1HTPA

Refined structures at 2 angstroms and 2.2 angstroms of the two forms of the h-protein, a lipoamide-containing protein of the glycine decarboxylase complex
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
131
structure length
131
Chain Sequence
SNVLDGLKYAPSHEWVKHEGSVATIGITDHAQDHLGEVVFVELPEPGVSVTKGKGFGAVESVKATSDVNSPISGEVIEVNTGLTGKPGLINSSPYEDGWMIKIKPTSPDELESLLGAKEYTKFCEEEDAAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The lipoamide arm in the glycine decarboxylase complex is not freely swinging.
pubmed doi rcsb
source organism Pisum sativum
molecule tags Oxidoreductases(acting on ch-nh2 donor)
molecule keywords H-PROTEIN
total genus 35
structure length 131
sequence length 131
ec nomenclature ec 1.4.4.2: Glycine dehydrogenase (aminomethyl-transferring).
pdb deposition date 1995-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01597 GCV_H Glycine cleavage H-protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1htpA00
2O5IC 4KI0A 4RCNA 3VR6A 1ZYRC 1H9SA 1GUNA 3EQLC 4OGQC 4BA1I 1LABA 2A6HD 4G7HC 4XIGS 2LMCB 1OXXK 3QJYA 2BE5D 4H0LC 2D2CC 1H9RA 3LNNA 2K32A 2E74C 2BE5C 3PUYA 3GQBA 1GUOA 1VF5C 5KNBA 1DD2A 1GHJA 2PNRC 3A7LA 4KKSA 1Y8OB 3A7AB 3OOCA 3T51B 1OXUA 4DK0A 1V43A 3OW7A 1EWHA 2D5DA 3LWUA 4DNRB 4DK1A 1CI3M 1CFMA 2DN8A 3GD7A 1PMRA 1H9SB 2AUKA 2L5TA 1T5EA 3I4LA 1H9KA 1TKWB 5K36G 3M7NA 3DXJC 1Q12A 3MXUA 3CRKC 1HTPA 4JK1C 5BN4A 4KN7C 3PV0A 3PUXA 3WDNA 3I73A 3MFYA 2PPBC 4G7ZC 1H9JA 1E2WA 1QJOA 1CTMA 4LJZC 1Z7TA 3FPPA 3T56B 1GJXA 3A8JE 4H13C 4G7OC 3NE5B 3RLFA 5BN3A 2ZT9C 2K33A 1K8OA 2IT1A 1A6XA 2B8FA 2JEAI 1O78A 1ZKOA 1VDZA 2NN6H 1IYVA 2A6ED 2DNEA 1BDOA 4KKTA 1LACA 3N6RA 3U9SA 4OO1G 1V8QA 4GZYC 3SDZA 2JXMB 3PUWA 2BDOA 1E2VA 1VCIA 3M4YA 4KKUA 1Y69U 3PUVA 2EVBA 1O7LA 3KLRA 3QG1A 2E76C 2F1MA 3ND8A 5JEAG 2O5JC 3CRLC 2JE6I 4L8JA 5BN5A 2A69C 5K36H 3VA7A 3L7ZC 3ND9A 3PUZA 1HPCA 3VR3A 1IW7D 2D62A 2JEBI 2YYZA 3BDOA 4JBWA 1OXVA 1I6VC 3A8IE 1HCZA 2K7VA 1FYCA 5C0XG 1DCZA 1Q90A 4PV1C 1VF7A 4IQZA 1GUGA 2V4DA 3TZUA 2CW0C 2EJFC 1YNJC 3AB9A 3A8KE 1K8MA 1OXSC 3P20A 1SMYC 1E2ZA 1GUTA 1Q1EA 2KCCA 2AUJD 2B8GA 1B9NA 2Q8IB 2EDGA 4HR7B 1DXMA 1Z6HA 1B9MA 4XTCS 3I72A 2BA0A 2QF7A 5KNCA 2A6EC 1Y8NB 2A6HC 1ONLA 4I7ZC 2NN6G 3FMCA 4DNTB 5C0XH 3QIAA 1H9MA 3HGBA 1FR3A 1OXTA 4IFDH 1HQMC 3OPOA 4H44C 4KN4C 3VR2A 4OO1H 3D4RA 1IW7C 2E75C 5JEAH 4KMUC 3VR4A 3VR5A 2EJGC 2KA7A 4KHZA 1TU2B 1YNNC 3IFTA 4LK1C 3T53B 2R6GA 3BG3A 2AWOA 3SE0A 2BA1A 3H94A 4BA2I 2A68D 4TQUS 1Q1BA 2EJMA 1GHKA 2PCFB 3M85A 5A35A 1IYUA 2A68C 4IFDG 1GUSA 1G291 5KNDA 4TKOB 2DNCA 3IKJA 3D31A 2NN6I 1Y8PB 2A69D 3W3AA
chains in the Genus database with same CATH superfamily
4J8QA 3MXNB 2HQEA 1RODA 1XPOA 4OGQC 4GKKQ 2B2VA 3PO3B 1PH3A 5IE8A 5D65A 2Z6KC 1QCBD 2PQAA 1L1OB 3HOYB 1YBYA 1SROA 4JI3L 1HA5A 3TP6A 1HNWQ 2ZTEA 1JB7A 2IJ0A 4APVA 5IIFA 2Z9HA 2VQEQ 2VUMB 3T1HL 1W3SA 5KGUA 3JAML 1O7ZA 3SR1A 4QF4A 1LYLA 3PUXA 3H0GH 3HKZG 4H13C 4IJHA 5TSSA 3D4WA 3RLFA 3GTPH 3C1EA 1IBKL 4OHJA 2RKSA 3T16A 1HNZQ 3G4SA 1GVPA 4A3FG 1FVIA 2BDOA 2YTXA 3WOEA 4GNXC 1KDCA 4QY7A 1YITA 3ND8A 1W2BA 4X64L 1YHAA 3G6JB 2UUBL 3VA5A 1VMCA 2LFNA 1MJCA 2IHEA 3QOLA 3UI2A 4X65Q 2F03A 4HAEA 3L2PA 4QMGA 3HG9A 1E24A 1YI2A 1S40A 2B63G 3GTMH 4BBRH 4KJNA 2K28A 4F88A 1SXTA 1HHVA 5IGGA 4X3TA 4NKLA 2BA0A 4DN4M 2R61A 1U4MA 2NN6G 4DV0L 1D1IA 1STEA 2JA5G 5CR3A 3UDFA 2WAQB 3DMUA 3OW2A 4K0KQ 1NUCA 2F0VA 1F2YA 5IGDA 3PF5A 5EQ0A 4GKKL 1KL9A 2G9HD 4ME5A 3NTHA 3FRPB 1DOLA 2CH4A 4JV5L 2B2YA 4B3SL 2A68D 4A75A 1Q82C 1AEXA 1G291 1F9QA 1RTOA 1SE3A 1SNOA 2NZOA 3S1NB 1U4RA 1XJVA 1Q8KA 4JI0Q 4KI0A 1A3TA 3HOZG 3MVVA 4IURA 3HP3A 1LABA 4IOAA 1KC8C 2D2CC 3RZOB 1A3VA 5JVH3 1FL0A 1UAPA 3I4MG 3GTGH 2A73B 5KNBA 2OF1A 5E1FA 3RZOH 2JA6H 1ASYA 1VQFA 4JI6L 1TT2A 3GTKH 4A3CG 3EROA 1R9TB 3CCMA 3MFGA 3LWUA 2RA4A 2DJFC 1CI3M 3HOZB 2ZJQA 1TS2A 2AUKA 5J3BA 3L9AX 5IP7H 1ZXTA 4JI7L 1B8AA 4JK1C 2UUAL 3I4MB 1E3PA 4NDXA 3CF5A 1AZQA 2PO4A 4FNFA 1XMOQ 1O7YA 5IGFA 3A8JE 2UXBQ 2GVBA 2RCNA 5BN3A 2LXJA 2B8FA 2JEAI 2I5LX 1ZKOA 2NZ1D 1XPUA 1EYAA 2WAQE 5C0XJ 3LGJA 2XN9C 5E4WC 1XNQL 1AN8A 3WOFA 3VYUA 4GZYC 2JXMB 4C3HB 2NVTH 4JYAQ 5M3FG 4BY1B 3GTOH 4KV6A 3VYTA 2EYJA 4FP5D 3PUZA 1CHPD 2PQEA 3E3XA 1SFOB 5IT9c 4ALPA 5M5WB 3ZJYC 4LF5L 1GUGA 4FDBA 3MEFA 3TZUA 4L5RC 3I4NG 4RKBA 1GUTA 1STAA 4C3HG 4QQBX 4DKAC 5JJIA 4PMWA 2BDNA 4GN3B 3PIPA 3W2DA 4BY1G 1JJGA 4DAPA 5EKKA 1II3A 3FHWA 3KF8B 3DWQA 5C3WA 1TS3A 3U50C 1VQIA 1VMPA 5DEHA 3OPOA 1EY0A 1PYSB 3D4RA 3P1HA 3A56A 2HQLA 4S3SA 1EY9A 4F87A 2ZTCA 5FO8B 1B53A 2IHFA 2KCMA 3K5MA 1STHA 2F0FA 5BR8Q 1Y1VG 4IPCA 3ONAB 3EJIA 4ABNA 1RTNA 3KDFB 3BZKA 1R9TH 3NEMA 3DUZA 3BDLA 5ELOA 4DR4Q 2B2UA 1QG7A 1A2UA 2UUBQ 4BBSH 4K5VA 3J7AV 4EQNA 2OTLA 4DV4L 3HOVG 1HUNA 1GHJA 4KKSA 2NVXH 3CC7A 4CJ2C 1Q81C 5LL6X 3K57A 4X6AH 1I4PA 3AFPA 1Z9FA 1D5MC 3G7LA 4DK1A 4POGA 2DN8A 4FF2A 3NUCA 2QGQA 4RCOA 1TWGH 1AE2A 1Q12A 4IZ8A 2SNMA 4ZKCB 5IP9G 4JI1Q 2PPBC 2EQSA 1SR3A 3CCRA 3HOVB 1Z7TA 1RL2A 2AWNA 1QVFA 3W1GA 4BBRG 1F77A 1XTCD 1LTBD 3SK8A 1VQAA 4A4IA 4YHHL 1B3AA 3IRBA 4H7BA 1KDBA 1SRUA 1KNEA 1VQ9A 4DR3L 5IT9E 3OWEB 5LMNW 1STBA 4A3EG 5M5YH 5CV6A 1PH1A 4GOPA 2MFIA 4XT1B 2A69C 3I8ZA 3BZCA 4MN3A 1YJWA 3DWAA 3K5NA 3C3LA 3MXNA 1FYCA 3FVQA 3MXPA 3NELA 2AHOB 3RLNA 2XRSD 2N88A 4RGMA 3AB9A 5ISRA 1K8MA 1VQGA 4Z9CB 1PTOB 2PQAB 3GTQH 2F0KA 5FO9B 4QIWB 1ONLA 2RVLA 3S1RB 1N34L 3PO2B 1WTHA 3MA2B 5I2XA 3AEVA 1B1ZA 1CHQD 4MZ9A 1RF2D 1X3FA 3E5SA 4DAYA 3TP7A 3OHXC 4UP9A 4OX9L 2NTTA 1UE6A 2D0PA 1IW7C 3VR4A 3S1NH 4C3IG 1M4VA 3ZYYX 4CGYB 4LK1C 2QDBA 3P75A 4IFDG 3K80C 4JI6Q 4A3GG 3S2DB 1E1OA 4WJ3M 1IL8A 2EYFA 5IOCA 2CKZB 2UXCL 1A2TA 3J81i 2YTYA 5M5XH 2EPBA 4PZ8A 4BA1I 3G71A 4FF3A 3G6EA 5JPNC 4KHVA 1VQKA 4J6HA 2R93G 4R4CA 3CD6A 2K32A 2E74C 2R92G 1Q46A 4GKJL 3GQBA 3KK7A 4WRDA 1V1PB 1BBUA 4IPHA 4DR3Q 2LKVA 3C46A 3DWPA 1PZKD 2DJGC 4BY7G 5DNFA 1JWMD 2NBFA 4HJ9A 5GAEC 3A5UA 4JPBW 1TXYA 1RJTA 2E5LL 4LF6Q 1TVXA 1JICA 3T56B 1SJHD 1IL2A 4B3RQ 4JC0A 4EQOA 5LMNQ 3F2DA 3STBD 3CXCA 1ENFA 2K05A 1O78A 5CGKA 3BVMA 3TEHB 2YU9H 1T5XD 3ER0A 1BVSA 3EA6A 1JOKA 1FNUA 1X55A 3M4YA 1VCIA 1EOTA 1BCPF 1MKHA 4GLAC 1BXTA 1JJ2A 4L8JA 1EZ6A 5E3FA 1UNSA 1WFQA 1L0WA 4FF1A 4M1UB 3BDOA 4DV1Q 1QWYA 1JWSD 1X6OA 3TBIB 2IX3A 3K59A 1VQ8A 5D3DA 4YCVA 1XXGA 5C44B 2V4DA 1PTOH 1BOSA 3S2HB 4FXGC 3GTOB 1CT1D 5C44H 1V1QA 4JBJA 1B9NA 1L0YB 2VUMG 4LFCQ 5FLMG 1DYQA 4P71A 1Z6HA 1B9MA 2JA6G 1HJPA 4JI1L 4DXFA 1C8CA 4NB3A 2EY1A 2JN4A 5C0XH 1EL0A 1EWCA 2UUCL 4IFDI 5C44G 2CHBD 4HMJA 2PNHA 3NP8A 1KLGD 4R4TA 2VQEL 2R7ZG 4A3FB 2Z1CA 1WCMB 1EYCA 4V190 2K1BA 4CDCC 5IP7G 2F0HA 2ZTDA 4OXPA 2LXKA 1KNAA 4MTKA 4LUVA 1A63A 2PW7A 3VR3A 2YYZA 5A2QE 3QWNA 2FJ2A 2WB1E 5C4XH 4NMZA 4HIMA 1UE7A 5BR8L 1BBWA 1LV9A 1XYIA 3BYYB 4KJOA 4DA2A 1WOCA 3M9BA 1XTDA 4UDUC 2VUMH 1YNXA 4Y52H 1HXYD 4R4QA 4DK0A 1YHBA 2F0PA 1HRJA 4K6DA 1SE8A 5C4JH 3CCEA 4LF4Q 3GD7A 3S15H 3I4LA 4ZUIA 1PTOD 5CORA 3MEHA 4C3JG 2JP1A 3MXUA 4BY7H 4A3KG 4NXNL 2WKCA 2F0TA 3B6YA 1WTQA 4NXNQ 4LJZC 1EWIA 3S1QH 1I4RA 1HQRD 3O13A 4EVOA 3RLOA 4AYBE 4LF9L 1QNUA 1IYVA 1LACA 1LT4D 1Q8IA 3OIQA 4QIWE 4C3JB 4QJFA 5M3MB 5AFWA 3CU7A 5CBEE 1SYCA 1MD2D 3QG1A 1O7LA 3J80c 3GV3A 5D3IB 2NVQH 3K0YA 3SK4A 3CKIB 3UDGA 1Y1VH 2JEBI 1S5ED 4EQ5A 3I70A 3T4AC 4JI4Q 1PFMA 2JA7H 1YNJC 4R9WA 4BY1H 2BH8A 5IGEA 1SMYC 1E2ZA 4UHVA 1ILQA 4L63B 4YY3L 1HNXL 5LL6S 4DV2L 1STGA 4IUTA 1DXMA 3A55A 3H0GG 4HEDA 3OYYA 2KCNA 4AQYL 2F4VL 2GN5A 3NTIA 1IBLQ 1UEBA 2OWOA 1H95A 4L6TB 1ESRA 5GROA 1STNA 4FVMA 4DV3Q 1HQMC 2EZVA 5FLXE 2B2VC 4K0KL 5K5PA 3S2DH 2QILA 1K73C 1U0LA 4JI2L 2EYMA 2UXDL 2R6GA 3RR5A 5C4HA 3SE0A 3SK5A 1XPRA 5JJLA 4N9PA 3SGIA 5A2QL 2F0GA 1K28A 4R8IA 3HOXG 1TWAH 4A3IH 3J7YW 2A68C 1U9RA 2EE1A 4X62Q 5F2DA 2K01A 4CKBA 3NK9A 4KD3A 1EIYB 2QDLA 4WJ4A 1FJGL 4X3UA 3ERQA 1PH4A 1H9SA 1GUNA 1RCVD 2J4XA 3S24A 2VQFQ 1K83B 2JA7G 3TRZA 2Q2TA 5EJWA 4A3BH 1OXXK 4DR4L 4H0LC 3OTOL 1F2ZA 1I4HA 4LW1A 3PO3H 1GUOA 1VF5C 4CKCA 4IPGA 3EFXD 1RIPA 2RF4A 2MNAA 3TS0A 3TDQA 5EKLA 2UXDQ 1T5EA 3TMEA 1XNRQ 3K7UC 1V9PA 1X3QA 1P16A 5BN4A 4BXXG 1QNKA 3C1FA 5JEAJ 1X3EA 2K5QA 2K75A 1NR4A 3HRZC 4XQQA 1YNJD 4AIMA 4B9XA 4DUZL 4B3TL 4NW2A 2F4VQ 4PNYA 2ZT9C 4DV5Q 1Y1VB 1ILPA 3UDXA 4DV2Q 2HT1A 2DNEA 4HCEA 1VQOA 5IWAL 2VB3X 4A3MB 1PA6A 1I4GA 1JC7A 3J80L 1R4PB 3Q23A 2G9DA 2ID0A 3VA7A 3L7ZC 3HOWH 3ND9A 5IGBA 1FNVA 2O2LD 2RSNA 2B2TA 3HOUH 4QGUA 1A62A 1TWHB 3AMUA 1LTGD 4A3JB 5I9PA 1CKOA 1VQBA 2J0TD 2EXDA 2RQXA 4A3MG 4BBSG 4DAVA 3V05A 2FHTA 3NHHA 2PZTA 4I7ZC 1KD1C 1LTSD 