1STGA

Two distinctly different metal binding modes are seen in x-ray crystal structures of staphylococcal nuclease-cobalt(ii)-nucleotide complexes
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
136
structure length
136
Chain Sequence
KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystal structures of staphylococcal nuclease complexed with the competitive inhibitor cobalt(II) and nucleotide.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase(phosphoric diester)
molecule keywords STAPHYLOCOCCAL NUCLEASE
total genus 38
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 1994-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1stgA00
4I65A 3NQTA 4ZQ3A 3SK6A 3MVVA 4LAAA 4G57A 4MIUA 5KYIA 1EY7A 5DAUA 1F2ZA 3MZ5A 3V2TA 5I6WA 5ISRA 3QB3A 2KHSA 3HEJA 5CV7A 4K6DA 3BDCA 3P1HA 4EQPA 2O4XA 3RUZA 5IGFA 1EY8A 1A2UA 4KHVA 4QF4A 4EVOA 3SR1A 4F8MA 4NDXA 4QB4A 3SXHA 4HMJA 2PQEA 2F0UA 4DFAA 5IGEA 5J1ZA 3SK4A 1SNQA 3TP6A 1EY6A 4DF7A 4KJNA 1SYDA 2SNSA 4ME5A 5CR3A 4DGZA 3OMCA 2F0FA 3MEHA 1EZ8A 4HMIA 2OXPA 2F0TA 2QDBA 4NKLA 1AEXA 1STYA 2F0VA 2LKVA 1F2MA 5EGTA 4ZUIA 1EY5A 5JAVA 4N9PA 5CV9A 2EY6A 2M00A 4KY5A 4TRDA 5EKLA 4K2LA 1JOKA 1SNDA 5IODA 2F0HA 2EYJA 2F0OA 2RDFA 5C4HA 2F0GA 2F0EA 5KIXA 1EY0A 1KAAA 5J22A 1STBA 1JORA 3EVQA 3H6MA 3D6CA 4F7XA 4E6IA 5IOCA 4N9TA 5E1FA 3TP5A 1SYFA 4WRDA 3T16A 1ENAA 4ODGA 4PMCA 1IHZA 3P75A 4NP5A 4ID6A 2PZUA 3OMGA 4B9XA 5HGTA 3DMUA 3QOJA 4K5VA 4YIJA 4EQOA 1SYCA 3EROA 2PZWA 4PMBA 4J6HA 4RKLA 3SHLA 2F0IA 2EXZA 5IGDA 1NSNS 4PNYA 1U9RA 3PMFA 4KY7A 5CV8A 1A2TA 3C1FA 2EY2A 2EYMA 3HZXA 4KD3A 3U9OA 1KABA 1EZ6A 1KDAA 3NUCA 3MXPA 3SK8A 5C3XA 2EY5A 1SNCA 2RKSA 1STGA 5IGCA 5IGGA 5C3WA 1II3A 2PYKA 2ENBA 4KV6A 5CV4A 4KY6A 2EYLA 1JOOA 2F0LA 2EY1A 1SYEA 2F0QA 2HQEA 5I9PA 1JOQA 3T13A 1TT2A 3NXWA 2F0NA 1SYBA 5I6YA 4IZ8A 4DU9A 5EKKA 5CGKA 4H7BA 2F0PA 4KTAA 5C5MA 1EY4A 1F2YA 2EYFA 3BDLA 1EYDA 1EQVA 1SNMA 5F2DA 3NK9A 3TMEA 4EQNA 5KGUA 1SYGA 2NUCA 2RBMA 2F0SA 2F0MA 2EYPA 3TP7A 2SOBA 2KQ3A 5JOBA 2PW5A 2F0DA 4NMZA 5KEEA 5E3FA 3QOLA 2F0JA 5K5PA 4K8JA 3D4DA 3DHQA 3NP8A 5HURA 2EYHA 1SNOA 2F3VA 4K5XA 4ZUJA 1SNPA 3OSOA 5IGBA 4J1MA 5CV5A 5C6AA 5CV6A 5DEHA 5CC4A 1NUCA 3R3OA 5M9OA 5C5LA 1EYAA 2F0WA 2WACA 4S3SA 3E5SA 4K14A 1A3TA 4KD4A 3SK5A 2EYOA 4R8NA 3ITPA 1KDBA 5J39A 5KYLA 4IALA 2F0KA 1STNA 2SNMA 1EY9A 3D8GA 1ENCA 3LX0A 3MHBA 3NHHA 3OWFA 3TP8A 4KJOA 5NUCA 1STAA 3ERQA 4K8IA 2F3WA 1TR5A 4OL7A 4B9WA 5I9OA 5KRUA 1STHA 1KDCA 3VA5A 5IIFA 1EYCA 4IUNA 4WORA 1A3VA 3S9WA 4QMGA 1A3UA 4HTHA 1TQOA 4K5WA 2PW7A 2OEOA 2PZTA 3C1EA 4RKBA 4K2KA 3EJIA 1RKNA 2OF1A 5C4ZA 3D4WA
chains in the Genus database with same CATH superfamily
1GM5A 3S2DH 5M3FG 4IJLA 3J80E 4MIUA 1K0SA 5DAUA 3A7LA 1S5BD 1RODA 1B2TA 1Y1WB 1PDQA 3GD7A 2H4OA 4QF4A 3F2CA 1Q3LA 1PH9A 2Z4HA 4DFAA 1HUNA 1L0YB 1TWGB 1FJGQ 2D5DA 2K52A 1EY6A 4UDUC 2A73B 4DAYA 1CK1A 3B6YA 2LKVA 5JAVA 2B2YC 5M3FH 4TRDA 1VQIA 1SJHD 2QILA 1N8RC 5DNFA 5COYA 2L12A 3BDOA 2EIFA 4C56C 3A0JA 2JYOA 1B70B 2CWPA 5IYDH 1QNKA 4F7XA 4DK3C 5FLMG 3UDGA 1SMYC 2CHBD 4CKEA 5C4JH 1YNND 1X3FA 1LTBD 1I3QB 2NB0A 1Y1VB 4JI0L 2MJ8A 2NYZD 1WTQA 1PTOF 3KUPA 3PMFA 2B63B 4P73A 1QWYA 1HR0L 1KABA 1EZ6A 4FP5D 4RFBA 4DV7Q 4GLVB 1D2BA 2B2UA 2UUCL 3I4MH 3M3YH 2HQEA 3CMEA 1B7YB 4IZ8A 2XRSD 4JBWA 1EYGA 5D3DA 1Y1VH 2TSSA 3IFDA 5C4JB 1BF4A 1NY4A 5KEEA 2F0JA 4A3EH 4ZKCB 2B2VC 2L55A 4KKSA 1NE3A 4XXEA 1SJED 1EIGA 3KLSX 3Q8DA 3GO5A 2JA8B 3ITPA 1KDBA 4M8AA 3K58A 4DNTB 4IQZA 1LABA 3FRPB 3KOJA 4OWTB 4AYBE 2K1BA 3K7UC 3PO3H 4O0AA 3CCMA 1JJCB 3VR3A 4A93H 5M5YH 2E2JB 4DV1Q 1Q12A 1TQOA 3A8KE 4K5WA 4WJWA 1IZ6A 4RKBA 3W3AA 3EJIA 2K04A 4A75A 3JC66 3IRBA 4G4KA 2YTXA 3NQTA 4ZQ3A 1STEA 3M4OH 4RAUC 2QW7A 1G2TA 2MHVA 3I7FA 1HA5A 1ZXTA 2MFIA 1V1PA 1ASZA 1X3PA 3E0EA 3RUZA 4KHVA 1Z9FA 5IYDG 4O42A 1VQHA 1LACA 2NVTH 1SNQA 2LY7A 2NTTA 1VQNA 1IBML 2B63G 1LTAD 1U0LA 1O78A 4NXML 2XTIA 3VDYA 4JPBW 5FJ8G 5CV9A 2EY6A 1Q86C 1N33Q 4KY5A 4JK1C 3A74A 4BY1G 4GOPB 2F0OA 4XT3B 3A8JE 2FXQA 1TS3A 4YHHL 3T16A 1ENAA 2FMMA 2CKZB 2RDHA 2IT1A 3TRZA 1W6KA 4N8X1 4CKCA 1GUWA 2JN4A 2K14A 4PMBA 4KHPL 3WOEA 3EBEA 4A3LH 5JEAH 3G7LA 4DAMA 4B3TQ 4PQXA 4R4OA 4JI3Q 2MO1A 4C3HH 3G4SA 5BR8L 1CT1D 3CC4A 2EYLA 1SYEA 4PZ6A 5E4XA 2Q2IA 2K03A 3PGZA 5C0XG 1CSQA 3RN2A 3RZOH 3RN5A 3FKIB 1H9SA 4A76A 1EEID 4BA1I 2Q8TA 4X3UA 3T1YL 4JI2L 4FF3A 1ASYA 2Q2TA 3U4ZA 2KECA 5JJIA 3QR8A 2E2HB 1IXRA 2WACA 4CDCC 5IT9c 4JI0Q 5IWAL 2J7ZA 4A3BH 2VXWA 1EY9A 3TP8A 1UE7A 5M3MB 4DK1A 2P5ZX 4JI7Q 1O80A 5L37A 4OIKA 2R93H 2SEBD 3CPFA 4OIJA 3RD4A 5EPLA 1KIXA 1TWAB 2B2WA 3W1BA 3NTIA 4A3FG 5C44H 1YHAA 1XNQL 4GN5A 3W5OA 2IPKD 1YNJD 1N9WA 4A3IH 2OT2A 4QUFA 1I6HH 5C4ZA 3D4WA 4X3KA 1V8QA 3MXUA 3C3LA 1I4PA 3EFXD 4ULLA 2ZTDA 2RHSB 3VYTA 3GTPH 2D2CC 2K7VA 3QO2A 4IPGA 3HGBA 3CC7A 4GNXB 4C3IH 1JWUD 4EGVA 3ERSX 4E6IA 2BE5C 4DR5L 2EZVA 1KL9A 1IBKL 3HOVH 4HIOA 3UE1A 1BCPC 3BVZA 3G6EA 4RGMA 2HIVA 1H9RA 1PFBA 5CBAE 1JICA 1EY5A 3OIPA 1AP0A 1NNXA 2HD3A 4RGTA 1A8VA 1BBUA 3WWVA 1TWHB 1Q82C 4NXMQ 3EN2A 3Q23A 3RZDH 1T9HA 4DR7Q 3ZJYC 1F2LA 5FLMH 3MA2B 3J7AV 5I2XA 3CCRA 4IFDI 3SGIA 2PZUA 4XDXA 4M1UB 4QIWE 1XMOL 4LFBL 4J8QA 3CCSA 4A3BB 4JBMA 5GQOA 2NVQH 4JYAQ 3E6ZX 3CMAA 1CZWA 4RWSC 1NSNS 1PYSB 2YTVA 4PNYA 1GUOA 1EL0A 5LMNL 3C1FA 2EY2A 2EYMA 1RF2D 3LNNA 3CU7A 2HCCA 5KNCA 3J81E 3MFYA 2XSCA 1JOOA 1UE6A 5I9PA 4JCVE 2MQHA 1HA6A 5M3MH 4X62Q 3KDFB 1ONLA 4DN4M 3M3YB 4H7BA 3UDXA 3TBIB 5IY0A 1EYDA 1WTRA 4GN4B 1RTOA 4LF7Q 3GTPB 4IUTA 2D62A 2GVAA 2F0SA 1HZCA 2EYPA 3HOWH 3NEMA 2Z4IA 4B3RL 3T51B 4CJ2C 4NMZA 3V05A 5IYCH 1DOMA 2PPBC 2RSNA 2CH4W 4G7OC 4A3KH 2NVYH 2ZT9C 2A68C 4ME3A 3MFGA 1NJIC 2BA1A 4S3SA 3R8BA 1G51A 3HOZG 2SNMA 3LWUA 3LX0A 2IJ0A 4OONA 1TWFB 4JW0A 5JPMC 1PFNA 1TR5A 3VA5A 1C4QA 4TSSA 4WORA 3H0GB 1MSHA 3DEPA 4JI7L 3OTOQ 3NWTA 4DV0L 5KNDA 2A6HC 1D1IA 1OXTA 2Y0SG 4BY1B 4A3KB 3MVVA 3T1HL 1JE4A 1F2ZA 1K0RA 1SFOH 1GHKA 4OO1G 2YU9H 4C1NI 4EQPA 1M1KC 4V190 2NTSA 3PSIA 1JMCA 3OPOA 3BZCA 5CR3A 4XYOA 2A6HD 3L7ZC 3KLWA 1RL2A 1SE2A 2QDBA 1S72A 2C35B 2F0VA 1JT8A 1F2MA 5E4WC 3HOYB 4A3BG 3N6RA 1PTOD 1JOKA 4DV4Q 4LF6Q 4L5RC 4XIGS 1CUKA 1I94Q 5KIXA 4DUZQ 4ZKBB 3GTJH 3KBGA 3PQIA 4LF8Q 2NVTB 2B2YA 2KCMA 3PUZA 5AJ3L 1QJOA 3FDTA 4FXGC 3K5MA 4JI5Q 1O7ZA 2PQAB 4P71A 5DM73 5HGTA 1I50H 2O5JC 1DZ1A 4K5VA 2UXBL 1TS2A 4FO2A 2B2WC 5DLQE 1VQ9A 3J7AF 4JV5L 1KC8C 3GTGB 1FNWA 4K6LA 4CKBA 4BBSB 5IYCG 3VR5A 4X64Q 1PA6A 5EAYA 5IE8A 1PV4A 4CBVA 1TT2A 2ASBA 3KF8A 4NW2A 2E8GA 5K36H 3FP9A 3T53B 3UE0A 3H3VI 5C3EB 4DV5L 2K5WA 4JI2Q 4DV0Q 4DR7L 1LT5D 4UY8C 1GUTA 2KVMA 2R92H 3R3OA 5CBEE 3OWEB 2L1BA 5C4XB 4RCNA 3CCJA 1WJJA 5CMDA 4DV6Q 3D8GA 3OWFA 1OXVA 2F1MA 4HIDA 2CW0D 1BXTA 4GOPC 1MHWC 3I4NB 2ICIA 3DM3A 3FVQA 5LL6S 4HR7B 1XNQQ 5AFWA 4Y7NB 1PLFA 4CJ1B 2E2HH 3TREA 4DUYQ 4LMQD 3CD6A 4ZYSA 5GAEC 4DK0A 2VY3A 5H1SE 1VQ8A 1FD7D 3QB3A 3HEJA 1SMYD 4U68A 2ZM6Q 2IL8A 1FYCA 1XTDA 2DJFC 4QB4A 1HFNA 1KLUD 1QZHA 3KF6B 1QE6A 1J9OA 1YHBA 4MHEA 1R4PB 2F0FA 4DNRB 1W2BA 3HP3A 3QWNA 4GNXA 2KUMA 1K8AC 1HZAA 2F0TA 4F87A 4IUQA 5IYBH 1TIID 1SN8A 2Z6BA 3MXGA 5A2QL 4FYDA 4N9PA 4WJ4A 3MC0B 1I4GA 1VQEA 2X6GA 5IT9E 3OW2A 4A3IG 1AE2A 4YHHQ 1FGUA 1KAAA 3BVMA 4A3FH 3CHBD 1IKLA 2RA4A 4N9TA 1LM0A 1VQ4A 3C2PA 2ZJPA 2VUMB 1MSGA 5C3EH 4X3TA 4WJ3M 2E2IB 3S1RH 2R93G 1PH4A 4DUYL 3HOUB 1D6EC 1XNRL 1X65A 3BYTB 1WCMH 1VQ7A 1U9RA 3K0XA 1L1OB 1VQGA 3GP7A 5IGCA 3S1NB 3TSSA 4DR2Q 3PIPA 4KV6A 1UWVA 2WIIB 1F77A 3KLRA 3TS2A 4A3MB 4BY7H 3NXWA 1QNUA 5C0XH 1XNRQ 2EYFA 1QUQA 1EQVA 1N32Q 1XPOA 2I5HA 3T56B 4LFAL 1NCVA 2B2TC 1EIYB 3K5LA 2F4VL 2I07B 4DR3L 5DEHA 3GQBA 4YCWA 3U9SA 3E5SA 1A3TA 1Y14B 1E3PA 4LF4Q 3SEBA 4DPGA 2E2JH 5M5YB 2MPMA 3OIQA 3PCOB 3VR2A 1HZ9A 4CDFC 1PRTD 3Q22A 2OQ0A 4LFCQ 1QOHA 1DOKA 1JWMD 1HR0Q 2R7ZG 3K80C 5FLXc 4A3GG 4I65A 4A3JB 3M7GA 4KLKA 1HR0W 4HSPA 4C2MB 4XQQA 5KYIA 2AMCB 1OXXK 3R2IA 4BY1H 5ISRA 3L3OC 2KHSA 4Q5VA 2H1EA 1CHQD 3BDCA 3U58A 1IYUA 4PZ7A 1C0AA 4DR1Q 3S17H 3CRKC 4CHTB 5IGEA 3EIVA 5J1ZA 3CCUA 3SK4A 1CA6A 1EFWA 3Q6SA 2DY7A 2RVLA 3J7A5 1BCPB 2UU9Q 3O13A 2JA6H 1SLJA 3A54A 2XWJB 5IP9G 2B29A 1PH1A 1OTCA 2BDNA 3PF4A 4X66Q 4X6AH 1I6HB 3E9HA 2A5HA 5CORA 1Q1BA 4KI0A 1M90C 2D9UA 4DAYB 2JEAI 4A93G 4IO9A 1I3QH 1X56A 1YJ9A 1PFMA 4YCUA 1I5FA 3EROA 4GKKL 1GUNA 1PZID 5C4XG 3I4NH 3A7AB 2NZHA 5C3XA 3JAML 4A3EG 2BE5D 1B3QA 2PYKA 4MTNA 1YI2A 5I4DA 3TZUA 1K83H 1VQCA 2PMZB 3MEFA 2Q2UA 2R92B 2AHOB 2B2UC 2JEBI 4OO1H 4C2MH 1PYWD 5C5MA 2RSOA 2CWAA 4H44C 4EX5A 1Y1WH 3EQLC 4A3GB 4MNOA 5EBDA 5JVH3 1SMXA 3NQIA 4BXXG 1ICFB 2DUDA 5E3FA 1K8GA 4DXGA 2VQFQ 2RQXA 2OQKA 1MBYA 3IL8A 