4N8X1

The structure of nostoc sp. pcc 7120 ccml
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
99
structure length
99
Chain Sequence
MQIAKVRGTVVSTQKDPSLRGVKLLLLQLVDEEGNLLQKYEVAADNSVGAGFDEWVLISRGSAARQLLGNEQRPVDAAVVAIIDTIHVEDRLIYSKKDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Carbon dioxide concentrating mechanism protein
publication title Interactions and structural variability of beta-carboxysomal shell protein CcmL.
pubmed doi rcsb
source organism Nostoc sp.
total genus 19
structure length 99
sequence length 99
chains with identical sequence 2, 3, 4, A, B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, W, X, Y, Z
ec nomenclature
pdb deposition date 2013-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF03319 EutN_CcmL Ethanolamine utilisation protein EutN/carboxysome
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.220 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) EutN/Ccml 4n8x100
2QW7A 2Z9HA 4JW0A 4N8FA 2RCFA 4N8X1 5L37A 2HD3A 4I7AA 4JVZA
chains in the Genus database with same CATH superfamily
2XIWA 5ELEA 5CV9A 3PF4A 3QOLA 1N36L 1ICFB 1Y8OB 4JI6L 1TWGH 3A0JA 2WFWA 2XRQD 1CUKA 4BY1G 2NN6G 1B7YB 3I4LA 2P5ZX 5BN3A 5IGGA 1HNWQ 2RDGA 4CKEA 5LHY1 1LTID 1STAA 2ZJPA 2PI2A 2RSNA 1K3RA 3T16A 4X3TA 3HOZH 1BOSA 5HGQA 3MFYA 4JBJA 1NUCA 2VS1A 1LTAD 2JN4A 1D8LA 1I50H 4DUZQ 1RJTA 1JR0D 4HMJA 4O42A 4A3FH 1RTNA 2XGTA 3G7LA 2DJGC 1XPRA 3CHBD 1NJIC 3HOZG 3NWTA 3RZOH 3GTPB 3QIAA 1QVGA 5LL6S 4K5XA 2SNMA 1D1IA 1I3QH 3HS0C 4A3FG 2OTLA 1PH2A 2CH4W 3VYUA 1EQQA 1TT2A 1WCMB 4WRDA 2GVBA 1YZ6A 3M3YB 2F0LA 4KY5A 2BDNA 2R7FA 3PQIA 1JOQA 4XYOA 3AQQA 3BJUA 1RD9D 1ML0D 1G291 1KAAA 5IGFA 1E24A 1D5ZC 1PXUA 1HFNA 4GLXA 3M4PA 1I6VC 2SDFA 4U673 1TWFH 2M00A 2EVBA 4RGNA 2GA4B 2C5CA 2BOSA 1L1OC 1AE3A 1D2BA 2Q2TA 2KECA 3LWUA 4JI7Q 4QY7A 3NUCA 4L5RC 3H15A 4LWCA 5JEAH 1HZAA 1WTQA 1JJGA 3HEJA 2AKWB 2KHIA 3FPUB 3RD4A 5M3MB 4LFCL 5JPMC 1BQQT 2ZM6Q 3OWFA 4MTNA 1Y8NB 2CW0C 2WACA 2JXMB 1U4RA 1VQ7A 1AZQA 3J7YW 1A3TA 5GQOA 4KTAA 5JEAG 3CMEA 4YWMA 2ENBA 1K8MA 1SNCA 3I4NB 4WJ4A 5IYBH 1KDCA 3S16H 2UUBL 5EPJA 3SDZA 3HOVH 3GTQH 3M4OH 3OMGA 1EFWA 3QB3A 1IHZA 2EYFA 3E6ZX 4OEMB 4KD4A 1SBBB 5K5PA 3G71A 1XPOA 1Y1VB 4A3MH 3S15B 5IYBG 1PVOA 1Y1WH 1STBA 3HOVG 4GLVB 2NZ1D 1SEBD 2ZTCA 3OSOA 2K32A 3DM3A 1YJNA 2VXWA 1UE6A 4A3MG 1E7ZA 4CKCA 2JQOA 1WFQA 1Y1WG 2KJXA 3RLNA 2VL6A 1A0IA 1UAPA 5KNDA 4PG3A 1BR9A 1ZKOA 1JMCA 3NBHA 2Z6KC 4DV3Q 2LXJA 1IZ6A 1SYFA 2HD3A 1QZHA 3FVQA 2OT2A 1A3UA 4YHHL 4XYQA 1GVPA 2EY1A 4DR6L 4H0LC 4KN7C 4C3JH 5JOBA 4PMWA 4RGOS 4GNXA 3KDFB 2N49A 4A3BH 3H3VI 3E5SA 5J22A 3CXCA 2B2WA 1CKNB 1D5MC 2YYZA 3CRKC 4C3JG 5FLXE 1EYAA 4A3BG 3ERQA 1B3QA 1EQTA 4DV0L 3S1RH 2K50A 4DNIA 4O2DA 4JOIA 1BNZA 1XNQQ 3LGJA 4QQBX 4KJOA 4F87A 3GTMH 4JI0Q 2B2VC 1ILPA 4JK1C 3I4MH 5C44B 3CKIB 2WINB 4C3IB 4K6LA 4JI5L 1NAPA 4A3EH 4DR1L 2FMMA 2MUYA 2RHSB 4C3HH 4DGZA 4K8JA 1U0LA 1X54A 5EBDA 3B6YA 1XMOL 1NTGA 2E5LQ 3I4MG 2PCFB 5EKIA 3TP6A 4A3EG 4L5QA 4LF5Q 1AP0A 1FNWA 3X3NA 4G7OC 3K5MA 3KYHC 4C3HG 2F4IA 4KLKA 4CJ1B 5CYUA 5JVH3 1B2TA 5IGDA 1Q90A 1ZYRD 3HOYH 3JAMc 3CW2C 4DXGA 2B2TA 3F2DA 2FJ2A 4DFAA 4TKOB 4Y7NH 4XDXA 2F0PA 2NVQB 4F88A 4JI1Q 1I4GA 2F0TA 2HHHQ 3HOYG 5EGTA 2OWOA 1STGA 2A68D 2OEOA 3QOJA 2R93B 2IT1A 3MXPA 2F0MA 1IYVA 2K5HA 1DJRD 1NY4A 1S4ZA 2PQEA 1QWYA 1EY0A 3GP7A 2G9HD 2I46A 1II3A 1H9KA 4C1NK 3K58A 3JC66 2I5MX 1NBWA 3M7NA 3HZXA 1SNPA 1K3BC 3ONAB 2K5NA 3J81E 5I6WA 2HQEA 4HIOA 2BH8A 1JCKB 1J8IA 1SYDA 1CSPA 3PUWA 3TBIB 2UXCL 3AB9A 1C8CA 4AQYL 3J81i 1BCPD 1DOLA 2VW9A 3EJIA 1I4PA 5IY0A 4LF7Q 1VF5C 3DMUA 4QUCA 1A63A 1ZXTA 1NSNS 2PZTA 4IUQA 1TY2A 1H9SB 4LF9L 2EXZA 2OCEA 1SNQA 3OMCA 3KBXA 1EU4A 3HOXB 5BN4A 1J9OA 1G91A 2LY7A 2L12A 2PZUA 4JI3L 3WWVA 4ABNA 4IURA 3U9OA 3P20A 4CKBA 1QB5D 1I6HB 2UXBQ 3OOCA 1QNUA 3K5NA 1F77A 1S5ED 1PMRA 2ZXRA 3PO3B 4A3DB 1K8OA 3HGBA 3DWPA 4OIKA 4HTHA 5GAGC 1NE3A 4Q5VA 4GKKL 4B3RL 1KIXA 1AFPA 4IPGA 2RVLA 5CV8A 1IYUA 2TMPA 4A3FB 1NNXA 2X6LA 1BBWA 4BBRB 1I94L 1HR0W 3H3VC 1UEBA 2Z6BA 1M1KC 4JI2L 1CQVA 1A8VA 4DUYL 5EBCA 1AH9A 1CT1D 5LMNL 1Z7TA 2Z4IA 3KLSA 2EZVA 2UUCL 2FINB 3I2ZA 4FF4A 3OW7A 3OTOQ 5L37A 3GTPH 2VZAA 4WORA 1EYGA 2XWBB 4QB4A 1MBYA 1WCMH 5C4XB 2HCCA 1PTOB 3KDFA 3M3YH 1GOZA 5DM63 1LLRD 3NK9A 1SE8A 2JA8H 1VMPA 1I4HA 1VQMA 1CSQA 1X3QA 1CKNA 3EROA 3H94A 1PH8A 1WCMG 4A93B 2UUAQ 1STYA 2H4OA 3CCJA 4IUNA 2MO0A 5C5LA 3VA7A 1C7YA 1TVXA 4XTCS 1EIFA 2JA8G 3I70A 4P72A 1F2ZA 1PTOF 1KNEA 2KCNA 4K5VA 4DUZL 2EXDA 1K8GA 4HIDA 4ULLA 1HH2P 1Q8IA 1TS4A 2B3GA 4P74A 1CA6A 3PV0A 5JPNC 1MD2D 2HCIA 4F8MA 1B4OA 2PNRC 2RCNA 1FJGQ 1SMXA 5CV7A 5M3MH 2SNSA 3GTLB 2HUGA 4PMCA 2OQKA 1N34Q 1GUTA 1CHQD 1WVLA 3M4OB 4QIWB 3I4NH 3T56B 4HJ9A 3TRZA 3CC4A 1EFID 4IZ8A 3H0GB 2H1EA 1JJ2A 1GUNA 3MC0B 5M3MG 2K05A 2VQFQ 2KCTA 5EPLA 1VDZA 2BDOA 4LFAQ 4M8AA 4EQ5A 1YBYA 1PDQA 1ENAA 1Y1VH 4POFA 2R3ZA 3I4NG 2TSSA 3G6EA 2OTJA 2IHFA 2ZXOA 5IP7H 3S15H 3NTKA 4ZUIA 5C3XA 4X66Q 1X65A 1PYBA 2AQ1B 1DONA 3G4SA 4JI7L 2L9HA 1VS0A 4G4KA 2KOLA 2F3VA 3A54A 1Y1VG 5IP7G 1K28A 1CZGA 2WP8J 4OWXB 4B3SQ 2A69C 2F0VA 2GN5A 1D7QA 2JK8A 1N32Q 1IKMA 5IWAL 4KY6A 4BY7B 4HCEA 