ D;  2ZJR A;  2EZV A;  4YCV A;  5JEA H;  2WAQ E;  2EDG A;  3I91 A;  3GV3 A;  2K03 A;  3TRE A;  1BBU A;  3I70 A;  2PO4 A;  3VR4 A;  2K04 A;  3CCU A;  2E2H B;  5C4H A;  1TKW B;  4HAE A;  3GTG B;  3I4N B;  1IYV A;  2R61 A;  3GTQ B;  5D14 A;  4O42 A;  3I90 A;  3OMC A;  3M3Y H;  4RHR A;  2HDL A;  3D6C A;  3CCV A;  3DEP A;  4IUQ A;  2ATW A;  3FPU B;  1CM9 A;  2A68 C;  1G2T A;  1XMO Q;  1HXY D;  4DXF A;  3M4Q A;  2ZTD A;  2RF4 A;  1IBL L;  1VQ6 A;  1JWU D;  3BU2 A;  5C44 B;  4IO9 A;  1SRU A;  2NUC A;  2HHH Q;  2HIV A;  4E6I A;  1B1Z A;  2BOS A;  2WAQ G;  2XGT A;  5J1Z A;  1EY9 A;  4DV0 L;  5LHY 1;  3MXG A;  1OXV A;  4IUP A;  5C3E H;  2K14 A;  4OHJ A;  1R4P B;  1SFO B;  2I0Q A;  3BVM A;  3KBG A;  5LMU L;  2Z6B A;  3D31 A;  3ZYY X;  4AH6 A;  3W5O A;  3MZ5 A;  4ABN A;  3HOW G;  2I5L X;  4GNX C;  4KHV A;  1STG A;  1QB5 D;  3DLL A;  1R4Q B;  4AQY Q;  2DY8 A;  1PYW D;  1C7Y A;  4YY3 Q;  1O7I A;  2R92 G;  1W3S A;  4KK7 A;  1HNX L;  3KLR A;  1Y1V B;  2A6H D;  3K0Y A;  3N52 A;  2PZW A;  3K59 A;  3IAY A;  3J7Y W;  4IPG A;  2KEN A;  2L4N A;  2Z8L A;  2L15 A;  2D2C C;  2CVR A;  4PV1 C;  4GOP B;  1S72 A;  1CKN B;  5BR8 L;  3ULJ A;  1X3F A;  2OTL A;  3DWQ A;  5I9P A;  2UXC Q;  2NN6 I;  4DUY L;  1NJI C;  2K75 A;  3HKZ B;  4K8I A;  1AN8 A;  1SMY C;  4IPH A;  1LAB A;  4KHP L;  3VR5 A;  1PTO F;  4DK6 C;  3A7A B;  4YHH L;  5FKA C;  3CD6 A;  2IW3 A;  2CW0 D;  2WP8 J;  3P20 A;  5IGE A;  4EVO A;  5A2Q L;  3A8J E;  5AJ3 L;  2BDO A;  2NVY H;  3OYY A;  1OXU A;  1TWG B;  2NZH A;  1VQ4 A;  1SXT A;  1S3O A;  1WD1 A;  4CJ0 B;  3BZD B;  2TSS A;  4K6L A;  4N9P A;  1HFG A;  1X3P A;  1GHK A;  2E2I B;  2R7F A;  4C1N I;  5HY6 A;  5JJZ A;  3QR8 A;  2IX3 A;  2DJG C;  2F0N A;  4GS3 A;  2R93 B;  4QCL A;  2F0K A;  4LFC Q;  2JA9 A;  3OTO Q;  3S1N H;  1Q46 A;  5K5P A;  4ZRZ A;  1VQB A;  4LF4 Q;  2EY6 A;  3FVQ A;  3HFZ B;  3MEF A;  4DV3 Q;  4FF1 A;  3S14 H;  2E5L L;  3RD4 A;  2JE6 I;  3RLF A;  2F1M A;  3UE0 A;  4FF3 A;  5A35 A;  5LMN L;  4XYQ A;  3KOJ A;  3EJI A;  1CUK A;  4DV0 Q;  2KEE A;  1LTB D;  5ELC A;  5A2Q E;  3K57 A;  1U4R A;  1BBW A;  1I5F A;  2JA5 H;  4CBV A;  2A5H A;  3ULP A;  2A6H C;  3R2T A;  2OWO A;  3NEN A;  1TS5 A;  3L7Z C;  2QEJ C;  2XWB B;  3CF5 A;  2MPM A;  1HNX Q;  1V1Q A;  3N6R A;  2EYH A;  3PO2 H;  1CKM A;  1EEF D;  3HEJ A;  4O2D A;  5KNC A;  4DV1 Q;  2L0C A;  5M3M G;  4Y52 H;  2EVB A;  5J3B A;  4PMW A;  3STB D;  4DR3 L;  2VQF Q;  2A73 B;  4C3H H;  5ISR A;  5JJI A;  4DR1 L;  1XMQ Q;  2EY2 A;  2BA1 A;  4JI8 Q;  4YWL A;  2Z9H A;  1FD7 D;  4UDU C;  2RCF A;  4GOP C;  3EA6 A;  1WTQ A;  5M5W H;  2RDH A;  4OEL B;  1HZC A;  1E2V A;  1SN8 A;  1A62 A;  2B8F A;  2Z4H A;  4DU9 A;  2N55 A;  3W1B A;  1F2Y A;  1IKL A;  4KN7 C;  4V0B A;  1H9S A;  4KV6 A;  2B63 H;  3S2D H;  4P74 A;  3FKI H;  5T1G A;  4WOR A;  3OSO A;  1IYU A;  2F0O A;  3HOZ H;  4A76 A;  2A19 A;  2R6G A;  4ZKB B;  4OON A;  4A3M B;  3RLO A;  4CHT B;  5EJW A;  2PI2 A;  2KBN A;  1V1O A;  2R3Z A;  2B29 A;  3R93 A;  4A3G B;  1F9R A;  2VXW A;  2J7Z A;  4M8A A;  3GTO H;  4JI0 L;  2I46 A;  1OTC A;  4BY1 G;  2KJX A;  5ELN A;  2YU9 H;  1NUC A;  2K6A A;  3J81 L;  3MC0 B;  5KIX A;  4IUU A;  3AQQ A;  3K7A H;  4L5T A;  3DMU A;  1EY6 A;  3EN2 A;  2KVM A;  1M90 C;  4HCS A;  4R4O A;  2IPK D;  4UP7 A;  3I7F A;  1K8M A;  1DON A;  2NB0 A;  5FO7 B;  1CI3 M;  1P16 A;  5IGG A;  4DV7 L;  5CGK A;  3OIQ A;  5COY A;  4KD4 A;  4LF6 L;  4JI3 L;  2I5M X;  1JJ2 A;  1YNN D;  3CRK C;  4IJL A;  1HQR D;  1NCV A;  2LS0 1;  4A3E B;  3TZD A;  3UI2 A;  2NVX H;  1PZI D;  2C35 B;  5FJ8 H;  5KYL A;  1Q7Y C;  4DR3 Q;  4DR5 L;  2E2J B;  4XT1 B;  1HZB A;  2O5J C;  4DR7 L;  3J81 E;  2F4V L;  2JN4 A;  1L0Y B;  1SR3 A;  4A3K H;  4P75 A;  3LX0 A;  2EYP A;  2OQK A;  5GRO A;  4C3I H;  3CPW A;  3I4M H;  1YEZ A;  4TVA B;  4LFA L;  4I65 A;  3L2P A;  4X3S A;  4HJ8 A;  1JE5 A;  1LT6 D;  4RG1 A;  4QGU A;  4LF7 Q;  1EY7 A;  2NVX B;  3J80 c;  4A3F H;  1N9W A;  1S5F D;  5IYD G;  1HTL D;  3LGJ A;  2H1E A;  4NXN Q;  1LUZ A;  2IJ0 A;  1Q1B A;  4PZ6 A;  