1HTPA

Refined structures at 2 angstroms and 2.2 angstroms of the two forms of the h-protein, a lipoamide-containing protein of the glycine decarboxylase complex
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
131
structure length
131
Chain Sequence
SNVLDGLKYAPSHEWVKHEGSVATIGITDHAQDHLGEVVFVELPEPGVSVTKGKGFGAVESVKATSDVNSPISGEVIEVNTGLTGKPGLINSSPYEDGWMIKIKPTSPDELESLLGAKEYTKFCEEEDAAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductases(acting on ch-nh2 donor)
molecule keywords H-PROTEIN
publication title The lipoamide arm in the glycine decarboxylase complex is not freely swinging.
pubmed doi rcsb
source organism Pisum sativum
total genus 35
structure length 131
sequence length 131
ec nomenclature ec 1.4.4.2: Glycine dehydrogenase (aminomethyl-transferring).
pdb deposition date 1995-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01597 GCV_H Glycine cleavage H-protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1htpA00
1TU2B 3PUZA 4TQUS 1Y8PB 4H13C 4DK0A 1H9JA 3ND8A 4IQZA 2AWOA 3I72A 2JE6I 3OOCA 3L7ZC 3TZUA 3IFTA 1Q1BA 4IFDG 1Q12A 1Z7TA 1E2WA 1Q1EA 1GHKA 3MXUA 1CTMA 2Q8IB 3A8JE 3P20A 5KNCA 1VCIA 2D2CC 2NN6H 2O5JC 2EJFC 4H0LC 1FR3A 3VR3A 3SDZA 3VR4A 5BN5A 3BG3A 4I7ZC 1VF7A 3AB9A 1Z6HA 1Y8NB 3CRLC 3PUWA 2PPBC 4L8JA 4KKSA 1A6XA 1K8MA 1HPCA 2A6ED 3MFYA 4KKUA 2CW0C 1H9KA 1Y8OB 3N6RA 3RLFA 1DD2A 2K33A 2BE5D 3M4YA 2JEBI 5K36G 1GUGA 1LACA 1FYCA 2BA1A 3T51B 2K7VA 5BN3A 4IFDH 2DNEA 3A7LA 1H9SA 3DXJC 2O5IC 4TKOB 1IYVA 2D5DA 1OXXK 2EVBA 2JXMB 1SMYC 3D4RA 3OPOA 2PCFB 2YYZA 1GUTA 1Q90A 2NN6I 4KMUC 3D31A 2IT1A 2PNRC 3I73A 1GHJA 2B8GA 4XTCS 4DNRB 1B9MA 2A68C 2A69D 1BDOA 1O7LA 3GD7A 1H9RA 1T5EA 4H44C 2KCCA 4KKTA 3PV0A 4BA2I 1IW7C 5A35A 2A6HC 1PMRA 1V8QA 3EQLC 5KNDA 2AUKA 4PV1C 2DNCA 1QJOA 1O78A 1K8OA 3VR5A 1CFMA 1GUOA 2BA0A 3VR6A 4OO1G 5K36H 2BE5C 2KA7A 3PUXA 2LMCB 5C0XG 3KLRA 1GUSA 4RCNA 1ZYRC 5BN4A 3NE5B 2JEAI 3M7NA 2EJMA 3OW7A 4KN7C 3U9SA 2E75C 1ZKOA 1V43A 3T56B 4DNTB 4JK1C 2EDGA 3VA7A 1B9NA 4KI0A 4HR7B 4G7HC 2E74C 1HCZA 3VR2A 2QF7A 5JEAG 3A8IE 4G7OC 1OXTA 1Y69U 1OXVA 3IKJA 4LK1C 3WDNA 1H9SB 2EJGC 3I4LA 3QG1A 1H9MA 1TKWB 2B8FA 2V4DA 4JBWA 1OXUA 4KN4C 1I6VC 4LJZC 2A6EC 3CRKC 3SE0A 3T53B 4OO1H 2K32A 3QIAA 1VDZA 1E2VA 5C0XH 3A8KE 3HGBA 3LNNA 1GJXA 1YNJC 1E2ZA 5KNBA 1HQMC 3W3AA 1DCZA 3M85A 3H94A 1CI3M 3GQBA 2E76C 3FMCA 2F1MA 2AUJD 1YNNC 2A68D 2L5TA 1IYUA 2NN6G 3BDOA 3LWUA 4OGQC 3QJYA 4GZYC 3PUYA 5JEAH 1OXSC 1G291 1IW7D 3ND9A 2A6HD 2D62A 3PUVA 3A7AB 2A69C 1HTPA 4KHZA 4BA1I 2ZT9C 2R6GA 4XIGS 1EWHA 1VF5C 1DXMA 2BDOA 4G7ZC 1ONLA 1LABA 2DN8A 1GUNA 4DK1A 3FPPA
chains in the Genus database with same CATH superfamily
4TVAB 1TU2B 1PTOB 1I4QA 1TXYA 1SYBA 1EEID 2AWOA 3K0XA 3NBHB 5LMNQ 5CV8A 1F2MA 2KHJA 1SNPA 4A3DB 3NWSA 3A8JE 3JC66 2B2YC 1L2FA 3J80i 4KHPQ 4DV4Q 1MIUA 2EJFC 1D8LA 3U50C 1I6HB 2E2JB 1AFPA 5D14A 1TY2A 4A3MB 4CKBA 1BCPD 5E4WC 1KLUD 3CRLC 3LWEA 3SHLA 1NJIC 4M8AA 3PQIA 2K1BA 4FP5D 1QG7A 2WKDA 4ZRZA 3J80E 4J8QA 2F0EA 1YHQA 3M4QA 4DAPA 1GUGA 3CMAA 2HIVA 1IL2A 2BA1A 4IUUA 1Q82C 1YVCA 3CKIB 5I9PA 4HMIA 1SXTA 4BY1H 3CCMA 4A3EG 2VUMH 2PCFB 4OX9L 1GUTA 1JJCB 3D0FA 2KCNA 4MTNA 1NUCA 4ZCKA 3T1YL 4DAYB 4A93G 4OWTB 4ZLTF 5G3LF 2N8NA 1CUKA 2H4OA 5FLMG 2DNCA 2L55A 1SROA 1QJOA 4QMGA 1CM9A 4R4CA 3WOEA 5K36H 5FLXc 1X3PA 4BBRB 5EPJA 4GOPC 3KLRA 4CKCA 1SEBD 1H95A 1SNQA 1SMXA 3KLSA 4YHHQ 1WYDA 2L1BA 4KHVA 4F88A 1ICWA 3VR2A 4JW0A 1LTTD 4G7OC 3GTLB 3I4NB 1TR5A 3EJIA 3IKJA 2Y0SB 1GO3E 1IXRA 3HKZB 1XYIA 3R3OA 2E2IB 1VQMA 3SE0A 1PA6A 5M3MG 4HJ9A 1WTWA 1VDZA 3G7LA 1D6EC 5CV7A 1DCZA 1PFMA 1PXUA 2E2HB 3GQBA 2IJ0A 2F0OA 2R7ZH 1W6JA 1IYUA 2I5HA 4KY6A 3NSWA 1Q81C 3A56A 5C4JB 3S1MH 1XNQQ 3PUYA 1MSHA 5GROA 1E7ZA 3PUVA 1IBLL 2D62A 4C2MB 1W2BA 1RTOA 4YY3Q 2XTIA 4FNFA 4MIUA 1M1KC 2B39A 1D1IA 5IT9E 2DY8A 1KC8C 4HCEA 2OXPA 1GKHA 3TZUA 1HRJA 3S15H 4L6TB 2K03A 4JCVE 5D3DA 5NUCA 5IGGA 2JJQA 4GOPB 3HOWB 4A3GG 3A74A 4A3CG 4JV5L 1KIXA 1IBMQ 1PTOF 2WINB 2LS01 3J80c 2FJ2A 3P7JA 2B2UC 4LF5Q 1VQIA 2HT1A 1Y8OB 4B3ML 2B63B 3GTQB 1SLJA 2K28A 4YCUA 2K5WA 1PVOA 1EWIA 1XTCD 3L0OA 2OQ0A 4U673 2N55A 4GKJL 4X66L 4CBVA 3S2HH 3EFXD 5IYBH 3DXJC 2D5DA 2O2LD 1OXXK 2K14A 1LM0A 3KOJA 3ULJA 2K04A 1K28A 4JYAL 3GD7A 1I4PA 1H9RA 4DR2L 1YHAA 4UP9A 3MXNB 2EOTA 5G3LD 5IYDH 4XYQA 4LUZA 1SJHD 1NR4A 1W3SA 4UP8A 3HOUH 1SYGA 2EZVA 5FO7B 2XRSD 3SEBA 4EQNA 1TWCH 1KLGD 3R8BA 1SFOH 3K7UC 3U4VA 1ASYA 5M5XH 1K73C 1CHPD 1KAWA 2B2WA 1ICFB 5JPMC 4IURA 3TQYA 5GAEC 3FVQA 1K0RA 2AQ2B 2BOSA 2UUCQ 1EY9A 3A8IE 1VQHA 2Q8TA 3J7YW 1NCVA 4C3HH 1VQEA 1EOVA 1WTPA 4K6DA 1B7YB 3NK9A 4DV6Q 1VQ4A 2CH4A 1U5KA 1ENAA 3E9HA 1J5EL 3M9BA 1EUJA 1YNJC 5KNBA 1HR0W 4HIDA 2Q2TA 2VNUD 2R92G 1D5ZC 1LUZA 2F1MA 2NN6G 5TSSA 4K8IA 1E3PA 4KY7A 3K7AH 2F52A 2RA4A 3MXPA 2L4NA 4MZ9A 4KHZA 5IY0A 5IT9c 2FHTA 4A3DH 3C2PA 1DXMA 1ONLA 1MD2D 1QUQB 2UUAL 4AYBG 3Q23A 1Q8KA 3EIVA 1ET9A 4NXNL 5DNFA 4A3IB 1SE3A 3MEFA 4XQNA 1EQVA 1HZAA 2NUCA 4UDUC 2IL8A 3P20A 1G2SA 1EYAA 2R93H 2IW3A 2WKCA 3V2TA 1Q86C 5DM73 4A3BH 1YHBA 2J0TD 2PZTA 1IL8A 3BYTB 4CHTB 1PTOD 3HOXG 5CV5A 4EQ5A 1JOQA 2C9OA 1BBWA 4MN3A 2B2YA 1X56A 1MHWC 4JI0L 5T1GA 4IOCA 2P5ZX 4F8MA 3SXHA 4IFDH 4MTKA 3CD6A 3OTOL 4X6AH 4DR6Q 3KDFB 1TIID 2RDFA 2K5NA 4L5TA 4CDEC 3OPOA 1K9MC 5C44H 2IWHA 4KMUC 2VQFQ 1EFWA 3RZOB 4EQPA 1PYBA 3I7FA 4BBRH 1T9HA 2EIFA 3FKIH 1EY4A 5BR8L 1M8AA 3DHQA 4ZUIA 1ESRA 4QL5A 3RD4A 1PH4A 1M4VA 5CMDA 1JT8A 3VR6A 1FNUA 1XXGA 4AQYQ 1MSGA 4JI2L 1SYEA 1NNXA 2CQOA 1B3QA 1O7IA 5BN4A 3GTLH 3M7NA 4J6HA 2YTXA 4DUZQ 1IKLA 1VQPA 3I91A 1OXTA 2PZUA 1KDAA 1BCPC 2XSCA 4P75A 2E2HH 1G51A 4S3SA 5CV4A 1WFQA 4QUCA 4X65Q 3HOZH 2B2VC 4A3FG 4CJ2C 5C4HA 4BY7H 2HIXA 3LNNA 4ULLA 4OELB 3IL8A 1WJJA 1HR0Q 2AKWB 4HN7A 1ILQA 2L5TA 3J7AF 2C5CA 3CPFA 4QIWB 1C7YA 2MP1A 2ZTDA 3ERSX 4LW1A 5J22A 4POFA 5IWAL 4ODGA 3HOVG 5EBDA 1AE3A 4EQOA 2ZT9C 4LAAA 1LTRD 1O7YA 2VY3A 4LFAQ 3RLOA 3BDLA 4QUFA 4WJ3M 2Q2IA 4JI6Q 1B50A 1VQJA 4Q0FA 2G9HD 4B3TL 1WCMG 1EY6A 3MXNA 5L37A 1GHKA 4RKBA 3D3RA 5FO9B 1N8RC 1S40A 3GTPH 2B63H 2K05A 3GTQH 1DOMA 3SDZA 4K0KL 1UE1A 4J1MA 5C3EB 1FJGL 4NXML 1TWGH 3OMCA 1HPCA 1R4QB 3VDYA 4HIMA 3M4OB 1BCPB 1A3TA 4RGOS 2YU9H 5I4DA 2F0NA 2KCTA 3KFUA 1AN8A 3C3LA 1NBWA 5LL6X 1HUNA 1B1ZA 1QE6A 2JK8A 2B8GA 5ISRA 2FMCA 1U4RA 1VMPA 1K3BC 3PV0A 3TREA 4LMQD 1YIJA 4A3EB 3E0EA 1JOOA 2BH8A 1K8OA 1AH9A 1IKMA 4A93B 3MHBA 3GTJB 3PO2B 5T1IA 1D2BA 3R2TA 3G4SA 4KN7C 4DR7L 1XMOQ 1QUQA 2E75C 3BYYB 4R4IA 2F4IA 2N78A 2DY7A 1XMQQ 3OWEB 1CT1D 1YJ9A 4X3UA 1BXTA 4GN4B 2XNAC 2CW0D 3WDNA 1JB7A 2B8FA 1TKWB 4BBSB 4A3KG 2I07B 4FO2A 2X6GA 4B08A 1OXUA 2VW9A 3I4MB 3O13A 4LJZC 1QB5D 1RTNA 4QGUA 4LUVA 1E1TA 3DM1A 3CW2C 1OTCA 2SNSA 4JI7Q 4RG1A 4GKKQ 1E2ZA 2JA8H 3S16H 2OF1A 3LWUA 2ZJQA 4C3IG 4C56C 2ZM6L 1U4LA 4ZKBB 2NVXB 3KLSX 4CJ1B 3J7A5 4IUTA 4BA1I 1B3AA 4C1NI 5M5YH 3H0GG 3KDFA 5DLQE 4HSPA 1EZ6A 2ATWA 1Y1WH 2JE6I 3FDTA 2X6LA 1WTOA 4NDXA 1Q12A 4DV4L 2R61A 1BBUA 1A3UA 1I4XA 3JAML 4DR5Q 2JA7H 1Z47A 3CP0A 5IIFA 3UDGA 4BXXH 4K6LA 5BN5A 1JOKA 3W5OA 4A3GB 3GO5A 1TS5A 3MTSA 5EBCA 2YTYA 1CKOA 1LTBD 2CKZB 3N52A 4GNXC 3T51B 2K7VA 1STHA 4H7BA 4CDCC 1J6QA 3S1QB 2F0VA 2KUMA 1PH2A 1F9QA 2XIWA 3SR1A 5IE8A 3J81j 1EZ8A 1PH9A 1F2LA 1R9TB 1BDOA 4BWGB 1BCPF 1RF2D 4DV5Q 3BZDB 1VQ6A 2RDHA 4JI3Q 1G8ZD 4P73A 3H3VH 2KBNA 2B3GA 2F0QA 5A35A 5KNDA 3PO3B 5LL6S 2HHHL 1XNRQ 1I50H 3L3OC 3SK6A 4APVA 1YEZA 1S5BD 1HNZL 2NVQB 4R9WA 3PUXA 1YNJD 4FF3A 1HNWL 1A15A 1L1OC 1HFGA 1RL2A 1Y1VG 2CWPA 4LFBQ 3M3YH 3S14H 3TEHB 3S17B 1PH3A 3VA5A 1NY4A 1QZHA 1JICA 1PFNA 3K0YA 2NVTB 4WJ4A 1H9SB 1QILA 4M1UB 4Z9CB 3OHXC 1TWAB 4RGTA 4HTHA 3BJUA 1HQRD 5EKKA 3A0JA 4DGZA 2MUYA 4BS9A 3HGBA 3TMEA 5IP9G 1PYWD 1KNAA 1QWYA 1SYDA 2O4XA 5IP7H 4OEMB 3M85A 4GNXB 3AQQA 4IJHA 3CPWA 2IHFA 4OGQC 1HFNA 1RDPD 3K5NA 3CCUA 3TP6A 2KQ3A 2B2VA 3GTKB 5LMUQ 1BO0A 1JB3A 1NSNS 4IPGA 3FP9A 1KTKA 1PYSB 3BZKA 4JI8L 1GUNA 2ID0A 4DR3Q 1S5CD 3KK7A 3QOLA 2Z6KA 4DV7Q 1YJNA 1JE5A 2Q8RE 4ILWA 2UXCQ 3ZJYC 5C3EH 1TS3A 4N8X1 4AYBB 1L1OB 1EY7A 1IBML 3M4OH 5M3FG 3IAYA 1SNOA 4YWLA 4UP7A 1HNXQ 1L0YB 2F0LA 1VF7A 4DXGA 4HIOA 2IPKD 2CHBD 4C3JH 4FXGC 5IYCH 2VZAA 3UI2A 3MFYA 3CCSA 3K81C 3RLFA 3N6RA 3K5OA 4B3RL 1TS2A 3HOXB 2NZHA 4KD3A 5ELBA 1O80A 2JP1A 3CHBD 2BH2A 3GTMB 2DNEA 3VYTA 2O5IC 4CDDC 1SRUA 1STNA 4JVZA 2N3SA 4JBJA 2R7FA 1V1PB 2UXBL 2HDMA 1MI2A 2YYZA 1NR2A 1PH8A 5CV6A 2PYKA 3KBGA 4A3LG 3PO2H 1AEXA 1SE2A 2ZXPA 2KENA 1BOSA 1LT4D 4KKTA 4BA2I 4JI5L 5KRUA 1UEAB 1SBBB 1VQ9A 1WOCA 1CKNB 3VR5A 4Y52H 2BE5C 1Q3LA 5C0XG 1CHQD 