2MO0A 4EX5A 3D6CA 4G57A 3I91A 3R2IA 1G51A 2B2UC 3RMHA 4EQPA 1TWFH 5C3XA 3CCJA 1U5KA 4OELB 1B7YB 4K8IA 4DV6Q 3ICEA 2FMCA 3VR5A 1N36L 1TU2B 2NUCA 4LAAA 1KQSA 4N9TA 2NVYB 1GHKA 2BCOA 2WACA 2Z4IA 2F0SA 3KF8A 2EIFA 2NZHA 2I46A 3BYTB 1XMQL 1TWAB 4A3IB 3DM3A 2NN6I 1GUWA 5IODA 1A15A 4IUQA 3ERSX 1VQEA 4G4KA 2NVYH 3KF6B 2D9UA 1XNRL 1X9NA 4DUYL 1H9RA 5LMUL 4HIOA 3PUYA 4PZ7A 3KJPA 2PI2E 1VQCA 1JB3A 4DGZA 2O4XA 2D5DA 2NVXB 1N9WA 1PV4A 3G48A 5I4DA 1TWGB 3J7A5 3HOXH 3W5OA 3KDFA 1QOHA 4NXMQ 4DR6L 2XGTA 1PVOA 1ESFA 3Q0AA 4C2MH 1HR0L 1UE5A 4KN7C 2EYHA 4C2MB 3Q24A 3CC4A 3RUZA 3TZDA 3R3OA 3EBEA 3KLSA 3QOJA 3I90A 5KYLA 5I6WA 2N3SA 3NE5B 1SYEA 3LX0A 1A6XA 2K14A 2SEBD 2ALYB 4OIJA 5HY6A 3KLWA 4C3IH 2GVAA 1WI5A 1KRSA 2Z8LA 1YJ9A 3NBIA 2L0CA 4L5SA 1JORA 4OWTB 1S5DD 4LF9Q 4CDDC 3CCSA 4KKUA 1SDFA 1LTRD 3J80E 4DV4Q 1ML0D 2HHHL 1CUKA 3S1MH 5JEAG 2R92B 1SNQA 3NSWA 2OXPA 4NP5A 3GO5A 2IL8A 3RD4A 1S4ZA 1HPCA 4YCUA 2HUGA 1JMCA 2R92H 2MP1A 4JBWA 2OEOA 2IX0A 2WV6D 3RZDB 1D2BA 1PFSA 1IYJB 4U68A 2VNUD 4HJ8A 4YY3Q 1AW7A 4M8AA 1HNXQ 1B3QA 4JOIC 1G2TA 1EYDA 1HNZL 2RHSB 1EUJA 1SNPA 5KIXA 1XWEA 4IUVA 4PMCA 4LFBQ 4MIUA 1SFOH 4FXKC 3H15A 4F7XA 4JI5Q 1SMYD 2K52A 1QZGA 3K6OA 1UE1A 1L2FA 1EFID 3VR2A 4X66Q 4LFBL 4ZYSA 1SE4A 4A3KH 4KHZA 1CK1A 4HJ5A 1EU3A 1CM9A 2HDLA 2Z4HA 4DXGA 2SNSA 1BO0A 1MJEA 1K8GA 4DV1L 2HDMA 1K0RA 4N8X1 4ODGA 3R8BA 2R7FA 2I07B 4DV5L 2VQFL 4ZCKA 1NMGA 1PRTD 4DR1Q 1D7QA 3I2ZA 4K8JA 4A3FH 3EQLC 4X62L 2A6HD 1VQDA 4O2DA 4QL5A 1RHPA 1AH9A 2UU9Q 3X3MA 3CW2C 3TP5A 1I5FA 1ET9A 2PNRC 3T51B 3S17H 4ZK9B 3D8GA 4Y7NH 2IY5B 4LF6L 5FLXL 2MO1A 2B63B 4OO1I 4KTAA 4DNIA 1DOMA 1Y1WH 1CQVA 1XMOL 2PW5A 4B3MQ 3OTOQ 2H5XA 3GTKB 5M3FB 2R7ZB 2JYOA 1WCMG 3FPPA 3UE0A 2JA9A 1MBYA 4TVAB 3D0FA 4NPSA 2B2WC 2Q2HA 4TRDA 3STBC 1CA5A 5M3MH 5DM63 4OO1G 3J81L 2AQ2B 4ULLA 5EPJA 5C3EB 4ZUJA 4GNXB 4C3JH 1K9MC 1J8IA 4YIJA 4XQNA 5BN5A 1WD0A 1NNXA 2OQ0A 3NTKA 4H02A 3M3YH 1D5XC 4PMBA 5IYCG 5C3EH 2JSOA 4HIDA 1KDAA 3T1HQ 2L11A 4JG2A 4OWWB 1GM5A 3TS2A 1G8ZD 3P20A 2E2HH 3FDTA 2KCCA 2AUJD 1LTID 2B39A 2Y0SE 5C3EG 4KHPQ 5EPKA 2KJXA 1I3QH 3PO2H 4IPDA 4DPGA 4A3KB 3BZDB 5DM73 2KHJA 4C1NI 1R4QB 4LF5Q 3S2HH 1EU4A 5GADC 1PRTC 4KN4C 1U4LA 3NPPA 2SOBA 3DEOA 1HA6A 1JWUD 4YWKA 3MTSA 3BVZA 2JA8G 4R4IA 4JBKA 4HTHA 2I0QA 3JAME 2BA1A 3FKIG 1B50A 2EJMA 1WJJA 4A93G 1I6HH 4KHPL 5HGTA 3TSSA 1EIFA 3E0JA 4XDXA 4DK6C 2K5WA 1WTPA 1ZEQX 1PZJD 5EBDA 4CBVA 4NXML 2JA8B 2EXZA 5IYDG 1P8LA 1X3PA 1STYA 2XWJB 1K8AC 4HN7A 1VQ7A 4PG3A 1WYDA 3OOCA 3Q8DA 4O42A 2NWGA 1GD7A 3OW7A 5FJ8H 3OSOA 2MQHA 2XRQD 4UPAA 4JW0A 1KAWA 4B9WA 3IFDA 1V1OA 3CQZH 1PLFA 2RDFA 1SYGA 3DXJC 3TN2A 3HOZH 2ZXOA 4UY8C 3U4VA 3GTJB 3PV0A 3PSIA 2WINB 3K7AB 5CV8A 1Y1WB 2F0OA 4LFCL 1CKNA 1DJRD 5FJ8G 1GJXA 1PH5A 3HOXB 4IUUA 3PF4A 4GLXA 1PXUA 4JI0L 3RN5A 4GLVB 3NENA 5AJ3L 3K7AH 2B29A 3RN2A 1VQ4A 4ZAIA 1KXLA 2JA7B 2CVRA 1HR0W 3HFZB 1E2VA 4GOPC 1X32A 1LTAD 2JE6I 3GDEA 1CKNB 1PHJA 2HHHQ 3PO2G 1MGSA 1I6VC 2AMCB 4LF4L 2QEXA 2UUCQ 3SK6A 1DCZA 3I3CA 3A8KE 1EIHA 2N8NA 4LF7L 1NCVA 3CCLA 3S1RH 1CZWA 4HR7B 3QR8A 3AU7A 2V1CC 1Y8NB 1C4QA 1TQOA 3GTQB 3FMCA 5FKAC 1DGSA 3NBHA 2OCEA 4DR1L 4ME3A 2CQAA 2KENA 4OO1H 1SYDA 4X65L 1LTLA 3CPFA 4B08A 1PYWD 2MUYA 4KMUC 3KFUA 5E4XA 5LHY1 4X64Q 2R93B 3IFTA 1NTGA 4RWSC 3M7GA 3BG3A 4DR7L 2F0UA 1Q1BA 4GN4B 1WTRA 3MHBA 3S9WA 1GUSA 3TQYA 4MNOA 2FINB 1A3UA 3VR6A 1ZYRC 1WCMH 2XVSA 3MAQA 1PFBA 2EYPA 3LNNA 1Q86C 4LFAL 2E5LQ 1DZ1A 1HR0Q 4DF7A 2P5ZX 2F3VA 1K3RA 1OO9B 1N36Q 1NJIC 2CW0D 1Y8OB 2A74C 2E8GA 1PFNA 1UUPA 1TIID 1N32Q 1DONA 2RDHA 5CMDA 4DNRB 1MSGA 2VB2X 3HZXA 3A0JA 4K2LA 1D5ZC 5K36G 2F0MA 3CRKC 2EY5A 2TSSA 1Q3LA 1BNZA 1E2WA 2EOTA 4DAMA 1X54A 2WP8J 3SVMA 3K5LA 2L55A 3WWVA 3BS1A 2A6ED 3K0XA 4KKTA 3DHQA 2F3WA 1XNQQ 3M3YB 2BH2A 1B2TA 2Y0SG 1WTXA 3JAMc 4K2KA 2TMPA 3HOWB 4FO2A 1ET6A 1NY4A 4P74A 4ZKBB 4IJLA 1NSNS 3AQQA 1NR2A 3S1MB 3LWEA 5KEEA 2D62A 2F0LA 2NVQB 3Q22A 4GN5A 1G91A 3X3NA 4X3SA 4JI7Q 3PGZA 1TWHH 3KYHC 3DEPA 4ID6A 2F0QA 1C9OA 4DK3C 2X6LA 3E9HA 4DR5Q 3J81c 1J5EQ 3S16B 1LM0A 5CYUA 4IUPA 4RA8A 3F1ZA 4KD4A 5COYA 4XQJA 3CCVA 3KOJA 2L9HA 1N8RC 2F3IA 4A3BG 4R8NA 1CA6A 2HIXA 5L37A 4B3ML 1HZ9A 2N78A 3L0OA 2XWBB 5IYBG 1A0IA 5I9OA 5M5XB 4LUOA 1C7YA 5IY0A 2X6GA 3M85A 3EIVA 1K0SA 5NUCA 2KHSA 2WKDA 4LNQA 1YNND 2F0EA 3KJOA 4DV7Q 4A3LH 2A69D 4A3BB 4J1MA 5IYBH 4RFBA 4K5WA 4RHRA 5IT9L 3NQIA 2LMCB 2IW3A 2QW7A 2BE5D 4X66L 5C4XB 5FK9C 2B2YC 3V2TA 1PH8A 3I4NH 4DV7L 4LF7Q 1Z47A 5I2YA 2BOSA 4O0AA 2AKWB 2Q2IA 1EWHA 1DM0B 1NAPA 1S5CD 2JA5B 1EY4A 4GS3A 4HSPA 1CFMA 2WB1G 1PMRA 4HMIA 5ELCA 2CH4W 3E9IA 3FPUB 4UAIA 3HOVH 2YTVA 2JA6B 4AQYQ 1I94L 1JE4A 4RG1A 1EY7A 5DAUA 3HOYG 2A5HA 3H91A 3GV6A 3S15B 1K8OA 1VQHA 2H1EA 2NN6H 2WB1B 1J9OA 4JI4L 3GTJH 2NVTB 1BKBA 2J7ZA 1NBWA 3PMFA 1YZ6A 1YHQA 1RDPD 2EVBA 3JC66 2FMMA 1TWCB 2IPKD 2O5JC 1EEFD 5I6YA 5J39A 3GTPB 3DLLA 4A3MH 2M9VA 3NBHB 2FFKB 4DV3L 2K7VA 1EY8A 3Q6SA 4ILWA 3MXGA 2JK8A 3HOUB 1I4XA 3JAMi 2VL6A 4L5TA 1S3OA 2EDGA 3CC2A 4OX9Q 3T1YL 3J81E 3T13A 4JI3Q 2SDFA 3M4OB 5ELDA 3J7AF 1OTCA 3M4PA 4DNTB 3QIAA 1HFGA 3HGBA 1I6HB 1JR0D 1E22A 1F2MA 5JJKA 2IWHA 4YCWA 1WVLA 3UDIA 2H4OA 3CMAA 1QE6A 4V0BA 2UXCQ 2KQ3A 4TQUS 1JCKB 2PCFB 2MHVA 2KEEA 3H6MA 4RHSA 1MI2A 3A74A 2CFMA 2WAQG 1K83H 1VQMA 2O5IC 5C6AA 4RCNA 4Y7NB 4IOCA 4XXEA 4YWMA 5C4JB 4DR6Q 3I4NB 1JOOA 1EOVA 4CKEA 2ATWA 5C4ZA 3T1YQ 2E2DC 5CC4A 3J81j 2JA8H 1J6QA 1DD2A 5CV5A 4AH6A 1QUQA 1VQJA 1VS0A 2A1AA 2A19A 2E2JH 3H3VI 2EY6A 4I7AA 3BU2A 1G6ZA 1O7IA 1H9SB 2L5TA 2K5NA 4L5QA 2EYOA 1IBML 1LTTD 4WFN3 1B44D 3F2BA 2KCTA 5JVG3 3H0GB 4P2CB 1RKNA 1PH7A 4G7ZC 1QJOA 2VW9A 3RNUA 3H09A 4OIKA 3KBXA 1TWCH 4G7OC 1TY2A 3IAYA 1JQYD 3OIPA 3VYRA 5HURA 3J7ZC 3N6RA 1HTLD 2MJ8A 3ULLA 4I65A 3PUWA 2E76C 4YWLA 1KTKA 5M5WH 1FNWA 3EVQA 1BF4A 1N34Q 1LT3D 2VZAA 1IW7D 4JI8L 1CQFA 4UP7A 1PH2A 2F4IA 5JAVA 1VF7A 5IP9H 3RZDH 4QUFA 2F0NA 2GA4B 2PYKA 5M9OA 5IWAQ 1KLUD 2ZJRA 3A5ZB 4PQXA 5D14A 2Q8IB 2CQOA 1IKLA 3S14H 5AJ3Q 2XNAC 2VS1A 2ZXPA 3OMCA 4X3KA 3J80i 4XTCS 4CJ1B 3K8AA 5GAHC 1Y1WG 2A6HC 1SYBA 3FKIH 1JJCB 4BBRB 3BVGA 2NYZD 2L1BA 5ELEA 1T9HA 2I5MX 3V96A 2KOLA 1SNCA 2C9OA 2KHIA 2OT2A 4DR5L 1J5EL 4FF4A 2AQ1B 4KLKA 1MIUA 1BBXC 1ENCA 1IYUA 3ULJA 4J15A 1PZID 5KNDA 2RSOA 4TKOB 3CCQA 3D31A 1X3GA 1SMXA 1CZGA 5J1ZA 1BCPD 4Q0FA 2DY7A 2PMZE 1JOQA 3U58A 4U673 1I94Q 2IX1A 4WORA 5CV7A 4EGVA 2Z6KA 1S5BD 1IBLL 1OXUA 1PRTB 2L15A 2JQOA 2F0JA 2F0DA 1UEAB 4RMFA 3VYSA 1BR9A 1MHWC 3A54A 1M90C 4JI2Q 1YVCA 2YV5A 2M00A 1IBMQ 3HEJA 4Q5VA 1HTPA 4C3IB 1AP0A 3MFYA 3CAMA 1AFPA 1CTMA 1K3BC 2ZM6L 3SXHA 1KAAA 2R7ZH 2QEJC 4P75A 1IKMA 3K81C 1GOZA 1EYGA 4KY7A 3CP0A 1D8LA 1UWVA 1TR5A 4JCVE 4DR2Q 1Y69U 1O80A 1Q7YC 3U9OA 1EFWA 2E2HB 1FGUA 3URYA 1EZ8A 4PZ6A 1SN8A 5FLMH 2K5HA 1EY6A 4A3IG 1QUQB 1IZ6A 1G2SA 1HCZA 5C0XG 4PV1C 5M5YB 4IQZA 1EQVA 1XX8A 3PO3G 3S14B 1E0BA 2OQKA 3HKSA 1KHIA 1NMFA 2B8GA 5ELFA 3L3OC 2QF7A 2Z6BA 2DGYA 3I55A 4DV0Q 4HJAA 1WTVA 3GTMB 4ZRZA 1SNMA 3BJUA 2B2TC 1PTOF 1N32L 1ZYRD 1ICFB 3AFQA 4HCSA 2E75C 2MPMA 3OMGA 4CDEC 2EJGC 3H3VH 3OWFA 1QB5D 5EKIA 2NB0A 3H94A 3HKZB 3ITPA 1PDQA 4GNXA 4BA2I 1TWFB 3MWYW 1RD9D 5IYDH 2LS01 1HUMA 4HIKA 4KY5A 3CPWA 3GTGB 2DNCA 2UU9L 3KUPA 4G7HC 4XIGS 2RBMA 3E6ZX 2K50A 1F9SA 1LT6D 3K58A 1VQNA 4ZQ3A 3A7LA 4IALA 5E7NA 2JA5H 2DUDA 2AQ3B 3A7AB 2B63H 2K6AA 3R2TA 1BUVT 3W1BA 3PIO3 2E2IH 1I50H 1TKWB 2N55A 2G5DA 4FXDA 2PZWA 3HOYH 1TS5A 1JT8A 1IXRA 3WDNA 2E2JB 1N33Q 3FP9A 1H9JA 4RGNA 3C2PA 1PRTF 5M3FH 3CCUA 1M1KC 4IUNA 3TREA 2M2LA 4DU9A 1S5FD 2RCFA 1SBBB 1W6KA 1CSQA 2IT1A 3HS0C 3M4QA 4OL7A 4BY7B 1BDOA 3U9SA 1V8QA 1M8AA 2NTSA 4DUZQ 3PIOA 3SDZA 1YEZA 3PUVA 1X65A 3KLRA 4RGTA 2A8VA 3H3VC 3HKZE 2KEDA 1LLRD 3E0EA 2JJQA 4XT3B 3S16H 3FEWX 4A3GH 1X56A 3M4OH 5ELNA 1EY5A 3CMEA 2F0IA 1QVCA 4C3HH 4BWGB 1A8VA 2B3GA 2PI2A 1I3QB 1OXSC 2KUMA 5FLXc 1PH6A 4P72A 3I7FA 4A3CH 3FKIB 4TSSA 4A93B 1V1PA 1QZHA 1QVGA 4UP8A 5EAYA 4RKLA 3PCOB 5EPLA 1EQRA 1H9MA 5J22A 2XTIA 1SLJA 1D6EC 4AYBB 3N52A 4RGOS 3IL8A 4QUCA 3NQTA 4IO9A 1ENAA 1GXDC 1AZPA 4E6IA 4OONA 1VQ6A 2Q8TA 2AWOA 3PIP3 5LMNL 4B3RL 4GOPB 1HZAA 1F9PA 5T1GA 1E1TA 2L4NA 3IKJA 1HZBA 4AYBG 5CV4A 2B2WA 4MTNA 1NE3A 1E7ZA 3EN2A 4DR2L 3QJYA 5H1SE 3HOUG 1LUZA 4XYQA 5JJZA 4C56C 3CQZB 4A3EH 3VDYA 1EQTA 2BE5C 2UUAQ 1Y14B 2D0OA 4JYAL 4CDFC 3D6WA 4A3DH 5JOBA 4CJ0B 4LF8L 3D3RA 2ZM6Q 1I50B 1FGBD 3S17B 5LMUQ 3KBGA 2WFWA 5T1IA 1H9KA 3KF6A 1WD1A 2WIIB 5G3LF 2QCPX 4N8FA 5C5LA 4A76A 1D1KA 2EYLA 1LO5D 2E2IB 1EIGA 3S1QB 2K33A 1VDZA 2ZJPA 1JE5A 4DUYQ 3NWSA 4DV6L 2R3ZA 1SJED 4FYDA 4B3SQ 2Q8RE 3SHLA 2F1MA 