2Z6KA

Crystal structure of full-length human rpa14/32 heterodimer
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
134
structure length
127
Chain Sequence
RAQHIVPCTISQLLSATLVDEVFRIGNVEISQVTIVGIIRHAEKAPTNIVYKIDDMTAAPMDVRQWVDNTVVPPETYVKVAGHLRSFQNKKSLVAFKIMPLEDMNEFTTHILEVINAHMVLSKANSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Full-length Human RPA14/32 Complex Gives Insights into the Mechanism of DNA Binding and Complex Formation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Replication
molecule keywords Replication protein A 32 kDa subunit
total genus 29
structure length 127
sequence length 134
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08784 RPA_C Replication protein A C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2z6kA00
1SN8A 2EXDA 1N9WA 3UDGA 1MJCA 1QUQA 2Z0SA 3I55A 4A3GG 4DR6L 4QQBX 1J5EL 3T1HL 5GROA 2ZJRA 1JJGA 4A3JH 1YJNA 1WCMH 4L5QA 4O2DA 4P74A 4DUZQ 1NTGA 1FJGL 1CSQA 3L0OA 2B3GA 1VQIA 5IYCG 4NB3A 4BXXH 3I4MH 2PI2A 4L5SA 1WYDA 5EAYA 3FKIH 2XTIA 1Q1BA 3W1GA 5C3EG 2BA0A 3OTOL 3M7NA 1VQAA 2NVYH 1NE3A 4A3IH 1L0WA 2NVXH 1Z9FA 1QUQB 4A3EH 1N32Q 2UXBL 4DPGA 4DV3Q 1EFWA 2D0PA 4HIOA 4DR2Q 4DV4Q 1BKBA 2ID0A 1QVGA 2VQEQ 1BBWA 2QGQA 4KHZA 2B29A 3RLNA 4DAMA 5GAHC 2YV5A 4HJAA 2CKZB 1S72A 4DV2L 2AWOA 3ULJA 1VQ6A 5LMUQ 1O7IA 4GN4B 1V9PA 3SGIA 3K0XA 3HOYG 3GDEA 1W2BA 1YNXA 1B70B 4A3MG 4DUZL 4GN3B 2A1AA 2D62A 3PUYA 1TXYA 4LW1A 4A3EG 4YWMA 3HOVG 1B7YB 1A63A 1TWHH 2XGTA 2R93H 1IXRA 2HQLA 5C4JH 2K75A 1X9NA 1NMFA 4R4IA 3KFUA 2UUAQ 4A3FH 1D7QA 4DAYB 1TWFH 1E22A 3E9HA 1AH9A 2KCMA 4KLKA 4XIGS 3H0GH 4GN5A 1S3OA 1Q81C 2JA6H 1MIUA 2YTXA 1KL9A 4IJLA 1AE3A 4DV0L 1YJWA 2OTLA 2Q2TA 4LF6Q 4BBSH 4BBSG 2VNUD 4P72A 2GVAA 2Y0SE 3DLLA 4OX9L 2VW9A 4KHPL 2A8VA 1K0RA 4LNQA 4IFDG 4AH6A 3GTMH 1PYSB 5HGQA 4X62Q 3S1NH 3CQZH 1XPRA 3M4OH 1N33L 1HR0W 2HHHQ 4POFA 4QGUA 3KLWA 3F2DA 3GTQH 1Q1EA 3KF8B 1R9TH 4DV3L 3MXNB 5IP9G 3I4NG 1U5KA 3NEMA 4JOIA 4X64Q 4HIMA 1K83H 2D0OA 1SFOH 4X6AH 3IRBA 1XNQQ 3DM3A 3HOUH 4NXNQ 3PF4A 3HOYH 4QL5A 3WWVA 5AJ3L 4DV7L 2E5LL 4B3RL 3KYHC 3MEFA 3TS2A 3S2DH 3I2ZA 3T1YL 4JV5L 1OXSC 4HJ9A 3KDFA 5GQOA 2ZM6L 2UUAL 2JQOA 5IWAL 2VUMH 1VQDA 2KENA 4DR7L 2YYZA 1IBLQ 1I5FA 3PGZA 3J7A5 2UUBQ 2OWOA 3I4OA 1HNZL 1KIXA 4DR4L 4LFBL 2Y0SG 4A93H 2Q2HA 2YU9H 4B3ML 3CD6A 4A3DG 1X54A 3JC66 3UDIA 5M3FH 5FLMH 1QZHA 3FP9A 5IP7G 3A5UA 2CCZA 4LFAL 1HZCA 2AHOB 2CWAA 2R93G 3S24A 1TWCH 2VS1A 3M4PA 4JI4L 5FJ8H 4A76A 2YTYA 4C3JH 3PV0A 4PMWA 1YVCA 3HKZE 5IYBG 1PH6A 4A3DH 4A3FG 4PZ7A 2VQFL 3KDFB 2F4VQ 3STBC 4DKAC 4P75A 3ER0A 5M5XH 2QEXA 1HR0L 3PO3G 4BY1H 1EUJA 4B3SL 2GVBA 1WJJA 1N36Q 4DR1Q 4UP8A 1VQOA 1JE5A 2R7FA 1LM0A 3K7UC 2K5NA 4LF6L 1HJPA 1K73C 4LF5Q 4R4CA 3CCEA 4LF8Q 1TWGH 2E2HH 1OTCA 2L15A 4B3TQ 1EIYB 2H5XA 4B3MQ 5IE8A 2RHSB 1N34L 4DV6Q 1Y1VG 3GD7A 3EN2A 4AIMA 4GKKQ 2ZTCA 3PIPA 1L2FA 1M1KC 1E7ZA 3Q8DA 3HOWH 1I6HH 1EIFA 4UP9A 3M4QA 1SRUA 4H02A 4YCVA 4LF9Q 4IPHA 3W5OA 3OW2A 1EQRA 2IHFA 4PZ6A 1VQ5A 2R92G 3CCUA 2AWNA 3F8TA 1OXVA 5LMNQ 2K50A 1YIJA 2NZHA 4LF7Q 4GKKL 4DR1L 4DR7Q 3CAMA 3RLOA 4TQUS 5C4XG 1GD7A 3RLFA 2UUCQ 4HJ8A 1X6OA 2MO1A 3PUWA 1I94L 4B3TL 4A3GH 1Y14B 2Z6KA 2MFIA 1Q7YC 4YY3Q 1CKOA 1A8VA 3AEVA 4OX9Q 5LMNL 2OQKA 2B63H 3UE1A 3M3YH 2WFWA 4DV0Q 3HOXG 4ALPA 1S40A 2R7ZG 4A3CH 1IL2A 3J81c 4PZ8A 1X55A 3J80c 1Q86C 2LXJA 3J81j 1HR0Q 3HOUG 1VQ7A 1HNWL 4GLAC 4QY7A 3RNUA 4A3MH 3H15A 1K8AC 3U50C 2R7ZH 4A3BH 4APVA 4LF7L 1VCIA 5IY0A 2JEAI 1HNWQ 3PIOA 1I3QH 4JOIC 1XPUA 3RR5A 4LF8L 4B3RQ 3VDYA 3CC7A 2NZOA 2OCEA 1JMCA 2CWPA 5M5YH 5IYBH 3GTGH 1PYBA 3F1ZA 4O0AA 4JBWA 4BA2I 4OWWB 5JJKA 2ZJQA 3UE0A 2IX1A 2E8GA 1BVSA 2ZTEA 4AYBE 2UUBL 2JA9A 2YTVA 1N36L 3S17H 3U58A 4JG2A 1N34Q 3A5ZB 1YHBA 2LXKA 5M3MG 1UE1A 1WOCA 3ZJYC 5K36G 3D0FA 4DV7Q 1IBKQ 2E5LQ 3EIVA 3HOVH 1KHIA 4MTNA 1L1OB 4DV5L 2E2JH 1NMGA 3U4ZA 4DK6C 4JI6L 4LFCQ 2NVQH 1IBKL 1E24A 4GLVB 5ELOA 1C0AA 3RZOH 2HIVA 3RZDH 1HH2P 1OXTA 2C35B 2Z6KC 2JK8A 4UP7A 1I94Q 4LFBQ 4JI5Q 1D8LA 4GOPC 1JT8A 1Q12A 5J3BA 1PVOA 1K3RA 1NBWA 1G6PA 4JI1L 1X65A 2BH8A 1VQ8A 1XPOA 3OTOQ 3HOZG 3PO3H 2IX0A 4A3KG 1XNQL 1PFSA 2CQOA 4J15A 3ULLA 1JB7A 3ERSX 2VL6A 1HNXL 1J6QA 2WB1G 2ATWA 3U4VA 3G4SA 1Y1WH 2RCNA 2KCTA 1VS0A 3H3VH 4HIKA 3H0GG 2HHHL 2UUCL 1YHAA 3PUXA 4A4IA 2VQEL 2ZTDA 3JAMi 5C0XG 1N33Q 1GVPA 3T1HQ 3KF6A 4IPCA 3CCLA 2DUDA 2N78A 1C7YA 3UDXA 5IYCH 1X3FA 1MJEA 4BXXG 5M3FG 1HZ9A 1PH1A 3E0EA 3BU2A 4JI4Q 2VUMG 1KAWA 5GAGC 4BBRH 5JJLA 4LF9L 4JI8Q 4DR3Q 1PH7A 1VQ4A 3UDFA 4A3BG 3K80C 1HNZQ 4HIDA 2HIXA 4DR4Q 3I7FA 4DUYL 2AKWB 1IBMQ 2JA5H 3PF5A 5IT9c 4IO9A 1W3SA 1KRTA 1VQMA 3HOXH 5IP9H 2CFMA 5C44G 1VQCA 4PG3A 2E2IH 4UPAA 3BJUA 5FLXc 2WP8J 3PO2H 4OO1G 1E1OA 2IHEA 2N49A 3G48A 4IOCA 1P16A 5IYDH 4LUVA 3D31A 1PA6A 3HKZG 4C2MH 4ME3A 4L5RC 5C4XH 1VQ9A 1YITA 4B3SQ 4JYAQ 1LUZA 2ZM6Q 2PNHA 3FKIG 1YHQA 1M90C 3S2HH 4DR2L 4JI7L 2JA6G 1YEZA 4IOAA 3S16H 1NY4A 1KRSA 1HZAA 3AFQA 3GO5A 4LWCA 4R1JA 4A3KH 4JI3Q 4JI6Q 1HZBA 3OYYA 4LF5L 2NVTH 1XJVA 5IP7H 3AFPA 4DUYQ 1IBML 3I4MG 2NN6I 4MNOA 1Y1WG 3TQYA 2EQSA 1FL0A 4Y52H 1E3PA 4WJ3M 1L1OA 2JE6I 4X65L 1IYJB 2KHJA 4OXPA 1XNRL 2JA7H 2HT1A 4C3HH 2I5MX 2MNAA 2F4VL 4GKJL 2WAQG 3CCJA 4RG1A 2R6GA 1QVCA 2I0QA 4DV1L 3CP0A 1IBLL 1UEBA 3I4NH 4R4OA 2UXBQ 5BR8L 1VQFA 1ASZA 1EOVA 3GTJH 2IY5B 1X3EA 2JA8H 2OTJA 2K52A 4R4QA 4KI0A 2JA8G 1TWAH 1PH5A 3FHWA 1CKNA 1SMXA 4YWKA 2B63G 1AE2A 3RN2A 2DGYA 2K14A 4NXNL 2Q2UA 3I56A 5JEAJ 1JJCB 1Q8KA 1A0IA 1SROA 1U0LA 4BY1G 4X64L 3CMEA 1PHJA 2K5VA 1YBYA 2EIFA 4JC0A 3CW2C 5M3MH 4DV2Q 4JBKA 3KF6B 2IT1A 3CXCA 1K8GA 2V1CC 1UE5A 2OQ0A 2K4KA 3TEHB 3CCQA 4JI1Q 4A75A 1GO3E 3AQQA 3T1YQ 1WFQA 4X62L 4QJFA 1PV4A 5JJIA 1IZ6A 4DR5L 2UXDQ 4LUZA 2ASBA 4P71A 3CCMA 5HY6A 4DV1Q 4Y7NH 4JI2Q 4JI0Q 1WCMG 4GKJQ 5FLMG 1JJ2A 4JI5L 3GTPH 3J81i 2Q2IA 4NPSA 3CCSA 4YY3L 3TS0A 1VQHA 3G6EA 1VQKA 1GKHA 5IYDG 1T9HA 4AQYQ 4WJ4A 3NELA 1G51A 4JI0L 1KC8C 3JAMc 2VY3A 3A0JA 1Q46A 4OWXB 4XTCS 4A3CG 1VQJA 2ALYB 2PQAB 4LF4Q 1LTLA 4JBMA 1L1OC 4IFDJ 4NXMQ 4GNXB 4AQYL 2FXQA 4DR6Q 1UE7A 1Z47A 2BA1A 3HKSA 4EQ5A 1YJ9A 1PH2A 1VQGA 4X66Q 2KBNA 3H3VI 4JYAL 3CCRA 3EBEA 2JA7G 1CSPA 4EX5A 2I5HA 3TREA 3J7ZC 3KJOA 5LMUL 1V43A 3B6YA 4JI2L 3GTOH 1PH8A 4DNIA 3K8AA 5C3EH 1SLJA 1CKMA 1K9MC 2UXDL 5IWAQ 1EWIA 5GAEC 4K0KL 3L7ZC 4NXML 1FGUA 3PUZA 4JI7Q 2F52A 3M85A 1J5EQ 1V1QA 4QIWE 4A3LH 1EYGA 4GS3A 3PCOB 3RN5A 4JCVE 1LYLA 3TRZA 4RMFA 3ICEA 4TVAB 3CPWA 3F2BA 2WB1E 4GNXA 4A3JG 3G71A 1N8RC 1VQPA 2UU9L 3HOWG 1EQQA 5JEAG 4IJHA 4X65Q 2MO0A 1A62A 1CUKA 1XNRQ 1MKHA 2AMCB 2R92H 3HFZB 3NENA 3LGJA 2UU9Q 3CC4A 3S1QH 1BBUA 2F3IA 3S1RH 3HOZH 1VQLA 3K81C 2VQFQ 1VQNA 4HJ7A 2JEBI 1YZ6A 5LMNW 5C0XJ 4JI3L 1RL2A 4UY8C 2VZAA 3ULPA 4DR5Q 1X3GA 2MQHA 1ASYA 1OXUA 1N32L 2RHQB 4IPDA 1SR3A 4YCUA 2PI2E 5ELNA 1KD1C 1UE6A 1XMQL 2ES2A 3GTKH 1VQBA 4K0KQ 1Q82C 4BA1I 1NJIC 3BZKA 4YHHQ 1GM5A 4YCWA 2JA5G 4HJ5A 3GTLH 2UXCL 1H95A 1CKNB 4JBJA 4IFDI 1E1TA 1I50H 4IPGA 2N3SA 3L2PA 2R7DA 1HNXQ 4L5TA 3NBHB 4OONA 4X66L 1FJGQ 4BBRG 2WAQE 4YHHL 2UXCQ 1XMOQ 4OWTB 2NN6G 3K7AH 3W1BA 4GOPB 4JV5Q 4YWLA 1SE8A 4GNXC 4C3IH 3E9IA 4FDBA 4LF4L 3CMAA 4GLXA 4A3IG 3STBD 5AJ3Q 3M9BA 3PSIA 3KJPA 4R4TA 3S1MH 4DV6L 3F2CA 2N8NA 2I5LX 1FVIA 4MZ9A 2A19A 5M5WH 1DGSA 3S14H 2PMZE 5FJ8G 3A74A 1QVFA 2K5HA 1KQSA 1OXXK 4A3LG 3CC2A 1WI5A 1UWVA 5E7NA 4DV5Q 1X56A 1XMQQ 4P73A 1B8AA 4DV4L 1PH4A 2ZJPA 2RF4A 3BZCA 5GADC 1KXLA 4LUOA 4OO1I 2BH2A 5BR8Q 3PUVA 4AYBG 4GOPA 4KHPQ 5DLQE 2QA4A 2KHIA 4A93G 1PH3A 5C44H 4POGA 1VQEA 1RIPA 4BY7H 1XMOL 1Y1VH 1G291 3PO2G 2PQAA 1XTDA 3S15H 2JJQA 3KOJA 5C0XI 3CPFA 3J80i 5H1SE 2LSSA 4JI8L 3AYHB 4LFCL 4DR3L 3CF5A 2GN5A 4DK3C 1P8LA 1C9OA 3CCVA 4BY7G 4LFAQ 1YI2A 1PH9A 1QZGA
chains in the Genus database with same CATH superfamily
1N9WA 4F7XA 2HCIA 1J5EL 1KNEA 5GROA 5E4XA 3J80L 4L5QA 2XNAC 2JP1A 3CRLC 1YNJD 3L0OA 5IYCG 1KNAA 1WYDA 2PYKA 4QF4A 3W1GA 3M7NA 2BA0A 2Z4IA 1LTID 2NVYH 2WIIB 1NNXA 4MIUA 2RVLA 3FVQA 3BYYB 1QVGA 2ID0A 1A3TA 2QGQA 2B29A 2YV5A 4HJAA 1RJTA 3I73A 5A2QL 2B2VC 3FKIB 1B70B 4A3MG 4DUZL 3CQZB 4R8NA 1TXYA 1BQQT 4RAUC 2XRSD 3P7JA 3FPUB 1PFBA 1A63A 2R93H 1X9NA 2HQLA 4QMGA 2B39A 2FHTA 2RDGA 3QIAA 1NR4A 4WRDA 4KMUC 1S3OA 2JA6H 2EOTA 5IODA 4BBSG 2VNUD 5CMDA 2NBFA 1HTLD 2GVAA 4HEDA 4ZCKA 1SNDA 4IFDG 5HGQA 4IQZA 1TWGB 1F77A 2EY1A 4C3IB 3KLWA 1Y8NB 3ND9A 3F2DA 3I4NG 1PZJD 2K28A 2E5LL 1ZKOA 3MEFA 1ZEQX 3I2ZA 5IWAL 3PGZA 3J7A5 2UUBQ 1SMYD 4UHVA 4B08A 5JJZA 4LFBL 2YU9H 1X54A 4ODGA 4BS9A 3RZOB 3T13A 3BYTB 5EJWA 3S24A 3Q23A 5CV8A 4C2MB 4L63B 4A76A 2BDOA 1PDQA 3GQBA 3NQIA 5COYA 5M5XH 2QEXA 1EUJA 4B3SL 1FD7D 1EY0A 5IOCA 2F0SA 2R7FA 1MD2D 1STBA 1K73C 4LF5Q 1GXDC 2E2HH 5DNFA 4M8AA 2OXPA 3EJIA 3TP5A 1ILPA 2F0OA 2R61A 3TZDA 4AIMA 1BF4A 1PTOH 3PIPA 3EVQA 4C56C 1L2FA 1E7ZA 3HOWH 1EIFA 1MBYA 2C5CA 3OW2A 2IHFA 3CCUA 2AWNA 2QCPX 1OXVA 2K50A 1B9NA 3OHXC 2GA4B 4DR1L 1EFID 5JEAH 4UDUC 3RLOA 5FLXL 3CRKC 5C4XG 3RLFA 5C4ZA 4KN4C 2UUCQ 4KY6A 4HJ8A 1X6OA 3PUWA 2ZXOA 2QW7A 3HOZB 2Z6KA 3NWTA 2K6AA 3RUZA 4YY3Q 4HN7A 2B2YA 2LY7A 1JR0D 4DXGA 2CHBD 5FO9B 4A3FB 5M5WB 3MXNA 1U9RA 1SBBB 3Q24A 3OMCA 1IL2A 4NW2A 3SK6A 1Q86C 1HR0Q 3HOUG 1QG7A 3SXHA 4A3MH 2R7ZH 4LF7L 5IY0A 2EJFC 5C44B 1I3QH 4JOIC 1XPUA 1WVLA 2E2IB 4C1NK 5I6WA 3OWEB 3A56A 3VYRA 2F3VA 2NZOA 2OCEA 3CC7A 1JMCA 2CWPA 3GTGH 4BA2I 1JWUD 1RTNA 1LTSD 3A55A 2L55A 2OT2A 2YTVA 3U58A 4JG2A 1YHBA 3H91A 2LXKA 1WOCA 3NXWA 3D0FA 1TS2A 1BXTA 4EQNA 4KKTA 