5I9OA

Crystal structure of staphylococcal nuclease variant delta+phs l36k l103k at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRKLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEAKVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS L36K L103K at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 35
structure length 129
sequence length 129
chains with identical sequence B
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5i9oA00
4F7XA 5CGKA 2F0QA 4K2KA 3PMFA 5CV7A 3RUZA 3OSOA 4DGZA 4HTHA 2PYKA 4LAAA 4ODGA 3MEHA 5C3WA 1SNCA 2O4XA 2PZUA 4KD4A 5KYIA 2KHSA 1EZ6A 4KY5A 3DMUA 1EYCA 3V2TA 5IIFA 3SR1A 3C1EA 4KTAA 2F0UA 4RKLA 1EYDA 4NP5A 2PW5A 2F3VA 3NQTA 4J1MA 4KJOA 4WRDA 5CV9A 1A3VA 1SYFA 5E1FA 4S3SA 3TP7A 1TT2A 1ENCA 5C6AA 5I6WA 3TP8A 5IGGA 5JOBA 5KYLA 4B9WA 1KDCA 5CV4A 5IGEA 1A2UA 2F0IA 3VA5A 3D8GA 4N9PA 4NKLA 2EYJA 1NSNS 3BDCA 5DEHA 5C5LA 4EQNA 5JAVA 5KGUA 1JOOA 1EY7A 2RBMA 2F0HA 1KAAA 2OF1A 3TP6A 1SNOA 5J39A 4ME5A 3NXWA 4QMGA 1EY6A 1A3TA 1KDBA 1JOKA 1F2YA 3MHBA 3NHHA 4MIUA 2F0PA 3QB3A 5CV6A 5I9PA 4I65A 2PZWA 1STHA 3ITPA 4KY6A 2F0NA 2RDFA 4K14A 3OMGA 4PNYA 3NUCA 5IODA 5J22A 2F0TA 3EROA 1SNQA 5CR3A 4N9TA 5E3FA 4PMBA 2F3WA 4IALA 2F0SA 1EY9A 4R8NA 5M9OA 1NUCA 4NMZA 4KV6A 1A2TA 4H7BA 4ID6A 2EYOA 2OEOA 5HURA 4G57A 4HMIA 4QF4A 1STGA 2F0LA 3BDLA 3SK4A 2PQEA 4KD3A 5KEEA 3NK9A 4J6HA 2EYLA 3R3OA 1STAA 3T16A 5IGDA 5IGBA 3OWFA 1SYCA 1U9RA 2F0KA 2EY6A 2RKSA 4KJNA 4E6IA 2QDBA 5KRUA 1JORA 4K5WA 3TMEA 1ENAA 3D6CA 5EKLA 4ZUJA 5NUCA 2EYFA 3LX0A 4OL7A 4DFAA 2PZTA 3SXHA 5CC4A 5IGFA 3SK5A 5EKKA 3SK6A 4KHVA 3HEJA 4K6DA 3C1FA 4PMCA 4DU9A 5C3XA 3DHQA 1EY4A 1STNA 1EZ8A 3SK8A 4F8MA 5HGTA 2M00A 3EJIA 4K8IA 3NP8A 1F2MA 1EY5A 3U9OA 4EQOA 2SNSA 3D4WA 1TR5A 4IZ8A 5CV5A 4B9XA 1STBA 1STYA 1KABA 2PW7A 5DAUA 5I6YA 2F0JA 1EYAA 2SOBA 4IUNA 2F0WA 5ISRA 5C4ZA 2EYHA 2EY5A 2LKVA 5CV8A 3HZXA 1JOQA 4K5XA 1SYGA 3EVQA 2EXZA 4K8JA 2EY1A 5EGTA 4YIJA 5C4HA 2KQ3A 3P75A 4K2LA 5IGCA 1A3UA 3MVVA 3E5SA 3S9WA 3MZ5A 2WACA 1TQOA 5C5MA 3P1HA 1EY8A 2F0MA 4EVOA 4KY7A 1IHZA 4QB4A 4ZQ3A 2ENBA 4NDXA 4EQPA 3MXPA 2F0OA 5IOCA 1II3A 3QOJA 4DF7A 1SYBA 1SNPA 2OXPA 2F0GA 2SNMA 3SHLA 5F2DA 2F0FA 5I9OA 2F0VA 4ZUIA 1F2ZA 2F0EA 1KDAA 2EYPA 4HMJA 2EYMA 1SNDA 3ERQA 4RKBA 1RKNA 2HQEA 1SYDA 2EY2A 4WORA 5J1ZA 3T13A 3D4DA 2F0DA 1AEXA 4TRDA 5KIXA 5K5PA 1SNMA 1EQVA 3OMCA 4K5VA 3TP5A 3QOLA 1SYEA 2NUCA 3H6MA 1EY0A
chains in the Genus database with same CATH superfamily
1CUKA 3PV0A 3Q24A 2L15A 3I4MG 4DV2Q 1WTHA 3N52A 1WJJA 3JC66 2ICIA 1OXTA 2B8GA 4C3IH 5IE8A 2K75A 2JSOA 2UUCQ 1A2UA 1QUQA 4N9PA 1LT3D 1JE4A 4B3ML 2CWPA 4L5SA 1PH6A 2RBMA 2YTXA 3ERSX 5KNDA 3E9IA 2ZM6L 1SNOA 1B53A 2RCNA 2OQKA 3CPWA 3TREA 1K3RA 1STHA 3KDFA 3I4MH 4K14A 4O0AA 3P20A 1O7LA 4CJ2C 1ML0D 2B2VA 4AYBE 1K8GA 4RMFA 3JAMc 5M3FB 1EUJA 1PFMA 1B9NA 4PQXA 1XMOL 1I6HB 5ELEA 2F0LA 2LXJA 1IBKQ 4AQYQ 3RLNA 3PF5A 4A3LG 1DOLA 5KEEA 1X55A 1ESFA 2UUBQ 4GS3A 1I4GA 5M3MG 1PRTD 3H09A 4BBSG 3DWPA 4R1JA 4RWSC 2CQAA 1ENAA 3HOZG 3S1RB 3RZDB 2K6AA 3LX0A 1HZBA 1UUPA 3ND8A 2IL8A 2WB1G 3H15A 1GUGA 3I70A 5IWAQ 3CCEA 3FPPA 5EBCA 2QDLA 3D4WA 5EKIA 1PH3A 1DZ1A 5IP9G 3GP7A 4A3LH 1JOQA 4H02A 4GKKL 5M3MH 4UDUC 1LTID 1GUNA 3J81E 2EPBA 3WOFA 4JVZA 1ENFA 3HOZH 1A3UA 5JPMC 1O7YA 2VQEQ 3LNNA 4HIKA 4N8X1 3BZCA 1HR0L 3J7YW 2F4IA 2B2VC 4LF8Q 4JI4L 3I56A 4NXML 3SHLA 2F1MA 2KJXA 3H91A 1DOKA 4ZUIA 1F2ZA 2MNAA 1LT5D 1CQFA 1T5XD 1KNAA 1GHKA 5IP9H 1GUWA 2HIXA 1TWHB 2WP8J 1DOMA 1LYLA 5CV7A 2UUAL 1WTPA 1PRTC 2L55A 2MO0A 1KIXA 4UAIA 1CTMA 3H94A 1XPOA 1EYDA 4L5QA 1HNWL 3SEBA 5KYLA 1G6PA 2MFIA 3TP8A 1B70B 3F2UA 1K28A 1QB5D 2HHHL 3HOVG 5C5LA 2N49A 3M4OB 4JI5Q 4CDDC 1KLUD 2VB2X 3RMHA 4UP7A 5FJ8H 3MHBA 3QB3A 5EPLA 2RDHA 4JOIC 5DLQE 1S40A 3PIOA 3MFYA 1SNQA 1VF5C 1QVGA 4HJ5A 1IKMA 2ZTDA 1WCMB 4A3DB 3X3NA 2B63H 4LF6Q 1DGSA 4QF4A 1X9NA 3URYA 1NAPA 4A93G 1L1OA 1VQ5A 3NK9A 2VQFQ 3G48A 4DAYA 5IGDA 2IHFA 3OW2A 2JA7H 1T5EA 3TBIB 1MBYA 2EY6A 3LWUA 5KRUA 3I4NH 4RHSA 5C0XG 2HDLA 3M4YA 5NUCA 3S14B 1HHVA 3SK6A 2AQ3B 1NMFA 5C3EB 3FMCA 1ILPA 2CHBD 3C2PA 3TS2A 3DWAA 1H9SB 1B50A 3EJIA 1LUZA 1V1PB 3GTJH 4C56C 4FDBA 1PH5A 5L37A 4IZ8A 1TR5A 2ZXOA 1I3QH 3HRZC 2L9HA 1D7QA 4A93H 2UXCL 2YU9H 1LLRD 2LFNA 4KI0A 2JA5B 1P8LA 4QIWE 3QJYA 4RGOS 4NPSA 2AQ1B 2VS1A 1O80A 1VCIA 2E2HH 1KHIA 2N3SA 1YJNA 2UU9Q 4JBWA 4NDXA 3BYTB 1VQ4A 1BBUA 1BOSA 1N8RC 1E1TA 2GVAA 5C4XG 1L1OC 2Q8TA 1RKNA 3J7AV 3W1GA 1AEXA 4TRDA 1VQOA 4A3GG 2BA0A 2JK8A 2H1EA 3QOLA 2ICEC 4MN3A 4MTNA 1EY0A 4F7XA 1EFWA 5D65A 2VUMG 1IYVA 3A74A 5EJWA 2ATWA 2EJFC 1SNCA 3NBHB 4YWLA 2NN6H 4B3TQ 1I94L 2JP1A 3J81j 3CRKC 2G9DA 5K5PA 2A6HC 2UXDQ 5JOBA 2RCFA 5JAVA 1UE5A 3BDCA 1AP0A 4RH6A 1K8AC 4A3GH 1TXYA 2OF1A 3TP6A 1PDQA 4CKCA 4M1UB 4DR1Q 3S1MB 2KEDA 4KKSA 4I65A 2VUMH 2PI2E 3ITPA 4KY6A 4LFAQ 1IZ6A 3R93A 4J8QA 1EY9A 1B3AA 1WD1A 1Q1EA 3MWYW 2I0QA 2EYOA 2JXMB 3DLLA 1RTNA 3KYHC 4KHPL 1I6VC 4TKOB 4X3SA 1WTQA 1OTCA 1CA6A 4FNFA 4X62Q 3T16A 2EYLA 2ZT9C 2FINB 2I5LX 3CXCA 4E6IA 1Y8OB 1ILQA 2XIWA 3CCVA 5LMNL 4C3JG 1HFNA 2IWHA 2I46A 2WKDA 3A55A 4KN7C 1IBML 3T53B 1E2WA 4BY7G 1EY4A 4JI1L 4BBSB 4A3FB 2CCZA 4DR4Q 3NP8A 3OIQA 3T1YQ 2PMZE 2BE5D 2XTIA 1D1IA 3GTLH 2DN8A 3GTKH 2EY5A 1PLFA 5CV8A 1SYGA 2EXZA 2QW7A 3IL8A 3HKSA 1XYIA 4K2LA 1GUTA 3BJUA 2A5HA 1BCPF 2WINB 1TWFB 2N55A 1II3A 4PV1C 3UDXA 4BY7H 1YNJD 1CM9A 2YTYA 4A4IA 3OTOQ 2D2CC 3S16B 1NTGA 3S1NH 2F0EA 3DEOA 3G6JB 3GV6A 4JBKA 1IL8A 4JI3L 4HAEA 4HSVA 1E1OA 2SEBD 2O5IC 1VQEA 5AFWA 1E3PA 2F0QA 1BDOA 4HTHA 4FVMA 4RCOA 1EWCA 3PUWA 5IYBG 1SDFA 1XPRA 1PYBA 3PUVA 5H1SE 1XTCD 3DXJC 1DM0B 4QUFA 1A8VA 5FLXL 1PH1A 4J1MA 4HSPA 4DNIA 2KECA 2H4OA 2K5VA 5IGEA 3GTPB 4P72A 4B3RL 4JYAQ 5BN4A 4LF9L 3RZOH 3Q0AA 2BE5C 2E2DC 2JA9A 2WB1E 2R93B 2P5ZX 2IW3A 5CV6A 3MAQA 2F0TA 5E3FA 2L1BA 3Q6SA 4JI0Q 3I55A 3AB9A 1XNQQ 3S2DH 3MXUA 3ULPA 1JCKB 4I7ZC 1H9SA 2NVYB 2QKIC 1G51A 2GN5A 1V1PA 3VR6A 1YNJC 2JA8G 3R3OA 2B29A 4GKJL 2NTTA 4ALPA 3VDYA 1K9MC 4HEDA 1LO5D 4LUZA 3V96A 5CORA 1JJ2A 4DV4Q 1LTRD 2M9VA 5M3FG 1J9OA 4BY1G 4OO1G 4TQUS 1TWCB 2PI2A 1NE3A 1PH8A 2X69A 1TVXA 1YITA 3PQIA 1KXLA 1Z9FA 3P7JA 3QO2A 3CC2A 3MEFA 3G4SA 2F0JA 5TSSA 1GJXA 3AFQA 3CP0A 5C4ZA 1MIUA 4ZKBB 3J81L 3H3VI 1S5FD 3HZXA 4ZCKA 2RHSB 4YIJA 1ICWA 1TWAB 3P75A 4OX9L 1QNKA 1RD9D 1E7ZA 2Q2IA 1TKWB 1AZPA 5M3FH 3AEVA 1S3OA 4ZQ3A 2KOLA 1I6HH 1AFPA 4R8IA 4JG2A 2NN6I 4PMWA 1NY4A 5LL6S 1MHWC 4DV1Q 4HJ7A 3NBHA 4POFA 4OEMB 1WOCA 2F0VA 4ZRZA 3S17H 3HOUB 1JT8A 1U4LA 4DR2Q 1IYUA 1VQ6A 3VR5A 3AYHB 1W3SA 5I2YA 1NJIC 4JI7L 4KD4A 4JI6L 5C4XB 4IOAA 4JV5Q 1STEA 3H0GG 4KK7A 2XRQD 1KLGD 1U4RA 5D14A 5FLXc 3TP7A 4A3JG 1HCZA 1ENCA 3D6WA 1ASYA 2R6GA 1PA6A 1T9HA 1XWEA 4UPAA 5DM63 1D5MC 4OWXB 4LF5Q 2K5WA 1KD1C 4A3CH 1I50B 5J39A 3MXNB 3K5LA 4DV2L 3SGIA 1CKMA 1EU3A 2IX0A 5JEAJ 1BNZA 2K05A 3OMGA 1HNZL 2BA1A 2RVLA 1CFMA 3HOWB 4IALA 1YJWA 2Z9HA 3EIVA 1M1KC 1TWHH 2CWAA 1HQMC 1C0AA 4DV3Q 4FXGC 4EQ5A 2R3ZA 1B7YB 1KAWA 3OWFA 1XTDA 3RNUA 1I4QA 1WCMG 2R7ZH 2A73B 2FFKB 4DXGA 3A5UA 5CC4A 1BUVT 5GQOA 4AIMA 1PTOB 4DV0L 4JI2L 3CCJA 4Y7NB 2NVTH 3SK8A 2Q8IB 1EOVA 4C3JB 3TSSA 3M4OH 3KBXA 4LWCA 2CFMA 3U9OA 4AQYL 4IFDG 3BZDB 3EN2A 3A8JE 1PV4A 1O7IA 2K5QA 5C3EG 3J81c 1AH9A 2EY1A 4FF3A 1U0LA 1EFID 5BR8Q 2HCCA 2XWBB 3R2IA 1WCMH 4A3DH 3GTMB 1MSGA 1LTAD 2KA7A 2F0MA 4WJ4A 5G3LD 4KY7A 4IUTA 4P71A 2ZTCA 1AZQA 2KBNA 4L6TB 3S1QB 2JA5G 2KCNA 4RCNA 3E6ZX 4A76A 4L8JA 1JWMD 1QG7A 2X6GA 3T13A 1XPUA 4DV5Q 3D4DA 1KTKA 3AMUA 2PNHA 3S14H 3NTKA 1SN8A 1VMPA 5C3EH 1JC7A 4CDCC 2A19A 3CMEA 1K0SA 1XNRQ 2IX3A 2KCTA 4GN3B 1VQ8A 5LMUL 2R7FA 4R9WA 1EYCA 1MD2D 2DY8A 3V2TA 1WTWA 3MA2B 2K4KA 2F0UA 4OXPA 1W6JA 3OYYA 1YHAA 1TY2A 3NSWA 3FEWX 4DUYQ 2HD3A 4BBRG 1PRTF 2Z1CA 2JA6B 2A6ED 3NENA 1QJOA 4K0KL 4IURA 1Y8PB 2I5MX 4QMGA 4X65Q 1E0BA 4ME3A 2QCPX 4RFBA 1GD7A 1QE6A 1TIID 2CKZB 3EROA 2BH2A 2K28A 2JJQA 4PMBA 4KV6A 4FF2A 5HURA 1BO0A 3K5MA 4NXNQ 2DY7A 4PZ8A 1MJCA 1FJGQ 1IBLQ 4N8FA 2OCEA 3NTIA 1JB7A 2IHEA 1MKHA 3IFTA 1U4MA 1ESRA 3IFDA 3KFUA 2JA8B 5EKKA 2MQHA 1R9TB 3KK7A 3DHQA 2KHIA 4LF6L 3ULJA 5HGTA 3BG3A 4CBVA 