1YJ9A 1HJPA 2OXPA 3EIVA 3V05A 1PRTC 2L15A 2Z1CA 1VQFA 2WAQE 2AMCB 1S72A 3D0FA 1XNRQ 2MFIA 4NXNL 2OF1A 1R4QB 3JAML 3CCUA 1RDPD 1GO3E 2A73B 3KLSX 4LAAA 4JVZA 2NZOA 3NXWA 4KY7A 4RH6A 1Y14B 1JQYD 2L4NA 4IPCA 1H9SA 2K7VA 1BKBA 2QILA 1SNMA 2Q2UA 4JI4L 1T9HA 3ND8A 3PCOB 4LJZC 1KLUD 5IT9c 2N8NA 4CGYB 5AJ3Q 3EA6A 3GTMB 4LF8L 3IRBA 2QDBA 3M4YA 2UU9Q 1TKWB 2ZTEA 3KOJA 3S1NB 4DU9A 3AYHB 4EX5A 2IPKD 1LTSD 5C44H 1EIYB 4UHVA 4C3IH 3U9SA 3RZDB 1KRSA 3NQTA 5BR8L 3S17B 3E0JA 1IW7C 4S3SA 1MJEA 4GOPC 4K0KL 3H91A 3M4QA 3BU2A 1F2YA 5C44G 4HAEA 2H5XA 3R93A 4C3IG 4P73A 2AQ3B 2HQLA 1OXXK 4DV6Q 3C2PA 1JE5A 5AFWA 2F0IA 5IGCA 4DV7L 1M90C 4HSVA 4IJLA 4DV1Q 3T1YQ 1A2UA 2F0DA 1V1OA 3VR6A 4DK6C 2NWGA 1F9QA 4FF3A 1G6ZA 3PIP3 4AH6A 5E1FA 4FF2A 4CDFC 1HNXL 2ATWA 2NVQH 1SFOB 1JB3A 1WTWA 2QF7A 1GUWA 2EJMA 3E3XA 3I8ZA 3QG1A 1ICWA 3I3CA 4DNTB 2E2IB 3OPOA 1IBMQ 3KLWA 3NE5B 2I5HA 3RLFA 2R93H 1G51A 4A75A 2IHEA 1E0BA 4KK7A 3W3AA 3QWNA 4DXFA 4YCVA 3LX0A 5JJLA 4U68A 1OXVA 2Z4HA 2A6HD 2R93G 2Q8IB 4XIGS 1WD0A 4IFDI 1VQJA 4A3KB 1HNZQ 3TEHB 4DR7Q 1HA5A 5COYA 3IL8A 5DNFA 2CVRA 1PH3A 5FOBB 4CBVA 4HN7A 3OIQA 2B2YC 4DV5Q 4HJ7A 1V1QA 4DR5Q 2F0QA 1QJOA 3VR2A 2B2UA 1CKOA 4JI1L 1FNVA 2V4DA 1EY7A 3E9HA 3TDQA 2ASBA 1KC8C 2E2DC 3PIOA 4C2MB 4BWGB 4B3TL 2EYHA 3HOXH 4X62L 1I5FA 4DAPA 2HT1A 1HQMC 4R8NA 1IBLL 4DR4Q 5LMUQ 1ASZA 3J81j 2A19A 4CDCC 1KABA 4G7HC 1I6HH 1F9RA 3W5OA 1QZGA 3DM1A 3HOXG 4NMZA 1VQPA 2SEBD 1CQFA 1V8QA 3MZ5A 3PUVA 3PO3H 2RSOA 4LF4L 2XWJB 4KKSA 3W1BA 1SJED 1SMYC 4A3DH 3QJYA 2F0FA 2PW5A 4IO9A 4LFBQ 3UE1A 4X64Q 4GNXC 5I9PA 2NYZD 1FYCA 1QE6A 5EKKA 5GADC 1VQKA 3PO3G 3FP9A 3L9AX 4BBRH 4A3DG 2DNEA 2CCZA 2F0SA 1L0YB 2ID0A 1Y69U 4OO1H 1GHKA 3E0EA 2N78A 1LUZA 3PIPA 2JEBI 3NELA 1XYIA 2HIVA 3K80C 4BBRG 2R6GA 4WJ3M 4DR3Q 3HOUB 2KEDA 1NMFA 2CQAA 2R92B 2PMZB 4OO1G 3FKIB 1L1OB 3D4RA 3FDTA 1FVIA 4ALPA 5C4XH 1WD1A 2PQAB 2JA8B 1PTOH 2F3WA 3K7UC 2CHBD 5J1ZA 4JYAQ 1RKNA 2ES2A 1WTHA 3RN2A 1UWVA 1LT4D 3IAYA 4PZ8A 1X3EA 2OQ0A 1YJWA 4LF6L 5C4XG 4A93H 4DV2L 3U4ZA 2F4VL 3RMHA 2XTIA 2JA6B 4OONA 2F0UA 1XWEA 1EQRA 5KRUA 1E2VA 3GDEA 4KHPL 2B2TC 4A93G 3V2TA 4K14A 5FO8B 1RL2A 5I2YA 3K0YA 2BE5D 2MHVA 1UE7A 5ELCA 1J5EL 2BA0A 3KBGA 3OTOL 3GTOB 1Q8KA 1Q86C 3P75A 2K5QA 3I7FA 4BBSB 2C35B 3MXUA 4NXMQ 1ESFA 4IUPA 4QUFA 3L2PA 2G5DA 3GTLH 1SDFA 2Q8RE 1YNND 2EYLA 4LNQA 4JI8L 1XTDA 3H0GH 2F1MA 1IBKQ 3U58A 1XMQQ 2F0GA 4RCNA 1B9NA 1PZID 1DGSA 4ME5A 1XJVA 2UUAL 2IX1A 3J7AF 5C4JH 3Q23A 1MKHA 5IT9L 3TZDA 3T13A 1S5FD 3H0GG 4OIJA 4GN4B 3KK7A 4OWTB 3CCMA 3DHQA 3NPPA 4MZ9A 1KHIA 1LABA 1BO0A 4X3UA 1FD7D 4TQUS 4N8X1 2FFKB 5JVG3 1ZEQX 4FP5D 4J15A 3SHLA 3KJOA 1MSGA 3SK5A 4X3SA 2SOBA 4HIKA 2JEAI 3VYTA 3TP8A 2PNHA 3DLLA 2EYPA 1W2BA 4BY7H 4OL7A 3GTGB 1N9WA 3SR1A 1KXLA 2DNCA 4CHTB 3NQIA 1N34L 1YHBA 2LKVA 5GAHC 2KA7A 4R1JA 4J1MA 4OX9L 1L0WA 1FL0A 3S24A 2UXDQ 3BS1A 2EPBA 1QVCA 4RCOA 1ENFA 4NW2A 4DV4L 4BY7G 1KL9A 2K5DA 1SAPA 2PW7A 1HR0L 1HRJA 2K01A 3CRLC 3I56A 1EY4A 2NN6I 2R7DA 1LV9A 1S5CD 2RKSA 5K36H 2K33A 3J80L 5F2DA 4FF1A 2A74C 3T1HQ 4K6DA 2A1AA 4HJ8A 1TS2A 3JAME 2ZTDA 5J39A 2N55A 5K36G 1A6XA 1OTCA 2PMZE 3JAMi 1BDOA 1D1KA 2IL8A 4HMIA 3S1NH 3S2DB 5C0XH 2IY5B 1EIHA 1OXUA 1U4PA 5A2QL 1W6KA 3CD6A 1N33Q 1HTPA 4B3ML 4CJ2C 3RZDH 1EWIA 1QUQB 3S17H 2CFMA 3T4AC 1I4QA 1XNRL 3ZJYC 5E4WC 5C0XG 2DN8A 3DEPA 1STNA 1LM0A 3RUZA 1E1TA 1LTLA 3MXNB 3K7AB 2AWNA 1SJHD 3VDYA 3QO2A 4EVOA 4K8IA 2A6ED 4EGVA 1EOVA 4FXKC 1YIJA 4X65L 4RKBA 1HUMA 1SSOA 5FLXc 5HY6A 1SFOH 1TU2B 1CM9A 1L1OA 2KHSA 3M9BA 2JA7B 1AEXA 3NSWA 3STBD 4GN3B 1YHQA 2CWAA 4IPDA 2PQAA 2E2IH 3W1GA 1PFMA 1T5XD 4DR2L 2WV6D 2KENA 4MNOA 3BVMA 4X6AH 3NBIA 1ZYRC 4HEDA 2YTYA 2D2CC 1GJXA 1DXMA 5I4DA 3CPWA 1JORA 2QKIC 2D9UA 2E74C 1O78A 3HKZE 1SR3A 4A3KH 5JJIA 3KF6B 4H02A 2JA9A 4DV6L 1VQBA 3EVQA 1N36Q 1TIID 1QILA 2I07B 4JI6Q 3KF8B 1EIGA 2AQ2B 4DN4M 1F2MA 4A3IB 4IUUA 3CC7A 1M4VA 4QJFA 4HJ5A 1KD1C 5C0XJ 4A3KG 3PO2B 4MIUA 1TWHB 3SEBA 3CC2A 3G6JB 3I91A 1X56A 1TS3A 2EYMA 3KUPA 1Q3LA 1TWAB 4KN4C 2NB0A 1BVSA 4AYBE 1JICA 1KDAA 4C2MH 2WB1E 1X3GA 4PNYA 1LTTD 3FMCA 3UDXA 4EQOA 4F7XA 2ALYB 2K28A 1JT8A 1BCPC 3M85A 2E2JB 4GKJL 1HFGA 3R2IA 2QEJC 2G9DA 4R9WA 4IALA 3BDOA 3Q6SA 1HZBA 2D5DA 2WAQB 2ZJQA 4IPHA 3PSIA 4WFN3 2NTSA 3AFQA 3CAMA 1BXTA 4ZUJA 1TS5A 2CWPA 4B9XA 2Z8LA 2VNUD 4DR5L 1JB7A 1QVFA 3SGIA 1JWMD 1NMGA 1X3PA 4FXDA 1MHWC 2MP1A 3SE0A 5CR3A 4XT1B 4YCUA 2YTVA 2JYOA 1E1OA 3TP5A 1VQCA 3VR4A 1YITA 4GS3A 4PZ7A 2D62A 3T51B 5CV4A 1HUNA 1SYBA 4H13C 3HOUH 3NTIA 4KHZA 3ULPA 3FKIH 2R92H 2K52A 3H09A 5KEEA 2B2VA 5CC4A 3TZUA 2VB3X 1F9PA 5T1GA 2BA1A 1EY8A 1D6EC 3VA5A 1YI2A 1HNWL 3HOUG 1UE1A 4LFCQ 1PTOD 4IQZA 3K57A 5D3IB 3FKIG 2R92G 4YIJA 2PO4A 2O5JC 4FVMA 4P2CB 1JWUD 3A7AB 3GO5A 1EWHA 3S1MB 2JA6H 1GXDC 5C0XI 5DAUA 2EDGA 1DD2A 4QF4A 3EFXD 2UUBQ 4KHVA 1U9RA 5GAEC 1J6QA 2J4XA 3DEOA 2JJQA 5ISRA 3G48A 3RNUA 4E6IA 4R4CA 2JA6G 3R3OA 4LK1C 4KKUA 1QUQA 1OO9B 3SVMA 3GTOH 1P8LA 4BBSH 1B70B 3OIPA 2IX3A 4DA2A 2BH2A 3MXNA 2JA5B 2EYJA 3NWSA 4JYAL 4TSSA 5C4JB 4BBSG 4LW1A 1STEA 2L1BA 3CCEA 1HCZA 2XN9C 2Y0SE 1EWCA 5KNBA 4RAUC 1DCZA 2LMCB 1I4XA 4YHHQ 1GUGA 1C0AA 1GUSA 4I65A 4DR6Q 1PRTB 1V1PB 3ITPA 4HIMA 5KNCA 4ME3A 