1EWC A;  3J81 i;  5EPK A;  1XXG A;  1HR0 L;  1XTC D;  4YCW A;  1F2L A;  3NBH A;  4B08 A;  1ASZ A;  4A93 B;  3C1E A;  3S2H H;  4DNT B;  2UUB L;  2F03 A;  1MSH A;  4HJ9 A;  3UDF A;  1G2S A;  5C5M A;  3T13 A;  5IP9 G;  2WFW A;  3K81 C;  2A69 D;  4TKO B;  4C3I B;  3GD7 A;  1I6H B;  5M5X H;  1GUT A;  3MTS A;  1EY4 A;  1LT3 D;  1WTV A;  1SE3 A;  1VF5 C;  1STN A;  4TRD A;  2NVT H;  2ZM6 Q;  1EIG A;  2SEB D;  4RFB A;  2YTX A;  2JA7 B;  2VB3 X;  3KF8 B;  4A3C H;  3JAM L;  1MHW C;  5EKL A;  1YJ9 A;  1R9T H;  1JOO A;  1SMX A;  5ELE A;  1JWM D;  2K5V A;  2EE1 A;  2SDF A;  1TWF H;  4KTA A;  2JEA I;  4JI3 Q;  3S2H B;  1VQK A;  2CQO A;  2VL6 A;  2F0H A;  1I4X A;  3AB9 A;  3AMU A;  2AHO B;  5C4X G;  1STE A;  1KDB A;  3HOU B;  4KY6 A;  4HR7 B;  1BVS A;  4FF4 A;  2B2V A;  4DR5 Q;  4CKB A;  3A8K E;  2F4I A;  3KF8 A;  1SSO A;  1NE3 A;  2ZXR A;  1H95 A;  4JI6 L;  1VQG A;  2JA6 G;  1TWC B;  4JC0 A;  2O5I C;  2F4V Q;  3JAM c;  2N49 A;  1UWV A;  4A3B B;  3LWE A;  3HOY H;  3F8T A;  4BY7 H;  4X3U A;  4NDX A;  1YI2 A;  3CAM A;  1IBM L;  4JI5 L;  4K5X A;  5I9O A;  2CH4 A;  5NUC A;  5IT9 L;  1Q86 C;  3QOL A;  1HTP A;  1YNX A;  3KUP A;  2R7Z H;  3RZO H;  1U4P A;  2MQH A;  1NR2 A;  3D4D A;  3FHW A;  4GN3 B;  4Z9C B;  5E4X A;  1PVO A;  1LTI D;  4JG2 A;  3U9O A;  5JPN C;  1GUN A;  1UUP A;  2B39 A;  5E7N A;  1K3B C;  2K05 A;  3OW2 A;  4A3J B;  4KLK A;  3K58 A;  1O7L A;  1KC8 C;  2UUB Q;  3PUZ A;  2L1B A;  1SNM A;  2AMC B;  3VR3 A;  2MNA A;  1E24 A;  4FP5 D;  3S1M B;  1Y8O B;  3HOY B;  3GV6 A;  2HIX A;  3S1R B;  2UUA Q;  1PH3 A;  1XX8 A;  1FNU A;  2K1B A;  4B3T L;  4DGZ A;  5IT9 c;  5K36 G;  1Z47 A;  3A7L A;  1TXY A;  4P71 A;  4HIM A;  3HOV H;  4EQN A;  2B8G A;  5AFW A;  1OXT A;  2RSO A;  4XDX A;  1K8A C;  3SVM A;  3CQZ B;  2OEO A;  3IRB A;  1J9O A;  4PMB A;  2B2V C;  5FOB B;  1VCI A;  3QIA A;  1PRT B;  4UHV A;  3I73 A;  2Q8T A;  5T1I A;  2F0Q A;  1Y1W H;  2HD3 A;  2X69 A;  3PF5 A;  4N9T A;  3FPP A;  1M8A A;  1GKH A;  5DM6 3;  4LUZ A;  3NQT A;  2HDM A;  3AEV A;  4BA2 I;  1UNS A;  3J7A F;  3IFT A;  5I6W A;  5JVH 3;  1HH2 P;  3E6Z X;  4FXG C;  3VA5 A;  4QUF A;  1SNO A;  2CFM A;  2OTJ A;  2Q2T A;  4HID A;  4BBR H;  5G3L D;  4QY7 A;  4DA2 A;  3HOV B;  1SRO A;  5GAH C;  1MGS A;  5C0X J;  1I50 H;  5FLX c;  1CA5 A;  3BZC A;  2Q2H A;  3VYS A;  1XMO L;  2VW9 A;  5EBC A;  1UE5 A;  1TWH B;  5M3F B;  4NMZ A;  2K5Q A;  1H9M A;  1Y1W B;  3CRL C;  4A3I G;  3BYT B;  1OO9 B;  5IGC A;  4Y7N H;  2AQ3 B;  3BVZ A;  4ZUI A;  3CME A;  2A68 D;  2JYO A;  4FXK C;  2E75 C;  1CTM A;  5EKK A;  1BR9 A;  1PYB A;  4OWW B;  4KKU A;  2HHH L;  1I6V C;  3KDF B;  4IUN A;  3H0G H;  2FHT A;  5ELF A;  4JBK A;  1VQM A;  3MWY W;  1EIY B;  1DOL A;  1U0L A;  2NN6 G;  1DM0 B;  3VYT A;  4NP5 A;  3U50 C;  2F0I A;  2ZT9 C;  2G9H D;  4G57 A;  5KEE A;  4DUZ Q;  1JMC A;  1EEI D;  2KED A;  4EQO A;  1A2U A;  3CXC A;  1OXS C;  1JOK A;  5GAE C;  2WIN B;  1EYA A;  5C3W A;  4AQY L;  3GDE A;  3FEW X;  2XNA C;  1O80 A;  1Z9F A;  3CW2 C;  4OXP A;  2XRS D;  1IYJ B;  2JJQ A;  1DCZ A;  3G48 A;  1WOC A;  4B3T Q;  3PSI A;  4DAM A;  4N8X 1;  2E2H H;  1RCV D;  1TS3 A;  2GN5 A;  2QGQ A;  4A4I A;  1PLF A;  1FR3 A;  3I4N H;  3GTQ H;  5IGF A;  3NTH A;  5BN5 A;  1AEX A;  3KF6 B;  1P8L A;  1U4M A;  2KHJ A;  3E5S A;  2KCT A;  2XTI A;  2UXC L;  4DV5 Q;  4IUV A;  2FIN B;  5M5Y B;  1T5X D;  4MTN A;  4IFD H;  2KCC A;  1IXR A;  5IYB H;  2F3I A;  4HIK A;  1KXL A;  4YIJ A;  5EKI A;  1PRT C;  1BCP D;  2VUM G;  4BBS G;  1EL0 A;  1SMY D;  3AYH B;  3OWF A;  5C44 H;  4C1N K;  2LY7 A;  3BZK A;  1N36 L;  3KF6 A;  3CC4 A;  5GQO A;  4LF9 Q;  4H7B A;  2QCP X;  1B2T A;  4K2L A;  4NW2 A;  3J7Z C;  2AUJ D;  5E3F A;  1SFO H;  5JJK A;  2ZTE A;  1HA6 A;  1VQH A;  2FXQ A;  3WOE A;  2LSS A;  2IHE A;  1JT8 A;  1JWS D;  1LT5 D;  4LWC A;  2WAQ B;  5H1S E;  2JA8 G;  2QIL A;  3CU7 A;  1M4V A;  1GUO A;  5EPL A;  2PQE A;  1DOK A;  3L3O C;  5CMD A;  4H44 C;  5C3X A;  4LFC L;  1EIH A;  1Y1V H;  3SK8 A;  4LNQ A;  3OTO L;  1HUM A;  5M9O A;  1VQF A;  