1STGA

Two distinctly different metal binding modes are seen in x-ray crystal structures of staphylococcal nuclease-cobalt(ii)-nucleotide complexes
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
136
structure length
136
Chain Sequence
b'KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOCOCCAL NUCLEASE
molecule tags Hydrolase(phosphoric diester)
source organism Staphylococcus aureus
publication title X-ray crystal structures of staphylococcal nuclease complexed with the competitive inhibitor cobalt(II) and nucleotide.
pubmed doi rcsb
total genus 38
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 1994-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1stgA00
4K2LA 2PZWA 5IGFA 2OXPA 1SYBA 3SK8A 3HEJA 3OWFA 4IZ8A 2F3VA 1EY5A 4DFAA 5C4HA 5E3FA 3NHHA 3PMFA 5KIXA 2SNSA 5CV5A 2EYPA 5JAVA 1SNPA 1TR5A 4KJOA 1TQOA 4EQNA 5KYLA 1EY9A 4S3SA 2RBMA 4H7BA 5HURA 1SYDA 5J22A 4ODGA 1RKNA 2F0VA 3HZXA 4RKBA 3VA5A 5IGCA 3T16A 5IIFA 2PYKA 5IODA 1STGA 1U9RA 4N9PA 3EVQA 2F0TA 2F0DA 1JORA 1KDCA 5CV6A 1EYCA 1SNQA 2F0EA 4KY6A 4MIUA 5EGTA 4B9WA 3T13A 5C4ZA 2O4XA 2KHSA 3QOLA 1F2YA 2F0QA 3D4WA 3MVVA 1ENAA 3TP5A 5KRUA 5DEHA 4HTHA 3QB3A 5CV9A 4KD4A 4KV6A 3EROA 3P75A 3U9OA 3C1FA 2F0GA 5CV4A 3TP8A 3E5SA 4PNYA 1NUCA 3SHLA 2F3WA 5ISRA 5IGBA 2KQ3A 2EYLA 3BDCA 2F0PA 4KJNA 1ENCA 2EYFA 2F0MA 4I65A 4NMZA 5I6WA 4IALA 5I6YA 5CGKA 2RDFA 1EZ6A 5C6AA 1JOQA 4YIJA 4EQOA 1II3A 5J39A 4NDXA 3DMUA 3D4DA 1SYCA 5KEEA 4DF7A 2EYHA 1EZ8A 5IOCA 5KGUA 4ZUJA 2LKVA 1A3VA 5C5LA 2PZTA 5IGDA 4ZUIA 4NP5A 3SXHA 2F0HA 2F0IA 1EYDA 3NUCA 1A2TA 1KDBA 4K5VA 5J1ZA 3SR1A 4B9XA 4K8IA 1F2ZA 1A3TA 3QOJA 4J1MA 1EQVA 2PW7A 2WACA 2F0LA 1STAA 3NXWA 2F0WA 5CV7A 1SNDA 4NKLA 3LX0A 4E6IA 2OEOA 1A3UA 4K5XA 4LAAA 3TP6A 4F8MA 2RKSA 2QDBA 5DAUA 4IUNA 2F0NA 3S9WA 1AEXA 5JOBA 4WRDA 1EY8A 5HGTA 3MEHA 3TP7A 4WORA 5EKLA 3SK5A 4EQPA 1EY4A 1F2MA 3OSOA 5EKKA 1EY7A 3R3OA 1EY0A 4HMJA 5I9PA 1JOKA 3MXPA 4J6HA 5KYIA 1STBA 1STYA 2F0SA 2NUCA 3D8GA 2OF1A 5CR3A 3NQTA 5E1FA 3SK4A 1EYAA 2EY2A 2PW5A 4K8JA 4K5WA 4ME5A 4OL7A 4DU9A 5K5PA 5C3WA 2SNMA 3OMCA 3P1HA 5IGEA 2F0JA 3MZ5A 1SYFA 4QMGA 3RUZA 5IGGA 1EY6A 1SYGA 3SK6A 1SNMA 1STNA 2ENBA 1IHZA 4RKLA 4K2KA 3TMEA 4K14A 2PZUA 4R8NA 3BDLA 3ERQA 5C5MA 4EVOA 3ITPA 4HMIA 5M9OA 4QF4A 1A2UA 5F2DA 1JOOA 1NSNS 4PMBA 2SOBA 4QB4A 2EY5A 3NK9A 5CC4A 1TT2A 2EXZA 3DHQA 1SNCA 3EJIA 5CV8A 2EY6A 5C3XA 4ID6A 4KY7A 3V2TA 2EYOA 3NP8A 3D6CA 4F7XA 4DGZA 1SNOA 2F0KA 4K6DA 1SYEA 1STHA 2F0UA 2F0FA 2HQEA 4KD3A 4KTAA 4KY5A 4ZQ3A 1KAAA 4N9TA 3MHBA 4KHVA 5I9OA 2EYJA 2F0OA 2PQEA 2EYMA 3C1EA 5NUCA 3OMGA 4TRDA 1KDAA 4PMCA 2EY1A 4G57A 2M00A 1KABA 3H6MA
chains in the Genus database with same CATH superfamily
2PZWA 4LF8L 3I4OA 2O5IC 4XTCS 5E3FA 3RZOB 4KKUA 2EE1A 3J80c 2EYPA 5LMNL 2BDOA 1TR5A 3OPOA 4DV7L 4JI7L 3HOZB 1IL2A 2JJQA 1RJTA 3T16A 3HOXG 1VQOA 2Z9HA 1HR0L 1Z6HA 2R92B 3BYTB 1KRSA 1K0RA 3L2PA 4PG3A 1TWFH 3S1MH 4FF3A 3TP5A 4JV5L 5FO9B 2UUCQ 4DAYB 4X62L 1B3AA 5FO7B 3VDYA 3OYYA 2F03A 3PQIA 5EJWA 4JYAL 4JI3Q 1GHKA 3BZCA 2BA1A 3EA6A 4LF7Q 2JQOA 3Q24A 2K5WA 1DOKA 2D9UA 2NWGA 1WTPA 4ZUIA 1LTSD 3PIOA 1VS0A 4X3KA 3AFQA 1A2TA 3LWUA 4XXEA 4K8IA 3PUVA 1F2ZA 1S5ED 1MIUA 3CXCA 3S1NB 5C4JH 3K58A 1VCIA 1Q1EA 2N78A 2E2IB 4ABNA 3BG3A 3BU2A 4A3GG 1VDZA 5IT9L 2L1BA 3HOXB 2Z6KC 1VQ9A 1EY0A 4JVZA 2BDNA 4OIJA 3GTOH 4IUQA 4FDBA 2OQKA 1N32L 5M5XB 4FXDA 4JI4Q 1CK1A 5C44G 2V4DA 1B4OA 3MZ5A 1OXSC 2LFNA 5L37A 1GHJA 4XDXA 4JI5Q 3CP0A 3HOVG 3TMEA 3ND8A 4A3EG 3VYRA 3M4OH 1Y14B 1PMRA 1VQGA 3FP9A 4HMIA 1CKNB 2B39A 1PH7A 3S16B 1GJXA 5LMNQ 5F2DA 1PH8A 2JA9A 4G4KA 4JYAQ 3AYHB 1ILQA 3P20A 4IJLA 1HNWL 4L63B 4ZAIA 4DK6C 4JI2L 2VQFQ 4KTAA 3MC0B 2B2TA 3H0GH 1ZKOA 1LT4D 2IHEA 1X3FA 1Y8PB 4HEDA 2CH4W 1D7QA 4F88A 4XYQA 5D14A 2IL8A 2J4XA 3MFGA 2R7ZG 2CQOA 4WJ3M 1SROA 5JAVA 2F4VQ 3CPWA 1EY9A 4S3SA 5CBEE 4DAYA 1RKNA 1WTRA 1AZQA 2J7ZA 5IE8A 1I50B 1S5BD 3EVQA 4KY6A 3OIPA 2O4XA 2ICIA 5D65A 2DY7A 1VQCA 3JAME 1TS3A 2UUAL 1PDQA 4DV5L 2QDLA 3U9OA 3VR6A 2K4KA 2KEDA 3E5SA 3T53B 2F3WA 3FKIG 4LF6Q 4XIGS 1N33Q 4IPGA 4IALA 1OXXK 2NVYH 3GTJB 4DAMA 1EYGA 4EQOA 1ENFA 2OT2A 1SYCA 2K5DA 4DF7A 3LWEA 2AMCB 2UUBQ 1KLGD 2L12A 2LKVA 3FRPB 4UHVA 5IGDA 3L9AX 3SXHA 1DCZA 1G6ZA 4N8X1 2WACA 3A7LA 4QY7A 4JV5Q 1CHPD 1KNAA 2PQAA 4A3FG 1SJED 3R8BA 5IY0A 4NXMQ 2R61A 2ZM6Q 3U50C 1W6JA 2JA6B 2UXCL 1HNZL 3RD4A 2B8GA 2EQSA 2RDHA 1H9JA 5EPJA 1P8LA 1STBA 2DN8A 1JWSD 2JA8H 3GTMH 3GTQB 4K8JA 4YWKA 1SFOH 2K04A 4BXXH 3P1HA 2A74C 3RUZA 3KF8A 1PH4A 3S24A 2CKZB 1STNA 1DD2A 1TXYA 1QILA 4DK1A 1HFNA 2D0OA 3VR3A 2VNUD 3GTLH 3OOCA 4JC0A 3ICEA 3PUXA 3S2HH 3I91A 2EXZA 4DV6Q 2ZJPA 4A3DB 1TWGB 1KTKA 3K7UC 3EJIA 5M3FH 1EOVA 3GTPH 4ULLA 2A5HA 3I70A 1KL9A 3F2UA 3SVMA 4ZQ3A 3HOYH 3PUZA 2C35B 3C1EA 1VQLA 3M85A 3X3MA 5C3EB 1IBMQ 1I6VC 3HEJA 3NBIA 4HIOA 5JEAJ 2R92H 4DFAA 1WVLA 4HJ8A 1R9TB 1A63A 2AUJD 5KYLA 3OWEB 4JI1Q 1ZYRD 3U58A 2NVXH 1OO9B 5M3MB 1FGBD 1EEFD 5EBDA 3WOFA 1H9MA 1S72A 3DM3A 3J7AV 1XNQL 1QJOA 1Z47A 2JXMB 3MVVA 3VR5A 1YNJC 4ZLTF 4JW0A 3V96A 5I2XA 1PV4A 5CV4A 2IJ0A 4GKKL 2EOTA 2B2VC 4DV2Q 1AE2A 2YTXA 2SEBD 2X69A 3GO5A 2PQAB 1YIJA 5BN3A 1X55A 1LTRD 1EZ8A 4X3UA 4A3KG 1QZGA 3HFZB 1J6QA 2R92G 3CW2C 1X54A 5FO8B 2QGQA 4K5VA 4C56C 3K57A 2YU9B 4KMUC 2HT1A 1RIPA 4MZ9A 3H91A 1UEBA 2AQ3B 3TP6A 3STBC 4R4IA 1V43A 3RZOH 4HCSA 1A6XA 1R4PB 2KCTA 1DGSA 4JI8Q 1OXVA 3E3XA 4H02A 4A4IA 3NQTA 1TWHB 5K5PA 1H9SB 2CWPA 4R9WA 5C3EG 3KLWA 1HXYD 1VQ5A 2UUAQ 4XQNA 4R8NA 1IW7C 3I3CA 4P74A 4EVOA 4GNXC 4QF4A 1NR4A 1Y1VB 3KJPA 3HKZG 5IP7H 1VQBA 1C48A 2HHHL 2EY6A 2KCNA 1HPCA 4F7XA 4X64L 3K5NA 5C4XG 3K0XA 4OHJA 4PQXA 2H5XA 5H1SE 4RHRA 2FFKB 2IX3A 2EYMA 5NUCA 5JEAH 1AFPA 4RHSA 3FMCA 4LF4Q 3CC7A 3K0YA 1O80A 4BWGB 2JEAI 4C3HB 1GUNA 3HOWG 3D0FA 3E0EA 4PZ6A 3Q0AA 4DV4Q 3QWNA 4AH6A 3HOUB 3ZYYX 1LLRD 3FHWA 1A8VA 3T1HL 1JORA 4A3GH 4QGUA 1YNNC 2FXQA 1RTOA 1TS4A 2FJ2A 1ICFB 2DNCA 4CJ0B 1CKNA 4C2MB 4KI0A 3TP8A 3BVMA 3U9SA 1BCPF 1EUJA 5FLXc 3GTLB 4QUCA 1J8IA 1K8MA 3VA7A 5I6YA 5JPMC 4KK7A 4CJ2C 3Q23A 2RDFA 2RCNA 3FPPA 3HKZB 3H09A 1PRTD 4NB3A 3CCRA 2QW7A 3DMUA 4A93B 1IBLQ 4RA8A 1LV9A 3TDQA 1XX8A 4POFA 3OTOL 3PGZA 1YJWA 4WFN3 1EYDA 2XWBB 4B9XA 1UUPA 1A3TA 2CHBD 2O5JC 1BBXC 5C44H 1HHVA 1T5XD 4F8MA 5LMUQ 3SEBA 4DR7L 1OTCA 1C8CA 3CAMA 1SFOB 2B2UC 3NPPA 5CMDA 4A3EH 1R9TH 4KKTA 1BCPC 2ZTDA 3L0OA 3A7AB 1YI2A 1CFMA 4DV4L 3M9BA 3DLLA 3S1RH 3JC66 5E1FA 3EBEA 4DUZL 1KHIA 3LNNA 1E2VA 4OWXB 1QZHA 3W1BA 2V1CC 2TSSA 4FXKC 1RTNA 1E2WA 2N49A 2JA8B 3F8TA 1X65A 4JI4L 4A3MG 1EQTA 5TSSA 3IRBA 4R4QA 3NELA 2NVTB 4JI8L 2B2WC 3TREA 3A55A 1EIHA 4B3SQ 2JA5G 2K5QA 1ILPA 2KECA 4BBRH 2K7VA 1SE2A 2XWJB 5C0XI 1V1QA 4K6DA 5IT9c 2F0UA 2F0FA 2E2JH 3AEVA 1CUKA 3PO2B 1IXRA 5I9OA 3I4MB 4QIWB 3TZDA 4UP8A 1WJJA 3MXGA 1QB5D 1KLUD 1VQIA 1KIXA 3L7ZC 1N34L 3OWFA 4OIKA 1MJEA 4LFCL 1AN8A 4PZ7A 2SNSA 1TU2B 2ID0A 4DR6L 3BZDB 5ELNA 1EIYB 3J80L 5HURA 1TWGH 3HZXA 3KUPA 4IUTA 1U9RA 4LF6L 1QE6A 1PA6A 4FYDA 4KN7C 5CV6A 1Q81C 3SE0A 1X56A 1B70B 3M4QA 4JI1L 4KV6A 1YITA 1YNJD 1JMCA 2B2YC 1K0SA 4IPCA 1VQDA 3J81E 3MWYW 4HIMA 2WB1G 1D1IA 2B29A 5M5WB 4CKEA 4A3DH 3QO2A 3HP3A 3OHXC 2A68C 2OTLA 1D2BA 1MJCA 1YJNA 1A3VA 4GKKQ 4A3BH 2LXKA 2K14A 4QQBX 3PF5A 3N6RA 5CV7A 2PW7A 3K81C 4DXFA 4EGVA 3T56B 1L2FA 2RKSA 2QDBA 5DAUA 3GTMB 3STBD 5LL6X 2R6GA 3S1QH 3I56A 2UXDL 4AYBG 3HGBA 1QNKA 3OSOA 1SJHD 1UAPA 4JPBW 4YCWA 4X66Q 5C0XG 1QUQA 3D8GA 2R93G 1I5FA 1LTLA 3KBXA 3KF6A 3S15H 3M4PA 2K52A 2XRQD 3I73A 1XMQQ 1JJCB 3M3YH 3BDLA 3HKZE 1N9WA 1Q1BA 4PZ8A 5IYBG 1GKHA 3AFPA 3G4SA 3I4NG 4UY8C 5CC4A 3NK9A 4HAEA 1SNCA 1WTXA 3V2TA 4Y7NH 1PTOC 1SMYD 2Z1CA 5A2QL 2E2HH 2RA4A 3CCUA 5C0XJ 1BVSA 3L3OC 3JAMi 1F9QA 2EJMA 1E0BA 3J81L 4TRDA 1UE1A 4C2MH 2YYZA 5KYIA 1KABA 1K8GA 1UNSA 1TWAB 4X64Q 4A3KH 5JPNC 1C7YA 3W3AA 2E2JB 3BDOA 3NHHA 3PMFA 4GLAC 4UP9A 1CSPA 1EL0A 2Z4IA 2HQLA 3PIP3 2H4OA 1KC8C 1PXUA 4BBSB 1XMOQ 3NENA 1STGA 5BR8Q 4X62Q 2R7ZB 5G3LF 2PCFB 2HDLA 2AWNA 4MIUA 4GLVB 3URYA 3BS1A 3BVZA 2F0QA 4RAUC 3MXNB 4GS3A 3HOVB 4YWMA 3C1FA 1NMFA 5E4WC 1HR0Q 4A93H 2NZHA 1B50A 4DA2A 2R7DA 2YV5A 4KLKA 4GN5A 1PTOH 5LHY1 1EZ6A 1QOHA 3F2BA 1V8QA 3M7GA 4B3SL 2PI2E 2RCFA 2VB2X 2Z4HA 2Y0SB 1TY0A 5IT9E 1LUZA 3T1YQ 2PZTA 4NP5A 1SBBB 4A3GB 4A3EB 4GOPA 4JI3L 3I4MH 5K36G 3BJUA 1STAA 4YCUA 1DYQA 2AQ1B 1EIFA 4LAAA 1M8AA 2UUBL 3M4YA 4IPHA 2AUKA 1Y8OB 2JA7G 3TP7A 3SK5A 2LMCB 1EY4A 3ER0A 1YZ6A 2HIXA 2EJGC 5I9PA 1TY2A 2R93B 4LW1A 4AQYQ 3I4MG 5K36H 2KCMA 1PVOA 2Q8IB 4AYBB 1ESRA 1I4XA 3NTIA 3WWVA 1I4GA 3QIAA 4K2KA 2IX1A 4DR3L 3SGIA 2A68D 3WDNA 4GKJQ 1WYDA 1FNWA 3CQZH 1HH2P 1Y1WG 2NVQH 