1STGA

Two distinctly different metal binding modes are seen in x-ray crystal structures of staphylococcal nuclease-cobalt(ii)-nucleotide complexes
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
136
structure length
136
Chain Sequence
KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOCOCCAL NUCLEASE
publication title X-ray crystal structures of staphylococcal nuclease complexed with the competitive inhibitor cobalt(II) and nucleotide.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase(phosphoric diester)
total genus 38
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 1994-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1stgA00
1JORA 2EY5A 1SYCA 2PW5A 4R8NA 5C5MA 4DGZA 4MIUA 4EQOA 2OF1A 2QDBA 5DEHA 5CGKA 4WRDA 3D4DA 2EYFA 3U9OA 3D6CA 4DF7A 5IIFA 3MZ5A 4QMGA 3TP5A 5C4ZA 1SYDA 2F0OA 1EZ8A 4K5WA 3MEHA 4EQPA 4QB4A 1EY6A 3SK4A 1F2MA 2F0EA 2F0UA 3ERQA 3SR1A 4KD3A 3TMEA 3TP7A 3MHBA 4PNYA 3DMUA 5J22A 2M00A 5C3XA 2F0JA 5JOBA 5JAVA 1EY8A 1NSNS 1STGA 2EXZA 1EYCA 1RKNA 2F0HA 3H6MA 5IGBA 5CR3A 5EKLA 4K5VA 2PW7A 4PMBA 5IGCA 1STNA 4K2KA 1STYA 5CV7A 5I6WA 5CV8A 4B9WA 1EYAA 4HMIA 4ID6A 4IZ8A 4I65A 2PZUA 3MXPA 4ME5A 1ENAA 4ZUIA 1KAAA 1STAA 2EYJA 4B9XA 1EY0A 5HURA 1F2YA 3SXHA 4DFAA 2PZTA 2F3WA 2F0QA 5I6YA 4OL7A 5E3FA 1KDAA 2EYOA 5C6AA 3QOLA 1TT2A 4K8IA 1U9RA 4K8JA 4EQNA 2F0FA 2PZWA 1SNQA 4H7BA 3BDLA 4KJOA 1EY9A 5CC4A 2SOBA 1EZ6A 5KEEA 2EY1A 5E1FA 2F0KA 3SHLA 4KJNA 2EYHA 3OMGA 2F0VA 3SK6A 4KY6A 2O4XA 2F0TA 3NP8A 3OMCA 1STBA 4LAAA 5IGFA 3D4WA 4J6HA 4K2LA 1SYGA 3PMFA 2SNMA 1STHA 2OXPA 2PQEA 2F0LA 2WACA 5I9OA 3MVVA 2KHSA 3EJIA 4KV6A 3P1HA 3T16A 3S9WA 3OSOA 1SNPA 2F3VA 5KYIA 5IOCA 5F2DA 3ITPA 4F7XA 2F0WA 1KABA 4DU9A 1IHZA 4NKLA 2EYPA 4WORA 3EVQA 3OWFA 5M9OA 5ISRA 2SNSA 1EYDA 3QOJA 4RKLA 4EVOA 5C4HA 5EGTA 5CV5A 1EQVA 1A3VA 5J1ZA 1JOKA 3EROA 2F0MA 4KY5A 3C1EA 4J1MA 4KY7A 3SK5A 2F0GA 3NQTA 2F0DA 3TP6A 1SYFA 4K5XA 1EY7A 1TR5A 2LKVA 4NP5A 2RDFA 3HEJA 5CV6A 5CV4A 5C5LA 4KHVA 5DAUA 5EKKA 5CV9A 5IGEA 1F2ZA 2RBMA 5I9PA 4ZQ3A 2RKSA 5KGUA 3DHQA 4ODGA 4RKBA 5IODA 3P75A 5IGDA 2F0PA 2PYKA 1SYBA 2OEOA 3NHHA 1A2UA 1EY4A 2KQ3A 2EYMA 2NUCA 3SK8A 4PMCA 1SNDA 1JOOA 3LX0A 1SNCA 2F0SA 3NXWA 3R3OA 1EY5A 3E5SA 4IALA 4K14A 2F0NA 3QB3A 4NMZA 4ZUJA 3V2TA 4K6DA 3T13A 1A2TA 1ENCA 1TQOA 3BDCA 3D8GA 4QF4A 3RUZA 4E6IA 5IGGA 5KYLA 3VA5A 4S3SA 1JOQA 4TRDA 5NUCA 4HTHA 5J39A 1KDBA 5KIXA 3HZXA 2HQEA 2EY2A 1AEXA 4N9TA 2EY6A 5C3WA 1II3A 2ENBA 5HGTA 1KDCA 1SNMA 2EYLA 4N9PA 5KRUA 4G57A 3TP8A 5K5PA 4F8MA 3C1FA 3NUCA 4NDXA 1SYEA 1A3TA 4HMJA 3NK9A 4IUNA 1A3UA 4KD4A 1SNOA 4KTAA 2F0IA 4YIJA 1NUCA
chains in the Genus database with same CATH superfamily
3MFGA 3HOXG 4IJLA 4DGZA 2ATWA 5IYCG 2A6ED 3CCQA 2RF4A 2I0QA 1EFID 2CW0D 1WTRA 4HR7B 1F2MA 3W3AA 1LT5D 1Z7TA 3NEMA 3DMUA 1O7LA 1MJCA 4LUOA 3VR4A 4JI4Q 1VF7A 3STBC 4A3FB 3TN2A 3NBHB 1IW7D 1E3PA 3I4NB 1OXTA 2E2HB 2K05A 2HDLA 4GN3B 1S5ED 4DFAA 4JW0A 2F3WA 3NPPA 4AYBB 3GTQB 2OWOA 5I2XA 3CF5A 3HS0C 1G51A 2Q2HA 1S72A 1YNXA 2KCMA 4R4QA 2DN8A 1Q7YC 3HOWH 1GM5A 2UUCL 1BCPF 1CUKA 2IHFA 4CBVA 4RGTA 1JICA 4UP8A 4GS3A 4DNTB 1GUGA 1SYGA 1YJWA 5I9OA 2H1EA 3I56A 2KVMA 3M4OB 5E4WC 1H95A 3BJUA 2F3VA 5IP9H 3QO2A 3PF5A 1GUOA 1O7YA 1X6OA 3NTIA 1HZAA 2B2UA 5C44G 3GTJB 5I4DA 4EGVA 3F2CA 1EYDA 1SMXA 3FMCA 4RKLA 3S1QB 2L0CA 4OO1H 1WFQA 1TWAH 4IOAA 1XWEA 2MO1A 3NQTA 4OELB 3H3VI 1I94Q 3W5OA 1TIID 2XWJB 5IGDA 3K0YA 3VA7A 1G8ZD 2KQ3A 1D7QA 4GN4B 5C3EH 1Z6HA 5L37A 4DK0A 4TQUS 1U4MA 1VQMA 2AKWB 4JI3Q 2JA8H 5IYDH 3KUPA 1VQKA 2K1BA 1FVIA 5JVH3 2UUAQ 1A15A 1IYUA 1KDBA 4XQNA 3L2PA 3H0GB 1K8GA 1E2VA 2BDOA 4LFCL 3M3YH 2C9OA 3RD4A 2Z9HA 5C44B 1EIFA 3CCSA 2L5TA 4M8AA 5COYA 1JORA 3DLLA 1MBYA 4LF8L 2O5JC 3GDEA 5JPMC 4A3BH 1VQ6A 3PIPA 3WOFA 4HIMA 1EIGA 2ZM6L 1EYGA 5LMUL 1EQQA 4H02A 4IPCA 1YBYA 5C4ZA 4DKAC 1G291 2R3ZA 3GTKH 1W2BA 3PO3G 5J22A 3A8JE 1AZPA 1VQBA 2KJXA 5IGBA 1PTOH 2IWHA 4K5VA 5IGCA 3U4ZA 3I4OA 1HFGA 3Q6SA 3M85A 4DV6L 2Z6KC 1YITA 1XNRQ 1KAAA 4TKOB 4N8X1 3E9HA 4RAUC 1JQYD 3E0JA 1VQGA 3MTSA 2CQAA 2FFKB 3CQZB 4OL7A 3VR3A 1BOSA 4P73A 1TT2A 3CP0A 2XGTA 3AMUA 4A3EG 1YEZA 4RGOS 1KC8C 2ZXPA 2YV5A 1LTAD 4ZKCB 3S2HH 4LAAA 1V1QA 3KLSA 4HCEA 1BBXC 1TWHB 1BQQT 2PQEA 3QG1A 1DGSA 5D3IB 1DJRD 2FXQA 4FF3A 4P71A 3HOXH 1CHPD 3CW2C 3TDQA 5IYCH 1JWMD 1A3VA 2B2YA 4DR2Q 1I4XA 1WD1A 1K8MA 3SK6A 4K5XA 4QIWB 3U50C 4DR1L 4Q0FA 2WP8J 2KA7A 3EA6A 2AQ2B 4LFBQ 5M5XH 1SE4A 2Y0SG 5DNFA 2VZAA 2E8GA 4A3EB 2BE5C 1GUSA 3GTJH 2IY5B 3S1QH 2Z4HA 3CCMA 3VA5A 1JOQA 3CC7A 4TRDA 2EPBA 2GVAA 3I3CA 4GKKQ 2EY2A 4FXDA 3TP8A 3OYYA 1D1IA 2K01A 3NK9A 1CKNA 1TY2A 1NUCA 4X65L 1Q3LA 1RJTA 1VQ4A 4X3KA 4ZCKA 1BCPC 2NWGA 3KF6B 1WTVA 1JE5A 1EWCA 1P16A 5CGKA 1AH9A 4G7OC 4RA8A 4KK7A 3MZ5A 1VS0A 1PFNA 3LWEA 2D5DA 2Y0SB 2MPMA 2OTJA 3P20A 4PNYA 4RCNA 1Q12A 1LV9A 2EDGA 5C44H 2MNAA 5C3XA 2NN6I 3D6WA 2FMMA 4DR3Q 1GUWA 4PMBA 1I4GA 4JV5Q 2VY3A 4JBJA 3J81L 2B2VA 3PIO3 1X9NA 1IBML 3PIOA 3CHBD 1N34L 3G7LA 5I6YA 5E3FA 1YJ9A 3MFYA 3KF8B 3AQQA 4DR7Q 1SSOA 2O2LD 2K7VA 3S14B 4YCVA 4LF5L 3I73A 2F03A 2Z6BA 2BH2A 1FGUA 3F8TA 3OMGA 3F2DA 2F0VA 5ELEA 1FD7D 3TREA 3TRZA 1EEID 4DR6Q 1KHIA 2DNCA 1C7YA 3HFZB 2WACA 2A5HA 1F77A 5GAEC 3R2IA 5ELBA 3CQZH 2VUMG 3K81C 3LGJA 3ITPA 4KKTA 5EPLA 4IJHA 3EVQA 4RFBA 1PFMA 5C4HA 2BA1A 3IKJA 2Q8IB 4KY5A 4ILWA 4J1MA 4ZAIA 2F0GA 2B2TC 3E6ZX 4JBKA 1EY7A 2NN6G 2N49A 3BZKA 3U4VA 4JOIC 4JI8Q 2K52A 1HRJA 1KXLA 5IODA 3PO3H 4DV2L 3SK8A 5G3LF 3H3VH 3GTPH 3KOJA 5K36G 1SNCA 1DONA 2BCOA 4BBRG 1Y8PB 3A74A 3PSIA 1ASYA 1ENCA 4JC0A 3T53B 1I5FA 2PMZB 1ILPA 3DWPA 1HQMC 2B63B 1SJHD 5GAGC 1J6QA 4WJ3M 1Y1WG 2CWAA 1XJVA 2SEBD 5EPKA 2CWPA 1LTGD 3T4AC 4KKUA 4IOCA 4KD4A 1Q90A 4A3EH 4BY7G 1MIUA 3KLRA 1PH9A 3MWYW 2MUYA 3FP9A 5C5MA 1I4RA 4EQOA 1Q1EA 3EFXD 1I6HB 1X55A 1NY4A 4YWKA 4XT3B 1SMYD 4DAVA 2JK8A 2NVXH 3D6CA 4QCLA 3HOUG 2EXDA 2RSNA 1CQFA 3KFUA 2JA9A 3K7AH 4O42A 2M00A 5JOBA 4KLKA 5IP7G 4BBRB 1G6PA 5FO8B 4X62L 1KRSA 3SE0A 2JE6I 1UE7A 4X64Q 4JI5L 4QUCA 2CKZB 1ENAA 5E7NA 4GLXA 1EY0A 1WTHA 2PNRC 3I90A 2IW3A 4JI0L 3ND8A 5C6AA 1GJXA 1CFMA 4YHHL 3QOLA 4JI6L 4LK1C 1X32A 3S2DH 3OW7A 4AQYL 2EJFC 4B3ML 4K6LA 3BDLA 1S5FD 4KJOA 5ELNA 1BR9A 2WB1G 4R4TA 1EFWA 3HOUB 4OHJA 1PH6A 2C5CA 1STBA 3PUWA 2VW9A 2SNMA 4QQBX 2XRSD 1H9JA 1PV4A 4GOPB 1HPCA 1PH2A 3HG9A 4KI0A 2UUCQ 3GD7A 2N78A 2EYPA 2WAQB 3OWFA 2N8NA 2IX3A 4L5QA 4CDEC 4B08A 5CV6A 3UE0A 3NSWA 1PRTD 2E5LL 1VQAA 3DHQA 2Z4IA 2L12A 2J7ZA 4LF9L 1Z47A 5E4XA 2CQOA 1YNJD 3RN2A 2F0NA 2IL8A 4TSSA 4DR2L 4BXXG 4K6DA 1BUVT 2N55A 4FNFA 4ZYSA 3IAYA 4S3SA 1K3RA 3EN2A 5T1GA 1D2BA 1CKMA 3M9BA 5J39A 2JA6B 4LFBL 4H44C 2ENBA 1SRUA 2EYLA 4AYBE 1RF2D 5FLXc 3J81i 2B8GA 1Y1VB 2ZT9C 1HA6A 2X6LA 1QJOA 4O1NA 5FLXL 2N3SA 2Q2IA 3J7ZC 3V05A 2DJFC 5DEHA 4LFCQ 1RIPA 2FMCA 4XXEA 1B50A 5IIFA 4B3TL 3J81E 3HKZG 2JYOA 3A5UA 2VUMH 5KNCA 1NCVA 1IL8A 1EOTA 4KKSA 1FYCA 1STGA 1V1PA 5LMUQ 1LT4D 3SDZA 3RZDH 2JJQA 1STNA 3ZYYX 5M5WH 4U673 2RSOA 4FVMA 3MEFA 2PNHA 1Q81C 1WI5A 2EJMA 2NN6H 1SJED 3UDXA 2PZTA 1QE6A 4HAEA 2KCTA 4DV6Q 3NE5B 3OHXC 5IYBG 4C3HG 1O80A 1EEFD 3RZOB 5CYUA 1Y14B 1EZ6A 5GROA 5KEEA 1EQRA 3PUYA 1XXGA 4HJAA 1JB3A 3HKZB 4A3DG 1PRTB 4IO9A 3HOWB 4LF7L 2EVBA 3UDIA 5T1IA 1Y1WH 2AWOA 1GKHA 1ICWA 4A3LH 2Z6KA 1VQJA 1HHVA 1TS2A 4BY7H 3J7A5 3G6JB 1J9OA 2OCEA 1WYDA 5CBAE 3SK5A 1LUZA 3CAMA 4OGQC 3HOUH 4APVA 1B3AA 1TR5A 2HHHL 2LFNA 3I7FA 3W2DA 1TWAB 5IGEA 1MD2D 4RGMA 1DOLA 1F2ZA 1YNNC 3BZDB 5DM63 4GN5A 1BKBA 3MAQA 2PYKA 1SYBA 3NHHA 1SFOH 5IP7H 1K8AC 5H1SE 1EOVA 1D5MC 1TKWB 2WKDA 3NXWA 1XTDA 1PLFA 4DR1Q 3HRZC 1TQOA 2YU9H 3BDCA 4DXGA 5C3EB 1HXYD 4A3DB 2RDGA 1ASZA 2AUJD 3NELA 3GTLH 2JA8B 2EY6A 1STEA 5ELCA 3FPUB 2F4IA 5EGTA 2X6GA 4KN7C 1UE5A 1O78A 4DV0L 1X3PA 5IY0A 1YI2A 1XTCD 4WRDA 1H9MA 2K6AA 3FEWX 4L6TB 4DF7A 2D0OA 2F0OA 4X65Q 1TWFH 4QUFA 1AZQA 1SEBD 3MHBA 2F0JA 2MO0A 4YCWA 2NTTA 4DR5L 4UP7A 5BR8L 1YVCA 1S3OA 1PTOB 1X3EA 2KCNA 2Z8LA 4QIWE 3TZUA 1STAA 2EYJA 4P74A 5HURA 4KHPL 1PH8A 1T9HA 3NTKA 4C1NK 1K73C 4FF2A 2Q2TA 1A6XA 2JEAI 2JEBI 1U9RA 4X64L 4XTCS 4BXXH 1SAPA 1T5EA 2NVYB 5EPJA 2K04A 1NJIC 4DV3L 1JCKB 4XT1B 4EQ5A 1IBMQ 1N34Q 1HNWL 1JT8A 1ET6A 1R4QB 1W3SA 3SEBA 3M4YA 3NWTA 4DAMA 4LF5Q 3S2HB 1SR3A 1EL0A 1YZ6A 2F1MA 3HOZG 3OSOA 2A6HC 1CSPA 3MXUA 3GTOB 1NTGA 4WORA 5M9OA 1YHBA 3G6EA 1J5EL 3RLFA 1B9MA 3RZOH 2VQEL 4OONA 3HOXB 1LABA 2K75A 1JOKA 3UDFA 1GXDC 1S5BD 2A73B 3ZJYC 2X69A 5A35A 1VQ9A 3VYSA 4F88A 2RDFA 4KHVA 4NXMQ 2PQAA 2Y0SE 1UUPA 1A0IA 4A3MG 4OWTB 2PPBC 3IL8A 1M90C 1A2UA 5HY6A 2RDHA 4RH6A 1TU2B 5M5XB 3KBXA 2E75C 2G9DA 2IHEA 3M4PA 3QB3A 2QDLA 1V1OA 5FLXE 