3NXWA 3LGJA 4RCNA 2JEAI 4RHSA 4BBSH 3KUPA 1HZBA 3S1NB 3I4MH 1X3QA 1N32L 1LT5D 2QEXA 3F2DA 2JQOA 5JEAG 1JR0D 1UUPA 1SNCA 1A2TA 1CZGA 1I3QB 3CCRA 4ALPA 2PI2E 3D8GA 1G2TA 1MJEA 4IFDJ 4JBWA 5IGBA 5JOBA 4LF8Q 1A0IA 3BU2A 3HEJA 4CKEA 5D65A 4DV1L 4XXEA 1OO9B 2X69A 4A3FB 1RHPA 2RVLA 1X9NA 3J81L 3A7AB 5E4XA 4DFAA 2RF4A 2JA6H 1LABA 2VXWA 3QR8A 2F0UA 4EGVA 2KECA 2H5XA 2EXZA 2K52A 2NZ1D 1I94Q 5F2DA 1H9JA 3ND8A 4OO1I 3IFTA 1IBKL 1EIGA 3CF5A 1Q1EA 4OWXB 3CXCA 5GAGC 4BY1G 4FXKC 1PDQA 4DV0Q 2VUMG 2MNAA 4I7AA 4DAVA 4H0LC 1TY0A 4X62L 1K8GA 1LLRD 2KHIA 1WCMB 4I7ZC 3EBEA 4PZ7A 4GLAC 2CW0C 1STGA 5I2XA 2UUBQ 4K2LA 1E1OA 4DV2L 5K36G 5HGQA 1FYCA 3KF6A 3NHHA 4DR6L 5K5PA 1SYFA 1H9SA 5C4XB 2QEJC 3SVMA 3PO3H 2AQ3B 1CSQA 4ZQ3A 1QVCA 2R3ZA 1Q8IA 4JBKA 1TWHB 4GLVB 4O42A 2EYMA 2PNRC 2Z4IA 1DGSA 1GHJA 1WTQA 2RSOA 2EPBA 3NEMA 4DPGA 2EYHA 1FD7D 1QNKA 2KCCA 4GNXA 1D7QA 2DUDA 2ASBA 4YCVA 3S17H 1PZID 5E7NA 2K6AA 4PZ8A 4LF9Q 2BA0A 2IHEA 3EROA 1X3EA 4R4QA 1KL9A 4K8JA 4B9XA 2ENBA 3K5LA 4JBMA 2R7ZG 1TWAH 1EFID 3VA7A 4L5SA 1SN8A 2D9UA 2L12A 2EXDA 5M9OA 5ELNA 4RA8A 4H02A 3UDFA 5CGKA 3T1HL 3HOYH 3I55A 1SSOA 1X32A 3TS0A 2D0PA 1BQQT 4LK1C 1L1OA 1Q46A 3K57A 1X3GA 5FJ8H 5KGUA 4OO1H 3BVZA 2K32A 2CCZA 3GTOH 2OCEA 4OIKA 2VQEL 3GTKH 2NTTA 2EYPA 2WB1E 2L0CA 4G57A 5CBAE 4ZAIA 1VQ7A 3S2DH 2FINB 1EQRA 2WB1G 4P2CB 3NBHA 2AWNA 3H91A 4POGA 1IW7D 4HMJA 3Q8DA 4K2KA 4HJAA 1V1PA 4MHEA 4C3IB 4DK1A 4KLKA 3S24A 2CH4W 4C1NK 2IY5B 1M90C 4FXDA 2DJFC 5JVG3 4ZK9B 1JWUD 3H0GB 1N34L 5IYBG 1XPOA 3HRZC 1CTMA 1NTGA 2JYOA 1CKNA 2N49A 3UDXA 5FOBB 4DA2A 4JG2A 4OX9Q 1PTOH 3V05A 2AMCB 3J81E 3BG3A 3T1YQ 1RIPA 3GTGB 2MHVA 3TDQA 3SK5A 1KAAA 2PW7A 5IYDG 2ZXRA 1D5MC 2A6ED 1ET6A 2EY6A 3HOUG 5EKIA 4JI4Q 1D1KA 1EY5A 1I6HH 3CQZB 4PQXA 4RHRA 4DAYA 3W2DA 3DEPA 2E2JH 1DZ1A 4A3MH 3MFGA 2YV5A 1EWCA 4IUVA 4NKLA 3I8ZA 2F4VL 2WAQB 2F0SA 2K5DA 1GD7A 1A3VA 4B9WA 4H44C 5C5LA 4NMZA 4C3HG 2E5LL 4LF4L 1V8QA 2OQKA 1CQVA 3F8TA 1EIFA 4X64L 1C9OA 3MVVA 1G6PA 2KA7A 1B2TA 3MAQA 1GUSA 1I3QH 1TT2A 4FVMA 1A8VA 4JPBW 1R4PB 3T56B 4DNTB 1N33L 3NPPA 2PNHA 4L63B 2Z1CA 1CA6A 4U68A 1MKHA 2Z9HA 1EQQA 1Y1VB 1HCZA 2E74C 4IUPA 1I4HA 3J7ZC 1IBLQ 1OXVA 4A3DG 1F9RA 3QG1A 4FF2A 2BDNA 1WD1A 4AH6A 4KN4C 5CC4A 4GKKL 1HJPA 2OWOA 4GN3B 3K59A 3CC4A 2M00A 5EAYA 3OYYA 3E3XA 3I4NH 5KEEA 2WFWA 2R93G 1DM0B 4JV5Q 3M4PA 4A3BG 2QDBA 2E2IH 1TS4A 2A6HD 4DV3L 4RH6A 5C3XA 1PZJD 1S5ED 3T16A 1VF5C 4P72A 4GOPA 4G7ZC 2GN5A 2QF7A 4XT1B 1X55A 1TVXA 1V1QA 2TMPA 3PUZA 2JA5B 4H13C 4B3MQ 2VB2X 4E6IA 3ICEA 3K6OA 5C4JH 4IFDG 3DUZA 4GKJQ 4A3JB 2JSOA 4X66Q 4C2MH 4DR5L 3ULLA 1K83B 5C44G 5ELCA 4RFBA 5M5WB 4LUOA 3CC7A 3VR3A 4KY5A 4BBRG 5JJKA 2JA9A 3FKIG 3FRPB 4DUYL 4DR2Q 5C4XH 5JJIA 1LT3D 2SNMA 4KKSA 1JE4A 4KKUA 4OHJA 3HOWH 5GQOA 1EEFD 2BE5D 2ZTCA 2A74C 4HJ5A 2Y0SE 3A5ZB 2J4XA 1HXYD 3Q22A 3HKZE 2K01A 1NE3A 1SMYC 3HKZG 5KYLA 3F2BA 3GDEA 1Q90A 4OWWB 3P75A 2UU9L 2ICEC 5LHY1 3C46A 2PO4A 3U4ZA 2EYOA 4DR1L 5JPNC 5C0XJ 1PV4A 3RN2A 2SDFA 1O78A 3HOZG 2LY7A 1D5XC 1S72A 4LNQA 2YTVA 1DOLA 4BY7G 1F77A 1SNMA 2G5DA 1J5EQ 1EYCA 1KNEA 1PRTD 2EJMA 3OIPA 5I2YA 2I5LX 1C48A 2B29A 4YIJA 5JEAJ 1U4PA 4LFCQ 2HCIA 1EYDA 2B2UA 1B9NA 4JI1L 3AFPA 4V0BA 3DWQA 4QQBX 1LTSD 3DEOA 3MZ5A 4L5RC 1ENFA 2RSNA 4FF1A 3ONAB 2UUAQ 3AEVA 1A62A 4LF7L 4NXNQ 1J8IA 3A8KE 2RQXA 1QZGA 4LF6L 3E0JA 1BUVT 2HD3A 2AUJD 2PQAB 2A68D 2B63G 3CCEA 2XRQD 4IALA 2PW5A 1N36L 1E22A 4RWSC 3V96A 2PMZE 3ND9A 4N9TA 1BNZA 4MNOA 1U4MA 2WV6D 5C4ZA 2M9VA 4UAIA 3IFDA 2Z0SA 1LTAD 5EJWA 1GXDC 4K5WA 1FNVA 1L0XB 4JI0Q 3ITPA 2EY5A 4PZ6A 1K8AC 3I3CA 2NZOA 1U0LA 1Z7TA 4DR4Q 1JWSD 2HDLA 3OTOQ 2RHQB 5FLXL 1PHJA 4PMBA 5ELFA 3BS1A 2F3VA 5M3MB 2EYLA 2IX3A 3CQZH 4A3IH 2RCFA 4HJ8A 1FVIA 4OONA 5CORA 4BY1B 2UXDQ 5BR8Q 2K5VA 4JOIC 2VUMB 1EY0A 1YJWA 5LMNL 4JI2Q 1HUMA 1ESFA 2I5MX 1DJRD 3G6EA 2JXMB 3D4RA 4KHPL 2F0FA 1B44D 3D31A 2D0OA 4XTCS 1EU4A 4DF7A 4G4KA 1BF4A 3CCQA 1GOZA 1IW7C 3URYA 2EE1A 3MXGA 2M2LA 4R1JA 1KRSA 2Z4HA 3RZOH 5JJZA 1KDBA 2A1AA 2XWJB 2K75A 2WIIB 2JA8G 3CAMA 3PCOB 1LTGD 3PSIA 1JJGA 1YZ6A 2NWGA 1X65A 5C6AA 2KEDA 2F0DA 4G7HC 2LFNA 5IWAQ 3TRZA 1QVFA 3FEWX 2R7ZB 1LTLA 3DWAA 2H1EA 1S5DD 1XJVA 3ZYYX 3IRBA 3AMUA 3U9OA 3T53B 2A6EC 3J80L 1Y1WG 3S1MB 1P16A 4CJ0B 4B3TQ 1KRTA 4YHHL 1W6KA 3C1EA 1CI3M 3PGZA 5EKLA 5EPKA 1C0AA 2ZXOA 2QW7A 3VYRA 2JA5H 1VQ8A 2JA7G 1BKBA 3QWNA 3S1RB 4KD4A 2FMMA 4BXXG 3S15B 3QOJA 4K0KQ 1WI5A 4QCLA 1Q7YC 1X3FA 2FFKB 4A4IA 4A3JH 1CKMA 4NPSA 2ES2A 1FJGQ 1VQ5A 4LWCA 4NXMQ 2EQSA 4B3SQ 5HGTA 3KF8B 1GVPA 5I6YA 2KEEA 3EVQA 1MBYA 2PZWA 2F0IA 4GN5A 4KV6A 3STBD 1ILPA 1T5XD 4TSSA 1XNQL 2JN4A 5CV9A 4NP5A 1BVSA 1CK1A 3AB9A 4WRDA 4YY3L 3PUWA 4PG3A 2R92B 2EYJA 1LV9A 2SOBA 1DD2A 1KXLA 3M4YA 4XT3B 1LACA 4CGYB 3RNUA 3HZXA 5I6WA 1PH6A 3TBIB 4YCWA 3HOUB 1TWCB 5FK9C 1SFOB 2A69D 4K5VA 1SNDA 2L9HA 1UE6A 1MJCA 1T5EA 4LF5L 4QIWE 4TRDA 2A6HC 3D4DA 2PQAA 3K80C 3A5UA 2QGQA 2XWBB 5IT9L 2QA4A 5EGTA 4C3HB 5IP7G 1ZYRC 3NE5B 1S3OA 3KJOA 5C3WA 3HKSA 1V43A 4A3EH 5HURA 5DEHA 3JAME 1VQAA 2IX0A 2Z8LA 1RCVD 4IPHA 2ZM6Q 4DK3C 3ER0A 2LSSA 4A93H 3GTJH 3C1FA 2XGTA 2R7DA 3TN2A 4ZKCB 1UE7A 3CU7A 5FLMH 2V4DA 1LTID 3KBXA 3K7AB 2E8GA 4R4OA 2K50A 3GP7A 1E2VA 2QKIC 3MA2B 2A73B 2QILA 3Q24A 3F2UA 5E1FA 5C3EG 1CA5A 1QNUA 4F87A 2F03A 4I65A 1SDFA 3HFZB 3KLWA 3TP7A 4EX5A 5AJ3Q 4QB4A 1EIHA 2UUCL 2FXQA 3KJPA 4C3JG 5IYCG 2R93B 3EN2A 5ELDA 3BVGA 4A3BB 4DV6L 3VYUA 4O1NA 5M3MH 1AP0A 1IYJB 2NVXH 3RZDB 5IGCA 2NB0A 1SMYD 4FF4A 2L15A 4DN4M 1PRTC 1F2ZA 1FR3A 4IOAA 3PO2G 3VR4A 1YITA 4ME3A 4L8JA 5GADC 3SK8A 1TWFB 3AYHB 2QDLA 1VS0A 2WP8J 4JI4L 5C44B 4DNIA 3PMFA 2HHHQ 3Q0AA 2JEBI 3FKIB 3HOVB 1HNZQ 4IZ8A 1YBYA 1RODA 5BN3A 4DK6C 4HJ7A 1WTXA 1HNWQ 1UE5A 3L9AX 4A3GH 4BBSG 2EYFA 3HP3A 1K3RA 4A3CH 4IN3A 2NN6I 3I4MG 4JOIA 3LX0A 3MC0B 4X3SA 2A68C 3RMHA 1O7LA 1PZKD 3CCJA 4FYDA 1II3A 1VQKA 2HQEA 1PMRA 3EQLC 3S1QH 2AUKA 4HEDA 2K4KA 1C8CA 3G71A 3H15A 1EYGA 1K0SA 4O2DA 4JC0A 2A19A 3RLNA 1R9TH 4YWMA 3JAMc 4V190 3PF4A 2MGSA 3DMUA 5AFWA 1MGSA 2VQFL 1PH5A 3HOZB 3KF8A 3PIOA 2EDGA 3GV6A 1AZPA 4QJFA 4EVOA 4BY7B 1PRTB 3TP8A 4ABNA 3R2IA 5JVH3 2NVQH 3D6CA 2OTLA 1F9PA 4F7XA 2I0QA 4KJOA 4RAUC 2JA6G 1LT6D 3WWVA 1WTRA 4JI8Q 3MEHA 3S1RH 1A2UA 1B53A 3DM3A 5DM63 4AQYL 1HTLD 3CC2A 4CDFC 2F0JA 5JJLA 3H94A 3RN5A 2NVTH 2CQAA 4DUZL 1SAPA 5GAHC 4IPDA 1O7ZA 5IOCA 3BDOA 2F0GA 4L5QA 1S5FD 4GZYC 1E24A 2EY2A 1OXSC 3OMGA 5KYIA 1JMCA 2F3IA 3D6WA 3NBIA 1ZXTA 2BDOA 3OWFA 1XX8A 2DN8A 3GTPB 1IYVA 4X65L 2RDGA 4XQJA 2KHSA 4IQZA 3OOCA 4B3RQ 3L7ZC 3ERQA 3GV3A 4DKAC 2Q2HA 2F0TA 3VYSA 2L11A 1HR0L 1TWGB 4DAMA 1U9RA 2PMZB 2R92H 4A3KB 3PO3G 1C4QA 1VCIA 2D2CC 2F0WA 2NN6H 4HCSA 1DONA 2UXBQ 3NTIA 3W1BA 2YU9B 1KD1C 3CMEA 1ML0D 1EL0A 1PH1A 2ZJRA 2MO1A 4LFAL 1K8MA 4JI5Q 1F2YA 4JI6L 5CR3A 2NBFA 3H09A 3J81i 1PFBA 2Z6BA 4J15A 2ALYB 4IFDI 4HAEA 3DWPA 3FHWA 3UE0A 1BR9A 2WACA 1UEBA 3UE1A 2IX1A 1N32Q 3RR5A 1UNSA 2RHSB 1ASZA 3HOYG 3HOXH 3OW2A 3GTMH 2DJGC 5C5MA 2TSSA 4IO9A 2MFIA 4KTAA 5FJ8G 3A54A 1EY8A 1GUOA 4OO1G 4OXPA 2CVRA 4P71A 1XTDA 1STAA 5A2QL 3PIPA 4LFCL 3TP5A 1QVGA 1ZKOA 2E2DC 3NWTA 4RCOA 4DV1Q 2K5HA 3F1ZA 4O0AA 3STBC 2VB3X 3K58A 4KI0A 2XVSA 2MPMA 3HG9A 4AYBE 2JA8B 1A63A 4PMCA 3S16B 3I4LA 2B2TC 4NW2A 3H3VC 2NVYB 3S1NH 3QIAA 5M5YB 4K5XA 1WTHA 2GVBA 1IBKQ 2KVMA 1HQMC 3W3AA 1XMOL 1PRTF 1RJTA 2C35B 3BVMA 2E76C 3FMCA 1Y1WB 1XMQL 3NQTA 3R93A 5I9OA 4X62Q 3NQIA 2A69C 3RZDH 3I70A 2R6GA 3PF5A 1CSPA 3NP8A 3I90A 5FKAC 5IODA 1XPRA 2JA7B 1YNXA 1STBA 4A3FH 1VQOA 4DV2Q 3OIQA 3TSSA 1G91A 1VQFA 4JI7L 1JC7A 4DR4L 3T13A 4A3MG 5J39A 1TWFH 2Q8IB 1P8LA 4ME5A 1AW7A 1V9PA 4DXFA 3HOVH 2UXDL 2VL6A 1WTVA 4PMWA 3Q6SA 3NELA 4IUQA 1Y14B 1ZYRD 1WCMH 1PFSA 4TKOB 1YNND 3D4WA 4FDBA 3J81c 1I50B 3MWYW 3EA6A 2K5QA 1S4ZA 5IGDA 4GLXA 4GS3A 2DGYA 3CCLA 4JYAQ 3M3YB 3T1HQ 3S14B 5E3FA 1I5FA 3TZDA 1WVLA 4AIMA 3K8AA 5M3FB 1TWHH 3E9IA 3CCVA 4A75A 2MQHA 4Y7NB 4RGNA 4ZYSA 2F0PA 2LXKA 5ELEA 2VQEQ 3S9WA 2Z6KC 3L2PA 3I4NG 2Y0SG 1X54A 2LXJA 2F0MA 4RMFA 1SE4A 1SYCA 1VQDA 1EOTA 4DV5L 4JI3L 1CZWA 4HIKA 1IZ6A 1Y69U 4QY7A 2RCNA 3M7GA 1XNRL 4IPCA 3WOFA 1I6VC 3G6JB 2AHOB 5EQ0A 5A2QE 4LFBL 3HS0C 1N34Q 5IGFA 3B6YA 3X3NA 3ULPA 4A76A 4Q5VA 4XYOA 1HZCA 3QJYA 2ICIA 1NAPA 4UHVA 5COYA 1I4RA 1UWVA 5C4XG 4B3SL 4A3KH 2KCMA 3FPPA 3HOWG 4RKLA 1JQYD 3I4OA 4OL7A 3I72A 1XWEA 1Q1BA 1ZEQX 4C3JB 4R8IA 3QO2A 1DYQA 2F4VQ 2RKSA 3SGIA 4C3IH 2O5JC 1NMFA 3TS2A 2CWAA 1HA6A 5LMUL 3H6MA 2HQLA 3T4AC 1Z6HA 4RGMA 3H0GH 3NTHA 3F2CA 2PPBC 1N9WA 4DR3L 2E5LQ 1A6XA 1B8AA 4LF4Q 1SJED 1STEA 2AQ1B 3QB3A 1UAPA 1E0BA 1H9KA 4DV7L 2K33A 3X3MA 