3EIVA 4Q5VA 2MPMA 3HOVH 4DV5L 4DK6C 3I90A 5FO8B 1E24A 4J8QA 5G3LF 1II3A 4ZLTF 4JI5Q 3KBGA 2NVXB 4R9WA 1DXMA 4RH6A 1X3QA 5CR3A 3SK4A 2BH8A 1VQ8A 1XPOA 3HOZG 4RKLA 2IX0A 3ULLA 1JB7A 3ERSX 3D4DA 4A3BB 4HIKA 1YHAA 2VQEL 4A4IA 1B53A 3H09A 1N33Q 5C0XG 3PMFA 2IJ0A 4F87A 1X3FA 4C3IG 5F2DA 5M3FG 1PH1A 5L37A 2VUMG 1UNSA 4BBRH 1EYDA 1Q90A 4LF9L 4JI8Q 2M9VA 4B9XA 3H0GB 3IFTA 3K80C 3RD4A 4HIDA 4DUYL 2AKWB 2JA5H 5I9PA 4IO9A 1KRTA 2CFMA 5C44G 2E2IH 3BJUA 1M4VA 5ELBA 1STYA 2N49A 2MHVA 1P16A 3S1RB 1TWCB 1HFGA 3HOUB 4ME3A 1SE4A 1LUZA 2KECA 4FF3A 2FFKB 1M90C 4ABNA 3S2HH 4JI7L 1WCMB 1ILQA 4LWCA 4A3KH 4R1JA 4LF5L 1UAPA 5IIFA 4DN4M 2SOBA 3D8GA 3I4MG 5IP7H 3GTMB 1IYVA 3PQIA 1DZ1A 5EPKA 3TQYA 2KCCA 1L1OA 5M5YB 4OXPA 2HT1A 4G7HC 2WAQG 1QWYA 3CCJA 5M9OA 1WTHA 4DV1L 5FK9C 2HCCA 2K52A 2JA8G 2IX3A 1CQFA 2XIWA 4RGNA 2K5WA 3I56A 1PXUA 2WAQB 1JJCB 4X64L 1A0IA 2L4NA 2K5VA 2EIFA 2MGSA 2K4KA 5EBDA 2RBMA 3CCQA 3RZDB 1KDCA 1EIHA 1WFQA 4PQXA 4CDFC 4X62L 1PV4A 1TWHB 1NUCA 4LUZA 4N9PA 1PH9A 2RSNA 1WCMG 4O1NA 1FR3A 4XQQA 4NPSA 2EE1A 4YY3L 1EYCA 2FINB 1VQHA 3G6EA 1EZ8A 5IYDG 4AQYQ 3DWAA 5D3IB 5J39A 2VY3A 4OWXB 4XTCS 1CFMA 1ENCA 2N55A 1XX8A 4IFDJ 4NXMQ 4EQ5A 2A6HD 2I46A 4WJWA 1G6ZA 1GJXA 2VB2X 1CSPA 2B2UC 3NBIA 3O13A 4CDDC 5LMUL 4A3IB 1V43A 3ERQA 3GTOH 2EY2A 4DNIA 3K8AA 4E6IA 1QB5D 1TS3A 1EWIA 5GAEC 2B2WA 4OIJA 3R93A 3M85A 2PO4A 2VUMB 1ET6A 2G5DA 1B9MA 3RN5A 5KYLA 2SNMA 4RMFA 3TRZA 2KEDA 2OF1A 4A3JG 3Q22A 3HOWG 1EWCA 2MO0A 2A74C 4FF1A 1MKHA 2B2TA 4K2LA 3HFZB 3NENA 2R92H 3HKZB 2F3IA 5TSSA 4HJ7A 4K5VA 1H9SA 5C0XJ 2K01A 1N32L 2VZAA 2WV6D 1HA5A 1EU3A 2RHQB 2ES2A 1JC7A 1SEBD 1UE6A 1XMQL 4K0KQ 2JA5G 2UXCL 4HJ5A 3GTLH 2K03A 3C1EA 4L5TA 3NBHB 1TR5A 1I3QB 3TP6A 4KY5A 4YHHL 1LTRD 1XMOQ 1PTOC 2NN6G 3K7AH 2JA7B 3U9OA 4C3IH 1HTPA 1BBXC 5E4WC 3M9BA 4R4TA 1V1PB 1D1IA 5M5WH 3ONAB 2PMZE 1SNOA 1KXLA 4OO1I 3PUVA 4GOPA 5JPNC 2QA4A 5C44H 3TSSA 4BY7H 2PQAA 4KN7C 4KHVA 3VR2A 2JJQA 2B2TC 5KEEA 4N8X1 3E0JA 3CPFA 2XVSA 5H1SE 2LSSA 4DR3L 3AYHB 2GN5A 1SAPA 4DK3C 3CCVA 2XSCA 1AZPA 3MA2B 4LFAQ 1YI2A 4A3CG 3LNNA 3BDCA 1QUQA 3HEJA 3I70A 2ZJRA 1WCMH 4DUZQ 1CSQA 4QUCA 1VQIA 4XQJA 4CBVA 1B4OA 5EAYA 2QDBA 2XTIA 1NAPA 1W6JA 3R2IA 5C3EG 1V1OA 4FP5D 3OTOL 4RKBA 1VQAA 1NE3A 2IWHA 5EPLA 1Z9FA 3GV6A 4A3EH 2UXBL 4DPGA 4ME5A 4DV3Q 4EQOA 2D0PA 3GTJB 4DR2Q 4DV4Q 4KHZA 3HG9A 1S72A 5CBAE 1VQ6A 2AWOA 1Q8IA 3ULJA 4X3SA 2PZTA 4ID6A 1V9PA 3R8BA 5KYIA 4NP5A 4LW1A 3C2PA 3GP7A 1DM0B 3HOVG 5IT9L 5K5PA 2X69A 3MTSA 1EY6A 1TWHH 1IXRA 2K75A 3KFUA 1TWAB 1F9RA 4IFDH 1E22A 2H1EA 3H0GH 1I4HA 5FOBB 2KCNA 1KL9A 2OTLA 4LF6Q 4BBSH 2FJ2A 1CI3M 4P72A 4KHPL 2A8VA 1A6XA 4AH6A 3J7YW 3CQZH 2YU9B 5ELFA 2NB0A 3MWYW 3DMUA 4POFA 4V190 3D6WA 1O78A 1TVXA 2E2DC 2F0HA 4NDXA 1U5KA 3MZ5A 4HIMA 4G4KA 1K83H 1PZID 2D0OA 4X6AH 3N52A 1XNQQ 3BG3A 3HOUH 2KVMA 5DM73 3HOYH 3WWVA 5AJ3L 3TS2A 5EKLA 3KDFA 2F0GA 2JQOA 1VQDA 2EYMA 4DR7L 5HURA 1GUTA 4A3KB 1I5FA 1I50B 1HNZL 1KIXA 2Y0SG 1JWSD 3ND8A 1EOTA 3UDIA 5M3FH 1DOMA 1GHJA 5FLMH 1SNMA 4H44C 1SMYC 4LFAL 2AHOB 3BVMA 4JI4L 1Q3LA 2RKSA 2I07B 2YTYA 4PMWA 3HKZE 1BCPB 5IYBG 1PH6A 1WTWA 4A3FG 2VQFL 2P5ZX 4DKAC 3CHBD 4P75A 3ER0A 2KHSA 2WINB 1WJJA 1STNA 4UP8A 1TU2B 4XYOA 1LM0A 2JN4A 2Q8RE 2K5NA 5J22A 2VXWA 2J7ZA 1DYQA 3MXGA 4FXGC 3CCEA 3S1NB 4B3TQ 2H5XA 4B3MQ 4K5WA 2A68C 2TSSA 5IE8A 2RHSB 3NK9A 3KLSX 1Y1VG 3GD7A 5DAUA 2JA8B 1GHKA 4RA8A 1I6HH 1TY2A 3KLSA 1L0XB 1U4MA 1LTBD 4H02A 5CBEE 2B2WC 4LF9Q 1EQRA 1QNKA 3F8TA 5LMNQ 5C6AA 3BDOA 5C0XH 2ZT9C 3NTIA 2FMMA 3I4MB 1CA6A 2RDFA 4TQUS 1GD7A 1C4QA 1TS4A 1I94L 2MO1A 4KD3A 3FEWX 1MSGA 3VYUA 2MFIA 5IGBA 3PO2B 3KUPA 1XYIA 1Y8OB 2AQ1B 2L12A 4A3CH 2R7ZG 3HOXG 2L5TA 2MJ8A 3J81c 4PZ8A 1STHA 2E76C 1VQ7A 1HNWL 4GLAC 4RGTA 2Q8IB 3RNUA 3MFYA 1K8AC 3U50C 2BCOA 2F0DA 4A3BH 1BUVT 4APVA 1HNWQ 2HUGA 4PNYA 3RR5A 4OHJA 4OWWB 3DWPA 1SYDA 2RQXA 4AYBE 2JA9A 3MC0B 3OW7A 3S17H 1LO5D 1N34Q 4K5XA 2Z8LA 2JA6B 1TQOA 3ZJYC 4IN3A 2OEOA 4MTNA 2PMZB 3U4ZA 1GUWA 1ESFA 1C0AA 5ELOA 3RZOH 1T5XD 3RZDH 2SEBD 5ELEA 2JK8A 3GTGB 2O2LD 1D8LA 3T4AC 4GOPC 1JT8A 4A3DB 4P2CB 2G9HD 5J3BA 1PVOA 1K3RA 1G6PA 2A69D 3S14B 5DM63 3P20A 3NTHA 4H0LC 1A2TA 3PO3H 1U4LA 4C3JG 1PFSA 2CQOA 2PQEA 3QO2A 4J15A 3CKIB 4OEMB 4A3MB 2ATWA 3G4SA 1VS0A 1HRJA 5KNBA 2HHHL 1PLFA 3BZDB 4NMZA 3V05A 3BS1A 2ZTDA 2UUCL 3NWSA 3T1HQ 4IPCA 2DUDA 2N78A 1C7YA 4BXXG 1MJEA 1R9TB 1HZ9A 3BU2A 4JI4Q 1KAWA 5GAGC 4IUPA 5JJLA 4DR3Q 2EXZA 2WB1B 1PH7A 3OWFA 4J6HA 2LMCB 1EIGA 1CT1D 3NPPA 1HNZQ 2HIXA 3IFDA 1ENAA 4WORA 1F9PA 1BOSA 3PF5A 5BN5A 1QE6A 1BDOA 5LL6S 3VYTA 3KF8A 4FXKC 3HOXH 3K7AB 4X3UA 4UPAA 2WP8J 4OO1G 1SNPA 1HQMC 3G48A 5IYDH 1GOZA 5C4JB 1J9OA 3JAML 1VQ9A 1YITA 4JYAQ 2ZM6Q 3T51B 1YHQA 1TS5A 3LWUA 2EYHA 4BY1B 4PMCA 4H7BA 2R93G 1KRSA 3GO5A 3NTKA 1HZBA 2MP1A 3HZXA 4RGOS 1TY0A 1IBML 5EKKA 4AYBB 1Y1WG 2NWGA 2EQSA 3OMGA 3K0YA 1GUNA 3J7AF 2JA7H 3SHLA 4XT1B 2I0QA 3CP0A 1UEBA 4G7ZC 4R4OA 1CZGA 1EOVA 4KI0A 1TWAH 4DU9A 3CU7A 1PH5A 2IW3A 3T53B 2DJFC 1EEFD 3NQTA 3QOLA 4YWKA 2DGYA 3A7LA 1J8IA 1U0LA 4BY1G 1PHJA 4JC0A 3IKJA 4KTAA 4ULLA 4JBKA 2IT1A 5D14A 3QG1A 4JI1Q 3NBHA 4A75A 1TT2A 3AQQA 3T1YQ 2A6EC 3R2TA 1SE3A 1IZ6A 2X6GA 4Z9CB 2ASBA 5HY6A 4DV1Q 4XQNA 1SJED 4JI2Q 4Y7NH 1K83B 4IURA 1G2SA 2EJMA 2Q2IA 4ZQ3A 4RHRA 2B8FA 2F0TA 1GKHA 4WJ4A 1QNUA 1EY8A 3FDTA 1O7LA 3A0JA 1Q46A 3VR4A 5JAVA 5HGTA 4LF4Q 4JBMA 4EQPA 4DK1A 3D6CA 1G91A 1UE7A 1Z47A 1VMPA 1VQGA 2EVBA 4X66Q 3C3LA 1MGSA 3CCRA 4KD4A 3LX0A 2I5HA 4L6TB 2ICEC 4RGMA 5EQ0A 1K9MC 3L7ZC 3K5MA 4NXML 3PUZA 1RDPD 1J5EQ 1V1QA 3K5OA 1HPCA 4QIWE 2EYOA 1LTAD 3A8JE 3A54A 1LYLA 3ICEA 4TVAB 4GNXA 3NUCA 3F2BA 3OOCA 5C5MA 1PZKD 2UU9L 1EQQA 2E2JB 4K2KA 1A62A 4XYQA 1JB3A 1F9QA 4XXEA 3V2TA 4CDCC 2D5DA 2A5HA 1BCPF 3CC4A 2UU9Q 3S1QH 1BBUA 3HOZH 4C3HB 3K81C 2F0FA 2JEBI 1YZ6A 5LMNW 5E1FA 2K05A 4UY8C 3ULPA 1X3GA 2MQHA 1OXUA 1SR3A 2PI2E 5T1IA 1I6HB 4YHHQ 4YCWA 1I50H 4IPGA 2N3SA 1LT5D 2DY7A 4OONA 1FJGQ 1SE2A 4YWLA 1KLGD 1SE8A 3NHHA 1K8MA 3UI2A 5AJ3Q 2LKVA 5AFWA 5ISRA 4DF7A 2N8NA 1FVIA 2KA7A 2A19A 2B63B 2TMPA 5IT9E 1QVFA 3T16A 1I6VC 1OXXK 3VYSA 3CC2A 3S2HB 1X56A 4LAAA 1I4GA 3S16B 5GADC 4LUOA 4X3KA 5BR8Q 2A68D 1WD1A 5DLQE 2KHIA 1RD9D 4KJOA 4MTKA 1PH3A 1Y1VH 1KAAA 4IALA 1P8LA 4BY7G 1LABA 2F3WA 2PW7A 3SEBA 4CJ0B 1QILA 1SN8A 2EXDA 5CGKA 1QZGA 1EFWA 2UXDL 4QQBX 4DR6L 2LS01 3NSWA 3WOEA 4A3JH 4P74A 4O2DA 4HAEA 1C48A 1NTGA 1LTGD 1O7ZA 2B3GA 1XXGA 4BXXH 4HMJA 3Q0AA 3I4MH 2PI2A 1LV9A 4OGQC 5M3MB 4L5SA 1EY5A 4C1NI 1U4PA 2A69C 1F2MA 4M1UB 1Q1BA 1G2TA 3MVVA 4A3IH 1L0WA 1YNJC 4IZ8A 1N32Q 2E74C 3AMUA 2SNSA 1H9SB 1BKBA 3X3NA 4CKBA 3GTKB 2VQEQ 3S2DB 3EROA 3RLNA 1PRTF 2D2CC 4DV2L 4LK1C 2JYOA 3DM1A 1O7IA 2B2YC 4GN4B 2K04A 4IUUA 1I4PA 3K0XA 3HOYG 3MXPA 1W2BA 4HCSA 1LLRD 2A1AA 4BY7B 4A3EG 4YWMA 2NTSA 3I91A 5C4JH 1BO0A 1EY9A 1NMFA 5EKIA 1D7QA 4DAYB 2XN9C 1TWFH 5G3LD 1KTKA 3E9HA 1AH9A 2KCMA 1HUMA 4XIGS 4CGYB 3MAQA 1Q81C 1MIUA 2YTXA 1AE3A 4QUFA 4OELB 2RCFA 1PFNA 4U68A 2E75C 2Y0SE 3DLLA 5IGEA 1AZQA 3GTMH 1PYSB 1SYCA 3S1NH 1XPRA 3M4OH 3MXUA 2HHHQ 2PNRC 1GUGA 2V4DA 3GTQH 3MFGA 5IP9G 4JOIA 1ZYRD 5CV6A 2WKCA 4BBRB 3IRBA 3DM3A 3A8IE 4ZAIA 3VA5A 4F8MA 3E5SA 4NXNQ 4QL5A 4B3RL 3I8ZA 5EBCA 1OXSC 4HJ9A 5GQOA 2ZM6L 3M7GA 2UUAL 2KQ3A 1RCVD 1EU4A 2YYZA 1IBLQ 1UUPA 2K32A 4RCNA 4ZKCB 4DR4L 4EVOA 1AEXA 2Q2HA 4B3ML 3P1HA 2F0LA 1DCZA 3FP9A 1D1KA 3A5UA 2CCZA 3RMHA 1EQVA 1HZCA 2CWAA 1TWCH 2VS1A 3M4PA 1VMCA 4C3JH 4A3DH 4K8JA 4PZ7A 1XWEA 4IUQA 3PO3G 2A6ED 1N36Q 4DR1Q 1VQOA 1JE5A 4RCOA 2NVTB 1KABA 2M00A 3G6JB 2WACA 2IPKD 4I7AA 4LF8Q 1OTCA 2R92B 1EIYB 2CW0D 4J1MA 1F9SA 4FO2A 4A3GB 3EN2A 4GKKQ 2ZTCA 1CM9A 4WFN3 2DNEA 3Q8DA 3J81L 2CVRA 4UP9A 1SRUA 4HSPA 2F0PA 4PZ6A 2K5QA 4GZYC 2HQEA 2B8GA 2NZHA 4LF7Q 1RHPA 4DAVA 2NZ1D 3HGBA 2L1BA 4B3TL 1D2BA 1Q7YC 2F0JA 4PV1C 1A8VA 2NN6H 4OX9Q 5LMNL 2OQKA 5KRUA 3TBIB 4A3EB 4OL7A 3UE1A 3M3YH 4DV0Q 4ALPA 3J80c 1MSHA 3E3XA 3J81j 1RODA 1JQYD 4C3HG 1D6EC 1T5EA 1L0YB 3PIOA 3W2DA 1EL0A 1O7YA 4B3RQ 4HSVA 2X6LA 4O0AA 4JBWA 4UAIA 3OIQA 3R3OA 3UE0A 2IX1A 2E8GA 1BVSA 2ZTEA 3QJYA 1ZXTA 3S1MB 3OIPA 3SVMA 2A73B 5M3MG 1UE1A 4N9TA 1DOLA 5KNDA 1JOKA 5CC4A 4CKCA 3PO3B 1WTXA 5K36G 4DV7Q 2SDFA 1IBKQ 2EDGA 5A2QE 4LFCQ 3C46A 1NMGA 2NVQH 1IBKL 4GLVB 1BCPC 2HIVA 1HH2P 1OXTA 2C35B 1I94Q 1IHZA 2JSOA 2FMCA 3D3RA 2MUYA 4DGZA 3K5LA 1S5CD 1D5ZC 5I2XA 4DNTB 1PTOB 4DAPA 4JI1L 2K5DA 1VDZA 2QDLA 4A3KG 1XNQL 1H9JA 1ICFB 3N6RA 1J6QA 2HDLA 1Y1WH 2RCNA 3L3OC 2F0NA 3H3VH 1E2WA 3PUXA 3JAMi 3DXJC 3J80E 1WD0A 1GVPA 2NVYB 5ELDA 3S1QB 1JCKB 3CCLA 2F0EA 2O5JC 5D3DA 1CHQD 1R4QB 5JVG3 2Z4HA 4XT3B 3IL8A 2ZXRA 1JORA 5IGGA 1A3UA 4DR4Q 1IBMQ 5NUCA 1M8AA 2D9UA 2Z6BA 4I65A 5IT9c 1STGA 4O42A 1W3SA 4IUVA 1BCPD 5FLXc 1K3BC 5I4DA 1YNND 3PO2H 3ITPA 4IOCA 1R4PB 4LUVA 1X32A 3D31A 5IGDA 1PA6A 4QB4A 4C2MH 2EYPA 4L5RC 1GUOA 3HOYB 5C4XH 5CV7A 2CH4A 2PNHA 2G9DA 1U4RA 4FNFA 4DR2L 4L8JA 1YEZA 3S16H 1NY4A 4JI3Q 3W3AA 3OYYA 2NVTH 3K6OA 1XJVA 3TDQA 1B44D 4A93B 4MNOA 3H94A 1AN8A 1FL0A 1LTTD 4Y52H 1E3PA 4WJ3M 4X65L 1IYJB 2KHJA 1E2ZA 4CHTB 2MNAA 4RG1A 1QVCA 3I4NH 4FF2A 1PRTB 1VQFA 4Y7NB 3GTJH 1SDFA 1SSOA 1X3EA 1LACA 1KDAA 2OTJA 2F1MA 3FHWA 1CKNA 1SMXA 2B63G 1A2UA 2K14A 1PYWD 1H9RA 3K59A 3TZUA 1FNWA 1Q8KA 4A3GG 3CMEA 4KKUA 5M3MH 2PW5A 4DV2Q 3C1FA 3KF6B 3CXCA 2HD3A 1K8GA 2V1CC 1UE5A 5FLXE 4DR5L 3E6ZX 2UXDQ 3CCMA 5BN4A 2Z9HA 1Z7TA 4C3JB 4JI0Q 4GKJQ 2DJGC 3D4WA 3PIO3 3GTPH 3TS0A 1V8QA 1VQKA 4BWGB 5C3XA 1T9HA 2F4IA 3NELA 1G51A 