1JJGA 1HNXL 1NUCA 3U50C 1B44D 1PTOH 4LF5L 2AQ1B 1R4QB 1VQMA 1NMFA 4A3CH 3GTJB 2WKCA 2IWHA 3MWYW 4OGQC 4IUNA 1D5MC 3BU2A 1KD1C 1DOLA 1C7YA 3S1NH 1X55A 4AH6A 1TKWB 2QGQA 2JA7B 3HOXB 2JA7H 1FGBD 2PCFB 1K73C 1B9MA 1U4PA 3BZDB 2PI2E 2F3IA 2JA5G 3VA7A 4DV3Q 3K7AB 1M8AA 4ZCKA 1GD7A 1SBBB 3AQQA 3W1GA 1LT3D 2O4XA 1SFOB 3CRLC 4HMJA 3NBIA 3HOXH 2FFKB 2AKWB 1X54A 3Q24A 1XMOQ 3HS0C 2E2IH 1PH6A 4CDDC 5T1IA 2HT1A 1CKNA 5EKIA 2EYJA 1CA5A 1RD9D 1LT4D 1STBA 4JI5L 1EU4A 2IX1A 1C48A 1IHZA 1VQBA 4I7AA 3F2BA 1S4ZA 3J7YW 5M3MG 1XMQL 2UXDQ 1A15A 4GN3B 4R4CA 4J6HA 2WINB 1EQQA 1S5DD 2K01A 1EUJA 3U9OA 3HZXA 1GVPA 3PUXA 2R61A 4RH6A 3I4MB 1G6ZA 2KEEA 1Z7TA 2VQFL 3IFTA 3E9IA 1IW7C 5C3WA 4B3RQ 1QUQB 1D5ZC 2DN8A 2EOTA 2EY1A 2G9DA 4R1JA 2PNHA 1RTNA 1UEBA 4H13C 1LTTD 4JYAL 5FO7B 3J81j 1ZYRC 4EQNA 2KCCA 3NK9A 1VF5C 2AQ3B 1WTHA 3JAME 1ML0D 1MJEA 3I8ZA 2HDLA 2NVXH 1RIPA 1HQMC 2C5CA 3J81i 4POGA 4R4QA 5K5PA 4IN3A 1DJRD 4HJ8A 2R6GA 5ELFA 5IGBA 5CV5A 5C6AA 1TWCB 1CQVA 3UI2A 1N36Q 3S14H 4R4TA 2JA5B 5C4XH 4BY7G 4OL7A 4AYBG 1KDCA 3HOWB 5FLXL 4DR5Q 2G9HD 3S9WA 4HTHA 1L0WA 4BBSH 4AIMA 4K2KA 3H3VH 1S5FD 1BR9A 3D4RA 3SK6A 2XRQD 4IPCA 3BJUA 1EY7A 2Z6KA 5C44G 2H5XA 2F4VQ 4X62L 4DV2Q 4FF2A 3H0GG 2WP8J 4RA8A 1SROA 4U673 1ICWA 2A74C 1TVXA 3I4NG 3AYHB 1K8OA 4JC0A 5GAGC 2OXPA 4NKLA 1PH2A 5IWAQ 1AZQA 4OEMB 1TWAH 1AZPA 3OHXC 3PIP3 1EIHA 2F0GA 1I4XA 3D6CA 4NB3A 3M9BA 1E1TA 1LTSD 4ODGA 2VUMH 2BCOA 1XX8A 4A3MH 1YNXA 2K6AA 1QVCA 1TY2A 3MXNB 4X65L 4RCOA 3ZYYX 2NZ1D 1P8LA 3K59A 3HOYG 4GKKQ 1Q7YC 4L6TB 3GTLB 2OTLA 3A8IE 2EJGC 4LNQA 2R93B 2K50A 4HJAA 5CV8A 4IUUA 4LF9Q 4GKJL 5FLXE 2RKSA 5LHY1 1Y8OB 5BR8Q 1WTVA 4BY7B 1VMPA 2ZXRA 4LFAQ 2RHQB 2VW9A 1Q8IA 1TWFH 2QKIC 5EJWA 5ELNA 2A8VA 1ENFA 5JPNC 3HOYH 1A6XA 3TMEA 3FPUB 3UDFA 2OWOA 1L0XB 4GLXA 2JE6I 4RHSA 4YWLA 3TEHB 4XTCS 3CCEA 2ZTCA 3I2ZA 3QOLA 1WOCA 1AE3A 1XPUA 1TXYA 3NBHA 4DR1L 1SNPA 2N78A 2NWGA 1BUVT 1EYAA 4P72A 2KHIA 1VQAA 5D14A 2VZAA 2JSOA 1E2VA 1CFMA 3ERQA 4B9WA 4J15A 4K8IA 1CKOA 3VYUA 4DNIA 3NENA 3H0GH 2B3GA 1CM9A 1DYQA 3C1EA 1WTPA 4KN7C 3TQYA 2MP1A 3S24A 2KJXA 2GN5A 3BG3A 3NSWA 3PUVA 1VQ5A 1YNJC 4JBJA 4KHPQ 4P75A 4JI8L 3VR6A 2NBFA 4HEDA 1MIUA 5IGFA 2EE1A 4NDXA 1KRTA 3GTOH 2FINB 1KLGD 2Z8LA 3I4MG 4DV1L 5HGQA 2WKDA 2UUAQ 4OELB 3AB9A 4NPSA 1BBXC 2J4XA 1VS0A 2E2DC 1IYJB 2JP1A 3I91A 5C3EG 2CCZA 2KA7A 4ZUIA 3JAMi 1EEFD 1E0BA 2PMZE 1SNDA 1VQKA 1PRTC 2RDFA 3RLOA 4X64L 1EOTA 1SSOA 3CCVA 1Q1EA 4PZ8A 4IFDH 3ULLA 5LL6X 2UUAL 4DA2A 2YV5A 3H91A 1BVSA 4KN4C 1KQSA 3QOJA 4DK6C 5IYBG 2BA0A 5JEAG 2PZWA 1V9PA 4A3LG 3HOZB 2VB3X 3EA6A 1IL2A 3PO2B 1ESFA 1KRSA 1NTGA 2KHJA 4H02A 1BCPF 1KTKA 3DXJC 3GTQH 3NUCA 5GROA 2C9OA 2LS01 2N49A 5CV4A 2ENBA 2UUBQ 5JJLA 2LXJA 5I6YA 1SYBA 2LMCB 4UPAA 1P16A 1DXMA 2WV6D 2AUJD 4L8JA 5JJKA 1VQLA 2QCPX 2WFWA 1JCKB 2XGTA 2B63H 1D5XC 3K57A 1Y8PB 2UUCQ 5K36G 2A69D 2PO4A 1HHVA 2EDGA 1I50B 5IP7H 3VYSA 1SNOA 2A6ED 4DR6L 1RHPA 4A3DH 5C5LA 3STBC 5TSSA 5JJZA 1BCPD 1U4RA 2I46A 2K32A 4IALA 1ILPA 1ENCA 1SDFA 3KK7A 3E0JA 3CQZB 2JA6B 1STAA 3DLLA 1STHA 4L5QA 2QEJC 4HJ9A 1A0IA 4K0KQ 4JBKA 5EPKA 1A3VA 3ICEA 1FJGL 4MTKA 2PW7A 2PZTA 3ONAB 3MAQA 2WB1B 2Q2HA 5JEAJ 4P2CB 4ZK9B 1XPRA 1J8IA 3KFUA 3AFQA 2UXDL 2R7FA 4IUPA 2K05A 3F1ZA 2YU9B 3L0OA 3CKIB 2CQAA 2R3ZA 1RDPD 4L5TA 1U5KA 1MKHA 4X65Q 3S1MH 4EVOA 4Y52H 2FHTA 5D65A 2PQEA 4DF7A 1SYDA 4DGZA 4APVA 1YVCA 1PRTF 4POFA 5EBCA 1YIJA 3D0FA 5EQ0A 1HH2P 3PO2G 3R93A 1QILA 4ZLTF 1QCBD 3URYA 1E24A 1ZYRD 4A3JH 3MTSA 3CQZH 4FNFA 1YEZA 2UUBL 4ZRZA 2ZXPA 4RGNA 5ELEA 5ELOA 5AJ3Q 3NTKA 3GTKB 1M4VA 3ULPA 4UP8A 1JB3A 3GV3A 3I3CA 3OMGA 1K3BC 3DMUA 1PXUA 4YIJA 2MNAA 3M4OB 5A2QE 1GUGA 3SHLA 4QL5A 2KENA 2L9HA 2N88A 4Q0FA 2R7ZB 1LUZA 2A6EC 2GA4B 2HIXA 4R8IA 1KDAA 1SNCA 1QZGA 1PTOB 1T5EA 5ELDA 2F0QA 1F9QA 1UEAB 3FEWX 2Y0SE 3NBHB 1HUMA 3SVMA 4C3JG 2IHFA 5KGUA 1HNXQ 2NUCA 2RBMA 3DUZA 1JWSD 2F0MA 3DWAA 1MD2D 2L4NA 1HPCA 1NR4A 4XYQA 2M2LA 5HY6A 4JI6L 2EYHA 3ER0A 1ET6A 3J7ZC 4A3IB 3OSOA 3HOVB 3ND9A 1NBWA 1BDOA 3S14B 1A63A 1XYIA 2JA8G 1HJPA 3KF6A 5KRUA 4UP9A 1ET9A 4BA2I 1B53A 1A62A 1XJVA 4QMGA 1B50A 2CFMA 3S2HH 5JVG3 1HNWQ 1PVOA 1Q46A 3BVGA 1SE8A 3AMUA 1N32L 2VQEL 2YYZA 2EQSA 2XVSA 3MZ5A 3HOXG 5C0XI 4A3MG 5CV7A 1PH8A 3K5NA 4A3GH 1PZJD 2Z1CA 4P74A 1A2UA 3D31A 2F52A 3SR1A 3OW7A 3TP6A 5J22A 1PTOC 3OMCA 4CJ0B 5C44B 2TMPA 3HFZB 4HJ7A 5FJ8H 5EKLA 3OOCA 4XQJA 3PIOA 3C46A 2D0PA 2QA4A 3FKIH 1VQOA 4YY3Q 3K5OA 1B4OA 4HSVA 1E22A 4A3CG 4ID6A 4H0LC 4AQYQ 1YITA 4OX9L 3DEOA 3J80L 5M3FB 2IW3A 4RKLA 4ZAIA 5BN5A 4JI1Q 3S17B 4X3SA 2NVYB 4L63B 3HKZE 4IPHA 3N52A 4C3IG 4HCEA 4BBSG 2EY5A 4MN3A 3CCQA 1II3A 1PH7A 4KY6A 2WAQB 1JC7A 3T13A 2ATWA 3M85A 5EKKA 3JAMc 3SE0A 4V0BA 1YJNA 1VQFA 4X66L 5F2DA 3H09A 1KNAA 3S2DB 2RDGA 1XXGA 3HRZC 2HQLA 1GO3E 3QJYA 3K8AA 4CDEC 1SRUA 4BWGB 4BBRG 3D4DA 3NP8A 3S2HB 1QVFA 4LF9L 2HUGA 1NMGA 3G6JB 2NVQB 1XTCD 2KCNA 2X69A 2E75C 2F03A 3QG1A 1PZKD 1L2FA 2IX0A 2E5LL 1F9PA 1N34Q 5D3IB 1B1ZA 5IIFA 1IBMQ 1EYCA 2B2VA 1HCZA 2PQAA 4UAIA 1ZKOA 1A3UA 2PI2A 4DV5Q 2OEOA 1RKNA 5LMUQ 1N34L 4ILWA 2CVRA 2E5LQ 2UXCL 2OTJA 4UP7A 2X6LA 1WVLA 1ILQA 4YCVA 2DNEA 1E2ZA 1BO0A 2Q8RE 3PV0A 4A93B 1VQPA 1KXLA 1HRJA 4K6DA 1BQQT 3P1HA 4DR3Q 5G3LD 1OO9B 1X3GA 1LLRD 1TY0A 4C3HG 3P20A 2F0UA 1O7YA 3G71A 2E74C 4HMIA 2B8GA 4JI3L 1AEXA 1STYA 3PUWA 2K75A 5M5XB 4LW1A 2M00A 1BNZA 5GADC 4KMUC 5A35A 5C4HA 2IX3A 4FXDA 1X3QA 1KNEA 2R92G 1QB5D 1Y69U 3H6MA 4HN7A 3I55A 4JV5Q 2FMCA 2ZM6L 4PMCA 3I4LA 2VB2X 4ABNA 1HNZL 2QDLA 1CKNB 1LTLA 4IPDA 1K28A 3CXCA 1LTID 3PO3G 2JA7G 1E7ZA 3KJPA 4KY7A 4OXPA 4RHRA 4AQYL 1QG7A 1WD0A 1PH5A 2E76C 3X3NA 1R9TH 3MXPA 1VQJA 4NXNQ 3AU7A 2A19A 4BBRB 2A69C 1JE5A 1YJWA 2AQ2B 1ESRA 2XN9C 1E2WA 1V1PB 3STBD 1Y8NB 3S15H 2MO0A 3FMCA 4QUCA 1B3AA 4DR4Q 1FR3A 3A5UA 1XWEA 5LMUL 3GTLH 1KAWA 1FL0A 3KF8B 4DV7L 3NELA 2HHHL 4QGUA 3RZDB 2F3VA 3L9AX 3NE5B 4DV3L 3T1HQ 2K28A 4R8NA 2SDFA 3PO2H 3NHHA 2CQOA 3FPPA 5KNBA 4QIWB 5NUCA 1O7LA 5I9OA 3TDQA 1PHJA 4IOCA 5FO9B 3PF5A 1SEBD 2Z9HA 4I7ZC 4R9WA 1LTRD 1UE5A 1HNWL 4WFN3 1WTWA 3FKIG 2O5IC 2JK8A 4DV4L 4LF6L 3PUYA 1HQRD 3CPWA 4LAAA 1PH3A 1EFID 4OWXB 1VDZA 2QF7A 5BN4A 3J80c 2JXMB 3GTGH 4MZ9A 5BN3A 4OHJA 3SXHA 3S1QH 4F88A 4PMWA 4KJNA 4C3IB 3MEHA 4GOPA 1TU2B 1G8ZD 1NAPA 1K8MA 5FOBB 3MXNA 1I4HA 2EVBA 3WDNA 1JQYD 4IFDJ 1EWIA 1CHPD 3TS0A 4A3DG 1X6OA 2AWNA 4LK1C 2Z0SA 3EVQA 3R2TA 5IP7G 1DM0B 4A3FB 3DM1A 1CZGA 3J81L 4JI4Q 1IKMA 1EIFA 4AYBB 4JVZA 4LUVA 1QVGA 2DGYA 3HOWG 4DUZL 3GTKH 1CI3M 2JA8H 1TS4A 1SR3A 1WFQA 2LXKA 2J0TD 4EQOA 3HOUH 3S1RB 1JJ2A 1OXSC 2F0IA 2UXBQ 1A2TA 2WAQE 4B08A 4FDBA 4HIKA 3F8TA 1WTXA 1GUSA 5M5WH 1T5XD 2CH4A 3T4AC 4QJFA 3GTOB 4B3SL 3GV6A 3HKZB 3D6WA 1V43A 3K0YA 5C0XJ 1LYLA 2K4KA 1GKHA 3KYHC 2A68D 1H9SB 3BDLA 1LV9A 4DAPA 2RCFA 4C3JB 2AWOA 2XWBB 1HTLD 1SE3A 3NTHA 2F0DA 3RR5A 1D8LA 1J5EL 1H9MA 2K5DA 4K0KL 4O2DA 2LSSA 4K5XA 4KKUA 5LMNQ 4C3HB 2IY5B 1DD2A 1MGSA 4K14A 3SK5A 1RCVD 2EYOA 3MHBA 5LMNW 1TS5A 2K5NA 4O1NA 2F3WA 3NWSA 1L1OC 1OXUA 2Z6KC 2ZTEA 4YWMA 4NXNL 2L11A 3OTOL 3ULJA 2KEDA 1Y1WG 4JI6Q 2N8NA 3RLFA 1Q81C 4GZYC 1SAPA 1WCMG 4LF4L 4A3DB 2EJMA 1IL8A 3W2DA 2V4DA 3CW2C 4HJ5A 4G7ZC 3K81C 4G7HC 4LFBQ 4A3JG 1H9JA 4RGOS 4HAEA 5I6WA 1G91A 1IBKQ 2WB1G 3J81c 3GDEA 2D0OA 4F8MA 1FVIA 1VQDA 1EWHA 5CYUA 1EZ8A 2DY8A 3AEVA 4CGYB 3PO3B 1C8CA 1JB7A 3GTQB 3RMHA 1X9NA 5ELBA 5IODA 1TWHH 2F0EA 3X3MA 2ES2A 1PYBA 3TP5A 1SYFA 2LFNA 4WRDA 4B3TL 1G6PA 2OCEA 2N3SA 3I90A 1YBYA 3F2DA 4NP5A 1K3RA 1VQ6A 1N33L 4DR4L 1Z6HA 4XQNA 2JA6G 2Y0SB 1B9NA 5T1GA 4PG3A 1SYCA 4DAVA 3TZDA 4IURA 3HOUG 2ID0A 3DWQA 2G5DA 2KBNA 5IGDA 2NZOA 3IAYA 4B3MQ 3DWPA 5ELCA 1PMRA 3A55A 1WTOA 1B8AA 3T1YQ 4RMFA 1AW7A 1AFPA 2F0LA 3NPPA 4LUZA 4QY7A 1GHJA 2UXCQ 1D1KA 5E7NA 1CQFA 1HZBA 1SYGA 3I70A 4L5SA 1WCMB 1HNZQ 2WAQG 1YZ6A 1E1OA 1SXTA 3S16B 4EQ5A 3DHQA 5HURA 3CF5A 2RCNA 2R7ZH 4R4IA 3E3XA 5CC4A 3IKJA 3WOFA 2XNAC 3OYYA 1YHQA 4KD4A 2JA5H 1NR2A 1HFGA 4LUOA 4YWKA 2HDMA 5FO8B 1EWCA 4IOAA 4KJOA 4GNXC 3PIO3 4LF7L 1JORA 5KYLA 5G3LF 1IW7D 3H94A 2KCTA 3P7JA 1S5CD 4DR2L 3S1MB 4IFDG 4C1NK 3TN2A 1MJCA 4JOIA 3S16H 1UNSA 2L0CA 1I4RA 4G57A 1G291 3BYYB 2WB1E 1IBLQ 3KLSA 1ZEQX 1R9TB 4GLAC 4KK7A 1D7QA 3F2UA 1EQRA 1SE4A 2NN6H 4FF1A 1EY8A 4GKJQ 4LJZC 4QQBX 3I4OA 4ME5A 2SNSA 1F9RA 2IHEA 3M4YA 3KJOA 2FJ2A 2I5LX 3M4QA 1IBLL 1X3EA 4ALPA 2PNRC 1WI5A 4OX9Q 2JQOA 1I4QA 2GVBA 1BOSA 4RG1A 1YNNC 1CSPA 2RF4A 5FKAC 1EY0A 2UU9L 1U4MA 3S1QB 1UUPA 5IOCA 4N8FA 4DV2L 4XT1B 3HKSA 2EPBA 1Z47A 2XIWA 3P75A 3M7NA 2EJFC 1MI2A 2ALYB 4JG2A 2BOSA 4DXFA 4JI8Q 4A4IA 1EU3A 3J80i 3LGJA 3K6OA 4KD3A 3Q0AA 2DNCA 1PFSA 3GTMH 2NN6G 5IGGA 3I73A 4B3ML 