3TQY A;  3HOW B;  4LF4 L;  4JI1 L;  2CQA A;  3I8Z A;  4DV3 L;  2UXB L;  1HFN A;  1JCK B;  1LO5 D;  3K8A A;  4JBW A;  2FFK B;  3CMA A;  3TS0 A;  1GXD C;  1QJO A;  1ENC A;  3S9W A;  4ILW A;  4BXX H;  1C0A A;  5EQ0 A;  3HRZ C;  4JBJ A;  4DPG A;  1YHQ A;  4HMJ A;  2BDN A;  4HSP A;  1VQP A;  3O13 A;  1PH5 A;  3JC6 6;  3NXW A;  1Q90 A;  5L37 A;  2NWG A;  3CCE A;  2E74 C;  2BE5 C;  3MEH A;  4RKB A;  1VMP A;  2L9H A;  1TWG H;  4UPA A;  5IP7 G;  1UE7 A;  4DV1 L;  4TQU S;  1YBY A;  1DOM A;  1ENA A;  4WFN 3;  2VQF L;  1IKM A;  3PGZ A;  3GP7 A;  3VR2 A;  1XMQ L;  4YWK A;  1E1O A;  2F0D A;  4JI8 L;  2VY3 A;  2E2I H;  5KYI A;  2YTV A;  3TRZ A;  2WB1 G;  3DM1 A;  1YZ6 A;  2G5D A;  2YTY A;  5JEA G;  1BCP C;  2R93 H;  4Q0F A;  4ZCK A;  2AKW B;  4JOI A;  4UP9 A;  3SHL A;  4N8F A;  4JI2 Q;  4ME3 A;  3J81 j;  2RDG A;  4L5Q A;  4XQN A;  2NBF A;  3A5Z B;  3D6W A;  2NTT A;  2LXK A;  1PZJ D;  1FVI A;  4CJ2 C;  5CV5 A;  1XPO A;  3D0F A;  1EU3 A;  3MXP A;  4GOP A;  3T4A C;  1N36 Q;  1CKN A;  2PNR C;  2B2U C;  3GO5 A;  1K8G A;  1KIX A;  1YJW A;  4OIJ A;  4POF A;  1SE2 A;  3U58 A;  1D8L A;  2SOB A;  1NMG A;  3UE1 A;  2OF1 A;  4DK3 C;  1Y1V G;  4ZQ3 A;  4C56 C;  4KJN A;  3SK5 A;  1EQT A;  5IYC H;  2YYZ A;  1B9N A;  1IHZ A;  3DEO A;  3I72 A;  1STA A;  2E2D C;  3SR1 A;  1V1P B;  2J0T D;  2SNM A;  3R8B A;  4C3J B;  3HKZ G;  3Q22 A;  4JI1 Q;  1QVG A;  1AE3 A;  5C3E G;  1LTL A;  2UXB Q;  4L6T B;  5D3D A;  1F9P A;  1V9P A;  4X62 Q;  4FYD A;  4FNF A;  3KYH C;  1KLU D;  3NTI A;  2EYL A;  1ILQ A;  3K5N A;  1YJN A;  1CHP D;  2X6G A;  1GO3 E;  1SJH D;  5M3M B;  4DV4 Q;  1S40 A;  5C5L A;  1SBB B;  3S15 B;  4OIK A;  2RA4 A;  1EZ8 A;  1V1P A;  3V05 A;  1O7Y A;  4IJH A;  1II3 A;  3VR6 A;  5HUR A;  2Z1C A;  1XPU A;  4QB4 A;  4FXD A;  1B44 D;  1DZ1 A;  2F0G A;  2K28 A;  3H6M A;  4DV2 Q;  5IY0 A;  4LJZ C;  3GQB A;  4NB3 A;  4JOI C;  1JB7 A;  3L9A X;  2R93 G;  2K5H A;  3OWE B;  2JQO A;  2IHF A;  1MJE A;  1JJG A;  3GTL B;  1EUJ A;  3T1H L;  2ZXO A;  1LM0 A;  2K01 A;  2A8V A;  1Y14 B;  3S17 B;  5TSS A;  2D9U A;  2KHS A;  2PW7 A;  3IKJ A;  4A3M H;  1TWA B;  1ZKO A;  1QVF A;  4G7O C;  1Q81 C;  4A3G H;  4JYA L;  4HCE A;  3A54 A;  3WDN A;  4DXG A;  1UEA B;  1KNE A;  1JOQ A;  1EIF A;  1B53 A;  2IX0 A;  3UDX A;  3DXJ C;  1SEB D;  4M1U B;  2PI2 E;  1PFN A;  1SYF A;  3A74 A;  3OOC A;  4LF7 L;  3HOX H;  4GLA C;  2F0T A;  4NXN L;  4IFD I;  3NK9 A;  4BY1 B;  4P2C B;  1HZ9 A;  3H3V C;  1Q12 A;  4ZUJ A;  4KY5 A;  2UUC Q;  4PMC A;  2DN8 A;  3WOF A;  2JXM B;  1NY4 A;  3EVQ A;  1W2B A;  3F2U A;  4KKT A;  3Q23 A;  1QZG A;  1GUS A;  4X66 Q;  1EZ6 A;  2LKV A;  4I7Z C;  1B8A A;  2K7V A;  4ODG A;  4A3E H;  4U68 A;  1EOV A;  3K80 C;  2AWO A;  2HQE A;  2JEB I;  3TN2 A;  4DR6 Q;  2JA5 G;  1Q8K A;  1A0I A;  3QWN A;  2E2J H;  5C4J H;  1G6Z A;  1MKH A;  2ZM6 L;  1VQL A;  4ZYS A;  3KJO A;  3HOX B;  1ROD A;  1CSQ A;  1AE2 A;  3LWU A;  3Q24 A;  1SYC A;  1TS2 A;  1A3V A;  1F9S A;  3SXH A;  3PO2 G;  1YIT A;  4R4C A;  1RTN A;  4S3S A;  3RN5 A;  1T9H A;  4C3H G;  4LUO A;  1O78 A;  4IUR A;  2CWA A;  3W2D A;  1JIC A;  5G3L F;  1SAP A;  3PO3 B;  2I07 B;  2PYK A;  3J81 c;  4KI0 A;  3A5U A;  1EY0 A;  2N88 A;  3T1H Q;  5C4J B;  2KA7 A;  2Z4I A;  3TS2 A;  2E76 C;  1X56 A;  1RJT A;  4A93 H;  5C0X H;  4IOA A;  3C2P A;  1G6P A;  3V2T A;  1LTG D;  4JYA Q;  1A8V A;  2KOL A;  4MIU A;  4KJO A;  2B63 G;  3FKI G;  3K0X A;  3PV0 A;  3F2C A;  1B3Q A;  3CCR A;  2X6L A;  3R3O A;  3I2Z A;  2F3W A;  1XNQ L;  3HOZ G;  3BDO A;  1I6H H;  1KL9 A;  1FGU A;  3QB3 A;  1Z6H A;  2PZT A;  3KLW A;  4WJ4 A;  2F0M A;  1MBY A;  2D62 A;  1BQQ T;  3KLS A;  4K5W A;  2O4X A;  3MA2 B;  1Y8P B;  3MXN B;  1PTO B;  3TSS A;  3CC7 A;  2JA7 H;  1L0W A;  2D5D A;  4K2K A;  2QEX A;  3K5L A;  1VQC A;  3PUV A;  2K52 A;  5BN3 A;  3KJP A;  5KRU A;  1A2T A;  2H4O A;  4QUC A;  2BA0 A;  2ZXP A;  2ZTC A;  1NTG A;  1EYG A;  1F9Q A;  4JPB W;  4KN4 C;  2L5T A;  3HOU H;  1CZG A;  2UUA L;  3VYU A;  4MN3 A;  5KND A;  4GN4 B;  2MO1 A;  1Y8N B;  3MXN A;  4B3S