1HTPA

Refined structures at 2 angstroms and 2.2 angstroms of the two forms of the h-protein, a lipoamide-containing protein of the glycine decarboxylase complex
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
131
structure length
131
Chain Sequence
SNVLDGLKYAPSHEWVKHEGSVATIGITDHAQDHLGEVVFVELPEPGVSVTKGKGFGAVESVKATSDVNSPISGEVIEVNTGLTGKPGLINSSPYEDGWMIKIKPTSPDELESLLGAKEYTKFCEEEDAAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-PROTEIN
publication title The lipoamide arm in the glycine decarboxylase complex is not freely swinging.
pubmed doi rcsb
source organism Pisum sativum
molecule tags Oxidoreductases(acting on ch-nh2 donor)
total genus 35
structure length 131
sequence length 131
ec nomenclature ec 1.4.4.2: Glycine dehydrogenase (aminomethyl-transferring).
pdb deposition date 1995-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01597 GCV_H Glycine cleavage H-protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1htpA00
3A7LA 3FPPA 3MFYA 1H9RA 2JE6I 3LNNA 4KKSA 1QJOA 2A69C 2EVBA 2K33A 1VF5C 3T56B 3WDNA 2A6HD 1T5EA 1OXSC 2F1MA 3EQLC 2IT1A 3IFTA 2A68D 2AUJD 3MXUA 1Z6HA 4DK1A 3CRKC 2DN8A 2BE5D 3PUYA 3BG3A 2AWOA 3T51B 1VCIA 2A6EC 1BDOA 1DD2A 2R6GA 1VDZA 3A8JE 1A6XA 4IFDG 2V4DA 1Y8PB 2DNEA 2NN6I 3OOCA 1H9SA 1HTPA 1OXTA 1H9JA 4DNRB 1V43A 1YNJC 3BDOA 4H44C 2B8FA 1GUSA 1H9MA 5BN3A 3OPOA 2E74C 4XIGS 3D4RA 2O5IC 3KLRA 3D31A 1G291 2PCFB 3LWUA 3PV0A 1B9MA 3PUWA 4KI0A 1TU2B 1CTMA 3RLFA 1H9KA 2EDGA 5A35A 1FYCA 1IW7D 1HQMC 2EJGC 2PPBC 4KMUC 3QJYA 2JXMB 3VR2A 5BN4A 4DNTB 2A6HC 2AUKA 2PNRC 3N6RA 1V8QA 2E76C 3PUVA 1E2WA 3VR3A 1OXXK 2NN6G 2L5TA 1K8MA 2NN6H 2QF7A 2EJFC 3W3AA 1GUTA 4XTCS 1EWHA 2A69D 5KNCA 5K36G 1GUGA 5K36H 1VF7A 2BE5C 4KKUA 1FR3A 4DK0A 4GZYC 1GUOA 3HGBA 2BA1A 4RCNA 1I6VC 1ZKOA 1Q1EA 3GQBA 3VR6A 1Y69U 2LMCB 1GUNA 4KHZA 2EJMA 3FMCA 3PUZA 4LK1C 5KNDA 3T53B 4TQUS 1H9SB 1OXUA 3AB9A 4G7HC 3H94A 1Q12A 4G7ZC 4G7OC 2JEAI 1LABA 3OW7A 3I72A 4KN7C 3A8IE 5BN5A 1HCZA 1GJXA 3IKJA 3SDZA 1IYUA 3QIAA 1Y8NB 1Y8OB 4H0LC 3DXJC 3P20A 4PV1C 5JEAG 2D5DA 2CW0C 3ND9A 1OXVA 5JEAH 3SE0A 2Q8IB 3CRLC 4LJZC 2D2CC 4BA1I 1HPCA 1IW7C 2ZT9C 4KKTA 2A68C 1O78A 4KN4C 2BA0A 4L8JA 1GHJA 3I73A 2K7VA 2BDOA 2JEBI 2DNCA 2K32A 2KA7A 3TZUA 3NE5B 3A7AB 3A8KE 3I4LA 1YNNC 3M7NA 1O7LA 1ZYRC 2A6ED 1ONLA 1E2ZA 4OO1G 4OO1H 1TKWB 3PUXA 3QG1A 3M4YA 4JBWA 1K8OA 3M85A 4H13C 4OGQC 4HR7B 3VR4A 2B8GA 3GD7A 3ND8A 1LACA 1Z7TA 3U9SA 1DCZA 2YYZA 1IYVA 2KCCA 1B9NA 3VA7A 4IFDH 2O5JC 1PMRA 5KNBA 4TKOB 2E75C 1CI3M 3L7ZC 1CFMA 1E2VA 1SMYC 4JK1C 3VR5A 1Q90A 4BA2I 4IQZA 5C0XG 1Q1BA 2D62A 1GHKA 1DXMA 5C0XH 4I7ZC
chains in the Genus database with same CATH superfamily
4CGYB 2EPBA 4P72A 1N34Q 1M90C 3G48A 3NWSA 1AZPA 2AUJD 1Z6HA 4LFCL 1DJRD 1VCIA 2K05A 1XPUA 5DM73 2QCPX 4ZLTF 3E0EA 3S15H 3S1QH 2A8VA 1C48A 2I07B 1IBKQ 4C3HG 4YCVA 3Q24A 3FEWX 1NSNS 1G2TA 2KUMA 4GNXB 3PSIA 3PV0A 1B9MA 1B3QA 1WTQA 4A93G 1L2FA 3G71A 3I4MB 1PH7A 2JA6B 3M3YH 1EZ6A 5C5MA 4C3IH 1Y1VG 3PO2G 1BCPC 4QF4A 3EBEA 4N8FA 2HDLA 2QGQA 5E4WC 3VR2A 1K3BC 4DNTB 1SE8A 3I55A 2MO1A 5EBDA 1ASYA 5IE8A 2SNSA 4A3IH 2H4OA 1QG7A 4B9WA 4JI0Q 3G4SA 3NTIA 1I3QH 2H1EA 3ICEA 1QCBD 4IPHA 2EJMA 2MHVA 1BVSA 1JWMD 2F0FA 5C4XG 1I4RA 2RCNA 4G7ZC 5AFWA 3F2UA 4NXML 3I91A 3PO3B 1FNUA 3S2HB 4QB4A 3I72A 3ERSX 4KN7C 3CXCA 4CJ0B 5D3IB 4HAEA 5JEAG 2ES2A 2B2TA 4JI4Q 2B2WA 3DUZA 1CKNB 1JICA 3P1HA 4KKTA 5J3BA 1XNQQ 1BXTA 4BY1B 2VQFQ 2XRQD 1KRTA 1B3AA 2VB2X 4LF5Q 3GTPH 2K7VA 2BDOA 3NUCA 2HIVA 2Z6KC 4LFAL 3MXNA 3TZUA 3NE5B 2L1BA 2JN4A 4DR7L 3H09A 5IGCA 1HNXL 3K57A 1U4PA 2KQ3A 2VL6A 4N9TA 5CV5A 2F0EA 3PUXA 4ODGA 3D3RA 1F2YA 2JA5B 1B9NA 3VA7A 2MQHA 4KHVA 4DNIA 2HCIA 1CI3M 1TS2A 4J6HA 3NBIA 3K58A 4DV1L 5FO8B 4R9WA 1SNDA 2F0SA 3K6OA 1JWSD 5CV8A 1VS0A 1GOZA 4JOIA 1JB7A 1EY6A 4CDCC 3TP7A 3ZYYX 1IKLA 5EGTA 3MXUA 4K5VA 2K5QA 4OWTB 3T51B 2R7ZG 4CKCA 1WTRA 1JMCA 3HOXH 4CJ2C 5T1IA 1SAPA 1M1KC 4C3HH 5C3EG 3HOVG 5KIXA 4K5XA 4X65Q 4X6AH 4A93H 2NTTA 4MHEA 1SE3A 1SE2A 2E2HB 2MP1A 3A5UA 3AFPA 1Y1VH 3PO2H 5JPNC 2Z8LA 3QJYA 4MIUA 2A6HC 1V8QA 2BH2A 1VQBA 1SNMA 4ZCKA 5M5XH 5IT9c 2WAQE 3H6MA 4QCLA 4MNOA 3E5SA 3CF5A 4RAUC 2NYZD 4FF3A 4IUTA 3KF6A 1SROA 5C3EB 5IOCA 4XQQA 4RCNA 4XQNA 5LMNW 1E0BA 4DR4L 3K81C 5CORA 3T1HL 4NXNL 1X3PA 4BS9A 1C8CA 2PZWA 4IN3A 2K04A 3OMCA 5JEAH 2RVLA 1ICFB 4GKJL 4PNYA 2A5HA 2AQ2B 5L37A 1IW7C 2EIFA 3G6EA 2YTXA 1YEZA 2GA4B 2XVSA 2EY5A 1N32L 4YWMA 3CPWA 3CCQA 1JJGA 2KA7A 2DNCA 5F2DA 2HIXA 5J1ZA 1GM5A 4LW1A 4NW2A 4OGQC 1SNQA 3U9SA 3E6ZX 2Z6KA 1KAWA 2MFIA 4H02A 4JBJA 4KHPL 2QILA 4J8QA 5DEHA 2L9HA 4GN4B 4B3RL 3T56B 2I5MX 3OMGA 1RD9D 1S5FD 3IFTA 2WACA 3F2BA 2VB3X 2FXQA 3S9WA 4KV6A 2AWOA 2GVAA 5JAVA 4ME3A 4LF9L 2R7ZH 4RHSA 3V96A 4LFBQ 2F0IA 1O7YA 4B3SL 1XPOA 1DYQA 3IFDA 4PQXA 4XT3B 2WV6D 1GUSA 3HOVH 3E9HA 2HUGA 1PH2A 4JI6Q 2F0PA 3CCEA 1VQPA 4K0KQ 4DV1Q 2JA7B 1G6ZA 4CDEC 1ILQA 1SNOA 3R2TA 1OXXK 2SOBA 2XIWA 2L0CA 4X3UA 2EYLA 2B63B 3ER0A 1FGUA 4FNFA 5C0XI 1F9SA 5C44G 3NQIA 2KEDA 2UXBL 2JYOA 4KHZA 1WD1A 4OX9L 2BDNA 2BCOA 1EWCA 3KBGA 1HZAA 4J15A 2V1CC 1AN8A 4EQPA 1LT4D 4M8AA 3J81j 1XMQQ 3SDZA 4QIWE 5COYA 3P20A 3K5NA 2RSOA 4TRDA 1X54A 1PH4A 5G3LF 1PRTD 3P7JA 3HOZG 1NAPA 1Y1WB 3HKZG 3S17H 4DAMA 1WI5A 3TMEA 3JC66 3I73A 5I2XA 3FPUB 1ENAA 2B3GA 1O80A 5T1GA 4JI8Q 1PFBA 5EPKA 4APVA 5HURA 1F9RA 4B3TQ 3DWPA 1LLRD 4HCSA 3K5LA 3BYYB 1KIXA 5JVH3 4ZKBB 1K0SA 2B29A 1S4ZA 2F3WA 4QUCA 1IXRA 1STYA 3HOZB 3CAMA 1YVCA 3T16A 2OT2A 2F4VL 1MHWC 3GTLH 3K0YA 1FJGQ 3BDLA 4OXPA 2LKVA 3J7A5 3EROA 2CWAA 2EVBA 1JE5A 4U68A 2F3IA 2PO4A 3U4ZA 3GTMH 2JQOA 1NR4A 1A3UA 2Z0SA 4A3MB 1CSPA 2EXZA 2VQEQ 1QOHA 4Q5VA 2R6GA 2OF1A 2O2LD 2UUCL 1E7ZA 1VQHA 1BR9A 3MC0B 3Q0AA 1NY4A 3IAYA 1I94L 1YNJC 4X62L 3D6CA 3NSWA 1SDFA 4KJOA 4TSSA 2PW7A 4X3SA 5BN3A 3KK7A 2F0VA 1HR0Q 2UU9L 3C2PA 4DFAA 3CC4A 2Z4IA 3GTOB 1TR5A 3EIVA 1CTMA 3T1YL 3RLFA 4EQOA 2WFWA 1HQMC 5I9PA 3HOWB 1L1OB 1CM9A 2CH4W 4POFA 2K5WA 1DOKA 2PQEA 3FKIB 4GN3B 5DAUA 2E2IH 1W6JA 4P2CB 2H5XA 2XWBB 1SMXA 4DV2Q 3HGBA 1GVPA 4CBVA 1PYSB 5C44H 4AIMA 2QEXA 1H9SB 3NP8A 3FHWA 3BS1A 4JPBW 3MWYW 4WFN3 3OW7A 1CT1D 5BN5A 2I46A 1HCZA 1IYUA 3RUZA 4IJLA 5ELBA 1CA6A 3ULJA 2ZM6Q 3ND9A 4A3BB 2Q8RE 5CBAE 4JI2L 3CCMA 2D2CC 1HA5A 4JI5Q 4JG2A 3J80c 5M9OA 3M4OB 3CC7A 4OONA 5CC4A 1RTOA 1PTOC 1SSOA 3WOEA 1RHPA 1O7LA 3U50C 4B3MQ 4DR1L 4WJ4A 3AU7A 3VR4A 3BU2A 2DY7A 2KCCA 1VQNA 4IZ8A 2CWPA 3TQYA 4R8NA 1PFSA 3GTQB 3NQTA 1FL0A 5CV9A 4ZUIA 2PZTA 1HRJA 1TWAH 4IUUA 4DK3C 1ASZA 3HZXA 1MGSA 1PV4A 4UDUC 1BCPD 2RKSA 3WWVA 1MIUA 2NZ1D 2UUBL 4AQYL 1SNPA 3OWFA 3F2CA 2IT1A 1UUPA 4YWLA 1MKHA 1AH9A 4A3GB 1STNA 1JC7A 2QEJC 2OTJA 1KLGD 1EY5A 4DUZQ 3GTKB 4ZQ3A 4DXGA 1UE1A 4LNQA 2NVYH 4XYQA 3MXGA 4DNRB 4DR2L 1WOCA 3NBHB 2J7ZA 2E8GA 2E74C 1PRTC 1UE7A 2HDMA 2PQAA 2LS01 4EQ5A 2XTIA 5HGQA 1SBBB 2AKWB 4LF8L 2JXMB 1CZGA 2PNRC 1HA6A 1G6PA 5K36G 2IWHA 4XYOA 1B8AA 1IBMQ 3MEHA 4RFBA 1LTLA 1YHAA 1Y69U 4Y52H 1P16A 4B08A 5KNDA 4LK1C 1C4QA 2A1AA 4OL7A 2Z4HA 4FP5D 3L9AX 4X3KA 2Z1CA 1Q12A 2EOTA 2PI2E 3DMUA 4NPSA 3VYSA 1PYBA 2WB1B 1WTWA 1QE6A 1Y8NB 1Y8OB 1VQLA 2UU9Q 3CHBD 2VZAA 4IUQA 5LHY1 2B2YC 1AP0A 4LF4Q 1EQVA 4ZRZA 3S15B 3S1QB 3HOYG 3BJUA 4DV7Q 3CCRA 1BUVT 1Y14B 4R8IA 2K32A 1G91A 1MBYA 5AJ3L 5IP7G 2VW9A 3FDTA 4CHTB 1PTOH 4DAPA 3PIP3 2D9UA 4Z9CB 3KBXA 3M3YB 1KABA 4C3IB 3PCOB 2R61A 2WB1E 4HR7B 2ZXOA 2IX0A 1EYDA 2NVQH 1X32A 3H0GG 3SK5A 4JBMA 4QQBX 5FLMG 3CC2A 3L7ZC 1MSGA 4A3IB 1QVCA 4BBRG 3HG9A 1II3A 1NTGA 2J4XA 1C0AA 2I5HA 3J81L 1CUKA 5GADC 3B6YA 1I3QB 1SLJA 2A6HD 1QNKA 2EYJA 4DV6L 1HZBA 1X9NA 4L6TB 2PW5A 3JAMc 1IYJB 1F9QA 1G2SA 2FMMA 3A0JA 3MXNB 1L0YB 1KL9A 5M3MG 2CQOA 3A8JE 2G5DA 3I2ZA 5KYIA 2DNEA 1KAAA 3UI2A 4UP9A 2HQEA 4O42A 4DU9A 4HJ9A 3GTPB 3SK8A 1BF4A 5FOBB 1RF2D 4LMQD 1BNZA 2E5LQ 2L55A 1TWGH 2IHEA 3F1ZA 3HFZB 4BBSG 1ENCA 4FXDA 4RGOS 3H15A 4BY7H 2M2LA 2EDGA 1IW7D 4IOAA 5C6AA 2NVTH 2KECA 2DJFC 4C3JG 3J7AF 1EWIA 2KENA 4A75A 1EYAA 4CDFC 5FJ8G 5K36H 5FLXL 1VF7A 4LUZA 1YJWA 3HOXG 5ISRA 1K83H 5IGFA 5KGUA 4IPGA 2K1BA 1GUOA 1CHPD 1M4VA 3GQBA 3SK4A 4JI7L 1F2ZA 1JCKB 1VQIA 2JJQA 4G4KA 3K59A 1EYGA 4JI3Q 1HFGA 4RKBA 2B2VC 3S24A 5CR3A 3A8IE 4FDBA 4DKAC 1PHJA 3QIAA 3J81i 1T5XD 1B7YB 3EVQA 5M5YH 1CSQA 5H1SE 1I4HA 1SFOH 2AQ1B 4IFDI 1HPCA 1B1ZA 2N49A 2LXKA 4KN4C 3KOJA 2BA0A 3EN2A 1GHJA 3HOYH 1HHVA 4C3HB 4LF8Q 1CA5A 1QVFA 2GN5A 1IBLQ 4IALA 5IP7H 3I4LA 1YNNC 4DUYQ 1JJCB 3S1MH 4A93B 4HMIA 4DGZA 3GO5A 1LUZA 3NPPA 4UP8A 3KF6B 2B2YA 3M4YA 1Y1VB 3PO2B 3OTOL 4MN3A 3S2DH 1X3FA 2OXPA 1BCPB 3H0GH 2O5JC 