2Z6KA

Crystal structure of full-length human rpa14/32 heterodimer
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
134
structure length
127
Chain Sequence
RAQHIVPCTISQLLSATLVDEVFRIGNVEISQVTIVGIIRHAEKAPTNIVYKIDDMTAAPMDVRQWVDNTVVPPETYVKVAGHLRSFQNKKSLVAFKIMPLEDMNEFTTHILEVINAHMVLSKANSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Replication protein A 32 kDa subunit
publication title Structure of the Full-length Human RPA14/32 Complex Gives Insights into the Mechanism of DNA Binding and Complex Formation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Replication
total genus 29
structure length 127
sequence length 134
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08784 RPA_C Replication protein A C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2z6kA00
1I3QH 3H3VH 1K73C 2H5XA 4BXXG 2A1AA 3U50C 3GTOH 3STBC 1X6OA 1K8AC 3KDFB 5BR8Q 4LF8L 3TRZA 1K3RA 3I7FA 1EUJA 5JJKA 4P74A 4LF5Q 3J7A5 2D0OA 4B3RQ 3M85A 5IYBG 1GM5A 1VQLA 2UUBQ 3F2CA 4YHHQ 5FJ8G 4YCVA 3S1MH 1EIFA 1U0LA 4C3JH 5IP9H 2QEXA 4GS3A 4IJLA 5C3EG 1JJ2A 3PUYA 2DUDA 3EBEA 2NVTH 2NZOA 3B6YA 1N9WA 3CCSA 1Z47A 1Q12A 5M5XH 1IBLQ 1XTDA 5C44H 4OWTB 1X56A 5DLQE 3WWVA 3I2ZA 4PZ6A 4LFCL 3SGIA 2ZTEA 4YCWA 4C3IH 2CWPA 3TREA 4GNXC 1L1OA 4IFDI 1I94L 4XTCS 1XMQQ 4LFAQ 4JI4Q 4KHPQ 3GTGH 2ALYB 3G4SA 1QUQB 4A93H 4UPAA 4LUOA 4X65L 4B3TL 4QJFA 3HOXG 4AQYL 3TQYA 3RN5A 3TS0A 2KCMA 4KLKA 5M3FH 3E9HA 1XMOQ 1VQKA 2NVXH 1G6PA 1KRTA 1IBKL 2JA7H 3CPFA 4HJ7A 2Q2UA 3STBD 5LMUQ 1B7YB 3CCUA 1BBUA 2ZTDA 1OXXK 1V9PA 2NVYH 4A3FH 1PH4A 1J5EQ 2Z6KC 3BZKA 4LFBL 4A3EG 5IYCG 3F8TA 3HKSA 1MJEA 2Y0SG 3J81c 4LF4Q 2XGTA 1OXVA 4IJHA 3CCEA 1JJCB 4DV3Q 4DV5Q 1C7YA 1NE3A 4DPGA 4A3CH 4HJ5A 2BA0A 2JA8H 3A5UA 3F1ZA 5H1SE 2KCTA 4JI6L 4JI1L 5IWAL 3HOWH 4X6AH 4LNQA 1Z9FA 4JI3Q 2FXQA 1X55A 4DK3C 1E3PA 3UDIA 1UE6A 2JJQA 3NEMA 2WP8J 1HR0Q 2VZAA 1VQ7A 2RHSB 3HOZH 3EIVA 1A8VA 1VQHA 3GD7A 4BBSH 4A3LG 4DKAC 1XNQL 3OTOQ 4POFA 2R7FA 3CMEA 1BBWA 2VY3A 1VQ4A 1LYLA 3HKZG 2Y0SE 2GVAA 4KHZA 3OYYA 1T9HA 1QVCA 2JEBI 1KAWA 3PV0A 4TVAB 2QA4A 3HOVH 4GN4B 3J80c 4GKJL 1S3OA 2UXCL 4YY3L 4LUVA 2YYZA 3TS2A 3CCVA 2RHQB 2ZJRA 4DR2Q 2LXJA 1YITA 5LMNQ 4DR1L 3EN2A 2UU9L 3RZDH 2R7DA 1GO3E 2CCZA 2B63G 3PCOB 2JA5H 2MO0A 2NN6G 1VQPA 1Q82C 2F52A 3CF5A 4QIWE 2YU9H 3GTMH 4B3SQ 2CFMA 2K52A 3ER0A 2E2IH 1Q8KA 4A3IH 4DR5L 1XPUA 1VCIA 4NXNL 4MTNA 4DV0Q 4DV4L 2DGYA 4UP7A 3S14H 3L7ZC 1Q86C 4OO1G 3W1BA 1PFSA 1QZHA 3BJUA 1K83H 4AH6A 5GAHC 1K9MC 2CWAA 3T1HQ 3MXNB 3PIPA 1C9OA 1VQOA 1FJGL 1EFWA 3GTLH 5IP9G 1PH1A 3CCLA 2JEAI 3S1QH 1PHJA 4JI0L 2UXBL 2EXDA 1X54A 4RG1A 3M7NA 2IHEA 1L1OB 1Q1EA 4YWKA 4C3HH 4X64Q 5C44G 4L5SA 2HHHQ 2F4VQ 3PIOA 2ZM6Q 2PI2E 3CC7A 4R4TA 2WB1G 1M1KC 2PMZE 1IZ6A 1U5KA 1Y1WG 3KF8B 3KYHC 4B3ML 3S2DH 5JJLA 3RN2A 2YTYA 4BY7H 1FGUA 1W2BA 1OXUA 5HY6A 2V1CC 4A93G 3RLOA 5IP7H 4JI2L 2OQ0A 1VQ8A 4X66L 1VQGA 2GVBA 5M3FG 1SE8A 1GD7A 2YTVA 4O2DA 1VQ6A 3M3YH 4GKKL 3ZJYC 4LF8Q 2JA9A 2JA7G 1VQMA 1C0AA 1EOVA 1HNWL 2E5LL 3PO3G 2EIFA 1DGSA 4A3FG 1XPRA 4JI5Q 3E9IA 3GTKH 4DV6L 1XNRL 1N33L 1VQEA 2HIXA 1S40A 2VUMG 2WB1E 2LSSA 4HIDA 1L2FA 2KHIA 1JT8A 4YWLA 1XPOA 2VNUD 4L5QA 4A3CG 2JA8G 3GTQH 1E7ZA 2LXKA 2N78A 1SROA 3A74A 3CAMA 3OW2A 3HOWG 4DR3Q 4IO9A 1B70B 3S15H 2Q2IA 4DV2L 1K8GA 1HNXL 2PQAA 3CQZH 2A19A 3KJPA 4OWWB 3HOZG 1FVIA 4LFCQ 1IXRA 5C4JH 3RZOH 4DR4L 1I50H 4JC0A 1YHQA 2B29A 2R6GA 4BBSG 5C0XJ 4DUZQ 1PH7A 2R92H 1N36Q 3J80i 3RLFA 1TXYA 1I5FA 1X3EA 1HNZL 4JV5L 1EWIA 3K0XA 4HJ9A 1EQRA 3T1YL 4BA2I 1E22A 1L1OC 4B3TQ 3PO3H 4IOAA 4LF6L 5ELOA 2MQHA 4KI0A 5GAGC 3A5ZB 4AQYQ 4NXML 1IBMQ 4X62L 3NELA 4HIMA 4OO1I 3UDGA 4R1JA 2VW9A 2PNHA 1Y1WH 2I5HA 1VQDA 4JYAQ 3PF4A 4IOCA 3KOJA 2EQSA 1V43A 4UY8C 2NVQH 1PH3A 3D0FA 3UDXA 2JA5G 1LTLA 2IX0A 5BR8L 1KD1C 1WCMH 2AMCB 2E8GA 5FLXc 1H95A 1KXLA 5JEAG 4A3IG 4B3RL 1XJVA 1HR0W 4GOPA 4QQBX 1YJNA 1VQJA 1I6HH 2R7ZH 2UUBL 1WFQA 4EX5A 1KC8C 2I0QA 1PH8A 5C0XI 2VUMH 3S2HH 4LUZA 1SR3A 5J3BA 5GQOA 2UUCQ 3S1NH 4A3GH 2OWOA 1XNQQ 3AQQA 1IBLL 2I5MX 3F2BA 2UUAL 4IPCA 5E7NA 1L0WA 3FHWA 2Z0SA 1EQQA 3CXCA 1LUZA 4R4OA 3GTPH 4JV5Q 3HOUH 2PI2A 3M4PA 4UP9A 3K80C 3MEFA 1KRSA 1SFOH 3CP0A 3ICEA 2Q2TA 1JE5A 4GKJQ 2UXCQ 4YY3Q 2BH2A 1XMQL 5LMNW 4JI4L 4LFAL 1UWVA 3KFUA 4KHPL 1D7QA 4DV7L 1UEBA 2L15A 4BY7G 1RL2A 1Y1VH 4YWMA 4DR1Q 3GO5A 4DUYL 1XMOL 5IP7G 4LF7L 1WYDA 1J6QA 4JYAL 5K36G 2KHJA 5M5WH 3H0GH 1TWAH 4O0AA 4DAMA 5LMUL 4LF9L 3PO2H 3HOVG 1OXTA 1N34L 3CC2A 4UP8A 5IYDG 4OX9L 1YHBA 3S17H 4JI7Q 3KLWA 4AYBG 1YI2A 4NXNQ 2K5HA 4QGUA 2ATWA 1OXSC 4DR6L 4P72A 2CQOA 4LF4L 3CC4A 1N32L 2HIVA 5AJ3Q 2HQLA 1NMGA 2VL6A 1JJGA 4A3BH 1KHIA 1M90C 1Q46A 3K81C 2AKWB 2PQAB 1VS0A 2K4KA 1UE5A 3HKZE 4NPSA 1N8RC 2OTLA 4DR7Q 4JI0Q 2BA1A 2UXBQ 3PGZA 4A3JH 2VS1A 1HR0L 5ELNA 1PYSB 1W3SA 3K7AH 4K0KL 3G6EA 4R4IA 3RNUA 2MO1A 3PUVA 4P73A 3CW2C 3U4ZA 1B8AA 4B3MQ 3J81j 1IL2A 2R92G 2R93G 2Q2HA 4P71A 4YCUA 1CUKA 4JOIA 4JBWA 4GLVB 1PV4A 3I4MH 4DV1L 4JG2A 4JI2Q 4DK6C 3ULLA 1PH9A 1WJJA 3UE0A 2JA6H 4X66Q 4Y52H 4A76A 4GKKQ 2UXDQ 1YVCA 1HJPA 4DR2L 1X3GA 1TWHH 3PUZA 2WFWA 4BBRH 5FLMG 5LMNL 2E5LQ 2ES2A 4JBMA 2MNAA 4ALPA 3M9BA 3DLLA 1V1QA 2IY5B 1XNRQ 4A3KH 4IFDG 1N33Q 4JI8Q 4B3SL 2D0PA 4BY1H 4GOPB 3UE1A 1E1OA 4PMWA 1WCMG 2YTXA 4ME3A 4GLXA 1PH6A 4DV0L 1QVGA 2E2HH 3J81i 2MFIA 2F3IA 4JBKA 1OTCA 1BKBA 2R7ZG 4AIMA 1CKNA 1HNXQ 1SRUA 1TWCH 1P16A 2RF4A 3KF6A 4LW1A 4MNOA 3GDEA 4PZ8A 4GN5A 1G51A 4A4IA 4A3GG 3S24A 3CPWA 1TWGH 3J7ZC 1X9NA 4PG3A 1HNZQ 3ULPA 2CKZB 3RR5A 2BH8A 4L5RC 4QL5A 2HHHL 2K50A 3KJOA 1G291 3HOUG 2VQFL 4LF6Q 4R4QA 3DM3A 4X62Q 2NN6I 1PH5A 1I94Q 3H3VI 5GADC 2OTJA 2R93H 3FKIH 4DNIA 2VQEL 3PSIA 1Y1VG 1VQAA 3K7UC 4X65Q 3U58A 1MIUA 3CCMA 1X65A 4A3MH 3TEHB 5M3MG 3K8AA 2WAQG 3H0GG 2JQOA 1MJCA 3G48A 4XIGS 3PO2G 1IBKQ 5FLMH 1YHAA 4JI5L 4JCVE 1YIJA 4LFBQ 1Q7YC 3BU2A 4PZ7A 1R9TH 4H02A 1IYJB 4A3DH 1NBWA 2K5VA 3I4OA 1YJWA 4GOPC 1SLJA 2NZHA 3A0JA 1HZAA 5GAEC 1VQNA 3HOYG 4A3BG 4LF5L 1CSQA 4NB3A 4JI6Q 1EYGA 4IPDA 4JI1Q 4FDBA 3CCQA 4DR3L 3I4NH 1A0IA 5IWAQ 2UUAQ 3AFQA 4A3JG 3JAMc 1AE2A 1PYBA 4GN3B 4YHHL 1AE3A 2WAQE 1HZCA 4IPGA 4OWXB 2IHFA 3H15A 1VQBA 1FL0A 2RCNA 4DUZL 1N36L 1KL9A 4RMFA 5IY0A 4DV7Q 4GNXA 2ZJQA 3U4VA 4WJ4A 5C4XH 3I55A 4DUYQ 3I4MG 4LF7Q 1IBML 2JA6G 5IT9c 4TQUS 1D8LA 1SMXA 1TWFH 2N8NA 1NTGA 4HJAA 4LF9Q 3AYHB 3M4OH 3L2PA 1N34Q 3ULJA 4BBRG 2OQKA 4HIKA 4OONA 4OX9Q 4BA1I 1VQCA 3D31A 4DR6Q 1YEZA 2UU9Q 1P8LA 4JI8L 1HH2P 3I56A 4BXXH 1N32Q 2Z6KA 5M3MH 4A3KG 4DAYB 4BY1G 3L0OA 5JEAJ 3PUWA 3ERSX 1O7IA 1YNXA 4HIOA 1J5EL 1CKNB 2YV5A 1UE1A 4OXPA 3M4QA 4R4CA 4DR5Q 1JMCA 3KF6B 4LWCA 2N3SA 5IYBH 1S72A 3KDFA 2GN5A 3Q8DA 4DV4Q 2I5LX 1A62A 3E0EA 3NENA 5FJ8H 1YBYA 1WI5A 1HZ9A 1CKOA 4MZ9A 2UUCL 1ASZA 4DV3L 4DV5L 4K0KQ 5JJIA 5C3EH 3PF5A 1UE7A 4JBJA 1FJGQ 3HOYH 2ZTCA 2JK8A 5HGQA 2K14A 4JI3L 3CCRA 1Q81C 2HT1A 3W1GA 1BVSA 1LM0A 4DV1Q 1VQ9A 1NJIC 1VQFA 3G71A 1EIYB 3OTOL 2QGQA 4JOIC 1MKHA 4AYBE 3FP9A 1A63A 1GKHA 2KBNA 4EQ5A 2K5NA 3HFZB 3CCJA 2IX1A 1YZ6A 3FKIG 3HOXH 3IRBA 3AEVA 4A3MG 2KENA 2AWNA 1QUQA 2OCEA 1JB7A 2K75A 1YJ9A 3VDYA 1E1TA 4J15A 5M5YH 4APVA 3GTJH 4JI7L 1HNWQ 4L5TA 1CSPA 4A3EH 5IYCH 2A8VA 1RIPA 2IT1A 3UDFA 4DV6Q 1KQSA 5AJ3L 1ASYA 4GLAC 2B3GA 1VQ5A 4A3DG 3W5OA 3RLNA 1X3FA 2XTIA 1Y14B 2AHOB 4DR7L 3JAMi 1CKMA 1PVOA 1HZBA 4Y7NH 3PUXA 2D62A 1NY4A 3I4NG 4WJ3M 1PH2A 1NMFA 3JC66 4DV2Q 3AFPA 4QY7A 3T1HL 4IPHA 2VQFQ 4GNXB 2ZJPA 4A75A 1WOCA 2ASBA 1Q1BA 1E24A 4DR4Q 4A3LH 1VQIA 2C35B 5IE8A 3LGJA 5EAYA 4POGA 3BZCA 4C2MH 5C0XG 1QZGA 1SN8A 5GROA 4HJ8A 1AH9A 3S16H 4X64L 2VQEQ 3CMAA 3T1YQ 2E2JH 5C4XG 3F2DA 2F4VL 5IYDH 1PA6A 2ZM6L 2UXDL 1QVFA 4NXMQ 1KIXA 2ID0A 3CD6A 2JE6I 2AWOA 3S1RH 2B63H 2N49A 1GVPA 3NBHB 4IFDJ 4P75A 1K0RA
chains in the Genus database with same CATH superfamily
1I3QH 3H3VH 5C44B 2A1AA 1K8AC 1RKNA 1QWYA 5BR8Q 3M4YA 4C3IB 2WB1B 4P74A 4LF5Q 3QO2A 2D0OA 1JCKB 1PZJD 3ZYYX 3A8IE 4B3RQ 2A74C 3GTGB 3TDQA 1GM5A 4KKSA 3F2CA 1IW7C 4OL7A 2RA4A 5FJ8G 4YCVA 1B44D 1PRTC 1EIFA 1U0LA 4C3JH 1JJ2A 5C3EG 4L63B 1B9MA 3PUYA 1EQVA 2C9OA 2NZOA 2OT2A 2KOLA 4OWTB 4FVMA 3WWVA 1B9NA 4PZ6A 4DK0A 4IZ8A 2CWPA 3C1EA 4QF4A 5ISRA 4JI4Q 1WTPA 1JR0D 3G4SA 4J1MA 4LUOA 4M1UB 4B3TL 1GUTA 3TQYA 5M3FH 3E9HA 1KRTA 3HOZB 4EQPA 4OIKA 3CPFA 4HJ7A 4JYAL 3PO3H 2Z6KC 1JWUD 4A3EG 4FXDA 2L4NA 1MJEA 3J81c 4LF4Q 4IJHA 3HOVB 3TSSA 1NE3A 4A3CH 4HJ5A 4EQNA 1HPCA 3RMHA 4JI1L 2B8GA 2JP1A 3HOWH 1AW7A 1D5XC 4G57A 2FXQA 1X55A 2IJ0A 3OMCA 1RHPA 1HR0Q 1TS2A 1S5FD 4GZYC 1X32A 4A3LG 4JPBW 5C5LA 1L0XB 2PW7A 4FYDA 3CMEA 2E2IB 1VQ4A 2Q8IB 3HKZG 4HR7B 2VNUD 3R3OA 1T9HA 4TVAB 3CRLC 3I73A 4CKEA 2D9UA 2LXJA 1YITA 5LMNQ 1H9JA 5CR3A 2UU9L 3RZDH 2CCZA 2AUKA 1F9QA 2JA5H 1VQPA 1YNNC 3CF5A 4C3HB 2CFMA 1SXTA 3H6MA 4DR5L 1G91A 3CKIB 3S14H 1BCPF 1Q86C 2SNSA 4KKTA 1PFSA 4K6LA 3E6ZX 2MHVA 4AH6A 5IIFA 2CWAA 1K9MC 3PIPA 3VYUA 1C9OA 1MI2A 2CHBD 1PH1A 3S1QH 2TSSA 4JI0L 2EXDA 2F0IA 4RG1A 4YWKA 5C44G 3GP7A 3MC0B 4X64Q 4L5SA 1ZYRD 1TY2A 2K6AA 1YNJD 4C3IG 3BVGA 2WB1G 4R4TA 2PMZE 2F1MA 2L9HA 1IZ6A 3L9AX 2F0KA 2GA4B 3RLOA 2SDFA 5IP7H 3CRKC 2OQ0A 1VQ8A 1VQGA 1VQ6A 2A6EC 1HNWL 1HTLD 1DJRD 3E9IA 3NP8A 1XNRL 3X3MA 1N33L 2HIXA 1L2FA 2KHIA 3FDTA 1VF7A 2N78A 3CAMA 3OW2A 4OGQC 4DR3Q 3S15H 4DV2L 4XQQA 3CQZH 1HNXL 1CA5A 3HOZG 2NVQB 4DR4L 1YHQA 2B29A 5C0XJ 2R92H 1N36Q 1X3EA 1I5FA 1EWIA 3K0XA 1I4PA 4BA2I 4IOAA 4AQYQ 2MQHA 2O5IC 3ONAB 3A5ZB 3HOVG 4NXML 1ENFA 2HDMA 2VUMB 3UDGA 1MSHA 1Y1WH 3I90A 