1HTPA

Refined structures at 2 angstroms and 2.2 angstroms of the two forms of the h-protein, a lipoamide-containing protein of the glycine decarboxylase complex
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
131
structure length
131
Chain Sequence
b'SNVLDGLKYAPSHEWVKHEGSVATIGITDHAQDHLGEVVFVELPEPGVSVTKGKGFGAVESVKATSDVNSPISGEVIEVNTGLTGKPGLINSSPYEDGWMIKIKPTSPDELESLLGAKEYTKFCEEEDAAH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-PROTEIN
publication title The lipoamide arm in the glycine decarboxylase complex is not freely swinging.
pubmed doi rcsb
source organism Pisum sativum
molecule tags Oxidoreductases(acting on ch-nh2 donor)
total genus 35
structure length 131
sequence length 131
ec nomenclature ec 1.4.4.2: Glycine dehydrogenase (aminomethyl-transferring).
pdb deposition date 1995-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01597 GCV_H Glycine cleavage H-protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1htpA00
3MFYA 1OXTA 3I73A 1E2WA 3VA7A 2DNEA 1V8QA 2EDGA 4I7ZC 1OXXK 2DNCA 3QG1A 4LK1C 5JEAG 1LABA 4XTCS 1GUOA 5JEAH 1CTMA 1G291 1Y8NB 4DNTB 1V43A 4OGQC 2O5IC 2L5TA 3OPOA 4OO1H 1LACA 2AUJD 2B8GA 5C0XH 4TQUS 1Y8PB 3FMCA 1ZKOA 2BDOA 2EJFC 2E75C 2EJMA 3D31A 4HR7B 4JBWA 5KNDA 2A6ED 1Y8OB 1E2ZA 3PUYA 2E74C 1GUNA 1OXVA 3OW7A 1EWHA 1CI3M 1VCIA 2PCFB 3A8IE 3CRLC 1Q12A 2D62A 3DXJC 1TKWB 1VDZA 3SE0A 4JK1C 2Q8IB 2PPBC 2EVBA 2NN6H 1TU2B 1GUSA 2BA1A 3A8KE 2A6EC 1FYCA 3OOCA 1DXMA 1IYUA 1VF5C 3I4LA 3IFTA 4PV1C 4RCNA 1OXUA 2K33A 1K8OA 3H94A 3L7ZC 1DCZA 4L8JA 4KI0A 3RLFA 3PUVA 3T53B 5BN3A 3HGBA 3EQLC 4KMUC 3U9SA 4IQZA 2O5JC 2F1MA 1Q1BA 2JXMB 2ZT9C 4DNRB 2NN6I 3A7LA 1IW7D 2PNRC 1H9MA 1B9NA 2KA7A 1BDOA 2A69C 1E2VA 3MXUA 4H13C 1GUTA 2DN8A 2AWOA 3GQBA 1GHKA 1PMRA 3VR4A 5BN4A 4KN4C 2IT1A 4GZYC 1IW7C 4DK0A 5KNCA 4IFDH 2E76C 3ND8A 4KN7C 4G7ZC 2AUKA 1CFMA 3GD7A 2BE5D 3M85A 3QIAA 1GUGA 1ONLA 2K7VA 3D4RA 4H0LC 3TZUA 5BN5A 4G7HC 3BDOA 3VR3A 3VR5A 2A6HD 3M7NA 1ZYRC 1HCZA 3T51B 1GJXA 4IFDG 1O7LA 3I72A 1B9MA 2A69D 1VF7A 2BE5C 5A35A 1OXSC 3PUWA 3CRKC 1K8MA 4KKSA 2R6GA 1H9SB 2A6HC 3P20A 5K36G 1Q90A 4G7OC 1QJOA 1HPCA 3IKJA 1SMYC 2V4DA 3KLRA 3N6RA 3NE5B 5K36H 1I6VC 3SDZA 3PV0A 2CW0C 3A7AB 3PUXA 1A6XA 1YNNC 1T5EA 1H9JA 1Q1EA 2YYZA 1YNJC 1H9KA 4KKUA 2EJGC 3W3AA 5KNBA 2B8FA 1IYVA 2LMCB 3M4YA 1HQMC 2A68D 4OO1G 3FPPA 1HTPA 3LWUA 5C0XG 2K32A 1DD2A 2KCCA 1GHJA 4BA1I 1H9SA 2D2CC 1Z7TA 2JE6I 3AB9A 3BG3A 3T56B 4DK1A 2A68C 4KKTA 3VR2A 3LNNA 3PUZA 2JEAI 1O78A 2JEBI 3WDNA 2QF7A 4LJZC 2D5DA 4XIGS 3A8JE 4BA2I 1H9RA 4H44C 1Y69U 1Z6HA 3VR6A 2NN6G 4TKOB 2BA0A 1FR3A 3ND9A 3QJYA 4KHZA
chains in the Genus database with same CATH superfamily
3GV3A 2B63H 3JAML 3K7AB 1HA6A 2ZXOA 3BYYB 1HNZQ 4GKJQ 3DWQA 5J39A 5BR8L 1CTMA 1X32A 1NTGA 1SNPA 4A3JH 5C44G 2B8GA 4DR7L 4IZ8A 1S5ED 1A62A 1KAAA 2A6ED 1HZAA 3UE1A 3L3OC 1NSNS 2VUMG 2Q2TA 3H0GG 2D62A 1HQRD 3OW2A 3K7AH 1I4PA 1FYCA 1PRTF 3FVQA 3PIP3 4OWWB 3I4MB 5JJLA 1QVCA 2OTLA 4F7XA 2A8VA 4DXFA 1V1QA 5BN3A 1B3QA 4JI5Q 4IQZA 3GTQB 3RLOA 1TWCB 4LMQD 2F0JA 4POFA 2JA6H 4DV2L 4FO2A 3IL8A 4RG1A 4TSSA 4DV1Q 4JI7L 4FF2A 3ICEA 3GTGH 2L55A 4A3KB 1MKHA 3S2HB 1SNQA 1C4QA 3M4OH 4M8AA 2QEJC 1CFMA 1A0IA 3U50C 5JAVA 1PH6A 4POGA 3QIAA 3JC66 2WKCA 4RKBA 3RN2A 3RR5A 3GTQH 1O7LA 3K5OA 3NWSA 5IGCA 1CA6A 2AKWB 1LT5D 1XTDA 1YJ9A 4IFDI 5M3MB 2R61A 2PMZB 3X3MA 2ZJRA 3PQIA 5GROA 1D8LA 4A3IB 1FGUA 4DR2Q 2CW0C 3A7AB 1ENFA 2K5VA 3KF8B 4E6IA 4UP9A 2ES2A 2Q2HA 4OONA 3UDGA 4RH6A 4ID6A 1PRTC 1G6ZA 3FPPA 4KTAA 2HIXA 2KBNA 2KCCA 3HOXB 4J8QA 1KC8C 2PMZE 4KJOA 3E3XA 3L9AX 3S1MB 2D5DA 5DM63 1I4RA 1TY0A 3UE0A 1UUPA 3MFYA 2EOTA 2DNEA 1V8QA 1VQKA 1EY4A 1AW7A 5I6WA 5IYCG 1X3FA 2M00A 1G291 4IPGA 3SK8A 4DPGA 3SR1A 1TWGB 1YZ6A 1X65A 5C0XH 1G2SA 1V1PB 2UUAQ 4KHPL 1VQ7A 5IYBH 1EIFA 1PZID 2KHIA 2PZWA 1TT2A 3B6YA 5LMUQ 5A2QE 1I50B 3GTLH 1FGBD 4IFDG 3JAME 4RA8A 3SE0A 3M3YH 1SFOB 2XRQD 3J80c 3NPPA 3RN5A 3IFTA 2UXCQ 2F0OA 1OXUA 2X69A 1NJIC 2HQLA 4GKKL 1SLJA 1DCZA 4G4KA 2R92H 4IJHA 2H4OA 4A3DB 2DY8A 4MTNA 4OO1G 2WFWA 4B9XA 3CPFA 1PH8A 1IW7D 3HEJA 1I50H 1B9NA 1XMQL 1HUNA 5EBCA 3Q23A 2XVSA 1SFOH 4HIKA 1TR5A 4HSVA 5BN4A 4R4IA 4DK0A 1Q8IA 3NXWA 1STHA 4PQXA 1S40A 2JYOA 2F0DA 4R8NA 1WCMB 4BBRH 4RGMA 3HOVG 1FJGL 5M5WB 3M7NA 2A6HD 3D6CA 5IP9G 3R3OA 3SK6A 3I4OA 1KXLA 1F2MA 3L2PA 4KKSA 3U4VA 2F0NA 4CBVA 1SSOA 4C3JB 3ER0A 5FO8B 1XNRQ 4IUNA 4TRDA 1N33L 2KECA 4K6LA 2XWBB 1H9JA 3K5MA 3H6MA 1E0BA 2XSCA 4XT1B 1N32Q 1WCMH 1X56A 2RDGA 4BY1G 2JP1A 4BXXH 1HTPA 3F2CA 1KDAA 4B3SL 1XTCD 4LUOA 1XPUA 5D3IB 4DAVA 2JE6I 1Z7TA 3PIOA 3HOUH 1K83H 4B3TQ 2CW0D 1YHBA 2ZM6L 1XYIA 1UE6A 3T1YL 1Q86C 3C3LA 1J5EQ 2NVQB 1Y1VG 4X66L 1CKMA 1F2ZA 5FJ8H 4LNQA 4I7ZC 3O13A 4DAYA 2DNCA 1TWHB 4M1UB 1NR4A 3BS1A 4A3EG 2UU9L 1CKNA 2R3ZA 5JOBA 4NW2A 3W1GA 3OTOL 5C3WA 2L5TA 4JI0L 1T5XD 1BCPB 4JPBW 2L0CA 5G3LF 3UDIA 2BDOA 1STAA 2C35B 3KUPA 2NVQH 3MEFA 2EE1A 4A3FG 4GOPB 2BCOA 1L0WA 4JG2A 2NVXH 3PO2B 3F2UA 3K81C 3A8KE 1TWHH 2L15A 4IFDJ 1N9WA 3CCJA 2K1BA 2NVYB 5KGUA 3P75A 4L8JA 1PH3A 1D1IA 2EY6A 3N52A 3T53B 3HGBA 2DJFC 2F0EA 4JCVE 3GP7A 3BZDB 2LS01 2VZAA 4DNRB 1VQ4A 4FVMA 4NXNQ 1MHWC 1JB3A 1F77A 5COYA 3PO3B 1STGA 1GUTA 2Y0SB 3PO2H 1JORA 4KJNA 1WOCA 2PQAB 2WB1B 3J81L 3K59A 2FJ2A 5IWAQ 4O0AA 4KN7C 3I3CA 3RNUA 1E7ZA 4AIMA 3S14B 1A2UA 3S1RB 3A74A 3FDTA 4C3IG 5FLMG 3OMCA 3X3NA 1E3PA 3DMUA 3TBIB 3TS0A 4BY7H 3PO3H 3KDFB 3S1QH 5ELCA 2I0QA 4YY3Q 2NZHA 2WB1E 2R93H 2E5LL 4IO9A 2X6LA 1KQSA 2YYZA 3H0GB 4DV5Q 4XDXA 4WFN3 4RGNA 1QG7A 4DR5L 3S1RH 1HQMC 1STYA 3E6ZX 1OO9B 1B4OA 2WINB 3M7GA 1VMPA 4GNXB 2KCMA 3EROA 3R8BA 1IKLA 1HR0L 3LNNA 4EQNA 1ESFA 2NVTB 3PSIA 1I94Q 2K4KA 4C2MB 2B29A 2WAQG 3STBD 4A3MG 2BA0A 3ND9A 3I73A 3QB3A 4R4TA 4LF8Q 3G7LA 1EWIA 3CCSA 3GV6A 5IGFA 1STEA 4NMZA 1PZKD 4EQPA 1Y8NB 1XWEA 2J0TD 4ZQ3A 4K5WA 1CQVA 1VMCA 5KYLA 3H3VI 4V0BA 1GVPA 3TEHB 3K7UC 2QEXA 2VQFQ 3KOJA 4RHRA 1I5FA 5EKKA 2ICEC 5C4XH 2Q8IB 1O7ZA 2B2TC 2PPBC 2F4VQ 2N49A 3FRPB 2QDBA 1LTLA 2MHVA 5C0XI 2EZVA 3P7JA 1EQRA 3QO2A 3CC2A 3WOFA 3I4NH 4WJ4A 1SE3A 1A3UA 3S15B 1U5KA 4DF7A 4B3RL 3RLFA 2V1CC 4X3KA 5EBDA 2NWGA 2Z4IA 1LTRD 1SXTA 4N8X1 4OHJA 3TS2A 1HTLD 2IPKD 3OMGA 4DR3L 3A56A 3A7LA 3GTKH 2PNRC 4ZUIA 5M3FH 2RA4A 1EYGA 1U4PA 4CDEC 4CJ2C 3T1HQ 1I6HB 2PZUA 4OIKA 3MWYW 1VQBA 2VQEL 3S15H 1PH1A 4A3GB 4X6AH 5CR3A 2TMPA 4IUVA 1NUCA 3I91A 3VR5A 1I4HA 3HOZH 2B2UC 3CC4A 1A63A 3U4ZA 4HIOA 3PMFA 1IBLL 4BBSH 4A3LH 1T9HA 1LM0A 4BWGB 3S17B 1EQQA 1YNND 4NP5A 1Q90A 5T1GA 1VQMA 3J81E 4DV7Q 1R4QB 1BQQT 5D3DA 5KRUA 1YNJC 1LYLA 4KKUA 3W3AA 3CW2C 4A3GH 1XNQQ 2R7ZB 5E1FA 5C0XG 3JAMc 4R4OA 1V1OA 4JI1L 2EYPA 1BXTA 3UI2A 3S17H 1HZBA 4I7AA 1MI2A 1KL9A 3CQZH 1WD1A 2A73B 3HP3A 2I46A 5HGQA 4X64Q 4LUVA 1D2BA 3CCLA 4DV0L 3A54A 2A5HA 1EFID 3BYTB 5JEAG 2R7ZH 2RHSB 2R92G 2JA5B 1YITA 1K0RA 1Y14B 1PA6A 3BVMA 1UE5A 4GLAC 1ENAA 5C4ZA 1D5ZC 1VQAA 1WI5A 4AQYQ 3HOVB 1EY5A 3CCQA 3DWPA 2WP8J 3VYSA 1JCKB 4JBKA 1CHPD 3OW7A 4DA2A 4L6TB 1CI3M 2SNMA 3G6JB 4GLVB 5C5LA 4DK6C 5EKLA 4TVAB 1NMFA 3BU2A 2A6EC 5ELBA 5EKIA 2HCIA 2JA5H 4PV1C 1NAPA 2XGTA 2E2IB 4DXGA 3RZDH 4BY1B 2A74C 3F2DA 3S16B 4IN3A 1SROA 4YCWA 3VA5A 1L1OB 1IHZA 3D0FA 3KBGA 1DONA 1XPOA 4HMIA 1BUVT 2M9VA 1O7IA 3ZYYX 2BDNA 1SE4A 3HZXA 3GTJH 4KN4C 4IPCA 4FF1A 2ATWA 1NR2A 1CK1A 2MNAA 3ULPA 3TREA 1B7YB 5I2YA 4A75A 1BOSA 5CV4A 5CV7A 4LF5L 3S16H 3VR3A 3AYHB 4QQBX 5C5MA 3NQIA 4LAAA 3ZJYC 5CGKA 1XPRA 4G7OC 1QJOA 4JV5Q 1JC7A 5FJ8G 1AP0A 3K58A 4A3FB 5C3EH 2EPBA 1EIYB 2EJGC 1Q46A 3J7AF 2PZTA 4DV1L 2RCFA 2K32A 3D6WA 2RSNA 2OQKA 4J1MA 5C0XJ 3BVZA 5CV5A 3NTIA 4EX5A 1O78A 4FXDA 1HNWQ 2H1EA 4IALA 2K14A 1Z6HA 1IXRA 3IFDA 1CHQD 1Q3LA 1WVLA 1VQOA 3LGJA 1EY0A 4X3SA 1MSHA 4DR2L 4LFCQ 1JJGA 1ML0D 4PMBA 4KY6A 5DM73 3PIPA 3T13A 1GOZA 1Y1WB 1HR0W 4C56C 3VYUA 4C3IB 1ILPA 4QL5A 2EYJA 4ZRZA 1BBUA 1LT3D 4JOIA 2BOSA 1Y8OB 1E2ZA 1W6JA 4YCUA 2Q8RE 1PTOB 1GUNA 2SDFA 4JOIC 1MGSA 2F0LA 1MSGA 5EPKA 1Q82C 1NMGA 1K8GA 4A3BG 4JI3Q 1JICA 1UE1A 2VNUD 2EYHA 1TXYA 4HJAA 1EU3A 3DWAA 1Y1WH 5M5YH 3RD4A 5FO9B 2GA4B 4RFBA 3DUZA 4C3HH 3HKSA 2JQOA 3U9SA 1LTID 1B53A 3QWNA 1BDOA 1PTOH 3C1FA 3TMEA 1EOTA 2F4IA 1K28A 4JI2Q 1TQOA 2RSOA 3S2DB 4LFAQ 2UUAL 2IT1A 1IW7C 4A3MB 5LMNQ 2E76C 5LMUL 3FKIG 2OXPA 3D3RA 3GD7A 4B3MQ 3HOWG 5IGEA 1SDFA 4OELB 1U4MA 4JYAQ 4IOAA 3I72A 2UXCL 5CV8A 2VY3A 5CC4A 2F0GA 3TRZA 5K36G 2A6HC 2EYMA 2F3WA 3KF8A 3C46A 1PH5A 3E9IA 2Q8TA 3NWTA 4HCEA 2WAQE 4ZCKA 3W5OA 5JVH3 2CCZA 4K5XA 2NTSA 3SXHA 3I4MH 2K6AA 3UDXA 2F0VA 2G9HD 4GLXA 1F9RA 4X62L 1WJJA 4HIDA 2XWJB 