4LFCL 3RNUA 4DU9A 1FNVA 2F0PA 4KTAA 3HOZH 4UHVA 5IT9L 5IP9H 1I6VC 1HXYD 3CP0A 1AH9A 1FNUA 1BKBA 5I2YA 1CTMA 3TP7A 2JA9A 5JOBA 4TVAB 3VR4A 2PW5A 3RLNA 3GTMB 3L2PA 2L5TA 2B8FA 3ND8A 1RJTA 4FF4A 2BH2A 3CC2A 3AFPA 1KHIA 2JJQA 2KOLA 4J1MA 5CV6A 2Q8IB 5M9OA 2O2LD 2B39A 2ZXOA 5J39A 5EPJA 2EXDA 2N55A 1JR0D 3I72A 2K5HA 2B2TA 2VUMG 1K83B 2HCIA 2YTYA 3SDZA 1V1QA 3H15A 4IJHA 3V96A 3U4VA 2OF1A 1K9MC 1TWCH 4KKTA 3H3VC 3D3RA 3KBXA 4OWWB 3RZOB 1WD1A 1J6QA 3S15B 1BBWA 2L15A 2VQEQ 3V2TA 4GS3A 3KDFA 4DKAC 4C3JH 2MGSA 4PV1C 4BBRH 2ZJRA 2CW0C 4IUVA 2VNUD 2VS1A 1H9KA 1X32A 2ZJQA 1VMCA 1EQTA 3G48A 3VYRA 1EOVA 4FVMA 2MUYA 4QCLA 5M5WB 5EGTA 4Y7NH 1H95A 4JOIC 4JI1L 1VF7A 4K2LA 1N36L 2I0QA 4JI4L 2F0HA 3HOVG 2NVXB 1GOZA 2M9VA 1V1OA 2A1AA 3QIAA 5J3BA 2BDOA 5E1FA 1Q90A 1J5EQ 4BS9A 3BZKA 4HCSA 1LT6D 1F9SA 2R7DA 4BXXH 5GAHC 4B9XA 4OO1I 4YY3L 1TWGH 4KHZA 2K33A 5M5XH 1DGSA 2EXZA 1XMQQ 2DJGC 3K7AH 1Q8KA 3SK8A 4B3SQ 4HIMA 3M4PA 3LWEA 1STGA 1UAPA 1JOQA 1U4LA 2F0NA 1AN8A 1C9OA 2BH8A 2ICEC 2AUKA 5CGKA 1W6JA 3I56A 1Y1VG 4TQUS 1IYVA 1EY4A 1F2YA 1SNMA 3A56A 1S3OA 5DM63 5FK9C 4DV6L 1O7IA 1LTGD 4DR6Q 1W3SA 1GJXA 4Z9CB 2SOBA 2KQ3A 1S40A 2NN6I 3HKZG 2QEXA 1S5ED 1HTPA 2K5VA 3CAMA 4K8JA 2F4IA 4LF8L 4ZUJA 1GXDC 3HG9A 1I94L 4LWCA 4TKOB 3BS1A 2F0WA 3FHWA 4LF5Q 1G2SA 2I5MX 1LO5D 3UDIA 2F0KA 1STNA 3A5ZB 2V1CC 1CKMA 1UE1A 2K5QA 4FXKC 4A3KG 2HHHQ 1PRTB 1DONA 4A3EB 2VL6A 1WYDA 3CCLA 1L1OA 1VCIA 1DCZA
chains in the Genus database with same CATH topology
3J80E 4MIUA 5DAUA 3A7LA 1S5BD 1RODA 1B2TA 1Y1WB 1PDQA 3GD7A 2H4OA 4QF4A 1Q3LA 2Z4HA 4DFAA 1HUNA 1L0YB 1TWGB 2D5DA 1EY6A 4UDUC 2A73B 4DAYA 1CK1A 2LKVA 5JAVA 2B2YC 4TRDA 1SJHD 2QILA 5DNFA 5COYA 2L12A 3BDOA 4C56C 2JYOA 1QNKA 4F7XA 1SMYC 2CHBD 4CKEA 1YNND 1LTBD 1I3QB 2NB0A 1Y1VB 2MJ8A 2NYZD 1WTQA 1PTOF 3KUPA 3PMFA 2B63B 1QWYA 1KABA 1EZ6A 4FP5D 4RFBA 1D2BA 2B2UA 2HQEA 4IZ8A 2XRSD 4JBWA 5D3DA 2TSSA 3IFDA 5C4JB 1BF4A 5KEEA 2F0JA 4ZKCB 2B2VC 2L55A 4KKSA 4XXEA 1SJED 1EIGA 3KLSX 3GO5A 2JA8B 3ITPA 1KDBA 4M8AA 3K58A 4DNTB 4IQZA 1LABA 3FRPB 2K1BA 3VR3A 2E2JB 1Q12A 1TQOA 3A8KE 4K5WA 4WJWA 4RKBA 3W3AA 3EJIA 2K04A 4G4KA 3NQTA 4ZQ3A 1STEA 4RAUC 1G2TA 2MHVA 1HA5A 1ZXTA 1V1PA 1X3PA 3RUZA 4KHVA 4O42A 1LACA 1SNQA 2LY7A 2NTTA 1LTAD 1O78A 5CV9A 2EY6A 4KY5A 4JK1C 2F0OA 4XT3B 3A8JE 1TS3A 3T16A 1ENAA 2FMMA 2RDHA 2IT1A 1W6KA 4CKCA 1GUWA 4PMBA 3WOEA 5JEAH 3G7LA 4PQXA 1CT1D 2EYLA 1SYEA 5E4XA 2K03A 5C0XG 3FKIB 1H9SA 1EEID 4BA1I 2Q8TA 4X3UA 4FF3A 2KECA 2E2HB 2WACA 2J7ZA 2VXWA 1EY9A 3TP8A 5M3MB 4DK1A 1O80A 4OIKA 3RD4A 2SEBD 4OIJA 5EPLA 1TWAB 2B2WA 3NTIA 2IPKD 1YNJD 2OT2A 4QUFA 5C4ZA 3D4WA 4X3KA 1V8QA 3MXUA 3C3LA 1I4PA 3EFXD 4ULLA 3VYTA 2D2CC 2K7VA 3QO2A 3HGBA 1JWUD 4EGVA 4E6IA 2BE5C 2EZVA 1BCPC 3BVZA 4RGMA 5CBAE 1H9RA 1PFBA 1JICA 1EY5A 3OIPA 1AP0A 4RGTA 1TWHB 3Q23A 1F2LA 3MA2B 3J7AV 5I2XA 4IFDI 2PZUA 4XDXA 4M1UB 4J8QA 4A3BB 3E6ZX 1CZWA 4RWSC 1NSNS 4PNYA 1GUOA 1EL0A 3C1FA 2EY2A 2EYMA 1RF2D 3LNNA 3CU7A 2HCCA 5KNCA 3J81E 3MFYA 2XSCA 1JOOA 5I9PA 1HA6A 1ONLA 4DN4M 3M3YB 4H7BA 3GTPB 3TBIB 1EYDA 1WTRA 1RTOA 2D62A 4IUTA 2F0SA 2EYPA 2Z4IA 3T51B 4CJ2C 4NMZA 3V05A 1DOMA 2PPBC 2RSNA 4G7OC 2ZT9C 2A68C 3MFGA 2BA1A 4S3SA 3R8BA 2SNMA 3LWUA 3LX0A 2IJ0A 1TWFB 5JPMC 1PFNA 1TR5A 3VA5A 1C4QA 4TSSA 4WORA 3H0GB 1MSHA 3DEPA 3NWTA 5KNDA 2A6HC 1D1IA 1OXTA 4BY1B 4A3KB 3MVVA 1JE4A 1F2ZA 1GHKA 4OO1G 4C1NI 4EQPA 4V190 2NTSA 3OPOA 5CR3A 4XYOA 2A6HD 3L7ZC 1SE2A 2QDBA 2F0VA 1F2MA 5E4WC 3HOYB 3N6RA 1PTOD 1JOKA 4XIGS 5KIXA 4ZKBB 3KBGA 2NVTB 2B2YA 3PUZA 1QJOA 3FDTA 4FXGC 3K5MA 1O7ZA 5DM73 5HGTA 2O5JC 1DZ1A 4K5VA 1TS2A 4FO2A 2B2WC 3J7AF 3GTGB 1FNWA 4K6LA 4CKBA 4BBSB 3VR5A 4CBVA 1TT2A 3KF8A 4NW2A 5K36H 3T53B 5C3EB 2K5WA 1LT5D 1GUTA 2KVMA 3R3OA 5CBEE 3OWEB 2L1BA 5C4XB 4RCNA 5CMDA 3D8GA 3OWFA 1OXVA 2F1MA 2CW0D 1BXTA 3I4NB 2ICIA 3FVQA 5LL6S 4HR7B 5AFWA 4Y7NB 1PLFA 4CJ1B 4LMQD 4ZYSA 4DK0A 1FD7D 3QB3A 3HEJA 1SMYD 4U68A 2IL8A 1FYCA 4QB4A 1HFNA 1KLUD 1QE6A 1J9OA 4MHEA 1R4PB 2F0FA 4DNRB 3HP3A 3QWNA 2KUMA 2F0TA 4F87A 4IUQA 1TIID 3MXGA 5A2QL 4FYDA 4N9PA 3MC0B 1I4GA 2X6GA 5IT9E 1KAAA 3BVMA 3CHBD 1IKLA 2RA4A 4N9TA 3C2PA 2VUMB 1MSGA 4X3TA 2E2IB 3HOUB 1D6EC 3BYTB 1U9RA 3GP7A 5IGCA 3S1NB 3TSSA 4KV6A 2WIIB 1F77A 3KLRA 4A3MB 3NXWA 1QNUA 5C0XH 2EYFA 1EQVA 3T56B 1NCVA 2B2TC 3K5LA 2I07B 5DEHA 3GQBA 3U9SA 3E5SA 1A3TA 3SEBA 5M5YB 2MPMA 3OIQA 3VR2A 1PRTD 3Q22A 1QOHA 1DOKA 1JWMD 4I65A 4A3JB 3M7GA 4HSPA 4C2MB 4XQQA 5KYIA 1OXXK 3R2IA 5ISRA 2KHSA 3L3OC 4Q5VA 2H1EA 1CHQD 3BDCA 1IYUA 3CRKC 4CHTB 5IGEA 5J1ZA 3SK4A 1CA6A 3Q6SA 2DY7A 2RVLA 1BCPB 3O13A 3A54A 2XWJB 2BDNA 1I6HB 2A5HA 5CORA 1Q1BA 4KI0A 2D9UA 2JEAI 1PFMA 3EROA 1GUNA 1PZID 3A7AB 5C3XA 3JAML 2BE5D 2PYKA 5I4DA 3TZUA 2PMZB 2R92B 2B2UC 2JEBI 4OO1H 1PYWD 5C5MA 2RSOA 4H44C 3EQLC 4A3GB 5EBDA 5JVH3 3NQIA 5E3FA 4DXGA 2RQXA 1MBYA 3IL8A 1NUCA 1B44D 1PTOH 2AQ1B 1R4QB 3GTJB 2WKCA 2IWHA 3MWYW 4OGQC 4IUNA 1D5MC 1DOLA 1TKWB 2JA7B 3HOXB 1FGBD 2PCFB 1B9MA 1U4PA 3BZDB 3VA7A 3K7AB 1M8AA 1SBBB 1LT3D 2O4XA 1SFOB 3CRLC 4HMJA 3NBIA 2FFKB 3Q24A 3HS0C 5T1IA 5EKIA 2EYJA 1CA5A 1RD9D 1LT4D 1STBA 1EU4A 2IX1A 1C48A 1IHZA 1S4ZA 3J7YW 1A15A 4J6HA 2WINB 1S5DD 2K01A 3U9OA 3HZXA 3PUXA 2R61A 4RH6A 3I4MB 1G6ZA 2KEEA 1Z7TA 3IFTA 1IW7C 5C3WA 1D5ZC 2DN8A 2EOTA 2EY1A 2G9DA 1RTNA 4H13C 1LTTD 5FO7B 1ZYRC 4EQNA 2KCCA 3NK9A 1VF5C 2AQ3B 3JAME 1ML0D 3I8ZA 2HDLA 1HQMC 2C5CA 5K5PA 4IN3A 1DJRD 2R6GA 5ELFA 5IGBA 5CV5A 5C6AA 1TWCB 1CQVA 3UI2A 2JA5B 4OL7A 1KDCA 3HOWB 5FLXL 2G9HD 3S9WA 4HTHA 4K2KA 1S5FD 1BR9A 3D4RA 3SK6A 2XRQD 1EY7A 4FF2A 2WP8J 4RA8A 4U673 1ICWA 2A74C 1TVXA 1K8OA 2OXPA 4NKLA 1AZQA 1AZPA 3OHXC 3PIP3 1EIHA 2F0GA 1I4XA 3D6CA 1LTSD 4ODGA 2BCOA 1XX8A 2K6AA 1TY2A 4RCOA 3ZYYX 2NZ1D 3K59A 4L6TB 3GTLB 3A8IE 2EJGC 2R93B 5CV8A 4IUUA 5FLXE 2RKSA 5LHY1 1Y8OB 1WTVA 4BY7B 1VMPA 2ZXRA 1Q8IA 2QKIC 5EJWA 1ENFA 5JPNC 1A6XA 3TMEA 3FPUB 1L0XB 2JE6I 4RHSA 4XTCS 3QOLA 3NBHA 1SNPA 2NWGA 1BUVT 1EYAA 5D14A 2JSOA 1E2VA 1CFMA 3ERQA 4B9WA 4K8IA 3VYUA 3C1EA 1CM9A 1DYQA 1WTPA 4KN7C 2MP1A 2KJXA 3BG3A 3NSWA 3PUVA 1YNJC 3VR6A 2NBFA 4HEDA 5IGFA 2EE1A 4NDXA 2FINB 1KLGD 2Z8LA 2WKDA 3AB9A 1BBXC 2J4XA 2E2DC 2JP1A 3I91A 2KA7A 4ZUIA 1EEFD 1E0BA 1SNDA 1PRTC 2RDFA 1EOTA 1SSOA 1Q1EA 4IFDH 5LL6X 4DA2A 3H91A 4KN4C 3QOJA 2BA0A 5JEAG 2PZWA 3PO2B 3HOZB 2VB3X 3EA6A 1ESFA 1BCPF 1KTKA 3DXJC 3NUCA 2C9OA 2LS01 5CV4A 2ENBA 5I6YA 1SYBA 2LMCB 1DXMA 2WV6D 2AUJD 4L8JA 2QCPX 1JCKB 1D5XC 3K57A 1Y8PB 5K36G 2A69D 2PO4A 1HHVA 2EDGA 1I50B 3VYSA 1SNOA 2A6ED 1RHPA 5C5LA 5TSSA 5JJZA 1BCPD 1U4RA 2I46A 2K32A 4IALA 1ILPA 1ENCA 1SDFA 3KK7A 3E0JA 3CQZB 2JA6B 1STAA 1STHA 2QEJC 5EPKA 1A3VA 2PW7A 2PZTA 3ONAB 3MAQA 2WB1B 5JEAJ 4P2CB 4ZK9B 1J8IA 4IUPA 2K05A 2YU9B 3CKIB 2CQAA 2R3ZA 1RDPD 4EVOA 2FHTA 5D65A 2PQEA 4DF7A 1SYDA 4DGZA 1PRTF 5EBCA 5EQ0A 3R93A 1QILA 4ZLTF 1QCBD 3URYA 1ZYRD 3MTSA 4FNFA 4ZRZA 2ZXPA 4RGNA 5ELEA 3NTKA 3GTKB 1M4VA 1JB3A 3GV3A 3I3CA 3OMGA 3DMUA 1PXUA 4YIJA 3M4OB 5A2QE 1GUGA 3SHLA 2L9HA 2N88A 4Q0FA 2R7ZB 2GA4B 2A6EC 4R8IA 1KDAA 1SNCA 1PTOB 1T5EA 5ELDA 2F0QA 1F9QA 1UEAB 3FEWX 1HUMA 3SVMA 4C3JG 5KGUA 2NUCA 2RBMA 3DUZA 1JWSD 2F0MA 3DWAA 1MD2D 2L4NA 1HPCA 1NR4A 4XYQA 2M2LA 2EYHA 1ET6A 4A3IB 3OSOA 3HOVB 3ND9A 1BDOA 3S14B 1XYIA 5KRUA 1ET9A 4BA2I 1B53A 4QMGA 1B50A 5JVG3 3BVGA 3AMUA 2YYZA 2XVSA 3MZ5A 5C0XI 5CV7A 3K5NA 1PZJD 2Z1CA 1A2UA 3D31A 3SR1A 3OW7A 3TP6A 5J22A 1PTOC 3OMCA 4CJ0B 5C44B 2TMPA 5EKLA 3OOCA 4XQJA 3C46A 3K5OA 1B4OA 4HSVA 4ID6A 4H0LC 3DEOA 3J80L 5M3FB 2IW3A 4RKLA 4ZAIA 5BN5A 3S17B 4X3SA 2NVYB 4L63B 3N52A 4C3IG 4HCEA 2EY5A 4MN3A 1II3A 4KY6A 2WAQB 1JC7A 3T13A 3M85A 5EKKA 3SE0A 4V0BA 5F2DA 3H09A 1KNAA 3S2DB 2RDGA 1XXGA 3HRZC 3QJYA 4BWGB 3D4DA 3NP8A 3S2HB 2HUGA 3G6JB 2NVQB 1XTCD 2KCNA 2X69A 2E75C 2F03A 3QG1A 1PZKD 2IX0A 1F9PA 5D3IB 1B1ZA 5IIFA 1EYCA 2B2VA 1HCZA 4UAIA 1ZKOA 1A3UA 2OEOA 1RKNA 4ILWA 2CVRA 2X6LA 1WVLA 1ILQA 2DNEA 1E2ZA 1BO0A 2Q8RE 3PV0A 4A93B 1HRJA 4K6DA 1BQQT 3P1HA 5G3LD 1OO9B 1LLRD 1TY0A 4C3HG 3P20A 2F0UA 1O7YA 2E74C 4HMIA 2B8GA 1AEXA 1STYA 3PUWA 5M5XB 2M00A 1BNZA 4KMUC 5A35A 5C4HA 2IX3A 4FXDA 1X3QA 1KNEA 1QB5D 1Y69U 3H6MA 4HN7A 2FMCA 4PMCA 3I4LA 2VB2X 4ABNA 1LTID 4KY7A 4RHRA 1QG7A 1WD0A 2E76C 3X3NA 3MXPA 3AU7A 4BBRB 2A69C 2AQ2B 1ESRA 2XN9C 1E2WA 1V1PB 1Y8NB 3FMCA 4QUCA 1B3AA 1FR3A 1XWEA 3RZDB 2F3VA 3L9AX 3NE5B 2K28A 4R8NA 2SDFA 3NHHA 3FPPA 5KNBA 4QIWB 5NUCA 1O7LA 5I9OA 3TDQA 5FO9B 1SEBD 4I7ZC 4R9WA 1LTRD 4WFN3 1WTWA 2O5IC 3PUYA 1HQRD 4LAAA 1EFID 1VDZA 2QF7A 5BN4A 2JXMB 5BN3A 4OHJA 3SXHA 4F88A 4PMWA 4KJNA 4C3IB 3MEHA 1TU2B 1G8ZD 1NAPA 1K8MA 5FOBB 3MXNA 1I4HA 2EVBA 3WDNA 