4IOCA 3SXHA 3TZUA 3D0FA 3UDXA 4RHSA 3Q24A 3EQLC 3GTPB 5BR8L 1IHZA 3HOUB 3K0YA 1KXLA 5JEAG 4MHEA 4B3RL 4KJOA 3HZXA 4GOPA 2Q8RE 1KC8C 2SOBA 5KGUA 1PH8A 2A5HA 1Y1VB 3S1NH 1IW7D 4A3GH 2F0UA 2RBMA 2WAQB 4KD4A 2OWOA 1LABA 5LHY1 1XNQQ 3LNNA 4IUPA 1IYVA 2LMCB 4IPCA 4X3TA 1L0WA 4FXKC 4QCLA 4R4OA 2PZTA 2PI2A 2EJGC 2LKVA 1LLRD 2M2LA 2NUCA 4UP9A 4C3HG 2IX3A 1SFOH 1ILPA 2UXCQ 4YY3Q 4JI4L 4A3BB 4YWMA 1DYQA 1WYDA 4A3JB 5CV8A 1AP0A 5K36G 5KYLA 3NBIA 1CHQD 5M5WH 1GUGA 1N34L 2ZT9C 4G7OC 4OX9L 4EGVA 1ONLA 4DR6L 4NXNQ 1S5ED 4QGUA 3A56A 4LF4L 5LL6S 2HQLA 3I4MB 2VL6A 1JJGA 5D14A 5CC4A 1M90C 3K81C 2PQAB 3HKZE 2F0EA 4I7AA 4BBRB 1HR0L 4E6IA 1CHPD 2EYJA 4P73A 4RCNA 2R93G 4JBWA 4U68A 4JI2Q 4DK6C 3UE0A 4X66Q 4CKCA 4Y52H 1TWCB 1HJPA 2O4XA 3RD4A 1B1ZA 1TWHH 2WFWA 3PUZA 5FLMG 5LMNL 2E5LQ 5EPKA 3OIPA 3ITPA 3R2IA 1NNXA 1V1QA 2PYKA 2IY5B 2EYMA 4RCOA 1YNND 4PMWA 4XDXA 3LWUA 1U4LA 2AQ3B 4DAYA 1EOTA 1SYCA 2Z8LA 1I3QB 3GDEA 1EYCA 1G51A 2IL8A 3WOFA 4A4IA 4I65A 1TWGH 1X9NA 4PG3A 1PYWD 1D2BA 3RR5A 1RF2D 2B2WC 4QL5A 3HOUG 2VQFL 1SNDA 4X62Q 1SJHD 2NN6I 1Y1VG 1VQAA 1XX8A 3I4NB 5CV4A 2WAQG 5CV7A 3G48A 2BDOA 5IGEA 1CQFA 1Q7YC 2XNAC 3EA6A 4PZ7A 3EFXD 2A6HD 4DAPA 5I2YA 2NTTA 5E4XA 2K5VA 3I4OA 1YJWA 1JORA 4GOPC 1VDZA 1SLJA 2NZHA 1VQNA 4A3BG 2KEEA 1CSQA 4JI6Q 5FLXL 4DR3L 4FDBA 5EPJA 2UUAQ 4A3JG 1O7LA 3OW7A 4R8NA 4IPGA 1LTRD 1SNOA 1NCVA 1NSNS 5M3MB 1FL0A 1N36L 5C0XH 3TP7A 3VR5A 1SJED 3QOJA 3T56B 1BOSA 4ODGA 2NVTB 1QB5D 1WVLA 3I55A 4DUYQ 3I4MG 2A68C 5FLXE 2QCPX 2M00A 1D8LA 5JVH3 1TWFH 4LF9Q 3OHXC 2EZVA 3ULJA 1LTTD 4BBRG 5IGCA 1I4QA 1VQCA 3D31A 3J81E 4BXXH 2ENBA 3T53B 3NBHA 5FO9B 3MFYA 1NAPA 3D6CA 4K2LA 1EU3A 1J5EL 1ENAA 2IPKD 2EY5A 2O5JC 1R4QB 1W6JA 4MZ9A 3OWFA 4DV3L 4H0LC 1FJGQ 3HOYH 2ZTCA 2K32A 5HGQA 3BYTB 4RFBA 1CFMA 3CCRA 4X3KA 5M5YB 3KLSA 1D6EC 5ELCA 3GV6A 5I6YA 1RD9D 1G2SA 1QILA 1VQFA 4XXEA 4KV6A 4DAVA 1A63A 2K5NA 3HFZB 4CDFC 3IRBA 3IAYA 2KENA 1QUQA 1STHA 1DD2A 1VMPA 1CSPA 2F0GA 5IYCH 2HCCA 2A8VA 1QE6A 1SEBD 2IT1A 4DV6Q 1STNA 1KQSA 4V190 5HURA 1PRTB 2E2JB 4K5XA 3RLNA 3SR1A 1Y14B 2AHOB 1OO9B 4X3SA 2EDGA 1CKMA 1HZBA 4Y7NH 3I4NG 1LT4D 3SEBA 4OIJA 2B63B 3JC66 3AFPA 3BYYB 3QB3A 1NR4A 1RJTA 3T1HL 2YU9B 2ASBA 1WOCA 1E24A 4K2KA 3MAQA 1ZEQX 3NSWA 2KCCA 5EAYA 1QZGA 2CQAA 4C2MH 1SN8A 4HJ8A 2PMZB 1JB3A 3BDLA 1QVFA 3SK8A 1BR9A 2F0HA 2JE6I 4PMCA 1XWEA 4OHJA 4IFDJ 1UEAB 1K0RA 1K73C 3D8GA 1QNUA 3GQBA 5E4WC 3I7FA 1EUJA 2EY2A 2RDFA 3DHQA 5BN4A 2V4DA 3M85A 4OO1H 1VQLA 1TVXA 2UUBQ 4A93B 4YHHQ 3K5MA 1RDPD 3S1MH 1EYAA 1EFID 2XRQD 4KN7C 5IP9H 2F0QA 4GS3A 3EBEA 4LMQD 1JQYD 2JA7B 3MXNA 3CCSA 4A3FB 3TP5A 2NVYB 1X56A 2RCFA 2NYZD 1T5XD 1HA5A 2EVBA 2RKSA 1L1OA 3VYTA 3H3VC 3K5LA 2DY8A 1XMQQ 4LFAQ 2JA8B 5CYUA 3E0JA 4UPAA 3KF8A 1Y8OB 4KLKA 2NVXH 3D4DA 1G6PA 2NBFA 1EY9A 2VB2X 3FMCA 4MIUA 3FRPB 5IT9L 3CCUA 1XXGA 1OXXK 1V9PA 5KNCA 4BBSB 3HKSA 4V0BA 1OXVA 1ZKOA 1JJCB 4DV5Q 1C7YA 4DPGA 1AEXA 1DOKA 4JI6L 3F1ZA 4X6AH 1EYDA 1Z9FA 4JI3Q 2WP8J 2VZAA 5IT9E 1VQ7A 4WORA 3EIVA 1A8VA 2F4IA 2R7FA 1CI3M 2J7ZA 1ZYRC 5IODA 4JV5L 4GN4B 1YNJC 2FINB 4GKJL 2LS01 1K83B 3CCVA 1ESFA 1J9OA 4NMZA 3EROA 3EN2A 2B63G 1GO3E 1WTXA 2MO0A 2NN6G 1CM9A 3P20A 2F52A 3GTMH 3PIO3 2EOTA 1SMYD 1LT3D 3SHLA 1Q8KA 4A3IH 1LTBD 1XPUA 1VCIA 4MTNA 1EY7A 3S2DB 1H9RA 4BY7B 3W1BA 1HFGA 2EYOA 1FJGL 5K5PA 3NWSA 1PHJA 1TU2B 2KHSA 2UXBL 1X54A 1DM0B 2IHEA 1MSGA 1Q1EA 4AYBB 4QUCA 1F2LA 2F4VQ 5C3WA 3I91A 1PTOH 3NTIA 1Y1WG 1K0SA 3KYHC 2F0JA 5KNDA 3RN2A 1FGUA 3GTQB 1F2ZA 3HGBA 1ILQA 5DM63 2ICEC 4A93G 2BDNA 1E2ZA 1PTOF 1H9KA 2F0WA 3I8ZA 3VA7A 1SE8A 3H91A 3M3YH 4O2DA 4GKKL 5CMDA 4LF8Q 3A7LA 3C46A 1VQMA 2JA7G 1EOVA 2CH4W 3RZOB 1I50B 4A3FG 1C0AA 1XPRA 3GTKH 4ZLTF 5C5MA 4DV6L 5EBDA 4PV1C 1V1OA 1WTWA 1S40A 1MD2D 2LSSA 4HIDA 2KQ3A 2JA8G 4JK1C 1SROA 3A74A 3FPPA 2EJFC 3MXUA 2Q2IA 3VYRA 3KJPA 4OWWB 1FVIA 4LFCQ 1ICWA 4Q0FA 5C4JH 5FKAC 1GXDC 4BBSG 4S3SA 4DUZQ 1S4ZA 1V1PA 1WCMB 4RH6A 3J80i 3RLFA 1HFNA 4B9XA 4HJ9A 5KYIA 1L1OC 2G9HD 1I6HB 5GAGC 3NELA 4OO1I 4G4KA 4K14A 3S2HB 5T1GA 1SBBB 3NHHA 2Q8TA 2PNHA 1Y8PB 1VQDA 1O80A 3QIAA 3KOJA 2EQSA 4IFDH 1B3QA 2K01A 1PZID 2AMCB 2E8GA 5FLXc 1XYIA 1I4GA 3UI2A 4NW2A 1HR0W 3SK5A 4QQBX 2R7ZH 2UUBL 3OOCA 2I0QA 1K28A 2KA7A 5J3BA 5GQOA 2FJ2A 3MXGA 3R2TA 3FVQA 3TMEA 1TWAB 2CW0D 3AQQA 3PO2B 3HP3A 4HMIA 1GUOA 3FHWA 2Z0SA 3MVVA 3S17B 3MEFA 3CP0A 1JE5A 1I4RA 2K5WA 4N9PA 5CGKA 1XMQL 2I46A 5LMNW 4LFAL 1UWVA 1EEID 1D7QA 4DV7L 1UEBA 3U9OA 1SE4A 2L15A 4BY7G 4DR1Q 3GO5A 4LF7L 1J6QA 4RWSC 3K7AB 3H0GH 4NKLA 4DAMA 3HS0C 5COYA 4QB4A 5IYDG 1AZQA 3KLWA 4AYBG 1H9SA 5AJ3Q 1HXYD 1ML0D 2JA6B 1VS0A 2K4KA 4DR7Q 1N8RC 2BA1A 3PGZA 2EJMA 2VS1A 4FF2A 5ELNA 1PYSB 4K0KL 3PUVA 4J8QA 2OXPA 3QWNA 4B3MQ 1EWCA 2Q2HA 4P71A 1TS4A 4JG2A 1PH9A 1WJJA 3DUZA 2UXDQ 1W6KA 1HRJA 4DNTB 5CORA 3D3RA 2ES2A 4JBMA 3KLSX 3M9BA 2L12A 2H1EA 1CT1D 1Y8NB 4A3KH 3J7AV 4JI8Q 1A3UA 2D0PA 4BY1H 4GOPB 2QDBA 1WCMG 1PH6A 2RQXA 1QVGA 2E2HH 2A6HC 5E3FA 2F3IA 5IOCA 2R93B 1SNCA 2Z4HA 1SRUA 3FKIB 2RF4A 4LW1A 2DNCA 4A3MB 4GN5A 2X69A 3EVQA 5AFWA 1RODA 1HNZQ 4NP5A 5EKLA 4LF6Q 3DM3A 3VR2A 1AZPA 4RGOS 5G3LF 1GOZA 4DA2A 1PH5A 1I94Q 3H3VI 1ET6A 1BCPD 2VQEL 2DN8A 3U58A 3VR4A 5DNFA 2WACA 4HMJA 5A35A 3PO2G 2H4OA 2NZ1D 4FP5D 5ELEA 1IBKQ 5D65A 1EIGA 3BU2A 3D4RA 3K58A 4H02A 1IYJB 1R9TH 4IUVA 4A3DH 5C4XB 1NBWA 1O78A 1FR3A 5C3XA 3A0JA 1HZAA 2DJGC 3HOYG 4LF5L 1EYGA 5IWAQ 5FO7B 3M4OB 1AE3A 4P2CB 1VQBA 2QW7A 4DUZL 2B2YA 3VR6A 5JVG3 4RMFA 4GNXA 3U4VA 4XQNA 2EY6A 3K59A 3KUPA 5I6WA 2JA6G 5IT9c 2AQ2B 1D1KA 1NTGA 1JOQA 4OONA 4BA1I 4G7HC 1N32Q 5IGFA 4DAYB 3MZ5A 2PO4A 3L0OA 3PUWA 3ERSX 5JEAJ 1O7IA 1YNXA 1KNAA 4OXPA 1JOOA 1JMCA 3KDFA 1K3BC 4DV4Q 1GUSA 5FJ8H 1HZ9A 3MHBA 5JJIA 3HOXB 1RTNA 3A8KE 5C3EH 4O42A 4JBJA 2JK8A 4PNYA 4KHVA 5D3IB 1HTPA 3GTJB 1XTCD 3W1GA 1LM0A 4RGMA 4DV1Q 1EZ8A 1NJIC 4HAEA 4AYBE 1GKHA 2X6LA 1HCZA 3FKIG 4A3MG 3RUZA 2AWNA 2O2LD 3G7LA 4XYOA 3MEHA 3C3LA 2K75A 1YJ9A 4APVA 4L5TA 4A3EH 4B08A 3R8BA 1RIPA 3UDFA 5AJ3L 2HQEA 3W5OA 1X3FA 4CJ2C 2E2DC 4C1NI 4DR7L 2K1BA 1LTID 4B9WA 3JAMi 3BDOA 3PUXA 1NY4A 4WJ3M 1Z7TA 4ABNA 1PH2A 1SNQA 4TSSA 1BF4A 2DNEA 4A75A 4A3LH 1VQIA 1LTAD 2RSNA 5GROA 2PNRC 1PDQA 5ELDA 3S16H 3TBIB 4X64L 5C4XG 3T1YQ 3G6JB 4RA8A 1PA6A 4DK1A 2OEOA 2UXDL 4FNFA 2VB3X 3E5SA 4F87A 4C3JB 1EEFD 3S1RH 2N49A 3NBHB 1MHWC 4P75A 4JI8L 2EYLA 2RVLA 4Z9CB 4FO2A 2P5ZX 4HCEA 2HUGA 3TRZA 1K3RA 4NDXA 1JICA 1ENCA 5IYBG 1SYGA 2AUJD 2QF7A 1K8OA 2B2VA 2QEXA 4IJLA 5M3FB 2F0DA 1Q3LA 2DJFC 3P7JA 2DUDA 2E76C 2RDGA 4FF1A 4KN4C 1IBLQ 1Q12A 3PO3B 5C44H 2XN9C 3F2UA 5DLQE 3SGIA 2B2YC 1DZ1A 2ZTEA 4C3IH 4GNXC 3TREA 1I94L 4XTCS 3GTGH 2ALYB 1J8IA 1KTKA 1QUQB 4QJFA 3HOWB 3HOXG 4AQYL 3RN5A 1XMOQ 1SYBA 1VQKA 5FO8B 1AFPA 1DONA 1IBKL 3STBD 5LMUQ 1KNEA 3BZKA 1U4PA 1WTHA 1FD7D 3E3XA 1SMYC 2XGTA 3CCEA 2WKDA 5CV5A 2BA0A 2HD3A 3A5UA 5H1SE 2KCTA 4MN3A 1B4OA 4ZKCB 5IWAL 4LNQA 3GV3A 3R93A 2JJQA 3HOZH 3RZDB 4DXFA 2JA5B 5L37A 1XNQL 3TZDA 3OTOQ 4EVOA 2MP1A 3NPPA 2VY3A 2ZXRA 1LYLA 3NUCA 2E74C 2Y0SE 5CBAE 1QVCA 2QA4A 3S14B 1A3TA 1SDFA 3HOVH 2L55A 1M8AA 3MA2B 2UXCL 4YY3L 4LUVA 3PIP3 1A15A 4IQZA 3TS2A 2RHQB 2ZJRA 4DR2Q 1VMCA 3S1QB 4F88A 3PQIA 3D6WA 2Z6BA 3PCOB 1Q82C 2K5QA 2IW3A 2R61A 2E2IH 5JEAH 2WKCA 1EWHA 4NXNL 4DV0Q 4DV4L 2DGYA 3C1FA 3Q6SA 1QZHA 2JYOA 4ZUJA 3IFTA 5A2QL 3MXNB 2R3ZA 1BO0A 3PMFA 4C3JG 4ZRZA 1EFWA 4KY7A 2JEAI 4DNRB 3CU7A 1I6VC 2A69D 2FMMA 3M7NA 3DMUA 4HN7A 1L1OB 4C3HH 2I07B 1EZ6A 4PQXA 3DEPA 2ZM6Q 2PI2E 1TS5A 4ZUIA 1M1KC 1U5KA 3KF8B 2VXWA 2YTYA 3QOLA 1KABA 2V1CC 2RDHA 3D4WA 3ERQA 3V05A 4JI2L 5K36H 1JWSD 2QILA 3S15B 1HUNA 4X66L 1UNSA 2GVBA 3CQZB 5M3FG 1GD7A 2YTVA 2JA9A 2BOSA 1DOMA 2E5LL 3PO3G 1DGSA 4JW0A 4KY5A 2R92B 1ET9A 1Z6HA 1VQEA 3URYA 4CJ0B 3TP8A 1XPOA 4A3CG 3AB9A 1E7ZA 2LXKA 4ZKBB 1PTOC 1Y1WB 3HOWG 4H13C 4IO9A 1B70B 4WRDA 4CKBA 1DXMA 3DWAA 2CW0C 1EY6A 1IYUA 1TXYA 4K8JA 3T1YL 1EQRA 1E22A 4B3TQ 4CHTB 1LTSD 5D3DA 4X62L 4PMBA 1IBMQ 4R1JA 1SYEA 3DM1A 4JYAQ 3S1NB 4A3GB 3NQIA 3PF4A 1RTOA 1V43A 4UY8C 2NVQH 2BCOA 1PH3A 2JA5G 1SYFA 2IX0A 2MJ8A 1SSOA 1KD1C 3U9SA 3K5NA 1SFOB 1RCVD 5FK9C 1WTRA 1CA6A 1XJVA 1CZWA 1C48A 1YJNA 2NTSA 4EX5A 5C0XI 2VUMH 2UUCQ 2L5TA 5M5WB 1KAAA 1IBLL 2G9DA 2I5MX 3F2BA 2UUAL 1SNMA 1EQQA 3GTPH 4L6TB 3HOUH 3K80C 1LO5D 1LV9A 3KFUA 2EY1A 1GUWA 3N6RA 3A8JE 1RL2A 1Y1VH 3A54A 4U673 3MWYW 2L0CA 5BN3A 5IP7G 4DUYL 1XMOL 4RKLA 5J39A 2KHJA 4IALA 2OF1A 3J80L 1BNZA 4LF9L 5LMUL 5FOBB 1OXTA 3CC2A 1BDOA 4UP8A 3K57A 2K33A 4KY6A 2ATWA 2K5HA 1WTVA 1SNPA 2CQOA 4P72A 3CC4A 4N8X1 2HIVA 1VF5C 1JWMD 4ME5A 4A3BH 2AKWB 2TMPA 3DEOA 4NPSA 2OTLA 5LL6X 4JI0Q 4A3JH 1TWHB 3T51B 3J80E 1W3SA 4CJ1B 1TS3A 3G6EA 3KLRA 1V1PB 3RNUA 2MO1A 4ZQ3A 3OIQA 3U4ZA 5CV9A 1B8AA 2R92G 5J22A 4JOIA 3I4MH 3OWEB 2PW5A 3ULLA 4A76A 3SVMA 1YVCA 4DR2L 1BCPC 1TIID 3LX0A 4BBRH 2WV6D 1WTQA 4MTKA 1TWGB 1A2TA 5IGDA 2DY7A 1XNRQ 1N33Q 1Q90A 1K8MA 3IFDA 1E1OA 1FNUA 1KDAA 4ME3A 3BG3A 1QCBD 3SE0A 4DV0L 3WOEA 4KJNA 2MFIA 1X3PA 1UUPA 4KMUC 1BKBA 4AIMA 1CKNA 1HNXQ 1TWCH 1P16A 3KF6A 2B2UA 4PZ8A 4C56C 1KLUD 4A3GG 3S24A 1QOHA 3J7ZC 1CZGA 2BH8A 2K50A 3SK4A 3VR3A 3V2TA 5JPMC 3C2PA 1H9MA 1B50A 5GADC 2OTJA 4ZK9B 1LTGD 5F2DA 3K7UC 4X65Q 1X65A 4IURA 3TEHB 4QMGA 1B53A 1E2VA 4RHRA 4G7ZC 4XIGS 1H9SB 1YHAA 5KRUA 4JCVE 3DWPA 1STYA 4LFBQ 2J4XA 2XWJB 2SNMA 5GAEC 1I4XA 1TWFB 1SYDA 4IPDA 3I4NH 4HCSA 1AE2A 4GN3B 1NR2A 1F9SA 1PTOD 4YHHL 1HZCA 3H15A 2IHFA 3J7AF 5EGTA 4EQOA 5IY0A 2K03A 2ZJQA 4CDCC 3HEJA 