4DUZQ

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u13c, bound with streptomycin
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
99
structure length
99
Chain Sequence
b'PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
total genus 18
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4duzQ00
4R4CA 4C3JH 2UUAL 1O7IA 3M4QA 3PUZA 5IP9H 2ZJQA 4YCWA 2VQEL 2LXKA 5IP9G 4DV4L 3EN2A 3GTGH 1TWAH 4B3RL 2VW9A 3PSIA 4JI0L 1D8LA 4Y7NH 1N32L 1EIYB 1W3SA 2KBNA 1RL2A 2DGYA 4IJHA 2E2JH 3GTOH 1E24A 4AYBG 5C0XJ 5DLQE 3M4OH 1FVIA 3BU2A 3CXCA 3S1RH 4POGA 1UE6A 4QJFA 3CCEA 1I5FA 1JT8A 4P71A 2UUCQ 2KHJA 4HIMA 4PZ6A 3PV0A 3KOJA 3TS0A 3J80c 4YY3Q 4LFCL 4TVAB 4HIDA 3RNUA 4LF9Q 2VUMH 3BJUA 1GO3E 3CW2C 1K83H 2BA0A 2VUMG 1OXTA 3L2PA 2JEBI 1E3PA 1YNXA 2YYZA 2YTXA 3CCQA 3G4SA 4EQ5A 1VQ4A 1K9MC 4DR5Q 2R92H 2IX0A 2PQAB 2HHHQ 3H15A 3UE0A 2R92G 1Y1VH 3B6YA 1HZAA 1Y1VG 4B3MQ 4YWLA 3F2CA 2NZOA 2UXCQ 4LF5Q 1TWHH 4NXNL 4IFDG 4R4OA 4JI7Q 4OO1G 2VY3A 3M3YH 1VQKA 3UE1A 4L5TA 1SMXA 1SRUA 2F52A 4X62Q 2OWOA 4WJ3M 1ASYA 2NN6I 3CQZH 5C4JH 1IBLL 4PG3A 4A3FH 2VNUD 4KI0A 3H3VI 2VZAA 4A3FG 4KHPL 1FGUA 2IX1A 2NVTH 4OXPA 4IO9A 1VQDA 1N32Q 1M1KC 5C3EH 1TWCH 5IE8A 3I56A 4BA2I 1DGSA 2YV5A 5C3EG 4X66Q 1SLJA 1QUQB 4A3DH 1MJCA 3PIOA 1N36Q 4K0KQ 3A74A 1N33L 2JA7H 1JMCA 3HKZG 1VCIA 4HJ8A 2NZHA 4JV5L 1Q46A 3GTJH 1I94L 3K7AH 4P74A 4JI4L 3NEMA 2N49A 1BBUA 4A3MH 1B7YB 3ZJYC 3F1ZA 4LF6L 4UPAA 5LMNL 4A3MG 1XPRA 4DR6L 1FL0A 2EIFA 5LMUL 2K4KA 1E1TA 4X6AH 2K14A 4IOCA 5JJLA 1V43A 3RLNA 1X65A 2YTYA 3K81C 1PH1A 3OTOQ 1NMGA 1C7YA 1C0AA 4DNIA 3PUXA 3AEVA 1J5EL 2N8NA 1HNXQ 1FJGL 1D7QA 4L5QA 2UUBL 3ERSX 4DV2Q 1MKHA 2JK8A 4JBWA 4BY7H 3HFZB 3F2BA 3PUVA 1RIPA 1VQEA 3CP0A 3KF6B 3PUWA 4GOPC 4BY7G 3CF5A 1X9NA 1C9OA 1VQCA 2LXJA 2RHQB 4YWMA 1WFQA 3L0OA 3HOWH 2Y0SG 1NY4A 1WYDA 1BVSA 4GLAC 1E1OA 5FLXc 2CWAA 3D31A 2IT1A 3I4NH 1JJCB 3EBEA 4O0AA 2E2IH 2OTLA 4C3IH 3M4PA 1EQRA 3I4NG 2NN6G 3H3VH 4A4IA 2NVXH 4DR4Q 4XIGS 4A3IH 4DAYB 4A75A 2A19A 4GKJL 3EIVA 3ICEA 1CKNA 4DV0Q 5GAHC 4A3IG 2UUCL 5JJIA 1XJVA 2AKWB 3GO5A 2ALYB 3NENA 4L5RC 2GVAA 4JCVE 3IRBA 4JI8Q 2YTVA 1N9WA 3AFPA 3DM3A 5C0XI 3OW2A 1HNWQ 3CCUA 3AYHB 4DUZQ 3CPWA 4LUOA 1BKBA 4QY7A 1Q12A 2RCNA 4DR5L 4YCUA 5IP7H 2HHHL 3TQYA 3U4ZA 2I5HA 5IP7G 5GAEC 4DV3Q 3E9HA 1JB7A 4DV1Q 3CC2A 3GTMH 4GOPB 1CKMA 2Y0SE 5GQOA 2QA4A 4R1JA 3JC66 3M9BA 3HOXH 3W1BA 1J5EQ 4LF5L 4JYAQ 3KF8B 5E7NA 3AQQA 3MXNB 3HOXG 1LM0A 3GTLH 4JI7L 1OXXK 5JEAJ 4IPDA 3FHWA 5M5YH 3VDYA 3TS2A 1XPUA 1VQAA 4X62L 4O2DA 4JI5L 1N8RC 4OONA 5C4XH 1S40A 4LUVA 2CKZB 5C4XG 1SFOH 1B8AA 3GTQH 4HIKA 4R4TA 4DR2Q 2QGQA 1WJJA 1YEZA 1J6QA 4DK6C 2YU9H 1YIJA 2ZTEA 4GLVB 3JAMi 2OQKA 3NBHB 3WWVA 4QL5A 3CMEA 1VQNA 2JEAI 4X66L 1YJWA 2R7ZH 4ALPA 1A62A 4AQYQ 1N36L 2D62A 4A3BH 4JC0A 3J81i 2JE6I 2R7ZG 4LFAQ 4GKJQ 3UDGA 4K0KL 4A3BG 4KLKA 3NELA 3FP9A 4A3GH 2ZM6Q 1K8AC 3S1QH 1XNRL 2MO1A 3CAMA 4A3GG 3I7FA 3STBD 1X54A 3G48A 4MNOA 1Q86C 1KC8C 1B70B 5K36G 4YHHQ 2E8GA 4C3HH 4GS3A 4JI1Q 3F2DA 2WFWA 2UXBL 5C0XG 1I3QH 3T1HQ 2V1CC 1VS0A 2EQSA 1WCMH 3M85A 3S16H 3OTOL 2PMZE 4P73A 1KIXA 1WCMG 4NB3A 3CPFA 1QZHA 1HNXL 3CCMA 4LF8Q 1L0WA 4DV2L 2D0PA 4DR1L 1PH8A 4LF7Q 2I5MX 2Z6KA 2I5LX 4JI5Q 4A3LH 3GD7A 3G71A 1HJPA 1U5KA 4A3LG 4LUZA 2B29A 3RR5A 2IY5B 1OXSC 3Q8DA 1K3RA 4DR3Q 1JJGA 1I6HH 1BBWA 3SGIA 2VQFL 4P72A 2NVQH 4DR4L 4JBJA 4EX5A 5M5WH 1VQGA 3PGZA 2Z0SA 3AFQA 3J81j 4L5SA 3A0JA 5IWAQ 4DV0L 1YHBA 4FDBA 4IPHA 2F4VQ 4DR7Q 2AWOA 2ZTCA 1PVOA 1U0LA 4JI8L 1VQPA 1HZBA 3E9IA 1XPOA 1VQIA 2KCMA 1HNWL 4AH6A 4HJ5A 1VQMA 4NXML 1XNRQ 2CWPA 4LFBQ 4DUZL 1PH5A 2HIXA 1X3GA 4JOIA 1QVCA 2E5LQ 2I0QA 3PUYA 4OWWB 1VQ6A 1KXLA 2A1AA 3RLOA 2DUDA 5AJ3Q 2UXBQ 4HJ9A 3RN2A 4BXXH 3LGJA 4UP9A 4DV3L 5GADC 4DV1L 5IT9c 1EIFA 5HY6A 1PH9A 4JI6Q 4BXXG 4DKAC 1V9PA 4JYAL 4P75A 3U50C 5ELOA 2RF4A 2QEXA 1IZ6A 3J7A5 3K7UC 4HIOA 1YBYA 2C35B 4DR1Q 1HR0Q 1Q82C 4JG2A 3KJOA 3GTKH 3U4VA 1X55A 4YCVA 1W2BA 1XNQQ 1TXYA 3UDIA 2B63H 3HOUH 1SR3A 1HZCA 3K8AA 3HOUG 2B63G 3TRZA 5FJ8H 2KCTA 1AH9A 5H1SE 1ASZA 2F3IA 3S2HH 2FXQA 2OCEA 1NE3A 5FJ8G 5M3FH 4DR2L 3CCLA 2Q2TA 1GM5A 5M3FG 4GN3B 1S72A 5IY0A 3CC4A 2UXDQ 1A63A 2MQHA 1KAWA 2VQFQ 1IBKQ 2KHIA 2BH2A 1SN8A 4AQYL 1HR0W 1Q7YC 3S17H 4LFAL 3K0XA 2MFIA 2ATWA 2RHSB 4GNXA 4GKKQ 1HH2P 2Q2HA 2ZM6L 2Q2IA 4NXMQ 5BR8Q 4A93H 2ES2A 3PCOB 3A5ZB 1YZ6A 4A93G 2WB1G 3JAMc 4YHHL 4AIMA 4BA1I 2R6GA 3BZKA 3W5OA 1OXUA 1IBMQ 1CKNB 4JI1L 4ME3A 3CMAA 3K80C 5GROA 4X65Q 2BH8A 4PMWA 3J81c 3T1HL 4IPGA 2E2HH 5EAYA 4BBSH 4LW1A 3PIPA 3TEHB 4BBSG 1VQHA 2HT1A 1A0IA 1YVCA 3MEFA 1OTCA 1Q1EA 1VQ8A 4LF8L 1S3OA 3L7ZC 4R4QA 1HNZQ 2D0OA 1PH6A 1AE3A 3BZCA 4DV6Q 4LF7L 4BY1H 2K5NA 1YJNA 1X56A 4POFA 5C44H 1N34Q 3T1YQ 4BY1G 1PH3A 1KRTA 5C44G 3CD6A 2AMCB 4WJ4A 4DV7Q 4OX9Q 1E22A 2NVYH 2JA5G 2ZJPA 4DR3L 5ELNA 2JA6H 3FKIH 2JA6G 4HJ7A 3HKSA 3FKIG 4UP8A 2WB1E 1UE1A 4LNQA 5IWAL 1QZGA 5JEAG 4IOAA 4KHZA 2F4VL 1CKOA 4UY8C 2K52A 4DR7L 4OWTB 4X64Q 2JQOA 2OQ0A 2WAQG 3STBC 2KENA 1EUJA 2K50A 3G6EA 2Z6KC 1Q8KA 1EWIA 2IHEA 4LFBL 5FLMH 4DUYQ 1PYSB 2E5LL 1XTDA 1PYBA 1VQFA 5FLMG 4BBRH 4OWXB 1IXRA 3I2ZA 4JBKA 1PH4A 4BBRG 5AJ3L 1EFWA 1P8LA 4DV5L 4QQBX 2XTIA 1CUKA 2JJQA 1T9HA 1X3EA 2BA1A 4JI6L 1KD1C 4B3TQ 1VQOA 3KYHC 1L1OA 1X3FA 2A8VA 5IYDH 4HJAA 2XGTA 3RN5A 2VS1A 4LF4Q 1Y14B 2PQAA 1EOVA 5IYDG 2H5XA 3HOVH 2K75A 1VQ5A 4IFDJ 2WP8J 1HR0L 3HOYH 3HOVG 4UP7A 1XNQL 3S1MH 3HOYG 3RZOH 2EXDA 4DK3C 2UU9Q 4JI3Q 3GTPH 1M90C 2HQLA 1PH7A 4A3KH 3H0GH 2VL6A 4JOIC 4PZ7A 1L1OB 1XMQQ 3PF4A 1XMOQ 4A3KG 3H0GG 1LTLA 4RG1A 1QVGA 2WAQE 1NTGA 4LWCA 1SE8A 3OYYA 1EQQA 4JBMA 5HGQA 4GN5A 2UXDL 3S1NH 3S2DH 1IBKL 4QIWE 3UDXA 4MTNA 3KJPA 1Y1WH 1VQJA 1H95A 1NMFA 1NBWA 3A5UA 1OXVA 1Y1WG 5J3BA 3RZDH 4B3SL 4GKKL 1K8GA 1VQ9A 4AYBE 2UUAQ 1QUQA 5GAGC 1LYLA 1I50H 5BR8L 4J15A 2VQEQ 1Q1BA 4DV4Q 4A3EH 2B3GA 2GN5A 4IPCA 3J80i 3PF5A 4A3EG 4B3RQ 4GLXA 1A8VA 1TWGH 5IYBH 1TWFH 1X6OA 1IBML 1V1QA 4JI0Q 3I4MH 2PI2A 5IYBG 3KDFA 4X65L 4DV5Q 3I4MG 1YHQA 4XTCS 3UDFA 1EYGA 2K5HA 1G291 5JJKA 2PNHA 3F8TA 2UXCL 1PFSA 3S15H 2ID0A 4A3DG 4C2MH 1GVPA 1VQBA 1WI5A 3CCRA 4DAMA 4GNXC 5IYCH 2JA7G 3ULJA 3RLFA 1HNZL 2N3SA 5IYCG 2GVBA 4DV6L 2R93H 3KDFB 4A3CH 2PI2E 4LFCQ 1KHIA 1N34L 2N78A 2R93G 4MZ9A 3ULPA 1KL9A 3T1YL 4A3CG 3HOZH 4DV7L 1JJ2A 4OX9L 1GKHA 1K0RA 4APVA 3HOZG 2MNAA 1PV4A 4JI2L 4R4IA 3J7ZC 2R7DA 3KF6A 1QVFA 3S24A 1GD7A 4A3JH 1UE7A 3I4OA 1K73C 2R7FA 4A3JG 1CSQA 1YHAA 1E7ZA 1KQSA 3KFUA 4NXNQ 3DLLA 3PO2H 3KLWA 3CC7A 1VQ7A 4B3SQ 1IYJB 3PO2G 4X64L 4RMFA 1PH2A 4DPGA 1YI2A 4Y52H 1UEBA 3CCVA 1IBLQ 4IJLA 3TREA 2CFMA 1PA6A 1NJIC 1G6PA 4H02A 1JE5A 4DUYL 2JA8H 4KHPQ 5M5XH 2Q2UA 3HKZE 3CCSA 1R9TH 4YWKA 2IHFA 2JA8G 1LUZA 2MO0A 3ULLA 3HOWG 3S14H 3E0EA 4A76A 1MIUA 1HZ9A 4GNXB 4NPSA 1VQLA 1Q81C 5M3MH 1MJEA 2AWNA 2HIVA 1L2FA 3GDEA 5M3MG 2ZJRA 4B3TL 1Z47A 1N33Q 4LF4L 3M7NA 2OTJA 1UWVA 1Z9FA 4PZ8A 4JV5Q 2LSSA 3ER0A 1I94Q 4GOPA 1PHJA 4JI4Q 4YY3L 1P16A 4JI3L 1YITA 2UU9L 2JA9A 4LF9L 1G51A 3W1GA 3PO3H 4LF6Q 3PO3G 5LMNQ 3U58A 1YJ9A 5LMUQ 1XMQL 4DR6Q 4IFDI 1WOCA 2JA5H 1XMOL 4JI2Q 1CSPA 2CQOA 4OO1I 4GN4B 4TQUS 3I55A 1KRSA 1AE2A 2K5VA 1IL2A 3D0FA 4B3ML 2ZTDA 1L1OC 1FJGQ 2AHOB 4QGUA 2UUBQ 2ASBA 2CCZA 1UE5A 2L15A 1SROA 3CCJA 5LMNW
chains in the Genus database with same CATH superfamily
1U4LA 2UUAL 3BDCA 2VQEL 3BDLA 2LXKA 5CC4A 5IP9G 1BQQT 3EN2A 2Q8TA 1M4VA 3PSIA 1EIYB 2P5ZX 5KNCA 5C44B 5C0XJ 4AYBG 4OIKA 1F9QA 2PO4A 4QJFA 2UUCQ 1D5XC 3PV0A 5ELEA 1JWSD 2JA6B 5CV9A 1ET9A 3TS0A 4LFCL 4LF9Q 4NDXA 1SEBD 3BZDB 1K83H 1E3PA 1YNXA 4KTAA 4O1NA 3LWEA 4FP5D 1VQ4A 3TP6A 1K9MC 4DR5Q 2IX0A 3R93A 1F2LA 3H15A 3W3AA 2J7ZA 1HZAA 2EY6A 4XT1B 2UXCQ 4GZYC 4IFDH 4LF5Q 1C8CA 1ZYRC 2VY3A 3K0YA 1SRUA 2F52A 4WJ3M 4A3FH 3H3VI 1J9OA 4KHPL 5JPNC 2M2LA 1QOHA 3A8JE 1VQDA 1N32Q 4FF4A 5IE8A 2BE5C 2KVMA 5CR3A 2NYZD 4A3DH 4A3KB 4K0KQ 3A55A 2JA7H 4JV5L 1V1PB 1Y1VB 2NZHA 1Y8OB 1I94L 3S1NB 3BVGA 4P74A 3NEMA 1MSGA 1TKWB 1B7YB 3ZJYC 3F1ZA 4A3MG 5JVH3 5LMUL 3M3YB 2B2UA 3RZDB 4TKOB 1Y69U 2F0KA 5E4WC 5JJLA 1V43A 2B2VA 3CQZB 1CA6A 1NMGA 4DNIA 1D7QA 3BVMA 2G9HD 4J8QA 1LACA 1FJGL 2UUBL 4R8IA 1SNDA 3ERSX 2CW0D 1H9SA 1QB5D 3JAME 3F2BA 1LABA 3KF6B 1DONA 1WTXA 2C9OA 1WTOA 1C9OA 1VQCA 5KNDA 3J81E 1WFQA 3HOWH 2LMCB 3HKZB 3A54A 3RMHA 3GTJB 2HCIA 2R93B 1JJCB 3EBEA 4DR4Q 2NVXH 2F0MA 4C3IG 4XIGS 3KLRA 4DU9A 4GKJL 1CKNA 4EQNA 4L5RC 2GVAA 2YTVA 1H9MA 1N9WA 5KRUA 4CDEC 5BN3A 5CMDA 1Q3LA 2F1MA 2EZVA 1Q12A 2RCNA 3Q0AA 3TQYA 5GAEC 1JB7A 1YNJD 3CC2A 3GTMH 3JAML 3JC66 2JA8B 3HOXH 3W1BA 3KF8B 5C3WA 3J81L 5M5YH 3FHWA 3VDYA 1KDCA 4X62L 5EPLA 4LUVA 4DK1A 1SFOH 2EYPA 2EJFC 5EBDA 1VMCA 4U68A 2YU9H 3DWAA 4GLVB 3JAMi 2DJGC 4ZKBB 3TP5A 1YJWA 4TRDA 1A62A 1N36L 3J81i 2R7ZG 2JE6I 3DUZA 4LFAQ 2PCFB 4KLKA 5I4DA 3BYYB 1U4MA 3KBXA 4I65A 1LT4D 4A3GG 3I7FA 2IPKD 3IFTA 4FXDA 3C1EA 4JI1Q 5C0XH 4C3HG 3KK7A 2AQ1B 3R3OA 1BXTA 1WCMH 4I7ZC 3M85A 3NBIA 5E3FA 3CPFA 4CDCC 1HNXL 3VA7A 1ENFA 4LF8Q 1PH8A 4PQXA 1BBXC 1JORA 2I5LX 4K2LA 3GD7A 4KY7A 3G71A 3IL8A 1EWCA 1OXSC 4IQZA 4KY6A 1I6HH 5IODA 3S1QB 3SGIA 4IUPA 2VQFL 1K83B 4JBJA 3J81j 5M5WH 1ENAA 2Z0SA 1TIID 5CGKA 2AQ2B 1PDQA 5IWAQ 4DV0L 2LKVA 4IPHA 4NW2A 4Z9CB 1XPOA 2F0LA 3E9IA 2KCMA 1XNRQ 4NXML 1F9SA 2CWPA 5EBCA 1FYCA 5FK9C 1X3GA 4N9TA 3RLOA 2DUDA 3RN2A 4A3FB 4DV1L 1EIFA 3F2UA 1V9PA 2RVLA 2CW0C 2BDNA 4HTHA 3J7A5 3ND9A 2XNAC 4H7BA 4DR1Q 2ZXOA 2KCNA 4XQJA 2NVQB 4KJNA 