4K6LA 2HIVA 1EEID 3K5OA 2HCIA 2K5VA 5K36H 4LMQD 5CBAE 1SEBD 2DY8A 3D4DA 3PQIA 4QCLA 4OWXB 4A3JH 1BCPC 1OXVA 3F2CA 1IBKQ 4DAYB 2QA4A 4KK7A 4HJ7A 2CW0C 1GO3E 2EJFC 1QILA 2K5DA 5M3MG 5ELBA 4IFDJ 2ZXRA 2PZUA 1L1OA 4JV5Q 1SYFA 3I72A 5KNCA 2F52A 2A6EC 1PTOC 4YHHQ 1HZCA 4B3TQ 1VQ5A 2CWAA 1MSHA 5G3LD 2Z0SA 1BQQT 1FR3A 2XIWA 2HD3A 4R4OA 2R7DA 3ULPA 1WTOA 1OXTA 4IFDH 4H44C 5CV9A 2L12A 2ICIA 2I5HA 3CHBD 1CSPA 4O1NA 1DOKA 1L1OC 4BXXH 1S72A 1BCPB 3QB3A 1C48A 4JI5L 2XSCA 2MGSA 2ASBA 3T53B 3U4ZA 5JPMC 4JVZA 1I4QA 4MHEA 4JOIA 5EGTA 1ICWA 4KY6A 4WJWA 4C1NK 1SSOA 2Q2UA 1TY0A 1PH9A 2KECA 3W3AA 1HH2P 4CHTB 1SNDA 4A3EB 4DFAA 4A3JG 5C0XI 3AYHB 4LUZA 1CKMA 1FJGQ 4XYOA 1W6JA 1YIJA 2LY7A 3NXWA 1ASZA 4BBSB 1KABA 3F8TA 1EQQA 4P73A 1V43A 4POFA 2VXWA 1HNWL 3QO2A 3TP8A 2FXQA 2RDGA 4BS9A 5C5MA 3M7NA 1F2LA 4OEMB 2QKIC 4A3DB 2Y0SB 2YU9B 3I73A 3HOWG 1KRTA 3UE1A 4K5XA 2F0WA 1U4PA 2PMZB 1SAPA 4F8MA 3SEBA 2K03A 1SE2A 5GQOA 2EY2A 4JBMA 3I4MH 2C5CA 1TS4A 2ES2A 4A3DG 2ICEC 1N33L 5IGCA 4GKJQ 2N49A 4LWCA 1F9RA 3CRLC 4HSVA 2K04A 4IN3A 4LFAQ 5FO7B 5FOBB 4A3GB 2HCCA 3F2UA 2C35B 5HGQA 2UXBL 1YJNA 5KRUA 1WTWA 1VQLA 3I4OA 3A8IE 2CCZA 3MZ5A 2VY3A 3R93A 1KIXA 1Q90A 1IHZA 2CWPA 2RHQB 1B70B 5GAGC 4A3LG 5EBCA 1LT5D 1HFNA 1Q1EA 2X69A 4QB4A 3GTLH 4JI8Q 4K14A 4DR7Q 2OTJA 4LF8Q 1G6PA 2K4KA 3MC0B 4RAUC 1GKHA 1B4OA 1C0AA 1VQPA 2KBNA 1XMQQ 1PYBA 3DM1A 3GTLB 5DLQE 5JEAH 4A93H 2KA7A 3KLSX 3NWTA 3I56A 1L0XB 1YNNC 4R1JA 5C4XG 3P7JA 3GP7A 2R93H 3BDCA 5A35A 2ENBA 2KVMA 5KYIA 1FD7D 1AE3A 5IYCH 1Y8PB 4RH6A 2LSSA 4ZLTF
chains in the Genus database with same CATH topology
4J8QA 2HQEA 1RODA 4OGQC 2B2VA 3PO3B 5D65A 1QCBD 3HOYB 1HA5A 3TP6A 2IJ0A 5IIFA 2VUMB 5KGUA 3JAML 1O7ZA 3SR1A 4QF4A 3PUXA 4H13C 5TSSA 3D4WA 3RLFA 3C1EA 4OHJA 2RKSA 3T16A 2BDOA 3WOEA 1KDCA 3ND8A 3G6JB 3VA5A 1VMCA 2LFNA 3QOLA 3UI2A 2F03A 4HAEA 4QMGA 3HG9A 4KJNA 2K28A 4F88A 1SXTA 1HHVA 5IGGA 4X3TA 4NKLA 2BA0A 4DN4M 2R61A 1U4MA 2NN6G 1D1IA 1STEA 5CR3A 2WAQB 3DMUA 1NUCA 2F0VA 1F2YA 5IGDA 5EQ0A 2G9HD 4ME5A 3NTHA 3FRPB 1DOLA 2B2YA 2A68D 1AEXA 1G291 1F9QA 1RTOA 1SE3A 1SNOA 3S1NB 1U4RA 4KI0A 1A3TA 3MVVA 4IURA 3HP3A 1LABA 2D2CC 3RZOB 1A3VA 5JVH3 1UAPA 2A73B 5KNBA 2OF1A 5E1FA 1TT2A 3EROA 1R9TB 3MFGA 3LWUA 2RA4A 1CI3M 3HOZB 1TS2A 2AUKA 3L9AX 1ZXTA 4JK1C 3I4MB 4NDXA 1AZQA 2PO4A 4FNFA 1O7YA 5IGFA 3A8JE 5BN3A 2B8FA 2JEAI 1ZKOA 2NZ1D 1EYAA 5C0XJ 2XN9C 5E4WC 1AN8A 3WOFA 3VYUA 4GZYC 2JXMB 4C3HB 4BY1B 4KV6A 3VYTA 2EYJA 4FP5D 3PUZA 1CHPD 2PQEA 1SFOB 5M5WB 1GUGA 3TZUA 4RKBA 1STAA 1GUTA 4C3HG 4PMWA 2BDNA 3W2DA 4DAPA 5EKKA 1II3A 3DWQA 5C3WA 1TS3A 1VMPA 5DEHA 3OPOA 1EY0A 3D4RA 3P1HA 3A56A 4S3SA 1EY9A 4F87A 5FO8B 1B53A 3K5MA 1STHA 2F0FA 3ONAB 3EJIA 4ABNA 1RTNA 3DUZA 3BDLA 2B2UA 1QG7A 1A2UA 4K5VA 3J7AV 4EQNA 1HUNA 1GHJA 4KKSA 4CJ2C 5LL6X 3K57A 1I4PA 1D5MC 3G7LA 4DK1A 2DN8A 4FF2A 3NUCA 4RCOA 1Q12A 4IZ8A 2SNMA 4ZKCB 2PPBC 3HOVB 1Z7TA 2AWNA 1F77A 1XTCD 1LTBD 3SK8A 1B3AA 4H7BA 1KDBA 1KNEA 5IT9E 3OWEB 1STBA 5CV6A 4XT1B 2A69C 3I8ZA 4MN3A 3DWAA 3K5NA 3C3LA 3MXNA 1FYCA 3FVQA 3MXPA 2XRSD 2N88A 4RGMA 3AB9A 5ISRA 1K8MA 4Z9CB 1PTOB 2F0KA 5FO9B 4QIWB 1ONLA 2RVLA 3S1RB 3PO2B 3MA2B 5I2XA 1B1ZA 1CHQD 1RF2D 3E5SA 4DAYA 3TP7A 3OHXC 2NTTA 1IW7C 3VR4A 4C3IG 1M4VA 3ZYYX 4CGYB 4LK1C 2QDBA 3P75A 4IFDG 3S2DB 1IL8A 2EYFA 5IOCA 1A2TA 2EPBA 4BA1I 4FF3A 5JPNC 4KHVA 4J6HA 2K32A 2E74C 3GQBA 3KK7A 4WRDA 1V1PB 2LKVA 3C46A 3DWPA 1PZKD 5DNFA 1JWMD 2NBFA 1RJTA 1TVXA 1JICA 3T56B 1SJHD 4EQOA 1ENFA 2K05A 1O78A 5CGKA 3BVMA 1T5XD 3EA6A 1JOKA 1FNUA 3M4YA 1VCIA 1EOTA 1BCPF 1BXTA 4L8JA 1EZ6A 5E3FA 1UNSA 4FF1A 4M1UB 3BDOA 1QWYA 1JWSD 3TBIB 2IX3A 3K59A 5D3DA 1XXGA 5C44B 2V4DA 1PTOH 1BOSA 3S2HB 4FXGC 3GTOB 1CT1D 1B9NA 1L0YB 1DYQA 1Z6HA 1B9MA 4DXFA 1C8CA 2EY1A 5C0XH 1EL0A 1EWCA 4IFDI 2CHBD 4HMJA 3NP8A 1KLGD 4A3FB 4V190 2Z1CA 1WCMB 1EYCA 2K1BA 2F0HA 1KNAA 5A2QE 3VR3A 2PW7A 2YYZA 3QWNA 2FJ2A 4NMZA 1LV9A 1XYIA 3BYYB 4KJOA 4DA2A 4UDUC 1HXYD 4DK0A 2F0PA 1HRJA 4K6DA 3GD7A 3I4LA 4ZUIA 1PTOD 5CORA 3MEHA 4C3JG 2JP1A 3MXUA 2WKCA 2F0TA 1WTQA 4LJZC 1I4RA 1HQRD 3O13A 4EVOA 1IYVA 1QNUA 1LACA 1LT4D 1Q8IA 3OIQA 4C3JB 5M3MB 5AFWA 3CU7A 5CBEE 1SYCA 1MD2D 3QG1A 1O7LA 3GV3A 5D3IB 3K0YA 3SK4A 3CKIB 2JEBI 1S5ED 3I70A 3T4AC 1PFMA 1YNJC 4R9WA 5IGEA 1SMYC 1E2ZA 1ILQA 4L63B 5LL6S 1STGA 4IUTA 1DXMA 3A55A 4HEDA 2KCNA 3NTIA 4L6TB 1ESRA 1STNA 4FVMA 1HQMC 2EZVA 5FLXE 2B2VC 5K5PA 2QILA 2EYMA 2R6GA 5C4HA 3SE0A 3SK5A 4N9PA 5A2QL 2F0GA 4R8IA 3J7YW 2A68C 1U9RA 2EE1A 5F2DA 2K01A 4CKBA 3NK9A 4KD3A 4X3UA 3ERQA 1H9SA 1GUNA 1RCVD 2J4XA 1K83B 5EJWA 1OXXK 4H0LC 1F2ZA 1I4HA 1GUOA 1VF5C 4CKCA 3EFXD 3TDQA 5EKLA 1T5EA 3TMEA 1X3QA 5BN4A 1QNKA 3C1FA 5JEAJ 4XQQA 2K5QA 1NR4A 3HRZC 4B9XA 1YNJD 4NW2A 4PNYA 2ZT9C 1Y1VB 1ILPA 2DNEA 4HCEA 2VB3X 4A3MB 1I4GA 1JC7A 3J80L 1R4PB 3Q23A 2G9DA 2ID0A 3VA7A 3L7ZC 3ND9A 5IGBA 1FNVA 2O2LD 2RSNA 2B2TA 1TWHB 3AMUA 1LTGD 4A3JB 5I9PA 2J0TD 2RQXA 4DAVA 3V05A 2FHTA 3NHHA 2PZTA 4I7ZC 1LTSD 3D6CA 4G57A 3I91A 3R2IA 2B2UC 3RMHA 4EQPA 5C3XA 4K8IA 2FMCA 3VR5A 1TU2B 2NUCA 4LAAA 4N9TA 2NVYB 1GHKA 2BCOA 2WACA 2Z4IA 2F0SA 3KF8A 3BYTB 2I46A 1TWAB 4A3IB 2NN6I 1GUWA 5IODA 1A15A 4IUQA 4G4KA 2D9UA 1H9RA 3PUYA 1JB3A 4DGZA 2O4XA 2D5DA 2NVXB 5I4DA 1TWGB 1QOHA 1ESFA 3Q0AA 4KN7C 2EYHA 4C2MB 3Q24A 3RUZA 3TZDA 3R3OA 3KLSA 3QOJA 3I90A 5KYLA 5I6WA 3NE5B 1SYEA 3LX0A 1A6XA 2SEBD 4OIJA 2Z8LA 3NBIA 2L0CA 1JORA 1S5DD 4KKUA 1SDFA 1LTRD 3J80E 1ML0D 5JEAG 2R92B 1SNQA 3NSWA 2OXPA 4NP5A 3GO5A 3RD4A 2IL8A 1S4ZA 1HPCA 2HUGA 2MP1A 4JBWA 2OEOA 2IX0A 2WV6D 3RZDB 1D2BA 2VNUD 4U68A 1AW7A 4M8AA 1G2TA 1EYDA 1SNPA 5KIXA 1XWEA 4IUVA 4PMCA 4MIUA 4FXKC 4F7XA 1SMYD 3K6OA 1EFID 3VR2A 4ZYSA 1SE4A 4KHZA 1CK1A 1EU3A 1CM9A 2HDLA 2Z4HA 4DXGA 2SNSA 1BO0A 2HDMA 4ODGA 3R8BA 2I07B 1PRTD 4K8JA 3EQLC 2A6HD 1RHPA 3X3MA 3TP5A 1ET9A 2PNRC 3T51B 4ZK9B 3D8GA 5FLXL 2B63B 4OO1I 4KTAA 1DOMA 1CQVA 2PW5A 3GTKB 5M3FB 2R7ZB 2JYOA 3FPPA 1MBYA 2B2WC 4TRDA 1CA5A 5DM63 4OO1G 3J81L 2AQ2B 4ULLA 5EPJA 5C3EB 4ZUJA 1J8IA 4YIJA 4XQNA 5BN5A 1WD0A 3NTKA 1D5XC 4PMBA 2JSOA 1KDAA 2L11A 1G8ZD 3P20A 2KCCA 2AUJD 3FDTA 1LTID 2B39A 5EPKA 2KJXA 4A3KB 3BZDB 5DM73 4C1NI 1R4QB 1EU4A 1PRTC 4KN4C 1U4LA 3NPPA 2SOBA 3DEOA 1HA6A 1JWUD 3MTSA 3BVZA 4HTHA 3JAME 2BA1A 1B50A 2EJMA 5HGTA 3TSSA 3E0JA 4XDXA 2K5WA 1WTPA 1ZEQX 1PZJD 5EBDA 4CBVA 2JA8B 2EXZA 1X3PA 1STYA 2XWJB 4HN7A 3OOCA 4O42A 2NWGA 3OW7A 3OSOA 2XRQD 4B9WA 3IFDA 1V1OA 1PLFA 2RDFA 1SYGA 3DXJC 3TN2A 2ZXOA 3GTJB 3PV0A 2WINB 3K7AB 5CV8A 1Y1WB 2F0OA 1DJRD 1GJXA 3HOXB 4IUUA 1PXUA 4ZAIA 2JA7B 2CVRA 1E2VA 1X32A 1LTAD 2JE6I 1MGSA 1I6VC 3SK6A 1DCZA 3I3CA 3A8KE 1EIHA 1NCVA 1CZWA 4HR7B 3AU7A 1Y8NB 1C4QA 1TQOA 3GTQB 3FMCA 5FKAC 3NBHA 2CQAA 4OO1H 1SYDA 4B08A 1PYWD 2MUYA 4KMUC 5E4XA 5LHY1 2R93B 3IFTA 4RWSC 3M7GA 3BG3A 2F0UA 1Q1BA 1WTRA 3MHBA 3S9WA 1GUSA 2FINB 1A3UA 3VR6A 1ZYRC 2XVSA 3MAQA 1PFBA 2EYPA 3LNNA 1DZ1A 4DF7A 2F3VA 1OO9B 2CW0D 1Y8OB 2A74C 1PFNA 1UUPA 1TIID 1DONA 2RDHA 5CMDA 4DNRB 1MSGA 2VB2X 3HZXA 4K2LA 1D5ZC 5K36G 2F0MA 3CRKC 2EY5A 2TSSA 1Q3LA 1BNZA 1E2WA 2EOTA 2WP8J 3SVMA 3K5LA 2L55A 3BS1A 2A6ED 4KKTA 3DHQA 2F3WA 3M3YB 1B2TA 1WTXA 4K2KA 2TMPA 3HOWB 4FO2A 1ET6A 4ZKBB 1NSNS 1NR2A 3S1MB 3LWEA 5KEEA 2D62A 2F0LA 2NVQB 3Q22A 1G91A 3X3NA 4X3SA 3DEPA 4ID6A 2F0QA 2X6LA 3S16B 5CYUA 4IUPA 4RA8A 4KD4A 5COYA 4XQJA 2L9HA 4R8NA 1CA6A 2XWBB 5I9OA 5M5XB 2X6GA 3M85A 5NUCA 2KHSA 2WKDA 1YNND 2F0EA 2A69D 4A3BB 4J1MA 4RFBA 4K5WA 4RHRA 5IT9L 3NQIA 2LMCB 2IW3A 2BE5D 5C4XB 5FK9C 2B2YC 3V2TA 1Z47A 5I2YA 2BOSA 1EWHA 1DM0B 1NAPA 1S5CD 2JA5B 1EY4A 4HSPA 1CFMA 1PMRA 4HMIA 5ELCA 3FPUB 4UAIA 2JA6B 1JE4A 1EY7A 5DAUA 2A5HA 3H91A 3GV6A 3S15B 1K8OA 2H1EA 2NN6H 2WB1B 1J9OA 2NVTB 2J7ZA 3PMFA 1RDPD 2EVBA 2FMMA 1TWCB 2IPKD 2O5JC 1EEFD 5I6YA 3GTPB 5J39A 2M9VA 2FFKB 2K7VA 1EY8A 3Q6SA 4ILWA 3MXGA 3HOUB 1I4XA 2EDGA 3J81E 3T13A 2SDFA 3M4OB 5ELDA 3J7AF 4DNTB 3QIAA 1HFGA 3HGBA 1I6HB 1JR0D 1F2MA 2IWHA 1WVLA 2H4OA 1QE6A 4V0BA 2KQ3A 4TQUS 1JCKB 2PCFB 2MHVA 2KEEA 3H6MA 4RHSA 1MI2A 2O5IC 5C6AA 4RCNA 4Y7NB 4XXEA 5C4JB 3I4NB 1JOOA 4CKEA 5C4ZA 2E2DC 5CC4A 1DD2A 5CV5A 2EY6A 1G6ZA 1H9SB 2L5TA 2EYOA 1LTTD 4WFN3 1B44D 5JVG3 3H0GB 4P2CB 1RKNA 4G7ZC 1QJOA 3H09A 4OIKA 3KBXA 4G7OC 1TY2A 3IAYA 1JQYD 3OIPA 3VYRA 5HURA 3N6RA 1HTLD 2MJ8A 4I65A 3PUWA 2E76C 1KTKA 1FNWA 3EVQA 1BF4A 1LT3D 1IW7D 1CQFA 2F4IA 5JAVA 1VF7A 4QUFA 2F0NA 2GA4B 2PYKA 5M9OA 1KLUD 4PQXA 2Q8IB 5D14A 1IKLA 2XNAC 2ZXPA 3OMCA 4X3KA 4XTCS 4CJ1B 2A6HC 1SYBA 4BBRB 3BVGA 2NYZD 2L1BA 5ELEA 3V96A 2KOLA 1SNCA 2C9OA 2OT2A 4FF4A 2AQ1B 1BBXC 1ENCA 