1J9OA

Solution structure of human lymphotactin
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
93
structure length
93
Chain Sequence
VGSEVSDKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCADPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Monomeric solution structure of the prototypical 'C' chemokine lymphotactin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
molecule keywords LYMPHOTACTIN
total genus 12
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2001-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1j9oA00
2DY8A 2KOLA 2L11A 1J8IA 1VMCA 1RJTA 3KUPA 2RVLA 4OIJA 2M2LA 4RAUC 4IUTA 2J7ZA 2MPMA 1JE4A 3DM1A 1WTXA 3MTSA 2L12A 2K28A 1F9PA 2B2TC 4HEDA 5EPKA 3HP3A 2MGSA 1NAPA 1HUNA 1AZPA 1O7YA 1EIGA 1EL0A 2HDMA 4U68A 1E0BA 2K05A 5CORA 2NYZD 2K01A 2L4NA 4HAEA 4ZKBB 1Q3LA 2L9HA 4CJ2C 1QNKA 3I3CA 2H1EA 3P7JA 5DNFA 1PFBA 4X3SA 1AP0A 3IL8A 1MSHA 1RTOA 1ICWA 2HCCA 2X6GA 1O7ZA 3G7LA 3GV6A 5T1GA 2FJ2A 3TZDA 2B2TA 2RA4A 1ZXTA 4XT3B 2CVRA 1WTOA 4RWSC 1RODA 1HUMA 1A15A 3D6WA 1HHVA 5EJWA 5D14A 3H91A 2KECA 3MWYW 2R3ZA 1SAPA 2Q8TA 1HFNA 1TVXA 1DOMA 2FINB 2HDLA 1WTQA 1ILPA 1U4LA 2FHTA 4XDXA 1HFGA 1B53A 1U4PA 1MI2A 2B2WC 1B3AA 1HA6A 4X3UA 1J9OA 4HSVA 4R8IA 3DEOA 1MGSA 2HCIA 1B4OA 2SDFA 1G6ZA 2IL8A 4R9WA 1SDFA 2EPBA 1U4MA 4IUQA 3IFDA 1WTWA 1WD0A 3GV3A 1PFMA 1LV9A 5COYA 2N55A 5EKIA 1WD1A 2HUGA 1KNAA 4RA8A 4QUFA 3DEPA 4MN3A 2N88A 2K04A 5EPJA 3I91A 1F9RA 2B2VC 1DOKA 2JYOA 5CBEE 1PLFA 1CM9A 1M8AA 4ZAIA 1EQTA 1WVLA 1U4RA 3I90A 1NR2A 1IKLA 3F2UA 4IUVA 1HRJA 2XIWA 2B2WA 1G91A 2B2YA 5EPLA 2DY7A 4IURA 1ILQA 2NWGA 5T1IA 5CBAE 4O42A 1ESRA 3TN2A 4X3KA 1GUWA 3R93A 4IUPA 5CMDA 1DOLA 2KUMA 3LWEA 2D9UA 1DZ1A 4NW2A 5AFWA 1X32A 2MP1A 2Q8RE 2EOTA 4IUUA 1IL8A 1RHPA 2BDNA 2RSNA 3QO2A 1PDQA 1EIHA 1IKMA 2X69A 1CA5A 1X3QA 4UAIA 1F9SA 2L1BA 2RSOA 2B2YC 4ZKCB 4OIKA 3ONAB 3Q6SA 1XX8A 4QUCA 2KVMA 2B2VA 4CJ1B 2K1BA 2EE1A 2FFKB 3FPUB 1BBXC 1NR4A 1VMPA 4MHEA 1KNEA 1BO0A 1O80A 1QG7A 3N52A 1AZQA 1CA6A 1ML0D 1S4ZA 1JICA 1SSOA 1PFNA 2MJ8A 2NZ1D 4ZLTF 2B2UA 5JJZA 2VXWA 1DONA 1F9QA 2K03A 1BF4A 1X3PA 4DN4M 1C8CA 3UI2A 5EQ0A 1B2TA 2JP1A 2KEEA 4LMQD 1WTRA 3KBXA 4XT1B 4CJ0B 2FMMA 5D65A 3I8ZA 1F2LA 1B50A 4HCSA 1EOTA 1MSGA 3FDTA 5E4XA 4ZK9B 1NCVA 2X6LA 1WTVA 5E4WC 3SVMA 2KEDA 1QE6A 1WTPA 4X3TA 1XYIA 2B2UC 1BNZA 1RTNA 1G2TA 1G2SA
chains in the Genus database with same CATH superfamily
2CCZA 3K81C 2R92G 1U5KA 3M4OH 2M2LA 2N78A 3KBGA 3IRBA 4DXGA 3S1RH 5KYLA 1EIGA 4DR4L 4LFAQ 5C6AA 1E22A 4FYDA 1XTCD 4NKLA 5G3LD 1LTBD 3CCLA 1K28A 2LKVA 4IJHA 1NY4A 1F77A 2A8VA 2E2IH 1TY2A 4GKJL 2UXBL 3ICEA 1SE2A 1ZXTA 2F0HA 4X64L 2WACA 4BA1I 2AQ1B 1V43A 4H0LC 1M90C 5JJLA 2NVYH 2YTVA 1SMYD 1VF7A 1FNVA 1FVIA 3I70A 4GKKL 4BBSB 1JC7A 3NBHA 5IYCG 2MO0A 4B9XA 4H13C 4DKAC 1EU4A 4PG3A 4BBSH 3NPPA 1KD1C 1VQHA 4X65L 3UDGA 1RL2A 1A3TA 1LTAD 1SDFA 3EFXD 2WFWA 5C44B 3NQTA 4J15A 3GV3A 1BCPB 4JI2Q 4JBJA 1EQVA 5I9PA 2LMCB 4QUFA 1BQQT 5M5XH 4HIMA 1WJJA 5KRUA 3HOUG 1MBYA 1L1OA 1IZ6A 5IGGA 1PMRA 3OIPA 4C3HB 4NXNL 1I3QH 4F87A 5AFWA 3TDQA 1WI5A 1RIPA 3HOWH 1E3PA 1STNA 2BDNA 2RSNA 3QO2A 4Y7NH 2EYJA 1JWMD 2YU9H 4OIKA 2VZAA 2Z6BA 1ESFA 4DV0L 3BYTB 3RD4A 2NVQB 3K5LA 1QG7A 3H09A 1Q8IA 4N8FA 2NZ1D 2BH8A 1H9KA 3UI2A 1LTID 5EQ0A 3SR1A 4DR5L 5LMNL 1SNDA 2L0CA 1KIXA 2B3GA 1IL2A 2B39A 2ATWA 4ILWA 1CI3M 4BBRG 1EIFA 4EX5A 1D8LA 1NCVA 4AYBE 1JR0D 3HOYB 1R4QB 4JPBW 4A3GH 1STHA 4LF7L 2RVLA 5K36G 2G9HD 2ID0A 3PQIA 3QOJA 1EZ8A 2K28A 5EPKA 2WP8J 3Q8DA 1AZPA 4KJNA 1UUPA 4ZRZA 3NWSA 4JVZA 3BYYB 2K01A 4DAPA 3P7JA 4E6IA 4IJLA 2KCCA 1A62A 4ZCKA 5J3BA 3OSOA 3TZDA 1JWUD 4RWSC 2D0PA 3PO2B 2IY5B 4PMBA 3SK4A 1HR0Q 1BOSA 1V9PA 2K5NA 5IT9E 4DR2L 1MI2A 4K5WA 5JJIA 4ID6A 4UP9A 1R9TB 2XRQD 4L8JA 1KDBA 3S15B 3FVQA 3K80C 3KLSX 2BE5C 4IUQA 1R9TH 2A73B 5I9OA 2DUDA 4GN3B 4QIWB 1B7YB 1KABA 1PFMA 2KHJA 1T9HA 2LXKA 3CCQA 2V1CC 2OWOA 2JXMB 4JBWA 5IP7H 3NE5B 1JCKB 3RNUA 2PNHA 4K5VA 1WCMG 2ZXPA 1ESRA 5JPNC 4EQOA 5M3MG 1FR3A 3K0XA 4LF5Q 5CMDA 1M1KC 2DNEA 2MP1A 1K8GA 5GQOA 4F8MA 2L5TA 2P5ZX 1M4VA 1IBKQ 1VQCA 1WCMB 2I46A 2WB1E 3E0EA 1E1OA 2QILA 5J22A 4R4QA 1BBXC 4GLAC 1CT1D 1NBWA 1CA6A 3Q24A 4HJAA 5D3IB 4J8QA 4JI4Q 2RF4A 1DONA 5IGCA 1BF4A 1H9JA 2IPKD 3X3MA 3JAML 1X9NA 2ENBA 2PZWA 4NMZA 3HEJA 3T56B 2EY5A 4P73A 4ME3A 1C9OA 4JI8Q 3UDXA 3MZ5A 5JOBA 4ZK9B 3K7AB 2KEDA 1YNJD 2HHHL 4X3TA 1Q46A 2QCPX 1LABA 1G2SA 2RCNA 1BXTA 1AE2A 5M5YH 1L0YB 1VQ6A 4L5RC 2J7ZA 5ELNA 1K3BC 4EQ5A 4FNFA 4X66Q 2J4XA 1VQPA 3U9SA 3J80L 1O7YA 3I4LA 1ONLA 1QZHA 2K05A 2WINB 3A8JE 2A68D 3PIO3 2R7ZG 4AH6A 4DR4Q 5AJ3L 1HNXL 3S9WA 4KTAA 3OWFA 3RLFA 2OQ0A 2BCOA 1Q1EA 2B8FA 2FJ2A 3KF8A 1RODA 1A15A 1TR5A 1W6KA 3D6WA 3GTJB 1VQKA 3MWYW 3D6CA 1XNRQ 5CGKA 3AB9A 3SK8A 3HOVG 1STAA 3GTJH 1V1OA 2QEJC 3GTLH 5C4ZA 4DV0Q 2Q2UA 2F0TA 3BZCA 1F2ZA 3A55A 4QB4A 2F3VA 4A3IH 4S3SA 1BCPC 2MNAA 1WD0A 4P75A 3B6YA 5FJ8G 2MQHA 1YEZA 3CCSA 2O5IC 2EY2A 2UUCL 1KXLA 2K32A 4HJ8A 1K0RA 1FD7D 2NZHA 4IURA 1HZBA 2EYMA 1XPOA 2ZJQA 1XTDA 2UXCL 4JI6L 1IHZA 3KYHC 4TKOB 2KHIA 1G51A 2VQFL 1EYGA 2B2YC 1I6HH 2JA5B 1CHQD 2JSOA 4LF5L 1QB5D 5GADC 1SMXA 4MHEA 1KNEA 2JA7H 1E2VA 2E2JH 2Z4IA 1JORA 2MJ8A 2PQAB 1TWFB 4K5XA 3SE0A 3K6OA 4NP5A 4ZUJA 1B8AA 4PNYA 1EU3A 3M3YB 2E2JB 4CJ0B 1HPCA 4WJWA 4HR7B 1MHWC 3KF6A 4A3MH 1KDCA 1MSGA 1ICFB 4DNRB 4NXML 1I4RA 1W2BA 3SVMA 3PIPA 3OMGA 3GDEA 3RLNA 2KOLA 2DJGC 4X65Q 2R7FA 2CH4W 2L11A 5C3XA 1RJTA 3EBEA 5ELBA 3H3VI 5JAVA 2HIVA 1EZ6A 3PUZA 3LWUA 5KIXA 1TS5A 1SBBB 3CRLC 4YIJA 5HURA 2NYZD 4B3SQ 4JI7L 5IT9c 1JOKA 1H9MA 1BDOA 1BBUA 2BE5D 1YVCA 3D8GA 4DK0A 3KLWA 2KCMA 2EJFC 3QJYA 2HQEA 4XYOA 3STBD 2CWAA 4QF4A 3EN2A 3O13A 3IKJA 4OX9Q 2E74C 2KCTA 3KK7A 3PIOA 1SRUA 2AQ2B 5F2DA 4A3IG 3IAYA 2NVYB 4RG1A 4DV3Q 1JT8A 3D3RA 3K8AA 4LF7Q 4Y52H 2MHVA 4IPHA 1EYAA 2GVAA 1QNUA 1G6ZA 3K5NA 4KKSA 1NE3A 1GHJA 4B3MQ 5E7NA 1VCIA 3ERSX 1SE8A 2AUJD 2ES2A 1CSQA 5FLXE 4QCLA 4YHHQ 1YNNC 1EQRA 2JA8H 5COYA 2VW9A 1IYJB 5C4XG 4LFCL 5C44H 2R7ZB 2Q2TA 1SLJA 1HCZA 3NXWA 2JA6G 5EPJA 1YNXA 2JA8B 3JC66 2R7ZH 4GKJQ 1TWAB 2UXBQ 1SMYC 1PA6A 1G8ZD 3U9OA 1NUCA 3F8TA 5M5WH 1DZ1A 4A3LH 5DM73 2EYFA 1X6OA 2EDGA 3KF6B 2NTSA 4F88A 3S1NH 2EVBA 5C0XG 1A8VA 1S3OA 1I3QB 1STGA 1DCZA 1X3QA 3ONAB 1XX8A 4DV3L 1FL0A 1Q86C 3CCRA 1B9NA 4G7HC 3TP5A 3SK6A 1SROA 2UXDQ 3S1RB 3I4MG 3F2BA 2CQAA 4KHPQ 4A3DB 1LTTD 2JA6B 3NK9A 3MFYA 4DF7A 5JJZA 2VXWA 2F52A 4BBSG 1F9QA 4RH6A 4DN4M 3UE1A 4IZ8A 3N6RA 1IBKL 4A3DH 4X6AH 3VYUA 4QMGA 3SK5A 5IYCH 1Y1WG 1CHPD 1EY0A 5FJ8H 1WFQA 2O2LD 1DYQA 3OTOQ 1S40A 2KQ3A 5FO8B 1PH1A 1IW7D 4JG2A 1KLUD 4GOPB 1TY0A 3VR4A 1JB7A 4WORA 3VR5A 5JEAH 1SYGA 4OWXB 4FF1A 5C0XI 4RFBA 3H0GG 3FKIB 3JAMi 4O2DA 3M9BA 3HP3A 4U673 3GTPH 4OONA 3RZOH 4U68A 1E0BA 1TQOA 1V1QA 1E24A 4ZKBB 1G6PA 3M4QA 1SE4A 4X3SA 2OTLA 3RZOB 1ET9A 4BY1H 5C4HA 2B2TA 2EYHA 2EY1A 4JI3Q 2NN6I 2PO4A 5IOCA 1IYVA 3HOUB 1RKNA 2Z9HA 2UUBL 2HDLA 1D5ZC 3SHLA 1VQLA 2OEOA 1B3AA 1UNSA 1AW7A 3T4AC 1PTOC 1QUQA 2IX1A 2N3SA 3G6EA 1K73C 2WAQB 3S1MH 3ITPA 3FEWX 1HNWQ 4FF2A 3CQZB 3EQLC 3ER0A 1JJCB 5KEEA 3S1MB 1VQ7A 4PMWA 2PMZE 4BY7B 3CQZH 4DU9A 2R6GA 4KY7A 4JI8L 1TKWB 5CBAE 4M8AA 1D1IA 3NSWA 3ND9A 3TP7A 5M3FB 2OT2A 3LWEA 1MIUA 3VA5A 4NW2A 2EOTA 3HOYH 3S14H 1PDQA 1Q7YC 5K36H 1FGBD 3VR3A 1CA5A 2YV5A 2L1BA 1PH2A 4UP7A 4DNTB 2EE1A 5ELCA 4IQZA 1L2FA 1O80A 2E2HB 3N52A 3L3OC 4DV5L 1UE6A 1PFNA 1TWGH 4ZLTF 2QDBA 3X3NA 1GO3E 2NBFA 2E2HH 3I73A 3S17H 2KA7A 1RCVD 3KBXA 4LFBQ 2HHHQ 4DV6Q 3WDNA 4R4OA 1NMGA 1B50A 1K83H 2FMCA 1A2TA 1XYIA 3S2DB 1I94Q 1RTNA 1G2TA 1QCBD 1UE7A 1VQEA 2I5HA 4DR5Q 4POGA 4X66L 3VYSA 3I4MB 4IUTA 4HMIA 4LF4L 3NBIA 5IGFA 2A6HD 1HNZL 5JVH3 3Q0AA 1GUNA 1Q12A 3I7FA 5M5YB 2Z6KC 1HZAA 1K8AC 4IPDA 2L4NA 4KI0A 4OEMB 1TU2B 2X6GA 4XQJA 3CD6A 1N33L 4N8X1 2CWPA 3BJUA 1K8MA 3A0JA 2Z6KA 4B3SL 1YITA 1E7ZA 1PRTC 4C3JG 4C1NI 1TVXA 4DAYA 2ZXOA 2NN6H 5ELOA 1PH7A 4LW1A 3MXGA 3CAMA 1I4XA 2F3IA 3A5UA 5FLMG 3W5OA 1J5EL 4JYAL 4R8IA 4GNXB 1KAWA 4HJ9A 2XWBB 4R9WA 3GTLB 2QGQA 1HNZQ 2F0FA 1W6JA 4LF4Q 3CCEA 3FKIG 1LTRD 3I2ZA 3A54A 4BWGB 2QDLA 4DGZA 5EKIA 2VS1A 4DNIA 4ZQ3A 3BDOA 1CM9A 1M8AA 2K7VA 5IWAL 1WVLA 2F4VQ 1NR2A 5J1ZA 4HIOA 1ENCA 3I4NG 2CFMA 1ENAA 4O42A 3S16H 4KHZA 1MJCA 2R93B 2KJXA 3DM3A 1Z6HA 5CV8A 3J7ZC 2A5HA 1PTOD 4X64Q 3OMCA 3G4SA 1SEBD 3AU7A 2MFIA 2UU9L 3PUYA 2HT1A 4P72A 3OW2A 2D5DA 3HOYG 3U58A 4AIMA 5C0XH 2B2VA 1ENFA 1EEID 1SNOA 2F0NA 4XQQA 1I6HB 1LUZA 1I4PA 3J80i 1RD9D 3KJOA 3PMFA 1JWSD 4LFCQ 3S1QB 1TS3A 4DAMA 5D65A 2G9DA 1SFOB 3J80E 3C46A 3CC2A 2QF7A 5L37A 3J81c 4IOCA 