2Z6KA

Crystal structure of full-length human rpa14/32 heterodimer
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
134
structure length
127
Chain Sequence
b'RAQHIVPCTISQLLSATLVDEVFRIGNVEISQVTIVGIIRHAEKAPTNIVYKIDDMTAAPMDVRQWVDNTVVPPETYVKVAGHLRSFQNKKSLVAFKIMPLEDMNEFTTHILEVINAHMVLSKANSQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Replication protein A 32 kDa subunit
publication title Structure of the Full-length Human RPA14/32 Complex Gives Insights into the Mechanism of DNA Binding and Complex Formation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Replication
total genus 29
structure length 127
sequence length 134
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08784 RPA_C Replication protein A C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2z6kA00
1UE5A 3CW2C 2C35B 2R7DA 2YTYA 4HJ9A 1YBYA 3H0GG 1SLJA 1UE1A 1HJPA 1LTLA 4GLAC 4R4IA 1HR0L 1Y1VG 2CQOA 3GO5A 3KF8B 4KI0A 3S17H 1X54A 1KXLA 4A3DH 3TS2A 1Y1WH 5C44H 5M3MG 3FKIG 5IP9H 3W5OA 5IWAQ 1EOVA 1YI2A 3S16H 4A3BG 4JCVE 1KIXA 4B3RQ 1S40A 1NJIC 3CP0A 3HKZG 2R7FA 4GNXA 1JT8A 4IPHA 2DUDA 3RZOH 1VS0A 3NBHB 4DK6C 3CC4A 4DV2L 2KHJA 5K36G 1JE5A 2IY5B 4A3IH 4L5RC 1L2FA 4JOIA 5J3BA 4A3GG 2XTIA 5IYDH 3PSIA 2JA6H 5GAEC 1X3GA 1KHIA 3AFQA 3K80C 3AQQA 1PA6A 1BKBA 2QGQA 2XGTA 3E9HA 1V1QA 2JA8G 2VW9A 4DUZQ 2VUMH 1NMFA 1VQJA 3WWVA 1Q86C 2VUMG 2V1CC 1PYSB 4JI8L 3AFPA 3GD7A 4YY3Q 5FJ8H 3RLNA 4A3FG 3I4OA 4DR3L 1YJ9A 4POFA 1N9WA 2BH8A 2YTVA 4L5TA 1KL9A 2JA5G 3HKZE 2RCNA 3AEVA 4X66L 1N33Q 1Q7YC 3L7ZC 1D8LA 3CF5A 1B70B 1WOCA 3UDGA 1GVPA 2UUAQ 1V9PA 4LWCA 3T1YL 1Q8KA 4DV0Q 4JI6Q 3I2ZA 4PG3A 5IYCH 5C3EG 2WP8J 2VQFL 2KCMA 1VQAA 4AH6A 2AWNA 1T9HA 3CMEA 4HIKA 1X3EA 1I94L 3GTQH 4BY1G 4NPSA 4UY8C 1X65A 3HOUH 1EIYB 2R6GA 1VQOA 1VQ5A 3PO3H 1NY4A 4C3JH 3M4OH 3ICEA 4ME3A 3F2DA 4XIGS 4WJ3M 3UDXA 2RHQB 3A5ZB 3DLLA 2ZTEA 2JEBI 3U4VA 2R93H 2N49A 3J7A5 4IFDI 3TEHB 1PV4A 2KHIA 1CKMA 2MQHA 3L2PA 2AMCB 4B3SL 1CKOA 2WB1G 1HZBA 3GTPH 3S24A 4AYBE 5IWAL 1MIUA 1L1OC 4A76A 1KC8C 2AKWB 3UDFA 2HIXA 4A3JH 1LUZA 4UP8A 3CPWA 3TS0A 1YJNA 3S1MH 1YITA 1N34Q 3MXNB 1UEBA 4QGUA 3EBEA 2DGYA 4KHPQ 4HJAA 5C4XG 4NXNQ 4B3TQ 1VQ6A 4JI5Q 1E24A 4IJLA 3M7NA 4LF6L 4OXPA 4JBJA 2ZTDA 3CCQA 1KD1C 1U5KA 2CFMA 1H95A 3GTOH 5M5XH 3W1GA 4GKKQ 5GQOA 2HHHQ 1HNZQ 5LMNW 5EAYA 4QIWE 1G51A 4DUZL 1QZGA 2ZJPA 1HNWQ 1W3SA 4JI3L 1YVCA 1OXUA 2B3GA 1YIJA 2JEAI 2WB1E 4YY3L 4PMWA 3W1BA 1VQFA 3JAMi 4Y7NH 2MFIA 1Q81C 1VQ8A 4NXMQ 3S1NH 3S2DH 1A63A 3KJOA 1QVFA 1EWIA 4IOAA 4GN3B 1Q12A 1QVCA 4YWMA 2LXJA 4JYAQ 3G48A 4LUOA 1KQSA 2I5LX 4LFBQ 2ATWA 2N3SA 1N33L 4DR5Q 4DK3C 1IBML 1D7QA 4R4TA 3PUYA 3K7AH 2MNAA 5IYBG 1CSPA 4GLVB 3HOYG 2JK8A 4DR7Q 2VZAA 4H02A 2JA7G 1XMOL 4HIDA 4BA2I 2A8VA 1PH2A 4DPGA 3HFZB 1A8VA 3PIPA 4X64Q 4DV0L 3J81c 3UE0A 1OTCA 4GLXA 1ASYA 3S1QH 3BJUA 4C2MH 1WFQA 3PV0A 4KHZA 2GVAA 2OQKA 3HOXG 3CCMA 4UP9A 4IPGA 1JJ2A 1WCMH 1J5EL 2HIVA 4OX9Q 3CD6A 5GAGC 1HH2P 4JBKA 1GO3E 4BXXG 4PZ6A 5LMUQ 1AE2A 1HZ9A 3BU2A 4MTNA 4DKAC 3G6EA 1MJEA 1XNQL 1VQLA 1C0AA 5FLXc 4XTCS 2B63H 2CWPA 2YTXA 1VQBA 3L0OA 2OTJA 3K7UC 2KCTA 5M5YH 1PH9A 3S14H 4DUYL 1EYGA 1SFOH 3RLOA 3UDIA 1WI5A 4LFAQ 4LF9Q 1HR0W 3KYHC 1VQNA 4DR2L 1C9OA 2JQOA 3KFUA 1SMXA 5C44G 1Y1WG 4A3DG 2UUBQ 1AH9A 5IP9G 4KLKA 1CSQA 1X55A 1TWHH 3PUVA 3DM3A 4YHHQ 4GNXC 2D0PA 5FLMH 1X9NA 2HT1A 2N8NA 3T1HQ 1EQQA 2NN6I 2NZOA 3A5UA 2E5LL 2PNHA 1JJCB 4KHPL 4B3TL 4JI5L 1PH6A 1KAWA 4JOIC 1HNXQ 1XMQQ 2UU9Q 4A3IG 2LSSA 2PQAB 4GN5A 1YJWA 3HOZH 1N36Q 4K0KQ 2IT1A 5IYDG 1EQRA 2JA6G 2D0OA 1IYJB 4GKKL 1I50H 3J80c 1IBKQ 2HHHL 4LF4Q 2OTLA 1M90C 1MKHA 1VQMA 1G291 1YHAA 2R92H 3U4ZA 4A75A 4DR6Q 5FJ8G 4R4QA 3STBC 5C0XI 3CC7A 4JYAL 4LFBL 3ULJA 4P71A 2E2IH 3RZDH 2VNUD 4Y52H 4DR5L 4DV6Q 2IHEA 1OXSC 2OCEA 5LMNQ 1DGSA 3S2HH 4LF8Q 4DR7L 4DV3Q 2YYZA 4P74A 1I5FA 3E9IA 4O0AA 4PZ7A 3F1ZA 1OXXK 2EIFA 3KOJA 4LFCL 3E0EA 4X62Q 1L1OB 1W2BA 1UE7A 1VQIA 5IYCG 1UWVA 1N32L 1IXRA 1Q46A 4POGA 1VQKA 4JI0L 4A93H 1BBWA 2I5HA 3M4QA 2F4VL 4A3LH 3A0JA 3J7ZC 4DV4L 2VL6A 4JI4Q 2ZTCA 3JC66 3HOUG 4IO9A 3PO3G 4LW1A 4DR4L 2E8GA 1K8GA 1XNRQ 3PIOA 4JI7Q 4B3MQ 1O7IA 2PQAA 5LMUL 1G6PA 4P72A 1GD7A 4YWLA 5IP7H 4DV5Q 3PO2H 4DR1Q 4IFDG 4L5SA 1QUQB 4HJ5A 2I0QA 4OWWB 2R93G 4DV7Q 1IL2A 3HOVG 2Y0SG 1UE6A 2VQEQ 5HY6A 1NMGA 4OONA 4LF9L 4LFAL 2F52A 4YWKA 1E7ZA 2Z6KC 4GOPB 5ELOA 4JC0A 3OTOQ 4A3EH 2UUBL 5IT9c 1FJGQ 1VQCA 4TVAB 5M5WH 4B3RL 2PI2A 2B29A 3H15A 1LM0A 4A3EG 2PMZE 3M4PA 4OWTB 4A3JG 3SGIA 3T1HL 2VY3A 4QY7A 4GN4B 1B8AA 1HNXL 1U0LA 2GVBA 3K0XA 3EIVA 1NBWA 4BBSH 1HR0Q 3RR5A 2ES2A 1PH8A 1K9MC 1YEZA 1EUJA 4LF4L 3PUXA 2K5HA 4P75A 2Y0SE 3KJPA 4R1JA 4NB3A 4JBMA 5JJLA 3GTGH 2UXDQ 3D0FA 2UXCQ 1Q1EA 3I4NH 4P73A 4DR6L 1PYBA 1JJGA 1IBLQ 3FP9A 3GTJH 1OXVA 3G4SA 3OW2A 4JV5Q 1E1OA 2ALYB 2RHSB 5GAHC 1EFWA 1YZ6A 4DV1Q 3I4MH 2UXBQ 1FGUA 1GKHA 4FDBA 3CPFA 4RG1A 3F2BA 4DV6L 4A3MH 4A3CH 1AE3A 2ASBA 2QEXA 4LF8L 5JEAG 1VCIA 1K83H 4DV3L 4A3KH 1E3PA 2D62A 2UUAL 1VQ4A 2BA0A 1QUQA 2ZJQA 4JI6L 4X62L 4BBRH 4DAYB 2FXQA 4X65Q 3F2CA 5C4JH 1NTGA 3K8AA 4GNXB 4DR3Q 4GOPA 1XPRA 3G71A 2F3IA 1EIFA 3OYYA 3HOVH 1P8LA 3EN2A 4MZ9A 4JG2A 2Q2UA 1S3OA 2L15A 3PF5A 1GM5A 2AWOA 2CWAA 4DAMA 5AJ3Q 1WCMG 2AHOB 1JB7A 3CC2A 2R7ZH 3NELA 4BY7H 3RNUA 1XPUA 3J81i 4JI7L 4AIMA 1TWAH 1WJJA 4C3IH 3HOWH 4IOCA 3CCLA 3T1YQ 4DV5L 1VQEA 1RIPA 2YU9H 2K14A 2NZHA 4APVA 5M3FH 2B63G 4DV7L 4QQBX 2VQEL 3PUWA 1I94Q 4OO1I 1E1TA 3BZCA 2KBNA 3OTOL 1FJGL 3RN5A 1KRSA 1MJCA 3AYHB 1VQGA 1N34L 4IJHA 1A0IA 4GKJQ 1CKNB 2EXDA 4NXNL 3H0GH 3ZJYC 2NN6G 5FLMG 3J81j 1PH3A 1SRUA 1C7YA 3M3YH 4IFDJ 1Y1VH 2GN5A 4LF5Q 2JJQA 3NEMA 1K3RA 1VQDA 2CCZA 3KF6B 4LF7Q 2ID0A 1XTDA 5M3MH 3HOZG 1BBUA 1I3QH 3FKIH 4HJ8A 1HNZL 4B3SQ 1N8RC 2MO1A 3TQYA 4A3BH 1QVGA 4WJ4A 5DLQE 1VQ9A 2Q2IA 4QL5A 5JJIA 1PVOA 2A1AA 4NXML 3TREA 2BH2A 2UXDL 2Q2TA 2UXCL 2ZM6Q 1ASZA 2R92G 1IBLL 3PUZA 2N78A 5C0XG 4A3GH 3U58A 1R9TH 4LF6Q 1PHJA 4JV5L 2UXBL 5E7NA 4DV1L 3J80i 1WYDA 3CQZH 2KENA 4L5QA 4YCUA 5BR8Q 2NVQH 4AQYQ 2JA8H 4OWXB 3KDFB 1X3FA 1I6HH 3FHWA 4JI1Q 1IZ6A 1SE8A 1A62A 1X56A 1Y14B 1E22A 4LUZA 2UUCQ 3CAMA 3ER0A 4DNIA 4HIOA 4HJ7A 3PGZA 4ALPA 4JI3Q 1TXYA 4X64L 4YCVA 4A3FH 1X6OA 5IE8A 1K0RA 3GTMH 4O2DA 1NE3A 4X65L 2JA5H 1FL0A 5GADC 2WAQG 2ZJRA 3GTLH 3I56A 3CXCA 4A93G 3PF4A 1Q82C 4A3LG 3STBD 3CCUA 1IBMQ 1HZAA 4OX9L 1CKNA 2BA1A 5JEAJ 1QZHA 5AJ3L 1HNWL 4BA1I 1V43A 3BZKA 1B7YB 1L0WA 4A4IA 2WFWA 1XMOQ 2IX1A 4EQ5A 5C3EH 4JI2Q 3KF6A 1TWCH 3K81C 3HKSA 5GROA 1SROA 3GDEA 4AYBG 5IP7G 4LUVA 2JA9A 3NENA 4BY1H 3PO2G 4EX5A 2NVTH 3GTKH 2WAQE 2RF4A 3I7FA 3CMAA 1VQ7A 4YHHL 1J5EQ 2K5VA 3I55A 1PH7A 4GKJL 3Q8DA 1KRTA 3S15H 3CCJA 2E2HH 1YHBA 2PI2E 5JJKA 1XMQL 2UU9L 1XNQQ 4PZ8A 3B6YA 4IPDA 1N36L 1K8AC 4JBWA 4R4CA 4LF5L 3KDFA 1HZCA 3PCOB 4LF7L 4BBSG 4DUYQ 4IPCA 1PH1A 1IBKL 3F8TA 2I5MX 1P16A 1L1OA 2OQ0A 4C3HH 4DR2Q 2Z6KA 1VQPA 1PH4A 4QJFA 1TWFH 1RL2A 2K75A 2IX0A 5HGQA 3RN2A 5C4XH 3S1RH 1Z9FA 2LXKA 2ZM6L 3TRZA 3D31A 4R4OA 3JAMc 2K5NA 3CCVA 4DV2Q 3I4NG 2E5LQ 3CCRA 4UPAA 1XJVA 2OWOA 2K52A 1M1KC 2VS1A 2CKZB 4UP7A 5LMNL 3LGJA 3I4MG 5BR8L 4A3MG 3KLWA 4AQYL 4A3CG 4JI1L 2UUCL 1OXTA 5H1SE 4K0KL 4A3KG 2A19A 4JI8Q 2HQLA 1JMCA 1PFSA 2YV5A 5C0XJ 4BBRG 1Z47A 4J15A 4GOPC 1SN8A 4HIMA 1CUKA 4GS3A 4JI4L 4X66Q 2MO0A 1YNXA 3ERSX 2JE6I 2K50A 3M85A 2H5XA 2EQSA 4YCWA 5IYBH 3CCEA 3HOYH 3MEFA 1BVSA 1VQHA 3IRBA 5ELNA 1S72A 2JA7H 4X6AH 3CCSA 3RLFA 1XNRL 1XPOA 4B3ML 4BY7G 2R7ZG 2K4KA 4TQUS 4JI2L 4LFCQ 3HOWG 3H3VH 4DR1L 3A74A 1J6QA 2NVXH 4LNQA 1LYLA 3H3VI 2VQFQ 1FVIA 2QA4A 2NVYH 1N32Q 2E2JH 2IHFA 4RMFA 5M3FG 4JI0Q 4OO1G 2Q2HA 3HOXH 2F4VQ 4DV4Q 1Q1BA 2Z0SA 1K73C 3VDYA 5IY0A 3M9BA 1SR3A 3ULPA 1TWGH 1YHQA 3U50C 3UE1A 1PH5A 4DR4Q 4BXXH 4MNOA 3ULLA
chains in the Genus database with same CATH superfamily
2CW0C 1CK1A 2R7DA 1TS2A 2YTYA 2NTTA 3NXWA 1KNAA 1HJPA 4GLAC 4R8IA 2NYZD 3GO5A 3S17H 4IUPA 5IP9H 4LAAA 5IWAQ 2M00A 1YNND 1LTBD 1KIXA 2IJ0A 5J22A 2WKCA 3HKZG 2R7FA 1BCPD 5C5LA 4J1MA 1CHPD 2KHJA 2O5JC 1EY9A 3NQTA 4CJ2C 4PMBA 3V05A 1EIHA 3AQQA 2QGQA 2JA8G 4HSPA 1NMFA 3FRPB 4HN7A 3TMEA 3AFPA 5EGTA 5FOBB 4A3FG 3I4OA 1MI2A 2FMMA 1N9WA 1CTMA 2JA5G 2B2TC 3E5SA 5CV8A 3AEVA 4X66L 2E2HB 1NAPA 3BG3A 1RTOA 1WOCA 3X3NA 3T1YL 4HR7B 1G2SA 4IQZA 4JI6Q 3WDNA 1NR2A 4XQQA 1I94L 1X3EA 1S5FD 5C4XB 1GHJA 5IT9L 2C5CA 2Z1CA 3H94A 4UY8C 3KLSA 4CDCC 1NY4A 2ZXPA 4WJ3M 3GTOB 1FR3A 2R93H 2N49A 2XWBB 1VF5C 1LTAD 4DFAA 3J7AV 1DYQA 4RGOS 3S1NB 2AKWB 5CV9A 1ZXTA 3TS0A 1YITA 3JAME 4QGUA 4IJLA 1D6EC 4J6HA 2RDHA 3CCQA 4JBJA 3ONAB 1J9OA 5JPMC 3GTOH 2KEDA 1SMYD 3GQBA 3NPPA 5CBAE 4JI3L 1CZGA 4C2MB 1XTCD 2WB1E 1VQ8A 3JAMi 1VQFA 3KLSX 4DXGA 3S1NH 3KBGA 1AP0A 2R3ZA 3HRZC 1QVCA 3T13A 4F7XA 2LXJA 2EVBA 1KQSA 2I5LX 3TP7A 1D7QA 3OPOA 3O13A 2IWHA 1CSPA 1TS5A 2JK8A 2B63B 4DR7Q 1U9RA 3KLRA 2JA7G 5FLXL 1PH2A 3HFZB 4DV0L 2F0KA 4GLXA 3BJUA 3WOFA 4C2MH 3QOLA 1JQYD 1WFQA 2IPKD 2L0CA 2B2VC 1CQFA 4IUUA 3Q22A 2J7ZA 3HOXG 2A6HD 3EQLC 3CCMA 4IPGA 1JJ2A 1A6XA 3I3CA 4PZ6A 1AE2A 4DKAC 1C0AA 3OIQA 1VQLA 5L37A 5FLXc 2OTJA 2B63H 2CWPA 2YTXA 1VQBA 5DNFA 4DUYL 3UDIA 3M7NA 1QOHA 1HR0W 4A3DG 2EY2A 4DN4M 5G3LD 4YHHQ 4GNXC 2D0PA 1FNVA 3RZDB 4K5VA 2N8NA 1EQQA 3A5UA 4KHPL 4B3TL 2KHSA 2UU9Q 2LSSA 1A3TA 1SNCA 2JA6G 4DNRB 2QDLA 3HS0C 3C2PA 3I91A 3G6JB 4HCSA 4A75A 4DR6Q 5FJ8G 3A8KE 4R4QA 3STBC 4C3JB 3VYUA 1ML0D 1WTRA 1TIID 1B1ZA 4BS9A 1SBBB 3R2IA 4FNFA 4X3TA 3ULJA 3RZDH 4JPBW 2IHEA 1B3QA 4CJ0B 1RTNA 2ZT9C 