1J9OA

Solution structure of human lymphotactin
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
93
structure length
93
Chain Sequence
VGSEVSDKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCADPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LYMPHOTACTIN
publication title Monomeric solution structure of the prototypical 'C' chemokine lymphotactin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
total genus 12
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2001-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1j9oA00
4LMQD 2MPMA 2K05A 1ESRA 2L12A 1NR2A 3TN2A 4CJ0B 1B3AA 1PFNA 2VXWA 1WTXA 2FJ2A 4IUTA 1HHVA 1PFBA 1MSHA 2HDMA 4MHEA 1MSGA 2RA4A 1Q3LA 5E4WC 3ONAB 2HCIA 2M2LA 1SDFA 1TVXA 2DY7A 4RA8A 4ZKCB 4IURA 2EE1A 1HFGA 1RODA 1X3QA 3KBXA 4RAUC 1RTOA 1F2LA 1U4MA 1WTOA 1HA6A 1HFNA 2KOLA 1B53A 2B2YA 2IL8A 3IFDA 3I3CA 5E4XA 1ILPA 4HAEA 2B2YC 1O80A 3GV6A 4IUUA 1F9RA 1SAPA 3I91A 1U4LA 2K28A 5T1IA 3GV3A 1EIHA 3IL8A 1AZQA 4XT3B 1J8IA 1VMCA 2K04A 1NCVA 1B4OA 2L9HA 1AZPA 1CA5A 5CBEE 1IKMA 2RVLA 2RSNA 2L11A 1WTPA 1WD0A 1HRJA 1AP0A 1PLFA 1F9PA 1G91A 1U4RA 1LV9A 2NYZD 2X6GA 3DEPA 2D9UA 4ZKBB 1WD1A 5D65A 5D14A 1M8AA 3KUPA 1DONA 2H1EA 1RTNA 2HCCA 4IUVA 1WVLA 1JE4A 4R8IA 4MN3A 4ZK9B 1ILQA 3LWEA 5T1GA 5JJZA 1X3PA 2X6LA 2K01A 1MGSA 2Q8TA 2L4NA 1SSOA 4IUPA 2B2TA 2L1BA 2RSOA 1EL0A 2FINB 3P7JA 2B2TC 3MTSA 2CVRA 5EPKA 3I90A 2FMMA 4ZLTF 5CMDA 5EPJA 3R93A 1BF4A 2KECA 3D6WA 1WTWA 4X3KA 1HUNA 4RWSC 1KNEA 2KUMA 2N88A 1DZ1A 1WTVA 2J7ZA 4CJ1B 2FFKB 4QUCA 1RJTA 1F9QA 3Q6SA 2N55A 5EKIA 2BDNA 1BNZA 1JICA 2MP1A 1NAPA 3DEOA 3TZDA 3FPUB 1IKLA 3DM1A 1G2SA 3SVMA 1IL8A 4QUFA 1G2TA 4U68A 1X32A 2MJ8A 3QO2A 4HCSA 1S4ZA 2X69A 1B50A 2K03A 2B2UA 4XDXA 2KVMA 2NZ1D 4NW2A 1DOKA 1XX8A 2B2UC 2HUGA 2HDLA 2JYOA 1ML0D 2MGSA 2XIWA 1F9SA 3UI2A 1NR4A 1O7ZA 2EOTA 1J9OA 1EQTA 1PFMA 4HSVA 4CJ2C 5CBAE 1VMPA 1GUWA 1DOLA 2B2WA 4XT1B 4ZAIA 2R3ZA 4OIKA 2Q8RE 1RHPA 1B2TA 2B2WC 2NWGA 4X3UA 1WTRA 4OIJA 5EPLA 1QE6A 1CA6A 1BBXC 3G7LA 1ZXTA 3N52A 2KEEA 1U4PA 4O42A 1HUMA 1DOMA 4HEDA 1MI2A 2SDFA 3H91A 1BO0A 2JP1A 1E0BA 1A15A 5AFWA 5CORA 1WTQA 2DY8A 5DNFA 1EOTA 1CM9A 3I8ZA 1QG7A 2K1BA 1O7YA 2B2VA 2FHTA 3HP3A 5EJWA 5EQ0A 4IUQA 5COYA 4DN4M 1G6ZA 1C8CA 2EPBA 1ICWA 2B2VC 1EIGA 1PDQA 2KEDA 3MWYW 4UAIA 4X3SA 3F2UA 1QNKA 4R9WA 3FDTA 4X3TA 1XYIA 1KNAA
chains in the Genus database with same CATH superfamily
1OO9B 2K05A 1SNPA 2MO0A 1WTXA 4ZQ3A 2N49A 2ALYB 2LFNA 3MXGA 1GHJA 1BXTA 2EXZA 1SDFA 1IBML 3KBXA 3GTOB 1TS5A 2G9HD 4FNFA 5CYUA 1IL2A 4JYAL 1VQ5A 3ZJYC 2B2YC 3HOXB 4A3GG 1YNXA 3H0GB 3EN2A 2AWOA 4L5RC 4KHZA 3UDGA 1PZJD 3EA6A 4KHVA 1VQCA 1S72A 1SMYD 3KJOA 3L0OA 5EGTA 3HOXH 2EVBA 4F87A 4X62Q 3HOUG 3H0GH 5BN4A 1IBLL 4BBSG 4RHRA 1VQ6A 1QOHA 1Q90A 4LJZC 5D65A 1S5CD 3E0JA 4GLAC 3E9HA 4DK1A 1NUCA 2NN6G 3OTOQ 2R92B 2K01A 2Q8TA 4P72A 1VQ9A 4HMJA 3M9BA 2CQAA 4LK1C 1E2VA 2KECA 1LTLA 3FPPA 4C3IH 2R92H 2VY3A 1DZ1A 1CQFA 3CRKC 1X55A 3BS1A 3LGJA 1EYDA 1Z47A 1STGA 3J80E 1A2UA 1KTKA 2KCMA 3TDQA 2Q2IA 3ICEA 3NBHA 5J22A 2K33A 5I4DA 2X69A 2YTXA 2PZWA 3HS0C 1PZID 4XDXA 1WYDA 4DR1L 1AN8A 3HOYG 3GP7A 1MD2D 3CCRA 4B3SQ 4NMZA 3MVVA 4KD4A 2F0KA 5KRUA 2LXJA 1K8MA 2JA9A 4FF1A 1D6EC 1TQOA 2Q8RE 1P8LA 1XPOA 2B39A 4S3SA 1II3A 1SYBA 1ZXTA 3AYHB 3KDFA 5BR8L 4P74A 1DOMA 2KCNA 4A3DG 1F2MA 2JP1A 4A3EG 1N34L 4JV5L 3TBIB 1CM9A 3HP3A 4AIMA 3L3OC 1ICWA 2DN8A 3HKZB 5IWAQ 2KEDA 3G6EA 3IKJA 4TQUS 4OWTB 3D3RA 3CCEA 1JJGA 1HTPA 1Q81C 1Q86C 1HH2P 4BA2I 5C3EG 3V05A 1Y1WG 1KHIA 2HDMA 4MHEA 2Z4HA 2HIXA 1VQPA 1TVXA 2DY7A 5LMNL 5CV6A 3HG9A 1LO5D 1JWSD 3VR4A 4BY1G 3DUZA 3C3LA 1QZHA 2VB3X 3K57A 4JOIA 2K52A 3IL8A 4KK7A 5LL6S 1ENFA 1XMOL 3KOJA 1JQYD 2UU9L 5DM63 4JW0A 1I4PA 1UAPA 1LV9A 4X62L 2FXQA 1I6VC 5FLMH 1J6QA 1JB3A 1LM0A 2J4XA 1VF5C 1GUNA 4FXKC 2K5HA 1A3TA 3X3MA 3D4DA 5IT9c 3AU7A 2F3WA 4BA1I 3MTSA 3PIOA 1LTBD 2KQ3A 3VYUA 3A8KE 3IRBA 1SNCA 4FF4A 4JG2A 4RFBA 3TRZA 3HOVG 3KJPA 4MTKA 5ELEA 2B63B 3CD6A 2OQ0A 1MJCA 1F9QA 2AHOB 1D7QA 3SGIA 3K5OA 2VQFQ 4GOPB 4CKBA 4FYDA 4IJLA 4EGVA 1NMGA 4X65L 3KDFB 1UNSA 4K6DA 2CQOA 2JA8G 4WJWA 2B63H 4NW2A 1DOKA 3VR3A 1HXYD 4HIDA 2K5NA 2KENA 1IW7D 1NR4A 2HQLA 4A3JH 4DUZL 1QWYA 1Z9FA 1N36L 1XNQQ 2KCCA 3WWVA 4A3BH 3PO3B 1RD9D 1F77A 4OO1H 2B2WA 3M4QA 1B2TA 2XRSD 1EZ6A 1WFQA 1STBA 4X3UA 1WTRA 3VA5A 1HR0Q 3M7NA 1BOSA 5BN3A 3TS2A 3PO3H 1MI2A 2JSOA 5JJKA 5J39A 1PYSB 5IGDA 3SR1A 3NHHA 3Q24A 1G8ZD 1EYAA 4RG1A 1KNAA 3CRLC 1LYLA 1U5KA 1VQBA 1CKNA 2OTJA 1WI5A 4CJ0B 4R1JA 2FJ2A 1ZYRD 5FJ8G 1E24A 2AUKA 2MO1A 3J81c 4GKJL 4P73A 3M4PA 4JVZA 4L8JA 3CC4A 2YU9B 4A3IB 3AFPA 4LUVA 4LFCL 2NBFA 3Q23A 5IP9G 1GJXA 4C3JB 3I4NG 3S16H 3J7AV 2WKDA 2I46A 2F0WA 3GTMH 3STBC 4U673 3PUVA 3RLNA 4A3IH 3QIAA 2AWNA 1HRJA 3K5NA 4V0BA 2PPBC 2RKSA 3CCLA 1HNXL 3NWSA 2YYZA 2H1EA 2ZJPA 3R3OA 4L63B 4R8IA 4GN5A 1PZKD 5ELOA 4HJ9A 4DUYQ 4LF6L 4GKKQ 3PUWA 2VL6A 4GLXA 3BYYB 2IX3A 1EWIA 2F0VA 1EIYB 3UDIA 2ZTDA 3MAQA 4NXNL 3HOZB 1JCKB 2OT2A 4DK3C 4LF4Q 3L7ZC 3RR5A 4YWLA 2K32A 2SEBD 1MBYA 4MTNA 4BXXG 1I4QA 2FMCA 2PMZB 4IUNA 1RJTA 1UE6A 3HOZH 4NDXA 3TREA 3DEOA 3KF8A 3CCJA 1YJWA 5ELNA 1G2SA 1H9KA 1C48A 4LAAA 3PV0A 1X32A 5JEAJ 3QO2A 3PUZA 3NENA 4A3GB 4PZ6A 1N8RC 2WV6D 2Z0SA 1E1OA 1EU3A 4YWMA 1STAA 3A7AB 4DR5Q 1D5XC 4YY3Q 3HOUB 1VCIA 1PFMA 4CDCC 2K4KA 1I4HA 4BBSB 4R8NA 3NEMA 1B44D 1TT2A 4XYOA 2QEJC 4ALPA 3I55A 4YCUA 2E2IH 3DM3A 2Q8IB 4R4OA 1NNXA 1HR0L 1SFOB 2WKCA 4BBSH 4PG3A 4OEMB 4A3FH 2DJGC 4ILWA 3BZKA 2NN6H 2PI2E 3OWFA 4OXPA 3TEHB 4UAIA 5IYCG 2MNAA 1U9RA 3FDTA 1UWVA 1K28A 2L12A 3VR2A 1KRTA 1PMRA 1Q3LA 1YHQA 5C4XG 3NK9A 1XMQL 3OOCA 4IALA 2XNAC 1BVSA 2C9OA 5E4XA 4HIKA 3HOYB 4C3IG 5M5YB 5NUCA 5I9OA 1F9RA 1SAPA 4LW1A 3G4SA 4GN3B 4K8IA 5JPNC 4JOIC 4HJAA 2C35B 5CBEE 1SBBB 2RSNA 3HOYH 4I7AA 4HN7A 4HMIA 1STYA 1G91A 2CW0C 1U4RA 4ABNA 2ID0A 5C3WA 4EQPA 1WD1A 1XPRA 1M8AA 3M85A 2ZJRA 3LWEA 3A5UA 4A3DB 2X6LA 2F0NA 2UXBL 4DR2L 5C0XI 1EQQA 3IFTA 4JI3Q 2YV5A 2K5VA 1LT3D 4A3DH 4O2DA 3CCMA 4A3EH 4JBWA 2N88A 1N32Q 5C3EB 2UUAL 5C0XJ 3RZDH 1Y1WB 4QUCA 3HOWH 2K75A 4O0AA 1E2WA 4JI7L 1W3SA 2CW0D 3CCVA 1O7IA 1RDPD 4K5WA 5C3EH 4OX9Q 1Y1WH 1Q1EA 1HCZA 1XX8A 1OXXK 2MGSA 3QG1A 1IHZA 3F2DA 1PH7A 1GD7A 2E76C 4BY1H 4GZYC 4DR5L 2D62A 4YY3L 3J80i 4B3ML 4IQZA 5DLQE 2ICEC 1I4RA 3K6OA 1RHPA 2B2WC 2IW3A 3OYYA 1TWHB 4F88A 2E5LQ 4QY7A 4DV3L 4JBMA 4RGOS 2KEEA 1VQNA 2VS1A 3BVZA 1HZBA 3H91A 1BO0A 3V2TA 2OTLA 1E0BA 5CORA 2OQKA 5DNFA 3CF5A 4MIUA 1O7YA 2FHTA 1TWHH 4IUQA 1G6ZA 1Q8KA 1YHAA 1B9MA 5CV7A 2WACA 3HOVB 5E3FA 2JA7G 1LTSD 4DXGA 1QVCA 2HCIA 3TZUA 4PZ7A 3DMUA 1HFGA 2CKZB 3HOVH 1WTOA 2JA8B 1ENAA 5J1ZA 1SNOA 2ZM6Q 4TKOB 2F52A 2I5HA 4A3LG 4J15A 1QUQB 3MFYA 4N9PA 4XT3B 1PA6A 1OXTA 4A3KB 2JA8H 2G9DA 2GVBA 1EY8A 1IYJB 4DR3L 3EQLC 2A8VA 2AUJD 5JOBA 3CCQA 2QCPX 2C5CA 1KDCA 1SMXA 3T4AC 3W5OA 4ZKBB 1IBMQ 1I94Q 3KUPA 1GXDC 3SK5A 3I7FA 4ZUJA 2VW9A 1YI2A 3GD7A 3GTQB 4JYAQ 1MGSA 3S2HB 5I6YA 1NE3A 4A4IA 4B08A 3AMUA 4A3JG 2UXCQ 3A54A 2F0PA 1PRTF 2GA4B 1DCZA 4ODGA 3GTQH 2PZUA 2JA5G 3S2HH 1SLJA 1QNUA 2J7ZA 1IBLQ 3C2PA 3RN5A 3I4MH 2DJFC 3BG3A 1N32L 5EKIA 1JICA 2NUCA 2ZJQA 3DM1A 1LT5D 2NZHA 1KLGD 3I4NB 1G6PA 5FJ8H 1TWCB 2QKIC 3HRZC 5E1FA 1VDZA 5CGKA 1HTLD 5C44G 1EY9A 5M3FG 4IO9A 5IT9E 1RIPA 3OMCA 1AE3A 4OL7A 5M9OA 3A74A 4PQXA 2OXPA 5IP9H 1J9OA 2UUCQ 1SYGA 3I4NH 1Q46A 1TWCH 1N9WA 4YCWA 1JC7A 1L0XB 5FLXL 4N9TA 4JI6L 4KY6A 1ASZA 3H3VC 1BBXC 1V43A 4WFN3 1EY5A 5I2XA 3BU2A 4JI4L 2E5LL 4HEDA 1Q12A 5AJ3L 2SDFA 4G4KA 1WTQA 4EX5A 1UE1A 5COYA 2VQEL 3UDFA 4LF7L 1QNKA 1B1ZA 2OWOA 1EQRA 3PF4A 1GVPA 4DA2A 4UPAA 5IT9L 3CC2A 3AFQA 2BA1A 3QB3A 2RF4A 4RA8A 1OXSC 2RCFA 1X3QA 4DV4L 2MHVA 4BXXH 4B9WA 1N34Q 3NQIA 1TWFH 1LTGD 3ULJA 5FOBB 3K7UC 4X64L 2M00A 2M9VA 1AZPA 2R7ZH 4EQ5A 2GVAA 1D1IA 4IZ8A 2CHBD 1HZCA 3A0JA 2D9UA 1LTID 4R4IA 5LMNQ 1K83B 4RHSA 2A6HC 3J81E 1RL2A 1Y8NB 1I94L 1ILQA 3I70A 1HQRD 3K80C 1KDAA 1JOOA 3T1YL 2B2TA 3J81j 2FINB 2HHHL 1KQSA 5GQOA 4DR7L 5EPKA 4K5XA 4HIMA 2UXCL 1K83H 5JJIA 1EQVA 3D6WA 1XMOQ 1W6KA 2UU9Q 4DV6L 1KIXA 4BY7G 3ITPA 5D3DA 4DV1Q 5IYCH 5C4XB 1NAPA 2EZVA 1HPCA 3FPUB 4A3FG 1QVFA 1KXLA 4FXDA 1TXYA 4HJ7A 3GTPH 2MJ8A 3ER0A 3K7AH 4DV2L 1JB7A 4C3IB 5HY6A 2R93G 1SE8A 2KVMA 1QVGA 2A6HD 5C4XH 1SN8A 2XIWA 1E1TA 3TP5A 1ET6A 4P71A 4K2KA 2N78A 1B8AA 1BKBA 1JOKA 2IHEA 1BBWA 4HSVA 2UUCL 3MEFA 4FVMA 2F3IA 2LKVA 4M8AA 4X65Q 4X6AH 1VQJA 2KCTA 1SJHD 3NBIA 3LWUA 4DR4L 1X56A 1AH9A 1K9MC 5AFWA 1RKNA 1S5BD 3A8IE 2Z6KA 2B2VA 4C3HG 2IPKD 3L9AX 4DUZQ 1N36Q 4NB3A 1D5MC 5FO7B 1ESRA 2BH2A 2A1AA 