1S5FD 1IXRA 1WTPA 1HZCA 4A3MB 2F0JA 2IW3A 3M7GA 1N32Q 2MPMA 3AEVA 3MTSA 3OHXC 2MGSA 1NAPA 1EL0A 4GNXA 5CORA 1GVPA 3W1BA 2GVBA 2JK8A 1II3A 4DUZQ 1PFBA 3D4WA 1KHIA 2A6EC 2E2DC 4YWKA 3F2DA 4DR1Q 4FXDA 4GNXC 3H91A 3TEHB 3KDFA 1YJNA 5M3MH 4QQBX 1A3UA 1PH3A 2F0PA 2FHTA 1DD2A 4KN7C 5DAUA 4MZ9A 2E8GA 1VQFA 3SDZA 4RGOS 3BU2A 4YCWA 4OO1H 3VYRA 4C2MB 4J1MA 5FK9C 2HCIA 2IX3A 4JI2L 1PRTB 2ICEC 2CH4A 3PV0A 4DAVA 3OW7A 3EIVA 4GN5A 1O7IA 2AUKA 4RA8A 3HKSA 2K52A 2N88A 3I91A 1IBMQ 4PMCA 4A3KH 4DAYB 4AQYL 4IUVA 1WYDA 3M3YH 5T1IA 1ILQA 2VY3A 3D31A 2LS01 1PH9A 1V1PA 3BZDB 4A3KB 3NTKA 4IUPA 3J81L 2D9UA 5IIFA 1X32A 2EYOA 3HFZB 1SJED 4TRDA 2D2CC 2WKDA 5M5WB 4UAIA 2UXDL 1F9SA 2RSOA 2M00A 3Q6SA 3T1HQ 3S1NB 5BN3A 2KVMA 1EY7A 1EWIA 3J80c 1EY5A 1I4HA 1YNND 3I72A 3RN2A 4C3IB 5CV7A 3AYHB 5IYBH 1IBLQ 5EGTA 3BVZA 4LF9Q 1PTOF 2KEEA 3CF5A 4OWWB 4XT1B 2JA6H 3L0OA 1I50B 3I8ZA 1F2LA 2RDGA 4MIUA 2K4KA 1D6EC 1Y1VG 3GP7A 1STEA 3IFTA 3KDFB 4N9TA 4OIJA 1Q81C 4IUNA 3GTMB 4HMJA 4HSPA 2B2TC 4KY6A 5EBCA 4B3RL 1PRTD 2KCNA 4JI0L 2PQAA 4CJ2C 2MUYA 3HOVH 1UE5A 2H1EA 3LGJA 5DNFA 1EY4A 2JEBI 4P71A 2TMPA 1Y8NB 5IYDH 3G7LA 5IODA 3MA2B 2A1AA 4L5QA 3HKZB 4XT3B 4JC0A 3V2TA 4C3HG 2K5HA 1Z47A 4BXXH 4DR7L 4DV2L 5C4JH 3OIQA 1SNCA 2KECA 3W3AA 1K3RA 5C3EB 1TWAH 2OQKA 2IX0A 5LL6X 5A35A 2WAQE 5IGEA 3HOUH 3M7NA 4TVAB 5C3EH 4V0BA 4A3FH 4LF6L 3HOWB 1T5XD 1FGUA 2SDFA 3NTHA 1JE5A 2LFNA 4JI5Q 4OGQC 4A3FB 2XRSD 2ASBA 2RHQB 1GKHA 5KNDA 5EKLA 3R2IA 1PH4A 1NJIC 2N55A 4A3EG 1EWHA 2PI2A 1BKBA 2XTIA 3GTOB 3ULJA 3Q22A 4F7XA 4TQUS 5C5LA 2GA4B 1PLFA 5CBEE 1K8OA 3FP9A 1DJRD 4KKTA 1YI2A 1IKLA 2PW5A 2B2WA 2RDHA 4A3FG 1BUVT 4DR7Q 3C1FA 1LTSD 3MEHA 1GUWA 3R93A 3CP0A 4CDEC 4YCUA 4JI1L 2E75C 2F1MA 3QOLA 5IY0A 4A3GB 3D4RA 3K59A 5KNBA 5M3FH 2UUBQ 4GOPA 2E5LL 1Q90A 3GO5A 3CCVA 1ASZA 2EIFA 3FPUB 2K6AA 3PO3G 2CKZB 1BO0A 1R4PB 3BVGA 3SXHA 3T51B 1KRSA 3UDFA 5I2YA 1JICA 1X3FA 5FO9B 1FNWA 4B08A 3VR2A 4R4TA 4HJ5A 4BY1B 2Z0SA 3NHHA 1TWGB 1PH6A 5EAYA 1D5XC 3PO3B 2VUMG 4V190 3S17B 5E4WC 4QIWE 4MTKA 2F3WA 3PSIA 4A3MG 1STBA 1K83B 5ELFA 3S2DH 2L12A 5C0XJ 1VDZA 5IP9G 4KD4A 2Y0SB 4X62L 1S5ED 3T1HL 4CBVA 3I4MH 2CQOA 1EIYB 3DHQA 3I3CA 3URYA 4WRDA 4R4CA 3IL8A 1MSHA 4JOIA 3GTGH 1LT5D 1L0WA 4CHTB 1XNRL 1WTHA 4K6DA 5D14A 3HOZB 3EJIA 1KLGD 1B1ZA 3L7ZC 1YZ6A 2JQOA 1C48A 2AQ3B 1LO5D 4KD3A 1FJGL 1N36L 4JV5Q 1J9OA 4PZ7A 4HSVA 1I94L 4BXXG 1TS4A 1Y69U 1D7QA 2EQSA 3ZJYC 4LF8L 1XWEA 1VQ8A 3PUVA 1GUTA 2RCFA 4GS3A 1LACA 2EZVA 1CSPA 4I7AA 4YY3Q 2F0VA 3MXUA 3U50C 1PFSA 5CV5A 5JVG3 1PXUA 4OO1I 5IT9L 2OF1A 4PZ8A 3EVQA 1XJVA 3KLRA 5IGDA 2XWJB 4WFN3 1CKNB 4EVOA 3PUXA 2XNAC 1VQDA 5C3WA 2Q8RE 4O0AA 4IUUA 4MNOA 4B3RQ 1IL8A 1EIHA 5JEAJ 1VQJA 2WAQG 1EFID 4Q5VA 3NUCA 1HUNA 2FFKB 1NR4A 1EYDA 1I4QA 4NDXA 5FLXL 3OPOA 1KAAA 4P74A 1S4ZA 4GOPC 1SYCA 3GTKB 4IN3A 1PH5A 2JP1A 4LMQD 1DXMA 1EEFD 1I6VC 3CCJA 5LMUQ 1KC8C 1X65A 3M85A 1IBLL 2F4VL 1KL9A 1BCPD 4KHVA 3S1QH 2EJMA 1XMQL 2HIXA 2X6LA 4PQXA 1U0LA 4EGVA 1QE6A 5NUCA 5I6WA 3U4VA 3QG1A 4CDFC 1LT4D 1OXSC 4QGUA 4IPCA 3JAME 2HDMA 2JA7G 2O5JC 4C1NK 2H4OA 4CKEA 3S24A 3J7A5 1IW7C 2PZUA 4DV1Q 4KHPL 1S5DD 1TWCH 4FXKC 4DR3L 3HGBA 1FYCA 2WV6D 3BS1A 1B70B 4PV1C 3V96A 2CVRA 2OTJA 3TZUA 1X3GA 4PZ6A 4BY1G 2VQEL 4A3JH 2R3ZA 3P75A 1XPRA 1DOMA 2FINB 1LTGD 4JOIC 4JBMA 1PVOA 1C4QA 3NENA 1X54A 3VDYA 3MC0B 3TREA 2ZT9C 3H0GH 1Z9FA 1MGSA 3CPFA 3RUZA 3TP8A 2F0UA 1YJ9A 3IFDA 2JA5H 1CZGA 1JJGA 1EY6A 3H0GB 4RKLA 4KLKA 3BDLA 3KF8B 1J5EQ 4JYAQ 1YJWA 4MN3A 1HJPA 1DOKA 2JYOA 2CW0D 4ZAIA 3I90A 4DV6L 4XYQA 5FOBB 3F2UA 2XIWA 4MTNA 2HD3A 2K5VA 5EPLA 1DGSA 4DR6L 2V4DA 1DOLA 2KUMA 4A3EH 3C3LA 3I55A 1D1KA 1A63A 1N9WA 2B8GA 4FVMA 5HGTA 4OX9L 2UUAL 1A3VA 5BN5A 3QB3A 3RZDH 5C5MA 4AYBB 2I5MX 3E9IA 1S5CD 3T53B 1D5MC 4BS9A 2ZTDA 1I5FA 2F0WA 2K1BA 5HY6A 1CTMA 2QEXA 2Z4HA 4YWLA 4CDDC 1H9SA 3CC4A 5M5XB 1L1OB 1X3PA 4DV7Q 1B2TA 2E5LQ 1TT2A 4C3IH 3WOEA 4C3HH 4K2KA 4A4IA 3GD7A 3J81E 1FJGQ 3RN5A 3E0JA 1OXUA 2A19A 3HKZG 3FMCA 2DY8A 4RHRA 3KUPA 2J0TD 3FRPB 3G48A 3HG9A 5FO7B 3NBHB 4LF8Q 2R7DA 1PH8A 1WTXA 1GJXA 4DUYQ 2R93G 5KNCA 3GTMH 2PZTA 4HAEA 1CQFA 2IT1A 1QNKA 4UDUC 3P20A 1SJHD 1YHQA 1AN8A 2HCCA 1Q1BA 1LYLA 4K6LA 4G7OC 2VQEQ 2WB1B 1Q82C 2C35B 4NXNQ 2F0GA 5CC4A 4ULLA 2I0QA 2N8NA 1L0XB 3K57A 4R1JA 4DK1A 1ASYA 1AE3A 5IYBG 4RCNA 2ZJPA 3H3VH 3I56A 5C4JB 1PTOB 4C3JH 1N34Q 3CMAA 2IL8A 2YTXA 3G71A 3NTIA 3SEBA 2Q8IB 2NVTH 3K58A 4IOAA 1VF5C 4HIKA 2RBMA 4I7ZC 4JBKA 4DV4Q 4IFDG 2NVTB 1N36Q 4JV5L 3CHBD 1ZKOA 4R4IA 4XXEA 1UWVA 1VQ4A 3C1EA 3GTOH 1G91A 4KJOA 1LT3D 2A69C 3KOJA 1SNMA 1GM5A 1DM0B 3ND8A 1YHBA 3VA7A 4B3TQ 3E9HA 3S15H 2I07B 3TBIB 2VUMB 4A3BG 2B63H 2L15A 1ZYRC 3F2CA 3OOCA 4RHSA 3MXPA 4K8JA 1STYA 2LSSA 5CYUA 1MD2D 4LFAL 2L55A 5CV6A 2Q2HA 3ULPA 1C0AA 3FKIH 3QIAA 2BA1A 1ZEQX 3GTPB 2RQXA 4EQPA 1PRTF 3K5OA 1ML0D 2CW0C 2I5LX 3FPPA 4K14A 3QWNA 4JI5L 3VYTA 3D4DA 3TRZA 3MHBA 4G57A 3FHWA 1EQQA 1EOTA 5BR8Q 1BNZA 2B2UC 2ICIA 1LM0A 5FKAC 1VMCA 1TS2A 5A2QL 1PZJD 3G6JB 1PYWD 4RAUC 3J81j 4B3ML 2BOSA 5J39A 4L63B 2JN4A 1QUQB 2QW7A 4LUOA 3H6MA 5DM63 4AYBG 2RDFA 2L9HA 1U9RA 2AMCB 4JI0Q 3KFUA 1AP0A 4KN4C 4YWMA 3K5MA 1ICWA 3CCUA 5GROA 2GN5A 4IFDH 5T1GA 4UHVA 3AQQA 1QVFA 1HUMA 5KGUA 5A2QE 1IYUA 2ZXRA 1HTLD 4BA2I 1HFNA 2XN9C 1WTQA 1U4LA 4NXMQ 2PQEA 4IO9A 1HNWL 3PF5A 1AFPA 4JW0A 3HOZH 4R8NA 4LUZA 3EROA 3CU7A 3DWAA 4DV4L 3DEOA 1Y14B 4K2LA 1E2WA 4FXGC 1E1TA 1O78A 2F0OA 4FDBA 2K5QA 5C4XH 4K8IA 2TSSA 3A7LA 2JJQA 1JOQA 2K50A 2K04A 5C4XB 3J81i 4Z9CB 3OTOL 1H9SB 3I4NB 2K5DA 2FXQA 2NWGA 3M4YA 2SEBD 3TN2A 2JEAI 4M1UB 4A3BB 2LXJA 1S5BD 4POFA 3D0FA 4DFAA 5I6YA 4A76A 1VQMA 3PF4A 1HH2P 3QR8A 3HRZC 1YIJA 1A0IA 4HCEA 2PPBC 4A3BH 1IKMA 1NTGA 4DK3C 1KRTA 4H44C 1GXDC 3TS0A 4OELB 1B3QA 3ZYYX 5CV9A 2KENA 2HQLA 1MJEA 3CKIB 5FLMH 1HNXQ 4FF4A 4B3TL 2IJ0A 2IHFA 2NN6G 1N8RC 1B9MA 1CUKA 5CV4A 3W1GA 4A3JG 3GTGB 4OHJA 1X55A 3RR5A 1KTKA 4KK7A 1EY9A 3MAQA 1LLRD 3PIP3 3BG3A 4WJ4A 4X3UA 3WOFA 1PYSB 4ODGA 3ERQA 4LFBL 1F9PA 1HR0L 4JI1Q 4APVA 3EA6A 2Y0SG 1H9RA 2VQFQ 1PHJA 2DNCA 2K5WA 4QJFA 2JA8G 3A8IE 3HOXH 2YTYA 1XXGA 3GV6A 1SYEA 3JAMc 4BBRB 4KMUC 2VB3X 4LF9L 1Y1WB 2C9OA 1TWCB 1HQRD 3R2TA 1SAPA 4ZUIA 2JA5G 2B29A 3P1HA 4YHHL 4I65A 1Y1WH 4DA2A 3CMEA 2R93H 3TSSA 4DK6C 3H15A 1IBML 3ULLA 2B2WC 1HA6A 3PCOB 4NPSA 1N33Q 1UE1A 5IWAQ 3UDIA 1UEAB 2NTTA 1AH9A 2EXDA 1N32L 1QJOA 4A3GG 1OO9B 1SNQA 5LMNQ 5ISRA 1BBWA 2K75A 1KNAA 2WB1G 1N34L 1X3EA 4YCVA 4C3IG 4B9WA 3A74A 4RGMA 1VQ9A 1ZYRD 1VQIA 2H5XA 1VQBA 3GTKH 3HOZG 1J6QA 2XGTA 1JOOA 2NVXH 2Y0SE 3OWEB 2DY7A 2A68C 5TSSA 1E2ZA 4A75A 5E1FA 4DR1L 2NVXB 1Y1VH 1SN8A 1RHPA 4JCVE 4A3EB 5C44G 3R8BA 4O1NA 4XTCS 4QUCA 2G5DA 3PO2G 1CZWA 3STBC 1AZQA 5BN4A 3RZDB 1SYBA 2UU9Q 1Z7TA 1SSOA 3L2PA 2UXCQ 5JJKA 3DMUA 2K03A 4JK1C 4NB3A 4J6HA 1EY8A 4LK1C 2FMMA 1BCPF 4DR2Q 3TQYA 1JJ2A 2JE6I 1S72A 2O4XA 3M4OB 4KY5A 1WTVA 2SNSA 4A3JB 3T1YL 3NP8A 1GUGA 4P2CB 2EYPA 2JA9A 3E3XA 1UEBA 1W3SA 2EXZA 4L5SA 3CPWA 4A3KG 2EJGC 2DGYA 4C2MH 2NVQH 4H7BA 2E2IB 4DV2Q 1VQAA 1HQMC 3GTQH 1G291 3J7AF 2D0OA 1O7ZA 2EYLA 1C7YA 1WTOA 3GTQB 4IFDI 1K0SA 1O7LA 4UY8C 2EY6A 3A5ZB 1TWHH 2Q8TA 1QVGA 1HFGA 1U4PA 4DV1L 2DN8A 1TWHB 1HR0W 1VS0A 3HZXA 4FP5D 1XMOL 2A69D 4GLXA 4C3JB 1V8QA 1K9MC 2LY7A 3CXCA 3HKZE 1LV9A 3M4PA 1GUSA 3NQIA 2AWNA 2HUGA 4A3LG 4FF3A 3DWPA 3E5SA 3GQBA 3V05A 2K14A 1Y8PB 4QL5A 1OXVA 2B2VC 2ZM6L 1EQTA 3CRKC 1XMQQ 1HRJA 2R61A 5AJ3Q 1QILA 1I50H 2PI2E 4Y7NB 2QKIC 2A74C 4CKCA 2BA0A 2YU9B 1LT6D 3DXJC 5CR3A 3A56A 5JEAG 2C5CA 1GD7A 4ZKCB 3KLSA 1JMCA 4HIDA 3H3VC 4CJ1B 1VMPA 3DLLA 4DR6Q 2VUMH 2VNUD 4UPAA 1QWYA 1HZ9A 4G7ZC 1XNQL 5EKKA 3J7YW 4LUVA 1D2BA 3CC7A 1VQGA 4A3DG 2B2UA 1OTCA 4BY7H 2DJFC 1X56A 4OL7A 3HOVB 3MXNA 4A3CH 3CCMA 4G4KA 4ZYSA 2YYZA 4DUYL 5I4DA 2F4IA 2ZJRA 3PGZA 1SYDA 5E3FA 5IYDG 4GN4B 2CHBD 2KHSA 4DXFA 5HGQA 3S14B 3A8KE 2WKCA 1J8IA 5M3FG 1PTOH 1WCMH 1BVSA 2K33A 1JE4A 3TP6A 4HEDA 3K7UC 1VQNA 1H95A 2IHEA 1BR9A 4HN7A 4LWCA 1EOVA 4WJ3M 3RMHA 2M9VA 4OXPA 4HJ7A 3KJPA 3A7AB 3PO2H 1RTOA 5D3DA 1XNQQ 4H02A 1UAPA 1AEXA 2A6ED 2RA4A 1HA5A 1QOHA 1GOZA 2PYKA 4EQNA 1TIID 4IALA 5EJWA 5KYIA 3NWTA 3K7AH 1EWCA 3HOWG 2BH2A 1YNJC 2UUAQ 2NUCA 5DEHA 5IP9H 1B53A 3L9AX 5C3EG 4YY3L 5EBDA 1B4OA 4RCOA 2B63B 3TS2A 1WTWA 1LTLA 1JB3A 3U4ZA 1VQOA 1F2YA 1RDPD 1WOCA 2ZM6Q 1MKHA 3Q23A 1CFMA 4DV7L 3DEPA 3W2DA 4RKBA 3NEMA 1SR3A 5GAHC 1OXXK 3AFQA 2A6HC 1A2UA 3LX0A 2VB2X 3DUZA 3MXNB 3CW2C 2B2YA 4L5TA 1PZID 3PO3H 3I4NH 5LHY1 5IP7G 4CGYB 1NMFA 3C2PA 1P16A 1PZKD 5GAEC 4K0KL 1GUOA 1YBYA 1Y8OB 5M9OA 2B63G 1SXTA 1KQSA 2Z1CA 4OO1G 4UP8A 