4WJ4A 1IBML 4F8MA 1X3QA 2NWGA 1F9PA 4UHVA 3L2PA 1N34Q 2OQKA 3HOYB 4HIKA 4OX9Q 4DR6Q 1YEZA 1P8LA 3MTSA 1HH2P 3I56A 5M3MH 1PFBA 4RGTA 1UE1A 2NB0A 3M4QA 1VQ5A 2NVTH 5HGTA 2N3SA 1S72A 2KECA 2K28A 3WDNA 3Q8DA 4UDUC 2EE1A 1YBYA 2UUCL 1CKOA 1ASZA 4DV5L 3H09A 3SDZA 2IWHA 1D5MC 4JI3L 4FF4A 1Q81C 2HT1A 5C4HA 3S9WA 2Y0SB 3G71A 1EIYB 4JOIC 1MKHA 1DOLA 3FP9A 1YZ6A 1G8ZD 3CHBD 4Y7NB 3KBGA 1R4PB 2OCEA 3VDYA 3X3NA 5M5YH 2F3VA 3BS1A 3HG9A 4C2MB 2XSCA 2KEDA 1ASYA 4GLAC 2A73B 2B3GA 1EY0A 2Z9HA 2QDLA 2K05A 2XTIA 1PVOA 2N55A 2D62A 2B2UC 4KKUA 1NMFA 5JPNC 2BE5D 2KUMA 1BBXC 4IPHA 2VQFQ 4GNXB 1STBA 2ZJPA 2N88A 2PQEA 3DWQA 5IE8A 4POGA 3BZCA 3H94A 5C0XG 4XYQA 3CMAA 2E2JH 1UAPA 3OPOA 2F4VL 1STGA 5ELFA 4ID6A 5EBCA 1EU4A 1KIXA 3S1MB 2ID0A 3CD6A 3K6OA 1PRTF 2K7VA 1C4QA 1EY5A 2AWOA 2B63H 1GVPA 2NN6H 5JAVA 2YU9H 2H5XA 4IUNA 5BN5A 4BXXG 3U50C 3GTOH 3STBC 1X6OA 2FHTA 3KDFB 4LF8L 1O7ZA 1PZKD 3T4AC 5JJKA 3J7A5 2J0TD 4TRDA 2EYFA 4H7BA 2XWBB 2B2WA 2NVXB 1GHKA 3B6YA 1N9WA 1Z47A 5M5XH 1JE4A 1SE2A 2FFKB 1XTDA 1A6XA 3I2ZA 3FEWX 4LFCL 3I4LA 3SK6A 3JAML 4YCWA 5CBEE 4IFDI 2G5DA 1MBYA 4KHPQ 4DFAA 4A93H 4X65L 3BVZA 1WD1A 3TS0A 2KCMA 4C1NK 2JA7H 2Q2UA 1B7YB 3ND9A 1BBUA 2ZTDA 1I4HA 2NVYH 4A3FH 1PH4A 1J5EQ 3JAME 4LFBL 2PZWA 5T1IA 5IYCG 3F8TA 4IN3A 2Y0SG 1V8QA 2Z1CA 2AQ1B 4DV3Q 5G3LD 1GHJA 2JA8H 2EXZA 1PRTD 3MXPA 1E2WA 3FPUB 4DK3C 1E3PA 3HRZC 1UE6A 3UDIA 3NEMA 4R8IA 2RHSB 3GD7A 1VQHA 1ICFB 2A69C 4BBSH 3GTMB 4DKAC 4POFA 5EJWA 1L0YB 1BBWA 2F3WA 4A3IB 3N52A 3IKJA 4KHZA 2D5DA 2GVAA 3OYYA 5KEEA 2JEBI 1KAWA 3PV0A 3J80c 2KJXA 1TKWB 1S3OA 1PLFA 2YYZA 2F0VA 2KVMA 4X3UA 1F9RA 2LFNA 4DR1L 2EYHA 2R7DA 3V96A 4QUFA 5JJZA 1HQRD 4HEDA 3TN2A 1HHVA 4QIWE 4B3SQ 2K52A 3ER0A 1A3VA 1HA6A 1FYCA 1WTOA 1PTOB 4UP7A 3L7ZC 4OO1G 1GJXA 2XIWA 3BJUA 1K83H 1ZXTA 1SE3A 5GAHC 3T1HQ 3GTLH 1VQOA 5IP9G 2F0SA 3CCLA 1G2TA 3M3YB 1T5EA 1E0BA 4HSVA 4YIJA 3W3AA 2F03A 1S5DD 3GTKB 4DN4M 2FMCA 1F2MA 2HHHQ 2EYPA 3DXJC 3PIOA 1B3AA 2LY7A 3CC7A 2M9VA 4B3ML 3S2DH 5JJLA 4FXGC 4K5VA 4RKBA 4BY7H 1W2BA 1OXUA 5HY6A 2CVRA 2C5CA 4CBVA 3Q22A 3ZJYC 5C4JB 5IYDH 2EIFA 4JI5Q 2QKIC 3W2DA 2VUMG 2WB1E 3I72A 3NE5B 1JT8A 4YWLA 3L3OC 4L5QA 5KIXA 3GTQH 1KDBA 4BWGB 3I70A 4LJZC 1K8GA 1CK1A 2PQAA 2A19A 4K6DA 1IXRA 2WINB 4ULLA 5EKIA 3RZOH 1I50H 4JC0A 2D2CC 2PPBC 2R6GA 4ZYSA 1PH7A 2L1BA 1HNZL 4Q5VA 4M8AA 5EPLA 1PMRA 1QJOA 1SAPA 5ELOA 4LF6L 4KI0A 2R7ZB 4HIMA 3J7YW 3BVMA 1CQVA 4HSPA 5I9OA 4IUUA 2VW9A 2I5HA 4UAIA 2A6ED 3QG1A 4BS9A 1LTLA 1EY4A 1WCMH 2JSOA 1H95A 1D5ZC 2ICIA 4A3IG 5IGBA 2PZUA 2F0LA 1I6HH 1VQJA 1QG7A 1WFQA 2JN4A 3S2HH 1S5CD 4LUZA 1SR3A 1O7YA 3J81L 2QEJC 2K5DA 1C8CA 1Y69U 1KDCA 3H0GB 4OEMB 3T13A 1PFNA 1EL0A 3MFGA 5E7NA 3CXCA 1LUZA 4JV5Q 4RAUC 2JXMB 3M4PA 3ICEA 1KRSA 4GKJQ 2Q2TA 3AU7A 2HDLA 3M7GA 4K5WA 2BH2A 3Q23A 4KHPL 1BCPB 3NTHA 4ILWA 4OELB 4LAAA 3EJIA 4ZCKA 1IL8A 1TWAH 4O0AA 4XQJA 3PO2H 4H44C 1D1IA 4JVZA 4O1NA 1YHBA 2B2TA 4JI7Q 3S17H 1YI2A 1OXSC 1N32L 1NMGA 1FNWA 1KHIA 1Q46A 2WIIB 5M9OA 1UE5A 2UXBQ 3BDCA 1STAA 5KNBA 4CGYB 3K7AH 1BXTA 4R4IA 5CV6A 4A3KB 4BY1B 3CW2C 3J81j 3VA5A 1IL2A 1JOKA 4YCUA 1CUKA 2E2HB 1PV4A 4GLVB 1S5BD 4DV1L 2JA6H 4GKKQ 1QNKA 1X3GA 1F77A 1M4VA 2MNAA 1LT5D 4ALPA 3DLLA 5A2QE 4WJWA 1KLGD 4F7XA 3VYSA 4IFDG 4B3SL 3UE1A 2YTXA 4GLXA 1DCZA 2Z4IA 3TP6A 3J81i 4JBKA 1OTCA 2R7ZG 4MNOA 2HCIA 2L11A 2K04A 1HUMA 3GTOB 1TQOA 3LWEA 3CPWA 4KTAA 2B2VC 4RGNA 3ULPA 2CKZB 4L5RC 2HHHL 3KJOA 1G291 5C4ZA 3OMGA 4R4QA 1R9TB 4A3DB 1AN8A 5E1FA 3P75A 2ZXOA 5EQ0A 1LT6D 4TKOB 2R93H 3P1HA 4WFN3 1PXUA 1CTMA 3FKIH 4N9TA 4DNIA 4LK1C 3PSIA 3AMUA 5M5XB 4A3MH 1MIUA 3CCMA 2EPBA 5DM73 5M3MG 3KBXA 3K8AA 3I3CA 2ZXPA 2XRSD 1TY0A 2JQOA 1MJCA 3H0GG 2KCNA 5FLMH 4JI5L 4KD3A 2F0OA 1YIJA 5J1ZA 5DAUA 4R9WA 2MPMA 4IUQA 4DF7A 3OSOA 2B8FA 5C6AA 2X6GA 4NB3A 4J6HA 4JI1Q 3CCQA 1A0IA 2MUYA 3AFQA 3NWTA 3JAMc 1IKMA 1PYBA 1EQTA 1IKLA 1STEA 2WAQE 5EKKA 1TR5A 4N8FA 4OWXB 2RCNA 5JOBA 2XVSA 2F0TA 4IUTA 1KL9A 4DV7Q 1NUCA 3KK7A 5C4XH 4L8JA 1EIHA 1TT2A 4DU9A 4LF7Q 4XT1B 1U4MA 1U4RA 3O13A 4TQUS 2E75C 1SMXA 1JC7A 2N8NA 4HJAA 3AYHB 5C3EB 3NXWA 3M4OH 4DXGA 2F0FA 2UU9Q 2Z6KA 4A3KG 2B39A 2B2TC 4BY1G 1PFMA 1HQMC 4HIOA 1CKNB 1BUVT 2YV5A 1F2YA 4CDDC 4R4CA 5I2XA 4DR5Q 2F0NA 3KF6B 1MGSA 4LWCA 5IYBH 2GN5A 2I5LX 1A62A 3E0EA 3NENA 1WI5A 4K0KQ 2SEBD 1ESRA 1WD0A 3PF5A 1UE7A 3ND8A 3IL8A 2K14A 2BE5C 1BVSA 1BQQT 4A3EB 1VQ9A 4ZAIA 1A2UA 3NQTA 2A68D 2F0MA 2QGQA 3OTOL 3GTLB 2RSOA 4EQ5A 2KBNA 3CCJA 2IX1A 3A7AB 4XT3B 4KK7A 3HOXH 3T16A 4DGZA 3AEVA 1G6ZA 3NK9A 1JB7A 5IGGA 1E1TA 4J15A 4QIWB 3GTJH 4JI7L 3K5OA 1HNWQ 1Q8IA 1II3A 1EY8A 5I9PA 3HKZB 1FNVA 4I7ZC 3QJYA 3S16B 4A3DG 2MGSA 1B2TA 1LACA 4FF3A 3A55A 4K8IA 5TSSA 3S1RB 4DV2Q 4QY7A 3QR8A 1FGBD 1GUNA 2PCFB 1Q1BA 5DEHA 4DR4Q 2C35B 3LGJA 5I4DA 5ELBA 1AH9A 2VQEQ 3F2DA 4CDEC 2CH4A 2F0PA 2ZM6L 5NUCA 4NXMQ 4HTHA 1U9RA 3BZDB 3NTKA 3Q0AA
chains in the Genus database with same CATH topology
1I3QH 3H3VH 1K73C 2H5XA 4BXXG 2A1AA 3U50C 3GTOH 3STBC 1X6OA 1K8AC 3KDFB 5BR8Q 4LF8L 3TRZA 1K3RA 3I7FA 1EUJA 5JJKA 4P74A 4LF5Q 3J7A5 2D0OA 4B3RQ 3M85A 5IYBG 1GM5A 1VQLA 2UUBQ 3F2CA 4YHHQ 5FJ8G 4YCVA 3S1MH 1EIFA 1U0LA 4C3JH 5IP9H 2QEXA 4GS3A 4IJLA 5C3EG 1JJ2A 3PUYA 2DUDA 3EBEA 2NVTH 2NZOA 3B6YA 1N9WA 3CCSA 1Z47A 1Q12A 5M5XH 1IBLQ 1XTDA 5C44H 4OWTB 1X56A 5DLQE 3WWVA 3I2ZA 4PZ6A 4LFCL 3SGIA 2ZTEA 4YCWA 4C3IH 2CWPA 3TREA 4GNXC 1L1OA 4IFDI 1I94L 4XTCS 1XMQQ 4LFAQ 4JI4Q 4KHPQ 3GTGH 2ALYB 3G4SA 1QUQB 4A93H 4UPAA 4LUOA 4X65L 4B3TL 4QJFA 3HOXG 4AQYL 3TQYA 3RN5A 3TS0A 2KCMA 4KLKA 5M3FH 3E9HA 1XMOQ 1VQKA 2NVXH 1G6PA 1KRTA 1IBKL 2JA7H 3CPFA 4HJ7A 2Q2UA 3STBD 5LMUQ 1B7YB 3CCUA 1BBUA 2ZTDA 1OXXK 1V9PA 2NVYH 4A3FH 1PH4A 1J5EQ 2Z6KC 3BZKA 4LFBL 4A3EG 5IYCG 3F8TA 3HKSA 1MJEA 2Y0SG 3J81c 4LF4Q 2XGTA 1OXVA 4IJHA 3CCEA 1JJCB 4DV3Q 4DV5Q 1C7YA 1NE3A 4DPGA 4A3CH 4HJ5A 2BA0A 2JA8H 3A5UA 3F1ZA 5H1SE 2KCTA 4JI6L 4JI1L 5IWAL 3HOWH 4X6AH 4LNQA 1Z9FA 4JI3Q 2FXQA 1X55A 4DK3C 1E3PA 3UDIA 1UE6A 2JJQA 3NEMA 2WP8J 1HR0Q 2VZAA 1VQ7A 2RHSB 3HOZH 3EIVA 1A8VA 1VQHA 3GD7A 4BBSH 4A3LG 4DKAC 1XNQL 3OTOQ 4POFA 2R7FA 3CMEA 1BBWA 2VY3A 1VQ4A 1LYLA 3HKZG 2Y0SE 2GVAA 4KHZA 3OYYA 1T9HA 1QVCA 2JEBI 1KAWA 3PV0A 4TVAB 2QA4A 3HOVH 4GN4B 3J80c 4GKJL 1S3OA 2UXCL 4YY3L 4LUVA 2YYZA 3TS2A 3CCVA 2RHQB 2ZJRA 4DR2Q 2LXJA 1YITA 5LMNQ 4DR1L 3EN2A 2UU9L 3RZDH 2R7DA 1GO3E 2CCZA 2B63G 3PCOB 2JA5H 2MO0A 2NN6G 1VQPA 1Q82C 2F52A 3CF5A 4QIWE 2YU9H 3GTMH 4B3SQ 2CFMA 2K52A 3ER0A 2E2IH 1Q8KA 4A3IH 4DR5L 1XPUA 1VCIA 4NXNL 4MTNA 4DV0Q 4DV4L 2DGYA 4UP7A 3S14H 3L7ZC 1Q86C 4OO1G 3W1BA 1PFSA 1QZHA 3BJUA 1K83H 4AH6A 5GAHC 1K9MC 2CWAA 3T1HQ 3MXNB 3PIPA 1C9OA 1VQOA 1FJGL 1EFWA 3GTLH 5IP9G 1PH1A 3CCLA 2JEAI 3S1QH 1PHJA 4JI0L 2UXBL 2EXDA 1X54A 4RG1A 3M7NA 2IHEA 1L1OB 1Q1EA 4YWKA 4C3HH 4X64Q 5C44G 4L5SA 2HHHQ 2F4VQ 3PIOA 2ZM6Q 2PI2E 3CC7A 4R4TA 2WB1G 1M1KC 2PMZE 1IZ6A 1U5KA 1Y1WG 3KF8B 3KYHC 4B3ML 3S2DH 5JJLA 3RN2A 2YTYA 4BY7H 1FGUA 1W2BA 1OXUA 5HY6A 2V1CC 4A93G 3RLOA 5IP7H 4JI2L 2OQ0A 1VQ8A 4X66L 1VQGA 2GVBA 5M3FG 1SE8A 1GD7A 2YTVA 4O2DA 1VQ6A 3M3YH 4GKKL 3ZJYC 4LF8Q 2JA9A 2JA7G 1VQMA 1C0AA 1EOVA 1HNWL 2E5LL 3PO3G 2EIFA 1DGSA 4A3FG 1XPRA 4JI5Q 3E9IA 3GTKH 4DV6L 1XNRL 1N33L 1VQEA 2HIXA 1S40A 2VUMG 2WB1E 2LSSA 4HIDA 1L2FA 2KHIA 1JT8A 4YWLA 1XPOA 2VNUD 4L5QA 4A3CG 2JA8G 3GTQH 1E7ZA 2LXKA 2N78A 1SROA 3A74A 3CAMA 3OW2A 3HOWG 4DR3Q 4IO9A 1B70B 3S15H 2Q2IA 4DV2L 1K8GA 1HNXL 2PQAA 3CQZH 2A19A 3KJPA 4OWWB 3HOZG 1FVIA 4LFCQ 1IXRA 5C4JH 3RZOH 4DR4L 1I50H 4JC0A 1YHQA 2B29A 2R6GA 4BBSG 5C0XJ 4DUZQ 1PH7A 2R92H 1N36Q 3J80i 3RLFA 1TXYA 1I5FA 1X3EA 1HNZL 4JV5L 1EWIA 3K0XA 4HJ9A 1EQRA 3T1YL 4BA2I 1E22A 1L1OC 4B3TQ 3PO3H 4IOAA 4LF6L 5ELOA 2MQHA 4KI0A 5GAGC 3A5ZB 4AQYQ 4NXML 1IBMQ 4X62L 3NELA 4HIMA 4OO1I 3UDGA 4R1JA 2VW9A 2PNHA 1Y1WH 2I5HA 1VQDA 4JYAQ 3PF4A 4IOCA 3KOJA 2EQSA 1V43A 4UY8C 2NVQH 1PH3A 3D0FA 3UDXA 2JA5G 1LTLA 2IX0A 5BR8L 1KD1C 1WCMH 2AMCB 2E8GA 5FLXc 1H95A 1KXLA 5JEAG 4A3IG 4B3RL 1XJVA 1HR0W 4GOPA 4QQBX 1YJNA 1VQJA 1I6HH 2R7ZH 2UUBL 1WFQA 4EX5A 1KC8C 2I0QA 1PH8A 5C0XI 2VUMH 3S2HH 4LUZA 1SR3A 5J3BA 5GQOA 2UUCQ 3S1NH 4A3GH 2OWOA 1XNQQ 3AQQA 1IBLL 2I5MX 3F2BA 2UUAL 4IPCA 5E7NA 1L0WA 3FHWA 2Z0SA 1EQQA 3CXCA 1LUZA 4R4OA 3GTPH 4JV5Q 3HOUH 2PI2A 3M4PA 4UP9A 3K80C 3MEFA 1KRSA 1SFOH 3CP0A 3ICEA 2Q2TA 1JE5A 4GKJQ 2UXCQ 4YY3Q 2BH2A 1XMQL 5LMNW 4JI4L 4LFAL 1UWVA 3KFUA 4KHPL 1D7QA 4DV7L 1UEBA 2L15A 4BY7G 1RL2A 1Y1VH 4YWMA 4DR1Q 3GO5A 4DUYL 1XMOL 5IP7G 4LF7L 1WYDA 1J6QA 4JYAL 5K36G 2KHJA 5M5WH 3H0GH 1TWAH 4O0AA 4DAMA 5LMUL 4LF9L 3PO2H 3HOVG 1OXTA 1N34L 3CC2A 4UP8A 5IYDG 4OX9L 1YHBA 3S17H 4JI7Q 3KLWA 4AYBG 1YI2A 4NXNQ 2K5HA 4QGUA 2ATWA 1OXSC 4DR6L 4P72A 2CQOA 4LF4L 3CC4A 1N32L 2HIVA 5AJ3Q 2HQLA 1NMGA 2VL6A 1JJGA 4A3BH 1KHIA 1M90C 1Q46A 3K81C 2AKWB 2PQAB 1VS0A 2K4KA 1UE5A 3HKZE 4NPSA 1N8RC 2OTLA 4DR7Q 4JI0Q 2BA1A 2UXBQ 3PGZA 4A3JH 2VS1A 1HR0L 5ELNA 1PYSB 1W3SA 3K7AH 4K0KL 3G6EA 4R4IA 3RNUA 2MO1A 3PUVA 4P73A 3CW2C 3U4ZA 1B8AA 4B3MQ 3J81j 1IL2A 2R92G 2R93G 2Q2HA 4P71A 4YCUA 1CUKA 4JOIA 4JBWA 4GLVB 1PV4A 3I4MH 4DV1L 4JG2A 4JI2Q 4DK6C 3ULLA 1PH9A 1WJJA 3UE0A 2JA6H 4X66Q 4Y52H 4A76A 4GKKQ 2UXDQ 1YVCA 1HJPA 4DR2L 1X3GA 1TWHH 3PUZA 2WFWA 4BBRH 5FLMG 5LMNL 2E5LQ 2ES2A 4JBMA 2MNAA 4ALPA 3M9BA 3DLLA 1V1QA 2IY5B 1XNRQ 4A3KH 4IFDG 1N33Q 4JI8Q 4B3SL 2D0PA 4BY1H 4GOPB 3UE1A 1E1OA 4PMWA 1WCMG 2YTXA 4ME3A 4GLXA 1PH6A 4DV0L 1QVGA 2E2HH 3J81i 2MFIA 2F3IA 4JBKA 1OTCA 1BKBA 2R7ZG 4AIMA 