1HHVA 4X64Q 3P1HA 2UXCL 4N8FA 2A8VA 4X3KA 1IHZA 3GTGH 5CYUA 2F0KA 1N33Q 1J9OA 1NMGA 3G48A 1JJ2A 3I73A 4ID6A 1B9MA 4XQQA 1HNXL 4N9PA 3A55A 5HY6A 2SEBD 3H3VI 2HCCA 4OIJA 2CFMA 1X6OA 3RUZA 2G9DA 4PV1C 5JAVA 1GM5A 1EQTA 1V1OA 2KOLA 1GUWA 1CFMA 1JWMD 2NTSA 4XDXA 3U9SA 4JK1C 1FGBD 1EIYB 2ZJPA 3NTKA 2J7ZA 2NVYH 1HH2P 1DOKA 1HA5A 1B70B 1VQCA 1SE8A 3I56A 4DV3Q 3SK4A 2EJGC 3NUCA 4X3TA 5KIXA 1VQNA 1Z9FA 3CRKC 1HZ9A 5DAUA 1KABA 1L0WA 5J3BA 1Y1VH 1GJXA 4DU9A 1FNWA 2JA6B 1LO5D 5AJ3L 3UDIA 1RD9D 3PIO3 1KHIA 4WFN3 2B2TA 1BBXC 5D3IB 3BZCA 4A3IG 1G291 2WAQE 1HTPA 4DUYQ 1EWHA 2IT1A 2WAQG 4TQUS 3FPUB 1RKNA 1Y8PB 3W1GA 4KK7A 4DK0A 5LMNW 4LF8L 5C0XI 5IP9H 1E2WA 4ZUJA 3MXUA 3NENA 5KNCA 2HUGA 4K14A 2Q2UA 1PLFA 1AZQA 1B4OA 2MJ8A 2UU9Q 5CBEE 2EY1A 2OT2A 2LKVA 1Y8NB 1LYLA 1QCBD 2BCOA 2F3WA 1FL0A 4DR1Q 3BDCA 1I94L 2WB1B 1FGUA 1K83H 5M5WH 2QCPX 2VS1A 2N88A 4R8NA 2RBMA 3A7LA 4DV0L 1JORA 2EVBA 2I46A 3I2ZA 2GA4B 2ZTEA 4WORA 5M3FH 4DNRB 1VQBA 4Y7NH 4JI1Q 1AE2A 3KF6B 4YWKA 3S2HB 2B2WC 1CQFA 5FO8B 4IUNA 1PTOC 1I4GA 3DLLA 5H1SE 4HSVA 4UPAA 4R4TA 2UUBL 3K5MA 3OSOA 4P74A 1EU3A 4WJWA 1XPUA 1F9SA 4QF4A 2KJXA 2LMCB 3HOYB 5ELOA 1KDCA 4LF7Q 1TQOA 3OW7A 4LF6Q 5FLXE 3E6ZX 3E5SA 1ENCA 2XN9C 2PQEA 4DR7Q 4KJNA 4PNYA 1VQLA 2JA5G 3KYHC 5J1ZA 4A3LH 2OTJA 3GTOB 4HR7B 1N36Q 5M5XB 3AFQA 5IGEA 4A3JG 2GVAA 2MO0A 1H9MA 3S2DB 2PI2A 4LF9L 3J7AV 3JAMi 2OEOA 2F0HA 5C0XH 2NYZD 4NB3A 3PIP3 1KQSA 1SR3A 1PH7A 1YNNC 1G6ZA 1VQGA 5EPLA 1YI2A 4UY8C 5JEAH 4IJLA 1QOHA 2V1CC 4XIGS 3AU7A 3U58A 1WD0A 1JCKB 2A5HA 1VMCA 1STYA
chains in the Genus database with same CATH topology
1TU2B 1PTOB 1I4QA 1SYBA 1EEID 2AWOA 5CV8A 1F2MA 1SNPA 4A3DB 3NWSA 3A8JE 2B2YC 2EJFC 1I6HB 1AFPA 2E2JB 5D14A 1TY2A 4A3MB 4CKBA 1BCPD 5E4WC 1KLUD 3CRLC 3LWEA 3SHLA 4M8AA 2K1BA 4FP5D 1QG7A 2WKDA 4ZRZA 3J80E 4J8QA 2F0EA 4DAPA 1GUGA 2BA1A 4IUUA 3CKIB 5I9PA 4HMIA 1SXTA 2PCFB 1GUTA 2KCNA 1NUCA 4ZLTF 5G3LF 2H4OA 2DNCA 2L55A 1QJOA 4QMGA 1CM9A 3WOEA 5K36H 1X3PA 4BBRB 5EPJA 3KLRA 4CKCA 1SEBD 1SNQA 3KLSA 2L1BA 4KHVA 4F88A 1ICWA 3VR2A 1LTTD 4G7OC 3GTLB 3I4NB 1TR5A 3EJIA 3IKJA 2Y0SB 3HKZB 1XYIA 3R3OA 2E2IB 3SE0A 1WTWA 1VDZA 3G7LA 1D6EC 5CV7A 1DCZA 1PFMA 1PXUA 2E2HB 3GQBA 2IJ0A 2F0OA 1W6JA 1IYUA 4KY6A 3NSWA 3A56A 5C4JB 3PUYA 1MSHA 3PUVA 2D62A 4C2MB 1RTOA 4FNFA 4MIUA 2B39A 1D1IA 5IT9E 2DY8A 4HCEA 2OXPA 3TZUA 1HRJA 4L6TB 2K03A 5D3DA 5NUCA 5IGGA 3HOWB 1PTOF 2WINB 2LS01 2FJ2A 3P7JA 2B2UC 1Y8OB 2B63B 3GTQB 2K28A 2K5WA 1XTCD 4U673 2N55A 4CBVA 3EFXD 3DXJC 2D5DA 2O2LD 1OXXK 2K04A 3GD7A 1I4PA 1H9RA 2EOTA 5G3LD 4XYQA 1SJHD 1NR4A 1SYGA 2EZVA 5FO7B 2XRSD 3SEBA 4EQNA 1KLGD 3R8BA 1CHPD 2B2WA 5JPMC 4IURA 3FVQA 2AQ2B 2BOSA 1EY9A 3A8IE 2Q8TA 3J7YW 1NCVA 1WTPA 4K6DA 3NK9A 1ENAA 1YNJC 5KNBA 2VNUD 1D5ZC 2F1MA 2NN6G 5TSSA 4K8IA 4KY7A 2RA4A 3MXPA 2L4NA 4KHZA 2FHTA 3C2PA 1DXMA 1ONLA 1MD2D 3Q23A 1ET9A 4A3IB 5DNFA 1SE3A 4XQNA 1EQVA 2NUCA 4UDUC 2IL8A 3P20A 1G2SA 1EYAA 2IW3A 2WKCA 3V2TA 5DM73 2J0TD 2PZTA 4CHTB 1IL8A 3BYTB 1PTOD 5CV5A 1JOQA 2C9OA 4MN3A 2B2YA 5T1GA 4F8MA 3SXHA 4IFDH 1TIID 2RDFA 3OPOA 2IWHA 4KMUC 3RZOB 4EQPA 1EY4A 1M8AA 3DHQA 4ZUIA 1ESRA 3RD4A 1M4VA 5CMDA 3VR6A 1FNUA 1XXGA 1MSGA 1SYEA 5BN4A 3M7NA 4J6HA 1IKLA 3I91A 1OXTA 2PZUA 1KDAA 1BCPC 2XSCA 4S3SA 5CV4A 4QUCA 2B2VC 4CJ2C 5C4HA 3LNNA 4ULLA 3IL8A 4HN7A 1ILQA 2L5TA 3J7AF 2C5CA 4QIWB 2MP1A 5J22A 4ODGA 5EBDA 4EQOA 2ZT9C 4LAAA 1LTRD 1O7YA 3BDLA 4QUFA 1B50A 4Q0FA 2G9HD 1EY6A 3MXNA 1GHKA 4RKBA 3D3RA 5FO9B 2K05A 1DOMA 3SDZA 4J1MA 5C3EB 3OMCA 1HPCA 1R4QB 3M4OB 1BCPB 1A3TA 4RGOS 5I4DA 2F0NA 1AN8A 3C3LA 5LL6X 1HUNA 1B1ZA 1QE6A 2B8GA 5ISRA 2FMCA 1U4RA 1VMPA 3PV0A 4LMQD 4A3EB 1JOOA 1K8OA 1IKMA 4A93B 3MHBA 3GTJB 3PO2B 5T1IA 1D2BA 3R2TA 4KN7C 2E75C 3BYYB 2F4IA 2DY7A 3OWEB 1CT1D 4X3UA 1BXTA 2XNAC 2CW0D 3WDNA 2B8FA 1TKWB 4BBSB 2I07B 4FO2A 2X6GA 4B08A 1OXUA 3I4MB 3O13A 4LJZC 1QB5D 1RTNA 3DM1A 2SNSA 1E2ZA 2OF1A 3LWUA 4C3IG 4C56C 1U4LA 4ZKBB 2NVXB 3KLSX 4CJ1B 4IUTA 4BA1I 1B3AA 4C1NI 4HSPA 1EZ6A 2JE6I 3FDTA 2X6LA 1WTOA 4NDXA 1Q12A 2R61A 1I4XA 1A3UA 3JAML 1Z47A 5IIFA 4K6LA 5BN5A 1JOKA 4A3GB 3GO5A 1TS5A 3MTSA 5EBCA 1LTBD 3N52A 3T51B 2K7VA 1STHA 4H7BA 3S1QB 2F0VA 2KUMA 1F9QA 2XIWA 3SR1A 1EZ8A 1F2LA 1R9TB 1BDOA 4BWGB 1BCPF 1RF2D 3BZDB 2RDHA 1G8ZD 5A35A 2F0QA 5KNDA 3PO3B 5LL6S 3L3OC 3SK6A 1S5BD 2NVQB 4R9WA 3PUXA 1YNJD 4FF3A 1A15A 1HFGA 3S17B 3VA5A 1JICA 1PFNA 3K0YA 2NVTB 1H9SB 1QILA 4M1UB 4Z9CB 3OHXC 1TWAB 4RGTA 4HTHA 1HQRD 5EKKA 4DGZA 2MUYA 4BS9A 3HGBA 3TMEA 1PYWD 1KNAA 1QWYA 1SYDA 2O4XA 3M85A 4OGQC 1HFNA 1RDPD 3K5NA 3TP6A 2KQ3A 2B2VA 3GTKB 1BO0A 1JB3A 1NSNS 1KTKA 1GUNA 2ID0A 1S5CD 3KK7A 3QOLA 2Q8RE 4ILWA 1TS3A 4AYBB 1EY7A 3IAYA 1SNOA 1L0YB 2F0LA 1VF7A 4DXGA 2IPKD 2CHBD 4FXGC 3UI2A 3MFYA 3RLFA 3N6RA 3K5OA 1TS2A 3HOXB 4KD3A 5ELBA 1O80A 2JP1A 3CHBD 3GTMB 2DNEA 3VYTA 2O5IC 1STNA 1V1PB 2HDMA 1MI2A 2YYZA 1NR2A 5CV6A 2PYKA 3KBGA 1AEXA 1SE2A 2ZXPA 1BOSA 1LT4D 4KKTA 4BA2I 5KRUA 1UEAB 1SBBB 3VR5A 2BE5C 1Q3LA 5C0XG 1CHQD 3NXWA 4RCNA 2JEAI 4RHSA 3KUPA 3S1NB 1X3QA 1LT5D 5JEAG 1JR0D 1UUPA 1SNCA 1A2TA 1CZGA 1I3QB 3D8GA 1G2TA 4IFDJ 4JBWA 5IGBA 5JOBA 3HEJA 4CKEA 5D65A 4XXEA 1OO9B 2X69A 4A3FB 1RHPA 2RVLA 3J81L 3A7AB 5E4XA 4DFAA 1LABA 2VXWA 2F0UA 4EGVA 2KECA 2EXZA 2NZ1D 5F2DA 1H9JA 3ND8A 4OO1I 3IFTA 1EIGA 1Q1EA 4FXKC 1PDQA 4DAVA 4H0LC 1TY0A 1LLRD 1WCMB 4I7ZC 2CW0C 1STGA 5I2XA 4K2LA 5K36G 1FYCA 3NHHA 5K5PA 1SYFA 1H9SA 5C4XB 2QEJC 3SVMA 2AQ3B 4ZQ3A 2R3ZA 1Q8IA 1TWHB 4O42A 2EYMA 2PNRC 2Z4IA 1GHJA 1WTQA 2RSOA 2EPBA 2EYHA 1FD7D 1QNKA 2KCCA 1PZID 2K6AA 2BA0A 3EROA 4K8JA 4B9XA 2ENBA 3K5LA 1EFID 3VA7A 2D9UA 2L12A 5M9OA 4RA8A 5CGKA 1SSOA 1X32A 1BQQT 4LK1C 3K57A 5KGUA 4OO1H 3BVZA 2K32A 4OIKA 2NTTA 2EYPA 2L0CA 4G57A 5CBAE 4ZAIA 2FINB 4P2CB 3NBHA 2AWNA 3H91A 1IW7D 4HMJA 4K2KA 1V1PA 4MHEA 4C3IB 4DK1A 4C1NK 4FXDA 5JVG3 4ZK9B 1JWUD 3H0GB 3HRZC 1CTMA 2JYOA 5FOBB 4DA2A 1PTOH 3V05A 3J81E 3BG3A 3GTGB 2MHVA 3TDQA 3SK5A 1KAAA 2PW7A 2ZXRA 1D5MC 2A6ED 1ET6A 2EY6A 5EKIA 1D1KA 1EY5A 3CQZB 4PQXA 4RHRA 4DAYA 3W2DA 3DEPA 1DZ1A 3MFGA 1EWCA 4IUVA 4NKLA 3I8ZA 2WAQB 2F0SA 2K5DA 1A3VA 4B9WA 4H44C 5C5LA 4NMZA 4C3HG 1V8QA 1CQVA 3MVVA 2KA7A 1B2TA 3MAQA 1GUSA 1TT2A 4FVMA 1R4PB 3T56B 4DNTB 3NPPA 4L63B 2Z1CA 1CA6A 4U68A 1Y1VB 1HCZA 2E74C 4IUPA 1I4HA 1OXVA 1F9RA 3QG1A 4FF2A 2BDNA 1WD1A 4KN4C 5CC4A 3K59A 2M00A 5KEEA 1DM0B 2QDBA 1TS4A 2A6HD 4RH6A 5C3XA 1PZJD 1S5ED 3T16A 1VF5C 4G7ZC 2QF7A 4XT1B 1TVXA 2TMPA 3PUZA 2JA5B 4H13C 2VB2X 4E6IA 3K6OA 4IFDG 3DUZA 4A3JB 2JSOA 1K83B 5M5WB 5ELCA 4RFBA 3VR3A 4KY5A 3FRPB 1LT3D 2SNMA 4KKSA 1JE4A 4KKUA 4OHJA 1EEFD 2BE5D 2A74C 2J4XA 1HXYD 3Q22A 2K01A 1SMYC 5KYLA 1Q90A 3P75A 2ICEC 5LHY1 1JCKB 3C46A 2PO4A 2EYOA 5JPNC 5C0XJ 2SDFA 1O78A 2LY7A 1D5XC 1DOLA 1F77A 1SNMA 1EYCA 1KNEA 1PRTD 2EJMA 3OIPA 5I2YA 1C48A 4YIJA 5JEAJ 1U4PA 2HCIA 1EYDA 2B2UA 1B9NA 4V0BA 3DWQA 1LTSD 3DEOA 3MZ5A 1ENFA 2RSNA 4FF1A 3ONAB 1J8IA 3A8KE 2RQXA 3E0JA 1BUVT 2AUJD 2A68D 2XRQD 4IALA 2PW5A 3V96A 3ND9A 4N9TA 1BNZA 1U4MA 2WV6D 5C4ZA 2M9VA 4UAIA 3IFDA 1LTAD 5EJWA 1GXDC 4K5WA 1FNVA 1L0XB 3ITPA 2EY5A 3I3CA 1Z7TA 1JWSD 2HDLA 5FLXL 4PMBA 5ELFA 3BS1A 2F3VA 5M3MB 2EYLA 2IX3A 5CORA 4BY1B 2VUMB 1EY0A 1HUMA 1ESFA 1DJRD 2JXMB 3D4RA 2F0FA 1B44D 3D31A 4XTCS 1EU4A 4DF7A 4G4KA 1BF4A 1GOZA 1IW7C 3URYA 2EE1A 3MXGA 2M2LA 2Z4HA 5JJZA 1KDBA 2XWJB 2WIIB 1LTGD 2NWGA 5C6AA 2KEDA 2F0DA 4G7HC 2LFNA 3FEWX 2R7ZB 3DWAA 2H1EA 1S5DD 3ZYYX 3AMUA 3U9OA 3T53B 2A6EC 3J80L 3S1MB 4CJ0B 1W6KA 3C1EA 1CI3M 5EKLA 5EPKA 2ZXOA 3VYRA 3QWNA 3S1RB 4KD4A 2FMMA 3S15B 4QCLA 3QOJA 2FFKB 5HGTA 5I6YA 2KEEA 3EVQA 1MBYA 2PZWA 2F0IA 4KV6A 1ILPA 1T5XD 4TSSA 5CV9A 4NP5A 1CK1A 3AB9A 4WRDA 3PUWA 2R92B 2EYJA 1LV9A 2SOBA 1DD2A 3M4YA 4XT3B 1LACA 4CGYB 3HZXA 5I6WA 3TBIB 3HOUB 1TWCB 5FK9C 1SFOB 2A69D 4K5VA 1SNDA 2L9HA 1T5EA 4TRDA 2A6HC 3D4DA 2XWBB 5IT9L 5EGTA 4C3HB 1ZYRC 3NE5B 5C3WA 1V43A 5HURA 5DEHA 3JAME 2IX0A 2Z8LA 1RCVD 3C1FA 3TN2A 4ZKCB 3CU7A 2V4DA 1LTID 3KBXA 3K7AB 3GP7A 1E2VA 2QKIC 3MA2B 2A73B 2QILA 3Q24A 3F2UA 5E1FA 1CA5A 1QNUA 4F87A 2F03A 4I65A 1SDFA 3TP7A 4QB4A 1EIHA 4C3JG 2R93B 5ELDA 3BVGA 4A3BB 3VYUA 4O1NA 1AP0A 3RZDB 5IGCA 2NB0A 1SMYD 4FF4A 4DN4M 1PRTC 1F2ZA 1FR3A 3VR4A 4L8JA 3SK8A 1TWFB 2WP8J 5C44B 3PMFA 3Q0AA 2JEBI 3FKIB 3HOVB 4IZ8A 1RODA 5BN3A 1WTXA 3L9AX 2EYFA 3HP3A 4IN3A 2NN6I 3LX0A 3MC0B 4X3SA 2A68C 3RMHA 1O7LA 1PZKD 4FYDA 1II3A 2HQEA 1PMRA 3EQLC 2AUKA 4HEDA 1C8CA 4V190 2MGSA 3DMUA 5AFWA 1MGSA 3HOZB 3KF8A 2EDGA 3GV6A 1AZPA 4EVOA 4BY7B 1PRTB 3TP8A 4ABNA 3R2IA 5JVH3 3D6CA 1F9PA 4F7XA 4KJOA 4RAUC 1LT6D 