3GV3A 1SFOB 1CZWA 2BDNA 4FP5D 4H44C 4L5RC 4FF1A 3FHWA 3T1HQ 4BY1B 2VQFL 4DKAC 3S1MH 1FNVA 1C48A 5M5YB 2TMPA 2GVBA 2EYHA 3A8IE 4K5XA 2ZJPA 2D62A 4A3FG 5A2QE 2Z0SA 3FPUB 1YVCA 5IGCA 1EIGA 2A6EC 3K57A 1S5CD 2B2YA 1E24A 5E7NA 1K8MA 3OPOA 5HGQA 3KLWA 2G5DA 1HA5A 3UDIA 5FKAC 4HMJA 3F2DA 1R4PB 4DV7L 2Q2UA 4DAPA 1SLJA 1XMQQ 3VYTA 1H9RA 1HR0W 3D8GA 1XX8A 2I5HA 4BBSH 4A3FH 4FO2A 3OSOA 4BWGB 3MXNA 1HFGA 1QILA 4Z9CB 5IIFA 4JOIA 1G2TA 3K5OA 3LGJA 4A3EB 4NP5A 3ND9A 1HZAA 4GNXB 1SJHD 3WDNA 1Y14B 4JBJA 4YHHQ 2FMMA 3H0GB 2NBFA 1FD7D 4NKLA 5FOBB 1GO3E 5KGUA 1KNEA 1JOOA 1B1ZA 2K50A 3RD4A 1EIYB 4Y52H 4WJ3M 2B2TA 1TWFH 4YCVA 1IL2A 4ME5A 4LW1A 2Z6KA 2JYOA 1PTOD 4A3JB 1A3TA 5AJ3Q 1PFNA 3F2BA 3CCUA 3GTOB 2B2YC 1PZID 3S16H 2F0SA 5JPNC 1GHJA 4DR6Q 1M8AA 4H0LC 1VDZA 1A2TA 4ZYSA 4GZYC 2E2IB 2R93G 4KD3A 4IO9A 2RHQB 4R4QA 4B08A 1DYQA 1L0YB 5JVG3 1FNUA 1IYJB 1SMXA 4LFBQ 4DNTB 1PZJD 5IGFA 1YIJA 1LT4D 4DU9A 1LM0A 1PXUA 3TRZA 3GTPH 1Q8KA 4F8MA 4X64Q 1F2MA 5BN3A 2UXBL 4R4CA 1R4QB 2SNSA 4YWKA 4X62L 1STBA 3VA7A 3I72A 3IRBA 1G291 2R93H 4L5TA 3VYUA 5ISRA 3VYRA 2DNEA 1SEBD 2B2TC 4YWMA 1J6QA 4B3MQ 3HOVH 2HUGA 2Z6KC 2LXKA 1VQKA 1PFBA 4P74A 2F4VQ 2ZM6Q 3S9WA 1L2FA 1TQOA 1OXXK 4LFCL 1VQMA 2D9UA 3K7AH 3L2PA 2NVYH 2AWOA 2A6HD 1PTOC 4DF7A 4DAVA 3R8BA 1SNPA 2F0GA 1I4HA 1G8ZD 2EYPA 3Q8DA 3ERQA 1EEID 1XMOQ 4OIKA 3ZYYX 5DNFA 5C0XJ 1TWCH 5T1GA 1TY0A 1DCZA 2AKWB 5ELFA 4S3SA 4B9WA 3PUXA 1CZGA 3BVGA 3K5NA 5C0XH 1CKNB 3IAYA 3HFZB 3KLRA 4PG3A 4DR5L 3HOUG 1OO9B 3OTOL 1NCVA 4XYQA 4CKEA 4KTAA 3VR3A 1KC8C 3UE0A 5IGGA 3JAME 2Z6BA 1D1KA 4EX5A 1TWAH 2E2JH 5IP7G 5DEHA 2JN4A 3VR4A 3L3OC 4DK1A 4DUZL 5JVH3 4GKKQ 1BKBA 2Q2HA 2IX1A 2AQ2B 3D4RA 1VQPA 4DAMA 4BBRB 2F0NA 2RDFA 3HOUH 1HR0Q 3BZKA 1YJ9A 2Q8RE 3TZUA 4JI4Q 1OXSC 3UI2A 3L9AX 3IKJA 5C4XH 3GD7A 2RA4A 1HNXQ 1Y1WB 3ULLA 4DR3L 3HOWG 1JORA 3BU2A 5EAYA 1X3FA 3RN5A 2FHTA 1SR3A 1SE8A 2PZTA 3DM1A 3I4OA 1C8CA 5C3XA 1QZGA 4RAUC 1WTXA 4G7OC 1XNQL 1STNA 4RHRA 1JICA 2Y0SB 1EWIA 1PMRA 1HNWQ 4OGQC 4EQOA 5C4JB 1I50H 3KF8B 5LMNW 1I4RA 4HJ9A 5ELBA 3KJPA 3S2HB 2F0WA 2HHHQ 3AQQA 1JE5A 1V43A 2BOSA 4K8JA 1FGUA 1N34L 3HOWH 1EQRA 2KQ3A 3CCQA 4IOCA 4DXFA 1HRJA 4QQBX 2XRSD 4M8AA 4CKBA 3RLOA 2AWNA 1O78A 1QCBD 1KDAA 3D31A 5ELOA 5J1ZA 4DN4M 1A15A 4GNXA 5KIXA 1PTOH 3U58A 4Y7NH 1SYEA 1CQVA 3H6MA 4LF4L 1W6KA 3S24A 2VL6A 4C3JH 1I4PA 3PIP3 1F77A 1CSPA 4WFN3 3SR1A 2FJ2A 4QUCA 3A7AB 4ZK9B 2MPMA 3SE0A 1SYFA 3OIPA 1BVSA 1JMCA 4JW0A 4IN3A 2UXCQ 1C4QA 1K8OA 2QEXA 1VQDA 2NB0A 2F3IA 1P16A 4JV5L 2B8FA 3NHHA 2F0PA 5A35A 2ZJRA 1BXTA 4LMQD 1N33Q 5T1IA 2JA6G 4P2CB 1ZKOA 3SDZA 4XXEA 1S4ZA 1Y69U 4KHZA 2ZJQA 4DA2A 2GA4B 1JB3A 1WVLA 3SK4A 1D8LA 4AYBG 1BQQT 2RDGA 4GNXC 3W3AA 2QDBA 2EJGC 4K5WA 3TDQA 1LACA 1TU2B 3M3YB 3UE1A 4K6DA 4A75A 4HJAA 1WD0A 5IYBH 2M00A 2JA6H 1AE3A 4OONA 1OXUA 2E8GA 3HS0C 1I94Q 3HKZG 4POGA 1F9PA 1H9MA 4B3SL 3Q22A 2H5XA 1UAPA 4LJZC 3LWEA 2K7VA 4NW2A 5C44G 1F9SA 2Z4HA 5C4HA 3TN2A 5GROA 2RF4A 5GADC 3L7ZC 5C0XI 4YCUA 3KF6B 1CKNA 2DJFC 3EBEA 2KUMA 4C2MB 4P75A 3EQLC 1SYBA 1AW7A 1UE7A 5GAEC 2KCMA 5ELDA 2JEAI 3K0XA 3I8ZA 4KHPQ 4PZ7A 5K36G 3CCMA 5BR8L 2JA8H 3RR5A 1IW7D 2CW0D 2XVSA 4LFBL 1R9TH 3GTQB 3I3CA 2E76C 2NUCA 1DONA 1RCVD 1LTGD 5I2XA 4DR7Q 4LF7L 5LMNQ 4V190 3K7UC 2LS01 3MEHA 1IBMQ 1QVFA 2O4XA 1JQYD 2PZUA 4BY1H 3PO2G 4OO1H 2ZXPA 2L4NA 5M5YH 4JI1Q 2B2WC 3NQTA 4KJOA 1CI3M 3KLSX 5CV4A 2E5LL 2PO4A 2F0IA 4LK1C 2EYJA 4LUOA 3S1RH 4JI8Q 4EQNA 3K6OA 3RZDH 3DM3A 1EWHA 5K36H 5IT9E 1N36Q 1X3QA 1VQJA 4A3KG 4TSSA 4A3EG 1KDBA 4MIUA 3BDOA 4IPHA 3PO3G 3FVQA 3PSIA 4IUQA 2XN9C 5IODA 3KBGA 3MFGA 3KJOA 2JEBI 5M9OA 5EBDA 4ABNA 5E4WC 4X3UA 1X3PA 2EJMA 3I90A 1J5EL 4DUYL 1GKHA 2HIVA 4DV6Q 2AHOB 2R92B 1MSHA 2K5NA 4YY3L 4JI3Q 2NZHA 4GLVB 1NR4A 1Q90A 4A3EH 5G3LF 1PYSB 1LTSD 4HR7B 1VQLA 2PQAB 4CDEC 1IW7C 2CW0C 2KEEA 1UEBA 1YHBA 4X66Q 5BN5A 4L63B 1CA5A 1EZ8A 1LTTD 3H0GH 2AMCB 3CW2C 1C9OA 4J15A 4X6AH 1ZYRD 3PCOB 1Q81C 3KUPA 2VY3A 2UUCL 3GTGB 1KABA 5DAUA 4A3JH 4LNQA 2N88A 3M7NA 5COYA 2A69C 3GTOH 4U673 4B3RQ 4OHJA 4HCSA 3HOYB 3NWSA 3J80i 4RGMA 4LF9Q 1JWSD 2K01A 2R7DA 5JJLA 1Y8NB 1YBYA 1FNWA 1RL2A 2DJGC 3K59A 5C5MA 3A8KE 3FKIB 2E2IH 3MXPA 1KRTA 3WWVA 1CKOA 4EGVA 4CDFC 5F2DA 4U68A 1IBKL 4UP9A 2K04A 2UUBL 4R4OA 5FLMG 4NB3A 4A3IB 4GKJQ 1TS2A 2XNAC 3GQBA 5KNBA 3HP3A 2YTVA 2Z4IA 2KHSA 1EZ6A 1HZ9A 2SDFA 1K83B 3JAML 3W1BA 5IWAL 4IFDJ 1PYWD 2F3VA 2OTJA 2EDGA 3VR2A 4FXDA 2MHVA 1XMQL 4XQQA 2AUJD 4A3MB 4IFDH 1DXMA 3BS1A 1NSNS 3G6EA 1QOHA 1ZYRC 3M4PA 1EY7A 1IXRA 3TZDA 1AN8A 5FLMH 2V4DA 2KENA 1F2YA 1K0RA 3RLFA 5I9PA 2VQEL 4OX9Q 2NZ1D 2C5CA 1Q82C 1FYCA 1YEZA 3I2ZA 3OOCA 5M5XB 4LF8L 1ZEQX 4C1NK 4H7BA 2JA5H 4YHHL 1HPCA 2FMCA 1CHPD 4O2DA 1C7YA 4FYDA 4XT3B 1X32A 1Y1VB 3CF5A 1QVCA 4APVA 4C3HB 1PVOA 1H95A 3X3MA 1FR3A 1LTBD 2RQXA 1GOZA 1I5FA 3ONAB 2F03A 4JI7Q 1D6EC 5EKLA 4GLAC 1Q86C 4JI6Q 1Q7YC 1UE6A 4AYBB 1B3QA 2MJ8A 4ILWA 1Y1WG 1HJPA 4H13C 3KF6A 2WIIB 2D0OA 1TS5A 4FF4A 2PW7A 4QGUA 1HH2P 3J80E 5JJZA 4F87A 4JI5L 4BBRH 4MTKA 1HUMA 1PH9A 4ULLA 3HKZB 3FP9A 3SVMA 3CMAA 2ES2A 2EIFA 2Y0SG 3MVVA 1NBWA 4UP8A 3K8AA 2WACA 4XYOA 5M5WB 1IKLA 4X64L 1IHZA 1Q46A 2ENBA 2QEJC 1HTPA 1K73C 5C44B 5IOCA 1FL0A 1HNZQ 4OO1I 1SBBB 1L0WA 1Y1WH 3OHXC 1V9PA 2SNMA 1SMYD 5FLXE 1K3BC 4WORA 3NQIA 2K5HA 2RSOA 2F0DA 3CC4A 3J7AF 1EQVA 2F4VL 4IQZA 4G7HC 3TP5A 4QCLA 1PTOF 3U9SA 4ZLTF 3PF4A 1QNUA 3RUZA 3PMFA 1MJEA 4DNRB 4TVAB 5C4JH 4DV0Q 4JI2Q 2NWGA 3S2HH 3FRPB 2OT2A 4HN7A 5FO8B 1F2LA 5E1FA 1TT2A 1JWUD 1B44D 1X65A 1SAPA 3PO2B 1RODA 1KQSA 3C3LA 3S17B 2F0HA 1KAAA 2CH4W 2WFWA 1SXTA 3NXWA 1VQ9A 1UE1A 5ELCA 3F8TA 2UU9L 3HOXB 4IPDA 3M7GA 1D5XC 2PZWA 3HKZE 4HCEA 2LSSA 3HG9A 5EPJA 5FO9B 3G7LA 2R61A 4BS9A 2PQAA 4A3KB 2O5JC 1HUNA 3D3RA 1G91A 1S5DD 1Z7TA 1M90C 3PO3B 4JK1C 3JAMi 1NR2A 4J6HA 4QY7A 1X56A 1VQHA 1SMYC 4KLKA 2F0KA 5GAGC 4KN4C 1VMCA 2A1AA 3RN2A 3H3VC 3TS0A 4B3TL 5LMUQ 2LY7A 3E0JA 1N32Q 1VQFA 3I91A 3NPPA 4ZAIA 3TEHB 1A0IA 1KRSA 2UXDL 3CQZB 5CV5A 5D3DA 4C1NI 1HNXL 2NVQB 3NTHA 2SOBA 1DD2A 3F1ZA 3NELA 2G9HD 2K33A 5EGTA 1W2BA 4DR1L 5FJ8G 4K0KQ 1X6OA 4HIOA 4LFAL 4EQPA 2R7ZB 2F0OA 2FXQA 1WTVA 2B63G 3CCSA 2OWOA 1L0XB 1M4VA 3PUYA 1A62A 2NVTB 3I7FA 2EYMA 1SNDA 2DGYA 3I4LA 4QIWB 1U5KA 2VW9A 2JA7G 3M3YH 4IPCA 4IFDI 1WTRA 1X54A 3I4NG 3OMCA 3QG1A 1CT1D 2EE1A 4OIJA 4OELB 2KHJA 1RF2D 5EPKA 3E3XA 1MGSA 5CGKA 3EA6A 2A68D 2XWJB 5D3IB 1HA6A 1HZCA 3CAMA 5C3WA 2F52A 3PIPA 1S72A 4DR4L 1S5BD 2HDMA 3T1YL 2BH8A 5I6WA 4RGTA 1BF4A 1ONLA 1VS0A 5IT9L 2EQSA 1SE4A 4A3BB 1GM5A 4CGYB 4QJFA 2PNRC 1NNXA 2X6LA 1H9KA 2AUKA 1TWGB 2QGQA 1OXVA 2N78A 2WKCA 5E4XA 4C2MH 2NVXB 1EIFA 1WYDA 3NUCA 3CD6A 5CR3A 4N9TA 2BDOA 4KKUA 3K58A 1BCPB 4NMZA 3CCRA 3V05A 3CPFA 3GTQH 3NBIA 3PUZA 4DV7Q 3S15B 1SYCA 4KJNA 1PH4A 2K32A 3D6CA 3T56B 4HIMA 3HGBA 1N33L 2NN6G 4KHVA 2R92G 2B39A 2L11A 3NE5B 4AH6A 2WV6D 4RG1A 4XTCS 2A68C 3PGZA 1EEFD 3M4QA 3K0YA 1GXDC 5I6YA 4NXMQ 4JYAL 1Z47A 3H3VH 1TS4A 4GN4B 3CC7A 4F88A 1SE2A 1PFSA 3A5ZB 3QWNA 3U4ZA 2LKVA 4C3IB 1D2BA 5IP7H 1B9MA 3N6RA 3T4AC 1SJED 4DK3C 4BA2I 3DEPA 2JQOA 2VNUD 3MZ5A 1EOTA 1EY8A 1YZ6A 2UUAQ 2PMZB 2R92H 4JI0L 3Q23A 4OWTB 3A7LA 3HOYG 1CHQD 2N8NA 5CBAE 3I4MB 5I9OA 3UDFA 4MNOA 1Q8IA 3J7ZC 4R4TA 3J7A5 2XSCA 1UEAB 3FKIG 4DPGA 3MTSA 4X3KA 4XQNA 1U4PA 2EXDA 4DV4L 4GOPB 3TQYA 4DGZA 2MUYA 1UNSA 1A6XA 3GTGH 5KYIA 3OW7A 1VQIA 3R2TA 3E9HA 4RKLA 1PH2A 2M2LA 3HOYH 4A3IG 4WRDA 5C6AA 3I73A 2D0PA 2UXBQ 2HQLA 2NTSA 1KDCA 4XDXA 5IT9c 3AU7A 3FKIH 2EVBA 4DR7L 3W2DA 5IYCG 2L5TA 4HIDA 4Q0FA 1D5ZC 1GUOA 4XQJA 2A74C 3PIO3 1TS3A 5M3MB 4A3MG 4LFCQ 1B2TA 2WAQG 4DV1L 1CSQA 1ZXTA 3HOZB 4IJHA 2K1BA 2L12A 1EU4A 2OEOA 2MGSA 4A3IH 3U4VA 4JI8L 5IY0A 4DR2L 1GVPA 2Y0SE 3UDGA 2IT1A 2WB1B 1N36L 3GTMH 5CMDA 2QILA 1EQQA 2RKSA 5ELNA 2PCFB 1MI2A 1K83H 4ZUJA 5IYCH 4FXKC 3S1QH 2EYFA 4DFAA 3F2CA 1HQRD 5LL6X 2ALYB 1Y1VG 4DR5Q 4C3HG 4A3MH 1E2ZA 4K8IA 1GUSA 2V1CC 1Q3LA 1V1OA 4DV6L 4JCVE 1EYGA 3J80L 1VQAA 2DUDA 2KVMA 3K80C 2VB3X 4LF5L 1LT6D 2CVRA 3CHBD 3EVQA 1Q1BA 2VZAA 5M5XH 4DUZQ 4R4IA 2ZTEA 1H9JA 3E5SA 4X66L 3MXGA 3P1HA 4EVOA 3WOEA 1X3EA 1YNXA 4DK6C 1Y1VH 