4DV0Q 4P71A 4JI2Q 2GA4B 3PO2H 2MP1A 2NYZD 3W1GA 1CI3M 2HD3A 3A5UA 3UI2A 1LYLA 3R2IA 5CV8A 3HG9A 4C3IG 4AIMA 4KD3A 4YWLA 2PO4A 3S16H 2G9DA 1F77A 2B2UA 3GQBA 2WB1B 4KHPL 2M00A 3H6MA 1HQRD 4Q0FA 2E2IH 2A8VA 2K75A 2QEJC 2ATWA 1ML0D 1TQOA 5DM73 4H44C 4EQNA 4EX5A 1KD1C 2NVTH 1XYIA 4QCLA 3ZJYC 3RMHA 1STEA 4X66L 3F2DA 1H9SA 4N9PA 1K3BC 4PV1C 2WP8J 2HDMA 1SLJA 2BH8A 3QOLA 1GOZA 1XXGA 1F2YA 3D4WA 3RN5A 1HTLD 1JR0D 5IWAQ 4LFBL 1FNUA 4FNFA 2F0GA 3QJYA 3G6EA 1I4HA 2EYLA 1NTGA 4I65A 3VYTA 1AE3A 1BBUA 1Y69U 2G5DA 1U4LA 2EVBA 2PI2A 3UDXA 1PYBA 1X3QA 3EN2A 2MO1A 2EYHA 3NE5B 1VQAA 1BBWA 1K28A 2ZM6L 2Z0SA 3I72A 1N33L 1KAWA 1S5FD 3V05A 3MXUA 2SDFA 2L55A 2F0IA 2J0TD 3KBGA 5J1ZA 5C4XH 1MBYA 1SRUA 3QOJA 1JWUD 2VY3A 4V0BA 2UU9L 2E76C 2ES2A 3S1RB 4K0KL 1A3UA 1HJPA 4HIKA 1B3QA 3P7JA 1JWMD 2F0NA 1SAPA 4C3HG 2EXDA 2D5DA 4P73A 1CQVA 5M5WH 1L1OA 1G6PA 4A3IG 3HOWH 3H3VC 5AFWA 1STYA 2F0SA 2I5LX 5LMUL 3GTKH 4IFDH 4HIDA 3UDGA 1EU3A 1QCBD 2SNMA 3FDTA 2KOLA 1VQPA 1DXMA 4G7HC 2UXBL 4RKLA 3I90A 1R4QB 2N88A 1UE7A 2VQFL 3TS0A 4WJ4A 2QA4A 4DUZQ 1U4RA 5LL6S 1NSNS 2SOBA 5IP7G 1EFWA 1JE4A 4ID6A 2EYOA 1EFID 4DGZA 1N34Q 4LF5Q 2CFMA 5FKAC 4XQJA 2KBNA 3KDFA 5EPKA 2PQEA 3EQLC 2EY1A 3HOZH 3TRZA 4JI6Q 4IQZA 1SYBA 4OEMB 4O0AA 2F3VA 5C4HA 5CV5A 1W6KA 3GTJH 5JJLA 3S2DH 1Z7TA 2WIIB 1RD9D 1G2SA 2VW9A 4IJHA 3U4VA 4Y7NB 1CSQA 3PF4A 3GTQH 1EYCA 2F0EA 5JVH3 1O7YA 2XNAC 4DR1Q 2E74C 4I7ZC 4HSVA 4RMFA 2C5CA 5IYDG 3EFXD 1W3SA 1XWEA 1N36Q 3H94A 3HKSA 1Q12A 4A3MB 4A3IB 5ELBA 3DEOA 2L0CA 4B08A 2CVRA 1JB3A 1BR9A 1Q8KA 4GOPB 1B9NA 1EWCA 5IOCA 5LMNW 4ZUJA 3Q8DA 2A69C 2R7ZH 4L5QA 1I94L 1O7LA 5ELOA 2QCPX 3HOYB 1X3EA 1KDBA 2DY8A 1CKMA 3K7AB 4KHPQ 2JN4A 4JBWA 4N8FA 1NR2A 1ZEQX 2RHSB 3CU7A 4DV7Q 1GUOA 4DR4Q 2JEBI 2O2LD 1NCVA 1VQHA 1LT6D 1P16A 3B6YA 4DU9A 4U68A 2NTSA 1K83H 2WAQG 1Q82C 4HSPA 3IKJA 4TVAB 1Q7YC 2PNHA 3HOYG 2IX0A 1Q86C 3G6JB 4JBJA 1BOSA 1U5KA 1DJRD 2F4IA 4MN3A 1JOOA 1PTOB 1D5ZC 1A0IA 4CDEC 4ZK9B 2A6HC 2IPKD 4FVMA 3DHQA 3F1ZA 3PUYA 4A3FH 1S5DD 4KY7A 1PRTB 1XTCD 4V190 4A3KB 3HS0C 4H0LC 1BCPB 1CA5A 3KLSX 4KY5A 4RCOA 4P72A 5FLXL 5T1IA 1FR3A 3TS2A 2UXBQ 1BCPD 4LF9L 4DUYQ 1VMCA 3RR5A 3RN2A 3ULLA 5M3MH 1DZ1A 1XMOL 3SK8A 2JA8G 4C3IB 2JA6G 5KIXA 1YVCA 4ZYSA 1YEZA 4GN4B 4LFAQ 1FNVA 2R93H 1WTVA 4BY7G 3H0GG 4DN4M 2A1AA 4B3TQ 1LTTD 4GLXA 2RF4A 4JCVE 5C4XB 2VL6A 1D5XC 1ENAA 1U4MA 5DEHA 3BYYB 3MEFA 4FXGC 3MTSA 1XJVA 3T1YL 2KQ3A 3VR4A 4B3ML 1ENCA 1H95A 5I6WA 1PFBA 1VQMA 4DK3C 2PMZB 5CGKA 1HNWQ 1WD1A 1BUVT 1H9RA 2BE5D 1MSHA 1IYUA 1E24A 1Y1WH 4DNRB 1O78A 2JA6H 4FF4A 3SR1A 4IPDA 3GV3A 1EQVA 1PH1A 2ICEC 4HJAA 2BE5C 1PZID 4IUNA 3IFDA 3S9WA 1IBKL 3KF6B 4WRDA 2QEXA 2WKDA 3VR2A 1EY8A 3G7LA 3MEHA 1V1PA 4HJ5A 2NBFA 3K5MA 1D5MC 2MGSA 5KNCA 3MAQA 4HMJA 1AH9A 2RQXA 4KHZA 1JJ2A 2I46A 4DR7Q 1FYCA 2XVSA 1LTAD 1HR0W 4B3RQ 4DV3L 1NBWA 2HHHQ 3Q22A 2WINB 3ERQA 3CRLC 2AQ2B 5IYCG 1B9MA 4PMBA 3G71A 5IP9H 1YBYA 4CDDC 4GKJL 3NP8A 2B63H 4LMQD 1HZCA 4CHTB 5GAGC 4ZKCB 5AJ3L 3NWTA 1LABA 3NEMA 2PNRC 3ND9A 4ZKBB 3CCSA 2WAQB 1I4RA 4K2LA 2JA7H 1B7YB 4DPGA 5T1GA 5M5YH 1ONLA 2KHJA 4IZ8A 3T1HQ 3UE1A 2M9VA 4A3JG 3BVGA 2VZAA 4JOIC 2KJXA 3CF5A 4FF2A 2JSOA 4R4OA 4CKCA 2GVAA 1KQSA 3CD6A 1F9RA 1HNXL 3OW7A 2VXWA 4LFCQ 2F0DA 2VS1A 1SNQA 4R4CA 4L6TB 4B9WA 5FLMG 1XNRQ 1PTOF 1IKMA 2XSCA 1HFGA 4HTHA 2B2WA 5D3IB 5CV9A 4YY3L 3KLSA 1SN8A 4LUZA 4PNYA 5BR8L 1M1KC 5KRUA 2K5HA 4MTNA 3OIQA 1RF2D 5FOBB 4DR5L 3J80E 4JI7Q 5JEAG 1ESFA 4Q5VA 1TIID 4JOIA 4BY1H 1A62A 3D4DA 5KEEA 1JJGA 2EJFC 2E75C 4J8QA 1V1OA 1BXTA 5AJ3Q 1O7ZA 5ELCA 3CRKC 4DUYL 3NXWA 1NNXA 2CH4A 4LK1C 1I4PA 1SNDA 4E6IA 2K50A 4OO1I 5COYA 1H9KA 3ONAB 2JE6I 1J5EQ 3C3LA 2JP1A 2RVLA 1AEXA 2K32A 1WCMH 4X65Q 1HZBA 3J81i 4FP5D 1K83B 1I3QH 1SE8A 5HGTA 1PHJA 2E5LL 4IFDI 1HCZA 5EKLA 2F4VL 5JJKA 4DV1Q 2NN6H 4CGYB 3S2DB 2OCEA 4A3FB 2RDGA 5GQOA 3NWSA 3HOUH 4A3LG 2OF1A 4DK0A 2ZT9C 5CR3A 1TVXA 2PW5A 2QILA 3PSIA 1X9NA 2JA5H 2MNAA 5CBAE 3AB9A 1DOMA 2JK8A 1FJGL 1SYFA 3R2TA 1FD7D 4IFDJ 1K8OA 2WKCA 2JYOA 1I4QA 2WV6D 1GO3E 5E7NA 3WOEA 2EY5A 3Q6SA 4UP7A 4GNXB 4M8AA 3IAYA 4NPSA 1HQMC 1OXUA 1SXTA 2E2DC 4NXNL 2MFIA 2Z8LA 2EZVA 2P5ZX 2F0OA 2B2TC 3J7ZC 3NQIA 4PMCA 2IW3A 4ILWA 4DAVA 4C3JH 4LF5L 3KK7A 1J5EL 1TWCB 5I2YA 4KJOA 2HUGA 2I5MX 4P2CB 4ODGA 2IT1A 3CMEA 4OGQC 1IBLL 5JJIA 4JI6L 2VUMH 3D6WA 1C0AA 3T51B 1KDCA 4A3IH 4A3MH 1PH3A 5EGTA 3H3VH 1LACA 2IY5B 4R4TA 1OXTA 3ULPA 1JE5A 3DXJC 3QB3A 1TS5A 4XYOA 4K6LA 2K6AA 1S3OA 3FVQA 4H13C 4J15A 2A69D 4GNXA 5EBCA 3HOXH 2VUMG 1TWFB 4BBRG 1XPUA 4DV1L 3PCOB 1X3PA 5DNFA 4DV6L 2K5NA 5J39A 2D0PA 3HOVH 4BBRB 5C4JB 1E7ZA 3J81c 1TKWB 5KGUA 3KDFB 1ET9A 4DKAC 3VYUA 2ASBA 3NUCA 1WTWA 2KEEA 1F9SA 1G91A 3AU7A 2F0WA 1V1PB 1SE3A 3LX0A 1BO0A 1JOQA 4R8IA 4JI0Q 5ELFA 3RZDB 5M5YB 4XQQA 4L5TA 1PH9A 2QKIC 2NN6G 1F2MA 2FHTA 4LJZC 4QUFA 3KOJA 3A8KE 3CKIB 1KXLA 2YTVA 3TSSA 4K0KQ 1EYAA 1PH6A 4O42A 4QJFA 1E2ZA 1CHQD 3OMCA 3H0GB 4UAIA 5IGGA 4QMGA 2MUYA 3NSWA 4YY3Q 1Y8NB 1BKBA 2KVMA 5JVG3 4K14A 2RHQB 1B8AA 1L1OB 1TWAH 4BA1I 5C5MA 2B2VA 3EIVA 1FVIA 2KUMA 3K6OA 1FGUA 4ZRZA 3KJOA 1QVCA 1TT2A 2OTJA 2KCCA 2LXJA 3RLFA 5J3BA 3GTGH 1VQKA 3I2ZA 1T5EA 2HCIA 1SYEA 1LTID 4HR7B 1XNQQ 4IO9A 4TQUS 3HRZC 1E1TA 3MHBA 4KHVA 2EYJA 1BQQT 4L5SA 1HZ9A 2MJ8A 3HOZG 3S1NH 4HCEA 4G57A 1O7IA 1GD7A 4QB4A 4A3CG 5IGFA 3W5OA 3GDEA 4L8JA 1WOCA 3PIO3 1HNZQ 1G2TA 4X6AH 5C0XH 2VQEL 1Z9FA 3UDFA 1W2BA 4MTKA 2B8FA 1MGSA 1F2LA 2F0VA 2DJGC 2JA7B 2Y0SE 2PYKA 3GP7A 1N36L 3E9IA 1HTPA 2AHOB 3RLNA 3CCJA 4A3CH 3I4LA 4PMWA 2K33A 4ZCKA 2MPMA 4DR2L 1JQYD 4XT3B 4BXXG 1K73C 3U4ZA 5HGQA 3A54A 2A6EC 5ISRA 1Y1WB 2DJFC 3J81j 1EWHA 4NMZA 1S5CD 1XNRL 3S2HB 1EWIA 4CKBA 4RFBA 3FEWX 4YIJA 1II3A 1QVGA 1QWYA 4RG1A 2N8NA 1SMYC 1UEAB 1IBKQ 4A3BG 2HIVA 1A15A 1HA6A 2NVYB 2GVBA 2WFWA 2ZXOA 1B44D 4NKLA 5C3EH 3CQZB 4R1JA 3KLRA 1VQNA 4ME3A 4TKOB 1I94Q 2JA5B 2L5TA 4BBSG 4B3RL 1QG7A 1ZYRC 4L5RC 2BCOA 2NVXB 2WB1E 1NE3A 3SK4A 3N52A 2XRSD 3ERSX 1CA6A 5IGEA 1NMGA 3I7FA 1SNMA 2ENBA 4DR2Q 2CCZA 1B1ZA 2PZUA 1D8LA 2AWOA 3ITPA 4EQ5A 2A6ED 3D3RA 3TEHB 4GOPC 3LGJA 1YJ9A 2X6LA 4A93G 3JAML 3J7YW 3TN2A 2F52A 5ELEA 1DONA 1JICA 3PUWA 1EOTA 5C3XA 2IHFA 2VUMB 1M4VA 3DUZA 1SNOA 2F0KA 2CWAA 3E6ZX 4UDUC 2CW0D 4JBKA 1PH2A 2YU9H 4BY1G 2LY7A 3MA2B 2OXPA 4HJ9A 3RZDH 4U673 3J80i 1EY5A 5GAEC 2CW0C 1MI2A 1SYDA 4O2DA 3VA5A 1ICWA 3H15A 4RKBA 1G51A 3MXNA 1IKLA 2DUDA 1IYJB 4QIWE 4B3MQ 1PLFA 3OTOQ 1L0XB 5C4ZA 2A19A 2K05A 4LF7L 1EIGA 5EKIA 3SHLA 1NUCA 2NVQB 2Q2HA 2EPBA 1SEBD 2MO0A 3BDCA 5DLQE 5KNDA 1TWCH 4APVA 2L9HA 2I07B 4GN3B 4DR1L 1TS2A 4OWWB 4NDXA 1IYVA 2NZ1D 4AQYL 4WJWA 1B53A 5IP9G 5C5LA 5CORA 4IURA 4CDCC 1PH5A 2LS01 1GUGA 3I8ZA 3GTKB 4ALPA 1N32Q 1K8AC 1LO5D 4C3HH 2M2LA 4BY7B 5KNBA 2VQEQ 2F3IA 1Y1VG 1V9PA 3R3OA 4J6HA 1Q3LA 4RCNA 2NUCA 1LTGD 2FMCA 2NZOA 3I55A 1CZWA 4ME5A 3K80C 3J7AF 1VQFA 3PO3G 2Z6KA 1HRJA 1BF4A 1CKOA 1C9OA 4DR4L 4XT1B 1SYGA 3QG1A 4GZYC 1VQEA 5IWAL 4LFBQ 1NAPA 1J9OA 1EQQA 1WFQA 1PFMA 1YHBA 1LTBD 1A2UA 2FMMA 4NXNQ 1S40A 2BOSA 3M7NA 4LF9Q 3PO3H 1D1KA 4X3TA 3D6CA 1SE4A 1JCKB 4AYBE 2HQEA 2Z6BA 1L0YB 4P75A 2Q2TA 1Y1VH 1I6HH 2F1MA 2ALYB 1DOLA 2G9HD 1KRTA 3TZUA 1KDAA 1CT1D 5E4XA 4I7AA 3D31A 2TMPA 1AP0A 4TSSA 1WI5A 2VB3X 4KN4C 2RBMA 5GAHC 3AMUA 5IGCA 4CJ1B 4LF8Q 5IODA 1RHPA 5CYUA 3K5LA 3DWAA 4O1NA 3T13A 2KHSA 1NY4A 4F87A 3PIPA 2ZJQA 2XN9C 5C44B 3EROA 2K03A 3P75A 1WD0A 1WTQA 1K3RA 3CCVA 1HNXQ 3F2CA 3VYSA 3E9HA 4KJNA 4LNQA 1YNND 2F0MA 3TBIB 1CM9A 2L11A 2PPBC 4RGNA 4DR6Q 4A3DG 1YHAA 2XTIA 3UE0A 1B2TA 1SMXA 2ZJRA 4YCVA 4CBVA 4DV5Q 3QR8A 3NBHB 1GUSA 2EDGA 4X65L 3S14H 2L4NA 1HZAA 5A2QE 2Y0SG 2F0HA 4OONA 3S17H 1U4PA 4DAPA 4RWSC 2F0LA 3GD7A 1ET6A 2N3SA 1HUNA 4K5XA 3J7A5 1MSGA 1VQ7A 3C2PA 1TWHH 1BNZA 2OWOA 2K28A 2DGYA 3K7AH 1KNEA 2E8GA 5EKKA 3R93A 3PV0A 3CCLA 1D6EC 1AW7A 5FJ8H 1VQ6A 3K5OA 4K5WA 4JBMA 4OELB 4LUOA 3IL8A 1EEID 2ZTEA 3S1QB 2C9OA 2UXCQ 2K01A 1LT3D 3S1MB 1EY6A 3SK6A 1EQRA 3GTGB 1IW7D 2NTTA 3H3VI 2UU9Q 1GM5A 4C1NI 2IWHA 2R7FA 1RDPD 2WAQE 4OO1G 3T4AC 1ASYA 5FJ8G 2I0QA 1CZGA 2R3ZA 5IYDH 4RH6A 4IFDG 3UDIA 4OX9L 2UXDQ 2B3GA 1U0LA 2OQ0A 3M3YB 4LF4L 2B2YA 3M4OB 3KYHC 1YHQA 3FKIH 4IUUA 1N8RC 4Z9CB 1KAAA 4N9TA 4MNOA 5A35A 2KHIA 2NB0A 4OO1H 2BH2A 3CHBD 1CQFA 1ASZA 1XPRA 2CQAA 3E0JA 4B3TL 4C3JG 5FLXE 2I5HA 1QVFA 1MD2D 1PZJD 4OWTB 2RSOA 4LWCA 2XIWA 1SNPA 1PFSA 1ZXTA 1GUTA 2A73B 3TQYA 1Q90A 5EPLA 5J22A 4H7BA 2KENA 4BA2I 3O13A 2ZXPA 4HN7A 3CC4A 1IBML 2HCCA 4G7OC 1SDFA 4MHEA 5M5XH 4A3BB 4X3SA 4M1UB 2ZTCA 1VQ4A 3CPFA 1XMQL 2D62A 3NTKA 1X6OA 1PYWD 5IGBA 5M3FG 1IL8A 3RNUA 1L0WA 4UPAA 5C6AA 1GUWA 3DWPA 3I4NH 1PTOD 3A0JA 4YHHL 4A3JB 5GROA 4G7ZC 