1IYUA 1PZID 5KNDA 2RSOA 4TKOB 3D31A 1CZGA 5J1ZA 1BCPD 4Q0FA 2DY7A 1JOQA 4U673 2IX1A 4WORA 5CV7A 4EGVA 1S5BD 1OXUA 1PRTB 2F0JA 2F0DA 1UEAB 3VYSA 1BR9A 3A54A 2M00A 3HEJA 4Q5VA 1HTPA 4C3IB 1AP0A 3MFYA 1AFPA 1CTMA 3SXHA 1KAAA 2QEJC 1IKMA 1GOZA 4KY7A 1TR5A 1Y69U 1O80A 3U9OA 2E2HB 3URYA 1EZ8A 1EY6A 1G2SA 1HCZA 5C0XG 4PV1C 5M5YB 4IQZA 1EQVA 1XX8A 3S14B 1E0BA 2B8GA 5ELFA 3L3OC 2QF7A 1WTVA 3GTMB 4ZRZA 1SNMA 2B2TC 1PTOF 1ZYRD 4HCSA 2E75C 2MPMA 3OMGA 2EJGC 3OWFA 1QB5D 5EKIA 2NB0A 3H94A 3HKZB 3ITPA 1PDQA 4BA2I 1TWFB 3MWYW 1RD9D 2LS01 1HUMA 3GTGB 4KY5A 2DNCA 3KUPA 4G7HC 4XIGS 2RBMA 3E6ZX 1F9SA 1LT6D 3K58A 4ZQ3A 3A7LA 4IALA 2AQ3B 3A7AB 2K6AA 3R2TA 1BUVT 3PIO3 1TKWB 2N55A 4FXDA 2PZWA 1TS5A 3WDNA 2E2JB 1H9JA 4RGNA 3C2PA 1PRTF 4IUNA 2M2LA 4DU9A 1S5FD 1SBBB 1W6KA 2IT1A 3HS0C 4OL7A 4BY7B 1BDOA 3U9SA 1V8QA 1M8AA 2NTSA 3SDZA 3PUVA 3KLRA 4RGTA 3H3VC 2KEDA 1LLRD 4XT3B 3FEWX 1EY5A 2F0IA 4BWGB 1I3QB 1OXSC 2KUMA 3FKIB 4TSSA 4A93B 1V1PA 4RKLA 5EPLA 1H9MA 5J22A 1D6EC 4AYBB 3N52A 4RGOS 3IL8A 4QUCA 3NQTA 1ENAA 1GXDC 1AZPA 4E6IA 2Q8TA 2AWOA 3PIP3 1F9PA 5T1GA 2L4NA 3IKJA 5CV4A 2B2WA 3QJYA 4XYQA 5JJZA 4C56C 3CQZB 1EQTA 2BE5C 3D6WA 5JOBA 4CJ0B 3D3RA 1I50B 1FGBD 3S17B 3KBGA 5T1IA 1H9KA 1WD1A 2WIIB 5G3LF 2QCPX 5C5LA 1D1KA 2EYLA 1LO5D 2E2IB 1EIGA 3S1QB 2K33A 1VDZA 3NWSA 2R3ZA 1SJED 4FYDA 2Q8RE 3SHLA 2F1MA 4K6LA 1EEID 3K5OA 2HCIA 5K36H 4LMQD 5CBAE 1SEBD 2DY8A 3D4DA 4QCLA 1BCPC 1OXVA 4KK7A 2CW0C 2EJFC 1QILA 2K5DA 4IFDJ 5ELBA 2ZXRA 2PZUA 1SYFA 3I72A 5KNCA 2A6EC 1PTOC 5G3LD 1MSHA 2XIWA 1BQQT 1FR3A 1WTOA 1OXTA 4IFDH 4H44C 5CV9A 2L12A 2ICIA 3CHBD 4O1NA 1DOKA 1BCPB 3QB3A 1C48A 2XSCA 2MGSA 3T53B 5JPMC 1I4QA 4MHEA 5EGTA 1ICWA 4KY6A 4WJWA 4C1NK 1SSOA 1TY0A 2KECA 3W3AA 4CHTB 1SNDA 4A3EB 4DFAA 5C0XI 4XYOA 1W6JA 2LY7A 3NXWA 4BBSB 1KABA 1V43A 2VXWA 3QO2A 3TP8A 2RDGA 4BS9A 5C5MA 3M7NA 1F2LA 2QKIC 4A3DB 2Y0SB 2YU9B 3I73A 4K5XA 2F0WA 1U4PA 2PMZB 1SAPA 4F8MA 3SEBA 2K03A 1SE2A 2EY2A 2C5CA 1TS4A 2ICEC 5IGCA 1F9RA 3CRLC 4HSVA 2K04A 4IN3A 5FO7B 5FOBB 4A3GB 2HCCA 3F2UA 5KRUA 1WTWA 3A8IE 3MZ5A 3R93A 1Q90A 1IHZA 5EBCA 1LT5D 1HFNA 1Q1EA 2X69A 4QB4A 4K14A 3MC0B 4RAUC 1B4OA 3DM1A 3GTLB 5JEAH 2KA7A 3KLSX 3NWTA 1L0XB 1YNNC 3P7JA 3GP7A 3BDCA 5A35A 2ENBA 2KVMA 5KYIA 1FD7D 1Y8PB 4RH6A 4ZLTF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O5I C;  4KI0 A;  4RCN A;  3VR6 A;  1ZYR C;  1H9S A;  1GUN A;  3EQL C;  4OGQ C;  4BA1 I;  1LAB A;  2A6H D;  4G7H C;  4XIG S;  2LMC B;  1OXX K;  3QJY A;  2BE5 D;  4H0L C;  2D2C C;  1H9R A;  3LNN A;  2K32 A;  2E74 C;  2BE5 C;  3PUY A;  3GQB A;  1GUO A;  1VF5 C;  5KNB A;  1DD2 A;  1GHJ A;  2PNR C;  3A7L A;  4KKS A;  1Y8O B;  3A7A B;  3OOC A;  3T51 B;  1OXU A;  4DK0 A;  1V43 A;  3OW7 A;  1EWH A;  2D5D A;  3LWU A;  4DNR B;  4DK1 A;  1CI3 M;  1CFM A;  2DN8 A;  3GD7 A;  1PMR A;  1H9S B;  2AUK A;  2L5T A;  1T5E A;  3I4L A;  1H9K A;  1TKW B;  5K36 G;  3M7N A;  3DXJ C;  1Q12 A;  3MXU A;  3CRK C;  1HTP A;  4JK1 C;  5BN4 A;  4KN7 C;  3PV0 A;  3PUX A;  3WDN A;  3I73 A;  3MFY A;  2PPB C;  4G7Z C;  1H9J A;  1E2W A;  1QJO A;  1CTM A;  4LJZ C;  1Z7T A;  3FPP A;  3T56 B;  1GJX A;  3A8J E;  4H13 C;  4G7O C;  3NE5 B;  3RLF A;  5BN3 A;  2ZT9 C;  2K33 A;  1K8O A;  2IT1 A;  1A6X A;  2B8F A;  2JEA I;  1O78 A;  1ZKO A;  1VDZ A;  2NN6 H;  1IYV A;  2A6E D;  2DNE A;  1BDO A;  4KKT A;  1LAC A;  3N6R A;  3U9S A;  4OO1 G;  1V8Q A;  4GZY C;  3SDZ A;  2JXM B;  3PUW A;  2BDO A;  1E2V A;  1VCI A;  3M4Y A;  4KKU A;  1Y69 U;  3PUV A;  2EVB A;  1O7L A;  3KLR A;  3QG1 A;  2E76 C;  2F1M A;  3ND8 A;  5JEA G;  2O5J C;  3CRL C;  2JE6 I;  4L8J A;  5BN5 A;  2A69 C;  5K36 H;  3VA7 A;  3L7Z C;  3ND9 A;  3PUZ A;  1HPC A;  3VR3 A;  1IW7 D;  2D62 A;  2JEB I;  2YYZ A;  3BDO A;  4JBW A;  1OXV A;  1I6V C;  3A8I E;  1HCZ A;  2K7V A;  1FYC A;  5C0X G;  1DCZ A;  1Q90 A;  4PV1 C;  1VF7 A;  4IQZ A;  1GUG A;  2V4D A;  3TZU A;  2CW0 C;  2EJF C;  1YNJ C;  3AB9 A;  3A8K E;  1K8M A;  1OXS C;  3P20 A;  1SMY C;  1E2Z A;  1GUT A;  1Q1E A;  2KCC A;  2AUJ D;  2B8G A;  1B9N A;  2Q8I B;  2EDG A;  4HR7 B;  1DXM A;  1Z6H A;  1B9M A;  4XTC S;  3I72 A;  2BA0 A;  2QF7 A;  5KNC A;  2A6E C;  1Y8N B;  2A6H C;  1ONL A;  4I7Z C;  2NN6 G;  3FMC A;  4DNT B;  5C0X H;  3QIA A;  1H9M A;  3HGB A;  1FR3 A;  1OXT A;  4IFD H;  1HQM C;  3OPO A;  4H44 C;  4KN4 C;  3VR2 A;  4OO1 H;  3D4R A;  1IW7 C;  2E75 C;  5JEA H;  4KMU C;  3VR4 A;  3VR5 A;  2EJG C;  2KA7 A;  4KHZ A;  1TU2 B;  1YNN C;  3IFT A;  4LK1 C;  3T53 B;  2R6G A;  3BG3 A;  2AWO A;  3SE0 A;  2BA1 A;  3H94 A;  4BA2 I;  2A68 D;  4TQU S;  1Q1B A;  2EJM A;  1GHK A;  2PCF B;  3M85 A;  5A35 A;  1IYU A;  2A68 C;  4IFD G;  1GUS A;  1G29 1;  5KND A;  4TKO B;  2DNC A;  3IKJ A;  3D31 A;  2NN6 I;  1Y8P B;  2A69 D;  3W3A A; 
#chains in the Genus database with same CATH topology
 4J8Q A;  3MXN B;  2HQE A;  1ROD A;  1XPO A;  4OGQ C;  4GKK Q;  2B2V A;  3PO3 B;  1PH3 A;  5IE8 A;  5D65 A;  2Z6K C;  1QCB D;  2PQA A;  1L1O B;  3HOY B;  1YBY A;  1SRO A;  4JI3 L;  1HA5 A;  3TP6 A;  1HNW Q;  2ZTE A;  1JB7 A;  2IJ0 A;  4APV A;  5IIF A;  2Z9H A;  2VQE Q;  2VUM B;  3T1H L;  1W3S A;  5KGU A;  3JAM L;  1O7Z A;  3SR1 A;  4QF4 A;  1LYL A;  3PUX A;  3H0G H;  3HKZ G;  4H13 C;  4IJH A;  5TSS A;  3D4W A;  3RLF A;  3GTP H;  3C1E A;  1IBK L;  4OHJ A;  2RKS A;  3T16 A;  1HNZ Q;  3G4S A;  1GVP A;  4A3F G;  1FVI A;  2BDO A;  2YTX A;  3WOE A;  4GNX C;  1KDC A;  4QY7 A;  1YIT A;  3ND8 A;  1W2B A;  4X64 L;  1YHA A;  3G6J B;  2UUB L;  3VA5 A;  1VMC A;  2LFN A;  1MJC A;  2IHE A;  3QOL A;  3UI2 A;  4X65 Q;  2F03 A;  4HAE A;  3L2P A;  4QMG A;  3HG9 A;  1E24 A;  1YI2 A;  1S40 A;  2B63 G;  3GTM H;  4BBR H;  4KJN A;  2K28 A;  4F88 A;  1SXT A;  1HHV A;  5IGG A;  4X3T A;  4NKL A;  2BA0 A;  4DN4 M;  2R61 A;  1U4M A;  2NN6 G;  4DV0 L;  1D1I A;  1STE A;  2JA5 G;  5CR3 A;  3UDF A;  2WAQ B;  3DMU A;  3OW2 A;  4K0K Q;  1NUC A;  2F0V A;  1F2Y A;  5IGD A;  3PF5 A;  5EQ0 A;  4GKK L;  1KL9 A;  2G9H D;  4ME5 A;  3NTH A;  3FRP B;  1DOL A;  2CH4 A;  4JV5 L;  2B2Y A;  4B3S L;  2A68 D;  4A75 A;  1Q82 C;  1AEX A;  1G29 1;  1F9Q A;  1RTO A;  1SE3 A;  1SNO A;  2NZO A;  3S1N B;  1U4R A;  1XJV A;  1Q8K A;  4JI0 Q;  4KI0 A;  1A3T A;  3HOZ G;  3MVV A;  4IUR A;  3HP3 A;  1LAB A;  4IOA A;  1KC8 C;  2D2C C;  3RZO B;  1A3V A;  5JVH 3;  1FL0 A;  1UAP A;  3I4M G;  3GTG H;  2A73 B;  5KNB A;  2OF1 A;  5E1F A;  3RZO H;  2JA6 H;  1ASY A;  1VQF A;  4JI6 L;  1TT2 A;  3GTK H;  4A3C G;  3ERO A;  1R9T B;  3CCM A;  3MFG A;  3LWU A;  2RA4 A;  2DJF C;  1CI3 M;  3HOZ B;  2ZJQ A;  1TS2 A;  2AUK A;  5J3B A;  3L9A X;  5IP7 H;  1ZXT A;  4JI7 L;  1B8A A;  4JK1 C;  2UUA L;  3I4M B;  1E3P A;  4NDX A;  3CF5 A;  1AZQ A;  2PO4 A;  4FNF A;  1XMO Q;  1O7Y A;  5IGF A;  3A8J E;  2UXB Q;  2GVB A;  2RCN A;  5BN3 A;  2LXJ A;  2B8F A;  2JEA I;  2I5L X;  1ZKO A;  2NZ1 D;  1XPU A;  1EYA A;  2WAQ E;  5C0X J;  3LGJ A;  2XN9 C;  5E4W C;  1XNQ L;  1AN8 A;  3WOF A;  3VYU A;  4GZY C;  2JXM B;  4C3H B;  2NVT H;  4JYA Q;  5M3F G;  4BY1 B;  3GTO H;  4KV6 A;  3VYT A;  2EYJ A;  4FP5 D;  3PUZ A;  1CHP D;  2PQE A;  3E3X A;  1SFO B;  5IT9 c;  4ALP A;  5M5W B;  3ZJY C;  4LF5 L;  1GUG A;  4FDB A;  3MEF A;  3TZU A;  4L5R C;  3I4N G;  4RKB A;  1GUT A;  1STA A;  4C3H G;  4QQB X;  4DKA C;  5JJI A;  4PMW A;  2BDN A;  4GN3 B;  3PIP A;  3W2D A;  4BY1 G;  1JJG A;  4DAP A;  5EKK A;  1II3 A;  3FHW A;  3KF8 B;  3DWQ A;  5C3W A;  1TS3 A;  3U50 C;  1VQI A;  1VMP A;  5DEH A;  3OPO A;  1EY0 A;  1PYS B;  3D4R A;  3P1H A;  3A56 A;  2HQL A;  4S3S A;  1EY9 A;  4F87 A;  2ZTC A;  5FO8 B;  1B53 A;  2IHF A;  2KCM A;  3K5M A;  1STH A;  2F0F A;  5BR8 Q;  1Y1V G;  4IPC A;  3ONA B;  3EJI A;  4ABN A;  1RTN A;  3KDF B;  3BZK A;  1R9T H;  3NEM A;  3DUZ A;  3BDL A;  5ELO A;  4DR4 Q;  2B2U A;  1QG7 A;  1A2U A;  2UUB Q;  4BBS H;  4K5V A;  3J7A V;  4EQN A;  2OTL A;  4DV4 L;  3HOV G;  1HUN A;  1GHJ A;  4KKS A;  2NVX H;  3CC7 A;  4CJ2 C;  1Q81 C;  5LL6 X;  3K57 A;  4X6A H;  1I4P A;  3AFP A;  1Z9F A;  1D5M C;  3G7L A;  4DK1 A;  4POG A;  2DN8 A;  4FF2 A;  3NUC A;  2QGQ A;  4RCO A;  1TWG H;  1AE2 A;  1Q12 A;  4IZ8 A;  2SNM A;  4ZKC B;  5IP9 G;  4JI1 Q;  2PPB C;  2EQS A;  1SR3 A;  3CCR A;  3HOV B;  1Z7T A;  1RL2 A;  2AWN A;  1QVF A;  3W1G A;  4BBR G;  1F77 A;  1XTC D;  1LTB D;  3SK8 A;  1VQA A;  4A4I A;  4YHH L;  1B3A A;  3IRB A;  4H7B A;  1KDB A;  1SRU A;  1KNE A;  1VQ9 A;  4DR3 L;  5IT9 E;  3OWE B;  5LMN W;  1STB A;  