4B3RL 2L11A 2A6EC 3CD6A 4DV2Q 2UXDL 3KYHC 4DAYA 1WOCA 3M4QA 5KIXA 1FJGL 3HOZB 2CW0C 4YCUA 2K5NA 4N9PA 1ML0D 2QA4A 1H9KA 1QG7A 1DOMA 3NUCA 2OTLA 5IYBH 4C3HH 3CRLC 2B2TA 3IFDA 2RQXA 4YIJA 1GHKA 1IW7C 2VB2X 2LSSA 3R8BA 5EJWA 3GTMH 2QDBA 1N32Q 1AP0A 2IX0A 4A3DH 4LNQA 1JJGA 3MXNA 4DUYL 1SYDA 2AQ1B 4QB4A 4LW1A 3OPOA 3S1RB 4ZRZA 3U9SA 4R9WA 1JMCA 1K9MC 2EXZA 4XQJA 1D5ZC 5C0XI 3Q23A 2NYZD 1KTKA 4I65A 1IBKQ 2AQ3B 3QR8A 3HOVG 1KLGD 2QKIC 4X62Q 3FPPA 4XIGS 1TWGH 3FRPB 3OIQA 2JXMB 4O2DA 1C8CA 2E2DC 1F9PA 4JI5Q 1L1OC 2L1BA 4KHZA 2Z1CA 1WCMG 1ZEQX 3KJPA 1EY9A 4PZ6A 3S24A 1HNZL 3A5ZB 4CJ2C 2PMZE 3K58A 2EYHA 3I55A 1HZBA 4JI0Q 4BWGB 1X56A 5C0XJ 4YHHQ 4JI6Q 1WTPA 2LS01 3ONAB 4AQYQ 4B3MQ 2F0LA 4NB3A 4NXNL 3S1NH 4HSPA 3S9WA 2QEJC 5KYIA 4POGA 5A2QL 1KABA 2L4NA 2NVYH 2BDNA 3QOJA 4JI7Q 1QILA 3J81j 3Q22A 1YHQA 1SE3A 3SK4A 4JI1L 2WIIB 1JB7A 5DAUA 4HIKA 1SXTA 2NVTB 1EUJA 2RKSA 1E1TA 2NTSA 5C0XG 4JYAL 3CMAA 2DNEA 2PO4A 1CSQA 2KBNA 1WCMB 3WDNA 4DK6C 4MZ9A 3PO3B 4C3IH 1EY5A 3GTOH 3V2TA 1XPRA 2E5LQ 3GTPB 4N8FA 3Q24A 1KRTA 4GLAC 2XSCA 4LF9Q 2D0PA 2P5ZX 3TZDA 2HQEA 1WTXA 2XRQD 1EU4A 2R61A 2B8FA 3TQYA 1XPOA 2NBFA 3OOCA 4Y7NB 5FKAC 4FYDA 1ZYRD 4OWXB 4FDBA 3CCRA 1ENFA 3AFPA 4C56C 4X66L 2J0TD 1Q86C 3HOZH 4JPBW 1EZ8A 1OXVA 1PFBA 2NVXB 3GQBA 4J8QA 4KD3A 3CCEA 4HJ7A 2WAQE 2QEXA 3K7AB 2QGQA 4JBWA 2EQSA 4B3TQ 3J7YW 4A76A 3KDFA 3A0JA 1IBLQ 4B3SL 3L3OC 5C4XG 3VYTA 2D62A 1TVXA 3GTGB 2E2JH 4B9XA 4A3MH 2NZ1D 4BS9A 4CKEA 1FGBD 3RNUA 3S1RH 2KCCA 4IPDA 4K8IA 1AN8A 4IFDI 2K33A 2RHQB 1VQLA 1X3FA 2ZJRA 1PH4A 4H0LC 5GADC 3S2DB 1JC7A 4MN3A 2E74C 3J81c 3NP8A 1Q46A 2K50A 1NAPA 1HTPA 1Y8OB 1F9QA 4DV1L 1UNSA 4JI2L 1L2FA 1RDPD 1F9SA 3KLWA 1UEBA 4LF7Q 2LXJA 4DNRB 4IFDJ 3F1ZA 2O5IC 1MJEA 5I2YA 1W6JA 5KGUA 5IT9L 1H9SA 2UXBL 3H91A 2A68D 4ZQ3A 1HH2P 2F3IA 5BN4A 1PMRA 1BCPB 4KN4C 2K28A 4PMCA 1E2WA 4J15A 4K14A 2VS1A 2HHHQ 2WKCA 4IUVA 2EZVA 5HGQA 4QF4A 4NXML 4A3GG 3HOVH 2B2WC 4A3JG 4YWLA 1N36L 5JVG3 3BVMA 4IFDG 1SDFA 5KRUA 3A55A 1SNMA 2NVTH 1HNXL 5M3FH 1B7YB 1NMFA 2DUDA 4NDXA 1SYEA 1JE4A 1M8AA 3K8AA 4XYQA 1M4VA 4HEDA 2G5DA 1WCMH 1SNOA 2UXCL 1Z9FA 4JK1C 3PQIA 4XYOA 3ULJA 2AUKA 3EIVA 5JEAJ 2OF1A 4P2CB 3HKZE 4IN3A 2GA4B 5C4JH 2UUBL 4HJ9A 1I3QH 1XX8A 3S17H 3VR5A 3JC66 2PQAB 4DV0Q 2Q2UA 4HCSA 1DXMA 1VMCA 5KNBA 5D3DA 4YY3Q 2CCZA 4Y7NH 1N32L 2VUMB 4NW2A 4WFN3 5EKLA 3GV6A 2M2LA 4UY8C 4A3LG 2HQLA 4LF4Q 3D3RA 2NZHA 4DV4Q 3RZDB 2PZUA 3MXPA 1UWVA 1XPUA 5M5WB 4AIMA 1U0LA 4DR5Q 5JEAG 4DAYB 5C0XH 2KECA 1KQSA 3WWVA 5BR8Q 4G7ZC 3E9IA 1YIJA 1SNQA 1PH5A 1IBKL 3FDTA 4KHPQ 2EY1A 2SDFA 4GLVB 2ZTDA 4OXPA 3OMCA 5IGFA 3GTGH 3O13A 3CMEA 1DM0B 2GVBA 1SBBB 3PMFA 1LM0A 1OXUA 3DM3A 2D2CC 3MVVA 4DV3Q 1HNWQ 2PCFB 3MXNB 2ZJQA 3OWEB 3S16H 3CCUA 4GOPC 2I46A 1SROA 3EBEA 1Y1WB 3FHWA 5AJ3L 3DM1A 4C2MB 2ZXOA 1HA5A 3WOEA 4OWWB 2QCPX 1VQDA 2MGSA 3VYUA 4HJ5A 4BY7B 1RODA 5C5LA 5CV4A 1RTNA 5I9PA 1J5EQ 4ODGA 1PH7A 2I5HA 3P75A 2VQEQ 4ABNA 2K5VA 2OQKA 2K5WA 1D5XC 3DEPA 3K6OA 4JI7L 2IT1A 2K5QA 4BA2I 4RCOA 1SFOB 5C4XH 4F87A 1SMYC 2NZOA 2LY7A 3K5MA 4QL5A 3M7NA 2YU9B 1QB5D 3UE1A 3HZXA 1AEXA 3G4SA 3VR2A 4B3RQ 3GTLB 2E76C 1SE8A 2UXDQ 1FJGQ 1X3QA 3BDOA 4IUTA 2XN9C 3TEHB 2WB1B 3FVQA 3KLSX 2HDMA 2R93G 3A54A 3TP5A 5M3MG 1WD0A 2F0UA 4Q5VA 4MTKA 2YTYA 4FF1A 1TWFB 2A74C 3H94A 4DUYQ 4K2KA 3R93A 2MP1A 5BN3A 3CCJA 3Q0AA 1YHAA 3PO2G 1UE1A 2B39A 1NNXA 1EIHA 5G3LD 4FF4A 1K8OA 2F4VL 3QWNA 1ET9A 2RVLA 4RGNA 3AYHB 1PDQA 4BA1I 1IBLL 4A3KH 1MKHA 4K8JA 4EQNA 5EAYA 1PYSB 1V43A 2RCNA 2KOLA 1TXYA 2ASBA 4A3GH 4IPHA 4KY6A 4A3JH 1PRTC 5IE8A 4IFDH 5M3MB 1LO5D 3TBIB 4MTNA 3R2TA 1HNZQ 1C0AA 1NMGA 1YNJC 3PGZA 4F7XA 4V190 5ISRA 2QF7A 3MA2B 4A3IG 4XQQA 1CQVA 4A3CG 3LNNA 4GKJL 1LTRD 1CHQD 1X3GA 3DWQA 4NXNQ 5JJLA 1BO0A 1L1OA 3KDFB 3T1HL 4G7HC 2KENA 3HP3A 2K32A 1CKNB 1F9RA 3JAML 5CV9A 1C48A 4P75A 3BYYB 1O7IA 5LMNW 3A8IE 1PTOD 4WJWA 2F0PA 1BDOA 3K57A 1EY4A 3MC0B 3HOYG 1SNDA 1A8VA 2F0SA 3KK7A 3R3OA 1VQ5A 4JI1Q 2FINB 2C35B 5LL6X 3GO5A 4C2MH 1VQIA 5IWAL 5NUCA 1PA6A 4JYAQ 1IZ6A 4GNXC 5JEAH 1C9OA 3BYTB 1PH1A 1FNWA 2A19A 1S5CD 1R9TB 1VCIA 2CH4A 2R7DA 3H15A 1UE6A 2BOSA 1YJNA 4A3IB 3C46A 2VQFL 1CT1D 1AW7A 4UHVA 4C3HB 3RR5A 4MIUA 4C1NI 1BVSA 1ILQA 4QMGA 3GTMB 1P8LA 1WTOA 3J7AV 3S1MH 1L0XB 4EQPA 1S40A 2EE1A 3TMEA 1H9SB 2QW7A 2PI2E 2DY7A 2A69D 4Y52H 1E7ZA 1RKNA 2F0HA 5KYLA 4X66Q 2RA4A 5CR3A 3CXCA 5FLMG 1VQOA 3CC4A 1JWSD 1KIXA 5FO7B 1E24A 4HMIA 4ID6A 1MSGA 2IJ0A 4R1JA 4ALPA 3I4MG 1K3BC 3RLNA 1E1OA 4IUPA 1F2YA 4YY3L 2ID0A 2ES2A 4B3SQ 2EYOA 4IUQA 1TWGB 2LMCB 4LF4L 3J80c 4DV4L 4LMQD 4TVAB 1B1ZA 5E1FA 5LMNL 3SHLA 3OIPA 4DUZL 3RN5A 1IL2A 1RCVD 3I72A 3CPFA 3J80L 1ONLA 1KL9A 4C3IG 4J6HA 3D0FA 1QCBD 1PXUA 2HIVA 1E2ZA 3P7JA 1PZID 1QUQA 3P1HA 3HGBA 1K28A 1SNPA 3KJOA 1LTLA 2F0WA 4A3FG 1BF4A 1IHZA 4NKLA 3S1NB 2H5XA 4EVOA 5JPNC 3I4NG 1D6EC 2BA0A 2FHTA 1CKOA 2ICEC 1F2LA 2XTIA 2ZJPA 4QGUA 1XMOL 3I4MB 3EROA 1G91A 4DV1Q 2R7FA 2R93H 4NP5A 4JI2Q 3VDYA 2LKVA 1PFSA 5D14A 2HT1A 4GZYC 4DR4L 4PQXA 5M3MH 2RBMA 4R4OA 2OEOA 1X65A 1JOOA 3LWUA 1OO9B 1KNEA 1PYBA 2UXBQ 4BY1H 3PO2H 4DAPA 4C3IB 1K83H 1CA6A 4Z9CB 1B2TA 4N9TA 1II3A 4G4KA 1W6KA 3C1FA 3FKIH 4IUNA 1RHPA 4A4IA 3TSSA 4A75A 4H13C 1N36Q 3H09A 4NPSA 1WTWA 2ZTEA 1HNXQ 2KHIA 4FO2A 4R4IA 2E2IB 1K0SA 3PUZA 3U9OA 4FXKC 3PV0A 4CDCC 2UXCQ 4RWSC 1E0BA 1CA5A 2B3GA 4RMFA 3NTHA 2F0EA 4UP9A 3D4RA 1R9TH 4UAIA 2B2WA 2H4OA 5JAVA 1EY8A 1EYCA 3H6MA 3I8ZA 4A3IH 2TSSA 2UUBQ 4IPGA 4A3CH 1DD2A 3GP7A 5EKIA 3PCOB 1Y69U 4WJ4A 1BBUA 1EU3A 3OW2A 1VQ8A 5CBEE 2YTXA 4JOIA 2NVQB 3H0GG 5BN5A 1QVCA 4AH6A 3ICEA 2XWBB 2E2JB 2F0QA 5D65A 2KEDA 4POFA 3JAMi 4A3MB 3AEVA 3HOYH 3K59A 4ULLA 5EBDA 2F0FA 2R7ZH 2K14A 2DY8A 4H7BA 5CMDA 4CHTB 4RHSA 4UDUC 2M9VA 2SOBA 3D31A 2Q8TA 1HJPA 2F0KA 1OXSC 1LLRD 2JA7G 3T1YQ 1TS5A 1CTMA 1B3QA 2YYZA 4L5SA 3JAME 2KHSA 3EJIA 4KV6A 5IOCA 3TS2A 3I70A 5M3FG 1DOKA 1PHJA 4BBSG 3L7ZC 1LTBD 2F0MA 1S4ZA 1CI3M 2F0DA 3I2ZA 3HEJA 2EIFA 2GN5A 5EKKA 3BU2A 5AJ3Q 3M7GA 1XNQL 4IURA 4K0KL 1FR3A 3K5LA 1HCZA 3I4LA 4FP5D 3PIP3 3CC2A 1IKMA 1S5DD 3LX0A 5FLMH 1SN8A 3S15B 1QZHA 1WTQA 3H3VC 1HZCA 3CRKC 3RUZA 2JA7B 4R8IA 4PZ7A 1JJ2A 4GOPA 3I4MH 2BH8A 2JSOA 1V1PB 5JJKA 4LF6Q 2V4DA 3HOVB 1VMPA 2R6GA 2NB0A 5K5PA 1KD1C 1L0YB 4M1UB 2K5HA 2KEEA 4HMJA 1KLUD 1HR0Q 2ZTCA 2ZXRA 2F0IA 5EQ0A 5M3FB 2BE5D 2WV6D 4OX9Q 4QY7A 4BBSB 1EWHA 2TMPA 1SLJA 1QOHA 3D4DA 2EYFA 1PH3A 4FXGC 1LT6D 1L1OB 4K5WA 3J80i 5C4JB 1BBWA 1EY6A 3ERQA 1I3QB 4L63B 3TP7A 2MHVA 4XDXA 4A3FH 3S17B 4DV5L 1HQRD 4P72A 1NSNS 4JG2A 3I4NH 1PZKD 4YWMA 2E2HH 3VR6A 1JWUD 1BCPD 2B29A 1R4PB 4IZ8A 4KMUC 4X3TA 4HIOA 2E2IH 3BG3A 4ZUIA 3J80E 3GTQH 4PG3A 4QJFA 2DGYA 2JA5G 2JP1A 2AMCB 2YTVA 4V0BA 4X3UA 2XIWA 3C3LA 2KHJA 4LUZA 1O7ZA 3L9AX 2UU9L 2CHBD 2F4VQ 3GV3A 3K0XA 1PVOA 4U68A 4CDDC 3M4OH 2NVQH 1TY0A 3ULPA 4L5TA 4DA2A 1HFNA 1K0RA 1ZXTA 1WJJA 2L9HA 5TSSA 4DV7L 2R92G 1IYVA 4DU9A 4LFAL 3S16B 3OTOL 3E0EA 1XYIA 3BS1A 2JQOA 1I50B 2WB1E 2KUMA 1UAPA 4JCVE 4KY7A 2K4KA 3AFQA 1SYFA 3MXGA 2JA5B 3AB9A 4JBMA 2OQ0A 4ME3A 4CJ0B 1Q82C 4ZKBB 5CORA 4LJZC 1V9PA 4GKJQ 4CKCA 3CCLA 3T1HQ 5DLQE 3K7UC 5ELDA 1U4PA 3E5SA 1RD9D 4NMZA 1ZYRC 3D8GA 2XVSA 3C2PA 3H0GH 5C4XB 4MNOA 5IT9c 4DK3C 1ZKOA 1NR2A 2R92B 2AHOB 4G57A 1B53A 4ZLTF 5IWAQ 2D9UA 4PV1C 1A3UA 1QUQB 3TS0A 5GAHC 1SYCA 1I4PA 2PW5A 3BVZA 1B8AA 3S15H 1VQCA 2DJGC 1QVFA 2MQHA 2JA7H 4A3KG 1PYWD 2CFMA 5GQOA 4JI4L 1G2SA 4IQZA 3SVMA 2VQFQ 1QZGA 1AFPA 4ZK9B 1NBWA 2ICIA 1AE2A 2N88A 4I7AA 1FNUA 3IRBA 1KNAA 4GNXA 1PRTF 4X3SA 1XMQQ 1LTTD 1ESRA 4BBSH 2PW7A 1STYA 4OIKA 5CV8A 4B9WA 4DK1A 2L55A 3PUVA 3W1GA 2B63G 3NWSA 1GD7A 2K03A 2B2UC 1QVGA 4EX5A 4PMWA 1I4QA 3A56A 2JN4A 1HR0W 2G9HD 5CC4A 1GO3E 1U5KA 4A3KB 2CH4W 1TWHH 1D1KA 4X6AH 3QIAA 3HKSA 3D4WA 4A3GB 2A68C 1H9RA 1DCZA 4A3JB 5AFWA 1LTSD 3T16A 5FO9B 5LMNQ 3ND9A 4DUZQ 5F2DA 3V96A 1B4OA 1TS3A 1WVLA 1I94L 1B44D 1CK1A 2HCIA 2VXWA 2VNUD 3T1YL 1LYLA 5J1ZA 1FNVA 3N6RA 1VF5C 3C1EA 3DXJC 1OTCA 5A2QE 1E22A 3TP6A 4CGYB 4DPGA 3F2BA 2J4XA 2QILA 3BVGA 4RHRA 4JI3L 4A93G 1N33Q 4MHEA 1Q8IA 1XMOQ 3NQIA 2UUAL 2NUCA 2EYMA 3VYRA 3NBHA 5FOBB 4IALA 5FJ8G 4ZUJA 4HJ8A 4DR4Q 1IKLA 2K5DA 3T13A 1GHJA 1A2TA 5IGGA 4E6IA 1EQTA 1I50H 4LWCA 2EJGC 4JVZA 2JA5H 5HGTA 1KDCA 2VB3X 2V1CC 2WAQG 1PTOF 3CPWA 1VQNA 3K5NA 4I7ZC 4KTAA 1Q1BA 2EY5A 1GUTA 3CCVA 4O0AA 2L15A 4R8NA 1JJCB 3UDGA 1U4RA 3UI2A 3G48A 4LF6L 4C3JG 1TS4A 4A93B 1MSHA 1VQHA 3BZCA 3T56B 1HR0L 3MEHA 3J7AF 1NR4A 1OXXK 2R92H 1QNKA 1IXRA 2Z0SA 4OX9L 1CZWA 1BXTA 1A63A 3URYA 1XNRL 1I6VC 3S1MB 5LHY1 5CV7A 1KAWA 3A7LA 1AE3A 1UEAB 2JA6G 1GUNA 4ME5A 1B9NA 1EWIA 1Y1VG 3S14H 1I4HA 2B2YC 1N9WA 1KDAA 1G2TA 