4DUZQ

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u13c, bound with streptomycin
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
99
structure length
99
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 18
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4duzQ00
1VQ8A 1GKHA 5IWAL 2VZAA 1M90C 2R92G 3BU2A 1Q81C 1TWAH 1PH8A 1MJEA 1IBKL 4LNQA 3J81j 1W2BA 3CD6A 3SGIA 5IP9H 1N32L 4NXML 2MFIA 4X64L 3PUYA 3F2BA 5LMNW 4JOIA 4JI5Q 3J81c 2PNHA 3JC66 1VQ5A 4HJ9A 1PH7A 1B7YB 1A62A 5EAYA 3T1YL 1YHBA 4HJ8A 1O7IA 2UU9L 2JEBI 4A3MH 2RF4A 2ZTEA 3HOZG 4LFBL 1A0IA 4B3TL 2R7ZH 3PUVA 5C44G 4IJLA 4J15A 1JMCA 1TWHH 4HJAA 5GQOA 1N34Q 1L2FA 4O2DA 1PH3A 1KRTA 1CKMA 1Y1VG 3TREA 3I56A 3K81C 4DR6Q 4DR1Q 3F2DA 2E5LQ 4A3JH 3KFUA 5M3MH 4TQUS 4NPSA 2V1CC 4P73A 1NTGA 4BY7H 4DUZQ 3VDYA 4IFDJ 1WOCA 3DLLA 1IL2A 3TRZA 3CCUA 3HOVH 2Y0SG 1VQBA 3S1RH 1K3RA 1PH5A 1C7YA 3KJPA 2HIXA 4YCUA 1EQRA 2VQEL 1J5EL 3K8AA 4POGA 1UWVA 4JI4L 3HOYG 2VUMG 3JAMi 3PO2H 2K50A 1GD7A 4DR3L 5JJKA 4PMWA 4LFAQ 1VQEA 3CF5A 4GOPA 3S1QH 4KHPQ 5BR8Q 3S17H 4A3DG 2UXDQ 4YY3L 5IYDH 2XTIA 4MNOA 1XPUA 2YTXA 1CSQA 2E2JH 4QJFA 2UUBQ 3GTGH 3EIVA 4X66L 4KHZA 3RR5A 2JA5G 1XMOL 1XMOQ 2WB1E 4BY1G 2VQFQ 4BA2I 4X66Q 2PQAA 3EN2A 1RIPA 2JA5H 3HOXG 1Q1EA 3CCJA 1QVFA 2VQFL 1SROA 4APVA 2JA8H 1EFWA 2NVTH 5IE8A 3PIOA 1AE3A 2R7FA 3CCLA 2UUBL 1I6HH 1E1OA 4QY7A 2NN6I 2QEXA 1K83H 5GROA 4IO9A 3M4QA 1HZAA 1G291 1NMGA 2OQKA 2UXDL 5GAEC 3KF6B 1KD1C 1QVGA 4JI3Q 4A76A 1XNRQ 2HHHQ 2C35B 4X62L 3S15H 1JJGA 5GAHC 4JV5L 4GNXA 5ELNA 3CMAA 2IHFA 1VQAA 4A3GG 4LW1A 5HGQA 4L5TA 4DR2Q 4IOAA 1Q82C 3JAMc 1SRUA 5IYBG 5C4JH 1KXLA 1N8RC 4A75A 1B70B 3U58A 3J7ZC 2KBNA 3HOWH 1HZBA 2VY3A 1C0AA 2F52A 4GN4B 4LWCA 4UY8C 1EOVA 1KRSA 2NN6G 5M3FH 3EBEA 1H95A 1A63A 4GOPB 4DR1L 1GVPA 3CCMA 4JBWA 4AYBE 3HKZG 4OONA 2D62A 3OTOQ 4QGUA 4A3FG 4BBSG 3S2DH 4DK6C 5JEAJ 4LFCL 3RNUA 2HT1A 2VUMH 1FJGQ 3PF5A 1VQ9A 3CC7A 1HNWL 2OTJA 2PQAB 4A3GH 4Y7NH 2UU9Q 4YCVA 3H3VH 4K0KL 2IY5B 2AWNA 1E22A 5IP9G 3T1YQ 4OO1I 2N8NA 2WAQG 4NXNL 2BA0A 1VQOA 1Q1BA 4X65L 1K8GA 4JI7Q 4JI5L 3E0EA 3J7A5 4B3RL 1L1OA 4DV2Q 3M9BA 1YNXA 3CPFA 4A3IG 4PZ8A 1PV4A 4BXXH 1LM0A 4AIMA 2A1AA 4A3EH 2LXJA 1XMQL 3FKIH 4FDBA 4NXMQ 5IWAQ 1PH2A 4DV6L 2PI2E 1VQCA 2MO1A 2OCEA 4DV4Q 4B3ML 4MTNA 1XTDA 3RLOA 3S24A 2RCNA 4YY3Q 1IBMQ 1WCMG 3CC2A 3T1HL 3J80c 1YHQA 1KHIA 1E7ZA 1TWCH 4C2MH 1K0RA 2NZOA 1Q86C 3UDGA 4GNXC 1P16A 2ZTCA 1VQPA 4JI2Q 4LF7L 1VQIA 1N33Q 1PYBA 1SLJA 2VQEQ 2K5VA 1EQQA 4A3BH 2K75A 2UUCQ 1HR0L 3I4MH 4A3BG 3AEVA 3HKSA 3G71A 1PVOA 3D31A 1YITA 5FLXc 3M7NA 2QGQA 5DLQE 3I4OA 1G6PA 1J6QA 3FP9A 2LXKA 3PGZA 4IPGA 1Z47A 1NMFA 3I55A 4DAYB 3ICEA 2Z0SA 5IYDG 4DR4L 4DV4L 2A19A 1B8AA 2CWPA 2UXCL 2VNUD 2B63H 4YHHQ 1T9HA 2AWOA 1UE1A 2MQHA 3U50C 4GN5A 3UDIA 1EIYB 1IBML 2F4VQ 3GTMH 4LFBQ 4WJ3M 1Y1VH 4P71A 4DKAC 4QIWE 5GAGC 1P8LA 2ZM6L 3D0FA 4L5RC 1G51A 2GVBA 1Q12A 4O0AA 2CCZA 4B3SL 2ZTDA 1I5FA 2N3SA 4ME3A 4L5QA 1PYSB 4LUZA 3LGJA 1I50H 4DV1Q 4A3IH 4JI7L 4GLAC 3G4SA 1KQSA 2AKWB 2UUAL 4ALPA 3I4MG 2NVQH 2JK8A 4DV0L 2K4KA 3NBHB 4LF6L 4NXNQ 5E7NA 1VCIA 1VQ6A 1FJGL 4K0KQ 5C0XG 1HNZQ 4AQYL 1VQFA 1HNWQ 2HQLA 4DR5Q 3M85A 3NENA 4HIOA 3GD7A 1MIUA 4BBRH 4NB3A 4A93G 3MEFA 1IXRA 4P75A 4C3HH 3J81i 3KJOA 3OYYA 1YBYA 1JE5A 3ERSX 5LMUL 4LFCQ 1S40A 3S16H 3S1MH 2GVAA 4JBJA 1AH9A 4A3DH 3B6YA 1W3SA 3GDEA 5M5WH 2JJQA 2ZJQA 5M3FG 3M4OH 3KYHC 3UE1A 1GO3E 3CC4A 1Y1WG 4DNIA 2JE6I 4P72A 2CQOA 2H5XA 1E3PA 3CQZH 5M5YH 4A3EG 1K8AC 4IPDA 4BY1H 4JYAL 1HH2P 1VQGA 1EYGA 1ASYA 3L2PA 4A3LG 5LMUQ 2Q2UA 3GTKH 1L0WA 3M3YH 3HOZH 4R1JA 2MNAA 3ULLA 3GTPH 1ASZA 1VQDA 1OXSC 2DUDA 1JJCB 2YTVA 2YYZA 1VQHA 2F3IA 1N36Q 4LF5L 2E2IH 2BH8A 1XNRL 2ASBA 4IFDG 4OWXB 5AJ3Q 3CCSA 2RHQB 4OWTB 1L1OC 5FJ8H 2L15A 3TS0A 1XJVA 1E24A 3S2HH 1UEBA 3U4ZA 4DR7L 4PG3A 3CP0A 3HOUH 2UXBL 2CFMA 4JCVE 3KF6A 4GKKL 2EQSA 3W1BA 1NBWA 4XTCS 4QQBX 4UP9A 3PUWA 4UPAA 2DGYA 3GTJH 3RZOH 5LMNQ 4DK3C 3BZCA 1LUZA 2Y0SE 3H15A 3I4NH 2CWAA 2OTLA 3TS2A 1NY4A 2EIFA 1IBLQ 1FVIA 2D0OA 4QL5A 3KDFB 4BBRG 4C3JH 4A3KG 2OWOA 2WAQE 4KI0A 4IOCA 4HIDA 1X65A 2AMCB 4LF5Q 1OXVA 1YEZA 2A8VA 2R92H 2KHJA 1V9PA 1XPOA 1YJNA 3J80i 3S14H 2VL6A 3DM3A 4AH6A 3BJUA 3KF8B 4MZ9A 4EQ5A 4DUZL 3HOVG 2K52A 2AHOB 3UDFA 2K14A 4IPHA 4JYAQ 4X6AH 3K80C 4OWWB 2Z6KC 4BY7G 3FHWA 2NVXH 2E5LL 2ATWA 1AE2A 2FXQA 3ULJA 1I94L 4DV7L 3G48A 4DV5L 4POFA 1OXXK 1SMXA 2ZJPA 3RZDH 2JA7G 2ES2A 3T1HQ 3PUZA 1Y14B 1HR0W 4A93H 3CAMA 3MXNB 2B63G 4EX5A 1X56A 3CW2C 4HIKA 3HOYH 2KENA 4DR5L 4DUYQ 5IYBH 3M4PA 4AQYQ 1UE6A 5C3EG 4B3TQ 4OX9L 2N49A 5C0XI 2E2HH 1PH1A 1XMQQ 3CPWA 1OXTA 2WFWA 3KLWA 2D0PA 4DV1L 4LF9L 3A5UA 5K36G 3STBD 4HJ5A 1WYDA 2UUAQ 3RN5A 4DV2L 4GOPC 1I3QH 1QUQB 1N32Q 1JT8A 4DPGA 1VQ7A 2XGTA 4X64Q 4B3SQ 3H0GH 4A3CH 1HZCA 4GNXB 3PO3H 1S3OA 4YHHL 1YJWA 4A3FH 1CKOA 4JC0A 5HY6A 1R9TH 3U4VA 2IX1A 3I4NG 5J3BA 4JI8Q 2BA1A 1SN8A 3K7AH 3CCRA 4AYBG 5C44H 2YTYA 1X6OA 4DR4Q 2MO0A 2WP8J 1A8VA 4A4IA 1YI2A 1VQKA 3CMEA 4LF4L 2K5NA 2ALYB 2JA6G 1I94Q 1PH4A 4YWLA 3F8TA 3IRBA 4IPCA 1KAWA 2WB1G 3I2ZA 3KOJA 5M3MG 1U5KA 4C3IH 1WI5A 2UUCL 3GTQH 1MKHA 3CCEA 1X3GA 4LUOA 4YCWA 1LYLA 2NVYH 3FKIG 2QA4A 4JI1L 4YWKA 4JI1Q 4HIMA 1KC8C 4DV3L 4BA1I 1HR0Q 4JBMA 3UE0A 2N78A 4LF8L 1X55A 4GKJQ 2R93G 3RN2A 5FLMG 4GS3A 3K0XA 4DAMA 5C4XH 2R93H 1YVCA 2KHIA 4JV5Q 4JI2L 1C9OA 3K7UC 4LF7Q 2I5HA 3E9HA 2JA7H 4A3KH 1GM5A 1PFSA 4JOIC 4JI3L 4JI6Q 3GTOH 2PI2A 5H1SE 4R4QA 1FL0A 4Y52H 2HIVA 1BBUA 3PCOB 4DV6Q 1QUQA 2LSSA 2JA9A 4H02A 3L0OA 1PHJA 3NEMA 2K5HA 1E1TA 2ZJRA 4B3MQ 1QZHA 2NZHA 2JA6H 1D7QA 2IHEA 2VW9A 3A74A 4JI0L 5LMNL 3HOWG 1WFQA 5IYCH 1QZGA 1SR3A 2KCTA 4B3RQ 3HKZE 1CSPA 4X65Q 1IZ6A 4GLVB 3W5OA 1BVSA 3E9IA 3PO3G 3H0GG 2Q2TA 1EWIA 2Q2HA 1U0LA 4DV7Q 4LF9Q 4DR7Q 4GKKQ 1UE7A 3STBC 4KHPL 2R6GA 4PZ7A 1FGUA 2BH2A 4OX9Q 1TWFH 2KCMA 4DR3Q 2PMZE 3PUXA 3AFQA 1XNQL 4DUYL 1OXUA 4XIGS 1DGSA 3I7FA 3CXCA 5AJ3L 1LTLA 1SFOH 1YHAA 2RHSB 5C3EH 1K73C 1J5EQ 2CKZB 2VS1A 3TEHB 1Q8KA 4HJ7A 4DV5Q 1OTCA 1Q7YC 3OTOL 1N9WA 5C0XJ 2E8GA 1EIFA 1L1OB 4UP7A 4A3JG 3F1ZA 2I0QA 5JEAG 2I5MX 1VS0A 2ID0A 2JEAI 3Q8DA 3W1GA 3PSIA 1VQNA 2YV5A 3AQQA 3NELA 5IYCG 1VQ4A 4BXXG 4R4CA 3KDFA 4P74A 5JJLA 5C4XG 1NJIC 5FLMH 4A3MG 5IP7H 4X62Q 4DR2L 2HHHL 4WJ4A 1V43A 1KL9A 1TXYA 2GN5A 1HNZL 1VQMA 3GO5A 3CCVA 1BKBA 1VQJA 5FJ8G 2EXDA 1IBLL 1XNQQ 3PO2G 2Z6KA 4DV0Q 1VQLA 2JQOA 1HJPA 1RL2A 5ELOA 1EUJA 2B29A 3ULPA 1PH6A 1JB7A 4LF6Q 1XPRA 1SE8A 3WWVA 4IFDI 4JG2A 4RMFA 1Y1WH 1HZ9A 1NE3A 3OW2A 1S72A 2JA8G 1M1KC 4A3LH 3A0JA 5IT9c 3BZKA 1PA6A 2IT1A 4JI0Q 1IBKQ 1X9NA 1CKNB 2B3GA 3F2CA 1IYJB 4PZ6A 4UP8A 4BBSH 2F4VL 4R4TA 3S1NH 2ZM6Q 2UXCQ 2OQ0A 4RG1A 1YJ9A 1TWGH 3GTLH 1UE5A 4A3CG 2UXBQ 4GN3B 3A5ZB 5BR8L 2R7ZG 3RLFA 4JI6L 4LFAL 4JBKA 4JI4Q 1Z9FA 4LUVA 4OO1G 2IX0A 1MJCA 3HOUG 4R4IA 3CCQA 4R4OA 1N36L 1YZ6A 5IY0A 1HNXL 1X54A 1X3FA 3G6EA 4GKJL 4YWMA 4GLXA 2Q2IA 2YU9H 1D8LA 4DV3Q 4IJHA 1QVCA 1PH9A 5M5XH 4LF8Q 3TQYA 4TVAB 3H3VI 3UDXA 1N33L 4OXPA 2I5LX 3L7ZC 1CUKA 3PV0A 3HOXH 1Q46A 1HNXQ 3AYHB 3ER0A 4DR6L 1BBWA 1WCMH 3ZJYC 4L5SA 5IP7G 3PIPA 1V1QA 1X3EA 1N34L 3PF4A 5JJIA 4KLKA 1KIXA 3HFZB 4LF4Q 2R7DA 4JI8L 1YIJA 1JJ2A 1K9MC 1CKNA 5GADC 1WJJA 3RLNA 3AFPA
chains in the Genus database with same CATH superfamily
4AYBB 3CRKC 3SR1A 5IWAL 1TWCB 3KLSA 1TWAH 1IBKL 1PZJD 5I4DA 5M3MB 2MFIA 2PNHA 1B7YB 1V1OA 1YHBA 2P5ZX 4HJ8A 2JEBI 4ID6A 3H6MA 1TWFB 1T5XD 2I07B 3W3AA 3I3CA 5D3DA 4HJAA 1LTTD 1N34Q 3LWEA 4HMIA 3K5OA 1Y1VG 5IGCA 1XWEA 3K81C 1JC7A 2ICIA 2B2YA 4NPSA 4BY7B 1PTOC 4P73A 1RTOA 5IGBA 2B2TC 4BY7H 5J1ZA 3VDYA 5NUCA 1WOCA 1IL2A 3NUCA 4LJZC 3TRZA 1BCPB 4YCUA 1EQVA 1J5EL 3K8AA 1G91A 4OL7A 1AW7A 1LT4D 4JI4L 5C3EB 2K50A 3RZDB 1VQEA 4A3DG 4XQJA 4X3SA 2B63B 1XPUA 1CSQA 2UUBQ 3RR5A 1XMOQ 2WB1E 2PO4A 3EN2A 1RIPA 1QVFA 4APVA 1JOOA 3A8KE 4HSPA 3PIOA 1AE3A 1I6HH 2UUBL 1E1OA 2QEXA 2O5JC 1K83H 4IO9A 4RHRA 1HZAA 2AUJD 3P20A 4A3FB 4XXEA 1IW7D 3SK5A 5GAEC 1QVGA 2C35B 4X62L 1JJGA 3PIO3 2A73B 4ILWA 1VQAA 2B2YC 5HGQA 1GOZA 1BR9A 2VB2X 1E2WA 1KXLA 1DYQA 2G9HD 4ZCKA 5C4JH 4L63B 2NYZD 2VY3A 2F52A 1GXDC 2NN6G 5M3FH 1STNA 3EBEA 1D6EC 1G6ZA 4FNFA 1HRJA 1GVPA 3CCMA 1PRTC 3GTPB 4QGUA 4A3FG 1RF2D 1CI3M 3H09A 3RNUA 3H91A 2K03A 2RDGA 1VQ9A 3DUZA 3D8GA 5BN3A 2KQ3A 2PQAB 2FMCA 4Y7NH 3H3VH 3H94A 3R8BA 1PYWD 3URYA 4DV2Q 3CPFA 1ZYRD 1DD2A 4FDBA 5IWAQ 4KMUC 4QF4A 2QKIC 1VQCA 1J8IA 4DV4Q 3MAQA 4MTNA 1XTDA 2MGSA 5ISRA 1IBMQ 1ZYRC 4ZUJA 1TWHB 1UNSA 3CC2A 1O78A 3MFGA 2HCCA 1EIGA 2K04A 3MA2B 2RCFA 1KAAA 4PQXA 2K75A 2E2JB 2TSSA 1HR0L 1FD7D 4A3BG 4HCSA 3D31A 2XWJB 5FLXc 4KKSA 5FLXL 3I4OA 1G6PA 1RD9D 3FP9A 3MEHA 2LXKA 1SYCA 2CH4A 2WB1B 4DAYB 4K8IA 1FYCA 4DNTB 4DV4L 1EFID 4YHHQ 3K5MA 2AWOA 3UDIA 1UE1A 2F4VQ 1SSOA 4LFBQ 3GTMH 4EQNA 1TY2A 4P71A 1Q12A 3A8JE 2ZTDA 1I5FA 2N3SA 1TS5A 3A54A 1LTGD 1KQSA 2UUAL 2NVQH 1NCVA 4DV0L 5KIXA 1V8QA 1VQ6A 2OF1A 5CBEE 2OT2A 5EKIA 1YNNC 4BBRH 2SEBD 3IFDA 3MEFA 2G5DA 2GVAA 4JBJA 1BNZA 1W3SA 3GDEA 1O7ZA 3WDNA 3MWYW 3M4OH 3UE1A 3H0GB 2SDFA 3CC4A 2EYLA 2JE6I 2EYHA 4FXKC 2F0FA 1HH2P 1VQGA 4PMBA 1EYGA 2C9OA 5DM73 3L2PA 1ASYA 4A3LG 3HOZH 3PMFA 4R1JA 2MNAA 1OXSC 1JJCB 4LF5L 1VQHA 4IFDG 2E2IH 4OWXB 5AJ3Q 3CCSA 4OWTB 1L1OC 3TS0A 4IUNA 1A3VA 3Q6SA 4RGNA 3U4ZA 2UXBL 4JCVE 5KGUA 2NUCA 4CDFC 3W1BA 4J1MA 4NW2A 3GTJB 3RZOB 4BS9A 4UP9A 3GTJH 3RZOH 1CQVA 4DK3C 4KY7A 1SNDA 4KY6A 3I4MB 4F7XA 3EROA 1EZ8A 2CWAA 