5JJKA 4CDDC 1VQCA 3AEVA 5FLMH 2F0WA 1TWHH 1S5BD 4BBRH 2N8NA 1LTTD 2D62A 4DR6Q 1WCMG 2F52A 1EUJA 4L5TA 4O1NA 2K33A 1BBXC 4K8IA 2L4NA 3J80i 4N8X1 5C4XB 2F1MA 1HNZL 2A68D 3OYYA 3KLWA 1EIYB 4HSVA 1D5XC 4DV5Q 1VQEA 1R9TH 4A3EG 5M3MH 3I4OA 1BBUA 1AE3A 4JI1Q 2CKZB 2EQSA 5M5WH 1SYBA 3OIPA 1TIID 2YU9H 2L11A 1BKBA 4DPGA 4JYAL 4IO9A 4F87A 4BBSH 2A19A 3SXHA 4R4CA 3RZOH 3CQZH 4DV4L 1KLUD 1RJTA 2E2JH 3DHQA 4N9PA 3J7ZC 5J22A 4JW0A 1IZ6A 2O4XA 1A62A 1K28A 4KMUC 1PXUA 3TP6A 5BN4A 3UDGA 2WAQG 4C3JH 4X3TA 1Q81C 2K4KA 1K8MA 1JB3A 5DM63 1GUTA 1GUGA 5FJ8H 1PZID 3T4AC 1PH8A 1IKMA 4DV3Q 2ZXRA 1FR3A 5C3XA 3CCJA 3A56A 1STGA 1HNWL 4G57A 1VMPA 4CKEA 3S1RH 2RDFA 1V1PA 1N36Q 2YV5A 4OO1I 5LMNQ 4ZK9B 3OSOA 5CV7A 1BOSA 2CW0C 2R7ZB 1O78A 3TP5A 2RDGA 2L12A 3K80C 2N55A 3MTSA 4JCVE 2YTVA 2B2VA 1LTRD 1NJIC 1RKNA 2WKDA 2JEBI 2KHIA 4LFCQ 3HOVB 1O7ZA 1QB5D 2CVRA 1GUWA 5C0XJ 2NB0A 4O2DA 2DJGC 3VYTA 2DGYA 3EFXD 2NBFA 1Q7YC 1U4MA 4PG3A 2RSNA 4E6IA 4A3DG 3GD7A 3ND8A 1YNJD 1W2BA 1PMRA 3K0XA 4BY1H 1I5FA 3QOJA 3VR5A 5I6WA 1TWCH 3BZDB 5DLQE 1DXMA 1MI2A 1I4QA 1WCMH 2C5CA 2F3VA 3TREA 3NXWA 4DAYA 3LNNA 4NB3A 4O0AA 3TRZA 4OIKA 2LXJA 4C56C 1AW7A 4XQJA 5IIFA 2EE1A 5GAEC 1YIJA 5GQOA 3X3MA 1JJ2A 1HTLD 3DEPA 4A3JG 4LF7L 1U4LA 1JT8A 1TWFH 2A6EC 1K8GA 2P5ZX 4B9XA 4OWWB 1WTXA 4A3EH 5IYBG 3S17B 1J5EL 4I7AA 5FO9B 3GTJH 1Q3LA 3TSSA 1EY9A 4PMWA 4NXMQ 4RCOA 2HD3A 4FXKC 1KNEA 1XNRL 1VQAA 3PIPA 3D31A 2DUDA 4DR5L 3PUWA 1XPRA 1VQ8A 1EOTA 1WTOA 2RHQB 1VQGA 3GDEA 3S14H 1Z9FA 5KEEA 4LFAQ 3UDXA 1RODA 2CFMA 2F0HA 2LY7A 1UNSA 1V9PA 1NNXA 3W3AA 3G6JB 1PTOD 4DR7Q 3D8GA 1HNXQ 2CHBD 2L15A 2DY8A 3QR8A 3GV6A 3GTLB 2MJ8A 1STBA 1X6OA 2OEOA 2EZVA 2SDFA 3RZDH 1MJEA 1YHQA 3QOLA 1LTBD 4IPDA 4R4OA 4TQUS 1DOMA 2AWNA 5JJZA 5C4JH 1U9RA 3A54A 3GTMB 1UWVA 2NZHA 3BDCA 3NHHA 1XX8A 3IKJA 4DXFA 4DV0L 1PH1A 5FO7B 5M3FG 5CGKA 4BA1I 1X65A 2A68C 2NZOA 2R7DA 3J7AV 2HHHL 3RMHA 4XXEA 5C4HA 3KFUA 1JWUD 1PRTF 3A8KE 3PMFA 5IY0A 3I7FA 1D8LA 1QVGA 3R8BA 4HCEA 4OO1G 1DGSA 1N8RC 1BQQT 1Q46A 2K14A 4DR3L 2Q2TA 4A3DH 4GLVB 1SYEA 2N3SA 4IFDH 2E75C 2E2IB 4ALPA 3OW2A 1D1IA 3CKIB 1SYCA 1J8IA 3EA6A 1GXDC 4I7ZC 5C44B 3UE0A 4OELB 4WJ3M 1T5EA 5D14A 5GROA 1A2TA 4A3JH 2Z6BA 2I0QA 1CQVA 4RGNA 3TS2A 1BDOA 3IL8A 1JQYD 1WYDA 2EY2A 3DWAA 3HKZB 2B2UC 5IYBH 4DR4Q 4ULLA 3RN2A 3D6WA 3KDFA 3T1HQ 4NXNQ 1ESFA 2UXDL 3HOUG 3SGIA 3S16H 1EIGA 1G291 4NDXA 2KOLA 3KF8B 4GKJQ 1XWEA 1L0XB 2FFKB 4ID6A 1RCVD 4LF6L 1PZJD 2KHJA 2Y0SG 1N32Q 1O7IA 4RMFA 1PA6A 1M8AA 5IT9L 5LMUL 3N6RA 2WIIB 4XTCS 1F2LA 2A69D 2KHSA 3HKZE 1VQKA 4L5QA 4A3FG 4DK0A 2ZTDA 1TWAB 4CJ1B 2PMZB 3ERQA 3VR6A 2LMCB 3FMCA 2G9HD 1XMOL 4K14A 1L1OC 4G7OC 2Y0SB 1CHQD 1G51A 4KHPQ 3O13A 4R1JA 3DXJC 2RA4A 4XT1B 1OXVA 4B3RQ 5EKLA 5IWAL 3Q6SA 1NE3A 4LJZC 5M3FH 1K9MC 2PQAB 4YHHL 4QGUA 2UXCL 3RLOA 3J81E 2ENBA 2NVYB 5ELNA 2RF4A 4GOPC 4U673 2MNAA 4X64L 4J1MA 4BXXG 5I6YA 1A2UA 4LF9Q 3M7NA 1YHBA 3PQIA 1SR3A 1ZYRC 1QZGA 2JA8G 2R92G 5FKAC 3I4NG 2X6GA 1SYFA 4B3SQ 2WKCA 4OO1H 4DK6C 4UY8C 3M7GA 1LO5D 1VQ7A 1R4PB 1HR0W 2ZJQA 4A3CG 4MTNA 2ASBA 1P8LA 3STBC 1PH6A 1PH3A 1WTVA 1Q90A 5ELCA 3H3VI 5C0XG 4GN5A 3PIOA 2F0TA 1SRUA 2KBNA 3GP7A 1I6HH 5BR8L 2XSCA 1KDCA 1QJOA 1ILPA 3BVGA 3HRZC 2AQ3B 5LL6X 4RGTA 4HJ5A 2JSOA 3MHBA 3DEOA 5IYCH 4DK1A 5JJLA 3CP0A 2X6LA 4JV5L 3PUYA 1BCPF 3J80E 4AYBG 1NR2A 5FLXE 2UXBQ 2V4DA 1I4XA 4OX9Q 4X66L 2Q2HA 1N33L 1B4OA 1V43A 4H44C 2F0OA 1CKMA 4A3KG 3U58A 1GD7A 1NUCA 3VA5A 1S5DD 3HOUH 3TEHB 1PTOB 4YY3L 2BOSA 5KRUA 3BVMA 5DNFA 2UUAL 1PFNA 2B2UA 3QB3A 4TVAB 4H7BA 1MD2D 3DLLA 4AYBB 2NVQB 3MVVA 3RR5A 4KD3A 1N34L 5IGBA 3AFQA 4OEMB 1K73C 1YNND 2BE5C 4EVOA 5I2YA 4A3FH 1FNWA 3KYHC 1B50A 2F03A 2RBMA 2JK8A 3UDIA 1E22A 4FF2A 4CKBA 1GUNA 2QKIC 3N52A 4K2KA 1X3EA 3PUZA 4L63B 5EKKA 2VUMG 4BY7G 4IURA 1IBKL 2F4VQ 1E24A 3LWEA 2FMCA 1YJ9A 1V1OA 3IRBA 1KQSA 2F0GA 1TT2A 3D0FA 4PV1C 4C1NK 5J39A 2WP8J 4BWGB 1STAA 2EY6A 3X3NA 4ZAIA 4Y7NH 1G8ZD 5IGEA 1EU3A 1Z47A 1A3VA 4L5RC 2F0MA 1I50H 4DAVA 4GLXA 4BXXH 1TWGB 3SHLA 3A7AB 4IUVA 1U0LA 2J0TD 5GAHC 3F2DA 4RA8A 1SYGA 1PRTB 2R92H 3UDFA 2JA8H 3I4NH 4BY7B 2UUCQ 1R4QB 3QWNA 4JI0L 2K5VA 3TS0A 4JBWA 1I94Q 4X62Q 2NVTB 4FF1A 2NVXH 4HSPA 1TS5A 4GOPA 1TY0A 2M00A 2XWJB 1QILA 3J7YW 4A3CH 1CFMA 3T1YQ 4HMJA 4K5WA 1K83B 4HIOA 1S72A 4IFDJ 3S1NH 5C0XH 1SXTA 3L0OA 1Q82C 4KY6A 4JI4L 1I4PA 3FPPA 1A3TA 4IPCA 1J6QA 5ELOA 2A69C 1E3PA 1XNQL 3EQLC 2VQFL 4LF5L 4YIJA 3M4QA 5D3DA 3K7AH 4C2MH 1TXYA 1HUNA 2ID0A 4ME5A 1DD2A 5M5YB 2E2DC 5CV6A 3H3VC 1SFOB 1Y8PB 1F77A 5JOBA 2NN6I 1HTPA 3HOYB 4UP7A 4UPAA 3C1FA 1EL0A 2ZTEA 1H9MA 2C35B 3D4RA 4A3KH 1SJHD 3S1MB 1PH9A 1TU2B 2CW0D 4JI2Q 4P75A 2ICIA 2XGTA 2R93G 2EYOA 4V0BA 1ESRA 2EJGC 2FJ2A 3L2PA 3AQQA 3S2DB 3GTGH 1QUQA 3H0GB 4AH6A 4DF7A 1TWHB 1NMGA 2F0LA 1JR0D 4POGA 1OTCA 1DONA 4BBRB 1FNVA 2K50A 2MUYA 4S3SA 4DR1Q 2F0QA 1VQDA 4JC0A 4Q0FA 4F8MA 1UE5A 2IHFA 1OXUA 2RCFA 3H94A 2VUMH 1HZCA 3RLNA 4JOIC 1GJXA 3NBHA 4K6LA 1VQFA 1R9TB 3A74A 1LTSD 1T9HA 4R4TA 4X65L 2WINB 5M3MB 3J80L 2UUBQ 4AQYQ 5IP9G 2PI2A 1SN8A 5C3WA 5M5WB 3W5OA 2YU9B 4GNXC 5KYLA 4BBSB 1Q8KA 4A3LH 2A6ED 2KVMA 3H91A 3RZOB 3CQZB 3I4MG 2JA6G 2PZUA 2E2JB 2D0PA 4DR2Q 4IOCA 1OO9B 3QO2A 5C4ZA 1ZEQX 4C3JB 1HFNA 3TZDA 3SK6A 4ZYSA 1D6EC 1V1PB 1IHZA 3ONAB 5EPJA 1QZHA 1ET9A 3C46A 2HT1A 4BA2I 3HOXB 1LT5D 4KTAA 1KC8C 1AZQA 4FXGC 3MFYA 3OHXC 5I4DA 3S1RB 1VF5C 1OXSC 2IX3A 3PO3G 1EU4A 5HY6A 4HTHA 4V190 5E1FA 3DWQA 3FVQA 3ITPA 1E1TA 1EY0A 5M5XB 4BY1G 2VXWA 3H3VH 3D4WA 3CCVA 3RD4A 3BDOA 5CMDA 4ZKCB 2RHSB 5IGDA 2C9OA 1VQMA 3Q8DA 5JJIA 4LAAA 2MGSA 4JVZA 2D0OA 2KCTA 2R93H 2VS1A 3K8AA 1DM0B 3W2DA 2LSSA 1ET6A 4DAYB 4RWSC 2JA5G 2E76C 2B39A 3VR3A 2NN6G 5AJ3Q 1EFID 2ZJRA 4FVMA 1K0RA 3GV3A 3ULLA 1ZXTA 1TWCB 5TSSA 1NMFA 3MXPA 2IX1A 1WCMB 1HUMA 2RDHA 5GAGC 1KNAA 4EQNA 4LFBL 3F8TA 4GKKL 4QJFA 5ELFA 1JORA 1STHA 5EKIA 2JEAI 1D2BA 3R3OA 1TWFB 1U5KA 2D5DA 1GKHA 1NBWA 2CH4A 5HGTA 4A3EB 2Q8IB 3OIQA 3M9BA 4JI6L 2N88A 3GTJB 1X3QA 2ZT9C 5IP9H 4K0KL 3C1EA 4DV6Q 4L8JA 2K5HA 2LFNA 3HS0C 2F0KA 2EYPA 3KJPA 3E3XA 3E0JA 3PIO3 3U9OA 1ICWA 3I4MH 4KJNA 2JA6H 1TKWB 3S14B 3M85A 2F4IA 2TMPA 4H13C 3VYRA 1K8AC 2WAQB 1VQ4A 4GNXA 1LT6D 4TKOB 3FRPB 1JOOA 3NWTA 5EQ0A 3Q22A 2HQLA 1XMQL 2IY5B 1GHKA 5NUCA 1PVOA 3RZDB 2SEBD 5D65A 3JAML 4LWCA 4NP5A 5EAYA 5C4JB 1SYDA 3PO3H 2IW3A 4PZ6A 3EJIA 5IT9E 3M4PA 3S2HH 4JI8L 3P75A 4B3TL 4HJ8A 3A55A 3NTHA 3RNUA 4IFDG 4JI7Q 4EX5A 3T13A 1KDAA 2F0NA 5C5LA 1OXTA 1H9JA 1EEID 2O5IC 3OPOA 4XIGS 4QL5A 2PCFB 1RL2A 5C4XH 1CKNA 1H9KA 3E9IA 1FYCA 2IPKD 1FJGL 2KCNA 5I9OA 4I65A 2XRSD 4A3DB 2JA5H 3CW2C 3PUVA 1BBWA 3K5OA 5K5PA 3CCUA 2NN6H 4RHRA 4GS3A 4HIDA 1B2TA 1ZYRD 4HN7A 3TDQA 2KCMA 2VQEL 1UEBA 4WRDA 4YCUA 1FVIA 1LTID 1ZKOA 3OTOQ 5JVG3 1PTOF 2JA9A 2F0JA 4ZUJA 1KD1C 1YZ6A 3KDFB 1VQOA 1LABA 2Z9HA 1EQRA 1KHIA 3STBD 1HR0L 4FF4A 4A3JB 1MJCA 3ULPA 4EGVA 3SE0A 3CRLC 3JAMi 1CZWA 4DA2A 2ZXPA 1LV9A 1HNZQ 1KTKA 1LYLA 3FP9A 4IJHA 4IUPA 3C3LA 4OHJA 2K03A 5EBCA 3I70A 5ELEA 5CBEE 3S16B 3D4DA 3PF5A 4OIJA 1JOQA 2JA7G 2E2HH 2IL8A 1PDQA 3QG1A 4DV2L 1PFMA 1K8OA 4OWXB 1CKOA 1TQOA 4P74A 1WJJA 1Z7TA 1A8VA 1IYVA 4JYAQ 3MZ5A 1HZ9A 2K6AA 4GKKQ 4HJAA 4JK1C 3R93A 1KDBA 4DV4Q 2EXDA 4IQZA 2B63G 1Q1BA 5C3EH 1WVLA 2ZM6L 2EYFA 3NTKA 4UAIA 3LX0A 1IL8A 2GVBA 4JI5L 1PH5A 1RDPD 2VNUD 4QIWB 5IYDG 4UHVA 3I3CA 3ZJYC 1F9PA 2BE5D 2FHTA 2OQ0A 3BG3A 4PZ7A 4A4IA 1KXLA 1HNWQ 2ICEC 1Y1WG 3AYHB 5M3FB 1XTDA 4B3ML 1SJED 4A76A 4HEDA 2A74C 1EQTA 2B8FA 3PF4A 3DM3A 4ABNA 3BZKA 4LUOA 1DZ1A 3G7LA 3LGJA 1X56A 5IYCG 4C1NI 3TBIB 5A2QE 3CMAA 3HP3A 1E2WA 5IODA 1Q86C 5KNCA 3MAQA 2K28A 2XNAC 4KKUA 4M1UB 1C7YA 1B53A 1I6HB 1I6VC 2K75A 1X3GA 2EYHA 3NEMA 3KLSX 1EIFA 4DUZL 1J9OA 4P71A 5G3LD 3AB9A 3MEFA 2EYMA 4GLAC 4F88A 3L3OC 4A3MG 1L0WA 3CCLA 2BH8A 4PZ8A 2X69A 1DOLA 1TS4A 1EOVA 3I56A 4RKLA 1CQFA 2JP1A 1ML0D 1A63A 5EJWA 4KD4A 4LF7Q 1SNCA 3HOUB 3DM1A 1HXYD 2IJ0A 1VMCA 1ONLA 1AEXA 1J5EQ 1E2ZA 1VQJA 1IBML 1YNXA 1BO0A 2VY3A 2JA7H 5CYUA 1TVXA 4QMGA 2QDLA 3SR1A 3HOWG 4FO2A 3UE1A 1XNRQ 3RN5A 1LACA 1EY4A 2R7FA 4PMCA 1WTHA 2M9VA 3FKIG 5KNBA 1YBYA 4DR5Q 1I4GA 1D5ZC 1E2VA 4XDXA 4KK7A 4A3FB 1D7QA 2B63H 4YCWA 4KKSA 1EYCA 1H9RA 2JE6I 3VDYA 2PMZE 1PLFA 3WDNA 3J81c 4HJ7A 1A15A 3CCSA 4LF4L 4PMBA 4DV7L 3VYUA 5IYDH 5LL6S 2G9DA 2MPMA 2XN9C 1VQ6A 5E4XA 3URYA 3CRKC 2DN8A 5ELDA 5E3FA 2Y0SE 4A3BG 2FINB 3KJOA 1IL2A 1Y1WH 4Y7NB 2Q2UA 1VQ9A 3NK9A 4K8JA 1I50B 4GOPB 2EY1A 3KLRA 1WFQA 1X55A 4DV0Q 3CPFA 4IUNA 1RTNA 2R92B 1W3SA 2RQXA 3HEJA 4F7XA 2QA4A 2JA8B 3I4NB 1S5CD 1EZ8A 3U4VA 1B44D 5A35A 1SMYD 3NELA 1FD7D 2HHHQ 3MA2B 2ALYB 