3KK7A 2BH8A 2H4OA 3W1GA 2XRQD 5C6AA 3TP7A 2EJMA 4GOPA 1G291 1Q8IA 1F2LA 1KL9A 1PTOF 1U4MA 4KJNA 2KOLA 3FP9A 2R7FA 5I9PA 3J80L 1Q82C 4FP5D 4IPDA 3JC66 3JAMc 2WAQE 1CZGA 4KI0A 3HOWG 3R2TA 3DWQA 1NCVA 4RH6A 2B3GA 2A69D 4YHHQ 2L11A 1BUVT 2NVYB 1PLFA 3CCSA 4GKJQ 4IFDI 4JI0L 4RMFA 5D14A 3G71A 4B3TQ 2EQSA 3DXJC 3TQYA 4AYBE 4IUVA 4FF3A 4LFCQ 4ZK9B 1BR9A 4J1MA 2NVYH 2VUMG 1K0SA 1JJCB 1E3PA 4IFDJ 1Q7YC 5GAGC 3PO2G 4EVOA 1I4GA 3TS0A 1ET9A 5G3LF 2JA7B 3N6RA 2JEBI 2KHIA 4LUZA 4UDUC 4OWWB 1HNXQ 2A73B 1GUSA 3CU7A 2N55A 4DV1L 2EY5A 1QILA 1G2TA 4LF6Q 1UEAB 2JA7H 5LMNW 3A8JE 3ERQA 3NTHA 1EY4A 1PRTB 3F1ZA 1F2ZA 1WTHA 2QGQA 1A8VA 4NXNQ 1IW7C 3H3VI 1HNWL 1PYBA 5IP7G 1EFWA 3UI2A 2Z1CA 3EROA 1ENCA 2XTIA 3PSIA 4JI2Q 4A3LH 2B8FA 4K14A 1GUGA 2F0SA 2Z9HA 2PQAB 4YIJA 2Q2TA 4XYQA 1BCPF 3ND9A 3RD4A 4HJ5A 4O42A 1S5ED 3Q0AA 3D8GA 4A3JB 2XGTA 4A3BB 3Q22A 2DY8A 2F4VL 1PVOA 1C8CA 1V1PA 3CC7A 3OW2A 2SNSA 2H5XA 5KGUA 3F2UA 2Y0SE 1ZYRC 3OMGA 1CI3M 2RDGA 4LMQD 3SHLA 3FMCA 2AQ3B 1TS3A 2O4XA 1KRSA 1VQFA 4HSPA 1SNDA 1JR0D 4J8QA 2WB1E 2Q2UA 2JA5H 4DAPA 2QW7A 2A6ED 1H95A 2IL8A 4MZ9A 1EYGA 4AH6A 2EY6A 3W2DA 5M3FB 4KY7A 1KD1C 3PGZA 5IGFA 1HJPA 2PNHA 1A2TA 4Z9CB 1AZQA 3I4MG 5EKLA 1B4OA 4TVAB 4DV7L 2E75C 2B8GA 1AP0A 1CSPA 5C44H 1F9PA 5M3FH 4YHHL 3C46A 2JA6G 2QDLA 3S1NB 3S16B 2NYZD 2ZTEA 1XMQQ 1V8QA 1SRUA 3ZYYX 4B3RQ 3FEWX 3GTMB 4B3TL 4JI5Q 4R4CA 4ID6A 1VS0A 4G7HC 4IUPA 3S1NH 3QWNA 1TKWB 2B2TC 1K73C 4RGMA 1BF4A 4ZUIA 2AMCB 2L55A 4X3KA 1D5ZC 2VZAA 1UE7A 3QJYA 3NELA 3M7GA 1EOVA 2PZTA 3GTGB 1BNZA 3RNUA 1SE4A 2IT1A 4H02A 3CMEA 2F03A 2UXBQ 4JK1C 4DR2Q 5JEAG 1NY4A 3O13A 1SJED 3GTGH 2NZ1D 3NUCA 5IYBH 1EYCA 1V1PB 4DAMA 3SXHA 5EAYA 2UUAQ 2L0CA 4DR6L 1JE5A 3F2CA 4JI2L 1GUWA 1TY2A 4JI7Q 4OIJA 3G7LA 1SE2A 1MIUA 1CSQA 4A3MG 1X3GA 3PCOB 4DNRB 4QQBX 4H0LC 2R7ZG 3KLSX 1STEA 5EJWA 3SE0A 2Z6KC 2B2VC 3J7YW 1D1KA 5JVG3 1H9SB 4HR7B 4L6TB 4X3SA 2K50A 4FF2A 2UUBQ 4B3MQ 4BY7B 1BBUA 2K5DA 3PMFA 3BJUA 1B3AA 1K0RA 5A2QE 1VQ8A 1SEBD 2E2IB 1HHVA 3S1MH 2R61A 3EJIA 3C1FA 1CKMA 4YWKA 3SDZA 1X6OA 1WCMG 4DV3Q 2PCFB 4A3FB 4X66L 4ZKCB 5C3XA 3RZOB 1K8GA 4RAUC 4RKLA 5IGBA 4GOPC 4BY7H 1HA6A 1O7LA 1HFNA 1FR3A 1PV4A 2R93B 1R9TB 4NP5A 3MC0B 4OHJA 2EYPA 4XIGS 2QF7A 3I91A 1TIID 1U4LA 1RF2D 3VR6A 3PF5A 3RZOH 4LF8Q 2IJ0A 3T56B 5HGTA 2L9HA 1PRTD 2I07B 2R93H 2BE5D 1R9TH 3UE1A 3TP8A 5M5XH 1WTPA 2A5HA 5I6WA 1DJRD 3X3NA 5KNCA 2IX0A 1CK1A 4FO2A 1PH1A 1JMCA 1PTOB 5C5LA 5A2QL 1DD2A 4KN4C 4PMWA 2OCEA 4B3RL 4OGQC 1TR5A 4Q5VA 5EBCA 3E3XA 1EL0A 4JI5L 4ULLA 4C3HB 1HR0W 1EWHA 3CMAA 1PTOH 4JI1L 3KF6A 5IYDH 2F0EA 4DR3Q 2IX1A 2KUMA 3HGBA 1V9PA 2R7DA 1EUJA 4OWXB 4C3HH 2L5TA 5C0XG 2FFKB 3J81i 3A7LA 3Q6SA 3L2PA 3U9SA 3K5MA 4K6LA 2NVXH 4G7OC 4U68A 2PNRC 4LWCA 4A3EB 2LMCB 3I4OA 1XXGA 1L2FA 2UXDL 3B6YA 2ES2A 4XQJA 1XWEA 2HUGA 3RZDB 1PH8A 3S9WA 1QUQA 3HOWB 1J5EL 2OEOA 2F0LA 1RCVD 1VQMA 4LF9L 3NQTA 5EBDA 1SXTA 1MKHA 1GM5A 1I3QB 4DKAC 4ZAIA 3QOLA 3GTLH 3K81C 4KD3A 1CA6A 1TS2A 4IOCA 1Y1VG 1QZGA 2VUMB 2KJXA 1LTTD 3SEBA 1L1OB 4A93G 4C56C 2E2HH 2K14A 1I3QH 5FK9C 2DNCA 3R2IA 4BY1B 1EOTA 4CDDC 3PO2B 5F2DA 2XSCA 4E6IA 2F1MA 1ASYA 3KLRA 5M5WH 3KFUA 2DGYA 3MWYW 1PDQA 1FD7D 2VUMH 4DK6C 1CZWA 3S2DH 3OPOA 4M1UB 2E2DC 2XWBB 3A55A 1SYFA 3CHBD 3PO2H 2UUBL 1LABA 1BCPB 1NBWA 4JI6Q 5BN5A 1MSGA 4JI4Q 3V96A 5AJ3Q 3CPWA 2QA4A 1SE3A 3E5SA 3TSSA 1N33L 2A74C 2VQEQ 5LL6X 5DM73 3ULLA 1FL0A 3KF6B 4QB4A 4LF7Q 4QMGA 2TSSA 3UE0A 3HFZB 5M3MG 4LF8L 2RVLA 4DK0A 1CKOA 1WD0A 1ICFB 4GLVB 5IP7H 1CHPD 1KABA 1B7YB 2F0FA 1HNZL 2B29A 4DV4Q 2K5QA 3VYSA 4MN3A 4KN7C 3S14B 5JJZA 1I5FA 2PI2A 2F4IA 2EJFC 3P7JA 4X64Q 3I2ZA 2F3VA 5ELCA 3U4VA 2ASBA 3I90A 1S5FD 1T5EA 5EPJA 4DF7A 4K0KL 3BYTB 3JAME 3S14H 1KNEA 2K7VA 3K0YA 4CJ1B 4G7ZC 1IBKL 1W6JA 1SYCA 1YNJD 2BDNA 3J7ZC 1E7ZA 1UUPA 1FYCA 2MP1A 2F0UA 1HA5A 2NTSA 3T1YQ 1DGSA 1I50B 1R4PB 2K03A 2HHHQ 1JWUD 5LHY1 2WINB 4DR7Q 2JYOA 3I4MB 1XNRQ 4ZCKA 4K2LA 3FKIG 4DV6Q 4WORA 4KKUA 1I50H 2RDFA 2ZTCA 2A19A 5IY0A 1SYEA 1SR3A 2TMPA 1EY7A 3HKZE 4DV0L 2JA6B 5H1SE 3JAML 5IIFA 2CFMA 2EJGC 3AQQA 3UDXA 4XQQA 3N52A 5ELBA 4DV2Q 3P1HA 2JA6H 2XN9C 3NSWA 2F0DA 1IYVA 2I5MX 3EFXD 1PTOD 1L0YB 3I72A 4QIWE 1A62A 4C1NI 4DPGA 4L5TA 1A63A 5JJLA 3GDEA 1YHBA 5DAUA 2ZXPA 2BOSA 4KLKA 4UY8C 3VYTA 4OO1I 3OHXC 2RBMA 3LX0A 3G6JB 5IE8A 2WP8J 4CKEA 4JI8L 3VA7A 2MFIA 4DR4Q 3OSOA 3BDCA 3IFDA 4IPHA 2D5DA 1EY0A 2A68D 4HAEA 1VQAA 1O80A 4RCNA 1S3OA 2BCOA 2HD3A 3NPPA 3D0FA 4KHPL 5C4ZA 5JEAH 1A6XA 1STHA 2D2CC 3NWTA 3T13A 4I7ZC 1IZ6A 1TWFB 5C4HA 4CDEC 5G3LD 3DEPA 2R6GA 3R8BA 2HCCA 1GOZA 5IYBG 3HKSA 2NB0A 1E2ZA 2CH4A 2R7ZB 4QL5A 4RGTA 3URYA 3A56A 4F7XA 3QR8A 3CP0A 4HJ8A 5L37A 4A3MH 4POGA 1P16A 4BS9A 2KA7A 3ULPA 5KYLA 2E74C 3CXCA 5K36G 4JI0Q 2IWHA 4N8FA 3EVQA 1STNA 3KLSA 4I65A 4EQOA 1KC8C 5TSSA 1IL8A 1NMFA 1X54A 5IGCA 1OXUA 3VR5A 3PIP3 1SYDA 3CQZH 3AEVA 1B50A 1BCPD 2B2UA 4DAYA 1WCMH 4A3CG 3HZXA 4L5QA 1XTDA 4BBRG 1F9SA 2RHSB 4JBJA 4C1NK 1DXMA 1XNRL 2LSSA 2F0GA 3GTPB 3K7AB 4CJ2C 2NVQH 2G5DA 1GKHA 3W3AA 1S5DD 1VQOA 4JCVE 4IJHA 4RCOA 2HIVA 2K5WA 1YITA 1ZKOA 2L15A 4N8X1 2WAQG 4LFBL 3J81L 1HNWQ 1QG7A 2K1BA 5KIXA 1VQ4A 4WRDA 3GTOH 1GO3E 1EIGA 3T51B 1LUZA 2MUYA 4UP7A 2E2JB 1NR2A 1A0IA 1FJGL 4C2MB 1V1QA 2XWJB 4IUTA 5LMUL 1PFBA 2O5IC 4AYBG 1MSHA 1EEID 1TWGB 1L0WA 3SK6A 2I0QA 2F0JA 3ONAB 2M2LA 4GN4B 1LLRD 4QCLA 5C5MA 2E2JH 2EYMA 3VYRA 4C2MH 5C0XH 2OF1A 5IYDG 1JT8A 2F4VQ 1KDBA 1U0LA 1TWGH 3T1HL 1YJ9A 2A69C 2YTVA 3NXWA 4HCEA 2EY2A 5GAHC 2RCNA 2NN6I 3TMEA 4CDFC 1LT4D 4H13C 3S24A 4L5SA 2PQAA 1Y1VB 3WDNA 3RMHA 2PMZE 1GHKA 1X9NA 4HTHA 4A93B 1H9MA 1Y69U 2RSOA 4AQYL 3KYHC 2BDOA 1Y14B 4DAYB 4UP9A 2LXKA 3KLWA 4IFDG 4OONA 1Y1VH 2FMMA 2NZOA 4A93H 1WTWA 2QILA 3M4OB 4RWSC 1AW7A 4DV7Q 3Q8DA 2GN5A 1D8LA 1WTVA 2N3SA 2KBNA 2J0TD 3BZCA 1MJEA 3M4OH 1XTCD 1I4XA 2QDBA 1PH6A 3H94A 4NKLA 2EYLA 3K0XA 2HDLA 2Y0SG 5IOCA 1WJJA 5KEEA 5M3MB 1EFID 3D6CA 2PW5A 1NTGA 1PHJA 3S1QB 1XJVA 2WB1G 4O1NA 3WOEA 1CT1D 4XT1B 1HQMC 2R3ZA 1CHQD 4OIKA 1I6HB 4ZRZA 5JAVA 2KHSA 1PH4A 5M3MH 1G51A 3K59A 3RN2A 4QIWB 3S1QH 2WFWA 1WOCA 1A15A 1I6HH 2DUDA 1NSNS 4XTCS 5CV4A 5EQ0A 5FLXc 3H15A 2Z8LA 3MXPA 4R9WA 1DONA 4DR6Q 2HT1A 2A6EC 2F0TA 3F8TA 4CHTB 1KAWA 3D4WA 3NBHB 3PIPA 1RTOA 3G48A 4Q0FA 1YJNA 2AQ1B 1BDOA 1SROA 3OTOL 1OXVA 3WOFA 2JQOA 4XXEA 5CV8A 2K28A 3T53B 3FKIB 2Q2HA 2JA5B 1S40A 2F0IA 1QB5D 1IKMA 2IHFA 1AEXA 4CGYB 3H09A 4CKCA 4X66Q 1YBYA 3FKIH 1FGUA 1WVLA 3PUXA 5T1GA 1JWMD 3CW2C 5GADC 2L4NA 1PFSA 3NE5B 2PW7A 3RLFA 1FNUA 1LTRD 2D0OA 4PZ8A 5FKAC 2JJQA 5C44B 5CMDA 2ZT9C 4ZLTF 2EYJA 2RHQB 4B3SL 1H9SA 4A3KG 3BZDB 4DNTB 4P75A 1K8AC 1AE2A 1TWAB 2EIFA 3DWAA 3RLOA 2AKWB 3IAYA 3ERSX 1MHWC 1K3RA 3CKIB 4QGUA 1ESFA 2EYFA 1TWAH 3E9IA 5CR3A 4JI1Q 3JAMi 2B2UC 1QCBD 4WJ3M 4GNXA 4CBVA 4GS3A 1A3UA 1T5XD 5IWAL 2EOTA 4R4QA 2PO4A 3NTKA 5D3IB 4K5VA 1VMPA 3H6MA 3MHBA 1YIJA 1UE5A 1LT6D 4A76A 1QE6A 3RUZA 3NTIA 4NPSA 2QEXA 1U4PA 2UXDQ 1F2YA 5HURA 2DNEA 1J5EQ 2YU9H 5CV9A 4DFAA 2D0PA 2CWAA 1SNMA 4LF9Q 4C3JH 1XYIA 2MPMA 4QF4A 4HIOA 1JORA 1EIFA 4K8JA 2BA0A 1FNWA 4H44C 4Y7NB 5E4WC 4JPBW 5K36H 1Z7TA 1B53A 3BVMA 3I3CA 1ILPA 3GV6A 4Y7NH 4BWGB 4BBRB 1PRTC 2BE5C 3OIQA 3S1MB 1TY0A 4TRDA 3BDOA 2F0QA 4IPCA 1PH5A 1C4QA 1FVIA 3STBD 4A3CH 1DM0B 4V190 3J80c 4BBRH 4WJ4A 4J6HA 2X6GA 4B9XA 4PNYA 1IXRA 1JE4A 2VQFL 4QJFA 3EIVA 1N33Q 1O78A 1L1OA 2WAQB 1ZEQX 1Y8PB 2L1BA 3BDLA 3MFGA 5M5XB 3M4YA 2N8NA 1T9HA 3EBEA 3S15B 3I56A 3FVQA 1EWCA 3I4LA 1YVCA 4GNXB 3MA2B 4A75A 5J3BA 5JVH3 4A3GH 1CKNB 4KV6A 1QJOA 1XNQL 4AYBB 3S15H 2WIIB 2JEAI 1LTAD 1HNZQ 4F8MA 1VQGA 3TZDA 1IKLA 1CQVA 3HOUH 1CFMA 3FHWA 5IGGA 1PH2A 1V1OA 1GUOA 3HOXG 1JJ2A 1Q1BA 2EYHA 5E7NA 1ML0D 4K0KQ 3H0GG 2CWPA 3S1RB 2PQEA 3U50C 1OTCA 1SFOH 4Y52H 1EQTA 3BVGA 5K5PA 3OIPA 5ISRA 5A35A 2NVXB 1IBKQ 5CBAE 3E6ZX 1PYWD 1EU4A 4FDBA 2ATWA 3S1RH 1K8OA 1PH9A 1H9RA 4MNOA 1VQHA 1HUMA 3U4ZA 4IOAA 2R92G 2Z4IA 4YCVA 1KAAA 2F0HA 1KLUD 4KKTA 2O5JC 3GTLB 1Y8OB 5FO8B 1CTMA 1XPUA 4DV0Q 2EDGA 5M5YH 3TN2A 2SNMA 5KNDA 1YNNC 4IFDH 2ZXOA 2E2HB 1EEFD 1JOQA 5EKKA 3KF8B 2RA4A 3SK4A 3CPFA 4LFAQ 3TP6A 1C0AA 5M5WB 2B2YA 1ONLA 3S2DB 3S17B 4DUYL 4GKKL 2Y0SB 1BQQT 1FGBD 5T1IA 4PMCA 4KMUC 5DEHA 2ENBA 3D31A 2O2LD 1W2BA 2EY1A 1VMCA 2ICIA 4LF4L 5I2YA 2LS01 2WB1B 3S17H 1Z6HA 2JK8A 3OWEB 4JI8Q 1RTNA 1DYQA 1YNND 1X3EA 2NTTA 3F2BA 1PH3A 1SSOA 2EYOA 5GAEC 3H3VH 3FRPB 3J7A5 4NXMQ 3K58A 5IGEA 4KHPQ 4KKSA 3HEJA 2F0MA 4FXGC 2AQ2B 4KY5A 1HUNA 3HKZG 4DV5Q 1VQDA 4RGNA 4ME3A 1YNJC 1YZ6A 2HQEA 3DWPA 2PYKA 1UEBA 1VQIA 2RQXA 1AFPA 4LF5Q 3SVMA 3GTKB 3J7AF 2EXDA 4EQNA 