1FVIA 2D0OA 4QL5A 4C3JH 2A6HC 1AEXA 3GV3A 1X65A 4LF5Q 1OXVA 1YEZA 2R92H 2DNCA 3S1QB 4LMQD 3R2TA 3S14H 3ZYYX 2VL6A 4AH6A 4RHSA 3KF8B 5A2QE 2AHOB 3CHBD 3K80C 4OWWB 3M7GA 3FHWA 1LO5D 2QDLA 2E5LL 1LTAD 1QNUA 3G48A 1BCPD 5IT9E 1SMXA 1PZKD 2B63G 1X56A 3HOYH 2KENA 5CBAE 4DUYQ 1STBA 2KUMA 3M4PA 4AQYQ 1F9PA 4OX9L 3TDQA 1S4ZA 4C3HB 1C4QA 1OXTA 1SJHD 5JPMC 1MHWC 4HJ5A 2UUAQ 3VR2A 3A8IE 1QJOA 4K14A 1PRTD 4DPGA 2XIWA 2RSOA 3BVGA 1S3OA 4YHHL 4JC0A 1R9TH 2IX1A 1HHVA 4CKEA 2EYJA 5C44H 1DXMA 1A8VA 3GP7A 3OWFA 2ALYB 2WV6D 3AMUA 4ZAIA 4IPCA 1HCZA 5FO9B 1U5KA 1LTBD 1LT3D 5HGTA 4X3KA 5HURA 4KKUA 3CQZB 1KNEA 2NVYH 3NXWA 4JI1Q 1KC8C 1S5BD 2R93G 3RN2A 4DAMA 2ZXRA 1KLUD 2AQ1B 3C46A 5EKLA 1GM5A 2Z9HA 4R4QA 4Y52H 2HIVA 4JPBW 2JP1A 2V4DA 1TKWB 2JA9A 4H02A 1SMYC 4ZKBB 1E1TA 2ZJRA 4B3MQ 4JI0L 3I4LA 3A7AB 1QE6A 1Z6HA 5FKAC 5LMNL 1SR3A 5C6AA 1HTLD 1CSPA 2X6LA 2R93B 4IUUA 1ICFB 3H0GG 4WRDA 2Q2HA 2Q2TA 1CK1A 1WTPA 5M9OA 4ME5A 1I4HA 4JVZA 1TWFH 2PNRC 4OX9Q 2Z6BA 3EVQA 3HEJA 3CXCA 1SFOH 3PO2B 1ZEQX 2CKZB 2VS1A 3I8ZA 4I7ZC 1CZWA 1NR2A 5C0XJ 2E8GA 2J7ZA 3BYYB 2RDHA 3QWNA 3PSIA 2YV5A 3KDFA 5C4ZA 4IUQA 5KNBA 3KK7A 4OGQC 4X62Q 3GTLB 1FNWA 4V190 3J81L 3GO5A 1O7LA 3H3VC 1IBLL 1XNQQ 2XRSD 4I7AA 1JWSD 1HJPA 1RL2A 5FK9C 1PH6A 1XPRA 2RDFA 4IFDI 4RMFA 2JA8G 4O42A 5M5WB 4JI0Q 1PFBA 4PZ6A 4BBSH 2F4VL 2OQ0A 4A3CG 2DY8A 1I6HB 4FP5D 2F3WA 2MP1A 4JI4Q 1Z9FA 1ENFA 3OPOA 3ND9A 4LUVA 4GZYC 1H9SB 2IX0A 3HOUG 3RMHA 3CCQA 1N36L 1HNXL 3JAME 1Y1WB 1BBXC 3NPPA 4GLXA 2YU9H 1QVCA 1TWAB 3WOEA 1T5EA 1D5MC 1I4PA 1N33L 3G6JB 2EY1A 3PV0A 2B2VA 4DR6L 3ER0A 2HUGA 5IIFA 1V1QA 1X3EA 1N34L 2Z4HA 3HRZC 4DU9A 4H7BA 4MN3A 4LF4Q 1JJ2A 3NP8A 2H1EA 1WJJA 4DFAA 3RLNA 1KTKA 5CV6A 4Q5VA 2VZAA 5ELDA 3HS0C 3U9SA 3BU2A 4C2MB 1Q81C 2MUYA 3G7LA 1W2BA 1SEBD 3CD6A 3F2BA 1DONA 3E3XA 4N9PA 3I73A 5EAYA 1BCPC 3UI2A 3T1YL 2NTSA 1EU4A 2PZWA 3P7JA 2RF4A 4LFBL 2ZXOA 1A0IA 1MSHA 3PUVA 4EVOA 1ILPA 4IJLA 1JMCA 1TWHH 1EWCA 5GQOA 1L2FA 1PH3A 1SDFA 1CKMA 4DR6Q 2E5LQ 2BCOA 3FDTA 1D2BA 4DUZQ 1Y8PB 4G7ZC 1PZID 4WORA 4H13C 1B9MA 3CCUA 3S1RH 1WD1A 1C7YA 2HIXA 2B2TA 2EJMA 4KD4A 1UWVA 2VUMG 2CW0C 2B8FA 3ERQA 3RUZA 4PMWA 4GOPA 5J22A 2UXDQ 4RWSC 4MNOA 2E2JH 1WTWA 4C3IG 4KHZA 4OHJA 2PW7A 1XMOL 4X66Q 1Q1EA 3CCJA 2VQFL 1SROA 3QOJA 1HQMC 4CGYB 5AFWA 5GROA 2L5TA 2L55A 1NMGA 2OQKA 3M3YB 2KHSA 5EBCA 3KF6B 5GAHC 3DM1A 4JV5L 3FRPB 4A3GG 3QJYA 4DR2Q 1Q82C 3JAMc 1SRUA 5IYBG 2CH4W 1N8RC 4A75A 1B70B 3M4OB 1JORA 1LLRD 3J7ZC 2JA5B 3NQTA 2KBNA 1UUPA 1IYVA 1TU2B 3D6CA 1XXGA 4LWCA 5M5XB 1KRSA 3S1NB 1IKMA 4DR1L 2R3ZA 2XRQD 1AN8A 3J81E 3K58A 2G9DA 1ENAA 4DK6C 2JSOA 3I90A 4CKCA 3PF5A 4TSSA 1YNJC 5DAUA 1K3BC 2A68C 1SE2A 4YCVA 2IY5B 2RA4A 2N8NA 1K8GA 2JXMB 1WTVA 4JI5L 1L1OA 1EQTA 4ZQ3A 1U4RA 2X69A 4RA8A 4A3IG 1IHZA 2PZUA 1LM0A 3OOCA 4AIMA 4A3EH 2LXJA 2PYKA 4NXMQ 1PH2A 2JA7B 5FOBB 2O2LD 2PI2E 2OCEA 3NTHA 3S24A 3RLOA 2C5CA 4YY3Q 1WCMG 1SYDA 1LTSD 1K0RA 1GUGA 3UDGA 1P16A 3SXHA 3KF8A 3V96A 1D1IA 1PYBA 2F0QA 1OO9B 1SLJA 1EQQA 4A3BH 2Q8IB 1X3PA 3T13A 2UUCQ 3I4MH 2ICEC 3HKSA 4ZK9B 3CRLC 3G71A 4IUTA 1IKLA 1E2ZA 3M7NA 5G3LD 4IALA 3BDCA 1SYGA 2F0TA 3CU7A 1EYAA 2Z0SA 3DHQA 2A19A 1B8AA 2CWPA 2UXCL 2VNUD 2MQHA 3U50C 2B2UC 2KEEA 4WJ3M 4DKAC 5GAGC 2ZM6L 1P8LA 3D0FA 2GVBA 3A7LA 4O0AA 3DWAA 2CCZA 4MTKA 1O80A 1SMYD 3X3NA 1PYSB 4HEDA 1I50H 1V1PA 3LGJA 1TY0A 2SNMA 4JK1C 1B3QA 2JK8A 1CM9A 1VCIA 4JW0A 4OO1H 1I6VC 1VQFA 1BQQT 1HNWQ 2HQLA 5C5LA 5I2XA 5EJWA 3GD7A 1MIUA 4RH6A 1STYA 1JCKB 4C3HH 2F0WA 1WTQA 4LFCQ 2M2LA 1YBYA 3OYYA 3S16B 3S1MB 4ZRZA 3S16H 3S1MH 3SDZA 2EYFA 1BOSA 1II3A 1AH9A 1GUWA 1RDPD 1Y8NB 4G7OC 4OIJA 3HZXA 3R2IA 2NN6H 5M3FG 3A55A 1Y1WG 4DNIA 4KD3A 4Z9CB 3CQZH 1K8AC 1E3PA 2CW0D 1D1KA 4IPDA 2Q2UA 3KBXA 3GTKH 1VDZA 4K5VA 4F88A 1SNMA 2YTVA 2BH8A 2RHQB 1KNAA 2B2UA 4DN4M 2N88A 5C4HA 3S2HH 4CDCC 4OELB 4PG3A 3CP0A 3P1HA 3HOUH 1J9OA 3KF6A 1RCVD 4QQBX 2WIIB 5TSSA 1EY4A 5LL6S 2DGYA 4HSVA 3BZCA 1LUZA 4XYQA 2HCIA 1HTPA 2NZ1D 2FFKB 5JOBA 4BBRG 4K6DA 4A3KG 2OWOA 3IFTA 4IOCA 1HUNA 5K5PA 2KHJA 4FF4A 2NBFA 3DM3A 2F0HA 3JAML 4UAIA 3HOVG 4MZ9A 4EQ5A 4X6AH 1G2TA 4JYAQ 4BY7G 4FO2A 3IAYA 3I72A 3J80E 2ATWA 4A3IB 1HA5A 1I94L 4DV7L 4DV5L 3FEWX 1HUMA 4POFA 1OXXK 3ONAB 5IGFA 2ES2A 2JA7G 4A93H 1B4OA 4DR5L 1PLFA 5IYBH 1U4MA 4B3TQ 1S5ED 2N49A 2XN9C 2K01A 1XMQQ 3QIAA 3CPWA 1H9JA 2D0PA 2KEDA 1Q3LA 3A5UA 1ZXTA 4FF2A 1WYDA 3K6OA 4GOPC 1QUQB 1N32Q 2XGTA 4B3SQ 3M4YA 4LK1C 4A3CH 3BZDB 4DAPA 5T1GA 1CKOA 1WTRA 2NB0A 3I4NG 4JI8Q 1SN8A 3V2TA 3CCRA 1ILQA 2YTYA 4DR4Q 2K33A 2PPBC 3CMEA 5D14A 1ET9A 2LY7A 4YWLA 3I2ZA 4L6TB 2NTTA 4C3IH 1WI5A 1WVLA 1EWHA 1CT1D 1MKHA 1X3GA 2F0KA 4LUOA 3FKIG 1F9SA 4YWKA 4BA1I 4JBMA 3T51B 4LF8L 4G57A 4GS3A 3SK8A 3K7AB 2R93H 1YVCA 2KHIA 1CFMA 3ND8A 4JI2L 4LF7Q 3K7UC 3E9HA 4JI6Q 4JI3L 5I2YA 5KRUA 1BBUA 3PCOB 4DV6Q 5JPNC 1QUQA 2LSSA 3SK4A 1QNKA 3SHLA 1QZHA 3A74A 2DN8A 5IOCA 2Z1CA 4KKTA 3HOWG 1QZGA 3HKZE 3VR5A 1L0YB 4GLVB 2ZXPA 2RSNA 4LF9Q 1U0LA 4DR7Q 1Y8OB 4KHPL 2R6GA 4KY5A 4PZ7A 1FGUA 2M9VA 5C0XH 2KCMA 1PRTB 3PUXA 4NMZA 4N9TA 4ABNA 4Y7NB 1DGSA 3I7FA 1YHAA 1A2UA 5C3EH 3K5NA 1Y69U 5EPLA 5DM63 3NBIA 1YNJD 4DF7A 2QCPX 3OTOL 2TMPA 4UP7A 4G4KA 2I0QA 4QUFA 2I5MX 2JEAI 2ID0A 3Q8DA 3F2UA 4HN7A 3AQQA 5IYCG 1VQ4A 1VQNA 4BXXG 1PMRA 2F0VA 1TS4A 4WJ4A 1GUSA 1STEA 1HNZL 1VQMA 5E1FA 2M00A 1CTMA 5FJ8G 1EUJA 3LX0A 3VYTA 1JB7A 1SE8A 2EJFC 4JG2A 1Y1WH 1HZ9A 1NE3A 2FHTA 5C4JB 2XSCA 3OW2A 1EIHA 1M1KC 5IT9c 2B2VC 2XNAC 4ZKCB 1ENCA 1CKNB 1IYJB 2EXZA 1H9SA 4R4TA 1YJ9A 4RG1A 1TWGH 1UE5A 1UAPA 3A5ZB 4LFAL 4JBKA 5CV8A 4OO1G 3Q23A 4B9WA 3N6RA 1MJCA 2PCFB 4KV6A 4R4OA 5KNDA 1YZ6A 1O7YA 4Q0FA 1X54A 3J7AV 1XX8A 1D8LA 4DV3Q 1I3QB 4QCLA 1ML0D 1PH9A 5M5XH 3T16A 4LF8Q 1D5XC 1BO0A 4TVAB 5CYUA 2X6GA 3BDLA 5COYA 3ZJYC 4L5SA 1E0BA 2JN4A 5D3IB 2MPMA 4R9WA 1A3TA 3D4WA 3QOLA 4ODGA 3HFZB 1I4RA 1K9MC 2XVSA 3NENA 2D5DA 1GKHA 4DXGA 2R92G 4RAUC 1EYDA 3E5SA 5I9OA 1PH8A 4OIKA 4LNQA 4DGZA 3SGIA 5IP9H 2L9HA 4NXML 4X64L 3PUYA 2Q8RE 5LMNW 3J81c 3HOXB 2F0MA 2FMMA 1U4PA 2F0UA 2RVLA 1W6KA 1O7IA 2VXWA 4DK0A 4R8NA 2CHBD 3HOZG 2R7ZH 4B3TL 1STHA 4XT1B 1CA6A 3BVZA 3K57A 1KRTA 1LT6D 3F2DA 4A3JH 3KFUA 1SJED 2V1CC 3GTMB 1F77A 4RGTA 3HOVH 2Y0SG 1PH5A 1K3RA 2K5DA 3KJPA 3HOVB 1EQRA 2VQEL 1MSGA 3TMEA 1QOHA 3JAMi 1GD7A 3DWPA 4DR3L 3DEPA 5JJKA 2GA4B 3K0YA 1SYEA 2EY6A 3S1QH 5BR8Q 1TQOA 3NSWA 2EOTA 4M8AA 4XQNA 4BY1G 1F2MA 3MVVA 2JA5H 4KN7C 4UHVA 2E76C 1I50B 1NNXA 4CJ0B 1EL0A 2R7FA 2NN6I 3HOYB 1G291 1R9TB 3HOZB 5ELCA 3U9OA 1UEAB 2BE5D 2HHHQ 4FXGC 5ELNA 3CMAA 2IHFA 3TP7A 5KYLA 4LW1A 1V1PB 1FR3A 4IOAA 1JWMD 3K59A 3U58A 1F2ZA 1HZBA 1A63A 1A3UA 4JBWA 1EY0A 4U68A 3HKZG 4OONA 4AYBE 3S2DB 2D62A 5G3LF 3S15B 4A3KB 4BBSG 3S2DH 5JEAJ 4LFCL 2VUMH 1FJGQ 1SNPA 3EJIA 1LT5D 2UU9Q 4K0KL 3HOWB 2I46A 4OO1I 1A2TA 3NQIA 2WAQG 4NXNL 2BA0A 1VQOA 1Q1BA 4X65L 4JI7Q 3E0EA 1Q8IA 3QR8A 3M9BA 1YNXA 1TIID 2QW7A 2SNSA 2NWGA 4BXXH 4KK7A 4B08A 3FKIH 4IURA 2MO1A 3T1HL 4ZYSA 3J80c 1I4XA 1YHQA 2F0NA 1E7ZA 1TWCH 2F0SA 4C3HG 2NZOA 4M1UB 2ZTCA 1VQPA 2E75C 3AB9A 1VQIA 2VQEQ 1STAA 2K5VA 3L9AX 4S3SA 2FINB 2A69C 3HGBA 1PVOA 5DLQE 1JWUD 4N8FA 5ELEA 1DCZA 1J6QA 4WFN3 3PGZA 4IPGA 1BDOA 2ENBA 3ICEA 1M8AA 1NAPA 4DR4L 4P2CB 4RKBA 4UDUC 1AZQA 5IGDA 3HP3A 2QDBA 1Y1VH 4IUVA 1GHJA 5T1IA 1G51A 5IGGA 1SE4A 4B3SL 4A3IH 4L5QA 4JI7L 4DV1Q 2O5IC 4GLAC 3G4SA 4FF3A 2AKWB 4H44C 4ALPA 2NVYB 3I4MG 2H4OA 2JA8B 1HFNA 2K4KA 3E6ZX 3NBHB 4NXNQ 5E7NA 1XYIA 1DOMA 5CMDA 4K0KQ 5EKKA 1WCMB 1HNZQ 4DR5Q 2F4IA 2A6EC 4NB3A 4A93G 3J81i 3D6WA 3O13A 1JE5A 2PMZB 3ERSX 5LMUL 1S40A 4A3DH 5M5WH 3EFXD 2ZJQA 2YU9B 2A6ED 2EYOA 3VYUA 5JEAH 1ESFA 3TBIB 2CQOA 4A3EG 4JYAL 5C5MA 5M5YH 1K83B 2L4NA 2HDLA 1LABA 5LMUQ 1DOKA 4DAYA 3SVMA 1ASZA 2YYZA 1XNRL 5FLXE 2ASBA 5A2QL 5FJ8H 1PTOD 3HG9A 4KJNA 1UEBA 3X3MA 2D2CC 5IODA 2HQEA 1SFOB 1AP0A 1IYUA 5M3FB 5F2DA 2EDGA 2BOSA 1NBWA 4XTCS 1PTOF 2EVBA 3Q24A 5JVG3 3OHXC 1PFMA 2IW3A 2XWBB 3H15A 4MHEA 1EY6A 3TS2A 1NY4A 3D3RA 3KDFB 3T56B 2WAQE 4A93B 3PQIA 4HIDA 5CC4A 5CR3A 5KYIA 1XPOA 2AQ3B 3J80i 1SXTA 3BJUA 1NSNS 3OMCA 2K52A 3UDFA 1HPCA 2K14A 1CQFA 2Z6KC 1ET6A 2NVXH 5ELFA 3NHHA 2WKDA 2FXQA 1S5FD 1X32A 3MTSA 2LFNA 3RZDH 3T1HQ 2BDNA 3W2DA 3MXNB 3CW2C 4BWGB 5C3EG 1R4QB 2E2HH 1PH1A 3VYRA 2WFWA 2E2HB 4LF9L 4YIJA 4ZLTF 1QG7A 5K36G 2K28A 3OMGA 4MIUA 5IGEA 5EPKA 4C3IB 5K36H 1JT8A 1VQ7A 4X64Q 4A3FH 5EGTA 5HY6A 4IUPA 1PFNA 3K7AH 1EY7A 3KUPA 2MO0A 4EGVA 1YI2A 2ZT9C 1TS2A 1QCBD 1I94Q 1PH4A 3F8TA 3IRBA 1Q90A 1EOTA 1SE3A 3KOJA 1LTRD 3J7AF 1K28A 1JOQA 2QA4A 2DNEA 4HIMA 4DV3L 2F3VA 1G2SA 2SOBA 1TWGB 3NTIA 1X55A 4GKJQ 1EY9A 4KJOA 3C3LA 5FLMG 2F0GA 3N52A 3K0XA 4IFDH 1C9OA 4HMJA 2I5HA 3GTOH 4JOIC 3NBHA 5H1SE 2Q8TA 1QWYA 1FL0A 5IT9L 2LS01 3L0OA 2PW5A 2JA6H 2IX3A 1D7QA 3V05A 1KABA 5DNFA 1WTOA 5L37A 1WFQA 1C48A 2F0OA 2KCTA 4B3RQ 1IZ6A 3W5OA 1BVSA 1ESRA 3E9IA 4DAVA 3PO3G 1EWIA 1UE7A 3STBC 2B39A 2BH2A 4DR3Q 2PMZE 2KECA 4DXFA 1S5DD 3AFQA 1OXUA 1TS3A 4PMCA 4XIGS 1EYCA 1LTLA 2RHSB 4F8MA 1B44D 4HJ7A 1RODA 1Q7YC 2EE1A 3I70A 4A3JG 3F1ZA 5LL6X 1VF5C 2O4XA 3SEBA 5JEAG 1EEFD 3KBGA 2K32A 3FMCA 5I9PA 4ZUIA 1RJTA 5C4XG 1JR0D 3LNNA 2HHHL 1V43A 2GN5A 4KN4C 3BS1A 1EZ6A 1SNCA 3OIPA 3SK6A 3PO2G 2B2WC 1VQLA 4BBRB 1F2YA 4K2KA 3ULPA 1WTXA 4XT3B 5JVH3 3WWVA 1L0XB 1S72A 4FVMA 1X9NA 1WTHA 3F2CA 2RBMA 4QB4A 2CVRA 3I91A 3S1NH 2ZM6Q 2UXCQ 5BR8L 2R7ZG 3NE5B 4JI6L 5KNCA 1NUCA 1JQYD 3S9WA 