3A0JA 4C3HH 1LTLA 2NZOA 3OWEB 3VYSA 3EFXD 3W5OA 4CJ0B 2MP1A 2OXPA 3CCLA 2B2WA 2F0FA 2B2UA 4DV3L 2HQEA 1SYDA 1LABA 2B63B 4IJLA 1SNMA 4X3TA 5A2QL 1VF7A 4XT1B 4K6LA 4DR3Q 1G2SA 3M85A 1J8IA 5FK9C 1BR9A 4LAAA 1XXGA 2J4XA 3HOVB 3O13A 1SE3A 2JA7B 2ZXRA 2J0TD 3CRLC 1BCPD 4KY5A 3I4NB 2C9OA 1F9RA 1JR0D 3QIAA 5CV9A 2IJ0A 1LV9A 1HTLD 3K7AB 4G7ZC 1N9WA 2A8VA 2XGTA 5M5WH 2K14A 1XJVA 3GTJB 2E75C 1V1QA 1ICFB 5C44H 3NEMA 4YCWA 1I3QB 1N34Q 1EY6A 4A93B 2YV5A 2K03A 2YU9B 1ET9A 1V8QA 3STBD 1SFOH 1YNND 3A54A 4O42A 1HXYD 2LMCB 5J22A 2I07B 2YYZA 2F3WA 4R8NA 2A69D 1QUQB 4O1NA 2E2HB 4ID6A 3ER0A 3L0OA 2B2UC 4G57A 2CQOA 2VXWA 1STGA 4DV5L 3BDLA 4JC0A 4PZ6A 2EZVA 3HOXG 3ZJYC 4I7AA 1EQTA 5IGBA 3T51B 2OQ0A 5DM73 3KDFB 3M9BA 5KNCA 1PH7A 1XNRL 2E2JB 1SROA 4LF4Q 1RJTA 5J3BA 2L0CA 3A56A 1PHJA 3SXHA 3GDEA 4XIGS 4JBMA 4PMCA 1F9QA 3PO2H 3FDTA 3CKIB 4KMUC 4MHEA 1Z6HA 1EY5A 3DWQA 4HJ8A 3D0FA 1BCPC 4B9XA 1YHQA 1I4XA 1RTOA 3J80c 1EYAA 1UWVA 3HOXH 4ZKCB 2QF7A 4IPGA 4A3CG 4G4KA 3KF8A 4X65L 1KL9A 1PRTB 2IY5B 2IPKD 1O7ZA 2DNCA 4A3KH 2RSNA 3G71A 1E22A 4A3GB 4QB4A 2J7ZA 3BVZA 4GOPA 3PO3H 4GLXA 1SRUA 5JEAG 1BBWA 3QOJA 4JPBW 4QL5A 2TSSA 3STBC 2KCCA 4NXNL 2VUMB 1YNNC 2HCIA 1FJGL 2QA4A 1IBLL 4IUVA 5JJIA 1B8AA 2K52A 1E2VA 3U50C 1Q12A 4K5VA 2R7ZG 4P73A 5JJKA 3DUZA 2ID0A 4K2KA 2ASBA 3BVMA 1ASZA 2PYKA 4ODGA 3CQZH 1VQBA 3DMUA 2NVQH 1FGBD 3CU7A 3BYYB 3C1EA 5JEAH 4IUUA 2CH4A 1EL0A 3MC0B 2PW5A 3T1HL 1A3VA 2E74C 4B3SQ 1RDPD 4Q5VA 1WI5A 3VA5A 1JJGA 5LHY1 4A3DG 4WJWA 4LUVA 5IYDG 3GTLB 1JOKA 4DK0A 1QWYA 4CJ1B 3GTKB 2BCOA 4GOPC 4PNYA 4GN5A 5FO7B 2Z8LA 3E0EA 4MZ9A 3QR8A 4A3BG 4BA1I 1NUCA 5GAHC 1S5ED 3AFPA 4BXXG 1B4OA 4HMIA 1BBXC 1G6ZA 1YI2A 5HY6A 2PQEA 4BY7B 2WAQB 1STAA 3K81C 1CK1A 1VQGA 1U9RA 4KKTA 4CHTB 3S1NB 1X3GA 3TMEA 2D5DA 1PZKD 3KLSA 5IYDH 4OL7A 4LF7Q 1A63A 5I4DA 1JJCB 1AE2A 4UY8C 3HEJA 3C1FA 1RHPA 4IUPA 1QZHA 1RIPA 4A3BH 1WFQA 1L1OB 3KOJA 1VQ7A 3C46A 4DAYB 1SSOA 4BXXH 1TWGH 1STYA 3GO5A 5CBEE 1FVIA 2NVXH 4IUNA 4V0BA 2K5DA 3B6YA 2JE6I 2E5LQ 2HT1A 3ICEA 2B3GA 1DJRD 1NMGA 5AJ3L 4RA8A 4RGNA 2MO1A 5EQ0A 3J81i 4UHVA 1VQCA 2NYZD 2C35B 1N32L 3RZOB 4DR6L 4C3IG 3NWTA 2O2LD 5CYUA 4OWWB 1WTOA 3S15H 1EIHA 1J5EQ 4RKBA 3SK5A 2OTLA 2EY2A 2PPBC 1VQNA 3S2DB 4YY3Q 1ET6A 2Q2TA 2WAQE 2EOTA
chains in the Genus database with same CATH topology
3PV0A 3Q24A 3N52A 2ICIA 1OXTA 2B8GA 2JSOA 1A2UA 4N9PA 1LT3D 1JE4A 2RBMA 5KNDA 1SNOA 1B53A 1STHA 4K14A 3P20A 1O7LA 4CJ2C 1ML0D 2B2VA 5M3FB 1PFMA 1B9NA 4PQXA 1I6HB 5ELEA 2F0LA 1DOLA 5KEEA 1ESFA 1I4GA 1PRTD 3H09A 3DWPA 4RWSC 2CQAA 1ENAA 3S1RB 3RZDB 2K6AA 3LX0A 1UUPA 3ND8A 2IL8A 1GUGA 3I70A 3FPPA 5EBCA 3D4WA 5EKIA 1DZ1A 3GP7A 1JOQA 4UDUC 1LTID 1GUNA 3J81E 2EPBA 3WOFA 1ENFA 1A3UA 5JPMC 1O7YA 3LNNA 3J7YW 2F4IA 2B2VC 3SHLA 2F1MA 2KJXA 3H91A 1DOKA 4ZUIA 1F2ZA 1LT5D 1T5XD 1CQFA 1KNAA 1GHKA 1GUWA 1TWHB 2WP8J 1DOMA 5CV7A 1WTPA 1PRTC 2L55A 4UAIA 1CTMA 3H94A 1EYDA 3SEBA 5KYLA 3TP8A 3F2UA 1QB5D 5C5LA 3M4OB 1KLUD 2VB2X 3RMHA 3MHBA 3QB3A 5EPLA 2RDHA 3MFYA 1SNQA 1VF5C 1IKMA 1WCMB 4A3DB 3X3NA 4QF4A 3URYA 1NAPA 3NK9A 4DAYA 5IGDA 1T5EA 3TBIB 1MBYA 2EY6A 3LWUA 5KRUA 4RHSA 5C0XG 2HDLA 3M4YA 5NUCA 3S14B 1HHVA 3SK6A 2AQ3B 5C3EB 3FMCA 1ILPA 2CHBD 3C2PA 1H9SB 3DWAA 1B50A 3EJIA 1V1PB 4C56C 4IZ8A 1TR5A 2ZXOA 3HRZC 2L9HA 1LLRD 2LFNA 4KI0A 2JA5B 3QJYA 4RGOS 2AQ1B 1O80A 1VCIA 4JBWA 4NDXA 3BYTB 1BOSA 2Q8TA 1RKNA 3J7AV 1AEXA 4TRDA 2BA0A 2H1EA 3QOLA 2ICEC 4MN3A 1EY0A 4F7XA 5D65A 1IYVA 5EJWA 2EJFC 1SNCA 2NN6H 2JP1A 3CRKC 2G9DA 5K5PA 2A6HC 5JOBA 5JAVA 3BDCA 1AP0A 4RH6A 2OF1A 3TP6A 1PDQA 4CKCA 4M1UB 3S1MB 2KEDA 4KKSA 4I65A 3ITPA 4KY6A 3R93A 4J8QA 1EY9A 1B3AA 1WD1A 1Q1EA 3MWYW 2EYOA 2JXMB 1RTNA 1I6VC 4TKOB 4X3SA 1WTQA 1CA6A 4FNFA 3T16A 2EYLA 2ZT9C 2FINB 4E6IA 1Y8OB 1ILQA 2XIWA 4C3JG 1HFNA 2IWHA 2I46A 2WKDA 3A55A 4KN7C 3T53B 1E2WA 1EY4A 4BBSB 4A3FB 3NP8A 3OIQA 2BE5D 1D1IA 2DN8A 2EY5A 1PLFA 5CV8A 1SYGA 2EXZA 3IL8A 1XYIA 4K2LA 1GUTA 2A5HA 1BCPF 2WINB 1TWFB 2N55A 1II3A 4PV1C 1YNJD 1CM9A 2D2CC 3S16B 2F0EA 3DEOA 3G6JB 3GV6A 1IL8A 4HAEA 4HSVA 2SEBD 2O5IC 5AFWA 2F0QA 1BDOA 4HTHA 4FVMA 4RCOA 1EWCA 3PUWA 1SDFA 3PUVA 1XTCD 3DXJC 1DM0B 4QUFA 5FLXL 4J1MA 4HSPA 2KECA 2H4OA 5IGEA 3GTPB 5BN4A 3Q0AA 2BE5C 2E2DC 2R93B 2IW3A 5CV6A 3MAQA 2F0TA 5E3FA 2L1BA 3Q6SA 3AB9A 3MXUA 1JCKB 4I7ZC 1H9SA 2NVYB 2QKIC 1V1PA 3VR6A 1YNJC 3R3OA 2NTTA 4HEDA 1LO5D 3V96A 5CORA 1LTRD 2M9VA 1J9OA 4OO1G 4TQUS 1TWCB 2X69A 1TVXA 3P7JA 3QO2A 2F0JA 5TSSA 1GJXA 5C4ZA 4ZKBB 3J81L 1S5FD 3HZXA 4YIJA 1ICWA 1TWAB 3P75A 1QNKA 1RD9D 1TKWB 1AZPA 4ZQ3A 2KOLA 1AFPA 4R8IA 4PMWA 2NN6I 5LL6S 3NBHA 2F0VA 4ZRZA 3HOUB 1U4LA 1IYUA 3VR5A 5I2YA 4KD4A 5C4XB 1STEA 4KK7A 2XRQD 1KLGD 1U4RA 5D14A 3TP7A 1HCZA 1ENCA 3D6WA 2R6GA 1XWEA 5DM63 1D5MC 2K5WA 1I50B 5J39A 3K5LA 1EU3A 2IX0A 5JEAJ 1BNZA 2K05A 3OMGA 2BA1A 2RVLA 1CFMA 3HOWB 4IALA 1HQMC 4FXGC 2R3ZA 3OWFA 1I4QA 2A73B 2FFKB 4DXGA 5CC4A 1BUVT 1PTOB 4Y7NB 3SK8A 2Q8IB 4C3JB 3TSSA 3KBXA 3U9OA 4IFDG 3BZDB 3A8JE 2K5QA 2EY1A 4FF3A 1EFID 2HCCA 2XWBB 3R2IA 3GTMB 1MSGA 1LTAD 2KA7A 2F0MA 5G3LD 4KY7A 4IUTA 1AZQA 4L6TB 3S1QB 2KCNA 4RCNA 3E6ZX 4L8JA 1JWMD 1QG7A 2X6GA 3T13A 3D4DA 1KTKA 3AMUA 3NTKA 1VMPA 1JC7A 2IX3A 4R9WA 1EYCA 1MD2D 2DY8A 3V2TA 1WTWA 3MA2B 2F0UA 1W6JA 1TY2A 3NSWA 3FEWX 1PRTF 2Z1CA 2JA6B 2A6ED 1QJOA 4IURA 1Y8PB 4QMGA 1E0BA 2QCPX 4RFBA 1QE6A 1TIID 3EROA 2K28A 4PMBA 4KV6A 4FF2A 5HURA 1BO0A 3K5MA 2DY7A 3NTIA 3IFTA 1U4MA 1ESRA 3IFDA 2JA8B 5EKKA 1R9TB 3KK7A 3DHQA 5HGTA 3BG3A 4CBVA 3GV3A 1SFOB 1CZWA 2BDNA 4FP5D 4H44C 4FF1A 4BY1B 1FNVA 1C48A 5M5YB 2TMPA 2EYHA 3A8IE 4K5XA 2D62A 5A2QE 3FPUB 5IGCA 1EIGA 2A6EC 3K57A 1S5CD 2B2YA 1K8MA 3OPOA 1HA5A 5FKAC 4HMJA 1R4PB 4DAPA 3VYTA 1H9RA 3D8GA 1XX8A 4FO2A 3OSOA 4BWGB 3MXNA 1HFGA 1QILA 4Z9CB 5IIFA 1G2TA 3K5OA 4A3EB 4NP5A 3ND9A 1SJHD 3WDNA 2FMMA 3H0GB 2NBFA 1FD7D 5FOBB 4NKLA 5KGUA 1KNEA 1JOOA 1B1ZA 3RD4A 2B2TA 4ME5A 4A3JB 2JYOA 1PTOD 1A3TA 1PFNA 3GTOB 2B2YC 1PZID 2F0SA 5JPNC 1GHJA 1M8AA 4H0LC 1VDZA 1A2TA 4ZYSA 4GZYC 2E2IB 4KD3A 4B08A 1DYQA 1L0YB 5JVG3 1FNUA 4DNTB 1PZJD 5IGFA 1LT4D 4DU9A 1PXUA 4F8MA 1F2MA 5BN3A 1R4QB 2SNSA 1STBA 3VA7A 3I72A 1G291 3VYUA 5ISRA 3VYRA 2DNEA 1SEBD 2B2TC 2HUGA 1PFBA 3S9WA 1TQOA 1OXXK 2D9UA 2AWOA 2A6HD 1PTOC 4DF7A 4DAVA 3R8BA 1SNPA 2F0GA 1I4HA 1G8ZD 2EYPA 3ERQA 1EEID 4OIKA 3ZYYX 5DNFA 5C0XJ 5T1GA 1TY0A 1DCZA 5ELFA 4S3SA 4B9WA 3PUXA 1CZGA 3BVGA 3K5NA 5C0XH 3IAYA 3KLRA 1OO9B 1NCVA 4XYQA 4CKEA 4KTAA 3VR3A 5IGGA 3JAME 1D1KA 5DEHA 3VR4A 3L3OC 4DK1A 5JVH3 2IX1A 2AQ2B 3D4RA 4BBRB 2F0NA 2RDFA 2Q8RE 3TZUA 1OXSC 3UI2A 3L9AX 3IKJA 3GD7A 2RA4A 1Y1WB 1JORA 2FHTA 2PZTA 3DM1A 1C8CA 5C3XA 4G7OC 4RAUC 1WTXA 1STNA 4RHRA 1JICA 2Y0SB 1PMRA 4OGQC 4EQOA 5C4JB 1I4RA 5ELBA 3S2HB 2F0WA 1V43A 2BOSA 4K8JA 2KQ3A 4DXFA 1HRJA 2XRSD 4M8AA 4CKBA 2AWNA 1O78A 1QCBD 1KDAA 3D31A 5J1ZA 4DN4M 1A15A 5KIXA 1PTOH 1CQVA 1SYEA 3H6MA 1W6KA 1I4PA 3PIP3 1F77A 4WFN3 3SR1A 2FJ2A 4QUCA 3A7AB 4ZK9B 2MPMA 3SE0A 1SYFA 3OIPA 4IN3A 1C4QA 1K8OA 2NB0A 2B8FA 3NHHA 2F0PA 5A35A 1BXTA 4LMQD 5T1IA 4P2CB 1ZKOA 3SDZA 4XXEA 1S4ZA 1Y69U 4KHZA 4DA2A 2GA4B 1JB3A 1WVLA 3SK4A 1BQQT 2RDGA 3W3AA 2QDBA 2EJGC 4K5WA 3TDQA 1LACA 1TU2B 3M3YB 4K6DA 1WD0A 2M00A 1OXUA 3HS0C 1F9PA 1H9MA 3Q22A 1UAPA 4LJZC 3LWEA 2K7VA 4NW2A 1F9SA 2Z4HA 5C4HA 3TN2A 3L7ZC 5C0XI 2KUMA 4C2MB 3EQLC 1SYBA 1AW7A 5ELDA 2JEAI 3I8ZA 5K36G 1IW7D 2CW0D 2XVSA 3GTQB 3I3CA 2E76C 2NUCA 1DONA 1RCVD 1LTGD 5I2XA 4V190 2LS01 3MEHA 2O4XA 1JQYD 2PZUA 4OO1H 2ZXPA 2L4NA 2B2WC 3NQTA 4KJOA 1CI3M 3KLSX 5CV4A 2PO4A 2F0IA 4LK1C 2EYJA 4EQNA 3K6OA 1EWHA 5K36H 5IT9E 1X3QA 4TSSA 1KDBA 4MIUA 3BDOA 3FVQA 4IUQA 2XN9C 5IODA 3KBGA 3MFGA 2JEBI 5M9OA 5EBDA 4ABNA 5E4WC 4X3UA 1X3PA 2EJMA 3I90A 2R92B 1MSHA 1NR4A 1Q90A 5G3LF 1LTSD 4HR7B 1IW7C 2CW0C 2KEEA 5BN5A 4L63B 1CA5A 1EZ8A 1LTTD 1ZYRD 3KUPA 3GTGB 1KABA 5DAUA 3M7NA 2N88A 5COYA 2A69C 4U673 4OHJA 4HCSA 3HOYB 3NWSA 4RGMA 1JWSD 2K01A 1Y8NB 1FNWA 3K59A 5C5MA 3A8KE 3FKIB 3MXPA 4EGVA 5F2DA 4U68A 2K04A 4A3IB 1TS2A 2XNAC 3GQBA 5KNBA 3HP3A 2Z4IA 2KHSA 1EZ6A 2SDFA 1K83B 3JAML 4IFDJ 1PYWD 2F3VA 2EDGA 3VR2A 