4HCSA 2E8GA 1M90C 2IY5B 4P2CB 3U9OA 4PMBA 3GTKH 2CCZA 3D4RA 2ZXRA 4PV1C 1O7ZA 5FLMG 1B3QA 4KJOA 4GNXC 1HZAA 4JBKA 1X3FA 2VNUD 3MXUA 3I73A 5GROA 3SK8A 1K3BC 5CC4A 4DAVA 1VF7A 5FO9B 4IN3A 5EPLA 3W1BA 1IYUA 1VQLA 1PTOC 3OW7A 1TS4A 3P75A 5HGQA 1B70B 3DHQA 1C7YA 3I8ZA 3NP8A 1EY6A 4DN4M 4POFA 2JE6I 1GUTA 3GTJB 4OELB 1PFNA 1H9JA 2VXWA 2CH4W 3E0EA 2B63G 1TU2B 3LNNA 4A3KH 2A68C 2JN4A 4IURA 2EE1A 1RODA 2LY7A 4UP8A 3GTJH 4XQNA 2VB2X 3PQIA 5KYIA 5ELDA 4LFAL 3PUYA 3MXNA 1R4QB 4LFBQ 2SOBA 4A3BG 3U58A 4IUUA 4G57A 5JPMC 3K5LA 4OO1G 3GV3A 2KHJA 1EIHA 2F0OA 5ELFA 1PXUA 4JI3L 1J8IA 5FLXE 2K04A 1FJGQ 1CA5A 2I5LX 5LMUQ 3QOJA 2V1CC 3PO3G 4DU9A 3GO5A 2XVSA 4JC0A 2Z6BA 5KNBA 1HZ9A 3KBGA 2RDHA 1X3PA 4APVA 4IPGA 3T1HQ 4OX9L 1L1OC 1CUKA 4H7BA 5C4JB 2CVRA 1LACA 4UHVA 4NXML 3R93A 1VQKA 4R4TA 4ZYSA 1VQ7A 1SNQA 1M4VA 4ME5A 4TSSA 3VDYA 4RKBA 3MZ5A 4DV5L 3CAMA 4LNQA 5C4JH 2JXMB 3DLLA 3MEHA 1BCPC 1C9OA 4A3MB 2NVTB 4QUFA 3CCUA 1X65A 1YEZA 1NJIC 3GQBA 3A5ZB 4A3IG 4LF5L 1D2BA 4DR1Q 4AQYQ 1S4ZA 1A3VA 1VQEA 4KTAA 4C3JG 2MQHA 5IODA 1EZ8A 2NVTH 3M3YB 1M1KC 3T16A 3ND8A 4DXFA 4LUOA 3CQZB 1DOLA 3P20A 4DNIA 1WCMB 2NWGA 5BR8Q 3M3YH 2V4DA 3AB9A 2K6AA 2P5ZX 4JV5Q 3C1EA 5CV5A 3MXNB 3K8AA 1SMYC 2ZM6L 2YTYA 2NVQB 1FNVA 2EPBA 3HOZG 3PIO3 1B9NA 4DGZA 1E22A 4X3TA
chains in the Genus database with same CATH topology
1OO9B 2K05A 1SNPA 1WTXA 4ZQ3A 2LFNA 3MXGA 1GHJA 1BXTA 2EXZA 1SDFA 3KBXA 3GTOB 1TS5A 2G9HD 4FNFA 5CYUA 2B2YC 3HOXB 3H0GB 2AWOA 4KHZA 1PZJD 3EA6A 4KHVA 1SMYD 5EGTA 2EVBA 4F87A 5BN4A 4RHRA 1QOHA 1Q90A 4LJZC 5D65A 1S5CD 3E0JA 4DK1A 1NUCA 2NN6G 2R92B 2K01A 2Q8TA 4HMJA 2CQAA 4LK1C 1E2VA 2KECA 3FPPA 1DZ1A 1CQFA 3CRKC 3BS1A 1EYDA 1Z47A 1STGA 3J80E 1A2UA 1KTKA 3TDQA 3NBHA 5J22A 2K33A 5I4DA 2X69A 2PZWA 3HS0C 1PZID 4XDXA 1AN8A 3GP7A 1MD2D 4NMZA 3MVVA 4KD4A 2F0KA 5KRUA 1K8MA 4FF1A 1D6EC 1TQOA 2Q8RE 2B39A 4S3SA 1II3A 1SYBA 1ZXTA 1DOMA 2KCNA 1F2MA 2JP1A 3TBIB 1CM9A 3HP3A 3L3OC 1ICWA 2DN8A 3HKZB 2KEDA 3IKJA 4TQUS 3D3RA 1HTPA 4BA2I 3V05A 2HDMA 4MHEA 2Z4HA 1TVXA 2DY7A 5CV6A 3HG9A 1LO5D 1JWSD 3VR4A 3DUZA 3C3LA 2VB3X 3K57A 3IL8A 4KK7A 5LL6S 1ENFA 1JQYD 5DM63 1I4PA 1UAPA 1LV9A 1I6VC 1JB3A 2J4XA 1VF5C 1GUNA 4FXKC 1A3TA 3X3MA 3D4DA 3AU7A 2F3WA 4BA1I 3MTSA 1LTBD 2KQ3A 3VYUA 3A8KE 1SNCA 4FF4A 4RFBA 5ELEA 2B63B 1F9QA 3K5OA 4CKBA 4FYDA 4EGVA 1UNSA 4K6DA 4WJWA 4NW2A 1DOKA 3VR3A 1HXYD 1IW7D 1NR4A 1QWYA 2KCCA 3PO3B 1RD9D 1F77A 4OO1H 2B2WA 1B2TA 2XRSD 1EZ6A 1STBA 4X3UA 1WTRA 3VA5A 3M7NA 1BOSA 5BN3A 1MI2A 2JSOA 5J39A 5IGDA 3SR1A 3NHHA 3Q24A 1G8ZD 1EYAA 1KNAA 3CRLC 4CJ0B 2FJ2A 1ZYRD 2AUKA 4L8JA 2YU9B 4A3IB 2NBFA 3Q23A 1GJXA 4C3JB 3J7AV 2WKDA 2I46A 2F0WA 4U673 3PUVA 3QIAA 2AWNA 1HRJA 3K5NA 4V0BA 2PPBC 2RKSA 3NWSA 2YYZA 2H1EA 3R3OA 4L63B 4R8IA 1PZKD 3PUWA 3BYYB 2IX3A 2F0VA 3MAQA 3HOZB 1JCKB 2OT2A 3L7ZC 2K32A 2SEBD 1MBYA 1I4QA 2FMCA 2PMZB 4IUNA 1RJTA 4NDXA 3DEOA 3KF8A 1G2SA 1H9KA 1C48A 4LAAA 3PV0A 1X32A 5JEAJ 3QO2A 3PUZA 4A3GB 2WV6D 1EU3A 1STAA 3A7AB 1D5XC 3HOUB 1VCIA 1PFMA 1I4HA 4BBSB 4R8NA 1B44D 1TT2A 4XYOA 2QEJC 2Q8IB 1SFOB 2WKCA 4ILWA 2NN6H 3OWFA 4UAIA 1U9RA 3FDTA 2L12A 3VR2A 1PMRA 1Q3LA 3NK9A 3OOCA 4IALA 2XNAC 2C9OA 5E4XA 3HOYB 4C3IG 5M5YB 5NUCA 5I9OA 1F9RA 1SAPA 4K8IA 5JPNC 5CBEE 1SBBB 2RSNA 4HN7A 4HMIA 1STYA 1G91A 2CW0C 1U4RA 4ABNA 2ID0A 5C3WA 4EQPA 1WD1A 1M8AA 3M85A 4A3DB 3LWEA 2X6LA 2F0NA 5C0XI 3IFTA 1LT3D 4JBWA 2N88A 5C3EB 5C0XJ 1Y1WB 4QUCA 1E2WA 2CW0D 1RDPD 4K5WA 1Q1EA 1HCZA 1XX8A 1OXXK 2MGSA 3QG1A 1IHZA 2E76C 4GZYC 2D62A 4IQZA 2ICEC 1I4RA 3K6OA 1RHPA 2B2WC 2IW3A 1TWHB 4F88A 4RGOS 2KEEA 3BVZA 3H91A 1BO0A 3V2TA 1E0BA 5CORA 5DNFA 4MIUA 1O7YA 2FHTA 4IUQA 1G6ZA 5CV7A 1B9MA 2WACA 3HOVB 5E3FA 1LTSD 4DXGA 2HCIA 3TZUA 3DMUA 1HFGA 1WTOA 2JA8B 1ENAA 5J1ZA 1SNOA 4TKOB 3MFYA 4N9PA 4XT3B 1OXTA 4A3KB 2G9DA 1EY8A 3EQLC 2AUJD 5JOBA 2QCPX 2C5CA 1KDCA 3T4AC 4ZKBB 3KUPA 1GXDC 3SK5A 4ZUJA 3GD7A 3GTQB 1MGSA 3S2HB 5I6YA 4B08A 3AMUA 3A54A 2F0PA 1PRTF 2GA4B 1DCZA 4ODGA 2PZUA 1QNUA 2J7ZA 3C2PA 3BG3A 5EKIA 1JICA 2NUCA 3DM1A 1LT5D 1KLGD 3I4NB 1TWCB 2QKIC 3HRZC 5E1FA 1VDZA 5CGKA 1HTLD 1EY9A 5IT9E 3OMCA 4OL7A 5M9OA 4PQXA 2OXPA 1J9OA 1SYGA 1JC7A 1L0XB 5FLXL 4N9TA 4KY6A 3H3VC 1BBXC 1V43A 4WFN3 1EY5A 5I2XA 4HEDA 1Q12A 2SDFA 4G4KA 1WTQA 5COYA 1QNKA 1B1ZA 4DA2A 5IT9L 2BA1A 3QB3A 4RA8A 1OXSC 1X3QA 2MHVA 4B9WA 3NQIA 1LTGD 5FOBB 2M00A 2M9VA 1AZPA 1D1IA 4IZ8A 2CHBD 2D9UA 1LTID 1K83B 4RHSA 2A6HC 3J81E 1Y8NB 1ILQA 3I70A 1HQRD 1KDAA 1JOOA 2B2TA 2FINB 5EPKA 4K5XA 1EQVA 3D6WA 1W6KA 3ITPA 5D3DA 5C4XB 1NAPA 2EZVA 1HPCA 3FPUB 4FXDA 2MJ8A 4C3IB 2KVMA 2A6HD 2XIWA 3TP5A 1ET6A 4K2KA 1JOKA 4HSVA 4FVMA 2LKVA 4M8AA 1SJHD 3NBIA 3LWUA 5AFWA 1RKNA 1S5BD 3A8IE 2B2VA 4C3HG 2IPKD 3L9AX 1D5MC 5FO7B 1ESRA 3KK7A 2H4OA 2XRQD 5C6AA 3TP7A 2EJMA 1G291 1Q8IA 1F2LA 1U4MA 1PTOF 4KJNA 2KOLA 5I9PA 3J80L 4FP5D 1CZGA 4KI0A 3R2TA 3DWQA 1NCVA 4RH6A 2A69D 2L11A 1BUVT 2NVYB 1PLFA 4IFDI 5D14A 3DXJC 4IUVA 4FF3A 4ZK9B 1BR9A 4J1MA 4IFDJ 4EVOA 1I4GA 1ET9A 5G3LF 2JA7B 3N6RA 2JEBI 4UDUC 2A73B 1GUSA 3CU7A 2N55A 2EY5A 1QILA 1G2TA 1UEAB 3A8JE 3ERQA 3NTHA 1EY4A 1PRTB 1F2ZA 1IW7C 3UI2A 2Z1CA 3EROA 1ENCA 2B8FA 4K14A 1GUGA 2F0SA 4YIJA 4XYQA 1BCPF 3ND9A 3RD4A 4O42A 1S5ED 3Q0AA 3D8GA 4A3JB 4A3BB 3Q22A 2DY8A 1C8CA 1V1PA 2SNSA 5KGUA 3F2UA 1ZYRC 3OMGA 1CI3M 2RDGA 4LMQD 3SHLA 3FMCA 2AQ3B 1TS3A 2O4XA 4HSPA 1SNDA 1JR0D 4J8QA 4DAPA 2A6ED 2IL8A 2EY6A 3W2DA 5M3FB 4KY7A 5IGFA 1A2TA 4Z9CB 1AZQA 5EKLA 1B4OA 2E75C 2B8GA 1AP0A 3C46A 1F9PA 3S1NB 3S16B 2NYZD 1V8QA 3ZYYX 3FEWX 3GTMB 4ID6A 4G7HC 4IUPA 3QWNA 1TKWB 2B2TC 4RGMA 1BF4A 4ZUIA 2L55A 4X3KA 1D5ZC 3QJYA 3M7GA 2PZTA 3GTGB 1BNZA 1SE4A 2IT1A 2F03A 4JK1C 5JEAG 3O13A 1SJED 2NZ1D 3NUCA 1EYCA 1V1PB 3SXHA 2L0CA 1GUWA 1TY2A 4OIJA 3G7LA 1SE2A 4DNRB 4H0LC 3KLSX 1STEA 5EJWA 3SE0A 2B2VC 3J7YW 1D1KA 5JVG3 1H9SB 4HR7B 4L6TB 4X3SA 4FF2A 4BY7B 2K5DA 3PMFA 5A2QE 1B3AA 2E2IB 1HHVA 1SEBD 2R61A 3EJIA 3C1FA 3SDZA 4A3FB 2PCFB 4ZKCB 5C3XA 3RZOB 4RAUC 4RKLA 5IGBA 1HFNA 1HA6A 1O7LA 1FR3A 2R93B 1R9TB 4NP5A 3MC0B 4OHJA 2EYPA 4XIGS 2QF7A 3I91A 1TIID 1U4LA 1RF2D 3VR6A 2IJ0A 3T56B 5HGTA 2L9HA 1PRTD 2I07B 2BE5D 3TP8A 1WTPA 2A5HA 5I6WA 1DJRD 3X3NA 5KNCA 2IX0A 1CK1A 4FO2A 1PTOB 5C5LA 5A2QL 1DD2A 4KN4C 4PMWA 4OGQC 1TR5A 4Q5VA 5EBCA 1EL0A 4ULLA 4C3HB 1EWHA 1PTOH 2F0EA 2IX1A 2KUMA 3HGBA 2L5TA 5C0XG 2FFKB 3A7LA 3Q6SA 3U9SA 3K5MA 4K6LA 4G7OC 4U68A 2PNRC 4A3EB 2LMCB 1XXGA 4XQJA 1XWEA 2HUGA 3RZDB 3S9WA 3HOWB 2OEOA 2F0LA 1RCVD 3NQTA 5EBDA 1SXTA 1I3QB 4ZAIA 3QOLA 4KD3A 1CA6A 1TS2A 2VUMB 2KJXA 1LTTD 3SEBA 4C56C 5FK9C 2DNCA 3R2IA 4BY1B 1EOTA 3PO2B 5F2DA 2XSCA 4E6IA 2F1MA 3KLRA 3MWYW 1PDQA 1FD7D 1CZWA 3OPOA 4M1UB 2E2DC 2XWBB 3A55A 1SYFA 3CHBD 1LABA 1BCPB 5BN5A 1MSGA 3V96A 1SE3A 3E5SA 3TSSA 2A74C 5LL6X 5DM73 4QB4A 4QMGA 2TSSA 2RVLA 4DK0A 1WD0A 1CHPD 1KABA 2F0FA 2K5QA 3VYSA 4MN3A 4KN7C 3S14B 5JJZA 2F4IA 2EJFC 3P7JA 2F3VA 5ELCA 3I90A 1S5FD 1T5EA 5EPJA 4DF7A 3BYTB 3JAME 1KNEA 2K7VA 3K0YA 4CJ1B 4G7ZC 1W6JA 1SYCA 1YNJD 2BDNA 1UUPA 1FYCA 2MP1A 2F0UA 1HA5A 2NTSA 1I50B 1R4PB 2K03A 1JWUD 5LHY1 2WINB 2JYOA 3I4MB 4K2LA 4WORA 4KKUA 2RDFA 1SYEA 2TMPA 1EY7A 2JA6B 3JAML 5IIFA 2EJGC 4XQQA 3N52A 5ELBA 3P1HA 2XN9C 3NSWA 2F0DA 1IYVA 3EFXD 1PTOD 1L0YB 3I72A 4C1NI 5DAUA 2ZXPA 2BOSA 3VYTA 4OO1I 3OHXC 2RBMA 3LX0A 3G6JB 2WP8J 4CKEA 3VA7A 3OSOA 3BDCA 3IFDA 2D5DA 1EY0A 2A68D 4HAEA 1O80A 4RCNA 2BCOA 3NPPA 1A6XA 5C4ZA 5JEAH 1STHA 2D2CC 3NWTA 3T13A 4I7ZC 1TWFB 5C4HA 5G3LD 3DEPA 2R6GA 3R8BA 2HCCA 1GOZA 2NB0A 1E2ZA 2R7ZB 4RGTA 3URYA 3A56A 4F7XA 4BS9A 2KA7A 5KYLA 2E74C 5K36G 2IWHA 3EVQA 1STNA 3KLSA 4I65A 4EQOA 5TSSA 1IL8A 5IGCA 3VR5A 1OXUA 3PIP3 1SYDA 1B50A 1BCPD 2B2UA 4DAYA 3HZXA 1F9SA 4C1NK 1DXMA 2F0GA 3GTPB 3K7AB 4CJ2C 3W3AA 1S5DD 4RCOA 2K5WA 1ZKOA 3J81L 1QG7A 2K1BA 5KIXA 4WRDA 3T51B 1EIGA 2MUYA 2E2JB 1NR2A 4C2MB 2XWJB 4IUTA 1PFBA 2O5IC 1MSHA 1EEID 1TWGB 3SK6A 2F0JA 3ONAB 2M2LA 1LLRD 4QCLA 5C5MA 2EYMA 3VYRA 5C0XH 2OF1A 1KDBA 2A69C 3NXWA 4HCEA 2EY2A 2NN6I 3TMEA 1LT4D 4H13C 1Y1VB 3WDNA 3RMHA 1GHKA 4A93B 4HTHA 1H9MA 1Y69U 2RSOA 2BDOA 4IFDG 2FMMA 1WTWA 2QILA 3M4OB 4RWSC 1AW7A 1WTVA 2J0TD 1XTCD 1I4XA 2QDBA 3H94A 4NKLA 2EYLA 2HDLA 5IOCA 5KEEA 5M3MB 1EFID 3D6CA 2PW5A 3S1QB 4O1NA 3WOEA 4XT1B 1CT1D 1HQMC 2R3ZA 1CHQD 4OIKA 1I6HB 4ZRZA 5JAVA 2KHSA 3K59A 4QIWB 1A15A 1NSNS 4XTCS 5CV4A 5EQ0A 2Z8LA 3MXPA 4R9WA 1DONA 2A6EC 2F0TA 4CHTB 3D4WA 1RTOA 4Q0FA 2AQ1B 1BDOA 1OXVA 3WOFA 4XXEA 5CV8A 2K28A 3T53B 3FKIB 2JA5B 2F0IA 1QB5D 1IKMA 1AEXA 4CGYB 3H09A 4CKCA 1WVLA 3PUXA 5T1GA 1JWMD 2L4NA 3NE5B 2PW7A 