1JQYD 4IFDJ 1CHPD 2AWNA 4LK1C 3EVQA 3R2TA 1DM0B 4A3FB 3DM1A 1CZGA 3J81L 1IKMA 4AYBB 1CI3M 1TS4A 4EQOA 2J0TD 3S1RB 1OXSC 2F0IA 1A2TA 4B08A 1WTXA 1GUSA 1T5XD 3T4AC 3GTOB 3GV6A 3HKZB 3D6WA 1V43A 3K0YA 5C0XJ 2A68D 1H9SB 3BDLA 1LV9A 4DAPA 4C3JB 2AWOA 2XWBB 1HTLD 1SE3A 3NTHA 2F0DA 1H9MA 2K5DA 4K5XA 4KKUA 4C3HB 1DD2A 1MGSA 4K14A 3SK5A 1RCVD 2EYOA 3MHBA 1TS5A 4O1NA 2F3WA 3NWSA 1OXUA 2L11A 2KEDA 3RLFA 4GZYC 1SAPA 4A3DB 2EJMA 1IL8A 3W2DA 2V4DA 4G7ZC 4G7HC 1H9JA 4RGOS 4HAEA 5I6WA 1G91A 4F8MA 1EWHA 5CYUA 1EZ8A 2DY8A 4CGYB 3PO3B 1C8CA 3GTQB 3RMHA 5ELBA 5IODA 2F0EA 3X3MA 3TP5A 1SYFA 2LFNA 4WRDA 3I90A 4NP5A 1Z6HA 4XQNA 2Y0SB 1B9NA 5T1GA 1SYCA 4DAVA 3TZDA 4IURA 2ID0A 3DWQA 5IGDA 3IAYA 3DWPA 5ELCA 1PMRA 3A55A 1WTOA 1AW7A 1AFPA 2F0LA 3NPPA 1GHJA 1D1KA 1CQFA 1SYGA 3I70A 1WCMB 1SXTA 3S16B 3DHQA 5HURA 5CC4A 3IKJA 3WOFA 2XNAC 4KD4A 1NR2A 1HFGA 2HDMA 5FO8B 1EWCA 4KJOA 3PIO3 1JORA 5KYLA 5G3LF 1IW7D 3H94A 3P7JA 1S5CD 3S1MB 4IFDG 4C1NK 3TN2A 1UNSA 2L0CA 1I4RA 4G57A 1G291 3BYYB 3KLSA 1ZEQX 1R9TB 4KK7A 3F2UA 1SE4A 2NN6H 4FF1A 1EY8A 4LJZC 4ME5A 2SNSA 1F9RA 3M4YA 2FJ2A 2PNRC 1I4QA 1BOSA 1YNNC 5FKAC 1EY0A 1U4MA 3S1QB 1UUPA 5IOCA 4XT1B 2EPBA 1Z47A 2XIWA 3P75A 3M7NA 2EJFC 1MI2A 2BOSA 4DXFA 1EU3A 3K6OA 4KD3A 3Q0AA 2DNCA 2NN6G 5IGGA 3I73A 4DU9A 1FNVA 2F0PA 4KTAA 5IT9L 1I6VC 1HXYD 1FNUA 5I2YA 1CTMA 3TP7A 5JOBA 3VR4A 2PW5A 3GTMB 2L5TA 2B8FA 3ND8A 1RJTA 4FF4A 2KOLA 4J1MA 5CV6A 2Q8IB 5M9OA 2O2LD 2B39A 2ZXOA 5J39A 5EPJA 2N55A 1JR0D 3I72A 2B2TA 1K83B 2HCIA 3SDZA 3V96A 2OF1A 4KKTA 3H3VC 3D3RA 3KBXA 3RZOB 1WD1A 3S15B 3V2TA 2MGSA 4PV1C 2CW0C 4IUVA 2VNUD 1H9KA 1X32A 1VMCA 1EQTA 3VYRA 4FVMA 2MUYA 4QCLA 5M5WB 5EGTA 1VF7A 4K2LA 2F0HA 2NVXB 1GOZA 2M9VA 1V1OA 3QIAA 2BDOA 5E1FA 1Q90A 4BS9A 4HCSA 1LT6D 1F9SA 4OO1I 4B9XA 4KHZA 2K33A 2EXZA 3SK8A 3LWEA 1STGA 1UAPA 1JOQA 1U4LA 2F0NA 1AN8A 2ICEC 2AUKA 5CGKA 1W6JA 4TQUS 1IYVA 1EY4A 1F2YA 1SNMA 3A56A 5DM63 5FK9C 1LTGD 1GJXA 4Z9CB 2SOBA 2KQ3A 2NN6I 1S5ED 1HTPA 4K8JA 2F4IA 4ZUJA 1GXDC 3HG9A 4TKOB 3BS1A 2F0WA 1G2SA 1LO5D 2F0KA 1STNA 2K5QA 4FXKC 1PRTB 1DONA 4A3EB 1VCIA 1DCZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I65 A;  3NQT A;  4ZQ3 A;  3SK6 A;  3MVV A;  4LAA A;  4G57 A;  4MIU A;  5KYI A;  1EY7 A;  5DAU A;  1F2Z A;  3MZ5 A;  3V2T A;  5I6W A;  5ISR A;  3QB3 A;  2KHS A;  3HEJ A;  5CV7 A;  4K6D A;  3BDC A;  3P1H A;  4EQP A;  2O4X A;  3RUZ A;  5IGF A;  1EY8 A;  1A2U A;  4KHV A;  4QF4 A;  4EVO A;  3SR1 A;  4F8M A;  4NDX A;  4QB4 A;  3SXH A;  4HMJ A;  2PQE A;  2F0U A;  4DFA A;  5IGE A;  5J1Z A;  3SK4 A;  1SNQ A;  3TP6 A;  1EY6 A;  4DF7 A;  4KJN A;  1SYD A;  2SNS A;  4ME5 A;  5CR3 A;  4DGZ A;  3OMC A;  2F0F A;  3MEH A;  1EZ8 A;  4HMI A;  2OXP A;  2F0T A;  2QDB A;  4NKL A;  1AEX A;  1STY A;  2F0V A;  2LKV A;  1F2M A;  5EGT A;  4ZUI A;  1EY5 A;  5JAV A;  4N9P A;  5CV9 A;  2EY6 A;  2M00 A;  4KY5 A;  4TRD A;  5EKL A;  4K2L A;  1JOK A;  1SND A;  5IOD A;  2F0H A;  2EYJ A;  2F0O A;  2RDF A;  5C4H A;  2F0G A;  2F0E A;  5KIX A;  1EY0 A;  1KAA A;  5J22 A;  1STB A;  1JOR A;  3EVQ A;  3H6M A;  3D6C A;  4F7X A;  4E6I A;  5IOC A;  4N9T A;  5E1F A;  3TP5 A;  1SYF A;  4WRD A;  3T16 A;  1ENA A;  4ODG A;  4PMC A;  1IHZ A;  3P75 A;  4NP5 A;  4ID6 A;  2PZU A;  3OMG A;  4B9X A;  5HGT A;  3DMU A;  3QOJ A;  4K5V A;  4YIJ A;  4EQO A;  1SYC A;  3ERO A;  2PZW A;  4PMB A;  4J6H A;  4RKL A;  3SHL A;  2F0I A;  2EXZ A;  5IGD A;  1NSN S;  4PNY A;  1U9R A;  3PMF A;  4KY7 A;  5CV8 A;  1A2T A;  3C1F A;  2EY2 A;  2EYM A;  3HZX A;  4KD3 A;  3U9O A;  1KAB A;  1EZ6 A;  1KDA A;  3NUC A;  3MXP A;  3SK8 A;  5C3X A;  2EY5 A;  1SNC A;  2RKS A;  1STG A;  5IGC A;  5IGG A;  5C3W A;  1II3 A;  2PYK A;  2ENB A;  4KV6 A;  5CV4 A;  4KY6 A;  2EYL A;  1JOO A;  2F0L A;  2EY1 A;  1SYE A;  2F0Q A;  2HQE A;  5I9P A;  1JOQ A;  3T13 A;  1TT2 A;  3NXW A;  2F0N A;  1SYB A;  5I6Y A;  4IZ8 A;  4DU9 A;  5EKK A;  5CGK A;  4H7B A;  2F0P A;  4KTA A;  5C5M A;  1EY4 A;  1F2Y A;  2EYF A;  3BDL A;  1EYD A;  1EQV A;  1SNM A;  5F2D A;  3NK9 A;  3TME A;  4EQN A;  5KGU A;  1SYG A;  2NUC A;  2RBM A;  2F0S A;  2F0M A;  2EYP A;  3TP7 A;  2SOB A;  2KQ3 A;  5JOB A;  2PW5 A;  2F0D A;  4NMZ A;  5KEE A;  5E3F A;  3QOL A;  2F0J A;  5K5P A;  4K8J A;  3D4D A;  3DHQ A;  3NP8 A;  5HUR A;  2EYH A;  1SNO A;  2F3V A;  4K5X A;  4ZUJ A;  1SNP A;  3OSO A;  5IGB A;  4J1M A;  5CV5 A;  5C6A A;  5CV6 A;  5DEH A;  5CC4 A;  1NUC A;  3R3O A;  5M9O A;  5C5L A;  1EYA A;  2F0W A;  2WAC A;  4S3S A;  3E5S A;  4K14 A;  1A3T A;  4KD4 A;  3SK5 A;  2EYO A;  4R8N A;  3ITP A;  1KDB A;  5J39 A;  5KYL A;  4IAL A;  2F0K A;  1STN A;  2SNM A;  1EY9 A;  3D8G A;  1ENC A;  3LX0 A;  3MHB A;  3NHH A;  3OWF A;  3TP8 A;  4KJO A;  5NUC A;  1STA A;  3ERQ A;  4K8I A;  2F3W A;  1TR5 A;  4OL7 A;  4B9W A;  5I9O A;  5KRU A;  1STH A;  1KDC A;  3VA5 A;  5IIF A;  1EYC A;  4IUN A;  4WOR A;  1A3V A;  3S9W A;  4QMG A;  1A3U A;  4HTH A;  1TQO A;  4K5W A;  2PW7 A;  2OEO A;  2PZT A;  3C1E A;  4RKB A;  4K2K A;  3EJI A;  1RKN A;  2OF1 A;  5C4Z A;  3D4W A; 
#chains in the Genus database with same CATH topology
 1GM5 A;  3S2D H;  5M3F G;  4IJL A;  3J80 E;  4MIU A;  1K0S A;  5DAU A;  3A7L A;  1S5B D;  1ROD A;  1B2T A;  1Y1W B;  1PDQ A;  3GD7 A;  2H4O A;  4QF4 A;  3F2C A;  1Q3L A;  1PH9 A;  2Z4H A;  4DFA A;  1HUN A;  1L0Y B;  1TWG B;  1FJG Q;  2D5D A;  2K52 A;  1EY6 A;  4UDU C;  2A73 B;  4DAY A;  1CK1 A;  3B6Y A;  2LKV A;  5JAV A;  2B2Y C;  5M3F H;  4TRD A;  1VQI A;  1SJH D;  2QIL A;  1N8R C;  5DNF A;  5COY A;  2L12 A;  3BDO A;  2EIF A;  4C56 C;  3A0J A;  2JYO A;  1B70 B;  2CWP A;  5IYD H;  1QNK A;  4F7X A;  4DK3 C;  5FLM G;  3UDG A;  1SMY C;  2CHB D;  4CKE A;  5C4J H;  1YNN D;  1X3F A;  1LTB D;  1I3Q B;  2NB0 A;  1Y1V B;  4JI0 L;  2MJ8 A;  2NYZ D;  1WTQ A;  1PTO F;  3KUP A;  3PMF A;  2B63 B;  4P73 A;  1QWY A;  1HR0 L;  1KAB A;  1EZ6 A;  4FP5 D;  4RFB A;  4DV7 Q;  4GLV B;  1D2B A;  2B2U A;  2UUC L;  3I4M H;  3M3Y H;  2HQE A;  3CME A;  1B7Y B;  4IZ8 A;  2XRS D;  4JBW A;  1EYG A;  5D3D A;  1Y1V H;  2TSS A;  3IFD A;  5C4J B;  1BF4 A;  1NY4 A;  5KEE A;  2F0J A;  4A3E H;  4ZKC B;  2B2V C;  2L55 A;  4KKS A;  1NE3 A;  4XXE A;  1SJE D;  1EIG A;  3KLS X;  3Q8D A;  3GO5 A;  2JA8 B;  3ITP A;  1KDB A;  4M8A A;  3K58 A;  4DNT B;  4IQZ A;  1LAB A;  3FRP B;  3KOJ A;  4OWT B;  4AYB E;  2K1B A;  3K7U C;  3PO3 H;  4O0A A;  3CCM A;  1JJC B;  3VR3 A;  4A93 H;  5M5Y H;  2E2J B;  4DV1 Q;  1Q12 A;  1TQO A;  3A8K E;  4K5W A;  4WJW A;  1IZ6 A;  4RKB A;  3W3A A;  3EJI A;  2K04 A;  4A75 A;  3JC6 6;  3IRB A;  4G4K A;  2YTX A;  3NQT A;  4ZQ3 A;  1STE A;  3M4O H;  4RAU C;  2QW7 A;  1G2T A;  2MHV A;  3I7F A;  1HA5 A;  1ZXT A;  2MFI A;  1V1P A;  1ASZ A;  1X3P A;  3E0E A;  3RUZ A;  4KHV A;  1Z9F A;  5IYD G;  4O42 A;  1VQH A;  1LAC A;  2NVT H;  1SNQ A;  2LY7 A;  2NTT A;  1VQN A;  1IBM L;  2B63 G;  1LTA D;  1U0L A;  1O78 A;  4NXM L;  2XTI A;  3VDY A;  4JPB W;  5FJ8 G;  5CV9 A;  2EY6 A;  1Q86 C;  1N33 Q;  4KY5 A;  4JK1 C;  3A74 A;  4BY1 G;  4GOP B;  2F0O A;  4XT3 B;  3A8J E;  2FXQ A;  1TS3 A;  4YHH L;  3T16 A;  1ENA A;  2FMM A;  2CKZ B;  2RDH A;  2IT1 A;  3TRZ A;  1W6K A;  4N8X 1;  4CKC A;  1GUW A;  2JN4 A;  2K14 A;  4PMB A;  4KHP L;  3WOE A;  3EBE A;  4A3L H;  5JEA H;  3G7L A;  4DAM A;  4B3T Q;  4PQX A;  4R4O A;  4JI3 Q;  2MO1 A;  4C3H H;  3G4S A;  5BR8 L;  1CT1 D;  3CC4 A;  2EYL A;  1SYE A;  4PZ6 A;  5E4X A;  2Q2I A;  2K03 A;  3PGZ A;  5C0X G;  1CSQ A;  3RN2 A;  3RZO H;  3RN5 A;  3FKI B;  1H9S A;  4A76 A;  1EEI D;  4BA1 I;  2Q8T A;  4X3U A;  3T1Y L;  4JI2 L;  4FF3 A;  1ASY A;  2Q2T A;  3U4Z A;  2KEC A;  5JJI A;  3QR8 A;  2E2H B;  1IXR A;  2WAC A;  4CDC C;  5IT9 c;  4JI0 Q;  5IWA L;  2J7Z A;  4A3B H;  2VXW A;  1EY9 A;  3TP8 A;  1UE7 A;  5M3M B;  4DK1 A;  2P5Z X;  4JI7 Q;  1O80 A;  5L37 A;  4OIK A;  2R93 H;  2SEB D;  3CPF A;  4OIJ A;  3RD4 A;  5EPL A;  1KIX A;  1TWA B;  2B2W A;  3W1B A;  3NTI A;  4A3F G;  5C44 H;  1YHA A;  1XNQ L;  4GN5 A;  3W5O A;  2IPK D;  1YNJ D;  1N9W A;  4A3I H;  2OT2 A;  4QUF A;  1I6H H;  5C4Z A;  3D4W A;  4X3K A;  1V8Q A;  3MXU A;  3C3L A;  1I4P A;  3EFX D;  4ULL A;  2ZTD A;  2RHS B;  3VYT A;  3GTP H;  2D2C C;  2K7V A;  3QO2 A;  4IPG A;  3HGB A;  3CC7 A;  4GNX B;  4C3I H;  1JWU D;  4EGV A;  3ERS X;  4E6I A;  2BE5 C;  4DR5 L;  2EZV A;  1KL9 A;  1IBK L;  3HOV H;  4HIO A;  3UE1 A;  1BCP C;  3BVZ A;  3G6E A;  4RGM A;  2HIV A;  1H9R A;  1PFB A;  5CBA E;  1JIC A;  1EY5 A;  3OIP A;  1AP0 A;  1NNX A;  2HD3 A;  