1B9NA 1EFID 2YYZA 1I5FA 3E9IA 4O0AA 3K59A 5E3FA 1L1OB 2VXWA 5CGKA 5M5WB 4POGA 1PTOB 2E76C 4OIJA 4A3LH 1CA5A 1DONA 5FO9B 1BF4A 2F1MA 2EE1A 4K2KA 1PRTC 1ZYRD 2F0LA 3M7GA 4DAPA 1XNRQ 5JVG3 2TSSA 3RUZA 5C3WA 3D4RA 4N9PA 4DV5Q 1HCZA 4HJ5A 1MD2D 1V8QA 1PFBA 4L5SA 1IL2A 2Y0SG 5HY6A 3SXHA 1NMGA 4OONA 4LF9L 4YWKA 4GOPB 5M5WH 2B29A 3H15A 1LM0A 1PTOH 3NE5B 1PMRA 1K83B 4ZYSA 3K0XA 1BO0A 3RR5A 3C1EA 4BBRB 3TZUA 2PZUA 1EUJA 4LF4L 5FK9C 1BQQT 3KJPA 2RCFA 4Q5VA 4R1JA 3CKIB 1CM9A 2C9OA 5DM63 1I4QA 4JV5Q 1E1OA 3HOWB 4QUFA 1GKHA 4FDBA 3CPFA 4DV6L 1FGBD 2KVMA 1AE3A 4LF8L 5JEAG 4DV3L 1K83H 1G8ZD 3D6WA 2N88A 4JI6L 2ZJQA 4X62L 4BBRH 1HQRD 1JOKA 3F2CA 4GOPA 1RJTA 1EIFA 3A8IE 5I9PA 4ZUIA 2Q2UA 5C4HA 3TDQA 3C1FA 1B53A 2L15A 3PF5A 1JB7A 3HOZB 3CC2A 4EQNA 3HOWH 1TWAH 2QDBA 1RIPA 2L5TA 4OO1H 1BCPC 3OTOL 2KBNA 1KRSA 3AYHB 4CKBA 2EYMA 4IJHA 1D1IA 1A0IA 5J1ZA 4C56C 4GKJQ 5E1FA 3S2HB 3H0GH 2D2CC 2DNCA 2G9DA 2ICIA 1Y1VH 2A6ED 2OF1A 1K3RA 4KKTA 2CCZA 1SYBA 1DXMA 3HEJA 5EBCA 4HJ8A 1LTID 2QCPX 2JXMB 3NTIA 2BCOA 2Q2IA 5JJIA 1PRTF 2Q2TA 1ASZA 2R92G 4FXDA 5C0XG 4IZ8A 2UXBL 1FD7D 4DV1L 2KENA 3P1HA 3FHWA 4K5XA 1SE8A 1X56A 1E22A 4LUZA 4BY1B 3CAMA 4RA8A 1ILQA 2FHTA 3I73A 3PGZA 1F2YA 4ALPA 1X32A 2KEEA 4YCVA 1JE4A 1X6OA 4IN3A 2AUJD 4X65L 1I4GA 5GADC 2ZJRA 1U4LA 3OMGA 3DWPA 3S15B 1Q82C 4GZYC 4B9XA 1IBMQ 1HZAA 2BA1A 2FMCA 5IGCA 1QZHA 5AJ3L 3BZKA 1B7YB 1F2MA 4A4IA 1XMOQ 4EQ5A 4JI2Q 3K81C 4OL7A 2PCFB 1SROA 3PO2G 4BY1H 1VDZA 4IURA 2WAQE 3CMAA 1BNZA 4YHHL 5C4ZA 2CH4A 3I55A 3S15H 3DM1A 4HMJA 1WTPA 4M1UB 2EJFC 4UDUC 1NCVA 1SMYC 2SEBD 1SE2A 2UU9L 4K5WA 1XNQQ 4PZ8A 3ERQA 3VR2A 5IGDA 5C6AA 4IPCA 1EQTA 2B8FA 2KQ3A 4C3HH 2Q8RE 2Z6KA 1PH4A 4M8AA 2K75A 4RHRA 2IX0A 3DEOA 5CYUA 3RN2A 1Z9FA 2LXKA 2NTSA 1ICWA 2K5NA 1SNPA 5CBEE 4UPAA 2F0EA 1D1KA 3KLWA 4A3CG 2P5ZX 1RCVD 3GV3A 1OXTA 2UUCL 2NVYB 5ELDA 2MUYA 2EYJA 1JMCA 2YV5A 2A6HC 4HIMA 4X66Q 1JOQA 2K50A 3QO2A 2EQSA 3MEFA 5A2QE 1IKLA 4X6AH 2D9UA 3CCSA 1XNRL 1BOSA 4BY7G 5C44B 4LFCQ 3H3VH 4C3IG 5DEHA 4LNQA 2I46A 2NVYH 2RSOA 4HEDA 5EPLA 5M3FG 5CC4A 2Z8LA 3CU7A 4I65A 1Q1BA 2Z0SA 4A3IB 3NUCA 4CDEC 2EYOA 2L12A 1YHQA 2EYLA 1G6ZA 3ULLA 3MZ5A 1I6HB 3CW2C 3TSSA 2C35B 1YBYA 3KK7A 2CQOA 4KI0A 4OHJA 1X54A 5BN4A 5C44H 1R4QB 5M3MG 3K5LA 2JYOA 3W5OA 4K8JA 4A3BG 4JCVE 3EA6A 4I7AA 2DUDA 3NBHB 4PMCA 3CC4A 2A68C 4WORA 4A3IH 3SK5A 4JOIA 4L5RC 1B4OA 1BR9A 5IYDH 3TP6A 5GAEC 1KHIA 4DF7A 2F0QA 4U673 1PA6A 1D2BA 3MC0B 1STBA 2VW9A 5EBDA 1VQJA 2PMZB 2VUMG 2V1CC 2QILA 3R8BA 5LHY1 1E2ZA 4L63B 4ID6A 1DOKA 3PO3B 4E6IA 2ZXOA 2EZVA 1YJ9A 1KL9A 2RCNA 1JWMD 4ODGA 3VYTA 1Q7YC 1F9QA 1ZYRC 1D8LA 3CF5A 2X69A 2V4DA 5IGEA 1WTWA 3ZYYX 3FPUB 2MGSA 3GTPB 2B8GA 4DK0A 1Q8KA 4DV0Q 4G7OC 3I2ZA 3SHLA 5IYCH 5C3EG 2WP8J 1VQAA 4AH6A 4NPSA 1S4ZA 3PO3H 3NBHA 4KMUC 3F2DA 4HAEA 2RHQB 5M5XB 1TT2A 3A5ZB 3U4VA 1PRTD 3TEHB 1PV4A 3BVMA 3L2PA 1VMCA 2WB1G 1HZBA 3GTPH 3S24A 3FEWX 4FF1A 1MIUA 1AN8A 5DM73 3UDFA 4KN4C 4CDFC 1N34Q 3X3MA 3HOYB 2ZXRA 3BVGA 3K7AB 2Q8TA 4KHPQ 5C4XG 1AZPA 4B3TQ 1VQ6A 4CJ1B 1AW7A 1H9JA 4TSSA 3URYA 5I2YA 1H95A 1QE6A 5M5XH 3W1GA 5GQOA 4QIWE 4DUZL 1QZGA 3J81L 2B3GA 1YIJA 1SNMA 2DJGC 4RGTA 4NXMQ 4Y7NH 1Q81C 1A63A 4H44C 3KJOA 1ET6A 1QVFA 1WCMB 1Q12A 1N33L 1B3AA 1IBML 3PUYA 2RSNA 3K7AH 1B50A 3D8GA 4WFN3 1XMOL 4HIDA 1SJHD 5KNCA 2M2LA 1D5XC 1ENFA 1SYEA 4X64Q 3J81c 5BN5A 1TWHB 3PV0A 1MGSA 2GVAA 2WACA 2EJMA 4UP9A 3KBXA 1ENCA 1KNEA 1WCMH 3CD6A 5GAGC 4BXXG 4MTNA 3G6EA 5IGGA 1XNQL 1WD0A 3L0OA 3J80L 1PXUA 1EYGA 3KUPA 3RLOA 3BDCA 4LF9Q 1Y1WG 2K6AA 3K57A 1TWHH 2DNEA 1X9NA 2F3VA 1HFGA 5FLMH 1A2TA 2XIWA 4KY6A 1DCZA 4RHSA 2E2DC 2D0OA 3J80c 2HHHL 4MIUA 4LF4Q 2OTLA 1MKHA 1SYDA 2BOSA 4LJZC 2XNAC 4K8IA 3U4ZA 3VA7A 5C0XI 3GV6A 3CC7A 1E2WA 4JYAL 1GUWA 4LFBL 2O5IC 1VF7A 4DV6Q 3Q6SA 1OXSC 2KA7A 5LMNQ 2R93B 4FF4A 1O7YA 1STGA 4WRDA 4LF8Q 2BDOA 4DV3Q 2RDGA 3F2UA 4LFCL 4H13C 4X62Q 3Q23A 5E4WC 2KUMA 4A3EB 1VQIA 4DXFA 1Q46A 1VQKA 1CFMA 1EEID 4JI4Q 3VR4A 4L8JA 2SOBA 3EFXD 4IO9A 3HOUG 5KIXA 4C3JG 2A74C 1SEBD 1G6PA 1C4QA 4MTKA 5IP7H 1AZQA 4IFDG 4Q0FA 1LLRD 3QJYA 4DA2A 1E7ZA 3OTOQ 1M8AA 1QB5D 4A3EH 1DOMA 4LMQD 1IHZA 5IT9c 3GTJB 1GXDC 1RHPA 4A3JG 3PQIA 4DAVA 1I4PA 2VY3A 4QY7A 4A3KB 2GVBA 2HDLA 3VR6A 5CR3A 4ZK9B 5EKLA 2WKDA 3PUXA 4P75A 2Z6BA 4NB3A 3SDZA 4P73A 3GTJH 2D5DA 2UXBQ 2ALYB 1NR4A 1EFWA 4DV1Q 5HGTA 1FGUA 3D4WA 2NZ1D 4XT3B 2YU9B 2QEXA 5CV4A 1VCIA 4A3KH 4RAUC 1E3PA 2D62A 1VQ4A 1EY0A 2BA0A 4DGZA 2EOTA 5CORA 2FXQA 4X65Q 2E75C 1STNA 1NTGA 3K8AA 4GNXB 3DWQA 2F3IA 3H91A 3G71A 3EN2A 4MZ9A 3NTKA 4B08A 4NMZA 2K01A 1JORA 5AJ3Q 2R7ZH 2AHOB 3NELA 3RNUA 3J81i 4FF2A 1I3QB 4AIMA 4XYQA 3HG9A 2EY6A 1QJOA 3K58A 2YU9H 2K14A 3HKZB 1EWCA 1ZKOA 4APVA 1WTVA 1Q90A 3PUWA 1CQVA 3BVZA 1E1TA 2B2VA 1DM0B 2O4XA 3ND9A 1MJCA 1MSHA 2NBFA 1OO9B 1N34L 1ILPA 3CQZB 1CT1D 2BDNA 3VA5A 3FMCA 3FPPA 2NVQB 2NN6G 4MN3A 2CVRA 2JA8B 1SRUA 4KTAA 4X3UA 2KCNA 4KJOA 2JJQA 1VQDA 4O1NA 3KF6B 3HOZG 2L4NA 4A3FB 1I3QH 1YNJC 3TQYA 4WJ4A 2JA5B 2K5WA 4NP5A 4QL5A 2LFNA 2H4OA 2A1AA 5EPJA 3TREA 4NXML 2B2UA 2EPBA 2BH2A 2K1BA 5KNBA 2UXDL 3K5OA 3T16A 2UXCL 2F0SA 2F3WA 2F0PA 1PRTB 1B2TA 2FFKB 3J80i 1EZ6A 3CQZH 2A68D 1LV9A 3NHHA 3N52A 2NVQH 1TWCB 2JA8H 3KDFB 1IZ6A 2UUCQ 1Y14B 3K6OA 4HIOA 4G57A 1TXYA 4U68A 5JPNC 1TU2B 4X64L 4A3FH 2NWGA 5IE8A 1WTXA 3GTKB 1IL8A 2JA5H 2HCCA 2WAQG 3NWTA 3HGBA 4A93G 2PPBC 2DN8A 3CCUA 4BWGB 5JEAJ 1HNWL 2OXPA 1U4PA 4BA1I 2MJ8A 1V43A 1K8MA 1SJED 3A7LA 3EVQA 2RBMA 1Y8NB 3KF6A 1TWCH 3QWNA 5GROA 2SNMA 4AYBG 2K03A 3NENA 1L0YB 5IT9E 3GTKH 4ZQ3A 2WINB 1J5EQ 2K5VA 4F87A 5E4XA 1UEAB 4OEMB 5JJKA 1K8AC 2J0TD 1C48A 4JBWA 3KDFA 5ELBA 4LF7L 4BBSG 5D3DA 3F8TA 1L1OA 4DR2Q 2F0HA 1EQVA 1RL2A 4IUVA 1H9KA 3S1RH 1CI3M 2ZM6L 3SE0A 4RGNA 3I4NG 2E5LQ 2JA7B 3CCRA 2K28A 1XJVA 2OWOA 2K52A 1M1KC 1TWAB 2VS1A 3C46A 5LMNL 3I4MG 1U4RA 1DJRD 1S5ED 4A3MG 1KAAA 2DJFC 2F0FA 2XN9C 1IW7C 1SSOA 2A5HA 1BCPB 2G9HD 3HOXB 4IALA 2XRQD 1PFSA 5C0XJ 1BDOA 2F0JA 2K05A 4GOPC 4GS3A 3H0GB 4JI4L 1YNXA 3HOVG 4YCWA 1Y1VB 4XXEA 3L3OC 3IRBA 1JB3A 3I72A 2JA7H 3G7LA 5T1GA 4A3DB 2K4KA 4H0LC 5FLXE 3S16B 1J6QA 1FVIA 1QCBD 4RMFA 3HP3A 4JI0Q 2Q2HA 3VYRA 3HOXH 3RZOB 2B2YA 5KEEA 5EKKA 2JA6B 3U50C 4DR4Q 1LTRD 1UE5A 3IKJA 4HJ9A 1SLJA 1UE1A 3IAYA 4CGYB 2KECA 4R4IA 1KXLA 4A3DH 3BS1A 3TS2A 1ESRA 3NBIA 3TP5A 3FKIG 3S16H 1I6VC 1YI2A 1H9RA 1JT8A 4OELB 3RZOH 1VS0A 4IUQA 2NB0A 4DV2L 2F0WA 4N8FA 5K36G 1HA6A 1L2FA 4A3GG 3PSIA 2JA6H 1WTHA 1GJXA 1LACA 5FKAC 2XGTA 3E9HA 4G7HC 4DUZQ 1Q86C 2KOLA 1PYSB 2HQEA 2J4XA 5FJ8H 1CA6A 3RLNA 5HURA 1EY4A 4NDXA 3M4OB 2BH8A 4L5TA 1TY0A 5ISRA 1N33Q 3SK6A 4HSVA 1JCKB 2EJGC 1B70B 2F0VA 2Y0SB 1RKNA 3TP8A 2UUAQ 1V9PA 3VR3A 4C3HB 4QB4A 4ME5A 4QCLA 3S1MB 2AWNA 1T9HA 4JK1C 4HIKA 4XDXA 3P20A 4S3SA 1VQOA 2PNRC 4ZRZA 3M4OH 3Q24A 1Q3LA 4FO2A 3UDXA 4KK7A 1V1PB 3DLLA 1HUNA 1LT5D 2JEBI 2I07B 4IFDI 2KHIA 1CKMA 2MQHA 2AMCB 4C1NK 1CKOA 4EGVA 4AYBE 4A76A 2WIIB 2HIXA 3S1MH 4KKSA 3EBEA 4K14A 4NXNQ 1E24A 1E2VA 4OXPA 2ZTDA 4K6DA 3FDTA 1Y8OB 1I4RA 2HHHQ 5EAYA 1FNUA 1G51A 1W3SA 5I9OA 1YVCA 4FF3A 2JEAI 3SEBA 4YY3L 4PMWA 1TVXA 1ONLA 1LT3D 4V190 4DNTB 3H09A 4JYAQ 4LFBQ 4LUOA 1EOTA 2N3SA 3CHBD 4CDDC 1MBYA 4PQXA 5JEAH 2MNAA 5IYBG 4GLVB 3QG1A 4Z9CB 3HOYG 1K0SA 3OIPA 1V1PA 4H02A 4BA2I 2A8VA 1XX8A 5KRUA 4DPGA 3PIPA 2HCIA 3UE0A 1OTCA 5T1IA 4QF4A 3AMUA 3QOJA 1XXGA 3SK8A 1TKWB 3U9SA 4ZKCB 4DU9A 1O80A 2OQKA 1J5EL 2HIVA 5D14A 5CV6A 1D5ZC 1HZ9A 4XTCS 3K7UC 2KCTA 4J8QA 1PH9A 3T51B 1HFNA 1VQNA 4DR2L 2JQOA 1SMXA 5IP9G 3V96A 2E2IB 2NN6I 2NZOA 3BDLA 1ESFA 2E5LL 2PNHA 1JJCB 1C8CA 4JI5L 1PH6A 1KAWA 4JOIC 3CRLC 2PQAB 4GN5A 5C3XA 1YJWA 1N36Q 5BN3A 1IYJB 2MP1A 4GKKL 3NQIA 1VQMA 2MPMA 1YNJD 1G291 3T4AC 2R92H 5C0XH 1S5CD 3MXGA 5KNDA 2JN4A 2E2IH 1IYVA 4Y52H 2BE5C 4DR5L 2PW5A 4FXGC 2OCEA 1AFPA 3PO2B 4P74A 4PZ7A 3F1ZA 1MSGA 3E0EA 5IODA 2Q8IB 3OWEB 4IUTA 1UWVA 1STHA 1PZID 4JI0L 1BBWA 3M4QA 3A0JA 3J7ZC 2VL6A 2ZTCA 3JC66 2AQ2B 4DR4L 2E8GA 5I4DA 1G91A 3PIOA 2XRSD 4B3MQ 1O7IA 2PQAA 5LMUL 4YWLA 4F8MA 3PO2H 4DR1Q 2R93G 2PQEA 3MVVA 4Y7NB 4EVOA 5C5MA 3RD4A 3GTGB 2EXZA 4LFAL 2B2WC 2F52A 4H7BA 4JC0A 2UUBL 2PI2A 5DAUA 4A3EG 2PMZE 2IX3A 3T1HL 1FYCA 1H9MA 2VB2X 4GN4B 1HNXL 3EIVA 1NBWA 4EQOA 1HR0Q 3OMCA 2ES2A 1GOZA 1K9MC 2KJXA 2HUGA 5C4JB 1HPCA 4ZAIA 2K5HA 5J39A 5JJLA 3GTGH 2UXDQ 2UXCQ 3E0JA 1KABA 1Q1EA 5I6YA 1JJGA 1PYBA 5KGUA 3J7AF 1TR5A 1ICFB 2QKIC 1EYCA 4BY7B 3G4SA 3RMHA 2RHSB 2WV6D 4C3IB 3F2BA 4A3CH 2LMCB 3R3OA 2ASBA 1UUPA 3MA2B 4C1NI 1RODA 5M3FB 2UUAL 2IW3A 2NUCA 1JICA 1SDFA 4DAYB 1IW7D 1F77A 1UNSA 1QNUA 5C4JH 1EU4A 4DR3Q 3NK9A 1BXTA 3OYYA 4FP5D 1F9RA 2XWJB 1STAA 5JVH3 3M3YB 3DMUA 1LO5D 1LTGD 2RA4A 2G5DA 2AWOA 2CWAA 1HNWQ 4BY7H 4QMGA 5M3MB 1XPUA 3OSOA 3SVMA 4JI7L 1WJJA 1WTOA 4C3IH 4A3BB 3CCLA 1IKMA 1Z6HA 3SK4A 2NZHA 5M3FH 2B63G 4DV7L 3PIP3 4QQBX 2VQEL 3H6MA 3BZCA 1FJGL 3RN5A 4KV6A 3SR1A 1VQGA 1KLGD 2EXDA 4NXNL 3J81j 1PH3A 1C7YA 3M3YH 2VUMB 4IFDJ 3NEMA 4LF7Q 5M3MH 1XTDA 1BBUA 4B3SQ 1N8RC 3GTMB 4A3BH 4WJWA 1K3BC 1QVGA 1VQ9A 1QNKA 1PVOA 3GTLB 4DAYA 1GUTA 2ZM6Q 1F9PA 2PW7A 1IBLL 2N78A 2IL8A 4HMIA 4RCNA 4LF6Q 1PHJA 2OEOA 5FO8B 5C3EB 1ET9A 3I70A 3OW7A 1NSNS 3IFDA 2VUMH 3QB3A 4KY7A 4HJ7A 1K0RA 3GTMH 4LK1C 4O2DA 1FL0A 2B2TA 3GTLH 3I56A 2RQXA 4A3LG 5COYA 1V1OA 4FXKC 2WB1B 1L0WA 2IX1A 5C3EH 3U9OA 1RD9D 1STEA 1TWFB 3HKSA 3GDEA 4LUVA 2JA9A 4EX5A 4RCOA 4CBVA 3V2TA 3I7FA 1VQ7A 1PH7A 3MXPA 1SE3A 3Q8DA 1KRTA 1VMPA 3AB9A 5ELFA 5D3IB 3CCJA 2E2HH 4FYDA 3IL8A 