1PFMA 1KD1C 3NQTA 1G8ZD 1TWCH 2K04A 4MHEA 2HHHQ 2CQAA 4IPDA 1G51A 4K5VA 5C4XG 4H44C 2RDFA 5ELOA 3Q0AA 1S3OA 2UUCQ 1PYWD 1G6PA 4A3KH 3A5ZB 4YHHQ 3VA7A 2B2YC 3S2HH 3I4NG 5AJ3L 1XNRL 2FFKB 1X9NA 4WORA 1VQ5A 2ICIA 4DNTB 1WD0A 1CA5A 1HA5A 1PTOD 1N32L 5HURA 1RTOA 4S3SA 1V9PA 2EY1A 4A93B 3F8TA 1C9OA 4GN3B 4APVA 5M3MH 1WTWA 4A3IH 3PUYA 2C5CA 5D65A 1QUQA 4X65Q 2PCFB 4PZ8A 4B3TL 1ESRA 3Q22A 4PZ6A 1X54A 2MJ8A 1VF5C 3I4LA 1Q8KA 1J5EL 3J81c 2I5HA 3HOXH 4BBSG 2OWOA 4A93H 2F1MA 1XX8A 4P74A 2Z0SA 3S1MH 3CU7A 3NELA 2UUBQ 5E7NA 5IGGA 3Q24A 1C7YA 2E2DC 1QZGA 1UWVA 4B9WA 1FD7D 1CZWA 3K0XA 2YTXA 1DOLA 4DR7Q 2Q2IA 4QF4A 3R2TA 1YVCA 1IBKQ 1BCPF 2BE5D 4ODGA 3NSWA 3H91A 5CV6A 1TWGH 2K5NA 1EUJA 5EGTA 3HOYG 1SMYD 3C1EA 1AZQA 1A3VA 4DGZA 5JJKA 1ENCA 1KNAA 4JC0A 1SYGA 4OL7A 1U4LA 4A3CG 3PV0A 4CJ0B 2JA7B 4HIMA 5CYUA 5KYIA 1B8AA 4NXNL 1EU4A 2N55A 3PF4A 5CBAE 4P2CB 3LWUA 3URYA 5LMNW 4DUYL 4CGYB 4DUZQ 5IWAL 4A3DH 5IP7G 4BA1I 2FXQA 4RHSA 4DV2Q 4WJWA 4QCLA 4JI7Q 4ZAIA 2MGSA 4Y52H 3PCOB 3VYRA 1WTXA 4PMWA 2JA7H 5GQOA 3CCMA 4HJ5A 1I3QB 2GVBA 1E1OA 1RF2D 1A8VA 2LY7A 4LK1C 3STBC 1JE5A 2Q2UA 5IYDG 1BCPC 5M5WH 2F0HA 4DV5L 1EZ6A 3IRBA 4OO1H 4ZYSA 5J3BA 1WYDA 1Y8PB 1BO0A 2FMMA 1YNXA 2IJ0A 1RDPD 3KYHC 5ELEA 4GOPC 4C3JH 2DJGC 1I3QH 4LFBL 1SNCA 1K8OA 1SR3A 5ISRA 1FNUA 1DOMA 4J6HA 1SYDA 4X3TA 1IYUA 2FMCA 5ELFA 2ZTCA 4P73A 1N34L 1KDBA 1X3GA 2WV6D 4FXKC 3M4QA 4KMUC 1JOQA 2ZT9C 1II3A 3PF5A 4O42A 3CMEA 1CSQA 1NE3A 3DM1A 4H13C 4R9WA 1CUKA 1U9RA 1ET6A 3HFZB 3VR4A 5GAEC 1PYBA 3ULLA 2YU9B 3LX0A 1CKOA 3RMHA 2VQFL 1D5MC 4JI6Q 2JA8G 1LT6D 1ONLA 2B2VA 2F4VL 1STBA 3NEMA 5BN5A 3KDFA 1VQDA 1HCZA 2IW3A 4MN3A 2P5ZX 2B2VC 3IAYA 4HSPA 3CCRA 4DV4Q 1VQJA 4QJFA 1VQ9A 1TVXA 3PUWA 1P16A 3K80C 2R6GA 4LF6L 2HCCA 1B3AA 2RCNA 2E2HB 1WFQA 1I6VC 3NENA 1YNNC 2D9UA 4K2KA 1YJNA 1GXDC 1Q1EA 2KCTA 4UAIA 1KLGD 2NVYH 4OX9L 3I70A 4GNXC 1AH9A 4DAYB 1H9SA 1CKNB 1VS0A 4KKTA 2L11A 5C44B 1K3BC 4RMFA 2OQ0A 1PH2A 3VR6A 2B63G 2UXDQ 1JOOA 2VUMB 1E2WA 1ZXTA 4Y7NB 4K0KQ 3KF6B 1YI2A 1KNEA 4RCOA 4DV7L 1UE7A 3S14H 3T16A 4A3JG 1ILQA 3FKIB 3HOWB 1E1TA 2E2JB 1AE2A 3VYTA 2QDLA 4OIJA 5C44H 1XNQL 1BKBA 4HJ9A 4QUCA 1WTQA 2EJMA 2EXZA 2K5WA 3D31A 2QW7A 4OWTB 2I5MX 3V05A 4DAMA 1B50A 3CCVA 2VUMH 1QCBD 2DY7A 2I5LX 3H0GH 4L5SA 1BCPD 2VS1A 2PO4A 1DXMA 4DR6Q 4X64L 2E2JH 2KEDA 4KI0A 2YTVA 2Z9HA 2L4NA 2GN5A 1JB7A 1GKHA 3FPUB 2NVTH 2JA6G 2CWAA 4C2MH 4NXMQ 1Z9FA 4AQYL 2B2TA 4YIJA 4RGOS 4ABNA 3OTOQ 4DFAA 1C8CA 1ZYRD 4UP7A 3L0OA 5DNFA 4RAUC 2K28A 1IYJB 2N8NA 2J4XA 2QKIC 1PYSB 4CDFC 2KEEA 1QNUA 3T51B 2NZ1D 1IL8A 1HUMA 3FHWA 2K03A 1K8MA 4LF9Q 5CORA 1GUWA 3I2ZA 3NE5B 2MFIA 3KLSX 1A6XA 3NBHB 1T5EA 1WTPA 1BVSA 5KNBA 4DNIA 1J8IA 5IT9L 4JI8Q 2YTYA 4DR4L 1YBYA 2B2UA 4A76A 1UEAB 1EYCA 1K73C 5M3MG 2AHOB 4FNFA 4HCSA 2UXBQ 1F9SA 4XIGS 3A8JE 1F2YA 4UPAA 5H1SE 1EQTA 1UAPA 2IX0A 1DZ1A 1I6HH 1SEBD 5E4WC 3MXNB 1CZGA 4JV5L 1L0XB 5T1IA 1QVFA 3JAMi 1ZEQX 2AQ1B 3AFQA 4RGTA 2ZXRA 1K0SA 5FOBB 1PVOA 1RIPA 3AU7A 5I4DA 2DUDA 2N78A 5IYBG 1O7YA 3HG9A 1LTGD 2KENA 2SEBD 1EEID 3HOYB 3BZCA 1PHJA 5E3FA 5JJIA 4EQ5A 1VCIA 3A8IE 1R9TB 1VDZA 1HNWL 2NN6H 4OO1I 5GAGC 1GUSA 2OCEA 2EYLA 1EOVA 2B3GA 1TS3A 1EY9A 1RCVD 4LF7Q 3H94A 3FEWX 4KHVA 3TP8A 1L1OC 3HKZG 4MNOA 2B2WC 1VQIA 1ET9A 4LFCL 2O5JC 3MAQA 4K14A 2JXMB 4KD4A 4LF4Q 1R4PB 3SGIA 1BBXC 2AWOA 4GZYC 1HNXQ 4JBMA 2IWHA 2OEOA 3S1NB 4BBRG 2KCNA 4DAPA 4JBJA 3GTMB 2ENBA 1CM9A 1I4GA 1HHVA 3HOVH 5IP9H 4JI3L 1VF7A 2VL6A 1GD7A 2R7DA 5E4XA 1OXSC 1HNZL 3CRKC 5FO7B 1PTOF 1SJED 1SNOA 1IBMQ 4GKJL 3P20A 1G91A 5ELNA 1LUZA 5C3XA 5M9OA 3I56A 1PH7A 1SMXA 5EPJA 4B3RQ 1WCMG 1PFBA 5EPLA 3RLNA 1Y1VB 3S1NH 4BXXG 1DGSA 4JI2L 3F2BA 2LMCB 3CCEA 3SHLA 1JQYD 2A68D 3M4YA 4DR3Q 4H7BA 2E2IH 1SYBA 2F03A 4BY1H 4UY8C 4R4QA 3GTMH 5LMNL 4A3EB 3HOUG 1QE6A 1EYDA 4MTKA 1DM0B 2HT1A 2K5DA 5FK9C 4B3ML 3D4WA 3OHXC 1KTKA 3CAMA 2F52A 4CKEA 5KEEA 3WDNA 1WTRA 4JI5L 2WACA 5IT9E 4L5QA 4XYQA 1PLFA 3EBEA 1JT8A 1IZ6A 1Y1VH 4O1NA 1TS5A 1SYFA 3G48A 3TZDA 2RF4A 2EDGA 3K5NA 5NUCA 3BDCA 2FHTA 3D4DA 4A3EH 2JA8B 4N9TA 4OGQC 1PH4A 1SNMA 4PMCA 1A3TA 1NNXA 4LW1A 4K2LA 5LL6X 3FMCA 4PG3A 2BH8A 4DV3Q 4JBWA 1PTOC 2VXWA 3RZOB 1TWFB 1LTSD 4P75A 4AYBG 4C1NI 2JSOA 2MO1A 1EWHA 1M4VA 1WTOA 4A3FH 4JI4Q 2HHHL 1F9PA 3J7ZC 5IODA 4JI1Q 1S5FD 2JK8A 3MC0B 1EEFD 4V190 2X6GA 1J6QA 2N88A 4YHHL 4KY5A 4QY7A 1VQ8A 2HUGA 2TSSA 2NZOA 2VB3X 3MHBA 1I4QA 4XQNA 3TSSA 4ZKCB 1TWFH 4GN4B 3V96A 4IJLA 4KLKA 3PO2G 2Z4HA 2O2LD 1BNZA 2F0QA 1GHKA 1D1KA 4DV6Q 1HZCA 3SVMA 5I9OA 2B63B 5FLXL 1KABA 2PYKA 2J7ZA 3EFXD 4X65L 1Q7YC 1GUGA 4H0LC 3TZUA 1VQ6A 3BDOA 3WOEA 4A3JB 2CVRA 4C3IH 4GS3A 1B9MA 3E0JA 2BE5C 5FLMH 4BY7G 4IUTA 2D0OA 3PO3G 1BR9A 2LFNA 2Y0SG 2SOBA 2R93G 4IPHA 1SMYC 2PI2E 2K50A 5A2QL 4F88A 2AWNA 5TSSA 1JMCA 1N8RC 2WAQB 3I90A 2UUBL 2B8FA 3M9BA 5GAHC 5M5XB 3KFUA 1PV4A 4G57A 4IUUA 5FKAC 2WIIB 5IE8A 1VQEA 4EGVA 1IBKL 3CXCA 5IGDA 3PUZA 4DR1Q 4NB3A 5I6YA 4JW0A 4R4CA 3TQYA 3KLSA 1FVIA 2JA6B 3S2DH 1KHIA 3PGZA 1K8AC 4A3MH 2A1AA 4N8FA 4LF5Q 3GTGB 4OEMB 3OWEB 2IHEA 2EYFA 3SK4A 1C0AA 2RVLA 5M5XH 3M4OB 1LABA 4XTCS 2CQOA 1RHPA 1AE3A 2K05A 5D14A 1G2TA 4ZKBB 1S5CD 3AEVA 1L2FA 3NK9A 3BZKA 4NDXA 2HDLA 3U58A 1HFNA 1ZKOA 1PFSA 5IIFA 1F2LA 3HRZC 2E75C 4DUZL 2EY2A 5KNDA 3MA2B 3TDQA 3H3VC 2NBFA 2B2YA 3I7FA 2A19A 2EVBA 1YHQA 2BA1A 3OOCA 2CWPA 2MP1A 3CHBD 1PH9A 1JWUD 1LO5D 1X55A 1V1PA 3FP9A 4XQQA 2R7FA 4Q0FA 2DGYA 4Z9CB 1ASZA 3PUVA 4OWXB 1W6KA 3V2TA 1HH2P 1SAPA 1Q1BA 3K5LA 2NN6I 5M3FG 1PXUA 1N36Q 1FL0A 2A69C 1E2VA 1VQNA 3ERSX 1EY7A 5DAUA 1SYEA 1TS4A 1PMRA 1EY6A 5EAYA 3EIVA 3MEHA 2RKSA 2HD3A 2L12A 4HTHA 5C4HA 3H09A 5IY0A 3J81i 1XMOQ 2B39A 2K7VA 3HOZG 2D0PA 4A4IA 4KY7A 4ULLA 4A3LG 2PW5A 5A35A 4P72A 4NKLA 3WWVA 1HPCA 2F0PA 3IKJA 2V4DA 1LTAD 3KLRA 3N6RA 3GTLB 3SDZA 3H3VH 4ALPA 5FLXE 5BR8Q 5L37A 3M3YB 1EFWA 4A3GG 2LXJA 2G5DA 3J80i 1KAWA 1UNSA 3NHHA 1I4XA 1STNA 2M2LA 1DOKA 1PRTB 1SE8A 2F0SA 2R92B 2QILA 4DK1A 5CMDA 4JI6L 5DLQE 2CH4A 3HKZB 1AFPA 2KHJA 1OTCA 1CSPA 4BA2I 4BS9A 4CHTB 2NN6G 4DV4L 4HMJA 2HQEA 4XQJA 5K5PA 4CDCC 2L1BA 2R7ZG 3Q6SA 4FF3A 2C9OA 1QUQB 3CCUA 1OXXK 2AQ3B 3W2DA 5I2XA 2VB2X 5JEAH 2EY5A 1LTBD 1LT4D 4BBRB 3QR8A 1JJ2A 4UP8A 2SNSA 3A55A 2AUJD 3HKZE 4ME5A 1QNKA 4LUZA 4RWSC 2XIWA 4HR7B 4XXEA 5LL6S 2JJQA 3MXGA 3KLWA 4X62Q 3KBXA 2CKZB 2ID0A 2JA5G 5GADC 4YY3L 1RJTA 2UXDL 4CDDC 4WRDA 4K0KL 2YV5A 4YWLA 4QIWB 1QZHA 1X3PA 3NTKA 3HOUB 3OSOA 2CFMA 1K83B 3MXPA 4GOPA 3G71A 1TIID 3ITPA 1HFGA 5AJ3Q 1XJVA 2OF1A 3Q8DA 2MUYA 2H5XA 2ZJQA 1I94L 1SN8A 4QIWE 5IT9c 1JR0D 1ZYRC 2Z6BA 1DYQA 4AH6A 4DR6L 1X3QA 2A69D 4LF8L 4KD3A 4UHVA 4ZK9B 1GM5A 4OXPA 2K5HA 2PQAA 3E0EA 3MVVA 1VQPA 4YCVA 1QB5D 3TP5A 1MD2D 2IHFA 1WTHA 5C3EG 1PRTD 4AYBB 1S5DD 2NVXB 1B1ZA 4IURA 3T4AC 4NXML 2GVAA 1KDCA 1L0YB 4MZ9A 4KHPQ 1K9MC 1GHJA 4IUQA 2PNHA 3NP8A 4K8IA 2E8GA 2HIVA 1MIUA 2NUCA 4K8JA 3W1BA 5JVG3 4LWCA 4QB4A 2JEAI 1Z47A 2Z1CA 4J15A 1YHAA 2LKVA 2K52A 4AYBE 3KF6A 1EZ8A 1Y69U 3ERQA 2RHQB 3KJPA 3VDYA 4GKKQ 4KHZA 2YU9H 4LF9L 2F0FA 3OWFA 2EXDA 4N9PA 3LWEA 4CJ1B 5JJZA 4GNXA 1TWAB 1KRSA 3PIO3 1GUOA 4A3BB 1XXGA 3T1HL 3DEPA 1A15A 1EIHA 1DJRD 2F0KA 4FP5D 2BH2A 4QGUA 1XMQQ 2F3IA 3A0JA 2Z6KA 1D6EC 3E9HA 1H95A 2G9DA 4TQUS 4JI8L 3R93A 4IUPA 2NYZD 2Z6KC 1QILA 4BY7B 1JWMD 4U673 2E2HH 3S1QB 3UDFA 2ZTDA 2E74C 4QMGA 2L9HA 3BDLA 2R93B 3SK5A 1BBWA 1NBWA 4DUYQ 2UXBL 4JK1C 4ZUJA 4HJ7A 1FJGQ 3TP6A 3MTSA 1TWAH 3J7YW 3QOJA 4A3BH 1KIXA 2EIFA 1YJWA 1Y1WG 3L7ZC 1J9OA 2I07B 4C3HG 5AFWA 1YIJA 1S72A 4B08A 5F2DA 1ICFB 1N33Q 4R8IA 1U0LA 3BJUA 3A5UA 2KVMA 2Y0SE 1H9MA 4PZ7A 4HAEA 2KA7A 3GDEA 3H15A 3P1HA 4FF4A 1P8LA 3MXUA 2QA4A 5J22A 1PDQA 2QGQA 3J80L 5IGBA 4Y7NH 2LSSA 4B3SQ 1O80A 2KHSA 4H02A 3ND8A 3OYYA 1JWSD 2AUKA 5JPMC 3FKIH 5LHY1 1VQHA 1S5BD 4F8MA 3C2PA 3HOWH 2ZM6Q 4HJ8A 5CV9A 3CC7A 3K6OA 3T1YQ 1TY2A 5KIXA 4LFBQ 5C4JB 3ONAB 4HN7A 4LF7L 3NBHA 1JE4A 4X66Q 1W2BA 1UEBA 1H9SB 1LLRD 1KLUD 1MJEA 5K36H 2F3VA 1VQCA 2CH4W 4FDBA 1EIGA 2UU9Q 1N34Q 5C4XB 4LF4L 1YEZA 2IX1A 3I4MG 4JI0Q 3D8GA 3AFPA 1B2TA 3EJIA 3KJOA 2MO0A 3M4PA 3J81j 3I4NB 1DD2A 1EWCA 1HNXL 3E5SA 3G6EA 5C4JH 1SRUA 3AB9A 3BG3A 5J1ZA 2A68C 2EYOA 2ALYB 3MXNA 4FYDA 1HXYD 3GTKB 4DKAC 2F0MA 1H9RA 5M3FB 4A3KG 2OT2A 1B44D 1IBML 1M8AA 1OXTA 1D7QA 2Z8LA 2F0WA 4ZLTF 2NTTA 4L5TA 3MZ5A 2XTIA 4DN4M 5I9PA 4LF6Q 1LV9A 3I8ZA 5IOCA 1IKMA 4PNYA 3S9WA 2NB0A 3OPOA 3J7A5 1LACA 1NY4A 1RL2A 3HOZB 1AEXA 5ELDA 4BBSB 4UDUC 3R2IA 2EJFC 1B70B 1RD9D 3J7AV 4A3IG 1EY8A 3TN2A 5EQ0A 3AQQA 4OX9Q 1OXVA 3S24A 1TS2A 2IY5B 2ZTEA 1CQFA 3DEOA 5DEHA 1S4ZA 3GTPB 4NPSA 2MPMA 1F9QA 4F87A 