1HTPA

Refined structures at 2 angstroms and 2.2 angstroms of the two forms of the h-protein, a lipoamide-containing protein of the glycine decarboxylase complex
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
131
structure length
131
Chain Sequence
SNVLDGLKYAPSHEWVKHEGSVATIGITDHAQDHLGEVVFVELPEPGVSVTKGKGFGAVESVKATSDVNSPISGEVIEVNTGLTGKPGLINSSPYEDGWMIKIKPTSPDELESLLGAKEYTKFCEEEDAAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-PROTEIN
publication title The lipoamide arm in the glycine decarboxylase complex is not freely swinging.
pubmed doi rcsb
source organism Pisum sativum
molecule tags Oxidoreductases(acting on ch-nh2 donor)
total genus 35
structure length 131
sequence length 131
ec nomenclature ec 1.4.4.2: Glycine dehydrogenase (aminomethyl-transferring).
pdb deposition date 1995-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01597 GCV_H Glycine cleavage H-protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1htpA00
1K8MA 1Y69U 3EQLC 1LABA 2O5IC 3FMCA 1IW7D 3ND9A 3VR4A 1Y8PB 4LJZC 3VA7A 1H9JA 1GJXA 1BDOA 1SMYC 1LACA 1OXXK 3OPOA 5BN3A 1V43A 1HTPA 1GUGA 1VF5C 1O7LA 5BN5A 2V4DA 1OXSC 5A35A 2B8GA 2EVBA 3A8JE 4KKUA 1VDZA 3QIAA 1E2WA 3P20A 4JBWA 3NE5B 3QJYA 2R6GA 3WDNA 2ZT9C 4G7HC 1O78A 3A8KE 1HCZA 1GHJA 4PV1C 2AWOA 3T56B 1B9NA 1DCZA 4JK1C 4G7OC 1IYUA 2E74C 1H9RA 3T51B 1Q1BA 3D4RA 4KN7C 5JEAG 4OO1H 2JE6I 2BDOA 1FYCA 2EJGC 3CRKC 3VR3A 1HQMC 1IW7C 2YYZA 2Q8IB 3PUZA 4KHZA 1Q12A 3LNNA 2D5DA 2L5TA 3HGBA 2AUJD 4HR7B 2O5JC 4XIGS 5C0XH 3IKJA 1DXMA 1GUNA 4KN4C 3W3AA 2QF7A 4H13C 2A68D 1Q1EA 1DD2A 4I7ZC 1VF7A 1Y8NB 1ZYRC 4DK1A 2JEAI 4BA2I 3FPPA 1T5EA 4GZYC 2K7VA 3BDOA 3TZUA 3ND8A 1ONLA 2A6HD 2K33A 3PUWA 2EJFC 3VR6A 1TU2B 3MFYA 1V8QA 5BN4A 4IQZA 4KKTA 3OW7A 2A69D 1QJOA 4DK0A 2EDGA 1H9KA 2D62A 3CRLC 3GQBA 5JEAH 4DNTB 2DNEA 1E2ZA 1I6VC 1YNJC 4H0LC 2EJMA 3QG1A 2PPBC 2DN8A 3VR2A 4RCNA 4XTCS 3BG3A 3D31A 5K36G 2BE5D 1Y8OB 3IFTA 1Q90A 2A6ED 4IFDG 4KI0A 2B8FA 2BA1A 1E2VA 2A68C 1B9MA 5KNBA 1FR3A 1GUTA 3U9SA 1PMRA 3MXUA 1K8OA 1HPCA 2IT1A 3A7LA 3PUVA 3KLRA 1EWHA 2A6HC 1Z6HA 1Z7TA 3I4LA 2KCCA 2LMCB 3LWUA 2NN6G 2CW0C 1A6XA 3OOCA 3DXJC 2F1MA 4OGQC 2K32A 1GHKA 1GUSA 3M85A 5KNDA 2A69C 2DNCA 1CTMA 2E76C 4L8JA 3PUYA 1H9SB 1CFMA 3A7AB 2KA7A 3I72A 3M4YA 3N6RA 4TQUS 1YNNC 3SE0A 1H9MA 5C0XG 3M7NA 2BA0A 2PNRC 3A8IE 1H9SA 2BE5C 2D2CC 1ZKOA 1GUOA 4LK1C 1IYVA 5K36H 3VR5A 2A6EC 3SDZA 3T53B 4TKOB 1OXVA 1TKWB 4DNRB 1VCIA 4IFDH 4BA1I 2PCFB 2JXMB 1G291 3I73A 5KNCA 3H94A 3AB9A 1OXTA 2E75C 2JEBI 2AUKA 1OXUA 3RLFA 3L7ZC 2NN6I 3GD7A 4H44C 3PUXA 2NN6H 3PV0A 4OO1G 4KMUC 4KKSA 4G7ZC 1CI3M
chains in the Genus database with same CATH superfamily
4JOIA 3J81E 1EIYB 2HT1A 3R2TA 1HUNA 1SFOH 5C0XI 3VR4A 4DR5Q 1XMQQ 1GJXA 2B2YA 2WB1E 5I4DA 1V43A 3NQTA 1E24A 1O7LA 4U673 4K5XA 4LF5L 2JA6H 4CGYB 2WKDA 3SEBA 3AFPA 4XQQA 2PZUA 5EPLA 4LF4Q 1L1OA 1VQIA 4A3EH 4XT1B 3NE5B 3WDNA 1WTXA 1XTDA 3HOYB 1O78A 1HCZA 1GHJA 4X62Q 2R7FA 1I4HA 1M8AA 2E74C 2LXKA 4XDXA 2LSSA 2N88A 3D4RA 5JEAG 4DUZQ 4CDEC 4PMCA 1GD7A 4GKJL 5IODA 2Y0SE 3R3OA 2Q2IA 2VUMG 5D3IB 4OWXB 4MIUA 2HHHQ 4HJ7A 3BJUA 2NTTA 4OX9Q 2N78A 3CAMA 4JI1Q 1K73C 1Q1EA 4F8MA 4QUCA 4DR1Q 1VF7A 2K5QA 2K7VA 3J7A5 4HMJA 4H7BA 3HOVG 1A2UA 2C9OA 4OONA 4LUOA 2E2IH 1MBYA 1CA5A 4LUVA 1XPOA 4JCVE 1HFNA 3NTHA 2F0QA 1HNWQ 1TWCB 4DUYL 2EJMA 1JJGA 4IO9A 1JOQA 4X6AH 3QOJA 1XPUA 4EVOA 1EIHA 1AE2A 5CBEE 3AMUA 1EIGA 1RL2A 1PMRA 1JJCB 4YCUA 1K8OA 1QG7A 4ZKBB 3A7LA 3E9IA 2F52A 1Z6HA 2KCCA 4KHVA 1TR5A 2R92G 5JPMC 1N32L 1PYSB 2RBMA 5HY6A 2B39A 5ELNA 1VQOA 4KHPL 5EBCA 4XYQA 4C3JH 4Y52H 3PUYA 5GADC 3M4YA 1E1TA 3I4NB 3G6EA 4EGVA 3A8IE 1Y1VB 2BE5C 3CCEA 3PO3G 3TP5A 1EYCA 2XGTA 5FLXL 1EEID 2B2TC 4DV5L 3PSIA 3S1MB 4N8FA 4DV2Q 3MZ5A 2JK8A 2A5HA 4OO1I 2RDGA 3E0JA 3PV0A 4UP7A 3UE0A 1SSOA 4KKSA 3GTLB 3GTGH 1CI3M 1EYDA 3PGZA 1Y69U 3OWFA 1IW7D 3D0FA 3FRPB 1KIXA 2RHSB 2EYHA 3RMHA 4A3MH 2ICIA 4EQNA 2WACA 3I7FA 1VF5C 1DGSA 1L1OB 4MTKA 2L9HA 2WIIB 5DAUA 2RF4A 4A3BH 5JPNC 4NXNQ 1SLJA 3RR5A 3JAMc 2ZT9C 3H91A 2K5VA 3HKZG 3H09A 4C1NI 3BS1A 1DCZA 2F0TA 2XWBB 2QCPX 3GTJB 1CKNA 4GKKL 5KGUA 2Q8IB 2K75A 2YYZA 4KHZA 4XT3B 3F2CA 3GTQH 5C0XH 4IN3A 3DM3A 2EY2A 3I91A 1OO9B 3NELA 4N9TA 1YIJA 2ZJRA 1SE3A 1STAA 4LF8L 3NPPA 2R92B 4IUNA 1EOVA 2N8NA 1GXDC 1IYJB 1Z47A 2DGYA 5H1SE 2FFKB 2VQEL 2HQLA 4BBSH 3PO3B 2IJ0A 4NXML 3GTMH 3BG3A 2B29A 4YY3L 1XPRA 1VQ9A 2A6ED 4HJ5A 4JI3Q 1PRTB 2JA5H 3O13A 1LM0A 1LTTD 4KD4A 2XRSD 1PH4A 4CJ1B 3GV3A 1SE4A 2FMCA 3I4LA 2NVYH 4L63B 1HNZQ 1EYAA 4KY5A 2CW0C 1V1OA 4GLXA 4A3KB 1K8GA 3A74A 1EEFD 1B8AA 5IGBA 3FDTA 1VQ7A 2UUBL 4BBRH 4UPAA 1G51A 1XMOQ 1XNQL 3BDLA 3M7NA 3GV6A 3S2DH 3AU7A 5M3FB 1A2TA 1H9SA 4DV4Q 2B2WA 5K36H 5DM73 4YHHL 4PMWA 1IBKQ 4BY1G 5IGFA 2EZVA 3HKZB 4ZLTF 4LWCA 2NN6I 3AYHB 3VYRA 2R3ZA 4DV6Q 3NTIA 2PW5A 5A2QL 1SMXA 1CHPD 5EQ0A 2PNHA 4DK3C 5M5WH 4PNYA 1OXXK 3P75A 1MJEA 1X65A 4JC0A 1BBWA 2K03A 1N36L 4CKCA 2K50A 1DZ1A 2IHFA 2UXDL 2MUYA 2FMMA 1WD0A 5I9PA 4LFCQ 4JI8L 2HIVA 5IYBG 4GN4B 5IP9G 2H4OA 2JQOA 1FVIA 1D8LA 4JV5L 2SNMA 4FVMA 2UXBL 1CKNB 1TY0A 2YU9H 5LMUQ 4OO1H 1ET6A 2KEDA 1Y1WG 2D5DA 1Q8IA 4NMZA 2AUJD 3MC0B 3S1RB 4DN4M 1HUMA 1WCMH 4EQOA 3C1FA 4J8QA 3W3AA 1MSGA 4R8IA 1VQGA 4I7ZC 3M7GA 1PLFA 3TZDA 3FPPA 1CQVA 4DV3L 1NE3A 3IRBA 3J81j 2EXDA 4KD3A 3M4OB 4A3IG 5IP7H 2EJFC 1U9RA 3MFYA 3MA2B 2CHBD 2CQOA 4HEDA 1NTGA 2IW3A 2PQAA 2K52A 2UXCQ 4KV6A 3WOFA 4DNTB 2TSSA 2DN8A 4A3DH 4IJLA 4IFDG 2K28A 5C0XJ 1HA6A 4OL7A 1K3RA 1I3QH 1B9MA 5CV8A 2R93G 4DR3Q 4AYBG 2AMCB 5J3BA 1WTRA 1WTHA 5C4XH 3BZKA 3ERQA 4BY7B 4OXPA 1EY4A 4NP5A 3J7AF 1JR0D 3D8GA 3E9HA 1L2FA 2PI2E 2K14A 1H9SB 5ELOA 2KOLA 2PO4A 4A3GH 4A4IA 3TP8A 4TKOB 3OTOL 4DNRB 3JAML 5C3EH 2VW9A 2F0NA 3D4WA 1MSHA 2Z0SA 1IL2A 4WRDA 2AUKA 1BCPD 2Z6BA 4K5WA 3GD7A 1KLGD 4QL5A 2HIXA 1Y1WB 4GNXB 4A3LH 2EPBA 5C4JB 1F2ZA 1LTBD 2KEEA 2F0EA 1JJ2A 2MP1A 1H9JA 2PZWA 3D4DA 2JA8G 1XNRL 3OPOA 4R4TA 1PH8A 4BXXH 3UDFA 5BN5A 3EA6A 1VDZA 1MJCA 1VQDA 1S4ZA 5ELCA 4JBWA 4A3IB 1AFPA 3M4PA 3NBIA 1JWUD 4C3HH 1HZAA 1UE1A 5FJ8H 5JVH3 1I50H 2F4VQ 1RODA 1LT5D 3L0OA 4HIMA 5IYCG 3Q6SA 1XX8A 3CRKC 3J80i 1NBWA 1Q12A 1WOCA 2IX1A 2L5TA 2CVRA 2EY5A 2XNAC 4LFAL 4OWWB 2R61A 1E3PA 4DR2L 3I4MH 2R93B 4J15A 3NP8A 3URYA 2ZJPA 1S5BD 2L12A 4NB3A 1Y8NB 1T5EA 4K8IA 1LT6D 1SYCA 4C2MH 5IGCA 5M9OA 2XWJB 1Q46A 1SROA 2PQAB 1NNXA 2FHTA 3TS0A 2YTYA 4LF6Q 1BUVT 2H1EA 1CSPA 1AE3A 1YNND 2VNUD 1ESFA 5COYA 1WTQA 4HTHA 1O7ZA 5ELEA 4PQXA 1RDPD 1EQVA 4C3IG 3CP0A 2NVXB 5EJWA 1HPCA 3HOUG 1BF4A 2PZTA 3E0EA 1IBML 3CCRA 2LS01 3I8ZA 4LNQA 2K32A 4AQYQ 3A5UA 1CTMA 2E76C 4DV1L 2JA8B 3S15B 2B2UC 4R4OA 4LK1C 1ASZA 3E6ZX 4DAPA 2FXQA 3GTKB 1PYWD 2I5HA 1EUJA 3DEPA 1PH9A 1O7YA 2PCFB 4DR5L 1XMQL 2EQSA 5HGQA 1HQRD 4UP8A 2QEJC 3HOZG 4L6TB 1OXUA 3QR8A 4LF4L 2RDFA 4H44C 2G5DA 2YTXA 3PUXA 4JOIC 5CV9A 5CORA 1IXRA 4FF4A 4X62L 2HCCA 3EQLC 3LGJA 5JJZA 4RG1A 3KBGA 4Q0FA 4ZQ3A 2F0KA 1HHVA 2NB0A 2VZAA 5LL6S 1L1OC 3SK4A 2V4DA 1RCVD 4FXGC 1HZBA 4V190 5JJLA 4FNFA 3I3CA 2HHHL 1YI2A 3IFDA 2R6GA 4G7HC 4OX9L 2C35B 4JI1L 1DOKA 1V9PA 4DR1L 3T51B 3CC7A 1SNMA 2E2HB 3MXNA 5CV7A 3TS2A 1ICWA 1JCKB 1PFSA 1X3QA 4MN3A 3HGBA 1PZJD 3IKJA 1DXMA 1HNWL 5L37A 2QF7A 3HOUB 1TT2A 1DD2A 4DV7Q 1C8CA 1YHQA 2BH2A 4GZYC 2EY1A 1E1OA 3Q22A 1VQEA 4PMBA 2WAQB 3FKIB 3PIOA 1ENFA 4E6IA 1QVCA 3OYYA 3CC4A 2XN9C 1FNUA 4HIKA 2XVSA 3I70A 3DM1A 1JC7A 2QDLA 4G57A 3TN2A 4F87A 4KK7A 3OMGA 2MFIA 1PRTC 2BA1A 3A55A 2F3IA 2E2JB 4F7XA 1EQTA 1SBBB 3HOZB 2B63H 2JA7G 5D14A 3S14B 3W1BA 2R7ZH 4X3UA 3UDGA 3P7JA 5C5LA 4B3TQ 1S3OA 5M3MH 2VQFQ 4A93B 5KYLA 1HNXQ 2JA9A 3SE0A 3G6JB 3N6RA 4DV2L 5I2XA 1UEAB 2D2CC 1SMYD 2L1BA 2NZHA 1OXVA 1QNUA 2YTVA 1KXLA 2ES2A 4QY7A 1PH7A 4GN3B 4ZYSA 5IY0A 4V0BA 4A3JH 4NXNL 3S17B 3K7UC 1E22A 1S5CD 4ID6A 3CQZH 4NKLA 1HJPA 1Y8PB 5IGEA 1RIPA 4RGNA 1UAPA 3STBC 1G6ZA 1B4OA 3WWVA 2OQ0A 2B8GA 3SK6A 3K7AH 1Z9FA 4A76A 3CHBD 2PW7A 1HZ9A 1J8IA 4R4CA 1SFOB 4C3JG 4KJOA 3MXNB 1JE5A 3I55A 1HFGA 3K81C 3T1HQ 3IAYA 2JA6B 3F2BA 3ULPA 1D7QA 4X3TA 2XSCA 4OHJA 4A3EB 2QILA 5FK9C 1AN8A 3HOWG 2Z4IA 5M5YH 4P72A 1GUWA 4AYBE 3I4NG 1KRSA 1PTOH 2JA7B 2SNSA 2JJQA 2OT2A 4DAYA 1Y1VG 3U4VA 3BZDB 2R7DA 4JI3L 4RKBA 3UI2A 4OEMB 1B3QA 3Q0AA 1D2BA 1N9WA 1RD9D 1K9MC 3E5SA 3FPUB 1NY4A 1PRTF 2A69D 3JC66 5IE8A 4JPBW 1HNZL 4RWSC 4F88A 4AIMA 4UHVA 4IUPA 3EVQA 3KDFA 4CHTB 1XMOL 1B7YB 4JI0Q 2YV5A 3UDXA 4DV4L 2E2IB 3H0GH 1PXUA 3J80E 1KQSA 3ZJYC 1SYGA 1IZ6A 1K0RA 4P71A 1IBKL 2A74C 1A6XA 2UU9Q 1X6OA 2K4KA 1GUSA 4FO2A 5IYDG 3HOYH 1WI5A 1H95A 4KY7A 