2NVXB 3R2IA 2AUKA 1B70B 1AE2A 3HOZH 4RGMA 2L5TA 2QF7A 2EJFC 1EWHA 1HH2P 5JEAJ 2PYKA 1LTAD 3S1NB 1MSHA 1XXGA 2HCCA 2BA1A 5FLXc 1UE6A 4DR3Q 4WJWA 5EPLA 2K52A 3A5ZB 4KY7A 4G7HC 4L5SA 1WTPA 4A3GG 2E5LL 2SNMA 4A3MH 3K7AB 1CK1A 4C2MB 1VQ5A 5FK9C 3KF8A 2MO0A 4LUVA 1LTGD 1EFWA 3W1BA 1TS3A 3KLSA 3BVZA 2K5DA 1Q8IA 2QW7A 1XYIA 1STEA 3I90A 1QUQB 1YI2A 3W1GA 4A3KB 3GTOH 4KLKA 1XTCD 1JE4A 3I8ZA 2K5NA 4NKLA 4RG1A 3K7UC 2ZJPA 1EY8A 3HKSA 2Q2IA 3HOWH 2B8GA 1WD0A 1S40A 2ZTCA 2TSSA 3AMUA 3GTGB 2UXDQ 4JI3L 1D1KA 4AYBE 2OCEA 3FKIH 5A2QL 4LF6Q 3OWEB 2R3ZA 4JBKA 3KUPA 3CU7A 5CV4A 3WOFA 1A0IA 3A7LA 5LMUQ 1L1OA 4FYDA 5IGGA 2Q8TA 1HQRD 4A3LG 1EIHA 4DN4M 2VUMB 2WB1G 4KY5A 1IBLL 1C9OA 3BZCA 1SEBD 4DUYL 4A3BH 1A6XA 1VDZA 1LM0A 2KJXA 1V1QA 1H9SA 3OOCA 1XMOQ 2A73B 3Q23A 1ENFA 3M4OH 2QDBA 1YITA 2KEEA 3LWUA 1GO3E 1TY2A 4KI0A 5IWAQ 2K01A 4MTKA 4RH6A 2F0UA 2AMCB 4YHHQ 2OWOA 2UXCQ 4C3IG 3PGZA 3TN2A 4DR6L 1QNUA 2NWGA 2OQKA 4QUFA 4X64Q 2PPBC 1K3RA 4HIKA 4QY7A 4P73A 1PYWD 4A3IG 4NMZA 1E1OA 1S5ED 3GTQH 4R4QA 1EEFD 4K2LA 2B2TC 2OTLA 4DV5L 2B2WC 1LT3D 4HIMA 1RIPA 4GZYC 1XJVA 1Q1EA 2AHOB 2N78A 3BYTB 1S3OA 2NTSA 4JI1L 4ILWA 3T53B 1N9WA 2CQAA 1EY7A 3V05A 3CD6A 3K5MA 2PNHA 4R4IA 2F0DA 1U4RA 4MZ9A 4A3GH 3SVMA 2CCZA 4H0LC 1FGBD 1PZKD 5BR8Q 1YJNA 3TP8A 3GTKH 1QWYA 4JV5Q 3JAME 2I5LX 1HJPA 1NCVA 3NENA 1SE4A 1JOKA 1EQQA 3V2TA 4K6DA 4DV3L 2R93B 4X66Q 2ATWA 2YTYA 1N33Q 5E7NA 1UAPA 3MFGA 1H95A 5JPMC 3SEBA 1AFPA 1D5MC 1UEAB 2NUCA 1DCZA 2YYZA 1KRSA 1N36L 4WORA 1SMYC 4YY3Q 1F2MA 1W6KA 5LMNL 3CMEA 2UUAQ 4YWKA
chains in the Genus database with same CATH topology
4CGYB 2EPBA 3NWSA 1AZPA 2AUJD 1Z6HA 1DJRD 1VCIA 2K05A 5DM73 2QCPX 4ZLTF 1C48A 2I07B 4C3HG 3Q24A 3FEWX 1NSNS 1G2TA 2KUMA 3PV0A 1B9MA 1WTQA 3I4MB 2JA6B 1EZ6A 5C5MA 1BCPC 4QF4A 2HDLA 5E4WC 3VR2A 4DNTB 5EBDA 2SNSA 2H4OA 1QG7A 4B9WA 3NTIA 2H1EA 1QCBD 2EJMA 2MHVA 1JWMD 2F0FA 1I4RA 4G7ZC 5AFWA 3F2UA 3PO3B 3I91A 3S2HB 1FNUA 4QB4A 3I72A 4KN7C 4CJ0B 5D3IB 4HAEA 5JEAG 2B2TA 2B2WA 3DUZA 1JICA 3P1HA 4KKTA 1BXTA 4BY1B 2XRQD 1B3AA 2VB2X 2K7VA 2BDOA 3NUCA 3MXNA 3TZUA 3NE5B 2L1BA 3H09A 5IGCA 3K57A 1U4PA 2KQ3A 4N9TA 5CV5A 2F0EA 3PUXA 4ODGA 3D3RA 1F2YA 2JA5B 1B9NA 3VA7A 4KHVA 2HCIA 1CI3M 1TS2A 4J6HA 3NBIA 3K58A 5FO8B 4R9WA 1SNDA 2F0SA 3K6OA 1JWSD 5CV8A 1GOZA 1EY6A 3TP7A 3ZYYX 1IKLA 5EGTA 3MXUA 4K5VA 2K5QA 3T51B 4CKCA 1WTRA 4CJ2C 5T1IA 1SAPA 5KIXA 4K5XA 2NTTA 4MHEA 1SE3A 1SE2A 2E2HB 2MP1A 5JPNC 2Z8LA 3QJYA 4MIUA 2A6HC 1V8QA 1SNMA 3H6MA 4QCLA 3E5SA 4RAUC 2NYZD 4FF3A 4IUTA 5C3EB 5IOCA 4XQQA 4RCNA 4XQNA 1E0BA 5CORA 1X3PA 4BS9A 1C8CA 2PZWA 4IN3A 2K04A 3OMCA 5JEAH 2RVLA 4PNYA 2A5HA 2AQ2B 1IW7C 2GA4B 2XVSA 2EY5A 2KA7A 2DNCA 5F2DA 5J1ZA 4NW2A 4OGQC 1SNQA 3U9SA 3E6ZX 2QILA 4J8QA 5DEHA 2L9HA 3T56B 3OMGA 1RD9D 1S5FD 3IFTA 2WACA 2VB3X 3S9WA 4KV6A 2AWOA 5JAVA 4RHSA 3V96A 2F0IA 1O7YA 1DYQA 3IFDA 4PQXA 4XT3B 2WV6D 1GUSA 2HUGA 2F0PA 2JA7B 1G6ZA 1ILQA 1SNOA 1OXXK 2SOBA 2XIWA 3R2TA 2L0CA 4X3UA 2EYLA 2B63B 4FNFA 5C0XI 1F9SA 3NQIA 2KEDA 2JYOA 4KHZA 1WD1A 2BDNA 2BCOA 1EWCA 3KBGA 1AN8A 4EQPA 1LT4D 4M8AA 3SDZA 5COYA 3P20A 3K5NA 2RSOA 4TRDA 5G3LF 1PRTD 3P7JA 1NAPA 1Y1WB 3TMEA 3I73A 5I2XA 3FPUB 1ENAA 1O80A 5T1GA 1PFBA 5EPKA 5HURA 1F9RA 3DWPA 1LLRD 4HCSA 3K5LA 3BYYB 5JVH3 4ZKBB 1S4ZA 2F3WA 4QUCA 1STYA 3HOZB 3T16A 2OT2A 3K0YA 3BDLA 2LKVA 3EROA 2EVBA 4U68A 2PO4A 1NR4A 1A3UA 4A3MB 2EXZA 1QOHA 4Q5VA 2R6GA 2OF1A 2O2LD 1BR9A 3MC0B 3Q0AA 3IAYA 1YNJC 3D6CA 3NSWA 1SDFA 4KJOA 4TSSA 2PW7A 4X3SA 5BN3A 3KK7A 2F0VA 3C2PA 4DFAA 2Z4IA 3GTOB 1TR5A 1CTMA 3RLFA 4EQOA 1HQMC 5I9PA 3HOWB 1CM9A 2K5WA 1DOKA 2PQEA 3FKIB 5DAUA 1W6JA 4P2CB 2XWBB 3HGBA 4CBVA 1H9SB 3NP8A 3BS1A 3MWYW 4WFN3 3OW7A 1CT1D 5BN5A 2I46A 1HCZA 1IYUA 3RUZA 5ELBA 1CA6A 3ND9A 4A3BB 2Q8RE 5CBAE 2D2CC 1HA5A 5M9OA 3M4OB 5CC4A 1RTOA 1PTOC 1SSOA 3WOEA 1RHPA 1O7LA 3AU7A 3VR4A 2DY7A 2KCCA 4IZ8A 4R8NA 3GTQB 3NQTA 5CV9A 4ZUIA 2PZTA 1HRJA 4IUUA 3HZXA 1MGSA 4UDUC 1BCPD 2RKSA 2NZ1D 1SNPA 3OWFA 2IT1A 1UUPA 4A3GB 1STNA 1JC7A 2QEJC 1KLGD 1EY5A 3GTKB 4ZQ3A 4DXGA 4XYQA 3MXGA 4DNRB 2J7ZA 2E74C 1PRTC 2HDMA 2LS01 1SBBB 2JXMB 1CZGA 2PNRC 1HA6A 5K36G 2IWHA 4XYOA 3MEHA 4RFBA 1Y69U 4B08A 5KNDA 4LK1C 1C4QA 4OL7A 2Z4HA 4FP5D 3L9AX 4X3KA 2Z1CA 1Q12A 2EOTA 3DMUA 3VYSA 2WB1B 1WTWA 1QE6A 1Y8NB 1Y8OB 3CHBD 4IUQA 5LHY1 2B2YC 1AP0A 1EQVA 4ZRZA 3S15B 3S1QB 1BUVT 4R8IA 2K32A 1G91A 1MBYA 3FDTA 4CHTB 1PTOH 4DAPA 3PIP3 2D9UA 4Z9CB 3KBXA 3M3YB 1KABA 4C3IB 2R61A 4HR7B 2ZXOA 2IX0A 1EYDA 1X32A 3SK5A 3L7ZC 1MSGA 4A3IB 3HG9A 1II3A 2J4XA 3J81L 1I3QB 2A6HD 1QNKA 2EYJA 4L6TB 2PW5A 1F9QA 1G2SA 2FMMA 1L0YB 3A8JE 5KYIA 2DNEA 1KAAA 3UI2A 2HQEA 4O42A 4DU9A 3GTPB 3SK8A 1BF4A 5FOBB 1RF2D 4LMQD 1BNZA 2L55A 1ENCA 4FXDA 4RGOS 2M2LA 2EDGA 1IW7D 5C6AA 2KECA 4C3JG 3J7AF 1EYAA 5K36H 5FLXL 1VF7A 5ISRA 5IGFA 5KGUA 2K1BA 1GUOA 1CHPD 1M4VA 3GQBA 3SK4A 1F2ZA 1JCKB 4G4KA 3K59A 1HFGA 4RKBA 2B2VC 5CR3A 3A8IE 3QIAA 1T5XD 3EVQA 1I4HA 2AQ1B 4IFDI 1HPCA 1B1ZA 4KN4C 2BA0A 1GHJA 1HHVA 4C3HB 1CA5A 4IALA 3I4LA 1YNNC 4A93B 4HMIA 4DGZA 3GO5A 3NPPA 2B2YA 3M4YA 1Y1VB 3PO2B 4MN3A 2OXPA 1BCPB 2O5JC 2F0WA 1S5BD 1LTTD 2D62A 4O1NA 2K33A 1BBXC 4K8IA 2L4NA 5C4XB 2F1MA 2A68D 4HSVA 1D5XC 1SYBA 3OIPA 1TIID 2L11A 4F87A 3SXHA 1KLUD 1RJTA 3DHQA 4N9PA 5J22A 2O4XA 4KMUC 1PXUA 3TP6A 5BN4A 4X3TA 1K8MA 1JB3A 5DM63 1GUTA 1GUGA 1PZID 3T4AC 1IKMA 2ZXRA 1FR3A 5C3XA 3A56A 1STGA 4G57A 1VMPA 4CKEA 2RDFA 1V1PA 4OO1I 4ZK9B 3OSOA 5CV7A 1BOSA 2CW0C 2R7ZB 1O78A 3TP5A 2RDGA 2L12A 2N55A 3MTSA 2B2VA 1LTRD 1RKNA 2WKDA 2JEBI 3HOVB 1O7ZA 1QB5D 2CVRA 1GUWA 5C0XJ 2NB0A 3VYTA 3EFXD 2NBFA 1U4MA 2RSNA 4E6IA 3GD7A 3ND8A 1YNJD 1PMRA 3QOJA 3VR5A 5I6WA 3BZDB 1DXMA 1MI2A 1I4QA 2C5CA 2F3VA 4DAYA 3NXWA 3LNNA 4OIKA 4C56C 1AW7A 4XQJA 5IIFA 2EE1A 3X3MA 1HTLD 3DEPA 1U4LA 2A6EC 4B9XA 1WTXA 3S17B 5FO9B 1Q3LA 3TSSA 1EY9A 4PMWA 4RCOA 4FXKC 1KNEA 3D31A 3PUWA 1EOTA 1WTOA 5KEEA 1RODA 2F0HA 2LY7A 1UNSA 3W3AA 3G6JB 1PTOD 3D8GA 2CHBD 2DY8A 3GV6A 3GTLB 2MJ8A 1STBA 2OEOA 2EZVA 2SDFA 3QOLA 1LTBD 4TQUS 1DOMA 2AWNA 5JJZA 1U9RA 3A54A 3GTMB 3BDCA 3NHHA 1XX8A 3IKJA 4DXFA 5FO7B 5CGKA 4BA1I 2A68C 3J7AV 3RMHA 4XXEA 5C4HA 1JWUD 1PRTF 3A8KE 3PMFA 3R8BA 4HCEA 4OO1G 1BQQT 1SYEA 4IFDH 2E75C 2E2IB 1D1IA 3CKIB 1SYCA 1J8IA 3EA6A 1GXDC 4I7ZC 5C44B 1T5EA 5D14A 1A2TA 1CQVA 4RGNA 1BDOA 3IL8A 1JQYD 2EY2A 3DWAA 3HKZB 2B2UC 4ULLA 3D6WA 1ESFA 1EIGA 1G291 4NDXA 2KOLA 1XWEA 1L0XB 2FFKB 4ID6A 1RCVD 1PZJD 1M8AA 5IT9L 3N6RA 2WIIB 4XTCS 1F2LA 2A69D 2KHSA 4DK0A 1TWAB 4CJ1B 2PMZB 3ERQA 3VR6A 2LMCB 3FMCA 2G9HD 4K14A 4G7OC 2Y0SB 1CHQD 3O13A 3DXJC 2RA4A 4XT1B 1OXVA 5EKLA 3Q6SA 4LJZC 3J81E 2ENBA 2NVYB 4U673 4J1MA 5I6YA 1A2UA 3M7NA 1ZYRC 5FKAC 2X6GA 1SYFA 2WKCA 4OO1H 3M7GA 1LO5D 1R4PB 1WTVA 1Q90A 5ELCA 5C0XG 2F0TA 3GP7A 2XSCA 1KDCA 1QJOA 1ILPA 3BVGA 3HRZC 2AQ3B 5LL6X 4RGTA 2JSOA 3MHBA 3DEOA 4DK1A 2X6LA 3PUYA 1BCPF 3J80E 1NR2A 5FLXE 2V4DA 1I4XA 1B4OA 1V43A 4H44C 2F0OA 1NUCA 3VA5A 1S5DD 1PTOB 2BOSA 5KRUA 3BVMA 5DNFA 1PFNA 2B2UA 3QB3A 4H7BA 1MD2D 2NVQB 4AYBB 3MVVA 4KD3A 5IGBA 1YNND 2BE5C 4EVOA 5I2YA 1FNWA 1B50A 2F03A 2RBMA 4FF2A 4CKBA 1GUNA 2QKIC 3N52A 4K2KA 3PUZA 4L63B 5EKKA 4IURA 3LWEA 2FMCA 1V1OA 2F0GA 1TT2A 4PV1C 4C1NK 5J39A 2WP8J 4BWGB 1STAA 2EY6A 3X3NA 4ZAIA 1G8ZD 5IGEA 1EU3A 1Z47A 1A3VA 2F0MA 4DAVA 1TWGB 3SHLA 3A7AB 4IUVA 2J0TD 4RA8A 1SYGA 1PRTB 4BY7B 1R4QB 3QWNA 4JBWA 2NVTB 4FF1A 4HSPA 1TS5A 1TY0A 2M00A 2XWJB 1QILA 3J7YW 1CFMA 4HMJA 4K5WA 1K83B 4IFDJ 5C0XH 1SXTA 4KY6A 1I4PA 3FPPA 1A3TA 2A69C 3EQLC 4YIJA 5D3DA 1HUNA 2ID0A 4ME5A 1DD2A 5M5YB 2E2DC 5CV6A 3H3VC 1SFOB 1Y8PB 1F77A 5JOBA 2NN6I 1HTPA 3HOYB 3C1FA 1EL0A 1H9MA 3D4RA 1SJHD 3S1MB 1TU2B 2CW0D 2ICIA 2EYOA 4V0BA 1ESRA 2EJGC 2FJ2A 3S2DB 3H0GB 4DF7A 1TWHB 2F0LA 1JR0D 1DONA 4BBRB 1FNVA 2MUYA 4S3SA 2F0QA 4Q0FA 4F8MA 1OXUA 3H94A 1GJXA 3NBHA 4K6LA 1R9TB 1LTSD 2WINB 5M3MB 3J80L 5C3WA 5M5WB 2YU9B 5KYLA 4BBSB 2A6ED 2KVMA 3H91A 3RZOB 3CQZB 2PZUA 2E2JB 1OO9B 3QO2A 5C4ZA 1ZEQX 4C3JB 1HFNA 3TZDA 3SK6A 4ZYSA 1D6EC 1V1PB 1IHZA 3ONAB 5EPJA 1ET9A 3C46A 4BA2I 3HOXB 1LT5D 4KTAA 1AZQA 4FXGC 3MFYA 3OHXC 5I4DA 3S1RB 1VF5C 1OXSC 2IX3A 1EU4A 4HTHA 4V190 5E1FA 3DWQA 3FVQA 3ITPA 1EY0A 5M5XB 2VXWA 3D4WA 3RD4A 3BDOA 5CMDA 4ZKCB 5IGDA 2C9OA 4LAAA 2MGSA 1DM0B 3W2DA 1ET6A 4RWSC 2E76C 2B39A 3VR3A 2NN6G 1EFID 4FVMA 3GV3A 1ZXTA 1TWCB 5TSSA 3MXPA 2IX1A 1WCMB 1HUMA 2RDHA 1KNAA 4EQNA 5ELFA 1JORA 1STHA 5EKIA 2JEAI 1D2BA 3R3OA 1TWFB 2D5DA 5HGTA 4A3EB 2Q8IB 3OIQA 2N88A 3GTJB 1X3QA 2ZT9C 3C1EA 4L8JA 2LFNA 3HS0C 2F0KA 2EYPA 3E0JA 3PIO3 3U9OA 1ICWA 4KJNA 1TKWB 