4A3E G;  5M5Y H;  5CV6 A;  1PH1 A;  4GOP A;  2MFI A;  4XT1 B;  2A69 C;  3I8Z A;  3BZC A;  4MN3 A;  1YJW A;  3DWA A;  3K5N A;  3C3L A;  3MXN A;  1FYC A;  3FVQ A;  3MXP A;  3NEL A;  2AHO B;  3RLN A;  2XRS D;  2N88 A;  4RGM A;  3AB9 A;  5ISR A;  1K8M A;  1VQG A;  4Z9C B;  1PTO B;  2PQA B;  3GTQ H;  2F0K A;  5FO9 B;  4QIW B;  1ONL A;  2RVL A;  3S1R B;  1N34 L;  3PO2 B;  1WTH A;  3MA2 B;  5I2X A;  3AEV A;  1B1Z A;  1CHQ D;  4MZ9 A;  1RF2 D;  1X3F A;  3E5S A;  4DAY A;  3TP7 A;  3OHX C;  4UP9 A;  4OX9 L;  2NTT A;  1UE6 A;  2D0P A;  1IW7 C;  3VR4 A;  3S1N H;  4C3I G;  1M4V A;  3ZYY X;  4CGY B;  4LK1 C;  2QDB A;  3P75 A;  4IFD G;  3K80 C;  4JI6 Q;  4A3G G;  3S2D B;  1E1O A;  4WJ3 M;  1IL8 A;  2EYF A;  5IOC A;  2CKZ B;  2UXC L;  1A2T A;  3J81 i;  2YTY A;  5M5X H;  2EPB A;  4PZ8 A;  4BA1 I;  3G71 A;  4FF3 A;  3G6E A;  5JPN C;  4KHV A;  1VQK A;  4J6H A;  2R93 G;  4R4C A;  3CD6 A;  2K32 A;  2E74 C;  2R92 G;  1Q46 A;  4GKJ L;  3GQB A;  3KK7 A;  4WRD A;  1V1P B;  1BBU A;  4IPH A;  4DR3 Q;  2LKV A;  3C46 A;  3DWP A;  1PZK D;  2DJG C;  4BY7 G;  5DNF A;  1JWM D;  2NBF A;  4HJ9 A;  5GAE C;  3A5U A;  4JPB W;  1TXY A;  1RJT A;  2E5L L;  4LF6 Q;  1TVX A;  1JIC A;  3T56 B;  1SJH D;  1IL2 A;  4B3R Q;  4JC0 A;  4EQO A;  5LMN Q;  3F2D A;  3STB D;  3CXC A;  1ENF A;  2K05 A;  1O78 A;  5CGK A;  3BVM A;  3TEH B;  2YU9 H;  1T5X D;  3ER0 A;  1BVS A;  3EA6 A;  1JOK A;  1FNU A;  1X55 A;  3M4Y A;  1VCI A;  1EOT A;  1BCP F;  1MKH A;  4GLA C;  1BXT A;  1JJ2 A;  4L8J A;  1EZ6 A;  5E3F A;  1UNS A;  1WFQ A;  1L0W A;  4FF1 A;  4M1U B;  3BDO A;  4DV1 Q;  1QWY A;  1JWS D;  1X6O A;  3TBI B;  2IX3 A;  3K59 A;  1VQ8 A;  5D3D A;  4YCV A;  1XXG A;  5C44 B;  2V4D A;  1PTO H;  1BOS A;  3S2H B;  4FXG C;  3GTO B;  1CT1 D;  5C44 H;  1V1Q A;  4JBJ A;  1B9N A;  1L0Y B;  2VUM G;  4LFC Q;  5FLM G;  1DYQ A;  4P71 A;  1Z6H A;  1B9M A;  2JA6 G;  1HJP A;  4JI1 L;  4DXF A;  1C8C A;  4NB3 A;  2EY1 A;  2JN4 A;  5C0X H;  1EL0 A;  1EWC A;  2UUC L;  4IFD I;  5C44 G;  2CHB D;  4HMJ A;  2PNH A;  3NP8 A;  1KLG D;  4R4T A;  2VQE L;  2R7Z G;  4A3F B;  2Z1C A;  1WCM B;  1EYC A;  4V19 0;  2K1B A;  4CDC C;  5IP7 G;  2F0H A;  2ZTD A;  4OXP A;  2LXK A;  1KNA A;  4MTK A;  4LUV A;  1A63 A;  2PW7 A;  3VR3 A;  2YYZ A;  5A2Q E;  3QWN A;  2FJ2 A;  2WB1 E;  5C4X H;  4NMZ A;  4HIM A;  1UE7 A;  5BR8 L;  1BBW A;  1LV9 A;  1XYI A;  3BYY B;  4KJO A;  4DA2 A;  1WOC A;  3M9B A;  1XTD A;  4UDU C;  2VUM H;  1YNX A;  4Y52 H;  1HXY D;  4R4Q A;  4DK0 A;  1YHB A;  2F0P A;  1HRJ A;  4K6D A;  1SE8 A;  5C4J H;  3CCE A;  4LF4 Q;  3GD7 A;  3S15 H;  3I4L A;  4ZUI A;  1PTO D;  5COR A;  3MEH A;  4C3J G;  2JP1 A;  3MXU A;  4BY7 H;  4A3K G;  4NXN L;  2WKC A;  2F0T A;  3B6Y A;  1WTQ A;  4NXN Q;  4LJZ C;  1EWI A;  3S1Q H;  1I4R A;  1HQR D;  3O13 A;  4EVO A;  3RLO A;  4AYB E;  4LF9 L;  1QNU A;  1IYV A;  1LAC A;  1LT4 D;  1Q8I A;  3OIQ A;  4QIW E;  4C3J B;  4QJF A;  5M3M B;  5AFW A;  3CU7 A;  5CBE E;  1SYC A;  1MD2 D;  3QG1 A;  1O7L A;  3J80 c;  3GV3 A;  5D3I B;  2NVQ H;  3K0Y A;  3SK4 A;  3CKI B;  3UDG A;  1Y1V H;  2JEB I;  1S5E D;  4EQ5 A;  3I70 A;  3T4A C;  4JI4 Q;  1PFM A;  2JA7 H;  1YNJ C;  4R9W A;  4BY1 H;  2BH8 A;  5IGE A;  1SMY C;  1E2Z A;  4UHV A;  1ILQ A;  4L63 B;  4YY3 L;  1HNX L;  5LL6 S;  4DV2 L;  1STG A;  4IUT A;  1DXM A;  3A55 A;  3H0G G;  4HED A;  3OYY A;  2KCN A;  4AQY L;  2F4V L;  2GN5 A;  3NTI A;  1IBL Q;  1UEB A;  2OWO A;  1H95 A;  4L6T B;  1ESR A;  5GRO A;  1STN A;  4FVM A;  4DV3 Q;  1HQM C;  2EZV A;  5FLX E;  2B2V C;  4K0K L;  5K5P A;  3S2D H;  2QIL A;  1K73 C;  1U0L A;  4JI2 L;  2EYM A;  2UXD L;  2R6G A;  3RR5 A;  5C4H A;  3SE0 A;  3SK5 A;  1XPR A;  5JJL A;  4N9P A;  3SGI A;  5A2Q L;  2F0G A;  1K28 A;  4R8I A;  3HOX G;  1TWA H;  4A3I H;  3J7Y W;  2A68 C;  1U9R A;  2EE1 A;  4X62 Q;  5F2D A;  2K01 A;  4CKB A;  3NK9 A;  4KD3 A;  1EIY B;  2QDL A;  4WJ4 A;  1FJG L;  4X3U A;  3ERQ A;  1PH4 A;  1H9S A;  1GUN A;  1RCV D;  2J4X A;  3S24 A;  2VQF Q;  1K83 B;  2JA7 G;  3TRZ A;  2Q2T A;  5EJW A;  4A3B H;  1OXX K;  4DR4 L;  4H0L C;  3OTO L;  1F2Z A;  1I4H A;  4LW1 A;  3PO3 H;  1GUO A;  1VF5 C;  4CKC A;  4IPG A;  3EFX D;  1RIP A;  2RF4 A;  2MNA A;  3TS0 A;  3TDQ A;  5EKL A;  2UXD Q;  1T5E A;  3TME A;  1XNR Q;  3K7U C;  1V9P A;  1X3Q A;  1P16 A;  5BN4 A;  4BXX G;  1QNK A;  3C1F A;  5JEA J;  1X3E A;  2K5Q A;  2K75 A;  1NR4 A;  3HRZ C;  4XQQ A;  1YNJ D;  4AIM A;  4B9X A;  4DUZ L;  4B3T L;  4NW2 A;  2F4V Q;  4PNY A;  2ZT9 C;  4DV5 Q;  1Y1V B;  1ILP A;  3UDX A;  4DV2 Q;  2HT1 A;  2DNE A;  4HCE A;  1VQO A;  5IWA L;  2VB3 X;  4A3M B;  1PA6 A;  1I4G A;  1JC7 A;  3J80 L;  1R4P B;  3Q23 A;  2G9D A;  2ID0 A;  3VA7 A;  3L7Z C;  3HOW H;  3ND9 A;  5IGB A;  1FNV A;  2O2L D;  2RSN A;  2B2T A;  3HOU H;  4QGU A;  1A62 A;  1TWH B;  3AMU A;  1LTG D;  4A3J B;  5I9P A;  1CKO A;  1VQB A;  2J0T D;  2EXD A;  2RQX A;  4A3M G;  4BBS G;  4DAV A;  3V05 A;  2FHT A;  3NHH A;  2PZT A;  4I7Z C;  1KD1 C;  1LTS D;  2MO0 A;  4EX5 A;  3D6C A;  4G57 A;  3I91 A;  3R2I A;  1G51 A;  2B2U C;  3RMH A;  4EQP A;  1TWF H;  5C3X A;  3CCJ A;  1U5K A;  4OEL B;  1B7Y B;  4K8I A;  4DV6 Q;  3ICE A;  2FMC A;  3VR5 A;  1N36 L;  1TU2 B;  2NUC A;  4LAA A;  1KQS A;  4N9T A;  2NVY B;  1GHK A;  2BCO A;  2WAC A;  2Z4I A;  2F0S A;  3KF8 A;  2EIF A;  2NZH A;  2I46 A;  3BYT B;  1XMQ L;  1TWA B;  4A3I B;  3DM3 A;  2NN6 I;  1GUW A;  5IOD A;  1A15 A;  4IUQ A;  3ERS X;  1VQE A;  4G4K A;  2NVY H;  3KF6 B;  2D9U A;  1XNR L;  1X9N A;  4DUY L;  1H9R A;  5LMU L;  4HIO A;  3PUY A;  4PZ7 A;  3KJP A;  2PI2 E;  1VQC A;  1JB3 A;  4DGZ A;  2O4X A;  2D5D A;  2NVX B;  1N9W A;  1PV4 A;  3G48 A;  5I4D A;  1TWG B;  3J7A 5;  3HOX H;  3W5O A;  3KDF A;  1QOH A;  4NXM Q;  4DR6 L;  2XGT A;  1PVO A;  1ESF A;  3Q0A A;  4C2M H;  1HR0 L;  1UE5 A;  4KN7 C;  2EYH A;  4C2M B;  3Q24 A;  3CC4 A;  3RUZ A;  3TZD A;  3R3O A;  3EBE A;  3KLS A;  3QOJ A;  3I90 A;  5KYL A;  5I6W A;  2N3S A;  3NE5 B;  1SYE A;  3LX0 A;  1A6X A;  2K14 A;  2SEB D;  2ALY B;  4OIJ A;  5HY6 A;  3KLW A;  4C3I H;  2GVA A;  1WI5 A;  1KRS A;  2Z8L A;  1YJ9 A;  3NBI A;  2L0C A;  4L5S A;  1JOR A;  4OWT B;  1S5D D;  4LF9 Q;  4CDD C;  3CCS A;  4KKU A;  1SDF A;  1LTR D;  3J80 E;  4DV4 Q;  1ML0 D;  2HHH L;  1CUK A;  3S1M H;  5JEA G;  2R92 B;  1SNQ A;  3NSW A;  2OXP A;  4NP5 A;  3GO5 A;  2IL8 A;  3RD4 A;  1S4Z A;  1HPC A;  4YCU A;  2HUG A;  1JMC A;  2R92 H;  2MP1 A;  4JBW A;  2OEO A;  2IX0 A;  2WV6 D;  3RZD B;  1D2B A;  1PFS A;  1IYJ B;  4U68 A;  2VNU D;  4HJ8 A;  4YY3 Q;  1AW7 A;  4M8A A;  1HNX Q;  1B3Q A;  4JOI C;  1G2T A;  1EYD A;  1HNZ L;  2RHS B;  1EUJ A;  1SNP A;  5KIX A;  1XWE A;  4IUV A;  4PMC A;  4LFB Q;  4MIU A;  1SFO H;  4FXK C;  3H15 A;  4F7X A;  4JI5 Q;  1SMY D;  2K52 A;  1QZG A;  3K6O A;  1UE1 A;  1L2F A;  1EFI D;  3VR2 A;  4X66 Q;  4LFB L;  4ZYS A;  1SE4 A;  4A3K H;  4KHZ A;  1CK1 A;  4HJ5 A;  1EU3 A;  1CM9 A;  2HDL A;  2Z4H A;  4DXG A;  2SNS A;  1BO0 A;  1MJE A;  1K8G A;  4DV1 L;  2HDM A;  1K0R A;  4N8X 1;  4ODG A;  3R8B A;  2R7F A;  2I07 B;  4DV5 L;  2VQF L;  4ZCK A;  1NMG A;  1PRT D;  4DR1 Q;  1D7Q A;  3I2Z A;  4K8J A;  4A3F H;  3EQL C;  4X62 L;  2A6H D;  1VQD A;  4O2D A;  4QL5 A;  1RHP A;  1AH9 A;  2UU9 Q;  3X3M A;  3CW2 C;  3TP5 A;  1I5F A;  1ET9 A;  2PNR C;  3T51 B;  3S17 H;  4ZK9 B;  3D8G A;  4Y7N H;  2IY5 B;  4LF6 L;  5FLX L;  2MO1 A;  2B63 B;  4OO1 I;  4KTA A;  4DNI A;  1DOM A;  1Y1W H;  1CQV A;  1XMO L;  2PW5 A;  4B3M Q;  3OTO Q;  2H5X A;  3GTK B;  5M3F B;  2R7Z B;  2JYO A;  1WCM G;  3FPP A;  3UE0 A;  2JA9 A;  1MBY A;  4TVA B;  3D0F A;  4NPS A;  2B2W C;  2Q2H A;  4TRD A;  3STB C;  1CA5 A;  5M3M H;  5DM6 3;  4OO1 G;  3J81 L;  2AQ2 B;  4ULL A;  5EPJ A;  5C3E B;  4ZUJ A;  4GNX B;  4C3J H;  1K9M C;  1J8I A;  4YIJ A;  4XQN A;  5BN5 A;  1WD0 A;  1NNX A;  2OQ0 A;  3NTK A;  4H02 A;  3M3Y H;  1D5X C;  4PMB A;  5IYC G;  5C3E H;  2JSO A;  4HID A;  1KDA A;  3T1H Q;  2L11 A;  4JG2 A;  4OWW B;  1GM5 A;  3TS2 A;  1G8Z D;  3P20 A;  2E2H H;  3FDT A;  2KCC A;  2AUJ D;  1LTI D;  2B39 A;  2Y0S E;  5C3E G;  4KHP Q;  5EPK A;  2KJX A;  1I3Q H;  3PO2 H;  4IPD A;  4DPG A;  4A3K B;  3BZD B;  5DM7 3;  2KHJ A;  4C1N I;  1R4Q B;  4LF5 Q;  3S2H H;  1EU4 A;  5GAD C;  1PRT C;  4KN4 C;  1U4L A;  3NPP A;  2SOB A;  3DEO A;  1HA6 A;  1JWU D;  4YWK A;  3MTS A;  3BVZ A;  2JA8 G;  4R4I A;  4JBK A;  4HTH A;  2I0Q A;  3JAM E;  2BA1 A;  3FKI