1SR3A 1GKHA 5C0XG 4LF9Q 5IT9E 2F4IA 2I0QA 4DV6L 1ZKOA 3L3OC 1DOMA 2B2VA 3BDCA 1CZGA 1JWSD 4K2KA 2RSNA 2WFWA 1ENCA 2F3WA 4C3JB 4ZUJA 5JOBA 1VQKA 4RCOA 3L7ZC 5EKKA 1EFID 1K83B 4GNXC 1BKBA 5KYIA 4A3FH 4K0KQ 3RN5A 5LHY1 3HOWB 1O7IA 1IHZA 2HDMA 5TSSA 1VMPA 3VYSA 5LMUL 3K58A 4AH6A 1SYFA 5BN3A 2DY8A 4B3MQ 4DXFA 3I4OA 1TWCH 3ICEA 1VQ5A 3D3RA 4O2DA 1ZYRD 4YIJA 1JT8A 4P2CB 3GTGB 4DKAC 4RMFA 1YVCA 1RTOA 4MTNA 4A3MB 1CSQA 1SXTA 4DF7A 1X56A 1E0BA 3P1HA 4A3KG 4L5RC 4X3SA 3VR3A 1IW7C 3G4SA 2D0OA 4A3BB 4HR7B 4ZUIA 1C48A 1KNEA 1C0AA 1EFWA 4DAYB 2UXCL 3TDQA 4ULLA 5M3FG 1ENAA 3DWQA 2AQ3B 2XRQD 1ONLA 2K33A 3U50C 3PUWA 3RUZA 1EY5A 3PIPA 1TU2B 4DR3L 3GTQB 2ID0A 2D62A 3A5ZB 5JEAH 3KDFB 1NJIC 3RZOH 2LY7A 4RCNA 5FLMG 1EY8A 3FHWA 2EXZA 2VUMH 2RHQB 3D6CA 4RKLA 1GUTA 5ISRA 1HTLD 3MXUA 4C56C 3NENA 3KLSX 2XTIA 3KLRA 4B9WA 4BBSB 1A0IA 4K14A 2IL8A 3OOCA 3J7YW 3S2HB 3J7ZC 3HOVH 1RHPA 1I4RA 1HA5A 2KVMA 5E3FA 3NWSA 4QGUA 1PDQA 2NWGA 2E8GA 2D0PA 2JA5B 1SN8A 3MXGA 1H9MA 4CBVA 1SE2A 1UWVA 2A6EC 3SDZA 2DUDA 2F0OA 2CH4A 2NVYB 1VCIA 2MHVA 3OWEB 1G291 3TP6A 4BBRB 1T5XD 5IP7G 2MGSA 2NUCA 3S2DB 1JOOA 2GVAA 1CKMA 4DR6Q 2WP8J 3HG9A 4DA2A 5BR8Q 1F9SA 4A3DG 4NW2A 5C44H 3SXHA 1BDOA 4X64L 5GROA 2F4VL 4KJNA 4P74A 1R4PB 2K01A 3PO3H 1HTPA 4DGZA 5EPJA 5A35A 3DUZA 4KKUA 1CUKA 1ML0D 2DJGC 5C4XG 2ICEC 1HR0Q 1ILQA 3A8KE 4GKJQ 1N33Q 3KK7A 4RFBA 5D3DA 4L5SA 4LUZA 4Q5VA 5M5WB 1V1PA 1AEXA 1C9OA 2DY7A 4BY7G 5CC4A 5LMNW 3KF8A 1C4QA 2ENBA 5FO7B 2G9DA 4DNIA 1YNJD 2KCMA 1YITA 1G8ZD 3U58A 3J81c 5C3EG 4JI4Q 1VQJA 4B3SQ 4LF6L 4GS3A 3H3VC 1FGBD 3K5OA 4OELB 2K1BA 4H13C 4IURA 3KYHC 2MQHA 3NBHA 1BBXC 4A3LG 1C7YA 4DR7Q 4ZAIA 3CRLC 1H9KA 1LTRD 1WCMB 2Z6KA 1VQFA 1YNXA 3RLOA 1OTCA 2F0JA 1TY2A 2BDNA 4H0LC 3QG1A 4AQYL 3NWTA 2N49A 4L5TA 1BOSA 1QZGA 3CXCA 5KEEA 2UUCL 4JW0A 2I07B 4CDCC 1FR3A 5E1FA 2ASBA 4WJ3M 2B2TA 3PO2G 1CK1A 2L0CA 4J6HA 5D65A 3J80c 2NN6G 1EIFA 1BO0A 3C2PA 4ZCKA 4A3DB 1GHKA 2DNCA 1D5MC 3K80C 3M3YH 1I3QB 5F2DA 2KA7A 1PFBA 5JEAJ 1EL0A 3AEVA 5CV4A 5IT9c 4DAVA 5C4XB 3FP9A 4JVZA 3PF4A 1L0YB 4MNOA 2F3VA 4A3CG 1LLRD 4JI5Q 3S1RH 5FLXE 3K5NA 2K5NA 5M5XH 2HQEA 2GN5A 1VQCA 4HSPA 4A3GB 4ABNA 1U4RA 2C5CA 3MHBA 2VB3X 2E5LQ 4TSSA 2Z9HA 1GM5A 4B3RQ 5C3EB 3M4OH 5DNFA 1FGUA 1LABA 4CKBA 5I6WA 3C1EA 4K8JA 5KRUA 1I5FA 1KAAA 4LAAA 2J0TD 2NVQH 2ALYB 3MVVA 4IPGA 1I6HH 1E2WA 1STNA 4BY1H 1YHAA 4A75A 1BVSA 3OSOA 1NR2A 2I5LX 4DV7L 1BCPC 1Q8KA 1FJGQ 3I90A 3KF8B 4XYOA 1TWFB 3MWYW 3S9WA 5C3XA 1PTOD 3TRZA 2AWNA 2RVLA 4IOAA 5G3LD 4B9XA 4RHRA 3HOXG 1B50A 5FO8B 5J22A 1SAPA 1X3GA 3PO2B 5IWAQ 1UEBA 3MEFA 5E4WC 1HRJA 4K5VA 4C3HB 2AKWB 1G2TA 4HIOA 3NBHB 4EQPA 4JI6Q 2PMZB 1KL9A 4APVA 1EQRA 1SEBD 5IP9H 1V8QA 2TMPA 2VL6A 1HXYD 1QJOA 3K8AA 3I4MB 2E2DC 3NEMA 2Q2HA 1WTVA 2M00A 3D31A 4B3TL 1KHIA 2VQFL 1HNXL 1KD1C 5C4JH 1Q81C 1JB3A 1F9QA 4YWMA 1DONA 3W1GA 2HDLA 1TWAH 3DXJC 1MD2D 3K0XA 3GTOB 3MFGA 1F2LA 1FNVA 1NUCA 1YNNC 1EY9A 3EBEA 2WB1B 1P8LA 4M8AA 4HCEA 2JN4A 4IFDH 3CD6A 1STEA 4GLAC 3M4QA 1TIID 3SVMA 4QJFA 3AFQA 3FVQA 5KNCA 3KFUA 5EKIA 5I9OA 3GP7A 3CF5A 5EBDA 2KECA 3J81L 1PYBA 2WAQG 3FKIG 3HOXB 1TWHH 4POGA 2Y0SB 1U0LA 1LV9A 5A2QE 2EIFA 3ZYYX 1BCPF 2CWPA 2X6LA 3T1HL 1AZPA 1VQ8A 4R4IA 1A3UA 3T4AC 2A19A 4HJ9A 1X55A 1CHQD 1JQYD 1DOLA 1Q7YC 3HKZE 2F0WA 4X66Q 5G3LF 1B53A 2QGQA 2EYJA 4Z9CB 4U68A 4DXGA 1M90C 3SHLA 3S16H 3J7AV 1H9RA 4ALPA 1VS0A 2BDOA 2B2YC 3S24A 4K6LA 2KQ3A 4QF4A 2P5ZX 2EOTA 4XIGS 4A93G 1T9HA 4DUZL 2F0GA 2JA8H 3NQIA 4M1UB 2K04A 4IUUA 2BCOA 3CMEA 3J80L 2ZM6Q 1PZID 3FEWX 4DK1A 1QVFA 4JI0L 3GTKH 3F8TA 4A3JG 2A6HD 4FF3A 1F9RA 5JVG3 1B70B 4DPGA 3S1QH 2D9UA 4DK0A 1J5EQ 1S5ED 5CV5A 2EY6A 4DK6C 2UU9L 2OQKA 5IYCH 4DU9A 3IFTA 2B8FA 4LF9L 4JI7Q 1E2VA 4OWTB 4CDDC 3MXPA 2F0MA 3NSWA 4JYAQ 5IGGA 3NUCA 3S1NH 2F0UA 1PVOA 1QVGA 1U4PA 4HCSA 1QNKA 3H6MA 1SNCA 4HAEA 2Z1CA 1TVXA 2AHOB 1AZQA 1WFQA 2BA0A 2PNRC 4GOPA 2B63B 1CT1D 4K0KL 2JA6G 4QCLA 4UP9A 4ZKCB 1ASYA 2EYPA 2UUAQ 3R93A 4A3EG 3RLNA 3I73A 4XXEA 4C3IH 1A63A 4HN7A 3H94A 4B3ML 3H3VH 1SYBA 3HOUH 3RZDB 1NMFA 3GDEA 1K0SA 5LMNQ 2MNAA 1QZHA 1EY7A 4RHSA 1SNQA 2IWHA 4YWLA 1K8MA 5HGTA 2O5IC 1ICFB 3VYUA 2G9HD 2ZXOA 3E3XA 1GOZA 1WYDA 3GTPH 1SMYC 1LACA 1TWGH 4CJ2C 1OXSC 1UE7A 4P75A 1U4MA 1MI2A 2F0FA 3H0GG 4A3JB 4IFDJ 4NDXA 3A0JA 1PH2A 4C1NK 2J4XA 1D1KA 2IHEA 4XQNA 1VQ6A 3SK8A 4Y7NB 1I4XA 3QWNA 1B9NA 3HOZH 4FF1A 1IKMA 1Q1BA 3QB3A 4KN7C 1B2TA 2JE6I 1KABA 3WOEA 5IGDA 4HMIA 3DHQA 2NVTH 3K7AB 1FD7D 5T1IA 3X3MA 1PZKD 4P73A 1EWCA 3A54A 4JG2A 2A68D 3OHXC 4LF7Q 2OF1A 3X3NA 3RN2A 2K6AA 2BOSA 2KHJA 5IOCA 1I4GA 5K5PA 4POFA 4A3FG 4UY8C 5BN4A 1QE6A 3TP7A 1L0XB 2WINB 2PI2A 2IX3A 5M5YB 1ESRA 4JI2Q 3Q24A 1B44D 1AW7A 1PTOB 3CCLA 2DNEA 3S17H 1XXGA 1Y8OB 2B2UA 1RKNA 5AFWA 1EQQA 1R9TH 3SK5A 3DWPA 4RAUC 1PHJA 1IBLQ 1JE4A 1SYEA 5EKLA 2EYLA 1NMGA 3CCJA 3LWUA 1A3VA 4OIKA 4X65Q 4UAIA 2A69C 3U4ZA 1YJ9A 5EAYA 4GOPB 1CFMA 4GLVB 4S3SA 4TQUS 3TBIB 4A3MG 4DR6L 3H0GB 5EPKA 1GUOA 2K5HA 5BR8L 3KF6A 1R4QB 5JAVA 1EY6A 1WJJA 4A3BG 4DV0Q 3H15A 2JXMB 1EOTA 4FF2A 2HD3A 1TS3A 1BXTA 2JEBI 2JA7H 2LFNA 1Q86C 1LUZA 4IJHA 1HR0L 5JJIA 1Q82C 5FO9B 1N33L 5ELDA 1EZ6A 1GO3E 2B2WC 3VA7A 5GAEC 1WD1A 1PA6A 3T1YQ 5GQOA 3A8JE 2WKCA 2J7ZA 4LW1A 4O42A 4JI4L 4ILWA 4B3SL 3I56A 4A3FB 1O80A 3MTSA 1XTCD 1W2BA 3L9AX 4LFCL 4J1MA 1VQPA 4BBSG 4TVAB 1STBA 1CKOA 2FJ2A 2H5XA 4HJ8A 2EJGC 1KLUD 4DR7L 3LX0A 4NPSA 2JA5G 3IL8A 5KIXA 3GO5A 1DM0B 3LWEA 4IUQA 1ZYRC 5DEHA 3AQQA 1X54A 1NR4A 4RA8A 1MIUA 1QB5D 1PH1A 2Z6KC 4BBRG 2F03A 3I2ZA 2Q2TA 5C44G 1UUPA 5C4ZA 3KBXA 2KUMA 1E2ZA 1S5FD 3NXWA 3VR2A 5K36G 1VQHA 1K83H 2BE5D 5C3WA 1WVLA 4KI0A 3HOWH 1YHBA 5FOBB 4LFBQ 3I4NH 1X9NA 1G6PA 2F0DA 2Q8TA 1L0WA 1Y1VH 4ME5A 3PUVA 3F2UA 4OIJA 4DR4Q 1II3A 1P16A 2WAQE 4JI5L 3RZOB 3TREA 1NSNS 3S1MH 5C5MA 1MKHA 2VUMB 4ODGA 1N34Q 1EZ8A 2ZJQA 4B08A 2KHIA 3I72A 3KF6B 1SDFA 1JWMD 2E5LL 4B3RL 2ZXPA 4QIWB 3GTLH 4IOCA 4KLKA 3HOVB 5AJ3Q 1JB7A 1LTGD 4I65A 1B1ZA 3AB9A 3CCVA 2E75C 3K0YA 4R4QA 2IX0A 3GTMB 4OO1G 3PQIA 1LO5D 5GAGC 5IYDH 4PZ6A 4JBKA 1FJGL 2V1CC 3ND9A 3DWAA 1D1IA 1WCMG 2NBFA 3K5LA 1W6JA 3CPFA 3GTJH 2CFMA 2X6GA 2ZTDA 1SJHD 4PZ8A 4RH6A 3PIP3 1RF2D 5NUCA 1A3TA 5J39A 1KDBA 5IWAL 1I94Q 3T56B 1RJTA 5C44B 1MHWC 4G7OC 4JI6L 1IYUA 2R92H 1IKLA 2CH4W 1E7ZA 5JJKA 5ELFA 3G71A 1VQ4A 4LF5Q 1CM9A 3S2HH 2Z4HA 3PUZA 3A56A 1DYQA 2QEXA 3CKIB 3HKSA 3DLLA 2Q2UA 3DEOA 4WJ4A 1STHA 3BDOA 4WJWA 3ND8A 3BVMA 2NYZD 2OXPA 1JOKA 3V96A 2ZTCA 2MO0A 2CW0D 2ATWA 2QKIC 4WFN3 2AQ2B 3CMAA 4TRDA 4K2LA 5E7NA 1YJWA 1QWYA 1I6VC 1NAPA 1YNJC 4CKEA 4A3KH 2LKVA 4A3GG 4XTCS 3F1ZA 4MHEA 4N8X1 5M3FH 1KC8C 2YU9B 2ZTEA 4ZRZA 4KY6A 2KBNA 4FDBA 1LYLA 4JBMA 4DUYQ 1ZEQX 1I4PA 4QMGA 3ONAB 1D5XC 3JAMi 2K5DA 4GNXA 1SE8A 1PH3A 3ER0A 5E4XA 4BXXG 2QA4A 3W2DA 2XIWA 5FLMH 3EFXD 2KCNA 4IFDI 1TKWB 3CCUA 1U4LA 1ZXTA 1IL8A 3HRZC 4YWKA 2HUGA 1N32Q 4CDFC 3W5OA 4KHPQ 1S72A 1TQOA 3M3YB 2JYOA 2N3SA 3RLFA 4X3KA 4C3HG 3KJOA 3PF5A 5FJ8G 1XWEA 5HURA 4X66L 4KMUC 2L15A 3HEJA 3HP3A 4IPHA 4DV5Q 1YEZA 3I4MG 2FINB 1G2SA 2SDFA 5M5XB 4R9WA 2EYFA 2EVBA 2ZXRA 3VYTA 3QIAA 3P20A 1KNAA 1F77A 1YZ6A 2ZM6L 1AP0A 1LT3D 3PCOB 4JK1C 1K3BC 1FL0A 2NVQB 2K05A 2RA4A 3KUPA 1UE6A 4YCVA 1I6HB 2RQXA 1TXYA 1HQMC 5CR3A 1QILA 1AH9A 2O5JC 1J5EL 4BY1B 4FXDA 2L11A 2F0PA 3CCQA 1W6KA 4KN4C 3M9BA 1KDCA 2WB1G 1XJVA 4MZ9A 3UDIA 4PG3A 3KLSA 4IZ8A 4JI7L 4XQJA 1UE5A 4GKKQ 1V1PB 2IY5B 3VR6A 3BYTB 4JYAL 1TS4A 4QQBX 5CGKA 1BR9A 4H02A 1PTOC 4BY7H 3CC2A 3K6OA 3BVZA 1ILPA 2KCTA 4G4KA 4LF8Q 3T13A 4UDUC 2Y0SG 1D5ZC 2A73B 2B3GA 5KNBA 3U9SA 1VQBA 3J81i 1I50B 2UUAL 2VQEQ 1SYDA 1Z7TA 2PQEA 5C6AA 5IYBH 4NXMQ 1S5DD 1X3FA 3M85A 5KNDA 2WV6D 4FYDA 4YY3Q 1HZCA 3N52A 4GOPC 1V1QA 3A7AB 2VXWA 1KRTA 4IPCA 5LMNL 1PH6A 5FKAC 1GVPA 1TWFH 2RCNA 1CA6A 1PFMA 4QIWE 1Y1WH 3VR5A 1IYVA 2F0VA 3T53B 4C2MB 4DFAA 4BA1I 1TWAB 1LTID 4I7AA 3OMCA 1X32A 2HCIA 3BYYB 3H3VI 1SNDA 1JORA 4HIDA 2UUBQ 3VA5A 1PH5A 3HZXA 5IIFA 3PO2H 1XNQQ 4PZ7A 1BQQT 2NN6H 4YCWA 1YBYA 4X64Q 4A3IH 2Z8LA 3D6WA 3K5MA 2L55A 1KDAA 4KTAA 4YHHQ 4IALA 2K5WA 2RDHA 4N9PA 1EYGA 4LJZC 4R8NA 1JMCA 2LXJA 1QOHA 2L4NA 1LTLA 5T1GA 4AYBB 2I46A 2EYMA 2VY3A 5CBAE 1VQLA 3VDYA 2MO1A 4A3CH 1LT4D 1D6EC 1PFNA 3NK9A 5GAHC 3C46A 3NHHA 2VB2X 3HFZB 3EIVA 1TWHB 3EJIA 2R93H 4PV1C 5EGTA 2AWOA 3CPWA 1M1KC 4LF7L 4FXKC 1Y14B 1QUQA 4EX5A 2DJFC 5I6YA 1U5KA 3C3LA 1MGSA 1KAWA 2RCFA 1N36Q 1FYCA 1QCBD 2EYOA 4QB4A 2UXDQ 3KOJA 1EU3A 3T16A 3GTOH 2I5MX 4JI2L 4JI8Q 4RGTA 1LTAD 1J6QA 2OWOA 4HJAA 3HS0C 2B63G 3S16B 4JV5Q 2JEAI 2F0LA 2UXBQ 1PTOF 3TZUA 3CCSA 3G48A 2R7ZG 1RTNA 1SRUA 2CWAA 3ITPA 3F2DA 