3FHWA 1TWCB 3A8JE 3HKZG 3RR5A 5EJWA 4Y52H 3PGZA 2B8FA 2EQSA 3OYYA 4GN5A 1KRTA 3OHXC 5IT9E 2ZM6L 1XPUA 3D31A 5IIFA 2L55A 3DWAA 2R61A 4UP8A 3A8IE 4L5TA 1PRTF 1WTXA 3KF6A 2AUJD 3GTGH 1H9MA 2B63B 1XXGA 1OXSC 4J6HA 3ERSX 5E7NA 2Z9HA 1PH5A 3BDCA 1CHPD 1CI3M 3K0XA 3KF8A 1VQNA 3D4DA 3F1ZA 2AWOA 5ELBA 4JI5Q 5HGTA 4DR1Q 4R4QA 1X55A 1R9TB 3NHHA 5ELNA 1O7IA 1VF7A 2NVTB 1XMOQ 3TMEA 1B8AA 4L5SA 3PIO3 3CU7A 4N8FA 1YHAA 1PH1A 1QCBD 4IOAA 3A5UA 4GOPB 1PFBA 5FJ8H 4C56C 4UAIA 3K5OA 4LUVA 2X69A 4XT3B 1WTPA 2PPBC 4HCSA 4P71A 1ASYA 4DV3L 1IW7D 3S2DH 3WOFA 2C9OA 5FJ8G 5EPKA 3J80E 4TRDA 2K04A 3R2TA 4K2KA 5C3WA 1EOTA 4ODGA 1VMCA 3I90A 1YNJD 3MWYW 1V43A 3J80i 3N52A 4DAMA 3SK4A 1ET9A 5M5XB 4PV1C 4YCWA 5FO7B 1Q82C 2YU9B 2NVXB 3OWEB 4KV6A 5IP9H 2FMCA 1EZ6A 1ONLA 4YWLA 1KNAA 1W6JA 5M3FB 1HPCA 1E3PA 1B1ZA 3K7AH 5A2QE 4ZYSA 1ENCA 5IP9G 4A4IA 1B3AA 1X9NA 1VQAA 4K2LA 5ELDA 3Q8DA 4DKAC 1EL0A 1TR5A 1AN8A 4FXGC 4KD3A 1CK1A 4AQYQ 1M8AA 4FNFA 3K5LA 1XNQL 3PMFA 5KIXA 4N9TA 3IFTA 2KCCA 4JI0L 4M1UB 2JA7H 2Q8TA 3BVGA 1RODA 5FKAC 3MXGA 1V9PA 2YV5A 1PHJA 1VQ9A 4RHRA 1PYSB 5FLMH 1N33L 3CCQA 3MEFA 4LF9Q 2E5LL 2JA7G 4KJNA 5H1SE 4HR7B 1I4RA 1LTRD 1VQIA 3EQLC 3CF5A 2IW3A 4LUZA 5IYCH 4LF5L 3UDGA 4JI3Q 5C4ZA 5FLMG 2EOTA 4L8JA 4AIMA 2EYOA 2BCOA 1PA6A 1K0RA 3SK8A 1MJCA 1XX8A 5IYCG 3C1EA 2ICEC 4A3IH 2F0OA 5IGEA 3GV3A 5IE8A 2HHHL 3PO2H 3VYRA 1TWHH 2LXKA 1N8RC 5IGBA 1VQGA 5LL6X 4C1NI 3GTKB 3ZYYX 5A35A 4GKKQ 1TWAH 2A8VA 2QEXA 1IL2A 1PYWD 4A3IG 1U4LA 5D3DA 1EQVA 2PI2E 1LTGD 2A5HA 4UDUC 3PO2G 1I94Q 3S14H 1KDBA 4L63B 5ELOA 5NUCA 4MTKA 4LUOA 1YVCA 1SYCA 4HSPA 4JI2Q 1AZPA 2E2JH 3S1QB 4DUYQ 2WKCA 3PUZA 4ZRZA 5LMNQ 3H3VH 3D6CA 4NKLA 2UUCQ 3R8BA 2GVAA 1YNXA 3WOEA 1HZ9A 2R7ZH 1WI5A 3GTJB 3U50C 4KKTA 1V1PA 3I73A 4OGQC 1LYLA 1MIUA 4IOCA 1SYGA 1PH7A 1S5DD 2B39A 1GD7A 1WTVA 3WDNA 1O7YA 4DK0A 4LF7L 2J0TD 4IJHA 2FXQA 2R7ZG 3LWEA 2WAQG 2B2WC 4TVAB 3K8AA 2F03A 1LACA 2VUMB 1E2WA 1LT6D 2B29A 4JOIC 3UI2A 3L3OC 5EAYA 1DOMA 3CQZB 2UXBL 2LFNA 3T53B 3HP3A 4I7ZC 3GV6A 4N9PA 4YY3Q 4A76A 4UPAA 4RKLA 1QG7A 1NR2A 1K8AC 1O7LA 4RG1A 4GOPA 3A55A 2KEEA 1JOOA 3DWQA 3GD7A 1JWSD 5M5YB 3C46A 3S1MH 2KCMA 4BA2I 1ILQA 3F2CA 2DY8A 2K5WA 2I0QA 3A56A 2CW0D 3H6MA 3I55A 3TS0A 1EZ8A 4RGMA 1C4QA 1VQ4A 1Q12A 2MQHA 1PH9A 4A3GB 4PQXA 1SNOA 4O0AA 1PFSA 5CBAE 3OW2A 5CV6A 2ZJRA 3K81C 2DGYA 3CPFA 1DOKA 1K83B 2RBMA 1BUVT 4GZYC 3N6RA 1VQLA 3UE0A 3VR3A 2RQXA 3TS2A 2JA5H 3BZDB 1JC7A 3HKSA 1A2TA 2QCPX 1EUJA 2QA4A 5M5WH 5IWAQ 1UE5A 1TY0A 2BE5C 3HKZB 4JBMA 1CTMA 4ZK9B 4I7AA 3HOWB 1RCVD 3NP8A 3K59A 2JA5G 3K6OA 1EU3A 4NXNQ 1GKHA 4G57A 1AE2A 1YNNC 3A7LA 2B2YA 1MGSA 1B9MA 4A3JH 2E8GA 1VQDA 1TWCH 3CCVA 1FJGL 4AYBB 4JI4Q 2CKZB 2WB1B 2KHJA 5KGUA 4IUTA 2MNAA 2EJFC 3IKJA 3PF5A 4A3JG 4LF8Q 3Q0AA 4UP9A 2B63H 2XVSA 2VQFL 1EEID 4LFAL 4QGUA 4DNRB 4A3CH 2VQEQ 1SLJA 2LSSA 1DYQA 2F0JA 4ID6A 4JBKA 1R9TH 3BG3A 3HRZC 2B63G 4X66L 3PUXA 1G6PA 5BR8Q 3J7ZC 5D65A 2NVTH 2KQ3A 3QR8A 4K0KQ 1G8ZD 3BYTB 4A3CG 1SRUA 1S3OA 4NPSA 2E2HB 4UY8C 5M9OA 4P75A 2NVYB 4B3SL 4R8IA 1EYDA 2ICIA 5JEAJ 4DV7Q 1ESRA 2JE6I 1C48A 2MJ8A 2XSCA 1FGUA 1AW7A 2J7ZA 5C3EB 1N32L 2IX0A 1VQ8A 1KQSA 1XTCD 2K03A 4CDEC 5JJKA 3TQYA 5JJZA 1HNXQ 1LT3D 4RWSC 5GROA 3ULJA 4JPBW 2F0EA 4BS9A 3FEWX 4OWWB 3TP7A 1B53A 2HDLA 2KBNA 4OO1I 3GQBA 3VYSA 5M5XH 4EQNA 2O5IC 1Q46A 5DEHA 2YU9H 2NVXH 3I72A 1X6OA 2E75C 2MO1A 3MFGA 2O2LD 5M3FH 1FGBD 4K5WA 2XNAC 2K5VA 4H44C 2EY6A 4CDDC 1ET6A 2NUCA 5AJ3L 4G7ZC 1IYJB 3HG9A 1QNKA 5CMDA 1PH6A 4Q0FA 5M3FG 2UU9L 2WIIB 4RA8A 3C3LA 2CH4A 1UEAB 4BXXH 1VQEA 4OHJA 4JV5Q 1HTLD 4DAVA 4DAYB 5CGKA 2FHTA 3J7AV 2AHOB 2A6EC 4B3TQ 1C9OA 3S2HB 2IJ0A 1K0SA 2WKDA 4X62Q 1LO5D 4BXXG 2K4KA 4ZKCB 4XQJA 2A68C 1IBLQ 5KYIA 2D0PA 3STBC 2JP1A 5E4XA 4DV1L 3T1YL 1VQ6A 2IWHA 1BCPB 2Y0SB 4XQNA 3ND9A 3AU7A 4V190 1PH4A 1LTBD 2QDLA 4B9WA 4QCLA 1EY6A 4LF4Q 2YTXA 4YWKA 3DXJC 2RHQB 1IBML 4NDXA 3ULLA 2QGQA 3A8KE 3GTKH 3NENA 5FO9B 4HJAA 3S14B 2EE1A 1CKMA 1RHPA 2XRSD 5I6YA 1BCPF 3I4OA 1BF4A 4MN3A 1BBUA 1PZJD 1KLGD 1K73C 3S1QH 4FO2A 5D14A 1PLFA 2Z6KA 3D6WA 3C1FA 4GLAC 2R7ZB 4BY1B 3BZCA 1HNZL 2VY3A 3SXHA 3J81c 4DR7L 1D5XC 4L6TB 3GTJH 2VB2X 1L2FA 1TWGB 4RGTA 3X3MA 3CCSA 4DV5L 4IN3A 1VQHA 3BVZA 3AFPA 2HDMA 1EY9A 2B8GA 1WYDA 3P1HA 4DF7A 4LF6Q 2K6AA 2PYKA 4UP7A 4DV2Q 5CV5A 2F4VQ 5E3FA 2VUMH 2L0CA 3MHBA 3CCRA 3HOZB 1Q1EA 3KJPA 1CZWA 3PUYA 4DR4L 1I50B 2RDHA 3F2BA 1SNDA 3CP0A 5LMUL 1SE3A 1GUOA 3CQZH 2LS01 1Z9FA 4KHPQ 3V96A 1IXRA 2F52A 2VUMG 3M7GA 3F8TA 1P16A 2KUMA 3RZOB 1SN8A 2AUKA 3L0OA 1I3QB 1J5EQ 2MPMA 5EKLA 3UDIA 1YEZA 4LFBL 1RF2D 3A74A 1Q7YC 4X64L 2D0OA 3ER0A 5IODA 4ZLTF 2F3IA 1NR4A 1TXYA 5M5YH 3IFDA 2DJFC 4BA1I 1IKLA 4JI8Q 1KAWA 5C6AA 1U5KA 2X6GA 1SROA 1TWFB 1E2ZA 2F0WA 4IUVA 1HHVA 3E9IA 4DR3L 1W3SA 3O13A 1PTOC 4A3GH 4PZ6A 2K1BA 3KLRA 3AMUA 3D3RA 3DUZA 5JAVA 4IFDH 5T1IA 3EBEA 1K83H 1QOHA 2RCFA 1B44D 5J3BA 4YY3L 4A3GG 5C4HA 3W2DA 5M5WB 1PZKD 2V1CC 1SE2A 4IFDG 1SXTA 2M2LA 1A15A 3FRPB 3S16B 3HOVB 1B50A 3FPPA 4JBWA 4EQPA 3GTQB 3BZKA 3HOWH 1OXTA 4OX9Q 2ZXPA 4DK3C 2A69D 1EY5A 1HA6A 1F2LA 3BYYB 2M9VA 4A3JB 4DV4Q 4A3MB 5CBEE 2B2UC 1T5EA 1HR0Q 2RF4A 4FDBA 1Y1WB 2PZWA 1UNSA 5DLQE 2Z0SA 5CORA 1Q1BA 1PRTD 