1WTRA 3MEHA 1A2UA 1B53A 5DM63 1HTLD 2F0JA 3H94A 2CQAA 1SAPA 1O7ZA 5IOCA 3BDOA 2F0GA 1S5FD 4GZYC 2EY2A 1OXSC 3OMGA 5KYIA 3D6WA 3NBIA 1ZXTA 2BDOA 3OWFA 1XX8A 2DN8A 3GTPB 1IYVA 2RDGA 4XQJA 2KHSA 4IQZA 3OOCA 3L7ZC 3ERQA 3GV3A 2F0TA 3VYSA 2L11A 1TWGB 1U9RA 2PMZB 4A3KB 1C4QA 1VCIA 2D2CC 2F0WA 2NN6H 4HCSA 1DONA 3NTIA 2YU9B 1ML0D 1EL0A 1K8MA 1F2YA 5CR3A 2NBFA 3H09A 1PFBA 4IFDI 4HAEA 3DWPA 1BR9A 2WACA 2IX1A 1UNSA 5C5MA 2TSSA 4KTAA 3A54A 1EY8A 1GUOA 4OO1G 2CVRA 1STAA 5A2QL 3TP5A 1ZKOA 2E2DC 3NWTA 4RCOA 2VB3X 3K58A 4KI0A 2XVSA 2MPMA 3HG9A 2JA8B 4PMCA 3S16B 3I4LA 2B2TC 4NW2A 3H3VC 2NVYB 3QIAA 5M5YB 4K5XA 2KVMA 1HQMC 3W3AA 1PRTF 1RJTA 3BVMA 2E76C 3FMCA 1Y1WB 3NQTA 3R93A 5I9OA 3NQIA 2A69C 3I70A 2R6GA 3NP8A 3I90A 5FKAC 5IODA 2JA7B 1STBA 3OIQA 3TSSA 1G91A 1JC7A 3T13A 5J39A 2Q8IB 4ME5A 1AW7A 4DXFA 1WTVA 4PMWA 3Q6SA 4IUQA 1ZYRD 4TKOB 1YNND 3D4WA 1I50B 3MWYW 3EA6A 2K5QA 1S4ZA 5IGDA 3M3YB 3S14B 5E3FA 3TZDA 1WVLA 5M3FB 4Y7NB 4RGNA 4ZYSA 2F0PA 5ELEA 3S9WA 2F0MA 1SE4A 1SYCA 1EOTA 1CZWA 1Y69U 3M7GA 3WOFA 1I6VC 3G6JB 5EQ0A 5A2QE 3HS0C 5IGFA 3X3NA 4Q5VA 4XYOA 3QJYA 2ICIA 1NAPA 5COYA 1I4RA 3FPPA 4RKLA 1JQYD 4OL7A 3I72A 1XWEA 1Q1BA 1ZEQX 4C3JB 4R8IA 3QO2A 1DYQA 2RKSA 2O5JC 1HA6A 3H6MA 3T4AC 1Z6HA 4RGMA 2PPBC 3NTHA 1A6XA 1SJED 1STEA 2AQ1B 3QB3A 1UAPA 1E0BA 1H9KA 2K33A 3X3MA 1HHVA 3P1HA 4X3KA 1IHZA 5CYUA 2F0KA 1J9OA 3I73A 4ID6A 1B9MA 4XQQA 4N9PA 3A55A 2SEBD 2HCCA 4OIJA 3RUZA 2G9DA 4PV1C 5JAVA 1EQTA 1V1OA 2KOLA 1GUWA 1CFMA 1JWMD 2NTSA 4XDXA 3U9SA 4JK1C 1FGBD 3NTKA 2J7ZA 1DOKA 1HA5A 3SK4A 2EJGC 3NUCA 4X3TA 5KIXA 3CRKC 5DAUA 1KABA 1GJXA 4DU9A 1FNWA 2JA6B 1LO5D 1RD9D 3PIO3 4WFN3 2B2TA 1BBXC 5D3IB 1G291 1HTPA 1EWHA 2IT1A 4TQUS 3FPUB 1RKNA 1Y8PB 4KK7A 4DK0A 5C0XI 1E2WA 4ZUJA 3MXUA 5KNCA 2HUGA 4K14A 1PLFA 1AZQA 1B4OA 2MJ8A 5CBEE 2EY1A 2OT2A 2LKVA 1Y8NB 1QCBD 2BCOA 2F3WA 3BDCA 2WB1B 2QCPX 2N88A 4R8NA 2RBMA 3A7LA 1JORA 2EVBA 2I46A 2GA4B 4WORA 4DNRB 3S2HB 2B2WC 1CQFA 5FO8B 4IUNA 1PTOC 1I4GA 4HSVA 3K5MA 3OSOA 1EU3A 4WJWA 1F9SA 4QF4A 2KJXA 2LMCB 3HOYB 1KDCA 1TQOA 3OW7A 5FLXE 3E5SA 3E6ZX 1ENCA 2XN9C 2PQEA 4KJNA 4PNYA 5J1ZA 3GTOB 4HR7B 5M5XB 5IGEA 1H9MA 3S2DB 3J7AV 2OEOA 2F0HA 5C0XH 2NYZD 3PIP3 1YNNC 1G6ZA 5EPLA 5JEAH 1QOHA 4XIGS 3AU7A 1WD0A 4RWSC 2A5HA 1VMCA 1STYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TU2 B;  3PUZ A;  4TQU S;  1Y8P B;  4H13 C;  4DK0 A;  1H9J A;  3ND8 A;  4IQZ A;  2AWO A;  3I72 A;  2JE6 I;  3OOC A;  3L7Z C;  3TZU A;  3IFT A;  1Q1B A;  4IFD G;  1Q12 A;  1Z7T A;  1E2W A;  1Q1E A;  1GHK A;  3MXU A;  1CTM A;  2Q8I B;  3A8J E;  3P20 A;  5KNC A;  1VCI A;  2D2C C;  2NN6 H;  2O5J C;  2EJF C;  4H0L C;  1FR3 A;  3VR3 A;  3SDZ A;  3VR4 A;  5BN5 A;  3BG3 A;  4I7Z C;  1VF7 A;  3AB9 A;  1Z6H A;  1Y8N B;  3CRL C;  3PUW A;  2PPB C;  4L8J A;  4KKS A;  1A6X A;  1K8M A;  1HPC A;  2A6E D;  3MFY A;  4KKU A;  2CW0 C;  1H9K A;  1Y8O B;  3N6R A;  3RLF A;  1DD2 A;  2K33 A;  2BE5 D;  3M4Y A;  2JEB I;  5K36 G;  1GUG A;  1LAC A;  1FYC A;  2BA1 A;  3T51 B;  2K7V A;  5BN3 A;  4IFD H;  2DNE A;  3A7L A;  1H9S A;  3DXJ C;  2O5I C;  4TKO B;  1IYV A;  2D5D A;  1OXX K;  2EVB A;  2JXM B;  1SMY C;  3D4R A;  3OPO A;  2PCF B;  2YYZ A;  1GUT A;  1Q90 A;  2NN6 I;  4KMU C;  3D31 A;  2IT1 A;  2PNR C;  3I73 A;  1GHJ A;  2B8G A;  4XTC S;  4DNR B;  1B9M A;  2A68 C;  2A69 D;  1BDO A;  1O7L A;  3GD7 A;  1H9R A;  1T5E A;  4H44 C;  2KCC A;  4KKT A;  3PV0 A;  4BA2 I;  1IW7 C;  5A35 A;  2A6H C;  1PMR A;  1V8Q A;  3EQL C;  5KND A;  2AUK A;  4PV1 C;  2DNC A;  1QJO A;  1O78 A;  1K8O A;  3VR5 A;  1CFM A;  1GUO A;  2BA0 A;  3VR6 A;  4OO1 G;  5K36 H;  2BE5 C;  2KA7 A;  3PUX A;  2LMC B;  5C0X G;  3KLR A;  1GUS A;  4RCN A;  1ZYR C;  5BN4 A;  3NE5 B;  2JEA I;  3M7N A;  2EJM A;  3OW7 A;  4KN7 C;  3U9S A;  2E75 C;  1ZKO A;  1V43 A;  3T56 B;  4DNT B;  4JK1 C;  2EDG A;  3VA7 A;  1B9N A;  4KI0 A;  4HR7 B;  4G7H C;  2E74 C;  1HCZ A;  3VR2 A;  2QF7 A;  5JEA G;  3A8I E;  4G7O C;  1OXT A;  1Y69 U;  1OXV A;  3IKJ A;  4LK1 C;  3WDN A;  1H9S B;  2EJG C;  3I4L A;  3QG1 A;  1H9M A;  1TKW B;  2B8F A;  2V4D A;  4JBW A;  1OXU A;  4KN4 C;  1I6V C;  4LJZ C;  2A6E C;  3CRK C;  3SE0 A;  3T53 B;  4OO1 H;  2K32 A;  3QIA A;  1VDZ A;  1E2V A;  5C0X H;  3A8K E;  3HGB A;  3LNN A;  1GJX A;  1YNJ C;  1E2Z A;  5KNB A;  1HQM C;  3W3A A;  1DCZ A;  3M85 A;  3H94 A;  1CI3 M;  3GQB A;  2E76 C;  3FMC A;  2F1M A;  2AUJ D;  1YNN C;  2A68 D;  2L5T A;  1IYU A;  2NN6 G;  3BDO A;  3LWU A;  4OGQ C;  3QJY A;  4GZY C;  3PUY A;  5JEA H;  1OXS C;  1G29 1;  1IW7 D;  3ND9 A;  2A6H D;  2D62 A;  3PUV A;  3A7A B;  2A69 C;  1HTP A;  4KHZ A;  4BA1 I;  2ZT9 C;  2R6G A;  4XIG S;  1EWH A;  1VF5 C;  1DXM A;  2BDO A;  4G7Z C;  1ONL A;  1LAB A;  2DN8 A;  1GUN A;  4DK1 A;  3FPP A; 
#chains in the Genus database with same CATH topology
 4TVA B;  1TU2 B;  1PTO B;  1I4Q A;  1TXY A;  1SYB A;  1EEI D;  2AWO A;  3K0X A;  3NBH B;  5LMN Q;  5CV8 A;  1F2M A;  2KHJ A;  1SNP A;  4A3D B;  3NWS A;  3A8J E;  3JC6 6;  2B2Y C;  1L2F A;  3J80 i;  4KHP Q;  4DV4 Q;  1MIU A;  2EJF C;  1D8L A;  3U50 C;  1I6H B;  2E2J B;  1AFP A;  5D14 A;  1TY2 A;  4A3M B;  4CKB A;  1BCP D;  5E4W C;  1KLU D;  3CRL C;  3LWE A;  3SHL A;  1NJI C;  4M8A A;  3PQI A;  2K1B A;  4FP5 D;  1QG7 A;  2WKD A;  4ZRZ A;  3J80 E;  4J8Q A;  2F0E A;  1YHQ A;  3M4Q A;  4DAP A;  1GUG A;  3CMA A;  2HIV A;  1IL2 A;  2BA1 A;  4IUU A;  1Q82 C;  1YVC A;  3CKI B;  5I9P A;  4HMI A;  1SXT A;  4BY1 H;  3CCM A;  4A3E G;  2VUM H;  2PCF B;  4OX9 L;  1GUT A;  1JJC B;  3D0F A;  2KCN A;  4MTN A;  1NUC A;  4ZCK A;  3T1Y L;  4DAY B;  4A93 G;  4OWT B;  4ZLT F;  5G3L F;  2N8N A;  1CUK A;  2H4O A;  5FLM G;  2DNC A;  2L55 A;  1SRO A;  1QJO A;  4QMG A;  1CM9 A;  4R4C A;  3WOE A;  5K36 H;  5FLX c;  1X3P A;  4BBR B;  5EPJ A;  4GOP C;  3KLR A;  4CKC A;  1SEB D;  1H95 A;  1SNQ A;  1SMX A;  3KLS A;  4YHH Q;  1WYD A;  2L1B A;  4KHV A;  4F88 A;  1ICW A;  3VR2 A;  4JW0 A;  1LTT D;  4G7O C;  3GTL B;  3I4N B;  1TR5 A;  3EJI A;  3IKJ A;  2Y0S B;  1GO3 E;  1IXR A;  3HKZ B;  1XYI A;  3R3O A;  2E2I B;  1VQM A;  3SE0 A;  1PA6 A;  5M3M G;  4HJ9 A;  1WTW A;  1VDZ A;  3G7L A;  1D6E C;  5CV7 A;  1DCZ A;  1PFM A;  1PXU A;  2E2H B;  3GQB A;  2IJ0 A;  2F0O A;  2R7Z H;  1W6J A;  1IYU A;  2I5H A;  4KY6 A;  3NSW A;  1Q81 C;  3A56 A;  5C4J B;  3S1M H;  1XNQ Q;  3PUY A;  1MSH A;  5GRO A;  1E7Z A;  3PUV A;  1IBL L;  2D62 A;  4C2M B;  1W2B A;  1RTO A;  4YY3 Q;  2XTI A;  4FNF A;  4MIU A;  1M1K C;  2B39 A;  1D1I A;  5IT9 E;  2DY8 A;  1KC8 C;  4HCE A;  2OXP A;  1GKH A;  3TZU A;  1HRJ A;  3S15 H;  4L6T B;  2K03 A;  4JCV E;  5D3D A;  5NUC A;  5IGG A;  2JJQ A;  4GOP B;  3HOW B;  4A3G G;  3A74 A;  4A3C G;  4JV5 L;  1KIX A;  1IBM Q;  1PTO F;  2WIN B;  2LS0 1;  3J80 c;  2FJ2 A;  3P7J A;  2B2U C;  4LF5 Q;  1VQI A;  2HT1 A;  1Y8O B;  4B3M L;  2B63 B;  3GTQ B;  1SLJ A;  2K28 A;  4YCU A;  2K5W A;  1PVO A;  1EWI A;  1XTC D;  3L0O A;  2OQ0 A;  4U67 3;  2N55 A;  4GKJ L;  4X66 L;  4CBV A;  3S2H H;  3EFX D;  5IYB H;  3DXJ C;  2D5D A;  2O2L D;  1OXX K;  2K14 A;  1LM0 A;  3KOJ A;  3ULJ A;  2K04 A;  1K28 A;  4JYA L;  3GD7 A;  1I4P A;  1H9R A;  4DR2 L;  1YHA A;  4UP9 A;  3MXN B;  2EOT A;  5G3L D;  5IYD H;  4XYQ A;  4LUZ A;  1SJH D;  1NR4 A;  1W3S A;  4UP8 A;  3HOU H;  1SYG A;  2EZV A;  5FO7 B;  2XRS D;  3SEB A;  4EQN A;  1TWC H;  1KLG D;  3R8B A;  1SFO H;  3K7U C;  3U4V A;  1ASY A;  5M5X H;  1K73 C;  1CHP D;  1KAW A;  2B2W A;  1ICF B;  5JPM C;  4IUR A;  3TQY A;  5GAE C;  3FVQ A;  1K0R A;  2AQ2 B;  2BOS A;  2UUC Q;  1EY9 A;  3A8I E;  1VQH A;  2Q8T A;  3J7Y W;  1NCV A;  4C3H H;  1VQE A;  1EOV A;  1WTP A;  4K6D A;  1B7Y B;  3NK9 A;  4DV6 Q;  1VQ4 A;  2CH4 A;  1U5K A;  1ENA A;  3E9H A;  1J5E L;  3M9B A;  1EUJ A;  1YNJ C;  5KNB A;  1HR0 W;  4HID A;  2Q2T A;  2VNU D;  2R92 G;  1D5Z C;  1LUZ A;  2F1M A;  2NN6 G;  5TSS A;  4K8I A;  1E3P A;  4KY7 A;  3K7A H;  2F52 A;  2RA4 A;  3MXP A;  2L4N A;  4MZ9 A;  4KHZ A;  5IY0 A;  5IT9 c;  2FHT A;  4A3D H;  3C2P A;  1DXM A;  1ONL A;  1MD2 D;  1QUQ B;  2UUA L;  4AYB G;  3Q23 A;  1Q8K A;  3EIV A;  1ET9 A;  4NXN L;  5DNF A;  4A3I B;  1SE3 A;  3MEF A;  4XQN A;  1EQV A;  1HZA A;  2NUC A;  4UDU C;  2IL8 A;  3P20 A;  1G2S A;  1EYA A;  2R93 H;  2IW3 A;  2WKC A;  3V2T A;  1Q86 C;  5DM7 3;  4A3B H;  1YHB A;  2J0T D;  2PZT A;  1IL8 A;  3BYT B;  4CHT B;  1PTO D;  3HOX G;  5CV5 A;  4EQ5 A;  1JOQ A;  2C9O A;  1BBW A;  4MN3 A;  2B2Y A;  