5IY0A 1CA5A 3G6EA 4GKJL 4YWMA 2F0IA 2FJ2A 2EPBA 2Q2IA 4IJHA 1PTOH 1DM0B 3MFYA 4K5WA 3TQYA 4N8X1 4OXPA 2I5LX 3HOXH 1HNXQ 3D4RA 2CQAA 4A3EB 5IP7G 3PIPA 5JJIA 2VUMB 4KLKA 2EZVA 2R7DA 4JI8L 4K2LA 5BN5A 1YIJA 1B9NA 2AQ2B 3AFPA 1SAPA 1VQ8A 4C3JB 4TKOB 1M90C 1MJEA 3J81j 1N32L 1EY5A 3VA7A 5E4XA 1STGA 3ITPA 4JOIA 4JI5Q 3JC66 1VQ5A 3GTKB 4HJ9A 1PH7A 1A62A 2UU9L 2RQXA 4A3MH 3FKIB 4XQQA 2K1BA 3TZUA 2ZTEA 5EBDA 2RKSA 5C44G 4J15A 1CHQD 4O2DA 3EQLC 2WKCA 3TREA 3I56A 2R92B 5JJZA 2HDMA 4CDDC 4DR1Q 2EYMA 5M3MH 4TQUS 1SNQA 4U673 2J4XA 1NTGA 2A6HD 1TT2A 4IFDJ 3DLLA 1VMCA 1JOKA 1VQBA 3PIP3 1KDCA 3E0JA 4POGA 1B53A 3HOYG 4R8IA 3PO2H 1VF7A 3S17B 4LFAQ 1IL8A 3CF5A 4KHPQ 3S17H 4YY3L 1QB5D 5IYDH 2XTIA 2WACA 1GUNA 2YTXA 1WD0A 4QJFA 5FO7B 1B3AA 3VR3A 3GTGH 3EIVA 4X66L 2JA5G 5CORA 2VQFQ 4BA2I 5CGKA 2PQAA 4DNRB 2Y0SB 3HOXG 2K5QA 3OSOA 2JA8H 1SYBA 1EFWA 4C56C 2NVTH 5IE8A 3CCLA 4DK1A 1AFPA 4QY7A 5E4WC 3M4QA 1EY8A 2DJGC 2UXDL 1KD1C 4JI3Q 3S15H 4A76A 3C2PA 1XNRQ 1K8OA 4GNXA 1I4GA 4L5TA 3FPPA 2OXPA 5EPJA 1C0AA 3HOWH 5DEHA 2IPKD 4GN4B 2D9UA 2QF7A 4UY8C 1EOVA 1H95A 2K5WA 3R3OA 3DXJC 1JE4A 4GOPB 3A56A 3VR4A 1H9KA 1RKNA 3RD4A 3OTOQ 1KDBA 4RKLA 2HT1A 1GHKA 4C1NI 3VYSA 1AZPA 4HCEA 3CC7A 1HXYD 1HNWL 4A3GB 2OTJA 4A3GH 2AWNA 1E22A 5IP9G 3T1YQ 5KEEA 3OW7A 3J7A5 4PV1C 4B3RL 2F0LA 2MHVA 1CZGA 4PZ8A 3C1EA 1E2VA 1PV4A 1DZ1A 2A1AA 3BVMA 1XMQL 2R61A 1QILA 3GV6A 3Q0AA 4DV6L 4B3ML 2RCNA 4V0BA 1HA6A 1XTCD 1KHIA 4RCNA 4C2MH 1Q86C 4GNXC 4JI2Q 3Q22A 4LF7L 2EY2A 1N33Q 2KOLA 3TN2A 4RFBA 5ELBA 4QUCA 2J0TD 2NVXB 4H0LC 3AEVA 4PNYA 1YITA 3FVQA 2QGQA 3IKJA 4QIWB 2L12A 4BBSB 2EJGC 1Z47A 1NMFA 3I55A 5IYDG 3K5LA 1DJRD 3OIQA 2B63H 4NDXA 1T9HA 1EIYB 4GN5A 1H9RA 1IBML 1B2TA 4QIWE 3T53B 2KA7A 2A74C 4L5RC 3CKIB 1I4QA 1W6JA 4ME3A 4LUZA 3MZ5A 5E3FA 1Z7TA 1ONLA 4LF6L 5M5YB 2EY5A 5I6YA 4K8JA 1FJGL 2E74C 5C0XG 4AQYL 1C8CA 1ICWA 5JAVA 3VA5A 5CV7A 3M85A 4HIOA 4RGMA 1GUTA 1IXRA 4P75A 4CJ1B 3KJOA 4DV7Q 1S5CD 3QG1A 3B6YA 2JJQA 3KYHC 1GO3E 3J80L 2IJ0A 4P72A 2NVQB 2H5XA 4FF1A 4BY1H 1BUVT 2DY7A 4BY1B 2IL8A 1JB3A 4RGOS 5FO8B 3M3YH 1L0WA 1LV9A 1K0SA 4ULLA 3ULLA 1HQRD 3TP6A 1BCPF 3GTPH 1VQDA 4TRDA 2DUDA 5CV9A 2F3IA 1N36Q 4KHVA 1F9QA 4L8JA 5CV4A 4C3JG 3C1FA 3GTOB 3DWQA 2B2WA 2L15A 1XJVA 1E24A 4DR7L 2F1MA 4FXDA 1B50A 2CFMA 4X3TA 4GKKL 2EQSA 4K5XA 2K6AA 3AU7A 1K8MA 1RHPA 2F0JA 1IW7C 1MBYA 3TP5A 3PUWA 4UPAA 1R4PB 5LMNQ 2Z8LA 5D65A 3TSSA 3S1RB 2Y0SE 3I4NB 1PDQA 1PXUA 3MXUA 3I4NH 2OTLA 2EIFA 1IBLQ 3MXPA 5A35A 4O1NA 4KI0A 2JA6B 3P75A 2AMCB 2F0EA 2KCCA 4CJ2C 2A8VA 3VR6A 3WOFA 1V9PA 1YJNA 1YNND 3MC0B 2KJXA 2LKVA 5EQ0A 4DUZL 3KLRA 3NWSA 4IPHA 2WAQB 4OEMB 1RTNA 1AE2A 2L1BA 3ULJA 1SNOA 2R7ZB 2F0DA 2L0CA 2ZJPA 4CKBA 4J8QA 3PUZA 1Y14B 1A15A 1MI2A 3CAMA 4CDEC 1D5ZC 4EX5A 1HR0W 4HIKA 4G7HC 2DJFC 2K05A 4IN3A 1UE6A 5CV5A 3SE0A 5C0XI 2Z4IA 3KLWA 4DV1L 3STBD 1FGBD 1DOLA 3RN5A 4FYDA 4DV2L 1I3QH 3T4AC 2QEJC 3H0GH 3PO3B 1MD2D 1HZCA 2AUKA 3EA6A 4GNXB 3MXGA 3PO3H 1YJWA 3U4VA 5J3BA 2HD3A 2BA1A 4AYBG 1X6OA 3LWUA 2WP8J 4A4IA 5I6WA 1VQKA 4LF4L 1G8ZD 2K5NA 4DA2A 2JA6G 2E2IB 1U4LA 2N55A 1KAWA 2WB1G 4X3UA 5M3MG 4HTHA 3GTQB 2F03A 2UUCL 3GTQH 3CCEA 4YCWA 1LYLA 3D4DA 2KVMA 4JI1L 2A5HA 1MGSA 1HR0Q 3UE0A 2N78A 1BXTA 4C1NK 3IL8A 4CBVA 5BN4A 5C4XB 4NKLA 5C4XH 4JV5Q 1SYFA 4K6LA 2JA7H 2PZTA 4A3KH 1PFSA 3HKZB 2PI2A 1VMPA 3OWEB 1PTOB 1PHJA 3NEMA 2K5HA 2NZHA 4XDXA 2IHEA 2VW9A 1H9MA 4A3JB 5IYCH 4J6HA 3S14B 1PRTF 4X65Q 2WINB 3BG3A 2MJ8A 1EEID 4GKKQ 4QMGA 2F0PA 1F2LA 3L3OC 2QILA 3R93A 3NK9A 2JYOA 1XNQL 4DUYL 4HR7B 2VB3X 4E6IA 5AJ3L 1K73C 3HOUB 1TR5A 1J5EQ 3TEHB 1X3QA 2LMCB 3QB3A 5C3WA 1FNUA 1Q8KA 1LACA 5C3XA 4DV5Q 1OTCA 1N9WA 4A3BB 4IZ8A 1EIFA 1L1OB 1EU3A 1VS0A 3W1GA 4NP5A 5JJLA 3NELA 5J39A 4R4CA 4P74A 1TVXA 1NJIC 3BYTB 5FLMH 2BDOA 4A3MG 5IP7H 4DR2L 3NTKA 1KL9A 1TXYA 4KTAA 4B9XA 3TZDA 3CCVA 1GUOA 1BKBA 1VQJA 2EXDA 3NWTA 3QO2A 2Z6KA 4DV0Q 2JQOA 3MXNA 5ELOA 3GTGB 1B1ZA 2B29A 4LF6Q 3FPUB 4RCOA 4A3LH 3A0JA 1PA6A 3BZKA 1F9RA 2IT1A 2NVTB 4EQPA 1IBKQ 3GQBA 2B3GA 3KLSX 1JICA 4F87A 2K7VA 2OEOA 4UP8A 4WJWA 4XYOA 3GTLH 2UXBQ 4LAAA 4GN3B 1GJXA 2A69D 5C44B 4CHTB 3MHBA 4I65A 2EYPA 3RLFA 1ZKOA 2B8GA 2KCNA 1Y1VB 3DEOA 4R4IA 1HFGA 1X3FA 1LTID 2L11A 3J7YW 1NR4A 2A68D 2IWHA 2PQEA 1M4VA 3TP8A 3UDXA 3H3VI 1A6XA 3DMUA 1FNVA 4HAEA 3L7ZC 1CUKA 5LHY1 1Q46A 3AYHB 1BBWA 1WCMH 2BE5C 3BDOA 1U9RA 2E2DC 1SBBB 1KLGD 3PF4A 4A3MB 1BF4A 4EQOA 1KIXA 1CHPD 1KDAA 4IQZA 3S2HB 1CKNA 5GADC 4A3DB
chains in the Genus database with same CATH topology
1VQ8A 1GKHA 5IWAL 2VZAA 1M90C 2R92G 3BU2A 1Q81C 1TWAH 1PH8A 1MJEA 1IBKL 4LNQA 3J81j 1W2BA 3CD6A 3SGIA 5IP9H 1N32L 4NXML 2MFIA 4X64L 3PUYA 3F2BA 5LMNW 4JOIA 4JI5Q 3J81c 2PNHA 3JC66 1VQ5A 4HJ9A 1PH7A 1B7YB 1A62A 5EAYA 3T1YL 1YHBA 4HJ8A 1O7IA 2UU9L 2JEBI 4A3MH 2RF4A 2ZTEA 3HOZG 4LFBL 1A0IA 4B3TL 2R7ZH 3PUVA 5C44G 4IJLA 4J15A 1JMCA 1TWHH 4HJAA 5GQOA 1N34Q 1L2FA 4O2DA 1PH3A 1KRTA 1CKMA 1Y1VG 3TREA 3I56A 3K81C 4DR6Q 4DR1Q 3F2DA 2E5LQ 4A3JH 3KFUA 5M3MH 4TQUS 4NPSA 2V1CC 4P73A 1NTGA 4BY7H 4DUZQ 3VDYA 4IFDJ 1WOCA 3DLLA 1IL2A 3TRZA 3CCUA 3HOVH 2Y0SG 1VQBA 3S1RH 1K3RA 1PH5A 1C7YA 3KJPA 2HIXA 4YCUA 1EQRA 2VQEL 1J5EL 3K8AA 4POGA 1UWVA 4JI4L 3HOYG 2VUMG 3JAMi 3PO2H 2K50A 1GD7A 4DR3L 5JJKA 4PMWA 4LFAQ 1VQEA 3CF5A 4GOPA 3S1QH 4KHPQ 5BR8Q 3S17H 4A3DG 2UXDQ 4YY3L 5IYDH 2XTIA 4MNOA 1XPUA 2YTXA 1CSQA 2E2JH 4QJFA 2UUBQ 3GTGH 3EIVA 4X66L 4KHZA 3RR5A 2JA5G 1XMOL 1XMOQ 2WB1E 4BY1G 2VQFQ 4BA2I 4X66Q 2PQAA 3EN2A 1RIPA 2JA5H 3HOXG 1Q1EA 3CCJA 1QVFA 2VQFL 1SROA 4APVA 2JA8H 1EFWA 2NVTH 5IE8A 3PIOA 1AE3A 2R7FA 3CCLA 2UUBL 1I6HH 1E1OA 4QY7A 2NN6I 2QEXA 1K83H 5GROA 4IO9A 3M4QA 1HZAA 1G291 1NMGA 2OQKA 2UXDL 5GAEC 3KF6B 1KD1C 1QVGA 4JI3Q 4A76A 1XNRQ 2HHHQ 2C35B 4X62L 3S15H 1JJGA 5GAHC 4JV5L 4GNXA 5ELNA 3CMAA 2IHFA 1VQAA 4A3GG 4LW1A 5HGQA 4L5TA 4DR2Q 4IOAA 1Q82C 3JAMc 1SRUA 5IYBG 5C4JH 1KXLA 1N8RC 4A75A 1B70B 3U58A 3J7ZC 2KBNA 3HOWH 1HZBA 2VY3A 1C0AA 2F52A 4GN4B 4LWCA 4UY8C 1EOVA 1KRSA 2NN6G 5M3FH 3EBEA 1H95A 1A63A 4GOPB 4DR1L 1GVPA 3CCMA 4JBWA 4AYBE 3HKZG 4OONA 2D62A 3OTOQ 4QGUA 4A3FG 4BBSG 3S2DH 4DK6C 5JEAJ 4LFCL 3RNUA 2HT1A 2VUMH 1FJGQ 3PF5A 1VQ9A 3CC7A 1HNWL 2OTJA 2PQAB 4A3GH 4Y7NH 2UU9Q 4YCVA 3H3VH 4K0KL 2IY5B 2AWNA 1E22A 5IP9G 3T1YQ 4OO1I 2N8NA 2WAQG 4NXNL 2BA0A 1VQOA 1Q1BA 4X65L 1K8GA 4JI7Q 4JI5L 3E0EA 3J7A5 4B3RL 1L1OA 4DV2Q 3M9BA 1YNXA 3CPFA 4A3IG 4PZ8A 1PV4A 4BXXH 1LM0A 4AIMA 2A1AA 4A3EH 2LXJA 1XMQL 3FKIH 4FDBA 4NXMQ 5IWAQ 1PH2A 4DV6L 2PI2E 1VQCA 2MO1A 2OCEA 4DV4Q 4B3ML 4MTNA 1XTDA 3RLOA 3S24A 2RCNA 4YY3Q 1IBMQ 1WCMG 3CC2A 3T1HL 3J80c 1YHQA 1KHIA 1E7ZA 1TWCH 4C2MH 1K0RA 2NZOA 1Q86C 3UDGA 4GNXC 1P16A 2ZTCA 1VQPA 4JI2Q 4LF7L 1VQIA 1N33Q 1PYBA 1SLJA 2VQEQ 2K5VA 1EQQA 4A3BH 2K75A 2UUCQ 1HR0L 3I4MH 4A3BG 3AEVA 3HKSA 3G71A 1PVOA 3D31A 1YITA 5FLXc 3M7NA 2QGQA 5DLQE 3I4OA 1G6PA 1J6QA 3FP9A 2LXKA 3PGZA 4IPGA 1Z47A 1NMFA 3I55A 4DAYB 3ICEA 2Z0SA 5IYDG 4DR4L 4DV4L 2A19A 1B8AA 2CWPA 2UXCL 2VNUD 2B63H 4YHHQ 1T9HA 2AWOA 1UE1A 2MQHA 3U50C 4GN5A 3UDIA 1EIYB 1IBML 2F4VQ 3GTMH 4LFBQ 4WJ3M 1Y1VH 4P71A 4DKAC 4QIWE 5GAGC 1P8LA 2ZM6L 3D0FA 4L5RC 1G51A 2GVBA 1Q12A 4O0AA 2CCZA 4B3SL 2ZTDA 1I5FA 2N3SA 4ME3A 4L5QA 1PYSB 4LUZA 3LGJA 1I50H 4DV1Q 4A3IH 4JI7L 4GLAC 3G4SA 1KQSA 2AKWB 2UUAL 4ALPA 3I4MG 2NVQH 2JK8A 4DV0L 2K4KA 3NBHB 4LF6L 4NXNQ 5E7NA 1VCIA 1VQ6A 1FJGL 4K0KQ 5C0XG 1HNZQ 4AQYL 1VQFA 1HNWQ 2HQLA 4DR5Q 3M85A 3NENA 4HIOA 3GD7A 1MIUA 4BBRH 4NB3A 4A93G 3MEFA 1IXRA 4P75A 4C3HH 3J81i 3KJOA 3OYYA 1YBYA 1JE5A 3ERSX 5LMUL 4LFCQ 1S40A 3S16H 3S1MH 2GVAA 4JBJA 1AH9A 4A3DH 3B6YA 1W3SA 3GDEA 5M5WH 2JJQA 2ZJQA 5M3FG 3M4OH 3KYHC 3UE1A 1GO3E 3CC4A 1Y1WG 4DNIA 2JE6I 4P72A 2CQOA 2H5XA 1E3PA 3CQZH 5M5YH 4A3EG 1K8AC 4IPDA 4BY1H 4JYAL 1HH2P 1VQGA 1EYGA 1ASYA 3L2PA 4A3LG 5LMUQ 2Q2UA 3GTKH 1L0WA 3M3YH 3HOZH 4R1JA 2MNAA 3ULLA 3GTPH 1ASZA 1VQDA 1OXSC 2DUDA 1JJCB 2YTVA 2YYZA 1VQHA 2F3IA 1N36Q 4LF5L 2E2IH 2BH8A 1XNRL 2ASBA 4IFDG 4OWXB 5AJ3Q 3CCSA 2RHQB 4OWTB 1L1OC 5FJ8H 2L15A 3TS0A 1XJVA 1E24A 3S2HH 1UEBA 3U4ZA 4DR7L 4PG3A 3CP0A 3HOUH 2UXBL 2CFMA 4JCVE 3KF6A 4GKKL 2EQSA 3W1BA 1NBWA 4XTCS 4QQBX 4UP9A 3PUWA 4UPAA 2DGYA 3GTJH 3RZOH 5LMNQ 4DK3C 3BZCA 1LUZA 2Y0SE 3H15A 3I4NH 2CWAA 2OTLA 3TS2A 1NY4A 2EIFA 1IBLQ 1FVIA 2D0OA 4QL5A 3KDFB 4BBRG 4C3JH 4A3KG 2OWOA 2WAQE 4KI0A 4IOCA 4HIDA 1X65A 2AMCB 4LF5Q 1OXVA 1YEZA 2A8VA 2R92H 2KHJA 1V9PA 1XPOA 1YJNA 3J80i 3S14H 2VL6A 3DM3A 4AH6A 3BJUA 3KF8B 4MZ9A 4EQ5A 4DUZL 3HOVG 2K52A 2AHOB 3UDFA 2K14A 4IPHA 4JYAQ 4X6AH 3K80C 4OWWB 2Z6KC 4BY7G 3FHWA 2NVXH 2E5LL 2ATWA 1AE2A 2FXQA 3ULJA 1I94L 4DV7L 3G48A 4DV5L 4POFA 1OXXK 1SMXA 2ZJPA 3RZDH 2JA7G 2ES2A 3T1HQ 3PUZA 1Y14B 1HR0W 4A93H 3CAMA 3MXNB 2B63G 4EX5A 1X56A 3CW2C 4HIKA 3HOYH 2KENA 4DR5L 4DUYQ 5IYBH 3M4PA 4AQYQ 1UE6A 5C3EG 4B3TQ 4OX9L 2N49A 5C0XI 2E2HH 1PH1A 1XMQQ 3CPWA 1OXTA 2WFWA 3KLWA 2D0PA 4DV1L 4LF9L 3A5UA 5K36G 3STBD 4HJ5A 1WYDA 2UUAQ 3RN5A 4DV2L 4GOPC 1I3QH 1QUQB 1N32Q 1JT8A 4DPGA 1VQ7A 2XGTA 4X64Q 4B3SQ 3H0GH 4A3CH 1HZCA 4GNXB 3PO3H 1S3OA 4YHHL 1YJWA 4A3FH 1CKOA 4JC0A 5HY6A 1R9TH 3U4VA 2IX1A 3I4NG 5J3BA 4JI8Q 2BA1A 1SN8A 3K7AH 3CCRA 4AYBG 5C44H 2YTYA 1X6OA 4DR4Q 2MO0A 2WP8J 1A8VA 4A4IA 1YI2A 1VQKA 3CMEA 4LF4L 2K5NA 2ALYB 2JA6G 1I94Q 1PH4A 4YWLA 3F8TA 3IRBA 4IPCA 1KAWA 2WB1G 3I2ZA 3KOJA 5M3MG 1U5KA 4C3IH 1WI5A 2UUCL 3GTQH 1MKHA 3CCEA 1X3GA 4LUOA 4YCWA 1LYLA 