1STGA

Two distinctly different metal binding modes are seen in x-ray crystal structures of staphylococcal nuclease-cobalt(ii)-nucleotide complexes
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
136
structure length
136
Chain Sequence
KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOCOCCAL NUCLEASE
publication title X-ray crystal structures of staphylococcal nuclease complexed with the competitive inhibitor cobalt(II) and nucleotide.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase(phosphoric diester)
total genus 38
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 1994-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1stgA00
1II3A 3SHLA 5HURA 5CV4A 2F0VA 3OSOA 5KYLA 1EY4A 3QOJA 4YIJA 4NKLA 2F0GA 3SK6A 5HGTA 5IGGA 4IZ8A 2RBMA 3SXHA 1NUCA 2LKVA 5CGKA 3MHBA 5IGFA 2M00A 1JORA 4J1MA 4KTAA 3TP8A 3BDCA 4F8MA 1A3VA 1SNMA 4K5WA 3RUZA 4OL7A 2EYPA 4NP5A 3TP7A 1JOQA 1SNDA 3BDLA 1ENAA 1EZ6A 3OMCA 2EY1A 4NDXA 3NK9A 4G57A 1EY0A 2EXZA 2OXPA 2F0KA 1EZ8A 4RKBA 1A2TA 2PZTA 5CV6A 3OWFA 4N9TA 1EYAA 4B9XA 3QB3A 4H7BA 4NMZA 5JAVA 2EY2A 1EY7A 3OMGA 5C4HA 4DF7A 5KIXA 5J1ZA 4DGZA 4RKLA 1STAA 2NUCA 2F0NA 5C3WA 3HEJA 2PYKA 2F0JA 5F2DA 4ID6A 4I65A 1EY8A 2F3WA 3T16A 4N9PA 5M9OA 5IIFA 4WRDA 5IOCA 4EVOA 2SNSA 3TP5A 4WORA 4PMCA 4EQOA 1IHZA 2F0DA 1ENCA 1EYDA 4IUNA 4ODGA 4K2KA 3TP6A 4KY6A 4KY7A 5EKLA 2EYJA 4DFAA 2F0MA 3D4DA 3ITPA 3C1EA 4PMBA 2PZUA 3SK8A 5IODA 1STBA 5CV7A 3SK5A 2EYMA 1EY5A 1STNA 3P1HA 3R3OA 4K5XA 1NSNS 1TT2A 5C5MA 3SR1A 3D4WA 5C5LA 5KRUA 3NUCA 4K8JA 4QB4A 5I6YA 2SNMA 3EJIA 5CC4A 2F0LA 2EYLA 3PMFA 3MVVA 4ME5A 5DAUA 3U9OA 2PQEA 3HZXA 2F0OA 1KABA 1EY9A 1STYA 3NXWA 1SYGA 2F0PA 1KDAA 3LX0A 2F0EA 2PW5A 4EQPA 3S9WA 1SNOA 1A2UA 3ERQA 2PW7A 5IGEA 5C4ZA 3DMUA 3H6MA 4K6DA 2QDBA 4KV6A 2OF1A 1STGA 4B9WA 5KGUA 3NHHA 4F7XA 1SNQA 2OEOA 4TRDA 2KQ3A 2EY6A 2F0FA 1JOKA 4KJOA 5I6WA 5CR3A 4K8IA 1SYFA 2EYFA 2PZWA 3DHQA 4HMIA 5IGBA 1SYDA 1SYBA 4HMJA 5EKKA 3TMEA 1KAAA 2F3VA 2RDFA 2EYHA 3C1FA 4K14A 4ZUJA 5JOBA 5J22A 4ZQ3A 3NQTA 1F2MA 2EY5A 2WACA 2O4XA 4K2LA 5CV8A 3SK4A 3D8GA 5E1FA 1EY6A 4DU9A 5IGCA 1RKNA 1SNPA 4PNYA 3E5SA 5CV5A 5EGTA 3MXPA 3P75A 1EQVA 4KHVA 1TQOA 4KJNA 3VA5A 5J39A 1F2YA 2F0TA 4HTHA 4KY5A 5K5PA 3D6CA 4R8NA 2F0IA 5IGDA 5DEHA 5I9PA 2KHSA 2F0HA 1SYEA 4ZUIA 5C3XA 2F0SA 3EROA 1SNCA 5ISRA 1AEXA 5CV9A 5C6AA 1EYCA 2F0WA 5KYIA 5NUCA 1A3TA 2ENBA 1SYCA 4QMGA 4J6HA 4MIUA 4K5VA 4S3SA 3MZ5A 3V2TA 3EVQA 5I9OA 2RKSA 3NP8A 5E3FA 1KDBA 3MEHA 4EQNA 2HQEA 5KEEA 4KD4A 4KD3A 2SOBA 2F0UA 3T13A 4IALA 1STHA 1A3UA 4QF4A 2EYOA 1TR5A 1JOOA 4E6IA 1KDCA 2F0QA 1F2ZA 3QOLA 1U9RA 4LAAA
chains in the Genus database with same CATH superfamily
1JWUD 3FKIB 4RH6A 5FLMH 2NN6G 2N49A 1V8QA 3CF5A 3T56B 2BA0A 3TQYA 3PIP3 5EPJA 2I46A 1S5FD 1KD1C 4BBRB 1I3QH 4IQZA 3A8KE 1EYGA 3C2PA 2ZM6L 3JAME 4CJ2C 1JOQA 3C3LA 2UXDQ 3BYYB 1B53A 2B2WA 2JN4A 3LWUA 3M4QA 3ZYYX 2CCZA 1I4GA 4N9TA 4EQ5A 1UEBA 1SE8A 4POFA 4A93B 2PI2E 1I50B 5KIXA 1LTID 4A3DB 2V4DA 1H9RA 3E9IA 3E6ZX 2E2IB 3GTLH 2JA8B 1HCZA 5IYDH 1E1TA 4ODGA 4R4QA 3BJUA 5IT9L 5IODA 1N9WA 3LGJA 4DAPA 5CV7A 3BZDB 1EY5A 1DGSA 3NUCA 4X64L 4QB4A 2R92G 2XGTA 1W6JA 2HDLA 3K0XA 5C44G 1JB3A 3R2IA 3EN2A 4RFBA 4CJ1B 4GOPC 2R93G 2X6GA 1NR2A 1S5BD 1G6PA 4HJAA 1BKBA 2Y0SB 5CR3A 3CCLA 2Y0SE 3KDFA 4KHZA 5EKKA 2J4XA 5COYA 4A3EH 4FF3A 1EOTA 4LJZC 2KCTA 2F52A 1GUOA 2AQ1B 4JC0A 3EBEA 1AZQA 4IUQA 3M3YH 2WAQG 2NVYH 1SNCA 1U4PA 1RIPA 2F0WA 1TY2A 3OYYA 4A3GH 1T5EA 1SRUA 4OO1G 4KHPQ 4DR5L 2A6HC 1HNWQ 2CW0C 2EYOA 2KJXA 3VYTA 2K5NA 1O80A 3NBHA 4JCVE 2R6GA 2JEAI 3SDZA 4JYAL 1QVGA 1BBXC 1UAPA 1OTCA 4KTAA 1SNMA 4K5WA 2ZTEA 2OQKA 4DV0Q 4GZYC 3D0FA 1Y1WH 1ENAA 1EZ6A 3OMCA 3I72A 2VL6A 3QB3A 5IWAL 4BBSG 1PYBA 1ILPA 4YWMA 2G9DA 1GUNA 3CQZH 4JOIA 2B2UC 1DZ1A 1PV4A 3AU7A 1L1OA 1WFQA 3CCEA 4PZ7A 1XNRQ 1VF5C 4B3SQ 4L8JA 1OO9B 1HNZQ 1HFGA 1K83B 1BNZA 5BR8Q 3RR5A 2F0DA 3PUYA 1PTOH 1SN8A 4KY7A 1OXTA 3NSWA 4DV0L 4UP8A 4BY7G 1LT3D 1N34Q 4YCVA 3K5LA 1TT2A 1OXUA 2Z6KC 5IP9H 2B63G 4DR2L 4A3FH 2VQFQ 5I6YA 2VY3A 4N8FA 3BVZA 2F0LA 2IX3A 1SE2A 1JWMD 2HCIA 3DMUA 3H6MA 1QB5D 1TWGH 2LY7A 4CHTB 3AEVA 3GTOH 4X6AH 1XNRL 2A8VA 2OEOA 3R2TA 2G5DA 1B44D 4IPHA 1HNZL 5C3EH 1CTMA 3H91A 1YJWA 5BR8L 3NBIA 1PXUA 1QUQA 2L0CA 3OWEB 4IN3A 1RHPA 2DY7A 3IKJA 4OGQC 3N6RA 4BA2I 1Q81C 2AUJD 3D8GA 2KEDA 3SE0A 1WTOA 4ZKCB 2V1CC 2VQFL 2A74C 4UY8C 3I4MB 3PO2G 3HRZC 2ICIA 5IYBG 4H0LC 1HFNA 5FKAC 2A5HA 2XWJB 2E5LQ 4QJFA 5C3XA 4ZUIA 5ISRA 2R7DA 1B1ZA 4QMGA 2NVXB 3NTKA 3K7AB 4KKSA 1Q46A 1KDBA 4JPBW 1JE4A 4KD3A 4P75A 3PUWA 1PYWD 1STHA 4GNXC 3PF5A 2ZTDA 1K3BC 1QG7A 4KN4C 3J80i 3SHLA 2K01A 2XVSA 3SK6A 4G4KA 3PO3B 4PV1C 1AW7A 1YIJA 2M00A 3UDGA 4R1JA 2E5LL 3P20A 4NP5A 4G57A 1ILQA 4C3IB 3HOVG 5IT9E 2EXZA 5AFWA 3BU2A 3CHBD 5CV6A 1PVOA 2BDNA 2KCMA 1PDQA 1VQKA 3OMGA 3RD4A 1B2TA 5C4HA 2OTJA 4DGZA 1JQYD 2RHSB 2MJ8A 3STBC 1BCPF 3CXCA 2VUMH 4ID6A 5GAEC 2Z4IA 1L0XB 4WRDA 3FMCA 4EVOA 2CHBD 1VQJA 4TQUS 3EFXD 1E2ZA 3FPUB 3D4DA 2PZUA 1YI2A 4LFCQ 3PUXA 2ZTCA 1NMFA 1ICFB 1MSGA 3CRLC 4GN5A 3GTQB 5DAUA 3MVVA 4AH6A 1HH2P 3OW7A 2F0OA 2MHVA 3NXWA 3S9WA 4KI0A 1IYJB 3RLFA 4X65L 4OHJA 1LYLA 4CDCC 4LWCA 3NWSA 2FINB 1Y69U 2Z4HA 1KXLA 5LMNW 1CSQA 1SYBA 3I56A 3HOZB 1J6QA 1RDPD 2B29A 1E2VA 4KMUC 1VQ8A 4LFCL 1Q3LA 1RTOA 3RNUA 2B2TC 3G7LA 1RTNA 1B3QA 2K5VA 4GKKL 5A2QL 5C4XH 2JA5G 2JE6I 4DV7Q 4J6HA 3LNNA 1ASZA 4EQNA 2A69C 1A6XA 1EIGA 1UUPA 3UE1A 3J7AF 2K28A 4V190 2R92B 3GP7A 4RG1A 1F2LA 2O2LD 1X3EA 1C0AA 2I5LX 1EIHA 5C44B 1NMGA 1NUCA 2CW0D 5CGKA 3I4NG 1D8LA 1CT1D 4OXPA 4LUVA 4HAEA 1Q1BA 1VQ4A 4OWWB 4DUZL 1WVLA 5M5XB 1J5EL 1BCPB 2J7ZA 4AQYL 4DV7L 5M3MH 2EVBA 2H1EA 3OWFA 1FJGQ 4GLVB 3T51B 4JBJA 1IW7C 3T1YQ 2UUAQ 3KJOA 1EFWA 1JICA 3TS2A 2HCCA 4M1UB 1SFOH 1VQAA 4R9WA 4ALPA 2D62A 3VYUA 3VR2A 4IO9A 1YNJC 1QNUA 4G7ZC 2WAQB 2CVRA 4I7ZC 1A8VA 1LTTD 3WDNA 3S2DB 3TBIB 1X6OA 2WAQE 2FFKB 1D2BA 1KIXA 4C3HB 1LTRD 3W2DA 3T4AC 1WCMH 4IFDG 2Z6BA 3MXUA 5CC4A 1FJGL 3PMFA 3J7ZC 2F0PA 3T1YL 1PH9A 2UUAL 1E0BA 3JAMc 1F9SA 1EIFA 1QNKA 1I6HB 5EPKA 3TRZA 1STGA 1PYSB 3I3CA 2ALYB 3A55A 3F1ZA 5I6WA 1PH3A 3NELA 1SYFA 4XDXA 3U50C 5C0XJ 3MA2B 3J80E 1I94Q 3WOEA 1EIYB 1HA5A 1WTPA 3OPOA 2WV6D 4BBSB 2JJQA 1LT4D 2UU9Q 2DN8A 4IUVA 5EGTA 3H0GH 2JA6H 4KHVA 4WJ3M 4L6TB 5K5PA 3A7LA 4R8NA 1TKWB 2BCOA 3V05A 2F0SA 4YCUA 3RZOH 2PNRC 1YNND 4B3RL 3RZDH 2JA7G 5GAGC 1EEID 4GN4B 2IPKD 1KHIA 2F1MA 5FK9C 3HOUG 1FGUA 2IX0A 3HOWG 4BY7B 4FF2A 2EQSA 1TR5A 2E76C 4XT1B 2B63B 1I94L 1U9RA 2QCPX 4B9WA 3FDTA 5M5WH 3U9SA 4CDDC 4YIJA 1ESRA 3KDFB 3HFZB 1JJCB 1X3QA 1NCVA 3CKIB 1VQMA 2UXBQ 3DLLA 3N52A 5IGFA 1HXYD 3TDQA 2NN6I 2MP1A 3K59A 4FDBA 2RSNA 2EY1A 3L7ZC 4A76A 1LTBD 3S17B 4B9XA 4H7BA 1I4HA 4DK6C 5C0XH 4JV5Q 4MHEA 1JJ2A 4A3IH 1KAWA 5EAYA 1BBWA 1CZGA 3PO2B 1FVIA 1U4RA 2K75A 5BN4A 2CFMA 1EY8A 3T16A 4L5RC 4N9PA 3GTKB 3CCQA 4UAIA 2ATWA 2ICEC 2L5TA 2UXBL 3NBHB 1CQVA 1IL8A 3KF6A 1VQPA 3OIQA 4A3CH 2EYJA 1PH8A 2XWBB 3W5OA 4X66Q 2A68D 4DPGA 2Z8LA 3W3AA 2Q2HA 4K0KQ 4NB3A 4JV5L 4IOAA 1K8OA 1KDAA 1G91A 1NJIC 3J81c 3GTPB 1TU2B 3RMHA 4RWSC 4FO2A 3TS0A 2RCFA 1I4RA 1BDOA 1MSHA 1XTCD 2EYFA 2K5HA 3FRPB 1IKLA 4DN4M 1L1OB 1CQFA 3HOVB 1C7YA 3M9BA 1M4VA 5G3LF 1XMQQ 4DAVA 1DYQA 1WOCA 2PNHA 3D6WA 1IZ6A 1PRTC 4JW0A 3VYRA 4POGA 1YJNA 1WTRA 2M9VA 1TQOA 2H5XA 2F0TA 2PQAA 5CYUA 4K0KL 1BBUA 4LNQA 1QOHA 2KHSA 2L4NA 2N78A 3J81L 4A3MB 4F87A 1T9HA 5NUCA 1A3TA 5D65A 2HQLA 3MZ5A 4JI0L 2O5JC 3X3NA 1K8AC 5H1SE 2KCNA 4A3BG 3TEHB 3HS0C 4LFBQ 3M4OH 1L0WA 1MJEA 1X3GA 3PIOA 2K05A 2K52A 1SDFA 1XMQL 4LAAA 2A69D 4OO1I 2EJGC 2WB1G 2E2HB 1QUQB 1WJJA 5LL6X 3GTJH 4RGMA 4XQNA 3GDEA 3M7NA 4RMFA 2MGSA 1Z47A 4BA1I 1TS4A 1YEZA 2Q2UA 4Q5VA 4FVMA 3H3VI 2R7ZB 4DK3C 4LFBL 1GUWA 4DXFA 2JK8A 5J1ZA 4GKJQ 2DNEA 4Z9CB 1V1PA 1AP0A 1XYIA 2J0TD 1Y1VB 5M5YB 4IPDA 2JA5B 4PMCA 2NZOA 4KN7C 2ID0A 4K2KA 1BQQT 1TWAH 1X3FA 4DV6Q 2FXQA 3HOZG 1RJTA 4LF8Q 1V9PA 2R3ZA 1Q82C 4TSSA 3S1NB 2EJMA 2KVMA 2R93H 2K5DA 1ENFA 1TWHH 2B8GA 3F2CA 4JI5Q 4GKJL 2E2JH 3I4NB 1GD7A 1NAPA 4X3TA 4UHVA 2B2YA 1K9MC 1CI3M 1JJGA 4F7XA 1JOKA 2EZVA 2I5HA 1LT5D 2O5IC 4JBMA 5JEAG 1YVCA 1EU4A 4HMIA 3ONAB 1O7IA 2UXDL 2QEXA 2RDFA 3K6OA 3UDIA 4JI7Q 3KBGA 1G8ZD 4LFAQ 4H13C 1Y8OB 4LF8L 1SE4A 5I2XA 4MTKA 3VA5A 1B3AA 4KJNA 4O42A 4JVZA 3D6CA 3EQLC 2D2CC 1FYCA 3TZUA 5FLMG 3GTGB 4JI5L 1T5XD 3OOCA 1CA5A 1J8IA 2ENBA 1XPOA 3C46A 5ELCA 3EVQA 3NP8A 4YHHQ 3MEHA 3SVMA 2HQEA 4QCLA 2SOBA 3MWYW 4O1NA 4L5TA 2YU9H 3LWEA 3S2HH 4WJWA 1W6KA 4JI7L 3MXGA 3I55A 4HN7A 4KLKA 3JC66 1A62A 2ZXPA 3S16B 2HHHQ 3DM3A 3NEMA 3CD6A 3PIO3 4P73A 3UI2A 2KHJA 3E9HA 4DXGA 3BDCA 