5JJIA 2PZWA 1TWCB 3I91A 4DXFA 4C3JB 1IYJB 4KJNA 4IUUA 2HD3A 1LTID 1RTOA 2MFIA 2LXKA 4K2LA 1BNZA 4BY1G 1GOZA 4OO1I 1HTLD 4HIDA 5M5YB 3EQLC 1QNUA 4LUVA 1QWYA 3PF4A 2WINB 2RHSB 1NE3A 3NBIA 2SNSA 3B6YA 3QJYA 5CV5A 2HUGA 3FKIG 2WFWA 1RL2A 5DM73 2I5LX 1JR0D 1V8QA 4OEMB 4L8JA 1CM9A 2OT2A 2R93B 1DYQA 2EOTA 1A62A 4GKKL 5IT9E 1Y8NB 4PZ8A 3E3XA 5JJZA 1ESFA 1XNQQ 1Q8KA 4RG1A 4K0KQ 3CKIB 3RLOA 2B63H 3A7AB 3HOWG 4LF8Q 2PI2A 1C4QA 3DWAA 3KBGA 3NENA 4OIJA 4BY1B 3PO2B 3JAMc 5C3WA 1LACA 2ZM6Q 1K83B 4HN7A 4CJ1B 1YNND 1A3TA 5IP9G 3A8KE 5KNDA 2B2VC 1I6HH 1DZ1A 4CKBA 5FK9C 3FKIB 1X54A 4CDFC 1VDZA 4OO1G 1CZGA 1U4LA 2A8VA 1PZJD 4DR3L 2R7ZG 1HUNA 3X3NA 5K36H 5ELOA 2Q8RE 3IFTA 4BBRH 3PUXA 3SR1A 4JV5L 5LL6S 1GVPA 3ULLA 5C3EG 3DUZA 5I6WA 2HCCA 1EYAA 4DR7L 3DEOA 2JA8G 5IYDG 4DV5Q 1SE2A 4A93H 3SXHA 2ALYB 1XMQL 5EBCA 3G71A 3U58A 1N8RC 5FJ8H 4DR6L 1VQ7A 3K5OA 3HOYB 3AU7A 3ERSX 4A3BG 1VQPA 2R7ZB 5J3BA 1T5XD 4R4CA 1ICFB 2AWNA 2F0TA 2O4XA 4UPAA 2IX1A 1HZ9A 1J8IA 2I07B 2MJ8A 1STHA 2OXPA 1PTOC 2UU9Q 1MI2A 3SGIA 1VQFA 2FJ2A 3KF6A 3K80C 4JI8L 1TWCH 4GNXB 3RMHA 4DN4M 1EQVA 3X3MA 4C3JH 3Q8DA 4DV7Q 4HSVA 1G6ZA 3STBD 2XNAC 5ELFA 1M1KC 2F52A 1MHWC 4LFAQ 3M3YB 3OTOQ 4RKBA 1HUMA 2HIXA 3ER0A 5M5YH 2A6HD 2A1AA 2CVRA 3N52A 2IPKD 4DNIA 4A3BB 1EIYB 1MGSA 2RCFA 2JA6H 1LT3D 4HTHA 3CU7A 1Y1VH 1N33L 3L0OA 3KF8A 3F2UA 3W1BA 3GTKB 1D8LA 1B70B 1FL0A 4F8MA 2I5MX 2VL6A 1VQEA 4AYBG 2A69C 1L0WA 4L5RC 3T51B
chains in the Genus database with same CATH topology
3MFGA 4DGZA 2A6ED 1EFID 2CW0D 1WTRA 4HR7B 1F2MA 3W3AA 1LT5D 1Z7TA 3DMUA 1O7LA 3VR4A 1VF7A 4A3FB 3TN2A 1IW7D 3I4NB 1OXTA 2E2HB 2K05A 2HDLA 1S5ED 4DFAA 2F3WA 3NPPA 4AYBB 3GTQB 5I2XA 3HS0C 2DN8A 1BCPF 4CBVA 4RGTA 1JICA 4DNTB 1GUGA 1SYGA 5I9OA 2H1EA 2KVMA 3M4OB 5E4WC 2F3VA 3QO2A 1GUOA 1O7YA 3NTIA 2B2UA 3GTJB 5I4DA 4EGVA 1EYDA 3FMCA 4RKLA 3S1QB 2L0CA 4OO1H 1XWEA 3NQTA 1TIID 2XWJB 5IGDA 3K0YA 3VA7A 1G8ZD 2KQ3A 1Z6HA 4DK0A 4TQUS 1U4MA 3KUPA 2K1BA 5JVH3 1A15A 1IYUA 1KDBA 4XQNA 3H0GB 1E2VA 2BDOA 2C9OA 3RD4A 5C44B 2L5TA 4M8AA 5COYA 1JORA 1MBYA 2O5JC 5JPMC 3WOFA 1EIGA 5C4ZA 1G291 2R3ZA 5J22A 3A8JE 1AZPA 2KJXA 5IGBA 1PTOH 2IWHA 4K5VA 5IGCA 1HFGA 3Q6SA 3M85A 1KAAA 4TKOB 4RAUC 1JQYD 3E0JA 3MTSA 2CQAA 2FFKB 3CQZB 4OL7A 3VR3A 1BOSA 1TT2A 3AMUA 4RGOS 2ZXPA 4ZKCB 1LTAD 4LAAA 3KLSA 4HCEA 1BBXC 1TWHB 1BQQT 2PQEA 3QG1A 5D3IB 1DJRD 4FF3A 1CHPD 3TDQA 1JWMD 1A3VA 2B2YA 1I4XA 1WD1A 1K8MA 3SK6A 4K5XA 4QIWB 4Q0FA 2WP8J 2KA7A 3EA6A 2AQ2B 1SE4A 5DNFA 4A3EB 2BE5C 1GUSA 2Z4HA 3VA5A 1JOQA 4TRDA 2EPBA 3I3CA 2EY2A 4FXDA 3TP8A 1D1IA 2K01A 3NK9A 1TY2A 1NUCA 1Q3LA 1RJTA 4X3KA 1BCPC 2NWGA 1WTVA 1EWCA 5CGKA 4G7OC 4RA8A 4KK7A 3MZ5A 1PFNA 3LWEA 2D5DA 2Y0SB 2MPMA 3P20A 4PNYA 4RCNA 1Q12A 1LV9A 2EDGA 5C3XA 2NN6I 3D6WA 2FMMA 1GUWA 4PMBA 1I4GA 3J81L 2B2VA 3PIO3 3CHBD 3G7LA 5I6YA 5E3FA 3MFYA 1SSOA 2O2LD 2K7VA 3S14B 3I73A 2F03A 3OMGA 2F0VA 5ELEA 1FD7D 1EEID 2DNCA 2A5HA 2WACA 1F77A 3R2IA 5ELBA 3ITPA 4KKTA 5EPLA 3EVQA 4RFBA 1PFMA 5C4HA 2BA1A 3IKJA 2Q8IB 4KY5A 4ILWA 4J1MA 4ZAIA 2F0GA 2B2TC 3E6ZX 1EY7A 2NN6G 1HRJA 5IODA 3SK8A 5G3LF 5K36G 1SNCA 1DONA 2BCOA 1Y8PB 1ENCA 3T53B 2PMZB 1ILPA 3DWPA 1HQMC 2B63B 1SJHD 2SEBD 5EPKA 3T4AC 1LTGD 4KKUA 4KD4A 1Q90A 3KLRA 3MWYW 2MUYA 5C5MA 1I4RA 4EQOA 1Q1EA 3EFXD 1I6HB 4XT3B 1SMYD 4DAVA 3D6CA 4QCLA 2RSNA 1CQFA 4O42A 2M00A 5JOBA 4BBRB 5FO8B 3SE0A 2JE6I 4QUCA 1ENAA 1EY0A 2PNRC 3I90A 2IW3A 3ND8A 5C6AA 1GJXA 1CFMA 3QOLA 4LK1C 1X32A 3OW7A 2EJFC 4K6LA 3BDLA 1S5FD 4KJOA 1BR9A 3HOUB 4OHJA 2C5CA 1STBA 3PUWA 2SNMA 2XRSD 1H9JA 1HPCA 3HG9A 4KI0A 3GD7A 2EYPA 2WAQB 3OWFA 2IX3A 4B08A 5CV6A 3NSWA 1PRTD 3DHQA 2Z4IA 2L12A 2J7ZA 1Z47A 5E4XA 1YNJD 2F0NA 2IL8A 4TSSA 4K6DA 1BUVT 2N55A 4FNFA 4ZYSA 3IAYA 4S3SA 5T1GA 1D2BA 5J39A 2JA6B 4H44C 2ENBA 2EYLA 1RF2D 2B8GA 1Y1VB 2ZT9C 1HA6A 2X6LA 4O1NA 1QJOA 5FLXL 3V05A 5DEHA 2FMCA 4XXEA 1B50A 5IIFA 3J81E 2JYOA 5KNCA 1NCVA 1IL8A 1EOTA 4KKSA 1FYCA 1STGA 1V1PA 1LT4D 3SDZA 1STNA 3ZYYX 4U673 2RSOA 4FVMA 2EJMA 2NN6H 1SJED 2PZTA 1QE6A 4HAEA 3NE5B 3OHXC 4C3HG 1O80A 1EEFD 3RZOB 5CYUA 1EZ6A 5KEEA 3PUYA 1XXGA 1JB3A 3HKZB 1PRTB 3HOWB 2EVBA 5T1IA 2AWOA 1ICWA 1HHVA 1TS2A 3G6JB 1J9OA 5CBAE 3SK5A 4OGQC 1B3AA 1TR5A 2LFNA 5IGEA 3W2DA 1TWAB 1MD2D 4RGMA 1DOLA 1F2ZA 1YNNC 3BZDB 5DM63 3MAQA 2PYKA 1SYBA 3NHHA 1D5MC 1TKWB 2WKDA 3NXWA 1PLFA 3HRZC 1TQOA 3BDCA 4DXGA 5C3EB 1HXYD 4A3DB 2RDGA 2AUJD 2JA8B 2EY6A 1STEA 5ELCA 3FPUB 2F4IA 5EGTA 2X6GA 4KN7C 1O78A 1X3PA 1XTCD 4WRDA 1H9MA 2K6AA 3FEWX 4L6TB 4DF7A 2F0OA 4QUFA 1AZQA 1SEBD 3MHBA 2F0JA 2NTTA 1PTOB 2KCNA 2Z8LA 3TZUA 1STAA 2EYJA 5HURA 3NTKA 4C1NK 4FF2A 1A6XA 2JEAI 2JEBI 1U9RA 4XTCS 1SAPA 1T5EA 2NVYB 5EPJA 2K04A 1JCKB 4XT1B 1ET6A 1R4QB 3SEBA 3M4YA 3NWTA 3S2HB 1EL0A 2F1MA 3OSOA 2A6HC 3MXUA 3GTOB 4WORA 5M9OA 3RLFA 1B9MA 3HOXB 1LABA 1JOKA 1GXDC 1S5BD 2A73B 5A35A 2X69A 3VYSA 4F88A 2RDFA 4KHVA 1UUPA 2PPBC 3IL8A 1A2UA 2RDHA 4RH6A 1TU2B 5M5XB 3KBXA 2E75C 2G9DA 3QB3A 1V1OA 5FLXE 2L11A 2A6EC 4DAYA 5KIXA 3HOZB 2CW0C 4N9PA 1ML0D 1H9KA 1QG7A 1DOMA 3NUCA 3CRLC 2B2TA 3IFDA 2RQXA 4YIJA 1GHKA 1IW7C 2VB2X 3R8BA 5EJWA 2QDBA 1AP0A 2IX0A 3MXNA 1SYDA 2AQ1B 4QB4A 3OPOA 3S1RB 4ZRZA 3U9SA 4R9WA 2EXZA 4XQJA 1D5ZC 5C0XI 3Q23A 2NYZD 1KTKA 4I65A 2AQ3B 1KLGD 2QKIC 3FPPA 4XIGS 3FRPB 3OIQA 2JXMB 1C8CA 2E2DC 1F9PA 2L1BA 4KHZA 2Z1CA 1ZEQX 1EY9A 4CJ2C 3K58A 2EYHA 4BWGB 5C0XJ 1WTPA 2LS01 3ONAB 2F0LA 4HSPA 3S9WA 2QEJC 5KYIA 5A2QL 1KABA 2L4NA 3QOJA 2BDNA 1QILA 3Q22A 1SE3A 3SK4A 2WIIB 5DAUA 1SXTA 2NVTB 2RKSA 2NTSA 5C0XG 2DNEA 2PO4A 1WCMB 3WDNA 3PO3B 1EY5A 3V2TA 3GTPB 3Q24A 2XSCA 3TZDA 2HQEA 1WTXA 2XRQD 1EU4A 2R61A 2B8FA 2NBFA 3OOCA 4Y7NB 5FKAC 4FYDA 1ZYRD 1ENFA 4C56C 2J0TD 1EZ8A 1OXVA 1PFBA 2NVXB 3GQBA 4J8QA 4KD3A 3K7AB 4JBWA 3J7YW 3L3OC 3VYTA 2D62A 1TVXA 3GTGB 4B9XA 2NZ1D 4BS9A 4CKEA 1FGBD 2KCCA 4K8IA 1AN8A 4IFDI 2K33A 4H0LC 3S2DB 1JC7A 4MN3A 2E74C 3NP8A 1NAPA 1HTPA 1Y8OB 1F9QA 1UNSA 1RDPD 1F9SA 4DNRB 4IFDJ 2O5IC 5I2YA 1W6JA 5KGUA 5IT9L 1H9SA 3H91A 2A68D 4ZQ3A 5BN4A 1PMRA 1BCPB 4KN4C 2K28A 4PMCA 1E2WA 4K14A 2WKCA 4IUVA 2EZVA 4QF4A 2B2WC 5JVG3 3BVMA 4IFDG 1SDFA 5KRUA 3A55A 1SNMA 4NDXA 1SYEA 1JE4A 1M8AA 4XYQA 1M4VA 4HEDA 1SNOA 4JK1C 4XYOA 2AUKA 5JEAJ 2OF1A 4P2CB 4IN3A 2GA4B 1XX8A 3VR5A 4HCSA 1DXMA 1VMCA 5KNBA 5D3DA 2VUMB 4NW2A 4WFN3 5EKLA 3GV6A 2M2LA 3D3RA 3RZDB 2PZUA 3MXPA 5M5WB 5JEAG 5C0XH 2KECA 4G7ZC 1SNQA 3FDTA 2EY1A 2SDFA 3OMCA 5IGFA 3O13A 1DM0B 1SBBB 3PMFA 1OXUA 2D2CC 3MVVA 2PCFB 3OWEB 2I46A 1Y1WB 3DM1A 4C2MB 2ZXOA 1HA5A 3WOEA 2QCPX 2MGSA 3VYUA 4BY7B 1RODA 5C5LA 5CV4A 1RTNA 5I9PA 4ODGA 3P75A 4ABNA 2K5WA 1D5XC 3DEPA 3K6OA 2IT1A 2K5QA 4BA2I 4RCOA 1SFOB 4F87A 1SMYC 2LY7A 3K5MA 3M7NA 2YU9B 1QB5D 3HZXA 1AEXA 3VR2A 3GTLB 2E76C 1X3QA 3BDOA 4IUTA 2XN9C 2WB1B 3FVQA 3KLSX 2HDMA 3A54A 3TP5A 1WD0A 2F0UA 4Q5VA 4FF1A 1TWFB 2A74C 3H94A 4K2KA 3R93A 2MP1A 5BN3A 3Q0AA 2B39A 1EIHA 5G3LD 4FF4A 1K8OA 3QWNA 1ET9A 2RVLA 4RGNA 1PDQA 4BA1I 4K8JA 4EQNA 1V43A 2KOLA 4KY6A 1PRTC 4IFDH 5M3MB 1LO5D 3TBIB 3R2TA 1YNJC 4F7XA 4V190 5ISRA 2QF7A 3MA2B 4XQQA 1CQVA 3LNNA 1LTRD 1CHQD 3DWQA 1BO0A 4G7HC 3HP3A 2K32A 1F9RA 3JAML 5CV9A 1C48A 3BYYB 3A8IE 1PTOD 4WJWA 2F0PA 1BDOA 3K57A 1EY4A 3MC0B 1SNDA 2F0SA 3KK7A 3R3OA 2FINB 5LL6X 3GO5A 5NUCA 5JEAH 3BYTB 1FNWA 1S5CD 1R9TB 1VCIA 2BOSA 4A3IB 3C46A 1CT1D 1AW7A 4C3HB 4MIUA 4C1NI 1ILQA 4QMGA 3GTMB 1WTOA 3J7AV 4EQPA 1L0XB 2EE1A 3TMEA 1H9SB 2DY7A 2A69D 2F0HA 1RKNA 5KYLA 2RA4A 5CR3A 1JWSD 5FO7B 4HMIA 4ID6A 1MSGA 2IJ0A 4IUPA 1F2YA 2ID0A 2EYOA 4IUQA 1TWGB 2LMCB 4LMQD 1B1ZA 5E1FA 3SHLA 3OIPA 1RCVD 3I72A 3J80L 1ONLA 4C3IG 4J6HA 1QCBD 1PXUA 1E2ZA 3P7JA 1PZID 3P1HA 3HGBA 1SNPA 2F0WA 1BF4A 1IHZA 4NKLA 3S1NB 5JPNC 4EVOA 1D6EC 2BA0A 2FHTA 2ICEC 1F2LA 3I4MB 1G91A 3EROA 4NP5A 4GZYC 2LKVA 5D14A 4PQXA 2RBMA 2OEOA 1JOOA 3LWUA 1OO9B 1KNEA 4DAPA 4C3IB 1CA6A 4Z9CB 1B2TA 4N9TA 1II3A 4G4KA 1W6KA 3C1FA 4IUNA 1RHPA 3TSSA 4H13C 3H09A 1WTWA 4FO2A 2E2IB 3PUZA 3U9OA 4FXKC 3PV0A 4RWSC 1E0BA 1CA5A 3NTHA 2F0EA 3D4RA 4UAIA 2B2WA 2H4OA 5JAVA 1EY8A 1EYCA 3H6MA 3I8ZA 2TSSA 1DD2A 3GP7A 5EKIA 1Y69U 1EU3A 5CBEE 2NVQB 5BN5A 2XWBB 2E2JB 2F0QA 5D65A 2KEDA 4A3MB 3K59A 4ULLA 5EBDA 2F0FA 4H7BA 5CMDA 2DY8A 4CHTB 4RHSA 4UDUC 2M9VA 2SOBA 3D31A 2Q8TA 2F0KA 1OXSC 1LLRD 1TS5A 1CTMA 2YYZA 3JAME 2KHSA 3EJIA 4KV6A 5IOCA 3I70A 1DOKA 3L7ZC 1LTBD 2F0MA 1S4ZA 1CI3M 2F0DA 3HEJA 5EKKA 3M7GA 4IURA 1FR3A 3K5LA 1HCZA 3I4LA 4FP5D 3PIP3 1IKMA 1S5DD 3LX0A 3S15B 1WTQA 3H3VC 3CRKC 3RUZA 2JA7B 4R8IA 2JSOA 1V1PB 2V4DA 3HOVB 1VMPA 2R6GA 2NB0A 5K5PA 1L0YB 4M1UB 2KEEA 4HMJA 1KLUD 2ZXRA 2F0IA 5EQ0A 5M3FB 2BE5D 2WV6D 4BBSB 1EWHA 2TMPA 