4FXDA 2MHVA 4XQQA 2AUJD 4A3MB 4IFDH 1DXMA 3BS1A 1NSNS 1QOHA 1ZYRC 1EY7A 3TZDA 1AN8A 2V4DA 1F2YA 3RLFA 5I9PA 2NZ1D 2C5CA 1FYCA 3OOCA 5M5XB 1ZEQX 4C1NK 4H7BA 1HPCA 2FMCA 1CHPD 4FYDA 4XT3B 1X32A 1Y1VB 4C3HB 3X3MA 1FR3A 1LTBD 2RQXA 1GOZA 3ONAB 2F03A 1D6EC 5EKLA 4AYBB 2MJ8A 4ILWA 4H13C 2WIIB 1TS5A 4FF4A 2PW7A 3J80E 5JJZA 4F87A 1HUMA 4ULLA 3HKZB 3SVMA 3MVVA 4XYOA 2WACA 5M5WB 1IKLA 1IHZA 2ENBA 2QEJC 1HTPA 5C44B 5IOCA 4OO1I 1SBBB 3OHXC 2SNMA 1SMYD 5FLXE 4WORA 3NQIA 2RSOA 2F0DA 3J7AF 1EQVA 4IQZA 4G7HC 3TP5A 4QCLA 1PTOF 3U9SA 4ZLTF 1QNUA 3RUZA 3PMFA 4DNRB 2NWGA 3FRPB 2OT2A 4HN7A 5FO8B 1F2LA 5E1FA 1TT2A 1JWUD 1B44D 1SAPA 3PO2B 1RODA 3C3LA 3S17B 2F0HA 1KAAA 1SXTA 3NXWA 5ELCA 3HOXB 3M7GA 1D5XC 2PZWA 4HCEA 3HG9A 5EPJA 5FO9B 3G7LA 2R61A 4BS9A 4A3KB 2O5JC 1HUNA 3D3RA 1G91A 1S5DD 1Z7TA 3PO3B 4JK1C 1NR2A 4J6HA 1SMYC 2F0KA 4KN4C 1VMCA 3H3VC 2LY7A 3E0JA 3I91A 3NPPA 4ZAIA 3CQZB 5CV5A 5D3DA 4C1NI 2NVQB 3NTHA 2SOBA 1DD2A 2G9HD 2K33A 5EGTA 4EQPA 2R7ZB 2F0OA 1WTVA 1L0XB 1M4VA 3PUYA 2NVTB 2EYMA 1SNDA 3I4LA 4QIWB 4IFDI 1WTRA 3OMCA 3QG1A 1CT1D 2EE1A 4OIJA 1RF2D 5EPKA 1MGSA 5CGKA 3EA6A 2A68D 2XWJB 5D3IB 1HA6A 5C3WA 1S5BD 2HDMA 5I6WA 4RGTA 1BF4A 1ONLA 5IT9L 1SE4A 4A3BB 4CGYB 2PNRC 2X6LA 1H9KA 2AUKA 1TWGB 1OXVA 2WKCA 5E4XA 2NVXB 3NUCA 5CR3A 4N9TA 2BDOA 4KKUA 3K58A 1BCPB 4NMZA 3V05A 3NBIA 3PUZA 3S15B 1SYCA 4KJNA 2K32A 3D6CA 3T56B 3HGBA 2NN6G 4KHVA 2B39A 2L11A 3NE5B 2WV6D 4XTCS 2A68C 1EEFD 3K0YA 1GXDC 5I6YA 1Z47A 1TS4A 4F88A 1SE2A 3QWNA 2LKVA 4C3IB 1D2BA 1B9MA 3N6RA 3T4AC 1SJED 4BA2I 3DEPA 2VNUD 3MZ5A 1EOTA 1EY8A 2PMZB 3Q23A 3A7LA 1CHQD 5CBAE 3I4MB 5I9OA 1Q8IA 2XSCA 1UEAB 3MTSA 4X3KA 4XQNA 1U4PA 4DGZA 2MUYA 1UNSA 1A6XA 5KYIA 3OW7A 3R2TA 4RKLA 2M2LA 4WRDA 5C6AA 3I73A 2NTSA 1KDCA 4XDXA 3AU7A 2EVBA 3W2DA 2L5TA 4Q0FA 1D5ZC 1GUOA 4XQJA 2A74C 3PIO3 1TS3A 5M3MB 1B2TA 1ZXTA 3HOZB 2K1BA 2L12A 1EU4A 2OEOA 2MGSA 2IT1A 2WB1B 5CMDA 2QILA 2RKSA 2PCFB 1MI2A 4ZUJA 4FXKC 2EYFA 4DFAA 1HQRD 5LL6X 4C3HG 1E2ZA 4K8IA 1GUSA 1Q3LA 1V1OA 3J80L 2KVMA 2VB3X 1LT6D 2CVRA 3CHBD 3EVQA 1Q1BA 1H9JA 3E5SA 3MXGA 3P1HA 4EVOA 3WOEA 3OWEB 3VYSA 3EFXD 4CJ0B 2MP1A 2OXPA 2B2WA 2F0FA 2B2UA 2HQEA 1SYDA 1LABA 2B63B 1SNMA 4X3TA 5A2QL 1VF7A 4XT1B 4K6LA 1G2SA 3M85A 1J8IA 5FK9C 1BR9A 4LAAA 1XXGA 2J4XA 3HOVB 3O13A 1SE3A 2JA7B 2ZXRA 2J0TD 3CRLC 1BCPD 4KY5A 3I4NB 2C9OA 1F9RA 1JR0D 3QIAA 5CV9A 2IJ0A 1LV9A 1HTLD 3K7AB 4G7ZC 3GTJB 2E75C 1I3QB 1EY6A 4A93B 2YU9B 2K03A 1ET9A 1V8QA 1YNND 3A54A 4O42A 1HXYD 2LMCB 5J22A 2I07B 2YYZA 2F3WA 4R8NA 2A69D 4O1NA 2E2HB 4ID6A 2B2UC 4G57A 2VXWA 1STGA 3BDLA 2EZVA 1EQTA 5IGBA 3T51B 2E2JB 5DM73 5KNCA 1RJTA 2L0CA 3A56A 3SXHA 4XIGS 4PMCA 1F9QA 3FDTA 3CKIB 4KMUC 4MHEA 1Z6HA 1EY5A 3DWQA 1BCPC 4B9XA 1I4XA 1RTOA 1EYAA 4ZKCB 2QF7A 4G4KA 3KF8A 1PRTB 2IPKD 1O7ZA 2DNCA 2RSNA 4A3GB 4QB4A 2J7ZA 3BVZA 5JEAG 3QOJA 2TSSA 2KCCA 2VUMB 1YNNC 2HCIA 4IUVA 1E2VA 1Q12A 4K5VA 3DUZA 2ID0A 4K2KA 3BVMA 2PYKA 4ODGA 3DMUA 1FGBD 3CU7A 3BYYB 3C1EA 5JEAH 4IUUA 1EL0A 3MC0B 2PW5A 1A3VA 2E74C 1RDPD 4Q5VA 3VA5A 5LHY1 4WJWA 3GTLB 1JOKA 4DK0A 1QWYA 4CJ1B 3GTKB 2BCOA 4PNYA 5FO7B 2Z8LA 4BA1I 1NUCA 1S5ED 1B4OA 4HMIA 1BBXC 1G6ZA 2PQEA 4BY7B 2WAQB 1STAA 1CK1A 1U9RA 4KKTA 4CHTB 3S1NB 3TMEA 2D5DA 1PZKD 3KLSA 4OL7A 5I4DA 3HEJA 3C1FA 1RHPA 4IUPA 3C46A 1SSOA 1STYA 3GO5A 5CBEE 4IUNA 4V0BA 2K5DA 2JE6I 1DJRD 4RA8A 4RGNA 5EQ0A 2NYZD 3RZOB 4C3IG 3NWTA 2O2LD 5CYUA 1WTOA 1EIHA 4RKBA 3SK5A 2EY2A 2PPBC 3S2DB 1ET6A 2EOTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F7X A;  5CGK A;  2F0Q A;  4K2K A;  3PMF A;  5CV7 A;  3RUZ A;  3OSO A;  4DGZ A;  4HTH A;  2PYK A;  4LAA A;  4ODG A;  3MEH A;  5C3W A;  1SNC A;  2O4X A;  2PZU A;  4KD4 A;  5KYI A;  2KHS A;  1EZ6 A;  4KY5 A;  3DMU A;  1EYC A;  3V2T A;  5IIF A;  3SR1 A;  3C1E A;  4KTA A;  2F0U A;  4RKL A;  1EYD A;  4NP5 A;  2PW5 A;  2F3V A;  3NQT A;  4J1M A;  4KJO A;  4WRD A;  5CV9 A;  1A3V A;  1SYF A;  5E1F A;  4S3S A;  3TP7 A;  1TT2 A;  1ENC A;  5C6A A;  5I6W A;  3TP8 A;  5IGG A;  5JOB A;  5KYL A;  4B9W A;  1KDC A;  5CV4 A;  5IGE A;  1A2U A;  2F0I A;  3VA5 A;  3D8G A;  4N9P A;  4NKL A;  2EYJ A;  1NSN S;  3BDC A;  5DEH A;  5C5L A;  4EQN A;  5JAV A;  5KGU A;  1JOO A;  1EY7 A;  2RBM A;  2F0H A;  1KAA A;  2OF1 A;  3TP6 A;  1SNO A;  5J39 A;  4ME5 A;  3NXW A;  4QMG A;  1EY6 A;  1A3T A;  1KDB A;  1JOK A;  1F2Y A;  3MHB A;  3NHH A;  4MIU A;  2F0P A;  3QB3 A;  5CV6 A;  5I9P A;  4I65 A;  2PZW A;  1STH A;  3ITP A;  4KY6 A;  2F0N A;  2RDF A;  4K14 A;  3OMG A;  4PNY A;  3NUC A;  5IOD A;  5J22 A;  2F0T A;  3ERO A;  1SNQ A;  5CR3 A;  4N9T A;  5E3F A;  4PMB A;  2F3W A;  4IAL A;  2F0S A;  1EY9 A;  4R8N A;  5M9O A;  1NUC A;  4NMZ A;  4KV6 A;  1A2T A;  4H7B A;  4ID6 A;  2EYO A;  2OEO A;  5HUR A;  4G57 A;  4HMI A;  4QF4 A;  1STG A;  2F0L A;  3BDL A;  3SK4 A;  2PQE A;  4KD3 A;  5KEE A;  3NK9 A;  4J6H A;  2EYL A;  3R3O A;  1STA A;  3T16 A;  5IGD A;  5IGB A;  3OWF A;  1SYC A;  1U9R A;  2F0K A;  2EY6 A;  2RKS A;  4KJN A;  4E6I A;  2QDB A;  5KRU A;  1JOR A;  4K5W A;  3TME A;  1ENA A;  3D6C A;  5EKL A;  4ZUJ A;  5NUC A;  2EYF A;  3LX0 A;  4OL7 A;  4DFA A;  2PZT A;  3SXH A;  5CC4 A;  5IGF A;  3SK5 A;  5EKK A;  3SK6 A;  4KHV A;  3HEJ A;  4K6D A;  3C1F A;  4PMC A;  4DU9 A;  5C3X A;  3DHQ A;  1EY4 A;  1STN A;  1EZ8 A;  3SK8 A;  4F8M A;  5HGT A;  2M00 A;  3EJI A;  4K8I A;  3NP8 A;  1F2M A;  1EY5 A;  3U9O A;  4EQO A;  2SNS A;  3D4W A;  1TR5 A;  4IZ8 A;  5CV5 A;  4B9X A;  1STB A;  1STY A;  1KAB A;  2PW7 A;  5DAU A;  5I6Y A;  2F0J A;  1EYA A;  2SOB A;  4IUN A;  2F0W A;  5ISR A;  5C4Z A;  2EYH A;  2EY5 A;  2LKV A;  5CV8 A;  3HZX A;  1JOQ A;  4K5X A;  1SYG A;  3EVQ A;  2EXZ A;  4K8J A;  2EY1 A;  5EGT A;  4YIJ A;  5C4H A;  2KQ3 A;  3P75 A;  4K2L A;  5IGC A;  1A3U A;  3MVV A;  3E5S A;  3S9W A;  3MZ5 A;  2WAC A;  1TQO A;  5C5M A;  3P1H A;  1EY8 A;  2F0M A;  4EVO A;  4KY7 A;  1IHZ A;  4QB4 A;  4ZQ3 A;  2ENB A;  4NDX A;  4EQP A;  3MXP A;  2F0O A;  5IOC A;  1II3 A;  3QOJ A;  4DF7 A;  1SYB A;  1SNP A;  2OXP A;  2F0G A;  2SNM A;  3SHL A;  5F2D A;  2F0F A;  5I9O A;  2F0V A;  4ZUI A;  1F2Z A;  2F0E A;  1KDA A;  2EYP A;  4HMJ A;  2EYM A;  1SND A;  3ERQ A;  4RKB A;  1RKN A;  2HQE A;  1SYD A;  2EY2 A;  4WOR A;  5J1Z A;  3T13 A;  3D4D A;  2F0D A;  1AEX A;  4TRD A;  5KIX A;  5K5P A;  1SNM A;  1EQV A;  3OMC A;  4K5V A;  3TP5 A;  3QOL A;  1SYE A;  2NUC A;  3H6M A;  1EY0 A; 
#chains in the Genus database with same CATH topology
 1CUK A;  3PV0 A;  3Q24 A;  2L15 A;  3I4M G;  4DV2 Q;  1WTH A;  3N52 A;  1WJJ A;  3JC6 6;  2ICI A;  1OXT A;  2B8G A;  4C3I H;  5IE8 A;  2K75 A;  2JSO A;  2UUC Q;  1A2U A;  1QUQ A;  4N9P A;  1LT3 D;  1JE4 A;  4B3M L;  2CWP A;  4L5S A;  1PH6 A;  2RBM A;  2YTX A;  3ERS X;  5KND A;  3E9I A;  2ZM6 L;  1SNO A;  1B53 A;  2RCN A;  2OQK A;  3CPW A;  3TRE A;  1K3R A;  1STH A;  3KDF A;  3I4M H;  4K14 A;  4O0A A;  3P20 A;  1O7L A;  4CJ2 C;  1ML0 D;  2B2V A;  4AYB E;  1K8G A;  4RMF A;  3JAM c;  5M3F B;  1EUJ A;  1PFM A;  1B9N A;  4PQX A;  1XMO L;  1I6H B;  5ELE A;  2F0L A;  2LXJ A;  1IBK Q;  4AQY Q;  3RLN A;  3PF5 A;  4A3L G;  1DOL A;  5KEE A;  1X55 A;  1ESF A;  2UUB Q;  4GS3 A;  1I4G A;  5M3M G;  1PRT D;  3H09 A;  4BBS G;  3DWP A;  4R1J A;  4RWS C;  2CQA A;  1ENA A;  3HOZ G;  3S1R B;  3RZD B;  2K6A A;  3LX0 A;  1HZB A;  1UUP A;  3ND8 A;  2IL8 A;  2WB1 G;  3H15 A;  1GUG A;  3I70 A;  5IWA Q;  3CCE A;  3FPP A;  5EBC A;  2QDL A;  3D4W A;  5EKI A;  1PH3 A;  1DZ1 A;  5IP9 G;  3GP7 A;  4A3L H;  1JOQ A;  4H02 A;  4GKK L;  5M3M H;  4UDU C;  1LTI D;  1GUN A;  3J81 E;  2EPB A;  3WOF A;  4JVZ A;  1ENF A;  3HOZ H;  1A3U A;  5JPM C;  1O7Y A;  2VQE Q;  3LNN A;  4HIK A;  4N8X 1;  3BZC A;  1HR0 L;  3J7Y W;  2F4I A;  2B2V C;  4LF8 Q;  4JI4 L;  3I56 A;  4NXM L;  3SHL A;  2F1M A;  2KJX A;  3H91 A;  1DOK A;  4ZUI A;  1F2Z A;  2MNA A;  1LT5 D;  1CQF A;  1T5X D;  1KNA A;  1GHK A;  5IP9 H;  1GUW A;  2HIX A;  1TWH B;  2WP8 J;  1DOM A;  1LYL A;  5CV7 A;  2UUA L;  1WTP A;  1PRT C;  2L55 