3RUZA 4UPAA 1CKOA 1P8LA 4OIKA 4RHSA 1C9OA 3KLWA 1K3RA 1VS0A 2YYZA 4C3HG 3E0JA 1S5DD 5IYDG 3K80C 5FLXE 2BOSA 3NTIA 4LMQD 3J7YW 2EY2A 4P71A 1VF7A 5JVH3 1GUTA 3MFGA 1XXGA 1YITA 1KRSA 4JI3Q 1VQCA 2VQEQ 4DK0A 2RDGA 3NQIA 4HCSA 4P72A 5F2DA 3QIAA 1YJ9A 2HHHL 2JA7B 3TP6A 1EYDA 1K8MA 3CPFA 1V1QA 1ET6A 3ITPA 3HOUB 4DR4Q 2VS1A 2TMPA 4K5XA 5C5MA 1VQDA 1RL2A 3TREA 3HOWB 2GN5A 4DR6Q 1G2TA 3S1RB 3BZCA 4KHPL 1SMYC 1EQQA 1HNWL 2BE5C 1G291 4FNFA 1WD1A 1IBMQ 1AFPA 4A3EG 4JI2Q 1KQSA 3LX0A 1DM0B 2F0EA 4IJLA 3K7UC 3IFDA 4JI3L 2VQEL 4R4OA 2NYZD 2SEBD 3NHHA 2DY8A 4KJOA 2B8FA 1ICWA 2NWGA 1QVFA 5EQ0A 2NTSA 2KENA 2ASBA 1KAAA 4DV2Q 4A3GG 1PLFA 4X62Q 4DR4L 2QILA 4K2LA 4R4IA 3J7A5 1EY6A 1SNPA 1HA6A 2D0PA 1BR9A 1SE3A 4HTHA 2NVTH 1HQRD 1IBML 4JI4Q 5I9PA 5C4JB 4JI2L 1PRTD 1ASYA 4DNRB 3A74A 2X6LA 4K6LA 3X3MA 5FJ8G 4B3SL 4ZK9B 4OELB 1X9NA 4B08A 2I5MX 2ZJPA 1IBLQ 4JI1Q 1CK1A 4BWGB 1Q8IA 1Y1WG 2MUYA 3QO2A 2Q8RE 1HTLD 1N34L 5M3FH 1PTOD 4X62L 3U4ZA 4AYBG 1EL0A 3QOJA 3TSSA 2F0GA 4IZ8A 2RBMA 4Y7NB 1GM5A 4UDUC 4BXXH 4HJ9A 4ZYSA 2I07B 2MO1A 3S1MB 4JI4L 3I4OA 3TP7A 3J80c 1FNWA 1ZYRC 2NVQB 4NW2A 2UXCQ 3T53B 2OXPA 1MBYA 2GVAA 3Q23A 1VMCA 4RKBA 3VA7A 3A54A 3BVGA 5EBCA 3I70A 1IBLL 2DGYA 3CP0A 4JI1L 1PH4A 2C35B 1UE6A 1EY7A 4R4TA 1TWCB 1B9NA 5EBDA 3OHXC 4A3FG 1ZXTA 4GOPA 2PYKA 3HOXG 3A56A 3OTOQ 1VQ5A 4CKCA 5AJ3Q 2F3WA 1EOVA 3RN5A 3HKZG 4IURA 4WORA 3ULPA 3AQQA 2WINB 3QG1A 3CU7A 3S14B 4IUNA 4DNIA 2PPBC 2ZJRA 4KY6A 4YY3Q 5IGDA 5FO7B 4CKBA 4RA8A 1CKMA 3SK5A 4A3BB 2EYMA 1NE3A 3HGBA 5D3DA 2UXCL 1TWFB 3QJYA 1U4LA 1X65A 2EYLA 2WKDA 3ER0A 2PQEA 2CKZB 1SSOA 3E3XA 2LXKA 1B4OA 2WB1B 2OT2A 4IFDI 1F9QA 4BY1H 4R8IA 2WB1E 4A3MG 5CBAE 2ZJQA 1DOKA 5AJ3L 3HOYB 3S15H 2NB0A 3GTMB 1CZWA 1G6ZA 3DHQA 1HZBA 3FKIH 2AMCB 4YY3L 3F2BA 1I5FA 2KA7A 1TS2A 1VQLA 1LO5D 4BBRH 3NQTA 3KBXA 1W3SA 1V43A 3KF6B 1D5MC 3IRBA 1LM0A 5CV5A 4EX5A 2RVLA 2MNAA 2CWPA 2MPMA 3HG9A 4A3KB 2K32A 3D4RA 5CMDA 3MEFA 2FMCA 1HJPA 2TSSA 4S3SA 4OX9Q 1B8AA 1I4XA 4C3JB 1WYDA 1X56A 4A93H 4J15A 1CUKA 1I50H 4UP9A 3S1QB 3MFYA 4A3DH 4FXKC 3NTHA 2PO4A 2R7ZG 2E2IH 2D0OA 4LUOA 2JA8H 2HUGA 2B2UA 1FNUA 5CV4A 2F0VA 3OSOA 2AQ2B 2ZT9C 4DA2A 3K5MA 2OWOA 4NKLA 1WD0A 5J3BA 3U4VA 1CA6A 2A6EC 3OW2A 1Y1VG 3DXJC 4HIMA 1KTKA 3AFPA 5DLQE 3D3RA 3CMAA 3FVQA 1ET9A 2Z6KA 2PQAB 1YBYA 4X3KA 4X3SA 4HEDA 4IPGA 1KNEA 4U673 4JI6Q 4LF6Q 3DWQA 2A6HD 2A1AA 1RD9D 3L9AX 4HJ7A 5IP7G 4AIMA 2SNSA 4HCEA 1SROA 2AQ3B 5E4WC 3CC4A 4FYDA 1ENCA 1I3QB 3Q0AA 1AE2A 2P5ZX 3R3OA 1IKMA 3D4WA 4DUYQ 2YTYA 4FF4A 1D5ZC 3Q22A 1CSPA 1AH9A 1D6EC 1EY9A 1O78A 1STYA 4QY7A 1ONLA 4EQPA 1LUZA 4JI6L 3WOFA 4LF6L 5KGUA 4HJ8A 3Q6SA 2JEBI 3MXNA 3GTLB 4GNXA 3KFUA 3ND8A 4CGYB 5C4XG 3KLSA 1WI5A 1V1PB 3TMEA 1G2SA 4LK1C 4OWTB 2QEJC 2RSOA 3KUPA 3A5ZB 1YNXA 2BDOA 2L15A 4KY5A 4CDFC 2F0IA 1LLRD 2QW7A 2KECA 2IL8A 4KKUA 5JPNC 2HIXA 4A3LG 1KNAA 1Q12A 1DJRD 3V2TA 1CKNA 2RKSA 3S24A 3SEBA 1A63A 1B50A 4IALA 5JJIA 3GV6A 1A3UA 4E6IA 1XX8A 1WTVA 4JBKA 2PMZB 2K50A 5M3MG 4H02A 2L55A 1K83H 2PMZE 1EUJA 1GHKA 1BCPC 4A3EB 3KLRA 3FEWX 3B6YA 3JAML 3MC0B 4GS3A 2G9HD 1A3VA 3MAQA 2JA9A 2AWOA 3I4LA 1CM9A 4NDXA 2A19A 1XTDA 3EIVA 3VR3A 2NVYB 4U68A 3V96A 4A3GB 1H9JA 2B2VC 2HD3A 3DUZA 1JB7A 3ZJYC 4V0BA 2KBNA 1A0IA 1DD2A 2EXDA 3KOJA 2UU9L 4IUUA 5IIFA 4CBVA 1XNQQ 3PUZA 1N36Q 3DM1A 5KNDA 4HIKA 2F0MA 5K36G 4ZKBB 3I4MH 3P1HA 2B2WC 1H9MA 3VR6A 1Y1WB 2RCNA 4G7HC 2Q2TA 1PMRA 3H3VC 1EFID 2Z9HA 4AYBB 2B2TA 2NVXH 1RF2D 3K7AH 1D5XC 5LMUQ 4AYBE 3KF8A 1PRTB 1JWSD 2H4OA 5IYCH 3CQZB 2F03A 5HGQA 2EY6A 2F0FA 3BZKA 4DV4Q 2AUKA 1XNQL 4JI8Q 4QGUA 3STBD 5FLXc 3PIPA 1Y8PB 2IHEA 1DONA 4JK1C 2GVBA 5D3IB 1PTOB 3PO3H 3CCRA 3DWAA 3I8ZA 1MHWC 2VW9A 1U5KA 5LMNQ 1QZGA 2FHTA 4HJ5A 1Z6HA 1EQVA 5ELEA 5T1IA 4A3FB 3HOXB 2UUCQ 3VR5A 2E74C 4C3IH 4HSPA 3Q8DA 3HKZB 2CH4W 2QF7A 2IWHA 3H15A 5LMUL 5A2QE 1GHJA 1HZAA 1SYCA 3K5OA 5BN5A 3HKZE 4RHRA 4LF7Q 5E3FA 4LW1A 1FL0A 2D5DA 1UE5A 1O7LA 4DV4L 3GTOB 1TWGB 1E2WA 4JI8L 3UE0A 1H9SA 3PF4A 3PSIA 3P7JA 4DV3Q 5C3EB 1XPUA 1Z7TA 4C2MB 5HURA 3KYHC 1QJOA 4X66L 1EY4A 1ZKOA 1SBBB 1HQMC 1RCVD 2E75C 3NE5B 1EWHA 1GKHA 2CQOA 5C0XG 3MHBA 4A3JG 1UNSA 2A73B 4A3IG 2CH4A 2UUCL 2KEEA 3BS1A 4OL7A 4XQJA 2VZAA 3NK9A 1B7YB 2L11A 3R93A 3GTQH 3K5NA 3J81i 1EZ8A 2NN6H 1VQGA 2Z0SA 4GN3B 3W1BA 3GQBA 2C9OA 3M85A 4ME3A 5ELOA 2K5QA 1Q1EA 4DV3L 1PFNA 2YTXA 3CCSA 4HR7B 4I65A 1IYUA 3G6EA 1QILA 1K28A 5GROA 1M8AA 1TXYA 3HOZH 2K14A 1IBKQ 3HOYG 1HNXQ 3T1HQ 4RGNA 4MZ9A 3SK8A 4H44C 3DEPA 1ML0D 3SR1A 4FP5D 4PMWA 4NPSA 1JC7A 4ME5A 1PFMA 3U9OA 4RAUC 4A4IA 2XTIA 1M90C 1MI2A 1SYGA 1YHBA 4JOIC 4PZ8A 4WJ4A 1UEAB 2B3GA 3BYTB 3K57A 1L1OC 3G71A 3J81j 5C4ZA 4A3KG 4KV6A 4K6DA 1VQ7A 3RLOA 2OF1A 1IW7D 4LUZA 2VUMB 1FGBD 4C3JG 4O2DA 1IBKL 2JYOA 2R92H 1SAPA 4GOPB 1HNXL 1GJXA 3T1HL 1YNJD 4DAYA 1TS5A 2F3VA 3C1FA 4I7AA 5JOBA 5C44H 4C1NI 3AB9A 3W1GA 3I91A 1Q7YC 5M5XH 2JSOA 3SGIA 5GQOA 1E24A 2IW3A 3KJPA 4L5QA 1ZEQX 3Q24A 3U58A 1GXDC 1PH1A 4K5VA 5IT9c 1BVSA 1PFBA 4X64Q 4MTNA 3AYHB 4HSVA 3I7FA 4DV6L 4LF9Q 3DEOA 1C48A 3CCVA 3S2DH 4QQBX 5HGTA 5LHY1 4RCOA 2XNAC 3M4PA 2IJ0A 2KUMA 1VQ9A 1HR0Q 1EEFD 4C3HH 2XIWA 4J1MA 4OO1H 1JORA 2N8NA 2N88A 1F9PA 1K0RA 1E3PA 1GUSA 1YZ6A 1BCPD 2F0KA 1B70B 3G6JB 5C4XB 3I2ZA 4IUTA 4XIGS 4QUFA 1BF4A 2XRQD 1Q86C 1PA6A 1I6HH 3H3VH 4C1NK 3D31A 1KRTA 1XPRA 4LF9L 4J8QA 1X32A 4LFAL 3O13A 2LMCB 1MJCA 5BN3A 2OTLA 2WIIB 3K58A 4LF5Q 2IX1A 3TP5A 1JT8A 3F8TA 1HR0L 4DR5Q 1GUGA 3PV0A 4DV5Q 4CKEA 4BBSH 3A8JE 3GD7A 2EDGA 2EPBA 2FJ2A 1STNA 5KRUA 4YHHL 3MTSA 5C5LA 3R8BA 3ULJA 1N32Q 4XXEA 1K73C 4JYAQ 2CWAA 5M3MB 4DKAC 2NZ1D 5DM73 1SNOA 4OONA 1PH7A 4JBWA 2ZXRA 3DWPA 1L0YB 4BY7H 1SNQA 2KQ3A 1XMOQ 1SFOB 5JPMC 2B63H 4LF5L 4K8IA 4FXDA 5IWAQ 1XJVA 4DV5L 3IAYA 1SXTA 2HIVA 4ZQ3A 2O4XA 4DU9A 5CV8A 2K5WA 5IGCA 1N32L 2WKCA 1NR4A 3MXPA 1WCMB 1MD2D 4G7OC 3KLSX 5FJ8H 1VMPA 1R9TB 1C4QA 3NWTA 1SYEA 3K81C 5ELFA 3EROA 3EA6A 4RCNA 4ZCKA 2YTVA 3J81E 1S3OA 1LV9A 3S17H 2LXJA 1H9KA 4DR2Q 1XMOL 1BUVT 1A15A 2RHQB 1MKHA 4QF4A 1VQOA 3PO2H 3TZDA 5ELDA 5IYBH 1NTGA 3QOLA 5IE8A 3GTKH 2X69A 3L0OA 3PCOB 3MXNB 4DR6L 4GNXB 4QIWB 4CJ0B 3VYSA 3SXHA 1HUNA 3A7AB 4QIWE 4X3UA 2K4KA 1EU3A 3TP8A 1TIID 1KL9A 3H0GB 2JA6B 4UP7A 5L37A 5D14A 5EJWA 1Q8KA 1Y8NB 2L1BA 1LT6D 1EY0A 4XQQA 3I90A 3RZOB 3VR4A 5FO8B 1UWVA 2PZTA 3CW2C 3RZDB 1TS3A 3ERSX 3HOXH 2K7VA 4A75A 3GTPH 4DV2L 4DF7A 3WWVA 1HZCA 1CKNB 4O0AA 2N55A 1STAA 1JE5A 2HDMA 1HTPA 1WTQA 2F0JA 1RODA 2F4IA 4WFN3 1Z9FA 1SJED 3M4YA 5M5WB 3HOVH 5JJZA 4NXNQ 1VQEA 4C2MH 1ESFA 3C1EA 1KC8C 1MIUA 1M1KC 3GO5A 2BH8A 1VCIA 3A8IE 2GA4B 2UUBQ 1YNNC 4L5SA 3AFQA 4DR3Q 5LL6S 4A3MH 1KABA 4DR1Q 2B39A 5IP9G 1U4MA 1PHJA 2YV5A 4A3JB 5IGEA 1WTHA 4APVA 4A3IB 1QWYA 2QDBA 4TRDA 3QR8A 5DM63 3J80L 2PZWA 4KK7A 4NXNL 3RN2A 1PFSA 2C5CA 3BG3A 2E2HH 4B3TQ 1JMCA 5C3EG 3CAMA 1OXXK 2UUBL 1PH2A 1PH5A 4DR3L 3G4SA 1X55A 1I4PA 5M3FG 2PI2A 4DR1L 1QZHA 1AEXA 5KYIA 1PZJD 1HZ9A 3OTOL 1I6VC 2KOLA 3CCMA 4MIUA 5IOCA 2R7ZH 4BXXG 5KNBA 1SEBD 4KD4A 1QCBD 1TY0A 2XN9C 2F0UA 1VQBA 3KF8B 4NXMQ 4PQXA 2M2LA 5DNFA 1JOOA 5GAHC 2KHIA 1KDCA 1AE3A 1SR3A 1II3A 2IHFA 1Y1VH 2WFWA 5M5YH 4B3TL 1VQIA 1S4ZA 1F9RA 2JA5H 2NBFA 5IGGA 5FOBB 1LACA 4X65Q 3ULLA 1TVXA 4EGVA 1LTAD 4LF4Q 4IFDJ 5JVG3 2A68C 4OWXB 2EYPA 4BS9A 1L2FA 1AN8A 3URYA 3BDLA 3S1NH 1OXVA 2DNCA 3CPWA 4B3MQ 2K03A 2HT1A 3UDXA 1NBWA 1DXMA 3AMUA 4CDEC 4FXGC 1VQNA 3I4NH 4NXML 5IP7H 5ELNA 1LTSD 4DK1A 1HRJA 4P74A 4GKKQ 2BA1A 2N3SA 5TSSA 3M4OB 2ZXOA 3FHWA 4DV1Q 1H9SB 3FP9A 4LF4L 1KLGD 2Q8TA 1I4QA 4EQOA 2VUMG 1IHZA 3G48A 3NPPA 1CHPD 3E0EA 4BY1G 3GTJB 1VQFA 5JJLA 1X54A 1UE1A 4OX9L 1GOZA 2E2DC 3CC2A 1NSNS 2PCFB 4Y52H 1K0SA 4B3ML 4FF1A 1HPCA 3FKIG 4TVAB 5E4XA 1FD7D 3GTGH 1WTXA 1EQRA 3L3OC 4YCWA 2F4VQ 2EJFC 5G3LD 4BBRG 4DUZQ 4ZRZA 1A2UA 1J5EQ 2JXMB 2NTTA 4DV1L 4AQYQ 2QDLA 1LTGD 1E7ZA 2AHOB 4IFDH 3M7GA 2Q2IA 3I73A 4M8AA 1SYDA 5IGBA 2VB2X 2JQOA 4ZUJA 3S16H 3HKSA 2K1BA 4A93G 3J7AV 1TWAB 1RKNA 4PNYA 3IFTA 4A3DG 4A3LH 2EOTA 3P75A 1S72A 1B9MA 1F2YA 4TKOB 2JA8G 1JCKB 2I0QA 3A5UA 2R93B 2F4VL 2F0HA 5C6AA 1SMYD 1EYCA 1TWHB 1H95A 2BE5D 4QL5A 2E2JB 3KK7A 4JG2A 1PH6A 1S5ED 4N8X1 1G51A 1QVCA 2QGQA 2BH2A 1D1KA 1DOMA 1PRTF 2ES2A 2LSSA 5KYLA 4OIJA 4DUYL 2MO0A 4XT3B 1O7YA 3BDOA 5KNCA 2JA7H 1D7QA 1N33Q 4RGTA 4MN3A 5JJKA 1S40A 4DAYB 5FO9B 3PQIA 3HOUH 3PGZA 4F8MA 3HOWH 2Y0SG 3PUVA 4ULLA 1SJHD 1PTOF 1SLJA 3S1RH 2LS01 5C0XI 3H09A 5A35A 1R4QB 1EYAA 5JAVA 2K33A 1R9TH 1O7ZA 3F2UA 4KKTA 2IY5B 2RF4A 2F0NA 2YU9B 4Q0FA 3S2HB 4L63B 4B3RQ 1LTLA 3K8AA 5K36H 1N33L 3ND9A 4MNOA 1E22A 3TN2A 3H94A 2SDFA 1W2BA 3K0YA 5EKLA 4XTCS 3M3YB 3JAMi 4R4CA 4DR7Q 1E1OA 2MFIA 1GVPA 4K8JA 