3HOUH 1SR3A 2B63G 5FJ8H 2B39A 1ASZA 2F3IA 2OCEA 4JPBW 1T5XD 1A3TA 1GM5A 1S72A 5IY0A 1GUSA 3EFXD 3D4RA 1SN8A 5ELDA 2BH2A 4AQYL 1GHKA 2EYFA 2OT2A 4HCSA 2ATWA 2RHSB 4ILWA 1HH2P 2Q2HA 1HFGA 2ZM6L 2A6EC 2L55A 2K01A 4CGYB 3PCOB 4A93G 1BUVT 1STGA 1NR2A 4AIMA 1EY5A 1IW7D 4M8AA 2QCPX 1SYEA 3K80C 4X65Q 4U673 4IPGA 2E2HH 4UHVA 5EAYA 1HQRD 3PIPA 1VQHA 3BS1A 5M3FB 1JOOA 1X32A 4K6DA 4R4QA 3L7ZC 1D6EC 4IUNA 1PH6A 1AE3A 2MHVA 2NVXB 3MA2B 1YJNA 1Q90A 2XN9C 3RD4A 2K1BA 4BY1G 3SE0A 1KRTA 3CD6A 4WJ4A 3O13A 1RJTA 3Q6SA 2A68D 4FNFA 2F0HA 2B2WA 2SOBA 1AP0A 3EA6A 1KNEA 1NR4A 3FRPB 3MC0B 1AFPA 2K6AA 3FKIG 4UP8A 2WB1E 3VR3A 4LNQA 2NTTA 2RSNA 2B2YC 2SNSA 3X3MA 2F4VL 4FF3A 4NMZA 3NE5B 1EZ8A 4MN3A 4RFBA 2O2LD 3HOXB 1QWYA 1JE4A 4DUYQ 4XYOA 2E5LL 1PYBA 1VQFA 1AZQA 5M5YB 3HEJA 3I2ZA 5AJ3L 4QQBX 2N55A 1X3EA 1V1OA 1SFOB 1L1OA 1X3FA 1C4QA 2F0VA 2YU9B 1BNZA 1HR0L 2EYJA 5EGTA 3SDZA 1PFMA 3HOYG 3RZOH 4WFN3 4DK3C 2UU9Q 4JI3Q 2EY2A 1M90C 2HQLA 3SVMA 4JOIC 3PF4A 1L1OB 2Z9HA 1U9RA 4RG1A 2WAQE 1CA5A 4GN5A 2UXDL 5DNFA 1IBKL 5G3LD 1VQJA 4QCLA 3A5UA 1Y1WG 4RCNA 1K8GA 4AYBE 2UUAQ 1WCMB 1I50H 5BR8L 2VQEQ 1D1IA 4QUCA 4LK1C 4A3EH 1GHJA 2B3GA 2A5HA 2PZWA 3SXHA 1TWFH 1X6OA 1V1QA 1A2TA 2SEBD 3AB9A 5FO8B 1EYGA 2F0DA 4IUUA 4UAIA 5JJKA 1BCPF 1DOKA 3H0GB 3MTSA 4A3DG 1SBBB 3P75A 1ESFA 1GVPA 3CCRA 1I6HB 2JA7G 1SNCA 1U4RA 2J4XA 3RLFA 1CK1A 3S2DB 2H1EA 1JQYD 4LFCQ 5M5WB 3T1YL 1K3BC 1KL9A 4A3CG 1GKHA 2K7VA 5IGDA 1QJOA 3HOZG 1SJED 3I70A 1QVFA 2PW7A 3N52A 2R7FA 1S4ZA 3C2PA 1SYFA 2J0TD 3KLWA 3NWSA 3PO2H 3FEWX 2B2TC 4X64L 1SMYD 1PH2A 4DPGA 1UUPA 4S3SA 1S5BD 1WTRA 1NJIC 1IW7C 1BCPC 1QNKA 4KHPQ 4EQOA 3D6CA 2Q2UA 3HOWG 2MO0A 4OL7A 3HOUB 3MXUA 1VQLA 5M3MH 2A6HD 2DN8A 2F0PA 4B3TL 1LO5D 1ESRA 4JV5Q 1I94Q 3OMGA 1YITA 4MTKA 3MXNA 4N9PA 5JOBA 1I4XA 5LMUQ 1YJ9A 1X3QA 4OELB 4JI2Q 2CQOA 4OO1I 4GN4B 3TN2A 3I55A 3MHBA 1KRSA 2K5VA 2HUGA 2WB1B 4K5WA 3DHQA 1FJGQ 2AHOB 2UUBQ 1I6VC 1V8QA 1PTOH 1HPCA 1SROA 2X69A 1JOKA 2E2HB 5LMNW 4R4CA 4C3JH 4YCWA 1D8LA 1RODA 1LTAD 3C3LA 2DGYA 2FFKB 4IJHA 3GTOH 2MPMA 3M4OH 1F77A 1FVIA 3BU2A 3CXCA 1UE6A 3CCEA 1I5FA 3GP7A 1NAPA 1K8OA 2KHJA 1PXUA 3KOJA 1KTKA 1Y8PB 1SAPA 3J80c 2D9UA 4YY3Q 3RNUA 1GO3E 3CW2C 4PNYA 2VUMG 2A73B 2JEBI 1HA6A 2AQ3B 2WAQB 4EQ5A 2R92H 1JB3A 4WORA 1Y1VH 2K5WA 1F9PA 3NTKA 4B3MQ 4E6IA 4NXNL 4L8JA 4OO1G 2L11A 4Y7NB 3M3YH 3UE1A 5FKAC 4AYBB 3FVQA 4HSVA 4X62Q 3CQZH 2VNUD 3S1RB 2VZAA 1KDAA 5IT9E 4LMQD 4ZYSA 3RZOB 1TWCH 1D1KA 4RA8A 4BA2I 2QDBA 2YV5A 5C3EG 2DJFC 1SLJA 1QUQB 1CZWA 1N36Q 1WTHA 3BDOA 4G7HC 3A74A 1FD7D 3CRLC 3WDNA 2B8FA 4QF4A 3E0JA 1Q46A 3GTJH 4JI4L 3DEPA 2N49A 2JP1A 4LF6L 3D4WA 2FMCA 4X3KA 1FL0A 3K57A 4IUQA 1ZEQX 1E1TA 4X6AH 2K14A 3K5MA 2K33A 1I50B 3SK6A 4A3EB 3PUXA 3AEVA 1SNOA 3OIQA 1HNXQ 4DAPA 1TWFB 2RKSA 3HFZB 3OW7A 1JR0D 1VQEA 5IT9L 4BY7G 1HTLD 5E4XA 5BN4A 3CF5A 2MGSA 1RTOA 1PTOF 3L0OA 2EY1A 1BVSA 1XXGA 2CWAA 3DM1A 2A6HC 2NN6H 3K7AB 4O0AA 3D8GA 5ELBA 2OEOA 3T16A 3I4NG 3VR6A 2EVBA 4A3IH 1TVXA 3ICEA 4DV0Q 5JJIA 2AKWB 3NENA 4XXEA 4HAEA 3IRBA 1JCKB 2PPBC 1OO9B 3AYHB 3UI2A 2MUYA 1Q8IA 3PO2B 1RDPD 2N88A 1BKBA 4LUOA 5IOCA 3X3NA 5IP7H 4XQNA 2HHHL 1A3VA 2IWHA 4DV1Q 2EPBA 1CKMA 2Y0SE 4DFAA 4R1JA 3M9BA 1S5FD 1PTOC 1J5EQ 5E7NA 3AQQA 3C1FA 3GTLH 1F2YA 4JI7L 4B9XA 4IPDA 3TS2A 5M3MB 1VQAA 2EYOA 5KIXA 4X3TA 4OONA 5C4XH 2CKZB 5JJZA 5JVG3 1B8AA 1MGSA 2QGQA 1WJJA 3FMCA 1J6QA 4DK6C 1KAAA 5JPMC 3CHBD 1VQNA 3MFGA 4X66L 4ALPA 1F2ZA 4AQYQ 2D62A 2X6GA 5KYLA 4A3BG 3VYRA 1HCZA 3MXGA 3NELA 1NSNS 4F87A 2ZM6Q 2FHTA 1K8AC 2DNCA 2KEEA 3S1QH 1DYQA 3CAMA 2TSSA 1KC8C 1Q86C 1DCZA 1WD0A 1PTOB 1QG7A 2O4XA 3MXPA 2WFWA 2UXBL 4C3JB 2K32A 2V1CC 2F0FA 1VS0A 3NTIA 3OTOL 1KIXA 2A69C 5FOBB 3T56B 3ZYYX 1UNSA 3CCMA 2TMPA 2D0PA 2XSCA 2XVSA 3EVQA 3GTOB 4JI5Q 3M4OB 2O5JC 5KEEA 1U5KA 4A3LG 3RR5A 1K8MA 2B2UC 4FVMA 3HGBA 4R8NA 2B2VC 2D2CC 4ODGA 1B44D 2NVQH 1BOSA 1VQGA 1EY9A 4FDBA 5CORA 4K6LA 2F4VQ 2R92B 2AWOA 2M9VA 4JI8L 1YNND 1HZBA 1HNWL 4AH6A 2HD3A 4HJ5A 1VQMA 4DUZL 1LTSD 2HIXA 2E5LQ 2EYLA 3I73A 1VQ6A 4OWWB 3QOLA 2XRSD 5AJ3Q 1KLGD 4HJ9A 1GUWA 4BXXH 4UP9A 4YIJA 4DKAC 4P75A 4HEDA 3U50C 5BN5A 2QEXA 4HIOA 1R4QB 3URYA 1HR0Q 5J22A 1TWCB 4YCVA 3BG3A 5I6YA 1ILQA 5C6AA 2KOLA 5H1SE 3S2HH 2FXQA 5M3FH 1NE3A 4DR2L 1EZ6A 4ZQ3A 3CC4A 2UXDQ 1H9SB 1EYDA 2MQHA 2R61A 1A63A 1IBKQ 1SYBA 4BS9A 1Q7YC 3S17H 3K0XA 4FXGC 4FF2A 2K5QA 2FINB 4GNXA 2KHSA 2CVRA 5BR8Q 4C56C 3A5ZB 3V05A 1GJXA 1WTQA 3JAMc 4HN7A 4KN7C 3TDQA 3W5OA 1OXUA 1CKNB 4ME3A 3CMAA 1EU4A 3A8IE 2BH8A 3J81c 2B63B 2Y0SB 4LW1A 4RGTA 1TY2A 4BBSG 2KEDA 3MEFA 2QEJC 1Q1EA 5C4ZA 1VQ8A 3K5LA 3BZCA 3NXWA 3OPOA 2K5NA 5I2XA 3CRKC 4XYQA 3T1YQ 4A3IB 1PH3A 4ZCKA 5C44G 2ICEC 3V2TA 4WRDA 2NVYH 3MEHA 2R3ZA 4DR3L 5ELNA 2WKCA 4F8MA 4FYDA 2JA6G 4KKTA 3IAYA 2F3VA 4HJ7A 1PLFA 5M9OA 1GOZA 1TQOA 1EY8A 5JEAG 4OWTB 4X3SA 2F3WA 4X64Q 2K50A 2I46A 1PZJD 1PYSB 3GTLB 5FLMG 4BBRH 3NTHA 1IXRA 3E5SA 1PH4A 1P8LA 4DV5L 2XTIA 1CUKA 5C4XB 1CHQD 2BA1A 2A8VA 4B3TQ 3KYHC 5IYDH 2VS1A 1Y14B 2PQAA 5IGBA 1PFBA 3HOVH 1K28A 2XWJB 3FKIB 4UP7A 1XNQL 3S1MH 5I2YA 3FPPA 3GTPH 4RKBA 2L12A 1PH7A 3H0GH 2VL6A 4A3KG 2NB0A 5TSSA 1EQQA 1LTRD 5HGQA 3S2DH 3UDXA 2NZ1D 4IN3A 4RAUC 5C3XA 2NUCA 4GKKL 3C46A 2CH4A 1Y8NB 2CHBD 1LYLA 2K28A 1LT5D 2GN5A 4N8X1 5J1ZA 5FO7B 4GLXA 4K8JA 5IYBH 1AW7A 1IBML 2OXPA 3A8KE 3I4MH 3UDFA 3DWQA 3NPPA 1I4HA 1WI5A 4C2MH 1G2SA 4DAMA 5IYCG 2GVBA 1ENCA 1JWUD 1MD2D 2HDMA 5LL6X 2C5CA 1KHIA 2N78A 2R93G 4MZ9A 3ULPA 1JJ2A 4OX9L 1K0RA 4APVA 1UEAB 3HZXA 5FO9B 3I72A 1IYVA 4A3JH 1UE7A 3I4OA 3KFUA 2FJ2A 4NXNQ 3DLLA 3CC7A 4B3SQ 1O7ZA 1LTGD 1YI2A 4H13C 4BWGB 4PMCA 1UEBA 2PQEA 4DAYA 2CFMA 3S15B 2DNEA 1G6PA 1JE5A 3CKIB 2MJ8A 5M5XH 1SJHD 3CCSA 2SNMA 2IHFA 2JA8G 1LUZA 2B2WC 3S14H 3R2TA 3E0EA 1YNJC 1MIUA 4HMIA 2EE1A 1Q81C 1D5MC 2K03A 1L2FA 3GDEA 1Z47A 4RHRA 3S2HB 4LF4L 5FLXL 3M7NA 4PZ8A 2LSSA 1ZKOA 5LHY1 4GOPA 4JI4Q 4DXFA 2PZTA 4LF9L 3PO3H 3QWNA 3S17B 4LF6Q 4G4KA 1LV9A 4F7XA 3U58A 1XMQL 3SK5A 4IFDI 1WOCA 1XMOL 4CJ2C 4TQUS 5T1GA 1FR3A 1STYA 1O7YA 1L1OC 3PMFA 1PRTD 1UE5A 2L15A 3IFDA 3CCJA 3NBHA 1TS2A 3M4QA 5IP9H 4CKEA 1RD9D 2VXWA 4DXGA 1ML0D 2WIIB 2F0IA 4DAVA 3K59A 3U9SA 4Y7NH 1N32L 4P2CB 1L0YB 1W3SA 2KBNA 1RL2A 2F0OA 4RH6A 1E24A 1I4RA 3SEBA 5DLQE 4DF7A 2RDHA 3S1RH 4POGA 2JA5B 2NVYB 3V96A 3VYUA 4HIMA 3L3OC 4PZ6A 4ZK9B 1EY4A 1XYIA 4IUTA 2BA0A 3QIAA 2YTXA 1QILA 3CCQA 2L0CA 2HHHQ 3UE0A 1SNPA 3B6YA 4YWLA 3F2CA 2B2YA 3VA5A 4IFDG 1CT1D 4BBRB 1CQVA 4JI7Q 4G7OC 2L5TA 1SMXA 2MP1A 3W2DA 1Z6HA 1HQMC 3D3RA 2OWOA 2RDFA 1IBLL 1E2VA 3BVZA 3Q24A 4KI0A 2F4IA 4A3FG 1FGUA 2KQ3A 4G7ZC 3HOVB 4OXPA 4IO9A 1M1KC 5IIFA 3S1MB 3I56A 1DGSA 3GTPB 1TS5A 4X66Q 4CKCA 3PIOA 1NUCA 3NK9A 1EYCA 4F88A 4OEMB 1JMCA 5CYUA 3PIP3 1U4PA 3K7AH 4H44C 4KJOA 4A3MH 2IW3A 4DA2A 4UPAA 1XPRA 4FF1A 2EIFA 3NHHA 3TP7A 1STAA 2XIWA 5C4JB 3K81C 1PH1A 3OTOQ 1KABA 1G8ZD 2N8NA 3LX0A 4L5QA 1F2MA 1SXTA 1H9KA 3I4MB 4RHSA 3TBIB 1C48A 1SYDA 1PFNA 1T5EA 4KD3A 3PUVA 3CP0A 3PUWA 4K5VA 1I4QA 1X9NA 1HFNA 4YWMA 4ABNA 1S5CD 4C2MB 1WYDA 5CBEE 4H0LC 1E1OA 1LTID 3D31A 1EY6A 2IT1A 2OTLA 4C3IH 1EQRA 4DNTB 4A4IA 3H3VH 2O5IC 1VF7A 1J8IA 4A75A 2A19A 3ITPA 3EIVA 5GAHC 2ALYB 5EKLA 4KKUA 1SYCA 4JI8Q 5C0XI 1HNWQ 3T53B 4A3JB 3CCUA 1KDBA 3HP3A 3P1HA 2A68C 2SDFA 5J39A 4DUZQ 3HG9A 3CPWA 5C4HA 2HQEA 3I90A 4QY7A 4YCUA 3RUZA 3U4ZA 5HURA 1TR5A 3E9HA 2QA4A 1GUNA 4J1MA 5M5XB 3MXNB 1W6KA 3HOXG 3S14B 1GUGA 2E74C 2JXMB 5G3LF 4O2DA 3A56A 1ZXTA 2F0WA 4HCEA 1WTPA 4JK1C 5C5MA 1QE6A 4DR2Q 2KECA 2ZTEA 2OQKA 2WV6D 4QL5A 3PO3B 2JEAI 2R7ZH 4KHVA 4GKJQ 4XT3B 4JC0A 1B53A 4OIJA 3I8ZA 3FP9A 4A3GH 1KNAA 1B1ZA 3PIO3 1XNRL 1LTTD 1PRTB 4MNOA 1B70B 4HMJA 1W6JA 4C3HH 4GS3A 3F2DA 4PV1C 3MVVA 5C0XG 2EQSA 5CV4A 4CHTB 3S16H 2PMZE 1WCMG 2Z8LA 4ID6A 3GTQB 3K5NA 4CDDC 1E0BA 4DV2L 4DR1L 3QB3A 1WTVA 2Z6KA 4A3BB 2B8GA 3FPUB 4LUZA 2B29A 2IY5B 2RBMA 3Q8DA 4DR3Q 1LTBD 4P72A 2H4OA 4EX5A 4L5SA 3PGZA 1TY0A 1ICFB 1CI3M 5IGEA 1I3QB 1ZYRD 3OIPA 1B9MA 1WTWA 3PUYA 1KXLA 2L1BA 2A1AA 2XRQD 2M00A 1HRJA 3LGJA 4DV3L 5IT9c 4EGVA 2BE5D 4JYAL 4K5XA 5ELOA 1WVLA 1SYGA 1SMYC 1F9RA 2DY7A 2L4NA 1Q82C 4JG2A 3U4VA 1XNQQ 3UDIA 1RCVD 2B63H 1HZCA 3HOUG 3NUCA 3TRZA 1AH9A 3IKJA 5FJ8G 1LLRD 3H3VC 3PQIA 2VQFQ 1KAWA 4A3MB 2KHIA 4ZUIA 1LT6D 1HR0W 2NBFA 4K2KA 4QB4A 1WD1A 4GKKQ 5A35A 2E2DC 2Q2IA 5EPKA 4NXMQ 1B50A 4A93H 1YZ6A 2WB1G 4YHHL 2R6GA 1IBMQ 2PNRC 3GTKB 3T4AC 2KCCA 5DEHA 4PMWA 4XDXA 3T1HL 1EWHA 1VDZA 2QW7A 4L6TB 1AN8A 3G6JB 3TEHB 1BR9A 1H9RA 1YVCA 1ICWA 1S3OA 1AZPA 2D0OA 4LF7L 2K5DA 4C3IB 2RCFA 4BY1H 2OF1A 5JAVA 1X56A 4G57A 4OX9Q 1A3UA 2EJGC 1AEXA 3J7AV 4QUFA 2ZJPA 3FKIH 3ONAB 5ISRA 2RQXA 5HGTA 3QG1A 1GUTA 1KLUD 3OMCA 1QZGA 4IOAA 1QNUA 4UY8C 5COYA 2K52A 4DR7L 5K5PA 2JQOA 2OQ0A 2WAQG 2KENA 2E75C 2G9DA 3AU7A 1EWIA 3EQLC 2IHEA 4LJZC 2F03A 1H9JA 5K36H 3NQTA 1BO0A 4LFBL 3NSWA 4OWXB 1HHVA 2FMMA 1EFWA 5D14A 2JJQA 4B9WA 2PMZB 4LAAA 4JI6L 1KD1C 2PZUA 2WINB 2Z1CA 3OWFA 4LF4Q 1EOVA 2H5XA 3I3CA 1TU2B 4DNRB 3HOYH 3SK4A 4MHEA 2EXDA 1QCBD 2R7ZB 3OHXC 1RTNA 2QKIC 1ONLA 4PZ7A 1XMQQ 1STNA 1XMOQ 1QVGA 1LTLA 4IURA 1EL0A 1NTGA 4LWCA 4A3GB 4QIWE 1M8AA 4MTNA 1FNVA 2ICIA 1B4OA 2I07B 3KJPA 1Y1WH 4C3HB 1H95A 1NMFA 2JYOA 5J3BA 1A2UA 1VQ9A 4K14A 5GAGC 3S16B 3TSSA 1Q1BA 4IPCA 3PF5A 4A3EG 1V1PA 1TWGH 3KUPA 1EY7A 2PI2A 3K6OA 3KDFA 1YHQA 3OSOA 2K5HA 1G291 1BF4A 3S15H 2ID0A 4IALA 2XWBB 3TZDA 4GNXC 1HNZL 4DV6L 3KDFB 1X3PA 