1J9OA

Solution structure of human lymphotactin
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
93
structure length
93
Chain Sequence
VGSEVSDKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCADPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytokine
molecule keywords LYMPHOTACTIN
publication title Monomeric solution structure of the prototypical 'C' chemokine lymphotactin.
pubmed doi rcsb
source organism Homo sapiens
total genus 12
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2001-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1j9oA00
1HFGA 5AFWA 1PLFA 1MSHA 4X3KA 5JJZA 1HA6A 1RHPA 2NWGA 1WTRA 2FMMA 4IUUA 5EQ0A 1WTWA 2B2TA 2KVMA 1SSOA 1E0BA 4DN4M 1U4RA 3P7JA 1WD1A 4IUVA 2B2WA 1HUMA 1ICWA 2L9HA 4QUFA 1MI2A 5CBAE 1ILPA 1WVLA 1DOLA 1PDQA 1A15A 2EE1A 2XIWA 1B3AA 1DOMA 1CM9A 1X32A 2D9UA 3IL8A 2J7ZA 3QO2A 5CORA 1WD0A 1B53A 1VMPA 2K01A 1MSGA 2KEEA 1NAPA 1QNKA 1AP0A 2DY8A 2N88A 3FDTA 3F2UA 3I90A 5DNFA 4CJ2C 1BF4A 1PFMA 1BO0A 1ESRA 4X3SA 5COYA 1CA6A 2RSNA 4RA8A 4X3TA 3D6WA 1G2TA 4IUQA 2L12A 4OIKA 4RWSC 5EPJA 1EQTA 4ZKBB 1ILQA 1WTOA 1QG7A 1S4ZA 4CJ0B 1U4MA 1J8IA 1QE6A 1O7ZA 1MGSA 1WTVA 1DONA 4X3UA 2SDFA 1LV9A 2JYOA 4O42A 5E4XA 5CBEE 1HRJA 1BNZA 5EKIA 2Q8RE 2K28A 2FFKB 1NR4A 1F9PA 4IURA 1IL8A 1EOTA 1HFNA 1DOKA 1EIGA 1IKMA 2K03A 1U4LA 2KECA 4LMQD 2FHTA 1XYIA 1O7YA 2HCIA 1B2TA 2N55A 1G6ZA 1NCVA 5CMDA 1J9OA 4XT1B 2MGSA 4IUTA 1X3QA 1SAPA 4XT3B 1VMCA 4MN3A 1RODA 1F2LA 3G7LA 4ZAIA 3N52A 1F9SA 3GV3A 2K05A 4HCSA 2HDLA 1EL0A 1F9RA 1SDFA 2EOTA 3ONAB 3DEOA 4NW2A 1F9QA 3TN2A 4R8IA 2HUGA 2IL8A 1DZ1A 5EPKA 2B2VC 1GUWA 2X6LA 2FJ2A 2NYZD 3Q6SA 3MTSA 2B2TC 3DM1A 2H1EA 1RJTA 1NR2A 2B2YC 2HDMA 3H91A 2MP1A 3KBXA 1JE4A 5D65A 4CJ1B 4IUPA 2RSOA 2RVLA 1M8AA 1G2SA 4RAUC 1AZPA 1KNEA 3UI2A 4U68A 2L1BA 1AZQA 3SVMA 1B50A 1Q3LA 2KOLA 5E4WC 2RA4A 3I91A 3I3CA 2M2LA 2JP1A 1PFNA 2FINB 5D14A 2EPBA 4XDXA 2B2VA 2VXWA 2K1BA 4MHEA 1WTXA 2L4NA 2B2UC 4R9WA 5T1IA 2HCCA 4HSVA 2Q8TA 2B2YA 4QUCA 1HHVA 1WTQA 2BDNA 2CVRA 1ML0D 3DEPA 3HP3A 3R93A 5T1GA 1G91A 5EJWA 2DY7A 4UAIA 2X6GA 1HUNA 2KUMA 2MPMA 3LWEA 4ZLTF 2R3ZA 4HEDA 2NZ1D 1IKLA 3FPUB 4ZK9B 1KNAA 1RTOA 1BBXC 3GV6A 1JICA 1XX8A 3TZDA 4ZKCB 1O80A 1ZXTA 1X3PA 2X69A 2B2WC 1TVXA 3IFDA 3MWYW 4OIJA 2MJ8A 1C8CA 1EIHA 3I8ZA 5EPLA 1WTPA 1CA5A 2KEDA 2L11A 1B4OA 1PFBA 2K04A 1RTNA 4HAEA 1U4PA 2B2UA 3KUPA
chains in the Genus database with same CATH superfamily
4IO9A 1Q86C 4PG3A 4YHHQ 1HA6A 5ELBA 1DJRD 5E7NA 4YWMA 4J1MA 1KD1C 2DJFC 1JOKA 5CR3A 4X66Q 1PXUA 3Q8DA 1EEID 3BYYB 2EJFC 1ENFA 2F0HA 2OTJA 1IYUA 1EFID 4R1JA 1KXLA 2DY8A 1BF4A 3CC4A 1XTCD 2VUMH 3I55A 2C9OA 3NE5B 1GXDC 3PGZA 3CRLC 2HHHL 1LTID 4JI8L 3STBC 5C0XJ 5C4HA 2L12A 3I72A 1KRTA 1Y1VG 2KHJA 4JI6Q 1QE6A 2GA4B 3NK9A 5E4XA 4DF7A 5JVH3 4RGMA 2G9HD 3NBIA 2SEBD 4HJ7A 4ZUIA 3J7AV 1EYAA 3M3YB 3VA7A 1HFNA 2TSSA 4ULLA 5IWAQ 1GHJA 4LMQD 4RGTA 4YWKA 4BS9A 4DAPA 4MTKA 3HOUG 3D6CA 1TWHB 1PZKD 4MN3A 4ZAIA 1B44D 4DGZA 2EYLA 1SNCA 1CHQD 2QEJC 1NMFA 4BY1B 4YCWA 2ZJPA 3BJUA 3S14B 4DR2Q 3BZCA 2WB1G 1XNQL 1EWHA 2H1EA 2A69C 2MHVA 4P72A 2K50A 2XRSD 4CJ1B 3SEBA 1GUTA 1F2ZA 2XWJB 2PNHA 1AE2A 3A56A 4A4IA 4JC0A 4HN7A 3NHHA 3MXPA 2CKZB 4DR3L 1VQKA 4DV6L 2E8GA 2NVTB 3TP7A 4GKKL 1VQPA 2I0QA 4WJWA 2KUMA 1L1OA 1QNUA 1SNPA 1HNXQ 5GADC 1K83H 2CCZA 5C0XG 2PMZE 1EIHA 1OXUA 1U9RA 2SOBA 2EY1A 4LF7L 3HGBA 2YU9H 4K8IA 1SNMA 4J8QA 3KJOA 2F0DA 1PRTD 1Y1VB 4Z9CB 4JOIA 3TEHB 1HJPA 4UY8C 2BDOA 2F0FA 2RDHA 2NB0A 1S5FD 3MC0B 2VS1A 1GUSA 5TSSA 1MSGA 4F87A 2JA7G 1UUPA 1CQVA 4DUYQ 3HOUB 2K14A 3JAMc 4BWGB 5IGCA 5COYA 4ABNA 2JA7H 2JJQA 4XXEA 1Q82C 4IUQA 3P1HA 4XYQA 2PW7A 4TQUS 5GROA 4DNTB 1BBWA 3RNUA 4LF8Q 1PH2A 2WB1B 3IAYA 2K5HA 3RLFA 1MKHA 1IKMA 2V4DA 2WKCA 3JC66 2Z4IA 4M1UB 2AUKA 1RCVD 3PO3G 4IUTA 3TSSA 1SFOH 3PO3H 1D5ZC 2K05A 4DKAC 1EL0A 1HTPA 3AFPA 2F3IA 3DEOA 2EYJA 3S1NH 5IP7G 2KA7A 1SEBD 1K83B 2IL8A 4YCVA 2B2VC 1RJTA 1SE4A 1STYA 1TS2A 1PH1A 3IRBA 3K80C 1E24A 1CKNA 3VYSA 2F0VA 2YU9B 4GKJQ 4YY3L 5BN4A 5E4WC 1X55A 3HOWH 4TKOB 1P8LA 2EPBA 3D3RA 4KY5A 1BCPB 4IJHA 2H4OA 4QUCA 2ZJQA 2PZWA 4RHRA 3KJPA 5EJWA 5GAEC 3M4OH 2NZ1D 4RCOA 2JQOA 3AU7A 4OXPA 4F7XA 2X69A 3NWTA 1JWSD 3P20A 1KLGD 3URYA 1ONLA 2JA7B 4DK0A 4GNXC 2KHSA 3E9HA 5M3MG 3W3AA 3G48A 4ME5A 5C4JH 4GOPA 4WJ4A 5M3MH 3DLLA 2OT2A 3U4ZA 5I2YA 3MFGA 5KRUA 1EQVA 3E9IA 5M3FH 1K73C 4JI5L 1KDAA 1WFQA 1QVCA 4EX5A 4NXML 2Z8LA 3GQBA 2RHSB 3UE0A 3PO3B 3G4SA 3UDFA 1PFMA 4JI0Q 2K5DA 1JR0D 3KF6B 1NJIC 2CW0D 2OXPA 3SHLA 3S1NB 3LGJA 1H9SB 5G3LF 4RWSC 3D4WA 1UE6A 1AH9A 1U4MA 4LF5L 1HCZA 2F52A 3T53B 4B08A 3BDLA 3STBD 3TP5A 1YNJC 4DV4Q 2G9DA 1C9OA 2NUCA 3JAME 2SNSA 4LF6L 4AQYL 1B9NA 1I94Q 5IGBA 4X64Q 4PZ6A 1XMQL 1PZID 2PQEA 1JE5A 3ONAB 1VQ9A 2L5TA 3M4OB 1I6VC 4V190 4Y7NH 3LX0A 2F0EA 1PYSB 5FOBB 1EIYB 1LTTD 2EDGA 5EBDA 1G2SA 3TS0A 5C4JB 4X65Q 3PV0A 4HJ8A 2IPKD 1LO5D 5M3MB 2XVSA 1Y69U 2B8GA 5HY6A 1FNWA 3WOEA 2HCCA 3R93A 2K6AA 1YNNC 1UAPA 2ZXRA 4ZLTF 1K0SA 2R3ZA 3NUCA 1TWAB 3RN2A 2KCNA 5FLXL 1N33L 2AWNA 3BZDB 2QILA 5LMNW 1CA5A 1F77A 1B1ZA 4KJOA 5JVG3 3T1HQ 4DAVA 5KNBA 2AWOA 2L0CA 2NWGA 4KHVA 2A6EC 4OL7A 1HH2P 4L5TA 3PO2G 2WB1E 1VF7A 3QJYA 1YJWA 1EY6A 3DUZA 3FMCA 2BOSA 1MI2A 3CC7A 3SK5A 1C48A 2Q8TA 1WD0A 5HGQA 4DV3L 3MFYA 3E6ZX 4BA1I 1TR5A 4K14A 1ICFB 4M8AA 1QB5D 4R4OA 4KKSA 4JI4L 2F0OA 2WV6D 1VQFA 4X3TA 1G2TA 4QMGA 5M5YB 3SDZA 1WTOA 4LJZC 1CHPD 1KQSA 5JJLA 2XGTA 1EYDA 2Z4HA 4O42A 5LL6S 4JV5Q 1NUCA 3CF5A 4AYBG 2NVXH 1CSQA 1HNZL 4DV7Q 3CD6A 3E3XA 2N8NA 3H15A 1Q81C 4DR6L 4GZYC 2FHTA 1B2TA 2EIFA 1G6ZA 4RFBA 4UHVA 1HNWQ 1P16A 1X3QA 2KCTA 3HKSA 2VQEQ 4DR5Q 3VYRA 1WJJA 3R2IA 5F2DA 4OWTB 4NB3A 4R8NA 3K0XA 4RH6A 3BS1A 3HOZG 3HZXA 2LY7A 1BCPF 2HUGA 4LF4Q 2Q8IB 3L7ZC 1EY4A 2IJ0A 1V8QA 1GUWA 1CKMA 1PFSA 3NTIA 4JI1L 3S16H 3BVGA 1XJVA 4BXXG 3K59A 3R3OA 3GTPB 2PI2E 2AHOB 3K58A 3A8KE 3GTMH 3R2TA 1I50H 4A3CG 2M00A 2KOLA 1Q7YC 3T16A 3ICEA 4BY7G 3KDFB 2MQHA 1KAWA 2LMCB 3TP8A 4A3CH 3BDCA 4LAAA 4N8X1 5T1IA 3KLSX 4BY7H 2DJGC 3FRPB 3PO2B 2ASBA 3I4LA 1V1PA 3UDIA 2RCFA 2MPMA 4G7HC 1TWGH 3QB3A 3U9SA 5M5WH 3CAMA 3LWUA 4JOIC 1Z7TA 1Q1BA 4LFAQ 1FNUA 4ZKCB 4JI3L 3VR3A 1SNQA 4XDXA 3OMCA 5K36G 2F0LA 3K5MA 5EPLA 4LNQA 1B4OA 2DGYA 4KKTA 2K04A 1CQFA 1K8GA 3P75A 4FDBA 1AN8A 4JI2Q 1I6HH 2ZXOA 1WTRA 2NZOA 4FXKC 2PW5A 1QVFA 1VQEA 1LLRD 1H95A 1I4RA 1PH5A 4H7BA 3VR2A 2L9HA 1ICWA 1UE7A 4C2MH 3DM3A 1UE5A 3G71A 1TWCH 4IQZA 1A0IA 3FVQA 4UP9A 3JAMi 4BBSG 3F2UA 5K5PA 3CCQA 1F2YA 1M4VA 2EXDA 2ID0A 1LTBD 5C5MA 3M4QA 4BBSH 1IBKQ 2A19A 2F0IA 1EZ6A 2Z9HA 4FO2A 3HOZB 3J7A5 1S40A 5KYLA 4A3MG 1J8IA 1WTVA 3S16B 1PYWD 3CW2C 3PIO3 1SE8A 1IBLQ 5FKAC 4KKUA 4A3MH 3OWEB 1VQOA 4DA2A 4DV2Q 2F03A 1LT5D 4EQ5A 2UUBL 1O7YA 4JBJA 5FO8B 3MA2B 3D8GA 4HIKA 4A3KG 4DAYB 1C4QA 3G7LA 4XIGS 4CKBA 5IOCA 1KC8C 4BY7B 2IX0A 4LF9Q 2HDLA 2Z1CA 4A3KH 1TWGB 2EVBA 3W2DA 2TMPA 3TN2A 3L9AX 3F2BA 4A75A 1OTCA 1WI5A 2WAQG 1Y14B 3NQIA 1SMYC 4GLVB 4QIWB 2EJGC 3GTJH 4K5WA 1HR0Q 1Z47A 3OW2A 3GTLH 3I56A 2RVLA 4PNYA 2KHIA 2HQLA 3MEFA 3CMEA 5EKKA 1Y8NB 5J39A 1HPCA 2WIIB 1OXSC 5FLMG 2M2LA 4YHHL 2IWHA 2N78A 4O1NA 1NNXA 1R4PB 2IW3A 1QZGA 2UUCL 1ZEQX 4C2MB 3G6JB 4LWCA 3H09A 4JBWA 4NKLA 4B3SQ 1H9JA 3LWEA 5ELFA 3S15B 1TWCB 1W6JA 4KY6A 2E76C 4N9TA 1ESFA 4KN7C 3TZDA 4L8JA 3A5UA 2K5QA 2BE5C 4QF4A 2KEDA 4BBSB 5M9OA 5IYDG 2K32A 5C3EG 4A3DG 3AB9A 1LTLA 4B3TL 1EOVA 1MSHA 4A3EH 1RHPA 5IYDH 5C3EH 1AE3A 4A3DH 3B6YA 5EQ0A 1A2UA 3DWQA 4V0BA 5GAHC 4A3MB 2OTLA 1FL0A 1U4RA 3X3MA 3RN5A 1Y1WG 1X32A 1YIJA 4S3SA 1ET6A 3F2CA 5EAYA 1H9RA 1JB7A 2NVYH 1CFMA 1X3FA 4Q5VA 1Y1WH 1L0XB 3NQTA 2AMCB 1JWMD 3OIQA 4A3KB 2F4VQ 2CWPA 4FVMA 2D5DA 1E2ZA 4X3SA 2ZTEA 2F0GA 5C3WA 2O5IC 2UXCQ 3E0JA 3QIAA 4ZKBB 1IW7C 3ND8A 1A3TA 1GVPA 1DONA 4G4KA 1LV9A 4DV5L 3GTJB 4J6HA 1D5XC 3GTLB 4A93G 2WAQB 2O5JC 3CKIB 5JOBA 1U5KA 4A93H 3S2DB 1GJXA 1MJCA 2VUMG 3GO5A 2HCIA 4DV1Q 2JN4A 3PUWA 3TREA 4XT1B 1MBYA 1I4QA 2DN8A 4KN4C 4EGVA 3L2PA 2VW9A 2R61A 1BKBA 2EOTA 1Q8IA 1Q8KA 3F8TA 1IHZA 2P5ZX 1NBWA 2X6LA 2A6HD 4HTHA 4CDFC 1TS4A 3ERQA 1QUQB 4ILWA 4RKBA 1GOZA 5C44H 1PV4A 4WFN3 1UEAB 2QA4A 1M8AA 1N9WA 2CQOA 4EVOA 5C3EB 4HCEA 4A3DB 3CC2A 5FLXE 4YWLA 5FO9B 4K0KQ 3I3CA 1HTLD 1TIID 2V1CC 3F1ZA 4JK1C 4L5QA 1ASYA 4OX9Q 2YTXA 1EY8A 1NY4A 3G6EA 3D4DA 4AYBE 1D6EC 5CV5A 1HZBA 2NVYB 1TY2A 5KIXA 1Y1WB 4ZK9B 3KF8A 1RTOA 2UXBQ 1RKNA 1VS0A 1X6OA 1WYDA 1FVIA 2EY2A 3HRZC 4PV1C 1JJ2A 1C0AA 4LFCL 1BDOA 4GN4B 5DM63 4EQNA 3CCVA 1II3A 1SJHD 2IX3A 1MHWC 2B2WA 2RHQB 4A93B 4LF8L 1Z6HA 1WVLA 1A15A 3S9WA 2D9UA 3AFQA 1GUOA 