2RQXA 3EJIA 5C4JH 2VNUD 3HZXA 1ZYRD 3CC7A 1WCMG 2E8GA 1K8GA 3ERQA 2PW7A 3IL8A 2RDHA 4IJHA 3CCUA 5ELBA 3OIPA 2EE1A 2EIFA 4QUCA 1NNXA 3QWNA 4HMJA 1BOSA 4Y7NH 1FR3A 5J22A 3A0JA 4DR7L 2DJFC 1HR0W 4IPCA 2DJGC 5E1FA 3L2PA 3S1MH 3RLNA 1BO0A 4YWKA 4ILWA 2NVQH 4HIDA 1DCZA 2F3IA 2B2YC 3H0GG 2OQ0A 2JA6G 1IXRA 5I9OA 3FPPA 1TWCH 5EPLA 1V1OA 1N36L 5CBEE 4A3JH 2FMMA 2F0QA 1JR0D 5I4DA 4C56C 4IUPA 5GADC 2QA4A 1BXTA 3F2DA 1XWEA 2LKVA 2NZHA 3S14H 2WP8J 1HHVA 5HY6A 1EWCA 1F77A 2LFNA 4A3BH 1CHQD 1J9OA 2NVTB 2CQAA 1SNDA 1TWFH 1U0LA 1YHAA 2K04A 1EWIA 1Q90A 5EKIA 5FLXL 1HUMA 1IYVA 1AZPA 1A2TA 4YWLA 1YHQA 4NMZA 2DUDA 1DOLA 1SMXA 3I4MG 1PZID 5JEAJ 1IL2A 1PZKD 4RKLA 2NUCA 5C3WA 3HOYH 4ZLTF 3HEJA 1C8CA 2R61A 4DAMA 5LMNL 3GTMH 5M3FB 5M9OA 4JI0Q 1MGSA 2AKWB 5E7NA 3HP3A 5I2YA 4DFAA 5IYCG 4PMBA 4IOCA 1STBA 2A6ED 3CRKC 2K6AA 4LF7L 1EQTA 2RA4A 3VDYA 4P2CB 1FNVA 1WTWA 2SNMA 2VB3X 2Z1CA 4A3KH 4A3CG 2XSCA 2L9HA 4PZ6A 1X3PA 1STEA 3ICEA 3CCJA 4GLAC 2PW5A 3PO3G 4C3JH 1VQ6A 1NY4A 1GO3E 3S1QH 4PG3A 1Y14B 4XYOA 4DNTB 1PTOC 1QE6A 3BVMA 1KLUD 2KCCA 2MQHA 4C3IG 4ZAIA 2L12A 3UDFA 1VDZA 2IT1A 4K14A 2EYHA 1VQHA 5CORA 1OXSC 3SK4A 1F2MA 2EY5A 2WACA 2JP1A 2XRSD 2R7FA 4RGOS 3E5SA 5T1GA 4GLXA 5J39A 4ABNA 2Q8IB 4F88A 2ZM6Q 4OEMB 5DEHA 2QKIC 4XYQA 5JEAH 2AWNA 5CV9A 1UE7A 5IY0A 1LABA 2OCEA 1D1IA 3NENA 2VXWA 4HIOA 3CMEA 5KEEA 1R4PB 4BY1B 3T13A 2D9UA 3GV3A 1N8RC 2B2VA 3S15B 1P16A 1CFMA 1F2ZA 1S5CD
chains in the Genus database with same CATH topology
1JWUD 3FKIB 4RH6A 2NN6G 1V8QA 3T56B 2BA0A 3PIP3 5EPJA 2I46A 1S5FD 4BBRB 4IQZA 3A8KE 3C2PA 3JAME 4CJ2C 1JOQA 3C3LA 3BYYB 1B53A 2B2WA 3LWUA 3ZYYX 1I4GA 4N9TA 4A93B 1I50B 5KIXA 1LTID 4A3DB 2V4DA 1H9RA 3E6ZX 2E2IB 2JA8B 1HCZA 4ODGA 5IT9L 5IODA 4DAPA 5CV7A 3BZDB 1EY5A 3NUCA 4QB4A 1W6JA 2HDLA 1JB3A 3R2IA 4RFBA 4CJ1B 2X6GA 1NR2A 1S5BD 2Y0SB 5CR3A 4KHZA 5EKKA 2J4XA 5COYA 4FF3A 1EOTA 4LJZC 1GUOA 2AQ1B 1AZQA 4IUQA 1SNCA 1U4PA 2F0WA 1TY2A 1T5EA 4OO1G 2A6HC 2CW0C 2EYOA 2KJXA 3VYTA 1O80A 3NBHA 2R6GA 2JEAI 3SDZA 1BBXC 1UAPA 4KTAA 1SNMA 4K5WA 4GZYC 1ENAA 1EZ6A 3OMCA 3I72A 3QB3A 1ILPA 2G9DA 1GUNA 2B2UC 1DZ1A 3AU7A 1VF5C 4L8JA 1OO9B 1HFGA 1K83B 1BNZA 2F0DA 3PUYA 1PTOH 4KY7A 1OXTA 3NSWA 1LT3D 3K5LA 1TT2A 1OXUA 5I6YA 3BVZA 2F0LA 2IX3A 1SE2A 1JWMD 2HCIA 3DMUA 3H6MA 1QB5D 2LY7A 4CHTB 2OEOA 3R2TA 1B44D 1CTMA 3H91A 1PXUA 2L0CA 3NBIA 3OWEB 4IN3A 1RHPA 2DY7A 3IKJA 4OGQC 3N6RA 4BA2I 2AUJD 3D8GA 2KEDA 3SE0A 1WTOA 4ZKCB 2A74C 3I4MB 3HRZC 2ICIA 4H0LC 1HFNA 5FKAC 2A5HA 2XWJB 5C3XA 4ZUIA 5ISRA 1B1ZA 4QMGA 2NVXB 3NTKA 3K7AB 4KKSA 1KDBA 1JE4A 4KD3A 3PUWA 1PYWD 1STHA 1QG7A 4KN4C 3SHLA 2K01A 2XVSA 3SK6A 4G4KA 3PO3B 4PV1C 1AW7A 2M00A 3P20A 4NP5A 4G57A 1ILQA 4C3IB 5IT9E 2EXZA 5AFWA 3CHBD 5CV6A 2BDNA 1PDQA 3OMGA 3RD4A 1B2TA 5C4HA 4DGZA 1JQYD 2MJ8A 1BCPF 4ID6A 2Z4IA 1L0XB 4WRDA 3FMCA 4EVOA 2CHBD 4TQUS 3EFXD 1E2ZA 3FPUB 3D4DA 2PZUA 3PUXA 1MSGA 3CRLC 3GTQB 5DAUA 3MVVA 3OW7A 2F0OA 2MHVA 3NXWA 3S9WA 4KI0A 3RLFA 4OHJA 3NWSA 2FINB 1Y69U 2Z4HA 1SYBA 3HOZB 1RDPD 1E2VA 4KMUC 1Q3LA 1RTOA 2B2TC 3G7LA 1RTNA 5A2QL 2JE6I 4J6HA 3LNNA 4EQNA 2A69C 1A6XA 1EIGA 1UUPA 3J7AF 2K28A 4V190 2R92B 3GP7A 1F2LA 2O2LD 1EIHA 5C44B 1NUCA 2CW0D 5CGKA 1CT1D 4HAEA 1Q1BA 1WVLA 5M5XB 1BCPB 2J7ZA 2EVBA 2H1EA 3OWFA 3T51B 1IW7C 1JICA 2HCCA 4M1UB 4R9WA 2D62A 3VYUA 3VR2A 1YNJC 1QNUA 4G7ZC 2WAQB 2CVRA 4I7ZC 1LTTD 3WDNA 3S2DB 3TBIB 2FFKB 1D2BA 4C3HB 1LTRD 3W2DA 3T4AC 4IFDG 3MXUA 5CC4A 3PMFA 2F0PA 1E0BA 1F9SA 1QNKA 1I6HB 5EPKA 1STGA 3I3CA 3A55A 5I6WA 1SYFA 4XDXA 5C0XJ 3MA2B 3J80E 3WOEA 1HA5A 1WTPA 3OPOA 2WV6D 4BBSB 1LT4D 2DN8A 4IUVA 5EGTA 4KHVA 4L6TB 5K5PA 3A7LA 4R8NA 1TKWB 2BCOA 3V05A 2F0SA 2PNRC 1YNND 1EEID 2IPKD 2F1MA 5FK9C 2IX0A 4BY7B 4FF2A 1TR5A 2E76C 4XT1B 2B63B 4B9WA 2QCPX 1U9RA 3FDTA 3U9SA 4YIJA 1ESRA 1X3QA 1NCVA 3CKIB 3N52A 5IGFA 1HXYD 3TDQA 2NN6I 2MP1A 3K59A 2RSNA 2EY1A 3L7ZC 1LTBD 3S17B 4B9XA 4H7BA 1I4HA 5C0XH 4MHEA 1CZGA 3PO2B 1U4RA 5BN4A 1EY8A 3T16A 4N9PA 3GTKB 4UAIA 2ICEC 2L5TA 1CQVA 1IL8A 3OIQA 2EYJA 2XWBB 2A68D 2Z8LA 3W3AA 1K8OA 1KDAA 1G91A 3GTPB 1TU2B 3RMHA 4RWSC 4FO2A 1I4RA 1BDOA 1MSHA 1XTCD 2EYFA 3FRPB 1IKLA 4DN4M 1CQFA 3HOVB 1M4VA 5G3LF 4DAVA 1DYQA 3D6WA 1PRTC 3VYRA 1WTRA 2M9VA 1TQOA 2F0TA 5CYUA 1QOHA 2KHSA 2L4NA 3J81L 4A3MB 4F87A 5NUCA 1A3TA 5D65A 3MZ5A 2O5JC 3X3NA 2KCNA 3HS0C 2K05A 1SDFA 4LAAA 2A69D 4OO1I 2EJGC 2E2HB 5LL6X 4RGMA 4XQNA 3M7NA 2MGSA 1Z47A 4BA1I 1TS4A 4Q5VA 4FVMA 2R7ZB 1GUWA 4DXFA 5J1ZA 2DNEA 4Z9CB 1V1PA 1AP0A 1XYIA 2J0TD 1Y1VB 5M5YB 2JA5B 4PMCA 4KN7C 2ID0A 4K2KA 1BQQT 1RJTA 2R3ZA 4TSSA 3S1NB 2EJMA 2KVMA 2K5DA 1ENFA 2B8GA 3I4NB 1NAPA 4X3TA 2B2YA 1CI3M 4F7XA 1JOKA 2EZVA 2O5IC 1LT5D 5JEAG 1EU4A 4HMIA 3ONAB 2RDFA 3K6OA 3KBGA 1G8ZD 4H13C 1Y8OB 5I2XA 1SE4A 3VA5A 1B3AA 4KJNA 4O42A 3D6CA 3EQLC 2D2CC 1FYCA 3TZUA 3GTGB 1T5XD 3OOCA 1CA5A 1J8IA 2ENBA 3C46A 5ELCA 3EVQA 3NP8A 3MEHA 3SVMA 2HQEA 4QCLA 2SOBA 3MWYW 4O1NA 3LWEA 4WJWA 1W6KA 3MXGA 4HN7A 2ZXPA 3S16B 3PIO3 3UI2A 4DXGA 3BDCA 3RUZA 4OIKA 4RHSA 4C3HG 2YYZA 3E0JA 1S5DD 5FLXE 2BOSA 3NTIA 4LMQD 3J7YW 2EY2A 1VF7A 5JVH3 1GUTA 3MFGA 1XXGA 4DK0A 2RDGA 3NQIA 4HCSA 5F2DA 3QIAA 2JA7B 3TP6A 1EYDA 1K8MA 1ET6A 3ITPA 3HOUB 2TMPA 4K5XA 5C5MA 3HOWB 1G2TA 3S1RB 1SMYC 2BE5C 1G291 4FNFA 1WD1A 1AFPA 3LX0A 1DM0B 2F0EA 3IFDA 2NYZD 2SEBD 3NHHA 2DY8A 4KJOA 2B8FA 1ICWA 2NWGA 5EQ0A 2NTSA 1KAAA 1PLFA 2QILA 4K2LA 1EY6A 1SNPA 1HA6A 1BR9A 1SE3A 4HTHA 1HQRD 5I9PA 5C4JB 1PRTD 4DNRB 2X6LA 4K6LA 3X3MA 4ZK9B 4B08A 1CK1A 4BWGB 1Q8IA 2MUYA 3QO2A 2Q8RE 1HTLD 1PTOD 1EL0A 3QOJA 3TSSA 2F0GA 4IZ8A 2RBMA 4Y7NB 4UDUC 4ZYSA 2I07B 3S1MB 3TP7A 1FNWA 1ZYRC 2NVQB 4NW2A 3T53B 2OXPA 1MBYA 3Q23A 1VMCA 4RKBA 3VA7A 3A54A 3BVGA 5EBCA 3I70A 1EY7A 1TWCB 1B9NA 5EBDA 3OHXC 1ZXTA 2PYKA 3A56A 4CKCA 2F3WA 4IURA 4WORA 2WINB 3QG1A 3CU7A 3S14B 4IUNA 2PPBC 4KY6A 5IGDA 5FO7B 4CKBA 4RA8A 3SK5A 4A3BB 2EYMA 3HGBA 5D3DA 1TWFB 3QJYA 1U4LA 2EYLA 2WKDA 2PQEA 1SSOA 1B4OA 2WB1B 2OT2A 4IFDI 1F9QA 4R8IA 5CBAE 1DOKA 3HOYB 2NB0A 3GTMB 1CZWA 1G6ZA 3DHQA 2KA7A 1TS2A 1LO5D 3KBXA 3NQTA 1V43A 1D5MC 5CV5A 2RVLA 2MPMA 3HG9A 4A3KB 2K32A 3D4RA 5CMDA 2FMCA 2TSSA 4S3SA 1I4XA 4C3JB 3S1QB 3MFYA 4FXKC 3NTHA 2PO4A 2HUGA 2B2UA 1FNUA 5CV4A 2F0VA 3OSOA 2AQ2B 2ZT9C 4DA2A 3K5MA 4NKLA 1WD0A 1CA6A 2A6EC 3DXJC 1KTKA 3D3RA 3FVQA 1ET9A 4X3KA 4X3SA 4HEDA 1KNEA 4U673 3DWQA 2A6HD 1RD9D 3L9AX 2SNSA 4HCEA 2AQ3B 5E4WC 4FYDA 1ENCA 1I3QB 3Q0AA 3R3OA 1IKMA 3D4WA 4FF4A 1D5ZC 3Q22A 1D6EC 1EY9A 1O78A 1STYA 1ONLA 4EQPA 3WOFA 5KGUA 3Q6SA 2JEBI 3MXNA 3GTLB 3ND8A 4CGYB 3KLSA 1V1PB 3TMEA 1G2SA 4LK1C 2QEJC 2RSOA 3KUPA 2BDOA 4KY5A 2F0IA 1LLRD 2KECA 2IL8A 4KKUA 5JPNC 1KNAA 1Q12A 1DJRD 3V2TA 2RKSA 3SEBA 1B50A 4IALA 3GV6A 1A3UA 4E6IA 1XX8A 1WTVA 2PMZB 2L55A 1GHKA 1BCPC 4A3EB 3KLRA 3FEWX 3JAML 3MC0B 2G9HD 1A3VA 3MAQA 2AWOA 3I4LA 1CM9A 4NDXA 3VR3A 2NVYB 4U68A 3V96A 4A3GB 1H9JA 2B2VC 3DUZA 4V0BA 1DD2A 4IUUA 5IIFA 4CBVA 3PUZA 3DM1A 5KNDA 2F0MA 5K36G 4ZKBB 3P1HA 2B2WC 1H9MA 3VR6A 1Y1WB 4G7HC 1PMRA 3H3VC 1EFID 4AYBB 2B2TA 1RF2D 1D5XC 3KF8A 1PRTB 1JWSD 2H4OA 3CQZB 2F03A 2EY6A 2F0FA 2AUKA 1Y8PB 1DONA 4JK1C 5D3IB 1PTOB 3DWAA 3I8ZA 2FHTA 1Z6HA 1EQVA 5ELEA 5T1IA 4A3FB 3HOXB 3VR5A 2E74C 4HSPA 3HKZB 2QF7A 2IWHA 5A2QE 1GHJA 1SYCA 3K5OA 5BN5A 4RHRA 5E3FA 2D5DA 1O7LA 3GTOB 1TWGB 1E2WA 1H9SA 3P7JA 5C3EB 1Z7TA 4C2MB 5HURA 1QJOA 1EY4A 1ZKOA 1SBBB 1HQMC 1RCVD 2E75C 3NE5B 1EWHA 5C0XG 3MHBA 1UNSA 2A73B 2KEEA 3BS1A 4OL7A 4XQJA 3NK9A 2L11A 3R93A 3K5NA 1EZ8A 2NN6H 3GQBA 2C9OA 3M85A 2K5QA 1Q1EA 1PFNA 4HR7B 4I65A 1IYUA 1QILA 1M8AA 4RGNA 3SK8A 4H44C 3DEPA 1ML0D 3SR1A 4FP5D 4PMWA 3U9OA 1JC7A 4ME5A 1PFMA 4RAUC 1MI2A 1SYGA 1UEAB 3BYTB 3K57A 5C4ZA 4KV6A 4K6DA 2OF1A 1IW7D 2VUMB 1FGBD 4C3JG 2JYOA 1SAPA 1GJXA 1YNJD 4DAYA 1TS5A 2F3VA 3C1FA 5JOBA 4C1NI 3AB9A 3I91A 2JSOA 2IW3A 1ZEQX 3Q24A 1GXDC 4K5VA 1PFBA 4HSVA 3DEOA 1C48A 5HGTA 5LHY1 4RCOA 2XNAC 2IJ0A 2KUMA 1EEFD 2XIWA 4J1MA 4OO1H 1JORA 2N88A 1F9PA 1GUSA 1BCPD 2F0KA 3G6JB 5C4XB 4IUTA 4XIGS 4QUFA 1BF4A 2XRQD 4C1NK 3D31A 4J8QA 1X32A 3O13A 2LMCB 5BN3A 2WIIB 3K58A 2IX1A 3TP5A 1GUGA 3PV0A 4CKEA 3A8JE 3GD7A 2EDGA 2EPBA 2FJ2A 1STNA 5KRUA 3MTSA 5C5LA 3R8BA 4XXEA 5M3MB 2NZ1D 5DM73 1SNOA 4JBWA 2ZXRA 3DWPA 1L0YB 1SNQA 2KQ3A 1SFOB 5JPMC 4K8IA 4FXDA 3IAYA 1SXTA 4ZQ3A 2O4XA 5IGCA 5CV8A 2K5WA 4DU9A 2WKCA 1NR4A 3MXPA 1WCMB 1MD2D 4G7OC 3KLSX 1VMPA 1R9TB 1C4QA 3NWTA 1SYEA 5ELFA 3EROA 3EA6A 4RCNA 3J81E 1LV9A 1H9KA 1BUVT 1A15A 4QF4A 3TZDA 5ELDA 3QOLA 2X69A 4QIWB 4CJ0B 3VYSA 3SXHA 1HUNA 3A7AB 4X3UA 1EU3A 3TP8A 1TIID 3H0GB 2JA6B 5D14A 5EJWA 1Y8NB 2L1BA 1LT6D 1EY0A 4XQQA 3I90A 3RZOB 3VR4A 