3DWQA 1YNXA 2K1BA 4Y52H 4DR3Q 2AKWB 2OEOA 1UE6A 1M90C 2MHVA 1UE5A 4POGA 5BN4A 5JOBA 2L15A 5M3MG 2Q2UA 3S17B 4DV3Q 2RSNA 1FJGQ 1MKHA 4IUVA 1JOKA 2K5VA 4NXML 3PO2G 5D3DA 5BN5A 4RGMA 2ZXRA 3ULJA 2E5LQ 4BY7H 3A5ZB 1BDOA 2D2CC 3C46A 4FO2A 1IHZA 4KKSA 1PZKD 2Q8RE 5IYBH 3BZKA 2Q8TA 2E2HB 1IZ6A 1VF7A 5GADC 3KFUA 4LFAL 1LM0A 5G3LD 3GV6A 4C3IH 1JC7A 1STHA 2LSSA 4JG2A 3MFYA 1PFNA 1X3GA 3CCEA 5JJZA 1RCVD 2PMZE 1PRTC 1XTDA 1VQJA 1HUMA 3OMGA 5DM63 1X32A 4BBSH 1I50H 3CCQA 1SSOA 4DV0L 4JK1C 1SR3A 1RODA 4NW2A 3W2DA 1L1OC 2Q2IA 3IFTA 4OX9Q 4C1NK 1K9MC 4BY1B 3D4RA 3JAMc 5I4DA 3PO3B 5EQ0A 4YHHQ 3A8IE 5IIFA 1VQ8A 3GTOB 2N55A 2F0TA 4LUVA 4DV2L 1F9PA 1QUQB 2MQHA 1QNUA 3OW2A 3NTHA 4OXPA 4A75A 4DNIA 3CCMA 3S15B 1E1OA 4KD4A 1HA5A 2BA0A 1PRTF 2XGTA 2YTYA 3CC2A 1AZPA 2F0PA 2EYFA 2FINB 1UWVA 1XPOA 5EAYA 4IOCA 1RL2A 1NJIC 2KA7A 1GVPA 1GXDC 3FKIB 1WCMB 1DM0B 3HOUG 2B63G 1I3QB 4A3LH 3CMAA 1VMPA 3RLOA 4J1MA 4JI5L 4DXGA 3I4NB 3X3NA 4A3JH 1Q8IA 3S14B 3KF8B 1WTHA 4WORA 4RGTA 4EQPA 1JT8A 1MHWC 1EY7A 5M3FB 3GTPB 2X6GA 3MXPA 1EU4A 1FL0A 4JI0L 2DNEA 3SDZA 1T9HA 2QF7A 3K59A 4HJ7A 2EY2A 2GN5A 4OL7A 4RGOS 4IUPA 3AQQA 5FK9C 5C3WA 5ELDA 2F0JA 1LT5D 1PYSB 2UUCL 1E22A 1VF5C 5FLMH 3HOWB 2B63B 1Q46A 5M9OA 1JB7A 5IYCH 4IN3A 1G8ZD 1I6HB 3G48A 4BS9A 4DR5Q 2H1EA 2NN6I 3A8JE 4A76A 2A6HD 4FF1A 3FPUB 3DEPA 4DNTB 4C3JB 1C4QA 4CDFC 1WTOA 4QL5A 3DM1A 1CTMA 2EIFA 3NBHA 1S4ZA 3A74A 3K8AA 5HY6A 1WCMG 3A56A 1G291 4IOAA 1E3PA
chains in the Genus database with same CATH topology
2PZWA 2O5IC 4XTCS 5E3FA 3RZOB 4KKUA 2EE1A 2EYPA 2BDOA 1TR5A 3OPOA 3HOZB 3T16A 1RJTA 1Z6HA 2R92B 3BYTB 4FF3A 3TP5A 5FO9B 1B3AA 5FO7B 2F03A 5EJWA 1GHKA 2BA1A 3EA6A 3Q24A 2K5WA 1DOKA 2D9UA 2NWGA 1WTPA 4ZUIA 1LTSD 4X3KA 1A2TA 3LWUA 4XXEA 4K8IA 3PUVA 1F2ZA 1S5ED 3S1NB 3K58A 1VCIA 1Q1EA 2E2IB 4ABNA 3BG3A 1VDZA 5IT9L 2L1BA 3HOXB 1EY0A 2BDNA 4OIJA 4IUQA 5M5XB 4FXDA 1CK1A 2V4DA 1B4OA 3MZ5A 1OXSC 2LFNA 1GHJA 4XDXA 3TMEA 3ND8A 3VYRA 1PMRA 4HMIA 2B39A 3S16B 1GJXA 5F2DA 4G4KA 1ILQA 3P20A 4L63B 4ZAIA 4KTAA 3MC0B 2B2TA 1ZKOA 1LT4D 1Y8PB 4HEDA 4F88A 4XYQA 5D14A 2IL8A 2J4XA 3MFGA 5JAVA 1EY9A 4S3SA 5CBEE 4DAYA 1RKNA 1WTRA 1AZQA 2J7ZA 1I50B 1S5BD 3EVQA 4KY6A 3OIPA 2O4XA 2ICIA 5D65A 2DY7A 3JAME 1TS3A 1PDQA 3VR6A 3U9OA 2KEDA 3E5SA 3T53B 2F3WA 4XIGS 4IALA 1OXXK 3GTJB 4EQOA 1ENFA 2OT2A 1SYCA 2K5DA 4DF7A 3LWEA 1KLGD 2L12A 2LKVA 3FRPB 5IGDA 3L9AX 3SXHA 1DCZA 1G6ZA 2WACA 3A7LA 1CHPD 1KNAA 1SJED 3R8BA 2R61A 1W6JA 2JA6B 3RD4A 2B8GA 2RDHA 1H9JA 5EPJA 1STBA 2DN8A 1JWSD 3GTQB 4K8JA 2K04A 3P1HA 2A74C 3RUZA 3KF8A 1STNA 1DD2A 1HFNA 1QILA 4DK1A 3VR3A 2VNUD 3OOCA 3PUXA 3I91A 2EXZA 4A3DB 1TWGB 1KTKA 3EJIA 4ULLA 2A5HA 3I70A 3F2UA 3SVMA 4ZQ3A 3PUZA 3C1EA 3M85A 3X3MA 5C3EB 1I6VC 3HEJA 3NBIA 5JEAJ 4DFAA 1WVLA 1R9TB 2AUJD 5KYLA 3OWEB 1ZYRD 1OO9B 5M3MB 1FGBD 1EEFD 5EBDA 3WOFA 1H9MA 3J7AV 1QJOA 1Z47A 2JXMB 3MVVA 3VR5A 1YNJC 4ZLTF 3V96A 5I2XA 5CV4A 2IJ0A 2EOTA 2B2VC 2SEBD 2X69A 3GO5A 5BN3A 1LTRD 1EZ8A 4X3UA 5FO8B 4K5VA 4C56C 3K57A 2YU9B 4KMUC 3H91A 2AQ3B 3TP6A 1V43A 4HCSA 1A6XA 1R4PB 1OXVA 3NQTA 1TWHB 5K5PA 1H9SB 4R9WA 1HXYD 4XQNA 4R8NA 1IW7C 3I3CA 4EVOA 4QF4A 1NR4A 1Y1VB 1C48A 2EY6A 2KCNA 1HPCA 4F7XA 3K5NA 4OHJA 4PQXA 4RHRA 2FFKB 2IX3A 2EYMA 5NUCA 5JEAH 1AFPA 4RHSA 3FMCA 3K0YA 1O80A 4BWGB 2JEAI 4C3HB 1GUNA 3Q0AA 3QWNA 3HOUB 3ZYYX 1LLRD 1JORA 1YNNC 1RTOA 1TS4A 2FJ2A 2DNCA 4CJ0B 4C2MB 4KI0A 3TP8A 3BVMA 3U9SA 1BCPF 3GTLB 1J8IA 4QUCA 1K8MA 3VA7A 5I6YA 5JPMC 4KK7A 4CJ2C 3Q23A 2RDFA 3FPPA 3HKZB 3H09A 1PRTD 3DMUA 4A93B 4RA8A 1LV9A 3TDQA 1XX8A 4WFN3 1EYDA 2XWBB 4B9XA 1UUPA 1A3TA 2CHBD 2O5JC 1BBXC 1HHVA 1T5XD 4F8MA 3SEBA 1C8CA 1SFOB 2B2UC 3NPPA 5CMDA 4KKTA 1BCPC 3A7AB 1CFMA 5E1FA 3LNNA 1E2VA 2TSSA 4FXKC 1RTNA 1E2WA 2JA8B 1EQTA 5TSSA 2NVTB 2B2WC 3A55A 1EIHA 2K5QA 1ILPA 2KECA 2K7VA 5C0XI 1SE2A 2XWJB 4K6DA 2F0UA 2F0FA 3PO2B 5I9OA 3I4MB 4QIWB 3TZDA 3MXGA 1QB5D 1KLUD 3L7ZC 3OWFA 4OIKA 1AN8A 2SNSA 1TU2B 2ID0A 3BZDB 3J80L 5HURA 3HZXA 3KUPA 4IUTA 1U9RA 1QE6A 4FYDA 4KN7C 5CV6A 3SE0A 4KV6A 1YNJD 2B2YC 3J81E 3MWYW 1D1IA 5M5WB 4CKEA 3QO2A 3HP3A 3OHXC 2A68C 1D2BA 1A3VA 3N6RA 5CV7A 2PW7A 4DXFA 4EGVA 3T56B 2RKSA 2QDBA 5DAUA 3GTMB 5LL6X 2R6GA 3HGBA 1QNKA 3OSOA 1SJHD 1UAPA 5C0XG 3D8GA 3KBXA 2XRQD 3I73A 3BDLA 1Q1BA 5CC4A 3NK9A 4HAEA 1SNCA 1WTXA 3V2TA 1PTOC 1SMYD 2Z1CA 5A2QL 2RA4A 5C0XJ 3L3OC 1F9QA 2EJMA 1E0BA 3J81L 4TRDA 2YYZA 5KYIA 1KABA 1UNSA 1TWAB 5JPNC 3W3AA 2E2JB 3BDOA 3NHHA 3PMFA 1EL0A 2Z4IA 3PIP3 2H4OA 1PXUA 4BBSB 1STGA 2R7ZB 5G3LF 2PCFB 2HDLA 2AWNA 4MIUA 3URYA 3BS1A 3BVZA 2F0QA 4RAUC 3HOVB 3C1FA 5E4WC 1B50A 4DA2A 1PTOH 5LHY1 1EZ6A 1QOHA 1V8QA 3M7GA 2VB2X 2Z4HA 2Y0SB 1TY0A 5IT9E 2PZTA 4NP5A 1SBBB 4A3GB 4A3EB 5K36G 1STAA 1DYQA 2AQ1B 4LAAA 1M8AA 3M4YA 2AUKA 1Y8OB 3TP7A 3SK5A 2LMCB 1EY4A 2EJGC 5I9PA 1TY2A 2R93B 5K36H 2Q8IB 4AYBB 1ESRA 1I4XA 3NTIA 1I4GA 3QIAA 4K2KA 2IX1A 2A68D 3WDNA 1FNWA 2GA4B 2MP1A 2NYZD 1CI3M 3UI2A 3R2IA 5CV8A 3HG9A 4C3IG 4KD3A 2PO4A 2G9DA 1F77A 2B2UA 3GQBA 2WB1B 2M00A 3H6MA 1HQRD 4Q0FA 2QEJC 1ML0D 1TQOA 5DM73 4H44C 4EQNA 1XYIA 4QCLA 3RMHA 1STEA 1H9SA 4N9PA 4PV1C 2WP8J 2HDMA 3QOLA 1GOZA 1XXGA 1F2YA 3D4WA 1HTLD 1JR0D 1FNUA 4FNFA 2F0GA 3QJYA 1I4HA 2EYLA 4I65A 3VYTA 1Y69U 1U4LA 2EVBA 1X3QA 2EYHA 3NE5B 3I72A 1S5FD 3V05A 3MXUA 2SDFA 2L55A 2F0IA 2J0TD 3KBGA 5J1ZA 1MBYA 3QOJA 1JWUD 4V0BA 2E76C 3S1RB 1A3UA 3P7JA 1JWMD 2F0NA 1SAPA 4C3HG 2D5DA 1CQVA 3H3VC 5AFWA 1STYA 2F0SA 4IFDH 1EU3A 1QCBD 2SNMA 3FDTA 2KOLA 1DXMA 4G7HC 4RKLA 3I90A 1R4QB 2N88A 1U4RA 5LL6S 1NSNS 2SOBA 1JE4A 4ID6A 2EYOA 1EFID 4DGZA 5FKAC 4XQJA 5EPKA 2PQEA 3EQLC 2EY1A 4IQZA 1SYBA 2F3VA 5C4HA 5CV5A 1W6KA 1Z7TA 2WIIB 1RD9D 1G2SA 4Y7NB 1EYCA 2F0EA 5JVH3 1O7YA 2XNAC 2E74C 4I7ZC 4HSVA 2C5CA 3EFXD 1XWEA 3H94A 1Q12A 4A3MB 4A3IB 5ELBA 3DEOA 2L0CA 4B08A 2CVRA 1JB3A 1BR9A 1B9NA 1EWCA 5IOCA 4ZUJA 2A69C 1O7LA 2QCPX 3HOYB 1KDBA 2DY8A 3K7AB 4JBWA 1NR2A 1ZEQX 3CU7A 1GUOA 2JEBI 2O2LD 1NCVA 1LT6D 4DU9A 4U68A 2NTSA 4HSPA 3IKJA 2IX0A 3G6JB 1BOSA 1DJRD 2F4IA 4MN3A 1JOOA 1PTOB 1D5ZC 4ZK9B 2A6HC 2IPKD 4FVMA 3DHQA 3PUYA 1S5DD 4KY7A 1PRTB 4V190 1XTCD 4A3KB 3HS0C 4H0LC 1BCPB 1CA5A 3KLSX 4KY5A 4RCOA 5FLXL 5T1IA 1FR3A 1BCPD 1VMCA 1DZ1A 3SK8A 4C3IB 5KIXA 4ZYSA 1FNVA 1WTVA 4DN4M 1LTTD 5C4XB 1D5XC 1ENAA 1U4MA 5DEHA 3BYYB 4FXGC 3MTSA 2KQ3A 3VR4A 1ENCA 5I6WA 1PFBA 5CGKA 2PMZB 1WD1A 1BUVT 1H9RA 2BE5D 1IYUA 1MSHA 4DNRB 1O78A 4FF4A 3SR1A 3GV3A 1EQVA 2ICEC 2BE5C 1PZID 4IUNA 3IFDA 3S9WA 4WRDA 2WKDA 3VR2A 1EY8A 3G7LA 3MEHA 1V1PA 2NBFA 3K5MA 1D5MC 2MGSA 5KNCA 3MAQA 4HMJA 2RQXA 4KHZA 2I46A 1FYCA 2XVSA 1LTAD 3Q22A 2WINB 3ERQA 3CRLC 2AQ2B 1B9MA 4PMBA 3NP8A 4LMQD 4CHTB 4ZKCB 3NWTA 1LABA 2PNRC 3ND9A 4ZKBB 2WAQB 1I4RA 4K2LA 5T1GA 1ONLA 4IZ8A 2M9VA 3BVGA 2KJXA 4FF2A 2JSOA 4CKCA 1F9RA 3OW7A 2VXWA 2F0DA 1SNQA 4L6TB 4B9WA 1PTOF 1IKMA 2XSCA 1HFGA 4HTHA 2B2WA 5D3IB 5CV9A 3KLSA 4PNYA 5KRUA 3OIQA 1RF2D 5FOBB 3J80E 5JEAG 1ESFA 4Q5VA 1TIID 3D4DA 5KEEA 2EJFC 2E75C 4J8QA 1V1OA 1BXTA 1O7ZA 5ELCA 3CRKC 3NXWA 4LK1C 1I4PA 1SNDA 4E6IA 4OO1I 5COYA 1H9KA 3ONAB 2JE6I 3C3LA 2JP1A 2RVLA 1AEXA 2K32A 4FP5D 1K83B 5HGTA 4IFDI 1HCZA 5EKLA 2NN6H 4CGYB 3S2DB 4A3FB 2RDGA 3NWSA 2OF1A 4DK0A 2ZT9C 5CR3A 1TVXA 2PW5A 2QILA 5CBAE 3AB9A 1DOMA 1SYFA 3R2TA 1FD7D 4IFDJ 1K8OA 2WKCA 2JYOA 1I4QA 2WV6D 3WOEA 2EY5A 3Q6SA 4M8AA 3IAYA 1HQMC 1SXTA 1OXUA 2E2DC 2Z8LA 2EZVA 2F0OA 2B2TC 3NQIA 4PMCA 2IW3A 4ILWA 4DAVA 3KK7A 1TWCB 5I2YA 4KJOA 2HUGA 4P2CB 4ODGA 2IT1A 4OGQC 3D6WA 3T51B 1KDCA 5EGTA 1LACA 1OXTA 3DXJC 3QB3A 1TS5A 4XYOA 4K6LA 2K6AA 3FVQA 4H13C 2A69D 5EBCA 1TWFB 1X3PA 5DNFA 5J39A 4BBRB 5C4JB 1TKWB 5KGUA 1ET9A 3VYUA 3NUCA 1WTWA 2KEEA 1F9SA 1G91A 3AU7A 2F0WA 1V1PB 1SE3A 3LX0A 1BO0A 1JOQA 4R8IA 5ELFA 3RZDB 5M5YB 4XQQA 2QKIC 2NN6G 1F2MA 2FHTA 4LJZC 4QUFA 3A8KE 3CKIB 3TSSA 1EYAA 4O42A 1E2ZA 1CHQD 3OMCA 3H0GB 4UAIA 5IGGA 4QMGA 2MUYA 3NSWA 1Y8NB 2KVMA 5JVG3 4K14A 4BA1I 5C5MA 2B2VA 2KUMA 3K6OA 4ZRZA 1TT2A 2KCCA 3RLFA 1T5EA 2HCIA 1SYEA 1LTID 4HR7B 4TQUS 3HRZC 3MHBA 4KHVA 2EYJA 1BQQT 2MJ8A 4HCEA 4G57A 4QB4A 5IGFA 4L8JA 3PIO3 1G2TA 5C0XH 2B8FA 1MGSA 1F2LA 2F0VA 2JA7B 2PYKA 3GP7A 1HTPA 3I4LA 4PMWA 2K33A 2MPMA 1JQYD 4XT3B 3A54A 2A6EC 5ISRA 1Y1WB 1EWHA 4NMZA 1S5CD 3S2HB 4CKBA 4RFBA 3FEWX 4YIJA 1II3A 1QWYA 1SMYC 1UEAB 1A15A 1HA6A 2NVYB 2ZXOA 1B44D 4NKLA 3CQZB 3KLRA 4TKOB 2JA5B 2L5TA 1QG7A 1ZYRC 2BCOA 2NVXB 3SK4A 3N52A 2XRSD 1CA6A 5IGEA 1SNMA 2ENBA 1B1ZA 2PZUA 2AWOA 3ITPA 2A6ED 3D3RA 2X6LA 3JAML 3J7YW 3TN2A 5ELEA 1DONA 1JICA 3PUWA 1EOTA 5C3XA 2VUMB 1M4VA 3DUZA 1SNOA 2F0KA 3E6ZX 4UDUC 2CW0D 2LY7A 3MA2B 2OXPA 4U673 1EY5A 2CW0C 1MI2A 1SYDA 