A;  2MO0 A;  1KIX A;  4UAI A;  1CTM A;  3H94 A;  1XPO A;  1EYD A;  4L5Q A;  1HNW L;  3SEB A;  5KYL A;  1G6P A;  2MFI A;  3TP8 A;  1B70 B;  3F2U A;  1K28 A;  1QB5 D;  2HHH L;  3HOV G;  5C5L A;  2N49 A;  3M4O B;  4JI5 Q;  4CDD C;  1KLU D;  2VB2 X;  3RMH A;  4UP7 A;  5FJ8 H;  3MHB A;  3QB3 A;  5EPL A;  2RDH A;  4JOI C;  5DLQ E;  1S40 A;  3PIO A;  3MFY A;  1SNQ A;  1VF5 C;  1QVG A;  4HJ5 A;  1IKM A;  2ZTD A;  1WCM B;  4A3D B;  3X3N A;  2B63 H;  4LF6 Q;  1DGS A;  4QF4 A;  1X9N A;  3URY A;  1NAP A;  4A93 G;  1L1O A;  1VQ5 A;  3NK9 A;  2VQF Q;  3G48 A;  4DAY A;  5IGD A;  2IHF A;  3OW2 A;  2JA7 H;  1T5E A;  3TBI B;  1MBY A;  2EY6 A;  3LWU A;  5KRU A;  3I4N H;  4RHS A;  5C0X G;  2HDL A;  3M4Y A;  5NUC A;  3S14 B;  1HHV A;  3SK6 A;  2AQ3 B;  1NMF A;  5C3E B;  3FMC A;  1ILP A;  2CHB D;  3C2P A;  3TS2 A;  3DWA A;  1H9S B;  1B50 A;  3EJI A;  1LUZ A;  1V1P B;  3GTJ H;  4C56 C;  4FDB A;  1PH5 A;  5L37 A;  4IZ8 A;  1TR5 A;  2ZXO A;  1I3Q H;  3HRZ C;  2L9H A;  1D7Q A;  4A93 H;  2UXC L;  2YU9 H;  1LLR D;  2LFN A;  4KI0 A;  2JA5 B;  1P8L A;  4QIW E;  3QJY A;  4RGO S;  4NPS A;  2AQ1 B;  2VS1 A;  1O80 A;  1VCI A;  2E2H H;  1KHI A;  2N3S A;  1YJN A;  2UU9 Q;  4JBW A;  4NDX A;  3BYT B;  1VQ4 A;  1BBU A;  1BOS A;  1N8R C;  1E1T A;  2GVA A;  5C4X G;  1L1O C;  2Q8T A;  1RKN A;  3J7A V;  3W1G A;  1AEX A;  4TRD A;  1VQO A;  4A3G G;  2BA0 A;  2JK8 A;  2H1E A;  3QOL A;  2ICE C;  4MN3 A;  4MTN A;  1EY0 A;  4F7X A;  1EFW A;  5D65 A;  2VUM G;  1IYV A;  3A74 A;  5EJW A;  2ATW A;  2EJF C;  1SNC A;  3NBH B;  4YWL A;  2NN6 H;  4B3T Q;  1I94 L;  2JP1 A;  3J81 j;  3CRK C;  2G9D A;  5K5P A;  2A6H C;  2UXD Q;  5JOB A;  2RCF A;  5JAV A;  1UE5 A;  3BDC A;  1AP0 A;  4RH6 A;  1K8A C;  4A3G H;  1TXY A;  2OF1 A;  3TP6 A;  1PDQ A;  4CKC A;  4M1U B;  4DR1 Q;  3S1M B;  2KED A;  4KKS A;  4I65 A;  2VUM H;  2PI2 E;  3ITP A;  4KY6 A;  4LFA Q;  1IZ6 A;  3R93 A;  4J8Q A;  1EY9 A;  1B3A A;  1WD1 A;  1Q1E A;  3MWY W;  2I0Q A;  2EYO A;  2JXM B;  3DLL A;  1RTN A;  3KYH C;  4KHP L;  1I6V C;  4TKO B;  4X3S A;  1WTQ A;  1OTC A;  1CA6 A;  4FNF A;  4X62 Q;  3T16 A;  2EYL A;  2ZT9 C;  2FIN B;  2I5L X;  3CXC A;  4E6I A;  1Y8O B;  1ILQ A;  2XIW A;  3CCV A;  5LMN L;  4C3J G;  1HFN A;  2IWH A;  2I46 A;  2WKD A;  3A55 A;  4KN7 C;  1IBM L;  3T53 B;  1E2W A;  4BY7 G;  1EY4 A;  4JI1 L;  4BBS B;  4A3F B;  2CCZ A;  4DR4 Q;  3NP8 A;  3OIQ A;  3T1Y Q;  2PMZ E;  2BE5 D;  2XTI A;  1D1I A;  3GTL H;  2DN8 A;  3GTK H;  2EY5 A;  1PLF A;  5CV8 A;  1SYG A;  2EXZ A;  2QW7 A;  3IL8 A;  3HKS A;  1XYI A;  4K2L A;  1GUT A;  3BJU A;  2A5H A;  1BCP F;  2WIN B;  1TWF B;  2N55 A;  1II3 A;  4PV1 C;  3UDX A;  4BY7 H;  1YNJ D;  1CM9 A;  2YTY A;  4A4I A;  3OTO Q;  2D2C C;  3S16 B;  1NTG A;  3S1N H;  2F0E A;  3DEO A;  3G6J B;  3GV6 A;  4JBK A;  1IL8 A;  4JI3 L;  4HAE A;  4HSV A;  1E1O A;  2SEB D;  2O5I C;  1VQE A;  5AFW A;  1E3P A;  2F0Q A;  1BDO A;  4HTH A;  4FVM A;  4RCO A;  1EWC A;  3PUW A;  5IYB G;  1SDF A;  1XPR A;  1PYB A;  3PUV A;  5H1S E;  1XTC D;  3DXJ C;  1DM0 B;  4QUF A;  1A8V A;  5FLX L;  1PH1 A;  4J1M A;  4HSP A;  4DNI A;  2KEC A;  2H4O A;  2K5V A;  5IGE A;  3GTP B;  4P72 A;  4B3R L;  4JYA Q;  5BN4 A;  4LF9 L;  3RZO H;  3Q0A A;  2BE5 C;  2E2D C;  2JA9 A;  2WB1 E;  2R93 B;  2P5Z X;  2IW3 A;  5CV6 A;  3MAQ A;  2F0T A;  5E3F A;  2L1B A;  3Q6S A;  4JI0 Q;  3I55 A;  3AB9 A;  1XNQ Q;  3S2D H;  3MXU A;  3ULP A;  1JCK B;  4I7Z C;  1H9S A;  2NVY B;  2QKI C;  1G51 A;  2GN5 A;  1V1P A;  3VR6 A;  1YNJ C;  2JA8 G;  3R3O A;  2B29 A;  4GKJ L;  2NTT A;  4ALP A;  3VDY A;  1K9M C;  4HED A;  1LO5 D;  4LUZ A;  3V96 A;  5COR A;  1JJ2 A;  4DV4 Q;  1LTR D;  2M9V A;  5M3F G;  1J9O A;  4BY1 G;  4OO1 G;  4TQU S;  1TWC B;  2PI2 A;  1NE3 A;  1PH8 A;  2X69 A;  1TVX A;  1YIT A;  3PQI A;  1KXL A;  1Z9F A;  3P7J A;  3QO2 A;  3CC2 A;  3MEF A;  3G4S A;  2F0J A;  5TSS A;  1GJX A;  3AFQ A;  3CP0 A;  5C4Z A;  1MIU A;  4ZKB B;  3J81 L;  3H3V I;  1S5F D;  3HZX A;  4ZCK A;  2RHS B;  4YIJ A;  1ICW A;  1TWA B;  3P75 A;  4OX9 L;  1QNK A;  1RD9 D;  1E7Z A;  2Q2I A;  1TKW B;  1AZP A;  5M3F H;  3AEV A;  1S3O A;  4ZQ3 A;  2KOL A;  1I6H H;  1AFP A;  4R8I A;  4JG2 A;  2NN6 I;  4PMW A;  1NY4 A;  5LL6 S;  1MHW C;  4DV1 Q;  4HJ7 A;  3NBH A;  4POF A;  4OEM B;  1WOC A;  2F0V A;  4ZRZ A;  3S17 H;  3HOU B;  1JT8 A;  1U4L A;  4DR2 Q;  1IYU A;  1VQ6 A;  3VR5 A;  3AYH B;  1W3S A;  5I2Y A;  1NJI C;  4JI7 L;  4KD4 A;  4JI6 L;  5C4X B;  4IOA A;  4JV5 Q;  1STE A;  3H0G G;  4KK7 A;  2XRQ D;  1KLG D;  1U4R A;  5D14 A;  5FLX c;  3TP7 A;  4A3J G;  1HCZ A;  1ENC A;  3D6W A;  1ASY A;  2R6G A;  1PA6 A;  1T9H A;  1XWE A;  4UPA A;  5DM6 3;  1D5M C;  4OWX B;  4LF5 Q;  2K5W A;  1KD1 C;  4A3C H;  1I50 B;  5J39 A;  3MXN B;  3K5L A;  4DV2 L;  3SGI A;  1CKM A;  1EU3 A;  2IX0 A;  5JEA J;  1BNZ A;  2K05 A;  3OMG A;  1HNZ L;  2BA1 A;  2RVL A;  1CFM A;  3HOW B;  4IAL A;  1YJW A;  2Z9H A;  3EIV A;  1M1K C;  1TWH H;  2CWA A;  1HQM C;  1C0A A;  4DV3 Q;  4FXG C;  4EQ5 A;  2R3Z A;  1B7Y B;  1KAW A;  3OWF A;  1XTD A;  3RNU A;  1I4Q A;  1WCM G;  2R7Z H;  2A73 B;  2FFK B;  4DXG A;  3A5U A;  5CC4 A;  1BUV T;  5GQO A;  4AIM A;  1PTO B;  4DV0 L;  4JI2 L;  3CCJ A;  4Y7N B;  2NVT H;  3SK8 A;  2Q8I B;  1EOV A;  4C3J B;  3TSS A;  3M4O H;  3KBX A;  4LWC A;  2CFM A;  3U9O A;  4AQY L;  4IFD G;  3BZD B;  3EN2 A;  3A8J E;  1PV4 A;  1O7I A;  2K5Q A;  5C3E G;  3J81 c;  1AH9 A;  2EY1 A;  4FF3 A;  1U0L A;  1EFI D;  5BR8 Q;  2HCC A;  2XWB B;  3R2I A;  1WCM H;  4A3D H;  3GTM B;  1MSG A;  1LTA D;  2KA7 A;  2F0M A;  4WJ4 A;  5G3L D;  4KY7 A;  4IUT A;  4P71 A;  2ZTC A;  1AZQ A;  2KBN A;  4L6T B;  3S1Q B;  2JA5 G;  2KCN A;  4RCN A;  3E6Z X;  4A76 A;  4L8J A;  1JWM D;  1QG7 A;  2X6G A;  3T13 A;  1XPU A;  4DV5 Q;  3D4D A;  1KTK A;  3AMU A;  2PNH A;  3S14 H;  3NTK A;  1SN8 A;  1VMP A;  5C3E H;  1JC7 A;  4CDC C;  2A19 A;  3CME A;  1K0S A;  1XNR Q;  2IX3 A;  2KCT A;  4GN3 B;  1VQ8 A;  5LMU L;  2R7F A;  4R9W A;  1EYC A;  1MD2 D;  2DY8 A;  3V2T A;  1WTW A;  3MA2 B;  2K4K A;  2F0U A;  4OXP A;  1W6J A;  3OYY A;  1YHA A;  1TY2 A;  3NSW A;  3FEW X;  4DUY Q;  2HD3 A;  4BBR G;  1PRT F;  2Z1C A;  2JA6 B;  2A6E D;  3NEN A;  1QJO A;  4K0K L;  4IUR A;  1Y8P B;  2I5M X;  4QMG A;  4X65 Q;  1E0B A;  4ME3 A;  2QCP X;  4RFB A;  1GD7 A;  1QE6 A;  1TII D;  2CKZ B;  3ERO A;  2BH2 A;  2K28 A;  2JJQ A;  4PMB A;  4KV6 A;  4FF2 A;  5HUR A;  1BO0 A;  3K5M A;  4NXN Q;  2DY7 A;  4PZ8 A;  1MJC A;  1FJG Q;  1IBL Q;  4N8F A;  2OCE A;  3NTI A;  1JB7 A;  2IHE A;  1MKH A;  3IFT A;  1U4M A;  1ESR A;  3IFD A;  3KFU A;  2JA8 B;  5EKK A;  2MQH A;  1R9T B;  3KK7 A;  3DHQ A;  2KHI A;  4LF6 L;  3ULJ A;  5HGT A;  3BG3 A;  4CBV A;  3GV3 A;  1SFO B;  1CZW A;  2BDN A;  4FP5 D;  4H44 C;  4L5R C;  4FF1 A;  3FHW A;  3T1H Q;  4BY1 B;  2VQF L;  4DKA C;  3S1M H;  1FNV A;  1C48 A;  5M5Y B;  2TMP A;  2GVB A;  2EYH A;  3A8I E;  4K5X A;  2ZJP A;  2D62 A;  4A3F G;  5A2Q E;  2Z0S A;  3FPU B;  1YVC A;  5IGC A;  1EIG A;  2A6E C;  3K57 A;  1S5C D;  2B2Y A;  1E24 A;  5E7N A;  1K8M A;  3OPO A;  5HGQ A;  3KLW A;  2G5D A;  1HA5 A;  3UDI A;  5FKA C;  4HMJ A;  3F2D A;  1R4P B;  4DV7 L;  2Q2U A;  4DAP A;  1SLJ A;  1XMQ Q;  3VYT A;  1H9R A;  1HR0 W;  3D8G A;  1XX8 A;  2I5H A;  4BBS H;  4A3F H;  4FO2 A;  3OSO A;  4BWG B;  3MXN A;  1HFG A;  1QIL A;  4Z9C B;  5IIF A;  4JOI A;  1G2T A;  3K5O A;  3LGJ A;  4A3E B;  4NP5 A;  3ND9 A;  1HZA A;  4GNX B;  1SJH D;  3WDN A;  1Y14 B;  4JBJ A;  4YHH Q;  2FMM A;  3H0G B;  2NBF A;  1FD7 D;  4NKL A;  5FOB B;  1GO3 E;  5KGU A;  1KNE A;  1JOO A;  1B1Z A;  2K50 A;  3RD4 A;  1EIY B;  4Y52 H;  4WJ3 M;  2B2T A;  1TWF H;  4YCV A;  1IL2 A;  4ME5 A;  4LW1 A;  2Z6K A;  2JYO A;  1PTO D;  4A3J B;  1A3T A;  5AJ3 Q;  1PFN A;  3F2B A;  3CCU A;  3GTO B;  2B2Y C;  1PZI D;  3S16 H;  2F0S A;  5JPN C;  1GHJ A;  4DR6 Q;  1M8A A;  4H0L C;  1VDZ A;  1A2T A;  4ZYS A;  4GZY C;  2E2I B;  2R93 G;  4KD3 A;  4IO9 A;  2RHQ B;  4R4Q A;  4B08 A;  1DYQ A;  1L0Y B;  5JVG 3;  1FNU A;  1IYJ B;  1SMX A;  4LFB Q;  4DNT B;  1PZJ D;  5IGF A;  1YIJ A;  1LT4 D;  4DU9 A;  1LM0 A;  1PXU A;  3TRZ A;  3GTP H;  1Q8K A;  4F8M A;  4X64 Q;  1F2M A;  5BN3 A;  2UXB L;  4R4C A;  1R4Q B;  2SNS A;  4YWK A;  4X62 L;  1STB A;  3VA7 A;  3I72 A;  3IRB A;  1G29 1;  2R93 H;  4L5T A;  3VYU A;  5ISR A;  3VYR A;  2DNE A;  1SEB D;  2B2T C;  4YWM A;  1J6Q A;  4B3M Q;  3HOV H;  2HUG A;  2Z6K C;  2LXK A;  1VQK A;  1PFB A;  4P74 A;  2F4V Q;  2ZM6 Q;  3S9W A;  1L2F A;  1TQO A;  1OXX K;  4LFC L;  1VQM A;  2D9U A;  3K7A H;  3L2P A;  2NVY H;  2AWO A;  2A6H D;  1PTO C;  4DF7 A;  4DAV A;  3R8B A;  1SNP A;  2F0G A;  1I4H A;  1G8Z D;  2EYP A;  3Q8D A;  3ERQ A;  1EEI D;  1XMO Q;  4OIK A;  3ZYY X;  5DNF A;  5C0X J;  1TWC H;  5T1G A;  1TY0 A;  1DCZ A;  2AKW B;  5ELF A;  4S3S A;  4B9W A;  3PUX A;  1CZG A;  3BVG A;  3K5N A;  5C0X H;  1CKN B;  3IAY A;  3HFZ B;  3KLR A;  4PG3 A;  4DR5 L;  3HOU G;  1OO9 B;  3OTO L;  1NCV A;  4XYQ A;  4CKE A;  4KTA A;  3VR3 A;  1KC8 C;  3UE0 A;  5IGG A;  3JAM E;  2Z6B A;  1D1K A;  4EX5 A;  1TWA H;  2E2J H;  5IP7 G;  5DEH A;  2JN4 A;  3VR4 A;  3L3O C;  4DK1 A;  4DUZ L;  5JVH 3;  4GKK Q;  1BKB A;  2Q2H A;  2IX1 A;  2AQ2 B;  3D4R A;  1VQP A;  4DAM A;  4BBR B;  2F0N A;  2RDF A;  3HOU H;  1HR0 Q;  3BZK A;  1YJ9 A;  2Q8R E;  3TZU A;  4JI4 Q;  1OXS C;  3UI2 A;  3L9A X;  3IKJ A;  5C4X H;  3GD7 A;  2RA4 A;  1HNX Q;  1Y1W B;  3ULL A;  4DR3 L;  3HOW G;  1JOR A;  3BU2 A;  5EAY A;  1X3F A;  3RN5 A;  2FHT A;  1SR3 A;  1SE8 A;  2PZT A;  3DM1 A;  3I4O A;  1C8C A;  5C3X A;  1QZG A;  4RAU C;  1WTX A;  4G7O C;  1XNQ L;  1STN A;  4RHR A;  1JIC A;  2Y0S B;  1EWI A;  1PMR A;  1HNW Q;  4OGQ C;  4EQO A;  5C4J B;  1I50 H;  3KF8 B;  5LMN W;  1I4R A;  4HJ9 A;  5ELB A;  3KJP A;  3S2H B;  2F0W A;  2HHH Q;  3AQQ A;  1JE5 A;  1V43 A;  2BOS A;  4K8J A;  1FGU A;  1N34 L;  3HOW H;  1EQR A;  2KQ3 A;  3CCQ A;  4IOC A;  4DXF A;  1HRJ A;  4QQB X;  2XRS D;  4M8A A;  4CKB A;  3RLO A;  2AWN A;  1O78 A;  1QCB D;  1KDA A;  3D31 A;  5ELO A;  5J1Z A;  4DN4 M;  1A15 A;  4GNX A;  5KIX A;  1PTO H;  3U58 A;  4Y7N H;  1SYE A;  1CQV A;  3H6M A;  4LF4 L;  1W6K A;  3S24 A;  2VL6 A;  4C3J H;  1I4P A;  3PIP 3;  1F77 A;  1CSP A;  4WFN 3;  3SR1 A;  2FJ2 A;  4QUC A;  3A7A B;  4ZK9 B;  2MPM A;  3SE0 A;  1SYF A;  3OIP A;  1BVS A;  1JMC A;  4JW0 A;  4IN3 A;  2UXC Q;  1C4Q A;  1K8O A;  2QEX A;  1VQD A;  2NB0 A;  2F3I A;  1P16 A;  4JV5 L;  2B8F A;  3NHH A;  2F0P A;  5A35 A;  2ZJR A;  1BXT A;  4LMQ D;  1N33 Q;  5T1I A;  2JA6 G;  4P2C B;  1ZKO A;  3SDZ A;  4XXE A;  1S4Z A;  1Y69 U;  4KHZ A;  2ZJQ A;  4DA2 A;  2GA4 B;  1JB3 A;  1WVL A;  3SK4 A;  1D8L A;  4AYB G;  1BQQ T;  2RDG A;  4GNX C;  3W3A A;  2QDB A;  2EJG C;  4K5W A;  3TDQ A;  1LAC A;  1TU2 B;  3M3Y B;  3UE1 A;  4K6D A;  4A75 A;  4HJA A;  1WD0 A;  5IYB H;  2M00 A;  2JA6 H;  1AE3 A;  4OON A;  1OXU A;  2E8G A;  3HS0 C;  1I94 Q;  3HKZ G;  4POG A;  1F9P A;  1H9M A;  4B3S L;  3Q22 A;  2H5X A;  1UAP A;  4LJZ C;  3LWE A;  2K7V A;  4NW2 A;  5C44 G;  1F9S A;  2Z4H A;  5C4H A;  3TN2 A;  5GRO A;  2RF4 A;  5GAD C;  3L7Z C;  5C0X I;  4YCU A;  3KF6 B;  1CKN A;  2DJF C;  3EBE A;  2KUM A;  4C2M B;  4P75 A;  3EQL C;  1SYB A;  1AW7 A;  1UE7 A;  5GAE C;  2KCM A;  5ELD A;  2JEA I;  3K0X A;  3I8Z A;  4KHP Q;  4PZ7 A;  5K36 G;  3CCM A;  5BR8 L;  2JA8 H;  3RR5 A;  1IW7 D;  2CW0 D;  2XVS A;  4LFB L;  1R9T H;  3GTQ B;  3I3C A;  2E76 C;  2NUC A;  1DON A;  1RCV D;  1LTG D;  5I2X A;  4DR7 Q;  4LF7 L;  5LMN Q;  4V19 0;  3K7U C;  2LS0 1;  3MEH A;  1IBM Q;  1QVF A;  2O4X A;  1JQY D;  2PZU A;  4BY1 H;  3PO2 G;  4OO1 H;  2ZXP A;  2L4N A;  5M5Y H;  4JI1 Q;  2B2W C;  3NQT A;  4KJO A;  1CI3 M;  3KLS X;  5CV4 A;  2E5L L;  2PO4 A;  2F0I A;  4LK1 C;  2EYJ A;  4LUO A;  3S1R H;  4JI8 Q;  4EQN A;  3K6O A;  3RZD H;  3DM3 A;  1EWH A;  5K36 H;  5IT9 E;  1N36 Q;  1X3Q A;  1VQJ A;  4A3K G;  4TSS A;  4A3E G;  1KDB A;  4MIU A;  3BDO A;  4IPH A;  3PO3 G;  3FVQ A;  3PSI A;  4IUQ A;  2XN9 C;  5IOD A;  3KBG A;  3MFG A;  3KJO A;  2JEB I;  5M9O A;  5EBD A;  4ABN A;  5E4W C;  4X3U A;  1X3P A;  2EJM A;  3I90 A;  1J5E L;  4DUY L;  1GKH A;  2HIV A;  4DV6 Q;  2AHO B;  2R92 B;  1MSH A;  2K5N A;  4YY3 L;  4JI3 Q;  2NZH A;  4GLV B;  1NR4 A;  1Q90 A;  4A3E H;  5G3L F;  1PYS B;  1LTS D;  4HR7 B;  1VQL A;  2PQA B;  4CDE C;  1IW7 C;  2CW0 C;  2KEE A;  1UEB A;  1YHB A;  4X66 Q;  5BN5 A;  4L63 B;  1CA5 A;  1EZ8 A;  1LTT D;  3H0G H;  2AMC B;  3CW2 C;  1C9O A;  4J15 A;  4X6A H;  1ZYR D;  3PCO B;  1Q81 C;  3KUP A;  2VY3 A;  2UUC L;  3GTG B;  1KAB A;  5DAU A;  4A3J H;  4LNQ A;  2N88 A;  3M7N A;  5COY A;  2A69 C;  3GTO H;  4U67 3;  4B3R Q;  4OHJ A;  4HCS A;  3HOY B;  3NWS A;  3J80 i;  4RGM A;  4LF9 Q;  1JWS D;  2K01 A;  2R7D A;  5JJL A;  1Y8N B;  1YBY A;  1FNW A;  1RL2 A;  2DJG C;  3K59 A;  5C5M A;  3A8K E;  3FKI B;  2E2I H;  3MXP A;  1KRT A;  3WWV A;  1CKO A;  4EGV A;  4CDF C;  5F2D A;  4U68 A;  1IBK L;  4UP9 A;  2K04 A;  2UUB L;  4R4O A;  5FLM G;  4NB3 A;  4A3I B;  4GKJ Q;  1TS2 A;  2XNA C;  3GQB A;  5KNB A;  3HP3 A;  2YTV A;  2Z4I A;  2KHS A;  1EZ6 A;  1HZ9 A;  2SDF A;  1K83 B;  3JAM L;  3W1B A;  5IWA L;  4IFD J;  1PYW D;  2F3V A;  2OTJ A;  2EDG A;  3VR2 A;  4FXD A;  2MHV A;  1XMQ L;  4XQQ A;  2AUJ D;  4A3M B;  4IFD H;  1DXM A;  3BS1 A;  1NSN S;  3G6E A;  1QOH A;  1ZYR C;  3M4P A;  1EY7 A;  1IXR A;  3TZD A;  1AN8 A;  5FLM H;  2V4D A;  2KEN A;  1F2Y A;  1K0R A;  3RLF A;  5I9P A;  2VQE L;  4OX9 Q;  2NZ1 D;  2C5C A;  1Q82 C;  1FYC A;  1YEZ A;  3I2Z A;  3OOC A;  5M5X B;  4LF8 L;  1ZEQ X;  4C1N K;  4H7B A;  2JA5 H;  4YHH L;  1HPC A;  2FMC A;  1CHP D;  4O2D A;  1C7Y A;  4FYD A;  4XT3 B;  1X32 A;  1Y1V B;  3CF5 A;  1QVC A;  4APV A;  4C3H B;  1PVO A;  1H95 A;  3X3M A;  1FR3 A;  1LTB D;  2RQX A;  1GOZ A;  1I5F A;  3ONA B;  2F03 A;  4JI7 Q;  1D6E C;  5EKL A;  4GLA C;  1Q86 C;  4JI6 Q;  1Q7Y C;  1UE6 A;  4AYB B;  1B3Q A;  2MJ8 A;  4ILW A;  1Y1W G;  1HJP A;  4H13 C;  3KF6 A;  2WII B;  2D0O A;  1TS5 A;  4FF4 A;  2PW7 A;  4QGU A;  1HH2 P;  3J80 E;  5JJZ A;  4F87 A;  4JI5 L;  4BBR H;  4MTK A;  1HUM A;  1PH9 A;  4ULL A;  3HKZ B;  3FP9 A;  3SVM A;  3CMA A;  2ES2 A;  2EIF A;  2Y0S G;  3MVV A;  1NBW A;  4UP8 A;  3K8A A;  2WAC A;  4XYO A;  5M5W B;  1IKL A;  4X64 L;  1IHZ A;  1Q46 A;  2ENB A;  2QEJ C;  1HTP A;  1K73 C;  5C44 B;  5IOC A;  1FL0 A;  1HNZ Q;  4OO1 I;  1SBB B;  1L0W A;  1Y1W H;  3OHX C;  1V9P A;  2SNM A;  1SMY D;  5FLX E;  1K3B C;  4WOR A;  3NQI A;  2K5H A;  2RSO A;  2F0D A;  3CC4 A;  3J7A F;  1EQV A;  2F4V L;  4IQZ A;  4G7H C;  3TP5 A;  4QCL A;  1PTO F;  3U9S A;  4ZLT F;  3PF4 A;  1QNU A;  3RUZ A;  3PMF A;  1MJE A;  4DNR B;  4TVA B;  5C4J H;  4DV0 Q;  4JI2 Q;  2NWG A;  3S2H H;  3FRP B;  2OT2 A;  4HN7 A;  5FO8 B;  1F2L A;  5E1F A;  1TT2 A;  1JWU D;  1B44 D;  1X65 A;  1SAP A;  3PO2 B;  1ROD A;  1KQS A;  3C3L A;  3S17 B;  2F0H A;  1KAA A;  2CH4 W;  2WFW A;  1SXT A;  3NXW A;  1VQ9 A;  1UE1 A;  5ELC A;  3F8T A;  2UU9 L;  3HOX B;  4IPD A;  3M7G A;  1D5X C;  2PZW A;  3HKZ E;  4HCE A;  2LSS A;  3HG9 A;  5EPJ A;  5FO9 B;  3G7L A;  2R61 A;  4BS9 A;  2PQA A;  4A3K B;  2O5J C;  1HUN A;  3D3R A;  1G91 A;  1S5D D;  1Z7T A;  1M90 C;  3PO3 B;  4JK1 C;  3JAM i;  1NR2 A;  4J6H A;  4QY7 A;  1X56 A;  1VQH A;  1SMY C;  4KLK A;  2F0K A;  5GAG C;  4KN4 C;  1VMC A;  2A1A A;  3RN2 A;  3H3V C;  3TS0 A;  4B3T L;  5LMU Q;  2LY7 A;  3E0J A;  1N32 Q;  1VQF A;  3I91 A;  3NPP A;  4ZAI A;  3TEH B;  1A0I A;  1KRS A;  2UXD L;  3CQZ B;  5CV5 A;  5D3D A;  4C1N I;  1HNX L;  2NVQ B;  3NTH A;  2SOB A;  1DD2 A;  3F1Z A;  3NEL A;  2G9H D;  2K33 A;  5EGT A;  1W2B A;  4DR1 L;  5FJ8 G;  4K0K Q;  1X6O A;  4HIO A;  4LFA L;  4EQP A;  2R7Z B;  2F0O A;  2FXQ A;  1WTV A;  2B63 G;  3CCS A;  2OWO A;  1L0X B;  1M4V A;  3PUY A;  1A62 A;  2NVT B;  3I7F A;  2EYM A;  1SND A;  2DGY A;  3I4L A;  4QIW B;  1U5K A;  2VW9 A;  2JA7 G;  3M3Y H;  