1STGA

Two distinctly different metal binding modes are seen in x-ray crystal structures of staphylococcal nuclease-cobalt(ii)-nucleotide complexes
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
136
structure length
136
Chain Sequence
KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystal structures of staphylococcal nuclease complexed with the competitive inhibitor cobalt(II) and nucleotide.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase(phosphoric diester)
molecule keywords STAPHYLOCOCCAL NUCLEASE
total genus 38
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 1994-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1stgA00
2KQ3A 4ZUIA 2F0EA 1A3VA 2SNSA 2PYKA 4IUNA 4LAAA 2F0SA 3HEJA 1JOQA 4N9PA 1ENCA 1RKNA 3P1HA 1TR5A 1SNOA 5I6YA 5DAUA 5J39A 5I9OA 1A3TA 2KHSA 4KJNA 2EYJA 5J22A 1STBA 4HMJA 4K6DA 2M00A 3SHLA 5E3FA 3S9WA 1EYDA 2PW5A 2F0UA 2O4XA 3D4WA 1EZ8A 3MZ5A 3NK9A 5C4HA 5I6WA 2WACA 3NUCA 1KAAA 2PZUA 1ENAA 4E6IA 2EY2A 2F0VA 1EYAA 4B9XA 4RKBA 1SYEA 1EQVA 5EGTA 2F3WA 4KD3A 5HGTA 3MHBA 4RKLA 5E1FA 2QDBA 5NUCA 2OF1A 4K5WA 3MVVA 3SK8A 4KTAA 5J1ZA 1SNDA 3E5SA 2F0NA 3R3OA 1SNPA 4DGZA 5K5PA 2EYLA 2F0LA 4WORA 4ZUJA 5KYLA 5F2DA 1SYFA 1EY0A 2F0FA 2RBMA 1EZ6A 3NXWA 3P75A 2EYFA 3D6CA 5ISRA 4PMCA 4PNYA 3SK5A 4EQOA 2F0PA 5KGUA 3NQTA 1A3UA 5CV9A 1AEXA 4MIUA 5KIXA 5KRUA 2F3VA 1F2ZA 3D4DA 2ENBA 2SNMA 1KABA 4G57A 3U9OA 5IGFA 4K14A 5IGBA 3PMFA 4KY7A 1JOKA 1SYGA 4HTHA 3RUZA 5IIFA 4QMGA 3TP7A 1U9RA 3OSOA 4NKLA 3BDLA 3TP8A 1STNA 4B9WA 2PW7A 1KDBA 2NUCA 1EY7A 4TRDA 4ID6A 5C5MA 5C6AA 3QB3A 3H6MA 3MXPA 5IOCA 3V2TA 1KDAA 4KHVA 5CV7A 3T13A 3HZXA 4QB4A 2F0TA 1EYCA 4K8IA 3DHQA 3SK6A 1EY8A 1NUCA 2EYMA 2F0GA 2RKSA 5C5LA 5KEEA 2SOBA 5CV8A 5C3WA 1SNMA 2OEOA 3TP5A 5CV5A 3EROA 1SYBA 5CGKA 4DFAA 3EVQA 2F0MA 5HURA 4J6HA 2F0IA 3T16A 5IGDA 4K2KA 4K5VA 5I9PA 4DU9A 2F0HA 1EY4A 2EYOA 4K5XA 3C1FA 2PZWA 5JOBA 4EQNA 5KYIA 4EVOA 2RDFA 3TP6A 4KY6A 1SNCA 1SNQA 1SYDA 4KV6A 1F2YA 2F0KA 5DEHA 5IGGA 1JORA 2EY1A 3MEHA 3OMCA 3ITPA 3QOLA 2PQEA 1IHZA 2EXZA 3EJIA 2HQEA 1KDCA 4J1MA 3SR1A 5CC4A 4ZQ3A 1STGA 1TQOA 4NP5A 1STHA 4N9TA 2F0WA 5JAVA 4H7BA 4IZ8A 1A2TA 1SYCA 1II3A 3OMGA 2LKVA 1EY5A 1STAA 4HMIA 4KJOA 3NHHA 4EQPA 4IALA 1JOOA 2F0DA 4F7XA 4F8MA 3NP8A 2EYHA 4KD4A 1NSNS 4R8NA 3OWFA 4I65A 1EY9A 1TT2A 1STYA 3D8GA 4K2LA 4OL7A 5CR3A 5EKKA 5EKLA 3VA5A 5C3XA 3QOJA 4NMZA 4PMBA 3TMEA 3SK4A 1F2MA 4ODGA 4DF7A 4WRDA 5IGCA 2OXPA 2EY5A 2F0OA 3ERQA 4S3SA 2PZTA 3SXHA 5CV6A 5C4ZA 3LX0A 1EY6A 4QF4A 3C1EA 5IGEA 2EY6A 4K8JA 2F0JA 5IODA 4ME5A 3BDCA 3DMUA 4YIJA 4NDXA 5M9OA 1A2UA 4KY5A 5CV4A 2F0QA 2EYPA
chains in the Genus database with same CATH superfamily
5IP9H 1CUKA 2Z6KA 4P74A 2F0SA 2N3SA 3BZKA 3NWSA 4LUZA 2DY7A 1JB3A 2R7FA 3KUPA 1BCPD 2P5ZX 3ND9A 1LUZA 1VQPA 2NN6G 2IL8A 4FF3A 1LTRD 1EQVA 4H0LC 1LACA 1FJGQ 1H9SB 1ZYRD 1JT8A 4DGZA 2QEXA 4DV4Q 2A68C 3T51B 4ZUJA 5C4JH 4LF4Q 1J5EL 5EQ0A 4X62Q 3KF6A 3CCSA 2QEJC 4IPHA 5KGUA 1PH3A 2N8NA 5G3LD 2VB3X 4GNXC 5IYCH 1XTDA 1K0SA 1BBUA 1BNZA 4R9WA 2OCEA 2HD3A 2A6EC 4BY7G 1AE3A 4WFN3 4L5RC 2XGTA 3BYTB 3E0EA 1D1IA 4K0KQ 1K28A 1S4ZA 4IQZA 1XJVA 5M5XB 5LMUQ 4A3CH 1FNUA 4XQNA 5C5LA 4BBSG 5KEEA 3HOVG 4JI4L 2NTTA 2EDGA 4ME3A 3GTOB 4DV2L 3MXGA 3CKIB 4K5VA 4DV0Q 1I3QB 1LTLA 4R4TA 3GDEA 1TWCB 1SE4A 4C1NK 4JC0A 5JEAH 1N8RC 1Q1EA 1RD9D 1BCPC 3HOVB 3KYHC 2L0CA 3S1QH 1K0RA 4BY7H 1CSPA 1PYWD 3FEWX 4DAVA 4N9TA 1II3A 2QDLA 1EWIA 4G4KA 3M3YB 4QUCA 2ZTDA 3OHXC 4JCVE 3PO3G 3AB9A 3J80L 4PMBA 2NVQH 4DF7A 1XNRQ 2OXPA 2R93B 4LF9L 4XT1B 2Z6KC 3A8KE 1EY6A 4XT3B 4CDEC 4A3GB 1HZBA 1H9SA 3RN2A 1X3QA 1HR0Q 1YNNC 1B1ZA 1Z9FA 1RL2A 1G291 2XSCA 1MHWC 1RKNA 2ZM6L 3PUYA 1G8ZD 1DOKA 1AE2A 1P8LA 2J7ZA 4JI8L 5J39A 3KJOA 1HNWQ 1WYDA 4UY8C 2MHVA 4KJNA 2F3IA 4C3HH 5I6WA 4PZ8A 3KJPA 3L9AX 5IT9L 1K83B 3KF8B 3WOEA 4GOPC 1X32A 3VYTA 2VB2X 2H5XA 1SJED 1EFWA 1EEID 3K7AB 1DM0B 1TWHB 3VYUA 4GOPB 2IY5B 3UDXA 3HOZH 1J6QA 3D6CA 2DY8A 5JJIA 4LWCA 1DYQA 3T1YL 1LO5D 1DZ1A 3A55A 5C0XH 5AJ3L 2RCNA 1KABA 5LHY1 3HOYH 3OIPA 4IJLA 1OXXK 2MO0A 3NBHA 3OSOA 4ABNA 2NUCA 2OQ0A 3T53B 4X62L 3H6MA 3CCVA 4DR6Q 1PRTC 1KDAA 2B2UA 3FVQA 3T13A 2IX3A 3HZXA 4OGQC 2JA8G 4K8IA 4JI5Q 2IHFA 4JV5Q 3NPPA 1WJJA 1SMYC 1LTID 5FJ8G 1LTSD 3CCJA 1Y1VB 1TWGH 4K2KA 2C5CA 2RHSB 4RAUC 1XMOL 4KI0A 1X65A 3OOCA 4QQBX 1F9SA 1LT3D 4BBRB 3OW2A 2L5TA 5A2QE 1IHZA 1BCPB 4J1MA 3G71A 2EXDA 4AYBB 4QIWB 3DM3A 1GHKA 4A3KH 3ICEA 1A2TA 3RD4A 1XXGA 4EQPA 3NHHA 2B2VC 4J15A 2JE6I 3E0JA 1B2TA 4OWTB 3MFGA 4KD4A 2K5DA 5C3EH 1R4PB 2NB0A 1QILA 2AUJD 4OO1I 3S16B 3TMEA 4APVA 3S1MB 3NEMA 2F0OA 3ERQA 3JAML 3GTMH 2ZXRA 5CV6A 4AQYQ 4QF4A 4CDDC 4KKUA 2EY6A 4ZLTF 2A69D 1QNKA 1B53A 1FL0A 1PV4A 2EZVA 2N88A 1F77A 1YJNA 2G9DA 1A3VA 4DR2L 1H9KA 4ZCKA 1N32Q 3MAQA 2JA5B 1NE3A 4XYQA 3TREA 4GNXB 2SDFA 5C44B 1U5KA 5KNCA 1WCMB 3DUZA 2UUCL 4KHZA 2CQOA 4RKLA 5IP7G 2FHTA 4DR7L 3R3OA 2K33A 4C3JH 5FO8B 3IKJA 5KYLA 1GD7A 2YTXA 2BOSA 1M8AA 2EOTA 1S3OA 3BVGA 2KCNA 2MUYA 1D5XC 1AEXA 4DXFA 3URYA 1HQMC 4JI5L 1S72A 1LTTD 3TQYA 4A3GG 2V1CC 3I4OA 2WAQE 4NKLA 3HRZC 1PFBA 5ELEA 5A2QL 4A3MH 4A3KG 4DR4Q 5CV7A 2JA7B 2JA6H 2EYMA 5KNDA 2E2HB 2Y0SB 1SBBB 3S14B 3TN2A 3CD6A 4BBRG 4I7AA 2F0MA 2QGQA 1H95A 2E2IH 4LF7Q 1YZ6A 4JOIA 1HA6A 2A69C 2E8GA 3S17B 5LMNL 3HOUB 2PZWA 2Q8IB 4L5TA 4IURA 5GAGC 1BCPF 4KY6A 2Z4IA 3H3VC 1G2TA 2PQEA 4CBVA 1PTOB 2JA8B 1K3RA 1ET9A 1HZCA 1GKHA 1CM9A 1ESRA 3L0OA 4HMIA 3ZYYX 3JAMc 2K01A 3MFYA 2D0OA 2EYHA 2WFWA 2OTJA 2JA9A 2MO1A 1F9QA 4DR5Q 3VA5A 3G6EA 4A3JG 3R93A 3T56B 4CJ1B 4ILWA 1GO3E 1K8GA 2PZTA 2R92H 2K28A 3HOVH 4HIOA 4K8JA 1X56A 1UNSA 5H1SE 2IT1A 1FR3A 3A74A 1WI5A 5IT9E 1OO9B 1QCBD 4LK1C 2QF7A 3S15B 5FLXc 4PZ7A 4GOPA 3KLSX 1MJEA 2NVYB 4JI0L 1HPCA 2VNUD 1N9WA 3KF8A 3BS1A 4G7ZC 1B4OA 4RCNA 1JE4A 1SR3A 1Y1WH 4RGOS 1OXUA 4NB3A 2Z9HA 3E5SA 1SNPA 2R7DA 4WORA 1CA5A 5F2DA 3H0GG 3S16H 1Y1VG 3VR5A 4A3EB 1TVXA 1S5CD 1E1TA 1PH6A 4EQOA 3A7LA 3ZJYC 1I94Q 2TSSA 2E76C 2UU9L 1I4RA 5KRUA 1CI3M 2F3VA 3D4DA 2A74C 4FP5D 2MGSA 3VDYA 1WTHA 4A3KB 3PMFA 3SE0A 3I70A 2UUAQ 3TP7A 2A8VA 4CKCA 3NBHB 2N78A 4TSSA 4ID6A 2XN9C 2DNCA 1JR0D 2JP1A 4C2MH 3UDFA 1PA6A 4IOAA 2RHQB 3ULJA 3D31A 5IT9c 1X9NA 2UXDQ 4B3SL 3PO2B 1BUVT 4P73A 3G48A 1EIGA 4LF9Q 5IGDA 4R4OA 2AKWB 3I4MG 3HKZE 1D5MC 4DR4L 2F52A 4OO1H 2EYOA 4Z9CB 2K1BA 1A15A 1NMFA 3TP6A 4Y7NH 1E24A 4DK6C 4AYBG 3JAME 1R9TB 4POFA 3PO2G 3K8AA 1HZAA 2WB1E 3HP3A 4L8JA 4JI2Q 3NE5B 2G5DA 4LW1A 2VL6A 2HDLA 1WFQA 1V1QA 3QR8A 5BR8L 3HOWH 2DUDA 5CBAE 2EQSA 1HJPA 1D8LA 5COYA 1IBKQ 2JXMB 5I4DA 4RGMA 2E2HH 2EY5A 4JW0A 4X65Q 4HIKA 2QA4A 2YU9H 1D7QA 1U4MA 4CGYB 2LS01 2YV5A 2JJQA 1KXLA 1HA5A 1BVSA 1IW7D 3S17H 5M3FB 5M5YB 4IUNA 1RTOA 1D5ZC 1VQ4A 1JOQA 2JA5H 3P1HA 1V1PB 1VQHA 4A3IG 4A3DG 4OHJA 2EYJA 4K6DA 4FXDA 2JA6B 3FKIB 1EYDA 3TSSA 2B63B 3NUCA 2L1BA 4CJ0B 2B8GA 3M4YA 1FVIA 5E4WC 1SNDA 1TWHH 3GTQB 3ER0A 4IFDG 3F8TA 2NVQB 3CMEA 1ESFA 3EBEA 1U4RA 3CC4A 2B2YC 3OTOQ 4QUFA 4DV0L 1J9OA 3CMAA 4B3ML 2L12A 2NVXB 1Q8IA 2PW7A 3M4QA 2VQEL 1VMPA 3MXPA 5K36G 4GS3A 3K5LA 4DNTB 4ULLA 3SK6A 4YWKA 2OTLA 3M7GA 1EWHA 2ICEC 4JI1L 3TRZA 1PVOA 2FJ2A 4MHEA 1LLRD 2B2WA 2SOBA 4HCSA 2Z0SA 2R93H 2AWOA 2B8FA 2L9HA 2WB1B 2VQFQ 4DFAA 4EGVA 1E2VA 3HOXH 2CHBD 1HRJA 1EY4A 1LM0A 3PF5A 3Q0AA 2RDFA 4IUTA 4HIMA 1IBMQ 3W1GA 1SE8A 5GAHC 3OMCA 1V1OA 3AYHB 2Q2UA 3FKIG 5J3BA 1A0IA 4UHVA 4OX9Q 2K7VA 3EIVA 3H94A 5D65A 1T9HA 3LNNA 4WJ3M 5EAYA 2D0PA 4F7XA 3IRBA 2UUBL 3S24A 1W6KA 3K7AH 1C9OA 1TT2A 2ZXOA 1J8IA 3CW2C 1NTGA 2RSOA 2PMZE 3KBXA 1Q86C 4DA2A 4BXXG 5HY6A 3S1NB 3LX0A 4OIJA 4A3LG 3NTHA 3E9IA 2RSNA 3NENA 1L0WA 1HHVA 3DMUA 2K32A 5FO7B 2R6GA 4P2CB 4ZUIA 2CVRA 1KNAA 1PLFA 2NWGA 3HEJA 1TWAB 1YVCA 2B3GA 4B3MQ 3FMCA 1Q8KA 4QIWE 4A93H 1QZHA 1JWUD 1R4QB 1L1OB 2K5WA 4DR1L 2XIWA 3BVMA 2MNAA 1B7YB 1PH5A 1AZPA 2E2JH 1CZWA 2CCZA 3GTQH 4IFDH 2ZXPA 2KOLA 2VZAA 3HOUH 4A3EH 4KHPQ 4ZK9B 1L2FA 4CHTB 3PUWA 3TBIB 3HOXG 4PMCA 2DNEA 2WKDA 5DNFA 3W3AA 4MIUA 1C0AA 3PIOA 4O42A 1KLGD 2SNMA 2E2IB 2L11A 1ZXTA 3BZCA 4HN7A 4HTHA 4LFAL 1ILPA 4YCWA 5GQOA 3UDIA 2A6HC 3E9HA 4RWSC 5IYBG 1V9PA 2HCCA 2D5DA 2JA7H 4KN7C 1WVLA 4IPCA 3DHQA 4OEMB 1QJOA 3HKZG 1WTXA 1WTOA 2YU9B 3AQQA 1XMOQ 1G51A 3KLRA 1QWYA 4HJAA 4O1NA 1O80A 1TKWB 4RG1A 3MA2B 4RH6A 5HURA 3PO3B 4RGNA 1DCZA 2RF4A 4JI6Q 5BN5A 4MTNA 1EU4A 5C3EG 1Z47A 3DXJC 4EVOA 3C3LA 1XX8A 4AQYL 1VS0A 4KV6A 1N34Q 2PPBC 3SGIA 1VQMA 2EXZA 3STBC 4GN4B 1IL2A 1BF4A 4DKAC 2NVYH 1MKHA 5DM63 5C44G 1A6XA 4C3IH 4H7BA 3KLWA 2JEBI 1WCMH 2X6LA 4BBSB 4IALA 2K5HA 4F87A 4AYBE 3LGJA 1JJ2A 1X3EA 1I4QA 2LMCB 3QOJA 1N36L 3SK4A 2F03A 4GNXA 1VDZA 5G3LF 3U58A 4B3RQ 4KHPL 1UUPA 1FJGL 3PF4A 1F9PA 1XTCD 4GKJL 3CP0A 3RR5A 3PUVA 5I9PA 3KDFA 4DV7L 1TU2B 4C56C 4LNQA 4RFBA 1GHJA 2R7ZB 1Q46A 4A3MB 2C9OA 4A4IA 3DWAA 4DV1Q 1IL8A 1PYSB 3SHLA 1JWMD 1B9MA 3DEOA 3KBGA 2WACA 3PCOB 4YWMA 2KEDA 5EGTA 2PI2E 4A3EG 2JSOA 5NUCA 2DJFC 3SDZA 3U4ZA 3A5ZB 3A54A 1V1PA 4A3IB 2RBMA 1VQNA 2XRQD 3OPOA 1CTMA 2L15A 1HNZL 4PNYA 1CSQA 3SK5A 2F0PA 4JOIC 4DV3Q 5CV9A 3JAMi 3VR2A 1KTKA 4P72A 5DM73 5IGBA 4MTKA 4JVZA 5IIFA 1KD1C 1K9MC 2ATWA 3CCQA 1IKLA 1F9RA 2KECA 4C3JG 2CW0C 5C44H 3GTJH 2PMZB 5FLMG 1SDFA 2WAQG 1JJCB 2LXKA 1NUCA 4A3FH 2E2DC 1STEA 2VQFL 5LMUL 3TZUA 4Y52H 1XYIA 2R92B 1CHPD 3TP5A 1SFOH 2ASBA 3W2DA 1RCVD 1Z6HA 1FNVA 3EVQA 5D14A 4J6HA 5C0XG 4BY1B 1XPOA 3Q6SA 1PH4A 1I6HH 1ASZA 4FVMA 1UE5A 2AUKA 2EJMA 2LFNA 4GKJQ 2A68D 3BG3A 2CFMA 4DAYB 1EQQA 5CC4A 5EJWA 1TQOA 2EJGC 4IUVA 3S1RH 1NAPA 1IKMA 1JC7A 3CCRA 1JE5A 1K83H 1Y8OB 3PUZA 1NR2A 1BKBA 4RMFA 2BH2A 1A63A 4DAMA 3I4MB 2HUGA 1VQ6A 1DXMA 3VR6A 5JJZA 2MJ8A 1CKOA 1MBYA 1UE6A 4ODGA 4GLAC 4BBRH 1M1KC 1TS4A 3GTLH 3B6YA 3J7ZC 3H91A 4L5QA 3HKZB 1HNXQ 5JEAJ 2K05A 1Y1VH 2IX0A 1HTLD 5LMNW 4YHHQ 2Q2TA 1I4PA 2F0QA 2KQ3A 3STBD 3F2UA 4JI3L 1EQTA 3PGZA 1O7LA 3KLSA 1CKNA 3NELA 1CKNB 4F88A 5IYDG 2VXWA 4XQJA 1MJCA 1U4PA 1I94L 2JQOA 1E1OA 1MSGA 3NTKA 4LUVA 2PW5A 4A3BG 2F0UA 3NK9A 1ML0D 5I2YA 1WTRA 1V8QA 2AQ3B 2TMPA 2B39A 1VMCA 3H3VI 2OF1A 5J1ZA 2VW9A 4H13C 4J8QA 1MI2A 4TKOB 2F4VQ 1FGBD 4EQ5A 4HCEA 2F0FA 2FFKB 1VQFA 1KAWA 2D2CC 2PCFB 4DUYL 2UXCQ 2VUMG 2CWPA 2KA7A 3X3NA 1MIUA 3KK7A 1LTGD 2LSSA 3CPWA 2RDHA 3NBIA 4FDBA 1QVFA 2KBNA 2ES2A 2BA1A 4K14A 2RDGA 4OX9L 4BBSH 4A3JB 1U9RA 3NSWA 3A7AB 2N55A 2K50A 4ZYSA 2DN8A 5C5MA 1B8AA 3QB3A 1XPRA 4OWXB 5CORA 1QNUA 3GP7A 4XDXA 2R7ZG 3CXCA 1LTAD 1HUMA 1D1KA 4CKBA 1EWCA 1Y1WG 1AN8A 4DR6L 3RMHA 3HFZB 3K5NA 1PH1A 3IFDA 3DM1A 5JEAG 1SNMA 2AMCB 4A3GH 4JV5L 1PZID 2BCOA 5C3EB 2AQ2B 4HJ8A 2RVLA 4WJ4A 3J81j 1I4GA 1B9NA 3HS0C 5C4XB 5C4XH 1YNJD 4X65L 5CYUA 3N52A 3TEHB 5IP7H 1IXRA 3ITPA 3CC7A 1G91A 5ELBA 4TVAB 4ZQ3A 4L5SA 1VQ8A 2BDNA 1KLUD 2B63H 3EA6A 2GA4B 3S14H 3QIAA 1N36Q 3D0FA 4YHHL 3ONAB 1WTQA 4JBMA 3O13A 4K2LA 3I56A 3HOZB 4JI3Q 4BS9A 4IFDJ 4WRDA 1YIJA 2NN6I 3S1NH 2K5VA 2WP8J 3IL8A 3F2DA 1CZGA 1ILQA 2B2WC 3M4OH 2JA7G 3I4NH 5M9OA 1TIID 2EYPA 4C3IB 1NR4A 1I4HA 4PV1C 4N9PA 2HIXA 1TR5A 2K04A 5I6YA 1A3TA 4JI7Q 2ICIA 3ULLA 5ELNA 4HJ7A 3KFUA 5HGQA 1QZGA 4GN5A 2O4XA 5FK9C 1G2SA 3K0XA 1KC8C 1Q82C 1ENAA 1SSOA 4CDFC 5C0XI 1SFOB 3MC0B 5E1FA 3HOXB 1L0XB 1XNRL 2F0LA 3NXWA 1VQ5A 2FMMA 3CCUA 1N33L 3P75A 1PH9A 4HIDA 3S15H 4X66L 5ISRA 4LMQD 4WJWA 2BH8A 5KIXA 2L4NA 1N34L 1A62A 3CCEA 3U9OA 4DV5Q 2ZTCA 3PV0A 5M5WH 4B3TQ 1JOKA 1L1OC 1HNWL 3VYRA 1LTBD 1TY2A 1SE2A 3T1HQ 1M4VA 2D62A 2PO4A 3FRPB 2UXCL 5DLQE 5JPNC 4MNOA 3J81E 3GTGH 2R92G 1JWSD 2NN6H 4B08A 3J7YW 5JJKA 3AEVA 1D6EC 4A3BB 1B44D 4ZKBB 1YEZA 1MD2D 4M1UB 3OYYA 2N49A 2F4IA 2MPMA 1PZJD 2NZHA 3C1FA 3R2IA 3L2PA 3S2HB 2NYZD 3PUXA 3M7NA 4LF6Q 1SNQA 5K36H 4Q0FA 1QVGA 2QKIC 1X6OA 2V4DA 3HG9A 2A19A 3UI2A 1SMYD 2F0WA 1JMCA 4IZ8A 1G6ZA 2XRSD 3A8JE 3F2CA 5GAEC 1LT5D 1HH2P 2WIIB 4O2DA 5I2XA 1UE7A 4F8MA 4RGTA 4I65A 1EY9A 5IE8A 4DAYA 5CR3A 2K6AA 2UUBQ 2O5JC 1K73C 1TXYA 5IGCA 1CQFA 3PO2H 3I91A 1CFMA 3C1EA 4HJ5A 1YNJC 5FLMH 3RZOH 4YIJA 1PRTF 4KY5A 5KNBA 2CQAA 2HHHL 2SNSA 4X6AH 2NZ1D 4LAAA 3J81c 1ET6A 4RA8A 4Q5VA 1ZKOA 2CKZB 3DLLA 4DR1Q 1PH2A 4RCOA 1I4XA 1EIFA 1EYGA 3D3RA 4C1NI 3S9WA 4UP9A 1N33Q 1YNND 5C4HA 3MZ5A 3S1RB 4JBJA 1IBLL 4A3DB 1KAAA 2L55A 2PZUA 5BN3A 2HDMA 1EYAA 1YI2A 1LT6D 1K8OA 2ALYB 1HUNA 3H0GB 2OQKA 4H02A 4IUQA 2IHEA 3T1HL 4HJ9A 1JB7A 3R2TA 1JJGA 2F1MA 1QUQB 1HZ9A 1EIHA 1XWEA 1OXTA 2NTSA 4L6TB 3WOFA 3HOYB 1QG7A 2FMCA 1PH7A 2UU9Q 1KNEA 2B2TC 2JA6G 2CW0D 3GTPH 3BDLA 3G6JB 4UDUC 3M9BA 1KIXA 3P7JA 3M4PA 4IPGA 4KHVA 1EUJA 2F0TA 5LMNQ 4JBWA 2UUCQ 3IAYA 4KN4C 3X3MA 2RKSA 4UP8A 4OO1G 3A56A 2ZT9C 4A3BH 4NPSA 4DR7Q 4N8FA 3NQIA 5CGKA 3M3YH 1GOZA 2K52A 1GVPA 3J80E 3NTIA 2GVAA 1UWVA 5JVG3 3AFQA 3VR4A 4EQNA 3HOWG 4TQUS 3I73A 4C3IG 3GO5A 3DWQA 1SE3A 1VQDA 5EKIA 1X3PA 1WTPA 1DD2A 3H3VH 3CF5A 5M3FH 4LF7L 1PRTD 3OMGA 1VQIA 4A3JH 4ZRZA 5FLXE 4IO9A 1XMQL 1GUSA 2VUMB 3CRKC 1WTWA 4IUUA 4LF5L 4JI1Q 4FXGC 4JBKA 1STYA 1B3QA 4OL7A 4QL5A 5CMDA 2JA5G 4C3HB 1YNXA 1F2MA 5IP9G 2X6GA 3K57A 3S2DH 1C8CA 5T1GA 2KVMA 5C4ZA 1SRUA 3RLOA 3K0YA 5E4XA 4UAIA 4FNFA 3QJYA 4B3RL 2OT2A 3V05A 1B50A 1PXUA 3BVZA 1HFNA 2I5HA 1HR0W 1SROA 1STBA 4HMJA 4BWGB 4JYAL 3J7A5 2CH4W 3KF6B 1DJRD 2R93G 1ZEQX 1HCZA 1QB5D 2C35B 4MZ9A 2XNAC 2AWNA 3CU7A 3GTOH 5IWAQ 1BO0A 2GVBA 3FP9A 3SK8A 1ONLA 4BY1H 2F0NA 1LYLA 3EQLC 3G7LA 3BU2A 4JI0Q 4UPAA 2UXBQ 1UEBA 1E22A 2PNRC 3CC2A 4QY7A 4IN3A 5FJ8H 1AZQA 4NXNL 3A0JA 5AFWA 1PTOF 2E75C 1NMGA 4FO2A 1D2BA 2HIVA 4IJHA 1QVCA 1BOSA 3I8ZA 5EPLA 3K59A 4LFCQ 1XNQQ 5JJLA 1ASYA 2Z1CA 1PFMA 4LF5Q 3HGBA 2OEOA 1DONA 4DV3L 1SXTA 1KQSA 2NZOA 2F0IA 4PZ6A 3W1BA 4B3TL 1S5BD 2MQHA 4DNRB 4A3CG 1CQVA 3P20A 1SNCA 1UAPA 4Y7NB 1VQAA 4CJ2C 2EY1A 3WWVA 3EJIA 1IBML 2KHJA 2JA8H 1PTOH 1Y69U 3F1ZA 2NVTH 4KLKA 4A76A 4JYAQ 2LKVA 1Q81C 1O7YA 5M3MG 1JOOA 5M5XH 2HQLA 3D8GA 1BDOA 1HNXL 4A3FB 1PHJA 5ELCA 3Q24A 1I5FA 4CKEA 1VCIA 1J5EQ 2FXQA 5IGEA 3H09A 2HHHQ 1WOCA 4ME5A 3RZDB 1C7YA 1VQLA 4X64L 2PYKA 2PQAB 1FD7D 4JI2L 2KHSA 1L1OA 1YJ9A 4IPDA 3W5OA 4HSPA 4B9XA 1Y1WB 2F3WA 1UE1A 4KD3A 3MHBA 2KUMA 2QDBA 4K5WA 2KHIA 2IPKD 3M85A 3RZOB 1TWGB 4C2MB 4YY3L 5IYBH 4LJZC 1TS5A 3FPUB 2F4VL 1OTCA 1X55A 4NXMQ 4JPBW 1F2ZA 2ENBA 2A6HD 1WCMG 4P71A 4KY7A 4L63B 4YCUA 4IOCA 4A3DH 2IWHA 4DN4M 3K80C 1PZKD 4GN3B 2XWJB 1VQOA 2GN5A 4LFAQ 1VQKA 4X3TA 2BDOA 3CAMA 2AQ1B 5ELOA 1EEFD 4DR5L 2OWOA 1HQRD 3DEPA 3FPPA 3T1YQ 1Q1BA 3A8IE 4A75A 3BDOA 4HR7B 2HT1A 3T16A 2DJGC 2EVBA 4LFBL 1VQCA 3GV6A 4K5XA 1A8VA 5JOBA 5KYIA 2WB1G 2K5NA 4HAEA 3J81L 4GLXA 1DGSA 3OTOL 2KCTA 2R7ZH 3CQZH 2F0KA 3MEHA 5EBCA 1STGA 1BBXC 4XQQA 1STHA 5C0XJ 1VQEA 2X69A 1STAA 2Z8LA 1LT4D 2DGYA 4BXXH 1WD1A 3HOWB 1ICWA 1PTOD 3VA7A 3MWYW 3UDGA 3A5UA 1C48A 1OXVA 5JVH3 1HTPA 1GUGA 4KKTA 4S3SA 1WD0A 1RF2D 1LABA 3ND8A 2JYOA 3K7UC 1I50H 3V96A 4EX5A 1H9RA 3NQTA 3SVMA 4DV4L 2O5IC 5D3IB 1GM5A 3K5OA 4DK1A 4X66Q 1S5FD 2FINB 1SNOA 1HNZQ 5DAUA 1VF5C 5I9OA 1X54A 2CH4A 4QGUA 5J22A 4IUPA 2B2TA 2K5QA 2Y0SE 2E5LQ 3HOYG 2M00A 3S1QB 4BY7B 2IX1A 2WINB 1IW7C 1FGUA 1EZ8A 3S2DB 2J0TD 1EOVA 4GZYC 2K75A 1O7ZA 4DK3C 2Z4HA 3PIO3 2LXJA 4BA2I 3GTJB 1RDPD 2EJFC 3QWNA 1S5DD 1V43A 2RA4A 3J80i 2EIFA 2ZJQA 4DAPA 3PIPA 4DXGA 1YITA 5GADC 4A93B 1NJIC 1U0LA 1GUWA 2KCCA 1YHAA 4DPGA 1UEAB 4G57A 1JQYD 4LF8Q 1SLJA 2M2LA 4XIGS 1GXDC 2YTYA 4QMGA 1GUTA 4X3SA 2NVXH 3JC66 4R8IA 1W2BA 1B70B 4TRDA 5TSSA 1Y14B 3AFPA 1K3BC 1PMRA 1TWFB 2K14A 3I3CA 4LF4L 2IW3A 1T5XD 1EYCA 3K5MA 1RHPA 1VQGA 3L3OC 4DV2Q 2KENA 4A3LH 4XTCS 3NWTA 3MTSA 2E2JB 3J81i 3BJUA 2VUMH 3AMUA 2K4KA 2Z6BA 1CT1D 1YHBA 4DU9A 5C4JB 2B2YA 2Q2HA 3LWUA 3D4RA 2A1AA 3HOZG 1EIYB 1VQBA 1NY4A 3GTLB 3PQIA 1JORA 5ELDA 4LFCL 3SR1A 1S5ED 4RHSA 4PQXA 4OELB 2CWAA 5M5WB 3IFTA 1SYCA 3N6RA 1EY5A 1AH9A 1Q90A 4C3HG 3CCMA 2A6ED 2WAQB 4JI8Q 4M8AA 2Q8TA 3I72A 5C3XA 4NMZA 3QO2A 3K58A 4KKSA 1E0BA 1PFSA 1EL0A 4BY1G 2F0JA 2MFIA 2VY3A 4G7HC 3PIP3 2D9UA 4OIKA 1I6HB 1A2UA 4POGA 4K6LA 2BE5C 3CHBD 3KOJA 4XXEA 3GTKH 1TWAH 3K81C 3QG1A 2EPBA 4HEDA 3GD7A 4KK7A 5E3FA 1VQ7A 3Q22A 1XNQL 3D4WA 4QCLA 4OXPA 3F2BA 2EY2A 2KCMA 2J4XA 4KMUC 1ICFB 3FDTA 5HGTA 3M4OB 3MXNA 1PH8A 3MXNB 5CBEE 1EY0A 3CCLA 1LV9A 4NW2A 2EYFA 3RLNA 4QJFA 3TZDA 2VS1A 1E7ZA 3CRLC 1QUQA 1A3UA 4DV7Q 5IY0A 2PI2A 3VR3A 4DUYQ 2A73B 1GUOA 2H4OA 1U4LA 1SYGA 5M5YH 3RUZA 3VYSA 3U9SA 5AJ3Q 1G6PA 4YCVA 3TP8A 1STNA 4B9WA 4DV1L 2MP1A 3UE1A 3MXUA 2NBFA 3OW7A 5C4XG 1I6VC 4B3SQ 4CDCC 1IZ6A 5CV8A 4RHRA 1QE6A 1TS3A 2R61A 5BN4A 4FF2A 5FLXL 1E2ZA 2UUAL 1L0YB 2JN4A 3Q23A 1EU3A 4XYOA 1SYDA 3RLFA 5IGGA 4I7ZC 5M3FG 1KDCA 3CPFA 3E6ZX 3T4AC 3I4NB 1GJXA 4DV6Q 2NVTB 1RJTA 2PQAA 4V0BA 2H1EA 1CHQD 4K0KL 1S40A 4DK0A 2F0DA 1SJHD 2M9VA 5GROA 4X3KA 1XMQQ 5EKKA 1KHIA 5JAVA 4JI4Q 1DOLA 1SEBD 2EE1A 1YJWA 1X3FA 3HOUG 3SXHA 1Q12A 5ELFA 4ZAIA 4DR3L 4LUOA 4R4QA 3GQBA 4UP7A 1EOTA 1N32L 3BDCA 2YYZA 1CA6A 5CV4A 2Y0SG 1YBYA 2F0EA 3FHWA 1VQJA 3S2HH 3OIQA 5M3MB 2E5LL 3I4LA 5BR8Q 2BE5D 1Z7TA 2KJXA 3MEFA 2R3ZA 1PDQA 5FKAC 1KL9A 1E3PA 4O0AA 2I46A 2QW7A 3DWPA 1T5EA 4E6IA 2QILA 3KDFB 2O2LD 1SYEA 4PG3A 3GV3A 3I90A 3J7AF 3MVVA 1HXYD 5K5PA 3RNUA 4R1JA 4A3MG 2EYLA 1K8MA 1SYFA 4JG2A 4DNIA 1IYVA 2K03A 1HR0L 1B3AA 3TS0A 1BQQT 2UXBL 3L7ZC 1R9TH 4H44C 5IGFA 1F2LA 5IYDH 1NNXA 1Y8NB 3RN5A 1KDBA 5FO9B 4LF6L 1EY7A 1SN8A 5C6AA 2I0QA 1IBLQ 1PRTB 5A35A 4FF1A 1EY8A 2B29A 4U68A 2F0GA 3AU7A 5T1IA 