1ICWA 4RCNA 3EA6A 3HS0C 3HOXG 5IYCH 2VW9A 5FLXc 2K01A 2O4XA 1AN8A 4A93G 3TP7A 2E5LQ 1RTNA 4FXGC 2IL8A 3CQZB 1MJCA 4YWMA 2DN8A 4DR5Q 4JVZA 1SBBB 1FNVA 4DV3L 3GTPH 4IFDH 4R1JA 3DLLA 1SYCA 3G4SA 1HR0Q 1VQGA 2JA9A 4JI4L 3M85A 5G3LD 1L1OA 3CF5A 2B2WA 2K5QA 2AMCB 1FNWA 3AMUA 3HOYH 1D5XC 2PQEA 1M90C 2FINB 3J80E 2RBMA 1R9TH 3CMAA 3QOLA 1C48A 4A3CH 3KK7A 1EQVA 5HGTA 1X6OA 3F1ZA 4A3DG 4DV6L 4RKLA 3RZDB 4LFAL 3K0YA 2D2CC 3T56B 5IP7H 3VR2A 5EJWA 4P71A 2JA7G 4K6DA 2QF7A 4ME3A 1QOHA 4ILWA 2IX3A 2AQ2B 4O2DA 2QCPX 4TKOB 1FR3A 4DK3C 3I55A 3GTJB 1HZ9A 2KUMA 1AZPA 1EYAA 3GO5A 2MQHA 3DM3A 2LXKA 2JN4A 2RDHA 1V43A 4GN5A 4I65A 2O5IC 5IYDH 3BVGA 1Q81C 4L5RC 3CD6A 4KV6A 1E24A 1A2TA 4C3JG 4EVOA 2VQEQ 2XN9C 4IOCA 4DR4Q 1VQFA 3QG1A 4JYAL 4EQOA 3DXJC 3EVQA 2KJXA 3CRLC 1Q12A 1TKWB 4DR1L 1SE2A 5HY6A 1M1KC 1E22A 3K57A 1TU2B 5C3EB 1U4RA 1IL2A 1PZJD 1RKNA 2F0UA 1WTVA 1ASYA 1IBLQ 1QVGA 5CBEE 2EQSA 2HDMA 3CP0A 1HJPA 1VQLA 2K33A 1K3RA 5JPNC 1GO3E 1PFNA 2N3SA 3U9OA 4U68A 4DU9A 2CHBD 3EQLC 1JOKA 2OTJA 1CT1D 1NCVA 3SEBA 2PI2A 1HRJA 3GQBA 4MIUA 4QUFA 2F0IA 3CKIB 2PW7A 5KNCA 1QWYA 4XYOA 4XT3B 1SJHD 2K75A 4G7ZC 3MFGA 2KOLA 2UUCL 2JA8H 3D4RA 1JJCB 2XNAC 4G7HC 4WJ3M 2ASBA 3K8AA 2RQXA 1KRTA 3GTOB 1GJXA 2XRSD 4Q5VA 1LTTD 3DHQA 4DV0Q 1YNJD 3RZOH 2KQ3A 1BF4A 1W3SA 1MBYA 3OIQA 3PUXA 3ULJA 4L63B 2F0TA 4CKCA 2ZJPA 1H9KA 5C6AA 3CPWA 1N36L 3OIPA 4CKBA 1IYVA 1X3EA 3NUCA 1SNDA 2WKDA 4KK7A 2ZXPA 5JEAJ 3NTHA 3GTOH 1EL0A 3NBIA 5M5YB 4YWKA 4C3HB 1XMOL 3EN2A 3RUZA 4C1NK 2JEBI 4HEDA 4LJZC 2WB1G 4X3UA 1RODA 3QJYA
chains in the Genus database with same CATH topology
3GV3A 3JAML 3K7AB 1HA6A 2ZXOA 3BYYB 3DWQA 5J39A 1CTMA 1X32A 1SNPA 2B8GA 4IZ8A 1S5ED 1KAAA 2A6ED 3L3OC 1NSNS 2D62A 1HQRD 1I4PA 1FYCA 1PRTF 3FVQA 3PIP3 3I4MB 4F7XA 4DXFA 5BN3A 4IQZA 3GTQB 1TWCB 4LMQD 2F0JA 4FO2A 3IL8A 4TSSA 4FF2A 2L55A 4A3KB 3S2HB 1SNQA 1C4QA 4M8AA 2QEJC 1CFMA 5JAVA 3QIAA 2WKCA 4RKBA 1O7LA 3K5OA 3NWSA 5IGCA 1CA6A 1LT5D 4IFDI 5M3MB 2R61A 2PMZB 3X3MA 4A3IB 2CW0C 3A7AB 1ENFA 4E6IA 4RH6A 4ID6A 1PRTC 1G6ZA 3FPPA 4KTAA 2KCCA 3HOXB 4J8QA 4KJOA 3L9AX 3S1MB 2D5DA 5DM63 1I4RA 1TY0A 1UUPA 3MFYA 2EOTA 2DNEA 1V8QA 1EY4A 1AW7A 5I6WA 2M00A 1G291 3SK8A 3SR1A 1TWGB 5C0XH 1G2SA 1V1PB 1PZID 2PZWA 1TT2A 5A2QE 1I50B 1FGBD 4IFDG 3JAME 4RA8A 3SE0A 1SFOB 2XRQD 3NPPA 3IFTA 2F0OA 1OXUA 2X69A 1DCZA 4G4KA 2H4OA 4A3DB 2DY8A 4B9XA 1IW7D 3HEJA 1B9NA 1HUNA 5EBCA 3Q23A 2XVSA 1TR5A 4HSVA 5BN4A 4DK0A 1Q8IA 3NXWA 1STHA 4PQXA 2JYOA 2F0DA 4R8NA 1WCMB 4RGMA 5M5WB 3M7NA 2A6HD 3D6CA 3R3OA 3SK6A 1F2MA 4KKSA 2F0NA 4CBVA 1SSOA 4C3JB 5FO8B 4IUNA 4TRDA 2KECA 4K6LA 2XWBB 1H9JA 3K5MA 3H6MA 1E0BA 2XSCA 4XT1B 2RDGA 2JP1A 1HTPA 1KDAA 1XTCD 5D3IB 4DAVA 2JE6I 1Z7TA 2CW0D 1XYIA 3C3LA 2NVQB 1F2ZA 4I7ZC 3O13A 4DAYA 2DNCA 1TWHB 4M1UB 1NR4A 3BS1A 2R3ZA 5JOBA 4NW2A 5C3WA 2L5TA 1T5XD 1BCPB 2L0CA 5G3LF 2BDOA 1STAA 3KUPA 2EE1A 2BCOA 3PO2B 3F2UA 3A8KE 4IFDJ 2K1BA 2NVYB 5KGUA 3P75A 4L8JA 1D1IA 2EY6A 3N52A 3T53B 3HGBA 2F0EA 3GP7A 3BZDB 2LS01 4DNRB 4FVMA 1JB3A 1F77A 5COYA 3PO3B 1STGA 1GUTA 2Y0SB 1JORA 4KJNA 3J81L 2WB1B 3K59A 2FJ2A 4KN7C 3I3CA 3S14B 1A2UA 3S1RB 3FDTA 4C3IG 3OMCA 3X3NA 3DMUA 3TBIB 5ELCA 2X6LA 2YYZA 3H0GB 4XDXA 4WFN3 4RGNA 1QG7A 1HQMC 1STYA 3E6ZX 1OO9B 1B4OA 2WINB 3M7GA 1VMPA 3EROA 3R8BA 1IKLA 3LNNA 4EQNA 1ESFA 2NVTB 4C2MB 2BA0A 3ND9A 3I73A 3QB3A 3G7LA 3GV6A 5IGFA 1STEA 4NMZA 1PZKD 4EQPA 1Y8NB 1XWEA 2J0TD 4ZQ3A 4K5WA 1CQVA 1VMCA 5KYLA 4V0BA 4RHRA 5EKKA 2ICEC 2Q8IB 1O7ZA 2B2TC 2PPBC 2QDBA 3FRPB 2MHVA 5C0XI 2EZVA 3P7JA 3QO2A 3WOFA 1SE3A 1A3UA 3S15B 4DF7A 3RLFA 5EBDA 4X3KA 2NWGA 2Z4IA 1LTRD 1SXTA 4OHJA 1HTLD 2IPKD 3OMGA 3A56A 3A7LA 2PNRC 4ZUIA 2RA4A 1U4PA 4CJ2C 1I6HB 2PZUA 4OIKA 3MWYW 4A3GB 5CR3A 2TMPA 4IUVA 1NUCA 3I91A 3VR5A 1I4HA 2B2UC 3PMFA 4BWGB 3S17B 1YNND 4NP5A 1Q90A 5T1GA 3J81E 1R4QB 1BQQT 5D3DA 5KRUA 1YNJC 4KKUA 3W3AA 2R7ZB 5E1FA 5C0XG 1V1OA 2EYPA 1BXTA 3UI2A 1MI2A 1WD1A 2A73B 3HP3A 2I46A 1D2BA 3A54A 2A5HA 1EFID 3BYTB 5JEAG 2JA5B 3BVMA 1ENAA 5C4ZA 1D5ZC 3HOVB 1EY5A 3DWPA 2WP8J 3VYSA 1JCKB 1CHPD 3OW7A 4DA2A 4L6TB 1CI3M 2SNMA 3G6JB 5C5LA 5EKLA 2A6EC 5ELBA 5EKIA 2HCIA 4PV1C 1NAPA 2E2IB 4DXGA 4BY1B 2A74C 3S16B 4IN3A 3VA5A 1IHZA 3KBGA 1DONA 4HMIA 1BUVT 2M9VA 3ZYYX 2BDNA 1SE4A 3HZXA 4FF1A 4KN4C 1NR2A 1CK1A 5I2YA 1BOSA 5CV4A 5CV7A 3VR3A 5C5MA 3NQIA 4LAAA 5CGKA 4G7OC 1QJOA 1JC7A 1AP0A 3K58A 4A3FB 2EPBA 2EJGC 3J7AF 2PZTA 2K32A 3D6WA 2RSNA 4J1MA 5C0XJ 3BVZA 5CV5A 3NTIA 4FXDA 1O78A 2H1EA 4IALA 1Z6HA 3IFDA 1CHQD 1Q3LA 1WVLA 1EY0A 4X3SA 1MSHA 1ML0D 4PMBA 4KY6A 5DM73 3T13A 1GOZA 1Y1WB 4C56C 3VYUA 4C3IB 1ILPA 2EYJA 4ZRZA 1LT3D 2BOSA 1Y8OB 1E2ZA 1W6JA 2Q8RE 1PTOB 1GUNA 2SDFA 1MGSA 2F0LA 1MSGA 5EPKA 1JICA 2VNUD 2EYHA 1EU3A 3DWAA 3RD4A 5FO9B 2GA4B 4RFBA 3DUZA 3U9SA 1LTID 1B53A 3QWNA 1BDOA 1PTOH 3C1FA 3TMEA 1EOTA 2F4IA 1TQOA 2RSOA 3S2DB 2IT1A 1IW7C 4A3MB 2E76C 2OXPA 3D3RA 3GD7A 5IGEA 1SDFA 1U4MA 3I72A 5CV8A 5CC4A 2F0GA 5K36G 2A6HC 2EYMA 2F3WA 3KF8A 3C46A 2Q8TA 3NWTA 4HCEA 5JVH3 4K5XA 2NTSA 3SXHA 2K6AA 2F0VA 2G9HD 1F9RA 2XWJB 1PFMA 3NQTA 1G8ZD 2K04A 4MHEA 2CQAA 4K5VA 4H44C 2RDFA 3Q0AA 1PYWD 3VA7A 2B2YC 2FFKB 4WORA 2ICIA 4DNTB 1WD0A 1CA5A 1HA5A 1PTOD 5HURA 1RTOA 4S3SA 2EY1A 4A93B 1WTWA 3PUYA 2C5CA 5D65A 2PCFB 1ESRA 3Q22A 2MJ8A 1VF5C 3I4LA 2F1MA 1XX8A 3CU7A 5IGGA 3Q24A 2E2DC 4B9WA 1FD7D 1CZWA 1DOLA 4QF4A 3R2TA 1BCPF 2BE5D 4ODGA 3NSWA 3H91A 5CV6A 5EGTA 1SMYD 3C1EA 1AZQA 1A3VA 4DGZA 1ENCA 1KNAA 1SYGA 4OL7A 1U4LA 3PV0A 4CJ0B 2JA7B 5CYUA 5KYIA 1EU4A 2N55A 5CBAE 4P2CB 3LWUA 3URYA 4CGYB 4BA1I 4RHSA 4WJWA 4QCLA 4ZAIA 2MGSA 3VYRA 1WTXA 4PMWA 1I3QB 1RF2D 2LY7A 4LK1C 1BCPC 2F0HA 1EZ6A 4OO1H 4ZYSA 1Y8PB 1BO0A 2FMMA 2IJ0A 1RDPD 5ELEA 1SNCA 1K8OA 5ISRA 1FNUA 1DOMA 4J6HA 1SYDA 4X3TA 1IYUA 2FMCA 5ELFA 1KDBA 2WV6D 4FXKC 4KMUC 1JOQA 2ZT9C 1II3A 4O42A 3DM1A 4H13C 4R9WA 1U9RA 1ET6A 3VR4A 2YU9B 3LX0A 3RMHA 1D5MC 1LT6D 1ONLA 2B2VA 1STBA 5BN5A 2IW3A 1HCZA 4MN3A 2B2VC 3IAYA 4HSPA 1TVXA 3PUWA 2R6GA 2HCCA 1B3AA 2E2HB 1I6VC 1YNNC 2D9UA 4K2KA 1GXDC 1Q1EA 4UAIA 1KLGD 3I70A 1H9SA 4KKTA 2L11A 5C44B 3VR6A 1JOOA 2VUMB 1E2WA 1ZXTA 4Y7NB 1KNEA 4RCOA 3T16A 1ILQA 3FKIB 3HOWB 2E2JB 3VYTA 4OIJA 4QUCA 1WTQA 2EJMA 2EXZA 2K5WA 3D31A 3V05A 1B50A 1QCBD 2DY7A 1BCPD 2PO4A 1DXMA 2KEDA 4KI0A 2L4NA 3FPUB 2B2TA 4YIJA 4RGOS 4ABNA 4DFAA 1C8CA 1ZYRD 5DNFA 4RAUC 2K28A 2J4XA 2QKIC 2KEEA 1QNUA 3T51B 2NZ1D 1IL8A 1HUMA 2K03A 1K8MA 5CORA 1GUWA 3NE5B 3KLSX 1A6XA 1T5EA 1WTPA 5KNBA 1J8IA 5IT9L 2B2UA 1UEAB 1EYCA 4FNFA 4HCSA 1F9SA 4XIGS 3A8JE 1F2YA 1EQTA 1UAPA 2IX0A 1DZ1A 1SEBD 5E4WC 1CZGA 1L0XB 5T1IA 1ZEQX 2AQ1B 4RGTA 2ZXRA 5FOBB 3AU7A 5I4DA 1O7YA 3HG9A 1LTGD 2SEBD 1EEID 3HOYB 5E3FA 1VCIA 3A8IE 1R9TB 1VDZA 2NN6H 4OO1I 1GUSA 2EYLA 1TS3A 1EY9A 1RCVD 3H94A 3FEWX 4KHVA 3TP8A 2B2WC 1ET9A 2O5JC 3MAQA 4K14A 2JXMB 4KD4A 1R4PB 1BBXC 2AWOA 4GZYC 2IWHA 2OEOA 3S1NB 4DAPA 2KCNA 3GTMB 2ENBA 1CM9A 1I4GA 1HHVA 1VF7A 5E4XA 1OXSC 3CRKC 5FO7B 1PTOF 1SJED 1SNOA 3P20A 1G91A 5C3XA 5M9OA 5EPJA 1PFBA 5EPLA 1Y1VB 2LMCB 3SHLA 1JQYD 2A68D 3M4YA 4OO1G 4H7BA 1SYBA 2F03A 4A3EB 1QE6A 1EYDA 1DM0B 2K5DA 5FK9C 3D4WA 3OHXC 1KTKA 5KEEA 4CKEA 3WDNA 1WTRA 2WACA 5IT9E 4XYQA 1PLFA 3TZDA 4O1NA 1TS5A 1SYFA 3K5NA 2EDGA 5NUCA 3BDCA 2FHTA 3D4DA 2JA8B 4N9TA 4OGQC 1SNMA 4PMCA 1A3TA 4K2LA 5LL6X 3FMCA 4JBWA 1PTOC 2VXWA 3RZOB 1TWFB 1LTSD 4C1NI 2JSOA 1WTOA 1EWHA 1M4VA 1F9PA 5IODA 1S5FD 3MC0B 1EEFD 4V190 2X6GA 2N88A 4KY5A 2HUGA 2TSSA 2VB3X 3MHBA 1I4QA 4XQNA 3TSSA 4ZKCB 3V96A 2Z4HA 2O2LD 1BNZA 2F0QA 1GHKA 1D1KA 3SVMA 5I9OA 2B63B 5FLXL 1KABA 2PYKA 2J7ZA 3EFXD 1GUGA 4H0LC 3TZUA 3BDOA 3WOEA 4A3JB 2CVRA 1B9MA 3E0JA 2BE5C 4IUTA 1BR9A 2LFNA 2SOBA 1SMYC 5A2QL 4F88A 2AWNA 5TSSA 2WAQB 3I90A 2B8FA 5M5XB 4G57A 4IUUA 5FKAC 2WIIB 4EGVA 5IGDA 3PUZA 5I6YA 3KLSA 2JA6B 3GTGB 3OWEB 3SK4A 2EYFA 2RVLA 3M4OB 1LABA 4XTCS 1RHPA 2K05A 5D14A 1G2TA 4ZKBB 1S5CD 3NK9A 4NDXA 2HDLA 1HFNA 1ZKOA 5IIFA 1F2LA 3HRZC 2E75C 2EY2A 5KNDA 3MA2B 3TDQA 3H3VC 2NBFA 2B2YA 2EVBA 2BA1A 3OOCA 2MP1A 3CHBD 1JWUD 1LO5D 1V1PA 4XQQA 4Q0FA 4Z9CB 3PUVA 1W6KA 3V2TA 1SAPA 1Q1BA 3K5LA 2NN6I 1PXUA 2A69C 1E2VA 1EY7A 5DAUA 1SYEA 1TS4A 1PMRA 1EY6A 3MEHA 2RKSA 2L12A 4HTHA 5C4HA 3H09A 2B39A 2K7VA 4KY7A 4ULLA 2PW5A 5A35A 4NKLA 1HPCA 2F0PA 3IKJA 2V4DA 1LTAD 3KLRA 3N6RA 3GTLB 3SDZA 5FLXE 3M3YB 1UNSA 3NHHA 1I4XA 1STNA 2M2LA 1DOKA 1PRTB 2F0SA 2R92B 2QILA 4DK1A 5CMDA 3HKZB 1AFPA 4BA2I 4BS9A 4CHTB 2NN6G 4HMJA 2HQEA 4XQJA 5K5PA 2L1BA 3Q6SA 4FF3A 2C9OA 1OXXK 2AQ3B 3W2DA 5I2XA 2VB2X 5JEAH 2EY5A 1LTBD 1LT4D 4BBRB 2SNSA 3A55A 