G;  1B50 A;  2EJM A;  1WJJ A;  4A93 G;  1I6H H;  4KHP L;  5HGT A;  3TSS A;  1EIF A;  3E0J A;  4XDX A;  4DK6 C;  2K5W A;  1WTP A;  1ZEQ X;  1PZJ D;  5EBD A;  4CBV A;  4NXM L;  2JA8 B;  2EXZ A;  5IYD G;  1P8L A;  1X3P A;  1STY A;  2XWJ B;  1K8A C;  4HN7 A;  1VQ7 A;  4PG3 A;  1WYD A;  3OOC A;  3Q8D A;  4O42 A;  2NWG A;  1GD7 A;  3OW7 A;  5FJ8 H;  3OSO A;  2MQH A;  2XRQ D;  4UPA A;  4JW0 A;  1KAW A;  4B9W A;  3IFD A;  1V1O A;  3CQZ H;  1PLF A;  2RDF A;  1SYG A;  3DXJ C;  3TN2 A;  3HOZ H;  2ZXO A;  4UY8 C;  3U4V A;  3GTJ B;  3PV0 A;  3PSI A;  2WIN B;  3K7A B;  5CV8 A;  1Y1W B;  2F0O A;  4LFC L;  1CKN A;  1DJR D;  5FJ8 G;  1GJX A;  1PH5 A;  3HOX B;  4IUU A;  3PF4 A;  4GLX A;  1PXU A;  4JI0 L;  3RN5 A;  4GLV B;  3NEN A;  5AJ3 L;  3K7A H;  2B29 A;  3RN2 A;  1VQ4 A;  4ZAI A;  1KXL A;  2JA7 B;  2CVR A;  1HR0 W;  3HFZ B;  1E2V A;  4GOP C;  1X32 A;  1LTA D;  2JE6 I;  3GDE A;  1CKN B;  1PHJ A;  2HHH Q;  3PO2 G;  1MGS A;  1I6V C;  2AMC B;  4LF4 L;  2QEX A;  2UUC Q;  3SK6 A;  1DCZ A;  3I3C A;  3A8K E;  1EIH A;  2N8N A;  4LF7 L;  1NCV A;  3CCL A;  3S1R H;  1CZW A;  4HR7 B;  3QR8 A;  3AU7 A;  2V1C C;  1Y8N B;  1C4Q A;  1TQO A;  3GTQ B;  3FMC A;  5FKA C;  1DGS A;  3NBH A;  2OCE A;  4DR1 L;  4ME3 A;  2CQA A;  2KEN A;  4OO1 H;  1SYD A;  4X65 L;  1LTL A;  3CPF A;  4B08 A;  1PYW D;  2MUY A;  4KMU C;  3KFU A;  5E4X A;  5LHY 1;  4X64 Q;  2R93 B;  3IFT A;  1NTG A;  4RWS C;  3M7G A;  3BG3 A;  4DR7 L;  2F0U A;  1Q1B A;  4GN4 B;  1WTR A;  3MHB A;  3S9W A;  1GUS A;  3TQY A;  4MNO A;  2FIN B;  1A3U A;  3VR6 A;  1ZYR C;  1WCM H;  2XVS A;  3MAQ A;  1PFB A;  2EYP A;  3LNN A;  1Q86 C;  4LFA L;  2E5L Q;  1DZ1 A;  1HR0 Q;  4DF7 A;  2P5Z X;  2F3V A;  1K3R A;  1OO9 B;  1N36 Q;  1NJI C;  2CW0 D;  1Y8O B;  2A74 C;  2E8G A;  1PFN A;  1UUP A;  1TII D;  1N32 Q;  1DON A;  2RDH A;  5CMD A;  4DNR B;  1MSG A;  2VB2 X;  3HZX A;  3A0J A;  4K2L A;  1D5Z C;  5K36 G;  2F0M A;  3CRK C;  2EY5 A;  2TSS A;  1Q3L A;  1BNZ A;  1E2W A;  2EOT A;  4DAM A;  1X54 A;  2WP8 J;  3SVM A;  3K5L A;  2L55 A;  3WWV A;  3BS1 A;  2A6E D;  3K0X A;  4KKT A;  3DHQ A;  2F3W A;  1XNQ Q;  3M3Y B;  2BH2 A;  1B2T A;  2Y0S G;  1WTX A;  3JAM c;  4K2K A;  2TMP A;  3HOW B;  4FO2 A;  1ET6 A;  1NY4 A;  4P74 A;  4ZKB B;  4IJL A;  1NSN S;  3AQQ A;  1NR2 A;  3S1M B;  3LWE A;  5KEE A;  2D62 A;  2F0L A;  2NVQ B;  3Q22 A;  4GN5 A;  1G91 A;  3X3N A;  4X3S A;  4JI7 Q;  3PGZ A;  1TWH H;  3KYH C;  3DEP A;  4ID6 A;  2F0Q A;  1C9O A;  4DK3 C;  2X6L A;  3E9H A;  4DR5 Q;  3J81 c;  1J5E Q;  3S16 B;  1LM0 A;  5CYU A;  4IUP A;  4RA8 A;  3F1Z A;  4KD4 A;  5COY A;  4XQJ A;  3CCV A;  3KOJ A;  2L9H A;  1N8R C;  2F3I A;  4A3B G;  4R8N A;  1CA6 A;  2HIX A;  5L37 A;  4B3M L;  1HZ9 A;  2N78 A;  3L0O A;  2XWB B;  5IYB G;  1A0I A;  5I9O A;  5M5X B;  4LUO A;  1C7Y A;  5IY0 A;  2X6G A;  3M85 A;  3EIV A;  1K0S A;  5NUC A;  2KHS A;  2WKD A;  4LNQ A;  1YNN D;  2F0E A;  3KJO A;  4DV7 Q;  4A3L H;  2A69 D;  4A3B B;  4J1M A;  5IYB H;  4RFB A;  4K5W A;  4RHR A;  5IT9 L;  3NQI A;  2LMC B;  2IW3 A;  2QW7 A;  2BE5 D;  4X66 L;  5C4X B;  5FK9 C;  2B2Y C;  3V2T A;  1PH8 A;  3I4N H;  4DV7 L;  4LF7 Q;  1Z47 A;  5I2Y A;  2BOS A;  4O0A A;  2AKW B;  2Q2I A;  1EWH A;  1DM0 B;  1NAP A;  1S5C D;  2JA5 B;  1EY4 A;  4GS3 A;  4HSP A;  1CFM A;  2WB1 G;  1PMR A;  4HMI A;  5ELC A;  2CH4 W;  3E9I A;  3FPU B;  4UAI A;  3HOV H;  2YTV A;  2JA6 B;  4AQY Q;  1I94 L;  1JE4 A;  4RG1 A;  1EY7 A;  5DAU A;  3HOY G;  2A5H A;  3H91 A;  3GV6 A;  3S15 B;  1K8O A;  1VQH A;  2H1E A;  2NN6 H;  2WB1 B;  1J9O A;  4JI4 L;  3GTJ H;  2NVT B;  1BKB A;  2J7Z A;  1NBW A;  3PMF A;  1YZ6 A;  1YHQ A;  1RDP D;  2EVB A;  3JC6 6;  2FMM A;  1TWC B;  2IPK D;  2O5J C;  1EEF D;  5I6Y A;  5J39 A;  3GTP B;  3DLL A;  4A3M H;  2M9V A;  3NBH B;  2FFK B;  4DV3 L;  2K7V A;  1EY8 A;  3Q6S A;  4ILW A;  3MXG A;  2JK8 A;  3HOU B;  1I4X A;  3JAM i;  2VL6 A;  4L5T A;  1S3O A;  2EDG A;  3CC2 A;  4OX9 Q;  3T1Y L;  3J81 E;  3T13 A;  4JI3 Q;  2SDF A;  3M4O B;  5ELD A;  3J7A F;  1OTC A;  3M4P A;  4DNT B;  3QIA A;  1HFG A;  3HGB A;  1I6H B;  1JR0 D;  1E22 A;  1F2M A;  5JJK A;  2IWH A;  4YCW A;  1WVL A;  3UDI A;  2H4O A;  3CMA A;  1QE6 A;  4V0B A;  2UXC Q;  2KQ3 A;  4TQU S;  1JCK B;  2PCF B;  2MHV A;  2KEE A;  3H6M A;  4RHS A;  1MI2 A;  3A74 A;  2CFM A;  2WAQ G;  1K83 H;  1VQM A;  2O5I C;  5C6A A;  4RCN A;  4Y7N B;  4IOC A;  4XXE A;  4YWM A;  5C4J B;  4DR6 Q;  3I4N B;  1JOO A;  1EOV A;  4CKE A;  2ATW A;  5C4Z A;  3T1Y Q;  2E2D C;  5CC4 A;  3J81 j;  2JA8 H;  1J6Q A;  1DD2 A;  5CV5 A;  4AH6 A;  1QUQ A;  1VQJ A;  1VS0 A;  2A1A A;  2A19 A;  2E2J H;  3H3V I;  2EY6 A;  4I7A A;  3BU2 A;  1G6Z A;  1O7I A;  1H9S B;  2L5T A;  2K5N A;  4L5Q A;  2EYO A;  1IBM L;  1LTT D;  4WFN 3;  1B44 D;  3F2B A;  2KCT A;  5JVG 3;  3H0G B;  4P2C B;  1RKN A;  1PH7 A;  4G7Z C;  1QJO A;  2VW9 A;  3RNU A;  3H09 A;  4OIK A;  3KBX A;  1TWC H;  4G7O C;  1TY2 A;  3IAY A;  1JQY D;  3OIP A;  3VYR A;  5HUR A;  3J7Z C;  3N6R A;  1HTL D;  2MJ8 A;  3ULL A;  4I65 A;  3PUW A;  2E76 C;  4YWL A;  1KTK A;  5M5W H;  1FNW A;  3EVQ A;  1BF4 A;  1N34 Q;  1LT3 D;  2VZA A;  1IW7 D;  4JI8 L;  1CQF A;  4UP7 A;  1PH2 A;  2F4I A;  5JAV A;  1VF7 A;  5IP9 H;  3RZD H;  4QUF A;  2F0N A;  2GA4 B;  2PYK A;  5M9O A;  5IWA Q;  1KLU D;  2ZJR A;  3A5Z B;  4PQX A;  5D14 A;  2Q8I B;  2CQO A;  1IKL A;  3S14 H;  5AJ3 Q;  2XNA C;  2VS1 A;  2ZXP A;  3OMC A;  4X3K A;  3J80 i;  4XTC S;  4CJ1 B;  3K8A A;  5GAH C;  1Y1W G;  2A6H C;  1SYB A;  3FKI H;  1JJC B;  4BBR B;  3BVG A;  2NYZ D;  2L1B A;  5ELE A;  1T9H A;  2I5M X;  3V96 A;  2KOL A;  1SNC A;  2C9O A;  2KHI A;  2OT2 A;  4DR5 L;  1J5E L;  4FF4 A;  2AQ1 B;  4KLK A;  1MIU A;  1BBX C;  1ENC A;  1IYU A;  3ULJ A;  4J15 A;  1PZI D;  5KND A;  2RSO A;  4TKO B;  3CCQ A;  3D31 A;  1X3G A;  1SMX A;  1CZG A;  5J1Z A;  1BCP D;  4Q0F A;  2DY7 A;  2PMZ E;  1JOQ A;  3U58 A;  4U67 3;  1I94 Q;  2IX1 A;  4WOR A;  5CV7 A;  4EGV A;  2Z6K A;  1S5B D;  1IBL L;  1OXU A;  1PRT B;  2L15 A;  2JQO A;  2F0J A;  2F0D A;  1UEA B;  4RMF A;  3VYS A;  1BR9 A;  1MHW C;  3A54 A;  1M90 C;  4JI2 Q;  1YVC A;  2YV5 A;  2M00 A;  1IBM Q;  3HEJ A;  4Q5V A;  1HTP A;  4C3I B;  1AP0 A;  3MFY A;  3CAM A;  1AFP A;  1CTM A;  1K3B C;  2ZM6 L;  3SXH A;  1KAA A;  2R7Z H;  2QEJ C;  4P75 A;  1IKM A;  3K81 C;  1GOZ A;  1EYG A;  4KY7 A;  3CP0 A;  1D8L A;  1UWV A;  1TR5 A;  4JCV E;  4DR2 Q;  1Y69 U;  1O80 A;  1Q7Y C;  3U9O A;  1EFW A;  2E2H B;  1FGU A;  3URY A;  1EZ8 A;  4PZ6 A;  1SN8 A;  5FLM H;  2K5H A;  1EY6 A;  4A3I G;  1QUQ B;  1IZ6 A;  1G2S A;  1HCZ A;  5C0X G;  4PV1 C;  5M5Y B;  4IQZ A;  1EQV A;  1XX8 A;  3PO3 G;  3S14 B;  1E0B A;  2OQK A;  3HKS A;  1KHI A;  1NMF A;  2B8G A;  5ELF A;  3L3O C;  2QF7 A;  2Z6B A;  2DGY A;  3I55 A;  4DV0 Q;  4HJA A;  1WTV A;  3GTM B;  4ZRZ A;  1SNM A;  3BJU A;  2B2T C;  1PTO F;  1N32 L;  1ZYR D;  1ICF B;  3AFQ A;  4HCS A;  2E75 C;  2MPM A;  3OMG A;  4CDE C;  2EJG C;  3H3V H;  3OWF A;  1QB5 D;  5EKI A;  2NB0 A;  3H94 A;  3HKZ B;  3ITP A;  1PDQ A;  4GNX A;  4BA2 I;  1TWF B;  3MWY W;  1RD9 D;  5IYD H;  2LS0 1;  1HUM A;  4HIK A;  4KY5 A;  3CPW A;  3GTG B;  2DNC A;  2UU9 L;  3KUP A;  4G7H C;  4XIG S;  2RBM A;  3E6Z X;  2K50 A;  1F9S A;  1LT6 D;  3K58 A;  1VQN A;  4ZQ3 A;  3A7L A;  4IAL A;  5E7N A;  2JA5 H;  2DUD A;  2AQ3 B;  3A7A B;  2B63 H;  2K6A A;  3R2T A;  1BUV T;  3W1B A;  3PIO 3;  2E2I H;  1I50 H;  1TKW B;  2N55 A;  2G5D A;  4FXD A;  2PZW A;  3HOY H;  1TS5 A;  1JT8 A;  1IXR A;  3WDN A;  2E2J B;  1N33 Q;  3FP9 A;  1H9J A;  4RGN A;  3C2P A;  1PRT F;  5M3F H;  3CCU A;  1M1K C;  4IUN A;  3TRE A;  2M2L A;  4DU9 A;  1S5F D;  2RCF A;  1SBB B;  1W6K A;  1CSQ A;  2IT1 A;  3HS0 C;  3M4Q A;  4OL7 A;  4BY7 B;  1BDO A;  3U9S A;  1V8Q A;  1M8A A;  2NTS A;  4DUZ Q;  3PIO A;  3SDZ A;  1YEZ A;  3PUV A;  1X65 A;  3KLR A;  4RGT A;  2A8V A;  3H3V C;  3HKZ E;  2KED A;  1LLR D;  3E0E A;  2JJQ A;  4XT3 B;  3S16 H;  3FEW X;  4A3G H;  1X56 A;  3M4O H;  5ELN A;  1EY5 A;  3CME A;  2F0I A;  1QVC A;  4C3H H;  4BWG B;  1A8V A;  2B3G A;  2PI2 A;  1I3Q B;  1OXS C;  2KUM A;  5FLX c;  1PH6 A;  4P72 A;  3I7F A;  4A3C H;  3FKI B;  4TSS A;  4A93 B;  1V1P A;  1QZH A;  1QVG A;  4UP8 A;  5EAY A;  4RKL A;  3PCO B;  5EPL A;  1EQR A;  1H9M A;  5J22 A;  2XTI A;  1SLJ A;  1D6E C;  4AYB B;  3N52 A;  4RGO S;  3IL8 A;  4QUC A;  3NQT A;  4IO9 A;  1ENA A;  1GXD C;  1AZP A;  4E6I