3S14B 3M85A 2F4IA 2TMPA 4H13C 3VYRA 2WAQB 1LT6D 4TKOB 3FRPB 1JOOA 3NWTA 5EQ0A 3Q22A 1GHKA 5NUCA 3RZDB 2SEBD 5D65A 3JAML 4NP5A 5C4JB 1SYDA 2IW3A 3EJIA 5IT9E 3P75A 3A55A 3NTHA 4IFDG 3T13A 1KDAA 2F0NA 5C5LA 1OXTA 1H9JA 1EEID 2O5IC 3OPOA 4XIGS 2PCFB 1H9KA 1FYCA 2IPKD 2KCNA 5I9OA 4I65A 2XRSD 4A3DB 3PUVA 3K5OA 5K5PA 2NN6H 4RHRA 1B2TA 1ZYRD 4HN7A 3TDQA 4WRDA 1LTID 1ZKOA 5JVG3 1PTOF 2F0JA 4ZUJA 1LABA 4FF4A 4A3JB 4EGVA 3SE0A 3CRLC 1CZWA 4DA2A 2ZXPA 1LV9A 1KTKA 4IUPA 3C3LA 4OHJA 2K03A 5EBCA 3I70A 5ELEA 5CBEE 3S16B 3D4DA 4OIJA 1JOQA 2IL8A 1PDQA 3QG1A 1PFMA 1K8OA 1TQOA 1Z7TA 1IYVA 3MZ5A 2K6AA 4JK1C 3R93A 1KDBA 4IQZA 1Q1BA 1WVLA 2EYFA 3NTKA 4UAIA 3LX0A 1IL8A 1RDPD 2VNUD 4QIWB 3I3CA 1F9PA 2BE5D 2FHTA 3BG3A 2ICEC 5M3FB 1SJED 4HEDA 2A74C 1EQTA 2B8FA 4ABNA 1DZ1A 3G7LA 4C1NI 3TBIB 5A2QE 3HP3A 1E2WA 5IODA 5KNCA 3MAQA 2K28A 2XNAC 4KKUA 4M1UB 1B53A 1I6HB 1I6VC 2EYHA 3KLSX 1J9OA 5G3LD 3AB9A 2EYMA 4F88A 3L3OC 2X69A 1DOLA 1TS4A 4RKLA 1CQFA 2JP1A 1ML0D 5EJWA 4KD4A 1SNCA 3HOUB 3DM1A 1HXYD 2IJ0A 1VMCA 1ONLA 1AEXA 1E2ZA 1BO0A 5CYUA 1TVXA 4QMGA 3SR1A 4FO2A 1LACA 1EY4A 4PMCA 2M9VA 5KNBA 1I4GA 1D5ZC 1E2VA 4XDXA 4KK7A 4A3FB 4KKSA 1EYCA 1H9RA 2JE6I 1PLFA 3WDNA 1A15A 4PMBA 3VYUA 5LL6S 2G9DA 2MPMA 2XN9C 5E4XA 3URYA 3CRKC 2DN8A 5ELDA 5E3FA 2FINB 4Y7NB 3NK9A 4K8JA 1I50B 2EY1A 3KLRA 4IUNA 1RTNA 2R92B 2RQXA 4F7XA 3HEJA 2JA8B 3I4NB 1S5CD 1EZ8A 1B44D 5A35A 1SMYD 1FD7D 3MA2B 2NVXB 3R2IA 2AUKA 4RGMA 2L5TA 2QF7A 2EJFC 1EWHA 5JEAJ 2PYKA 1LTAD 3S1NB 1MSHA 1XXGA 2HCCA 2BA1A 4WJWA 5EPLA 4KY7A 4G7HC 1WTPA 2SNMA 3K7AB 1CK1A 4C2MB 5FK9C 3KF8A 1LTGD 1TS3A 3BVZA 3KLSA 2K5DA 1Q8IA 1XYIA 1STEA 3I90A 4A3KB 1XTCD 1JE4A 3I8ZA 4NKLA 1EY8A 2B8GA 1WD0A 3AMUA 2TSSA 3GTGB 1D1KA 5A2QL 3OWEB 2R3ZA 3KUPA 3CU7A 5CV4A 3WOFA 3A7LA 4FYDA 5IGGA 2Q8TA 1HQRD 1EIHA 4DN4M 2VUMB 4KY5A 1SEBD 1A6XA 1VDZA 2KJXA 3OOCA 1H9SA 2A73B 3Q23A 1ENFA 2QDBA 2KEEA 3LWUA 1TY2A 4KI0A 2K01A 4RH6A 2F0UA 4C3IG 3TN2A 1QNUA 2NWGA 4QUFA 2PPBC 1PYWD 4NMZA 1S5ED 1EEFD 4K2LA 2B2TC 2B2WC 1LT3D 4GZYC 1Q1EA 3BYTB 2NTSA 4ILWA 3T53B 2CQAA 1EY7A 3V05A 3K5MA 2F0DA 1U4RA 3SVMA 4H0LC 1FGBD 1PZKD 3TP8A 1QWYA 3JAME 1NCVA 1SE4A 1JOKA 3V2TA 4K6DA 2R93B 1UAPA 3MFGA 5JPMC 3SEBA 1AFPA 1D5MC 1UEAB 2NUCA 1DCZA 2YYZA 4WORA 1SMYC 1F2MA 1W6KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A7L A;  3FPP A;  3MFY A;  1H9R A;  2JE6 I;  3LNN A;  4KKS A;  1QJO A;  2A69 C;  2EVB A;  2K33 A;  1VF5 C;  3T56 B;  3WDN A;  2A6H D;  1T5E A;  1OXS C;  2F1M A;  3EQL C;  2IT1 A;  3IFT A;  2A68 D;  2AUJ D;  3MXU A;  1Z6H A;  4DK1 A;  3CRK C;  2DN8 A;  2BE5 D;  3PUY A;  3BG3 A;  2AWO A;  3T51 B;  1VCI A;  2A6E C;  1BDO A;  1DD2 A;  2R6G A;  1VDZ A;  3A8J E;  1A6X A;  4IFD G;  2V4D A;  1Y8P B;  2DNE A;  2NN6 I;  3OOC A;  1H9S A;  1HTP A;  1OXT A;  1H9J A;  4DNR B;  1V43 A;  1YNJ C;  3BDO A;  4H44 C;  2B8F A;  1GUS A;  1H9M A;  5BN3 A;  3OPO A;  2E74 C;  4XIG S;  3D4R A;  2O5I C;  3KLR A;  3D31 A;  1G29 1;  2PCF B;  3LWU A;  3PV0 A;  1B9M A;  3PUW A;  4KI0 A;  1TU2 B;  1CTM A;  3RLF A;  1H9K A;  2EDG A;  5A35 A;  1FYC A;  1IW7 D;  1HQM C;  2EJG C;  2PPB C;  4KMU C;  3QJY A;  2JXM B;  3VR2 A;  5BN4 A;  4DNT B;  2A6H C;  2AUK A;  2PNR C;  3N6R A;  1V8Q A;  2E76 C;  3PUV A;  1E2W A;  3VR3 A;  1OXX K;  2NN6 G;  2L5T A;  1K8M A;  2NN6 H;  2QF7 A;  2EJF C;  3W3A A;  1GUT A;  4XTC S;  1EWH A;  2A69 D;  5KNC A;  5K36 G;  1GUG A;  5K36 H;  1VF7 A;  2BE5 C;  4KKU A;  1FR3 A;  4DK0 A;  4GZY C;  1GUO A;  3HGB A;  2BA1 A;  4RCN A;  1I6V C;  1ZKO A;  1Q1E A;  3GQB A;  3VR6 A;  1Y69 U;  2LMC B;  1GUN A;  4KHZ A;  2EJM A;  3FMC A;  3PUZ A;  4LK1 C;  5KND A;  3T53 B;  4TQU S;  1H9S B;  1OXU A;  3AB9 A;  4G7H C;  3H94 A;  1Q12 A;  4G7Z C;  4G7O C;  2JEA I;  1LAB A;  3OW7 A;  3I72 A;  4KN7 C;  3A8I E;  5BN5 A;  1HCZ A;  1GJX A;  3IKJ A;  3SDZ A;  1IYU A;  3QIA A;  1Y8N B;  1Y8O B;  4H0L C;  3DXJ C;  3P20 A;  4PV1 C;  5JEA G;  2D5D A;  2CW0 C;  3ND9 A;  1OXV A;  5JEA H;  3SE0 A;  2Q8I B;  3CRL C;  4LJZ C;  2D2C C;  4BA1 I;  1HPC A;  1IW7 C;  2ZT9 C;  4KKT A;  2A68 C;  1O78 A;  4KN4 C;  2BA0 A;  4L8J A;  1GHJ A;  3I73 A;  2K7V A;  2BDO A;  2JEB I;  2DNC A;  2K32 A;  2KA7 A;  3TZU A;  3NE5 B;  3A7A B;  3A8K E;  3I4L A;  1YNN C;  3M7N A;  1O7L A;  1ZYR C;  2A6E D;  1ONL A;  1E2Z A;  4OO1 G;  4OO1 H;  1TKW B;  3PUX A;  3QG1 A;  3M4Y A;  4JBW A;  1K8O A;  3M85 A;  4H13 C;  4OGQ C;  4HR7 B;  3VR4 A;  2B8G A;  3GD7 A;  3ND8 A;  1LAC A;  1Z7T A;  3U9S A;  1DCZ A;  2YYZ A;  1IYV A;  2KCC A;  1B9N A;  3VA7 A;  4IFD H;  2O5J C;  1PMR A;  5KNB A;  4TKO B;  2E75 C;  1CI3 M;  3L7Z C;  1CFM A;  1E2V A;  1SMY C;  4JK1 C;  3VR5 A;  1Q90 A;  4BA2 I;  4IQZ A;  5C0X G;  1Q1B A;  2D62 A;  1GHK A;  1DXM A;  5C0X H;  4I7Z C; 
#chains in the Genus database with same CATH topology
 4CGY B;  2EPB A;  4P72 A;  1N34 Q;  1M90 C;  3G48 A;  3NWS A;  1AZP A;  2AUJ D;  1Z6H A;  4LFC L;  1DJR D;  1VCI A;  2K05 A;  1XPU A;  5DM7 3;  2QCP X;  4ZLT F;  3E0E A;  3S15 H;  3S1Q H;  2A8V A;  1C48 A;  2I07 B;  1IBK Q;  4C3H G;  4YCV A;  3Q24 A;  3FEW X;  1NSN S;  1G2T A;  2KUM A;  4GNX B;  3PSI A;  3PV0 A;  1B9M A;  1B3Q A;  1WTQ A;  4A93 G;  1L2F A;  3G71 A;  3I4M B;  1PH7 A;  2JA6 B;  3M3Y H;  1EZ6 A;  5C5M A;  4C3I H;  1Y1V G;  3PO2 G;  1BCP C;  4QF4 A;  3EBE A;  4N8F A;  2HDL A;  2QGQ A;  5E4W C;  3VR2 A;  1K3B C;  4DNT B;  1SE8 A;  3I55 A;  2MO1 A;  5EBD A;  1ASY A;  5IE8 A;  2SNS A;  4A3I H;  2H4O A;  1QG7 A;  4B9W A;  4JI0 Q;  3G4S A;  3NTI A;  1I3Q H;  2H1E A;  3ICE A;  1QCB D;  4IPH A;  2EJM A;  2MHV A;  1BVS A;  1JWM D;  2F0F A;  5C4X G;  1I4R A;  2RCN A;  4G7Z C;  5AFW A;  3F2U A;  4NXM L;  3I91 A;  3PO3 B;  1FNU A;  3S2H B;  4QB4 A;  3I72 A;  3ERS X;  4KN7 C;  3CXC A;  4CJ0 B;  5D3I B;  4HAE A;  5JEA G;  2ES2 A;  2B2T A;  4JI4 Q;  2B2W A;  3DUZ A;  1CKN B;  1JIC A;  3P1H A;  4KKT A;  5J3B A;  1XNQ Q;  1BXT A;  4BY1 B;  2VQF Q;  2XRQ D;  1KRT A;  1B3A A;  2VB2 X;  4LF5 Q;  3GTP H;  2K7V A;  2BDO A;  3NUC A;  2HIV A;  2Z6K C;  4LFA L;  3MXN A;  3TZU A;  3NE5 B;  2L1B A;  2JN4 A;  4DR7 L;  3H09 A;  5IGC A;  1HNX L;  3K57 A;  1U4P A;  2KQ3 A;  2VL6 A;  4N9T A;  5CV5 A;  2F0E A;  3PUX A;  4ODG A;  3D3R A;  1F2Y A;  2JA5 B;  1B9N A;  3VA7 A;  2MQH A;  4KHV A;  4DNI A;  2HCI A;  1CI3 M;  1TS2 A;  4J6H A;  3NBI A;  3K58 A;  4DV1 L;  5FO8 B;  4R9W A;  1SND A;  2F0S A;  3K6O A;  1JWS D;  5CV8 A;  1VS0 A;  1GOZ A;  4JOI A;  1JB7 A;  1EY6 A;  4CDC C;  3TP7 A;  3ZYY X;  1IKL A;  5EGT A;  3MXU A;  4K5V A;  2K5Q A;  4OWT B;  3T51 B;  2R7Z G;  4CKC A;  1WTR A;  1JMC A;  3HOX H;  4CJ2 C;  5T1I A;  1SAP A;  1M1K C;  4C3H H;  5C3E G;  3HOV G;  5KIX A;  4K5X A;  4X65 Q;  4X6A H;  4A93 H;  2NTT A;  4MHE A;  1SE3 A;  1SE2 A;  2E2H B;  2MP1 A;  3A5U A;  3AFP A;  1Y1V H;  3PO2 H;  5JPN C;  2Z8L A;  3QJY A;  4MIU A;  2A6H C;  1V8Q A;  2BH2 A;  1VQB A;  1SNM A;  4ZCK A;  5M5X H;  5IT9 c;  2WAQ E;  3H6M A;  4QCL A;  4MNO A;  3E5S A;  3CF5 A;  4RAU C;  2NYZ D;  4FF3 A;  4IUT A;  3KF6 A;  1SRO A;  5C3E B;  5IOC A;  4XQQ A;  4RCN A;  4XQN A;  5LMN W;  1E0B A;  4DR4 L;  3K81 C;  5COR A;  3T1H L;  4NXN L;  1X3P A;  4BS9 A;  1C8C A;  2PZW A;  4IN3 A;  2K04 A;  3OMC A;  5JEA H;  2RVL A;  1ICF B;  4GKJ L;  4PNY A;  2A5H A;  2AQ2 B;  5L37 A;  1IW7 C;  2EIF A;  3G6E A;  2YTX A;  1YEZ A;  2GA4 B;  2XVS A;  2EY5 A;  1N32 L;  4YWM A;  3CPW A;  3CCQ A;  1JJG A;  2KA7 A;  2DNC A;  5F2D A;  2HIX A;  5J1Z A;  1GM5 A;  4LW1 A;  4NW2 A;  4OGQ C;  1SNQ A;  3U9S A;  3E6Z X;  2Z6K A;  1KAW A;  2MFI A;  4H02 A;  4JBJ A;  4KHP L;  2QIL A;  4J8Q A;  5DEH A;  2L9H A;  4GN4 B;  4B3R L;  3T56 B;  2I5M X;  3OMG A;  1RD9 D;  1S5F D;  3IFT A;  2WAC A;  3F2B A;  2VB3 X;  2FXQ A;  3S9W A;  4KV6 A;  2AWO A;  2GVA A;  5JAV A;  4ME3 A;  4LF9 L;  2R7Z H;  4RHS A;  3V96 A;  4LFB Q;  2F0I A;  1O7Y A;  4B3S L;  1XPO A;  1DYQ A;  3IFD A;  4PQX A;  4XT3 B;  2WV6 D;  1GUS A;  3HOV H;  3E9H A;  2HUG A;  1PH2 A;  4JI6 Q;  2F0P A;  3CCE A;  1VQP A;  4K0K Q;  4DV1 Q;  2JA7 B;  1G6Z A;  4CDE C;  1ILQ A;  1SNO A;  3R2T A;  1OXX K;  2SOB A;  2XIW A;  2L0C A;  4X3U A;  2EYL A;  2B63 B;  3ER0 A;  1FGU A;  4FNF A;  5C0X I;  1F9S A;  5C44 G;  3NQI A;  2KED A;  2UXB L;  2JYO A;  4KHZ A;  1WD1 A;  4OX9 L;  2BDN A;  2BCO A;  1EWC A;  3KBG A;  1HZA A;  4J15 A;  2V1C C;  1AN8 A;  4EQP A;  1LT4 D;  4M8A A;  3J81 j;  1XMQ Q;  3SDZ A;  4QIW E;  5COY A;  3P20 A;  