2AUJD 4ME5A 1QNKA 4RWSC 2XIWA 4HR7B 4XXEA 5LL6S 3MXGA 3KBXA 2ID0A 1RJTA 4WRDA 4QIWB 1X3PA 3NTKA 3HOUB 3OSOA 1K83B 3MXPA 1TIID 3ITPA 1HFGA 2OF1A 2MUYA 1JR0D 1ZYRC 1DYQA 1X3QA 2A69D 4KD3A 4ZK9B 3MVVA 1QB5D 3TP5A 1MD2D 1PRTD 4AYBB 1S5DD 2NVXB 1B1ZA 4IURA 3T4AC 1KDCA 1L0YB 1GHJA 4IUQA 3NP8A 4K8IA 4K8JA 2NUCA 5JVG3 4QB4A 2JEAI 1Z47A 2Z1CA 2LKVA 1EZ8A 1Y69U 3ERQA 4KHZA 2F0FA 3OWFA 4CJ1B 4N9PA 3LWEA 5JJZA 1TWAB 3PIO3 1GUOA 4A3BB 1XXGA 3DEPA 1A15A 1EIHA 1DJRD 2F0KA 4FP5D 1D6EC 2G9DA 4TQUS 3R93A 4IUPA 2NYZD 1QILA 4BY7B 1JWMD 4U673 3S1QB 2E74C 4QMGA 2L9HA 3BDLA 2R93B 3SK5A 4JK1C 4ZUJA 3TP6A 3MTSA 3J7YW 3QOJA 3L7ZC 1J9OA 2I07B 4C3HG 5AFWA 4B08A 5F2DA 4R8IA 2KVMA 1H9MA 4FF4A 4HAEA 2KA7A 3P1HA 3MXUA 5J22A 1PDQA 3J80L 5IGBA 1O80A 2KHSA 3ND8A 1JWSD 2AUKA 5JPMC 5LHY1 3C2PA 1S5BD 4F8MA 5CV9A 3K6OA 1TY2A 5KIXA 5C4JB 3ONAB 4HN7A 3NBHA 1JE4A 1H9SB 1LLRD 1KLUD 5K36H 2F3VA 1EIGA 5C4XB 2IX1A 3D8GA 1B2TA 3EJIA 3I4NB 1DD2A 1EWCA 3E5SA 3AB9A 3BG3A 5J1ZA 2A68C 2EYOA 3MXNA 4FYDA 1HXYD 3GTKB 2F0MA 1H9RA 5M3FB 2OT2A 1B44D 1M8AA 1OXTA 2Z8LA 2F0WA 4ZLTF 2NTTA 3MZ5A 4DN4M 5I9PA 5IOCA 1LV9A 3I8ZA 1IKMA 4PNYA 3S9WA 2NB0A 3OPOA 1LACA 3HOZB 1AEXA 5ELDA 4BBSB 4UDUC 3R2IA 2EJFC 3J7AV 1RD9D 1EY8A 3TN2A 5EQ0A 1OXVA 1TS2A 1CQFA 3DEOA 5DEHA 1S4ZA 3GTPB 2MPMA 1F9QA 4F87A 1ICWA 4RCNA 3EA6A 3HS0C 2K01A 2O4XA 1AN8A 3TP7A 1RTNA 4FXGC 2IL8A 3CQZB 2DN8A 1SBBB 1FNVA 4IFDH 1SYCA 3M85A 5G3LD 2B2WA 2K5QA 1FNWA 3AMUA 1D5XC 2PQEA 2FINB 3J80E 2RBMA 3QOLA 1C48A 3KK7A 1EQVA 5HGTA 4RKLA 3RZDB 3K0YA 2D2CC 3T56B 3VR2A 5EJWA 4K6DA 2QF7A 1QOHA 4ILWA 2IX3A 2AQ2B 2QCPX 4TKOB 1FR3A 3GTJB 2KUMA 1AZPA 1EYAA 3GO5A 2RDHA 1V43A 4I65A 2O5IC 3BVGA 4KV6A 1A2TA 4C3JG 4EVOA 2XN9C 3QG1A 4EQOA 3DXJC 2KJXA 3CRLC 3EVQA 1Q12A 1TKWB 1SE2A 3K57A 1TU2B 5C3EB 1U4RA 1PZJD 1RKNA 2F0UA 1WTVA 5CBEE 2HDMA 2K33A 5JPNC 1PFNA 3U9OA 4U68A 4DU9A 2CHBD 3EQLC 1JOKA 1CT1D 1NCVA 3SEBA 1HRJA 3GQBA 4MIUA 4QUFA 2F0IA 3CKIB 2PW7A 5KNCA 1QWYA 4XYOA 4XT3B 1SJHD 4G7ZC 3MFGA 2KOLA 3D4RA 2XNAC 4G7HC 2RQXA 3GTOB 1GJXA 2XRSD 4Q5VA 1LTTD 3DHQA 1YNJD 2KQ3A 1BF4A 3OIQA 1MBYA 3PUXA 4L63B 2F0TA 4CKCA 1H9KA 5C6AA 3OIPA 4CKBA 1IYVA 3NUCA 1SNDA 2WKDA 4KK7A 2ZXPA 5JEAJ 3NTHA 1EL0A 3NBIA 5M5YB 4C3HB 3RUZA 4C1NK 2JEBI 4HEDA 4LJZC 4X3UA 1RODA 3QJYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MFY A;  1OXT A;  3I73 A;  1E2W A;  3VA7 A;  2DNE A;  1V8Q A;  2EDG A;  4I7Z C;  1OXX K;  2DNC A;  3QG1 A;  4LK1 C;  5JEA G;  1LAB A;  4XTC S;  1GUO A;  5JEA H;  1CTM A;  1G29 1;  1Y8N B;  4DNT B;  1V43 A;  4OGQ C;  2O5I C;  2L5T A;  3OPO A;  4OO1 H;  1LAC A;  2AUJ D;  2B8G A;  5C0X H;  4TQU S;  1Y8P B;  3FMC A;  1ZKO A;  2BDO A;  2EJF C;  2E75 C;  2EJM A;  3D31 A;  4HR7 B;  4JBW A;  5KND A;  2A6E D;  1Y8O B;  1E2Z A;  3PUY A;  2E74 C;  1GUN A;  1OXV A;  3OW7 A;  1EWH A;  1CI3 M;  1VCI A;  2PCF B;  3A8I E;  3CRL C;  1Q12 A;  2D62 A;  3DXJ C;  1TKW B;  1VDZ A;  3SE0 A;  4JK1 C;  2Q8I B;  2PPB C;  2EVB A;  2NN6 H;  1TU2 B;  1GUS A;  2BA1 A;  3A8K E;  2A6E C;  1FYC A;  3OOC A;  1DXM A;  1IYU A;  1VF5 C;  3I4L A;  3IFT A;  4PV1 C;  4RCN A;  1OXU A;  2K33 A;  1K8O A;  3H94 A;  3L7Z C;  1DCZ A;  4L8J A;  4KI0 A;  3RLF A;  3PUV A;  3T53 B;  5BN3 A;  3HGB A;  3EQL C;  4KMU C;  3U9S A;  4IQZ A;  2O5J C;  2F1M A;  1Q1B A;  2JXM B;  2ZT9 C;  4DNR B;  2NN6 I;  3A7L A;  1IW7 D;  2PNR C;  1H9M A;  1B9N A;  2KA7 A;  1BDO A;  2A69 C;  1E2V A;  3MXU A;  4H13 C;  1GUT A;  2DN8 A;  2AWO A;  3GQB A;  1GHK A;  1PMR A;  3VR4 A;  5BN4 A;  4KN4 C;  2IT1 A;  4GZY C;  1IW7 C;  4DK0 A;  5KNC A;  4IFD H;  2E76 C;  3ND8 A;  4KN7 C;  4G7Z C;  2AUK A;  1CFM A;  3GD7 A;  2BE5 D;  3M85 A;  3QIA A;  1GUG A;  1ONL A;  2K7V A;  3D4R A;  4H0L C;  3TZU A;  5BN5 A;  4G7H C;  3BDO A;  3VR3 A;  3VR5 A;  2A6H D;  3M7N A;  1ZYR C;  1HCZ A;  3T51 B;  1GJX A;  4IFD G;  1O7L A;  3I72 A;  1B9M A;  2A69 D;  1VF7 A;  2BE5 C;  5A35 A;  1OXS C;  3PUW A;  3CRK C;  1K8M A;  4KKS A;  2R6G A;  1H9S B;  2A6H C;  3P20 A;  5K36 G;  1Q90 A;  4G7O C;  1QJO A;  1HPC A;  3IKJ A;  1SMY C;  2V4D A;  3KLR A;  3N6R A;  3NE5 B;  5K36 H;  1I6V C;  3SDZ A;  3PV0 A;  2CW0 C;  3A7A B;  3PUX A;  1A6X A;  1YNN C;  1T5E A;  1H9J A;  1Q1E A;  2YYZ A;  1YNJ C;  1H9K A;  4KKU A;  2EJG C;  3W3A A;  5KNB A;  2B8F A;  1IYV A;  2LMC B;  3M4Y A;  1HQM C;  2A68 D;  4OO1 G;  3FPP A;  1HTP A;  3LWU A;  5C0X G;  2K32 A;  1DD2 A;  2KCC A;  1GHJ A;  4BA1 I;  1H9S A;  2D2C C;  1Z7T A;  2JE6 I;  3AB9 A;  3BG3 A;  3T56 B;  4DK1 A;  2A68 C;  4KKT A;  3VR2 A;  3LNN A;  3PUZ A;  2JEA I;  1O78 A;  2JEB I;  3WDN A;  2QF7 A;  4LJZ C;  2D5D A;  4XIG S;  3A8J E;  4BA2 I;  1H9R A;  4H44 C;  1Y69 U;  1Z6H A;  3VR6 A;  2NN6 G;  4TKO B;  2BA0 A;  1FR3 A;  3ND9 A;  3QJY A;  4KHZ A; 
#chains in the Genus database with same CATH topology
 3GV3 A;  2B63 H;  3JAM L;  3K7A B;  1HA6 A;  2ZXO A;  3BYY B;  1HNZ Q;  4GKJ Q;  3DWQ A;  5J39 A;  5BR8 L;  1CTM A;  1X32 A;  1NTG A;  1SNP A;  4A3J H;  5C44 G;  2B8G A;  4DR7 L;  4IZ8 A;  1S5E D;  1A62 A;  1KAA A;  2A6E D;  1HZA A;  3UE1 A;  3L3O C;  1NSN S;  2VUM G;  2Q2T A;  3H0G G;  2D62 A;  1HQR D;  3OW2 A;  3K7A H;  1I4P A;  1FYC A;  1PRT F;  3FVQ A;  3PIP 3;  4OWW B;  3I4M B;  5JJL A;  1QVC A;  2OTL A;  4F7X A;  2A8V A;  4DXF A;  1V1Q A;  5BN3 A;  1B3Q A;  4JI5 Q;  4IQZ A;  3GTQ B;  3RLO A;  1TWC B;  4LMQ D;  2F0J A;  4POF A;  2JA6 H;  4DV2 L;  4FO2 A;  3IL8 A;  4RG1 A;  4TSS A;  4DV1 Q;  4JI7 L;  4FF2 A;  3ICE A;  3GTG H;  2L55 A;  4A3K B;  1MKH A;  3S2H B;  1SNQ A;  1C4Q A;  3M4O H;  4M8A A;  2QEJ C;  1CFM A;  1A0I A;  3U50 C;  5JAV A;  1PH6 A;  4POG A;  3QIA A;  3JC6 6;  2WKC A;  4RKB A;  3RN2 A;  3RR5 A;  3GTQ H;  1O7L A;  3K5O A;  3NWS A;  5IGC A;  1CA6 A;  2AKW B;  1LT5 D;  1XTD A;  1YJ9 A;  4IFD I;  5M3M B;  2R61 A;  2PMZ B;  3X3M A;  2ZJR A;  3PQI A;  5GRO A;  1D8L A;  4A3I B;  1FGU A;  4DR2 Q;  2CW0 C;  3A7A B;  1ENF A;  2K5V A;  3KF8 B;  4E6I A;  4UP9 A;  2ES2 A;  2Q2H A;  4OON A;  3UDG A;  4RH6 A;  4ID6 A;  1PRT C;  1G6Z A;  3FPP A;  4KTA A;  2HIX A;  2KBN A;  2KCC A;  3HOX B;  4J8Q A;  1KC8 C;  2PMZ E;  4KJO A;  3E3X A;  3L9A X;  3S1M B;  2D5D A;  5DM6 3;  1I4R A;  1TY0 A;  3UE0 A;  1UUP A;  3MFY A;  2EOT A;  2DNE A;  1V8Q A;  1VQK A;  1EY4 A;  1AW7 A;  5I6W A;  5IYC G;  1X3F A;  2M00 A;  1G29 1;  4IPG A;  3SK8 A;  4DPG A;  3SR1 A;  1TWG B;  1YZ6 A;  1X65 A;  5C0X H;  1G2S A;  1V1P B;  2UUA Q;  4KHP L;  1VQ7 A;  5IYB H;  1EIF A;  1PZI D;  2KHI A;  2PZW A;  1TT2 A;  3B6Y A;  5LMU Q;  5A2Q E;  1I50 B;  3GTL H;  1FGB D;  4IFD G;  3JAM E;  4RA8 A;  3SE0 A;  3M3Y H;  1SFO B;  2XRQ D;  3J80 c;  3NPP A;  3RN5 A;  3IFT A;  2UXC Q;  2F0O A;  1OXU A;  2X69 A;  1NJI C;  2HQL A;  4GKK L;  1SLJ A;  1DCZ A;  4G4K A;  2R92 H;  4IJH A;  2H4O A;  4A3D B;  2DY8 A;  4MTN A;  4OO1 G;  2WFW A;  4B9X A;  3CPF A;  1PH8 A;  1IW7 D;  3HEJ A;  1I50 H;  1B9N A;  1XMQ L;  1HUN A;  5EBC A;  3Q23 A;  2XVS A;  1SFO H;  4HIK A;  1TR5 A;  4HSV A;  5BN4 A;  4R4I A;  4DK0 A;  1Q8I A;  3NXW A;  1STH A;  4PQX A;  1S40 A;  2JYO A;  2F0D A;  4R8N A;  1WCM B;  4BBR H;  4RGM A;  3HOV G;  1FJG L;  5M5W B;  3M7N A;  2A6H D;  3D6C A;  5IP9 G;  3R3O A;  3SK6 A;  3I4O A;  1KXL A;  1F2M A;  3L2P A;  4KKS A;  3U4V A;  2F0N A;  4CBV A;  1SSO A;  4C3J B;  3ER0 A;  5FO8 B;  1XNR Q;  4IUN A;  4TRD A;  1N33 L;  2KEC A;  4K6L A;  2XWB B;  1H9J A;  3K5M A;  3H6M A;  1E0B A;  2XSC A;  4XT1 B;  1N32 Q;  1WCM H;  1X56 A;  2RDG A;  4BY1 G;  2JP1 A;  4BXX H;  1HTP A;  3F2C A;  1KDA A;  4B3S L;  1XTC D;  4LUO A;  1XPU A;  5D3I B;  4DAV A;  2JE6 I;  1Z7T A;  3PIO A;  3HOU H;  1K83 H;  4B3T Q;  2CW0 D;  1YHB A;  2ZM6 L;  1XYI A;  1UE6 A;  3T1Y L;  1Q86 C;  3C3L A;  1J5E Q;  2NVQ B;  1Y1V G;  4X66 L;  1CKM A;  1F2Z A;  5FJ8 H;  4LNQ A;  4I7Z C;  3O13 A;  4DAY A;  2DNC A;  1TWH B;  4M1U B;  1NR4 A;  3BS1 A;  4A3E G;  2UU9 L;  1CKN A;  2R3Z A;  5JOB A;  4NW2 A;  3W1G A;  3OTO L;  5C3W A;  2L5T A;  4JI0 L;  1T5X D;  1BCP B;  4JPB W;  2L0C A;  5G3L F;  3UDI A;  2BDO A;  1STA A;  2C35 B;  3KUP A;  2NVQ H;  3MEF A;  2EE1 A;  4A3F G;  4GOP B;  2BCO A;  1L0W A;  4JG2 A;  2NVX H;  3PO2 B;  3F2U A;  3K81 C;  3A8K E;  1TWH H;  2L15 A;  4IFD J;  1N9W A;  3CCJ A;  2K1B A;  2NVY B;  5KGU A;  3P75 A;  4L8J A;  1PH3 A;  1D1I A;  2EY6 A;  3N52 A;  3T53 B;  3HGB A;  2DJF C;  2F0E A;  4JCV E;  3GP7 A;  3BZD B;  2LS0 1;  2VZA A;  4DNR B;  1VQ4 A;  4FVM