3B6YA 3PIO3 1N36L 4LF5L 4R4CA 2XSCA 3R93A 3K5MA 1HZCA 2H1EA 5IGFA 3LX0A 5JOBA 2PO4A 4JW0A 2I5MX 2OQ0A 1WTQA 4QJFA 1TWFH 3A54A 5AFWA 1TS3A 1O7LA 1ENAA 1Y8PB 5C4XH 3TRZA 4YIJA 4P2CB 3D31A 4R4OA 3CCVA 4DV2Q 2R7ZB 2GA4B 1A3UA 1X3PA 2CKZB 3TZDA 1II3A 5BR8L 1U4MA 4AQYL 1S5DD 4JI1L 5H1SE 4K0KL 2A19A 3J81E 1O7ZA 2HQLA 4BBRG 1Z47A 2K5DA 4J15A 3NTHA 4DK1A 3ERSX 4F88A 2JE6I 3IFTA 3CCEA 2H5XA 1HTLD 1BVSA 1VQHA 1GUNA 2FJ2A 4B3ML 1Y1WB 1PZJD 3HOWG 4DR1L 3A74A 1LYLA 2QA4A 3MAQA 1N32Q 4OO1G 4CKEA 2F4VQ 1A15A 3M4YA 2A69C 4DV4Q 5D65A 3VDYA 5IY0A 5IGBA 1SR3A 3ULPA 3OOCA 3UE1A 2EY1A 1PH5A 4BXXH 4MNOA 2MHVA 3S9WA 1JWUD 3H0GG 2PZTA 2CQAA 1LTLA 3MWYW 1HR0L 1Y1VG 1DD2A 3KF8B 3LWUA 2LS01 3J80E 5K5PA 2E74C 2EDGA 1Y1WH 1EOVA 1SNDA 4NW2A 2TMPA 4B3RQ 1S40A 1NJIC 3CP0A 1I4HA 2F0MA 2B2UC 5ELCA 4GNXA 4IPHA 2AQ1B 1QG7A 2R61A 4DK6C 1JE5A 2IY5B 1LABA 5J3BA 2XTIA 2QEJC 1NNXA 4HCEA 1X3GA 3T53B 3AFQA 3K80C 1BKBA 3BYTB 5CMDA 1V1QA 3QIAA 3WWVA 3OWFA 3GTQB 3D4DA 4JI8L 1O78A 3GD7A 4YY3Q 4KD4A 3HOUB 4DR3L 4POFA 2YTVA 4UHVA 2K32A 3HKZE 1G2TA 1EZ8A 1JOOA 3L7ZC 5EKIA 3A8JE 3E3XA 2BE5D 3DWAA 1K8OA 3UDGA 1GVPA 5FO7B 4LWCA 2DY8A 1Y69U 3KF8A 4PG3A 2EYHA 4A3JB 2VQFL 2KCMA 2CH4W 3CMEA 3S1RB 5EJWA 1A2UA 4OIKA 3CRKC 4BY1G 3GTQH 1X65A 4XQJA 1EIYB 3HOUH 2R6GA 1VQ5A 4RFBA 1WD1A 4C3JH 3ICEA 4ME3A 4XIGS 4KD3A 2QF7A 5F2DA 1BBXC 2ZTEA 4UAIA 4IFDH 3J7A5 1Z7TA 1HHVA 1SAPA 2F0OA 3S2DB 4B3SL 1F2ZA 4NKLA 5IWAL 1L1OC 1KC8C 3W3AA 4C3HG 3DHQA 4A3JH 1LUZA 4UP8A 3CPWA 1YJNA 1PTOC 3MXNB 5LL6X 1UEBA 2DGYA 4HJAA 3MXUA 4JI5Q 1IYUA 2K04A 4LF6L 1SXTA 4X3SA 1KD1C 1U5KA 2CFMA 1EY5A 1STYA 2KCCA 1EU3A 4GKKQ 1HNZQ 5LMNW 3S1QB 5JJZA 2ZJPA 1D5MC 3HZXA 1OXUA 3W1BA 3S2DH 2MFIA 1W6KA 3FVQA 1EWIA 1CZWA 4IOAA 3MTSA 4GN3B 4YWMA 2FINB 3G48A 3LWEA 2ATWA 4DR5Q 4DK3C 4R4TA 1EYDA 3DXJC 5A2QL 1SYCA 2VZAA 3S14B 5M5YB 1SFOB 1A8VA 3ND8A 4V0BA 1ASYA 3S1QH 1B9MA 1XWEA 4KHZA 4QUCA 2B2YC 3A55A 2K5QA 3MXNA 4OX9Q 1HH2P 4JBKA 3A7AB 3NP8A 1GO3E 5LMUQ 3BU2A 1I50B 1MJEA 2VB3X 2AQ3B 3S14H 1JC7A 3EJIA 5M5YH 1YNNC 1SFOH 4OGQC 1WI5A 5JAVA 4LFAQ 4RWSC 3KYHC 1C9OA 1AH9A 3KFUA 5C44G 2UUBQ 2PZWA 4KLKA 1CSQA 1X55A 2F4IA 3PUVA 4ZLTF 3DM3A 1SNOA 2HT1A 2NN6H 3T1HQ 2L11A 2L9HA 4ULLA 4FVMA 1HNXQ 4R9WA 1XMQQ 4A3IG 3HOZH 2DY7A 2IT1A 5IYDG 1K28A 1EQRA 2CW0D 1I50H 2WAQB 1IBKQ 1M90C 1TQOA 2F0GA 4A93B 4CHTB 1YHAA 5CV7A 5ELEA 1EIGA 3BZDB 1PYWD 1AEXA 3QR8A 2JSOA 4P71A 5LL6S 2VNUD 1DZ1A 2CHBD 4EQPA 2N55A 4AYBB 1DGSA 3S2HH 4DR7L 5CV5A 2F03A 1SE4A 4N8X1 3DUZA 5EQ0A 1OXXK 1RDPD 2EIFA 3KOJA 4KY5A 1HRJA 1PTOF 1RF2D 1QWYA 4KHVA 1W2BA 1HA5A 1UE7A 3L9AX 3T56B 5IYCG 1N32L 1IXRA 4A93H 1GUOA 3MFGA 1EY8A 2I5HA 2F4VL 2M9VA 4DV4L 3LNNA 3BYYB 2RVLA 1SNQA 1NUCA 4KJNA 3PO3G 4BBSB 4LW1A 1K8GA 4XYOA 4JI7Q 2PYKA 4P72A 1GD7A 2LY7A 3BDOA 3C3LA 1QUQB 2I0QA 1E0BA 2ICEC 5M9OA 3MHBA 4OWWB 4DV7Q 1UE6A 2EY5A 2VQEQ 1SYFA 3I4NB 1Q8IA 2Z6KC 1EY6A 5ELOA 5TSSA 1FJGQ 1TS4A 1VQCA 4TVAB 5EPKA 3K5NA 4B3RL 1PFMA 3J7YW 1EL0A 4OWTB 3M4PA 3I4MB 3SGIA 1LT6D 4A3MB 1EYAA 1B8AA 1U0LA 1WVLA 4BBSH 1L0XB 2A73B 4G7ZC 4ILWA 1HUMA 5IOCA 1PH8A 1YEZA 1EWHA 4JVZA 2L55A 1JWSD 3TN2A 4N9TA 3HOVB 2Y0SE 1KDBA 3MEHA 2RKSA 4JBMA 3D0FA 1J8IA 3I4NH 1A3VA 4DR6L 1IBLQ 3FP9A 1T5EA 3ITPA 1OXVA 4TKOB 3OW2A 3PMFA 5GAHC 1YZ6A 4ZKBB 3I4MH 4A3MH 4RG1A 4B9WA 5I6WA 2K33A 1GUGA 1BCPF 1KLUD 4PV1C 1QUQA 1MHWC 4CKCA 2LKVA 3OHXC 2K7VA 4IUNA 1XPRA 3HOVH 1P8LA 4JG2A 2SDFA 1S3OA 2Z9HA 1GM5A 4DAMA 1WCMG 1H9SB 1KDCA 2Z4IA 1SYGA 3FKIB 4IOCA 3T1YQ 2F0UA 4DV5L 1VQEA 4RGMA 3H3VC 5I2XA 2R92B 1W6JA 1HTPA 1I94Q 2HD3A 4OO1I 1ZEQX 3R2TA 2F0NA 4XQNA 3NSWA 2SNSA 3D6CA 4L6TB 4A3GB 2OT2A 4G4KA 1R9TB 1HQMC 2A69D 1CKNB 5FLMG 3ZJYC 2GN5A 4R8NA 4ABNA 4LF5Q 2JP1A 3EROA 1R4PB 2ID0A 3FKIH 2XVSA 1HNZL 2MO1A 4ZUJA 5DLQE 2Z4HA 3K0YA 2AUKA 2RDFA 5K36H 4RKBA 3PUZA 2B39A 3U58A 4A3GH 1LTSD 3NWSA 1R9TH 4JV5L 1PLFA 5E7NA 1WYDA 2F0DA 1EY7A 4L5QA 1PFNA 1H9SA 4YCUA 5BR8Q 4AQYQ 4OWXB 1X3FA 1I6HH 1UAPA 4JI1Q 5KYLA 1A62A 4K0KQ 3ER0A 4DNIA 4JI3Q 1DOLA 2NVTB 1NE3A 2EYPA 3CXCA 1I4XA 4KKUA 5IIFA 3PF4A 1KTKA 3STBD 1F2LA 3A56A 4OX9L 1CKNA 4QIWB 2WFWA 1T5XD 3AU7A 3I4LA 1HXYD 3WOEA 4X3KA 1PDQA 5IP7G 3W2DA 1KDAA 1B44D 3I90A 4XT1B 4K6LA 2NVTH 2RF4A 1CHQD 3JAML 2O2LD 4GKJL 4RKLA 5A35A 1YHBA 4PNYA 2PI2E 4KN7C 1GUSA 1XMQL 4IPDA 3DEPA 4ZCKA 3PCOB 3P75A 4O42A 1X3QA 3TBIB 2F0TA 1PZKD 4DUYQ 1PH1A 1IBKL 3UI2A 1JR0D 1P16A 2B2WA 1VQPA 4HTHA 5HGQA 5KYIA 2HDMA 3JAMc 3VYSA 1EEFD 4TRDA 1PTOD 4RH6A 4UP7A 3MFYA 1M4VA 3LGJA 2NVXB 5G3LF 4K2LA 1XYIA 3VR5A 4A3KG 2QW7A 2E2JB 4JI8Q 4MHEA 1TY2A 3GP7A 1SN8A 1TWGB 2L1BA 1CUKA 5NUCA 3M85A 2MO0A 2X6GA 5IYBH 3HOYH 1GHKA 3P7JA 5ELNA 1S72A 1LTTD 2EYFA 1QILA 3RLFA 2ENBA 3S17B 1XPOA 3E6ZX 2R7ZG 1LT4D 4TQUS 4JI2L 2NVXH 3H3VI 2VQFQ 1S5BD 3Q0AA 3I8ZA 2X6LA 3N6RA 4I7ZC 2E2JH 1BUVT 3D3RA 2IHFA 1F9SA 1K73C 3M9BA 2F0IA 1FNWA 1TWGH 2A6EC
chains in the Genus database with same CATH topology
1UE5A 3CW2C 2C35B 2R7DA 2YTYA 4HJ9A 1YBYA 3H0GG 1SLJA 1UE1A 1HJPA 1LTLA 4GLAC 4R4IA 1HR0L 1Y1VG 2CQOA 3GO5A 3KF8B 4KI0A 3S17H 1X54A 1KXLA 4A3DH 3TS2A 1Y1WH 5C44H 5M3MG 3FKIG 5IP9H 3W5OA 5IWAQ 1EOVA 1YI2A 3S16H 4A3BG 4JCVE 1KIXA 4B3RQ 1S40A 1NJIC 3CP0A 3HKZG 2R7FA 4GNXA 1JT8A 4IPHA 2DUDA 3RZOH 1VS0A 3NBHB 4DK6C 3CC4A 4DV2L 2KHJA 5K36G 1JE5A 2IY5B 4A3IH 4L5RC 1L2FA 4JOIA 5J3BA 4A3GG 2XTIA 5IYDH 3PSIA 2JA6H 5GAEC 1X3GA 1KHIA 3AFQA 3K80C 3AQQA 1PA6A 1BKBA 2QGQA 2XGTA 3E9HA 1V1QA 2JA8G 2VW9A 4DUZQ 2VUMH 1NMFA 1VQJA 3WWVA 1Q86C 2VUMG 2V1CC 1PYSB 4JI8L 3AFPA 3GD7A 4YY3Q 5FJ8H 3RLNA 4A3FG 3I4OA 4DR3L 1YJ9A 4POFA 1N9WA 2BH8A 2YTVA 4L5TA 1KL9A 2JA5G 3HKZE 2RCNA 3AEVA 4X66L 1N33Q 1Q7YC 3L7ZC 1D8LA 3CF5A 1B70B 1WOCA 3UDGA 1GVPA 2UUAQ 1V9PA 4LWCA 3T1YL 1Q8KA 4DV0Q 4JI6Q 3I2ZA 4PG3A 5IYCH 5C3EG 2WP8J 2VQFL 2KCMA 1VQAA 4AH6A 2AWNA 1T9HA 3CMEA 4HIKA 1X3EA 1I94L 3GTQH 4BY1G 4NPSA 4UY8C 1X65A 3HOUH 1EIYB 2R6GA 1VQOA 1VQ5A 3PO3H 1NY4A 4C3JH 3M4OH 3ICEA 4ME3A 3F2DA 4XIGS 4WJ3M 3UDXA 2RHQB 3A5ZB 3DLLA 2ZTEA 2JEBI 3U4VA 2R93H 2N49A 3J7A5 4IFDI 3TEHB 1PV4A 2KHIA 1CKMA 2MQHA 3L2PA 2AMCB 4B3SL 1CKOA 2WB1G 1HZBA 3GTPH 3S24A 4AYBE 5IWAL 1MIUA 1L1OC 4A76A 1KC8C 2AKWB 3UDFA 2HIXA 4A3JH 1LUZA 4UP8A 3CPWA 3TS0A 1YJNA 3S1MH 1YITA 1N34Q 3MXNB 1UEBA 4QGUA 3EBEA 2DGYA 4KHPQ 4HJAA 5C4XG 4NXNQ 4B3TQ 1VQ6A 4JI5Q 1E24A 4IJLA 3M7NA 4LF6L 4OXPA 4JBJA 2ZTDA 3CCQA 1KD1C 1U5KA 2CFMA 1H95A 3GTOH 5M5XH 3W1GA 4GKKQ 5GQOA 2HHHQ 1HNZQ 5LMNW 5EAYA 4QIWE 1G51A 4DUZL 1QZGA 2ZJPA 1HNWQ 1W3SA 4JI3L 1YVCA 1OXUA 2B3GA 1YIJA 2JEAI 2WB1E 4YY3L 4PMWA 3W1BA 1VQFA 3JAMi 4Y7NH 2MFIA 1Q81C 1VQ8A 4NXMQ 3S1NH 3S2DH 1A63A 3KJOA 1QVFA 1EWIA 4IOAA 4GN3B 1Q12A 1QVCA 4YWMA 2LXJA 4JYAQ 3G48A 4LUOA 1KQSA 2I5LX 4LFBQ 2ATWA 2N3SA 1N33L 4DR5Q 4DK3C 1IBML 1D7QA 4R4TA 3PUYA 3K7AH 2MNAA 5IYBG 1CSPA 4GLVB 3HOYG 2JK8A 4DR7Q 2VZAA 4H02A 2JA7G 1XMOL 4HIDA 4BA2I 2A8VA 1PH2A 4DPGA 3HFZB 1A8VA 3PIPA 4X64Q 4DV0L 3J81c 3UE0A 1OTCA 4GLXA 1ASYA 3S1QH 3BJUA 4C2MH 1WFQA 3PV0A 4KHZA 2GVAA 2OQKA 3HOXG 3CCMA 4UP9A 4IPGA 1JJ2A 1WCMH 1J5EL 2HIVA 4OX9Q 3CD6A 5GAGC 1HH2P 4JBKA 1GO3E 4BXXG 4PZ6A 5LMUQ 1AE2A 1HZ9A 3BU2A 4MTNA 4DKAC 3G6EA 1MJEA 1XNQL 1VQLA 1C0AA 5FLXc 4XTCS 2B63H 2CWPA 2YTXA 1VQBA 3L0OA 2OTJA 3K7UC 2KCTA 5M5YH 1PH9A 3S14H 4DUYL 1EYGA 1SFOH 3RLOA 3UDIA 1WI5A 4LFAQ 4LF9Q 1HR0W 3KYHC 1VQNA 4DR2L 1C9OA 2JQOA 3KFUA 1SMXA 5C44G 1Y1WG 4A3DG 2UUBQ 1AH9A 5IP9G 4KLKA 1CSQA 1X55A 1TWHH 3PUVA 3DM3A 4YHHQ 4GNXC 2D0PA 5FLMH 1X9NA 2HT1A 2N8NA 3T1HQ 1EQQA 2NN6I 2NZOA 3A5UA 2E5LL 2PNHA 1JJCB 4KHPL 4B3TL 4JI5L 1PH6A 1KAWA 4JOIC 1HNXQ 1XMQQ 2UU9Q 4A3IG 2LSSA 2PQAB 4GN5A 1YJWA 3HOZH 1N36Q 4K0KQ 2IT1A 5IYDG 1EQRA 2JA6G 2D0OA 1IYJB 4GKKL 1I50H 3J80c 1IBKQ 2HHHL 4LF4Q 2OTLA 1M90C 1MKHA 1VQMA 1G291 1YHAA 2R92H 3U4ZA 4A75A 4DR6Q 5FJ8G 4R4QA 3STBC 5C0XI 3CC7A 4JYAL 4LFBL 3ULJA 4P71A 2E2IH 3RZDH 2VNUD 4Y52H 4DR5L 4DV6Q 2IHEA 1OXSC 2OCEA 5LMNQ 1DGSA 3S2HH 4LF8Q 4DR7L 4DV3Q 2YYZA 4P74A 1I5FA 3E9IA 4O0AA 4PZ7A 3F1ZA 1OXXK 2EIFA 3KOJA 4LFCL 3E0EA 4X62Q 1L1OB 1W2BA 1UE7A 1VQIA 5IYCG 1UWVA 1N32L 1IXRA 1Q46A 4POGA 1VQKA 4JI0L 4A93H 1BBWA 2I5HA 3M4QA 2F4VL 4A3LH 3A0JA 3J7ZC 4DV4L 2VL6A 4JI4Q 2ZTCA 3JC66 3HOUG 4IO9A 3PO3G 4LW1A 4DR4L 2E8GA 1K8GA 1XNRQ 3PIOA 4JI7Q 4B3MQ 1O7IA 2PQAA 5LMUL 1G6PA 4P72A 1GD7A 4YWLA 5IP7H 4DV5Q 3PO2H 4DR1Q 4IFDG 4L5SA 1QUQB 4HJ5A 2I0QA 4OWWB 2R93G 4DV7Q 1IL2A 3HOVG 2Y0SG 1UE6A 2VQEQ 5HY6A 1NMGA 4OONA 4LF9L 4LFAL 2F52A 4YWKA 1E7ZA 2Z6KC 4GOPB 5ELOA 4JC0A 3OTOQ 4A3EH 2UUBL 5IT9c 1FJGQ 1VQCA 4TVAB 5M5WH 4B3RL 2PI2A 2B29A 3H15A 1LM0A 4A3EG 2PMZE 3M4PA 4OWTB 4A3JG 3SGIA 3T1HL 2VY3A 4QY7A 4GN4B 1B8AA 1HNXL 1U0LA 2GVBA 3K0XA 3EIVA 1NBWA 4BBSH 1HR0Q 3RR5A 2ES2A 1PH8A 1K9MC 1YEZA 1EUJA 4LF4L 3PUXA 2K5HA 4P75A 2Y0SE 3KJPA 4R1JA 4NB3A 4JBMA 5JJLA 3GTGH 2UXDQ 3D0FA 2UXCQ 1Q1EA 3I4NH 4P73A 4DR6L 1PYBA 1JJGA 1IBLQ 3FP9A 3GTJH 1OXVA 3G4SA 3OW2A 4JV5Q 1E1OA 2ALYB 2RHSB 5GAHC 1EFWA 1YZ6A 4DV1Q 3I4MH 2UXBQ 1FGUA 1GKHA 4FDBA 3CPFA 4RG1A 3F2BA 4DV6L 4A3MH 4A3CH 1AE3A 2ASBA 2QEXA 4LF8L 5JEAG 1VCIA 1K83H 4DV3L 4A3KH 1E3PA 2D62A 2UUAL 1VQ4A 2BA0A 1QUQA 2ZJQA 4JI6L 4X62L 4BBRH 4DAYB 2FXQA 4X65Q 3F2CA 5C4JH 1NTGA 3K8AA 4GNXB 4DR3Q 4GOPA 1XPRA 3G71A 2F3IA 1EIFA 3OYYA 3HOVH 1P8LA 3EN2A 4MZ9A 4JG2A 2Q2UA 1S3OA 2L15A 3PF5A 1GM5A 2AWOA 2CWAA 4DAMA 5AJ3Q 1WCMG 2AHOB 1JB7A 3CC2A 2R7ZH 3NELA 4BY7H 3RNUA 1XPUA 3J81i 4JI7L 4AIMA 1TWAH 1WJJA 4C3IH 3HOWH 4IOCA 3CCLA 3T1YQ 4DV5L 1VQEA 