2Z6KA

Crystal structure of full-length human rpa14/32 heterodimer
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
134
structure length
127
Chain Sequence
RAQHIVPCTISQLLSATLVDEVFRIGNVEISQVTIVGIIRHAEKAPTNIVYKIDDMTAAPMDVRQWVDNTVVPPETYVKVAGHLRSFQNKKSLVAFKIMPLEDMNEFTTHILEVINAHMVLSKANSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Replication
molecule keywords Replication protein A 32 kDa subunit
publication title Structure of the Full-length Human RPA14/32 Complex Gives Insights into the Mechanism of DNA Binding and Complex Formation
pubmed doi rcsb
source organism Homo sapiens
total genus 29
structure length 127
sequence length 134
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08784 RPA_C Replication protein A C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2z6kA00
1Q82C 4DR4Q 4BBSH 4IOCA 1K8GA 4JBWA 4P71A 5BR8L 1YI2A 4B3RL 1L1OB 1QZHA 3WWVA 4IFDJ 1HNZL 4DV5L 1YHAA 2JEBI 4FDBA 3CD6A 4IFDG 1LTLA 3IRBA 2A19A 3BU2A 3SGIA 4DR2Q 3U58A 4P74A 4GN4B 4A3LH 3GO5A 2KHIA 2AWOA 2OCEA 1PH6A 4GLVB 2LSSA 2ES2A 5JJKA 3STBC 2JA8H 1PH7A 2RHQB 4B3TQ 4JI8L 4GLXA 1YHQA 1N36Q 4GN5A 3BJUA 1OXTA 2MFIA 2N3SA 2JA7H 4LUOA 1KD1C 1Q12A 3CW2C 4WJ4A 4OO1G 4XIGS 2UUBL 2ALYB 4OX9Q 1SE8A 1A63A 3D0FA 1G6PA 2PNHA 2HQLA 2MQHA 1WCMG 3A5ZB 1KAWA 1J6QA 2I5MX 3AFPA 1PH2A 1P8LA 3S2HH 1SRUA 4OWWB 1HNWL 2JJQA 1HNXQ 1PH1A 4JBKA 2UXBQ 1ASYA 2K4KA 5IYDH 4DR5Q 2JA6G 4A3DH 1JT8A 2UUAL 3T1HL 4A3BG 5FLMH 2K52A 4A3CG 4BY7G 3FHWA 4A3GH 4AYBE 4GOPC 2VL6A 2UUCL 3GTGH 1VQJA 2EXDA 5C3EH 1AE2A 1EQRA 1VQBA 1QVGA 1IBKL 1IYJB 1VQPA 4QIWE 1G51A 1MJEA 4JG2A 4JI0Q 2EQSA 1M1KC 2PMZE 4A3JH 3W5OA 4NXNQ 3GTLH 1KC8C 4GLAC 3JAMi 5IY0A 1FJGQ 2JEAI 4YHHQ 4JI1Q 4DV0Q 3UDFA 4R4TA 5IWAL 3CQZH 1JJ2A 1NJIC 4APVA 3UE1A 5M5WH 1IBMQ 4MNOA 1XNQL 1NMFA 1XMQL 3U4ZA 4JI6Q 1BKBA 4DV3Q 4JI4Q 4R4IA 1N8RC 1Y1VG 2GVBA 1TXYA 3I4MH 4C3HH 2R7ZG 4AYBG 5LMUQ 4NXMQ 3PO3G 4HIOA 4YCUA 2I5HA 3GTQH 1XTDA 3S16H 1YIJA 4DUZL 1SN8A 4BBSG 3KF8B 4LUZA 3M4OH 2NN6I 1UE7A 1WCMH 3JAMc 3GTMH 2KBNA 3CAMA 3EBEA 3NEMA 4ALPA 2DGYA 3HOWH 2VQFL 4LF7L 1U5KA 4X62Q 3TEHB 4DV1Q 1VQMA 5GAGC 1QZGA 4JI2Q 5C0XJ 1PH8A 2MNAA 3HOZH 2JA6H 2BH8A 1PH9A 5C0XG 4B3RQ 4A3LG 1VQKA 4JOIA 4KHZA 2Z0SA 1E1TA 4QJFA 4HJAA 2UXDL 2JA8G 4P73A 1Q46A 1SR3A 2JA7G 1YITA 2QEXA 2Z6KA 2Q2UA 2B3GA 3S15H 4GN3B 4X66Q 4C3JH 3TS2A 4JI3L 1Q86C 1Y1WH 4DR7L 2NZOA 1PYBA 4LUVA 2V1CC 1HZ9A 1XNRL 3S2DH 4LFAL 5LMNL 4QGUA 4LF8Q 1VS0A 3TS0A 1HZBA 1RIPA 3Q8DA 3TQYA 4LF4L 1MJCA 2K5VA 3ULLA 2VS1A 4O0AA 1YZ6A 3I4NH 1OXVA 2UUBQ 4PMWA 4JC0A 5IYDG 1V1QA 5JEAJ 4A3DG 4GKKQ 1KIXA 1HR0L 3PUZA 5FLMG 3S1RH 5IP9H 1QVFA 5JEAG 3CF5A 5IYBH 1K8AC 1IBLQ 4A3GG 1N32Q 1EUJA 1QVCA 1HNWQ 4PZ8A 3J7A5 1GKHA 1MKHA 3FKIH 1N33L 3CCQA 5C3EG 4JBJA 1JJCB 4JI5L 2CCZA 2IHFA 3CC7A 3PIOA 3GDEA 4PG3A 3AEVA 1I6HH 1IZ6A 2UXCQ 1HZCA 4A3JG 3GTJH 1KXLA 1NY4A 1VQGA 2UUCQ 1D7QA 3PUYA 5GAHC 2E5LL 1I3QH 4DV2L 1IBKQ 4DR6L 1C9OA 1EIFA 2PI2A 1A8VA 3B6YA 1SROA 1I94L 4DR3L 1PH3A 1VQFA 3KOJA 3KYHC 1TWCH 2CQOA 4YWMA 3U50C 5FLXc 2L15A 4A3MH 2WP8J 1YBYA 5IP7H 4A3FH 4LF6Q 1JJGA 4HIDA 2LXJA 1X3EA 1Z9FA 2R92H 5JJLA 4RG1A 3I4MG 3AFQA 2N49A 5ELNA 3CCRA 1NE3A 1TWHH 1CKMA 1X3GA 1X55A 2ZTDA 3RLNA 4HJ8A 2IHEA 2R6GA 3NELA 3PIPA 3VDYA 1XMQQ 2B63H 4GOPB 2DUDA 3KFUA 1VQNA 2JK8A 4KI0A 3GTKH 3HOWG 2ZM6Q 4B3MQ 3G4SA 1PH4A 4X65L 3PUXA 3OYYA 4DUZQ 1YNXA 1SLJA 4XTCS 2E2HH 2KENA 2OWOA 2BA0A 3HOZG 1Q8KA 4Y52H 2UU9L 2F3IA 5GAEC 4LF7Q 3RLFA 1MIUA 4AIMA 5M5YH 4AQYQ 3TRZA 4POFA 1T9HA 2A1AA 2JA9A 1LYLA 3UDIA 1VQOA 1IL2A 3I56A 4IO9A 2R93H 1Y1WG 4DK3C 3HKSA 1VQ5A 1EIYB 2UXDQ 2KCTA 4KLKA 3T1YL 2YYZA 2Q2HA 2VQEL 1NBWA 1A62A 3MEFA 1XPRA 4L5QA 1HZAA 2HIXA 2RHSB 1VQ9A 3E9IA 3I4NG 4DR7Q 4OO1I 2AKWB 3L0OA 3KJPA 2VNUD 5IYCH 1XNRQ 5FJ8G 3HOVH 5AJ3L 1K83H 5ELOA 4K0KQ 5GROA 5LMNQ 4LFBL 4QQBX 3D31A 1PVOA 3OTOL 5IP9G 4A76A 5IYBG 4JYAL 4JV5Q 5M3MH 4IPCA 1FGUA 3F1ZA 2NN6G 4DV4L 2ZTCA 3FKIG 4GOPA 3CCEA 1WJJA 2F52A 3KLWA 1HR0Q 2EIFA 2NVTH 2A8VA 1J5EQ 1GO3E 4DV6L 4L5RC 2CWPA 2XTIA 2N8NA 1XPOA 4C2MH 4DR2L 5C4JH 4PZ6A 3K80C 4GKJQ 5GQOA 1KRTA 4IOAA 1VQ6A 2D0PA 1XMOL 3HKZE 2KCMA 2QA4A 1UE1A 1KQSA 4JI5Q 2OTLA 3UDXA 4MZ9A 2VUMG 3MXNB 3ZJYC 1K73C 4LF9L 3M7NA 2BH2A 2JE6I 5JJIA 4LW1A 1WI5A 1PFSA 5BR8Q 4OX9L 2YTVA 5IP7G 4IPDA 3M9BA 4A3FG 2WAQE 3CCSA 4DV7L 4A3MG 2E5LQ 4WJ3M 2R92G 4DR6Q 4AH6A 1XJVA 4DV5Q 1I94Q 1HNZQ 4DR3Q 3PO2H 4LNQA 3U4VA 4HIMA 3W1GA 2JQOA 1X9NA 1VQEA 1QUQB 2Y0SE 3S14H 1HNXL 1P16A 3CC4A 2GVAA 3LGJA 4L5TA 2ZJPA 1VQAA 2ASBA 3A74A 3HOXH 1CSPA 2B63G 2B29A 4GNXB 1TWFH 4HJ7A 1Y14B 2K50A 4YWKA 4JI8Q 2E2JH 4A4IA 2LXKA 3UDGA 4X64L 1VCIA 3M85A 4IPHA 3PUVA 3L7ZC 3HFZB 3S1QH 1JB7A 1G291 3HKZG 4C3IH 1JE5A 4DK6C 2WFWA 5FJ8H 1OXUA 3PCOB 4DNIA 3G48A 1DGSA 5IE8A 3M4QA 4YWLA 3J7ZC 3F2DA 2RCNA 3K0XA 1D8LA 3I7FA 3W1BA 2PQAB 3A0JA 1FVIA 2WAQG 4GNXC 1EQQA 4YHHL 2UUAQ 1V9PA 4JI1L 1UWVA 3T1HQ 2R93G 4DAYB 1X56A 3F8TA 4YCWA 5C44H 1N34L 2Y0SG 2CFMA 3F2CA 1VQ8A 1CSQA 3ULJA 5IT9c 1OTCA 5M3FH 4HJ9A 4BY1H 1TWAH 3NENA 4ME3A 4JI6L 3S1MH 4R4QA 1H95A 1Q81C 3AYHB 2YV5A 3EN2A 4UY8C 3H3VI 4O2DA 2K5NA 5IYCG 2JA5H 3HOVG 4BBRG 3K7UC 2VUMH 3E0EA 3CXCA 3PF5A 3STBD 2AHOB 3HOYH 1QUQA 3CCLA 1KRSA 2FXQA 5M3MG 1WOCA 4TVAB 2MO1A 1PA6A 1E22A 1EFWA 4YY3L 1I50H 4UP9A 4GNXA 3CCMA 4QL5A 5IWAQ 3RNUA 4X62L 4DV1L 4DUYL 2HHHL 1JMCA 2AWNA 3UE0A 3BZCA 3EIVA 1S3OA 3FP9A 3OTOQ 4A75A 2NVQH 3CCVA 1XNQQ 1NTGA 3RZOH 4RMFA 1GD7A 4DV4Q 2WB1E 1PYSB 4KHPL 2YTYA 5C4XH 1KHIA 1Q1EA 2QGQA 1VQ7A 4BXXH 1E1OA 2MO0A 3PGZA 4IJLA 1M90C 4GS3A 2ZJQA 3HOUG 3I4OA 2K14A 4DV6Q 2K5HA 1K0RA 1W2BA 1S40A 3S17H 1B7YB 4LFCL 3G71A 2D62A 4X66L 3A5UA 2PQAA 2R7DA 4B3SL 3H0GH 1B8AA 4DR1L 2ID0A 1L2FA 3H15A 1SFOH 1XMOQ 1PHJA 2I0QA 1X65A 3RR5A 4BXXG 2VQFQ 4LF8L 4OWXB 1PV4A 5H1SE 1HJPA 3F2BA 3PO2G 4POGA 1YHBA 1O7IA 1C0AA 4X6AH 4LF9Q 4IFDI 1VQHA 4H02A 1L1OC 4HJ5A 2F4VL 3H3VH 3GTPH 2HT1A 4J15A 4GKKL 3HOXG 1Z47A 4DV7Q 4A3IH 1FL0A 3L2PA 2Q2IA 1S72A 1I5FA 3GTOH 4LF5L 1C7YA 1VQDA 2IY5B 3BZKA 1IBLL 1N32L 3KDFB 2OTJA 1X6OA 3AQQA 3KF6B 1LUZA 2WB1G 4A3KH 4JI7L 5E7NA 2ZTEA 5M5XH 2IX0A 3JC66 4JI3Q 1UE6A 3ICEA 2YTXA 4NB3A 4A93H 4OWTB 2HIVA 3PF4A 1BBWA 2E8GA 1Q7YC 4BBRH 4LFAQ 4R1JA 1K3RA 1E3PA 4HIKA 4LF4Q 2UXCL 1Q1BA 1E7ZA 1GVPA 3ER0A 4X64Q 5EAYA 4DR4L 4OONA 4P75A 2NVXH 5GADC 3CP0A 1B70B 1YJ9A 2VY3A 2GN5A 3CMEA 1EYGA 2Q2TA 1L1OA 3KJOA 1N9WA 5C44G 2NVYH 1NMGA 4A3EH 1K9MC 1VQLA 1EOVA 3K81C 4IPGA 3CCUA 1CKNB 3ULPA 5M3FG 4BY1G 4LF6L 3PUWA 1N33Q 4JCVE 2IT1A 1RL2A 1W3SA 3RZDH 3PV0A 1IXRA 4B3TL 3J81i 3HOUH 1N34Q 4BA2I 1AE3A 2I5LX 1EWIA 3E9HA 3NBHB 4MTNA 3J80i 3TREA 1N36L 2JA5G 2ATWA 3CCJA 1R9TH 3HOYG 1LM0A 1BBUA 4JOIC 2RF4A 1CKOA 4LWCA 1PH5A 4R4OA 2CWAA 1WFQA 4DV2Q 1YVCA 2KHJA 2ZM6L 4B3ML 2Z6KC 5LMNW 4QY7A 2BA1A 1OXXK 1YEZA 3J81j 3M3YH 3I55A 3KDFA 4P72A 2UXBL 3KF6A 2N78A 3M4PA 3ERSX 4UP8A 4DR5L 5DLQE 4YY3Q 3K7AH 2E2IH 1VQCA 5C4XG 1HR0W 1XPUA 2HHHQ 1VQ4A 1WYDA 3J81c 4IJHA 4DUYQ 1U0LA 4DPGA 2IX1A 3J80c 4AQYL 1ASZA 4R4CA 2OQKA 4Y7NH 2VZAA 3PSIA 1AH9A 5HGQA 4UP7A 3CPWA 4JBMA 4A3BH 4KHPQ 2NZHA 3H0GG 4A3CH 4BY7H 3GD7A 1V43A 2D0OA 5J3BA 3RLOA 3OW2A 1SMXA 1X54A 3I2ZA 4JI0L 4NPSA 4TQUS 3RN2A 4X65Q 1CUKA 1KL9A 2R7FA 1VQIA 4LFCQ 4NXNL 1CKNA 2AMCB 2C35B 3S24A 4B3SQ 1FJGL 3RN5A 5C0XI 4DR1Q 5K36G 1UE5A 4DV0L 1HH2P 4A3IG 4K0KL 2OQ0A 4UPAA 1BVSA 2UU9Q 4L5SA 2PI2E 4EX5A 1IBML 2YU9H 1A0IA 4EQ5A 5HY6A 3S1NH 4JV5L 1E24A 4DV3L 4PZ7A 4JI4L 3CMAA 4A3KG 2F4VQ 4DKAC 1GM5A 1OXSC 1X3FA 1UEBA 2K75A 2VW9A 3CC2A 4BA1I 4A93G 2XGTA 4YCVA 1L0WA 5LMUL 4LF5Q 1J5EL 4NXML 3DLLA 3T1YQ 4DAMA 2VQEQ 1YJNA 1YJWA 4JI7Q 4OXPA 1Y1VH 3K8AA 4GKJL 3G6EA 3CPFA 2R7ZH 1TWGH 3DM3A 3PO3H 2ZJRA 5AJ3Q 4LFBQ 2CKZB 2H5XA 4A3EG 4JI2L 4JYAQ
chains in the Genus database with same CATH superfamily
4BBSH 1K8GA 4JBWA 1YI2A 2QDBA 1YNJD 4P2CB 2I46A 3WWVA 4DV5L 1VF7A 1YHAA 5C44B 4OEMB 4DAVA 4IFDG 1RJTA 2SNMA 3SGIA 3UI2A 1FNUA 1GUTA 3BS1A 1IW7C 2AWOA 2A69D 2OCEA 4GLVB 5JJKA 4JI8L 1YHQA 1N36Q 1ICWA 1E2VA 2MFIA 3RUZA 4IUTA 1ENFA 2P5ZX 4OX9Q 1LTRD 1SE8A 3D0FA 3MVVA 3A5ZB 4C1NI 1J6QA 1SNPA 2C9OA 1II3A 4H13C 4XT3B 2A68C 1HNXQ 1PH1A 2UXBQ 3MFYA 2K4KA 4L8JA 2JA6G 3T1HL 4A3BG 5C4XB 3FHWA 4K6DA 4N8X1 5EPLA 5JEAH 4A3GH 4KY6A 2K04A 4GOPC 4FNFA 1BUVT 3GTGH 5C3EH 1F2MA 1QVGA 4KN7C 1G51A 1STHA 5TSSA 3SVMA 1MJEA 4JI0Q 1HXYD 2EQSA 4L6TB 3WDNA 4NXNQ 3QOLA 3GTLH 4GLAC 2RVLA 3G6JB 5IY0A 2JEAI 3UDFA 1VDZA 4R4TA 4EQNA 4A3IB 1IBMQ 3UE1A 4FVMA 4MNOA 3S2HB 2NUCA 4MHEA 4JI6Q 1BKBA 4JI4Q 1N8RC 1U9RA 2O2LD 1MI2A 2XN9C 3I4MH 2R7ZG 4NXMQ 2I5HA 4JK1C 1XTDA 3S16H 4DXFA 2J0TD 5EBDA 4LUZA 5KYIA 1O7LA 3L9AX 2NN6I 1UE7A 3EBEA 4K8IA 1XXGA 2F0IA 5HURA 4ALPA 2VQFL 1PH8A 1AN8A 2WIIB 4KJNA 2MNAA 1PH9A 5C0XG 3VR2A 1NR2A 4CHTB 4QJFA 1R4QB 4FXDA 3CQZB 2JA7G 2D2CC 2Z6KA 3S15H 4X66Q 1R9TB 4C3JH 1S5FD 1LT4D 4LFAL 4QGUA 1VS0A 3TS0A 3Q8DA 3ULLA 2HDLA 4PMWA 1S5DD 1V1QA 4N8FA 4A3DG 1I4QA 1WCMB 3GP7A 3PUZA 5FLMG 2E2IB 5IYBH 4KMUC 1BNZA 3D6WA 4PZ8A 2BOSA 4WORA 4Y7NB 1GKHA 2NN6H 4C1NK 3LWUA 1N33L 1WTOA 4JBJA 2B39A 4H7BA 1FNVA 2EOTA 1JJCB 5KNBA 4JI5L 4BY7B 1U4PA 2XIWA 3PIOA 3AB9A 3GDEA 2IJ0A 4PG3A 1HZCA 4RAUC 1TU2B 1KXLA 2L9HA 1VQGA 2ZT9C 3A55A 1GHKA 1I3QH 4WJWA 5C5LA 1IW7D 1CA5A 1SROA 2F0OA 1B44D 1PH3A 1PTOH 3KOJA 4RGOS 2WP8J 4XYQA 1JJGA 4HIDA 2LXJA 2R92H 5EPJA 3KLSX 4RG1A 4KKUA 3S1RB 5ELNA 4HJ8A 4DK0A 2ZTDA 3RLNA 1YNND 1S5BD 3NELA 1XMQQ 4ME5A 2A68D 2DUDA 1EIHA 5E1FA 3GTKH 