Q;  4QIW E;  1WFQ A;  3J7A V;  4IN3 A;  3R2I A;  2F0V A;  1A3T A;  2RCN A;  3M7N A;  1TWC H;  2JK8 A;  1X3E A;  3EIV A;  5CV4 A;  2AQ1 B;  1WTX A;  4G7Z C;  2PCF B;  4A3B H;  3PIO 3;  1PH1 A;  4QIW B;  1BCP F;  2UU9 L;  3SK6 A;  2NYZ D;  5FJ8 G;  1HNZ L;  1L1O B;  2JA6 B;  2O2L D;  4K0K Q;  2F0L A;  4ME5 A;  4JW0 A;  1AFP A;  4PZ8 A;  4RCN A;  1EY5 A;  3PUX A;  2ZJP A;  1F2Z A;  3I55 A;  1DYQ A;  3J7A 5;  3BDL A;  1K28 A;  2RBM A;  2RVL A;  4FO2 A;  1WTH A;  2Y0S E;  4A3K G;  2N8N A;  2ICE C;  2K5N A;  4C3I G;  5CV9 A;  3I4M G;  3CP0 A;  1AZQ A;  2EOT A;  4A3J H;  2UXD L;  1L1O A;  3CHB D;  3BG3 A;  5GAG C;  1EQV A;  3ERS X;  3B6Y A;  4X6A H;  4X3T A;  1VQO A;  2C5C A;  2L12 A;  3U9S A;  3KFU A;  2LMC B;  4YWM A;  3S1M H;  4A3F G;  1UAP A;  1S5D D;  3CCJ A;  3S1R H;  1VQN A;  1XNQ Q;  3BVG A;  2F0W A;  1GOZ A;  1LT4 D;  1M1K C;  4EX5 A;  4L63 B;  1FNW A;  5CV8 A;  4OO1 H;  1SNP A;  4EGV A;  2BH8 A;  4PZ7 A;  1PA6 A;  3I3C A;  2RHQ B;  4JV5 Q;  2FMM A;  1MSG A;  3HZX A;  3L0O A;  2P5Z X;  4UP8 A;  5FLM H;  1VQ5 A;  4UY8 C;  4DK0 A;  1EU4 A;  3CQZ H;  2B2Y A;  2Y0S G;  1L0X B;  2EXD A;  2FMC A;  4RAU C;  4PNY A;  2HT1 A;  1PTO C;  1WCM H;  1N8R C;  1CT1 D;  4DFA A;  1CSP A;  4DUZ L;  4RGM A;  2K5D A;  4LFB L;  1JE4 A;  1SNC A;  4A3L H;  1EQR A;  4A3D B;  4YCU A;  4OGQ C;  3BDC A;  1E2W A;  1ONL A;  1E0B A;  3CCS A;  4DV6 L;  1SJE D;  3P1H A;  2WAC A;  4A3C G;  2OQ0 A;  4C2M B;  1XWE A;  2KQ3 A;  3RUZ A;  3W1G A;  5FK9 C;  4JBM A;  1GD7 A;  3HKS A;  4X65 L;  5IOC A;  4DV5 L;  1N34 Q;  2IT1 A;  2UU9 Q;  1EY8 A;  1MIU A;  1WCM B;  3IFD A;  1TWH H;  1HNZ Q;  5M3F H;  2PZU A;  1RL2 A;  2KCM A;  2M2L A;  5CV7 A;  3MHB A;  3OMG A;  4F88 A;  3Q0A A;  5CV6 A;  1L1O C;  1TVX A;  1ICF B;  1VDZ A;  3CPF A;  1QUQ B;  3GTM B;  2L11 A;  3FMC A;  5IGB A;  3G4S A;  4DR2 L;  4A3I B;  5JJL A;  2QW7 A;  1ESR A;  1PRT D;  2Q8I B;  1RKN A;  2VB2 X;  4LF9 L;  2Q8R E;  3HOY G;  4FVM A;  3ERO A;  1D1K A;  2ID0 A;  1D2B A;  2F0S A;  2RQX A;  2UXD Q;  3CCM A;  1IL2 A;  4BY7 G;  4GKJ Q;  3K5O A;  3K5M A;  1V8Q A;  3D8G A;  2V4D A;  5BN4 A;  3LNN A;  5F2D A;  1QCB D;  2R7Z G;  2B2Y C;  4RGN A;  1U5K A;  3URY A;  4DKA C;  1WTO A;  2NVQ B;  1Q3L A;  2PQA B;  2F0U A;  1KLG D;  3PIP 3;  1UE1 A;  3NTK A;  1LLR D;  2HCI A;  2NZO A;  3T53 B;  5C0X I;  3NSW A;  2K4K A;  2DNE A;  4HJ7 A;  1NSN S;  2CH4 W;  4XIG S;  3MAQ A;  4POG A;  5M5Y H;  2OT2 A;  1MJC A;  1HZA A;  4RCO A;  1GUW A;  2NZ1 D;  2KHI A;  2WKC A;  1SE4 A;  2Z0S A;  3DM3 A;  4XT3 B;  3T1Y Q;  1IW7 D;  1EQQ A;  5DEH A;  4LFB Q;  4XYO A;  4JI7 Q;  3A55 A;  2HUG A;  3M4O H;  3HOV G;  2Z6K C;  1WTR A;  2DGY A;  4IUT A;  4DV6 Q;  4ZK9 B;  3NP8 A;  1SNQ A;  1V43 A;  3QO2 A;  3KDF A;  1BOS A;  1K0R A;  1HNW Q;  3G7L A;  4KMU C;  2F0E A;  2VUM B;  4BBS B;  3M4P A;  1K83 B;  2B2W A;  4AYB G;  4IOC A;  2BE5 D;  1Y1W G;  3AFQ A;  3GTK H;  2EYO A;  2VQE L;  4GLX A;  4X65 Q;  1YNJ D;  2ASB A;  1ENF A;  2XN9 C;  1J6Q A;  4J8Q A;  1KQS A;  4CKE A;  4V19 0;  1T5E A;  1PYS B;  4RA8 A;  1STB A;  1CQV A;  4JI2 L;  1X9N A;  4X64 L;  3HOW H;  3S16 B;  2D0P A;  2J4X A;  4BBR G;  1E7Z A;  2JA8 B;  3M4O B;  1VF7 A;  1HHV A;  5IGD A;  3I4L A;  2R92 H;  3H09 A;  4DR2 Q;  2FJ2 A;  2PNH A;  3E9I A;  1Q1E A;  5J22 A;  4LMQ D;  3FP9 A;  2GA4 B;  1B4O A;  4WJW A;  4GKK L;  1C4Q A;  2IX1 A;  3GTK B;  3Q8D A;  3D3R A;  1SYE A;  3TEH B;  1VS0 A;  2KEC A;  3OW7 A;  1PDQ A;  2EYJ A;  1QOH A;  2B2U A;  3DWA A;  5JAV A;  4LF5 Q;  4IAL A;  4HTH A;  3H0G G;  3D4W A;  1I3Q B;  1PH6 A;  2LFN A;  3NHH A;  4R1J A;  1GHJ A;  3CKI B;  3I4O A;  3A8I E;  3SE0 A;  3I56 A;  1GVP A;  4L5S A;  2R92 B;  4X62 L;  1X65 A;  4GLV B;  1IW7 C;  4NPS A;  2EPB A;  2WB1 E;  2EYM A;  2CCZ A;  4RGO S;  1ICW A;  4DNR B;  5CR3 A;  5LL6 X;  1PMR A;  1B50 A;  5EPJ A;  1B7Y B;  4DK1 A;  4DV4 L;  1ILP A;  4BWG B;  3ULL A;  4HED A;  1XNR L;  3EBE A;  2XWJ B;  3V96 A;  2B2W C;  1YVC A;  3I4N G;  2Q2I A;  2WB1 B;  2LXJ A;  1X3G A;  5KGU A;  4B9X A;  1CK1 A;  