1X56 A;  1MHW C;  4JI0 L;  5T1G A;  4IOC A;  2P5Z X;  4F8M A;  3SXH A;  4IFD H;  4MTK A;  3CD6 A;  3OTO L;  4X6A H;  4DR6 Q;  3KDF B;  1TII D;  2RDF A;  2K5N A;  4L5T A;  4CDE C;  3OPO A;  1K9M C;  5C44 H;  2IWH A;  4KMU C;  2VQF Q;  1EFW A;  3RZO B;  4EQP A;  1PYB A;  3I7F A;  4BBR H;  1T9H A;  2EIF A;  3FKI H;  1EY4 A;  5BR8 L;  1M8A A;  3DHQ A;  4ZUI A;  1ESR A;  4QL5 A;  3RD4 A;  1PH4 A;  1M4V A;  5CMD A;  1JT8 A;  3VR6 A;  1FNU A;  1XXG A;  4AQY Q;  1MSG A;  4JI2 L;  1SYE A;  1NNX A;  2CQO A;  1B3Q A;  1O7I A;  5BN4 A;  3GTL H;  3M7N A;  4J6H A;  2YTX A;  4DUZ Q;  1IKL A;  1VQP A;  3I91 A;  1OXT A;  2PZU A;  1KDA A;  1BCP C;  2XSC A;  4P75 A;  2E2H H;  1G51 A;  4S3S A;  5CV4 A;  1WFQ A;  4QUC A;  4X65 Q;  3HOZ H;  2B2V C;  4A3F G;  4CJ2 C;  5C4H A;  4BY7 H;  2HIX A;  3LNN A;  4ULL A;  4OEL B;  3IL8 A;  1WJJ A;  1HR0 Q;  2AKW B;  4HN7 A;  1ILQ A;  2L5T A;  3J7A F;  2C5C A;  3CPF A;  4QIW B;  1C7Y A;  2MP1 A;  2ZTD A;  3ERS X;  4LW1 A;  5J22 A;  4POF A;  5IWA L;  4ODG A;  3HOV G;  5EBD A;  1AE3 A;  4EQO A;  2ZT9 C;  4LAA A;  1LTR D;  1O7Y A;  2VY3 A;  4LFA Q;  3RLO A;  3BDL A;  4QUF A;  4WJ3 M;  2Q2I A;  4JI6 Q;  1B50 A;  1VQJ A;  4Q0F A;  2G9H D;  4B3T L;  1WCM G;  1EY6 A;  3MXN A;  5L37 A;  1GHK A;  4RKB A;  3D3R A;  5FO9 B;  1N8R C;  1S40 A;  3GTP H;  2B63 H;  2K05 A;  3GTQ H;  1DOM A;  3SDZ A;  4K0K L;  1UE1 A;  4J1M A;  5C3E B;  1FJG L;  4NXM L;  1TWG H;  3OMC A;  1HPC A;  1R4Q B;  3VDY A;  4HIM A;  3M4O B;  1BCP B;  1A3T A;  4RGO S;  2YU9 H;  5I4D A;  2F0N A;  2KCT A;  3KFU A;  1AN8 A;  3C3L A;  1NBW A;  5LL6 X;  1HUN A;  1B1Z A;  1QE6 A;  2JK8 A;  2B8G A;  5ISR A;  2FMC A;  1U4R A;  1VMP A;  1K3B C;  3PV0 A;  3TRE A;  4LMQ D;  1YIJ A;  4A3E B;  3E0E A;  1JOO A;  2BH8 A;  1K8O A;  1AH9 A;  1IKM A;  4A93 B;  3MHB A;  3GTJ B;  3PO2 B;  5T1I A;  1D2B A;  3R2T A;  3G4S A;  4KN7 C;  4DR7 L;  1XMO Q;  1QUQ A;  2E75 C;  3BYY B;  4R4I A;  2F4I A;  2N78 A;  2DY7 A;  1XMQ Q;  3OWE B;  1CT1 D;  1YJ9 A;  4X3U A;  1BXT A;  4GN4 B;  2XNA C;  2CW0 D;  3WDN A;  1JB7 A;  2B8F A;  1TKW B;  4BBS B;  4A3K G;  2I07 B;  4FO2 A;  2X6G A;  4B08 A;  1OXU A;  2VW9 A;  3I4M B;  3O13 A;  4LJZ C;  1QB5 D;  1RTN A;  4QGU A;  4LUV A;  1E1T A;  3DM1 A;  3CW2 C;  1OTC A;  2SNS A;  4JI7 Q;  4RG1 A;  4GKK Q;  1E2Z A;  2JA8 H;  3S16 H;  2OF1 A;  3LWU A;  2ZJQ A;  4C3I G;  4C56 C;  2ZM6 L;  1U4L A;  4ZKB B;  2NVX B;  3KLS X;  4CJ1 B;  3J7A 5;  4IUT A;  4BA1 I;  1B3A A;  4C1N I;  5M5Y H;  3H0G G;  3KDF A;  5DLQ E;  4HSP A;  1EZ6 A;  2ATW A;  1Y1W H;  2JE6 I;  3FDT A;  2X6L A;  1WTO A;  4NDX A;  1Q12 A;  4DV4 L;  2R61 A;  1BBU A;  1A3U A;  1I4X A;  3JAM L;  4DR5 Q;  2JA7 H;  1Z47 A;  3CP0 A;  5IIF A;  3UDG A;  4BXX H;  4K6L A;  5BN5 A;  1JOK A;  3W5O A;  4A3G B;  3GO5 A;  1TS5 A;  3MTS A;  5EBC A;  2YTY A;  1CKO A;  1LTB D;  2CKZ B;  3N52 A;  4GNX C;  3T51 B;  2K7V A;  1STH A;  4H7B A;  4CDC C;  1J6Q A;  3S1Q B;  2F0V A;  2KUM A;  1PH2 A;  1F9Q A;  2XIW A;  3SR1 A;  5IE8 A;  3J81 j;  1EZ8 A;  1PH9 A;  1F2L A;  1R9T B;  1BDO A;  4BWG B;  1BCP F;  1RF2 D;  4DV5 Q;  3BZD B;  1VQ6 A;  2RDH A;  4JI3 Q;  1G8Z D;  4P73 A;  3H3V H;  2KBN A;  2B3G A;  2F0Q A;  5A35 A;  5KND A;  3PO3 B;  5LL6 S;  2HHH L;  1XNR Q;  1I50 H;  3L3O C;  3SK6 A;  4APV A;  1YEZ A;  1S5B D;  1HNZ L;  2NVQ B;  4R9W A;  3PUX A;  1YNJ D;  4FF3 A;  1HNW L;  1A15 A;  1L1O C;  1HFG A;  1RL2 A;  1Y1V G;  2CWP A;  4LFB Q;  3M3Y H;  3S14 H;  3TEH B;  3S17 B;  1PH3 A;  3VA5 A;  1NY4 A;  1QZH A;  1JIC A;  1PFN A;  3K0Y A;  2NVT B;  4WJ4 A;  1H9S B;  1QIL A;  4M1U B;  4Z9C B;  3OHX C;  1TWA B;  4RGT A;  4HTH A;  3BJU A;  1HQR D;  5EKK A;  3A0J A;  4DGZ A;  2MUY A;  4BS9 A;  3HGB A;  3TME A;  5IP9 G;  1PYW D;  1KNA A;  1QWY A;  1SYD A;  2O4X A;  5IP7 H;  4OEM B;  3M85 A;  4GNX B;  3AQQ A;  4IJH A;  3CPW A;  2IHF A;  4OGQ C;  1HFN A;  1RDP D;  3K5N A;  3CCU A;  3TP6 A;  2KQ3 A;  2B2V A;  3GTK B;  5LMU Q;  1BO0 A;  1JB3 A;  1NSN S;  4IPG A;  3FP9 A;  1KTK A;  1PYS B;  3BZK A;  4JI8 L;  1GUN A;  2ID0 A;  4DR3 Q;  1S5C D;  3KK7 A;  3QOL A;  2Z6K A;  4DV7 Q;  1YJN A;  1JE5 A;  2Q8R E;  4ILW A;  2UXC Q;  3ZJY C;  5C3E H;  1TS3 A;  4N8X 1;  4AYB B;  1L1O B;  1EY7 A;  1IBM L;  3M4O H;  5M3F G;  3IAY A;  1SNO A;  4YWL A;  4UP7 A;  1HNX Q;  1L0Y B;  2F0L A;  1VF7 A;  4DXG A;  4HIO A;  2IPK D;  2CHB D;  4C3J H;  4FXG C;  5IYC H;  2VZA A;  3UI2 A;  3MFY A;  3CCS A;  3K81 C;  3RLF A;  3N6R A;  3K5O A;  4B3R L;  1TS2 A;  3HOX B;  2NZH A;  4KD3 A;  5ELB A;  1O80 A;  2JP1 A;  3CHB D;  2BH2 A;  3GTM B;  2DNE A;  3VYT A;  2O5I C;  4CDD C;  1SRU A;  1STN A;  4JVZ A;  2N3S A;  4JBJ A;  2R7F A;  1V1P B;  2UXB L;  2HDM A;  1MI2 A;  2YYZ A;  1NR2 A;  1PH8 A;  5CV6 A;  2PYK A;  3KBG A;  4A3L G;  3PO2 H;  1AEX A;  1SE2 A;  2ZXP A;  2KEN A;  1BOS A;  1LT4 D;  4KKT A;  4BA2 I;  4JI5 L;  5KRU A;  1UEA B;  1SBB B;  1VQ9 A;  1WOC A;  1CKN B;  3VR5 A;  4Y52 H;  2BE5 C;  1Q3L A;  5C0X G;  1CHQ D;  3NXW A;  3LGJ A;  4RCN A;  2JEA I;  4RHS A;  4BBS H;  3KUP A;  1HZB A;  3S1N B;  3I4M H;  1X3Q A;  1N32 L;  1LT5 D;  2QEX A;  3F2D A;  2JQO A;  5JEA G;  1JR0 D;  1UUP A;  1SNC A;  1A2T A;  1CZG A;  1I3Q B;  3CCR A;  4ALP A;  2PI2 E;  3D8G A;  1G2T A;  1MJE A;  4IFD J;  4JBW A;  5IGB A;  5JOB A;  4LF8 Q;  1A0I A;  3BU2 A;  3HEJ A;  4CKE A;  5D65 A;  4DV1 L;  4XXE A;  1OO9 B;  2X69 A;  4A3F B;  1RHP A;  2RVL A;  1X9N A;  3J81 L;  3A7A B;  5E4X A;  4DFA A;  2RF4 A;  2JA6 H;  1LAB A;  2VXW A;  3QR8 A;  2F0U A;  4EGV A;  2KEC A;  2H5X A;  2EXZ A;  2K52 A;  2NZ1 D;  1I94 Q;  5F2D A;  1H9J A;  3ND8 A;  4OO1 I;  3IFT A;  1IBK L;  1EIG A;  3CF5 A;  1Q1E A;  4OWX B;  3CXC A;  5GAG C;  4BY1 G;  4FXK C;  1PDQ A;  4DV0 Q;  2VUM G;  2MNA A;  4I7A A;  4DAV A;  4H0L C;  1TY0 A;  4X62 L;  1K8G A;  1LLR D;  2KHI A;  1WCM B;  4I7Z C;  3EBE A;  4PZ7 A;  4GLA C;  2CW0 C;  1STG A;  5I2X A;  2UUB Q;  4K2L A;  1E1O A;  4DV2 L;  5K36 G;  5HGQ A;  1FYC A;  3KF6 A;  3NHH A;  4DR6 L;  5K5P A;  1SYF A;  1H9S A;  5C4X B;  2QEJ C;  3SVM A;  3PO3 H;  2AQ3 B;  1CSQ A;  4ZQ3 A;  1QVC A;  2R3Z A;  1Q8I A;  4JBK A;  1TWH B;  4GLV B;  4O42 A;  2EYM A;  2PNR C;  2Z4I A;  1DGS A;  1GHJ A;  1WTQ A;  2RSO A;  2EPB A;  3NEM A;  4DPG A;  2EYH A;  1FD7 D;  1QNK A;  2KCC A;  4GNX A;  1D7Q A;  2DUD A;  2ASB A;  4YCV A;  3S17 H;  1PZI D;  5E7N A;  2K6A A;  4PZ8 A;  4LF9 Q;  2BA0 A;  2IHE A;  3ERO A;  1X3E A;  4R4Q A;  1KL9 A;  4K8J A;  4B9X A;  2ENB A;  3K5L A;  4JBM A;  2R7Z G;  1TWA H;  1EFI D;  3VA7 A;  4L5S A;  1SN8 A;  2D9U A;  2L12 A;  2EXD A;  5M9O A;  5ELN A;  4RA8 A;  4H02 A;  3UDF A;  5CGK A;  3T1H L;  3HOY H;  3I55 A;  1SSO A;  1X32 A;  3TS0 A;  2D0P A;  1BQQ T;  4LK1 C;  1L1O A;  1Q46 A;  3K57 A;  1X3G A;  5FJ8 H;  5KGU A;  4OO1 H;  3BVZ A;  2K32 A;  2CCZ A;  3GTO H;  2OCE A;  4OIK A;  2VQE L;  3GTK H;  2NTT A;  2EYP A;  2WB1 E;  2L0C A;  4G57 A;  5CBA E;  4ZAI A;  1VQ7 A;  3S2D H;  2FIN B;  1EQR A;  2WB1 G;  4P2C B;  3NBH A;  2AWN A;  3H91 A;  4POG A;  1IW7 D;  4HMJ A;  3Q8D A;  4K2K A;  4HJA A;  1V1P A;  4MHE A;  4C3I B;  4DK1 A;  4KLK A;  3S24 A;  2CH4 W;  4C1N K;  2IY5 B;  1M90 C;  4FXD A;  2DJF C;  5JVG 3;  4ZK9 B;  1JWU D;  3H0G B;  1N34 L;  5IYB G;  1XPO A;  3HRZ C;  1CTM A;  1NTG A;  2JYO A;  1CKN A;  2N49 A;  3UDX A;  5FOB B;  4DA2 A;  4JG2 A;  4OX9 Q;  1PTO H;  3V05 A;  2AMC B;  3J81 E;  3BG3 A;  3T1Y Q;  1RIP A;  3GTG B;  2MHV A;  3TDQ A;  3SK5 A;  1KAA A;  2PW7 A;  5IYD G;  2ZXR A;  1D5M C;  2A6E D;  1ET6 A;  2EY6 A;  3HOU G;  5EKI A;  4JI4 Q;  1D1K A;  1EY5 A;  1I6H H;  3CQZ B;  4PQX A;  4RHR A;  4DAY A;  3W2D A;  3DEP A;  2E2J H;  1DZ1 A;  4A3M H;  3MFG A;  2YV5 A;  1EWC A;  4IUV A;  4NKL A;  3I8Z A;  2F4V L;  2WAQ B;  2F0S A;  2K5D A;  1GD7 A;  1A3V A;  4B9W A;  4H44 C;  5C5L A;  4NMZ A;  4C3H G;  2E5L L;  4LF4 L;  1V8Q A;  2OQK A;  1CQV A;  3F8T A;  1EIF A;  4X64 L;  1C9O A;  3MVV A;  1G6P A;  2KA7 A;  1B2T A;  3MAQ A;  1GUS A;  1I3Q H;  1TT2 A;  4FVM A;  1A8V A;  4JPB W;  1R4P B;  3T56 B;  4DNT B;  1N33 L;  3NPP A;  2PNH A;  4L63 B;  2Z1C A;  1CA6 A;  4U68 A;  1MKH A;  2Z9H A;  1EQQ A;  1Y1V B;  1HCZ A;  2E74 C;  4IUP A;  1I4H A;  3J7Z C;  1IBL Q;  1OXV A;  4A3D G;  1F9R A;  3QG1 A;  4FF2 A;  2BDN A;  1WD1 A;  4AH6 A;  4KN4 C;  5CC4 A;  4GKK L;  1HJP A;  2OWO A;  4GN3 B;  3K59 A;  3CC4 A;  2M00 A;  5EAY A;  3OYY A;  3E3X