4JI0L 3A7AB 2F0IA 5CV5A 3SDZA 1D5XC 1HA6A 1LTLA 1QCBD 3J7AV 4DR6Q 2QEJC 4ILWA 1YJ9A 2KOLA 4JYAL 2KBNA 3EBEA 1ZYRC 4EX5A 5I2YA 3TREA 3KJOA 3B6YA 4JI2L 1PH8A 1CKMA 4K0KL 1SNCA 3QWNA 4JI7Q 1F2ZA 4CDEC 4QCLA 5K36H 2BDNA 3A8KE 3PCOB 2KEEA 4JCVE 3CPWA 3HS0C 1N8RC 1VQPA 4X65Q 1I4QA 1FNUA 1HXYD 1CA5A 1B2TA 1STEA 4JI3L 3S17B 1ASYA 1ML0D 4IPDA 5ELNA 3KBXA 1SYFA 4BA1I 1WTPA 3BZKA 1Q82C 1NJIC 4A3JB 1B3AA 3I4LA 3VR6A 4R8IA 1DJRD 1LT3D 4JBJA 4IFDI 1HNXQ 3L2PA 1SYBA 4BBRG 2WAQE 1IKLA 2CW0C 4OWTB 4GOPB 1VF7A 2PZWA 1S5FD 4HMIA 4GNXC 2N88A 3E9IA 4FDBA 3CMAA 4GLXA 4A3IG 1HFNA 3NE5B 1Y8PB 3PSIA 3S1MH 4DV6L 1IW7C 1ICWA 3F2CA 1S5ED 2I5LX 4MZ9A 3BVZA 5J1ZA 3S14H 5FJ8G 1QJOA 1PTOD 4DAYA 1F2LA 5I9OA 1XMQQ 4P73A 4DV4L 2RF4A 4CJ1B 2BH2A 2O5IC 4QIWB 3QR8A 3NP8A 4A93G 1CZWA 3DEPA 1RIPA 1XMOL 1G291 3PO2G 1XTDA 2RSOA 3S15H 2O4XA 3KOJA 2ICIA 1DONA 5C0XI 5DEHA 4KJNA 3J80i 2R93B 4LFCL 3CF5A 1I4XA 1C9OA 5IGFA 4ZYSA 1B1ZA 5C4XB 3UDGA 1MJCA 2Z0SA 3I55A 1EWHA 2BE5D 3T1HL 2AUJD 1JJGA 1YJNA 1C8CA 4KKSA 1S5BD 4MHEA 1FJGL 2EY5A 5FKAC 4NB3A 4V0BA 5EPJA 5I6YA 3M4OB 3FKIH 1FYCA 1HCZA 1Y1VB 1IYUA 2EZVA 4DFAA 2F0WA 2NVXH 1QUQB 3H6MA 1IL8A 4OO1H 4HIOA 1EZ6A 3KLRA 1BBWA 5GAHC 4DAMA 2CKZB 2J0TD 1TIID 1HHVA 5LMUQ 1GUSA 3SGIA 3GDEA 1YNXA 3OPOA 1JICA 2NYZD 4GN3B 1OO9B 3HOXB 2D62A 1DD2A 3PUYA 1JOOA 4HCEA 1PTOF 2K1BA 1B7YB 2XGTA 2DNCA 4R4IA 2UUAQ 4A3FH 4KLKA 4GN5A 3SK8A 2Q2TA 2BOSA 4IJLA 4K6DA 4DV0L 2F0MA 2DN8A 1YJWA 2C9OA 3FPPA 4OX9L 2VW9A 1K0RA 4LNQA 1XTCD 4X62Q 2E2HB 1JE4A 1N33L 2KUMA 1HR0W 5JOBA 4QGUA 3H3VC 4IUNA 1Q1EA 3KF8B 1R9TH 1X3PA 4DV3L 3MXNB 4PMBA 3I4NB 3AU7A 1S4ZA 1CQVA 3NEMA 2EYFA 4X64Q 1SFOH 1TWFB 3PF4A 4DV7L 3S9WA 1E0BA 3KYHC 1MI2A 3S2DH 3T1YL 4JV5L 2NUCA 4RHSA 3I3CA 5FO7B 4CKEA 2VUMH 2KENA 3WOFA 2K7VA 2OWOA 3I4OA 4A93H 4K8IA 3CD6A 4A3DG 3JC66 1QZHA 4JVZA 1EY7A 5IP7G 2L9HA 2F0KA 2QF7A 3D4RA 2AQ2B 2CQAA 3P75A 1SYGA 5FJ8H 1CTMA 3PV0A 3GTPB 1YVCA 1D5MC 1PRTC 3KDFB 1RTOA 1EQTA 4IUTA 3STBC 2F4VQ 2Y0SB 1HR0L 3SE0A 4BY1H 2GVBA 3GTLB 5JPMC 1Y69U 3K7UC 1JWMD 3HRZC 3EA6A 4LF6L 3V96A 1NR2A 2QILA 1HJPA 5A35A 4R4CA 1H9MA 1TWGH 3SR1A 2L15A 3MHBA 4ZKBB 4I7ZC 1NCVA 4CJ2C 1N34L 4DV6Q 1SNQA 1W6KA 5KIXA 1M1KC 3IAYA 5LL6X 3BVGA 3M4QA 3K5NA 4YCVA 4IPHA 3W5OA 1VQ5A 2R92G 1G8ZD 1YIJA 3U9SA 4GKKL 2NVQB 2R7ZB 4DR7Q 3CAMA 5C3WA 2K33A 1SJHD 1V1PA 4A3GH 1Y14B 1LT6D 1CKOA 3AEVA 4FXDA 2WKDA 3WDNA 2F0UA 2B63H 3I72A 2WFWA 1S40A 4ZK9B 1X55A 2H4OA 1I4RA 4MN3A 3VR3A 4KK7A 2LXJA 1Z6HA 4LJZC 2EPBA 3G7LA 4NKLA 4QY7A 2HDMA 3H15A 4TSSA 4ZRZA 1VCIA 2JEAI 1AFPA 2VB3X 3Q6SA 4LF8L 1CHPD 3VDYA 3HP3A 4B9WA 5M5YH 5IYBH 1AW7A 1MHWC 1PYBA 1BNZA 3F1ZA 1SYEA 1BR9A 5JJKA 2ZJQA 3URYA 2UUBL 5C3EB 1N36L 2EY6A 3A5ZB 1DOKA 3QB3A 2AQ3B 2L0CA 4K14A 2E5LQ 2JA5B 1EY4A 1IW7D 1KHIA 1L1OB 3DUZA 2E2JH 4JI6L 1NSNS 1S5DD 1B3QA 3BDLA 2Z6KC 4UP7A 2XWBB 4LFBQ 2F0QA 1K28A 1Q12A 1ONLA 3ZYYX 3HOWB 4FYDA 5IGCA 5E3FA 1NBWA 3M3YB 4DXFA 2M2LA 1X65A 2A6HC 3OTOQ 5T1GA 5EGTA 5CV4A 1PRTD 3K57A 4F88A 2VL6A 2PPBC 1HNXL 3HOVB 1RF2D 2WB1G 3U4VA 1AP0A 1WTQA 1H9KA 2KCTA 3L9AX 3H0GG 1JOQA 3KF6A 3M4YA 3UDXA 5IYCH 3E0EA 3SK5A 1WTRA 5CYUA 3T56B 1VF5C 2J4XA 1VQ4A 3UDFA 1B50A 4A3BG 5M5XB 2LFNA 3I7FA 1HQRD 2JXMB 5D65A 1STAA 1VQMA 5IP9H 1KDBA 1VQCA 4PG3A 2Q8TA 2ENBA 1E1OA 2IHEA 4EGVA 1WTVA 4FVMA 1O80A 3HKZG 2NTTA 1KLUD 3KK7A 4B3SQ 2XWJB 3FKIG 2Z1CA 2JA6G 4IOAA 4KV6A 1HZAA 3AFQA 2PZUA 4JI6Q 1TKWB 2EYJA 4DUYQ 3AFPA 4ZUJA 2NN6I 3EQLC 1F2YA 3DWQA 3K58A 2JE6I 1XNRL 4C3HH 2I5MX 2F4VL 1FNVA 4GKJL 2R6GA 4XDXA 1IBLL 3TP8A 2UXBQ 5BR8L 1ASZA 2IY5B 2JA8H 4R4QA 4X3TA 3FRPB 2RA4A 1AE2A 4OIKA 3RN2A 4NXNL 2Q2UA 5JEAJ 1ET9A 5KNCA 4N8FA 1SROA 1UEAB 4JW0A 1YBYA 2R3ZA 3CW2C 3QOJA 2OQ0A 3TEHB 4DNRB 1GO3E 4JK1C 4QJFA 5JJIA 1CK1A 1SXTA 4P71A 1HUNA 1EYAA 4G7OC 1SFOB 5FLMG 1JJ2A 4KY7A 4JI5L 3J81i 2B2VA 1FGBD 3CCSA 4YIJA 1PFMA 3TP7A 2EJGC 2QKIC 1K8OA 3GV3A 1KC8C 3JAMc 1VQJA 2ALYB 2IL8A 2PQAB 4HR7B 1L1OC 4GNXB 4AQYL 2FXQA 5M3FB 3HKSA 2XRQD 2BA1A 2EYLA 5BN3A 1PH2A 1K0SA 1LT4D 3DHQA 3J81E 3EFXD 3FMCA 3H3VI 2JA7G 3J7ZC 2ZXPA 4DA2A 4Q0FA 5C3EH 1SLJA 2F0VA 5IWAQ 2RDHA 5CORA 1FGUA 2F52A 4BBSB 4A3LH 2PCFB 1EYGA 2CH4W 4GS3A 1IKMA 5C5LA 2F03A 4FF4A 2WB1E 1YNNC 3G71A 4JPBW 5JEAG 4IJHA 1XNRQ 1CUKA 2AMCB 3S15B 1E2VA 3LGJA 3JAME 3DEOA 4U673 3S1RH 1VQLA 1VQNA 2VQFQ 2L11A 1RKNA 4LMQD 1QOHA 1RL2A 2DY8A 4TKOB 4DR5Q 4YCUA 1KD1C 3GTKH 4RFBA 1VQBA 1GM5A 5ELCA 2BE5C 1H95A 1CKNB 1E1TA 5KGUA 2R7DA 3VR5A 4X66L 1A15A 2UXCQ 3W1BA 4JV5Q 4TRDA 4LF4L 3STBD 3VA7A 3LWEA 3F2UA 3KJPA 1A3VA 2AUKA 3MEHA 4G57A 5LHY1 4K6LA 1PMRA 4H13C 3GTOB 3AB9A 1WTOA 3X3MA 1DGSA 3TMEA 3A74A 5JVH3 2K5HA 1KQSA 4A3LG 1WI5A 1UWVA 5E7NA 4DV5Q 1ESRA 1B8AA 1PH4A 2ZJPA 2B2UA 3BZCA 4DK0A 3TN2A 4AYBG 1Y1WB 4KHPQ 1ENFA 3PIP3 3OSOA 4ZUIA 4POGA 1VQEA 4RWSC 3GTQB 4HTHA 2KJXA 4S3SA 5C4HA 4JI8L 5CV9A 1EEID
chains in the Genus database with same CATH topology
1SN8A 2EXDA 1N9WA 3UDGA 1MJCA 1QUQA 2Z0SA 3I55A 4A3GG 4DR6L 4QQBX 1J5EL 3T1HL 5GROA 2ZJRA 1JJGA 4A3JH 1YJNA 1WCMH 4L5QA 4O2DA 4P74A 4DUZQ 1NTGA 1FJGL 1CSQA 3L0OA 2B3GA 1VQIA 5IYCG 4NB3A 4BXXH 3I4MH 2PI2A 4L5SA 1WYDA 5EAYA 3FKIH 2XTIA 1Q1BA 3W1GA 5C3EG 2BA0A 3OTOL 3M7NA 1VQAA 2NVYH 1NE3A 4A3IH 1L0WA 2NVXH 1Z9FA 1QUQB 4A3EH 1N32Q 2UXBL 4DPGA 4DV3Q 1EFWA 2D0PA 4HIOA 4DR2Q 4DV4Q 1BKBA 2ID0A 1QVGA 2VQEQ 1BBWA 2QGQA 4KHZA 2B29A 3RLNA 4DAMA 5GAHC 2YV5A 4HJAA 2CKZB 1S72A 4DV2L 2AWOA 3ULJA 1VQ6A 5LMUQ 1O7IA 4GN4B 1V9PA 3SGIA 3K0XA 3HOYG 3GDEA 1W2BA 1YNXA 1B70B 4A3MG 4DUZL 4GN3B 2A1AA 2D62A 3PUYA 1TXYA 4LW1A 4A3EG 4YWMA 3HOVG 1B7YB 1A63A 1TWHH 2XGTA 2R93H 1IXRA 2HQLA 5C4JH 2K75A 1X9NA 1NMFA 4R4IA 3KFUA 2UUAQ 4A3FH 1D7QA 4DAYB 1TWFH 1E22A 3E9HA 1AH9A 2KCMA 4KLKA 4XIGS 3H0GH 4GN5A 1S3OA 1Q81C 2JA6H 1MIUA 2YTXA 1KL9A 4IJLA 1AE3A 4DV0L 1YJWA 2OTLA 2Q2TA 4LF6Q 4BBSH 4BBSG 2VNUD 4P72A 2GVAA 2Y0SE 3DLLA 4OX9L 2VW9A 4KHPL 2A8VA 1K0RA 4LNQA 4IFDG 4AH6A 3GTMH 1PYSB 5HGQA 4X62Q 3S1NH 3CQZH 1XPRA 3M4OH 1N33L 1HR0W 2HHHQ 4POFA 4QGUA 3KLWA 3F2DA 3GTQH 1Q1EA 3KF8B 1R9TH 4DV3L 3MXNB 5IP9G 3I4NG 1U5KA 3NEMA 4JOIA 4X64Q 4HIMA 1K83H 2D0OA 1SFOH 4X6AH 3IRBA 1XNQQ 3DM3A 3HOUH 4NXNQ 3PF4A 3HOYH 4QL5A 3WWVA 5AJ3L 4DV7L 2E5LL 4B3RL 3KYHC 3MEFA 3TS2A 3S2DH 3I2ZA 3T1YL 4JV5L 1OXSC 4HJ9A 3KDFA 5GQOA 2ZM6L 2UUAL 2JQOA 5IWAL 2VUMH 1VQDA 2KENA 4DR7L 2YYZA 1IBLQ 1I5FA 3PGZA 3J7A5 2UUBQ 2OWOA 3I4OA 1HNZL 1KIXA 4DR4L 4LFBL 2Y0SG 4A93H 2Q2HA 2YU9H 4B3ML 3CD6A 4A3DG 1X54A 3JC66 3UDIA 5M3FH 5FLMH 1QZHA 3FP9A 5IP7G 3A5UA 2CCZA 4LFAL 1HZCA 2AHOB 2CWAA 2R93G 3S24A 1TWCH 2VS1A 3M4PA 4JI4L 5FJ8H 4A76A 2YTYA 4C3JH 3PV0A 4PMWA 1YVCA 3HKZE 5IYBG 1PH6A 4A3DH 4A3FG 4PZ7A 2VQFL 3KDFB 2F4VQ 3STBC 4DKAC 4P75A 3ER0A 5M5XH 2QEXA 1HR0L 3PO3G 4BY1H 1EUJA 4B3SL 2GVBA 1WJJA 1N36Q 4DR1Q 4UP8A 1VQOA 1JE5A 2R7FA 1LM0A 3K7UC 2K5NA 4LF6L 1HJPA 1K73C 4LF5Q 4R4CA 3CCEA 4LF8Q 1TWGH 2E2HH 1OTCA 2L15A 4B3TQ 1EIYB 2H5XA 4B3MQ 5IE8A 2RHSB 1N34L 4DV6Q 1Y1VG 3GD7A 3EN2A 4AIMA 4GKKQ 2ZTCA 3PIPA 1L2FA 1M1KC 1E7ZA 3Q8DA 3HOWH 1I6HH 1EIFA 4UP9A 3M4QA 1SRUA 4H02A 4YCVA 4LF9Q 4IPHA 3W5OA 3OW2A 1EQRA 2IHFA 4PZ6A 1VQ5A 2R92G 3CCUA 2AWNA 3F8TA 1OXVA 5LMNQ 2K50A 1YIJA 2NZHA 4LF7Q 4GKKL 4DR1L 4DR7Q 3CAMA 3RLOA 4TQUS 5C4XG 1GD7A 3RLFA 2UUCQ 4HJ8A 1X6OA 2MO1A 3PUWA 1I94L 4B3TL 4A3GH 1Y14B 2Z6KA 2MFIA 1Q7YC 4YY3Q 1CKOA 1A8VA 3AEVA 4OX9Q 5LMNL 2OQKA 2B63H 3UE1A 3M3YH 2WFWA 4DV0Q 3HOXG 4ALPA 1S40A 2R7ZG 4A3CH 1IL2A 3J81c 4PZ8A 1X55A 3J80c 1Q86C 2LXJA 3J81j 1HR0Q 3HOUG 1VQ7A 1HNWL 4GLAC 4QY7A 3RNUA 4A3MH 3H15A 1K8AC 3U50C 2R7ZH 4A3BH 4APVA 4LF7L 1VCIA 5IY0A 2JEAI 1HNWQ 3PIOA 1I3QH 4JOIC 1XPUA 3RR5A 4LF8L 4B3RQ 3VDYA 3CC7A 2NZOA 2OCEA 1JMCA 2CWPA 5M5YH 5IYBH 3GTGH 1PYBA 3F1ZA 4O0AA 4JBWA 4BA2I 4OWWB 5JJKA 2ZJQA 3UE0A 2IX1A 2E8GA 1BVSA 2ZTEA 4AYBE 2UUBL 2JA9A 2YTVA 1N36L 3S17H 3U58A 4JG2A 1N34Q 3A5ZB 1YHBA 2LXKA 5M3MG 1UE1A 1WOCA 3ZJYC 5K36G 3D0FA 4DV7Q 1IBKQ 2E5LQ 3EIVA 3HOVH 1KHIA 4MTNA 1L1OB 4DV5L 2E2JH 1NMGA 3U4ZA 4DK6C 4JI6L 4LFCQ 2NVQH 1IBKL 1E24A 4GLVB 5ELOA 1C0AA 3RZOH 2HIVA 3RZDH 1HH2P 1OXTA 2C35B 2Z6KC 2JK8A 4UP7A 1I94Q 4LFBQ 4JI5Q 1D8LA 4GOPC 1JT8A 1Q12A 5J3BA 1PVOA 1K3RA 1NBWA 1G6PA 4JI1L 1X65A 2BH8A 1VQ8A 1XPOA 3OTOQ 3HOZG 3PO3H 2IX0A 4A3KG 1XNQL 1PFSA 2CQOA 4J15A 3ULLA 1JB7A 3ERSX 2VL6A 1HNXL 1J6QA 2WB1G 2ATWA 3U4VA 3G4SA 1Y1WH 2RCNA 2KCTA 1VS0A 3H3VH 4HIKA 3H0GG 2HHHL 2UUCL 1YHAA 3PUXA 4A4IA 2VQEL 2ZTDA 3JAMi 5C0XG 1N33Q 1GVPA 3T1HQ 3KF6A 4IPCA 3CCLA 2DUDA 2N78A 1C7YA 3UDXA 5IYCH 1X3FA 1MJEA 4BXXG 5M3FG 1HZ9A 1PH1A 3E0EA 3BU2A 4JI4Q 2VUMG 1KAWA 5GAGC 4BBRH 5JJLA 4LF9L 4JI8Q 4DR3Q 1PH7A 1VQ4A 3UDFA 4A3BG 3K80C 1HNZQ 4HIDA 2HIXA 4DR4Q 3I7FA 4DUYL 2AKWB 1IBMQ 2JA5H 3PF5A 5IT9c 4IO9A 1W3SA 1KRTA 1VQMA 3HOXH 5IP9H 2CFMA 5C44G 1VQCA 4PG3A 2E2IH 4UPAA 3BJUA 5FLXc 2WP8J 3PO2H 4OO1G 1E1OA 2IHEA 2N49A 3G48A 4IOCA 1P16A 5IYDH 4LUVA 3D31A 1PA6A 3HKZG 4C2MH 4ME3A 4L5RC 5C4XH 1VQ9A 1YITA 4B3SQ 4JYAQ 1LUZA 2ZM6Q 2PNHA 3FKIG 1YHQA 1M90C 3S2HH 4DR2L 4JI7L 2JA6G 1YEZA 4IOAA 3S16H 1NY4A 1KRSA 1HZAA 3AFQA 3GO5A 4LWCA 4R1JA 4A3KH 4JI3Q 4JI6Q 1HZBA 3OYYA 4LF5L 2NVTH 1XJVA 5IP7H 3AFPA 4DUYQ 1IBML 3I4MG 2NN6I 4MNOA 1Y1WG 3TQYA 2EQSA 1FL0A 4Y52H 1E3PA 4WJ3M 1L1OA 2JE6I 4X65L 1IYJB 2KHJA 4OXPA 1XNRL 2JA7H 2HT1A 4C3HH 2I5MX 2MNAA 2F4VL 4GKJL 2WAQG 3CCJA 4RG1A 2R6GA 1QVCA 2I0QA 4DV1L 3CP0A 1IBLL 1UEBA 3I4NH 4R4OA 2UXBQ 5BR8L 1VQFA 1ASZA 1EOVA 3GTJH 2IY5B 1X3EA 2JA8H 2OTJA 2K52A 4R4QA 