1STGA

Two distinctly different metal binding modes are seen in x-ray crystal structures of staphylococcal nuclease-cobalt(ii)-nucleotide complexes
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
136
structure length
136
Chain Sequence
KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase(phosphoric diester)
molecule keywords STAPHYLOCOCCAL NUCLEASE
publication title X-ray crystal structures of staphylococcal nuclease complexed with the competitive inhibitor cobalt(II) and nucleotide.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 38
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 1994-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1stgA00
5C3XA 1A2TA 1KDCA 4J6HA 3D6CA 1TT2A 4HTHA 1EY5A 1TQOA 2F0NA 3HEJA 4NDXA 2PQEA 4K14A 4N9PA 5IGEA 3NK9A 3E5SA 5KEEA 5CV6A 3OSOA 5ISRA 3MVVA 2EY2A 1JORA 4KY6A 2EYMA 3SXHA 2SOBA 2F0UA 2F0VA 4OL7A 4I65A 1SNMA 1II3A 1EYCA 3NQTA 1SNPA 3T13A 5CV4A 2EYLA 2F0QA 1F2YA 3EJIA 4HMJA 4QMGA 1JOKA 4EQOA 3SK5A 4EQPA 2KQ3A 3ERQA 5I6WA 2F0IA 2QDBA 5JAVA 4KY5A 4ZQ3A 3BDCA 4KTAA 3EVQA 5HURA 3SK6A 1RKNA 3D4WA 2RDFA 3QB3A 4F8MA 1SYCA 2PW7A 1STBA 2PZTA 2F0LA 4EVOA 2F0OA 3DHQA 5C5LA 2SNSA 1JOQA 4ME5A 1SNOA 5JOBA 1SNDA 1KABA 1KDAA 4K8IA 1EY4A 1F2MA 3ITPA 3VA5A 3EROA 4IZ8A 4K8JA 5EGTA 5I9PA 1F2ZA 4YIJA 5CR3A 5IIFA 5DEHA 5IGCA 2F0GA 2O4XA 1EZ8A 1A3VA 2F0DA 3LX0A 4KD3A 5CV9A 3SK8A 1EZ6A 3MHBA 4B9XA 5IGDA 2F0MA 3D8GA 1EY7A 2EY5A 4G57A 4DGZA 5IGBA 3S9WA 2KHSA 1ENAA 4WRDA 3OMGA 4IUNA 4ZUJA 1SYFA 3SK4A 1KAAA 2EY1A 2OEOA 4S3SA 3TP7A 3P75A 4LAAA 4K5VA 5IOCA 3TP6A 5IODA 2EYJA 2RKSA 5IGGA 5J1ZA 3OMCA 2EYFA 2NUCA 4H7BA 3V2TA 2EXZA 4RKBA 3NHHA 5CV5A 4NP5A 1SYEA 2F0JA 3H6MA 4K6DA 4KV6A 2ENBA 4ID6A 2SNMA 4EQNA 4NMZA 4DFAA 1EYDA 1EY9A 2F0TA 4HMIA 4DF7A 3T16A 5C3WA 3HZXA 2EYHA 1ENCA 4R8NA 3NP8A 5CGKA 5KGUA 5CC4A 4QF4A 2PZUA 3C1EA 1SYDA 3NXWA 4PMBA 3PMFA 5EKLA 3TP8A 5I9OA 5CV8A 2PZWA 4K5XA 5KRUA 5M9OA 3R3OA 4K5WA 4KD4A 1A3TA 5C6AA 2F0PA 1EY0A 1JOOA 1STYA 1STGA 4PMCA 1EQVA 1NUCA 4RKLA 2F0SA 4K2LA 3NUCA 4ZUIA 3D4DA 2F0FA 5C4HA 4E6IA 2PYKA 1IHZA 2EYPA 2F0HA 3DMUA 3QOJA 1STAA 5E3FA 4K2KA 1SYGA 4TRDA 2F0KA 1STHA 3MEHA 4NKLA 2F0WA 2LKVA 2M00A 1A3UA 3SR1A 4ODGA 5J22A 4B9WA 2WACA 5I6YA 1A2UA 2HQEA 3OWFA 4KJOA 1U9RA 1STNA 2RBMA 3BDLA 3QOLA 3TMEA 1SNQA 2F3WA 5E1FA 4F7XA 2EY6A 4J1MA 1NSNS 1KDBA 1SNCA 5DAUA 2OXPA 5CV7A 3P1HA 5F2DA 5C4ZA 5K5PA 5NUCA 2PW5A 4DU9A 1TR5A 4IALA 1EY6A 1EY8A 2F3VA 5KYLA 5KYIA 5J39A 4KHVA 5HGTA 4KJNA 4MIUA 1EYAA 4WORA 4PNYA 3U9OA 5EKKA 3SHLA 3TP5A 5KIXA 3MXPA 1SYBA 3MZ5A 1AEXA 2EYOA 3C1FA 4QB4A 5IGFA 4KY7A 2OF1A 3RUZA 5C5MA 4N9TA 2F0EA
chains in the Genus database with same CATH superfamily
4NDXA 1EY5A 1V1QA 2F0NA 3AQQA 4DN4M 1L2FA 2KBNA 4B3SQ 3MVVA 1MKHA 4A76A 1HTLD 4IQZA 3T13A 4NXML 3KYHC 4CKBA 1C8CA 1VQEA 1W2BA 4N8FA 2EIFA 4A3KB 2UU9L 1RKNA 2QEJC 2MP1A 1GOZA 1Q90A 4KI0A 3L0OA 4APVA 4CKEA 2NN6H 5DLQE 4V190 5LL6S 2KCTA 3J7AV 4GKJL 4R8IA 2F0MA 4ZUJA 1KD1C 2GN5A 2PQAB 4LF6L 1Y69U 3WDNA 2CHBD 4ZAIA 5IOCA 2JA5B 5IP7H 1VS0A 5M5XB 4NB3A 3V2TA 2HCIA 1S5CD 2Q8TA 4X65Q 3CMAA 1EYGA 1OXVA 1RD9D 5CV8A 1D5XC 2XTIA 2F4VQ 3PF5A 1JOOA 2ZJQA 2PNRC 3D4DA 3QJYA 4LFCQ 3D31A 2UXCL 1Q82C 1I3QB 2KJXA 1YITA 2EDGA 3DUZA 1H9RA 3S16H 2LKVA 3Q0AA 3HOWG 5IYDG 1E2ZA 2GVBA 1K0SA 2MHVA 4QL5A 5DAUA 3KBGA 1F9PA 3P1HA 2KOLA 4DU9A 1WVLA 3BJUA 3IFTA 3GO5A 5EPJA 2WIIB 5IYBG 4A3LG 4C3IB 1J6QA 1B3QA 4WORA 3GTMH 2Q2HA 4XQQA 3HOXG 3F2CA 1CKOA 4IJLA 4IFDJ 1GM5A 1MD2D 1AH9A 4IUQA 2MO0A 4ZCKA 2EVBA 1TWAB 4GNXB 1CHQD 5M3MG 3N6RA 1OXSC 3KDFA 1F9RA 1BCPD 2QDBA 2SDFA 4A3IB 1VQOA 4X65L 1ENFA 3G7LA 2XN9C 5C0XG 4B3RQ 2Z4IA 5IP7G 4ME5A 2I5HA 3CW2C 2K32A 3ITPA 3J81L 4C3JH 4B3MQ 4CJ1B 2F0DA 2E74C 4LFCL 5D14A 2MNAA 2MFIA 1VQIA 5LHY1 2PI2A 1ASYA 2AUKA 2Y0SE 3D4RA 4PZ8A 3S2HB 2EXZA 2KHIA 3K5MA 5IT9c 4C56C 2LSSA 2JA7G 2NVQB 2ENBA 2Q2IA 4ID6A 5DNFA 1VQKA 1BOSA 2Z6KA 3NE5B 3C1EA 3NXWA 3T1HL 2Y0SG 5A2QL 2J0TD 3M4QA 3M3YH 2L11A 1GD7A 1X9NA 2WB1E 2A19A 4L5SA 1WTQA 1EQVA 4LUOA 4RKLA 1BBUA 1QNUA 4DK0A 1S4ZA 1KQSA 1HUMA 1SYGA 1TWFB 1K73C 1S5ED 1OO9B 3J80L 4LMQD 3I4MB 1X6OA 2ALYB 1B70B 1HXYD 3BG3A 4HJAA 1X3QA 4NPSA 4CKCA 5C3EG 3AB9A 1G6PA 1LV9A 1SEBD 1Y8OB 5ELDA 4GOPB 1G2SA 2R93H 2UUBQ 1PFNA 4A3MB 3GTLH 4C3HG 1IL8A 2F52A 3MA2B 4PZ7A 1EYAA 1F2LA 1K0RA 1FNUA 3M4OB 3RZOB 1HZBA 2HHHQ 3OOCA 4OO1G 2KEEA 5CV5A 1PTOC 1YEZA 5C5MA 1HRJA 1CZWA 3SE0A 4B3ML 1EFID 2DNEA 1SJHD 2PQEA 1D5MC 3ZJYC 1SROA 3J7YW 3MAQA 2EY2A 4KY6A 3S1NH 2WAQB 4H0LC 3J7ZC 1JE4A 1F9SA 3DEOA 1X55A 2NVXB 2D0OA 2FINB 4GS3A 3U4ZA 3EJIA 3A8JE 1ESRA 4DR7Q 1SLJA 2AHOB 1PHJA 2IY5B 2WFWA 1RHPA 2AKWB 4OONA 1ML0D 4BBSG 4F8MA 1I6HB 3HOYB 4JBWA 3CCJA 3MC0B 5C5LA 4GLAC 3RMHA 1KTKA 4U673 1CFMA 3CU7A 4A3GG 3DLLA 1PFSA 5T1IA 4PG3A 3LX0A 5M3FG 4A3DH 2Z6KC 3OIPA 1R9TB 4JV5Q 3QIAA 4L63B 4AQYQ 3I90A 4CGYB 2F3IA 1VF5C 4M1UB 4TSSA 2OQ0A 2VB3X 1HJPA 5GAHC 1D1IA 3TP6A 2RKSA 1JJ2A 1HH2P 1PRTD 4BY7G 1X3EA 5FKAC 3OW2A 3U9SA 1MBYA 1TWGH 4LUZA 2JA8H 3NSWA 5D65A 3TREA 5JJKA 2E76C 4H13C 2UUBL 3PIPA 5L37A 1VQ6A 4RGTA 3TP8A 4DV5Q 3BU2A 1IBLQ 3MXNB 1EUJA 1LTGD 1CA6A 1JWUD 2HHHL 5C4HA 2EYPA 4IPDA 5HY6A 2X6LA 1PH3A 1VQDA 5H1SE 2R7ZH 1EU4A 1STHA 2JA6H 2PO4A 4WJWA 5J22A 3D0FA 3N52A 1A2UA 3FHWA 1YNJC 2BA1A 1M1KC 1JJGA 1MHWC 3BDLA 3M9BA 1KNAA 1N33Q 1IKLA 4DR7L 4LFBQ 3A0JA 4DPGA 1JQYD 3FKIG 4L5TA 4R4IA 2UUAQ 2QKIC 1DOMA 4R4OA 2I0QA 4PNYA 2VL6A 3CQZH 4DV6Q 4BXXH 1NJIC 2BDOA 1JICA 4EGVA 2HCCA 2ZJRA 4PZ6A 1SJED 4JV5L 3HOUH 3GP7A 4YWMA 1WTPA 3R93A 5IP9G 2EYMA 1AZQA 2L12A 3HOVG 1WI5A 5C4XG 4LF9Q 3K57A 2B2YA 1LT5D 4QMGA 2M9VA 3E6ZX 2K33A 1QUQA 1Q8IA 3PCOB 1TU2B 5IE8A 2VUMH 3D4WA 2QW7A 3I7FA 1RODA 2D62A 4DV5L 1IBLL 1LLRD 3DHQA 1PZID 1H9JA 2KVMA 3BZDB 1MSGA 4LF8Q 3UDXA 1KDAA 1QE6A 2CFMA 3EIVA 4ZLTF 1PTOD 5I9PA 1JT8A 2JA8G 3GV6A 3CRKC 1EIHA 2L4NA 1KNEA 3BZCA 3K5OA 3DXJC 1PH5A 2KHSA 1VQJA 1BF4A 4JI3Q 4A93H 1D2BA 1CSPA 4A3JG 1DCZA 4LAAA 4HJ7A 2E2JH 2JE6I 3J7AF 2DJFC 4H7BA 5FO7B 2ZXPA 3GTKH 3ICEA 4DV7Q 1SRUA 2L15A 1B44D 2N8NA 2Z6BA 4JI0Q 4EQ5A 3CMEA 5FLXL 1SDFA 1N33L 2XWJB 3T1YL 4JYAQ 5EKLA 2UUAL 1NCVA 3Q22A 3S16B 1MGSA 2YTYA 1XNRL 1HZAA 2K28A 4BA2I 1EY0A 2VS1A 1HPCA 4IUPA 1STYA 3UI2A 1K9MC 3Q8DA 3MWYW 3QOJA 4HIOA 1PDQA 4BY1B 1IW7C 2XWBB 4CDDC 3I70A 3MEHA 3STBC 3GTMB 4LF9L 4FXDA 4BXXG 1RL2A 4J1MA 2P5ZX 1BCPB 1UE7A 2K4KA 4FP5D 4AYBE 3AMUA 1YHBA 1CSQA 2L0CA 4XDXA 4QCLA 2K5NA 1U4MA 2B2YC 4JI5Q 4LF8L 2OF1A 4YWLA 2QF7A 1EIFA 4BBRH 1KDCA 4MNOA 1HQRD 4A3FH 3GTGB 5KEEA 4HAEA 3PO2H 2F0VA 4IPHA 3GTJH 4C3JB 3DWQA 4DV7L 1B2TA 1KAWA 4JI0L 2NVYH 5CBAE 4ZQ3A 4A93G 2N55A 2ZTCA 5CMDA 1ILQA 2PW7A 4JYAL 4EVOA 3RLFA 1DGSA 2JEBI 5K36G 3V96A 1EEFD 1LTRD 4JI2L 2OCEA 3TDQA 1B1ZA 1N36Q 1K8GA 1AW7A 2KA7A 3A55A 2EOTA 3MHBA 2WKDA 1I4PA 1VQFA 1E3PA 3L7ZC 2BE5C 1UEBA 3M3YB 1UWVA 5IGGA 3I2ZA 1IYJB 3OMCA 1QWYA 1SYEA 3NBHA 1JB7A 1PA6A 1N34Q 1H95A 2DJGC 3T16A 1LTSD 4FNFA 5LL6X 3K7AB 2H1EA 1UNSA 1V1PA 2CH4W 3NELA 4P74A 1WJJA 1L0XB 3H94A 4A3EH 1Y1VB 1V43A 2A6HC 2G9HD 3H0GG 1JWMD 2UXDQ 1QZHA 2KECA 3MFGA 1EQQA 1STAA 2R93B 3PUYA 3UDFA 3GTLB 4Q0FA 3KK7A 4QY7A 4XTCS 4XYOA 1J9OA 3GV3A 3SEBA 5I4DA 1HNWQ 2IX1A 3FPPA 1CHPD 3I3CA 1A3UA 2XRQD 2PNHA 2A6EC 3HRZC 1FL0A 3IL8A 2DN8A 1U0LA 1UE6A 3OTOQ 1BDOA 2ZXRA 2VQFQ 1NSNS 1LTID 2JA9A 5F2DA 1NMFA 4FF2A 3FPUB 1YIJA 2JP1A 3HFZB 4IALA 3S1NB 3U9OA 1WTHA 5KIXA 3MXPA 1HNXQ 2EYOA 2F03A 1K8AC 4C1NI 3WOEA 1IW7D 4B08A 4DR5Q 1EFWA 1VDZA 1QILA 2ZTDA 1QOHA 1QG7A 3SXHA 1Q1BA 1RTOA 1F77A 5M5WH 3STBD 3MXGA 4AH6A 3ERSX 2BOSA 3S1RH 1HR0Q 4B3TL 1EOTA 3NPPA 2AWNA 2K5QA 2KQ3A 2Q2TA 1KXLA 4A3DB 3KUPA 1D8LA 4IURA 1N34L 3HOZH 1X32A 3HOWH 1ZYRD 4OIJA 1B50A 1PH4A 3T53B 5IYDH 4RCOA 1JOQA 1GO3E 4DKAC 4DV1Q 3FVQA 2Z9HA 4GN3B 5IYBH 4A3LH 4A3MG 2E2IH 5BN5A 4QGUA 2K75A 3OMGA 1PYSB 3P75A 4DR1L 3HOXH 4A3EG 2IHFA 4MN3A 2NUCA 4WFN3 4K6DA 3CCMA 1S5FD 2B63G 1A15A 4NMZA 4DFAA 3I4NG 5C3WA 2VQFL 1LACA 5G3LD 2D9UA 1X3GA 2R7ZB 3J81j 2WAQG 1C0AA 5M3MH 4DV3L 1GHJA 2JA6B 3KJPA 3H3VI 1E2WA 2V1CC 3CKIB 4JOIA 3TBIB 4YY3Q 4PQXA 5JJIA 1S5BD 4EX5A 3M4PA 1HNXL 1STGA 1YVCA 5C0XH 3I91A 2F1MA 3GTQB 3HOYG 4OWXB 5C44G 5EBDA 2R7FA 5C0XJ 4K2KA 2BE5D 4DR5L 1HUNA 2F0WA 2SEBD 5I6YA 2MO1A 1X56A 2V4DA 3QOLA 1HR0L 1EQRA 1PFBA 3JC66 4KLKA 1KDBA 3W2DA 3HOUB 4KN4C 3ER0A 1WCMB 2UXBQ 1E2VA 2JA7H 5EQ0A 3OW7A 3HKZG 2PPBC 2Q8RE 2X6GA 3IKJA 3PO3B 3S1QH 4JI6Q 2HT1A 2A6HD 1SSOA 1PRTF 2BA0A 2Z0SA 3KF8A 4B3SL 2YU9B 4AYBB 3CF5A 1PTOB 1HA6A 4XT1B 2L1BA 3D6CA 3TZDA 1A8VA 3HOZG 3A74A 2VUMB 1Z7TA 3ONAB 4JI7Q 4LF4Q 1XPOA 1A6XA 4X62Q 2A6ED 3NTHA 1NY4A 2E2HH 