3VA5A 1ICWA 4RKBA 3MXNA 1IKLA 1PLFA 1L0XB 5C4ZA 2K05A 1EIGA 5EKIA 3SHLA 1NUCA 2NVQB 2EPBA 1SEBD 3BDCA 5KNDA 2L9HA 2I07B 1TS2A 4NDXA 1IYVA 2NZ1D 4WJWA 1B53A 5C5LA 5CORA 4IURA 2LS01 1GUGA 3I8ZA 3GTKB 1LO5D 2M2LA 4BY7B 5KNBA 3R3OA 4J6HA 1Q3LA 4RCNA 2NUCA 1LTGD 2FMCA 1CZWA 4ME5A 3J7AF 1HRJA 1BF4A 4XT1B 1SYGA 3QG1A 4GZYC 1NAPA 1J9OA 1PFMA 1LTBD 1A2UA 2FMMA 2BOSA 3M7NA 1D1KA 4X3TA 3D6CA 1SE4A 1JCKB 2HQEA 1L0YB 2F1MA 2G9HD 1DOLA 3TZUA 1KDAA 1CT1D 5E4XA 3D31A 2TMPA 1AP0A 4TSSA 2VB3X 4KN4C 2RBMA 3AMUA 5IGCA 4CJ1B 5IODA 1RHPA 5CYUA 3K5LA 3DWAA 4O1NA 3T13A 2KHSA 4F87A 2XN9C 5C44B 3EROA 2K03A 3P75A 1WD0A 1WTQA 3VYSA 4KJNA 1YNND 2F0MA 3TBIB 1CM9A 2L11A 2PPBC 4RGNA 1B2TA 4CBVA 1GUSA 2EDGA 2L4NA 5A2QE 2F0HA 1U4PA 4DAPA 4RWSC 2F0LA 3GD7A 1ET6A 1HUNA 4K5XA 1MSGA 3C2PA 1BNZA 2K28A 1KNEA 5EKKA 3R93A 3PV0A 1D6EC 1AW7A 3K5OA 4K5WA 3IL8A 1EEID 3S1QB 2C9OA 2K01A 1LT3D 3S1MB 1EY6A 3SK6A 3GTGB 1IW7D 2NTTA 4C1NI 2IWHA 1RDPD 4OO1G 3T4AC 1CZGA 2R3ZA 4RH6A 4IFDG 3M3YB 2B2YA 3M4OB 4IUUA 4Z9CB 1KAAA 4N9TA 5A35A 2NB0A 4OO1H 3CHBD 1CQFA 2CQAA 3E0JA 4C3JG 5FLXE 1MD2D 1PZJD 2RSOA 2XIWA 1SNPA 1ZXTA 2A73B 1GUTA 1Q90A 5EPLA 5J22A 4H7BA 4BA2I 3O13A 2ZXPA 4HN7A 2HCCA 4G7OC 1SDFA 4MHEA 4A3BB 4X3SA 4M1UB 2D62A 3NTKA 1PYWD 5IGBA 1IL8A 5C6AA 1GUWA 3DWPA 1PTOD 4A3JB 4G7ZC 3DWQA 2K1BA 2OEOA 2MHVA 5BN4A 5JOBA 3S17B 2RSNA 4IUVA 1JOKA 5D3DA 5BN5A 4RGMA 2ZXRA 1BDOA 2D2CC 3C46A 4FO2A 1IHZA 4KKSA 1PZKD 2Q8RE 2Q8TA 2E2HB 1VF7A 5G3LD 3GV6A 1JC7A 1STHA 3MFYA 1PFNA 5JJZA 1RCVD 1PRTC 1HUMA 3OMGA 5DM63 1X32A 1SSOA 4JK1C 1RODA 4NW2A 3W2DA 3IFTA 4C1NK 4BY1B 3D4RA 5I4DA 3PO3B 5EQ0A 3A8IE 5IIFA 3GTOB 2N55A 2F0TA 1F9PA 1QNUA 3NTHA 3S15B 4KD4A 1HA5A 2BA0A 1PRTF 1AZPA 2F0PA 2EYFA 2FINB 2KA7A 1GXDC 3FKIB 1WCMB 1DM0B 1I3QB 1VMPA 4J1MA 4DXGA 3I4NB 3X3NA 1Q8IA 3S14B 4WORA 4RGTA 4EQPA 1EY7A 5M3FB 3GTPB 2X6GA 3MXPA 1EU4A 2DNEA 3SDZA 2QF7A 3K59A 2EY2A 4OL7A 4RGOS 4IUPA 5FK9C 5C3WA 5ELDA 2F0JA 1LT5D 1VF5C 3HOWB 2B63B 5M9OA 4IN3A 1G8ZD 1I6HB 4BS9A 2H1EA 2NN6I 3A8JE 2A6HD 4FF1A 3FPUB 3DEPA 4DNTB 4C3JB 1C4QA 1WTOA 3DM1A 1CTMA 3NBHA 1S4ZA 3A56A 1G291
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K2L A;  2PZW A;  5IGF A;  2OXP A;  1SYB A;  3SK8 A;  3HEJ A;  3OWF A;  4IZ8 A;  2F3V A;  1EY5 A;  4DFA A;  5C4H A;  5E3F A;  3NHH A;  3PMF A;  5KIX A;  2SNS A;  5CV5 A;  2EYP A;  5JAV A;  1SNP A;  1TR5 A;  4KJO A;  1TQO A;  4EQN A;  5KYL A;  1EY9 A;  4S3S A;  2RBM A;  4H7B A;  5HUR A;  1SYD A;  5J22 A;  4ODG A;  1RKN A;  2F0V A;  3HZX A;  4RKB A;  3VA5 A;  5IGC A;  3T16 A;  5IIF A;  2PYK A;  5IOD A;  1STG A;  1U9R A;  4N9P A;  3EVQ A;  2F0T A;  2F0D A;  1JOR A;  1KDC A;  5CV6 A;  1EYC A;  1SNQ A;  2F0E A;  4KY6 A;  4MIU A;  5EGT A;  4B9W A;  3T13 A;  5C4Z A;  2O4X A;  2KHS A;  3QOL A;  1F2Y A;  2F0Q A;  3D4W A;  3MVV A;  1ENA A;  3TP5 A;  5KRU A;  5DEH A;  4HTH A;  3QB3 A;  5CV9 A;  4KD4 A;  4KV6 A;  3ERO A;  3P75 A;  3U9O A;  3C1F A;  2F0G A;  5CV4 A;  3TP8 A;  3E5S A;  4PNY A;  1NUC A;  3SHL A;  2F3W A;  5ISR A;  5IGB A;  2KQ3 A;  2EYL A;  3BDC A;  2F0P A;  4KJN A;  1ENC A;  2EYF A;  2F0M A;  4I65 A;  4NMZ A;  5I6W A;  4IAL A;  5I6Y A;  5CGK A;  2RDF A;  1EZ6 A;  5C6A A;  1JOQ A;  4YIJ A;  4EQO A;  1II3 A;  5J39 A;  4NDX A;  3DMU A;  3D4D A;  1SYC A;  5KEE A;  4DF7 A;  2EYH A;  1EZ8 A;  5IOC A;  5KGU A;  4ZUJ A;  2LKV A;  1A3V A;  5C5L A;  2PZT A;  5IGD A;  4ZUI A;  4NP5 A;  3SXH A;  2F0H A;  2F0I A;  1EYD A;  3NUC A;  1A2T A;  1KDB A;  4K5V A;  5J1Z A;  3SR1 A;  4B9X A;  4K8I A;  1F2Z A;  1A3T A;  3QOJ A;  4J1M A;  1EQV A;  2PW7 A;  2WAC A;  2F0L A;  1STA A;  3NXW A;  2F0W A;  5CV7 A;  1SND A;  4NKL A;  3LX0 A;  4E6I A;  2OEO A;  1A3U A;  4K5X A;  4LAA A;  3TP6 A;  4F8M A;  2RKS A;  2QDB A;  5DAU A;  4IUN A;  2F0N A;  3S9W A;  1AEX A;  5JOB A;  4WRD A;  1EY8 A;  5HGT A;  3MEH A;  3TP7 A;  4WOR A;  5EKL A;  3SK5 A;  4EQP A;  1EY4 A;  1F2M A;  3OSO A;  5EKK A;  1EY7 A;  3R3O A;  1EY0 A;  4HMJ A;  5I9P A;  1JOK A;  3MXP A;  4J6H A;  5KYI A;  1STB A;  1STY A;  2F0S A;  2NUC A;  3D8G A;  2OF1 A;  5CR3 A;  3NQT A;  5E1F A;  3SK4 A;  1EYA A;  2EY2 A;  2PW5 A;  4K8J A;  4K5W A;  4ME5 A;  4OL7 A;  4DU9 A;  5K5P A;  5C3W A;  2SNM A;  3OMC A;  3P1H A;  5IGE A;  2F0J A;  3MZ5 A;  1SYF A;  4QMG A;  3RUZ A;  5IGG A;  1EY6 A;  1SYG A;  3SK6 A;  1SNM A;  1STN A;  2ENB A;  1IHZ A;  4RKL A;  4K2K A;  3TME A;  4K14 A;  2PZU A;  4R8N A;  3BDL A;  3ERQ A;  5C5M A;  4EVO A;  3ITP A;  4HMI A;  5M9O A;  4QF4 A;  1A2U A;  5F2D A;  1JOO A;  1NSN S;  4PMB A;  2SOB A;  4QB4 A;  2EY5 A;  3NK9 A;  5CC4 A;  1TT2 A;  2EXZ A;  3DHQ A;  1SNC A;  3EJI A;  5CV8 A;  2EY6 A;  5C3X A;  4ID6 A;  4KY7 A;  3V2T A;  2EYO A;  3NP8 A;  3D6C A;  4F7X A;  4DGZ A;  1SNO A;  2F0K A;  4K6D A;  1SYE A;  1STH A;  2F0U A;  2F0F A;  2HQE A;  4KD3 A;  4KTA A;  4KY5 A;  4ZQ3 A;  1KAA A;  4N9T A;  3MHB A;  4KHV A;  5I9O A;  2EYJ A;  2F0O A;  2PQE A;  2EYM A;  3C1E A;  5NUC A;  3OMG A;  4TRD A;  1KDA A;  4PMC A;  2EY1 A;  4G57 A;  2M00 A;  1KAB A;  3H6M A; 
#chains in the Genus database with same CATH topology
 2PZW A;  4LF8 L;  3I4O A;  2O5I C;  4XTC S;  5E3F A;  3RZO B;  4KKU A;  2EE1 A;  3J80 c;  2EYP A;  5LMN L;  2BDO A;  1TR5 A;  3OPO A;  4DV7 L;  4JI7 L;  3HOZ B;  1IL2 A;  2JJQ A;  1RJT A;  3T16 A;  3HOX G;  1VQO A;  2Z9H A;  1HR0 L;  1Z6H A;  2R92 B;  3BYT B;  1KRS A;  1K0R A;  3L2P A;  4PG3 A;  1TWF H;  3S1M H;  4FF3 A;  3TP5 A;  4JV5 L;  5FO9 B;  2UUC Q;  4DAY B;  4X62 L;  1B3A A;  5FO7 B;  3VDY A;  3OYY A;  2F03 A;  3PQI A;  5EJW A;  4JYA L;  4JI3 Q;  1GHK A;  3BZC A;  2BA1 A;  3EA6 A;  4LF7 Q;  2JQO A;  3Q24 A;  2K5W A;  1DOK A;  2D9U A;  2NWG A;  1WTP A;  4ZUI A;  1LTS D;  3PIO A;  1VS0 A;  4X3K A;  3AFQ A;  1A2T A;  3LWU A;  4XXE A;  4K8I A;  3PUV A;  1F2Z A;  1S5E D;  1MIU A;  3CXC A;  3S1N B;  5C4J H;  3K58 A;  1VCI A;  1Q1E A;  2N78 A;  2E2I B;  4ABN A;  3BG3 A;  3BU2 A;  4A3G G;  1VDZ A;  5IT9 L;  2L1B A;  3HOX B;  2Z6K C;  1VQ9 A;  1EY0 A;  4JVZ A;  2BDN A;  4OIJ A;  3GTO H;  4IUQ A;  4FDB A;  2OQK A;  1N32 L;  5M5X B;  4FXD A;  4JI4 Q;  1CK1 A;  5C44 G;  2V4D A;  1B4O A;  3MZ5 A;  1OXS C;  2LFN A;  5L37 A;  1GHJ A;  4XDX A;  4JI5 Q;  3CP0 A;  3HOV G;  3TME A;  3ND8 A;  4A3E G;  3VYR A;  3M4O H;  1Y14 B;  1PMR A;  1VQG A;  3FP9 A;  4HMI A;  1CKN B;  2B39 A;  1PH7 A;  3S16 B;  1GJX A;  5LMN Q;  5F2D A;  1PH8 A;  2JA9 A;  4G4K A;  4JYA Q;  3AYH B;  1ILQ A;  3P20 A;  4IJL A;  1HNW L;  4L63 B;  4ZAI A;  4DK6 C;  4JI2 L;  2VQF Q;  4KTA A;  3MC0 B;  2B2T A;  3H0G H;  1ZKO A;  1LT4 D;  2IHE A;  1X3F A;  1Y8P B;  4HED A;  2CH4 W;  1D7Q A;  4F88 A;  4XYQ A;  5D14 A;  2IL8 A;  2J4X A;  3MFG A;  2R7Z G;  2CQO A;  4WJ3 M;  1SRO A;  5JAV A;  2F4V Q;  3CPW A;  1EY9 A;  4S3S A;  5CBE E;  4DAY A;  1RKN A;  1WTR A;  1AZQ A;  2J7Z A;  5IE8 A;  1I50 B;  1S5B D;  3EVQ A;  4KY6 A;  3OIP A;  2O4X A;  2ICI A;  5D65 A;  2DY7 A;  1VQC A;  3JAM E;  1TS3 A;  2UUA L;  1PDQ A;  4DV5 L;  2QDL A;  3U9O A;  3VR6 A;  2K4K A;  2KED A;  3E5S A;  3T53 B;  2F3W A;  3FKI G;  4LF6 Q;  4XIG S;  1N33 Q;  4IPG A;  4IAL A;  1OXX K;  2NVY H;  3GTJ B;  4DAM A;  1EYG A;  4EQO A;  1ENF A;  2OT2 A;  1SYC A;  2K5D A;  4DF7 A;  3LWE A;  2AMC B;  2UUB Q;  1KLG D;  2L12 A;  2LKV A;  3FRP B;  4UHV A;  5IGD A;  3L9A X;  3SXH A;  1DCZ A;  1G6Z A;  4N8X 1;  2WAC A;  3A7L A;  4QY7 A;  4JV5 Q;  1CHP D;  1KNA A;  2PQA A;  4A3F G;  1SJE D;  3R8B A;  5IY0 A;  4NXM Q;  2R61 A;  2ZM6 Q;  3U50 C;  1W6J A;  2JA6 B;  2UXC L;  1HNZ L;  3RD4 A;  2B8G A;  2EQS A;  2RDH A;  1H9J A;  5EPJ A;  1P8L A;  1STB A;  2DN8 A;  1JWS D;  2JA8 H;  3GTM H;  3GTQ B;  4K8J A;  4YWK A;  1SFO H;  2K04 A;  4BXX H;  3P1H A;  2A74 C;  3RUZ A;  3KF8 A;  1PH4 A;  3S24 A;  2CKZ B;  1STN A;  1DD2 A;  1TXY A;  1QIL A;  4DK1 A;  1HFN A;  2D0O A;  3VR3 A;  2VNU D;  3GTL H;  3OOC A;  4JC0 A;  3ICE A;  3PUX A;  3S2H H;  3I91 A;  2EXZ A;  4DV6 Q;  2ZJP A;  4A3D B;  1TWG B;  1KTK A;  3K7U C;  3EJI A;  5M3F H;  1EOV A;  3GTP H;  4ULL A;  2A5H A;  3I70 A;  1KL9 A;  3F2U A;  3SVM A;  4ZQ3 A;  3HOY H;  3PUZ A;  2C35 B;  3C1E A;  1VQL A;  3M85 A;  3X3M A;  5C3E B;  1IBM Q;  1I6V C;  3HEJ A;  3NBI A;  4HIO A;  5JEA J;  2R92 H;  4DFA A;  1WVL A;  4HJ8 A;  1R9T B;  1A63 A;  2AUJ D;  5KYL A;  3OWE B;  4JI1 Q;  1ZYR D;  3U58 A;  2NVX H;  1OO9 B;  5M3M B;  1FGB D;  1EEF D;  5EBD A;  3WOF A;  1H9M A;  1S72 A;  3DM3 A;  3J7A V;  1XNQ L;  1QJO A;  1Z47 A;  2JXM B;  3MVV