1IBLL 2RKSA 1F9PA 4IQZA 5M3MG 2NVXH 2EDGA 3BVGA 5I2YA 1VQAA 3SR1A 2UUCQ 1UNSA 2NTSA 3G7LA 3UE1A 4X65L 3CCMA 1NCVA 2A8VA 1EWIA 1SJED 1Q90A 5J1ZA 2O4XA 3HOXH 4DV3Q 3Q8DA 3S15H 4EQ5A 4R1JA 4HSVA 3S1QB 3V05A 2KENA 2A6HC 2F0HA 5CYUA 1HH2P 2F0SA 2LMCB 4DV0L 2F1MA 4OGQC 2O2LD 4L5QA 2JP1A 4L8JA 1CZWA 4IPDA 3TMEA 5IT9L 2Q8RE 3NTKA 1WTWA 2A1AA 3RNUA 2AQ1B 4JBJA 2IPKD 3S1NB 3CW2C 3V2TA 3DMUA 1J9OA 4BWGB 5CV6A 1ET9A 2KJXA 3ULLA 1K28A 1K8AC 3MAQA 2CQAA 5CMDA 3T1YL 2MPMA 3K59A 1A15A 1B3AA 1Q3LA 2QDBA 2M2LA 2NZOA 1VMCA 4RGOS 3BU2A 4LMQD 4RGMA 3B6YA 2OTJA 1W3SA 1CQFA 3OTOQ 2MJ8A 4O0AA 4WORA 3FMCA 3MEHA 1S40A 2N55A 4C3IB 2B2VC 1SNOA 1GUGA 2E2HH 3EROA 2R7ZB 2OCEA 4DAMA 2M9VA 3JAME 3BZCA 3TEHB 3QJYA 5M3MB 5FLXc 1QUQB 3RD4A 2CKZB 1HR0W 3GTPB 1EU4A 1TWGB 2OEOA 1XNRQ 2KHSA 3PMFA 3FKIH 2OTLA 3LNNA 2GA4B 2SEBD 1X3EA 5C4HA 1WTOA 1PRTD 1GUNA 4IUVA 1WTPA 2EE1A 1BNZA 2F0IA 3R8BA 4BA2I 1EY0A 4ZK9B 3PIO3 3OIQA 2PYKA 1M4VA 2E2JH 4LFBL 4K6DA 1FNWA 3CQZB 2NVTB 1I4QA 3HOYG 4KKTA 3OW7A 5DLQE 3GQBA 4LFAQ 4DR4L 1VQNA 3RZDH 3ULJA 4DR2Q 3S14H 2PPBC 1N34L 3SGIA 4A93H 1VQMA 3U9OA 5LL6X 2A68C 3KJPA 1N8RC 1A8VA 4QUFA 1STGA 1X3PA 2NZ1D 2SOBA 3R2IA 2IT1A 1KTKA 1EWHA 2VS1A 2QW7A 2PMZE 5ELBA 4O1NA 4BS9A 3OW2A 4IUTA 5AJ3L 1JICA 5DM63 1STYA 1TS2A 3CU7A 3KLWA 3OIPA 3K57A 1XYIA 4Y7NH 1PV4A 1R9TB 3ERSX 3L2PA 3QO2A 4FP5D 1LTSD 3TQYA 1F2YA 1SNPA 3STBD 3TSSA 1BBUA 2CCZA 2JSOA 1IBMQ 2RSOA 1G91A 1OXTA 1F2MA 3Q23A 1TS5A 1BCPB 2GVBA 4DV1Q 2BH8A 3QOLA 4CJ0B 1A62A 3EN2A 4ME3A 1YJNA 4G7ZC 1I94L 1DJRD 4GN5A 2X69A
chains in the Genus database with same CATH topology
3J81E 1HUNA 3R2TA 5C0XI 3VR4A 1GJXA 2B2YA 5I4DA 1V43A 3NQTA 1O7LA 4U673 4K5XA 4CGYB 2WKDA 3SEBA 4XQQA 2PZUA 5EPLA 4XT1B 3NE5B 3WDNA 1WTXA 3HOYB 1O78A 1HCZA 1GHJA 1I4HA 1M8AA 2E74C 4XDXA 2N88A 3D4RA 5JEAG 4PMCA 5IODA 3R3OA 5D3IB 4MIUA 2NTTA 1Q1EA 4F8MA 4QUCA 1VF7A 2K5QA 2K7VA 4HMJA 4H7BA 1A2UA 2C9OA 1MBYA 1CA5A 1HFNA 3NTHA 2F0QA 1TWCB 2EJMA 1JOQA 3QOJA 4EVOA 1EIHA 5CBEE 3AMUA 1EIGA 1PMRA 1K8OA 1QG7A 4ZKBB 3A7LA 1Z6HA 2KCCA 4KHVA 1TR5A 5JPMC 2RBMA 2B39A 5EBCA 4XYQA 3PUYA 3M4YA 3I4NB 4EGVA 3A8IE 1Y1VB 2BE5C 3TP5A 1EYCA 5FLXL 1EEID 2B2TC 3S1MB 3MZ5A 2A5HA 4OO1I 2RDGA 3E0JA 3PV0A 1SSOA 4KKSA 3GTLB 1CI3M 1EYDA 1Y69U 3OWFA 1IW7D 3FRPB 2EYHA 3RMHA 2ICIA 4EQNA 2WACA 1VF5C 2L9HA 2WIIB 5DAUA 5JPNC 2ZT9C 3H91A 3H09A 4C1NI 3BS1A 1DCZA 2F0TA 2XWBB 2QCPX 3GTJB 5KGUA 2Q8IB 2YYZA 4KHZA 4XT3B 5C0XH 4IN3A 2EY2A 3I91A 1OO9B 4N9TA 1SE3A 1STAA 3NPPA 2R92B 4IUNA 1GXDC 1Z47A 2FFKB 3PO3B 2IJ0A 3BG3A 2A6ED 1PRTB 3O13A 1LTTD 4KD4A 2XRSD 4CJ1B 3GV3A 1SE4A 2FMCA 3I4LA 4L63B 1EYAA 4KY5A 2CW0C 1V1OA 4A3KB 1EEFD 5IGBA 3FDTA 3BDLA 3M7NA 3GV6A 3AU7A 5M3FB 1A2TA 1H9SA 2B2WA 5K36H 5DM73 4PMWA 5IGFA 2EZVA 3HKZB 4ZLTF 2NN6I 3VYRA 2R3ZA 3NTIA 2PW5A 5A2QL 1CHPD 5EQ0A 4PNYA 1OXXK 3P75A 2K03A 4CKCA 1DZ1A 2MUYA 2FMMA 1WD0A 5I9PA 2H4OA 2SNMA 4FVMA 1TY0A 4OO1H 1ET6A 2KEDA 2D5DA 1Q8IA 4NMZA 2AUJD 3MC0B 3S1RB 4DN4M 1HUMA 4EQOA 3C1FA 4J8QA 3W3AA 1MSGA 4R8IA 4I7ZC 3M7GA 1PLFA 3TZDA 3FPPA 1CQVA 4KD3A 3M4OB 2EJFC 1U9RA 3MFYA 3MA2B 2CHBD 4HEDA 2IW3A 4KV6A 3WOFA 4DNTB 2TSSA 2DN8A 4IFDG 2K28A 5C0XJ 1HA6A 4OL7A 1B9MA 5CV8A 1WTRA 3ERQA 4BY7B 1EY4A 4NP5A 3J7AF 1JR0D 3D8GA 1H9SB 2KOLA 2PO4A 3TP8A 4TKOB 4DNRB 3JAML 2F0NA 3D4WA 1MSHA 4WRDA 2AUKA 1BCPD 4K5WA 3GD7A 1KLGD 1Y1WB 2EPBA 5C4JB 1F2ZA 1LTBD 2KEEA 2F0EA 2MP1A 1H9JA 2PZWA 3D4DA 3OPOA 5BN5A 3EA6A 1VDZA 1S4ZA 5ELCA 4JBWA 4A3IB 1AFPA 3NBIA 1JWUD 5JVH3 1RODA 1LT5D 1XX8A 3CRKC 3Q6SA 1Q12A 2IX1A 2L5TA 2CVRA 2EY5A 2XNAC 2R61A 2R93B 3NP8A 3URYA 1S5BD 2L12A 1Y8NB 1T5EA 4K8IA 1LT6D 1SYCA 5IGCA 5M9OA 2XWJB 2FHTA 1BUVT 2H1EA 1YNND 2VNUD 1ESFA 5COYA 1WTQA 4HTHA 1O7ZA 5ELEA 4PQXA 1RDPD 1EQVA 4C3IG 2NVXB 5EJWA 1HPCA 1BF4A 2PZTA 2LS01 3I8ZA 2K32A 1CTMA 2E76C 2JA8B 3S15B 2B2UC 4LK1C 3E6ZX 4DAPA 3GTKB 1PYWD 3DEPA 1O7YA 2PCFB 1HQRD 2QEJC 4L6TB 1OXUA 2RDFA 4H44C 3PUXA 5CV9A 5CORA 4FF4A 2HCCA 3EQLC 5JJZA 3KBGA 4Q0FA 4ZQ3A 2F0KA 1HHVA 2NB0A 5LL6S 3SK4A 2V4DA 1RCVD 4FXGC 4V190 4FNFA 3I3CA 3IFDA 2R6GA 4G7HC 1DOKA 3T51B 1SNMA 2E2HB 3MXNA 5CV7A 1ICWA 1JCKB 1X3QA 4MN3A 3HGBA 1PZJD 3IKJA 1DXMA 3HOUB 2QF7A 1TT2A 1DD2A 1C8CA 4GZYC 2EY1A 3Q22A 4PMBA 2WAQB 3FKIB 1ENFA 4E6IA 2XN9C 1FNUA 2XVSA 3I70A 3DM1A 1JC7A 4G57A 3TN2A 4F87A 4KK7A 3OMGA 1PRTC 2BA1A 3A55A 2E2JB 4F7XA 1EQTA 1SBBB 3HOZB 5D14A 3S14B 4X3UA 3P7JA 5C5LA 4A93B 5KYLA 3SE0A 3G6JB 3N6RA 5I2XA 1UEAB 2D2CC 1SMYD 2L1BA 1OXVA 1QNUA 4ZYSA 4V0BA 3S17B 1S5CD 4ID6A 4NKLA 1Y8PB 5IGEA 4RGNA 1UAPA 1G6ZA 1B4OA 2B8GA 3SK6A 3CHBD 2PW7A 1J8IA 1SFOB 4C3JG 4KJOA 1HFGA 3IAYA 2JA6B 4X3TA 2XSCA 4OHJA 4A3EB 2QILA 5FK9C 1AN8A 2Z4IA 1GUWA 1PTOH 2JA7B 2SNSA 2OT2A 4DAYA 3BZDB 4RKBA 3UI2A 3Q0AA 1D2BA 1RD9D 3E5SA 3FPUB 1PRTF 2A69D 4RWSC 4F88A 4IUPA 3EVQA 4CHTB 2E2IB 1PXUA 3J80E 1SYGA 2A74C 1A6XA 4FO2A 1GUSA 4KY7A 5C0XG 5IT9E 2F4IA 1ZKOA 3L3OC 1DOMA 2B2VA 3BDCA 1CZGA 1JWSD 4K2KA 2RSNA 1ENCA 2F3WA 4C3JB 4ZUJA 5JOBA 4RCOA 3L7ZC 5EKKA 1EFID 1K83B 5KYIA 5LHY1 3HOWB 1IHZA 2HDMA 5TSSA 1VMPA 3VYSA 3K58A 1SYFA 5BN3A 2DY8A 4DXFA 3D3RA 1ZYRD 4YIJA 4P2CB 3GTGB 1RTOA 4A3MB 1SXTA 4DF7A 1E0BA 3P1HA 4X3SA 3VR3A 1IW7C 4A3BB 4HR7B 4ZUIA 1C48A 1KNEA 3TDQA 4ULLA 1ENAA 3DWQA 2AQ3B 2XRQD 1ONLA 2K33A 3PUWA 3RUZA 1EY5A 1TU2B 3GTQB 2ID0A 2D62A 5JEAH 2LY7A 4RCNA 1EY8A 2EXZA 3D6CA 4RKLA 1GUTA 5ISRA 1HTLD 3MXUA 4C56C 3KLSX 3KLRA 4B9WA 4BBSB 4K14A 2IL8A 3OOCA 3J7YW 3S2HB 1RHPA 1I4RA 1HA5A 2KVMA 5E3FA 3NWSA 1PDQA 2NWGA 2JA5B 3MXGA 1H9MA 4CBVA 1SE2A 2A6EC 3SDZA 2F0OA 2NVYB 1VCIA 2MHVA 3OWEB 1G291 3TP6A 4BBRB 1T5XD 2MGSA 2NUCA 3S2DB 1JOOA 2WP8J 3HG9A 4DA2A 1F9SA 4NW2A 3SXHA 1BDOA 4KJNA 1R4PB 2K01A 1HTPA 4DGZA 5EPJA 5A35A 3DUZA 4KKUA 1ML0D 2ICEC 1ILQA 3A8KE 3KK7A 4RFBA 5D3DA 4Q5VA 5M5WB 1V1PA 1AEXA 2DY7A 5CC4A 3KF8A 1C4QA 2ENBA 5FO7B 2G9DA 1YNJD 1G8ZD 3H3VC 1FGBD 3K5OA 2K1BA 4H13C 4IURA 3NBHA 1BBXC 4ZAIA 3CRLC 1H9KA 1LTRD 1WCMB 2F0JA 1TY2A 2BDNA 4H0LC 3QG1A 3NWTA 1BOSA 5KEEA 2I07B 1FR3A 5E1FA 2B2TA 1CK1A 2L0CA 4J6HA 5D65A 2NN6G 1BO0A 3C2PA 4A3DB 1GHKA 2DNCA 1D5MC 1I3QB 5F2DA 2KA7A 1PFBA 5JEAJ 1EL0A 5CV4A 4DAVA 5C4XB 1L0YB 2F3VA 1LLRD 5FLXE 3K5NA 2HQEA 4HSPA 4A3GB 4ABNA 1U4RA 2C5CA 3MHBA 2VB3X 4TSSA 5C3EB 5DNFA 4CKBA 1LABA 5I6WA 3C1EA 4K8JA 5KRUA 1KAAA 4LAAA 2J0TD 3MVVA 1E2WA 1STNA 3OSOA 1NR2A 1BCPC 3I90A 4XYOA 1TWFB 3MWYW 3S9WA 5C3XA 1PTOD 2AWNA 2RVLA 5G3LD 4B9XA 4RHRA 1B50A 5FO8B 5J22A 1SAPA 3PO2B 1HRJA 5E4WC 4K5VA 4C3HB 1G2TA 4EQPA 2PMZB 1SEBD 1V8QA 2TMPA 1HXYD 1QJOA 3I4MB 2E2DC 1WTVA 2M00A 3D31A 1JB3A 1F9QA 1DONA 2HDLA 3DXJC 1MD2D 3GTOB 3MFGA 1F2LA 1FNVA 1NUCA 1YNNC 1EY9A 2WB1B 4M8AA 4HCEA 4IFDH 1STEA 1TIID 3SVMA 3FVQA 5KNCA 5EKIA 5I9OA 3GP7A 5EBDA 2KECA 3J81L 3HOXB 2Y0SB 1LV9A 5A2QE 3ZYYX 1BCPF 1AZPA 2X6LA 1A3UA 3T4AC 1CHQD 1JQYD 1DOLA 2F0WA 5G3LF 1B53A 2EYJA 4Z9CB 4U68A 4DXGA 3SHLA 3J7AV 1H9RA 2BDOA 2B2YC 4K6LA 2KQ3A 4QF4A 2EOTA 4XIGS 2F0GA 3NQIA 4M1UB 2K04A 4IUUA 2BCOA 3J80L 1PZID 3FEWX 4DK1A 2A6HD 4FF3A 1F9RA 5JVG3 2D9UA 4DK0A 1S5ED 5CV5A 2EY6A 4DU9A 3IFTA 2B8FA 1E2VA 3MXPA 2F0MA 3NSWA 5IGGA 3NUCA 2F0UA 1U4PA 4HCSA 1QNKA 3H6MA 1SNCA 4HAEA 2Z1CA 1TVXA 1AZQA 2BA0A 2PNRC 2B63B 1CT1D 4QCLA 4ZKCB 2EYPA 3R93A 3I73A 4XXEA 4HN7A 3H94A 1SYBA 3RZDB 1EY7A 4RHSA 1SNQA 2IWHA 1K8MA 5HGTA 2O5IC 3VYUA 2G9HD 2ZXOA 1GOZA 1SMYC 1LACA 4CJ2C 1OXSC 1U4MA 1MI2A 2F0FA 4A3JB 4IFDJ 4NDXA 4C1NK 2J4XA 1D1KA 4XQNA 3SK8A 4Y7NB 1I4XA 3QWNA 1B9NA 4FF1A 1IKMA 1Q1BA 3QB3A 4KN7C 1B2TA 2JE6I 1KABA 3WOEA 5IGDA 4HMIA 3DHQA 3K7AB 1FD7D 5T1IA 3X3MA 1PZKD 1EWCA 3A54A 2A68D 3OHXC 2OF1A 3X3NA 2K6AA 2BOSA 5IOCA 1I4GA 5K5PA 5BN4A 1QE6A 3TP7A 1L0XB 2WINB 2IX3A 5M5YB 1ESRA 3Q24A 1B44D 1AW7A 1PTOB 2DNEA 1XXGA 1Y8OB 2B2UA 1RKNA 5AFWA 3SK5A 3DWPA 4RAUC 1JE4A 1SYEA 5EKLA 2EYLA 3LWUA 1A3VA 4OIKA 4UAIA 2A69C 1CFMA 4S3SA 4TQUS 3TBIB 3H0GB 5EPKA 1GUOA 1R4QB 5JAVA 1EY6A 2JXMB 1EOTA 4FF2A 1TS3A 1BXTA 2JEBI 2LFNA 5FO9B 5ELDA 1EZ6A 2B2WC 3VA7A 1WD1A 3A8JE 2WKCA 2J7ZA 4O42A 4ILWA 4A3FB 1O80A 3MTSA 1XTCD 3L9AX 4J1MA 1STBA 2FJ2A 2EJGC 1KLUD 3LX0A 3IL8A 5KIXA 3GO5A 1DM0B 3LWEA 4IUQA 1ZYRC 5DEHA 1NR4A 4RA8A 1QB5D 2F03A 1UUPA 5C4ZA 3KBXA 2KUMA 1E2ZA 1S5FD 3NXWA 3VR2A 5K36G 2BE5D 5C3WA 1WVLA 4KI0A 5FOBB 2F0DA 2Q8TA 4ME5A 3PUVA 3F2UA 4OIJA 1II3A 3RZOB 1NSNS 5C5MA 2VUMB 4ODGA 1EZ8A 4B08A 3I72A 1SDFA 1JWMD 2ZXPA 4QIWB 3HOVB 1LTGD 4I65A 1B1ZA 3AB9A 2E75C 3K0YA 2IX0A 3GTMB 4OO1G 1LO5D 3ND9A 3DWAA 1D1IA 2NBFA 3K5LA 1W6JA 2X6GA 1SJHD 4RH6A 3PIP3 1RF2D 5NUCA 1A3TA 5J39A 1KDBA 3T56B 1RJTA 5C44B 