3RLFA 1FNUA 1LTRD 5FKAC 5C44B 5CMDA 2ZT9C 4ZLTF 2EYJA 1H9SA 3BZDB 4DNTB 1TWAB 3DWAA 3IAYA 3CKIB 1ESFA 2EYFA 5CR3A 2B2UC 1QCBD 4CBVA 1A3UA 1T5XD 2EOTA 2PO4A 3NTKA 5D3IB 4K5VA 1VMPA 3H6MA 3MHBA 1LT6D 1QE6A 3RUZA 3NTIA 1U4PA 1F2YA 5HURA 2DNEA 5CV9A 4DFAA 1SNMA 1XYIA 2MPMA 4QF4A 1JORA 4K8JA 2BA0A 1FNWA 4H44C 4Y7NB 5E4WC 5K36H 1Z7TA 1B53A 3BVMA 3I3CA 1ILPA 3GV6A 4BWGB 4BBRB 1PRTC 2BE5C 3OIQA 3S1MB 1TY0A 4TRDA 3BDOA 2F0QA 1C4QA 1DM0B 4V190 4J6HA 2X6GA 4B9XA 4PNYA 1JE4A 1O78A 2WAQB 1ZEQX 1Y8PB 2L1BA 3BDLA 3MFGA 5M5XB 3M4YA 3S15B 3FVQA 1EWCA 3I4LA 3MA2B 5JVH3 4KV6A 1QJOA 4AYBB 2WIIB 2JEAI 1LTAD 4F8MA 3TZDA 1IKLA 1CQVA 1CFMA 5IGGA 1V1OA 1GUOA 1Q1BA 2EYHA 1ML0D 3S1RB 2PQEA 1EQTA 3BVGA 5K5PA 3OIPA 5ISRA 5A35A 2NVXB 5CBAE 3E6ZX 1PYWD 1EU4A 1K8OA 1H9RA 1HUMA 2Z4IA 1KAAA 2F0HA 1KLUD 4KKTA 2O5JC 3GTLB 1Y8OB 5FO8B 1CTMA 2EDGA 3TN2A 2SNMA 5KNDA 1YNNC 4IFDH 2ZXOA 2E2HB 1EEFD 1JOQA 5EKKA 2RA4A 3SK4A 3TP6A 5M5WB 2B2YA 1ONLA 3S2DB 3S17B 2Y0SB 1BQQT 1FGBD 5T1IA 4PMCA 5DEHA 4KMUC 2ENBA 3D31A 2O2LD 2EY1A 1VMCA 2ICIA 5I2YA 2LS01 2WB1B 1Z6HA 3OWEB 1RTNA 1DYQA 1YNND 2NTTA 1SSOA 2EYOA 3FRPB 3K58A 5IGEA 4KKSA 3HEJA 2F0MA 4FXGC 2AQ2B 4KY5A 1HUNA 4RGNA 1YNJC 2HQEA 3DWPA 2PYKA 2RQXA 1AFPA 3SVMA 3GTKB 3J7AF 4EQNA 4HCSA 4P2CB 3U9OA 4PMBA 3D4RA 2ZXRA 4PV1C 1O7ZA 4KJOA 2VNUD 3MXUA 3I73A 3SK8A 5CC4A 4DAVA 1VF7A 5FO9B 4IN3A 5EPLA 1IYUA 1PTOC 3OW7A 1TS4A 3P75A 3DHQA 3I8ZA 3NP8A 1EY6A 4DN4M 2JE6I 1GUTA 3GTJB 1PFNA 1H9JA 2VXWA 1TU2B 3LNNA 2A68C 4IURA 2EE1A 1RODA 2LY7A 4XQNA 2VB2X 5KYIA 5ELDA 3PUYA 3MXNA 1R4QB 2SOBA 4IUUA 4G57A 5JPMC 3K5LA 4OO1G 3GV3A 1EIHA 2F0OA 5ELFA 1PXUA 1J8IA 5FLXE 2K04A 1CA5A 3QOJA 4DU9A 3GO5A 2XVSA 5KNBA 3KBGA 2RDHA 1X3PA 4H7BA 5C4JB 2CVRA 1LACA 3R93A 4ZYSA 1SNQA 1M4VA 4ME5A 4TSSA 4RKBA 3MZ5A 2JXMB 3MEHA 1BCPC 4A3MB 2NVTB 4QUFA 3GQBA 1D2BA 1S4ZA 1A3VA 4KTAA 4C3JG 5IODA 1EZ8A 3M3YB 3T16A 3ND8A 4DXFA 3CQZB 1DOLA 3P20A 1WCMB 2NWGA 2V4DA 3AB9A 2K6AA 3C1EA 5CV5A 1SMYC 2NVQB 1FNVA 2EPBA 3PIO3 1B9NA 4DGZA 4X3TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LMQ D;  2MPM A;  2K05 A;  1ESR A;  2L12 A;  1NR2 A;  3TN2 A;  4CJ0 B;  1B3A A;  1PFN A;  2VXW A;  1WTX A;  2FJ2 A;  4IUT A;  1HHV A;  1PFB A;  1MSH A;  2HDM A;  4MHE A;  1MSG A;  2RA4 A;  1Q3L A;  5E4W C;  3ONA B;  2HCI A;  2M2L A;  1SDF A;  1TVX A;  2DY7 A;  4RA8 A;  4ZKC B;  4IUR A;  2EE1 A;  1HFG A;  1ROD A;  1X3Q A;  3KBX A;  4RAU C;  1RTO A;  1F2L A;  1U4M A;  1WTO A;  1HA6 A;  1HFN A;  2KOL A;  1B53 A;  2B2Y A;  2IL8 A;  3IFD A;  3I3C A;  5E4X A;  1ILP A;  4HAE A;  2B2Y C;  1O80 A;  3GV6 A;  4IUU A;  1F9R A;  1SAP A;  3I91 A;  1U4L A;  2K28 A;  5T1I A;  3GV3 A;  1EIH A;  3IL8 A;  1AZQ A;  4XT3 B;  1J8I A;  1VMC A;  2K04 A;  1NCV A;  1B4O A;  2L9H A;  1AZP A;  1CA5 A;  5CBE E;  1IKM A;  2RVL A;  2RSN A;  2L11 A;  1WTP A;  1WD0 A;  1HRJ A;  1AP0 A;  1PLF A;  1F9P A;  1G91 A;  1U4R A;  1LV9 A;  2NYZ D;  2X6G A;  3DEP A;  2D9U A;  4ZKB B;  1WD1 A;  5D65 A;  5D14 A;  1M8A A;  3KUP A;  1DON A;  2H1E A;  1RTN A;  2HCC A;  4IUV A;  1WVL A;  1JE4 A;  4R8I A;  4MN3 A;  4ZK9 B;  1ILQ A;  3LWE A;  5T1G A;  5JJZ A;  1X3P A;  2X6L A;  2K01 A;  1MGS A;  2Q8T A;  2L4N A;  1SSO A;  4IUP A;  2B2T A;  2L1B A;  2RSO A;  1EL0 A;  2FIN B;  3P7J A;  2B2T C;  3MTS A;  2CVR A;  5EPK A;  3I90 A;  2FMM A;  4ZLT F;  5CMD A;  5EPJ A;  3R93 A;  1BF4 A;  2KEC A;  3D6W A;  1WTW A;  4X3K A;  1HUN A;  4RWS C;  1KNE A;  2KUM A;  2N88 A;  1DZ1 A;  1WTV A;  2J7Z A;  4CJ1 B;  2FFK B;  4QUC A;  1RJT A;  1F9Q A;  3Q6S A;  2N55 A;  5EKI A;  2BDN A;  1BNZ A;  1JIC A;  2MP1 A;  1NAP A;  3DEO A;  3TZD A;  3FPU B;  1IKL A;  3DM1 A;  1G2S A;  3SVM A;  1IL8 A;  4QUF A;  1G2T A;  4U68 A;  1X32 A;  2MJ8 A;  3QO2 A;  4HCS A;  1S4Z A;  2X69 A;  1B50 A;  2K03 A;  2B2U A;  4XDX A;  2KVM A;  2NZ1 D;  4NW2 A;  1DOK A;  1XX8 A;  2B2U C;  2HUG A;  2HDL A;  2JYO A;  1ML0 D;  2MGS A;  2XIW A;  1F9S A;  3UI2 A;  1NR4 A;  1O7Z A;  2EOT A;  1J9O A;  1EQT A;  1PFM A;  4HSV A;  4CJ2 C;  5CBA E;  1VMP A;  1GUW A;  1DOL A;  2B2W A;  4XT1 B;  4ZAI A;  2R3Z A;  4OIK A;  2Q8R E;  1RHP A;  1B2T A;  2B2W C;  2NWG A;  4X3U A;  1WTR A;  4OIJ A;  5EPL A;  1QE6 A;  1CA6 A;  1BBX C;  3G7L A;  1ZXT A;  3N52 A;  2KEE A;  1U4P A;  4O42 A;  1HUM A;  1DOM A;  4HED A;  1MI2 A;  2SDF A;  3H91 A;  1BO0 A;  2JP1 A;  1E0B A;  1A15 A;  5AFW A;  5COR A;  1WTQ A;  2DY8 A;  5DNF A;  1EOT A;  1CM9 A;  3I8Z A;  1QG7 A;  2K1B A;  1O7Y A;  2B2V A;  2FHT A;  3HP3 A;  5EJW A;  5EQ0 A;  4IUQ A;  5COY A;  4DN4 M;  1G6Z A;  1C8C A;  2EPB A;  1ICW A;  2B2V C;  1EIG A;  1PDQ A;  2KED A;  3MWY W;  4UAI A;  4X3S A;  3F2U A;  1QNK A;  4R9W A;  3FDT A;  4X3T A;  1XYI A;  1KNA A; 
#chains in the Genus database with same CATH topology
 1OO9 B;  2K05 A;  1SNP A;  2MO0 A;  1WTX A;  4ZQ3 A;  2N49 A;  2ALY B;  2LFN A;  3MXG A;  1GHJ A;  1BXT A;  2EXZ A;  1SDF A;  1IBM L;  3KBX A;  3GTO B;  1TS5 A;  2G9H D;  4FNF A;  5CYU A;  1IL2 A;  4JYA L;  1VQ5 A;  3ZJY C;  2B2Y C;  3HOX B;  4A3G G;  1YNX A;  3H0G B;  3EN2 A;  2AWO A;  4L5R C;  4KHZ A;  3UDG A;  1PZJ D;  3EA6 A;  4KHV A;  1VQC A;  1S72 A;  1SMY D;  3KJO A;  3L0O A;  5EGT A;  3HOX H;  2EVB A;  4F87 A;  4X62 Q;  3HOU G;  3H0G H;  5BN4 A;  1IBL L;  4BBS G;  4RHR A;  1VQ6 A;  1QOH A;  1Q90 A;  4LJZ C;  5D65 A;  1S5C D;  3E0J A;  4GLA C;  3E9H A;  4DK1 A;  1NUC A;  2NN6 G;  3OTO Q;  2R92 B;  2K01 A;  2Q8T A;  4P72 A;  1VQ9 A;  4HMJ A;  3M9B A;  2CQA A;  4LK1 C;  1E2V A;  2KEC A;  1LTL A;  3FPP A;  4C3I H;  2R92 H;  2VY3 A;  1DZ1 A;  1CQF A;  3CRK C;  1X55 A;  3BS1 A;  3LGJ A;  1EYD A;  1Z47 A;  1STG A;  3J80 E;  1A2U A;  1KTK A;  2KCM A;  3TDQ A;  2Q2I A;  3ICE A;  3NBH A;  5J22 A;  2K33 A;  5I4D A;  2X69 A;  2YTX A;  2PZW A;  3HS0 C;  1PZI D;  4XDX A;  1WYD A;  4DR1 L;  1AN8 A;  3HOY G;  3GP7 A;  1MD2 D;  3CCR A;  4B3S Q;  4NMZ A;  3MVV A;  4KD4 A;  2F0K A;  5KRU A;  2LXJ A;  1K8M A;  2JA9 A;  4FF1 A;  1D6E C;  1TQO A;  2Q8R E;  1P8L A;  1XPO A;  2B39 A;  4S3S A;  1II3 A;  1SYB A;  1ZXT A;  3AYH B;  3KDF A;  5BR8 L;  4P74 A;  1DOM A;  2KCN A;  4A3D G;  1F2M A;  2JP1 A;  4A3E G;  1N34 L;  4JV5 L;  3TBI B;  1CM9 A;  3HP3 A;  4AIM A;  3L3O C;  1ICW A;  2DN8 A;  3HKZ B;  5IWA Q;  2KED A;  3G6E A;  3IKJ A;  4TQU S;  4OWT B;  3D3R A;  3CCE A;  1JJG A;  1HTP A;  1Q81 C;  1Q86 C;  1HH2 P;  4BA2 I;  5C3E G;  3V05 A;  1Y1W G;  1KHI A;  2HDM A;  4MHE A;  2Z4H A;  2HIX A;  1VQP A;  1TVX A;  2DY7 A;  5LMN L;  5CV6 A;  3HG9 A;  1LO5 D;  1JWS D;  3VR4 A;  4BY1 G;  3DUZ A;  3C3L A;  1QZH A;  2VB3 X;  3K57 A;  4JOI A;  2K52 A;  3IL8 A;  4KK7 A;  5LL6 S;  1ENF A;  1XMO L;  3KOJ A;  1JQY D;  2UU9 L;  5DM6 3;  4JW0 A;  1I4P A;  1UAP A;  1LV9 A;  4X62 L;  2FXQ A;  1I6V C;  5FLM H;  1J6Q A;  1JB3 A;  1LM0 A;  2J4X A;  1VF5 C;  1GUN A;  4FXK C;  2K5H A;  1A3T A;  3X3M A;  3D4D A;  5IT9 c;  3AU7 A;  2F3W A;  4BA1 I;  3MTS A;  3PIO A;  1LTB D;  2KQ3 A;  3VYU A;  3A8K E;  3IRB A;  1SNC A;  4FF4 A;  4JG2 A;  4RFB A;  3TRZ A;  3HOV G;  3KJP A;  4MTK A;  5ELE A;  2B63 B;  3CD6 A;  2OQ0 A;  1MJC A;  1F9Q A;  2AHO B;  1D7Q A;  3SGI A;  3K5O A;  2VQF Q;  4GOP B;  4CKB A;  4FYD A;  4IJL A;  4EGV A;  1NMG A;  4X65 L;  3KDF B;  1UNS A;  4K6D A;  2CQO A;  2JA8 G;  4WJW A;  2B63 H;  4NW2 A;  1DOK A;  3VR3 A;  1HXY D;  4HID A;  2K5N A;  2KEN A;  1IW7 D;  1NR4 A;  2HQL A;  4A3J H;  4DUZ L;  1QWY A;  1Z9F A;  1N36 L;  1XNQ Q;  2KCC A;  3WWV A;  4A3B H;  3PO3 B;  1RD9 D;  1F77 A;  4OO1 H;  2B2W A;  3M4Q A;  1B2T A;  2XRS D;  1EZ6 A;  1WFQ A;  1STB A;  4X3U A;  1WTR A;  3VA5 A;  1HR0 Q;  3M7N A;  1BOS A;  5BN3 A;  3TS2 A;  3PO3 H;  1MI2 A;  2JSO A;  5JJK A;  5J39 A;  1PYS B;  5IGD A;  3SR1 A;  3NHH A;  3Q24 A;  1G8Z D;  1EYA A;  4RG1 A;  1KNA A;  3CRL C;  1LYL A;  1U5K A;  1VQB A;  1CKN A;  2OTJ A;  1WI5 A;  4CJ0 B;  4R1J A;  2FJ2 A;  1ZYR D;  5FJ8 G;  1E24 A;  2AUK A;  2MO1 A;  3J81 c;  4GKJ L;  4P73 A;  3M4P A;  4JVZ A;  4L8J A;  3CC4 A;  2YU9 B;  4A3I B;  3AFP A;  4LUV A;  4LFC L;  2NBF A;  3Q23 A;  5IP9 G;  1GJX A;  4C3J B;  3I4N G;  3S16 H;  3J7A V;  2WKD A;  2I46 A;  2F0W A;  3GTM H;  3STB C;  4U67 3;  3PUV A;  3RLN A;  4A3I H;  3QIA A;  2AWN A;  1HRJ A;  3K5N A;  4V0B A;  2PPB C;  2RKS A;  3CCL A;  1HNX L;  3NWS A;  2YYZ A;  2H1E A;  2ZJP A;  3R3O A;  4L63 B;  4R8I A;  4GN5 A;  1PZK D;  5ELO A;  4HJ9 A;  4DUY Q;  4LF6 L;  4GKK Q;  3PUW A;  