5KNDA 3S1QH 2VUMB 1R4QB 3NELA 3A7AB 3A5ZB 2HHHQ 3J80E 5EKLA 4JI8Q 2PYKA 2NVQH 3RMHA 4JBKA 2EYOA 4OONA 5EPJA 1EQTA 1ILQA 1PTOF 4C3HG 5I2XA 1KDCA 5LHY1 3F2DA 5CBEE 3FKIH 4QIWE 5KYIA 1E1TA 2Q8RE 5C44B 4C3HH 1SYDA 1D1IA 4C3JG 1KDBA 4HJ9A 1R9TH 5I4DA 1I5FA 4C3JH 3H0GG 4GKJL 2PI2A 4A3FH 2KENA 5CV4A 3H0GH 1RDPD 4HCSA 1V1OA 3NEMA 2EXZA 1PTOC 1EY7A 1RD9D 4KHZA 4B3MQ 2R7DA 1JOOA 4DR1L 1XNQQ 2A73B 2PCFB 1X54A 1LT3D 1NR2A 2HDMA 3ULJA 4UDUC 5JJKA 3MEHA 4A3IG 2UUAL 3J81L 4A3IH 2ES2A 2PZUA 3A0JA 1J5EQ 1W6KA 1STNA 1K28A 3KF6A 4DV6Q 1B7YB 2JP1A 4AH6A 4KMUC 2ALYB 5D14A 2MFIA 4DK3C 4GKKQ 1D8LA 1H9SA 3VDYA 1EYGA 3BDOA 3NTHA 1YZ6A 5IGDA 3TP6A 1G91A 2BCOA 4L5RC 5BR8Q 1HUNA 2RBMA 3S1QB 1IKLA 1ZYRC 3DXJC 3FPUB 4P74A 5CV9A 2JA6G 2K52A 3GV6A 5ELOA 5GAGC 1YJNA 5CYUA 1QZHA 4KD3A 3HOWG 4LF7Q 2JA6H 3QOJA 3OPOA 4JI0L 1E7ZA 2QW7A 1WTHA 2BE5D 3GTGH 1HZAA 1SYFA 1G8ZD 1VQCA 2FMMA 2D62A 4ZRZA 4HMJA 4C3HB 1WTWA 1STBA 1VDZA 2WAQE 1BBUA 1KRSA 1L0WA 3EN2A 2VB2X 3K5OA 5CBAE 5FJ8H 4UPAA 4C3JB 1VQMA 1O7IA 4OO1I 4HMIA 2LSSA 3KFUA 4QGUA 1FD7D 2KEEA 1XMOL 3H0GB 1A3UA 2N88A 3L0OA 2UXDQ 3EFXD 3S24A 3WOFA 3NTKA 1SNOA 2F0KA 1I94L 4G57A 2NTTA 4P73A 4J15A 2K4KA 1W2BA 1SJED 1EY0A 5M3FG 1HXYD 3CCLA 2MO1A 4ODGA 4Q0FA 1XNRL 2KJXA 3PQIA 1IW7D 1EIGA 3CCMA 5LMUL 4A3IB 5L37A 1SFOB 4FXDA 1PH7A 1VQJA 3I4OA 4EQOA 2EZVA 4X65L 3H3VH 3MXNB 4TSSA 4YCUA 3V96A 4FF4A 5KEEA 3RR5A 3SE0A 1VQDA 3CU7A 2I07B 5EPKA 3MTSA 3CCJA 1PRTB 2JA6B 3FHWA 3K7AH 4YY3Q 5DM73 1TWFH 3HOWB 1GKHA 2QDLA 3GTGB 1HQMC 2BH2A 1Q3LA 4K6DA 2FINB 4H02A 1EFWA 3PUZA 2L4NA 4HIMA 3I70A 2C5CA 2YTYA 4LFBL 4IOAA 2CVRA 1XPUA 3T56B 1PVOA 1N36Q 3HOYG 4IPHA 1YHBA 1BBXC 4B3RL 3I2ZA 3T13A 1JB3A 3QG1A 1X3PA 3KLWA 4POGA 1I4PA 3HOYH 3CPWA 5I9OA 1PFBA 4LUVA 2B2UA 3KUPA 2A69D 1BR9A 4DXGA 4X62L 3J80i 1HA5A 3A55A 3RD4A 4DNRB 5GQOA 3E5SA 1N34Q 2PO4A 5M3FB 4IUVA 1HUMA 4HSPA 4LUZA 1NE3A 3TS2A 3PIPA 3TRZA 4JV5L 1IZ6A 1CM9A 4NXMQ 1DXMA 3OTOQ 1K3BC 1VMPA 3NENA 2BA0A 2NZHA 3S2HH 3GP7A 1ASZA 2OWOA 4HR7B 4DR7Q 2JA8G 4MTNA 1I4HA 5IT9L 4DR5L 2RSNA 3AEVA 2JA8H 3KDFA 4OELB 4LF5Q 4OO1G 1K8OA 3NWSA 2I5LX 2Y0SB 3OSOA 4KTAA 2ENBA 5ELDA 1FJGQ 4ZQ3A 3EA6A 2ICEC 4OO1H 2JYOA 3EJIA 2ICIA 3J81c 3MAQA 5CC4A 5DEHA 1T5XD 1D1KA 2WACA 1F9PA 4KHPL 1EWIA 1TS5A 1X56A 3RUZA 1PH3A 4LF6Q 5IYCH 2K03A 4AQYQ 2MUYA 4A3LH 1NCVA 5IP9G 4NXNQ 4XT3B 4RHSA 2DNCA 5IODA 1XMQQ 1PH4A 1L0YB 1ET9A 2KQ3A 2A68C 4QB4A 5IP9H 1A6XA 4LK1C 4KD4A 1FGBD 2EYHA 4Y7NB 5I6YA 1X9NA 4NW2A 4K8JA 2XTIA 3UDGA 4RGOS 3OW7A 3T1YL 4MNOA 2HD3A 3HOYB 2PNRC 1X65A 1I4GA 1UE1A 3H91A 1GO3E 1JE4A 3J80L 4WJ3M 1GD7A 4FF1A 1VQBA 3UI2A 4U68A 1DGSA 2UU9L 4NP5A 2GN5A 4K5XA 4JI2L 1Q46A 3A74A 4JCVE 4MHEA 1WTXA 1IYVA 3GTOH 3TZUA 1GUGA 4JG2A 2R92H 4CHTB 1GUNA 4CDCC 1TKWB 3CRKC 1XX8A 2B2WC 1TVXA 1EZ8A 1SE2A 1TQOA 3BZKA 1EU3A 2Q2IA 4IALA 4R4TA 2JA8B 3SK8A 4DAYA 1JC7A 4X3KA 1OXVA 2VQFL 1CZGA 5A2QL 1BOSA 2KVMA 2YTVA 3ZYYX 1KHIA 3FEWX 3CPFA 4QUFA 1BCPC 1W3SA 1DOLA 2Q2HA 2M9VA 1JMCA 3W5OA 4DUZQ 5JPMC 1STEA 2EY6A 1FNVA 3MXUA 3NBHA 2R7ZG 2R93G 3PMFA 2XSCA 2JA9A 1A63A 4MIUA 3PF5A 4RA8A 2R7ZH 2R93H 1SROA 1X3EA 4DV0L 4JI7Q 2HT1A 4U673 4LF9L 1EQQA 2KBNA 2F0QA 5FO7B 2OF1A 1VQ6A 4TRDA 4XQQA 4N8FA 3CQZH 1O7ZA 4X3UA 2NVXB 2AQ3B 3DWAA 1UEBA 1HNZQ 1YITA 3HS0C 2FFKB 3H6MA 3HFZB 1VQHA 4IURA 1VQ8A 3HOVG 3ULPA 1EOTA 4PMCA 4DR6Q 3HEJA 1EWCA 4IUNA 3BU2A 1PRTF 2QF7A 3HOVH 1N32L 3V2TA 1SAPA 1VMCA 3OMGA 2VNUD 1JQYD 2IX1A 2ZM6Q 1CI3M 1IL2A 1EYCA 1SDFA 3CP0A 2YYZA 3U9OA 2E5LQ 3J81E 2B29A 3IFTA 3NPPA 3X3NA 3K0YA 4DU9A 1DZ1A 2FJ2A 1SXTA 3PUYA 2B2TC 1IBML 4B3SL 1RIPA 2Z6KC 3E0EA 4QCLA 2HQEA 3I7FA 5JAVA 3T51B 3GTMB 4DNIA 4GN5A 2BA1A 1I50B 1AZPA 3NSWA 4LUOA 1B50A 5IGEA 3I91A 1YNJD 3GD7A 5JEAJ 3U58A 1PH6A 1PFNA 1LACA 5NUCA 1YHQA 4JYAL 5FLXc 5C3XA 1I3QH 4R9WA 4HSVA 2E74C 4RKLA 5M5WB 1PZJD 4UAIA 5IT9c 5H1SE 3J81j 4JI3Q 2CWAA 5AJ3Q 3OOCA 5G3LD 4HJAA 4OIJA 1Q1EA 2VL6A 2B63G 1H9KA 3Q23A 2K75A 3EROA 3PCOB 1DYQA 2R93B 4HAEA 2R7ZB 1I6HB 1DD2A 3SK6A 1HFGA 2B63H 2F4VL 2OQKA 3CQZB 2UXCL 3J7ZC 1M90C 1V1PB 3QOLA 3P7JA 1STAA 1WD1A 2QKIC 4X66L 3HOVB 1QUQA 1D5MC 3IL8A 3VYUA 5CORA 2I5MX 3D0FA 1YNND 2O2LD 1YI2A 3TDQA 1VCIA 2F0TA 4OHJA 4A3EG 2Z0SA 1SRUA 1EY5A 4PZ7A 4DK1A 3I4MG 3CMAA 1F2MA 4RGNA 3J80c 3K8AA 3I4MH 1YNXA 4JI6L 1YJ9A 1SN8A 3FPPA 2A6ED 2UUBQ 1RF2D 3QWNA 5JEAG 1YEZA 3M85A 5DAUA 3GTQH 2HIVA 3FP9A 1Q12A 5IWAL 1QJOA 5CMDA 4I7ZC 5JEAH 1I3QB 2BH8A 1FR3A 4K0KL 2C35B 4ZCKA 3D31A 4EQPA 5EBCA 2WFWA 4BA2I 5M5XH 4LW1A 1VQIA 2JK8A 4R8IA 1T5EA 3J7YW 1QOHA 4BY1H 4DR2L 3S14H 4GNXB 1J6QA 2I5HA 2UXBL 2KCCA 1SNDA 2F0NA 2K5VA 4IUPA 3LNNA 2B63B 1PHJA 5LMNQ 2G5DA 4L5SA 4O2DA 1PH9A 4FF2A 5IGGA 3CHBD 3M7NA 2F0UA 1PA6A 2UUCQ 4NMZA 2CH4W 2B2UC 2D0PA 2O4XA 2PPBC 3U4VA 3DEPA 1CUKA 2NVTH 1D2BA 2JEBI 2X6GA 1HZCA 1H9MA 3KLRA 4A76A 5C44G 4F88A 1A2TA 4C1NI 3I4NG 1LTSD 2CW0C 1O80A 1HNXL 3HKZG 4B3TQ 4A3EB 1RTNA 3I4NH 4OIKA 2WKDA 3K81C 4G7OC 3I4MB 2A74C 1BVSA 2FMCA 2F0MA 2E2JH 1CK1A 3ULLA 2MNAA 4JVZA 5IT9E 4IPGA 4DR4Q 1Y1VH 2B39A 3GTQB 1MD2D 4KJNA 2JXMB 2IHEA 2XIWA 1A8VA 1B3AA 5J22A 2J7ZA 3SGIA 4TVAB 3PF4A 1S5CD 1B53A 1UWVA 2K01A 1ZKOA 1IYJB 1BCPD 2K33A 2OEOA 5DNFA 4OGQC 4DUYL 5I6WA 5M5XB 3AYHB 4IPCA 1QWYA 2PQAB 4QJFA 2AUJD 3HOUH 2F0PA 5IE8A 2XWBB 2Z6BA 1SYEA 4KI0A 3V05A 1QG7A 4DV5Q 2D0OA 3GTKH 5ELCA 2SDFA 3J81i 4B3ML 4JBMA 4UP8A 2XN9C 1TU2B 5EGTA 4A3BG 5JJIA 1YHAA 1MJEA 1J9OA 3RZOH 2YV5A 3NP8A 5BN3A 4L6TB 1RODA 4A3BH 4C1NK 1J5EL 4NDXA 1TXYA 3NXWA 5E3FA 3H3VI 1HQRD 3FKIG 1GM5A 5C5LA 1A3VA 2GVAA 2IY5B 1V9PA 5D3DA 5BR8L 2L15A 4IPDA 1EU4A 1AEXA 2E75C 3VR6A 3I4NB 2DUDA 4A3FG 2ZTCA 1EY9A 2CHBD 1KNEA 3HKZB 1VF5C 4NPSA 4CBVA 5C0XH 2E2JB 1VQAA 2QEXA 2QGQA 4FXGC 4ME3A 4XQJA 4CDDC 1B8AA 2E2HH 3PUXA 2B8FA 1V1QA 1C7YA 2B2YA 2BDNA 1ML0D 5T1GA 1KLUD 1NTGA 4WRDA 1S72A 5A2QE 5IGFA 1CKOA 3BVMA 2GVBA 4DXFA 2JSOA 2XRQD 1XWEA 3MXGA 3MWYW 1E3PA 3QR8A 3UDXA 4FYDA 1WTPA 2CQAA 5ELEA 2Q2TA 1CTMA 1BQQT 4ALPA 4LFCQ 1SMYD 4OWXB 1G6PA 5AFWA 1PLFA 1LTRD 3MXNA 4HIOA 4DR3Q 2UXDL 3GTKB 2OCEA 2J0TD 4B9WA 2LFNA 1EEFD 3VR5A 5C4XG 2B2TA 4IN3A 1PH8A 4P71A 2Z6KA 3N6RA 1BUVT 4DN4M 1HZ9A 5C4XH 1SYGA 2EYPA 3KF8B 1YVCA 1EUJA 4KK7A 4B9XA 1Y8PB 3RZOB 2HIXA 3OYYA 4A3BB 2JE6I 3CCEA 1QNKA 1LT6D 2EJMA 2NBFA 4DAMA 2NVQB 4BBRG 3VYTA 3ZJYC 3EQLC 4APVA 1QVGA 4BBRH 2A5HA 4RG1A 4GS3A 1S4ZA 3FKIB 1SE3A 1JJCB 5FJ8G 4K2KA 1BNZA 5EKIA 1R9TB 5IP7H 2EQSA 1VQ5A 1L1OB 1NR4A 1BXTA 1LT4D 1OXXK 3T4AC 1TS3A 3OIPA 4A3FB 1XYIA 1CZWA 1SMXA 2N55A 5HURA 4DV4L 3DWPA 3C2PA 2A8VA 3J7AF 2MGSA 3C46A 4OWWB 2E2HB 4O0AA 3RLOA 3S1RH 4XQNA 3ER0A 2E2DC 4X64L 4DR1Q 1B9MA 4K2LA 4KY7A 1OXTA 3Q6SA 2R6GA 2J4XA 3DM1A 2F0WA 2ZJRA 2AKWB 4CKCA 1N36L 2LXKA 2UUAQ 4QY7A 5LL6X 3W1GA 2R7FA 2ZXPA 4QL5A 3ND9A 2AQ1B 1B70B 1E1OA 4KLKA 1O7LA 4ZUJA 3PIOA 4FNFA 5C4XB 1XPOA 2K7VA 2Y0SG 3ITPA 1A62A 5IYBG 4H13C 1N34L 4CKEA 4UP7A 4HEDA 5IYBH 4GLAC 1S3OA 3K6OA 1HR0W 2H5XA 2SNMA 5JPNC 1TWAH 3OTOL 3A7LA 2PZTA 2CH4A 2EYMA 1T9HA 4DR7L 1KAAA 4BBRB 3PSIA 3T1HL 3TBIB 2F4IA 3GDEA 3HOXG 1X3GA 4IUUA 3Q0AA 5C6AA 3OHXC 1TT2A 1U0LA 1CSPA 1FJGL 4H44C 1E0BA 3TQYA 2E2IH 1Z9FA 3HOXH 1FYCA 3O13A 4IZ8A 1I4XA 1VQLA 4HIDA 1XMOQ 1G291 1CKNB 1VQGA 3MHBA 4A3JG 2F1MA 3S1RB 1NAPA 5ELNA 4C3IG 3M4PA 4CJ2C 2OQ0A 1ENCA 1BO0A 4NXNL 5IIFA 4A3JH 4CGYB 5KNCA 4C3IH 3K7UC 1XPRA 5CV6A 5KGUA 4R4QA 2NN6I 1WCMG 1XTDA 2N3SA 1S5BD 4DFAA 1MGSA 2RKSA 5M5YH 5D3IB 1HRJA 1GHKA 1XNRQ 4L63B 1WCMH 2KCMA 4JI5Q 3TMEA 5LMUQ 2CFMA 3KLSA 4YIJA 5J1ZA 3HKZE 4DV7L 2KECA 2RQXA 4JW0A 1STGA 4RCNA 1F2LA 1HNWL 3GV3A 4GOPB 3A54A 2VQEL 5CV7A 3WDNA 4POFA 1F9QA 2L55A 2JA5G 3S1MH 5HGTA 1AFPA 1SBBB 2ATWA 1QCBD 3WWVA 3K7AB 4PMWA 4LF4L 5IYCG 2JA5H 1E2WA 1TWFB 1XXGA 4A3LG 3KYHC 1OO9B 1STHA 3GTPH 1FGUA 2ZT9C 3M7GA 3UE1A 2XNAC 3KK7A 2IT1A 4PQXA 4ID6A 3C3LA 2VXWA 2E2IB 1RL2A 4LFBQ 3HOXB 4P75A 2VY3A 1HHVA 4R4CA 1WTQA 1Q90A 2F0SA 4JPBW 2DY7A 4G7ZC 4A3GG 3PO2H 4IJLA 4B3RQ 2RF4A 4LFAL 3IFDA 1PTOD 4DUZL 1C8CA 4A3GH 4A3JB 3I8ZA 2MO0A 4X62Q 4C3IB 4H0LC 1PMRA 1KNAA 1B3QA 1JWUD 5JJZA 5CGKA 2K5NA 5CV8A 4I7AA 4JI7L 5ISRA 1WCMB 2R92G 1VQ7A 1VQ4A 3W1BA 1AW7A 1Y8OB 1PDQA 4R4IA 3S2HB 1DOMA 1N33Q 1TY0A 3QO2A 1LUZA 2N49A 3Q22A 4WORA 1ZYRD 2ZTDA 3S1MB 2NTSA 3DMUA 3D6WA 2A6HC 4PZ8A 2ZM6L 1O78A 3D4RA 4CJ0B 1IBKL 2JA5B 2E5LL 1LYLA 3VR4A 2LKVA 3HOZH 4KHPQ 1JT8A 3HG9A 1LTAD 3SK4A 2DNEA 4DK6C 1IBLL 1DOKA 3K5NA 4DV3Q 5BN5A 1N8RC 1SYBA 4FP5D 3SXHA 1L1OC 3MZ5A 4DV2L 4BXXH 2NN6G 1ENAA 2VZAA 1CT1D 3KBGA 4JI4Q 2F3VA 2NN6H 3N52A 1F9SA 3EIVA 1JCKB 1G51A 1WOCA 1F9RA 5IY0A 4I65A 1PTOH 