3C46A 1WTVA 2SEBD 1AP0A 5C3WA 1OXSC 2JK8A 1FYCA 1SYBA 3C2PA 3PO3H 2WKCA 4LF8L 1O78A 1RODA 1TWCH 2I07B 3K6OA 1E2WA 3H0GH 5D3DA 2E74C 2WV6D 1TS2A 4BA1I 3R8BA 2XWBB 5DEHA 1MSHA 2VQEQ 3QOLA 2HQEA 4NP5A 2KEEA 4U673 1W3SA 2B2UC 5EPKA 3TDQA 3GTPB 4DR3Q 4KJOA 1KRSA 3SEBA 3UE0A 2ZM6Q 4AIMA 4HSVA 3NP8A 1TWFH 4R8NA 3BYYB 4JK1C 2I5LX 4R4CA 1H9MA 1P16A 4YWLA 1ENFA 1RIPA 4R4IA 1AFPA 3U4VA 1IYUA 5FOBB 2ID0A 3WDNA 4PMWA 2I5MX 5JPMC 4NDXA 3PSIA 2YTVA 1QOHA 1PYBA 2PNHA 4DUZQ 1CKMA 2XTIA 1ENCA 1JICA 1W6JA 1DOMA 4NXML 2B2VA 4GKKL 1EQRA 2AHOB 3GTGB 2ZJRA 3TS2A 3G4SA 4FYDA 5EPJA 1KRTA 5IYCG 3I4NG 2F0VA 1ZYRC 4RKBA 1K8AC 1YHQA 4KTAA 1PFNA 1X3GA 4DV5L 4JI7L 3E3XA 4X64Q 3S1MH 1EZ6A 4G7OC 5LL6X 3GTMB 4P75A 3LWEA 3CQZB 1O7IA 1Q3LA 1VQ9A 1AW7A 4DR2Q 1I50B 1C4QA 2B63G 1IYJB 2BA0A 4A3FG 1H9JA 1NCVA 5M3MH 1Q7YC 4GLVB 4OWWB 3I55A 5IOCA 3U50C 3V2TA 2UXDL 3HKSA 4QB4A 4YY3Q 3J7AV 3I7FA 3FKIH 3ERSX 4X3UA 5IWAL 1TY0A 1XPUA 4AH6A 1M90C 5CV5A 2HCIA 3EROA 1Y8PB 1JCKB 1GUNA 2A5HA 4A93G 3EN2A 3EFXD 4N8X1 1EFID 5LL6S 1I3QH 2F0HA 1IBKL 1BBWA 5EBDA 4FF4A 3I2ZA 1NBWA 4ALPA 3ULPA 4LFBQ 1FNWA 1HFGA 1F2YA 1BXTA 1PTOC 2Q2IA 4IFDI 3Q8DA 2G9HD 1CK1A 3H15A 2XVSA 4NXNQ 1SAPA 4MN3A 4GKKQ 4ZKCB 1MGSA 1RTNA 5L37A 3GTKB 2RCFA 2QCPX 2JEAI 3J80c 5E7NA 2ZJPA 3I4MH 1NSNS 3OWFA 4JI6L 5EKLA 2Q8RE 4FXKC 2IJ0A 4C3JB 4A3IH 1SMXA 4DUZL 2RQXA 4V190 3D6WA 2LY7A 3OWEB 4OONA 3BZDB 1BR9A 5IODA 3RZDH 1VF7A 4DV6L 2ZTEA
chains in the Genus database with same CATH topology
2F0SA 3NWSA 2DY7A 1JB3A 3KUPA 1BCPD 3ND9A 2NN6G 2IL8A 4FF3A 1LTRD 1EQVA 4H0LC 1LACA 1H9SB 1ZYRD 4DGZA 2A68C 3T51B 4ZUJA 5EQ0A 2QEJC 5KGUA 5G3LD 2VB3X 1BNZA 4R9WA 2A6EC 4WFN3 3BYTB 1D1IA 1S4ZA 4IQZA 5M5XB 1FNUA 4XQNA 5C5LA 5KEEA 2NTTA 2EDGA 3GTOB 3MXGA 3CKIB 4K5VA 1I3QB 1TWCB 1SE4A 4C1NK 5JEAH 1Q1EA 1RD9D 1BCPC 3HOVB 2L0CA 1PYWD 3FEWX 4DAVA 4N9TA 1II3A 4G4KA 3M3YB 4QUCA 3OHXC 3AB9A 3J80L 4PMBA 4DF7A 2OXPA 2R93B 4XT1B 3A8KE 1EY6A 4XT3B 4A3GB 1H9SA 1X3QA 1YNNC 1B1ZA 1G291 2XSCA 1RKNA 3PUYA 1G8ZD 1DOKA 2J7ZA 5J39A 2MHVA 4KJNA 5I6WA 3L9AX 5IT9L 1K83B 3WOEA 1X32A 3VYTA 2VB2X 1SJED 1EEID 3K7AB 1DM0B 1TWHB 3VYUA 3D6CA 2DY8A 1DYQA 1LO5D 1DZ1A 3A55A 5C0XH 1KABA 5LHY1 3OIPA 1OXXK 3NBHA 3OSOA 4ABNA 2NUCA 3T53B 3H6MA 1PRTC 1KDAA 2B2UA 3FVQA 3T13A 2IX3A 3HZXA 4OGQC 4K8IA 3NPPA 1SMYC 1LTID 1LTSD 1Y1VB 2C5CA 4K2KA 4RAUC 4KI0A 3OOCA 1F9SA 1LT3D 4BBRB 2L5TA 5A2QE 1IHZA 1BCPB 4J1MA 4AYBB 4QIWB 1GHKA 1A2TA 3RD4A 1XXGA 4EQPA 3NHHA 2B2VC 2JE6I 3E0JA 1B2TA 3MFGA 4KD4A 2K5DA 1R4PB 2NB0A 1QILA 2AUJD 4OO1I 3S16B 3TMEA 3S1MB 2F0OA 3ERQA 3JAML 2ZXRA 5CV6A 4QF4A 4KKUA 4ZLTF 2EY6A 2A69D 1QNKA 1B53A 2EZVA 2N88A 1F77A 2G9DA 1A3VA 1H9KA 3MAQA 2JA5B 4XYQA 2SDFA 5C44B 5KNCA 1WCMB 3DUZA 4KHZA 4RKLA 2FHTA 3R3OA 2K33A 5FO8B 3IKJA 5KYLA 2BOSA 1M8AA 2EOTA 3BVGA 2KCNA 2MUYA 1D5XC 1AEXA 4DXFA 3URYA 1HQMC 1LTTD 3HRZC 4NKLA 1PFBA 5ELEA 5A2QL 5CV7A 2JA7B 2EYMA 5KNDA 2E2HB 2Y0SB 1SBBB 3S14B 3TN2A 2F0MA 1HA6A 2A69C 3S17B 3HOUB 2PZWA 2Q8IB 4IURA 1BCPF 4KY6A 2Z4IA 3H3VC 1G2TA 2PQEA 4CBVA 1PTOB 2JA8B 1ET9A 1CM9A 1ESRA 4HMIA 3ZYYX 2K01A 3MFYA 2EYHA 1F9QA 3VA5A 3R93A 3T56B 4CJ1B 4ILWA 2PZTA 2K28A 4K8JA 1UNSA 2IT1A 1FR3A 5IT9E 1OO9B 1QCBD 4LK1C 2QF7A 3S15B 3KLSX 2NVYB 1HPCA 2VNUD 3KF8A 3BS1A 4G7ZC 1B4OA 4RCNA 1JE4A 4RGOS 1OXUA 3E5SA 1SNPA 4WORA 1CA5A 5F2DA 3VR5A 4A3EB 1TVXA 1S5CD 4EQOA 3A7LA 2TSSA 2E76C 1I4RA 5KRUA 1CI3M 2F3VA 3D4DA 2A74C 4FP5D 2MGSA 4A3KB 3PMFA 3SE0A 3I70A 3TP7A 4CKCA 4TSSA 4ID6A 2XN9C 2DNCA 1JR0D 2JP1A 3D31A 3PO2B 1BUVT 1EIGA 5IGDA 1D5MC 4OO1H 2EYOA 4Z9CB 2K1BA 1A15A 3TP6A 3JAME 1R9TB 4L8JA 3HP3A 3NE5B 2HDLA 5CBAE 5COYA 2JXMB 5I4DA 4RGMA 2EY5A 1U4MA 4CGYB 2LS01 1HA5A 1IW7D 5M3FB 5M5YB 4IUNA 1RTOA 1D5ZC 1JOQA 3P1HA 1V1PB 4OHJA 2EYJA 4K6DA 4FXDA 2JA6B 3FKIB 1EYDA 3TSSA 2B63B 3NUCA 2L1BA 4CJ0B 2B8GA 3M4YA 5E4WC 1SNDA 3GTQB 4IFDG 2NVQB 1ESFA 1U4RA 2B2YC 4QUFA 1J9OA 2L12A 2NVXB 1Q8IA 2PW7A 1VMPA 3MXPA 5K36G 3K5LA 4DNTB 4ULLA 3SK6A 3M7GA 1EWHA 2ICEC 2FJ2A 4MHEA 1LLRD 2B2WA 2SOBA 4HCSA 2AWOA 2B8FA 2L9HA 2WB1B 4DFAA 4EGVA 1E2VA 2CHBD 1HRJA 1EY4A 3Q0AA 2RDFA 4IUTA 3OMCA 1V1OA 2K7VA 3H94A 5D65A 3LNNA 4F7XA 1W6KA 1TT2A 2ZXOA 1J8IA 2RSOA 3KBXA 4DA2A 3S1NB 3LX0A 4OIJA 3NTHA 2RSNA 1HHVA 3DMUA 2K32A 5FO7B 2R6GA 4P2CB 4ZUIA 2CVRA 1KNAA 1PLFA 2NWGA 3HEJA 1TWAB 3FMCA 1JWUD 1R4QB 2K5WA 2XIWA 3BVMA 1AZPA 1CZWA 4IFDH 2ZXPA 2KOLA 4ZK9B 4CHTB 3PUWA 3TBIB 4PMCA 2DNEA 2WKDA 5DNFA 3W3AA 4MIUA 4O42A 1KLGD 2SNMA 2E2IB 2L11A 1ZXTA 4HN7A 4HTHA 1ILPA 2A6HC 4RWSC 2HCCA 2D5DA 4KN7C 1WVLA 3DHQA 1QJOA 1WTXA 1WTOA 2YU9B 3KLRA 1QWYA 4O1NA 1O80A 5HURA 1TKWB 3MA2B 4RH6A 3PO3B 4RGNA 1DCZA 5BN5A 1EU4A 1Z47A 3DXJC 4EVOA 3C3LA 1XX8A 4KV6A 2PPBC 2EXZA 1BF4A 5DM63 1A6XA 4H7BA 2JEBI 2X6LA 4BBSB 4IALA 4F87A 1I4QA 2LMCB 3QOJA 3SK4A 2F03A 1VDZA 5G3LF 1UUPA 1F9PA 1XTCD 3PUVA 5I9PA 1TU2B 4C56C 4RFBA 1GHJA 2R7ZB 4A3MB 2C9OA 3DWAA 1IL8A 3SHLA 1JWMD 1B9MA 3DEOA 3KBGA 2WACA 2KEDA 5EGTA 2JSOA 5NUCA 3SDZA 3A54A 1V1PA 4A3IB 2RBMA 2XRQD 3OPOA 1CTMA 4PNYA 3SK5A 2F0PA 5CV9A 3VR2A 1KTKA 5DM73 5IGBA 5IIFA 1IKLA 1F9RA 2KECA 4C3JG 2CW0C 2PMZB 1SDFA 1NUCA 2E2DC 1STEA 3TZUA 1XYIA 2R92B 1CHPD 3TP5A 3W2DA 1RCVD 1Z6HA 1FNVA 3EVQA 5D14A 4J6HA 5C0XG 4BY1B 3Q6SA 4FVMA 2AUKA 2EJMA 2LFNA 2A68D 3BG3A 5CC4A 5EJWA 1TQOA 2EJGC 4IUVA 1IKMA 1NAPA 1JC7A 1Y8OB 3PUZA 1NR2A 3I4MB 2HUGA 1DXMA 3VR6A 5JJZA 2MJ8A 1MBYA 4ODGA 1TS4A 3H91A 3HKZB 5JEAJ 2K05A 2IX0A 1HTLD 1I4PA 2F0QA 2KQ3A 3F2UA 1EQTA 1O7LA 3KLSA 4F88A 2VXWA 4XQJA 1U4PA 1MSGA 3NTKA 2PW5A 2F0UA 3NK9A 1ML0D 5I2YA 1WTRA 1V8QA 2AQ3B 2TMPA 2B39A 1VMCA 2OF1A 5J1ZA 4H13C 4J8QA 1MI2A 4TKOB 1FGBD 4HCEA 2F0FA 2FFKB 2D2CC 2PCFB 2KA7A 3X3NA 3KK7A 1LTGD 2RDHA 3NBIA 2BA1A 4K14A 2RDGA 4A3JB 1U9RA 3NSWA 3A7AB 2N55A 4ZYSA 2DN8A 5C5MA 3QB3A 5CORA 1QNUA 3GP7A 4XDXA 1LTAD 1HUMA 1D1KA 4CKBA 1EWCA 1AN8A 3RMHA 3K5NA 3IFDA 3DM1A 5JEAG 1SNMA 1PZID 2BCOA 5C3EB 2AQ2B 2RVLA 1I4GA 1B9NA 3HS0C 5C4XB 1YNJD 5CYUA 3N52A 3ITPA 1G91A 5ELBA 4ZQ3A 2BDNA 1KLUD 3EA6A 2GA4B 3QIAA 3ONAB 1WTQA 3O13A 4K2LA 3HOZB 4BS9A 4IFDJ 4WRDA 2NN6I 2WP8J 3IL8A 1CZGA 1ILQA 2B2WC 5M9OA 1TIID 2EYPA 4C3IB 1NR4A 1I4HA 4PV1C 4N9PA 1TR5A 2K04A 5I6YA 1A3TA 2ICIA 2O4XA 5FK9C 1G2SA 1ENAA 1SSOA 5C0XI 1SFOB 3MC0B 5E1FA 3HOXB 1L0XB 2F0LA 3NXWA 2FMMA 3P75A 5ISRA 4LMQD 4WJWA 5KIXA 2L4NA 3U9OA 3PV0A 1JOKA 3VYRA 1LTBD 1TY2A 1SE2A 1M4VA 2D62A 2PO4A 3FRPB 5JPNC 3J81E 1JWSD 2NN6H 4B08A 3J7YW 1D6EC 4A3BB 1B44D 4ZKBB 1MD2D 4M1UB 2F4IA 2MPMA 1PZJD 3C1FA 3R2IA 3S2HB 2NYZD 3PUXA 3M7NA 1SNQA 5K36H 4Q0FA 2QKIC 2V4DA 3HG9A 3UI2A 1SMYD 2F0WA 4IZ8A 1G6ZA 2XRSD 3A8JE 1LT5D 2WIIB 5I2XA 4F8MA 4RGTA 4I65A 1EY9A 4DAYA 5CR3A 2K6AA 2O5JC 5IGCA 1CQFA 3I91A 1CFMA 3C1EA 1YNJC 4YIJA 1PRTF 4KY5A 5KNBA 2CQAA 2SNSA 2NZ1D 4LAAA 1ET6A 4RA8A 4Q5VA 1ZKOA 4RCOA 1I4XA 3D3RA 4C1NI 3S9WA 1YNND 5C4HA 3MZ5A 3S1RB 4A3DB 1KAAA 2L55A 2PZUA 5BN3A 2HDMA 1EYAA 1LT6D 1K8OA 1HUNA 3H0GB 4IUQA 3R2TA 2F1MA 1EIHA 1XWEA 1OXTA 2NTSA 4L6TB 3WOFA 3HOYB 1QG7A 2FMCA 1KNEA 2B2TC 2CW0D 3BDLA 3G6JB 4UDUC 3P7JA 4KHVA 2F0TA 4JBWA 3IAYA 4KN4C 3X3MA 2RKSA 4OO1G 3A56A 2ZT9C 3NQIA 5CGKA 1GOZA 3J80E 3NTIA 5JVG3 3VR4A 4EQNA 4TQUS 3I73A 4C3IG 3GO5A 3DWQA 1SE3A 5EKIA 1X3PA 1WTPA 1DD2A 1PRTD 3OMGA 4ZRZA 5FLXE 1GUSA 2VUMB 3CRKC 1WTWA 4IUUA 4FXGC 1STYA 4OL7A 5CMDA 4C3HB 1F2MA 2X6GA 3K57A 1C8CA 5T1GA 2KVMA 5C4ZA 3K0YA 5E4XA 4UAIA 4FNFA 3QJYA 2OT2A 3V05A 1B50A 1PXUA 3BVZA 1HFNA 1STBA 4HMJA 4BWGB 1DJRD 1ZEQX 1HCZA 1QB5D 2XNAC 2AWNA 3CU7A 1BO0A 3SK8A 1ONLA 2F0NA 3EQLC 3G7LA 2PNRC 4IN3A 1AZQA 5AFWA 1PTOF 2E75C 1D2BA 4FO2A 3I8ZA 1BOSA 5EPLA 3K59A 2Z1CA 1PFMA 3HGBA 2OEOA 1DONA 1SXTA 2F0IA 4DNRB 1S5BD 1CQVA 3P20A 1SNCA 1UAPA 4Y7NB 4CJ2C 2EY1A 3EJIA 1PTOH 1Y69U 2LKVA 1O7YA 1JOOA 3D8GA 1BDOA 4A3FB 5ELCA 3Q24A 4CKEA 1VCIA 5IGEA 3H09A 3RZDB 4ME5A 2PYKA 1FD7D 2KHSA 4HSPA 4B9XA 1Y1WB 2F3WA 4KD3A 3MHBA 2KUMA 2QDBA 4K5WA 2IPKD 3M85A 3RZOB 1TWGB 4C2MB 4LJZC 1TS5A 3FPUB 1F2ZA 2ENBA 2A6HD 4KY7A 4L63B 2IWHA 4DN4M 1PZKD 2XWJB 4X3TA 2BDOA 2AQ1B 1EEFD 1HQRD 3DEPA 3FPPA 1Q1BA 3A8IE 3BDOA 4HR7B 3T16A 2EVBA 3GV6A 4K5XA 5JOBA 5KYIA 4HAEA 3J81L 2F0KA 3MEHA 5EBCA 1STGA 1BBXC 4XQQA 1STHA 5C0XJ 2X69A 1STAA 2Z8LA 1LT4D 1WD1A 3HOWB 1ICWA 1PTOD 3VA7A 3MWYW 1C48A 1OXVA 5JVH3 1HTPA 1GUGA 4KKTA 4S3SA 1WD0A 1RF2D 1LABA 3ND8A 2JYOA 3V96A 1H9RA 3NQTA 3SVMA 2O5IC 5D3IB 3K5OA 4DK1A 1S5FD 2FINB 1SNOA 5DAUA 1VF5C 5I9OA 5J22A 4IUPA 2B2TA 2K5QA 3S1QB 4BY7B 2M00A 2IX1A 2WINB 1IW7C 1EZ8A 3S2DB 2J0TD 4GZYC 1O7ZA 2Z4HA 3PIO3 4BA2I 3GTJB 1RDPD 2EJFC 3QWNA 1S5DD 1V43A 2RA4A 4DAPA 4DXGA 4A93B 1GUWA 2KCCA 