4KI0A 2JA8G 1TWAH 1PH5A 3FHWA 1CKNA 1SMXA 4YWKA 2B63G 1AE2A 3RN2A 2DGYA 2K14A 4NXNL 2Q2UA 3I56A 5JEAJ 1JJCB 1Q8KA 1A0IA 1SROA 1U0LA 4BY1G 4X64L 3CMEA 1PHJA 2K5VA 1YBYA 2EIFA 4JC0A 3CW2C 5M3MH 4DV2Q 4JBKA 3KF6B 2IT1A 3CXCA 1K8GA 2V1CC 1UE5A 2OQ0A 2K4KA 3TEHB 3CCQA 4JI1Q 4A75A 1GO3E 3AQQA 3T1YQ 1WFQA 4X62L 4QJFA 1PV4A 5JJIA 1IZ6A 4DR5L 2UXDQ 4LUZA 2ASBA 4P71A 3CCMA 5HY6A 4DV1Q 4Y7NH 4JI2Q 4JI0Q 1WCMG 4GKJQ 5FLMG 1JJ2A 4JI5L 3GTPH 3J81i 2Q2IA 4NPSA 3CCSA 4YY3L 3TS0A 1VQHA 3G6EA 1VQKA 1GKHA 5IYDG 1T9HA 4AQYQ 4WJ4A 3NELA 1G51A 4JI0L 1KC8C 3JAMc 2VY3A 3A0JA 1Q46A 4OWXB 4XTCS 4A3CG 1VQJA 2ALYB 2PQAB 4LF4Q 1LTLA 4JBMA 1L1OC 4IFDJ 4NXMQ 4GNXB 4AQYL 2FXQA 4DR6Q 1UE7A 1Z47A 2BA1A 3HKSA 4EQ5A 1YJ9A 1PH2A 1VQGA 4X66Q 2KBNA 3H3VI 4JYAL 3CCRA 3EBEA 2JA7G 1CSPA 4EX5A 2I5HA 3TREA 3J7ZC 3KJOA 5LMUL 1V43A 3B6YA 4JI2L 3GTOH 1PH8A 4DNIA 3K8AA 5C3EH 1SLJA 1CKMA 1K9MC 2UXDL 5IWAQ 1EWIA 5GAEC 4K0KL 3L7ZC 4NXML 1FGUA 3PUZA 4JI7Q 2F52A 3M85A 1J5EQ 1V1QA 4QIWE 4A3LH 1EYGA 4GS3A 3PCOB 3RN5A 4JCVE 1LYLA 3TRZA 4RMFA 3ICEA 4TVAB 3CPWA 3F2BA 2WB1E 4GNXA 4A3JG 3G71A 1N8RC 1VQPA 2UU9L 3HOWG 1EQQA 5JEAG 4IJHA 4X65Q 2MO0A 1A62A 1CUKA 1XNRQ 1MKHA 2AMCB 2R92H 3HFZB 3NENA 3LGJA 2UU9Q 3CC4A 3S1QH 1BBUA 2F3IA 3S1RH 3HOZH 1VQLA 3K81C 2VQFQ 1VQNA 4HJ7A 2JEBI 1YZ6A 5LMNW 5C0XJ 4JI3L 1RL2A 4UY8C 2VZAA 3ULPA 4DR5Q 1X3GA 2MQHA 1ASYA 1OXUA 1N32L 2RHQB 4IPDA 1SR3A 4YCUA 2PI2E 5ELNA 1KD1C 1UE6A 1XMQL 2ES2A 3GTKH 1VQBA 4K0KQ 1Q82C 4BA1I 1NJIC 3BZKA 4YHHQ 1GM5A 4YCWA 2JA5G 4HJ5A 3GTLH 2UXCL 1H95A 1CKNB 4JBJA 4IFDI 1E1TA 1I50H 4IPGA 2N3SA 3L2PA 2R7DA 1HNXQ 4L5TA 3NBHB 4OONA 4X66L 1FJGQ 4BBRG 2WAQE 4YHHL 2UXCQ 1XMOQ 4OWTB 2NN6G 3K7AH 3W1BA 4GOPB 4JV5Q 4YWLA 1SE8A 4GNXC 4C3IH 3E9IA 4FDBA 4LF4L 3CMAA 4GLXA 4A3IG 3STBD 5AJ3Q 3M9BA 3PSIA 3KJPA 4R4TA 3S1MH 4DV6L 3F2CA 2N8NA 2I5LX 1FVIA 4MZ9A 2A19A 5M5WH 1DGSA 3S14H 2PMZE 5FJ8G 3A74A 1QVFA 2K5HA 1KQSA 1OXXK 4A3LG 3CC2A 1WI5A 1UWVA 5E7NA 4DV5Q 1X56A 1XMQQ 4P73A 1B8AA 4DV4L 1PH4A 2ZJPA 2RF4A 3BZCA 5GADC 1KXLA 4LUOA 4OO1I 2BH2A 5BR8Q 3PUVA 4AYBG 4GOPA 4KHPQ 5DLQE 2QA4A 2KHIA 4A93G 1PH3A 5C44H 4POGA 1VQEA 1RIPA 4BY7H 1XMOL 1Y1VH 1G291 3PO2G 2PQAA 1XTDA 3S15H 2JJQA 3KOJA 5C0XI 3CPFA 3J80i 5H1SE 2LSSA 4JI8L 3AYHB 4LFCL 4DR3L 3CF5A 2GN5A 4DK3C 1P8LA 1C9OA 3CCVA 4BY7G 4LFAQ 1YI2A 1PH9A 1QZGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SN8 A;  2EXD A;  1N9W A;  3UDG A;  1MJC A;  1QUQ A;  2Z0S A;  3I55 A;  4A3G G;  4DR6 L;  4QQB X;  1J5E L;  3T1H L;  5GRO A;  2ZJR A;  1JJG A;  4A3J H;  1YJN A;  1WCM H;  4L5Q A;  4O2D A;  4P74 A;  4DUZ Q;  1NTG A;  1FJG L;  1CSQ A;  3L0O A;  2B3G A;  1VQI A;  5IYC G;  4NB3 A;  4BXX H;  3I4M H;  2PI2 A;  4L5S A;  1WYD A;  5EAY A;  3FKI H;  2XTI A;  1Q1B A;  3W1G A;  5C3E G;  2BA0 A;  3OTO L;  3M7N A;  1VQA A;  2NVY H;  1NE3 A;  4A3I H;  1L0W A;  2NVX H;  1Z9F A;  1QUQ B;  4A3E H;  1N32 Q;  2UXB L;  4DPG A;  4DV3 Q;  1EFW A;  2D0P A;  4HIO A;  4DR2 Q;  4DV4 Q;  1BKB A;  2ID0 A;  1QVG A;  2VQE Q;  1BBW A;  2QGQ A;  4KHZ A;  2B29 A;  3RLN A;  4DAM A;  5GAH C;  2YV5 A;  4HJA A;  2CKZ B;  1S72 A;  4DV2 L;  2AWO A;  3ULJ A;  1VQ6 A;  5LMU Q;  1O7I A;  4GN4 B;  1V9P A;  3SGI A;  3K0X A;  3HOY G;  3GDE A;  1W2B A;  1YNX A;  1B70 B;  4A3M G;  4DUZ L;  4GN3 B;  2A1A A;  2D62 A;  3PUY A;  1TXY A;  4LW1 A;  4A3E G;  4YWM A;  3HOV G;  1B7Y B;  1A63 A;  1TWH H;  2XGT A;  2R93 H;  1IXR A;  2HQL A;  5C4J H;  2K75 A;  1X9N A;  1NMF A;  4R4I A;  3KFU A;  2UUA Q;  4A3F H;  1D7Q A;  4DAY B;  1TWF H;  1E22 A;  3E9H A;  1AH9 A;  2KCM A;  4KLK A;  4XIG S;  3H0G H;  4GN5 A;  1S3O A;  1Q81 C;  2JA6 H;  1MIU A;  2YTX A;  1KL9 A;  4IJL A;  1AE3 A;  4DV0 L;  1YJW A;  2OTL A;  2Q2T A;  4LF6 Q;  4BBS H;  4BBS G;  2VNU D;  4P72 A;  2GVA A;  2Y0S E;  3DLL A;  4OX9 L;  2VW9 A;  4KHP L;  2A8V A;  1K0R A;  4LNQ A;  4IFD G;  4AH6 A;  3GTM H;  1PYS B;  5HGQ A;  4X62 Q;  3S1N H;  3CQZ H;  1XPR A;  3M4O H;  1N33 L;  1HR0 W;  2HHH Q;  4POF A;  4QGU A;  3KLW A;  3F2D A;  3GTQ H;  1Q1E A;  3KF8 B;  1R9T H;  4DV3 L;  3MXN B;  5IP9 G;  3I4N G;  1U5K A;  3NEM A;  4JOI A;  4X64 Q;  4HIM A;  1K83 H;  2D0O A;  1SFO H;  4X6A H;  3IRB A;  1XNQ Q;  3DM3 A;  3HOU H;  4NXN Q;  3PF4 A;  3HOY H;  4QL5 A;  3WWV A;  5AJ3 L;  4DV7 L;  2E5L L;  4B3R L;  3KYH C;  3MEF A;  3TS2 A;  3S2D H;  3I2Z A;  3T1Y L;  4JV5 L;  1OXS C;  4HJ9 A;  3KDF A;  5GQO A;  2ZM6 L;  2UUA L;  2JQO A;  5IWA L;  2VUM H;  1VQD A;  2KEN A;  4DR7 L;  2YYZ A;  1IBL Q;  1I5F A;  3PGZ A;  3J7A 5;  2UUB Q;  2OWO A;  3I4O A;  1HNZ L;  1KIX A;  4DR4 L;  4LFB L;  2Y0S G;  4A93 H;  2Q2H A;  2YU9 H;  4B3M L;  3CD6 A;  4A3D G;  1X54 A;  3JC6 6;  3UDI A;  5M3F H;  5FLM H;  1QZH A;  3FP9 A;  5IP7 G;  3A5U A;  2CCZ A;  4LFA L;  1HZC A;  2AHO B;  2CWA A;  2R93 G;  3S24 A;  1TWC H;  2VS1 A;  3M4P A;  4JI4 L;  5FJ8 H;  4A76 A;  2YTY A;  4C3J H;  3PV0 A;  4PMW A;  1YVC A;  3HKZ E;  5IYB G;  1PH6 A;  4A3D H;  4A3F G;  4PZ7 A;  2VQF L;  3KDF B;  2F4V Q;  3STB C;  4DKA C;  4P75 A;  3ER0 A;  5M5X H;  2QEX A;  1HR0 L;  3PO3 G;  4BY1 H;  1EUJ A;  4B3S L;  2GVB A;  1WJJ A;  1N36 Q;  4DR1 Q;  4UP8 A;  1VQO A;  1JE5 A;  2R7F A;  1LM0 A;  3K7U C;  2K5N A;  4LF6 L;  1HJP A;  1K73 C;  4LF5 Q;  4R4C A;  3CCE A;  4LF8 Q;  1TWG H;  2E2H H;  1OTC A;  2L15 A;  4B3T Q;  1EIY B;  2H5X A;  4B3M Q;  5IE8 A;  2RHS B;  1N34 L;  4DV6 Q;  1Y1V G;  3GD7 A;  3EN2 A;  4AIM A;  4GKK Q;  2ZTC A;  3PIP A;  1L2F A;  1M1K C;  1E7Z A;  3Q8D A;  3HOW H;  1I6H H;  1EIF A;  4UP9 A;  3M4Q A;  1SRU A;  4H02 A;  4YCV A;  4LF9 Q;  4IPH A;  3W5O A;  3OW2 A;  1EQR A;  2IHF A;  4PZ6 A;  1VQ5 A;  2R92 G;  3CCU A;  2AWN A;  3F8T A;  1OXV A;  5LMN Q;  2K50 A;  1YIJ A;  2NZH A;  4LF7 Q;  4GKK L;  4DR1 L;  4DR7 Q;  3CAM A;  3RLO A;  4TQU S;  5C4X G;  1GD7 A;  3RLF A;  2UUC Q;  4HJ8 A;  1X6O A;  2MO1 A;  3PUW A;  1I94 L;  4B3T L;  4A3G H;  1Y14 B;  2Z6K A;  2MFI A;  1Q7Y C;  4YY3 Q;  1CKO A;  1A8V A;  3AEV A;  4OX9 Q;  5LMN L;  2OQK A;  2B63 H;  3UE1 A;  3M3Y H;  2WFW A;  4DV0 Q;  3HOX G;  4ALP A;  1S40 A;  2R7Z G;  4A3C H;  1IL2 A;  3J81 c;  4PZ8 A;  1X55 A;  3J80 c;  1Q86 C;  2LXJ A;  3J81 j;  1HR0 Q;  3HOU G;  1VQ7 A;  1HNW L;  4GLA C;  4QY7 A;  3RNU A;  4A3M H;  3H15 A;  1K8A C;  3U50 C;  2R7Z H;  4A3B H;  4APV A;  4LF7 L;  1VCI A;  5IY0 A;  2JEA I;  1HNW Q;  3PIO A;  1I3Q H;  4JOI C;  1XPU A;  3RR5 A;  4LF8 L;  4B3R Q;  3VDY A;  3CC7 A;  2NZO A;  2OCE A;  1JMC A;  2CWP A;  5M5Y H;  5IYB H;  3GTG H;  1PYB A;  3F1Z A;  4O0A A;  4JBW A;  4BA2 I;  4OWW B;  5JJK A;  2ZJQ A;  3UE0 A;  2IX1 A;  2E8G A;  1BVS A;  2ZTE A;  4AYB E;  2UUB L;  2JA9 A;  2YTV A;  1N36 L;  3S17 H;  3U58 A;  4JG2 A;  1N34 Q;  3A5Z B;  1YHB A;  2LXK A;  5M3M G;  1UE1 A;  1WOC A;  3ZJY C;  5K36 G;  3D0F A;  4DV7 Q;  1IBK Q;  2E5L Q;  3EIV A;  3HOV H;  1KHI A;  4MTN A;  1L1O B;  4DV5 L;  2E2J H;  1NMG A;  3U4Z A;  4DK6 C;  4JI6 L;  4LFC Q;  2NVQ H;  1IBK L;  1E24 A;  4GLV B;  5ELO A;  1C0A A;  3RZO H;  2HIV A;  3RZD H;  1HH2 P;  1OXT A;  2C35 B;  2Z6K C;  2JK8 A;  4UP7 A;  1I94 Q;  4LFB Q;  4JI5 Q;  1D8L A;  4GOP C;  1JT8 A;  1Q12 A;  5J3B A;  1PVO A;  1K3R A;  1NBW A;  1G6P A;  4JI1 L;  1X65 A;  2BH8 A;  1VQ8 A;  1XPO A;  3OTO Q;  3HOZ G;  3PO3 H;  2IX0 A;  4A3K G;  1XNQ L;  1PFS A;  2CQO A;  4J15 A;  3ULL A;  1JB7 A;  3ERS X;  2VL6 A;  1HNX L;  1J6Q A;  2WB1 G;  2ATW A;  3U4V A;  3G4S A;  1Y1W H;  2RCN A;  2KCT A;  1VS0 A;  3H3V H;  4HIK A;  3H0G G;  2HHH L;  2UUC L;  1YHA A;  3PUX A;  4A4I A;  2VQE L;  2ZTD A;  3JAM i;  5C0X G;  1N33 Q;  1GVP A;  3T1H Q;  3KF6 A;  4IPC A;  3CCL A;  2DUD A;  2N78 A;  1C7Y A;  3UDX A;  5IYC H;  1X3F A;  1MJE A;  4BXX G;  5M3F G;  1HZ9 A;  1PH1 A;  3E0E A;  3BU2 A;  4JI4 Q;  2VUM G;  1KAW A;  5GAG C;  4BBR H;  5JJL A;  4LF9 L;  4JI8 Q;  4DR3 Q;  1PH7 A;  1VQ4 A;  3UDF A;  4A3B G;  3K80 C;  1HNZ Q;  4HID A;  2HIX A;  4DR4 Q;  3I7F A;  4DUY L;  2AKW B;  1IBM Q;  2JA5 H;  3PF5 A;  5IT9 c;  4IO9 A;  1W3S A;  1KRT A;  1VQM A;  3HOX H;  5IP9 H;  2CFM A;  5C44 G;  1VQC A;  4PG3 A;  2E2I H;  4UPA A;  3BJU A;  5FLX c;  2WP8 J;  3PO2 H;  4OO1 G;  1E1O A;  2IHE A;  2N49 A;  3G48 A;  4IOC A;  1P16 A;  5IYD H;  4LUV A;  3D31 A;  1PA6 A;  3HKZ G;  4C2M H;  4ME3 A;  4L5R C;  5C4X H;  1VQ9 A;  1YIT A;  4B3S Q;  4JYA Q;  1LUZ A;  2ZM6 Q;  2PNH A;  3FKI G;  1YHQ A;  1M90 C;  3S2H H;  4DR2 L;  4JI7 L;  2JA6 G;  1YEZ A;  4IOA A;  3S16 H;  1NY4 A;  1KRS A;  1HZA A;  3AFQ A;  3GO5 A;  4LWC A;  4R1J A;  4A3K H;  4JI3 Q;  4JI6 Q;  1HZB A;  3OYY A;  4LF5 L;  2NVT H;  1XJV A;  5IP7 H;  3AFP A;  4DUY Q;  1IBM L;  3I4M G;  2NN6 I;  4MNO A;  1Y1W G;  3TQY A;  2EQS A;  1FL0 A;  4Y52 H;  1E3P A;  4WJ3 M;  1L1O A;  2JE6 I;  4X65 L;  1IYJ B;  2KHJ A;  4OXP A;  1XNR L;  2JA7 H;  2HT1 A;  4C3H H;  2I5M X;  2MNA A;  2F4V L;  4GKJ L;  2WAQ G;  3CCJ A;  4RG1 A;  2R6G A;  1QVC A;  2I0Q A;  4DV1 L;  3CP0 A;  1IBL L;  1UEB A;  3I4N H;  4R4O A;  2UXB Q;  5BR8 L;  1VQF A;  1ASZ A;  1EOV A;  3GTJ H;  2IY5 B;  1X3E A;  2JA8 H;  2OTJ A;  2K52 A;  4R4Q A;  4KI0 A;  2JA8 G;  1TWA H;  1PH5 A;  3FHW A;  1CKN A;  1SMX A;  4YWK A;  2B63 G;  1AE2 A;  3RN2 A;  2DGY A;  2K14 A;  4NXN L;  2Q2U A;  3I56 A;  5JEA J;  1JJC B;  1Q8K A;  1A0I A;  1SRO A;  1U0L A;  4BY1 G;  4X64 L;  3CME