2NVYH 3FKIG 2QA4A 4JI1L 4YWKA 4JI1Q 4HIMA 1KC8C 4DV3L 4BA1I 1HR0Q 4JBMA 3UE0A 2N78A 4LF8L 1X55A 4GKJQ 2R93G 3RN2A 5FLMG 4GS3A 3K0XA 4DAMA 5C4XH 2R93H 1YVCA 2KHIA 4JV5Q 4JI2L 1C9OA 3K7UC 4LF7Q 2I5HA 3E9HA 2JA7H 4A3KH 1GM5A 1PFSA 4JOIC 4JI3L 4JI6Q 3GTOH 2PI2A 5H1SE 4R4QA 1FL0A 4Y52H 2HIVA 1BBUA 3PCOB 4DV6Q 1QUQA 2LSSA 2JA9A 4H02A 3L0OA 1PHJA 3NEMA 2K5HA 1E1TA 2ZJRA 4B3MQ 1QZHA 2NZHA 2JA6H 1D7QA 2IHEA 2VW9A 3A74A 4JI0L 5LMNL 3HOWG 1WFQA 5IYCH 1QZGA 1SR3A 2KCTA 4B3RQ 3HKZE 1CSPA 4X65Q 1IZ6A 4GLVB 3W5OA 1BVSA 3E9IA 3PO3G 3H0GG 2Q2TA 1EWIA 2Q2HA 1U0LA 4DV7Q 4LF9Q 4DR7Q 4GKKQ 1UE7A 3STBC 4KHPL 2R6GA 4PZ7A 1FGUA 2BH2A 4OX9Q 1TWFH 2KCMA 4DR3Q 2PMZE 3PUXA 3AFQA 1XNQL 4DUYL 1OXUA 4XIGS 1DGSA 3I7FA 3CXCA 5AJ3L 1LTLA 1SFOH 1YHAA 2RHSB 5C3EH 1K73C 1J5EQ 2CKZB 2VS1A 3TEHB 1Q8KA 4HJ7A 4DV5Q 1OTCA 1Q7YC 3OTOL 1N9WA 5C0XJ 2E8GA 1EIFA 1L1OB 4UP7A 4A3JG 3F1ZA 2I0QA 5JEAG 2I5MX 1VS0A 2ID0A 2JEAI 3Q8DA 3W1GA 3PSIA 1VQNA 2YV5A 3AQQA 3NELA 5IYCG 1VQ4A 4BXXG 4R4CA 3KDFA 4P74A 5JJLA 5C4XG 1NJIC 5FLMH 4A3MG 5IP7H 4X62Q 4DR2L 2HHHL 4WJ4A 1V43A 1KL9A 1TXYA 2GN5A 1HNZL 1VQMA 3GO5A 3CCVA 1BKBA 1VQJA 5FJ8G 2EXDA 1IBLL 1XNQQ 3PO2G 2Z6KA 4DV0Q 1VQLA 2JQOA 1HJPA 1RL2A 5ELOA 1EUJA 2B29A 3ULPA 1PH6A 1JB7A 4LF6Q 1XPRA 1SE8A 3WWVA 4IFDI 4JG2A 4RMFA 1Y1WH 1HZ9A 1NE3A 3OW2A 1S72A 2JA8G 1M1KC 4A3LH 3A0JA 5IT9c 3BZKA 1PA6A 2IT1A 4JI0Q 1IBKQ 1X9NA 1CKNB 2B3GA 3F2CA 1IYJB 4PZ6A 4UP8A 4BBSH 2F4VL 4R4TA 3S1NH 2ZM6Q 2UXCQ 2OQ0A 4RG1A 1YJ9A 1TWGH 3GTLH 1UE5A 4A3CG 2UXBQ 4GN3B 3A5ZB 5BR8L 2R7ZG 3RLFA 4JI6L 4LFAL 4JBKA 4JI4Q 1Z9FA 4LUVA 4OO1G 2IX0A 1MJCA 3HOUG 4R4IA 3CCQA 4R4OA 1N36L 1YZ6A 5IY0A 1HNXL 1X54A 1X3FA 3G6EA 4GKJL 4YWMA 4GLXA 2Q2IA 2YU9H 1D8LA 4DV3Q 4IJHA 1QVCA 1PH9A 5M5XH 4LF8Q 3TQYA 4TVAB 3H3VI 3UDXA 1N33L 4OXPA 2I5LX 3L7ZC 1CUKA 3PV0A 3HOXH 1Q46A 1HNXQ 3AYHB 3ER0A 4DR6L 1BBWA 1WCMH 3ZJYC 4L5SA 5IP7G 3PIPA 1V1QA 1X3EA 1N34L 3PF4A 5JJIA 4KLKA 1KIXA 3HFZB 4LF4Q 2R7DA 4JI8L 1YIJA 1JJ2A 1K9MC 1CKNA 5GADC 1WJJA 3RLNA 3AFPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ8 A;  1GKH A;  5IWA L;  2VZA A;  1M90 C;  2R92 G;  3BU2 A;  1Q81 C;  1TWA H;  1PH8 A;  1MJE A;  1IBK L;  4LNQ A;  3J81 j;  1W2B A;  3CD6 A;  3SGI A;  5IP9 H;  1N32 L;  4NXM L;  2MFI A;  4X64 L;  3PUY A;  3F2B A;  5LMN W;  4JOI A;  4JI5 Q;  3J81 c;  2PNH A;  3JC6 6;  1VQ5 A;  4HJ9 A;  1PH7 A;  1B7Y B;  1A62 A;  5EAY A;  3T1Y L;  1YHB A;  4HJ8 A;  1O7I A;  2UU9 L;  2JEB I;  4A3M H;  2RF4 A;  2ZTE A;  3HOZ G;  4LFB L;  1A0I A;  4B3T L;  2R7Z H;  3PUV A;  5C44 G;  4IJL A;  4J15 A;  1JMC A;  1TWH H;  4HJA A;  5GQO A;  1N34 Q;  1L2F A;  4O2D A;  1PH3 A;  1KRT A;  1CKM A;  1Y1V G;  3TRE A;  3I56 A;  3K81 C;  4DR6 Q;  4DR1 Q;  3F2D A;  2E5L Q;  4A3J H;  3KFU A;  5M3M H;  4TQU S;  4NPS A;  2V1C C;  4P73 A;  1NTG A;  4BY7 H;  4DUZ Q;  3VDY A;  4IFD J;  1WOC A;  3DLL A;  1IL2 A;  3TRZ A;  3CCU A;  3HOV H;  2Y0S G;  1VQB A;  3S1R H;  1K3R A;  1PH5 A;  1C7Y A;  3KJP A;  2HIX A;  4YCU A;  1EQR A;  2VQE L;  1J5E L;  3K8A A;  4POG A;  1UWV A;  4JI4 L;  3HOY G;  2VUM G;  3JAM i;  3PO2 H;  2K50 A;  1GD7 A;  4DR3 L;  5JJK A;  4PMW A;  4LFA Q;  1VQE A;  3CF5 A;  4GOP A;  3S1Q H;  4KHP Q;  5BR8 Q;  3S17 H;  4A3D G;  2UXD Q;  4YY3 L;  5IYD H;  2XTI A;  4MNO A;  1XPU A;  2YTX A;  1CSQ A;  2E2J H;  4QJF A;  2UUB Q;  3GTG H;  3EIV A;  4X66 L;  4KHZ A;  3RR5 A;  2JA5 G;  1XMO L;  1XMO Q;  2WB1 E;  4BY1 G;  2VQF Q;  4BA2 I;  4X66 Q;  2PQA A;  3EN2 A;  1RIP A;  2JA5 H;  3HOX G;  1Q1E A;  3CCJ A;  1QVF A;  2VQF L;  1SRO A;  4APV A;  2JA8 H;  1EFW A;  2NVT H;  5IE8 A;  3PIO A;  1AE3 A;  2R7F A;  3CCL A;  2UUB L;  1I6H H;  1E1O A;  4QY7 A;  2NN6 I;  2QEX A;  1K83 H;  5GRO A;  4IO9 A;  3M4Q A;  1HZA A;  1G29 1;  1NMG A;  2OQK A;  2UXD L;  5GAE C;  3KF6 B;  1KD1 C;  1QVG A;  4JI3 Q;  4A76 A;  1XNR Q;  2HHH Q;  2C35 B;  4X62 L;  3S15 H;  1JJG A;  5GAH C;  4JV5 L;  4GNX A;  5ELN A;  3CMA A;  2IHF A;  1VQA A;  4A3G G;  4LW1 A;  5HGQ A;  4L5T A;  4DR2 Q;  4IOA A;  1Q82 C;  3JAM c;  1SRU A;  5IYB G;  5C4J H;  1KXL A;  1N8R C;  4A75 A;  1B70 B;  3U58 A;  3J7Z C;  2KBN A;  3HOW H;  1HZB A;  2VY3 A;  1C0A A;  2F52 A;  4GN4 B;  4LWC A;  4UY8 C;  1EOV A;  1KRS A;  2NN6 G;  5M3F H;  3EBE A;  1H95 A;  1A63 A;  4GOP B;  4DR1 L;  1GVP A;  3CCM A;  4JBW A;  4AYB E;  3HKZ G;  4OON A;  2D62 A;  3OTO Q;  4QGU A;  4A3F G;  4BBS G;  3S2D H;  4DK6 C;  5JEA J;  4LFC L;  3RNU A;  2HT1 A;  2VUM H;  1FJG Q;  3PF5 A;  1VQ9 A;  3CC7 A;  1HNW L;  2OTJ A;  2PQA B;  4A3G H;  4Y7N H;  2UU9 Q;  4YCV A;  3H3V H;  4K0K L;  2IY5 B;  2AWN A;  1E22 A;  5IP9 G;  3T1Y Q;  4OO1 I;  2N8N A;  2WAQ G;  4NXN L;  2BA0 A;  1VQO A;  1Q1B A;  4X65 L;  1K8G A;  4JI7 Q;  4JI5 L;  3E0E A;  3J7A 5;  4B3R L;  1L1O A;  4DV2 Q;  3M9B A;  1YNX A;  3CPF A;  4A3I G;  4PZ8 A;  1PV4 A;  4BXX H;  1LM0 A;  4AIM A;  2A1A A;  4A3E H;  2LXJ A;  1XMQ L;  3FKI H;  4FDB A;  4NXM Q;  5IWA Q;  1PH2 A;  4DV6 L;  2PI2 E;  1VQC A;  2MO1 A;  2OCE A;  4DV4 Q;  4B3M L;  4MTN A;  1XTD A;  3RLO A;  3S24 A;  2RCN A;  4YY3 Q;  1IBM Q;  1WCM G;  3CC2 A;  3T1H L;  3J80 c;  1YHQ A;  1KHI A;  1E7Z A;  1TWC H;  4C2M H;  1K0R A;  2NZO A;  1Q86 C;  3UDG A;  4GNX C;  1P16 A;  2ZTC A;  1VQP A;  4JI2 Q;  4LF7 L;  1VQI A;  1N33 Q;  1PYB A;  1SLJ A;  2VQE Q;  2K5V A;  1EQQ A;  4A3B H;  2K75 A;  2UUC Q;  1HR0 L;  3I4M H;  4A3B G;  3AEV A;  3HKS A;  3G71 A;  1PVO A;  3D31 A;  1YIT A;  5FLX c;  3M7N A;  2QGQ A;  5DLQ E;  3I4O A;  1G6P A;  1J6Q A;  3FP9 A;  2LXK A;  3PGZ A;  4IPG A;  1Z47 A;  1NMF A;  3I55 A;  4DAY B;  3ICE A;  2Z0S A;  5IYD G;  4DR4 L;  4DV4 L;  2A19 A;  1B8A A;  2CWP A;  2UXC L;  2VNU D;  2B63 H;  4YHH Q;  1T9H A;  2AWO A;  1UE1 A;  2MQH A;  3U50 C;  4GN5 A;  3UDI A;  1EIY B;  1IBM L;  2F4V Q;  3GTM H;  4LFB Q;  4WJ3 M;  1Y1V H;  4P71 A;  4DKA C;  4QIW E;  5GAG C;  1P8L A;  2ZM6 L;  3D0F A;  4L5R C;  1G51 A;  2GVB A;  1Q12 A;  4O0A A;  2CCZ A;  4B3S L;  2ZTD A;  1I5F A;  2N3S A;  4ME3 A;  4L5Q A;  1PYS B;  4LUZ A;  3LGJ A;  1I50 H;  4DV1 Q;  4A3I H;  4JI7 L;  4GLA C;  3G4S A;  1KQS A;  2AKW B;  2UUA L;  4ALP A;  3I4M G;  2NVQ H;  2JK8 A;  4DV0 L;  2K4K A;  3NBH B;  4LF6 L;  4NXN Q;  5E7N A;  1VCI A;  1VQ6 A;  1FJG L;  4K0K Q;  5C0X G;  1HNZ Q;  4AQY L;  1VQF A;  1HNW Q;  2HQL A;  4DR5 Q;  3M85 A;  3NEN A;  4HIO A;  3GD7 A;  1MIU A;  4BBR H;  4NB3 A;  4A93 G;  3MEF A;  1IXR A;  4P75 A;  4C3H H;  3J81 i;  3KJO A;  3OYY A;  1YBY A;  1JE5 A;  3ERS X;  5LMU L;  4LFC Q;  1S40 A;  3S16 H;  3S1M H;  2GVA A;  4JBJ A;  1AH9 A;  4A3D H;  3B6Y A;  1W3S A;  3GDE A;  5M5W H;  2JJQ A;  2ZJQ A;  5M3F G;  3M4O H;  3KYH C;  3UE1 A;  1GO3 E;  3CC4 A;  1Y1W G;  4DNI A;  2JE6 I;  4P72 A;  2CQO A;  2H5X A;  1E3P A;  3CQZ H;  5M5Y H;  4A3E G;  1K8A C;  4IPD A;  4BY1 H;  4JYA L;  1HH2 P;  1VQG A;  1EYG A;  1ASY A;  3L2P A;  4A3L G;  5LMU Q;  2Q2U A;  3GTK H;  1L0W A;  3M3Y H;  3HOZ H;  4R1J A;  2MNA A;  3ULL A;  3GTP H;  1ASZ A;  1VQD A;  1OXS C;  2DUD A;  1JJC B;  2YTV A;  2YYZ A;  1VQH A;  2F3I A;  1N36 Q;  4LF5 L;  2E2I H;  2BH8 A;  1XNR L;  2ASB A;  4IFD G;  4OWX B;  5AJ3 Q;  3CCS A;  2RHQ B;  4OWT B;  1L1O C;  5FJ8 H;  2L15 A;  3TS0 A;  1XJV A;  1E24 A;  3S2H H;  1UEB A;  3U4Z A;  4DR7 L;  4PG3 A;  3CP0 A;  3HOU H;  2UXB L;  2CFM A;  4JCV E;  3KF6 A;  4GKK L;  2EQS A;  3W1B A;  1NBW A;  4XTC S;  4QQB X;  4UP9 A;  3PUW A;  4UPA A;  2DGY A;  3GTJ H;  3RZO H;  5LMN Q;  4DK3 C;  3BZC A;  1LUZ A;  2Y0S E;  3H15 A;  3I4N H;  2CWA A;  2OTL A;  3TS2 A;  1NY4 A;  2EIF A;  1IBL Q;  1FVI A;  2D0O A;  4QL5 A;  3KDF B;  4BBR G;  4C3J H;  4A3K G;  2OWO A;  2WAQ E;  4KI0 A;  4IOC A;  4HID A;  1X65 A;  2AMC B;  4LF5 Q;  1OXV A;  1YEZ A;  2A8V A;  2R92 H;  2KHJ A;  1V9P A;  1XPO A;  1YJN A;  3J80 i;  3S14 H;  2VL6 A;  3DM3 A;  4AH6 A;  3BJU A;  3KF8 B;  4MZ9 A;  4EQ5 A;  4DUZ L;  3HOV G;  2K52 A;  2AHO B;  3UDF A;  2K14 A;  4IPH A;  4JYA Q;  4X6A H;  3K80 C;  4OWW B;  2Z6K C;  4BY7 G;  3FHW A;  2NVX H;  2E5L L;  2ATW A;  1AE2 A;  2FXQ A;  3ULJ A;  1I94 L;  4DV7 L;  3G48 A;  4DV5 L;  4POF A;  1OXX K;  1SMX A;  2ZJP A;  3RZD H;  2JA7 G;  2ES2 A;  3T1H Q;  3PUZ A;  1Y14 B;  1HR0 W;  4A93 H;  3CAM A;  3MXN B;  2B63 G;  4EX5 A;  1X56 A;  3CW2 C;  4HIK A;  3HOY H;  2KEN A;  4DR5 L;  4DUY Q;  5IYB H;  3M4P A;  4AQY Q;  1UE6 A;  5C3E G;  4B3T Q;  4OX9 L;  2N49 A;  5C0X I;  2E2H H;  1PH1 A;  1XMQ Q;  3CPW A;  1OXT A;  2WFW A;  3KLW A;  2D0P A;  4DV1 L;  4LF9 L;  3A5U A;  5K36 G;  3STB D;  4HJ5 A;  1WYD A;  2UUA Q;  3RN5 A;  4DV2 L;  4GOP C;  1I3Q H;  1QUQ B;  1N32 Q;  1JT8 A;  4DPG A;  1VQ7 A;  2XGT A;  4X64 Q;  4B3S Q;  3H0G H;  4A3C H;  1HZC A;  4GNX B;  3PO3 H;  1S3O A;  4YHH L;  1YJW A;  4A3F H;  1CKO A;  4JC0 A;  5HY6 A;  1R9T H;  3U4V A;  2IX1 A;  3I4N G;  5J3B A;  4JI8 Q;  2BA1 A;  1SN8 A;  3K7A H;  3CCR A;  4AYB G;  5C44 H;  2YTY A;  1X6O A;  4DR4 Q;  2MO0 A;  2WP8 J;  1A8V A;  4A4I A;  1YI2 A;  1VQK A;  3CME A;  4LF4 L;  2K5N A;  2ALY B;  2JA6 G;  1I94 Q;  1PH4 A;  4YWL A;  3F8T A;  3IRB A;  4IPC A;  1KAW A;  2WB1 G;  3I2Z A;  3KOJ A;  5M3M G;  1U5K A;  4C3I H;  1WI5 A;  2UUC L;  3GTQ H;  1MKH A;  3CCE A;  1X3G A;  4LUO A;  4YCW A;  1LYL A;  2NVY H;  3FKI