1UEAB 4G57A 1JQYD 2M2LA 4XIGS 1GXDC 4QMGA 4X3SA 1GUTA 4R8IA 4TRDA 5TSSA 1PMRA 1TWFB 3I3CA 2IW3A 1T5XD 1EYCA 3K5MA 1RHPA 3L3OC 4XTCS 3NWTA 3MTSA 2E2JB 3AMUA 1CT1D 4DU9A 5C4JB 2B2YA 3LWUA 3D4RA 3GTLB 1JORA 5ELDA 3SR1A 1S5ED 4RHSA 4PQXA 5M5WB 3IFTA 1SYCA 3N6RA 1EY5A 1Q90A 4C3HG 2A6ED 2WAQB 4M8AA 2Q8TA 3I72A 5C3XA 4NMZA 3QO2A 3K58A 4KKSA 1E0BA 1EL0A 2F0JA 4G7HC 3PIP3 2D9UA 4OIKA 1I6HB 1A2UA 4K6LA 2BE5C 3CHBD 4XXEA 3QG1A 2EPBA 4HEDA 3GD7A 4KK7A 5E3FA 3Q22A 3D4WA 4QCLA 2EY2A 2J4XA 4KMUC 3FDTA 5HGTA 3M4OB 3MXNA 5CBEE 1EY0A 1LV9A 4NW2A 2EYFA 3TZDA 3CRLC 1A3UA 3VR3A 2A73B 1GUOA 2H4OA 1U4LA 1SYGA 3RUZA 3VYSA 3U9SA 3TP8A 1STNA 4B9WA 2MP1A 3MXUA 2NBFA 3OW7A 1I6VC 5CV8A 4RHRA 1QE6A 1TS3A 2R61A 5BN4A 4FF2A 5FLXL 1E2ZA 1L0YB 3Q23A 1EU3A 4XYOA 1SYDA 3RLFA 5IGGA 4I7ZC 1KDCA 3E6ZX 3T4AC 3I4NB 1GJXA 2NVTB 1RJTA 4V0BA 2H1EA 1CHQD 4DK0A 2F0DA 1SJHD 2M9VA 4X3KA 5EKKA 5JAVA 1DOLA 1SEBD 2EE1A 3SXHA 1Q12A 5ELFA 4ZAIA 3GQBA 1EOTA 3BDCA 2YYZA 1CA6A 5CV4A 2F0EA 3OIQA 5M3MB 3I4LA 2BE5D 1Z7TA 2KJXA 2R3ZA 1PDQA 5FKAC 2I46A 3DWPA 1T5EA 4E6IA 2QILA 2O2LD 1SYEA 3GV3A 3I90A 3J7AF 3MVVA 1HXYD 5K5PA 2EYLA 1K8MA 1SYFA 1IYVA 2K03A 1B3AA 1BQQT 3L7ZC 4H44C 5IGFA 1F2LA 1Y8NB 1KDBA 5FO9B 1EY7A 5C6AA 1PRTB 5A35A 4FF1A 1EY8A 3C46A 4U68A 2F0GA 3AU7A 5T1IA 1WTVA 2SEBD 1AP0A 5C3WA 1OXSC 1FYCA 1SYBA 3C2PA 2WKCA 1O78A 1RODA 2I07B 3K6OA 1E2WA 5D3DA 2E74C 2WV6D 1TS2A 4BA1I 3R8BA 2XWBB 5DEHA 1MSHA 3QOLA 2HQEA 4NP5A 2KEEA 4U673 2B2UC 5EPKA 3TDQA 3GTPB 4KJOA 3SEBA 4HSVA 3NP8A 4R8NA 3BYYB 4JK1C 1H9MA 1ENFA 1AFPA 1IYUA 5FOBB 2ID0A 3WDNA 4PMWA 5JPMC 4NDXA 1QOHA 1ENCA 1JICA 1W6JA 1DOMA 2B2VA 3GTGB 4FYDA 5EPJA 2F0VA 1ZYRC 4RKBA 4KTAA 1PFNA 1EZ6A 4G7OC 5LL6X 3GTMB 3LWEA 3CQZB 1Q3LA 1AW7A 1I50B 1C4QA 2BA0A 1H9JA 1NCVA 5IOCA 3V2TA 4QB4A 3J7AV 4X3UA 1TY0A 5CV5A 2HCIA 3EROA 1Y8PB 1JCKB 1GUNA 2A5HA 3EFXD 1EFID 5LL6S 2F0HA 5EBDA 4FF4A 1FNWA 1HFGA 1F2YA 1BXTA 1PTOC 4IFDI 2G9HD 1CK1A 2XVSA 1SAPA 4MN3A 4ZKCB 1MGSA 1RTNA 3GTKB 2QCPX 2JEAI 1NSNS 3OWFA 5EKLA 2Q8RE 4FXKC 2IJ0A 4C3JB 2RQXA 4V190 3D6WA 2LY7A 3OWEB 3BZDB 1BR9A 5IODA 1VF7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KQ3 A;  4ZUI A;  2F0E A;  1A3V A;  2SNS A;  2PYK A;  4IUN A;  4LAA A;  2F0S A;  3HEJ A;  1JOQ A;  4N9P A;  1ENC A;  1RKN A;  3P1H A;  1TR5 A;  1SNO A;  5I6Y A;  5DAU A;  5J39 A;  5I9O A;  1A3T A;  2KHS A;  4KJN A;  2EYJ A;  5J22 A;  1STB A;  4HMJ A;  4K6D A;  2M00 A;  3SHL A;  5E3F A;  3S9W A;  1EYD A;  2PW5 A;  2F0U A;  2O4X A;  3D4W A;  1EZ8 A;  3MZ5 A;  3NK9 A;  5C4H A;  5I6W A;  2WAC A;  3NUC A;  1KAA A;  2PZU A;  1ENA A;  4E6I A;  2EY2 A;  2F0V A;  1EYA A;  4B9X A;  4RKB A;  1SYE A;  1EQV A;  5EGT A;  2F3W A;  4KD3 A;  5HGT A;  3MHB A;  4RKL A;  5E1F A;  2QDB A;  5NUC A;  2OF1 A;  4K5W A;  3MVV A;  3SK8 A;  4KTA A;  5J1Z A;  1SND A;  3E5S A;  2F0N A;  3R3O A;  1SNP A;  4DGZ A;  5K5P A;  2EYL A;  2F0L A;  4WOR A;  4ZUJ A;  5KYL A;  5F2D A;  1SYF A;  1EY0 A;  2F0F A;  2RBM A;  1EZ6 A;  3NXW A;  3P75 A;  2EYF A;  3D6C A;  5ISR A;  4PMC A;  4PNY A;  3SK5 A;  4EQO A;  2F0P A;  5KGU A;  3NQT A;  1A3U A;  5CV9 A;  1AEX A;  4MIU A;  5KIX A;  5KRU A;  2F3V A;  1F2Z A;  3D4D A;  2ENB A;  2SNM A;  1KAB A;  4G57 A;  3U9O A;  5IGF A;  4K14 A;  5IGB A;  3PMF A;  4KY7 A;  1JOK A;  1SYG A;  4HTH A;  3RUZ A;  5IIF A;  4QMG A;  3TP7 A;  1U9R A;  3OSO A;  4NKL A;  3BDL A;  3TP8 A;  1STN A;  4B9W A;  2PW7 A;  1KDB A;  2NUC A;  1EY7 A;  4TRD A;  4ID6 A;  5C5M A;  5C6A A;  3QB3 A;  3H6M A;  3MXP A;  5IOC A;  3V2T A;  1KDA A;  4KHV A;  5CV7 A;  3T13 A;  3HZX A;  4QB4 A;  2F0T A;  1EYC A;  4K8I A;  3DHQ A;  3SK6 A;  1EY8 A;  1NUC A;  2EYM A;  2F0G A;  2RKS A;  5C5L A;  5KEE A;  2SOB A;  5CV8 A;  5C3W A;  1SNM A;  2OEO A;  3TP5 A;  5CV5 A;  3ERO A;  1SYB A;  5CGK A;  4DFA A;  3EVQ A;  2F0M A;  5HUR A;  4J6H A;  2F0I A;  3T16 A;  5IGD A;  4K2K A;  4K5V A;  5I9P A;  4DU9 A;  2F0H A;  1EY4 A;  2EYO A;  4K5X A;  3C1F A;  2PZW A;  5JOB A;  4EQN A;  5KYI A;  4EVO A;  2RDF A;  3TP6 A;  4KY6 A;  1SNC A;  1SNQ A;  1SYD A;  4KV6 A;  1F2Y A;  2F0K A;  5DEH A;  5IGG A;  1JOR A;  2EY1 A;  3MEH A;  3OMC A;  3ITP A;  3QOL A;  2PQE A;  1IHZ A;  2EXZ A;  3EJI A;  2HQE A;  1KDC A;  4J1M A;  3SR1 A;  5CC4 A;  4ZQ3 A;  1STG A;  1TQO A;  4NP5 A;  1STH A;  4N9T A;  2F0W A;  5JAV A;  4H7B A;  4IZ8 A;  1A2T A;  1SYC A;  1II3 A;  3OMG A;  2LKV A;  1EY5 A;  1STA A;  4HMI A;  4KJO A;  3NHH A;  4EQP A;  4IAL A;  1JOO A;  2F0D A;  4F7X A;  4F8M A;  3NP8 A;  2EYH A;  4KD4 A;  1NSN S;  4R8N A;  3OWF A;  4I65 A;  1EY9 A;  1TT2 A;  1STY A;  3D8G A;  4K2L A;  4OL7 A;  5CR3 A;  5EKK A;  5EKL A;  3VA5 A;  5C3X A;  3QOJ A;  4NMZ A;  4PMB A;  3TME A;  3SK4 A;  1F2M A;  4ODG A;  4DF7 A;  4WRD A;  5IGC A;  2OXP A;  2EY5 A;  2F0O A;  3ERQ A;  4S3S A;  2PZT A;  3SXH A;  5CV6 A;  5C4Z A;  3LX0 A;  1EY6 A;  4QF4 A;  3C1E A;  5IGE A;  2EY6 A;  4K8J A;  2F0J A;  5IOD A;  4ME5 A;  3BDC A;  3DMU A;  4YIJ A;  4NDX A;  5M9O A;  1A2U A;  4KY5 A;  5CV4 A;  2F0Q A;  2EYP A; 
#chains in the Genus database with same CATH topology
 5IP9 H;  1CUK A;  2Z6K A;  4P74 A;  2F0S A;  2N3S A;  3BZK A;  3NWS A;  4LUZ A;  2DY7 A;  1JB3 A;  2R7F A;  3KUP A;  1BCP D;  2P5Z X;  3ND9 A;  1LUZ A;  1VQP A;  2NN6 G;  2IL8 A;  4FF3 A;  1LTR D;  1EQV A;  4H0L C;  1LAC A;  1FJG Q;  1H9S B;  1ZYR D;  1JT8 A;  4DGZ A;  2QEX A;  4DV4 Q;  2A68 C;  3T51 B;  4ZUJ A;  5C4J H;  4LF4 Q;  1J5E L;  5EQ0 A;  4X62 Q;  3KF6 A;  3CCS A;  2QEJ C;  4IPH A;  5KGU A;  1PH3 A;  2N8N A;  5G3L D;  2VB3 X;  4GNX C;  5IYC H;  1XTD A;  1K0S A;  1BBU A;  1BNZ A;  4R9W A;  2OCE A;  2HD3 A;  2A6E C;  4BY7 G;  1AE3 A;  4WFN 3;  4L5R C;  2XGT A;  3BYT B;  3E0E A;  1D1I A;  4K0K Q;  1K28 A;  1S4Z A;  4IQZ A;  1XJV A;  5M5X B;  5LMU Q;  4A3C H;  1FNU A;  4XQN A;  5C5L A;  4BBS G;  5KEE A;  3HOV G;  4JI4 L;  2NTT A;  2EDG A;  4ME3 A;  3GTO B;  4DV2 L;  3MXG A;  3CKI B;  4K5V A;  4DV0 Q;  1I3Q B;  1LTL A;  4R4T A;  3GDE A;  1TWC B;  1SE4 A;  4C1N K;  4JC0 A;  5JEA H;  1N8R C;  1Q1E A;  1RD9 D;  1BCP C;  3HOV B;  3KYH C;  2L0C A;  3S1Q H;  1K0R A;  4BY7 H;  1CSP A;  1PYW D;  3FEW X;  4DAV A;  4N9T A;  1II3 A;  2QDL A;  1EWI A;  4G4K A;  3M3Y B;  4QUC A;  2ZTD A;  3OHX C;  4JCV E;  3PO3 G;  3AB9 A;  3J80 L;  4PMB A;  2NVQ H;  4DF7 A;  1XNR Q;  2OXP A;  2R93 B;  4LF9 L;  4XT1 B;  2Z6K C;  3A8K E;  1EY6 A;  4XT3 B;  4CDE C;  4A3G B;  1HZB A;  1H9S A;  3RN2 A;  1X3Q A;  1HR0 Q;  1YNN C;  1B1Z A;  1Z9F A;  1RL2 A;  1G29 1;  2XSC A;  1MHW C;  1RKN A;  2ZM6 L;  3PUY A;  1G8Z D;  1DOK A;  1AE2 A;  1P8L A;  2J7Z A;  4JI8 L;  5J39 A;  3KJO A;  1HNW Q;  1WYD A;  4UY8 C;  2MHV A;  4KJN A;  2F3I A;  4C3H H;  5I6W A;  4PZ8 A;  3KJP A;  3L9A X;  5IT9 L;  1K83 B;  3KF8 B;  3WOE A;  4GOP C;  1X32 A;  3VYT A;  2VB2 X;  2H5X A;  1SJE D;  1EFW A;  1EEI D;  3K7A B;  1DM0 B;  1TWH B;  3VYU A;  4GOP B;  2IY5 B;  3UDX A;  3HOZ H;  1J6Q A;  3D6C A;  2DY8 A;  5JJI A;  4LWC A;  1DYQ A;  3T1Y L;  1LO5 D;  1DZ1 A;  3A55 A;  5C0X H;  5AJ3 L;  2RCN A;  1KAB A;  5LHY 1;  3HOY H;  3OIP A;  4IJL A;  1OXX K;  2MO0 A;  3NBH A;  3OSO A;  4ABN A;  2NUC A;  2OQ0 A;  3T53 B;  4X62 L;  3H6M A;  3CCV A;  4DR6 Q;  1PRT C;  1KDA A;  2B2U A;  3FVQ A;  3T13 A;  2IX3 A;  3HZX A;  4OGQ C;  2JA8 G;  4K8I A;  4JI5 Q;  2IHF A;  4JV5 Q;  3NPP A;  1WJJ A;  1SMY C;  1LTI D;  5FJ8 G;  1LTS D;  3CCJ A;  1Y1V B;  1TWG H;  4K2K A;  2C5C A;  2RHS B;  4RAU C;  1XMO L;  4KI0 A;  1X65 A;  3OOC A;  4QQB X;  1F9S A;  1LT3 D;  4BBR B;  3OW2 A;  2L5T A;  5A2Q E;  1IHZ A;  1BCP B;  4J1M A;  3G71 A;  2EXD A;  4AYB B;  4QIW B;  3DM3 A;  1GHK A;  4A3K H;  3ICE A;  1A2T A;  3RD4 A;  1XXG A;  4EQP A;  3NHH A;  2B2V C;  4J15 A;  2JE6 I;  3E0J A;  1B2T A;  4OWT B;  3MFG A;  4KD4 A;  2K5D A;  5C3E H;  1R4P B;  2NB0 A;  1QIL A;  2AUJ D;  4OO1 I;  3S16 B;  3TME A;  4APV A;  3S1M B;  3NEM A;  2F0O A;  3ERQ A;  3JAM L;  3GTM H;  2ZXR A;  5CV6 A;  4AQY Q;  4QF4 A;  4CDD C;  4KKU A;  2EY6 A;  4ZLT F;  2A69 D;  1QNK A;  1B53 A;  1FL0 A;  1PV4 A;  2EZV A;  2N88 A;  1F77 A;  1YJN A;  2G9D A;  1A3V A;  4DR2 L;  1H9K A;  4ZCK A;  1N32 Q;  3MAQ A;  2JA5 B;  1NE3 A;  4XYQ A;  3TRE A;  4GNX B;  2SDF A;  5C44 B;  1U5K A;  5KNC A;  1WCM B;  3DUZ A;  2UUC L;  4KHZ A;  2CQO A;  4RKL A;  5IP7 G;  2FHT A;  4DR7 L;  3R3O A;  2K33 A;  4C3J H;  5FO8 B;  3IKJ A;  5KYL A;  1GD7 A;  2YTX A;  2BOS A;  1M8A A;  2EOT A;  1S3O A;  3BVG A;  2KCN A;  2MUY A;  1D5X C;  