2EYFA 2RDGA 3T1YQ 4IFDI 1MIUA 3I73A 3EVQA 2NYZD 4A3GB 5DLQE 1PYBA 2B2YC 3KBXA 5AJ3L 3DHQA 1LM0A 5D65A 1NMGA 4DPGA 2RSOA 4F8MA 1HR0L 2UU9Q 3A8JE 2L1BA 3H94A 3SVMA 3CCUA 5K36H 4IOCA 4XTCS 3S17H 2JEAI 4FF3A 4CDEC 1QILA 3GTOB 2Q2UA 2K5WA 2B2VA 1KIXA 2K1BA 1DM0B 2EY5A 2AQ2B 1UNSA 2R92B 3CCRA 2B3GA 3HP3A 3L3OC 5J3BA 3C1EA 4JI1Q 4AYBB 4K5VA 1SYCA 4Y52H 3S15H 1JICA 4P2CB 1ZXTA 2A1AA 1ILPA 3RZDH 2MJ8A 4KV6A 2LS01 2D2CC 1K3RA 1PRTC 1U4PA 4RMFA 1DCZA 3K5LA 2VQFQ 3RLNA 5I9PA 4GLXA 4QQBX 2RDFA 1E2VA 4OEMB 3A8IE 1SSOA 4GN3B 2F3WA 1EQRA 1SR3A 3ERSX 4IFDJ 3AQQA 1K9MC 2WINB 4N9PA 1KABA 3M4YA 1V43A 2EE1A 4GNXA 4AIMA 3CCSA 4HJ5A 1JORA 1IXRA 1AP0A 3FDTA 4PMBA 3I90A 2PMZB 2WP8J 1EIFA 3IKJA 1ESRA 4DV0Q 1CA6A 1PTOB 3Q24A 2Y0SE 1K0RA 1JOQA 3EBEA 4MZ9A 2K28A 2LXJA 1IL8A 1LTGD 2F0JA 1L2FA 1U4LA 1S5DD 1N32Q 3S17B 2QCPX 3NBHB 3S2DH 3BYTB 2RCNA 5LMNL 4DV1L 1YBYA 1LABA 2VB3X 5FK9C 3H3VC 2QDBA 4K6LA 2I46A 5FLMH 4GOPC 5C4ZA 1KL9A 3VA5A 1IBMQ 3JAML 4E6IA 1KTKA 3RZDB 4ZYSA 3SR1A 3OWFA 2FXQA 2MP1A 5A35A 3BG3A 3KOJA 3PIP3 4RAUC 3M3YH 1SLJA 1K8MA 1AZQA 4IFDG 2RA4A 2PQAA 4JYAQ 3PUVA 4C56C 1D7QA 1JJGA 1NSNS 5C0XI 1TWHH 4IFDH 1S5ED 3M9BA 3C1FA 4OX9L 4BY1G 3BVZA 3CXCA 2IHFA 5E1FA 1VQNA 3R8BA 4X6AH 2A68D 4DR4L 3MVVA 3U50C 1M1KC 3K57A 1E22A 1K8AC 3AMUA 2L11A 4XYOA
chains in the Genus database with same CATH topology
1HA6A 5ELBA 1DJRD 4J1MA 1JOKA 5CR3A 1PXUA 1EEID 3BYYB 2EJFC 1ENFA 2F0HA 1IYUA 1EFID 2DY8A 1BF4A 1XTCD 2C9OA 3NE5B 1GXDC 3CRLC 1LTID 5C0XJ 5C4HA 2L12A 3I72A 1QE6A 2GA4B 3NK9A 5E4XA 4DF7A 5JVH3 4RGMA 2G9HD 3NBIA 2SEBD 3M3YB 4ZUIA 3J7AV 1EYAA 3VA7A 1HFNA 2TSSA 4ULLA 1GHJA 4LMQD 4RGTA 4BS9A 4DAPA 3D6CA 1TWHB 1PZKD 4MN3A 4ZAIA 1B44D 4DGZA 2EYLA 1SNCA 1CHQD 2QEJC 4BY1B 3S14B 1EWHA 2H1EA 2A69C 2MHVA 2XRSD 4CJ1B 3SEBA 1GUTA 1F2ZA 2XWJB 3A56A 4HN7A 3NHHA 3MXPA 2NVTB 3TP7A 4WJWA 2KUMA 1QNUA 1SNPA 5C0XG 1EIHA 1OXUA 1U9RA 2SOBA 2EY1A 3HGBA 4K8IA 1SNMA 4J8QA 2F0DA 1PRTD 1Y1VB 4Z9CB 2BDOA 2F0FA 2RDHA 2NB0A 1S5FD 3MC0B 1GUSA 5TSSA 1MSGA 4F87A 1UUPA 1CQVA 3HOUB 4BWGB 5IGCA 5COYA 4ABNA 4XXEA 4IUQA 3P1HA 4XYQA 2PW7A 4TQUS 4DNTB 2WB1B 3IAYA 3RLFA 1IKMA 2V4DA 2WKCA 2Z4IA 4M1UB 2AUKA 1RCVD 4IUTA 3TSSA 1D5ZC 2K05A 1EL0A 1HTPA 3DEOA 2EYJA 2KA7A 1SEBD 1K83B 2IL8A 2B2VC 1RJTA 1SE4A 1STYA 1TS2A 3VYSA 2F0VA 2YU9B 5BN4A 5E4WC 4TKOB 2EPBA 3D3RA 4KY5A 1BCPB 2H4OA 4QUCA 2PZWA 4RHRA 5EJWA 2NZ1D 4RCOA 3AU7A 4F7XA 2X69A 3NWTA 1JWSD 3P20A 1KLGD 3URYA 1ONLA 2JA7B 4DK0A 2KHSA 3W3AA 4ME5A 2OT2A 5I2YA 3MFGA 5KRUA 1EQVA 1KDAA 2Z8LA 3GQBA 3PO3B 1PFMA 2K5DA 1JR0D 3S1NB 2CW0D 2OXPA 3SHLA 1H9SB 5G3LF 4RWSC 3D4WA 1U4MA 1HCZA 4B08A 3T53B 3BDLA 3TP5A 1YNJC 2G9DA 2NUCA 3JAME 2SNSA 1B9NA 5IGBA 1PZID 2PQEA 3ONAB 2L5TA 3M4OB 1I6VC 4V190 3LX0A 2F0EA 5FOBB 1LTTD 2EDGA 5EBDA 1G2SA 5C4JB 3PV0A 2IPKD 1LO5D 5M3MB 2XVSA 1Y69U 2B8GA 1FNWA 3WOEA 2HCCA 3R93A 2K6AA 1YNNC 1UAPA 2ZXRA 4ZLTF 2R3ZA 3NUCA 1TWAB 2KCNA 5FLXL 2AWNA 3BZDB 2QILA 1CA5A 1F77A 1B1ZA 4KJOA 5JVG3 4DAVA 5KNBA 2AWOA 2L0CA 2NWGA 4KHVA 2A6EC 4OL7A 1VF7A 3QJYA 1EY6A 3DUZA 3FMCA 2BOSA 1MI2A 3SK5A 1C48A 2Q8TA 1WD0A 3MFYA 3E6ZX 4BA1I 1TR5A 4K14A 4M8AA 1QB5D 4KKSA 2F0OA 2WV6D 4X3TA 1G2TA 4QMGA 5M5YB 3SDZA 1WTOA 4LJZC 1CHPD 1EYDA 2Z4HA 4O42A 5LL6S 1NUCA 4GZYC 2FHTA 1B2TA 1G6ZA 4RFBA 1X3QA 3VYRA 3R2IA 5F2DA 4R8NA 4RH6A 3BS1A 3HZXA 2LY7A 1BCPF 2HUGA 2Q8IB 3L7ZC 1EY4A 2IJ0A 1V8QA 1GUWA 3NTIA 3BVGA 3K59A 3R3OA 3GTPB 3K58A 3A8KE 3R2TA 2M00A 2KOLA 3T16A 2LMCB 3TP8A 3BDCA 4LAAA 5T1IA 3KLSX 3FRPB 3PO2B 3I4LA 1V1PA 2MPMA 4G7HC 3QB3A 3U9SA 3LWUA 1Z7TA 1Q1BA 1FNUA 4ZKCB 3VR3A 1SNQA 4XDXA 3OMCA 5K36G 2F0LA 3K5MA 5EPLA 1B4OA 4KKTA 2K04A 1CQFA 3P75A 1AN8A 2ZXOA 1WTRA 4FXKC 2PW5A 1LLRD 1I4RA 4H7BA 3VR2A 2L9HA 1ICWA 4IQZA 3FVQA 3F2UA 5K5PA 1F2YA 1M4VA 2ID0A 1LTBD 5C5MA 2F0IA 4FO2A 1EZ6A 3HOZB 5KYLA 1J8IA 1WTVA 3S16B 1PYWD 3PIO3 5FKAC 4KKUA 3OWEB 4DA2A 2F03A 1LT5D 1O7YA 5FO8B 3MA2B 3D8GA 1C4QA 3G7LA 4XIGS 4CKBA 5IOCA 4BY7B 2IX0A 2HDLA 2Z1CA 1TWGB 2EVBA 3W2DA 2TMPA 3TN2A 3L9AX 3NQIA 1SMYC 4QIWB 2EJGC 4K5WA 1Z47A 2RVLA 4PNYA 5EKKA 1Y8NB 5J39A 1HPCA 2WIIB 1OXSC 2M2LA 2IWHA 4O1NA 1R4PB 2IW3A 1ZEQX 4C2MB 3G6JB 3H09A 4JBWA 4NKLA 1H9JA 3LWEA 5ELFA 3S15B 1TWCB 1W6JA 4KY6A 2E76C 4N9TA 1ESFA 4KN7C 3TZDA 4L8JA 2K5QA 2BE5C 4QF4A 2KEDA 4BBSB 5M9OA 2K32A 3AB9A 1MSHA 1RHPA 5EQ0A 1A2UA 3DWQA 4V0BA 4A3MB 1U4RA 3X3MA 1X32A 4S3SA 1ET6A 1H9RA 1CFMA 4Q5VA 1L0XB 3NQTA 1JWMD 3OIQA 4A3KB 4FVMA 2D5DA 1E2ZA 4X3SA 2F0GA 5C3WA 2O5IC 3E0JA 3QIAA 4ZKBB 1IW7C 3ND8A 1A3TA 1DONA 4G4KA 1LV9A 3GTJB 4J6HA 1D5XC 3GTLB 2WAQB 2O5JC 3CKIB 5JOBA 3S2DB 1GJXA 3GO5A 2HCIA 3PUWA 4XT1B 1MBYA 1I4QA 2DN8A 4KN4C 4EGVA 2R61A 2EOTA 1Q8IA 1IHZA 2X6LA 2A6HD 4HTHA 1TS4A 3ERQA 4ILWA 4RKBA 1GOZA 4WFN3 1UEAB 1M8AA 4EVOA 5C3EB 4HCEA 4A3DB 5FLXE 5FO9B 3I3CA 1HTLD 1TIID 4JK1C 1EY8A 3D4DA 1D6EC 5CV5A 2NVYB 1TY2A 5KIXA 1Y1WB 4ZK9B 3KF8A 1RTOA 1RKNA 2EY2A 3HRZC 4PV1C 1BDOA 5DM63 4EQNA 1II3A 1SJHD 2IX3A 2B2WA 4A93B 1Z6HA 1WVLA 1A15A 3S9WA 2D9UA 1GUOA 5KNDA 2VUMB 1R4QB 3A7AB 3J80E 5EKLA 2PYKA 3RMHA 2EYOA 5EPJA 1EQTA 1ILQA 1PTOF 4C3HG 5I2XA 1KDCA 5LHY1 5CBEE 5KYIA 5C44B 2Q8RE 1SYDA 1D1IA 4C3JG 1KDBA 5I4DA 5CV4A 1RDPD 4HCSA 1V1OA 2EXZA 1PTOC 1EY7A 1RD9D 4KHZA 1JOOA 2A73B 2PCFB 1LT3D 1NR2A 2HDMA 4UDUC 3MEHA 3J81L 2PZUA 1W6KA 1STNA 2JP1A 4KMUC 5D14A 1H9SA 3BDOA 3NTHA 5IGDA 3TP6A 1G91A 2BCOA 1HUNA 2RBMA 3S1QB 1IKLA 1ZYRC 3DXJC 3FPUB 5CV9A 3GV6A 5CYUA 4KD3A 3QOJA 3OPOA 2BE5D 1SYFA 1G8ZD 2FMMA 4ZRZA 2D62A 4C3HB 4HMJA 1WTWA 1STBA 1VDZA 2VB2X 3K5OA 5CBAE 4C3JB 4OO1I 4HMIA 1FD7D 2KEEA 3H0GB 1A3UA 2N88A 3EFXD 3WOFA 3NTKA 1SNOA 2F0KA 4G57A 2NTTA 1SJED 1EY0A 1HXYD 4ODGA 4Q0FA 2KJXA 1IW7D 1EIGA 4A3IB 1SFOB 4FXDA 4EQOA 2EZVA 4TSSA 3V96A 4FF4A 5KEEA 3SE0A 3CU7A 2I07B 5EPKA 3MTSA 1PRTB 2JA6B 5DM73 3HOWB 3GTGB 1HQMC 1Q3LA 4K6DA 2FINB 3PUZA 2L4NA 3I70A 2C5CA 2CVRA 3T56B 1BBXC 3T13A 1JB3A 3QG1A 1X3PA 1I4PA 5I9OA 1PFBA 4DXGA 2B2UA 3KUPA 2A69D 1BR9A 1HA5A 3A55A 3RD4A 4DNRB 3E5SA 2PO4A 5M3FB 4IUVA 1HUMA 4HSPA 1CM9A 1DXMA 1VMPA 2BA0A 3GP7A 4HR7B 1I4HA 5IT9L 2RSNA 4OO1G 1K8OA 3NWSA 4KTAA 2Y0SB 3OSOA 2ENBA 5ELDA 4ZQ3A 3EA6A 2ICEC 4OO1H 2JYOA 3EJIA 2ICIA 3MAQA 5CC4A 5DEHA 1T5XD 1D1KA 2WACA 1F9PA 1TS5A 3RUZA 2K03A 2MUYA 1NCVA 4XT3B 4RHSA 2DNCA 5IODA 1L0YB 1ET9A 2KQ3A 2A68C 4QB4A 1A6XA 4LK1C 4KD4A 1FGBD 2EYHA 4Y7NB 5I6YA 4NW2A 4K8JA 4RGOS 3OW7A 3HOYB 2PNRC 1I4GA 3H91A 1JE4A 3J80L 4FF1A 3UI2A 4U68A 4NP5A 4K5XA 1IYVA 1WTXA 4MHEA 3TZUA 1GUGA 4CHTB 1GUNA 1TKWB 3CRKC 1XX8A 2B2WC 1TVXA 1EZ8A 1SE2A 1TQOA 1EU3A 4IALA 2JA8B 3SK8A 4DAYA 1JC7A 4X3KA 1OXVA 1CZGA 5A2QL 1BOSA 2KVMA 3ZYYX 3FEWX 4QUFA 1BCPC 1DOLA 2M9VA 5JPMC 1STEA 2EY6A 1FNVA 3MXUA 3NBHA 3PMFA 2XSCA 4MIUA 4RA8A 4U673 2F0QA 5FO7B 2OF1A 4TRDA 4XQQA 1O7ZA 4X3UA 2NVXB 2AQ3B 3DWAA 3HS0C 2FFKB 3H6MA 4IURA 1EOTA 4PMCA 3HEJA 1EWCA 4IUNA 1PRTF 2QF7A 3V2TA 1SAPA 1VMCA 3OMGA 2VNUD 1JQYD 2IX1A 1CI3M 1EYCA 1SDFA 3U9OA 2YYZA 3J81E 3IFTA 3NPPA 3X3NA 3K0YA 4DU9A 1DZ1A 2FJ2A 1SXTA 3PUYA 2B2TC 4QCLA 2HQEA 5JAVA 3T51B 3GTMB 2BA1A 1I50B 1AZPA 3NSWA 1B50A 5IGEA 3I91A 1YNJD 3GD7A 5JEAJ 1PFNA 1LACA 5NUCA 5C3XA 4R9WA 4HSVA 2E74C 4RKLA 5M5WB 1PZJD 4UAIA 3OOCA 5G3LD 4OIJA 1Q1EA 1H9KA 3Q23A 3EROA 1DYQA 2R93B 4HAEA 2R7ZB 1I6HB 1DD2A 3SK6A 1HFGA 3CQZB 1V1PB 3QOLA 3P7JA 1STAA 1WD1A 2QKIC 3HOVB 1D5MC 3IL8A 3VYUA 5CORA 1YNND 2O2LD 3TDQA 1VCIA 2F0TA 4OHJA 1EY5A 4DK1A 1F2MA 4RGNA 3FPPA 2A6ED 1RF2D 3QWNA 5JEAG 3M85A 5DAUA 1Q12A 1QJOA 5CMDA 4I7ZC 5JEAH 1I3QB 1FR3A 3D31A 4EQPA 5EBCA 4BA2I 4R8IA 1T5EA 3J7YW 1QOHA 2KCCA 1SNDA 2F0NA 4IUPA 2B63B 3LNNA 4FF2A 5IGGA 3CHBD 3M7NA 2F0UA 4NMZA 2B2UC 2O4XA 2PPBC 3DEPA 1D2BA 2JEBI 2X6GA 1H9MA 3KLRA 4F88A 1A2TA 4C1NI 1LTSD 2CW0C 1O80A 4A3EB 1RTNA 4OIKA 2WKDA 4G7OC 3I4MB 2A74C 2FMCA 2F0MA 1CK1A 5IT9E 2B39A 3GTQB 1MD2D 4KJNA 2JXMB 2XIWA 1B3AA 5J22A 2J7ZA 1S5CD 1B53A 2K01A 1ZKOA 1BCPD 2K33A 2OEOA 5DNFA 4OGQC 5I6WA 5M5XB 1QWYA 2AUJD 2F0PA 2XWBB 1SYEA 4KI0A 3V05A 1QG7A 5ELCA 2SDFA 2XN9C 1TU2B 5EGTA 1J9OA 3NP8A 5BN3A 4L6TB 1RODA 4C1NK 4NDXA 3NXWA 5E3FA 1HQRD 5C5LA 1A3VA 5D3DA 1EU4A 1AEXA 2E75C 3VR6A 3I4NB 1EY9A 2CHBD 1KNEA 3HKZB 1VF5C 4CBVA 5C0XH 2E2JB 4FXGC 4XQJA 3PUXA 2B8FA 2B2YA 2BDNA 1ML0D 5T1GA 1KLUD 4WRDA 5A2QE 5IGFA 3BVMA 4DXFA 2JSOA 2XRQD 1XWEA 3MXGA 3MWYW 4FYDA 1WTPA 2CQAA 5ELEA 1CTMA 1BQQT 1SMYD 5AFWA 1PLFA 1LTRD 3MXNA 3GTKB 2J0TD 4B9WA 2LFNA 1EEFD 3VR5A 2B2TA 4IN3A 3N6RA 1BUVT 4DN4M 1SYGA 2EYPA 4KK7A 4B9XA 1Y8PB 3RZOB 4A3BB 2JE6I 1QNKA 1LT6D 2EJMA 2NBFA 2NVQB 3VYTA 3EQLC 