4G7OC 1IYUA 1IKLA 5ELFA 1CM9A 2Z4HA 3PUZA 3A56A 1DYQA 3CKIB 3DEOA 1STHA 3BDOA 4WJWA 3ND8A 3BVMA 2NYZD 2OXPA 1JOKA 3V96A 2CW0D 2QKIC 4WFN3 2AQ2B 4TRDA 4K2LA 1QWYA 1I6VC 1NAPA 1YNJC 4CKEA 2LKVA 4XTCS 4MHEA 2YU9B 4ZRZA 4KY6A 1ZEQX 1I4PA 4QMGA 3ONAB 1D5XC 2K5DA 5E4XA 3W2DA 2XIWA 3EFXD 2KCNA 4IFDI 1TKWB 1U4LA 1ZXTA 1IL8A 3HRZC 2HUGA 1TQOA 3M3YB 2JYOA 4C3HG 3RLFA 4X3KA 1XWEA 5HURA 4KMUC 3HEJA 3HP3A 2FINB 1G2SA 2SDFA 5M5XB 4R9WA 2EYFA 2EVBA 2ZXRA 3VYTA 3QIAA 3P20A 1KNAA 1F77A 1AP0A 1LT3D 4JK1C 2NVQB 2K05A 2RA4A 3KUPA 1I6HB 2RQXA 1HQMC 5CR3A 1QILA 2O5JC 4BY1B 4FXDA 2L11A 2F0PA 1W6KA 4KN4C 1KDCA 3KLSA 4IZ8A 4XQJA 1V1PB 3VR6A 3BYTB 1TS4A 5CGKA 1BR9A 1PTOC 3K6OA 3BVZA 1ILPA 4G4KA 3T13A 4UDUC 1D5ZC 2A73B 5KNBA 3U9SA 1I50B 1SYDA 1Z7TA 2PQEA 5C6AA 1S5DD 3M85A 5KNDA 2WV6D 4FYDA 3N52A 3A7AB 2VXWA 5FKAC 1CA6A 1PFMA 1IYVA 3VR5A 2F0VA 3T53B 4C2MB 4DFAA 4BA1I 1TWAB 1LTID 3OMCA 1X32A 2HCIA 3BYYB 1JORA 1SNDA 3VA5A 3HZXA 5IIFA 1BQQT 2NN6H 2Z8LA 3D6WA 3K5MA 2L55A 1KDAA 4KTAA 4IALA 2K5WA 2RDHA 4N9PA 4LJZC 4R8NA 1QOHA 2L4NA 5T1GA 4AYBB 2I46A 2EYMA 5CBAE 1LT4D 1D6EC 1PFNA 3NK9A 3C46A 3NHHA 2VB2X 1TWHB 3EJIA 4PV1C 5EGTA 2AWOA 4FXKC 5I6YA 3C3LA 1MGSA 1FYCA 1QCBD 2EYOA 4QB4A 1EU3A 3T16A 4RGTA 1LTAD 3HS0C 3S16B 2JEAI 2F0LA 1PTOF 3TZUA 1RTNA 3ITPA 2RKSA 1F9PA 4IQZA 2EDGA 3BVGA 5I2YA 3SR1A 1UNSA 2NTSA 3G7LA 1NCVA 1SJED 1Q90A 5J1ZA 2O4XA 4HSVA 3S1QB 3V05A 2A6HC 2F0HA 5CYUA 2F0SA 2LMCB 2F1MA 4OGQC 2O2LD 2JP1A 4L8JA 1CZWA 3TMEA 5IT9L 2Q8RE 3NTKA 1WTWA 2AQ1B 2IPKD 3S1NB 3V2TA 3DMUA 1J9OA 4BWGB 5CV6A 1ET9A 2KJXA 3MAQA 2CQAA 5CMDA 2MPMA 3K59A 1A15A 1B3AA 1Q3LA 2QDBA 2M2LA 1VMCA 4RGOS 4LMQD 4RGMA 1CQFA 2MJ8A 4WORA 3FMCA 3MEHA 2N55A 4C3IB 2B2VC 1SNOA 1GUGA 3EROA 2R7ZB 2M9VA 3JAME 3QJYA 5M3MB 3RD4A 3GTPB 1EU4A 1TWGB 2OEOA 2KHSA 3PMFA 3LNNA 2GA4B 2SEBD 5C4HA 1WTOA 1PRTD 1GUNA 4IUVA 1WTPA 2EE1A 1BNZA 2F0IA 3R8BA 4BA2I 1EY0A 4ZK9B 3PIO3 3OIQA 2PYKA 1M4VA 4K6DA 1FNWA 3CQZB 2NVTB 1I4QA 4KKTA 3OW7A 3GQBA 2PPBC 3U9OA 5LL6X 2A68C 4QUFA 1STGA 1X3PA 2NZ1D 2SOBA 3R2IA 2IT1A 1KTKA 1EWHA 5ELBA 4O1NA 4BS9A 4IUTA 1JICA 5DM63 1STYA 1TS2A 3CU7A 3OIPA 3K57A 1XYIA 1R9TB 3QO2A 4FP5D 1LTSD 1F2YA 1SNPA 3TSSA 2JSOA 2RSOA 1G91A 1OXTA 1F2MA 3Q23A 1TS5A 1BCPB 3QOLA 4CJ0B 4G7ZC 1DJRD 2X69A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K8M A;  1Y69 U;  3EQL C;  1LAB A;  2O5I C;  3FMC A;  1IW7 D;  3ND9 A;  3VR4 A;  1Y8P B;  4LJZ C;  3VA7 A;  1H9J A;  1GJX A;  1BDO A;  1SMY C;  1LAC A;  1OXX K;  3OPO A;  5BN3 A;  1V43 A;  1HTP A;  1GUG A;  1VF5 C;  1O7L A;  5BN5 A;  2V4D A;  1OXS C;  5A35 A;  2B8G A;  2EVB A;  3A8J E;  4KKU A;  1VDZ A;  3QIA A;  1E2W A;  3P20 A;  4JBW A;  3NE5 B;  3QJY A;  2R6G A;  3WDN A;  2ZT9 C;  4G7H C;  1O78 A;  3A8K E;  1HCZ A;  1GHJ A;  4PV1 C;  2AWO A;  3T56 B;  1B9N A;  1DCZ A;  4JK1 C;  4G7O C;  1IYU A;  2E74 C;  1H9R A;  3T51 B;  1Q1B A;  3D4R A;  4KN7 C;  5JEA G;  4OO1 H;  2JE6 I;  2BDO A;  1FYC A;  2EJG C;  3CRK C;  3VR3 A;  1HQM C;  1IW7 C;  2YYZ A;  2Q8I B;  3PUZ A;  4KHZ A;  1Q12 A;  3LNN A;  2D5D A;  2L5T A;  3HGB A;  2AUJ D;  4HR7 B;  2O5J C;  4XIG S;  5C0X H;  3IKJ A;  1DXM A;  1GUN A;  4KN4 C;  3W3A A;  2QF7 A;  4H13 C;  2A68 D;  1Q1E A;  1DD2 A;  4I7Z C;  1VF7 A;  1Y8N B;  1ZYR C;  4DK1 A;  2JEA I;  4BA2 I;  3FPP A;  1T5E A;  4GZY C;  2K7V A;  3BDO A;  3TZU A;  3ND8 A;  1ONL A;  2A6H D;  2K33 A;  3PUW A;  2EJF C;  3VR6 A;  1TU2 B;  3MFY A;  1V8Q A;  5BN4 A;  4IQZ A;  4KKT A;  3OW7 A;  2A69 D;  1QJO A;  4DK0 A;  2EDG A;  1H9K A;  2D62 A;  3CRL C;  3GQB A;  5JEA H;  4DNT B;  2DNE A;  1E2Z A;  1I6V C;  1YNJ C;  4H0L C;  2EJM A;  3QG1 A;  2PPB C;  2DN8 A;  3VR2 A;  4RCN A;  4XTC S;  3BG3 A;  3D31 A;  5K36 G;  2BE5 D;  1Y8O B;  3IFT A;  1Q90 A;  2A6E D;  4IFD G;  4KI0 A;  2B8F A;  2BA1 A;  1E2V A;  2A68 C;  1B9M A;  5KNB A;  1FR3 A;  1GUT A;  3U9S A;  1PMR A;  3MXU A;  1K8O A;  1HPC A;  2IT1 A;  3A7L A;  3PUV A;  3KLR A;  1EWH A;  2A6H C;  1Z6H A;  1Z7T A;  3I4L A;  2KCC A;  2LMC B;  3LWU A;  2NN6 G;  2CW0 C;  1A6X A;  3OOC A;  3DXJ C;  2F1M A;  4OGQ C;  2K32 A;  1GHK A;  1GUS A;  3M85 A;  5KND A;  2A69 C;  2DNC A;  1CTM A;  2E76 C;  4L8J A;  3PUY A;  1H9S B;  1CFM A;  3A7A B;  2KA7 A;  3I72 A;  3M4Y A;  3N6R A;  4TQU S;  1YNN C;  3SE0 A;  1H9M A;  5C0X G;  3M7N A;  2BA0 A;  2PNR C;  3A8I E;  1H9S A;  2BE5 C;  2D2C C;  1ZKO A;  1GUO A;  4LK1 C;  1IYV A;  5K36 H;  3VR5 A;  2A6E C;  3SDZ A;  3T53 B;  4TKO B;  1OXV A;  1TKW B;  4DNR B;  1VCI A;  4IFD H;  4BA1 I;  2PCF B;  2JXM B;  1G29 1;  3I73 A;  5KNC A;  3H94 A;  3AB9 A;  1OXT A;  2E75 C;  2JEB I;  2AUK A;  1OXU A;  3RLF A;  3L7Z C;  2NN6 I;  3GD7 A;  4H44 C;  3PUX A;  2NN6 H;  3PV0 A;  4OO1 G;  4KMU C;  4KKS A;  4G7Z C;  1CI3 M; 
#chains in the Genus database with same CATH topology
 4JOI A;  3J81 E;  1EIY B;  2HT1 A;  3R2T A;  1HUN A;  1SFO H;  5C0X I;  3VR4 A;  4DR5 Q;  1XMQ Q;  1GJX A;  2B2Y A;  2WB1 E;  5I4D A;  1V43 A;  3NQT A;  1E24 A;  1O7L A;  4U67 3;  4K5X A;  4LF5 L;  2JA6 H;  4CGY B;  2WKD A;  3SEB A;  3AFP A;  4XQQ A;  2PZU A;  5EPL A;  4LF4 Q;  1L1O A;  1VQI A;  4A3E H;  4XT1 B;  3NE5 B;  3WDN A;  1WTX A;  1XTD A;  3HOY B;  1O78 A;  1HCZ A;  1GHJ A;  4X62 Q;  2R7F A;  1I4H A;  1M8A A;  2E74 C;  2LXK A;  4XDX A;  2LSS A;  2N88 A;  3D4R A;  5JEA G;  4DUZ Q;  4CDE C;  4PMC A;  1GD7 A;  4GKJ L;  5IOD A;  2Y0S E;  3R3O A;  2Q2I A;  2VUM G;  5D3I B;  4OWX B;  4MIU A;  2HHH Q;  4HJ7 A;  3BJU A;  2NTT A;  4OX9 Q;  2N78 A;  3CAM A;  4JI1 Q;  1K73 C;  1Q1E A;  4F8M A;  4QUC A;  4DR1 Q;  1VF7 A;  2K5Q A;  2K7V A;  3J7A 5;  4HMJ A;  4H7B A;  3HOV G;  1A2U A;  2C9O A;  4OON A;  4LUO A;  2E2I H;  1MBY A;  1CA5 A;  4LUV A;  1XPO A;  4JCV E;  1HFN A;  3NTH A;  2F0Q A;  1HNW Q;  1TWC B;  4DUY L;  2EJM A;  1JJG A;  4IO9 A;  1JOQ A;  4X6A H;  3QOJ A;  1XPU A;  4EVO A;  1EIH A;  1AE2 A;  5CBE E;  3AMU A;  1EIG A;  1RL2 A;  1PMR A;  1JJC B;  4YCU A;  1K8O A;  1QG7 A;  4ZKB B;  3A7L A;  3E9I A;  2F52 A;  1Z6H A;  2KCC A;  4KHV A;  1TR5 A;  2R92 G;  5JPM C;  1N32 L;  1PYS B;  2RBM A;  5HY6 A;  2B39 A;  5ELN A;  1VQO A;  4KHP L;  5EBC A;  4XYQ A;  4C3J H;  4Y52 H;  3PUY A;  5GAD C;  3M4Y A;  1E1T A;  3I4N B;  3G6E A;  4EGV A;  3A8I E;  1Y1V B;  2BE5 C;  3CCE A;  3PO3 G;  3TP5 A;  1EYC A;  2XGT A;  5FLX L;  1EEI D;  2B2T C;  4DV5 L;  3PSI A;  3S1M B;  4N8F A;  4DV2 Q;  3MZ5 A;  2JK8 A;  2A5H A;  4OO1 I;  2RDG A;  3E0J A;  3PV0 A;  4UP7 A;  3UE0 A;  1SSO A;  4KKS A;  3GTL B;  3GTG H;  1CI3 M;  1EYD A;  3PGZ A;  1Y69 U;  3OWF A;  1IW7 D;  3D0F A;  3FRP B;  1KIX A;  2RHS B;  2EYH A;  3RMH A;  4A3M H;  2ICI A;  4EQN A;  2WAC A;  3I7F A;  1VF5 C;  1DGS A;  1L1O B;  4MTK A;  2L9H A;  2WII B;  5DAU A;  2RF4 A;  4A3B H;  5JPN C;  4NXN Q;  1SLJ A;  3RR5 A;  3JAM c;  2ZT9 C;  3H91 A;  2K5V A;  3HKZ G;  3H09 A;  4C1N I;  3BS1 A;  1DCZ A;  2F0T A;  2XWB B;  2QCP X;  3GTJ B;  1CKN A;  4GKK L;  5KGU A;  2Q8I B;  2K75 A;  2YYZ A;  4KHZ A;  4XT3 B;  3F2C A;  3GTQ H;  5C0X H;  4IN3 A;  3DM3 A;  2EY2 A;  3I91 A;  1OO9 B;  3NEL A;  4N9T A;  1YIJ A;  2ZJR A;  1SE3 A;  1STA A;  4LF8 L;  3NPP A;  2R92 B;  4IUN A;  1EOV A;  2N8N A;  1GXD C;  1IYJ B;  1Z47 A;  2DGY A;  5H1S E;  2FFK B;  2VQE L;  2HQL A;  4BBS H;  3PO3 B;  2IJ0 A;  4NXM L;  3GTM H;  3BG3 A;  2B29 A;  4YY3 L;  1XPR A;  1VQ9 A;  2A6E D;  4HJ5 A;  4JI3 Q;  1PRT B;  2JA5 H;  3O13 A;  1LM0 A;  1LTT D;  4KD4 A;  2XRS D;  1PH4 A;  4CJ1 B;  3GV3 A;  1SE4 A;  2FMC A;  3I4L A;  2NVY H;  4L63 B;  1HNZ Q;  1EYA A;  4KY5 A;  2CW0 C;  1V1O A;  4GLX A;  4A3K B;  1K8G A;  3A74 A;  1EEF D;  1B8A A;  5IGB A;  3FDT A;  1VQ7 A;  2UUB L;  4BBR H;  4UPA A;  1G51 A;  1XMO Q;  1XNQ L;  3BDL A;  3M7N A;  3GV6 A;  3S2D H;  3AU7 A;  5M3F B;  1A2T A;  1H9S A;  4DV4 Q;  2B2W A;  5K36 H;  5DM7 3;  4YHH L;  4PMW A;  1IBK Q;  4BY1 G;  5IGF A;  2EZV A;  3HKZ B;  4ZLT F;  4LWC A;  2NN6 I;  3AYH B;  3VYR A;  2R3Z A;  4DV6 Q;  3NTI A;  2PW5 A;  5A2Q L;  1SMX A;  1CHP D;  5EQ0 A;  2PNH A;  4DK3 C;  5M5W H;  4PNY A;  1OXX K;  3P75 A;  1MJE A;  1X65 A;  4JC0 A;  1BBW A;  2K03 A;  1N36 L;  4CKC A;  2K50 A;  1DZ1 A;  2IHF A;  2UXD L;  2MUY A;  2FMM A;  1WD0 A;  5I9P A;  4LFC Q;  4JI8 L;  2HIV A;  5IYB G;  4GN4 B;  5IP9 G;  2H4O A;  2JQO A;  1FVI A;  1D8L A;  4JV5 L;  2SNM A;  4FVM A;  2UXB L;  1CKN B;  1TY0 A;  2YU9 H;  5LMU Q;  4OO1 H;  1ET6 A;  2KED A;  1Y1W G;  2D5D A;  1Q8I A;  