3K5N A;  2RSO A;  4TRD A;  1X54 A;  1PH4 A;  5G3L F;  1PRT D;  3P7J A;  3HOZ G;  1NAP A;  1Y1W B;  3HKZ G;  3S17 H;  4DAM A;  1WI5 A;  3TME A;  3JC6 6;  3I73 A;  5I2X A;  3FPU B;  1ENA A;  2B3G A;  1O80 A;  5T1G A;  4JI8 Q;  1PFB A;  5EPK A;  4APV A;  5HUR A;  1F9R A;  4B3T Q;  3DWP A;  1LLR D;  4HCS A;  3K5L A;  3BYY B;  1KIX A;  5JVH 3;  4ZKB B;  1K0S A;  2B29 A;  1S4Z A;  2F3W A;  4QUC A;  1IXR A;  1STY A;  3HOZ B;  3CAM A;  1YVC A;  3T16 A;  2OT2 A;  2F4V L;  1MHW C;  3GTL H;  3K0Y A;  1FJG Q;  3BDL A;  4OXP A;  2LKV A;  3J7A 5;  3ERO A;  2CWA A;  2EVB A;  1JE5 A;  4U68 A;  2F3I A;  2PO4 A;  3U4Z A;  3GTM H;  2JQO A;  1NR4 A;  1A3U A;  2Z0S A;  4A3M B;  1CSP A;  2EXZ A;  2VQE Q;  1QOH A;  4Q5V A;  2R6G A;  2OF1 A;  2O2L D;  2UUC L;  1E7Z A;  1VQH A;  1BR9 A;  3MC0 B;  3Q0A A;  1NY4 A;  3IAY A;  1I94 L;  1YNJ C;  4X62 L;  3D6C A;  3NSW A;  1SDF A;  4KJO A;  4TSS A;  2PW7 A;  4X3S A;  5BN3 A;  3KK7 A;  2F0V A;  1HR0 Q;  2UU9 L;  3C2P A;  4DFA A;  3CC4 A;  2Z4I A;  3GTO B;  1TR5 A;  3EIV A;  1CTM A;  3T1Y L;  3RLF A;  4EQO A;  2WFW A;  1HQM C;  5I9P A;  3HOW B;  1L1O B;  1CM9 A;  2CH4 W;  4POF A;  2K5W A;  1DOK A;  2PQE A;  3FKI B;  4GN3 B;  5DAU A;  2E2I H;  1W6J A;  4P2C B;  2H5X A;  2XWB B;  1SMX A;  4DV2 Q;  3HGB A;  1GVP A;  4CBV A;  1PYS B;  5C44 H;  4AIM A;  2QEX A;  1H9S B;  3NP8 A;  3FHW A;  3BS1 A;  4JPB W;  3MWY W;  4WFN 3;  3OW7 A;  1CT1 D;  5BN5 A;  2I46 A;  1HCZ A;  1IYU A;  3RUZ A;  4IJL A;  5ELB A;  1CA6 A;  3ULJ A;  2ZM6 Q;  3ND9 A;  4A3B B;  2Q8R E;  5CBA E;  4JI2 L;  3CCM A;  2D2C C;  1HA5 A;  4JI5 Q;  4JG2 A;  3J80 c;  5M9O A;  3M4O B;  3CC7 A;  4OON A;  5CC4 A;  1RTO A;  1PTO C;  1SSO A;  3WOE A;  1RHP A;  1O7L A;  3U50 C;  4B3M Q;  4DR1 L;  4WJ4 A;  3AU7 A;  3VR4 A;  3BU2 A;  2DY7 A;  2KCC A;  1VQN A;  4IZ8 A;  2CWP A;  3TQY A;  4R8N A;  1PFS A;  3GTQ B;  3NQT A;  1FL0 A;  5CV9 A;  4ZUI A;  2PZT A;  1HRJ A;  1TWA H;  4IUU A;  4DK3 C;  1ASZ A;  3HZX A;  1MGS A;  1PV4 A;  4UDU C;  1BCP D;  2RKS A;  3WWV A;  1MIU A;  2NZ1 D;  2UUB L;  4AQY L;  1SNP A;  3OWF A;  3F2C A;  2IT1 A;  1UUP A;  4YWL A;  1MKH A;  1AH9 A;  4A3G B;  1STN A;  1JC7 A;  2QEJ C;  2OTJ A;  1KLG D;  1EY5 A;  4DUZ Q;  3GTK B;  4ZQ3 A;  4DXG A;  1UE1 A;  4LNQ A;  2NVY H;  4XYQ A;  3MXG A;  4DNR B;  4DR2 L;  1WOC A;  3NBH B;  2J7Z A;  2E8G A;  2E74 C;  1PRT C;  1UE7 A;  2HDM A;  2PQA A;  2LS0 1;  4EQ5 A;  2XTI A;  5HGQ A;  1SBB B;  2AKW B;  4LF8 L;  2JXM B;  1CZG A;  2PNR C;  1HA6 A;  1G6P A;  5K36 G;  2IWH A;  4XYO A;  1B8A A;  1IBM Q;  3MEH A;  4RFB A;  1LTL A;  1YHA A;  1Y69 U;  4Y52 H;  1P16 A;  4B08 A;  5KND A;  4LK1 C;  1C4Q A;  2A1A A;  4OL7 A;  2Z4H A;  4FP5 D;  3L9A X;  4X3K A;  2Z1C A;  1Q12 A;  2EOT A;  2PI2 E;  3DMU A;  4NPS A;  3VYS A;  1PYB A;  2WB1 B;  1WTW A;  1QE6 A;  1Y8N B;  1Y8O B;  1VQL A;  2UU9 Q;  3CHB D;  2VZA A;  4IUQ A;  5LHY 1;  2B2Y C;  1AP0 A;  4LF4 Q;  1EQV A;  4ZRZ A;  3S15 B;  3S1Q B;  3HOY G;  3BJU A;  4DV7 Q;  3CCR A;  1BUV T;  1Y14 B;  4R8I A;  2K32 A;  1G91 A;  1MBY A;  5AJ3 L;  5IP7 G;  2VW9 A;  3FDT A;  4CHT B;  1PTO H;  4DAP A;  3PIP 3;  2D9U A;  4Z9C B;  3KBX A;  3M3Y B;  1KAB A;  4C3I B;  3PCO B;  2R61 A;  2WB1 E;  4HR7 B;  2ZXO A;  2IX0 A;  1EYD A;  2NVQ H;  1X32 A;  3H0G G;  3SK5 A;  4JBM A;  4QQB X;  5FLM G;  3CC2 A;  3L7Z C;  1MSG A;  4A3I B;  1QVC A;  4BBR G;  3HG9 A;  1II3 A;  1NTG A;  2J4X A;  1C0A A;  2I5H A;  3J81 L;  1CUK A;  5GAD C;  3B6Y A;  1I3Q B;  1SLJ A;  2A6H D;  1QNK A;  2EYJ A;  4DV6 L;  1HZB A;  1X9N A;  4L6T B;  2PW5 A;  3JAM c;  1IYJ B;  1F9Q A;  1G2S A;  2FMM A;  3A0J A;  3MXN B;  1L0Y B;  1KL9 A;  5M3M G;  2CQO A;  3A8J E;  2G5D A;  3I2Z A;  5KYI A;  2DNE A;  1KAA A;  3UI2 A;  4UP9 A;  2HQE A;  4O42 A;  4DU9 A;  4HJ9 A;  3GTP B;  3SK8 A;  1BF4 A;  5FOB B;  1RF2 D;  4LMQ D;  1BNZ A;  2E5L Q;  2L55 A;  1TWG H;  2IHE A;  3F1Z A;  3HFZ B;  4BBS G;  1ENC A;  4FXD A;  4RGO S;  3H15 A;  4BY7 H;  2M2L A;  2EDG A;  1IW7 D;  4IOA A;  5C6A A;  2NVT H;  2KEC A;  2DJF C;  4C3J G;  3J7A F;  1EWI A;  2KEN A;  4A75 A;  1EYA A;  4CDF C;  5FJ8 G;  5K36 H;  5FLX L;  1VF7 A;  4LUZ A;  1YJW A;  3HOX G;  5ISR A;  1K83 H;  5IGF A;  5KGU A;  4IPG A;  2K1B A;  1GUO A;  1CHP D;  1M4V A;  3GQB A;  3SK4 A;  4JI7 L;  1F2Z A;  1JCK B;  1VQI A;  2JJQ A;  4G4K A;  3K59 A;  1EYG A;  4JI3 Q;  1HFG A;  4RKB A;  2B2V C;  3S24 A;  5CR3 A;  3A8I E;  4FDB A;  4DKA C;  1PHJ A;  3QIA A;  3J81 i;  1T5X D;  1B7Y B;  3EVQ A;  5M5Y H;  1CSQ A;  5H1S E;  1I4H A;  1SFO H;  2AQ1 B;  4IFD I;  1HPC A;  1B1Z A;  2N49 A;  2LXK A;  4KN4 C;  3KOJ A;  2BA0 A;  3EN2 A;  1GHJ A;  3HOY H;  1HHV A;  4C3H B;  4LF8 Q;  1CA5 A;  1QVF A;  2GN5 A;  1IBL Q;  4IAL A;  5IP7 H;  3I4L A;  1YNN C;  4DUY Q;  1JJC B;  3S1M H;  4A93 B;  4HMI A;  4DGZ A;  3GO5 A;  1LUZ A;  3NPP A;  4UP8 A;  3KF6 B;  2B2Y A;  3M4Y A;  1Y1V B;  3PO2 B;  3OTO L;  4MN3 A;  3S2D H;  1X3F A;  2OXP A;  1BCP B;  3H0G H;  2O5J C;  5JJK A;  4CDD C;  1VQC A;  3AEV A;  5FLM H;  2F0W A;  1TWH H;  1S5B D;  4BBR H;  2N8N A;  1LTT D;  2D62 A;  4DR6 Q;  1WCM G;  2F52 A;  1EUJ A;  4L5T A;  4O1N A;  2K33 A;  1BBX C;  4K8I A;  2L4N A;  3J80 i;  4N8X 1;  5C4X B;  2F1M A;  1HNZ L;  2A68 D;  3OYY A;  3KLW A;  1EIY B;  4HSV A;  1D5X C;  4DV5 Q;  1VQE A;  1R9T H;  4A3E G;  5M3M H;  3I4O A;  1BBU A;  1AE3 A;  4JI1 Q;  2CKZ B;  2EQS A;  5M5W H;  1SYB A;  3OIP A;  1TII D;  2YU9 H;  2L11 A;  1BKB A;  4DPG A;  4JYA L;  4IO9 A;  4F87 A;  4BBS H;  2A19 A;  3SXH A;  4R4C A;  3RZO H;  3CQZ H;  4DV4 L;  1KLU D;  1RJT A;  2E2J H;  3DHQ A;  4N9P A;  3J7Z C;  5J22 A;  4JW0 A;  1IZ6 A;  2O4X A;  1A62 A;  1K28 A;  4KMU C;  1PXU A;  3TP6 A;  5BN4 A;  3UDG A;  2WAQ G;  4C3J H;  4X3T A;  1Q81 C;  2K4K A;  1K8M A;  1JB3 A;  5DM6 3;  1GUT A;  1GUG A;  5FJ8 H;  1PZI D;  3T4A C;  1PH8 A;  1IKM A;  4DV3 Q;  2ZXR A;  1FR3 A;  5C3X A;  3CCJ A;  3A56 A;  1STG A;  1HNW L;  4G57 A;  1VMP A;  4CKE A;  3S1R H;  2RDF A;  1V1P A;  1N36 Q;  2YV5 A;  4OO1 I;  5LMN Q;  4ZK9 B;  3OSO A;  5CV7 A;  1BOS A;  2CW0 C;  2R7Z B;  1O78 A;  3TP5 A;  2RDG A;  2L12 A;  3K80 C;  2N55 A;  3MTS A;  4JCV E;  2YTV A;  2B2V A;  1LTR D;  1NJI C;  1RKN A;  2WKD A;  2JEB I;  2KHI A;  4LFC Q;  3HOV B;  1O7Z A;  1QB5 D;  2CVR A;  1GUW A;  5C0X J;  2NB0 A;  4O2D A;  2DJG C;  3VYT A;  2DGY A;  3EFX D;  2NBF A;  1Q7Y C;  1U4M A;  4PG3 A;  2RSN A;  4E6I A;  4A3D G;  3GD7 A;  3ND8 A;  1YNJ D;  1W2B A;  1PMR A;  3K0X A;  4BY1 H;  1I5F A;  3QOJ A;  3VR5 A;  5I6W A;  1TWC H;  3BZD B;  5DLQ E;  1DXM A;  1MI2 A;  1I4Q A;  1WCM H;  2C5C A;  2F3V A;  3TRE A;  3NXW A;  4DAY A;  3LNN A;  4NB3 A;  4O0A A;  3TRZ A;  4OIK A;  2LXJ A;  4C56 C;  1AW7 A;  4XQJ A;  5IIF A;  2EE1 A;  5GAE C;  1YIJ A;  5GQO A;  3X3M A;  1JJ2 A;  1HTL D;  3DEP A;  4A3J G;  4LF7 L;  1U4L A;  1JT8 A;  1TWF H;  2A6E C;  1K8G A;  2P5Z X;  4B9X A;  4OWW B;  1WTX A;  4A3E H;  5IYB G;  3S17 B;  1J5E L;  4I7A A;  5FO9 B;  3GTJ H;  1Q3L A;  3TSS A;  1EY9 A;  4PMW A;  4NXM Q;  4RCO A;  2HD3 A;  4FXK C;  1KNE A;  1XNR L;  1VQA A;  3PIP A;  3D31 A;  2DUD A;  4DR5 L;  3PUW A;  1XPR A;  1VQ8 A;  1EOT A;  1WTO A;  2RHQ B;  1VQG A;  3GDE A;  3S14 H;  1Z9F A;  5KEE A;  4LFA Q;  3UDX A;  1ROD A;  2CFM A;  2F0H A;  2LY7 A;  1UNS A;  1V9P A;  1NNX A;  3W3A A;  3G6J B;  1PTO D;  4DR7 Q;  3D8G A;  1HNX Q;  2CHB D;  2L15 A;  2DY8 A;  3QR8 A;  3GV6 A;  3GTL B;  2MJ8 A;  1STB A;  1X6O A;  2OEO A;  2EZV A;  2SDF A;  3RZD H;  1MJE A;  1YHQ A;  3QOL A;  1LTB D;  4IPD A;  4R4O A;  4TQU S;  1DOM A;  2AWN A;  5JJZ A;  5C4J H;  1U9R A;  3A54 A;  3GTM B;  1UWV A;  2NZH A;  3BDC A;  3NHH A;  1XX8 A;  3IKJ A;  4DXF A;  4DV0 L;  1PH1 A;  5FO7 B;  5M3F G;  5CGK A;  4BA1 I;  1X65 A;  2A68 C;  2NZO A;  2R7D A;  3J7A V;  2HHH L;  3RMH A;  4XXE A;  5C4H A;  3KFU A;  1JWU D;  1PRT F;  3A8K E;  3PMF A;  5IY0 A;  3I7F A;  1D8L A;  1QVG A;  3R8B A;  4HCE A;  4OO1 G;  1DGS A;  1N8R C;  1BQQ T;  1Q46 A;  2K14 A;  4DR3 L;  2Q2T A;  4A3D H;  4GLV B;  1SYE A;  2N3S A;  4IFD H;  2E75 C;  2E2I B;  4ALP A;  3OW2 A;  1D1I A;  3CKI B;  1SYC A;  1J8I A;  3EA6 A;  1GXD C;  4I7Z C;  5C44 B;  3UE0 A;  4OEL B;  4WJ3 M;  1T5E A;  5D14 A;  5GRO A;  1A2T A;  4A3J H;  2Z6B A;  2I0Q A;  1CQV A;  4RGN A;  3TS2 A;  1BDO A;  3IL8 A;  1JQY D;  1WYD A;  2EY2 A;  3DWA A;  3HKZ B;  2B2U C;  5IYB H;  4DR4 Q;  4ULL A;  3RN2 