2A5HA 1S4ZA 3FKIB 1SE3A 4K2KA 1BNZA 5EKIA 1R9TB 1NR4A 1BXTA 1LT4D 1OXXK 3T4AC 1TS3A 3OIPA 4A3FB 1XYIA 1CZWA 2N55A 5HURA 3DWPA 3C2PA 3J7AF 2MGSA 3C46A 2E2HB 4XQNA 2E2DC 1B9MA 4K2LA 4KY7A 1OXTA 3Q6SA 2R6GA 2J4XA 3DM1A 2F0WA 4CKCA 5LL6X 2ZXPA 3ND9A 2AQ1B 1O7LA 4ZUJA 4FNFA 5C4XB 2K7VA 3ITPA 4H13C 4CKEA 4HEDA 3K6OA 2SNMA 5JPNC 3A7LA 2PZTA 2EYMA 1KAAA 4BBRB 3TBIB 2F4IA 4IUUA 3Q0AA 5C6AA 3OHXC 1TT2A 4H44C 1E0BA 1FYCA 3O13A 4IZ8A 1I4XA 1G291 3MHBA 2F1MA 3S1RB 1NAPA 4C3IG 4CJ2C 1ENCA 1BO0A 5IIFA 4CGYB 5KNCA 5CV6A 5KGUA 2NN6I 4DFAA 1S5BD 1MGSA 2RKSA 5D3IB 1HRJA 1GHKA 4L63B 3TMEA 3KLSA 4YIJA 5J1ZA 2KECA 2RQXA 1STGA 4RCNA 1F2LA 3GV3A 3A54A 5CV7A 3WDNA 1F9QA 2L55A 5HGTA 1AFPA 1SBBB 1QCBD 3K7AB 4PMWA 1E2WA 1TWFB 1XXGA 1OO9B 1STHA 3M7GA 2ZT9C 2XNAC 3KK7A 2IT1A 4PQXA 4ID6A 3C3LA 2VXWA 2E2IB 3HOXB 1HHVA 1WTQA 1Q90A 2F0SA 4G7ZC 2DY7A 3IFDA 1PTOD 1C8CA 4A3JB 3I8ZA 4C3IB 4H0LC 1PMRA 1KNAA 1JWUD 5JJZA 5CGKA 5CV8A 5ISRA 1WCMB 1AW7A 1Y8OB 1PDQA 3S2HB 1DOMA 1TY0A 3QO2A 3Q22A 4WORA 1ZYRD 3S1MB 2NTSA 3DMUA 3D6WA 2A6HC 1O78A 3D4RA 4CJ0B 2JA5B 3VR4A 2LKVA 3HG9A 1LTAD 3SK4A 2DNEA 1DOKA 3K5NA 5BN5A 1SYBA 4FP5D 3SXHA 3MZ5A 2NN6G 1ENAA 1CT1D 3KBGA 2F3VA 2NN6H 3N52A 1F9SA 1JCKB 1F9RA 4I65A 1PTOH 2EYFA 2RDGA 4IFDI 3I73A 3EVQA 2NYZD 4A3GB 2B2YC 3KBXA 3DHQA 5D65A 2RSOA 4F8MA 3A8JE 2L1BA 3H94A 3SVMA 5K36H 4XTCS 2JEAI 4FF3A 1QILA 3GTOB 2K5WA 2B2VA 2K1BA 1DM0B 2EY5A 2AQ2B 1UNSA 2R92B 3HP3A 3L3OC 3C1EA 4AYBB 4K5VA 1SYCA 1JICA 4P2CB 1ZXTA 1ILPA 2MJ8A 4KV6A 2LS01 2D2CC 1PRTC 1U4PA 1DCZA 3K5LA 5I9PA 1E2VA 2RDFA 3A8IE 1SSOA 2F3WA 4IFDJ 2WINB 4N9PA 1KABA 1V43A 3M4YA 2EE1A 1JORA 1AP0A 3FDTA 4PMBA 3I90A 2PMZB 2WP8J 3IKJA 1ESRA 1CA6A 1PTOB 3Q24A 1JOQA 2K28A 1IL8A 1LTGD 2F0JA 1U4LA 1S5DD 3S17B 2QCPX 3BYTB 1LABA 2VB3X 5FK9C 3H3VC 2QDBA 4K6LA 2I46A 5C4ZA 3VA5A 3JAML 4E6IA 1KTKA 3RZDB 4ZYSA 3SR1A 3OWFA 2MP1A 5A35A 3BG3A 3PIP3 4RAUC 1K8MA 1AZQA 4IFDG 2RA4A 3PUVA 4C56C 1NSNS 5C0XI 4IFDH 1S5ED 3C1FA 3BVZA 5E1FA 3R8BA 2A68D 3MVVA 3K57A 3AMUA 2L11A 4XYOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HFG A;  5AFW A;  1PLF A;  1MSH A;  4X3K A;  5JJZ A;  1HA6 A;  1RHP A;  2NWG A;  1WTR A;  2FMM A;  4IUU A;  5EQ0 A;  1WTW A;  2B2T A;  2KVM A;  1SSO A;  1E0B A;  4DN4 M;  1U4R A;  3P7J A;  1WD1 A;  4IUV A;  2B2W A;  1HUM A;  1ICW A;  2L9H A;  4QUF A;  1MI2 A;  5CBA E;  1ILP A;  1WVL A;  1DOL A;  1PDQ A;  1A15 A;  2EE1 A;  2XIW A;  1B3A A;  1DOM A;  1CM9 A;  1X32 A;  2D9U A;  3IL8 A;  2J7Z A;  3QO2 A;  5COR A;  1WD0 A;  1B53 A;  1VMP A;  2K01 A;  1MSG A;  2KEE A;  1NAP A;  1QNK A;  1AP0 A;  2DY8 A;  2N88 A;  3FDT A;  3F2U A;  3I90 A;  5DNF A;  4CJ2 C;  1BF4 A;  1PFM A;  1BO0 A;  1ESR A;  4X3S A;  5COY A;  1CA6 A;  2RSN A;  4RA8 A;  4X3T A;  3D6W A;  1G2T A;  4IUQ A;  2L12 A;  4OIK A;  4RWS C;  5EPJ A;  1EQT A;  4ZKB B;  1ILQ A;  1WTO A;  1QG7 A;  1S4Z A;  4CJ0 B;  1U4M A;  1J8I A;  1QE6 A;  1O7Z A;  1MGS A;  1WTV A;  1DON A;  4X3U A;  2SDF A;  1LV9 A;  2JYO A;  4O42 A;  5E4X A;  5CBE E;  1HRJ A;  1BNZ A;  5EKI A;  2Q8R E;  2K28 A;  2FFK B;  1NR4 A;  1F9P A;  4IUR A;  1IL8 A;  1EOT A;  1HFN A;  1DOK A;  1EIG A;  1IKM A;  2K03 A;  1U4L A;  2KEC A;  4LMQ D;  2FHT A;  1XYI A;  1O7Y A;  2HCI A;  1B2T A;  2N55 A;  1G6Z A;  1NCV A;  5CMD A;  1J9O A;  4XT1 B;  2MGS A;  4IUT A;  1X3Q A;  1SAP A;  4XT3 B;  1VMC A;  4MN3 A;  1ROD A;  1F2L A;  3G7L A;  4ZAI A;  3N52 A;  1F9S A;  3GV3 A;  2K05 A;  4HCS A;  2HDL A;  1EL0 A;  1F9R A;  1SDF A;  2EOT A;  3ONA B;  3DEO A;  4NW2 A;  1F9Q A;  3TN2 A;  4R8I A;  2HUG A;  2IL8 A;  1DZ1 A;  5EPK A;  2B2V C;  1GUW A;  2X6L A;  2FJ2 A;  2NYZ D;  3Q6S A;  3MTS A;  2B2T C;  3DM1 A;  2H1E A;  1RJT A;  1NR2 A;  2B2Y C;  2HDM A;  3H91 A;  2MP1 A;  3KBX A;  1JE4 A;  5D65 A;  4CJ1 B;  4IUP A;  2RSO A;  2RVL A;  1M8A A;  1G2S A;  4RAU C;  1AZP A;  1KNE A;  3UI2 A;  4U68 A;  2L1B A;  1AZQ A;  3SVM A;  1B50 A;  1Q3L A;  2KOL A;  5E4W C;  2RA4 A;  3I91 A;  3I3C A;  2M2L A;  2JP1 A;  1PFN A;  2FIN B;  5D14 A;  2EPB A;  4XDX A;  2B2V A;  2VXW A;  2K1B A;  4MHE A;  1WTX A;  2L4N A;  2B2U C;  4R9W A;  5T1I A;  2HCC A;  4HSV A;  2Q8T A;  2B2Y A;  4QUC A;  1HHV A;  1WTQ A;  2BDN A;  2CVR A;  1ML0 D;  3DEP A;  3HP3 A;  3R93 A;  5T1G A;  1G91 A;  5EJW A;  2DY7 A;  4UAI A;  2X6G A;  1HUN A;  2KUM A;  2MPM A;  3LWE A;  4ZLT F;  2R3Z A;  4HED A;  2NZ1 D;  1IKL A;  3FPU B;  4ZK9 B;  1KNA A;  1RTO A;  1BBX C;  3GV6 A;  1JIC A;  1XX8 A;  3TZD A;  4ZKC B;  1O80 A;  1ZXT A;  1X3P A;  2X69 A;  2B2W C;  1TVX A;  3IFD A;  3MWY W;  4OIJ A;  2MJ8 A;  1C8C A;  1EIH A;  3I8Z A;  5EPL A;  1WTP A;  1CA5 A;  2KED A;  2L11 A;  1B4O A;  1PFB A;  2K04 A;  1RTN A;  4HAE A;  1U4P A;  2B2U A;  3KUP A; 
#chains in the Genus database with same CATH topology
 4IO9 A;  1Q86 C;  4PG3 A;  4YHH Q;  1HA6 A;  5ELB A;  1DJR D;  5E7N A;  4YWM A;  4J1M A;  1KD1 C;  2DJF C;  1JOK A;  5CR3 A;  4X66 Q;  1PXU A;  3Q8D A;  1EEI D;  3BYY B;  2EJF C;  1ENF A;  2F0H A;  2OTJ A;  1IYU A;  1EFI D;  4R1J A;  1KXL A;  2DY8 A;  1BF4 A;  3CC4 A;  1XTC D;  2VUM H;  3I55 A;  2C9O A;  3NE5 B;  1GXD C;  3PGZ A;  3CRL C;  2HHH L;  1LTI D;  4JI8 L;  3STB C;  5C0X J;  5C4H A;  2L12 A;  3I72 A;  1KRT A;  1Y1V G;  2KHJ A;  4JI6 Q;  1QE6 A;  2GA4 B;  3NK9 A;  5E4X A;  4DF7 A;  5JVH 3;  4RGM A;  2G9H D;  3NBI A;  2SEB D;  4HJ7 A;  4ZUI A;  3J7A V;  1EYA A;  3M3Y B;  3VA7 A;  1HFN A;  2TSS A;  4ULL A;  5IWA Q;  1GHJ A;  4LMQ D;  4RGT A;  4YWK A;  4BS9 A;  4DAP A;  4MTK A;  3HOU G;  3D6C A;  1TWH B;  1PZK D;  4MN3 A;  4ZAI A;  1B44 D;  4DGZ A;  2EYL A;  1SNC A;  1CHQ D;  2QEJ C;  1NMF A;  4BY1 B;  4YCW A;  2ZJP A;  3BJU A;  3S14 B;  4DR2 Q;  3BZC A;  2WB1 G;  1XNQ L;  1EWH A;  2H1E A;  2A69 C;  2MHV A;  4P72 A;  2K50 A;  2XRS D;  4CJ1 B;  3SEB A;  1GUT A;  1F2Z A;  2XWJ B;  2PNH A;  1AE2 A;  3A56 A;  4A4I A;  4JC0 A;  4HN7 A;  3NHH A;  3MXP A;  2CKZ B;  4DR3 L;  1VQK A;  4DV6 L;  2E8G A;  2NVT B;  3TP7 A;  4GKK L;  1VQP A;  2I0Q A;  4WJW A;  2KUM A;  1L1O A;  1QNU A;  1SNP A;  1HNX Q;  5GAD C;  1K83 H;  2CCZ A;  5C0X G;  2PMZ E;  1EIH A;  1OXU A;  1U9R A;  2SOB A;  2EY1 A;  4LF7 L;  3HGB A;  2YU9 H;  4K8I A;  1SNM A;  4J8Q A;  3KJO A;  2F0D A;  1PRT D;  1Y1V B;  4Z9C B;  4JOI A;  3TEH B;  1HJP A;  4UY8 C;  2BDO A;  2F0F A;  2RDH A;  2NB0 A;  1S5F D;  3MC0 B;  2VS1 A;  1GUS A;  5TSS A;  1MSG A;  4F87 A;  2JA7 G;  1UUP A;  1CQV A;  4DUY Q;  3HOU B;  2K14 A;  3JAM c;  4BWG B;  5IGC A;  5COY A;  4ABN A;  2JA7 H;  2JJQ A;  4XXE A;  1Q82 C;  4IUQ A;  3P1H A;  4XYQ A;  2PW7 A;  4TQU S;  5GRO A;  4DNT B;  1BBW A;  3RNU A;  4LF8 Q;  1PH2 A;  2WB1 B;  3IAY A;  2K5H A;  3RLF A;  1MKH A;  1IKM A;  2V4D A;  2WKC A;  3JC6 6;  2Z4I A;  4M1U B;  2AUK A;  1RCV D;  3PO3 G;  4IUT A;  3TSS A;  1SFO H;  3PO3 H;  1D5Z C;  2K05 A;  4DKA C;  1EL0 A;  1HTP A;  3AFP A;  2F3I A;  3DEO A;  2EYJ A;  3S1N H;  5IP7 G;  2KA7 A;  1SEB D;  1K83 B;  2IL8 A;  4YCV A;  2B2V C;  1RJT A;  1SE4 A;  1STY A;  1TS2 A;  1PH1 A;  3IRB A;  3K80 C;  1E24 A;  1CKN A;  3VYS A;  2F0V A;  2YU9 B;  4GKJ Q;  4YY3 L;  5BN4 A;  5E4W C;  1X55 A;  3HOW H;  4TKO B;  1P8L A;  2EPB A;  3D3R A;  4KY5 A;  1BCP B;  4IJH A;  2H4O A;  4QUC A;  2ZJQ A;  2PZW A;  4RHR A;  3KJP A;  5EJW A;  5GAE C;  3M4O H;  2NZ1 D;  4RCO A;  2JQO A;  3AU7 A;  4OXP A;  4F7X A;  2X69 A;  3NWT A;  1JWS D;  3P20 A;  1KLG D;  3URY A;  1ONL A;  2JA7 B;  4DK0 A;  4GNX C;  2KHS A;  3E9H A;  5M3M G;  3W3A A;  3G48 A;  4ME5 A;  5C4J H;  4GOP A;  4WJ4 A;  5M3M H;  3DLL A;  2OT2 A;  3U4Z A;  5I2Y A;  3MFG A;  5KRU A;  1EQV A;  3E9I A;  5M3F H;  1K73 C;  4JI5 L;  1KDA A;  1WFQ A;  1QVC A;  4EX5 A;  4NXM L;  2Z8L A;  3GQB A;  2RHS B;  3UE0 A;  3PO3 B;  3G4S A;  3UDF A;  1PFM A;  4JI0 Q;  2K5D A;  1JR0 D;  3KF6 B;  1NJI C;  2CW0 D;  2OXP A;  3SHL A;  3S1N B;  3LGJ A;  1H9S B;  5G3L F;  4RWS C;  3D4W A;  1UE6 A;  1AH9 A;  1U4M A;  4LF5 L;  1HCZ A;  2F52 A;  3T53 B;  4B08 A;  3BDL A;  3STB D;  3TP5 A;  1YNJ C;  4DV4 Q;  2G9D A;  1C9O A;  2NUC A;  3JAM E;  2SNS A;  4LF6 L;  4AQY L;  1B9N A;  1I94 Q;  5IGB A;  4X64 Q;  4PZ6 A;  1XMQ L;  1PZI D;  2PQE A;  1JE5 A;  3ONA B;  1VQ9 A;  2L5T A;  3M4O B;  1I6V C;  4V19 0;  4Y7N H;  3LX0 A;  2F0E A;  1PYS B;  5FOB B;  1EIY B;  1LTT D;  2EDG A;  5EBD A;  1G2S A;  3TS0 A;  5C4J B;  4X65 Q;  3PV0 A;  4HJ8 A;  2IPK D;  1LO5 D;  5M3M B;  2XVS A;  1Y69 U;  2B8G A;  