A;  1PHJ A;  2K5V A;  1YBY A;  2EIF A;  4JC0 A;  3CW2 C;  5M3M H;  4DV2 Q;  4JBK A;  3KF6 B;  2IT1 A;  3CXC A;  1K8G A;  2V1C C;  1UE5 A;  2OQ0 A;  2K4K A;  3TEH B;  3CCQ A;  4JI1 Q;  4A75 A;  1GO3 E;  3AQQ A;  3T1Y Q;  1WFQ A;  4X62 L;  4QJF A;  1PV4 A;  5JJI A;  1IZ6 A;  4DR5 L;  2UXD Q;  4LUZ A;  2ASB A;  4P71 A;  3CCM A;  5HY6 A;  4DV1 Q;  4Y7N H;  4JI2 Q;  4JI0 Q;  1WCM G;  4GKJ Q;  5FLM G;  1JJ2 A;  4JI5 L;  3GTP H;  3J81 i;  2Q2I A;  4NPS A;  3CCS A;  4YY3 L;  3TS0 A;  1VQH A;  3G6E A;  1VQK A;  1GKH A;  5IYD G;  1T9H A;  4AQY Q;  4WJ4 A;  3NEL A;  1G51 A;  4JI0 L;  1KC8 C;  3JAM c;  2VY3 A;  3A0J A;  1Q46 A;  4OWX B;  4XTC S;  4A3C G;  1VQJ A;  2ALY B;  2PQA B;  4LF4 Q;  1LTL A;  4JBM A;  1L1O C;  4IFD J;  4NXM Q;  4GNX B;  4AQY L;  2FXQ A;  4DR6 Q;  1UE7 A;  1Z47 A;  2BA1 A;  3HKS A;  4EQ5 A;  1YJ9 A;  1PH2 A;  1VQG A;  4X66 Q;  2KBN A;  3H3V I;  4JYA L;  3CCR A;  3EBE A;  2JA7 G;  1CSP A;  4EX5 A;  2I5H A;  3TRE A;  3J7Z C;  3KJO A;  5LMU L;  1V43 A;  3B6Y A;  4JI2 L;  3GTO H;  1PH8 A;  4DNI A;  3K8A A;  5C3E H;  1SLJ A;  1CKM A;  1K9M C;  2UXD L;  5IWA Q;  1EWI A;  5GAE C;  4K0K L;  3L7Z C;  4NXM L;  1FGU A;  3PUZ A;  4JI7 Q;  2F52 A;  3M85 A;  1J5E Q;  1V1Q A;  4QIW E;  4A3L H;  1EYG A;  4GS3 A;  3PCO B;  3RN5 A;  4JCV E;  1LYL A;  3TRZ A;  4RMF A;  3ICE A;  4TVA B;  3CPW A;  3F2B A;  2WB1 E;  4GNX A;  4A3J G;  3G71 A;  1N8R C;  1VQP A;  2UU9 L;  3HOW G;  1EQQ A;  5JEA G;  4IJH A;  4X65 Q;  2MO0 A;  1A62 A;  1CUK A;  1XNR Q;  1MKH A;  2AMC B;  2R92 H;  3HFZ B;  3NEN A;  3LGJ A;  2UU9 Q;  3CC4 A;  3S1Q H;  1BBU A;  2F3I A;  3S1R H;  3HOZ H;  1VQL A;  3K81 C;  2VQF Q;  1VQN A;  4HJ7 A;  2JEB I;  1YZ6 A;  5LMN W;  5C0X J;  4JI3 L;  1RL2 A;  4UY8 C;  2VZA A;  3ULP A;  4DR5 Q;  1X3G A;  2MQH A;  1ASY A;  1OXU A;  1N32 L;  2RHQ B;  4IPD A;  1SR3 A;  4YCU A;  2PI2 E;  5ELN A;  1KD1 C;  1UE6 A;  1XMQ L;  2ES2 A;  3GTK H;  1VQB A;  4K0K Q;  1Q82 C;  4BA1 I;  1NJI C;  3BZK A;  4YHH Q;  1GM5 A;  4YCW A;  2JA5 G;  4HJ5 A;  3GTL H;  2UXC L;  1H95 A;  1CKN B;  4JBJ A;  4IFD I;  1E1T A;  1I50 H;  4IPG A;  2N3S A;  3L2P A;  2R7D A;  1HNX Q;  4L5T A;  3NBH B;  4OON A;  4X66 L;  1FJG Q;  4BBR G;  2WAQ E;  4YHH L;  2UXC Q;  1XMO Q;  4OWT B;  2NN6 G;  3K7A H;  3W1B A;  4GOP B;  4JV5 Q;  4YWL A;  1SE8 A;  4GNX C;  4C3I H;  3E9I A;  4FDB A;  4LF4 L;  3CMA A;  4GLX A;  4A3I G;  3STB D;  5AJ3 Q;  3M9B A;  3PSI A;  3KJP A;  4R4T A;  3S1M H;  4DV6 L;  3F2C A;  2N8N A;  2I5L X;  1FVI A;  4MZ9 A;  2A19 A;  5M5W H;  1DGS A;  3S14 H;  2PMZ E;  5FJ8 G;  3A74 A;  1QVF A;  2K5H A;  1KQS A;  1OXX K;  4A3L G;  3CC2 A;  1WI5 A;  1UWV A;  5E7N A;  4DV5 Q;  1X56 A;  1XMQ Q;  4P73 A;  1B8A A;  4DV4 L;  1PH4 A;  2ZJP A;  2RF4 A;  3BZC A;  5GAD C;  1KXL A;  4LUO A;  4OO1 I;  2BH2 A;  5BR8 Q;  3PUV A;  4AYB G;  4GOP A;  4KHP Q;  5DLQ E;  2QA4 A;  2KHI A;  4A93 G;  1PH3 A;  5C44 H;  4POG A;  1VQE A;  1RIP A;  4BY7 H;  1XMO L;  1Y1V H;  1G29 1;  3PO2 G;  2PQA A;  1XTD A;  3S15 H;  2JJQ A;  3KOJ A;  5C0X I;  3CPF A;  3J80 i;  5H1S E;  2LSS A;  4JI8 L;  3AYH B;  4LFC L;  4DR3 L;  3CF5 A;  2GN5 A;  4DK3 C;  1P8L A;  1C9O A;  3CCV A;  4BY7 G;  4LFA Q;  1YI2 A;  1PH9 A;  1QZG A; 
#chains in the Genus database with same CATH topology
 1N9W A;  4F7X A;  2HCI A;  1J5E L;  1KNE A;  5GRO A;  5E4X A;  3J80 L;  4L5Q A;  2XNA C;  2JP1 A;  3CRL C;  1YNJ D;  3L0O A;  5IYC G;  1KNA A;  1WYD A;  2PYK A;  4QF4 A;  3W1G A;  3M7N A;  2BA0 A;  2Z4I A;  1LTI D;  2NVY H;  2WII B;  1NNX A;  4MIU A;  2RVL A;  3FVQ A;  3BYY B;  1QVG A;  2ID0 A;  1A3T A;  2QGQ A;  2B29 A;  2YV5 A;  4HJA A;  1RJT A;  3I73 A;  5A2Q L;  2B2V C;  3FKI B;  1B70 B;  4A3M G;  4DUZ L;  3CQZ B;  4R8N A;  1TXY A;  1BQQ T;  4RAU C;  2XRS D;  3P7J A;  3FPU B;  1PFB A;  1A63 A;  2R93 H;  1X9N A;  2HQL A;  4QMG A;  2B39 A;  2FHT A;  2RDG A;  3QIA A;  1NR4 A;  4WRD A;  4KMU C;  1S3O A;  2JA6 H;  2EOT A;  5IOD A;  4BBS G;  2VNU D;  5CMD A;  2NBF A;  1HTL D;  2GVA A;  4HED A;  4ZCK A;  1SND A;  4IFD G;  5HGQ A;  4IQZ A;  1TWG B;  1F77 A;  2EY1 A;  4C3I B;  3KLW A;  1Y8N B;  3ND9 A;  3F2D A;  3I4N G;  1PZJ D;  2K28 A;  2E5L L;  1ZKO A;  3MEF A;  1ZEQ X;  3I2Z A;  5IWA L;  3PGZ A;  3J7A 5;  2UUB Q;  1SMY D;  4UHV A;  4B08 A;  5JJZ A;  4LFB L;  2YU9 H;  1X54 A;  4ODG A;  4BS9 A;  3RZO B;  3T13 A;  3BYT B;  5EJW A;  3S24 A;  3Q23 A;  5CV8 A;  4C2M B;  4L63 B;  4A76 A;  2BDO A;  1PDQ A;  3GQB A;  3NQI A;  5COY A;  5M5X H;  2QEX A;  1EUJ A;  4B3S L;  1FD7 D;  1EY0 A;  5IOC A;  2F0S A;  2R7F A;  1MD2 D;  1STB A;  1K73 C;  4LF5 Q;  1GXD C;  2E2H H;  5DNF A;  4M8A A;  2OXP A;  3EJI A;  3TP5 A;  1ILP A;  2F0O A;  2R61 A;  3TZD A;  4AIM A;  1BF4 A;  1PTO H;  3PIP A;  3EVQ A;  4C56 C;  1L2F A;  1E7Z A;  3HOW H;  1EIF A;  1MBY A;  2C5C A;  3OW2 A;  2IHF A;  3CCU A;  2AWN A;  2QCP X;  1OXV A;  2K50 A;  1B9N A;  3OHX C;  2GA4 B;  4DR1 L;  1EFI D;  5JEA H;  4UDU C;  3RLO A;  5FLX L;  3CRK C;  5C4X G;  3RLF A;  5C4Z A;  4KN4 C;  2UUC Q;  4KY6 A;  4HJ8 A;  1X6O A;  3PUW A;  2ZXO A;  2QW7 A;  3HOZ B;  2Z6K A;  3NWT A;  2K6A A;  3RUZ A;  4YY3 Q;  4HN7 A;  2B2Y A;  2LY7 A;  1JR0 D;  4DXG A;  2CHB D;  5FO9 B;  4A3F B;  5M5W B;  3MXN A;  1U9R A;  1SBB B;  3Q24 A;  3OMC A;  1IL2 A;  4NW2 A;  3SK6 A;  1Q86 C;  1HR0 Q;  3HOU G;  1QG7 A;  3SXH A;  4A3M H;  2R7Z H;  4LF7 L;  5IY0 A;  2EJF C;  5C44 B;  1I3Q H;  4JOI C;  1XPU A;  1WVL A;  2E2I B;  4C1N K;  5I6W A;  3OWE B;  3A56 A;  3VYR A;  2F3V A;  2NZO A;  2OCE A;  3CC7 A;  1JMC A;  2CWP A;  3GTG H;  4BA2 I;  1JWU D;  1RTN A;  1LTS D;  3A55 A;  2L55 A;  2OT2 A;  2YTV A;  3U58 A;  4JG2 A;  1YHB A;  3H91 A;  2LXK A;  1WOC A;  3NXW A;  3D0F A;  1TS2 A;  1BXT A;  4EQN A;  4KKT A;  3EIV A;  4Q5V A;  2MPM A;  3HOV H;  4DV5 L;  4DK6 C;  3I90 A;  5FO8 B;  1E24 A;  4J8Q A;  5G3L F;  1II3 A;  4ZLT F;  4JI5 Q;  3KBG A;  2NVX B;  4R9W A;  1DXM A;  4RH6 A;  1X3Q A;  5CR3 A;  3SK4 A;  2BH8 A;  1VQ8 A;  1XPO A;  3HOZ G;  4RKL A;  2IX0 A;  3ULL A;  1JB7 A;  3ERS X;  3D4D A;  4A3B B;  4HIK A;  1YHA A;  2VQE L;  4A4I A;  1B53 A;  3H09 A;  1N33 Q;  5C0X G;  3PMF A;  2IJ0 A;  4F87 A;  1X3F A;  4C3I G;  5F2D A;  5M3F G;  1PH1 A;  5L37 A;  2VUM G;  1UNS A;  4BBR H;  1EYD A;  1Q90 A;  4LF9 L;  4JI8 Q;  2M9V A;  4B9X A;  3H0G B;  3IFT A;  3K80 C;  3RD4 A;  4HID A;  4DUY L;  2AKW B;  2JA5 H;  5I9P A;  4IO9 A;  1KRT A;  2CFM A;  5C44 G;  2E2I H;  3BJU A;  1M4V A;  5ELB A;  1STY A;  2N49 A;  2MHV A;  1P16 A;  3S1R B;  1TWC B;  1HFG A;  3HOU B;  4ME3 A;  1SE4 A;  1LUZ A;  2KEC A;  4FF3 A;  2FFK B;  1M90 C;  4ABN A;  3S2H H;  4JI7 L;  1WCM B;  1ILQ A;  4LWC A;  4A3K H;  4R1J A;  4LF5 L;  1UAP A;  5IIF A;  4DN4 M;  2SOB A;  3D8G A;  3I4M G;  5IP7 H;  3GTM B;  1IYV A;  3PQI A;  1DZ1 A;  5EPK A;  3TQY A;  2KCC A;  1L1O A;  5M5Y B;  4OXP A;  2HT1 A;  4G7H C;  2WAQ G;  1QWY A;  3CCJ A;  5M9O A;  1WTH A;  4DV1 L;  5FK9 C;  2HCC A;  2K52 A;  2JA8 G;  2IX3 A;  1CQF A;  2XIW A;  4RGN A;  2K5W A;  3I56 A;  1PXU A;  2WAQ B;  1JJC B;  4X64 L;  1A0I A;  2L4N A;  2K5V A;  2EIF A;  2MGS A;  2K4K A;  5EBD A;  2RBM A;  3CCQ A;  3RZD B;  1KDC A;  1EIH A;  1WFQ A;  4PQX A;  4CDF C;  4X62 L;  1PV4 A;  1TWH B;  1NUC A;  4LUZ A;  4N9P A;  1PH9 A;  2RSN A;  1WCM G;  4O1N A;  1FR3 A;  4XQQ A;  4NPS A;  2EE1 A;  4YY3 L;  1EYC A;  2FIN B;  1VQH A;  3G6E A;  1EZ8 A;  5IYD G;  4AQY Q;  3DWA A;  5D3I B;  5J39 A;  2VY3 A;  4OWX B;  4XTC S;  1CFM A;  1ENC A;  2N55 A;  1XX8 A;  4IFD J;  4NXM Q;  4EQ5 A;  2A6H D;  2I46 A;  4WJW A;  1G6Z A;  1GJX A;  2VB2 X;  1CSP A;  2B2U C;  3NBI A;  3O13 A;  4CDD C;  5LMU L;  4A3I B;  1V43 A;  3ERQ A;  3GTO H;  2EY2 A;  4DNI A;  3K8A A;  4E6I A;  1QB5 D;  1TS3 A;  1EWI A;  5GAE C;  2B2W A;  4OIJ A;  3R93 A;  3M85 A;  2PO4 A;  2VUM B;  1ET6 A;  2G5D A;  1B9M A;  3RN5 A;  5KYL A;  2SNM A;  4RMF A;  3TRZ A;  2KED A;  2OF1 A;  4A3J G;  3Q22 A;  3HOW G;  1EWC A;  2MO0 A;  2A74 C;  4FF1 A;  1MKH A;  2B2T A;  4K2L A;  3HFZ B;  3NEN A;  2R92 H;  3HKZ B;  2F3I A;  5TSS A;  4HJ7 A;  4K5V A;  1H9S A;  5C0X J;  2K01 A;  1N32 L;  2VZA A;  2WV6 D;  1HA5 A;  1EU3 A;  2RHQ B;  2ES2 A;  1JC7 A;  1SEB D;  1UE6 A;  1XMQ L;  4K0K Q;  2JA5 G;  2UXC L;  4HJ5 A;  3GTL H;  2K03 A;  3C1E A;  4L5T A;  3NBH B;  1TR5 A;  1I3Q B;  3TP6 A;  4KY5 A;  4YHH L;  1LTR D;  1XMO Q;  1PTO C;  2NN6 G;  3K7A H;  2JA7 B;  3U9O A;  4C3I H;  1HTP A;  1BBX C;  5E4W C;  3M9B A;  4R4T A;  1V1P B;  1D1I A;  5M5W H;  3ONA B;  2PMZ E;  1SNO A;  1KXL A;  4OO1 I;  3PUV A;  4GOP A;  5JPN C;  2QA4 A;  5C44 H;  3TSS A;  4BY7 H;  2PQA A;  4KN7 C;  4KHV A;  3VR2 A;  2JJQ A;  2B2T C;  5KEE A;  4N8X 1;  3E0J A;  3CPF A;  2XVS A;  5H1S E;  2LSS A;  4DR3 L;  3AYH B;  2GN5 A;  1SAP A;  4DK3 C;  3CCV A;  2XSC A;  1AZP A;  3MA2 B;  4LFA Q;  1YI2 A;  4A3C G;  3LNN A;  3BDC A;  1QUQ A;  3HEJ A;  3I70 A;  2ZJR A;  1WCM H;  4DUZ Q;  1CSQ A;  4QUC A;  1VQI A;  4XQJ A;  4CBV A;  1B4O A;  5EAY A;  2QDB A;  2XTI A;  1NAP A;  1W6J A;  3R2I A;  5C3E G;  1V1O A;  4FP5 D;  3OTO L;  4RKB A;  1VQA A;  1NE3 A;  2IWH A;  5EPL A;  1Z9F A;  3GV6 A;  4A3E H;  2UXB L;  4DPG A;  4ME5 A;  4DV3 Q;  4EQO A;  2D0P A;  3GTJ B;  4DR2 Q;  4DV4 Q;  4KHZ A;  3HG9 A;  1S72 A;  5CBA