3RLOA 2Q2IA 3HOWG 3TSSA 4DAYA 4X3KA 3MAQA 1WOCA 3Q22A 4ZAIA 1CA5A 4NXML 5ELFA 3EN2A 4DV0Q 5I9OA 2EJGC 4QMGA 4ZQ3A 5KYLA 5FK9C 1G2TA 1Q81C 1LT5D 1IBKL 1XMQL 5TSSA 4AYBG 2NZHA 3J7A5 1H9JA 1CFMA 2WB1G 3TREA 1TQOA 3AEVA 1Y8PB 4MHEA 1G2SA 4R4OA 3RN5A 5FLXL 4B3MQ 1EYCA 1PV4A 2O4XA 2Q2HA 2MGSA 4C3JB 4NB3A 4ZKBB 4XQQA 4B08A 4A3BB 1SYEA 1RIPA 4DK1A 3KFUA 3HFZB 1Z6HA 4ILWA 3TN2A 2E2HH 4IFDJ 4RHSA 3VR5A 2NVYH 4JCVE 3UDFA 2HIXA 4KI0A 5C3EH 4A3LH 1O7ZA 4LMQD 3A5ZB 3S1RB 4X65Q 1VQ5A 3NEMA 2ZT9C 2EY5A 1JOKA 1PFNA 1GHJA 1WTRA 2JSOA 3I4MB 2UXDL 3BDLA 2I5LX 4V0BA 2NBFA 2RA4A 1MI2A 5C3EG 4A3LG 4A3EB 1Z47A 4DR2Q 4R4IA 2VQEL 4PMBA 5HURA 4C3HB 4DPGA 1A62A 2KVMA 5LMNW 1SE4A 2QW7A 2RDFA 5DM73 4NP5A 1GM5A 3LNNA 4ZCKA 3T1HL 3U4VA 4POGA 3ICEA 4FYDA 2UXCQ 1MSHA 4OELB 4JC0A 5EQ0A 1VCIA 3HOYB 1WJJA 1R4PB 1YNJC 1FR3A 2NTTA 1F9SA 1IL8A 3CMAA 1H95A 1BBXC 1DM0B 1JE4A 1H9RA 1FNUA 5I2XA 4Y7NB 1E22A 4KMUC 2F0KA 1U4MA 1HZCA 4R4TA 4J8QA 3J81L 2DUDA 4APVA 3J80c 3L7ZC 2E76C 2F0NA 2EIFA 2CQOA 1K9MC 2K75A 4CJ0B 3S2HH 2K14A 3NTHA 3D4WA 4Z9CB 1WTOA 1HXYD 5G3LD 4QIWE 1STHA 1A3VA 1S5BD 4GKJQ 1X32A 3S9WA 2F0HA 3SK6A 4JG2A 1HQRD 3NBHB 1JJCB 5G3LF 1NCVA 2EY2A 3MTSA 1VQOA 2A6HC 1L0XB 3D8GA 5IYDH 1X3FA 3MEHA 3URYA 4XXEA 4B3RQ 3MA2B 5BN5A 2L11A 4H7BA 2Y0SG 4WJWA 4RFBA 4GNXB 4QL5A 3MVVA 3F2UA 4OXPA 4RMFA 4O1NA 1S40A 1KTKA 5IYDG 1O80A 2N88A 4JV5L 3CCLA 1SMYD 4JW0A 3Q24A 2DY7A 5IOCA 1DZ1A 2L5TA 1RTOA 3P7JA 5C5MA 1UUPA 4BY1H 2NN6H 1EEFD 2N3SA
chains in the Genus database with same CATH topology
2QW7A 2Z9HA 4JW0A 4N8FA 2RCFA 4N8X1 5L37A 2HD3A 4I7AA 4JVZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QW7 A;  2Z9H A;  4JW0 A;  4N8F A;  2RCF A;  4N8X 1;  5L37 A;  2HD3 A;  4I7A A;  4JVZ A; 
#chains in the Genus database with same CATH topology
 2XIW A;  5ELE A;  5CV9 A;  3PF4 A;  3QOL A;  1N36 L;  1ICF B;  1Y8O B;  4JI6 L;  1TWG H;  3A0J A;  2WFW A;  2XRQ D;  1CUK A;  4BY1 G;  2NN6 G;  1B7Y B;  3I4L A;  2P5Z X;  5BN3 A;  5IGG A;  1HNW Q;  2RDG A;  4CKE A;  5LHY 1;  1LTI D;  1STA A;  2ZJP A;  2PI2 A;  2RSN A;  1K3R A;  3T16 A;  4X3T A;  3HOZ H;  1BOS A;  5HGQ A;  3MFY A;  4JBJ A;  1NUC A;  2VS1 A;  1LTA D;  2JN4 A;  1D8L A;  1I50 H;  4DUZ Q;  1RJT A;  1JR0 D;  4HMJ A;  4O42 A;  4A3F H;  1RTN A;  2XGT A;  3G7L A;  2DJG C;  1XPR A;  3CHB D;  1NJI C;  3HOZ G;  3NWT A;  3RZO H;  3GTP B;  3QIA A;  1QVG A;  5LL6 S;  4K5X A;  2SNM A;  1D1I A;  1I3Q H;  3HS0 C;  4A3F G;  2OTL A;  1PH2 A;  2CH4 W;  3VYU A;  1EQQ A;  1TT2 A;  1WCM B;  4WRD A;  2GVB A;  1YZ6 A;  3M3Y B;  2F0L A;  4KY5 A;  2BDN A;  2R7F A;  3PQI A;  1JOQ A;  4XYO A;  3AQQ A;  3BJU A;  1RD9 D;  1ML0 D;  1G29 1;  1KAA A;  5IGF A;  1E24 A;  1D5Z C;  1PXU A;  1HFN A;  4GLX A;  3M4P A;  1I6V C;  2SDF A;  4U67 3;  1TWF H;  2M00 A;  2EVB A;  4RGN A;  2GA4 B;  2C5C A;  2BOS A;  1L1O C;  1AE3 A;  1D2B A;  2Q2T A;  2KEC A;  3LWU A;  4JI7 Q;  4QY7 A;  3NUC A;  4L5R C;  3H15 A;  4LWC A;  5JEA H;  1HZA A;  1WTQ A;  1JJG A;  3HEJ A;  2AKW B;  2KHI A;  3FPU B;  3RD4 A;  5M3M B;  4LFC L;  5JPM C;  1BQQ T;  2ZM6 Q;  3OWF A;  4MTN A;  1Y8N B;  2CW0 C;  2WAC A;  2JXM B;  1U4R A;  1VQ7 A;  1AZQ A;  3J7Y W;  1A3T A;  5GQO A;  4KTA A;  5JEA G;  3CME A;  4YWM A;  2ENB A;  1K8M A;  1SNC A;  3I4N B;  4WJ4 A;  5IYB H;  1KDC A;  3S16 H;  2UUB L;  5EPJ A;  3SDZ A;  3HOV H;  3GTQ H;  3M4O H;  3OMG A;  1EFW A;  3QB3 A;  1IHZ A;  2EYF A;  3E6Z X;  4OEM B;  4KD4 A;  1SBB B;  5K5P A;  3G71 A;  1XPO A;  1Y1V B;  4A3M H;  3S15 B;  5IYB G;  1PVO A;  1Y1W H;  1STB A;  3HOV G;  4GLV B;  2NZ1 D;  1SEB D;  2ZTC A;  3OSO A;  2K32 A;  3DM3 A;  1YJN A;  2VXW A;  1UE6 A;  4A3M G;  1E7Z A;  4CKC A;  2JQO A;  1WFQ A;  1Y1W G;  2KJX A;  3RLN A;  2VL6 A;  1A0I A;  1UAP A;  5KND A;  4PG3 A;  1BR9 A;  1ZKO A;  1JMC A;  3NBH A;  2Z6K C;  4DV3 Q;  2LXJ A;  1IZ6 A;  1SYF A;  2HD3 A;  1QZH A;  3FVQ A;  2OT2 A;  1A3U A;  4YHH L;  4XYQ A;  1GVP A;  2EY1 A;  4DR6 L;  4H0L C;  4KN7 C;  4C3J H;  5JOB A;  4PMW A;  4RGO S;  4GNX A;  3KDF B;  2N49 A;  4A3B H;  3H3V I;  3E5S A;  5J22 A;  3CXC A;  2B2W A;  1CKN B;  1D5M C;  2YYZ A;  3CRK C;  4C3J G;  5FLX E;  1EYA A;  4A3B G;  3ERQ A;  1B3Q A;  1EQT A;  4DV0 L;  3S1R H;  2K50 A;  4DNI A;  4O2D A;  4JOI A;  1BNZ A;  1XNQ Q;  3LGJ A;  4QQB X;  4KJO A;  4F87 A;  3GTM H;  4JI0 Q;  2B2V C;  1ILP A;  4JK1 C;  3I4M H;  5C44 B;  3CKI B;  2WIN B;  4C3I B;  4K6L A;  4JI5 L;  1NAP A;  4A3E H;  4DR1 L;  2FMM A;  2MUY A;  2RHS B;  4C3H H;  4DGZ A;  4K8J A;  1U0L A;  1X54 A;  5EBD A;  3B6Y A;  1XMO L;  1NTG A;  2E5L Q;  3I4M G;  2PCF B;  5EKI A;  3TP6 A;  4A3E G;  4L5Q A;  4LF5 Q;  1AP0 A;  1FNW A;  3X3N A;  4G7O C;  3K5M A;  3KYH C;  4C3H G;  2F4I A;  4KLK A;  4CJ1 B;  5CYU A;  5JVH 3;  1B2T A;  5IGD A;  1Q90 A;  1ZYR D;  3HOY H;  3JAM c;  3CW2 C;  4DXG A;  2B2T A;  3F2D A;  2FJ2 A;  4DFA A;  4TKO B;  4Y7N H;  4XDX A;  2F0P A;  2NVQ B;  4F88 A;  4JI1 Q;  1I4G A;  2F0T A;  2HHH Q;  3HOY G;  5EGT A;  2OWO A;  1STG A;  2A68 D;  2OEO A;  3QOJ A;  2R93 B;  2IT1 A;  3MXP A;  2F0M A;  1IYV A;  2K5H A;  1DJR D;  1NY4 A;  1S4Z A;  