5HY6 A;  1FNW A;  3WOE A;  2HCC A;  3R93 A;  2K6A A;  1YNN C;  1UAP A;  2ZXR A;  4ZLT F;  1K0S A;  2R3Z A;  3NUC A;  1TWA B;  3RN2 A;  2KCN A;  5FLX L;  1N33 L;  2AWN A;  3BZD B;  2QIL A;  5LMN W;  1CA5 A;  1F77 A;  1B1Z A;  4KJO A;  5JVG 3;  3T1H Q;  4DAV A;  5KNB A;  2AWO A;  2L0C A;  2NWG A;  4KHV A;  2A6E C;  4OL7 A;  1HH2 P;  4L5T A;  3PO2 G;  2WB1 E;  1VF7 A;  3QJY A;  1YJW A;  1EY6 A;  3DUZ A;  3FMC A;  2BOS A;  1MI2 A;  3CC7 A;  3SK5 A;  1C48 A;  2Q8T A;  1WD0 A;  5HGQ A;  4DV3 L;  3MFY A;  3E6Z X;  4BA1 I;  1TR5 A;  4K14 A;  1ICF B;  4M8A A;  1QB5 D;  4R4O A;  4KKS A;  4JI4 L;  2F0O A;  2WV6 D;  1VQF A;  4X3T A;  1G2T A;  4QMG A;  5M5Y B;  3SDZ A;  1WTO A;  4LJZ C;  1CHP D;  1KQS A;  5JJL A;  2XGT A;  1EYD A;  2Z4H A;  4O42 A;  5LL6 S;  4JV5 Q;  1NUC A;  3CF5 A;  4AYB G;  2NVX H;  1CSQ A;  1HNZ L;  4DV7 Q;  3CD6 A;  3E3X A;  2N8N A;  3H15 A;  1Q81 C;  4DR6 L;  4GZY C;  2FHT A;  1B2T A;  2EIF A;  1G6Z A;  4RFB A;  4UHV A;  1HNW Q;  1P16 A;  1X3Q A;  2KCT A;  3HKS A;  2VQE Q;  4DR5 Q;  3VYR A;  1WJJ A;  3R2I A;  5F2D A;  4OWT B;  4NB3 A;  4R8N A;  3K0X A;  4RH6 A;  3BS1 A;  3HOZ G;  3HZX A;  2LY7 A;  1BCP F;  2HUG A;  4LF4 Q;  2Q8I B;  3L7Z C;  1EY4 A;  2IJ0 A;  1V8Q A;  1GUW A;  1CKM A;  1PFS A;  3NTI A;  4JI1 L;  3S16 H;  3BVG A;  1XJV A;  4BXX G;  3K59 A;  3R3O A;  3GTP B;  2PI2 E;  2AHO B;  3K58 A;  3A8K E;  3GTM H;  3R2T A;  1I50 H;  4A3C G;  2M00 A;  2KOL A;  1Q7Y C;  3T16 A;  3ICE A;  4BY7 G;  3KDF B;  2MQH A;  1KAW A;  2LMC B;  3TP8 A;  4A3C H;  3BDC A;  4LAA A;  4N8X 1;  5T1I A;  3KLS X;  4BY7 H;  2DJG C;  3FRP B;  3PO2 B;  2ASB A;  3I4L A;  1V1P A;  3UDI A;  2RCF A;  2MPM A;  4G7H C;  1TWG H;  3QB3 A;  3U9S A;  5M5W H;  3CAM A;  3LWU A;  4JOI C;  1Z7T A;  1Q1B A;  4LFA Q;  1FNU A;  4ZKC B;  4JI3 L;  3VR3 A;  1SNQ A;  4XDX A;  3OMC A;  5K36 G;  2F0L A;  3K5M A;  5EPL A;  4LNQ A;  1B4O A;  2DGY A;  4KKT A;  2K04 A;  1CQF A;  1K8G A;  3P75 A;  4FDB A;  1AN8 A;  4JI2 Q;  1I6H H;  2ZXO A;  1WTR A;  2NZO A;  4FXK C;  2PW5 A;  1QVF A;  1VQE A;  1LLR D;  1H95 A;  1I4R A;  1PH5 A;  4H7B A;  3VR2 A;  2L9H A;  1ICW A;  1UE7 A;  4C2M H;  3DM3 A;  1UE5 A;  3G71 A;  1TWC H;  4IQZ A;  1A0I A;  3FVQ A;  4UP9 A;  3JAM i;  4BBS G;  3F2U A;  5K5P A;  3CCQ A;  1F2Y A;  1M4V A;  2EXD A;  2ID0 A;  1LTB D;  5C5M A;  3M4Q A;  4BBS H;  1IBK Q;  2A19 A;  2F0I A;  1EZ6 A;  2Z9H A;  4FO2 A;  3HOZ B;  3J7A 5;  1S40 A;  5KYL A;  4A3M G;  1J8I A;  1WTV A;  3S16 B;  1PYW D;  3CW2 C;  3PIO 3;  1SE8 A;  1IBL Q;  5FKA C;  4KKU A;  4A3M H;  3OWE B;  1VQO A;  4DA2 A;  4DV2 Q;  2F03 A;  1LT5 D;  4EQ5 A;  2UUB L;  1O7Y A;  4JBJ A;  5FO8 B;  3MA2 B;  3D8G A;  4HIK A;  4A3K G;  4DAY B;  1C4Q A;  3G7L A;  4XIG S;  4CKB A;  5IOC A;  1KC8 C;  4BY7 B;  2IX0 A;  4LF9 Q;  2HDL A;  2Z1C A;  4A3K H;  1TWG B;  2EVB A;  3W2D A;  2TMP A;  3TN2 A;  3L9A X;  3F2B A;  4A75 A;  1OTC A;  1WI5 A;  2WAQ G;  1Y14 B;  3NQI A;  1SMY C;  4GLV B;  4QIW B;  2EJG C;  3GTJ H;  4K5W A;  1HR0 Q;  1Z47 A;  3OW2 A;  3GTL H;  3I56 A;  2RVL A;  4PNY A;  2KHI A;  2HQL A;  3MEF A;  3CME A;  5EKK A;  1Y8N B;  5J39 A;  1HPC A;  2WII B;  1OXS C;  5FLM G;  2M2L A;  4YHH L;  2IWH A;  2N78 A;  4O1N A;  1NNX A;  1R4P B;  2IW3 A;  1QZG A;  2UUC L;  1ZEQ X;  4C2M B;  3G6J B;  4LWC A;  3H09 A;  4JBW A;  4NKL A;  4B3S Q;  1H9J A;  3LWE A;  5ELF A;  3S15 B;  1TWC B;  1W6J A;  4KY6 A;  2E76 C;  4N9T A;  1ESF A;  4KN7 C;  3TZD A;  4L8J A;  3A5U A;  2K5Q A;  2BE5 C;  4QF4 A;  2KED A;  4BBS B;  5M9O A;  5IYD G;  2K32 A;  5C3E G;  4A3D G;  3AB9 A;  1LTL A;  4B3T L;  1EOV A;  1MSH A;  4A3E H;  1RHP A;  5IYD H;  5C3E H;  1AE3 A;  4A3D H;  3B6Y A;  5EQ0 A;  1A2U A;  3DWQ A;  4V0B A;  5GAH C;  4A3M B;  2OTL A;  1FL0 A;  1U4R A;  3X3M A;  3RN5 A;  1Y1W G;  1X32 A;  1YIJ A;  4S3S A;  1ET6 A;  3F2C A;  5EAY A;  1H9R A;  1JB7 A;  2NVY H;  1CFM A;  1X3F A;  4Q5V A;  1Y1W H;  1L0X B;  3NQT A;  2AMC B;  1JWM D;  3OIQ A;  4A3K B;  2F4V Q;  2CWP A;  4FVM A;  2D5D A;  1E2Z A;  4X3S A;  2ZTE A;  2F0G A;  5C3W A;  2O5I C;  2UXC Q;  3E0J A;  3QIA A;  4ZKB B;  1IW7 C;  3ND8 A;  1A3T A;  1GVP A;  1DON A;  4G4K A;  1LV9 A;  4DV5 L;  3GTJ B;  4J6H A;  1D5X C;  3GTL B;  4A93 G;  2WAQ B;  2O5J C;  3CKI B;  5JOB A;  1U5K A;  4A93 H;  3S2D B;  1GJX A;  1MJC A;  2VUM G;  3GO5 A;  2HCI A;  4DV1 Q;  2JN4 A;  3PUW A;  3TRE A;  4XT1 B;  1MBY A;  1I4Q A;  2DN8 A;  4KN4 C;  4EGV A;  3L2P A;  2VW9 A;  2R61 A;  1BKB A;  2EOT A;  1Q8I A;  1Q8K A;  3F8T A;  1IHZ A;  2P5Z X;  1NBW A;  2X6L A;  2A6H D;  4HTH A;  4CDF C;  1TS4 A;  3ERQ A;  1QUQ B;  4ILW A;  4RKB A;  1GOZ A;  5C44 H;  1PV4 A;  4WFN 3;  1UEA B;  2QA4 A;  1M8A A;  1N9W A;  2CQO A;  4EVO A;  5C3E B;  4HCE A;  4A3D B;  3CC2 A;  5FLX E;  4YWL A;  5FO9 B;  4K0K Q;  3I3C A;  1HTL D;  1TII D;  2V1C C;  3F1Z A;  4JK1 C;  4L5Q A;  1ASY A;  4OX9 Q;  2YTX A;  1EY8 A;  1NY4 A;  3G6E A;  3D4D A;  4AYB E;  1D6E C;  5CV5 A;  1HZB A;  2NVY B;  1TY2 A;  5KIX A;  1Y1W B;  4ZK9 B;  3KF8 A;  1RTO A;  2UXB Q;  1RKN A;  1VS0 A;  1X6O A;  1WYD A;  1FVI A;  2EY2 A;  3HRZ C;  4PV1 C;  1JJ2 A;  1C0A A;  4LFC L;  1BDO A;  4GN4 B;  5DM6 3;  4EQN A;  3CCV A;  1II3 A;  1SJH D;  2IX3 A;  1MHW C;  2B2W A;  2RHQ B;  4A93 B;  4LF8 L;  1Z6H A;  1WVL A;  1A15 A;  3S9W A;  2D9U A;  3AFQ A;  1GUO A;  5KND A;  3S1Q H;  2VUM B;  1R4Q B;  3NEL A;  3A7A B;  3A5Z B;  2HHH Q;  3J80 E;  5EKL A;  4JI8 Q;  2PYK A;  2NVQ H;  3RMH A;  4JBK A;  2EYO A;  4OON A;  5EPJ A;  1EQT A;  1ILQ A;  1PTO F;  4C3H G;  5I2X A;  1KDC A;  5LHY 1;  3F2D A;  5CBE E;  3FKI H;  4QIW E;  5KYI A;  1E1T A;  2Q8R E;  5C44 B;  4C3H H;  1SYD A;  1D1I A;  4C3J G;  1KDB A;  4HJ9 A;  1R9T H;  5I4D A;  1I5F A;  4C3J H;  3H0G G;  4GKJ L;  2PI2 A;  4A3F H;  2KEN A;  5CV4 A;  3H0G H;  1RDP D;  4HCS A;  1V1O A;  3NEM A;  2EXZ A;  1PTO C;  1EY7 A;  1RD9 D;  4KHZ A;  4B3M Q;  2R7D A;  1JOO A;  4DR1 L;  1XNQ Q;  2A73 B;  2PCF B;  1X54 A;  1LT3 D;  1NR2 A;  2HDM A;  3ULJ A;  4UDU C;  5JJK A;  3MEH A;  4A3I G;  2UUA L;  3J81 L;  4A3I H;  2ES2 A;  2PZU A;  3A0J A;  1J5E Q;  1W6K A;  1STN A;  1K28 A;  3KF6 A;  4DV6 Q;  1B7Y B;  2JP1 A;  4AH6 A;  4KMU C;  2ALY B;  5D14 A;  2MFI A;  4DK3 C;  4GKK Q;  1D8L A;  1H9S A;  3VDY A;  1EYG A;  3BDO A;  3NTH A;  1YZ6 A;  5IGD A;  3TP6 A;  1G91 A;  2BCO A;  4L5R C;  5BR8 Q;  1HUN A;  2RBM A;  3S1Q B;  1IKL A;  1ZYR C;  3DXJ C;  3FPU B;  4P74 A;  5CV9 A;  2JA6 G;  2K52 A;  3GV6 A;  5ELO A;  5GAG C;  1YJN A;  5CYU A;  1QZH A;  4KD3 A;  3HOW G;  4LF7 Q;  2JA6 H;  3QOJ A;  3OPO A;  4JI0 L;  1E7Z A;  2QW7 A;  1WTH A;  2BE5 D;  3GTG H;  1HZA A;  1SYF A;  1G8Z D;  1VQC A;  2FMM A;  2D62 A;  4ZRZ A;  4HMJ A;  4C3H B;  1WTW A;  1STB A;  1VDZ A;  2WAQ E;  1BBU A;  1KRS A;  1L0W A;  3EN2 A;  2VB2 X;  3K5O A;  5CBA E;  5FJ8 H;  4UPA A;  4C3J B;  1VQM A;  1O7I A;  4OO1 I;  4HMI A;  2LSS A;  3KFU A;  4QGU A;  1FD7 D;  2KEE A;  1XMO L;  3H0G B;  1A3U A;  2N88 A;  3L0O A;  2UXD Q;  3EFX D;  3S24 A;  3WOF A;  3NTK A;  1SNO A;  2F0K A;  1I94 L;  4G57 A;  2NTT A;  4P73 A;  4J15 A;  2K4K A;  1W2B A;  1SJE D;  1EY0 A;  5M3F G;  1HXY D;  3CCL A;  2MO1 A;  4ODG A;  4Q0F A;  1XNR L;  2KJX A;  3PQI A;  1IW7 D;  1EIG A;  3CCM A;  5LMU L;  4A3I B;  5L37 A;  1SFO B;  4FXD A;  1PH7 A;  1VQJ A;  3I4O A;  4EQO A;  2EZV A;  4X65 L;  3H3V H;  3MXN B;  4TSS A;  4YCU A;  3V96 A;  4FF4 A;  5KEE A;  3RR5 A;  3SE0 A;  1VQD A;  3CU7 A;  2I07 B;  5EPK A;  3MTS A;  3CCJ A;  1PRT B;  2JA6 B;  3FHW A;  3K7A H;  4YY3 Q;  5DM7 3;  1TWF H;  3HOW B;  1GKH A;  2QDL A;  3GTG B;  1HQM C;  2BH2 A;  1Q3L A;  4K6D A;  2FIN B;  4H02 A;  1EFW A;  3PUZ A;  2L4N A;  4HIM A;  3I70 A;  2C5C A;  2YTY A;  4LFB L;  4IOA A;  2CVR A;  1XPU A;  3T56 B;  1PVO A;  1N36 Q;  3HOY G;  4IPH A;  1YHB A;  1BBX C;  4B3R L;  3I2Z A;  3T13 A;  1JB3 A;  3QG1 A;  1X3P A;  3KLW A;  4POG A;  1I4P A;  3HOY H;  3CPW A;  5I9O A;  1PFB A;  4LUV A;  2B2U A;  3KUP A;  2A69 D;  1BR9 A;  4DXG A;  4X62 L;  3J80 i;  1HA5 A;  3A55 A;  3RD4 A;  4DNR B;  5GQO A;  3E5S A;  1N34 Q;  2PO4 A;  5M3F B;  4IUV A;  1HUM A;  4HSP A;  4LUZ A;  1NE3 A;  3TS2 A;  3PIP A;  3TRZ A;  4JV5 L;  1IZ6 A;  1CM9 A;  4NXM Q;  1DXM A;  3OTO Q;  1K3B C;  1VMP A;  3NEN A;  2BA0 A;  2NZH A;  3S2H H;  3GP7 A;  1ASZ A;  2OWO A;  4HR7 B;  4DR7 Q;  2JA8 G;  4MTN A;  1I4H A;  5IT9 L;  4DR5 L;  2RSN A;  