1CKNA 1HNXQ 1SRUA 1TWCH 1P16A 2RF4A 3KF6A 4LW1A 4MNOA 3GDEA 4PZ8A 4GN5A 1G51A 4A4IA 4A3GG 3S24A 3CPWA 1TWGH 3J7ZC 1X9NA 4PG3A 1HNZQ 3ULPA 2CKZB 3RR5A 2BH8A 4L5RC 4QL5A 2HHHL 2K50A 3KJOA 1G291 3HOUG 2VQFL 4LF6Q 4R4QA 3DM3A 4X62Q 2NN6I 1PH5A 1I94Q 3H3VI 5GADC 2OTJA 2R93H 3FKIH 4DNIA 2VQEL 3PSIA 1Y1VG 1VQAA 3K7UC 4X65Q 3U58A 1MIUA 3CCMA 1X65A 4A3MH 3TEHB 5M3MG 3K8AA 2WAQG 3H0GG 2JQOA 1MJCA 3G48A 4XIGS 3PO2G 1IBKQ 5FLMH 1YHAA 4JI5L 4JCVE 1YIJA 4LFBQ 1Q7YC 3BU2A 4PZ7A 1R9TH 4H02A 1IYJB 4A3DH 1NBWA 2K5VA 3I4OA 1YJWA 4GOPC 1SLJA 2NZHA 3A0JA 1HZAA 5GAEC 1VQNA 3HOYG 4A3BG 4LF5L 1CSQA 4NB3A 4JI6Q 1EYGA 4IPDA 4JI1Q 4FDBA 3CCQA 4DR3L 3I4NH 1A0IA 5IWAQ 2UUAQ 3AFQA 4A3JG 3JAMc 1AE2A 1PYBA 4GN3B 4YHHL 1AE3A 2WAQE 1HZCA 4IPGA 4OWXB 2IHFA 3H15A 1VQBA 1FL0A 2RCNA 4DUZL 1N36L 1KL9A 4RMFA 5IY0A 4DV7Q 4GNXA 2ZJQA 3U4VA 4WJ4A 5C4XH 3I55A 4DUYQ 3I4MG 4LF7Q 1IBML 2JA6G 5IT9c 4TQUS 1D8LA 1SMXA 1TWFH 2N8NA 1NTGA 4HJAA 4LF9Q 3AYHB 3M4OH 3L2PA 1N34Q 3ULJA 4BBRG 2OQKA 4HIKA 4OONA 4OX9Q 4BA1I 1VQCA 3D31A 4DR6Q 1YEZA 2UU9Q 1P8LA 4JI8L 1HH2P 3I56A 4BXXH 1N32Q 2Z6KA 5M3MH 4A3KG 4DAYB 4BY1G 3L0OA 5JEAJ 3PUWA 3ERSX 1O7IA 1YNXA 4HIOA 1J5EL 1CKNB 2YV5A 1UE1A 4OXPA 3M4QA 4R4CA 4DR5Q 1JMCA 3KF6B 4LWCA 2N3SA 5IYBH 1S72A 3KDFA 2GN5A 3Q8DA 4DV4Q 2I5LX 1A62A 3E0EA 3NENA 5FJ8H 1YBYA 1WI5A 1HZ9A 1CKOA 4MZ9A 2UUCL 1ASZA 4DV3L 4DV5L 4K0KQ 5JJIA 5C3EH 3PF5A 1UE7A 4JBJA 1FJGQ 3HOYH 2ZTCA 2JK8A 5HGQA 2K14A 4JI3L 3CCRA 1Q81C 2HT1A 3W1GA 1BVSA 1LM0A 4DV1Q 1VQ9A 1NJIC 1VQFA 3G71A 1EIYB 3OTOL 2QGQA 4JOIC 1MKHA 4AYBE 3FP9A 1A63A 1GKHA 2KBNA 4EQ5A 2K5NA 3HFZB 3CCJA 2IX1A 1YZ6A 3FKIG 3HOXH 3IRBA 3AEVA 4A3MG 2KENA 2AWNA 1QUQA 2OCEA 1JB7A 2K75A 1YJ9A 3VDYA 1E1TA 4J15A 5M5YH 4APVA 3GTJH 4JI7L 1HNWQ 4L5TA 1CSPA 4A3EH 5IYCH 2A8VA 1RIPA 2IT1A 3UDFA 4DV6Q 1KQSA 5AJ3L 1ASYA 4GLAC 2B3GA 1VQ5A 4A3DG 3W5OA 3RLNA 1X3FA 2XTIA 1Y14B 2AHOB 4DR7L 3JAMi 1CKMA 1PVOA 1HZBA 4Y7NH 3PUXA 2D62A 1NY4A 3I4NG 4WJ3M 1PH2A 1NMFA 3JC66 4DV2Q 3AFPA 4QY7A 3T1HL 4IPHA 2VQFQ 4GNXB 2ZJPA 4A75A 1WOCA 2ASBA 1Q1BA 1E24A 4DR4Q 4A3LH 1VQIA 2C35B 5IE8A 3LGJA 5EAYA 4POGA 3BZCA 4C2MH 5C0XG 1QZGA 1SN8A 5GROA 4HJ8A 1AH9A 3S16H 4X64L 2VQEQ 3CMAA 3T1YQ 2E2JH 5C4XG 3F2DA 2F4VL 5IYDH 1PA6A 2ZM6L 2UXDL 1QVFA 4NXMQ 1KIXA 2ID0A 3CD6A 2JE6I 2AWOA 3S1RH 2B63H 2N49A 1GVPA 3NBHB 4IFDJ 4P75A 1K0RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I3Q H;  3H3V H;  1K73 C;  2H5X A;  4BXX G;  2A1A A;  3U50 C;  3GTO H;  3STB C;  1X6O A;  1K8A C;  3KDF B;  5BR8 Q;  4LF8 L;  3TRZ A;  1K3R A;  3I7F A;  1EUJ A;  5JJK A;  4P74 A;  4LF5 Q;  3J7A 5;  2D0O A;  4B3R Q;  3M85 A;  5IYB G;  1GM5 A;  1VQL A;  2UUB Q;  3F2C A;  4YHH Q;  5FJ8 G;  4YCV A;  3S1M H;  1EIF A;  1U0L A;  4C3J H;  5IP9 H;  2QEX A;  4GS3 A;  4IJL A;  5C3E G;  1JJ2 A;  3PUY A;  2DUD A;  3EBE A;  2NVT H;  2NZO A;  3B6Y A;  1N9W A;  3CCS A;  1Z47 A;  1Q12 A;  5M5X H;  1IBL Q;  1XTD A;  5C44 H;  4OWT B;  1X56 A;  5DLQ E;  3WWV A;  3I2Z A;  4PZ6 A;  4LFC L;  3SGI A;  2ZTE A;  4YCW A;  4C3I H;  2CWP A;  3TRE A;  4GNX C;  1L1O A;  4IFD I;  1I94 L;  4XTC S;  1XMQ Q;  4LFA Q;  4JI4 Q;  4KHP Q;  3GTG H;  2ALY B;  3G4S A;  1QUQ B;  4A93 H;  4UPA A;  4LUO A;  4X65 L;  4B3T L;  4QJF A;  3HOX G;  4AQY L;  3TQY A;  3RN5 A;  3TS0 A;  2KCM A;  4KLK A;  5M3F H;  3E9H A;  1XMO Q;  1VQK A;  2NVX H;  1G6P A;  1KRT A;  1IBK L;  2JA7 H;  3CPF A;  4HJ7 A;  2Q2U A;  3STB D;  5LMU Q;  1B7Y B;  3CCU A;  1BBU A;  2ZTD A;  1OXX K;  1V9P A;  2NVY H;  4A3F H;  1PH4 A;  1J5E Q;  2Z6K C;  3BZK A;  4LFB L;  4A3E G;  5IYC G;  3F8T A;  3HKS A;  1MJE A;  2Y0S G;  3J81 c;  4LF4 Q;  2XGT A;  1OXV A;  4IJH A;  3CCE A;  1JJC B;  4DV3 Q;  4DV5 Q;  1C7Y A;  1NE3 A;  4DPG A;  4A3C H;  4HJ5 A;  2BA0 A;  2JA8 H;  3A5U A;  3F1Z A;  5H1S E;  2KCT A;  4JI6 L;  4JI1 L;  5IWA L;  3HOW H;  4X6A H;  4LNQ A;  1Z9F A;  4JI3 Q;  2FXQ A;  1X55 A;  4DK3 C;  1E3P A;  3UDI A;  1UE6 A;  2JJQ A;  3NEM A;  2WP8 J;  1HR0 Q;  2VZA A;  1VQ7 A;  2RHS B;  3HOZ H;  3EIV A;  1A8V A;  1VQH A;  3GD7 A;  4BBS H;  4A3L G;  4DKA C;  1XNQ L;  3OTO Q;  4POF A;  2R7F A;  3CME A;  1BBW A;  2VY3 A;  1VQ4 A;  1LYL A;  3HKZ G;  2Y0S E;  2GVA A;  4KHZ A;  3OYY A;  1T9H A;  1QVC A;  2JEB I;  1KAW A;  3PV0 A;  4TVA B;  2QA4 A;  3HOV H;  4GN4 B;  3J80 c;  4GKJ L;  1S3O A;  2UXC L;  4YY3 L;  4LUV A;  2YYZ A;  3TS2 A;  3CCV A;  2RHQ B;  2ZJR A;  4DR2 Q;  2LXJ A;  1YIT A;  5LMN Q;  4DR1 L;  3EN2 A;  2UU9 L;  3RZD H;  2R7D A;  1GO3 E;  2CCZ A;  2B63 G;  3PCO B;  2JA5 H;  2MO0 A;  2NN6 G;  1VQP A;  1Q82 C;  2F52 A;  3CF5 A;  4QIW E;  2YU9 H;  3GTM H;  4B3S Q;  2CFM A;  2K52 A;  3ER0 A;  2E2I H;  1Q8K A;  4A3I H;  4DR5 L;  1XPU A;  1VCI A;  4NXN L;  4MTN A;  4DV0 Q;  4DV4 L;  2DGY A;  4UP7 A;  3S14 H;  3L7Z C;  1Q86 C;  4OO1 G;  3W1B A;  1PFS A;  1QZH A;  3BJU A;  1K83 H;  4AH6 A;  5GAH C;  1K9M C;  2CWA A;  3T1H Q;  3MXN B;  3PIP A;  1C9O A;  1VQO A;  1FJG L;  1EFW A;  3GTL H;  5IP9 G;  1PH1 A;  3CCL A;  2JEA I;  3S1Q H;  1PHJ A;  4JI0 L;  2UXB L;  2EXD A;  1X54 A;  4RG1 A;  3M7N A;  2IHE A;  1L1O B;  1Q1E A;  4YWK A;  4C3H H;  4X64 Q;  5C44 G;  4L5S A;  2HHH Q;  2F4V Q;  3PIO A;  2ZM6 Q;  2PI2 E;  3CC7 A;  4R4T A;  2WB1 G;  1M1K C;  2PMZ E;  1IZ6 A;  1U5K A;  1Y1W G;  3KF8 B;  3KYH C;  4B3M L;  3S2D H;  5JJL A;  3RN2 A;  2YTY A;  4BY7 H;  1FGU A;  1W2B A;  1OXU A;  5HY6 A;  2V1C C;  4A93 G;  3RLO A;  5IP7 H;  4JI2 L;  2OQ0 A;  1VQ8 A;  4X66 L;  1VQG A;  2GVB A;  5M3F G;  1SE8 A;  1GD7 A;  2YTV A;  4O2D A;  1VQ6 A;  3M3Y H;  4GKK L;  3ZJY C;  4LF8 Q;  2JA9 A;  2JA7 G;  1VQM A;  1C0A A;  1EOV A;  1HNW L;  2E5L L;  3PO3 G;  2EIF A;  1DGS A;  4A3F G;  1XPR A;  4JI5 Q;  3E9I A;  3GTK H;  4DV6 L;  1XNR L;  1N33 L;  1VQE A;  2HIX A;  1S40 A;  2VUM G;  2WB1 E;  2LSS A;  4HID A;  1L2F A;  2KHI A;  1JT8 A;  4YWL A;  1XPO A;  2VNU D;  4L5Q A;  4A3C G;  2JA8 G;  3GTQ H;  1E7Z A;  2LXK A;  2N78 A;  1SRO A;  3A74 A;  3CAM A;  3OW2 A;  3HOW G;  4DR3 Q;  4IO9 A;  1B70 B;  3S15 H;  2Q2I A;  4DV2 L;  1K8G A;  1HNX L;  2PQA A;  3CQZ H;  2A19 A;  3KJP A;  4OWW B;  3HOZ G;  1FVI A;  4LFC Q;  1IXR A;  5C4J H;  3RZO H;  4DR4 L;  1I50 H;  4JC0 A;  1YHQ A;  2B29 A;  2R6G A;  4BBS G;  5C0X J;  4DUZ Q;  1PH7 A;  2R92 H;  1N36 Q;  3J80 i;  3RLF A;  1TXY A;  1I5F A;  1X3E A;  1HNZ L;  4JV5 L;  1EWI A;  3K0X A;  4HJ9 A;  1EQR A;  3T1Y L;  4BA2 I;  1E22 A;  1L1O C;  4B3T Q;  3PO3 H;  4IOA A;  4LF6 L;  5ELO A;  2MQH A;  4KI0 A;  5GAG C;  3A5Z B;  4AQY Q;  4NXM L;  1IBM Q;  4X62 L;  3NEL A;  4HIM A;  4OO1 I;  3UDG A;  4R1J A;  2VW9 A;  2PNH A;  1Y1W H;  2I5H A;  1VQD A;  4JYA Q;  3PF4 A;  4IOC A;  3KOJ A;  2EQS A;  1V43 A;  4UY8 C;  2NVQ H;  1PH3 A;  3D0F A;  3UDX A;  2JA5 G;  1LTL A;  2IX0 A;  5BR8 L;  1KD1 C;  1WCM H;  2AMC B;  2E8G A;  5FLX c;  1H95 A;  1KXL A;  5JEA G;  4A3I G;  4B3R L;  1XJV A;  1HR0 W;  4GOP A;  4QQB X;  1YJN A;  1VQJ A;  1I6H H;  2R7Z H;  2UUB L;  1WFQ A;  4EX5 A;  1KC8 C;  2I0Q A;  1PH8 A;  5C0X I;  2VUM H;  3S2H H;  4LUZ A;  1SR3 A;  5J3B A;  5GQO A;  2UUC Q;  3S1N H;  4A3G H;  2OWO A;  1XNQ Q;  3AQQ A;  1IBL L;  2I5M X;  3F2B A;  2UUA L;  4IPC A;  5E7N A;  1L0W A;  3FHW A;  2Z0S A;  1EQQ A;  3CXC A;  1LUZ A;  4R4O A;  3GTP H;  4JV5 Q;  3HOU H;  2PI2 A;  3M4P A;  4UP9 A;  3K80 C;  3MEF A;  1KRS A;  1SFO H;  3CP0 A;  3ICE A;  2Q2T A;  1JE5 A;  4GKJ Q;  2UXC Q;  4YY3 Q;  2BH2 A;  1XMQ L;  5LMN W;  4JI4 L;  4LFA L;  1UWV A;  3KFU A;  4KHP L;  1D7Q A;  4DV7 L;  1UEB A;  2L15 A;  4BY7 G;  1RL2 A;  1Y1V H;  4YWM A;  4DR1 Q;  3GO5 A;  4DUY L;  1XMO L;  5IP7 G;  4LF7 L;  1WYD A;  1J6Q A;  4JYA L;  5K36 G;  2KHJ A;  5M5W H;  3H0G H;  1TWA H;  4O0A A;  4DAM A;  5LMU L;  4LF9 L;  3PO2 H;  3HOV G;  1OXT A;  1N34 L;  3CC2 A;  4UP8 A;  5IYD G;  4OX9 L;  1YHB A;  3S17 H;  4JI7 Q;  3KLW A;  4AYB G;  1YI2 A;  4NXN Q;  2K5H A;  4QGU A;  2ATW A;  1OXS C;  4DR6 L;  4P72 A;  2CQO A;  4LF4 L;  3CC4 A;  1N32 L;  2HIV A;  5AJ3 Q;  2HQL A;  1NMG A;  2VL6 A;  1JJG A;  4A3B H;  1KHI A;  1M90 C;  1Q46 A;  3K81 C;  2AKW B;  2PQA B;  1VS0 A;  2K4K A;  1UE5 A;  3HKZ E;  4NPS A;  1N8R C;  2OTL A;  4DR7 Q;  4JI0 Q;  2BA1 A;  2UXB Q;  3PGZ A;  4A3J H;  2VS1 A;  1HR0 L;  5ELN A;  1PYS B;  1W3S A;  3K7A H;  4K0K L;  3G6E A;  4R4I A;  3RNU A;  2MO1 A;  3PUV A;  4P73 A;  3CW2 C;  3U4Z A;  1B8A A;  4B3M Q;  3J81 j;  1IL2 A;  2R92 G;  2R93 G;  2Q2H A;  4P71 A;  4YCU A;  1CUK A;  4JOI A;  4JBW A;  4GLV B;  1PV4 A;  3I4M H;  4DV1 L;  4JG2 A;  4JI2 Q;  4DK6 C;  3ULL A;  1PH9 A;  1WJJ A;  3UE0 A;  2JA6 H;  4X66 Q;  4Y52 H;  4A76 A;  4GKK Q;  2UXD Q;  1YVC A;  1HJP A;  4DR2 L;  1X3G A;  1TWH H;  3PUZ A;  2WFW A;  4BBR H;  5FLM G;  5LMN L;  2E5L Q;  2ES2 A;  4JBM A;  2MNA A;  4ALP A;  3M9B A;  3DLL A;  1V1Q A;  2IY5 B;  1XNR Q;  4A3K H;  4IFD G;  1N33 Q;  4JI8 Q;  4B3S L;  2D0P A;  4BY1 H;  4GOP B;  3UE1 A;  1E1O A;  4PMW A;  1WCM G;  2YTX A;  4ME3 A;  4GLX A;  1PH6 A;  4DV0 L;  1QVG A;  2E2H H;  3J81 i;  2MFI A;  2F3I A;  4JBK A;  1OTC A;  1BKB A;  2R7Z G;  4AIM A;  1CKN A;  1HNX Q;  1SRU A;  1TWC H;  1P16 A;  2RF4 A;  3KF6 A;  4LW1 A;  4MNO A;  3GDE A;  4PZ8 A;  4GN5 A;  1G51 A;  4A4I A;  4A3G G;  3S24 A;  3CPW A;  1TWG H;  3J7Z C;  1X9N A;  4PG3 A;  1HNZ Q;  3ULP A;  2CKZ B;  3RR5 A;  2BH8 