G;  2QA4 A;  4JI1 L;  4YWK A;  4JI1 Q;  4HIM A;  1KC8 C;  4DV3 L;  4BA1 I;  1HR0 Q;  4JBM A;  3UE0 A;  2N78 A;  4LF8 L;  1X55 A;  4GKJ Q;  2R93 G;  3RN2 A;  5FLM G;  4GS3 A;  3K0X A;  4DAM A;  5C4X H;  2R93 H;  1YVC A;  2KHI A;  4JV5 Q;  4JI2 L;  1C9O A;  3K7U C;  4LF7 Q;  2I5H A;  3E9H A;  2JA7 H;  4A3K H;  1GM5 A;  1PFS A;  4JOI C;  4JI3 L;  4JI6 Q;  3GTO H;  2PI2 A;  5H1S E;  4R4Q A;  1FL0 A;  4Y52 H;  2HIV A;  1BBU A;  3PCO B;  4DV6 Q;  1QUQ A;  2LSS A;  2JA9 A;  4H02 A;  3L0O A;  1PHJ A;  3NEM A;  2K5H A;  1E1T A;  2ZJR A;  4B3M Q;  1QZH A;  2NZH A;  2JA6 H;  1D7Q A;  2IHE A;  2VW9 A;  3A74 A;  4JI0 L;  5LMN L;  3HOW G;  1WFQ A;  5IYC H;  1QZG A;  1SR3 A;  2KCT A;  4B3R Q;  3HKZ E;  1CSP A;  4X65 Q;  1IZ6 A;  4GLV B;  3W5O A;  1BVS A;  3E9I A;  3PO3 G;  3H0G G;  2Q2T A;  1EWI A;  2Q2H A;  1U0L A;  4DV7 Q;  4LF9 Q;  4DR7 Q;  4GKK Q;  1UE7 A;  3STB C;  4KHP L;  2R6G A;  4PZ7 A;  1FGU A;  2BH2 A;  4OX9 Q;  1TWF H;  2KCM A;  4DR3 Q;  2PMZ E;  3PUX A;  3AFQ A;  1XNQ L;  4DUY L;  1OXU A;  4XIG S;  1DGS A;  3I7F A;  3CXC A;  5AJ3 L;  1LTL A;  1SFO H;  1YHA A;  2RHS B;  5C3E H;  1K73 C;  1J5E Q;  2CKZ B;  2VS1 A;  3TEH B;  1Q8K A;  4HJ7 A;  4DV5 Q;  1OTC A;  1Q7Y C;  3OTO L;  1N9W A;  5C0X J;  2E8G A;  1EIF A;  1L1O B;  4UP7 A;  4A3J G;  3F1Z A;  2I0Q A;  5JEA G;  2I5M X;  1VS0 A;  2ID0 A;  2JEA I;  3Q8D A;  3W1G A;  3PSI A;  1VQN A;  2YV5 A;  3AQQ A;  3NEL A;  5IYC G;  1VQ4 A;  4BXX G;  4R4C A;  3KDF A;  4P74 A;  5JJL A;  5C4X G;  1NJI C;  5FLM H;  4A3M G;  5IP7 H;  4X62 Q;  4DR2 L;  2HHH L;  4WJ4 A;  1V43 A;  1KL9 A;  1TXY A;  2GN5 A;  1HNZ L;  1VQM A;  3GO5 A;  3CCV A;  1BKB A;  1VQJ A;  5FJ8 G;  2EXD A;  1IBL L;  1XNQ Q;  3PO2 G;  2Z6K A;  4DV0 Q;  1VQL A;  2JQO A;  1HJP A;  1RL2 A;  5ELO A;  1EUJ A;  2B29 A;  3ULP A;  1PH6 A;  1JB7 A;  4LF6 Q;  1XPR A;  1SE8 A;  3WWV A;  4IFD I;  4JG2 A;  4RMF A;  1Y1W H;  1HZ9 A;  1NE3 A;  3OW2 A;  1S72 A;  2JA8 G;  1M1K C;  4A3L H;  3A0J A;  5IT9 c;  3BZK A;  1PA6 A;  2IT1 A;  4JI0 Q;  1IBK Q;  1X9N A;  1CKN B;  2B3G A;  3F2C A;  1IYJ B;  4PZ6 A;  4UP8 A;  4BBS H;  2F4V L;  4R4T A;  3S1N H;  2ZM6 Q;  2UXC Q;  2OQ0 A;  4RG1 A;  1YJ9 A;  1TWG H;  3GTL H;  1UE5 A;  4A3C G;  2UXB Q;  4GN3 B;  3A5Z B;  5BR8 L;  2R7Z G;  3RLF A;  4JI6 L;  4LFA L;  4JBK A;  4JI4 Q;  1Z9F A;  4LUV A;  4OO1 G;  2IX0 A;  1MJC A;  3HOU G;  4R4I A;  3CCQ A;  4R4O A;  1N36 L;  1YZ6 A;  5IY0 A;  1HNX L;  1X54 A;  1X3F A;  3G6E A;  4GKJ L;  4YWM A;  4GLX A;  2Q2I A;  2YU9 H;  1D8L A;  4DV3 Q;  4IJH A;  1QVC A;  1PH9 A;  5M5X H;  4LF8 Q;  3TQY A;  4TVA B;  3H3V I;  3UDX A;  1N33 L;  4OXP A;  2I5L X;  3L7Z C;  1CUK A;  3PV0 A;  3HOX H;  1Q46 A;  1HNX Q;  3AYH B;  3ER0 A;  4DR6 L;  1BBW A;  1WCM H;  3ZJY C;  4L5S A;  5IP7 G;  3PIP A;  1V1Q A;  1X3E A;  1N34 L;  3PF4 A;  5JJI A;  4KLK A;  1KIX A;  3HFZ B;  4LF4 Q;  2R7D A;  4JI8 L;  1YIJ A;  1JJ2 A;  1K9M C;  1CKN A;  5GAD C;  1WJJ A;  3RLN A;  3AFP A; 
#chains in the Genus database with same CATH topology
 4AYB B;  3CRK C;  3SR1 A;  5IWA L;  1TWC B;  3KLS A;  1TWA H;  1IBK L;  1PZJ D;  5I4D A;  5M3M B;  2MFI A;  2PNH A;  1B7Y B;  1V1O A;  1YHB A;  2P5Z X;  4HJ8 A;  2JEB I;  4ID6 A;  3H6M A;  1TWF B;  1T5X D;  2I07 B;  3W3A A;  3I3C A;  5D3D A;  4HJA A;  1LTT D;  1N34 Q;  3LWE A;  4HMI A;  3K5O A;  1Y1V G;  5IGC A;  1XWE A;  3K81 C;  1JC7 A;  2ICI A;  2B2Y A;  4NPS A;  4BY7 B;  1PTO C;  4P73 A;  1RTO A;  5IGB A;  2B2T C;  4BY7 H;  5J1Z A;  3VDY A;  5NUC A;  1WOC A;  1IL2 A;  3NUC A;  4LJZ C;  3TRZ A;  1BCP B;  4YCU A;  1EQV A;  1J5E L;  3K8A A;  1G91 A;  4OL7 A;  1AW7 A;  1LT4 D;  4JI4 L;  5C3E B;  2K50 A;  3RZD B;  1VQE A;  4A3D G;  4XQJ A;  4X3S A;  2B63 B;  1XPU A;  1CSQ A;  2UUB Q;  3RR5 A;  1XMO Q;  2WB1 E;  2PO4 A;  3EN2 A;  1RIP A;  1QVF A;  4APV A;  1JOO A;  3A8K E;  4HSP A;  3PIO A;  1AE3 A;  1I6H H;  2UUB L;  1E1O A;  2QEX A;  2O5J C;  1K83 H;  4IO9 A;  4RHR A;  1HZA A;  2AUJ D;  3P20 A;  4A3F B;  4XXE A;  1IW7 D;  3SK5 A;  5GAE C;  1QVG A;  2C35 B;  4X62 L;  1JJG A;  3PIO 3;  2A73 B;  4ILW A;  1VQA A;  2B2Y C;  5HGQ A;  1GOZ A;  1BR9 A;  2VB2 X;  1E2W A;  1KXL A;  1DYQ A;  2G9H D;  4ZCK A;  5C4J H;  4L63 B;  2NYZ D;  2VY3 A;  2F52 A;  1GXD C;  2NN6 G;  5M3F H;  1STN A;  3EBE A;  1D6E C;  1G6Z A;  4FNF A;  1HRJ A;  1GVP A;  3CCM A;  1PRT C;  3GTP B;  4QGU A;  4A3F G;  1RF2 D;  1CI3 M;  3H09 A;  3RNU A;  3H91 A;  2K03 A;  2RDG A;  1VQ9 A;  3DUZ A;  3D8G A;  5BN3 A;  2KQ3 A;  2PQA B;  2FMC A;  4Y7N H;  3H3V H;  3H94 A;  3R8B A;  1PYW D;  3URY A;  4DV2 Q;  3CPF A;  1ZYR D;  1DD2 A;  4FDB A;  5IWA Q;  4KMU C;  4QF4 A;  2QKI C;  1VQC A;  1J8I A;  4DV4 Q;  3MAQ A;  4MTN A;  1XTD A;  2MGS A;  5ISR A;  1IBM Q;  1ZYR C;  4ZUJ A;  1TWH B;  1UNS A;  3CC2 A;  1O78 A;  3MFG A;  2HCC A;  1EIG A;  2K04 A;  3MA2 B;  2RCF A;  1KAA A;  4PQX A;  2K75 A;  2E2J B;  2TSS A;  1HR0 L;  1FD7 D;  4A3B G;  4HCS A;  3D31 A;  2XWJ B;  5FLX c;  4KKS A;  5FLX L;  3I4O A;  1G6P A;  1RD9 D;  3FP9 A;  3MEH A;  2LXK A;  1SYC A;  2CH4 A;  2WB1 B;  4DAY B;  4K8I A;  1FYC A;  4DNT B;  4DV4 L;  1EFI D;  4YHH Q;  3K5M A;  2AWO A;  3UDI A;  1UE1 A;  2F4V Q;  1SSO A;  4LFB Q;  3GTM H;  4EQN A;  1TY2 A;  4P71 A;  1Q12 A;  3A8J E;  2ZTD A;  1I5F A;  2N3S A;  1TS5 A;  3A54 A;  1LTG D;  1KQS A;  2UUA L;  2NVQ H;  1NCV A;  4DV0 L;  5KIX A;  1V8Q A;  1VQ6 A;  2OF1 A;  5CBE E;  2OT2 A;  5EKI A;  1YNN C;  4BBR H;  2SEB D;  3IFD A;  3MEF A;  2G5D A;  2GVA A;  4JBJ A;  1BNZ A;  1W3S A;  3GDE A;  1O7Z A;  3WDN A;  3MWY W;  3M4O H;  3UE1 A;  3H0G B;  2SDF A;  3CC4 A;  2EYL A;  2JE6 I;  2EYH A;  4FXK C;  2F0F A;  1HH2 P;  1VQG A;  4PMB A;  1EYG A;  2C9O A;  5DM7 3;  3L2P A;  1ASY A;  4A3L G;  3HOZ H;  3PMF A;  4R1J A;  2MNA A;  1OXS C;  1JJC B;  4LF5 L;  1VQH A;  4IFD G;  2E2I H;  4OWX B;  5AJ3 Q;  3CCS A;  4OWT B;  1L1O C;  3TS0 A;  4IUN A;  1A3V A;  3Q6S A;  4RGN A;  3U4Z A;  2UXB L;  4JCV E;  5KGU A;  2NUC A;  4CDF C;  3W1B A;  4J1M A;  4NW2 A;  3GTJ B;  3RZO B;  4BS9 A;  4UP9 A;  3GTJ H;  3RZO H;  1CQV A;  4DK3 C;  4KY7 A;  1SND A;  4KY6 A;  3I4M B;  4F7X A;  3ERO A;  1EZ8 A;  2CWA A;  1FVI A;  2D0O A;  4QL5 A;  4C3J H;  2A6H C;  1AEX A;  3GV3 A;  1X65 A;  4LF5 Q;  1OXV A;  1YEZ A;  2R92 H;  2DNC A;  3S1Q B;  4LMQ D;  3R2T A;  3S14 H;  3ZYY X;  2VL6 A;  4AH6 A;  4RHS A;  3KF8 B;  5A2Q E;  2AHO B;  3CHB D;  3K80 C;  4OWW B;  3M7G A;  3FHW A;  1LO5 D;  2QDL A;  2E5L L;  1LTA D;  1QNU A;  3G48 A;  1BCP D;  5IT9 E;  1SMX A;  1PZK D;  2B63 G;  1X56 A;  3HOY H;  2KEN A;  5CBA E;  4DUY Q;  1STB A;  2KUM A;  3M4P A;  4AQY Q;  1F9P A;  4OX9 L;  3TDQ A;  1S4Z A;  4C3H B;  1C4Q A;  1OXT A;  1SJH D;  5JPM C;  1MHW C;  4HJ5 A;  2UUA Q;  3VR2 A;  3A8I E;  1QJO A;  4K14 A;  1PRT D;  4DPG A;  2XIW A;  2RSO A;  3BVG A;  1S3O A;  4YHH L;  4JC0 A;  1R9T H;  2IX1 A;  1HHV A;  4CKE A;  2EYJ A;  5C44 H;  1DXM A;  1A8V A;  3GP7 A;  3OWF A;  2ALY B;  2WV6 D;  3AMU A;  4ZAI A;  4IPC A;  1HCZ A;  5FO9 B;  1U5K A;  1LTB D;  1LT3 D;  5HGT A;  4X3K A;  5HUR A;  4KKU A;  3CQZ B;  1KNE A;  2NVY H;  3NXW A;  4JI1 Q;  1KC8 C;  1S5B D;  2R93 G;  3RN2 A;  4DAM A;  2ZXR A;  1KLU D;  2AQ1 B;  3C46 A;  5EKL A;  1GM5 A;  2Z9H A;  4R4Q A;  4Y52 H;  2HIV A;  4JPB W;  2JP1 A;  2V4D A;  1TKW B;  2JA9 A;  4H02 A;  1SMY C;  4ZKB B;  1E1T A;  2ZJR A;  4B3M Q;  4JI0 L;  3I4L A;  3A7A B;  1QE6 A;  1Z6H A;  5FKA C;  5LMN L;  1SR3 A;  5C6A A;  1HTL D;  1CSP A;  2X6L A;  2R93 B;  4IUU A;  1ICF B;  3H0G G;  4WRD A;  2Q2H A;  2Q2T A;  1CK1 A;  1WTP A;  5M9O A;  4ME5 A;  1I4H A;  4JVZ A;  1TWF H;  2PNR C;  4OX9 Q;  2Z6B A;  3EVQ A;  3HEJ A;  3CXC A;  1SFO H;  3PO2 B;  1ZEQ X;  2CKZ B;  2VS1 A;  3I8Z A;  4I7Z C;  1CZW A;  1NR2 A;  5C0X J;  2E8G A;  2J7Z A;  3BYY B;  2RDH A;  3QWN A;  3PSI A;  2YV5 A;  3KDF A;  5C4Z A;  4IUQ A;  5KNB A;  3KK7 A;  4OGQ C;  4X62 Q;  3GTL B;  1FNW A;  4V19 0;  3J81 L;  3GO5 A;  1O7L A;  3H3V C;  1IBL L;  1XNQ Q;  2XRS D;  4I7A A;  1JWS D;  1HJP A;  1RL2 A;  5FK9 C;  1PH6 A;  1XPR A;  2RDF A;  4IFD I;  4RMF A;  2JA8 G;  4O42 A;  5M5W B;  4JI0 Q;  1PFB A;  4PZ6 A;  4BBS H;  2F4V L;  2OQ0 A;  4A3C G;  2DY8 A;  1I6H B;  4FP5 D;  2F3W A;  2MP1 A;  4JI4 Q;  1Z9F A;  1ENF A;  3OPO A;  3ND9 A;  4LUV A;  4GZY C;  1H9S B;  2IX0 A;  3HOU G;  3RMH A;  3CCQ A;  1N36 L;  1HNX L;  3JAM E;  1Y1W B;  1BBX C;  3NPP A;  4GLX A;  2YU9 H;  1QVC A;  1TWA B;  3WOE A;  1T5E A;  1D5M C;  1I4P A;  1N33 L;  3G6J B;  2EY1 A;  3PV0 A;  2B2V A;  4DR6 L;  3ER0 A;  2HUG A;  5IIF A;  1V1Q A;  1X3E A;  1N34 L;  2Z4H A;  3HRZ C;  4DU9 A;  4H7B A;  4MN3 A;  4LF4 Q;  1JJ2 A;  3NP8 A;  2H1E A;  1WJJ A;  4DFA A;  3RLN A;  1KTK A;  5CV6 A;  4Q5V A;  2VZA A;  5ELD A;  3HS0 C;  3U9S A;  3BU2 A;  4C2M B;  1Q81 C;  2MUY A;  3G7L A;  1W2B A;  1SEB D;  3CD6 A;  3F2B A;  1DON A;  3E3X A;  4N9P A;  3I73 A;  5EAY A;  1BCP C;  3UI2 A;  3T1Y L;  2NTS A;  1EU4 A;  2PZW A;  3P7J A;  2RF4 A;  4LFB L;  2ZXO A;  1A0I A;  1MSH A;  3PUV A;  4EVO A;  1ILP A;  4IJL A;  1JMC A;  1TWH H;  1EWC A;  5GQO A;  1L2F A;  1PH3 A;  1SDF A;  1CKM A;  4DR6 Q;  2E5L Q;  2BCO A;  3FDT A;  1D2B A;  4DUZ Q;  1Y8P B;  4G7Z C;  