3AEV A;  2JA8 H;  3KDF A;  4OEL B;  4LF5 Q;  4OO1 G;  1K8O A;  3NWS A;  2I5L X;  2Y0S B;  3OSO A;  4KTA A;  2ENB A;  5ELD A;  1FJG Q;  4ZQ3 A;  3EA6 A;  2ICE C;  4OO1 H;  2JYO A;  3EJI A;  2ICI A;  3J81 c;  3MAQ A;  5CC4 A;  5DEH A;  1T5X D;  1D1K A;  2WAC A;  1F9P A;  4KHP L;  1EWI A;  1TS5 A;  1X56 A;  3RUZ A;  1PH3 A;  4LF6 Q;  5IYC H;  2K03 A;  4AQY Q;  2MUY A;  4A3L H;  1NCV A;  5IP9 G;  4NXN Q;  4XT3 B;  4RHS A;  2DNC A;  5IOD A;  1XMQ Q;  1PH4 A;  1L0Y B;  1ET9 A;  2KQ3 A;  2A68 C;  4QB4 A;  5IP9 H;  1A6X A;  4LK1 C;  4KD4 A;  1FGB D;  2EYH A;  4Y7N B;  5I6Y A;  1X9N A;  4NW2 A;  4K8J A;  2XTI A;  3UDG A;  4RGO S;  3OW7 A;  3T1Y L;  4MNO A;  2HD3 A;  3HOY B;  2PNR C;  1X65 A;  1I4G A;  1UE1 A;  3H91 A;  1GO3 E;  1JE4 A;  3J80 L;  4WJ3 M;  1GD7 A;  4FF1 A;  1VQB A;  3UI2 A;  4U68 A;  1DGS A;  2UU9 L;  4NP5 A;  2GN5 A;  4K5X A;  4JI2 L;  1Q46 A;  3A74 A;  4JCV E;  4MHE A;  1WTX A;  1IYV A;  3GTO H;  3TZU A;  1GUG A;  4JG2 A;  2R92 H;  4CHT B;  1GUN A;  4CDC C;  1TKW B;  3CRK C;  1XX8 A;  2B2W C;  1TVX A;  1EZ8 A;  1SE2 A;  1TQO A;  3BZK A;  1EU3 A;  2Q2I A;  4IAL A;  4R4T A;  2JA8 B;  3SK8 A;  4DAY A;  1JC7 A;  4X3K A;  1OXV A;  2VQF L;  1CZG A;  5A2Q L;  1BOS A;  2KVM A;  2YTV A;  3ZYY X;  1KHI A;  3FEW X;  3CPF A;  4QUF A;  1BCP C;  1W3S A;  1DOL A;  2Q2H A;  2M9V A;  1JMC A;  3W5O A;  4DUZ Q;  5JPM C;  1STE A;  2EY6 A;  1FNV A;  3MXU A;  3NBH A;  2R7Z G;  2R93 G;  3PMF A;  2XSC A;  2JA9 A;  1A63 A;  4MIU A;  3PF5 A;  4RA8 A;  2R7Z H;  2R93 H;  1SRO A;  1X3E A;  4DV0 L;  4JI7 Q;  2HT1 A;  4U67 3;  4LF9 L;  1EQQ A;  2KBN A;  2F0Q A;  5FO7 B;  2OF1 A;  1VQ6 A;  4TRD A;  4XQQ A;  4N8F A;  3CQZ H;  1O7Z A;  4X3U A;  2NVX B;  2AQ3 B;  3DWA A;  1UEB A;  1HNZ Q;  1YIT A;  3HS0 C;  2FFK B;  3H6M A;  3HFZ B;  1VQH A;  4IUR A;  1VQ8 A;  3HOV G;  3ULP A;  1EOT A;  4PMC A;  4DR6 Q;  3HEJ A;  1EWC A;  4IUN A;  3BU2 A;  1PRT F;  2QF7 A;  3HOV H;  1N32 L;  3V2T A;  1SAP A;  1VMC A;  3OMG A;  2VNU D;  1JQY D;  2IX1 A;  2ZM6 Q;  1CI3 M;  1IL2 A;  1EYC A;  1SDF A;  3CP0 A;  2YYZ A;  3U9O A;  2E5L Q;  3J81 E;  2B29 A;  3IFT A;  3NPP A;  3X3N A;  3K0Y A;  4DU9 A;  1DZ1 A;  2FJ2 A;  1SXT A;  3PUY A;  2B2T C;  1IBM L;  4B3S L;  1RIP A;  2Z6K C;  3E0E A;  4QCL A;  2HQE A;  3I7F A;  5JAV A;  3T51 B;  3GTM B;  4DNI A;  4GN5 A;  2BA1 A;  1I50 B;  1AZP A;  3NSW A;  4LUO A;  1B50 A;  5IGE A;  3I91 A;  1YNJ D;  3GD7 A;  5JEA J;  3U58 A;  1PH6 A;  1PFN A;  1LAC A;  5NUC A;  1YHQ A;  4JYA L;  5FLX c;  5C3X A;  1I3Q H;  4R9W A;  4HSV A;  2E74 C;  4RKL A;  5M5W B;  1PZJ D;  4UAI A;  5IT9 c;  5H1S E;  3J81 j;  4JI3 Q;  2CWA A;  5AJ3 Q;  3OOC A;  5G3L D;  4HJA A;  4OIJ A;  1Q1E A;  2VL6 A;  2B63 G;  1H9K A;  3Q23 A;  2K75 A;  3ERO A;  3PCO B;  1DYQ A;  2R93 B;  4HAE A;  2R7Z B;  1I6H B;  1DD2 A;  3SK6 A;  1HFG A;  2B63 H;  2F4V L;  2OQK A;  3CQZ B;  2UXC L;  3J7Z C;  1M90 C;  1V1P B;  3QOL A;  3P7J A;  1STA A;  1WD1 A;  2QKI C;  4X66 L;  3HOV B;  1QUQ A;  1D5M C;  3IL8 A;  3VYU A;  5COR A;  2I5M X;  3D0F A;  1YNN D;  2O2L D;  1YI2 A;  3TDQ A;  1VCI A;  2F0T A;  4OHJ A;  4A3E G;  2Z0S A;  1SRU A;  1EY5 A;  4PZ7 A;  4DK1 A;  3I4M G;  3CMA A;  1F2M A;  4RGN A;  3J80 c;  3K8A A;  3I4M H;  1YNX A;  4JI6 L;  1YJ9 A;  1SN8 A;  3FPP A;  2A6E D;  2UUB Q;  1RF2 D;  3QWN A;  5JEA G;  1YEZ A;  3M85 A;  5DAU A;  3GTQ H;  2HIV A;  3FP9 A;  1Q12 A;  5IWA L;  1QJO A;  5CMD A;  4I7Z C;  5JEA H;  1I3Q B;  2BH8 A;  1FR3 A;  4K0K L;  2C35 B;  4ZCK A;  3D31 A;  4EQP A;  5EBC A;  2WFW A;  4BA2 I;  5M5X H;  4LW1 A;  1VQI A;  2JK8 A;  4R8I A;  1T5E A;  3J7Y W;  1QOH A;  4BY1 H;  4DR2 L;  3S14 H;  4GNX B;  1J6Q A;  2I5H A;  2UXB L;  2KCC A;  1SND A;  2F0N A;  2K5V A;  4IUP A;  3LNN A;  2B63 B;  1PHJ A;  5LMN Q;  2G5D A;  4L5S A;  4O2D A;  1PH9 A;  4FF2 A;  5IGG A;  3CHB D;  3M7N A;  2F0U A;  1PA6 A;  2UUC Q;  4NMZ A;  2CH4 W;  2B2U C;  2D0P A;  2O4X A;  2PPB C;  3U4V A;  3DEP A;  1CUK A;  2NVT H;  1D2B A;  2JEB I;  2X6G A;  1HZC A;  1H9M A;  3KLR A;  4A76 A;  5C44 G;  4F88 A;  1A2T A;  4C1N I;  3I4N G;  1LTS D;  2CW0 C;  1O80 A;  1HNX L;  3HKZ G;  4B3T Q;  4A3E B;  1RTN A;  3I4N H;  4OIK A;  2WKD A;  3K81 C;  4G7O C;  3I4M B;  2A74 C;  1BVS A;  2FMC A;  2F0M A;  2E2J H;  1CK1 A;  3ULL A;  2MNA A;  4JVZ A;  5IT9 E;  4IPG A;  4DR4 Q;  1Y1V H;  2B39 A;  3GTQ B;  1MD2 D;  4KJN A;  2JXM B;  2IHE A;  2XIW A;  1A8V A;  1B3A A;  5J22 A;  2J7Z A;  3SGI A;  4TVA B;  3PF4 A;  1S5C D;  1B53 A;  1UWV A;  2K01 A;  1ZKO A;  1IYJ B;  1BCP D;  2K33 A;  2OEO A;  5DNF A;  4OGQ C;  4DUY L;  5I6W A;  5M5X B;  3AYH B;  4IPC A;  1QWY A;  2PQA B;  4QJF A;  2AUJ D;  3HOU H;  2F0P A;  5IE8 A;  2XWB B;  2Z6B A;  1SYE A;  4KI0 A;  3V05 A;  1QG7 A;  4DV5 Q;  2D0O A;  3GTK H;  5ELC A;  2SDF A;  3J81 i;  4B3M L;  4JBM A;  4UP8 A;  2XN9 C;  1TU2 B;  5EGT A;  4A3B G;  5JJI A;  1YHA A;  1MJE A;  1J9O A;  3RZO H;  2YV5 A;  3NP8 A;  5BN3 A;  4L6T B;  1ROD A;  4A3B H;  4C1N K;  1J5E L;  4NDX A;  1TXY A;  3NXW A;  5E3F A;  3H3V I;  1HQR D;  3FKI G;  1GM5 A;  5C5L A;  1A3V A;  2GVA A;  2IY5 B;  1V9P A;  5D3D A;  5BR8 L;  2L15 A;  4IPD A;  1EU4 A;  1AEX A;  2E75 C;  3VR6 A;  3I4N B;  2DUD A;  4A3F G;  2ZTC A;  1EY9 A;  2CHB D;  1KNE A;  3HKZ B;  1VF5 C;  4NPS A;  4CBV A;  5C0X H;  2E2J B;  1VQA A;  2QEX A;  2QGQ A;  4FXG C;  4ME3 A;  4XQJ A;  4CDD C;  1B8A A;  2E2H H;  3PUX A;  2B8F A;  1V1Q A;  1C7Y A;  2B2Y A;  2BDN A;  1ML0 D;  5T1G A;  1KLU D;  1NTG A;  4WRD A;  1S72 A;  5A2Q E;  5IGF A;  1CKO A;  3BVM A;  2GVB A;  4DXF A;  2JSO A;  2XRQ D;  1XWE A;  3MXG A;  3MWY W;  1E3P A;  3QR8 A;  3UDX A;  4FYD A;  1WTP A;  2CQA A;  5ELE A;  2Q2T A;  1CTM A;  1BQQ T;  4ALP A;  4LFC Q;  1SMY D;  4OWX B;  1G6P A;  5AFW A;  1PLF A;  1LTR D;  3MXN A;  4HIO A;  4DR3 Q;  2UXD L;  3GTK B;  2OCE A;  2J0T D;  4B9W A;  2LFN A;  1EEF D;  3VR5 A;  5C4X G;  2B2T A;  4IN3 A;  1PH8 A;  4P71 A;  2Z6K A;  3N6R A;  1BUV T;  4DN4 M;  1HZ9 A;  5C4X H;  1SYG A;  2EYP A;  3KF8 B;  1YVC A;  1EUJ A;  4KK7 A;  4B9X A;  1Y8P B;  3RZO B;  2HIX A;  3OYY A;  4A3B B;  2JE6 I;  3CCE A;  1QNK A;  1LT6 D;  2EJM A;  2NBF A;  4DAM A;  2NVQ B;  4BBR G;  3VYT A;  3ZJY C;  3EQL C;  4APV A;  1QVG A;  4BBR H;  2A5H A;  4RG1 A;  4GS3 A;  1S4Z A;  3FKI B;  1SE3 A;  1JJC B;  5FJ8 G;  4K2K A;  1BNZ A;  5EKI A;  1R9T B;  5IP7 H;  2EQS A;  1VQ5 A;  1L1O B;  1NR4 A;  1BXT A;  1LT4 D;  1OXX K;  3T4A C;  1TS3 A;  3OIP A;  4A3F B;  1XYI A;  1CZW A;  1SMX A;  2N55 A;  5HUR A;  4DV4 L;  3DWP A;  3C2P A;  2A8V A;  3J7A F;  2MGS A;  3C46 A;  4OWW B;  2E2H B;  4O0A A;  3RLO A;  3S1R H;  4XQN A;  3ER0 A;  2E2D C;  4X64 L;  4DR1 Q;  1B9M A;  4K2L A;  4KY7 A;  1OXT A;  3Q6S A;  2R6G A;  2J4X A;  3DM1 A;  2F0W A;  2ZJR A;  2AKW B;  4CKC A;  1N36 L;  2LXK A;  2UUA Q;  4QY7 A;  5LL6 X;  3W1G A;  2R7F A;  2ZXP A;  4QL5 A;  3ND9 A;  2AQ1 B;  1B70 B;  1E1O A;  4KLK A;  1O7L A;  4ZUJ A;  3PIO A;  4FNF A;  5C4X B;  1XPO A;  2K7V A;  2Y0S G;  3ITP A;  1A62 A;  5IYB G;  4H13 C;  1N34 L;  4CKE A;  4UP7 A;  4HED A;  5IYB H;  4GLA C;  1S3O A;  3K6O A;  1HR0 W;  2H5X A;  2SNM A;  5JPN C;  1TWA H;  3OTO L;  3A7L A;  2PZT A;  2CH4 A;  2EYM A;  1T9H A;  4DR7 L;  1KAA A;  4BBR B;  3PSI A;  3T1H L;  3TBI B;  2F4I A;  3GDE A;  3HOX G;  1X3G A;  4IUU A;  3Q0A A;  5C6A A;  3OHX C;  1TT2 A;  1U0L A;  1CSP A;  1FJG L;  4H44 C;  1E0B A;  3TQY A;  2E2I H;  1Z9F A;  3HOX H;  1FYC A;  3O13 A;  4IZ8 A;  1I4X A;  1VQL A;  4HID A;  1XMO Q;  1G29 1;  1CKN B;  1VQG A;  3MHB A;  4A3J G;  2F1M A;  3S1R B;  1NAP A;  5ELN A;  4C3I G;  3M4P A;  4CJ2 C;  2OQ0 A;  1ENC A;  1BO0 A;  4NXN L;  5IIF A;  4A3J H;  4CGY B;  5KNC A;  4C3I H;  3K7U C;  1XPR A;  5CV6 A;  5KGU A;  4R4Q A;  2NN6 I;  1WCM G;  1XTD A;  2N3S A;  1S5B D;  4DFA A;  1MGS A;  2RKS A;  5M5Y H;  5D3I B;  1HRJ A;  1GHK A;  1XNR Q;  4L63 B;  1WCM H;  2KCM A;  4JI5 Q;  3TME A;  5LMU Q;  2CFM A;  3KLS A;  4YIJ A;  5J1Z A;  3HKZ E;  4DV7 L;  2KEC A;  2RQX A;  4JW0 A;  1STG A;  4RCN A;  1F2L A;  1HNW L;  3GV3 A;  4GOP B;  3A54 A;  2VQE L;  5CV7 A;  3WDN A;  4POF A;  1F9Q A;  2L55 A;  2JA5 G;  3S1M H;  5HGT A;  1AFP A;  1SBB B;  2ATW A;  1QCB D;  3WWV A;  3K7A B;  4PMW A;  4LF4 L;  5IYC G;  2JA5 H;  1E2W A;  1TWF B;  1XXG A;  4A3L G;  3KYH C;  1OO9 B;  1STH A;  3GTP H;  1FGU A;  2ZT9 C;  3M7G A;  3UE1 A;  2XNA C;  3KK7 A;  2IT1 