A;  3VR5 A;  1YNJ C;  4ZLT F;  4JW0 A;  3V96 A;  5I2X A;  1PV4 A;  5CV4 A;  2IJ0 A;  4GKK L;  2EOT A;  2B2V C;  4DV2 Q;  1AE2 A;  2YTX A;  2SEB D;  2X69 A;  3GO5 A;  2PQA B;  1YIJ A;  5BN3 A;  1X55 A;  1LTR D;  1EZ8 A;  4X3U A;  4A3K G;  1QZG A;  3HFZ B;  1J6Q A;  2R92 G;  3CW2 C;  1X54 A;  5FO8 B;  2QGQ A;  4K5V A;  4C56 C;  3K57 A;  2YU9 B;  4KMU C;  2HT1 A;  1RIP A;  4MZ9 A;  3H91 A;  1UEB A;  2AQ3 B;  3TP6 A;  3STB C;  4R4I A;  1V43 A;  3RZO H;  4HCS A;  1A6X A;  1R4P B;  2KCT A;  1DGS A;  4JI8 Q;  1OXV A;  3E3X A;  4H02 A;  4A4I A;  3NQT A;  1TWH B;  5K5P A;  1H9S B;  2CWP A;  4R9W A;  5C3E G;  3KLW A;  1HXY D;  1VQ5 A;  2UUA Q;  4XQN A;  4R8N A;  1IW7 C;  3I3C A;  4P74 A;  4EVO A;  4GNX C;  4QF4 A;  1NR4 A;  1Y1V B;  3KJP A;  3HKZ G;  5IP7 H;  1VQB A;  1C48 A;  2HHH L;  2EY6 A;  2KCN A;  1HPC A;  4F7X A;  4X64 L;  3K5N A;  5C4X G;  3K0X A;  4OHJ A;  4PQX A;  2H5X A;  5H1S E;  4RHR A;  2FFK B;  2IX3 A;  2EYM A;  5NUC A;  5JEA H;  1AFP A;  4RHS A;  3FMC A;  4LF4 Q;  3CC7 A;  3K0Y A;  1O80 A;  4BWG B;  2JEA I;  4C3H B;  1GUN A;  3HOW G;  3D0F A;  3E0E A;  4PZ6 A;  3Q0A A;  4DV4 Q;  3QWN A;  4AH6 A;  3HOU B;  3ZYY X;  1LLR D;  3FHW A;  1A8V A;  3T1H L;  1JOR A;  4A3G H;  4QGU A;  1YNN C;  2FXQ A;  1RTO A;  1TS4 A;  2FJ2 A;  1ICF B;  2DNC A;  4CJ0 B;  1CKN A;  4C2M B;  4KI0 A;  3TP8 A;  3BVM A;  3U9S A;  1BCP F;  1EUJ A;  5FLX c;  3GTL B;  4QUC A;  1J8I A;  1K8M A;  3VA7 A;  5I6Y A;  5JPM C;  4KK7 A;  4CJ2 C;  3Q23 A;  2RDF A;  2RCN A;  3FPP A;  3HKZ B;  3H09 A;  1PRT D;  4NB3 A;  3CCR A;  2QW7 A;  3DMU A;  4A93 B;  1IBL Q;  4RA8 A;  1LV9 A;  3TDQ A;  1XX8 A;  4POF A;  3OTO L;  3PGZ A;  1YJW A;  4WFN 3;  1EYD A;  2XWB B;  4B9X A;  1UUP A;  1A3T A;  2CHB D;  2O5J C;  1BBX C;  5C44 H;  1HHV A;  1T5X D;  4F8M A;  5LMU Q;  3SEB A;  4DR7 L;  1OTC A;  1C8C A;  3CAM A;  1SFO B;  2B2U C;  3NPP A;  5CMD A;  4A3E H;  1R9T H;  4KKT A;  1BCP C;  2ZTD A;  3L0O A;  3A7A B;  1YI2 A;  1CFM A;  4DV4 L;  3M9B A;  3DLL A;  3S1R H;  3JC6 6;  5E1F A;  3EBE A;  4DUZ L;  1KHI A;  3LNN A;  1E2V A;  4OWX B;  1QZH A;  3W1B A;  2V1C C;  2TSS A;  4FXK C;  1RTN A;  1E2W A;  2N49 A;  2JA8 B;  3F8T A;  1X65 A;  4JI4 L;  4A3M G;  1EQT A;  5TSS A;  3IRB A;  4R4Q A;  3NEL A;  2NVT B;  4JI8 L;  2B2W C;  3TRE A;  3A55 A;  1EIH A;  4B3S Q;  2JA5 G;  2K5Q A;  1ILP A;  2KEC A;  4BBR H;  2K7V A;  1SE2 A;  2XWJ B;  5C0X I;  1V1Q A;  4K6D A;  5IT9 c;  2F0U A;  2F0F A;  2E2J H;  3AEV A;  1CUK A;  3PO2 B;  1IXR A;  5I9O A;  3I4M B;  4QIW B;  3TZD A;  4UP8 A;  1WJJ A;  3MXG A;  1QB5 D;  1KLU D;  1VQI A;  1KIX A;  3L7Z C;  1N34 L;  3OWF A;  4OIK A;  1MJE A;  4LFC L;  1AN8 A;  4PZ7 A;  2SNS A;  1TU2 B;  2ID0 A;  4DR6 L;  3BZD B;  5ELN A;  1EIY B;  3J80 L;  5HUR A;  1TWG H;  3HZX A;  3KUP A;  4IUT A;  1U9R A;  4LF6 L;  1QE6 A;  1PA6 A;  4FYD A;  4KN7 C;  5CV6 A;  1Q81 C;  3SE0 A;  1X56 A;  1B70 B;  3M4Q A;  4JI1 L;  4KV6 A;  1YIT A;  1YNJ D;  1JMC A;  2B2Y C;  1K0S A;  4IPC A;  1VQD A;  3J81 E;  3MWY W;  4HIM A;  2WB1 G;  1D1I A;  2B29 A;  5M5W B;  4CKE A;  4A3D H;  3QO2 A;  3HP3 A;  3OHX C;  2A68 C;  2OTL A;  1D2B A;  1MJC A;  1YJN A;  1A3V A;  4GKK Q;  4A3B H;  2LXK A;  2K14 A;  4QQB X;  3PF5 A;  3N6R A;  5CV7 A;  2PW7 A;  3K81 C;  4DXF A;  4EGV A;  3T56 B;  1L2F A;  2RKS A;  2QDB A;  5DAU A;  3GTM B;  3STB D;  5LL6 X;  2R6G A;  3S1Q H;  3I56 A;  2UXD L;  4AYB G;  3HGB A;  1QNK A;  3OSO A;  1SJH D;  1UAP A;  4JPB W;  4YCW A;  4X66 Q;  5C0X G;  1QUQ A;  3D8G A;  2R93 G;  1I5F A;  1LTL A;  3KBX A;  3KF6 A;  3S15 H;  3M4P A;  2K52 A;  2XRQ D;  3I73 A;  1XMQ Q;  1JJC B;  3M3Y H;  3BDL A;  3HKZ E;  1N9W A;  1Q1B A;  4PZ8 A;  5IYB G;  1GKH A;  3AFP A;  3G4S A;  3I4N G;  4UY8 C;  5CC4 A;  3NK9 A;  4HAE A;  1SNC A;  1WTX A;  3V2T A;  4Y7N H;  1PTO C;  1SMY D;  2Z1C A;  5A2Q L;  2E2H H;  2RA4 A;  3CCU A;  5C0X J;  1BVS A;  3L3O C;  3JAM i;  1F9Q A;  2EJM A;  1E0B A;  3J81 L;  4TRD A;  1UE1 A;  4C2M H;  2YYZ A;  5KYI A;  1KAB A;  1K8G A;  1UNS A;  1TWA B;  4X64 Q;  4A3K H;  5JPN C;  1C7Y A;  3W3A A;  2E2J B;  3BDO A;  3NHH A;  3PMF A;  4GLA C;  4UP9 A;  1CSP A;  1EL0 A;  2Z4I A;  2HQL A;  3PIP 3;  2H4O A;  1KC8 C;  1PXU A;  4BBS B;  1XMO Q;  3NEN A;  1STG A;  5BR8 Q;  4X62 Q;  2R7Z B;  5G3L F;  2PCF B;  2HDL A;  2AWN A;  4MIU A;  4GLV B;  3URY A;  3BS1 A;  3BVZ A;  2F0Q A;  4RAU C;  3MXN B;  4GS3 A;  3HOV B;  4YWM A;  3C1F A;  1NMF A;  5E4W C;  1HR0 Q;  4A93 H;  2NZH A;  1B50 A;  4DA2 A;  2R7D A;  2YV5 A;  4KLK A;  4GN5 A;  1PTO H;  5LHY 1;  1EZ6 A;  1QOH A;  3F2B A;  1V8Q A;  3M7G A;  4B3S L;  2PI2 E;  2RCF A;  2VB2 X;  2Z4H A;  2Y0S B;  1TY0 A;  5IT9 E;  1LUZ A;  3T1Y Q;  2PZT A;  4NP5 A;  1SBB B;  4A3G B;  4A3E B;  4GOP A;  4JI3 L;  3I4M H;  5K36 G;  3BJU A;  1STA A;  4YCU A;  1DYQ A;  2AQ1 B;  1EIF A;  4LAA A;  1M8A A;  2UUB L;  3M4Y A;  4IPH A;  2AUK A;  1Y8O B;  2JA7 G;  3TP7 A;  3SK5 A;  2LMC B;  1EY4 A;  3ER0 A;  1YZ6 A;  2HIX A;  2EJG C;  5I9P A;  1TY2 A;  2R93 B;  4LW1 A;  4AQY Q;  3I4M G;  5K36 H;  2KCM A;  1PVO A;  2Q8I B;  4AYB B;  1ESR A;  1I4X A;  3NTI A;  3WWV A;  1I4G A;  3QIA A;  4K2K A;  2IX1 A;  4DR3 L;  3SGI A;  2A68 D;  3WDN A;  4GKJ Q;  1WYD A;  1FNW A;  3CQZ H;  1HH2 P;  1Y1W G;  2NVQ H;  4DV0 Q;  4P71 A;  4JI2 Q;  2GA4 B;  3PO2 H;  2MP1 A;  2NYZ D;  3W1G A;  1CI3 M;  2HD3 A;  3A5U A;  3UI2 A;  1LYL A;  3R2I A;  5CV8 A;  3HG9 A;  4C3I G;  4AIM A;  4KD3 A;  4YWL A;  2PO4 A;  3S16 H;  2G9D A;  1F77 A;  2B2U A;  3GQB A;  2WB1 B;  4KHP L;  2M00 A;  3H6M A;  1HQR D;  4Q0F A;  2E2I H;  2A8V A;  2K75 A;  2QEJ C;  2ATW A;  1ML0 D;  1TQO A;  5DM7 3;  4H44 C;  4EQN A;  4EX5 A;  1KD1 C;  2NVT H;  1XYI A;  4QCL A;  3ZJY C;  3RMH A;  1STE A;  4X66 L;  3F2D A;  1H9S A;  4N9P A;  1K3B C;  4PV1 C;  2WP8 J;  2HDM A;  1SLJ A;  2BH8 A;  3QOL A;  1GOZ A;  1XXG A;  1F2Y A;  3D4W A;  3RN5 A;  1HTL D;  1JR0 D;  5IWA Q;  4LFB L;  1FNU A;  4FNF A;  2F0G A;  3QJY A;  3G6E A;  1I4H A;  2EYL A;  1NTG A;  4I65 A;  3VYT A;  1AE3 A;  1BBU A;  1Y69 U;  2G5D A;  1U4L A;  2EVB A;  2PI2 A;  3UDX A;  1PYB A;  1X3Q A;  3EN2 A;  2MO1 A;  2EYH A;  3NE5 B;  1VQA A;  1BBW A;  1K28 A;  2ZM6 L;  2Z0S A;  3I72 A;  1N33 L;  1KAW A;  1S5F D;  3V05 A;  3MXU A;  2SDF A;  2L55 A;  2F0I A;  2J0T D;  3KBG A;  5J1Z A;  5C4X H;  1MBY A;  1SRU A;  3QOJ A;  1JWU D;  2VY3 A;  4V0B A;  2UU9 L;  2E76 C;  2ES2 A;  3S1R B;  4K0K L;  1A3U A;  1HJP A;  4HIK A;  1B3Q A;  3P7J A;  1JWM D;  2F0N A;  1SAP A;  4C3H G;  2EXD A;  2D5D A;  4P73 A;  1CQV A;  5M5W H;  1L1O A;  1G6P A;  4A3I G;  3HOW H;  3H3V C;  5AFW A;  1STY A;  2F0S A;  2I5L X;  5LMU L;  3GTK H;  4IFD H;  4HID A;  3UDG A;  1EU3 A;  1QCB D;  2SNM A;  3FDT A;  2KOL A;  1VQP A;  1DXM A;  4G7H C;  2UXB L;  4RKL A;  3I90 A;  1R4Q B;  2N88 A;  1UE7 A;  2VQF L;  3TS0 A;  4WJ4 A;  2QA4 A;  4DUZ Q;  1U4R A;  5LL6 S;  1NSN S;  2SOB A;  5IP7 G;  1EFW A;  1JE4 A;  4ID6 A;  2EYO A;  1EFI D;  4DGZ A;  1N34 Q;  4LF5 Q;  2CFM A;  5FKA C;  4XQJ A;  2KBN A;  3KDF A;  5EPK A;  2PQE A;  3EQL C;  2EY1 A;  3HOZ H;  3TRZ A;  4JI6 Q;  4IQZ A;  1SYB A;  4OEM B;  4O0A A;  2F3V A;  5C4H A;  5CV5 A;  1W6K A;  3GTJ H;  5JJL A;  3S2D H;  1Z7T A;  2WII B;  1RD9 D;  1G2S A;  2VW9 A;  4IJH A;  3U4V A;  4Y7N B;  1CSQ A;  3PF4 A;  3GTQ H;  1EYC A;  2F0E A;  5JVH 3;  1O7Y A;  2XNA C;  4DR1 Q;  2E74 C;  4I7Z C;  4HSV A;  4RMF A;  2C5C A;  5IYD G;  3EFX D;  1W3S A;  1XWE A;  1N36 Q;  3H94 A;  3HKS A;  1Q12 A;  4A3M B;  4A3I B;  5ELB A;  3DEO A;  2L0C A;  4B08 A;  2CVR A;  1JB3 A;  1BR9 A;  1Q8K A;  4GOP B;  1B9N A;  1EWC A;  5IOC A;  5LMN W;  4ZUJ A;  3Q8D A;  2A69 C;  2R7Z H;  4L5Q A;  1I94 L;  1O7L A;  5ELO A;  2QCP X;  3HOY B;  1X3E A;  1KDB A;  2DY8 A;  1CKM A;  3K7A B;  4KHP Q;  2JN4 A;  4JBW A;  4N8F A;  1NR2 A;  1ZEQ X;  2RHS B;  3CU7 A;  4DV7 Q;  1GUO A;  4DR4 Q;  2JEB I;  2O2L D;  1NCV A;  1VQH A;  1LT6 D;  1P16 A;  3B6Y A;  4DU9 A;  4U68 A;  2NTS A;  1K83 H;  2WAQ G;  1Q82 C;  4HSP A;  3IKJ A;  4TVA B;  1Q7Y C;  2PNH A;  3HOY G;  2IX0 A;  1Q86 C;  3G6J B;  4JBJ A;  1BOS A;  1U5K A;  1DJR D;  2F4I A;  4MN3 A;  1JOO A;  1PTO B;  1D5Z C;  1A0I A;  4CDE C;  4ZK9 B;  2A6H C;  2IPK D;  4FVM A;  3DHQ A;  3F1Z A;  3PUY A;  4A3F H;  1S5D D;  4KY7 A;  1PRT B;  1XTC D;  4V19 0;  4A3K B;  3HS0 C;  4H0L C;  1BCP B;  1CA5 A;  3KLS X;  4KY5 A;  4RCO A;  4P72 A;  5FLX L;  5T1I A;  1FR3 A;  3TS2 A;  2UXB Q;  1BCP D;  4LF9 