4RGT A;  1A8V A;  1BBU A;  3WWV A;  1TWH B;  1Q82 C;  4NXM Q;  3EN2 A;  3Q23 A;  3RZD H;  1T9H A;  4DR7 Q;  3ZJY C;  1F2L A;  5FLM H;  3MA2 B;  3J7A V;  5I2X A;  3CCR A;  4IFD I;  3SGI A;  2PZU A;  4XDX A;  4M1U B;  4QIW E;  1XMO L;  4LFB L;  4J8Q A;  3CCS A;  4A3B B;  4JBM A;  5GQO A;  2NVQ H;  4JYA Q;  3E6Z X;  3CMA A;  1CZW A;  4RWS C;  1NSN S;  1PYS B;  2YTV A;  4PNY A;  1GUO A;  1EL0 A;  5LMN L;  3C1F A;  2EY2 A;  2EYM A;  1RF2 D;  3LNN A;  3CU7 A;  2HCC A;  5KNC A;  3J81 E;  3MFY A;  2XSC A;  1JOO A;  1UE6 A;  5I9P A;  4JCV E;  2MQH A;  1HA6 A;  5M3M H;  4X62 Q;  3KDF B;  1ONL A;  4DN4 M;  3M3Y B;  4H7B A;  3UDX A;  3TBI B;  5IY0 A;  1EYD A;  1WTR A;  4GN4 B;  1RTO A;  4LF7 Q;  3GTP B;  4IUT A;  2D62 A;  2GVA A;  2F0S A;  1HZC A;  2EYP A;  3HOW H;  3NEM A;  2Z4I A;  4B3R L;  3T51 B;  4CJ2 C;  4NMZ A;  3V05 A;  5IYC H;  1DOM A;  2PPB C;  2RSN A;  2CH4 W;  4G7O C;  4A3K H;  2NVY H;  2ZT9 C;  2A68 C;  4ME3 A;  3MFG A;  1NJI C;  2BA1 A;  4S3S A;  3R8B A;  1G51 A;  3HOZ G;  2SNM A;  3LWU A;  3LX0 A;  2IJ0 A;  4OON A;  1TWF B;  4JW0 A;  5JPM C;  1PFN A;  1TR5 A;  3VA5 A;  1C4Q A;  4TSS A;  4WOR A;  3H0G B;  1MSH A;  3DEP A;  4JI7 L;  3OTO Q;  3NWT A;  4DV0 L;  5KND A;  2A6H C;  1D1I A;  1OXT A;  2Y0S G;  4BY1 B;  4A3K B;  3MVV A;  3T1H L;  1JE4 A;  1F2Z A;  1K0R A;  1SFO H;  1GHK A;  4OO1 G;  2YU9 H;  4C1N I;  4EQP A;  1M1K C;  4V19 0;  2NTS A;  3PSI A;  1JMC A;  3OPO A;  3BZC A;  5CR3 A;  4XYO A;  2A6H D;  3L7Z C;  3KLW A;  1RL2 A;  1SE2 A;  2QDB A;  1S72 A;  2C35 B;  2F0V A;  1JT8 A;  1F2M A;  5E4W C;  3HOY B;  4A3B G;  3N6R A;  1PTO D;  1JOK A;  4DV4 Q;  4LF6 Q;  4L5R C;  4XIG S;  1CUK A;  1I94 Q;  5KIX A;  4DUZ Q;  4ZKB B;  3GTJ H;  3KBG A;  3PQI A;  4LF8 Q;  2NVT B;  2B2Y A;  2KCM A;  3PUZ A;  5AJ3 L;  1QJO A;  3FDT A;  4FXG C;  3K5M A;  4JI5 Q;  1O7Z A;  2PQA B;  4P71 A;  5DM7 3;  5HGT A;  1I50 H;  2O5J C;  1DZ1 A;  4K5V A;  2UXB L;  1TS2 A;  4FO2 A;  2B2W C;  5DLQ E;  1VQ9 A;  3J7A F;  4JV5 L;  1KC8 C;  3GTG B;  1FNW A;  4K6L A;  4CKB A;  4BBS B;  5IYC G;  3VR5 A;  4X64 Q;  1PA6 A;  5EAY A;  5IE8 A;  1PV4 A;  4CBV A;  1TT2 A;  2ASB A;  3KF8 A;  4NW2 A;  2E8G A;  5K36 H;  3FP9 A;  3T53 B;  3UE0 A;  3H3V I;  5C3E B;  4DV5 L;  2K5W A;  4JI2 Q;  4DV0 Q;  4DR7 L;  1LT5 D;  4UY8 C;  1GUT A;  2KVM A;  2R92 H;  3R3O A;  5CBE E;  3OWE B;  2L1B A;  5C4X B;  4RCN A;  3CCJ A;  1WJJ A;  5CMD A;  4DV6 Q;  3D8G A;  3OWF A;  1OXV A;  2F1M A;  4HID A;  2CW0 D;  1BXT A;  4GOP C;  1MHW C;  3I4N B;  2ICI A;  3DM3 A;  3FVQ A;  5LL6 S;  4HR7 B;  1XNQ Q;  5AFW A;  4Y7N B;  1PLF A;  4CJ1 B;  2E2H H;  3TRE A;  4DUY Q;  4LMQ D;  3CD6 A;  4ZYS A;  5GAE C;  4DK0 A;  2VY3 A;  5H1S E;  1VQ8 A;  1FD7 D;  3QB3 A;  3HEJ A;  1SMY D;  4U68 A;  2ZM6 Q;  2IL8 A;  1FYC A;  1XTD A;  2DJF C;  4QB4 A;  1HFN A;  1KLU D;  1QZH A;  3KF6 B;  1QE6 A;  1J9O A;  1YHB A;  4MHE A;  1R4P B;  2F0F A;  4DNR B;  1W2B A;  3HP3 A;  3QWN A;  4GNX A;  2KUM A;  1K8A C;  1HZA A;  2F0T A;  4F87 A;  4IUQ A;  5IYB H;  1TII D;  1SN8 A;  2Z6B A;  3MXG A;  5A2Q L;  4FYD A;  4N9P A;  4WJ4 A;  3MC0 B;  1I4G A;  1VQE A;  2X6G A;  5IT9 E;  3OW2 A;  4A3I G;  1AE2 A;  4YHH Q;  1FGU A;  1KAA A;  3BVM A;  4A3F H;  3CHB D;  1IKL A;  2RA4 A;  4N9T A;  1LM0 A;  1VQ4 A;  3C2P A;  2ZJP A;  2VUM B;  1MSG A;  5C3E H;  4X3T A;  4WJ3 M;  2E2I B;  3S1R H;  2R93 G;  1PH4 A;  4DUY L;  3HOU B;  1D6E C;  1XNR L;  1X65 A;  3BYT B;  1WCM H;  1VQ7 A;  1U9R A;  3K0X A;  1L1O B;  1VQG A;  3GP7 A;  5IGC A;  3S1N B;  3TSS A;  4DR2 Q;  3PIP A;  4KV6 A;  1UWV A;  2WII B;  1F77 A;  3KLR A;  3TS2 A;  4A3M B;  4BY7 H;  3NXW A;  1QNU A;  5C0X H;  1XNR Q;  2EYF A;  1QUQ A;  1EQV A;  1N32 Q;  1XPO A;  2I5H A;  3T56 B;  4LFA L;  1NCV A;  2B2T C;  1EIY B;  3K5L A;  2F4V L;  2I07 B;  4DR3 L;  5DEH A;  3GQB A;  4YCW A;  3U9S A;  3E5S A;  1A3T A;  1Y14 B;  1E3P A;  4LF4 Q;  3SEB A;  4DPG A;  2E2J H;  5M5Y B;  2MPM A;  3OIQ A;  3PCO B;  3VR2 A;  1HZ9 A;  4CDF C;  1PRT D;  3Q22 A;  2OQ0 A;  4LFC Q;  1QOH A;  1DOK A;  1JWM D;  1HR0 Q;  2R7Z G;  3K80 C;  5FLX c;  4A3G G;  4I65 A;  4A3J B;  3M7G A;  4KLK A;  1HR0 W;  4HSP A;  4C2M B;  4XQQ A;  5KYI A;  2AMC B;  1OXX K;  3R2I A;  4BY1 H;  5ISR A;  3L3O C;  2KHS A;  4Q5V A;  2H1E A;  1CHQ D;  3BDC A;  3U58 A;  1IYU A;  4PZ7 A;  1C0A A;  4DR1 Q;  3S17 H;  3CRK C;  4CHT B;  5IGE A;  3EIV A;  5J1Z A;  3CCU A;  3SK4 A;  1CA6 A;  1EFW A;  3Q6S A;  2DY7 A;  2RVL A;  3J7A 5;  1BCP B;  2UU9 Q;  3O13 A;  2JA6 H;  1SLJ A;  3A54 A;  2XWJ B;  5IP9 G;  2B29 A;  1PH1 A;  1OTC A;  2BDN A;  3PF4 A;  4X66 Q;  4X6A H;  1I6H B;  3E9H A;  2A5H A;  5COR A;  1Q1B A;  4KI0 A;  1M90 C;  2D9U A;  4DAY B;  2JEA I;  4A93 G;  4IO9 A;  1I3Q H;  1X56 A;  1YJ9 A;  1PFM A;  4YCU A;  1I5F A;  3ERO A;  4GKK L;  1GUN A;  1PZI D;  5C4X G;  3I4N H;  3A7A B;  2NZH A;  5C3X A;  3JAM L;  4A3E G;  2BE5 D;  1B3Q A;  2PYK A;  4MTN A;  1YI2 A;  5I4D A;  3TZU A;  1K83 H;  1VQC A;  2PMZ B;  3MEF A;  2Q2U A;  2R92 B;  2AHO B;  2B2U C;  2JEB I;  4OO1 H;  4C2M H;  1PYW D;  5C5M A;  2RSO A;  2CWA A;  4H44 C;  4EX5 A;  1Y1W H;  3EQL C;  4A3G B;  4MNO A;  5EBD A;  5JVH 3;  1SMX A;  3NQI A;  4BXX G;  1ICF B;  2DUD A;  5E3F A;  1K8G A;  4DXG A;  2VQF Q;  2RQX A;  2OQK A;  1MBY A;  3IL8 A;  1JJG A;  1HNX L;  1NUC A;  3U50 C;  1B44 D;  1PTO H;  4LF5 L;  2AQ1 B;  1R4Q B;  1VQM A;  1NMF A;  4A3C H;  3GTJ B;  2WKC A;  2IWH A;  3MWY W;  4OGQ C;  4IUN A;  1D5M C;  3BU2 A;  1KD1 C;  1DOL A;  1C7Y A;  3S1N H;  1X55 A;  4AH6 A;  1TKW B;  2QGQ A;  2JA7 B;  3HOX B;  2JA7 H;  1FGB D;  2PCF B;  1K73 C;  1B9M A;  1U4P A;  3BZD B;  2PI2 E;  2F3I A;  2JA5 G;  3VA7 A;  4DV3 Q;  3K7A B;  1M8A A;  4ZCK A;  1GD7 A;  1SBB B;  3AQQ A;  3W1G A;  1LT3 D;  2O4X A;  1SFO B;  3CRL C;  4HMJ A;  3NBI A;  3HOX H;  2FFK B;  2AKW B;  1X54 A;  3Q24 A;  1XMO Q;  3HS0 C;  2E2I H;  1PH6 A;  4CDD C;  5T1I A;  2HT1 A;  1CKN A;  5EKI A;  2EYJ A;  1CA5 A;  1RD9 D;  1LT4 D;  1STB A;  4JI5 L;  1EU4 A;  2IX1 A;  1C48 A;  1IHZ A;  1VQB A;  4I7A A;  3F2B A;  1S4Z A;  3J7Y W;  5M3M G;  1XMQ L;  2UXD Q;  1A15 A;  4GN3 B;  4R4C A;  4J6H A;  2WIN B;  1EQQ A;  1S5D D;  2K01 A;  1EUJ A;  3U9O A;  3HZX A;  1GVP A;  3PUX A;  2R61 A;  4RH6 A;  3I4M B;  1G6Z A;  2KEE A;  1Z7T A;  2VQF L;  3IFT A;  3E9I A;  1IW7 C;  5C3W A;  4B3R Q;  1QUQ B;  1D5Z C;  2DN8 A;  2EOT A;  2EY1 A;  2G9D A;  4R1J A;  2PNH A;  1RTN A;  1UEB A;  4H13 C;  1LTT D;  4JYA L;  5FO7 B;  3J81 j;  1ZYR C;  4EQN A;  2KCC A;  3NK9 A;  1VF5 C;  2AQ3 B;  1WTH A;  3JAM E;  1ML0 D;  1MJE A;  3I8Z A;  2HDL A;  2NVX H;  1RIP A;  1HQM C;  2C5C A;  3J81 i;  4POG A;  4R4Q A;  5K5P A;  4IN3 A;  1DJR D;  4HJ8 A;  2R6G A;  5ELF A;  5IGB A;  5CV5 A;  5C6A A;  1TWC B;  1CQV A;  3UI2 A;  1N36 Q;  3S14 H;  4R4T A;  2JA5 B;  5C4X H;  4BY7 G;  4OL7 A;  4AYB G;  1KDC A;  3HOW B;  5FLX L;  4DR5 Q;  2G9H D;  3S9W A;  4HTH A;  1L0W A;  4BBS H;  4AIM A;  4K2K A;  3H3V H;  1S5F D;  1BR9 A;  3D4R A;  3SK6 A;  2XRQ D;  4IPC A;  3BJU A;  1EY7 A;  2Z6K A;  5C44 G;  2H5X A;  2F4V Q;  4X62 L;  4DV2 Q;  4FF2 A;  3H0G G;  2WP8 J;  4RA8 A;  1SRO A;  4U67 3;  1ICW A;  2A74 C;  1TVX A;  3I4N G;  3AYH B;  1K8O A;  4JC0 A;  5GAG C;  2OXP A;  4NKL A;  1PH2 A;  5IWA Q;  1AZQ A;  4OEM B;  1TWA H;  1AZP A;  3OHX C;  3PIP 3;  1EIH A;  2F0G A;  1I4X A;  3D6C A;  4NB3 A;  3M9B A;  1E1T A;  1LTS D;  4ODG A;  2VUM H;  2BCO A;  1XX8 A;  4A3M H;  1YNX A;  2K6A A;  1QVC A;  1TY2 A;  3MXN B;  4X65 L;  4RCO A;  3ZYY X;  2NZ1 D;  1P8L A;  3K59 A;  3HOY G;  4GKK Q;  1Q7Y C;  4L6T B;  3GTL B;  2OTL A;  3A8I E;  2EJG C;  4LNQ A;  2R93 B;  2K50 A;  4HJA A;  5CV8 A;  4IUU A;  4LF9 Q;  4GKJ L;  5FLX E;  2RKS A;  5LHY 1;  1Y8O B;  5BR8 Q;  1WTV A;  4BY7 B;  1VMP A;  2ZXR A;  4LFA Q;  2RHQ B;  2VW9 A;  1Q8I A;  1TWF H;  2QKI C;  5EJW A;  5ELN A;  2A8V A;  1ENF A;  5JPN C;  3HOY H;  1A6X A;  3TME A;  3FPU B;  3UDF A;  2OWO A;  1L0X B;  4GLX A;  2JE6 I;  4RHS A;  4YWL A;  3TEH B;  4XTC S;  3CCE A;  2ZTC A;  3I2Z A;  3QOL A;  1WOC A;  1AE3 A;  1XPU A;  1TXY A;  3NBH A;  4DR1 L;  1SNP A;  2N78 A;  2NWG A;  1BUV T;  1EYA A;  4P72 A;  2KHI A;  1VQA A;  5D14 A;  2VZA A;  2JSO A;  1E2V A;  1CFM A;  3ERQ A;  4B9W A;  4J15 A;  4K8I A;  1CKO A;  3VYU A;  4DNI A;  3NEN A;  3H0G H;  2B3G A;  1CM9 A;  1DYQ A;  3C1E A;  1WTP A;  4KN7 C;  3TQY A;  2MP1 A;  3S24 A;  2KJX A;  2GN5 A;  3BG3 A;  3NSW A;  3PUV A;  1VQ5 