3PCO B;  4OO1 I;  1BF4 A;  1IL8 A;  3E0E A;  2CWP A;  1E22 A;  2MGS A;  4IPC A;  1S5B D;  3RNU A;  1DD2 A;  4DV2 L;  4CDF C;  3H3V H;  1CHQ D;  1W6K A;  2ZJQ A;  1VQ7 A;  4NKL A;  4RGT A;  2MJ8 A;  4IFD G;  1AZP A;  3TBI B;  1YNJ C;  3M3Y B;  4OEM B;  1S5E D;  3QJY A;  5IYB G;  2MP1 A;  1KRT A;  3ND9 A;  1ZXT A;  2PMZ E;  3OIP A;  4P73 A;  2VQE Q;  2F0F A;  4QMG A;  3ER0 A;  5I2X A;  1RTO A;  5C4Z A;  2A74 C;  1VQ8 A;  5C44 G;  4KHZ A;  1PH2 A;  2BCO A;  3HKZ E;  4DAP A;  2EY1 A;  4X64 Q;  3SGI A;  4C3J H;  1JQY D;  1XJV A;  5JPM C;  2PMZ B;  2QKI C;  1SYG A;  1PFB A;  3ERQ A;  1I94 L;  1WJJ A;  1YHB A;  3BJU A;  1N32 L;  2IY5 B;  1D7Q A;  1IBK Q;  1FNV A;  4RHS A;  5CBA E;  3PUW A;  5C3E B;  5M3M H;  2CHB D;  1SYD A;  4HIO A;  1Q82 C;  3D4R A;  1E2Z A;  4GKK Q;  3S15 H;  4U67 3;  2UUC L;  5I2Y A;  2XIW A;  4B9W A;  3BS1 A;  3M7G A;  4EQ5 A;  5GAD C;  1GUG A;  1D6E C;  3OHX C;  3PIO A;  4X66 L;  1KAB A;  4Q5V A;  3VYR A;  1C9O A;  4O1N A;  3K7U C;  1HUN A;  3C3L A;  4BXX G;  1QE6 A;  1I4G A;  2F3V A;  4DR6 L;  3DUZ A;  3GTL H;  3SK4 A;  1A63 A;  4JVZ A;  3S17 H;  1RHP A;  2CKZ B;  1TWA H;  2M00 A;  4PG3 A;  4J6H A;  5LL6 S;  5E4W C;  1IBL Q;  1LTA D;  5DAU A;  1XNR Q;  1NAP A;  1E3P A;  4LW1 A;  1WTP A;  2RKS A;  2B3G A;  4WRD A;  2MUY A;  3RLN A;  5HGQ A;  1W6J A;  1TY0 A;  1RD9 D;  1EOT A;  3CCL A;  5COR A;  1E1T A;  1FL0 A;  4QJF A;  1TS4 A;  1STY A;  1FGB D;  1I4P A;  2NVY B;  2RHS B;  2ENB A;  2I5H A;  4QQB X;  1AP0 A;  2IWH A;  4BY1 H;  2OXP A;  2K33 A;  3SEB A;  3H94 A;  4H13 C;  1K3R A;  1PXU A;  4DN4 M;  5LMU Q;  4RMF A;  1S4Z A;  4ZKC B;  4C3J G;  1L2F A;  1X32 A;  1D5Z C;  4QL5 A;  3OPO A;  2EIF A;  4DAY B;  1K0S A;  4MTK A;  1I4H A;  1K8O A;  3TP8 A;  3S1N B;  3W3A A;  3K6O A;  4F7X A;  3S14 B;  2K50 A;  1BO0 A;  1TU2 B;  1H9S B;  1SDF A;  5HGT A;  5BR8 Q;  1I94 Q;  4ZAI A;  2AQ2 B;  4DUY Q;  5IYC G;  1X55 A;  1NBW A;  1N32 Q;  4JK1 C;  3ICE A;  3PUY A;  4IFD J;  4DAY A;  3M4Y A;  2KCN A;  2JA5 B;  2CW0 C;  4KHP Q;  3TP7 A;  3S1Q H;  3H15 A;  4HN7 A;  2EYF A;  4KY7 A;  4YHH Q;  1H9K A;  4J1M A;  3GTP H;  4BA1 I;  4ID6 A;  4EQP A;  5JEA J;  1EFW A;  1AH9 A;  1NMF A;  1ET6 A;  4CDE C;  5AJ3 Q;  1U9R A;  2MHV A;  4FDB A;  3RMH A;  3PO2 B;  3PO3 H;  1JR0 D;  1BDO A;  1WI5 A;  5DNF A;  2VNU D;  1K9M C;  4OWT B;  3EQL C;  4B3S L;  1VQE A;  4C3H B;  1QZH A;  1PZK D;  3HGB A;  4O0A A;  2SNS A;  3TP5 A;  2WII B;  2KUM A;  4G7H C;  4XXE A;  3RR5 A;  5IYD H;  1Q8I A;  2PW5 A;  4APV A;  1YIJ A;  1PV4 A;  5M5W B;  4K8J A;  2ES2 A;  1RDP D;  3S1Q B;  1D1I A;  3MFG A;  3F2D A;  1S5C D;  1ML0 D;  2E5L Q;  3GTP B;  4K0K L;  5IWA L;  3WWV A;  1N33 L;  1KDA A;  1PRT F;  1EYD A;  5IP9 H;  2B63 B;  1HPC A;  2F52 A;  3S2D B;  3FKI B;  4GZY C;  3QG1 A;  3F1Z A;  3VDY A;  5LMN Q;  4OWX B;  4A3M G;  1TR5 A;  1HRJ A;  3RZD H;  3HOZ B;  2DY7 A;  4DAV A;  2VZA A;  3NEM A;  1PTO H;  4A3G G;  2E8G A;  3PIP A;  1VQI A;  3GTJ H;  3FRP B;  1NR4 A;  5I6Y A;  2EY5 A;  1D5M C;  4ALP A;  1ZYR D;  2R7D A;  1BBX C;  1KNA A;  3UDG A;  4IQZ A;  3STB C;  3AFP A;  1RIP A;  4B3R L;  3S24 A;  1DXM A;  3GTO B;  3H3V I;  1TQO A;  2V1C C;  3HOX G;  4DF7 A;  1CFM A;  2WV6 D;  3J80 L;  1XYI A;  2YU9 B;  4DR1 Q;  1PH9 A;  4LUV A;  3K7A B;  3PF4 A;  1WD0 A;  1LYL A;  5D3I B;  5C4X H;  1UEB A;  4LF8 L;  3RZD B;  1LV9 A;  4RH6 A;  4JV5 L;  1A3U A;  2Q2U A;  1KRS A;  3MFY A;  3GTJ B;  4A3E G;  1KHI A;  2TMP A;  3PO3 G;  3NBH B;  1J8I A;  2D0O A;  1ZEQ X;  4P72 A;  4X3K A;  1G29 1;  2JA6 H;  1HA5 A;  3C46 A;  2RDF A;  1KD1 C;  1PFM A;  4NXM L;  2BH2 A;  1SYB A;  5ELO A;  1PTO D;  5CBE E;  5EAY A;  3ITP A;  2C9O A;  1JJC B;  1LTT D;  4QF4 A;  3VA7 A;  2M9V A;  3TME A;  1CQF A;  2ALY B;  1CA6 A;  3MXU A;  3IL8 A;  5IE8 A;  5FO9 B;  1EWH A;  3A0J A;  3NEL A;  4KKS A;  5LMN W;  1Z7T A;  3J80 E;  1EFI D;  5C4X B;  1FJG L;  3HG9 A;  3Q6S A;  1QG7 A;  3G6E A;  4J15 A;  4A3K B;  4PQX A;  1MI2 A;  1VMC A;  1PHJ A;  1AW7 A;  3KBX A;  3F2B A;  1N34 L;  3E0J A;  4JI0 