4IPC A;  4IFD I;  1WTR A;  1X54 A;  3I4N G;  3OMC A;  3QG1 A;  1CT1 D;  2EE1 A;  4OIJ A;  4OEL B;  2KHJ A;  1RF2 D;  5EPK A;  3E3X A;  1MGS A;  5CGK A;  3EA6 A;  2A68 D;  2XWJ B;  5D3I B;  1HA6 A;  1HZC A;  3CAM A;  5C3W A;  2F52 A;  3PIP A;  1S72 A;  4DR4 L;  1S5B D;  2HDM A;  3T1Y L;  2BH8 A;  5I6W A;  4RGT A;  1BF4 A;  1ONL A;  1VS0 A;  5IT9 L;  2EQS A;  1SE4 A;  4A3B B;  1GM5 A;  4CGY B;  4QJF A;  2PNR C;  1NNX A;  2X6L A;  1H9K A;  2AUK A;  1TWG B;  2QGQ A;  1OXV A;  2N78 A;  2WKC A;  5E4X A;  4C2M H;  2NVX B;  1EIF A;  1WYD A;  3NUC A;  3CD6 A;  5CR3 A;  4N9T A;  2BDO A;  4KKU A;  3K58 A;  1BCP B;  4NMZ A;  3CCR A;  3V05 A;  3CPF A;  3GTQ H;  3NBI A;  3PUZ A;  4DV7 Q;  3S15 B;  1SYC A;  4KJN A;  1PH4 A;  2K32 A;  3D6C A;  3T56 B;  4HIM A;  3HGB A;  1N33 L;  2NN6 G;  4KHV A;  2R92 G;  2B39 A;  2L11 A;  3NE5 B;  4AH6 A;  2WV6 D;  4RG1 A;  4XTC S;  2A68 C;  3PGZ A;  1EEF D;  3M4Q A;  3K0Y A;  1GXD C;  5I6Y A;  4NXM Q;  4JYA L;  1Z47 A;  3H3V H;  1TS4 A;  4GN4 B;  3CC7 A;  4F88 A;  1SE2 A;  1PFS A;  3A5Z B;  3QWN A;  3U4Z A;  2LKV A;  4C3I B;  1D2B A;  5IP7 H;  1B9M A;  3N6R A;  3T4A C;  1SJE D;  4DK3 C;  4BA2 I;  3DEP A;  2JQO A;  2VNU D;  3MZ5 A;  1EOT A;  1EY8 A;  1YZ6 A;  2UUA Q;  2PMZ B;  2R92 H;  4JI0 L;  3Q23 A;  4OWT B;  3A7L A;  3HOY G;  1CHQ D;  2N8N A;  5CBA E;  3I4M B;  5I9O A;  3UDF A;  4MNO A;  1Q8I A;  3J7Z C;  4R4T A;  3J7A 5;  2XSC A;  1UEA B;  3FKI G;  4DPG A;  3MTS A;  4X3K A;  4XQN A;  1U4P A;  2EXD A;  4DV4 L;  4GOP B;  3TQY A;  4DGZ A;  2MUY A;  1UNS A;  1A6X A;  3GTG H;  5KYI A;  3OW7 A;  1VQI A;  3R2T A;  3E9H A;  4RKL A;  1PH2 A;  2M2L A;  3HOY H;  4A3I G;  4WRD A;  5C6A A;  3I73 A;  2D0P A;  2UXB Q;  2HQL A;  2NTS A;  1KDC A;  4XDX A;  5IT9 c;  3AU7 A;  3FKI H;  2EVB A;  4DR7 L;  3W2D A;  5IYC G;  2L5T A;  4HID A;  4Q0F A;  1D5Z C;  1GUO A;  4XQJ A;  2A74 C;  3PIO 3;  1TS3 A;  5M3M B;  4A3M G;  4LFC Q;  1B2T A;  2WAQ G;  4DV1 L;  1CSQ A;  1ZXT A;  3HOZ B;  4IJH A;  2K1B A;  2L12 A;  1EU4 A;  2OEO A;  2MGS A;  4A3I H;  3U4V A;  4JI8 L;  5IY0 A;  4DR2 L;  1GVP A;  2Y0S E;  3UDG A;  2IT1 A;  2WB1 B;  1N36 L;  3GTM H;  5CMD A;  2QIL A;  1EQQ A;  2RKS A;  5ELN A;  2PCF B;  1MI2 A;  1K83 H;  4ZUJ A;  5IYC H;  4FXK C;  3S1Q H;  2EYF A;  4DFA A;  3F2C A;  1HQR D;  5LL6 X;  2ALY B;  1Y1V G;  4DR5 Q;  4C3H G;  4A3M H;  1E2Z A;  4K8I A;  1GUS A;  2V1C C;  1Q3L A;  1V1O A;  4DV6 L;  4JCV E;  1EYG A;  3J80 L;  1VQA A;  2DUD A;  2KVM A;  3K80 C;  2VB3 X;  4LF5 L;  1LT6 D;  2CVR A;  3CHB D;  3EVQ A;  1Q1B A;  2VZA A;  5M5X H;  4DUZ Q;  4R4I A;  2ZTE A;  1H9J A;  3E5S A;  4X66 L;  3MXG A;  3P1H A;  4EVO A;  3WOE A;  1X3E A;  1YNX A;  4DK6 C;  1Y1V H;  3A0J A;  4C3H H;  1LTL A;  2NZO A;  3OWE B;  3VYS A;  3EFX D;  3W5O A;  4CJ0 B;  2MP1 A;  2OXP A;  3CCL A;  2B2W A;  2F0F A;  2B2U A;  4DV3 L;  2HQE A;  1SYD A;  1LAB A;  2B63 B;  4IJL A;  1SNM A;  4X3T A;  5A2Q L;  1VF7 A;  4XT1 B;  4K6L A;  4DR3 Q;  1G2S A;  3M85 A;  1J8I A;  5FK9 C;  1BR9 A;  4LAA A;  1XXG A;  2J4X A;  3HOV B;  3O13 A;  1SE3 A;  2JA7 B;  2ZXR A;  2J0T D;  3CRL C;  1BCP D;  4KY5 A;  3I4N B;  2C9O A;  1F9R A;  1JR0 D;  3QIA A;  5CV9 A;  2IJ0 A;  1LV9 A;  1HTL D;  3K7A B;  4G7Z C;  1N9W A;  2A8V A;  2XGT A;  5M5W H;  2K14 A;  1XJV A;  3GTJ B;  2E75 C;  1V1Q A;  1ICF B;  5C44 H;  3NEM A;  4YCW A;  1I3Q B;  1N34 Q;  1EY6 A;  4A93 B;  2YV5 A;  2K03 A;  2YU9 B;  1ET9 A;  1V8Q A;  3STB D;  1SFO H;  1YNN D;  3A54 A;  4O42 A;  1HXY D;  2LMC B;  5J22 A;  2I07 B;  2YYZ A;  2F3W A;  4R8N A;  2A69 D;  1QUQ B;  4O1N A;  2E2H B;  4ID6 A;  3ER0 A;  3L0O A;  2B2U C;  4G57 A;  2CQO A;  2VXW A;  1STG A;  4DV5 L;  3BDL A;  4JC0 A;  4PZ6 A;  2EZV A;  3HOX G;  3ZJY C;  4I7A A;  1EQT A;  5IGB A;  3T51 B;  2OQ0 A;  5DM7 3;  3KDF B;  3M9B A;  5KNC A;  1PH7 A;  1XNR L;  2E2J B;  1SRO A;  4LF4 Q;  1RJT A;  5J3B A;  2L0C A;  3A56 A;  1PHJ A;  3SXH A;  3GDE A;  4XIG S;  4JBM A;  4PMC A;  1F9Q A;  3PO2 H;  3FDT A;  3CKI B;  4KMU C;  4MHE A;  1Z6H A;  1EY5 A;  3DWQ A;  4HJ8 A;  3D0F A;  1BCP C;  4B9X A;  1YHQ A;  1I4X A;  1RTO A;  3J80 c;  1EYA A;  1UWV A;  3HOX H;  4ZKC B;  2QF7 A;  4IPG A;  4A3C G;  4G4K A;  3KF8 A;  4X65 L;  1KL9 A;  1PRT B;  2IY5 B;  2IPK D;  1O7Z A;  2DNC A;  4A3K H;  2RSN A;  3G71 A;  1E22 A;  4A3G B;  4QB4 A;  2J7Z A;  3BVZ A;  4GOP A;  3PO3 H;  4GLX A;  1SRU A;  5JEA G;  1BBW A;  3QOJ A;  4JPB W;  4QL5 A;  2TSS A;  3STB C;  2KCC A;  4NXN L;  2VUM B;  1YNN C;  2HCI A;  1FJG L;  2QA4 A;  1IBL L;  4IUV A;  5JJI A;  1B8A A;  2K52 A;  1E2V A;  3U50 C;  1Q12 A;  4K5V A;  2R7Z G;  4P73 A;  5JJK A;  3DUZ A;  2ID0 A;  4K2K A;  2ASB A;  3BVM A;  1ASZ A;  2PYK A;  4ODG A;  3CQZ H;  1VQB A;  3DMU A;  2NVQ H;  1FGB D;  3CU7 A;  3BYY B;  3C1E A;  5JEA H;  4IUU A;  2CH4 A;  1EL0 A;  3MC0 B;  2PW5 A;  3T1H L;  1A3V A;  2E74 C;  4B3S Q;  1RDP D;  4Q5V A;  1WI5 A;  3VA5 A;  1JJG A;  5LHY 1;  4A3D G;  4WJW A;  4LUV A;  5IYD G;  3GTL B;  1JOK A;  4DK0 A;  1QWY A;  4CJ1 B;  3GTK B;  2BCO A;  4GOP C;  4PNY A;  4GN5 A;  5FO7 B;  2Z8L A;  3E0E A;  4MZ9 A;  3QR8 A;  4A3B G;  4BA1 I;  1NUC A;  5GAH C;  1S5E D;  3AFP A;  4BXX G;  1B4O A;  4HMI A;  1BBX C;  1G6Z A;  1YI2 A;  5HY6 A;  2PQE A;  4BY7 B;  2WAQ B;  1STA A;  3K81 C;  1CK1 A;  1VQG A;  1U9R A;  4KKT A;  4CHT B;  3S1N B;  1X3G A;  3TME A;  2D5D A;  1PZK D;  3KLS A;  5IYD H;  4OL7 A;  4LF7 Q;  1A63 A;  5I4D A;  1JJC B;  1AE2 A;  4UY8 C;  3HEJ A;  3C1F A;  1RHP A;  4IUP A;  1QZH A;  1RIP A;  4A3B H;  1WFQ A;  1L1O B;  3KOJ A;  1VQ7 A;  3C46 A;  4DAY B;  1SSO A;  4BXX H;  1TWG H;  1STY A;  3GO5 A;  5CBE E;  1FVI A;  2NVX H;  4IUN A;  4V0B A;  2K5D A;  3B6Y A;  2JE6 I;  2E5L Q;  2HT1 A;  3ICE A;  2B3G A;  1DJR D;  1NMG A;  5AJ3 L;  4RA8 A;  4RGN A;  2MO1 A;  5EQ0 A;  3J81 i;  4UHV A;  1VQC A;  2NYZ D;  2C35 B;  1N32 L;  3RZO B;  4DR6 L;  4C3I G;  3NWT A;  2O2L D;  5CYU A;  4OWW B;  1WTO A;  3S15 H;  1EIH A;  1J5E Q;  4RKB A;  3SK5 A;  2OTL A;  2EY2 A;  2PPB C;  1VQN A;  3S2D B;  4YY3 Q;  1ET6 A;  2Q2T A;  2WAQ E;  2EOT A; 
#chains in the Genus database with same CATH homology
 3PV0 A;  3Q24 A;  3N52 A;  2ICI A;  1OXT A;  2B8G A;  2JSO A;  1A2U A;  4N9P A;  1LT3 D;  1JE4 A;  2RBM A;  5KND A;  1SNO A;  1B53 A;  1STH A;  4K14 A;  3P20 A;  1O7L A;  4CJ2 C;  1ML0 D;  2B2V A;  5M3F B;  1PFM A;  1B9N A;  4PQX A;  1I6H B;  5ELE A;  2F0L A;  1DOL A;  5KEE A;  1ESF A;  1I4G A;  1PRT D;  3H09 A;  3DWP A;  4RWS C;  2CQA A;  1ENA A;  3S1R B;  3RZD B;  2K6A A;  3LX0 A;  1UUP A;  3ND8 A;  2IL8 A;  1GUG A;  3I70 A;  3FPP A;  5EBC A;  3D4W A;  5EKI A;  1DZ1 A;  3GP7 A;  1JOQ A;  4UDU C;  1LTI D;  1GUN A;  3J81 E;  2EPB A;  3WOF A;  1ENF A;  1A3U A;  5JPM C;  1O7Y A;  3LNN A;  3J7Y W;  2F4I A;  2B2V C;  3SHL A;  2F1M A;  2KJX A;  3H91 A;  1DOK A;  4ZUI A;  1F2Z A;  1LT5 D;  1T5X D;  1CQF A;  1KNA A;  1GHK A;  1GUW A;  1TWH B;  2WP8 J;  1DOM A;  5CV7 A;  1WTP A;  1PRT C;  2L55 A;  4UAI A;  1CTM A;  3H94 A;  1EYD A;  3SEB A;  5KYL A;  3TP8 A;  3F2U A;  1QB5 D;  5C5L A;  3M4O B;  1KLU D;  2VB2 X;  3RMH A;  3MHB A;  3QB3 A;  5EPL A;  2RDH A;  3MFY A;  1SNQ A;  1VF5 C;  1IKM A;  1WCM B;  4A3D B;  3X3N A;  4QF4 A;  3URY A;  1NAP A;  3NK9 A;  4DAY A;  5IGD A;  1T5E A;  3TBI B;  1MBY A;  2EY6 A;  3LWU A;  5KRU A;  4RHS A;  5C0X G;  2HDL A;  3M4Y A;  5NUC A;  3S14 B;  1HHV A;  3SK6 A;  2AQ3 B;  5C3E B;  3FMC A;  1ILP A;  2CHB D;  3C2P A;  1H9S B;  3DWA A;  1B50 A;  3EJI A;  1V1P B;  4C56 C;  4IZ8 A;  1TR5 A;  2ZXO A;  3HRZ C;  2L9H A;  1LLR D;  2LFN A;  4KI0 A;  2JA5 B;  3QJY A;  4RGO S;  2AQ1 B;  1O80 A;  1VCI A;  4JBW A;  4NDX A;  3BYT B;  1BOS A;  2Q8T A;  1RKN A;  3J7A V;  1AEX A;  4TRD A;  2BA0 A;  2H1E A;  3QOL A;  2ICE C;  4MN3 A;  1EY0 A;  4F7X A;  5D65 A;  1IYV A;  5EJW A;  2EJF C;  1SNC A;  2NN6 H;  2JP1 A;  3CRK C;  2G9D A;  5K5P A;  2A6H C;  5JOB A;  5JAV A;  3BDC A;  1AP0 A;  