A;  4NXN Q;  1MHW C;  1JB3 A;  1F77 A;  5COY A;  3PO3 B;  1STG A;  1GUT A;  2Y0S B;  3PO2 H;  1JOR A;  4KJN A;  1WOC A;  2PQA B;  2WB1 B;  3J81 L;  3K59 A;  2FJ2 A;  5IWA Q;  4O0A A;  4KN7 C;  3I3C A;  3RNU A;  1E7Z A;  4AIM A;  3S14 B;  1A2U A;  3S1R B;  3A74 A;  3FDT A;  4C3I G;  5FLM G;  3OMC A;  3X3N A;  1E3P A;  3DMU A;  3TBI B;  3TS0 A;  4BY7 H;  3PO3 H;  3KDF B;  3S1Q H;  5ELC A;  2I0Q A;  4YY3 Q;  2NZH A;  2WB1 E;  2R93 H;  2E5L L;  4IO9 A;  2X6L A;  1KQS A;  2YYZ A;  3H0G B;  4DV5 Q;  4XDX A;  4WFN 3;  4RGN A;  1QG7 A;  4DR5 L;  3S1R H;  1HQM C;  1STY A;  3E6Z X;  1OO9 B;  1B4O A;  2WIN B;  3M7G A;  1VMP A;  4GNX B;  2KCM A;  3ERO A;  3R8B A;  1IKL A;  1HR0 L;  3LNN A;  4EQN A;  1ESF A;  2NVT B;  3PSI A;  1I94 Q;  2K4K A;  4C2M B;  2B29 A;  2WAQ G;  3STB D;  4A3M G;  2BA0 A;  3ND9 A;  3I73 A;  3QB3 A;  4R4T A;  4LF8 Q;  3G7L A;  1EWI A;  3CCS A;  3GV6 A;  5IGF A;  1STE A;  4NMZ A;  1PZK D;  4EQP A;  1Y8N B;  1XWE A;  2J0T D;  4ZQ3 A;  4K5W A;  1CQV A;  1VMC A;  5KYL A;  3H3V I;  4V0B A;  1GVP A;  3TEH B;  3K7U C;  2QEX A;  2VQF Q;  3KOJ A;  4RHR A;  1I5F A;  5EKK A;  2ICE C;  5C4X H;  2Q8I B;  1O7Z A;  2B2T C;  2PPB C;  2F4V Q;  2N49 A;  3FRP B;  2QDB A;  1LTL A;  2MHV A;  5C0X I;  2EZV A;  3P7J A;  1EQR A;  3QO2 A;  3CC2 A;  3WOF A;  3I4N H;  4WJ4 A;  1SE3 A;  1A3U A;  3S15 B;  1U5K A;  4DF7 A;  4B3R L;  3RLF A;  2V1C C;  4X3K A;  5EBD A;  2NWG A;  2Z4I A;  1LTR D;  1SXT A;  4N8X 1;  4OHJ A;  3TS2 A;  1HTL D;  2IPK D;  3OMG A;  4DR3 L;  3A56 A;  3A7L A;  3GTK H;  2PNR C;  4ZUI A;  5M3F H;  2RA4 A;  1EYG A;  1U4P A;  4CDE C;  4CJ2 C;  3T1H Q;  1I6H B;  2PZU A;  4OIK A;  3MWY W;  1VQB A;  2VQE L;  3S15 H;  1PH1 A;  4A3G B;  4X6A H;  5CR3 A;  2TMP A;  4IUV A;  1NUC A;  3I91 A;  3VR5 A;  1I4H A;  3HOZ H;  2B2U C;  3CC4 A;  1A63 A;  3U4Z A;  4HIO A;  3PMF A;  1IBL L;  4BBS H;  4A3L H;  1T9H A;  1LM0 A;  4BWG B;  3S17 B;  1EQQ A;  1YNN D;  4NP5 A;  1Q90 A;  5T1G A;  1VQM A;  3J81 E;  4DV7 Q;  1R4Q B;  1BQQ T;  5D3D A;  5KRU A;  1YNJ C;  1LYL A;  4KKU A;  3W3A A;  3CW2 C;  4A3G H;  1XNQ Q;  2R7Z B;  5E1F A;  5C0X G;  3JAM c;  4R4O A;  1V1O A;  4JI1 L;  2EYP A;  1BXT A;  3UI2 A;  3S17 H;  1HZB A;  4I7A A;  1MI2 A;  1KL9 A;  3CQZ H;  1WD1 A;  2A73 B;  3HP3 A;  2I46 A;  5HGQ A;  4X64 Q;  4LUV A;  1D2B A;  3CCL A;  4DV0 L;  3A54 A;  2A5H A;  1EFI D;  3BYT B;  5JEA G;  2R7Z H;  2RHS B;  2R92 G;  2JA5 B;  1YIT A;  1K0R A;  1Y14 B;  1PA6 A;  3BVM A;  1UE5 A;  4GLA C;  1ENA A;  5C4Z A;  1D5Z C;  1VQA A;  1WI5 A;  4AQY Q;  3HOV B;  1EY5 A;  3CCQ A;  3DWP A;  2WP8 J;  3VYS A;  1JCK B;  4JBK A;  1CHP D;  3OW7 A;  4DA2 A;  4L6T B;  1CI3 M;  2SNM A;  3G6J B;  4GLV B;  5C5L A;  4DK6 C;  5EKL A;  4TVA B;  1NMF A;  3BU2 A;  2A6E C;  5ELB A;  5EKI A;  2HCI A;  2JA5 H;  4PV1 C;  1NAP A;  2XGT A;  2E2I B;  4DXG A;  3RZD H;  4BY1 B;  2A74 C;  3F2D A;  3S16 B;  4IN3 A;  1SRO A;  4YCW A;  3VA5 A;  1L1O B;  1IHZ A;  3D0F A;  3KBG A;  1DON A;  1XPO A;  4HMI A;  1BUV T;  2M9V A;  1O7I A;  3ZYY X;  2BDN A;  1SE4 A;  3HZX A;  3GTJ H;  4KN4 C;  4IPC A;  4FF1 A;  2ATW A;  1NR2 A;  1CK1 A;  2MNA A;  3ULP A;  3TRE A;  1B7Y B;  5I2Y A;  4A75 A;  1BOS A;  5CV4 A;  5CV7 A;  4LF5 L;  3S16 H;  3VR3 A;  3AYH B;  4QQB X;  5C5M A;  3NQI A;  4LAA A;  3ZJY C;  5CGK A;  1XPR A;  4G7O C;  1QJO A;  4JV5 Q;  1JC7 A;  5FJ8 G;  1AP0 A;  3K58 A;  4A3F B;  5C3E H;  2EPB A;  1EIY B;  2EJG C;  1Q46 A;  3J7A F;  2PZT A;  4DV1 L;  2RCF A;  2K32 A;  3D6W A;  2RSN A;  2OQK A;  4J1M A;  5C0X J;  3BVZ A;  5CV5 A;  3NTI A;  4EX5 A;  1O78 A;  4FXD A;  1HNW Q;  2H1E A;  4IAL A;  2K14 A;  1Z6H A;  1IXR A;  3IFD A;  1CHQ D;  1Q3L A;  1WVL A;  1VQO A;  3LGJ A;  1EY0 A;  4X3S A;  1MSH A;  4DR2 L;  4LFC Q;  1JJG A;  1ML0 D;  4PMB A;  4KY6 A;  5DM7 3;  3PIP A;  3T13 A;  1GOZ A;  1Y1W B;  1HR0 W;  4C56 C;  3VYU A;  4C3I B;  1ILP A;  4QL5 A;  2EYJ A;  4ZRZ A;  1BBU A;  1LT3 D;  4JOI A;  2BOS A;  1Y8O B;  1E2Z A;  1W6J A;  4YCU A;  2Q8R E;  1PTO B;  1GUN A;  2SDF A;  4JOI C;  1MGS A;  2F0L A;  1MSG A;  5EPK A;  1Q82 C;  1NMG A;  1K8G A;  4A3B G;  4JI3 Q;  1JIC A;  1UE1 A;  2VNU D;  2EYH A;  1TXY A;  4HJA A;  1EU3 A;  3DWA A;  1Y1W H;  5M5Y H;  3RD4 A;  5FO9 B;  2GA4 B;  4RFB A;  3DUZ A;  4C3H H;  3HKS A;  2JQO A;  3U9S A;  1LTI D;  1B53 A;  3QWN A;  1BDO A;  1PTO H;  3C1F A;  3TME A;  1EOT A;  2F4I A;  1K28 A;  4JI2 Q;  1TQO A;  2RSO A;  3S2D B;  4LFA Q;  2UUA L;  2IT1 A;  1IW7 C;  4A3M B;  5LMN Q;  2E76 C;  5LMU L;  3FKI G;  2OXP A;  3D3R A;  3GD7 A;  4B3M Q;  3HOW G;  5IGE A;  1SDF A;  4OEL B;  1U4M A;  4JYA Q;  4IOA A;  3I72 A;  2UXC L;  5CV8 A;  2VY3 A;  5CC4 A;  2F0G A;  3TRZ A;  5K36 G;  2A6H C;  2EYM A;  2F3W A;  3KF8 A;  3C46 A;  1PH5 A;  3E9I A;  2Q8T A;  3NWT A;  4HCE A;  2WAQ E;  4ZCK A;  3W5O A;  5JVH 3;  2CCZ A;  4K5X A;  2NTS A;  3SXH A;  3I4M H;  2K6A A;  3UDX A;  2F0V A;  2G9H D;  4GLX A;  1F9R A;  4X62 L;  1WJJ A;  4HID A;  2XWJ B;  1PFM A;  1KD1 C;  3NQT A;  1G8Z D;  1TWC H;  2K04 A;  4MHE A;  2HHH Q;  2CQA A;  4IPD A;  1G51 A;  4K5V A;  5C4X G;  4H44 C;  2RDF A;  5ELO A;  3Q0A A;  1S3O A;  2UUC Q;  1PYW D;  1G6P A;  4A3K H;  3A5Z B;  4YHH Q;  3VA7 A;  2B2Y C;  3S2H H;  3I4N G;  5AJ3 L;  1XNR L;  2FFK B;  1X9N A;  4WOR A;  1VQ5 A;  2ICI A;  4DNT B;  1WD0 A;  1CA5 A;  1HA5 A;  1PTO D;  1N32 L;  5HUR A;  1RTO A;  4S3S A;  1V9P A;  2EY1 A;  4A93 B;  3F8T A;  1C9O A;  4GN3 B;  4APV A;  5M3M H;  1WTW A;  4A3I H;  3PUY A;  2C5C A;  5D65 A;  1QUQ A;  4X65 Q;  2PCF B;  4PZ8 A;  4B3T L;  1ESR A;  3Q22 A;  4PZ6 A;  1X54 A;  2MJ8 A;  1VF5 C;  3I4L A;  1Q8K A;  1J5E L;  3J81 c;  2I5H A;  3HOX H;  4BBS G;  2OWO A;  4A93 H;  2F1M A;  1XX8 A;  4P74 A;  2Z0S A;  3S1M H;  3CU7 A;  3NEL A;  2UUB Q;  5E7N A;  5IGG A;  3Q24 A;  1C7Y A;  2E2D C;  1QZG A;  1UWV A;  4B9W A;  1FD7 D;  1CZW A;  3K0X A;  2YTX A;  1DOL A;  4DR7 Q;  2Q2I A;  4QF4 A;  3R2T A;  1YVC A;  1IBK Q;  1BCP F;  2BE5 D;  4ODG A;  3NSW A;  3H91 A;  5CV6 A;  1TWG H;  2K5N A;  1EUJ A;  5EGT A;  3HOY G;  1SMY D;  3C1E A;  1AZQ A;  1A3V A;  4DGZ A;  5JJK A;  1ENC A;  1KNA A;  4JC0 A;  1SYG A;  4OL7 A;  1U4L A;  4A3C G;  3PV0 A;  4CJ0 B;  2JA7 B;  4HIM A;  5CYU A;  5KYI A;  1B8A A;  4NXN L;  1EU4 A;  2N55 A;  3PF4 A;  5CBA E;  4P2C B;  3LWU A;  3URY A;  5LMN W;  4DUY L;  4CGY B;  4DUZ Q;  5IWA L;  4A3D H;  5IP7 G;  4BA1 I;  2FXQ A;  4RHS A;  4DV2 Q;  4WJW A;  4QCL A;  4JI7 Q;  4ZAI A;  2MGS A;  4Y52 H;  3PCO B;  3VYR A;  1WTX A;  4PMW A;  2JA7 H;  5GQO A;  3CCM A;  4HJ5 A;  1I3Q B;  2GVB A;  1E1O A;  1RF2 D;  1A8V A;  2LY7 A;  4LK1 C;  3STB C;  1JE5 A;  2Q2U A;  5IYD G;  1BCP C;  5M5W H;  2F0H A;  4DV5 L;  1EZ6 A;  3IRB A;  4OO1 H;  4ZYS A;  5J3B A;  1WYD A;  1Y8P B;  1BO0 A;  2FMM A;  1YNX A;  2IJ0 A;  1RDP D;  3KYH C;  5ELE A;  4GOP C;  4C3J H;  2DJG C;  1I3Q H;  4LFB L;  1SNC A;  1K8O A;  1SR3 A;  5ISR A;  1FNU A;  1DOM A;  4J6H A;  1SYD A;  4X3T A;  1IYU A;  2FMC A;  5ELF A;  2ZTC A;  4P73 A;  1N34 L;  1KDB A;  1X3G A;  2WV6 D;  4FXK C;  3M4Q A;  4KMU C;  1JOQ A;  2ZT9 C;  1II3 A;  3PF5 A;  4O42 A;  3CME A;  1CSQ A;  1NE3 A;  3DM1 A;  4H13 C;  4R9W A;  1CUK A;  1U9R A;  1ET6 A;  3HFZ B;  3VR4 A;  5GAE C;  1PYB A;  3ULL A;  2YU9 B;  3LX0 A;  1CKO A;  3RMH A;  2VQF L;  1D5M C;  4JI6 Q;  2JA8 G;  1LT6 D;  1ONL A;  2B2V A;  2F4V L;  1STB A;  3NEM A;  5BN5 A;  3KDF A;  1VQD A;  1HCZ A;  2IW3 A;  4MN3 A;  2P5Z X;  2B2V C;  3IAY A;  4HSP A;  3CCR A;  4DV4 Q;  1VQJ A;  4QJF A;  1VQ9 A;  1TVX A;  3PUW A;  1P16 A;  3K80 C;  2R6G A;  4LF6 L;  2HCC A;  1B3A A;  2RCN A;  2E2H B;  1WFQ A;  1I6V C;  3NEN A;  1YNN C;  2D9U A;  4K2K A;  1YJN A;  1GXD C;  1Q1E A;  2KCT A;  4UAI A;  1KLG D;  2NVY H;  4OX9 L;  3I70 A;  4GNX C;  1AH9 A;  4DAY B;  1H9S A;  1CKN B;  1VS0 A;  4KKT A;  2L11 A;  5C44 B;  1K3B C;  4RMF A;  2OQ0 A;  1PH2 A;  3VR6 A;  2B63 G;  2UXD Q;  1JOO A;  2VUM B;  1E2W A;  1ZXT A;  4Y7N B;  4K0K Q;  3KF6 B;  1YI2 A;  1KNE A;  4RCO A;  4DV7 L;  1UE7 A;  3S14 H;  3T16 A;  4A3J G;  1ILQ A;  3FKI B;  3HOW B;  1E1T A;  2E2J B;  1AE2 A;  3VYT A;  2QDL A;  4OIJ A;  5C44 H;  1XNQ L;  1BKB A;  4HJ9 A;  4QUC A;  1WTQ A;  2EJM A;  2EXZ A;  2K5W A;  3D31 A;  2QW7 A;  4OWT B;  2I5M X;  3V05 A;  4DAM A;  1B50 A;  3CCV A;  2VUM H;  1QCB D;  2DY7 A;  2I5L X;  3H0G H;  4L5S A;  1BCP D;  2VS1 A;  2PO4 A;  1DXM A;  4DR6 