5FO8B 2PZTA 3RZDB 1TS3A 2K7VA 4DF7A 2N55A 1STAA 2HDMA 1HTPA 1WTQA 2F0JA 1RODA 2F4IA 4WFN3 1SJED 3M4YA 5M5WB 5JJZA 1ESFA 3C1EA 3GO5A 1VCIA 3A8IE 2GA4B 1YNNC 5LL6S 1KABA 2B39A 1U4MA 4A3JB 5IGEA 4A3IB 1QWYA 2QDBA 4TRDA 5DM63 3J80L 2PZWA 4KK7A 2C5CA 3BG3A 1OXXK 1I4PA 1AEXA 5KYIA 1PZJD 1I6VC 2KOLA 4MIUA 5IOCA 5KNBA 1SEBD 4KD4A 1QCBD 1TY0A 2XN9C 2F0UA 4PQXA 2M2LA 5DNFA 1JOOA 1KDCA 1II3A 1S4ZA 1F9RA 2NBFA 5IGGA 5FOBB 1LACA 1TVXA 4EGVA 1LTAD 4IFDJ 5JVG3 2A68C 2EYPA 4BS9A 1AN8A 3URYA 3BDLA 1OXVA 2DNCA 2K03A 1DXMA 3AMUA 4FXGC 1LTSD 4DK1A 1HRJA 2BA1A 5TSSA 3M4OB 2ZXOA 1H9SB 1KLGD 2Q8TA 1I4QA 4EQOA 1IHZA 3NPPA 1CHPD 3GTJB 1GOZA 2E2DC 1NSNS 2PCFB 4FF1A 1HPCA 5E4XA 1FD7D 1WTXA 3L3OC 2EJFC 5G3LD 4ZRZA 1A2UA 2JXMB 2NTTA 1LTGD 4IFDH 3M7GA 3I73A 4M8AA 5IGBA 1SYDA 2VB2X 4ZUJA 2K1BA 3J7AV 1TWAB 1RKNA 4PNYA 3IFTA 2EOTA 3P75A 1B9MA 1F2YA 4TKOB 1JCKB 2R93B 2F0HA 5C6AA 1SMYD 1EYCA 1TWHB 2BE5D 2E2JB 3KK7A 1S5ED 1D1KA 1DOMA 1PRTF 5KYLA 4OIJA 4XT3B 1O7YA 3BDOA 5KNCA 4RGTA 4MN3A 5FO9B 4F8MA 3PUVA 4ULLA 1SJHD 1PTOF 2LS01 5C0XI 3H09A 5A35A 1R4QB 1EYAA 5JAVA 2K33A 1O7ZA 3F2UA 4KKTA 2F0NA 2YU9B 4Q0FA 3S2HB 4L63B 5K36H 3ND9A 3TN2A 3H94A 2SDFA 3K0YA 5EKLA 4XTCS 3M3YB 4K8JA 2RQXA 3EJIA 2VNUD 3HZXA 1ZYRD 3ERQA 2PW7A 3IL8A 2RDHA 5ELBA 3OIPA 2EE1A 4QUCA 3QWNA 4HMJA 1BOSA 1FR3A 5J22A 5E1FA 1BO0A 4ILWA 1DCZA 2B2YC 5I9OA 3FPPA 5EPLA 1V1OA 5CBEE 2FMMA 2F0QA 1JR0D 5I4DA 4C56C 4IUPA 1BXTA 1XWEA 2LKVA 1HHVA 2WP8J 1EWCA 1F77A 2LFNA 1CHQD 1J9OA 2NVTB 2CQAA 1SNDA 2K04A 1Q90A 5EKIA 5FLXL 1HUMA 1IYVA 1AZPA 1A2TA 4NMZA 1DOLA 1PZID 5JEAJ 1PZKD 5C3WA 2NUCA 4RKLA 4ZLTF 3HEJA 1C8CA 2R61A 5M3FB 5M9OA 1MGSA 3HP3A 5I2YA 4DFAA 4PMBA 1STBA 2A6ED 3CRKC 2K6AA 1EQTA 2RA4A 4P2CB 1FNVA 1WTWA 2SNMA 2VB3X 2Z1CA 2XSCA 2L9HA 1X3PA 1STEA 2PW5A 4XYOA 4DNTB 1PTOC 1QE6A 3BVMA 1KLUD 2KCCA 4C3IG 4ZAIA 2L12A 1VDZA 2IT1A 4K14A 2EYHA 5CORA 3SK4A 1OXSC 1F2MA 2EY5A 2WACA 2JP1A 2XRSD 4RGOS 3E5SA 5T1GA 5J39A 4ABNA 2Q8IB 4F88A 5DEHA 2QKIC 4XYQA 5JEAH 2AWNA 5CV9A 1LABA 1D1IA 2VXWA 5KEEA 1R4PB 4BY1B 3T13A 2D9UA 3GV3A 2B2VA 3S15B 1CFMA 1F2ZA 1S5CD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1II3 A;  3SHL A;  5HUR A;  5CV4 A;  2F0V A;  3OSO A;  5KYL A;  1EY4 A;  3QOJ A;  4YIJ A;  4NKL A;  2F0G A;  3SK6 A;  5HGT A;  5IGG A;  4IZ8 A;  2RBM A;  3SXH A;  1NUC A;  2LKV A;  5CGK A;  3MHB A;  5IGF A;  2M00 A;  1JOR A;  4J1M A;  4KTA A;  3TP8 A;  3BDC A;  4F8M A;  1A3V A;  1SNM A;  4K5W A;  3RUZ A;  4OL7 A;  2EYP A;  4NP5 A;  3TP7 A;  1JOQ A;  1SND A;  3BDL A;  1ENA A;  1EZ6 A;  3OMC A;  2EY1 A;  4NDX A;  3NK9 A;  4G57 A;  1EY0 A;  2EXZ A;  2OXP A;  2F0K A;  1EZ8 A;  4RKB A;  1A2T A;  2PZT A;  5CV6 A;  3OWF A;  4N9T A;  1EYA A;  4B9X A;  3QB3 A;  4H7B A;  4NMZ A;  5JAV A;  2EY2 A;  1EY7 A;  3OMG A;  5C4H A;  4DF7 A;  5KIX A;  5J1Z A;  4DGZ A;  4RKL A;  1STA A;  2NUC A;  2F0N A;  5C3W A;  3HEJ A;  2PYK A;  2F0J A;  5F2D A;  4ID6 A;  4I65 A;  1EY8 A;  2F3W A;  3T16 A;  4N9P A;  5M9O A;  5IIF A;  4WRD A;  5IOC A;  4EVO A;  2SNS A;  3TP5 A;  4WOR A;  4PMC A;  4EQO A;  1IHZ A;  2F0D A;  1ENC A;  1EYD A;  4IUN A;  4ODG A;  4K2K A;  3TP6 A;  4KY6 A;  4KY7 A;  5EKL A;  2EYJ A;  4DFA A;  2F0M A;  3D4D A;  3ITP A;  3C1E A;  4PMB A;  2PZU A;  3SK8 A;  5IOD A;  1STB A;  5CV7 A;  3SK5 A;  2EYM A;  1EY5 A;  1STN A;  3P1H A;  3R3O A;  4K5X A;  1NSN S;  1TT2 A;  5C5M A;  3SR1 A;  3D4W A;  5C5L A;  5KRU A;  3NUC A;  4K8J A;  4QB4 A;  5I6Y A;  2SNM A;  3EJI A;  5CC4 A;  2F0L A;  2EYL A;  3PMF A;  3MVV A;  4ME5 A;  5DAU A;  3U9O A;  2PQE A;  3HZX A;  2F0O A;  1KAB A;  1EY9 A;  1STY A;  3NXW A;  1SYG A;  2F0P A;  1KDA A;  3LX0 A;  2F0E A;  2PW5 A;  4EQP A;  3S9W A;  1SNO A;  1A2U A;  3ERQ A;  2PW7 A;  5IGE A;  5C4Z A;  3DMU A;  3H6M A;  4K6D A;  2QDB A;  4KV6 A;  2OF1 A;  1STG A;  4B9W A;  5KGU A;  3NHH A;  4F7X A;  1SNQ A;  2OEO A;  4TRD A;  2KQ3 A;  2EY6 A;  2F0F A;  1JOK A;  4KJO A;  5I6W A;  5CR3 A;  4K8I A;  1SYF A;  2EYF A;  2PZW A;  3DHQ A;  4HMI A;  5IGB A;  1SYD A;  1SYB A;  4HMJ A;  5EKK A;  3TME A;  1KAA A;  2F3V A;  2RDF A;  2EYH A;  3C1F A;  4K14 A;  4ZUJ A;  5JOB A;  5J22 A;  4ZQ3 A;  3NQT A;  1F2M A;  2EY5 A;  2WAC A;  2O4X A;  4K2L A;  5CV8 A;  3SK4 A;  3D8G A;  5E1F A;  1EY6 A;  4DU9 A;  5IGC A;  1RKN A;  1SNP A;  4PNY A;  3E5S A;  5CV5 A;  5EGT A;  3MXP A;  3P75 A;  1EQV A;  4KHV A;  1TQO A;  4KJN A;  3VA5 A;  5J39 A;  1F2Y A;  2F0T A;  4HTH A;  4KY5 A;  5K5P A;  3D6C A;  4R8N A;  2F0I A;  5IGD A;  5DEH A;  5I9P A;  2KHS A;  2F0H A;  1SYE A;  4ZUI A;  5C3X A;  2F0S A;  3ERO A;  1SNC A;  5ISR A;  1AEX A;  5CV9 A;  5C6A A;  1EYC A;  2F0W A;  5KYI A;  5NUC A;  1A3T A;  2ENB A;  1SYC A;  4QMG A;  4J6H A;  4MIU A;  4K5V A;  4S3S A;  3MZ5 A;  3V2T A;  3EVQ A;  5I9O A;  2RKS A;  3NP8 A;  5E3F A;  1KDB A;  3MEH A;  4EQN A;  2HQE A;  5KEE A;  4KD4 A;  4KD3 A;  2SOB A;  2F0U A;  3T13 A;  4IAL A;  1STH A;  1A3U A;  4QF4 A;  2EYO A;  1TR5 A;  1JOO A;  4E6I A;  1KDC A;  2F0Q A;  1F2Z A;  3QOL A;  1U9R A;  4LAA A; 
#chains in the Genus database with same CATH topology
 1JWU D;  3FKI B;  4RH6 A;  5FLM H;  2NN6 G;  2N49 A;  1V8Q A;  3CF5 A;  3T56 B;  2BA0 A;  3TQY A;  3PIP 3;  5EPJ A;  2I46 A;  1S5F D;  1KD1 C;  4BBR B;  1I3Q H;  4IQZ A;  3A8K E;  1EYG A;  3C2P A;  2ZM6 L;  3JAM E;  4CJ2 C;  1JOQ A;  3C3L A;  2UXD Q;  3BYY B;  1B53 A;  2B2W A;  2JN4 A;  3LWU A;  3M4Q A;  3ZYY X;  2CCZ A;  1I4G A;  4N9T A;  4EQ5 A;  1UEB A;  1SE8 A;  4POF A;  4A93 B;  2PI2 E;  1I50 B;  5KIX A;  1LTI D;  4A3D B;  2V4D A;  1H9R A;  3E9I A;  3E6Z X;  2E2I B;  3GTL H;  2JA8 B;  1HCZ A;  5IYD H;  1E1T A;  4ODG A;  4R4Q A;  3BJU A;  5IT9 L;  5IOD A;  1N9W A;  3LGJ A;  4DAP A;  5CV7 A;  3BZD B;  1EY5 A;  1DGS A;  3NUC A;  4X64 L;  4QB4 A;  2R92 G;  2XGT A;  1W6J A;  2HDL A;  3K0X A;  5C44 G;  1JB3 A;  3R2I A;  3EN2 A;  4RFB A;  4CJ1 B;  4GOP C;  2R93 G;  2X6G A;  1NR2 A;  1S5B D;  1G6P A;  4HJA A;  1BKB A;  2Y0S B;  5CR3 A;  3CCL A;  2Y0S E;  3KDF A;  4KHZ A;  5EKK A;  2J4X A;  5COY A;  4A3E H;  4FF3 A;  1EOT A;  4LJZ C;  2KCT A;  2F52 A;  1GUO A;  2AQ1 B;  4JC0 A;  3EBE A;  1AZQ A;  4IUQ A;  3M3Y H;  2WAQ G;  2NVY H;  1SNC A;  1U4P A;  1RIP A;  2F0W A;  1TY2 A;  3OYY A;  4A3G H;  1T5E A;  1SRU A;  4OO1 G;  4KHP Q;  4DR5 L;  2A6H C;  1HNW Q;  2CW0 C;  2EYO A;  2KJX A;  3VYT A;  2K5N A;  1O80 A;  3NBH A;  4JCV E;  2R6G A;  2JEA I;  3SDZ A;  4JYA L;  1QVG A;  1BBX C;  1UAP A;  1OTC A;  4KTA A;  1SNM A;  4K5W A;  2ZTE A;  2OQK A;  4DV0 Q;  4GZY C;  3D0F A;  1Y1W H;  1ENA A;  1EZ6 A;  3OMC A;  3I72 A;  2VL6 A;  3QB3 A;  5IWA L;  4BBS G;  1PYB A;  1ILP A;  4YWM A;  2G9D A;  1GUN A;  3CQZ H;  4JOI A;  2B2U C;  1DZ1 A;  1PV4 A;  3AU7 A;  1L1O A;  1WFQ A;  3CCE A;  4PZ7 A;  1XNR Q;  1VF5 C;  4B3S Q;  4L8J A;  1OO9 B;  1HNZ Q;  1HFG A;  1K83 B;  1BNZ A;  5BR8 Q;  3RR5 A;  2F0D A;  3PUY A;  1PTO H;  1SN8 A;  4KY7 A;  1OXT A;  3NSW A;  4DV0 L;  4UP8 A;  4BY7 G;  1LT3 D;  1N34 Q;  4YCV A;  3K5L A;  1TT2 A;  1OXU A;  2Z6K C;  5IP9 H;  2B63 G;  4DR2 L;  4A3F H;  2VQF Q;  5I6Y A;  2VY3 A;  4N8F A;  3BVZ A;  2F0L A;  2IX3 A;  1SE2 A;  1JWM D;  2HCI A;  3DMU A;  3H6M A;  1QB5 D;  1TWG H;  2LY7 A;  4CHT B;  3AEV A;  3GTO H;  4X6A H;  1XNR L;  2A8V A;  2OEO A;  3R2T A;  2G5D A;  1B44 D;  4IPH A;  1HNZ L;  5C3E H;  1CTM A;  3H91 A;  1YJW A;  5BR8 L;  3NBI A;  1PXU A;  1QUQ A;  2L0C A;  3OWE B;  4IN3 A;  1RHP A;  2DY7 A;  3IKJ A;  4OGQ C;  3N6R A;  4BA2 I;  1Q81 C;  2AUJ D;  3D8G A;  2KED A;  3SE0 A;  1WTO A;  4ZKC B;  2V1C C;  2VQF L;  2A74 C;  4UY8 C;  3I4M B;  3PO2 G;  3HRZ C;  2ICI A;  5IYB G;  4H0L C;  1HFN A;  5FKA C;  2A5H A;  2XWJ B;  2E5L Q;  4QJF A;  5C3X A;  4ZUI A;  5ISR A;  2R7D A;  1B1Z A;  4QMG A;  2NVX B;  3NTK A;  3K7A B;  4KKS A;  1Q46 A;  1KDB A;  4JPB W;  1JE4 A;  4KD3 A;  4P75 A;  3PUW A;  1PYW D;  1STH A;  4GNX C;  3PF5 A;  2ZTD A;  1K3B C;  1QG7 A;  4KN4 C;  3J80 i;  3SHL A;  2K01 A;  2XVS A;  3SK6 A;  4G4K A;  3PO3 B;  4PV1 C;  1AW7 A;  1YIJ A;  2M00 A;  3UDG A;  4R1J A;  2E5L L;  3P20 A;  4NP5 A;  4G57 A;  1ILQ A;  4C3I B;  3HOV G;  5IT9 E;  2EXZ A;  5AFW A;  3BU2 A;  3CHB D;  5CV6 A;  1PVO A;  2BDN A;  2KCM A;  1PDQ A;  1VQK A;  3OMG A;  3RD4 A;  1B2T A;  5C4H A;  2OTJ A;  4DGZ A;  1JQY D;  2RHS B;  2MJ8 A;  3STB C;  1BCP F;  3CXC A;  2VUM H;  4ID6 A;  5GAE C;  2Z4I A;  1L0X B;  4WRD A;  3FMC A;  4EVO A;  2CHB D;  1VQJ A;  4TQU S;  3EFX D;  1E2Z A;  3FPU B;  3D4D A;  