2PQE A;  1QWY A;  1EY0 A;  3GP7 A;  2G9H D;  2I46 A;  1II3 A;  1H9K A;  4C1N K;  3K58 A;  3JC6 6;  2I5M X;  1NBW A;  3M7N A;  3HZX A;  1SNP A;  1K3B C;  3ONA B;  2K5N A;  3J81 E;  5I6W A;  2HQE A;  4HIO A;  2BH8 A;  1JCK B;  1J8I A;  1SYD A;  1CSP A;  3PUW A;  3TBI B;  2UXC L;  3AB9 A;  1C8C A;  4AQY L;  3J81 i;  1BCP D;  1DOL A;  2VW9 A;  3EJI A;  1I4P A;  5IY0 A;  4LF7 Q;  1VF5 C;  3DMU A;  4QUC A;  1A63 A;  1ZXT A;  1NSN S;  2PZT A;  4IUQ A;  1TY2 A;  1H9S B;  4LF9 L;  2EXZ A;  2OCE A;  1SNQ A;  3OMC A;  3KBX A;  1EU4 A;  3HOX B;  5BN4 A;  1J9O A;  1G91 A;  2LY7 A;  2L12 A;  2PZU A;  4JI3 L;  3WWV A;  4ABN A;  4IUR A;  3U9O A;  3P20 A;  4CKB A;  1QB5 D;  1I6H B;  2UXB Q;  3OOC A;  1QNU A;  3K5N A;  1F77 A;  1S5E D;  1PMR A;  2ZXR A;  3PO3 B;  4A3D B;  1K8O A;  3HGB A;  3DWP A;  4OIK A;  4HTH A;  5GAG C;  1NE3 A;  4Q5V A;  4GKK L;  4B3R L;  1KIX A;  1AFP A;  4IPG A;  2RVL A;  5CV8 A;  1IYU A;  2TMP A;  4A3F B;  1NNX A;  2X6L A;  1BBW A;  4BBR B;  1I94 L;  1HR0 W;  3H3V C;  1UEB A;  2Z6B A;  1M1K C;  4JI2 L;  1CQV A;  1A8V A;  4DUY L;  5EBC A;  1AH9 A;  1CT1 D;  5LMN L;  1Z7T A;  2Z4I A;  3KLS A;  2EZV A;  2UUC L;  2FIN B;  3I2Z A;  4FF4 A;  3OW7 A;  3OTO Q;  5L37 A;  3GTP H;  2VZA A;  4WOR A;  1EYG A;  2XWB B;  4QB4 A;  1MBY A;  1WCM H;  5C4X B;  2HCC A;  1PTO B;  3KDF A;  3M3Y H;  1GOZ A;  5DM6 3;  1LLR D;  3NK9 A;  1SE8 A;  2JA8 H;  1VMP A;  1I4H A;  1VQM A;  1CSQ A;  1X3Q A;  1CKN A;  3ERO A;  3H94 A;  1PH8 A;  1WCM G;  4A93 B;  2UUA Q;  1STY A;  2H4O A;  3CCJ A;  4IUN A;  2MO0 A;  5C5L A;  3VA7 A;  1C7Y A;  1TVX A;  4XTC S;  1EIF A;  2JA8 G;  3I70 A;  4P72 A;  1F2Z A;  1PTO F;  1KNE A;  2KCN A;  4K5V A;  4DUZ L;  2EXD A;  1K8G A;  4HID A;  4ULL A;  1HH2 P;  1Q8I A;  1TS4 A;  2B3G A;  4P74 A;  1CA6 A;  3PV0 A;  5JPN C;  1MD2 D;  2HCI A;  4F8M A;  1B4O A;  2PNR C;  2RCN A;  1FJG Q;  1SMX A;  5CV7 A;  5M3M H;  2SNS A;  3GTL B;  2HUG A;  4PMC A;  2OQK A;  1N34 Q;  1GUT A;  1CHQ D;  1WVL A;  3M4O B;  4QIW B;  3I4N H;  3T56 B;  4HJ9 A;  3TRZ A;  3CC4 A;  1EFI D;  4IZ8 A;  3H0G B;  2H1E A;  1JJ2 A;  1GUN A;  3MC0 B;  5M3M G;  2K05 A;  2VQF Q;  2KCT A;  5EPL A;  1VDZ A;  2BDO A;  4LFA Q;  4M8A A;  4EQ5 A;  1YBY A;  1PDQ A;  1ENA A;  1Y1V H;  4POF A;  2R3Z A;  3I4N G;  2TSS A;  3G6E A;  2OTJ A;  2IHF A;  2ZXO A;  5IP7 H;  3S15 H;  3NTK A;  4ZUI A;  5C3X A;  4X66 Q;  1X65 A;  1PYB A;  2AQ1 B;  1DON A;  3G4S A;  4JI7 L;  2L9H A;  1VS0 A;  4G4K A;  2KOL A;  2F3V A;  3A54 A;  1Y1V G;  5IP7 G;  1K28 A;  1CZG A;  2WP8 J;  4OWX B;  4B3S Q;  2A69 C;  2F0V A;  2GN5 A;  1D7Q A;  2JK8 A;  1N32 Q;  1IKM A;  5IWA L;  4KY6 A;  4BY7 B;  4HCE A;  1YJ9 A;  1HJP A;  2OXP A;  3EIV A;  3V05 A;  1PRT C;  2L15 A;  2Z1C A;  1VQF A;  2WAQ E;  2AMC B;  1S72 A;  3D0F A;  1XNR Q;  2MFI A;  4NXN L;  2OF1 A;  1R4Q B;  3JAM L;  3CCU A;  1RDP D;  1GO3 E;  2A73 B;  3KLS X;  4LAA A;  4JVZ A;  2NZO A;  3NXW A;  4KY7 A;  4RH6 A;  1Y14 B;  1JQY D;  2L4N A;  4IPC A;  1H9S A;  2K7V A;  1BKB A;  2QIL A;  1SNM A;  2Q2U A;  4JI4 L;  1T9H A;  3ND8 A;  3PCO B;  4LJZ C;  1KLU D;  5IT9 c;  2N8N A;  4CGY B;  5AJ3 Q;  3EA6 A;  3GTM B;  4LF8 L;  3IRB A;  2QDB A;  3M4Y A;  2UU9 Q;  1TKW B;  2ZTE A;  3KOJ A;  3S1N B;  4DU9 A;  3AYH B;  4EX5 A;  2IPK D;  1LTS D;  5C44 H;  1EIY B;  4UHV A;  4C3I H;  3U9S A;  3RZD B;  1KRS A;  3NQT A;  5BR8 L;  3S17 B;  3E0J A;  1IW7 C;  4S3S A;  1MJE A;  4GOP C;  4K0K L;  3H91 A;  3M4Q A;  3BU2 A;  1F2Y A;  5C44 G;  4HAE A;  2H5X A;  3R93 A;  4C3I G;  4P73 A;  2AQ3 B;  2HQL A;  1OXX K;  4DV6 Q;  3C2P A;  1JE5 A;  5AFW A;  2F0I A;  5IGC A;  4DV7 L;  1M90 C;  4HSV A;  4IJL A;  4DV1 Q;  3T1Y Q;  1A2U A;  2F0D A;  1V1O A;  3VR6 A;  4DK6 C;  2NWG A;  1F9Q A;  4FF3 A;  1G6Z A;  3PIP 3;  4AH6 A;  5E1F A;  4FF2 A;  4CDF C;  1HNX L;  2ATW A;  2NVQ H;  1SFO B;  1JB3 A;  1WTW A;  2QF7 A;  1GUW A;  2EJM A;  3E3X A;  3I8Z A;  3QG1 A;  1ICW A;  3I3C A;  4DNT B;  2E2I B;  3OPO A;  1IBM Q;  3KLW A;  3NE5 B;  2I5H A;  3RLF A;  2R93 H;  1G51 A;  4A75 A;  2IHE A;  1E0B A;  4KK7 A;  3W3A A;  3QWN A;  4DXF A;  4YCV A;  3LX0 A;  5JJL A;  4U68 A;  1OXV A;  2Z4H A;  2A6H D;  2R93 G;  2Q8I B;  4XIG S;  1WD0 A;  4IFD I;  1VQJ A;  4A3K B;  1HNZ Q;  3TEH B;  4DR7 Q;  1HA5 A;  5COY A;  3IL8 A;  5DNF A;  2CVR A;  1PH3 A;  5FOB B;  4CBV A;  4HN7 A;  3OIQ A;  2B2Y C;  4DV5 Q;  4HJ7 A;  1V1Q A;  4DR5 Q;  2F0Q A;  1QJO A;  3VR2 A;  2B2U A;  1CKO A;  4JI1 L;  1FNV A;  2V4D A;  1EY7 A;  3E9H A;  3TDQ A;  2ASB A;  1KC8 C;  2E2D C;  3PIO A;  4C2M B;  4BWG B;  4B3T L;  2EYH A;  3HOX H;  4X62 L;  1I5F A;  4DAP A;  2HT1 A;  1HQM C;  4R8N A;  1IBL L;  4DR4 Q;  5LMU Q;  1ASZ A;  3J81 j;  2A19 A;  4CDC C;  1KAB A;  4G7H C;  1I6H H;  1F9R A;  3W5O A;  1QZG A;  3DM1 A;  3HOX G;  4NMZ A;  1VQP A;  2SEB D;  1CQF A;  1V8Q A;  3MZ5 A;  3PUV A;  3PO3 H;  2RSO A;  4LF4 L;  2XWJ B;  4KKS A;  3W1B A;  1SJE D;  1SMY C;  4A3D H;  3QJY A;  2F0F A;  2PW5 A;  4IO9 A;  4LFB Q;  3UE1 A;  4X64 Q;  4GNX C;  5I9P A;  2NYZ D;  1FYC A;  1QE6 A;  5EKK A;  5GAD C;  1VQK A;  3PO3 