4A3CH 4CJ1B 2Q8IB 1N34L 3MWYW 3HOZH 4DV7L 1A6XA 5D65A 1DXMA 2MNAA 3VYSA 4JI2L 4R4IA 3KF6A 1GD7A 1K0SA 1CSQA 2NTSA 1O7LA 5IGCA 1VQ7A 1IYJB 3PO2G 4ZLTF 2KUMA 3QO2A 1IBLQ 3I4LA 1PA6A 3Q23A 3GV3A 5I9OA 1R9TH 3P20A 1HZ9A 4GNXB 4NPSA 1MJEA 3ERQA 2AWNA 2Z4IA 5M3MG 5CBAE 4OGQC 1IHZA 4V190 1E2ZA 3R8BA 1Z9FA 1CTMA 2EDGA 3ER0A 1PHJA 5EPJA 2IX3A 4YY3L 2RSOA 2JA9A 3KF8A 3ND8A 3W1GA 2A6ED 4Q0FA 1RHPA 1STBA 4CKBA 2JA5H 3J7YW 3H6MA 4A93B 3DMUA 1JC7A 2EJMA 1IL2A 4B3ML 3LNNA 2ZTDA 5L37A 3H09A 4QGUA 4C1NK 5DM63 4FXKC 1CHPD 2BOSA 2ZJQA 1O7IA 3PUZA 4C3JG 1I4GA 2HCCA 4DV4L 3GTGH 1TWAH 4B3RL 2VW9A 4JI0L 2DY8A 4BY1B 2F0GA 2E2JH 4RCOA 3NWTA 3VR5A 1JT8A 5CV5A 4P71A 2WKDA 3DWPA 4KN4C 1FGBD 2HDLA 4TVAB 4HIDA 2VUMH 3BJUA 4Q5VA 3H94A 1TS3A 1OXTA 3L2PA 2YYZA 2NWGA 2F0EA 3G4SA 1I4PA 2E76C 1SSOA 2PQAB 2R92G 5EQ0A 4RGNA 2LS01 4QIWB 1Y1VG 4KD4A 2NZOA 1TWHH 5EJWA 4OO1H 1YNNC 4R4OA 3T13A 1VQKA 4L5TA 2KA7A 3R2IA 4NP5A 1E2WA 3KBGA 1JOQA 5CV6A 1ASYA 2NN6I 5C4JH 4PG3A 3LWUA 5EKKA 2IX1A 2NVTH 3H91A 3HOYB 4N8FA 1IKMA 5C3EH 4L63B 3TP8A 1MJCA 4IZ8A 1UAPA 1N33L 1CM9A 3HKZG 1VCIA 4HJ8A 1EEID 1JWMD 1NCVA 2VB3X 4C1NI 3CU7A 5FLXE 1BBUA 1Y1WB 5LMNL 4DR6L 2F0JA 1G2TA 2K04A 2K4KA 4X3UA 4IOCA 3RLNA 3NP8A 4M1UB 1X65A 2YTYA 2Q8RE 1C7YA 1C0AA 5C5LA 1BDOA 2EYMA 4EQPA 1J5EL 1TS4A 1TWGB 1EQTA 4DV2Q 1MKHA 4RKLA 2JK8A 1A15A 4ZRZA 4JBWA 4BY7H 1IL8A 1RIPA 4GOPC 4A3DB 2F0QA 2LXJA 2RHQB 5A2QE 1SE4A 3DXJC 2JA7B 1NY4A 2Y0SG 5I9PA 4GLAC 1DM0B 5FLXc 4ZKCB 3I4NH 2E2IH 2Z4HA 1B3QA 3M4PA 4JVZA 2NN6G 1PZKD 3HOZB 4DAYB 4A3IG 2UUCL 1XJVA 3GO5A 1HXYD 4JCVE 1SE2A 3DM3A 5KNBA 3AFPA 1B3AA 3OW2A 4KK7A 3VYTA 4J6HA 3SK8A 4B08A 1DD2A 1BCPD 4DR5L 1II3A 2I5HA 5IP7G 4FO2A 4DV3Q 2UXCL 4GOPB 5GQOA 3HOWB 4LF5L 4JYAQ 1R9TB 1LM0A 1OXXK 2QILA 5A2QL 5JEAJ 1L0XB 2ZXPA 1XPUA 1MHWC 4JI5L 4KY5A 5AFWA 1N8RC 1S40A 1JICA 1XTCD 5C4XG 4PMBA 2JN4A 3GTQH 2JSOA 4R4TA 4HIKA 2LFNA 1YEZA 1YIJA 4ME5A 3NBHB 3WWVA 3CMEA 4I7AA 4TSSA 5LL6S 4A3BH 4K0KL 2BDOA 3UDGA 2VB2X 4MIUA 3GTMB 2MO1A 3D4DA 2AUJD 2LY7A 5T1IA 4DGZA 3STBD 1X54A 3G48A 5D3DA 5K36G 3MFYA 1G91A 3G7LA 4YHHQ 2E8GA 1EEFD 1O80A 1SNMA 1HTPA 1VF5C 1I3QH 3N6RA 3T1HQ 4P73A 4NB3A 3GTGB 1TWAB 5EKIA 1QZHA 1L0WA 4LF7Q 2CQAA 2E2JB 2I5MX 1EFID 2CH4W 1FNWA 3D6WA 3EROA 4A3LH 1HJPA 4JW0A 1CQFA 3Q22A 3K58A 3NQIA 1K3RA 1JJGA 1BBWA 1EIHA 2VUMB 2F0UA 4DR4L 3AFQA 4ZUJA 4RGOS 3A0JA 5D3IB 1YHBA 4DR7Q 2ZTCA 5KGUA 1PVOA 1U0LA 1G6ZA 1VQPA 1VQIA 1TWHB 4LFBQ 1PH5A 4JOIA 1QVCA 2I0QA 3L9AX 3QOJA 3I91A 1B9NA 2UXBQ 5GADC 1PH9A 5HY6A 4JI6Q 4BXXG 3EJIA 1DZ1A 2RF4A 2NVTB 1IZ6A 3K7UC 2F0SA 1YBYA 2C35B 3MZ5A 5C3EB 3GTKH 3KJOA 1X55A 4EVOA 1W2BA 1TXYA 3K8AA 1PRTF 3M7GA 4XQQA 4CBVA 1IYUA 3OWEB 4CJ0B 2KCTA 3WOFA 4UDUC 3CCLA 2Q2TA 5M3FG 1CZGA 5IGGA 4GN3B 3TZUA 1EIGA 1R4PB 2KJXA 3MAQA 3VR4A 2AUKA 3FDTA 4LFAL 2MFIA 2QDLA 5ELCA 5NUCA 2ES2A 3SHLA 2GA4B 4BA1I 3BZKA 3SR1A 4BY7B 4JI1L 5IGFA 2F0NA 5GROA 1GUOA 4RWSC 4BBSH 1TT2A 4O42A 1PRTC 3K5OA 2HT1A 1A0IA 1OTCA 2A74C 1XX8A 4LF8L 1HNZQ 2B2TA 3I4NB 2E2IB 2RA4A 4DV6Q 1D2BA 1HUMA 2EYHA 4POFA 1O78A 5C44H 1N34Q 2IJ0A 3AMUA 2AMCB 4DV7Q 3QR8A 2ZT9C 1E22A 4DN4M 2JA5G 2JA6H 1RKNA 1MI2A 2ZXRA 4KV6A 1STEA 3HKSA 1UE1A 5JEAH 4ULLA 3J80E 5IWAL 1BCPB 4KHZA 1CKOA 1PTOD 4KMUC 3STBC 1EUJA 3G6EA 2Z6KC 1Q8KA 3GQBA 5DAUA 3U9OA 3WOEA 5FLMH 1XTDA 4JBKA 1EY0A 4BBRG 2D5DA 1PZID 1GXDC 1VMPA 1T9HA 1VQOA 1SNQA 4HJAA 2XGTA 3RN5A 1SE3A 5IYDG 1ET6A 2K75A 1VQ5A 4IFDJ 2WP8J 3HOVG 3HRZC 2PYKA 3E6ZX 4QMGA 2IL8A 5I6WA 1EU3A 4A3KH 2WACA 2G5DA 1PYWD 3H0GG 2BCOA 4JBMA 1SE8A 1D5ZC 3OYYA 3J80L 3S1NH 3HS0C 3VR2A 1NBWA 1CFMA 1OXVA 2A69D 3P7JA 3RZDH 4B3SL 1QUQA 4KKSA 4J15A 4DV4Q 3J80i 4B3RQ 1A8VA 4JI0Q 5IYBG 4X65L 4DV5Q 3I4MG 2Z6BA 4XTCS 5F2DA 1NNXA 3A7AB 1MBYA 2PNHA 3F8TA 1PFSA 2EXZA 1DJRD 1LT3D 5KYIA 1VQBA 3J7AF 5IYCH 3ULJA 3DEOA 1RF2D 2N3SA 4ZAIA 2R93H 4OHJA 2PI2E 1EOTA 1ILPA 1DOMA 3S9WA 3BYTB 1DOLA 1PV4A 1PMRA 3J7ZC 2R7DA 3A7LA 4CDFC 3S24A 3M4YA 3OOCA 1K73C 4A3JG 1YHAA 1E7ZA 1KQSA 1HA5A 2V4DA 4HR7B 4K8IA 1Z7TA 4IUVA 4RMFA 4V0BA 4Y52H 1S5DD 1FNUA 3CCVA 4IJLA 3TREA 2L9HA 2EY5A 1SDFA 1EYAA 4H02A 4NKLA 5CV7A 1STHA 4DUYL 2JA8H 2ENBA 3HKZE 4YWKA 3ULLA 4A76A 3KLSX 1XWEA 1IKLA 3T51B 4WJWA 4RGMA 2HIVA 2ZJRA 5ELFA 5DM73 1MSHA 1N33Q 3E3XA 2OTJA 1UWVA 1S5ED 1EQVA 1HUNA 3TMEA 2X6LA 4DK0A 2RDGA 2QF7A 1P16A 4JI3L 2UU9L 2F0TA 1G51A 3PO3G 5E1FA 5LMNQ 4DR6Q 1CSPA 3GV6A 4R9WA 2K05A 1AE2A 5CV8A 3D0FA 3KLSA 1B2TA 2ASBA 2CCZA 2EOTA 3QJYA 4HSPA 2PW5A 4BBSB
chains in the Genus database with same CATH topology
4R4CA 4C3JH 2UUAL 1O7IA 3M4QA 3PUZA 5IP9H 2ZJQA 4YCWA 2VQEL 2LXKA 5IP9G 4DV4L 3EN2A 3GTGH 1TWAH 4B3RL 2VW9A 3PSIA 4JI0L 1D8LA 4Y7NH 1N32L 1EIYB 1W3SA 2KBNA 1RL2A 2DGYA 4IJHA 2E2JH 3GTOH 1E24A 4AYBG 5C0XJ 5DLQE 3M4OH 1FVIA 3BU2A 3CXCA 3S1RH 4POGA 1UE6A 4QJFA 3CCEA 1I5FA 1JT8A 4P71A 2UUCQ 2KHJA 4HIMA 4PZ6A 3PV0A 3KOJA 3TS0A 3J80c 4YY3Q 4LFCL 4TVAB 4HIDA 3RNUA 4LF9Q 2VUMH 3BJUA 1GO3E 3CW2C 1K83H 2BA0A 2VUMG 1OXTA 3L2PA 2JEBI 1E3PA 1YNXA 2YYZA 2YTXA 3CCQA 3G4SA 4EQ5A 1VQ4A 1K9MC 4DR5Q 2R92H 2IX0A 2PQAB 2HHHQ 3H15A 3UE0A 2R92G 1Y1VH 3B6YA 1HZAA 1Y1VG 4B3MQ 4YWLA 3F2CA 2NZOA 2UXCQ 4LF5Q 1TWHH 4NXNL 4IFDG 4R4OA 4JI7Q 4OO1G 2VY3A 3M3YH 1VQKA 3UE1A 4L5TA 1SMXA 1SRUA 2F52A 4X62Q 2OWOA 4WJ3M 1ASYA 2NN6I 3CQZH 5C4JH 1IBLL 4PG3A 4A3FH 2VNUD 4KI0A 3H3VI 2VZAA 4A3FG 4KHPL 1FGUA 2IX1A 2NVTH 4OXPA 4IO9A 1VQDA 1N32Q 1M1KC 5C3EH 1TWCH 5IE8A 3I56A 4BA2I 1DGSA 2YV5A 5C3EG 4X66Q 1SLJA 1QUQB 4A3DH 1MJCA 3PIOA 1N36Q 4K0KQ 3A74A 1N33L 2JA7H 1JMCA 3HKZG 1VCIA 4HJ8A 2NZHA 4JV5L 1Q46A 3GTJH 1I94L 3K7AH 4P74A 4JI4L 3NEMA 2N49A 1BBUA 4A3MH 1B7YB 3ZJYC 3F1ZA 4LF6L 4UPAA 5LMNL 4A3MG 1XPRA 4DR6L 1FL0A 2EIFA 5LMUL 2K4KA 1E1TA 4X6AH 2K14A 4IOCA 5JJLA 1V43A 3RLNA 1X65A 2YTYA 3K81C 1PH1A 3OTOQ 1NMGA 1C7YA 1C0AA 4DNIA 3PUXA 3AEVA 1J5EL 2N8NA 1HNXQ 1FJGL 1D7QA 4L5QA 2UUBL 3ERSX 4DV2Q 1MKHA 2JK8A 4JBWA 4BY7H 3HFZB 3F2BA 3PUVA 1RIPA 1VQEA 3CP0A 3KF6B 3PUWA 4GOPC 4BY7G 3CF5A 1X9NA 1C9OA 1VQCA 2LXJA 2RHQB 4YWMA 1WFQA 3L0OA 3HOWH 2Y0SG 1NY4A 1WYDA 1BVSA 4GLAC 1E1OA 5FLXc 2CWAA 3D31A 2IT1A 3I4NH 1JJCB 3EBEA 4O0AA 2E2IH 2OTLA 4C3IH 3M4PA 1EQRA 3I4NG 2NN6G 3H3VH 4A4IA 2NVXH 4DR4Q 4XIGS 4A3IH 4DAYB 4A75A 2A19A 4GKJL 3EIVA 3ICEA 1CKNA 4DV0Q 5GAHC 4A3IG 2UUCL 5JJIA 1XJVA 2AKWB 3GO5A 2ALYB 3NENA 4L5RC 2GVAA 4JCVE 3IRBA 4JI8Q 2YTVA 1N9WA 3AFPA 3DM3A 5C0XI 3OW2A 1HNWQ 3CCUA 3AYHB 4DUZQ 3CPWA 4LUOA 1BKBA 4QY7A 1Q12A 2RCNA 4DR5L 4YCUA 5IP7H 2HHHL 3TQYA 3U4ZA 2I5HA 5IP7G 5GAEC 4DV3Q 3E9HA 1JB7A 4DV1Q 3CC2A 3GTMH 4GOPB 1CKMA 2Y0SE 5GQOA 2QA4A 4R1JA 3JC66 3M9BA 3HOXH 3W1BA 1J5EQ 4LF5L 4JYAQ 3KF8B 5E7NA 3AQQA 3MXNB 3HOXG 1LM0A 3GTLH 4JI7L 1OXXK 5JEAJ 4IPDA 3FHWA 5M5YH 3VDYA 3TS2A 1XPUA 1VQAA 4X62L 4O2DA 4JI5L 1N8RC 4OONA 5C4XH 1S40A 4LUVA 2CKZB 5C4XG 1SFOH 1B8AA 3GTQH 4HIKA 4R4TA 4DR2Q 2QGQA 1WJJA 1YEZA 1J6QA 4DK6C 2YU9H 1YIJA 2ZTEA 4GLVB 3JAMi 2OQKA 3NBHB 3WWVA 4QL5A 3CMEA 1VQNA 2JEAI 4X66L 1YJWA 2R7ZH 4ALPA 1A62A 4AQYQ 1N36L 2D62A 4A3BH 4JC0A 3J81i 2JE6I 2R7ZG 4LFAQ 4GKJQ 3UDGA 4K0KL 4A3BG 4KLKA 3NELA 3FP9A 4A3GH 2ZM6Q 1K8AC 3S1QH 1XNRL 2MO1A 3CAMA 4A3GG 3I7FA 3STBD 1X54A 3G48A 4MNOA 1Q86C 1KC8C 1B70B 5K36G 4YHHQ 2E8GA 4C3HH 4GS3A 4JI1Q 3F2DA 2WFWA 2UXBL 5C0XG 1I3QH 3T1HQ 2V1CC 1VS0A 2EQSA 1WCMH 3M85A 3S16H 3OTOL 2PMZE 4P73A 1KIXA 1WCMG 4NB3A 3CPFA 1QZHA 1HNXL 3CCMA 4LF8Q 1L0WA 4DV2L 2D0PA 4DR1L 1PH8A 4LF7Q 2I5MX 2Z6KA 2I5LX 4JI5Q 4A3LH 3GD7A 3G71A 1HJPA 1U5KA 4A3LG 4LUZA 2B29A 3RR5A 2IY5B 1OXSC 3Q8DA 1K3RA 4DR3Q 1JJGA 1I6HH 1BBWA 3SGIA 2VQFL 4P72A 2NVQH 4DR4L 4JBJA 4EX5A 5M5WH 1VQGA 3PGZA 2Z0SA 3AFQA 3J81j 4L5SA 3A0JA 5IWAQ 4DV0L 1YHBA 4FDBA 4IPHA 2F4VQ 4DR7Q 2AWOA 2ZTCA 1PVOA 1U0LA 4JI8L 1VQPA 1HZBA 3E9IA 1XPOA 1VQIA 2KCMA 1HNWL 4AH6A 4HJ5A 1VQMA 4NXML 1XNRQ 2CWPA 4LFBQ 4DUZL 1PH5A 2HIXA 1X3GA 4JOIA 1QVCA 2E5LQ 2I0QA 3PUYA 4OWWB 1VQ6A 1KXLA 2A1AA 3RLOA 2DUDA 5AJ3Q 2UXBQ 4HJ9A 3RN2A 4BXXH 3LGJA 4UP9A 4DV3L 5GADC 4DV1L 5IT9c 1EIFA 5HY6A 1PH9A 4JI6Q 4BXXG 4DKAC 1V9PA 4JYAL 4P75A 3U50C 5ELOA 2RF4A 2QEXA 1IZ6A 3J7A5 3K7UC 4HIOA 1YBYA 2C35B 4DR1Q 1HR0Q 1Q82C 4JG2A 3KJOA 3GTKH 3U4VA 1X55A 4YCVA 1W2BA 1XNQQ 1TXYA 3UDIA 2B63H 3HOUH 1SR3A 1HZCA 3K8AA 3HOUG 2B63G 3TRZA 5FJ8H 2KCTA 1AH9A 5H1SE 1ASZA 2F3IA 3S2HH 2FXQA 2OCEA 1NE3A 5FJ8G 5M3FH 4DR2L 3CCLA 2Q2TA 1GM5A 5M3FG 4GN3B 1S72A 5IY0A 3CC4A 2UXDQ 1A63A 2MQHA 1KAWA 2VQFQ 1IBKQ 2KHIA 2BH2A 1SN8A 4AQYL 1HR0W 1Q7YC 3S17H 4LFAL 3K0XA 2MFIA 2ATWA 2RHSB 4GNXA 4GKKQ 1HH2P 2Q2HA 2ZM6L 2Q2IA 4NXMQ 5BR8Q 4A93H 2ES2A 3PCOB 3A5ZB 1YZ6A 4A93G 2WB1G 3JAMc 4YHHL 4AIMA 4BA1I 2R6GA 3BZKA 3W5OA 1OXUA 1IBMQ 1CKNB 4JI1L 4ME3A 3CMAA 3K80C 5GROA 4X65Q 2BH8A 4PMWA 3J81c 3T1HL 4IPGA 2E2HH 5EAYA 4BBSH 4LW1A 3PIPA 3TEHB 4BBSG 1VQHA 2HT1A 1A0IA 1YVCA 3MEFA 1OTCA 1Q1EA 1VQ8A 4LF8L 1S3OA 3L7ZC 4R4QA 1HNZQ 2D0OA 1PH6A 1AE3A 3BZCA 4DV6Q 4LF7L 4BY1H 2K5NA 1YJNA 1X56A 4POFA 5C44H 1N34Q 3T1YQ 4BY1G 1PH3A 1KRTA 5C44G 3CD6A 2AMCB 4WJ4A 4DV7Q 4OX9Q 1E22A 2NVYH 2JA5G 2ZJPA 4DR3L 5ELNA 2JA6H 3FKIH 2JA6G 4HJ7A 3HKSA 3FKIG 4UP8A 2WB1E 1UE1A 4LNQA 5IWAL 1QZGA 5JEAG 4IOAA 4KHZA 2F4VL 1CKOA 4UY8C 2K52A 4DR7L 4OWTB 4X64Q 2JQOA 2OQ0A 2WAQG 3STBC 2KENA 1EUJA 2K50A 3G6EA 2Z6KC 1Q8KA 1EWIA 2IHEA 4LFBL 5FLMH 4DUYQ 1PYSB 2E5LL 1XTDA 1PYBA 1VQFA 5FLMG 4BBRH 4OWXB 1IXRA 3I2ZA 4JBKA 1PH4A 4BBRG 5AJ3L 1EFWA 1P8LA 4DV5L 