1KHIA 2F0QA 3R8BA 4CDFC 4AIMA 2L55A 1DOLA 1CM9A 1IXRA 2RDFA 3QB3A 4K6LA 5C3EH 3PUWA 2HUGA 4R9WA 4DK1A 4DR3Q 3GTKB 2PQAA 3S14H 4YY3L 1MI2A 1J8IA 3BVMA 1TWCH 4C3HH 3H09A 1L0WA 3ZYYX 5FLMH 5DM73 1EZ8A 1WTVA 3CD6A 1EY7A 2OTLA 3DWAA 4ZKBB 3X3MA 3A5UA 3KLSA 4DV2Q 1PH1A 1KAAA 2C35B 4OO1H 1QVGA 4JPBW 4JOIC 2EYJA 4A3BB 1JWSD 3H6MA 1A0IA 2SNMA 4EQNA 3J81c 2F0TA 1W3SA 3PUXA 5KGUA 5CC4A 1D1KA 1GKHA 5TSSA 2F4VL 1VQAA 2UXBL 1WFQA 3MFYA 4PV1C 3PUZA 3BYTB 1HZCA 5ELFA 1YI2A 4JI6L 3KF6A 4BBSH 3CCVA 4E6IA 1FGUA 1LT6D 1STEA 4XXEA 1VMPA 1Q81C 1UE1A 3S17H 4YCUA 1VQCA 4QIWE 4TKOB 5M5YH 4JI7L 4LF4L 3M7GA 4A3GH 1K3RA 3R2TA 4WJ4A 5M3FH 4X62L 3BDOA 4FF4A 5ELNA 2IJ0A 3CCSA 1O7ZA 2YTXA 2F3WA 2EPBA 2EY6A 4BBRB 5NUCA 1IKMA 4BY7H 1VQ9A 3D3RA 5HGTA 4UAIA 1NNXA 3J80c 1O7YA 2N49A 1SYBA 4DXFA 1AEXA 4MTNA 4DR3L 2KEDA 4GKKQ 4GLVB 4MTKA 1D6EC 2ZJPA 5IT9L 2NVYB 2K03A 1MSHA 4HJ8A 1TXYA 3A5ZB 3OSOA 5AJ3Q 2TSSA 1YJ9A 1SE4A 1B53A 4DNIA 1II3A 3E0EA 1HHVA 2QA4A 3HP3A 4OX9Q 4UP7A 3C2PA 5FLMG 4BY1G 1YHAA 4B3RL 1QVCA 5KNBA 1TY2A 1SYCA 3RZDH 1YNNC 2DNCA 1LT3D 5JJLA 2SNSA 1GUGA 1SMXA 2A68C 4LFAQ 3U4VA 2EJGC 3FKIH 2ATWA 4YIJA 2NZOA 1K83B 2RSNA 2X69A 2YTVA 1OXUA 2WP8J 4UY8C 2NVTB 3S9WA 3TZUA 3RN2A 1FVIA 3ULJA 5C4JH 4IUNA 2CW0C 4L6TB 4K5VA 3I72A 4HCEA 1WTOA 2R92H 1E24A 3FP9A 1P8LA 2K5VA 5IP9H 1Q12A 5EAYA 1LTTD 1EY9A 2VQEQ 4DF7A 1WTWA 1B9MA 3UE0A 3HOVH 1X3FA 5C4XH 3G4SA 1GUNA 1XMOQ 5KRUA 3R3OA 4K5WA 4KD4A 4RG1A 4DUYQ 3S1MH 1KLUD 1X54A 4HIDA 1MJEA 4O2DA 1YNXA 1CQVA 1H9MA 4PMCA 4GKKL 1X3PA 4U68A 1Z9FA 1BXTA 2K7VA 1Y8NB 2FMCA 2PYKA 2I07B 1SE2A 3A54A 4ILWA 1YHQA 4H02A 2F0KA 3VR6A 1LTAD 2IX0A 2Z1CA 5AJ3L 4RHRA 4C2MH 3CCRA 1MIUA 1VQBA 2ZM6Q 4DAYB 5E1FA 4F7XA 2IX3A 3W1BA 4A3JH 2XIWA 3NBIA 2K04A 3E9IA 4JW0A 5KYIA 2H4OA 4KJNA 5M5WB 3JAMi 3CCLA 3W1GA 1GUOA 1VQGA 1CZGA 4LFAL 2RVLA 2MGSA 4N9TA 1QUQB 4DV0Q 2R7DA 2H5XA 4A3CG 1TQOA 2B2TA 4KMUC 3HOWB 1SAPA 1DD2A 2CWAA 1ICWA 1JORA 1PFMA 1Y1VG 4Y7NH 2SOBA 4X3TA 2K52A 3PSIA 1XNQQ 4Q5VA 2EYLA 3SK5A 4FDBA 4ME3A 1B7YB 1VF7A 2VQEL 2E2IB 4RGMA 5IT9E 1C48A 4FO2A 3VR4A 1M4VA 3CC2A 1HCZA 1XMOL 1E1TA 4IN3A 5JOBA 4DUYL 4K8IA 2A73B 2DGYA 2R92G 4AQYL 2JA5H 5CV9A 5M5XH 5A35A 4N8X1 2EQSA 3VR5A 4YCWA 2VZAA 4DGZA 4G7HC 3TEHB 4WRDA 3A8IE 1I4RA 1O7LA 5GADC 2OEOA 3TP7A 5FOBB 1XXGA 4JI4Q 3G6EA 3KFUA 3V05A 4YHHQ 3C3LA 2JK8A 1DJRD 2K5DA 2ZM6L 1VQ5A 1WOCA 1Y1WG 2A8VA 1SFOH 1OXXK 1RIPA 2N78A 2CVRA 4XIGS 3BYYB 2AWOA 1YNND 4P72A 1GUSA 4ZYSA 1G6ZA 4CDEC 4A75A 2A68D 1U4LA 3AEVA 4RMFA 1ONLA 4BS9A 1D7QA 5D3IB 2BH2A 4WJ3M 1K8MA 1VQ7A 1LYLA 4DV0L 1CKNB 5K36H 3VYTA 2CW0D 2JA7B 1V9PA 2M00A 1ZKOA 4ALPA 4KKSA 1LUZA 4LFBL 4CHTB 1XNQL 1U9RA 2RBMA 4C3IH 2Y0SB 1ET9A 3GTOH 1FR3A 1PLFA 4NXNQ 3TRZA 1TR5A 1IBKQ 5BR8Q 3D6WA 1EY8A 5J39A 4V0BA 1PYBA 4DV6L 3SHLA 4A3KG 3TP5A 1B8AA 5DM63 3MZ5A 3M4YA 2E2HB 1YBYA 1I50H 4G7ZC 3FDTA 5IGFA 4KY7A 3RUZA 2WB1B 2F0EA 5C3XA 2NTTA 1A2TA 3K0YA 1VQPA 4HIKA 1Q8KA 1JJCB 3H0GH 5C3EB 3NENA 4KKUA 3K58A 2VY3A 4FYDA 1VMCA 4LF7Q 5GAGC 3K5LA 1TWCB 1F2YA 3SVMA 4YHHL 3F8TA 1YJNA 3PF4A 3S2DH 2A69C 2JA5G 2LY7A 1CT1D 1TVXA 3SK6A 1LM0A 1M8AA 1NE3A 2JN4A 3DM1A 3OIQA 1WD0A 2G9DA 3CC7A 4DK6C 3HKSA 3J81i 3NBHB 5AFWA 3VA5A 4LF5Q 2WKCA 1DM0B 4JI3L 4RFBA 3SK8A 3S2HH 3A8KE 2EJMA 2EY5A 1WCMG 3DWPA 4DA2A 4J8QA 2K01A 5E7NA 1YNJD 2NVQH 5FO9B 1V1PB 3PO3G 3EBEA 2LMCB 4QUFA 2NN6I 3M85A 2BCOA 4BBSB 1PZKD 4I7ZC 5GROA 1AE3A 3I4OA 2B2UA 2LXJA 2AQ1B 2R6GA 3HZXA 2L5TA 3U58A 4NXNL 3QO2A 1QNKA 2CQAA 3K0XA 2L9HA 1PYWD 4DK3C 1LO5D 5BR8L 1WTXA 1IBMQ 5M9OA 1BBWA 3A7AB 4A3GB 3HGBA 5M3FB 3S15H 2KCCA 2AMCB 5D3DA 1HR0W 3EN2A 5J3BA 4C3IG 4FXGC 3WOFA 2F0HA 3O13A 4DXGA 3FMCA 1U5KA 4BY7B 1RTNA 4TRDA 1F9QA 2YYZA 2D0PA 1G91A 1TS2A 3Q23A 3J80i 1XYIA 1WYDA 1L0YB 4A3MH 4LF7L 2I5LX 2E5LQ 1I5FA 3S24A 5ELCA 3FEWX 1S5DD 3F1ZA 3PIP3 1W6KA 2AQ3B 3CCUA 1O7IA 1EY6A 1PH6A 4JI5L 2EJFC 1NBWA 4A3BG 2ID0A 2B63H 3I4LA 5JEAG 3I4NH 4A3IG 5T1GA 1DXMA 1BCPF 3TS2A 1I4HA 3RLOA 4LF5L 1H9SA 5EBCA 2NVXH 3E0JA 2KHJA 3P20A 4MHEA 3KLWA 2QDLA 3MTSA 3E5SA 3NK9A 4BWGB 4DAPA 3RZDB 3EFXD 4JVZA 2NWGA 4MZ9A 3PIOA 4OL7A 4LNQA 4IFDI 2Z8LA 3HOYH 1JR0D 5C44H 4G4KA 4EQOA 3FKIB 3KBXA 1WTRA 2NZ1D 2RA4A 5I6WA 2F0IA 2WV6D 4IUUA 1V8QA 5C4JB 3U50C 4X3UA 2DY8A 1XWEA 2PZTA 2F0LA 2F0OA 1IBML 1N36L 3QWNA 2UU9Q 2G5DA 3AFQA 4DR6Q 1L1OA 2Z4HA 1NMGA 3A7LA 2J4XA 4LJZC 1GHKA 2B2UC 1KLGD 2F0GA 2O4XA 1CK1A 4G57A 4DR2Q 1J5EQ 3JAMc 4X64Q 1R4QB 4GKJQ 1AN8A 3S1MB 2EYFA 3I73A 4LF6Q 1CTMA 2IW3A 1SMYC 2A69D 2E5LL 5EPLA 4M8AA 3I4MG 4Z9CB 4R8NA 1ENCA 5CGKA 3RNUA 4QF4A 2OQKA 1S72A 3CPWA 1TWGB 2RCNA 2JA8B 3MXUA 5IYCG 5C6AA 2F0PA 2UXDL 4KHZA 4C2MB 3NTIA 2YV5A 4K2LA 4X3SA 4A3JB 1HNWL 2WAQE 2B2WA 1BR9A 4HN7A 1EIYB 3VYSA 1SE3A 3FRPB 3GDEA 4OIKA 3IRBA 1G51A 2B29A 2WINB 1FYCA 3OTOL 2WACA 2HIVA 3K80C 4RAUC 4RWSC 3K59A 3GTPH 2NBFA 4LWCA 3TMEA 4JI1Q 2K6AA 3KF8B 3OHXC 1O80A 5C4ZA 2OXPA 5CV7A 1UUPA 1GVPA 2JXMB 2RF4A 1BVSA 2DY7A 4Y7NB 1N8RC 1XTDA 1XPRA 3K81C 4DR6L 2K05A 4QB4A 4GN5A 1LABA 4F87A 2HQLA 4A4IA 1TY0A 3G6JB 4RCNA 5GQOA 1PH2A 4J6HA 1T5XD 4LW1A 1NAPA 2NB0A 3HKZE 1OTCA 4DR2L 5CV6A 4XQJA 1J5EL 3CQZB 4X64L 2QCPX 3M7NA 1L1OC 1BBXC 4JK1C 2PMZE 1K3BC 4G7OC 3NQTA 1SNPA 5JPMC 4L5QA 2I46A 3SGIA 2XNAC 4DNTB 4ABNA 4IUTA 2RDHA 4GLXA 3BDCA 4KTAA 1E1OA 5HURA 1QB5D 3ULLA 1STBA 3H3VC 1BO0A 3KDFB 4POFA 4DV1L 1CQFA 4IOCA 3VR2A 2QEXA 1SNDA 4RGOS 3LWEA 3T56B 4IZ8A 2MUYA 5IIFA 2AUJD 5IGCA 1KL9A 1A3VA 4B9XA 3D8GA 4R4CA 3L3OC 1SFOB 1PZJD 1OXTA 1T5EA 2EY1A 1T9HA 5IODA 4O42A 1EL0A 2NZHA 4RKBA 5I2YA 4A93B 3KF6B 4KV6A 2K50A 4R1JA 4JI1L 2B2WC 5E4WC 1LTBD 4HMIA 4NW2A 4FF3A 2E2JB 2LFNA 1N9WA 3VYRA 1JB3A 1WD1A 2ZTEA 1N32Q 4JI8Q 4OGQC 4P2CB 4BY1H 1JE5A 1E22A 5LMNW 3T1HQ 1VCIA 1AFPA 4RA8A 2A5HA 2XRSD 3KLRA 1NUCA 4HIMA 3NUCA 1VQ8A 1TS4A 2F0FA 3GTOB 3GQBA 3DMUA 1B9NA 2BH8A 3LWUA 5IWAQ 4IFDH 4OHJA 5E3FA 5KNDA 1FNWA 2RHSB 4UPAA 2XGTA 4HJ5A 2ASBA 4HSVA 3VA7A 4R4QA 4ODGA 3UE1A 1SMYD 1I50B 2F4IA 2B3GA 3TN2A 4IUVA 1VQNA 2JJQA 2NN6G 1PRTC 3JAME 3Q24A 3H0GB 1JMCA 2FFKB 4MIUA 5HGQA 3GD7A 1KRSA 4OXPA 3GTGH 1IL2A 3F2BA 4HJ9A 1JC7A 3S2DB 2IT1A 2B2VA 1QCBD 3PGZA 3OPOA 4IO9A 1DOKA 1RJTA 1HQMC 1SE8A 2OTJA 3LNNA 4JBMA 3L9AX 4P71A 3PIO3 1PTOF 4A3FB 4UDUC 1VQMA 2UUCQ 1A63A 3PO2B 1PVOA 1NR4A 3DM3A 3EVQA 3BVGA 3Q6SA 5CORA 2QGQA 5KNCA 3GTJB 1N32L 4GNXA 1HZ9A 4JI8L 2GVAA 3F2UA 1KABA 1EY4A 2K1BA 3CCQA 2RHQB 3RD4A 4DV2L 5IGDA 5IGBA 5IWAL 5LMNQ 1Z47A 1Q86C 4S3SA 4RHSA 3H3VH 4F88A 3S15B 3IFDA 3K7AH 5JVG3 4A3CH 2WB1G 4FF1A 2F0JA 4DAVA 2J7ZA 3LGJA 4KN7C 2PCFB 2N3SA 1Y1VH 1XTCD 2CCZA 1O78A 4IFDG 1DZ1A 3CAMA 4JBJA 2ZT9C 4X66Q 2PZUA 2E8GA 2IPKD 2PZWA 1TWHH 4YWKA 4DNRB 5COYA 1AZPA 2I5MX 1C7YA 3AU7A 1P16A 2NTSA 1IYUA 2TMPA 1K8OA 4A3EB 1MJCA 1B4OA 1EIGA 1U4PA 2B63B 3H91A 1CA5A 5ELOA 3I4NB 4ZRZA 2D5DA 1CUKA 3OWFA 4GZYC 4X3KA 2B2VC 1EQTA 1NTGA 1I4XA 4XQNA 2UUCL 2FHTA 1HFGA 2Q8IB 1I94Q 4C3JG 1D5ZC 3I56A 1XJVA 1DYQA 1X65A 1SR3A 5EKKA 1Y1WH 3W5OA 2OT2A 1U4RA 5CYUA 5C44B 1I4GA 1Q7YC 3G48A 1TKWB 2VB2X 4GOPA 3HEJA 2E2DC 1ILPA 4N9PA 2GA4B 5IGEA 5ISRA 2K5WA 5LMNL 4H44C 1S40A 4GNXC 4OX9L 2B8FA 4QQBX 2IWHA 1FJGQ 1JOKA 4LUVA 1UE5A 2AQ2B 4L8JA 4EQPA 3HKZB 1HTPA 5FJ8H 2C9OA 2MJ8A 4KY5A 4PMWA 1GXDC 5EJWA 3S1RB 3NQIA 2XSCA 1QVFA 3J81E 4X66L 3MEFA 2PMZB 3VR3A 2MQHA 3OWEB 3L2PA 1SNOA 2FMMA 1SN8A 3HOZB 4L5RC 3I8ZA 1F2MA 5CBEE 5EGTA 4UP8A 3RN5A 3CHBD 3H15A 3E9HA 1HA5A 1XMQQ 4OEMB 5FO8B 4A3KH 1I4QA 1ZEQX 4HR7B 4CJ2C 4HCSA 3CP0A 4C1NK 2R93G 2K5HA 1QJOA 1AP0A 3X3NA 5EKIA 2JYOA 2RCFA 1C9OA 4CJ0B 5A2QE 3AFPA 4FVMA 3EQLC 3HOXB 1Q1EA 1G291 5E4XA 2EYHA 1PMRA 4XT3B 2ES2A 2N88A 1I94L 1BNZA 4PMBA 2CWPA 1IZ6A 3GTQH 3T1YQ 3GTPB 1XNRQ 2F0SA 5M3MB 3J80E 4DV4Q 1IHZA 3T4AC 3I55A 1B3AA 2HDLA 5ELEA 4HSPA 4DAYA 2HIXA 1DONA 3ND8A 3G71A 2JEAI 4QUCA 3MXNA 4ULLA 5JPNC 3BS1A 1LT4D 2O2LD 5BN3A 1C4QA 2HQEA 3KJOA 1WCMH 4KJOA 3PV0A 5JJZA 2ZXOA 1I6VC 1FJGL 4GOPC 3NTKA 3PO3H 4IJHA 5I2XA 4IPGA 1EWIA 1I3QH 1UAPA 2F3VA 4IPCA 1PV4A 2YU9H 2DUDA 1PTOH 4A3DG 3TSSA 2LS01 4UP9A 3AYHB 2O5IC 5FLXc 3IAYA 1M90C 5K5PA 5FJ8G 4XYQA 3URYA 1IYVA 1RDPD 1ZXTA 4HTHA 4R4TA 1S3OA 1XMQL 3S1QB 4K14A 3NEMA 2EE1A 1Q46A 5ELBA 4ZK9B 3CXCA 4I65A 1SNMA 2CKZB 2B2TC 4QIWB 2HD3A 1PH7A 3TQYA 1EWCA 3ERQA 3PUVA 4CDCC 4BA1I 2FJ2A 1PH9A 2K14A 4JCVE 2VNUD 1ET6A 1QZGA 1TWAH 2R7ZG 1VQ4A 3C46A 2JA6G 3EROA 4K8JA 1F2ZA 5G3LF 5CR3A 5LMUQ 4KD3A 4JI2Q 3K6OA 1H9KA 4A3BH 1EZ6A 2CQOA 5JEAH 4DV4L 4A3IH 4JI4L 1ENAA 1EOVA 1SYFA 3S14B 4C3HB 5JEAJ 2KCNA 4RGNA 4K0KQ 2A1AA 4KK7A 3WWVA 4CBVA 2R3ZA 1GJXA 1AE2A 4GN4B 1KC8C 3NP8A 1BQQT 5JVH3 4O0AA 1SYDA 3DEPA 3K5NA 1YJWA 3CC4A 2JSOA 