4LNQA 3HOXG 2NB0A 2Z8LA 1Q8KA 4ME5A 1SE3A 4FO2A 1HTPA 5K5PA 4DR3Q 3R3OA 2IWHA 3BZKA 5ELDA 1CKNA 2PMZB 2BDOA 2F0QA 5G3LF 1WTRA 3OYYA 3S16B 3DWQA 3T16A 1RF2D 4HCSA 3MVVA 2VL6A 4LAAA 2F0IA 1B44D 4DV5Q 1SYFA 1OXTA 3T13A 4X62Q 2QA4A 4CKBA 2AWOA 3RLOA 3T1YQ 2SNMA 2F0LA 1PYBA 3DM1A 1XPUA 4QY7A 4ALPA 2JA7B 2F0KA 1GHKA 5GAGC 1Q3LA 4DPGA 2WIIB 2E76C 1QVCA 1EYCA 4JI3L 1CKOA 4L6TB 3UE0A 2PW7A 5FLXc 3MEFA 1SFOH 1T5EA 5H1SE 1HHVA 3I4OA 5IGBA 4KV6A 5LL6S 2MO1A 4BBRH 1HXYD 1VQ5A 2AHOB 3VR6A 1ILPA 4JI6Q 4XDXA 2RKSA 3AFPA 4A3IB 1V1PB 1F2MA 3AMUA 2F0DA 2PNRC 2OCEA 2XSCA 2KBNA 4LJZC 1I4GA 4OWTB 3NELA 4Q0FA 1TXYA 2EPBA 2F0MA 1U4MA 2D62A 4A93G 1JQYD 1NNXA 4GKKQ 4XIGS 5LMUL 4KKUA 1WD1A 1EFWA 4CDCC 3LNNA 4A93H 2N49A 1A6XA 5DLQE 4IFDJ 3S2HH 1F9RA 4XQNA 5BR8L 2F0SA 1U4RA 4K0KQ 4A93B 2PCFB 5M3MB 3E6ZX 4RMFA 3S2HB 1ET6A 4BY7G 4A3CG 5IE8A 3SGIA 3MFGA 4X3KA 4RGNA 2AKWB 2R92H 2ZTCA 2Q2IA 2OXPA 3TMEA 3BVMA 2F0EA 4C56C 2XVSA 4ABNA 1CKMA 3K0YA 2R92B 2X69A 3H94A 2UUCQ 1PV4A 1EUJA 1SNPA 4GLVB 4LF6Q 4IPGA 4DUZL 1Y1VB 5ELEA 4JI7Q 2SOBA 3BDCA 4JI4L 4TSSA 1KDAA 1TWFH 1P8LA 4GZYC 2F03A 1L1OC 2RHSB 1YHAA 3PUWA 1CQVA 4N9PA 3WWVA 2NZOA 3F1ZA 1C8CA 3HOXB 3HS0C 1CK1A 1NSNS 3J7AV 1FNUA 2ALYB 5LMNW 5JPMC 4HTHA 4AQYQ 3FDTA 5E4XA 1QZGA 2ZTEA 5I2XA 1XMOQ 4RGTA
chains in the Genus database with same CATH topology
2M2LA 3KBGA 4DXGA 5KYLA 1EIGA 5C6AA 4FYDA 1XTCD 4NKLA 5G3LD 1LTBD 2LKVA 1F77A 1TY2A 1SE2A 1ZXTA 2F0HA 2WACA 4BA1I 2AQ1B 1V43A 4H0LC 1SMYD 1VF7A 1FNVA 3I70A 4BBSB 1JC7A 3NBHA 4B9XA 4H13C 1EU4A 3NPPA 1A3TA 1LTAD 1SDFA 3EFXD 5C44B 3NQTA 3GV3A 1BCPB 1EQVA 5I9PA 2LMCB 4QUFA 1BQQT 5KRUA 1MBYA 5IGGA 1PMRA 3OIPA 4C3HB 4F87A 5AFWA 3TDQA 1STNA 2BDNA 2RSNA 3QO2A 2EYJA 1JWMD 4OIKA 1ESFA 3BYTB 3RD4A 2NVQB 3K5LA 1QG7A 3H09A 1Q8IA 2NZ1D 1H9KA 3UI2A 1LTID 5EQ0A 3SR1A 1SNDA 2L0CA 2B39A 4ILWA 1CI3M 1NCVA 1JR0D 3HOYB 1R4QB 1STHA 2RVLA 5K36G 2G9HD 2ID0A 3QOJA 1EZ8A 2K28A 5EPKA 2WP8J 1AZPA 4KJNA 1UUPA 4ZRZA 3NWSA 3BYYB 2K01A 4DAPA 3P7JA 4E6IA 2KCCA 3OSOA 3TZDA 1JWUD 4RWSC 3PO2B 4PMBA 3SK4A 1BOSA 5IT9E 1MI2A 4K5WA 4ID6A 1R9TB 2XRQD 4L8JA 1KDBA 3S15B 3FVQA 3KLSX 2BE5C 4IUQA 2A73B 5I9OA 4QIWB 1KABA 1PFMA 2JXMB 4JBWA 3NE5B 1JCKB 4K5VA 2ZXPA 1ESRA 5JPNC 4EQOA 1FR3A 5CMDA 2DNEA 2MP1A 4F8MA 2L5TA 1M4VA 1WCMB 2I46A 2QILA 5J22A 1BBXC 1CT1D 1CA6A 3Q24A 5D3IB 4J8QA 1DONA 5IGCA 1BF4A 1H9JA 2IPKD 3X3MA 3JAML 2ENBA 2PZWA 4NMZA 3HEJA 3T56B 2EY5A 3MZ5A 5JOBA 4ZK9B 3K7AB 2KEDA 1YNJD 4X3TA 2QCPX 1LABA 1G2SA 1BXTA 1L0YB 2J7ZA 4FNFA 2J4XA 3U9SA 3J80L 1O7YA 3I4LA 1ONLA 2K05A 2WINB 3A8JE 2A68D 3PIO3 3S9WA 4KTAA 3OWFA 3RLFA 2BCOA 1Q1EA 2B8FA 2FJ2A 3KF8A 1RODA 1A15A 1TR5A 1W6KA 3GTJB 3D6WA 3MWYW 3D6CA 5CGKA 3AB9A 3SK8A 1STAA 1V1OA 2QEJC 5C4ZA 2F0TA 1F2ZA 3A55A 4QB4A 2F3VA 4S3SA 1BCPC 1WD0A 2O5IC 2EY2A 2K32A 1FD7D 4IURA 2EYMA 1IHZA 4TKOB 2B2YC 2JA5B 1CHQD 2JSOA 1QB5D 4MHEA 1KNEA 1E2VA 2Z4IA 1JORA 2MJ8A 1TWFB 4K5XA 3SE0A 3K6OA 4NP5A 4ZUJA 4PNYA 1EU3A 3M3YB 2E2JB 4CJ0B 1HPCA 4WJWA 4HR7B 1KDCA 1MSGA 4DNRB 1I4RA 3SVMA 3OMGA 2KOLA 2L11A 5C3XA 1RJTA 5ELBA 5JAVA 1EZ6A 3PUZA 3LWUA 5KIXA 1TS5A 1SBBB 3CRLC 4YIJA 5HURA 2NYZD 1JOKA 1H9MA 1BDOA 2BE5D 3D8GA 4DK0A 2EJFC 3QJYA 2HQEA 4XYOA 4QF4A 3O13A 3IKJA 2E74C 3KK7A 2AQ2B 5F2DA 3IAYA 2NVYB 3D3RA 2MHVA 1EYAA 1QNUA 1G6ZA 3K5NA 4KKSA 1GHJA 1VCIA 2AUJD 5FLXE 4QCLA 1YNNC 5COYA 2R7ZB 1HCZA 3NXWA 5EPJA 2JA8B 1TWAB 1SMYC 1G8ZD 3U9OA 1NUCA 1DZ1A 5DM73 2EYFA 2EDGA 2NTSA 4F88A 2EVBA 5C0XG 1I3QB 1STGA 1DCZA 1X3QA 3ONAB 1XX8A 1B9NA 4G7HC 3TP5A 3SK6A 3S1RB 2CQAA 4A3DB 1LTTD 2JA6B 3NK9A 3MFYA 4DF7A 5JJZA 2VXWA 1F9QA 4RH6A 4DN4M 4IZ8A 3N6RA 3VYUA 4QMGA 3SK5A 1CHPD 1EY0A 2O2LD 1DYQA 2KQ3A 5FO8B 1IW7D 1KLUD 1TY0A 3VR4A 4WORA 3VR5A 5JEAH 1SYGA 4FF1A 5C0XI 4RFBA 3FKIB 3HP3A 4U673 4U68A 1E0BA 1TQOA 4ZKBB 1SE4A 4X3SA 3RZOB 1ET9A 5C4HA 2B2TA 2EYHA 2EY1A 2NN6I 2PO4A 5IOCA 1IYVA 3HOUB 1RKNA 2HDLA 1D5ZC 3SHLA 2OEOA 1B3AA 1UNSA 1AW7A 3T4AC 1PTOC 2IX1A 2WAQB 3ITPA 3FEWX 4FF2A 3CQZB 3EQLC 5KEEA 3S1MB 4PMWA 4BY7B 4DU9A 2R6GA 4KY7A 1TKWB 5CBAE 4M8AA 1D1IA 3NSWA 3ND9A 3TP7A 5M3FB 2OT2A 3LWEA 3VA5A 4NW2A 2EOTA 1PDQA 5K36H 1FGBD 3VR3A 1CA5A 2L1BA 4DNTB 2EE1A 5ELCA 4IQZA 1O80A 2E2HB 3N52A 3L3OC 1PFNA 4ZLTF 2QDBA 3X3NA 2NBFA 3I73A 2KA7A 1RCVD 3KBXA 3WDNA 1B50A 2FMCA 1A2TA 1XYIA 3S2DB 1RTNA 1G2TA 1QCBD 3VYSA 3I4MB 4IUTA 4HMIA 3NBIA 5IGFA 2A6HD 5JVH3 3Q0AA 1GUNA 1Q12A 5M5YB 2L4NA 4KI0A 1TU2B 2X6GA 4XQJA 1K8MA 1PRTC 4C3JG 4DAYA 4C1NI 1TVXA 2ZXOA 2NN6H 3MXGA 1I4XA 4R8IA 2XWBB 4R9WA 3GTLB 2F0FA 1W6JA 1LTRD 3A54A 4BWGB 4DGZA 5EKIA 4ZQ3A 3BDOA 1CM9A 1WVLA 1M8AA 2K7VA 1NR2A 5J1ZA 1ENCA 1ENAA 4O42A 4KHZA 2R93B 2KJXA 5CV8A 1Z6HA 2A5HA 1PTOD 3OMCA 1SEBD 3AU7A 3PUYA 2D5DA 5C0XH 2B2VA 1ENFA 1EEID 1SNOA 2F0NA 4XQQA 1I6HB 1I4PA 1RD9D 3PMFA 1JWSD 3S1QB 1TS3A 5D65A 2G9DA 1SFOB 3J80E 3C46A 2QF7A 1S5FD 1WTPA 4A3MB 2F0JA 2IW3A 3M7GA 2MPMA 3MTSA 3OHXC 2MGSA 1NAPA 1EL0A 5CORA 1II3A 1PFBA 3D4WA 2A6EC 2E2DC 4FXDA 3H91A 1A3UA 2F0PA 2FHTA 1DD2A 4KN7C 5DAUA 3SDZA 4RGOS 4OO1H 3VYRA 4C2MB 4J1MA 5FK9C 2HCIA 2IX3A 1PRTB 2ICEC 3PV0A 4DAVA 3OW7A 2AUKA 4RA8A 2N88A 3I91A 4PMCA 4IUVA 5T1IA 1ILQA 3D31A 2LS01 1V1PA 3BZDB 4A3KB 3NTKA 4IUPA 3J81L 2D9UA 5IIFA 1X32A 2EYOA 1SJED 4TRDA 2D2CC 2WKDA 5M5WB 4UAIA 1F9SA 2RSOA 2M00A 3Q6SA 3S1NB 5BN3A 2KVMA 1EY7A 1EY5A 1I4HA 1YNND 3I72A 4C3IB 5CV7A 5EGTA 3BVZA 1PTOF 2KEEA 4XT1B 1I50B 3I8ZA 1F2LA 2RDGA 4MIUA 1D6EC 3GP7A 1STEA 3IFTA 4N9TA 4OIJA 4IUNA 3GTMB 4HMJA 4HSPA 2B2TC 4KY6A 5EBCA 1PRTD 2KCNA 4CJ2C 2MUYA 2H1EA 5DNFA 1EY4A 2JEBI 2TMPA 1Y8NB 3G7LA 5IODA 3MA2B 3HKZB 4XT3B 4C3HG 3V2TA 1Z47A 3OIQA 1SNCA 2KECA 3W3AA 5C3EB 2IX0A 5LL6X 5A35A 5IGEA 3M7NA 4V0BA 3HOWB 1T5XD 2SDFA 3NTHA 2LFNA 4OGQC 4A3FB 2XRSD 5KNDA 5EKLA 3R2IA 2N55A 1EWHA 3GTOB 3Q22A 4F7XA 4TQUS 5C5LA 2GA4B 1PLFA 5CBEE 1K8OA 1DJRD 4KKTA 1IKLA 2PW5A 2B2WA 2RDHA 1BUVT 3C1FA 1LTSD 3MEHA 1GUWA 3R93A 2E75C 2F1MA 3QOLA 4A3GB 3D4RA 3K59A 5KNBA 1Q90A 3GO5A 3FPUB 2K6AA 1BO0A 1R4PB 3BVGA 3SXHA 3T51B 5I2YA 1JICA 5FO9B 1FNWA 4B08A 3VR2A 4BY1B 3NHHA 1TWGB 1D5XC 3PO3B 4V190 3S17B 5E4WC 2F3WA 1STBA 1K83B 5ELFA 2L12A 5C0XJ 1VDZA 4KD4A 2Y0SB 1S5ED 4CBVA 3DHQA 3I3CA 3URYA 4WRDA 3IL8A 1MSHA 1LT5D 4CHTB 4K6DA 5D14A 3HOZB 3EJIA 1KLGD 1B1ZA 3L7ZC 1C48A 2AQ3B 1LO5D 4KD3A 1J9OA 4HSVA 1TS4A 1Y69U 1XWEA 3PUVA 1GUTA 1LACA 2EZVA 2F0VA 3MXUA 5CV5A 5JVG3 1PXUA 4OO1I 5IT9L 2OF1A 3EVQA 3KLRA 5IGDA 2XWJB 4WFN3 4EVOA 3PUXA 2XNAC 5C3WA 2Q8RE 4IUUA 1IL8A 1EIHA 5JEAJ 1EFID 4Q5VA 3NUCA 1HUNA 2FFKB 1NR4A 1EYDA 1I4QA 4NDXA 5FLXL 3OPOA 1KAAA 1S4ZA 1SYCA 3GTKB 4IN3A 2JP1A 4LMQD 1DXMA 1EEFD 1I6VC 3M85A 1BCPD 4KHVA 2EJMA 2X6LA 4PQXA 4EGVA 1QE6A 5NUCA 5I6WA 3QG1A 1LT4D 1OXSC 3JAME 2HDMA 2O5JC 4C1NK 2H4OA 4CKEA 1IW7C 2PZUA 1S5DD 4FXKC 3HGBA 1FYCA 2WV6D 3BS1A 4PV1C 3V96A 2CVRA 3TZUA 2R3ZA 3P75A 1DOMA 2FINB 1LTGD 1C4QA 3MC0B 2ZT9C 1MGSA 3RUZA 3TP8A 2F0UA 3IFDA 1CZGA 1EY6A 3H0GB 4RKLA 3BDLA 4MN3A 1DOKA 2JYOA 2CW0D 4ZAIA 3I90A 4XYQA 5FOBB 3F2UA 2XIWA 5EPLA 2V4DA 1DOLA 2KUMA 3C3LA 1D1KA 2B8GA 4FVMA 5HGTA 1A3VA 5BN5A 3QB3A 5C5MA 4AYBB 1S5CD 3T53B 1D5MC 4BS9A 2F0WA 2K1BA 1CTMA 2Z4HA 1H9SA 5M5XB 1X3PA 1B2TA 1TT2A 3WOEA 4K2KA 3J81E 3GD7A 3E0JA 1OXUA 3FMCA 2DY8A 4RHRA 3KUPA 2J0TD 3FRPB 3HG9A 5FO7B 1WTXA 1GJXA 5KNCA 2PZTA 4HAEA 1CQFA 2IT1A 1QNKA 4UDUC 3P20A 1SJHD 1AN8A 2HCCA 1Q1BA 4K6LA 4G7OC 2WB1B 2F0GA 5CC4A 4ULLA 1L0XB 3K57A 4DK1A 4RCNA 5C4JB 1PTOB 2IL8A 3NTIA 3SEBA 2Q8IB 3K58A 1VF5C 2RBMA 4I7ZC 4IFDG 2NVTB 3CHBD 1ZKOA 4XXEA 3C1EA 1G91A 4KJOA 1LT3D 2A69C 1SNMA 1DM0B 3ND8A 3VA7A 2I07B 3TBIB 2VUMB 1ZYRC 3OOCA 4RHSA 3MXPA 4K8JA 1STYA 5CYUA 1MD2D 2L55A 5CV6A 3QIAA 2BA1A 1ZEQX 3GTPB 2RQXA 4EQPA 1PRTF 3K5OA 1ML0D 2CW0C 3FPPA 4K14A 3QWNA 3VYTA 3D4DA 3MHBA 4G57A 1EOTA 1BNZA 2B2UC 2ICIA 5FKAC 1VMCA 1TS2A 5A2QL 1PZJD 3G6JB 1PYWD 4RAUC 2BOSA 5J39A 4L63B 5DM63 3H6MA 2RDFA 2L9HA 1U9RA 1AP0A 4KN4C 3K5MA 1ICWA 4IFDH 5T1GA 1HUMA 5KGUA 5A2QE 1IYUA 2ZXRA 1HTLD 4BA2I 1HFNA 2XN9C 1WTQA 1U4LA 2PQEA 1AFPA 4R8NA 3EROA 3CU7A 3DWAA 3DEOA 1E2WA 4K2LA 4FXGC 1O78A 2F0OA 2K5QA 4K8IA 2TSSA 3A7LA 1JOQA 2K04A 5C4XB 4Z9CB 1H9SB 3I4NB 2K5DA 2NWGA 3M4YA 2JEAI 3TN2A 2SEBD 4M1UB 4A3BB 1S5BD 4DFAA 5I6YA 3HRZC 4HCEA 2PPBC 1IKMA 4H44C 1GXDC 3ZYYX 5CV9A 3CKIB 4FF4A 2IJ0A 2NN6G 1B9MA 5CV4A 3GTGB 4OHJA 1KTKA 4KK7A 1EY9A 3MAQA 1LLRD 3PIP3 3BG3A 4X3UA 3WOFA 4ODGA 3ERQA 1F9PA 3EA6A 1H9RA 2DNCA 2K5WA 3A8IE 1XXGA 3GV6A 1SYEA 4BBRB 4KMUC 2VB3X 1Y1WB 2C9OA 1TWCB 1HQRD 3R2TA 1SAPA 4ZUIA 3P1HA 4I65A 4DA2A 3TSSA 2B2WC 