4NMZ A;  2AUJ D;  3MC0 B;  3S1R B;  4DN4 M;  1HUM A;  1WCM H;  4EQO A;  3C1F A;  4J8Q A;  3W3A A;  1MSG A;  4R8I A;  1VQG A;  4I7Z C;  3M7G A;  1PLF A;  3TZD A;  3FPP A;  1CQV A;  4DV3 L;  1NE3 A;  3IRB A;  3J81 j;  2EXD A;  4KD3 A;  3M4O B;  4A3I G;  5IP7 H;  2EJF C;  1U9R A;  3MFY A;  3MA2 B;  2CHB D;  2CQO A;  4HED A;  1NTG A;  2IW3 A;  2PQA A;  2K52 A;  2UXC Q;  4KV6 A;  3WOF A;  4DNT B;  2TSS A;  2DN8 A;  4A3D H;  4IJL A;  4IFD G;  2K28 A;  5C0X J;  1HA6 A;  4OL7 A;  1K3R A;  1I3Q H;  1B9M A;  5CV8 A;  2R93 G;  4DR3 Q;  4AYB G;  2AMC B;  5J3B A;  1WTR A;  1WTH A;  5C4X H;  3BZK A;  3ERQ A;  4BY7 B;  4OXP A;  1EY4 A;  4NP5 A;  3J7A F;  1JR0 D;  3D8G A;  3E9H A;  1L2F A;  2PI2 E;  2K14 A;  1H9S B;  5ELO A;  2KOL A;  2PO4 A;  4A3G H;  4A4I A;  3TP8 A;  4TKO B;  3OTO L;  4DNR B;  3JAM L;  5C3E H;  2VW9 A;  2F0N A;  3D4W A;  1MSH A;  2Z0S A;  1IL2 A;  4WRD A;  2AUK A;  1BCP D;  2Z6B A;  4K5W A;  3GD7 A;  1KLG D;  4QL5 A;  2HIX A;  1Y1W B;  4GNX B;  4A3L H;  2EPB A;  5C4J B;  1F2Z A;  1LTB D;  2KEE A;  2F0E A;  1JJ2 A;  2MP1 A;  1H9J A;  2PZW A;  3D4D A;  2JA8 G;  1XNR L;  3OPO A;  4R4T A;  1PH8 A;  4BXX H;  3UDF A;  5BN5 A;  3EA6 A;  1VDZ A;  1MJC A;  1VQD A;  1S4Z A;  5ELC A;  4JBW A;  4A3I B;  1AFP A;  3M4P A;  3NBI A;  1JWU D;  4C3H H;  1HZA A;  1UE1 A;  5FJ8 H;  5JVH 3;  1I50 H;  2F4V Q;  1ROD A;  1LT5 D;  3L0O A;  4HIM A;  5IYC G;  3Q6S A;  1XX8 A;  3CRK C;  3J80 i;  1NBW A;  1Q12 A;  1WOC A;  2IX1 A;  2L5T A;  2CVR A;  2EY5 A;  2XNA C;  4LFA L;  4OWW B;  2R61 A;  1E3P A;  4DR2 L;  3I4M H;  2R93 B;  4J15 A;  3NP8 A;  3URY A;  2ZJP A;  1S5B D;  2L12 A;  4NB3 A;  1Y8N B;  1T5E A;  4K8I A;  1LT6 D;  1SYC A;  4C2M H;  5IGC A;  5M9O A;  2XWJ B;  1Q46 A;  1SRO A;  2PQA B;  1NNX A;  2FHT A;  3TS0 A;  2YTY A;  4LF6 Q;  1BUV T;  2H1E A;  1CSP A;  1AE3 A;  1YNN D;  2VNU D;  1ESF A;  5COY A;  1WTQ A;  4HTH A;  1O7Z A;  5ELE A;  4PQX A;  1RDP D;  1EQV A;  4C3I G;  3CP0 A;  2NVX B;  5EJW A;  1HPC A;  3HOU G;  1BF4 A;  2PZT A;  3E0E A;  1IBM L;  3CCR A;  2LS0 1;  3I8Z A;  4LNQ A;  2K32 A;  4AQY Q;  3A5U A;  1CTM A;  2E76 C;  4DV1 L;  2JA8 B;  3S15 B;  2B2U C;  4R4O A;  4LK1 C;  1ASZ A;  3E6Z X;  4DAP A;  2FXQ A;  3GTK B;  1PYW D;  2I5H A;  1EUJ A;  3DEP A;  1PH9 A;  1O7Y A;  2PCF B;  4DR5 L;  1XMQ L;  2EQS A;  5HGQ A;  1HQR D;  4UP8 A;  2QEJ C;  3HOZ G;  4L6T B;  1OXU A;  3QR8 A;  4LF4 L;  2RDF A;  4H44 C;  2G5D A;  2YTX A;  3PUX A;  4JOI C;  5CV9 A;  5COR A;  1IXR A;  4FF4 A;  4X62 L;  2HCC A;  3EQL C;  3LGJ A;  5JJZ A;  4RG1 A;  3KBG A;  4Q0F A;  4ZQ3 A;  2F0K A;  1HHV A;  2NB0 A;  2VZA A;  5LL6 S;  1L1O C;  3SK4 A;  2V4D A;  1RCV D;  4FXG C;  1HZB A;  4V19 0;  5JJL A;  4FNF A;  3I3C A;  2HHH L;  1YI2 A;  3IFD A;  2R6G A;  4G7H C;  4OX9 L;  2C35 B;  4JI1 L;  1DOK A;  1V9P A;  4DR1 L;  3T51 B;  3CC7 A;  1SNM A;  2E2H B;  3MXN A;  5CV7 A;  3TS2 A;  1ICW A;  1JCK B;  1PFS A;  1X3Q A;  4MN3 A;  3HGB A;  1PZJ D;  3IKJ A;  1DXM A;  1HNW L;  5L37 A;  2QF7 A;  3HOU B;  1TT2 A;  1DD2 A;  4DV7 Q;  1C8C A;  1YHQ A;  2BH2 A;  4GZY C;  2EY1 A;  1E1O A;  3Q22 A;  1VQE A;  4PMB A;  2WAQ B;  3FKI B;  3PIO A;  1ENF A;  4E6I A;  1QVC A;  3OYY A;  3CC4 A;  2XN9 C;  1FNU A;  4HIK A;  2XVS A;  3I70 A;  3DM1 A;  1JC7 A;  2QDL A;  4G57 A;  3TN2 A;  4F87 A;  4KK7 A;  3OMG A;  2MFI A;  1PRT C;  2BA1 A;  3A55 A;  2F3I A;  2E2J B;  4F7X A;  1EQT A;  1SBB B;  3HOZ B;  2B63 H;  2JA7 G;  5D14 A;  3S14 B;  3W1B A;  2R7Z H;  4X3U A;  3UDG A;  3P7J A;  5C5L A;  4B3T Q;  1S3O A;  5M3M H;  2VQF Q;  4A93 B;  5KYL A;  1HNX Q;  2JA9 A;  3SE0 A;  3G6J B;  3N6R A;  4DV2 L;  5I2X A;  1UEA B;  2D2C C;  1SMY D;  2L1B A;  2NZH A;  1OXV A;  1QNU A;  2YTV A;  1KXL A;  2ES2 A;  4QY7 A;  1PH7 A;  4GN3 B;  4ZYS A;  5IY0 A;  4V0B A;  4A3J H;  4NXN L;  3S17 B;  3K7U C;  1E22 A;  1S5C D;  4ID6 A;  3CQZ H;  4NKL A;  1HJP A;  1Y8P B;  5IGE A;  1RIP A;  4RGN A;  1UAP A;  3STB C;  1G6Z A;  1B4O A;  3WWV A;  2OQ0 A;  2B8G A;  3SK6 A;  3K7A H;  1Z9F A;  4A76 A;  3CHB D;  2PW7 A;  1HZ9 A;  1J8I A;  4R4C A;  1SFO B;  4C3J G;  4KJO A;  3MXN B;  1JE5 A;  3I55 A;  1HFG A;  3K81 C;  3T1H Q;  3IAY A;  2JA6 B;  3F2B A;  3ULP A;  1D7Q A;  4X3T A;  2XSC A;  4OHJ A;  4A3E B;  2QIL A;  5FK9 C;  1AN8 A;  3HOW G;  2Z4I A;  5M5Y H;  4P72 A;  1GUW A;  4AYB E;  3I4N G;  1KRS A;  1PTO H;  2JA7 B;  2SNS A;  2JJQ A;  2OT2 A;  4DAY A;  1Y1V G;  3U4V A;  3BZD B;  2R7D A;  4JI3 L;  4RKB A;  3UI2 A;  4OEM B;  1B3Q A;  3Q0A A;  1D2B A;  1N9W A;  1RD9 D;  1K9M C;  3E5S A;  3FPU B;  1NY4 A;  1PRT F;  2A69 D;  3JC6 6;  5IE8 A;  4JPB W;  1HNZ L;  4RWS C;  4F88 A;  4AIM A;  4UHV A;  4IUP A;  3EVQ A;  3KDF A;  4CHT B;  1XMO L;  1B7Y B;  4JI0 Q;  2YV5 A;  3UDX A;  4DV4 L;  2E2I B;  3H0G H;  1PXU A;  3J80 E;  1KQS A;  3ZJY C;  1SYG A;  1IZ6 A;  1K0R A;  4P71 A;  1IBK L;  2A74 C;  1A6X A;  2UU9 Q;  1X6O A;  2K4K A;  1GUS A;  4FO2 A;  5IYD G;  3HOY H;  1WI5 A;  1H95 A;  4KY7 A;  1SR3 A;  1GKH A;  5C0X G;  4LF9 Q;  5IT9 E;  2F4I A;  2I0Q A;  4DV6 L;  1ZKO A;  3L3O C;  1DOM A;  2B2V A;  3BDC A;  1CZG A;  1JWS D;  4K2K A;  2RSN A;  2WFW A;  1ENC A;  2F3W A;  4C3J B;  4ZUJ A;  5JOB A;  1VQK A;  4RCO A;  3L7Z C;  5EKK A;  1EFI D;  1K83 B;  4GNX C;  1BKB A;  5KYI A;  4A3F H;  4K0K Q;  3RN5 A;  5LHY 1;  3HOW B;  1O7I A;  1IHZ A;  2HDM A;  5TSS A;  1VMP A;  3VYS A;  5LMU L;  3K58 A;  4AH6 A;  1SYF A;  5BN3 A;  2DY8 A;  4B3M Q;  4DXF A;  3I4O A;  1TWC H;  3ICE A;  1VQ5 A;  3D3R A;  4O2D A;  1ZYR D;  4YIJ A;  1JT8 A;  4P2C B;  3GTG B;  4DKA C;  4RMF A;  1YVC A;  1RTO A;  4MTN A;  4A3M B;  1CSQ A;  1SXT A;  4DF7 A;  1X56 A;  1E0B A;  3P1H A;  4A3K G;  4L5R C;  4X3S A;  3VR3 A;  1IW7 C;  3G4S A;  2D0O A;  4A3B B;  4HR7 B;  4ZUI A;  1C48 A;  1KNE A;  1C0A A;  1EFW A;  4DAY B;  2UXC L;  3TDQ A;  4ULL A;  5M3F G;  1ENA A;  3DWQ A;  2AQ3 B;  2XRQ D;  1ONL A;  2K33 A;  3U50 C;  3PUW A;  3RUZ A;  1EY5 A;  3PIP A;  1TU2 B;  4DR3 L;  3GTQ B;  2ID0 A;  2D62 A;  3A5Z B;  5JEA H;  3KDF B;  1NJI C;  3RZO H;  2LY7 A;  4RCN A;  5FLM G;  1EY8 A;  3FHW A;  2EXZ A;  2VUM H;  2RHQ B;  3D6C A;  4RKL A;  1GUT A;  5ISR A;  1HTL D;  3MXU A;  4C56 C;  3NEN A;  3KLS X;  2XTI A;  3KLR A;  4B9W A;  4BBS B;  1A0I A;  4K14 A;  2IL8 A;  3OOC A;  3J7Y W;  3S2H B;  3J7Z C;  3HOV H;  1RHP A;  1I4R A;  1HA5 A;  2KVM A;  5E3F A;  3NWS A;  4QGU A;  1PDQ A;  2NWG A;  2E8G A;  2D0P A;  2JA5 B;  1SN8 A;  3MXG A;  1H9M A;  4CBV A;  1SE2 A;  1UWV A;  2A6E C;  3SDZ A;  2DUD A;  2F0O A;  2CH4 A;  2NVY B;  1VCI A;  2MHV A;  3OWE B;  1G29 1;  3TP6 A;  4BBR B;  1T5X D;  5IP7 G;  2MGS A;  2NUC A;  3S2D B;  1JOO A;  2GVA A;  1CKM A;  4DR6 Q;  2WP8 J;  3HG9 A;  4DA2 A;  5BR8 Q;  1F9S A;  4A3D G;  4NW2 A;  5C44 H;  3SXH A;  1BDO A;  4X64 L;  5GRO A;  2F4V L;  4KJN A;  4P74 A;  1R4P B;  2K01 A;  3PO3 H;  1HTP A;  4DGZ A;  5EPJ A;  5A35 A;  3DUZ A;  4KKU A;  1CUK A;  1ML0 D;  2DJG C;  5C4X G;  2ICE C;  1HR0 Q;  1ILQ A;  3A8K E;  4GKJ Q;  1N33 Q;  3KK7 A;  4RFB A;  5D3D A;  4L5S A;  4LUZ A;  4Q5V A;  5M5W B;  1V1P A;  1AEX A;  1C9O A;  2DY7 A;  4BY7 G;  5CC4 A;  5LMN W;  3KF8 A;  1C4Q A;  2ENB A;  5FO7 B;  2G9D A;  4DNI A;  1YNJ D;  2KCM A;  1YIT A;  1G8Z D;  3U58 A;  3J81 c;  5C3E G;  4JI4 Q;  1VQJ A;  4B3S Q;  4LF6 L;  4GS3 A;  3H3V C;  1FGB D;  3K5O A;  4OEL B;  2K1B A;  4H13 C;  4IUR A;  3KYH C;  2MQH A;  3NBH A;  1BBX C;  4A3L G;  1C7Y A;  4DR7 Q;  4ZAI A;  3CRL C;  1H9K A;  1LTR D;  1WCM B;  2Z6K A;  1VQF A;  1YNX A;  3RLO A;  1OTC A;  2F0J A;  1TY2 A;  2BDN A;  4H0L C;  3QG1 A;  4AQY L;  3NWT A;  2N49 A;  4L5T A;  1BOS A;  1QZG A;  3CXC A;  5KEE A;  2UUC L;  4JW0 A;  2I07 B;  4CDC C;  1FR3 A;  5E1F A;  2ASB A;  4WJ3 M;  2B2T A;  3PO2 G;  1CK1 A;  2L0C A;  4J6H A;  5D65 A;  3J80 c;  2NN6 G;  1EIF A;  1BO0 A;  3C2P A;  4ZCK A;  4A3D B;  1GHK A;  2DNC A;  1D5M C;  3K80 C;  3M3Y H;  1I3Q B;  5F2D A;  2KA7 A;  1PFB A;  5JEA J;  1EL0 A;  3AEV A;  5CV4 A;  5IT9 c;  4DAV A;  5C4X B;  3FP9 A;  4JVZ A;  3PF4 A;  1L0Y B;  4MNO A;  2F3V A;  4A3C G;  1LLR D;  4JI5 Q;  3S1R H;  5FLX E;  3K5N A;  2K5N A;  5M5X H;  2HQE A;  2GN5 A;  1VQC A;  4HSP A;  4A3G B;  4ABN A;  1U4R A;  2C5C A;  3MHB A;  2VB3 X;  2E5L Q;  4TSS A;  2Z9H A;  1GM5 A;  4B3R Q;  5C3E B;  3M4O H;  5DNF A;  1FGU A;  1LAB A;  4CKB A;  5I6W A;  3C1E A;  4K8J A;  5KRU A;  1I5F A;  1KAA A;  4LAA