1CKNA 3HOUG 1ZYRC 3KLSX 3RR5A 1ESFA 1EEID 3UDIA 4DUZQ 3VDYA 3HG9A 4OELB 4P75A 1Q3LA 4AYBG 2VXWA 2KCMA 2VUMG 3K7UC 4B9WA 5BN4A 2E75C 4ZKCB 5C0XI 3S17B 4DR4Q 1RCVD 1IBKL 5M5YB 1H9SB 1V1OA 2PI2E 4IOAA 1HNZQ 2XVSA 1CI3M 3K8AA 3OYYA 4FXKC 2KENA 3CPFA 1TWFH 4KHVA 1ASZA 2O5JC 1Y8PB 3I4MH 3CCEA 2BDNA 1A62A 4OWTB 4JC0A 3C1FA 1K28A 5LMUL 3T51B 2HDMA 1TT2A 4J15A 5IYCH 2C5CA 3P7JA 3HS0C 1FGBD 1KIXA 2M2LA 2F0UA 4K0KL 1TIID 1E7ZA 1EYCA 1L1OB 2ICIA 1Z6HA 2QILA 4DAMA 1PXUA 3NWSA 5CV4A 3J7A5 3RZOH 3M4OH 4JBKA 4HMJA 1GUWA 1SXTA 4YCVA 4X6AH 4B3TQ 3SDZA 5JAVA 4TVAB 3R2IA 1E0BA 4LK1C 4JG2A 1K83H 3UDGA 3W3AA 2CH4A 3QG1A 1VQHA 4KHPQ 2NVTH 3ND9A 1XPUA 5IY0A 2ICEC 5FK9C 3TS0A 1EU3A 5DEHA 4POGA 1TS3A 1G2TA 3KOJA 1RF2D 4DUZL 2RDGA 1JCKB 3SK4A 1I6HH 1ICFB 1BUVT 1TWHB 1W6JA 3E3XA 4UHVA 5FLXE 1EWHA 5J1ZA 4O1NA 4NXMQ 3NHHA 4NP5A 4DR1Q 2RSOA 3NWTA 4DR4L 1EYDA 4Y52H 1XX8A 2RQXA 1FNVA 4KKTA 1R9TH 4HEDA 1TS5A 1HNZL 3RLNA 5I9OA 4OO1I 3PMFA 1LTLA 4K5XA 4BBRG 2R92B 4OWWB 1R4PB 1A3TA 3BVZA 4A3FG 2B39A 1VQLA 4DV3Q 2NYZD 3CRLC 3VYUA 2Q2UA 4TQUS 3HOVB 1YZ6A 5C4XB 5EPKA 5GAEC 3F2DA 4RH6A 3PO2G 4ZUIA 1GUTA 1HFNA 2KUMA 1NR2A 1G8ZD 1PH8A 1KRTA 2OWOA 3EA6A 1FD7D 3B6YA 2D2CC 4NKLA 1BKBA 3SR1A 2B8GA 4QJFA 1Y1WB 3QR8A 3PQIA 2IL8A 4P73A 2EXDA 1STNA 1SNQA 1UEAB 2JQOA 1BCPC 1SNCA 2FXQA 3A56A 1PRTB 2PW5A 2A74C 1CKMA 3BZKA 5KYLA 4I7AA 2IHEA 3ULPA 2MPMA 3JAML 4KHPL 2LXKA 2R61A 1Y14B 1SBBB 2EZVA 2UXCQ 2VW9A
chains in the Genus database with same CATH topology
4NDXA 1EY5A 2F0NA 4DN4M 3MVVA 1HTLD 4IQZA 3T13A 4CKBA 1C8CA 4A3KB 1RKNA 2QEJC 2MP1A 1GOZA 1Q90A 4KI0A 4CKEA 2NN6H 4V190 5LL6S 3J7AV 4R8IA 2F0MA 4ZUJA 1Y69U 3WDNA 2CHBD 4ZAIA 5IOCA 2JA5B 5M5XB 3V2TA 2HCIA 1S5CD 2Q8TA 1OXVA 1RD9D 5CV8A 1D5XC 1JOOA 2PNRC 3D4DA 3QJYA 3D31A 1I3QB 2KJXA 2EDGA 3DUZA 1H9RA 2LKVA 3Q0AA 1E2ZA 2MHVA 5DAUA 3KBGA 1F9PA 3P1HA 2KOLA 4DU9A 1WVLA 3IFTA 3GO5A 5EPJA 2WIIB 4C3IB 4WORA 4XQQA 4IFDJ 1MD2D 4IUQA 2EVBA 1TWAB 1CHQD 3N6RA 1OXSC 1F9RA 1BCPD 2QDBA 2SDFA 4A3IB 1ENFA 3G7LA 2XN9C 5C0XG 2Z4IA 4ME5A 2K32A 3ITPA 3J81L 4CJ1B 2F0DA 2E74C 5D14A 5LHY1 2AUKA 3D4RA 3S2HB 2EXZA 3K5MA 4C56C 2NVQB 2ENBA 4ID6A 5DNFA 1BOSA 3NE5B 3C1EA 3NXWA 5A2QL 2J0TD 2L11A 1WTQA 1EQVA 4RKLA 1QNUA 4DK0A 1S4ZA 1HUMA 1SYGA 1TWFB 1S5ED 1OO9B 3J80L 4LMQD 3I4MB 1HXYD 3BG3A 1X3QA 4CKCA 3AB9A 1LV9A 1SEBD 1Y8OB 5ELDA 1G2SA 1PFNA 4A3MB 4C3HG 1IL8A 3MA2B 1EYAA 1F2LA 1FNUA 3M4OB 3RZOB 4OO1G 3OOCA 2KEEA 5CV5A 1PTOC 5C5MA 1HRJA 1CZWA 3SE0A 1EFID 2DNEA 1SJHD 2PQEA 1D5MC 3J7YW 3MAQA 2EY2A 4KY6A 2WAQB 4H0LC 1JE4A 1F9SA 3DEOA 2NVXB 2FINB 3EJIA 3A8JE 1ESRA 1RHPA 1ML0D 4F8MA 1I6HB 3HOYB 4JBWA 3MC0B 5C5LA 3RMHA 1KTKA 4U673 1CFMA 3CU7A 5T1IA 3LX0A 3OIPA 1R9TB 3QIAA 4L63B 3I90A 4CGYB 1VF5C 4M1UB 4TSSA 2VB3X 1D1IA 3TP6A 2RKSA 1PRTD 5FKAC 3U9SA 1MBYA 3NSWA 5D65A 2E76C 4H13C 4RGTA 3TP8A 1LTGD 1CA6A 1JWUD 5C4HA 2EYPA 2X6LA 1EU4A 1STHA 2PO4A 4WJWA 5J22A 3N52A 1A2UA 1YNJC 2BA1A 3BDLA 1KNAA 1IKLA 1JQYD 2QKIC 1DOMA 4PNYA 2BDOA 4EGVA 1JICA 2HCCA 1SJED 3GP7A 1WTPA 3R93A 2EYMA 1AZQA 2L12A 3K57A 2B2YA 1LT5D 4QMGA 2M9VA 3E6ZX 2K33A 1Q8IA 1TU2B 3D4WA 1RODA 2D62A 1LLRD 3DHQA 1PZID 1H9JA 2KVMA 3BZDB 1MSGA 1KDAA 1QE6A 4ZLTF 1PTOD 5I9PA 3GV6A 3CRKC 1EIHA 2L4NA 1KNEA 3K5OA 3DXJC 1BF4A 2KHSA 1D2BA 1DCZA 4LAAA 2JE6I 3J7AF 4H7BA 5FO7B 2ZXPA 1B44D 5FLXL 1SDFA 2XWJB 5EKLA 1NCVA 3Q22A 3S16B 1MGSA 2K28A 4BA2I 1EY0A 1HPCA 4IUPA 1STYA 3UI2A 3MWYW 3QOJA 1PDQA 4BY1B 1IW7C 2XWBB 3I70A 3MEHA 3GTMB 4FXDA 4J1MA 1BCPB 4FP5D 3AMUA 2L0CA 4XDXA 4QCLA 1U4MA 2B2YC 2OF1A 2QF7A 1KDCA 1HQRD 3GTGB 5KEEA 4HAEA 2F0VA 4C3JB 3DWQA 1B2TA 5CBAE 4ZQ3A 2N55A 5CMDA 1ILQA 2PW7A 4EVOA 3RLFA 2JEBI 5K36G 3V96A 1EEFD 1LTRD 3TDQA 1B1ZA 1AW7A 2KA7A 3A55A 2EOTA 3MHBA 2WKDA 1I4PA 3L7ZC 2BE5C 3M3YB 5IGGA 3OMCA 1QWYA 1SYEA 3NBHA 3T16A 1LTSD 4FNFA 5LL6X 3K7AB 2H1EA 1UNSA 1V1PA 1L0XB 3H94A 1Y1VB 1V43A 2A6HC 2G9HD 1JWMD 2KECA 3MFGA 1STAA 2R93B 3PUYA 3GTLB 4Q0FA 3KK7A 4XTCS 4XYOA 1J9OA 3GV3A 3SEBA 5I4DA 2IX1A 3FPPA 1CHPD 3I3CA 1A3UA 2XRQD 2A6EC 3HRZC 3IL8A 2DN8A 1BDOA 2ZXRA 1NSNS 1LTID 5F2DA 4FF2A 3FPUB 2JP1A 4IALA 3S1NB 3U9OA 5KIXA 3MXPA 2EYOA 2F03A 4C1NI 3WOEA 1IW7D 4B08A 1VDZA 1QILA 1QOHA 1QG7A 3SXHA 1Q1BA 1RTOA 1F77A 3MXGA 2BOSA 1EOTA 2AWNA 2K5QA 3NPPA 2KQ3A 4A3DB 3KUPA 4IURA 1X32A 1ZYRD 4OIJA 1B50A 3T53B 4RCOA 1JOQA 3FVQA 5BN5A 3OMGA 3P75A 4MN3A 2NUCA 4WFN3 4K6DA 1S5FD 1A15A 4NMZA 4DFAA 5C3WA 1LACA 5G3LD 2D9UA 2R7ZB 1GHJA 2JA6B 1E2WA 3CKIB 3TBIB 4PQXA 1S5BD 1STGA 5C0XH 3I91A 2F1MA 3GTQB 5EBDA 5C0XJ 4K2KA 2BE5D 1HUNA 2F0WA 2SEBD 5I6YA 2V4DA 3QOLA 1PFBA 1KDBA 3W2DA 3HOUB 4KN4C 1WCMB 1E2VA 5EQ0A 3OW7A 2PPBC 2Q8RE 2X6GA 3IKJA 3PO3B 2A6HD 1SSOA 1PRTF 2BA0A 3KF8A 2YU9B 4AYBB 1PTOB 1HA6A 4XT1B 2L1BA 3D6CA 3TZDA 2VUMB 1Z7TA 3ONAB 1A6XA 2A6ED 3NTHA 3R8BA 2F0QA 2L55A 1DOLA 1CM9A 2RDFA 3QB3A 4K6LA 3PUWA 2HUGA 4R9WA 4DK1A 3GTKB 1J8IA 1MI2A 3BVMA 3H09A 3ZYYX 5DM73 1EZ8A 1WTVA 1EY7A 3DWAA 4ZKBB 3X3MA 3KLSA 1KAAA 4OO1H 2EYJA 4A3BB 1JWSD 3H6MA 2SNMA 4EQNA 2F0TA 3PUXA 5KGUA 5CC4A 1D1KA 5TSSA 3MFYA 4PV1C 3PUZA 3BYTB 5ELFA 4E6IA 1LT6D 1STEA 4XXEA 1VMPA 4TKOB 3M7GA 3R2TA 3BDOA 4FF4A 2IJ0A 1O7ZA 2F3WA 2EPBA 2EY6A 4BBRB 5NUCA 1IKMA 3D3RA 5HGTA 4UAIA 1O7YA 1SYBA 4DXFA 1AEXA 2KEDA 1D6EC 5IT9L 2NVYB 2K03A 1MSHA 3OSOA 2TSSA 1SE4A 1B53A 1II3A 1HHVA 3HP3A 3C2PA 5KNBA 1TY2A 1SYCA 1YNNC 2DNCA 1LT3D 2SNSA 1GUGA 2A68C 2EJGC 4YIJA 1K83B 2RSNA 2X69A 1OXUA 2WP8J 2NVTB 3S9WA 3TZUA 4IUNA 2CW0C 4L6TB 4K5VA 3I72A 4HCEA 1WTOA 1Q12A 1LTTD 1EY9A 4DF7A 1WTWA 1B9MA 1GUNA 5KRUA 3R3OA 4K5WA 4KD4A 1KLUD 1CQVA 1H9MA 4PMCA 1X3PA 4U68A 1BXTA 2K7VA 1Y8NB 2FMCA 2PYKA 2I07B 1SE2A 3A54A 4ILWA 2F0KA 3VR6A 1LTAD 2IX0A 2Z1CA 4RHRA 5E1FA 4F7XA 2IX3A 2XIWA 3NBIA 2K04A 5KYIA 2H4OA 4KJNA 5M5WB 1GUOA 1CZGA 2RVLA 2MGSA 4N9TA 1TQOA 2B2TA 4KMUC 3HOWB 1SAPA 1DD2A 1JORA 1ICWA 1PFMA 2SOBA 4X3TA 4Q5VA 2EYLA 3SK5A 1VF7A 2E2IB 4RGMA 5IT9E 1C48A 4FO2A 3VR4A 1M4VA 1HCZA 5JOBA 4IN3A 4K8IA 2A73B 5CV9A 5A35A 3VR5A 4DGZA 4G7HC 4WRDA 3A8IE 1I4RA 1O7LA 2OEOA 3TP7A 5FOBB 1XXGA 3V05A 3C3LA 2K5DA 1DJRD 1OXXK 2CVRA 4XIGS 3BYYB 2AWOA 1YNND 4ZYSA 1GUSA 1G6ZA 2A68D 1U4LA 1ONLA 4BS9A 5D3IB 1K8MA 5K36H 3VYTA 2CW0D 2JA7B 2M00A 1ZKOA 4KKSA 4CHTB 1U9RA 2RBMA 2Y0SB 1ET9A 1PLFA 1FR3A 1TR5A 3D6WA 1EY8A 5J39A 4V0BA 3SHLA 3TP5A 5DM63 3MZ5A 3M4YA 2E2HB 4G7ZC 3FDTA 5IGFA 4KY7A 3RUZA 2WB1B 2F0EA 5C3XA 2NTTA 1A2TA 3K0YA 5C3EB 4KKUA 3K58A 4FYDA 1VMCA 3K5LA 1TWCB 1F2YA 3SVMA 2A69C 2LY7A 1CT1D 1TVXA 3SK6A 1M8AA 3DM1A 3OIQA 1WD0A 2G9DA 3VA5A 5AFWA 2WKCA 1DM0B 4RFBA 3SK8A 3A8KE 2EJMA 2EY5A 3DWPA 4DA2A 4J8QA 2K01A 1YNJD 5FO9B 1V1PB 2LMCB 4QUFA 2NN6I 3M85A 2BCOA 4BBSB 1PZKD 4I7ZC 2B2UA 2AQ1B 2R6GA 3HZXA 2L5TA 3QO2A 1QNKA 2CQAA 2L9HA 1PYWD 1WTXA 1LO5D 5M9OA 3A7AB 4A3GB 3HGBA 5M3FB 2KCCA 5D3DA 4C3IG 4FXGC 3WOFA 2F0HA 3O13A 4DXGA 3FMCA 4BY7B 1RTNA 4TRDA 1F9QA 2YYZA 1G91A 1TS2A 3Q23A 1XYIA 1L0YB 5ELCA 3FEWX 1S5DD 3PIP3 1W6KA 2AQ3B 1EY6A 2EJFC 2ID0A 3I4LA 5JEAG 5T1GA 1DXMA 1BCPF 1I4HA 1H9SA 5EBCA 3E0JA 3P20A 4MHEA 4BWGB 3MTSA 3E5SA 3NK9A 4DAPA 3RZDB 3EFXD 2NWGA 4OL7A 4IFDI 2Z8LA 1JR0D 4G4KA 4EQOA 3FKIB 3KBXA 1WTRA 2NZ1D 2RA4A 5I6WA 2F0IA 2WV6D 4IUUA 1V8QA 5C4JB 4X3UA 2DY8A 1XWEA 2PZTA 2F0LA 2F0OA 3QWNA 2Z4HA 3A7LA 2J4XA 4LJZC 1GHKA 2B2UC 1KLGD 2F0GA 2O4XA 1CK1A 4G57A 1R4QB 1AN8A 3S1MB 2EYFA 3I73A 1CTMA 2IW3A 1SMYC 2A69D 5EPLA 4M8AA 4Z9CB 4R8NA 1ENCA 5CGKA 4QF4A 1TWGB 2JA8B 3MXUA 5C6AA 2F0PA 4KHZA 4C2MB 3NTIA 4K2LA 4X3SA 4A3JB 2B2WA 1BR9A 4HN7A 3VYSA 1SE3A 3FRPB 4OIKA 2WINB 1FYCA 2WACA 4RAUC 4RWSC 3K59A 2NBFA 3TMEA 2K6AA 3OHXC 1O80A 5C4ZA 2OXPA 5CV7A 1UUPA 2JXMB 2DY7A 4Y7NB 2K05A 4QB4A 1LABA 4F87A 1TY0A 3G6JB 4RCNA 4J6HA 1T5XD 1NAPA 2NB0A 5CV6A 4XQJA 3CQZB 2QCPX 3M7NA 1BBXC 4JK1C 4G7OC 3NQTA 1SNPA 5JPMC 2I46A 2XNAC 4DNTB 4ABNA 4IUTA 2RDHA 3BDCA 4KTAA 5HURA 1QB5D 1STBA 3H3VC 1BO0A 1CQFA 3VR2A 1SNDA 4RGOS 3LWEA 3T56B 4IZ8A 5IIFA 2MUYA 2AUJD 5IGCA 1A3VA 4B9XA 3D8GA 3L3OC 1SFOB 1PZJD 1OXTA 1T5EA 2EY1A 5IODA 4O42A 1EL0A 4RKBA 5I2YA 4A93B 4KV6A 2E2JB 5E4WC 2B2WC 1LTBD 4HMIA 4NW2A 4FF3A 2LFNA 3VYRA 1JB3A 1WD1A 4OGQC 4P2CB 1VCIA 1AFPA 4RA8A 2A5HA 2XRSD 3KLRA 1NUCA 3NUCA 1TS4A 2F0FA 3GTOB 3DMUA 3GQBA 1B9NA 3LWUA 4IFDH 4OHJA 5E3FA 5KNDA 1FNWA 4HSVA 3VA7A 4ODGA 1SMYD 1I50B 2F4IA 3TN2A 4IUVA 2NN6G 1PRTC 3JAME 3Q24A 3H0GB 2FFKB 4MIUA 3GD7A 1JC7A 3S2DB 2IT1A 2B2VA 1QCBD 3OPOA 1DOKA 1RJTA 1HQMC 3LNNA 3L9AX 3PIO3 1PTOF 4A3FB 4UDUC 3PO2B 1NR4A 3EVQA 3BVGA 3Q6SA 5CORA 5KNCA 3GTJB 3F2UA 1KABA 1EY4A 2K1BA 3RD4A 5IGDA 5IGBA 1Z47A 4S3SA 4RHSA 4F88A 3S15B 3IFDA 5JVG3 4FF1A 