1AEX A;  4DXF A;  3URY A;  1HQM C;  4JI5 L;  1S72 A;  1LTT D;  3TQY A;  4A3G G;  2V1C C;  3I4O A;  2WAQ E;  4NKL A;  3HRZ C;  1PFB A;  5ELE A;  5A2Q L;  4A3M H;  4A3K G;  4DR4 Q;  5CV7 A;  2JA7 B;  2JA6 H;  2EYM A;  5KND A;  2E2H B;  2Y0S B;  1SBB B;  3S14 B;  3TN2 A;  3CD6 A;  4BBR G;  4I7A A;  2F0M A;  2QGQ A;  1H95 A;  2E2I H;  4LF7 Q;  1YZ6 A;  4JOI A;  1HA6 A;  2A69 C;  2E8G A;  3S17 B;  5LMN L;  3HOU B;  2PZW A;  2Q8I B;  4L5T A;  4IUR A;  5GAG C;  1BCP F;  4KY6 A;  2Z4I A;  3H3V C;  1G2T A;  2PQE A;  4CBV A;  1PTO B;  2JA8 B;  1K3R A;  1ET9 A;  1HZC A;  1GKH A;  1CM9 A;  1ESR A;  3L0O A;  4HMI A;  3ZYY X;  3JAM c;  2K01 A;  3MFY A;  2D0O A;  2EYH A;  2WFW A;  2OTJ A;  2JA9 A;  2MO1 A;  1F9Q A;  4DR5 Q;  3VA5 A;  3G6E A;  4A3J G;  3R93 A;  3T56 B;  4CJ1 B;  4ILW A;  1GO3 E;  1K8G A;  2PZT A;  2R92 H;  2K28 A;  3HOV H;  4HIO A;  4K8J A;  1X56 A;  1UNS A;  5H1S E;  2IT1 A;  1FR3 A;  3A74 A;  1WI5 A;  5IT9 E;  1OO9 B;  1QCB D;  4LK1 C;  2QF7 A;  3S15 B;  5FLX c;  4PZ7 A;  4GOP A;  3KLS X;  1MJE A;  2NVY B;  4JI0 L;  1HPC A;  2VNU D;  1N9W A;  3KF8 A;  3BS1 A;  4G7Z C;  1B4O A;  4RCN A;  1JE4 A;  1SR3 A;  1Y1W H;  4RGO S;  1OXU A;  4NB3 A;  2Z9H A;  3E5S A;  1SNP A;  2R7D A;  4WOR A;  1CA5 A;  5F2D A;  3H0G G;  3S16 H;  1Y1V G;  3VR5 A;  4A3E B;  1TVX A;  1S5C D;  1E1T A;  1PH6 A;  4EQO A;  3A7L A;  3ZJY C;  1I94 Q;  2TSS A;  2E76 C;  2UU9 L;  1I4R A;  5KRU A;  1CI3 M;  2F3V A;  3D4D A;  2A74 C;  4FP5 D;  2MGS A;  3VDY A;  1WTH A;  4A3K B;  3PMF A;  3SE0 A;  3I70 A;  2UUA Q;  3TP7 A;  2A8V A;  4CKC A;  3NBH B;  2N78 A;  4TSS A;  4ID6 A;  2XN9 C;  2DNC A;  1JR0 D;  2JP1 A;  4C2M H;  3UDF A;  1PA6 A;  4IOA A;  2RHQ B;  3ULJ A;  3D31 A;  5IT9 c;  1X9N A;  2UXD Q;  4B3S L;  3PO2 B;  1BUV T;  4P73 A;  3G48 A;  1EIG A;  4LF9 Q;  5IGD A;  4R4O A;  2AKW B;  3I4M G;  3HKZ E;  1D5M C;  4DR4 L;  2F52 A;  4OO1 H;  2EYO A;  4Z9C B;  2K1B A;  1A15 A;  1NMF A;  3TP6 A;  4Y7N H;  1E24 A;  4DK6 C;  4AYB G;  3JAM E;  1R9T B;  4POF A;  3PO2 G;  3K8A A;  1HZA A;  2WB1 E;  3HP3 A;  4L8J A;  4JI2 Q;  3NE5 B;  2G5D A;  4LW1 A;  2VL6 A;  2HDL A;  1WFQ A;  1V1Q A;  3QR8 A;  5BR8 L;  3HOW H;  2DUD A;  5CBA E;  2EQS A;  1HJP A;  1D8L A;  5COY A;  1IBK Q;  2JXM B;  5I4D A;  4RGM A;  2E2H H;  2EY5 A;  4JW0 A;  4X65 Q;  4HIK A;  2QA4 A;  2YU9 H;  1D7Q A;  1U4M A;  4CGY B;  2LS0 1;  2YV5 A;  2JJQ A;  1KXL A;  1HA5 A;  1BVS A;  1IW7 D;  3S17 H;  5M3F B;  5M5Y B;  4IUN A;  1RTO A;  1D5Z C;  1VQ4 A;  1JOQ A;  2JA5 H;  3P1H A;  1V1P B;  1VQH A;  4A3I G;  4A3D G;  4OHJ A;  2EYJ A;  4K6D A;  4FXD A;  2JA6 B;  3FKI B;  1EYD A;  3TSS A;  2B63 B;  3NUC A;  2L1B A;  4CJ0 B;  2B8G A;  3M4Y A;  1FVI A;  5E4W C;  1SND A;  1TWH H;  3GTQ B;  3ER0 A;  4IFD G;  3F8T A;  2NVQ B;  3CME A;  1ESF A;  3EBE A;  1U4R A;  3CC4 A;  2B2Y C;  3OTO Q;  4QUF A;  4DV0 L;  1J9O A;  3CMA A;  4B3M L;  2L12 A;  2NVX B;  1Q8I A;  2PW7 A;  3M4Q A;  2VQE L;  1VMP A;  3MXP A;  5K36 G;  4GS3 A;  3K5L A;  4DNT B;  4ULL A;  3SK6 A;  4YWK A;  2OTL A;  3M7G A;  1EWH A;  2ICE C;  4JI1 L;  3TRZ A;  1PVO A;  2FJ2 A;  4MHE A;  1LLR D;  2B2W A;  2SOB A;  4HCS A;  2Z0S A;  2R93 H;  2AWO A;  2B8F A;  2L9H A;  2WB1 B;  2VQF Q;  4DFA A;  4EGV A;  1E2V A;  3HOX H;  2CHB D;  1HRJ A;  1EY4 A;  1LM0 A;  3PF5 A;  3Q0A A;  2RDF A;  4IUT A;  4HIM A;  1IBM Q;  3W1G A;  1SE8 A;  5GAH C;  3OMC A;  1V1O A;  3AYH B;  2Q2U A;  3FKI G;  5J3B A;  1A0I A;  4UHV A;  4OX9 Q;  2K7V A;  3EIV A;  3H94 A;  5D65 A;  1T9H A;  3LNN A;  4WJ3 M;  5EAY A;  2D0P A;  4F7X A;  3IRB A;  2UUB L;  3S24 A;  1W6K A;  3K7A H;  1C9O A;  1TT2 A;  2ZXO A;  1J8I A;  3CW2 C;  1NTG A;  2RSO A;  2PMZ E;  3KBX A;  1Q86 C;  4DA2 A;  4BXX G;  5HY6 A;  3S1N B;  3LX0 A;  4OIJ A;  4A3L G;  3NTH A;  3E9I A;  2RSN A;  3NEN A;  1L0W A;  1HHV A;  3DMU A;  2K32 A;  5FO7 B;  2R6G A;  4P2C B;  4ZUI A;  2CVR A;  1KNA A;  1PLF A;  2NWG A;  3HEJ A;  1TWA B;  1YVC A;  2B3G A;  4B3M Q;  3FMC A;  1Q8K A;  4QIW E;  4A93 H;  1QZH A;  1JWU D;  1R4Q B;  1L1O B;  2K5W A;  4DR1 L;  2XIW A;  3BVM A;  2MNA A;  1B7Y B;  1PH5 A;  1AZP A;  2E2J H;  1CZW A;  2CCZ A;  3GTQ H;  4IFD H;  2ZXP A;  2KOL A;  2VZA A;  3HOU H;  4A3E H;  4KHP Q;  4ZK9 B;  1L2F A;  4CHT B;  3PUW A;  3TBI B;  3HOX G;  4PMC A;  2DNE A;  2WKD A;  5DNF A;  3W3A A;  4MIU A;  1C0A A;  3PIO A;  4O42 A;  1KLG D;  2SNM A;  2E2I B;  2L11 A;  1ZXT A;  3BZC A;  4HN7 A;  4HTH A;  4LFA L;  1ILP A;  4YCW A;  5GQO A;  3UDI A;  2A6H C;  3E9H A;  4RWS C;  5IYB G;  1V9P A;  2HCC A;  2D5D A;  2JA7 H;  4KN7 C;  1WVL A;  4IPC A;  3DHQ A;  4OEM B;  1QJO A;  3HKZ G;  1WTX A;  1WTO A;  2YU9 B;  3AQQ A;  1XMO Q;  1G51 A;  3KLR A;  1QWY A;  4HJA A;  4O1N A;  1O80 A;  1TKW B;  4RG1 A;  3MA2 B;  4RH6 A;  5HUR A;  3PO3 B;  4RGN A;  1DCZ A;  2RF4 A;  4JI6 Q;  5BN5 A;  4MTN A;  1EU4 A;  5C3E G;  1Z47 A;  3DXJ C;  4EVO A;  3C3L A;  1XX8 A;  4AQY L;  1VS0 A;  4KV6 A;  1N34 Q;  2PPB C;  3SGI A;  1VQM A;  2EXZ A;  3STB C;  4GN4 B;  1IL2 A;  1BF4 A;  4DKA C;  2NVY H;  1MKH A;  5DM6 3;  5C44 G;  1A6X A;  4C3I H;  4H7B A;  3KLW A;  2JEB I;  1WCM H;  2X6L A;  4BBS B;  4IAL A;  2K5H A;  4F87 A;  4AYB E;  3LGJ A;  1JJ2 A;  1X3E A;  1I4Q A;  2LMC B;  3QOJ A;  1N36 L;  3SK4 A;  2F03 A;  4GNX A;  1VDZ A;  5G3L F;  3U58 A;  4B3R Q;  4KHP L;  1UUP A;  1FJG L;  3PF4 A;  1F9P A;  1XTC D;  4GKJ L;  3CP0 A;  3RR5 A;  3PUV A;  5I9P A;  3KDF A;  4DV7 L;  1TU2 B;  4C56 C;  4LNQ A;  4RFB A;  1GHJ A;  2R7Z B;  1Q46 A;  4A3M B;  2C9O A;  4A4I A;  3DWA A;  4DV1 Q;  1IL8 A;  1PYS B;  3SHL A;  1JWM D;  1B9M A;  3DEO A;  3KBG A;  2WAC A;  3PCO B;  4YWM A;  2KED A;  5EGT A;  2PI2 E;  4A3E G;  2JSO A;  5NUC A;  2DJF C;  3SDZ A;  3U4Z A;  3A5Z B;  3A54 A;  1V1P A;  4A3I B;  2RBM A;  1VQN A;  2XRQ D;  3OPO A;  1CTM A;  2L15 A;  1HNZ L;  4PNY A;  1CSQ A;  3SK5 A;  2F0P A;  4JOI C;  4DV3 Q;  5CV9 A;  3JAM i;  3VR2 A;  1KTK A;  4P72 A;  5DM7 3;  5IGB A;  4MTK A;  4JVZ A;  5IIF A;  1KD1 C;  1K9M C;  2ATW A;  3CCQ A;  1IKL A;  1F9R A;  2KEC A;  4C3J G;  2CW0 C;  5C44 H;  3GTJ H;  2PMZ B;  5FLM G;  1SDF A;  2WAQ G;  1JJC B;  2LXK A;  1NUC A;  4A3F H;  2E2D C;  1STE A;  2VQF L;  5LMU L;  3TZU A;  4Y52 H;  1XYI A;  2R92 B;  1CHP D;  3TP5 A;  1SFO H;  2ASB A;  3W2D A;  1RCV D;  1Z6H A;  1FNV A;  3EVQ A;  5D14 A;  4J6H A;  5C0X G;  4BY1 B;  1XPO A;  3Q6S A;  1PH4 A;  1I6H H;  1ASZ A;  4FVM A;  1UE5 A;  2AUK A;  2EJM A;  2LFN A;  4GKJ Q;  2A68 D;  3BG3 A;  2CFM A;  4DAY B;  1EQQ A;  5CC4 A;  5EJW A;  1TQO A;  2EJG C;  4IUV A;  3S1R H;  1NAP A;  1IKM A;  1JC7 A;  3CCR A;  1JE5 A;  1K83 H;  1Y8O B;  3PUZ A;  1NR2 A;  1BKB A;  4RMF A;  2BH2 A;  1A63 A;  4DAM A;  3I4M B;  2HUG A;  1VQ6 A;  1DXM A;  3VR6 A;  5JJZ A;  2MJ8 A;  1CKO A;  1MBY A;  1UE6 A;  4ODG A;  4GLA C;  4BBR H;  1M1K C;  1TS4 A;  3GTL H;  3B6Y A;  3J7Z C;  3H91 A;  4L5Q A;  3HKZ B;  1HNX Q;  5JEA J;  2K05 A;  1Y1V H;  2IX0 A;  1HTL D;  5LMN W;  4YHH Q;  2Q2T A;  1I4P A;  2F0Q A;  2KQ3 A;  3STB D;  3F2U A;  4JI3 L;  1EQT A;  3PGZ A;  1O7L A;  3KLS A;  1CKN A;  3NEL A;  1CKN B;  4F88 A;  5IYD G;  2VXW A;  4XQJ A;  1MJC A;  1U4P A;  1I94 L;  2JQO A;  1E1O A;  1MSG A;  3NTK A;  4LUV A;  2PW5 A;  4A3B G;  2F0U A;  3NK9 A;  1ML0 D;  5I2Y A;  1WTR A;  1V8Q A;  2AQ3 B;  2TMP A;  2B39 A;  1VMC A;  3H3V I;  2OF1 A;  5J1Z A;  2VW9 A;  4H13 C;  4J8Q A;  1MI2 A;  4TKO B;  2F4V Q;  1FGB D;  4EQ5 A;  4HCE A;  2F0F A;  2FFK B;  1VQF A;  1KAW A;  2D2C C;  2PCF B;  4DUY L;  2UXC Q;  2VUM G;  2CWP A;  2KA7 A;  3X3N A;  1MIU A;  3KK7 A;  1LTG D;  2LSS A;  3CPW A;  2RDH A;  3NBI A;  4FDB A;  1QVF A;  2KBN A;  2ES2 A;  2BA1 A;  4K14 A;  2RDG A;  4OX9 L;  4BBS H;  4A3J B;  1U9R A;  3NSW A;  3A7A B;  2N55 A;  2K50 A;  4ZYS A;  2DN8 A;  5C5M A;  1B8A A;  3QB3 A;  1XPR A;  4OWX B;  5COR A;  1QNU A;  3GP7 A;  4XDX A;  2R7Z G;  3CXC A;  1LTA D;  1HUM A;  1D1K A;  4CKB A;  1EWC A;  1Y1W G;  1AN8 A;  4DR6 L;  3RMH A;  3HFZ B;  3K5N A;  1PH1 A;  3IFD A;  3DM1 A;  5JEA G;  1SNM A;  2AMC B;  4A3G H;  4JV5 L;  1PZI D;  2BCO A;  5C3E B;  2AQ2 B;  4HJ8 A;  2RVL A;  4WJ4 A;  3J81 j;  1I4G A;  1B9N A;  3HS0 C;  5C4X B;  5C4X H;  1YNJ D;  4X65 L;  5CYU A;  3N52 A;  3TEH B;  5IP7 H;  1IXR A;  3ITP A;  3CC7 A;  1G91 A;  5ELB A;  4TVA B;  4ZQ3 A;  4L5S A;  1VQ8 A;  2BDN A;  1KLU D;  2B63 H;  3EA6 A;  2GA4 B;  3S14 H;  3QIA A;  1N36 Q;  3D0F A;  4YHH L;  3ONA B;  1WTQ A;  4JBM