A;  3D6W A;  3KDF A;  3T1H Q;  4NXN Q;  1ESF A;  2UXD L;  3HOU G;  3SGI A;  3S16 H;  1EIG A;  1G29 1;  4NDX A;  2KOL A;  3KF8 B;  4GKJ Q;  1XWE A;  1L0X B;  2FFK B;  4ID6 A;  1RCV D;  4LF6 L;  1PZJ D;  2KHJ A;  2Y0S G;  1N32 Q;  1O7I A;  4RMF A;  1PA6 A;  1M8A A;  5IT9 L;  5LMU L;  3N6R A;  2WII B;  4XTC S;  1F2L A;  2A69 D;  2KHS A;  3HKZ E;  1VQK A;  4L5Q A;  4A3F G;  4DK0 A;  2ZTD A;  1TWA B;  4CJ1 B;  2PMZ B;  3ERQ A;  3VR6 A;  2LMC B;  3FMC A;  2G9H D;  1XMO L;  4K14 A;  1L1O C;  4G7O C;  2Y0S B;  1CHQ D;  1G51 A;  4KHP Q;  3O13 A;  4R1J A;  3DXJ C;  2RA4 A;  4XT1 B;  1OXV A;  4B3R Q;  5EKL A;  5IWA L;  3Q6S A;  1NE3 A;  4LJZ C;  5M3F H;  1K9M C;  2PQA B;  4YHH L;  4QGU A;  2UXC L;  3RLO A;  3J81 E;  2ENB A;  2NVY B;  5ELN A;  2RF4 A;  4GOP C;  4U67 3;  2MNA A;  4X64 L;  4J1M A;  4BXX G;  5I6Y A;  1A2U A;  4LF9 Q;  3M7N A;  1YHB A;  3PQI A;  1SR3 A;  1ZYR C;  1QZG A;  2JA8 G;  2R92 G;  5FKA C;  3I4N G;  2X6G A;  1SYF A;  4B3S Q;  2WKC A;  4OO1 H;  4DK6 C;  4UY8 C;  3M7G A;  1LO5 D;  1VQ7 A;  1R4P B;  1HR0 W;  2ZJQ A;  4A3C G;  4MTN A;  2ASB A;  1P8L A;  3STB C;  1PH6 A;  1PH3 A;  1WTV A;  1Q90 A;  5ELC A;  3H3V I;  5C0X G;  4GN5 A;  3PIO A;  2F0T A;  1SRU A;  2KBN A;  3GP7 A;  1I6H H;  5BR8 L;  2XSC A;  1KDC A;  1QJO A;  1ILP A;  3BVG A;  3HRZ C;  2AQ3 B;  5LL6 X;  4RGT A;  4HJ5 A;  2JSO A;  3MHB A;  3DEO A;  5IYC H;  4DK1 A;  5JJL A;  3CP0 A;  2X6L A;  4JV5 L;  3PUY A;  1BCP F;  3J80 E;  4AYB G;  1NR2 A;  5FLX E;  2UXB Q;  2V4D A;  1I4X A;  4OX9 Q;  4X66 L;  2Q2H A;  1N33 L;  1B4O A;  1V43 A;  4H44 C;  2F0O A;  1CKM A;  4A3K G;  3U58 A;  1GD7 A;  1NUC A;  3VA5 A;  1S5D D;  3HOU H;  3TEH B;  1PTO B;  4YY3 L;  2BOS A;  5KRU A;  3BVM A;  5DNF A;  2UUA L;  1PFN A;  2B2U A;  3QB3 A;  4TVA B;  4H7B A;  1MD2 D;  3DLL A;  4AYB B;  2NVQ B;  3MVV A;  3RR5 A;  4KD3 A;  1N34 L;  5IGB A;  3AFQ A;  4OEM B;  1K73 C;  1YNN D;  2BE5 C;  4EVO A;  5I2Y A;  4A3F H;  1FNW A;  3KYH C;  1B50 A;  2F03 A;  2RBM A;  2JK8 A;  3UDI A;  1E22 A;  4FF2 A;  4CKB A;  1GUN A;  2QKI C;  3N52 A;  4K2K A;  1X3E A;  3PUZ A;  4L63 B;  5EKK A;  2VUM G;  4BY7 G;  4IUR A;  1IBK L;  2F4V Q;  1E24 A;  3LWE A;  2FMC A;  1YJ9 A;  1V1O A;  3IRB A;  1KQS A;  2F0G A;  1TT2 A;  3D0F A;  4PV1 C;  4C1N K;  5J39 A;  2WP8 J;  4BWG B;  1STA A;  2EY6 A;  3X3N A;  4ZAI A;  4Y7N H;  1G8Z D;  5IGE A;  1EU3 A;  1Z47 A;  1A3V A;  4L5R C;  2F0M A;  1I50 H;  4DAV A;  4GLX A;  4BXX H;  1TWG B;  3SHL A;  3A7A B;  4IUV A;  1U0L A;  2J0T D;  5GAH C;  3F2D A;  4RA8 A;  1SYG A;  1PRT B;  2R92 H;  3UDF A;  2JA8 H;  3I4N H;  4BY7 B;  2UUC Q;  1R4Q B;  3QWN A;  4JI0 L;  2K5V A;  3TS0 A;  4JBW A;  1I94 Q;  4X62 Q;  2NVT B;  4FF1 A;  2NVX H;  4HSP A;  1TS5 A;  4GOP A;  1TY0 A;  2M00 A;  2XWJ B;  1QIL A;  3J7Y W;  4A3C H;  1CFM A;  3T1Y Q;  4HMJ A;  4K5W A;  1K83 B;  4HIO A;  1S72 A;  4IFD J;  3S1N H;  5C0X H;  1SXT A;  3L0O A;  1Q82 C;  4KY6 A;  4JI4 L;  1I4P A;  3FPP A;  1A3T A;  4IPC A;  1J6Q A;  5ELO A;  2A69 C;  1E3P A;  1XNQ L;  3EQL C;  2VQF L;  4LF5 L;  4YIJ A;  3M4Q A;  5D3D A;  3K7A H;  4C2M H;  1TXY A;  1HUN A;  2ID0 A;  4ME5 A;  1DD2 A;  5M5Y B;  2E2D C;  5CV6 A;  3H3V C;  1SFO B;  1Y8P B;  1F77 A;  5JOB A;  2NN6 I;  1HTP A;  3HOY B;  4UP7 A;  4UPA A;  3C1F A;  1EL0 A;  2ZTE A;  1H9M A;  2C35 B;  3D4R A;  4A3K H;  1SJH D;  3S1M B;  1PH9 A;  1TU2 B;  2CW0 D;  4JI2 Q;  4P75 A;  2ICI A;  2XGT A;  2R93 G;  2EYO A;  4V0B A;  1ESR A;  2EJG C;  2FJ2 A;  3L2P A;  3AQQ A;  3S2D B;  3GTG H;  1QUQ A;  3H0G B;  4AH6 A;  4DF7 A;  1TWH B;  1NMG A;  2F0L A;  1JR0 D;  4POG A;  1OTC A;  1DON A;  4BBR B;  1FNV A;  2K50 A;  2MUY A;  4S3S A;  4DR1 Q;  2F0Q A;  1VQD A;  4JC0 A;  4Q0F A;  4F8M A;  1UE5 A;  2IHF A;  1OXU A;  2RCF A;  3H94 A;  2VUM H;  1HZC A;  3RLN A;  4JOI C;  1GJX A;  3NBH A;  4K6L A;  1VQF A;  1R9T B;  3A74 A;  1LTS D;  1T9H A;  4R4T A;  4X65 L;  2WIN B;  5M3M B;  3J80 L;  2UUB Q;  4AQY Q;  5IP9 G;  2PI2 A;  1SN8 A;  5C3W A;  5M5W B;  3W5O A;  2YU9 B;  4GNX C;  5KYL A;  4BBS B;  1Q8K A;  4A3L H;  2A6E D;  2KVM A;  3H91 A;  3RZO B;  3CQZ B;  3I4M G;  2JA6 G;  2PZU A;  2E2J B;  2D0P A;  4DR2 Q;  4IOC A;  1OO9 B;  3QO2 A;  5C4Z A;  1ZEQ X;  4C3J B;  1HFN A;  3TZD A;  3SK6 A;  4ZYS A;  1D6E C;  1V1P B;  1IHZ A;  3ONA B;  5EPJ A;  1QZH A;  1ET9 A;  3C46 A;  2HT1 A;  4BA2 I;  3HOX B;  1LT5 D;  4KTA A;  1KC8 C;  1AZQ A;  4FXG C;  3MFY A;  3OHX C;  5I4D A;  3S1R B;  1VF5 C;  1OXS C;  2IX3 A;  3PO3 G;  1EU4 A;  5HY6 A;  4HTH A;  4V19 0;  5E1F A;  3DWQ A;  3FVQ A;  3ITP A;  1E1T A;  1EY0 A;  5M5X B;  4BY1 G;  2VXW A;  3H3V H;  3D4W A;  3CCV A;  3RD4 A;  3BDO A;  5CMD A;  4ZKC B;  2RHS B;  5IGD A;  2C9O A;  1VQM A;  3Q8D A;  5JJI A;  4LAA A;  2MGS A;  4JVZ A;  2D0O A;  2KCT A;  2R93 H;  2VS1 A;  3K8A A;  1DM0 B;  3W2D A;  2LSS A;  1ET6 A;  4DAY B;  4RWS C;  2JA5 G;  2E76 C;  2B39 A;  3VR3 A;  2NN6 G;  5AJ3 Q;  1EFI D;  2ZJR A;  4FVM A;  1K0R A;  3GV3 A;  3ULL A;  1ZXT A;  1TWC B;  5TSS A;  1NMF A;  3MXP A;  2IX1 A;  1WCM B;  1HUM A;  2RDH A;  5GAG C;  1KNA A;  4EQN A;  4LFB L;  3F8T A;  4GKK L;  4QJF A;  5ELF A;  1JOR A;  1STH A;  5EKI A;  2JEA I;  1D2B A;  3R3O A;  1TWF B;  1U5K A;  2D5D A;  1GKH A;  1NBW A;  2CH4 A;  5HGT A;  4A3E B;  2Q8I B;  3OIQ A;  3M9B A;  4JI6 L;  2N88 A;  3GTJ B;  1X3Q A;  2ZT9 C;  5IP9 H;  4K0K L;  3C1E A;  4DV6 Q;  4L8J A;  2K5H A;  2LFN A;  3HS0 C;  2F0K A;  2EYP A;  3KJP A;  3E3X A;  3E0J A;  3PIO 3;  3U9O A;  1ICW A;  3I4M H;  4KJN A;  2JA6 H;  1TKW B;  3S14 B;  3M85 A;  2F4I A;  2TMP A;  4H13 C;  3VYR A;  1K8A C;  2WAQ B;  1VQ4 A;  4GNX A;  1LT6 D;  4TKO B;  3FRP B;  1JOO A;  3NWT A;  5EQ0 A;  3Q22 A;  2HQL A;  1XMQ L;  2IY5 B;  1GHK A;  5NUC A;  1PVO A;  3RZD B;  2SEB D;  5D65 A;  3JAM L;  4LWC A;  4NP5 A;  5EAY A;  5C4J B;  1SYD A;  3PO3 H;  2IW3 A;  4PZ6 A;  3EJI A;  5IT9 E;  3M4P A;  3S2H H;  4JI8 L;  3P75 A;  4B3T L;  4HJ8 A;  3A55 A;  3NTH A;  3RNU A;  4IFD G;  4JI7 Q;  4EX5 A;  3T13 A;  1KDA A;  2F0N A;  5C5L A;  1OXT A;  1H9J A;  1EEI D;  2O5I C;  3OPO A;  4XIG S;  4QL5 A;  2PCF B;  1RL2 A;  5C4X H;  1CKN A;  1H9K A;  3E9I A;  1FYC A;  2IPK D;  1FJG L;  2KCN A;  5I9O A;  4I65 A;  2XRS D;  4A3D B;  2JA5 H;  3CW2 C;  3PUV A;  1BBW A;  3K5O A;  5K5P A;  3CCU A;  2NN6 H;  4RHR A;  4GS3 A;  4HID A;  1B2T A;  1ZYR D;  4HN7 A;  3TDQ A;  2KCM A;  2VQE L;  1UEB A;  4WRD A;  4YCU A;  1FVI A;  1LTI D;  1ZKO A;  3OTO Q;  5JVG 3;  1PTO F;  2JA9 A;  2F0J A;  4ZUJ A;  1KD1 C;  1YZ6 A;  3KDF B;  1VQO A;  1LAB A;  2Z9H A;  1EQR A;  1KHI A;  3STB D;  1HR0 L;  4FF4 A;  4A3J B;  1MJC A;  3ULP A;  4EGV A;  3SE0 A;  3CRL C;  3JAM i;  1CZW A;  4DA2 A;  2ZXP A;  1LV9 A;  1HNZ Q;  1KTK A;  1LYL A;  3FP9 A;  4IJH A;  4IUP A;  3C3L A;  4OHJ A;  2K03 A;  5EBC A;  3I70 A;  5ELE A;  5CBE E;  3S16 B;  3D4D A;  3PF5 A;  4OIJ A;  1JOQ A;  2JA7 G;  2E2H H;  2IL8 A;  1PDQ A;  3QG1 A;  4DV2 L;  1PFM A;  1K8O A;  4OWX B;  1CKO A;  1TQO A;  4P74 A;  1WJJ A;  1Z7T A;  1A8V A;  1IYV A;  4JYA Q;  3MZ5 A;  1HZ9 A;  2K6A A;  4GKK Q;  4HJA A;  4JK1 C;  3R93 A;  1KDB A;  4DV4 Q;  2EXD A;  4IQZ A;  2B63 G;  1Q1B A;  5C3E H;  1WVL A;  2ZM6 L;  2EYF A;  3NTK A;  4UAI A;  3LX0 A;  1IL8 A;  2GVB A;  4JI5 L;  1PH5 A;  1RDP D;  2VNU D;  4QIW B;  5IYD G;  4UHV A;  3I3C A;  3ZJY C;  1F9P A;  2BE5 D;  2FHT A;  2OQ0 A;  3BG3 A;  4PZ7 A;  4A4I A;  1KXL A;  1HNW Q;  2ICE C;  1Y1W G;  3AYH B;  5M3F B;  1XTD A;  4B3M L;  1SJE D;  4A76 A;  4HED A;  2A74 C;  1EQT A;  2B8F A;  3PF4 A;  3DM3 A;  4ABN A;  3BZK A;  4LUO A;  1DZ1 A;  3G7L A;  3LGJ A;  1X56 A;  5IYC G;  4C1N I;  3TBI B;  5A2Q E;  3CMA A;  3HP3 A;  1E2W A;  5IOD A;  1Q86 C;  5KNC A;  3MAQ A;  2K28 A;  2XNA C;  4KKU A;  4M1U B;  1C7Y A;  1B53 A;  1I6H B;  1I6V C;  2K75 A;  1X3G A;  2EYH A;  3NEM A;  3KLS X;  1EIF A;  4DUZ L;  1J9O A;  4P71 A;  5G3L D;  3AB9 A;  3MEF A;  2EYM A;  4GLA C;  4F88 A;  3L3O C;  4A3M G;  1L0W A;  3CCL A;  2BH8 A;  4PZ8 A;  2X69 A;  1DOL A;  1TS4 A;  1EOV A;  3I56 A;  4RKL A;  1CQF A;  2JP1 A;  1ML0 D;  1A63 A;  5EJW A;  4KD4 A;  4LF7 Q;  1SNC A;  3HOU B;  3DM1 A;  1HXY D;  2IJ0 A;  1VMC A;  1ONL A;  1AEX A;  1J5E Q;  1E2Z A;  1VQJ A;  1IBM L;  1YNX A;  1BO0 A;  2VY3 A;  2JA7 H;  5CYU A;  1TVX A;  4QMG A;  2QDL A;  3SR1 A;  3HOW G;  4FO2 A;  3UE1 A;  1XNR Q;  3RN5 A;  1LAC A;  1EY4 A;  2R7F A;  4PMC