2F0JA 4DAVA 2J7ZA 4KN7C 2PCFB 1XTCD 1O78A 4IFDG 1DZ1A 2ZT9C 2PZUA 2IPKD 2PZWA 4DNRB 5COYA 1AZPA 3AU7A 2NTSA 1IYUA 2TMPA 1K8OA 4A3EB 1B4OA 1EIGA 1U4PA 2B63B 3H91A 1CA5A 3I4NB 4ZRZA 2D5DA 3OWFA 4GZYC 4X3KA 2B2VC 1EQTA 1I4XA 4XQNA 2FHTA 1HFGA 2Q8IB 4C3JG 1D5ZC 1DYQA 5EKKA 2OT2A 1U4RA 5CYUA 5C44B 1I4GA 1TKWB 2VB2X 3HEJA 2E2DC 1ILPA 4N9PA 2GA4B 5IGEA 5ISRA 2K5WA 4H44C 2B8FA 2IWHA 1JOKA 2AQ2B 4L8JA 4EQPA 3HKZB 1HTPA 2C9OA 2MJ8A 4KY5A 4PMWA 1GXDC 5EJWA 3S1RB 3NQIA 2XSCA 3J81E 2PMZB 3VR3A 3OWEB 1SNOA 2FMMA 3HOZB 3I8ZA 1F2MA 5CBEE 5EGTA 3CHBD 1HA5A 5FO8B 1I4QA 1ZEQX 4HR7B 4CJ2C 4HCSA 4C1NK 1QJOA 1AP0A 3X3NA 5EKIA 2JYOA 4CJ0B 5A2QE 4FVMA 3EQLC 3HOXB 1Q1EA 1G291 5E4XA 2EYHA 1PMRA 4XT3B 2N88A 1BNZA 4PMBA 3GTPB 2F0SA 5M3MB 3J80E 1IHZA 3T4AC 1B3AA 2HDLA 5ELEA 4HSPA 4DAYA 1DONA 3ND8A 2JEAI 4QUCA 3MXNA 4ULLA 5JPNC 3BS1A 1LT4D 2O2LD 5BN3A 1C4QA 2HQEA 4KJOA 3PV0A 5JJZA 2ZXOA 1I6VC 3NTKA 5I2XA 1UAPA 2F3VA 1PTOH 3TSSA 2LS01 2O5IC 3IAYA 5K5PA 4XYQA 3URYA 1IYVA 1RDPD 1ZXTA 4HTHA 3S1QB 4K14A 2EE1A 5ELBA 4ZK9B 4I65A 1SNMA 2B2TC 4QIWB 1EWCA 3ERQA 3PUVA 4BA1I 2FJ2A 2VNUD 1ET6A 3C46A 3EROA 4K8JA 1F2ZA 5G3LF 5CR3A 4KD3A 3K6OA 1H9KA 1EZ6A 5JEAH 1ENAA 1SYFA 3S14B 4C3HB 5JEAJ 2KCNA 4RGNA 4KK7A 4CBVA 2R3ZA 1GJXA 3NP8A 1BQQT 5JVH3 1SYDA 3DEPA 3K5NA 2JSOA 1ZYRC 3KLSX 1ESFA 1EEID 3HG9A 1Q3LA 2VXWA 4B9WA 5BN4A 2E75C 4ZKCB 5C0XI 3S17B 1RCVD 5M5YB 1H9SB 1V1OA 2XVSA 1CI3M 4FXKC 4KHVA 2O5JC 1Y8PB 2BDNA 3C1FA 3T51B 2HDMA 1TT2A 2C5CA 3P7JA 3HS0C 1FGBD 2M2LA 2F0UA 1TIID 1EYCA 2ICIA 1Z6HA 2QILA 1PXUA 3NWSA 5CV4A 4HMJA 1GUWA 1SXTA 3SDZA 5JAVA 3R2IA 1E0BA 4LK1C 3W3AA 3QG1A 3ND9A 2ICEC 5FK9C 1EU3A 5DEHA 1TS3A 1G2TA 1RF2D 2RDGA 1JCKB 3SK4A 1BUVT 1TWHB 1W6JA 5FLXE 1EWHA 5J1ZA 4O1NA 3NHHA 4NP5A 2RSOA 3NWTA 1EYDA 1XX8A 2RQXA 1FNVA 4KKTA 4HEDA 1TS5A 5I9OA 4OO1I 3PMFA 4K5XA 2R92B 1R4PB 1A3TA 3BVZA 2B39A 2NYZD 3CRLC 3VYUA 4TQUS 3HOVB 5C4XB 5EPKA 4RH6A 4ZUIA 1GUTA 1HFNA 2KUMA 1NR2A 1G8ZD 3EA6A 1FD7D 2D2CC 4NKLA 3SR1A 2B8GA 1Y1WB 2IL8A 1STNA 1SNQA 1UEAB 1BCPC 1SNCA 3A56A 1PRTB 2PW5A 2A74C 5KYLA 2MPMA 3JAML 2R61A 1SBBB 2EZVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C3X A;  1A2T A;  1KDC A;  4J6H A;  3D6C A;  1TT2 A;  4HTH A;  1EY5 A;  1TQO A;  2F0N A;  3HEJ A;  4NDX A;  2PQE A;  4K14 A;  4N9P A;  5IGE A;  3NK9 A;  3E5S A;  5KEE A;  5CV6 A;  3OSO A;  5ISR A;  3MVV A;  2EY2 A;  1JOR A;  4KY6 A;  2EYM A;  3SXH A;  2SOB A;  2F0U A;  2F0V A;  4OL7 A;  4I65 A;  1SNM A;  1II3 A;  1EYC A;  3NQT A;  1SNP A;  3T13 A;  5CV4 A;  2EYL A;  2F0Q A;  1F2Y A;  3EJI A;  4HMJ A;  4QMG A;  1JOK A;  4EQO A;  3SK5 A;  4EQP A;  2KQ3 A;  3ERQ A;  5I6W A;  2F0I A;  2QDB A;  5JAV A;  4KY5 A;  4ZQ3 A;  3BDC A;  4KTA A;  3EVQ A;  5HUR A;  3SK6 A;  1RKN A;  3D4W A;  2RDF A;  3QB3 A;  4F8M A;  1SYC A;  2PW7 A;  1STB A;  2PZT A;  2F0L A;  4EVO A;  2F0O A;  3DHQ A;  5C5L A;  2SNS A;  1JOQ A;  4ME5 A;  1SNO A;  5JOB A;  1SND A;  1KAB A;  1KDA A;  4K8I A;  1EY4 A;  1F2M A;  3ITP A;  3VA5 A;  3ERO A;  4IZ8 A;  4K8J A;  5EGT A;  5I9P A;  1F2Z A;  4YIJ A;  5CR3 A;  5IIF A;  5DEH A;  5IGC A;  2F0G A;  2O4X A;  1EZ8 A;  1A3V A;  2F0D A;  3LX0 A;  4KD3 A;  5CV9 A;  3SK8 A;  1EZ6 A;  3MHB A;  4B9X A;  5IGD A;  2F0M A;  3D8G A;  1EY7 A;  2EY5 A;  4G57 A;  4DGZ A;  5IGB A;  3S9W A;  2KHS A;  1ENA A;  4WRD A;  3OMG A;  4IUN A;  4ZUJ A;  1SYF A;  3SK4 A;  1KAA A;  2EY1 A;  2OEO A;  4S3S A;  3TP7 A;  3P75 A;  4LAA A;  4K5V A;  5IOC A;  3TP6 A;  5IOD A;  2EYJ A;  2RKS A;  5IGG A;  5J1Z A;  3OMC A;  2EYF A;  2NUC A;  4H7B A;  3V2T A;  2EXZ A;  4RKB A;  3NHH A;  5CV5 A;  4NP5 A;  1SYE A;  2F0J A;  3H6M A;  4K6D A;  4KV6 A;  2ENB A;  4ID6 A;  2SNM A;  4EQN A;  4NMZ A;  4DFA A;  1EYD A;  1EY9 A;  2F0T A;  4HMI A;  4DF7 A;  3T16 A;  5C3W A;  3HZX A;  2EYH A;  1ENC A;  4R8N A;  3NP8 A;  5CGK A;  5KGU A;  5CC4 A;  4QF4 A;  2PZU A;  3C1E A;  1SYD A;  3NXW A;  4PMB A;  3PMF A;  5EKL A;  3TP8 A;  5I9O A;  5CV8 A;  2PZW A;  4K5X A;  5KRU A;  5M9O A;  3R3O A;  4K5W A;  4KD4 A;  1A3T A;  5C6A A;  2F0P A;  1EY0 A;  1JOO A;  1STY A;  1STG A;  4PMC A;  1EQV A;  1NUC A;  4RKL A;  2F0S A;  4K2L A;  3NUC A;  4ZUI A;  3D4D A;  2F0F A;  5C4H A;  4E6I A;  2PYK A;  1IHZ A;  2EYP A;  2F0H A;  3DMU A;  3QOJ A;  1STA A;  5E3F A;  4K2K A;  1SYG A;  4TRD A;  2F0K A;  1STH A;  3MEH A;  4NKL A;  2F0W A;  2LKV A;  2M00 A;  1A3U A;  3SR1 A;  4ODG A;  5J22 A;  4B9W A;  2WAC A;  5I6Y A;  1A2U A;  2HQE A;  3OWF A;  4KJO A;  1U9R A;  1STN A;  2RBM A;  3BDL A;  3QOL A;  3TME A;  1SNQ A;  2F3W A;  5E1F A;  4F7X A;  2EY6 A;  4J1M A;  1NSN S;  1KDB A;  1SNC A;  5DAU A;  2OXP A;  5CV7 A;  3P1H A;  5F2D A;  5C4Z A;  5K5P A;  5NUC A;  2PW5 A;  4DU9 A;  1TR5 A;  4IAL A;  1EY6 A;  1EY8 A;  2F3V A;  5KYL A;  5KYI A;  5J39 A;  4KHV A;  5HGT A;  4KJN A;  4MIU A;  1EYA A;  4WOR A;  4PNY A;  3U9O A;  5EKK A;  3SHL A;  3TP5 A;  5KIX A;  3MXP A;  1SYB A;  3MZ5 A;  1AEX A;  2EYO A;  3C1F A;  4QB4 A;  5IGF A;  4KY7 A;  2OF1 A;  3RUZ A;  5C5M A;  4N9T A;  2F0E A; 
#chains in the Genus database with same CATH topology
 4NDX A;  1EY5 A;  1V1Q A;  2F0N A;  3AQQ A;  4DN4 M;  1L2F A;  2KBN A;  4B3S Q;  3MVV A;  1MKH A;  4A76 A;  1HTL D;  4IQZ A;  3T13 A;  4NXM L;  3KYH C;  4CKB A;  1C8C A;  1VQE A;  1W2B A;  4N8F A;  2EIF A;  4A3K B;  2UU9 L;  1RKN A;  2QEJ C;  2MP1 A;  1GOZ A;  1Q90 A;  4KI0 A;  3L0O A;  4APV A;  4CKE A;  2NN6 H;  5DLQ E;  4V19 0;  5LL6 S;  2KCT A;  3J7A V;  4GKJ L;  4R8I A;  2F0M A;  4ZUJ A;  1KD1 C;  2GN5 A;  2PQA B;  4LF6 L;  1Y69 U;  3WDN A;  2CHB D;  4ZAI A;  5IOC A;  2JA5 B;  5IP7 H;  1VS0 A;  5M5X B;  4NB3 A;  3V2T A;  2HCI A;  1S5C D;  2Q8T A;  4X65 Q;  3CMA A;  1EYG A;  1OXV A;  1RD9 D;  5CV8 A;  1D5X C;  2XTI A;  2F4V Q;  3PF5 A;  1JOO A;  2ZJQ A;  2PNR C;  3D4D A;  3QJY A;  4LFC Q;  3D31 A;  2UXC L;  1Q82 C;  1I3Q B;  2KJX A;  1YIT A;  2EDG A;  3DUZ A;  1H9R A;  3S16 H;  2LKV A;  3Q0A A;  3HOW G;  5IYD G;  1E2Z A;  2GVB A;  1K0S A;  2MHV A;  4QL5 A;  5DAU A;  3KBG A;  1F9P A;  3P1H A;  2KOL A;  4DU9 A;  1WVL A;  3BJU A;  3IFT A;  3GO5 A;  5EPJ A;  2WII B;  5IYB G;  4A3L G;  4C3I B;  1J6Q A;  1B3Q A;  4WOR A;  3GTM H;  2Q2H A;  4XQQ A;  3HOX G;  3F2C A;  1CKO A;  4IJL A;  4IFD J;  1GM5 A;  1MD2 D;  1AH9 A;  4IUQ A;  2MO0 A;  4ZCK A;  2EVB A;  1TWA B;  4GNX B;  1CHQ D;  5M3M G;  3N6R A;  1OXS C;  3KDF A;  1F9R A;  1BCP D;  2QDB A;  2SDF A;  4A3I B;  1VQO A;  4X65 L;  1ENF A;  3G7L A;  2XN9 C;  5C0X G;  4B3R Q;  2Z4I A;  5IP7 G;  4ME5 A;  2I5H A;  3CW2 C;  2K32 A;  3ITP A;  3J81 L;  4C3J H;  4B3M Q;  4CJ1 B;  2F0D A;  2E74 C;  4LFC L;  5D14 A;  2MNA A;  2MFI A;  1VQI A;  5LHY 1;  2PI2 A;  1ASY A;  2AUK A;  2Y0S E;  3D4R A;  4PZ8 A;  3S2H B;  2EXZ A;  2KHI A;  3K5M A;  5IT9 c;  4C56 C;  2LSS A;  2JA7 G;  2NVQ B;  2ENB A;  2Q2I A;  4ID6 A;  5DNF A;  1VQK A;  1BOS A;  2Z6K A;  3NE5 B;  3C1E A;  3NXW A;  3T1H L;  2Y0S G;  5A2Q L;  2J0T D;  3M4Q A;  3M3Y H;  2L11 A;  1GD7 A;  1X9N A;  2WB1 E;  2A19 A;  4L5S A;  1WTQ A;  1EQV A;  4LUO A;  4RKL A;  1BBU A;  1QNU A;  4DK0 A;  1S4Z A;  1KQS A;  1HUM A;  1SYG A;  1TWF B;  1K73 C;  1S5E D;  1OO9 B;  3J80 L;  4LMQ D;  3I4M B;  1X6O A;  2ALY B;  1B70 B;  1HXY D;  3BG3 A;  4HJA A;  1X3Q A;  4NPS A;  4CKC A;  5C3E G;  3AB9 A;  1G6P A;  1LV9 A;  1SEB D;  1Y8O B;  5ELD A;  4GOP B;  1G2S A;  2R93 H;  2UUB Q;  1PFN A;  4A3M B;  3GTL H;  4C3H G;  1IL8 A;  2F52 A;  3MA2 B;  4PZ7 A;  1EYA A;  1F2L A;  1K0R A;  1FNU A;  3M4O B;  3RZO B;  1HZB A;  2HHH Q;  3OOC A;  4OO1 G;  2KEE A;  5CV5 A;  1PTO C;  1YEZ A;  5C5M A;  1HRJ A;  1CZW A;  3SE0 A;  4B3M L;  1EFI D;  2DNE A;  1SJH D;  2PQE A;  1D5M C;  3ZJY C;  1SRO A;  3J7Y W;  3MAQ A;  2EY2 A;  4KY6 A;  3S1N H;  2WAQ B;  4H0L C;  3J7Z C;  1JE4 A;  1F9S A;  3DEO A;  1X55 A;  2NVX B;  2D0O A;  2FIN B;  4GS3 A;  3U4Z A;  3EJI A;  3A8J E;  1ESR A;  4DR7 Q;  1SLJ A;  2AHO B;  1PHJ A;  2IY5 B;  2WFW A;  1RHP A;  2AKW B;  4OON A;  1ML0 D;  4BBS G;  4F8M A;  1I6H B;  3HOY B;  4JBW A;  3CCJ A;  3MC0 B;  5C5L A;  4GLA C;  3RMH A;  1KTK A;  4U67 3;  1CFM A;  3CU7 A;  4A3G G;  3DLL A;  1PFS A;  5T1I A;  4PG3 A;  3LX0 A;  5M3F G;  4A3D H;  2Z6K C;  3OIP A;  1R9T B;  4JV5 Q;  3QIA A;  4L63 B;  4AQY Q;  3I90 A;  4CGY B;  2F3I A;  1VF5 C;  4M1U B;  4TSS A;  2OQ0 A;  2VB3 X;  1HJP A;  5GAH C;  1D1I A;  3TP6 A;  2RKS A;  1JJ2 A;  1HH2 P;  1PRT D;  4BY7 G;  1X3E A;  5FKA C;  3OW2 A;  3U9S A;  1MBY A;  1TWG H;  