E;  1VQ6 A;  2AWO A;  1Q8I A;  3ULJ A;  4X3S A;  2PZT A;  4ID6 A;  1V9P A;  3R8B A;  5KYI A;  4NP5 A;  4LW1 A;  3C2P A;  3GP7 A;  1DM0 B;  3HOV G;  5IT9 L;  5K5P A;  2X69 A;  3MTS A;  1EY6 A;  1TWH H;  1IXR A;  2K75 A;  3KFU A;  1TWA B;  1F9R A;  4IFD H;  1E22 A;  2H1E A;  3H0G H;  1I4H A;  5FOB B;  2KCN A;  1KL9 A;  2OTL A;  4LF6 Q;  4BBS H;  2FJ2 A;  1CI3 M;  4P72 A;  4KHP L;  2A8V A;  1A6X A;  4AH6 A;  3J7Y W;  3CQZ H;  2YU9 B;  5ELF A;  2NB0 A;  3MWY W;  3DMU A;  4POF A;  4V19 0;  3D6W A;  1O78 A;  1TVX A;  2E2D C;  2F0H A;  4NDX A;  1U5K A;  3MZ5 A;  4HIM A;  4G4K A;  1K83 H;  1PZI D;  2D0O A;  4X6A H;  3N52 A;  1XNQ Q;  3BG3 A;  3HOU H;  2KVM A;  5DM7 3;  3HOY H;  3WWV A;  5AJ3 L;  3TS2 A;  5EKL A;  3KDF A;  2F0G A;  2JQO A;  1VQD A;  2EYM A;  4DR7 L;  5HUR A;  1GUT A;  4A3K B;  1I5F A;  1I50 B;  1HNZ L;  1KIX A;  2Y0S G;  1JWS D;  3ND8 A;  1EOT A;  3UDI A;  5M3F H;  1DOM A;  1GHJ A;  5FLM H;  1SNM A;  4H44 C;  1SMY C;  4LFA L;  2AHO B;  3BVM A;  4JI4 L;  1Q3L A;  2RKS A;  2I07 B;  2YTY A;  4PMW A;  3HKZ E;  1BCP B;  5IYB G;  1PH6 A;  1WTW A;  4A3F G;  2VQF L;  2P5Z X;  4DKA C;  3CHB D;  4P75 A;  3ER0 A;  2KHS A;  2WIN B;  1WJJ A;  1STN A;  4UP8 A;  1TU2 B;  4XYO A;  1LM0 A;  2JN4 A;  2Q8R E;  2K5N A;  5J22 A;  2VXW A;  2J7Z A;  1DYQ A;  3MXG A;  4FXG C;  3CCE A;  3S1N B;  4B3T Q;  2H5X A;  4B3M Q;  4K5W A;  2A68 C;  2TSS A;  5IE8 A;  2RHS B;  3NK9 A;  3KLS X;  1Y1V G;  3GD7 A;  5DAU A;  2JA8 B;  1GHK A;  4RA8 A;  1I6H H;  1TY2 A;  3KLS A;  1L0X B;  1U4M A;  1LTB D;  4H02 A;  5CBE E;  2B2W C;  4LF9 Q;  1EQR A;  1QNK A;  3F8T A;  5LMN Q;  5C6A A;  3BDO A;  5C0X H;  2ZT9 C;  3NTI A;  2FMM A;  3I4M B;  1CA6 A;  2RDF A;  4TQU S;  1GD7 A;  1C4Q A;  1TS4 A;  1I94 L;  2MO1 A;  4KD3 A;  3FEW X;  1MSG A;  3VYU A;  2MFI A;  5IGB A;  3PO2 B;  3KUP A;  1XYI A;  1Y8O B;  2AQ1 B;  2L12 A;  4A3C H;  2R7Z G;  3HOX G;  2L5T A;  2MJ8 A;  3J81 c;  4PZ8 A;  1STH A;  2E76 C;  1VQ7 A;  1HNW L;  4GLA C;  4RGT A;  2Q8I B;  3RNU A;  3MFY A;  1K8A C;  3U50 C;  2BCO A;  2F0D A;  4A3B H;  1BUV T;  4APV A;  1HNW Q;  2HUG A;  4PNY A;  3RR5 A;  4OHJ A;  4OWW B;  3DWP A;  1SYD A;  2RQX A;  4AYB E;  2JA9 A;  3MC0 B;  3OW7 A;  3S17 H;  1LO5 D;  1N34 Q;  4K5X A;  2Z8L A;  2JA6 B;  1TQO A;  3ZJY C;  4IN3 A;  2OEO A;  4MTN A;  2PMZ B;  3U4Z A;  1GUW A;  1ESF A;  1C0A A;  5ELO A;  3RZO H;  1T5X D;  3RZD H;  2SEB D;  5ELE A;  2JK8 A;  3GTG B;  2O2L D;  1D8L A;  3T4A C;  4GOP C;  1JT8 A;  4A3D B;  4P2C B;  2G9H D;  5J3B A;  1PVO A;  1K3R A;  1G6P A;  2A69 D;  3S14 B;  5DM6 3;  3P20 A;  3NTH A;  4H0L C;  1A2T A;  3PO3 H;  1U4L A;  4C3J G;  1PFS A;  2CQO A;  2PQE A;  3QO2 A;  4J15 A;  3CKI B;  4OEM B;  4A3M B;  2ATW A;  3G4S A;  1VS0 A;  1HRJ A;  5KNB A;  2HHH L;  1PLF A;  3BZD B;  4NMZ A;  3V05 A;  3BS1 A;  2ZTD A;  2UUC L;  3NWS A;  3T1H Q;  4IPC A;  2DUD A;  2N78 A;  1C7Y A;  4BXX G;  1MJE A;  1R9T B;  1HZ9 A;  3BU2 A;  4JI4 Q;  1KAW A;  5GAG C;  4IUP A;  5JJL A;  4DR3 Q;  2EXZ A;  2WB1 B;  1PH7 A;  3OWF A;  4J6H A;  2LMC B;  1EIG A;  1CT1 D;  3NPP A;  1HNZ Q;  2HIX A;  3IFD A;  1ENA A;  4WOR A;  1F9P A;  1BOS A;  3PF5 A;  5BN5 A;  1QE6 A;  1BDO A;  5LL6 S;  3VYT A;  3KF8 A;  4FXK C;  3HOX H;  3K7A B;  4X3U A;  4UPA A;  2WP8 J;  4OO1 G;  1SNP A;  1HQM C;  3G48 A;  5IYD H;  1GOZ A;  5C4J B;  1J9O A;  3JAM L;  1VQ9 A;  1YIT A;  4JYA Q;  2ZM6 Q;  3T51 B;  1YHQ A;  1TS5 A;  3LWU A;  2EYH A;  4BY1 B;  4PMC A;  4H7B A;  2R93 G;  1KRS A;  3GO5 A;  3NTK A;  1HZB A;  2MP1 A;  3HZX A;  4RGO S;  1TY0 A;  1IBM L;  5EKK A;  4AYB B;  1Y1W G;  2NWG A;  2EQS A;  3OMG A;  3K0Y A;  1GUN A;  3J7A F;  2JA7 H;  3SHL A;  4XT1 B;  2I0Q A;  3CP0 A;  1UEB A;  4G7Z C;  4R4O A;  1CZG A;  1EOV A;  4KI0 A;  1TWA H;  4DU9 A;  3CU7 A;  1PH5 A;  2IW3 A;  3T53 B;  2DJF C;  1EEF D;  3NQT A;  3QOL A;  4YWK A;  2DGY A;  3A7L A;  1J8I A;  1U0L A;  4BY1 G;  1PHJ A;  4JC0 A;  3IKJ A;  4KTA A;  4ULL A;  4JBK A;  2IT1 A;  5D14 A;  3QG1 A;  4JI1 Q;  3NBH A;  4A75 A;  1TT2 A;  3AQQ A;  3T1Y Q;  2A6E C;  3R2T A;  1SE3 A;  1IZ6 A;  2X6G A;  4Z9C B;  2ASB A;  5HY6 A;  4DV1 Q;  4XQN A;  1SJE D;  4JI2 Q;  4Y7N H;  1K83 B;  4IUR A;  1G2S A;  2EJM A;  2Q2I A;  4ZQ3 A;  4RHR A;  2B8F A;  2F0T A;  1GKH A;  4WJ4 A;  1QNU A;  1EY8 A;  3FDT A;  1O7L A;  3A0J A;  1Q46 A;  3VR4 A;  5JAV A;  5HGT A;  4LF4 Q;  4JBM A;  4EQP A;  4DK1 A;  3D6C A;  1G91 A;  1UE7 A;  1Z47 A;  1VMP A;  1VQG A;  2EVB A;  4X66 Q;  3C3L A;  1MGS A;  3CCR A;  4KD4 A;  3LX0 A;  2I5H A;  4L6T B;  2ICE C;  4RGM A;  5EQ0 A;  1K9M C;  3L7Z C;  3K5M A;  4NXM L;  3PUZ A;  1RDP D;  1J5E Q;  1V1Q A;  3K5O A;  1HPC A;  4QIW E;  2EYO A;  1LTA D;  3A8J E;  3A54 A;  1LYL A;  3ICE A;  4TVA B;  4GNX A;  3NUC A;  3F2B A;  3OOC A;  5C5M A;  1PZK D;  2UU9 L;  1EQQ A;  2E2J B;  4K2K A;  1A62 A;  4XYQ A;  1JB3 A;  1F9Q A;  4XXE A;  3V2T A;  4CDC C;  2D5D A;  2A5H A;  1BCP F;  3CC4 A;  2UU9 Q;  3S1Q H;  1BBU A;  3HOZ H;  4C3H B;  3K81 C;  2F0F A;  2JEB I;  1YZ6 A;  5LMN W;  5E1F A;  2K05 A;  4UY8 C;  3ULP A;  1X3G A;  2MQH A;  1OXU A;  1SR3 A;  2PI2 E;  5T1I A;  1I6H B;  4YHH Q;  4YCW A;  1I50 H;  4IPG A;  2N3S A;  1LT5 D;  2DY7 A;  4OON A;  1FJG Q;  1SE2 A;  4YWL A;  1KLG D;  1SE8 A;  3NHH A;  1K8M A;  3UI2 A;  5AJ3 Q;  2LKV A;  5AFW A;  5ISR A;  4DF7 A;  2N8N A;  1FVI A;  2KA7 A;  2A19 A;  2B63 B;  2TMP A;  5IT9 E;  1QVF A;  3T16 A;  1I6V C;  1OXX K;  3VYS A;  3CC2 A;  3S2H B;  1X56 A;  4LAA A;  1I4G A;  3S16 B;  5GAD C;  4LUO A;  4X3K A;  5BR8 Q;  2A68 D;  1WD1 A;  5DLQ E;  2KHI A;  1RD9 D;  4KJO A;  4MTK A;  1PH3 A;  1Y1V H;  1KAA A;  4IAL A;  1P8L A;  4BY7 G;  1LAB A;  2F3W A;  2PW7 A;  3SEB A;  4CJ0 B;  1QIL A;  1SN8 A;  2EXD A;  5CGK A;  1QZG A;  1EFW A;  2UXD L;  4QQB X;  4DR6 L;  2LS0 1;  3NSW A;  3WOE A;  4A3J H;  4P74 A;  4O2D A;  4HAE A;  1C48 A;  1NTG A;  1LTG D;  1O7Z A;  2B3G A;  1XXG A;  4BXX H;  4HMJ A;  3Q0A A;  3I4M H;  2PI2 A;  1LV9 A;  4OGQ C;  5M3M B;  4L5S A;  1EY5 A;  4C1N I;  1U4P A;  2A69 C;  1F2M A;  4M1U B;  1Q1B A;  1G2T A;  3MVV A;  4A3I H;  1L0W A;  1YNJ C;  4IZ8 A;  1N32 Q;  2E74 C;  3AMU A;  2SNS A;  1H9S B;  1BKB A;  3X3N A;  4CKB A;  3GTK B;  2VQE Q;  3S2D B;  3ERO A;  3RLN A;  1PRT F;  2D2C C;  4DV2 L;  4LK1 C;  2JYO A;  3DM1 A;  1O7I A;  2B2Y C;  4GN4 B;  2K04 A;  4IUU A;  1I4P A;  3K0X A;  3HOY G;  3MXP A;  1W2B A;  4HCS A;  1LLR D;  2A1A A;  4BY7 B;  4A3E G;  4YWM A;  2NTS A;  3I91 A;  5C4J H;  1BO0 A;  1EY9 A;  1NMF A;  5EKI A;  1D7Q A;  4DAY B;  2XN9 C;  1TWF H;  5G3L D;  1KTK A;  3E9H A;  1AH9 A;  2KCM A;  1HUM A;  4XIG S;  4CGY B;  3MAQ A;  1Q81 C;  1MIU A;  2YTX A;  1AE3 A;  4QUF A;  4OEL B;  2RCF A;  1PFN A;  4U68 A;  2E75 C;  2Y0S E;  3DLL A;  5IGE A;  1AZQ A;  3GTM H;  1PYS B;  1SYC A;  3S1N H;  1XPR A;  3M4O H;  3MXU A;  2HHH Q;  2PNR C;  1GUG A;  2V4D A;  3GTQ H;  3MFG A;  5IP9 G;  4JOI A;  1ZYR D;  5CV6 A;  2WKC A;  4BBR B;  3IRB A;  3DM3 A;  3A8I E;  4ZAI A;  3VA5 A;  4F8M A;  3E5S A;  4NXN Q;  4QL5 A;  4B3R L;  3I8Z A;  5EBC A;  1OXS C;  4HJ9 A;  5GQO A;  2ZM6 L;  3M7G A;  2UUA L;  2KQ3 A;  1RCV D;  1EU4 A;  2YYZ A;  1IBL Q;  1UUP A;  2K32 A;  4RCN A;  4ZKC B;  4DR4 L;  4EVO A;  1AEX A;  2Q2H A;  4B3M L;  3P1H A;  2F0L A;  1DCZ A;  3FP9 A;  1D1K A;  3A5U A;  2CCZ A;  3RMH A;  1EQV A;  1HZC A;  2CWA A;  1TWC H;  2VS1 A;  3M4P A;  1VMC A;  4C3J H;  4A3D H;  4K8J A;  4PZ7 A;  1XWE A;  4IUQ A;  3PO3 G;  2A6E D;  1N36 Q;  4DR1 Q;  1VQO A;  1JE5 A;  4RCO A;  2NVT B;  1KAB A;  2M00 A;  3G6J B;  2WAC A;  2IPK D;  4I7A A;  4LF8 Q;  1OTC A;  2R92 B;  1EIY B;  2CW0 D;  4J1M A;  1F9S A;  4FO2 A;  4A3G B;  3EN2 A;  4GKK Q;  2ZTC A;  1CM9 A;  4WFN 3;  2DNE A;  3Q8D A;  3J81 L;  2CVR A;  4UP9 A;  1SRU A;  4HSP A;  2F0P A;  4PZ6 A;  2K5Q A;  4GZY C;  2HQE A;  2B8G A;  2NZH A;  4LF7 Q;  1RHP A;  4DAV A;  2NZ1 D;  3HGB A;  2L1B A;  4B3T L;  1D2B A;  1Q7Y C;  2F0J A;  4PV1 C;  1A8V A;  2NN6 H;  4OX9 Q;  5LMN L;  2OQK A;  5KRU A;  3TBI B;  4A3E B;  4OL7 A;  3UE1 A;  3M3Y H;  4DV0 Q;  4ALP A;  3J80 c;  1MSH A;  3E3X A;  3J81 j;  1ROD A;  1JQY D;  4C3H G;  1D6E C;  1T5E A;  1L0Y B;  3PIO A;  3W2D A;  1EL0 A;  1O7Y A;  4B3R Q;  4HSV A;  2X6L A;  4O0A A;  4JBW A;  4UAI A;  3OIQ A;  3R3O A;  3UE0 A;  2IX1 A;  2E8G A;  1BVS A;  2ZTE A;  3QJY A;  1ZXT A;  3S1M B;  3OIP A;  3SVM A;  2A73 B;  5M3M G;  1UE1 A;  4N9T A;  1DOL A;  5KND A;  1JOK A;  5CC4 A;  4CKC A;  3PO3 B;  1WTX A;  5K36 G;  4DV7 Q;  2SDF A;  1IBK Q;  2EDG A;  5A2Q E;  4LFC Q;  3C46 A;  1NMG A;  2NVQ H;  1IBK L;  4GLV B;  1BCP C;  2HIV A;  1HH2 P;  1OXT A;  2C35 B;  1I94 Q;  1IHZ A;  2JSO A;  2FMC A;  3D3R A;  2MUY A;  4DGZ A;  3K5L A;  1S5C D;  1D5Z C;  5I2X A;  4DNT B;  1PTO B;  4DAP A;  4JI1 L;  2K5D A;  1VDZ A;  2QDL A;  4A3K G;  1XNQ L;  1H9J A;  1ICF B;  3N6R A;  1J6Q A;  2HDL A;  1Y1W H;  2RCN A;  3L3O C;  2F0N A;  3H3V H;  1E2W A;  3PUX A;  3JAM i;  3DXJ C;  3J80 E;  1WD0 A;  1GVP A;  2NVY B;  5ELD A;  3S1Q B;  1JCK B;  3CCL A;  2F0E A;  2O5J C;  5D3D A;  1CHQ D;  1R4Q B;  5JVG 3;  2Z4H A;  4XT3 B;  3IL8 A;  2ZXR A;  1JOR A;  5IGG A;  1A3U A;  4DR4 Q;  1IBM Q;  5NUC A;  1M8A A;  2D9U A;  2Z6B A;  4I65 A;  5IT9 c;  1STG A;  4O42 A;  1W3S A;  