G;  3FP9 A;  3L9A X;  4BBR H;  4A3D G;  2DNE A;  2CCZ A;  2F0S A;  1L0Y B;  2ID0 A;  1Y69 U;  4OO1 H;  1GHK A;  3E0E A;  2N78 A;  1LUZ A;  3PIP A;  2JEB I;  3NEL A;  1XYI A;  2HIV A;  3K80 C;  4BBR G;  2R6G A;  4WJ3 M;  4DR3 Q;  3HOU B;  2KED A;  1NMF A;  2CQA A;  2R92 B;  2PMZ B;  4OO1 G;  3FKI B;  1L1O B;  3D4R A;  3FDT A;  1FVI A;  4ALP A;  5C4X H;  1WD1 A;  2PQA B;  2JA8 B;  1PTO H;  2F3W A;  3K7U C;  2CHB D;  5J1Z A;  4JYA Q;  1RKN A;  2ES2 A;  1WTH A;  3RN2 A;  1UWV A;  1LT4 D;  3IAY A;  4PZ8 A;  1X3E A;  2OQ0 A;  1YJW A;  4LF6 L;  5C4X G;  4A93 H;  4DV2 L;  3U4Z A;  2F4V L;  3RMH A;  2XTI A;  2JA6 B;  4OON A;  2F0U A;  1XWE A;  1EQR A;  5KRU A;  1E2V A;  3GDE A;  4KHP L;  2B2T C;  4A93 G;  3V2T A;  4K14 A;  5FO8 B;  1RL2 A;  5I2Y A;  3K0Y A;  2BE5 D;  2MHV A;  1UE7 A;  5ELC A;  1J5E L;  2BA0 A;  3KBG A;  3OTO L;  3GTO B;  1Q8K A;  1Q86 C;  3P75 A;  2K5Q A;  3I7F A;  4BBS B;  2C35 B;  3MXU A;  4NXM Q;  1ESF A;  4IUP A;  4QUF A;  3L2P A;  2G5D A;  3GTL H;  1SDF A;  2Q8R E;  1YNN D;  2EYL A;  4LNQ A;  4JI8 L;  1XTD A;  3H0G H;  2F1M A;  1IBK Q;  3U58 A;  1XMQ Q;  2F0G A;  4RCN A;  1B9N A;  1PZI D;  1DGS A;  4ME5 A;  1XJV A;  2UUA L;  2IX1 A;  3J7A F;  5C4J H;  3Q23 A;  1MKH A;  5IT9 L;  3TZD A;  3T13 A;  1S5F D;  3H0G G;  4OIJ A;  4GN4 B;  3KK7 A;  4OWT B;  3CCM A;  3DHQ A;  3NPP A;  4MZ9 A;  1KHI A;  1LAB A;  1BO0 A;  4X3U A;  1FD7 D;  4TQU S;  4N8X 1;  2FFK B;  5JVG 3;  1ZEQ X;  4FP5 D;  4J15 A;  3SHL A;  3KJO A;  1MSG A;  3SK5 A;  4X3S A;  2SOB A;  4HIK A;  2JEA I;  3VYT A;  3TP8 A;  2PNH A;  3DLL A;  2EYP A;  1W2B A;  4BY7 H;  4OL7 A;  3GTG B;  1N9W A;  3SR1 A;  1KXL A;  2DNC A;  4CHT B;  3NQI A;  1N34 L;  1YHB A;  2LKV A;  5GAH C;  2KA7 A;  4R1J A;  4J1M A;  4OX9 L;  1L0W A;  1FL0 A;  3S24 A;  2UXD Q;  3BS1 A;  2EPB A;  1QVC A;  4RCO A;  1ENF A;  4NW2 A;  4DV4 L;  4BY7 G;  1KL9 A;  2K5D A;  1SAP A;  2PW7 A;  1HR0 L;  1HRJ A;  2K01 A;  3CRL C;  3I56 A;  1EY4 A;  2NN6 I;  2R7D A;  1LV9 A;  1S5C D;  2RKS A;  5K36 H;  2K33 A;  3J80 L;  5F2D A;  4FF1 A;  2A74 C;  3T1H Q;  4K6D A;  2A1A A;  4HJ8 A;  1TS2 A;  3JAM E;  2ZTD A;  5J39 A;  2N55 A;  5K36 G;  1A6X A;  1OTC A;  2PMZ E;  3JAM i;  1BDO A;  1D1K A;  2IL8 A;  4HMI A;  3S1N H;  3S2D B;  5C0X H;  2IY5 B;  1EIH A;  1OXU A;  1U4P A;  5A2Q L;  1W6K A;  3CD6 A;  1N33 Q;  1HTP A;  4B3M L;  4CJ2 C;  3RZD H;  1EWI A;  1QUQ B;  3S17 H;  2CFM A;  3T4A C;  1I4Q A;  1XNR L;  3ZJY C;  5E4W C;  5C0X G;  2DN8 A;  3DEP A;  1STN A;  1LM0 A;  3RUZ A;  1E1T A;  1LTL A;  3MXN B;  3K7A B;  2AWN A;  1SJH D;  3VDY A;  3QO2 A;  4EVO A;  4K8I A;  2A6E D;  4EGV A;  1EOV A;  4FXK C;  1YIJ A;  4X65 L;  4RKB A;  1HUM A;  1SSO A;  5FLX c;  5HY6 A;  1SFO H;  1TU2 B;  1CM9 A;  1L1O A;  2KHS A;  3M9B A;  2JA7 B;  1AEX A;  3NSW A;  3STB D;  4GN3 B;  1YHQ A;  2CWA A;  4IPD A;  2PQA A;  2E2I H;  3W1G A;  1PFM A;  1T5X D;  4DR2 L;  2WV6 D;  2KEN A;  4MNO A;  3BVM A;  4X6A H;  3NBI A;  1ZYR C;  4HED A;  2YTY A;  2D2C C;  1GJX A;  1DXM A;  5I4D A;  3CPW A;  1JOR A;  2QKI C;  2D9U A;  2E74 C;  1O78 A;  3HKZ E;  1SR3 A;  4A3K H;  5JJI A;  3KF6 B;  4H02 A;  2JA9 A;  4DV6 L;  1VQB A;  3EVQ A;  1N36 Q;  1TII D;  1QIL A;  2I07 B;  4JI6 Q;  3KF8 B;  1EIG A;  2AQ2 B;  4DN4 M;  1F2M A;  4A3I B;  4IUU A;  3CC7 A;  1M4V A;  4QJF A;  4HJ5 A;  1KD1 C;  5C0X J;  4A3K G;  3PO2 B;  4MIU A;  1TWH B;  3SEB A;  3CC2 A;  3G6J B;  3I91 A;  1X56 A;  1TS3 A;  2EYM A;  3KUP A;  1Q3L A;  1TWA B;  4KN4 C;  2NB0 A;  1BVS A;  4AYB E;  1JIC A;  1KDA A;  4C2M H;  2WB1 E;  1X3G A;  4PNY A;  1LTT D;  3FMC A;  3UDX A;  4EQO A;  4F7X A;  2ALY B;  2K28 A;  1JT8 A;  1BCP C;  3M85 A;  2E2J B;  4GKJ L;  1HFG A;  3R2I A;  2QEJ C;  2G9D A;  4R9W A;  4IAL A;  3BDO A;  3Q6S A;  1HZB A;  2D5D A;  2WAQ B;  2ZJQ A;  4IPH A;  3PSI A;  4WFN 3;  2NTS A;  3AFQ A;  3CAM A;  1BXT A;  4ZUJ A;  1TS5 A;  2CWP A;  4B9X A;  2Z8L A;  2VNU D;  4DR5 L;  1JB7 A;  1QVF A;  3SGI A;  1JWM D;  1NMG A;  1X3P A;  4FXD A;  1MHW C;  2MP1 A;  3SE0 A;  5CR3 A;  4XT1 B;  4YCU A;  2YTV A;  2JYO A;  1E1O A;  3TP5 A;  1VQC A;  3VR4 A;  1YIT A;  4GS3 A;  4PZ7 A;  2D62 A;  3T51 B;  5CV4 A;  1HUN A;  1SYB A;  4H13 C;  3HOU H;  3NTI A;  4KHZ A;  3ULP A;  3FKI H;  2R92 H;  2K52 A;  3H09 A;  5KEE A;  2B2V A;  5CC4 A;  3TZU A;  2VB3 X;  1F9P A;  5T1G A;  2BA1 A;  1EY8 A;  1D6E C;  3VA5 A;  1YI2 A;  1HNW L;  3HOU G;  1UE1 A;  4LFC Q;  1PTO D;  4IQZ A;  3K57 A;  5D3I B;  3FKI G;  2R92 G;  4YIJ A;  2PO4 A;  2O5J C;  4FVM A;  4P2C B;  1JWU D;  3A7A B;  3GO5 A;  1EWH A;  3S1M B;  2JA6 H;  1GXD C;  5C0X I;  5DAU A;  2EDG A;  1DD2 A;  4QF4 A;  3EFX D;  2UUB Q;  4KHV A;  1U9R A;  5GAE C;  1J6Q A;  2J4X A;  3DEO A;  2JJQ A;  5ISR A;  3G48 A;  3RNU A;  4E6I A;  4R4C A;  2JA6 G;  3R3O A;  4LK1 C;  4KKU A;  1QUQ A;  1OO9 B;  3SVM A;  3GTO H;  1P8L A;  4BBS H;  1B70 B;  3OIP A;  2IX3 A;  4DA2 A;  2BH2 A;  3MXN A;  2JA5 B;  2EYJ A;  3NWS A;  4JYA L;  4TSS A;  5C4J B;  4BBS G;  4LW1 A;  1STE A;  2L1B A;  3CCE A;  1HCZ A;  2XN9 C;  2Y0S E;  1EWC A;  5KNB A;  4RAU C;  1DCZ A;  2LMC B;  1I4X A;  4YHH Q;  1GUG A;  1C0A A;  1GUS A;  4I65 A;  4DR6 Q;  1PRT B;  1V1P B;  3ITP A;  4HIM A;  5KNC A;  4ME3 A;  3FHW A;  1TWC B;  3A8J E;  3HKZ G;  3RR5 A;  5EJW A;  4Y52 H;  3PGZ A;  2B8F A;  2EQS A;  3OYY A;  4GN5 A;  1KRT A;  3OHX C;  5IT9 E;  2ZM6 L;  1XPU A;  3D31 A;  5IIF A;  2L55 A;  3DWA A;  2R61 A;  4UP8 A;  3A8I E;  4L5T A;  1PRT F;  1WTX A;  3KF6 A;  2AUJ D;  3GTG H;  1H9M A;  2B63 B;  1XXG A;  1OXS C;  4J6H A;  3ERS X;  5E7N A;  2Z9H A;  1PH5 A;  3BDC A;  1CHP D;  1CI3 M;  3K0X A;  3KF8 A;  1VQN A;  3D4D A;  3F1Z A;  2AWO A;  5ELB A;  4JI5 Q;  5HGT A;  4DR1 Q;  4R4Q A;  1X55 A;  1R9T B;  3NHH A;  5ELN A;  1O7I A;  1VF7 A;  2NVT B;  1XMO Q;  3TME A;  1B8A A;  4L5S A;  3PIO 3;  3CU7 A;  4N8F A;  1YHA A;  1PH1 A;  1QCB D;  4IOA A;  3A5U A;  4GOP B;  1PFB A;  5FJ8 H;  4C56 C;  4UAI A;  3K5O A;  4LUV A;  2X69 A;  4XT3 B;  1WTP A;  2PPB C;  4HCS A;  4P71 A;  1ASY A;  4DV3 L;  1IW7 D;  3S2D H;  3WOF A;  2C9O A;  5FJ8 G;  5EPK A;  3J80 E;  4TRD A;  2K04 A;  3R2T A;  4K2K A;  5C3W A;  1EOT A;  4ODG A;  1VMC A;  3I90 A;  1YNJ D;  3MWY W;  1V43 A;  3J80 i;  3N52 A;  4DAM A;  3SK4 A;  1ET9 A;  5M5X B;  4PV1 C;  4YCW A;  5FO7 B;  1Q82 C;  2YU9 B;  2NVX B;  3OWE B;  4KV6 A;  5IP9 H;  2FMC A;  1EZ6 A;  1ONL A;  4YWL A;  1KNA A;  1W6J A;  5M3F B;  1HPC A;  1E3P A;  1B1Z A;  3K7A H;  5A2Q E;  4ZYS A;  1ENC A;  5IP9 G;  4A4I A;  1B3A A;  1X9N A;  1VQA A;  4K2L A;  5ELD A;  3Q8D A;  4DKA C;  1EL0 A;  1TR5 A;  1AN8 A;  4FXG C;  4KD3 A;  1CK1 A;  4AQY Q;  1M8A A;  4FNF A;  3K5L A;  1XNQ L;  3PMF A;  5KIX A;  4N9T A;  3IFT A;  2KCC A;  4JI0 L;  4M1U B;  2JA7 H;  2Q8T A;  3BVG A;  1ROD A;  5FKA C;  3MXG A;  1V9P A;  2YV5 A;  1PHJ A;  1VQ9 A;  4RHR A;  1PYS B;  5FLM H;  1N33 L;  3CCQ A;  3MEF A;  4LF9 Q;  2E5L L;  2JA7 G;  4KJN A;  5H1S E;  4HR7 B;  1I4R A;  1LTR D;  1VQI A;  3EQL C;  3CF5 A;  2IW3 A;  4LUZ A;  5IYC H;  4LF5 L;  3UDG A;  4JI3 Q;  5C4Z A;  5FLM G;  2EOT A;  4L8J A;  4AIM A;  2EYO A;  2BCO A;  1PA6 A;  1K0R A;  3SK8 A;  1MJC A;  1XX8 A;  5IYC G;  3C1E A;  2ICE C;  4A3I H;  2F0O A;  5IGE A;  3GV3 A;  5IE8 A;  2HHH L;  3PO2 H;  3VYR A;  1TWH H;  2LXK A;  1N8R C;  5IGB A;  1VQG A;  5LL6 X;  4C1N I;  3GTK B;  3ZYY X;  5A35 A;  4GKK Q;  1TWA H;  2A8V A;  2QEX A;  1IL2 A;  1PYW D;  4A3I G;  1U4L A;  5D3D A;  1EQV A;  2PI2 E;  1LTG D;  2A5H A;  4UDU C;  3PO2 G;  1I94 Q;  3S14 H;  1KDB A;  4L63 B;  5ELO A;  5NUC A;  4MTK A;  4LUO A;  1YVC A;  1SYC A;  4HSP A;  4JI2 Q;  1AZP A;  2E2J H;  3S1Q B;  4DUY Q;  2WKC A;  3PUZ A;  4ZRZ A;  5LMN Q;  3H3V H;  3D6C A;  4NKL A;  2UUC Q;  3R8B A;  2GVA A;  1YNX A;  3WOE A;  1HZ9 A;  2R7Z H;  1WI5 A;  3GTJ B;  3U50 C;  4KKT A;  1V1P A;  3I73 A;  4OGQ C;  1LYL A;  1MIU A;  4IOC A;  1SYG A;  1PH7 A;  1S5D D;  2B39 A;  1GD7 A;  1WTV A;  3WDN A;  1O7Y A;  4DK0 A;  4LF7 L;  2J0T D;  4IJH A;  2FXQ A;  2R7Z G;  3LWE A;  2WAQ G;  2B2W C;  4TVA B;  3K8A A;  2F03 A;  1LAC A;  2VUM B;  1E2W A;  1LT6 D;  2B29 A;  4JOI C;  3UI2 A;  3L3O C;  5EAY A;  1DOM A;  3CQZ B;  2UXB L;  2LFN A;  3T53 B;  3HP3 A;  4I7Z C;  3GV6 A;  4N9P A;  4YY3 Q;  4A76 A;  4UPA A;  4RKL A;  1QG7 A;  1NR2 A;  1K8A C;  1O7L A;  4RG1 A;  4GOP A;  3A55 A;  2KEE A;  1JOO A;  3DWQ A;  3GD7 A;  1JWS D;  5M5Y B;  3C46 A;  3S1M H;  2KCM A;  4BA2 I;  1ILQ A;  3F2C A;  2DY8 A;  2K5W A;  2I0Q A;  3A56 A;  2CW0 D;  3H6M A;  3I55 A;  3TS0 A;  1EZ8 A;  4RGM A;  1C4Q A;  1VQ4 A;  1Q12 A;  2MQH A;  1PH9 A;  4A3G B;  4PQX A;  1SNO A;  4O0A A;  1PFS A;  5CBA E;  3OW2 A;  5CV6 A;  2ZJR A;  3K81 C;  2DGY A;  3CPF A;  1DOK A;  1K83 B;  2RBM A;  1BUV T;  4GZY C;  3N6R A;  1VQL A;  3UE0 A;  3VR3 A;  2RQX A;  3TS2 A;  2JA5 H;  3BZD B;  1JC7 A;  3HKS A;  1A2T A;  2QCP X;  1EUJ A;  2QA4 A;  5M5W H;  5IWA Q;  1UE5 A;  1TY0 A;  2BE5 C;  3HKZ B;  4JBM A;  1CTM A;  4ZK9 B;  4I7A A;  3HOW B;  1RCV D;  3NP8 A;  3K59 A;  2JA5 G;  3K6O A;  1EU3 A;  4NXN Q;  1GKH A;  4G57 A;  1AE2 A;  1YNN C;  3A7L A;  2B2Y A;  1MGS A;  1B9M A;  4A3J H;  2E8G A;  1VQD A;  1TWC H;  3CCV A;  1FJG L;  4AYB B;  4JI4 Q;  2CKZ B;  2WB1 B;  2KHJ A;  5KGU A;  4IUT A;  2MNA A;  2EJF C;  3IKJ A;  3PF5 A;  4A3J G;  4LF8 Q;  3Q0A A;  4UP9 A;  2B63 H;  2XVS A;  2VQF L;  1EEI D;  4LFA L;  4QGU A;  4DNR B;  4A3C H;  2VQE Q;  1SLJ A;  2LSS A;  1DYQ A;  2F0J A;  4ID6 A;  4JBK A;  1R9T H;  3BG3 A;  3HRZ C;  2B63 G;  4X66 L;  3PUX A;  1G6P A;  5BR8 Q;  3J7Z C;  5D65 A;  2NVT H;  2KQ3 A;  3QR8 A;  4K0K Q;  1G8Z D;  3BYT B;  4A3C G;  1SRU A;  1S3O A;  4NPS A;  2E2H B;  4UY8 C;  5M9O A;  4P75 A;  2NVY B;  4B3S L;  4R8I A;  1EYD A;  2ICI A;  5JEA J;  4DV7 Q;  1ESR A;  2JE6 I;  1C48 A;  2MJ8 A;  2XSC A;  1FGU A;  1AW7 A;  2J7Z A;  5C3E B;  1N32 L;  2IX0 A;  1VQ8 A;  1KQS A;  1XTC D;  2K03 A;  4CDE C;  5JJK A;  3TQY A;  5JJZ A;  1HNX Q;  1LT3 D;  4RWS C;  5GRO A;  3ULJ A;  4JPB W;  2F0E A;  4BS9 A;  3FEW X;  4OWW B;  3TP7 A;  1B53 A;  2HDL A;  2KBN A;  4OO1 I;  3GQB A;  3VYS A;  5M5X H;  4EQN A;  2O5I C;  1Q46 A;  5DEH A;  2YU9 H;  2NVX H;  3I72 A;  1X6O A;  