4LUZ A;  2JA8 H;  3NSW A;  5D65 A;  3TRE A;  5JJK A;  2E76 C;  4H13 C;  2UUB L;  3PIP A;  5L37 A;  1VQ6 A;  4RGT A;  3TP8 A;  4DV5 Q;  3BU2 A;  1IBL Q;  3MXN B;  1EUJ A;  1LTG D;  1CA6 A;  1JWU D;  2HHH L;  5C4H A;  2EYP A;  4IPD A;  5HY6 A;  2X6L A;  1PH3 A;  1VQD A;  5H1S E;  2R7Z H;  1EU4 A;  1STH A;  2JA6 H;  2PO4 A;  4WJW A;  5J22 A;  3D0F A;  3N52 A;  1A2U A;  3FHW A;  1YNJ C;  2BA1 A;  1M1K C;  1JJG A;  1MHW C;  3BDL A;  3M9B A;  1KNA A;  1N33 Q;  1IKL A;  4DR7 L;  4LFB Q;  3A0J A;  4DPG A;  1JQY D;  3FKI G;  4L5T A;  4R4I A;  2UUA Q;  2QKI C;  1DOM A;  4R4O A;  2I0Q A;  4PNY A;  2VL6 A;  3CQZ H;  4DV6 Q;  4BXX H;  1NJI C;  2BDO A;  1JIC A;  4EGV A;  2HCC A;  2ZJR A;  4PZ6 A;  1SJE D;  4JV5 L;  3HOU H;  3GP7 A;  4YWM A;  1WTP A;  3R93 A;  5IP9 G;  2EYM A;  1AZQ A;  2L12 A;  3HOV G;  1WI5 A;  5C4X G;  4LF9 Q;  3K57 A;  2B2Y A;  1LT5 D;  4QMG A;  2M9V A;  3E6Z X;  2K33 A;  1QUQ A;  1Q8I A;  3PCO B;  1TU2 B;  5IE8 A;  2VUM H;  3D4W A;  2QW7 A;  3I7F A;  1ROD A;  2D62 A;  4DV5 L;  1IBL L;  1LLR D;  3DHQ A;  1PZI D;  1H9J A;  2KVM A;  3BZD B;  1MSG A;  4LF8 Q;  3UDX A;  1KDA A;  1QE6 A;  2CFM A;  3EIV A;  4ZLT F;  1PTO D;  5I9P A;  1JT8 A;  2JA8 G;  3GV6 A;  3CRK C;  1EIH A;  2L4N A;  1KNE A;  3BZC A;  3K5O A;  3DXJ C;  1PH5 A;  2KHS A;  1VQJ A;  1BF4 A;  4JI3 Q;  4A93 H;  1D2B A;  1CSP A;  4A3J G;  1DCZ A;  4LAA A;  4HJ7 A;  2E2J H;  2JE6 I;  3J7A F;  2DJF C;  4H7B A;  5FO7 B;  2ZXP A;  3GTK H;  3ICE A;  4DV7 Q;  1SRU A;  2L15 A;  1B44 D;  2N8N A;  2Z6B A;  4JI0 Q;  4EQ5 A;  3CME A;  5FLX L;  1SDF A;  1N33 L;  2XWJ B;  3T1Y L;  4JYA Q;  5EKL A;  2UUA L;  1NCV A;  3Q22 A;  3S16 B;  1MGS A;  2YTY A;  1XNR L;  1HZA A;  2K28 A;  4BA2 I;  1EY0 A;  2VS1 A;  1HPC A;  4IUP A;  1STY A;  3UI2 A;  1K9M C;  3Q8D A;  3MWY W;  3QOJ A;  4HIO A;  1PDQ A;  4BY1 B;  1IW7 C;  2XWB B;  4CDD C;  3I70 A;  3MEH A;  3STB C;  3GTM B;  4LF9 L;  4FXD A;  4BXX G;  1RL2 A;  4J1M A;  2P5Z X;  1BCP B;  1UE7 A;  2K4K A;  4FP5 D;  4AYB E;  3AMU A;  1YHB A;  1CSQ A;  2L0C A;  4XDX A;  4QCL A;  2K5N A;  1U4M A;  2B2Y C;  4JI5 Q;  4LF8 L;  2OF1 A;  4YWL A;  2QF7 A;  1EIF A;  4BBR H;  1KDC A;  4MNO A;  1HQR D;  4A3F H;  3GTG B;  5KEE A;  4HAE A;  3PO2 H;  2F0V A;  4IPH A;  3GTJ H;  4C3J B;  3DWQ A;  4DV7 L;  1B2T A;  1KAW A;  4JI0 L;  2NVY H;  5CBA E;  4ZQ3 A;  4A93 G;  2N55 A;  2ZTC A;  5CMD A;  1ILQ A;  2PW7 A;  4JYA L;  4EVO A;  3RLF A;  1DGS A;  2JEB I;  5K36 G;  3V96 A;  1EEF D;  1LTR D;  4JI2 L;  2OCE A;  3TDQ A;  1B1Z A;  1N36 Q;  1K8G A;  1AW7 A;  2KA7 A;  3A55 A;  2EOT A;  3MHB A;  2WKD A;  1I4P A;  1VQF A;  1E3P A;  3L7Z C;  2BE5 C;  1UEB A;  3M3Y B;  1UWV A;  5IGG A;  3I2Z A;  1IYJ B;  3OMC A;  1QWY A;  1SYE A;  3NBH A;  1JB7 A;  1PA6 A;  1N34 Q;  1H95 A;  2DJG C;  3T16 A;  1LTS D;  4FNF A;  5LL6 X;  3K7A B;  2H1E A;  1UNS A;  1V1P A;  2CH4 W;  3NEL A;  4P74 A;  1WJJ A;  1L0X B;  3H94 A;  4A3E H;  1Y1V B;  1V43 A;  2A6H C;  2G9H D;  3H0G G;  1JWM D;  2UXD Q;  1QZH A;  2KEC A;  3MFG A;  1EQQ A;  1STA A;  2R93 B;  3PUY A;  3UDF A;  3GTL B;  4Q0F A;  3KK7 A;  4QY7 A;  4XTC S;  4XYO A;  1J9O A;  3GV3 A;  3SEB A;  5I4D A;  1HNW Q;  2IX1 A;  3FPP A;  1CHP D;  3I3C A;  1A3U A;  2XRQ D;  2PNH A;  2A6E C;  3HRZ C;  1FL0 A;  3IL8 A;  2DN8 A;  1U0L A;  1UE6 A;  3OTO Q;  1BDO A;  2ZXR A;  2VQF Q;  1NSN S;  1LTI D;  2JA9 A;  5F2D A;  1NMF A;  4FF2 A;  3FPU B;  1YIJ A;  2JP1 A;  3HFZ B;  4IAL A;  3S1N B;  3U9O A;  1WTH A;  5KIX A;  3MXP A;  1HNX Q;  2EYO A;  2F03 A;  1K8A C;  4C1N I;  3WOE A;  1IW7 D;  4B08 A;  4DR5 Q;  1EFW A;  1VDZ A;  1QIL A;  2ZTD A;  1QOH A;  1QG7 A;  3SXH A;  1Q1B A;  1RTO A;  1F77 A;  5M5W H;  3STB D;  3MXG A;  4AH6 A;  3ERS X;  2BOS A;  3S1R H;  1HR0 Q;  4B3T L;  1EOT A;  3NPP A;  2AWN A;  2K5Q A;  2KQ3 A;  2Q2T A;  1KXL A;  4A3D B;  3KUP A;  1D8L A;  4IUR A;  1N34 L;  3HOZ H;  1X32 A;  3HOW H;  1ZYR D;  4OIJ A;  1B50 A;  1PH4 A;  3T53 B;  5IYD H;  4RCO A;  1JOQ A;  1GO3 E;  4DKA C;  4DV1 Q;  3FVQ A;  2Z9H A;  4GN3 B;  5IYB H;  4A3L H;  4A3M G;  2E2I H;  5BN5 A;  4QGU A;  2K75 A;  3OMG A;  1PYS B;  3P75 A;  4DR1 L;  3HOX H;  4A3E G;  2IHF A;  4MN3 A;  2NUC A;  4WFN 3;  4K6D A;  3CCM A;  1S5F D;  2B63 G;  1A15 A;  4NMZ A;  4DFA A;  3I4N G;  5C3W A;  2VQF L;  1LAC A;  5G3L D;  2D9U A;  1X3G A;  2R7Z B;  3J81 j;  2WAQ G;  1C0A A;  5M3M H;  4DV3 L;  1GHJ A;  2JA6 B;  3KJP A;  3H3V I;  1E2W A;  2V1C C;  3CKI B;  4JOI A;  3TBI B;  4YY3 Q;  4PQX A;  5JJI A;  1S5B D;  4EX5 A;  3M4P A;  1HNX L;  1STG A;  1YVC A;  5C0X H;  3I91 A;  2F1M A;  3GTQ B;  3HOY G;  4OWX B;  5C44 G;  5EBD A;  2R7F A;  5C0X J;  4K2K A;  2BE5 D;  4DR5 L;  1HUN A;  2F0W A;  2SEB D;  5I6Y A;  2MO1 A;  1X56 A;  2V4D A;  3QOL A;  1HR0 L;  1EQR A;  1PFB A;  3JC6 6;  4KLK A;  1KDB A;  3W2D A;  3HOU B;  4KN4 C;  3ER0 A;  1WCM B;  2UXB Q;  1E2V A;  2JA7 H;  5EQ0 A;  3OW7 A;  3HKZ G;  2PPB C;  2Q8R E;  2X6G A;  3IKJ A;  3PO3 B;  3S1Q H;  4JI6 Q;  2HT1 A;  2A6H D;  1SSO A;  1PRT F;  2BA0 A;  2Z0S A;  3KF8 A;  4B3S L;  2YU9 B;  4AYB B;  3CF5 A;  1PTO B;  1HA6 A;  4XT1 B;  2L1B A;  3D6C A;  3TZD A;  1A8V A;  3HOZ G;  3A74 A;  2VUM B;  1Z7T A;  3ONA B;  4JI7 Q;  4LF4 Q;  1XPO A;  1A6X A;  4X62 Q;  2A6E D;  3NTH A;  1NY4 A;  2E2H H;  1KHI A;  2F0Q A;  3R8B A;  4CDF C;  4AIM A;  2L55 A;  1DOL A;  1CM9 A;  1IXR A;  2RDF A;  3QB3 A;  4K6L A;  5C3E H;  3PUW A;  2HUG A;  4R9W A;  4DK1 A;  4DR3 Q;  3GTK B;  2PQA A;  3S14 H;  4YY3 L;  1MI2 A;  1J8I A;  3BVM A;  1TWC H;  4C3H H;  3H09 A;  1L0W A;  3ZYY X;  5FLM H;  5DM7 3;  1EZ8 A;  1WTV A;  3CD6 A;  1EY7 A;  2OTL A;  3DWA A;  4ZKB B;  3X3M A;  3A5U A;  3KLS A;  4DV2 Q;  1PH1 A;  1KAA A;  2C35 B;  4OO1 H;  1QVG A;  4JPB W;  4JOI C;  2EYJ A;  4A3B B;  1JWS D;  3H6M A;  1A0I A;  2SNM A;  4EQN A;  3J81 c;  2F0T A;  1W3S A;  3PUX A;  5KGU A;  5CC4 A;  1D1K A;  1GKH A;  5TSS A;  2F4V L;  1VQA A;  2UXB L;  1WFQ A;  3MFY A;  4PV1 C;  3PUZ A;  3BYT B;  1HZC A;  5ELF A;  1YI2 A;  4JI6 L;  3KF6 A;  4BBS H;  3CCV A;  4E6I A;  1FGU A;  1LT6 D;  1STE A;  4XXE A;  1VMP A;  1Q81 C;  1UE1 A;  3S17 H;  4YCU A;  1VQC A;  4QIW E;  4TKO B;  5M5Y H;  4JI7 L;  4LF4 L;  3M7G A;  4A3G H;  1K3R A;  3R2T A;  4WJ4 A;  5M3F H;  4X62 L;  3BDO A;  4FF4 A;  5ELN A;  2IJ0 A;  3CCS A;  1O7Z A;  2YTX A;  2F3W A;  2EPB A;  2EY6 A;  4BBR B;  5NUC A;  1IKM A;  4BY7 H;  1VQ9 A;  3D3R A;  5HGT A;  4UAI A;  1NNX A;  3J80 c;  1O7Y A;  2N49 A;  1SYB A;  4DXF A;  1AEX A;  4MTN A;  4DR3 L;  2KED A;  4GKK Q;  4GLV B;  4MTK A;  1D6E C;  2ZJP A;  5IT9 L;  2NVY B;  2K03 A;  1MSH A;  4HJ8 A;  1TXY A;  3A5Z B;  3OSO A;  5AJ3 Q;  2TSS A;  1YJ9 A;  1SE4 A;  1B53 A;  4DNI A;  1II3 A;  3E0E A;  1HHV A;  2QA4 A;  3HP3 A;  4OX9 Q;  4UP7 A;  3C2P A;  5FLM G;  4BY1 G;  1YHA A;  4B3R L;  1QVC A;  5KNB A;  1TY2 A;  1SYC A;  3RZD H;  1YNN C;  2DNC A;  1LT3 D;  5JJL A;  2SNS A;  1GUG A;  1SMX A;  2A68 C;  4LFA Q;  3U4V A;  2EJG C;  3FKI H;  2ATW A;  4YIJ A;  2NZO A;  1K83 B;  2RSN A;  2X69 A;  2YTV A;  1OXU A;  2WP8 J;  4UY8 C;  2NVT B;  3S9W A;  3TZU A;  3RN2 A;  1FVI A;  3ULJ A;  5C4J H;  4IUN A;  2CW0 C;  4L6T B;  4K5V A;  3I72 A;  4HCE A;  1WTO A;  2R92 H;  1E24 A;  3FP9 A;  1P8L A;  2K5V A;  5IP9 H;  1Q12 A;  5EAY A;  1LTT D;  1EY9 A;  2VQE Q;  4DF7 A;  1WTW A;  1B9M A;  3UE0 A;  3HOV H;  1X3F A;  5C4X H;  3G4S A;  1GUN A;  1XMO Q;  5KRU A;  3R3O A;  4K5W A;  4KD4 A;  4RG1 A;  4DUY Q;  3S1M H;  1KLU D;  1X54 A;  4HID A;  1MJE A;  4O2D A;  1YNX A;  1CQV A;  1H9M A;  4PMC A;  4GKK L;  1X3P A;  4U68 A;  1Z9F A;  1BXT A;  2K7V A;  1Y8N B;  2FMC A;  2PYK A;  2I07 B;  1SE2 A;  3A54 A;  4ILW A;  1YHQ A;  4H02 A;  2F0K A;  3VR6 A;  1LTA D;  2IX0 A;  2Z1C A;  5AJ3 L;  4RHR A;  4C2M H;  3CCR A;  1MIU A;  1VQB A;  2ZM6 Q;  4DAY B;  5E1F A;  4F7X A;  2IX3 A;  3W1B A;  4A3J H;  2XIW A;  3NBI A;  2K04 A;  3E9I A;  4JW0 A;  5KYI A;  2H4O A;  4KJN A;  5M5W B;  3JAM i;  3CCL A;  3W1G A;  1GUO A;  1VQG A;  1CZG A;  4LFA L;  2RVL A;  2MGS A;  4N9T A;  1QUQ B;  4DV0 Q;  2R7D A;  2H5X A;  4A3C G;  1TQO A;  2B2T A;  4KMU C;  3HOW B;  1SAP A;  1DD2 A;  2CWA A;  1ICW A;  1JOR A;  1PFM A;  1Y1V G;  4Y7N H;  2SOB A;  4X3T A;  2K52 A;  3PSI A;  1XNQ Q;  4Q5V A;  2EYL A;  3SK5 A;  4FDB A;  4ME3 A;  1B7Y B;  1VF7 A;  2VQE L;  2E2I B;  4RGM A;  5IT9 E;  1C48 A;  4FO2 A;  3VR4 A;  1M4V A;  3CC2 A;  1HCZ A;  1XMO L;  1E1T A;  4IN3 A;  5JOB A;  4DUY L;  