Q;  4X64 L;  2E2J H;  2KED A;  4KI0 A;  2YTV A;  2Z9H A;  2L4N A;  2GN5 A;  1JB7 A;  1GKH A;  3FPU B;  2NVT H;  2JA6 G;  2CWA A;  4C2M H;  4NXM Q;  1Z9F A;  4AQY L;  2B2T A;  4YIJ A;  4RGO S;  4ABN A;  3OTO Q;  4DFA A;  1C8C A;  1ZYR D;  4UP7 A;  3L0O A;  5DNF A;  4RAU C;  2K28 A;  1IYJ B;  2N8N A;  2J4X A;  2QKI C;  1PYS B;  4CDF C;  2KEE A;  1QNU A;  3T51 B;  2NZ1 D;  1IL8 A;  1HUM A;  3FHW A;  2K03 A;  1K8M A;  4LF9 Q;  5COR A;  1GUW A;  3I2Z A;  3NE5 B;  2MFI A;  3KLS X;  1A6X A;  3NBH B;  1T5E A;  1WTP A;  1BVS A;  5KNB A;  4DNI A;  1J8I A;  5IT9 L;  4JI8 Q;  2YTY A;  4DR4 L;  1YBY A;  2B2U A;  4A76 A;  1UEA B;  1EYC A;  1K73 C;  5M3M G;  2AHO B;  4FNF A;  4HCS A;  2UXB Q;  1F9S A;  4XIG S;  3A8J E;  1F2Y A;  4UPA A;  5H1S E;  1EQT A;  1UAP A;  2IX0 A;  1DZ1 A;  1I6H H;  1SEB D;  5E4W C;  3MXN B;  1CZG A;  4JV5 L;  1L0X B;  5T1I A;  1QVF A;  3JAM i;  1ZEQ X;  2AQ1 B;  3AFQ A;  4RGT A;  2ZXR A;  1K0S A;  5FOB B;  1PVO A;  1RIP A;  3AU7 A;  5I4D A;  2DUD A;  2N78 A;  5IYB G;  1O7Y A;  3HG9 A;  1LTG D;  2KEN A;  2SEB D;  1EEI D;  3HOY B;  3BZC A;  1PHJ A;  5E3F A;  5JJI A;  4EQ5 A;  1VCI A;  3A8I E;  1R9T B;  1VDZ A;  1HNW L;  2NN6 H;  4OO1 I;  5GAG C;  1GUS A;  2OCE A;  2EYL A;  1EOV A;  2B3G A;  1TS3 A;  1EY9 A;  1RCV D;  4LF7 Q;  3H94 A;  3FEW X;  4KHV A;  3TP8 A;  1L1O C;  3HKZ G;  4MNO A;  2B2W C;  1VQI A;  1ET9 A;  4LFC L;  2O5J C;  3MAQ A;  4K14 A;  2JXM B;  4KD4 A;  4LF4 Q;  1R4P B;  3SGI A;  1BBX C;  2AWO A;  4GZY C;  1HNX Q;  4JBM A;  2IWH A;  2OEO A;  3S1N B;  4BBR G;  2KCN A;  4DAP A;  4JBJ A;  3GTM B;  2ENB A;  1CM9 A;  1I4G A;  1HHV A;  3HOV H;  5IP9 H;  4JI3 L;  1VF7 A;  2VL6 A;  1GD7 A;  2R7D A;  5E4X A;  1OXS C;  1HNZ L;  3CRK C;  5FO7 B;  1PTO F;  1SJE D;  1SNO A;  1IBM Q;  4GKJ L;  3P20 A;  1G91 A;  5ELN A;  1LUZ A;  5C3X A;  5M9O A;  3I56 A;  1PH7 A;  1SMX A;  5EPJ A;  4B3R Q;  1WCM G;  1PFB A;  5EPL A;  3RLN A;  1Y1V B;  3S1N H;  4BXX G;  1DGS A;  4JI2 L;  3F2B A;  2LMC B;  3CCE A;  3SHL A;  1JQY D;  2A68 D;  3M4Y A;  4DR3 Q;  4H7B A;  2E2I H;  1SYB A;  2F03 A;  4BY1 H;  4UY8 C;  4R4Q A;  3GTM H;  5LMN L;  4A3E B;  3HOU G;  1QE6 A;  1EYD A;  4MTK A;  1DM0 B;  2HT1 A;  2K5D A;  5FK9 C;  4B3M L;  3D4W A;  3OHX C;  1KTK A;  3CAM A;  2F52 A;  4CKE A;  5KEE A;  3WDN A;  1WTR A;  4JI5 L;  2WAC A;  5IT9 E;  4L5Q A;  4XYQ A;  1PLF A;  3EBE A;  1JT8 A;  1IZ6 A;  1Y1V H;  4O1N A;  1TS5 A;  1SYF A;  3G48 A;  3TZD A;  2RF4 A;  2EDG A;  3K5N A;  5NUC A;  3BDC A;  2FHT A;  3D4D A;  4A3E H;  2JA8 B;  4N9T A;  4OGQ C;  1PH4 A;  1SNM A;  4PMC A;  1A3T A;  1NNX A;  4LW1 A;  4K2L A;  5LL6 X;  3FMC A;  4PG3 A;  2BH8 A;  4DV3 Q;  4JBW A;  1PTO C;  2VXW A;  3RZO B;  1TWF B;  1LTS D;  4P75 A;  4AYB G;  4C1N I;  2JSO A;  2MO1 A;  1EWH A;  1M4V A;  1WTO A;  4A3F H;  4JI4 Q;  2HHH L;  1F9P A;  3J7Z C;  5IOD A;  4JI1 Q;  1S5F D;  2JK8 A;  3MC0 B;  1EEF D;  4V19 0;  2X6G A;  1J6Q A;  2N88 A;  4YHH L;  4KY5 A;  4QY7 A;  1VQ8 A;  2HUG A;  2TSS A;  2NZO A;  2VB3 X;  3MHB A;  1I4Q A;  4XQN A;  3TSS A;  4ZKC B;  1TWF H;  4GN4 B;  3V96 A;  4IJL A;  4KLK A;  3PO2 G;  2Z4H A;  2O2L D;  1BNZ A;  2F0Q A;  1GHK A;  1D1K A;  4DV6 Q;  1HZC A;  3SVM A;  5I9O A;  2B63 B;  5FLX L;  1KAB A;  2PYK A;  2J7Z A;  3EFX D;  4X65 L;  1Q7Y C;  1GUG A;  4H0L C;  3TZU A;  1VQ6 A;  3BDO A;  3WOE A;  4A3J B;  2CVR A;  4C3I H;  4GS3 A;  1B9M A;  3E0J A;  2BE5 C;  5FLM H;  4BY7 G;  4IUT A;  2D0O A;  3PO3 G;  1BR9 A;  2LFN A;  2Y0S G;  2SOB A;  2R93 G;  4IPH A;  1SMY C;  2PI2 E;  2K50 A;  5A2Q L;  4F88 A;  2AWN A;  5TSS A;  1JMC A;  1N8R C;  2WAQ B;  3I90 A;  2UUB L;  2B8F A;  3M9B A;  5GAH C;  5M5X B;  3KFU A;  1PV4 A;  4G57 A;  4IUU A;  5FKA C;  2WII B;  5IE8 A;  1VQE A;  4EGV A;  1IBK L;  3CXC A;  5IGD A;  3PUZ A;  4DR1 Q;  4NB3 A;  5I6Y A;  4JW0 A;  4R4C A;  3TQY A;  3KLS A;  1FVI A;  2JA6 B;  3S2D H;  1KHI A;  3PGZ A;  1K8A C;  4A3M H;  2A1A A;  4N8F A;  4LF5 Q;  3GTG B;  4OEM B;  3OWE B;  2IHE A;  2EYF A;  3SK4 A;  1C0A A;  2RVL A;  5M5X H;  3M4O B;  1LAB A;  4XTC S;  2CQO A;  1RHP A;  1AE3 A;  2K05 A;  5D14 A;  1G2T A;  4ZKB B;  1S5C D;  3AEV A;  1L2F A;  3NK9 A;  3BZK A;  4NDX A;  2HDL A;  3U58 A;  1HFN A;  1ZKO A;  1PFS A;  5IIF A;  1F2L A;  3HRZ C;  2E75 C;  4DUZ L;  2EY2 A;  5KND A;  3MA2 B;  3TDQ A;  3H3V C;  2NBF A;  2B2Y A;  3I7F A;  2A19 A;  2EVB A;  1YHQ A;  2BA1 A;  3OOC A;  2CWP A;  2MP1 A;  3CHB D;  1PH9 A;  1JWU D;  1LO5 D;  1X55 A;  1V1P A;  3FP9 A;  4XQQ A;  2R7F A;  4Q0F A;  2DGY A;  4Z9C B;  1ASZ A;  3PUV A;  4OWX B;  1W6K A;  3V2T A;  1HH2 P;  1SAP A;  1Q1B A;  3K5L A;  2NN6 I;  5M3F G;  1PXU A;  1N36 Q;  1FL0 A;  2A69 C;  1E2V A;  1VQN A;  3ERS X;  1EY7 A;  5DAU A;  1SYE A;  1TS4 A;  1PMR A;  1EY6 A;  5EAY A;  3EIV A;  3MEH A;  2RKS A;  2HD3 A;  2L12 A;  4HTH A;  5C4H A;  3H09 A;  5IY0 A;  3J81 i;  1XMO Q;  2B39 A;  2K7V A;  3HOZ G;  2D0P A;  4A4I A;  4KY7 A;  4ULL A;  4A3L G;  2PW5 A;  5A35 A;  4P72 A;  4NKL A;  3WWV A;  1HPC A;  2F0P A;  3IKJ A;  2V4D A;  1LTA D;  3KLR A;  3N6R A;  3GTL B;  3SDZ A;  3H3V H;  4ALP A;  5FLX E;  5BR8 Q;  5L37 A;  3M3Y B;  1EFW A;  4A3G G;  2LXJ A;  2G5D A;  3J80 i;  1KAW A;  1UNS A;  3NHH A;  1I4X A;  1STN A;  2M2L A;  1DOK A;  1PRT B;  1SE8 A;  2F0S A;  2R92 B;  2QIL A;  4DK1 A;  5CMD A;  4JI6 L;  5DLQ E;  2CH4 A;  3HKZ B;  1AFP A;  2KHJ A;  1OTC A;  1CSP A;  4BA2 I;  4BS9 A;  4CHT B;  2NN6 G;  4DV4 L;  4HMJ A;  2HQE A;  4XQJ A;  5K5P A;  4CDC C;  2L1B A;  2R7Z G;  3Q6S A;  4FF3 A;  2C9O A;  1QUQ B;  3CCU A;  1OXX K;  2AQ3 B;  3W2D A;  5I2X A;  2VB2 X;  5JEA H;  2EY5 A;  1LTB D;  1LT4 D;  4BBR B;  3QR8 A;  1JJ2 A;  4UP8 A;  2SNS A;  3A55 A;  2AUJ D;  3HKZ E;  4ME5 A;  1QNK A;  4LUZ A;  4RWS C;  2XIW A;  4HR7 B;  4XXE A;  5LL6 S;  2JJQ A;  3MXG A;  3KLW A;  4X62 Q;  3KBX A;  2CKZ B;  2ID0 A;  2JA5 G;  5GAD C;  4YY3 L;  1RJT A;  2UXD L;  4CDD C;  4WRD A;  4K0K L;  2YV5 A;  4YWL A;  4QIW B;  1QZH A;  1X3P A;  3NTK A;  3HOU B;  3OSO A;  2CFM A;  1K83 B;  3MXP A;  4GOP A;  3G71 A;  1TII D;  3ITP A;  1HFG A;  5AJ3 Q;  1XJV A;  2OF1 A;  3Q8D A;  2MUY A;  2H5X A;  2ZJQ A;  1I94 L;  1SN8 A;  4QIW E;  5IT9 c;  1JR0 D;  1ZYR C;  2Z6B A;  1DYQ A;  4AH6 A;  4DR6 L;  1X3Q A;  2A69 D;  4LF8 L;  4KD3 A;  4UHV A;  4ZK9 B;  1GM5 A;  4OXP A;  2K5H A;  2PQA A;  3E0E A;  3MVV A;  1VQP A;  4YCV A;  1QB5 D;  3TP5 A;  1MD2 D;  2IHF A;  1WTH A;  5C3E G;  1PRT D;  4AYB B;  1S5D D;  2NVX B;  1B1Z A;  4IUR A;  3T4A C;  4NXM L;  2GVA A;  1KDC A;  1L0Y B;  4MZ9 A;  4KHP Q;  1K9M C;  1GHJ A;  4IUQ A;  2PNH A;  3NP8 A;  4K8I A;  2E8G A;  2HIV A;  1MIU A;  2NUC A;  4K8J A;  3W1B A;  5JVG 3;  4LWC A;  4QB4 A;  2JEA I;  1Z47 A;  2Z1C A;  4J15 A;  1YHA A;  2LKV A;  2K52 A;  4AYB E;  3KF6 A;  1EZ8 A;  1Y69 U;  3ERQ A;  2RHQ B;  3KJP A;  3VDY A;  4GKK Q;  4KHZ A;  2YU9 H;  4LF9 L;  2F0F A;  3OWF A;  2EXD A;  4N9P A;  3LWE A;  4CJ1 B;  5JJZ A;  4GNX A;  1TWA B;  1KRS A;  3PIO 3;  1GUO A;  4A3B B;  1XXG A;  3T1H L;  3DEP A;  1A15 A;  1EIH A;  1DJR D;  2F0K A;  4FP5 D;  2BH2 A;  4QGU A;  1XMQ Q;  2F3I A;  3A0J A;  2Z6K A;  1D6E C;  3E9H A;  1H95 A;  2G9D A;  4TQU S;  4JI8 L;  3R93 A;  4IUP A;  2NYZ D;  2Z6K C;  1QIL A;  4BY7 B;  1JWM D;  4U67 3;  2E2H H;  3S1Q B;  3UDF A;  2ZTD A;  2E74 C;  4QMG A;  2L9H A;  3BDL A;  2R93 B;  3SK5 A;  1BBW A;  1NBW A;  4DUY Q;  2UXB L;  4JK1 C;  4ZUJ A;  4HJ7 A;  1FJG Q;  3TP6 A;  3MTS A;  1TWA H;  3J7Y W;  3QOJ A;  4A3B H;  1KIX A;  2EIF A;  1YJW A;  1Y1W G;  3L7Z C;  1J9O A;  2I07 B;  4C3H G;  5AFW A;  1YIJ A;  1S72 A;  4B08 A;  5F2D A;  1ICF B;  1N33 Q;  4R8I A;  1U0L A;  3BJU A;  3A5U A;  2KVM A;  2Y0S E;  1H9M A;  4PZ7 A;  4HAE A;  2KA7 A;  3GDE A;  3H15 A;  3P1H A;  4FF4 A;  1P8L A;  3MXU A;  2QA4 A;  5J22 A;  1PDQ A;  2QGQ A;  3J80 L;  5IGB A;  4Y7N H;  2LSS A;  4B3S Q;  1O80 A;  2KHS A;  4H02 A;  3ND8 A;  3OYY A;  1JWS D;  2AUK A;  5JPM C;  3FKI H;  5LHY 1;  1VQH A;  1S5B D;  4F8M A;  3C2P A;  3HOW H;  2ZM6 Q;  4HJ8 A;  5CV9 A;  3CC7 A;  3K6O A;  3T1Y Q;  1TY2 A;  5KIX A;  4LFB Q;  5C4J B;  3ONA B;  4HN7 A;  4LF7 L;  3NBH A;  1JE4 A;  4X66 Q;  1W2B A;  1UEB A;  1H9S B;  1LLR D;  1KLU D;  1MJE A;  5K36 H;  2F3V A;  1VQC A;  2CH4 W;  4FDB A;  1EIG A;  2UU9 Q;  1N34 Q;  5C4X B;  4LF4 L;  1YEZ A;  2IX1 A;  3I4M G;  4JI0 Q;  3D8G A;  3AFP A;  1B2T A;  3EJI A;  3KJO A;  