A;  4PQX A;  4ID6 A;  3C3L A;  2VXW A;  2E2I B;  1RL2 A;  4LFB Q;  3HOX B;  4P75 A;  2VY3 A;  1HHV A;  4R4C A;  1WTQ A;  1Q90 A;  2F0S A;  4JPB W;  2DY7 A;  4G7Z C;  4A3G G;  3PO2 H;  4IJL A;  4B3R Q;  2RF4 A;  4LFA L;  3IFD A;  1PTO D;  4DUZ L;  1C8C A;  4A3G H;  4A3J B;  3I8Z A;  2MO0 A;  4X62 Q;  4C3I B;  4H0L C;  1PMR A;  1KNA A;  1B3Q A;  1JWU D;  5JJZ A;  5CGK A;  2K5N A;  5CV8 A;  4I7A A;  4JI7 L;  5ISR A;  1WCM B;  2R92 G;  1VQ7 A;  1VQ4 A;  3W1B A;  1AW7 A;  1Y8O B;  1PDQ A;  4R4I A;  3S2H B;  1DOM A;  1N33 Q;  1TY0 A;  3QO2 A;  1LUZ A;  2N49 A;  3Q22 A;  4WOR A;  1ZYR D;  2ZTD A;  3S1M B;  2NTS A;  3DMU A;  3D6W A;  2A6H C;  4PZ8 A;  2ZM6 L;  1O78 A;  3D4R A;  4CJ0 B;  1IBK L;  2JA5 B;  2E5L L;  1LYL A;  3VR4 A;  2LKV A;  3HOZ H;  4KHP Q;  1JT8 A;  3HG9 A;  1LTA D;  3SK4 A;  2DNE A;  4DK6 C;  1IBL L;  1DOK A;  3K5N A;  4DV3 Q;  5BN5 A;  1N8R C;  1SYB A;  4FP5 D;  3SXH A;  1L1O C;  3MZ5 A;  4DV2 L;  4BXX H;  2NN6 G;  1ENA A;  2VZA A;  1CT1 D;  3KBG A;  4JI4 Q;  2F3V A;  2NN6 H;  3N52 A;  1F9S A;  3EIV A;  1JCK B;  1G51 A;  1WOC A;  1F9R A;  5IY0 A;  4I65 A;  1PTO H;  2EYF A;  2RDG A;  3T1Y Q;  4IFD I;  1MIU A;  3I73 A;  3EVQ A;  2NYZ D;  4A3G B;  5DLQ E;  1PYB A;  2B2Y C;  3KBX A;  5AJ3 L;  3DHQ A;  1LM0 A;  5D65 A;  1NMG A;  4DPG A;  2RSO A;  4F8M A;  1HR0 L;  2UU9 Q;  3A8J E;  2L1B A;  3H94 A;  3SVM A;  3CCU A;  5K36 H;  4IOC A;  4XTC S;  3S17 H;  2JEA I;  4FF3 A;  4CDE C;  1QIL A;  3GTO B;  2Q2U A;  2K5W A;  2B2V A;  1KIX A;  2K1B A;  1DM0 B;  2EY5 A;  2AQ2 B;  1UNS A;  2R92 B;  3CCR A;  2B3G A;  3HP3 A;  3L3O C;  5J3B A;  3C1E A;  4JI1 Q;  4AYB B;  4K5V A;  1SYC A;  4Y52 H;  3S15 H;  1JIC A;  4P2C B;  1ZXT A;  2A1A A;  1ILP A;  3RZD H;  2MJ8 A;  4KV6 A;  2LS0 1;  2D2C C;  1K3R A;  1PRT C;  1U4P A;  4RMF A;  1DCZ A;  3K5L A;  2VQF Q;  3RLN A;  5I9P A;  4GLX A;  4QQB X;  2RDF A;  1E2V A;  4OEM B;  3A8I E;  1SSO A;  4GN3 B;  2F3W A;  1EQR A;  1SR3 A;  3ERS X;  4IFD J;  3AQQ A;  1K9M C;  2WIN B;  4N9P A;  1KAB A;  3M4Y A;  1V43 A;  2EE1 A;  4GNX A;  4AIM A;  3CCS A;  4HJ5 A;  1JOR A;  1IXR A;  1AP0 A;  3FDT A;  4PMB A;  3I90 A;  2PMZ B;  2WP8 J;  1EIF A;  3IKJ A;  1ESR A;  4DV0 Q;  1CA6 A;  1PTO B;  3Q24 A;  2Y0S E;  1K0R A;  1JOQ A;  3EBE A;  4MZ9 A;  2K28 A;  2LXJ A;  1IL8 A;  1LTG D;  2F0J A;  1L2F A;  1U4L A;  1S5D D;  1N32 Q;  3S17 B;  2QCP X;  3NBH B;  3S2D H;  3BYT B;  2RCN A;  5LMN L;  4DV1 L;  1YBY A;  1LAB A;  2VB3 X;  5FK9 C;  3H3V C;  2QDB A;  4K6L A;  2I46 A;  5FLM H;  4GOP C;  5C4Z A;  1KL9 A;  3VA5 A;  1IBM Q;  3JAM L;  4E6I A;  1KTK A;  3RZD B;  4ZYS A;  3SR1 A;  3OWF A;  2FXQ A;  2MP1 A;  5A35 A;  3BG3 A;  3KOJ A;  3PIP 3;  4RAU C;  3M3Y H;  1SLJ A;  1K8M A;  1AZQ A;  4IFD G;  2RA4 A;  2PQA A;  4JYA Q;  3PUV A;  4C56 C;  1D7Q A;  1JJG A;  1NSN S;  5C0X I;  1TWH H;  4IFD H;  1S5E D;  3M9B A;  3C1F A;  4OX9 L;  4BY1 G;  3BVZ A;  3CXC A;  2IHF A;  5E1F A;  1VQN A;  3R8B A;  4X6A H;  2A68 D;  4DR4 L;  3MVV A;  3U50 C;  1M1K C;  3K57 A;  1E22 A;  1K8A C;  3AMU A;  2L11 A;  4XYO A; 
#chains in the Genus database with same CATH homology
 1HA6 A;  5ELB A;  1DJR D;  4J1M A;  1JOK A;  5CR3 A;  1PXU A;  1EEI D;  3BYY B;  2EJF C;  1ENF A;  2F0H A;  1IYU A;  1EFI D;  2DY8 A;  1BF4 A;  1XTC D;  2C9O A;  3NE5 B;  1GXD C;  3CRL C;  1LTI D;  5C0X J;  5C4H A;  2L12 A;  3I72 A;  1QE6 A;  2GA4 B;  3NK9 A;  5E4X A;  4DF7 A;  5JVH 3;  4RGM A;  2G9H D;  3NBI A;  2SEB D;  3M3Y B;  4ZUI A;  3J7A V;  1EYA A;  3VA7 A;  1HFN A;  2TSS A;  4ULL A;  1GHJ A;  4LMQ D;  4RGT A;  4BS9 A;  4DAP A;  3D6C A;  1TWH B;  1PZK D;  4MN3 A;  4ZAI A;  1B44 D;  4DGZ A;  2EYL A;  1SNC A;  1CHQ D;  2QEJ C;  4BY1 B;  3S14 B;  1EWH A;  2H1E A;  2A69 C;  2MHV A;  2XRS D;  4CJ1 B;  3SEB A;  1GUT A;  1F2Z A;  2XWJ B;  3A56 A;  4HN7 A;  3NHH A;  3MXP A;  2NVT B;  3TP7 A;  4WJW A;  2KUM A;  1QNU A;  1SNP A;  5C0X G;  1EIH A;  1OXU A;  1U9R A;  2SOB A;  2EY1 A;  3HGB A;  4K8I A;  1SNM A;  4J8Q A;  2F0D A;  1PRT D;  1Y1V B;  4Z9C B;  2BDO A;  2F0F A;  2RDH A;  2NB0 A;  1S5F D;  3MC0 B;  1GUS A;  5TSS A;  1MSG A;  4F87 A;  1UUP A;  1CQV A;  3HOU B;  4BWG B;  5IGC A;  5COY A;  4ABN A;  4XXE A;  4IUQ A;  3P1H A;  4XYQ A;  2PW7 A;  4TQU S;  4DNT B;  2WB1 B;  3IAY A;  3RLF A;  1IKM A;  2V4D A;  2WKC A;  2Z4I A;  4M1U B;  2AUK A;  1RCV D;  4IUT A;  3TSS A;  1D5Z C;  2K05 A;  1EL0 A;  1HTP A;  3DEO A;  2EYJ A;  2KA7 A;  1SEB D;  1K83 B;  2IL8 A;  2B2V C;  1RJT A;  1SE4 A;  1STY A;  1TS2 A;  3VYS A;  2F0V A;  2YU9 B;  5BN4 A;  5E4W C;  4TKO B;  2EPB A;  3D3R A;  4KY5 A;  1BCP B;  2H4O A;  4QUC A;  2PZW A;  4RHR A;  5EJW A;  2NZ1 D;  4RCO A;  3AU7 A;  4F7X A;  2X69 A;  3NWT A;  1JWS D;  3P20 A;  1KLG D;  3URY A;  1ONL A;  2JA7 B;  4DK0 A;  2KHS A;  3W3A A;  4ME5 A;  2OT2 A;  5I2Y A;  3MFG A;  5KRU A;  1EQV A;  1KDA A;  2Z8L A;  3GQB A;  3PO3 B;  1PFM A;  2K5D A;  1JR0 D;  3S1N B;  2CW0 D;  2OXP A;  3SHL A;  1H9S B;  5G3L F;  4RWS C;  3D4W A;  1U4M A;  1HCZ A;  4B08 A;  3T53 B;  3BDL A;  3TP5 A;  1YNJ C;  2G9D A;  2NUC A;  3JAM E;  2SNS A;  1B9N A;  5IGB A;  1PZI D;  2PQE A;  3ONA B;  2L5T A;  3M4O B;  1I6V C;  4V19 0;  3LX0 A;  2F0E A;  5FOB B;  1LTT D;  2EDG A;  5EBD A;  1G2S A;  5C4J B;  3PV0 A;  2IPK D;  1LO5 D;  5M3M B;  2XVS A;  1Y69 U;  2B8G A;  1FNW A;  3WOE A;  2HCC A;  3R93 A;  2K6A A;  1YNN C;  1UAP A;  2ZXR A;  4ZLT F;  2R3Z A;  3NUC A;  1TWA B;  2KCN A;  5FLX L;  2AWN A;  3BZD B;  2QIL A;  1CA5 A;  1F77 A;  1B1Z A;  4KJO A;  5JVG 3;  4DAV A;  5KNB A;  2AWO A;  2L0C A;  2NWG A;  4KHV A;  2A6E C;  4OL7 A;  1VF7 A;  3QJY A;  1EY6 A;  3DUZ A;  3FMC A;  2BOS A;  1MI2 A;  3SK5 A;  1C48 A;  2Q8T A;  1WD0 A;  3MFY A;  3E6Z X;  4BA1 I;  1TR5 A;  4K14 A;  4M8A A;  1QB5 D;  4KKS A;  2F0O A;  2WV6 D;  4X3T A;  1G2T A;  4QMG A;  5M5Y B;  3SDZ A;  1WTO A;  4LJZ C;  1CHP D;  1EYD A;  2Z4H A;  4O42 A;  5LL6 S;  1NUC A;  4GZY C;  2FHT A;  1B2T A;  1G6Z A;  4RFB A;  1X3Q A;  3VYR A;  3R2I A;  5F2D A;  4R8N A;  4RH6 A;  3BS1 A;  3HZX A;  2LY7 A;  1BCP F;  2HUG A;  2Q8I B;  3L7Z C;  1EY4 A;  2IJ0 A;  1V8Q A;  1GUW A;  3NTI A;  3BVG A;  3K59 A;  3R3O A;  3GTP B;  3K58 A;  3A8K E;  3R2T A;  2M00 A;  2KOL A;  3T16 A;  2LMC B;  3TP8 A;  3BDC A;  4LAA A;  5T1I A;  3KLS X;  3FRP B;  3PO2 B;  3I4L A;  1V1P A;  2MPM A;  4G7H C;  3QB3 A;  3U9S A;  3LWU A;  1Z7T A;  1Q1B A;  1FNU A;  4ZKC B;  3VR3 A;  1SNQ A;  4XDX A;  3OMC A;  5K36 G;  2F0L A;  3K5M A;  5EPL A;  1B4O A;  4KKT A;  2K04 A;  1CQF A;  3P75 A;  1AN8 A;  2ZXO A;  1WTR A;  4FXK C;  2PW5 A;  1LLR D;  1I4R A;  4H7B A;  3VR2 A;  2L9H A;  1ICW A;  4IQZ A;  3FVQ A;  3F2U A;  5K5P A;  1F2Y A;  1M4V A;  2ID0 A;  1LTB D;  5C5M A;  2F0I A;  4FO2 A;  1EZ6 A;  3HOZ B;  5KYL A;  1J8I A;  1WTV A;  3S16 B;  1PYW D;  3PIO 3;  5FKA C;  4KKU A;  3OWE B;  4DA2 A;  2F03 A;  1LT5 D;  1O7Y A;  5FO8 B;  3MA2 B;  3D8G A;  1C4Q A;  3G7L A;  4XIG S;  4CKB A;  5IOC A;  4BY7 B;  2IX0 A;  2HDL A;  2Z1C A;  1TWG B;  2EVB A;  3W2D A;  2TMP A;  3TN2 A;  3L9A X;  3NQI A;  1SMY C;  4QIW B;  2EJG C;  4K5W A;  1Z47 A;  2RVL A;  4PNY A;  5EKK A;  1Y8N B;  5J39 A;  1HPC A;  2WII B;  1OXS C;  2M2L A;  2IWH A;  4O1N A;  1R4P B;  2IW3 A;  1ZEQ X;  4C2M B;  3G6J B;  3H09 A;  4JBW A;  4NKL A;  1H9J A;  3LWE A;  5ELF A;  3S15 B;  1TWC B;  1W6J A;  4KY6 A;  2E76 C;  4N9T A;  1ESF A;  4KN7 C;  3TZD A;  4L8J A;  2K5Q A;  2BE5 C;  4QF4 A;  2KED A;  4BBS B;  5M9O A;  2K32 A;  3AB9 A;  1MSH A;  1RHP A;  5EQ0 A;  1A2U A;  3DWQ A;  4V0B A;  4A3M B;  1U4R A;  3X3M A;  1X32 A;  4S3S A;  1ET6 A;  1H9R A;  1CFM A;  4Q5V A;  1L0X B;  3NQT A;  1JWM D;  3OIQ A;  4A3K B;  4FVM A;  2D5D A;  1E2Z A;  4X3S A;  2F0G A;  5C3W A;  2O5I C;  3E0J A;  3QIA A;  4ZKB B;  1IW7 C;  3ND8 A;  1A3T A;  1DON A;  4G4K A;  1LV9 A;  3GTJ B;  4J6H A;  1D5X C;  3GTL B;  2WAQ B;  2O5J C;  3CKI B;  5JOB A;  3S2D B;  1GJX A;  3GO5 A;  2HCI A;  3PUW A;  4XT1 B;  1MBY A;  1I4Q A;  2DN8 A;  4KN4 C;  4EGV A;  2R61 A;  2EOT A;  1Q8I A;  1IHZ A;  2X6L A;  2A6H D;  4HTH A;  1TS4 A;  3ERQ A;  4ILW A;  4RKB A;  1GOZ A;  4WFN 3;  1UEA B;  1M8A A;  4EVO A;  5C3E B;  4HCE A;  4A3D B;  5FLX E;  5FO9 B;  3I3C A;  1HTL D;  1TII D;  4JK1 C;  1EY8 A;  3D4D A;  1D6E C;  5CV5 A;  2NVY B;  1TY2 A;  5KIX A;  1Y1W B;  4ZK9 B;  3KF8 A;  1RTO A;  1RKN A;  2EY2 A;  3HRZ C;  4PV1 C;  1BDO