1RIPA 2YU9H 2K14A 2NZHA 4APVA 5M3FH 2B63G 4DV7L 4QQBX 2VQEL 3PUWA 1I94Q 4OO1I 1E1TA 3BZCA 2KBNA 3OTOL 1FJGL 3RN5A 1KRSA 1MJCA 3AYHB 1VQGA 1N34L 4IJHA 1A0IA 4GKJQ 1CKNB 2EXDA 4NXNL 3H0GH 3ZJYC 2NN6G 5FLMG 3J81j 1PH3A 1SRUA 1C7YA 3M3YH 4IFDJ 1Y1VH 2GN5A 4LF5Q 2JJQA 3NEMA 1K3RA 1VQDA 2CCZA 3KF6B 4LF7Q 2ID0A 1XTDA 5M3MH 3HOZG 1BBUA 1I3QH 3FKIH 4HJ8A 1HNZL 4B3SQ 1N8RC 2MO1A 3TQYA 4A3BH 1QVGA 4WJ4A 5DLQE 1VQ9A 2Q2IA 4QL5A 5JJIA 1PVOA 2A1AA 4NXML 3TREA 2BH2A 2UXDL 2Q2TA 2UXCL 2ZM6Q 1ASZA 2R92G 1IBLL 3PUZA 2N78A 5C0XG 4A3GH 3U58A 1R9TH 4LF6Q 1PHJA 4JV5L 2UXBL 5E7NA 4DV1L 3J80i 1WYDA 3CQZH 2KENA 4L5QA 4YCUA 5BR8Q 2NVQH 4AQYQ 2JA8H 4OWXB 3KDFB 1X3FA 1I6HH 3FHWA 4JI1Q 1IZ6A 1SE8A 1A62A 1X56A 1Y14B 1E22A 4LUZA 2UUCQ 3CAMA 3ER0A 4DNIA 4HIOA 4HJ7A 3PGZA 4ALPA 4JI3Q 1TXYA 4X64L 4YCVA 4A3FH 1X6OA 5IE8A 1K0RA 3GTMH 4O2DA 1NE3A 4X65L 2JA5H 1FL0A 5GADC 2WAQG 2ZJRA 3GTLH 3I56A 3CXCA 4A93G 3PF4A 1Q82C 4A3LG 3STBD 3CCUA 1IBMQ 1HZAA 4OX9L 1CKNA 2BA1A 5JEAJ 1QZHA 5AJ3L 1HNWL 4BA1I 1V43A 3BZKA 1B7YB 1L0WA 4A4IA 2WFWA 1XMOQ 2IX1A 4EQ5A 5C3EH 4JI2Q 3KF6A 1TWCH 3K81C 3HKSA 5GROA 1SROA 3GDEA 4AYBG 5IP7G 4LUVA 2JA9A 3NENA 4BY1H 3PO2G 4EX5A 2NVTH 3GTKH 2WAQE 2RF4A 3I7FA 3CMAA 1VQ7A 4YHHL 1J5EQ 2K5VA 3I55A 1PH7A 4GKJL 3Q8DA 1KRTA 3S15H 3CCJA 2E2HH 1YHBA 2PI2E 5JJKA 1XMQL 2UU9L 1XNQQ 4PZ8A 3B6YA 4IPDA 1N36L 1K8AC 4JBWA 4R4CA 4LF5L 3KDFA 1HZCA 3PCOB 4LF7L 4BBSG 4DUYQ 4IPCA 1PH1A 1IBKL 3F8TA 2I5MX 1P16A 1L1OA 2OQ0A 4C3HH 4DR2Q 2Z6KA 1VQPA 1PH4A 4QJFA 1TWFH 1RL2A 2K75A 2IX0A 5HGQA 3RN2A 5C4XH 3S1RH 1Z9FA 2LXKA 2ZM6L 3TRZA 3D31A 4R4OA 3JAMc 2K5NA 3CCVA 4DV2Q 3I4NG 2E5LQ 3CCRA 4UPAA 1XJVA 2OWOA 2K52A 1M1KC 2VS1A 2CKZB 4UP7A 5LMNL 3LGJA 3I4MG 5BR8L 4A3MG 3KLWA 4AQYL 4A3CG 4JI1L 2UUCL 1OXTA 5H1SE 4K0KL 4A3KG 2A19A 4JI8Q 2HQLA 1JMCA 1PFSA 2YV5A 5C0XJ 4BBRG 1Z47A 4J15A 4GOPC 1SN8A 4HIMA 1CUKA 4GS3A 4JI4L 4X66Q 2MO0A 1YNXA 3ERSX 2JE6I 2K50A 3M85A 2H5XA 2EQSA 4YCWA 5IYBH 3CCEA 3HOYH 3MEFA 1BVSA 1VQHA 3IRBA 5ELNA 1S72A 2JA7H 4X6AH 3CCSA 3RLFA 1XNRL 1XPOA 4B3ML 4BY7G 2R7ZG 2K4KA 4TQUS 4JI2L 4LFCQ 3HOWG 3H3VH 4DR1L 3A74A 1J6QA 2NVXH 4LNQA 1LYLA 3H3VI 2VQFQ 1FVIA 2QA4A 2NVYH 1N32Q 2E2JH 2IHFA 4RMFA 5M3FG 4JI0Q 4OO1G 2Q2HA 3HOXH 2F4VQ 4DV4Q 1Q1BA 2Z0SA 1K73C 3VDYA 5IY0A 3M9BA 1SR3A 3ULPA 1TWGH 1YHQA 3U50C 3UE1A 1PH5A 4DR4Q 4BXXH 4MNOA 3ULLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UE5 A;  3CW2 C;  2C35 B;  2R7D A;  2YTY A;  4HJ9 A;  1YBY A;  3H0G G;  1SLJ A;  1UE1 A;  1HJP A;  1LTL A;  4GLA C;  4R4I A;  1HR0 L;  1Y1V G;  2CQO A;  3GO5 A;  3KF8 B;  4KI0 A;  3S17 H;  1X54 A;  1KXL A;  4A3D H;  3TS2 A;  1Y1W H;  5C44 H;  5M3M G;  3FKI G;  5IP9 H;  3W5O A;  5IWA Q;  1EOV A;  1YI2 A;  3S16 H;  4A3B G;  4JCV E;  1KIX A;  4B3R Q;  1S40 A;  1NJI C;  3CP0 A;  3HKZ G;  2R7F A;  4GNX A;  1JT8 A;  4IPH A;  2DUD A;  3RZO H;  1VS0 A;  3NBH B;  4DK6 C;  3CC4 A;  4DV2 L;  2KHJ A;  5K36 G;  1JE5 A;  2IY5 B;  4A3I H;  4L5R C;  1L2F A;  4JOI A;  5J3B A;  4A3G G;  2XTI A;  5IYD H;  3PSI A;  2JA6 H;  5GAE C;  1X3G A;  1KHI A;  3AFQ A;  3K80 C;  3AQQ A;  1PA6 A;  1BKB A;  2QGQ A;  2XGT A;  3E9H A;  1V1Q A;  2JA8 G;  2VW9 A;  4DUZ Q;  2VUM H;  1NMF A;  1VQJ A;  3WWV A;  1Q86 C;  2VUM G;  2V1C C;  1PYS B;  4JI8 L;  3AFP A;  3GD7 A;  4YY3 Q;  5FJ8 H;  3RLN A;  4A3F G;  3I4O A;  4DR3 L;  1YJ9 A;  4POF A;  1N9W A;  2BH8 A;  2YTV A;  4L5T A;  1KL9 A;  2JA5 G;  3HKZ E;  2RCN A;  3AEV A;  4X66 L;  1N33 Q;  1Q7Y C;  3L7Z C;  1D8L A;  3CF5 A;  1B70 B;  1WOC A;  3UDG A;  1GVP A;  2UUA Q;  1V9P A;  4LWC A;  3T1Y L;  1Q8K A;  4DV0 Q;  4JI6 Q;  3I2Z A;  4PG3 A;  5IYC H;  5C3E G;  2WP8 J;  2VQF L;  2KCM A;  1VQA A;  4AH6 A;  2AWN A;  1T9H A;  3CME A;  4HIK A;  1X3E A;  1I94 L;  3GTQ H;  4BY1 G;  4NPS A;  4UY8 C;  1X65 A;  3HOU H;  1EIY B;  2R6G A;  1VQO A;  1VQ5 A;  3PO3 H;  1NY4 A;  4C3J H;  3M4O H;  3ICE A;  4ME3 A;  3F2D A;  4XIG S;  4WJ3 M;  3UDX A;  2RHQ B;  3A5Z B;  3DLL A;  2ZTE A;  2JEB I;  3U4V A;  2R93 H;  2N49 A;  3J7A 5;  4IFD I;  3TEH B;  1PV4 A;  2KHI A;  1CKM A;  2MQH A;  3L2P A;  2AMC B;  4B3S L;  1CKO A;  2WB1 G;  1HZB A;  3GTP H;  3S24 A;  4AYB E;  5IWA L;  1MIU A;  1L1O C;  4A76 A;  1KC8 C;  2AKW B;  3UDF A;  2HIX A;  4A3J H;  1LUZ A;  4UP8 A;  3CPW A;  3TS0 A;  1YJN A;  3S1M H;  1YIT A;  1N34 Q;  3MXN B;  1UEB A;  4QGU A;  3EBE A;  2DGY A;  4KHP Q;  4HJA A;  5C4X G;  4NXN Q;  4B3T Q;  1VQ6 A;  4JI5 Q;  1E24 A;  4IJL A;  3M7N A;  4LF6 L;  4OXP A;  4JBJ A;  2ZTD A;  3CCQ A;  1KD1 C;  1U5K A;  2CFM A;  1H95 A;  3GTO H;  5M5X H;  3W1G A;  4GKK Q;  5GQO A;  2HHH Q;  1HNZ Q;  5LMN W;  5EAY A;  4QIW E;  1G51 A;  4DUZ L;  1QZG A;  2ZJP A;  1HNW Q;  1W3S A;  4JI3 L;  1YVC A;  1OXU A;  2B3G A;  1YIJ A;  2JEA I;  2WB1 E;  4YY3 L;  4PMW A;  3W1B A;  1VQF A;  3JAM i;  4Y7N H;  2MFI A;  1Q81 C;  1VQ8 A;  4NXM Q;  3S1N H;  3S2D H;  1A63 A;  3KJO A;  1QVF A;  1EWI A;  4IOA A;  4GN3 B;  1Q12 A;  1QVC A;  4YWM A;  2LXJ A;  4JYA Q;  3G48 A;  4LUO A;  1KQS A;  2I5L X;  4LFB Q;  2ATW A;  2N3S A;  1N33 L;  4DR5 Q;  4DK3 C;  1IBM L;  1D7Q A;  4R4T A;  3PUY A;  3K7A H;  2MNA A;  5IYB G;  1CSP A;  4GLV B;  3HOY G;  2JK8 A;  4DR7 Q;  2VZA A;  4H02 A;  2JA7 G;  1XMO L;  4HID A;  4BA2 I;  2A8V A;  1PH2 A;  4DPG A;  3HFZ B;  1A8V A;  3PIP A;  4X64 Q;  4DV0 L;  3J81 c;  3UE0 A;  1OTC A;  4GLX A;  1ASY A;  3S1Q H;  3BJU A;  4C2M H;  1WFQ A;  3PV0 A;  4KHZ A;  2GVA A;  2OQK A;  3HOX G;  3CCM A;  4UP9 A;  4IPG A;  1JJ2 A;  1WCM H;  1J5E L;  2HIV A;  4OX9 Q;  3CD6 A;  5GAG C;  1HH2 P;  4JBK A;  1GO3 E;  4BXX G;  4PZ6 A;  5LMU Q;  1AE2 A;  1HZ9 A;  3BU2 A;  4MTN A;  4DKA C;  3G6E A;  1MJE A;  1XNQ L;  1VQL A;  1C0A A;  5FLX c;  4XTC S;  2B63 H;  2CWP A;  2YTX A;  1VQB A;  3L0O A;  2OTJ A;  3K7U C;  2KCT A;  5M5Y H;  1PH9 A;  3S14 H;  4DUY L;  1EYG A;  1SFO H;  3RLO A;  3UDI A;  1WI5 A;  4LFA Q;  4LF9 Q;  1HR0 W;  3KYH C;  1VQN A;  4DR2 L;  1C9O A;  2JQO A;  3KFU A;  1SMX A;  5C44 G;  1Y1W G;  4A3D G;  2UUB Q;  1AH9 A;  5IP9 G;  4KLK A;  1CSQ A;  1X55 A;  1TWH H;  3PUV A;  3DM3 A;  4YHH Q;  4GNX C;  2D0P A;  5FLM H;  1X9N A;  2HT1 A;  2N8N A;  3T1H Q;  1EQQ A;  2NN6 I;  2NZO A;  3A5U A;  2E5L L;  2PNH A;  1JJC B;  4KHP L;  4B3T L;  4JI5 L;  1PH6 A;  1KAW A;  4JOI C;  1HNX Q;  1XMQ Q;  2UU9 Q;  4A3I G;  2LSS A;  2PQA B;  4GN5 A;  1YJW A;  3HOZ H;  1N36 Q;  4K0K Q;  2IT1 A;  5IYD G;  1EQR A;  2JA6 G;  2D0O A;  1IYJ B;  4GKK L;  1I50 H;  3J80 c;  1IBK Q;  2HHH L;  4LF4 Q;  2OTL A;  1M90 C;  1MKH A;  1VQM A;  1G29 1;  1YHA A;  2R92 H;  3U4Z A;  4A75 A;  4DR6 Q;  5FJ8 G;  4R4Q A;  3STB C;  5C0X I;  3CC7 A;  4JYA L;  4LFB L;  3ULJ A;  4P71 A;  2E2I H;  3RZD H;  2VNU D;  4Y52 H;  4DR5 L;  4DV6 Q;  2IHE A;  1OXS C;  2OCE A;  5LMN Q;  1DGS A;  3S2H H;  4LF8 Q;  4DR7 L;  4DV3 Q;  2YYZ A;  4P74 A;  1I5F A;  3E9I A;  4O0A A;  4PZ7 A;  3F1Z A;  1OXX K;  2EIF A;  3KOJ A;  4LFC L;  3E0E A;  4X62 Q;  1L1O B;  1W2B A;  1UE7 A;  1VQI A;  5IYC G;  1UWV A;  1N32 L;  1IXR A;  1Q46 A;  4POG A;  1VQK A;  4JI0 L;  4A93 H;  1BBW A;  2I5H A;  3M4Q A;  2F4V L;  4A3L H;  3A0J A;  3J7Z C;  4DV4 L;  2VL6 A;  4JI4 Q;  2ZTC A;  3JC6 6;  3HOU G;  4IO9 A;  3PO3 G;  4LW1 A;  4DR4 L;  2E8G A;  1K8G A;  1XNR Q;  3PIO A;  4JI7 Q;  4B3M Q;  1O7I A;  2PQA A;  5LMU L;  1G6P A;  4P72 A;  1GD7 A;  4YWL A;  5IP7 H;  4DV5 Q;  3PO2 H;  4DR1 Q;  4IFD G;  4L5S A;  1QUQ B;  4HJ5 A;  2I0Q A;  4OWW B;  2R93 G;  4DV7 Q;  1IL2 A;  3HOV G;  2Y0S G;  1UE6 A;  2VQE Q;  5HY6 A;  1NMG A;  4OON A;  4LF9 L;  4LFA L;  2F52 A;  4YWK A;  1E7Z A;  2Z6K C;  4GOP B;  5ELO A;  4JC0 A;  3OTO Q;  4A3E H;  2UUB L;  5IT9 c;  1FJG Q;  1VQC A;  4TVA B;  5M5W H;  4B3R L;  2PI2 A;  2B29 A;  3H15 A;  1LM0 A;  4A3E G;  2PMZ E;  3M4P A;  4OWT B;  4A3J G;  3SGI A;  3T1H L;  2VY3 A;  4QY7 A;  4GN4 B;  1B8A A;  1HNX L;  1U0L A;  2GVB A;  3K0X A;  3EIV A;  1NBW A;  4BBS H;  1HR0 Q;  3RR5 A;  2ES2 A;  1PH8 A;  1K9M C;  1YEZ A;  1EUJ A;  4LF4 L;  3PUX A;  2K5H A;  4P75 A;  2Y0S E;  3KJP A;  4R1J A;  4NB3 A;  4JBM A;  5JJL A;  3GTG H;  2UXD Q;  3D0F A;  2UXC Q;  1Q1E A;  3I4N H;  4P73 A;  4DR6 L;  1PYB A;  1JJG A;  1IBL Q;  3FP9 A;  3GTJ H;  1OXV A;  3G4S A;  3OW2 A;  4JV5 Q;  1E1O A;  2ALY B;  2RHS B;  5GAH C;  1EFW A;  1YZ6 A;  4DV1 Q;  3I4M H;  2UXB Q;  1FGU A;  1GKH A;  4FDB A;  3CPF A;  4RG1 A;  3F2B A;  4DV6 L;  4A3M H;  4A3C H;  1AE3 A;  2ASB A;  2QEX A;  4LF8 L;  5JEA G;  1VCI A;  1K83 H;  4DV3 L;  4A3K H;  1E3P A;  2D62 A;  2UUA L;  1VQ4 A;  2BA0 A;  1QUQ A;  2ZJQ A;  4JI6 L;  4X62 L;  4BBR H;  4DAY B;  2FXQ A;  4X65 Q;  3F2C A;  5C4J H;  1NTG A;  3K8A A;  4GNX B;  4DR3 Q;  4GOP A;  1XPR A;  3G71 A;  2F3I A;  1EIF A;  3OYY A;  3HOV H;  1P8L A;  3EN2 A;  4MZ9 A;  4JG2 A;  2Q2U A;  1S3O A;  2L15 A;  3PF5 A;  1GM5 A;  2AWO A;  2CWA A;  4DAM A;  5AJ3 Q;  1WCM G;  2AHO B;  1JB7 A;  3CC2 A;  2R7Z H;  3NEL A;  4BY7 H;  3RNU A;  1XPU A;  3J81 i;  4JI7 L;  4AIM A;  1TWA H;  1WJJ A;  4C3I H;  3HOW H;  4IOC A;  3CCL A;  3T1Y Q;  4DV5 L;  1VQE A;  1RIP A;  2YU9 H;  2K14 A;  2NZH A;  4APV A;  5M3F H;  2B63 G;  4DV7 L;  4QQB X;  2VQE L;  3PUW A;  1I94 Q;  4OO1 I;  1E1T A;  3BZC A;  2KBN A;  3OTO L;  1FJG L;  3RN5 A;  1KRS A;  1MJC A;  3AYH B;  1VQG A;  1N34 L;  4IJH A;  1A0I A;  4GKJ Q;  1CKN B;  2EXD A;  4NXN L;  3H0G H;  3ZJY C;  2NN6 G;  5FLM G;  3J81 j;  1PH3 A;  1SRU A;  1C7Y A;  3M3Y H;  4IFD J;  1Y1V H;  2GN5 A;  4LF5 Q;  2JJQ A;  3NEM A;  1K3R A;  1VQD A;  2CCZ A;  3KF6 B;  4LF7 Q;  2ID0 A;  1XTD A;  5M3M H;  3HOZ G;  1BBU A;  1I3Q H;  3FKI H;  4HJ8 A;  1HNZ L;  4B3S Q;  1N8R C;  2MO1 A;  3TQY A;  4A3B H;  1QVG A;  4WJ4 A;  5DLQ E;  1VQ9 A;  2Q2I A;  4QL5 A;  5JJI A;  1PVO A;  2A1A A;  4NXM L;  3TRE A;  2BH2 A;  2UXD L;  2Q2T A;  2UXC L;  2ZM6 Q;  1ASZ A;  2R92 G;  1IBL L;  3PUZ A;  2N78 A;  5C0X G;  4A3G H;  3U58 A;  1R9T H;  4LF6 Q;  1PHJ A;  4JV5 L;  2UXB L;  5E7N A;  4DV1 L;  3J80 i;  1WYD A;  3CQZ H;  2KEN A;  4L5Q A;  4YCU A;  5BR8 Q;  2NVQ H;  4AQY Q;  2JA8 H;  4OWX B;  3KDF B;  1X3F A;  1I6H H;  3FHW A;  4JI1 Q;  1IZ6 A;  1SE8 A;  1A62 A;  1X56 A;  1Y14 B;  1E22 A;  4LUZ A;  2UUC Q;  3CAM A;  3ER0 A;  4DNI A;  4HIO A;  4HJ7 A;  3PGZ A;  4ALP A;  4JI3 Q;  1TXY A;  4X64 L;  4YCV A;  4A3F H;  1X6O A;  5IE8 A;  1K0R A;  3GTM H;  4O2D A;  1NE3 A;  4X65 L;  2JA5 H;  1FL0 A;  5GAD C;  2WAQ G;  2ZJR A;  3GTL H;  3I56 A;  3CXC A;  4A93 G;  3PF4 A;  1Q82 C;  4A3L G;  3STB D;  3CCU A;  1IBM Q;  1HZA A;  4OX9 L;  1CKN A;  2BA1 A;  5JEA J;  1QZH A;  5AJ3 L;  1HNW L;  4BA1 I;  1V43 A;  3BZK A;  1B7Y B;  1L0W A;  4A4I A;  2WFW A;  1XMO Q;  2IX1 A;  4EQ5 A;  5C3E H;  4JI2 Q;  3KF6 A;  1TWC H;  3K81 C;  3HKS A;  5GRO A;  1SRO A;  3GDE A;  4AYB G;  5IP7 G;  4LUV A;  2JA9 A;  3NEN A;  4BY1 H;  3PO2 G;  4EX5 A;  2NVT H;  3GTK H;  2WAQ E;  2RF4 A;  3I7F A;  3CMA A;  1VQ7 A;  4YHH L;  1J5E Q;  2K5V A;  3I55 A;  1PH7 A;  4GKJ L;  3Q8D A;  1KRT A;  3S15 H;  3CCJ A;  2E2H H;  1YHB A;  2PI2 E;  5JJK A;  1XMQ L;  2UU9 L;  1XNQ Q;  4PZ8 A;  3B6Y A;  4IPD A;  1N36 L;  1K8A C;  4JBW A;  4R4C A;  4LF5 L;  3KDF A;  1HZC A;  3PCO B;  4LF7 L;  4BBS G;  4DUY Q;  4IPC A;  1PH1 A;  1IBK L;  3F8T A;  2I5M X;  1P16 A;  1L1O A;  2OQ0 A;  4C3H H;  4DR2 Q;  2Z6K A;  1VQP A;  1PH4 A;  4QJF A;  1TWF H;  1RL2 A;  2K75 A;  2IX0 A;  5HGQ A;  3RN2 A;  5C4X H;  3S1R H;  1Z9F A;  2LXK A;  2ZM6 L;  3TRZ A;  3D31 A;  4R4O A;  3JAM c;  2K5N A;  3CCV A;  4DV2 Q;  3I4N G;  2E5L Q;  3CCR A;  4UPA A;  1XJV A;  2OWO A;  2K52 A;  1M1K C;  2VS1 A;  2CKZ B;  4UP7 A;  5LMN L;  3LGJ A;  3I4M G;  5BR8 L;  4A3M G;  3KLW A;  4AQY L;  4A3C G;  4JI1 L;  2UUC L;  1OXT A;  5H1S E;  4K0K L;  4A3K G;  2A19 A;  4JI8 Q;  2HQL A;  1JMC A;  1PFS A;  2YV5 A;  5C0X J;  4BBR G;  1Z47 A;  4J15 A;  4GOP C;  1SN8 A;  4HIM A;  1CUK A;  4GS3 A;  4JI4 L;  4X66 Q;  2MO0 A;  1YNX A;  3ERS X;  2JE6 I;  2K50 A;  3M85 A;  2H5X A;  2EQS A;  4YCW A;  5IYB H;  3CCE A;  3HOY H;  3MEF A;  1BVS A;  1VQH A;  3IRB A;  5ELN A;  1S72 A;  2JA7 H;  4X6A H;  3CCS A;  3RLF A;  1XNR L;  1XPO A;  4B3M L;  4BY7 G;  2R7Z G;  2K4K A;  4TQU S;  4JI2 L;  4LFC Q;  3HOW G;  3H3V H;  4DR1 L;  3A74 A;  1J6Q A;  2NVX H;  4LNQ A;  1LYL A;  3H3V I;  2VQF Q;  1FVI A;  2QA4 A;  2NVY H;  1N32 Q;  2E2J H;  2IHF A;  4RMF A;  5M3F G;  4JI0 Q;  4OO1 G;  2Q2H A;  3HOX H;  2F4V Q;  4DV4 Q;  1Q1B A;  2Z0S A;  1K73 C;  3VDY A;  5IY0 A;  3M9B A;  1SR3 A;  3ULP A;  1TWG H;  1YHQ A;  3U50 C;  3UE1 A;  1PH5 A;  4DR4 Q;  4BXX H;  4MNO A;  3ULL A; 
#chains in the Genus database with same CATH topology
 2CW0 C;  1CK1 A;  2R7D A;  1TS2 A;  2YTY A;  2NTT A;  3NXW A;  1KNA A;  1HJP A;  4GLA C;  4R8I A;  2NYZ D;  3GO5 A;  3S17 H;  4IUP A;  5IP9 H;  4LAA A;  5IWA Q;  2M00 A;  1YNN D;  1LTB D;  1KIX A;  2IJ0 A;  5J22 A;  2WKC A;  3HKZ G;  2R7F A;  1BCP D;  5C5L A;  4J1M A;  1CHP D;  2KHJ A;  2O5J C;  1EY9 A;  3NQT A;  4CJ2 C;  4PMB A;  3V05 A;  1EIH A;  3AQQ A;  2QGQ A;  2JA8 G;  4HSP A;  1NMF A;  3FRP B;  4HN7 A;  3TME A;  3AFP A;  5EGT A;  5FOB B;  4A3F G;  3I4O A;  1MI2 A;  2FMM A;  1N9W A;  1CTM A;  2JA5 G;  2B2T C;  3E5S A;  5CV8 A;  3AEV A;  4X66 L;  2E2H B;  1NAP A;  3BG3 A;  1RTO A;  1WOC A;  3X3N A;  3T1Y L;  4HR7 B;  1G2S A;  4IQZ A;  4JI6 Q;  3WDN A;  1NR2 A;  4XQQ A;  1I94 L;  1X3E A;  1S5F D;  5C4X B;  1GHJ A;  5IT9 L;  2C5C A;  2Z1C A;  3H94 A;  4UY8 C;  3KLS A;  4CDC C;  1NY4 A;  2ZXP A;  4WJ3 M;  3GTO B;  1FR3 A;  2R93 H;  2N49 A;  2XWB B;  1VF5 C;  1LTA D;  4DFA A;  3J7A V;  1DYQ A;  4RGO S;  3S1N B;  2AKW B;  5CV9 A;  1ZXT A;  3TS0 A;  1YIT A;  3JAM E;  4QGU A;  4IJL A;  1D6E C;  4J6H A;  2RDH A;  3CCQ A;  4JBJ A;  3ONA B;  1J9O A;  5JPM C;  3GTO H;  2KED A;  1SMY D;  3GQB A;  3NPP A;  5CBA E;  4JI3 L;  1CZG A;  4C2M B;  1XTC D;  2WB1 E;  1VQ8 A;  3JAM i;  1VQF A;  3KLS X;  4DXG A;  3S1N H;  3KBG A;  1AP0 A;  2R3Z A;  3HRZ C;  1QVC A;  3T13 A;  4F7X A;  2LXJ A;  2EVB A;  1KQS A;  2I5L X;  3TP7 A;  1D7Q A;  3OPO A;  3O13 A;  2IWH A;  1CSP A;  1TS5 A;  2JK8 A;  2B63 B;  4DR7 Q;  1U9R A;  3KLR A;  2JA7 G;  5FLX L;  1PH2 A;  3HFZ B;  4DV0 L;  2F0K A;  4GLX A;  3BJU A;  3WOF A;  4C2M H;  3QOL A;  1JQY D;  1WFQ A;  2IPK D;  2L0C A;  2B2V C;  1CQF A;  4IUU A;  3Q22 A;  2J7Z A;  3HOX G;  2A6H D;  3EQL C;  3CCM A;  4IPG A;  1JJ2 A;  1A6X A;  3I3C A;  4PZ6 A;  1AE2 A;  4DKA C;  1C0A A;  3OIQ A;  1VQL A;  5L37 A;  5FLX c;  2OTJ A;  2B63 H;  2CWP A;  2YTX A;  1VQB A;  5DNF A;  4DUY L;  3UDI A;  3M7N A;  1QOH A;  1HR0 W;  4A3D G;  2EY2 A;  4DN4 M;  5G3L D;  4YHH Q;  4GNX C;  2D0P A;  1FNV A;  3RZD B;  4K5V A;  2N8N A;  1EQQ A;  3A5U A;  4KHP L;  4B3T L;  2KHS A;  2UU9 Q;  2LSS A;  1A3T A;  1SNC A;  2JA6 G;  4DNR B;  2QDL A;  3HS0 C;  3C2P A;  3I91 A;  3G6J B;  4HCS A;  4A75 A;  4DR6 Q;  5FJ8 G;  3A8K E;  4R4Q A;  3STB C;  4C3J B;  3VYU A;  1ML0 D;  1WTR A;  1TII D;  1B1Z A;  4BS9 A;  1SBB B;  3R2I A;  4FNF A;  4X3T A;  3ULJ A;  3RZD H;  4JPB W;  2IHE A;  1B3Q A;  4CJ0 B;  1RTN A;  2ZT9 C;  1B9N A;  1EFI D;  2YYZ A;  1I5F A;  3E9I A;  4O0A A;  3K59 A;  5E3F A;  1L1O B;  2VXW A;  5CGK A;  5M5W B;  4POG A;  1PTO B;  2E76 C;  4OIJ A;  4A3L H;  1CA5 A;  1DON A;  5FO9 B;  1BF4 A;  2F1M A;  2EE1 A;  4K2K A;  1PRT C;  1ZYR D;  2F0L A;  3M7G A;  4DAP A;  1XNR Q;  5JVG 3;  2TSS A;  3RUZ A;  5C3W A;  3D4R A;  4N9P A;  4DV5 Q;  1HCZ A;  4HJ5 A;  1MD2 D;  1V8Q A;  1PFB A;  4L5S A;  1IL2 A;  2Y0S G;  5HY6 A;  3SXH A;  1NMG A;  4OON A;  4LF9 L;  4YWK A;  4GOP B;  5M5W H;  2B29 A;  3H15 A;  1LM0 A;  1PTO H;  3NE5 B;  1PMR A;  1K83 B;  4ZYS A;  3K0X A;  1BO0 A;  3RR5 A;  3C1E A;  4BBR B;  3TZU A;  2PZU A;  1EUJ A;  4LF4 L;  5FK9 C;  1BQQ T;  3KJP A;  2RCF A;  4Q5V A;  4R1J A;  3CKI B;  1CM9 A;  2C9O A;  5DM6 3;  1I4Q A;  4JV5 Q;  1E1O A;  3HOW B;  4QUF A;  1GKH A;  4FDB A;  3CPF A;  4DV6 L;  1FGB D;  2KVM A;  1AE3 A;  4LF8 L;  5JEA G;  4DV3 L;  1K83 H;  1G8Z D;  3D6W A;  2N88 A;  4JI6 L;  2ZJQ A;  4X62 L;  4BBR H;  1HQR D;  1JOK A;  3F2C A;  4GOP A;  1RJT A;  1EIF A;  3A8I E;  5I9P A;  4ZUI A;  2Q2U A;  5C4H A;  3TDQ A;  3C1F A;  1B53 A;  2L15 A;  3PF5 A;  1JB7 A;  3HOZ B;  3CC2 A;  4EQN A;  3HOW H;  1TWA H;  2QDB A;  1RIP A;  2L5T A;  4OO1 H;  1BCP C;  3OTO L;  2KBN A;  1KRS A;  3AYH B;  4CKB A;  2EYM A;  4IJH A;  1D1I A;  1A0I A;  5J1Z A;  4C56 C;  4GKJ Q;  5E1F A;  3S2H B;  3H0G H;  2D2C C;  2DNC A;  2G9D A;  2ICI A;  1Y1V H;  2A6E D;  2OF1 A;  1K3R A;  4KKT A;  2CCZ A;  1SYB A;  1DXM A;  3HEJ A;  5EBC A;  4HJ8 A;  1LTI D;  2QCP X;  2JXM B;  3NTI A;  2BCO A;  2Q2I A;  5JJI A;  1PRT F;  2Q2T A;  1ASZ A;  2R92 G;  4FXD A;  5C0X G;  4IZ8 A;  2UXB L;  1FD7 D;  4DV1 L;  2KEN A;  3P1H A;  3FHW A;  4K5X A;  1SE8 A;  1X56 A;  1E22 A;  4LUZ A;  4BY1 B;  3CAM A;  4RA8 A;  1ILQ A;  2FHT A;  3I73 A;  3PGZ A;  1F2Y A;  4ALP A;  1X32 A;  2KEE A;  4YCV A;  1JE4 A;  1X6O A;  4IN3 A;  2AUJ D;  4X65 L;  1I4G A;  5GAD C;  2ZJR A;  1U4L A;  3OMG A;  3DWP A;  3S15 B;  1Q82 C;  4GZY C;  4B9X A;  1IBM Q;  1HZA A;  2BA1 A;  2FMC A;  5IGC A;  1QZH A;  5AJ3 L;  3BZK A;  1B7Y B;  1F2M A;  4A4I A;  1XMO Q;  4EQ5 A;  4JI2 Q;  3K81 C;  4OL7 A;  2PCF B;  1SRO A;  3PO2 G;  4BY1 H;  1VDZ A;  4IUR A;  2WAQ E;  3CMA A;  1BNZ A;  4YHH L;  5C4Z A;  2CH4 A;  3I55 A;  3S15 H;  3DM1 A;  4HMJ A;  1WTP A;  4M1U B;  2EJF C;  4UDU C;  1NCV A;  1SMY C;  2SEB D;  1SE2 A;  2UU9 L;  4K5W A;  1XNQ Q;  4PZ8 A;  3ERQ A;  3VR2 A;  5IGD A;  5C6A A;  4IPC A;  1EQT A;  2B8F A;  2KQ3 A;  4C3H H;  2Q8R E;  2Z6K A;  1PH4 A;  4M8A A;  2K75 A;  4RHR A;  2IX0 A;  3DEO A;  5CYU A;  3RN2 A;  1Z9F A;  2LXK A;  2NTS A;  1ICW A;  2K5N A;  1SNP A;  5CBE E;  4UPA A;  2F0E A;  1D1K A;  3KLW A;  4A3C G;  2P5Z X;  1RCV D;  3GV3 A;  1OXT A;  2UUC L;  2NVY B;  5ELD A;  2MUY A;  2EYJ A;  1JMC A;  2YV5 A;  2A6H C;  4HIM A;  4X66 Q;  1JOQ A;  2K50 A;  3QO2 A;  2EQS A;  3MEF A;  5A2Q E;  1IKL A;  4X6A H;  2D9U A;  3CCS A;  1XNR L;  1BOS A;  4BY7 G;  5C44 B;  4LFC Q;  3H3V H;  4C3I G;  5DEH A;  4LNQ A;  2I46 A;  2NVY H;  2RSO A;  4HED A;  5EPL A;  5M3F G;  5CC4 A;  2Z8L A;  3CU7 A;  4I65 A;  1Q1B A;  2Z0S A;  4A3I B;  3NUC A;  4CDE C;  2EYO A;  2L12 A;  1YHQ A;  2EYL A;  1G6Z A;  3ULL A;  3MZ5 A;  1I6H B;  3CW2 C;  3TSS A;  2C35 B;  1YBY A;  3KK7 A;  2CQO A;  4KI0 A;  4OHJ A;  1X54 A;  5BN4 A;  5C44 H;  1R4Q B;  5M3M G;  3K5L A;  2JYO A;  3W5O A;  4K8J A;  4A3B G;  4JCV E;  3EA6 A;  4I7A A;  2DUD A;  3NBH B;  4PMC A;  3CC4 A;  2A68 C;  4WOR A;  4A3I H;  3SK5 A;  4JOI A;  4L5R C;  1B4O A;  