A;  1YNJ C;  4JBJ A;  4KHP Q;  4P75 A;  4JI8 L;  3VR6 A;  2NBF A;  4HED A;  1MIU A;  5IGF A;  2EE1 A;  4NDX A;  1KRT A;  3GTO H;  2FIN B;  1KLG D;  2Z8L A;  3I4M G;  4DV1 L;  5HGQ A;  2WKD A;  2UUA Q;  4OEL B;  3AB9 A;  4NPS A;  1BBX C;  2J4X A;  1VS0 A;  2E2D C;  1IYJ B;  2JP1 A;  3I91 A;  5C3E G;  2CCZ A;  2KA7 A;  4ZUI A;  3JAM i;  1EEF D;  1E0B A;  2PMZ E;  1SND A;  1VQK A;  1PRT C;  2RDF A;  3RLO A;  4X64 L;  1EOT A;  1SSO A;  3CCV A;  1Q1E A;  4PZ8 A;  4IFD H;  3ULL A;  5LL6 X;  2UUA L;  4DA2 A;  2YV5 A;  3H91 A;  1BVS A;  4KN4 C;  1KQS A;  3QOJ A;  4DK6 C;  5IYB G;  2BA0 A;  5JEA G;  2PZW A;  1V9P A;  4A3L G;  3HOZ B;  2VB3 X;  3EA6 A;  1IL2 A;  3PO2 B;  1ESF A;  1KRS A;  1NTG A;  2KHJ A;  4H02 A;  1BCP F;  1KTK A;  3DXJ C;  3GTQ H;  3NUC A;  5GRO A;  2C9O A;  2LS0 1;  2N49 A;  5CV4 A;  2ENB A;  2UUB Q;  5JJL A;  2LXJ A;  5I6Y A;  1SYB A;  2LMC B;  4UPA A;  1P16 A;  1DXM A;  2WV6 D;  2AUJ D;  4L8J A;  5JJK A;  1VQL A;  2QCP X;  2WFW A;  1JCK B;  2XGT A;  2B63 H;  1D5X C;  3K57 A;  1Y8P B;  2UUC Q;  5K36 G;  2A69 D;  2PO4 A;  1HHV A;  2EDG A;  1I50 B;  5IP7 H;  3VYS A;  1SNO A;  2A6E D;  4DR6 L;  1RHP A;  4A3D H;  5C5L A;  3STB C;  5TSS A;  5JJZ A;  1BCP D;  1U4R A;  2I46 A;  2K32 A;  4IAL A;  1ILP A;  1ENC A;  1SDF A;  3KK7 A;  3E0J A;  3CQZ B;  2JA6 B;  1STA A;  3DLL A;  1STH A;  4L5Q A;  2QEJ C;  4HJ9 A;  1A0I A;  4K0K Q;  4JBK A;  5EPK A;  1A3V A;  3ICE A;  1FJG L;  4MTK A;  2PW7 A;  2PZT A;  3ONA B;  3MAQ A;  2WB1 B;  2Q2H A;  5JEA J;  4P2C B;  4ZK9 B;  1XPR A;  1J8I A;  3KFU A;  3AFQ A;  2UXD L;  2R7F A;  4IUP A;  2K05 A;  3F1Z A;  2YU9 B;  3L0O A;  3CKI B;  2CQA A;  2R3Z A;  1RDP D;  4L5T A;  1U5K A;  1MKH A;  4X65 Q;  3S1M H;  4EVO A;  4Y52 H;  2FHT A;  5D65 A;  2PQE A;  4DF7 A;  1SYD A;  4DGZ A;  4APV A;  1YVC A;  1PRT F;  4POF A;  5EBC A;  1YIJ A;  3D0F A;  5EQ0 A;  1HH2 P;  3PO2 G;  3R93 A;  1QIL A;  4ZLT F;  1QCB D;  3URY A;  1E24 A;  1ZYR D;  4A3J H;  3MTS A;  3CQZ H;  4FNF A;  1YEZ A;  2UUB L;  4ZRZ A;  2ZXP A;  4RGN A;  5ELE A;  5ELO A;  5AJ3 Q;  3NTK A;  3GTK B;  1M4V A;  3ULP A;  4UP8 A;  1JB3 A;  3GV3 A;  3I3C A;  3OMG A;  1K3B C;  3DMU A;  1PXU A;  4YIJ A;  2MNA A;  3M4O B;  5A2Q E;  1GUG A;  3SHL A;  4QL5 A;  2KEN A;  2L9H A;  2N88 A;  4Q0F A;  2R7Z B;  1LUZ A;  2A6E C;  2GA4 B;  2HIX A;  4R8I A;  1KDA A;  1SNC A;  1QZG A;  1PTO B;  1T5E A;  5ELD A;  2F0Q A;  1F9Q A;  1UEA B;  3FEW X;  2Y0S E;  3NBH B;  1HUM A;  3SVM A;  4C3J G;  2IHF A;  5KGU A;  1HNX Q;  2NUC A;  2RBM A;  3DUZ A;  1JWS D;  2F0M A;  3DWA A;  1MD2 D;  2L4N A;  1HPC A;  1NR4 A;  4XYQ A;  2M2L A;  5HY6 A;  4JI6 L;  2EYH A;  3ER0 A;  1ET6 A;  3J7Z C;  4A3I B;  3OSO A;  3HOV B;  3ND9 A;  1NBW A;  1BDO A;  3S14 B;  1A63 A;  1XYI A;  2JA8 G;  1HJP A;  3KF6 A;  5KRU A;  4UP9 A;  1ET9 A;  4BA2 I;  1B53 A;  1A62 A;  1XJV A;  4QMG A;  1B50 A;  2CFM A;  3S2H H;  5JVG 3;  1HNW Q;  1PVO A;  1Q46 A;  3BVG A;  1SE8 A;  3AMU A;  1N32 L;  2VQE L;  2YYZ A;  2EQS A;  2XVS A;  3MZ5 A;  3HOX G;  5C0X I;  4A3M G;  5CV7 A;  1PH8 A;  3K5N A;  4A3G H;  1PZJ D;  2Z1C A;  4P74 A;  1A2U A;  3D31 A;  2F52 A;  3SR1 A;  3OW7 A;  3TP6 A;  5J22 A;  1PTO C;  3OMC A;  4CJ0 B;  5C44 B;  2TMP A;  3HFZ B;  4HJ7 A;  5FJ8 H;  5EKL A;  3OOC A;  4XQJ A;  3PIO A;  3C46 A;  2D0P A;  2QA4 A;  3FKI H;  1VQO A;  4YY3 Q;  3K5O A;  1B4O A;  4HSV A;  1E22 A;  4A3C G;  4ID6 A;  4H0L C;  4AQY Q;  1YIT A;  4OX9 L;  3DEO A;  3J80 L;  5M3F B;  2IW3 A;  4RKL A;  4ZAI A;  5BN5 A;  4JI1 Q;  3S17 B;  4X3S A;  2NVY B;  4L63 B;  3HKZ E;  4IPH A;  3N52 A;  4C3I G;  4HCE A;  4BBS G;  2EY5 A;  4MN3 A;  3CCQ A;  1II3 A;  1PH7 A;  4KY6 A;  2WAQ B;  1JC7 A;  3T13 A;  2ATW A;  3M85 A;  5EKK A;  3JAM c;  3SE0 A;  4V0B A;  1YJN A;  1VQF A;  4X66 L;  5F2D A;  3H09 A;  1KNA A;  3S2D B;  2RDG A;  1XXG A;  3HRZ C;  2HQL A;  1GO3 E;  3QJY A;  3K8A A;  4CDE C;  1SRU A;  4BWG B;  4BBR G;  3D4D A;  3NP8 A;  3S2H B;  1QVF A;  4LF9 L;  2HUG A;  1NMG A;  3G6J B;  2NVQ B;  1XTC D;  2KCN A;  2X69 A;  2E75 C;  2F03 A;  3QG1 A;  1PZK D;  1L2F A;  2IX0 A;  2E5L L;  1F9P A;  1N34 Q;  5D3I B;  1B1Z A;  5IIF A;  1IBM Q;  1EYC A;  2B2V A;  1HCZ A;  2PQA A;  4UAI A;  1ZKO A;  1A3U A;  2PI2 A;  4DV5 Q;  2OEO A;  1RKN A;  5LMU Q;  1N34 L;  4ILW A;  2CVR A;  2E5L Q;  2UXC L;  2OTJ A;  4UP7 A;  2X6L A;  1WVL A;  1ILQ A;  4YCV A;  2DNE A;  1E2Z A;  1BO0 A;  2Q8R E;  3PV0 A;  4A93 B;  1VQP A;  1KXL A;  1HRJ A;  4K6D A;  1BQQ T;  3P1H A;  4DR3 Q;  5G3L D;  1OO9 B;  1X3G A;  1LLR D;  1TY0 A;  4C3H G;  3P20 A;  2F0U A;  1O7Y A;  3G71 A;  2E74 C;  4HMI A;  2B8G A;  4JI3 L;  1AEX A;  1STY A;  3PUW A;  2K75 A;  5M5X B;  4LW1 A;  2M00 A;  1BNZ A;  5GAD C;  4KMU C;  5A35 A;  5C4H A;  2IX3 A;  4FXD A;  1X3Q A;  1KNE A;  2R92 G;  1QB5 D;  1Y69 U;  3H6M A;  4HN7 A;  3I55 A;  4JV5 Q;  2FMC A;  2ZM6 L;  4PMC A;  3I4L A;  2VB2 X;  4ABN A;  1HNZ L;  2QDL A;  1CKN B;  1LTL A;  4IPD A;  1K28 A;  3CXC A;  1LTI D;  3PO3 G;  2JA7 G;  1E7Z A;  3KJP A;  4KY7 A;  4OXP A;  4RHR A;  4AQY L;  1QG7 A;  1WD0 A;  1PH5 A;  2E76 C;  3X3N A;  1R9T H;  3MXP A;  1VQJ A;  4NXN Q;  3AU7 A;  2A19 A;  4BBR B;  2A69 C;  1JE5 A;  1YJW A;  2AQ2 B;  1ESR A;  2XN9 C;  1E2W A;  1V1P B;  3STB D;  1Y8N B;  3S15 H;  2MO0 A;  3FMC A;  4QUC A;  1B3A A;  4DR4 Q;  1FR3 A;  3A5U A;  1XWE A;  5LMU L;  3GTL H;  1KAW A;  1FL0 A;  3KF8 B;  4DV7 L;  3NEL A;  2HHH L;  4QGU A;  3RZD B;  2F3V A;  3L9A X;  3NE5 B;  4DV3 L;  3T1H Q;  2K28 A;  4R8N A;  2SDF A;  3PO2 H;  3NHH A;  2CQO A;  3FPP A;  5KNB A;  4QIW B;  5NUC A;  1O7L A;  5I9O A;  3TDQ A;  1PHJ A;  4IOC A;  5FO9 B;  3PF5 A;  1SEB D;  2Z9H A;  4I7Z C;  4R9W A;  1LTR D;  1UE5 A;  1HNW L;  4WFN 3;  1WTW A;  3FKI G;  2O5I C;  2JK8 A;  4DV4 L;  4LF6 L;  3PUY A;  1HQR D;  3CPW A;  4LAA A;  1PH3 A;  1EFI D;  4OWX B;  1VDZ A;  2QF7 A;  5BN4 A;  3J80 c;  2JXM B;  3GTG H;  4MZ9 A;  5BN3 A;  4OHJ A;  3SXH A;  3S1Q H;  4F88 A;  4PMW A;  4KJN A;  4C3I B;  3MEH A;  4GOP A;  1TU2 B;  1G8Z D;  1NAP A;  1K8M A;  5FOB B;  3MXN A;  1I4H A;  2EVB A;  3WDN A;  1JQY D;  4IFD J;  1EWI A;  1CHP D;  3TS0 A;  4A3D G;  1X6O A;  2AWN A;  4LK1 C;  2Z0S A;  3EVQ A;  3R2T A;  5IP7 G;  1DM0 B;  4A3F B;  3DM1 A;  1CZG A;  3J81 L;  4JI4 Q;  1IKM A;  1EIF A;  4AYB B;  4JVZ A;  4LUV A;  1QVG A;  2DGY A;  3HOW G;  4DUZ L;  3GTK H;  1CI3 M;  2JA8 H;  1TS4 A;  1SR3 A;  1WFQ A;  2LXK A;  2J0T D;  4EQO A;  3HOU H;  3S1R B;  1JJ2 A;  1OXS C;  2F0I A;  2UXB Q;  1A2T A;  2WAQ E;  4B08 A;  4FDB A;  4HIK A;  3F8T A;  1WTX A;  1GUS A;  5M5W H;  1T5X D;  2CH4 A;  3T4A C;  4QJF A;  3GTO B;  4B3S L;  3GV6 A;  3HKZ B;  3D6W A;  1V43 A;  3K0Y A;  5C0X J;  1LYL A;  2K4K A;  1GKH A;  3KYH C;  2A68 D;  1H9S B;  3BDL A;  1LV9 A;  4DAP A;  2RCF A;  4C3J B;  2AWO A;  2XWB B;  1HTL D;  1SE3 A;  3NTH A;  2F0D A;  3RR5 A;  1D8L A;  1J5E L;  1H9M A;  2K5D A;  4K0K L;  4O2D A;  2LSS A;  4K5X A;  4KKU A;  5LMN Q;  4C3H B;  2IY5 B;  1DD2 A;  1MGS A;  4K14 A;  3SK5 A;  1RCV D;  2EYO A;  3MHB A;  5LMN W;  1TS5 A;  2K5N A;  4O1N A;  2F3W A;  3NWS A;  1L1O C;  1OXU A;  2Z6K C;  2ZTE A;  4YWM A;  4NXN L;  2L11 A;  3OTO L;  3ULJ A;  2KED A;  1Y1W G;  4JI6 Q;  2N8N A;  3RLF A;  1Q81 C;  4GZY C;  1SAP A;  1WCM G;  4LF4 L;  4A3D B;  2EJM A;  1IL8 A;  3W2D A;  2V4D A;  3CW2 C;  4HJ5 A;  4G7Z C;  3K81 C;  4G7H C;  4LFB Q;  4A3J G;  1H9J A;  4RGO S;  4HAE A;  5I6W A;  1G91 A;  1IBK Q;  2WB1 G;  3J81 c;  3GDE A;  2D0O A;  4F8M A;  1FVI A;  1VQD A;  1EWH A;  5CYU A;  1EZ8 A;  2DY8 A;  3AEV A;  4CGY B;  3PO3 B;  1C8C A;  1JB7 A;  3GTQ B;  3RMH A;  1X9N A;  5ELB A;  5IOD A;  1TWH H;  2F0E A;  3X3M A;  2ES2 A;  1PYB A;  3TP5 A;  1SYF A;  2LFN A;  4WRD A;  4B3T L;  1G6P A;  2OCE A;  2N3S A;  3I90 A;  1YBY A;  3F2D A;  4NP5 A;  1K3R A;  1VQ6 A;  1N33 L;  4DR4 L;  1Z6H A;  4XQN A;  2JA6 G;  2Y0S B;  1B9N A;  5T1G A;  4PG3 A;  1SYC A;  4DAV A;  3TZD A;  4IUR A;  3HOU G;  2ID0 A;  3DWQ A;  2G5D A;  2KBN A;  5IGD A;  2NZO A;  3IAY A;  4B3M Q;  3DWP A;  5ELC A;  1PMR A;  3A55 A;  1WTO A;  1B8A A;  3T1Y Q;  4RMF A;  1AW7 A;  1AFP A;  2F0L A;  3NPP A;  4LUZ A;  4QY7 A;  1GHJ A;  2UXC Q;  1D1K A;  5E7N A;  1CQF A;  1HZB A;  1SYG A;  3I70 A;  4L5S A;  1WCM B;  1HNZ Q;  2WAQ G;  1YZ6 A;  1E1O A;  1SXT A;  3S16 B;  4EQ5 A;  3DHQ A;  5HUR A;  3CF5 A;  2RCN A;  2R7Z H;  4R4I A;  3E3X A;  5CC4 A;  3IKJ A;  3WOF A;  2XNA C;  3OYY A;  1YHQ A;  4KD4 