A;  3O13 A;  4K2L A;  3I56 A;  3HOZ B;  4JI3 Q;  4BS9 A;  4IFD J;  4WRD A;  1YIJ A;  2NN6 I;  3S1N H;  2K5V A;  2WP8 J;  3IL8 A;  3F2D A;  1CZG A;  1ILQ A;  2B2W C;  3M4O H;  2JA7 G;  3I4N H;  5M9O A;  1TII D;  2EYP A;  4C3I B;  1NR4 A;  1I4H A;  4PV1 C;  4N9P A;  2HIX A;  1TR5 A;  2K04 A;  5I6Y A;  1A3T A;  4JI7 Q;  2ICI A;  3ULL A;  5ELN A;  4HJ7 A;  3KFU A;  5HGQ A;  1QZG A;  4GN5 A;  2O4X A;  5FK9 C;  1G2S A;  3K0X A;  1KC8 C;  1Q82 C;  1ENA A;  1SSO A;  4CDF C;  5C0X I;  1SFO B;  3MC0 B;  5E1F A;  3HOX B;  1L0X B;  1XNR L;  2F0L A;  3NXW A;  1VQ5 A;  2FMM A;  3CCU A;  1N33 L;  3P75 A;  1PH9 A;  4HID A;  3S15 H;  4X66 L;  5ISR A;  4LMQ D;  4WJW A;  2BH8 A;  5KIX A;  2L4N A;  1N34 L;  1A62 A;  3CCE A;  3U9O A;  4DV5 Q;  2ZTC A;  3PV0 A;  5M5W H;  4B3T Q;  1JOK A;  1L1O C;  1HNW L;  3VYR A;  1LTB D;  1TY2 A;  1SE2 A;  3T1H Q;  1M4V A;  2D62 A;  2PO4 A;  3FRP B;  2UXC L;  5DLQ E;  5JPN C;  4MNO A;  3J81 E;  3GTG H;  2R92 G;  1JWS D;  2NN6 H;  4B08 A;  3J7Y W;  5JJK A;  3AEV A;  1D6E C;  4A3B B;  1B44 D;  4ZKB B;  1YEZ A;  1MD2 D;  4M1U B;  3OYY A;  2N49 A;  2F4I A;  2MPM A;  1PZJ D;  2NZH A;  3C1F A;  3R2I A;  3L2P A;  3S2H B;  2NYZ D;  3PUX A;  3M7N A;  4LF6 Q;  1SNQ A;  5K36 H;  4Q0F A;  1QVG A;  2QKI C;  1X6O A;  2V4D A;  3HG9 A;  2A19 A;  3UI2 A;  1SMY D;  2F0W A;  1JMC A;  4IZ8 A;  1G6Z A;  2XRS D;  3A8J E;  3F2C A;  5GAE C;  1LT5 D;  1HH2 P;  2WII B;  4O2D A;  5I2X A;  1UE7 A;  4F8M A;  4RGT A;  4I65 A;  1EY9 A;  5IE8 A;  4DAY A;  5CR3 A;  2K6A A;  2UUB Q;  2O5J C;  1K73 C;  1TXY A;  5IGC A;  1CQF A;  3PO2 H;  3I91 A;  1CFM A;  3C1E A;  4HJ5 A;  1YNJ C;  5FLM H;  3RZO H;  4YIJ A;  1PRT F;  4KY5 A;  5KNB A;  2CQA A;  2HHH L;  2SNS A;  4X6A H;  2NZ1 D;  4LAA A;  3J81 c;  1ET6 A;  4RA8 A;  4Q5V A;  1ZKO A;  2CKZ B;  3DLL A;  4DR1 Q;  1PH2 A;  4RCO A;  1I4X A;  1EIF A;  1EYG A;  3D3R A;  4C1N I;  3S9W A;  4UP9 A;  1N33 Q;  1YNN D;  5C4H A;  3MZ5 A;  3S1R B;  4JBJ A;  1IBL L;  4A3D B;  1KAA A;  2L55 A;  2PZU A;  5BN3 A;  2HDM A;  1EYA A;  1YI2 A;  1LT6 D;  1K8O A;  2ALY B;  1HUN A;  3H0G B;  2OQK A;  4H02 A;  4IUQ A;  2IHE A;  3T1H L;  4HJ9 A;  1JB7 A;  3R2T A;  1JJG A;  2F1M A;  1QUQ B;  1HZ9 A;  1EIH A;  1XWE A;  1OXT A;  2NTS A;  4L6T B;  3WOF A;  3HOY B;  1QG7 A;  2FMC A;  1PH7 A;  2UU9 Q;  1KNE A;  2B2T C;  2JA6 G;  2CW0 D;  3GTP H;  3BDL A;  3G6J B;  4UDU C;  3M9B A;  1KIX A;  3P7J A;  3M4P A;  4IPG A;  4KHV A;  1EUJ A;  2F0T A;  5LMN Q;  4JBW A;  2UUC Q;  3IAY A;  4KN4 C;  3X3M A;  2RKS A;  4UP8 A;  4OO1 G;  3A56 A;  2ZT9 C;  4A3B H;  4NPS A;  4DR7 Q;  4N8F A;  3NQI A;  5CGK A;  3M3Y H;  1GOZ A;  2K52 A;  1GVP A;  3J80 E;  3NTI A;  2GVA A;  1UWV A;  5JVG 3;  3AFQ A;  3VR4 A;  4EQN A;  3HOW G;  4TQU S;  3I73 A;  4C3I G;  3GO5 A;  3DWQ A;  1SE3 A;  1VQD A;  5EKI A;  1X3P A;  1WTP A;  1DD2 A;  3H3V H;  3CF5 A;  5M3F H;  4LF7 L;  1PRT D;  3OMG A;  1VQI A;  4A3J H;  4ZRZ A;  5FLX E;  4IO9 A;  1XMQ L;  1GUS A;  2VUM B;  3CRK C;  1WTW A;  4IUU A;  4LF5 L;  4JI1 Q;  4FXG C;  4JBK A;  1STY A;  1B3Q A;  4OL7 A;  4QL5 A;  5CMD A;  2JA5 G;  4C3H B;  1YNX A;  1F2M A;  5IP9 G;  2X6G A;  3K57 A;  3S2D H;  1C8C A;  5T1G A;  2KVM A;  5C4Z A;  1SRU A;  3RLO A;  3K0Y A;  5E4X A;  4UAI A;  4FNF A;  3QJY A;  4B3R L;  2OT2 A;  3V05 A;  1B50 A;  1PXU A;  3BVZ A;  1HFN A;  2I5H A;  1HR0 W;  1SRO A;  1STB A;  4HMJ A;  4BWG B;  4JYA L;  3J7A 5;  2CH4 W;  3KF6 B;  1DJR D;  2R93 G;  1ZEQ X;  1HCZ A;  1QB5 D;  2C35 B;  4MZ9 A;  2XNA C;  2AWN A;  3CU7 A;  3GTO H;  5IWA Q;  1BO0 A;  2GVB A;  3FP9 A;  3SK8 A;  1ONL A;  4BY1 H;  2F0N A;  1LYL A;  3EQL C;  3G7L A;  3BU2 A;  4JI0 Q;  4UPA A;  2UXB Q;  1UEB A;  1E22 A;  2PNR C;  3CC2 A;  4QY7 A;  4IN3 A;  5FJ8 H;  1AZQ A;  4NXN L;  3A0J A;  5AFW A;  1PTO F;  2E75 C;  1NMG A;  4FO2 A;  1D2B A;  2HIV A;  4IJH A;  1QVC A;  1BOS A;  3I8Z A;  5EPL A;  3K59 A;  4LFC Q;  1XNQ Q;  5JJL A;  1ASY A;  2Z1C A;  1PFM A;  4LF5 Q;  3HGB A;  2OEO A;  1DON A;  4DV3 L;  1SXT A;  1KQS A;  2NZO A;  2F0I A;  4PZ6 A;  3W1B A;  4B3T L;  1S5B D;  2MQH A;  4DNR B;  4A3C G;  1CQV A;  3P20 A;  1SNC A;  1UAP A;  4Y7N B;  1VQA A;  4CJ2 C;  2EY1 A;  3WWV A;  3EJI A;  1IBM L;  2KHJ A;  2JA8 H;  1PTO H;  1Y69 U;  3F1Z A;  2NVT H;  4KLK A;  4A76 A;  4JYA Q;  2LKV A;  1Q81 C;  1O7Y A;  5M3M G;  1JOO A;  5M5X H;  2HQL A;  3D8G A;  1BDO A;  1HNX L;  4A3F B;  1PHJ A;  5ELC A;  3Q24 A;  1I5F A;  4CKE A;  1VCI A;  1J5E Q;  2FXQ A;  5IGE A;  3H09 A;  2HHH Q;  1WOC A;  4ME5 A;  3RZD B;  1C7Y A;  1VQL A;  4X64 L;  2PYK A;  2PQA B;  1FD7 D;  4JI2 L;  2KHS A;  1L1O A;  1YJ9 A;  4IPD A;  3W5O A;  4HSP A;  4B9X A;  1Y1W B;  2F3W A;  1UE1 A;  4KD3 A;  3MHB A;  2KUM A;  2QDB A;  4K5W A;  2KHI A;  2IPK D;  3M85 A;  3RZO B;  1TWG B;  4C2M B;  4YY3 L;  5IYB H;  4LJZ C;  1TS5 A;  3FPU B;  2F4V L;  1OTC A;  1X55 A;  4NXM Q;  4JPB W;  1F2Z A;  2ENB A;  2A6H D;  1WCM G;  4P71 A;  4KY7 A;  4L63 B;  4YCU A;  4IOC A;  4A3D H;  2IWH A;  4DN4 M;  3K80 C;  1PZK D;  4GN3 B;  2XWJ B;  1VQO A;  2GN5 A;  4LFA Q;  1VQK A;  4X3T A;  2BDO A;  3CAM A;  2AQ1 B;  5ELO A;  1EEF D;  4DR5 L;  2OWO A;  1HQR D;  3DEP A;  3FPP A;  3T1Y Q;  1Q1B A;  3A8I E;  4A75 A;  3BDO A;  4HR7 B;  2HT1 A;  3T16 A;  2DJG C;  2EVB A;  4LFB L;  1VQC A;  3GV6 A;  4K5X A;  1A8V A;  5JOB A;  5KYI A;  2WB1 G;  2K5N A;  4HAE A;  3J81 L;  4GLX A;  1DGS A;  3OTO L;  2KCT A;  2R7Z H;  3CQZ H;  2F0K A;  3MEH A;  5EBC A;  1STG A;  1BBX C;  4XQQ A;  1STH A;  5C0X J;  1VQE A;  2X69 A;  1STA A;  2Z8L A;  1LT4 D;  2DGY A;  4BXX H;  1WD1 A;  3HOW B;  1ICW A;  1PTO D;  3VA7 A;  3MWY W;  3UDG A;  3A5U A;  1C48 A;  1OXV A;  5JVH 3;  1HTP A;  1GUG A;  4KKT A;  4S3S A;  1WD0 A;  1RF2 D;  1LAB A;  3ND8 A;  2JYO A;  3K7U C;  1I50 H;  3V96 A;  4EX5 A;  1H9R A;  3NQT A;  3SVM A;  4DV4 L;  2O5I C;  5D3I B;  1GM5 A;  3K5O A;  4DK1 A;  4X66 Q;  1S5F D;  2FIN B;  1SNO A;  1HNZ Q;  5DAU A;  1VF5 C;  5I9O A;  1X54 A;  2CH4 A;  4QGU A;  5J22 A;  4IUP A;  2B2T A;  2K5Q A;  2Y0S E;  2E5L Q;  3HOY G;  2M00 A;  3S1Q B;  4BY7 B;  2IX1 A;  2WIN B;  1IW7 C;  1FGU A;  1EZ8 A;  3S2D B;  2J0T D;  1EOV A;  4GZY C;  2K75 A;  1O7Z A;  4DK3 C;  2Z4H A;  3PIO 3;  2LXJ A;  4BA2 I;  3GTJ B;  1RDP D;  2EJF C;  3QWN A;  1S5D D;  1V43 A;  2RA4 A;  3J80 i;  2EIF A;  2ZJQ A;  4DAP A;  3PIP A;  4DXG A;  1YIT A;  5GAD C;  4A93 B;  1NJI C;  1U0L A;  1GUW A;  2KCC A;  1YHA A;  4DPG A;  1UEA B;  4G57 A;  1JQY D;  4LF8 Q;  1SLJ A;  2M2L A;  4XIG S;  1GXD C;  2YTY A;  4QMG A;  1GUT A;  4X3S A;  2NVX H;  3JC6 6;  4R8I A;  1W2B A;  1B70 B;  4TRD A;  5TSS A;  1Y14 B;  3AFP A;  1K3B C;  1PMR A;  1TWF B;  2K14 A;  3I3C A;  4LF4 L;  2IW3 A;  1T5X D;  1EYC A;  3K5M A;  1RHP A;  1VQG A;  3L3O C;  4DV2 Q;  2KEN A;  4A3L H;  4XTC S;  3NWT A;  3MTS A;  2E2J B;  3J81 i;  3BJU A;  2VUM H;  3AMU A;  2K4K A;  2Z6B A;  1CT1 D;  1YHB A;  4DU9 A;  5C4J B;  2B2Y A;  2Q2H A;  3LWU A;  3D4R A;  2A1A A;  3HOZ G;  1EIY B;  1VQB A;  1NY4 A;  3GTL B;  3PQI A;  1JOR A;  5ELD A;  4LFC L;  3SR1 A;  1S5E D;  4RHS A;  4PQX A;  4OEL B;  2CWA A;  5M5W B;  3IFT A;  1SYC A;  3N6R A;  1EY5 A;  1AH9 A;  1Q90 A;  4C3H G;  3CCM A;  2A6E D;  2WAQ B;  4JI8 Q;  4M8A A;  2Q8T A;  3I72 A;  5C3X A;  4NMZ A;  3QO2 A;  3K58 A;  4KKS A;  1E0B A;  1PFS A;  1EL0 A;  4BY1 G;  2F0J A;  2MFI A;  2VY3 A;  4G7H C;  3PIP 3;  2D9U A;  4OIK A;  1I6H B;  1A2U A;  4POG A;  4K6L A;  2BE5 C;  3CHB D;  3KOJ A;  4XXE A;  3GTK H;  1TWA H;  3K81 C;  3QG1 A;  2EPB A;  4HED A;  3GD7 A;  4KK7 A;  5E3F A;  1VQ7 A;  3Q22 A;  1XNQ L;  3D4W A;  4QCL A;  4OXP A;  3F2B A;  2EY2 A;  2KCM A;  2J4X A;  4KMU C;  1ICF B;  3FDT A;  5HGT A;  3M4O B;  3MXN A;  1PH8 A;  3MXN B;  5CBE E;  1EY0 A;  3CCL A;  1LV9 A;  4NW2 A;  2EYF A;  3RLN A;  4QJF A;  3TZD A;  2VS1 A;  1E7Z A;  3CRL C;  1QUQ A;  1A3U A;  4DV7 Q;  5IY0 A;  2PI2 A;  3VR3 A;  4DUY Q;  2A73 B;  1GUO A;  2H4O A;  1U4L A;  1SYG A;  5M5Y H;  3RUZ A;  3VYS A;  3U9S A;  5AJ3 Q;  1G6P A;  4YCV A;  3TP8 A;  1STN A;  4B9W A;  4DV1 L;  2MP1 A;  3UE1 A;  3MXU A;  2NBF A;  3OW7 A;  5C4X G;  1I6V C;  4B3S Q;  4CDC C;  1IZ6 A;  5CV8 A;  4RHR A;  1QE6 A;  1TS3 A;  2R61 A;  5BN4 A;  4FF2 A;  5FLX L;  1E2Z A;  2UUA L;  1L0Y B;  2JN4 A;  3Q23 A;  1EU3 A;  4XYO A;  1SYD A;  3RLF A;  5IGG A;  4I7Z C;  5M3F G;  1KDC A;  3CPF A;  3E6Z X;  3T4A C;  3I4N B;  1GJX A;  4DV6 Q;  2NVT B;  1RJT A;  2PQA A;  4V0B A;  2H1E