4K8I A;  2A73 B;  2DGY A;  2R92 G;  4AQY L;  2JA5 H;  5CV9 A;  5M5X H;  5A35 A;  4N8X 1;  2EQS A;  3VR5 A;  4YCW A;  2VZA A;  4DGZ A;  4G7H C;  3TEH B;  4WRD A;  3A8I E;  1I4R A;  1O7L A;  5GAD C;  2OEO A;  3TP7 A;  5FOB B;  1XXG A;  4JI4 Q;  3G6E A;  3KFU A;  3V05 A;  4YHH Q;  3C3L A;  2JK8 A;  1DJR D;  2K5D A;  2ZM6 L;  1VQ5 A;  1WOC A;  1Y1W G;  2A8V A;  1SFO H;  1OXX K;  1RIP A;  2N78 A;  2CVR A;  4XIG S;  3BYY B;  2AWO A;  1YNN D;  4P72 A;  1GUS A;  4ZYS A;  1G6Z A;  4CDE C;  4A75 A;  2A68 D;  1U4L A;  3AEV A;  4RMF A;  1ONL A;  4BS9 A;  1D7Q A;  5D3I B;  2BH2 A;  4WJ3 M;  1K8M A;  1VQ7 A;  1LYL A;  4DV0 L;  1CKN B;  5K36 H;  3VYT A;  2CW0 D;  2JA7 B;  1V9P A;  2M00 A;  1ZKO A;  4ALP A;  4KKS A;  1LUZ A;  4LFB L;  4CHT B;  1XNQ L;  1U9R A;  2RBM A;  4C3I H;  2Y0S B;  1ET9 A;  3GTO H;  1FR3 A;  1PLF A;  4NXN Q;  3TRZ A;  1TR5 A;  1IBK Q;  5BR8 Q;  3D6W A;  1EY8 A;  5J39 A;  4V0B A;  1PYB A;  4DV6 L;  3SHL A;  4A3K G;  3TP5 A;  1B8A A;  5DM6 3;  3MZ5 A;  3M4Y A;  2E2H B;  1YBY A;  1I50 H;  4G7Z C;  3FDT A;  5IGF A;  4KY7 A;  3RUZ A;  2WB1 B;  2F0E A;  5C3X A;  2NTT A;  1A2T A;  3K0Y A;  1VQP A;  4HIK A;  1Q8K A;  1JJC B;  3H0G H;  5C3E B;  3NEN A;  4KKU A;  3K58 A;  2VY3 A;  4FYD A;  1VMC A;  4LF7 Q;  5GAG C;  3K5L A;  1TWC B;  1F2Y A;  3SVM A;  4YHH L;  3F8T A;  1YJN A;  3PF4 A;  3S2D H;  2A69 C;  2JA5 G;  2LY7 A;  1CT1 D;  1TVX A;  3SK6 A;  1LM0 A;  1M8A A;  1NE3 A;  2JN4 A;  3DM1 A;  3OIQ A;  1WD0 A;  2G9D A;  3CC7 A;  4DK6 C;  3HKS A;  3J81 i;  3NBH B;  5AFW A;  3VA5 A;  4LF5 Q;  2WKC A;  1DM0 B;  4JI3 L;  4RFB A;  3SK8 A;  3S2H H;  3A8K E;  2EJM A;  2EY5 A;  1WCM G;  3DWP A;  4DA2 A;  4J8Q A;  2K01 A;  5E7N A;  1YNJ D;  2NVQ H;  5FO9 B;  1V1P B;  3PO3 G;  3EBE A;  2LMC B;  4QUF A;  2NN6 I;  3M85 A;  2BCO A;  4BBS B;  1PZK D;  4I7Z C;  5GRO A;  1AE3 A;  3I4O A;  2B2U A;  2LXJ A;  2AQ1 B;  2R6G A;  3HZX A;  2L5T A;  3U58 A;  4NXN L;  3QO2 A;  1QNK A;  2CQA A;  3K0X A;  2L9H A;  1PYW D;  4DK3 C;  1LO5 D;  5BR8 L;  1WTX A;  1IBM Q;  5M9O A;  1BBW A;  3A7A B;  4A3G B;  3HGB A;  5M3F B;  3S15 H;  2KCC A;  2AMC B;  5D3D A;  1HR0 W;  3EN2 A;  5J3B A;  4C3I G;  4FXG C;  3WOF A;  2F0H A;  3O13 A;  4DXG A;  3FMC A;  1U5K A;  4BY7 B;  1RTN A;  4TRD A;  1F9Q A;  2YYZ A;  2D0P A;  1G91 A;  1TS2 A;  3Q23 A;  3J80 i;  1XYI A;  1WYD A;  1L0Y B;  4A3M H;  4LF7 L;  2I5L X;  2E5L Q;  1I5F A;  3S24 A;  5ELC A;  3FEW X;  1S5D D;  3F1Z A;  3PIP 3;  1W6K A;  2AQ3 B;  3CCU A;  1O7I A;  1EY6 A;  1PH6 A;  4JI5 L;  2EJF C;  1NBW A;  4A3B G;  2ID0 A;  2B63 H;  3I4L A;  5JEA G;  3I4N H;  4A3I G;  5T1G A;  1DXM A;  1BCP F;  3TS2 A;  1I4H A;  3RLO A;  4LF5 L;  1H9S A;  5EBC A;  2NVX H;  3E0J A;  2KHJ A;  3P20 A;  4MHE A;  3KLW A;  2QDL A;  3MTS A;  3E5S A;  3NK9 A;  4BWG B;  4DAP A;  3RZD B;  3EFX D;  4JVZ A;  2NWG A;  4MZ9 A;  3PIO A;  4OL7 A;  4LNQ A;  4IFD I;  2Z8L A;  3HOY H;  1JR0 D;  5C44 H;  4G4K A;  4EQO A;  3FKI B;  3KBX A;  1WTR A;  2NZ1 D;  2RA4 A;  5I6W A;  2F0I A;  2WV6 D;  4IUU A;  1V8Q A;  5C4J B;  3U50 C;  4X3U A;  2DY8 A;  1XWE A;  2PZT A;  2F0L A;  2F0O A;  1IBM L;  1N36 L;  3QWN A;  2UU9 Q;  2G5D A;  3AFQ A;  4DR6 Q;  1L1O A;  2Z4H A;  1NMG A;  3A7L A;  2J4X A;  4LJZ C;  1GHK A;  2B2U C;  1KLG D;  2F0G A;  2O4X A;  1CK1 A;  4G57 A;  4DR2 Q;  1J5E Q;  3JAM c;  4X64 Q;  1R4Q B;  4GKJ Q;  1AN8 A;  3S1M B;  2EYF A;  3I73 A;  4LF6 Q;  1CTM A;  2IW3 A;  1SMY C;  2A69 D;  2E5L L;  5EPL A;  4M8A A;  3I4M G;  4Z9C B;  4R8N A;  1ENC A;  5CGK A;  3RNU A;  4QF4 A;  2OQK A;  1S72 A;  3CPW A;  1TWG B;  2RCN A;  2JA8 B;  3MXU A;  5IYC G;  5C6A A;  2F0P A;  2UXD L;  4KHZ A;  4C2M B;  3NTI A;  2YV5 A;  4K2L A;  4X3S A;  4A3J B;  1HNW L;  2WAQ E;  2B2W A;  1BR9 A;  4HN7 A;  1EIY B;  3VYS A;  1SE3 A;  3FRP B;  3GDE A;  4OIK A;  3IRB A;  1G51 A;  2B29 A;  2WIN B;  1FYC A;  3OTO L;  2WAC A;  2HIV A;  3K80 C;  4RAU C;  4RWS C;  3K59 A;  3GTP H;  2NBF A;  4LWC A;  3TME A;  4JI1 Q;  2K6A A;  3KF8 B;  3OHX C;  1O80 A;  5C4Z A;  2OXP A;  5CV7 A;  1UUP A;  1GVP A;  2JXM B;  2RF4 A;  1BVS A;  2DY7 A;  4Y7N B;  1N8R C;  1XTD A;  1XPR A;  3K81 C;  4DR6 L;  2K05 A;  4QB4 A;  4GN5 A;  1LAB A;  4F87 A;  2HQL A;  4A4I A;  1TY0 A;  3G6J B;  4RCN A;  5GQO A;  1PH2 A;  4J6H A;  1T5X D;  4LW1 A;  1NAP A;  2NB0 A;  3HKZ E;  1OTC A;  4DR2 L;  5CV6 A;  4XQJ A;  1J5E L;  3CQZ B;  4X64 L;  2QCP X;  3M7N A;  1L1O C;  1BBX C;  4JK1 C;  2PMZ E;  1K3B C;  4G7O C;  3NQT A;  1SNP A;  5JPM C;  4L5Q A;  2I46 A;  3SGI A;  2XNA C;  4DNT B;  4ABN A;  4IUT A;  2RDH A;  4GLX A;  3BDC A;  4KTA A;  1E1O A;  5HUR A;  1QB5 D;  3ULL A;  1STB A;  3H3V C;  1BO0 A;  3KDF B;  4POF A;  4DV1 L;  1CQF A;  4IOC A;  3VR2 A;  2QEX A;  1SND A;  4RGO S;  3LWE A;  3T56 B;  4IZ8 A;  2MUY A;  5IIF A;  2AUJ D;  5IGC A;  1KL9 A;  1A3V A;  4B9X A;  3D8G A;  4R4C A;  3L3O C;  1SFO B;  1PZJ D;  1OXT A;  1T5E A;  2EY1 A;  1T9H A;  5IOD A;  4O42 A;  1EL0 A;  2NZH A;  4RKB A;  5I2Y A;  4A93 B;  3KF6 B;  4KV6 A;  2K50 A;  4R1J A;  4JI1 L;  2B2W C;  5E4W C;  1LTB D;  4HMI A;  4NW2 A;  4FF3 A;  2E2J B;  2LFN A;  1N9W A;  3VYR A;  1JB3 A;  1WD1 A;  2ZTE A;  1N32 Q;  4JI8 Q;  4OGQ C;  4P2C B;  4BY1 H;  1JE5 A;  1E22 A;  5LMN W;  3T1H Q;  1VCI A;  1AFP A;  4RA8 A;  2A5H A;  2XRS D;  3KLR A;  1NUC A;  4HIM A;  3NUC A;  1VQ8 A;  1TS4 A;  2F0F A;  3GTO B;  3GQB A;  3DMU A;  1B9N A;  2BH8 A;  3LWU A;  5IWA Q;  4IFD H;  4OHJ A;  5E3F A;  5KND A;  1FNW A;  2RHS B;  4UPA A;  2XGT A;  4HJ5 A;  2ASB A;  4HSV A;  3VA7 A;  4R4Q A;  4ODG A;  3UE1 A;  1SMY D;  1I50 B;  2F4I A;  2B3G A;  3TN2 A;  4IUV A;  1VQN A;  2JJQ A;  2NN6 G;  1PRT C;  3JAM E;  3Q24 A;  3H0G B;  1JMC A;  2FFK B;  4MIU A;  5HGQ A;  3GD7 A;  1KRS A;  4OXP A;  3GTG H;  1IL2 A;  3F2B A;  4HJ9 A;  1JC7 A;  3S2D B;  2IT1 A;  2B2V A;  1QCB D;  3PGZ A;  3OPO A;  4IO9 A;  1DOK A;  1RJT A;  1HQM C;  1SE8 A;  2OTJ A;  3LNN A;  4JBM A;  3L9A X;  4P71 A;  3PIO 3;  1PTO F;  4A3F B;  4UDU C;  1VQM A;  2UUC Q;  1A63 A;  3PO2 B;  1PVO A;  1NR4 A;  3DM3 A;  3EVQ A;  3BVG A;  3Q6S A;  5COR A;  2QGQ A;  5KNC A;  3GTJ B;  1N32 L;  4GNX A;  1HZ9 A;  4JI8 L;  2GVA A;  3F2U A;  1KAB A;  1EY4 A;  2K1B A;  3CCQ A;  2RHQ B;  3RD4 A;  4DV2 L;  5IGD A;  5IGB A;  5IWA L;  5LMN Q;  1Z47 A;  1Q86 C;  4S3S A;  4RHS A;  3H3V H;  4F88 A;  3S15 B;  3IFD A;  3K7A H;  5JVG 3;  4A3C H;  2WB1 G;  4FF1 A;  2F0J A;  4DAV A;  2J7Z A;  3LGJ A;  4KN7 C;  2PCF B;  2N3S A;  1Y1V H;  1XTC D;  2CCZ A;  1O78 A;  4IFD G;  1DZ1 A;  3CAM A;  4JBJ A;  2ZT9 C;  4X66 Q;  2PZU A;  2E8G A;  2IPK D;  2PZW A;  1TWH H;  4YWK A;  4DNR B;  5COY A;  1AZP A;  2I5M X;  1C7Y A;  3AU7 A;  1P16 A;  2NTS A;  1IYU A;  2TMP A;  1K8O A;  4A3E B;  1MJC A;  1B4O A;  1EIG A;  1U4P A;  2B63 B;  3H91 A;  1CA5 A;  5ELO A;  3I4N B;  4ZRZ A;  2D5D A;  1CUK A;  3OWF A;  4GZY C;  4X3K A;  2B2V C;  1EQT A;  1NTG A;  1I4X A;  4XQN A;  2UUC L;  2FHT A;  1HFG A;  2Q8I B;  1I94 Q;  4C3J G;  1D5Z C;  3I56 A;  1XJV A;  1DYQ A;  1X65 A;  1SR3 A;  5EKK A;  1Y1W H;  3W5O A;  2OT2 A;  1U4R A;  5CYU A;  5C44 B;  1I4G A;  1Q7Y C;  3G48 A;  1TKW B;  2VB2 X;  4GOP A;  3HEJ A;  2E2D C;  1ILP A;  4N9P A;  2GA4 B;  5IGE A;  5ISR A;  2K5W A;  5LMN L;  4H44 C;  1S40 A;  4GNX C;  4OX9 L;  2B8F A;  4QQB X;  2IWH A;  1FJG Q;  1JOK A;  4LUV A;  1UE5 A;  2AQ2 B;  4L8J A;  4EQP A;  3HKZ B;  1HTP A;  5FJ8 H;  2C9O A;  2MJ8 A;  4KY5 A;  4PMW A;  1GXD C;  5EJW A;  3S1R B;  3NQI A;  2XSC A;  1QVF A;  3J81 E;  4X66 L;  3MEF A;  2PMZ B;  3VR3 A;  2MQH A;  3OWE B;  3L2P A;  1SNO A;  2FMM A;  1SN8 A;  3HOZ B;  4L5R C;  3I8Z A;  1F2M A;  5CBE E;  5EGT A;  4UP8 A;  3RN5 A;  3CHB D;  3H15 A;  3E9H A;  1HA5 A;  1XMQ Q;  4OEM B;  5FO8 B;  4A3K H;  1I4Q A;  1ZEQ X;  4HR7 B;  4CJ2 C;  4HCS A;  3CP0 A;  4C1N K;  2R93 G;  2K5H A;  1QJO A;  1AP0 A;  3X3N A;  5EKI A;  2JYO A;  2RCF A;  1C9O A;  4CJ0 B;  5A2Q E;  3AFP A;  4FVM A;  3EQL C;  3HOX B;  1Q1E A;  1G29 1;  5E4X A;  2EYH A;  1PMR A;  4XT3 B;  2ES2 A;  2N88 A;  1I94 L;  1BNZ A;  4PMB A;  2CWP A;  1IZ6 A;  3GTQ H;  3T1Y Q;  3GTP B;  1XNR Q;  2F0S A;  5M3M B;  3J80 E;  4DV4 Q;  1IHZ A;  3T4A C;  3I55 A;  1B3A A;  2HDL A;  5ELE A;  4HSP A;  4DAY A;  2HIX A;  1DON A;  3ND8 A;  3G71 A;  2JEA I;  4QUC A;  3MXN A;  4ULL A;  5JPN C;  3BS1 A;  1LT4 D;  2O2L D;  5BN3 A;  1C4Q A;  2HQE A;  3KJO A;  1WCM H;  4KJO A;  3PV0 A;  5JJZ A;  2ZXO A;  1I6V C;  1FJG L;  