2PZU A;  1YI2 A;  4LFC Q;  3PUX A;  2ZTC A;  1NMF A;  1ICF B;  1MSG A;  3CRL C;  4GN5 A;  3GTQ B;  5DAU A;  3MVV A;  4AH6 A;  1HH2 P;  3OW7 A;  2F0O A;  2MHV A;  3NXW A;  3S9W A;  4KI0 A;  1IYJ B;  3RLF A;  4X65 L;  4OHJ A;  1LYL A;  4CDC C;  4LWC A;  3NWS A;  2FIN B;  1Y69 U;  2Z4H A;  1KXL A;  5LMN W;  1CSQ A;  1SYB A;  3I56 A;  3HOZ B;  1J6Q A;  1RDP D;  2B29 A;  1E2V A;  4KMU C;  1VQ8 A;  4LFC L;  1Q3L A;  1RTO A;  3RNU A;  2B2T C;  3G7L A;  1RTN A;  1B3Q A;  2K5V A;  4GKK L;  5A2Q L;  5C4X H;  2JA5 G;  2JE6 I;  4DV7 Q;  4J6H A;  3LNN A;  1ASZ A;  4EQN A;  2A69 C;  1A6X A;  1EIG A;  1UUP A;  3UE1 A;  3J7A F;  2K28 A;  4V19 0;  2R92 B;  3GP7 A;  4RG1 A;  1F2L A;  2O2L D;  1X3E A;  1C0A A;  2I5L X;  1EIH A;  5C44 B;  1NMG A;  1NUC A;  2CW0 D;  5CGK A;  3I4N G;  1D8L A;  1CT1 D;  4OXP A;  4LUV A;  4HAE A;  1Q1B A;  1VQ4 A;  4OWW B;  4DUZ L;  1WVL A;  5M5X B;  1J5E L;  1BCP B;  2J7Z A;  4AQY L;  4DV7 L;  5M3M H;  2EVB A;  2H1E A;  3OWF A;  1FJG Q;  4GLV B;  3T51 B;  4JBJ A;  1IW7 C;  3T1Y Q;  2UUA Q;  3KJO A;  1EFW A;  1JIC A;  3TS2 A;  2HCC A;  4M1U B;  1SFO H;  1VQA A;  4R9W A;  4ALP A;  2D62 A;  3VYU A;  3VR2 A;  4IO9 A;  1YNJ C;  1QNU A;  4G7Z C;  2WAQ B;  2CVR A;  4I7Z C;  1A8V A;  1LTT D;  3WDN A;  3S2D B;  3TBI B;  1X6O A;  2WAQ E;  2FFK B;  1D2B A;  1KIX A;  4C3H B;  1LTR D;  3W2D A;  3T4A C;  1WCM H;  4IFD G;  2Z6B A;  3MXU A;  5CC4 A;  1FJG L;  3PMF A;  3J7Z C;  2F0P A;  3T1Y L;  1PH9 A;  2UUA L;  1E0B A;  3JAM c;  1F9S A;  1EIF A;  1QNK A;  1I6H B;  5EPK A;  3TRZ A;  1STG A;  1PYS B;  3I3C A;  2ALY B;  3A55 A;  3F1Z A;  5I6W A;  1PH3 A;  3NEL A;  1SYF A;  4XDX A;  3U50 C;  5C0X J;  3MA2 B;  3J80 E;  1I94 Q;  3WOE A;  1EIY B;  1HA5 A;  1WTP A;  3OPO A;  2WV6 D;  4BBS B;  2JJQ A;  1LT4 D;  2UU9 Q;  2DN8 A;  4IUV A;  5EGT A;  3H0G H;  2JA6 H;  4KHV A;  4WJ3 M;  4L6T B;  5K5P A;  3A7L A;  4R8N A;  1TKW B;  2BCO A;  3V05 A;  2F0S A;  4YCU A;  3RZO H;  2PNR C;  1YNN D;  4B3R L;  3RZD H;  2JA7 G;  5GAG C;  1EEI D;  4GN4 B;  2IPK D;  1KHI A;  2F1M A;  5FK9 C;  3HOU G;  1FGU A;  2IX0 A;  3HOW G;  4BY7 B;  4FF2 A;  2EQS A;  1TR5 A;  2E76 C;  4XT1 B;  2B63 B;  1I94 L;  1U9R A;  2QCP X;  4B9W A;  3FDT A;  5M5W H;  3U9S A;  4CDD C;  4YIJ A;  1ESR A;  3KDF B;  3HFZ B;  1JJC B;  1X3Q A;  1NCV A;  3CKI B;  1VQM A;  2UXB Q;  3DLL A;  3N52 A;  5IGF A;  1HXY D;  3TDQ A;  2NN6 I;  2MP1 A;  3K59 A;  4FDB A;  2RSN A;  2EY1 A;  3L7Z C;  4A76 A;  1LTB D;  3S17 B;  4B9X A;  4H7B A;  1I4H A;  4DK6 C;  5C0X H;  4JV5 Q;  4MHE A;  1JJ2 A;  4A3I H;  1KAW A;  5EAY A;  1BBW A;  1CZG A;  3PO2 B;  1FVI A;  1U4R A;  2K75 A;  5BN4 A;  2CFM A;  1EY8 A;  3T16 A;  4L5R C;  4N9P A;  3GTK B;  3CCQ A;  4UAI A;  2ATW A;  2ICE C;  2L5T A;  2UXB L;  3NBH B;  1CQV A;  1IL8 A;  3KF6 A;  1VQP A;  3OIQ A;  4A3C H;  2EYJ A;  1PH8 A;  2XWB B;  3W5O A;  4X66 Q;  2A68 D;  4DPG A;  2Z8L A;  3W3A A;  2Q2H A;  4K0K Q;  4NB3 A;  4JV5 L;  4IOA A;  1K8O A;  1KDA A;  1G91 A;  1NJI C;  3J81 c;  3GTP B;  1TU2 B;  3RMH A;  4RWS C;  4FO2 A;  3TS0 A;  2RCF A;  1I4R A;  1BDO A;  1MSH A;  1XTC D;  2EYF A;  2K5H A;  3FRP B;  1IKL A;  4DN4 M;  1L1O B;  1CQF A;  3HOV B;  1C7Y A;  3M9B A;  1M4V A;  5G3L F;  1XMQ Q;  4DAV A;  1DYQ A;  1WOC A;  2PNH A;  3D6W A;  1IZ6 A;  1PRT C;  4JW0 A;  3VYR A;  4POG A;  1YJN A;  1WTR A;  2M9V A;  1TQO A;  2H5X A;  2F0T A;  2PQA A;  5CYU A;  4K0K L;  1BBU A;  4LNQ A;  1QOH A;  2KHS A;  2L4N A;  2N78 A;  3J81 L;  4A3M B;  4F87 A;  1T9H A;  5NUC A;  1A3T A;  5D65 A;  2HQL A;  3MZ5 A;  4JI0 L;  2O5J C;  3X3N A;  1K8A C;  5H1S E;  2KCN A;  4A3B G;  3TEH B;  3HS0 C;  4LFB Q;  3M4O H;  1L0W A;  1MJE A;  1X3G A;  3PIO A;  2K05 A;  2K52 A;  1SDF A;  1XMQ L;  4LAA A;  2A69 D;  4OO1 I;  2EJG C;  2WB1 G;  2E2H B;  1QUQ B;  1WJJ A;  5LL6 X;  3GTJ H;  4RGM A;  4XQN A;  3GDE A;  3M7N A;  4RMF A;  2MGS A;  1Z47 A;  4BA1 I;  1TS4 A;  1YEZ A;  2Q2U A;  4Q5V A;  4FVM A;  3H3V I;  2R7Z B;  4DK3 C;  4LFB L;  1GUW A;  4DXF A;  2JK8 A;  5J1Z A;  4GKJ Q;  2DNE A;  4Z9C B;  1V1P A;  1AP0 A;  1XYI A;  2J0T D;  1Y1V B;  5M5Y B;  4IPD A;  2JA5 B;  4PMC A;  2NZO A;  4KN7 C;  2ID0 A;  4K2K A;  1BQQ T;  1TWA H;  1X3F A;  4DV6 Q;  2FXQ A;  3HOZ G;  1RJT A;  4LF8 Q;  1V9P A;  2R3Z A;  1Q82 C;  4TSS A;  3S1N B;  2EJM A;  2KVM A;  2R93 H;  2K5D A;  1ENF A;  1TWH H;  2B8G A;  3F2C A;  4JI5 Q;  4GKJ L;  2E2J H;  3I4N B;  1GD7 A;  1NAP A;  4X3T A;  4UHV A;  2B2Y A;  1K9M C;  1CI3 M;  1JJG A;  4F7X A;  1JOK A;  2EZV A;  2I5H A;  1LT5 D;  2O5I C;  4JBM A;  5JEA G;  1YVC A;  1EU4 A;  4HMI A;  3ONA B;  1O7I A;  2UXD L;  2QEX A;  2RDF A;  3K6O A;  3UDI A;  4JI7 Q;  3KBG A;  1G8Z D;  4LFA Q;  4H13 C;  1Y8O B;  4LF8 L;  1SE4 A;  5I2X A;  4MTK A;  3VA5 A;  1B3A A;  4KJN A;  4O42 A;  4JVZ A;  3D6C A;  3EQL C;  2D2C C;  1FYC A;  3TZU A;  5FLM G;  3GTG B;  4JI5 L;  1T5X D;  3OOC A;  1CA5 A;  1J8I A;  2ENB A;  1XPO A;  3C46 A;  5ELC A;  3EVQ A;  3NP8 A;  4YHH Q;  3MEH A;  3SVM A;  2HQE A;  4QCL A;  2SOB A;  3MWY W;  4O1N A;  4L5T A;  2YU9 H;  3LWE A;  3S2H H;  4WJW A;  1W6K A;  4JI7 L;  3MXG A;  3I55 A;  4HN7 A;  4KLK A;  3JC6 6;  1A62 A;  2ZXP A;  3S16 B;  2HHH Q;  3DM3 A;  3NEM A;  3CD6 A;  3PIO 3;  4P73 A;  3UI2 A;  2KHJ A;  3E9H A;  4DXG A;  3BDC A;  3RUZ A;  4UPA A;  1CKO A;  1P8L A;  4OIK A;  4RHS A;  1C9O A;  3KLW A;  1K3R A;  1VS0 A;  2YYZ A;  4C3H G;  3E0J A;  1S5D D;  5IYD G;  3K80 C;  5FLX E;  2BOS A;  3NTI A;  4LMQ D;  3J7Y W;  2EY2 A;  4P71 A;  1VF7 A;  5JVH 3;  1GUT A;  3MFG A;  1XXG A;  1YIT A;  1KRS A;  4JI3 Q;  1VQC A;  2VQE Q;  4DK0 A;  2RDG A;  3NQI A;  4HCS A;  4P72 A;  5F2D A;  3QIA A;  1YJ9 A;  2HHH L;  2JA7 B;  3TP6 A;  1EYD A;  1K8M A;  3CPF A;  1V1Q A;  1ET6 A;  3ITP A;  3HOU B;  4DR4 Q;  2VS1 A;  2TMP A;  4K5X A;  5C5M A;  1VQD A;  1RL2 A;  3TRE A;  3HOW B;  2GN5 A;  4DR6 Q;  1G2T A;  3S1R B;  3BZC A;  4KHP L;  1SMY C;  1EQQ A;  1HNW L;  2BE5 C;  1G29 1;  4FNF A;  1WD1 A;  1IBM Q;  1AFP A;  4A3E G;  4JI2 Q;  1KQS A;  3LX0 A;  1DM0 B;  2F0E A;  4IJL A;  3K7U C;  3IFD A;  4JI3 L;  2VQE L;  4R4O A;  2NYZ D;  2SEB D;  3NHH A;  2DY8 A;  4KJO A;  2B8F A;  1ICW A;  2NWG A;  1QVF A;  5EQ0 A;  2NTS A;  2KEN A;  2ASB A;  1KAA A;  4DV2 Q;  4A3G G;  1PLF A;  4X62 Q;  4DR4 L;  2QIL A;  4K2L A;  4R4I A;  3J7A 5;  1EY6 A;  1SNP A;  1HA6 A;  2D0P A;  1BR9 A;  1SE3 A;  4HTH A;  2NVT H;  1HQR D;  1IBM L;  4JI4 Q;  5I9P A;  5C4J B;  4JI2 L;  1PRT D;  1ASY A;  4DNR B;  3A74 A;  2X6L A;  4K6L A;  3X3M A;  5FJ8 G;  4B3S L;  4ZK9 B;  4OEL B;  1X9N A;  4B08 A;  2I5M X;  2ZJP A;  1IBL Q;  4JI1 Q;  1CK1 A;  4BWG B;  1Q8I A;  1Y1W G;  2MUY A;  3QO2 A;  2Q8R E;  1HTL D;  1N34 L;  5M3F H;  1PTO D;  4X62 L;  3U4Z A;  4AYB G;  1EL0 A;  3QOJ A;  3TSS A;  2F0G A;  4IZ8 A;  2RBM A;  4Y7N B;  1GM5 A;  4UDU C;  4BXX H;  4HJ9 A;  4ZYS A;  2I07 B;  2MO1 A;  3S1M B;  4JI4 L;  3I4O A;  3TP7 A;  3J80 c;  1FNW A;  1ZYR C;  2NVQ B;  4NW2 A;  2UXC Q;  3T53 B;  2OXP A;  1MBY A;  2GVA A;  3Q23 A;  1VMC A;  4RKB A;  3VA7 A;  3A54 A;  3BVG A;  5EBC A;  3I70 A;  1IBL L;  2DGY A;  3CP0 A;  4JI1 L;  1PH4 A;  2C35 B;  1UE6 A;  1EY7 A;  4R4T A;  1TWC B;  1B9N A;  5EBD A;  3OHX C;  4A3F G;  1ZXT A;  4GOP A;  2PYK A;  3HOX G;  3A56 A;  3OTO Q;  1VQ5 A;  4CKC A;  5AJ3 Q;  2F3W A;  1EOV A;  3RN5 A;  3HKZ G;  4IUR A;  4WOR A;  3ULP A;  3AQQ A;  2WIN B;  3QG1 A;  3CU7 A;  3S14 B;  4IUN A;  4DNI A;  2PPB C;  2ZJR A;  4KY6 A;  4YY3 Q;  5IGD A;  5FO7 B;  4CKB A;  4RA8 A;  1CKM A;  3SK5 A;  4A3B B;  2EYM A;  1NE3 A;  3HGB A;  5D3D A;  2UXC L;  1TWF B;  3QJY A;  1U4L A;  1X65 A;  2EYL A;  2WKD A;  3ER0 A;  2PQE A;  2CKZ B;  1SSO A;  3E3X A;  2LXK A;  1B4O A;  2WB1 B;  2OT2 A;  4IFD I;  1F9Q A;  4BY1 H;  4R8I A;  2WB1 E;  4A3M G;  5CBA E;  2ZJQ A;  1DOK A;  5AJ3 L;  3HOY B;  3S15 H;  2NB0 A;  3GTM B;  1CZW A;  1G6Z A;  3DHQ A;  1HZB A;  3FKI H;  2AMC B;  4YY3 L;  3F2B A;  1I5F A;  2KA7 A;  1TS2 A;  1VQL A;  1LO5 D;  4BBR H;  3NQT A;  3KBX A;  1W3S A;  1V43 A;  3KF6 B;  1D5M C;  3IRB A;  1LM0 A;  5CV5 A;  4EX5 A;  2RVL A;  2MNA A;  2CWP A;  2MPM A;  3HG9 A;  4A3K B;  2K32 A;  3D4R A;  5CMD A;  3MEF A;  2FMC A;  1HJP A;  2TSS A;  4S3S A;  4OX9 Q;  1B8A A;  1I4X A;  4C3J B;  1WYD A;  1X56 A;  4A93 H;  4J15 A;  1CUK A;  1I50 H;  4UP9 A;  3S1Q B;  3MFY A;  4A3D H;  4FXK C;  3NTH A;  2PO4 A;  2R7Z G;  2E2I H;  2D0O A;  4LUO A;  2JA8 H;  2HUG A;  2B2U A;  1FNU A;  