A;  1CHQ D;  4K0K L;  1S40 A;  4DK0 A;  2F0D A;  1SJH D;  2M9V A;  5GRO A;  4X3K A;  1XMQ Q;  5EKK A;  1KHI A;  5JAV A;  4JI4 Q;  1DOL A;  1SEB D;  2EE1 A;  1YJW A;  1X3F A;  3HOU G;  3SXH A;  1Q12 A;  5ELF A;  4ZAI A;  4DR3 L;  4LUO A;  4R4Q A;  3GQB A;  4UP7 A;  1EOT A;  1N32 L;  3BDC A;  2YYZ A;  1CA6 A;  5CV4 A;  2Y0S G;  1YBY A;  2F0E A;  3FHW A;  1VQJ A;  3S2H H;  3OIQ A;  5M3M B;  2E5L L;  3I4L A;  5BR8 Q;  2BE5 D;  1Z7T A;  2KJX A;  3MEF A;  2R3Z A;  1PDQ A;  5FKA C;  1KL9 A;  1E3P A;  4O0A A;  2I46 A;  2QW7 A;  3DWP A;  1T5E A;  4E6I A;  2QIL A;  3KDF B;  2O2L D;  1SYE A;  4PG3 A;  3GV3 A;  3I90 A;  3J7A F;  3MVV A;  1HXY D;  5K5P A;  3RNU A;  4R1J A;  4A3M G;  2EYL A;  1K8M A;  1SYF A;  4JG2 A;  4DNI A;  1IYV A;  2K03 A;  1HR0 L;  1B3A A;  3TS0 A;  1BQQ T;  2UXB L;  3L7Z C;  1R9T H;  4H44 C;  5IGF A;  1F2L A;  5IYD H;  1NNX A;  1Y8N B;  3RN5 A;  1KDB A;  5FO9 B;  4LF6 L;  1EY7 A;  1SN8 A;  5C6A A;  2I0Q A;  1IBL Q;  1PRT B;  5A35 A;  4FF1 A;  1EY8 A;  2B29 A;  4U68 A;  2F0G A;  3AU7 A;  5T1I A;  3C46 A;  1WTV A;  2SEB D;  1AP0 A;  5C3W A;  1OXS C;  2JK8 A;  1FYC A;  1SYB A;  3C2P A;  3PO3 H;  2WKC A;  4LF8 L;  1O78 A;  1ROD A;  1TWC H;  2I07 B;  3K6O A;  1E2W A;  3H0G H;  5D3D A;  2E74 C;  2WV6 D;  1TS2 A;  4BA1 I;  3R8B A;  2XWB B;  5DEH A;  1MSH A;  2VQE Q;  3QOL A;  2HQE A;  4NP5 A;  2KEE A;  4U67 3;  1W3S A;  2B2U C;  5EPK A;  3TDQ A;  3GTP B;  4DR3 Q;  4KJO A;  1KRS A;  3SEB A;  3UE0 A;  2ZM6 Q;  4AIM A;  4HSV A;  3NP8 A;  1TWF H;  4R8N A;  3BYY B;  4JK1 C;  2I5L X;  4R4C A;  1H9M A;  1P16 A;  4YWL A;  1ENF A;  1RIP A;  4R4I A;  1AFP A;  3U4V A;  1IYU A;  5FOB B;  2ID0 A;  3WDN A;  4PMW A;  2I5M X;  5JPM C;  4NDX A;  3PSI A;  2YTV A;  1QOH A;  1PYB A;  2PNH A;  4DUZ Q;  1CKM A;  2XTI A;  1ENC A;  1JIC A;  1W6J A;  1DOM A;  4NXM L;  2B2V A;  4GKK L;  1EQR A;  2AHO B;  3GTG B;  2ZJR A;  3TS2 A;  3G4S A;  4FYD A;  5EPJ A;  1KRT A;  5IYC G;  3I4N G;  2F0V A;  1ZYR C;  4RKB A;  1K8A C;  1YHQ A;  4KTA A;  1PFN A;  1X3G A;  4DV5 L;  4JI7 L;  3E3X A;  4X64 Q;  3S1M H;  1EZ6 A;  4G7O C;  5LL6 X;  3GTM B;  4P75 A;  3LWE A;  3CQZ B;  1O7I A;  1Q3L A;  1VQ9 A;  1AW7 A;  4DR2 Q;  1I50 B;  1C4Q A;  2B63 G;  1IYJ B;  2BA0 A;  4A3F G;  1H9J A;  1NCV A;  5M3M H;  1Q7Y C;  4GLV B;  4OWW B;  3I55 A;  5IOC A;  3U50 C;  3V2T A;  2UXD L;  3HKS A;  4QB4 A;  4YY3 Q;  3J7A V;  3I7F A;  3FKI H;  3ERS X;  4X3U A;  5IWA L;  1TY0 A;  1XPU A;  4AH6 A;  1M90 C;  5CV5 A;  2HCI A;  3ERO A;  1Y8P B;  1JCK B;  1GUN A;  2A5H A;  4A93 G;  3EN2 A;  3EFX D;  4N8X 1;  1EFI D;  5LL6 S;  1I3Q H;  2F0H A;  1IBK L;  1BBW A;  5EBD A;  4FF4 A;  3I2Z A;  1NBW A;  4ALP A;  3ULP A;  4LFB Q;  1FNW A;  1HFG A;  1F2Y A;  1BXT A;  1PTO C;  2Q2I A;  4IFD I;  3Q8D A;  2G9H D;  1CK1 A;  3H15 A;  2XVS A;  4NXN Q;  1SAP A;  4MN3 A;  4GKK Q;  4ZKC B;  1MGS A;  1RTN A;  5L37 A;  3GTK B;  2RCF A;  2QCP X;  2JEA I;  3J80 c;  5E7N A;  2ZJP A;  3I4M H;  1NSN S;  3OWF A;  4JI6 L;  5EKL A;  2Q8R E;  4FXK C;  2IJ0 A;  4C3J B;  4A3I H;  1SMX A;  4DUZ L;  2RQX A;  4V19 0;  3D6W A;  2LY7 A;  3OWE B;  4OON A;  3BZD B;  1BR9 A;  5IOD A;  3RZD H;  1VF7 A;  4DV6 L;  2ZTE A; 
#chains in the Genus database with same CATH homology
 2F0S A;  3NWS A;  2DY7 A;  1JB3 A;  3KUP A;  1BCP D;  3ND9 A;  2NN6 G;  2IL8 A;  4FF3 A;  1LTR D;  1EQV A;  4H0L C;  1LAC A;  1H9S B;  1ZYR D;  4DGZ A;  2A68 C;  3T51 B;  4ZUJ A;  5EQ0 A;  2QEJ C;  5KGU A;  5G3L D;  2VB3 X;  1BNZ A;  4R9W A;  2A6E C;  4WFN 3;  3BYT B;  1D1I A;  1S4Z A;  4IQZ A;  5M5X B;  1FNU A;  4XQN A;  5C5L A;  5KEE A;  2NTT A;  2EDG A;  3GTO B;  3MXG A;  3CKI B;  4K5V A;  1I3Q B;  1TWC B;  1SE4 A;  4C1N K;  5JEA H;  1Q1E A;  1RD9 D;  1BCP C;  3HOV B;  2L0C A;  1PYW D;  3FEW X;  4DAV A;  4N9T A;  1II3 A;  4G4K A;  3M3Y B;  4QUC A;  3OHX C;  3AB9 A;  3J80 L;  4PMB A;  4DF7 A;  2OXP A;  2R93 B;  4XT1 B;  3A8K E;  1EY6 A;  4XT3 B;  4A3G B;  1H9S A;  1X3Q A;  1YNN C;  1B1Z A;  1G29 1;  2XSC A;  1RKN A;  3PUY A;  1G8Z D;  1DOK A;  2J7Z A;  5J39 A;  2MHV A;  4KJN A;  5I6W A;  3L9A X;  5IT9 L;  1K83 B;  3WOE A;  1X32 A;  3VYT A;  2VB2 X;  1SJE D;  1EEI D;  3K7A B;  1DM0 B;  1TWH B;  3VYU A;  3D6C A;  2DY8 A;  1DYQ A;  1LO5 D;  1DZ1 A;  3A55 A;  5C0X H;  1KAB A;  5LHY 1;  3OIP A;  1OXX K;  3NBH A;  3OSO A;  4ABN A;  2NUC A;  3T53 B;  3H6M A;  1PRT C;  1KDA A;  2B2U A;  3FVQ A;  3T13 A;  2IX3 A;  3HZX A;  4OGQ C;  4K8I A;  3NPP A;  1SMY C;  1LTI D;  1LTS D;  1Y1V B;  2C5C A;  4K2K A;  4RAU C;  4KI0 A;  3OOC A;  1F9S A;  1LT3 D;  4BBR B;  2L5T A;  5A2Q E;  1IHZ A;  1BCP B;  4J1M A;  4AYB B;  4QIW B;  1GHK A;  1A2T A;  3RD4 A;  1XXG A;  4EQP A;  3NHH A;  2B2V C;  2JE6 I;  3E0J A;  1B2T A;  3MFG A;  4KD4 A;  2K5D A;  1R4P B;  2NB0 A;  1QIL A;  2AUJ D;  4OO1 I;  3S16 B;  3TME A;  3S1M B;  2F0O A;  3ERQ A;  3JAM L;  2ZXR A;  5CV6 A;  4QF4 A;  4KKU A;  4ZLT F;  2EY6 A;  2A69 D;  1QNK A;  1B53 A;  2EZV A;  2N88 A;  1F77 A;  2G9D A;  1A3V A;  1H9K A;  3MAQ A;  2JA5 B;  4XYQ A;  2SDF A;  5C44 B;  5KNC A;  1WCM B;  3DUZ A;  4KHZ A;  4RKL A;  2FHT A;  3R3O A;  2K33 A;  5FO8 B;  3IKJ A;  5KYL A;  2BOS A;  1M8A A;  2EOT A;  3BVG A;  2KCN A;  2MUY A;  1D5X C;  1AEX A;  4DXF A;  3URY A;  1HQM C;  1LTT D;  3HRZ C;  4NKL A;  1PFB A;  5ELE A;  5A2Q L;  5CV7 A;  2JA7 B;  2EYM A;  5KND A;  2E2H B;  2Y0S B;  1SBB B;  3S14 B;  3TN2 A;  2F0M A;  1HA6 A;  2A69 C;  3S17 B;  3HOU B;  2PZW A;  2Q8I B;  4IUR A;  1BCP F;  4KY6 A;  2Z4I A;  3H3V C;  1G2T A;  2PQE A;  4CBV A;  1PTO B;  2JA8 B;  1ET9 A;  1CM9 A;  1ESR A;  4HMI A;  3ZYY X;  2K01 A;  3MFY A;  2EYH A;  1F9Q A;  3VA5 A;  3R93 A;  3T56 B;  4CJ1 B;  4ILW A;  2PZT A;  2K28 A;  4K8J A;  1UNS A;  2IT1 A;  1FR3 A;  5IT9 E;  1OO9 B;  1QCB D;  4LK1 C;  2QF7 A;  3S15 B;  3KLS X;  2NVY B;  1HPC A;  2VNU D;  3KF8 A;  3BS1 A;  4G7Z C;  1B4O A;  4RCN A;  1JE4 A;  4RGO S;  1OXU A;  3E5S A;  1SNP A;  4WOR A;  1CA5 A;  5F2D A;  3VR5 A;  4A3E B;  1TVX A;  1S5C D;  4EQO A;  3A7L A;  2TSS A;  2E76 C;  1I4R A;  5KRU A;  1CI3 M;  2F3V A;  3D4D A;  2A74 C;  4FP5 D;  2MGS A;  4A3K B;  3PMF A;  3SE0 A;  3I70 A;  3TP7 A;  4CKC A;  4TSS A;  4ID6 A;  2XN9 C;  2DNC A;  1JR0 D;  2JP1 A;  3D31 A;  3PO2 B;  1BUV T;  1EIG A;  5IGD A;  1D5M C;  4OO1 H;  2EYO A;  4Z9C B;  2K1B A;  1A15 A;  3TP6 A;  3JAM E;  1R9T B;  4L8J A;  3HP3 A;  3NE5 B;  2HDL A;  5CBA E;  5COY A;  2JXM B;  5I4D A;  4RGM A;  2EY5 A;  1U4M A;  4CGY B;  2LS0 1;  1HA5 A;  1IW7 D;  5M3F B;  5M5Y B;  4IUN A;  1RTO A;  1D5Z C;  1JOQ A;  3P1H A;  1V1P B;  4OHJ A;  2EYJ A;  4K6D A;  4FXD A;  2JA6 B;  3FKI B;  1EYD A;  3TSS A;  2B63 B;  3NUC A;  2L1B A;  4CJ0 B;  2B8G A;  3M4Y A;  5E4W C;  1SND A;  3GTQ B;  4IFD G;  2NVQ B;  1ESF A;  1U4R A;  2B2Y C;  4QUF A;  1J9O A;  2L12 A;  2NVX B;  1Q8I A;  2PW7 A;  1VMP A;  3MXP A;  5K36 G;  3K5L A;  4DNT B;  4ULL A;  3SK6 A;  3M7G A;  1EWH A;  2ICE C;  2FJ2 A;  4MHE A;  1LLR D;  2B2W A;  2SOB A;  4HCS A;  2AWO A;  2B8F A;  2L9H A;  2WB1 B;  4DFA A;  4EGV A;  1E2V A;  2CHB D;  1HRJ A;  1EY4 A;  3Q0A A;  2RDF A;  4IUT A;  3OMC A;  1V1O A;  2K7V A;  3H94 A;  5D65 A;  3LNN A;  4F7X A;  1W6K A;  1TT2 A;  2ZXO A;  1J8I A;  2RSO A;  3KBX A;  4DA2 A;  3S1N B;  3LX0 A;  4OIJ A;  3NTH A;  2RSN A;  1HHV A;  3DMU A;  2K32 A;  5FO7 B;  2R6G A;  4P2C B;  4ZUI A;  2CVR A;  1KNA A;  1PLF A;  2NWG A;  3HEJ A;  1TWA B;  3FMC A;  1JWU D;  1R4Q B;  2K5W A;  2XIW A;  3BVM A;  1AZP A;  1CZW A;  4IFD H;  2ZXP A;  2KOL A;  4ZK9 B;  4CHT B;  3PUW A;  3TBI B;  4PMC A;  2DNE A;  2WKD A;  5DNF A;  3W3A A;  4MIU A;  4O42 A;  1KLG D;  2SNM A;  2E2I B;  2L11 A;  1ZXT A;  4HN7 A;  4HTH A;  1ILP A;  2A6H C;  4RWS C;  2HCC A;  2D5D A;  4KN7 C;  1WVL A;  3DHQ A;  1QJO A;  1WTX A;  1WTO A;  2YU9 B;  3KLR A;  1QWY A;  4O1N A;  1O80 A;  5HUR A;  1TKW B;  3MA2 B;  4RH6 A;  3PO3 B;  4RGN A;  1DCZ A;  5BN5 A;  1EU4 A;  1Z47 A;  3DXJ C;  4EVO A;  3C3L A;  1XX8 A;  4KV6 A;  2PPB C;  2EXZ A;  1BF4 A;  5DM6 3;  1A6X A;  4H7B A;  2JEB I;  2X6L A;  4BBS B;  4IAL A;  4F87 A;  1I4Q A;  2LMC B;  3QOJ A;  3SK4 A;  2F03 A;  1VDZ A;  5G3L F;  1UUP A;  1F9P A;  1XTC D;  3PUV A;  5I9P A;  1TU2 B;  4C56 C;  4RFB A;  1GHJ A;  2R7Z B;  4A3M B;  2C9O A;  3DWA A;  1IL8 A;  3SHL A;  1JWM D;  1B9M A;  3DEO A;  3KBG A;  2WAC A;  2KED A;  5EGT A;  2JSO A;  5NUC A;  3SDZ A;  3A54 A;  1V1P A;  4A3I B;  2RBM A;  2XRQ D;  3OPO A;  