A;  3I4N H;  5KEE A;  2WFW A;  2R93 G;  1DM0 B;  4JV5 Q;  3M4P A;  4A3B G;  2QDB A;  2E2I H;  1TS4 A;  2A6H D;  4DV3 L;  4RH6 A;  5C3X A;  1PZJ D;  1S5E D;  3T16 A;  1VF5 C;  4P72 A;  4GOP A;  4G7Z C;  2GN5 A;  2QF7 A;  4XT1 B;  1X55 A;  1TVX A;  1V1Q A;  2TMP A;  3PUZ A;  2JA5 B;  4H13 C;  4B3M Q;  2VB2 X;  4E6I A;  3ICE A;  3K6O A;  5C4J H;  4IFD G;  3DUZ A;  4GKJ Q;  4A3J B;  2JSO A;  4X66 Q;  4C2M H;  4DR5 L;  3ULL A;  1K83 B;  5C44 G;  5ELC A;  4RFB A;  5M5W B;  4LUO A;  3CC7 A;  3VR3 A;  4KY5 A;  4BBR G;  5JJK A;  2JA9 A;  3FKI G;  3FRP B;  4DUY L;  4DR2 Q;  5C4X H;  5JJI A;  1LT3 D;  2SNM A;  4KKS A;  1JE4 A;  4KKU A;  4OHJ A;  3HOW H;  5GQO A;  1EEF D;  2BE5 D;  2ZTC A;  2A74 C;  4HJ5 A;  2Y0S E;  3A5Z B;  2J4X A;  1HXY D;  3Q22 A;  3HKZ E;  2K01 A;  1NE3 A;  1SMY C;  3HKZ G;  5KYL A;  3F2B A;  3GDE A;  1Q90 A;  4OWW B;  3P75 A;  2UU9 L;  2ICE C;  5LHY 1;  3C46 A;  2PO4 A;  3U4Z A;  2EYO A;  4DR1 L;  5JPN C;  5C0X J;  1PV4 A;  3RN2 A;  2SDF A;  1O78 A;  3HOZ G;  2LY7 A;  1D5X C;  1S72 A;  4LNQ A;  2YTV A;  1DOL A;  4BY7 G;  1F77 A;  1SNM A;  2G5D A;  1J5E Q;  1EYC A;  1KNE A;  1PRT D;  2EJM A;  3OIP A;  5I2Y A;  2I5L X;  1C48 A;  2B29 A;  4YIJ A;  5JEA J;  1U4P A;  4LFC Q;  2HCI A;  1EYD A;  2B2U A;  1B9N A;  4JI1 L;  3AFP A;  4V0B A;  3DWQ A;  4QQB X;  1LTS D;  3DEO A;  3MZ5 A;  4L5R C;  1ENF A;  2RSN A;  4FF1 A;  3ONA B;  2UUA Q;  3AEV A;  1A62 A;  4LF7 L;  4NXN Q;  1J8I A;  3A8K E;  2RQX A;  1QZG A;  4LF6 L;  3E0J A;  1BUV T;  2HD3 A;  2AUJ D;  2PQA B;  2A68 D;  2B63 G;  3CCE A;  2XRQ D;  4IAL A;  2PW5 A;  1N36 L;  1E22 A;  4RWS C;  3V96 A;  2PMZ E;  3ND9 A;  4N9T A;  1BNZ A;  4MNO A;  1U4M A;  2WV6 D;  5C4Z A;  2M9V A;  4UAI A;  3IFD A;  2Z0S A;  1LTA D;  5EJW A;  1GXD C;  4K5W A;  1FNV A;  1L0X B;  4JI0 Q;  3ITP A;  2EY5 A;  4PZ6 A;  1K8A C;  3I3C A;  2NZO A;  1U0L A;  1Z7T A;  4DR4 Q;  1JWS D;  2HDL A;  3OTO Q;  2RHQ B;  5FLX L;  1PHJ A;  4PMB A;  5ELF A;  3BS1 A;  2F3V A;  5M3M B;  2EYL A;  2IX3 A;  3CQZ H;  4A3I H;  2RCF A;  4HJ8 A;  1FVI A;  4OON A;  5COR A;  4BY1 B;  2UXD Q;  5BR8 Q;  2K5V A;  4JOI C;  2VUM B;  1EY0 A;  1YJW A;  5LMN L;  4JI2 Q;  1HUM A;  1ESF A;  2I5M X;  1DJR D;  3G6E A;  2JXM B;  3D4R A;  4KHP L;  2F0F A;  1B44 D;  3D31 A;  2D0O A;  4XTC S;  1EU4 A;  4DF7 A;  4G4K A;  1BF4 A;  3CCQ A;  1GOZ A;  1IW7 C;  3URY A;  2EE1 A;  3MXG A;  2M2L A;  4R1J A;  1KRS A;  2Z4H A;  3RZO H;  5JJZ A;  1KDB A;  2A1A A;  2XWJ B;  2K75 A;  2WII B;  2JA8 G;  3CAM A;  3PCO B;  1LTG D;  3PSI A;  1JJG A;  1YZ6 A;  2NWG A;  1X65 A;  5C6A A;  2KED A;  2F0D A;  4G7H C;  2LFN A;  5IWA Q;  3TRZ A;  1QVF A;  3FEW X;  2R7Z B;  1LTL A;  3DWA A;  2H1E A;  1S5D D;  1XJV A;  3ZYY X;  3IRB A;  3AMU A;  3U9O A;  3T53 B;  2A6E C;  3J80 L;  1Y1W G;  3S1M B;  1P16 A;  4CJ0 B;  4B3T Q;  1KRT A;  4YHH L;  1W6K A;  3C1E A;  1CI3 M;  3PGZ A;  5EKL A;  5EPK A;  1C0A A;  2ZXO A;  2QW7 A;  3VYR A;  2JA5 H;  1VQ8 A;  2JA7 G;  1BKB A;  3QWN A;  3S1R B;  4KD4 A;  2FMM A;  4BXX G;  3S15 B;  3QOJ A;  4K0K Q;  1WI5 A;  4QCL A;  1Q7Y C;  1X3F A;  2FFK B;  4A4I A;  4A3J H;  1CKM A;  4NPS A;  2ES2 A;  1FJG Q;  1VQ5 A;  4LWC A;  4NXM Q;  2EQS A;  4B3S Q;  5HGT A;  3KF8 B;  1GVP A;  5I6Y A;  2KEE A;  3EVQ A;  1MBY A;  2PZW A;  2F0I A;  4GN5 A;  4KV6 A;  3STB D;  1ILP A;  1T5X D;  4TSS A;  1XNQ L;  2JN4 A;  5CV9 A;  4NP5 A;  1BVS A;  1CK1 A;  3AB9 A;  4WRD A;  4YY3 L;  3PUW A;  4PG3 A;  2R92 B;  2EYJ A;  1LV9 A;  2SOB A;  1DD2 A;  1KXL A;  3M4Y A;  4XT3 B;  1LAC A;  4CGY B;  3RNU A;  3HZX A;  5I6W A;  1PH6 A;  3TBI B;  4YCW A;  3HOU B;  1TWC B;  5FK9 C;  1SFO B;  2A69 D;  4K5V A;  1SND A;  2L9H A;  1UE6 A;  1MJC A;  1T5E A;  4LF5 L;  4QIW E;  4TRD A;  2A6H C;  3D4D A;  2PQA A;  3K80 C;  3A5U A;  2QGQ A;  2XWB B;  5IT9 L;  2QA4 A;  5EGT A;  4C3H B;  5IP7 G;  1ZYR C;  3NE5 B;  1S3O A;  3KJO A;  5C3W A;  3HKS A;  1V43 A;  4A3E H;  5HUR A;  5DEH A;  3JAM E;  1VQA A;  2IX0 A;  2Z8L A;  1RCV D;  4IPH A;  2ZM6 Q;  4DK3 C;  3ER0 A;  2LSS A;  4A93 H;  3GTJ H;  3C1F A;  2XGT A;  2R7D A;  3TN2 A;  4ZKC B;  1UE7 A;  3CU7 A;  5FLM H;  2V4D A;  1LTI D;  3KBX A;  3K7A B;  2E8G A;  4R4O A;  2K50 A;  3GP7 A;  1E2V A;  2QKI C;  3MA2 B;  2A73 B;  2QIL A;  3Q24 A;  3F2U A;  5E1F A;  5C3E G;  1CA5 A;  1QNU A;  4F87 A;  2F03 A;  4I65 A;  1SDF A;  3HFZ B;  3KLW A;  3TP7 A;  4EX5 A;  5AJ3 Q;  4QB4 A;  1EIH A;  2UUC L;  2FXQ A;  3KJP A;  4C3J G;  5IYC G;  2R93 B;  3EN2 A;  5ELD A;  3BVG A;  4A3B B;  4DV6 L;  3VYU A;  4O1N A;  5M3M H;  1AP0 A;  1IYJ B;  2NVX H;  3RZD B;  5IGC A;  2NB0 A;  1SMY D;  4FF4 A;  2L15 A;  4DN4 M;  1PRT C;  1F2Z A;  1FR3 A;  4IOA A;  3PO2 G;  3VR4 A;  1YIT A;  4ME3 A;  4L8J A;  5GAD C;  3SK8 A;  1TWF B;  3AYH B;  2QDL A;  1VS0 A;  2WP8 J;  4JI4 L;  5C44 B;  4DNI A;  3PMF A;  2HHH Q;  3Q0A A;  2JEB I;  3FKI B;  3HOV B;  1HNZ Q;  4IZ8 A;  1YBY A;  1ROD A;  5BN3 A;  4DK6 C;  4HJ7 A;  1WTX A;  1HNW Q;  1UE5 A;  3L9A X;  4A3G H;  4BBS G;  2EYF A;  3HP3 A;  1K3R A;  4A3C H;  4IN3 A;  2NN6 I;  3I4M G;  4JOI A;  3LX0 A;  3MC0 B;  4X3S A;  2A68 C;  3RMH A;  1O7L A;  1PZK D;  3CCJ A;  4FYD A;  1II3 A;  1VQK A;  2HQE A;  1PMR A;  3EQL C;  3S1Q H;  2AUK A;  4HED A;  2K4K A;  1C8C A;  3G71 A;  3H15 A;  1EYG A;  1K0S A;  4O2D A;  4JC0 A;  2A19 A;  3RLN A;  1R9T H;  4YWM A;  3JAM c;  4V19 0;  3PF4 A;  2MGS A;  3DMU A;  5AFW A;  1MGS A;  2VQF L;  1PH5 A;  3HOZ B;  3KF8 A;  3PIO A;  2EDG A;  3GV6 A;  1AZP A;  4QJF A;  4EVO A;  4BY7 B;  1PRT B;  3TP8 A;  4ABN A;  3R2I A;  5JVH 3;  2NVQ H;  3D6C A;  2OTL A;  1F9P A;  4F7X A;  2I0Q A;  4KJO A;  4RAU C;  2JA6 G;  1LT6 D;  3WWV A;  1WTR A;  4JI8 Q;  3MEH A;  3S1R H;  1A2U A;  1B53 A;  3DM3 A;  5DM6 3;  4AQY L;  1HTL D;  3CC2 A;  4CDF C;  2F0J A;  5JJL A;  3H94 A;  3RN5 A;  2NVT H;  2CQA A;  4DUZ L;  1SAP A;  5GAH C;  4IPD A;  1O7Z A;  5IOC A;  3BDO A;  2F0G A;  4L5Q A;  1S5F D;  4GZY C;  1E24 A;  2EY2 A;  1OXS C;  3OMG A;  5KYI A;  1JMC A;  2F3I A;  3D6W A;  3NBI A;  1ZXT A;  2BDO A;  3OWF A;  1XX8 A;  2DN8 A;  3GTP B;  1IYV A;  4X65 L;  2RDG A;  4XQJ A;  2KHS A;  4IQZ A;  3OOC A;  4B3R Q;  3L7Z C;  3ERQ A;  3GV3 A;  4DKA C;  2Q2H A;  2F0T A;  3VYS A;  2L11 A;  1HR0 L;  1TWG B;  4DAM A;  1U9R A;  2PMZ B;  2R92 H;  4A3K B;  3PO3 G;  1C4Q A;  1VCI A;  2D2C C;  2F0W A;  2NN6 H;  4HCS A;  1DON A;  2UXB Q;  3NTI A;  3W1B A;  2YU9 B;  1KD1 C;  3CME A;  1ML0 D;  1EL0 A;  1PH1 A;  2ZJR A;  2MO1 A;  4LFA L;  1K8M A;  4JI5 Q;  1F2Y A;  4JI6 L;  5CR3 A;  2NBF A;  3H09 A;  3J81 i;  1PFB A;  2Z6B A;  4J15 A;  2ALY B;  4IFD I;  4HAE A;  3DWP A;  3FHW A;  3UE0 A;  1BR9 A;  2WAC A;  1UEB A;  3UE1 A;  2IX1 A;  1N32 Q;  3RR5 A;  1UNS A;  2RHS B;  1ASZ A;  3HOY G;  3HOX H;  3OW2 A;  3GTM H;  2DJG C;  5C5M A;  2TSS A;  4IO9 A;  2MFI A;  4KTA A;  5FJ8 G;  3A54 A;  1EY8 A;  1GUO A;  4OO1 G;  4OXP A;  2CVR A;  4P71 A;  1XTD A;  1STA A;  5A2Q L;  3PIP A;  4LFC L;  3TP5 A;  1QVG A;  1ZKO A;  2E2D C;  3NWT A;  4RCO A;  4DV1 Q;  2K5H A;  3F1Z A;  4O0A A;  3STB C;  2VB3 X;  3K58 A;  4KI0 A;  2XVS A;  2MPM A;  3HG9 A;  4AYB E;  2JA8 B;  1A63 A;  4PMC A;  3S16 B;  3I4L A;  2B2T C;  4NW2 A;  3H3V C;  2NVY B;  3S1N H;  3QIA A;  5M5Y B;  4K5X A;  1WTH A;  2GVB A;  1IBK Q;  2KVM A;  1HQM C;  3W3A A;  1XMO L;  1PRT F;  1RJT A;  2C35 B;  3BVM A;  2E76 C;  3FMC A;  1Y1W B;  1XMQ L;  3NQT A;  3R93 A;  5I9O A;  4X62 Q;  3NQI A;  2A69 C;  3RZD H;  3I70 A;  2R6G A;  3PF5 A;  1CSP A;  3NP8 A;  3I90 A;  5FKA C;  5IOD A;  1XPR A;  2JA7 B;  1YNX A;  1STB A;  4A3F H;  1VQO A;  4DV2 Q;  3OIQ A;  3TSS A;  1G91 A;  1VQF A;  4JI7 L;  1JC7 A;  4DR4 L;  3T13 A;  4A3M G;  5J39 A;  1TWF H;  2Q8I B;  1P8L A;  4ME5 A;  1AW7 A;  1V9P A;  4DXF A;  3HOV H;  2UXD L;  2VL6 A;  1WTV A;  4PMW A;  3Q6S A;  3NEL A;  4IUQ A;  1Y14 B;  1ZYR D;  1WCM H;  1PFS A;  4TKO B;  1YNN D;  3D4W A;  4FDB A;  3J81 c;  1I50 B;  3MWY W;  3EA6 A;  2K5Q A;  1S4Z A;  5IGD A;  4GLX A;  4GS3 A;  2DGY A;  3CCL A;  4JYA Q;  3M3Y B;  3T1H Q;  3S14 B;  5E3F A;  1I5F A;  3TZD A;  1WVL A;  4AIM A;  3K8A A;  5M3F B;  1TWH H;  3E9I A;  3CCV A;  4A75 A;  2MQH A;  4Y7N B;  4RGN A;  4ZYS A;  2F0P A;  2LXK A;  5ELE A;  2VQE Q;  3S9W A;  2Z6K C;  3L2P A;  3I4N G;  2Y0S G;  1X54 A;  2LXJ A;  2F0M A;  4RMF A;  1SE4 A;  1SYC A;  1VQD A;  1EOT A;  4DV5 L;  4JI3 L;  1CZW A;  4HIK A;  1IZ6 