4QQBX 2XTIA 1CUKA 2JJQA 1T9HA 1X3EA 2BA1A 4JI6L 1KD1C 4B3TQ 1VQOA 3KYHC 1L1OA 1X3FA 2A8VA 5IYDH 4HJAA 2XGTA 3RN5A 2VS1A 4LF4Q 1Y14B 2PQAA 1EOVA 5IYDG 2H5XA 3HOVH 2K75A 1VQ5A 4IFDJ 2WP8J 1HR0L 3HOYH 3HOVG 4UP7A 1XNQL 3S1MH 3HOYG 3RZOH 2EXDA 4DK3C 2UU9Q 4JI3Q 3GTPH 1M90C 2HQLA 1PH7A 4A3KH 3H0GH 2VL6A 4JOIC 4PZ7A 1L1OB 1XMQQ 3PF4A 1XMOQ 4A3KG 3H0GG 1LTLA 4RG1A 1QVGA 2WAQE 1NTGA 4LWCA 1SE8A 3OYYA 1EQQA 4JBMA 5HGQA 4GN5A 2UXDL 3S1NH 3S2DH 1IBKL 4QIWE 3UDXA 4MTNA 3KJPA 1Y1WH 1VQJA 1H95A 1NMFA 1NBWA 3A5UA 1OXVA 1Y1WG 5J3BA 3RZDH 4B3SL 4GKKL 1K8GA 1VQ9A 4AYBE 2UUAQ 1QUQA 5GAGC 1LYLA 1I50H 5BR8L 4J15A 2VQEQ 1Q1BA 4DV4Q 4A3EH 2B3GA 2GN5A 4IPCA 3J80i 3PF5A 4A3EG 4B3RQ 4GLXA 1A8VA 1TWGH 5IYBH 1TWFH 1X6OA 1IBML 1V1QA 4JI0Q 3I4MH 2PI2A 5IYBG 3KDFA 4X65L 4DV5Q 3I4MG 1YHQA 4XTCS 3UDFA 1EYGA 2K5HA 1G291 5JJKA 2PNHA 3F8TA 2UXCL 1PFSA 3S15H 2ID0A 4A3DG 4C2MH 1GVPA 1VQBA 1WI5A 3CCRA 4DAMA 4GNXC 5IYCH 2JA7G 3ULJA 3RLFA 1HNZL 2N3SA 5IYCG 2GVBA 4DV6L 2R93H 3KDFB 4A3CH 2PI2E 4LFCQ 1KHIA 1N34L 2N78A 2R93G 4MZ9A 3ULPA 1KL9A 3T1YL 4A3CG 3HOZH 4DV7L 1JJ2A 4OX9L 1GKHA 1K0RA 4APVA 3HOZG 2MNAA 1PV4A 4JI2L 4R4IA 3J7ZC 2R7DA 3KF6A 1QVFA 3S24A 1GD7A 4A3JH 1UE7A 3I4OA 1K73C 2R7FA 4A3JG 1CSQA 1YHAA 1E7ZA 1KQSA 3KFUA 4NXNQ 3DLLA 3PO2H 3KLWA 3CC7A 1VQ7A 4B3SQ 1IYJB 3PO2G 4X64L 4RMFA 1PH2A 4DPGA 1YI2A 4Y52H 1UEBA 3CCVA 1IBLQ 4IJLA 3TREA 2CFMA 1PA6A 1NJIC 1G6PA 4H02A 1JE5A 4DUYL 2JA8H 4KHPQ 5M5XH 2Q2UA 3HKZE 3CCSA 1R9TH 4YWKA 2IHFA 2JA8G 1LUZA 2MO0A 3ULLA 3HOWG 3S14H 3E0EA 4A76A 1MIUA 1HZ9A 4GNXB 4NPSA 1VQLA 1Q81C 5M3MH 1MJEA 2AWNA 2HIVA 1L2FA 3GDEA 5M3MG 2ZJRA 4B3TL 1Z47A 1N33Q 4LF4L 3M7NA 2OTJA 1UWVA 1Z9FA 4PZ8A 4JV5Q 2LSSA 3ER0A 1I94Q 4GOPA 1PHJA 4JI4Q 4YY3L 1P16A 4JI3L 1YITA 2UU9L 2JA9A 4LF9L 1G51A 3W1GA 3PO3H 4LF6Q 3PO3G 5LMNQ 3U58A 1YJ9A 5LMUQ 1XMQL 4DR6Q 4IFDI 1WOCA 2JA5H 1XMOL 4JI2Q 1CSPA 2CQOA 4OO1I 4GN4B 4TQUS 3I55A 1KRSA 1AE2A 2K5VA 1IL2A 3D0FA 4B3ML 2ZTDA 1L1OC 1FJGQ 2AHOB 4QGUA 2UUBQ 2ASBA 2CCZA 1UE5A 2L15A 1SROA 3CCJA 5LMNW
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R4C A;  4C3J H;  2UUA L;  1O7I A;  3M4Q A;  3PUZ A;  5IP9 H;  2ZJQ A;  4YCW A;  2VQE L;  2LXK A;  5IP9 G;  4DV4 L;  3EN2 A;  3GTG H;  1TWA H;  4B3R L;  2VW9 A;  3PSI A;  4JI0 L;  1D8L A;  4Y7N H;  1N32 L;  1EIY B;  1W3S A;  2KBN A;  1RL2 A;  2DGY A;  4IJH A;  2E2J H;  3GTO H;  1E24 A;  4AYB G;  5C0X J;  5DLQ E;  3M4O H;  1FVI A;  3BU2 A;  3CXC A;  3S1R H;  4POG A;  1UE6 A;  4QJF A;  3CCE A;  1I5F A;  1JT8 A;  4P71 A;  2UUC Q;  2KHJ A;  4HIM A;  4PZ6 A;  3PV0 A;  3KOJ A;  3TS0 A;  3J80 c;  4YY3 Q;  4LFC L;  4TVA B;  4HID A;  3RNU A;  4LF9 Q;  2VUM H;  3BJU A;  1GO3 E;  3CW2 C;  1K83 H;  2BA0 A;  2VUM G;  1OXT A;  3L2P A;  2JEB I;  1E3P A;  1YNX A;  2YYZ A;  2YTX A;  3CCQ A;  3G4S A;  4EQ5 A;  1VQ4 A;  1K9M C;  4DR5 Q;  2R92 H;  2IX0 A;  2PQA B;  2HHH Q;  3H15 A;  3UE0 A;  2R92 G;  1Y1V H;  3B6Y A;  1HZA A;  1Y1V G;  4B3M Q;  4YWL A;  3F2C A;  2NZO A;  2UXC Q;  4LF5 Q;  1TWH H;  4NXN L;  4IFD G;  4R4O A;  4JI7 Q;  4OO1 G;  2VY3 A;  3M3Y H;  1VQK A;  3UE1 A;  4L5T A;  1SMX A;  1SRU A;  2F52 A;  4X62 Q;  2OWO A;  4WJ3 M;  1ASY A;  2NN6 I;  3CQZ H;  5C4J H;  1IBL L;  4PG3 A;  4A3F H;  2VNU D;  4KI0 A;  3H3V I;  2VZA A;  4A3F G;  4KHP L;  1FGU A;  2IX1 A;  2NVT H;  4OXP A;  4IO9 A;  1VQD A;  1N32 Q;  1M1K C;  5C3E H;  1TWC H;  5IE8 A;  3I56 A;  4BA2 I;  1DGS A;  2YV5 A;  5C3E G;  4X66 Q;  1SLJ A;  1QUQ B;  4A3D H;  1MJC A;  3PIO A;  1N36 Q;  4K0K Q;  3A74 A;  1N33 L;  2JA7 H;  1JMC A;  3HKZ G;  1VCI A;  4HJ8 A;  2NZH A;  4JV5 L;  1Q46 A;  3GTJ H;  1I94 L;  3K7A H;  4P74 A;  4JI4 L;  3NEM A;  2N49 A;  1BBU A;  4A3M H;  1B7Y B;  3ZJY C;  3F1Z A;  4LF6 L;  4UPA A;  5LMN L;  4A3M G;  1XPR A;  4DR6 L;  1FL0 A;  2EIF A;  5LMU L;  2K4K A;  1E1T A;  4X6A H;  2K14 A;  4IOC A;  5JJL A;  1V43 A;  3RLN A;  1X65 A;  2YTY A;  3K81 C;  1PH1 A;  3OTO Q;  1NMG A;  1C7Y A;  1C0A A;  4DNI A;  3PUX A;  3AEV A;  1J5E L;  2N8N A;  1HNX Q;  1FJG L;  1D7Q A;  4L5Q A;  2UUB L;  3ERS X;  4DV2 Q;  1MKH A;  2JK8 A;  4JBW A;  4BY7 H;  3HFZ B;  3F2B A;  3PUV A;  1RIP A;  1VQE A;  3CP0 A;  3KF6 B;  3PUW A;  4GOP C;  4BY7 G;  3CF5 A;  1X9N A;  1C9O A;  1VQC A;  2LXJ A;  2RHQ B;  4YWM A;  1WFQ A;  3L0O A;  3HOW H;  2Y0S G;  1NY4 A;  1WYD A;  1BVS A;  4GLA C;  1E1O A;  5FLX c;  2CWA A;  3D31 A;  2IT1 A;  3I4N H;  1JJC B;  3EBE A;  4O0A A;  2E2I H;  2OTL A;  4C3I H;  3M4P A;  1EQR A;  3I4N G;  2NN6 G;  3H3V H;  4A4I A;  2NVX H;  4DR4 Q;  4XIG S;  4A3I H;  4DAY B;  4A75 A;  2A19 A;  4GKJ L;  3EIV A;  3ICE A;  1CKN A;  4DV0 Q;  5GAH C;  4A3I G;  2UUC L;  5JJI A;  1XJV A;  2AKW B;  3GO5 A;  2ALY B;  3NEN A;  4L5R C;  2GVA A;  4JCV E;  3IRB A;  4JI8 Q;  2YTV A;  1N9W A;  3AFP A;  3DM3 A;  5C0X I;  3OW2 A;  1HNW Q;  3CCU A;  3AYH B;  4DUZ Q;  3CPW A;  4LUO A;  1BKB A;  4QY7 A;  1Q12 A;  2RCN A;  4DR5 L;  4YCU A;  5IP7 H;  2HHH L;  3TQY A;  3U4Z A;  2I5H A;  5IP7 G;  5GAE C;  4DV3 Q;  3E9H A;  1JB7 A;  4DV1 Q;  3CC2 A;  3GTM H;  4GOP B;  1CKM A;  2Y0S E;  5GQO A;  2QA4 A;  4R1J A;  3JC6 6;  3M9B A;  3HOX H;  3W1B A;  1J5E Q;  4LF5 L;  4JYA Q;  3KF8 B;  5E7N A;  3AQQ A;  3MXN B;  3HOX G;  1LM0 A;  3GTL H;  4JI7 L;  1OXX K;  5JEA J;  4IPD A;  3FHW A;  5M5Y H;  3VDY A;  3TS2 A;  1XPU A;  1VQA A;  4X62 L;  4O2D A;  4JI5 L;  1N8R C;  4OON A;  5C4X H;  1S40 A;  4LUV A;  2CKZ B;  5C4X G;  1SFO H;  1B8A A;  3GTQ H;  4HIK A;  4R4T A;  4DR2 Q;  2QGQ A;  1WJJ A;  1YEZ A;  1J6Q A;  4DK6 C;  2YU9 H;  1YIJ A;  2ZTE A;  4GLV B;  3JAM i;  2OQK A;  3NBH B;  3WWV A;  4QL5 A;  3CME A;  1VQN A;  2JEA I;  4X66 L;  1YJW A;  2R7Z H;  4ALP A;  1A62 A;  4AQY Q;  1N36 L;  2D62 A;  4A3B H;  4JC0 A;  3J81 i;  2JE6 I;  2R7Z G;  4LFA Q;  4GKJ Q;  3UDG A;  4K0K L;  4A3B G;  4KLK A;  3NEL A;  3FP9 A;  4A3G H;  2ZM6 Q;  1K8A C;  3S1Q H;  1XNR L;  2MO1 A;  3CAM A;  4A3G G;  3I7F A;  3STB D;  1X54 A;  3G48 A;  4MNO A;  1Q86 C;  1KC8 C;  1B70 B;  5K36 G;  4YHH Q;  2E8G A;  4C3H H;  4GS3 A;  4JI1 Q;  3F2D A;  2WFW A;  2UXB L;  5C0X G;  1I3Q H;  3T1H Q;  2V1C C;  1VS0 A;  2EQS A;  1WCM H;  3M85 A;  3S16 H;  3OTO L;  2PMZ E;  4P73 A;  1KIX A;  1WCM G;  4NB3 A;  3CPF A;  1QZH A;  1HNX L;  3CCM A;  4LF8 Q;  1L0W A;  4DV2 L;  2D0P A;  4DR1 L;  1PH8 A;  4LF7 Q;  2I5M X;  2Z6K A;  2I5L X;  4JI5 Q;  4A3L H;  3GD7 A;  3G71 A;  1HJP A;  1U5K A;  4A3L G;  4LUZ A;  2B29 A;  3RR5 A;  2IY5 B;  1OXS C;  3Q8D A;  1K3R A;  4DR3 Q;  1JJG A;  1I6H H;  1BBW A;  3SGI A;  2VQF L;  4P72 A;  2NVQ H;  4DR4 L;  4JBJ A;  4EX5 A;  5M5W H;  1VQG A;  3PGZ A;  2Z0S A;  3AFQ A;  3J81 j;  4L5S A;  3A0J A;  5IWA Q;  4DV0 L;  1YHB A;  4FDB A;  4IPH A;  2F4V Q;  4DR7 Q;  2AWO A;  2ZTC A;  1PVO A;  1U0L A;  4JI8 L;  1VQP A;  1HZB A;  3E9I A;  1XPO A;  1VQI A;  2KCM A;  1HNW L;  4AH6 A;  4HJ5 A;  1VQM A;  4NXM L;  1XNR Q;  2CWP A;  4LFB Q;  4DUZ L;  1PH5 A;  2HIX A;  1X3G A;  4JOI A;  1QVC A;  2E5L Q;  2I0Q A;  3PUY A;  4OWW B;  1VQ6 A;  1KXL A;  2A1A A;  3RLO A;  2DUD A;  5AJ3 Q;  2UXB Q;  4HJ9 A;  3RN2 A;  4BXX H;  3LGJ A;  4UP9 A;  4DV3 L;  5GAD C;  4DV1 L;  5IT9 c;  1EIF A;  5HY6 A;  1PH9 A;  4JI6 Q;  4BXX G;  4DKA C;  1V9P A;  4JYA L;  4P75 A;  3U50 C;  5ELO A;  2RF4 A;  2QEX A;  1IZ6 A;  3J7A 5;  3K7U C;  4HIO A;  1YBY A;  2C35 B;  4DR1 Q;  1HR0 Q;  1Q82 C;  4JG2 A;  3KJO A;  3GTK H;  3U4V A;  1X55 A;  4YCV A;  1W2B A;  1XNQ Q;  1TXY A;  3UDI A;  2B63 H;  3HOU H;  1SR3 A;  1HZC A;  3K8A A;  3HOU G;  2B63 G;  3TRZ A;  5FJ8 H;  2KCT A;  1AH9 A;  5H1S E;  1ASZ A;  2F3I A;  3S2H H;  2FXQ A;  2OCE A;  1NE3 A;  5FJ8 G;  5M3F H;  4DR2 L;  3CCL A;  2Q2T A;  1GM5 A;  5M3F G;  4GN3 B;  1S72 A;  5IY0 A;  3CC4 A;  2UXD Q;  1A63 A;  2MQH A;  1KAW A;  2VQF Q;  1IBK Q;  2KHI A;  2BH2 A;  1SN8 A;  4AQY L;  1HR0 W;  1Q7Y C;  3S17 H;  4LFA L;  3K0X A;  2MFI A;  2ATW A;  2RHS B;  4GNX A;  4GKK Q;  1HH2 P;  2Q2H A;  2ZM6 L;  2Q2I A;  4NXM Q;  5BR8 Q;  4A93 H;  2ES2 A;  3PCO B;  3A5Z B;  1YZ6 A;  4A93 G;  2WB1 G;  3JAM c;  4YHH L;  4AIM A;  4BA1 I;  2R6G A;  3BZK A;  3W5O A;  1OXU A;  1IBM Q;  1CKN B;  4JI1 L;  4ME3 A;  3CMA A;  3K80 C;  5GRO A;  4X65 Q;  2BH8 A;  4PMW A;  3J81 c;  3T1H L;  4IPG A;  2E2H H;  5EAY A;  4BBS H;  4LW1 A;  3PIP A;  3TEH B;  4BBS G;  1VQH A;  2HT1 A;  1A0I A;  1YVC A;  3MEF A;  1OTC A;  1Q1E A;  1VQ8 A;  4LF8 L;  1S3O A;  3L7Z C;  4R4Q A;  1HNZ Q;  2D0O A;  1PH6 A;  1AE3 A;  3BZC A;  4DV6 Q;  4LF7 L;  4BY1 H;  2K5N A;  1YJN A;  1X56 A;  4POF A;  5C44 H;  1N34 Q;  3T1Y Q;  4BY1 G;  1PH3 A;  1KRT A;  5C44 G;  3CD6 A;  2AMC B;  4WJ4 A;  4DV7 Q;  4OX9 Q;  1E22 A;  2NVY H;  2JA5 G;  2ZJP A;  4DR3 L;  5ELN A;  2JA6 H;  3FKI H;  2JA6 G;  4HJ7 A;  3HKS A;  3FKI G;  4UP8 A;  2WB1 E;  1UE1 A;  4LNQ A;  5IWA L;  1QZG A;  5JEA G;  4IOA A;  4KHZ A;  2F4V L;  1CKO A;  4UY8 C;  2K52 A;  4DR7 L;  4OWT B;  4X64 Q;  2JQO A;  2OQ0 A;  2WAQ G;  3STB C;  2KEN A;  1EUJ A;  2K50 A;  3G6E A;  2Z6K C;  1Q8K A;  1EWI A;  2IHE A;  4LFB L;  5FLM H;  4DUY Q;  1PYS B;  2E5L L;  1XTD A;  1PYB A;  1VQF A;  5FLM G;  4BBR H;  4OWX B;  1IXR A;  3I2Z A;  4JBK A;  1PH4 A;  4BBR G;  5AJ3 L;  1EFW A;  1P8L A;  4DV5 L;  4QQB X;  2XTI A;  1CUK A;  