1PZI D;  4WOR A;  4H13 C;  1B9M A;  3CCU A;  3S1R H;  1WD1 A;  1C7Y A;  2HIX A;  2B2T A;  2EJM A;  4KD4 A;  1UWV A;  2VUM G;  2CW0 C;  2B8F A;  3ERQ A;  3RUZ A;  4PMW A;  4GOP A;  5J22 A;  2UXD Q;  4RWS C;  4MNO A;  2E2J H;  1WTW A;  4C3I G;  4KHZ A;  4OHJ A;  2PW7 A;  1XMO L;  4X66 Q;  1Q1E A;  3CCJ A;  2VQF L;  1SRO A;  3QOJ A;  1HQM C;  4CGY B;  5AFW A;  5GRO A;  2L5T A;  2L55 A;  1NMG A;  2OQK A;  3M3Y B;  2KHS A;  5EBC A;  3KF6 B;  5GAH C;  3DM1 A;  4JV5 L;  3FRP B;  4A3G G;  3QJY A;  4DR2 Q;  1Q82 C;  3JAM c;  1SRU A;  5IYB G;  2CH4 W;  1N8R C;  4A75 A;  1B70 B;  3M4O B;  1JOR A;  1LLR D;  3J7Z C;  2JA5 B;  3NQT A;  2KBN A;  1UUP A;  1IYV A;  1TU2 B;  3D6C A;  1XXG A;  4LWC A;  5M5X B;  1KRS A;  3S1N B;  1IKM A;  4DR1 L;  2R3Z A;  2XRQ D;  1AN8 A;  3J81 E;  3K58 A;  2G9D A;  1ENA A;  4DK6 C;  2JSO A;  3I90 A;  4CKC A;  3PF5 A;  4TSS A;  1YNJ C;  5DAU A;  1K3B C;  2A68 C;  1SE2 A;  4YCV A;  2IY5 B;  2RA4 A;  2N8N A;  1K8G A;  2JXM B;  1WTV A;  4JI5 L;  1L1O A;  1EQT A;  4ZQ3 A;  1U4R A;  2X69 A;  4RA8 A;  4A3I G;  1IHZ A;  2PZU A;  1LM0 A;  3OOC A;  4AIM A;  4A3E H;  2LXJ A;  2PYK A;  4NXM Q;  1PH2 A;  2JA7 B;  5FOB B;  2O2L D;  2PI2 E;  2OCE A;  3NTH A;  3S24 A;  3RLO A;  2C5C A;  4YY3 Q;  1WCM G;  1SYD A;  1LTS D;  1K0R A;  1GUG A;  3UDG A;  1P16 A;  3SXH A;  3KF8 A;  3V96 A;  1D1I A;  1PYB A;  2F0Q A;  1OO9 B;  1SLJ A;  1EQQ A;  4A3B H;  2Q8I B;  1X3P A;  3T13 A;  2UUC Q;  3I4M H;  2ICE C;  3HKS A;  4ZK9 B;  3CRL C;  3G71 A;  4IUT A;  1IKL A;  1E2Z A;  3M7N A;  5G3L D;  4IAL A;  3BDC A;  1SYG A;  2F0T A;  3CU7 A;  1EYA A;  2Z0S A;  3DHQ A;  2A19 A;  1B8A A;  2CWP A;  2UXC L;  2VNU D;  2MQH A;  3U50 C;  2B2U C;  2KEE A;  4WJ3 M;  4DKA C;  5GAG C;  2ZM6 L;  1P8L A;  3D0F A;  2GVB A;  3A7L A;  4O0A A;  3DWA A;  2CCZ A;  4MTK A;  1O80 A;  1SMY D;  3X3N A;  1PYS B;  4HED A;  1I50 H;  1V1P A;  3LGJ A;  1TY0 A;  2SNM A;  4JK1 C;  1B3Q A;  2JK8 A;  1CM9 A;  1VCI A;  4JW0 A;  4OO1 H;  1I6V C;  1VQF A;  1BQQ T;  1HNW Q;  2HQL A;  5C5L A;  5I2X A;  5EJW A;  3GD7 A;  1MIU A;  4RH6 A;  1STY A;  1JCK B;  4C3H H;  2F0W A;  1WTQ A;  4LFC Q;  2M2L A;  1YBY A;  3OYY A;  3S16 B;  3S1M B;  4ZRZ A;  3S16 H;  3S1M H;  3SDZ A;  2EYF A;  1BOS A;  1II3 A;  1AH9 A;  1GUW A;  1RDP D;  1Y8N B;  4G7O C;  4OIJ A;  3HZX A;  3R2I A;  2NN6 H;  5M3F G;  3A55 A;  1Y1W G;  4DNI A;  4KD3 A;  4Z9C B;  3CQZ H;  1K8A C;  1E3P A;  2CW0 D;  1D1K A;  4IPD A;  2Q2U A;  3KBX A;  3GTK H;  1VDZ A;  4K5V A;  4F88 A;  1SNM A;  2YTV A;  2BH8 A;  2RHQ B;  1KNA A;  2B2U A;  4DN4 M;  2N88 A;  5C4H A;  3S2H H;  4CDC C;  4OEL B;  4PG3 A;  3CP0 A;  3P1H A;  3HOU H;  1J9O A;  3KF6 A;  1RCV D;  4QQB X;  2WII B;  5TSS A;  1EY4 A;  5LL6 S;  2DGY A;  4HSV A;  3BZC A;  1LUZ A;  4XYQ A;  2HCI A;  1HTP A;  2NZ1 D;  2FFK B;  5JOB A;  4BBR G;  4K6D A;  4A3K G;  2OWO A;  3IFT A;  4IOC A;  1HUN A;  5K5P A;  2KHJ A;  4FF4 A;  2NBF A;  3DM3 A;  2F0H A;  3JAM L;  4UAI A;  3HOV G;  4MZ9 A;  4EQ5 A;  4X6A H;  1G2T A;  4JYA Q;  4BY7 G;  4FO2 A;  3IAY A;  3I72 A;  3J80 E;  2ATW A;  4A3I B;  1HA5 A;  1I94 L;  4DV7 L;  4DV5 L;  3FEW X;  1HUM A;  4POF A;  1OXX K;  3ONA B;  5IGF A;  2ES2 A;  2JA7 G;  4A93 H;  1B4O A;  4DR5 L;  1PLF A;  5IYB H;  1U4M A;  4B3T Q;  1S5E D;  2N49 A;  2XN9 C;  2K01 A;  1XMQ Q;  3QIA A;  3CPW A;  1H9J A;  2D0P A;  2KED A;  1Q3L A;  3A5U A;  1ZXT A;  4FF2 A;  1WYD A;  3K6O A;  4GOP C;  1QUQ B;  1N32 Q;  2XGT A;  4B3S Q;  3M4Y A;  4LK1 C;  4A3C H;  3BZD B;  4DAP A;  5T1G A;  1CKO A;  1WTR A;  2NB0 A;  3I4N G;  4JI8 Q;  1SN8 A;  3V2T A;  3CCR A;  1ILQ A;  2YTY A;  4DR4 Q;  2K33 A;  2PPB C;  3CME A;  5D14 A;  1ET9 A;  2LY7 A;  4YWL A;  3I2Z A;  4L6T B;  2NTT A;  4C3I H;  1WI5 A;  1WVL A;  1EWH A;  1CT1 D;  1MKH A;  1X3G A;  2F0K A;  4LUO A;  3FKI G;  1F9S A;  4YWK A;  4BA1 I;  4JBM A;  3T51 B;  4LF8 L;  4G57 A;  4GS3 A;  3SK8 A;  3K7A B;  2R93 H;  1YVC A;  2KHI A;  1CFM A;  3ND8 A;  4JI2 L;  4LF7 Q;  3K7U C;  3E9H A;  4JI6 Q;  4JI3 L;  5I2Y A;  5KRU A;  1BBU A;  3PCO B;  4DV6 Q;  5JPN C;  1QUQ A;  2LSS A;  3SK4 A;  1QNK A;  3SHL A;  1QZH A;  3A74 A;  2DN8 A;  5IOC A;  2Z1C A;  4KKT A;  3HOW G;  1QZG A;  3HKZ E;  3VR5 A;  1L0Y B;  4GLV B;  2ZXP A;  2RSN A;  4LF9 Q;  1U0L A;  4DR7 Q;  1Y8O B;  4KHP L;  2R6G A;  4KY5 A;  4PZ7 A;  1FGU A;  2M9V A;  5C0X H;  2KCM A;  1PRT B;  3PUX A;  4NMZ A;  4N9T A;  4ABN A;  4Y7N B;  1DGS A;  3I7F A;  1YHA A;  1A2U A;  5C3E H;  3K5N A;  1Y69 U;  5EPL A;  5DM6 3;  3NBI A;  1YNJ D;  4DF7 A;  2QCP X;  3OTO L;  2TMP A;  4UP7 A;  4G4K A;  2I0Q A;  4QUF A;  2I5M X;  2JEA I;  2ID0 A;  3Q8D A;  3F2U A;  4HN7 A;  3AQQ A;  5IYC G;  1VQ4 A;  1VQN A;  4BXX G;  1PMR A;  2F0V A;  1TS4 A;  4WJ4 A;  1GUS A;  1STE A;  1HNZ L;  1VQM A;  5E1F A;  2M00 A;  1CTM A;  5FJ8 G;  1EUJ A;  3LX0 A;  3VYT A;  1JB7 A;  1SE8 A;  2EJF C;  4JG2 A;  1Y1W H;  1HZ9 A;  1NE3 A;  2FHT A;  5C4J B;  2XSC A;  3OW2 A;  1EIH A;  1M1K C;  5IT9 c;  2B2V C;  2XNA C;  4ZKC B;  1ENC A;  1CKN B;  1IYJ B;  2EXZ A;  1H9S A;  4R4T A;  1YJ9 A;  4RG1 A;  1TWG H;  1UE5 A;  1UAP A;  3A5Z B;  4LFA L;  4JBK A;  5CV8 A;  4OO1 G;  3Q23 A;  4B9W A;  3N6R A;  1MJC A;  2PCF B;  4KV6 A;  4R4O A;  5KND A;  1YZ6 A;  1O7Y A;  4Q0F A;  1X54 A;  3J7A V;  1XX8 A;  1D8L A;  4DV3 Q;  1I3Q B;  4QCL A;  1ML0 D;  1PH9 A;  5M5X H;  3T16 A;  4LF8 Q;  1D5X C;  1BO0 A;  4TVA B;  5CYU A;  2X6G A;  3BDL A;  5COY A;  3ZJY C;  4L5S A;  1E0B A;  2JN4 A;  5D3I B;  2MPM A;  4R9W A;  1A3T A;  3D4W A;  3QOL A;  4ODG A;  3HFZ B;  1I4R A;  1K9M C;  2XVS A;  3NEN A;  2D5D A;  1GKH A;  4DXG A;  2R92 G;  4RAU C;  1EYD A;  3E5S A;  5I9O A;  1PH8 A;  4OIK A;  4LNQ A;  4DGZ A;  3SGI A;  5IP9 H;  2L9H A;  4NXM L;  4X64 L;  3PUY A;  2Q8R E;  5LMN W;  3J81 c;  3HOX B;  2F0M A;  2FMM A;  1U4P A;  2F0U A;  2RVL A;  1W6K A;  1O7I A;  2VXW A;  4DK0 A;  4R8N A;  2CHB D;  3HOZ G;  2R7Z H;  4B3T L;  1STH A;  4XT1 B;  1CA6 A;  3BVZ A;  3K57 A;  1KRT A;  1LT6 D;  3F2D A;  4A3J H;  3KFU A;  1SJE D;  2V1C C;  3GTM B;  1F77 A;  4RGT A;  3HOV H;  2Y0S G;  1PH5 A;  1K3R A;  2K5D A;  3KJP A;  3HOV B;  1EQR A;  2VQE L;  1MSG A;  3TME A;  1QOH A;  3JAM i;  1GD7 A;  3DWP A;  4DR3 L;  3DEP A;  5JJK A;  2GA4 B;  3K0Y A;  1SYE A;  2EY6 A;  3S1Q H;  5BR8 Q;  1TQO A;  3NSW A;  2EOT A;  4M8A A;  4XQN A;  4BY1 G;  1F2M A;  3MVV A;  2JA5 H;  4KN7 C;  4UHV A;  2E76 C;  1I50 B;  1NNX A;  4CJ0 B;  1EL0 A;  2R7F A;  2NN6 I;  3HOY B;  1G29 1;  1R9T B;  3HOZ B;  5ELC A;  3U9O A;  1UEA B;  2BE5 D;  2HHH Q;  4FXG C;  5ELN A;  3CMA A;  2IHF A;  3TP7 A;  5KYL A;  4LW1 A;  1V1P B;  1FR3 A;  4IOA A;  1JWM D;  3K59 A;  3U58 A;  1F2Z A;  1HZB A;  1A63 A;  1A3U A;  4JBW A;  1EY0 A;  4U68 A;  3HKZ G;  4OON A;  4AYB E;  3S2D B;  2D62 A;  5G3L F;  3S15 B;  4A3K B;  4BBS G;  3S2D H;  5JEA J;  4LFC L;  2VUM H;  1FJG Q;  1SNP A;  3EJI A;  1LT5 D;  2UU9 Q;  4K0K L;  3HOW B;  2I46 A;  4OO1 I;  1A2T A;  3NQI A;  2WAQ G;  4NXN L;  2BA0 A;  1VQO A;  1Q1B A;  4X65 L;  4JI7 Q;  3E0E A;  1Q8I A;  3QR8 A;  3M9B A;  1YNX A;  1TII D;  2QW7 A;  2SNS A;  2NWG A;  4BXX H;  4KK7 A;  4B08 A;  3FKI H;  4IUR A;  2MO1 A;  3T1H L;  4ZYS A;  3J80 c;  1I4X A;  1YHQ A;  2F0N A;  1E7Z A;  1TWC H;  2F0S A;  4C3H G;  2NZO A;  4M1U B;  2ZTC A;  1VQP A;  2E75 C;  3AB9 A;  1VQI A;  2VQE Q;  1STA A;  2K5V A;  3L9A X;  4S3S A;  2FIN B;  2A69 C;  3HGB A;  1PVO A;  5DLQ E;  1JWU D;  4N8F A;  5ELE A;  1DCZ A;  1J6Q A;  4WFN 3;  3PGZ A;  4IPG A;  1BDO A;  2ENB A;  3ICE A;  1M8A A;  1NAP A;  4DR4 L;  4P2C B;  4RKB A;  4UDU C;  1AZQ A;  5IGD A;  3HP3 A;  2QDB A;  1Y1V H;  4IUV A;  1GHJ A;  5T1I A;  1G51 A;  5IGG A;  1SE4 A;  4B3S L;  4A3I H;  4L5Q A;  4JI7 L;  4DV1 Q;  2O5I C;  4GLA C;  3G4S A;  4FF3 A;  2AKW B;  4H44 C;  4ALP A;  2NVY B;  3I4M G;  2H4O A;  2JA8 B;  1HFN A;  2K4K A;  3E6Z X;  3NBH B;  4NXN Q;  5E7N A;  1XYI A;  1DOM A;  5CMD A;  4K0K Q;  5EKK A;  1WCM B;  1HNZ Q;  4DR5 Q;  2F4I A;  2A6E C;  4NB3 A;  4A93 G;  3J81 i;  3D6W A;  3O13 A;  1JE5 A;  2PMZ B;  3ERS X;  5LMU L;  1S40 A;  4A3D H;  5M5W H;  3EFX D;  2ZJQ A;  2YU9 B;  2A6E D;  2EYO A;  3VYU A;  5JEA H;  1ESF A;  3TBI B;  2CQO A;  4A3E G;  4JYA L;  5C5M A;  5M5Y H;  1K83 B;  2L4N A;  2HDL A;  1LAB A;  5LMU Q;  1DOK A;  4DAY A;  3SVM A;  1ASZ A;  2YYZ A;  1XNR L;  5FLX E;  2ASB A;  5A2Q L;  5FJ8 H;  1PTO D;  3HG9 A;  4KJN A;  1UEB A;  3X3M A;  2D2C C;  5IOD A;  2HQE A;  1SFO B;  1AP0 A;  1IYU A;  5M3F B;  5F2D A;  2EDG A;  2BOS A;  1NBW A;  4XTC S;  1PTO F;  2EVB A;  3Q24 A;  5JVG 3;  3OHX C;  1PFM A;  2IW3 A;  2XWB B;  3H15 A;  4MHE A;  1EY6 A;  3TS2 A;  1NY4 A;  3D3R A;  3KDF B;  3T56 B;  2WAQ E;  4A93 B;  3PQI A;  4HID A;  5CC4 A;  5CR3 A;  5KYI A;  1XPO A;  2AQ3 B;  3J80 i;  1SXT A;  3BJU A;  1NSN S;  3OMC A;  2K52 A;  3UDF A;  1HPC A;  2K14 A;  1CQF A;  2Z6K C;  1ET6 A;  2NVX H;  5ELF A;  3NHH A;  2WKD A;  2FXQ A;  1S5F D;  1X32 A;  3MTS A;  2LFN A;  3RZD H;  3T1H Q;  2BDN A;  3W2D A;  3MXN B;  3CW2 C;  4BWG B;  5C3E G;  1R4Q B;  2E2H H;  1PH1 A;  3VYR A;  2WFW A;  2E2H B;  4LF9 L;  4YIJ A;  4ZLT F;  1QG7 A;  5K36 G;  2K28 A;  3OMG A;  4MIU A;  5IGE A;  5EPK