2VL6 A;  4GLX A;  3BYY B;  2IX3 A;  1EWI A;  2F0V A;  1EIY B;  3UDI A;  2ZTD A;  3MAQ A;  4NXN L;  3HOZ B;  1JCK B;  2OT2 A;  4DK3 C;  4LF4 Q;  3L7Z C;  3RR5 A;  4YWL A;  2K32 A;  2SEB D;  1MBY A;  4MTN A;  4BXX G;  1I4Q A;  2FMC A;  2PMZ B;  4IUN A;  1RJT A;  1UE6 A;  3HOZ H;  4NDX A;  3TRE A;  3DEO A;  3KF8 A;  3CCJ A;  1YJW A;  5ELN A;  1G2S A;  1H9K A;  1C48 A;  4LAA A;  3PV0 A;  1X32 A;  5JEA J;  3QO2 A;  3PUZ A;  3NEN A;  4A3G B;  4PZ6 A;  1N8R C;  2WV6 D;  2Z0S A;  1E1O A;  1EU3 A;  4YWM A;  1STA A;  3A7A B;  4DR5 Q;  1D5X C;  4YY3 Q;  3HOU B;  1VCI A;  1PFM A;  4CDC C;  2K4K A;  1I4H A;  4BBS B;  4R8N A;  3NEM A;  1B44 D;  1TT2 A;  4XYO A;  2QEJ C;  4ALP A;  3I55 A;  4YCU A;  2E2I H;  3DM3 A;  2Q8I B;  4R4O A;  1NNX A;  1HR0 L;  1SFO B;  2WKC A;  4BBS H;  4PG3 A;  4OEM B;  4A3F H;  2DJG C;  4ILW A;  3BZK A;  2NN6 H;  2PI2 E;  3OWF A;  4OXP A;  3TEH B;  4UAI A;  5IYC G;  2MNA A;  1U9R A;  3FDT A;  1UWV A;  1K28 A;  2L12 A;  3VR2 A;  1KRT A;  1PMR A;  1Q3L A;  1YHQ A;  5C4X G;  3NK9 A;  1XMQ L;  3OOC A;  4IAL A;  2XNA C;  1BVS A;  2C9O A;  5E4X A;  4HIK A;  3HOY B;  4C3I G;  5M5Y B;  5NUC A;  5I9O A;  1F9R A;  1SAP A;  4LW1 A;  3G4S A;  4GN3 B;  4K8I A;  5JPN C;  4JOI C;  4HJA A;  2C35 B;  5CBE E;  1SBB B;  2RSN A;  3HOY H;  4I7A A;  4HN7 A;  4HMI A;  1STY A;  1G91 A;  2CW0 C;  1U4R A;  4ABN A;  2ID0 A;  5C3W A;  4EQP A;  1WD1 A;  1XPR A;  1M8A A;  3M85 A;  2ZJR A;  3LWE A;  3A5U A;  4A3D B;  2X6L A;  2F0N A;  2UXB L;  4DR2 L;  5C0X I;  1EQQ A;  3IFT A;  4JI3 Q;  2YV5 A;  2K5V A;  1LT3 D;  4A3D H;  4O2D A;  3CCM A;  4A3E H;  4JBW A;  2N88 A;  1N32 Q;  5C3E B;  2UUA L;  5C0X J;  3RZD H;  1Y1W B;  4QUC A;  3HOW H;  2K75 A;  4O0A A;  1E2W A;  4JI7 L;  1W3S A;  2CW0 D;  3CCV A;  1O7I A;  1RDP D;  4K5W A;  5C3E H;  4OX9 Q;  1Y1W H;  1Q1E A;  1HCZ A;  1XX8 A;  1OXX K;  2MGS A;  3QG1 A;  1IHZ A;  3F2D A;  1PH7 A;  1GD7 A;  2E76 C;  4BY1 H;  4GZY C;  4DR5 L;  2D62 A;  4YY3 L;  3J80 i;  4B3M L;  4IQZ A;  5DLQ E;  2ICE C;  1I4R A;  3K6O A;  1RHP A;  2B2W C;  2IW3 A;  3OYY A;  1TWH B;  4F88 A;  2E5L Q;  4QY7 A;  4DV3 L;  4JBM A;  4RGO S;  2KEE A;  1VQN A;  2VS1 A;  3BVZ A;  1HZB A;  3H91 A;  1BO0 A;  3V2T A;  2OTL A;  1E0B A;  5COR A;  2OQK A;  5DNF A;  3CF5 A;  4MIU A;  1O7Y A;  2FHT A;  1TWH H;  4IUQ A;  1G6Z A;  1Q8K A;  1YHA A;  1B9M A;  5CV7 A;  2WAC A;  3HOV B;  5E3F A;  2JA7 G;  1LTS D;  4DXG A;  1QVC A;  2HCI A;  3TZU A;  4PZ7 A;  3DMU A;  1HFG A;  2CKZ B;  3HOV H;  1WTO A;  2JA8 B;  1ENA A;  5J1Z A;  1SNO A;  2ZM6 Q;  4TKO B;  2F52 A;  2I5H A;  4A3L G;  4J15 A;  1QUQ B;  3MFY A;  4N9P A;  4XT3 B;  1PA6 A;  1OXT A;  4A3K B;  2JA8 H;  2G9D A;  2GVB A;  1EY8 A;  1IYJ B;  4DR3 L;  3EQL C;  2A8V A;  2AUJ D;  5JOB A;  3CCQ A;  2QCP X;  2C5C A;  1KDC A;  1SMX A;  3T4A C;  3W5O A;  4ZKB B;  1IBM Q;  1I94 Q;  3KUP A;  1GXD C;  3SK5 A;  3I7F A;  4ZUJ A;  2VW9 A;  1YI2 A;  3GD7 A;  3GTQ B;  4JYA Q;  1MGS A;  3S2H B;  5I6Y A;  1NE3 A;  4A4I A;  4B08 A;  3AMU A;  4A3J G;  2UXC Q;  3A54 A;  2F0P A;  1PRT F;  2GA4 B;  1DCZ A;  4ODG A;  3GTQ H;  2PZU A;  2JA5 G;  3S2H H;  1SLJ A;  1QNU A;  2J7Z A;  1IBL Q;  3C2P A;  3RN5 A;  3I4M H;  2DJF C;  3BG3 A;  1N32 L;  5EKI A;  1JIC A;  2NUC A;  2ZJQ A;  3DM1 A;  1LT5 D;  2NZH A;  1KLG D;  3I4N B;  1G6P A;  5FJ8 H;  1TWC B;  2QKI C;  3HRZ C;  5E1F A;  1VDZ A;  5CGK A;  1HTL D;  5C44 G;  1EY9 A;  5M3F G;  4IO9 A;  5IT9 E;  1RIP A;  3OMC A;  1AE3 A;  4OL7 A;  5M9O A;  3A74 A;  4PQX A;  2OXP A;  5IP9 H;  1J9O A;  2UUC Q;  1SYG A;  3I4N H;  1Q46 A;  1TWC H;  1N9W A;  4YCW A;  1JC7 A;  1L0X B;  5FLX L;  4N9T A;  4JI6 L;  4KY6 A;  1ASZ A;  3H3V C;  1BBX C;  1V43 A;  4WFN 3;  1EY5 A;  5I2X A;  3BU2 A;  4JI4 L;  2E5L L;  4HED A;  1Q12 A;  5AJ3 L;  2SDF A;  4G4K A;  1WTQ A;  4EX5 A;  1UE1 A;  5COY A;  2VQE L;  3UDF A;  4LF7 L;  1QNK A;  1B1Z A;  2OWO A;  1EQR A;  3PF4 A;  1GVP A;  4DA2 A;  4UPA A;  5IT9 L;  3CC2 A;  3AFQ A;  2BA1 A;  3QB3 A;  2RF4 A;  4RA8 A;  1OXS C;  2RCF A;  1X3Q A;  4DV4 L;  2MHV A;  4BXX H;  4B9W A;  1N34 Q;  3NQI A;  1TWF H;  1LTG D;  3ULJ A;  5FOB B;  3K7U C;  4X64 L;  2M00 A;  2M9V A;  1AZP A;  2R7Z H;  4EQ5 A;  2GVA A;  1D1I A;  4IZ8 A;  2CHB D;  1HZC A;  3A0J A;  2D9U A;  1LTI D;  4R4I A;  5LMN Q;  1K83 B;  4RHS A;  2A6H C;  3J81 E;  1RL2 A;  1Y8N B;  1I94 L;  1ILQ A;  3I70 A;  1HQR D;  3K80 C;  1KDA A;  1JOO A;  3T1Y L;  2B2T A;  3J81 j;  2FIN B;  2HHH L;  1KQS A;  5GQO A;  4DR7 L;  5EPK A;  4K5X A;  4HIM A;  2UXC L;  1K83 H;  5JJI A;  1EQV A;  3D6W A;  1XMO Q;  1W6K A;  2UU9 Q;  4DV6 L;  1KIX A;  4BY7 G;  3ITP A;  5D3D A;  4DV1 Q;  5IYC H;  5C4X B;  1NAP A;  2EZV A;  1HPC A;  3FPU B;  4A3F G;  1QVF A;  1KXL A;  4FXD A;  1TXY A;  4HJ7 A;  3GTP H;  2MJ8 A;  3ER0 A;  3K7A H;  4DV2 L;  1JB7 A;  4C3I B;  5HY6 A;  2R93 G;  1SE8 A;  2KVM A;  1QVG A;  2A6H D;  5C4X H;  1SN8 A;  2XIW A;  1E1T A;  3TP5 A;  1ET6 A;  4P71 A;  4K2K A;  2N78 A;  1B8A A;  1BKB A;  1JOK A;  2IHE A;  1BBW A;  4HSV A;  2UUC L;  3MEF A;  4FVM A;  2F3I A;  2LKV A;  4M8A A;  4X65 Q;  4X6A H;  1VQJ A;  2KCT A;  1SJH D;  3NBI A;  3LWU A;  4DR4 L;  1X56 A;  1AH9 A;  1K9M C;  5AFW A;  1RKN A;  1S5B D;  3A8I E;  2Z6K A;  2B2V A;  4C3H G;  2IPK D;  3L9A X;  4DUZ Q;  1N36 Q;  4NB3 A;  1D5M C;  5FO7 B;  1ESR A;  2BH2 A;  2A1A A;  3KK7 A;  2BH8 A;  2H4O A;  3W1G A;  2XRQ D;  5C6A A;  3TP7 A;  2EJM A;  4GOP A;  1G29 1;  1Q8I A;  1F2L A;  1KL9 A;  1PTO F;  1U4M A;  4KJN A;  2KOL A;  3FP9 A;  2R7F A;  5I9P A;  3J80 L;  1Q82 C;  4FP5 D;  4IPD A;  3JC6 6;  3JAM c;  2WAQ E;  1CZG A;  4KI0 A;  3HOW G;  3R2T A;  3DWQ A;  1NCV A;  4RH6 A;  2B3G A;  2A69 D;  4YHH Q;  2L11 A;  1BUV T;  2NVY B;  1PLF A;  3CCS A;  4GKJ Q;  4IFD I;  4JI0 L;  4RMF A;  5D14 A;  3G71 A;  4B3T Q;  2EQS A;  3DXJ C;  3TQY A;  4AYB E;  4IUV A;  4FF3 A;  4LFC Q;  4ZK9 B;  1BR9 A;  4J1M A;  2NVY H;  2VUM G;  1K0S A;  1JJC B;  1E3P A;  4IFD J;  1Q7Y C;  5GAG C;  3PO2 G;  4EVO A;  1I4G A;  3TS0 A;  1ET9 A;  5G3L F;  2JA7 B;  3N6R A;  2JEB I;  2KHI A;  4LUZ A;  4UDU C;  4OWW B;  1HNX Q;  2A73 B;  1GUS A;  3CU7 A;  2N55 A;  4DV1 L;  2EY5 A;  1QIL A;  1G2T A;  4LF6 Q;  1UEA B;  2JA7 H;  5LMN W;  3A8J E;  3ERQ A;  3NTH A;  1EY4 A;  1PRT B;  3F1Z A;  1F2Z A;  1WTH A;  2QGQ A;  1A8V A;  4NXN Q;  1IW7 C;  3H3V I;  1HNW L;  1PYB A;  5IP7 G;  1EFW A;  3UI2 A;  2Z1C A;  3ERO A;  1ENC A;  2XTI A;  3PSI A;  4JI2 Q;  4A3L H;  2B8F A;  4K14 A;  1GUG A;  2F0S A;  2Z9H A;  2PQA B;  4YIJ A;  2Q2T A;  4XYQ A;  1BCP F;  3ND9 A;  3RD4 A;  4HJ5 A;  4O42 A;  1S5E D;  3Q0A A;  3D8G A;  4A3J B;  2XGT A;  4A3B B;  3Q22 A;  2DY8 A;  2F4V L;  1PVO A;  1C8C A;  1V1P A;  3CC7 A;  3OW2 A;  2SNS A;  2H5X A;  5KGU A;  3F2U A;  2Y0S E;  1ZYR C;  3OMG A;  1CI3 M;  2RDG A;  4LMQ D;  3SHL A;  3FMC A;  2AQ3 B;  1TS3 A;  2O4X A;  1KRS A;  1VQF A;  4HSP A;  1SND A;  1JR0 D;  4J8Q A;  2WB1 E;  2Q2U A;  2JA5 H;  4DAP A;  2QW7 A;  2A6E D;  1H95 A;  2IL8 A;  4MZ9 A;  1EYG A;  4AH6 A;  2EY6 A;  3W2D A;  5M3F B;  4KY7 A;  1KD1 C;  3PGZ A;  5IGF A;  1HJP A;  2PNH A;  1A2T A;  4Z9C B;  1AZQ A;  3I4M G;  5EKL A;  1B4O A;  4TVA B;  4DV7 L;  2E75 C;  2B8G A;  1AP0 A;  1CSP A;  5C44 H;  1F9P A;  5M3F H;  4YHH L;  3C46 A;  2JA6 G;  2QDL A;  3S1N B;  3S16 B;  2NYZ D;  2ZTE A;  1XMQ Q;  1V8Q A;  1SRU A;  3ZYY X;  4B3R Q;  3FEW X;  3GTM B;  4B3T L;  4JI5 Q;  4R4C A;  4ID6 A;  1VS0 A;  4G7H C;  4IUP A;  3S1N H;  3QWN A;  1TKW B;  2B2T C;  1K73 C;  4RGM A;  1BF4 A;  4ZUI A;  2AMC B;  2L55 A;  4X3K A;  1D5Z C;  2VZA A;  1UE7 A;  3QJY A;  3NEL A;  3M7G A;  1EOV A;  2PZT A;  3GTG B;  1BNZ A;  3RNU A;  1SE4 A;  2IT1 A;  4H02 A;  3CME A;  2F03 A;  2UXB Q;  4JK1 C;  4DR2 Q;  5JEA G;  1NY4 A;  3O13 A;  1SJE D;  3GTG H;  2NZ1 D;  3NUC A;  5IYB H;  1EYC A;  1V1P B;  4DAM A;  3SXH A;  5EAY A;  2UUA Q;  2L0C A;  4DR6 L;  1JE5 A;  3F2C A;  4JI2 L;  1GUW A;  1TY2 A;  4JI7 Q;  4OIJ A;  3G7L A;  1SE2 A;  1MIU A;  1CSQ A;  4A3M G;  1X3G A;  3PCO B;  4DNR B;  4QQB X;  4H0L C;  2R7Z G;  3KLS X;  1STE A;  5EJW A;  3SE0 A;  2Z6K C;  2B2V C;  3J7Y W;  1D1K A;  5JVG 3;  1H9S B;  4HR7 B;  4L6T B;  4X3S A;  2K50 A;  4FF2 A;  2UUB Q;  4B3M Q;  4BY7 B;  1BBU A;  2K5D A;  3PMF A;  3BJU A;  1B3A A;  1K0R A;  5A2Q E;  1VQ8 A;  1SEB D;  2E2I B;  1HHV A;  3S1M H;  2R61 A;  3EJI A;  3C1F A;  1CKM A;  4YWK A;  