2JJQ A;  1T9H A;  1X3E A;  2BA1 A;  4JI6 L;  1KD1 C;  4B3T Q;  1VQO A;  3KYH C;  1L1O A;  1X3F A;  2A8V A;  5IYD H;  4HJA A;  2XGT A;  3RN5 A;  2VS1 A;  4LF4 Q;  1Y14 B;  2PQA A;  1EOV A;  5IYD G;  2H5X A;  3HOV H;  2K75 A;  1VQ5 A;  4IFD J;  2WP8 J;  1HR0 L;  3HOY H;  3HOV G;  4UP7 A;  1XNQ L;  3S1M H;  3HOY G;  3RZO H;  2EXD A;  4DK3 C;  2UU9 Q;  4JI3 Q;  3GTP H;  1M90 C;  2HQL A;  1PH7 A;  4A3K H;  3H0G H;  2VL6 A;  4JOI C;  4PZ7 A;  1L1O B;  1XMQ Q;  3PF4 A;  1XMO Q;  4A3K G;  3H0G G;  1LTL A;  4RG1 A;  1QVG A;  2WAQ E;  1NTG A;  4LWC A;  1SE8 A;  3OYY A;  1EQQ A;  4JBM A;  5HGQ A;  4GN5 A;  2UXD L;  3S1N H;  3S2D H;  1IBK L;  4QIW E;  3UDX A;  4MTN A;  3KJP A;  1Y1W H;  1VQJ A;  1H95 A;  1NMF A;  1NBW A;  3A5U A;  1OXV A;  1Y1W G;  5J3B A;  3RZD H;  4B3S L;  4GKK L;  1K8G A;  1VQ9 A;  4AYB E;  2UUA Q;  1QUQ A;  5GAG C;  1LYL A;  1I50 H;  5BR8 L;  4J15 A;  2VQE Q;  1Q1B A;  4DV4 Q;  4A3E H;  2B3G A;  2GN5 A;  4IPC A;  3J80 i;  3PF5 A;  4A3E G;  4B3R Q;  4GLX A;  1A8V A;  1TWG H;  5IYB H;  1TWF H;  1X6O A;  1IBM L;  1V1Q A;  4JI0 Q;  3I4M H;  2PI2 A;  5IYB G;  3KDF A;  4X65 L;  4DV5 Q;  3I4M G;  1YHQ A;  4XTC S;  3UDF A;  1EYG A;  2K5H A;  1G29 1;  5JJK A;  2PNH A;  3F8T A;  2UXC L;  1PFS A;  3S15 H;  2ID0 A;  4A3D G;  4C2M H;  1GVP A;  1VQB A;  1WI5 A;  3CCR A;  4DAM A;  4GNX C;  5IYC H;  2JA7 G;  3ULJ A;  3RLF A;  1HNZ L;  2N3S A;  5IYC G;  2GVB A;  4DV6 L;  2R93 H;  3KDF B;  4A3C H;  2PI2 E;  4LFC Q;  1KHI A;  1N34 L;  2N78 A;  2R93 G;  4MZ9 A;  3ULP A;  1KL9 A;  3T1Y L;  4A3C G;  3HOZ H;  4DV7 L;  1JJ2 A;  4OX9 L;  1GKH A;  1K0R A;  4APV A;  3HOZ G;  2MNA A;  1PV4 A;  4JI2 L;  4R4I A;  3J7Z C;  2R7D A;  3KF6 A;  1QVF A;  3S24 A;  1GD7 A;  4A3J H;  1UE7 A;  3I4O A;  1K73 C;  2R7F A;  4A3J G;  1CSQ A;  1YHA A;  1E7Z A;  1KQS A;  3KFU A;  4NXN Q;  3DLL A;  3PO2 H;  3KLW A;  3CC7 A;  1VQ7 A;  4B3S Q;  1IYJ B;  3PO2 G;  4X64 L;  4RMF A;  1PH2 A;  4DPG A;  1YI2 A;  4Y52 H;  1UEB A;  3CCV A;  1IBL Q;  4IJL A;  3TRE A;  2CFM A;  1PA6 A;  1NJI C;  1G6P A;  4H02 A;  1JE5 A;  4DUY L;  2JA8 H;  4KHP Q;  5M5X H;  2Q2U A;  3HKZ E;  3CCS A;  1R9T H;  4YWK A;  2IHF A;  2JA8 G;  1LUZ A;  2MO0 A;  3ULL A;  3HOW G;  3S14 H;  3E0E A;  4A76 A;  1MIU A;  1HZ9 A;  4GNX B;  4NPS A;  1VQL A;  1Q81 C;  5M3M H;  1MJE A;  2AWN A;  2HIV A;  1L2F A;  3GDE A;  5M3M G;  2ZJR A;  4B3T L;  1Z47 A;  1N33 Q;  4LF4 L;  3M7N A;  2OTJ A;  1UWV A;  1Z9F A;  4PZ8 A;  4JV5 Q;  2LSS A;  3ER0 A;  1I94 Q;  4GOP A;  1PHJ A;  4JI4 Q;  4YY3 L;  1P16 A;  4JI3 L;  1YIT A;  2UU9 L;  2JA9 A;  4LF9 L;  1G51 A;  3W1G A;  3PO3 H;  4LF6 Q;  3PO3 G;  5LMN Q;  3U58 A;  1YJ9 A;  5LMU Q;  1XMQ L;  4DR6 Q;  4IFD I;  1WOC A;  2JA5 H;  1XMO L;  4JI2 Q;  1CSP A;  2CQO A;  4OO1 I;  4GN4 B;  4TQU S;  3I55 A;  1KRS A;  1AE2 A;  2K5V A;  1IL2 A;  3D0F A;  4B3M L;  2ZTD A;  1L1O C;  1FJG Q;  2AHO B;  4QGU A;  2UUB Q;  2ASB A;  2CCZ A;  1UE5 A;  2L15 A;  1SRO A;  3CCJ A;  5LMN W; 
#chains in the Genus database with same CATH topology
 1U4L A;  2UUA L;  3BDC A;  2VQE L;  3BDL A;  2LXK A;  5CC4 A;  5IP9 G;  1BQQ T;  3EN2 A;  2Q8T A;  1M4V A;  3PSI A;  1EIY B;  2P5Z X;  5KNC A;  5C44 B;  5C0X J;  4AYB G;  4OIK A;  1F9Q A;  2PO4 A;  4QJF A;  2UUC Q;  1D5X C;  3PV0 A;  5ELE A;  1JWS D;  2JA6 B;  5CV9 A;  1ET9 A;  3TS0 A;  4LFC L;  4LF9 Q;  4NDX A;  1SEB D;  3BZD B;  1K83 H;  1E3P A;  1YNX A;  4KTA A;  4O1N A;  3LWE A;  4FP5 D;  1VQ4 A;  3TP6 A;  1K9M C;  4DR5 Q;  2IX0 A;  3R93 A;  1F2L A;  3H15 A;  3W3A A;  2J7Z A;  1HZA A;  2EY6 A;  4XT1 B;  2UXC Q;  4GZY C;  4IFD H;  4LF5 Q;  1C8C A;  1ZYR C;  2VY3 A;  3K0Y A;  1SRU A;  2F52 A;  4WJ3 M;  4A3F H;  3H3V I;  1J9O A;  4KHP L;  5JPN C;  2M2L A;  1QOH A;  3A8J E;  1VQD A;  1N32 Q;  4FF4 A;  5IE8 A;  2BE5 C;  2KVM A;  5CR3 A;  2NYZ D;  4A3D H;  4A3K B;  4K0K Q;  3A55 A;  2JA7 H;  4JV5 L;  1V1P B;  1Y1V B;  2NZH A;  1Y8O B;  1I94 L;  3S1N B;  3BVG A;  4P74 A;  3NEM A;  1MSG A;  1TKW B;  1B7Y B;  3ZJY C;  3F1Z A;  4A3M G;  5JVH 3;  5LMU L;  3M3Y B;  2B2U A;  3RZD B;  4TKO B;  1Y69 U;  2F0K A;  5E4W C;  5JJL A;  1V43 A;  2B2V A;  3CQZ B;  1CA6 A;  1NMG A;  4DNI A;  1D7Q A;  3BVM A;  2G9H D;  4J8Q A;  1LAC A;  1FJG L;  2UUB L;  4R8I A;  1SND A;  3ERS X;  2CW0 D;  1H9S A;  1QB5 D;  3JAM E;  3F2B A;  1LAB A;  3KF6 B;  1DON A;  1WTX A;  2C9O A;  1WTO A;  1C9O A;  1VQC A;  5KND A;  3J81 E;  1WFQ A;  3HOW H;  2LMC B;  3HKZ B;  3A54 A;  3RMH A;  3GTJ B;  2HCI A;  2R93 B;  1JJC B;  3EBE A;  4DR4 Q;  2NVX H;  2F0M A;  4C3I G;  4XIG S;  3KLR A;  4DU9 A;  4GKJ L;  1CKN A;  4EQN A;  4L5R C;  2GVA A;  2YTV A;  1H9M A;  1N9W A;  5KRU A;  4CDE C;  5BN3 A;  5CMD A;  1Q3L A;  2F1M A;  2EZV A;  1Q12 A;  2RCN A;  3Q0A A;  3TQY A;  5GAE C;  1JB7 A;  1YNJ D;  3CC2 A;  3GTM H;  3JAM L;  3JC6 6;  2JA8 B;  3HOX H;  3W1B A;  3KF8 B;  5C3W A;  3J81 L;  5M5Y H;  3FHW A;  3VDY A;  1KDC A;  4X62 L;  5EPL A;  4LUV A;  4DK1 A;  1SFO H;  2EYP A;  2EJF C;  5EBD A;  1VMC A;  4U68 A;  2YU9 H;  3DWA A;  4GLV B;  3JAM i;  2DJG C;  4ZKB B;  3TP5 A;  1YJW A;  4TRD A;  1A62 A;  1N36 L;  3J81 i;  2R7Z G;  2JE6 I;  3DUZ A;  4LFA Q;  2PCF B;  4KLK A;  5I4D A;  3BYY B;  1U4M A;  3KBX A;  4I65 A;  1LT4 D;  4A3G G;  3I7F A;  2IPK D;  3IFT A;  4FXD A;  3C1E A;  4JI1 Q;  5C0X H;  4C3H G;  3KK7 A;  2AQ1 B;  3R3O A;  1BXT A;  1WCM H;  4I7Z C;  3M85 A;  3NBI A;  5E3F A;  3CPF A;  4CDC C;  1HNX L;  3VA7 A;  1ENF A;  4LF8 Q;  1PH8 A;  4PQX A;  1BBX C;  1JOR A;  2I5L X;  4K2L A;  3GD7 A;  4KY7 A;  3G71 A;  3IL8 A;  1EWC A;  1OXS C;  4IQZ A;  4KY6 A;  1I6H H;  5IOD A;  3S1Q B;  3SGI A;  4IUP A;  2VQF L;  1K83 B;  4JBJ A;  3J81 j;  5M5W H;  1ENA A;  2Z0S A;  1TII D;  5CGK A;  2AQ2 B;  1PDQ A;  5IWA Q;  4DV0 L;  2LKV A;  4IPH A;  4NW2 A;  4Z9C B;  1XPO A;  2F0L A;  3E9I A;  2KCM A;  1XNR Q;  4NXM L;  1F9S A;  2CWP A;  5EBC A;  1FYC A;  5FK9 C;  1X3G A;  4N9T A;  3RLO A;  2DUD A;  3RN2 A;  4A3F B;  4DV1 L;  1EIF A;  3F2U A;  1V9P A;  2RVL A;  2CW0 C;  2BDN A;  4HTH A;  3J7A 5;  3ND9 A;  2XNA C;  4H7B A;  4DR1 Q;  2ZXO A;  2KCN A;  4XQJ A;  2NVQ B;  4KJN A;  3HOU H;  1SR3 A;  2B63 G;  5FJ8 H;  2B39 A;  1ASZ A;  2F3I A;  2OCE A;  4JPB W;  1T5X D;  1A3T A;  1GM5 A;  1S72 A;  5IY0 A;  1GUS A;  3EFX D;  3D4R A;  1SN8 A;  5ELD A;  2BH2 A;  4AQY L;  1GHK A;  2EYF A;  2OT2 A;  4HCS A;  2ATW A;  2RHS B;  4ILW A;  1HH2 P;  2Q2H A;  1HFG A;  2ZM6 L;  2A6E C;  2L55 A;  2K01 A;  4CGY B;  3PCO B;  4A93 G;  1BUV T;  1STG A;  1NR2 A;  4AIM A;  1EY5 A;  1IW7 D;  4M8A A;  2QCP X;  1SYE A;  3K80 C;  4X65 Q;  4U67 3;  4IPG A;  2E2H H;  4UHV A;  5EAY A;  1HQR D;  3PIP A;  1VQH A;  3BS1 A;  5M3F B;  1JOO A;  1X32 A;  4K6D A;  4R4Q A;  3L7Z C;  1D6E C;  4IUN A;  1PH6 A;  1AE3 A;  2MHV A;  2NVX B;  3MA2 B;  1YJN A;  1Q90 A;  2XN9 C;  3RD4 A;  2K1B A;  4BY1 G;  3SE0 A;  1KRT A;  3CD6 A;  4WJ4 A;  3O13 A;  1RJT A;  3Q6S A;  2A68 D;  4FNF A;  2F0H A;  2B2W A;  2SOB A;  1AP0 A;  3EA6 A;  1KNE A;  1NR4 A;  3FRP B;  3MC0 B;  1AFP A;  2K6A A;  3FKI G;  4UP8 A;  2WB1 E;  3VR3 A;  4LNQ A;  2NTT A;  2RSN A;  2B2Y C;  2SNS A;  3X3M A;  2F4V L;  4FF3 A;  4NMZ A;  3NE5 B;  1EZ8 A;  4MN3 A;  4RFB A;  2O2L D;  3HOX B;  1QWY A;  1JE4 A;  4DUY Q;  4XYO A;  2E5L L;  1PYB A;  1VQF A;  1AZQ A;  5M5Y B;  3HEJ A;  3I2Z A;  5AJ3 L;  4QQB X;  2N55 A;  1X3E A;  1V1O A;  1SFO B;  1L1O A;  1X3F A;  1C4Q A;  2F0V A;  2YU9 B;  1BNZ A;  1HR0 L;  2EYJ A;  5EGT A;  3SDZ A;  1PFM A;  3HOY G;  3RZO H;  4WFN 3;  4DK3 C;  2UU9 Q;  4JI3 Q;  2EY2 A;  1M90 C;  2HQL A;  3SVM A;  4JOI C;  3PF4 A;  1L1O B;  2Z9H A;  1U9R A;  4RG1 A;  2WAQ E;  1CA5 A;  4GN5 A;  2UXD L;  5DNF A;  1IBK L;  5G3L D;  1VQJ A;  4QCL A;  3A5U A;  1Y1W G;  4RCN A;  1K8G A;  4AYB E;  2UUA Q;  1WCM B;  1I50 H;  5BR8 L;  2VQE Q;  1D1I A;  4QUC A;  4LK1 C;  4A3E H;  1GHJ A;  2B3G A;  2A5H A;  2PZW A;  3SXH A;  1TWF H;  1X6O A;  1V1Q A;  1A2T A;  2SEB D;  3AB9 A;  5FO8 B;  1EYG A;  2F0D A;  4IUU A;  4UAI A;  5JJK A;  1BCP F;  1DOK A;  3H0G B;  3MTS A;  4A3D G;  1SBB B;  3P75 A;  1ESF A;  1GVP A;  3CCR A;  1I6H B;  2JA7 G;  1SNC A;  1U4R A;  2J4X A;  3RLF A;  1CK1 A;  3S2D B;  2H1E A;  1JQY D;  4LFC Q;  5M5W B;  3T1Y L;  1K3B C;  1KL9 A;  4A3C G;  1GKH A;  2K7V A;  5IGD A;  1QJO A;  3HOZ G;  1SJE D;  3I70 A;  1QVF A;  2PW7 A;  3N52 A;  2R7F A;  1S4Z A;  3C2P A;  1SYF A;  2J0T D;  3KLW A;  3NWS A;  3PO2 H;  3FEW X;  2B2T C;  4X64 L;  1SMY D;  1PH2 A;  4DPG A;  1UUP A;  4S3S A;  1S5B D;  1WTR A;  1NJI C;  1IW7 C;  1BCP C;  1QNK A;  4KHP Q;  4EQO A;  3D6C A;  2Q2U A;  3HOW G;  2MO0 A;  4OL7 A;  3HOU B;  3MXU A;  1VQL A;  5M3M H;  2A6H D;  2DN8 A;  2F0P A;  4B3T L;  1LO5 D;  1ESR A;  4JV5 Q;  1I94 Q;  3OMG A;  1YIT A;  4MTK A;  3MXN A;  4N9P A;  5JOB A;  1I4X A;  5LMU Q;  1YJ9 A;  1X3Q A;  4OEL B;  4JI2 Q;  2CQO A;  4OO1 I;  4GN4 B;  3TN2 A;  3I55 A;  3MHB A;  1KRS A;  2K5V A;  2HUG A;  2WB1 B;  4K5W A;  3DHQ A;  1FJG Q;  2AHO B;  2UUB Q;  1I6V C;  1V8Q A;  1PTO H;  1HPC A;  1SRO A;  2X69 A;  1JOK A;  2E2H B;  5LMN W;  4R4C A;  4C3J H;  4YCW A;  1D8L A;  1ROD A;  1LTA D;  3C3L A;  2DGY A;  2FFK B;  4IJH A;  3GTO H;  2MPM A;  