L;  4DUY Q;  1VMC A;  3RR5 A;  3RN2 A;  3ULL A;  5M3M H;  1DZ1 A;  1XMO L;  3SK8 A;  2JA8 G;  4C3I B;  2JA6 G;  5KIX A;  1YVC A;  4ZYS A;  1YEZ A;  4GN4 B;  4LFA Q;  1FNV A;  2R93 H;  1WTV A;  4BY7 G;  3H0G G;  4DN4 M;  2A1A A;  4B3T Q;  1LTT D;  4GLX A;  2RF4 A;  4JCV E;  5C4X B;  2VL6 A;  1D5X C;  1ENA A;  1U4M A;  5DEH A;  3BYY B;  3MEF A;  4FXG C;  3MTS A;  1XJV A;  3T1Y L;  2KQ3 A;  3VR4 A;  4B3M L;  1ENC A;  1H95 A;  5I6W A;  1PFB A;  1VQM A;  4DK3 C;  2PMZ B;  5CGK A;  1HNW Q;  1WD1 A;  1BUV T;  1H9R A;  2BE5 D;  1MSH A;  1IYU A;  1E24 A;  1Y1W H;  4DNR B;  1O78 A;  2JA6 H;  4FF4 A;  3SR1 A;  4IPD A;  3GV3 A;  1EQV A;  1PH1 A;  2ICE C;  4HJA A;  2BE5 C;  1PZI D;  4IUN A;  3IFD A;  3S9W A;  1IBK L;  3KF6 B;  4WRD A;  2QEX A;  2WKD A;  3VR2 A;  1EY8 A;  3G7L A;  3MEH A;  1V1P A;  4HJ5 A;  2NBF A;  3K5M A;  1D5M C;  2MGS A;  5KNC A;  3MAQ A;  4HMJ A;  1AH9 A;  2RQX A;  4KHZ A;  1JJ2 A;  2I46 A;  4DR7 Q;  1FYC A;  2XVS A;  1LTA D;  1HR0 W;  4B3R Q;  4DV3 L;  1NBW A;  2HHH Q;  3Q22 A;  2WIN B;  3ERQ A;  3CRL C;  2AQ2 B;  5IYC G;  1B9M A;  4PMB A;  3G71 A;  5IP9 H;  1YBY A;  4CDD C;  4GKJ L;  3NP8 A;  2B63 H;  4LMQ D;  1HZC A;  4CHT B;  5GAG C;  4ZKC B;  5AJ3 L;  3NWT A;  1LAB A;  3NEM A;  2PNR C;  3ND9 A;  4ZKB B;  3CCS A;  2WAQ B;  1I4R A;  4K2L A;  2JA7 H;  1B7Y B;  4DPG A;  5T1G A;  5M5Y H;  1ONL A;  2KHJ A;  4IZ8 A;  3T1H Q;  3UE1 A;  2M9V A;  4A3J G;  3BVG A;  2VZA A;  4JOI C;  2KJX A;  3CF5 A;  4FF2 A;  2JSO A;  4R4O A;  4CKC A;  2GVA A;  1KQS A;  3CD6 A;  1F9R A;  1HNX L;  3OW7 A;  2VXW A;  4LFC Q;  2F0D A;  2VS1 A;  1SNQ A;  4R4C A;  4L6T B;  4B9W A;  5FLM G;  1XNR Q;  1PTO F;  1IKM A;  2XSC A;  1HFG A;  4HTH A;  2B2W A;  5D3I B;  5CV9 A;  4YY3 L;  3KLS A;  1SN8 A;  4LUZ A;  4PNY A;  5BR8 L;  1M1K C;  5KRU A;  2K5H A;  4MTN A;  3OIQ A;  1RF2 D;  5FOB B;  4DR5 L;  3J80 E;  4JI7 Q;  5JEA G;  1ESF A;  4Q5V A;  1TII D;  4JOI A;  4BY1 H;  1A62 A;  3D4D A;  5KEE A;  1JJG A;  2EJF C;  2E75 C;  4J8Q A;  1V1O A;  1BXT A;  5AJ3 Q;  1O7Z A;  5ELC A;  3CRK C;  4DUY L;  3NXW A;  1NNX A;  2CH4 A;  4LK1 C;  1I4P A;  1SND A;  4E6I A;  2K50 A;  4OO1 I;  5COY A;  1H9K A;  3ONA B;  2JE6 I;  1J5E Q;  3C3L A;  2JP1 A;  2RVL A;  1AEX A;  2K32 A;  1WCM H;  4X65 Q;  1HZB A;  3J81 i;  4FP5 D;  1K83 B;  1I3Q H;  1SE8 A;  5HGT A;  1PHJ A;  2E5L L;  4IFD I;  1HCZ A;  5EKL A;  2F4V L;  5JJK A;  4DV1 Q;  2NN6 H;  4CGY B;  3S2D B;  2OCE A;  4A3F B;  2RDG A;  5GQO A;  3NWS A;  3HOU H;  4A3L G;  2OF1 A;  4DK0 A;  2ZT9 C;  5CR3 A;  1TVX A;  2PW5 A;  2QIL A;  3PSI A;  1X9N A;  2JA5 H;  2MNA A;  5CBA E;  3AB9 A;  1DOM A;  2JK8 A;  1FJG L;  1SYF A;  3R2T A;  1FD7 D;  4IFD J;  1K8O A;  2WKC A;  2JYO A;  1I4Q A;  2WV6 D;  1GO3 E;  5E7N A;  3WOE A;  2EY5 A;  3Q6S A;  4UP7 A;  4GNX B;  4M8A A;  3IAY A;  4NPS A;  1HQM C;  1OXU A;  1SXT A;  2E2D C;  4NXN L;  2MFI A;  2Z8L A;  2EZV A;  2P5Z X;  2F0O A;  2B2T C;  3J7Z C;  3NQI A;  4PMC A;  2IW3 A;  4ILW A;  4DAV A;  4C3J H;  4LF5 L;  3KK7 A;  1J5E L;  1TWC B;  5I2Y A;  4KJO A;  2HUG A;  2I5M X;  4P2C B;  4ODG A;  2IT1 A;  3CME A;  4OGQ C;  1IBL L;  5JJI A;  4JI6 L;  2VUM H;  3D6W A;  1C0A A;  3T51 B;  1KDC A;  4A3I H;  4A3M H;  1PH3 A;  5EGT A;  3H3V H;  1LAC A;  2IY5 B;  4R4T A;  1OXT A;  3ULP A;  1JE5 A;  3DXJ C;  3QB3 A;  1TS5 A;  4XYO A;  4K6L A;  2K6A A;  1S3O A;  3FVQ A;  4H13 C;  4J15 A;  2A69 D;  4GNX A;  5EBC A;  3HOX H;  2VUM G;  1TWF B;  4BBR G;  1XPU A;  4DV1 L;  3PCO B;  1X3P A;  5DNF A;  4DV6 L;  2K5N A;  5J39 A;  2D0P A;  3HOV H;  4BBR B;  5C4J B;  1E7Z A;  3J81 c;  1TKW B;  5KGU A;  3KDF B;  1ET9 A;  4DKA C;  3VYU A;  2ASB A;  3NUC A;  1WTW A;  2KEE A;  1F9S A;  1G91 A;  3AU7 A;  2F0W A;  1V1P B;  1SE3 A;  3LX0 A;  1BO0 A;  1JOQ A;  4R8I A;  4JI0 Q;  5ELF A;  3RZD B;  5M5Y B;  4XQQ A;  4L5T A;  1PH9 A;  2QKI C;  2NN6 G;  1F2M A;  2FHT A;  4LJZ C;  4QUF A;  3KOJ A;  3A8K E;  3CKI B;  1KXL A;  2YTV A;  3TSS A;  4K0K Q;  1EYA A;  1PH6 A;  4O42 A;  4QJF A;  1E2Z A;  1CHQ D;  3OMC A;  3H0G B;  4UAI A;  5IGG A;  4QMG A;  2MUY A;  3NSW A;  4YY3 Q;  1Y8N B;  1BKB A;  2KVM A;  5JVG 3;  4K14 A;  2RHQ B;  1B8A A;  1L1O B;  1TWA H;  4BA1 I;  5C5M A;  2B2V A;  3EIV A;  1FVI A;  2KUM A;  3K6O A;  1FGU A;  4ZRZ A;  3KJO A;  1QVC A;  1TT2 A;  2OTJ A;  2KCC A;  2LXJ A;  3RLF A;  5J3B A;  3GTG H;  1VQK A;  3I2Z A;  1T5E A;  2HCI A;  1SYE A;  1LTI D;  4HR7 B;  1XNQ Q;  4IO9 A;  4TQU S;  3HRZ C;  1E1T A;  3MHB A;  4KHV A;  2EYJ A;  1BQQ T;  4L5S A;  1HZ9 A;  2MJ8 A;  3HOZ G;  3S1N H;  4HCE A;  4G57 A;  1O7I A;  1GD7 A;  4QB4 A;  4A3C G;  5IGF A;  3W5O A;  3GDE A;  4L8J A;  1WOC A;  3PIO 3;  1HNZ Q;  1G2T A;  4X6A H;  5C0X H;  2VQE L;  1Z9F A;  3UDF A;  1W2B A;  4MTK A;  2B8F A;  1MGS A;  1F2L A;  2F0V A;  2DJG C;  2JA7 B;  2Y0S E;  2PYK A;  3GP7 A;  1N36 L;  3E9I A;  1HTP A;  2AHO B;  3RLN A;  3CCJ A;  4A3C H;  3I4L A;  4PMW A;  2K33 A;  4ZCK A;  2MPM A;  4DR2 L;  1JQY D;  4XT3 B;  4BXX G;  1K73 C;  3U4Z A;  5HGQ A;  3A54 A;  2A6E C;  5ISR A;  1Y1W B;  2DJF C;  3J81 j;  1EWH A;  4NMZ A;  1S5C D;  1XNR L;  3S2H B;  1EWI A;  4CKB A;  4RFB A;  3FEW X;  4YIJ A;  1II3 A;  1QVG A;  1QWY A;  4RG1 A;  2N8N A;  1SMY C;  1UEA B;  1IBK Q;  4A3B G;  2HIV A;  1A15 A;  1HA6 A;  2NVY B;  2GVB A;  2WFW A;  2ZXO A;  1B44 D;  4NKL A;  5C3E H;  3CQZ B;  4R1J A;  3KLR A;  1VQN A;  4ME3 A;  4TKO B;  1I94 Q;  2JA5 B;  2L5T A;  4BBS G;  4B3R L;  1QG7 A;  1ZYR C;  4L5R C;  2BCO A;  2NVX B;  2WB1 E;  1NE3 A;  3SK4 A;  3N52 A;  2XRS D;  3ERS X;  1CA6 A;  5IGE A;  1NMG A;  3I7F A;  1SNM A;  2ENB A;  4DR2 Q;  2CCZ A;  1B1Z A;  2PZU A;  1D8L A;  2AWO A;  3ITP A;  4EQ5 A;  2A6E D;  3D3R A;  3TEH B;  4GOP C;  3LGJ A;  1YJ9 A;  2X6L A;  4A93 G;  3JAM L;  3J7Y W;  3TN2 A;  2F52 A;  5ELE A;  1DON A;  1JIC A;  3PUW A;  1EOT A;  5C3X A;  2IHF A;  2VUM B;  1M4V A;  3DUZ A;  1SNO A;  2F0K A;  2CWA A;  3E6Z X;  4UDU C;  2CW0 D;  4JBK A;  1PH2 A;  2YU9 H;  4BY1 G;  2LY7 A;  3MA2 B;  2OXP A;  4HJ9 A;  3RZD H;  4U67 3;  3J80 i;  1EY5 A;  5GAE C;  2CW0 C;  1MI2 A;  1SYD A;  4O2D A;  3VA5 A;  1ICW A;  3H15 A;  4RKB A;  1G51 A;  3MXN A;  1IKL A;  2DUD A;  1IYJ B;  4QIW E;  4B3M Q;  1PLF A;  3OTO Q;  1L0X B;  5C4Z A;  2A19 A;  2K05 A;  4LF7 L;  1EIG A;  5EKI A;  3SHL A;  1NUC A;  2NVQ B;  2Q2H A;  2EPB A;  1SEB D;  2MO0 A;  3BDC A;  5DLQ E;  5KND A;  1TWC H;  4APV A;  2L9H A;  2I07 B;  4GN3 B;  4DR1 L;  1TS2 A;  4OWW B;  4NDX A;  1IYV A;  2NZ1 D;  4AQY L;  4WJW A;  1B53 A;  5IP9 G;  5C5L A;  5COR A;  4IUR A;  4CDC C;  1PH5 A;  2LS0 1;  1GUG A;  3I8Z A;  3GTK B;  4ALP A;  1N32 Q;  1K8A C;  1LO5 D;  4C3H H;  2M2L A;  4BY7 B;  5KNB A;  2VQE Q;  2F3I A;  1Y1V G;  1V9P A;  3R3O A;  4J6H A;  1Q3L A;  4RCN A;  2NUC A;  1LTG D;  2FMC A;  2NZO A;  3I55 A;  1CZW A;  4ME5 A;  3K80 C;  3J7A F;  1VQF A;  3PO3 G;  2Z6K A;  1HRJ A;  1BF4 A;  1CKO A;  1C9O A;  4DR4 L;  4XT1 B;  1SYG A;  3QG1 A;  4GZY C;  1VQE A;  5IWA L;  4LFB Q;  1NAP A;  1J9O A;  1EQQ A;  1WFQ A;  1PFM A;  1YHB A;  1LTB D;  1A2U A;  2FMM A;  4NXN Q;  1S40 A;  2BOS A;  3M7N A;  4LF9 Q;  3PO3 H;  1D1K A;  4X3T A;  3D6C A;  1SE4 A;  1JCK B;  4AYB E;  2HQE A;  2Z6B A;  1L0Y B;  4P75 A;  2Q2T A;  1Y1V H;  1I6H H;  2F1M A;  2ALY B;  1DOL A;  2G9H D;  1KRT A;  3TZU A;  1KDA A;  1CT1 D;  5E4X A;  4I7A A;  3D31 A;  2TMP A;  1AP0 A;  4TSS A;  1WI5 A;  2VB3 X;  4KN4 C;  2RBM A;  5GAH C;  3AMU A;  5IGC A;  4CJ1 B;  4LF8 Q;  5IOD A;  1RHP A;  5CYU A;  3K5L A;  3DWA A;  4O1N A;  3T13 A;  2KHS A;  1NY4 A;  4F87 A;  3PIP A;  2ZJQ A;  2XN9 C;  5C44 B;  3ERO A;  2K03 A;  3P75 A;  1WD0 A;  1WTQ A;  1K3R A;  3CCV A;  1HNX Q;  3F2C A;  3VYS A;  3E9H A;  4KJN A;  4LNQ A;  1YNN D;  2F0M A;  3TBI B;  1CM9 A;  2L11 A;  2PPB C;  4RGN A;  4DR6 Q;  4A3D G;  1YHA A;  2XTI A;  3UE0 A;  1B2T A;  1SMX A;  2ZJR A;  4YCV A;  4CBV A;  4DV5 Q;  3QR8 A;  3NBH B;  1GUS A;  2EDG A;  4X65 L;  3S14 H;  2L4N A;  1HZA A;  5A2Q E;  2Y0S G;  2F0H A;  4OON A;  3S17 H;  1U4P A;  4DAP A;  4RWS C;  2F0L A;  3GD7 A;  1ET6 A;  2N3S A;  1HUN A;  4K5X A;  3J7A 5;  1MSG A;  1VQ7 A;  3C2P A;  1TWH H;  1BNZ A;  2OWO A;  2K28 A;  2DGY A;  3K7A H;  1KNE A;  2E8G A;  5EKK A;  3R93 A;  3PV0 A;  3CCL A;  1D6E C;  1AW7 A;  5FJ8 H;  1VQ6 A;  3K5O A;  4K5W A;  4JBM A;  4OEL B;  4LUO A;  3IL8 A;  1EEI D;  2ZTE A;  3S1Q B;  2C9O A;  2UXC Q;  2K01 A;  1LT3 D;  3S1M B;  1EY6 A;  3SK6 A;  1EQR A;  3GTG B;  1IW7 D;  2NTT A;  3H3V I;  2UU9 Q;  1GM5 A;  4C1N I;  2IWH A;  2R7F A;  1RDP D;  2WAQ E;  4OO1 G;  3T4A C;  1ASY A;  5FJ8 G;  2I0Q A;  1CZG A;  2R3Z A;  5IYD H;  4RH6 A;  4IFD G;  3UDI A;  4OX9 L;  2UXD Q;  2B3G A;  1U0L A;  2OQ0 A;  3M3Y B;  4LF4 L;  2B2Y A;  3M4O B;  3KYH C;  1YHQ A;  3FKI H;  4IUU A;  1N8R C;  4Z9C B;  1KAA A;  4N9T A;  4MNO A;  5A35 A;  2KHI A;  2NB0 A;  4OO1 H;  2BH2 A;  3CHB D;  1CQF A;  1ASZ A;  1XPR A;  2CQA A;  3E0J A;  4B3T L;  4C3J G;  5FLX E;  2I5H A;  1QVF A;  1MD2 D;  1PZJ D;  4OWT B;  2RSO A;  4LWC A;  2XIW A;  1SNP A;  1PFS A;  1ZXT A;  1GUT A;  2A73 B;  3TQY A;  1Q90 A;  5EPL A;  5J22 A;  4H7B A;  2KEN A;  4BA2 I;  3O13 A;  2ZXP A;  4HN7 A;  3CC4 A;  1IBM L;  2HCC A;  4G7O C;  1SDF A;  4MHE A;  5M5X H;  4A3B B;  4X3S A;  4M1U B;  2ZTC A;  1VQ4 A;  3CPF A;  1XMQ L;  2D62 A;  3NTK A;  1X6O A;  1PYW D;  5IGB A;  5M3F G;  1IL8 A;  3RNU A;  1L0W A;  4UPA A;  5C6A A;  1GUW A;  3DWP A;  3I4N H;  1PTO D;  3A0J A;  4YHH L;  4A3J B;  5GRO A;  4G7Z C;  3DWQ A;  1YNX A;  2K1B A;  4Y52 H;  4DR3 Q;  2AKW B;  2OEO A;  1UE6 A;  1M90 C;  2MHV A;  1UE5 A;  4POG A;  5BN4 A;  5JOB A;  2L15 A;  5M3M G;  2Q2U A;  3S17 B;  4DV3 Q;  2RSN A;  1FJG Q;  1MKH A;  4IUV A;  1JOK A;  2K5V A;  4NXM L;  3PO2 G;  5D3D A;  5BN5 A;  4RGM A;  2ZXR A;  3ULJ A;  2E5L Q;  4BY7 H;  3A5Z B;  1BDO A;  2D2C C;  3C46 A;  4FO2 A;  1IHZ A;  4KKS A;  1PZK D;  2Q8R E;  5IYB H;  3BZK A;  2Q8T A;  2E2H B;  1IZ6 A;  1VF7 A;  5GAD C;  3KFU A;  4LFA L;  1LM0 A;  5G3L D;  3GV6 A;  4C3I H;  1JC7 A;  1STH A;  2LSS A;  4JG2 A;  3MFY A;  1PFN A;  1X3G A;  3CCE A;  5JJZ A;  1RCV D;  2PMZ E;  1PRT C;  1XTD A;  1VQJ A;  1HUM A;  3OMG A;  5DM6 3;  1X32 A;  4BBS H;  1I50 H;  3CCQ A;  1SSO A;  4DV0 L;  4JK1 C;  1SR3 A;  1ROD A;  4NW2 A;  3W2D A;  1L1O C;  2Q2I A;  3IFT A;  4OX9 Q;  4C1N K;  1K9M C;  4BY1 B;  3D4R A;  3JAM c;  5I4D A;  3PO3 B;  5EQ0 A;  4YHH Q;  3A8I E;  5IIF A;  1VQ8 A;  3GTO B;  2N55 A;  2F0T A;  4LUV A;  4DV2 L;  1F9P A;  1QUQ B;  2MQH A;  1QNU A;  3OW2 A;  3NTH A;  4OXP A;  4A75 A;  4DNI A;  3CCM A;  3S15 B;  1E1O A;  4KD4 A;  1HA5 A;  2BA0 A;  1PRT F;  2XGT A;  2YTY A;  3CC2 A;  1AZP A;  2F0P A;  2EYF A;  2FIN B;  1UWV A;  1XPO A;  5EAY A;  4IOC A;  1RL2 A;  1NJI C;  2KA7 A;  1GVP A;  1GXD C;  3FKI B;  1WCM B;  1DM0 B;  3HOU G;  2B63 G;  1I3Q B;  4A3L H;  3CMA A;  1VMP A;  3RLO A;  4J1M A;  4JI5 L;  4DXG A;  3I4N B;  3X3N A;  4A3J H;  1Q8I A;  3S14 B;  3KF8 B;  1WTH A;  4WOR A;  4RGT A;  4EQP A;  1JT8 A;  1MHW C;  1EY7 A;  5M3F B;  3GTP B;  2X6G A;  3MXP A;  1EU4 A;  1FL0 A;  4JI0 L;  2DNE A;  3SDZ A;  1T9H A;  2QF7 A;  3K59 A;  4HJ7 A;  2EY2 A;  2GN5 A;  4OL7 A;  4RGO S;  4IUP A;  3AQQ A;  5FK9 C;  5C3W A;  5ELD A;  2F0J A;  1LT5 D;  1PYS B;  2UUC L;  1E22 A;  1VF5 C;  5FLM H;  3HOW B;  2B63 B;  1Q46 A;  5M9O A;  1JB7 A;  5IYC H;  4IN3 A;  1G8Z D;  1I6H B;  3G48 A;  4BS9 A;  4DR5 Q;  2H1E A;  2NN6 I;  3A8J E;  4A76 A;  2A6H D;  4FF1 A;  3FPU B;  3DEP A;  4DNT B;  4C3J B;  1C4Q A;  4CDF C;  1WTO A;  4QL5 A;  3DM1 A;  1CTM A;  2EIF A;  3NBH A;  1S4Z A;  3A74 A;  3K8A A;  5HY6 A;  1WCM G;  3A56 A;  1G29 1;  4IOA A;  1E3P A; 
#chains in the Genus database with same CATH homology
 2PZW A;  2O5I C;  4XTC S;  5E3F A;  3RZO B;  4KKU A;  2EE1 A;  2EYP A;  2BDO A;  1TR5 A;  3OPO A;  3HOZ B;  3T16 A;  1RJT A;  1Z6H A;  2R92 B;  3BYT B;  4FF3 A;  3TP5 A;  5FO9 B;  1B3A A;  5FO7 B;  2F03 A;  5EJW A;  1GHK A;  2BA1 A;  3EA6 A;  3Q24 A;  2K5W A;  1DOK A;  2D9U A;  2NWG A;  1WTP A;  4ZUI A;  1LTS D;  4X3K A;  1A2T A;  3LWU A;  4XXE A;  4K8I A;  3PUV A;  1F2Z A;  1S5E D;  3S1N B;  3K58 A;  1VCI A;  1Q1E A;  2E2I B;  4ABN A;  3BG3 A;  1VDZ A;  5IT9 L;  2L1B A;  3HOX B;  1EY0 A;  2BDN A;  4OIJ A;  4IUQ A;  5M5X B;  4FXD A;  1CK1 A;  2V4D A;  1B4O A;  3MZ5 A;  1OXS C;  2LFN A;  1GHJ A;  4XDX A;  3TME A;  3ND8 A;  3VYR A;  1PMR A;  4HMI A;  2B39 A;  3S16 B;  1GJX A;  5F2D A;  4G4K A;  1ILQ A;  3P20 A;  4L63 B;  4ZAI A;  4KTA A;  3MC0 B;  2B2T A;  1ZKO A;  1LT4 D;  1Y8P B;  4HED A;  4F88 A;  4XYQ A;  5D14 A;  2IL8 A;  2J4X A;  3MFG A;  5JAV A;  1EY9 A;  4S3S A;  5CBE E;  4DAY A;  1RKN A;  1WTR A;  1AZQ A;  2J7Z A;  1I50 B;  1S5B D;  3EVQ A;  4KY6 A;  3OIP A;  2O4X A;  2ICI A;  5D65 A;  2DY7 A;  3JAM E;  1TS3 A;  1PDQ A;  3VR6 A;  3U9O A;  2KED A;  3E5S A;  3T53 B;  2F3W A;  4XIG S;  4IAL A;  1OXX K;  3GTJ B;  4EQO A;  1ENF A;  2OT2 A;  1SYC A;  2K5D A;  4DF7 A;  3LWE A;  1KLG D;  2L12 A;  2LKV A;  3FRP B;  5IGD A;  3L9A X;  3SXH A;  1DCZ A;  1G6Z A;  2WAC A;  3A7L A;  1CHP D;  1KNA A;  1SJE D;  3R8B A;  2R61 A;  1W6J A;  2JA6 B;  3RD4 A;  2B8G A;  2RDH A;  1H9J A;  5EPJ A;  1STB A;  2DN8 A;  1JWS D;  3GTQ B;  4K8J A;  2K04 A;  3P1H A;  2A74 C;  3RUZ A;  3KF8 A;  1STN A;  1DD2 A;  1HFN A;  1QIL A;  4DK1 A;  3VR3 A;  2VNU D;  3OOC A;  3PUX A;  3I91 A;  2EXZ A;  4A3D B;  1TWG B;  1KTK A;  3EJI A;  4ULL A;  2A5H A;  3I70 A;  3F2U A;  3SVM A;  4ZQ3 A;  3PUZ A;  3C1E A;  3M85 A;  3X3M A;  5C3E B;  1I6V C;  3HEJ A;  3NBI A;  5JEA J;  4DFA A;  1WVL A;  1R9T B;  2AUJ D;  5KYL A;  3OWE B;  1ZYR D;  1OO9 B;  5M3M B;  1FGB D;  1EEF D;  5EBD A;  3WOF A;  1H9M A;  3J7A V;  1QJO A;  1Z47 A;  2JXM B;  3MVV A;  3VR5 A;  1YNJ C;  4ZLT F;  3V96 A;  5I2X A;  5CV4 A;  2IJ0 A;  2EOT A;  2B2V C;  2SEB D;  2X69 A;  3GO5 A;  5BN3 A;  1LTR D;  1EZ8 A;  4X3U A;  5FO8 B;  4K5V A;  4C56 C;  3K57 A;  2YU9 B;  4KMU C;  3H91 A;  2AQ3 B;  3TP6 A;  1V43 A;  4HCS A;  1A6X A;  1R4P B;  1OXV A;  3NQT A;  1TWH B;  5K5P A;  1H9S B;  4R9W A;  1HXY D;  4XQN A;  4R8N A;  1IW7 C;  3I3C A;  4EVO A;  4QF4 A;  1NR4 A;  1Y1V B;  1C48 A;  2EY6 A;  2KCN A;  1HPC A;  4F7X A;  3K5N A;  4OHJ A;  4PQX A;  4RHR A;  2FFK B;  2IX3 A;  2EYM A;  5NUC A;  5JEA H;  1AFP A;  4RHS A;  3FMC A;  3K0Y A;  1O80 A;  4BWG B;  2JEA I;  4C3H B;  1GUN A;  3Q0A A;  3QWN A;  3HOU B;  3ZYY X;  1LLR D;  1JOR A;  1YNN C;  1RTO A;  1TS4 A;  2FJ2 A;  2DNC A;  4CJ0 B;  4C2M B;  4KI0 A;  3TP8 A;  3BVM A;  3U9S A;  1BCP F;  3GTL B;  1J8I A;  4QUC A;  1K8M A;  3VA7 A;  5I6Y A;  5JPM C;  4KK7 A;  4CJ2 C;  3Q23 A;  2RDF A;  3FPP A;  3HKZ B;  3H09 A;  1PRT D;  3DMU A;  4A93 B;  4RA8 A;  1LV9 A;  3TDQ A;  1XX8 A;  4WFN 3;  1EYD A;  2XWB B;  4B9X A;  1UUP A;  1A3T A;  2CHB D;  2O5J C;  1BBX C;  1HHV A;  1T5X D;  4F8M A;  3SEB A;  1C8C A;  1SFO B;  2B2U C;  3NPP A;  5CMD A;  4KKT A;  1BCP C;  3A7A B;  1CFM A;  5E1F A;  3LNN A;  1E2V A;  2TSS A;  4FXK C;  1RTN A;  1E2W A;  2JA8 B;  1EQT A;  5TSS A;  2NVT B;  2B2W C;  3A55 A;  1EIH A;  2K5Q A;  1ILP A;  2KEC A;  2K7V A;  5C0X I;  1SE2 A;  2XWJ B;  4K6D A;  2F0U A;  2F0F A;  3PO2 B;  5I9O A;  3I4M B;  4QIW B;  3TZD A;  3MXG A;  1QB5 D;  1KLU D;  3L7Z C;  3OWF A;  4OIK A;  1AN8 A;  2SNS A;  1TU2 B;  2ID0 A;  3BZD B;  3J80 L;  5HUR A;  3HZX A;  3KUP A;  4IUT A;  1U9R A;  1QE6 A;  4FYD A;  4KN7 C;  5CV6 A;  3SE0 A;  4KV6 A;  1YNJ D;  2B2Y C;  3J81 E;  3MWY W;  1D1I A;  5M5W B;  4CKE A;  3QO2 A;  3HP3 A;  3OHX C;  2A68 C;  1D2B A;  1A3V A;  3N6R A;  5CV7 A;  2PW7 A;  4DXF A;  4EGV A;  3T56 B;  2RKS A;  2QDB A;  5DAU A;  3GTM B;  5LL6 X;  2R6G A;  3HGB A;  1QNK A;  3OSO A;  1SJH D;  1UAP A;  5C0X G;  3D8G A;  3KBX A;  2XRQ D;  3I73 A;  3BDL A;  1Q1B A;  5CC4 A;  3NK9 A;  4HAE A;  1SNC A;  1WTX A;  3V2T A;  1PTO C;  1SMY D;  2Z1C A;  5A2Q L;  2RA4 A;  5C0X J;  3L3O C;  1F9Q A;  2EJM A;  1E0B A;  3J81 L;  4TRD A;  2YYZ A;  5KYI A;  1KAB A;  1UNS A;  1TWA B;  5JPN C;  3W3A A;  2E2J B;  3BDO A;  3NHH A;  3PMF A;  1EL0 A;  2Z4I A;  3PIP 3;  2H4O A;  1PXU A;  4BBS B;  1STG A;  2R7Z B;  5G3L F;  2PCF B;  2HDL A;  2AWN A;  4MIU A;  3URY A;  3BS1 A;  3BVZ A;  2F0Q A;  4RAU C;  3HOV B;  3C1F A;  5E4W C;  1B50 A;  4DA2 A;  1PTO H;  5LHY 1;  1EZ6 A;  1QOH A;  1V8Q A;  3M7G A;  2VB2 X;  2Z4H A;  2Y0S B;  1TY0 A;  5IT9 E;  2PZT A;  4NP5 A;  1SBB B;  4A3G B;  4A3E B;  5K36 G;  1STA A;  1DYQ A;  2AQ1 B;  4LAA A;  1M8A A;  3M4Y A;  2AUK A;  1Y8O B;  3TP7 A;  3SK5 A;  2LMC B;  1EY4 A;  2EJG C;  5I9P A;  1TY2 A;  2R93 B;  5K36 H;  2Q8I B;  4AYB B;  1ESR A;  1I4X A;  3NTI A;  1I4G A;  3QIA A;  4K2K A;  2IX1 A;  2A68 D;  3WDN A;  1FNW A;  2GA4 B;  2MP1 A;  2NYZ D;  1CI3 M;  3UI2 A;  3R2I A;  5CV8 A;  3HG9 A;  4C3I G;  4KD3 A;  2PO4 A;  2G9D A;  1F77 A;  2B2U A;  3GQB A;  2WB1 B;  2M00 A;  3H6M A;  1HQR D;  4Q0F A;  2QEJ C;  1ML0 