A;  4L5R C;  4QL5 A;  2HHH L;  2K50 A;  3KJO A;  1G29 1;  3HOU G;  2VQF L;  4LF6 Q;  4R4Q A;  3DM3 A;  4X62 Q;  2NN6 I;  1PH5 A;  1I94 Q;  3H3V I;  5GAD C;  2OTJ A;  2R93 H;  3FKI H;  4DNI A;  2VQE L;  3PSI A;  1Y1V G;  1VQA A;  3K7U C;  4X65 Q;  3U58 A;  1MIU A;  3CCM A;  1X65 A;  4A3M H;  3TEH B;  5M3M G;  3K8A A;  2WAQ G;  3H0G G;  2JQO A;  1MJC A;  3G48 A;  4XIG S;  3PO2 G;  1IBK Q;  5FLM H;  1YHA A;  4JI5 L;  4JCV E;  1YIJ A;  4LFB Q;  1Q7Y C;  3BU2 A;  4PZ7 A;  1R9T H;  4H02 A;  1IYJ B;  4A3D H;  1NBW A;  2K5V A;  3I4O A;  1YJW A;  4GOP C;  1SLJ A;  2NZH A;  3A0J A;  1HZA A;  5GAE C;  1VQN A;  3HOY G;  4A3B G;  4LF5 L;  1CSQ A;  4NB3 A;  4JI6 Q;  1EYG A;  4IPD A;  4JI1 Q;  4FDB A;  3CCQ A;  4DR3 L;  3I4N H;  1A0I A;  5IWA Q;  2UUA Q;  3AFQ A;  4A3J G;  3JAM c;  1AE2 A;  1PYB A;  4GN3 B;  4YHH L;  1AE3 A;  2WAQ E;  1HZC A;  4IPG A;  4OWX B;  2IHF A;  3H15 A;  1VQB A;  1FL0 A;  2RCN A;  4DUZ L;  1N36 L;  1KL9 A;  4RMF A;  5IY0 A;  4DV7 Q;  4GNX A;  2ZJQ A;  3U4V A;  4WJ4 A;  5C4X H;  3I55 A;  4DUY Q;  3I4M G;  4LF7 Q;  1IBM L;  2JA6 G;  5IT9 c;  4TQU S;  1D8L A;  1SMX A;  1TWF H;  2N8N A;  1NTG A;  4HJA A;  4LF9 Q;  3AYH B;  3M4O H;  3L2P A;  1N34 Q;  3ULJ A;  4BBR G;  2OQK A;  4HIK A;  4OON A;  4OX9 Q;  4BA1 I;  1VQC A;  3D31 A;  4DR6 Q;  1YEZ A;  2UU9 Q;  1P8L A;  4JI8 L;  1HH2 P;  3I56 A;  4BXX H;  1N32 Q;  2Z6K A;  5M3M H;  4A3K G;  4DAY B;  4BY1 G;  3L0O A;  5JEA J;  3PUW A;  3ERS X;  1O7I A;  1YNX A;  4HIO A;  1J5E L;  1CKN B;  2YV5 A;  1UE1 A;  4OXP A;  3M4Q A;  4R4C A;  4DR5 Q;  1JMC A;  3KF6 B;  4LWC A;  2N3S A;  5IYB H;  1S72 A;  3KDF A;  2GN5 A;  3Q8D A;  4DV4 Q;  2I5L X;  1A62 A;  3E0E A;  3NEN A;  5FJ8 H;  1YBY A;  1WI5 A;  1HZ9 A;  1CKO A;  4MZ9 A;  2UUC L;  1ASZ A;  4DV3 L;  4DV5 L;  4K0K Q;  5JJI A;  5C3E H;  3PF5 A;  1UE7 A;  4JBJ A;  1FJG Q;  3HOY H;  2ZTC A;  2JK8 A;  5HGQ A;  2K14 A;  4JI3 L;  3CCR A;  1Q81 C;  2HT1 A;  3W1G A;  1BVS A;  1LM0 A;  4DV1 Q;  1VQ9 A;  1NJI C;  1VQF A;  3G71 A;  1EIY B;  3OTO L;  2QGQ A;  4JOI C;  1MKH A;  4AYB E;  3FP9 A;  1A63 A;  1GKH A;  2KBN A;  4EQ5 A;  2K5N A;  3HFZ B;  3CCJ A;  2IX1 A;  1YZ6 A;  3FKI G;  3HOX H;  3IRB A;  3AEV A;  4A3M G;  2KEN A;  2AWN A;  1QUQ A;  2OCE A;  1JB7 A;  2K75 A;  1YJ9 A;  3VDY A;  1E1T A;  4J15 A;  5M5Y H;  4APV A;  3GTJ H;  4JI7 L;  1HNW Q;  4L5T A;  1CSP A;  4A3E H;  5IYC H;  2A8V A;  1RIP A;  2IT1 A;  3UDF A;  4DV6 Q;  1KQS A;  5AJ3 L;  1ASY A;  4GLA C;  2B3G A;  1VQ5 A;  4A3D G;  3W5O A;  3RLN A;  1X3F A;  2XTI A;  1Y14 B;  2AHO B;  4DR7 L;  3JAM i;  1CKM A;  1PVO A;  1HZB A;  4Y7N H;  3PUX A;  2D62 A;  1NY4 A;  3I4N G;  4WJ3 M;  1PH2 A;  1NMF A;  3JC6 6;  4DV2 Q;  3AFP A;  4QY7 A;  3T1H L;  4IPH A;  2VQF Q;  4GNX B;  2ZJP A;  4A75 A;  1WOC A;  2ASB A;  1Q1B A;  1E24 A;  4DR4 Q;  4A3L H;  1VQI A;  2C35 B;  5IE8 A;  3LGJ A;  5EAY A;  4POG A;  3BZC A;  4C2M H;  5C0X G;  1QZG A;  1SN8 A;  5GRO A;  4HJ8 A;  1AH9 A;  3S16 H;  4X64 L;  2VQE Q;  3CMA A;  3T1Y Q;  2E2J H;  5C4X G;  3F2D A;  2F4V L;  5IYD H;  1PA6 A;  2ZM6 L;  2UXD L;  1QVF A;  4NXM Q;  1KIX A;  2ID0 A;  3CD6 A;  2JE6 I;  2AWO A;  3S1R H;  2B63 H;  2N49 A;  1GVP A;  3NBH B;  4IFD J;  4P75 A;  1K0R A; 
#chains in the Genus database with same CATH topology
 1I3Q H;  3H3V H;  5C44 B;  2A1A A;  1K8A C;  1RKN A;  1QWY A;  5BR8 Q;  3M4Y A;  4C3I B;  2WB1 B;  4P74 A;  4LF5 Q;  3QO2 A;  2D0O A;  1JCK B;  1PZJ D;  3ZYY X;  3A8I E;  4B3R Q;  2A74 C;  3GTG B;  3TDQ A;  1GM5 A;  4KKS A;  3F2C A;  1IW7 C;  4OL7 A;  2RA4 A;  5FJ8 G;  4YCV A;  1B44 D;  1PRT C;  1EIF A;  1U0L A;  4C3J H;  1JJ2 A;  5C3E G;  4L63 B;  1B9M A;  3PUY A;  1EQV A;  2C9O A;  2NZO A;  2OT2 A;  2KOL A;  4OWT B;  4FVM A;  3WWV A;  1B9N A;  4PZ6 A;  4DK0 A;  4IZ8 A;  2CWP A;  3C1E A;  4QF4 A;  5ISR A;  4JI4 Q;  1WTP A;  1JR0 D;  3G4S A;  4J1M A;  4LUO A;  4M1U B;  4B3T L;  1GUT A;  3TQY A;  5M3F H;  3E9H A;  1KRT A;  3HOZ B;  4EQP A;  4OIK A;  3CPF A;  4HJ7 A;  4JYA L;  3PO3 H;  2Z6K C;  1JWU D;  4A3E G;  4FXD A;  2L4N A;  1MJE A;  3J81 c;  4LF4 Q;  4IJH A;  3HOV B;  3TSS A;  1NE3 A;  4A3C H;  4HJ5 A;  4EQN A;  1HPC A;  3RMH A;  4JI1 L;  2B8G A;  2JP1 A;  3HOW H;  1AW7 A;  1D5X C;  4G57 A;  2FXQ A;  1X55 A;  2IJ0 A;  3OMC A;  1RHP A;  1HR0 Q;  1TS2 A;  1S5F D;  4GZY C;  1X32 A;  4A3L G;  4JPB W;  5C5L A;  1L0X B;  2PW7 A;  4FYD A;  3CME A;  2E2I B;  1VQ4 A;  2Q8I B;  3HKZ G;  4HR7 B;  2VNU D;  3R3O A;  1T9H A;  4TVA B;  3CRL C;  3I73 A;  4CKE A;  2D9U A;  2LXJ A;  1YIT A;  5LMN Q;  1H9J A;  5CR3 A;  2UU9 L;  3RZD H;  2CCZ A;  2AUK A;  1F9Q A;  2JA5 H;  1VQP A;  1YNN C;  3CF5 A;  4C3H B;  2CFM A;  1SXT A;  3H6M A;  4DR5 L;  1G91 A;  3CKI B;  3S14 H;  1BCP F;  1Q86 C;  2SNS A;  4KKT A;  1PFS A;  4K6L A;  3E6Z X;  2MHV A;  4AH6 A;  5IIF A;  2CWA A;  1K9M C;  3PIP A;  3VYU A;  1C9O A;  1MI2 A;  2CHB D;  1PH1 A;  3S1Q H;  2TSS A;  4JI0 L;  2EXD A;  2F0I A;  4RG1 A;  4YWK A;  5C44 G;  3GP7 A;  3MC0 B;  4X64 Q;  4L5S A;  1ZYR D;  1TY2 A;  2K6A A;  1YNJ D;  4C3I G;  3BVG A;  2WB1 G;  4R4T A;  2PMZ E;  2F1M A;  2L9H A;  1IZ6 A;  3L9A X;  2F0K A;  2GA4 B;  3RLO A;  2SDF A;  5IP7 H;  3CRK C;  2OQ0 A;  1VQ8 A;  1VQG A;  1VQ6 A;  2A6E C;  1HNW L;  1HTL D;  1DJR D;  3E9I A;  3NP8 A;  1XNR L;  3X3M A;  1N33 L;  2HIX A;  1L2F A;  2KHI A;  3FDT A;  1VF7 A;  2N78 A;  3CAM A;  3OW2 A;  4OGQ C;  4DR3 Q;  3S15 H;  4DV2 L;  4XQQ A;  3CQZ H;  1HNX L;  1CA5 A;  3HOZ G;  2NVQ B;  4DR4 L;  1YHQ A;  2B29 A;  5C0X J;  2R92 H;  1N36 Q;  1X3E A;  1I5F A;  1EWI A;  3K0X A;  1I4P A;  4BA2 I;  4IOA A;  4AQY Q;  2MQH A;  2O5I C;  3ONA B;  3A5Z B;  3HOV G;  4NXM L;  1ENF A;  2HDM A;  2VUM B;  3UDG A;  1MSH A;  1Y1W H;  3I90 A;  4IOC A;  3SXH A;  3TZU A;  3D0F A;  3UDX A;  4RHS A;  3Q24 A;  3EQL C;  3GTP B;  5BR8 L;  1IHZ A;  3HOU B;  3K0Y A;  1KXL A;  5JEA G;  4MHE A;  4B3R L;  4KJO A;  3HZX A;  4GOP A;  2Q8R E;  1KC8 C;  2SOB A;  5KGU A;  1PH8 A;  2A5H A;  1Y1V B;  3S1N H;  1IW7 D;  4A3G H;  2F0U A;  2RBM A;  2WAQ B;  4KD4 A;  2OWO A;  1LAB A;  5LHY 1;  1XNQ Q;  3LNN A;  4IUP A;  1IYV A;  2LMC B;  4IPC A;  4X3T A;  1L0W A;  4FXK C;  4QCL A;  4R4O A;  2PZT A;  2PI2 A;  2EJG C;  2LKV A;  1LLR D;  2M2L A;  2NUC A;  4UP9 A;  4C3H G;  2IX3 A;  1SFO H;  1ILP A;  2UXC Q;  4YY3 Q;  4JI4 L;  4A3B B;  4YWM A;  1DYQ A;  1WYD A;  4A3J B;  5CV8 A;  1AP0 A;  5K36 G;  5KYL A;  3NBI A;  1CHQ D;  5M5W H;  1GUG A;  1N34 L;  2ZT9 C;  4G7O C;  4OX9 L;  4EGV A;  1ONL A;  4DR6 L;  4NXN Q;  1S5E D;  4QGU A;  3A56 A;  4LF4 L;  5LL6 S;  2HQL A;  3I4M B;  2VL6 A;  1JJG A;  5D14 A;  5CC4 A;  1M90 C;  3K81 C;  2PQA B;  3HKZ E;  2F0E A;  4I7A A;  4BBR B;  1HR0 L;  4E6I A;  1CHP D;  2EYJ A;  4P73 A;  4RCN A;  2R93 G;  4JBW A;  4U68 A;  4JI2 Q;  4DK6 C;  3UE0 A;  4X66 Q;  4CKC A;  4Y52 H;  1TWC B;  1HJP A;  2O4X A;  3RD4 A;  1B1Z A;  1TWH H;  2WFW A;  3PUZ A;  5FLM G;  5LMN L;  2E5L Q;  5EPK A;  3OIP A;  3ITP A;  3R2I A;  1NNX A;  1V1Q A;  2PYK A;  2IY5 B;  2EYM A;  4RCO A;  1YNN D;  4PMW A;  4XDX A;  3LWU A;  1U4L A;  2AQ3 B;  4DAY A;  1EOT A;  1SYC A;  2Z8L A;  1I3Q B;  3GDE A;  1EYC A;  1G51 A;  2IL8 A;  3WOF A;  4A4I A;  4I65 A;  1TWG H;  1X9N A;  4PG3 A;  1PYW D;  1D2B A;  3RR5 A;  1RF2 D;  2B2W C;  4QL5 A;  3HOU G;  2VQF L;  1SND A;  4X62 Q;  1SJH D;  2NN6 I;  1Y1V G;  1VQA A;  1XX8 A;  3I4N B;  5CV4 A;  2WAQ G;  5CV7 A;  3G48 A;  2BDO A;  5IGE A;  1CQF A;  1Q7Y C;  2XNA C;  3EA6 A;  4PZ7 A;  3EFX D;  2A6H D;  4DAP A;  5I2Y A;  2NTT A;  5E4X A;  2K5V A;  3I4O A;  1YJW A;  1JOR A;  4GOP C;  1VDZ A;  1SLJ A;  2NZH A;  1VQN A;  4A3B G;  2KEE A;  1CSQ A;  4JI6 Q;  5FLX L;  4DR3 L;  4FDB A;  5EPJ A;  2UUA Q;  4A3J G;  1O7L A;  3OW7 A;  4R8N A;  4IPG A;  1LTR D;  1SNO A;  1NCV A;  1NSN S;  5M3M B;  1FL0 A;  1N36 L;  5C0X H;  3TP7 A;  3VR5 A;  1SJE D;  3QOJ A;  3T56 B;  1BOS A;  4ODG A;  2NVT B;  1QB5 D;  1WVL A;  3I55 A;  4DUY Q;  3I4M G;  2A68 C;  5FLX E;  2QCP X;  2M00 A;  1D8L A;  5JVH 3;  1TWF H;  4LF9 Q;  3OHX C;  2EZV A;  3ULJ A;  1LTT D;  4BBR G;  5IGC A;  1I4Q A;  1VQC A;  3D31 A;  3J81 E;  4BXX H;  2ENB A;  3T53 B;  3NBH A;  5FO9 B;  3MFY A;  1NAP A;  3D6C A;  4K2L A;  1EU3 A;  1J5E L;  1ENA A;  2IPK D;  2EY5 A;  2O5J C;  1R4Q B;  1W6J A;  4MZ9 A;  3OWF A;  4DV3 L;  4H0L C;  1FJG Q;  3HOY H;  2ZTC A;  2K32 A;  5HGQ A;  3BYT B;  4RFB A;  1CFM A;  3CCR A;  4X3K A;  5M5Y B;  3KLS A;  1D6E C;  5ELC A;  3GV6 A;  5I6Y A;  1RD9 D;  1G2S A;  1QIL A;  1VQF A;  4XXE A;  4KV6 A;  4DAV A;  1A63 A;  2K5N A;  3HFZ B;  4CDF C;  3IRB A;  3IAY A;  2KEN A;  1QUQ A;  1STH A;  1DD2 A;  1VMP A;  1CSP A;  2F0G A;  5IYC H;  2HCC A;  2A8V A;  1QE6 A;  1SEB D;  2IT1 A;  4DV6 Q;  1STN A;  1KQS A;  4V19 0;  5HUR A;  1PRT B;  2E2J B;  4K5X A;  3RLN A;  3SR1 A;  1Y14 B;  2AHO B;  1OO9 B;  4X3S A;  2EDG A;  1CKM A;  1HZB A;  4Y7N H;  3I4N G;  1LT4 D;  3SEB A;  4OIJ A;  2B63 B;  3JC6 6;  3AFP A;  3BYY B;  3QB3 A;  1NR4 A;  1RJT A;  3T1H L;  2YU9 B;  2ASB A;  1WOC A;  1E24 A;  4K2K A;  3MAQ A;  1ZEQ X;  3NSW A;  2KCC A;  5EAY A;  1QZG A;  2CQA A;  4C2M H;  1SN8 A;  4HJ8 A;  2PMZ B;  1JB3 A;  3BDL A;  1QVF A;  3SK8 A;  1BR9 A;  2F0H A;  2JE6 I;  4PMC A;  1XWE A;  4OHJ A;  4IFD J;  