1TWGB 3HOWG 2KA7A 3PO3B 1WTWA 1KDAA 1T5EA 4X65L 1ENCA 3HZXA 4XTCS 3MZ5A 4QIWB 1SNDA 5GAEC 2K5WA 1MIUA 5M5YH 1T9HA 1LYLA 3I56A 4LAAA 4IO9A 4KN4C 2R93H 1ML0D 4DK3C 2M9VA 1EYCA 2F0QA 2UXDQ 2KCTA 4KLKA 2Q2HA 2F0UA 1DOKA 2RHSB 3E9IA 4DR7Q 4IN3A 5KNCA 3KJPA 5IYCH 1AFPA 3K59A 3HOVH 1K83H 3I3CA 3MEHA 2F0VA 4A76A 4QB4A 5LL6X 3FKIG 4GOPA 1WJJA 3KLWA 1HR0Q 2NVTH 3NTKA 4K2LA 1O80A 2CWPA 2K05A 5CV9A 1NCVA 2NZ1D 2B2WC 2PPBC 2WV6D 1KRTA 3SK5A 1XYIA 3HKZE 2QA4A 4Q5VA 2F0LA 5DM73 4A3JB 5BR8Q 1PFSA 4BXXH 5IP7G 2WAQE 3CCSA 4WJ3M 1XX8A 4DR6Q 5I6YA 4DR3Q 3U4VA 1X9NA 2JQOA 1H9RA 1QUQB 2Y0SE 3S14H 3DWQA 1SYFA 2DNCA 2B63G 2B29A 4GNXB 1TWFH 3W2DA 4XYOA 2L55A 3NTIA 4PMBA 4A4IA 2LXKA 1SSOA 5KYLA 1ZXTA 3L7ZC 3EFXD 2PW7A 1JB7A 5FO9B 1OXUA 3GTMB 4ODGA 2FHTA 5EKKA 5IE8A 3M4QA 2RCNA 1TR5A 2A6EC 1B1ZA 2XSCA 2UUAQ 1UWVA 4YCWA 1A2TA 1MBYA 1N34L 1JE4A 2OT2A 1CSQA 3SHLA 1QILA 4IUNA 1UAPA 2YV5A 1Y1WB 4BS9A 1GXDC 1IYVA 1LTSD 1WTHA 3K5NA 4BBRG 3K7UC 4RHRA 3CXCA 3STBD 2AHOB 5C4HA 3HOYH 2FXQA 4TVAB 3I4NB 1E22A 1EFWA 2OXPA 1I4HA 1LABA 1JMCA 5ELBA 3OTOQ 4I7ZC 1LACA 1D5MC 1XNQQ 2F0KA 3RZOH 4KHPL 1KHIA 1Q1EA 2QGQA 5ELEA 2K32A 3I4OA 4WFN3 3S17H 1NR4A 2IL8A 1B7YB 3FVQA 3A5UA 1TWAB 3MXUA 4PV1C 3IAYA 4B3SL 1PHJA 4DR1L 1L2FA 3H15A 1XMOQ 2SNSA 3QR8A 2XRQD 3JAME 1HJPA 3PO2G 1LLRD 4IFDI 1D1IA 1BO0A 1S4ZA 4HCEA 2RA4A 4A3MB 4J15A 1FL0A 5IGFA 3L2PA 1S72A 3P7JA 1C7YA 1TT2A 1IBLL 3A8IE 5IGGA 3T4AC 3KDFB 1X6OA 4A3KH 2ZTEA 3JC66 1UE6A 4NB3A 4A93H 4I7AA 2E8GA 3I91A 5HGTA 2B2TC 4LF4Q 2UXCL 4DR4L 2NVXH 5GADC 3CP0A 3T56B 5LHY1 2Q2TA 5KIXA 4NMZA 5C44G 2WKCA 4KY5A 5EKIA 2PQEA 4A3EH 1CI3M 3C3LA 3K81C 4IPGA 1CKNB 5I9PA 4LF6L 3BVMA 2A6HC 1RL2A 3R2IA 3HOUH 4B3TL 3IKJA 3E5SA 1AE3A 2I5LX 4IUVA 4JBKA 4IFDH 2B2YA 3T53B 4JOIC 4LWCA 4O42A 3VA7A 2CWAA 4DV2Q 4B3ML 1NSNS 3V96A 1YEZA 3J81j 3KF6A 2N78A 3M4PA 5M3MB 4DR5L 1EOTA 1QE6A 5DLQE 5FLXE 3K7AH 1HFGA 2B2WA 5C4XG 1HR0W 1XPUA 3J81c 2PW5A 2IX1A 4AQYL 2OQKA 1EZ6A 3J7YW 1I4XA 3VR6A 5HGQA 4A3BH 2A6ED 5EJWA 1HRJA 2D9UA 1V43A 3GD7A 2D0OA 5J3BA 1SMXA 3I2ZA 4FP5D 5CMDA 1EY5A 4HSVA 1CUKA 1KL9A 1VQIA 3PMFA 3S24A 5K5PA 2F0JA 5C0XI 5K36G 1UE5A 4DV0L 4DGZA 4A3IG 3H6MA 1H9SA 1BVSA 4NDXA 1PRTB 3I72A 2YU9H 3I8ZA 1VMCA 4DV3L 3D4RA 1X3FA 1UEBA 2K75A 4ZKCB 4YCVA 1L0WA 5LMUL 1HQRD 5I2YA 4LF5Q 3T1YQ 2QF7A 1YJNA 2WB1B 3HEJA 3KF8A 4GKJL 2R7ZH 4C3IB 2PCFB 5AJ3Q 4LFBQ 2CKZB 1FNWA 4JYAQ 3QB3A 1Q82C 1C8CA 2BE5D 2MJ8A 3EQLC 1CT1D 2VB3X 2HDMA 3LX0A 1HNZL 1IHZA 1SJHD 2K28A 4DNTB 3CD6A 1PXUA 2MHVA 5JVG3 1LTLA 3IRBA 2A19A 3BDCA 3VA5A 5C0XH 3S1MB 3GO5A 2KHIA 1PH6A 2LSSA 1PH7A 2RHQB 3NPPA 2C5CA 3GV3A 2JA7H 3BJUA 1OXTA 2N3SA 1SDFA 2R3ZA 3DWAA 1LT6D 3CW2C 1PZID 4XIGS 3TZUA 2UUBL 4RWSC 5DEHA 1WCMG 2I5MX 1PH2A 1P8LA 2Z8LA 1SRUA 1HNWL 3C1FA 1ASYA 4A3DH 1JT8A 4J1MA 2AQ3B 5FLMH 2K52A 2F0NA 4BY7G 5FK9C 3DMUA 1L0YB 3T16A 3K58A 2VL6A 3EVQA 2UUCL 1AE2A 1EQRA 3H0GB 1VQBA 3NQTA 1SFOB 5D3DA 1IBKL 4ZLTF 1EU4A 4DU9A 2EVBA 2PZWA 1HUMA 2WKDA 3TMEA 1JOQA 3J81L 3JAMi 3J7AV 1FJGQ 4YHHQ 3GTPB 1G6ZA 2AQ1B 1NJIC 1W6JA 3KUPA 2B2TA 3U4ZA 1SYCA 1JOKA 1XTCD 4DNRB 5KRUA 2FFKB 2O4XA 4IURA 3PO3G 4HIOA 3GTQH 1ILPA 1HHVA 2SEBD 3NBIA 4X3KA 1SN8A 3KLRA 3KF8B 2KBNA 3HOWH 4X62Q 3TEHB 1VQMA 2NVYB 4R9WA 1QZGA 2NYZD 4HAEA 3TP5A 3GTLB 4JOIA 4KY7A 4HSPA 2DY7A 4HJAA 3RZDB 3F2UA 1Q46A 1F2ZA 2QEXA 3DM1A 4RGNA 1PYBA 5I4DA 3I70A 1XNRL 5FOBB 5LMNL 3I4MB 3I90A 1HZBA 1A2UA 1RIPA 2F1MA 3TQYA 2E2DC 1MJCA 2EY5A 4RA8A 1YZ6A 1EIGA 5IYDG 4K6LA 5JEAJ 5FLXL 4GKKQ 2AQ2B 4ZKBB 1BXTA 3G7LA 1QVFA 1EUJA 3IL8A 3CU7A 4DA2A 3FKIH 1SYBA 1RF2D 2EZVA 4CKEA 1I6HH 1CQFA 4A3JG 2AUKA 1TS2A 1NY4A 2A5HA 2R61A 1PDQA 1C9OA 1I94L 1VQFA 4CJ2C 3P20A 2RDGA 3KYHC 2K03A 3U50C 5IP7H 1WD1A 1X3EA 4RCOA 1SYGA 2IHEA 3PIPA 2B63H 1Y1VB 3KFUA 1VQNA 4KI0A 4H44C 4AYBB 5G3LF 3G4SA 5FO8B 1SXTA 3PUXA 1CA6A 5AFWA 2E2HH 2KENA 4RKLA 4Y52H 1I3QB 2F3IA 5J22A 2PMZB 1CM9A 3MHBA 1PFNA 4AIMA 5A2QL 3TRZA 4POFA 2RCFA 2A1AA 3J80E 3TP6A 1Y1WG 1IL8A 4PMCA 1EIYB 2JA8B 2VQEL 2TMPA 1NBWA 1QJOA 1A62A 1XPRA 3PIO3 4KJOA 3I4NG 2XVSA 5ELOA 1PVOA 3X3MA 5IP9G 1X3QA 1TQOA 4JV5Q 1FGUA 1JWSD 5JJZA 1ESRA 2ZTCA 5IT9E 1EWCA 2F52A 1R4PB 2EIFA 1EY0A 3U9SA 4OIJA 4DV6L 1XWEA 4XDXA 4CDEC 1GJXA 1KLUD 3FMCA 2MPMA 5LL6S 1AEXA 3QOJA 4C2MH 5C4JH 1LT5D 3A7LA 1CTMA 5GQOA 4IOAA 1K3BC 1UNSA 2Y0SB 3OWFA 3Q22A 4JI5Q 1PFMA 1F2LA 2K1BA 5G3LD 3M7NA 3ZJYC 4LF9L 2JE6I 4LW1A 1WI5A 4OX9L 4A3MG 4IPDA 4N9TA 2PNRC 4A3FG 1I6VC 1MSGA 4KK7A 3PO2H 1K83B 4LNQA 3W1GA 1VQEA 5M5WB 1B3AA 1HNXL 1P16A 1RTNA 2GVAA 3LGJA 4L5TA 1LTGD 2V4DA 2ASBA 1CSPA 4GZYC 1Y14B 2K50A 4C3HB 2E2JH 3E0JA 1GOZA 3OMGA 1EYAA 3D4DA 3OIQA 4HCSA 1VCIA 1SE4A 3HFZB 3S1QH 1C48A 1JE5A 1ENAA 5FJ8H 3M4OB 4X3SA 3G48A 1RDPD 2OEOA 3KK7A 2F0DA 1D8LA 1KDCA 2ENBA 3ND8A 3W1BA 1FVIA 3HOZB 1O7YA 4KV6A 5C44H 1QCBD 1WD0A 2CFMA 3KLSA 3F2CA 2Q8RE 4X3UA 1VQ8A 5IT9c 1AZQA 1STBA 4JI6L 4JW0A 2CH4W 2EYOA 2Z6BA 2NTSA 3T51B 4UY8C 2K5NA 3S2DB 1WTPA 3Q0AA 3R93A 2VUMH 1EY8A 3OHXC 2Q8TA 1QUQA 1AZPA 3CCLA 5M3MG 1WOCA 1CHPD 1LV9A 2EJMA 4O1NA 5T1IA 4YY3L 1PA6A 2O5JC 4LJZC 1I50H 1DD2A 4GNXA 2SOBA 4QL5A 1TIID 1PRTC 5IWAQ 3BZCA 3FP9A 2JYOA 1Y8NB 4DFAA 2A73B 1X32A 3A8KE 5C4XH 1M4VA 3FDTA 3K5LA 1WTVA 1IYUA 2K14A 2CH4A 2K5HA 4LFCL 4X66L 2OF1A 2CW0C 3GTJB 2F3WA 2I0QA 1X65A 4EQOA 4V0BA 2ZXPA 1C0AA 4UAIA 1TWCB 1VQHA 5I9OA 5K36H 4ZQ3A 4A3IH 1Z47A 1JCKB 1I5FA 3BG3A 4HEDA 3K5MA 4KHVA 1TWHB 2HUGA 1S5CD 2WB1G 4JI7L 1B9NA 3C2PA 2IX0A 4JI3Q 2YTXA 1QNKA 4C3IG 4OWTB 2HIVA 4HMJA 1BBWA 1ICFB 2L4NA 3LNNA 4R1JA 1K3RA 2B2YC 4CKCA 2MGSA 2B2UA 4J8QA 4OONA 4P75A 1G91A 3KBXA 2RDFA 3I4LA 1ZEQX 1EYGA 3KJOA 3NE5B 3SK8A 1EOVA 3CCUA 4FF1A 3J80L 3SE0A 3TSSA 2LMCB 1N34Q 2E74C 3E9HA 1EWIA 3J80i 2D5DA 2F03A 1R9TH 3BZDB 3QG1A 1PH5A 4R4OA 3RMHA 1YVCA 4CKBA 1VMPA 4QY7A 3GV6A 3IFDA 5CR3A 2MUYA 3KDFA 4P72A 1LO5D 3H3VC 3FRPB 3I73A 4UP8A 5IT9L 2E2IH 2FMCA 4IUUA 2AUJD 4QUCA 4IUQA 4Y7NH 3BVGA 3NTHA 3PSIA 4UP7A 4KHPQ 3H0GG 4BY7H 5CV4A 3OW2A 1JWUD 3HOUB 4KD3A 4KTAA 4NPSA 3RN2A 3QO2A 2L12A 1CKNA 3NSWA 4B3SQ 3RN5A 1B9MA 4DR1Q 4K5WA 1HH2P 2UU9Q 1J8IA 4L5SA 5I6WA 4QF4A 2CVRA 2F0HA 1SNMA 5HY6A 1QWYA 4PZ7A 1EQVA 3CMAA 1OXSC 2VW9A 3HOXB 3CC2A 5EKLA 4BA1I 2XGTA 4EQPA 2NTTA 3NWSA 4TSSA 2A74C 3S9WA 3FPUB 4HR7B 4OXPA 4CJ0B 3AU7A 2F0EA 5FO7B 4A3BB 1TWGH 3DM3A 3PO3H 4G7HC 1TVXA 2QW7A 3FPPA 1HPCA 1MKHA 4JI2L 4DR4Q 2ZXOA 4IOCA 4P71A 5BR8L 4G4KA 4B3RL 1NNXA 2DNEA 2F0WA 1D5XC 2CW0D 4IFDJ 2Q8IB 4EGVA 1A15A 2KVMA 2JEBI 3BU2A 4DR2Q 2YU9B 2LKVA 4P74A 5M3FB 4BY1B 1Q8IA 1IKMA 1Y69U 4U673 2J4XA 4FXKC 4B3TQ 4GLXA 2JA5B 4GN5A 3P75A 4LUOA 1Q12A 4FXGC 3CKIB 1A63A 1LTTD 1G6PA 2PNHA 2HQLA 2MQHA 2F0PA 3O13A 4KKTA 1JOOA 4OWWB 1EY7A 2G5DA 4YIJA 5IYDH 3VYSA 4N9PA 4DR5Q 2UUAL 2QEJC 5CC4A 4CBVA 3MAQA 3W3AA 3SEBA 5IIFA 4IALA 2KCCA 3VR3A 4OL7A 1VF5C 1WTQA 3OOCA 1VQJA 1O78A 1LTAD 2DJGC 1VQPA 2FINB 4QIWE 4JG2A 4A3JH 4JI1Q 4DV0Q 1RKNA 1JJ2A 1XNQL 1NMFA 4K2KA 1STYA 2B2VC 4DV3Q 5M5XB 1Y1VG 4EVOA 2GVBA 1TXYA 4AYBG 1LTBD 5LMUQ 4YCUA 1Q90A 2B8GA 4DUZL 1HA5A 3QWNA 3NXWA 1SNCA 2EYLA 3JAMc 3GTMH 3CAMA 4LF7L 3TP7A 1U5KA 4DV1Q 5GAGC 3OIPA 5C0XJ 1GUOA 2JA6H 2BH8A 4K14A 1JR0D 1VQKA 4A3LG 2QDLA 2Z0SA 2JA8G 4P73A 3R8BA 1SR3A 5DNFA 1YITA 1LTID 2B3GA 4QCLA 1Y1WH 4LUVA 1RTOA 4DK1A 1A3TA 4LF8Q 3FEWX 4LF4L 2K5VA 4BWGB 2VS1A 1PMRA 4O0AA 3I4NH 3M3YB 1DYQA 2UUBQ 3QIAA 3TN2A 4JC0A 1RHPA 1KIXA 4RH6A 2DN8A 2H4OA 5IP9H 2LS01 1K8AC 2EYPA 1N32Q 1QVCA 1TY2A 1HNWQ 3DHQA 3J7A5 1ET9A 4E6IA 3AEVA 3M4YA 4RCNA 3MXNA 1GHJA 3EROA 2UUCQ 1D7QA 3PUYA 2E5LL 3HS0C 4DV2L 1IBKQ 2E75C 3VR5A 2L11A 4S3SA 3CHBD 2CQOA 4YWMA 5FLXc 1PFBA 2L15A 4A3MH 3S1NB 3H94A 1M8AA 4A3FH 3K0YA 5JJLA 4V190 2F0FA 4C3HG 4CJ1B 3AFQA 2N49A 1JB3A 3NUCA 2Z1CA 1NE3A 1X3GA 1CKMA 1MD2D 5JPNC 3SK6A 4NW2A 5DM63 2KHSA 2ZM6Q 1SMYC 1X3PA 3OYYA 1I6HB 1YNXA 5KEEA 3HOZG 4BBSB 5EQ0A 3A56A 3ERQA 1BF4A 5COYA 4DAYA 4DN4M 5I2XA 2KJXA 3HGBA 1D2BA 1EU3A 1IL2A 1VQOA 1PZJD 1BCPB 4B9XA 1VQ5A 2A6HD 3JAML 2WINB 3T1YL 2YYZA 2EDGA 4L5QA 1HZAA 4OO1I 1HTLD 3L0OA 2B63B 2IW3A 2VNUD 1FR3A 1XNRQ 1A3UA 5AJ3L 4K0KQ 1KNAA 5LMNQ 4LFBL 4JYAL 1SAPA 1W6KA 1D5ZC 5M3MH 2EY6A 4DV4L 4K5XA 2E2HB 4OIKA 3CCEA 2A8VA 1J5EQ 4A3GB 4CDFC 2EY1A 4L5RC 4Z9CB 2H1EA 2EE1A 5IGEA 3K80C 3GTGB 2D0PA 2NBFA 5C3EB 2KCMA 1UE1A 1KQSA 4B08A 4PNYA 2OTLA 3UDXA 2RSNA 3MXNB 1K73C 2HCCA 3R3OA 4XXEA 1T5XD 3M9BA 3ZYYX 4DV7L 2B2VA 3E3XA 1Z6HA 1UEAB 4AH6A 3C46A 4DV5Q 1I94Q 5EPKA 4G57A 1QG7A 3WOEA 4KD4A 2N88A 3ND9A 1GUSA 2ZJPA 1VQAA 2IWHA 1K28A 5F2DA 3EJIA 4HJ7A 4YWKA 4JI8Q 3NK9A 3UDGA 1E0BA 4OHJA 4X64L 3S16B 3PUVA 1G291 1B50A 1HCZA 4C3IH 4DK6C 3QJYA 2WFWA 5D14A 3PCOB 2N55A 1DGSA 3J7ZC 3F2DA 3K0XA 2PQAB 1ZKOA 3A0JA 4GNXC 1EQQA 4YHHL 1V9PA 3T1HQ 1F9PA 4DAYB 1X56A 3F8TA 1Y8PB 1TKWB 4ZYSA 2EY2A 3ULJA 4HJ9A 1QNUA 3NENA 3S1MH 4ME3A 1H95A 3S15B 4C3JB 3AYHB 2DJFC 1Q81C 3EN2A 2KEDA 3H3VI 4HTHA 3E0EA 5CORA 2E2JB 3D6CA 1KRSA 1STEA 3A7AB 1HUNA 2QCPX 2MO1A 3S1QB 1F2YA 1V1PB 4UP9A 3CCMA 1H9KA 4X62L 3RNUA 4DUYL 2HHHL 3UE0A 2M2LA 2NVQH 4A75A 1JORA 1NTGA 3M7GA 1SMYD 5BN5A 2G9DA 1A3VA 1PYSB 2WB1E 4ZK9B 3HRZC 2X69A 3PGZA 1M90C 4IJLA 4GS3A 3HOUG 1F9SA 1HTPA 1F77A 4DV6Q 1W2BA 1S40A 2D62A 2R7DA 3H0GH 1B8AA 1SFOH 2ID0A 3RR5A 2B2UC 2VQFQ 4OWXB 3F2BA 4POGA 1YHBA 2VUMB 1O7IA 2Z9HA 5IGBA 1PTOB 4LF9Q 5EBCA 1MSHA 5IODA 2IPKD 4H02A 4HJ5A 4Q0FA 2F4VL 2M00A 3GTPH 3H3VH 2K5QA 2HT1A 4GKKL 3HOXG 3GTOH 1I50B 2R92B 1U4MA 1YNNC 4L63B 5IGDA 2IY5B 2OTJA 