Q;  1WVL A;  4R4T A;  4DNI A;  3EFX D;  1GM5 A;  3I4M B;  4MNO A;  1CZW A;  3SDZ A;  3HS0 C;  4I7A A;  3UDI A;  3M85 A;  5IWA Q;  4IZ8 A;  2B2T A;  2JSO A;  1XPR A;  2G9D A;  1N33 Q;  4BS9 A;  3CC2 A;  1EYC A;  1BXT A;  1X3Q A;  1KDC A;  4A3F B;  2QF7 A;  4A93 G;  5C0X G;  1OXX K;  4R8N A;  5EBD A;  3ND8 A;  4AIM A;  3DHQ A;  1ZYR C;  1BKB A;  1QWY A;  3J80 i;  1G91 A;  4OX9 L;  1YNN C;  1PFS A;  5K36 H;  4DV7 Q;  1NNX A;  1KTK A;  4G4K A;  4LF6 Q;  2F0P A;  1RF2 D;  2NTS A;  4GKJ L;  2F0J A;  3RN2 A;  2QDB A;  1JB3 A;  4A3D H;  3NWT A;  2AUK A;  2Y0S B;  4B3R Q;  2DJF C;  3X3M A;  1B3A A;  3E9H A;  3DWP A;  4CJ1 B;  1JC7 A;  5M5X B;  2JA7 G;  1G51 A;  1C48 A;  4C2M H;  1X6O A;  4H02 A;  4IPD A;  2NVT B;  4JI4 L;  1F2M A;  1MD2 D;  2RSN A;  4LF8 Q;  4DR7 Q;  2L55 A;  1ET9 A;  1ESF A;  4R8I A;  5I4D A;  3NBI A;  2GVA A;  1CKO A;  3H91 A;  2N78 A;  2MFI A;  4K6D A;  1R9T B;  3PMF A;  3HOU G;  4LFA Q;  1TWF B;  3MVV A;  3T1Y L;  1VQJ A;  1TT2 A;  4XTC S;  1C8C A;  3T51 B;  1J5E L;  3JAM E;  3G71 A;  4JCV E;  4R9W A;  1BNZ A;  4NXM Q;  4JI7 L;  4A75 A;  1JOR A;  2ICI A;  4CGY B;  3QOJ A;  5ELD A;  2DNC A;  3GTM H;  1HQM C;  3P7J A;  1F77 A;  2H5X A;  2YV5 A;  3A56 A;  4CDD C;  3TDQ A;  4A3I H;  1HNW L;  1A15 A;  1HR0 Q;  4A3B G;  5IOD A;  2IL8 A;  2EJF C;  2B2T C;  2PPB C;  2A69 C;  1FJG Q;  4K14 A;  4L8J A;  1PH8 A;  2Z6K A;  1X54 A;  2HCC A;  4DR4 L;  2NN6 H;  3KK7 A;  3JAM i;  4B3M L;  2GVB A;  4HJ5 A;  3FDT A;  3G6J B;  4WJ3 M;  4HSV A;  1LTR D;  2EQS A;  4BY7 B;  1YHA A;  1ASY A;  5KNB A;  2NVQ H;  1WYD A;  1D5X C;  3ONA B;  3T16 A;  5J39 A;  4H0L C;  4A3J G;  4CDC C;  3RZO B;  2R7Z B;  4XQQ A;  2A6E D;  4A3D G;  4OX9 Q;  4LAA A;  3TZU A;  5IT9 E;  1SND A;  1DGS A;  4UAI A;  5FLX L;  3NPP A;  4F87 A;  1EWI A;  1QIL A;  4GN5 A;  1VQA A;  3P75 A;  1PH4 A;  4L5R C;  2A1A A;  5D65 A;  4R4Q A;  5JVG 3;  4OO1 G; 
#chains in the Genus database with same CATH homology
 1QUQ A;  3UDX A;  1SE8 A;  4R4I A;  3E0E A;  2CWP A;  1E22 A;  4IPC A;  5M5X H;  3RNU A;  4LF5 L;  5FLM G;  4DV2 L;  1UE6 A;  2PI2 E;  3H3V H;  3A74 A;  2ZJQ A;  2ZM6 Q;  4JI6 Q;  1VQ7 A;  4AYB E;  4LF7 L;  1WCM G;  2NVT H;  4JI4 Q;  3HOX H;  4GLA C;  2VUM H;  2MO0 A;  4NXN L;  4BBS H;  2YTX A;  4IFD I;  1K83 H;  4IFD G;  2HQL A;  1HZ9 A;  5DLQ E;  5IYB G;  1Q12 A;  1B70 B;  1KRT A;  1HR0 W;  3KF8 B;  4A3L G;  4A3C H;  2PMZ E;  2UUC Q;  1QVC A;  4P73 A;  2VQE Q;  1YJ9 A;  3CCQ A;  1R9T H;  3M9B A;  1SMX A;  3ER0 A;  1NY4 A;  2DUD A;  2K5V A;  1W2B A;  1TWF H;  1VQ8 A;  2JEA I;  4JI3 Q;  5C44 G;  1VQK A;  2CQO A;  1KAW A;  2VL6 A;  4KHZ A;  1QZG A;  4X66 Q;  1PH2 A;  1J5E Q;  1IBM Q;  3HKZ E;  4JI5 Q;  3S16 H;  1SLJ A;  4X64 Q;  1B8A A;  4A3E H;  2AHO B;  2PQA A;  3SGI A;  4C3J H;  2JA8 H;  5C4X G;  1PH7 A;  1EOV A;  1XJV A;  3K80 C;  2AWO A;  2JEB I;  1VQD A;  4DR6 Q;  2JA5 G;  1Q8K A;  1BVS A;  1A0I A;  1I94 L;  2E2J H;  5C4J H;  4DR5 Q;  1WJJ A;  1YHB A;  1NE3 A;  1MKH A;  3BJU A;  1H95 A;  2ZM6 L;  4JI6 L;  1VQL A;  1VQG A;  1IBK Q;  1N32 L;  2IY5 B;  1D7Q A;  3KJO A;  4GNX B;  2JA6 G;  3PUW A;  4JC0 A;  1CSQ A;  5M3M H;  5M3F G;  1AE2 A;  2F4V Q;  4HIO A;  1Q82 C;  3JAM c;  4GKK Q;  2N49 A;  3S15 H;  1UWV A;  2UUC L;  1IZ6 A;  4DR4 Q;  3PO2 G;  1YIT A;  3HOY H;  4R4C A;  4B3M Q;  4EQ5 A;  5GAD C;  4YY3 L;  2N3S A;  3RN5 A;  4HJA A;  3F8T A;  4BY7 H;  1T9H A;  3PIO A;  4LUO A;  2OCE A;  4X66 L;  1YI2 A;  3CAM A;  1IBM L;  4JI5 L;  2CWA A;  1C9O A;  3K7U C;  1I3Q H;  3GTG H;  2AWN A;  3ZJY C;  2QA4 A;  4BXX G;  1Q86 C;  4GNX A;  1YNX A;  3J81 c;  2VS1 A;  2R7Z H;  3RZO H;  4DR6 L;  1XTD A;  2MQH A;  4KI0 A;  3GTL H;  3A5U A;  3U4V A;  1PVO A;  3FHW A;  4GN3 B;  3T1H Q;  1VQ9 A;  4JG2 A;  1A63 A;  3TS2 A;  3S17 H;  1IBK L;  1X56 A;  5E7N A;  2CKZ B;  5IP7 H;  3OW2 A;  4KLK A;  1TWA H;  1KC8 C;  4A93 H;  4IOA A;  1G6P A;  4PG3 A;  3U4Z A;  1IBL Q;  2UUB Q;  3PUZ A;  4JYA Q;  1A8V A;  1XNR Q;  4MZ9 A;  1E3P A;  1K73 C;  2B63 G;  2AMC B;  4LW1 A;  2MNA A;  