3SDZ A;  1X6O A;  1WCM G;  4DV3 Q;  2PCF B;  4A3F B;  4X66 L;  4ZKC B;  5C3X A;  3RZO B;  1K8G A;  4RAU C;  4RKL A;  5IGB A;  4GOP C;  4BY7 H;  1HA6 A;  1O7L A;  1HFN A;  1FR3 A;  1PV4 A;  2R93 B;  1R9T B;  4NP5 A;  3MC0 B;  4OHJ A;  2EYP A;  4XIG S;  2QF7 A;  3I91 A;  1TII D;  1U4L A;  1RF2 D;  3VR6 A;  3PF5 A;  3RZO H;  4LF8 Q;  2IJ0 A;  3T56 B;  5HGT A;  2L9H A;  1PRT D;  2I07 B;  2R93 H;  2BE5 D;  1R9T H;  3UE1 A;  3TP8 A;  5M5X H;  1WTP A;  2A5H A;  5I6W A;  1DJR D;  3X3N A;  5KNC A;  2IX0 A;  1CK1 A;  4FO2 A;  1PH1 A;  1JMC A;  1PTO B;  5C5L A;  5A2Q L;  1DD2 A;  4KN4 C;  4PMW A;  2OCE A;  4B3R L;  4OGQ C;  1TR5 A;  4Q5V A;  5EBC A;  3E3X A;  1EL0 A;  4JI5 L;  4ULL A;  4C3H B;  1HR0 W;  1EWH A;  3CMA A;  1PTO H;  4JI1 L;  3KF6 A;  5IYD H;  2F0E A;  4DR3 Q;  2IX1 A;  2KUM A;  3HGB A;  1V9P A;  2R7D A;  1EUJ A;  4OWX B;  4C3H H;  2L5T A;  5C0X G;  2FFK B;  3J81 i;  3A7L A;  3Q6S A;  3L2P A;  3U9S A;  3K5M A;  4K6L A;  2NVX H;  4G7O C;  4U68 A;  2PNR C;  4LWC A;  4A3E B;  2LMC B;  3I4O A;  1XXG A;  1L2F A;  2UXD L;  3B6Y A;  2ES2 A;  4XQJ A;  1XWE A;  2HUG A;  3RZD B;  1PH8 A;  3S9W A;  1QUQ A;  3HOW B;  1J5E L;  2OEO A;  2F0L A;  1RCV D;  1VQM A;  4LF9 L;  3NQT A;  5EBD A;  1SXT A;  1MKH A;  1GM5 A;  1I3Q B;  4DKA C;  4ZAI A;  3QOL A;  3GTL H;  3K81 C;  4KD3 A;  1CA6 A;  1TS2 A;  4IOC A;  1Y1V G;  1QZG A;  2VUM B;  2KJX A;  1LTT D;  3SEB A;  1L1O B;  4A93 G;  4C56 C;  2E2H H;  2K14 A;  1I3Q H;  5FK9 C;  2DNC A;  3R2I A;  4BY1 B;  1EOT A;  4CDD C;  3PO2 B;  5F2D A;  2XSC A;  4E6I A;  2F1M A;  1ASY A;  3KLR A;  5M5W H;  3KFU A;  2DGY A;  3MWY W;  1PDQ A;  1FD7 D;  2VUM H;  4DK6 C;  1CZW A;  3S2D H;  3OPO A;  4M1U B;  2E2D C;  2XWB B;  3A55 A;  1SYF A;  3CHB D;  3PO2 H;  2UUB L;  1LAB A;  1BCP B;  1NBW A;  4JI6 Q;  5BN5 A;  1MSG A;  4JI4 Q;  3V96 A;  5AJ3 Q;  3CPW A;  2QA4 A;  1SE3 A;  3E5S A;  3TSS A;  1N33 L;  2A74 C;  2VQE Q;  5LL6 X;  5DM7 3;  3ULL A;  1FL0 A;  3KF6 B;  4QB4 A;  4LF7 Q;  4QMG A;  2TSS A;  3UE0 A;  3HFZ B;  5M3M G;  4LF8 L;  2RVL A;  4DK0 A;  1CKO A;  1WD0 A;  1ICF B;  4GLV B;  5IP7 H;  1CHP D;  1KAB A;  1B7Y B;  2F0F A;  1HNZ L;  2B29 A;  4DV4 Q;  2K5Q A;  3VYS A;  4MN3 A;  4KN7 C;  3S14 B;  5JJZ A;  1I5F A;  2PI2 A;  2F4I A;  2EJF C;  3P7J A;  4X64 Q;  3I2Z A;  2F3V A;  5ELC A;  3U4V A;  2ASB A;  3I90 A;  1S5F D;  1T5E A;  5EPJ A;  4DF7 A;  4K0K L;  3BYT B;  3JAM E;  3S14 H;  1KNE A;  2K7V A;  3K0Y A;  4CJ1 B;  4G7Z C;  1IBK L;  1W6J A;  1SYC A;  1YNJ D;  2BDN A;  3J7Z C;  1E7Z A;  1UUP A;  1FYC A;  2MP1 A;  2F0U A;  1HA5 A;  2NTS A;  3T1Y Q;  1DGS A;  1I50 B;  1R4P B;  2K03 A;  2HHH Q;  1JWU D;  5LHY 1;  2WIN B;  4DR7 Q;  2JYO A;  3I4M B;  1XNR Q;  4ZCK A;  4K2L A;  3FKI G;  4DV6 Q;  4WOR A;  4KKU A;  1I50 H;  2RDF A;  2ZTC A;  2A19 A;  5IY0 A;  1SYE A;  1SR3 A;  2TMP A;  1EY7 A;  3HKZ E;  4DV0 L;  2JA6 B;  5H1S E;  3JAM L;  5IIF A;  2CFM A;  2EJG C;  3AQQ A;  3UDX A;  4XQQ A;  3N52 A;  5ELB A;  4DV2 Q;  3P1H A;  2JA6 H;  2XN9 C;  3NSW A;  2F0D A;  1IYV A;  2I5M X;  3EFX D;  1PTO D;  1L0Y B;  3I72 A;  4QIW E;  1A62 A;  4C1N I;  4DPG A;  4L5T A;  1A63 A;  5JJL A;  3GDE A;  1YHB A;  5DAU A;  2ZXP A;  2BOS A;  4KLK A;  4UY8 C;  3VYT A;  4OO1 I;  3OHX C;  2RBM A;  3LX0 A;  3G6J B;  5IE8 A;  2WP8 J;  4CKE A;  4JI8 L;  3VA7 A;  2MFI A;  4DR4 Q;  3OSO A;  3BDC A;  3IFD A;  4IPH A;  2D5D A;  1EY0 A;  2A68 D;  4HAE A;  1VQA A;  1O80 A;  4RCN A;  1S3O A;  2BCO A;  2HD3 A;  3NPP A;  3D0F A;  4KHP L;  5C4Z A;  5JEA H;  1A6X A;  1STH A;  2D2C C;  3NWT A;  3T13 A;  4I7Z C;  1IZ6 A;  1TWF B;  5C4H A;  4CDE C;  5G3L D;  3DEP A;  2R6G A;  3R8B A;  2HCC A;  1GOZ A;  5IYB G;  3HKS A;  2NB0 A;  1E2Z A;  2CH4 A;  2R7Z B;  4QL5 A;  4RGT A;  3URY A;  3A56 A;  4F7X A;  3QR8 A;  3CP0 A;  4HJ8 A;  5L37 A;  4A3M H;  4POG A;  1P16 A;  4BS9 A;  2KA7 A;  3ULP A;  5KYL A;  2E74 C;  3CXC A;  5K36 G;  4JI0 Q;  2IWH A;  4N8F A;  3EVQ A;  1STN A;  3KLS A;  4I65 A;  4EQO A;  1KC8 C;  5TSS A;  1IL8 A;  1NMF A;  1X54 A;  5IGC A;  1OXU A;  3VR5 A;  3PIP 3;  1SYD A;  3CQZ H;  3AEV A;  1B50 A;  1BCP D;  2B2U A;  4DAY A;  1WCM H;  4A3C G;  3HZX A;  4L5Q A;  1XTD A;  4BBR G;  1F9S A;  2RHS B;  4JBJ A;  4C1N K;  1DXM A;  1XNR L;  2LSS A;  2F0G A;  3GTP B;  3K7A B;  4CJ2 C;  2NVQ H;  2G5D A;  1GKH A;  3W3A A;  1S5D D;  1VQO A;  4JCV E;  4IJH A;  4RCO A;  2HIV A;  2K5W A;  1YIT A;  1ZKO A;  2L15 A;  4N8X 1;  2WAQ G;  4LFB L;  3J81 L;  1HNW Q;  1QG7 A;  2K1B A;  5KIX A;  1VQ4 A;  4WRD A;  3GTO H;  1GO3 E;  1EIG A;  3T51 B;  1LUZ A;  2MUY A;  4UP7 A;  2E2J B;  1NR2 A;  1A0I A;  1FJG L;  4C2M B;  1V1Q A;  2XWJ B;  4IUT A;  5LMU L;  1PFB A;  2O5I C;  4AYB G;  1MSH A;  1EEI D;  1TWG B;  1L0W A;  3SK6 A;  2I0Q A;  2F0J A;  3ONA B;  2M2L A;  4GN4 B;  1LLR D;  4QCL A;  5C5M A;  2E2J H;  2EYM A;  3VYR A;  4C2M H;  5C0X H;  2OF1 A;  5IYD G;  1JT8 A;  2F4V Q;  1KDB A;  1U0L A;  1TWG H;  3T1H L;  1YJ9 A;  2A69 C;  2YTV A;  3NXW A;  4HCE A;  2EY2 A;  5GAH C;  2RCN A;  2NN6 I;  3TME A;  4CDF C;  1LT4 D;  4H13 C;  3S24 A;  4L5S A;  2PQA A;  1Y1V B;  3WDN A;  3RMH A;  2PMZ E;  1GHK A;  1X9N A;  4HTH A;  4A93 B;  1H9M A;  1Y69 U;  2RSO A;  4AQY L;  3KYH C;  2BDO A;  1Y14 B;  4DAY B;  4UP9 A;  2LXK A;  3KLW A;  4IFD G;  4OON A;  1Y1V H;  2FMM A;  2NZO A;  4A93 H;  1WTW A;  2QIL A;  3M4O B;  4RWS C;  1AW7 A;  4DV7 Q;  3Q8D A;  2GN5 A;  1D8L A;  1WTV A;  2N3S A;  2KBN A;  2J0T D;  3BZC A;  1MJE A;  3M4O H;  1XTC D;  1I4X A;  2QDB A;  1PH6 A;  3H94 A;  4NKL A;  2EYL A;  3K0X A;  2HDL A;  2Y0S G;  5IOC A;  1WJJ A;  5KEE A;  5M3M B;  1EFI D;  3D6C A;  2PW5 A;  1NTG A;  1PHJ A;  3S1Q B;  1XJV A;  2WB1 G;  4O1N A;  3WOE A;  1CT1 D;  4XT1 B;  1HQM C;  2R3Z A;  1CHQ D;  4OIK A;  1I6H B;  4ZRZ A;  5JAV A;  2KHS A;  1PH4 A;  5M3M H;  1G51 A;  3K59 A;  3RN2 A;  4QIW B;  3S1Q H;  2WFW A;  1WOC A;  1A15 A;  1I6H H;  2DUD A;  1NSN S;  4XTC S;  5CV4 A;  5EQ0 A;  5FLX c;  3H15 A;  2Z8L A;  3MXP A;  4R9W A;  1DON A;  4DR6 Q;  2HT1 A;  2A6E C;  2F0T A;  3F8T A;  4CHT B;  1KAW A;  3D4W A;  3NBH B;  3PIP A;  1RTO A;  3G48 A;  4Q0F A;  1YJN A;  2AQ1 B;  1BDO A;  1SRO A;  3OTO L;  1OXV A;  3WOF A;  2JQO A;  4XXE A;  5CV8 A;  2K28 A;  3T53 B;  3FKI B;  2Q2H A;  2JA5 B;  1S40 A;  2F0I A;  1QB5 D;  1IKM A;  2IHF A;  1AEX A;  4CGY B;  3H09 A;  4CKC A;  4X66 Q;  1YBY A;  3FKI H;  1FGU A;  1WVL A;  3PUX A;  5T1G A;  1JWM D;  3CW2 C;  5GAD C;  2L4N A;  1PFS A;  3NE5 B;  2PW7 A;  3RLF A;  1FNU A;  1LTR D;  2D0O A;  4PZ8 A;  5FKA C;  2JJQ A;  5C44 B;  5CMD A;  2ZT9 C;  4ZLT F;  2EYJ A;  2RHQ B;  4B3S L;  1H9S A;  4A3K G;  3BZD B;  4DNT B;  4P75 A;  1K8A C;  1AE2 A;  1TWA B;  2EIF A;  3DWA A;  3RLO A;  2AKW B;  3IAY A;  3ERS X;  1MHW C;  1K3R A;  3CKI B;  4QGU A;  1ESF A;  2EYF A;  1TWA H;  3E9I A;  5CR3 A;  4JI1 Q;  3JAM i;  2B2U C;  1QCB D;  4WJ3 M;  4GNX A;  4CBV A;  4GS3 A;  1A3U A;  1T5X D;  5IWA L;  2EOT A;  4R4Q A;  2PO4 A;  3NTK A;  5D3I B;  4K5V A;  1VMP A;  3H6M A;  3MHB A;  1YIJ A;  1UE5 A;  1LT6 D;  4A76 A;  1QE6 A;  3RUZ A;  3NTI A;  4NPS A;  2QEX A;  1U4P A;  2UXD Q;  1F2Y A;  5HUR A;  2DNE A;  1J5E Q;  2YU9 H;  5CV9 A;  4DFA A;  2D0P A;  2CWA A;  1SNM A;  4LF9 Q;  4C3J H;  1XYI A;  2MPM A;  4QF4 A;  4HIO A;  1JOR A;  1EIF A;  4K8J A;  2BA0 A;  1FNW A;  4H44 C;  4Y7N B;  5E4W C;  4JPB W;  5K36 H;  1Z7T A;  1B53 A;  3BVM A;  3I3C A;  1ILP A;  3GV6 A;  4Y7N H;  4BWG B;  4BBR B;  1PRT C;  2BE5 C;  3OIQ A;  3S1M B;  1TY0 A;  4TRD A;  3BDO A;  2F0Q A;  4IPC A;  1PH5 A;  1C4Q A;  1FVI A;  3STB D;  4A3C H;  1DM0 B;  4V19 0;  3J80 c;  4BBR H;  4WJ4 A;  4J6H A;  2X6G A;  4B9X A;  4PNY A;  1IXR A;  1JE4 A;  2VQF L;  4QJF A;  3EIV A;  1N33 Q;  1O78 A;  1L1O A;  2WAQ B;  1ZEQ X;  1Y8P B;  2L1B A;  3BDL A;  3MFG A;  5M5X B;  3M4Y A;  2N8N A;  1T9H A;  3EBE A;  3S15 B;  3I56 A;  3FVQ A;  1EWC A;  3I4L A;  1YVC A;  4GNX B;  3MA2 B;  4A75 A;  5J3B A;  5JVH 3;  4A3G H;  1CKN B;  4KV6 A;  1QJO A;  1XNQ L;  4AYB B;  3S15 H;  2WII B;  2JEA I;  1LTA D;  1HNZ Q;  4F8M A;  1VQG A;  3TZD A;  1IKL A;  1CQV A;  3HOU H;  1CFM A;  3FHW A;  5IGG A;  1PH2 A;  1V1O A;  1GUO A;  3HOX G;  1JJ2 A;  1Q1B A;  2EYH A;  5E7N A;  1ML0 D;  4K0K Q;  3H0G G;  2CWP A;  3S1R B;  2PQE A;  3U50 C;  1OTC A;  1SFO H;  4Y52 H;  1EQT A;  3BVG A;  5K5P A;  3OIP A;  5ISR A;  5A35 A;  2NVX B;  