A;  1WTH A;  2M9V A;  3FKI G;  5KNB A;  1YBY A;  4DR5 Q;  1I4G A;  1D5Z C;  1E2V A;  4XDX A;  4KK7 A;  4A3F B;  1D7Q A;  2B63 H;  4YCW A;  4KKS A;  1EYC A;  1H9R A;  2JE6 I;  3VDY A;  2PMZ E;  1PLF A;  3WDN A;  3J81 c;  4HJ7 A;  1A15 A;  3CCS A;  4LF4 L;  4PMB A;  4DV7 L;  3VYU A;  5IYD H;  5LL6 S;  2G9D A;  2MPM A;  2XN9 C;  1VQ6 A;  5E4X A;  3URY A;  3CRK C;  2DN8 A;  5ELD A;  5E3F A;  2Y0S E;  4A3B G;  2FIN B;  3KJO A;  1IL2 A;  1Y1W H;  4Y7N B;  2Q2U A;  1VQ9 A;  3NK9 A;  4K8J A;  1I50 B;  4GOP B;  2EY1 A;  3KLR A;  1WFQ A;  1X55 A;  4DV0 Q;  3CPF A;  4IUN A;  1RTN A;  2R92 B;  1W3S A;  2RQX A;  3HEJ A;  4F7X A;  2QA4 A;  2JA8 B;  3I4N B;  1S5C D;  1EZ8 A;  3U4V A;  1B44 D;  5A35 A;  1SMY D;  3NEL A;  1FD7 D;  2HHH Q;  3MA2 B;  2ALY B;  2NVX B;  3R2I A;  2AUK A;  1B70 B;  1AE2 A;  3HOZ H;  4RGM A;  2L5T A;  2QF7 A;  2EJF C;  1EWH A;  1HH2 P;  5JEA J;  2PYK A;  1LTA D;  3S1N B;  1MSH A;  1XXG A;  2HCC A;  2BA1 A;  5FLX c;  1UE6 A;  4DR3 Q;  4WJW A;  5EPL A;  2K52 A;  3A5Z B;  4KY7 A;  4G7H C;  4L5S A;  1WTP A;  4A3G G;  2E5L L;  2SNM A;  4A3M H;  3K7A B;  1CK1 A;  4C2M B;  1VQ5 A;  5FK9 C;  3KF8 A;  2MO0 A;  4LUV A;  1LTG D;  1EFW A;  3W1B A;  1TS3 A;  3KLS A;  3BVZ A;  2K5D A;  1Q8I A;  2QW7 A;  1XYI A;  1STE A;  3I90 A;  1QUQ B;  1YI2 A;  3W1G A;  4A3K B;  3GTO H;  4KLK A;  1XTC D;  1JE4 A;  3I8Z A;  2K5N A;  4NKL A;  4RG1 A;  3K7U C;  2ZJP A;  1EY8 A;  3HKS A;  2Q2I A;  3HOW H;  2B8G A;  1WD0 A;  1S40 A;  2ZTC A;  2TSS A;  3AMU A;  3GTG B;  2UXD Q;  4JI3 L;  1D1K A;  4AYB E;  2OCE A;  3FKI H;  5A2Q L;  4LF6 Q;  3OWE B;  2R3Z A;  4JBK A;  3KUP A;  3CU7 A;  5CV4 A;  3WOF A;  1A0I A;  3A7L A;  5LMU Q;  1L1O A;  4FYD A;  5IGG A;  2Q8T A;  1HQR D;  4A3L G;  1EIH A;  4DN4 M;  2VUM B;  2WB1 G;  4KY5 A;  1IBL L;  1C9O A;  3BZC A;  1SEB D;  4DUY L;  4A3B H;  1A6X A;  1VDZ A;  1LM0 A;  2KJX A;  1V1Q A;  1H9S A;  3OOC A;  1XMO Q;  2A73 B;  3Q23 A;  1ENF A;  3M4O H;  2QDB A;  1YIT A;  2KEE A;  3LWU A;  1GO3 E;  1TY2 A;  4KI0 A;  5IWA Q;  2K01 A;  4MTK A;  4RH6 A;  2F0U A;  2AMC B;  4YHH Q;  2OWO A;  2UXC Q;  4C3I G;  3PGZ A;  3TN2 A;  4DR6 L;  1QNU A;  2NWG A;  2OQK A;  4QUF A;  4X64 Q;  2PPB C;  1K3R A;  4HIK A;  4QY7 A;  4P73 A;  1PYW D;  4A3I G;  4NMZ A;  1E1O A;  1S5E D;  3GTQ H;  4R4Q A;  1EEF D;  4K2L A;  2B2T C;  2OTL A;  4DV5 L;  2B2W C;  1LT3 D;  4HIM A;  1RIP A;  4GZY C;  1XJV A;  1Q1E A;  2AHO B;  2N78 A;  3BYT B;  1S3O A;  2NTS A;  4JI1 L;  4ILW A;  3T53 B;  1N9W A;  2CQA A;  1EY7 A;  3V05 A;  3CD6 A;  3K5M A;  2PNH A;  4R4I A;  2F0D A;  1U4R A;  4MZ9 A;  4A3G H;  3SVM A;  2CCZ A;  4H0L C;  1FGB D;  1PZK D;  5BR8 Q;  1YJN A;  3TP8 A;  3GTK H;  1QWY A;  4JV5 Q;  3JAM E;  2I5L X;  1HJP A;  1NCV A;  3NEN A;  1SE4 A;  1JOK A;  1EQQ A;  3V2T A;  4K6D A;  4DV3 L;  2R93 B;  4X66 Q;  2ATW A;  2YTY A;  1N33 Q;  5E7N A;  1UAP A;  3MFG A;  1H95 A;  5JPM C;  3SEB A;  1AFP A;  1D5M C;  1UEA B;  2NUC A;  1DCZ A;  2YYZ A;  1KRS A;  1N36 L;  4WOR A;  1SMY C;  4YY3 Q;  1F2M A;  1W6K A;  5LMN L;  3CME A;  2UUA Q;  4YWK A; 
#chains in the Genus database with same CATH homology
 4CGY B;  2EPB A;  3NWS A;  1AZP A;  2AUJ D;  1Z6H A;  1DJR D;  1VCI A;  2K05 A;  5DM7 3;  2QCP X;  4ZLT F;  1C48 A;  2I07 B;  4C3H G;  3Q24 A;  3FEW X;  1NSN S;  1G2T A;  2KUM A;  3PV0 A;  1B9M A;  1WTQ A;  3I4M B;  2JA6 B;  1EZ6 A;  5C5M A;  1BCP C;  4QF4 A;  2HDL A;  5E4W C;  3VR2 A;  4DNT B;  5EBD A;  2SNS A;  2H4O A;  1QG7 A;  4B9W A;  3NTI A;  2H1E A;  1QCB D;  2EJM A;  2MHV A;  1JWM D;  2F0F A;  1I4R A;  4G7Z C;  5AFW A;  3F2U A;  3PO3 B;  3I91 A;  3S2H B;  1FNU A;  4QB4 A;  3I72 A;  4KN7 C;  4CJ0 B;  5D3I B;  4HAE A;  5JEA G;  2B2T A;  2B2W A;  3DUZ A;  1JIC A;  3P1H A;  4KKT A;  1BXT A;  4BY1 B;  2XRQ D;  1B3A A;  2VB2 X;  2K7V A;  2BDO A;  3NUC A;  3MXN A;  3TZU A;  3NE5 B;  2L1B A;  3H09 A;  5IGC A;  3K57 A;  1U4P A;  2KQ3 A;  4N9T A;  5CV5 A;  2F0E A;  3PUX A;  4ODG A;  3D3R A;  1F2Y A;  2JA5 B;  1B9N A;  3VA7 A;  4KHV A;  2HCI A;  1CI3 M;  1TS2 A;  4J6H A;  3NBI A;  3K58 A;  5FO8 B;  4R9W A;  1SND A;  2F0S A;  3K6O A;  1JWS D;  5CV8 A;  1GOZ A;  1EY6 A;  3TP7 A;  3ZYY X;  1IKL A;  5EGT A;  3MXU A;  4K5V A;  2K5Q A;  3T51 B;  4CKC A;  1WTR A;  4CJ2 C;  5T1I A;  1SAP A;  5KIX A;  4K5X A;  2NTT A;  4MHE A;  1SE3 A;  1SE2 A;  2E2H B;  2MP1 A;  5JPN C;  2Z8L A;  3QJY A;  4MIU A;  2A6H C;  1V8Q A;  1SNM A;  3H6M A;  4QCL A;  3E5S A;  4RAU C;  2NYZ D;  4FF3 A;  4IUT A;  5C3E B;  5IOC A;  4XQQ A;  4RCN A;  4XQN A;  1E0B A;  5COR A;  1X3P A;  4BS9 A;  1C8C A;  2PZW A;  4IN3 A;  2K04 A;  3OMC A;  5JEA H;  2RVL A;  4PNY A;  2A5H A;  2AQ2 B;  1IW7 C;  2GA4 B;  2XVS A;  2EY5 A;  2KA7 A;  2DNC A;  5F2D A;  5J1Z A;  4NW2 A;  4OGQ C;  1SNQ A;  3U9S A;  3E6Z X;  2QIL A;  4J8Q A;  5DEH A;  2L9H A;  3T56 B;  3OMG A;  1RD9 D;  1S5F D;  3IFT A;  2WAC A;  2VB3 X;  3S9W A;  4KV6 A;  2AWO A;  5JAV A;  4RHS A;  3V96 A;  2F0I A;  1O7Y A;  1DYQ A;  3IFD A;  4PQX A;  4XT3 B;  2WV6 D;  1GUS A;  2HUG A;  2F0P A;  2JA7 B;  1G6Z A;  1ILQ A;  1SNO A;  1OXX K;  2SOB A;  2XIW A;  3R2T A;  2L0C A;  4X3U A;  2EYL A;  2B63 B;  4FNF A;  5C0X I;  1F9S A;  3NQI A;  2KED A;  2JYO A;  4KHZ A;  1WD1 A;  2BDN A;  2BCO A;  1EWC A;  3KBG A;  1AN8 A;  4EQP A;  1LT4 D;  4M8A A;  3SDZ A;  5COY A;  3P20 A;  3K5N A;  2RSO A;  4TRD A;  5G3L F;  1PRT D;  3P7J A;  1NAP A;  1Y1W B;  3TME A;  3I73 A;  5I2X A;  3FPU B;  1ENA A;  1O80 A;  5T1G A;  1PFB A;  5EPK A;  5HUR A;  1F9R A;  3DWP A;  1LLR D;  4HCS A;  3K5L A;  3BYY B;  5JVH 3;  4ZKB B;  1S4Z A;  2F3W A;  4QUC A;  1STY A;  3HOZ B;  3T16 A;  2OT2 A;  3K0Y A;  3BDL A;  2LKV A;  3ERO A;  2EVB A;  4U68 A;  2PO4 A;  1NR4 A;  1A3U A;  4A3M B;  2EXZ A;  1QOH A;  4Q5V A;  2R6G A;  2OF1 A;  2O2L D;  1BR9 A;  3MC0 B;  3Q0A A;  3IAY A;  1YNJ C;  3D6C A;  3NSW A;  1SDF A;  4KJO A;  4TSS A;  2PW7 A;  4X3S A;  5BN3 A;  3KK7 A;  2F0V A;  3C2P A;  4DFA A;  2Z4I A;  3GTO B;  1TR5 A;  1CTM A;  3RLF A;  4EQO A;  1HQM C;  5I9P A;  3HOW B;  1CM9 A;  2K5W A;  1DOK A;  2PQE A;  3FKI B;  5DAU A;  1W6J A;  4P2C B;  2XWB B;  3HGB A;  4CBV A;  1H9S B;  3NP8 A;  3BS1 A;  3MWY W;  4WFN 3;  3OW7 A;  1CT1 D;  5BN5 A;  2I46 A;  1HCZ A;  1IYU A;  3RUZ A;  5ELB A;  1CA6 A;  3ND9 A;  4A3B B;  2Q8R E;  5CBA E;  2D2C C;  1HA5 A;  5M9O A;  3M4O B;  5CC4 A;  1RTO A;  1PTO C;  1SSO A;  3WOE A;  1RHP A;  1O7L A;  3AU7 A;  3VR4 A;  2DY7 A;  2KCC A;  4IZ8 A;  4R8N A;  3GTQ B;  3NQT A;  5CV9 A;  4ZUI A;  2PZT A;  1HRJ A;  4IUU A;  3HZX A;  1MGS A;  4UDU C;  1BCP D;  2RKS A;  2NZ1 D;  1SNP A;  3OWF A;  2IT1 A;  1UUP A;  4A3G B;  1STN A;  1JC7 A;  2QEJ C;  1KLG D;  1EY5 A;  3GTK B;  4ZQ3 A;  4DXG A;  4XYQ A;  3MXG A;  4DNR B;  2J7Z A;  2E74 C;  1PRT C;  2HDM A;  2LS0 1;  1SBB B;  2JXM B;  1CZG A;  2PNR C;  1HA6 A;  5K36 G;  2IWH A;  4XYO A;  3MEH A;  4RFB A;  1Y69 U;  4B08 A;  5KND A;  4LK1 C;  1C4Q A;  4OL7 A;  2Z4H A;  4FP5 D;  3L9A X;  4X3K A;  2Z1C A;  1Q12 A;  2EOT A;  3DMU A;  3VYS A;  2WB1 B;  1WTW A;  1QE6 A;  1Y8N B;  1Y8O B;  3CHB D;  4IUQ A;  5LHY 1;  2B2Y C;  1AP0 A;  1EQV A;  4ZRZ A;  3S15 B;  3S1Q B;  1BUV T;  4R8I A;  2K32 A;  1G91 A;  1MBY A;  3FDT A;  4CHT B;  1PTO H;  4DAP A;  3PIP 3;  2D9U A;  4Z9C B;  3KBX A;  3M3Y B;  1KAB A;  4C3I B;  2R61 A;  4HR7 B;  2ZXO A;  2IX0 A;  1EYD A;  1X32 A;  3SK5 A;  3L7Z C;  1MSG A;  4A3I B;  3HG9 A;  1II3 A;  2J4X A;  3J81 L;  1I3Q B;  2A6H D;  1QNK A;  2EYJ A;  4L6T B;  2PW5 A;  1F9Q A;  1G2S A;  2FMM A;  1L0Y B;  3A8J E;  5KYI A;  2DNE A;  1KAA A;  3UI2 A;  2HQE A;  4O42 A;  4DU9 A;  3GTP B;  3SK8 A;  1BF4 A;  5FOB B;  1RF2 D;  4LMQ D;  1BNZ A;  2L55 A;  1ENC A;  4FXD A;  4RGO S;  2M2L A;  2EDG A;  1IW7 D;  5C6A A;  2KEC A;  4C3J G;  3J7A F;  1EYA A;  5K36 H;  5FLX L;  1VF7 A;  5ISR A;  5IGF A;  5KGU A;  2K1B A;  1GUO A;  1CHP D;  1M4V A;  3GQB A;  3SK4 A;  1F2Z A;  1JCK B;  4G4K A;  3K59 A;  1HFG A;  4RKB A;  2B2V C;  5CR3 A;  3A8I E;  3QIA A;  1T5X D;  3EVQ A;  1I4H A;  2AQ1 B;  4IFD I;  1HPC A;  1B1Z A;  4KN4 C;  2BA0 A;  1GHJ A;  1HHV A;  4C3H B;  1CA5 A;  4IAL A;  3I4L A;  1YNN C;  4A93 B;  4HMI A;  4DGZ A;  3GO5 A;  3NPP A;  2B2Y A;  3M4Y A;  1Y1V B;  3PO2 B;  4MN3 A;  2OXP A;  1BCP B;  2O5J C;  2F0W A;  1S5B D;  1LTT D;  2D62 A;  4O1N A;  2K33 A;  1BBX C;  4K8I A;  2L4N A;  5C4X B;  2F1M A;  2A68 D;  