1HA6A 1UEAB 2NTTA 1QJOA 1OO9B 1SNQA 5ISRA 1KNAA 4C3IG 4B9WA 4RGMA 1ZYRD 1JOOA 3OWEB 2DY7A 2A68C 5TSSA 1E2ZA 5E1FA 2NVXB 1RHPA 4A3EB 3R8BA 4O1NA 4XTCS 4QUCA 1CZWA 1AZQA 5BN4A 3RZDB 1SYBA 1Z7TA 1SSOA 3DMUA 2K03A 4JK1C 4J6HA 1EY8A 4LK1C 2FMMA 1BCPF 2JE6I 2O4XA 3M4OB 1WTVA 4KY5A 2SNSA 4A3JB 3NP8A 1GUGA 4P2CB 2EYPA 2EXZA 2EJGC 4H7BA 2E2IB 1HQMC 1G291 3J7AF 1O7ZA 2EYLA 1WTOA 3GTQB 4IFDI 1O7LA 2EY6A 2Q8TA 1HFGA 1U4PA 2DN8A 1TWHB 3HZXA 4FP5D 2A69D 4C3JB 1V8QA 2LY7A 1LV9A 1GUSA 3NQIA 2AWNA 2HUGA 4FF3A 3DWPA 3E5SA 3GQBA 3V05A 1Y8PB 1OXVA 2B2VC 1EQTA 3CRKC 1HRJA 2R61A 1QILA 4Y7NB 2QKIC 2A74C 4CKCA 2BA0A 2YU9B 1LT6D 3DXJC 5CR3A 3A56A 5JEAG 2C5CA 4ZKCB 3KLSA 3H3VC 4CJ1B 1VMPA 2VNUD 1QWYA 4G7ZC 5EKKA 3J7YW 1D2BA 2B2UA 4OL7A 3HOVB 3MXNA 4G4KA 4ZYSA 2YYZA 5I4DA 2F4IA 1SYDA 5E3FA 2CHBD 2KHSA 4DXFA 3S14B 3A8KE 2WKCA 1J8IA 1PTOH 2K33A 1JE4A 3TP6A 4HEDA 1BR9A 4HN7A 3RMHA 2M9VA 3A7AB 1RTOA 5D3DA 1UAPA 1AEXA 2A6ED 2RA4A 1HA5A 1QOHA 1GOZA 2PYKA 4EQNA 1TIID 4IALA 5EJWA 5KYIA 3NWTA 1EWCA 1YNJC 2NUCA 5DEHA 1B53A 3L9AX 5EBDA 1B4OA 4RCOA 2B63B 1WTWA 1JB3A 1F2YA 1RDPD 3Q23A 1CFMA 3DEPA 3W2DA 4RKBA 1OXXK 2A6HC 1A2UA 3LX0A 2VB2X 3DUZA 2B2YA 1PZID 5LHY1 4CGYB 3C2PA 1PZKD 1GUOA 1Y8OB 5M9OA 1SXTA 2Z1CA 4OO1G 2NB0A 2Z8LA 4ME5A 1SE3A 4FO2A 1HTPA 5K5PA 3R3OA 2IWHA 5ELDA 2PMZB 2BDOA 2F0QA 5G3LF 1WTRA 3S16B 3DWQA 3T16A 1RF2D 4HCSA 2F0IA 3MVVA 4LAAA 1B44D 1SYFA 1OXTA 3T13A 4CKBA 2AWOA 2SNMA 2F0LA 3DM1A 2JA7B 2F0KA 1GHKA 1Q3LA 2WIIB 2E76C 1EYCA 4L6TB 2PW7A 1T5EA 1HHVA 5IGBA 4KV6A 5LL6S 1HXYD 3VR6A 1ILPA 4XDXA 2RKSA 4A3IB 1V1PB 1F2MA 3AMUA 2F0DA 2PNRC 2XSCA 1I4GA 4LJZC 4Q0FA 2EPBA 2F0MA 1U4MA 2D62A 1JQYD 4XIGS 4KKUA 1WD1A 3LNNA 1A6XA 4IFDJ 1F9RA 4XQNA 2F0SA 1U4RA 4A93B 2PCFB 5M3MB 3E6ZX 3S2HB 1ET6A 3MFGA 4X3KA 4RGNA 3TMEA 2OXPA 3BVMA 2F0EA 4C56C 2XVSA 4ABNA 3K0YA 2R92B 2X69A 3H94A 1SNPA 1Y1VB 5ELEA 2SOBA 3BDCA 4TSSA 1KDAA 4GZYC 2F03A 3PUWA 1CQVA 4N9PA 1C8CA 3HOXB 3HS0C 1CK1A 1NSNS 3J7AV 1FNUA 5JPMC 4HTHA 3FDTA 5E4XA 5I2XA 4RGTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DY8 A;  2KOL A;  2L11 A;  1J8I A;  1VMC A;  1RJT A;  3KUP A;  2RVL A;  4OIJ A;  2M2L A;  4RAU C;  4IUT A;  2J7Z A;  2MPM A;  1JE4 A;  3DM1 A;  1WTX A;  3MTS A;  2L12 A;  2K28 A;  1F9P A;  2B2T C;  4HED A;  5EPK A;  3HP3 A;  2MGS A;  1NAP A;  1HUN A;  1AZP A;  1O7Y A;  1EIG A;  1EL0 A;  2HDM A;  4U68 A;  1E0B A;  2K05 A;  5COR A;  2NYZ D;  2K01 A;  2L4N A;  4HAE A;  4ZKB B;  1Q3L A;  2L9H A;  4CJ2 C;  1QNK A;  3I3C A;  2H1E A;  3P7J A;  5DNF A;  1PFB A;  4X3S A;  1AP0 A;  3IL8 A;  1MSH A;  1RTO A;  1ICW A;  2HCC A;  2X6G A;  1O7Z A;  3G7L A;  3GV6 A;  5T1G A;  2FJ2 A;  3TZD A;  2B2T A;  2RA4 A;  1ZXT A;  4XT3 B;  2CVR A;  1WTO A;  4RWS C;  1ROD A;  1HUM A;  1A15 A;  3D6W A;  1HHV A;  5EJW A;  5D14 A;  3H91 A;  2KEC A;  3MWY W;  2R3Z A;  1SAP A;  2Q8T A;  1HFN A;  1TVX A;  1DOM A;  2FIN B;  2HDL A;  1WTQ A;  1ILP A;  1U4L A;  2FHT A;  4XDX A;  1HFG A;  1B53 A;  1U4P A;  1MI2 A;  2B2W C;  1B3A A;  1HA6 A;  4X3U A;  1J9O A;  4HSV A;  4R8I A;  3DEO A;  1MGS A;  2HCI A;  1B4O A;  2SDF A;  1G6Z A;  2IL8 A;  4R9W A;  1SDF A;  2EPB A;  1U4M A;  4IUQ A;  3IFD A;  1WTW A;  1WD0 A;  3GV3 A;  1PFM A;  1LV9 A;  5COY A;  2N55 A;  5EKI A;  1WD1 A;  2HUG A;  1KNA A;  4RA8 A;  4QUF A;  3DEP A;  4MN3 A;  2N88 A;  2K04 A;  5EPJ A;  3I91 A;  1F9R A;  2B2V C;  1DOK A;  2JYO A;  5CBE E;  1PLF A;  1CM9 A;  1M8A A;  4ZAI A;  1EQT A;  1WVL A;  1U4R A;  3I90 A;  1NR2 A;  1IKL A;  3F2U A;  4IUV A;  1HRJ A;  2XIW A;  2B2W A;  1G91 A;  2B2Y A;  5EPL A;  2DY7 A;  4IUR A;  1ILQ A;  2NWG A;  5T1I A;  5CBA E;  4O42 A;  1ESR A;  3TN2 A;  4X3K A;  1GUW A;  3R93 A;  4IUP A;  5CMD A;  1DOL A;  2KUM A;  3LWE A;  2D9U A;  1DZ1 A;  4NW2 A;  5AFW A;  1X32 A;  2MP1 A;  2Q8R E;  2EOT A;  4IUU A;  1IL8 A;  1RHP A;  2BDN A;  2RSN A;  3QO2 A;  1PDQ A;  1EIH A;  1IKM A;  2X69 A;  1CA5 A;  1X3Q A;  4UAI A;  1F9S A;  2L1B A;  2RSO A;  2B2Y C;  4ZKC B;  4OIK A;  3ONA B;  3Q6S A;  1XX8 A;  4QUC A;  2KVM A;  2B2V A;  4CJ1 B;  2K1B A;  2EE1 A;  2FFK B;  3FPU B;  1BBX C;  1NR4 A;  1VMP A;  4MHE A;  1KNE A;  1BO0 A;  1O80 A;  1QG7 A;  3N52 A;  1AZQ A;  1CA6 A;  1ML0 D;  1S4Z A;  1JIC A;  1SSO A;  1PFN A;  2MJ8 A;  2NZ1 D;  4ZLT F;  2B2U A;  5JJZ A;  2VXW A;  1DON A;  1F9Q A;  2K03 A;  1BF4 A;  1X3P A;  4DN4 M;  1C8C A;  3UI2 A;  5EQ0 A;  1B2T A;  2JP1 A;  2KEE A;  4LMQ D;  1WTR A;  3KBX A;  4XT1 B;  4CJ0 B;  2FMM A;  5D65 A;  3I8Z A;  1F2L A;  1B50 A;  4HCS A;  1EOT A;  1MSG A;  3FDT A;  5E4X A;  4ZK9 B;  1NCV A;  2X6L A;  1WTV A;  5E4W C;  3SVM A;  2KED A;  1QE6 A;  1WTP A;  4X3T A;  1XYI A;  2B2U C;  1BNZ A;  1RTN A;  1G2T A;  1G2S A; 
#chains in the Genus database with same CATH topology
 2CCZ A;  3K81 C;  2R92 G;  1U5K A;  3M4O H;  2M2L A;  2N78 A;  3KBG A;  3IRB A;  4DXG A;  3S1R H;  5KYL A;  1EIG A;  4DR4 L;  4LFA Q;  5C6A A;  1E22 A;  4FYD A;  1XTC D;  4NKL A;  5G3L D;  1LTB D;  3CCL A;  1K28 A;  2LKV A;  4IJH A;  1NY4 A;  1F77 A;  2A8V A;  2E2I H;  1TY2 A;  4GKJ L;  2UXB L;  3ICE A;  1SE2 A;  1ZXT A;  2F0H A;  4X64 L;  2WAC A;  4BA1 I;  2AQ1 B;  1V43 A;  4H0L C;  1M90 C;  5JJL A;  2NVY H;  2YTV A;  1SMY D;  1VF7 A;  1FNV A;  1FVI A;  3I70 A;  4GKK L;  4BBS B;  1JC7 A;  3NBH A;  5IYC G;  2MO0 A;  4B9X A;  4H13 C;  4DKA C;  1EU4 A;  4PG3 A;  4BBS H;  3NPP A;  1KD1 C;  1VQH A;  4X65 L;  3UDG A;  1RL2 A;  1A3T A;  1LTA D;  1SDF A;  3EFX D;  2WFW A;  5C44 B;  3NQT A;  4J15 A;  3GV3 A;  1BCP B;  4JI2 Q;  4JBJ A;  1EQV A;  5I9P A;  2LMC B;  4QUF A;  1BQQ T;  5M5X H;  4HIM A;  1WJJ A;  5KRU A;  3HOU G;  1MBY A;  1L1O A;  1IZ6 A;  5IGG A;  1PMR A;  3OIP A;  4C3H B;  4NXN L;  1I3Q H;  4F87 A;  5AFW A;  3TDQ A;  1WI5 A;  1RIP A;  3HOW H;  1E3P A;  1STN A;  2BDN A;  2RSN A;  3QO2 A;  4Y7N H;  2EYJ A;  1JWM D;  2YU9 H;  4OIK A;  2VZA A;  2Z6B A;  1ESF A;  4DV0 L;  3BYT B;  3RD4 A;  2NVQ B;  3K5L A;  1QG7 A;  3H09 A;  1Q8I A;  4N8F A;  2NZ1 D;  2BH8 A;  1H9K A;  3UI2 A;  1LTI D;  5EQ0 A;  3SR1 A;  4DR5 L;  5LMN L;  1SND A;  2L0C A;  1KIX A;  2B3G A;  1IL2 A;  2B39 A;  2ATW A;  4ILW A;  1CI3 M;  4BBR G;  1EIF A;  4EX5 A;  1D8L A;  1NCV A;  4AYB E;  1JR0 D;  3HOY B;  1R4Q B;  4JPB W;  4A3G H;  1STH A;  4LF7 L;  2RVL A;  5K36 G;  2G9H D;  2ID0 A;  3PQI A;  3QOJ A;  1EZ8 A;  2K28 A;  5EPK A;  2WP8 J;  3Q8D A;  1AZP A;  4KJN A;  1UUP A;  4ZRZ A;  3NWS A;  4JVZ A;  3BYY B;  2K01 A;  4DAP A;  3P7J A;  4E6I A;  4IJL A;  2KCC A;  1A62 A;  4ZCK A;  5J3B A;  3OSO A;  3TZD A;  1JWU D;  4RWS C;  2D0P A;  3PO2 B;  2IY5 B;  4PMB A;  3SK4 A;  1HR0 Q;  1BOS A;  1V9P A;  2K5N A;  5IT9 E;  4DR2 L;  1MI2 A;  4K5W A;  5JJI A;  4ID6 A;  4UP9 A;  1R9T B;  2XRQ D;  4L8J A;  1KDB A;  3S15 B;  3FVQ A;  3K80 C;  3KLS X;  2BE5 C;  4IUQ A;  1R9T H;  2A73 B;  5I9O A;  2DUD A;  4GN3 B;  4QIW B;  1B7Y B;  1KAB A;  1PFM A;  2KHJ A;  1T9H A;  2LXK A;  3CCQ A;  2V1C C;  2OWO A;  2JXM B;  4JBW A;  5IP7 H;  3NE5 B;  1JCK B;  3RNU A;  2PNH A;  4K5V A;  1WCM G;  2ZXP A;  1ESR A;  5JPN C;  4EQO A;  5M3M G;  1FR3 A;  3K0X A;  4LF5 Q;  5CMD A;  1M1K C;  2DNE A;  2MP1 A;  1K8G A;  5GQO A;  4F8M A;  2L5T A;  2P5Z X;  1M4V A;  1IBK Q;  1VQC A;  1WCM B;  2I46 A;  2WB1 E;  3E0E A;  1E1O A;  2QIL A;  5J22 A;  4R4Q A;  1BBX C;  4GLA C;  1CT1 D;  1NBW A;  1CA6 A;  3Q24 A;  4HJA A;  5D3I B;  4J8Q A;  4JI4 Q;  2RF4 A;  1DON A;  5IGC A;  1BF4 A;  1H9J A;  2IPK D;  3X3M A;  3JAM L;  1X9N A;  2ENB A;  2PZW A;  4NMZ A;  3HEJ A;  3T56 B;  2EY5 A;  4P73 A;  4ME3 A;  1C9O A;  4JI8 Q;  3UDX A;  3MZ5 A;  5JOB A;  4ZK9 B;  3K7A B;  2KED A;  1YNJ D;  2HHH L;  4X3T A;  1Q46 A;  2QCP X;  1LAB A;  1G2S A;  2RCN A;  1BXT A;  1AE2 A;  5M5Y H;  1L0Y B;  1VQ6 A;  4L5R C;  2J7Z A;  5ELN A;  1K3B C;  4EQ5 A;  4FNF A;  4X66 Q;  2J4X A;  1VQP A;  3U9S A;  3J80 L;  1O7Y A;  3I4L A;  1ONL A;  1QZH A;  2K05 A;  2WIN B;  3A8J E;  2A68 D;  3PIO 3;  2R7Z G;  4AH6 A;  4DR4 Q;  5AJ3 L;  1HNX L;  3S9W A;  4KTA A;  3OWF A;  3RLF A;  2OQ0 A;  2BCO A;  1Q1E A;  2B8F A;  2FJ2 A;  3KF8 A;  1ROD A;  1A15 A;  1TR5 A;  1W6K A;  3D6W A;  3GTJ B;  1VQK A;  3MWY W;  3D6C A;  1XNR Q;  5CGK A;  3AB9 A;  3SK8 A;  3HOV G;  1STA A;  3GTJ H;  1V1O A;  2QEJ C;  3GTL H;  5C4Z A;  4DV0 Q;  2Q2U A;  2F0T A;  3BZC A;  1F2Z A;  3A55 A;  4QB4 A;  2F3V A;  4A3I H;  4S3S A;  1BCP C;  2MNA A;  1WD0 A;  4P75 A;  3B6Y A;  