A;  1Y69 U;  4QY7 A;  2RCN A;  3M7G A;  1XNR L;  4IPC A;  3WOF A;  1I6V C;  3G6J B;  2AHO B;  5EQ0 A;  5A2Q E;  4LFB L;  3HS0 C;  1N34 Q;  5IGF A;  3B6Y A;  3X3N A;  3ULP A;  4A76 A;  4Q5V A;  4XYO A;  1HZC A;  3QJY A;  2ICI A;  1NAP A;  4UHV A;  5COY A;  1I4R A;  1UWV A;  5C4X G;  4B3S L;  4A3K H;  2KCM A;  3FPP A;  3HOW G;  4RKL A;  1JQY D;  3I4O A;  4OL7 A;  3I72 A;  1XWE A;  1Q1B A;  1ZEQ X;  4C3J B;  4R8I A;  3QO2 A;  1DYQ A;  2F4V Q;  2RKS A;  3SGI A;  4C3I H;  2O5J C;  1NMF A;  3TS2 A;  2CWA A;  1HA6 A;  5LMU L;  3H6M A;  2HQL A;  3T4A C;  1Z6H A;  4RGM A;  3H0G H;  3NTH A;  3F2C A;  2PPB C;  1N9W A;  4DR3 L;  2E5L Q;  1A6X A;  1B8A A;  4LF4 Q;  1SJE D;  1STE A;  2AQ1 B;  3QB3 A;  1UAP A;  1E0B A;  1H9K A;  4DV7 L;  2K33 A;  3X3M A;  1HHV A;  4X64 Q;  3P1H A;  2UXC L;  4N8F A;  2A8V A;  4X3K A;  1IHZ A;  3GTG H;  5CYU A;  2F0K A;  1N33 Q;  1J9O A;  1NMG A;  3G48 A;  1JJ2 A;  3I73 A;  4ID6 A;  1B9M A;  4XQQ A;  1HNX L;  4N9P A;  3A55 A;  5HY6 A;  2SEB D;  3H3V I;  2HCC A;  4OIJ A;  2CFM A;  1X6O A;  3RUZ A;  2G9D A;  4PV1 C;  5JAV A;  1GM5 A;  1EQT A;  1V1O A;  2KOL A;  1GUW A;  1CFM A;  1JWM D;  2NTS A;  4XDX A;  3U9S A;  4JK1 C;  1FGB D;  1EIY B;  2ZJP A;  3NTK A;  2J7Z A;  2NVY H;  1HH2 P;  1DOK A;  1HA5 A;  1B70 B;  1VQC A;  1SE8 A;  3I56 A;  4DV3 Q;  3SK4 A;  2EJG C;  3NUC A;  4X3T A;  5KIX A;  1VQN A;  1Z9F A;  3CRK C;  1HZ9 A;  5DAU A;  1KAB A;  1L0W A;  5J3B A;  1Y1V H;  1GJX A;  4DU9 A;  1FNW A;  2JA6 B;  1LO5 D;  5AJ3 L;  3UDI A;  1RD9 D;  3PIO 3;  1KHI A;  4WFN 3;  2B2T A;  1BBX C;  5D3I B;  3BZC A;  4A3I G;  1G29 1;  2WAQ E;  1HTP A;  4DUY Q;  1EWH A;  2IT1 A;  2WAQ G;  4TQU S;  3FPU B;  1RKN A;  1Y8P B;  3W1G A;  4KK7 A;  4DK0 A;  5LMN W;  4LF8 L;  5C0X I;  5IP9 H;  1E2W A;  4ZUJ A;  3MXU A;  3NEN A;  5KNC A;  2HUG A;  4K14 A;  2Q2U A;  1PLF A;  1AZQ A;  1B4O A;  2MJ8 A;  2UU9 Q;  5CBE E;  2EY1 A;  2OT2 A;  2LKV A;  1Y8N B;  1LYL A;  1QCB D;  2BCO A;  2F3W A;  1FL0 A;  4DR1 Q;  3BDC A;  1I94 L;  2WB1 B;  1FGU A;  1K83 H;  5M5W H;  2QCP X;  2VS1 A;  2N88 A;  4R8N A;  2RBM A;  3A7L A;  4DV0 L;  1JOR A;  2EVB A;  2I46 A;  3I2Z A;  2GA4 B;  2ZTE A;  4WOR A;  5M3F H;  4DNR B;  1VQB A;  4Y7N H;  4JI1 Q;  1AE2 A;  3KF6 B;  4YWK A;  3S2H B;  2B2W C;  1CQF A;  5FO8 B;  4IUN A;  1PTO C;  1I4G A;  3DLL A;  5H1S E;  4HSV A;  4UPA A;  4R4T A;  2UUB L;  3K5M A;  3OSO A;  4P74 A;  1EU3 A;  4WJW A;  1XPU A;  1F9S A;  4QF4 A;  2KJX A;  2LMC B;  3HOY B;  5ELO A;  1KDC A;  4LF7 Q;  1TQO A;  3OW7 A;  4LF6 Q;  5FLX E;  3E6Z X;  3E5S A;  1ENC A;  2XN9 C;  2PQE A;  4DR7 Q;  4KJN A;  4PNY A;  1VQL A;  2JA5 G;  3KYH C;  5J1Z A;  4A3L H;  2OTJ A;  3GTO B;  4HR7 B;  1N36 Q;  5M5X B;  3AFQ A;  5IGE A;  4A3J G;  2GVA A;  2MO0 A;  1H9M A;  3S2D B;  2PI2 A;  4LF9 L;  3J7A V;  3JAM i;  2OEO A;  2F0H A;  5C0X H;  2NYZ D;  4NB3 A;  3PIP 3;  1KQS A;  1SR3 A;  1PH7 A;  1YNN C;  1G6Z A;  1VQG A;  5EPL A;  1YI2 A;  4UY8 C;  5JEA H;  4IJL A;  1QOH A;  2V1C C;  4XIG S;  3AU7 A;  3U58 A;  1WD0 A;  1JCK B;  2A5H A;  1VMC A;  1STY A; 
#chains in the Genus database with same CATH homology
 1TU2 B;  1PTO B;  1I4Q A;  1SYB A;  1EEI D;  2AWO A;  5CV8 A;  1F2M A;  1SNP A;  4A3D B;  3NWS A;  3A8J E;  2B2Y C;  2EJF C;  1I6H B;  1AFP A;  2E2J B;  5D14 A;  1TY2 A;  4A3M B;  4CKB A;  1BCP D;  5E4W C;  1KLU D;  3CRL C;  3LWE A;  3SHL A;  4M8A A;  2K1B A;  4FP5 D;  1QG7 A;  2WKD A;  4ZRZ A;  3J80 E;  4J8Q A;  2F0E A;  4DAP A;  1GUG A;  2BA1 A;  4IUU A;  3CKI B;  5I9P A;  4HMI A;  1SXT A;  2PCF B;  1GUT A;  2KCN A;  1NUC A;  4ZLT F;  5G3L F;  2H4O A;  2DNC A;  2L55 A;  1QJO A;  4QMG A;  1CM9 A;  3WOE A;  5K36 H;  1X3P A;  4BBR B;  5EPJ A;  3KLR A;  4CKC A;  1SEB D;  1SNQ A;  3KLS A;  2L1B A;  4KHV A;  4F88 A;  1ICW A;  3VR2 A;  1LTT D;  4G7O C;  3GTL B;  3I4N B;  1TR5 A;  3EJI A;  3IKJ A;  2Y0S B;  3HKZ B;  1XYI A;  3R3O A;  2E2I B;  3SE0 A;  1WTW A;  1VDZ A;  3G7L A;  1D6E C;  5CV7 A;  1DCZ A;  1PFM A;  1PXU A;  2E2H B;  3GQB A;  2IJ0 A;  2F0O A;  1W6J A;  1IYU A;  4KY6 A;  3NSW A;  3A56 A;  5C4J B;  3PUY A;  1MSH A;  3PUV A;  2D62 A;  4C2M B;  1RTO A;  4FNF A;  4MIU A;  2B39 A;  1D1I A;  5IT9 E;  2DY8 A;  4HCE A;  2OXP A;  3TZU A;  1HRJ A;  4L6T B;  2K03 A;  5D3D A;  5NUC A;  5IGG A;  3HOW B;  1PTO F;  2WIN B;  2LS0 1;  2FJ2 A;  3P7J A;  2B2U C;  1Y8O B;  2B63 B;  3GTQ B;  2K28 A;  2K5W A;  1XTC D;  4U67 3;  2N55 A;  4CBV A;  3EFX D;  3DXJ C;  2D5D A;  2O2L D;  1OXX K;  2K04 A;  3GD7 A;  1I4P A;  1H9R A;  2EOT A;  5G3L D;  4XYQ A;  1SJH D;  1NR4 A;  1SYG A;  2EZV A;  5FO7 B;  2XRS D;  3SEB A;  4EQN A;  1KLG D;  3R8B A;  1CHP D;  2B2W A;  5JPM C;  4IUR A;  3FVQ A;  2AQ2 B;  2BOS A;  1EY9 A;  3A8I E;  2Q8T A;  3J7Y W;  1NCV A;  1WTP A;  4K6D A;  3NK9 A;  1ENA A;  1YNJ C;  5KNB A;  2VNU D;  1D5Z C;  2F1M A;  2NN6 G;  5TSS A;  4K8I A;  4KY7 A;  2RA4 A;  3MXP A;  2L4N A;  4KHZ A;  2FHT A;  3C2P A;  1DXM A;  1ONL A;  1MD2 D;  3Q23 A;  1ET9 A;  4A3I B;  5DNF A;  1SE3 A;  4XQN A;  1EQV A;  2NUC A;  4UDU C;  2IL8 A;  3P20 A;  1G2S A;  1EYA A;  2IW3 A;  2WKC A;  3V2T A;  5DM7 3;  2J0T D;  2PZT A;  4CHT B;  1IL8 A;  3BYT B;  1PTO D;  5CV5 A;  1JOQ A;  2C9O A;  4MN3 A;  2B2Y A;  5T1G A;  4F8M A;  3SXH A;  4IFD H;  1TII D;  2RDF A;  3OPO A;  2IWH A;  4KMU C;  3RZO B;  4EQP A;  1EY4 A;  1M8A A;  3DHQ A;  4ZUI A;  1ESR A;  3RD4 A;  1M4V A;  5CMD A;  3VR6 A;  1FNU A;  1XXG A;  1MSG A;  1SYE A;  5BN4 A;  3M7N A;  4J6H A;  1IKL A;  3I91 A;  1OXT A;  2PZU A;  1KDA A;  1BCP C;  2XSC A;  4S3S A;  5CV4 A;  4QUC A;  2B2V C;  4CJ2 C;  5C4H A;  3LNN A;  4ULL A;  3IL8 A;  4HN7 A;  1ILQ A;  2L5T A;  3J7A F;  2C5C A;  4QIW B;  2MP1 A;  5J22 A;  4ODG A;  5EBD A;  4EQO A;  2ZT9 C;  4LAA A;  1LTR D;  1O7Y A;  3BDL A;  4QUF A;  1B50 A;  4Q0F A;  2G9H D;  1EY6 A;  3MXN A;  1GHK A;  4RKB A;  3D3R A;  5FO9 B;  2K05 A;  1DOM A;  3SDZ A;  4J1M A;  5C3E B;  3OMC A;  1HPC A;  1R4Q B;  3M4O B;  1BCP B;  1A3T A;  4RGO S;  5I4D A;  2F0N A;  1AN8 A;  3C3L A;  5LL6 X;  1HUN A;  1B1Z A;  1QE6 A;  2B8G A;  5ISR A;  2FMC A;  1U4R A;  1VMP A;  3PV0 A;  4LMQ D;  4A3E B;  1JOO A;  1K8O A;  1IKM A;  4A93 B;  3MHB A;  3GTJ B;  3PO2 B;  5T1I A;  1D2B A;  3R2T A;  4KN7 C;  2E75 C;  3BYY B;  2F4I A;  2DY7 A;  3OWE B;  1CT1 D;  4X3U A;  1BXT A;  2XNA C;  2CW0 D;  3WDN A;  2B8F A;  1TKW B;  4BBS B;  2I07 B;  4FO2 A;  2X6G A;  4B08 A;  1OXU A;  3I4M B;  3O13 A;  4LJZ C;  1QB5 D;  1RTN A;  3DM1 A;  2SNS A;  1E2Z A;  2OF1 A;  3LWU A;  4C3I G;  4C56 C;  1U4L A;  4ZKB B;  2NVX B;  3KLS X;  4CJ1 B;  4IUT A;  4BA1 I;  1B3A A;  4C1N I;  4HSP A;  1EZ6 A;  2JE6 I;  3FDT A;  2X6L A;  1WTO A;  4NDX A;  1Q12 A;  2R61 A;  1I4X A;  1A3U A;  3JAM L;  1Z47 A;  5IIF A;  4K6L A;  5BN5 A;  1JOK A;  4A3G B;  3GO5 A;  1TS5 A;  3MTS A;  5EBC A;  1LTB D;  3N52 A;  3T51 B;  2K7V A;  1STH A;  4H7B A;  3S1Q B;  2F0V A;  2KUM A;  1F9Q A;  2XIW A;  3SR1 A;  1EZ8 A;  1F2L A;  1R9T B;  1BDO A;  4BWG B;  1BCP F;  1RF2 D;  3BZD B;  2RDH A;  1G8Z D;  5A35 A;  2F0Q A;  5KND A;  3PO3 B;  5LL6 S;  3L3O C;  3SK6 A;  1S5B D;  2NVQ B;  4R9W A;  3PUX A;  1YNJ D;  4FF3 A;  1A15 A;  1HFG A;  3S17 B;  3VA5 A;  1JIC A;  1PFN A;  3K0Y A;  2NVT B;  1H9S B;  1QIL A;  4M1U B;  4Z9C B;  3OHX C;  1TWA B;  4RGT A;  4HTH A;  1HQR D;  5EKK A;  4DGZ A;  2MUY A;  4BS9 A;  3HGB A;  3TME A;  1PYW D;  1KNA A;  1QWY A;  1SYD A;  2O4X A;  3M85 A;  4OGQ C;  1HFN A;  1RDP D;  3K5N A;  3TP6 A;  2KQ3 A;  2B2V A;  3GTK B;  1BO0 A;  1JB3 A;  1NSN S;  1KTK A;  1GUN A;  2ID0 A;  1S5C D;  3KK7 A;  3QOL A;  2Q8R E;  4ILW A;  1TS3 A;  4AYB B;  1EY7 A;  3IAY A;  1SNO A;  1L0Y B;  2F0L A;  1VF7 A;  4DXG A;  2IPK D;  2CHB D;  4FXG C;  3UI2 A;  3MFY A;  3RLF A;  3N6R A;  3K5O A;  1TS2 A;  3HOX B;  4KD3 A;  5ELB A;  1O80 A;  2JP1 A;  3CHB D;  3GTM B;  2DNE A;  3VYT A;  2O5I C;  1STN A;  1V1P B;  2HDM A;  1MI2 A;  2YYZ A;  1NR2 A;  5CV6 A;  2PYK A;  3KBG A;  1AEX A;  1SE2 A;  2ZXP A;  1BOS A;  1LT4 D;  4KKT A;  4BA2 I;  5KRU A;  1UEA B;  1SBB B;  3VR5 A;  2BE5 C;  1Q3L A;  5C0X G;  1CHQ D;  3NXW A;  4RCN A;  2JEA I;  4RHS A;  3KUP A;  3S1N B;  1X3Q A;  1LT5 D;  5JEA G;  1JR0 D;  1UUP A;  1SNC A;  1A2T A;  1CZG A;  1I3Q B;  3D8G A;  1G2T A;  4IFD J;  4JBW A;  5IGB A;  5JOB A;  3HEJ A;  4CKE A;  5D65 A;  4XXE A;  1OO9 B;  2X69 A;  4A3F B;  1RHP A;  2RVL A;  