1QOHA 3D4DA 2EYFA 4FXGC 1LT6D 4K5WA 5C4JB 1EY6A 3ERQA 1I3QB 4L63B 3TP7A 2MHVA 4XDXA 3S17B 1HQRD 1NSNS 1PZKD 3VR6A 1JWUD 1BCPD 1R4PB 4IZ8A 4KMUC 4X3TA 3BG3A 4ZUIA 3J80E 2JP1A 4V0BA 4X3UA 2XIWA 3C3LA 1O7ZA 3L9AX 2CHBD 3GV3A 4U68A 1TY0A 4DA2A 1HFNA 1ZXTA 2L9HA 5TSSA 1IYVA 4DU9A 3S16B 1XYIA 3BS1A 1I50B 2KUMA 1UAPA 4KY7A 1SYFA 3MXGA 2JA5B 3AB9A 4CJ0B 4ZKBB 5CORA 4LJZC 4CKCA 5ELDA 1U4PA 3E5SA 1RD9D 4NMZA 1ZYRC 3D8GA 2XVSA 3C2PA 5C4XB 1ZKOA 1NR2A 2R92B 4G57A 1B53A 4ZLTF 2D9UA 4PV1C 1A3UA 1SYCA 1I4PA 2PW5A 3BVZA 1PYWD 1G2SA 4IQZA 3SVMA 1AFPA 4ZK9B 2ICIA 2N88A 1FNUA 1KNAA 1PRTF 4X3SA 1LTTD 1ESRA 2PW7A 1STYA 4OIKA 5CV8A 4B9WA 4DK1A 2L55A 3PUVA 3NWSA 2K03A 2B2UC 4PMWA 1I4QA 3A56A 2G9HD 5CC4A 4A3KB 1D1KA 3QIAA 3D4WA 4A3GB 2A68C 1H9RA 1DCZA 4A3JB 5AFWA 1LTSD 3T16A 5FO9B 3ND9A 5F2DA 3V96A 1B4OA 1TS3A 1WVLA 1B44D 1CK1A 2HCIA 2VXWA 2VNUD 5J1ZA 1FNVA 3N6RA 1VF5C 3C1EA 3DXJC 5A2QE 3TP6A 4CGYB 2J4XA 2QILA 3BVGA 4RHRA 4MHEA 1Q8IA 3NQIA 2NUCA 2EYMA 3VYRA 3NBHA 5FOBB 4IALA 4ZUJA 1IKLA 2K5DA 3T13A 1GHJA 1A2TA 5IGGA 4E6IA 1EQTA 2EJGC 5HGTA 1KDCA 2VB3X 1PTOF 3K5NA 4I7ZC 4KTAA 1Q1BA 2EY5A 1GUTA 4R8NA 1U4RA 3UI2A 4C3JG 1TS4A 4A93B 1MSHA 3T56B 3MEHA 3J7AF 1NR4A 1OXXK 1QNKA 1CZWA 1BXTA 3URYA 1I6VC 3S1MB 5LHY1 5CV7A 3A7LA 1UEAB 1GUNA 4ME5A 1B9NA 1I4HA 2B2YC 1KDAA 1G2TA 2PZWA 1TWCB 3I91A 4DXFA 4C3JB 4KJNA 4IUUA 1LTID 1RTOA 4K2LA 1BNZA 1GOZA 4OO1I 1HTLD 5M5YB 3EQLC 1QNUA 1QWYA 2WINB 3NBIA 2SNSA 3QJYA 5CV5A 2HUGA 5DM73 1JR0D 1V8QA 4L8JA 1CM9A 2OT2A 2R93B 1DYQA 2EOTA 5IT9E 1Y8NB 5JJZA 1ESFA 3CKIB 3A7AB 1C4QA 3DWAA 3KBGA 4OIJA 4BY1B 3PO2B 5C3WA 1LACA 1K83B 4HN7A 4CJ1B 1YNND 1A3TA 3A8KE 5KNDA 2B2VC 1DZ1A 4CKBA 5FK9C 3FKIB 1VDZA 4OO1G 1CZGA 1U4LA 1PZJD 1HUNA 3X3NA 5K36H 2Q8RE 3IFTA 3PUXA 3SR1A 5LL6S 3DUZA 5I6WA 2HCCA 1EYAA 3DEOA 1SE2A 3SXHA 5EBCA 3K5OA 3HOYB 3AU7A 2R7ZB 1T5XD 2AWNA 2O4XA 2F0TA 2IX1A 1J8IA 2I07B 2MJ8A 1STHA 2OXPA 1PTOC 1MI2A 2FJ2A 3RMHA 4DN4M 1EQVA 3X3MA 4HSVA 1G6ZA 2XNAC 5ELFA 3M3YB 4RKBA 1HUMA 2A6HD 2CVRA 3N52A 2IPKD 4A3BB 1MGSA 1LT3D 4HTHA 3CU7A 3KF8A 3F2UA 3GTKB 4F8MA 2A69C 3T51B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JOR A;  2EY5 A;  1SYC A;  2PW5 A;  4R8N A;  5C5M A;  4DGZ A;  4MIU A;  4EQO A;  2OF1 A;  2QDB A;  5DEH A;  5CGK A;  4WRD A;  3D4D A;  2EYF A;  3U9O A;  3D6C A;  4DF7 A;  5IIF A;  3MZ5 A;  4QMG A;  3TP5 A;  5C4Z A;  1SYD A;  2F0O A;  1EZ8 A;  4K5W A;  3MEH A;  4EQP A;  4QB4 A;  1EY6 A;  3SK4 A;  1F2M A;  2F0E A;  2F0U A;  3ERQ A;  3SR1 A;  4KD3 A;  3TME A;  3TP7 A;  3MHB A;  4PNY A;  3DMU A;  5J22 A;  2M00 A;  5C3X A;  2F0J A;  5JOB A;  5JAV A;  1EY8 A;  1NSN S;  1STG A;  2EXZ A;  1EYC A;  1RKN A;  2F0H A;  3H6M A;  5IGB A;  5CR3 A;  5EKL A;  4K5V A;  2PW7 A;  4PMB A;  5IGC A;  1STN A;  4K2K A;  1STY A;  5CV7 A;  5I6W A;  5CV8 A;  4B9W A;  1EYA A;  4HMI A;  4ID6 A;  4IZ8 A;  4I65 A;  2PZU A;  3MXP A;  4ME5 A;  1ENA A;  4ZUI A;  1KAA A;  1STA A;  2EYJ A;  4B9X A;  1EY0 A;  5HUR A;  1F2Y A;  3SXH A;  4DFA A;  2PZT A;  2F3W A;  2F0Q A;  5I6Y A;  4OL7 A;  5E3F A;  1KDA A;  2EYO A;  5C6A A;  3QOL A;  1TT2 A;  4K8I A;  1U9R A;  4K8J A;  4EQN A;  2F0F A;  2PZW A;  1SNQ A;  4H7B A;  3BDL A;  4KJO A;  1EY9 A;  5CC4 A;  2SOB A;  1EZ6 A;  5KEE A;  2EY1 A;  5E1F A;  2F0K A;  3SHL A;  4KJN A;  2EYH A;  3OMG A;  2F0V A;  3SK6 A;  4KY6 A;  2O4X A;  2F0T A;  3NP8 A;  3OMC A;  1STB A;  4LAA A;  5IGF A;  3D4W A;  4J6H A;  4K2L A;  1SYG A;  3PMF A;  2SNM A;  1STH A;  2OXP A;  2PQE A;  2F0L A;  2WAC A;  5I9O A;  3MVV A;  2KHS A;  3EJI A;  4KV6 A;  3P1H A;  3T16 A;  3S9W A;  3OSO A;  1SNP A;  2F3V A;  5KYI A;  5IOC A;  5F2D A;  3ITP A;  4F7X A;  2F0W A;  1KAB A;  4DU9 A;  1IHZ A;  4NKL A;  2EYP A;  4WOR A;  3EVQ A;  3OWF A;  5M9O A;  5ISR A;  2SNS A;  1EYD A;  3QOJ A;  4RKL A;  4EVO A;  5C4H A;  5EGT A;  5CV5 A;  1EQV A;  1A3V A;  5J1Z A;  1JOK A;  3ERO A;  2F0M A;  4KY5 A;  3C1E A;  4J1M A;  4KY7 A;  3SK5 A;  2F0G A;  3NQT A;  2F0D A;  3TP6 A;  1SYF A;  4K5X A;  1EY7 A;  1TR5 A;  2LKV A;  4NP5 A;  2RDF A;  3HEJ A;  5CV6 A;  5CV4 A;  5C5L A;  4KHV A;  5DAU A;  5EKK A;  5CV9 A;  5IGE A;  1F2Z A;  2RBM A;  5I9P A;  4ZQ3 A;  2RKS A;  5KGU A;  3DHQ A;  4ODG A;  4RKB A;  5IOD A;  3P75 A;  5IGD A;  2F0P A;  2PYK A;  1SYB A;  2OEO A;  3NHH A;  1A2U A;  1EY4 A;  2KQ3 A;  2EYM A;  2NUC A;  3SK8 A;  4PMC A;  1SND A;  1JOO A;  3LX0 A;  1SNC A;  2F0S A;  3NXW A;  3R3O A;  1EY5 A;  3E5S A;  4IAL A;  4K14 A;  2F0N A;  3QB3 A;  4NMZ A;  4ZUJ A;  3V2T A;  4K6D A;  3T13 A;  1A2T A;  1ENC A;  1TQO A;  3BDC A;  3D8G A;  4QF4 A;  3RUZ A;  4E6I A;  5IGG A;  5KYL A;  3VA5 A;  4S3S A;  1JOQ A;  4TRD A;  5NUC A;  4HTH A;  5J39 A;  1KDB A;  5KIX A;  3HZX A;  2HQE A;  2EY2 A;  1AEX A;  4N9T A;  2EY6 A;  5C3W A;  1II3 A;  2ENB A;  5HGT A;  1KDC A;  1SNM A;  2EYL A;  4N9P A;  5KRU A;  4G57 A;  3TP8 A;  5K5P A;  4F8M A;  3C1F A;  3NUC A;  4NDX A;  1SYE A;  1A3T A;  4HMJ A;  3NK9 A;  4IUN A;  1A3U A;  4KD4 A;  1SNO A;  4KTA A;  2F0I A;  4YIJ A;  1NUC A; 
#chains in the Genus database with same CATH topology
 3MFG A;  3HOX G;  4IJL A;  4DGZ A;  2ATW A;  5IYC G;  2A6E D;  3CCQ A;  2RF4 A;  2I0Q A;  1EFI D;  2CW0 D;  1WTR A;  4HR7 B;  1F2M A;  3W3A A;  1LT5 D;  1Z7T A;  3NEM A;  3DMU A;  1O7L A;  1MJC A;  4LUO A;  3VR4 A;  4JI4 Q;  1VF7 A;  3STB C;  4A3F B;  3TN2 A;  3NBH B;  1IW7 D;  1E3P A;  3I4N B;  1OXT A;  2E2H B;  2K05 A;  2HDL A;  4GN3 B;  1S5E D;  4DFA A;  4JW0 A;  2F3W A;  3NPP A;  4AYB B;  3GTQ B;  2OWO A;  5I2X A;  3CF5 A;  3HS0 C;  1G51 A;  2Q2H A;  1S72 A;  1YNX A;  2KCM A;  4R4Q A;  2DN8 A;  1Q7Y C;  3HOW H;  1GM5 A;  2UUC L;  1BCP F;  1CUK A;  2IHF A;  4CBV A;  4RGT A;  1JIC A;  4UP8 A;  4GS3 A;  4DNT B;  1GUG A;  1SYG A;  1YJW A;  5I9O A;  2H1E A;  3I56 A;  2KVM A;  3M4O B;  5E4W C;  1H95 A;  3BJU A;  2F3V A;  5IP9 H;  3QO2 A;  3PF5 A;  1GUO A;  1O7Y A;  1X6O A;  3NTI A;  1HZA A;  2B2U A;  5C44 G;  3GTJ B;  5I4D A;  4EGV A;  3F2C A;  1EYD A;  1SMX A;  3FMC A;  4RKL A;  3S1Q B;  2L0C A;  4OO1 H;  1WFQ A;  1TWA H;  4IOA A;  1XWE A;  2MO1 A;  3NQT A;  4OEL B;  3H3V I;  1I94 Q;  3W5O A;  1TII D;  2XWJ B;  5IGD A;  3K0Y A;  3VA7 A;  1G8Z D;  2KQ3 A;  1D7Q A;  4GN4 B;  5C3E H;  1Z6H A;  5L37 A;  4DK0 A;  4TQU S;  1U4M A;  1VQM A;  2AKW B;  4JI3 Q;  2JA8 H;  5IYD H;  3KUP A;  1VQK A;  2K1B A;  1FVI A;  5JVH 3;  2UUA Q;  1A15 A;  1IYU A;  1KDB A;  4XQN A;  3L2P A;  3H0G B;  1K8G A;  1E2V A;  2BDO A;  4LFC L;  3M3Y H;  2C9O A;  3RD4 A;  2Z9H A;  5C44 B;  1EIF A;  3CCS A;  2L5T A;  4M8A A;  5COY A;  1JOR A;  3DLL A;  1MBY A;  4LF8 L;  2O5J C;  3GDE A;  5JPM C;  4A3B H;  1VQ6 A;  3PIP A;  3WOF A;  4HIM A;  1EIG A;  2ZM6 L;  1EYG A;  5LMU L;  1EQQ A;  4H02 A;  4IPC A;  1YBY A;  5C4Z A;  4DKA C;  1G29 1;  2R3Z A;  3GTK H;  1W2B A;  3PO3 G;  5J22 A;  3A8J E;  1AZP A;  1VQB A;  2KJX A;  5IGB A;  1PTO H;  2IWH A;  4K5V A;  5IGC A;  3U4Z A;  3I4O A;  1HFG A;  3Q6S A;  3M85 A;  4DV6 L;  2Z6K C;  1YIT A;  1XNR Q;  1KAA A;  4TKO B;  4N8X 1;  3E9H A;  4RAU C;  1JQY D;  3E0J A;  1VQG A;  3MTS A;  2CQA A;  2FFK B;  3CQZ B;  4OL7 A;  3VR3 A;  1BOS A;  4P73 A;  1TT2 A;  3CP0 A;  2XGT A;  3AMU A;  4A3E G;  1YEZ A;  4RGO S;  1KC8 C;  2ZXP A;  2YV5 A;  1LTA D;  4ZKC B;  3S2H H;  4LAA A;  1V1Q A;  3KLS A;  4HCE A;  1BBX C;  1TWH B;  1BQQ T;  2PQE A;  3QG1 A;  1DGS A;  5D3I B;  1DJR D;  2FXQ A;  4FF3 A;  4P71 A;  3HOX H;  1CHP D;  3CW2 C;  3TDQ A;  5IYC H;  1JWM D;  1A3V A;  2B2Y A;  4DR2 Q;  1I4X A;  1WD1 A;  1K8M A;  3SK6 A;  4K5X A;  4QIW B;  3U50 C;  4DR1 L;  4Q0F A;  2WP8 J;  2KA7 A;  3EA6 A;  2AQ2 B;  4LFB Q;  5M5X H;  1SE4 A;  2Y0S G;  5DNF A;  2VZA A;  2E8G A;  4A3E B;  2BE5 C;  1GUS A;  3GTJ H;  2IY5 B;  3S1Q H;  2Z4H A;  3CCM A;  3VA5 A;  1JOQ A;  3CC7 A;  4TRD A;  2EPB A;  2GVA A;  3I3C A;  4GKK Q;  2EY2 A;  4FXD A;  3TP8 A;  3OYY A;  1D1I A;  2K01 A;  3NK9 A;  1CKN A;  1TY2 A;  1NUC A;  4X65 L;  1Q3L A;  1RJT A;  1VQ4 A;  4X3K A;  4ZCK A;  1BCP C;  2NWG A;  3KF6 B;  1WTV A;  1JE5 A;  1EWC A;  1P16 A;  5CGK A;  1AH9 A;  4G7O C;  4RA8 A;  4KK7 A;  3MZ5 A;  1VS0 A;  1PFN A;  3LWE A;  2D5D A;  2Y0S B;  2MPM A;  2OTJ A;  3P20 A;  4PNY A;  4RCN A;  1Q12 A;  1LV9 A;  2EDG A;  5C44 H;  2MNA A;  5C3X A;  2NN6 I;  3D6W A;  2FMM A;  4DR3 Q;  1GUW A;  4PMB A;  1I4G A;  4JV5 Q;  2VY3 A;  4JBJ A;  3J81 L;  2B2V A;  3PIO 3;  1X9N A;  1IBM L;  3PIO A;  3CHB D;  1N34 L;  3G7L A;  5I6Y A;  5E3F A;  1YJ9 A;  