4GOP C;  3NTK A;  3PO3 H;  4IJH A;  5I2X A;  4IPG A;  1EWI A;  1I3Q H;  1UAP A;  2F3V A;  4IPC A;  1PV4 A;  2YU9 H;  2DUD A;  1PTO H;  4A3D G;  3TSS A;  2LS0 1;  4UP9 A;  3AYH B;  2O5I C;  5FLX c;  3IAY A;  1M90 C;  5K5P A;  5FJ8 G;  4XYQ A;  3URY A;  1IYV A;  1RDP D;  1ZXT A;  4HTH A;  4R4T A;  1S3O A;  1XMQ L;  3S1Q B;  4K14 A;  3NEM A;  2EE1 A;  1Q46 A;  5ELB A;  4ZK9 B;  3CXC A;  4I65 A;  1SNM A;  2CKZ B;  2B2T C;  4QIW B;  2HD3 A;  1PH7 A;  3TQY A;  1EWC A;  3ERQ A;  3PUV A;  4CDC C;  4BA1 I;  2FJ2 A;  1PH9 A;  2K14 A;  4JCV E;  2VNU D;  1ET6 A;  1QZG A;  1TWA H;  2R7Z G;  1VQ4 A;  3C46 A;  2JA6 G;  3ERO A;  4K8J A;  1F2Z A;  5G3L F;  5CR3 A;  5LMU Q;  4KD3 A;  4JI2 Q;  3K6O A;  1H9K A;  4A3B H;  1EZ6 A;  2CQO A;  5JEA H;  4DV4 L;  4A3I H;  4JI4 L;  1ENA A;  1EOV A;  1SYF A;  3S14 B;  4C3H B;  5JEA J;  2KCN A;  4RGN A;  4K0K Q;  2A1A A;  4KK7 A;  3WWV A;  4CBV A;  2R3Z A;  1GJX A;  1AE2 A;  4GN4 B;  1KC8 C;  3NP8 A;  1BQQ T;  5JVH 3;  4O0A A;  1SYD A;  3DEP A;  3K5N A;  1YJW A;  3CC4 A;  2JSO A;  1CKN A;  3HOU G;  1ZYR C;  3KLS X;  3RR5 A;  1ESF A;  1EEI D;  3UDI A;  4DUZ Q;  3VDY A;  3HG9 A;  4OEL B;  4P75 A;  1Q3L A;  4AYB G;  2VXW A;  2KCM A;  2VUM G;  3K7U C;  4B9W A;  5BN4 A;  2E75 C;  4ZKC B;  5C0X I;  3S17 B;  4DR4 Q;  1RCV D;  1IBK L;  5M5Y B;  1H9S B;  1V1O A;  2PI2 E;  4IOA A;  1HNZ Q;  2XVS A;  1CI3 M;  3K8A A;  3OYY A;  4FXK C;  2KEN A;  3CPF A;  1TWF H;  4KHV A;  1ASZ A;  2O5J C;  1Y8P B;  3I4M H;  3CCE A;  2BDN A;  1A62 A;  4OWT B;  4JC0 A;  3C1F A;  1K28 A;  5LMU L;  3T51 B;  2HDM A;  1TT2 A;  4J15 A;  5IYC H;  2C5C A;  3P7J A;  3HS0 C;  1FGB D;  1KIX A;  2M2L A;  2F0U A;  4K0K L;  1TII D;  1E7Z A;  1EYC A;  1L1O B;  2ICI A;  1Z6H A;  2QIL A;  4DAM A;  1PXU A;  3NWS A;  5CV4 A;  3J7A 5;  3RZO H;  3M4O H;  4JBK A;  4HMJ A;  1GUW A;  1SXT A;  4YCV A;  4X6A H;  4B3T Q;  3SDZ A;  5JAV A;  4TVA B;  3R2I A;  1E0B A;  4LK1 C;  4JG2 A;  1K83 H;  3UDG A;  3W3A A;  2CH4 A;  3QG1 A;  1VQH A;  4KHP Q;  2NVT H;  3ND9 A;  1XPU A;  5IY0 A;  2ICE C;  5FK9 C;  3TS0 A;  1EU3 A;  5DEH A;  4POG A;  1TS3 A;  1G2T A;  3KOJ A;  1RF2 D;  4DUZ L;  2RDG A;  1JCK B;  3SK4 A;  1I6H H;  1ICF B;  1BUV T;  1TWH B;  1W6J A;  3E3X A;  4UHV A;  5FLX E;  1EWH A;  5J1Z A;  4O1N A;  4NXM Q;  3NHH A;  4NP5 A;  4DR1 Q;  2RSO A;  3NWT A;  4DR4 L;  1EYD A;  4Y52 H;  1XX8 A;  2RQX A;  1FNV A;  4KKT A;  1R9T H;  4HED A;  1TS5 A;  1HNZ L;  3RLN A;  5I9O A;  4OO1 I;  3PMF A;  1LTL A;  4K5X A;  4BBR G;  2R92 B;  4OWW B;  1R4P B;  1A3T A;  3BVZ A;  4A3F G;  2B39 A;  1VQL A;  4DV3 Q;  2NYZ D;  3CRL C;  3VYU A;  2Q2U A;  4TQU S;  3HOV B;  1YZ6 A;  5C4X B;  5EPK A;  5GAE C;  3F2D A;  4RH6 A;  3PO2 G;  4ZUI A;  1GUT A;  1HFN A;  2KUM A;  1NR2 A;  1G8Z D;  1PH8 A;  1KRT A;  2OWO A;  3EA6 A;  1FD7 D;  3B6Y A;  2D2C C;  4NKL A;  1BKB A;  3SR1 A;  2B8G A;  4QJF A;  1Y1W B;  3QR8 A;  3PQI A;  2IL8 A;  4P73 A;  2EXD A;  1STN A;  1SNQ A;  1UEA B;  2JQO A;  1BCP C;  1SNC A;  2FXQ A;  3A56 A;  1PRT B;  2PW5 A;  2A74 C;  1CKM A;  3BZK A;  5KYL A;  4I7A A;  2IHE A;  3ULP A;  2MPM A;  3JAM L;  4KHP L;  2LXK A;  2R61 A;  1Y14 B;  1SBB B;  2EZV A;  2UXC Q;  2VW9 A; 
#chains in the Genus database with same CATH homology
 4NDX A;  1EY5 A;  2F0N A;  4DN4 M;  3MVV A;  1HTL D;  4IQZ A;  3T13 A;  4CKB A;  1C8C A;  4A3K B;  1RKN A;  2QEJ C;  2MP1 A;  1GOZ A;  1Q90 A;  4KI0 A;  4CKE A;  2NN6 H;  4V19 0;  5LL6 S;  3J7A V;  4R8I A;  2F0M A;  4ZUJ A;  1Y69 U;  3WDN A;  2CHB D;  4ZAI A;  5IOC A;  2JA5 B;  5M5X B;  3V2T A;  2HCI A;  1S5C D;  2Q8T A;  1OXV A;  1RD9 D;  5CV8 A;  1D5X C;  1JOO A;  2PNR C;  3D4D A;  3QJY A;  3D31 A;  1I3Q B;  2KJX A;  2EDG A;  3DUZ A;  1H9R A;  2LKV A;  3Q0A A;  1E2Z A;  2MHV A;  5DAU A;  3KBG A;  1F9P A;  3P1H A;  2KOL A;  4DU9 A;  1WVL A;  3IFT A;  3GO5 A;  5EPJ A;  2WII B;  4C3I B;  4WOR A;  4XQQ A;  4IFD J;  1MD2 D;  4IUQ A;  2EVB A;  1TWA B;  1CHQ D;  3N6R A;  1OXS C;  1F9R A;  1BCP D;  2QDB A;  2SDF A;  4A3I B;  1ENF A;  3G7L A;  2XN9 C;  5C0X G;  2Z4I A;  4ME5 A;  2K32 A;  3ITP A;  3J81 L;  4CJ1 B;  2F0D A;  2E74 C;  5D14 A;  5LHY 1;  2AUK A;  3D4R A;  3S2H B;  2EXZ A;  3K5M A;  4C56 C;  2NVQ B;  2ENB A;  4ID6 A;  5DNF A;  1BOS A;  3NE5 B;  3C1E A;  3NXW A;  5A2Q L;  2J0T D;  2L11 A;  1WTQ A;  1EQV A;  4RKL A;  1QNU A;  4DK0 A;  1S4Z A;  1HUM A;  1SYG A;  1TWF B;  1S5E D;  1OO9 B;  3J80 L;  4LMQ D;  3I4M B;  1HXY D;  3BG3 A;  1X3Q A;  4CKC A;  3AB9 A;  1LV9 A;  1SEB D;  1Y8O B;  5ELD A;  1G2S A;  1PFN A;  4A3M B;  4C3H G;  1IL8 A;  3MA2 B;  1EYA A;  1F2L A;  1FNU A;  3M4O B;  3RZO B;  4OO1 G;  3OOC A;  2KEE A;  5CV5 A;  1PTO C;  5C5M A;  1HRJ A;  1CZW A;  3SE0 A;  1EFI D;  2DNE A;  1SJH D;  2PQE A;  1D5M C;  3J7Y W;  3MAQ A;  2EY2 A;  4KY6 A;  2WAQ B;  4H0L C;  1JE4 A;  1F9S A;  3DEO A;  2NVX B;  2FIN B;  3EJI A;  3A8J E;  1ESR A;  1RHP A;  1ML0 D;  4F8M A;  1I6H B;  3HOY B;  4JBW A;  3MC0 B;  5C5L A;  3RMH A;  1KTK A;  4U67 3;  1CFM A;  3CU7 A;  5T1I A;  3LX0 A;  3OIP A;  1R9T B;  3QIA A;  4L63 B;  3I90 A;  4CGY B;  1VF5 C;  4M1U B;  4TSS A;  2VB3 X;  1D1I A;  3TP6 A;  2RKS A;  1PRT D;  5FKA C;  3U9S A;  1MBY A;  3NSW A;  5D65 A;  2E76 C;  4H13 C;  4RGT A;  3TP8 A;  1LTG D;  1CA6 A;  1JWU D;  5C4H A;  2EYP A;  2X6L A;  1EU4 A;  1STH A;  2PO4 A;  4WJW A;  5J22 A;  3N52 A;  1A2U A;  1YNJ C;  2BA1 A;  3BDL A;  1KNA A;  1IKL A;  1JQY D;  2QKI C;  1DOM A;  4PNY A;  2BDO A;  4EGV A;  1JIC A;  2HCC A;  1SJE D;  3GP7 A;  1WTP A;  3R93 A;  2EYM A;  1AZQ A;  2L12 A;  3K57 A;  2B2Y A;  1LT5 D;  4QMG A;  2M9V A;  3E6Z X;  2K33 A;  1Q8I A;  1TU2 B;  3D4W A;  1ROD A;  2D62 A;  1LLR D;  3DHQ A;  1PZI D;  1H9J A;  2KVM A;  3BZD B;  1MSG A;  1KDA A;  1QE6 A;  4ZLT F;  1PTO D;  5I9P A;  3GV6 A;  3CRK C;  1EIH A;  2L4N A;  1KNE A;  3K5O A;  3DXJ C;  1BF4 A;  2KHS A;  1D2B A;  1DCZ A;  4LAA A;  2JE6 I;  3J7A F;  4H7B A;  5FO7 B;  2ZXP A;  1B44 D;  5FLX L;  1SDF A;  2XWJ B;  5EKL A;  1NCV A;  3Q22 A;  3S16 B;  1MGS A;  2K28 A;  4BA2 I;  1EY0 A;  1HPC A;  4IUP A;  1STY A;  3UI2 A;  3MWY W;  3QOJ A;  1PDQ A;  4BY1 B;  1IW7 C;  2XWB B;  3I70 A;  3MEH A;  3GTM B;  4FXD A;  4J1M A;  1BCP B;  4FP5 D;  3AMU A;  2L0C A;  4XDX A;  4QCL A;  1U4M A;  2B2Y C;  2OF1 A;  2QF7 A;  1KDC A;  1HQR D;  3GTG B;  5KEE A;  4HAE A;  2F0V A;  4C3J B;  3DWQ A;  1B2T A;  5CBA E;  4ZQ3 A;  2N55 A;  5CMD A;  1ILQ A;  2PW7 A;  4EVO A;  3RLF A;  2JEB I;  5K36 G;  3V96 A;  1EEF D;  1LTR D;  3TDQ A;  1B1Z A;  1AW7 A;  2KA7 A;  3A55 A;  2EOT A;  3MHB A;  2WKD A;  1I4P A;  3L7Z C;  2BE5 C;  3M3Y B;  5IGG A;  3OMC A;  1QWY A;  1SYE A;  3NBH A;  3T16 A;  1LTS D;  4FNF A;  5LL6 X;  3K7A B;  2H1E A;  1UNS A;  1V1P A;  1L0X B;  3H94 A;  1Y1V B;  1V43 A;  2A6H C;  2G9H D;  1JWM D;  2KEC A;  3MFG A;  1STA A;  2R93 B;  3PUY A;  3GTL B;  4Q0F A;  3KK7 A;  4XTC S;  4XYO A;  1J9O A;  3GV3 A;  3SEB A;  5I4D A;  2IX1 A;  3FPP A;  1CHP D;  3I3C A;  1A3U A;  2XRQ D;  2A6E C;  3HRZ C;  3IL8 A;  2DN8 A;  1BDO A;  2ZXR A;  1NSN S;  1LTI D;  5F2D A;  4FF2 A;  3FPU B;  2JP1 A;  4IAL A;  3S1N B;  3U9O A;  5KIX A;  3MXP A;  2EYO A;  2F03 A;  4C1N I;  3WOE A;  1IW7 D;  4B08 A;  1VDZ A;  1QIL A;  1QOH A;  1QG7 A;  3SXH A;  1Q1B A;  1RTO A;  1F77 A;  3MXG A;  2BOS A;  1EOT A;  2AWN A;  2K5Q A;  3NPP A;  2KQ3 A;  4A3D B;  3KUP A;  4IUR A;  1X32 A;  1ZYR D;  4OIJ A;  1B50 A;  3T53 B;  4RCO A;  1JOQ A;  3FVQ A;  5BN5 A;  3OMG A;  3P75 A;  4MN3 A;  2NUC A;  4WFN 3;  4K6D A;  1S5F D;  1A15 A;  4NMZ A;  4DFA A;  5C3W A;  1LAC A;  5G3L D;  2D9U A;  2R7Z B;  1GHJ A;  2JA6 B;  1E2W A;  3CKI B;  3TBI B;  4PQX A;  1S5B D;  1STG A;  5C0X H;  3I91 A;  2F1M A;  3GTQ B;  5EBD A;  5C0X J;  4K2K A;  2BE5 D;  1HUN A;  2F0W A;  2SEB D;  5I6Y A;  2V4D A;  3QOL A;  1PFB A;  1KDB A;  3W2D A;  3HOU B;  4KN4 C;  1WCM B;  1E2V A;  5EQ0 A;  3OW7 A;  2PPB C;  2Q8R E;  2X6G A;  3IKJ A;  3PO3 B;  2A6H D;  1SSO A;  1PRT F;  2BA0 A;  3KF8 A;  2YU9 B;  4AYB B;  1PTO B;  1HA6 A;  4XT1 B;  2L1B A;  3D6C A;  3TZD A;  2VUM B;  1Z7T A;  3ONA B;  1A6X A;  2A6E D;  3NTH A;  3R8B A;  2F0Q A;  2L55 A;  1DOL A;  1CM9 A;  2RDF A;  3QB3 A;  4K6L A;  3PUW A;  2HUG A;  4R9W A;  4DK1 A;  3GTK B;  1J8I A;  1MI2 A;  3BVM A;  3H09 A;  3ZYY X;  5DM7 3;  1EZ8 A;  1WTV A;  1EY7 A;  3DWA A;  4ZKB B;  3X3M A;  3KLS A;  1KAA A;  4OO1 H;  2EYJ A;  4A3B B;  1JWS D;  3H6M A;  2SNM A;  4EQN A;  2F0T A;  