5FJ8 G;  2MQH A;  1YEZ A;  3CCS A;  2O5I C;  2EY2 A;  2UUC L;  1KXL A;  2K32 A;  4HJ8 A;  1K0R A;  1FD7 D;  2NZH A;  4IUR A;  1HZB A;  2EYM A;  1XPO A;  2ZJQ A;  1XTD A;  2UXC L;  4JI6 L;  1IHZ A;  3KYH C;  4TKO B;  2KHI A;  1G51 A;  2VQF L;  1EYG A;  2B2Y C;  1I6H H;  2JA5 B;  1CHQ D;  2JSO A;  4LF5 L;  1QB5 D;  5GAD C;  1SMX A;  4MHE A;  1KNE A;  2JA7 H;  1E2V A;  2E2J H;  2Z4I A;  1JOR A;  2MJ8 A;  2PQA B;  1TWF B;  4K5X A;  3SE0 A;  3K6O A;  4NP5 A;  4ZUJ A;  1B8A A;  4PNY A;  1EU3 A;  3M3Y B;  2E2J B;  4CJ0 B;  1HPC A;  4WJW A;  4HR7 B;  1MHW C;  3KF6 A;  4A3M H;  1KDC A;  1MSG A;  1ICF B;  4DNR B;  4NXM L;  1I4R A;  1W2B A;  3SVM A;  3PIP A;  3OMG A;  3GDE A;  3RLN A;  2KOL A;  2DJG C;  4X65 Q;  2R7F A;  2CH4 W;  2L11 A;  5C3X A;  1RJT A;  3EBE A;  5ELB A;  3H3V I;  5JAV A;  2HIV A;  1EZ6 A;  3PUZ A;  3LWU A;  5KIX A;  1TS5 A;  1SBB B;  3CRL C;  4YIJ A;  5HUR A;  2NYZ D;  4B3S Q;  4JI7 L;  5IT9 c;  1JOK A;  1H9M A;  1BDO A;  1BBU A;  2BE5 D;  1YVC A;  3D8G A;  4DK0 A;  3KLW A;  2KCM A;  2EJF C;  3QJY A;  2HQE A;  4XYO A;  3STB D;  2CWA A;  4QF4 A;  3EN2 A;  3O13 A;  3IKJ A;  4OX9 Q;  2E74 C;  2KCT A;  3KK7 A;  3PIO A;  1SRU A;  2AQ2 B;  5F2D A;  4A3I G;  3IAY A;  2NVY B;  4RG1 A;  4DV3 Q;  1JT8 A;  3D3R A;  3K8A A;  4LF7 Q;  4Y52 H;  2MHV A;  4IPH A;  1EYA A;  2GVA A;  1QNU A;  1G6Z A;  3K5N A;  4KKS A;  1NE3 A;  1GHJ A;  4B3M Q;  5E7N A;  1VCI A;  3ERS X;  1SE8 A;  2AUJ D;  2ES2 A;  1CSQ A;  5FLX E;  4QCL A;  4YHH Q;  1YNN C;  1EQR A;  2JA8 H;  5COY A;  2VW9 A;  1IYJ B;  5C4X G;  4LFC L;  5C44 H;  2R7Z B;  2Q2T A;  1SLJ A;  1HCZ A;  3NXW A;  2JA6 G;  5EPJ A;  1YNX A;  2JA8 B;  3JC6 6;  2R7Z H;  4GKJ Q;  1TWA B;  2UXB Q;  1SMY C;  1PA6 A;  1G8Z D;  3U9O A;  1NUC A;  3F8T A;  5M5W H;  1DZ1 A;  4A3L H;  5DM7 3;  2EYF A;  1X6O A;  2EDG A;  3KF6 B;  2NTS A;  4F88 A;  3S1N H;  2EVB A;  5C0X G;  1A8V A;  1S3O A;  1I3Q B;  1STG A;  1DCZ A;  1X3Q A;  3ONA B;  1XX8 A;  4DV3 L;  1FL0 A;  1Q86 C;  3CCR A;  1B9N A;  4G7H C;  3TP5 A;  3SK6 A;  1SRO A;  2UXD Q;  3S1R B;  3I4M G;  3F2B A;  2CQA A;  4KHP Q;  4A3D B;  1LTT D;  2JA6 B;  3NK9 A;  3MFY A;  4DF7 A;  5JJZ A;  2VXW A;  2F52 A;  4BBS G;  1F9Q A;  4RH6 A;  4DN4 M;  3UE1 A;  4IZ8 A;  3N6R A;  1IBK L;  4A3D H;  4X6A H;  3VYU A;  4QMG A;  3SK5 A;  5IYC H;  1Y1W G;  1CHP D;  1EY0 A;  5FJ8 H;  1WFQ A;  2O2L D;  1DYQ A;  3OTO Q;  1S40 A;  2KQ3 A;  5FO8 B;  1PH1 A;  1IW7 D;  4JG2 A;  1KLU D;  4GOP B;  1TY0 A;  3VR4 A;  1JB7 A;  4WOR A;  3VR5 A;  5JEA H;  1SYG A;  4OWX B;  4FF1 A;  5C0X I;  4RFB A;  3H0G G;  3FKI B;  3JAM i;  4O2D A;  3M9B A;  3HP3 A;  4U67 3;  3GTP H;  4OON A;  3RZO H;  4U68 A;  1E0B A;  1TQO A;  1V1Q A;  1E24 A;  4ZKB B;  1G6P A;  3M4Q A;  1SE4 A;  4X3S A;  2OTL A;  3RZO B;  1ET9 A;  4BY1 H;  5C4H A;  2B2T A;  2EYH A;  2EY1 A;  4JI3 Q;  2NN6 I;  2PO4 A;  5IOC A;  1IYV A;  3HOU B;  1RKN A;  2Z9H A;  2UUB L;  2HDL A;  1D5Z C;  3SHL A;  1VQL A;  2OEO A;  1B3A A;  1UNS A;  1AW7 A;  3T4A C;  1PTO C;  1QUQ A;  2IX1 A;  2N3S A;  3G6E A;  1K73 C;  2WAQ B;  3S1M H;  3ITP A;  3FEW X;  1HNW Q;  4FF2 A;  3CQZ B;  3EQL C;  3ER0 A;  1JJC B;  5KEE A;  3S1M B;  1VQ7 A;  4PMW A;  2PMZ E;  4BY7 B;  3CQZ H;  4DU9 A;  2R6G A;  4KY7 A;  4JI8 L;  1TKW B;  5CBA E;  4M8A A;  1D1I A;  3NSW A;  3ND9 A;  3TP7 A;  5M3F B;  2OT2 A;  3LWE A;  1MIU A;  3VA5 A;  4NW2 A;  2EOT A;  3HOY H;  3S14 H;  1PDQ A;  1Q7Y C;  5K36 H;  1FGB D;  3VR3 A;  1CA5 A;  2YV5 A;  2L1B A;  1PH2 A;  4UP7 A;  4DNT B;  2EE1 A;  5ELC A;  4IQZ A;  1L2F A;  1O80 A;  2E2H B;  3N52 A;  3L3O C;  4DV5 L;  1UE6 A;  1PFN A;  1TWG H;  4ZLT F;  2QDB A;  3X3N A;  1GO3 E;  2NBF A;  2E2H H;  3I73 A;  3S17 H;  2KA7 A;  1RCV D;  3KBX A;  4LFB Q;  2HHH Q;  4DV6 Q;  3WDN A;  4R4O A;  1NMG A;  1B50 A;  1K83 H;  2FMC A;  1A2T A;  1XYI A;  3S2D B;  1I94 Q;  1RTN A;  1G2T A;  1QCB D;  1UE7 A;  1VQE A;  2I5H A;  4DR5 Q;  4POG A;  4X66 L;  3VYS A;  3I4M B;  4IUT A;  4HMI A;  4LF4 L;  3NBI A;  5IGF A;  2A6H D;  1HNZ L;  5JVH 3;  3Q0A A;  1GUN A;  1Q12 A;  3I7F A;  5M5Y B;  2Z6K C;  1HZA A;  1K8A C;  4IPD A;  2L4N A;  4KI0 A;  4OEM B;  1TU2 B;  2X6G A;  4XQJ A;  3CD6 A;  1N33 L;  4N8X 1;  2CWP A;  3BJU A;  1K8M A;  3A0J A;  2Z6K A;  4B3S L;  1YIT A;  1E7Z A;  1PRT C;  4C3J G;  4C1N I;  1TVX A;  4DAY A;  2ZXO A;  2NN6 H;  5ELO A;  1PH7 A;  4LW1 A;  3MXG A;  3CAM A;  1I4X A;  2F3I A;  3A5U A;  5FLM G;  3W5O A;  1J5E L;  4JYA L;  4R8I A;  4GNX B;  1KAW A;  4HJ9 A;  2XWB B;  4R9W A;  3GTL B;  2QGQ A;  1HNZ Q;  2F0F A;  1W6J A;  4LF4 Q;  3CCE A;  3FKI G;  1LTR D;  3I2Z A;  3A54 A;  4BWG B;  2QDL A;  4DGZ A;  5EKI A;  2VS1 A;  4DNI A;  4ZQ3 A;  3BDO A;  1CM9 A;  1M8A A;  2K7V A;  5IWA L;  1WVL A;  2F4V Q;  1NR2 A;  5J1Z A;  4HIO A;  1ENC A;  3I4N G;  2CFM A;  1ENA A;  4O42 A;  3S16 H;  4KHZ A;  1MJC A;  2R93 B;  2KJX A;  3DM3 A;  1Z6H A;  5CV8 A;  3J7Z C;  2A5H A;  1PTO D;  4X64 Q;  3OMC A;  3G4S A;  1SEB D;  3AU7 A;  2MFI A;  2UU9 L;  3PUY A;  2HT1 A;  4P72 A;  3OW2 A;  2D5D A;  3HOY G;  3U58 A;  4AIM A;  5C0X H;  2B2V A;  1ENF A;  1EEI D;  1SNO A;  2F0N A;  4XQQ A;  1I6H B;  1LUZ A;  1I4P A;  3J80 i;  1RD9 D;  3KJO A;  3PMF A;  1JWS D;  4LFC Q;  3S1Q B;  1TS3 A;  4DAM A;  5D65 A;  2G9D A;  1SFO B;  3J80 E;  3C46 A;  3CC2 A;  2QF7 A;  5L37 A;  3J81 c;  4IOC A;  1S5F D;  1IXR A;  1WTP A;  1HZC A;  4A3M B;  2F0J A;  2IW3 A;  3M7G A;  1N32 Q;  2MPM A;  3AEV A;  3MTS A;  3OHX C;  2MGS A;  1NAP A;  1EL0 A;  4GNX A;  5COR A;  1GVP A;  3W1B A;  2GVB A;  2JK8 A;  1II3 A;  4DUZ Q;  1PFB A;  3D4W A;  1KHI A;  2A6E C;  2E2D C;  4YWK A;  3F2D A;  4DR1 Q;  4FXD A;  4GNX C;  3H91 A;  3TEH B;  3KDF A;  1YJN A;  5M3M H;  4QQB X;  1A3U A;  1PH3 A;  2F0P A;  2FHT A;  1DD2 A;  4KN7 C;  5DAU A;  4MZ9 A;  2E8G A;  1VQF A;  3SDZ A;  4RGO S;  3BU2 A;  4YCW A;  4OO1 H;  3VYR A;  4C2M B;  4J1M A;  5FK9 C;  2HCI A;  2IX3 A;  4JI2 L;  1PRT B;  2ICE C;  2CH4 A;  3PV0 A;  4DAV A;  3OW7 A;  3EIV A;  4GN5 A;  1O7I A;  2AUK A;  4RA8 A;  3HKS A;  2K52 A;  2N88 A;  3I91 A;  1IBM Q;  4PMC A;  4A3K H;  4DAY B;  4AQY L;  4IUV A;  1WYD A;  3M3Y H;  5T1I A;  1ILQ A;  2VY3 A;  3D31 A;  2LS0 1;  1PH9 A;  1V1P A;  3BZD B;  4A3K B;  3NTK A;  4IUP A;  3J81 L;  2D9U A;  5IIF A;  1X32 A;  2EYO A;  3HFZ B;  1SJE D;  4TRD A;  2D2C C;  2WKD A;  5M5W B;  4UAI A;  2UXD L;  1F9S A;  2RSO A;  2M00 A;  3Q6S A;  3T1H Q;  3S1N B;  5BN3 A;  2KVM A;  1EY7 A;  1EWI A;  3J80 c;  1EY5 A;  1I4H A;  1YNN D;  3I72 A;  3RN2 A;  4C3I B;  5CV7 A;  3AYH B;  5IYB H;  1IBL Q;  5EGT A;  3BVZ A;  4LF9 Q;  1PTO F;  2KEE A;  3CF5 A;  4OWW B;  4XT1 B;  2JA6 H;  3L0O A;  1I50 B;  3I8Z A;  1F2L A;  2RDG A;  4MIU A;  2K4K A;  1D6E C;  1Y1V G;  3GP7 A;  1STE A;  3IFT A;  3KDF B;  4N9T A;  4OIJ A;  1Q81 C;  4IUN A;  3GTM B;  4HMJ A;  4HSP A;  2B2T C;  4KY6 A;  5EBC A;  4B3R L;  1PRT D;  2KCN A;  4JI0 L;  2PQA A;  4CJ2 C;  2MUY A;  3HOV H;  1UE5 A;  2H1E A;  3LGJ A;  5DNF A;  1EY4 A;  2JEB I;  4P71 A;  2TMP A;  1Y8N B;  5IYD H;  3G7L A;  5IOD A;  3MA2 B;  2A1A A;  4L5Q A;  3HKZ B;  4XT3 B;  4JC0 A;  3V2T A;  4C3H G;  2K5H A;  1Z47 A;  4BXX H;  4DR7 L;  4DV2 L;  5C4J H;  3OIQ A;  1SNC A;  2KEC A;  3W3A A;  1K3R A;  5C3E B;  1TWA H;  2OQK A;  2IX0 A;  5LL6 X;  5A35 A;  2WAQ E;  5IGE A;  3HOU H;  3M7N A;  4TVA B;  5C3E H;  4V0B A;  4A3F H;  4LF6 L;  3HOW B;  1T5X D;  1FGU A;  2SDF A;  3NTH A;  1JE5 A;  2LFN A;  4JI5 Q;  4OGQ C;  4A3F B;  2XRS D;  2ASB A;  2RHQ B;  1GKH A;  5KND A;  5EKL A;  3R2I A;  1PH4 A;  1NJI C;  2N55 A;  4A3E G;  1EWH A;  2PI2 A;  1BKB A;  2XTI A;  3GTO B;  3ULJ A;  3Q22 A;  4F7X A;  4TQU S;  5C5L A;  2GA4 B;  1PLF A;  5CBE E;  1K8O A;  3FP9 A;  1DJR D;  4KKT A;  1YI2 A;  1IKL A;  2PW5 A;  2B2W A;  2RDH A;  4A3F G;  1BUV T;  4DR7 Q;  3C1F A;  1LTS D;  3MEH A;  1GUW A;  3R93 A;  3CP0 A;  4CDE C;  4YCU A;  4JI1 L;  2E75 C;  2F1M A;  3QOL A;  5IY0 A;  4A3G B;  3D4R A;  3K59 A;  5KNB A;  5M3F H;  2UUB Q;  4GOP A;  2E5L L;  1Q90 A;  3GO5 A;  3CCV A;  1ASZ A;  2EIF A;  3FPU B;  2K6A A;  3PO3 G;  2CKZ B;  1BO0 A;  1R4P B;  3BVG A;  3SXH A;  3T51 B;  1KRS A;  3UDF A;  5I2Y A;  1JIC A;  1X3F A;  5FO9 B;  1FNW A;  4B08 A;  3VR2 A;  4R4T A;  4HJ5 A;  4BY1 B;  2Z0S A;  3NHH A;  1TWG B;  1PH6 A;  5EAY A;  1D5X C;  3PO3 B;  2VUM G;  4V19 0;  3S17 B;  5E4W C;  4QIW E;  4MTK A;  2F3W A;  3PSI A;  4A3M G;  1STB A;  1K83 B;  5ELF A;  3S2D H;  2L12 A;  5C0X J;  1VDZ A;  5IP9 G;  4KD4 A;  2Y0S B;  4X62 L;  1S5E D;  3T1H L;  4CBV A;  3I4M H;  2CQO A;  1EIY B;  3DHQ A;  3I3C A;  3URY A;  4WRD A;  4R4C A;  3IL8 A;  1MSH A;  4JOI A;  3GTG H;  1LT5 D;  1L0W A;  4CHT B;  1XNR L;  1WTH A;  4K6D A;  5D14 A;  3HOZ B;  3EJI A;  1KLG D;  1B1Z A;  3L7Z C;  1YZ6 A;  2JQO A;  1C48 A;  2AQ3 B;  1LO5 D;  4KD3 A;  1FJG L;  1N36 L;  4JV5 Q;  1J9O A;  4PZ7 A;  4HSV A;  1I94 L;  4BXX G;  1TS4 A;  1Y69 U;  1D7Q A;  2EQS A;  3ZJY C;  4LF8 L;  1XWE A;  1VQ8 A;  3PUV A;  1GUT A;  2RCF A;  4GS3 A;  1LAC A;  2EZV A;  1CSP A;  4I7A A;  4YY3 Q;  2F0V A;  3MXU A;  3U50 C;  1PFS A;  5CV5 A;  5JVG 3;  1PXU A;  4OO1 I;  5IT9 L;  2OF1 A;  4PZ8 A;  3EVQ A;  1XJV A;  3KLR A;  5IGD A;  2XWJ B;  4WFN 3;  1CKN B;  4EVO A;  3PUX A;  2XNA C;  1VQD A;  5C3W A;  2Q8R E;  4O0A A;  4IUU A;  4MNO A;  4B3R Q;  1IL8 A;  1EIH A;  5JEA J;  1VQJ A;  2WAQ G;  1EFI D;  4Q5V A;  3NUC A;  1HUN A;  2FFK B;  1NR4 A;  1EYD A;  1I4Q A;  4NDX A;  5FLX L;  3OPO A;  1KAA A;  4P74 A;  1S4Z A;  4GOP C;  1SYC A;  3GTK B;  4IN3 A;  1PH5 A;  2JP1 A;  4LMQ D;  1DXM A;  1EEF D;  1I6V C;  3CCJ A;  5LMU Q;  1KC8 C;  1X65 A;  3M85 A;  1IBL L;  2F4V L;  1KL9 A;  1BCP D;  4KHV A;  3S1Q H;  2EJM A;  1XMQ L;  2HIX A;  2X6L A;  4PQX A;  1U0L A;  4EGV A;  1QE6 A;  5NUC A;  5I6W A;  3U4V A;  3QG1 A;  4CDF C;  1LT4 D;  1OXS C;  4QGU A;  4IPC A;  3JAM E;  2HDM A;  2JA7 G;  2O5J C;  4C1N K;  2H4O A;  4CKE A;  3S24 A;  3J7A 5;  1IW7 C;  2PZU A;  4DV1 Q;  4KHP L;  1S5D D;  1TWC H;  4FXK C;  4DR3 L;  3HGB A;  1FYC A;  2WV6 D;  3BS1 A;  1B70 B;  4PV1 C;  3V96 A;  2CVR A;  2OTJ A;  3TZU A;  1X3G A;  4PZ6 A;  4BY1 G;  2VQE L;  4A3J H;  2R3Z A;  3P75 A;  1XPR A;  1DOM A;  2FIN B;  1LTG D;  4JOI C;  4JBM A;  1PVO A;  1C4Q A;  3NEN A;  1X54 A;  3VDY A;  3MC0 B;  3TRE A;  2ZT9 C;  3H0G H;  1Z9F A;  1MGS A;  3CPF A;  3RUZ A;  3TP8 A;  2F0U A;  1YJ9 A;  3IFD A;  2JA5 H;  1CZG A;  1JJG A;  1EY6 A;  3H0G B;  4RKL A;  4KLK A;  3BDL A;  3KF8 B;  1J5E Q;  4JYA Q;  1YJW A;  4MN3 A;  1HJP A;  1DOK A;  2JYO A;  2CW0 D;  4ZAI A;  3I90 A;  4DV6 L;  4XYQ A;  5FOB B;  3F2U A;  2XIW A;  4MTN A;  2HD3 A;  2K5V A;  5EPL A;  1DGS A;  4DR6 L;  2V4D A;  1DOL A;  2KUM A;  4A3E H;  3C3L A;  3I55 A;  1D1K A;  1A63 A;  1N9W A;  2B8G A;  4FVM A;  5HGT A;  4OX9 L;  2UUA L;  1A3V A;  5BN5 A;  3QB3 A;  3RZD H;  5C5M A;  4AYB B;  2I5M X;  3E9I A;  1S5C D;  3T53 B;  1D5M C;  4BS9 A;  2ZTD A;  1I5F A;  2F0W A;  2K1B A;  5HY6 A;  1CTM A;  2QEX A;  2Z4H A;  4YWL A;  4CDD C;  1H9S A;  3CC4 A;  5M5X B;  1L1O B;  1X3P A;  4DV7 Q;  1B2T A;  2E5L Q;  1TT2 A;  4C3I H;  3WOE A;  4C3H H;  4K2K A;  4A4I A;  3GD7 A;  3J81 E;  1FJG Q;  3RN5 A;  3E0J A;  1OXU A;  2A19 A;  3HKZ G;  3FMC A;  2DY8 A;  4RHR A;  3KUP A;  2J0T D;  3FRP B;  3G48 A;  3HG9 A;  5FO7 B;  3NBH B;  4LF8 Q;  2R7D A;  1PH8 A;  1WTX A;  1GJX A;  4DUY Q;  2R93 G;  5KNC A;  3GTM H;  2PZT A;  4HAE A;  1CQF A;  2IT1 A;  1QNK A;  4UDU C;  3P20 A;  1SJH D;  1YHQ A;  1AN8 A;  2HCC A;  1Q1B A;  1LYL A;  4K6L A;  4G7O C;  2VQE Q;  2WB1 B;  1Q82 C;  2C35 B;  4NXN Q;  2F0G A;  5CC4 A;  4ULL A;  2I0Q A;  2N8N A;  1L0X B;  3K57 A;  4R1J A;  4DK1 A;  1ASY A;  1AE3 A;  5IYB G;  4RCN A;  2ZJP A;  3H3V H;  3I56 A;  5C4J B;  1PTO B;  4C3J H;  1N34 Q;  3CMA A;  2IL8 A;  2YTX A;  3G71 A;  3NTI A;  3SEB A;  2Q8I B;  2NVT H;  3K58 A;  4IOA A;  1VF5 C;  4HIK A;  2RBM A;  4I7Z C;  4JBK A;  4DV4 Q;  4IFD G;  2NVT B;  1N36 Q;  4JV5 L;  3CHB D;  1ZKO A;  4R4I A;  4XXE A;  1UWV A;  1VQ4 A;  3C1E A;  3GTO H;  1G91 A;  4KJO A;  1LT3 D;  2A69 C;  3KOJ A;  1SNM A;  1GM5 A;  1DM0 B;  3ND8 A;  1YHB A;  3VA7 A;  4B3T Q;  3E9H A;  3S15 H;  2I07 B;  3TBI B;  2VUM B;  4A3B G;  2B63 H;  2L15 A;  1ZYR C;  3F2C A;  3OOC A;  4RHS A;  3MXP A;  4K8J A;  1STY A;  2LSS A;  5CYU A;  1MD2 D;  4LFA L;  2L55 A;  5CV6 A;  2Q2H A;  3ULP A;  1C0A A;  3FKI H;  3QIA A;  2BA1 A;  1ZEQ X;  3GTP B;  2RQX A;  4EQP A;  1PRT F;  3K5O A;  1ML0 D;  2CW0 C;  2I5L X;  3FPP A;  4K14 A;  3QWN A;  4JI5 L;  3VYT A;  3D4D A;  3TRZ A;  3MHB A;  4G57 A;  3FHW A;  1EQQ A;  1EOT A;  5BR8 Q;  1BNZ A;  2B2U C;  2ICI A;  1LM0 A;  5FKA C;  1VMC A;  1TS2 A;  5A2Q L;  1PZJ D;  3G6J B;  1PYW D;  4RAU C;  3J81 j;  4B3M L;  2BOS A;  5J39 A;  4L63 B;  2JN4 A;  1QUQ B;  2QW7 A;  4LUO A;  3H6M A;  5DM6 3;  4AYB G;  2RDF A;  2L9H A;  1U9R A;  2AMC B;  4JI0 Q;  3KFU A;  1AP0 A;  4KN4 C;  4YWM A;  3K5M A;  1ICW A;  3CCU A;  5GRO A;  2GN5 A;  4IFD H;  5T1G A;  4UHV A;  3AQQ A;  1QVF A;  1HUM A;  5KGU A;  5A2Q E;  1IYU A;  2ZXR A;  1HTL D;  4BA2 I;  1HFN A;  2XN9 C;  1WTQ A;  1U4L A;  4NXM Q;  2PQE A;  4IO9 A;  1HNW L;  3PF5 A;  1AFP A;  4JW0 A;  3HOZ H;  4R8N A;  4LUZ A;  3ERO A;  3CU7 A;  3DWA A;  4DV4 L;  3DEO A;  1Y14 B;  4K2L A;  1E2W A;  4FXG C;  1E1T A;  1O78 A;  2F0O A;  4FDB A;  2K5Q A;  5C4X H;  4K8I A;  2TSS A;  3A7L A;  2JJQ A;  1JOQ A;  2K50 A;  2K04 A;  5C4X B;  3J81 i;  4Z9C B;  3OTO L;  1H9S B;  3I4N B;  2K5D A;  2FXQ A;  2NWG A;  3M4Y A;  2SEB D;  3TN2 A;  2JEA I;  4M1U B;  4A3B B;  2LXJ A;  1S5B D;  4POF A;  3D0F A;  4DFA A;  5I6Y A;  4A76 A;  1VQM A;  3PF4 A;  1HH2 P;  3QR8 A;  3HRZ C;  1YIJ A;  1A0I A;  4HCE A;  2PPB C;  4A3B H;  1IKM A;  1NTG A;  4DK3 C;  1KRT A;  4H44 C;  1GXD C;  3TS0 A;  4OEL B;  1B3Q A;  3ZYY X;  5CV9 A;  2KEN A;  2HQL A;  1MJE A;  3CKI B;  5FLM H;  1HNX Q;  4FF4 A;  4B3T L;  2IJ0 A;  2IHF A;  2NN6 G;  1N8R C;  1B9M A;  1CUK A;  5CV4 A;  3W1G A;  4A3J G;  3GTG B;  4OHJ A;  1X55 A;  3RR5 A;  1KTK A;  4KK7 A;  1EY9 A;  3MAQ A;  1LLR D;  3PIP 3;  3BG3 A;  4WJ4 A;  4X3U A;  3WOF A;  1PYS B;  4ODG A;  3ERQ A;  4LFB L;  1F9P A;  1HR0 L;  4JI1 Q;  4APV A;  3EA6 A;  2Y0S G;  1H9R A;  2VQF Q;  1PHJ A;  2DNC A;  2K5W A;  4QJF A;  2JA8 G;  3A8I E;  3HOX H;  2YTY A;  1XXG A;  3GV6 A;  1SYE A;  3JAM c;  4BBR B;  4KMU C;  2VB3 X;  4LF9 L;  1Y1W B;  2C9O A;  1TWC B;  1HQR D;  3R2T A;  1SAP A;  4ZUI A;  2JA5 G;  2B29 A;  3P1H A;  4YHH L;  4I65 A;  1Y1W H;  4DA2 A;  3CME A;  2R93 H;  3TSS A;  4DK6 C;  3H15 A;  1IBM L;  3ULL A;  2B2W C;  1HA6 A;  3PCO B;  4NPS A;  1N33 Q;  1UE1 A;  5IWA Q;  3UDI A;  1UEA B;  2NTT A;  1AH9 A;  2EXD A;  1N32 L;  1QJO A;  4A3G G;  1OO9 B;  1SNQ A;  5LMN Q;  5ISR A;  1BBW A;  2K75 A;  1KNA A;  2WB1 G;  1N34 L;  1X3E A;  4YCV A;  4C3I G;  4B9W A;  3A74 A;  4RGM A;  1VQ9 A;  1ZYR D;  1VQI A;  2H5X A;  1VQB A;  3GTK H;  3HOZ G;  1J6Q A;  2XGT A;  1JOO A;  2NVX H;  2Y0S E;  3OWE B;  2DY7 A;  2A68 C;  5TSS A;  1E2Z A;  4A75 A;  5E1F A;  4DR1 L;  2NVX B;  1Y1V H;  1SN8 A;  1RHP A;  4JCV E;  4A3E B;  5C44 G;  3R8B A;  4O1N A;  4XTC S;  4QUC A;  2G5D A;  3PO2 G;  1CZW A;  3STB C;  1AZQ A;  5BN4 A;  3RZD B;  1SYB A;  2UU9 Q;  1Z7T A;  1SSO A;  3L2P A;  2UXC Q;  5JJK A;  3DMU A;  2K03 A;  4JK1 C;  4NB3 A;  4J6H A;  1EY8 A;  4LK1 C;  2FMM A;  1BCP F;  4DR2 Q;  3TQY A;  1JJ2 A;  2JE6 I;  1S72 A;  2O4X A;  3M4O B;  4KY5 A;  1WTV A;  2SNS A;  4A3J B;  3T1Y L;  3NP8 A;  1GUG A;  4P2C B;  2EYP A;  2JA9 A;  3E3X A;  1UEB A;  1W3S A;  2EXZ A;  4L5S A;  3CPW A;  4A3K G;  2EJG C;  2DGY A;  4C2M H;  2NVQ H;  4H7B A;  2E2I B;  4DV2 Q;  1VQA A;  1HQM C;  3GTQ H;  1G29 1;  3J7A F;  2D0O A;  1O7Z A;  2EYL A;  1C7Y A;  1WTO A;  3GTQ B;  4IFD I;  1K0S A;  1O7L A;  4UY8 C;  2EY6 A;  3A5Z B;  1TWH H;  2Q8T A;  1QVG A;  1HFG A;  1U4P A;  4DV1 L;  2DN8 A;  1TWH B;  1HR0 W;  1VS0 A;  3HZX A;  4FP5 D;  1XMO L;  2A69 D;  4GLX A;  4C3J B;  1V8Q A;  1K9M C;  2LY7 A;  3CXC A;  3HKZ E;  1LV9 A;  3M4P A;  1GUS A;  3NQI A;  2AWN A;  2HUG A;  4A3L G;  4FF3 A;  3DWP A;  3E5S A;  3GQB A;  3V05 A;  2K14 A;  1Y8P B;  4QL5 A;  1OXV A;  2B2V C;  2ZM6 L;  1EQT A;  3CRK C;  1XMQ Q;  1HRJ A;  2R61 A;  5AJ3 Q;  1QIL A;  1I50 H;  2PI2 E;  4Y7N B;  2QKI C;  2A74 C;  4CKC A;  2BA0 A;  2YU9 B;  1LT6 D;  3DXJ C;  5CR3 A;  3A56 A;  5JEA G;  2C5C A;  1GD7 A;  4ZKC B;  3KLS A;  1JMC A;  4HID A;  3H3V C;  4CJ1 B;  1VMP A;  3DLL A;  4DR6 Q;  2VUM H;  2VNU D;  4UPA A;  1QWY A;  1HZ9 A;  4G7Z C;  1XNQ L;  5EKK A;  3J7Y W;  4LUV A;  1D2B A;  3CC7 A;  1VQG A;  4A3D G;  2B2U A;  1OTC A;  4BY7 H;  2DJF C;  1X56 A;  4OL7 A;  3HOV B;  3MXN A;  4A3C H;  3CCM A;  4G4K A;  4ZYS A;  2YYZ A;  4DUY L;  5I4D A;  2F4I A;  2ZJR A;  3PGZ A;  1SYD A;  