3MFY A;  3KF8 B;  3AQQ A;  4DR7 Q;  1SSO A;  2O2L D;  2K7V A;  3S14 B;  4YCV A;  4LF5 L;  3I73 A;  2F03 A;  2Z6B A;  2BH2 A;  1FGU A;  3F8T A;  3OMG A;  3F2D A;  2F0V A;  5ELE A;  1FD7 D;  3TRE A;  3TRZ A;  1EEI D;  4DR6 Q;  1KHI A;  2DNC A;  1C7Y A;  3HFZ B;  2WAC A;  2A5H A;  1F77 A;  5GAE C;  3R2I A;  5ELB A;  3CQZ H;  2VUM G;  3K81 C;  3LGJ A;  3ITP A;  4KKT A;  5EPL A;  4IJH A;  3EVQ A;  4RFB A;  1PFM A;  5C4H A;  2BA1 A;  3IKJ A;  2Q8I B;  4KY5 A;  4ILW A;  4J1M A;  4ZAI A;  2F0G A;  2B2T C;  3E6Z X;  4JBK A;  1EY7 A;  2NN6 G;  2N49 A;  3BZK A;  3U4V A;  4JOI C;  4JI8 Q;  2K52 A;  1HRJ A;  1KXL A;  5IOD A;  3PO3 H;  4DV2 L;  3SK8 A;  5G3L F;  3H3V H;  3GTP H;  3KOJ A;  5K36 G;  1SNC A;  1DON A;  2BCO A;  4BBR G;  1Y8P B;  3A74 A;  3PSI A;  1ASY A;  1ENC A;  4JC0 A;  3T53 B;  1I5F A;  2PMZ B;  1ILP A;  3DWP A;  1HQM C;  2B63 B;  1SJH D;  5GAG C;  1J6Q A;  4WJ3 M;  1Y1W G;  2CWA A;  1XJV A;  2SEB D;  5EPK A;  2CWP A;  1LTG D;  3T4A C;  4KKU A;  4IOC A;  4KD4 A;  1Q90 A;  4A3E H;  4BY7 G;  1MIU A;  3KLR A;  1PH9 A;  3MWY W;  2MUY A;  3FP9 A;  5C5M A;  1I4R A;  4EQO A;  1Q1E A;  3EFX D;  1I6H B;  1X55 A;  1NY4 A;  4YWK A;  4XT3 B;  1SMY D;  4DAV A;  2JK8 A;  2NVX H;  3D6C A;  4QCL A;  3HOU G;  2EXD A;  2RSN A;  1CQF A;  3KFU A;  2JA9 A;  3K7A H;  4O42 A;  2M00 A;  5JOB A;  4KLK A;  5IP7 G;  4BBR B;  1G6P A;  5FO8 B;  4X62 L;  1KRS A;  3SE0 A;  2JE6 I;  1UE7 A;  4X64 Q;  4JI5 L;  4QUC A;  2CKZ B;  1ENA A;  5E7N A;  4GLX A;  1EY0 A;  1WTH A;  2PNR C;  3I90 A;  2IW3 A;  4JI0 L;  3ND8 A;  5C6A A;  1GJX A;  1CFM A;  4YHH L;  3QOL A;  4JI6 L;  4LK1 C;  1X32 A;  3S2D H;  3OW7 A;  4AQY L;  2EJF C;  4B3M L;  4K6L A;  3BDL A;  1S5F D;  4KJO A;  5ELN A;  1BR9 A;  2WB1 G;  4R4T A;  1EFW A;  3HOU B;  4OHJ A;  1PH6 A;  2C5C A;  1STB A;  3PUW A;  2VW9 A;  2SNM A;  4QQB X;  2XRS D;  1H9J A;  1PV4 A;  4GOP B;  1HPC A;  1PH2 A;  3HG9 A;  4KI0 A;  2UUC Q;  3GD7 A;  2N78 A;  2EYP A;  2WAQ B;  3OWF A;  2N8N A;  2IX3 A;  4L5Q A;  4CDE C;  4B08 A;  5CV6 A;  3UE0 A;  3NSW A;  1PRT D;  2E5L L;  1VQA A;  3DHQ A;  2Z4I A;  2L12 A;  2J7Z A;  4LF9 L;  1Z47 A;  5E4X A;  2CQO A;  1YNJ D;  3RN2 A;  2F0N A;  2IL8 A;  4TSS A;  4DR2 L;  4BXX G;  4K6D A;  1BUV T;  2N55 A;  4FNF A;  4ZYS A;  3IAY A;  4S3S A;  1K3R A;  3EN2 A;  5T1G A;  1D2B A;  1CKM A;  3M9B A;  5J39 A;  2JA6 B;  4LFB L;  4H44 C;  2ENB A;  1SRU A;  2EYL A;  4AYB E;  1RF2 D;  5FLX c;  3J81 i;  2B8G A;  1Y1V B;  2ZT9 C;  1HA6 A;  2X6L A;  1QJO A;  4O1N A;  5FLX L;  2N3S A;  2Q2I A;  3J7Z C;  3V05 A;  2DJF C;  5DEH A;  4LFC Q;  1RIP A;  2FMC A;  4XXE A;  1B50 A;  5IIF A;  4B3T L;  3J81 E;  3HKZ G;  2JYO A;  3A5U A;  2VUM H;  5KNC A;  1NCV A;  1IL8 A;  1EOT A;  4KKS A;  1FYC A;  1STG A;  1V1P A;  5LMU Q;  1LT4 D;  3SDZ A;  3RZD H;  2JJQ A;  1STN A;  3ZYY X;  5M5W H;  4U67 3;  2RSO A;  4FVM A;  3MEF A;  2PNH A;  1Q81 C;  1WI5 A;  2EJM A;  2NN6 H;  1SJE D;  3UDX A;  2PZT A;  1QE6 A;  4HAE A;  2KCT A;  4DV6 Q;  3NE5 B;  3OHX C;  5IYB G;  4C3H G;  1O80 A;  1EEF D;  3RZO B;  5CYU A;  1Y14 B;  1EZ6 A;  5GRO A;  5KEE A;  1EQR A;  3PUY A;  1XXG A;  4HJA A;  1JB3 A;  3HKZ B;  4A3D G;  1PRT B;  4IO9 A;  3HOW B;  4LF7 L;  2EVB A;  3UDI A;  5T1I A;  1Y1W H;  2AWO A;  1GKH A;  1ICW A;  4A3L H;  2Z6K A;  1VQJ A;  1HHV A;  1TS2 A;  4BY7 H;  3J7A 5;  3G6J B;  1J9O A;  2OCE A;  1WYD A;  5CBA E;  3SK5 A;  1LUZ A;  3CAM A;  4OGQ C;  3HOU H;  4APV A;  1B3A A;  1TR5 A;  2HHH L;  2LFN A;  3I7F A;  3W2D A;  1TWA B;  5IGE A;  1MD2 D;  4RGM A;  1DOL A;  1F2Z A;  1YNN C;  3BZD B;  5DM6 3;  4GN5 A;  1BKB A;  3MAQ A;  2PYK A;  1SYB A;  3NHH A;  1SFO H;  5IP7 H;  1K8A C;  5H1S E;  1EOV A;  1D5M C;  1TKW B;  2WKD A;  3NXW A;  1XTD A;  1PLF A;  4DR1 Q;  3HRZ C;  1TQO A;  2YU9 H;  3BDC A;  4DXG A;  5C3E B;  1HXY D;  4A3D B;  2RDG A;  1ASZ A;  2AUJ D;  3NEL A;  3GTL H;  2JA8 B;  2EY6 A;  1STE A;  5ELC A;  3FPU B;  2F4I A;  5EGT A;  2X6G A;  4KN7 C;  1UE5 A;  1O78 A;  4DV0 L;  1X3P A;  5IY0 A;  1YI2 A;  1XTC D;  4WRD A;  1H9M A;  2K6A A;  3FEW X;  4L6T B;  4DF7 A;  2D0O A;  2F0O A;  4X65 Q;  1TWF H;  4QUF A;  1AZQ A;  1SEB D;  3MHB A;  2F0J A;  2MO0 A;  4YCW A;  2NTT A;  4DR5 L;  4UP7 A;  5BR8 L;  1YVC A;  1S3O A;  1PTO B;  1X3E A;  2KCN A;  2Z8L A;  4QIW E;  3TZU A;  1STA A;  2EYJ A;  4P74 A;  5HUR A;  4KHP L;  1PH8 A;  1T9H A;  3NTK A;  4C1N K;  1K73 C;  4FF2 A;  2Q2T A;  1A6X A;  2JEA I;  2JEB I;  1U9R A;  4X64 L;  4XTC S;  4BXX H;  1SAP A;  1T5E A;  2NVY B;  5EPJ A;  2K04 A;  1NJI C;  4DV3 L;  1JCK B;  4XT1 B;  4EQ5 A;  1IBM Q;  1N34 Q;  1HNW L;  1JT8 A;  1ET6 A;  1R4Q B;  1W3S A;  3SEB A;  3M4Y A;  3NWT A;  4DAM A;  4LF5 Q;  3S2H B;  1SR3 A;  1EL0 A;  1YZ6 A;  2F1M A;  3HOZ G;  3OSO A;  2A6H C;  1CSP A;  3MXU A;  3GTO B;  1NTG A;  4WOR A;  5M9O A;  1YHB A;  3G6E A;  1J5E L;  3RLF A;  1B9M A;  3RZO H;  2VQE L;  4OON A;  3HOX B;  1LAB A;  2K75 A;  1JOK A;  3UDF A;  1GXD C;  1S5B D;  2A73 B;  3ZJY C;  2X69 A;  5A35 A;  1VQ9 A;  3VYS A;  4F88 A;  2RDF A;  4KHV A;  4NXM Q;  2PQA A;  2Y0S E;  1UUP A;  1A0I A;  4A3M G;  4OWT B;  2PPB C;  3IL8 A;  1M90 C;  1A2U A;  5HY6 A;  2RDH A;  4RH6 A;  1TU2 B;  5M5X B;  3KBX A;  2E75 C;  2G9D A;  2IHE A;  3M4P A;  3QB3 A;  2QDL A;  1V1O A;  5FLX E;  4B3R L;  2L11 A;  2A6E C;  3CD6 A;  4DV2 Q;  2UXD L;  3KYH C;  4DAY A;  1WOC A;  3M4Q A;  5KIX A;  1FJG L;  3HOZ B;  2CW0 C;  4YCU A;  2K5N A;  4N9P A;  1ML0 D;  2QA4 A;  1H9K A;  1QG7 A;  1DOM A;  3NUC A;  2OTL A;  5IYB H;  4C3H H;  3CRL C;  2B2T A;  3IFD A;  2RQX A;  4YIJ A;  1GHK A;  1IW7 C;  2VB2 X;  2LSS A;  3R8B A;  5EJW A;  3GTM H;  2QDB A;  1N32 Q;  1AP0 A;  2IX0 A;  4A3D H;  4LNQ A;  1JJG A;  3MXN A;  4DUY L;  1SYD A;  2AQ1 B;  4QB4 A;  4LW1 A;  3OPO A;  3S1R B;  4ZRZ A;  3U9S A;  4R9W A;  1JMC A;  1K9M C;  2EXZ A;  4XQJ A;  1D5Z C;  5C0X I;  3Q23 A;  2NYZ D;  1KTK A;  4I65 A;  1IBK Q;  2AQ3 B;  3QR8 A;  3HOV G;  1KLG D;  2QKI C;  4X62 Q;  3FPP A;  4XIG S;  1TWG H;  3FRP B;  3OIQ A;  2JXM B;  4O2D A;  1C8C A;  2E2D C;  1F9P A;  4JI5 Q;  1L1O C;  2L1B A;  4KHZ A;  2Z1C A;  1WCM G;  1ZEQ X;  3KJP A;  1EY9 A;  4PZ6 A;  3S24 A;  1HNZ L;  3A5Z B;  4CJ2 C;  2PMZ E;  3K58 A;  2EYH A;  3I55 A;  1HZB A;  4JI0 Q;  4BWG B;  1X56 A;  5C0X J;  4YHH Q;  4JI6 Q;  1WTP A;  2LS0 1;  3ONA B;  4AQY Q;  4B3M Q;  2F0L A;  4NB3 A;  4NXN L;  3S1N H;  4HSP A;  3S9W A;  2QEJ C;  5KYI A;  4POG A;  5A2Q L;  1KAB A;  2L4N A;  2NVY H;  2BDN A;  3QOJ A;  4JI7 Q;  1QIL A;  3J81 j;  3Q22 A;  1YHQ A;  1SE3 A;  3SK4 A;  4JI1 L;  2WII B;  1JB7 A;  5DAU A;  4HIK A;  1SXT A;  2NVT B;  1EUJ A;  2RKS A;  1E1T A;  2NTS A;  5C0X G;  4JYA L;  3CMA A;  2DNE A;  2PO4 A;  1CSQ A;  2KBN A;  1WCM B;  3WDN A;  4DK6 C;  4MZ9 A;  3PO3 B;  4C3I H;  1EY5 A;  3GTO H;  3V2T A;  1XPR A;  2E5L Q;  3GTP B;  4N8F A;  3Q24 A;  1KRT A;  4GLA C;  2XSC A;  4LF9 Q;  2D0P A;  2P5Z X;  3TZD A;  2HQE A;  1WTX A;  2XRQ D;  1EU4 A;  2R61 A;  2B8F A;  3TQY A;  1XPO A;  2NBF A;  3OOC A;  4Y7N B;  5FKA C;  4FYD A;  1ZYR D;  4OWX B;  4FDB A;  3CCR A;  1ENF A;  3AFP A;  4C56 C;  4X66 L;  2J0T D;  1Q86 C;  3HOZ H;  4JPB W;  1EZ8 A;  1OXV A;  1PFB A;  2NVX B;  3GQB A;  4J8Q A;  4KD3 A;  3CCE A;  4HJ7 A;  2WAQ E;  2QEX A;  3K7A B;  2QGQ A;  4JBW A;  2EQS A;  4B3T Q;  3J7Y W;  4A76 A;  3KDF A;  3A0J A;  1IBL Q;  4B3S L;  3L3O C;  5C4X G;  3VYT A;  2D62 A;  1TVX A;  3GTG B;  2E2J H;  4B9X A;  4A3M H;  2NZ1 D;  4BS9 A;  4CKE A;  1FGB D;  3RNU A;  3S1R H;  2KCC A;  4IPD A;  4K8I A;  1AN8 A;  4IFD I;  2K33 A;  2RHQ B;  1VQL A;  1X3F A;  2ZJR A;  1PH4 A;  4H0L C;  5GAD C;  3S2D B;  1JC7 A;  4MN3 A;  2E74 C;  3J81 c;  3NP8 A;  1Q46 A;  2K50 A;  1NAP A;  1HTP A;  1Y8O B;  1F9Q A;  4DV1 L;  1UNS A;  4JI2 L;  1L2F A;  1RDP D;  1F9S A;  3KLW A;  1UEB A;  4LF7 Q;  2LXJ A;  4DNR B;  4IFD J;  3F1Z A;  2O5I C;  1MJE A;  5I2Y A;  1W6J A;  5KGU A;  5IT9 L;  1H9S A;  2UXB L;  3H91 A;  2A68 D;  4ZQ3 A;  1HH2 P;  2F3I A;  5BN4 A;  1PMR A;  1BCP B;  4KN4 C;  2K28 A;  4PMC A;  1E2W A;  4J15 A;  4K14 A;  2VS1 A;  2HHH Q;  2WKC A;  4IUV A;  2EZV A;  5HGQ A;  4QF4 A;  4NXM L;  4A3G G;  3HOV H;  2B2W C;  4A3J G;  4YWL A;  1N36 L;  5JVG 3;  3BVM A;  4IFD G;  1SDF A;  5KRU A;  3A55 A;  1SNM A;  2NVT H;  1HNX L;  5M3F H;  1B7Y B;  1NMF A;  2DUD A;  4NDX A;  1SYE A;  1JE4 A;  1M8A A;  3K8A A;  4XYQ A;  1M4V A;  4HED A;  2G5D A;  1WCM H;  1SNO A;  2UXC L;  1Z9F