3FKI G;  3K0X A;  1E24 A;  2B3G A;  3PCO B;  3PV0 A;  3RLN A;  1HJP A;  3F2C A;  3CCR A;  3I2Z A;  5HGQ A;  2ZJR A;  2HIX A;  2UUA Q;  1PH3 A;  1XNQ L;  3HOZ G;  3CCL A;  4YCV A;  1I6H H;  1E1T A;  1FL0 A;  1FGU A;  1KL9 A;  2WAQ E;  4QJF A;  3TRE A;  1BBU A;  4B3T L;  2RHS B;  3CCU A;  3KLW A;  5IT9 c;  4WJ4 A;  5K36 G;  1Z47 A;  2I5H A;  4QQB X;  2D62 A;  1TXY A;  4P71 A;  4HIM A;  3HOV H;  1OXT A;  4BY1 H;  3M3Y H;  3MXN B;  3CC7 A;  1K3R A;  1K8A C;  5LMU Q;  4RMF A;  3CCV A;  2JA7 H;  2ATW A;  1L2F A;  1L0W A;  3IRB A;  2QEX A;  4QL5 A;  1XMO Q;  1VCI A;  3M4Q A;  2EIF A;  4DAY B;  1VQC A;  2ZTD A;  3PUV A;  2K52 A;  3KJP A;  2RF4 A;  1IBL L;  1Y1W H;  2BA0 A;  3PF5 A;  1GKH A;  2ZTC A;  4LUZ A;  1NTG A;  1EYG A;  1VQ6 A;  3AEV A;  4BA2 I;  3HOU H;  2UUA L;  3BU2 A;  1HH2 P;  2K50 A;  4IO9 A;  4GN4 B;  2MO1 A;  1SRU A;  4B3S Q;  2HHH Q;  2CFM A;  2HIV A;  4QIW E;  5BR8 Q;  1I94 Q;  1WFQ A;  2OTJ A;  2WAQ G;  4DUY Q;  5IYC G;  2XGT A;  4HID A;  1X55 A;  4BBR H;  1NBW A;  4DV0 L;  2Q2T A;  1N32 Q;  2RCN A;  4QY7 A;  3M7N A;  3ICE A;  1OXV A;  1TWC H;  3PUY A;  5C3E H;  1SRO A;  2JK8 A;  1X3E A;  3EIV A;  4IFD J;  5GAH C;  2K14 A;  5C0X J;  2I0Q A;  5LMU L;  4KHP Q;  3D31 A;  4AH6 A;  3S1Q H;  3H15 A;  3W5O A;  1I50 H;  5FLX c;  3HOW G;  2I5L X;  4GNX C;  4YHH Q;  4AQY Q;  3DLL A;  4A3B H;  1PH1 A;  3BZC A;  2UU9 L;  2Q2H A;  5FJ8 G;  1XMO L;  2VW9 A;  1L1O B;  1HNZ L;  1UE5 A;  1C7Y A;  4YY3 Q;  4BA1 I;  1O7I A;  3GTP H;  4K0K Q;  2R92 G;  1W3S A;  4PZ8 A;  5JEA J;  1EFW A;  1HNX L;  1AH9 A;  3PUX A;  4A3I G;  1NMF A;  5AJ3 Q;  3I55 A;  2ZJP A;  4Y7N H;  3CME A;  3J7A 5;  3GD7 A;  4FDB A;  3PO3 H;  1WI5 A;  4IPG A;  2KEN A;  4OWW B;  1PYB A;  1K9M C;  2L15 A;  2VNU D;  4OWT B;  2Y0S E;  4A3K G;  4B3S L;  1VQE A;  4GOP B;  1S72 A;  2HHH L;  1CKN B;  2N8N A;  3KDF B;  5BR8 L;  3H0G H;  1QZH A;  4JBK A;  1VQM A;  3ULJ A;  1X3F A;  1EIY B;  1U0L A;  2NN6 G;  2OTL A;  4O0A A;  2NN6 I;  4DUY L;  2K5N A;  2UXC Q;  1NJI C;  3I4M G;  3CP0 A;  2K75 A;  3U50 C;  3RR5 A;  5IYD H;  4A3J H;  2UXD L;  1L1O A;  4APV A;  4DUZ Q;  5GAG C;  1YIJ A;  1PV4 A;  3ERS X;  4IPH A;  1JMC A;  4KHP L;  3B6Y A;  4X6A H;  2ES2 A;  3CXC A;  1OXS C;  1VQO A;  5GAE C;  4DK6 C;  4YHH L;  4AQY L;  3KFU A;  3GDE A;  4YWM A;  3S1M H;  3F2D A;  4A3F G;  3CCJ A;  3CD6 A;  3S1R H;  2E5L Q;  1Z9F A;  2WP8 J;  5IWA L;  1VQN A;  1XNQ Q;  4K0K L;  3CW2 C;  4OXP A;  3WWV A;  1IYJ B;  2JJQ A;  1N33 L;  3G48 A;  1WOC A;  5AJ3 L;  2NVY H;  4B3T Q;  3OYY A;  3PSI A;  4DAM A;  5IP9 H;  2E2H H;  2F52 A;  1M1K C;  4EX5 A;  2GN5 A;  2QGQ A;  4A4I A;  3F1Z A;  3VDY A;  1OXU A;  5LMN Q;  4OWX B;  4A3M G;  2NZH A;  1VQ4 A;  3I4N H;  1S3O A;  3GTQ H;  3RZD H;  2BH8 A;  4PZ7 A;  1PA6 A;  2VZA A;  3NEM A;  2RHQ B;  4A3G G;  3KF6 B;  2E8G A;  4JV5 Q;  1P8L A;  2KHJ A;  3L0O A;  4UP8 A;  1VQI A;  3PIP A;  5FLM H;  2KCT A;  1VQ5 A;  4UY8 C;  2XTI A;  3GTJ H;  3CQZ H;  2Y0S G;  2UXC L;  2EXD A;  2R7F A;  4DV5 Q;  4ALP A;  5HY6 A;  2HT1 A;  1WCM H;  1N8R C;  4MTN A;  2R7D A;  1CSP A;  4GS3 A;  4DUZ L;  1IXR A;  3UDG A;  4LFB L;  5IYB H;  2F3I A;  4LFC Q;  2JA9 A;  3STB C;  3AFP A;  1RIP A;  4HIK A;  1EQR A;  3OTO Q;  3S24 A;  4B3R L;  4A3L H;  3S1N H;  3H3V I;  1KXL A;  1Q46 A;  4LF4 Q;  4YCU A;  1VQB A;  2V1C C;  3HFZ B;  3MEF A;  3HOX G;  2VUM G;  4BBS G;  4DV3 Q;  3S14 H;  2E5L L;  3AYH B;  5C44 H;  3CCS A;  4DV6 L;  3BZK A;  1N36 L;  3KF6 A;  2JE6 I;  4DR1 Q;  1PH9 A;  4LUV A;  2OQ0 A;  4A3C G;  3RLF A;  3CC4 A;  5GQO A;  3UE0 A;  4LF9 Q;  3PF4 A;  1LYL A;  5LMN L;  3KOJ A;  5C4X H;  1CUK A;  1UEB A;  4DV0 Q;  4LF8 L;  3J7Z C;  3W1G A;  1BBW A;  1I5F A;  1SFO H;  5JJK A;  2JA5 H;  2ZTE A;  4JV5 L;  1VQH A;  2FXQ A;  1GD7 A;  2LSS A;  2IHE A;  3HKS A;  4JBM A;  1JT8 A;  2Q2U A;  1KRS A;  4X65 L;  4LWC A;  5H1S E;  4DV5 L;  3ULP A;  4A3E G;  1KHI A;  1N34 Q;  2JA8 G;  3NBH B;  3PO3 G;  2D0O A;  2IT1 A;  4P72 A;  2UU9 Q;  1MIU A;  1G29 1;  2JA6 H;  1HNZ Q;  1TWH H;  