1IBK Q;  5CBA E;  3E6Z X;  1PYW D;  1EU4 A;  4FDB A;  2ATW A;  3S1R H;  1K8O A;  1PH9 A;  1H9R A;  4MNO A;  1VQH A;  1HUM A;  3U4Z A;  4IOA A;  2R92 G;  2Z4I A;  4YCV A;  1KAA A;  2F0H A;  1KLU D;  4KKT A;  2O5J C;  3GTL B;  1Y8O B;  5FO8 B;  1CTM A;  1XPU A;  4DV0 Q;  2EDG A;  5M5Y H;  3TN2 A;  2SNM A;  5KND A;  1YNN C;  4IFD H;  2ZXO A;  2E2H B;  1EEF D;  1JOQ A;  5EKK A;  3KF8 B;  2RA4 A;  3SK4 A;  3CPF A;  4LFA Q;  3TP6 A;  1C0A A;  5M5W B;  2B2Y A;  1ONL A;  3S2D B;  3S17 B;  4DUY L;  4GKK L;  2Y0S B;  1BQQ T;  1FGB D;  5T1I A;  4PMC A;  4KMU C;  5DEH A;  2ENB A;  3D31 A;  2O2L D;  1W2B A;  2EY1 A;  1VMC A;  2ICI A;  4LF4 L;  5I2Y A;  2LS0 1;  2WB1 B;  3S17 H;  1Z6H A;  2JK8 A;  3OWE B;  4JI8 Q;  1RTN A;  1DYQ A;  1YNN D;  1X3E A;  2NTT A;  3F2B A;  1PH3 A;  1SSO A;  2EYO A;  5GAE C;  3H3V H;  3FRP B;  3J7A 5;  4NXM Q;  3K58 A;  5IGE A;  4KHP Q;  4KKS A;  3HEJ A;  2F0M A;  4FXG C;  2AQ2 B;  4KY5 A;  1HUN A;  3HKZ G;  4DV5 Q;  1VQD A;  4RGN A;  4ME3 A;  1YNJ C;  1YZ6 A;  2HQE A;  3DWP A;  2PYK A;  1UEB A;  1VQI A;  2RQX A;  1AFP A;  4LF5 Q;  3SVM A;  3GTK B;  3J7A F;  2EXD A;  4EQN A;  4HCS A;  2E8G A;  1M90 C;  2IY5 B;  4P2C B;  3U9O A;  4PMB A;  3GTK H;  2CCZ A;  3D4R A;  2ZXR A;  4PV1 C;  1O7Z A;  5FLM G;  1B3Q A;  4KJO A;  4GNX C;  1HZA A;  4JBK A;  1X3F A;  2VNU D;  3MXU A;  3I73 A;  5GRO A;  3SK8 A;  1K3B C;  5CC4 A;  4DAV A;  1VF7 A;  5FO9 B;  4IN3 A;  5EPL A;  3W1B A;  1IYU A;  1VQL A;  1PTO C;  3OW7 A;  1TS4 A;  3P75 A;  5HGQ A;  1B70 B;  3DHQ A;  1C7Y A;  3I8Z A;  3NP8 A;  1EY6 A;  4DN4 M;  4POF A;  2JE6 I;  1GUT A;  3GTJ B;  4OEL B;  1PFN A;  1H9J A;  2VXW A;  2CH4 W;  3E0E A;  2B63 G;  1TU2 B;  3LNN A;  4A3K H;  2A68 C;  2JN4 A;  4IUR A;  2EE1 A;  1ROD A;  2LY7 A;  4UP8 A;  3GTJ H;  4XQN A;  2VB2 X;  3PQI A;  5KYI A;  5ELD A;  4LFA L;  3PUY A;  3MXN A;  1R4Q B;  4LFB Q;  2SOB A;  4A3B G;  3U58 A;  4IUU A;  4G57 A;  5JPM C;  3K5L A;  4OO1 G;  3GV3 A;  2KHJ A;  1EIH A;  2F0O A;  5ELF A;  1PXU A;  4JI3 L;  1J8I A;  5FLX E;  2K04 A;  1FJG Q;  1CA5 A;  2I5L X;  5LMU Q;  3QOJ A;  2V1C C;  3PO3 G;  4DU9 A;  3GO5 A;  2XVS A;  4JC0 A;  2Z6B A;  5KNB A;  1HZ9 A;  3KBG A;  2RDH A;  1X3P A;  4APV A;  4IPG A;  3T1H Q;  4OX9 L;  1L1O C;  1CUK A;  4H7B A;  5C4J B;  2CVR A;  1LAC A;  4UHV A;  4NXM L;  3R93 A;  1VQK A;  4R4T A;  4ZYS A;  1VQ7 A;  1SNQ A;  1M4V A;  4ME5 A;  4TSS A;  3VDY A;  4RKB A;  3MZ5 A;  4DV5 L;  3CAM A;  4LNQ A;  5C4J H;  2JXM B;  3DLL A;  3MEH A;  1BCP C;  1C9O A;  4A3M B;  2NVT B;  4QUF A;  3CCU A;  1X65 A;  1YEZ A;  1NJI C;  3GQB A;  3A5Z B;  4A3I G;  4LF5 L;  1D2B A;  4DR1 Q;  4AQY Q;  1S4Z A;  1A3V A;  1VQE A;  4KTA A;  4C3J G;  2MQH A;  5IOD A;  1EZ8 A;  2NVT H;  3M3Y B;  1M1K C;  3T16 A;  3ND8 A;  4DXF A;  4LUO A;  3CQZ B;  1DOL A;  3P20 A;  4DNI A;  1WCM B;  2NWG A;  5BR8 Q;  3M3Y H;  2V4D A;  3AB9 A;  2K6A A;  2P5Z X;  4JV5 Q;  3C1E A;  5CV5 A;  3MXN B;  3K8A A;  1SMY C;  2ZM6 L;  2YTY A;  2NVQ B;  1FNV A;  2EPB A;  3HOZ G;  3PIO 3;  1B9N A;  4DGZ A;  1E22 A;  4X3T A; 
#chains in the Genus database with same CATH homology
 1OO9 B;  2K05 A;  1SNP A;  1WTX A;  4ZQ3 A;  2LFN A;  3MXG A;  1GHJ A;  1BXT A;  2EXZ A;  1SDF A;  3KBX A;  3GTO B;  1TS5 A;  2G9H D;  4FNF A;  5CYU A;  2B2Y C;  3HOX B;  3H0G B;  2AWO A;  4KHZ A;  1PZJ D;  3EA6 A;  4KHV A;  1SMY D;  5EGT A;  2EVB A;  4F87 A;  5BN4 A;  4RHR A;  1QOH A;  1Q90 A;  4LJZ C;  5D65 A;  1S5C D;  3E0J A;  4DK1 A;  1NUC A;  2NN6 G;  2R92 B;  2K01 A;  2Q8T A;  4HMJ A;  2CQA A;  4LK1 C;  1E2V A;  2KEC A;  3FPP A;  1DZ1 A;  1CQF A;  3CRK C;  3BS1 A;  1EYD A;  1Z47 A;  1STG A;  3J80 E;  1A2U A;  1KTK A;  3TDQ A;  3NBH A;  5J22 A;  2K33 A;  5I4D A;  2X69 A;  2PZW A;  3HS0 C;  1PZI D;  4XDX A;  1AN8 A;  3GP7 A;  1MD2 D;  4NMZ A;  3MVV A;  4KD4 A;  2F0K A;  5KRU A;  1K8M A;  4FF1 A;  1D6E C;  1TQO A;  2Q8R E;  2B39 A;  4S3S A;  1II3 A;  1SYB A;  1ZXT A;  1DOM A;  2KCN A;  1F2M A;  2JP1 A;  3TBI B;  1CM9 A;  3HP3 A;  3L3O C;  1ICW A;  2DN8 A;  3HKZ B;  2KED A;  3IKJ A;  4TQU S;  3D3R A;  1HTP A;  4BA2 I;  3V05 A;  2HDM A;  4MHE A;  2Z4H A;  1TVX A;  2DY7 A;  5CV6 A;  3HG9 A;  1LO5 D;  1JWS D;  3VR4 A;  3DUZ A;  3C3L A;  2VB3 X;  3K57 A;  3IL8 A;  4KK7 A;  5LL6 S;  1ENF A;  1JQY D;  5DM6 3;  1I4P A;  1UAP A;  1LV9 A;  1I6V C;  1JB3 A;  2J4X A;  1VF5 C;  1GUN A;  4FXK C;  1A3T A;  3X3M A;  3D4D A;  3AU7 A;  2F3W A;  4BA1 I;  3MTS A;  1LTB D;  2KQ3 A;  3VYU A;  3A8K E;  1SNC A;  4FF4 A;  4RFB A;  5ELE A;  2B63 B;  1F9Q A;  3K5O A;  4CKB A;  4FYD A;  4EGV A;  1UNS A;  4K6D A;  4WJW A;  4NW2 A;  1DOK A;  3VR3 A;  1HXY D;  1IW7 D;  1NR4 A;  1QWY A;  2KCC A;  3PO3 B;  1RD9 D;  1F77 A;  4OO1 H;  2B2W A;  1B2T A;  2XRS D;  1EZ6 A;  1STB A;  4X3U A;  1WTR A;  3VA5 A;  3M7N A;  1BOS A;  5BN3 A;  1MI2 A;  2JSO A;  5J39 A;  5IGD A;  3SR1 A;  3NHH A;  3Q24 A;  1G8Z D;  1EYA A;  1KNA A;  3CRL C;  4CJ0 B;  2FJ2 A;  1ZYR D;  2AUK A;  4L8J A;  2YU9 B;  4A3I B;  2NBF A;  3Q23 A;  1GJX A;  4C3J B;  3J7A V;  2WKD A;  2I46 A;  2F0W A;  4U67 3;  3PUV A;  3QIA A;  2AWN A;  1HRJ A;  3K5N A;  4V0B A;  2PPB C;  2RKS A;  3NWS A;  2YYZ A;  2H1E A;  3R3O A;  4L63 B;  4R8I A;  1PZK D;  3PUW A;  3BYY B;  2IX3 A;  2F0V A;  3MAQ A;  3HOZ B;  1JCK B;  2OT2 A;  3L7Z C;  2K32 A;  2SEB D;  1MBY A;  1I4Q A;  2FMC A;  2PMZ B;  4IUN A;  1RJT A;  4NDX A;  3DEO A;  3KF8 A;  1G2S A;  1H9K A;  1C48 A;  4LAA A;  3PV0 A;  1X32 A;  5JEA J;  3QO2 A;  3PUZ A;  4A3G B;  2WV6 D;  1EU3 A;  1STA A;  3A7A B;  1D5X C;  3HOU B;  1VCI A;  1PFM A;  1I4H A;  4BBS B;  4R8N A;  1B44 D;  1TT2 A;  4XYO A;  2QEJ C;  2Q8I B;  1SFO B;  2WKC A;  4ILW A;  2NN6 H;  3OWF A;  4UAI A;  1U9R A;  3FDT A;  2L12 A;  3VR2 A;  1PMR A;  1Q3L A;  3NK9 A;  3OOC A;  4IAL A;  2XNA C;  2C9O A;  5E4X A;  3HOY B;  4C3I G;  5M5Y B;  5NUC A;  5I9O A;  1F9R A;  1SAP A;  4K8I A;  5JPN C;  5CBE E;  1SBB B;  2RSN A;  4HN7 A;  4HMI A;  1STY A;  1G91 A;  2CW0 C;  1U4R A;  4ABN A;  2ID0 A;  5C3W A;  4EQP A;  1WD1 A;  1M8A A;  3M85 A;  4A3D B;  3LWE A;  2X6L A;  2F0N A;  5C0X I;  3IFT A;  1LT3 D;  4JBW A;  2N88 A;  5C3E B;  5C0X J;  1Y1W B;  4QUC A;  1E2W A;  2CW0 D;  1RDP D;  4K5W A;  1Q1E A;  1HCZ A;  1XX8 A;  1OXX K;  2MGS A;  3QG1 A;  1IHZ A;  2E76 C;  4GZY C;  2D62 A;  4IQZ A;  2ICE C;  1I4R A;  3K6O A;  1RHP A;  2B2W C;  2IW3 A;  1TWH B;  4F88 A;  4RGO S;  2KEE A;  3BVZ A;  3H91 A;  1BO0 A;  3V2T A;  1E0B A;  5COR A;  5DNF A;  4MIU A;  1O7Y A;  2FHT A;  4IUQ A;  1G6Z A;  5CV7 A;  1B9M A;  2WAC A;  3HOV B;  5E3F A;  1LTS D;  4DXG A;  2HCI A;  3TZU A;  3DMU A;  1HFG A;  1WTO A;  2JA8 B;  1ENA A;  5J1Z A;  1SNO A;  4TKO B;  3MFY A;  4N9P A;  4XT3 B;  1OXT A;  4A3K B;  2G9D A;  1EY8 A;  3EQL C;  2AUJ D;  5JOB A;  2QCP X;  2C5C A;  1KDC A;  3T4A C;  4ZKB B;  3KUP A;  1GXD C;  3SK5 A;  4ZUJ A;  3GD7 A;  3GTQ B;  1MGS A;  3S2H B;  5I6Y A;  4B08 A;  3AMU A;  3A54 A;  2F0P A;  1PRT F;  2GA4 B;  1DCZ A;  4ODG A;  2PZU A;  1QNU A;  2J7Z A;  3C2P A;  3BG3 A;  5EKI A;  1JIC A;  2NUC A;  3DM1 A;  1LT5 D;  1KLG D;  3I4N B;  1TWC B;  2QKI C;  3HRZ C;  5E1F A;  1VDZ A;  5CGK A;  1HTL D;  1EY9 A;  5IT9 E;  3OMC A;  4OL7 A;  5M9O A;  4PQX A;  2OXP A;  1J9O A;  1SYG A;  1JC7 A;  1L0X B;  5FLX L;  4N9T A;  4KY6 A;  3H3V C;  1BBX C;  1V43 A;  4WFN 3;  1EY5 A;  5I2X A;  4HED A;  1Q12 A;  2SDF A;  4G4K A;  1WTQ A;  5COY A;  1QNK A;  1B1Z A;  4DA2 A;  5IT9 L;  2BA1 A;  3QB3 A;  4RA8 A;  1OXS C;  1X3Q A;  2MHV A;  4B9W A;  3NQI A;  1LTG D;  5FOB B;  2M00 A;  2M9V A;  1AZP A;  1D1I A;  4IZ8 A;  2CHB D;  2D9U A;  1LTI D;  1K83 B;  4RHS A;  2A6H C;  3J81 E;  1Y8N B;  1ILQ A;  3I70 A;  1HQR D;  1KDA A;  1JOO A;  2B2T A;  2FIN B;  5EPK A;  4K5X A;  1EQV A;  3D6W A;  1W6K A;  3ITP A;  5D3D A;  5C4X B;  1NAP A;  2EZV A;  1HPC A;  3FPU B;  4FXD A;  2MJ8 A;  4C3I B;  2KVM A;  2A6H D;  2XIW A;  3TP5 A;  1ET6 A;  4K2K A;  1JOK A;  4HSV A;  4FVM A;  2LKV A;  4M8A A;  1SJH D;  3NBI A;  3LWU A;  5AFW A;  1RKN A;  1S5B D;  3A8I E;  2B2V A;  4C3H G;  2IPK D;  3L9A X;  1D5M C;  5FO7 B;  1ESR A;  3KK7 A;  2H4O A;  2XRQ D;  5C6A A;  3TP7 A;  2EJM A;  1G29 1;  1Q8I A;  1F2L A;  1U4M A;  1PTO F;  4KJN A;  2KOL A;  5I9P A;  3J80 L;  4FP5 D;  1CZG A;  4KI0 A;  3R2T A;  3DWQ A;  1NCV A;  4RH6 A;  2A69 D;  2L11 A;  1BUV T;  2NVY B;  1PLF A;  4IFD I;  5D14 