A;  2J0T D;  2NVQ H;  2ALY B;  3MVV A;  4IPG A;  1I6H H;  1E2W A;  1STN A;  4BY1 H;  1YHA A;  4A75 A;  1BVS A;  3OSO A;  1NR2 A;  2I5L X;  4DV7 L;  1BCP C;  1Q8K A;  1FJG Q;  3I90 A;  3KF8 B;  4XYO A;  1TWF B;  3MWY W;  3S9W A;  5C3X A;  1PTO D;  3TRZ A;  2AWN A;  2RVL A;  4IOA A;  5G3L D;  4B9X A;  4RHR A;  3HOX G;  1B50 A;  5FO8 B;  5J22 A;  1SAP A;  1X3G A;  3PO2 B;  5IWA Q;  1UEB A;  3MEF A;  5E4W C;  1HRJ A;  4K5V A;  4C3H B;  2AKW B;  1G2T A;  4HIO A;  3NBH B;  4EQP A;  4JI6 Q;  2PMZ B;  1KL9 A;  4APV A;  1EQR A;  1SEB D;  5IP9 H;  1V8Q A;  2TMP A;  2VL6 A;  1HXY D;  1QJO A;  3K8A A;  3I4M B;  2E2D C;  3NEM A;  2Q2H A;  1WTV A;  2M00 A;  3D31 A;  4B3T L;  1KHI A;  2VQF L;  1HNX L;  1KD1 C;  5C4J H;  1Q81 C;  1JB3 A;  1F9Q A;  4YWM A;  1DON A;  3W1G A;  2HDL A;  1TWA H;  3DXJ C;  1MD2 D;  3K0X A;  3GTO B;  3MFG A;  1F2L A;  1FNV A;  1NUC A;  1YNN C;  1EY9 A;  3EBE A;  2WB1 B;  1P8L A;  4M8A A;  4HCE A;  2JN4 A;  4IFD H;  3CD6 A;  1STE A;  4GLA C;  3M4Q A;  1TII D;  3SVM A;  4QJF A;  3AFQ A;  3FVQ A;  5KNC A;  3KFU A;  5EKI A;  5I9O A;  3GP7 A;  3CF5 A;  5EBD A;  2KEC A;  3J81 L;  1PYB A;  2WAQ G;  3FKI G;  3HOX B;  1TWH H;  4POG A;  2Y0S B;  1U0L A;  1LV9 A;  5A2Q E;  2EIF A;  3ZYY X;  1BCP F;  2CWP A;  2X6L A;  3T1H L;  1AZP A;  1VQ8 A;  4R4I A;  1A3U A;  3T4A C;  2A19 A;  4HJ9 A;  1X55 A;  1CHQ D;  1JQY D;  1DOL A;  1Q7Y C;  3HKZ E;  2F0W A;  4X66 Q;  5G3L F;  1B53 A;  2QGQ A;  2EYJ A;  4Z9C B;  4U68 A;  4DXG A;  1M90 C;  3SHL A;  3S16 H;  3J7A V;  1H9R A;  4ALP A;  1VS0 A;  2BDO A;  2B2Y C;  3S24 A;  4K6L A;  2KQ3 A;  4QF4 A;  2P5Z X;  2EOT A;  4XIG S;  4A93 G;  1T9H A;  4DUZ L;  2F0G A;  2JA8 H;  3NQI A;  4M1U B;  2K04 A;  4IUU A;  2BCO A;  3CME A;  3J80 L;  2ZM6 Q;  1PZI D;  3FEW X;  4DK1 A;  1QVF A;  4JI0 L;  3GTK H;  3F8T A;  4A3J G;  2A6H D;  4FF3 A;  1F9R A;  5JVG 3;  1B70 B;  4DPG A;  3S1Q H;  2D9U A;  4DK0 A;  1J5E Q;  1S5E D;  5CV5 A;  2EY6 A;  4DK6 C;  2UU9 L;  2OQK A;  5IYC H;  4DU9 A;  3IFT A;  2B8F A;  4LF9 L;  4JI7 Q;  1E2V A;  4OWT B;  4CDD C;  3MXP A;  2F0M A;  3NSW A;  4JYA Q;  5IGG A;  3NUC A;  3S1N H;  2F0U A;  1PVO A;  1QVG A;  1U4P A;  4HCS A;  1QNK A;  3H6M A;  1SNC A;  4HAE A;  2Z1C A;  1TVX A;  2AHO B;  1AZQ A;  1WFQ A;  2BA0 A;  2PNR C;  4GOP A;  2B63 B;  1CT1 D;  4K0K L;  2JA6 G;  4QCL A;  4UP9 A;  4ZKC B;  1ASY A;  2EYP A;  2UUA Q;  3R93 A;  4A3E G;  3RLN A;  3I73 A;  4XXE A;  4C3I H;  1A63 A;  4HN7 A;  3H94 A;  4B3M L;  3H3V H;  1SYB A;  3HOU H;  3RZD B;  1NMF A;  3GDE A;  1K0S A;  5LMN Q;  2MNA A;  1QZH A;  1EY7 A;  4RHS A;  1SNQ A;  2IWH A;  4YWL A;  1K8M A;  5HGT A;  2O5I C;  1ICF B;  3VYU A;  2G9H D;  2ZXO A;  3E3X A;  1GOZ A;  1WYD A;  3GTP H;  1SMY C;  1LAC A;  1TWG H;  4CJ2 C;  1OXS C;  1UE7 A;  4P75 A;  1U4M A;  1MI2 A;  2F0F A;  3H0G G;  4A3J B;  4IFD J;  4NDX A;  3A0J A;  1PH2 A;  4C1N K;  2J4X A;  1D1K A;  2IHE A;  4XQN A;  1VQ6 A;  3SK8 A;  4Y7N B;  1I4X A;  3QWN A;  1B9N A;  3HOZ H;  4FF1 A;  1IKM A;  1Q1B A;  3QB3 A;  4KN7 C;  1B2T A;  2JE6 I;  1KAB A;  3WOE A;  5IGD A;  4HMI A;  3DHQ A;  2NVT H;  3K7A B;  1FD7 D;  5T1I A;  3X3M A;  1PZK D;  4P73 A;  1EWC A;  3A54 A;  4JG2 A;  2A68 D;  3OHX C;  4LF7 Q;  2OF1 A;  3X3N A;  3RN2 A;  2K6A A;  2BOS A;  2KHJ A;  5IOC A;  1I4G A;  5K5P A;  4POF A;  4A3F G;  4UY8 C;  5BN4 A;  1QE6 A;  3TP7 A;  1L0X B;  2WIN B;  2PI2 A;  2IX3 A;  5M5Y B;  1ESR A;  4JI2 Q;  3Q24 A;  1B44 D;  1AW7 A;  1PTO B;  3CCL A;  2DNE A;  3S17 H;  1XXG A;  1Y8O B;  2B2U A;  1RKN A;  5AFW A;  1EQQ A;  1R9T H;  3SK5 A;  3DWP A;  4RAU C;  1PHJ A;  1IBL Q;  1JE4 A;  1SYE A;  5EKL A;  2EYL A;  1NMG A;  3CCJ A;  3LWU A;  1A3V A;  4OIK A;  4X65 Q;  4UAI A;  2A69 C;  3U4Z A;  1YJ9 A;  5EAY A;  4GOP B;  1CFM A;  4GLV B;  4S3S A;  4TQU S;  3TBI B;  4A3M G;  4DR6 L;  3H0G B;  5EPK A;  1GUO A;  2K5H A;  5BR8 L;  3KF6 A;  1R4Q B;  5JAV A;  1EY6 A;  1WJJ A;  4A3B G;  4DV0 Q;  3H15 A;  2JXM B;  1EOT A;  4FF2 A;  2HD3 A;  1TS3 A;  1BXT A;  2JEB I;  2JA7 H;  2LFN A;  1Q86 C;  1LUZ A;  4IJH A;  1HR0 L;  5JJI A;  1Q82 C;  5FO9 B;  1N33 L;  5ELD A;  1EZ6 A;  1GO3 E;  2B2W C;  3VA7 A;  5GAE C;  1WD1 A;  1PA6 A;  3T1Y Q;  5GQO A;  3A8J E;  2WKC A;  2J7Z A;  4LW1 A;  4O42 A;  4JI4 L;  4ILW A;  4B3S L;  3I56 A;  4A3F B;  1O80 A;  3MTS A;  1XTC D;  1W2B A;  3L9A X;  4LFC L;  4J1M A;  1VQP A;  4BBS G;  4TVA B;  1STB A;  1CKO A;  2FJ2 A;  2H5X A;  4HJ8 A;  2EJG C;  1KLU D;  4DR7 L;  3LX0 A;  4NPS A;  2JA5 G;  3IL8 A;  5KIX A;  3GO5 A;  1DM0 B;  3LWE A;  4IUQ A;  1ZYR C;  5DEH A;  3AQQ A;  1X54 A;  1NR4 A;  4RA8 A;  1MIU A;  1QB5 D;  1PH1 A;  2Z6K C;  4BBR G;  2F03 A;  3I2Z A;  2Q2T A;  5C44 G;  1UUP A;  5C4Z A;  3KBX A;  2KUM A;  1E2Z A;  1S5F D;  3NXW A;  3VR2 A;  5K36 G;  1VQH A;  1K83 H;  2BE5 D;  5C3W A;  1WVL A;  4KI0 A;  3HOW H;  1YHB A;  5FOB B;  4LFB Q;  3I4N H;  1X9N A;  1G6P A;  2F0D A;  2Q8T A;  1L0W A;  1Y1V H;  4ME5 A;  3PUV A;  3F2U A;  4OIJ A;  4DR4 Q;  1II3 A;  1P16 A;  2WAQ E;  4JI5 L;  3RZO B;  3TRE A;  1NSN S;  3S1M H;  5C5M A;  1MKH A;  2VUM B;  4ODG A;  1N34 Q;  1EZ8 A;  2ZJQ A;  4B08 A;  2KHI A;  3I72 A;  3KF6 B;  1SDF A;  1JWM D;  2E5L L;  4B3R L;  2ZXP A;  4QIW B;  3GTL H;  4IOC A;  4KLK A;  3HOV B;  5AJ3 Q;  1JB7 A;  1LTG D;  4I65 A;  1B1Z A;  3AB9 A;  3CCV A;  2E75 C;  3K0Y A;  4R4Q A;  2IX0 A;  3GTM B;  4OO1 G;  3PQI A;  1LO5 D;  5GAG C;  5IYD H;  4PZ6 A;  4JBK A;  1FJG L;  2V1C C;  3ND9 A;  3DWA A;  1D1I A;  1WCM G;  2NBF A;  3K5L A;  1W6J A;  3CPF A;  3GTJ H;  2CFM A;  2X6G A;  2ZTD A;  1SJH D;  4PZ8 A;  4RH6 A;  3PIP 3;  1RF2 D;  5NUC A;  1A3T A;  5J39 A;  1KDB A;  5IWA L;  1I94 Q;  3T56 B;  1RJT A;  5C44 B;  1MHW C;  4G7O C;  4JI6 L;  1IYU A;  2R92 H;  1IKL A;  2CH4 W;  1E7Z A;  5JJK A;  5ELF A;  3G71 A;  1VQ4 A;  4LF5 Q;  1CM9 A;  3S2H H;  2Z4H A;  3PUZ A;  3A56 A;  1DYQ A;  2QEX A;  3CKI B;  3HKS A;  3DLL A;  2Q2U A;  3DEO A;  4WJ4 A;  1STH A;  3BDO A;  4WJW A;  3ND8 A;  3BVM A;  2NYZ D;  2OXP A;  1JOK A;  3V96 A;  2ZTC A;  2MO0 A;  2CW0 D;  2ATW A;  2QKI C;  4WFN 3;  2AQ2 B;  3CMA A;  4TRD A;  4K2L A;  5E7N A;  1YJW A;  1QWY A;  1I6V C;  1NAP A;  1YNJ C;  4CKE A;  4A3K H;  2LKV A;  4A3G G;  4XTC S;  3F1Z A;  4MHE A;  4N8X 1;  5M3F H;  1KC8 C;  2YU9 B;  2ZTE A;  4ZRZ A;  4KY6 A;  2KBN A;  4FDB A;  1LYL A;  4JBM A;  4DUY Q;  1ZEQ X;  1I4P A;  4QMG A;  3ONA B;  1D5X C;  3JAM i;  2K5D A;  4GNX A;  1SE8 A;  1PH3 A;  3ER0 A;  5E4X A;  4BXX G;  2QA4 A;  3W2D A;  2XIW A;  5FLM H;  3EFX D;  2KCN A;  4IFD I;  1TKW B;  3CCU A;  1U4L A;  1ZXT A;  1IL8 A;  3HRZ C;  4YWK A;  2HUG A;  1N32 Q;  4CDF C;  3W5O A;  4KHP Q;  1S72 A;  1TQO A;  3M3Y B;  2JYO A;  2N3S A;  3RLF A;  4X3K A;  4C3H G;  3KJO A;  3PF5 A;  5FJ8 G;  1XWE A;  5HUR A;  4X66 L;  4KMU C;  2L15 A;  3HEJ A;  3HP3 A;  4IPH A;  4DV5 Q;  1YEZ A;  3I4M G;  2FIN B;  1G2S A;  2SDF A;  5M5X B;  4R9W A;  2EYF A;  2EVB A;  2ZXR A;  3VYT A;  3QIA A;  3P20 A;  1KNA A;  1F77 A;  1YZ6 A;  2ZM6 L;  1AP0 A;  1LT3 D;  3PCO B;  4JK1 C;  1K3B C;  1FL0 A;  2NVQ B;  2K05 A;  2RA4 A;  3KUP A;  1UE6 A;  4YCV A;  1I6H B;  2RQX A;  1TXY A;  1HQM C;  5CR3 A;  1QIL A;  1AH9 A;  2O5J C;  1J5E L;  4BY1 B;  4FXD A;  2L11 A;  2F0P A;  3CCQ A;  1W6K A;  4KN4 C;  3M9B A;  1KDC A;  2WB1 G;  1XJV A;  4MZ9 A;  3UDI A;  4PG3 A;  3KLS A;  4IZ8 A;  4JI7 L;  4XQJ A;  1UE5 A;  4GKK Q;  1V1P B;  2IY5 B;  3VR6 A;  3BYT B;  4JYA L;  1TS4 A;  4QQB X;  5CGK A;  1BR9 A;  4H02 A;  1PTO C;  4BY7 H;  3CC2 A;  3K6O A;  3BVZ A;  1ILP A;  2KCT A;  4G4K A;  4LF8 Q;  3T13 A;  4UDU C;  2Y0S G;  1D5Z C;  2A73 B;  2B3G A;  5KNB A;  3U9S A;  1VQB A;  3J81 i;  1I50 B;  2UUA L;  2VQE Q;  1SYD A;  1Z7T A;  2PQE A;  5C6A A;  5IYB H;  4NXM Q;  1S5D D;  1X3F A;  3M85 A;  5KND A;  2WV6 D;  4FYD A;  4YY3 Q;  1HZC A;  3N52 A;  4GOP C;  1V1Q A;  3A7A B;  2VXW A;  1KRT A;  4IPC A;  5LMN L;  1PH6 A;  5FKA C;  1GVP A;  1TWF H;  2RCN A;  1CA6 A;  1PFM A;  4QIW E;  1Y1W H;  3VR5 A;  1IYV A;  2F0V A;  3T53 B;  4C2M B;  4DFA A;  4BA1 I;  1TWA B;  1LTI D;  4I7A A;  3OMC A;  1X32 A;  2HCI A;  3BYY B;  3H3V I;  1SND A;  1JOR A;  4HID A;  2UUB Q;  3VA5 A;  1PH5 A;  3HZX A;  5IIF A;  3PO2 H;  1XNQ Q;  4PZ7 A;  1BQQ T;  2NN6 H;  4YCW A;  1YBY A;  4X64 Q;  4A3I H;  2Z8L A;  3D6W A;  3K5M A;  2L55 A;  1KDA A;  4KTA A;  4YHH Q;  4IAL A;  2K5W A;  2RDH A;  4N9P