2OWO A;  3NEN A;  5M3F H;  3L7Z C;  1KD1 C;  1RL2 A;  2KCM A;  4NXM L;  2BH2 A;  4LFC L;  3CF5 A;  1Y1V H;  4LNQ A;  1HNX Q;  3OTO L;  1VQF A;  1V1Q A;  5ELO A;  3TQY A;  1L1O C;  4LF4 L;  4JI1 L;  3PO2 H;  5EAY A;  1CKM A;  3CPF A;  4DV3 L;  1QUQ B;  4O2D A;  2UXB L;  4DV1 Q;  5M3M G;  4Y52 H;  1JJC B;  3K8A A;  4JBW A;  5J3B A;  4PMW A;  3STB D;  4DR3 L;  2VQF Q;  3G4S A;  4DR2 L;  3CMA A;  4C3H H;  2ALY B;  5JJI A;  4DR1 L;  1XMQ Q;  3TS0 A;  5JJL A;  2BA1 A;  5IE8 A;  4JI8 Q;  4YWL A;  4LF9 L;  3A0J A;  3NEL A;  5LMN W;  3HOY G;  1C0A A;  4BXX H;  4GOP C;  2ID0 A;  1FJG L;  4JBJ A;  4DPG A;  2UXD Q;  3CCM A;  1YHQ A;  1IL2 A;  4BY7 G;  3G6E A;  4GKJ Q;  4J15 A;  5M5W H;  1VQP A;  1HZC A;  1PH5 A;  1SN8 A;  3F2B A;  3JC6 6;  1PHJ A;  1N34 L;  1A62 A;  4JI0 Q;  4R4T A;  4DNI A;  1GM5 A;  4MNO A;  3UDI A;  3M85 A;  2R7Z G;  3W1B A;  5IWA Q;  3CCE A;  1U5K A;  1XPR A;  4DKA C;  1N33 Q;  2B63 H;  3CC2 A;  2PQA B;  4P74 A;  3FKI H;  3S2D H;  1TWG H;  1UE1 A;  4UPA A;  5IP7 G;  1UE7 A;  2NZO A;  4DV1 L;  4A93 G;  4TQU S;  1YBY A;  1OXX K;  5C0X G;  5C0X I;  3HOZ H;  2K4K A;  4AIM A;  4A76 A;  2VQF L;  2A19 A;  1BKB A;  3J80 i;  4HJ7 A;  3PGZ A;  2R6G A;  4OX9 L;  4XIG S;  1XMQ L;  1PFS A;  4YWK A;  4OON A;  1E1O A;  4JI8 L;  2VY3 A;  2E2I H;  4POG A;  5M5Y H;  2YTV A;  4DV7 Q;  3TRZ A;  1MJC A;  2WB1 G;  1HZA A;  1YZ6 A;  3RLO A;  4LF6 Q;  2KHI A;  2Z0S A;  2PI2 A;  2YTY A;  3DM3 A;  2KBN A;  5JEA G;  3T1Y Q;  2R93 H;  2B29 A;  3RN2 A;  1EQQ A;  4GKJ L;  2AKW B;  4JOI A;  4LFB Q;  4UP9 A;  4JI2 Q;  4ME3 A;  3J81 j;  4L5Q A;  4JI7 Q;  4A3D H;  3GTO H;  4B3R Q;  3A5Z B;  4JI0 L;  3M4O H;  2LXK A;  3HOV G;  2Z6K C;  1FVI A;  3E9H A;  1OTC A;  2DGY A;  4BY1 G;  1XPO A;  3D0F A;  5ELN A;  2YU9 H;  4DV6 Q;  2JA7 G;  1G51 A;  4GOP A;  3AQQ A;  1N36 Q;  1V43 A;  1CKN A;  3KDF A;  4C2M H;  1K0R A;  1HNW Q;  3K7A H;  1X6O A;  4L5T A;  4H02 A;  3GO5 A;  4IPD A;  4JI4 L;  1K8G A;  3EN2 A;  1YJW A;  1KIX A;  1M90 C;  4R4O A;  4POF A;  4LF8 Q;  3M4P A;  4UP7 A;  3I7F A;  1D8L A;  3U58 A;  4DR7 Q;  4AYB G;  1NMG A;  3UE1 A;  4IOC A;  1Y1W G;  3AFQ A;  4DK3 C;  1Y1V G;  3GTK H;  1P16 A;  2GVA A;  2VQE L;  4GLX A;  1CKO A;  4X65 Q;  4DV7 L;  2N78 A;  2MFI A;  5IYC H;  2ASB A;  3HOU G;  4LF6 L;  2YYZ A;  1J6Q A;  4LFA Q;  4JI3 L;  1KQS A;  2I5M X;  3T1Y L;  1JJ2 A;  1VQJ A;  1PYS B;  4IJL A;  4XTC S;  1J5E L;  4NXM Q;  3G71 A;  4JI2 L;  4JCV E;  1X9N A;  4JI7 L;  4X64 L;  3HOW H;  4A75 A;  2D0P A;  4BBR G;  1E7Z A;  2NVX H;  2C35 B;  3HKZ G;  4JI1 Q;  1QVG A;  1AE3 A;  5FJ8 H;  1LTL A;  5C3E G;  3GTM H;  2UXB Q;  1Q7Y C;  2H5X A;  2YV5 A;  2R92 H;  4DR3 Q;  1V9P A;  4X62 Q;  4DR5 L;  4DR2 Q;  4A3I H;  1HNW L;  1HR0 Q;  2PNH A;  4A3B G;  3E9I A;  3KYH C;  1Q1E A;  1HZB A;  1YJN A;  4DR7 L;  1GO3 E;  4DV4 Q;  1S40 A;  1FJG Q;  2F4V L;  1SR3 A;  4A3K H;  1PH8 A;  3FP9 A;  4P75 A;  4GKK L;  2Z6K A;  2IX1 A;  3Q8D A;  1X54 A;  2OQK A;  3TEH B;  1VS0 A;  4DR4 L;  5GRO A;  4C3I H;  3CPW A;  4B3M L;  3JAM i;  1YEZ A;  2GVB A;  4IJH A;  4TVA B;  3I4M H;  4HJ5 A;  4LFA L;  3L2P A;  4HJ8 A;  1XPU A;  4WJ3 M;  2EQS A;  1YHA A;  1ASY A;  1JE5 A;  4LF5 Q;  3H0G G;  4DV2 Q;  2NVQ H;  4RG1 A;  1WYD A;  4QGU A;  5IY0 A;  1PH6 A;  4LF7 Q;  4R1J A;  3J80 c;  4A3F H;  1N9W A;  4NB3 A;  4JOI C;  3I4O A;  5IYD G;  4A3J G;  3LGJ A;  1JB7 A;  4NXN Q;  2R93 G;  2K5H A;  2JQO A;  1LUZ A;  2IHF A;  3I56 A;  1MJE A;  1JJG A;  1GVP A;  1Q1B A;  1EUJ A;  4PZ6 A;  4X62 L;  3T1H L;  4L5S A;  1X65 A;  4GLV B;  4A3D G;  4OX9 Q;  4NPS A;  3J81 i;  2WB1 E;  1HR0 L;  1LM0 A;  4YCW A;  2CCZ A;  2A8V A;  1Y14 B;  1DGS A;  4A3M H;  1ASZ A;  1EWI A;  1B7Y B;  4GN5 A;  4DV4 L;  3S2H H;  1VQA A;  2UUB L;  1QVF A;  1Q81 C;  3ULL A;  4HJ9 A;  1PH4 A;  4L5R C;  1XNR L;  3UDF A;  4A3G H;  3EBE A;  4JYA L;  2A1A A;  5IP9 G;  4R4Q A;  2WFW A;  3K81 C;  1EIF A;  1YVC A;  3I4N G;  2Q2I A;  2LXJ A;  1X3G A;  4OO1 G;  4OO1 I;  2IX0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...