A;  3DXJ C;  4IUV A;  4FF3 A;  4ZK9 B;  1BR9 A;  4J1M A;  4IFD J;  4EVO A;  1I4G A;  1ET9 A;  5G3L F;  2JA7 B;  3N6R A;  2JEB I;  4UDU C;  2A73 B;  1GUS A;  3CU7 A;  2N55 A;  2EY5 A;  1QIL A;  1G2T A;  1UEA B;  3A8J E;  3ERQ A;  3NTH A;  1EY4 A;  1PRT B;  1F2Z A;  1IW7 C;  3UI2 A;  2Z1C A;  3ERO A;  1ENC A;  2B8F A;  4K14 A;  1GUG A;  2F0S A;  4YIJ A;  4XYQ A;  1BCP F;  3ND9 A;  3RD4 A;  4O42 A;  1S5E D;  3Q0A A;  3D8G A;  4A3J B;  4A3B B;  3Q22 A;  2DY8 A;  1C8C A;  1V1P A;  2SNS A;  5KGU A;  3F2U A;  1ZYR C;  3OMG A;  1CI3 M;  2RDG A;  4LMQ D;  3SHL A;  3FMC A;  2AQ3 B;  1TS3 A;  2O4X A;  4HSP A;  1SND A;  1JR0 D;  4J8Q A;  4DAP A;  2A6E D;  2IL8 A;  2EY6 A;  3W2D A;  5M3F B;  4KY7 A;  5IGF A;  1A2T A;  4Z9C B;  1AZQ A;  5EKL A;  1B4O A;  2E75 C;  2B8G A;  1AP0 A;  3C46 A;  1F9P A;  3S1N B;  3S16 B;  2NYZ D;  1V8Q A;  3ZYY X;  3FEW X;  3GTM B;  4ID6 A;  4G7H C;  4IUP A;  3QWN A;  1TKW B;  2B2T C;  4RGM A;  1BF4 A;  4ZUI A;  2L55 A;  4X3K A;  1D5Z C;  3QJY A;  3M7G A;  2PZT A;  3GTG B;  1BNZ A;  1SE4 A;  2IT1 A;  2F03 A;  4JK1 C;  5JEA G;  3O13 A;  1SJE D;  2NZ1 D;  3NUC A;  1EYC A;  1V1P B;  3SXH A;  2L0C A;  1GUW A;  1TY2 A;  4OIJ A;  3G7L A;  1SE2 A;  4DNR B;  4H0L C;  3KLS X;  1STE A;  5EJW A;  3SE0 A;  2B2V C;  3J7Y W;  1D1K A;  5JVG 3;  1H9S B;  4HR7 B;  4L6T B;  4X3S A;  4FF2 A;  4BY7 B;  2K5D A;  3PMF A;  5A2Q E;  1B3A A;  2E2I B;  1HHV A;  1SEB D;  2R61 A;  3EJI A;  3C1F A;  3SDZ A;  4A3F B;  2PCF B;  4ZKC B;  5C3X A;  3RZO B;  4RAU C;  4RKL A;  5IGB A;  1HFN A;  1HA6 A;  1O7L A;  1FR3 A;  2R93 B;  1R9T B;  4NP5 A;  3MC0 B;  4OHJ A;  2EYP A;  4XIG S;  2QF7 A;  3I91 A;  1TII D;  1U4L A;  1RF2 D;  3VR6 A;  2IJ0 A;  3T56 B;  5HGT A;  2L9H A;  1PRT D;  2I07 B;  2BE5 D;  3TP8 A;  1WTP A;  2A5H A;  5I6W A;  1DJR D;  3X3N A;  5KNC A;  2IX0 A;  1CK1 A;  4FO2 A;  1PTO B;  5C5L A;  5A2Q L;  1DD2 A;  4KN4 C;  4PMW A;  4OGQ C;  1TR5 A;  4Q5V A;  5EBC A;  1EL0 A;  4ULL A;  4C3H B;  1EWH A;  1PTO H;  2F0E A;  2IX1 A;  2KUM A;  3HGB A;  2L5T A;  5C0X G;  2FFK B;  3A7L A;  3Q6S A;  3U9S A;  3K5M A;  4K6L A;  4G7O C;  4U68 A;  2PNR C;  4A3E B;  2LMC B;  1XXG A;  4XQJ A;  1XWE A;  2HUG A;  3RZD B;  3S9W A;  3HOW B;  2OEO A;  2F0L A;  1RCV D;  3NQT A;  5EBD A;  1SXT A;  1I3Q B;  4ZAI A;  3QOL A;  4KD3 A;  1CA6 A;  1TS2 A;  2VUM B;  2KJX A;  1LTT D;  3SEB A;  4C56 C;  5FK9 C;  2DNC A;  3R2I A;  4BY1 B;  1EOT A;  3PO2 B;  5F2D A;  2XSC A;  4E6I A;  2F1M A;  3KLR A;  3MWY W;  1PDQ A;  1FD7 D;  1CZW A;  3OPO A;  4M1U B;  2E2D C;  2XWB B;  3A55 A;  1SYF A;  3CHB D;  1LAB A;  1BCP B;  5BN5 A;  1MSG A;  3V96 A;  1SE3 A;  3E5S A;  3TSS A;  2A74 C;  5LL6 X;  5DM7 3;  4QB4 A;  4QMG A;  2TSS A;  2RVL A;  4DK0 A;  1WD0 A;  1CHP D;  1KAB A;  2F0F A;  2K5Q A;  3VYS A;  4MN3 A;  4KN7 C;  3S14 B;  5JJZ A;  2F4I A;  2EJF C;  3P7J A;  2F3V A;  5ELC A;  3I90 A;  1S5F D;  1T5E A;  5EPJ A;  4DF7 A;  3BYT B;  3JAM E;  1KNE A;  2K7V A;  3K0Y A;  4CJ1 B;  4G7Z C;  1W6J A;  1SYC A;  1YNJ D;  2BDN A;  1UUP A;  1FYC A;  2MP1 A;  2F0U A;  1HA5 A;  2NTS A;  1I50 B;  1R4P B;  2K03 A;  1JWU D;  5LHY 1;  2WIN B;  2JYO A;  3I4M B;  4K2L A;  4WOR A;  4KKU A;  2RDF A;  1SYE A;  2TMP A;  1EY7 A;  2JA6 B;  3JAM L;  5IIF A;  2EJG C;  4XQQ A;  3N52 A;  5ELB A;  3P1H A;  2XN9 C;  3NSW A;  2F0D A;  1IYV A;  3EFX D;  1PTO D;  1L0Y B;  3I72 A;  4C1N I;  5DAU A;  2ZXP A;  2BOS A;  3VYT A;  4OO1 I;  3OHX C;  2RBM A;  3LX0 A;  3G6J B;  2WP8 J;  4CKE A;  3VA7 A;  3OSO A;  3BDC A;  3IFD A;  2D5D A;  1EY0 A;  2A68 D;  4HAE A;  1O80 A;  4RCN A;  2BCO A;  3NPP A;  1A6X A;  5C4Z A;  5JEA H;  1STH A;  2D2C C;  3NWT A;  3T13 A;  4I7Z C;  1TWF B;  5C4H A;  5G3L D;  3DEP A;  2R6G A;  3R8B A;  2HCC A;  1GOZ A;  2NB0 A;  1E2Z A;  2R7Z B;  4RGT A;  3URY A;  3A56 A;  4F7X A;  4BS9 A;  2KA7 A;  5KYL A;  2E74 C;  5K36 G;  2IWH A;  3EVQ A;  1STN A;  3KLS A;  4I65 A;  4EQO A;  5TSS A;  1IL8 A;  5IGC A;  3VR5 A;  1OXU A;  3PIP 3;  1SYD A;  1B50 A;  1BCP D;  2B2U A;  4DAY A;  3HZX A;  1F9S A;  4C1N K;  1DXM A;  2F0G A;  3GTP B;  3K7A B;  4CJ2 C;  3W3A A;  1S5D D;  4RCO A;  2K5W A;  1ZKO A;  3J81 L;  1QG7 A;  2K1B A;  5KIX A;  4WRD A;  3T51 B;  1EIG A;  2MUY A;  2E2J B;  1NR2 A;  4C2M B;  2XWJ B;  4IUT A;  1PFB A;  2O5I C;  1MSH A;  1EEI D;  1TWG B;  3SK6 A;  2F0J A;  3ONA B;  2M2L A;  1LLR D;  4QCL A;  5C5M A;  2EYM A;  3VYR A;  5C0X H;  2OF1 A;  1KDB A;  2A69 C;  3NXW A;  4HCE A;  2EY2 A;  2NN6 I;  3TME A;  1LT4 D;  4H13 C;  1Y1V B;  3WDN A;  3RMH A;  1GHK A;  4A93 B;  4HTH A;  1H9M A;  1Y69 U;  2RSO A;  2BDO A;  4IFD G;  2FMM A;  1WTW A;  2QIL A;  3M4O B;  4RWS C;  1AW7 A;  1WTV A;  2J0T D;  1XTC D;  1I4X A;  2QDB A;  3H94 A;  4NKL A;  2EYL A;  2HDL A;  5IOC A;  5KEE A;  5M3M B;  1EFI D;  3D6C A;  2PW5 A;  3S1Q B;  4O1N A;  3WOE A;  4XT1 B;  1CT1 D;  1HQM C;  2R3Z A;  1CHQ D;  4OIK A;  1I6H B;  4ZRZ A;  5JAV A;  2KHS A;  3K59 A;  4QIW B;  1A15 A;  1NSN S;  4XTC S;  5CV4 A;  5EQ0 A;  2Z8L A;  3MXP A;  4R9W A;  1DON A;  2A6E C;  2F0T A;  4CHT B;  3D4W A;  1RTO A;  4Q0F A;  2AQ1 B;  1BDO A;  1OXV A;  3WOF A;  4XXE A;  5CV8 A;  2K28 A;  3T53 B;  3FKI B;  2JA5 B;  2F0I A;  1QB5 D;  1IKM A;  1AEX A;  4CGY B;  3H09 A;  4CKC A;  1WVL A;  3PUX A;  5T1G A;  1JWM D;  2L4N A;  3NE5 B;  2PW7 A;  3RLF A;  1FNU A;  1LTR D;  5FKA C;  5C44 B;  5CMD A;  2ZT9 C;  4ZLT F;  2EYJ A;  1H9S A;  3BZD B;  4DNT B;  1TWA B;  3DWA A;  3IAY A;  3CKI B;  1ESF A;  2EYF A;  5CR3 A;  2B2U C;  1QCB D;  4CBV A;  1A3U A;  1T5X D;  2EOT A;  2PO4 A;  3NTK A;  5D3I B;  4K5V A;  1VMP A;  3H6M A;  3MHB A;  1LT6 D;  1QE6 A;  3RUZ A;  3NTI A;  1U4P A;  1F2Y A;  5HUR A;  2DNE A;  5CV9 A;  4DFA A;  1SNM A;  1XYI A;  2MPM A;  4QF4 A;  1JOR A;  4K8J A;  2BA0 A;  1FNW A;  4H44 C;  4Y7N B;  5E4W C;  5K36 H;  1Z7T A;  1B53 A;  3BVM A;  3I3C A;  1ILP A;  3GV6 A;  4BWG B;  4BBR B;  1PRT C;  2BE5 C;  3OIQ A;  3S1M B;  1TY0 A;  4TRD A;  3BDO A;  2F0Q A;  1C4Q A;  1DM0 B;  4V19 0;  4J6H A;  2X6G A;  4B9X A;  4PNY A;  1JE4 A;  1O78 A;  2WAQ B;  1ZEQ X;  1Y8P B;  2L1B A;  3BDL A;  3MFG A;  5M5X B;  3M4Y A;  3S15 B;  3FVQ A;  1EWC A;  3I4L A;  3MA2 B;  5JVH 3;  4KV6 A;  1QJO A;  4AYB B;  2WII B;  2JEA I;  1LTA D;  4F8M A;  3TZD A;  1IKL A;  1CQV A;  1CFM A;  5IGG A;  1V1O A;  1GUO A;  1Q1B A;  2EYH A;  1ML0 D;  3S1R B;  2PQE A;  1EQT A;  3BVG A;  5K5P A;  3OIP A;  5ISR A;  5A35 A;  2NVX B;  5CBA E;  3E6Z X;  1PYW D;  1EU4 A;  1K8O A;  1H9R A;  1HUM A;  2Z4I A;  1KAA A;  2F0H A;  1KLU D;  4KKT A;  2O5J C;  3GTL B;  1Y8O B;  5FO8 B;  1CTM A;  2EDG A;  3TN2 A;  2SNM A;  5KND A;  1YNN C;  4IFD H;  2ZXO A;  2E2H B;  1EEF D;  1JOQ A;  5EKK A;  2RA4 A;  3SK4 A;  3TP6 A;  5M5W B;  2B2Y A;  1ONL A;  3S2D B;  3S17 B;  2Y0S B;  1BQQ T;  1FGB D;  5T1I A;  4PMC A;  5DEH A;  4KMU C;  2ENB A;  3D31 A;  2O2L D;  2EY1 A;  1VMC A;  2ICI A;  5I2Y A;  2LS0 1;  2WB1 B;  1Z6H A;  3OWE B;  1RTN A;  1DYQ A;  1YNN D;  2NTT A;  1SSO A;  2EYO A;  3FRP B;  3K58 A;  5IGE A;  4KKS A;  3HEJ A;  2F0M A;  4FXG C;  2AQ2 B;  4KY5 A;  1HUN A;  4RGN A;  1YNJ C;  2HQE A;  3DWP A;  2PYK A;  2RQX A;  1AFP A;  3SVM A;  3GTK B;  3J7A F;  4EQN A;  4HCS A;  4P2C B;  3U9O A;  4PMB A;  3D4R A;  2ZXR A;  4PV1 C;  1O7Z A;  4KJO A;  2VNU D;  3MXU A;  3I73 A;  3SK8 A;  5CC4 A;  4DAV A;  1VF7 A;  5FO9 B;  4IN3 A;  5EPL A;  1IYU A;  1PTO C;  3OW7 A;  1TS4 A;  3P75 A;  3DHQ A;  3I8Z A;  3NP8 A;  1EY6 A;  4DN4 M;  2JE6 I;  1GUT A;  3GTJ B;  1PFN A;  1H9J A;  2VXW A;  1TU2 B;  3LNN A;  2A68 C;  4IUR A;  2EE1 A;  1ROD A;  2LY7 A;  4XQN A;  2VB2 X;  5KYI A;  5ELD A;  3PUY A;  3MXN A;  1R4Q B;  2SOB A;  4IUU A;  4G57 A;  5JPM C;  3K5L A;  4OO1 G;  3GV3 A;  1EIH A;  2F0O A;  5ELF A;  1PXU A;  1J8I A;  5FLX E;  2K04 A;  1CA5 A;  3QOJ A;  4DU9 A;  3GO5 A;  2XVS A;  5KNB A;  3KBG A;  2RDH A;  1X3P A;  4H7B A;  5C4J B;  2CVR A;  1LAC A;  3R93 A;  4ZYS A;  1SNQ A;  1M4V A;  4ME5 A;  4TSS A;  4RKB A;  3MZ5 A;  2JXM B;  3MEH A;  1BCP C;  4A3M B;  2NVT B;  4QUF A;  3GQB A;  1D2B A;  1S4Z A;  1A3V A;  4KTA A;  4C3J G;  5IOD A;  1EZ8 A;  3M3Y B;  3T16 A;  3ND8 A;  4DXF A;  3CQZ B;  1DOL A;  3P20 A;  1WCM B;  2NWG A;  2V4D A;  3AB9 A;  2K6A A;  3C1E A;  5CV5 A;  1SMY C;  2NVQ B;  1FNV A;  2EPB A;  3PIO 3;  1B9N A;  4DGZ A;  4X3T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...