2E75 C;  2MO1 A;  3MFG A;  2O2L D;  5M3F H;  1FGB D;  4K5W A;  2XNA C;  2K5V A;  4H44 C;  2EY6 A;  4CDD C;  1ET6 A;  2NUC A;  5AJ3 L;  4G7Z C;  1IYJ B;  3HG9 A;  1QNK A;  5CMD A;  1PH6 A;  4Q0F A;  5M3F G;  2UU9 L;  2WII B;  4RA8 A;  3C3L A;  2CH4 A;  1UEA B;  4BXX H;  1VQE A;  4OHJ A;  4JV5 Q;  1HTL D;  4DAV A;  4DAY B;  5CGK A;  2FHT A;  3J7A V;  2AHO B;  2A6E C;  4B3T Q;  1C9O A;  3S2H B;  2IJ0 A;  1K0S A;  2WKD A;  4X62 Q;  1LO5 D;  4BXX G;  2K4K A;  4ZKC B;  4XQJ A;  2A68 C;  1IBL Q;  5KYI A;  2D0P A;  3STB C;  2JP1 A;  5E4X A;  4DV1 L;  3T1Y L;  1VQ6 A;  2IWH A;  1BCP B;  2Y0S B;  4XQN A;  3ND9 A;  3AU7 A;  4V19 0;  1PH4 A;  1LTB D;  2QDL A;  4B9W A;  4QCL A;  1EY6 A;  4LF4 Q;  2YTX A;  4YWK A;  3DXJ C;  2RHQ B;  1IBM L;  4NDX A;  3ULL A;  2QGQ A;  3A8K E;  3GTK H;  3NEN A;  5FO9 B;  4HJA A;  3S14 B;  2EE1 A;  1CKM A;  1RHP A;  2XRS D;  5I6Y A;  1BCP F;  3I4O A;  1BF4 A;  4MN3 A;  1BBU A;  1PZJ D;  1KLG D;  1K73 C;  3S1Q H;  4FO2 A;  5D14 A;  1PLF A;  2Z6K A;  3D6W A;  3C1F A;  4GLA C;  2R7Z B;  4BY1 B;  3BZC A;  1HNZ L;  2VY3 A;  3SXH A;  3J81 c;  4DR7 L;  1D5X C;  4L6T B;  3GTJ H;  2VB2 X;  1L2F A;  1TWG B;  4RGT A;  3X3M A;  3CCS A;  4DV5 L;  4IN3 A;  1VQH A;  3BVZ A;  3AFP A;  2HDM A;  1EY9 A;  2B8G A;  1WYD A;  3P1H A;  4DF7 A;  4LF6 Q;  2K6A A;  2PYK A;  4UP7 A;  4DV2 Q;  5CV5 A;  2F4V Q;  5E3F A;  2VUM H;  2L0C A;  3MHB A;  3CCR A;  3HOZ B;  1Q1E A;  3KJP A;  1CZW A;  3PUY A;  4DR4 L;  1I50 B;  2RDH A;  3F2B A;  1SND A;  3CP0 A;  5LMU L;  1SE3 A;  1GUO A;  3CQZ H;  2LS0 1;  1Z9F A;  4KHP Q;  3V96 A;  1IXR A;  2F52 A;  2VUM G;  3M7G A;  3F8T A;  1P16 A;  2KUM A;  3RZO B;  1SN8 A;  2AUK A;  3L0O A;  1I3Q B;  1J5E Q;  2MPM A;  5EKL A;  3UDI A;  1YEZ A;  4LFB L;  1RF2 D;  3A74 A;  1Q7Y C;  4X64 L;  2D0O A;  3ER0 A;  5IOD A;  4ZLT F;  2F3I A;  1NR4 A;  1TXY A;  5M5Y H;  3IFD A;  2DJF C;  4BA1 I;  1IKL A;  4JI8 Q;  1KAW A;  5C6A A;  1U5K A;  2X6G A;  1SRO A;  1TWF B;  1E2Z A;  2F0W A;  4IUV A;  1HHV A;  3E9I A;  4DR3 L;  1W3S A;  3O13 A;  1PTO C;  4A3G H;  4PZ6 A;  2K1B A;  3KLR A;  3AMU A;  3D3R A;  3DUZ A;  5JAV A;  4IFD H;  5T1I A;  3EBE A;  1K83 H;  1QOH A;  2RCF A;  1B44 D;  5J3B A;  4YY3 L;  4A3G G;  5C4H A;  3W2D A;  5M5W B;  1PZK D;  2V1C C;  1SE2 A;  4IFD G;  1SXT A;  2M2L A;  1A15 A;  3FRP B;  3S16 B;  3HOV B;  1B50 A;  3FPP A;  4JBW A;  4EQP A;  3GTQ B;  3BZK A;  3HOW H;  1OXT A;  4OX9 Q;  2ZXP A;  4DK3 C;  2A69 D;  1EY5 A;  1HA6 A;  1F2L A;  3BYY B;  2M9V A;  4A3J B;  4DV4 Q;  4A3M B;  5CBE E;  2B2U C;  1T5E A;  1HR0 Q;  2RF4 A;  4FDB A;  1Y1W B;  2PZW A;  1UNS A;  5DLQ E;  2Z0S A;  5COR A;  1Q1B A;  1PRT D;  3RLO A;  2Q2I A;  3HOW G;  3TSS A;  4DAY A;  4X3K A;  3MAQ A;  1WOC A;  3Q22 A;  4ZAI A;  1CA5 A;  4NXM L;  5ELF A;  3EN2 A;  4DV0 Q;  5I9O A;  2EJG C;  4QMG A;  4ZQ3 A;  5KYL A;  5FK9 C;  1G2T A;  1Q81 C;  1LT5 D;  1IBK L;  1XMQ L;  5TSS A;  4AYB G;  2NZH A;  3J7A 5;  1H9J A;  1CFM A;  2WB1 G;  3TRE A;  1TQO A;  3AEV A;  1Y8P B;  4MHE A;  1G2S A;  4R4O A;  3RN5 A;  5FLX L;  4B3M Q;  1EYC A;  1PV4 A;  2O4X A;  2Q2H A;  2MGS A;  4C3J B;  4NB3 A;  4ZKB B;  4XQQ A;  4B08 A;  4A3B B;  1SYE A;  1RIP A;  4DK1 A;  3KFU A;  3HFZ B;  1Z6H A;  4ILW A;  3TN2 A;  2E2H H;  4IFD J;  4RHS A;  3VR5 A;  2NVY H;  4JCV E;  3UDF A;  2HIX A;  4KI0 A;  5C3E H;  4A3L H;  1O7Z A;  4LMQ D;  3A5Z B;  3S1R B;  4X65 Q;  1VQ5 A;  3NEM A;  2ZT9 C;  2EY5 A;  1JOK A;  1PFN A;  1GHJ A;  1WTR A;  2JSO A;  3I4M B;  2UXD L;  3BDL A;  2I5L X;  4V0B A;  2NBF A;  2RA4 A;  1MI2 A;  5C3E G;  4A3L G;  4A3E B;  1Z47 A;  4DR2 Q;  4R4I A;  2VQE L;  4PMB A;  5HUR A;  4C3H B;  4DPG A;  1A62 A;  2KVM A;  5LMN W;  1SE4 A;  2QW7 A;  2RDF A;  5DM7 3;  4NP5 A;  1GM5 A;  3LNN A;  4ZCK A;  3T1H L;  3U4V A;  4POG A;  3ICE A;  4FYD A;  2UXC Q;  1MSH A;  4OEL B;  4JC0 A;  5EQ0 A;  1VCI A;  3HOY B;  1WJJ A;  1R4P B;  1YNJ C;  1FR3 A;  2NTT A;  1F9S A;  1IL8 A;  3CMA A;  1H95 A;  1BBX C;  1DM0 B;  1JE4 A;  1H9R A;  1FNU A;  5I2X A;  4Y7N B;  1E22 A;  4KMU C;  2F0K A;  1U4M A;  1HZC A;  4R4T A;  4J8Q A;  3J81 L;  2DUD A;  4APV A;  3J80 c;  3L7Z C;  2E76 C;  2F0N A;  2EIF A;  2CQO A;  1K9M C;  2K75 A;  4CJ0 B;  3S2H H;  2K14 A;  3NTH A;  3D4W A;  4Z9C B;  1WTO A;  1HXY D;  5G3L D;  4QIW E;  1STH A;  1A3V A;  1S5B D;  4GKJ Q;  1X32 A;  3S9W A;  2F0H A;  3SK6 A;  4JG2 A;  1HQR D;  3NBH B;  1JJC B;  5G3L F;  1NCV A;  2EY2 A;  3MTS A;  1VQO A;  2A6H C;  1L0X B;  3D8G A;  5IYD H;  1X3F A;  3MEH A;  3URY A;  4XXE A;  4B3R Q;  3MA2 B;  5BN5 A;  2L11 A;  4H7B A;  2Y0S G;  4WJW A;  4RFB A;  4GNX B;  4QL5 A;  3MVV A;  3F2U A;  4OXP A;  4RMF A;  4O1N A;  1S40 A;  1KTK A;  5IYD G;  1O80 A;  2N88 A;  4JV5 L;  3CCL A;  1SMY D;  4JW0 A;  3Q24 A;  2DY7 A;  5IOC A;  1DZ1 A;  2L5T A;  1RTO A;  3P7J A;  5C5M A;  1UUP A;  4BY1 H;  2NN6 H;  1EEF D;  2N3S A; 
#chains in the Genus database with same CATH homology
 2QW7 A;  2Z9H A;  4JW0 A;  4N8F A;  2RCF A;  4N8X 1;  5L37 A;  2HD3 A;  4I7A A;  4JVZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...