4IUV A;  1BCP D;  5FLX c;  1K3B C;  5I4D A;  1YNN D;  3PO2 H;  3ITP A;  4IOC A;  1R4P B;  4LUV A;  1X32 A;  3D31 A;  5IGD A;  1PA6 A;  4QB4 A;  4C2M H;  2EYP A;  4L5R C;  1GUO A;  3HOY B;  5C4X H;  5CV7 A;  2CH4 A;  2PNH A;  2G9D A;  1U4R A;  4FNF A;  4DR2 L;  4L8J A;  1YEZ A;  3S16 H;  1NY4 A;  4JI3 Q;  3W3A A;  3OYY A;  2NVT H;  3K6O A;  1XJV A;  3TDQ A;  1B44 D;  4A93 B;  4MNO A;  3H94 A;  1AN8 A;  1FL0 A;  1LTT D;  4Y52 H;  1E3P A;  4WJ3 M;  4X65 L;  1IYJ B;  2KHJ A;  1E2Z A;  4CHT B;  2MNA A;  4RG1 A;  1QVC A;  3I4N H;  4FF2 A;  1PRT B;  1VQF A;  4Y7N B;  3GTJ H;  1SDF A;  1SSO A;  1X3E A;  1LAC A;  1KDA A;  2OTJ A;  2F1M A;  3FHW A;  1CKN A;  1SMX A;  2B63 G;  1A2U A;  2K14 A;  1PYW D;  1H9R A;  3K59 A;  3TZU A;  1FNW A;  1Q8K A;  4A3G G;  3CME A;  4KKU A;  5M3M H;  2PW5 A;  4DV2 Q;  3C1F A;  3KF6 B;  3CXC A;  2HD3 A;  1K8G A;  2V1C C;  1UE5 A;  5FLX E;  4DR5 L;  3E6Z X;  2UXD Q;  3CCM A;  5BN4 A;  2Z9H A;  1Z7T A;  4C3J B;  4JI0 Q;  4GKJ Q;  2DJG C;  3D4W A;  3PIO 3;  3GTP H;  3TS0 A;  1V8Q A;  1VQK A;  4BWG B;  5C3X A;  1T9H A;  2F4I A;  3NEL A;  1G51 A;  4JI0 L;  3A7A B;  2F0I A;  5CV5 A;  3SDZ A;  1D5X C;  1HA6 A;  1LTL A;  1QCB D;  3J7A V;  4DR6 Q;  2QEJ C;  4ILW A;  1YJ9 A;  2KOL A;  4JYA L;  2KBN A;  3EBE A;  1ZYR C;  4EX5 A;  5I2Y A;  3TRE A;  3KJO A;  3B6Y A;  4JI2 L;  1PH8 A;  1CKM A;  4K0K L;  1SNC A;  3QWN A;  4JI7 Q;  1F2Z A;  4CDE C;  4QCL A;  5K36 H;  2BDN A;  3A8K E;  3PCO B;  2KEE A;  4JCV E;  3CPW A;  3HS0 C;  1N8R C;  1VQP A;  4X65 Q;  1I4Q A;  1FNU A;  1HXY D;  1CA5 A;  1B2T A;  1STE A;  4JI3 L;  3S17 B;  1ASY A;  1ML0 D;  4IPD A;  5ELN A;  3KBX A;  1SYF A;  4BA1 I;  1WTP A;  3BZK A;  1Q82 C;  1NJI C;  4A3J B;  1B3A A;  3I4L A;  3VR6 A;  4R8I A;  1DJR D;  1LT3 D;  4JBJ A;  4IFD I;  1HNX Q;  3L2P A;  1SYB A;  4BBR G;  2WAQ E;  1IKL A;  2CW0 C;  4OWT B;  4GOP B;  1VF7 A;  2PZW A;  1S5F D;  4HMI A;  4GNX C;  2N88 A;  3E9I A;  4FDB A;  3CMA A;  4GLX A;  4A3I G;  1HFN A;  3NE5 B;  1Y8P B;  3PSI A;  3S1M H;  4DV6 L;  1IW7 C;  1ICW A;  3F2C A;  1S5E D;  2I5L X;  4MZ9 A;  3BVZ A;  5J1Z A;  3S14 H;  5FJ8 G;  1QJO A;  1PTO D;  4DAY A;  1F2L A;  5I9O A;  1XMQ Q;  4P73 A;  4DV4 L;  2RF4 A;  4CJ1 B;  2BH2 A;  2O5I C;  4QIW B;  3QR8 A;  3NP8 A;  4A93 G;  1CZW A;  3DEP A;  1RIP A;  1XMO L;  1G29 1;  3PO2 G;  1XTD A;  2RSO A;  3S15 H;  2O4X A;  3KOJ A;  2ICI A;  1DON A;  5C0X I;  5DEH A;  4KJN A;  3J80 i;  2R93 B;  4LFC L;  3CF5 A;  1I4X A;  1C9O A;  5IGF A;  4ZYS A;  1B1Z A;  5C4X B;  3UDG A;  1MJC A;  2Z0S A;  3I55 A;  1EWH A;  2BE5 D;  3T1H L;  2AUJ D;  1JJG A;  1YJN A;  1C8C A;  4KKS A;  1S5B D;  4MHE A;  1FJG L;  2EY5 A;  5FKA C;  4NB3 A;  4V0B A;  5EPJ A;  5I6Y A;  3M4O B;  3FKI H;  1FYC A;  1HCZ A;  1Y1V B;  1IYU A;  2EZV A;  4DFA A;  2F0W A;  2NVX H;  1QUQ B;  3H6M A;  1IL8 A;  4OO1 H;  4HIO A;  1EZ6 A;  3KLR A;  1BBW A;  5GAH C;  4DAM A;  2CKZ B;  2J0T D;  1TII D;  1HHV A;  5LMU Q;  1GUS A;  3SGI A;  3GDE A;  1YNX A;  3OPO A;  1JIC A;  2NYZ D;  4GN3 B;  1OO9 B;  3HOX B;  2D62 A;  1DD2 A;  3PUY A;  1JOO A;  4HCE A;  1PTO F;  2K1B A;  1B7Y B;  2XGT A;  2DNC A;  4R4I A;  2UUA Q;  4A3F H;  4KLK A;  4GN5 A;  3SK8 A;  2Q2T A;  2BOS A;  4IJL A;  4K6D A;  4DV0 L;  2F0M A;  2DN8 A;  1YJW A;  2C9O A;  3FPP A;  4OX9 L;  2VW9 A;  1K0R A;  4LNQ A;  1XTC D;  4X62 Q;  2E2H B;  1JE4 A;  1N33 L;  2KUM A;  1HR0 W;  5JOB A;  4QGU A;  3H3V C;  4IUN A;  1Q1E A;  3KF8 B;  1R9T H;  1X3P A;  4DV3 L;  3MXN B;  4PMB A;  3I4N B;  3AU7 A;  1S4Z A;  1CQV A;  3NEM A;  2EYF A;  4X64 Q;  1SFO H;  1TWF B;  3PF4 A;  4DV7 L;  3S9W A;  1E0B A;  3KYH C;  1MI2 A;  3S2D H;  3T1Y L;  4JV5 L;  2NUC A;  4RHS A;  3I3C A;  5FO7 B;  4CKE A;  2VUM H;  2KEN A;  3WOF A;  2K7V A;  2OWO A;  3I4O A;  4A93 H;  4K8I A;  3CD6 A;  4A3D G;  3JC6 6;  1QZH A;  4JVZ A;  1EY7 A;  5IP7 G;  2L9H A;  2F0K A;  2QF7 A;  3D4R A;  2AQ2 B;  2CQA A;  3P75 A;  1SYG A;  5FJ8 H;  1CTM A;  3PV0 A;  3GTP B;  1YVC A;  1D5M C;  1PRT C;  3KDF B;  1RTO A;  1EQT A;  4IUT A;  3STB C;  2F4V Q;  2Y0S B;  1HR0 L;  3SE0 A;  4BY1 H;  2GVB A;  3GTL B;  5JPM C;  1Y69 U;  3K7U C;  1JWM D;  3HRZ C;  3EA6 A;  4LF6 L;  3V96 A;  1NR2 A;  2QIL A;  1HJP A;  5A35 A;  4R4C A;  1H9M A;  1TWG H;  3SR1 A;  2L15 A;  3MHB A;  4ZKB B;  4I7Z C;  1NCV A;  4CJ2 C;  1N34 L;  4DV6 Q;  1SNQ A;  1W6K A;  5KIX A;  1M1K C;  3IAY A;  5LL6 X;  3BVG A;  3M4Q A;  3K5N A;  4YCV A;  4IPH A;  3W5O A;  1VQ5 A;  2R92 G;  1G8Z D;  1YIJ A;  3U9S A;  4GKK L;  2NVQ B;  2R7Z B;  4DR7 Q;  3CAM A;  5C3W A;  2K33 A;  1SJH D;  1V1P A;  4A3G H;  1Y14 B;  1LT6 D;  1CKO A;  3AEV A;  4FXD A;  2WKD A;  3WDN A;  2F0U A;  2B63 H;  3I72 A;  2WFW A;  1S40 A;  4ZK9 B;  1X55 A;  2H4O A;  1I4R A;  4MN3 A;  3VR3 A;  4KK7 A;  2LXJ A;  1Z6H A;  4LJZ C;  2EPB A;  3G7L A;  4NKL A;  4QY7 A;  2HDM A;  3H15 A;  4TSS A;  4ZRZ A;  1VCI A;  2JEA I;  1AFP A;  2VB3 X;  3Q6S A;  4LF8 L;  1CHP D;  3VDY A;  3HP3 A;  4B9W A;  5M5Y H;  5IYB H;  1AW7 A;  1MHW C;  1PYB A;  1BNZ A;  3F1Z A;  1SYE A;  1BR9 A;  5JJK A;  2ZJQ A;  3URY A;  2UUB L;  5C3E B;  1N36 L;  2EY6 A;  3A5Z B;  1DOK A;  3QB3 A;  2AQ3 B;  2L0C A;  4K14 A;  2E5L Q;  2JA5 B;  1EY4 A;  1IW7 D;  1KHI A;  1L1O B;  3DUZ A;  2E2J H;  4JI6 L;  1NSN S;  1S5D D;  1B3Q A;  3BDL A;  2Z6K C;  4UP7 A;  2XWB B;  4LFB Q;  2F0Q A;  1K28 A;  1Q12 A;  1ONL A;  3ZYY X;  3HOW B;  4FYD A;  5IGC A;  5E3F A;  1NBW A;  3M3Y B;  4DXF A;  2M2L A;  1X65 A;  2A6H C;  3OTO Q;  5T1G A;  5EGT A;  5CV4 A;  1PRT D;  3K57 A;  4F88 A;  2VL6 A;  2PPB C;  1HNX L;  3HOV B;  1RF2 D;  2WB1 G;  3U4V A;  1AP0 A;  1WTQ A;  1H9K A;  2KCT A;  3L9A X;  3H0G G;  1JOQ A;  3KF6 A;  3M4Y A;  3UDX A;  5IYC H;  3E0E A;  3SK5 A;  1WTR A;  5CYU A;  3T56 B;  1VF5 C;  2J4X A;  1VQ4 A;  3UDF A;  1B50 A;  4A3B G;  5M5X B;  2LFN A;  3I7F A;  1HQR D;  2JXM B;  5D65 A;  1STA A;  1VQM A;  5IP9 H;  1KDB A;  1VQC A;  4PG3 A;  2Q8T A;  2ENB A;  1E1O A;  2IHE A;  4EGV A;  1WTV A;  4FVM A;  1O80 A;  3HKZ G;  2NTT A;  1KLU D;  3KK7 A;  4B3S Q;  2XWJ B;  3FKI G;  2Z1C A;  2JA6 G;  4IOA A;  4KV6 A;  1HZA A;  3AFQ A;  2PZU A;  4JI6 Q;  1TKW B;  2EYJ A;  4DUY Q;  3AFP A;  4ZUJ A;  2NN6 I;  3EQL C;  1F2Y A;  3DWQ A;  3K58 A;  2JE6 I;  1XNR L;  4C3H H;  2I5M X;  2F4V L;  1FNV A;  4GKJ L;  2R6G A;  4XDX A;  1IBL L;  3TP8 A;  2UXB Q;  5BR8 L;  1ASZ A;  2IY5 B;  2JA8 H;  4R4Q A;  4X3T A;  3FRP B;  2RA4 A;  1AE2 A;  4OIK A;  3RN2 A;  4NXN L;  2Q2U A;  5JEA J;  1ET9 A;  5KNC A;  4N8F A;  1SRO A;  1UEA B;  4JW0 A;  1YBY A;  2R3Z A;  3CW2 C;  3QOJ A;  2OQ0 A;  3TEH B;  4DNR B;  1GO3 E;  4JK1 C;  4QJF A;  5JJI A;  1CK1 A;  1SXT A;  4P71 A;  1HUN A;  1EYA A;  4G7O C;  1SFO B;  5FLM G;  1JJ2 A;  4KY7 A;  4JI5 L;  3J81 i;  2B2V A;  1FGB D;  3CCS A;  4YIJ A;  1PFM A;  3TP7 A;  2EJG C;  2QKI C;  1K8O A;  3GV3 A;  1KC8 C;  3JAM c;  1VQJ A;  2ALY B;  2IL8 A;  2PQA B;  4HR7 B;  1L1O C;  4GNX B;  4AQY L;  2FXQ A;  5M3F B;  3HKS A;  2XRQ D;  2BA1 A;  2EYL A;  5BN3 A;  1PH2 A;  1K0S A;  1LT4 D;  3DHQ A;  3J81 E;  3EFX D;  3FMC A;  3H3V I;  2JA7 G;  3J7Z C;  2ZXP A;  4DA2 A;  4Q0F A;  5C3E H;  1SLJ A;  2F0V A;  5IWA Q;  2RDH A;  5COR A;  1FGU A;  2F52 A;  4BBS B;  4A3L H;  2PCF B;  1EYG A;  2CH4 W;  4GS3 A;  1IKM A;  5C5L A;  2F03 A;  4FF4 A;  2WB1 E;  1YNN C;  3G71 A;  4JPB W;  5JEA G;  4IJH A;  1XNR Q;  1CUK A;  2AMC B;  3S15 B;  1E2V A;  3LGJ A;  3JAM E;  3DEO A;  4U67 3;  3S1R H;  1VQL A;  1VQN A;  2VQF Q;  2L11 A;  1RKN A;  4LMQ D;  1QOH A;  1RL2 A;  2DY8 A;  4TKO B;  4DR5 Q;  4YCU A;  1KD1 C;  3GTK H;  4RFB A;  1VQB A;  1GM5 A;  5ELC A;  2BE5 C;  1H95 A;  1CKN B;  1E1T A;  5KGU A;  2R7D A;  3VR5 A;  4X66 L;  1A15 A;  2UXC Q;  3W1B A;  4JV5 Q;  4TRD A;  4LF4 L;  3STB D;  3VA7 A;  3LWE A;  3F2U A;  3KJP A;  1A3V A;  2AUK A;  3MEH A;  4G57 A;  5LHY 1;  4K6L A;  1PMR A;  4H13 C;  3GTO B;  3AB9 A;  1WTO A;  3X3M A;  1DGS A;  3TME A;  3A74 A;  5JVH 3;  2K5H A;  1KQS A;  4A3L G;  1WI5 A;  1UWV A;  5E7N A;  4DV5 Q;  1ESR A;  1B8A A;  1PH4 A;  2ZJP A;  2B2U A;  3BZC A;  4DK0 A;  3TN2 A;  4AYB G;  1Y1W B;  4KHP Q;  1ENF A;  3PIP 3;  3OSO A;  4ZUI A;  4POG A;  1VQE A;  4RWS C;  3GTQ B;  4HTH A;  2KJX A;  4S3S A;  5C4H A;  4JI8 L;  5CV9 A;  1EEI D; 
#chains in the Genus database with same CATH homology