5E3F A;  5IYD G;  4GN4 B;  2CHB D;  2KHS A;  4DXF A;  5HGQ A;  3S14 B;  3A8K E;  2WKC A;  1J8I A;  5M3F G;  1PTO H;  1WCM H;  1BVS A;  2K33 A;  1JE4 A;  3TP6 A;  4HED A;  3K7U C;  1VQN A;  1H95 A;  2IHE A;  1BR9 A;  4HN7 A;  4LWC A;  1EOV A;  4WJ3 M;  3RMH A;  2M9V A;  4OXP A;  4HJ7 A;  3KJP A;  3A7A B;  3PO2 H;  1RTO A;  5D3D A;  1XNQ Q;  4H02 A;  1UAP A;  1AEX A;  2A6E D;  2RA4 A;  1HA5 A;  1QOH A;  1GOZ A;  2PYK A;  4EQN A;  1TII D;  4IAL A;  5EJW A;  5KYI A;  3NWT A;  3K7A H;  1EWC A;  3HOW G;  2BH2 A;  1YNJ C;  2UUA Q;  2NUC A;  5DEH A;  5IP9 H;  1B53 A;  3L9A X;  5C3E G;  4YY3 L;  5EBD A;  1B4O A;  4RCO A;  2B63 B;  3TS2 A;  1WTW A;  1LTL A;  1JB3 A;  3U4Z A;  1VQO A;  1F2Y A;  1RDP D;  1WOC A;  2ZM6 Q;  1MKH A;  3Q23 A;  1CFM A;  4DV7 L;  3DEP A;  3W2D A;  4RKB A;  3NEM A;  1SR3 A;  5GAH C;  1OXX K;  3AFQ A;  2A6H C;  1A2U A;  3LX0 A;  2VB2 X;  3DUZ A;  3MXN B;  3CW2 C;  2B2Y A;  4L5T A;  1PZI D;  3PO3 H;  3I4N H;  5LHY 1;  5IP7 G;  4CGY B;  1NMF A;  3C2P A;  1P16 A;  1PZK D;  5GAE C;  4K0K L;  1GUO A;  1YBY A;  1Y8O B;  5M9O A;  2B63 G;  1SXT A;  1KQS A;  2Z1C A;  4OO1 G;  4UP8 A;  4LNQ A;  3HOX G;  2NB0 A;  2Z8L A;  1Q8K A;  4ME5 A;  1SE3 A;  4FO2 A;  1HTP A;  5K5P A;  4DR3 Q;  3R3O A;  2IWH A;  3BZK A;  5ELD A;  1CKN A;  2PMZ B;  2BDO A;  2F0Q A;  5G3L F;  1WTR A;  3OYY A;  3S16 B;  3DWQ A;  3T16 A;  1RF2 D;  4HCS A;  3MVV A;  2VL6 A;  4LAA A;  2F0I A;  1B44 D;  4DV5 Q;  1SYF A;  1OXT A;  3T13 A;  4X62 Q;  2QA4 A;  4CKB A;  2AWO A;  3RLO A;  3T1Y Q;  2SNM A;  2F0L A;  1PYB A;  3DM1 A;  1XPU A;  4QY7 A;  4ALP A;  2JA7 B;  2F0K A;  1GHK A;  5GAG C;  1Q3L A;  4DPG A;  2WII B;  2E76 C;  1QVC A;  1EYC A;  4JI3 L;  1CKO A;  4L6T B;  3UE0 A;  2PW7 A;  5FLX c;  3MEF A;  1SFO H;  1T5E A;  5H1S E;  1HHV A;  3I4O A;  5IGB A;  4KV6 A;  5LL6 S;  2MO1 A;  4BBR H;  1HXY D;  1VQ5 A;  2AHO B;  3VR6 A;  1ILP A;  4JI6 Q;  4XDX A;  2RKS A;  3AFP A;  4A3I B;  1V1P B;  1F2M A;  3AMU A;  2F0D A;  2PNR C;  2OCE A;  2XSC A;  2KBN A;  4LJZ C;  1I4G A;  4OWT B;  3NEL A;  4Q0F A;  1TXY A;  2EPB A;  2F0M A;  1U4M A;  2D62 A;  4A93 G;  1JQY D;  1NNX A;  4GKK Q;  4XIG S;  5LMU L;  4KKU A;  1WD1 A;  1EFW A;  4CDC C;  3LNN A;  4A93 H;  2N49 A;  1A6X A;  5DLQ E;  4IFD J;  3S2H H;  1F9R A;  4XQN A;  5BR8 L;  2F0S A;  1U4R A;  4K0K Q;  4A93 B;  2PCF B;  5M3M B;  3E6Z X;  4RMF A;  3S2H B;  1ET6 A;  4BY7 G;  4A3C G;  5IE8 A;  3SGI A;  3MFG A;  4X3K A;  4RGN A;  2AKW B;  2R92 H;  2ZTC A;  2Q2I A;  2OXP A;  3TME A;  3BVM A;  2F0E A;  4C56 C;  2XVS A;  4ABN A;  1CKM A;  3K0Y A;  2R92 B;  2X69 A;  3H94 A;  2UUC Q;  1PV4 A;  1EUJ A;  1SNP A;  4GLV B;  4LF6 Q;  4IPG A;  4DUZ L;  1Y1V B;  5ELE A;  4JI7 Q;  2SOB A;  3BDC A;  4JI4 L;  4TSS A;  1KDA A;  1TWF H;  1P8L A;  4GZY C;  2F03 A;  1L1O C;  2RHS B;  1YHA A;  3PUW A;  1CQV A;  4N9P A;  3WWV A;  2NZO A;  3F1Z A;  1C8C A;  3HOX B;  3HS0 C;  1CK1 A;  1NSN S;  3J7A V;  1FNU A;  2ALY B;  5LMN W;  5JPM C;  4HTH A;  4AQY Q;  3FDT A;  5E4X A;  1QZG A;  2ZTE A;  5I2X A;  1XMO Q;  4RGT A; 
#chains in the Genus database with same CATH homology
 2M2L A;  3KBG A;  4DXG A;  5KYL A;  1EIG A;  5C6A A;  4FYD A;  1XTC D;  4NKL A;  5G3L D;  1LTB D;  2LKV A;  1F77 A;  1TY2 A;  1SE2 A;  1ZXT A;  2F0H A;  2WAC A;  4BA1 I;  2AQ1 B;  1V43 A;  4H0L C;  1SMY D;  1VF7 A;  1FNV A;  3I70 A;  4BBS B;  1JC7 A;  3NBH A;  4B9X A;  4H13 C;  1EU4 A;  3NPP A;  1A3T A;  1LTA D;  1SDF A;  3EFX D;  5C44 B;  3NQT A;  3GV3 A;  1BCP B;  1EQV A;  5I9P A;  2LMC B;  4QUF A;  1BQQ T;  5KRU A;  1MBY A;  5IGG A;  1PMR A;  3OIP A;  4C3H B;  4F87 A;  5AFW A;  3TDQ A;  1STN A;  2BDN A;  2RSN A;  3QO2 A;  2EYJ A;  1JWM D;  4OIK A;  1ESF A;  3BYT B;  3RD4 A;  2NVQ B;  3K5L A;  1QG7 A;  3H09 A;  1Q8I A;  2NZ1 D;  1H9K A;  3UI2 A;  1LTI D;  5EQ0 A;  3SR1 A;  1SND A;  2L0C A;  2B39 A;  4ILW A;  1CI3 M;  1NCV A;  1JR0 D;  3HOY B;  1R4Q B;  1STH A;  2RVL A;  5K36 G;  2G9H D;  2ID0 A;  3QOJ A;  1EZ8 A;  2K28 A;  5EPK A;  2WP8 J;  1AZP A;  4KJN A;  1UUP A;  4ZRZ A;  3NWS A;  3BYY B;  2K01 A;  4DAP A;  3P7J A;  4E6I A;  2KCC A;  3OSO A;  3TZD A;  1JWU D;  4RWS C;  3PO2 B;  4PMB A;  3SK4 A;  1BOS A;  5IT9 E;  1MI2 A;  4K5W A;  4ID6 A;  1R9T B;  2XRQ D;  4L8J A;  1KDB A;  3S15 B;  3FVQ A;  3KLS X;  2BE5 C;  4IUQ A;  2A73 B;  5I9O A;  4QIW B;  1KAB A;  1PFM A;  2JXM B;  4JBW A;  3NE5 B;  1JCK B;  4K5V A;  2ZXP A;  1ESR A;  5JPN C;  4EQO A;  1FR3 A;  5CMD A;  2DNE A;  2MP1 A;  4F8M A;  2L5T A;  1M4V A;  1WCM B;  2I46 A;  2QIL A;  5J22 A;  1BBX C;  1CT1 D;  1CA6 A;  3Q24 A;  5D3I B;  4J8Q A;  1DON A;  5IGC A;  1BF4 A;  1H9J A;  2IPK D;  3X3M A;  3JAM L;  2ENB A;  2PZW A;  4NMZ A;  3HEJ A;  3T56 B;  2EY5 A;  3MZ5 A;  5JOB A;  4ZK9 B;  3K7A B;  2KED A;  1YNJ D;  4X3T A;  2QCP X;  1LAB A;  1G2S A;  1BXT A;  1L0Y B;  2J7Z A;  4FNF A;  2J4X A;  3U9S A;  3J80 L;  1O7Y A;  3I4L A;  1ONL A;  2K05 A;  2WIN B;  3A8J E;  2A68 D;  3PIO 3;  3S9W A;  4KTA A;  3OWF A;  3RLF A;  2BCO A;  1Q1E A;  2B8F A;  2FJ2 A;  3KF8 A;  1ROD A;  1A15 A;  1TR5 A;  1W6K A;  3GTJ B;  3D6W A;  3MWY W;  3D6C A;  5CGK A;  3AB9 A;  3SK8 A;  1STA A;  1V1O A;  2QEJ C;  5C4Z A;  2F0T A;  1F2Z A;  3A55 A;  4QB4 A;  2F3V A;  4S3S A;  1BCP C;  1WD0 A;  2O5I C;  2EY2 A;  2K32 A;  1FD7 D;  4IUR A;  2EYM A;  1IHZ A;  4TKO B;  2B2Y C;  2JA5 B;  1CHQ D;  2JSO A;  1QB5 D;  4MHE A;  1KNE A;  1E2V A;  2Z4I A;  1JOR A;  2MJ8 A;  1TWF B;  4K5X A;  3SE0 A;  3K6O A;  4NP5 A;  4ZUJ A;  4PNY A;  1EU3 A;  3M3Y B;  2E2J B;  4CJ0 B;  1HPC A;  4WJW A;  4HR7 B;  1KDC A;  1MSG A;  4DNR B;  1I4R A;  3SVM A;  3OMG A;  2KOL A;  2L11 A;  5C3X A;  1RJT A;  5ELB A;  5JAV A;  1EZ6 A;  3PUZ A;  3LWU A;  5KIX A;  1TS5 A;  1SBB B;  3CRL C;  4YIJ A;  5HUR A;  2NYZ D;  1JOK A;  1H9M A;  1BDO A;  2BE5 D;  3D8G A;  4DK0 A;  2EJF C;  3QJY A;  2HQE A;  4XYO A;  4QF4 A;  3O13 A;  3IKJ A;  2E74 C;  3KK7 A;  2AQ2 B;  5F2D A;  3IAY A;  2NVY B;  3D3R A;  2MHV A;  1EYA A;  1QNU A;  1G6Z A;  3K5N A;  4KKS A;  1GHJ A;  1VCI A;  2AUJ D;  5FLX E;  4QCL A;  1YNN C;  5COY A;  2R7Z B;  1HCZ A;  3NXW A;  5EPJ A;  2JA8 B;  1TWA B;  1SMY C;  1G8Z D;  3U9O A;  1NUC A;  1DZ1 A;  5DM7 3;  2EYF A;  2EDG A;  2NTS A;  4F88 A;  2EVB A;  5C0X G;  1I3Q B;  1STG A;  1DCZ A;  1X3Q A;  3ONA B;  1XX8 A;  1B9N A;  4G7H C;  3TP5 A;  3SK6 A;  3S1R B;  2CQA A;  4A3D B;  1LTT D;  2JA6 B;  3NK9 A;  3MFY A;  4DF7 A;  5JJZ A;  2VXW A;  1F9Q A;  4RH6 A;  4DN4 M;  4IZ8 A;  3N6R A;  3VYU A;  4QMG A;  3SK5 A;  1CHP D;  1EY0 A;  2O2L D;  1DYQ A;  2KQ3 A;  5FO8 B;  1IW7 D;  1KLU D;  1TY0 A;  3VR4 A;  4WOR A;  3VR5 A;  5JEA H;  1SYG A;  4FF1 A;  5C0X I;  4RFB A;  3FKI B;  3HP3 A;  4U67 3;  4U68 A;  1E0B A;  1TQO A;  4ZKB B;  1SE4 A;  4X3S A;  3RZO B;  1ET9 A;  5C4H A;  2B2T A;  2EYH A;  2EY1 A;  2NN6 I;  2PO4 A;  5IOC A;  1IYV A;  3HOU B;  1RKN A;  2HDL A;  1D5Z C;  3SHL A;  2OEO A;  1B3A A;  1UNS A;  1AW7 A;  3T4A C;  1PTO C;  2IX1 A;  2WAQ B;  3ITP A;  3FEW X;  4FF2 A;  3CQZ B;  3EQL C;  5KEE A;  3S1M B;  4PMW A;  4BY7 B;  4DU9 A;  2R6G A;  4KY7 A;  1TKW B;  5CBA E;  4M8A A;  1D1I A;  3NSW A;  3ND9 A;  3TP7 A;  5M3F B;  2OT2 A;  3LWE A;  3VA5 A;  4NW2 A;  2EOT A;  1PDQ A;  5K36 H;  1FGB D;  3VR3 A;  1CA5 A;  2L1B A;  4DNT B;  2EE1 A;  5ELC A;  4IQZ A;  1O80 A;  2E2H B;  3N52 A;  3L3O C;  1PFN A;  4ZLT F;  2QDB A;  3X3N A;  2NBF A;  3I73 A;  2KA7 A;  1RCV D;  3KBX A;  3WDN A;  1B50 A;  2FMC A;  1A2T A;  1XYI A;  3S2D B;  1RTN A;  1G2T A;  1QCB D;  3VYS A;  3I4M B;  4IUT A;  4HMI A;  3NBI A;  5IGF A;  2A6H D;  5JVH 3;  3Q0A A;  1GUN A;  1Q12 A;  5M5Y B;  2L4N A;  4KI0 A;  1TU2 B;  2X6G A;  4XQJ A;  1K8M A;  1PRT C;  4C3J G;  4DAY A;  4C1N I;  1TVX A;  2ZXO A;  2NN6 H;  3MXG A;  1I4X A;  4R8I A;  2XWB B;  4R9W A;  3GTL B;  2F0F A;  1W6J A;  1LTR D;  3A54 A;  4BWG B;  4DGZ A;  5EKI A;  4ZQ3 A;  3BDO A;  1CM9 A;  1WVL A;  1M8A A;  2K7V A;  1NR2 A;  5J1Z A;  1ENC A;  1ENA A;  4O42 A;  4KHZ A;  2R93 B;  2KJX A;  5CV8 A;  1Z6H A;  2A5H A;  1PTO D;  3OMC A;  1SEB D;  3AU7 A;  3PUY A;  2D5D A;  5C0X H;  2B2V A;  1ENF A;  1EEI D;  1SNO A;  2F0N A;  4XQQ A;  1I6H B;  1I4P A;  1RD9 D;  3PMF A;  1JWS D;  3S1Q B;  1TS3 A;  5D65 A;  2G9D A;  1SFO B;  3J80 E;  3C46 A;  2QF7 A;  1S5F D;  1WTP A;  4A3M B;  2F0J A;  2IW3 A;  3M7G A;  2MPM A;  3MTS A;  3OHX C;  2MGS