4HSV A;  1D5X C;  1SYB A;  3OIP A;  1TII D;  2L11 A;  4F87 A;  3SXH A;  1KLU D;  1RJT A;  3DHQ A;  4N9P A;  5J22 A;  2O4X A;  4KMU C;  1PXU A;  3TP6 A;  5BN4 A;  4X3T A;  1K8M A;  1JB3 A;  5DM6 3;  1GUT A;  1GUG A;  1PZI D;  3T4A C;  1IKM A;  2ZXR A;  1FR3 A;  5C3X A;  3A56 A;  1STG A;  4G57 A;  1VMP A;  4CKE A;  2RDF A;  1V1P A;  4OO1 I;  4ZK9 B;  3OSO A;  5CV7 A;  1BOS A;  2CW0 C;  2R7Z B;  1O78 A;  3TP5 A;  2RDG A;  2L12 A;  2N55 A;  3MTS A;  2B2V A;  1LTR D;  1RKN A;  2WKD A;  2JEB I;  3HOV B;  1O7Z A;  1QB5 D;  2CVR A;  1GUW A;  5C0X J;  2NB0 A;  3VYT A;  3EFX D;  2NBF A;  1U4M A;  2RSN A;  4E6I A;  3GD7 A;  3ND8 A;  1YNJ D;  1PMR A;  3QOJ A;  3VR5 A;  5I6W A;  3BZD B;  1DXM A;  1MI2 A;  1I4Q A;  2C5C A;  2F3V A;  4DAY A;  3NXW A;  3LNN A;  4OIK A;  4C56 C;  1AW7 A;  4XQJ A;  5IIF A;  2EE1 A;  3X3M A;  1HTL D;  3DEP A;  1U4L A;  2A6E C;  4B9X A;  1WTX A;  3S17 B;  5FO9 B;  1Q3L A;  3TSS A;  1EY9 A;  4PMW A;  4RCO A;  4FXK C;  1KNE A;  3D31 A;  3PUW A;  1EOT A;  1WTO A;  5KEE A;  1ROD A;  2F0H A;  2LY7 A;  1UNS A;  3W3A A;  3G6J B;  1PTO D;  3D8G A;  2CHB D;  2DY8 A;  3GV6 A;  3GTL B;  2MJ8 A;  1STB A;  2OEO A;  2EZV A;  2SDF A;  3QOL A;  1LTB D;  4TQU S;  1DOM A;  2AWN A;  5JJZ A;  1U9R A;  3A54 A;  3GTM B;  3BDC A;  3NHH A;  1XX8 A;  3IKJ A;  4DXF A;  5FO7 B;  5CGK A;  4BA1 I;  2A68 C;  3J7A V;  3RMH A;  4XXE A;  5C4H A;  1JWU D;  1PRT F;  3A8K E;  3PMF A;  3R8B A;  4HCE A;  4OO1 G;  1BQQ T;  1SYE A;  4IFD H;  2E75 C;  2E2I B;  1D1I A;  3CKI B;  1SYC A;  1J8I A;  3EA6 A;  1GXD C;  4I7Z C;  5C44 B;  1T5E A;  5D14 A;  1A2T A;  1CQV A;  4RGN A;  1BDO A;  3IL8 A;  1JQY D;  2EY2 A;  3DWA A;  3HKZ B;  2B2U C;  4ULL A;  3D6W A;  1ESF A;  1EIG A;  1G29 1;  4NDX A;  2KOL A;  1XWE A;  1L0X B;  2FFK B;  4ID6 A;  1RCV D;  1PZJ D;  1M8A A;  5IT9 L;  3N6R A;  2WII B;  4XTC S;  1F2L A;  2A69 D;  2KHS A;  4DK0 A;  1TWA B;  4CJ1 B;  2PMZ B;  3ERQ A;  3VR6 A;  2LMC B;  3FMC A;  2G9H D;  4K14 A;  4G7O C;  2Y0S B;  1CHQ D;  3O13 A;  3DXJ C;  2RA4 A;  4XT1 B;  1OXV A;  5EKL A;  3Q6S A;  4LJZ C;  3J81 E;  2ENB A;  2NVY B;  4U67 3;  4J1M A;  5I6Y A;  1A2U A;  3M7N A;  1ZYR C;  5FKA C;  2X6G A;  1SYF A;  2WKC A;  4OO1 H;  3M7G A;  1LO5 D;  1R4P B;  1WTV A;  1Q90 A;  5ELC A;  5C0X G;  2F0T A;  3GP7 A;  2XSC A;  1KDC A;  1QJO A;  1ILP A;  3BVG A;  3HRZ C;  2AQ3 B;  5LL6 X;  4RGT A;  2JSO A;  3MHB A;  3DEO A;  4DK1 A;  2X6L A;  3PUY A;  1BCP F;  3J80 E;  1NR2 A;  5FLX E;  2V4D A;  1I4X A;  1B4O A;  1V43 A;  4H44 C;  2F0O A;  1NUC A;  3VA5 A;  1S5D D;  1PTO B;  2BOS A;  5KRU A;  3BVM A;  5DNF A;  1PFN A;  2B2U A;  3QB3 A;  4H7B A;  1MD2 D;  2NVQ B;  4AYB B;  3MVV A;  4KD3 A;  5IGB A;  1YNN D;  2BE5 C;  4EVO A;  5I2Y A;  1FNW A;  1B50 A;  2F03 A;  2RBM A;  4FF2 A;  4CKB A;  1GUN A;  2QKI C;  3N52 A;  4K2K A;  3PUZ A;  4L63 B;  5EKK A;  4IUR A;  3LWE A;  2FMC A;  1V1O A;  2F0G A;  1TT2 A;  4PV1 C;  4C1N K;  5J39 A;  2WP8 J;  4BWG B;  1STA A;  2EY6 A;  3X3N A;  4ZAI A;  1G8Z D;  5IGE A;  1EU3 A;  1Z47 A;  1A3V A;  2F0M A;  4DAV A;  1TWG B;  3SHL A;  3A7A B;  4IUV A;  2J0T D;  4RA8 A;  1SYG A;  1PRT B;  4BY7 B;  1R4Q B;  3QWN A;  4JBW A;  2NVT B;  4FF1 A;  4HSP A;  1TS5 A;  1TY0 A;  2M00 A;  2XWJ B;  1QIL A;  3J7Y W;  1CFM A;  4HMJ A;  4K5W A;  1K83 B;  4IFD J;  5C0X H;  1SXT A;  4KY6 A;  1I4P A;  3FPP A;  1A3T A;  2A69 C;  3EQL C;  4YIJ A;  5D3D A;  1HUN A;  2ID0 A;  4ME5 A;  1DD2 A;  5M5Y B;  2E2D C;  5CV6 A;  3H3V C;  1SFO B;  1Y8P B;  1F77 A;  5JOB A;  2NN6 I;  1HTP A;  3HOY B;  3C1F A;  1EL0 A;  1H9M A;  3D4R A;  1SJH D;  3S1M B;  1TU2 B;  2CW0 D;  2ICI A;  2EYO A;  4V0B A;  1ESR A;  2EJG C;  2FJ2 A;  3S2D B;  3H0G B;  4DF7 A;  1TWH B;  2F0L A;  1JR0 D;  1DON A;  4BBR B;  1FNV A;  2MUY A;  4S3S A;  2F0Q A;  4Q0F A;  4F8M A;  1OXU A;  3H94 A;  1GJX A;  3NBH A;  4K6L A;  1R9T B;  1LTS D;  2WIN B;  5M3M B;  3J80 L;  5C3W A;  5M5W B;  2YU9 B;  5KYL A;  4BBS B;  2A6E D;  2KVM A;  3H91 A;  3RZO B;  3CQZ B;  2PZU A;  2E2J B;  1OO9 B;  3QO2 A;  5C4Z A;  1ZEQ X;  4C3J B;  1HFN A;  3TZD A;  3SK6 A;  4ZYS A;  1D6E C;  1V1P B;  1IHZ A;  3ONA B;  5EPJ A;  1ET9 A;  3C46 A;  4BA2 I;  3HOX B;  1LT5 D;  4KTA A;  1AZQ A;  4FXG C;  3MFY A;  3OHX C;  5I4D A;  3S1R B;  1VF5 C;  1OXS C;  2IX3 A;  1EU4 A;  4HTH A;  4V19 0;  5E1F A;  3DWQ A;  3FVQ A;  3ITP A;  1EY0 A;  5M5X B;  2VXW A;  3D4W A;  3RD4 A;  3BDO A;  5CMD A;  4ZKC B;  5IGD A;  2C9O A;  4LAA A;  2MGS A;  1DM0 B;  3W2D A;  1ET6 A;  4RWS C;  2E76 C;  2B39 A;  3VR3 A;  2NN6 G;  1EFI D;  4FVM A;  3GV3 A;  1ZXT A;  1TWC B;  5TSS A;  3MXP A;  2IX1 A;  1WCM B;  1HUM A;  2RDH A;  1KNA A;  4EQN A;  5ELF A;  1JOR A;  1STH A;  5EKI A;  2JEA I;  1D2B A;  3R3O A;  1TWF B;  2D5D A;  5HGT A;  4A3E B;  2Q8I B;  3OIQ A;  2N88 A;  3GTJ B;  1X3Q A;  2ZT9 C;  3C1E A;  4L8J A;  2LFN A;  3HS0 C;  2F0K A;  2EYP A;  3E0J A;  3PIO 3;  3U9O A;  1ICW A;  4KJN A;  1TKW B;  3S14 B;  3M85 A;  2F4I A;  2TMP A;  4H13 C;  3VYR A;  2WAQ B;  1LT6 D;  4TKO B;  3FRP B;  1JOO A;  3NWT A;  5EQ0 A;  3Q22 A;  1GHK A;  5NUC A;  3RZD B;  2SEB D;  5D65 A;  3JAM L;  4NP5 A;  5C4J B;  1SYD A;  2IW3 A;  3EJI A;  5IT9 E;  3P75 A;  3A55 A;  3NTH A;  4IFD G;  3T13 A;  1KDA A;  2F0N A;  5C5L A;  1OXT A;  1H9J A;  1EEI D;  2O5I C;  3OPO A;  4XIG S;  2PCF B;  1H9K A;  1FYC A;  2IPK D;  2KCN A;  5I9O A;  4I65 A;  2XRS D;  4A3D B;  3PUV A;  3K5O A;  5K5P A;  2NN6 H;  4RHR A;  1B2T A;  1ZYR D;  4HN7 A;  3TDQ A;  4WRD A;  1LTI D;  1ZKO A;  5JVG 3;  1PTO F;  2F0J A;  4ZUJ A;  1LAB A;  4FF4 A;  4A3J B;  4EGV A;  3SE0 A;  3CRL C;  1CZW A;  4DA2 A;  2ZXP A;  1LV9 A;  1KTK A;  4IUP A;  3C3L A;  4OHJ A;  2K03 A;  5EBC A;  3I70 A;  5ELE A;  5CBE E;  3S16 B;  3D4D A;  4OIJ A;  1JOQ A;  2IL8 A;  1PDQ A;  3QG1 A;  1PFM A;  1K8O A;  1TQO A;  1Z7T A;  1IYV A;  3MZ5 A;  2K6A A;  4JK1 C;  3R93 A;  1KDB A;  4IQZ A;  1Q1B A;  1WVL A;  2EYF A;  3NTK A;  4UAI A;  3LX0 A;  1IL8 A;  1RDP D;  2VNU D;  4QIW B;  3I3C A;  1F9P A;  2BE5 D;  2FHT A;  3BG3 A;  2ICE C;  5M3F B;  1SJE D;  4HED A;  2A74 C;  1EQT A;  2B8F A;  4ABN A;  1DZ1 A;  3G7L A;  4C1N I;  3TBI B;  5A2Q E;  3HP3 A;  1E2W A;  5IOD A;  5KNC A;  3MAQ A;  2K28 A;  2XNA C;  4KKU A;  4M1U B;  1B53 A;  1I6H B;  1I6V C;  2EYH A;  3KLS X;  1J9O A;  5G3L D;  3AB9 A;  2EYM A;  4F88 A;  3L3O C;  2X69 A;  1DOL A;  1TS4 A;  4RKL A;  1CQF A;  2JP1 A;  1ML0 D;  5EJW A;  4KD4 A;  1SNC A;  3HOU B;  3DM1 A;  1HXY D;  2IJ0 A;  1VMC A;  1ONL A;  1AEX A;  1E2Z A;  1BO0 A;  5CYU A;  1TVX A;  4QMG A;  3SR1 A;  4FO2 A;  1LAC A;  1EY4 A;  4PMC A;  2M9V A;  5KNB A;  1I4G A;  1D5Z C;  1E2V A;  4XDX A;  4KK7 A;  4A3F B;  4KKS A;  1EYC A;  1H9R A;  2JE6 I;  1PLF A;  3WDN A;  1A15 A;  4PMB A;  3VYU A;  5LL6 S;  2G9D A;  2MPM A;  2XN9 C;  5E4X A;  3URY A;  3CRK C;  2DN8 A;  5ELD A;  5E3F A;  2FIN B;  4Y7N B;  3NK9 A;  4K8J A;  1I50 B;  2EY1 A;  3KLR A;  4IUN A;  1RTN A;  2R92 B;  2RQX A;  4F7X A;  3HEJ A;  2JA8 B;  3I4N B;  1S5C D;  1EZ8 A;  1B44 D;  5A35 A;  1SMY D;  1FD7 D;  3MA2 B;  2NVX B;  3R2I A;  2AUK A;  4RGM A;  2L5T A;  2QF7 A;  2EJF C;  1EWH A;  5JEA J;  2PYK A;  1LTA D;  3S1N B;  1MSH A;  1XXG A;  2HCC A;  2BA1 A;  4WJW A;  5EPL A;  4KY7 A;  4G7H C;  1WTP A;  2SNM A;  3K7A B;  1CK1 A;  4C2M B;  5FK9 C;  3KF8 A;  1LTG D;  1TS3 A;  3BVZ A;  3KLS A;  2K5D A;  1Q8I A;  1XYI A;  1STE A;  3I90 A;  4A3K B;  1XTC D;  1JE4 A;  3I8Z A;  4NKL A;  1EY8 A;  2B8G A;  1WD0 A;  3AMU A;  2TSS A;  3GTG B;  1D1K A;  5A2Q L;  3OWE B;  2R3Z A;  3KUP A;  3CU7 A;  5CV4 A;  3WOF A;  3A7L A;  4FYD A;  5IGG A;  2Q8T A;  1HQR D;  1EIH A;  4DN4 M;  2VUM B;  4KY5 A;  1SEB D;  1A6X A;  1VDZ A;  2KJX A;  3OOC A;  1H9S A;  2A73 B;  3Q23 A;  1ENF A;  2QDB A;  2KEE A;  3LWU A;  1TY2 A;  4KI0 A;  2K01 A;  4RH6 A;  2F0U A;  4C3I G;  3TN2 A;  1QNU A;  2NWG A;  4QUF A;  2PPB C;  1PYW D;  4NMZ A;  1S5E D;  1EEF D;  4K2L A;  2B2T C;  2B2W C;  1LT3 D;  4GZY C;  1Q1E A;  3BYT B;  2NTS A;  4ILW A;  3T53 B;  2CQA A;  1EY7 A;  3V05 A;  3K5M A;  2F0D A;  1U4R A;  3SVM A;  4H0L C;  1FGB D;  1PZK D;  3TP8 A;  1QWY A;  3JAM E;  1NCV A;  1SE4 A;  1JOK A;  3V2T A;  4K6D A;  2R93 B;  1UAP A;  3MFG A;  5JPM C;  3SEB A;  1AFP A;  1D5M C;  1UEA B;  2NUC A;  1DCZ A;  2YYZ A;  4WOR A;  1SMY C;  1F2M A;  1W6K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...