3AQQA 1RD9D 5E7NA 3ICEA 2RDHA 3PF4A 4BBRH 1JQYD 4LFAQ 5IOCA 3GTKB 4RFBA 1E3PA 4HIKA 1E7ZA 1QB5D 5EAYA 2Z4IA 1TS5A 3HKZB 2VY3A 2GN5A 1L1OA 2NVYH 1VQLA 5M5YB 4FO2A 5M3FG 4BY1G 2WAQB 2F0TA 5NUCA 3PUWA 1ET6A 1N33Q 2R93B 1W3SA 3RZDH 1DZ1A 3PV0A 1I4GA 2JA5G 1JC7A 3T13A 3NWTA 4MTNA 4DF7A 1N36L 2TSSA 2ATWA 3CCJA 2RQXA 3VYRA 3NP8A 1CKOA 2X6GA 1HFNA 1Z7TA 3HOVB 5LMNW 3R2TA 1AW7A 2BA1A 2UXBL 1FD7D 3I55A 1B3QA 1CZGA 3KBGA 4TKOB 1CZWA 4YY3Q 1TS4A 1VQCA 3BYTB 1WYDA 2NVTB 1U0LA 4DPGA 3J80c 1ASZA 4R4CA 2VZAA 1BBXC 1AH9A 4F8MA 4JBMA 4CGYB 1EY6A 1DCZA 5E3FA 1ONLA 2B8FA 4UHVA 4JI0L 1RCVD 4X65Q 3J7AF 4LFCQ 2G9HD 2R7FA 4NXNL 1DOMA 1E2ZA 2C35B 2EYJA 2F3VA 3EA6A 3SK4A 1ILQA 4EX5A 1IBML 1BR9A 2K01A 5C3WA 3S14B 4EQ5A 4JV5L 4JI4L 4F87A 3U9OA 4DKAC 3HP3A 1H9JA 4NXML 1CK1A 1TWFB 3DLLA 2PO4A 1YJWA 4JI7Q 1Y1VH 3TBIB 3K8AA 3G6EA 3CPFA 4IQZA 1DM0B 1Q3LA 1E1OA 3OMCA 1KTKA 3A8JE 1KDBA 1V1OA 3TDQA 1SE2A 1B4OA 3K57A 3SR1A 1L1OB 2BDOA 1QZHA 3N6RA 4C56C 4FDBA 3U58A 1CQVA 2JSOA 4IZ8A 4GN4B 4A3LH 1SJED 4K8JA 2ES2A 3STBC 2JA8H 3DEPA 1KD1C 5C3XA 3HOYB 4WJ4A 4OO1G 1KAAA 3MC0B 4JPBW 1KABA 2ALYB 2F4IA 1UUPA 1KAWA 2HCIA 3AFPA 4FF3A 3S2HH 2JJQA 1ZYRC 4I65A 4ABNA 3RZOB 1O7ZA 4A3CG 2BCOA 4AYBE 1GUGA 3OPOA 3S17B 2BDNA 3URYA 2EXDA 4OELB 1HQMC 1IYJB 4R8NA 3BVZA 1M1KC 2PMZE 3W5OA 2KQ3A 1CFMA 1QOHA 1KC8C 2F0MA 1EWHA 2ICEC 1SNOA 3L3OC 3CRLC 5IWAL 2X6LA 3CQZH 1PRTF 4APVA 5M5WH 3V2TA 5J39A 1XMQL 1BCPC 4R4IA 5ISRA 4A3KB 4C3HH 4A93B 1EFID 2IX3A 1HA6A 5CBAE 1EY9A 2ZXRA 1YIJA 1G8ZD 4MIUA 3GQBA 4BBSG 3OSOA 3M4OH 4HN7A 2NVXB 1WCMH 3NEMA 2DGYA 1D1KA 2K5DA 3V05A 4A3EB 2XWBB 4JI2Q 1I4PA 2VB2X 1SNQA 3HOZH 4B3RQ 5CV7A 4KHZA 4ZRZA 1E1TA 2UXDL 5A35A 4F88A 5CV6A 3DXJC 4A3EG 2I07B 1SBBB 2Q2UA 4GN3B 3TS2A 1PZKD 2SDFA 4RGMA 4JI3L 1Q86C 4DR7L 2NZOA 4G7OC 2V1CC 1HZ9A 3S2DH 4JVZA 2RKSA 4G7ZC 2EYMA 2EYFA 1OXVA 3CRKC 1HR0L 3K7AB 3RD4A 3S1RH 3BDLA 5FKAC 4A3GG 1C4QA 1H9MA 5JEAG 3CF5A 1IBLQ 5E4XA 1LT3D 1PRTD 4FF4A 5L37A 2JA6B 3CCQA 1IKLA 5C3EG 2EPBA 1U4LA 3MWYW 2CCZA 2IHFA 4M1UB 3MXPA 3CC7A 4CDCC 3D3RA 1JWMD 2UXCQ 1IZ6A 2QILA 3GTJH 4ID6A 1BCPF 5GAHC 4WRDA 4DR6L 1EIFA 2PI2A 1A8VA 3B6YA 4DR3L 5DAUA 3OWEB 5CBEE 1TWCH 5EGTA 1E2WA 4LF6Q 1YBYA 2L0CA 4TRDA 2L1BA 1Z9FA 2NB0A 1DXMA 3H09A 3I4MG 4MN3A 4OGQC 1TWHH 3CCRA 1X55A 2F0GA 1EEFD 3VDYA 2R6GA 1SE3A 4GOPB 1ZYRD 2JK8A 4CDDC 1J9OA 2R7ZB 4B3MQ 2BE5C 2NWGA 2E76C 1PH4A 4DUZQ 1FYCA 5D65A 1SLJA 2OWOA 3MTSA 2BA0A 4U68A 1Q8KA 3ITPA 3VYTA 2UU9L 4LF7Q 5BN4A 3RLFA 2JXMB 4AQYQ 1MGSA 3J81E 2JA9A 3UDIA 4C3JG 1EY4A 3Q24A 4A3FB 3HKSA 2EJGC 3BDOA 2JA7B 1EL0A 3MEFA 3WOFA 1VQ9A 2HIXA 4FYDA 4ZAIA 5JPMC 2AKWB 1BOSA 1CHQD 5M9OA 5FJ8G 1BCPD 5GROA 4QQBX 3D31A 3OTOL 1PTOC 5IYBG 1STGA 4IPCA 3F1ZA 2NN6G 3LWEA 4A3DB 2CQAA 4RKBA 2RSOA 3OW7A 5KGUA 1GO3E 2XTIA 5BN3A 2N8NA 1XPOA 4DR2L 5CV8A 4PZ6A 5CV5A 5CYUA 4ZCKA 4XQQA 1TS3A 4XQJA 4GKJQ 1VQ6A 1XMOL 2KCNA 3SDZA 4HMIA 4FF2A 1NUCA 4MZ9A 2VUMG 5JVH3 3N52A 2BH2A 4NP5A 5C6AA 5JJIA 3IFTA 1Y8OB 2J7ZA 3A54A 2YTVA 2E5LQ 2R92G 2HD3A 1XJVA 1HNZQ 1OO9B 4HIMA 3HG9A 2DY8A 3CC4A 2XWJB 2XRSD 3MA2B 3DEOA 3A74A 3HOXH 1GUWA 2EJFC 2KOLA 2KECA 3DUZA 2PZTA 3GTQB 1ESFA 1K8MA 3M85A 4IPHA 3HKZG 2QKIC 1EQTA 4DNIA 2PYKA 3HOWB 4YWLA 4ILWA 5JOBA 1WVLA 3H91A 4MTKA 3TP8A 1G2TA 2WACA 3I7FA 4H0LC 2K33A 2WAQG 2RBMA 4JI1L 2R93G 5E4WC 2Y0SG 1K8OA 3NBHA 1S5ED 1PTOF 5T1GA 1OTCA 5M3FH 3MXGA 4BY1H 1TWAH 1SYDA 4R4QA 4RGTA 4QMGA 4O2DA 5IYCG 4XT1B 1G2SA 2JA5H 3HOVG 4K5VA 3PF5A 3SXHA 4IUPA 1B53A 2JP1A 2GA4B 2EXZA 5KNDA 4DV1L 1GUNA 2AWNA 4NKLA 3EIVA 1S3OA 2HQEA 3MFGA 4QUFA 3CCVA 4PQXA 4RMFA 4XQNA 1GD7A 4DV4Q 3D4WA 3FKIB 2YTYA 1VQ7A 2VXWA 1PLFA 2MO0A 2ZJQA 3TZDA 4DAPA 2XNAC 4X3TA 5A2QE 3P1HA 1YNJC 1K0RA 3G71A 1WTXA 2PQAA 1I4RA 3PQIA 4BXXG 4KKSA 4LF8L 1WTRA 1PV4A 5H1SE 3NHHA 4X6AH 2LFNA 2A69C 2K6AA 3X3NA 2O5IC 3VYUA 1L1OC 2LY7A 1STAA 4DV7Q 2Q2IA 4LF5L 1VQDA 3BZKA 4ZUIA 3AMUA 1N32L 2ICIA 2NVQB 3KF6B 3E6ZX 1LUZA 5M5XH 1PTOD 1D6EC 5IGCA 4UDUC 4LMQD 1NAPA 1Q7YC 1V1PA 4B9WA 1AP0A 1A6XA 1Q1BA 1TY0A 1GVPA 3ER0A 4X64Q 1EZ8A 1STNA 1L0XB 3Q6SA 2CHBD 1YJ9A 1B70B 3CMEA 1N9WA 1K9MC 1NMGA 3BYYB 1JICA 1EEID 2K7VA 4J6HA 3ULPA 3Q23A 2PZUA 1KNEA 4JCVE 2IT1A 5ELFA 3PIP3 5ELCA 1H9SB 1B2TA 1IXRA 4BA2I 3J81i 1SYEA 4ULLA 3GTOB 3NBHB 4F7XA 3TREA 3HOYG 1LM0A 1BBUA 2RF4A 2FMMA 1WFQA 2F0SA 3VR4A 2KHJA 2ZM6L 4BBRB 2Z6KC 1F9RA 4M8AA 2KEEA 1KLGD 2Z4HA 1OXXK 5CGKA 3M3YH 4OO1H 3ERSX 2EYHA 5C5MA 3D8GA 3DWPA 5J1ZA 2HHHQ 1PYWD 1VQ4A 4DUYQ 4IJHA 2FJ2A 5JAVA 5C4ZA 1DJRD 4C2MB 5C4JB 3CPWA 1V8QA 2NZHA 4A3CH 3ONAB 3RLOA 4ZUJA 1X54A 2MP1A 1FGBD 4TQUS 5D3IB 1F9QA 2AMCB 4R8IA 1FJGL 4K0KL 2OQ0A 4UPAA 2PI2E 3K6OA 1DOLA 3PO2B 1RODA 1A0IA 3NQIA 1K0SA 3S1NH 1E24A 4DXGA 3K5OA 2F4VQ 4A3KG 1GM5A 2KUMA 2L5TA 4LK1C 4A93G 1SEBD 1J5EL 1BQQT 3C1EA 4DAMA 2VQEQ 5ELDA 2JN4A 1BDOA 1DONA 2ZJRA 4RHSA 1EYDA 1U4RA 2H5XA 1MHWC
chains in the Genus database with same CATH topology
1Q82C 4DR4Q 4BBSH 4IOCA 1K8GA 4JBWA 4P71A 5BR8L 1YI2A 4B3RL 1L1OB 1QZHA 3WWVA 4IFDJ 1HNZL 4DV5L 1YHAA 2JEBI 4FDBA 3CD6A 4IFDG 1LTLA 3IRBA 2A19A 3BU2A 3SGIA 4DR2Q 3U58A 4P74A 4GN4B 4A3LH 3GO5A 2KHIA 2AWOA 2OCEA 1PH6A 4GLVB 2LSSA 2ES2A 5JJKA 3STBC 2JA8H 1PH7A 2RHQB 4B3TQ 4JI8L 4GLXA 1YHQA 1N36Q 4GN5A 3BJUA 1OXTA 2MFIA 2N3SA 2JA7H 4LUOA 1KD1C 1Q12A 3CW2C 4WJ4A 4OO1G 4XIGS 2UUBL 2ALYB 4OX9Q 1SE8A 1A63A 3D0FA 1G6PA 2PNHA 2HQLA 2MQHA 1WCMG 3A5ZB 1KAWA 1J6QA 2I5MX 3AFPA 1PH2A 1P8LA 3S2HH 1SRUA 4OWWB 1HNWL 2JJQA 1HNXQ 1PH1A 4JBKA 2UXBQ 1ASYA 2K4KA 5IYDH 4DR5Q 2JA6G 4A3DH 1JT8A 2UUAL 3T1HL 4A3BG 5FLMH 2K52A 4A3CG 4BY7G 3FHWA 4A3GH 4AYBE 4GOPC 2VL6A 2UUCL 3GTGH 1VQJA 2EXDA 5C3EH 1AE2A 1EQRA 1VQBA 1QVGA 1IBKL 1IYJB 1VQPA 4QIWE 1G51A 1MJEA 4JG2A 4JI0Q 2EQSA 1M1KC 2PMZE 4A3JH 3W5OA 4NXNQ 3GTLH 1KC8C 4GLAC 3JAMi 5IY0A 1FJGQ 2JEAI 4YHHQ 4JI1Q 4DV0Q 3UDFA 4R4TA 5IWAL 3CQZH 1JJ2A 1NJIC 4APVA 3UE1A 5M5WH 1IBMQ 4MNOA 1XNQL 1NMFA 1XMQL 3U4ZA 4JI6Q 1BKBA 4DV3Q 4JI4Q 4R4IA 1N8RC 1Y1VG 2GVBA 1TXYA 3I4MH 4C3HH 2R7ZG 4AYBG 5LMUQ 4NXMQ 3PO3G 4HIOA 4YCUA 2I5HA 3GTQH 1XTDA 3S16H 1YIJA 4DUZL 1SN8A 4BBSG 3KF8B 4LUZA 3M4OH 2NN6I 1UE7A 1WCMH 3JAMc 3GTMH 2KBNA 3CAMA 3EBEA 3NEMA 4ALPA 2DGYA 3HOWH 2VQFL 4LF7L 1U5KA 4X62Q 3TEHB 4DV1Q 1VQMA 5GAGC 1QZGA 4JI2Q 5C0XJ 1PH8A 2MNAA 3HOZH 2JA6H 2BH8A 1PH9A 5C0XG 4B3RQ 4A3LG 1VQKA 4JOIA 4KHZA 2Z0SA 1E1TA 4QJFA 4HJAA 2UXDL 2JA8G 4P73A 1Q46A 1SR3A 2JA7G 1YITA 2QEXA 2Z6KA 2Q2UA 2B3GA 3S15H 4GN3B 4X66Q 4C3JH 3TS2A 4JI3L 1Q86C 1Y1WH 4DR7L 2NZOA 1PYBA 4LUVA 2V1CC 1HZ9A 1XNRL 3S2DH 4LFAL 5LMNL 4QGUA 4LF8Q 1VS0A 3TS0A 1HZBA 1RIPA 3Q8DA 3TQYA 4LF4L 1MJCA 2K5VA 3ULLA 2VS1A 4O0AA 1YZ6A 3I4NH 1OXVA 2UUBQ 4PMWA 4JC0A 5IYDG 1V1QA 5JEAJ 4A3DG 4GKKQ 1KIXA 1HR0L 3PUZA 5FLMG 3S1RH 5IP9H 1QVFA 5JEAG 3CF5A 5IYBH 1K8AC 1IBLQ 4A3GG 1N32Q 1EUJA 1QVCA 1HNWQ 4PZ8A 3J7A5 1GKHA 1MKHA 3FKIH 1N33L 3CCQA 5C3EG 4JBJA 1JJCB 4JI5L 2CCZA 2IHFA 3CC7A 3PIOA 3GDEA 4PG3A 3AEVA 1I6HH 1IZ6A 2UXCQ 1HZCA 4A3JG 3GTJH 1KXLA 1NY4A 1VQGA 2UUCQ 1D7QA 3PUYA 5GAHC 2E5LL 1I3QH 4DV2L 1IBKQ 4DR6L 1C9OA 1EIFA 2PI2A 1A8VA 3B6YA 1SROA 1I94L 4DR3L 1PH3A 1VQFA 3KOJA 3KYHC 1TWCH 2CQOA 4YWMA 3U50C 5FLXc 2L15A 4A3MH 2WP8J 1YBYA 5IP7H 4A3FH 4LF6Q 1JJGA 4HIDA 2LXJA 1X3EA 1Z9FA 2R92H 5JJLA 4RG1A 3I4MG 3AFQA 2N49A 5ELNA 3CCRA 1NE3A 1TWHH 1CKMA 1X3GA 1X55A 2ZTDA 3RLNA 4HJ8A 2IHEA 2R6GA 3NELA 3PIPA 3VDYA 1XMQQ 2B63H 4GOPB 2DUDA 3KFUA 1VQNA 2JK8A 4KI0A 3GTKH 3HOWG 2ZM6Q 4B3MQ 3G4SA 1PH4A 4X65L 3PUXA 3OYYA 4DUZQ 1YNXA 1SLJA 4XTCS 2E2HH 2KENA 2OWOA 2BA0A 3HOZG 1Q8KA 4Y52H 2UU9L 2F3IA 5GAEC 4LF7Q 3RLFA 1MIUA 4AIMA 5M5YH 4AQYQ 3TRZA 4POFA 1T9HA 2A1AA 2JA9A 1LYLA 3UDIA 1VQOA 1IL2A 3I56A 4IO9A 2R93H 1Y1WG 4DK3C 3HKSA 1VQ5A 1EIYB 2UXDQ 2KCTA 4KLKA 3T1YL 2YYZA 2Q2HA 2VQEL 1NBWA 1A62A 3MEFA 1XPRA 4L5QA 1HZAA 2HIXA 2RHSB 1VQ9A 3E9IA 3I4NG 4DR7Q 4OO1I 2AKWB 3L0OA 3KJPA 2VNUD 5IYCH 1XNRQ 5FJ8G 3HOVH 5AJ3L 1K83H 5ELOA 4K0KQ 5GROA 5LMNQ 4LFBL 4QQBX 3D31A 1PVOA 3OTOL 5IP9G 4A76A 5IYBG 4JYAL 4JV5Q 5M3MH 4IPCA 1FGUA 3F1ZA 2NN6G 4DV4L 2ZTCA 3FKIG 4GOPA 3CCEA 1WJJA 2F52A 3KLWA 1HR0Q 2EIFA 2NVTH 2A8VA 1J5EQ 1GO3E 4DV6L 4L5RC 2CWPA 2XTIA 2N8NA 1XPOA 4C2MH 4DR2L 5C4JH 4PZ6A 3K80C 4GKJQ 5GQOA 1KRTA 4IOAA 1VQ6A 2D0PA 1XMOL 3HKZE 2KCMA 2QA4A 1UE1A 1KQSA 4JI5Q 2OTLA 3UDXA 4MZ9A 2VUMG 3MXNB 3ZJYC 1K73C 4LF9L 3M7NA 2BH2A 2JE6I 5JJIA 4LW1A 1WI5A 1PFSA 5BR8Q 4OX9L 2YTVA 5IP7G 4IPDA 3M9BA 4A3FG 2WAQE 3CCSA 4DV7L 4A3MG 2E5LQ 4WJ3M 2R92G 4DR6Q 4AH6A 1XJVA 4DV5Q 1I94Q 1HNZQ 4DR3Q 3PO2H 4LNQA 3U4VA 4HIMA 3W1GA 2JQOA 1X9NA 1VQEA 1QUQB 2Y0SE 3S14H 1HNXL 1P16A 3CC4A 2GVAA 3LGJA 4L5TA 2ZJPA 1VQAA 2ASBA 3A74A 3HOXH 1CSPA 2B63G 2B29A 4GNXB 1TWFH 4HJ7A 1Y14B 2K50A 4YWKA 4JI8Q 2E2JH 4A4IA 2LXKA 3UDGA 4X64L 1VCIA 3M85A 4IPHA 3PUVA 3L7ZC 3HFZB 3S1QH 1JB7A 1G291 3HKZG 4C3IH 1JE5A 4DK6C 2WFWA 5FJ8H 1OXUA 3PCOB 4DNIA 3G48A 1DGSA 5IE8A 3M4QA 4YWLA 3J7ZC 3F2DA 2RCNA 3K0XA 1D8LA 3I7FA 3W1BA 2PQAB 3A0JA 1FVIA 2WAQG 4GNXC 1EQQA 4YHHL 2UUAQ 1V9PA 4JI1L 1UWVA 3T1HQ 2R93G 4DAYB 1X56A 3F8TA 4YCWA 5C44H 1N34L 2Y0SG 2CFMA 3F2CA 1VQ8A 1CSQA 3ULJA 5IT9c 1OTCA 5M3FH 4HJ9A 4BY1H 1TWAH 3NENA 4ME3A 4JI6L 3S1MH 4R4QA 1H95A 1Q81C 3AYHB 2YV5A 3EN2A 4UY8C 3H3VI 4O2DA 2K5NA 5IYCG 2JA5H 3HOVG 4BBRG 3K7UC 2VUMH 3E0EA 3CXCA 3PF5A 3STBD 2AHOB 3HOYH 1QUQA 3CCLA 1KRSA 2FXQA 5M3MG 1WOCA 4TVAB 2MO1A 1PA6A 1E22A 1EFWA 4YY3L 1I50H 4UP9A 4GNXA 3CCMA 4QL5A 5IWAQ 3RNUA 4X62L 4DV1L 4DUYL 2HHHL 1JMCA 