3M4O H;  1F77 A;  1FVI A;  3BU2 A;  3CXC A;  1UE6 A;  3CCE A;  1I5F A;  3GP7 A;  1NAP A;  1K8O A;  2KHJ A;  1PXU A;  3KOJ A;  1KTK A;  1Y8P B;  1SAP A;  3J80 c;  2D9U A;  4YY3 Q;  3RNU A;  1GO3 E;  3CW2 C;  4PNY A;  2VUM G;  2A73 B;  2JEB I;  1HA6 A;  2AQ3 B;  2WAQ B;  4EQ5 A;  2R92 H;  1JB3 A;  4WOR A;  1Y1V H;  2K5W A;  1F9P A;  3NTK A;  4B3M Q;  4E6I A;  4NXN L;  4L8J A;  4OO1 G;  2L11 A;  4Y7N B;  3M3Y H;  3UE1 A;  5FKA C;  4AYB B;  3FVQ A;  4HSV A;  4X62 Q;  3CQZ H;  2VNU D;  3S1R B;  2VZA A;  1KDA A;  5IT9 E;  4LMQ D;  4ZYS A;  3RZO B;  1TWC H;  1D1K A;  4RA8 A;  4BA2 I;  2QDB A;  2YV5 A;  5C3E G;  2DJF C;  1SLJ A;  1QUQ B;  1CZW A;  1N36 Q;  1WTH A;  3BDO A;  4G7H C;  3A74 A;  1FD7 D;  3CRL C;  3WDN A;  2B8F A;  4QF4 A;  3E0J A;  1Q46 A;  3GTJ H;  4JI4 L;  3DEP A;  2N49 A;  2JP1 A;  4LF6 L;  3D4W A;  2FMC A;  4X3K A;  1FL0 A;  3K57 A;  4IUQ A;  1ZEQ X;  1E1T A;  4X6A H;  2K14 A;  3K5M A;  2K33 A;  1I50 B;  3SK6 A;  4A3E B;  3PUX A;  3AEV A;  1SNO A;  3OIQ A;  1HNX Q;  4DAP A;  1TWF B;  2RKS A;  3HFZ B;  3OW7 A;  1JR0 D;  1VQE A;  5IT9 L;  4BY7 G;  1HTL D;  5E4X A;  5BN4 A;  3CF5 A;  2MGS A;  1RTO A;  1PTO F;  3L0O A;  2EY1 A;  1BVS A;  1XXG A;  2CWA A;  3DM1 A;  2A6H C;  2NN6 H;  3K7A B;  4O0A A;  3D8G A;  5ELB A;  2OEO A;  3T16 A;  3I4N G;  3VR6 A;  2EVB A;  4A3I H;  1TVX A;  3ICE A;  4DV0 Q;  5JJI A;  2AKW B;  3NEN A;  4XXE A;  4HAE A;  3IRB A;  1JCK B;  2PPB C;  1OO9 B;  3AYH B;  3UI2 A;  2MUY A;  1Q8I A;  3PO2 B;  1RDP D;  2N88 A;  1BKB A;  4LUO A;  5IOC A;  3X3N A;  5IP7 H;  4XQN A;  2HHH L;  1A3V A;  2IWH A;  4DV1 Q;  2EPB A;  1CKM A;  2Y0S E;  4DFA A;  4R1J A;  3M9B A;  1S5F D;  1PTO C;  1J5E Q;  5E7N A;  3AQQ A;  3C1F A;  3GTL H;  1F2Y A;  4JI7 L;  4B9X A;  4IPD A;  3TS2 A;  5M3M B;  1VQA A;  2EYO A;  5KIX A;  4X3T A;  4OON A;  5C4X H;  2CKZ B;  5JJZ A;  5JVG 3;  1B8A A;  1MGS A;  2QGQ A;  1WJJ A;  3FMC A;  1J6Q A;  4DK6 C;  1KAA A;  5JPM C;  3CHB D;  1VQN A;  3MFG A;  4X66 L;  4ALP A;  1F2Z A;  4AQY Q;  2D62 A;  2X6G A;  5KYL A;  4A3B G;  3VYR A;  1HCZ A;  3MXG A;  3NEL A;  1NSN S;  4F87 A;  2ZM6 Q;  2FHT A;  1K8A C;  2DNC A;  2KEE A;  3S1Q H;  1DYQ A;  3CAM A;  2TSS A;  1KC8 C;  1Q86 C;  1DCZ A;  1WD0 A;  1PTO B;  1QG7 A;  2O4X A;  3MXP A;  2WFW A;  2UXB L;  4C3J B;  2K32 A;  2V1C C;  2F0F A;  1VS0 A;  3NTI A;  3OTO L;  1KIX A;  2A69 C;  5FOB B;  3T56 B;  3ZYY X;  1UNS A;  3CCM A;  2TMP A;  2D0P A;  2XSC A;  2XVS A;  3EVQ A;  3GTO B;  4JI5 Q;  3M4O B;  2O5J C;  5KEE A;  1U5K A;  4A3L G;  3RR5 A;  1K8M A;  2B2U C;  4FVM A;  3HGB A;  4R8N A;  2B2V C;  2D2C C;  4ODG A;  1B44 D;  2NVQ H;  1BOS A;  1VQG A;  1EY9 A;  4FDB A;  5COR A;  4K6L A;  2F4V Q;  2R92 B;  2AWO A;  2M9V A;  4JI8 L;  1YNN D;  1HZB A;  1HNW L;  4AH6 A;  2HD3 A;  4HJ5 A;  1VQM A;  4DUZ L;  1LTS D;  2HIX A;  2E5L Q;  2EYL A;  3I73 A;  1VQ6 A;  4OWW B;  3QOL A;  2XRS D;  5AJ3 Q;  1KLG D;  4HJ9 A;  1GUW A;  4BXX H;  4UP9 A;  4YIJ A;  4DKA C;  4P75 A;  4HED A;  3U50 C;  5BN5 A;  2QEX A;  4HIO A;  1R4Q B;  3URY A;  1HR0 Q;  5J22 A;  1TWC B;  4YCV A;  3BG3 A;  5I6Y A;  1ILQ A;  5C6A A;  2KOL A;  5H1S E;  3S2H H;  2FXQ A;  5M3F H;  1NE3 A;  4DR2 L;  1EZ6 A;  4ZQ3 A;  3CC4 A;  2UXD Q;  1H9S B;  1EYD A;  2MQH A;  2R61 A;  1A63 A;  1IBK Q;  1SYB A;  4BS9 A;  1Q7Y C;  3S17 H;  3K0X A;  4FXG C;  4FF2 A;  2K5Q A;  2FIN B;  4GNX A;  2KHS A;  2CVR A;  5BR8 Q;  4C56 C;  3A5Z B;  3V05 A;  1GJX A;  1WTQ A;  3JAM c;  4HN7 A;  4KN7 C;  3TDQ A;  3W5O A;  1OXU A;  1CKN B;  4ME3 A;  3CMA A;  1EU4 A;  3A8I E;  2BH8 A;  3J81 c;  2B63 B;  2Y0S B;  4LW1 A;  4RGT A;  1TY2 A;  4BBS G;  2KED A;  3MEF A;  2QEJ C;  1Q1E A;  5C4Z A;  1VQ8 A;  3K5L A;  3BZC A;  3NXW A;  3OPO A;  2K5N A;  5I2X A;  3CRK C;  4XYQ A;  3T1Y Q;  4A3I B;  1PH3 A;  4ZCK A;  5C44 G;  2ICE C;  3V2T A;  4WRD A;  2NVY H;  3MEH A;  2R3Z A;  4DR3 L;  5ELN A;  2WKC A;  4F8M A;  4FYD A;  2JA6 G;  4KKT A;  3IAY A;  2F3V A;  4HJ7 A;  1PLF A;  5M9O A;  1GOZ A;  1TQO A;  1EY8 A;  5JEA G;  4OWT B;  4X3S A;  2F3W A;  4X64 Q;  2K50 A;  2I46 A;  1PZJ D;  1PYS B;  3GTL B;  5FLM G;  4BBR H;  3NTH A;  1IXR A;  3E5S A;  1PH4 A;  1P8L A;  4DV5 L;  2XTI A;  1CUK A;  5C4X B;  1CHQ D;  2BA1 A;  2A8V A;  4B3T Q;  3KYH C;  5IYD H;  2VS1 A;  1Y14 B;  2PQA A;  5IGB A;  1PFB A;  3HOV H;  1K28 A;  2XWJ B;  3FKI B;  4UP7 A;  1XNQ L;  3S1M H;  5I2Y A;  3FPP A;  3GTP H;  4RKB A;  2L12 A;  1PH7 A;  3H0G H;  2VL6 A;  4A3K G;  2NB0 A;  5TSS A;  1EQQ A;  1LTR D;  5HGQ A;  3S2D H;  3UDX A;  2NZ1 D;  4IN3 A;  4RAU C;  5C3X A;  2NUC A;  4GKK L;  3C46 A;  2CH4 A;  1Y8N B;  2CHB D;  1LYL A;  2K28 A;  1LT5 D;  2GN5 A;  4N8X 1;  5J1Z A;  5FO7 B;  4GLX A;  4K8J A;  5IYB H;  1AW7 A;  1IBM L;  2OXP A;  3A8K E;  3I4M H;  3UDF A;  3DWQ A;  3NPP A;  1I4H A;  1WI5 A;  4C2M H;  1G2S A;  4DAM A;  5IYC G;  2GVB A;  1ENC A;  1JWU D;  1MD2 D;  2HDM A;  5LL6 X;  2C5C A;  1KHI A;  2N78 A;  2R93 G;  4MZ9 A;  3ULP A;  1JJ2 A;  4OX9 L;  1K0R A;  4APV A;  1UEA B;  3HZX A;  5FO9 B;  3I72 A;  1IYV A;  4A3J H;  1UE7 A;  3I4O A;  3KFU A;  2FJ2 A;  4NXN Q;  3DLL A;  3CC7 A;  4B3S Q;  1O7Z A;  1LTG D;  1YI2 A;  4H13 C;  4BWG B;  4PMC A;  1UEB A;  2PQE A;  4DAY A;  2CFM A;  3S15 B;  2DNE A;  1G6P A;  1JE5 A;  3CKI B;  2MJ8 A;  5M5X H;  1SJH D;  3CCS A;  2SNM A;  2IHF A;  2JA8 G;  1LUZ A;  2B2W C;  3S14 H;  3R2T A;  3E0E A;  1YNJ C;  1MIU A;  4HMI A;  2EE1 A;  1Q81 C;  1D5M C;  2K03 A;  1L2F A;  3GDE A;  1Z47 A;  4RHR A;  3S2H B;  4LF4 L;  5FLX L;  3M7N A;  4PZ8 A;  2LSS A;  1ZKO A;  5LHY 1;  4GOP A;  4JI4 Q;  4DXF A;  2PZT A;  4LF9 L;  3PO3 H;  3QWN A;  3S17 B;  4LF6 Q;  4G4K A;  1LV9 A;  4F7X A;  3U58 A;  1XMQ L;  3SK5 A;  4IFD I;  1WOC A;  1XMO L;  4CJ2 C;  4TQU S;  5T1G A;  1FR3 A;  1STY A;  1O7Y A;  1L1O C;  3PMF A;  1PRT D;  1UE5 A;  2L15 A;  3IFD A;  3CCJ A;  3NBH A;  1TS2 A;  3M4Q A;  5IP9 H;  4CKE A;  1RD9 D;  2VXW A;  4DXG A;  1ML0 D;  2WII B;  2F0I A;  4DAV A;  3K59 A;  3U9S A;  4Y7N H;  1N32 L;  4P2C B;  1L0Y B;  1W3S A;  2KBN A;  1RL2 A;  2F0O A;  4RH6 A;  1E24 A;  1I4R A;  3SEB A;  5DLQ E;  4DF7 A;  2RDH A;  3S1R H;  4POG A;  2JA5 B;  2NVY B;  3V96 A;  3VYU A;  4HIM A;  3L3O C;  4PZ6 A;  4ZK9 B;  1EY4 A;  1XYI A;  4IUT A;  2BA0 A;  3QIA A;  2YTX A;  1QIL A;  3CCQ A;  2L0C A;  2HHH Q;  3UE0 A;  1SNP A;  3B6Y A;  4YWL A;  3F2C A;  2B2Y A;  3VA5 A;  4IFD G;  1CT1 D;  4BBR B;  1CQV A;  4JI7 Q;  4G7O C;  2L5T A;  1SMX A;  2MP1 A;  3W2D A;  1Z6H A;  1HQM C;  3D3R A;  2OWO A;  2RDF A;  1IBL L;  1E2V A;  3BVZ A;  3Q24 A;  4KI0 A;  2F4I A;  4A3F G;  1FGU A;  2KQ3 A;  4G7Z C;  3HOV B;  4OXP A;  4IO9 A;  1M1K C;  5IIF A;  3S1M B;  3I56 A;  1DGS A;  3GTP B;  1TS5 A;  4X66 Q;  4CKC A;  3PIO A;  1NUC A;  3NK9 A;  1EYC A;  4F88 A;  4OEM B;  1JMC A;  5CYU A;  3PIP 3;  1U4P A;  3K7A H;  4H44 C;  4KJO A;  4A3M H;  2IW3 A;  4DA2 A;  4UPA A;  1XPR A;  4FF1 A;  2EIF A;  3NHH A;  3TP7 A;  1STA A;  2XIW A;  5C4J B;  3K81 C;  1PH1 A;  3OTO Q;  1KAB A;  1G8Z D;  2N8N A;  3LX0 A;  4L5Q A;  1F2M A;  1SXT A;  1H9K A;  3I4M B;  4RHS A;  3TBI B;  1C48 A;  1SYD A;  1PFN A;  1T5E A;  4KD3 A;  3PUV A;  3CP0 A;  3PUW A;  4K5V A;  1I4Q A;  1X9N A;  1HFN A;  4YWM A;  4ABN A;  1S5C D;  4C2M B;  1WYD A;  5CBE E;  4H0L C;  1E1O A;  1LTI D;  3D31 A;  1EY6 A;  2IT1 A;  2OTL A;  4C3I H;  1EQR A;  4DNT B;  4A4I A;  3H3V H;  2O5I C;  1VF7 A;  1J8I A;  4A75 A;  2A19 A;  3ITP A;  3EIV A;  5GAH C;  2ALY B;  5EKL A;  4KKU A;  1SYC A;  4JI8 Q;  5C0X I;  1HNW Q;  3T53 B;  4A3J B;  3CCU A;  1KDB A;  3HP3 A;  3P1H A;  2A68 C;  2SDF A;  5J39 A;  4DUZ Q;  3HG9 A;  3CPW A;  5C4H A;  2HQE A;  3I90 A;  4QY7 A;  4YCU A;  3RUZ A;  3U4Z A;  5HUR A;  1TR5 A;  3E9H A;  2QA4 A;  1GUN A;  4J1M A;  5M5X B;  3MXN B;  1W6K A;  3HOX G;  3S14 B;  1GUG A;  2E74 C;  2JXM B;  5G3L F;  4O2D A;  3A56 A;  1ZXT A;  2F0W A;  4HCE A;  1WTP A;  4JK1 C;  5C5M A;  1QE6 A;  4DR2 Q;  2KEC A;  2ZTE A;  2OQK A;  2WV6 D;  4QL5 A;  3PO3 B;  2JEA I;  2R7Z H;  4KHV A;  4GKJ Q;  4XT3 B;  4JC0 A;  1B53 A;  4OIJ A;  3I8Z A;  3FP9 A;  4A3G H;  1KNA A;  1B1Z A;  3PIO 3;  1XNR L;  1LTT D;  1PRT B;  4MNO A;  1B70 B;  4HMJ A;  1W6J A;  4C3H H;  4GS3 A;  3F2D A;  4PV1 C;  3MVV A;  5C0X G;  2EQS A;  5CV4 A;  4CHT B;  3S16 H;  2PMZ E;  1WCM G;  2Z8L A;  4ID6 A;  3GTQ B;  3K5N A;  4CDD C;  1E0B A;  4DV2 L;  4DR1 L;  3QB3 A;  1WTV A;  2Z6K A;  4A3B B;  2B8G A;  3FPU B;  4LUZ A;  2B29 A;  2IY5 B;  2RBM A;  3Q8D A;  4DR3 Q;  1LTB D;  4P72 A;  2H4O A;  4EX5 A;  4L5S A;  3PGZ A;  1TY0 A;  1ICF B;  1CI3 M;  5IGE A;  1I3Q B;  1ZYR D;  3OIP A;  1B9M A;  1WTW A;  3PUY A;  1KXL A;  2L1B A;  2A1A A;  2XRQ D;  2M00 A;  1HRJ A;  3LGJ A;  4DV3 L;  5IT9 c;  4EGV A;  2BE5 D;  4JYA L;  4K5X A;  5ELO A;  1WVL A;  1SYG A;  1SMY C;  1F9R A;  2DY7 A;  2L4N A;  1Q82 C;  4JG2 A;  3U4V A;  1XNQ Q;  3UDI A;  1RCV D;  2B63 H;  1HZC A;  3HOU G;  3NUC A;  3TRZ A;  1AH9 A;  3IKJ A;  5FJ8 G;  1LLR D;  3H3V C;  3PQI A;  2VQF Q;  1KAW A;  4A3M B;  2KHI A;  4ZUI A;  1LT6 D;  1HR0 W;  2NBF A;  4K2K A;  4QB4 A;  1WD1 A;  4GKK Q;  5A35 A;  2E2D C;  2Q2I A;  5EPK A;  4NXM Q;  1B50 A;  4A93 H;  1YZ6 A;  2WB1 G;  