A;  1EYG A;  4LJZ C;  4R8N A;  1JMC A;  2LXJ A;  1QOH A;  2L4N A;  1LTL A;  5T1G A;  4AYB B;  2I46 A;  2EYM A;  2VY3 A;  5CBA E;  1VQL A;  3VDY A;  2MO1 A;  4A3C H;  1LT4 D;  1D6E C;  1PFN A;  3NK9 A;  5GAH C;  3C46 A;  3NHH A;  2VB2 X;  3HFZ B;  3EIV A;  1TWH B;  3EJI A;  2R93 H;  4PV1 C;  5EGT A;  2AWO A;  3CPW A;  1M1K C;  4LF7 L;  4FXK C;  1Y14 B;  1QUQ A;  4EX5 A;  2DJF C;  5I6Y A;  1U5K A;  3C3L A;  1MGS A;  1KAW A;  2RCF A;  1N36 Q;  1FYC A;  1QCB D;  2EYO A;  4QB4 A;  2UXD Q;  3KOJ A;  1EU3 A;  3T16 A;  3GTO H;  2I5M X;  4JI2 L;  4JI8 Q;  4RGT A;  1LTA D;  1J6Q A;  2OWO A;  4HJA A;  3HS0 C;  2B63 G;  3S16 B;  4JV5 Q;  2JEA I;  2F0L A;  2UXB Q;  1PTO F;  3TZU A;  3CCS A;  3G48 A;  2R7Z G;  1RTN A;  1SRU A;  2CWA A;  3ITP A;  3F2D A;  1IBL L;  2RKS A;  1F9P A;  4IQZ A;  5M3M G;  2NVX H;  2EDG A;  3BVG A;  5I2Y A;  1VQA A;  3SR1 A;  2UUC Q;  1UNS A;  2NTS A;  3G7L A;  3UE1 A;  4X65 L;  3CCM A;  1NCV A;  2A8V A;  1EWI A;  1SJE D;  1Q90 A;  5J1Z A;  2O4X A;  3HOX H;  4DV3 Q;  3Q8D A;  3S15 H;  4EQ5 A;  4R1J A;  4HSV A;  3S1Q B;  3V05 A;  2KEN A;  2A6H C;  2F0H A;  5CYU A;  1HH2 P;  2F0S A;  2LMC B;  4DV0 L;  2F1M A;  4OGQ C;  2O2L D;  4L5Q A;  2JP1 A;  4L8J A;  1CZW A;  4IPD A;  3TME A;  5IT9 L;  2Q8R E;  3NTK A;  1WTW A;  2A1A A;  3RNU A;  2AQ1 B;  4JBJ A;  2IPK D;  3S1N B;  3CW2 C;  3V2T A;  3DMU A;  1J9O A;  4BWG B;  5CV6 A;  1ET9 A;  2KJX A;  3ULL A;  1K28 A;  1K8A C;  3MAQ A;  2CQA A;  5CMD A;  3T1Y L;  2MPM A;  3K59 A;  1A15 A;  1B3A A;  1Q3L A;  2QDB A;  2M2L A;  2NZO A;  1VMC A;  4RGO S;  3BU2 A;  4LMQ D;  4RGM A;  3B6Y A;  2OTJ A;  1W3S A;  1CQF A;  3OTO Q;  2MJ8 A;  4O0A A;  4WOR A;  3FMC A;  3MEH A;  1S40 A;  2N55 A;  4C3I B;  2B2V C;  1SNO A;  1GUG A;  2E2H H;  3ERO A;  2R7Z B;  2OCE A;  4DAM A;  2M9V A;  3JAM E;  3BZC A;  3TEH B;  3QJY A;  5M3M B;  5FLX c;  1QUQ B;  3RD4 A;  2CKZ B;  1HR0 W;  3GTP B;  1EU4 A;  1TWG B;  2OEO A;  1XNR Q;  2KHS A;  3PMF A;  3FKI H;  2OTL A;  3LNN A;  2GA4 B;  2SEB D;  1X3E A;  5C4H A;  1WTO A;  1PRT D;  1GUN A;  4IUV A;  1WTP A;  2EE1 A;  1BNZ A;  2F0I A;  3R8B A;  4BA2 I;  1EY0 A;  4ZK9 B;  3PIO 3;  3OIQ A;  2PYK A;  1M4V A;  2E2J H;  4LFB L;  4K6D A;  1FNW A;  3CQZ B;  2NVT B;  1I4Q A;  3HOY G;  4KKT A;  3OW7 A;  5DLQ E;  3GQB A;  4LFA Q;  4DR4 L;  1VQN A;  3RZD H;  3ULJ A;  4DR2 Q;  3S14 H;  2PPB C;  1N34 L;  3SGI A;  4A93 H;  1VQM A;  3U9O A;  5LL6 X;  2A68 C;  3KJP A;  1N8R C;  1A8V A;  4QUF A;  1STG A;  1X3P A;  2NZ1 D;  2SOB A;  3R2I A;  2IT1 A;  1KTK A;  1EWH A;  2VS1 A;  2QW7 A;  2PMZ E;  5ELB A;  4O1N A;  4BS9 A;  3OW2 A;  4IUT A;  5AJ3 L;  1JIC A;  5DM6 3;  1STY A;  1TS2 A;  3CU7 A;  3KLW A;  3OIP A;  3K57 A;  1XYI A;  4Y7N H;  1PV4 A;  1R9T B;  3ERS X;  3L2P A;  3QO2 A;  4FP5 D;  1LTS D;  3TQY A;  1F2Y A;  1SNP A;  3STB D;  3TSS A;  1BBU A;  2CCZ A;  2JSO A;  1IBM Q;  2RSO A;  1G91 A;  1OXT A;  1F2M A;  3Q23 A;  1TS5 A;  1BCP B;  2GVB A;  4DV1 Q;  2BH8 A;  3QOL A;  4CJ0 B;  1A62 A;  3EN2 A;  4ME3 A;  1YJN A;  4G7Z C;  1I94 L;  1DJR D;  4GN5 A;  2X69 A; 
#chains in the Genus database with same CATH homology
 3J81 E;  1HUN A;  3R2T A;  5C0X I;  3VR4 A;  1GJX A;  2B2Y A;  5I4D A;  1V43 A;  3NQT A;  1O7L A;  4U67 3;  4K5X A;  4CGY B;  2WKD A;  3SEB A;  4XQQ A;  2PZU A;  5EPL A;  4XT1 B;  3NE5 B;  3WDN A;  1WTX A;  3HOY B;  1O78 A;  1HCZ A;  1GHJ A;  1I4H A;  1M8A A;  2E74 C;  4XDX A;  2N88 A;  3D4R A;  5JEA G;  4PMC A;  5IOD A;  3R3O A;  5D3I B;  4MIU A;  2NTT A;  1Q1E A;  4F8M A;  4QUC A;  1VF7 A;  2K5Q A;  2K7V A;  4HMJ A;  4H7B A;  1A2U A;  2C9O A;  1MBY A;  1CA5 A;  1HFN A;  3NTH A;  2F0Q A;  1TWC B;  2EJM A;  1JOQ A;  3QOJ A;  4EVO A;  1EIH A;  5CBE E;  3AMU A;  1EIG A;  1PMR A;  1K8O A;  1QG7 A;  4ZKB B;  3A7L A;  1Z6H A;  2KCC A;  4KHV A;  1TR5 A;  5JPM C;  2RBM A;  2B39 A;  5EBC A;  4XYQ A;  3PUY A;  3M4Y A;  3I4N B;  4EGV A;  3A8I E;  1Y1V B;  2BE5 C;  3TP5 A;  1EYC A;  5FLX L;  1EEI D;  2B2T C;  3S1M B;  3MZ5 A;  2A5H A;  4OO1 I;  2RDG A;  3E0J A;  3PV0 A;  1SSO A;  4KKS A;  3GTL B;  1CI3 M;  1EYD A;  1Y69 U;  3OWF A;  1IW7 D;  3FRP B;  2EYH A;  3RMH A;  2ICI A;  4EQN A;  2WAC A;  1VF5 C;  2L9H A;  2WII B;  5DAU A;  5JPN C;  2ZT9 C;  3H91 A;  3H09 A;  4C1N I;  3BS1 A;  1DCZ A;  2F0T A;  2XWB B;  2QCP X;  3GTJ B;  5KGU A;  2Q8I B;  2YYZ A;  4KHZ A;  4XT3 B;  5C0X H;  4IN3 A;  2EY2 A;  3I91 A;  1OO9 B;  4N9T A;  1SE3 A;  1STA A;  3NPP A;  2R92 B;  4IUN A;  1GXD C;  1Z47 A;  2FFK B;  3PO3 B;  2IJ0 A;  3BG3 A;  2A6E D;  1PRT B;  3O13 A;  1LTT D;  4KD4 A;  2XRS D;  4CJ1 B;  3GV3 A;  1SE4 A;  2FMC A;  3I4L A;  4L63 B;  1EYA A;  4KY5 A;  2CW0 C;  1V1O A;  4A3K B;  1EEF D;  5IGB A;  3FDT A;  3BDL A;  3M7N A;  3GV6 A;  3AU7 A;  5M3F B;  1A2T A;  1H9S A;  2B2W A;  5K36 H;  5DM7 3;  4PMW A;  5IGF A;  2EZV A;  3HKZ B;  4ZLT F;  2NN6 I;  3VYR A;  2R3Z A;  3NTI A;  2PW5 A;  5A2Q L;  1CHP D;  5EQ0 A;  4PNY A;  1OXX K;  3P75 A;  2K03 A;  4CKC A;  1DZ1 A;  2MUY A;  2FMM A;  1WD0 A;  5I9P A;  2H4O A;  2SNM A;  4FVM A;  1TY0 A;  4OO1 H;  1ET6 A;  2KED A;  2D5D A;  1Q8I A;  4NMZ A;  2AUJ D;  3MC0 B;  3S1R B;  4DN4 M;  1HUM A;  4EQO A;  3C1F A;  4J8Q A;  3W3A A;  1MSG A;  4R8I A;  4I7Z C;  3M7G A;  1PLF A;  3TZD A;  3FPP A;  1CQV A;  4KD3 A;  3M4O B;  2EJF C;  1U9R A;  3MFY A;  3MA2 B;  2CHB D;  4HED A;  2IW3 A;  4KV6 A;  3WOF A;  4DNT B;  2TSS A;  2DN8 A;  4IFD G;  2K28 A;  5C0X J;  1HA6 A;  4OL7 A;  1B9M A;  5CV8 A;  1WTR A;  3ERQ A;  4BY7 B;  1EY4 A;  4NP5 A;  3J7A F;  1JR0 D;  3D8G A;  1H9S B;  2KOL A;  2PO4 A;  3TP8 A;  4TKO B;  4DNR B;  3JAM L;  2F0N A;  3D4W A;  1MSH A;  4WRD A;  2AUK A;  1BCP D;  4K5W A;  3GD7 A;  1KLG D;  1Y1W B;  2EPB A;  5C4J B;  1F2Z A;  1LTB D;  2KEE A;  2F0E A;  2MP1 A;  1H9J A;  2PZW A;  3D4D A;  3OPO A;  5BN5 A;  3EA6 A;  1VDZ A;  1S4Z A;  5ELC A;  4JBW A;  4A3I B;  1AFP A;  3NBI A;  1JWU D;  5JVH 3;  1ROD A;  1LT5 D;  1XX8 A;  3CRK C;  3Q6S A;  1Q12 A;  2IX1 A;  2L5T A;  2CVR A;  2EY5 A;  2XNA C;  2R61 A;  2R93 B;  3NP8 A;  3URY A;  1S5B D;  2L12 A;  1Y8N B;  1T5E A;  4K8I A;  1LT6 D;  1SYC A;  5IGC A;  5M9O A;  2XWJ B;  2FHT A;  1BUV T;  2H1E A;  1YNN D;  2VNU D;  1ESF A;  5COY A;  1WTQ A;  4HTH A;  1O7Z A;  5ELE A;  4PQX A;  1RDP D;  1EQV A;  4C3I G;  2NVX B;  5EJW A;  1HPC A;  1BF4 A;  2PZT A;  2LS0 1;  3I8Z A;  2K32 A;  1CTM A;  2E76 C;  2JA8 B;  3S15 B;  2B2U C;  4LK1 C;  3E6Z X;  4DAP A;  3GTK B;  1PYW D;  3DEP A;  1O7Y A;  2PCF B;  1HQR D;  2QEJ C;  4L6T B;  1OXU A;  2RDF A;  4H44 C;  3PUX A;  5CV9 A;  5COR A;  4FF4 A;  2HCC A;  3EQL C;  5JJZ A;  3KBG A;  4Q0F A;  4ZQ3 A;  2F0K A;  1HHV A;  2NB0 A;  5LL6 S;  3SK4 A;  2V4D A;  1RCV D;  4FXG C;  4V19 0;  4FNF A;  3I3C A;  3IFD A;  2R6G A;  4G7H C;  1DOK A;  3T51 B;  1SNM A;  2E2H B;  3MXN A;  5CV7 A;  1ICW A;  1JCK B;  1X3Q A;  4MN3 A;  3HGB A;  1PZJ D;  3IKJ A;  1DXM A;  3HOU B;  2QF7 A;  1TT2 A;  1DD2 A;  1C8C A;  4GZY C;  2EY1 A;  3Q22 A;  4PMB A;  2WAQ B;  3FKI B;  1ENF A;  4E6I A;  2XN9 C;  1FNU A;  2XVS A;  3I70 A;  3DM1 A;  1JC7 A;  4G57 A;  3TN2 A;  4F87 A;  4KK7 A;  3OMG A;  1PRT C;  2BA1 A;  3A55 A;  2E2J B;  4F7X A;  1EQT A;  1SBB B;  3HOZ B;  5D14 A;  3S14 B;  4X3U A;  3P7J A;  5C5L A;  4A93 B;  5KYL A;  3SE0 A;  3G6J B;  3N6R A;  5I2X A;  1UEA B;  2D2C C;  1SMY D;  2L1B A;  1OXV A;  1QNU A;  4ZYS A;  4V0B A;  3S17 B;  1S5C D;  4ID6 A;  4NKL A;  1Y8P B;  5IGE A;  4RGN A;  1UAP A;  1G6Z A;  1B4O A;  2B8G A;  3SK6 A;  3CHB D;  2PW7 A;  1J8I A;  1SFO B;  4C3J G;  4KJO A;  1HFG A;  3IAY A;  2JA6 B;  4X3T A;  2XSC A;  4OHJ A;  4A3E B;  2QIL A;  5FK9 C;  1AN8 A;  2Z4I A;  1GUW A;  1PTO H;  2JA7 B;  2SNS A;  2OT2 A;  4DAY A;  3BZD B;  4RKB A;  3UI2 A;  3Q0A A;  1D2B A;  1RD9 D;  3E5S A;  3FPU B;  1PRT F;  2A69 D;  4RWS C;  4F88 A;  4IUP A;  3EVQ A;  4CHT B;  2E2I B;  1PXU A;  3J80 E;  1SYG A;  2A74 C;  1A6X A;  4FO2 A;  1GUS A;  4KY7 A;  5C0X G;  5IT9 E;  2F4I A;  1ZKO A;  3L3O C;  1DOM A;  2B2V A;  3BDC A;  1CZG A;  1JWS D;  4K2K A;  2RSN A;  1ENC A;  2F3W A;  4C3J B;  4ZUJ A;  5JOB A;  4RCO A;  3L7Z C;  5EKK A;  1EFI D;  1K83 B;  5KYI A;  5LHY 1;  3HOW B;  1IHZ A;  2HDM A;  5TSS A;  1VMP A;  3VYS A;  3K58 A;  1SYF A;  5BN3 A;  2DY8 A;  4DXF A;  3D3R A;  1ZYR D;  4YIJ A;  4P2C B;  3GTG B;  1RTO A;  4A3M B;  1SXT A;  4DF7 A;  1E0B A;  3P1H A;  4X3S A;  