2AWNA 3UE0A 3BZCA 3EIVA 1S3OA 3FP9A 3OTOQ 4A75A 2NVQH 3CCVA 1XNQQ 1NTGA 3RZOH 4RMFA 1GD7A 4DV4Q 2WB1E 1PYSB 4KHPL 2YTYA 5C4XH 1KHIA 1Q1EA 2QGQA 1VQ7A 4BXXH 1E1OA 2MO0A 3PGZA 4IJLA 1M90C 4GS3A 2ZJQA 3HOUG 3I4OA 2K14A 4DV6Q 2K5HA 1K0RA 1W2BA 1S40A 3S17H 1B7YB 4LFCL 3G71A 2D62A 4X66L 3A5UA 2PQAA 2R7DA 4B3SL 3H0GH 1B8AA 4DR1L 2ID0A 1L2FA 3H15A 1SFOH 1XMOQ 1PHJA 2I0QA 1X65A 3RR5A 4BXXG 2VQFQ 4LF8L 4OWXB 1PV4A 5H1SE 1HJPA 3F2BA 3PO2G 4POGA 1YHBA 1O7IA 1C0AA 4X6AH 4LF9Q 4IFDI 1VQHA 4H02A 1L1OC 4HJ5A 2F4VL 3H3VH 3GTPH 2HT1A 4J15A 4GKKL 3HOXG 1Z47A 4DV7Q 4A3IH 1FL0A 3L2PA 2Q2IA 1S72A 1I5FA 3GTOH 4LF5L 1C7YA 1VQDA 2IY5B 3BZKA 1IBLL 1N32L 3KDFB 2OTJA 1X6OA 3AQQA 3KF6B 1LUZA 2WB1G 4A3KH 4JI7L 5E7NA 2ZTEA 5M5XH 2IX0A 3JC66 4JI3Q 1UE6A 3ICEA 2YTXA 4NB3A 4A93H 4OWTB 2HIVA 3PF4A 1BBWA 2E8GA 1Q7YC 4BBRH 4LFAQ 4R1JA 1K3RA 1E3PA 4HIKA 4LF4Q 2UXCL 1Q1BA 1E7ZA 1GVPA 3ER0A 4X64Q 5EAYA 4DR4L 4OONA 4P75A 2NVXH 5GADC 3CP0A 1B70B 1YJ9A 2VY3A 2GN5A 3CMEA 1EYGA 2Q2TA 1L1OA 3KJOA 1N9WA 5C44G 2NVYH 1NMGA 4A3EH 1K9MC 1VQLA 1EOVA 3K81C 4IPGA 3CCUA 1CKNB 3ULPA 5M3FG 4BY1G 4LF6L 3PUWA 1N33Q 4JCVE 2IT1A 1RL2A 1W3SA 3RZDH 3PV0A 1IXRA 4B3TL 3J81i 3HOUH 1N34Q 4BA2I 1AE3A 2I5LX 1EWIA 3E9HA 3NBHB 4MTNA 3J80i 3TREA 1N36L 2JA5G 2ATWA 3CCJA 1R9TH 3HOYG 1LM0A 1BBUA 4JOIC 2RF4A 1CKOA 4LWCA 1PH5A 4R4OA 2CWAA 1WFQA 4DV2Q 1YVCA 2KHJA 2ZM6L 4B3ML 2Z6KC 5LMNW 4QY7A 2BA1A 1OXXK 1YEZA 3J81j 3M3YH 3I55A 3KDFA 4P72A 2UXBL 3KF6A 2N78A 3M4PA 3ERSX 4UP8A 4DR5L 5DLQE 4YY3Q 3K7AH 2E2IH 1VQCA 5C4XG 1HR0W 1XPUA 2HHHQ 1VQ4A 1WYDA 3J81c 4IJHA 4DUYQ 1U0LA 4DPGA 2IX1A 3J80c 4AQYL 1ASZA 4R4CA 2OQKA 4Y7NH 2VZAA 3PSIA 1AH9A 5HGQA 4UP7A 3CPWA 4JBMA 4A3BH 4KHPQ 2NZHA 3H0GG 4A3CH 4BY7H 3GD7A 1V43A 2D0OA 5J3BA 3RLOA 3OW2A 1SMXA 1X54A 3I2ZA 4JI0L 4NPSA 4TQUS 3RN2A 4X65Q 1CUKA 1KL9A 2R7FA 1VQIA 4LFCQ 4NXNL 1CKNA 2AMCB 2C35B 3S24A 4B3SQ 1FJGL 3RN5A 5C0XI 4DR1Q 5K36G 1UE5A 4DV0L 1HH2P 4A3IG 4K0KL 2OQ0A 4UPAA 1BVSA 2UU9Q 4L5SA 2PI2E 4EX5A 1IBML 2YU9H 1A0IA 4EQ5A 5HY6A 3S1NH 4JV5L 1E24A 4DV3L 4PZ7A 4JI4L 3CMAA 4A3KG 2F4VQ 4DKAC 1GM5A 1OXSC 1X3FA 1UEBA 2K75A 2VW9A 3CC2A 4BA1I 4A93G 2XGTA 4YCVA 1L0WA 5LMUL 4LF5Q 1J5EL 4NXML 3DLLA 3T1YQ 4DAMA 2VQEQ 1YJNA 1YJWA 4JI7Q 4OXPA 1Y1VH 3K8AA 4GKJL 3G6EA 3CPFA 2R7ZH 1TWGH 3DM3A 3PO3H 2ZJRA 5AJ3Q 4LFBQ 2CKZB 2H5XA 4A3EG 4JI2L 4JYAQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q82 C;  4DR4 Q;  4BBS H;  4IOC A;  1K8G A;  4JBW A;  4P71 A;  5BR8 L;  1YI2 A;  4B3R L;  1L1O B;  1QZH A;  3WWV A;  4IFD J;  1HNZ L;  4DV5 L;  1YHA A;  2JEB I;  4FDB A;  3CD6 A;  4IFD G;  1LTL A;  3IRB A;  2A19 A;  3BU2 A;  3SGI A;  4DR2 Q;  3U58 A;  4P74 A;  4GN4 B;  4A3L H;  3GO5 A;  2KHI A;  2AWO A;  2OCE A;  1PH6 A;  4GLV B;  2LSS A;  2ES2 A;  5JJK A;  3STB C;  2JA8 H;  1PH7 A;  2RHQ B;  4B3T Q;  4JI8 L;  4GLX A;  1YHQ A;  1N36 Q;  4GN5 A;  3BJU A;  1OXT A;  2MFI A;  2N3S A;  2JA7 H;  4LUO A;  1KD1 C;  1Q12 A;  3CW2 C;  4WJ4 A;  4OO1 G;  4XIG S;  2UUB L;  2ALY B;  4OX9 Q;  1SE8 A;  1A63 A;  3D0F A;  1G6P A;  2PNH A;  2HQL A;  2MQH A;  1WCM G;  3A5Z B;  1KAW A;  1J6Q A;  2I5M X;  3AFP A;  1PH2 A;  1P8L A;  3S2H H;  1SRU A;  4OWW B;  1HNW L;  2JJQ A;  1HNX Q;  1PH1 A;  4JBK A;  2UXB Q;  1ASY A;  2K4K A;  5IYD H;  4DR5 Q;  2JA6 G;  4A3D H;  1JT8 A;  2UUA L;  3T1H L;  4A3B G;  5FLM H;  2K52 A;  4A3C G;  4BY7 G;  3FHW A;  4A3G H;  4AYB E;  4GOP C;  2VL6 A;  2UUC L;  3GTG H;  1VQJ A;  2EXD A;  5C3E H;  1AE2 A;  1EQR A;  1VQB A;  1QVG A;  1IBK L;  1IYJ B;  1VQP A;  4QIW E;  1G51 A;  1MJE A;  4JG2 A;  4JI0 Q;  2EQS A;  1M1K C;  2PMZ E;  4A3J H;  3W5O A;  4NXN Q;  3GTL H;  1KC8 C;  4GLA C;  3JAM i;  5IY0 A;  1FJG Q;  2JEA I;  4YHH Q;  4JI1 Q;  4DV0 Q;  3UDF A;  4R4T A;  5IWA L;  3CQZ H;  1JJ2 A;  1NJI C;  4APV A;  3UE1 A;  5M5W H;  1IBM Q;  4MNO A;  1XNQ L;  1NMF A;  1XMQ L;  3U4Z A;  4JI6 Q;  1BKB A;  4DV3 Q;  4JI4 Q;  4R4I A;  1N8R C;  1Y1V G;  2GVB A;  1TXY A;  3I4M H;  4C3H H;  2R7Z G;  4AYB G;  5LMU Q;  4NXM Q;  3PO3 G;  4HIO A;  4YCU A;  2I5H A;  3GTQ H;  1XTD A;  3S16 H;  1YIJ A;  4DUZ L;  1SN8 A;  4BBS G;  3KF8 B;  4LUZ A;  3M4O H;  2NN6 I;  1UE7 A;  1WCM H;  3JAM c;  3GTM H;  2KBN A;  3CAM A;  3EBE A;  3NEM A;  4ALP A;  2DGY A;  3HOW H;  2VQF L;  4LF7 L;  1U5K A;  4X62 Q;  3TEH B;  4DV1 Q;  1VQM A;  5GAG C;  1QZG A;  4JI2 Q;  5C0X J;  1PH8 A;  2MNA A;  3HOZ H;  2JA6 H;  2BH8 A;  1PH9 A;  5C0X G;  4B3R Q;  4A3L G;  1VQK A;  4JOI A;  4KHZ A;  2Z0S A;  1E1T A;  4QJF A;  4HJA A;  2UXD L;  2JA8 G;  4P73 A;  1Q46 A;  1SR3 A;  2JA7 G;  1YIT A;  2QEX A;  2Z6K A;  2Q2U A;  2B3G A;  3S15 H;  4GN3 B;  4X66 Q;  4C3J H;  3TS2 A;  4JI3 L;  1Q86 C;  1Y1W H;  4DR7 L;  2NZO A;  1PYB A;  4LUV A;  2V1C C;  1HZ9 A;  1XNR L;  3S2D H;  4LFA L;  5LMN L;  4QGU A;  4LF8 Q;  1VS0 A;  3TS0 A;  1HZB A;  1RIP A;  3Q8D A;  3TQY A;  4LF4 L;  1MJC A;  2K5V A;  3ULL A;  2VS1 A;  4O0A A;  1YZ6 A;  3I4N H;  1OXV A;  2UUB Q;  4PMW A;  4JC0 A;  5IYD G;  1V1Q A;  5JEA J;  4A3D G;  4GKK Q;  1KIX A;  1HR0 L;  3PUZ A;  5FLM G;  3S1R H;  5IP9 H;  1QVF A;  5JEA G;  3CF5 A;  5IYB H;  1K8A C;  1IBL Q;  4A3G G;  1N32 Q;  1EUJ A;  1QVC A;  1HNW Q;  4PZ8 A;  3J7A 5;  1GKH A;  1MKH A;  3FKI H;  1N33 L;  3CCQ A;  5C3E G;  4JBJ A;  1JJC B;  4JI5 L;  2CCZ A;  2IHF A;  3CC7 A;  3PIO A;  3GDE A;  4PG3 A;  3AEV A;  1I6H H;  1IZ6 A;  2UXC Q;  1HZC A;  4A3J G;  3GTJ H;  1KXL A;  1NY4 A;  1VQG A;  2UUC Q;  1D7Q A;  3PUY A;  5GAH C;  2E5L L;  1I3Q H;  4DV2 L;  1IBK Q;  4DR6 L;  1C9O A;  1EIF A;  2PI2 A;  1A8V A;  3B6Y A;  1SRO A;  1I94 L;  4DR3 L;  1PH3 A;  1VQF A;  3KOJ A;  3KYH C;  1TWC H;  2CQO A;  4YWM A;  3U50 C;  5FLX c;  2L15 A;  4A3M H;  2WP8 J;  1YBY A;  5IP7 H;  4A3F H;  4LF6 Q;  1JJG A;  4HID A;  2LXJ A;  1X3E A;  1Z9F A;  2R92 H;  5JJL A;  4RG1 A;  3I4M G;  3AFQ A;  2N49 A;  5ELN A;  3CCR A;  1NE3 A;  1TWH H;  1CKM A;  1X3G A;  1X55 A;  2ZTD A;  3RLN A;  4HJ8 A;  2IHE A;  2R6G A;  3NEL A;  3PIP A;  3VDY A;  1XMQ Q;  2B63 H;  4GOP B;  2DUD A;  3KFU A;  1VQN A;  2JK8 A;  4KI0 A;  3GTK H;  3HOW G;  2ZM6 Q;  4B3M Q;  3G4S A;  1PH4 A;  4X65 L;  3PUX A;  3OYY A;  4DUZ Q;  1YNX A;  1SLJ A;  4XTC S;  2E2H H;  2KEN A;  2OWO A;  2BA0 A;  3HOZ G;  1Q8K A;  4Y52 H;  2UU9 L;  2F3I A;  5GAE C;  4LF7 Q;  3RLF A;  1MIU A;  4AIM A;  5M5Y H;  4AQY Q;  3TRZ A;  4POF A;  1T9H A;  2A1A A;  2JA9 A;  1LYL A;  3UDI A;  1VQO A;  1IL2 A;  3I56 A;  4IO9 A;  2R93 H;  1Y1W G;  4DK3 C;  3HKS A;  1VQ5 A;  1EIY B;  2UXD Q;  2KCT A;  4KLK A;  3T1Y L;  2YYZ A;  2Q2H A;  2VQE L;  1NBW A;  1A62 A;  3MEF A;  1XPR A;  4L5Q A;  1HZA A;  2HIX A;  2RHS B;  1VQ9 A;  3E9I A;  3I4N G;  4DR7 Q;  4OO1 I;  2AKW B;  3L0O A;  3KJP A;  2VNU D;  5IYC H;  1XNR Q;  5FJ8 G;  3HOV H;  5AJ3 L;  1K83 H;  5ELO A;  4K0K Q;  5GRO A;  5LMN Q;  4LFB L;  4QQB X;  3D31 A;  1PVO A;  3OTO L;  5IP9 G;  4A76 A;  5IYB G;  4JYA L;  4JV5 Q;  5M3M H;  4IPC A;  1FGU A;  3F1Z A;  2NN6 G;  4DV4 L;  2ZTC A;  3FKI G;  4GOP A;  3CCE A;  1WJJ A;  2F52 A;  3KLW A;  1HR0 Q;  2EIF A;  2NVT H;  2A8V A;  1J5E Q;  1GO3 E;  4DV6 L;  4L5R C;  2CWP A;  2XTI A;  2N8N A;  1XPO A;  4C2M H;  4DR2 L;  5C4J H;  4PZ6 A;  3K80 C;  4GKJ Q;  5GQO A;  1KRT A;  4IOA A;  1VQ6 A;  2D0P A;  1XMO L;  3HKZ E;  2KCM A;  2QA4 A;  1UE1 A;  1KQS A;  4JI5 Q;  2OTL A;  3UDX A;  4MZ9 A;  2VUM G;  3MXN B;  3ZJY C;  1K73 C;  4LF9 L;  3M7N A;  2BH2 A;  2JE6 I;  5JJI A;  4LW1 A;  1WI5 A;  1PFS A;  5BR8 Q;  4OX9 L;  2YTV A;  5IP7 G;  4IPD A;  3M9B A;  4A3F G;  2WAQ E;  3CCS A;  4DV7 L;  4A3M G;  2E5L Q;  4WJ3 M;  2R92 G;  4DR6 Q;  4AH6 A;  1XJV A;  4DV5 Q;  1I94 Q;  1HNZ Q;  4DR3 Q;  3PO2 H;  4LNQ A;  3U4V A;  4HIM A;  3W1G A;  2JQO A;  1X9N A;  1VQE A;  1QUQ B;  2Y0S E;  3S14 H;  1HNX L;  1P16 A;  3CC4 A;  2GVA A;  3LGJ A;  4L5T A;  2ZJP A;  1VQA A;  2ASB A;  3A74 A;  3HOX H;  1CSP A;  2B63 G;  2B29 A;  4GNX B;  1TWF H;  4HJ7 A;  1Y14 B;  2K50 A;  4YWK A;  4JI8 Q;  2E2J H;  4A4I A;  2LXK A;  3UDG A;  4X64 L;  1VCI A;  3M85 A;  4IPH A;  3PUV A;  3L7Z C;  3HFZ B;  3S1Q H;  1JB7 A;  1G29 1;  3HKZ G;  4C3I H;  1JE5 A;  4DK6 C;  2WFW A;  5FJ8 H;  1OXU A;  3PCO B;  4DNI A;  3G48 A;  1DGS A;  5IE8 A;  3M4Q A;  4YWL A;  3J7Z C;  3F2D A;  2RCN A;  3K0X A;  1D8L A;  3I7F A;  3W1B A;  2PQA B;  3A0J A;  1FVI A;  2WAQ G;  4GNX C;  1EQQ A;  4YHH L;  2UUA Q;  1V9P A;  4JI1 L;  1UWV A;  3T1H Q;  2R93 G;  4DAY B;  1X56 A;  3F8T A;  4YCW A;  5C44 H;  1N34 L;  2Y0S G;  2CFM A;  3F2C A;  1VQ8 A;  1CSQ A;  3ULJ A;  5IT9 c;  1OTC A;  5M3F H;  4HJ9 A;  4BY1 H;  1TWA H;  3NEN A;  4ME3 A;  4JI6 L;  3S1M H;  4R4Q A;  1H95 A;  1Q81 C;  3AYH B;  2YV5 A;  3EN2 A;  4UY8 C;  3H3V I;  4O2D A;  2K5N A;  5IYC G;  2JA5 H;  3HOV G;  4BBR G;  3K7U C;  2VUM H;  3E0E A;  3CXC A;  3PF5 A;  3STB D;  2AHO B;  3HOY H;  1QUQ A;  3CCL A;  1KRS A;  2FXQ A;  5M3M G;  1WOC A;  4TVA B;  2MO1 A;  1PA6 A;  1E22 A;  1EFW A;  4YY3 L;  1I50 H;  4UP9 A;  4GNX A;  3CCM A;  4QL5 A;  5IWA Q;  3RNU A;  4X62 L;  4DV1 L;  4DUY L;  2HHH L;  1JMC A;  2AWN A;  3UE0 A;  3BZC A;  3EIV A;  1S3O A;  3FP9 A;  3OTO Q;  4A75 A;  2NVQ H;  3CCV A;  1XNQ Q;  1NTG A;  3RZO H;  4RMF A;  1GD7 A;  4DV4 Q;  2WB1 E;  1PYS B;  4KHP L;  2YTY A;  5C4X H;  1KHI A;  1Q1E A;  2QGQ A;  1VQ7 A;  4BXX H;  