2MO0 A;  3M4P A;  3J81 j;  3I4N B;  1DD2 A;  1EWC A;  1HNX L;  3E5S A;  3G6E A;  5C4J H;  1SRU A;  3AB9 A;  3BG3 A;  5J1Z A;  2A68 C;  2EYO A;  2ALY B;  3MXN A;  4FYD A;  1HXY D;  3GTK B;  4DKA C;  2F0M A;  1H9R A;  5M3F B;  4A3K G;  2OT2 A;  1B44 D;  1IBM L;  1M8A A;  1OXT A;  1D7Q A;  2Z8L A;  2F0W A;  4ZLT F;  2NTT A;  4L5T A;  3MZ5 A;  2XTI A;  4DN4 M;  5I9P A;  4LF6 Q;  1LV9 A;  3I8Z A;  5IOC A;  1IKM A;  4PNY A;  3S9W A;  2NB0 A;  3OPO A;  3J7A 5;  1LAC A;  1NY4 A;  1RL2 A;  3HOZ B;  1AEX A;  5ELD A;  4BBS B;  4UDU C;  3R2I A;  2EJF C;  1B70 B;  1RD9 D;  3J7A V;  4A3I G;  1EY8 A;  3TN2 A;  5EQ0 A;  3AQQ A;  4OX9 Q;  1OXV A;  3S24 A;  1TS2 A;  2IY5 B;  2ZTE A;  1CQF A;  3DEO A;  5DEH A;  1S4Z A;  3GTP B;  4NPS A;  2MPM A;  1F9Q A;  4F87 A;  1ICW A;  4RCN A;  3EA6 A;  3HS0 C;  3HOX G;  5IYC H;  2VW9 A;  5FLX c;  2K01 A;  2O4X A;  1AN8 A;  4A93 G;  3TP7 A;  2E5L Q;  1RTN A;  4FXG C;  2IL8 A;  3CQZ B;  1MJC A;  4YWM A;  2DN8 A;  4DR5 Q;  4JVZ A;  1SBB B;  1FNV A;  4DV3 L;  3GTP H;  4IFD H;  4R1J A;  3DLL A;  1SYC A;  3G4S A;  1HR0 Q;  1VQG A;  2JA9 A;  4JI4 L;  3M85 A;  5G3L D;  1L1O A;  3CF5 A;  2B2W A;  2K5Q A;  2AMC B;  1FNW A;  3AMU A;  3HOY H;  1D5X C;  2PQE A;  1M90 C;  2FIN B;  3J80 E;  2RBM A;  1R9T H;  3CMA A;  3QOL A;  1C48 A;  4A3C H;  3KK7 A;  1EQV A;  5HGT A;  1X6O A;  3F1Z A;  4A3D G;  4DV6 L;  4RKL A;  3RZD B;  4LFA L;  3K0Y A;  2D2C C;  3T56 B;  5IP7 H;  3VR2 A;  5EJW A;  4P71 A;  2JA7 G;  4K6D A;  2QF7 A;  4ME3 A;  1QOH A;  4ILW A;  2IX3 A;  2AQ2 B;  4O2D A;  2QCP X;  4TKO B;  1FR3 A;  4DK3 C;  3I55 A;  3GTJ B;  1HZ9 A;  2KUM A;  1AZP A;  1EYA A;  3GO5 A;  2MQH A;  3DM3 A;  2LXK A;  2JN4 A;  2RDH A;  1V43 A;  4GN5 A;  4I65 A;  2O5I C;  5IYD H;  3BVG A;  1Q81 C;  4L5R C;  3CD6 A;  4KV6 A;  1E24 A;  1A2T A;  4C3J G;  4EVO A;  2VQE Q;  2XN9 C;  4IOC A;  4DR4 Q;  1VQF A;  3QG1 A;  4JYA L;  4EQO A;  3DXJ C;  3EVQ A;  2KJX A;  3CRL C;  1Q12 A;  1TKW B;  4DR1 L;  1SE2 A;  5HY6 A;  1M1K C;  1E22 A;  3K57 A;  1TU2 B;  5C3E B;  1U4R A;  1IL2 A;  1PZJ D;  1RKN A;  2F0U A;  1WTV A;  1ASY A;  1IBL Q;  1QVG A;  5CBE E;  2EQS A;  2HDM A;  3CP0 A;  1HJP A;  1VQL A;  2K33 A;  1K3R A;  5JPN C;  1GO3 E;  1PFN A;  2N3S A;  3U9O A;  4U68 A;  4DU9 A;  2CHB D;  3EQL C;  1JOK A;  2OTJ A;  1CT1 D;  1NCV A;  3SEB A;  2PI2 A;  1HRJ A;  3GQB A;  4MIU A;  4QUF A;  2F0I A;  3CKI B;  2PW7 A;  5KNC A;  1QWY A;  4XYO A;  4XT3 B;  1SJH D;  2K75 A;  4G7Z C;  3MFG A;  2KOL A;  2UUC L;  2JA8 H;  3D4R A;  1JJC B;  2XNA C;  4G7H C;  4WJ3 M;  2ASB A;  3K8A A;  2RQX A;  1KRT A;  3GTO B;  1GJX A;  2XRS D;  4Q5V A;  1LTT D;  3DHQ A;  4DV0 Q;  1YNJ D;  3RZO H;  2KQ3 A;  1BF4 A;  1W3S A;  1MBY A;  3OIQ A;  3PUX A;  3ULJ A;  4L63 B;  2F0T A;  4CKC A;  2ZJP A;  1H9K A;  5C6A A;  3CPW A;  1N36 L;  3OIP A;  4CKB A;  1IYV A;  1X3E A;  3NUC A;  1SND A;  2WKD A;  4KK7 A;  2ZXP A;  5JEA J;  3NTH A;  3GTO H;  1EL0 A;  3NBI A;  5M5Y B;  4YWK A;  4C3H B;  1XMO L;  3EN2 A;  3RUZ A;  4C1N K;  2JEB I;  4HED A;  4LJZ C;  2WB1 G;  4X3U A;  1ROD A;  3QJY A; 
#chains in the Genus database with same CATH homology
 3GV3 A;  3JAM L;  3K7A B;  1HA6 A;  2ZXO A;  3BYY B;  3DWQ A;  5J39 A;  1CTM A;  1X32 A;  1SNP A;  2B8G A;  4IZ8 A;  1S5E D;  1KAA A;  2A6E D;  3L3O C;  1NSN S;  2D62 A;  1HQR D;  1I4P A;  1FYC A;  1PRT F;  3FVQ A;  3PIP 3;  3I4M B;  4F7X A;  4DXF A;  5BN3 A;  4IQZ A;  3GTQ B;  1TWC B;  4LMQ D;  2F0J A;  4FO2 A;  3IL8 A;  4TSS A;  4FF2 A;  2L55 A;  4A3K B;  3S2H B;  1SNQ A;  1C4Q A;  4M8A A;  2QEJ C;  1CFM A;  5JAV A;  3QIA A;  2WKC A;  4RKB A;  1O7L A;  3K5O A;  3NWS A;  5IGC A;  1CA6 A;  1LT5 D;  4IFD I;  5M3M B;  2R61 A;  2PMZ B;  3X3M A;  4A3I B;  2CW0 C;  3A7A B;  1ENF A;  4E6I A;  4RH6 A;  4ID6 A;  1PRT C;  1G6Z A;  3FPP A;  4KTA A;  2KCC A;  3HOX B;  4J8Q A;  4KJO A;  3L9A X;  3S1M B;  2D5D A;  5DM6 3;  1I4R A;  1TY0 A;  1UUP A;  3MFY A;  2EOT A;  2DNE A;  1V8Q A;  1EY4 A;  1AW7 A;  5I6W A;  2M00 A;  1G29 1;  3SK8 A;  3SR1 A;  1TWG B;  5C0X H;  1G2S A;  1V1P B;  1PZI D;  2PZW A;  1TT2 A;  5A2Q E;  1I50 B;  1FGB D;  4IFD G;  3JAM E;  4RA8 A;  3SE0 A;  1SFO B;  2XRQ D;  3NPP A;  3IFT A;  2F0O A;  1OXU A;  2X69 A;  1DCZ A;  4G4K A;  2H4O A;  4A3D B;  2DY8 A;  4B9X A;  1IW7 D;  3HEJ A;  1B9N A;  1HUN A;  5EBC A;  3Q23 A;  2XVS A;  1TR5 A;  4HSV A;  5BN4 A;  4DK0 A;  1Q8I A;  3NXW A;  1STH A;  4PQX A;  2JYO A;  2F0D A;  4R8N A;  1WCM B;  4RGM A;  5M5W B;  3M7N A;  2A6H D;  3D6C A;  3R3O A;  3SK6 A;  1F2M A;  4KKS A;  2F0N A;  4CBV A;  1SSO A;  4C3J B;  5FO8 B;  4IUN A;  4TRD A;  2KEC A;  4K6L A;  2XWB B;  1H9J A;  3K5M A;  3H6M A;  1E0B A;  2XSC A;  4XT1 B;  2RDG A;  2JP1 A;  1HTP A;  1KDA A;  1XTC D;  5D3I B;  4DAV A;  2JE6 I;  1Z7T A;  2CW0 D;  1XYI A;  3C3L A;  2NVQ B;  1F2Z A;  4I7Z C;  3O13 A;  4DAY A;  2DNC A;  1TWH B;  4M1U B;  1NR4 A;  3BS1 A;  2R3Z A;  5JOB A;  4NW2 A;  5C3W A;  2L5T A;  1T5X D;  1BCP B;  2L0C A;  5G3L F;  2BDO A;  1STA A;  3KUP A;  2EE1 A;  2BCO A;  3PO2 B;  3F2U A;  3A8K E;  4IFD J;  2K1B A;  2NVY B;  5KGU A;  3P75 A;  4L8J A;  1D1I A;  2EY6 A;  3N52 A;  3T53 B;  3HGB A;  2F0E A;  3GP7 A;  3BZD B;  2LS0 1;  4DNR B;  4FVM A;  1JB3 A;  1F77 A;  5COY A;  3PO3 B;  1STG A;  1GUT A;  2Y0S B;  1JOR A;  4KJN A;  3J81 L;  2WB1 B;  3K59 A;  2FJ2 A;  4KN7 C;  3I3C A;  3S14 B;  1A2U A;  3S1R B;  3FDT A;  4C3I G;  3OMC A;  3X3N A;  3DMU A;  3TBI B;  5ELC A;  2X6L A;  2YYZ A;  3H0G B;  4XDX A;  4WFN 3;  4RGN A;  1QG7 A;  1HQM C;  1STY A;  3E6Z X;  1OO9 B;  1B4O A;  2WIN B;  3M7G A;  1VMP A;  3ERO A;  3R8B A;  1IKL A;  3LNN A;  4EQN A;  1ESF A;  2NVT B;  4C2M B;  2BA0 A;  3ND9 A;  3I73 A;  3QB3 A;  3G7L A;  3GV6 A;  5IGF A;  1STE A;  4NMZ A;  1PZK D;  4EQP A;  1Y8N B;  1XWE A;  2J0T D;  4ZQ3 A;  4K5W A;  1CQV A;  1VMC A;  5KYL A;  4V0B A;  4RHR A;  5EKK A;  2ICE C;  2Q8I B;  1O7Z A;  2B2T C;  2PPB C;  2QDB A;  3FRP B;  2MHV A;  5C0X I;  2EZV A;  3P7J A;  3QO2 A;  3WOF A;  1SE3 A;  1A3U A;  3S15 B;  4DF7 A;  3RLF A;  5EBD A;  4X3K A;  2NWG A;  2Z4I A;  1LTR D;  1SXT A;  4OHJ A;  1HTL D;  2IPK D;  3OMG A;  3A56 A;  3A7L A;  2PNR C;  4ZUI A;  2RA4 A;  1U4P A;  4CJ2 C;  1I6H B;  2PZU A;  4OIK A;  3MWY W;  4A3G B;  5CR3 A;  2TMP A;  4IUV A;  1NUC A;  3I91 A;  3VR5 A;  1I4H A;  2B2U C;  3PMF A;  4BWG B;  3S17 B;  1YNN D;  4NP5 A;  1Q90 A;  5T1G A;  3J81 E;  1R4Q B;  1BQQ T;  5D3D A;  5KRU A;  1YNJ C;  4KKU A;  3W3A A;  2R7Z B;  5E1F A;  5C0X G;  1V1O A;  2EYP A;  1BXT A;  3UI2 A;  1MI2 A;  1WD1 A;  2A73 B;  3HP3 A;  2I46 A;  1D2B A;  3A54 A;  2A5H A;  1EFI D;  3BYT B;  5JEA G;  2JA5 B;  3BVM A;  1ENA A;  5C4Z A;  1D5Z C;  3HOV B;  1EY5 A;  3DWP A;  2WP8 J;  3VYS A;  1JCK B;  1CHP D;  3OW7 A;  4DA2 A;  4L6T B;  1CI3 M;  2SNM A;  3G6J B;  5C5L A;  5EKL A;  2A6E C;  5ELB A;  5EKI A;  2HCI A;  4PV1 C;  1NAP A;  2E2I B;  4DXG A;  4BY1 B;  2A74 C;  3S16 B;  4IN3 A;  3VA5 A;  1IHZ A;  3KBG A;  1DON A;  4HMI A;  1BUV T;  2M9V A;  3ZYY X;  2BDN A;  1SE4 A;  3HZX A;  4FF1 A;  4KN4 C;  1NR2 A;  1CK1 A;  5I2Y A;  1BOS A;  5CV4 A;  5CV7 A;  3VR3 A;  5C5M A;  3NQI A;  4LAA A;  5CGK A;  4G7O C;  1QJO A;  1JC7 A;  1AP0 A;  3K58 A;  4A3F B;  2EPB A;  2EJG C;  3J7A F;  2PZT A;  2K32 A;  3D6W A;  2RSN A;  4J1M A;  5C0X J;  3BVZ A;  5CV5 A;  3NTI A;  4FXD A;  1O78 A;  2H1E A;  4IAL A;  1Z6H A;  3IFD A;  1CHQ D;  1Q3L A;  1WVL A;  1EY0 A;  4X3S A;  1MSH A;  1ML0 D;  4PMB A;  4KY6 A;  5DM7 3;  3T13 A;  1GOZ A;  1Y1W B;  4C56 C;  3VYU A;  4C3I B;  1ILP A;  2EYJ A;  4ZRZ A;  1LT3 D;  2BOS A;  1Y8O B;  1E2Z A;  1W6J A;  2Q8R E;  1PTO B;  1GUN A;  2SDF A;  1MGS A;  2F0L A;  1MSG A;  5EPK A;  1JIC A;  2VNU D;  2EYH A;  1EU3 A;  3DWA A;  3RD4 A;  5FO9 B;  2GA4 B;  4RFB A;  3DUZ A;  3U9S A;  1LTI D;  1B53 A;  3QWN A;  1BDO A;  1PTO H;  3C1F A;  3TME A;  1EOT A;  2F4I A;  1TQO A;  2RSO A;  3S2D B;  2IT1 A;  1IW7 C;  4A3M B;  2E76 C;  2OXP A;  3D3R A;  3GD7 A;  5IGE A;  1SDF A;  1U4M A;  3I72 A;  5CV8 A;  5CC4 A;  2F0G A;  5K36 G;  2A6H C;  2EYM A;  2F3W A;  3KF8 A;  3C46 A;  2Q8T A;  3NWT A;  4HCE A;  5JVH 3;  4K5X A;  2NTS A;  3SXH A;  2K6A A;  2F0V A;  2G9H D;  1F9R A;  2XWJ B;  1PFM A;  3NQT A;  1G8Z D;  2K04 A;  4MHE A;  2CQA A;  4K5V A;  4H44 C;  2RDF A;  3Q0A A;  1PYW D;  3VA7 A;  2B2Y C;  2FFK B;  4WOR A;  2ICI A;  4DNT B;  1WD0 A;  1CA5 A;  