5CV4 A;  2F0V A;  3OSO A;  2AQ2 B;  2ZT9 C;  4DA2 A;  3K5M A;  2OWO A;  4NKL A;  1WD0 A;  5J3B A;  3U4V A;  1CA6 A;  2A6E C;  3OW2 A;  1Y1V G;  3DXJ C;  4HIM A;  1KTK A;  3AFP A;  5DLQ E;  3D3R A;  3CMA A;  3FVQ A;  1ET9 A;  2Z6K A;  2PQA B;  1YBY A;  4X3K A;  4X3S A;  4HED A;  4IPG A;  1KNE A;  4U67 3;  4JI6 Q;  4LF6 Q;  3DWQ A;  2A6H D;  2A1A A;  1RD9 D;  3L9A X;  4HJ7 A;  5IP7 G;  4AIM A;  2SNS A;  4HCE A;  1SRO A;  2AQ3 B;  5E4W C;  3CC4 A;  4FYD A;  1ENC A;  1I3Q B;  3Q0A A;  1AE2 A;  2P5Z X;  3R3O A;  1IKM A;  3D4W A;  4DUY Q;  2YTY A;  4FF4 A;  1D5Z C;  3Q22 A;  1CSP A;  1AH9 A;  1D6E C;  1EY9 A;  1O78 A;  1STY A;  4QY7 A;  1ONL A;  4EQP A;  1LUZ A;  4JI6 L;  3WOF A;  4LF6 L;  5KGU A;  4HJ8 A;  3Q6S A;  2JEB I;  3MXN A;  3GTL B;  4GNX A;  3KFU A;  3ND8 A;  4CGY B;  5C4X G;  3KLS A;  1WI5 A;  1V1P B;  3TME A;  1G2S A;  4LK1 C;  4OWT B;  2QEJ C;  2RSO A;  3KUP A;  3A5Z B;  1YNX A;  2BDO A;  2L15 A;  4KY5 A;  4CDF C;  2F0I A;  1LLR D;  2QW7 A;  2KEC A;  2IL8 A;  4KKU A;  5JPN C;  2HIX A;  4A3L G;  1KNA A;  1Q12 A;  1DJR D;  3V2T A;  1CKN A;  2RKS A;  3S24 A;  3SEB A;  1A63 A;  1B50 A;  4IAL A;  5JJI A;  3GV6 A;  1A3U A;  4E6I A;  1XX8 A;  1WTV A;  4JBK A;  2PMZ B;  2K50 A;  5M3M G;  4H02 A;  2L55 A;  1K83 H;  2PMZ E;  1EUJ A;  1GHK A;  1BCP C;  4A3E B;  3KLR A;  3FEW X;  3B6Y A;  3JAM L;  3MC0 B;  4GS3 A;  2G9H D;  1A3V A;  3MAQ A;  2JA9 A;  2AWO A;  3I4L A;  1CM9 A;  4NDX A;  2A19 A;  1XTD A;  3EIV A;  3VR3 A;  2NVY B;  4U68 A;  3V96 A;  4A3G B;  1H9J A;  2B2V C;  2HD3 A;  3DUZ A;  1JB7 A;  3ZJY C;  4V0B A;  2KBN A;  1A0I A;  1DD2 A;  2EXD A;  3KOJ A;  2UU9 L;  4IUU A;  5IIF A;  4CBV A;  1XNQ Q;  3PUZ A;  1N36 Q;  3DM1 A;  5KND A;  4HIK A;  2F0M A;  5K36 G;  4ZKB B;  3I4M H;  3P1H A;  2B2W C;  1H9M A;  3VR6 A;  1Y1W B;  2RCN A;  4G7H C;  2Q2T A;  1PMR A;  3H3V C;  1EFI D;  2Z9H A;  4AYB B;  2B2T A;  2NVX H;  1RF2 D;  3K7A H;  1D5X C;  5LMU Q;  4AYB E;  3KF8 A;  1PRT B;  1JWS D;  2H4O A;  5IYC H;  3CQZ B;  2F03 A;  5HGQ A;  2EY6 A;  2F0F A;  3BZK A;  4DV4 Q;  2AUK A;  1XNQ L;  4JI8 Q;  4QGU A;  3STB D;  5FLX c;  3PIP A;  1Y8P B;  2IHE A;  1DON A;  4JK1 C;  2GVB A;  5D3I B;  1PTO B;  3PO3 H;  3CCR A;  3DWA A;  3I8Z A;  1MHW C;  2VW9 A;  1U5K A;  5LMN Q;  1QZG A;  2FHT A;  4HJ5 A;  1Z6H A;  1EQV A;  5ELE A;  5T1I A;  4A3F B;  3HOX B;  2UUC Q;  3VR5 A;  2E74 C;  4C3I H;  4HSP A;  3Q8D A;  3HKZ B;  2CH4 W;  2QF7 A;  2IWH A;  3H15 A;  5LMU L;  5A2Q E;  1GHJ A;  1HZA A;  1SYC A;  3K5O A;  5BN5 A;  3HKZ E;  4RHR A;  4LF7 Q;  5E3F A;  4LW1 A;  1FL0 A;  2D5D A;  1UE5 A;  1O7L A;  4DV4 L;  3GTO B;  1TWG B;  1E2W A;  4JI8 L;  3UE0 A;  1H9S A;  3PF4 A;  3PSI A;  3P7J A;  4DV3 Q;  5C3E B;  1XPU A;  1Z7T A;  4C2M B;  5HUR A;  3KYH C;  1QJO A;  4X66 L;  1EY4 A;  1ZKO A;  1SBB B;  1HQM C;  1RCV D;  2E75 C;  3NE5 B;  1EWH A;  1GKH A;  2CQO A;  5C0X G;  3MHB A;  4A3J G;  1UNS A;  2A73 B;  4A3I G;  2CH4 A;  2UUC L;  2KEE A;  3BS1 A;  4OL7 A;  4XQJ A;  2VZA A;  3NK9 A;  1B7Y B;  2L11 A;  3R93 A;  3GTQ H;  3K5N A;  3J81 i;  1EZ8 A;  2NN6 H;  1VQG A;  2Z0S A;  4GN3 B;  3W1B A;  3GQB A;  2C9O A;  3M85 A;  4ME3 A;  5ELO A;  2K5Q A;  1Q1E A;  4DV3 L;  1PFN A;  2YTX A;  3CCS A;  4HR7 B;  4I65 A;  1IYU A;  3G6E A;  1QIL A;  1K28 A;  5GRO A;  1M8A A;  1TXY A;  3HOZ H;  2K14 A;  1IBK Q;  3HOY G;  1HNX Q;  3T1H Q;  4RGN A;  4MZ9 A;  3SK8 A;  4H44 C;  3DEP A;  1ML0 D;  3SR1 A;  4FP5 D;  4PMW A;  4NPS A;  1JC7 A;  4ME5 A;  1PFM A;  3U9O A;  4RAU C;  4A4I A;  2XTI A;  1M90 C;  1MI2 A;  1SYG A;  1YHB A;  4JOI C;  4PZ8 A;  4WJ4 A;  1UEA B;  2B3G A;  3BYT B;  3K57 A;  1L1O C;  3G71 A;  3J81 j;  5C4Z A;  4A3K G;  4KV6 A;  4K6D A;  1VQ7 A;  3RLO A;  2OF1 A;  1IW7 D;  4LUZ A;  2VUM B;  1FGB D;  4C3J G;  4O2D A;  1IBK L;  2JYO A;  2R92 H;  1SAP A;  4GOP B;  1HNX L;  1GJX A;  3T1H L;  1YNJ D;  4DAY A;  1TS5 A;  2F3V A;  3C1F A;  4I7A A;  5JOB A;  5C44 H;  4C1N I;  3AB9 A;  3W1G A;  3I91 A;  1Q7Y C;  5M5X H;  2JSO A;  3SGI A;  5GQO A;  1E24 A;  2IW3 A;  3KJP A;  4L5Q A;  1ZEQ X;  3Q24 A;  3U58 A;  1GXD C;  1PH1 A;  4K5V A;  5IT9 c;  1BVS A;  1PFB A;  4X64 Q;  4MTN A;  3AYH B;  4HSV A;  3I7F A;  4DV6 L;  4LF9 Q;  3DEO A;  1C48 A;  3CCV A;  3S2D H;  4QQB X;  5HGT A;  5LHY 1;  4RCO A;  2XNA C;  3M4P A;  2IJ0 A;  2KUM A;  1VQ9 A;  1HR0 Q;  1EEF D;  4C3H H;  2XIW A;  4J1M A;  4OO1 H;  1JOR A;  2N8N A;  2N88 A;  1F9P A;  1K0R A;  1E3P A;  1GUS A;  1YZ6 A;  1BCP D;  2F0K A;  1B70 B;  3G6J B;  5C4X B;  3I2Z A;  4IUT A;  4XIG S;  4QUF A;  1BF4 A;  2XRQ D;  1Q86 C;  1PA6 A;  1I6H H;  3H3V H;  4C1N K;  3D31 A;  1KRT A;  1XPR A;  4LF9 L;  4J8Q A;  1X32 A;  4LFA L;  3O13 A;  2LMC B;  1MJC A;  5BN3 A;  2OTL A;  2WII B;  3K58 A;  4LF5 Q;  2IX1 A;  3TP5 A;  1JT8 A;  3F8T A;  1HR0 L;  4DR5 Q;  1GUG A;  3PV0 A;  4DV5 Q;  4CKE A;  4BBS H;  3A8J E;  3GD7 A;  2EDG A;  2EPB A;  2FJ2 A;  1STN A;  5KRU A;  4YHH L;  3MTS A;  5C5L A;  3R8B A;  3ULJ A;  1N32 Q;  4XXE A;  1K73 C;  4JYA Q;  2CWA A;  5M3M B;  4DKA C;  2NZ1 D;  5DM7 3;  1SNO A;  4OON A;  1PH7 A;  4JBW A;  2ZXR A;  3DWP A;  1L0Y B;  4BY7 H;  1SNQ A;  2KQ3 A;  1XMO Q;  1SFO B;  5JPM C;  2B63 H;  4LF5 L;  4K8I A;  4FXD A;  5IWA Q;  1XJV A;  4DV5 L;  3IAY A;  1SXT A;  2HIV A;  4ZQ3 A;  2O4X A;  4DU9 A;  5CV8 A;  2K5W A;  5IGC A;  1N32 L;  2WKC A;  1NR4 A;  3MXP A;  1WCM B;  1MD2 D;  4G7O C;  3KLS X;  5FJ8 H;  1VMP A;  1R9T B;  1C4Q A;  3NWT A;  1SYE A;  3K81 C;  5ELF A;  3ERO A;  3EA6 A;  4RCN A;  4ZCK A;  2YTV A;  3J81 E;  1S3O A;  1LV9 A;  3S17 H;  2LXJ A;  1H9K A;  4DR2 Q;  1XMO L;  1BUV T;  1A15 A;  2RHQ B;  1MKH A;  4QF4 A;  1VQO A;  3PO2 H;  3TZD A;  5ELD A;  5IYB H;  1NTG A;  3QOL A;  5IE8 A;  3GTK H;  2X69 A;  3L0O A;  3PCO B;  3MXN B;  4DR6 L;  4GNX B;  4QIW B;  4CJ0 B;  3VYS A;  3SXH A;  1HUN A;  3A7A B;  4QIW E;  4X3U A;  2K4K A;  1EU3 A;  3TP8 A;  1TII D;  1KL9 A;  3H0G B;  2JA6 B;  4UP7 A;  5L37 A;  5D14 A;  5EJW A;  1Q8K A;  1Y8N B;  2L1B A;  1LT6 D;  1EY0 A;  4XQQ A;  3I90 A;  3RZO B;  3VR4 A;  5FO8 B;  1UWV A;  2PZT A;  3CW2 C;  3RZD B;  1TS3 A;  3ERS X;  3HOX H;  2K7V A;  4A75 A;  3GTP H;  4DV2 L;  4DF7 A;  3WWV A;  1HZC A;  1CKN B;  4O0A A;  2N55 A;  1STA A;  1JE5 A;  2HDM A;  1HTP A;  1WTQ A;  2F0J A;  1ROD A;  2F4I A;  4WFN 3;  1Z9F A;  1SJE D;  3M4Y A;  5M5W B;  3HOV H;  5JJZ A;  4NXN Q;  1VQE A;  4C2M H;  1ESF A;  3C1E A;  1KC8 C;  1MIU A;  1M1K C;  3GO5 A;  2BH8 A;  1VCI A;  3A8I E;  2GA4 B;  2UUB Q;  1YNN C;  4L5S A;  3AFQ A;  4DR3 Q;  5LL6 S;  4A3M H;  1KAB A;  4DR1 Q;  2B39 A;  5IP9 G;  1U4M A;  1PHJ A;  2YV5 A;  4A3J B;  5IGE A;  1WTH A;  4APV A;  4A3I B;  1QWY A;  2QDB A;  4TRD A;  3QR8 A;  5DM6 3;  3J80 L;  2PZW A;  4KK7 A;  4NXN L;  3RN2 A;  1PFS A;  2C5C A;  3BG3 A;  2E2H H;  4B3T Q;  1JMC A;  5C3E G;  3CAM A;  1OXX K;  2UUB L;  1PH2 A;  1PH5 A;  4DR3 L;  3G4S A;  1X55 A;  1I4P A;  5M3F G;  2PI2 A;  4DR1 L;  1QZH A;  1AEX A;  5KYI A;  1PZJ D;  1HZ9 A;  3OTO L;  1I6V C;  2KOL A;  3CCM A;  4MIU A;  5IOC A;  2R7Z H;  4BXX G;  5KNB A;  1SEB D;  4KD4 A;  1QCB D;  1TY0 A;  2XN9 C;  2F0U A;  1VQB A;  3KF8 B;  4NXM Q;  4PQX A;  2M2L A;  5DNF A;  1JOO A;  5GAH C;  2KHI A;  1KDC A;  1AE3 A;  1SR3 A;  1II3 A;  2IHF A;  1Y1V H;  2WFW A;  5M5Y H;  4B3T L;  1VQI A;  1S4Z A;  1F9R A;  2JA5 H;  2NBF A;  5IGG A;  5FOB B;  1LAC A;  4X65 Q;  3ULL A;  1TVX A;  4EGV A;  1LTA D;  4LF4 Q;  4IFD J;  5JVG 3;  2A68 C;  4OWX B;  2EYP A;  4BS9 A;  1L2F A;  1AN8 A;  3URY A;  3BDL A;  3S1N H;  1OXV A;  2DNC A;  3CPW A;  4B3M Q;  2K03 A;  2HT1 A;  3UDX A;  1NBW A;  1DXM A;  3AMU A;  4CDE C;  4FXG C;  1VQN A;  3I4N H;  4NXM L;  5IP7 H;  5ELN A;  1LTS D;  4DK1 A;  1HRJ A;  4P74 A;  4GKK Q;  2BA1 A;  2N3S A;  5TSS A;  3M4O B;  2ZXO A;  3FHW A;  4DV1 Q;  1H9S B;  3FP9 A;  4LF4 L;  1KLG D;  2Q8T A;  1I4Q A;  4EQO A;  2VUM G;  1IHZ A;  3G48 A;  3NPP A;  1CHP D;  3E0E A;  4BY1 G;  3GTJ B;  1VQF A;  5JJL A;  1X54 A;  1UE1 A;  4OX9 L;  1GOZ A;  2E2D C;  3CC2 A;  1NSN S;  2PCF B;  4Y52 H;  1K0S A;  4B3M L;  4FF1 A;  1HPC A;  3FKI G;  4TVA B;  5E4X A;  1FD7 D;  3GTG H;  1WTX A;  1EQR A;  3L3O C;  4YCW A;  2F4V Q;  2EJF C;  5G3L D;  4BBR G;  4DUZ Q;  4ZRZ A;  1A2U A;  1J5E Q;  2JXM B;  2NTT A;  4DV1 L;  4AQY Q;  2QDL A;  1LTG D;  1E7Z A;  2AHO B;  4IFD H;  3M7G A;  2Q2I A;  3I73 A;  4M8A A;  1SYD A;  5IGB A;  2VB2 X;  2JQO A;  4ZUJ A;  3S16 H;  3HKS A;  2K1B