1E1O A;  2MO0 A;  3PGZ A;  4IJL A;  1M90 C;  4GS3 A;  2ZJQ A;  3HOU G;  3I4O A;  2K14 A;  4DV6 Q;  2K5H A;  1K0R A;  1W2B A;  1S40 A;  3S17 H;  1B7Y B;  4LFC L;  3G71 A;  2D62 A;  4X66 L;  3A5U A;  2PQA A;  2R7D A;  4B3S L;  3H0G H;  1B8A A;  4DR1 L;  2ID0 A;  1L2F A;  3H15 A;  1SFO H;  1XMO Q;  1PHJ A;  2I0Q A;  1X65 A;  3RR5 A;  4BXX G;  2VQF Q;  4LF8 L;  4OWX B;  1PV4 A;  5H1S E;  1HJP A;  3F2B A;  3PO2 G;  4POG A;  1YHB A;  1O7I A;  1C0A A;  4X6A H;  4LF9 Q;  4IFD I;  1VQH A;  4H02 A;  1L1O C;  4HJ5 A;  2F4V L;  3H3V H;  3GTP H;  2HT1 A;  4J15 A;  4GKK L;  3HOX G;  1Z47 A;  4DV7 Q;  4A3I H;  1FL0 A;  3L2P A;  2Q2I A;  1S72 A;  1I5F A;  3GTO H;  4LF5 L;  1C7Y A;  1VQD A;  2IY5 B;  3BZK A;  1IBL L;  1N32 L;  3KDF B;  2OTJ A;  1X6O A;  3AQQ A;  3KF6 B;  1LUZ A;  2WB1 G;  4A3K H;  4JI7 L;  5E7N A;  2ZTE A;  5M5X H;  2IX0 A;  3JC6 6;  4JI3 Q;  1UE6 A;  3ICE A;  2YTX A;  4NB3 A;  4A93 H;  4OWT B;  2HIV A;  3PF4 A;  1BBW A;  2E8G A;  1Q7Y C;  4BBR H;  4LFA Q;  4R1J A;  1K3R A;  1E3P A;  4HIK A;  4LF4 Q;  2UXC L;  1Q1B A;  1E7Z A;  1GVP A;  3ER0 A;  4X64 Q;  5EAY A;  4DR4 L;  4OON A;  4P75 A;  2NVX H;  5GAD C;  3CP0 A;  1B70 B;  1YJ9 A;  2VY3 A;  2GN5 A;  3CME A;  1EYG A;  2Q2T A;  1L1O A;  3KJO A;  1N9W A;  5C44 G;  2NVY H;  1NMG A;  4A3E H;  1K9M C;  1VQL A;  1EOV A;  3K81 C;  4IPG A;  3CCU A;  1CKN B;  3ULP A;  5M3F G;  4BY1 G;  4LF6 L;  3PUW A;  1N33 Q;  4JCV E;  2IT1 A;  1RL2 A;  1W3S A;  3RZD H;  3PV0 A;  1IXR A;  4B3T L;  3J81 i;  3HOU H;  1N34 Q;  4BA2 I;  1AE3 A;  2I5L X;  1EWI A;  3E9H A;  3NBH B;  4MTN A;  3J80 i;  3TRE A;  1N36 L;  2JA5 G;  2ATW A;  3CCJ A;  1R9T H;  3HOY G;  1LM0 A;  1BBU A;  4JOI C;  2RF4 A;  1CKO A;  4LWC A;  1PH5 A;  4R4O A;  2CWA A;  1WFQ A;  4DV2 Q;  1YVC A;  2KHJ A;  2ZM6 L;  4B3M L;  2Z6K C;  5LMN W;  4QY7 A;  2BA1 A;  1OXX K;  1YEZ A;  3J81 j;  3M3Y H;  3I55 A;  3KDF A;  4P72 A;  2UXB L;  3KF6 A;  2N78 A;  3M4P A;  3ERS X;  4UP8 A;  4DR5 L;  5DLQ E;  4YY3 Q;  3K7A H;  2E2I H;  1VQC A;  5C4X G;  1HR0 W;  1XPU A;  2HHH Q;  1VQ4 A;  1WYD A;  3J81 c;  4IJH A;  4DUY Q;  1U0L A;  4DPG A;  2IX1 A;  3J80 c;  4AQY L;  1ASZ A;  4R4C A;  2OQK A;  4Y7N H;  2VZA A;  3PSI A;  1AH9 A;  5HGQ A;  4UP7 A;  3CPW A;  4JBM A;  4A3B H;  4KHP Q;  2NZH A;  3H0G G;  4A3C H;  4BY7 H;  3GD7 A;  1V43 A;  2D0O A;  5J3B A;  3RLO A;  3OW2 A;  1SMX A;  1X54 A;  3I2Z A;  4JI0 L;  4NPS A;  4TQU S;  3RN2 A;  4X65 Q;  1CUK A;  1KL9 A;  2R7F A;  1VQI A;  4LFC Q;  4NXN L;  1CKN A;  2AMC B;  2C35 B;  3S24 A;  4B3S Q;  1FJG L;  3RN5 A;  5C0X I;  4DR1 Q;  5K36 G;  1UE5 A;  4DV0 L;  1HH2 P;  4A3I G;  4K0K L;  2OQ0 A;  4UPA A;  1BVS A;  2UU9 Q;  4L5S A;  2PI2 E;  4EX5 A;  1IBM L;  2YU9 H;  1A0I A;  4EQ5 A;  5HY6 A;  3S1N H;  4JV5 L;  1E24 A;  4DV3 L;  4PZ7 A;  4JI4 L;  3CMA A;  4A3K G;  2F4V Q;  4DKA C;  1GM5 A;  1OXS C;  1X3F A;  1UEB A;  2K75 A;  2VW9 A;  3CC2 A;  4BA1 I;  4A93 G;  2XGT A;  4YCV A;  1L0W A;  5LMU L;  4LF5 Q;  1J5E L;  4NXM L;  3DLL A;  3T1Y Q;  4DAM A;  2VQE Q;  1YJN A;  1YJW A;  4JI7 Q;  4OXP A;  1Y1V H;  3K8A A;  4GKJ L;  3G6E A;  3CPF A;  2R7Z H;  1TWG H;  3DM3 A;  3PO3 H;  2ZJR A;  5AJ3 Q;  4LFB Q;  2CKZ B;  2H5X A;  4A3E G;  4JI2 L;  4JYA Q; 
#chains in the Genus database with same CATH topology
 4BBS H;  1K8G A;  4JBW A;  1YI2 A;  2QDB A;  1YNJ D;  4P2C B;  2I46 A;  3WWV A;  4DV5 L;  1VF7 A;  1YHA A;  5C44 B;  4OEM B;  4DAV A;  4IFD G;  1RJT A;  2SNM A;  3SGI A;  3UI2 A;  1FNU A;  1GUT A;  3BS1 A;  1IW7 C;  2AWO A;  2A69 D;  2OCE A;  4GLV B;  5JJK A;  4JI8 L;  1YHQ A;  1N36 Q;  1ICW A;  1E2V A;  2MFI A;  3RUZ A;  4IUT A;  1ENF A;  2P5Z X;  4OX9 Q;  1LTR D;  1SE8 A;  3D0F A;  3MVV A;  3A5Z B;  4C1N I;  1J6Q A;  1SNP A;  2C9O A;  1II3 A;  4H13 C;  4XT3 B;  2A68 C;  1HNX Q;  1PH1 A;  2UXB Q;  3MFY A;  2K4K A;  4L8J A;  2JA6 G;  3T1H L;  4A3B G;  5C4X B;  3FHW A;  4K6D A;  4N8X 1;  5EPL A;  5JEA H;  4A3G H;  4KY6 A;  2K04 A;  4GOP C;  4FNF A;  1BUV T;  3GTG H;  5C3E H;  1F2M A;  1QVG A;  4KN7 C;  1G51 A;  1STH A;  5TSS A;  3SVM A;  1MJE A;  4JI0 Q;  1HXY D;  2EQS A;  4L6T B;  3WDN A;  4NXN Q;  3QOL A;  3GTL H;  4GLA C;  2RVL A;  3G6J B;  5IY0 A;  2JEA I;  3UDF A;  1VDZ A;  4R4T A;  4EQN A;  4A3I B;  1IBM Q;  3UE1 A;  4FVM A;  4MNO A;  3S2H B;  2NUC A;  4MHE A;  4JI6 Q;  1BKB A;  4JI4 Q;  1N8R C;  1U9R A;  2O2L D;  1MI2 A;  2XN9 C;  3I4M H;  2R7Z G;  4NXM Q;  2I5H A;  4JK1 C;  1XTD A;  3S16 H;  4DXF A;  2J0T D;  5EBD A;  4LUZ A;  5KYI A;  1O7L A;  3L9A X;  2NN6 I;  1UE7 A;  3EBE A;  4K8I A;  1XXG A;  2F0I A;  5HUR A;  4ALP A;  2VQF L;  1PH8 A;  1AN8 A;  2WII B;  4KJN A;  2MNA A;  1PH9 A;  5C0X G;  3VR2 A;  1NR2 A;  4CHT B;  4QJF A;  1R4Q B;  4FXD A;  3CQZ B;  2JA7 G;  2D2C C;  2Z6K A;  3S15 H;  4X66 Q;  1R9T B;  4C3J H;  1S5F D;  1LT4 D;  4LFA L;  4QGU A;  1VS0 A;  3TS0 A;  3Q8D A;  3ULL A;  2HDL A;  4PMW A;  1S5D D;  1V1Q A;  4N8F A;  4A3D G;  1I4Q A;  1WCM B;  3GP7 A;  3PUZ A;  5FLM G;  2E2I B;  5IYB H;  4KMU C;  1BNZ A;  3D6W A;  4PZ8 A;  2BOS A;  4WOR A;  4Y7N B;  1GKH A;  2NN6 H;  4C1N K;  3LWU A;  1N33 L;  1WTO A;  4JBJ A;  2B39 A;  4H7B A;  1FNV A;  2EOT A;  1JJC B;  5KNB A;  4JI5 L;  4BY7 B;  1U4P A;  2XIW A;  3PIO A;  3AB9 A;  3GDE A;  2IJ0 A;  4PG3 A;  1HZC A;  4RAU C;  1TU2 B;  1KXL A;  2L9H A;  1VQG A;  2ZT9 C;  3A55 A;  1GHK A;  1I3Q H;  4WJW A;  5C5L A;  1IW7 D;  1CA5 A;  1SRO A;  2F0O A;  1B44 D;  1PH3 A;  1PTO H;  3KOJ A;  4RGO S;  2WP8 J;  4XYQ A;  1JJG A;  4HID A;  2LXJ A;  2R92 H;  5EPJ A;  3KLS X;  4RG1 A;  4KKU A;  3S1R B;  5ELN A;  4HJ8 A;  4DK0 A;  2ZTD A;  3RLN A;  1YNN D;  1S5B D;  3NEL A;  1XMQ Q;  4ME5 A;  2A68 D;  2DUD A;  1EIH A;  5E1F A;  3GTK H;  1TWG B;  3HOW G;  2KA7 A;  3PO3 B;  1WTW A;  1KDA A;  1T5E A;  4X65 L;  1ENC A;  3HZX A;  4XTC S;  3MZ5 A;  4QIW B;  1SND A;  5GAE C;  2K5W A;  1MIU A;  5M5Y H;  1T9H A;  1LYL A;  3I56 A;  4LAA A;  4IO9 A;  4KN4 C;  2R93 H;  1ML0 D;  4DK3 C;  2M9V A;  1EYC A;  2F0Q A;  2UXD Q;  2KCT A;  4KLK A;  2Q2H A;  2F0U A;  1DOK A;  2RHS B;  3E9I A;  4DR7 Q;  4IN3 A;  5KNC A;  3KJP A;  5IYC H;  1AFP A;  3K59 A;  3HOV H;  1K83 H;  3I3C A;  3MEH A;  2F0V A;  4A76 A;  4QB4 A;  5LL6 X;  3FKI G;  4GOP A;  1WJJ A;  3KLW A;  1HR0 Q;  2NVT H;  3NTK A;  4K2L A;  1O80 A;  2CWP A;  2K05 A;  5CV9 A;  1NCV A;  2NZ1 D;  2B2W C;  2PPB C;  2WV6 D;  1KRT A;  3SK5 A;  1XYI A;  3HKZ E;  2QA4 A;  4Q5V A;  2F0L A;  5DM7 3;  4A3J B;  5BR8 Q;  1PFS A;  4BXX H;  5IP7 G;  2WAQ E;  3CCS A;  4WJ3 M;  1XX8 A;  4DR6 Q;  5I6Y A;  4DR3 Q;  3U4V A;  1X9N A;  2JQO A;  1H9R A;  1QUQ B;  2Y0S E;  3S14 H;  3DWQ A;  1SYF A;  2DNC A;  2B63 G;  2B29 A;  4GNX B;  1TWF H;  3W2D A;  4XYO A;  2L55 A;  3NTI A;  4PMB A;  4A4I A;  2LXK A;  1SSO A;  5KYL A;  1ZXT A;  3L7Z C;  3EFX D;  2PW7 A;  1JB7 A;  5FO9 B;  1OXU A;  3GTM B;  4ODG A;  2FHT A;  5EKK A;  5IE8 A;  3M4Q A;  2RCN A;  1TR5 A;  2A6E C;  1B1Z A;  2XSC A;  2UUA Q;  1UWV A;  4YCW A;  1A2T A;  1MBY A;  1N34 L;  1JE4 A;  2OT2 A;  1CSQ A;  3SHL A;  1QIL A;  4IUN A;  1UAP A;  2YV5 A;  1Y1W B;  4BS9 A;  1GXD C;  1IYV A;  1LTS D;  1WTH A;  3K5N A;  4BBR G;  3K7U C;  4RHR A;  3CXC A;  3STB D;  2AHO B;  5C4H A;  3HOY H;  2FXQ A;  4TVA B;  3I4N B;  1E22 A;  1EFW A;  2OXP A;  1I4H A;  1LAB A;  1JMC A;  5ELB A;  3OTO Q;  4I7Z C;  1LAC A;  1D5M C;  1XNQ Q;  2F0K A;  3RZO H;  4KHP L;  1KHI A;  1Q1E A;  2QGQ A;  5ELE A;  2K32 A;  3I4O A;  4WFN 3;  3S17 H;  1NR4 A;  2IL8 A;  1B7Y B;  3FVQ A;  3A5U A;  1TWA B;  3MXU A;  4PV1 C;  3IAY A;  4B3S L;  1PHJ A;  4DR1 L;  1L2F A;  3H15 A;  1XMO Q;  2SNS A;  3QR8 A;  2XRQ D;  3JAM E;  1HJP A;  3PO2 G;  1LLR D;  4IFD I;  1D1I A;  1BO0 A;  1S4Z A;  4HCE A;  2RA4 A;  4A3M B;  4J15 A;  1FL0 A;  5IGF A;  3L2P A;  1S72 A;  3P7J A;  1C7Y A;  1TT2 A;  1IBL L;  3A8I E;  5IGG A;  3T4A C;  3KDF B;  1X6O A;  4A3K H;  2ZTE A;  3JC6 6;  1UE6 A;  4NB3 A;  4A93 H;  4I7A A;  2E8G A;  3I91 A;  5HGT A;  2B2T C;  4LF4 Q;  2UXC L;  4DR4 L;  2NVX H;  5GAD C;  3CP0 A;  3T56 B;  5LHY 1;  2Q2T A;  5KIX A;  4NMZ A;  5C44 G;  2WKC A;  4KY5 A;  5EKI A;  2PQE A;  4A3E H;  1CI3 M;  3C3L A;  3K81 C;  4IPG A;  1CKN B;  5I9P A;  4LF6 L;  3BVM A;  2A6H C;  1RL2 A;  3R2I A;  3HOU H;  4B3T L;  3IKJ A;  3E5S A;  1AE3 A;  2I5L X;  4IUV A;  4JBK A;  4IFD H;  2B2Y A;  3T53 B;  4JOI C;  4LWC A;  4O42 A;  3VA7 A;  2CWA A;  4DV2 Q;  4B3M L;  1NSN S;  3V96 A;  1YEZ A;  3J81 j;  3KF6 A;  2N78 A;  3M4P A;  5M3M B;  4DR5 L;  1EOT A;  1QE6 A;  5DLQ E;  5FLX E;  3K7A H;  1HFG A;  2B2W A;  5C4X G;  1HR0 W;  1XPU A;  3J81 c;  2PW5 A;  2IX1 A;  4AQY L;  2OQK A;  1EZ6 A;  3J7Y W;  1I4X A;  3VR6 A;  5HGQ A;  4A3B H;  2A6E D;  5EJW A;  1HRJ A;  2D9U A;  1V43 A;  3GD7 A;  2D0O A;  5J3B A;  1SMX A;  3I2Z A;  4FP5 D;  5CMD A;  1EY5 A;  4HSV A;  1CUK A;  1KL9 A;  1VQI A;  3PMF A;  3S24 A;  5K5P A;  2F0J A;  5C0X I;  5K36 G;  1UE5 A;  4DV0 L;  4DGZ A;  4A3I G;  3H6M A;  1H9S A;  1BVS A;  4NDX A;  1PRT B;  3I72 A;  2YU9 H;  3I8Z A;  1VMC A;  4DV3 L;  3D4R A;  1X3F A;  1UEB A;  2K75 A;  4ZKC B;  4YCV A;  1L0W A;  5LMU L;  1HQR D;  5I2Y A;  4LF5 Q;  3T1Y Q;  2QF7 A;  1YJN A;  2WB1 B;  3HEJ A;  3KF8 A;  4GKJ L;  2R7Z H;  4C3I B;  2PCF B;  5AJ3 Q;  4LFB