1CTM A;  4PNY A;  3SK5 A;  2F0P A;  5CV9 A;  3VR2 A;  1KTK A;  5DM7 3;  5IGB A;  5IIF A;  1IKL A;  1F9R A;  2KEC A;  4C3J G;  2CW0 C;  2PMZ B;  1SDF A;  1NUC A;  2E2D C;  1STE A;  3TZU A;  1XYI A;  2R92 B;  1CHP D;  3TP5 A;  3W2D A;  1RCV D;  1Z6H A;  1FNV A;  3EVQ A;  5D14 A;  4J6H A;  5C0X G;  4BY1 B;  3Q6S A;  4FVM A;  2AUK A;  2EJM A;  2LFN A;  2A68 D;  3BG3 A;  5CC4 A;  5EJW A;  1TQO A;  2EJG C;  4IUV A;  1IKM A;  1NAP A;  1JC7 A;  1Y8O B;  3PUZ A;  1NR2 A;  3I4M B;  2HUG A;  1DXM A;  3VR6 A;  5JJZ A;  2MJ8 A;  1MBY A;  4ODG A;  1TS4 A;  3H91 A;  3HKZ B;  5JEA J;  2K05 A;  2IX0 A;  1HTL D;  1I4P A;  2F0Q A;  2KQ3 A;  3F2U A;  1EQT A;  1O7L A;  3KLS A;  4F88 A;  2VXW A;  4XQJ A;  1U4P A;  1MSG A;  3NTK A;  2PW5 A;  2F0U A;  3NK9 A;  1ML0 D;  5I2Y A;  1WTR A;  1V8Q A;  2AQ3 B;  2TMP A;  2B39 A;  1VMC A;  2OF1 A;  5J1Z A;  4H13 C;  4J8Q A;  1MI2 A;  4TKO B;  1FGB D;  4HCE A;  2F0F A;  2FFK B;  2D2C C;  2PCF B;  2KA7 A;  3X3N A;  3KK7 A;  1LTG D;  2RDH A;  3NBI A;  2BA1 A;  4K14 A;  2RDG A;  4A3J B;  1U9R A;  3NSW A;  3A7A B;  2N55 A;  4ZYS A;  2DN8 A;  5C5M A;  3QB3 A;  5COR A;  1QNU A;  3GP7 A;  4XDX A;  1LTA D;  1HUM A;  1D1K A;  4CKB A;  1EWC A;  1AN8 A;  3RMH A;  3K5N A;  3IFD A;  3DM1 A;  5JEA G;  1SNM A;  1PZI D;  2BCO A;  5C3E B;  2AQ2 B;  2RVL A;  1I4G A;  1B9N A;  3HS0 C;  5C4X B;  1YNJ D;  5CYU A;  3N52 A;  3ITP A;  1G91 A;  5ELB A;  4ZQ3 A;  2BDN A;  1KLU D;  3EA6 A;  2GA4 B;  3QIA A;  3ONA B;  1WTQ A;  3O13 A;  4K2L A;  3HOZ B;  4BS9 A;  4IFD J;  4WRD A;  2NN6 I;  2WP8 J;  3IL8 A;  1CZG A;  1ILQ A;  2B2W C;  5M9O A;  1TII D;  2EYP A;  4C3I B;  1NR4 A;  1I4H A;  4PV1 C;  4N9P A;  1TR5 A;  2K04 A;  5I6Y A;  1A3T A;  2ICI A;  2O4X A;  5FK9 C;  1G2S A;  1ENA A;  1SSO A;  5C0X I;  1SFO B;  3MC0 B;  5E1F A;  3HOX B;  1L0X B;  2F0L A;  3NXW A;  2FMM A;  3P75 A;  5ISR A;  4LMQ D;  4WJW A;  5KIX A;  2L4N A;  3U9O A;  3PV0 A;  1JOK A;  3VYR A;  1LTB D;  1TY2 A;  1SE2 A;  1M4V A;  2D62 A;  2PO4 A;  3FRP B;  5JPN C;  3J81 E;  1JWS D;  2NN6 H;  4B08 A;  3J7Y W;  1D6E C;  4A3B B;  1B44 D;  4ZKB B;  1MD2 D;  4M1U B;  2F4I A;  2MPM A;  1PZJ D;  3C1F A;  3R2I A;  3S2H B;  2NYZ D;  3PUX A;  3M7N A;  1SNQ A;  5K36 H;  4Q0F A;  2QKI C;  2V4D A;  3HG9 A;  3UI2 A;  1SMY D;  2F0W A;  4IZ8 A;  1G6Z A;  2XRS D;  3A8J E;  1LT5 D;  2WII B;  5I2X A;  4F8M A;  4RGT A;  4I65 A;  1EY9 A;  4DAY A;  5CR3 A;  2K6A A;  2O5J C;  5IGC A;  1CQF A;  3I91 A;  1CFM A;  3C1E A;  1YNJ C;  4YIJ A;  1PRT F;  4KY5 A;  5KNB A;  2CQA A;  2SNS A;  2NZ1 D;  4LAA A;  1ET6 A;  4RA8 A;  4Q5V A;  1ZKO A;  4RCO A;  1I4X A;  3D3R A;  4C1N I;  3S9W A;  1YNN D;  5C4H A;  3MZ5 A;  3S1R B;  4A3D B;  1KAA A;  2L55 A;  2PZU A;  5BN3 A;  2HDM A;  1EYA A;  1LT6 D;  1K8O A;  1HUN A;  3H0G B;  4IUQ A;  3R2T A;  2F1M A;  1EIH A;  1XWE A;  1OXT A;  2NTS A;  4L6T B;  3WOF A;  3HOY B;  1QG7 A;  2FMC A;  1KNE A;  2B2T C;  2CW0 D;  3BDL A;  3G6J B;  4UDU C;  3P7J A;  4KHV A;  2F0T A;  4JBW A;  3IAY A;  4KN4 C;  3X3M A;  2RKS A;  4OO1 G;  3A56 A;  2ZT9 C;  3NQI A;  5CGK A;  1GOZ A;  3J80 E;  3NTI A;  5JVG 3;  3VR4 A;  4EQN A;  4TQU S;  3I73 A;  4C3I G;  3GO5 A;  3DWQ A;  1SE3 A;  5EKI A;  1X3P A;  1WTP A;  1DD2 A;  1PRT D;  3OMG A;  4ZRZ A;  5FLX E;  1GUS A;  2VUM B;  3CRK C;  1WTW A;  4IUU A;  4FXG C;  1STY A;  4OL7 A;  5CMD A;  4C3H B;  1F2M A;  2X6G A;  3K57 A;  1C8C A;  5T1G A;  2KVM A;  5C4Z A;  3K0Y A;  5E4X A;  4UAI A;  4FNF A;  3QJY A;  2OT2 A;  3V05 A;  1B50 A;  1PXU A;  3BVZ A;  1HFN A;  1STB A;  4HMJ A;  4BWG B;  1DJR D;  1ZEQ X;  1HCZ A;  1QB5 D;  2XNA C;  2AWN A;  3CU7 A;  1BO0 A;  3SK8 A;  1ONL A;  2F0N A;  3EQL C;  3G7L A;  2PNR C;  4IN3 A;  1AZQ A;  5AFW A;  1PTO F;  2E75 C;  1D2B A;  4FO2 A;  3I8Z A;  1BOS A;  5EPL A;  3K59 A;  2Z1C A;  1PFM A;  3HGB A;  2OEO A;  1DON A;  1SXT A;  2F0I A;  4DNR B;  1S5B D;  1CQV A;  3P20 A;  1SNC A;  1UAP A;  4Y7N B;  4CJ2 C;  2EY1 A;  3EJI A;  1PTO H;  1Y69 U;  2LKV A;  1O7Y A;  1JOO A;  3D8G A;  1BDO A;  4A3F B;  5ELC A;  3Q24 A;  4CKE A;  1VCI A;  5IGE A;  3H09 A;  3RZD B;  4ME5 A;  2PYK A;  1FD7 D;  2KHS A;  4HSP A;  4B9X A;  1Y1W B;  2F3W A;  4KD3 A;  3MHB A;  2KUM A;  2QDB A;  4K5W A;  2IPK D;  3M85 A;  3RZO B;  1TWG B;  4C2M B;  4LJZ C;  1TS5 A;  3FPU B;  1F2Z A;  2ENB A;  2A6H D;  4KY7 A;  4L63 B;  2IWH A;  4DN4 M;  1PZK D;  2XWJ B;  4X3T A;  2BDO A;  2AQ1 B;  1EEF D;  1HQR D;  3DEP A;  3FPP A;  1Q1B A;  3A8I E;  3BDO A;  4HR7 B;  3T16 A;  2EVB A;  3GV6 A;  4K5X A;  5JOB A;  5KYI A;  4HAE A;  3J81 L;  2F0K A;  3MEH A;  5EBC A;  1STG A;  1BBX C;  4XQQ A;  1STH A;  5C0X J;  2X69 A;  1STA A;  2Z8L A;  1LT4 D;  1WD1 A;  3HOW B;  1ICW A;  1PTO D;  3VA7 A;  3MWY W;  1C48 A;  1OXV A;  5JVH 3;  1HTP A;  1GUG A;  4KKT A;  4S3S A;  1WD0 A;  1RF2 D;  1LAB A;  3ND8 A;  2JYO A;  3V96 A;  1H9R A;  3NQT A;  3SVM A;  2O5I C;  5D3I B;  3K5O A;  4DK1 A;  1S5F D;  2FIN B;  1SNO A;  5DAU A;  1VF5 C;  5I9O A;  5J22 A;  4IUP A;  2B2T A;  2K5Q A;  3S1Q B;  4BY7 B;  2M00 A;  2IX1 A;  2WIN B;  1IW7 C;  1EZ8 A;  3S2D B;  2J0T D;  4GZY C;  1O7Z A;  2Z4H A;  3PIO 3;  4BA2 I;  3GTJ B;  1RDP D;  2EJF C;  3QWN A;  1S5D D;  1V43 A;  2RA4 A;  4DAP A;  4DXG A;  4A93 B;  1GUW A;  2KCC A;  1UEA B;  4G57 A;  1JQY D;  2M2L A;  4XIG S;  1GXD C;  4QMG A;  4X3S A;  1GUT A;  4R8I A;  4TRD A;  5TSS A;  1PMR A;  1TWF B;  3I3C A;  2IW3 A;  1T5X D;  1EYC A;  3K5M A;  1RHP A;  3L3O C;  4XTC S;  3NWT A;  3MTS A;  2E2J B;  3AMU A;  1CT1 D;  4DU9 A;  5C4J B;  2B2Y A;  3LWU A;  3D4R A;  3GTL B;  1JOR A;  5ELD A;  3SR1 A;  1S5E D;  4RHS A;  4PQX A;  5M5W B;  3IFT A;  1SYC A;  3N6R A;  1EY5 A;  1Q90 A;  4C3H G;  2A6E D;  2WAQ B;  4M8A A;  2Q8T A;  3I72 A;  5C3X A;  4NMZ A;  3QO2 A;  3K58 A;  4KKS A;  1E0B A;  1EL0 A;  2F0J A;  4G7H C;  3PIP 3;  2D9U A;  4OIK A;  1I6H B;  1A2U A;  4K6L A;  2BE5 C;  3CHB D;  4XXE A;  3QG1 A;  2EPB A;  4HED A;  3GD7 A;  4KK7 A;  5E3F A;  3Q22 A;  3D4W A;  4QCL A;  2EY2 A;  2J4X A;  4KMU C;  3FDT A;  5HGT A;  3M4O B;  3MXN A;  5CBE E;  1EY0 A;  1LV9 A;  4NW2 A;  2EYF A;  3TZD A;  3CRL C;  1A3U A;  3VR3 A;  2A73 B;  1GUO A;  2H4O A;  1U4L A;  1SYG A;  3RUZ A;  3VYS A;  3U9S A;  3TP8 A;  1STN A;  4B9W A;  2MP1 A;  3MXU A;  2NBF A;  3OW7 A;  1I6V C;  5CV8 A;  4RHR A;  1QE6 A;  1TS3 A;  2R61 A;  5BN4 A;  4FF2 A;  5FLX L;  1E2Z A;  1L0Y B;  3Q23 A;  1EU3 A;  4XYO A;  1SYD A;  3RLF A;  5IGG A;  4I7Z C;  1KDC A;  3E6Z X;  3T4A C;  3I4N B;  1GJX A;  2NVT B;  1RJT A;  4V0B A;  2H1E A;  1CHQ D;  4DK0 A;  2F0D A;  1SJH D;  2M9V A;  4X3K A;  5EKK A;  5JAV A;  1DOL A;  1SEB D;  2EE1 A;  3SXH A;  1Q12 A;  5ELF A;  4ZAI A;  3GQB A;  1EOT A;  3BDC A;  2YYZ A;  1CA6 A;  5CV4 A;  2F0E A;  3OIQ A;  5M3M B;  3I4L A;  2BE5 D;  1Z7T A;  2KJX A;  2R3Z A;  1PDQ A;  5FKA C;  2I46 A;  3DWP A;  1T5E A;  4E6I A;  2QIL A;  2O2L D;  1SYE A;  3GV3 A;  3I90 A;  3J7A F;  3MVV A;  1HXY D;  5K5P A;  2EYL A;  1K8M A;  1SYF A;  1IYV A;  2K03 A;  1B3A A;  1BQQ T;  3L7Z C;  4H44 C;  5IGF A;  1F2L A;  1Y8N B;  1KDB A;  5FO9 B;  1EY7 A;  5C6A A;  1PRT B;  5A35 A;  4FF1 A;  1EY8 A;  3C46 A;  4U68 A;  2F0G A;  3AU7 A;  5T1I A;  1WTV A;  2SEB D;  1AP0 A;  5C3W A;  1OXS C;  1FYC A;  1SYB A;  3C2P A;  2WKC A;  1O78 A;  1ROD A;  2I07 B;  3K6O A;  1E2W A;  5D3D A;  2E74 C;  2WV6 D;  1TS2 A;  4BA1 I;  3R8B A;  2XWB B;  5DEH A;  1MSH A;  3QOL A;  2HQE A;  4NP5 A;  2KEE A;  4U67 3;  2B2U C;  5EPK A;  3TDQ A;  3GTP B;  4KJO A;  3SEB A;  4HSV A;  3NP8 A;  4R8N A;  3BYY B;  4JK1 C;  1H9M A;  1ENF A;  1AFP A;  1IYU A;  5FOB B;  2ID0 A;  3WDN A;  4PMW A;  5JPM C;  4NDX A;  1QOH A;  1ENC A;  1JIC A;  1W6J A;  1DOM A;  2B2V A;  3GTG B;  4FYD A;  5EPJ A;  2F0V A;  1ZYR C;  4RKB A;  4KTA A;  1PFN A;  1EZ6 A;  4G7O C;  5LL6 X;  3GTM B;  3LWE A;  3CQZ B;  1Q3L A;  1AW7 A;  1I50 B;  1C4Q A;  2BA0 A;  1H9J A;  1NCV A;  5IOC A;  3V2T A;  4QB4 A;  3J7A V;  4X3U A;  1TY0 A;  5CV5 A;  2HCI A;  3ERO A;  1Y8P B;  1JCK B;  1GUN A;  2A5H A;  3EFX D;  1EFI D;  5LL6 S;  2F0H A;  5EBD A;  4FF4 A;  1FNW A;  1HFG A;  1F2Y A;  1BXT A;  1PTO C;  4IFD I;  2G9H D;  1CK1 A;  2XVS A;  1SAP A;  4MN3 A;  4ZKC B;  1MGS A;  1RTN A;  3GTK B;  2QCP X;  2JEA I;  1NSN S;  3OWF A;  5EKL A;  2Q8R E;  4FXK C;  2IJ0 A;  4C3J B;  2RQX A;  4V19 0;  3D6W A;  2LY7 A;  3OWE B;  3BZD B;  1BR9 A;  5IOD A;  1VF7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...