1UEA B;  1K0R A;  1K73 C;  3D8G A;  1QNU A;  3GQB A;  5E4W C;  3I7F A;  1EUJ A;  2EY2 A;  2RDF A;  3DHQ A;  5BN4 A;  2V4D A;  3M85 A;  4OO1 H;  1VQL A;  1TVX A;  2UUB Q;  4A93 B;  4YHH Q;  3K5M A;  1RDP D;  3S1M H;  1EYA A;  1EFI D;  2XRQ D;  4KN7 C;  5IP9 H;  2F0Q A;  4GS3 A;  3EBE A;  4LMQ D;  1JQY D;  2JA7 B;  3MXN A;  3CCS A;  4A3F B;  3TP5 A;  2NVY B;  1X56 A;  2RCF A;  2NYZ D;  1T5X D;  1HA5 A;  2EVB A;  2RKS A;  1L1O A;  3VYT A;  3H3V C;  3K5L A;  2DY8 A;  1XMQ Q;  4LFA Q;  2JA8 B;  5CYU A;  3E0J A;  4UPA A;  3KF8 A;  1Y8O B;  4KLK A;  2NVX H;  3D4D A;  1G6P A;  2NBF A;  1EY9 A;  2VB2 X;  3FMC A;  4MIU A;  3FRP B;  5IT9 L;  3CCU A;  1XXG A;  1OXX K;  1V9P A;  5KNC A;  4BBS B;  3HKS A;  4V0B A;  1OXV A;  1ZKO A;  1JJC B;  4DV5 Q;  1C7Y A;  4DPG A;  1AEX A;  1DOK A;  4JI6 L;  3F1Z A;  4X6A H;  1EYD A;  1Z9F A;  4JI3 Q;  2WP8 J;  2VZA A;  5IT9 E;  1VQ7 A;  4WOR A;  3EIV A;  1A8V A;  2F4I A;  2R7F A;  1CI3 M;  2J7Z A;  1ZYR C;  5IOD A;  4JV5 L;  4GN4 B;  1YNJ C;  2FIN B;  4GKJ L;  2LS0 1;  1K83 B;  3CCV A;  1ESF A;  1J9O A;  4NMZ A;  3ERO A;  3EN2 A;  2B63 G;  1GO3 E;  1WTX A;  2MO0 A;  2NN6 G;  1CM9 A;  3P20 A;  2F52 A;  3GTM H;  3PIO 3;  2EOT A;  1SMY D;  1LT3 D;  3SHL A;  1Q8K A;  4A3I H;  1LTB D;  1XPU A;  1VCI A;  4MTN A;  1EY7 A;  3S2D B;  1H9R A;  4BY7 B;  3W1B A;  1HFG A;  2EYO A;  1FJG L;  5K5P A;  3NWS A;  1PHJ A;  1TU2 B;  2KHS A;  2UXB L;  1X54 A;  1DM0 B;  2IHE A;  1MSG A;  1Q1E A;  4AYB B;  4QUC A;  1F2L A;  2F4V Q;  5C3W A;  3I91 A;  1PTO H;  3NTI A;  1Y1W G;  1K0S A;  3KYH C;  2F0J A;  5KND A;  3RN2 A;  1FGU A;  3GTQ B;  1F2Z A;  3HGB A;  1ILQ A;  5DM6 3;  2ICE C;  4A93 G;  2BDN A;  1E2Z A;  1PTO F;  1H9K A;  2F0W A;  3I8Z A;  3VA7 A;  1SE8 A;  3H91 A;  3M3Y H;  4O2D A;  4GKK L;  5CMD A;  4LF8 Q;  3A7L A;  3C46 A;  1VQM A;  2JA7 G;  1EOV A;  2CH4 W;  3RZO B;  1I50 B;  4A3F G;  1C0A A;  1XPR A;  3GTK H;  4ZLT F;  5C5M A;  4DV6 L;  5EBD A;  4PV1 C;  1V1O A;  1WTW A;  1S40 A;  1MD2 D;  2LSS A;  4HID A;  2KQ3 A;  2JA8 G;  4JK1 C;  1SRO A;  3A74 A;  3FPP A;  2EJF C;  3MXU A;  2Q2I A;  3VYR A;  3KJP A;  4OWW B;  1FVI A;  4LFC Q;  1ICW A;  4Q0F A;  5C4J H;  5FKA C;  1GXD C;  4BBS G;  4S3S A;  4DUZ Q;  1S4Z A;  1V1P A;  1WCM B;  4RH6 A;  3J80 i;  3RLF A;  1HFN A;  4B9X A;  4HJ9 A;  5KYI A;  1L1O C;  2G9H D;  1I6H B;  5GAG C;  3NEL A;  4OO1 I;  4G4K A;  4K14 A;  3S2H B;  5T1G A;  1SBB B;  3NHH A;  2Q8T A;  2PNH A;  1Y8P B;  1VQD A;  1O80 A;  3QIA A;  3KOJ A;  2EQS A;  4IFD H;  1B3Q A;  2K01 A;  1PZI D;  2AMC B;  2E8G A;  5FLX c;  1XYI A;  1I4G A;  3UI2 A;  4NW2 A;  1HR0 W;  3SK5 A;  4QQB X;  2R7Z H;  2UUB L;  3OOC A;  2I0Q A;  1K28 A;  2KA7 A;  5J3B A;  5GQO A;  2FJ2 A;  3MXG A;  3R2T A;  3FVQ A;  3TME A;  1TWA B;  2CW0 D;  3AQQ A;  3PO2 B;  3HP3 A;  4HMI A;  1GUO A;  3FHW A;  2Z0S A;  3MVV A;  3S17 B;  3MEF A;  3CP0 A;  1JE5 A;  1I4R A;  2K5W A;  4N9P A;  5CGK A;  1XMQ L;  2I46 A;  5LMN W;  4LFA L;  1UWV A;  1EEI D;  1D7Q A;  4DV7 L;  1UEB A;  3U9O A;  1SE4 A;  2L15 A;  4BY7 G;  4DR1 Q;  3GO5 A;  4LF7 L;  1J6Q A;  4RWS C;  3K7A B;  3H0G H;  4NKL A;  4DAM A;  3HS0 C;  5COY A;  4QB4 A;  5IYD G;  1AZQ A;  3KLW A;  4AYB G;  1H9S A;  5AJ3 Q;  1HXY D;  1ML0 D;  2JA6 B;  1VS0 A;  2K4K A;  4DR7 Q;  1N8R C;  2BA1 A;  3PGZ A;  2EJM A;  2VS1 A;  4FF2 A;  5ELN A;  1PYS B;  4K0K L;  3PUV A;  4J8Q A;  2OXP A;  3QWN A;  4B3M Q;  1EWC A;  2Q2H A;  4P71 A;  1TS4 A;  4JG2 A;  1PH9 A;  1WJJ A;  3DUZ A;  2UXD Q;  1W6K A;  1HRJ A;  4DNT B;  5COR A;  3D3R A;  2ES2 A;  4JBM A;  3KLS X;  3M9B A;  2L12 A;  2H1E A;  1CT1 D;  1Y8N B;  4A3K H;  3J7A V;  4JI8 Q;  1A3U A;  2D0P A;  4BY1 H;  4GOP B;  2QDB A;  1WCM G;  1PH6 A;  2RQX A;  1QVG A;  2E2H H;  2A6H C;  5E3F A;  2F3I A;  5IOC A;  2R93 B;  1SNC A;  2Z4H A;  1SRU A;  3FKI B;  2RF4 A;  4LW1 A;  2DNC A;  4A3M B;  4GN5 A;  2X69 A;  3EVQ A;  5AFW A;  1ROD A;  1HNZ Q;  4NP5 A;  5EKL A;  4LF6 Q;  3DM3 A;  3VR2 A;  1AZP A;  4RGO S;  5G3L F;  1GOZ A;  4DA2 A;  1PH5 A;  1I94 Q;  3H3V I;  1ET6 A;  1BCP D;  2VQE L;  2DN8 A;  3U58 A;  3VR4 A;  5DNF A;  2WAC A;  4HMJ A;  5A35 A;  3PO2 G;  2H4O A;  2NZ1 D;  4FP5 D;  5ELE A;  1IBK Q;  5D65 A;  1EIG A;  3BU2 A;  3D4R A;  3K58 A;  4H02 A;  1IYJ B;  1R9T H;  4IUV A;  4A3D H;  5C4X B;  1NBW A;  1O78 A;  1FR3 A;  5C3X A;  3A0J A;  1HZA A;  2DJG C;  3HOY G;  4LF5 L;  1EYG A;  5IWA Q;  5FO7 B;  3M4O B;  1AE3 A;  4P2C B;  1VQB A;  2QW7 A;  4DUZ L;  2B2Y A;  3VR6 A;  5JVG 3;  4RMF A;  4GNX A;  3U4V A;  4XQN A;  2EY6 A;  3K59 A;  3KUP A;  5I6W A;  2JA6 G;  5IT9 c;  2AQ2 B;  1D1K A;  1NTG A;  1JOQ A;  4OON A;  4BA1 I;  4G7H C;  1N32 Q;  5IGF A;  4DAY B;  3MZ5 A;  2PO4 A;  3L0O A;  3PUW A;  3ERS X;  5JEA J;  1O7I A;  1YNX A;  1KNA A;  4OXP A;  1JOO A;  1JMC A;  3KDF A;  1K3B C;  4DV4 Q;  1GUS A;  5FJ8 H;  1HZ9 A;  3MHB A;  5JJI A;  3HOX B;  1RTN A;  3A8K E;  5C3E H;  4O42 A;  4JBJ A;  2JK8 A;  4PNY A;  4KHV A;  5D3I B;  1HTP A;  3GTJ B;  1XTC D;  3W1G A;  1LM0 A;  4RGM A;  4DV1 Q;  1EZ8 A;  1NJI C;  4HAE A;  4AYB E;  1GKH A;  2X6L A;  1HCZ A;  3FKI G;  4A3M G;  3RUZ A;  2AWN A;  2O2L D;  3G7L A;  4XYO A;  3MEH A;  3C3L A;  2K75 A;  1YJ9 A;  4APV A;  4L5T A;  4A3E H;  4B08 A;  3R8B A;  1RIP A;  3UDF A;  5AJ3 L;  2HQE A;  3W5O A;  1X3F A;  4CJ2 C;  2E2D C;  4C1N I;  4DR7 L;  2K1B A;  1LTI D;  4B9W A;  3JAM i;  3BDO A;  3PUX A;  1NY4 A;  4WJ3 M;  1Z7T A;  4ABN A;  1PH2 A;  1SNQ A;  4TSS A;  1BF4 A;  2DNE A;  4A75 A;  4A3L H;  1VQI A;  1LTA D;  2RSN A;  5GRO A;  2PNR C;  1PDQ A;  5ELD A;  3S16 H;  3TBI B;  4X64 L;  5C4X G;  3T1Y Q;  3G6J B;  4RA8 A;  1PA6 A;  4DK1 A;  2OEO A;  2UXD L;  4FNF A;  2VB3 X;  3E5S A;  4F87 A;  4C3J B;  1EEF D;  3S1R H;  2N49 A;  3NBH B;  1MHW C;  4P75 A;  4JI8 L;  2EYL A;  2RVL A;  4Z9C B;  4FO2 A;  2P5Z X;  4HCE A;  2HUG A;  3TRZ A;  1K3R A;  4NDX A;  1JIC A;  1ENC A;  5IYB G;  1SYG A;  2AUJ D;  2QF7 A;  1K8O A;  2B2V A;  2QEX A;  4IJL A;  5M3F B;  2F0D A;  1Q3L A;  2DJF C;  3P7J A;  2DUD A;  2E76 C;  2RDG A;  4FF1 A;  4KN4 C;  1IBL Q;  1Q12 A;  3PO3 B;  5C44 H;  2XN9 C;  3F2U A;  5DLQ E;  3SGI A;  2B2Y C;  1DZ1 A;  2ZTE A;  4C3I H;  4GNX C;  3TRE A;  1I94 L;  4XTC S;  3GTG H;  2ALY B;  1J8I A;  1KTK A;  1QUQ B;  4QJF A;  3HOW B;  3HOX G;  4AQY L;  3RN5 A;  1XMO Q;  1SYB A;  1VQK A;  5FO8 B;  1AFP A;  1DON A;  1IBK L;  3STB D;  5LMU Q;  1KNE A;  3BZK A;  1U4P A;  1WTH A;  1FD7 D;  3E3X A;  1SMY C;  2XGT A;  3CCE A;  2WKD A;  5CV5 A;  2BA0 A;  2HD3 A;  3A5U A;  5H1S E;  2KCT A;  4MN3 A;  1B4O A;  4ZKC B;  5IWA L;  4LNQ A;  3GV3 A;  3R93 A;  2JJQ A;  3HOZ H;  3RZD B;  4DXF A;  2JA5 B;  5L37 A;  1XNQ L;  3TZD A;  3OTO Q;  4EVO A;  2MP1 A;  3NPP A;  2VY3 A;  2ZXR A;  1LYL A;  3NUC A;  2E74 C;  2Y0S E;  5CBA E;  1QVC A;  2QA4 A;  3S14 B;  1A3T A;  1SDF A;  3HOV H;  2L55 A;  1M8A A;  3MA2 B;  2UXC L;  4YY3 L;  4LUV A;  3PIP 3;  1A15 A;  4IQZ A;  3TS2 A;  2RHQ B;  2ZJR A;  4DR2 Q;  1VMC A;  3S1Q B;  4F88 A;  3PQI A;  3D6W A;  2Z6B A;  3PCO B;  1Q82 C;  2K5Q A;  2IW3 A;  2R61 A;  2E2I H;  5JEA H;  2WKC A;  1EWH A;  4NXN L;  4DV0 Q;  4DV4 L;  2DGY A;  3C1F A;  3Q6S A;  1QZH A;  2JYO A;  4ZUJ A;  3IFT A;  5A2Q L;  3MXN B;  2R3Z A;  1BO0 A;  3PMF A;  4C3J G;  4ZRZ A;  1EFW A;  4KY7 A;  2JEA I;  4DNR B;  3CU7 A;  1I6V C;  2A69 D;  2FMM A;  3M7N A;  3DMU A;  4HN7 A;  1L1O B;  4C3H H;  2I07 B;  1EZ6 A;  4PQX A;  3DEP A;  2ZM6 Q;  2PI2 E;  1TS5 A;  4ZUI A;  1M1K C;  1U5K A;  3KF8 B;  2VXW A;  2YTY A;  3QOL A;  1KAB A;  2V1C C;  2RDH A;  3D4W A;  3ERQ A;  3V05 A;  4JI2 L;  5K36 H;  1JWS D;  2QIL A;  3S15 B;  1HUN A;  4X66 L;  1UNS A;  2GVB A;  3CQZ B;  5M3F G;  1GD7 A;  2YTV A;  2JA9 A;  2BOS A;  1DOM A;  2E5L L;  3PO3 G;  1DGS A;  4JW0 A;  4KY5 A;  2R92 B;  1ET9 A;  1Z6H A;  1VQE A;  3URY A;  4CJ0 B;  3TP8 A;  1XPO A;  4A3C G;  3AB9 A;  1E7Z A;  2LXK A;  4ZKB B;  1PTO C;  1Y1W B;  3HOW G;  4H13 C;  4IO9 A;  1B70 B;  4WRD A;  4CKB A;  1DXM A;  3DWA A;  2CW0 C;  1EY6 A;  1IYU A;  1TXY A;  4K8J A;  3T1Y L;  1EQR A;  1E22 A;  4B3T Q;  4CHT B;  1LTS D;  5D3D A;  4X62 L;  4PMB A;  1IBM Q;  4R1J A;  1SYE A;  3DM1 A;  4JYA Q;  3S1N B;  4A3G B;  3NQI A;  3PF4 A;  1RTO A;  1V43 A;  4UY8 C;  2NVQ H;  2BCO A;  1PH3 A;  2JA5 G;  1SYF A;  2IX0 A;  2MJ8 A;  1SSO A;  1KD1 C;  3U9S A;  3K5N A;  1SFO B;  1RCV D;  5FK9 C;  1WTR A;  1CA6 A;  1XJV A;  1CZW A;  1C48 A;  1YJN A;  2NTS A;  4EX5 A;  5C0X I;  2VUM H;  2UUC Q;  2L5T A;  5M5W B;  1KAA A;  1IBL L;  2G9D A;  2I5M X;  3F2B A;  2UUA L;  1SNM A;  1EQQ A;  3GTP H;  4L6T B;  3HOU H;  3K80 C;  1LO5 D;  1LV9 A;  3KFU A;  2EY1 A;  1GUW A;  3N6R A;  3A8J E;  1RL2 A;  1Y1V H;  3A54 A;  4U67 3;  3MWY W;  2L0C A;  5BN3 A;  5IP7 G;  4DUY L;  1XMO L;  4RKL A;  5J39 A;  2KHJ A;  4IAL A;  2OF1 A;  3J80 L;  1BNZ A;  4LF9 L;  5LMU L;  5FOB B;  1OXT A;  3CC2 A;  1BDO A;  4UP8 A;  3K57 A;  2K33 A;  4KY6 A;  2ATW A;  2K5H A;  1WTV A;  1SNP A;  2CQO A;  4P72 A;  3CC4 A;  4N8X 1;  2HIV A;  1VF5 C;  1JWM D;  4ME5 A;  4A3B H;  2AKW B;  2TMP A;  3DEO A;  4NPS A;  2OTL A;  5LL6 X;  4JI0 Q;  4A3J H;  1TWH B;  3T51 B;  3J80 E;  1W3S A;  4CJ1 B;  1TS3 A;  3G6E A;  3KLR A;  1V1P B;  3RNU A;  2MO1 A;  4ZQ3 A;  3OIQ A;  3U4Z