A;  4C3I B;  5K36 H;  1JT8 A;  1VQ7 A;  4X64 Q;  4A3F H;  5EGT A;  5HY6 A;  4IUP A;  1PFN A;  3K7A H;  1EY7 A;  3KUP A;  2MO0 A;  4EGV A;  1YI2 A;  2ZT9 C;  1TS2 A;  1QCB D;  1I94 Q;  1PH4 A;  3F8T A;  3IRB A;  1Q90 A;  1EOT A;  1SE3 A;  3KOJ A;  1LTR D;  3J7A F;  1K28 A;  1JOQ A;  2QA4 A;  2DNE A;  4HIM A;  4DV3 L;  2F3V A;  1G2S A;  2SOB A;  1TWG B;  3NTI A;  1X55 A;  4GKJ Q;  1EY9 A;  4KJO A;  3C3L A;  5FLM G;  2F0G A;  3N52 A;  3K0X A;  4IFD H;  1C9O A;  4HMJ A;  2I5H A;  3GTO H;  4JOI C;  3NBH A;  5H1S E;  2Q8T A;  1QWY A;  1FL0 A;  5IT9 L;  2LS0 1;  3L0O A;  2PW5 A;  2JA6 H;  2IX3 A;  1D7Q A;  3V05 A;  1KAB A;  5DNF A;  1WTO A;  5L37 A;  1WFQ A;  1C48 A;  2F0O A;  2KCT A;  4B3R Q;  1IZ6 A;  3W5O A;  1BVS A;  1ESR A;  3E9I A;  4DAV A;  3PO3 G;  1EWI A;  1UE7 A;  3STB C;  2B39 A;  2BH2 A;  4DR3 Q;  2PMZ E;  2KEC A;  4DXF A;  1S5D D;  3AFQ A;  1OXU A;  1TS3 A;  4PMC A;  4XIG S;  1EYC A;  1LTL A;  2RHS B;  4F8M A;  1B44 D;  4HJ7 A;  1ROD A;  1Q7Y C;  2EE1 A;  3I70 A;  4A3J G;  3F1Z A;  5LL6 X;  1VF5 C;  2O4X A;  3SEB A;  5JEA G;  1EEF D;  3KBG A;  2K32 A;  3FMC A;  5I9P A;  4ZUI A;  1RJT A;  5C4X G;  1JR0 D;  3LNN A;  2HHH L;  1V43 A;  2GN5 A;  4KN4 C;  3BS1 A;  1EZ6 A;  1SNC A;  3OIP A;  3SK6 A;  3PO2 G;  2B2W C;  1VQL A;  4BBR B;  1F2Y A;  4K2K A;  3ULP A;  1WTX A;  4XT3 B;  5JVH 3;  3WWV A;  1L0X B;  1S72 A;  4FVM A;  1X9N A;  1WTH A;  3F2C A;  2RBM A;  4QB4 A;  2CVR A;  3I91 A;  3S1N H;  2ZM6 Q;  2UXC Q;  5BR8 L;  2R7Z G;  3NE5 B;  4JI6 L;  5KNC A;  1NUC A;  1JQY D;  3S9W A;  5IY0 A;  1CA5 A;  3G6E A;  4GKJ L;  4YWM A;  2F0I A;  2FJ2 A;  2EPB A;  2Q2I A;  4IJH A;  1PTO H;  1DM0 B;  3MFY A;  4K5W A;  3TQY A;  4N8X 1;  4OXP A;  2I5L X;  3HOX H;  1HNX Q;  3D4R A;  2CQA A;  4A3E B;  5IP7 G;  3PIP A;  5JJI A;  2VUM B;  4KLK A;  2EZV A;  2R7D A;  4JI8 L;  4K2L A;  5BN5 A;  1YIJ A;  1B9N A;  2AQ2 B;  3AFP A;  1SAP A;  1VQ8 A;  4C3J B;  4TKO B;  1M90 C;  1MJE A;  3J81 j;  1N32 L;  1EY5 A;  3VA7 A;  5E4X A;  1STG A;  3ITP A;  4JOI A;  4JI5 Q;  3JC6 6;  1VQ5 A;  3GTK B;  4HJ9 A;  1PH7 A;  1A62 A;  2UU9 L;  2RQX A;  4A3M H;  3FKI B;  4XQQ A;  2K1B A;  3TZU A;  2ZTE A;  5EBD A;  2RKS A;  5C44 G;  4J15 A;  1CHQ D;  4O2D A;  3EQL C;  2WKC A;  3TRE A;  3I56 A;  2R92 B;  5JJZ A;  2HDM A;  4CDD C;  4DR1 Q;  2EYM A;  5M3M H;  4TQU S;  1SNQ A;  4U67 3;  2J4X A;  1NTG A;  2A6H D;  1TT2 A;  4IFD J;  3DLL A;  1VMC A;  1JOK A;  1VQB A;  3PIP 3;  1KDC A;  3E0J A;  4POG A;  1B53 A;  3HOY G;  4R8I A;  3PO2 H;  1VF7 A;  3S17 B;  4LFA Q;  1IL8 A;  3CF5 A;  4KHP Q;  3S17 H;  4YY3 L;  1QB5 D;  5IYD H;  2XTI A;  2WAC A;  1GUN A;  2YTX A;  1WD0 A;  4QJF A;  5FO7 B;  1B3A A;  3VR3 A;  3GTG H;  3EIV A;  4X66 L;  2JA5 G;  5COR A;  2VQF Q;  4BA2 I;  5CGK A;  2PQA A;  4DNR B;  2Y0S B;  3HOX G;  2K5Q A;  3OSO A;  2JA8 H;  1SYB A;  1EFW A;  4C56 C;  2NVT H;  5IE8 A;  3CCL A;  4DK1 A;  1AFP A;  4QY7 A;  5E4W C;  3M4Q A;  1EY8 A;  2DJG C;  2UXD L;  1KD1 C;  4JI3 Q;  3S15 H;  4A76 A;  3C2P A;  1XNR Q;  1K8O A;  4GNX A;  1I4G A;  4L5T A;  3FPP A;  2OXP A;  5EPJ A;  1C0A A;  3HOW H;  5DEH A;  2IPK D;  4GN4 B;  2D9U A;  2QF7 A;  4UY8 C;  1EOV A;  1H95 A;  2K5W A;  3R3O A;  3DXJ C;  1JE4 A;  4GOP B;  3A56 A;  3VR4 A;  1H9K A;  1RKN A;  3RD4 A;  3OTO Q;  1KDB A;  4RKL A;  2HT1 A;  1GHK A;  4C1N I;  3VYS A;  1AZP A;  4HCE A;  3CC7 A;  1HXY D;  1HNW L;  4A3G B;  2OTJ A;  4A3G H;  2AWN A;  1E22 A;  5IP9 G;  3T1Y Q;  5KEE A;  3OW7 A;  3J7A 5;  4PV1 C;  4B3R L;  2F0L A;  2MHV A;  1CZG A;  4PZ8 A;  3C1E A;  1E2V A;  1PV4 A;  1DZ1 A;  2A1A A;  3BVM A;  1XMQ L;  2R61 A;  1QIL A;  3GV6 A;  3Q0A A;  4DV6 L;  4B3M L;  2RCN A;  4V0B A;  1HA6 A;  1XTC D;  1KHI A;  4RCN A;  4C2M H;  1Q86 C;  4GNX C;  4JI2 Q;  3Q22 A;  4LF7 L;  2EY2 A;  1N33 Q;  2KOL A;  3TN2 A;  4RFB A;  5ELB A;  4QUC A;  2J0T D;  2NVX B;  4H0L C;  3AEV A;  4PNY A;  1YIT A;  3FVQ A;  2QGQ A;  3IKJ A;  4QIW B;  2L12 A;  4BBS B;  2EJG C;  1Z47 A;  1NMF A;  3I55 A;  5IYD G;  3K5L A;  1DJR D;  3OIQ A;  2B63 H;  4NDX A;  1T9H A;  1EIY B;  4GN5 A;  1H9R A;  1IBM L;  1B2T A;  4QIW E;  3T53 B;  2KA7 A;  2A74 C;  4L5R C;  3CKI B;  1I4Q A;  1W6J A;  4ME3 A;  4LUZ A;  3MZ5 A;  5E3F A;  1Z7T A;  1ONL A;  4LF6 L;  5M5Y B;  2EY5 A;  5I6Y A;  4K8J A;  1FJG L;  2E74 C;  5C0X G;  4AQY L;  1C8C A;  1ICW A;  5JAV A;  3VA5 A;  5CV7 A;  3M85 A;  4HIO A;  4RGM A;  1GUT A;  1IXR A;  4P75 A;  4CJ1 B;  3KJO A;  4DV7 Q;  1S5C D;  3QG1 A;  3B6Y A;  2JJQ A;  3KYH C;  1GO3 E;  3J80 L;  2IJ0 A;  4P72 A;  2NVQ B;  2H5X A;  4FF1 A;  4BY1 H;  1BUV T;  2DY7 A;  4BY1 B;  2IL8 A;  1JB3 A;  4RGO S;  5FO8 B;  3M3Y H;  1L0W A;  1LV9 A;  1K0S A;  4ULL A;  3ULL A;  1HQR D;  3TP6 A;  1BCP F;  3GTP H;  1VQD A;  4TRD A;  2DUD A;  5CV9 A;  2F3I A;  1N36 Q;  4KHV A;  1F9Q A;  4L8J A;  5CV4 A;  4C3J G;  3C1F A;  3GTO B;  3DWQ A;  2B2W A;  2L15 A;  1XJV A;  1E24 A;  4DR7 L;  2F1M A;  4FXD A;  1B50 A;  2CFM A;  4X3T A;  4GKK L;  2EQS A;  4K5X A;  2K6A A;  3AU7 A;  1K8M A;  1RHP A;  2F0J A;  1IW7 C;  1MBY A;  3TP5 A;  3PUW A;  4UPA A;  1R4P B;  5LMN Q;  2Z8L A;  5D65 A;  3TSS A;  3S1R B;  2Y0S E;  3I4N B;  1PDQ A;  1PXU A;  3MXU A;  3I4N H;  2OTL A;  2EIF A;  1IBL Q;  3MXP A;  5A35 A;  4O1N A;  4KI0 A;  2JA6 B;  3P75 A;  2AMC B;  2F0E A;  2KCC A;  4CJ2 C;  2A8V A;  3VR6 A;  3WOF A;  1V9P A;  1YJN A;  1YNN D;  3MC0 B;  2KJX A;  2LKV A;  5EQ0 A;  4DUZ L;  3KLR A;  3NWS A;  4IPH A;  2WAQ B;  4OEM B;  1RTN A;  1AE2 A;  2L1B A;  3ULJ A;  1SNO A;  2R7Z B;  2F0D A;  2L0C A;  2ZJP A;  4CKB A;  4J8Q A;  3PUZ A;  1Y14 B;  1A15 A;  1MI2 A;  3CAM A;  4CDE C;  1D5Z C;  4EX5 A;  1HR0 W;  4HIK A;  4G7H C;  2DJF C;  2K05 A;  4IN3 A;  1UE6 A;  5CV5 A;  3SE0 A;  5C0X I;  2Z4I A;  3KLW A;  4DV1 L;  3STB D;  1FGB D;  1DOL A;  3RN5 A;  4FYD A;  4DV2 L;  1I3Q H;  3T4A C;  2QEJ C;  3H0G H;  3PO3 B;  1MD2 D;  1HZC A;  2AUK A;  3EA6 A;  4GNX B;  3MXG A;  3PO3 H;  1YJW A;  3U4V A;  5J3B A;  2HD3 A;  2BA1 A;  4AYB G;  1X6O A;  3LWU A;  2WP8 J;  4A4I A;  5I6W A;  1VQK A;  4LF4 L;  1G8Z D;  2K5N A;  4DA2 A;  2JA6 G;  2E2I B;  1U4L A;  2N55 A;  1KAW A;  2WB1 G;  4X3U A;  5M3M G;  4HTH A;  3GTQ B;  2F03 A;  2UUC L;  3GTQ H;  3CCE A;  4YCW A;  1LYL A;  3D4D A;  2KVM A;  4JI1 L;  2A5H A;  1MGS A;  1HR0 Q;  3UE0 A;  2N78 A;  1BXT A;  4C1N K;  3IL8 A;  4CBV A;  5BN4 A;  5C4X B;  4NKL A;  5C4X H;  4JV5 Q;  1SYF A;  4K6L A;  2JA7 H;  2PZT A;  4A3K H;  1PFS A;  3HKZ B;  2PI2 A;  1VMP A;  3OWE B;  1PTO B;  1PHJ A;  3NEM A;  2K5H A;  2NZH A;  4XDX A;  2IHE A;  2VW9 A;  1H9M A;  4A3J B;  5IYC H;  4J6H A;  3S14 B;  1PRT F;  4X65 Q;  2WIN B;  3BG3 A;  2MJ8 A;  1EEI D;  4GKK Q;  4QMG A;  2F0P A;  1F2L A;  3L3O C;  2QIL A;  3R93 A;  3NK9 A;  2JYO A;  1XNQ L;  4DUY L;  4HR7 B;  2VB3 X;  4E6I A;  5AJ3 L;  1K73 C;  3HOU B;  1TR5 A;  1J5E Q;  3TEH B;  1X3Q A;  2LMC B;  3QB3 A;  5C3W A;  1FNU A;  1Q8K A;  1LAC A;  5C3X A;  4DV5 Q;  1OTC A;  1N9W A;  4A3B B;  4IZ8 A;  1EIF A;  1L1O B;  1EU3 A;  1VS0 A;  3W1G A;  4NP5 A;  5JJL A;  3NEL A;  5J39 A;  4R4C A;  4P74 A;  1TVX A;  1NJI C;  3BYT B;  5FLM H;  2BDO A;  4A3M G;  5IP7 H;  4DR2 L;  3NTK A;  1KL9 A;  1TXY A;  4KTA A;  4B9X A;  3TZD A;  3CCV A;  1GUO A;  1BKB A;  1VQJ A;  2EXD A;  3NWT A;  3QO2 A;  2Z6K A;  4DV0 Q;  2JQO A;  3MXN A;  5ELO A;  3GTG B;  1B1Z A;  2B29 A;  4LF6 Q;  3FPU B;  4RCO A;  4A3L H;  3A0J A;  1PA6 A;  3BZK A;  1F9R A;  2IT1 A;  2NVT B;  4EQP A;  1IBK Q;  3GQB A;  2B3G A;  3KLS X;  1JIC A;  4F87 A;  2K7V A;  2OEO A;  4UP8 A;  4WJW A;  4XYO A;  3GTL H;  2UXB Q;  4LAA A;  4GN3 B;  1GJX A;  2A69 D;  5C44 B;  4CHT B;  3MHB A;  4I65 A;  2EYP A;  3RLF A;  1ZKO A;  2B8G A;  2KCN A;  1Y1V B;  3DEO A;  4R4I A;  1HFG A;  1X3F A;  1LTI D;  2L11 A;  3J7Y W;  1NR4 A;  2A68 D;  2IWH A;  2PQE A;  1M4V A;  3TP8 A;  3UDX A;  3H3V I;  1A6X A;  3DMU A;  1FNV A;  4HAE A;  3L7Z C;  1CUK A;  5LHY 1;  1Q46 A;  3AYH B;  1BBW A;  1WCM H;  2BE5 C;  3BDO A;  1U9R A;  2E2D C;  1SBB B;  1KLG D;  3PF4 A;  4A3M B;  1BF4 A;  4EQO A;  1KIX A;  1CHP D;  1KDA A;  4IQZ A;  3S2H B;  1CKN A;  5GAD C;  4A3D B; 
#chains in the Genus database with same CATH homology