A;  2JA5 H;  1NR2 A;  1HFG A;  4LUO A;  4YWK A;  2HDM A;  5FO8 B;  1EWC A;  4IOA A;  4KJO A;  4GNX C;  3PIO 3;  4LF7 L;  1JOR A;  5KYL A;  5G3L F;  1IW7 D;  3H94 A;  2KCT A;  3P7J A;  1S5C D;  4DR2 L;  3S1M B;  4IFD G;  4C1N K;  3TN2 A;  1MJC A;  4JOI A;  3S16 H;  1UNS A;  2L0C A;  1I4R A;  4G57 A;  1G29 1;  3BYY B;  2WB1 E;  1IBL Q;  3KLS A;  1ZEQ X;  1R9T B;  4GLA C;  4KK7 A;  1D7Q A;  3F2U A;  1EQR A;  1SE4 A;  2NN6 H;  4FF1 A;  1EY8 A;  4GKJ Q;  4LJZ C;  4QQB X;  3I4O A;  4ME5 A;  2SNS A;  1F9R A;  2IHE A;  3M4Y A;  3KJO A;  2FJ2 A;  2I5L X;  3M4Q A;  1IBL L;  1X3E A;  4ALP A;  2PNR C;  1WI5 A;  4OX9 Q;  2JQO A;  1I4Q A;  2GVB A;  1BOS A;  4RG1 A;  1YNN C;  1CSP A;  2RF4 A;  5FKA C;  1EY0 A;  2UU9 L;  1U4M A;  3S1Q B;  1UUP A;  5IOC A;  4N8F A;  4DV2 L;  4XT1 B;  3HKS A;  2EPB A;  1Z47 A;  2XIW A;  3P75 A;  3M7N A;  2EJF C;  1MI2 A;  2ALY B;  4JG2 A;  2BOS A;  4DXF A;  4JI8 Q;  4A4I A;  1EU3 A;  3J80 i;  3LGJ A;  3K6O A;  4KD3 A;  3Q0A A;  2DNC A;  1PFS A;  3GTM H;  2NN6 G;  5IGG A;  3I73 A;  4B3M L;  4LFC L;  3RNU A;  4DU9 A;  1FNV A;  2F0P A;  4KTA A;  3HOZ H;  4UHV A;  5IT9 L;  5IP9 H;  1I6V C;  1HXY D;  3CP0 A;  1AH9 A;  1FNU A;  1BKB A;  5I2Y A;  1CTM A;  3TP7 A;  2JA9 A;  5JOB A;  4TVA B;  3VR4 A;  2PW5 A;  3RLN A;  3GTM B;  3L2P A;  2L5T A;  2B8F A;  3ND8 A;  1RJT A;  4FF4 A;  2BH2 A;  3CC2 A;  3AFP A;  1KHI A;  2JJQ A;  2KOL A;  4J1M A;  5CV6 A;  2Q8I B;  5M9O A;  2O2L D;  2B39 A;  2ZXO A;  5J39 A;  5EPJ A;  2EXD A;  2N55 A;  1JR0 D;  3I72 A;  2K5H A;  2B2T A;  2VUM G;  1K83 B;  2HCI A;  2YTY A;  3SDZ A;  1V1Q A;  3H15 A;  4IJH A;  3V96 A;  3U4V A;  2OF1 A;  1K9M C;  1TWC H;  4KKT A;  3H3V C;  3D3R A;  3KBX A;  4OWW B;  3RZO B;  1WD1 A;  1J6Q A;  3S15 B;  1BBW A;  2L15 A;  2VQE Q;  3V2T A;  4GS3 A;  3KDF A;  4DKA C;  4C3J H;  2MGS A;  4PV1 C;  4BBR H;  2ZJR A;  2CW0 C;  4IUV A;  2VNU D;  2VS1 A;  1H9K A;  1X32 A;  2ZJQ A;  1VMC A;  1EQT A;  3G48 A;  3VYR A;  1EOV A;  4FVM A;  2MUY A;  4QCL A;  5M5W B;  5EGT A;  4Y7N H;  1H95 A;  4JOI C;  4JI1 L;  1VF7 A;  4K2L A;  1N36 L;  2I0Q A;  4JI4 L;  2F0H A;  3HOV G;  2NVX B;  1GOZ A;  2M9V A;  1V1O A;  2A1A A;  3QIA A;  5J3B A;  2BDO A;  5E1F A;  1Q90 A;  1J5E Q;  4BS9 A;  3BZK A;  4HCS A;  1LT6 D;  1F9S A;  2R7D A;  4BXX H;  5GAH C;  4B9X A;  4OO1 I;  4YY3 L;  1TWG H;  4KHZ A;  2K33 A;  5M5X H;  1DGS A;  2EXZ A;  1XMQ Q;  2DJG C;  3K7A H;  1Q8K A;  3SK8 A;  4B3S Q;  4HIM A;  3M4P A;  3LWE A;  1STG A;  1UAP A;  1JOQ A;  1U4L A;  2F0N A;  1AN8 A;  1C9O A;  2BH8 A;  2ICE C;  2AUK A;  5CGK A;  1W6J A;  3I56 A;  1Y1V G;  4TQU S;  1IYV A;  1EY4 A;  1F2Y A;  1SNM A;  3A56 A;  1S3O A;  5DM6 3;  5FK9 C;  4DV6 L;  1O7I A;  1LTG D;  4DR6 Q;  1W3S A;  1GJX A;  4Z9C B;  2SOB A;  2KQ3 A;  1S40 A;  2NN6 I;  3HKZ G;  2QEX A;  1S5E D;  1HTP A;  2K5V A;  3CAM A;  4K8J A;  2F4I A;  4LF8 L;  4ZUJ A;  1GXD C;  3HG9 A;  1I94 L;  4LWC A;  4TKO B;  3BS1 A;  2F0W A;  3FHW A;  4LF5 Q;  1G2S A;  2I5M X;  1LO5 D;  3UDI A;  2F0K A;  1STN A;  3A5Z B;  2V1C C;  1CKM A;  1UE1 A;  2K5Q A;  4FXK C;  4A3K G;  2HHH Q;  1PRT B;  1DON A;  4A3E B;  2VL6 A;  1WYD A;  3CCL A;  1L1O A;  1VCI A;  1DCZ A; 
#chains in the Genus database with same CATH homology
 3J80 E;  4MIU A;  5DAU A;  3A7L A;  1S5B D;  1ROD A;  1B2T A;  1Y1W B;  1PDQ A;  3GD7 A;  2H4O A;  4QF4 A;  1Q3L A;  2Z4H A;  4DFA A;  1HUN A;  1L0Y B;  1TWG B;  2D5D A;  1EY6 A;  4UDU C;  2A73 B;  4DAY A;  1CK1 A;  2LKV A;  5JAV A;  2B2Y C;  4TRD A;  1SJH D;  2QIL A;  5DNF A;  5COY A;  2L12 A;  3BDO A;  4C56 C;  2JYO A;  1QNK A;  4F7X A;  1SMY C;  2CHB D;  4CKE A;  1YNN D;  1LTB D;  1I3Q B;  2NB0 A;  1Y1V B;  2MJ8 A;  2NYZ D;  1WTQ A;  1PTO F;  3KUP A;  3PMF A;  2B63 B;  1QWY A;  1KAB A;  1EZ6 A;  4FP5 D;  4RFB A;  1D2B A;  2B2U A;  2HQE A;  4IZ8 A;  2XRS D;  4JBW A;  5D3D A;  2TSS A;  3IFD A;  5C4J B;  1BF4 A;  5KEE A;  2F0J A;  4ZKC B;  2B2V C;  2L55 A;  4KKS A;  4XXE A;  1SJE D;  1EIG A;  3KLS X;  3GO5 A;  2JA8 B;  3ITP A;  1KDB A;  4M8A A;  3K58 A;  4DNT B;  4IQZ A;  1LAB A;  3FRP B;  2K1B A;  3VR3 A;  2E2J B;  1Q12 A;  1TQO A;  3A8K E;  4K5W A;  4WJW A;  4RKB A;  3W3A A;  3EJI A;  2K04 A;  4G4K A;  3NQT A;  4ZQ3 A;  1STE A;  4RAU C;  1G2T A;  2MHV A;  1HA5 A;  1ZXT A;  1V1P A;  1X3P A;  3RUZ A;  4KHV A;  4O42 A;  1LAC A;  1SNQ A;  2LY7 A;  2NTT A;  1LTA D;  1O78 A;  5CV9 A;  2EY6 A;  4KY5 A;  4JK1 C;  2F0O A;  4XT3 B;  3A8J E;  1TS3 A;  3T16 A;  1ENA A;  2FMM A;  2RDH A;  2IT1 A;  1W6K A;  4CKC A;  1GUW A;  4PMB A;  3WOE A;  5JEA H;  3G7L A;  4PQX A;  1CT1 D;  2EYL A;  1SYE A;  5E4X A;  2K03 A;  5C0X G;  3FKI B;  1H9S A;  1EEI D;  4BA1 I;  2Q8T A;  4X3U A;  4FF3 A;  2KEC A;  2E2H B;  2WAC A;  2J7Z A;  2VXW A;  1EY9 A;  3TP8 A;  5M3M B;  4DK1 A;  1O80 A;  4OIK A;  3RD4 A;  2SEB D;  4OIJ A;  5EPL A;  1TWA B;  2B2W A;  3NTI A;  2IPK D;  1YNJ D;  2OT2 A;  4QUF A;  5C4Z A;  3D4W A;  4X3K A;  1V8Q A;  3MXU A;  3C3L A;  1I4P A;  3EFX D;  4ULL A;  3VYT A;  2D2C C;  2K7V A;  3QO2 A;  3HGB A;  1JWU D;  4EGV A;  4E6I A;  2BE5 C;  2EZV A;  1BCP C;  3BVZ A;  4RGM A;  5CBA E;  1H9R A;  1PFB A;  1JIC A;  1EY5 A;  3OIP A;  1AP0 A;  4RGT A;  1TWH B;  3Q23 A;  1F2L A;  3MA2 B;  3J7A V;  5I2X A;  4IFD I;  2PZU A;  4XDX A;  4M1U B;  4J8Q A;  4A3B B;  3E6Z X;  1CZW A;  4RWS C;  1NSN S;  4PNY A;  1GUO A;  1EL0 A;  3C1F A;  2EY2 A;  2EYM A;  1RF2 D;  3LNN A;  3CU7 A;  2HCC A;  5KNC A;  3J81 E;  3MFY A;  2XSC A;  1JOO A;  5I9P A;  1HA6 A;  1ONL A;  4DN4 M;  3M3Y B;  4H7B A;  3GTP B;  3TBI B;  1EYD A;  1WTR A;  1RTO A;  2D62 A;  4IUT A;  2F0S A;  2EYP A;  2Z4I A;  3T51 B;  4CJ2 C;  4NMZ A;  3V05 A;  1DOM A;  2PPB C;  2RSN A;  4G7O C;  2ZT9 C;  2A68 C;  3MFG A;  2BA1 A;  4S3S A;  3R8B A;  2SNM A;  3LWU A;  3LX0 A;  2IJ0 A;  1TWF B;  5JPM C;  1PFN A;  1TR5 A;  3VA5 A;  1C4Q A;  4TSS A;  4WOR A;  3H0G B;  1MSH A;  3DEP A;  3NWT A;  5KND A;  2A6H C;  1D1I A;  1OXT A;  4BY1 B;  4A3K B;  3MVV A;  1JE4 A;  1F2Z A;  1GHK A;  4OO1 G;  4C1N I;  4EQP A;  4V19 0;  2NTS A;  3OPO A;  5CR3 A;  4XYO A;  2A6H D;  3L7Z C;  1SE2 A;  2QDB A;  2F0V A;  1F2M A;  5E4W C;  3HOY B;  3N6R A;  1PTO D;  1JOK A;  4XIG S;  5KIX A;  4ZKB B;  3KBG A;  2NVT B;  2B2Y A;  3PUZ A;  1QJO A;  3FDT A;  4FXG C;  3K5M A;  1O7Z A;  5DM7 3;  5HGT A;  2O5J C;  1DZ1 A;  4K5V A;  1TS2 A;  4FO2 A;  2B2W C;  3J7A F;  3GTG B;  1FNW A;  4K6L A;  4CKB A;  4BBS B;  3VR5 A;  4CBV A;  1TT2 A;  3KF8 A;  4NW2 A;  5K36 H;  3T53 B;  5C3E B;  2K5W A;  1LT5 D;  1GUT A;  2KVM A;  3R3O A;  5CBE E;  3OWE B;  2L1B A;  5C4X B;  4RCN A;  5CMD A;  3D8G A;  3OWF A;  1OXV A;  2F1M A;  2CW0 D;  1BXT A;  3I4N B;  2ICI A;  3FVQ A;  5LL6 S;  4HR7 B;  5AFW A;  4Y7N B;  1PLF A;  4CJ1 B;  4LMQ D;  4ZYS A;  4DK0 A;  1FD7 D;  3QB3 A;  3HEJ A;  1SMY D;  4U68 A;  2IL8 A;  1FYC A;  4QB4 A;  1HFN A;  1KLU D;  1QE6 A;  1J9O A;  4MHE A;  1R4P B;  2F0F A;  4DNR B;  3HP3 A;  3QWN A;  2KUM A;  2F0T A;  4F87 A;  4IUQ A;  1TII D;  3MXG A;  5A2Q L;  4FYD A;  4N9P A;  3MC0 B;  1I4G A;  2X6G A;  5IT9 E;  1KAA A;  3BVM A;  3CHB D;  1IKL A;  2RA4 A;  4N9T A;  3C2P A;  2VUM B;  1MSG A;  4X3T A;  2E2I B;  3HOU B;  1D6E C;  3BYT B;  1U9R A;  3GP7 A;  5IGC A;  3S1N B;  3TSS A;  4KV6 A;  2WII B;  1F77 A;  3KLR A;  4A3M B;  3NXW A;  1QNU A;  5C0X H;  2EYF A;  1EQV A;  3T56 B;  1NCV A;  2B2T C;  3K5L A;  2I07 B;  5DEH A;  3GQB A;  3U9S A;  3E5S A;  1A3T A;  3SEB A;  5M5Y B;  2MPM A;  3OIQ A;  3VR2 A;  1PRT D;  3Q22 A;  1QOH A;  1DOK A;  1JWM D;  4I65 A;  4A3J B;  3M7G A;  4HSP A;  4C2M B;  4XQQ A;  5KYI A;  1OXX K;  3R2I A;  5ISR A;  2KHS A;  3L3O C;  4Q5V A;  2H1E A;  1CHQ D;  3BDC A;  1IYU A;  3CRK C;  4CHT B;  5IGE A;  5J1Z A;  3SK4 A;  1CA6 A;  3Q6S A;  2DY7 A;  2RVL A;  1BCP B;  3O13 A;  3A54 A;  2XWJ B;  2BDN A;  1I6H B;  2A5H A;  5COR A;  1Q1B A;  4KI0 A;  2D9U A;  2JEA I;  1PFM A;  3ERO A;  1GUN A;  1PZI D;  3A7A B;  5C3X A;  3JAM L;  2BE5 D;  2PYK A;  5I4D A;  3TZU A;  2PMZ B;  2R92 B;  2B2U C;  2JEB I;  4OO1 H;  1PYW D;  5C5M A;  2RSO A;  4H44 C;  3EQL C;  4A3G B;  5EBD A;  5JVH 3;  3NQI A;  5E3F A;  4DXG A;  2RQX A;  1MBY A;  3IL8 A;  1NUC A;  1B44 D;  1PTO H;  2AQ1 B;  1R4Q B;  3GTJ B;  2WKC A;  2IWH A;  3MWY W;  4OGQ C;  4IUN A;  1D5M C;  1DOL A;  1TKW B;  2JA7 B;  3HOX B;  1FGB D;  2PCF B;  1B9M A;  1U4P A;  3BZD B;  3VA7 A;  3K7A B;  1M8A A;  1SBB B;  1LT3 D;  2O4X A;  1SFO B;  