1BR9 A;  5IYD H;  3TP6 A;  5GAE C;  1KHI A;  4DF7 A;  2F0Q A;  4U67 3;  1PA6 A;  1D2B A;  3MC0 B;  1STB A;  2VW9 A;  5EBD A;  1VQJ A;  2PMZ B;  2VUM G;  2V1C C;  2QIL A;  3R8B A;  5LHY 1;  1E2Z A;  4L63 B;  4ID6 A;  1DOK A;  3PO3 B;  4E6I A;  2ZXO A;  2EZV A;  1YJ9 A;  1KL9 A;  2RCN A;  1JWM D;  4ODG A;  3VYT A;  1Q7Y C;  1F9Q A;  1ZYR C;  1D8L A;  3CF5 A;  2X69 A;  2V4D A;  5IGE A;  1WTW A;  3ZYY X;  3FPU B;  2MGS A;  3GTP B;  2B8G A;  4DK0 A;  1Q8K A;  4DV0 Q;  4G7O C;  3I2Z A;  3SHL A;  5IYC H;  5C3E G;  2WP8 J;  1VQA A;  4AH6 A;  4NPS A;  1S4Z A;  3PO3 H;  3NBH A;  4KMU C;  3F2D A;  4HAE A;  2RHQ B;  5M5X B;  1TT2 A;  3A5Z B;  3U4V A;  1PRT D;  3TEH B;  1PV4 A;  3BVM A;  3L2P A;  1VMC A;  2WB1 G;  1HZB A;  3GTP H;  3S24 A;  3FEW X;  4FF1 A;  1MIU A;  1AN8 A;  5DM7 3;  3UDF A;  4KN4 C;  4CDF C;  1N34 Q;  3X3M A;  3HOY B;  2ZXR A;  3BVG A;  3K7A B;  2Q8T A;  4KHP Q;  5C4X G;  1AZP A;  4B3T Q;  1VQ6 A;  4CJ1 B;  1AW7 A;  1H9J A;  4TSS A;  3URY A;  5I2Y A;  1H95 A;  1QE6 A;  5M5X H;  3W1G A;  5GQO A;  4QIW E;  4DUZ L;  1QZG A;  3J81 L;  2B3G A;  1YIJ A;  1SNM A;  2DJG C;  4RGT A;  4NXM Q;  4Y7N H;  1Q81 C;  1A63 A;  4H44 C;  3KJO A;  1ET6 A;  1QVF A;  1WCM B;  1Q12 A;  1N33 L;  1B3A A;  1IBM L;  3PUY A;  2RSN A;  3K7A H;  1B50 A;  3D8G A;  4WFN 3;  1XMO L;  4HID A;  1SJH D;  5KNC A;  2M2L A;  1D5X C;  1ENF A;  1SYE A;  4X64 Q;  3J81 c;  5BN5 A;  1TWH B;  3PV0 A;  1MGS A;  2GVA A;  2WAC A;  2EJM A;  4UP9 A;  3KBX A;  1ENC A;  1KNE A;  1WCM H;  3CD6 A;  5GAG C;  4BXX G;  4MTN A;  3G6E A;  5IGG A;  1XNQ L;  1WD0 A;  3L0O A;  3J80 L;  1PXU A;  1EYG A;  3KUP A;  3RLO A;  3BDC A;  4LF9 Q;  1Y1W G;  2K6A A;  3K57 A;  1TWH H;  2DNE A;  1X9N A;  2F3V A;  1HFG A;  5FLM H;  1A2T A;  2XIW A;  4KY6 A;  1DCZ A;  4RHS A;  2E2D C;  2D0O A;  3J80 c;  2HHH L;  4MIU A;  4LF4 Q;  2OTL A;  1MKH A;  1SYD A;  2BOS A;  4LJZ C;  2XNA C;  4K8I A;  3U4Z A;  3VA7 A;  5C0X I;  3GV6 A;  3CC7 A;  1E2W A;  4JYA L;  1GUW A;  4LFB L;  2O5I C;  1VF7 A;  4DV6 Q;  3Q6S A;  1OXS C;  2KA7 A;  5LMN Q;  2R93 B;  4FF4 A;  1O7Y A;  1STG A;  4WRD A;  4LF8 Q;  2BDO A;  4DV3 Q;  2RDG A;  3F2U A;  4LFC L;  4H13 C;  4X62 Q;  3Q23 A;  5E4W C;  2KUM A;  4A3E B;  1VQI A;  4DXF A;  1Q46 A;  1VQK A;  1CFM A;  1EEI D;  4JI4 Q;  3VR4 A;  4L8J A;  2SOB A;  3EFX D;  4IO9 A;  3HOU G;  5KIX A;  4C3J G;  2A74 C;  1SEB D;  1G6P A;  1C4Q A;  4MTK A;  5IP7 H;  1AZQ A;  4IFD G;  4Q0F A;  1LLR D;  3QJY A;  4DA2 A;  1E7Z A;  3OTO Q;  1M8A A;  1QB5 D;  4A3E H;  1DOM A;  4LMQ D;  1IHZ A;  5IT9 c;  3GTJ B;  1GXD C;  1RHP A;  4A3J G;  3PQI A;  4DAV A;  1I4P A;  2VY3 A;  4QY7 A;  4A3K B;  2GVB A;  2HDL A;  3VR6 A;  5CR3 A;  4ZK9 B;  5EKL A;  2WKD A;  3PUX A;  4P75 A;  2Z6B A;  4NB3 A;  3SDZ A;  4P73 A;  3GTJ H;  2D5D A;  2UXB Q;  2ALY B;  1NR4 A;  1EFW A;  4DV1 Q;  5HGT A;  1FGU A;  3D4W A;  2NZ1 D;  4XT3 B;  2YU9 B;  2QEX A;  5CV4 A;  1VCI A;  4A3K H;  4RAU C;  1E3P A;  2D62 A;  1VQ4 A;  1EY0 A;  2BA0 A;  4DGZ A;  2EOT A;  5COR A;  2FXQ A;  4X65 Q;  2E75 C;  1STN A;  1NTG A;  3K8A A;  4GNX B;  3DWQ A;  2F3I A;  3H91 A;  3G71 A;  3EN2 A;  4MZ9 A;  3NTK A;  4B08 A;  4NMZ A;  2K01 A;  1JOR A;  5AJ3 Q;  2R7Z H;  2AHO B;  3NEL A;  3RNU A;  3J81 i;  4FF2 A;  1I3Q B;  4AIM A;  4XYQ A;  3HG9 A;  2EY6 A;  1QJO A;  3K58 A;  2YU9 H;  2K14 A;  3HKZ B;  1EWC A;  1ZKO A;  4APV A;  1WTV A;  1Q90 A;  3PUW A;  1CQV A;  3BVZ A;  1E1T A;  2B2V A;  1DM0 B;  2O4X A;  3ND9 A;  1MJC A;  1MSH A;  2NBF A;  1OO9 B;  1N34 L;  1ILP A;  3CQZ B;  1CT1 D;  2BDN A;  3VA5 A;  3FMC A;  3FPP A;  2NVQ B;  2NN6 G;  4MN3 A;  2CVR A;  2JA8 B;  1SRU A;  4KTA A;  4X3U A;  2KCN A;  4KJO A;  2JJQ A;  1VQD A;  4O1N A;  3KF6 B;  3HOZ G;  2L4N A;  4A3F B;  1I3Q H;  1YNJ C;  3TQY A;  4WJ4 A;  2JA5 B;  2K5W A;  4NP5 A;  4QL5 A;  2LFN A;  2H4O A;  2A1A A;  5EPJ A;  3TRE A;  4NXM L;  2B2U A;  2EPB A;  2BH2 A;  2K1B A;  5KNB A;  2UXD L;  3K5O A;  3T16 A;  2UXC L;  2F0S A;  2F3W A;  2F0P A;  1PRT B;  1B2T A;  2FFK B;  3J80 i;  1EZ6 A;  3CQZ H;  2A68 D;  1LV9 A;  3NHH A;  3N52 A;  2NVQ H;  1TWC B;  2JA8 H;  3KDF B;  1IZ6 A;  2UUC Q;  1Y14 B;  3K6O A;  4HIO A;  4G57 A;  1TXY A;  4U68 A;  5JPN C;  1TU2 B;  4X64 L;  4A3F H;  2NWG A;  5IE8 A;  1WTX A;  3GTK B;  1IL8 A;  2JA5 H;  2HCC A;  2WAQ G;  3NWT A;  3HGB A;  4A93 G;  2PPB C;  2DN8 A;  3CCU A;  4BWG B;  5JEA J;  1HNW L;  2OXP A;  1U4P A;  4BA1 I;  2MJ8 A;  1V43 A;  1K8M A;  1SJE D;  3A7L A;  3EVQ A;  2RBM A;  1Y8N B;  3KF6 A;  1TWC H;  3QWN A;  5GRO A;  2SNM A;  4AYB G;  2K03 A;  3NEN A;  1L0Y B;  5IT9 E;  3GTK H;  4ZQ3 A;  2WIN B;  1J5E Q;  2K5V A;  4F87 A;  5E4X A;  1UEA B;  4OEM B;  5JJK A;  1K8A C;  2J0T D;  1C48 A;  4JBW A;  3KDF A;  5ELB A;  4LF7 L;  4BBS G;  5D3D A;  3F8T A;  1L1O A;  4DR2 Q;  2F0H A;  1EQV A;  1RL2 A;  4IUV A;  1H9K A;  3S1R H;  1CI3 M;  2ZM6 L;  3SE0 A;  4RGN A;  3I4N G;  2E5L Q;  2JA7 B;  3CCR A;  2K28 A;  1XJV A;  2OWO A;  2K52 A;  1M1K C;  1TWA B;  2VS1 A;  3C46 A;  5LMN L;  3I4M G;  1U4R A;  1DJR D;  1S5E D;  4A3M G;  1KAA A;  2DJF C;  2F0F A;  2XN9 C;  1IW7 C;  1SSO A;  2A5H A;  1BCP B;  2G9H D;  3HOX B;  4IAL A;  2XRQ D;  1PFS A;  5C0X J;  1BDO A;  2F0J A;  2K05 A;  4GOP C;  4GS3 A;  3H0G B;  4JI4 L;  1YNX A;  3HOV G;  4YCW A;  1Y1V B;  4XXE A;  3L3O C;  3IRB A;  1JB3 A;  3I72 A;  2JA7 H;  3G7L A;  5T1G A;  4A3D B;  2K4K A;  4H0L C;  5FLX E;  3S16 B;  1J6Q A;  1FVI A;  1QCB D;  4RMF A;  3HP3 A;  4JI0 Q;  2Q2H A;  3VYR A;  3HOX H;  3RZO B;  2B2Y A;  5KEE A;  5EKK A;  2JA6 B;  3U50 C;  4DR4 Q;  1LTR D;  1UE5 A;  3IKJ A;  4HJ9 A;  1SLJ A;  1UE1 A;  3IAY A;  4CGY B;  2KEC A;  4R4I A;  1KXL A;  4A3D H;  3BS1 A;  3TS2 A;  1ESR A;  3NBI A;  3TP5 A;  3FKI G;  3S16 H;  1I6V C;  1YI2 A;  1H9R A;  1JT8 A;  4OEL B;  3RZO H;  1VS0 A;  4IUQ A;  2NB0 A;  4DV2 L;  2F0W A;  4N8F A;  5K36 G;  1HA6 A;  1L2F A;  4A3G G;  3PSI A;  2JA6 H;  1WTH A;  1GJX A;  1LAC A;  5FKA C;  2XGT A;  3E9H A;  4G7H C;  4DUZ Q;  1Q86 C;  2KOL A;  1PYS B;  2HQE A;  2J4X A;  5FJ8 H;  1CA6 A;  3RLN A;  5HUR A;  1EY4 A;  4NDX A;  3M4O B;  2BH8 A;  4L5T A;  1TY0 A;  5ISR A;  1N33 Q;  3SK6 A;  4HSV A;  1JCK B;  2EJG C;  1B70 B;  2F0V A;  2Y0S B;  1RKN A;  3TP8 A;  2UUA Q;  1V9P A;  3VR3 A;  4C3H B;  4QB4 A;  4ME5 A;  4QCL A;  3S1M B;  2AWN A;  1T9H A;  4JK1 C;  4HIK A;  4XDX A;  3P20 A;  4S3S A;  1VQO A;  2PNR C;  4ZRZ A;  3M4O H;  3Q24 A;  1Q3L A;  4FO2 A;  3UDX A;  4KK7 A;  1V1P B;  3DLL A;  1HUN A;  1LT5 D;  2JEB I;  2I07 B;  4IFD I;  2KHI A;  1CKM A;  2MQH A;  2AMC B;  4C1N K;  1CKO A;  4EGV A;  4AYB E;  4A76 A;  2WII B;  2HIX A;  3S1M H;  4KKS A;  3EBE A;  4K14 A;  4NXN Q;  1E24 A;  1E2V A;  4OXP A;  2ZTD A;  4K6D A;  3FDT A;  1Y8O B;  1I4R A;  2HHH Q;  5EAY A;  1FNU A;  1G51 A;  1W3S A;  5I9O A;  1YVC A;  4FF3 A;  2JEA I;  3SEB A;  4YY3 L;  4PMW A;  1TVX A;  1ONL A;  1LT3 D;  4V19 0;  4DNT B;  3H09 A;  4JYA Q;  4LFB Q;  4LUO A;  1EOT A;  2N3S A;  3CHB D;  4CDD C;  1MBY A;  4PQX A;  5JEA H;  2MNA A;  5IYB G;  4GLV B;  3QG1 A;  4Z9C B;  3HOY G;  1K0S A;  3OIP A;  1V1P A;  4H02 A;  4BA2 I;  2A8V A;  1XX8 A;  5KRU A;  4DPG A;  3PIP A;  2HCI A;  3UE0 A;  1OTC A;  5T1I A;  4QF4 A;  3AMU A;  3QOJ A;  1XXG A;  3SK8 A;  1TKW B;  3U9S A;  4ZKC B;  4DU9 A;  1O80 A;  2OQK A;  1J5E L;  2HIV A;  5D14 A;  5CV6 A;  1D5Z C;  1HZ9 A;  4XTC S;  3K7U C;  2KCT A;  4J8Q A;  1PH9 A;  3T51 B;  1HFN A;  1VQN A;  4DR2 L;  2JQO A;  1SMX A;  5IP9 G;  3V96 A;  2E2I B;  2NN6 I;  2NZO A;  3BDL A;  1ESF A;  2E5L L;  2PNH A;  1JJC B;  1C8C A;  4JI5 L;  1PH6 A;  1KAW A;  4JOI C;  3CRL C;  2PQA B;  4GN5 A;  5C3X A;  1YJW A;  1N36 Q;  5BN3 A;  1IYJ B;  2MP1 A;  4GKK L;  3NQI A;  1VQM A;  2MPM A;  1YNJ D;  1G29 1;  3T4A C;  2R92 H;  5C0X H;  1S5C D;  3MXG A;  5KND A;  2JN4 A;  2E2I H;  1IYV A;  4Y52 H;  2BE5 C;  4DR5 L;  2PW5 A;  4FXG C;  2OCE A;  1AFP A;  3PO2 B;  4P74 A;  4PZ7 A;  3F1Z A;  1MSG A;  3E0E A;  5IOD A;  2Q8I B;  3OWE B;  4IUT A;  1UWV A;  1STH A;  1PZI D;  4JI0 L;  1BBW A;  3M4Q A;  3A0J A;  3J7Z C;  2VL6 A;  2ZTC A;  3JC6 6;  2AQ2 B;  4DR4 L;  2E8G A;  5I4D A;  1G91 A;  3PIO A;  2XRS D;  4B3M Q;  1O7I A;  2PQA A;  5LMU L;  4YWL A;  4F8M A;  3PO2 H;  4DR1 Q;  2R93 G;  2PQE A;  3MVV A;  4Y7N B;  4EVO A;  5C5M A;  3RD4 A;  3GTG B;  2EXZ A;  4LFA L;  2B2W C;  2F52 A;  4H7B A;  4JC0 A;  2UUB L;  2PI2 A;  5DAU A;  4A3E G;  2PMZ E;  2IX3 A;  3T1H L;  1FYC A;  1H9M A;  2VB2 X;  4GN4 B;  1HNX L;  3EIV A;  1NBW A;  4EQO A;  1HR0 Q;  3OMC A;  2ES2 A;  1GOZ A;  1K9M C;  2KJX A;  2HUG A;  5C4J B;  1HPC A;  4ZAI A;  2K5H A;  5J39 A;  5JJL A;  3GTG H;  2UXD Q;  2UXC Q;  3E0J A;  1KAB A;  1Q1E A;  5I6Y A;  1JJG A;  1PYB A;  5KGU A;  3J7A F;  1TR5 A;  1ICF B;  2QKI C;  1EYC A;  4BY7 B;  3G4S A;  3RMH A;  2RHS B;  2WV6 D;  4C3I B;  3F2B A;  4A3C H;  2LMC B;  3R3O A;  2ASB A;  1UUP A;  3MA2 B;  4C1N I;  1ROD A;  5M3F B;  2UUA L;  2IW3 A;  2NUC A;  1JIC A;  1SDF A;  4DAY B;  1IW7 D;  1F77 A;  1UNS A;  1QNU A;  5C4J H;  1EU4 A;  4DR3 Q;  3NK9 A;  1BXT A;  3OYY A;  4FP5 D;  1F9R A;  2XWJ B;  1STA A;  5JVH 3;  3M3Y B;  3DMU A;  1LO5 D;  1LTG D;  2RA4 A;  2G5D A;  2AWO A;  2CWA A;  1HNW Q;  4BY7 H;  4QMG A;  5M3M B;  1XPU