Q;  2CKZ B;  1FNW A;  4JYA Q;  3QB3 A;  1Q82 C;  1C8C A;  2BE5 D;  2MJ8 A;  3EQL C;  1CT1 D;  2VB3 X;  2HDM A;  3LX0 A;  1HNZ L;  1IHZ A;  1SJH D;  2K28 A;  4DNT B;  3CD6 A;  1PXU A;  2MHV A;  5JVG 3;  1LTL A;  3IRB A;  2A19 A;  3BDC A;  3VA5 A;  5C0X H;  3S1M B;  3GO5 A;  2KHI A;  1PH6 A;  2LSS A;  1PH7 A;  2RHQ B;  3NPP A;  2C5C A;  3GV3 A;  2JA7 H;  3BJU A;  1OXT A;  2N3S A;  1SDF A;  2R3Z A;  3DWA A;  1LT6 D;  3CW2 C;  1PZI D;  4XIG S;  3TZU A;  2UUB L;  4RWS C;  5DEH A;  1WCM G;  2I5M X;  1PH2 A;  1P8L A;  2Z8L A;  1SRU A;  1HNW L;  3C1F A;  1ASY A;  4A3D H;  1JT8 A;  4J1M A;  2AQ3 B;  5FLM H;  2K52 A;  2F0N A;  4BY7 G;  5FK9 C;  3DMU A;  1L0Y B;  3T16 A;  3K58 A;  2VL6 A;  3EVQ A;  2UUC L;  1AE2 A;  1EQR A;  3H0G B;  1VQB A;  3NQT A;  1SFO B;  5D3D A;  1IBK L;  4ZLT F;  1EU4 A;  4DU9 A;  2EVB A;  2PZW A;  1HUM A;  2WKD A;  3TME A;  1JOQ A;  3J81 L;  3JAM i;  3J7A V;  1FJG Q;  4YHH Q;  3GTP B;  1G6Z A;  2AQ1 B;  1NJI C;  1W6J A;  3KUP A;  2B2T A;  3U4Z A;  1SYC A;  1JOK A;  1XTC D;  4DNR B;  5KRU A;  2FFK B;  2O4X A;  4IUR A;  3PO3 G;  4HIO A;  3GTQ H;  1ILP A;  1HHV A;  2SEB D;  3NBI A;  4X3K A;  1SN8 A;  3KLR A;  3KF8 B;  2KBN A;  3HOW H;  4X62 Q;  3TEH B;  1VQM A;  2NVY B;  4R9W A;  1QZG A;  2NYZ D;  4HAE A;  3TP5 A;  3GTL B;  4JOI A;  4KY7 A;  4HSP A;  2DY7 A;  4HJA A;  3RZD B;  3F2U A;  1Q46 A;  1F2Z A;  2QEX A;  3DM1 A;  4RGN A;  1PYB A;  5I4D A;  3I70 A;  1XNR L;  5FOB B;  5LMN L;  3I4M B;  3I90 A;  1HZB A;  1A2U A;  1RIP A;  2F1M A;  3TQY A;  2E2D C;  1MJC A;  2EY5 A;  4RA8 A;  1YZ6 A;  1EIG A;  5IYD G;  4K6L A;  5JEA J;  5FLX L;  4GKK Q;  2AQ2 B;  4ZKB B;  1BXT A;  3G7L A;  1QVF A;  1EUJ A;  3IL8 A;  3CU7 A;  4DA2 A;  3FKI H;  1SYB A;  1RF2 D;  2EZV A;  4CKE A;  1I6H H;  1CQF A;  4A3J G;  2AUK A;  1TS2 A;  1NY4 A;  2A5H A;  2R61 A;  1PDQ A;  1C9O A;  1I94 L;  1VQF A;  4CJ2 C;  3P20 A;  2RDG A;  3KYH C;  2K03 A;  3U50 C;  5IP7 H;  1WD1 A;  1X3E A;  4RCO A;  1SYG A;  2IHE A;  3PIP A;  2B63 H;  1Y1V B;  3KFU A;  1VQN A;  4KI0 A;  4H44 C;  4AYB B;  5G3L F;  3G4S A;  5FO8 B;  1SXT A;  3PUX A;  1CA6 A;  5AFW A;  2E2H H;  2KEN A;  4RKL A;  4Y52 H;  1I3Q B;  2F3I A;  5J22 A;  2PMZ B;  1CM9 A;  3MHB A;  1PFN A;  4AIM A;  5A2Q L;  3TRZ A;  4POF A;  2RCF A;  2A1A A;  3J80 E;  3TP6 A;  1Y1W G;  1IL8 A;  4PMC A;  1EIY B;  2JA8 B;  2VQE L;  2TMP A;  1NBW A;  1QJO A;  1A62 A;  1XPR A;  3PIO 3;  4KJO A;  3I4N G;  2XVS A;  5ELO A;  1PVO A;  3X3M A;  5IP9 G;  1X3Q A;  1TQO A;  4JV5 Q;  1FGU A;  1JWS D;  5JJZ A;  1ESR A;  2ZTC A;  5IT9 E;  1EWC A;  2F52 A;  1R4P B;  2EIF A;  1EY0 A;  3U9S A;  4OIJ A;  4DV6 L;  1XWE A;  4XDX A;  4CDE C;  1GJX A;  1KLU D;  3FMC A;  2MPM A;  5LL6 S;  1AEX A;  3QOJ A;  4C2M H;  5C4J H;  1LT5 D;  3A7L A;  1CTM A;  5GQO A;  4IOA A;  1K3B C;  1UNS A;  2Y0S B;  3OWF A;  3Q22 A;  4JI5 Q;  1PFM A;  1F2L A;  2K1B A;  5G3L D;  3M7N A;  3ZJY C;  4LF9 L;  2JE6 I;  4LW1 A;  1WI5 A;  4OX9 L;  4A3M G;  4IPD A;  4N9T A;  2PNR C;  4A3F G;  1I6V C;  1MSG A;  4KK7 A;  3PO2 H;  1K83 B;  4LNQ A;  3W1G A;  1VQE A;  5M5W B;  1B3A A;  1HNX L;  1P16 A;  1RTN A;  2GVA A;  3LGJ A;  4L5T A;  1LTG D;  2V4D A;  2ASB A;  1CSP A;  4GZY C;  1Y14 B;  2K50 A;  4C3H B;  2E2J H;  3E0J A;  1GOZ A;  3OMG A;  1EYA A;  3D4D A;  3OIQ A;  4HCS A;  1VCI A;  1SE4 A;  3HFZ B;  3S1Q H;  1C48 A;  1JE5 A;  1ENA A;  5FJ8 H;  3M4O B;  4X3S A;  3G48 A;  1RDP D;  2OEO A;  3KK7 A;  2F0D A;  1D8L A;  1KDC A;  2ENB A;  3ND8 A;  3W1B A;  1FVI A;  3HOZ B;  1O7Y A;  4KV6 A;  5C44 H;  1QCB D;  1WD0 A;  2CFM A;  3KLS A;  3F2C A;  2Q8R E;  4X3U A;  1VQ8 A;  5IT9 c;  1AZQ A;  1STB A;  4JI6 L;  4JW0 A;  2CH4 W;  2EYO A;  2Z6B A;  2NTS A;  3T51 B;  4UY8 C;  2K5N A;  3S2D B;  1WTP A;  3Q0A A;  3R93 A;  2VUM H;  1EY8 A;  3OHX C;  2Q8T A;  1QUQ A;  1AZP A;  3CCL A;  5M3M G;  1WOC A;  1CHP D;  1LV9 A;  2EJM A;  4O1N A;  5T1I A;  4YY3 L;  1PA6 A;  2O5J C;  4LJZ C;  1I50 H;  1DD2 A;  4GNX A;  2SOB A;  4QL5 A;  1TII D;  1PRT C;  5IWA Q;  3BZC A;  3FP9 A;  2JYO A;  1Y8N B;  4DFA A;  2A73 B;  1X32 A;  3A8K E;  5C4X H;  1M4V A;  3FDT A;  3K5L A;  1WTV A;  1IYU A;  2K14 A;  2CH4 A;  2K5H A;  4LFC L;  4X66 L;  2OF1 A;  2CW0 C;  3GTJ B;  2F3W A;  2I0Q A;  1X65 A;  4EQO A;  4V0B A;  2ZXP A;  1C0A A;  4UAI A;  1TWC B;  1VQH A;  5I9O A;  5K36 H;  4ZQ3 A;  4A3I H;  1Z47 A;  1JCK B;  1I5F A;  3BG3 A;  4HED A;  3K5M A;  4KHV A;  1TWH B;  2HUG A;  1S5C D;  2WB1 G;  4JI7 L;  1B9N A;  3C2P A;  2IX0 A;  4JI3 Q;  2YTX A;  1QNK A;  4C3I G;  4OWT B;  2HIV A;  4HMJ A;  1BBW A;  1ICF B;  2L4N A;  3LNN A;  4R1J A;  1K3R A;  2B2Y C;  4CKC A;  2MGS A;  2B2U A;  4J8Q A;  4OON A;  4P75 A;  1G91 A;  3KBX A;  2RDF A;  3I4L A;  1ZEQ X;  1EYG A;  3KJO A;  3NE5 B;  3SK8 A;  1EOV A;  3CCU A;  4FF1 A;  3J80 L;  3SE0 A;  3TSS A;  2LMC B;  1N34 Q;  2E74 C;  3E9H A;  1EWI A;  3J80 i;  2D5D A;  2F03 A;  1R9T H;  3BZD B;  3QG1 A;  1PH5 A;  4R4O A;  3RMH A;  1YVC A;  4CKB A;  1VMP A;  4QY7 A;  3GV6 A;  3IFD A;  5CR3 A;  2MUY A;  3KDF A;  4P72 A;  1LO5 D;  3H3V C;  3FRP B;  3I73 A;  4UP8 A;  5IT9 L;  2E2I H;  2FMC A;  4IUU A;  2AUJ D;  4QUC A;  4IUQ A;  4Y7N H;  3BVG A;  3NTH A;  3PSI A;  4UP7 A;  4KHP Q;  3H0G G;  4BY7 H;  5CV4 A;  3OW2 A;  1JWU D;  3HOU B;  4KD3 A;  4KTA A;  4NPS A;  3RN2 A;  3QO2 A;  2L12 A;  1CKN A;  3NSW A;  4B3S Q;  3RN5 A;  1B9M A;  4DR1 Q;  4K5W A;  1HH2 P;  2UU9 Q;  1J8I A;  4L5S A;  5I6W A;  4QF4 A;  2CVR A;  2F0H A;  1SNM A;  5HY6 A;  1QWY A;  4PZ7 A;  1EQV A;  3CMA A;  1OXS C;  2VW9 A;  3HOX B;  3CC2 A;  5EKL A;  4BA1 I;  2XGT A;  4EQP A;  2NTT A;  3NWS A;  4TSS A;  2A74 C;  3S9W A;  3FPU B;  4HR7 B;  4OXP A;  4CJ0 B;  3AU7 A;  2F0E A;  5FO7 B;  4A3B B;  1TWG H;  3DM3 A;  3PO3 H;  4G7H C;  1TVX A;  2QW7 A;  3FPP A;  1HPC A;  1MKH A;  4JI2 L;  4DR4 Q;  2ZXO A;  4IOC A;  4P71 A;  5BR8 L;  4G4K A;  4B3R L;  1NNX A;  2DNE A;  2F0W A;  1D5X C;  2CW0 D;  4IFD J;  2Q8I B;  4EGV A;  1A15 A;  2KVM A;  2JEB I;  3BU2 A;  4DR2 Q;  2YU9 B;  2LKV A;  4P74 A;  5M3F B;  4BY1 B;  1Q8I A;  1IKM A;  1Y69 U;  4U67 3;  2J4X A;  4FXK C;  4B3T Q;  4GLX A;  2JA5 B;  4GN5 A;  3P75 A;  4LUO A;  1Q12 A;  4FXG C;  3CKI B;  1A63 A;  1LTT D;  1G6P A;  2PNH A;  2HQL A;  2MQH A;  2F0P A;  3O13 A;  4KKT A;  1JOO A;  4OWW B;  1EY7 A;  2G5D A;  4YIJ A;  5IYD H;  3VYS A;  4N9P A;  4DR5 Q;  2UUA L;  2QEJ C;  5CC4 A;  4CBV A;  3MAQ A;  3W3A A;  3SEB A;  5IIF A;  4IAL A;  2KCC A;  3VR3 A;  4OL7 A;  1VF5 C;  1WTQ A;  3OOC A;  1VQJ A;  1O78 A;  1LTA D;  2DJG C;  1VQP A;  2FIN B;  4QIW E;  4JG2 A;  4A3J H;  4JI1 Q;  4DV0 Q;  1RKN A;  1JJ2 A;  1XNQ L;  1NMF A;  4K2K A;  1STY A;  2B2V C;  4DV3 Q;  5M5X B;  1Y1V G;  4EVO A;  2GVB A;  1TXY A;  4AYB G;  1LTB D;  5LMU Q;  4YCU A;  1Q90 A;  2B8G A;  4DUZ L;  1HA5 A;  3QWN A;  3NXW A;  1SNC A;  2EYL A;  3JAM c;  3GTM H;  3CAM A;  4LF7 L;  3TP7 A;  1U5K A;  4DV1 Q;  5GAG C;  3OIP A;  5C0X J;  1GUO A;  2JA6 H;  2BH8 A;  4K14 A;  1JR0 D;  1VQK A;  4A3L G;  2QDL A;  2Z0S A;  2JA8 G;  4P73 A;  3R8B A;  1SR3 A;  5DNF A;  1YIT A;  1LTI D;  2B3G A;  4QCL A;  1Y1W H;  4LUV A;  1RTO A;  4DK1 A;  1A3T A;  4LF8 Q;  3FEW X;  4LF4 L;  2K5V A;  4BWG B;  2VS1 A;  1PMR A;  4O0A A;  3I4N H;  3M3Y B;  1DYQ A;  2UUB Q;  3QIA A;  3TN2 A;  4JC0 A;  1RHP A;  1KIX A;  4RH6 A;  2DN8 A;  2H4O A;  5IP9 H;  2LS0 1;  1K8A C;  2EYP A;  1N32 Q;  1QVC A;  1TY2 A;  1HNW Q;  3DHQ A;  3J7A 5;  1ET9 A;  4E6I A;  3AEV A;  3M4Y A;  4RCN A;  3MXN A;  1GHJ A;  3ERO A;  2UUC Q;  1D7Q A;  3PUY A;  2E5L L;  3HS0 C;  4DV2 L;  1IBK Q;  2E75 C;  3VR5 A;  2L11 A;  4S3S A;  3CHB D;  2CQO A;  4YWM A;  5FLX c;  1PFB A;  2L15 A;  4A3M H;  3S1N B;  3H94 A;  1M8A A;  4A3F H;  3K0Y A;  5JJL A;  4V19 0;  2F0F A;  4C3H G;  4CJ1 B;  3AFQ A;  2N49 A;  1JB3 A;  3NUC A;  2Z1C A;  1NE3 A;  1X3G A;  1CKM A;  1MD2 D;  5JPN C;  3SK6 A;  4NW2 A;  5DM6 3;  2KHS A;  2ZM6 Q;  1SMY C;  1X3P A;  3OYY A;  1I6H B;  1YNX A;  5KEE A;  3HOZ G;  4BBS B;  5EQ0 A;  3A56 A;  3ERQ A;  1BF4 A;  5COY A;  4DAY A;  4DN4 M;  5I2X A;  2KJX A;  3HGB A;  1D2B A;  1EU3 A;  1IL2 A;  1VQO A;  1PZJ D;  1BCP B;  4B9X A;  1VQ5 A;  2A6H D;  3JAM L;  2WIN B;  3T1Y L;  2YYZ A;  2EDG A;  4L5Q A;  1HZA A;  4OO1 I;  1HTL D;  3L0O A;  2B63 B;  2IW3 A;  2VNU D;  1FR3 A;  1XNR Q;  1A3U A;  5AJ3 L;  4K0K Q;  1KNA A;  5LMN Q;  4LFB L;  4JYA L;  1SAP A;  1W6K A;  1D5Z C;  5M3M H;  2EY6 A;  4DV4 L;  4K5X A;  2E2H B;  4OIK A;  3CCE A;  2A8V A;  1J5E Q;  4A3G B;  4CDF C;  2EY1 A;  4L5R C;  4Z9C B;  2H1E A;  2EE1 A;  5IGE A;  3K80 C;  3GTG B;  2D0P A;  2NBF A;  5C3E B;  2KCM A;  1UE1 A;  1KQS A;  4B08 A;  4PNY A;  2OTL A;  3UDX A;  2RSN A;  3MXN B;  1K73 C;  2HCC A;  3R3O A;  4XXE A;  1T5X D;  3M9B A;  3ZYY X;  4DV7 L;  2B2V A;  3E3X A;  1Z6H A;  1UEA B;  4AH6 A;  3C46 A;  4DV5 Q;  1I94 Q;  5EPK A;  4G57 A;  1QG7 A;  3WOE A;  4KD4 A;  2N88 A;  3ND9 A;  1GUS A;  2ZJP A;  1VQA A;  2IWH A;  1K28 A;  5F2D A;  3EJI A;  4HJ7 A;  4YWK A;  4JI8 Q;  3NK9 A;  3UDG A;  1E0B A;  4OHJ A;  4X64 L;  3S16 B;  3PUV A;  1G29 1;  1B50 A;  1HCZ A;  4C3I H;  4DK6 C;  3QJY A;  2WFW A;  5D14 A;  3PCO B;  2N55 A;  1DGS A;  3J7Z C;  3F2D A;  3K0X A;  2PQA B;  1ZKO A;  3A0J A;  4GNX C;  