 1SN8 A;  2EXD A;  1N9W A;  3UDG A;  1MJC A;  1QUQ A;  2Z0S A;  3I55 A;  4A3G G;  4DR6 L;  4QQB X;  1J5E L;  3T1H L;  5GRO A;  2ZJR A;  1JJG A;  4A3J H;  1YJN A;  1WCM H;  4L5Q A;  4O2D A;  4P74 A;  4DUZ Q;  1NTG A;  1FJG L;  1CSQ A;  3L0O A;  2B3G A;  1VQI A;  5IYC G;  4NB3 A;  4BXX H;  3I4M H;  2PI2 A;  4L5S A;  1WYD A;  5EAY A;  3FKI H;  2XTI A;  1Q1B A;  3W1G A;  5C3E G;  2BA0 A;  3OTO L;  3M7N A;  1VQA A;  2NVY H;  1NE3 A;  4A3I H;  1L0W A;  2NVX H;  1Z9F A;  1QUQ B;  4A3E H;  1N32 Q;  2UXB L;  4DPG A;  4DV3 Q;  1EFW A;  2D0P A;  4HIO A;  4DR2 Q;  4DV4 Q;  1BKB A;  2ID0 A;  1QVG A;  2VQE Q;  1BBW A;  2QGQ A;  4KHZ A;  2B29 A;  3RLN A;  4DAM A;  5GAH C;  2YV5 A;  4HJA A;  2CKZ B;  1S72 A;  4DV2 L;  2AWO A;  3ULJ A;  1VQ6 A;  5LMU Q;  1O7I A;  4GN4 B;  1V9P A;  3SGI A;  3K0X A;  3HOY G;  3GDE A;  1W2B A;  1YNX A;  1B70 B;  4A3M G;  4DUZ L;  4GN3 B;  2A1A A;  2D62 A;  3PUY A;  1TXY A;  4LW1 A;  4A3E G;  4YWM A;  3HOV G;  1B7Y B;  1A63 A;  1TWH H;  2XGT A;  2R93 H;  1IXR A;  2HQL A;  5C4J H;  2K75 A;  1X9N A;  1NMF A;  4R4I A;  3KFU A;  2UUA Q;  4A3F H;  1D7Q A;  4DAY B;  1TWF H;  1E22 A;  3E9H A;  1AH9 A;  2KCM A;  4KLK A;  4XIG S;  3H0G H;  4GN5 A;  1S3O A;  1Q81 C;  2JA6 H;  1MIU A;  2YTX A;  1KL9 A;  4IJL A;  1AE3 A;  4DV0 L;  1YJW A;  2OTL A;  2Q2T A;  4LF6 Q;  4BBS H;  4BBS G;  2VNU D;  4P72 A;  2GVA A;  2Y0S E;  3DLL A;  4OX9 L;  2VW9 A;  4KHP L;  2A8V A;  1K0R A;  4LNQ A;  4IFD G;  4AH6 A;  3GTM H;  1PYS B;  5HGQ A;  4X62 Q;  3S1N H;  3CQZ H;  1XPR A;  3M4O H;  1N33 L;  1HR0 W;  2HHH Q;  4POF A;  4QGU A;  3KLW A;  3F2D A;  3GTQ H;  1Q1E A;  3KF8 B;  1R9T H;  4DV3 L;  3MXN B;  5IP9 G;  3I4N G;  1U5K A;  3NEM A;  4JOI A;  4X64 Q;  4HIM A;  1K83 H;  2D0O A;  1SFO H;  4X6A H;  3IRB A;  1XNQ Q;  3DM3 A;  3HOU H;  4NXN Q;  3PF4 A;  3HOY H;  4QL5 A;  3WWV A;  5AJ3 L;  4DV7 L;  2E5L L;  4B3R L;  3KYH C;  3MEF A;  3TS2 A;  3S2D H;  3I2Z A;  3T1Y L;  4JV5 L;  1OXS C;  4HJ9 A;  3KDF A;  5GQO A;  2ZM6 L;  2UUA L;  2JQO A;  5IWA L;  2VUM H;  1VQD A;  2KEN A;  4DR7 L;  2YYZ A;  1IBL Q;  1I5F A;  3PGZ A;  3J7A 5;  2UUB Q;  2OWO A;  3I4O A;  1HNZ L;  1KIX A;  4DR4 L;  4LFB L;  2Y0S G;  4A93 H;  2Q2H A;  2YU9 H;  4B3M L;  3CD6 A;  4A3D G;  1X54 A;  3JC6 6;  3UDI A;  5M3F H;  5FLM H;  1QZH A;  3FP9 A;  5IP7 G;  3A5U A;  2CCZ A;  4LFA L;  1HZC A;  2AHO B;  2CWA A;  2R93 G;  3S24 A;  1TWC H;  2VS1 A;  3M4P A;  4JI4 L;  5FJ8 H;  4A76 A;  2YTY A;  4C3J H;  3PV0 A;  4PMW A;  1YVC A;  3HKZ E;  5IYB G;  1PH6 A;  4A3D H;  4A3F G;  4PZ7 A;  2VQF L;  3KDF B;  2F4V Q;  3STB C;  4DKA C;  4P75 A;  3ER0 A;  5M5X H;  2QEX A;  1HR0 L;  3PO3 G;  4BY1 H;  1EUJ A;  4B3S L;  2GVB A;  1WJJ A;  1N36 Q;  4DR1 Q;  4UP8 A;  1VQO A;  1JE5 A;  2R7F A;  1LM0 A;  3K7U C;  2K5N A;  4LF6 L;  1HJP A;  1K73 C;  4LF5 Q;  4R4C A;  3CCE A;  4LF8 Q;  1TWG H;  2E2H H;  1OTC A;  2L15 A;  4B3T Q;  1EIY B;  2H5X A;  4B3M Q;  5IE8 A;  2RHS B;  1N34 L;  4DV6 Q;  1Y1V G;  3GD7 A;  3EN2 A;  4AIM A;  4GKK Q;  2ZTC A;  3PIP A;  1L2F A;  1M1K C;  1E7Z A;  3Q8D A;  3HOW H;  1I6H H;  1EIF A;  4UP9 A;  3M4Q A;  1SRU A;  4H02 A;  4YCV A;  4LF9 Q;  4IPH A;  3W5O A;  3OW2 A;  1EQR A;  2IHF A;  4PZ6 A;  1VQ5 A;  2R92 G;  3CCU A;  2AWN A;  3F8T A;  1OXV A;  5LMN Q;  2K50 A;  1YIJ A;  2NZH A;  4LF7 Q;  4GKK L;  4DR1 L;  4DR7 Q;  3CAM A;  3RLO A;  4TQU S;  5C4X G;  1GD7 A;  3RLF A;  2UUC Q;  4HJ8 A;  1X6O A;  2MO1 A;  3PUW A;  1I94 L;  4B3T L;  4A3G H;  1Y14 B;  2Z6K A;  2MFI A;  1Q7Y C;  4YY3 Q;  1CKO A;  1A8V A;  3AEV A;  4OX9 Q;  5LMN L;  2OQK A;  2B63 H;  3UE1 A;  3M3Y H;  2WFW A;  4DV0 Q;  3HOX G;  4ALP A;  1S40 A;  2R7Z G;  4A3C H;  1IL2 A;  3J81 c;  4PZ8 A;  1X55 A;  3J80 c;  1Q86 C;  2LXJ A;  3J81 j;  1HR0 Q;  3HOU G;  1VQ7 A;  1HNW L;  4GLA C;  4QY7 A;  3RNU A;  4A3M H;  3H15 A;  1K8A C;  3U50 C;  2R7Z H;  4A3B H;  4APV A;  4LF7 L;  1VCI A;  5IY0 A;  2JEA I;  1HNW Q;  3PIO A;  1I3Q H;  4JOI C;  1XPU A;  3RR5 A;  4LF8 L;  4B3R Q;  3VDY A;  3CC7 A;  2NZO A;  2OCE A;  1JMC A;  2CWP A;  5M5Y H;  5IYB H;  3GTG H;  1PYB A;  3F1Z A;  4O0A A;  4JBW A;  4BA2 I;  4OWW B;  5JJK A;  2ZJQ A;  3UE0 A;  2IX1 A;  2E8G A;  1BVS A;  2ZTE A;  4AYB E;  2UUB L;  2JA9 A;  2YTV A;  1N36 L;  3S17 H;  3U58 A;  4JG2 A;  1N34 Q;  3A5Z B;  1YHB A;  2LXK A;  5M3M G;  1UE1 A;  1WOC A;  3ZJY C;  5K36 G;  3D0F A;  4DV7 Q;  1IBK Q;  2E5L Q;  3EIV A;  3HOV H;  1KHI A;  4MTN A;  1L1O B;  4DV5 L;  2E2J H;  1NMG A;  3U4Z A;  4DK6 C;  4JI6 L;  4LFC Q;  2NVQ H;  1IBK L;  1E24 A;  4GLV B;  5ELO A;  1C0A A;  3RZO H;  2HIV A;  3RZD H;  1HH2 P;  1OXT A;  2C35 B;  2Z6K C;  2JK8 A;  4UP7 A;  1I94 Q;  4LFB Q;  4JI5 Q;  1D8L A;  4GOP C;  1JT8 A;  1Q12 A;  5J3B A;  1PVO A;  1K3R A;  1NBW A;  1G6P A;  4JI1 L;  1X65 A;  2BH8 A;  1VQ8 A;  1XPO A;  3OTO Q;  3HOZ G;  3PO3 H;  2IX0 A;  4A3K G;  1XNQ L;  1PFS A;  2CQO A;  4J15 A;  3ULL A;  1JB7 A;  3ERS X;  2VL6 A;  1HNX L;  1J6Q A;  2WB1 G;  2ATW A;  3U4V A;  3G4S A;  1Y1W H;  2RCN A;  2KCT A;  1VS0 A;  3H3V H;  4HIK A;  3H0G G;  2HHH L;  2UUC L;  1YHA A;  3PUX A;  4A4I A;  2VQE L;  2ZTD A;  3JAM i;  5C0X G;  1N33 Q;  1GVP A;  3T1H Q;  3KF6 A;  4IPC A;  3CCL A;  2DUD A;  2N78 A;  1C7Y A;  3UDX A;  5IYC H;  1X3F A;  1MJE A;  4BXX G;  5M3F G;  1HZ9 A;  1PH1 A;  3E0E A;  3BU2 A;  4JI4 Q;  2VUM G;  1KAW A;  5GAG C;  4BBR H;  5JJL A;  4LF9 L;  4JI8 Q;  4DR3 Q;  1PH7 A;  1VQ4 A;  3UDF A;  4A3B G;  3K80 C;  1HNZ Q;  4HID A;  2HIX A;  4DR4 Q;  3I7F A;  4DUY L;  2AKW B;  1IBM Q;  2JA5 H;  3PF5 A;  5IT9 c;  4IO9 A;  1W3S A;  1KRT A;  1VQM A;  3HOX H;  5IP9 H;  2CFM A;  5C44 G;  1VQC A;  4PG3 A;  2E2I H;  4UPA A;  3BJU A;  5FLX c;  2WP8 J;  3PO2 H;  4OO1 G;  1E1O A;  2IHE A;  2N49 A;  3G48 A;  4IOC A;  1P16 A;  5IYD H;  4LUV A;  3D31 A;  1PA6 A;  3HKZ G;  4C2M H;  4ME3 A;  4L5R C;  5C4X H;  1VQ9 A;  1YIT A;  4B3S Q;  4JYA Q;  1LUZ A;  2ZM6 Q;  2PNH A;  3FKI G;  1YHQ A;  1M90 C;  3S2H H;  4DR2 L;  4JI7 L;  2JA6 G;  1YEZ A;  4IOA A;  3S16 H;  1NY4 A;  1KRS A;  1HZA A;  3AFQ A;  3GO5 A;  4LWC A;  4R1J A;  4A3K H;  4JI3 Q;  4JI6 Q;  1HZB A;  3OYY A;  4LF5 L;  2NVT H;  1XJV A;  5IP7 H;  3AFP A;  4DUY Q;  1IBM L;  3I4M G;  2NN6 I;  4MNO A;  1Y1W G;  3TQY A;  2EQS A;  1FL0 A;  4Y52 H;  1E3P A;  4WJ3 M;  1L1O A;  2JE6 I;  4X65 L;  1IYJ B;  2KHJ A;  4OXP A;  1XNR L;  2JA7 H;  2HT1 A;  4C3H H;  2I5M X;  2MNA A;  2F4V L;  4GKJ L;  2WAQ G;  3CCJ A;  4RG1 A;  2R6G A;  1QVC A;  2I0Q A;  4DV1 L;  3CP0 A;  1IBL L;  1UEB A;  3I4N H;  4R4O A;  2UXB Q;  5BR8 L;  1VQF A;  1ASZ A;  1EOV A;  3GTJ H;  2IY5 B;  1X3E A;  2JA8 H;  2OTJ A;  2K52 A;  4R4Q A;  4KI0 A;  2JA8 G;  1TWA H;  1PH5 A;  3FHW A;  1CKN A;  1SMX A;  4YWK A;  2B63 G;  1AE2 A;  3RN2 A;  2DGY A;  2K14 A;  4NXN L;  2Q2U A;  3I56 A;  5JEA J;  1JJC B;  1Q8K A;  1A0I A;  1SRO A;  1U0L A;  4BY1 G;  4X64 L;  3CME A;  1PHJ A;  2K5V A;  1YBY A;  2EIF A;  4JC0 A;  3CW2 C;  5M3M H;  4DV2 Q;  4JBK A;  3KF6 B;  2IT1 A;  3CXC A;  1K8G A;  2V1C C;  1UE5 A;  2OQ0 A;  2K4K A;  3TEH B;  3CCQ A;  4JI1 Q;  4A75 A;  1GO3 E;  3AQQ A;  3T1Y Q;  1WFQ A;  4X62 L;  4QJF A;  1PV4 A;  5JJI A;  1IZ6 A;  4DR5 L;  2UXD Q;  4LUZ A;  2ASB A;  4P71 A;  3CCM A;  5HY6 A;  4DV1 Q;  4Y7N H;  4JI2 Q;  4JI0 Q;  1WCM G;  4GKJ Q;  5FLM G;  1JJ2 A;  4JI5 L;  3GTP H;  3J81 i;  2Q2I A;  4NPS A;  3CCS A;  4YY3 L;  3TS0 A;  1VQH A;  3G6E A;  1VQK A;  1GKH A;  5IYD G;  1T9H A;  4AQY Q;  4WJ4 A;  3NEL A;  1G51 A;  4JI0 L;  1KC8 C;  3JAM c;  2VY3 A;  3A0J A;  1Q46 A;  4OWX B;  4XTC S;  4A3C G;  1VQJ A;  2ALY B;  2PQA B;  4LF4 Q;  1LTL A;  4JBM A;  1L1O C;  4IFD J;  4NXM Q;  4GNX B;  4AQY L;  2FXQ A;  4DR6 Q;  1UE7 A;  1Z47 A;  2BA1 A;  3HKS A;  4EQ5 A;  1YJ9 A;  1PH2 A;  1VQG A;  4X66 Q;  2KBN A;  3H3V I;  4JYA L;  3CCR A;  3EBE A;  2JA7 G;  1CSP A;  4EX5 A;  2I5H A;  3TRE A;  3J7Z C;  3KJO A;  5LMU L;  1V43 A;  3B6Y A;  4JI2 L;  3GTO H;  1PH8 A;  4DNI A;  3K8A A;  5C3E H;  1SLJ A;  1CKM A;  1K9M C;  2UXD L;  5IWA Q;  1EWI A;  5GAE C;  4K0K L;  3L7Z C;  4NXM L;  1FGU A;  3PUZ A;  4JI7 Q;  2F52 A;  3M85 A;  1J5E Q;  1V1Q A;  4QIW E;  4A3L H;  1EYG A;  4GS3 A;  3PCO B;  3RN5 A;  4JCV E;  1LYL A;  3TRZ A;  4RMF A;  3ICE A;  4TVA B;  3CPW A;  3F2B A;  2WB1 E;  4GNX A;  4A3J G;  3G71 A;  1N8R C;  1VQP A;  2UU9 L;  3HOW G;  1EQQ A;  5JEA G;  4IJH A;  4X65 Q;  2MO0 A;  1A62 A;  1CUK A;  1XNR Q;  1MKH A;  2AMC B;  2R92 H;  3HFZ B;  3NEN A;  3LGJ A;  2UU9 Q;  3CC4 A;  3S1Q H;  1BBU A;  2F3I A;  3S1R H;  3HOZ H;  1VQL A;  3K81 C;  2VQF Q;  1VQN A;  4HJ7 A;  2JEB I;  1YZ6 A;  5LMN W;  5C0X J;  4JI3 L;  1RL2 A;  4UY8 C;  2VZA A;  3ULP A;  4DR5 Q;  1X3G A;  2MQH A;  1ASY A;  1OXU A;  1N32 L;  2RHQ B;  4IPD A;  1SR3 A;  4YCU A;  2PI2 E;  5ELN A;  1KD1 C;  1UE6 A;  1XMQ L;  2ES2 A;  3GTK H;  1VQB A;  4K0K Q;  1Q82 C;  4BA1 I;  1NJI C;  3BZK A;  4YHH Q;  1GM5 A;  4YCW A;  2JA5 G;  4HJ5 A;  3GTL H;  2UXC L;  1H95 A;  1CKN B;  4JBJ A;  4IFD I;  1E1T A;  1I50 H;  4IPG A;  2N3S A;  3L2P A;  2R7D A;  1HNX Q;  4L5T A;  3NBH B;  4OON A;  4X66 L;  1FJG Q;  4BBR G;  2WAQ E;  4YHH L;  2UXC Q;  1XMO Q;  4OWT B;  2NN6 G;  3K7A H;  3W1B A;  4GOP B;  4JV5 Q;  4YWL A;  1SE8 A;  4GNX C;  4C3I H;  3E9I A;  4FDB A;  4LF4 L;  3CMA A;  4GLX A;  4A3I G;  3STB D;  5AJ3 Q;  3M9B A;  3PSI A;  3KJP A;  4R4T A;  3S1M H;  4DV6 L;  3F2C A;  2N8N A;  2I5L X;  1FVI A;  4MZ9 A;  2A19 A;  5M5W H;  1DGS A;  3S14 H;  2PMZ E;  5FJ8 G;  3A74 A;  1QVF A;  2K5H A;  1KQS A;  1OXX K;  4A3L G;  3CC2 A;  1WI5 A;  1UWV A;  5E7N A;  4DV5 Q;  1X56 A;  1XMQ Q;  4P73 A;  1B8A A;  4DV4 L;  1PH4 A;  2ZJP A;  2RF4 A;  3BZC A;  5GAD C;  1KXL A;  4LUO A;  4OO1 I;  2BH2 A;  5BR8 Q;  3PUV A;  4AYB G;  4GOP A;  4KHP Q;  5DLQ E;  2QA4 A;  2KHI A;  4A93 G;  1PH3 A;  5C44 H;  4POG A;  1VQE A;  1RIP A;  4BY7 H;  1XMO L;  1Y1V H;  1G29 1;  3PO2 G;  2PQA A;  1XTD A;  3S15 H;  2JJQ A;  3KOJ A;  5C0X I;  3CPF A;  3J80 i;  5H1S E;  2LSS A;  4JI8 L;  3AYH B;  4LFC L;  4DR3 L;  3CF5 A;  2GN5 A;  4DK3 C;  1P8L A;  1C9O A;  3CCV A;  4BY7 G;  4LFA Q;  1YI2 A;  1PH9 A;  1QZG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...