A;  4A93 G;  3J7A V;  1TWA B;  1RKN A;  4PNY A;  3IFT A;  4A3D G;  4A3L H;  2EOT A;  3P75 A;  1S72 A;  1B9M A;  1F2Y A;  4TKO B;  2JA8 G;  1JCK B;  2I0Q A;  3A5U A;  2R93 B;  2F4V L;  2F0H A;  5C6A A;  1SMY D;  1EYC A;  1TWH B;  1H95 A;  2BE5 D;  4QL5 A;  2E2J B;  3KK7 A;  4JG2 A;  1PH6 A;  1S5E D;  4N8X 1;  1G51 A;  1QVC A;  2QGQ A;  2BH2 A;  1D1K A;  1DOM A;  1PRT F;  2ES2 A;  2LSS A;  5KYL A;  4OIJ A;  4DUY L;  2MO0 A;  4XT3 B;  1O7Y A;  3BDO A;  5KNC A;  2JA7 H;  1D7Q A;  1N33 Q;  4RGT A;  4MN3 A;  5JJK A;  1S40 A;  4DAY B;  5FO9 B;  3PQI A;  3HOU H;  3PGZ A;  4F8M A;  3HOW H;  2Y0S G;  3PUV A;  4ULL A;  1SJH D;  1PTO F;  1SLJ A;  3S1R H;  2LS0 1;  5C0X I;  3H09 A;  5A35 A;  1R4Q B;  1EYA A;  5JAV A;  2K33 A;  1R9T H;  1O7Z A;  3F2U A;  4KKT A;  2IY5 B;  2RF4 A;  2F0N A;  2YU9 B;  4Q0F A;  3S2H B;  4L63 B;  4B3R Q;  1LTL A;  3K8A A;  5K36 H;  1N33 L;  3ND9 A;  4MNO A;  1E22 A;  3TN2 A;  3H94 A;  2SDF A;  1W2B A;  3K0Y A;  5EKL A;  4XTC S;  3M3Y B;  3JAM i;  4R4C A;  4DR7 Q;  1E1O A;  2MFI A;  1GVP A;  4K8J A;  2RQX A;  3EJI A;  5C4J H;  2VNU D;  3HZX A;  1ZYR D;  3CC7 A;  1WCM G;  2E8G A;  1K8G A;  3ERQ A;  2PW7 A;  3IL8 A;  2RDH A;  4IJH A;  3CCU A;  5ELB A;  3OIP A;  2EE1 A;  2EIF A;  4QUC A;  1NNX A;  3QWN A;  4HMJ A;  1BOS A;  4Y7N H;  1FR3 A;  5J22 A;  3A0J A;  4DR7 L;  2DJF C;  1HR0 W;  4IPC A;  2DJG C;  5E1F A;  3L2P A;  3S1M H;  3RLN A;  1BO0 A;  4YWK A;  4ILW A;  2NVQ H;  4HID A;  1DCZ A;  2F3I A;  2B2Y C;  3H0G G;  2OQ0 A;  2JA6 G;  1IXR A;  5I9O A;  3FPP A;  1TWC H;  5EPL A;  1V1O A;  1N36 L;  5CBE E;  4A3J H;  2FMM A;  2F0Q A;  1JR0 D;  5I4D A;  4C56 C;  4IUP A;  5GAD C;  2QA4 A;  1BXT A;  3F2D A;  1XWE A;  2LKV A;  2NZH A;  3S14 H;  2WP8 J;  1HHV A;  5HY6 A;  1EWC A;  1F77 A;  2LFN A;  4A3B H;  1CHQ D;  1J9O A;  2NVT B;  2CQA A;  1SND A;  1TWF H;  1U0L A;  1YHA A;  2K04 A;  1EWI A;  1Q90 A;  5EKI A;  5FLX L;  1HUM A;  1IYV A;  1AZP A;  1A2T A;  4YWL A;  1YHQ A;  4NMZ A;  2DUD A;  1DOL A;  1SMX A;  3I4M G;  1PZI D;  5JEA J;  1IL2 A;  1PZK D;  4RKL A;  2NUC A;  5C3W A;  3HOY H;  4ZLT F;  3HEJ A;  1C8C A;  2R61 A;  4DAM A;  5LMN L;  3GTM H;  5M3F B;  5M9O A;  4JI0 Q;  1MGS A;  2AKW B;  5E7N A;  3HP3 A;  5I2Y A;  4DFA A;  5IYC G;  4PMB A;  4IOC A;  1STB A;  2A6E D;  3CRK C;  2K6A A;  4LF7 L;  1EQT A;  2RA4 A;  3VDY A;  4P2C B;  1FNV A;  1WTW A;  2SNM A;  2VB3 X;  2Z1C A;  4A3K H;  4A3C G;  2XSC A;  2L9H A;  4PZ6 A;  1X3P A;  1STE A;  3ICE A;  3CCJ A;  4GLA C;  2PW5 A;  3PO3 G;  4C3J H;  1VQ6 A;  1NY4 A;  1GO3 E;  3S1Q H;  4PG3 A;  1Y14 B;  4XYO A;  4DNT B;  1PTO C;  1QE6 A;  3BVM A;  1KLU D;  2KCC A;  2MQH A;  4C3I G;  4ZAI A;  2L12 A;  3UDF A;  1VDZ A;  2IT1 A;  4K14 A;  2EYH A;  1VQH A;  5COR A;  1OXS C;  3SK4 A;  1F2M A;  2EY5 A;  2WAC A;  2JP1 A;  2XRS D;  2R7F A;  4RGO S;  3E5S A;  5T1G A;  4GLX A;  5J39 A;  4ABN A;  2Q8I B;  4F88 A;  2ZM6 Q;  4OEM B;  5DEH A;  2QKI C;  4XYQ A;  5JEA H;  2AWN A;  5CV9 A;  1UE7 A;  5IY0 A;  1LAB A;  2OCE A;  1D1I A;  3NEN A;  2VXW A;  4HIO A;  3CME A;  5KEE A;  1R4P B;  4BY1 B;  3T13 A;  2D9U A;  3GV3 A;  1N8R C;  2B2V A;  3S15 B;  1P16 A;  1CFM A;  1F2Z A;  1S5C D; 
#chains in the Genus database with same CATH homology
 1JWU D;  3FKI B;  4RH6 A;  2NN6 G;  1V8Q A;  3T56 B;  2BA0 A;  3PIP 3;  5EPJ A;  2I46 A;  1S5F D;  4BBR B;  4IQZ A;  3A8K E;  3C2P A;  3JAM E;  4CJ2 C;  1JOQ A;  3C3L A;  3BYY B;  1B53 A;  2B2W A;  3LWU A;  3ZYY X;  1I4G A;  4N9T A;  4A93 B;  1I50 B;  5KIX A;  1LTI D;  4A3D B;  2V4D A;  1H9R A;  3E6Z X;  2E2I B;  2JA8 B;  1HCZ A;  4ODG A;  5IT9 L;  5IOD A;  4DAP A;  5CV7 A;  3BZD B;  1EY5 A;  3NUC A;  4QB4 A;  1W6J A;  2HDL A;  1JB3 A;  3R2I A;  4RFB A;  4CJ1 B;  2X6G A;  1NR2 A;  1S5B D;  2Y0S B;  5CR3 A;  4KHZ A;  5EKK A;  2J4X A;  5COY A;  4FF3 A;  1EOT A;  4LJZ C;  1GUO A;  2AQ1 B;  1AZQ A;  4IUQ A;  1SNC A;  1U4P A;  2F0W A;  1TY2 A;  1T5E A;  4OO1 G;  2A6H C;  2CW0 C;  2EYO A;  2KJX A;  3VYT A;  1O80 A;  3NBH A;  2R6G A;  2JEA I;  3SDZ A;  1BBX C;  1UAP A;  4KTA A;  1SNM A;  4K5W A;  4GZY C;  1ENA A;  1EZ6 A;  3OMC A;  3I72 A;  3QB3 A;  1ILP A;  2G9D A;  1GUN A;  2B2U C;  1DZ1 A;  3AU7 A;  1VF5 C;  4L8J A;  1OO9 B;  1HFG A;  1K83 B;  1BNZ A;  2F0D A;  3PUY A;  1PTO H;  4KY7 A;  1OXT A;  3NSW A;  1LT3 D;  3K5L A;  1TT2 A;  1OXU A;  5I6Y A;  3BVZ A;  2F0L A;  2IX3 A;  1SE2 A;  1JWM D;  2HCI A;  3DMU A;  3H6M A;  1QB5 D;  2LY7 A;  4CHT B;  2OEO A;  3R2T A;  1B44 D;  1CTM A;  3H91 A;  1PXU A;  2L0C A;  3NBI A;  3OWE B;  4IN3 A;  1RHP A;  2DY7 A;  3IKJ A;  4OGQ C;  3N6R A;  4BA2 I;  2AUJ D;  3D8G A;  2KED A;  3SE0 A;  1WTO A;  4ZKC B;  2A74 C;  3I4M B;  3HRZ C;  2ICI A;  4H0L C;  1HFN A;  5FKA C;  2A5H A;  2XWJ B;  5C3X A;  4ZUI A;  5ISR A;  1B1Z A;  4QMG A;  2NVX B;  3NTK A;  3K7A B;  4KKS A;  1KDB A;  1JE4 A;  4KD3 A;  3PUW A;  1PYW D;  1STH A;  1QG7 A;  4KN4 C;  3SHL A;  2K01 A;  2XVS A;  3SK6 A;  4G4K A;  3PO3 B;  4PV1 C;  1AW7 A;  2M00 A;  3P20 A;  4NP5 A;  4G57 A;  1ILQ A;  4C3I B;  5IT9 E;  2EXZ A;  5AFW A;  3CHB D;  5CV6 A;  2BDN A;  1PDQ A;  3OMG A;  3RD4 A;  1B2T A;  5C4H A;  4DGZ A;  1JQY D;  2MJ8 A;  1BCP F;  4ID6 A;  2Z4I A;  1L0X B;  4WRD A;  3FMC A;  4EVO A;  2CHB D;  4TQU S;  3EFX D;  1E2Z A;  3FPU B;  3D4D A;  2PZU A;  3PUX A;  1MSG A;  3CRL C;  3GTQ B;  5DAU A;  3MVV A;  3OW7 A;  2F0O A;  2MHV A;  3NXW A;  3S9W A;  4KI0 A;  3RLF A;  4OHJ A;  3NWS A;  2FIN B;  1Y69 U;  2Z4H A;  1SYB A;  3HOZ B;  1RDP D;  1E2V A;  4KMU C;  1Q3L A;  1RTO A;  2B2T C;  3G7L A;  1RTN A;  5A2Q L;  2JE6 I;  4J6H A;  3LNN A;  4EQN A;  2A69 C;  1A6X A;  1EIG A;  1UUP A;  3J7A F;  2K28 A;  4V19 0;  2R92 B;  3GP7 A;  1F2L A;  2O2L D;  1EIH A;  5C44 B;  1NUC A;  2CW0 D;  5CGK A;  1CT1 D;  4HAE A;  1Q1B A;  1WVL A;  5M5X B;  1BCP B;  2J7Z A;  2EVB A;  2H1E A;  3OWF A;  3T51 B;  1IW7 C;  1JIC A;  2HCC A;  4M1U B;  4R9W A;  2D62 A;  3VYU A;  3VR2 A;  1YNJ C;  1QNU A;  4G7Z C;  2WAQ B;  2CVR A;  4I7Z C;  1LTT D;  3WDN A;  3S2D B;  3TBI B;  2FFK B;  1D2B A;  4C3H B;  1LTR D;  3W2D A;  3T4A C;  4IFD G;  3MXU A;  5CC4 A;  3PMF A;  2F0P A;  1E0B A;  1F9S A;  1QNK A;  1I6H B;  5EPK A;  1STG A;  3I3C A;  3A55 A;  5I6W A;  1SYF A;  4XDX A;  5C0X J;  3MA2 B;  3J80 E;  3WOE A;  1HA5 A;  1WTP A;  3OPO A;  2WV6 D;  4BBS B;  1LT4 D;  2DN8 A;  4IUV A;  5EGT A;  4KHV A;  4L6T B;  5K5P A;  3A7L A;  4R8N A;  1TKW B;  2BCO A;  3V05 A;  2F0S A;  2PNR C;  1YNN D;  1EEI D;  2IPK D;  2F1M A;  5FK9 C;  2IX0 A;  4BY7 B;  4FF2 A;  1TR5 A;  2E76 C;  4XT1 B;  2B63 B;  4B9W A;  2QCP X;  1U9R A;  3FDT A;  3U9S A;  4YIJ A;  1ESR A;  1X3Q A;  1NCV A;  3CKI B;  3N52 A;  5IGF A;  1HXY D;  3TDQ A;  2NN6 I;  2MP1 A;  3K59 A;  2RSN A;  2EY1 A;  3L7Z C;  1LTB D;  3S17 B;  4B9X A;  4H7B A;  1I4H A;  5C0X H;  4MHE A;  1CZG A;  3PO2 B;  1U4R A;  5BN4 A;  1EY8 A;  3T16 A;  4N9P A;  3GTK B;  4UAI A;  2ICE C;  2L5T A;  1CQV A;  1IL8 A;  3OIQ A;  2EYJ A;  2XWB B;  2A68 D;  2Z8L A;  3W3A A;  1K8O A;  1KDA A;  1G91 A;  3GTP B;  1TU2 B;  3RMH A;  4RWS C;  4FO2 A;  1I4R A;  1BDO A;  1MSH A;  1XTC D;  2EYF A;  3FRP B;  1IKL A;  4DN4 M;  1CQF A;  3HOV B;  1M4V A;  5G3L F;  4DAV A;  1DYQ A;  3D6W A;  1PRT C;  3VYR A;  1WTR A;  2M9V A;  1TQO A;  2F0T A;  5CYU A;  1QOH A;  2KHS A;  2L4N A;  3J81 L;  4A3M B;  4F87 A;  5NUC A;  1A3T A;  5D65 A;  3MZ5 A;  2O5J C;  3X3N A;  2KCN A;  3HS0 C;  2K05 A;  1SDF A;  4LAA A;  2A69 D;  4OO1 I;  2EJG C;  2E2H B;  5LL6 X;  4RGM A;  4XQN A;  3M7N A;  2MGS A;  1Z47 A;  4BA1 I;  1TS4 A;  4Q5V A;  4FVM A;  2R7Z B;  1GUW A;  4DXF A;  5J1Z A;  2DNE A;  4Z9C B;  1V1P A;  1AP0 A;  1XYI A;  2J0T D;  1Y1V B;  5M5Y B;  2JA5 B;  4PMC A;  4KN7 C;  2ID0 A;  4K2K A;  1BQQ T;  1RJT A;  2R3Z A;  4TSS A;  3S1N B;  2EJM A;  2KVM A;  2K5D A;  1ENF A;  2B8G A;  3I4N B;  1NAP A;  4X3T A;  2B2Y A;  1CI3 M;  4F7X A;  1JOK A;  2EZV A;  2O5I C;  1LT5 D;  5JEA G;  1EU4 A;  4HMI A;  3ONA B;  2RDF A;  3K6O A;  3KBG A;  1G8Z D;  4H13 C;  1Y8O B;  5I2X A;  1SE4 A;  3VA5 A;  1B3A A;  4KJN A;  4O42 A;  3D6C A;  3EQL C;  2D2C C;  1FYC A;  3TZU A;  3GTG B;  1T5X D;  3OOC A;  1CA5 A;  1J8I A;  2ENB A;  3C46 A;  5ELC A;  3EVQ A;  3NP8 A;  3MEH A;  3SVM A;  2HQE A;  4QCL A;  2SOB A;  3MWY W;  4O1N A;  3LWE A;  4WJW A;  1W6K A;  3MXG A;  4HN7 A;  2ZXP A;  3S16 B;  3PIO 3;  3UI2 A;  4DXG A;  3BDC A;  3RUZ A;  4OIK A;  4RHS A;  4C3H G;  2YYZ A;  