4YHH L;  2R6G A;  1IBM Q;  2PNR C;  3GTK B;  3T4A C;  2KCC A;  5DEH A;  4PMW A;  4XDX A;  3T1H L;  1EWH A;  1VDZ A;  2QW7 A;  4L6T B;  1AN8 A;  3G6J B;  3TEH B;  1BR9 A;  1H9R A;  1YVC A;  1ICW A;  1S3O A;  1AZP A;  2D0O A;  4LF7 L;  2K5D A;  4C3I B;  2RCF A;  4BY1 H;  2OF1 A;  5JAV A;  1X56 A;  4G57 A;  4OX9 Q;  1A3U A;  2EJG C;  1AEX A;  3J7A V;  4QUF A;  2ZJP A;  3FKI H;  3ONA B;  5ISR A;  2RQX A;  5HGT A;  3QG1 A;  1GUT A;  1KLU D;  3OMC A;  1QZG A;  4IOA A;  1QNU A;  4UY8 C;  5COY A;  2K52 A;  4DR7 L;  5K5P A;  2JQO A;  2OQ0 A;  2WAQ G;  2KEN A;  2E75 C;  2G9D A;  3AU7 A;  1EWI A;  3EQL C;  2IHE A;  4LJZ C;  2F03 A;  1H9J A;  5K36 H;  3NQT A;  1BO0 A;  4LFB L;  3NSW A;  4OWX B;  1HHV A;  2FMM A;  1EFW A;  5D14 A;  2JJQ A;  4B9W A;  2PMZ B;  4LAA A;  4JI6 L;  1KD1 C;  2PZU A;  2WIN B;  2Z1C A;  3OWF A;  4LF4 Q;  1EOV A;  2H5X A;  3I3C A;  1TU2 B;  4DNR B;  3HOY H;  3SK4 A;  4MHE A;  2EXD A;  1QCB D;  2R7Z B;  3OHX C;  1RTN A;  2QKI C;  1ONL A;  4PZ7 A;  1XMQ Q;  1STN A;  1XMO Q;  1QVG A;  1LTL A;  4IUR A;  1EL0 A;  1NTG A;  4LWC A;  4A3G B;  4QIW E;  1M8A A;  4MTN A;  1FNV A;  2ICI A;  1B4O A;  2I07 B;  3KJP A;  1Y1W H;  4C3H B;  1H95 A;  1NMF A;  2JYO A;  5J3B A;  1A2U A;  1VQ9 A;  4K14 A;  5GAG C;  3S16 B;  3TSS A;  1Q1B A;  4IPC A;  3PF5 A;  4A3E G;  1V1P A;  1TWG H;  3KUP A;  1EY7 A;  2PI2 A;  3K6O A;  3KDF A;  1YHQ A;  3OSO A;  2K5H A;  1G29 1;  1BF4 A;  3S15 H;  2ID0 A;  4IAL A;  2XWB B;  3TZD A;  4GNX C;  1HNZ L;  4DV6 L;  3KDF B;  1X3P A;  4A3C H;  4CJ1 B;  2Q8I B;  1N34 L;  3MWY W;  3HOZ H;  4DV7 L;  1A6X A;  5D65 A;  1DXM A;  2MNA A;  3VYS A;  4JI2 L;  4R4I A;  3KF6 A;  1GD7 A;  1K0S A;  1CSQ A;  2NTS A;  1O7L A;  5IGC A;  1VQ7 A;  1IYJ B;  3PO2 G;  4ZLT F;  2KUM A;  3QO2 A;  1IBL Q;  3I4L A;  1PA6 A;  3Q23 A;  3GV3 A;  5I9O A;  1R9T H;  3P20 A;  1HZ9 A;  4GNX B;  4NPS A;  1MJE A;  3ERQ A;  2AWN A;  2Z4I A;  5M3M G;  5CBA E;  4OGQ C;  1IHZ A;  4V19 0;  1E2Z A;  3R8B A;  1Z9F A;  1CTM A;  2EDG A;  3ER0 A;  1PHJ A;  5EPJ A;  2IX3 A;  4YY3 L;  2RSO A;  2JA9 A;  3KF8 A;  3ND8 A;  3W1G A;  2A6E D;  4Q0F A;  1RHP A;  1STB A;  4CKB A;  2JA5 H;  3J7Y W;  3H6M A;  4A93 B;  3DMU A;  1JC7 A;  2EJM A;  1IL2 A;  4B3M L;  3LNN A;  2ZTD A;  5L37 A;  3H09 A;  4QGU A;  4C1N K;  5DM6 3;  4FXK C;  1CHP D;  2BOS A;  2ZJQ A;  1O7I A;  3PUZ A;  4C3J G;  1I4G A;  2HCC A;  4DV4 L;  3GTG H;  1TWA H;  4B3R L;  2VW9 A;  4JI0 L;  2DY8 A;  4BY1 B;  2F0G A;  2E2J H;  4RCO A;  3NWT A;  3VR5 A;  1JT8 A;  5CV5 A;  4P71 A;  2WKD A;  3DWP A;  4KN4 C;  1FGB D;  2HDL A;  4TVA B;  4HID A;  2VUM H;  3BJU A;  4Q5V A;  3H94 A;  1TS3 A;  1OXT A;  3L2P A;  2YYZ A;  2NWG A;  2F0E A;  3G4S A;  1I4P A;  2E76 C;  1SSO A;  2PQA B;  2R92 G;  5EQ0 A;  4RGN A;  2LS0 1;  4QIW B;  1Y1V G;  4KD4 A;  2NZO A;  1TWH H;  5EJW A;  4OO1 H;  1YNN C;  4R4O A;  3T13 A;  1VQK A;  4L5T A;  2KA7 A;  3R2I A;  4NP5 A;  1E2W A;  3KBG A;  1JOQ A;  5CV6 A;  1ASY A;  2NN6 I;  5C4J H;  4PG3 A;  3LWU A;  5EKK A;  2IX1 A;  2NVT H;  3H91 A;  3HOY B;  4N8F A;  1IKM A;  5C3E H;  4L63 B;  3TP8 A;  1MJC A;  4IZ8 A;  1UAP A;  1N33 L;  1CM9 A;  3HKZ G;  1VCI A;  4HJ8 A;  1EEI D;  1JWM D;  1NCV A;  2VB3 X;  4C1N I;  3CU7 A;  5FLX E;  1BBU A;  1Y1W B;  5LMN L;  4DR6 L;  2F0J A;  1G2T A;  2K04 A;  2K4K A;  4X3U A;  4IOC A;  3RLN A;  3NP8 A;  4M1U B;  1X65 A;  2YTY A;  2Q8R E;  1C7Y A;  1C0A A;  5C5L A;  1BDO A;  2EYM A;  4EQP A;  1J5E L;  1TS4 A;  1TWG B;  1EQT A;  4DV2 Q;  1MKH A;  4RKL A;  2JK8 A;  1A15 A;  4ZRZ A;  4JBW A;  4BY7 H;  1IL8 A;  1RIP A;  4GOP C;  4A3D B;  2F0Q A;  2LXJ A;  2RHQ B;  5A2Q E;  1SE4 A;  3DXJ C;  2JA7 B;  1NY4 A;  2Y0S G;  5I9P A;  4GLA C;  1DM0 B;  5FLX c;  4ZKC B;  3I4N H;  2E2I H;  2Z4H A;  1B3Q A;  3M4P A;  4JVZ A;  2NN6 G;  1PZK D;  3HOZ B;  4DAY B;  4A3I G;  2UUC L;  1XJV A;  3GO5 A;  1HXY D;  4JCV E;  1SE2 A;  3DM3 A;  5KNB A;  3AFP A;  1B3A A;  3OW2 A;  4KK7 A;  3VYT A;  4J6H A;  3SK8 A;  4B08 A;  1DD2 A;  1BCP D;  4DR5 L;  1II3 A;  2I5H A;  5IP7 G;  4FO2 A;  4DV3 Q;  2UXC L;  4GOP B;  5GQO A;  3HOW B;  4LF5 L;  4JYA Q;  1R9T B;  1LM0 A;  1OXX K;  2QIL A;  5A2Q L;  5JEA J;  1L0X B;  2ZXP A;  1XPU A;  1MHW C;  4JI5 L;  4KY5 A;  5AFW A;  1N8R C;  1S40 A;  1JIC A;  1XTC D;  5C4X G;  4PMB A;  2JN4 A;  3GTQ H;  2JSO A;  4R4T A;  4HIK A;  2LFN A;  1YEZ A;  1YIJ A;  4ME5 A;  3NBH B;  3WWV A;  3CME A;  4I7A A;  4TSS A;  5LL6 S;  4A3B H;  4K0K L;  2BDO A;  3UDG A;  2VB2 X;  4MIU A;  3GTM B;  2MO1 A;  3D4D A;  2AUJ D;  2LY7 A;  5T1I A;  4DGZ A;  3STB D;  1X54 A;  3G48 A;  5D3D A;  5K36 G;  3MFY A;  1G91 A;  3G7L A;  4YHH Q;  2E8G A;  1EEF D;  1O80 A;  1SNM A;  1HTP A;  1VF5 C;  1I3Q H;  3N6R A;  3T1H Q;  4P73 A;  4NB3 A;  3GTG B;  1TWA B;  5EKI A;  1QZH A;  1L0W A;  4LF7 Q;  2CQA A;  2E2J B;  2I5M X;  1EFI D;  2CH4 W;  1FNW A;  3D6W A;  3ERO A;  4A3L H;  1HJP A;  4JW0 A;  1CQF A;  3Q22 A;  3K58 A;  3NQI A;  1K3R A;  1JJG A;  1BBW A;  1EIH A;  2VUM B;  2F0U A;  4DR4 L;  3AFQ A;  4ZUJ A;  4RGO S;  3A0J A;  5D3I B;  1YHB A;  4DR7 Q;  2ZTC A;  5KGU A;  1PVO A;  1U0L A;  1G6Z A;  1VQP A;  1VQI A;  1TWH B;  4LFB Q;  1PH5 A;  4JOI A;  1QVC A;  2I0Q A;  3L9A X;  3QOJ A;  3I91 A;  1B9N A;  2UXB Q;  5GAD C;  1PH9 A;  5HY6 A;  4JI6 Q;  4BXX G;  3EJI A;  1DZ1 A;  2RF4 A;  2NVT B;  1IZ6 A;  3K7U C;  2F0S A;  1YBY A;  2C35 B;  3MZ5 A;  5C3E B;  3GTK H;  3KJO A;  1X55 A;  4EVO A;  1W2B A;  1TXY A;  3K8A A;  1PRT F;  3M7G A;  4XQQ A;  4CBV A;  1IYU A;  3OWE B;  4CJ0 B;  2KCT A;  3WOF A;  4UDU C;  3CCL A;  2Q2T A;  5M3F G;  1CZG A;  5IGG A;  4GN3 B;  3TZU A;  1EIG A;  1R4P B;  2KJX A;  3MAQ A;  3VR4 A;  2AUK A;  3FDT A;  4LFA L;  2MFI A;  2QDL A;  5ELC A;  5NUC A;  2ES2 A;  3SHL A;  2GA4 B;  4BA1 I;  3BZK A;  3SR1 A;  4BY7 B;  4JI1 L;  5IGF A;  2F0N A;  5GRO A;  1GUO A;  4RWS C;  4BBS H;  1TT2 A;  4O42 A;  1PRT C;  3K5O A;  2HT1 A;  1A0I A;  1OTC A;  2A74 C;  1XX8 A;  4LF8 L;  1HNZ Q;  2B2T A;  3I4N B;  2E2I B;  2RA4 A;  4DV6 Q;  1D2B A;  1HUM A;  2EYH A;  4POF A;  1O78 A;  5C44 H;  1N34 Q;  2IJ0 A;  3AMU A;  2AMC B;  4DV7 Q;  3QR8 A;  2ZT9 C;  1E22 A;  4DN4 M;  2JA5 G;  2JA6 H;  1RKN A;  1MI2 A;  2ZXR A;  4KV6 A;  1STE A;  3HKS A;  1UE1 A;  5JEA H;  4ULL A;  3J80 E;  5IWA L;  1BCP B;  4KHZ A;  1CKO A;  1PTO D;  4KMU C;  3STB C;  1EUJ A;  3G6E A;  2Z6K C;  1Q8K A;  3GQB A;  5DAU A;  3U9O A;  3WOE A;  5FLM H;  1XTD A;  4JBK A;  1EY0 A;  4BBR G;  2D5D A;  1PZI D;  1GXD C;  1VMP A;  1T9H A;  1VQO A;  1SNQ A;  4HJA A;  2XGT A;  3RN5 A;  1SE3 A;  5IYD G;  1ET6 A;  2K75 A;  1VQ5 A;  4IFD J;  2WP8 J;  3HOV G;  3HRZ C;  2PYK A;  3E6Z X;  4QMG A;  2IL8 A;  5I6W A;  1EU3 A;  4A3K H;  2WAC A;  2G5D A;  1PYW D;  3H0G G;  2BCO A;  4JBM A;  1SE8 A;  1D5Z C;  3OYY A;  3J80 L;  3S1N H;  3HS0 C;  3VR2 A;  1NBW A;  1CFM A;  1OXV A;  2A69 D;  3P7J A;  3RZD H;  4B3S L;  1QUQ A;  4KKS A;  4J15 A;  4DV4 Q;  3J80 i;  4B3R Q;  1A8V A;  4JI0 Q;  5IYB G;  4X65 L;  4DV5 Q;  3I4M G;  2Z6B A;  4XTC S;  5F2D A;  1NNX A;  3A7A B;  1MBY A;  2PNH A;  3F8T A;  1PFS A;  2EXZ A;  1DJR D;  1LT3 D;  5KYI A;  1VQB A;  3J7A F;  5IYC H;  3ULJ A;  3DEO A;  1RF2 D;  2N3S A;  4ZAI A;  2R93 H;  4OHJ A;  2PI2 E;  1EOT A;  1ILP A;  1DOM A;  3S9W A;  3BYT B;  1DOL A;  1PV4 A;  1PMR A;  3J7Z C;  2R7D A;  3A7L A;  4CDF C;  3S24 A;  3M4Y A;  3OOC A;  1K73 C;  4A3J G;  1YHA A;  1E7Z A;  1KQS A;  1HA5 A;  2V4D A;  4HR7 B;  4K8I A;  1Z7T A;  4IUV A;  4RMF A;  4V0B A;  4Y52 H;  1S5D D;  1FNU A;  3CCV A;  4IJL A;  3TRE A;  2L9H A;  2EY5 A;  1SDF A;  1EYA A;  4H02 A;  4NKL A;  5CV7 A;  1STH A;  4DUY L;  2JA8 H;  2ENB A;  3HKZ E;  4YWK A;  3ULL A;  4A76 A;  3KLS X;  1XWE A;  1IKL A;  3T51 B;  4WJW A;  4RGM A;  2HIV A;  2ZJR A;  5ELF A;  5DM7 3;  1MSH A;  1N33 Q;  3E3X A;  2OTJ A;  1UWV A;  1S5E D;  1EQV A;  1HUN A;  3TME A;  2X6L A;  4DK0 A;  2RDG A;  2QF7 A;  1P16 A;  4JI3 L;  2UU9 L;  2F0T A;  1G51 A;  3PO3 G;  5E1F A;  5LMN Q;  4DR6 Q;  1CSP A;  3GV6 A;  4R9W A;  2K05 A;  1AE2 A;  5CV8 A;  3D0F A;  3KLS A;  1B2T A;  2ASB A;  2CCZ A;  2EOT A;  3QJY A;  4HSP A;  2PW5 A;  4BBS B; 
#chains in the Genus database with same CATH homology