A;  5DM6 3;  4EQN A;  1II3 A;  1SJH D;  2IX3 A;  2B2W A;  4A93 B;  1Z6H A;  1WVL A;  1A15 A;  3S9W A;  2D9U A;  1GUO A;  5KND A;  2VUM B;  1R4Q B;  3A7A B;  3J80 E;  5EKL A;  2PYK A;  3RMH A;  2EYO A;  5EPJ A;  1EQT A;  1ILQ A;  1PTO F;  4C3H G;  5I2X A;  1KDC A;  5LHY 1;  5CBE E;  5KYI A;  5C44 B;  2Q8R E;  1SYD A;  1D1I A;  4C3J G;  1KDB A;  5I4D A;  5CV4 A;  1RDP D;  4HCS A;  1V1O A;  2EXZ A;  1PTO C;  1EY7 A;  1RD9 D;  4KHZ A;  1JOO A;  2A73 B;  2PCF B;  1LT3 D;  1NR2 A;  2HDM A;  4UDU C;  3MEH A;  3J81 L;  2PZU A;  1W6K A;  1STN A;  2JP1 A;  4KMU C;  5D14 A;  1H9S A;  3BDO A;  3NTH A;  5IGD A;  3TP6 A;  1G91 A;  2BCO A;  1HUN A;  2RBM A;  3S1Q B;  1IKL A;  1ZYR C;  3DXJ C;  3FPU B;  5CV9 A;  3GV6 A;  5CYU A;  4KD3 A;  3QOJ A;  3OPO A;  2BE5 D;  1SYF A;  1G8Z D;  2FMM A;  4ZRZ A;  2D62 A;  4C3H B;  4HMJ A;  1WTW A;  1STB A;  1VDZ A;  2VB2 X;  3K5O A;  5CBA E;  4C3J B;  4OO1 I;  4HMI A;  1FD7 D;  2KEE A;  3H0G B;  1A3U A;  2N88 A;  3EFX D;  3WOF A;  3NTK A;  1SNO A;  2F0K A;  4G57 A;  2NTT A;  1SJE D;  1EY0 A;  1HXY D;  4ODG A;  4Q0F A;  2KJX A;  1IW7 D;  1EIG A;  4A3I B;  1SFO B;  4FXD A;  4EQO A;  2EZV A;  4TSS A;  3V96 A;  4FF4 A;  5KEE A;  3SE0 A;  3CU7 A;  2I07 B;  5EPK A;  3MTS A;  1PRT B;  2JA6 B;  5DM7 3;  3HOW B;  3GTG B;  1HQM C;  1Q3L A;  4K6D A;  2FIN B;  3PUZ A;  2L4N A;  3I70 A;  2C5C A;  2CVR A;  3T56 B;  1BBX C;  3T13 A;  1JB3 A;  3QG1 A;  1X3P A;  1I4P A;  5I9O A;  1PFB A;  4DXG A;  2B2U A;  3KUP A;  2A69 D;  1BR9 A;  1HA5 A;  3A55 A;  3RD4 A;  4DNR B;  3E5S A;  2PO4 A;  5M3F B;  4IUV A;  1HUM A;  4HSP A;  1CM9 A;  1DXM A;  1VMP A;  2BA0 A;  3GP7 A;  4HR7 B;  1I4H A;  5IT9 L;  2RSN A;  4OO1 G;  1K8O A;  3NWS A;  4KTA A;  2Y0S B;  3OSO A;  2ENB A;  5ELD A;  4ZQ3 A;  3EA6 A;  2ICE C;  4OO1 H;  2JYO A;  3EJI A;  2ICI A;  3MAQ A;  5CC4 A;  5DEH A;  1T5X D;  1D1K A;  2WAC A;  1F9P A;  1TS5 A;  3RUZ A;  2K03 A;  2MUY A;  1NCV A;  4XT3 B;  4RHS A;  2DNC A;  5IOD A;  1L0Y B;  1ET9 A;  2KQ3 A;  2A68 C;  4QB4 A;  1A6X A;  4LK1 C;  4KD4 A;  1FGB D;  2EYH A;  4Y7N B;  5I6Y A;  4NW2 A;  4K8J A;  4RGO S;  3OW7 A;  3HOY B;  2PNR C;  1I4G A;  3H91 A;  1JE4 A;  3J80 L;  4FF1 A;  3UI2 A;  4U68 A;  4NP5 A;  4K5X A;  1IYV A;  1WTX A;  4MHE A;  3TZU A;  1GUG A;  4CHT B;  1GUN A;  1TKW B;  3CRK C;  1XX8 A;  2B2W C;  1TVX A;  1EZ8 A;  1SE2 A;  1TQO A;  1EU3 A;  4IAL A;  2JA8 B;  3SK8 A;  4DAY A;  1JC7 A;  4X3K A;  1OXV A;  1CZG A;  5A2Q L;  1BOS A;  2KVM A;  3ZYY X;  3FEW X;  4QUF A;  1BCP C;  1DOL A;  2M9V A;  5JPM C;  1STE A;  2EY6 A;  1FNV A;  3MXU A;  3NBH A;  3PMF A;  2XSC A;  4MIU A;  4RA8 A;  4U67 3;  2F0Q A;  5FO7 B;  2OF1 A;  4TRD A;  4XQQ A;  1O7Z A;  4X3U A;  2NVX B;  2AQ3 B;  3DWA A;  3HS0 C;  2FFK B;  3H6M A;  4IUR A;  1EOT A;  4PMC A;  3HEJ A;  1EWC A;  4IUN A;  1PRT F;  2QF7 A;  3V2T A;  1SAP A;  1VMC A;  3OMG A;  2VNU D;  1JQY D;  2IX1 A;  1CI3 M;  1EYC A;  1SDF A;  3U9O A;  2YYZ A;  3J81 E;  3IFT A;  3NPP A;  3X3N A;  3K0Y A;  4DU9 A;  1DZ1 A;  2FJ2 A;  1SXT A;  3PUY A;  2B2T C;  4QCL A;  2HQE A;  5JAV A;  3T51 B;  3GTM B;  2BA1 A;  1I50 B;  1AZP A;  3NSW A;  1B50 A;  5IGE A;  3I91 A;  1YNJ D;  3GD7 A;  5JEA J;  1PFN A;  1LAC A;  5NUC A;  5C3X A;  4R9W A;  4HSV A;  2E74 C;  4RKL A;  5M5W B;  1PZJ D;  4UAI A;  3OOC A;  5G3L D;  4OIJ A;  1Q1E A;  1H9K A;  3Q23 A;  3ERO A;  1DYQ A;  2R93 B;  4HAE A;  2R7Z B;  1I6H B;  1DD2 A;  3SK6 A;  1HFG A;  3CQZ B;  1V1P B;  3QOL A;  3P7J A;  1STA A;  1WD1 A;  2QKI C;  3HOV B;  1D5M C;  3IL8 A;  3VYU A;  5COR A;  1YNN D;  2O2L D;  3TDQ A;  1VCI A;  2F0T A;  4OHJ A;  1EY5 A;  4DK1 A;  1F2M A;  4RGN A;  3FPP A;  2A6E D;  1RF2 D;  3QWN A;  5JEA G;  3M85 A;  5DAU A;  1Q12 A;  1QJO A;  5CMD A;  4I7Z C;  5JEA H;  1I3Q B;  1FR3 A;  3D31 A;  4EQP A;  5EBC A;  4BA2 I;  4R8I A;  1T5E A;  3J7Y W;  1QOH A;  2KCC A;  1SND A;  2F0N A;  4IUP A;  2B63 B;  3LNN A;  4FF2 A;  5IGG A;  3CHB D;  3M7N A;  2F0U A;  4NMZ A;  2B2U C;  2O4X A;  2PPB C;  3DEP A;  1D2B A;  2JEB I;  2X6G A;  1H9M A;  3KLR A;  4F88 A;  1A2T A;  4C1N I;  1LTS D;  2CW0 C;  1O80 A;  4A3E B;  1RTN A;  4OIK A;  2WKD A;  4G7O C;  3I4M B;  2A74 C;  2FMC A;  2F0M A;  1CK1 A;  5IT9 E;  2B39 A;  3GTQ B;  1MD2 D;  4KJN A;  2JXM B;  2XIW A;  1B3A A;  5J22 A;  2J7Z A;  1S5C D;  1B53 A;  2K01 A;  1ZKO A;  1BCP D;  2K33 A;  2OEO A;  5DNF A;  4OGQ C;  5I6W A;  5M5X B;  1QWY A;  2AUJ D;  2F0P A;  2XWB B;  1SYE A;  4KI0 A;  3V05 A;  1QG7 A;  5ELC A;  2SDF A;  2XN9 C;  1TU2 B;  5EGT A;  1J9O A;  3NP8 A;  5BN3 A;  4L6T B;  1ROD A;  4C1N K;  4NDX A;  3NXW A;  5E3F A;  1HQR D;  5C5L A;  1A3V A;  5D3D A;  1EU4 A;  1AEX A;  2E75 C;  3VR6 A;  3I4N B;  1EY9 A;  2CHB D;  1KNE A;  3HKZ B;  1VF5 C;  4CBV A;  5C0X H;  2E2J B;  4FXG C;  4XQJ A;  3PUX A;  2B8F A;  2B2Y A;  2BDN A;  1ML0 D;  5T1G A;  1KLU D;  4WRD A;  5A2Q E;  5IGF A;  3BVM A;  4DXF A;  2JSO A;  2XRQ D;  1XWE A;  3MXG A;  3MWY W;  4FYD A;  1WTP A;  2CQA A;  5ELE A;  1CTM A;  1BQQ T;  1SMY D;  5AFW A;  1PLF A;  1LTR D;  3MXN A;  3GTK B;  2J0T D;  4B9W A;  2LFN A;  1EEF D;  3VR5 A;  2B2T A;  4IN3 A;  3N6R A;  1BUV T;  4DN4 M;  1SYG A;  2EYP A;  4KK7 A;  4B9X A;  1Y8P B;  3RZO B;  4A3B B;  2JE6 I;  1QNK A;  1LT6 D;  2EJM A;  2NBF A;  2NVQ B;  3VYT A;  3EQL C;  2A5H A;  1S4Z A;  3FKI B;  1SE3 A;  4K2K A;  1BNZ A;  5EKI A;  1R9T B;  1NR4 A;  1BXT A;  1LT4 D;  1OXX K;  3T4A C;  1TS3 A;  3OIP A;  4A3F B;  1XYI A;  1CZW A;  2N55 A;  5HUR A;  3DWP A;  3C2P A;  3J7A F;  2MGS A;  3C46 A;  2E2H B;  4XQN A;  2E2D C;  1B9M A;  4K2L A;  4KY7 A;  1OXT A;  3Q6S A;  2R6G A;  2J4X A;  3DM1 A;  2F0W A;  4CKC A;  5LL6 X;  2ZXP A;  3ND9 A;  2AQ1 B;  1O7L A;  4ZUJ A;  4FNF A;  5C4X B;  2K7V A;  3ITP A;  4H13 C;  4CKE A;  4HED A;  3K6O A;  2SNM A;  5JPN C;  3A7L A;  2PZT A;  2EYM A;  1KAA A;  4BBR B;  3TBI B;  2F4I A;  4IUU A;  3Q0A A;  5C6A A;  3OHX C;  1TT2 A;  4H44 C;  1E0B A;  1FYC A;  3O13 A;  4IZ8 A;  1I4X A;  1G29 1;  3MHB A;  2F1M A;  3S1R B;  1NAP A;  4C3I G;  4CJ2 C;  1ENC A;  1BO0 A;  5IIF A;  4CGY B;  5KNC A;  5CV6 A;  5KGU A;  2NN6 I;  4DFA A;  1S5B D;  1MGS A;  2RKS A;  5D3I B;  1HRJ A;  1GHK A;  4L63 B;  3TME A;  3KLS A;  4YIJ A;  5J1Z A;  2KEC A;  2RQX A;  1STG A;  4RCN A;  1F2L A;  3GV3 A;  3A54 A;  5CV7 A;  3WDN A;  1F9Q A;  2L55 A;  5HGT A;  1AFP A;  1SBB B;  1QCB D;  3K7A B;  4PMW A;  1E2W A;  1TWF B;  1XXG A;  1OO9 B;  1STH A;  3M7G A;  2ZT9 C;  2XNA C;  3KK7 A;  2IT1 A;  4PQX A;  4ID6 A;  3C3L A;  2VXW A;  2E2I B;  3HOX B;  1HHV A;  1WTQ A;  1Q90 A;  2F0S A;  4G7Z C;  2DY7 A;  3IFD A;  1PTO D;  1C8C A;  4A3J B;  3I8Z A;  4C3I B;  4H0L C;  1PMR A;  1KNA A;  1JWU D;  5JJZ A;  5CGK A;  5CV8 A;  5ISR A;  1WCM B;  1AW7 A;  1Y8O B;  1PDQ A;  3S2H B;  1DOM A;  1TY0 A;  3QO2 A;  3Q22 A;  4WOR A;  1ZYR D;  3S1M B;  2NTS A;  3DMU A;  3D6W A;  2A6H C;  1O78 A;  3D4R A;  4CJ0 B;  2JA5 B;  3VR4 A;  2LKV A;  3HG9 A;  1LTA D;  3SK4 A;  2DNE A;  1DOK A;  3K5N A;  5BN5 A;  1SYB A;  4FP5 D;  3SXH A;  3MZ5 A;  2NN6 G;  1ENA A;  1CT1 D;  3KBG A;  2F3V A;  2NN6 H;  3N52 A;  1F9S A;  1JCK B;  1F9R A;  4I65 A;  1PTO H;  2EYF A;  2RDG A;  4IFD I;  3I73 A;  3EVQ A;  2NYZ D;  4A3G B;  2B2Y C;  3KBX A;  3DHQ A;  5D65 A;  2RSO A;  4F8M A;  3A8J E;  2L1B A;  3H94 A;  3SVM A;  5K36 H;  4XTC S;  2JEA I;  4FF3 A;  1QIL A;  3GTO B;  2K5W A;  2B2V A;  2K1B A;  1DM0 B;  2EY5 A;  2AQ2 B;  1UNS A;  2R92 B;  3HP3 A;  3L3O C;  3C1E A;  4AYB B;  4K5V A;  1SYC A;  1JIC A;  4P2C B;  1ZXT A;  1ILP A;  2MJ8 A;  4KV6 A;  2LS0 1;  2D2C C;  1PRT C;  1U4P A;  1DCZ A;  3K5L A;  5I9P A;  1E2V A;  2RDF A;  3A8I E;  1SSO A;  2F3W A;  4IFD J;  2WIN B;  4N9P A;  1KAB A;  1V43 A;  3M4Y A;  2EE1 A;  1JOR A;  1AP0 A;  3FDT A;  4PMB A;  3I90 A;  2PMZ B;  2WP8 J;  3IKJ A;  1ESR A;  1CA6 A;  1PTO B;  3Q24 A;  1JOQ A;  2K28 A;  1IL8 A;  1LTG D;  2F0J A;  1U4L A;  1S5D D;  3S17 B;  2QCP X;  3BYT B;  1LAB A;  2VB3 X;  5FK9 C;  3H3V C;  2QDB A;  4K6L A;  2I46 A;  5C4Z A;  3VA5 A;  3JAM L;  4E6I A;  1KTK A;  3RZD B;  4ZYS A;  3SR1 A;  3OWF A;  2MP1 A;  5A35 A;  3BG3 A;  3PIP 3;  4RAU C;  1K8M A;  1AZQ A;  4IFD G;  2RA4 A;  3PUV A;  4C56 C;  1NSN S;  5C0X I;  4IFD H;  1S5E D;  3C1F A;  3BVZ A;  5E1F A;  3R8B A;  2A68 D;  3MVV A;  3K57 A;  3AMU A;  2L11 A;  4XYO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...