A;  1NAP A;  1EL0 A;  5COR A;  1II3 A;  1PFB A;  3D4W A;  2A6E C;  2E2D C;  4FXD A;  3H91 A;  1A3U A;  2F0P A;  2FHT A;  1DD2 A;  4KN7 C;  5DAU A;  3SDZ A;  4RGO S;  4OO1 H;  3VYR A;  4C2M B;  4J1M A;  5FK9 C;  2HCI A;  2IX3 A;  1PRT B;  2ICE C;  3PV0 A;  4DAV A;  3OW7 A;  2AUK A;  4RA8 A;  2N88 A;  3I91 A;  4PMC A;  4IUV A;  5T1I A;  1ILQ A;  3D31 A;  2LS0 1;  1V1P A;  3BZD B;  4A3K B;  3NTK A;  4IUP A;  3J81 L;  2D9U A;  5IIF A;  1X32 A;  2EYO A;  1SJE D;  4TRD A;  2D2C C;  2WKD A;  5M5W B;  4UAI A;  1F9S A;  2RSO A;  2M00 A;  3Q6S A;  3S1N B;  5BN3 A;  2KVM A;  1EY7 A;  1EY5 A;  1I4H A;  1YNN D;  3I72 A;  4C3I B;  5CV7 A;  5EGT A;  3BVZ A;  1PTO F;  2KEE A;  4XT1 B;  1I50 B;  3I8Z A;  1F2L A;  2RDG A;  4MIU A;  1D6E C;  3GP7 A;  1STE A;  3IFT A;  4N9T A;  4OIJ A;  4IUN A;  3GTM B;  4HMJ A;  4HSP A;  2B2T C;  4KY6 A;  5EBC A;  1PRT D;  2KCN A;  4CJ2 C;  2MUY A;  2H1E A;  5DNF A;  1EY4 A;  2JEB I;  2TMP A;  1Y8N B;  3G7L A;  5IOD A;  3MA2 B;  3HKZ B;  4XT3 B;  4C3H G;  3V2T A;  1Z47 A;  3OIQ A;  1SNC A;  2KEC A;  3W3A A;  5C3E B;  2IX0 A;  5LL6 X;  5A35 A;  5IGE A;  3M7N A;  4V0B A;  3HOW B;  1T5X D;  2SDF A;  3NTH A;  2LFN A;  4OGQ C;  4A3F B;  2XRS D;  5KND A;  5EKL A;  3R2I A;  2N55 A;  1EWH A;  3GTO B;  3Q22 A;  4F7X A;  4TQU S;  5C5L A;  2GA4 B;  1PLF A;  5CBE E;  1K8O A;  1DJR D;  4KKT A;  1IKL A;  2PW5 A;  2B2W A;  2RDH A;  1BUV T;  3C1F A;  1LTS D;  3MEH A;  1GUW A;  3R93 A;  2E75 C;  2F1M A;  3QOL A;  4A3G B;  3D4R A;  3K59 A;  5KNB A;  1Q90 A;  3GO5 A;  3FPU B;  2K6A A;  1BO0 A;  1R4P B;  3BVG A;  3SXH A;  3T51 B;  5I2Y A;  1JIC A;  5FO9 B;  1FNW A;  4B08 A;  3VR2 A;  4BY1 B;  3NHH A;  1TWG B;  1D5X C;  3PO3 B;  4V19 0;  3S17 B;  5E4W C;  2F3W A;  1STB A;  1K83 B;  5ELF A;  2L12 A;  5C0X J;  1VDZ A;  4KD4 A;  2Y0S B;  1S5E D;  4CBV A;  3DHQ A;  3I3C A;  3URY A;  4WRD A;  3IL8 A;  1MSH A;  1LT5 D;  4CHT B;  4K6D A;  5D14 A;  3HOZ B;  3EJI A;  1KLG D;  1B1Z A;  3L7Z C;  1C48 A;  2AQ3 B;  1LO5 D;  4KD3 A;  1J9O A;  4HSV A;  1TS4 A;  1Y69 U;  1XWE A;  3PUV A;  1GUT A;  1LAC A;  2EZV A;  2F0V A;  3MXU A;  5CV5 A;  5JVG 3;  1PXU A;  4OO1 I;  5IT9 L;  2OF1 A;  3EVQ A;  3KLR A;  5IGD A;  2XWJ B;  4WFN 3;  4EVO A;  3PUX A;  2XNA C;  5C3W A;  2Q8R E;  4IUU A;  1IL8 A;  1EIH A;  5JEA J;  1EFI D;  4Q5V A;  3NUC A;  1HUN A;  2FFK B;  1NR4 A;  1EYD A;  1I4Q A;  4NDX A;  5FLX L;  3OPO A;  1KAA A;  1S4Z A;  1SYC A;  3GTK B;  4IN3 A;  2JP1 A;  4LMQ D;  1DXM A;  1EEF D;  1I6V C;  3M85 A;  1BCP D;  4KHV A;  2EJM A;  2X6L A;  4PQX A;  4EGV A;  1QE6 A;  5NUC A;  5I6W A;  3QG1 A;  1LT4 D;  1OXS C;  3JAM E;  2HDM A;  2O5J C;  4C1N K;  2H4O A;  4CKE A;  1IW7 C;  2PZU A;  1S5D D;  4FXK C;  3HGB A;  1FYC A;  2WV6 D;  3BS1 A;  4PV1 C;  3V96 A;  2CVR A;  3TZU A;  2R3Z A;  3P75 A;  1DOM A;  2FIN B;  1LTG D;  1C4Q A;  3MC0 B;  2ZT9 C;  1MGS A;  3RUZ A;  3TP8 A;  2F0U A;  3IFD A;  1CZG A;  1EY6 A;  3H0G B;  4RKL A;  3BDL A;  4MN3 A;  1DOK A;  2JYO A;  2CW0 D;  4ZAI A;  3I90 A;  4XYQ A;  5FOB B;  3F2U A;  2XIW A;  5EPL A;  2V4D A;  1DOL A;  2KUM A;  3C3L A;  1D1K A;  2B8G A;  4FVM A;  5HGT A;  1A3V A;  5BN5 A;  3QB3 A;  5C5M A;  4AYB B;  1S5C D;  3T53 B;  1D5M C;  4BS9 A;  2F0W A;  2K1B A;  1CTM A;  2Z4H A;  1H9S A;  5M5X B;  1X3P A;  1B2T A;  1TT2 A;  3WOE A;  4K2K A;  3J81 E;  3GD7 A;  3E0J A;  1OXU A;  3FMC A;  2DY8 A;  4RHR A;  3KUP A;  2J0T D;  3FRP B;  3HG9 A;  5FO7 B;  1WTX A;  1GJX A;  5KNC A;  2PZT A;  4HAE A;  1CQF A;  2IT1 A;  1QNK A;  4UDU C;  3P20 A;  1SJH D;  1AN8 A;  2HCC A;  1Q1B A;  4K6L A;  4G7O C;  2WB1 B;  2F0G A;  5CC4 A;  4ULL A;  1L0X B;  3K57 A;  4DK1 A;  4RCN A;  5C4J B;  1PTO B;  2IL8 A;  3NTI A;  3SEB A;  2Q8I B;  3K58 A;  1VF5 C;  2RBM A;  4I7Z C;  4IFD G;  2NVT B;  3CHB D;  1ZKO A;  4XXE A;  3C1E A;  1G91 A;  4KJO A;  1LT3 D;  2A69 C;  1SNM A;  1DM0 B;  3ND8 A;  3VA7 A;  2I07 B;  3TBI B;  2VUM B;  1ZYR C;  3OOC A;  4RHS A;  3MXP A;  4K8J A;  1STY A;  5CYU A;  1MD2 D;  2L55 A;  5CV6 A;  3QIA A;  2BA1 A;  1ZEQ X;  3GTP B;  2RQX A;  4EQP A;  1PRT F;  3K5O A;  1ML0 D;  2CW0 C;  3FPP A;  4K14 A;  3QWN A;  3VYT A;  3D4D A;  3MHB A;  4G57 A;  1EOT A;  1BNZ A;  2B2U C;  2ICI A;  5FKA C;  1VMC A;  1TS2 A;  5A2Q L;  1PZJ D;  3G6J B;  1PYW D;  4RAU C;  2BOS A;  5J39 A;  4L63 B;  5DM6 3;  3H6M A;  2RDF A;  2L9H A;  1U9R A;  1AP0 A;  4KN4 C;  3K5M A;  1ICW A;  4IFD H;  5T1G A;  1HUM A;  5KGU A;  5A2Q E;  1IYU A;  2ZXR A;  1HTL D;  4BA2 I;  1HFN A;  2XN9 C;  1WTQ A;  1U4L A;  2PQE A;  1AFP A;  4R8N A;  3ERO A;  3CU7 A;  3DWA A;  3DEO A;  1E2W A;  4K2L A;  4FXG C;  1O78 A;  2F0O A;  2K5Q A;  4K8I A;  2TSS A;  3A7L A;  1JOQ A;  2K04 A;  5C4X B;  4Z9C B;  1H9S B;  3I4N B;  2K5D A;  2NWG A;  3M4Y A;  2JEA I;  3TN2 A;  2SEB D;  4M1U B;  4A3B B;  1S5B D;  4DFA A;  5I6Y A;  3HRZ C;  4HCE A;  2PPB C;  1IKM A;  4H44 C;  1GXD C;  3ZYY X;  5CV9 A;  3CKI B;  4FF4 A;  2IJ0 A;  2NN6 G;  1B9M A;  5CV4 A;  3GTG B;  4OHJ A;  1KTK A;  4KK7 A;  1EY9 A;  3MAQ A;  1LLR D;  3PIP 3;  3BG3 A;  4X3U A;  3WOF A;  4ODG A;  3ERQ A;  1F9P A;  3EA6 A;  1H9R A;  2DNC A;  2K5W A;  3A8I E;  1XXG A;  3GV6 A;  1SYE A;  4BBR B;  4KMU C;  2VB3 X;  1Y1W B;  2C9O A;  1TWC B;  1HQR D;  3R2T A;  1SAP A;  4ZUI A;  3P1H A;  4I65 A;  4DA2 A;  3TSS A;  2B2W C;  1HA6 A;  1UEA B;  2NTT A;  1QJO A;  1OO9 B;  1SNQ A;  5ISR A;  1KNA A;  4C3I G;  4B9W A;  4RGM A;  1ZYR D;  1JOO A;  3OWE B;  2DY7 A;  2A68 C;  5TSS A;  1E2Z A;  5E1F A;  2NVX B;  1RHP A;  4A3E B;  3R8B A;  4O1N A;  4XTC S;  4QUC A;  1CZW A;  1AZQ A;  5BN4 A;  3RZD B;  1SYB A;  1Z7T A;  1SSO A;  3DMU A;  2K03 A;  4JK1 C;  4J6H A;  1EY8 A;  4LK1 C;  2FMM A;  1BCP F;  2JE6 I;  2O4X A;  3M4O B;  1WTV A;  4KY5 A;  2SNS A;  4A3J B;  3NP8 A;  1GUG A;  4P2C B;  2EYP A;  2EXZ A;  2EJG C;  4H7B A;  2E2I B;  1HQM C;  1G29 1;  3J7A F;  1O7Z A;  2EYL A;  1WTO A;  3GTQ B;  4IFD I;  1O7L A;  2EY6 A;  2Q8T A;  1HFG A;  1U4P A;  2DN8 A;  1TWH B;  3HZX A;  4FP5 D;  2A69 D;  4C3J B;  1V8Q A;  2LY7 A;  1LV9 A;  1GUS A;  3NQI A;  2AWN A;  2HUG A;  4FF3 A;  3DWP A;  3E5S A;  3GQB A;  3V05 A;  1Y8P B;  1OXV A;  2B2V C;  1EQT A;  3CRK C;  1HRJ A;  2R61 A;  1QIL A;  4Y7N B;  2QKI C;  2A74 C;  4CKC A;  2BA0 A;  2YU9 B;  1LT6 D;  3DXJ C;  5CR3 A;  3A56 A;  5JEA G;  2C5C A;  4ZKC B;  3KLS A;  3H3V C;  4CJ1 B;  1VMP A;  2VNU D;  1QWY A;  4G7Z C;  5EKK A;  3J7Y W;  1D2B A;  2B2U A;  4OL7 A;  3HOV B;  3MXN A;  4G4K A;  4ZYS A;  2YYZ A;  5I4D A;  2F4I A;  1SYD A;  5E3F A;  2CHB D;  2KHS A;  4DXF A;  3S14 B;  3A8K E;  2WKC A;  1J8I A;  1PTO H;  2K33 A;  1JE4 A;  3TP6 A;  4HED A;  1BR9 A;  4HN7 A;  3RMH A;  2M9V A;  3A7A B;  1RTO A;  5D3D A;  1UAP A;  1AEX A;  2A6E D;  2RA4 A;  1HA5 A;  1QOH A;  1GOZ A;  2PYK A;  4EQN A;  1TII D;  4IAL A;  5EJW A;  5KYI A;  3NWT A;  1EWC A;  1YNJ C;  2NUC A;  5DEH A;  1B53 A;  3L9A X;  5EBD A;  1B4O A;  4RCO A;  2B63 B;  1WTW A;  1JB3 A;  1F2Y A;  1RDP D;  3Q23 A;  1CFM A;  3DEP A;  3W2D A;  4RKB A;  1OXX K;  2A6H C;  1A2U A;  3LX0 A;  2VB2 X;  3DUZ A;  2B2Y A;  1PZI D;  5LHY 1;  4CGY B;  3C2P A;  1PZK D;  1GUO A;  1Y8O B;  5M9O A;  1SXT A;  2Z1C A;  4OO1 G;  2NB0 A;  2Z8L A;  4ME5 A;  1SE3 A;  4FO2 A;  1HTP A;  5K5P A;  3R3O A;  2IWH A;  5ELD A;  2PMZ B;  2BDO A;  2F0Q A;  5G3L F;  1WTR A;  3S16 B;  3DWQ A;  3T16 A;  1RF2 D;  4HCS A;  2F0I A;  3MVV A;  4LAA A;  1B44 D;  1SYF A;  1OXT A;  3T13 A;  4CKB A;  2AWO A;  2SNM A;  2F0L A;  3DM1 A;  2JA7 B;  2F0K A;  1GHK A;  1Q3L A;  2WII B;  2E76 C;  1EYC A;  4L6T B;  2PW7 A;  1T5E A;  1HHV A;  5IGB A;  4KV6 A;  5LL6 S;  1HXY D;  3VR6 A;  1ILP A;  4XDX A;  2RKS A;  4A3I B;  1V1P B;  1F2M A;  3AMU A;  2F0D A;  2PNR C;  2XSC A;  1I4G A;  4LJZ C;  4Q0F A;  2EPB A;  2F0M A;  1U4M A;  2D62 A;  1JQY D;  4XIG S;  4KKU A;  1WD1 A;  3LNN A;  1A6X A;  4IFD J;  1F9R A;  4XQN A;  2F0S A;  1U4R A;  4A93 B;  2PCF B;  5M3M B;  3E6Z X;  3S2H B;  1ET6 A;  3MFG A;  4X3K A;  4RGN A;  3TME A;  2OXP A;  3BVM A;  2F0E A;  4C56 C;  2XVS A;  4ABN A;  3K0Y A;  2R92 B;  2X69 A;  3H94 A;  1SNP A;  1Y1V B;  5ELE A;  2SOB A;  3BDC A;  4TSS A;  1KDA A;  4GZY C;  2F03 A;  3PUW A;  1CQV A;  4N9P A;  1C8C A;  3HOX B;  3HS0 C;  1CK1 A;  1NSN S;  3J7A V;  1FNU A;  5JPM C;  4HTH A;  3FDT A;  5E4X A;  5I2X A;  4RGT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...