3PUX A;  5KGU A;  5CC4 A;  1D1K A;  5TSS A;  3MFY A;  4PV1 C;  3PUZ A;  3BYT B;  5ELF A;  4E6I A;  1LT6 D;  1STE A;  4XXE A;  1VMP A;  4TKO B;  3M7G A;  3R2T A;  3BDO A;  4FF4 A;  2IJ0 A;  1O7Z A;  2F3W A;  2EPB A;  2EY6 A;  4BBR B;  5NUC A;  1IKM A;  3D3R A;  5HGT A;  4UAI A;  1O7Y A;  1SYB A;  4DXF A;  1AEX A;  2KED A;  1D6E C;  5IT9 L;  2NVY B;  2K03 A;  1MSH A;  3OSO A;  2TSS A;  1SE4 A;  1B53 A;  1II3 A;  1HHV A;  3HP3 A;  3C2P A;  5KNB A;  1TY2 A;  1SYC A;  1YNN C;  2DNC A;  1LT3 D;  2SNS A;  1GUG A;  2A68 C;  2EJG C;  4YIJ A;  1K83 B;  2RSN A;  2X69 A;  1OXU A;  2WP8 J;  2NVT B;  3S9W A;  3TZU A;  4IUN A;  2CW0 C;  4L6T B;  4K5V A;  3I72 A;  4HCE A;  1WTO A;  1Q12 A;  1LTT D;  1EY9 A;  4DF7 A;  1WTW A;  1B9M A;  1GUN A;  5KRU A;  3R3O A;  4K5W A;  4KD4 A;  1KLU D;  1CQV A;  1H9M A;  4PMC A;  1X3P A;  4U68 A;  1BXT A;  2K7V A;  1Y8N B;  2FMC A;  2PYK A;  2I07 B;  1SE2 A;  3A54 A;  4ILW A;  2F0K A;  3VR6 A;  1LTA D;  2IX0 A;  2Z1C A;  4RHR A;  5E1F A;  4F7X A;  2IX3 A;  2XIW A;  3NBI A;  2K04 A;  5KYI A;  2H4O A;  4KJN A;  5M5W B;  1GUO A;  1CZG A;  2RVL A;  2MGS A;  4N9T A;  1TQO A;  2B2T A;  4KMU C;  3HOW B;  1SAP A;  1DD2 A;  1JOR A;  1ICW A;  1PFM A;  2SOB A;  4X3T A;  4Q5V A;  2EYL A;  3SK5 A;  1VF7 A;  2E2I B;  4RGM A;  5IT9 E;  1C48 A;  4FO2 A;  3VR4 A;  1M4V A;  1HCZ A;  5JOB A;  4IN3 A;  4K8I A;  2A73 B;  5CV9 A;  5A35 A;  3VR5 A;  4DGZ A;  4G7H C;  4WRD A;  3A8I E;  1I4R A;  1O7L A;  2OEO A;  3TP7 A;  5FOB B;  1XXG A;  3V05 A;  3C3L A;  2K5D A;  1DJR D;  1OXX K;  2CVR A;  4XIG S;  3BYY B;  2AWO A;  1YNN D;  4ZYS A;  1GUS A;  1G6Z A;  2A68 D;  1U4L A;  1ONL A;  4BS9 A;  5D3I B;  1K8M A;  5K36 H;  3VYT A;  2CW0 D;  2JA7 B;  2M00 A;  1ZKO A;  4KKS A;  4CHT B;  1U9R A;  2RBM A;  2Y0S B;  1ET9 A;  1PLF A;  1FR3 A;  1TR5 A;  3D6W A;  1EY8 A;  5J39 A;  4V0B A;  3SHL A;  3TP5 A;  5DM6 3;  3MZ5 A;  3M4Y A;  2E2H B;  4G7Z C;  3FDT A;  5IGF A;  4KY7 A;  3RUZ A;  2WB1 B;  2F0E A;  5C3X A;  2NTT A;  1A2T A;  3K0Y A;  5C3E B;  4KKU A;  3K58 A;  4FYD A;  1VMC A;  3K5L A;  1TWC B;  1F2Y A;  3SVM A;  2A69 C;  2LY7 A;  1CT1 D;  1TVX A;  3SK6 A;  1M8A A;  3DM1 A;  3OIQ A;  1WD0 A;  2G9D A;  3VA5 A;  5AFW A;  2WKC A;  1DM0 B;  4RFB A;  3SK8 A;  3A8K E;  2EJM A;  2EY5 A;  3DWP A;  4DA2 A;  4J8Q A;  2K01 A;  1YNJ D;  5FO9 B;  1V1P B;  2LMC B;  4QUF A;  2NN6 I;  3M85 A;  2BCO A;  4BBS B;  1PZK D;  4I7Z C;  2B2U A;  2AQ1 B;  2R6G A;  3HZX A;  2L5T A;  3QO2 A;  1QNK A;  2CQA A;  2L9H A;  1PYW D;  1WTX A;  1LO5 D;  5M9O A;  3A7A B;  4A3G B;  3HGB A;  5M3F B;  2KCC A;  5D3D A;  4C3I G;  4FXG C;  3WOF A;  2F0H A;  3O13 A;  4DXG A;  3FMC A;  4BY7 B;  1RTN A;  4TRD A;  1F9Q A;  2YYZ A;  1G91 A;  1TS2 A;  3Q23 A;  1XYI A;  1L0Y B;  5ELC A;  3FEW X;  1S5D D;  3PIP 3;  1W6K A;  2AQ3 B;  1EY6 A;  2EJF C;  2ID0 A;  3I4L A;  5JEA G;  5T1G A;  1DXM A;  1BCP F;  1I4H A;  1H9S A;  5EBC A;  3E0J A;  3P20 A;  4MHE A;  4BWG B;  3MTS A;  3E5S A;  3NK9 A;  4DAP A;  3RZD B;  3EFX D;  2NWG A;  4OL7 A;  4IFD I;  2Z8L A;  1JR0 D;  4G4K A;  4EQO A;  3FKI B;  3KBX A;  1WTR A;  2NZ1 D;  2RA4 A;  5I6W A;  2F0I A;  2WV6 D;  4IUU A;  1V8Q A;  5C4J B;  4X3U A;  2DY8 A;  1XWE A;  2PZT A;  2F0L A;  2F0O A;  3QWN A;  2Z4H A;  3A7L A;  2J4X A;  4LJZ C;  1GHK A;  2B2U C;  1KLG D;  2F0G A;  2O4X A;  1CK1 A;  4G57 A;  1R4Q B;  1AN8 A;  3S1M B;  2EYF A;  3I73 A;  1CTM A;  2IW3 A;  1SMY C;  2A69 D;  5EPL A;  4M8A A;  4Z9C B;  4R8N A;  1ENC A;  5CGK A;  4QF4 A;  1TWG B;  2JA8 B;  3MXU A;  5C6A A;  2F0P A;  4KHZ A;  4C2M B;  3NTI A;  4K2L A;  4X3S A;  4A3J B;  2B2W A;  1BR9 A;  4HN7 A;  3VYS A;  1SE3 A;  3FRP B;  4OIK A;  2WIN B;  1FYC A;  2WAC A;  4RAU C;  4RWS C;  3K59 A;  2NBF A;  3TME A;  2K6A A;  3OHX C;  1O80 A;  5C4Z A;  2OXP A;  5CV7 A;  1UUP A;  2JXM B;  2DY7 A;  4Y7N B;  2K05 A;  4QB4 A;  1LAB A;  4F87 A;  1TY0 A;  3G6J B;  4RCN A;  4J6H A;  1T5X D;  1NAP A;  2NB0 A;  5CV6 A;  4XQJ A;  3CQZ B;  2QCP X;  3M7N A;  1BBX C;  4JK1 C;  4G7O C;  3NQT A;  1SNP A;  5JPM C;  2I46 A;  2XNA C;  4DNT B;  4ABN A;  4IUT A;  2RDH A;  3BDC A;  4KTA A;  5HUR A;  1QB5 D;  1STB A;  3H3V C;  1BO0 A;  1CQF A;  3VR2 A;  1SND A;  4RGO S;  3LWE A;  3T56 B;  4IZ8 A;  5IIF A;  2MUY A;  2AUJ D;  5IGC A;  1A3V A;  4B9X A;  3D8G A;  3L3O C;  1SFO B;  1PZJ D;  1OXT A;  1T5E A;  2EY1 A;  5IOD A;  4O42 A;  1EL0 A;  4RKB A;  5I2Y A;  4A93 B;  4KV6 A;  2E2J B;  5E4W C;  2B2W C;  1LTB D;  4HMI A;  4NW2 A;  4FF3 A;  2LFN A;  3VYR A;  1JB3 A;  1WD1 A;  4OGQ C;  4P2C B;  1VCI A;  1AFP A;  4RA8 A;  2A5H A;  2XRS D;  3KLR A;  1NUC A;  3NUC A;  1TS4 A;  2F0F A;  3GTO B;  3DMU A;  3GQB A;  1B9N A;  3LWU A;  4IFD H;  4OHJ A;  5E3F A;  5KND A;  1FNW A;  4HSV A;  3VA7 A;  4ODG A;  1SMY D;  1I50 B;  2F4I A;  3TN2 A;  4IUV A;  2NN6 G;  1PRT C;  3JAM E;  3Q24 A;  3H0G B;  2FFK B;  4MIU A;  3GD7 A;  1JC7 A;  3S2D B;  2IT1 A;  2B2V A;  1QCB D;  3OPO A;  1DOK A;  1RJT A;  1HQM C;  3LNN A;  3L9A X;  3PIO 3;  1PTO F;  4A3F B;  4UDU C;  3PO2 B;  1NR4 A;  3EVQ A;  3BVG A;  3Q6S A;  5COR A;  5KNC A;  3GTJ B;  3F2U A;  1KAB A;  1EY4 A;  2K1B A;  3RD4 A;  5IGD A;  5IGB A;  1Z47 A;  4S3S A;  4RHS A;  4F88 A;  3S15 B;  3IFD A;  5JVG 3;  4FF1 A;  2F0J A;  4DAV A;  2J7Z A;  4KN7 C;  2PCF B;  1XTC D;  1O78 A;  4IFD G;  1DZ1 A;  2ZT9 C;  2PZU A;  2IPK D;  2PZW A;  4DNR B;  5COY A;  1AZP A;  3AU7 A;  2NTS A;  1IYU A;  2TMP A;  1K8O A;  4A3E B;  1B4O A;  1EIG A;  1U4P A;  2B63 B;  3H91 A;  1CA5 A;  3I4N B;  4ZRZ A;  2D5D A;  3OWF A;  4GZY C;  4X3K A;  2B2V C;  1EQT A;  1I4X A;  4XQN A;  2FHT A;  1HFG A;  2Q8I B;  4C3J G;  1D5Z C;  1DYQ A;  5EKK A;  2OT2 A;  1U4R A;  5CYU A;  5C44 B;  1I4G A;  1TKW B;  2VB2 X;  3HEJ A;  2E2D C;  1ILP A;  4N9P A;  2GA4 B;  5IGE A;  5ISR A;  2K5W A;  4H44 C;  2B8F A;  2IWH A;  1JOK A;  2AQ2 B;  4L8J A;  4EQP A;  3HKZ B;  1HTP A;  2C9O A;  2MJ8 A;  4KY5 A;  4PMW A;  1GXD C;  5EJW A;  3S1R B;  3NQI A;  2XSC A;  3J81 E;  2PMZ B;  3VR3 A;  3OWE B;  1SNO A;  2FMM A;  3HOZ B;  3I8Z A;  1F2M A;  5CBE E;  5EGT A;  3CHB D;  1HA5 A;  5FO8 B;  1I4Q A;  1ZEQ X;  4HR7 B;  4CJ2 C;  4HCS A;  4C1N K;  1QJO A;  1AP0 A;  3X3N A;  5EKI A;  2JYO A;  4CJ0 B;  5A2Q E;  4FVM A;  3EQL C;  3HOX B;  1Q1E A;  1G29 1;  5E4X A;  2EYH A;  1PMR A;  4XT3 B;  2N88 A;  1BNZ A;  4PMB A;  3GTP B;  2F0S A;  5M3M B;  3J80 E;  1IHZ A;  3T4A C;  1B3A A;  2HDL A;  5ELE A;  4HSP A;  4DAY A;  1DON A;  3ND8 A;  2JEA I;  4QUC A;  3MXN A;  4ULL A;  5JPN C;  3BS1 A;  1LT4 D;  2O2L D;  5BN3 A;  1C4Q A;  2HQE A;  4KJO A;  3PV0 A;  5JJZ A;  2ZXO A;  1I6V C;  3NTK A;  5I2X A;  1UAP A;  2F3V A;  1PTO H;  3TSS A;  2LS0 1;  2O5I C;  3IAY A;  5K5P A;  4XYQ A;  3URY A;  1IYV A;  1RDP D;  1ZXT A;  4HTH A;  3S1Q B;  4K14 A;  2EE1 A;  5ELB A;  4ZK9 B;  4I65 A;  1SNM A;  2B2T C;  4QIW B;  1EWC A;  3ERQ A;  3PUV A;  4BA1 I;  2FJ2 A;  2VNU D;  1ET6 A;  3C46 A;  3ERO A;  4K8J A;  1F2Z A;  5G3L F;  5CR3 A;  4KD3 A;  3K6O A;  1H9K A;  1EZ6 A;  5JEA H;  1ENA A;  1SYF A;  3S14 B;  4C3H B;  5JEA J;  2KCN A;  4RGN A;  4KK7 A;  4CBV A;  2R3Z A;  1GJX A;  3NP8 A;  1BQQ T;  5JVH 3;  1SYD A;  3DEP A;  3K5N A;  2JSO A;  1ZYR C;  3KLS X;  1ESF A;  1EEI D;  3HG9 A;  1Q3L A;  2VXW A;  4B9W A;  5BN4 A;  2E75 C;  4ZKC B;  5C0X I;  3S17 B;  1RCV D;  5M5Y B;  1H9S B;  1V1O A;  2XVS A;  1CI3 M;  4FXK C;  4KHV A;  2O5J C;  1Y8P B;  2BDN A;  3C1F A;  3T51 B;  2HDM A;  1TT2 A;  2C5C A;  3P7J A;  3HS0 C;  1FGB D;  2M2L A;  2F0U A;  1TII D;  1EYC A;  2ICI A;  1Z6H A;  2QIL A;  1PXU A;  3NWS A;  5CV4 A;  4HMJ A;  1GUW A;  1SXT A;  3SDZ A;  5JAV A;  3R2I A;  1E0B A;  4LK1 C;  3W3A A;  3QG1 A;  3ND9 A;  2ICE C;  5FK9 C;  1EU3 A;  5DEH A;  1TS3 A;  1G2T A;  1RF2 D;  2RDG A;  1JCK B;  3SK4 A;  1BUV T;  1TWH B;  1W6J A;  5FLX E;  1EWH A;  5J1Z A;  4O1N A;  3NHH A;  4NP5 A;  2RSO A;  3NWT A;  1EYD A;  1XX8 A;  2RQX A;  1FNV A;  4KKT A;  4HED A;  1TS5 A;  5I9O A;  4OO1 I;  3PMF A;  4K5X A;  2R92 B;  1R4P B;  1A3T A;  3BVZ A;  2B39 A;  2NYZ D;  3CRL C;  3VYU A;  4TQU S;  3HOV B;  5C4X B;  5EPK A;  4RH6 A;  4ZUI A;  1GUT A;  1HFN A;  2KUM A;  1NR2 A;  1G8Z D;  3EA6 A;  1FD7 D;  2D2C C;  4NKL A;  3SR1 A;  2B8G A;  1Y1W B;  2IL8 A;  1STN A;  1SNQ A;  1UEA B;  1BCP C;  1SNC A;  3A56 A;  1PRT B;  2PW5 A;  2A74 C;  5KYL A;  2MPM A;  3JAM L;  2R61 A;  1SBB B;  2EZV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...