A;  3OSO A;  3SVM A;  4JI7 L;  1WJJ A;  1WTO A;  4C3I H;  4A3B B;  3CCL A;  1IKM A;  1Z6H A;  3SK4 A;  2NZH A;  5M3F H;  2B63 G;  4DV7 L;  3PIP 3;  4QQB X;  2VQE L;  3H6M A;  3BZC A;  1FJG L;  3RN5 A;  4KV6 A;  3SR1 A;  1VQG A;  1KLG D;  2EXD A;  4NXN L;  3J81 j;  1PH3 A;  1C7Y A;  3M3Y H;  2VUM B;  4IFD J;  3NEM A;  4LF7 Q;  5M3M H;  1XTD A;  1BBU A;  4B3S Q;  1N8R C;  3GTM B;  4A3B H;  4WJW A;  1K3B C;  1QVG A;  1VQ9 A;  1QNK A;  1PVO A;  3GTL B;  4DAY A;  1GUT A;  2ZM6 Q;  1F9P A;  2PW7 A;  1IBL L;  2N78 A;  2IL8 A;  4HMI A;  4RCN A;  4LF6 Q;  1PHJ A;  2OEO A;  5FO8 B;  5C3E B;  1ET9 A;  3I70 A;  3OW7 A;  1NSN S;  3IFD A;  2VUM H;  3QB3 A;  4KY7 A;  4HJ7 A;  1K0R A;  3GTM H;  4LK1 C;  4O2D A;  1FL0 A;  2B2T A;  3GTL H;  3I56 A;  2RQX A;  4A3L G;  5COY A;  1V1O A;  4FXK C;  2WB1 B;  1L0W A;  2IX1 A;  5C3E H;  3U9O A;  1RD9 D;  1STE A;  1TWF B;  3HKS A;  3GDE A;  4LUV A;  2JA9 A;  4EX5 A;  4RCO A;  4CBV A;  3V2T A;  3I7F A;  1VQ7 A;  1PH7 A;  3MXP A;  1SE3 A;  3Q8D A;  1KRT A;  1VMP A;  3AB9 A;  5ELF A;  5D3I B;  3CCJ A;  2E2H H;  4FYD A;  3IL8 A;  3B6Y A;  3PIO 3;  1N36 L;  4LF5 L;  4R4C A;  2XSC A;  3R93 A;  3K5M A;  1HZC A;  2H1E A;  5IGF A;  3LX0 A;  5JOB A;  2PO4 A;  4JW0 A;  2I5M X;  2OQ0 A;  1WTQ A;  4QJF A;  1TWF H;  3A54 A;  5AFW A;  1TS3 A;  1O7L A;  1ENA A;  1Y8P B;  5C4X H;  3TRZ A;  4YIJ A;  4P2C B;  3D31 A;  4R4O A;  3CCV A;  4DV2 Q;  2R7Z B;  2GA4 B;  1A3U A;  1X3P A;  2CKZ B;  3TZD A;  1II3 A;  5BR8 L;  1U4M A;  4AQY L;  1S5D D;  4JI1 L;  5H1S E;  4K0K L;  2A19 A;  3J81 E;  1O7Z A;  2HQL A;  4BBR G;  1Z47 A;  2K5D A;  4J15 A;  3NTH A;  4DK1 A;  3ERS X;  4F88 A;  2JE6 I;  3IFT A;  3CCE A;  2H5X A;  1HTL D;  1BVS A;  1VQH A;  1GUN A;  2FJ2 A;  4B3M L;  1Y1W B;  1PZJ D;  3HOW G;  4DR1 L;  3A74 A;  1LYL A;  2QA4 A;  3MAQ A;  1N32 Q;  4OO1 G;  4CKE A;  2F4V Q;  1A15 A;  3M4Y A;  2A69 C;  4DV4 Q;  5D65 A;  3VDY A;  5IY0 A;  5IGB A;  1SR3 A;  3ULP A;  3OOC A;  3UE1 A;  2EY1 A;  1PH5 A;  4BXX H;  4MNO A;  2MHV A;  3S9W A;  1JWU D;  3H0G G;  2PZT A;  2CQA A;  1LTL A;  3MWY W;  1HR0 L;  1Y1V G;  1DD2 A;  3KF8 B;  3LWU A;  2LS0 1;  3J80 E;  5K5P A;  2E74 C;  2EDG A;  1Y1W H;  1EOV A;  1SND A;  4NW2 A;  2TMP A;  4B3R Q;  1S40 A;  1NJI C;  3CP0 A;  1I4H A;  2F0M A;  2B2U C;  5ELC A;  4GNX A;  4IPH A;  2AQ1 B;  1QG7 A;  2R61 A;  4DK6 C;  1JE5 A;  2IY5 B;  1LAB A;  5J3B A;  2XTI A;  2QEJ C;  1NNX A;  4HCE A;  1X3G A;  3T53 B;  3AFQ A;  3K80 C;  1BKB A;  3BYT B;  5CMD A;  1V1Q A;  3QIA A;  3WWV A;  3OWF A;  3GTQ B;  3D4D A;  4JI8 L;  1O78 A;  3GD7 A;  4YY3 Q;  4KD4 A;  3HOU B;  4DR3 L;  4POF A;  2YTV A;  4UHV A;  2K32 A;  3HKZ E;  1G2T A;  1EZ8 A;  1JOO A;  3L7Z C;  5EKI A;  3A8J E;  3E3X A;  2BE5 D;  3DWA A;  1K8O A;  3UDG A;  1GVP A;  5FO7 B;  4LWC A;  2DY8 A;  1Y69 U;  3KF8 A;  4PG3 A;  2EYH A;  4A3J B;  2VQF L;  2KCM A;  2CH4 W;  3CME A;  3S1R B;  5EJW A;  1A2U A;  4OIK A;  3CRK C;  4BY1 G;  3GTQ H;  1X65 A;  4XQJ A;  1EIY B;  3HOU H;  2R6G A;  1VQ5 A;  4RFB A;  1WD1 A;  4C3J H;  3ICE A;  4ME3 A;  4XIG S;  4KD3 A;  2QF7 A;  5F2D A;  1BBX C;  2ZTE A;  4UAI A;  4IFD H;  3J7A 5;  1Z7T A;  1HHV A;  1SAP A;  2F0O A;  3S2D B;  4B3S L;  1F2Z A;  4NKL A;  5IWA L;  1L1O C;  1KC8 C;  3W3A A;  4C3H G;  3DHQ A;  4A3J H;  1LUZ A;  4UP8 A;  3CPW A;  1YJN A;  1PTO C;  3MXN B;  5LL6 X;  1UEB A;  2DGY A;  4HJA A;  3MXU A;  4JI5 Q;  1IYU A;  2K04 A;  4LF6 L;  1SXT A;  4X3S A;  1KD1 C;  1U5K A;  2CFM A;  1EY5 A;  1STY A;  2KCC A;  1EU3 A;  4GKK Q;  1HNZ Q;  5LMN W;  3S1Q B;  5JJZ A;  2ZJP A;  1D5M C;  3HZX A;  1OXU A;  3W1B A;  3S2D H;  2MFI A;  1W6K A;  3FVQ A;  1EWI A;  1CZW A;  4IOA A;  3MTS A;  4GN3 B;  4YWM A;  2FIN B;  3G48 A;  3LWE A;  2ATW A;  4DR5 Q;  4DK3 C;  4R4T A;  1EYD A;  3DXJ C;  5A2Q L;  1SYC A;  2VZA A;  3S14 B;  5M5Y B;  1SFO B;  1A8V A;  3ND8 A;  4V0B A;  1ASY A;  3S1Q H;  1B9M A;  1XWE A;  4KHZ A;  4QUC A;  2B2Y C;  3A55 A;  2K5Q A;  3MXN A;  4OX9 Q;  1HH2 P;  4JBK A;  3A7A B;  3NP8 A;  1GO3 E;  5LMU Q;  3BU2 A;  1I50 B;  1MJE A;  2VB3 X;  2AQ3 B;  3S14 H;  1JC7 A;  3EJI A;  5M5Y H;  1YNN C;  1SFO H;  4OGQ C;  1WI5 A;  5JAV A;  4LFA Q;  4RWS C;  3KYH C;  1C9O A;  1AH9 A;  3KFU A;  5C44 G;  2UUB Q;  2PZW A;  4KLK A;  1CSQ A;  1X55 A;  2F4I A;  3PUV A;  4ZLT F;  3DM3 A;  1SNO A;  2HT1 A;  2NN6 H;  3T1H Q;  2L11 A;  2L9H A;  4ULL A;  4FVM A;  1HNX Q;  4R9W A;  1XMQ Q;  4A3I G;  3HOZ H;  2DY7 A;  2IT1 A;  5IYD G;  1K28 A;  1EQR A;  2CW0 D;  1I50 H;  2WAQ B;  1IBK Q;  1M90 C;  1TQO A;  2F0G A;  4A93 B;  4CHT B;  1YHA A;  5CV7 A;  5ELE A;  1EIG A;  3BZD B;  1PYW D;  1AEX A;  3QR8 A;  2JSO A;  4P71 A;  5LL6 S;  2VNU D;  1DZ1 A;  2CHB D;  4EQP A;  2N55 A;  4AYB B;  1DGS A;  3S2H H;  4DR7 L;  5CV5 A;  2F03 A;  1SE4 A;  4N8X 1;  3DUZ A;  5EQ0 A;  1OXX K;  1RDP D;  2EIF A;  3KOJ A;  4KY5 A;  1HRJ A;  1PTO F;  1RF2 D;  1QWY A;  4KHV A;  1W2B A;  1HA5 A;  1UE7 A;  3L9A X;  3T56 B;  5IYC G;  1N32 L;  1IXR A;  4A93 H;  1GUO A;  3MFG A;  1EY8 A;  2I5H A;  2F4V L;  2M9V A;  4DV4 L;  3LNN A;  3BYY B;  2RVL A;  1SNQ A;  1NUC A;  4KJN A;  3PO3 G;  4BBS B;  4LW1 A;  1K8G A;  4XYO A;  4JI7 Q;  2PYK A;  4P72 A;  1GD7 A;  2LY7 A;  3BDO A;  3C3L A;  1QUQ B;  2I0Q A;  1E0B A;  2ICE C;  5M9O A;  3MHB A;  4OWW B;  4DV7 Q;  1UE6 A;  2EY5 A;  2VQE Q;  1SYF A;  3I4N B;  1Q8I A;  2Z6K C;  1EY6 A;  5ELO A;  5TSS A;  1FJG Q;  1TS4 A;  1VQC A;  4TVA B;  5EPK A;  3K5N A;  4B3R L;  1PFM A;  3J7Y W;  1EL0 A;  4OWT B;  3M4P A;  3I4M B;  3SGI A;  1LT6 D;  4A3M B;  1EYA A;  1B8A A;  1U0L A;  1WVL A;  4BBS H;  1L0X B;  2A73 B;  4G7Z C;  4ILW A;  1HUM A;  5IOC A;  1PH8 A;  1YEZ A;  1EWH A;  4JVZ A;  2L55 A;  1JWS D;  3TN2 A;  4N9T A;  3HOV B;  2Y0S E;  1KDB A;  3MEH A;  2RKS A;  4JBM A;  3D0F A;  1J8I A;  3I4N H;  1A3V A;  4DR6 L;  1IBL Q;  3FP9 A;  1T5E A;  3ITP A;  1OXV A;  4TKO B;  3OW2 A;  3PMF A;  5GAH C;  1YZ6 A;  4ZKB B;  3I4M H;  4A3M H;  4RG1 A;  4B9W A;  5I6W A;  2K33 A;  1GUG A;  1BCP F;  1KLU D;  4PV1 C;  1QUQ A;  1MHW C;  4CKC A;  2LKV A;  3OHX C;  2K7V A;  4IUN A;  1XPR A;  3HOV H;  1P8L A;  4JG2 A;  2SDF A;  1S3O A;  2Z9H A;  1GM5 A;  4DAM A;  1WCM G;  1H9S B;  1KDC A;  2Z4I A;  1SYG A;  3FKI B;  4IOC A;  3T1Y Q;  2F0U A;  4DV5 L;  1VQE A;  4RGM A;  3H3V C;  5I2X A;  2R92 B;  1W6J A;  1HTP A;  1I94 Q;  2HD3 A;  4OO1 I;  1ZEQ X;  3R2T A;  2F0N A;  4XQN A;  3NSW A;  2SNS A;  3D6C A;  4L6T B;  4A3G B;  2OT2 A;  4G4K A;  1R9T B;  1HQM C;  2A69 D;  1CKN B;  5FLM G;  3ZJY C;  2GN5 A;  4R8N A;  4ABN A;  4LF5 Q;  2JP1 A;  3ERO A;  1R4P B;  2ID0 A;  3FKI H;  2XVS A;  1HNZ L;  2MO1 A;  4ZUJ A;  5DLQ E;  2Z4H A;  3K0Y A;  2AUK A;  2RDF A;  5K36 H;  4RKB A;  3PUZ A;  2B39 A;  3U58 A;  4A3G H;  1LTS D;  3NWS A;  1R9T H;  4JV5 L;  1PLF A;  5E7N A;  1WYD A;  2F0D A;  1EY7 A;  4L5Q A;  1PFN A;  1H9S A;  4YCU A;  5BR8 Q;  4AQY Q;  4OWX B;  1X3F A;  1I6H H;  1UAP A;  4JI1 Q;  5KYL A;  1A62 A;  4K0K Q;  3ER0 A;  4DNI A;  4JI3 Q;  1DOL A;  2NVT B;  1NE3 A;  2EYP A;  3CXC A;  1I4X A;  4KKU A;  5IIF A;  3PF4 A;  1KTK A;  3STB D;  1F2L A;  3A56 A;  4OX9 L;  1CKN A;  4QIW B;  2WFW A;  1T5X D;  3AU7 A;  3I4L A;  1HXY D;  3WOE A;  4X3K A;  1PDQ A;  5IP7 G;  3W2D A;  1KDA A;  1B44 D;  3I90 A;  4XT1 B;  4K6L A;  2NVT H;  2RF4 A;  1CHQ D;  3JAM L;  2O2L D;  4GKJ L;  4RKL A;  5A35 A;  1YHB A;  4PNY A;  2PI2 E;  4KN7 C;  1GUS A;  1XMQ L;  4IPD A;  3DEP A;  4ZCK A;  3PCO B;  3P75 A;  4O42 A;  1X3Q A;  3TBI B;  2F0T A;  1PZK D;  4DUY Q;  1PH1 A;  1IBK L;  3UI2 A;  1JR0 D;  1P16 A;  2B2W A;  1VQP A;  4HTH A;  5HGQ A;  5KYI A;  2HDM A;  3JAM c;  3VYS A;  1EEF D;  4TRD A;  1PTO D;  4RH6 A;  4UP7 A;  3MFY A;  1M4V A;  3LGJ A;  2NVX B;  5G3L F;  4K2L A;  1XYI A;  3VR5 A;  4A3K G;  2QW7 A;  2E2J B;  4JI8 Q;  4MHE A;  1TY2 A;  3GP7 A;  1SN8 A;  1TWG B;  2L1B A;  1CUK A;  5NUC A;  3M85 A;  2MO0 A;  2X6G A;  5IYB H;  3HOY H;  1GHK A;  3P7J A;  5ELN A;  1S72 A;  1LTT D;  2EYF A;  1QIL A;  3RLF A;  2ENB A;  3S17 B;  1XPO A;  3E6Z X;  2R7Z G;  1LT4 D;  4TQU S;  4JI2 L;  2NVX H;  3H3V I;  2VQF Q;  1S5B D;  3Q0A A;  3I8Z A;  2X6L A;  3N6R A;  4I7Z C;  2E2J H;  1BUV T;  3D3R A;  2IHF A;  1F9S A;  1K73 C;  3M9B A;  2F0I A;  1FNW A;  1TWG H;  2A6E C; 
#chains in the Genus database with same CATH homology