3J81 L;  3A7A B;  5E4X A;  4DFA A;  1LAB A;  2VXW A;  2F0U A;  4EGV A;  2KEC A;  2EXZ A;  2NZ1 D;  5F2D A;  1H9J A;  3ND8 A;  4OO1 I;  3IFT A;  1EIG A;  1Q1E A;  4FXK C;  1PDQ A;  4DAV A;  4H0L C;  1TY0 A;  1LLR D;  1WCM B;  4I7Z C;  2CW0 C;  1STG A;  5I2X A;  4K2L A;  5K36 G;  1FYC A;  3NHH A;  5K5P A;  1SYF A;  1H9S A;  5C4X B;  2QEJ C;  3SVM A;  2AQ3 B;  4ZQ3 A;  2R3Z A;  1Q8I A;  1TWH B;  4O42 A;  2EYM A;  2PNR C;  2Z4I A;  1GHJ A;  1WTQ A;  2RSO A;  2EPB A;  2EYH A;  1FD7 D;  1QNK A;  2KCC A;  1PZI D;  2K6A A;  2BA0 A;  3ERO A;  4K8J A;  4B9X A;  2ENB A;  3K5L A;  1EFI D;  3VA7 A;  2D9U A;  2L12 A;  5M9O A;  4RA8 A;  5CGK A;  1SSO A;  1X32 A;  1BQQ T;  4LK1 C;  3K57 A;  5KGU A;  4OO1 H;  3BVZ A;  2K32 A;  4OIK A;  2NTT A;  2EYP A;  2L0C A;  4G57 A;  5CBA E;  4ZAI A;  2FIN B;  4P2C B;  3NBH A;  2AWN A;  3H91 A;  1IW7 D;  4HMJ A;  4K2K A;  1V1P A;  4MHE A;  4C3I B;  4DK1 A;  4C1N K;  4FXD A;  5JVG 3;  4ZK9 B;  1JWU D;  3H0G B;  3HRZ C;  1CTM A;  2JYO A;  5FOB B;  4DA2 A;  1PTO H;  3V05 A;  3J81 E;  3BG3 A;  3GTG B;  2MHV A;  3TDQ A;  3SK5 A;  1KAA A;  2PW7 A;  2ZXR A;  1D5M C;  2A6E D;  1ET6 A;  2EY6 A;  5EKI A;  1D1K A;  1EY5 A;  3CQZ B;  4PQX A;  4RHR A;  4DAY A;  3W2D A;  3DEP A;  1DZ1 A;  3MFG A;  1EWC A;  4IUV A;  4NKL A;  3I8Z A;  2WAQ B;  2F0S A;  2K5D A;  1A3V A;  4B9W A;  4H44 C;  5C5L A;  4NMZ A;  4C3H G;  1V8Q A;  1CQV A;  3MVV A;  2KA7 A;  1B2T A;  3MAQ A;  1GUS A;  1TT2 A;  4FVM A;  1R4P B;  3T56 B;  4DNT B;  3NPP A;  4L63 B;  2Z1C A;  1CA6 A;  4U68 A;  1Y1V B;  1HCZ A;  2E74 C;  4IUP A;  1I4H A;  1OXV A;  1F9R A;  3QG1 A;  4FF2 A;  2BDN A;  1WD1 A;  4KN4 C;  5CC4 A;  3K59 A;  2M00 A;  5KEE A;  1DM0 B;  2QDB A;  1TS4 A;  2A6H D;  4RH6 A;  5C3X A;  1PZJ D;  1S5E D;  3T16 A;  1VF5 C;  4G7Z C;  2QF7 A;  4XT1 B;  1TVX A;  2TMP A;  3PUZ A;  2JA5 B;  4H13 C;  2VB2 X;  4E6I A;  3K6O A;  4IFD G;  3DUZ A;  4A3J B;  2JSO A;  1K83 B;  5M5W B;  5ELC A;  4RFB A;  3VR3 A;  4KY5 A;  3FRP B;  1LT3 D;  2SNM A;  4KKS A;  1JE4 A;  4KKU A;  4OHJ A;  1EEF D;  2BE5 D;  2A74 C;  2J4X A;  1HXY D;  3Q22 A;  2K01 A;  1SMY C;  5KYL A;  1Q90 A;  3P75 A;  2ICE C;  5LHY 1;  1JCK B;  3C46 A;  2PO4 A;  2EYO A;  5JPN C;  5C0X J;  2SDF A;  1O78 A;  2LY7 A;  1D5X C;  1DOL A;  1F77 A;  1SNM A;  1EYC A;  1KNE A;  1PRT D;  2EJM A;  3OIP A;  5I2Y A;  1C48 A;  4YIJ A;  5JEA J;  1U4P A;  2HCI A;  1EYD A;  2B2U A;  1B9N A;  4V0B A;  3DWQ A;  1LTS D;  3DEO A;  3MZ5 A;  1ENF A;  2RSN A;  4FF1 A;  3ONA B;  1J8I A;  3A8K E;  2RQX A;  3E0J A;  1BUV T;  2AUJ D;  2A68 D;  2XRQ D;  4IAL A;  2PW5 A;  3V96 A;  3ND9 A;  4N9T A;  1BNZ A;  1U4M A;  2WV6 D;  5C4Z A;  2M9V A;  4UAI A;  3IFD A;  1LTA D;  5EJW A;  1GXD C;  4K5W A;  1FNV A;  1L0X B;  3ITP A;  2EY5 A;  3I3C A;  1Z7T A;  1JWS D;  2HDL A;  5FLX L;  4PMB A;  5ELF A;  3BS1 A;  2F3V A;  5M3M B;  2EYL A;  2IX3 A;  5COR A;  4BY1 B;  2VUM B;  1EY0 A;  1HUM A;  1ESF A;  1DJR D;  2JXM B;  3D4R A;  2F0F A;  1B44 D;  3D31 A;  4XTC S;  1EU4 A;  4DF7 A;  4G4K A;  1BF4 A;  1GOZ A;  1IW7 C;  3URY A;  2EE1 A;  3MXG A;  2M2L A;  2Z4H A;  5JJZ A;  1KDB A;  2XWJ B;  2WII B;  1LTG D;  2NWG A;  5C6A A;  2KED A;  2F0D A;  4G7H C;  2LFN A;  3FEW X;  2R7Z B;  3DWA A;  2H1E A;  1S5D D;  3ZYY X;  3AMU A;  3U9O A;  3T53 B;  2A6E C;  3J80 L;  3S1M B;  4CJ0 B;  1W6K A;  3C1E A;  1CI3 M;  5EKL A;  5EPK A;  2ZXO A;  3VYR A;  3QWN A;  3S1R B;  4KD4 A;  2FMM A;  3S15 B;  4QCL A;  3QOJ A;  2FFK B;  5HGT A;  5I6Y A;  2KEE A;  3EVQ A;  1MBY A;  2PZW A;  2F0I A;  4KV6 A;  1ILP A;  1T5X D;  4TSS A;  5CV9 A;  4NP5 A;  1CK1 A;  3AB9 A;  4WRD A;  3PUW A;  2R92 B;  2EYJ A;  1LV9 A;  2SOB A;  1DD2 A;  3M4Y A;  4XT3 B;  1LAC A;  4CGY B;  3HZX A;  5I6W A;  3TBI B;  3HOU B;  1TWC B;  5FK9 C;  1SFO B;  2A69 D;  4K5V A;  1SND A;  2L9H A;  1T5E A;  4TRD A;  2A6H C;  3D4D A;  2XWB B;  5IT9 L;  5EGT A;  4C3H B;  1ZYR C;  3NE5 B;  5C3W A;  1V43 A;  5HUR A;  5DEH A;  3JAM E;  2IX0 A;  2Z8L A;  1RCV D;  3C1F A;  3TN2 A;  4ZKC B;  3CU7 A;  2V4D A;  1LTI D;  3KBX A;  3K7A B;  3GP7 A;  1E2V A;  2QKI C;  3MA2 B;  2A73 B;  2QIL A;  3Q24 A;  3F2U A;  5E1F A;  1CA5 A;  1QNU A;  4F87 A;  2F03 A;  4I65 A;  1SDF A;  3TP7 A;  4QB4 A;  1EIH A;  4C3J G;  2R93 B;  5ELD A;  3BVG A;  4A3B B;  3VYU A;  4O1N A;  1AP0 A;  3RZD B;  5IGC A;  2NB0 A;  1SMY D;  4FF4 A;  4DN4 M;  1PRT C;  1F2Z A;  1FR3 A;  3VR4 A;  4L8J A;  3SK8 A;  1TWF B;  2WP8 J;  5C44 B;  3PMF A;  3Q0A A;  2JEB I;  3FKI B;  3HOV B;  4IZ8 A;  1ROD A;  5BN3 A;  1WTX A;  3L9A X;  2EYF A;  3HP3 A;  4IN3 A;  2NN6 I;  3LX0 A;  3MC0 B;  4X3S A;  2A68 C;  3RMH A;  1O7L A;  1PZK D;  4FYD A;  1II3 A;  2HQE A;  1PMR A;  3EQL C;  2AUK A;  4HED A;  1C8C A;  4V19 0;  2MGS A;  3DMU A;  5AFW A;  1MGS A;  3HOZ B;  3KF8 A;  2EDG A;  3GV6 A;  1AZP A;  4EVO A;  4BY7 B;  1PRT B;  3TP8 A;  4ABN A;  3R2I A;  5JVH 3;  3D6C A;  1F9P A;  4F7X A;  4KJO A;  4RAU C;  1LT6 D;  1WTR A;  3MEH A;  1A2U A;  1B53 A;  5DM6 3;  1HTL D;  2F0J A;  3H94 A;  2CQA A;  1SAP A;  1O7Z A;  5IOC A;  3BDO A;  2F0G A;  1S5F D;  4GZY C;  2EY2 A;  1OXS C;  3OMG A;  5KYI A;  3D6W A;  3NBI A;  1ZXT A;  2BDO A;  3OWF A;  1XX8 A;  2DN8 A;  3GTP B;  1IYV A;  2RDG A;  4XQJ A;  2KHS A;  4IQZ A;  3OOC A;  3L7Z C;  3ERQ A;  3GV3 A;  2F0T A;  3VYS A;  2L11 A;  1TWG B;  1U9R A;  2PMZ B;  4A3K B;  1C4Q A;  1VCI A;  2D2C C;  2F0W A;  2NN6 H;  4HCS A;  1DON A;  3NTI A;  2YU9 B;  1ML0 D;  1EL0 A;  1K8M A;  1F2Y A;  5CR3 A;  2NBF A;  3H09 A;  1PFB A;  4IFD I;  4HAE A;  3DWP A;  1BR9 A;  2WAC A;  2IX1 A;  1UNS A;  5C5M A;  2TSS A;  4KTA A;  3A54 A;  1EY8 A;  1GUO A;  4OO1 G;  2CVR A;  1STA A;  5A2Q L;  3TP5 A;  1ZKO A;  2E2D C;  3NWT A;  4RCO A;  2VB3 X;  3K58 A;  4KI0 A;  2XVS A;  2MPM A;  3HG9 A;  2JA8 B;  4PMC A;  3S16 B;  3I4L A;  2B2T C;  4NW2 A;  3H3V C;  2NVY B;  3QIA A;  5M5Y B;  4K5X A;  2KVM A;  1HQM C;  3W3A A;  1PRT F;  1RJT A;  3BVM A;  2E76 C;  3FMC A;  1Y1W B;  3NQT A;  3R93 A;  5I9O A;  3NQI A;  2A69 C;  3I70 A;  2R6G A;  3NP8 A;  3I90 A;  5FKA C;  5IOD A;  2JA7 B;  1STB A;  3OIQ A;  3TSS A;  1G91 A;  1JC7 A;  3T13 A;  5J39 A;  2Q8I B;  4ME5 A;  1AW7 A;  4DXF A;  1WTV A;  4PMW A;  3Q6S A;  4IUQ A;  1ZYR D;  4TKO B;  1YNN D;  3D4W A;  1I50 B;  3MWY W;  3EA6 A;  2K5Q A;  1S4Z A;  5IGD A;  3M3Y B;  3S14 B;  5E3F A;  3TZD A;  1WVL A;  5M3F B;  4Y7N B;  4RGN A;  4ZYS A;  2F0P A;  5ELE A;  3S9W A;  2F0M A;  1SE4 A;  1SYC A;  1EOT A;  1CZW A;  1Y69 U;  3M7G A;  3WOF A;  1I6V C;  3G6J B;  5EQ0 A;  5A2Q E;  3HS0 C;  5IGF A;  3X3N A;  4Q5V A;  4XYO A;  3QJY A;  2ICI A;  1NAP A;  5COY A;  1I4R A;  3FPP A;  4RKL A;  1JQY D;  4OL7 A;  3I72 A;  1XWE A;  1Q1B A;  1ZEQ X;  4C3J B;  4R8I A;  3QO2 A;  1DYQ A;  2RKS A;  2O5J C;  1HA6 A;  3H6M A;  3T4A C;  1Z6H A;  4RGM A;  2PPB C;  3NTH A;  1A6X A;  1SJE D;  1STE A;  2AQ1 B;  3QB3 A;  1UAP A;  1E0B A;  1H9K A;  2K33 A;  3X3M A;  1HHV A;  3P1H A;  4X3K A;  1IHZ A;  5CYU A;  2F0K A;  1J9O A;  3I73 A;  4ID6 A;  1B9M A;  4XQQ A;  4N9P A;  3A55 A;  2SEB D;  2HCC A;  4OIJ A;  3RUZ A;  2G9D A;  4PV1 C;  5JAV A;  1EQT A;  1V1O A;  2KOL A;  1GUW A;  1CFM A;  1JWM D;  2NTS A;  4XDX A;  3U9S A;  4JK1 C;  1FGB D;  3NTK A;  2J7Z A;  1DOK A;  1HA5 A;  3SK4 A;  2EJG C;  3NUC A;  4X3T A;  5KIX A;  3CRK C;  5DAU A;  1KAB A;  1GJX A;  4DU9 A;  1FNW A;  2JA6 B;  1LO5 D;  1RD9 D;  3PIO 3;  4WFN 3;  2B2T A;  1BBX C;  5D3I B;  1G29 1;  1HTP A;  1EWH A;  2IT1 A;  4TQU S;  3FPU B;  1RKN A;  1Y8P B;  4KK7 A;  4DK0 A;  5C0X I;  1E2W A;  4ZUJ A;  3MXU A;  5KNC A;  2HUG A;  4K14 A;  1PLF A;  1AZQ A;  1B4O A;  2MJ8 A;  5CBE E;  2EY1 A;  2OT2 A;  2LKV A;  1Y8N B;  1QCB D;  2BCO A;  2F3W A;  3BDC A;  2WB1 B;  2QCP X;  2N88 A;  4R8N A;  2RBM A;  3A7L A;  1JOR A;  2EVB A;  2I46 A;  2GA4 B;  4WOR A;  4DNR B;  3S2H B;  2B2W C;  1CQF A;  5FO8 B;  4IUN A;  1PTO C;  1I4G A;  4HSV A;  3K5M A;  3OSO A;  1EU3 A;  4WJW A;  1F9S A;  4QF4 A;  2KJX A;  2LMC B;  3HOY B;  1KDC A;  1TQO A;  3OW7 A;  5FLX E;  3E5S A;  3E6Z X;  1ENC A;  2XN9 C;  2PQE A;  4KJN A;  4PNY A;  5J1Z A;  3GTO B;  4HR7 B;  5M5X B;  5IGE A;  1H9M A;  3S2D B;  3J7A V;  2OEO A;  2F0H A;  5C0X H;  2NYZ D;  3PIP 3;  1YNN C;  1G6Z A;  5EPL A;  5JEA H;  1QOH A;  4XIG S;  3AU7 A;  1WD0 A;  4RWS C;  2A5H A;  1VMC A;  1STY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...