1EQQ A;  4YHH L;  1V9P A;  3T1H Q;  1F9P A;  4DAY B;  1X56 A;  3F8T A;  1Y8P B;  1TKW B;  4ZYS A;  2EY2 A;  3ULJ A;  4HJ9 A;  1QNU A;  3NEN A;  3S1M H;  4ME3 A;  1H95 A;  3S15 B;  4C3J B;  3AYH B;  2DJF C;  1Q81 C;  3EN2 A;  2KED A;  3H3V I;  4HTH A;  3E0E A;  5COR A;  2E2J B;  3D6C A;  1KRS A;  1STE A;  3A7A B;  1HUN A;  2QCP X;  2MO1 A;  3S1Q B;  1F2Y A;  1V1P B;  4UP9 A;  3CCM A;  1H9K A;  4X62 L;  3RNU A;  4DUY L;  2HHH L;  3UE0 A;  2M2L A;  2NVQ H;  4A75 A;  1JOR A;  1NTG A;  3M7G A;  1SMY D;  5BN5 A;  2G9D A;  1A3V A;  1PYS B;  2WB1 E;  4ZK9 B;  3HRZ C;  2X69 A;  3PGZ A;  1M90 C;  4IJL A;  4GS3 A;  3HOU G;  1F9S A;  1HTP A;  1F77 A;  4DV6 Q;  1W2B A;  1S40 A;  2D62 A;  2R7D A;  3H0G H;  1B8A A;  1SFO H;  2ID0 A;  3RR5 A;  2B2U C;  2VQF Q;  4OWX B;  3F2B A;  4POG A;  1YHB A;  2VUM B;  1O7I A;  2Z9H A;  5IGB A;  1PTO B;  4LF9 Q;  5EBC A;  1MSH A;  5IOD A;  2IPK D;  4H02 A;  4HJ5 A;  4Q0F A;  2F4V L;  2M00 A;  3GTP H;  3H3V H;  2K5Q A;  2HT1 A;  4GKK L;  3HOX G;  3GTO H;  1I50 B;  2R92 B;  1U4M A;  1YNN C;  4L63 B;  5IGD A;  2IY5 B;  2OTJ A;  3AQQ A;  1RD9 D;  5E7N A;  3ICE A;  2RDH A;  3PF4 A;  4BBR H;  1JQY D;  4LFA Q;  5IOC A;  3GTK B;  4RFB A;  1E3P A;  4HIK A;  1E7Z A;  1QB5 D;  5EAY A;  2Z4I A;  1TS5 A;  3HKZ B;  2VY3 A;  2GN5 A;  1L1O A;  2NVY H;  1VQL A;  5M5Y B;  4FO2 A;  5M3F G;  4BY1 G;  2WAQ B;  2F0T A;  5NUC A;  3PUW A;  1ET6 A;  1N33 Q;  2R93 B;  1W3S A;  3RZD H;  1DZ1 A;  3PV0 A;  1I4G A;  2JA5 G;  1JC7 A;  3T13 A;  3NWT A;  4MTN A;  4DF7 A;  1N36 L;  2TSS A;  2ATW A;  3CCJ A;  2RQX A;  3VYR A;  3NP8 A;  1CKO A;  2X6G A;  1HFN A;  1Z7T A;  3HOV B;  5LMN W;  3R2T A;  1AW7 A;  2BA1 A;  2UXB L;  1FD7 D;  3I55 A;  1B3Q A;  1CZG A;  3KBG A;  4TKO B;  1CZW A;  4YY3 Q;  1TS4 A;  1VQC A;  3BYT B;  1WYD A;  2NVT B;  1U0L A;  4DPG A;  3J80 c;  1ASZ A;  4R4C A;  2VZA A;  1BBX C;  1AH9 A;  4F8M A;  4JBM A;  4CGY B;  1EY6 A;  1DCZ A;  5E3F A;  1ONL A;  2B8F A;  4UHV A;  4JI0 L;  1RCV D;  4X65 Q;  3J7A F;  4LFC Q;  2G9H D;  2R7F A;  4NXN L;  1DOM A;  1E2Z A;  2C35 B;  2EYJ A;  2F3V A;  3EA6 A;  3SK4 A;  1ILQ A;  4EX5 A;  1IBM L;  1BR9 A;  2K01 A;  5C3W A;  3S14 B;  4EQ5 A;  4JV5 L;  4JI4 L;  4F87 A;  3U9O A;  4DKA C;  3HP3 A;  1H9J A;  4NXM L;  1CK1 A;  1TWF B;  3DLL A;  2PO4 A;  1YJW A;  4JI7 Q;  1Y1V H;  3TBI B;  3K8A A;  3G6E A;  3CPF A;  4IQZ A;  1DM0 B;  1Q3L A;  1E1O A;  3OMC A;  1KTK A;  3A8J E;  1KDB A;  1V1O A;  3TDQ A;  1SE2 A;  1B4O A;  3K57 A;  3SR1 A;  1L1O B;  2BDO A;  1QZH A;  3N6R A;  4C56 C;  4FDB A;  3U58 A;  1CQV A;  2JSO A;  4IZ8 A;  4GN4 B;  4A3L H;  1SJE D;  4K8J A;  2ES2 A;  3STB C;  2JA8 H;  3DEP A;  1KD1 C;  5C3X A;  3HOY B;  4WJ4 A;  4OO1 G;  1KAA A;  3MC0 B;  4JPB W;  1KAB A;  2ALY B;  2F4I A;  1UUP A;  1KAW A;  2HCI A;  3AFP A;  4FF3 A;  3S2H H;  2JJQ A;  1ZYR C;  4I65 A;  4ABN A;  3RZO B;  1O7Z A;  4A3C G;  2BCO A;  4AYB E;  1GUG A;  3OPO A;  3S17 B;  2BDN A;  3URY A;  2EXD A;  4OEL B;  1HQM C;  1IYJ B;  4R8N A;  3BVZ A;  1M1K C;  2PMZ E;  3W5O A;  2KQ3 A;  1CFM A;  1QOH A;  1KC8 C;  2F0M A;  1EWH A;  2ICE C;  1SNO A;  3L3O C;  3CRL C;  5IWA L;  2X6L A;  3CQZ H;  1PRT F;  4APV A;  5M5W H;  3V2T A;  5J39 A;  1XMQ L;  1BCP C;  4R4I A;  5ISR A;  4A3K B;  4C3H H;  4A93 B;  1EFI D;  2IX3 A;  1HA6 A;  5CBA E;  1EY9 A;  2ZXR A;  1YIJ A;  1G8Z D;  4MIU A;  3GQB A;  4BBS G;  3OSO A;  3M4O H;  4HN7 A;  2NVX B;  1WCM H;  3NEM A;  2DGY A;  1D1K A;  2K5D A;  3V05 A;  4A3E B;  2XWB B;  4JI2 Q;  1I4P A;  2VB2 X;  1SNQ A;  3HOZ H;  4B3R Q;  5CV7 A;  4KHZ A;  4ZRZ A;  1E1T A;  2UXD L;  5A35 A;  4F88 A;  5CV6 A;  3DXJ C;  4A3E G;  2I07 B;  1SBB B;  2Q2U A;  4GN3 B;  3TS2 A;  1PZK D;  2SDF A;  4RGM A;  4JI3 L;  1Q86 C;  4DR7 L;  2NZO A;  4G7O C;  2V1C C;  1HZ9 A;  3S2D H;  4JVZ A;  2RKS A;  4G7Z C;  2EYM A;  2EYF A;  1OXV A;  3CRK C;  1HR0 L;  3K7A B;  3RD4 A;  3S1R H;  3BDL A;  5FKA C;  4A3G G;  1C4Q A;  1H9M A;  5JEA G;  3CF5 A;  1IBL Q;  5E4X A;  1LT3 D;  1PRT D;  4FF4 A;  5L37 A;  2JA6 B;  3CCQ A;  1IKL A;  5C3E G;  2EPB A;  1U4L A;  3MWY W;  2CCZ A;  2IHF A;  4M1U B;  3MXP A;  3CC7 A;  4CDC C;  3D3R A;  1JWM D;  2UXC Q;  1IZ6 A;  2QIL A;  3GTJ H;  4ID6 A;  1BCP F;  5GAH C;  4WRD A;  4DR6 L;  1EIF A;  2PI2 A;  1A8V A;  3B6Y A;  4DR3 L;  5DAU A;  3OWE B;  5CBE E;  1TWC H;  5EGT A;  1E2W A;  4LF6 Q;  1YBY A;  2L0C A;  4TRD A;  2L1B A;  1Z9F A;  2NB0 A;  1DXM A;  3H09 A;  3I4M G;  4MN3 A;  4OGQ C;  1TWH H;  3CCR A;  1X55 A;  2F0G A;  1EEF D;  3VDY A;  2R6G A;  1SE3 A;  4GOP B;  1ZYR D;  2JK8 A;  4CDD C;  1J9O A;  2R7Z B;  4B3M Q;  2BE5 C;  2NWG A;  2E76 C;  1PH4 A;  4DUZ Q;  1FYC A;  5D65 A;  1SLJ A;  2OWO A;  3MTS A;  2BA0 A;  4U68 A;  1Q8K A;  3ITP A;  3VYT A;  2UU9 L;  4LF7 Q;  5BN4 A;  3RLF A;  2JXM B;  4AQY Q;  1MGS A;  3J81 E;  2JA9 A;  3UDI A;  4C3J G;  1EY4 A;  3Q24 A;  4A3F B;  3HKS A;  2EJG C;  3BDO A;  2JA7 B;  1EL0 A;  3MEF A;  3WOF A;  1VQ9 A;  2HIX A;  4FYD A;  4ZAI A;  5JPM C;  2AKW B;  1BOS A;  1CHQ D;  5M9O A;  5FJ8 G;  1BCP D;  5GRO A;  4QQB X;  3D31 A;  3OTO L;  1PTO C;  5IYB G;  1STG A;  4IPC A;  3F1Z A;  2NN6 G;  3LWE A;  4A3D B;  2CQA A;  4RKB A;  2RSO A;  3OW7 A;  5KGU A;  1GO3 E;  2XTI A;  5BN3 A;  2N8N A;  1XPO A;  4DR2 L;  5CV8 A;  4PZ6 A;  5CV5 A;  5CYU A;  4ZCK A;  4XQQ A;  1TS3 A;  4XQJ A;  4GKJ Q;  1VQ6 A;  1XMO L;  2KCN A;  3SDZ A;  4HMI A;  4FF2 A;  1NUC A;  4MZ9 A;  2VUM G;  5JVH 3;  3N52 A;  2BH2 A;  4NP5 A;  5C6A A;  5JJI A;  3IFT A;  1Y8O B;  2J7Z A;  3A54 A;  2YTV A;  2E5L Q;  2R92 G;  2HD3 A;  1XJV A;  1HNZ Q;  1OO9 B;  4HIM A;  3HG9 A;  2DY8 A;  3CC4 A;  2XWJ B;  2XRS D;  3MA2 B;  3DEO A;  3A74 A;  3HOX H;  1GUW A;  2EJF C;  2KOL A;  2KEC A;  3DUZ A;  2PZT A;  3GTQ B;  1ESF A;  1K8M A;  3M85 A;  4IPH A;  3HKZ G;  2QKI C;  1EQT A;  4DNI A;  2PYK A;  3HOW B;  4YWL A;  4ILW A;  5JOB A;  1WVL A;  3H91 A;  4MTK A;  3TP8 A;  1G2T A;  2WAC A;  3I7F A;  4H0L C;  2K33 A;  2WAQ G;  2RBM A;  4JI1 L;  2R93 G;  5E4W C;  2Y0S G;  1K8O A;  3NBH A;  1S5E D;  1PTO F;  5T1G A;  1OTC A;  5M3F H;  3MXG A;  4BY1 H;  1TWA H;  1SYD A;  4R4Q A;  4RGT A;  4QMG A;  4O2D A;  5IYC G;  4XT1 B;  1G2S A;  2JA5 H;  3HOV G;  4K5V A;  3PF5 A;  3SXH A;  4IUP A;  1B53 A;  2JP1 A;  2GA4 B;  2EXZ A;  5KND A;  4DV1 L;  1GUN A;  2AWN A;  4NKL A;  3EIV A;  1S3O A;  2HQE A;  3MFG A;  4QUF A;  3CCV A;  4PQX A;  4RMF A;  4XQN A;  1GD7 A;  4DV4 Q;  3D4W A;  3FKI B;  2YTY A;  1VQ7 A;  2VXW A;  1PLF A;  2MO0 A;  2ZJQ A;  3TZD A;  4DAP A;  2XNA C;  4X3T A;  5A2Q E;  3P1H A;  1YNJ C;  1K0R A;  3G71 A;  1WTX A;  2PQA A;  1I4R A;  3PQI A;  4BXX G;  4KKS A;  4LF8 L;  1WTR A;  1PV4 A;  5H1S E;  3NHH A;  4X6A H;  2LFN A;  2A69 C;  2K6A A;  3X3N A;  2O5I C;  3VYU A;  1L1O C;  2LY7 A;  1STA A;  4DV7 Q;  2Q2I A;  4LF5 L;  1VQD A;  3BZK A;  4ZUI A;  3AMU A;  1N32 L;  2ICI A;  2NVQ B;  3KF6 B;  3E6Z X;  1LUZ A;  5M5X H;  1PTO D;  1D6E C;  5IGC A;  4UDU C;  4LMQ D;  1NAP A;  1Q7Y C;  1V1P A;  4B9W A;  1AP0 A;  1A6X A;  1Q1B A;  1TY0 A;  1GVP A;  3ER0 A;  4X64 Q;  1EZ8 A;  1STN A;  1L0X B;  3Q6S A;  2CHB D;  1YJ9 A;  1B70 B;  3CME A;  1N9W A;  1K9M C;  1NMG A;  3BYY B;  1JIC A;  1EEI D;  2K7V A;  4J6H A;  3ULP A;  3Q23 A;  2PZU A;  1KNE A;  4JCV E;  2IT1 A;  5ELF A;  3PIP 3;  5ELC A;  1H9S B;  1B2T A;  1IXR A;  4BA2 I;  3J81 i;  1SYE A;  4ULL A;  3GTO B;  3NBH B;  4F7X A;  3TRE A;  3HOY G;  1LM0 A;  1BBU A;  2RF4 A;  2FMM A;  1WFQ A;  2F0S A;  3VR4 A;  2KHJ A;  2ZM6 L;  4BBR B;  2Z6K C;  1F9R A;  4M8A A;  2KEE A;  1KLG D;  2Z4H A;  1OXX K;  5CGK A;  3M3Y H;  4OO1 H;  3ERS X;  2EYH A;  5C5M A;  3D8G A;  3DWP A;  5J1Z A;  2HHH Q;  1PYW D;  1VQ4 A;  4DUY Q;  4IJH A;  2FJ2 A;  5JAV A;  5C4Z A;  1DJR D;  4C2M B;  5C4J B;  3CPW A;  1V8Q A;  2NZH A;  4A3C H;  3ONA B;  3RLO A;  4ZUJ A;  1X54 A;  2MP1 A;  1FGB D;  4TQU S;  5D3I B;  1F9Q A;  2AMC B;  4R8I A;  1FJG L;  4K0K L;  2OQ0 A;  4UPA A;  2PI2 E;  3K6O A;  1DOL A;  3PO2 B;  1ROD A;  1A0I A;  3NQI A;  1K0S A;  3S1N H;  1E24 A;  4DXG A;  3K5O A;  2F4V Q;  4A3K G;  1GM5 A;  2KUM A;  2L5T A;  4LK1 C;  4A93 G;  1SEB D;  1J5E L;  1BQQ T;  3C1E A;  4DAM A;  2VQE Q;  5ELD A;  2JN4 A;  1BDO A;  1DON A;  2ZJR A;  4RHS A;  1EYD A;  1U4R A;  2H5X A;  1MHW C; 
#chains in the Genus database with same CATH homology