 1UE5 A;  3CW2 C;  2C35 B;  2R7D A;  2YTY A;  4HJ9 A;  1YBY A;  3H0G G;  1SLJ A;  1UE1 A;  1HJP A;  1LTL A;  4GLA C;  4R4I A;  1HR0 L;  1Y1V G;  2CQO A;  3GO5 A;  3KF8 B;  4KI0 A;  3S17 H;  1X54 A;  1KXL A;  4A3D H;  3TS2 A;  1Y1W H;  5C44 H;  5M3M G;  3FKI G;  5IP9 H;  3W5O A;  5IWA Q;  1EOV A;  1YI2 A;  3S16 H;  4A3B G;  4JCV E;  1KIX A;  4B3R Q;  1S40 A;  1NJI C;  3CP0 A;  3HKZ G;  2R7F A;  4GNX A;  1JT8 A;  4IPH A;  2DUD A;  3RZO H;  1VS0 A;  3NBH B;  4DK6 C;  3CC4 A;  4DV2 L;  2KHJ A;  5K36 G;  1JE5 A;  2IY5 B;  4A3I H;  4L5R C;  1L2F A;  4JOI A;  5J3B A;  4A3G G;  2XTI A;  5IYD H;  3PSI A;  2JA6 H;  5GAE C;  1X3G A;  1KHI A;  3AFQ A;  3K80 C;  3AQQ A;  1PA6 A;  1BKB A;  2QGQ A;  2XGT A;  3E9H A;  1V1Q A;  2JA8 G;  2VW9 A;  4DUZ Q;  2VUM H;  1NMF A;  1VQJ A;  3WWV A;  1Q86 C;  2VUM G;  2V1C C;  1PYS B;  4JI8 L;  3AFP A;  3GD7 A;  4YY3 Q;  5FJ8 H;  3RLN A;  4A3F G;  3I4O A;  4DR3 L;  1YJ9 A;  4POF A;  1N9W A;  2BH8 A;  2YTV A;  4L5T A;  1KL9 A;  2JA5 G;  3HKZ E;  2RCN A;  3AEV A;  4X66 L;  1N33 Q;  1Q7Y C;  3L7Z C;  1D8L A;  3CF5 A;  1B70 B;  1WOC A;  3UDG A;  1GVP A;  2UUA Q;  1V9P A;  4LWC A;  3T1Y L;  1Q8K A;  4DV0 Q;  4JI6 Q;  3I2Z A;  4PG3 A;  5IYC H;  5C3E G;  2WP8 J;  2VQF L;  2KCM A;  1VQA A;  4AH6 A;  2AWN A;  1T9H A;  3CME A;  4HIK A;  1X3E A;  1I94 L;  3GTQ H;  4BY1 G;  4NPS A;  4UY8 C;  1X65 A;  3HOU H;  1EIY B;  2R6G A;  1VQO A;  1VQ5 A;  3PO3 H;  1NY4 A;  4C3J H;  3M4O H;  3ICE A;  4ME3 A;  3F2D A;  4XIG S;  4WJ3 M;  3UDX A;  2RHQ B;  3A5Z B;  3DLL A;  2ZTE A;  2JEB I;  3U4V A;  2R93 H;  2N49 A;  3J7A 5;  4IFD I;  3TEH B;  1PV4 A;  2KHI A;  1CKM A;  2MQH A;  3L2P A;  2AMC B;  4B3S L;  1CKO A;  2WB1 G;  1HZB A;  3GTP H;  3S24 A;  4AYB E;  5IWA L;  1MIU A;  1L1O C;  4A76 A;  1KC8 C;  2AKW B;  3UDF A;  2HIX A;  4A3J H;  1LUZ A;  4UP8 A;  3CPW A;  3TS0 A;  1YJN A;  3S1M H;  1YIT A;  1N34 Q;  3MXN B;  1UEB A;  4QGU A;  3EBE A;  2DGY A;  4KHP Q;  4HJA A;  5C4X G;  4NXN Q;  4B3T Q;  1VQ6 A;  4JI5 Q;  1E24 A;  4IJL A;  3M7N A;  4LF6 L;  4OXP A;  4JBJ A;  2ZTD A;  3CCQ A;  1KD1 C;  1U5K A;  2CFM A;  1H95 A;  3GTO H;  5M5X H;  3W1G A;  4GKK Q;  5GQO A;  2HHH Q;  1HNZ Q;  5LMN W;  5EAY A;  4QIW E;  1G51 A;  4DUZ L;  1QZG A;  2ZJP A;  1HNW Q;  1W3S A;  4JI3 L;  1YVC A;  1OXU A;  2B3G A;  1YIJ A;  2JEA I;  2WB1 E;  4YY3 L;  4PMW A;  3W1B A;  1VQF A;  3JAM i;  4Y7N H;  2MFI A;  1Q81 C;  1VQ8 A;  4NXM Q;  3S1N H;  3S2D H;  1A63 A;  3KJO A;  1QVF A;  1EWI A;  4IOA A;  4GN3 B;  1Q12 A;  1QVC A;  4YWM A;  2LXJ A;  4JYA Q;  3G48 A;  4LUO A;  1KQS A;  2I5L X;  4LFB Q;  2ATW A;  2N3S A;  1N33 L;  4DR5 Q;  4DK3 C;  1IBM L;  1D7Q A;  4R4T A;  3PUY A;  3K7A H;  2MNA A;  5IYB G;  1CSP A;  4GLV B;  3HOY G;  2JK8 A;  4DR7 Q;  2VZA A;  4H02 A;  2JA7 G;  1XMO L;  4HID A;  4BA2 I;  2A8V A;  1PH2 A;  4DPG A;  3HFZ B;  1A8V A;  3PIP A;  4X64 Q;  4DV0 L;  3J81 c;  3UE0 A;  1OTC A;  4GLX A;  1ASY A;  3S1Q H;  3BJU A;  4C2M H;  1WFQ A;  3PV0 A;  4KHZ A;  2GVA A;  2OQK A;  3HOX G;  3CCM A;  4UP9 A;  4IPG A;  1JJ2 A;  1WCM H;  1J5E L;  2HIV A;  4OX9 Q;  3CD6 A;  5GAG C;  1HH2 P;  4JBK A;  1GO3 E;  4BXX G;  4PZ6 A;  5LMU Q;  1AE2 A;  1HZ9 A;  3BU2 A;  4MTN A;  4DKA C;  3G6E A;  1MJE A;  1XNQ L;  1VQL A;  1C0A A;  5FLX c;  4XTC S;  2B63 H;  2CWP A;  2YTX A;  1VQB A;  3L0O A;  2OTJ A;  3K7U C;  2KCT A;  5M5Y H;  1PH9 A;  3S14 H;  4DUY L;  1EYG A;  1SFO H;  3RLO A;  3UDI A;  1WI5 A;  4LFA Q;  4LF9 Q;  1HR0 W;  3KYH C;  1VQN A;  4DR2 L;  1C9O A;  2JQO A;  3KFU A;  1SMX A;  5C44 G;  1Y1W G;  4A3D G;  2UUB Q;  1AH9 A;  5IP9 G;  4KLK A;  1CSQ A;  1X55 A;  1TWH H;  3PUV A;  3DM3 A;  4YHH Q;  4GNX C;  2D0P A;  5FLM H;  1X9N A;  2HT1 A;  2N8N A;  3T1H Q;  1EQQ A;  2NN6 I;  2NZO A;  3A5U A;  2E5L L;  2PNH A;  1JJC B;  4KHP L;  4B3T L;  4JI5 L;  1PH6 A;  1KAW A;  4JOI C;  1HNX Q;  1XMQ Q;  2UU9 Q;  4A3I G;  2LSS A;  2PQA B;  4GN5 A;  1YJW A;  3HOZ H;  1N36 Q;  4K0K Q;  2IT1 A;  5IYD G;  1EQR A;  2JA6 G;  2D0O A;  1IYJ B;  4GKK L;  1I50 H;  3J80 c;  1IBK Q;  2HHH L;  4LF4 Q;  2OTL A;  1M90 C;  1MKH A;  1VQM A;  1G29 1;  1YHA A;  2R92 H;  3U4Z A;  4A75 A;  4DR6 Q;  5FJ8 G;  4R4Q A;  3STB C;  5C0X I;  3CC7 A;  4JYA L;  4LFB L;  3ULJ A;  4P71 A;  2E2I H;  3RZD H;  2VNU D;  4Y52 H;  4DR5 L;  4DV6 Q;  2IHE A;  1OXS C;  2OCE A;  5LMN Q;  1DGS A;  3S2H H;  4LF8 Q;  4DR7 L;  4DV3 Q;  2YYZ A;  4P74 A;  1I5F A;  3E9I A;  4O0A A;  4PZ7 A;  3F1Z A;  1OXX K;  2EIF A;  3KOJ A;  4LFC L;  3E0E A;  4X62 Q;  1L1O B;  1W2B A;  1UE7 A;  1VQI A;  5IYC G;  1UWV A;  1N32 L;  1IXR A;  1Q46 A;  4POG A;  1VQK A;  4JI0 L;  4A93 H;  1BBW A;  2I5H A;  3M4Q A;  2F4V L;  4A3L H;  3A0J A;  3J7Z C;  4DV4 L;  2VL6 A;  4JI4 Q;  2ZTC A;  3JC6 6;  3HOU G;  4IO9 A;  3PO3 G;  4LW1 A;  4DR4 L;  2E8G A;  1K8G A;  1XNR Q;  3PIO A;  4JI7 Q;  4B3M Q;  1O7I A;  2PQA A;  5LMU L;  1G6P A;  4P72 A;  1GD7 A;  4YWL A;  5IP7 H;  4DV5 Q;  3PO2 H;  4DR1 Q;  4IFD G;  4L5S A;  1QUQ B;  4HJ5 A;  2I0Q A;  4OWW B;  2R93 G;  4DV7 Q;  1IL2 A;  3HOV G;  2Y0S G;  1UE6 A;  2VQE Q;  5HY6 A;  1NMG A;  4OON A;  4LF9 L;  4LFA L;  2F52 A;  4YWK A;  1E7Z A;  2Z6K C;  4GOP B;  5ELO A;  4JC0 A;  3OTO Q;  4A3E H;  2UUB L;  5IT9 c;  1FJG Q;  1VQC A;  4TVA B;  5M5W H;  4B3R L;  2PI2 A;  2B29 A;  3H15 A;  1LM0 A;  4A3E G;  2PMZ E;  3M4P A;  4OWT B;  4A3J G;  3SGI A;  3T1H L;  2VY3 A;  4QY7 A;  4GN4 B;  1B8A A;  1HNX L;  1U0L A;  2GVB A;  3K0X A;  3EIV A;  1NBW A;  4BBS H;  1HR0 Q;  3RR5 A;  2ES2 A;  1PH8 A;  1K9M C;  1YEZ A;  1EUJ A;  4LF4 L;  3PUX A;  2K5H A;  4P75 A;  2Y0S E;  3KJP A;  4R1J A;  4NB3 A;  4JBM A;  5JJL A;  3GTG H;  2UXD Q;  3D0F A;  2UXC Q;  1Q1E A;  3I4N H;  4P73 A;  4DR6 L;  1PYB A;  1JJG A;  1IBL Q;  3FP9 A;  3GTJ H;  1OXV A;  3G4S A;  3OW2 A;  4JV5 Q;  1E1O A;  2ALY B;  2RHS B;  5GAH C;  1EFW A;  1YZ6 A;  4DV1 Q;  3I4M H;  2UXB Q;  1FGU A;  1GKH A;  4FDB A;  3CPF A;  4RG1 A;  3F2B A;  4DV6 L;  4A3M H;  4A3C H;  1AE3 A;  2ASB A;  2QEX A;  4LF8 L;  5JEA G;  1VCI A;  1K83 H;  4DV3 L;  4A3K H;  1E3P A;  2D62 A;  2UUA L;  1VQ4 A;  2BA0 A;  1QUQ A;  2ZJQ A;  4JI6 L;  4X62 L;  4BBR H;  4DAY B;  2FXQ A;  4X65 Q;  3F2C A;  5C4J H;  1NTG A;  3K8A A;  4GNX B;  4DR3 Q;  4GOP A;  1XPR A;  3G71 A;  2F3I A;  1EIF A;  3OYY A;  3HOV H;  1P8L A;  3EN2 A;  4MZ9 A;  4JG2 A;  2Q2U A;  1S3O A;  2L15 A;  3PF5 A;  1GM5 A;  2AWO A;  2CWA A;  4DAM A;  5AJ3 Q;  1WCM G;  2AHO B;  1JB7 A;  3CC2 A;  2R7Z H;  3NEL A;  4BY7 H;  3RNU A;  1XPU A;  3J81 i;  4JI7 L;  4AIM A;  1TWA H;  1WJJ A;  4C3I H;  3HOW H;  4IOC A;  3CCL A;  3T1Y Q;  4DV5 L;  1VQE A;  1RIP A;  2YU9 H;  2K14 A;  2NZH A;  4APV A;  5M3F H;  2B63 G;  4DV7 L;  4QQB X;  2VQE L;  3PUW A;  1I94 Q;  4OO1 I;  1E1T A;  3BZC A;  2KBN A;  3OTO L;  1FJG L;  3RN5 A;  1KRS A;  1MJC A;  3AYH B;  1VQG A;  1N34 L;  4IJH A;  1A0I A;  4GKJ Q;  1CKN B;  2EXD A;  4NXN L;  3H0G H;  3ZJY C;  2NN6 G;  5FLM G;  3J81 j;  1PH3 A;  1SRU A;  1C7Y A;  3M3Y H;  4IFD J;  1Y1V H;  2GN5 A;  4LF5 Q;  2JJQ A;  3NEM A;  1K3R A;  1VQD A;  2CCZ A;  3KF6 B;  4LF7 Q;  2ID0 A;  1XTD A;  5M3M H;  3HOZ G;  1BBU A;  1I3Q H;  3FKI H;  4HJ8 A;  1HNZ L;  4B3S Q;  1N8R C;  2MO1 A;  3TQY A;  4A3B H;  1QVG A;  4WJ4 A;  5DLQ E;  1VQ9 A;  2Q2I A;  4QL5 A;  5JJI A;  1PVO A;  2A1A A;  4NXM L;  3TRE A;  2BH2 A;  2UXD L;  2Q2T A;  2UXC L;  2ZM6 Q;  1ASZ A;  2R92 G;  1IBL L;  3PUZ A;  2N78 A;  5C0X G;  4A3G H;  3U58 A;  1R9T H;  4LF6 Q;  1PHJ A;  4JV5 L;  2UXB L;  5E7N A;  4DV1 L;  3J80 i;  1WYD A;  3CQZ H;  2KEN A;  4L5Q A;  4YCU A;  5BR8 Q;  2NVQ H;  4AQY Q;  2JA8 H;  4OWX B;  3KDF B;  1X3F A;  1I6H H;  3FHW A;  4JI1 Q;  1IZ6 A;  1SE8 A;  1A62 A;  1X56 A;  1Y14 B;  1E22 A;  4LUZ A;  2UUC Q;  3CAM A;  3ER0 A;  4DNI A;  4HIO A;  4HJ7 A;  3PGZ A;  4ALP A;  4JI3 Q;  1TXY A;  4X64 L;  4YCV A;  4A3F H;  1X6O A;  5IE8 A;  1K0R A;  3GTM H;  4O2D A;  1NE3 A;  4X65 L;  2JA5 H;  1FL0 A;  5GAD C;  2WAQ G;  2ZJR A;  3GTL H;  3I56 A;  3CXC A;  4A93 G;  3PF4 A;  1Q82 C;  4A3L G;  3STB D;  3CCU A;  1IBM Q;  1HZA A;  4OX9 L;  1CKN A;  2BA1 A;  5JEA J;  1QZH A;  5AJ3 L;  1HNW L;  4BA1 I;  1V43 A;  3BZK A;  1B7Y B;  1L0W A;  4A4I A;  2WFW A;  1XMO Q;  2IX1 A;  4EQ5 A;  5C3E H;  4JI2 Q;  3KF6 A;  1TWC H;  3K81 C;  3HKS A;  5GRO A;  1SRO A;  3GDE A;  4AYB G;  5IP7 G;  4LUV A;  2JA9 A;  3NEN A;  4BY1 H;  3PO2 G;  4EX5 A;  2NVT H;  3GTK H;  2WAQ E;  2RF4 A;  3I7F A;  3CMA A;  1VQ7 A;  4YHH L;  1J5E Q;  2K5V A;  3I55 A;  1PH7 A;  4GKJ L;  3Q8D A;  1KRT A;  3S15 H;  3CCJ A;  2E2H H;  1YHB A;  2PI2 E;  5JJK A;  1XMQ L;  2UU9 L;  1XNQ Q;  4PZ8 A;  3B6Y A;  4IPD A;  1N36 L;  1K8A C;  4JBW A;  4R4C A;  4LF5 L;  3KDF A;  1HZC A;  3PCO B;  4LF7 L;  4BBS G;  4DUY Q;  4IPC A;  1PH1 A;  1IBK L;  3F8T A;  2I5M X;  1P16 A;  1L1O A;  2OQ0 A;  4C3H H;  4DR2 Q;  2Z6K A;  1VQP A;  1PH4 A;  4QJF A;  1TWF H;  1RL2 A;  2K75 A;  2IX0 A;  5HGQ A;  3RN2 A;  5C4X H;  3S1R H;  1Z9F A;  2LXK A;  2ZM6 L;  3TRZ A;  3D31 A;  4R4O A;  3JAM c;  2K5N A;  3CCV A;  4DV2 Q;  3I4N G;  2E5L Q;  3CCR A;  4UPA A;  1XJV A;  2OWO A;  2K52 A;  1M1K C;  2VS1 A;  2CKZ B;  4UP7 A;  5LMN L;  3LGJ A;  3I4M G;  5BR8 L;  4A3M G;  3KLW A;  4AQY L;  4A3C G;  4JI1 L;  2UUC L;  1OXT A;  5H1S E;  4K0K L;  4A3K G;  2A19 A;  4JI8 Q;  2HQL A;  1JMC A;  1PFS A;  2YV5 A;  5C0X J;  4BBR G;  1Z47 A;  4J15 A;  4GOP C;  1SN8 A;  4HIM A;  1CUK A;  4GS3 A;  4JI4 L;  4X66 Q;  2MO0 A;  1YNX A;  3ERS X;  2JE6 I;  2K50 A;  3M85 A;  2H5X A;  2EQS A;  4YCW A;  5IYB H;  3CCE A;  3HOY H;  3MEF A;  1BVS A;  1VQH A;  3IRB A;  5ELN A;  1S72 A;  2JA7 H;  4X6A H;  3CCS A;  3RLF A;  1XNR L;  1XPO A;  4B3M L;  4BY7 G;  2R7Z G;  2K4K A;  4TQU S;  4JI2 L;  4LFC Q;  3HOW G;  3H3V H;  4DR1 L;  3A74 A;  1J6Q A;  2NVX H;  4LNQ A;  1LYL A;  3H3V I;  2VQF Q;  1FVI A;  2QA4 A;  2NVY H;  1N32 Q;  2E2J H;  2IHF A;  4RMF A;  5M3F G;  4JI0 Q;  4OO1 G;  2Q2H A;  3HOX H;  2F4V Q;  4DV4 Q;  1Q1B A;  2Z0S A;  1K73 C;  3VDY A;  5IY0 A;  3M9B A;  1SR3 A;  3ULP A;  1TWG H;  1YHQ A;  3U50 C;  3UE1 A;  1PH5 A;  4DR4 Q;  4BXX H;  4MNO A;  3ULL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...