A;  5CV9 A;  1B8A A;  2R92 G;  5J22 A;  4JOI A;  3I4M H;  3OWE B;  2PW5 A;  3ULL A;  4A76 A;  3SVM A;  1YVC A;  4DR2 L;  1BCP C;  1TII D;  3LX0 A;  4BBR H;  2WV6 D;  1WTQ A;  4MTK A;  1TWG B;  1A2T A;  5IGD A;  2DY7 A;  1XNR Q;  1N33 Q;  1Q90 A;  1K8M A;  3IFD A;  1E1O A;  1FNU A;  1KDA A;  4ME3 A;  3BG3 A;  1QCB D;  3SE0 A;  4DV0 L;  3WOE A;  4KJN A;  2MFI A;  1X3P A;  1UUP A;  4KMU C;  1BKB A;  4AIM A;  1CKN A;  1HNX Q;  1TWC H;  1P16 A;  3KF6 A;  2B2U A;  4PZ8 A;  4C56 C;  1KLU D;  4A3G G;  3S24 A;  1QOH A;  3J7Z C;  1CZG A;  2BH8 A;  2K50 A;  3SK4 A;  3VR3 A;  3V2T A;  5JPM C;  3C2P A;  1H9M A;  1B50 A;  5GAD C;  2OTJ A;  4ZK9 B;  1LTG D;  5F2D A;  3K7U C;  4X65 Q;  1X65 A;  4IUR A;  3TEH B;  4QMG A;  1B53 A;  1E2V A;  4RHR A;  4G7Z C;  4XIG S;  1H9S B;  1YHA A;  5KRU A;  4JCV E;  3DWP A;  1STY A;  4LFB Q;  2J4X A;  2XWJ B;  2SNM A;  5GAE C;  1I4X A;  1TWF B;  1SYD A;  4IPD A;  3I4N H;  4HCS A;  1AE2 A;  4GN3 B;  1NR2 A;  1F9S A;  1PTO D;  4YHH L;  1HZC A;  3H15 A;  2IHF A;  3J7A F;  5EGT A;  4EQO A;  5IY0 A;  2K03 A;  2ZJQ A;  4CDC C;  3HEJ A;  4WJ4 A;  1IBM L;  4F8M A;  1X3Q A;  2NWG A;  1F9P A;  4UHV A;  3L2P A;  1N34 Q;  2OQK A;  3HOY B;  4HIK A;  4OX9 Q;  4DR6 Q;  1YEZ A;  1P8L A;  3MTS A;  1HH2 P;  3I56 A;  5M3M H;  1PFB A;  4RGT A;  1UE1 A;  2NB0 A;  3M4Q A;  1VQ5 A;  2NVT H;  5HGT A;  2N3S A;  1S72 A;  2KEC A;  2K28 A;  3WDN A;  3Q8D A;  4UDU C;  2EE1 A;  1YBY A;  2UUC L;  1CKO A;  1ASZ A;  4DV5 L;  3H09 A;  3SDZ A;  2IWH A;  1D5M C;  4JI3 L;  4FF4 A;  1Q81 C;  2HT1 A;  5C4H A;  3S9W A;  2Y0S B;  3G71 A;  1EIY B;  4JOI C;  1MKH A;  1DOL A;  3FP9 A;  1YZ6 A;  1G8Z D;  3CHB D;  4Y7N B;  3KBG A;  1R4P B;  2OCE A;  3VDY A;  3X3N A;  5M5Y H;  2F3V A;  3BS1 A;  3HG9 A;  4C2M B;  2XSC A;  2KED A;  1ASY A;  4GLA C;  2A73 B;  2B3G A;  1EY0 A;  2Z9H A;  2QDL A;  2K05 A;  2XTI A;  1PVO A;  2N55 A;  2D62 A;  2B2U C;  4KKU A;  1NMF A;  5JPN C;  2BE5 D;  2KUM A;  1BBX C;  4IPH A;  2VQF Q;  4GNX B;  1STB A;  2ZJP A;  2N88 A;  2PQE A;  3DWQ A;  5IE8 A;  4POG A;  3BZC A;  3H94 A;  5C0X G;  4XYQ A;  3CMA A;  2E2J H;  1UAP A;  3OPO A;  2F4V L;  1STG A;  5ELF A;  4ID6 A;  5EBC A;  1EU4 A;  1KIX A;  3S1M B;  2ID0 A;  3CD6 A;  3K6O A;  1PRT F;  2K7V A;  1C4Q A;  1EY5 A;  2AWO A;  2B63 H;  1GVP A;  2NN6 H;  5JAV A;  2YU9 H;  2H5X A;  4IUN A;  5BN5 A;  4BXX G;  3U50 C;  3GTO H;  3STB C;  1X6O A;  2FHT A;  3KDF B;  4LF8 L;  1O7Z A;  1PZK D;  3T4A C;  5JJK A;  3J7A 5;  2J0T D;  4TRD A;  2EYF A;  4H7B A;  2XWB B;  2B2W A;  2NVX B;  1GHK A;  3B6Y A;  1N9W A;  1Z47 A;  5M5X H;  1JE4 A;  1SE2 A;  2FFK B;  1XTD A;  1A6X A;  3I2Z A;  3FEW X;  4LFC L;  3I4L A;  3SK6 A;  3JAM L;  4YCW A;  5CBE E;  4IFD I;  2G5D A;  1MBY A;  4KHP Q;  4DFA A;  4A93 H;  4X65 L;  3BVZ A;  1WD1 A;  3TS0 A;  2KCM A;  4C1N K;  2JA7 H;  2Q2U A;  1B7Y B;  3ND9 A;  1BBU A;  2ZTD A;  1I4H A;  2NVY H;  4A3F H;  1PH4 A;  1J5E Q;  3JAM E;  4LFB L;  2PZW A;  5T1I A;  5IYC G;  3F8T A;  4IN3 A;  2Y0S G;  1V8Q A;  2Z1C A;  2AQ1 B;  4DV3 Q;  5G3L D;  1GHJ A;  2JA8 H;  2EXZ A;  1PRT D;  3MXP A;  1E2W A;  3FPU B;  4DK3 C;  1E3P A;  3HRZ C;  1UE6 A;  3UDI A;  3NEM A;  4R8I A;  2RHS B;  3GD7 A;  1VQH A;  1ICF B;  2A69 C;  4BBS H;  3GTM B;  4DKA C;  4POF A;  5EJW A;  1L0Y B;  1BBW A;  2F3W A;  4A3I B;  3N52 A;  3IKJ A;  4KHZ A;  2D5D A;  2GVA A;  3OYY A;  5KEE A;  2JEB I;  1KAW A;  3PV0 A;  3J80 c;  2KJX A;  1TKW B;  1S3O A;  1PLF A;  2YYZ A;  2F0V A;  2KVM A;  4X3U A;  1F9R A;  2LFN A;  4DR1 L;  2EYH A;  2R7D A;  3V96 A;  4QUF A;  5JJZ A;  1HQR D;  4HED A;  3TN2 A;  1HHV A;  4QIW E;  4B3S Q;  2K52 A;  3ER0 A;  1A3V A;  1HA6 A;  1FYC A;  1WTO A;  1PTO B;  4UP7 A;  3L7Z C;  4OO1 G;  1GJX A;  2XIW A;  3BJU A;  1K83 H;  1ZXT A;  1SE3 A;  5GAH C;  3T1H Q;  3GTL H;  1VQO A;  5IP9 G;  2F0S A;  3CCL A;  1G2T A;  3M3Y B;  1T5E A;  1E0B A;  4HSV A;  4YIJ A;  3W3A A;  2F03 A;  1S5D D;  3GTK B;  4DN4 M;  2FMC A;  1F2M A;  2HHH Q;  2EYP A;  3DXJ C;  3PIO A;  1B3A A;  2LY7 A;  3CC7 A;  2M9V A;  4B3M L;  3S2D H;  5JJL A;  4FXG C;  4K5V A;  4RKB A;  4BY7 H;  1W2B A;  1OXU A;  5HY6 A;  2CVR A;  2C5C A;  4CBV A;  3Q22 A;  3ZJY C;  5C4J B;  5IYD H;  2EIF A;  4JI5 Q;  2QKI C;  3W2D A;  2VUM G;  2WB1 E;  3I72 A;  3NE5 B;  1JT8 A;  4YWL A;  3L3O C;  4L5Q A;  5KIX A;  3GTQ H;  1KDB A;  4BWG B;  3I70 A;  4LJZ C;  1K8G A;  1CK1 A;  2PQA A;  2A19 A;  4K6D A;  1IXR A;  2WIN B;  4ULL A;  5EKI A;  3RZO H;  1I50 H;  4JC0 A;  2D2C C;  2PPB C;  2R6G A;  4ZYS A;  1PH7 A;  2L1B A;  1HNZ L;  4Q5V A;  4M8A A;  5EPL A;  1PMR A;  1QJO A;  1SAP A;  5ELO A;  4LF6 L;  4KI0 A;  2R7Z B;  4HIM A;  3J7Y W;  3BVM A;  1CQV A;  4HSP A;  5I9O A;  4IUU A;  2VW9 A;  2I5H A;  4UAI A;  2A6E D;  3QG1 A;  4BS9 A;  1LTL A;  1EY4 A;  1WCM H;  2JSO A;  1H95 A;  1D5Z C;  2ICI A;  4A3I G;  5IGB A;  2PZU A;  2F0L A;  1I6H H;  1VQJ A;  1QG7 A;  1WFQ A;  2JN4 A;  3S2H H;  1S5C D;  4LUZ A;  1SR3 A;  1O7Y A;  3J81 L;  2QEJ C;  2K5D A;  1C8C A;  1Y69 U;  1KDC A;  3H0G B;  4OEM B;  3T13 A;  1PFN A;  1EL0 A;  3MFG A;  5E7N A;  3CXC A;  1LUZ A;  4JV5 Q;  4RAU C;  2JXM B;  3M4P A;  3ICE A;  1KRS A;  4GKJ Q;  2Q2T A;  3AU7 A;  2HDL A;  3M7G A;  4K5W A;  2BH2 A;  3Q23 A;  4KHP L;  1BCP B;  3NTH A;  4ILW A;  4OEL B;  4LAA A;  3EJI A;  4ZCK A;  1IL8 A;  1TWA H;  4O0A A;  4XQJ A;  3PO2 H;  4H44 C;  1D1I A;  4JVZ A;  4O1N A;  1YHB A;  2B2T A;  4JI7 Q;  3S17 H;  1YI2 A;  1OXS C;  1N32 L;  1NMG A;  1FNW A;  1KHI A;  1Q46 A;  2WII B;  5M9O A;  1UE5 A;  2UXB Q;  3BDC A;  1STA A;  5KNB A;  4CGY B;  3K7A H;  1BXT A;  4R4I A;  5CV6 A;  4A3K B;  4BY1 B;  3CW2 C;  3J81 j;  3VA5 A;  1IL2 A;  1JOK A;  4YCU A;  1CUK A;  2E2H B;  1PV4 A;  4GLV B;  1S5B D;  4DV1 L;  2JA6 H;  4GKK Q;  1QNK A;  1X3G A;  1F77 A;  1M4V A;  2MNA A;  1LT5 D;  4ALP A;  3DLL A;  5A2Q E;  4WJW A;  1KLG D;  4F7X A;  3VYS A;  4IFD G;  4B3S L;  3UE1 A;  2YTX A;  4GLX A;  1DCZ A;  2Z4I A;  3TP6 A;  3J81 i;  4JBK A;  1OTC A;  2R7Z G;  4MNO A;  2HCI A;  2L11 A;  2K04 A;  1HUM A;  3GTO B;  1TQO A;  3LWE A;  3CPW A;  4KTA A;  2B2V C;  4RGN A;  3ULP A;  2CKZ B;  4L5R C;  2HHH L;  3KJO A;  1G29 1;  5C4Z A;  3OMG A;  4R4Q A;  1R9T B;  4A3D B;  1AN8 A;  5E1F A;  3P75 A;  2ZXO A;  5EQ0 A;  1LT6 D;  4TKO B;  2R93 H;  3P1H A;  4WFN 3;  1PXU A;  1CTM A;  3FKI H;  4N9T A;  4DNI A;  4LK1 C;  3PSI A;  3AMU A;  5M5X B;  4A3M H;  1MIU A;  3CCM A;  2EPB A;  5DM7 3;  5M3M G;  3KBX A;  3K8A A;  3I3C A;  2ZXP A;  2XRS D;  1TY0 A;  2JQO A;  1MJC A;  3H0G G;  2KCN A;  5FLM H;  4JI5 L;  4KD3 A;  2F0O A;  1YIJ A;  5J1Z A;  5DAU A;  4R9W A;  2MPM A;  4IUQ A;  4DF7 A;  3OSO A;  2B8F A;  5C6A A;  2X6G A;  4NB3 A;  4J6H A;  4JI1 Q;  3CCQ A;  1A0I A;  2MUY A;  3AFQ A;  3NWT A;  3JAM c;  1IKM A;  1PYB A;  1EQT A;  1IKL A;  1STE A;  2WAQ E;  5EKK A;  1TR5 A;  4N8F A;  4OWX B;  2RCN A;  5JOB A;  2XVS A;  2F0T A;  4IUT A;  1KL9 A;  4DV7 Q;  1NUC A;  3KK7 A;  5C4X H;  4L8J A;  1EIH A;  1TT2 A;  4DU9 A;  4LF7 Q;  4XT1 B;  1U4M A;  1U4R A;  3O13 A;  4TQU S;  2E75 C;  1SMX A;  1JC7 A;  2N8N A;  4HJA A;  3AYH B;  5C3E B;  3NXW A;  3M4O H;  4DXG A;  2F0F A;  2UU9 Q;  2Z6K A;  4A3K G;  2B39 A;  2B2T C;  4BY1 G;  1PFM A;  1HQM C;  4HIO A;  1CKN B;  1BUV T;  2YV5 A;  1F2Y A;  4CDD C;  4R4C A;  5I2X A;  4DR5 Q;  2F0N A;  3KF6 B;  1MGS A;  4LWC A;  5IYB H;  2GN5 A;  2I5L X;  1A62 A;  3E0E A;  3NEN A;  1WI5 A;  4K0K Q;  2SEB D;  1ESR A;  1WD0 A;  3PF5 A;  1UE7 A;  3ND8 A;  3IL8 A;  2K14 A;  2BE5 C;  1BVS A;  1BQQ T;  4A3E B;  1VQ9 A;  4ZAI A;  1A2U A;  3NQT A;  2A68 D;  2F0M A;  2QGQ A;  3OTO L;  3GTL B;  2RSO A;  4EQ5 A;  2KBN A;  3CCJ A;  2IX1 A;  3A7A B;  4XT3 B;  4KK7 A;  3HOX H;  3T16 A;  4DGZ A;  3AEV A;  1G6Z A;  3NK9 A;  1JB7 A;  5IGG A;  1E1T A;  4J15 A;  4QIW B;  3GTJ H;  4JI7 L;  3K5O A;  1HNW Q;  1Q8I A;  1II3 A;  1EY8 A;  5I9P A;  3HKZ B;  1FNV A;  4I7Z C;  3QJY A;  3S16 B;  4A3D G;  2MGS A;  1B2T A;  1LAC A;  4FF3 A;  3A55 A;  4K8I A;  5TSS A;  3S1R B;  4DV2 Q;  4QY7 A;  3QR8 A;  1FGB D;  1GUN A;  2PCF B;  1Q1B A;  5DEH A;  4DR4 Q;  2C35 B;  3LGJ A;  5I4D A;  5ELB A;  1AH9 A;  2VQE Q;  3F2D A;  4CDE C;  2CH4 A;  2F0P A;  2ZM6 L;  5NUC A;  4NXM Q;  4HTH A;  1U9R A;  3BZD B;  3NTK A;  3Q0A A; 
#chains in the Genus database with same CATH homology