3E0J A;  1S5D D;  5FLX E;  2BOS A;  3NTI A;  4LMQ D;  3J7Y W;  2EY2 A;  1VF7 A;  5JVH 3;  1GUT A;  3MFG A;  1XXG A;  4DK0 A;  2RDG A;  3NQI A;  4HCS A;  5F2D A;  3QIA A;  2JA7 B;  3TP6 A;  1EYD A;  1K8M A;  1ET6 A;  3ITP A;  3HOU B;  2TMP A;  4K5X A;  5C5M A;  3HOW B;  1G2T A;  3S1R B;  1SMY C;  2BE5 C;  1G29 1;  4FNF A;  1WD1 A;  1AFP A;  3LX0 A;  1DM0 B;  2F0E A;  3IFD A;  2NYZ D;  2SEB D;  3NHH A;  2DY8 A;  4KJO A;  2B8F A;  1ICW A;  2NWG A;  5EQ0 A;  2NTS A;  1KAA A;  1PLF A;  2QIL A;  4K2L A;  1EY6 A;  1SNP A;  1HA6 A;  1BR9 A;  1SE3 A;  4HTH A;  1HQR D;  5I9P A;  5C4J B;  1PRT D;  4DNR B;  2X6L A;  4K6L A;  3X3M A;  4ZK9 B;  4B08 A;  1CK1 A;  4BWG B;  1Q8I A;  2MUY A;  3QO2 A;  2Q8R E;  1HTL D;  1PTO D;  1EL0 A;  3QOJ A;  3TSS A;  2F0G A;  4IZ8 A;  2RBM A;  4Y7N B;  4UDU C;  4ZYS A;  2I07 B;  3S1M B;  3TP7 A;  1FNW A;  1ZYR C;  2NVQ B;  4NW2 A;  3T53 B;  2OXP A;  1MBY A;  3Q23 A;  1VMC A;  4RKB A;  3VA7 A;  3A54 A;  3BVG A;  5EBC A;  3I70 A;  1EY7 A;  1TWC B;  1B9N A;  5EBD A;  3OHX C;  1ZXT A;  2PYK A;  3A56 A;  4CKC A;  2F3W A;  4IUR A;  4WOR A;  2WIN B;  3QG1 A;  3CU7 A;  3S14 B;  4IUN A;  2PPB C;  4KY6 A;  5IGD A;  5FO7 B;  4CKB A;  4RA8 A;  3SK5 A;  4A3B B;  2EYM A;  3HGB A;  5D3D A;  1TWF B;  3QJY A;  1U4L A;  2EYL A;  2WKD A;  2PQE A;  1SSO A;  1B4O A;  2WB1 B;  2OT2 A;  4IFD I;  1F9Q A;  4R8I A;  5CBA E;  1DOK A;  3HOY B;  2NB0 A;  3GTM B;  1CZW A;  1G6Z A;  3DHQ A;  2KA7 A;  1TS2 A;  1LO5 D;  3KBX A;  3NQT A;  1V43 A;  1D5M C;  5CV5 A;  2RVL A;  2MPM A;  3HG9 A;  4A3K B;  2K32 A;  3D4R A;  5CMD A;  2FMC A;  2TSS A;  4S3S A;  1I4X A;  4C3J B;  3S1Q B;  3MFY A;  4FXK C;  3NTH A;  2PO4 A;  2HUG A;  2B2U A;  1FNU A;  5CV4 A;  2F0V A;  3OSO A;  2AQ2 B;  2ZT9 C;  4DA2 A;  3K5M A;  4NKL A;  1WD0 A;  1CA6 A;  2A6E C;  3DXJ C;  1KTK A;  3D3R A;  3FVQ A;  1ET9 A;  4X3K A;  4X3S A;  4HED A;  1KNE A;  4U67 3;  3DWQ A;  2A6H D;  1RD9 D;  3L9A X;  2SNS A;  4HCE A;  2AQ3 B;  5E4W C;  4FYD A;  1ENC A;  1I3Q B;  3Q0A A;  3R3O A;  1IKM A;  3D4W A;  4FF4 A;  1D5Z C;  3Q22 A;  1D6E C;  1EY9 A;  1O78 A;  1STY A;  1ONL A;  4EQP A;  3WOF A;  5KGU A;  3Q6S A;  2JEB I;  3MXN A;  3GTL B;  3ND8 A;  4CGY B;  3KLS A;  1V1P B;  3TME A;  1G2S A;  4LK1 C;  2QEJ C;  2RSO A;  3KUP A;  2BDO A;  4KY5 A;  2F0I A;  1LLR D;  2KEC A;  2IL8 A;  4KKU A;  5JPN C;  1KNA A;  1Q12 A;  1DJR D;  3V2T A;  2RKS A;  3SEB A;  1B50 A;  4IAL A;  3GV6 A;  1A3U A;  4E6I A;  1XX8 A;  1WTV A;  2PMZ B;  2L55 A;  1GHK A;  1BCP C;  4A3E B;  3KLR A;  3FEW X;  3JAM L;  3MC0 B;  2G9H D;  1A3V A;  3MAQ A;  2AWO A;  3I4L A;  1CM9 A;  4NDX A;  3VR3 A;  2NVY B;  4U68 A;  3V96 A;  4A3G B;  1H9J A;  2B2V C;  3DUZ A;  4V0B A;  1DD2 A;  4IUU A;  5IIF A;  4CBV A;  3PUZ A;  3DM1 A;  5KND A;  2F0M A;  5K36 G;  4ZKB B;  3P1H A;  2B2W C;  1H9M A;  3VR6 A;  1Y1W B;  4G7H C;  1PMR A;  3H3V C;  1EFI D;  4AYB B;  2B2T A;  1RF2 D;  1D5X C;  3KF8 A;  1PRT B;  1JWS D;  2H4O A;  3CQZ B;  2F03 A;  2EY6 A;  2F0F A;  2AUK A;  1Y8P B;  1DON A;  4JK1 C;  5D3I B;  1PTO B;  3DWA A;  3I8Z A;  2FHT A;  1Z6H A;  1EQV A;  5ELE A;  5T1I A;  4A3F B;  3HOX B;  3VR5 A;  2E74 C;  4HSP A;  3HKZ B;  2QF7 A;  2IWH A;  5A2Q E;  1GHJ A;  1SYC A;  3K5O A;  5BN5 A;  4RHR A;  5E3F A;  2D5D A;  1O7L A;  3GTO B;  1TWG B;  1E2W A;  1H9S A;  3P7J A;  5C3E B;  1Z7T A;  4C2M B;  5HUR A;  1QJO A;  1EY4 A;  1ZKO A;  1SBB B;  1HQM C;  1RCV D;  2E75 C;  3NE5 B;  1EWH A;  5C0X G;  3MHB A;  1UNS A;  2A73 B;  2KEE A;  3BS1 A;  4OL7 A;  4XQJ A;  3NK9 A;  2L11 A;  3R93 A;  3K5N A;  1EZ8 A;  2NN6 H;  3GQB A;  2C9O A;  3M85 A;  2K5Q A;  1Q1E A;  1PFN A;  4HR7 B;  4I65 A;  1IYU A;  1QIL A;  1M8A A;  4RGN A;  3SK8 A;  4H44 C;  3DEP A;  1ML0 D;  3SR1 A;  4FP5 D;  4PMW A;  3U9O A;  1JC7 A;  4ME5 A;  1PFM A;  4RAU C;  1MI2 A;  1SYG A;  1UEA B;  3BYT B;  3K57 A;  5C4Z A;  4KV6 A;  4K6D A;  2OF1 A;  1IW7 D;  2VUM B;  1FGB D;  4C3J G;  2JYO A;  1SAP A;  1GJX A;  1YNJ D;  4DAY A;  1TS5 A;  2F3V A;  3C1F A;  5JOB A;  4C1N I;  3AB9 A;  3I91 A;  2JSO A;  2IW3 A;  1ZEQ X;  3Q24 A;  1GXD C;  4K5V A;  1PFB A;  4HSV A;  3DEO A;  1C48 A;  5HGT A;  5LHY 1;  4RCO A;  2XNA C;  2IJ0 A;  2KUM A;  1EEF D;  2XIW A;  4J1M A;  4OO1 H;  1JOR A;  2N88 A;  1F9P A;  1GUS A;  1BCP D;  2F0K A;  3G6J B;  5C4X B;  4IUT A;  4XIG S;  4QUF A;  1BF4 A;  2XRQ D;  4C1N K;  3D31 A;  4J8Q A;  1X32 A;  3O13 A;  2LMC B;  5BN3 A;  2WII B;  3K58 A;  2IX1 A;  3TP5 A;  1GUG A;  3PV0 A;  4CKE A;  3A8J E;  3GD7 A;  2EDG A;  2EPB A;  2FJ2 A;  1STN A;  5KRU A;  3MTS A;  5C5L A;  3R8B A;  4XXE A;  5M3M B;  2NZ1 D;  5DM7 3;  1SNO A;  4JBW A;  2ZXR A;  3DWP A;  1L0Y B;  1SNQ A;  2KQ3 A;  1SFO B;  5JPM C;  4K8I A;  4FXD A;  3IAY A;  1SXT A;  4ZQ3 A;  2O4X A;  5IGC A;  5CV8 A;  2K5W A;  4DU9 A;  2WKC A;  1NR4 A;  3MXP A;  1WCM B;  1MD2 D;  4G7O C;  3KLS X;  1VMP A;  1R9T B;  1C4Q A;  3NWT A;  1SYE A;  5ELF A;  3ERO A;  3EA6 A;  4RCN A;  3J81 E;  1LV9 A;  1H9K A;  1BUV T;  1A15 A;  4QF4 A;  3TZD A;  5ELD A;  3QOL A;  2X69 A;  4QIW B;  4CJ0 B;  3VYS A;  3SXH A;  1HUN A;  3A7A B;  4X3U A;  1EU3 A;  3TP8 A;  1TII D;  3H0G B;  2JA6 B;  5D14 A;  5EJW A;  1Y8N B;  2L1B A;  1LT6 D;  1EY0 A;  4XQQ A;  3I90 A;  3RZO B;  3VR4 A;  5FO8 B;  2PZT A;  3RZD B;  1TS3 A;  2K7V A;  4DF7 A;  2N55 A;  1STA A;  2HDM A;  1HTP A;  1WTQ A;  2F0J A;  1ROD A;  2F4I A;  4WFN 3;  1SJE D;  3M4Y A;  5M5W B;  5JJZ A;  1ESF A;  3C1E A;  3GO5 A;  1VCI A;  3A8I E;  2GA4 B;  1YNN C;  5LL6 S;  1KAB A;  2B39 A;  1U4M A;  4A3J B;  5IGE A;  4A3I B;  1QWY A;  2QDB A;  4TRD A;  5DM6 3;  3J80 L;  2PZW A;  4KK7 A;  2C5C A;  3BG3 A;  1OXX K;  1I4P A;  1AEX A;  5KYI A;  1PZJ D;  1I6V C;  2KOL A;  4MIU A;  5IOC A;  5KNB A;  1SEB D;  4KD4 A;  1QCB D;  1TY0 A;  2XN9 C;  2F0U A;  4PQX A;  2M2L A;  5DNF A;  1JOO A;  1KDC A;  1II3 A;  1S4Z A;  1F9R A;  2NBF A;  5IGG A;  5FOB B;  1LAC A;  1TVX A;  4EGV A;  1LTA D;  4IFD J;  5JVG 3;  2A68 C;  2EYP A;  4BS9 A;  1AN8 A;  3URY A;  3BDL A;  1OXV A;  2DNC A;  2K03 A;  1DXM A;  3AMU A;  4FXG C;  1LTS D;  4DK1 A;  1HRJ A;  2BA1 A;  5TSS A;  3M4O B;  2ZXO A;  1H9S B;  1KLG D;  2Q8T A;  1I4Q A;  4EQO A;  1IHZ A;  3NPP A;  1CHP D;  3GTJ B;  1GOZ A;  2E2D C;  1NSN S;  2PCF B;  4FF1 A;  1HPC A;  5E4X A;  1FD7 D;  1WTX A;  3L3O C;  2EJF C;  5G3L D;  4ZRZ A;  1A2U A;  2JXM B;  2NTT A;  1LTG D;  4IFD H;  3M7G A;  3I73 A;  4M8A A;  5IGB A;  1SYD A;  2VB2 X;  4ZUJ A;  2K1B A;  3J7A V;  1TWA B;  1RKN A;  4PNY A;  3IFT A;  2EOT A;  3P75 A;  1B9M A;  1F2Y A;  4TKO B;  1JCK B;  2R93 B;  2F0H A;  5C6A A;  1SMY D;  1EYC A;  1TWH B;  2BE5 D;  2E2J B;  3KK7 A;  1S5E D;  1D1K A;  1DOM A;  1PRT F;  5KYL A;  4OIJ A;  4XT3 B;  1O7Y A;  3BDO A;  5KNC A;  4RGT A;  4MN3 A;  5FO9 B;  4F8M A;  3PUV A;  4ULL A;  1SJH D;  1PTO F;  2LS0 1;  5C0X I;  3H09 A;  5A35 A;  1R4Q B;  1EYA A;  5JAV A;  2K33 A;  1O7Z A;  3F2U A;  4KKT A;  2F0N A;  2YU9 B;  4Q0F A;  3S2H B;  4L63 B;  5K36 H;  3ND9 A;  3TN2 A;  3H94 A;  2SDF A;  3K0Y A;  5EKL A;  4XTC S;  3M3Y B;  4K8J A;  2RQX A;  3EJI A;  2VNU D;  3HZX A;  1ZYR D;  3ERQ A;  2PW7 A;  3IL8 A;  2RDH A;  5ELB A;  3OIP A;  2EE1 A;  4QUC A;  3QWN A;  4HMJ A;  1BOS A;  1FR3 A;  5J22 A;  5E1F A;  1BO0 A;  4ILW A;  1DCZ A;  2B2Y C;  5I9O A;  3FPP A;  5EPL A;  1V1O A;  5CBE E;  2FMM A;  2F0Q A;  1JR0 D;  5I4D A;  4C56 C;  4IUP A;  1BXT A;  1XWE A;  2LKV A;  1HHV A;  2WP8 J;  1EWC A;  1F77 A;  2LFN A;  1CHQ D;  1J9O A;  2NVT B;  2CQA A;  1SND A;  2K04 A;  1Q90 A;  5EKI A;  5FLX L;  1HUM A;  1IYV A;  1AZP A;  1A2T A;  4NMZ A;  1DOL A;  1PZI D;  5JEA J;  1PZK D;  5C3W A;  2NUC A;  4RKL A;  4ZLT F;  3HEJ A;  1C8C A;  2R61 A;  5M3F B;  5M9O A;  1MGS A;  3HP3 A;  5I2Y A;  4DFA A;  4PMB A;  1STB A;  2A6E D;  3CRK C;  2K6A A;  1EQT A;  2RA4 A;  4P2C B;  1FNV A;  1WTW A;  2SNM A;  2VB3 X;  2Z1C A;  2XSC A;  2L9H A;  1X3P A;  1STE A;  2PW5 A;  4XYO A;  4DNT B;  1PTO C;  1QE6 A;  3BVM A;  1KLU D;  2KCC A;  4C3I G;  4ZAI A;  2L12 A;  1VDZ A;  2IT1 A;  4K14 A;  2EYH A;  5COR A;  3SK4 A;  1OXS C;  1F2M A;  2EY5 A;  2WAC A;  2JP1 A;  2XRS D;  4RGO S;  3E5S A;  5T1G A;  5J39 A;  4ABN A;  2Q8I B;  4F88 A;  5DEH A;  2QKI C;  4XYQ A;  5JEA H;  2AWN A;  5CV9 A;  1LAB A;  1D1I A;  2VXW A;  5KEE A;  1R4P B;  4BY1 B;  3T13 A;  2D9U A;  3GV3 A;  2B2V A;  3S15 B;  1CFM A;  1F2Z A;  1S5C D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...