 4R4C A;  4C3J H;  2UUA L;  1O7I A;  3M4Q A;  3PUZ A;  5IP9 H;  2ZJQ A;  4YCW A;  2VQE L;  2LXK A;  5IP9 G;  4DV4 L;  3EN2 A;  3GTG H;  1TWA H;  4B3R L;  2VW9 A;  3PSI A;  4JI0 L;  1D8L A;  4Y7N H;  1N32 L;  1EIY B;  1W3S A;  2KBN A;  1RL2 A;  2DGY A;  4IJH A;  2E2J H;  3GTO H;  1E24 A;  4AYB G;  5C0X J;  5DLQ E;  3M4O H;  1FVI A;  3BU2 A;  3CXC A;  3S1R H;  4POG A;  1UE6 A;  4QJF A;  3CCE A;  1I5F A;  1JT8 A;  4P71 A;  2UUC Q;  2KHJ A;  4HIM A;  4PZ6 A;  3PV0 A;  3KOJ A;  3TS0 A;  3J80 c;  4YY3 Q;  4LFC L;  4TVA B;  4HID A;  3RNU A;  4LF9 Q;  2VUM H;  3BJU A;  1GO3 E;  3CW2 C;  1K83 H;  2BA0 A;  2VUM G;  1OXT A;  3L2P A;  2JEB I;  1E3P A;  1YNX A;  2YYZ A;  2YTX A;  3CCQ A;  3G4S A;  4EQ5 A;  1VQ4 A;  1K9M C;  4DR5 Q;  2R92 H;  2IX0 A;  2PQA B;  2HHH Q;  3H15 A;  3UE0 A;  2R92 G;  1Y1V H;  3B6Y A;  1HZA A;  1Y1V G;  4B3M Q;  4YWL A;  3F2C A;  2NZO A;  2UXC Q;  4LF5 Q;  1TWH H;  4NXN L;  4IFD G;  4R4O A;  4JI7 Q;  4OO1 G;  2VY3 A;  3M3Y H;  1VQK A;  3UE1 A;  4L5T A;  1SMX A;  1SRU A;  2F52 A;  4X62 Q;  2OWO A;  4WJ3 M;  1ASY A;  2NN6 I;  3CQZ H;  5C4J H;  1IBL L;  4PG3 A;  4A3F H;  2VNU D;  4KI0 A;  3H3V I;  2VZA A;  4A3F G;  4KHP L;  1FGU A;  2IX1 A;  2NVT H;  4OXP A;  4IO9 A;  1VQD A;  1N32 Q;  1M1K C;  5C3E H;  1TWC H;  5IE8 A;  3I56 A;  4BA2 I;  1DGS A;  2YV5 A;  5C3E G;  4X66 Q;  1SLJ A;  1QUQ B;  4A3D H;  1MJC A;  3PIO A;  1N36 Q;  4K0K Q;  3A74 A;  1N33 L;  2JA7 H;  1JMC A;  3HKZ G;  1VCI A;  4HJ8 A;  2NZH A;  4JV5 L;  1Q46 A;  3GTJ H;  1I94 L;  3K7A H;  4P74 A;  4JI4 L;  3NEM A;  2N49 A;  1BBU A;  4A3M H;  1B7Y B;  3ZJY C;  3F1Z A;  4LF6 L;  4UPA A;  5LMN L;  4A3M G;  1XPR A;  4DR6 L;  1FL0 A;  2EIF A;  5LMU L;  2K4K A;  1E1T A;  4X6A H;  2K14 A;  4IOC A;  5JJL A;  1V43 A;  3RLN A;  1X65 A;  2YTY A;  3K81 C;  1PH1 A;  3OTO Q;  1NMG A;  1C7Y A;  1C0A A;  4DNI A;  3PUX A;  3AEV A;  1J5E L;  2N8N A;  1HNX Q;  1FJG L;  1D7Q A;  4L5Q A;  2UUB L;  3ERS X;  4DV2 Q;  1MKH A;  2JK8 A;  4JBW A;  4BY7 H;  3HFZ B;  3F2B A;  3PUV A;  1RIP A;  1VQE A;  3CP0 A;  3KF6 B;  3PUW A;  4GOP C;  4BY7 G;  3CF5 A;  1X9N A;  1C9O A;  1VQC A;  2LXJ A;  2RHQ B;  4YWM A;  1WFQ A;  3L0O A;  3HOW H;  2Y0S G;  1NY4 A;  1WYD A;  1BVS A;  4GLA C;  1E1O A;  5FLX c;  2CWA A;  3D31 A;  2IT1 A;  3I4N H;  1JJC B;  3EBE A;  4O0A A;  2E2I H;  2OTL A;  4C3I H;  3M4P A;  1EQR A;  3I4N G;  2NN6 G;  3H3V H;  4A4I A;  2NVX H;  4DR4 Q;  4XIG S;  4A3I H;  4DAY B;  4A75 A;  2A19 A;  4GKJ L;  3EIV A;  3ICE A;  1CKN A;  4DV0 Q;  5GAH C;  4A3I G;  2UUC L;  5JJI A;  1XJV A;  2AKW B;  3GO5 A;  2ALY B;  3NEN A;  4L5R C;  2GVA A;  4JCV E;  3IRB A;  4JI8 Q;  2YTV A;  1N9W A;  3AFP A;  3DM3 A;  5C0X I;  3OW2 A;  1HNW Q;  3CCU A;  3AYH B;  4DUZ Q;  3CPW A;  4LUO A;  1BKB A;  4QY7 A;  1Q12 A;  2RCN A;  4DR5 L;  4YCU A;  5IP7 H;  2HHH L;  3TQY A;  3U4Z A;  2I5H A;  5IP7 G;  5GAE C;  4DV3 Q;  3E9H A;  1JB7 A;  4DV1 Q;  3CC2 A;  3GTM H;  4GOP B;  1CKM A;  2Y0S E;  5GQO A;  2QA4 A;  4R1J A;  3JC6 6;  3M9B A;  3HOX H;  3W1B A;  1J5E Q;  4LF5 L;  4JYA Q;  3KF8 B;  5E7N A;  3AQQ A;  3MXN B;  3HOX G;  1LM0 A;  3GTL H;  4JI7 L;  1OXX K;  5JEA J;  4IPD A;  3FHW A;  5M5Y H;  3VDY A;  3TS2 A;  1XPU A;  1VQA A;  4X62 L;  4O2D A;  4JI5 L;  1N8R C;  4OON A;  5C4X H;  1S40 A;  4LUV A;  2CKZ B;  5C4X G;  1SFO H;  1B8A A;  3GTQ H;  4HIK A;  4R4T A;  4DR2 Q;  2QGQ A;  1WJJ A;  1YEZ A;  1J6Q A;  4DK6 C;  2YU9 H;  1YIJ A;  2ZTE A;  4GLV B;  3JAM i;  2OQK A;  3NBH B;  3WWV A;  4QL5 A;  3CME A;  1VQN A;  2JEA I;  4X66 L;  1YJW A;  2R7Z H;  4ALP A;  1A62 A;  4AQY Q;  1N36 L;  2D62 A;  4A3B H;  4JC0 A;  3J81 i;  2JE6 I;  2R7Z G;  4LFA Q;  4GKJ Q;  3UDG A;  4K0K L;  4A3B G;  4KLK A;  3NEL A;  3FP9 A;  4A3G H;  2ZM6 Q;  1K8A C;  3S1Q H;  1XNR L;  2MO1 A;  3CAM A;  4A3G G;  3I7F A;  3STB D;  1X54 A;  3G48 A;  4MNO A;  1Q86 C;  1KC8 C;  1B70 B;  5K36 G;  4YHH Q;  2E8G A;  4C3H H;  4GS3 A;  4JI1 Q;  3F2D A;  2WFW A;  2UXB L;  5C0X G;  1I3Q H;  3T1H Q;  2V1C C;  1VS0 A;  2EQS A;  1WCM H;  3M85 A;  3S16 H;  3OTO L;  2PMZ E;  4P73 A;  1KIX A;  1WCM G;  4NB3 A;  3CPF A;  1QZH A;  1HNX L;  3CCM A;  4LF8 Q;  1L0W A;  4DV2 L;  2D0P A;  4DR1 L;  1PH8 A;  4LF7 Q;  2I5M X;  2Z6K A;  2I5L X;  4JI5 Q;  4A3L H;  3GD7 A;  3G71 A;  1HJP A;  1U5K A;  4A3L G;  4LUZ A;  2B29 A;  3RR5 A;  2IY5 B;  1OXS C;  3Q8D A;  1K3R A;  4DR3 Q;  1JJG A;  1I6H H;  1BBW A;  3SGI A;  2VQF L;  4P72 A;  2NVQ H;  4DR4 L;  4JBJ A;  4EX5 A;  5M5W H;  1VQG A;  3PGZ A;  2Z0S A;  3AFQ A;  3J81 j;  4L5S A;  3A0J A;  5IWA Q;  4DV0 L;  1YHB A;  4FDB A;  4IPH A;  2F4V Q;  4DR7 Q;  2AWO A;  2ZTC A;  1PVO A;  1U0L A;  4JI8 L;  1VQP A;  1HZB A;  3E9I A;  1XPO A;  1VQI A;  2KCM A;  1HNW L;  4AH6 A;  4HJ5 A;  1VQM A;  4NXM L;  1XNR Q;  2CWP A;  4LFB Q;  4DUZ L;  1PH5 A;  2HIX A;  1X3G A;  4JOI A;  1QVC A;  2E5L Q;  2I0Q A;  3PUY A;  4OWW B;  1VQ6 A;  1KXL A;  2A1A A;  3RLO A;  2DUD A;  5AJ3 Q;  2UXB Q;  4HJ9 A;  3RN2 A;  4BXX H;  3LGJ A;  4UP9 A;  4DV3 L;  5GAD C;  4DV1 L;  5IT9 c;  1EIF A;  5HY6 A;  1PH9 A;  4JI6 Q;  4BXX G;  4DKA C;  1V9P A;  4JYA L;  4P75 A;  3U50 C;  5ELO A;  2RF4 A;  2QEX A;  1IZ6 A;  3J7A 5;  3K7U C;  4HIO A;  1YBY A;  2C35 B;  4DR1 Q;  1HR0 Q;  1Q82 C;  4JG2 A;  3KJO A;  3GTK H;  3U4V A;  1X55 A;  4YCV A;  1W2B A;  1XNQ Q;  1TXY A;  3UDI A;  2B63 H;  3HOU H;  1SR3 A;  1HZC A;  3K8A A;  3HOU G;  2B63 G;  3TRZ A;  5FJ8 H;  2KCT A;  1AH9 A;  5H1S E;  1ASZ A;  2F3I A;  3S2H H;  2FXQ A;  2OCE A;  1NE3 A;  5FJ8 G;  5M3F H;  4DR2 L;  3CCL A;  2Q2T A;  1GM5 A;  5M3F G;  4GN3 B;  1S72 A;  5IY0 A;  3CC4 A;  2UXD Q;  1A63 A;  2MQH A;  1KAW A;  2VQF Q;  1IBK Q;  2KHI A;  2BH2 A;  1SN8 A;  4AQY L;  1HR0 W;  1Q7Y C;  3S17 H;  4LFA L;  3K0X A;  2MFI A;  2ATW A;  2RHS B;  4GNX A;  4GKK Q;  1HH2 P;  2Q2H A;  2ZM6 L;  2Q2I A;  4NXM Q;  5BR8 Q;  4A93 H;  2ES2 A;  3PCO B;  3A5Z B;  1YZ6 A;  4A93 G;  2WB1 G;  3JAM c;  4YHH L;  4AIM A;  4BA1 I;  2R6G A;  3BZK A;  3W5O A;  1OXU A;  1IBM Q;  1CKN B;  4JI1 L;  4ME3 A;  3CMA A;  3K80 C;  5GRO A;  4X65 Q;  2BH8 A;  4PMW A;  3J81 c;  3T1H L;  4IPG A;  2E2H H;  5EAY A;  4BBS H;  4LW1 A;  3PIP A;  3TEH B;  4BBS G;  1VQH A;  2HT1 A;  1A0I A;  1YVC A;  3MEF A;  1OTC A;  1Q1E A;  1VQ8 A;  4LF8 L;  1S3O A;  3L7Z C;  4R4Q A;  1HNZ Q;  2D0O A;  1PH6 A;  1AE3 A;  3BZC A;  4DV6 Q;  4LF7 L;  4BY1 H;  2K5N A;  1YJN A;  1X56 A;  4POF A;  5C44 H;  1N34 Q;  3T1Y Q;  4BY1 G;  1PH3 A;  1KRT A;  5C44 G;  3CD6 A;  2AMC B;  4WJ4 A;  4DV7 Q;  4OX9 Q;  1E22 A;  2NVY H;  2JA5 G;  2ZJP A;  4DR3 L;  5ELN A;  2JA6 H;  3FKI H;  2JA6 G;  4HJ7 A;  3HKS A;  3FKI G;  4UP8 A;  2WB1 E;  1UE1 A;  4LNQ A;  5IWA L;  1QZG A;  5JEA G;  4IOA A;  4KHZ A;  2F4V L;  1CKO A;  4UY8 C;  2K52 A;  4DR7 L;  4OWT B;  4X64 Q;  2JQO A;  2OQ0 A;  2WAQ G;  3STB C;  2KEN A;  1EUJ A;  2K50 A;  3G6E A;  2Z6K C;  1Q8K A;  1EWI A;  2IHE A;  4LFB L;  5FLM H;  4DUY Q;  1PYS B;  2E5L L;  1XTD A;  1PYB A;  1VQF A;  5FLM G;  4BBR H;  4OWX B;  1IXR A;  3I2Z A;  4JBK A;  1PH4 A;  4BBR G;  5AJ3 L;  1EFW A;  1P8L A;  4DV5 L;  4QQB X;  2XTI A;  1CUK A;  2JJQ A;  1T9H A;  1X3E A;  2BA1 A;  4JI6 L;  1KD1 C;  4B3T Q;  1VQO A;  3KYH C;  1L1O A;  1X3F A;  2A8V A;  5IYD H;  4HJA A;  2XGT A;  3RN5 A;  2VS1 A;  4LF4 Q;  1Y14 B;  2PQA A;  1EOV A;  5IYD G;  2H5X A;  3HOV H;  2K75 A;  1VQ5 A;  4IFD J;  2WP8 J;  1HR0 L;  3HOY H;  3HOV G;  4UP7 A;  1XNQ L;  3S1M H;  3HOY G;  3RZO H;  2EXD A;  4DK3 C;  2UU9 Q;  4JI3 Q;  3GTP H;  1M90 C;  2HQL A;  1PH7 A;  4A3K H;  3H0G H;  2VL6 A;  4JOI C;  4PZ7 A;  1L1O B;  1XMQ Q;  3PF4 A;  1XMO Q;  4A3K G;  3H0G G;  1LTL A;  4RG1 A;  1QVG A;  2WAQ E;  1NTG A;  4LWC A;  1SE8 A;  3OYY A;  1EQQ A;  4JBM A;  5HGQ A;  4GN5 A;  2UXD L;  3S1N H;  3S2D H;  1IBK L;  4QIW E;  3UDX A;  4MTN A;  3KJP A;  1Y1W H;  1VQJ A;  1H95 A;  1NMF A;  1NBW A;  3A5U A;  1OXV A;  1Y1W G;  5J3B A;  3RZD H;  4B3S L;  4GKK L;  1K8G A;  1VQ9 A;  4AYB E;  2UUA Q;  1QUQ A;  5GAG C;  1LYL A;  1I50 H;  5BR8 L;  4J15 A;  2VQE Q;  1Q1B A;  4DV4 Q;  4A3E H;  2B3G A;  2GN5 A;  4IPC A;  3J80 i;  3PF5 A;  4A3E G;  4B3R Q;  4GLX A;  1A8V A;  1TWG H;  5IYB H;  1TWF H;  1X6O A;  1IBM L;  1V1Q A;  4JI0 Q;  3I4M H;  2PI2 A;  5IYB G;  3KDF A;  4X65 L;  4DV5 Q;  3I4M G;  1YHQ A;  4XTC S;  3UDF A;  1EYG A;  2K5H A;  1G29 1;  5JJK A;  2PNH A;  3F8T A;  2UXC L;  1PFS A;  3S15 H;  2ID0 A;  4A3D G;  4C2M H;  1GVP A;  1VQB A;  1WI5 A;  3CCR A;  4DAM A;  4GNX C;  5IYC H;  2JA7 G;  3ULJ A;  3RLF A;  1HNZ L;  2N3S A;  5IYC G;  2GVB A;  4DV6 L;  2R93 H;  3KDF B;  4A3C H;  2PI2 E;  4LFC Q;  1KHI A;  1N34 L;  2N78 A;  2R93 G;  4MZ9 A;  3ULP A;  1KL9 A;  3T1Y L;  4A3C G;  3HOZ H;  4DV7 L;  1JJ2 A;  4OX9 L;  1GKH A;  1K0R A;  4APV A;  3HOZ G;  2MNA A;  1PV4 A;  4JI2 L;  4R4I A;  3J7Z C;  2R7D A;  3KF6 A;  1QVF A;  3S24 A;  1GD7 A;  4A3J H;  1UE7 A;  3I4O A;  1K73 C;  2R7F A;  4A3J G;  1CSQ A;  1YHA A;  1E7Z A;  1KQS A;  3KFU A;  4NXN Q;  3DLL A;  3PO2 H;  3KLW A;  3CC7 A;  1VQ7 A;  4B3S Q;  1IYJ B;  3PO2 G;  4X64 L;  4RMF A;  1PH2 A;  4DPG A;  1YI2 A;  4Y52 H;  1UEB A;  3CCV A;  1IBL Q;  4IJL A;  3TRE A;  2CFM A;  1PA6 A;  1NJI C;  1G6P A;  4H02 A;  1JE5 A;  4DUY L;  2JA8 H;  4KHP Q;  5M5X H;  2Q2U A;  3HKZ E;  3CCS A;  1R9T H;  4YWK A;  2IHF A;  2JA8 G;  1LUZ A;  2MO0 A;  3ULL A;  3HOW G;  3S14 H;  3E0E A;  4A76 A;  1MIU A;  1HZ9 A;  4GNX B;  4NPS A;  1VQL A;  1Q81 C;  5M3M H;  1MJE A;  2AWN A;  2HIV A;  1L2F A;  3GDE A;  5M3M G;  2ZJR A;  4B3T L;  1Z47 A;  1N33 Q;  4LF4 L;  3M7N A;  2OTJ A;  1UWV A;  1Z9F A;  4PZ8 A;  4JV5 Q;  2LSS A;  3ER0 A;  1I94 Q;  4GOP A;  1PHJ A;  4JI4 Q;  4YY3 L;  1P16 A;  4JI3 L;  1YIT A;  2UU9 L;  2JA9 A;  4LF9 L;  1G51 A;  3W1G A;  3PO3 H;  4LF6 Q;  3PO3 G;  5LMN Q;  3U58 A;  1YJ9 A;  5LMU Q;  1XMQ L;  4DR6 Q;  4IFD I;  1WOC A;  2JA5 H;  1XMO L;  4JI2 Q;  1CSP A;  2CQO A;  4OO1 I;  4GN4 B;  4TQU S;  3I55 A;  1KRS A;  1AE2 A;  2K5V A;  1IL2 A;  3D0F A;  4B3M L;  2ZTD A;  1L1O C;  1FJG Q;  2AHO B;  4QGU A;  2UUB Q;  2ASB A;  2CCZ A;  1UE5 A;  2L15 A;  1SRO A;  3CCJ A;  5LMN W; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...