 1Q82 C;  4DR4 Q;  4BBS H;  4IOC A;  1K8G A;  4JBW A;  4P71 A;  5BR8 L;  1YI2 A;  4B3R L;  1L1O B;  1QZH A;  3WWV A;  4IFD J;  1HNZ L;  4DV5 L;  1YHA A;  2JEB I;  4FDB A;  3CD6 A;  4IFD G;  1LTL A;  3IRB A;  2A19 A;  3BU2 A;  3SGI A;  4DR2 Q;  3U58 A;  4P74 A;  4GN4 B;  4A3L H;  3GO5 A;  2KHI A;  2AWO A;  2OCE A;  1PH6 A;  4GLV B;  2LSS A;  2ES2 A;  5JJK A;  3STB C;  2JA8 H;  1PH7 A;  2RHQ B;  4B3T Q;  4JI8 L;  4GLX A;  1YHQ A;  1N36 Q;  4GN5 A;  3BJU A;  1OXT A;  2MFI A;  2N3S A;  2JA7 H;  4LUO A;  1KD1 C;  1Q12 A;  3CW2 C;  4WJ4 A;  4OO1 G;  4XIG S;  2UUB L;  2ALY B;  4OX9 Q;  1SE8 A;  1A63 A;  3D0F A;  1G6P A;  2PNH A;  2HQL A;  2MQH A;  1WCM G;  3A5Z B;  1KAW A;  1J6Q A;  2I5M X;  3AFP A;  1PH2 A;  1P8L A;  3S2H H;  1SRU A;  4OWW B;  1HNW L;  2JJQ A;  1HNX Q;  1PH1 A;  4JBK A;  2UXB Q;  1ASY A;  2K4K A;  5IYD H;  4DR5 Q;  2JA6 G;  4A3D H;  1JT8 A;  2UUA L;  3T1H L;  4A3B G;  5FLM H;  2K52 A;  4A3C G;  4BY7 G;  3FHW A;  4A3G H;  4AYB E;  4GOP C;  2VL6 A;  2UUC L;  3GTG H;  1VQJ A;  2EXD A;  5C3E H;  1AE2 A;  1EQR A;  1VQB A;  1QVG A;  1IBK L;  1IYJ B;  1VQP A;  4QIW E;  1G51 A;  1MJE A;  4JG2 A;  4JI0 Q;  2EQS A;  1M1K C;  2PMZ E;  4A3J H;  3W5O A;  4NXN Q;  3GTL H;  1KC8 C;  4GLA C;  3JAM i;  5IY0 A;  1FJG Q;  2JEA I;  4YHH Q;  4JI1 Q;  4DV0 Q;  3UDF A;  4R4T A;  5IWA L;  3CQZ H;  1JJ2 A;  1NJI C;  4APV A;  3UE1 A;  5M5W H;  1IBM Q;  4MNO A;  1XNQ L;  1NMF A;  1XMQ L;  3U4Z A;  4JI6 Q;  1BKB A;  4DV3 Q;  4JI4 Q;  4R4I A;  1N8R C;  1Y1V G;  2GVB A;  1TXY A;  3I4M H;  4C3H H;  2R7Z G;  4AYB G;  5LMU Q;  4NXM Q;  3PO3 G;  4HIO A;  4YCU A;  2I5H A;  3GTQ H;  1XTD A;  3S16 H;  1YIJ A;  4DUZ L;  1SN8 A;  4BBS G;  3KF8 B;  4LUZ A;  3M4O H;  2NN6 I;  1UE7 A;  1WCM H;  3JAM c;  3GTM H;  2KBN A;  3CAM A;  3EBE A;  3NEM A;  4ALP A;  2DGY A;  3HOW H;  2VQF L;  4LF7 L;  1U5K A;  4X62 Q;  3TEH B;  4DV1 Q;  1VQM A;  5GAG C;  1QZG A;  4JI2 Q;  5C0X J;  1PH8 A;  2MNA A;  3HOZ H;  2JA6 H;  2BH8 A;  1PH9 A;  5C0X G;  4B3R Q;  4A3L G;  1VQK A;  4JOI A;  4KHZ A;  2Z0S A;  1E1T A;  4QJF A;  4HJA A;  2UXD L;  2JA8 G;  4P73 A;  1Q46 A;  1SR3 A;  2JA7 G;  1YIT A;  2QEX A;  2Z6K A;  2Q2U A;  2B3G A;  3S15 H;  4GN3 B;  4X66 Q;  4C3J H;  3TS2 A;  4JI3 L;  1Q86 C;  1Y1W H;  4DR7 L;  2NZO A;  1PYB A;  4LUV A;  2V1C C;  1HZ9 A;  1XNR L;  3S2D H;  4LFA L;  5LMN L;  4QGU A;  4LF8 Q;  1VS0 A;  3TS0 A;  1HZB A;  1RIP A;  3Q8D A;  3TQY A;  4LF4 L;  1MJC A;  2K5V A;  3ULL A;  2VS1 A;  4O0A A;  1YZ6 A;  3I4N H;  1OXV A;  2UUB Q;  4PMW A;  4JC0 A;  5IYD G;  1V1Q A;  5JEA J;  4A3D G;  4GKK Q;  1KIX A;  1HR0 L;  3PUZ A;  5FLM G;  3S1R H;  5IP9 H;  1QVF A;  5JEA G;  3CF5 A;  5IYB H;  1K8A C;  1IBL Q;  4A3G G;  1N32 Q;  1EUJ A;  1QVC A;  1HNW Q;  4PZ8 A;  3J7A 5;  1GKH A;  1MKH A;  3FKI H;  1N33 L;  3CCQ A;  5C3E G;  4JBJ A;  1JJC B;  4JI5 L;  2CCZ A;  2IHF A;  3CC7 A;  3PIO A;  3GDE A;  4PG3 A;  3AEV A;  1I6H H;  1IZ6 A;  2UXC Q;  1HZC A;  4A3J G;  3GTJ H;  1KXL A;  1NY4 A;  1VQG A;  2UUC Q;  1D7Q A;  3PUY A;  5GAH C;  2E5L L;  1I3Q H;  4DV2 L;  1IBK Q;  4DR6 L;  1C9O A;  1EIF A;  2PI2 A;  1A8V A;  3B6Y A;  1SRO A;  1I94 L;  4DR3 L;  1PH3 A;  1VQF A;  3KOJ A;  3KYH C;  1TWC H;  2CQO A;  4YWM A;  3U50 C;  5FLX c;  2L15 A;  4A3M H;  2WP8 J;  1YBY A;  5IP7 H;  4A3F H;  4LF6 Q;  1JJG A;  4HID A;  2LXJ A;  1X3E A;  1Z9F A;  2R92 H;  5JJL A;  4RG1 A;  3I4M G;  3AFQ A;  2N49 A;  5ELN A;  3CCR A;  1NE3 A;  1TWH H;  1CKM A;  1X3G A;  1X55 A;  2ZTD A;  3RLN A;  4HJ8 A;  2IHE A;  2R6G A;  3NEL A;  3PIP A;  3VDY A;  1XMQ Q;  2B63 H;  4GOP B;  2DUD A;  3KFU A;  1VQN A;  2JK8 A;  4KI0 A;  3GTK H;  3HOW G;  2ZM6 Q;  4B3M Q;  3G4S A;  1PH4 A;  4X65 L;  3PUX A;  3OYY A;  4DUZ Q;  1YNX A;  1SLJ A;  4XTC S;  2E2H H;  2KEN A;  2OWO A;  2BA0 A;  3HOZ G;  1Q8K A;  4Y52 H;  2UU9 L;  2F3I A;  5GAE C;  4LF7 Q;  3RLF A;  1MIU A;  4AIM A;  5M5Y H;  4AQY Q;  3TRZ A;  4POF A;  1T9H A;  2A1A A;  2JA9 A;  1LYL A;  3UDI A;  1VQO A;  1IL2 A;  3I56 A;  4IO9 A;  2R93 H;  1Y1W G;  4DK3 C;  3HKS A;  1VQ5 A;  1EIY B;  2UXD Q;  2KCT A;  4KLK A;  3T1Y L;  2YYZ A;  2Q2H A;  2VQE L;  1NBW A;  1A62 A;  3MEF A;  1XPR A;  4L5Q A;  1HZA A;  2HIX A;  2RHS B;  1VQ9 A;  3E9I A;  3I4N G;  4DR7 Q;  4OO1 I;  2AKW B;  3L0O A;  3KJP A;  2VNU D;  5IYC H;  1XNR Q;  5FJ8 G;  3HOV H;  5AJ3 L;  1K83 H;  5ELO A;  4K0K Q;  5GRO A;  5LMN Q;  4LFB L;  4QQB X;  3D31 A;  1PVO A;  3OTO L;  5IP9 G;  4A76 A;  5IYB G;  4JYA L;  4JV5 Q;  5M3M H;  4IPC A;  1FGU A;  3F1Z A;  2NN6 G;  4DV4 L;  2ZTC A;  3FKI G;  4GOP A;  3CCE A;  1WJJ A;  2F52 A;  3KLW A;  1HR0 Q;  2EIF A;  2NVT H;  2A8V A;  1J5E Q;  1GO3 E;  4DV6 L;  4L5R C;  2CWP A;  2XTI A;  2N8N A;  1XPO A;  4C2M H;  4DR2 L;  5C4J H;  4PZ6 A;  3K80 C;  4GKJ Q;  5GQO A;  1KRT A;  4IOA A;  1VQ6 A;  2D0P A;  1XMO L;  3HKZ E;  2KCM A;  2QA4 A;  1UE1 A;  1KQS A;  4JI5 Q;  2OTL A;  3UDX A;  4MZ9 A;  2VUM G;  3MXN B;  3ZJY C;  1K73 C;  4LF9 L;  3M7N A;  2BH2 A;  2JE6 I;  5JJI A;  4LW1 A;  1WI5 A;  1PFS A;  5BR8 Q;  4OX9 L;  2YTV A;  5IP7 G;  4IPD A;  3M9B A;  4A3F G;  2WAQ E;  3CCS A;  4DV7 L;  4A3M G;  2E5L Q;  4WJ3 M;  2R92 G;  4DR6 Q;  4AH6 A;  1XJV A;  4DV5 Q;  1I94 Q;  1HNZ Q;  4DR3 Q;  3PO2 H;  4LNQ A;  3U4V A;  4HIM A;  3W1G A;  2JQO A;  1X9N A;  1VQE A;  1QUQ B;  2Y0S E;  3S14 H;  1HNX L;  1P16 A;  3CC4 A;  2GVA A;  3LGJ A;  4L5T A;  2ZJP A;  1VQA A;  2ASB A;  3A74 A;  3HOX H;  1CSP A;  2B63 G;  2B29 A;  4GNX B;  1TWF H;  4HJ7 A;  1Y14 B;  2K50 A;  4YWK A;  4JI8 Q;  2E2J H;  4A4I A;  2LXK A;  3UDG A;  4X64 L;  1VCI A;  3M85 A;  4IPH A;  3PUV A;  3L7Z C;  3HFZ B;  3S1Q H;  1JB7 A;  1G29 1;  3HKZ G;  4C3I H;  1JE5 A;  4DK6 C;  2WFW A;  5FJ8 H;  1OXU A;  3PCO B;  4DNI A;  3G48 A;  1DGS A;  5IE8 A;  3M4Q A;  4YWL A;  3J7Z C;  3F2D A;  2RCN A;  3K0X A;  1D8L A;  3I7F A;  3W1B A;  2PQA B;  3A0J A;  1FVI A;  2WAQ G;  4GNX C;  1EQQ A;  4YHH L;  2UUA Q;  1V9P A;  4JI1 L;  1UWV A;  3T1H Q;  2R93 G;  4DAY B;  1X56 A;  3F8T A;  4YCW A;  5C44 H;  1N34 L;  2Y0S G;  2CFM A;  3F2C A;  1VQ8 A;  1CSQ A;  3ULJ A;  5IT9 c;  1OTC A;  5M3F H;  4HJ9 A;  4BY1 H;  1TWA H;  3NEN A;  4ME3 A;  4JI6 L;  3S1M H;  4R4Q A;  1H95 A;  1Q81 C;  3AYH B;  2YV5 A;  3EN2 A;  4UY8 C;  3H3V I;  4O2D A;  2K5N A;  5IYC G;  2JA5 H;  3HOV G;  4BBR G;  3K7U C;  2VUM H;  3E0E A;  3CXC A;  3PF5 A;  3STB D;  2AHO B;  3HOY H;  1QUQ A;  3CCL A;  1KRS A;  2FXQ A;  5M3M G;  1WOC A;  4TVA B;  2MO1 A;  1PA6 A;  1E22 A;  1EFW A;  4YY3 L;  1I50 H;  4UP9 A;  4GNX A;  3CCM A;  4QL5 A;  5IWA Q;  3RNU A;  4X62 L;  4DV1 L;  4DUY L;  2HHH L;  1JMC A;  2AWN A;  3UE0 A;  3BZC A;  3EIV A;  1S3O A;  3FP9 A;  3OTO Q;  4A75 A;  2NVQ H;  3CCV A;  1XNQ Q;  1NTG A;  3RZO H;  4RMF A;  1GD7 A;  4DV4 Q;  2WB1 E;  1PYS B;  4KHP L;  2YTY A;  5C4X H;  1KHI A;  1Q1E A;  2QGQ A;  1VQ7 A;  4BXX H;  1E1O A;  2MO0 A;  3PGZ A;  4IJL A;  1M90 C;  4GS3 A;  2ZJQ A;  3HOU G;  3I4O A;  2K14 A;  4DV6 Q;  2K5H A;  1K0R A;  1W2B A;  1S40 A;  3S17 H;  1B7Y B;  4LFC L;  3G71 A;  2D62 A;  4X66 L;  3A5U A;  2PQA A;  2R7D A;  4B3S L;  3H0G H;  1B8A A;  4DR1 L;  2ID0 A;  1L2F A;  3H15 A;  1SFO H;  1XMO Q;  1PHJ A;  2I0Q A;  1X65 A;  3RR5 A;  4BXX G;  2VQF Q;  4LF8 L;  4OWX B;  1PV4 A;  5H1S E;  1HJP A;  3F2B A;  3PO2 G;  4POG A;  1YHB A;  1O7I A;  1C0A A;  4X6A H;  4LF9 Q;  4IFD I;  1VQH A;  4H02 A;  1L1O C;  4HJ5 A;  2F4V L;  3H3V H;  3GTP H;  2HT1 A;  4J15 A;  4GKK L;  3HOX G;  1Z47 A;  4DV7 Q;  4A3I H;  1FL0 A;  3L2P A;  2Q2I A;  1S72 A;  1I5F A;  3GTO H;  4LF5 L;  1C7Y A;  1VQD A;  2IY5 B;  3BZK A;  1IBL L;  1N32 L;  3KDF B;  2OTJ A;  1X6O A;  3AQQ A;  3KF6 B;  1LUZ A;  2WB1 G;  4A3K H;  4JI7 L;  5E7N A;  2ZTE A;  5M5X H;  2IX0 A;  3JC6 6;  4JI3 Q;  1UE6 A;  3ICE A;  2YTX A;  4NB3 A;  4A93 H;  4OWT B;  2HIV A;  3PF4 A;  1BBW A;  2E8G A;  1Q7Y C;  4BBR H;  4LFA Q;  4R1J A;  1K3R A;  1E3P A;  4HIK A;  4LF4 Q;  2UXC L;  1Q1B A;  1E7Z A;  1GVP A;  3ER0 A;  4X64 Q;  5EAY A;  4DR4 L;  4OON A;  4P75 A;  2NVX H;  5GAD C;  3CP0 A;  1B70 B;  1YJ9 A;  2VY3 A;  2GN5 A;  3CME A;  1EYG A;  2Q2T A;  1L1O A;  3KJO A;  1N9W A;  5C44 G;  2NVY H;  1NMG A;  4A3E H;  1K9M C;  1VQL A;  1EOV A;  3K81 C;  4IPG A;  3CCU A;  1CKN B;  3ULP A;  5M3F G;  4BY1 G;  4LF6 L;  3PUW A;  1N33 Q;  4JCV E;  2IT1 A;  1RL2 A;  1W3S A;  3RZD H;  3PV0 A;  1IXR A;  4B3T L;  3J81 i;  3HOU H;  1N34 Q;  4BA2 I;  1AE3 A;  2I5L X;  1EWI A;  3E9H A;  3NBH B;  4MTN A;  3J80 i;  3TRE A;  1N36 L;  2JA5 G;  2ATW A;  3CCJ A;  1R9T H;  3HOY G;  1LM0 A;  1BBU A;  4JOI C;  2RF4 A;  1CKO A;  4LWC A;  1PH5 A;  4R4O A;  2CWA A;  1WFQ A;  4DV2 Q;  1YVC A;  2KHJ A;  2ZM6 L;  4B3M L;  2Z6K C;  5LMN W;  4QY7 A;  2BA1 A;  1OXX K;  1YEZ A;  3J81 j;  3M3Y H;  3I55 A;  3KDF A;  4P72 A;  2UXB L;  3KF6 A;  2N78 A;  3M4P A;  3ERS X;  4UP8 A;  4DR5 L;  5DLQ E;  4YY3 Q;  3K7A H;  2E2I H;  1VQC A;  5C4X G;  1HR0 W;  1XPU A;  2HHH Q;  1VQ4 A;  1WYD A;  3J81 c;  4IJH A;  4DUY Q;  1U0L A;  4DPG A;  2IX1 A;  3J80 c;  4AQY L;  1ASZ A;  4R4C A;  2OQK A;  4Y7N H;  2VZA A;  3PSI A;  1AH9 A;  5HGQ A;  4UP7 A;  3CPW A;  4JBM A;  4A3B H;  4KHP Q;  2NZH A;  3H0G G;  4A3C H;  4BY7 H;  3GD7 A;  1V43 A;  2D0O A;  5J3B A;  3RLO A;  3OW2 A;  1SMX A;  1X54 A;  3I2Z A;  4JI0 L;  4NPS A;  4TQU S;  3RN2 A;  4X65 Q;  1CUK A;  1KL9 A;  2R7F A;  1VQI A;  4LFC Q;  4NXN L;  1CKN A;  2AMC B;  2C35 B;  3S24 A;  4B3S Q;  1FJG L;  3RN5 A;  5C0X I;  4DR1 Q;  5K36 G;  1UE5 A;  4DV0 L;  1HH2 P;  4A3I G;  4K0K L;  2OQ0 A;  4UPA A;  1BVS A;  2UU9 Q;  4L5S A;  2PI2 E;  4EX5 A;  1IBM L;  2YU9 H;  1A0I A;  4EQ5 A;  5HY6 A;  3S1N H;  4JV5 L;  1E24 A;  4DV3 L;  4PZ7 A;  4JI4 L;  3CMA A;  4A3K G;  2F4V Q;  4DKA C;  1GM5 A;  1OXS C;  1X3F A;  1UEB A;  2K75 A;  2VW9 A;  3CC2 A;  4BA1 I;  4A93 G;  2XGT A;  4YCV A;  1L0W A;  5LMU L;  4LF5 Q;  1J5E L;  4NXM L;  3DLL A;  3T1Y Q;  4DAM A;  2VQE Q;  1YJN A;  1YJW A;  4JI7 Q;  4OXP A;  1Y1V H;  3K8A A;  4GKJ L;  3G6E A;  3CPF A;  2R7Z H;  1TWG H;  3DM3 A;  3PO3 H;  2ZJR A;  5AJ3 Q;  4LFB Q;  2CKZ B;  2H5X A;  4A3E G;  4JI2 L;  4JYA Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...