A;  4OON A;  1VQ6 A;  2Q8T A;  2AWO A;  3PIP 3;  5LMN L;  4B3R L;  4GOP B;  1HZA A;  1F9P A;  5T1G A;  1E1T A;  2L4N A;  3IKJ A;  1HZB A;  4AYB G;  5CV4 A;  2B2W A;  4MTN A;  1NE3 A;  1E7Z A;  3EN2 A;  4DR2 L;  3QJY A;  5H1S E;  3HOU G;  1LUZ A;  4XYQ A;  5JJZ A;  4C56 C;  3CQZ B;  4A3E H;  3VDY A;  1EQT A;  2BE5 C;  2UUA Q;  1Y14 B;  2D0O A;  4JYA L;  4CDF C;  3D6W A;  4A3D H;  5JOB A;  4CJ0 B;  4LF8 L;  3D3R A;  2ZM6 Q;  1I50 B;  1FGB D;  3S17 B;  5LMU Q;  3KBG A;  2WFW A;  5T1I A;  1H9K A;  3KF6 A;  1WD1 A;  2WII B;  5G3L F;  2QCP X;  4N8F A;  5C5L A;  4A76 A;  1D1K A;  2EYL A;  1LO5 D;  2E2I B;  1EIG A;  3S1Q B;  2K33 A;  1VDZ A;  2ZJP A;  1JE5 A;  4DUY Q;  3NWS A;  4DV6 L;  2R3Z A;  1SJE D;  4FYD A;  4B3S Q;  2Q8R E;  3SHL A;  2F1M A;  4K6L A;  2HIV A;  1EEI D;  3K5O A;  2HCI A;  2K5V A;  5K36 H;  4LMQ D;  5CBA E;  1SEB D;  2DY8 A;  3D4D A;  3PQI A;  4QCL A;  4OWX B;  4A3J H;  1BCP C;  1OXV A;  3F2C A;  1IBK Q;  4DAY B;  2QA4 A;  4KK7 A;  4HJ7 A;  2CW0 C;  1GO3 E;  2EJF C;  1QIL A;  2K5D A;  5M3M G;  5ELB A;  4IFD J;  2ZXR A;  2PZU A;  1L1O A;  4JV5 Q;  1SYF A;  3I72 A;  5KNC A;  2F52 A;  2A6E C;  1PTO C;  4YHH Q;  1HZC A;  4B3T Q;  1VQ5 A;  2CWA A;  1MSH A;  5G3L D;  2Z0S A;  1BQQ T;  1FR3 A;  2XIW A;  2HD3 A;  4R4O A;  2R7D A;  3ULP A;  1WTO A;  1OXT A;  4IFD H;  4H44 C;  5CV9 A;  2L12 A;  2ICI A;  2I5H A;  3CHB D;  1CSP A;  4O1N A;  1DOK A;  1L1O C;  4BXX H;  1S72 A;  1BCP B;  3QB3 A;  1C48 A;  4JI5 L;  2XSC A;  2MGS A;  2ASB A;  3T53 B;  3U4Z A;  5JPM C;  4JVZ A;  1I4Q A;  4MHE A;  4JOI A;  5EGT A;  1ICW A;  4KY6 A;  4WJW A;  4C1N K;  1SSO A;  2Q2U A;  1TY0 A;  1PH9 A;  2KEC A;  3W3A A;  1HH2 P;  4CHT B;  1SND A;  4A3E B;  4DFA A;  4A3J G;  5C0X I;  3AYH B;  4LUZ A;  1CKM A;  1FJG Q;  4XYO A;  1W6J A;  1YIJ A;  2LY7 A;  3NXW A;  1ASZ A;  4BBS B;  1KAB A;  3F8T A;  1EQQ A;  4P73 A;  1V43 A;  4POF A;  2VXW A;  1HNW L;  3QO2 A;  3TP8 A;  2FXQ A;  2RDG A;  4BS9 A;  5C5M A;  3M7N A;  1F2L A;  4OEM B;  2QKI C;  4A3D B;  2Y0S B;  2YU9 B;  3I73 A;  3HOW G;  1KRT A;  3UE1 A;  4K5X A;  2F0W A;  1U4P A;  2PMZ B;  1SAP A;  4F8M A;  3SEB A;  2K03 A;  1SE2 A;  5GQO A;  2EY2 A;  4JBM A;  3I4M H;  2C5C A;  1TS4 A;  2ES2 A;  4A3D G;  2ICE C;  1N33 L;  5IGC A;  4GKJ Q;  2N49 A;  4LWC A;  1F9R A;  3CRL C;  4HSV A;  2K04 A;  4IN3 A;  4LFA Q;  5FO7 B;  5FOB B;  4A3G B;  2HCC A;  3F2U A;  2C35 B;  5HGQ A;  2UXB L;  1YJN A;  5KRU A;  1WTW A;  1VQL A;  3I4O A;  3A8I E;  2CCZ A;  3MZ5 A;  2VY3 A;  3R93 A;  1KIX A;  1Q90 A;  1IHZ A;  2CWP A;  2RHQ B;  1B70 B;  5GAG C;  4A3L G;  5EBC A;  1LT5 D;  1HFN A;  1Q1E A;  2X69 A;  4QB4 A;  3GTL H;  4JI8 Q;  4K14 A;  4DR7 Q;  2OTJ A;  4LF8 Q;  1G6P A;  2K4K A;  3MC0 B;  4RAU C;  1GKH A;  1B4O A;  1C0A A;  1VQP A;  2KBN A;  1XMQ Q;  1PYB A;  3DM1 A;  3GTL B;  5DLQ E;  5JEA H;  4A93 H;  2KA7 A;  3KLS X;  3NWT A;  3I56 A;  1L0X B;  1YNN C;  4R1J A;  5C4X G;  3P7J A;  3GP7 A;  2R93 H;  3BDC A;  5A35 A;  2ENB A;  2KVM A;  5KYI A;  1FD7 D;  1AE3 A;  5IYC H;  1Y8P B;  4RH6 A;  2LSS A;  4ZLT F; 
#chains in the Genus database with same CATH homology
 4J8Q A;  2HQE A;  1ROD A;  4OGQ C;  2B2V A;  3PO3 B;  5D65 A;  1QCB D;  3HOY B;  1HA5 A;  3TP6 A;  2IJ0 A;  5IIF A;  2VUM B;  5KGU A;  3JAM L;  1O7Z A;  3SR1 A;  4QF4 A;  3PUX A;  4H13 C;  5TSS A;  3D4W A;  3RLF A;  3C1E A;  4OHJ A;  2RKS A;  3T16 A;  2BDO A;  3WOE A;  1KDC A;  3ND8 A;  3G6J B;  3VA5 A;  1VMC A;  2LFN A;  3QOL A;  3UI2 A;  2F03 A;  4HAE A;  4QMG A;  3HG9 A;  4KJN A;  2K28 A;  4F88 A;  1SXT A;  1HHV A;  5IGG A;  4X3T A;  4NKL A;  2BA0 A;  4DN4 M;  2R61 A;  1U4M A;  2NN6 G;  1D1I A;  1STE A;  5CR3 A;  2WAQ B;  3DMU A;  1NUC A;  2F0V A;  1F2Y A;  5IGD A;  5EQ0 A;  2G9H D;  4ME5 A;  3NTH A;  3FRP B;  1DOL A;  2B2Y A;  2A68 D;  1AEX A;  1G29 1;  1F9Q A;  1RTO A;  1SE3 A;  1SNO A;  3S1N B;  1U4R A;  4KI0 A;  1A3T A;  3MVV A;  4IUR A;  3HP3 A;  1LAB A;  2D2C C;  3RZO B;  1A3V A;  5JVH 3;  1UAP A;  2A73 B;  5KNB A;  2OF1 A;  5E1F A;  1TT2 A;  3ERO A;  1R9T B;  3MFG A;  3LWU A;  2RA4 A;  1CI3 M;  3HOZ B;  1TS2 A;  2AUK A;  3L9A X;  1ZXT A;  4JK1 C;  3I4M B;  4NDX A;  1AZQ A;  2PO4 A;  4FNF A;  1O7Y A;  5IGF A;  3A8J E;  5BN3 A;  2B8F A;  2JEA I;  1ZKO A;  2NZ1 D;  1EYA A;  5C0X J;  2XN9 C;  5E4W C;  1AN8 A;  3WOF A;  3VYU A;  4GZY C;  2JXM B;  4C3H B;  4BY1 B;  4KV6 A;  3VYT A;  2EYJ A;  4FP5 D;  3PUZ A;  1CHP D;  2PQE A;  1SFO B;  5M5W B;  1GUG A;  3TZU A;  4RKB A;  1STA A;  1GUT A;  4C3H G;  4PMW A;  2BDN A;  3W2D A;  4DAP A;  5EKK A;  1II3 A;  3DWQ A;  5C3W A;  1TS3 A;  1VMP A;  5DEH A;  3OPO A;  1EY0 A;  3D4R A;  3P1H A;  3A56 A;  4S3S A;  1EY9 A;  4F87 A;  5FO8 B;  1B53 A;  3K5M A;  1STH A;  2F0F A;  3ONA B;  3EJI A;  4ABN A;  1RTN A;  3DUZ A;  3BDL A;  2B2U A;  1QG7 A;  1A2U A;  4K5V A;  3J7A V;  4EQN A;  1HUN A;  1GHJ A;  4KKS A;  4CJ2 C;  5LL6 X;  3K57 A;  1I4P A;  1D5M C;  3G7L A;  4DK1 A;  2DN8 A;  4FF2 A;  3NUC A;  4RCO A;  1Q12 A;  4IZ8 A;  2SNM A;  4ZKC B;  2PPB C;  3HOV B;  1Z7T A;  2AWN A;  1F77 A;  1XTC D;  1LTB D;  3SK8 A;  1B3A A;  4H7B A;  1KDB A;  1KNE A;  5IT9 E;  3OWE B;  1STB A;  5CV6 A;  4XT1 B;  2A69 C;  3I8Z A;  4MN3 A;  3DWA A;  3K5N A;  3C3L A;  3MXN A;  1FYC A;  3FVQ A;  3MXP A;  2XRS D;  2N88 A;  4RGM A;  3AB9 A;  5ISR A;  1K8M A;  4Z9C B;  1PTO B;  2F0K A;  5FO9 B;  4QIW B;  1ONL A;  2RVL A;  3S1R B;  3PO2 B;  3MA2 B;  5I2X A;  1B1Z A;  1CHQ D;  1RF2 D;  3E5S A;  4DAY A;  3TP7 A;  3OHX C;  2NTT A;  1IW7 C;  3VR4 A;  4C3I G;  1M4V A;  3ZYY X;  4CGY B;  4LK1 C;  2QDB A;  3P75 A;  4IFD G;  3S2D B;  1IL8 A;  2EYF A;  5IOC A;  1A2T A;  2EPB A;  4BA1 I;  4FF3 A;  5JPN C;  4KHV A;  4J6H A;  2K32 A;  2E74 C;  3GQB A;  3KK7 A;  4WRD A;  1V1P B;  2LKV A;  3C46 A;  3DWP A;  1PZK D;  5DNF A;  1JWM D;  2NBF A;  1RJT A;  1TVX A;  1JIC A;  3T56 B;  1SJH D;  4EQO A;  1ENF A;  2K05 A;  1O78 A;  5CGK A;  3BVM A;  1T5X D;  3EA6 A;  1JOK A;  1FNU A;  3M4Y A;  1VCI A;  1EOT A;  1BCP F;  1BXT A;  4L8J A;  1EZ6 A;  5E3F A;  1UNS A;  4FF1 A;  4M1U B;  3BDO A;  1QWY A;  1JWS D;  3TBI B;  2IX3 A;  3K59 A;  5D3D A;  1XXG A;  5C44 B;  2V4D A;  1PTO H;  1BOS A;  3S2H B;  4FXG C;  3GTO B;  1CT1 D;  1B9N A;  1L0Y B;  1DYQ A;  1Z6H A;  1B9M A;  4DXF A;  1C8C A;  2EY1 A;  5C0X H;  1EL0 A;  1EWC A;  4IFD I;  2CHB D;  4HMJ A;  3NP8 A;  1KLG D;  4A3F B;  4V19 0;  2Z1C A;  1WCM B;  1EYC A;  2K1B A;  2F0H A;  1KNA A;  5A2Q E;  3VR3 A;  2PW7 A;  2YYZ A;  3QWN A;  2FJ2 A;  4NMZ A;  1LV9 A;  1XYI A;  3BYY B;  4KJO A;  4DA2 A;  4UDU C;  1HXY D;  4DK0 A;  2F0P A;  1HRJ A;  4K6D A;  3GD7 A;  3I4L A;  4ZUI A;  1PTO D;  5COR A;  3MEH A;  4C3J G;  2JP1 A;  3MXU A;  2WKC A;  2F0T A;  1WTQ A;  4LJZ C;  1I4R A;  1HQR D;  3O13 A;  4EVO A;  1IYV A;  1QNU A;  1LAC A;  1LT4 D;  1Q8I A;  3OIQ A;  4C3J B;  5M3M B;  5AFW A;  3CU7 A;  5CBE E;  1SYC A;  1MD2 D;  3QG1 A;  1O7L A;  3GV3 A;  5D3I B;  3K0Y A;  3SK4 A;  3CKI B;  2JEB I;  1S5E D;  3I70 A;  3T4A C;  1PFM A;  1YNJ C;  4R9W A;  5IGE A;  1SMY C;  1E2Z A;  1ILQ A;  4L63 B;  5LL6 S;  1STG A;  4IUT A;  1DXM A;  3A55 A;  4HED A;  2KCN A;  3NTI A;  4L6T B;  1ESR A;  1STN A;  4FVM A;  1HQM C;  2EZV A;  5FLX E;  2B2V C;  5K5P A;  2QIL A;  2EYM A;  2R6G A;  5C4H A;  3SE0 A;  3SK5 A;  4N9P A;  5A2Q L;  2F0G A;  4R8I A;  3J7Y W;  2A68 C;  1U9R A;  2EE1 A;  5F2D A;  2K01 A;  4CKB A;  3NK9 A;  4KD3 A;  4X3U A;  3ERQ A;  1H9S A;  1GUN A;  1RCV D;  2J4X A;  1K83 B;  5EJW A;  1OXX K;  4H0L C;  1F2Z A;  1I4H A;  1GUO A;  1VF5 C;  4CKC A;  3EFX D;  3TDQ A;  5EKL A;  1T5E A;  3TME A;  1X3Q A;  5BN4 A;  1QNK A;  3C1F A;  5JEA J;  4XQQ A;  2K5Q A;  1NR4 A;  3HRZ C;  4B9X A;  1YNJ D;  4NW2 A;  4PNY A;  2ZT9 C;  1Y1V B;  1ILP A;  2DNE A;  4HCE A;  2VB3 X;  4A3M B;  1I4G A;  1JC7 A;  3J80 L;  1R4P B;  3Q23 A;  2G9D A;  2ID0 A;  3VA7 A;  3L7Z C;  3ND9 A;  5IGB A;  1FNV A;  2O2L D;  2RSN A;  2B2T A;  1TWH B;  3AMU A;  1LTG D;  4A3J B;  5I9P A;  2J0T D;  2RQX A;  4DAV A;  3V05 A;  2FHT A;  3NHH A;  2PZT A;  4I7Z C;  1LTS D;  3D6C A;  4G57 A;  3I91 A;  3R2I A;  2B2U C;  3RMH A;  4EQP A;  5C3X A;  4K8I A;  2FMC A;  3VR5 A;  1TU2 B;  2NUC A;  4LAA A;  4N9T A;  2NVY B;  1GHK A;  2BCO A;  2WAC A;  2Z4I A;  2F0S A;  3KF8 A;  3BYT B;  2I46 A;  1TWA B;  4A3I B;  2NN6 I;  1GUW A;  5IOD A;  1A15 A;  4IUQ A;  4G4K A;  2D9U A;  