A;  4JK1 C;  3PQI A;  4XYO A;  3ULJ A;  2AUK A;  3EIV A;  5JEA J;  2OF1 A;  4P2C B;  3HKZ E;  4IN3 A;  2GA4 B;  5C4J H;  2UUB L;  4HJ9 A;  1I3Q H;  1XX8 A;  3S17 H;  3VR5 A;  3JC6 6;  2PQA B;  4DV0 Q;  2Q2U A;  4HCS A;  1DXM A;  1VMC A;  5KNB A;  5D3D A;  4YY3 Q;  2CCZ A;  4Y7N H;  1N32 L;  2VUM B;  4NW2 A;  4WFN 3;  5EKL A;  3GV6 A;  2M2L A;  4UY8 C;  4A3L G;  2HQL A;  4LF4 Q;  3D3R A;  2NZH A;  4DV4 Q;  3RZD B;  2PZU A;  3MXP A;  1UWV A;  1XPU A;  5M5W B;  4AIM A;  1U0L A;  4DR5 Q;  5JEA G;  4DAY B;  5C0X H;  2KEC A;  1KQS A;  3WWV A;  5BR8 Q;  4G7Z C;  3E9I A;  1YIJ A;  1SNQ A;  1PH5 A;  1IBK L;  3FDT A;  4KHP Q;  2EY1 A;  2SDF A;  4GLV B;  2ZTD A;  4OXP A;  3OMC A;  5IGF A;  3GTG H;  3O13 A;  3CME A;  1DM0 B;  2GVB A;  1SBB B;  3PMF A;  1LM0 A;  1OXU A;  3DM3 A;  2D2C C;  3MVV A;  4DV3 Q;  1HNW Q;  2PCF B;  3MXN B;  2ZJQ A;  3OWE B;  3S16 H;  3CCU A;  4GOP C;  2I46 A;  1SRO A;  3EBE A;  1Y1W B;  3FHW A;  5AJ3 L;  3DM1 A;  4C2M B;  2ZXO A;  1HA5 A;  3WOE A;  4OWW B;  2QCP X;  1VQD A;  2MGS A;  3VYU A;  4HJ5 A;  4BY7 B;  1ROD A;  5C5L A;  5CV4 A;  1RTN A;  5I9P A;  1J5E Q;  4ODG A;  1PH7 A;  2I5H A;  3P75 A;  2VQE Q;  4ABN A;  2K5V A;  2OQK A;  2K5W A;  1D5X C;  3DEP A;  3K6O A;  4JI7 L;  2IT1 A;  2K5Q A;  4BA2 I;  4RCO A;  1SFO B;  5C4X H;  4F87 A;  1SMY C;  2NZO A;  2LY7 A;  3K5M A;  4QL5 A;  3M7N A;  2YU9 B;  1QB5 D;  3UE1 A;  3HZX A;  1AEX A;  3G4S A;  3VR2 A;  4B3R Q;  3GTL B;  2E76 C;  1SE8 A;  2UXD Q;  1FJG Q;  1X3Q A;  3BDO A;  4IUT A;  2XN9 C;  3TEH B;  2WB1 B;  3FVQ A;  3KLS X;  2HDM A;  2R93 G;  3A54 A;  3TP5 A;  5M3M G;  1WD0 A;  2F0U A;  4Q5V A;  4MTK A;  2YTY A;  4FF1 A;  1TWF B;  2A74 C;  3H94 A;  4DUY Q;  4K2K A;  3R93 A;  2MP1 A;  5BN3 A;  3CCJ A;  3Q0A A;  1YHA A;  3PO2 G;  1UE1 A;  2B39 A;  1NNX A;  1EIH A;  5G3L D;  4FF4 A;  1K8O A;  2F4V L;  3QWN A;  1ET9 A;  2RVL A;  4RGN A;  3AYH B;  1PDQ A;  4BA1 I;  1IBL L;  4A3K H;  1MKH A;  4K8J A;  4EQN A;  5EAY A;  1PYS B;  1V43 A;  2RCN A;  2KOL A;  1TXY A;  2ASB A;  4A3G H;  4IPH A;  4KY6 A;  4A3J H;  1PRT C;  5IE8 A;  4IFD H;  5M3M B;  1LO5 D;  3TBI B;  4MTN A;  3R2T A;  1HNZ Q;  1C0A A;  1NMG A;  1YNJ C;  3PGZ A;  4F7X A;  4V19 0;  5ISR A;  2QF7 A;  3MA2 B;  4A3I G;  4XQQ A;  1CQV A;  4A3C G;  3LNN A;  4GKJ L;  1LTR D;  1CHQ D;  1X3G A;  3DWQ A;  4NXN Q;  5JJL A;  1BO0 A;  1L1O A;  3KDF B;  3T1H L;  4G7H C;  2KEN A;  3HP3 A;  2K32 A;  1CKN B;  1F9R A;  3JAM L;  5CV9 A;  1C48 A;  4P75 A;  3BYY B;  1O7I A;  5LMN W;  3A8I E;  1PTO D;  4WJW A;  2F0P A;  1BDO A;  3K57 A;  1EY4 A;  3MC0 B;  3HOY G;  1SND A;  1A8V A;  2F0S A;  3KK7 A;  3R3O A;  1VQ5 A;  4JI1 Q;  2FIN B;  2C35 B;  5LL6 X;  3GO5 A;  4C2M H;  1VQI A;  5IWA L;  5NUC A;  1PA6 A;  4JYA Q;  1IZ6 A;  4GNX C;  5JEA H;  1C9O A;  3BYT B;  1PH1 A;  1FNW A;  2A19 A;  1S5C D;  1R9T B;  1VCI A;  2CH4 A;  2R7D A;  3H15 A;  1UE6 A;  2BOS A;  1YJN A;  4A3I B;  3C46 A;  2VQF L;  1CT1 D;  1AW7 A;  4UHV A;  4C3H B;  3RR5 A;  4MIU A;  4C1N I;  1BVS A;  1ILQ A;  4QMG A;  3GTM B;  1P8L A;  1WTO A;  3J7A V;  3S1M H;  1L0X B;  4EQP A;  1S40 A;  2EE1 A;  3TME A;  1H9S B;  2QW7 A;  2PI2 E;  2DY7 A;  2A69 D;  4Y52 H;  1E7Z A;  1RKN A;  2F0H A;  5KYL A;  4X66 Q;  2RA4 A;  5CR3 A;  3CXC A;  5FLM G;  1VQO A;  3CC4 A;  1JWS D;  1KIX A;  5FO7 B;  1E24 A;  4HMI A;  4ID6 A;  1MSG A;  2IJ0 A;  4R1J A;  4ALP A;  3I4M G;  1K3B C;  3RLN A;  1E1O A;  4IUP A;  1F2Y A;  4YY3 L;  2ID0 A;  2ES2 A;  4B3S Q;  2EYO A;  4IUQ A;  1TWG B;  2LMC B;  4LF4 L;  3J80 c;  4DV4 L;  4LMQ D;  4TVA B;  1B1Z A;  5E1F A;  5LMN L;  3SHL A;  3OIP A;  4DUZ L;  3RN5 A;  1IL2 A;  1RCV D;  3I72 A;  3CPF A;  3J80 L;  1ONL A;  1KL9 A;  4C3I G;  4J6H A;  3D0F A;  1QCB D;  1PXU A;  2HIV A;  1E2Z A;  3P7J A;  1PZI D;  1QUQ A;  3P1H A;  3HGB A;  1K28 A;  1SNP A;  3KJO A;  1LTL A;  2F0W A;  4A3F G;  1BF4 A;  1IHZ A;  4NKL A;  3S1N B;  2H5X A;  4EVO A;  5JPN C;  3I4N G;  1D6E C;  2BA0 A;  2FHT A;  1CKO A;  2ICE C;  1F2L A;  2XTI A;  2ZJP A;  4QGU A;  1XMO L;  3I4M B;  3ERO A;  1G91 A;  4DV1 Q;  2R7F A;  2R93 H;  4NP5 A;  4JI2 Q;  3VDY A;  2LKV A;  1PFS A;  5D14 A;  2HT1 A;  4GZY C;  4DR4 L;  4PQX A;  5M3M H;  2RBM A;  4R4O A;  2OEO A;  1X65 A;  1JOO A;  3LWU A;  1OO9 B;  1KNE A;  1PYB A;  2UXB Q;  4BY1 H;  3PO2 H;  4DAP A;  4C3I B;  1K83 H;  1CA6 A;  4Z9C B;  1B2T A;  4N9T A;  1II3 A;  4G4K A;  1W6K A;  3C1F A;  3FKI H;  4IUN A;  1RHP A;  4A4I A;  3TSS A;  4A75 A;  4H13 C;  1N36 Q;  3H09 A;  4NPS A;  1WTW A;  2ZTE A;  1HNX Q;  2KHI A;  4FO2 A;  4R4I A;  2E2I B;  1K0S A;  3PUZ A;  3U9O A;  4FXK C;  3PV0 A;  4CDC C;  2UXC Q;  4RWS C;  1E0B A;  1CA5 A;  2B3G A;  4RMF A;  3NTH A;  2F0E A;  4UP9 A;  3D4R A;  1R9T H;  4UAI A;  2B2W A;  2H4O A;  5JAV A;  1EY8 A;  1EYC A;  3H6M A;  3I8Z A;  4A3I H;  2TSS A;  2UUB Q;  4IPG A;  4A3C H;  1DD2 A;  3GP7 A;  5EKI A;  3PCO B;  1Y69 U;  4WJ4 A;  1BBU A;  1EU3 A;  3OW2 A;  1VQ8 A;  5CBE E;  2YTX A;  4JOI A;  2NVQ B;  3H0G G;  5BN5 A;  1QVC A;  4AH6 A;  3ICE A;  2XWB B;  2E2J B;  2F0Q A;  5D65 A;  2KED A;  4POF A;  3JAM i;  4A3M B;  3AEV A;  3HOY H;  3K59 A;  4ULL A;  5EBD A;  2F0F A;  2R7Z H;  2K14 A;  2DY8 A;  4H7B A;  5CMD A;  4CHT B;  4RHS A;  4UDU C;  2M9V A;  2SOB A;  3D31 A;  2Q8T A;  1HJP A;  2F0K A;  1OXS C;  1LLR D;  2JA7 G;  3T1Y Q;  1TS5 A;  1CTM A;  1B3Q A;  2YYZ A;  4L5S A;  3JAM E;  2KHS A;  3EJI A;  4KV6 A;  5IOC A;  3TS2 A;  3I70 A;  5M3F G;  1DOK A;  1PHJ A;  4BBS G;  3L7Z C;  1LTB D;  2F0M A;  1S4Z A;  1CI3 M;  2F0D A;  3I2Z A;  3HEJ A;  2EIF A;  2GN5 A;  5EKK A;  3BU2 A;  5AJ3 Q;  3M7G A;  1XNQ L;  4IUR A;  4K0K L;  1FR3 A;  3K5L A;  1HCZ A;  3I4L A;  4FP5 D;  3PIP 3;  3CC2 A;  1IKM A;  1S5D D;  3LX0 A;  5FLM H;  1SN8 A;  3S15 B;  1QZH A;  1WTQ A;  3H3V C;  1HZC A;  3CRK C;  3RUZ A;  2JA7 B;  4R8I A;  4PZ7 A;  1JJ2 A;  4GOP A;  3I4M H;  2BH8 A;  2JSO A;  1V1P B;  5JJK A;  4LF6 Q;  2V4D A;  3HOV B;  1VMP A;  2R6G A;  2NB0 A;  5K5P A;  1KD1 C;  1L0Y B;  4M1U B;  2K5H A;  2KEE A;  4HMJ A;  1KLU D;  1HR0 Q;  2ZTC A;  2ZXR A;  2F0I A;  5EQ0 A;  5M3F B;  2BE5 D;  2WV6 D;  4OX9 Q;  4QY7 A;  4BBS B;  1EWH A;  2TMP A;  1SLJ A;  1QOH A;  3D4D A;  2EYF A;  1PH3 A;  4FXG C;  1LT6 D;  1L1O B;  4K5W A;  3J80 i;  5C4J B;  1BBW A;  1EY6 A;  3ERQ A;  1I3Q B;  4L63 B;  3TP7 A;  2MHV A;  4XDX A;  4A3F H;  3S17 B;  4DV5 L;  1HQR D;  4P72 A;  1NSN S;  4JG2 A;  3I4N H;  1PZK D;  4YWM A;  2E2H H;  3VR6 A;  1JWU D;  1BCP D;  2B29 A;  1R4P B;  4IZ8 A;  4KMU C;  4X3T A;  4HIO A;  2E2I H;  3BG3 A;  4ZUI A;  3J80 E;  3GTQ H;  4PG3 A;  4QJF A;  2DGY A;  2JA5 G;  2JP1 A;  2AMC B;  2YTV A;  4V0B A;  4X3U A;  2XIW A;  3C3L A;  2KHJ A;  4LUZ A;  1O7Z A;  3L9A X;  2UU9 L;  2CHB D;  2F4V Q;  3GV3 A;  3K0X A;  1PVO A;  4U68 A;  4CDD C;  3M4O H;  2NVQ H;  1TY0 A;  3ULP A;  4L5T A;  4DA2 A;  1HFN A;  1K0R A;  1ZXT A;  1WJJ A;  2L9H A;  5TSS A;  4DV7 L;  2R92 G;  1IYV A;  4DU9 A;  4LFA L;  3S16 B;  3OTO L;  3E0E A;  1XYI A;  3BS1 A;  2JQO A;  1I50 B;  2WB1 E;  2KUM A;  1UAP A;  4JCV E;  4KY7 A;  2K4K A;  3AFQ A;  1SYF A;  3MXG A;  2JA5 B;  3AB9 A;  4JBM A;  2OQ0 A;  4ME3 A;  4CJ0 B;  1Q82 C;  4ZKB B;  5COR A;  4LJZ C;  1V9P A;  4GKJ Q;  4CKC A;  3CCL A;  3T1H Q;  5DLQ E;  3K7U C;  5ELD A;  1U4P A;  3E5S A;  1RD9 D;  4NMZ A;  1ZYR C;  3D8G A;  2XVS A;  3C2P A;  3H0G H;  5C4X B;  4MNO A;  5IT9 c;  4DK3 C;  1ZKO A;  1NR2 A;  2R92 B;  2AHO B;  4G57 A;  1B53 A;  4ZLT F;  5IWA Q;  2D9U A;  4PV1 C;  1A3U A;  1QUQ B;  3TS0 A;  5GAH C;  1SYC A;  1I4P A;  2PW5 A;  3BVZ A;  1B8A A;  3S15 H;  1VQC A;  2DJG C;  1QVF A;  2MQH A;  2JA7 H;  4A3K G;  1PYW D;  2CFM A;  5GQO A;  4JI4 L;  1G2S A;  4IQZ A;  3SVM A;  2VQF Q;  1QZG A;  1AFP A;  4ZK9 B;  1NBW A;  2ICI A;  1AE2 A;  2N88 A;  4I7A A;  1FNU A;  3IRB A;  1KNA A;  4GNX A;  1PRT F;  4X3S A;  1XMQ Q;  1LTT D;  1ESR A;  4BBS H;  2PW7 A;  1STY A;  4OIK A;  5CV8 A;  4B9W A;  4DK1 A;  2L55 A;  3PUV A;  3W1G A;  2B63 G;  3NWS A;  1GD7 A;  2K03 A;  2B2U C;  1QVG A;  4EX5 A;  4PMW A;  1I4Q A;  3A56 A;  2JN4 A;  1HR0 W;  2G9H D;  5CC4 A;  1GO3 E;  1U5K A;  4A3K B;  2CH4 W;  1TWH H;  1D1K A;  4X6A H;  3QIA A;  3HKS A;  3D4W A;  4A3G B;  2A68 C;  1H9R A;  1DCZ A;  4A3J B;  5AFW A;  1LTS D;  3T16 A;  5FO9 B;  5LMN Q;  3ND9 A;  4DUZ Q;  5F2D A;  3V96 A;  1B4O A;  1TS3 A;  1WVL A;  1I94 L;  1B44 D;  1CK1 A;  2HCI A;  2VXW A;  2VNU D;  3T1Y L;  1LYL A;  5J1Z