3VR3 A;  1IW7 C;  4A3B B;  4HR7 B;  4ZUI A;  1C48 A;  1KNE A;  3TDQ A;  4ULL A;  1ENA A;  3DWQ A;  2AQ3 B;  2XRQ D;  1ONL A;  2K33 A;  3PUW A;  3RUZ A;  1EY5 A;  1TU2 B;  3GTQ B;  2ID0 A;  2D62 A;  5JEA H;  2LY7 A;  4RCN A;  1EY8 A;  2EXZ A;  3D6C A;  4RKL A;  1GUT A;  5ISR A;  1HTL D;  3MXU A;  4C56 C;  3KLS X;  3KLR A;  4B9W A;  4BBS B;  4K14 A;  2IL8 A;  3OOC A;  3J7Y W;  3S2H B;  1RHP A;  1I4R A;  1HA5 A;  2KVM A;  5E3F A;  3NWS A;  1PDQ A;  2NWG A;  2JA5 B;  3MXG A;  1H9M A;  4CBV A;  1SE2 A;  2A6E C;  3SDZ A;  2F0O A;  2NVY B;  1VCI A;  2MHV A;  3OWE B;  1G29 1;  3TP6 A;  4BBR B;  1T5X D;  2MGS A;  2NUC A;  3S2D B;  1JOO A;  2WP8 J;  3HG9 A;  4DA2 A;  1F9S A;  4NW2 A;  3SXH A;  1BDO A;  4KJN A;  1R4P B;  2K01 A;  1HTP A;  4DGZ A;  5EPJ A;  5A35 A;  3DUZ A;  4KKU A;  1ML0 D;  2ICE C;  1ILQ A;  3A8K E;  3KK7 A;  4RFB A;  5D3D A;  4Q5V A;  5M5W B;  1V1P A;  1AEX A;  2DY7 A;  5CC4 A;  3KF8 A;  1C4Q A;  2ENB A;  5FO7 B;  2G9D A;  1YNJ D;  1G8Z D;  3H3V C;  1FGB D;  3K5O A;  2K1B A;  4H13 C;  4IUR A;  3NBH A;  1BBX C;  4ZAI A;  3CRL C;  1H9K A;  1LTR D;  1WCM B;  2F0J A;  1TY2 A;  2BDN A;  4H0L C;  3QG1 A;  3NWT A;  1BOS A;  5KEE A;  2I07 B;  1FR3 A;  5E1F A;  2B2T A;  1CK1 A;  2L0C A;  4J6H A;  5D65 A;  2NN6 G;  1BO0 A;  3C2P A;  4A3D B;  1GHK A;  2DNC A;  1D5M C;  1I3Q B;  5F2D A;  2KA7 A;  1PFB A;  5JEA J;  1EL0 A;  5CV4 A;  4DAV A;  5C4X B;  1L0Y B;  2F3V A;  1LLR D;  5FLX E;  3K5N A;  2HQE A;  4HSP A;  4A3G B;  4ABN A;  1U4R A;  2C5C A;  3MHB A;  2VB3 X;  4TSS A;  5C3E B;  5DNF A;  4CKB A;  1LAB A;  5I6W A;  3C1E A;  4K8J A;  5KRU A;  1KAA A;  4LAA A;  2J0T D;  3MVV A;  1E2W A;  1STN A;  3OSO A;  1NR2 A;  1BCP C;  3I90 A;  4XYO A;  1TWF B;  3MWY W;  3S9W A;  5C3X A;  1PTO D;  2AWN A;  2RVL A;  5G3L D;  4B9X A;  4RHR A;  1B50 A;  5FO8 B;  5J22 A;  1SAP A;  3PO2 B;  1HRJ A;  5E4W C;  4K5V A;  4C3H B;  1G2T A;  4EQP A;  2PMZ B;  1SEB D;  1V8Q A;  2TMP A;  1HXY D;  1QJO A;  3I4M B;  2E2D C;  1WTV A;  2M00 A;  3D31 A;  1JB3 A;  1F9Q A;  1DON A;  2HDL A;  3DXJ C;  1MD2 D;  3GTO B;  3MFG A;  1F2L A;  1FNV A;  1NUC A;  1YNN C;  1EY9 A;  2WB1 B;  4M8A A;  4HCE A;  4IFD H;  1STE A;  1TII D;  3SVM A;  3FVQ A;  5KNC A;  5EKI A;  5I9O A;  3GP7 A;  5EBD A;  2KEC A;  3J81 L;  3HOX B;  2Y0S B;  1LV9 A;  5A2Q E;  3ZYY X;  1BCP F;  1AZP A;  2X6L A;  1A3U A;  3T4A C;  1CHQ D;  1JQY D;  1DOL A;  2F0W A;  5G3L F;  1B53 A;  2EYJ A;  4Z9C B;  4U68 A;  4DXG A;  3SHL A;  3J7A V;  1H9R A;  2BDO A;  2B2Y C;  4K6L A;  2KQ3 A;  4QF4 A;  2EOT A;  4XIG S;  2F0G A;  3NQI A;  4M1U B;  2K04 A;  4IUU A;  2BCO A;  3J80 L;  1PZI D;  3FEW X;  4DK1 A;  2A6H D;  4FF3 A;  1F9R A;  5JVG 3;  2D9U A;  4DK0 A;  1S5E D;  5CV5 A;  2EY6 A;  4DU9 A;  3IFT A;  2B8F A;  1E2V A;  3MXP A;  2F0M A;  3NSW A;  5IGG A;  3NUC A;  2F0U A;  1U4P A;  4HCS A;  1QNK A;  3H6M A;  1SNC A;  4HAE A;  2Z1C A;  1TVX A;  1AZQ A;  2BA0 A;  2PNR C;  2B63 B;  1CT1 D;  4QCL A;  4ZKC B;  2EYP A;  3R93 A;  3I73 A;  4XXE A;  4HN7 A;  3H94 A;  1SYB A;  3RZD B;  1EY7 A;  4RHS A;  1SNQ A;  2IWH A;  1K8M A;  5HGT A;  2O5I C;  3VYU A;  2G9H D;  2ZXO A;  1GOZ A;  1SMY C;  1LAC A;  4CJ2 C;  1OXS C;  1U4M A;  1MI2 A;  2F0F A;  4A3J B;  4IFD J;  4NDX A;  4C1N K;  2J4X A;  1D1K A;  4XQN A;  3SK8 A;  4Y7N B;  1I4X A;  3QWN A;  1B9N A;  4FF1 A;  1IKM A;  1Q1B A;  3QB3 A;  4KN7 C;  1B2T A;  2JE6 I;  1KAB A;  3WOE A;  5IGD A;  4HMI A;  3DHQ A;  3K7A B;  1FD7 D;  5T1I A;  3X3M A;  1PZK D;  1EWC A;  3A54 A;  2A68 D;  3OHX C;  2OF1 A;  3X3N A;  2K6A A;  2BOS A;  5IOC A;  1I4G A;  5K5P A;  5BN4 A;  1QE6 A;  3TP7 A;  1L0X B;  2WIN B;  2IX3 A;  5M5Y B;  1ESR A;  3Q24 A;  1B44 D;  1AW7 A;  1PTO B;  2DNE A;  1XXG A;  1Y8O B;  2B2U A;  1RKN A;  5AFW A;  3SK5 A;  3DWP A;  4RAU C;  1JE4 A;  1SYE A;  5EKL A;  2EYL A;  3LWU A;  1A3V A;  4OIK A;  4UAI A;  2A69 C;  1CFM A;  4S3S A;  4TQU S;  3TBI B;  3H0G B;  5EPK A;  1GUO A;  1R4Q B;  5JAV A;  1EY6 A;  2JXM B;  1EOT A;  4FF2 A;  1TS3 A;  1BXT A;  2JEB I;  2LFN A;  5FO9 B;  5ELD A;  1EZ6 A;  2B2W C;  3VA7 A;  1WD1 A;  3A8J E;  2WKC A;  2J7Z A;  4O42 A;  4ILW A;  4A3F B;  1O80 A;  3MTS A;  1XTC D;  3L9A X;  4J1M A;  1STB A;  2FJ2 A;  2EJG C;  1KLU D;  3LX0 A;  3IL8 A;  5KIX A;  3GO5 A;  1DM0 B;  3LWE A;  4IUQ A;  1ZYR C;  5DEH A;  1NR4 A;  4RA8 A;  1QB5 D;  2F03 A;  1UUP A;  5C4Z A;  3KBX A;  2KUM A;  1E2Z A;  1S5F D;  3NXW A;  3VR2 A;  5K36 G;  2BE5 D;  5C3W A;  1WVL A;  4KI0 A;  5FOB B;  2F0D A;  2Q8T A;  4ME5 A;  3PUV A;  3F2U A;  4OIJ A;  1II3 A;  3RZO B;  1NSN S;  5C5M A;  2VUM B;  4ODG A;  1EZ8 A;  4B08 A;  3I72 A;  1SDF A;  1JWM D;  2ZXP A;  4QIW B;  3HOV B;  1LTG D;  4I65 A;  1B1Z A;  3AB9 A;  2E75 C;  3K0Y A;  2IX0 A;  3GTM B;  4OO1 G;  1LO5 D;  3ND9 A;  3DWA A;  1D1I A;  2NBF A;  3K5L A;  1W6J A;  2X6G A;  1SJH D;  4RH6 A;  3PIP 3;  1RF2 D;  5NUC A;  1A3T A;  5J39 A;  1KDB A;  3T56 B;  1RJT A;  5C44 B;  4G7O C;  1IYU A;  1IKL A;  5ELF A;  1CM9 A;  2Z4H A;  3PUZ A;  3A56 A;  1DYQ A;  3CKI B;  3DEO A;  1STH A;  3BDO A;  4WJW A;  3ND8 A;  3BVM A;  2NYZ D;  2OXP A;  1JOK A;  3V96 A;  2CW0 D;  2QKI C;  4WFN 3;  2AQ2 B;  4TRD A;  4K2L A;  1QWY A;  1I6V C;  1NAP A;  1YNJ C;  4CKE A;  2LKV A;  4XTC S;  4MHE A;  2YU9 B;  4ZRZ A;  4KY6 A;  1ZEQ X;  1I4P A;  4QMG A;  3ONA B;  1D5X C;  2K5D A;  5E4X A;  3W2D A;  2XIW A;  3EFX D;  2KCN A;  4IFD I;  1TKW B;  1U4L A;  1ZXT A;  1IL8 A;  3HRZ C;  2HUG A;  1TQO A;  3M3Y B;  2JYO A;  4C3H G;  3RLF A;  4X3K A;  1XWE A;  5HUR A;  4KMU C;  3HEJ A;  3HP3 A;  2FIN B;  1G2S A;  2SDF A;  5M5X B;  4R9W A;  2EYF A;  2EVB A;  2ZXR A;  3VYT A;  3QIA A;  3P20 A;  1KNA A;  1F77 A;  1AP0 A;  1LT3 D;  4JK1 C;  2NVQ B;  2K05 A;  2RA4 A;  3KUP A;  1I6H B;  2RQX A;  1HQM C;  5CR3 A;  1QIL A;  2O5J C;  4BY1 B;  4FXD A;  2L11 A;  2F0P A;  1W6K A;  4KN4 C;  1KDC A;  3KLS A;  4IZ8 A;  4XQJ A;  1V1P B;  3VR6 A;  3BYT B;  1TS4 A;  5CGK A;  1BR9 A;  1PTO C;  3K6O A;  3BVZ A;  1ILP A;  4G4K A;  3T13 A;  4UDU C;  1D5Z C;  2A73 B;  5KNB A;  3U9S A;  1I50 B;  1SYD A;  1Z7T A;  2PQE A;  5C6A A;  1S5D D;  3M85 A;  5KND A;  2WV6 D;  4FYD A;  3N52 A;  3A7A B;  2VXW A;  5FKA C;  1CA6 A;  1PFM A;  1IYV A;  3VR5 A;  2F0V A;  3T53 B;  4C2M B;  4DFA A;  4BA1 I;  1TWA B;  1LTI D;  3OMC A;  1X32 A;  2HCI A;  3BYY B;  1JOR A;  1SND A;  3VA5 A;  3HZX A;  5IIF A;  1BQQ T;  2NN6 H;  2Z8L A;  3D6W A;  3K5M A;  2L55 A;  1KDA A;  4KTA A;  4IAL A;  2K5W A;  2RDH A;  4N9P A;  4LJZ C;  4R8N A;  1QOH A;  2L4N A;  5T1G A;  4AYB B;  2I46 A;  2EYM A;  5CBA E;  1LT4 D;  1D6E C;  1PFN A;  3NK9 A;  3C46 A;  3NHH A;  2VB2 X;  1TWH B;  3EJI A;  4PV1 C;  5EGT A;  2AWO A;  4FXK C;  5I6Y A;  3C3L A;  1MGS A;  1FYC A;  1QCB D;  2EYO A;  4QB4 A;  1EU3 A;  3T16 A;  4RGT A;  1LTA D;  3HS0 C;  3S16 B;  2JEA I;  2F0L A;  1PTO F;  3TZU A;  1RTN A;  3ITP A;  2RKS A;  1F9P A;  4IQZ A;  2EDG A;  3BVG A;  5I2Y A;  3SR1 A;  1UNS A;  2NTS A;  3G7L A;  1NCV A;  1SJE D;  1Q90 A;  5J1Z A;  2O4X A;  4HSV A;  3S1Q B;  3V05 A;  2A6H C;  2F0H A;  5CYU A;  2F0S A;  2LMC B;  2F1M A;  4OGQ C;  2O2L D;  2JP1 A;  4L8J A;  1CZW A;  3TME A;  5IT9 L;  2Q8R E;  3NTK A;  1WTW A;  2AQ1 B;  2IPK D;  3S1N B;  3V2T A;  3DMU A;  1J9O A;  4BWG B;  5CV6 A;  1ET9 A;  2KJX A;  3MAQ A;  2CQA A;  5CMD A;  2MPM A;  3K59 A;  1A15 A;  1B3A A;  1Q3L A;  2QDB A;  2M2L A;  1VMC A;  4RGO S;  4LMQ D;  4RGM A;  1CQF A;  2MJ8 A;  4WOR A;  3FMC A;  3MEH A;  2N55 A;  4C3I B;  2B2V C;  1SNO A;  1GUG A;  3ERO A;  2R7Z B;  2M9V A;  3JAM E;  3QJY A;  5M3M B;  3RD4 A;  3GTP B;  1EU4 A;  1TWG B;  2OEO A;  2KHS A;  3PMF A;  3LNN A;  2GA4 B;  2SEB D;  5C4H A;  1WTO A;  1PRT D;  1GUN A;  4IUV A;  1WTP A;  2EE1 A;  1BNZ A;  2F0I A;  3R8B A;  4BA2 I;  1EY0 A;  4ZK9 B;  3PIO 3;  3OIQ A;  2PYK A;  1M4V A;  4K6D A;  1FNW A;  3CQZ B;  2NVT B;  1I4Q A;  4KKT A;  3OW7 A;  3GQB A;  2PPB C;  3U9O A;  5LL6 X;  2A68 C;  4QUF A;  1STG A;  1X3P A;  2NZ1 D;  2SOB A;  3R2I A;  2IT1 A;  1KTK A;  1EWH A;  5ELB A;  4O1N A;  4BS9 A;  4IUT A;  1JIC A;  5DM6 3;  1STY A;  1TS2 A;  3CU7 A;  3OIP A;  3K57 A;  1XYI A;  1R9T B;  3QO2 A;  4FP5 D;  1LTS D;  1F2Y A;  1SNP A;  3TSS A;  2JSO A;  2RSO A;  1G91 A;  1OXT A;  1F2M A;  3Q23 A;  1TS5 A;  1BCP B;  3QOL A;  4CJ0 B;  4G7Z C;  1DJR D;  2X69 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...