1H9R A;  3PUY A;  1JB3 A;  4DGZ A;  2O4X A;  2D5D A;  2NVX B;  5I4D A;  1TWG B;  1QOH A;  1ESF A;  3Q0A A;  4KN7 C;  2EYH A;  4C2M B;  3Q24 A;  3RUZ A;  3TZD A;  3R3O A;  3KLS A;  3QOJ A;  3I90 A;  5KYL A;  5I6W A;  3NE5 B;  1SYE A;  3LX0 A;  1A6X A;  2SEB D;  4OIJ A;  2Z8L A;  3NBI A;  2L0C A;  1JOR A;  1S5D D;  4KKU A;  1SDF A;  1LTR D;  3J80 E;  1ML0 D;  5JEA G;  2R92 B;  1SNQ A;  3NSW A;  2OXP A;  4NP5 A;  3GO5 A;  3RD4 A;  2IL8 A;  1S4Z A;  1HPC A;  2HUG A;  2MP1 A;  4JBW A;  2OEO A;  2IX0 A;  2WV6 D;  3RZD B;  1D2B A;  2VNU D;  4U68 A;  1AW7 A;  4M8A A;  1G2T A;  1EYD A;  1SNP A;  5KIX A;  1XWE A;  4IUV A;  4PMC A;  4MIU A;  4FXK C;  4F7X A;  1SMY D;  3K6O A;  1EFI D;  3VR2 A;  4ZYS A;  1SE4 A;  4KHZ A;  1CK1 A;  1EU3 A;  1CM9 A;  2HDL A;  2Z4H A;  4DXG A;  2SNS A;  1BO0 A;  2HDM A;  4ODG A;  3R8B A;  2I07 B;  1PRT D;  4K8J A;  3EQL C;  2A6H D;  1RHP A;  3X3M A;  3TP5 A;  1ET9 A;  2PNR C;  3T51 B;  4ZK9 B;  3D8G A;  5FLX L;  2B63 B;  4OO1 I;  4KTA A;  1DOM A;  1CQV A;  2PW5 A;  3GTK B;  5M3F B;  2R7Z B;  2JYO A;  3FPP A;  1MBY A;  2B2W C;  4TRD A;  1CA5 A;  5DM6 3;  4OO1 G;  3J81 L;  2AQ2 B;  4ULL A;  5EPJ A;  5C3E B;  4ZUJ A;  1J8I A;  4YIJ A;  4XQN A;  5BN5 A;  1WD0 A;  3NTK A;  1D5X C;  4PMB A;  2JSO A;  1KDA A;  2L11 A;  1G8Z D;  3P20 A;  2KCC A;  2AUJ D;  3FDT A;  1LTI D;  2B39 A;  5EPK A;  2KJX A;  4A3K B;  3BZD B;  5DM7 3;  4C1N I;  1R4Q B;  1EU4 A;  1PRT C;  4KN4 C;  1U4L A;  3NPP A;  2SOB A;  3DEO A;  1HA6 A;  1JWU D;  3MTS A;  3BVZ A;  4HTH A;  3JAM E;  2BA1 A;  1B50 A;  2EJM A;  5HGT A;  3TSS A;  3E0J A;  4XDX A;  2K5W A;  1WTP A;  1ZEQ X;  1PZJ D;  5EBD A;  4CBV A;  2JA8 B;  2EXZ A;  1X3P A;  1STY A;  2XWJ B;  4HN7 A;  3OOC A;  4O42 A;  2NWG A;  3OW7 A;  3OSO A;  2XRQ D;  4B9W A;  3IFD A;  1V1O A;  1PLF A;  2RDF A;  1SYG A;  3DXJ C;  3TN2 A;  2ZXO A;  3GTJ B;  3PV0 A;  2WIN B;  3K7A B;  5CV8 A;  1Y1W B;  2F0O A;  1DJR D;  1GJX A;  3HOX B;  4IUU A;  1PXU A;  4ZAI A;  2JA7 B;  2CVR A;  1E2V A;  1X32 A;  1LTA D;  2JE6 I;  1MGS A;  1I6V C;  3SK6 A;  1DCZ A;  3I3C A;  3A8K E;  1EIH A;  1NCV A;  1CZW A;  4HR7 B;  3AU7 A;  1Y8N B;  1C4Q A;  1TQO A;  3GTQ B;  3FMC A;  5FKA C;  3NBH A;  2CQA A;  4OO1 H;  1SYD A;  4B08 A;  1PYW D;  2MUY A;  4KMU C;  5E4X A;  5LHY 1;  2R93 B;  3IFT A;  4RWS C;  3M7G A;  3BG3 A;  2F0U A;  1Q1B A;  1WTR A;  3MHB A;  3S9W A;  1GUS A;  2FIN B;  1A3U A;  3VR6 A;  1ZYR C;  2XVS A;  3MAQ A;  1PFB A;  2EYP A;  3LNN A;  1DZ1 A;  4DF7 A;  2F3V A;  1OO9 B;  2CW0 D;  1Y8O B;  2A74 C;  1PFN A;  1UUP A;  1TII D;  1DON A;  2RDH A;  5CMD A;  4DNR B;  1MSG A;  2VB2 X;  3HZX A;  4K2L A;  1D5Z C;  5K36 G;  2F0M A;  3CRK C;  2EY5 A;  2TSS A;  1Q3L A;  1BNZ A;  1E2W A;  2EOT A;  2WP8 J;  3SVM A;  3K5L A;  2L55 A;  3BS1 A;  2A6E D;  4KKT A;  3DHQ A;  2F3W A;  3M3Y B;  1B2T A;  1WTX A;  4K2K A;  2TMP A;  3HOW B;  4FO2 A;  1ET6 A;  4ZKB B;  1NSN S;  1NR2 A;  3S1M B;  3LWE A;  5KEE A;  2D62 A;  2F0L A;  2NVQ B;  3Q22 A;  1G91 A;  3X3N A;  4X3S A;  3DEP A;  4ID6 A;  2F0Q A;  2X6L A;  3S16 B;  5CYU A;  4IUP A;  4RA8 A;  4KD4 A;  5COY A;  4XQJ A;  2L9H A;  4R8N A;  1CA6 A;  2XWB B;  5I9O A;  5M5X B;  2X6G A;  3M85 A;  5NUC A;  2KHS A;  2WKD A;  1YNN D;  2F0E A;  2A69 D;  4A3B B;  4J1M A;  4RFB A;  4K5W A;  4RHR A;  5IT9 L;  3NQI A;  2LMC B;  2IW3 A;  2BE5 D;  5C4X B;  5FK9 C;  2B2Y C;  3V2T A;  1Z47 A;  5I2Y A;  2BOS A;  1EWH A;  1DM0 B;  1NAP A;  1S5C D;  2JA5 B;  1EY4 A;  4HSP A;  1CFM A;  1PMR A;  4HMI A;  5ELC A;  3FPU B;  4UAI A;  2JA6 B;  1JE4 A;  1EY7 A;  5DAU A;  2A5H A;  3H91 A;  3GV6 A;  3S15 B;  1K8O A;  2H1E A;  2NN6 H;  2WB1 B;  1J9O A;  2NVT B;  2J7Z A;  3PMF A;  1RDP D;  2EVB A;  2FMM A;  1TWC B;  2IPK D;  2O5J C;  1EEF D;  5I6Y A;  3GTP B;  5J39 A;  2M9V A;  2FFK B;  2K7V A;  1EY8 A;  3Q6S A;  4ILW A;  3MXG A;  3HOU B;  1I4X A;  2EDG A;  3J81 E;  3T13 A;  2SDF A;  3M4O B;  5ELD A;  3J7A F;  4DNT B;  3QIA A;  1HFG A;  3HGB A;  1I6H B;  1JR0 D;  1F2M A;  2IWH A;  1WVL A;  2H4O A;  1QE6 A;  4V0B A;  2KQ3 A;  4TQU S;  1JCK B;  2PCF B;  2MHV A;  2KEE A;  3H6M A;  4RHS A;  1MI2 A;  2O5I C;  5C6A A;  4RCN A;  4Y7N B;  4XXE A;  5C4J B;  3I4N B;  1JOO A;  4CKE A;  5C4Z A;  2E2D C;  5CC4 A;  1DD2 A;  5CV5 A;  2EY6 A;  1G6Z A;  1H9S B;  2L5T A;  2EYO A;  1LTT D;  4WFN 3;  1B44 D;  5JVG 3;  3H0G B;  4P2C B;  1RKN A;  4G7Z C;  1QJO A;  3H09 A;  4OIK A;  3KBX A;  4G7O C;  1TY2 A;  3IAY A;  1JQY D;  3OIP A;  3VYR A;  5HUR A;  3N6R A;  1HTL D;  2MJ8 A;  4I65 A;  3PUW A;  2E76 C;  1KTK A;  1FNW A;  3EVQ A;  1BF4 A;  1LT3 D;  1IW7 D;  1CQF A;  2F4I A;  5JAV A;  1VF7 A;  4QUF A;  2F0N A;  2GA4 B;  2PYK A;  5M9O A;  1KLU D;  4PQX A;  2Q8I B;  5D14 A;  1IKL A;  2XNA C;  2ZXP A;  3OMC A;  4X3K A;  4XTC S;  4CJ1 B;  2A6H C;  1SYB A;  4BBR B;  3BVG A;  2NYZ D;  2L1B A;  5ELE A;  3V96 A;  2KOL A;  1SNC A;  2C9O A;  2OT2 A;  4FF4 A;  2AQ1 B;  1BBX C;  1ENC A;  1IYU A;  1PZI D;  5KND A;  2RSO A;  4TKO B;  3D31 A;  1CZG A;  5J1Z A;  1BCP D;  4Q0F A;  2DY7 A;  1JOQ A;  4U67 3;  2IX1 A;  4WOR A;  5CV7 A;  4EGV A;  1S5B D;  1OXU A;  1PRT B;  2F0J A;  2F0D A;  1UEA B;  3VYS A;  1BR9 A;  3A54 A;  2M00 A;  3HEJ A;  4Q5V A;  1HTP A;  4C3I B;  1AP0 A;  3MFY A;  1AFP A;  1CTM A;  3SXH A;  1KAA A;  2QEJ C;  1IKM A;  1GOZ A;  4KY7 A;  1TR5 A;  1Y69 U;  1O80 A;  3U9O A;  2E2H B;  3URY A;  1EZ8 A;  1EY6 A;  1G2S A;  1HCZ A;  5C0X G;  4PV1 C;  5M5Y B;  4IQZ A;  1EQV A;  1XX8 A;  3S14 B;  1E0B A;  2B8G A;  5ELF A;  3L3O C;  2QF7 A;  1WTV A;  3GTM B;  4ZRZ A;  1SNM A;  2B2T C;  1PTO F;  1ZYR D;  4HCS A;  2E75 C;  2MPM A;  3OMG A;  2EJG C;  3OWF A;  1QB5 D;  5EKI A;  2NB0 A;  3H94 A;  3HKZ B;  3ITP A;  1PDQ A;  4BA2 I;  1TWF B;  3MWY W;  1RD9 D;  2LS0 1;  1HUM A;  3GTG B;  4KY5 A;  2DNC A;  3KUP A;  4G7H C;  4XIG S;  2RBM A;  3E6Z X;  1F9S A;  1LT6 D;  3K58 A;  4ZQ3 A;  3A7L A;  4IAL A;  2AQ3 B;  3A7A B;  2K6A A;  3R2T A;  1BUV T;  3PIO 3;  1TKW B;  2N55 A;  4FXD A;  2PZW A;  1TS5 A;  3WDN A;  2E2J B;  1H9J A;  4RGN A;  3C2P A;  1PRT F;  4IUN A;  2M2L A;  4DU9 A;  1S5F D;  1SBB B;  1W6K A;  2IT1 A;  3HS0 C;  4OL7 A;  4BY7 B;  1BDO A;  3U9S A;  1V8Q A;  1M8A A;  2NTS A;  3SDZ A;  3PUV A;  3KLR A;  4RGT A;  3H3V C;  2KED A;  1LLR D;  4XT3 B;  3FEW X;  1EY5 A;  2F0I A;  4BWG B;  1I3Q B;  1OXS C;  2KUM A;  3FKI B;  4TSS A;  4A93 B;  1V1P A;  4RKL A;  5EPL A;  1H9M A;  5J22 A;  1D6E C;  4AYB B;  3N52 A;  4RGO S;  3IL8 A;  4QUC A;  3NQT A;  1ENA A;  1GXD C;  1AZP A;  4E6I A;  2Q8T A;  2AWO A;  3PIP 3;  1F9P A;  5T1G A;  2L4N A;  3IKJ A;  5CV4 A;  2B2W A;  3QJY A;  4XYQ A;  5JJZ A;  4C56 C;  3CQZ B;  1EQT A;  2BE5 C;  3D6W A;  5JOB A;  4CJ0 B;  3D3R A;  1I50 B;  1FGB D;  3S17 B;  3KBG A;  5T1I A;  1H9K A;  1WD1 A;  2WII B;  5G3L F;  2QCP X;  5C5L A;  1D1K A;  2EYL A;  1LO5 D;  2E2I B;  1EIG A;  3S1Q B;  2K33 A;  1VDZ A;  3NWS A;  2R3Z A;  1SJE D;  4FYD A;  2Q8R E;  3SHL A;  2F1M A;  4K6L A;  1EEI D;  3K5O A;  2HCI A;  5K36 H;  4LMQ D;  5CBA E;  1SEB D;  2DY8 A;  3D4D A;  4QCL A;  1BCP C;  1OXV A;  4KK7 A;  2CW0 C;  2EJF C;  1QIL A;  2K5D A;  4IFD J;  5ELB A;  2ZXR A;  2PZU A;  1SYF A;  3I72 A;  5KNC A;  2A6E C;  1PTO C;  5G3L D;  1MSH A;  2XIW A;  1BQQ T;  1FR3 A;  1WTO A;  1OXT A;  4IFD H;  4H44 C;  5CV9 A;  2L12 A;  2ICI A;  3CHB D;  4O1N A;  1DOK A;  1BCP B;  3QB3 A;  1C48 A;  2XSC A;  2MGS A;  3T53 B;  5JPM C;  1I4Q A;  4MHE A;  5EGT A;  1ICW A;  4KY6 A;  4WJW A;  4C1N K;  1SSO A;  1TY0 A;  2KEC A;  3W3A A;  4CHT B;  1SND A;  4A3E B;  4DFA A;  5C0X I;  4XYO A;  1W6J A;  2LY7 A;  3NXW A;  4BBS B;  1KAB A;  1V43 A;  2VXW A;  3QO2 A;  3TP8 A;  2RDG A;  4BS9 A;  5C5M A;  3M7N A;  1F2L A;  2QKI C;  4A3D B;  2Y0S B;  2YU9 B;  3I73 A;  4K5X A;  2F0W A;  1U4P A;  2PMZ B;  1SAP A;  4F8M A;  3SEB A;  2K03 A;  1SE2 A;  2EY2 A;  2C5C A;  1TS4 A;  2ICE C;  5IGC A;  1F9R A;  3CRL C;  4HSV A;  2K04 A;  4IN3 A;  5FO7 B;  5FOB B;  4A3G B;  2HCC A;  3F2U A;  5KRU A;  1WTW A;  3A8I E;  3MZ5 A;  3R93 A;  1Q90 A;  1IHZ A;  5EBC A;  1LT5 D;  1HFN A;  1Q1E A;  2X69 A;  4QB4 A;  4K14 A;  3MC0 B;  4RAU C;  1B4O A;  3DM1 A;  3GTL B;  5JEA H;  2KA7 A;  3KLS X;  3NWT A;  1L0X B;  1YNN C;  3P7J A;  3GP7 A;  3BDC A;  5A35 A;  2ENB A;  2KVM A;  5KYI A;  1FD7 D;  1Y8P B;  4RH6 A;  4ZLT F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...