 1I3Q H;  3H3V H;  1K73 C;  2H5X A;  4BXX G;  2A1A A;  3U50 C;  3GTO H;  3STB C;  1X6O A;  1K8A C;  3KDF B;  5BR8 Q;  4LF8 L;  3TRZ A;  1K3R A;  3I7F A;  1EUJ A;  5JJK A;  4P74 A;  4LF5 Q;  3J7A 5;  2D0O A;  4B3R Q;  3M85 A;  5IYB G;  1GM5 A;  1VQL A;  2UUB Q;  3F2C A;  4YHH Q;  5FJ8 G;  4YCV A;  3S1M H;  1EIF A;  1U0L A;  4C3J H;  5IP9 H;  2QEX A;  4GS3 A;  4IJL A;  5C3E G;  1JJ2 A;  3PUY A;  2DUD A;  3EBE A;  2NVT H;  2NZO A;  3B6Y A;  1N9W A;  3CCS A;  1Z47 A;  1Q12 A;  5M5X H;  1IBL Q;  1XTD A;  5C44 H;  4OWT B;  1X56 A;  5DLQ E;  3WWV A;  3I2Z A;  4PZ6 A;  4LFC L;  3SGI A;  2ZTE A;  4YCW A;  4C3I H;  2CWP A;  3TRE A;  4GNX C;  1L1O A;  4IFD I;  1I94 L;  4XTC S;  1XMQ Q;  4LFA Q;  4JI4 Q;  4KHP Q;  3GTG H;  2ALY B;  3G4S A;  1QUQ B;  4A93 H;  4UPA A;  4LUO A;  4X65 L;  4B3T L;  4QJF A;  3HOX G;  4AQY L;  3TQY A;  3RN5 A;  3TS0 A;  2KCM A;  4KLK A;  5M3F H;  3E9H A;  1XMO Q;  1VQK A;  2NVX H;  1G6P A;  1KRT A;  1IBK L;  2JA7 H;  3CPF A;  4HJ7 A;  2Q2U A;  3STB D;  5LMU Q;  1B7Y B;  3CCU A;  1BBU A;  2ZTD A;  1OXX K;  1V9P A;  2NVY H;  4A3F H;  1PH4 A;  1J5E Q;  2Z6K C;  3BZK A;  4LFB L;  4A3E G;  5IYC G;  3F8T A;  3HKS A;  1MJE A;  2Y0S G;  3J81 c;  4LF4 Q;  2XGT A;  1OXV A;  4IJH A;  3CCE A;  1JJC B;  4DV3 Q;  4DV5 Q;  1C7Y A;  1NE3 A;  4DPG A;  4A3C H;  4HJ5 A;  2BA0 A;  2JA8 H;  3A5U A;  3F1Z A;  5H1S E;  2KCT A;  4JI6 L;  4JI1 L;  5IWA L;  3HOW H;  4X6A H;  4LNQ A;  1Z9F A;  4JI3 Q;  2FXQ A;  1X55 A;  4DK3 C;  1E3P A;  3UDI A;  1UE6 A;  2JJQ A;  3NEM A;  2WP8 J;  1HR0 Q;  2VZA A;  1VQ7 A;  2RHS B;  3HOZ H;  3EIV A;  1A8V A;  1VQH A;  3GD7 A;  4BBS H;  4A3L G;  4DKA C;  1XNQ L;  3OTO Q;  4POF A;  2R7F A;  3CME A;  1BBW A;  2VY3 A;  1VQ4 A;  1LYL A;  3HKZ G;  2Y0S E;  2GVA A;  4KHZ A;  3OYY A;  1T9H A;  1QVC A;  2JEB I;  1KAW A;  3PV0 A;  4TVA B;  2QA4 A;  3HOV H;  4GN4 B;  3J80 c;  4GKJ L;  1S3O A;  2UXC L;  4YY3 L;  4LUV A;  2YYZ A;  3TS2 A;  3CCV A;  2RHQ B;  2ZJR A;  4DR2 Q;  2LXJ A;  1YIT A;  5LMN Q;  4DR1 L;  3EN2 A;  2UU9 L;  3RZD H;  2R7D A;  1GO3 E;  2CCZ A;  2B63 G;  3PCO B;  2JA5 H;  2MO0 A;  2NN6 G;  1VQP A;  1Q82 C;  2F52 A;  3CF5 A;  4QIW E;  2YU9 H;  3GTM H;  4B3S Q;  2CFM A;  2K52 A;  3ER0 A;  2E2I H;  1Q8K A;  4A3I H;  4DR5 L;  1XPU A;  1VCI A;  4NXN L;  4MTN A;  4DV0 Q;  4DV4 L;  2DGY A;  4UP7 A;  3S14 H;  3L7Z C;  1Q86 C;  4OO1 G;  3W1B A;  1PFS A;  1QZH A;  3BJU A;  1K83 H;  4AH6 A;  5GAH C;  1K9M C;  2CWA A;  3T1H Q;  3MXN B;  3PIP A;  1C9O A;  1VQO A;  1FJG L;  1EFW A;  3GTL H;  5IP9 G;  1PH1 A;  3CCL A;  2JEA I;  3S1Q H;  1PHJ A;  4JI0 L;  2UXB L;  2EXD A;  1X54 A;  4RG1 A;  3M7N A;  2IHE A;  1L1O B;  1Q1E A;  4YWK A;  4C3H H;  4X64 Q;  5C44 G;  4L5S A;  2HHH Q;  2F4V Q;  3PIO A;  2ZM6 Q;  2PI2 E;  3CC7 A;  4R4T A;  2WB1 G;  1M1K C;  2PMZ E;  1IZ6 A;  1U5K A;  1Y1W G;  3KF8 B;  3KYH C;  4B3M L;  3S2D H;  5JJL A;  3RN2 A;  2YTY A;  4BY7 H;  1FGU A;  1W2B A;  1OXU A;  5HY6 A;  2V1C C;  4A93 G;  3RLO A;  5IP7 H;  4JI2 L;  2OQ0 A;  1VQ8 A;  4X66 L;  1VQG A;  2GVB A;  5M3F G;  1SE8 A;  1GD7 A;  2YTV A;  4O2D A;  1VQ6 A;  3M3Y H;  4GKK L;  3ZJY C;  4LF8 Q;  2JA9 A;  2JA7 G;  1VQM A;  1C0A A;  1EOV A;  1HNW L;  2E5L L;  3PO3 G;  2EIF A;  1DGS A;  4A3F G;  1XPR A;  4JI5 Q;  3E9I A;  3GTK H;  4DV6 L;  1XNR L;  1N33 L;  1VQE A;  2HIX A;  1S40 A;  2VUM G;  2WB1 E;  2LSS A;  4HID A;  1L2F A;  2KHI A;  1JT8 A;  4YWL A;  1XPO A;  2VNU D;  4L5Q A;  4A3C G;  2JA8 G;  3GTQ H;  1E7Z A;  2LXK A;  2N78 A;  1SRO A;  3A74 A;  3CAM A;  3OW2 A;  3HOW G;  4DR3 Q;  4IO9 A;  1B70 B;  3S15 H;  2Q2I A;  4DV2 L;  1K8G A;  1HNX L;  2PQA A;  3CQZ H;  2A19 A;  3KJP A;  4OWW B;  3HOZ G;  1FVI A;  4LFC Q;  1IXR A;  5C4J H;  3RZO H;  4DR4 L;  1I50 H;  4JC0 A;  1YHQ A;  2B29 A;  2R6G A;  4BBS G;  5C0X J;  4DUZ Q;  1PH7 A;  2R92 H;  1N36 Q;  3J80 i;  3RLF A;  1TXY A;  1I5F A;  1X3E A;  1HNZ L;  4JV5 L;  1EWI A;  3K0X A;  4HJ9 A;  1EQR A;  3T1Y L;  4BA2 I;  1E22 A;  1L1O C;  4B3T Q;  3PO3 H;  4IOA A;  4LF6 L;  5ELO A;  2MQH A;  4KI0 A;  5GAG C;  3A5Z B;  4AQY Q;  4NXM L;  1IBM Q;  4X62 L;  3NEL A;  4HIM A;  4OO1 I;  3UDG A;  4R1J A;  2VW9 A;  2PNH A;  1Y1W H;  2I5H A;  1VQD A;  4JYA Q;  3PF4 A;  4IOC A;  3KOJ A;  2EQS A;  1V43 A;  4UY8 C;  2NVQ H;  1PH3 A;  3D0F A;  3UDX A;  2JA5 G;  1LTL A;  2IX0 A;  5BR8 L;  1KD1 C;  1WCM H;  2AMC B;  2E8G A;  5FLX c;  1H95 A;  1KXL A;  5JEA G;  4A3I G;  4B3R L;  1XJV A;  1HR0 W;  4GOP A;  4QQB X;  1YJN A;  1VQJ A;  1I6H H;  2R7Z H;  2UUB L;  1WFQ A;  4EX5 A;  1KC8 C;  2I0Q A;  1PH8 A;  5C0X I;  2VUM H;  3S2H H;  4LUZ A;  1SR3 A;  5J3B A;  5GQO A;  2UUC Q;  3S1N H;  4A3G H;  2OWO A;  1XNQ Q;  3AQQ A;  1IBL L;  2I5M X;  3F2B A;  2UUA L;  4IPC A;  5E7N A;  1L0W A;  3FHW A;  2Z0S A;  1EQQ A;  3CXC A;  1LUZ A;  4R4O A;  3GTP H;  4JV5 Q;  3HOU H;  2PI2 A;  3M4P A;  4UP9 A;  3K80 C;  3MEF A;  1KRS A;  1SFO H;  3CP0 A;  3ICE A;  2Q2T A;  1JE5 A;  4GKJ Q;  2UXC Q;  4YY3 Q;  2BH2 A;  1XMQ L;  5LMN W;  4JI4 L;  4LFA L;  1UWV A;  3KFU A;  4KHP L;  1D7Q A;  4DV7 L;  1UEB A;  2L15 A;  4BY7 G;  1RL2 A;  1Y1V H;  4YWM A;  4DR1 Q;  3GO5 A;  4DUY L;  1XMO L;  5IP7 G;  4LF7 L;  1WYD A;  1J6Q A;  4JYA L;  5K36 G;  2KHJ A;  5M5W H;  3H0G H;  1TWA H;  4O0A A;  4DAM A;  5LMU L;  4LF9 L;  3PO2 H;  3HOV G;  1OXT A;  1N34 L;  3CC2 A;  4UP8 A;  5IYD G;  4OX9 L;  1YHB A;  3S17 H;  4JI7 Q;  3KLW A;  4AYB G;  1YI2 A;  4NXN Q;  2K5H A;  4QGU A;  2ATW A;  1OXS C;  4DR6 L;  4P72 A;  2CQO A;  4LF4 L;  3CC4 A;  1N32 L;  2HIV A;  5AJ3 Q;  2HQL A;  1NMG A;  2VL6 A;  1JJG A;  4A3B H;  1KHI A;  1M90 C;  1Q46 A;  3K81 C;  2AKW B;  2PQA B;  1VS0 A;  2K4K A;  1UE5 A;  3HKZ E;  4NPS A;  1N8R C;  2OTL A;  4DR7 Q;  4JI0 Q;  2BA1 A;  2UXB Q;  3PGZ A;  4A3J H;  2VS1 A;  1HR0 L;  5ELN A;  1PYS B;  1W3S A;  3K7A H;  4K0K L;  3G6E A;  4R4I A;  3RNU A;  2MO1 A;  3PUV A;  4P73 A;  3CW2 C;  3U4Z A;  1B8A A;  4B3M Q;  3J81 j;  1IL2 A;  2R92 G;  2R93 G;  2Q2H A;  4P71 A;  4YCU A;  1CUK A;  4JOI A;  4JBW A;  4GLV B;  1PV4 A;  3I4M H;  4DV1 L;  4JG2 A;  4JI2 Q;  4DK6 C;  3ULL A;  1PH9 A;  1WJJ A;  3UE0 A;  2JA6 H;  4X66 Q;  4Y52 H;  4A76 A;  4GKK Q;  2UXD Q;  1YVC A;  1HJP A;  4DR2 L;  1X3G A;  1TWH H;  3PUZ A;  2WFW A;  4BBR H;  5FLM G;  5LMN L;  2E5L Q;  2ES2 A;  4JBM A;  2MNA A;  4ALP A;  3M9B A;  3DLL A;  1V1Q A;  2IY5 B;  1XNR Q;  4A3K H;  4IFD G;  1N33 Q;  4JI8 Q;  4B3S L;  2D0P A;  4BY1 H;  4GOP B;  3UE1 A;  1E1O A;  4PMW A;  1WCM G;  2YTX A;  4ME3 A;  4GLX A;  1PH6 A;  4DV0 L;  1QVG A;  2E2H H;  3J81 i;  2MFI A;  2F3I A;  4JBK A;  1OTC A;  1BKB A;  2R7Z G;  4AIM A;  1CKN A;  1HNX Q;  1SRU A;  1TWC H;  1P16 A;  2RF4 A;  3KF6 A;  4LW1 A;  4MNO A;  3GDE A;  4PZ8 A;  4GN5 A;  1G51 A;  4A4I A;  4A3G G;  3S24 A;  3CPW A;  1TWG H;  3J7Z C;  1X9N A;  4PG3 A;  1HNZ Q;  3ULP A;  2CKZ B;  3RR5 A;  2BH8 A;  4L5R C;  4QL5 A;  2HHH L;  2K50 A;  3KJO A;  1G29 1;  3HOU G;  2VQF L;  4LF6 Q;  4R4Q A;  3DM3 A;  4X62 Q;  2NN6 I;  1PH5 A;  1I94 Q;  3H3V I;  5GAD C;  2OTJ A;  2R93 H;  3FKI H;  4DNI A;  2VQE L;  3PSI A;  1Y1V G;  1VQA A;  3K7U C;  4X65 Q;  3U58 A;  1MIU A;  3CCM A;  1X65 A;  4A3M H;  3TEH B;  5M3M G;  3K8A A;  2WAQ G;  3H0G G;  2JQO A;  1MJC A;  3G48 A;  4XIG S;  3PO2 G;  1IBK Q;  5FLM H;  1YHA A;  4JI5 L;  4JCV E;  1YIJ A;  4LFB Q;  1Q7Y C;  3BU2 A;  4PZ7 A;  1R9T H;  4H02 A;  1IYJ B;  4A3D H;  1NBW A;  2K5V A;  3I4O A;  1YJW A;  4GOP C;  1SLJ A;  2NZH A;  3A0J A;  1HZA A;  5GAE C;  1VQN A;  3HOY G;  4A3B G;  4LF5 L;  1CSQ A;  4NB3 A;  4JI6 Q;  1EYG A;  4IPD A;  4JI1 Q;  4FDB A;  3CCQ A;  4DR3 L;  3I4N H;  1A0I A;  5IWA Q;  2UUA Q;  3AFQ A;  4A3J G;  3JAM c;  1AE2 A;  1PYB A;  4GN3 B;  4YHH L;  1AE3 A;  2WAQ E;  1HZC A;  4IPG A;  4OWX B;  2IHF A;  3H15 A;  1VQB A;  1FL0 A;  2RCN A;  4DUZ L;  1N36 L;  1KL9 A;  4RMF A;  5IY0 A;  4DV7 Q;  4GNX A;  2ZJQ A;  3U4V A;  4WJ4 A;  5C4X H;  3I55 A;  4DUY Q;  3I4M G;  4LF7 Q;  1IBM L;  2JA6 G;  5IT9 c;  4TQU S;  1D8L A;  1SMX A;  1TWF H;  2N8N A;  1NTG A;  4HJA A;  4LF9 Q;  3AYH B;  3M4O H;  3L2P A;  1N34 Q;  3ULJ A;  4BBR G;  2OQK A;  4HIK A;  4OON A;  4OX9 Q;  4BA1 I;  1VQC A;  3D31 A;  4DR6 Q;  1YEZ A;  2UU9 Q;  1P8L A;  4JI8 L;  1HH2 P;  3I56 A;  4BXX H;  1N32 Q;  2Z6K A;  5M3M H;  4A3K G;  4DAY B;  4BY1 G;  3L0O A;  5JEA J;  3PUW A;  3ERS X;  1O7I A;  1YNX A;  4HIO A;  1J5E L;  1CKN B;  2YV5 A;  1UE1 A;  4OXP A;  3M4Q A;  4R4C A;  4DR5 Q;  1JMC A;  3KF6 B;  4LWC A;  2N3S A;  5IYB H;  1S72 A;  3KDF A;  2GN5 A;  3Q8D A;  4DV4 Q;  2I5L X;  1A62 A;  3E0E A;  3NEN A;  5FJ8 H;  1YBY A;  1WI5 A;  1HZ9 A;  1CKO A;  4MZ9 A;  2UUC L;  1ASZ A;  4DV3 L;  4DV5 L;  4K0K Q;  5JJI A;  5C3E H;  3PF5 A;  1UE7 A;  4JBJ A;  1FJG Q;  3HOY H;  2ZTC A;  2JK8 A;  5HGQ A;  2K14 A;  4JI3 L;  3CCR A;  1Q81 C;  2HT1 A;  3W1G A;  1BVS A;  1LM0 A;  4DV1 Q;  1VQ9 A;  1NJI C;  1VQF A;  3G71 A;  1EIY B;  3OTO L;  2QGQ A;  4JOI C;  1MKH A;  4AYB E;  3FP9 A;  1A63 A;  1GKH A;  2KBN A;  4EQ5 A;  2K5N A;  3HFZ B;  3CCJ A;  2IX1 A;  1YZ6 A;  3FKI G;  3HOX H;  3IRB A;  3AEV A;  4A3M G;  2KEN A;  2AWN A;  1QUQ A;  2OCE A;  1JB7 A;  2K75 A;  1YJ9 A;  3VDY A;  1E1T A;  4J15 A;  5M5Y H;  4APV A;  3GTJ H;  4JI7 L;  1HNW Q;  4L5T A;  1CSP A;  4A3E H;  5IYC H;  2A8V A;  1RIP A;  2IT1 A;  3UDF A;  4DV6 Q;  1KQS A;  5AJ3 L;  1ASY A;  4GLA C;  2B3G A;  1VQ5 A;  4A3D G;  3W5O A;  3RLN A;  1X3F A;  2XTI A;  1Y14 B;  2AHO B;  4DR7 L;  3JAM i;  1CKM A;  1PVO A;  1HZB A;  4Y7N H;  3PUX A;  2D62 A;  1NY4 A;  3I4N G;  4WJ3 M;  1PH2 A;  1NMF A;  3JC6 6;  4DV2 Q;  3AFP A;  4QY7 A;  3T1H L;  4IPH A;  2VQF Q;  4GNX B;  2ZJP A;  4A75 A;  1WOC A;  2ASB A;  1Q1B A;  1E24 A;  4DR4 Q;  4A3L H;  1VQI A;  2C35 B;  5IE8 A;  3LGJ A;  5EAY A;  4POG A;  3BZC A;  4C2M H;  5C0X G;  1QZG A;  1SN8 A;  5GRO A;  4HJ8 A;  1AH9 A;  3S16 H;  4X64 L;  2VQE Q;  3CMA A;  3T1Y Q;  2E2J H;  5C4X G;  3F2D A;  2F4V L;  5IYD H;  1PA6 A;  2ZM6 L;  2UXD L;  1QVF A;  4NXM Q;  1KIX A;  2ID0 A;  3CD6 A;  2JE6 I;  2AWO A;  3S1R H;  2B63 H;  2N49 A;  1GVP A;  3NBH B;  4IFD J;  4P75 A;  1K0R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...