A;  1FNV A;  3N6R A;  1VF5 C;  3C1E A;  3DXJ C;  1OTC A;  5A2Q E;  1E22 A;  3TP6 A;  4CGY B;  4DPG A;  3F2B A;  2J4X A;  2QIL A;  3BVG A;  4RHR A;  4JI3 L;  4A93 G;  1N33 Q;  4MHE A;  1Q8I A;  1XMO Q;  3NQI A;  2UUA L;  2NUC A;  2EYM A;  3VYR A;  3NBH A;  5FOB B;  4IAL A;  5FJ8 G;  4ZUJ A;  4HJ8 A;  4DR4 Q;  1IKL A;  2K5D A;  3T13 A;  1GHJ A;  1A2T A;  5IGG A;  4E6I A;  1EQT A;  1I50 H;  4LWC A;  2EJG C;  4JVZ A;  2JA5 H;  5HGT A;  1KDC A;  2VB3 X;  2V1C C;  2WAQ G;  1PTO F;  3CPW A;  1VQN A;  3K5N A;  4I7Z C;  4KTA A;  1Q1B A;  2EY5 A;  1GUT A;  3CCV A;  4O0A A;  2L15 A;  4R8N A;  1JJC B;  3UDG A;  1U4R A;  3UI2 A;  3G48 A;  4LF6 L;  4C3J G;  1TS4 A;  4A93 B;  1MSH A;  1VQH A;  3BZC A;  3T56 B;  1HR0 L;  3MEH A;  3J7A F;  1NR4 A;  1OXX K;  2R92 H;  1QNK A;  1IXR A;  2Z0S A;  4OX9 L;  1CZW A;  1BXT A;  1A63 A;  3URY A;  1XNR L;  1I6V C;  3S1M B;  5LHY 1;  5CV7 A;  1KAW A;  3A7L A;  1AE3 A;  1UEA B;  2JA6 G;  1GUN A;  4ME5 A;  1B9N A;  1EWI A;  1Y1V G;  3S14 H;  1I4H A;  2B2Y C;  1N9W A;  1KDA A;  1G2T A;  5JJI A;  2PZW A;  1TWC B;  3I91 A;  4DXF A;  4C3J B;  1IYJ B;  4KJN A;  4IUU A;  2HD3 A;  1LTI D;  1RTO A;  2MFI A;  2LXK A;  4K2L A;  1BNZ A;  4BY1 G;  1GOZ A;  4OO1 I;  1HTL D;  4HID A;  5M5Y B;  3EQL C;  1QNU A;  4LUV A;  1QWY A;  3PF4 A;  2WIN B;  2RHS B;  1NE3 A;  3NBI A;  2SNS A;  3B6Y A;  3QJY A;  5CV5 A;  2HUG A;  3FKI G;  2WFW A;  1RL2 A;  5DM7 3;  2I5L X;  1JR0 D;  1V8Q A;  4OEM B;  4L8J A;  1CM9 A;  2OT2 A;  2R93 B;  1DYQ A;  2EOT A;  1A62 A;  4GKK L;  5IT9 E;  1Y8N B;  4PZ8 A;  3E3X A;  5JJZ A;  1ESF A;  1XNQ Q;  1Q8K A;  4RG1 A;  4K0K Q;  3CKI B;  3RLO A;  2B63 H;  3A7A B;  3HOW G;  4LF8 Q;  2PI2 A;  1C4Q A;  3DWA A;  3KBG A;  3NEN A;  4OIJ A;  4BY1 B;  3PO2 B;  3JAM c;  5C3W A;  1LAC A;  2ZM6 Q;  1K83 B;  4HN7 A;  4CJ1 B;  1YNN D;  1A3T A;  5IP9 G;  3A8K E;  5KND A;  2B2V C;  1I6H H;  1DZ1 A;  4CKB A;  5FK9 C;  3FKI B;  1X54 A;  4CDF C;  1VDZ A;  4OO1 G;  1CZG A;  1U4L A;  2A8V A;  1PZJ D;  4DR3 L;  2R7Z G;  1HUN A;  3X3N A;  5K36 H;  5ELO A;  2Q8R E;  3IFT A;  4BBR H;  3PUX A;  3SR1 A;  4JV5 L;  5LL6 S;  1GVP A;  3ULL A;  5C3E G;  3DUZ A;  5I6W A;  2HCC A;  1EYA A;  4DR7 L;  3DEO A;  2JA8 G;  5IYD G;  4DV5 Q;  1SE2 A;  4A93 H;  3SXH A;  2ALY B;  1XMQ L;  5EBC A;  3G71 A;  3U58 A;  1N8R C;  5FJ8 H;  4DR6 L;  1VQ7 A;  3K5O A;  3HOY B;  3AU7 A;  3ERS X;  4A3B G;  1VQP A;  2R7Z B;  5J3B A;  1T5X D;  4R4C A;  1ICF B;  2AWN A;  2F0T A;  2O4X A;  4UPA A;  2IX1 A;  1HZ9 A;  1J8I A;  2I07 B;  2MJ8 A;  1STH A;  2OXP A;  1PTO C;  2UU9 Q;  1MI2 A;  3SGI A;  1VQF A;  2FJ2 A;  3KF6 A;  3K80 C;  4JI8 L;  1TWC H;  4GNX B;  3RMH A;  4DN4 M;  1EQV A;  3X3M A;  4C3J H;  3Q8D A;  4DV7 Q;  4HSV A;  1G6Z A;  3STB D;  2XNA C;  5ELF A;  1M1K C;  2F52 A;  1MHW C;  4LFA Q;  3M3Y B;  3OTO Q;  4RKB A;  1HUM A;  2HIX A;  3ER0 A;  5M5Y H;  2A6H D;  2A1A A;  2CVR A;  3N52 A;  2IPK D;  4DNI A;  4A3B B;  1EIY B;  1MGS A;  2RCF A;  2JA6 H;  1LT3 D;  4HTH A;  3CU7 A;  1Y1V H;  1N33 L;  3L0O A;  3KF8 A;  3F2U A;  3W1B A;  3GTK B;  1D8L A;  1B70 B;  1FL0 A;  4F8M A;  2I5M X;  2VL6 A;  1VQE A;  4AYB G;  2A69 C;  1L0W A;  4L5R C;  3T51 B; 
#chains in the Genus database with same CATH homology
 3MFG A;  4DGZ A;  2A6E D;  1EFI D;  2CW0 D;  1WTR A;  4HR7 B;  1F2M A;  3W3A A;  1LT5 D;  1Z7T A;  3DMU A;  1O7L A;  3VR4 A;  1VF7 A;  4A3F B;  3TN2 A;  1IW7 D;  3I4N B;  1OXT A;  2E2H B;  2K05 A;  2HDL A;  1S5E D;  4DFA A;  2F3W A;  3NPP A;  4AYB B;  3GTQ B;  5I2X A;  3HS0 C;  2DN8 A;  1BCP F;  4CBV A;  4RGT A;  1JIC A;  4DNT B;  1GUG A;  1SYG A;  5I9O A;  2H1E A;  2KVM A;  3M4O B;  5E4W C;  2F3V A;  3QO2 A;  1GUO A;  1O7Y A;  3NTI A;  2B2U A;  3GTJ B;  5I4D A;  4EGV A;  1EYD A;  3FMC A;  4RKL A;  3S1Q B;  2L0C A;  4OO1 H;  1XWE A;  3NQT A;  1TII D;  2XWJ B;  5IGD A;  3K0Y A;  3VA7 A;  1G8Z D;  2KQ3 A;  1Z6H A;  4DK0 A;  4TQU S;  1U4M A;  3KUP A;  2K1B A;  5JVH 3;  1A15 A;  1IYU A;  1KDB A;  4XQN A;  3H0G B;  1E2V A;  2BDO A;  2C9O A;  3RD4 A;  5C44 B;  2L5T A;  4M8A A;  5COY A;  1JOR A;  1MBY A;  2O5J C;  5JPM C;  3WOF A;  1EIG A;  5C4Z A;  1G29 1;  2R3Z A;  5J22 A;  3A8J E;  1AZP A;  2KJX A;  5IGB A;  1PTO H;  2IWH A;  4K5V A;  5IGC A;  1HFG A;  3Q6S A;  3M85 A;  1KAA A;  4TKO B;  4RAU C;  1JQY D;  3E0J A;  3MTS A;  2CQA A;  2FFK B;  3CQZ B;  4OL7 A;  3VR3 A;  1BOS A;  1TT2 A;  3AMU A;  4RGO S;  2ZXP A;  4ZKC B;  1LTA D;  4LAA A;  3KLS A;  4HCE A;  1BBX C;  1TWH B;  1BQQ T;  2PQE A;  3QG1 A;  5D3I B;  1DJR D;  4FF3 A;  1CHP D;  3TDQ A;  1JWM D;  1A3V A;  2B2Y A;  1I4X A;  1WD1 A;  1K8M A;  3SK6 A;  4K5X A;  4QIW B;  4Q0F A;  2WP8 J;  2KA7 A;  3EA6 A;  2AQ2 B;  1SE4 A;  5DNF A;  4A3E B;  2BE5 C;  1GUS A;  2Z4H A;  3VA5 A;  1JOQ A;  4TRD A;  2EPB A;  3I3C A;  2EY2 A;  4FXD A;  3TP8 A;  1D1I A;  2K01 A;  3NK9 A;  1TY2 A;  1NUC A;  1Q3L A;  1RJT A;  4X3K A;  1BCP C;  2NWG A;  1WTV A;  1EWC A;  5CGK A;  4G7O C;  4RA8 A;  4KK7 A;  3MZ5 A;  1PFN A;  3LWE A;  2D5D A;  2Y0S B;  2MPM A;  3P20 A;  4PNY A;  4RCN A;  1Q12 A;  1LV9 A;  2EDG A;  5C3X A;  2NN6 I;  3D6W A;  2FMM A;  1GUW A;  4PMB A;  1I4G A;  3J81 L;  2B2V A;  3PIO 3;  3CHB D;  3G7L A;  5I6Y A;  5E3F A;  3MFY A;  1SSO A;  2O2L D;  2K7V A;  3S14 B;  3I73 A;  2F03 A;  3OMG A;  2F0V A;  5ELE A;  1FD7 D;  1EEI D;  2DNC A;  2A5H A;  2WAC A;  1F77 A;  3R2I A;  5ELB A;  3ITP A;  4KKT A;  5EPL A;  3EVQ A;  4RFB A;  1PFM A;  5C4H A;  2BA1 A;  3IKJ A;  2Q8I B;  4KY5 A;  4ILW A;  4J1M A;  4ZAI A;  2F0G A;  2B2T C;  3E6Z X;  1EY7 A;  2NN6 G;  1HRJ A;  5IOD A;  3SK8 A;  5G3L F;  5K36 G;  1SNC A;  1DON A;  2BCO A;  1Y8P B;  1ENC A;  3T53 B;  2PMZ B;  1ILP A;  3DWP A;  1HQM C;  2B63 B;  1SJH D;  2SEB D;  5EPK A;  3T4A C;  1LTG D;  4KKU A;  4KD4 A;  1Q90 A;  3KLR A;  3MWY W;  2MUY A;  5C5M A;  1I4R A;  4EQO A;  1Q1E A;  3EFX D;  1I6H B;  4XT3 B;  1SMY D;  4DAV A;  3D6C A;  4QCL A;  2RSN A;  1CQF A;  4O42 A;  2M00 A;  5JOB A;  4BBR B;  5FO8 B;  3SE0 A;  2JE6 I;  4QUC A;  1ENA A;  1EY0 A;  2PNR C;  3I90 A;  2IW3 A;  3ND8 A;  5C6A A;  1GJX A;  1CFM A;  3QOL A;  4LK1 C;  1X32 A;  3OW7 A;  2EJF C;  4K6L A;  3BDL A;  1S5F D;  4KJO A;  1BR9 A;  3HOU B;  4OHJ A;  2C5C A;  1STB A;  3PUW A;  2SNM A;  2XRS D;  1H9J A;  1HPC A;  3HG9 A;  4KI0 A;  3GD7 A;  2EYP A;  2WAQ B;  3OWF A;  2IX3 A;  4B08 A;  5CV6 A;  3NSW A;  1PRT D;  3DHQ A;  2Z4I A;  2L12 A;  2J7Z A;  1Z47 A;  5E4X A;  1YNJ D;  2F0N A;  2IL8 A;  4TSS A;  4K6D A;  1BUV T;  2N55 A;  4FNF A;  4ZYS A;  3IAY A;  4S3S A;  5T1G A;  1D2B A;  5J39 A;  2JA6 B;  4H44 C;  2ENB A;  2EYL A;  1RF2 D;  2B8G A;  1Y1V B;  2ZT9 C;  1HA6 A;  2X6L A;  4O1N A;  1QJO A;  5FLX L;  3V05 A;  5DEH A;  2FMC A;  4XXE A;  1B50 A;  5IIF A;  3J81 E;  2JYO A;  5KNC A;  1NCV A;  1IL8 A;  1EOT A;  4KKS A;  1FYC A;  1STG A;  1V1P A;  1LT4 D;  3SDZ A;  1STN A;  3ZYY X;  4U67 3;  2RSO A;  4FVM A;  2EJM A;  2NN6 H;  1SJE D;  2PZT A;  1QE6 A;  4HAE A;  3NE5 B;  3OHX C;  4C3H G;  1O80 A;  1EEF D;  3RZO B;  5CYU A;  1EZ6 A;  5KEE A;  3PUY A;  1XXG A;  1JB3 A;  3HKZ B;  1PRT B;  3HOW B;  2EVB A;  5T1I A;  2AWO A;  1ICW A;  1HHV A;  1TS2 A;  3G6J B;  1J9O A;  5CBA E;  3SK5 A;  4OGQ C;  1B3A A;  1TR5 A;  2LFN A;  5IGE A;  3W2D A;  1TWA B;  1MD2 D;  4RGM A;  1DOL A;  1F2Z A;  1YNN C;  3BZD B;  5DM6 3;  3MAQ A;  2PYK A;  1SYB A;  3NHH A;  1D5M C;  1TKW B;  2WKD A;  3NXW A;  1PLF A;  3HRZ C;  1TQO A;  3BDC A;  4DXG A;  5C3E B;  1HXY D;  4A3D B;  2RDG A;  2AUJ D;  2JA8 B;  2EY6 A;  1STE A;  5ELC A;  3FPU B;  2F4I A;  5EGT A;  2X6G A;  4KN7 C;  1O78 A;  1X3P A;  1XTC D;  4WRD A;  1H9M A;  2K6A A;  3FEW X;  4L6T B;  4DF7 A;  2F0O A;  4QUF A;  1AZQ A;  1SEB D;  3MHB A;  2F0J A;  2NTT A;  1PTO B;  2KCN A;  2Z8L A;  3TZU A;  1STA A;  2EYJ A;  5HUR A;  3NTK A;  4C1N K;  4FF2 A;  1A6X A;  2JEA I;  2JEB I;  1U9R A;  4XTC S;  1SAP A;  1T5E A;  2NVY B;  5EPJ A;  2K04 A;  1JCK B;  4XT1 B;  1ET6 A;  1R4Q B;  3SEB A;  3M4Y A;  3NWT A;  3S2H B;  1EL0 A;  2F1M A;  3OSO A;  2A6H C;  3MXU A;  3GTO B;  4WOR A;  5M9O A;  3RLF A;  1B9M A;  3HOX B;  1LAB A;  1JOK A;  1GXD C;  1S5B D;  2A73 B;  5A35 A;  2X69 A;  3VYS A;  4F88 A;  2RDF A;  4KHV A;  1UUP A;  2PPB C;  3IL8 A;  1A2U A;  2RDH A;  4RH6 A;  1TU2 B;  5M5X B;  3KBX A;  2E75 C;  2G9D A;  3QB3 A;  1V1O A;  5FLX E;  2L11 A;  2A6E C;  4DAY A;  5KIX A;  3HOZ B;  2CW0 C;  4N9P A;  1ML0 D;  1H9K A;  1QG7 A;  