1HA5 A;  1PTO D;  5HUR A;  1RTO A;  4S3S A;  2EY1 A;  4A93 B;  1WTW A;  3PUY A;  2C5C A;  5D65 A;  2PCF B;  1ESR A;  3Q22 A;  2MJ8 A;  1VF5 C;  3I4L A;  2F1M A;  1XX8 A;  3CU7 A;  5IGG A;  3Q24 A;  2E2D C;  4B9W A;  1FD7 D;  1CZW A;  1DOL A;  4QF4 A;  3R2T A;  1BCP F;  2BE5 D;  4ODG A;  3NSW A;  3H91 A;  5CV6 A;  5EGT A;  1SMY D;  3C1E A;  1AZQ A;  1A3V A;  4DGZ A;  1ENC A;  1KNA A;  1SYG A;  4OL7 A;  1U4L A;  3PV0 A;  4CJ0 B;  2JA7 B;  5CYU A;  5KYI A;  1EU4 A;  2N55 A;  5CBA E;  4P2C B;  3LWU A;  3URY A;  4CGY B;  4BA1 I;  4RHS A;  4WJW A;  4QCL A;  4ZAI A;  2MGS A;  3VYR A;  1WTX A;  4PMW A;  1I3Q B;  1RF2 D;  2LY7 A;  4LK1 C;  1BCP C;  2F0H A;  1EZ6 A;  4OO1 H;  4ZYS A;  1Y8P B;  1BO0 A;  2FMM A;  2IJ0 A;  1RDP D;  5ELE A;  1SNC A;  1K8O A;  5ISR A;  1FNU A;  1DOM A;  4J6H A;  1SYD A;  4X3T A;  1IYU A;  2FMC A;  5ELF A;  1KDB A;  2WV6 D;  4FXK C;  4KMU C;  1JOQ A;  2ZT9 C;  1II3 A;  4O42 A;  3DM1 A;  4H13 C;  4R9W A;  1U9R A;  1ET6 A;  3VR4 A;  2YU9 B;  3LX0 A;  3RMH A;  1D5M C;  1LT6 D;  1ONL A;  2B2V A;  1STB A;  5BN5 A;  2IW3 A;  1HCZ A;  4MN3 A;  2B2V C;  3IAY A;  4HSP A;  1TVX A;  3PUW A;  2R6G A;  2HCC A;  1B3A A;  2E2H B;  1I6V C;  1YNN C;  2D9U A;  4K2K A;  1GXD C;  1Q1E A;  4UAI A;  1KLG D;  3I70 A;  1H9S A;  4KKT A;  2L11 A;  5C44 B;  3VR6 A;  1JOO A;  2VUM B;  1E2W A;  1ZXT A;  4Y7N B;  1KNE A;  4RCO A;  3T16 A;  1ILQ A;  3FKI B;  3HOW B;  2E2J B;  3VYT A;  4OIJ A;  4QUC A;  1WTQ A;  2EJM A;  2EXZ A;  2K5W A;  3D31 A;  3V05 A;  1B50 A;  1QCB D;  2DY7 A;  1BCP D;  2PO4 A;  1DXM A;  2KED A;  4KI0 A;  2L4N A;  3FPU B;  2B2T A;  4YIJ A;  4RGO S;  4ABN A;  4DFA A;  1C8C A;  1ZYR D;  5DNF A;  4RAU C;  2K28 A;  2J4X A;  2QKI C;  2KEE A;  1QNU A;  3T51 B;  2NZ1 D;  1IL8 A;  1HUM A;  2K03 A;  1K8M A;  5COR A;  1GUW A;  3NE5 B;  3KLS X;  1A6X A;  1T5E A;  1WTP A;  5KNB A;  1J8I A;  5IT9 L;  2B2U A;  1UEA B;  1EYC A;  4FNF A;  4HCS A;  1F9S A;  4XIG S;  3A8J E;  1F2Y A;  1EQT A;  1UAP A;  2IX0 A;  1DZ1 A;  1SEB D;  5E4W C;  1CZG A;  1L0X B;  5T1I A;  1ZEQ X;  2AQ1 B;  4RGT A;  2ZXR A;  5FOB B;  3AU7 A;  5I4D A;  1O7Y A;  3HG9 A;  1LTG D;  2SEB D;  1EEI D;  3HOY B;  5E3F A;  1VCI A;  3A8I E;  1R9T B;  1VDZ A;  2NN6 H;  4OO1 I;  1GUS A;  2EYL A;  1TS3 A;  1EY9 A;  1RCV D;  3H94 A;  3FEW X;  4KHV A;  3TP8 A;  2B2W C;  1ET9 A;  2O5J C;  3MAQ A;  4K14 A;  2JXM B;  4KD4 A;  1R4P B;  1BBX C;  2AWO A;  4GZY C;  2IWH A;  2OEO A;  3S1N B;  4DAP A;  2KCN A;  3GTM B;  2ENB A;  1CM9 A;  1I4G A;  1HHV A;  1VF7 A;  5E4X A;  1OXS C;  3CRK C;  5FO7 B;  1PTO F;  1SJE D;  1SNO A;  3P20 A;  1G91 A;  5C3X A;  5M9O A;  5EPJ A;  1PFB A;  5EPL A;  1Y1V B;  2LMC B;  3SHL A;  1JQY D;  2A68 D;  3M4Y A;  4OO1 G;  4H7B A;  1SYB A;  2F03 A;  4A3E B;  1QE6 A;  1EYD A;  1DM0 B;  2K5D A;  5FK9 C;  3D4W A;  3OHX C;  1KTK A;  5KEE A;  4CKE A;  3WDN A;  1WTR A;  2WAC A;  5IT9 E;  4XYQ A;  1PLF A;  3TZD A;  4O1N A;  1TS5 A;  1SYF A;  3K5N A;  2EDG A;  5NUC A;  3BDC A;  2FHT A;  3D4D A;  2JA8 B;  4N9T A;  4OGQ C;  1SNM A;  4PMC A;  1A3T A;  4K2L A;  5LL6 X;  3FMC A;  4JBW A;  1PTO C;  2VXW A;  3RZO B;  1TWF B;  1LTS D;  4C1N I;  2JSO A;  1WTO A;  1EWH A;  1M4V A;  1F9P A;  5IOD A;  1S5F D;  3MC0 B;  1EEF D;  4V19 0;  2X6G A;  2N88 A;  4KY5 A;  2HUG A;  2TSS A;  2VB3 X;  3MHB A;  1I4Q A;  4XQN A;  3TSS A;  4ZKC B;  3V96 A;  2Z4H A;  2O2L D;  1BNZ A;  2F0Q A;  1GHK A;  1D1K A;  3SVM A;  5I9O A;  2B63 B;  5FLX L;  1KAB A;  2PYK A;  2J7Z A;  3EFX D;  1GUG A;  4H0L C;  3TZU A;  3BDO A;  3WOE A;  4A3J B;  2CVR A;  1B9M A;  3E0J A;  2BE5 C;  4IUT A;  1BR9 A;  2LFN A;  2SOB A;  1SMY C;  5A2Q L;  4F88 A;  2AWN A;  5TSS A;  2WAQ B;  3I90 A;  2B8F A;  5M5X B;  4G57 A;  4IUU A;  5FKA C;  2WII B;  4EGV A;  5IGD A;  3PUZ A;  5I6Y A;  3KLS A;  2JA6 B;  3GTG B;  3OWE B;  3SK4 A;  2EYF A;  2RVL A;  3M4O B;  1LAB A;  4XTC S;  1RHP A;  2K05 A;  5D14 A;  1G2T A;  4ZKB B;  1S5C D;  3NK9 A;  4NDX A;  2HDL A;  1HFN A;  1ZKO A;  5IIF A;  1F2L A;  3HRZ C;  2E75 C;  2EY2 A;  5KND A;  3MA2 B;  3TDQ A;  3H3V C;  2NBF A;  2B2Y A;  2EVB A;  2BA1 A;  3OOC A;  2MP1 A;  3CHB D;  1JWU D;  1LO5 D;  1V1P A;  4XQQ A;  4Q0F A;  4Z9C B;  3PUV A;  1W6K A;  3V2T A;  1SAP A;  1Q1B A;  3K5L A;  2NN6 I;  1PXU A;  2A69 C;  1E2V A;  1EY7 A;  5DAU A;  1SYE A;  1TS4 A;  1PMR A;  1EY6 A;  3MEH A;  2RKS A;  2L12 A;  4HTH A;  5C4H A;  3H09 A;  2B39 A;  2K7V A;  4KY7 A;  4ULL A;  2PW5 A;  5A35 A;  4NKL A;  1HPC A;  2F0P A;  3IKJ A;  2V4D A;  1LTA D;  3KLR A;  3N6R A;  3GTL B;  3SDZ A;  5FLX E;  3M3Y B;  1UNS A;  3NHH A;  1I4X A;  1STN A;  2M2L A;  1DOK A;  1PRT B;  2F0S A;  2R92 B;  2QIL A;  4DK1 A;  5CMD A;  3HKZ B;  1AFP A;  4BA2 I;  4BS9 A;  4CHT B;  2NN6 G;  4HMJ A;  2HQE A;  4XQJ A;  5K5P A;  2L1B A;  3Q6S A;  4FF3 A;  2C9O A;  1OXX K;  2AQ3 B;  3W2D A;  5I2X A;  2VB2 X;  5JEA H;  2EY5 A;  1LTB D;  1LT4 D;  4BBR B;  2SNS A;  3A55 A;  2AUJ D;  4ME5 A;  1QNK A;  4RWS C;  2XIW A;  4HR7 B;  4XXE A;  5LL6 S;  3MXG A;  3KBX A;  2ID0 A;  1RJT A;  4WRD A;  4QIW B;  1X3P A;  3NTK A;  3HOU B;  3OSO A;  1K83 B;  3MXP A;  1TII D;  3ITP A;  1HFG A;  2OF1 A;  2MUY A;  1JR0 D;  1ZYR C;  1DYQ A;  1X3Q A;  2A69 D;  4KD3 A;  4ZK9 B;  3MVV A;  1QB5 D;  3TP5 A;  1MD2 D;  1PRT D;  4AYB B;  1S5D D;  2NVX B;  1B1Z A;  4IUR A;  3T4A C;  1KDC A;  1L0Y B;  1GHJ A;  4IUQ A;  3NP8 A;  4K8I A;  4K8J A;  2NUC A;  5JVG 3;  4QB4 A;  2JEA I;  1Z47 A;  2Z1C A;  2LKV A;  1EZ8 A;  1Y69 U;  3ERQ A;  4KHZ A;  2F0F A;  3OWF A;  4CJ1 B;  4N9P A;  3LWE A;  5JJZ A;  1TWA B;  3PIO 3;  1GUO A;  4A3B B;  1XXG A;  3DEP A;  1A15 A;  1EIH A;  1DJR D;  2F0K A;  4FP5 D;  1D6E C;  2G9D A;  4TQU S;  3R93 A;  4IUP A;  2NYZ D;  1QIL A;  4BY7 B;  1JWM D;  4U67 3;  3S1Q B;  2E74 C;  4QMG A;  2L9H A;  3BDL A;  2R93 B;  3SK5 A;  4JK1 C;  4ZUJ A;  3TP6 A;  3MTS A;  3J7Y W;  3QOJ A;  3L7Z C;  1J9O A;  2I07 B;  4C3H G;  5AFW A;  4B08 A;  5F2D A;  4R8I A;  2KVM A;  1H9M A;  4FF4 A;  4HAE A;  2KA7 A;  3P1H A;  3MXU A;  5J22 A;  1PDQ A;  3J80 L;  5IGB A;  1O80 A;  2KHS A;  3ND8 A;  1JWS D;  2AUK A;  5JPM C;  5LHY 1;  3C2P A;  1S5B D;  4F8M A;  5CV9 A;  3K6O A;  1TY2 A;  5KIX A;  5C4J B;  3ONA B;  4HN7 A;  3NBH A;  1JE4 A;  1H9S B;  1LLR D;  1KLU D;  5K36 H;  2F3V A;  1EIG A;  5C4X B;  2IX1 A;  3D8G A;  1B2T A;  3EJI A;  3I4N B;  1DD2 A;  1EWC A;  3E5S A;  3AB9 A;  3BG3 A;  5J1Z A;  2A68 C;  2EYO A;  3MXN A;  4FYD A;  1HXY D;  3GTK B;  2F0M A;  1H9R A;  5M3F B;  2OT2 A;  1B44 D;  1M8A A;  1OXT A;  2Z8L A;  2F0W A;  4ZLT F;  2NTT A;  3MZ5 A;  4DN4 M;  5I9P A;  5IOC A;  1LV9 A;  3I8Z A;  1IKM A;  4PNY A;  3S9W A;  2NB0 A;  3OPO A;  1LAC A;  3HOZ B;  1AEX A;  5ELD A;  4BBS B;  4UDU C;  3R2I A;  2EJF C;  3J7A V;  1RD9 D;  1EY8 A;  3TN2 A;  5EQ0 A;  1OXV A;  1TS2 A;  1CQF A;  3DEO A;  5DEH A;  1S4Z A;  3GTP B;  2MPM A;  1F9Q A;  4F87 A;  1ICW A;  4RCN A;  3EA6 A;  3HS0 C;  2K01 A;  2O4X A;  1AN8 A;  3TP7 A;  1RTN A;  4FXG C;  2IL8 A;  3CQZ B;  2DN8 A;  1SBB B;  1FNV A;  4IFD H;  1SYC A;  3M85 A;  5G3L D;  2B2W A;  2K5Q A;  1FNW A;  3AMU A;  1D5X C;  2PQE A;  2FIN B;  3J80 E;  2RBM A;  3QOL A;  1C48 A;  3KK7 A;  1EQV A;  5HGT A;  4RKL A;  3RZD B;  3K0Y A;  2D2C C;  3T56 B;  3VR2 A;  5EJW A;  4K6D A;  2QF7 A;  1QOH A;  4ILW A;  2IX3 A;  2AQ2 B;  2QCP X;  4TKO B;  1FR3 A;  3GTJ B;  2KUM A;  1AZP A;  1EYA A;  3GO5 A;  2RDH A;  1V43 A;  4I65 A;  2O5I C;  3BVG A;  4KV6 A;  1A2T A;  4C3J G;  4EVO A;  2XN9 C;  3QG1 A;  4EQO A;  3DXJ C;  2KJX A;  3CRL C;  3EVQ A;  1Q12 A;  1TKW B;  1SE2 A;  3K57 A;  1TU2 B;  5C3E B;  1U4R A;  1PZJ D;  1RKN A;  2F0U A;  1WTV A;  5CBE E;  2HDM A;  2K33 A;  5JPN C;  1PFN A;  3U9O A;  4U68 A;  4DU9 A;  2CHB D;  3EQL C;  1JOK A;  1CT1 D;  1NCV A;  3SEB A;  1HRJ A;  3GQB A;  4MIU A;  4QUF A;  2F0I A;  3CKI B;  2PW7 A;  5KNC A;  1QWY A;  4XYO A;  4XT3 B;  1SJH D;  4G7Z C;  3MFG A;  2KOL A;  3D4R A;  2XNA C;  4G7H C;  2RQX A;  3GTO B;  1GJX A;  2XRS D;  4Q5V A;  1LTT D;  3DHQ A;  1YNJ D;  2KQ3 A;  1BF4 A;  3OIQ A;  1MBY A;  3PUX A;  4L63 B;  2F0T A;  4CKC A;  1H9K A;  5C6A A;  3OIP A;  4CKB A;  1IYV A;  3NUC A;  1SND A;  2WKD A;  4KK7 A;  2ZXP A;  5JEA J;  3NTH A;  1EL0 A;  3NBI A;  5M5Y B;  4C3H B;  3RUZ A;  4C1N K;  2JEB I;  4HED A;  4LJZ C;  4X3U A;  1ROD A;  3QJY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...