 1VQ8 A;  1GKH A;  5IWA L;  2VZA A;  1M90 C;  2R92 G;  3BU2 A;  1Q81 C;  1TWA H;  1PH8 A;  1MJE A;  1IBK L;  4LNQ A;  3J81 j;  1W2B A;  3CD6 A;  3SGI A;  5IP9 H;  1N32 L;  4NXM L;  2MFI A;  4X64 L;  3PUY A;  3F2B A;  5LMN W;  4JOI A;  4JI5 Q;  3J81 c;  2PNH A;  3JC6 6;  1VQ5 A;  4HJ9 A;  1PH7 A;  1B7Y B;  1A62 A;  5EAY A;  3T1Y L;  1YHB A;  4HJ8 A;  1O7I A;  2UU9 L;  2JEB I;  4A3M H;  2RF4 A;  2ZTE A;  3HOZ G;  4LFB L;  1A0I A;  4B3T L;  2R7Z H;  3PUV A;  5C44 G;  4IJL A;  4J15 A;  1JMC A;  1TWH H;  4HJA A;  5GQO A;  1N34 Q;  1L2F A;  4O2D A;  1PH3 A;  1KRT A;  1CKM A;  1Y1V G;  3TRE A;  3I56 A;  3K81 C;  4DR6 Q;  4DR1 Q;  3F2D A;  2E5L Q;  4A3J H;  3KFU A;  5M3M H;  4TQU S;  4NPS A;  2V1C C;  4P73 A;  1NTG A;  4BY7 H;  4DUZ Q;  3VDY A;  4IFD J;  1WOC A;  3DLL A;  1IL2 A;  3TRZ A;  3CCU A;  3HOV H;  2Y0S G;  1VQB A;  3S1R H;  1K3R A;  1PH5 A;  1C7Y A;  3KJP A;  2HIX A;  4YCU A;  1EQR A;  2VQE L;  1J5E L;  3K8A A;  4POG A;  1UWV A;  4JI4 L;  3HOY G;  2VUM G;  3JAM i;  3PO2 H;  2K50 A;  1GD7 A;  4DR3 L;  5JJK A;  4PMW A;  4LFA Q;  1VQE A;  3CF5 A;  4GOP A;  3S1Q H;  4KHP Q;  5BR8 Q;  3S17 H;  4A3D G;  2UXD Q;  4YY3 L;  5IYD H;  2XTI A;  4MNO A;  1XPU A;  2YTX A;  1CSQ A;  2E2J H;  4QJF A;  2UUB Q;  3GTG H;  3EIV A;  4X66 L;  4KHZ A;  3RR5 A;  2JA5 G;  1XMO L;  1XMO Q;  2WB1 E;  4BY1 G;  2VQF Q;  4BA2 I;  4X66 Q;  2PQA A;  3EN2 A;  1RIP A;  2JA5 H;  3HOX G;  1Q1E A;  3CCJ A;  1QVF A;  2VQF L;  1SRO A;  4APV A;  2JA8 H;  1EFW A;  2NVT H;  5IE8 A;  3PIO A;  1AE3 A;  2R7F A;  3CCL A;  2UUB L;  1I6H H;  1E1O A;  4QY7 A;  2NN6 I;  2QEX A;  1K83 H;  5GRO A;  4IO9 A;  3M4Q A;  1HZA A;  1G29 1;  1NMG A;  2OQK A;  2UXD L;  5GAE C;  3KF6 B;  1KD1 C;  1QVG A;  4JI3 Q;  4A76 A;  1XNR Q;  2HHH Q;  2C35 B;  4X62 L;  3S15 H;  1JJG A;  5GAH C;  4JV5 L;  4GNX A;  5ELN A;  3CMA A;  2IHF A;  1VQA A;  4A3G G;  4LW1 A;  5HGQ A;  4L5T A;  4DR2 Q;  4IOA A;  1Q82 C;  3JAM c;  1SRU A;  5IYB G;  5C4J H;  1KXL A;  1N8R C;  4A75 A;  1B70 B;  3U58 A;  3J7Z C;  2KBN A;  3HOW H;  1HZB A;  2VY3 A;  1C0A A;  2F52 A;  4GN4 B;  4LWC A;  4UY8 C;  1EOV A;  1KRS A;  2NN6 G;  5M3F H;  3EBE A;  1H95 A;  1A63 A;  4GOP B;  4DR1 L;  1GVP A;  3CCM A;  4JBW A;  4AYB E;  3HKZ G;  4OON A;  2D62 A;  3OTO Q;  4QGU A;  4A3F G;  4BBS G;  3S2D H;  4DK6 C;  5JEA J;  4LFC L;  3RNU A;  2HT1 A;  2VUM H;  1FJG Q;  3PF5 A;  1VQ9 A;  3CC7 A;  1HNW L;  2OTJ A;  2PQA B;  4A3G H;  4Y7N H;  2UU9 Q;  4YCV A;  3H3V H;  4K0K L;  2IY5 B;  2AWN A;  1E22 A;  5IP9 G;  3T1Y Q;  4OO1 I;  2N8N A;  2WAQ G;  4NXN L;  2BA0 A;  1VQO A;  1Q1B A;  4X65 L;  1K8G A;  4JI7 Q;  4JI5 L;  3E0E A;  3J7A 5;  4B3R L;  1L1O A;  4DV2 Q;  3M9B A;  1YNX A;  3CPF A;  4A3I G;  4PZ8 A;  1PV4 A;  4BXX H;  1LM0 A;  4AIM A;  2A1A A;  4A3E H;  2LXJ A;  1XMQ L;  3FKI H;  4FDB A;  4NXM Q;  5IWA Q;  1PH2 A;  4DV6 L;  2PI2 E;  1VQC A;  2MO1 A;  2OCE A;  4DV4 Q;  4B3M L;  4MTN A;  1XTD A;  3RLO A;  3S24 A;  2RCN A;  4YY3 Q;  1IBM Q;  1WCM G;  3CC2 A;  3T1H L;  3J80 c;  1YHQ A;  1KHI A;  1E7Z A;  1TWC H;  4C2M H;  1K0R A;  2NZO A;  1Q86 C;  3UDG A;  4GNX C;  1P16 A;  2ZTC A;  1VQP A;  4JI2 Q;  4LF7 L;  1VQI A;  1N33 Q;  1PYB A;  1SLJ A;  2VQE Q;  2K5V A;  1EQQ A;  4A3B H;  2K75 A;  2UUC Q;  1HR0 L;  3I4M H;  4A3B G;  3AEV A;  3HKS A;  3G71 A;  1PVO A;  3D31 A;  1YIT A;  5FLX c;  3M7N A;  2QGQ A;  5DLQ E;  3I4O A;  1G6P A;  1J6Q A;  3FP9 A;  2LXK A;  3PGZ A;  4IPG A;  1Z47 A;  1NMF A;  3I55 A;  4DAY B;  3ICE A;  2Z0S A;  5IYD G;  4DR4 L;  4DV4 L;  2A19 A;  1B8A A;  2CWP A;  2UXC L;  2VNU D;  2B63 H;  4YHH Q;  1T9H A;  2AWO A;  1UE1 A;  2MQH A;  3U50 C;  4GN5 A;  3UDI A;  1EIY B;  1IBM L;  2F4V Q;  3GTM H;  4LFB Q;  4WJ3 M;  1Y1V H;  4P71 A;  4DKA C;  4QIW E;  5GAG C;  1P8L A;  2ZM6 L;  3D0F A;  4L5R C;  1G51 A;  2GVB A;  1Q12 A;  4O0A A;  2CCZ A;  4B3S L;  2ZTD A;  1I5F A;  2N3S A;  4ME3 A;  4L5Q A;  1PYS B;  4LUZ A;  3LGJ A;  1I50 H;  4DV1 Q;  4A3I H;  4JI7 L;  4GLA C;  3G4S A;  1KQS A;  2AKW B;  2UUA L;  4ALP A;  3I4M G;  2NVQ H;  2JK8 A;  4DV0 L;  2K4K A;  3NBH B;  4LF6 L;  4NXN Q;  5E7N A;  1VCI A;  1VQ6 A;  1FJG L;  4K0K Q;  5C0X G;  1HNZ Q;  4AQY L;  1VQF A;  1HNW Q;  2HQL A;  4DR5 Q;  3M85 A;  3NEN A;  4HIO A;  3GD7 A;  1MIU A;  4BBR H;  4NB3 A;  4A93 G;  3MEF A;  1IXR A;  4P75 A;  4C3H H;  3J81 i;  3KJO A;  3OYY A;  1YBY A;  1JE5 A;  3ERS X;  5LMU L;  4LFC Q;  1S40 A;  3S16 H;  3S1M H;  2GVA A;  4JBJ A;  1AH9 A;  4A3D H;  3B6Y A;  1W3S A;  3GDE A;  5M5W H;  2JJQ A;  2ZJQ A;  5M3F G;  3M4O H;  3KYH C;  3UE1 A;  1GO3 E;  3CC4 A;  1Y1W G;  4DNI A;  2JE6 I;  4P72 A;  2CQO A;  2H5X A;  1E3P A;  3CQZ H;  5M5Y H;  4A3E G;  1K8A C;  4IPD A;  4BY1 H;  4JYA L;  1HH2 P;  1VQG A;  1EYG A;  1ASY A;  3L2P A;  4A3L G;  5LMU Q;  2Q2U A;  3GTK H;  1L0W A;  3M3Y H;  3HOZ H;  4R1J A;  2MNA A;  3ULL A;  3GTP H;  1ASZ A;  1VQD A;  1OXS C;  2DUD A;  1JJC B;  2YTV A;  2YYZ A;  1VQH A;  2F3I A;  1N36 Q;  4LF5 L;  2E2I H;  2BH8 A;  1XNR L;  2ASB A;  4IFD G;  4OWX B;  5AJ3 Q;  3CCS A;  2RHQ B;  4OWT B;  1L1O C;  5FJ8 H;  2L15 A;  3TS0 A;  1XJV A;  1E24 A;  3S2H H;  1UEB A;  3U4Z A;  4DR7 L;  4PG3 A;  3CP0 A;  3HOU H;  2UXB L;  2CFM A;  4JCV E;  3KF6 A;  4GKK L;  2EQS A;  3W1B A;  1NBW A;  4XTC S;  4QQB X;  4UP9 A;  3PUW A;  4UPA A;  2DGY A;  3GTJ H;  3RZO H;  5LMN Q;  4DK3 C;  3BZC A;  1LUZ A;  2Y0S E;  3H15 A;  3I4N H;  2CWA A;  2OTL A;  3TS2 A;  1NY4 A;  2EIF A;  1IBL Q;  1FVI A;  2D0O A;  4QL5 A;  3KDF B;  4BBR G;  4C3J H;  4A3K G;  2OWO A;  2WAQ E;  4KI0 A;  4IOC A;  4HID A;  1X65 A;  2AMC B;  4LF5 Q;  1OXV A;  1YEZ A;  2A8V A;  2R92 H;  2KHJ A;  1V9P A;  1XPO A;  1YJN A;  3J80 i;  3S14 H;  2VL6 A;  3DM3 A;  4AH6 A;  3BJU A;  3KF8 B;  4MZ9 A;  4EQ5 A;  4DUZ L;  3HOV G;  2K52 A;  2AHO B;  3UDF A;  2K14 A;  4IPH A;  4JYA Q;  4X6A H;  3K80 C;  4OWW B;  2Z6K C;  4BY7 G;  3FHW A;  2NVX H;  2E5L L;  2ATW A;  1AE2 A;  2FXQ A;  3ULJ A;  1I94 L;  4DV7 L;  3G48 A;  4DV5 L;  4POF A;  1OXX K;  1SMX A;  2ZJP A;  3RZD H;  2JA7 G;  2ES2 A;  3T1H Q;  3PUZ A;  1Y14 B;  1HR0 W;  4A93 H;  3CAM A;  3MXN B;  2B63 G;  4EX5 A;  1X56 A;  3CW2 C;  4HIK A;  3HOY H;  2KEN A;  4DR5 L;  4DUY Q;  5IYB H;  3M4P A;  4AQY Q;  1UE6 A;  5C3E G;  4B3T Q;  4OX9 L;  2N49 A;  5C0X I;  2E2H H;  1PH1 A;  1XMQ Q;  3CPW A;  1OXT A;  2WFW A;  3KLW A;  2D0P A;  4DV1 L;  4LF9 L;  3A5U A;  5K36 G;  3STB D;  4HJ5 A;  1WYD A;  2UUA Q;  3RN5 A;  4DV2 L;  4GOP C;  1I3Q H;  1QUQ B;  1N32 Q;  1JT8 A;  4DPG A;  1VQ7 A;  2XGT A;  4X64 Q;  4B3S Q;  3H0G H;  4A3C H;  1HZC A;  4GNX B;  3PO3 H;  1S3O A;  4YHH L;  1YJW A;  4A3F H;  1CKO A;  4JC0 A;  5HY6 A;  1R9T H;  3U4V A;  2IX1 A;  3I4N G;  5J3B A;  4JI8 Q;  2BA1 A;  1SN8 A;  3K7A H;  3CCR A;  4AYB G;  5C44 H;  2YTY A;  1X6O A;  4DR4 Q;  2MO0 A;  2WP8 J;  1A8V A;  4A4I A;  1YI2 A;  1VQK A;  3CME A;  4LF4 L;  2K5N A;  2ALY B;  2JA6 G;  1I94 Q;  1PH4 A;  4YWL A;  3F8T A;  3IRB A;  4IPC A;  1KAW A;  2WB1 G;  3I2Z A;  3KOJ A;  5M3M G;  1U5K A;  4C3I H;  1WI5 A;  2UUC L;  3GTQ H;  1MKH A;  3CCE A;  1X3G A;  4LUO A;  4YCW A;  1LYL A;  2NVY H;  3FKI G;  2QA4 A;  4JI1 L;  4YWK A;  4JI1 Q;  4HIM A;  1KC8 C;  4DV3 L;  4BA1 I;  1HR0 Q;  4JBM A;  3UE0 A;  2N78 A;  4LF8 L;  1X55 A;  4GKJ Q;  2R93 G;  3RN2 A;  5FLM G;  4GS3 A;  3K0X A;  4DAM A;  5C4X H;  2R93 H;  1YVC A;  2KHI A;  4JV5 Q;  4JI2 L;  1C9O A;  3K7U C;  4LF7 Q;  2I5H A;  3E9H A;  2JA7 H;  4A3K H;  1GM5 A;  1PFS A;  4JOI C;  4JI3 L;  4JI6 Q;  3GTO H;  2PI2 A;  5H1S E;  4R4Q A;  1FL0 A;  4Y52 H;  2HIV A;  1BBU A;  3PCO B;  4DV6 Q;  1QUQ A;  2LSS A;  2JA9 A;  4H02 A;  3L0O A;  1PHJ A;  3NEM A;  2K5H A;  1E1T A;  2ZJR A;  4B3M Q;  1QZH A;  2NZH A;  2JA6 H;  1D7Q A;  2IHE A;  2VW9 A;  3A74 A;  4JI0 L;  5LMN L;  3HOW G;  1WFQ A;  5IYC H;  1QZG A;  1SR3 A;  2KCT A;  4B3R Q;  3HKZ E;  1CSP A;  4X65 Q;  1IZ6 A;  4GLV B;  3W5O A;  1BVS A;  3E9I A;  3PO3 G;  3H0G G;  2Q2T A;  1EWI A;  2Q2H A;  1U0L A;  4DV7 Q;  4LF9 Q;  4DR7 Q;  4GKK Q;  1UE7 A;  3STB C;  4KHP L;  2R6G A;  4PZ7 A;  1FGU A;  2BH2 A;  4OX9 Q;  1TWF H;  2KCM A;  4DR3 Q;  2PMZ E;  3PUX A;  3AFQ A;  1XNQ L;  4DUY L;  1OXU A;  4XIG S;  1DGS A;  3I7F A;  3CXC A;  5AJ3 L;  1LTL A;  1SFO H;  1YHA A;  2RHS B;  5C3E H;  1K73 C;  1J5E Q;  2CKZ B;  2VS1 A;  3TEH B;  1Q8K A;  4HJ7 A;  4DV5 Q;  1OTC A;  1Q7Y C;  3OTO L;  1N9W A;  5C0X J;  2E8G A;  1EIF A;  1L1O B;  4UP7 A;  4A3J G;  3F1Z A;  2I0Q A;  5JEA G;  2I5M X;  1VS0 A;  2ID0 A;  2JEA I;  3Q8D A;  3W1G A;  3PSI A;  1VQN A;  2YV5 A;  3AQQ A;  3NEL A;  5IYC G;  1VQ4 A;  4BXX G;  4R4C A;  3KDF A;  4P74 A;  5JJL A;  5C4X G;  1NJI C;  5FLM H;  4A3M G;  5IP7 H;  4X62 Q;  4DR2 L;  2HHH L;  4WJ4 A;  1V43 A;  1KL9 A;  1TXY A;  2GN5 A;  1HNZ L;  1VQM A;  3GO5 A;  3CCV A;  1BKB A;  1VQJ A;  5FJ8 G;  2EXD A;  1IBL L;  1XNQ Q;  3PO2 G;  2Z6K A;  4DV0 Q;  1VQL A;  2JQO A;  1HJP A;  1RL2 A;  5ELO A;  1EUJ A;  2B29 A;  3ULP A;  1PH6 A;  1JB7 A;  4LF6 Q;  1XPR A;  1SE8 A;  3WWV A;  4IFD I;  4JG2 A;  4RMF A;  1Y1W H;  1HZ9 A;  1NE3 A;  3OW2 A;  1S72 A;  2JA8 G;  1M1K C;  4A3L H;  3A0J A;  5IT9 c;  3BZK A;  1PA6 A;  2IT1 A;  4JI0 Q;  1IBK Q;  1X9N A;  1CKN B;  2B3G A;  3F2C A;  1IYJ B;  4PZ6 A;  4UP8 A;  4BBS H;  2F4V L;  4R4T A;  3S1N H;  2ZM6 Q;  2UXC Q;  2OQ0 A;  4RG1 A;  1YJ9 A;  1TWG H;  3GTL H;  1UE5 A;  4A3C G;  2UXB Q;  4GN3 B;  3A5Z B;  5BR8 L;  2R7Z G;  3RLF A;  4JI6 L;  4LFA L;  4JBK A;  4JI4 Q;  1Z9F A;  4LUV A;  4OO1 G;  2IX0 A;  1MJC A;  3HOU G;  4R4I A;  3CCQ A;  4R4O A;  1N36 L;  1YZ6 A;  5IY0 A;  1HNX L;  1X54 A;  1X3F A;  3G6E A;  4GKJ L;  4YWM A;  4GLX A;  2Q2I A;  2YU9 H;  1D8L A;  4DV3 Q;  4IJH A;  1QVC A;  1PH9 A;  5M5X H;  4LF8 Q;  3TQY A;  4TVA B;  3H3V I;  3UDX A;  1N33 L;  4OXP A;  2I5L X;  3L7Z C;  1CUK A;  3PV0 A;  3HOX H;  1Q46 A;  1HNX Q;  3AYH B;  3ER0 A;  4DR6 L;  1BBW A;  1WCM H;  3ZJY C;  4L5S A;  5IP7 G;  3PIP A;  1V1Q A;  1X3E A;  1N34 L;  3PF4 A;  5JJI A;  4KLK A;  1KIX A;  3HFZ B;  4LF4 Q;  2R7D A;  4JI8 L;  1YIJ A;  1JJ2 A;  1K9M C;  1CKN A;  5GAD C;  1WJJ A;  3RLN A;  3AFP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...