D;  1TQO A;  5DM7 3;  4H44 C;  4EQN A;  1XYI A;  4QCL A;  3RMH A;  1STE A;  1H9S A;  4N9P A;  4PV1 C;  2WP8 J;  2HDM A;  3QOL A;  1GOZ A;  1XXG A;  1F2Y A;  3D4W A;  1HTL D;  1JR0 D;  1FNU A;  4FNF A;  2F0G A;  3QJY A;  1I4H A;  2EYL A;  4I65 A;  3VYT A;  1Y69 U;  1U4L A;  2EVB A;  1X3Q A;  2EYH A;  3NE5 B;  3I72 A;  1S5F D;  3V05 A;  3MXU A;  2SDF A;  2L55 A;  2F0I A;  2J0T D;  3KBG A;  5J1Z A;  1MBY A;  3QOJ A;  1JWU D;  4V0B A;  2E76 C;  3S1R B;  1A3U A;  3P7J A;  1JWM D;  2F0N A;  1SAP A;  4C3H G;  2D5D A;  1CQV A;  3H3V C;  5AFW A;  1STY A;  2F0S A;  4IFD H;  1EU3 A;  1QCB D;  2SNM A;  3FDT A;  2KOL A;  1DXM A;  4G7H C;  4RKL A;  3I90 A;  1R4Q B;  2N88 A;  1U4R A;  5LL6 S;  1NSN S;  2SOB A;  1JE4 A;  4ID6 A;  2EYO A;  1EFI D;  4DGZ A;  5FKA C;  4XQJ A;  5EPK A;  2PQE A;  3EQL C;  2EY1 A;  4IQZ A;  1SYB A;  2F3V A;  5C4H A;  5CV5 A;  1W6K A;  1Z7T A;  2WII B;  1RD9 D;  1G2S A;  4Y7N B;  1EYC A;  2F0E A;  5JVH 3;  1O7Y A;  2XNA C;  2E74 C;  4I7Z C;  4HSV A;  2C5C A;  3EFX D;  1XWE A;  3H94 A;  1Q12 A;  4A3M B;  4A3I B;  5ELB A;  3DEO A;  2L0C A;  4B08 A;  2CVR A;  1JB3 A;  1BR9 A;  1B9N A;  1EWC A;  5IOC A;  4ZUJ A;  2A69 C;  1O7L A;  2QCP X;  3HOY B;  1KDB A;  2DY8 A;  3K7A B;  4JBW A;  1NR2 A;  1ZEQ X;  3CU7 A;  1GUO A;  2JEB I;  2O2L D;  1NCV A;  1LT6 D;  4DU9 A;  4U68 A;  2NTS A;  4HSP A;  3IKJ A;  2IX0 A;  3G6J B;  1BOS A;  1DJR D;  2F4I A;  4MN3 A;  1JOO A;  1PTO B;  1D5Z C;  4ZK9 B;  2A6H C;  2IPK D;  4FVM A;  3DHQ A;  3PUY A;  1S5D D;  4KY7 A;  1PRT B;  4V19 0;  1XTC D;  4A3K B;  3HS0 C;  4H0L C;  1BCP B;  1CA5 A;  3KLS X;  4KY5 A;  4RCO A;  5FLX L;  5T1I A;  1FR3 A;  1BCP D;  1VMC A;  1DZ1 A;  3SK8 A;  4C3I B;  5KIX A;  4ZYS A;  1FNV A;  1WTV A;  4DN4 M;  1LTT D;  5C4X B;  1D5X C;  1ENA A;  1U4M A;  5DEH A;  3BYY B;  4FXG C;  3MTS A;  2KQ3 A;  3VR4 A;  1ENC A;  5I6W A;  1PFB A;  5CGK A;  2PMZ B;  1WD1 A;  1BUV T;  1H9R A;  2BE5 D;  1IYU A;  1MSH A;  4DNR B;  1O78 A;  4FF4 A;  3SR1 A;  3GV3 A;  1EQV A;  2ICE C;  2BE5 C;  1PZI D;  4IUN A;  3IFD A;  3S9W A;  4WRD A;  2WKD A;  3VR2 A;  1EY8 A;  3G7L A;  3MEH A;  1V1P A;  2NBF A;  3K5M A;  1D5M C;  2MGS A;  5KNC A;  3MAQ A;  4HMJ A;  2RQX A;  4KHZ A;  2I46 A;  1FYC A;  2XVS A;  1LTA D;  3Q22 A;  2WIN B;  3ERQ A;  3CRL C;  2AQ2 B;  1B9M A;  4PMB A;  3NP8 A;  4LMQ D;  4CHT B;  4ZKC B;  3NWT A;  1LAB A;  2PNR C;  3ND9 A;  4ZKB B;  2WAQ B;  1I4R A;  4K2L A;  5T1G A;  1ONL A;  4IZ8 A;  2M9V A;  3BVG A;  2KJX A;  4FF2 A;  2JSO A;  4CKC A;  1F9R A;  3OW7 A;  2VXW A;  2F0D A;  1SNQ A;  4L6T B;  4B9W A;  1PTO F;  1IKM A;  2XSC A;  1HFG A;  4HTH A;  2B2W A;  5D3I B;  5CV9 A;  3KLS A;  4PNY A;  5KRU A;  3OIQ A;  1RF2 D;  5FOB B;  3J80 E;  5JEA G;  1ESF A;  4Q5V A;  1TII D;  3D4D A;  5KEE A;  2EJF C;  2E75 C;  4J8Q A;  1V1O A;  1BXT A;  1O7Z A;  5ELC A;  3CRK C;  3NXW A;  4LK1 C;  1I4P A;  1SND A;  4E6I A;  4OO1 I;  5COY A;  1H9K A;  3ONA B;  2JE6 I;  3C3L A;  2JP1 A;  2RVL A;  1AEX A;  2K32 A;  4FP5 D;  1K83 B;  5HGT A;  4IFD I;  1HCZ A;  5EKL A;  2NN6 H;  4CGY B;  3S2D B;  4A3F B;  2RDG A;  3NWS A;  2OF1 A;  4DK0 A;  2ZT9 C;  5CR3 A;  1TVX A;  2PW5 A;  2QIL A;  5CBA E;  3AB9 A;  1DOM A;  1SYF A;  3R2T A;  1FD7 D;  4IFD J;  1K8O A;  2WKC A;  2JYO A;  1I4Q A;  2WV6 D;  3WOE A;  2EY5 A;  3Q6S A;  4M8A A;  3IAY A;  1HQM C;  1SXT A;  1OXU A;  2E2D C;  2Z8L A;  2EZV A;  2F0O A;  2B2T C;  3NQI A;  4PMC A;  2IW3 A;  4ILW A;  4DAV A;  3KK7 A;  1TWC B;  5I2Y A;  4KJO A;  2HUG A;  4P2C B;  4ODG A;  2IT1 A;  4OGQ C;  3D6W A;  3T51 B;  1KDC A;  5EGT A;  1LAC A;  1OXT A;  3DXJ C;  3QB3 A;  1TS5 A;  4XYO A;  4K6L A;  2K6A A;  3FVQ A;  4H13 C;  2A69 D;  5EBC A;  1TWF B;  1X3P A;  5DNF A;  5J39 A;  4BBR B;  5C4J B;  1TKW B;  5KGU A;  1ET9 A;  3VYU A;  3NUC A;  1WTW A;  2KEE A;  1F9S A;  1G91 A;  3AU7 A;  2F0W A;  1V1P B;  1SE3 A;  3LX0 A;  1BO0 A;  1JOQ A;  4R8I A;  5ELF A;  3RZD B;  5M5Y B;  4XQQ A;  2QKI C;  2NN6 G;  1F2M A;  2FHT A;  4LJZ C;  4QUF A;  3A8K E;  3CKI B;  3TSS A;  1EYA A;  4O42 A;  1E2Z A;  1CHQ D;  3OMC A;  3H0G B;  4UAI A;  5IGG A;  4QMG A;  2MUY A;  3NSW A;  1Y8N B;  2KVM A;  5JVG 3;  4K14 A;  4BA1 I;  5C5M A;  2B2V A;  2KUM A;  3K6O A;  4ZRZ A;  1TT2 A;  2KCC A;  3RLF A;  1T5E A;  2HCI A;  1SYE A;  1LTI D;  4HR7 B;  4TQU S;  3HRZ C;  3MHB A;  4KHV A;  2EYJ A;  1BQQ T;  2MJ8 A;  4HCE A;  4G57 A;  4QB4 A;  5IGF A;  4L8J A;  3PIO 3;  1G2T A;  5C0X H;  2B8F A;  1MGS A;  1F2L A;  2F0V A;  2JA7 B;  2PYK A;  3GP7 A;  1HTP A;  3I4L A;  4PMW A;  2K33 A;  2MPM A;  1JQY D;  4XT3 B;  3A54 A;  2A6E C;  5ISR A;  1Y1W B;  1EWH A;  4NMZ A;  1S5C D;  3S2H B;  4CKB A;  4RFB A;  3FEW X;  4YIJ A;  1II3 A;  1QWY A;  1SMY C;  1UEA B;  1A15 A;  1HA6 A;  2NVY B;  2ZXO A;  1B44 D;  4NKL A;  3CQZ B;  3KLR A;  4TKO B;  2JA5 B;  2L5T A;  1QG7 A;  1ZYR C;  2BCO A;  2NVX B;  3SK4 A;  3N52 A;  2XRS D;  1CA6 A;  5IGE A;  1SNM A;  2ENB A;  1B1Z A;  2PZU A;  2AWO A;  3ITP A;  2A6E D;  3D3R A;  2X6L A;  3JAM L;  3J7Y W;  3TN2 A;  5ELE A;  1DON A;  1JIC A;  3PUW A;  1EOT A;  5C3X A;  2VUM B;  1M4V A;  3DUZ A;  1SNO A;  2F0K A;  3E6Z X;  4UDU C;  2CW0 D;  2LY7 A;  3MA2 B;  2OXP A;  4U67 3;  1EY5 A;  2CW0 C;  1MI2 A;  1SYD A;  3VA5 A;  1ICW A;  4RKB A;  3MXN A;  1IKL A;  1PLF A;  1L0X B;  5C4Z A;  2K05 A;  1EIG A;  5EKI A;  3SHL A;  1NUC A;  2NVQ B;  2EPB A;  1SEB D;  3BDC A;  5KND A;  2L9H A;  2I07 B;  1TS2 A;  4NDX A;  1IYV A;  2NZ1 D;  4WJW A;  1B53 A;  5C5L A;  5COR A;  4IUR A;  2LS0 1;  1GUG A;  3I8Z A;  3GTK B;  1LO5 D;  2M2L A;  4BY7 B;  5KNB A;  3R3O A;  4J6H A;  1Q3L A;  4RCN A;  2NUC A;  1LTG D;  2FMC A;  1CZW A;  4ME5 A;  3J7A F;  1HRJ A;  1BF4 A;  4XT1 B;  1SYG A;  3QG1 A;  4GZY C;  1NAP A;  1J9O A;  1PFM A;  1LTB D;  1A2U A;  2FMM A;  2BOS A;  3M7N A;  1D1K A;  4X3T A;  3D6C A;  1SE4 A;  1JCK B;  2HQE A;  1L0Y B;  2F1M A;  2G9H D;  1DOL A;  3TZU A;  1KDA A;  1CT1 D;  5E4X A;  3D31 A;  2TMP A;  1AP0 A;  4TSS A;  2VB3 X;  4KN4 C;  2RBM A;  3AMU A;  5IGC A;  4CJ1 B;  5IOD A;  1RHP A;  5CYU A;  3K5L A;  3DWA A;  4O1N A;  3T13 A;  2KHS A;  4F87 A;  2XN9 C;  5C44 B;  3ERO A;  2K03 A;  3P75 A;  1WD0 A;  1WTQ A;  3VYS A;  4KJN A;  1YNN D;  2F0M A;  3TBI B;  1CM9 A;  2L11 A;  2PPB C;  4RGN A;  1B2T A;  4CBV A;  1GUS A;  2EDG A;  2L4N A;  5A2Q E;  2F0H A;  1U4P A;  4DAP A;  4RWS C;  2F0L A;  3GD7 A;  1ET6 A;  1HUN A;  4K5X A;  1MSG A;  3C2P A;  1BNZ A;  2K28 A;  1KNE A;  5EKK A;  3R93 A;  3PV0 A;  1D6E C;  1AW7 A;  3K5O A;  4K5W A;  3IL8 A;  1EEI D;  3S1Q B;  2C9O A;  2K01 A;  1LT3 D;  3S1M B;  1EY6 A;  3SK6 A;  3GTG B;  1IW7 D;  2NTT A;  4C1N I;  2IWH A;  1RDP D;  4OO1 G;  3T4A C;  1CZG A;  2R3Z A;  4RH6 A;  4IFD G;  3M3Y B;  2B2Y A;  3M4O B;  4IUU A;  4Z9C B;  1KAA A;  4N9T A;  5A35 A;  2NB0 A;  4OO1 H;  3CHB D;  1CQF A;  2CQA A;  3E0J A;  4C3J G;  5FLX E;  1MD2 D;  1PZJ D;  2RSO A;  2XIW A;  1SNP A;  1ZXT A;  2A73 B;  1GUT A;  1Q90 A;  5EPL A;  5J22 A;  4H7B A;  4BA2 I;  3O13 A;  2ZXP A;  4HN7 A;  2HCC A;  4G7O C;  1SDF A;  4MHE A;  4A3B B;  4X3S A;  4M1U B;  2D62 A;  3NTK A;  1PYW D;  5IGB A;  1IL8 A;  5C6A A;  1GUW A;  3DWP A;  1PTO D;  4A3J B;  4G7Z C;  3DWQ A;  2K1B A;  2OEO A;  2MHV A;  5BN4 A;  5JOB A;  3S17 B;  2RSN A;  4IUV A;  1JOK A;  5D3D A;  5BN5 A;  4RGM A;  2ZXR A;  1BDO A;  2D2C C;  3C46 A;  4FO2 A;  1IHZ A;  4KKS A;  1PZK D;  2Q8R E;  2Q8T A;  2E2H B;  1VF7 A;  5G3L D;  3GV6 A;  1JC7 A;  1STH A;  3MFY A;  1PFN A;  5JJZ A;  1RCV D;  1PRT C;  1HUM A;  3OMG A;  5DM6 3;  1X32 A;  1SSO A;  4JK1 C;  1ROD A;  4NW2 A;  3W2D A;  3IFT A;  4C1N K;  4BY1 B;  3D4R A;  5I4D A;  3PO3 B;  5EQ0 A;  3A8I E;  5IIF A;  3GTO B;  2N55 A;  2F0T A;  1F9P A;  1QNU A;  3NTH A;  3S15 B;  4KD4 A;  1HA5 A;  2BA0 A;  1PRT F;  1AZP A;  2F0P A;  2EYF A;  2FIN B;  2KA7 A;  1GXD C;  3FKI B;  1WCM B;  1DM0 B;  1I3Q B;  1VMP A;  4J1M A;  4DXG A;  3I4N B;  3X3N A;  1Q8I A;  3S14 B;  4WOR A;  4RGT A;  4EQP A;  1EY7 A;  5M3F B;  3GTP B;  2X6G A;  3MXP A;  1EU4 A;  2DNE A;  3SDZ A;  2QF7 A;  3K59 A;  2EY2 A;  4OL7 A;  4RGO S;  4IUP A;  5FK9 C;  5C3W A;  5ELD A;  2F0J A;  1LT5 D;  1VF5 C;  3HOW B;  2B63 B;  5M9O A;  4IN3 A;  1G8Z D;  1I6H B;  4BS9 A;  2H1E A;  2NN6 I;  3A8J E;  2A6H D;  4FF1 A;  3FPU B;  3DEP A;  4DNT B;  4C3J B;  1C4Q A;  1WTO A;  3DM1 A;  1CTM A;  3NBH A;  1S4Z A;  3A56 A;  1G29 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...