1DOM A;  3NUC A;  3CRL C;  2B2T A;  3IFD A;  2RQX A;  4YIJ A;  1GHK A;  1IW7 C;  2VB2 X;  3R8B A;  5EJW A;  2QDB A;  1AP0 A;  2IX0 A;  3MXN A;  1SYD A;  2AQ1 B;  4QB4 A;  3OPO A;  3S1R B;  4ZRZ A;  3U9S A;  4R9W A;  2EXZ A;  4XQJ A;  1D5Z C;  5C0X I;  3Q23 A;  2NYZ D;  1KTK A;  4I65 A;  2AQ3 B;  1KLG D;  2QKI C;  3FPP A;  4XIG S;  3FRP B;  3OIQ A;  2JXM B;  1C8C A;  2E2D C;  1F9P A;  2L1B A;  4KHZ A;  2Z1C A;  1ZEQ X;  1EY9 A;  4CJ2 C;  3K58 A;  2EYH A;  4BWG B;  5C0X J;  1WTP A;  2LS0 1;  3ONA B;  2F0L A;  4HSP A;  3S9W A;  2QEJ C;  5KYI A;  5A2Q L;  1KAB A;  2L4N A;  3QOJ A;  2BDN A;  1QIL A;  3Q22 A;  1SE3 A;  3SK4 A;  2WII B;  5DAU A;  1SXT A;  2NVT B;  2RKS A;  2NTS A;  5C0X G;  2DNE A;  2PO4 A;  1WCM B;  3WDN A;  3PO3 B;  1EY5 A;  3V2T A;  3GTP B;  3Q24 A;  2XSC A;  3TZD A;  2HQE A;  1WTX A;  2XRQ D;  1EU4 A;  2R61 A;  2B8F A;  2NBF A;  3OOC A;  4Y7N B;  5FKA C;  4FYD A;  1ZYR D;  1ENF A;  4C56 C;  2J0T D;  1EZ8 A;  1OXV A;  1PFB A;  2NVX B;  3GQB A;  4J8Q A;  4KD3 A;  3K7A B;  4JBW A;  3J7Y W;  3L3O C;  3VYT A;  2D62 A;  1TVX A;  3GTG B;  4B9X A;  2NZ1 D;  4BS9 A;  4CKE A;  1FGB D;  2KCC A;  4K8I A;  1AN8 A;  4IFD I;  2K33 A;  4H0L C;  3S2D B;  1JC7 A;  4MN3 A;  2E74 C;  3NP8 A;  1NAP A;  1HTP A;  1Y8O B;  1F9Q A;  1UNS A;  1RDP D;  1F9S A;  4DNR B;  4IFD J;  2O5I C;  5I2Y A;  1W6J A;  5KGU A;  5IT9 L;  1H9S A;  3H91 A;  2A68 D;  4ZQ3 A;  5BN4 A;  1PMR A;  1BCP B;  4KN4 C;  2K28 A;  4PMC A;  1E2W A;  4K14 A;  2WKC A;  4IUV A;  2EZV A;  4QF4 A;  2B2W C;  5JVG 3;  3BVM A;  4IFD G;  1SDF A;  5KRU A;  3A55 A;  1SNM A;  4NDX A;  1SYE A;  1JE4 A;  1M8A A;  4XYQ A;  1M4V A;  4HED A;  1SNO A;  4JK1 C;  4XYO A;  2AUK A;  5JEA J;  2OF1 A;  4P2C B;  4IN3 A;  2GA4 B;  1XX8 A;  3VR5 A;  4HCS A;  1DXM A;  1VMC A;  5KNB A;  5D3D A;  2VUM B;  4NW2 A;  4WFN 3;  5EKL A;  3GV6 A;  2M2L A;  3D3R A;  3RZD B;  2PZU A;  3MXP A;  5M5W B;  5JEA G;  5C0X H;  2KEC A;  4G7Z C;  1SNQ A;  3FDT A;  2EY1 A;  2SDF A;  3OMC A;  5IGF A;  3O13 A;  1DM0 B;  1SBB B;  3PMF A;  1OXU A;  2D2C C;  3MVV A;  2PCF B;  3OWE B;  2I46 A;  1Y1W B;  3DM1 A;  4C2M B;  2ZXO A;  1HA5 A;  3WOE A;  2QCP X;  2MGS A;  3VYU A;  4BY7 B;  1ROD A;  5C5L A;  5CV4 A;  1RTN A;  5I9P A;  4ODG A;  3P75 A;  4ABN A;  2K5W A;  1D5X C;  3DEP A;  3K6O A;  2IT1 A;  2K5Q A;  4BA2 I;  4RCO A;  1SFO B;  4F87 A;  1SMY C;  2LY7 A;  3K5M A;  3M7N A;  2YU9 B;  1QB5 D;  3HZX A;  1AEX A;  3VR2 A;  3GTL B;  2E76 C;  1X3Q A;  3BDO A;  4IUT A;  2XN9 C;  2WB1 B;  3FVQ A;  3KLS X;  2HDM A;  3A54 A;  3TP5 A;  1WD0 A;  2F0U A;  4Q5V A;  4FF1 A;  1TWF B;  2A74 C;  3H94 A;  4K2K A;  3R93 A;  2MP1 A;  5BN3 A;  3Q0A A;  2B39 A;  1EIH A;  5G3L D;  4FF4 A;  1K8O A;  3QWN A;  1ET9 A;  2RVL A;  4RGN A;  1PDQ A;  4BA1 I;  4K8J A;  4EQN A;  1V43 A;  2KOL A;  4KY6 A;  1PRT C;  4IFD H;  5M3M B;  1LO5 D;  3TBI B;  3R2T A;  1YNJ C;  4F7X A;  4V19 0;  5ISR A;  2QF7 A;  3MA2 B;  4XQQ A;  1CQV A;  3LNN A;  1LTR D;  1CHQ D;  3DWQ A;  1BO0 A;  4G7H C;  3HP3 A;  2K32 A;  1F9R A;  3JAM L;  5CV9 A;  1C48 A;  3BYY B;  3A8I E;  1PTO D;  4WJW A;  2F0P A;  1BDO A;  3K57 A;  1EY4 A;  3MC0 B;  1SND A;  2F0S A;  3KK7 A;  3R3O A;  2FIN B;  5LL6 X;  3GO5 A;  5NUC A;  5JEA H;  3BYT B;  1FNW A;  1S5C D;  1R9T B;  1VCI A;  2BOS A;  4A3I B;  3C46 A;  1CT1 D;  1AW7 A;  4C3H B;  4MIU A;  4C1N I;  1ILQ A;  4QMG A;  3GTM B;  1WTO A;  3J7A V;  4EQP A;  1L0X B;  2EE1 A;  3TME A;  1H9S B;  2DY7 A;  2A69 D;  2F0H A;  1RKN A;  5KYL A;  2RA4 A;  5CR3 A;  1JWS D;  5FO7 B;  4HMI A;  4ID6 A;  1MSG A;  2IJ0 A;  4IUP A;  1F2Y A;  2ID0 A;  2EYO A;  4IUQ A;  1TWG B;  2LMC B;  4LMQ D;  1B1Z A;  5E1F A;  3SHL A;  3OIP A;  1RCV D;  3I72 A;  3J80 L;  1ONL A;  4C3I G;  4J6H A;  1QCB D;  1PXU A;  1E2Z A;  3P7J A;  1PZI D;  3P1H A;  3HGB A;  1SNP A;  2F0W A;  1BF4 A;  1IHZ A;  4NKL A;  3S1N B;  5JPN C;  4EVO A;  1D6E C;  2BA0 A;  2FHT A;  2ICE C;  1F2L A;  3I4M B;  1G91 A;  3ERO A;  4NP5 A;  4GZY C;  2LKV A;  5D14 A;  4PQX A;  2RBM A;  2OEO A;  1JOO A;  3LWU A;  1OO9 B;  1KNE A;  4DAP A;  4C3I B;  1CA6 A;  4Z9C B;  1B2T A;  4N9T A;  1II3 A;  4G4K A;  1W6K A;  3C1F A;  4IUN A;  1RHP A;  3TSS A;  4H13 C;  3H09 A;  1WTW A;  4FO2 A;  2E2I B;  3PUZ A;  3U9O A;  4FXK C;  3PV0 A;  4RWS C;  1E0B A;  1CA5 A;  3NTH A;  2F0E A;  3D4R A;  4UAI A;  2B2W A;  2H4O A;  5JAV A;  1EY8 A;  1EYC A;  3H6M A;  3I8Z A;  2TSS A;  1DD2 A;  3GP7 A;  5EKI A;  1Y69 U;  1EU3 A;  5CBE E;  2NVQ B;  5BN5 A;  2XWB B;  2E2J B;  2F0Q A;  5D65 A;  2KED A;  4A3M B;  3K59 A;  4ULL A;  5EBD A;  2F0F A;  4H7B A;  5CMD A;  2DY8 A;  4CHT B;  4RHS A;  4UDU C;  2M9V A;  2SOB A;  3D31 A;  2Q8T A;  2F0K A;  1OXS C;  1LLR D;  1TS5 A;  1CTM A;  2YYZ A;  3JAM E;  2KHS A;  3EJI A;  4KV6 A;  5IOC A;  3I70 A;  1DOK A;  3L7Z C;  1LTB D;  2F0M A;  1S4Z A;  1CI3 M;  2F0D A;  3HEJ A;  5EKK A;  3M7G A;  4IUR A;  1FR3 A;  3K5L A;  1HCZ A;  3I4L A;  4FP5 D;  3PIP 3;  1IKM A;  1S5D D;  3LX0 A;  3S15 B;  1WTQ A;  3H3V C;  3CRK C;  3RUZ A;  2JA7 B;  4R8I A;  2JSO A;  1V1P B;  2V4D A;  3HOV B;  1VMP A;  2R6G A;  2NB0 A;  5K5P A;  1L0Y B;  4M1U B;  2KEE A;  4HMJ A;  1KLU D;  2ZXR A;  2F0I A;  5EQ0 A;  5M3F B;  2BE5 D;  2WV6 D;  4BBS B;  1EWH A;  2TMP A;  1QOH A;  3D4D A;  2EYF A;  4FXG C;  1LT6 D;  4K5W A;  5C4J B;  1EY6 A;  3ERQ A;  1I3Q B;  4L63 B;  3TP7 A;  2MHV A;  4XDX A;  3S17 B;  1HQR D;  1NSN S;  1PZK D;  3VR6 A;  1JWU D;  1BCP D;  1R4P B;  4IZ8 A;  4KMU C;  4X3T A;  3BG3 A;  4ZUI A;  3J80 E;  2JP1 A;  4V0B A;  4X3U A;  2XIW A;  3C3L A;  1O7Z A;  3L9A X;  2CHB D;  3GV3 A;  4U68 A;  1TY0 A;  4DA2 A;  1HFN A;  1ZXT A;  2L9H A;  5TSS A;  1IYV A;  4DU9 A;  3S16 B;  1XYI A;  3BS1 A;  1I50 B;  2KUM A;  1UAP A;  4KY7 A;  1SYF A;  3MXG A;  2JA5 B;  3AB9 A;  4CJ0 B;  4ZKB B;  5COR A;  4LJZ C;  4CKC A;  5ELD A;  1U4P A;  3E5S A;  1RD9 D;  4NMZ A;  1ZYR C;  3D8G A;  2XVS A;  3C2P A;  5C4X B;  1ZKO A;  1NR2 A;  2R92 B;  4G57 A;  1B53 A;  4ZLT F;  2D9U A;  4PV1 C;  1A3U A;  1SYC A;  1I4P A;  2PW5 A;  3BVZ A;  1PYW D;  1G2S A;  4IQZ A;  3SVM A;  1AFP A;  4ZK9 B;  2ICI A;  2N88 A;  1FNU A;  1KNA A;  1PRT F;  4X3S A;  1LTT D;  1ESR A;  2PW7 A;  1STY A;  4OIK A;  5CV8 A;  4B9W A;  4DK1 A;  2L55 A;  3PUV A;  3NWS A;  2K03 A;  2B2U C;  4PMW A;  1I4Q A;  3A56 A;  2G9H D;  5CC4 A;  4A3K B;  1D1K A;  3QIA A;  3D4W A;  4A3G B;  2A68 C;  1H9R A;  1DCZ A;  4A3J B;  5AFW A;  1LTS D;  3T16 A;  5FO9 B;  3ND9 A;  5F2D A;  3V96 A;  1B4O A;  1TS3 A;  1WVL A;  1B44 D;  1CK1 A;  2HCI A;  2VXW A;  2VNU D;  5J1Z A;  1FNV A;  3N6R A;  1VF5 C;  3C1E A;  3DXJ C;  5A2Q E;  3TP6 A;  4CGY B;  2J4X A;  2QIL A;  3BVG A;  4RHR A;  4MHE A;  1Q8I A;  3NQI A;  2NUC A;  2EYM A;  3VYR A;  3NBH A;  5FOB B;  4IAL A;  4ZUJ A;  1IKL A;  2K5D A;  3T13 A;  1GHJ A;  1A2T A;  5IGG A;  4E6I A;  1EQT A;  2EJG C;  5HGT A;  1KDC A;  2VB3 X;  1PTO F;  3K5N A;  4I7Z C;  4KTA A;  1Q1B A;  2EY5 A;  1GUT A;  4R8N A;  1U4R A;  3UI2 A;  4C3J G;  1TS4 A;  4A93 B;  1MSH A;  3T56 B;  3MEH A;  3J7A F;  1NR4 A;  1OXX K;  1QNK A;  1CZW A;  1BXT A;  3URY A;  1I6V C;  3S1M B;  5LHY 1;  5CV7 A;  3A7L A;  1UEA B;  1GUN A;  4ME5 A;  1B9N A;  1I4H A;  2B2Y C;  1KDA A;  1G2T A;  2PZW A;  1TWC B;  3I91 A;  4DXF A;  4C3J B;  4KJN A;  4IUU A;  1LTI D;  1RTO A;  4K2L A;  1BNZ A;  1GOZ A;  4OO1 I;  1HTL D;  5M5Y B;  3EQL C;  1QNU A;  1QWY A;  2WIN B;  3NBI A;  2SNS A;  3QJY A;  5CV5 A;  2HUG A;  5DM7 3;  1JR0 D;  1V8Q A;  4L8J A;  1CM9 A;  2OT2 A;  2R93 B;  1DYQ A;  2EOT A;  5IT9 E;  1Y8N B;  5JJZ A;  1ESF A;  3CKI B;  3A7A B;  1C4Q A;  3DWA A;  3KBG A;  4OIJ A;  4BY1 B;  3PO2 B;  5C3W A;  1LAC A;  1K83 B;  4HN7 A;  4CJ1 B;  1YNN D;  1A3T A;  3A8K E;  5KND A;  2B2V C;  1DZ1 A;  4CKB A;  5FK9 C;  3FKI B;  1VDZ A;  4OO1 G;  1CZG A;  1U4L A;  1PZJ D;  1HUN A;  3X3N A;  5K36 H;  2Q8R E;  3IFT A;  3PUX A;  3SR1 A;  5LL6 S;  3DUZ A;  5I6W A;  2HCC A;  1EYA A;  3DEO A;  1SE2 A;  3SXH A;  5EBC A;  3K5O A;  3HOY B;  3AU7 A;  2R7Z B;  1T5X D;  2AWN A;  2O4X A;  2F0T A;  2IX1 A;  1J8I A;  2I07 B;  2MJ8 A;  1STH A;  2OXP A;  1PTO C;  1MI2 A;  2FJ2 A;  3RMH A;  4DN4 M;  1EQV A;  3X3M A;  4HSV A;  1G6Z A;  2XNA C;  5ELF A;  3M3Y B;  4RKB A;  1HUM A;  2A6H D;  2CVR A;  3N52 A;  2IPK D;  4A3B B;  1MGS A;  1LT3 D;  4HTH A;  3CU7 A;  3KF8 A;  3F2U A;  3GTK B;  4F8M A;  2A69 C;  3T51 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...