3CRL C;  4HMJ A;  3NBI A;  2FFK B;  3Q24 A;  3HS0 C;  5T1I A;  5EKI A;  2EYJ A;  1CA5 A;  1RD9 D;  1LT4 D;  1STB A;  1EU4 A;  2IX1 A;  1C48 A;  1IHZ A;  1S4Z A;  3J7Y W;  1A15 A;  4J6H A;  2WIN B;  1S5D D;  2K01 A;  3U9O A;  3HZX A;  3PUX A;  2R61 A;  4RH6 A;  3I4M B;  1G6Z A;  2KEE A;  1Z7T A;  3IFT A;  1IW7 C;  5C3W A;  1D5Z C;  2DN8 A;  2EOT A;  2EY1 A;  2G9D A;  1RTN A;  4H13 C;  1LTT D;  5FO7 B;  1ZYR C;  4EQN A;  2KCC A;  3NK9 A;  1VF5 C;  2AQ3 B;  3JAM E;  1ML0 D;  3I8Z A;  2HDL A;  1HQM C;  2C5C A;  5K5P A;  4IN3 A;  1DJR D;  2R6G A;  5ELF A;  5IGB A;  5CV5 A;  5C6A A;  1TWC B;  1CQV A;  3UI2 A;  2JA5 B;  4OL7 A;  1KDC A;  3HOW B;  5FLX L;  2G9H D;  3S9W A;  4HTH A;  4K2K A;  1S5F D;  1BR9 A;  3D4R A;  3SK6 A;  2XRQ D;  1EY7 A;  4FF2 A;  2WP8 J;  4RA8 A;  4U67 3;  1ICW A;  2A74 C;  1TVX A;  1K8O A;  2OXP A;  4NKL A;  1AZQ A;  1AZP A;  3OHX C;  3PIP 3;  1EIH A;  2F0G A;  1I4X A;  3D6C A;  1LTS D;  4ODG A;  2BCO A;  1XX8 A;  2K6A A;  1TY2 A;  4RCO A;  3ZYY X;  2NZ1 D;  3K59 A;  4L6T B;  3GTL B;  3A8I E;  2EJG C;  2R93 B;  5CV8 A;  4IUU A;  5FLX E;  2RKS A;  5LHY 1;  1Y8O B;  1WTV A;  4BY7 B;  1VMP A;  2ZXR A;  1Q8I A;  2QKI C;  5EJW A;  1ENF A;  5JPN C;  1A6X A;  3TME A;  3FPU B;  1L0X B;  2JE6 I;  4RHS A;  4XTC S;  3QOL A;  3NBH A;  1SNP A;  2NWG A;  1BUV T;  1EYA A;  5D14 A;  2JSO A;  1E2V A;  1CFM A;  3ERQ A;  4B9W A;  4K8I A;  3VYU A;  3C1E A;  1CM9 A;  1DYQ A;  1WTP A;  4KN7 C;  2MP1 A;  2KJX A;  3BG3 A;  3NSW A;  3PUV A;  1YNJ C;  3VR6 A;  2NBF A;  4HED A;  5IGF A;  2EE1 A;  4NDX A;  2FIN B;  1KLG D;  2Z8L A;  2WKD A;  3AB9 A;  1BBX C;  2J4X A;  2E2D C;  2JP1 A;  3I91 A;  2KA7 A;  4ZUI A;  1EEF D;  1E0B A;  1SND A;  1PRT C;  2RDF A;  1EOT A;  1SSO A;  1Q1E A;  4IFD H;  5LL6 X;  4DA2 A;  3H91 A;  4KN4 C;  3QOJ A;  2BA0 A;  5JEA G;  2PZW A;  3PO2 B;  3HOZ B;  2VB3 X;  3EA6 A;  1ESF A;  1BCP F;  1KTK A;  3DXJ C;  3NUC A;  2C9O A;  2LS0 1;  5CV4 A;  2ENB A;  5I6Y A;  1SYB A;  2LMC B;  1DXM A;  2WV6 D;  2AUJ D;  4L8J A;  2QCP X;  1JCK B;  1D5X C;  3K57 A;  1Y8P B;  5K36 G;  2A69 D;  2PO4 A;  1HHV A;  2EDG A;  1I50 B;  3VYS A;  1SNO A;  2A6E D;  1RHP A;  5C5L A;  5TSS A;  5JJZ A;  1BCP D;  1U4R A;  2I46 A;  2K32 A;  4IAL A;  1ILP A;  1ENC A;  1SDF A;  3KK7 A;  3E0J A;  3CQZ B;  2JA6 B;  1STA A;  1STH A;  2QEJ C;  5EPK A;  1A3V A;  2PW7 A;  2PZT A;  3ONA B;  3MAQ A;  2WB1 B;  5JEA J;  4P2C B;  4ZK9 B;  1J8I A;  4IUP A;  2K05 A;  2YU9 B;  3CKI B;  2CQA A;  2R3Z A;  1RDP D;  4EVO A;  2FHT A;  5D65 A;  2PQE A;  4DF7 A;  1SYD A;  4DGZ A;  1PRT F;  5EBC A;  5EQ0 A;  3R93 A;  1QIL A;  4ZLT F;  1QCB D;  3URY A;  1ZYR D;  3MTS A;  4FNF A;  4ZRZ A;  2ZXP A;  4RGN A;  5ELE A;  3NTK A;  3GTK B;  1M4V A;  1JB3 A;  3GV3 A;  3I3C A;  3OMG A;  3DMU A;  1PXU A;  4YIJ A;  3M4O B;  5A2Q E;  1GUG A;  3SHL A;  2L9H A;  2N88 A;  4Q0F A;  2R7Z B;  2GA4 B;  2A6E C;  4R8I A;  1KDA A;  1SNC A;  1PTO B;  1T5E A;  5ELD A;  2F0Q A;  1F9Q A;  1UEA B;  3FEW X;  1HUM A;  3SVM A;  4C3J G;  5KGU A;  2NUC A;  2RBM A;  3DUZ A;  1JWS D;  2F0M A;  3DWA A;  1MD2 D;  2L4N A;  1HPC A;  1NR4 A;  4XYQ A;  2M2L A;  2EYH A;  1ET6 A;  4A3I B;  3OSO A;  3HOV B;  3ND9 A;  1BDO A;  3S14 B;  1XYI A;  5KRU A;  1ET9 A;  4BA2 I;  1B53 A;  4QMG A;  1B50 A;  5JVG 3;  3BVG A;  3AMU A;  2YYZ A;  2XVS A;  3MZ5 A;  5C0X I;  5CV7 A;  3K5N A;  1PZJ D;  2Z1C A;  1A2U A;  3D31 A;  3SR1 A;  3OW7 A;  3TP6 A;  5J22 A;  1PTO C;  3OMC A;  4CJ0 B;  5C44 B;  2TMP A;  5EKL A;  3OOC A;  4XQJ A;  3C46 A;  3K5O A;  1B4O A;  4HSV A;  4ID6 A;  4H0L C;  3DEO A;  3J80 L;  5M3F B;  2IW3 A;  4RKL A;  4ZAI A;  5BN5 A;  3S17 B;  4X3S A;  2NVY B;  4L63 B;  3N52 A;  4C3I G;  4HCE A;  2EY5 A;  4MN3 A;  1II3 A;  4KY6 A;  2WAQ B;  1JC7 A;  3T13 A;  3M85 A;  5EKK A;  3SE0 A;  4V0B A;  5F2D A;  3H09 A;  1KNA A;  3S2D B;  2RDG A;  1XXG A;  3HRZ C;  3QJY A;  4BWG B;  3D4D A;  3NP8 A;  3S2H B;  2HUG A;  3G6J B;  2NVQ B;  1XTC D;  2KCN A;  2X69 A;  2E75 C;  2F03 A;  3QG1 A;  1PZK D;  2IX0 A;  1F9P A;  5D3I B;  1B1Z A;  5IIF A;  1EYC A;  2B2V A;  1HCZ A;  4UAI A;  1ZKO A;  1A3U A;  2OEO A;  1RKN A;  4ILW A;  2CVR A;  2X6L A;  1WVL A;  1ILQ A;  2DNE A;  1E2Z A;  1BO0 A;  2Q8R E;  3PV0 A;  4A93 B;  1HRJ A;  4K6D A;  1BQQ T;  3P1H A;  5G3L D;  1OO9 B;  1LLR D;  1TY0 A;  4C3H G;  3P20 A;  2F0U A;  1O7Y A;  2E74 C;  4HMI A;  2B8G A;  1AEX A;  1STY A;  3PUW A;  5M5X B;  2M00 A;  1BNZ A;  4KMU C;  5A35 A;  5C4H A;  2IX3 A;  4FXD A;  1X3Q A;  1KNE A;  1QB5 D;  1Y69 U;  3H6M A;  4HN7 A;  2FMC A;  4PMC A;  3I4L A;  2VB2 X;  4ABN A;  1LTI D;  4KY7 A;  4RHR A;  1QG7 A;  1WD0 A;  2E76 C;  3X3N A;  3MXP A;  3AU7 A;  4BBR B;  2A69 C;  2AQ2 B;  1ESR A;  2XN9 C;  1E2W A;  1V1P B;  1Y8N B;  3FMC A;  4QUC A;  1B3A A;  1FR3 A;  1XWE A;  3RZD B;  2F3V A;  3L9A X;  3NE5 B;  2K28 A;  4R8N A;  2SDF A;  3NHH A;  3FPP A;  5KNB A;  4QIW B;  5NUC A;  1O7L A;  5I9O A;  3TDQ A;  5FO9 B;  1SEB D;  4I7Z C;  4R9W A;  1LTR D;  4WFN 3;  1WTW A;  2O5I C;  3PUY A;  1HQR D;  4LAA A;  1EFI D;  1VDZ A;  2QF7 A;  5BN4 A;  2JXM B;  5BN3 A;  4OHJ A;  3SXH A;  4F88 A;  4PMW A;  4KJN A;  4C3I B;  3MEH A;  1TU2 B;  1G8Z D;  1NAP A;  1K8M A;  5FOB B;  3MXN A;  1I4H A;  2EVB A;  3WDN A;  1JQY D;  4IFD J;  1CHP D;  2AWN A;  4LK1 C;  3EVQ A;  3R2T A;  1DM0 B;  4A3F B;  3DM1 A;  1CZG A;  3J81 L;  1IKM A;  4AYB B;  1CI3 M;  1TS4 A;  4EQO A;  2J0T D;  3S1R B;  1OXS C;  2F0I A;  1A2T A;  4B08 A;  1WTX A;  1GUS A;  1T5X D;  3T4A C;  3GTO B;  3GV6 A;  3HKZ B;  3D6W A;  1V43 A;  3K0Y A;  5C0X J;  2A68 D;  1H9S B;  3BDL A;  1LV9 A;  4DAP A;  4C3J B;  2AWO A;  2XWB B;  1HTL D;  1SE3 A;  3NTH A;  2F0D A;  1H9M A;  2K5D A;  4K5X A;  4KKU A;  4C3H B;  1DD2 A;  1MGS A;  4K14 A;  3SK5 A;  1RCV D;  2EYO A;  3MHB A;  1TS5 A;  4O1N A;  2F3W A;  3NWS A;  1OXU A;  2L11 A;  2KED A;  3RLF A;  4GZY C;  1SAP A;  4A3D B;  2EJM A;  1IL8 A;  3W2D A;  2V4D A;  4G7Z C;  4G7H C;  1H9J A;  4RGO S;  4HAE A;  5I6W A;  1G91 A;  4F8M A;  1EWH A;  5CYU A;  1EZ8 A;  2DY8 A;  4CGY B;  3PO3 B;  1C8C A;  3GTQ B;  3RMH A;  5ELB A;  5IOD A;  2F0E A;  3X3M A;  3TP5 A;  1SYF A;  2LFN A;  4WRD A;  3I90 A;  4NP5 A;  1Z6H A;  4XQN A;  2Y0S B;  1B9N A;  5T1G A;  1SYC A;  4DAV A;  3TZD A;  4IUR A;  2ID0 A;  3DWQ A;  5IGD A;  3IAY A;  3DWP A;  5ELC A;  1PMR A;  3A55 A;  1WTO A;  1AW7 A;  1AFP A;  2F0L A;  3NPP A;  1GHJ A;  1D1K A;  1CQF A;  1SYG A;  3I70 A;  1WCM B;  1SXT A;  3S16 B;  3DHQ A;  5HUR A;  5CC4 A;  3IKJ A;  3WOF A;  2XNA C;  4KD4 A;  1NR2 A;  1HFG A;  2HDM A;  5FO8 B;  1EWC A;  4KJO A;  3PIO 3;  1JOR A;  5KYL A;  5G3L F;  1IW7 D;  3H94 A;  3P7J A;  1S5C D;  3S1M B;  4IFD G;  4C1N K;  3TN2 A;  1UNS A;  2L0C A;  1I4R A;  4G57 A;  1G29 1;  3BYY B;  3KLS A;  1ZEQ X;  1R9T B;  4KK7 A;  3F2U A;  1SE4 A;  2NN6 H;  4FF1 A;  1EY8 A;  4LJZ C;  4ME5 A;  2SNS A;  1F9R A;  3M4Y A;  2FJ2 A;  2PNR C;  1I4Q A;  1BOS A;  1YNN C;  5FKA C;  1EY0 A;  1U4M A;  3S1Q B;  1UUP A;  5IOC A;  4XT1 B;  2EPB A;  1Z47 A;  2XIW A;  3P75 A;  3M7N A;  2EJF C;  1MI2 A;  2BOS A;  4DXF A;  1EU3 A;  3K6O A;  4KD3 A;  3Q0A A;  2DNC A;  2NN6 G;  5IGG A;  3I73 A;  4DU9 A;  1FNV A;  2F0P A;  4KTA A;  5IT9 L;  1I6V C;  1HXY D;  1FNU A;  5I2Y A;  1CTM A;  3TP7 A;  5JOB A;  3VR4 A;  2PW5 A;  3GTM B;  2L5T A;  2B8F A;  3ND8 A;  1RJT A;  4FF4 A;  2KOL A;  4J1M A;  5CV6 A;  2Q8I B;  5M9O A;  2O2L D;  2B39 A;  2ZXO A;  5J39 A;  5EPJ A;  2N55 A;  1JR0 D;  3I72 A;  2B2T A;  1K83 B;  2HCI A;  3SDZ A;  3V96 A;  2OF1 A;  4KKT A;  3H3V C;  3D3R A;  3KBX A;  3RZO B;  1WD1 A;  3S15 B;  3V2T A;  2MGS A;  4PV1 C;  2CW0 C;  4IUV A;  2VNU D;  1H9K A;  1X32 A;  1VMC A;  1EQT A;  3VYR A;  4FVM A;  2MUY A;  4QCL A;  5M5W B;  5EGT A;  1VF7 A;  4K2L A;  2F0H A;  2NVX B;  1GOZ A;  2M9V A;  1V1O A;  3QIA A;  2BDO A;  5E1F A;  1Q90 A;  4BS9 A;  4HCS A;  1LT6 D;  1F9S A;  4OO1 I;  4B9X A;  4KHZ A;  2K33 A;  2EXZ A;  3SK8 A;  3LWE A;  1STG A;  1UAP A;  1JOQ A;  1U4L A;  2F0N A;  1AN8 A;  2ICE C;  2AUK A;  5CGK A;  1W6J A;  4TQU S;  1IYV A;  1EY4 A;  1F2Y A;  1SNM A;  3A56 A;  5DM6 3;  5FK9 C;  1LTG D;  1GJX A;  4Z9C B;  2SOB A;  2KQ3 A;  2NN6 I;  1S5E D;  1HTP A;  4K8J A;  2F4I A;  4ZUJ A;  1GXD C;  3HG9 A;  4TKO B;  3BS1 A;  2F0W A;  1G2S A;  1LO5 D;  2F0K A;  1STN A;  2K5Q A;  4FXK C;  1PRT B;  1DON A;  4A3E B;  1VCI A;  1DCZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...