4RH6 A;  2OF1 A;  3TP6 A;  1PDQ A;  4CKC A;  4M1U B;  3S1M B;  2KED A;  4KKS A;  4I65 A;  3ITP A;  4KY6 A;  3R93 A;  4J8Q A;  1EY9 A;  1B3A A;  1WD1 A;  1Q1E A;  3MWY W;  2EYO A;  2JXM B;  1RTN A;  1I6V C;  4TKO B;  4X3S A;  1WTQ A;  1CA6 A;  4FNF A;  3T16 A;  2EYL A;  2ZT9 C;  2FIN B;  4E6I A;  1Y8O B;  1ILQ A;  2XIW A;  4C3J G;  1HFN A;  2IWH A;  2I46 A;  2WKD A;  3A55 A;  4KN7 C;  3T53 B;  1E2W A;  1EY4 A;  4BBS B;  4A3F B;  3NP8 A;  3OIQ A;  2BE5 D;  1D1I A;  2DN8 A;  2EY5 A;  1PLF A;  5CV8 A;  1SYG A;  2EXZ A;  3IL8 A;  1XYI A;  4K2L A;  1GUT A;  2A5H A;  1BCP F;  2WIN B;  1TWF B;  2N55 A;  1II3 A;  4PV1 C;  1YNJ D;  1CM9 A;  2D2C C;  3S16 B;  2F0E A;  3DEO A;  3G6J B;  3GV6 A;  1IL8 A;  4HAE A;  4HSV A;  2SEB D;  2O5I C;  5AFW A;  2F0Q A;  1BDO A;  4HTH A;  4FVM A;  4RCO A;  1EWC A;  3PUW A;  1SDF A;  3PUV A;  1XTC D;  3DXJ C;  1DM0 B;  4QUF A;  5FLX L;  4J1M A;  4HSP A;  2KEC A;  2H4O A;  5IGE A;  3GTP B;  5BN4 A;  3Q0A A;  2BE5 C;  2E2D C;  2R93 B;  2IW3 A;  5CV6 A;  3MAQ A;  2F0T A;  5E3F A;  2L1B A;  3Q6S A;  3AB9 A;  3MXU A;  1JCK B;  4I7Z C;  1H9S A;  2NVY B;  2QKI C;  1V1P A;  3VR6 A;  1YNJ C;  3R3O A;  2NTT A;  4HED A;  1LO5 D;  3V96 A;  5COR A;  1LTR D;  2M9V A;  1J9O A;  4OO1 G;  4TQU S;  1TWC B;  2X69 A;  1TVX A;  3P7J A;  3QO2 A;  2F0J A;  5TSS A;  1GJX A;  5C4Z A;  4ZKB B;  3J81 L;  1S5F D;  3HZX A;  4YIJ A;  1ICW A;  1TWA B;  3P75 A;  1QNK A;  1RD9 D;  1TKW B;  1AZP A;  4ZQ3 A;  2KOL A;  1AFP A;  4R8I A;  4PMW A;  2NN6 I;  5LL6 S;  3NBH A;  2F0V A;  4ZRZ A;  3HOU B;  1U4L A;  1IYU A;  3VR5 A;  5I2Y A;  4KD4 A;  5C4X B;  1STE A;  4KK7 A;  2XRQ D;  1KLG D;  1U4R A;  5D14 A;  3TP7 A;  1HCZ A;  1ENC A;  3D6W A;  2R6G A;  1XWE A;  5DM6 3;  1D5M C;  2K5W A;  1I50 B;  5J39 A;  3K5L A;  1EU3 A;  2IX0 A;  5JEA J;  1BNZ A;  2K05 A;  3OMG A;  2BA1 A;  2RVL A;  1CFM A;  3HOW B;  4IAL A;  1HQM C;  4FXG C;  2R3Z A;  3OWF A;  1I4Q A;  2A73 B;  2FFK B;  4DXG A;  5CC4 A;  1BUV T;  1PTO B;  4Y7N B;  3SK8 A;  2Q8I B;  4C3J B;  3TSS A;  3KBX A;  3U9O A;  4IFD G;  3BZD B;  3A8J E;  2K5Q A;  2EY1 A;  4FF3 A;  1EFI D;  2HCC A;  2XWB B;  3R2I A;  3GTM B;  1MSG A;  1LTA D;  2KA7 A;  2F0M A;  5G3L D;  4KY7 A;  4IUT A;  1AZQ A;  4L6T B;  3S1Q B;  2KCN A;  4RCN A;  3E6Z X;  4L8J A;  1JWM D;  1QG7 A;  2X6G A;  3T13 A;  3D4D A;  1KTK A;  3AMU A;  3NTK A;  1VMP A;  1JC7 A;  2IX3 A;  4R9W A;  1EYC A;  1MD2 D;  2DY8 A;  3V2T A;  1WTW A;  3MA2 B;  2F0U A;  1W6J A;  1TY2 A;  3NSW A;  3FEW X;  1PRT F;  2Z1C A;  2JA6 B;  2A6E D;  1QJO A;  4IUR A;  1Y8P B;  4QMG A;  1E0B A;  2QCP X;  4RFB A;  1QE6 A;  1TII D;  3ERO A;  2K28 A;  4PMB A;  4KV6 A;  4FF2 A;  5HUR A;  1BO0 A;  3K5M A;  2DY7 A;  3NTI A;  3IFT A;  1U4M A;  1ESR A;  3IFD A;  2JA8 B;  5EKK A;  1R9T B;  3KK7 A;  3DHQ A;  5HGT A;  3BG3 A;  4CBV A;  3GV3 A;  1SFO B;  1CZW A;  2BDN A;  4FP5 D;  4H44 C;  4FF1 A;  4BY1 B;  1FNV A;  1C48 A;  5M5Y B;  2TMP A;  2EYH A;  3A8I E;  4K5X A;  2D62 A;  5A2Q E;  3FPU B;  5IGC A;  1EIG A;  2A6E C;  3K57 A;  1S5C D;  2B2Y A;  1K8M A;  3OPO A;  1HA5 A;  5FKA C;  4HMJ A;  1R4P B;  4DAP A;  3VYT A;  1H9R A;  3D8G A;  1XX8 A;  4FO2 A;  3OSO A;  4BWG B;  3MXN A;  1HFG A;  1QIL A;  4Z9C B;  5IIF A;  1G2T A;  3K5O A;  4A3E B;  4NP5 A;  3ND9 A;  1SJH D;  3WDN A;  2FMM A;  3H0G B;  2NBF A;  1FD7 D;  5FOB B;  4NKL A;  5KGU A;  1KNE A;  1JOO A;  1B1Z A;  3RD4 A;  2B2T A;  4ME5 A;  4A3J B;  2JYO A;  1PTO D;  1A3T A;  1PFN A;  3GTO B;  2B2Y C;  1PZI D;  2F0S A;  5JPN C;  1GHJ A;  1M8A A;  4H0L C;  1VDZ A;  1A2T A;  4ZYS A;  4GZY C;  2E2I B;  4KD3 A;  4B08 A;  1DYQ A;  1L0Y B;  5JVG 3;  1FNU A;  4DNT B;  1PZJ D;  5IGF A;  1LT4 D;  4DU9 A;  1PXU A;  4F8M A;  1F2M A;  5BN3 A;  1R4Q B;  2SNS A;  1STB A;  3VA7 A;  3I72 A;  1G29 1;  3VYU A;  5ISR A;  3VYR A;  2DNE A;  1SEB D;  2B2T C;  2HUG A;  1PFB A;  3S9W A;  1TQO A;  1OXX K;  2D9U A;  2AWO A;  2A6H D;  1PTO C;  4DF7 A;  4DAV A;  3R8B A;  1SNP A;  2F0G A;  1I4H A;  1G8Z D;  2EYP A;  3ERQ A;  1EEI D;  4OIK A;  3ZYY X;  5DNF A;  5C0X J;  5T1G A;  1TY0 A;  1DCZ A;  5ELF A;  4S3S A;  4B9W A;  3PUX A;  1CZG A;  3BVG A;  3K5N A;  5C0X H;  3IAY A;  3KLR A;  1OO9 B;  1NCV A;  4XYQ A;  4CKE A;  4KTA A;  3VR3 A;  5IGG A;  3JAM E;  1D1K A;  5DEH A;  3VR4 A;  3L3O C;  4DK1 A;  5JVH 3;  2IX1 A;  2AQ2 B;  3D4R A;  4BBR B;  2F0N A;  2RDF A;  2Q8R E;  3TZU A;  1OXS C;  3UI2 A;  3L9A X;  3IKJ A;  3GD7 A;  2RA4 A;  1Y1W B;  1JOR A;  2FHT A;  2PZT A;  3DM1 A;  1C8C A;  5C3X A;  4G7O C;  4RAU C;  1WTX A;  1STN A;  4RHR A;  1JIC A;  2Y0S B;  1PMR A;  4OGQ C;  4EQO A;  5C4J B;  1I4R A;  5ELB A;  3S2H B;  2F0W A;  1V43 A;  2BOS A;  4K8J A;  2KQ3 A;  4DXF A;  1HRJ A;  2XRS D;  4M8A A;  4CKB A;  2AWN A;  1O78 A;  1QCB D;  1KDA A;  3D31 A;  5J1Z A;  4DN4 M;  1A15 A;  5KIX A;  1PTO H;  1CQV A;  1SYE A;  3H6M A;  1W6K A;  1I4P A;  3PIP 3;  1F77 A;  4WFN 3;  3SR1 A;  2FJ2 A;  4QUC A;  3A7A B;  4ZK9 B;  2MPM A;  3SE0 A;  1SYF A;  3OIP A;  4IN3 A;  1C4Q A;  1K8O A;  2NB0 A;  2B8F A;  3NHH A;  2F0P A;  5A35 A;  1BXT A;  4LMQ D;  5T1I A;  4P2C B;  1ZKO A;  3SDZ A;  4XXE A;  1S4Z A;  1Y69 U;  4KHZ A;  4DA2 A;  2GA4 B;  1JB3 A;  1WVL A;  3SK4 A;  1BQQ T;  2RDG A;  3W3A A;  2QDB A;  2EJG C;  4K5W A;  3TDQ A;  1LAC A;  1TU2 B;  3M3Y B;  4K6D A;  1WD0 A;  2M00 A;  1OXU A;  3HS0 C;  1F9P A;  1H9M A;  3Q22 A;  1UAP A;  4LJZ C;  3LWE A;  2K7V A;  4NW2 A;  1F9S A;  2Z4H A;  5C4H A;  3TN2 A;  3L7Z C;  5C0X I;  2KUM A;  4C2M B;  3EQL C;  1SYB A;  1AW7 A;  5ELD A;  2JEA I;  3I8Z A;  5K36 G;  1IW7 D;  2CW0 D;  2XVS A;  3GTQ B;  3I3C A;  2E76 C;  2NUC A;  1DON A;  1RCV D;  1LTG D;  5I2X A;  4V19 0;  2LS0 1;  3MEH A;  2O4X A;  1JQY D;  2PZU A;  4OO1 H;  2ZXP A;  2L4N A;  2B2W C;  3NQT A;  4KJO A;  1CI3 M;  3KLS X;  5CV4 A;  2PO4 A;  2F0I A;  4LK1 C;  2EYJ A;  4EQN A;  3K6O A;  1EWH A;  5K36 H;  5IT9 E;  1X3Q A;  4TSS A;  1KDB A;  4MIU A;  3BDO A;  3FVQ A;  4IUQ A;  2XN9 C;  5IOD A;  3KBG A;  3MFG A;  2JEB I;  5M9O A;  5EBD A;  4ABN A;  5E4W C;  4X3U A;  1X3P A;  2EJM A;  3I90 A;  2R92 B;  1MSH A;  1NR4 A;  1Q90 A;  5G3L F;  1LTS D;  4HR7 B;  1IW7 C;  2CW0 C;  2KEE A;  5BN5 A;  4L63 B;  1CA5 A;  1EZ8 A;  1LTT D;  1ZYR D;  3KUP A;  3GTG B;  1KAB A;  5DAU A;  3M7N A;  2N88 A;  5COY A;  2A69 C;  4U67 3;  4OHJ A;  4HCS A;  3HOY B;  3NWS A;  4RGM A;  1JWS D;  2K01 A;  1Y8N B;  1FNW A;  3K59 A;  5C5M A;  3A8K E;  3FKI B;  3MXP A;  4EGV A;  5F2D A;  4U68 A;  2K04 A;  4A3I B;  1TS2 A;  2XNA C;  3GQB A;  5KNB A;  3HP3 A;  2Z4I A;  2KHS A;  1EZ6 A;  2SDF A;  1K83 B;  3JAM L;  4IFD J;  1PYW D;  2F3V A;  2EDG A;  3VR2 A;  4FXD A;  2MHV A;  4XQQ A;  2AUJ D;  4A3M B;  4IFD H;  1DXM A;  3BS1 A;  1NSN S;  1QOH A;  1ZYR C;  1EY7 A;  3TZD A;  1AN8 A;  2V4D A;  1F2Y A;  3RLF A;  5I9P A;  2NZ1 D;  2C5C A;  1FYC A;  3OOC A;  5M5X B;  1ZEQ X;  4C1N K;  4H7B A;  1HPC A;  2FMC A;  1CHP D;  4FYD A;  4XT3 B;  1X32 A;  1Y1V B;  4C3H B;  3X3M A;  1FR3 A;  1LTB D;  2RQX A;  1GOZ A;  3ONA B;  2F03 A;  1D6E C;  5EKL A;  4AYB B;  2MJ8 A;  4ILW A;  4H13 C;  2WII B;  1TS5 A;  4FF4 A;  2PW7 A;  3J80 E;  5JJZ A;  4F87 A;  1HUM A;  4ULL A;  3HKZ B;  3SVM A;  3MVV A;  4XYO A;  2WAC A;  5M5W B;  1IKL A;  1IHZ A;  2ENB A;  2QEJ C;  1HTP A;  5C44 B;  5IOC A;  4OO1 I;  1SBB B;  3OHX C;  2SNM A;  1SMY D;  5FLX E;  4WOR A;  3NQI A;  2RSO A;  2F0D A;  3J7A F;  1EQV A;  4IQZ A;  4G7H C;  3TP5 A;  4QCL A;  1PTO F;  3U9S A;  4ZLT F;  1QNU A;  3RUZ A;  3PMF A;  4DNR B;  2NWG A;  3FRP B;  2OT2 A;  4HN7 A;  5FO8 B;  1F2L A;  5E1F A;  1TT2 A;  1JWU D;  1B44 D;  1SAP A;  3PO2 B;  1ROD A;  3C3L A;  3S17 B;  2F0H A;  1KAA A;  1SXT A;  3NXW A;  5ELC A;  3HOX B;  3M7G A;  1D5X C;  2PZW A;  4HCE A;  3HG9 A;  5EPJ A;  5FO9 B;  3G7L A;  2R61 A;  4BS9 A;  4A3K B;  2O5J C;  1HUN A;  3D3R A;  1G91 A;  1S5D D;  1Z7T A;  3PO3 B;  4JK1 C;  1NR2 A;  4J6H A;  1SMY C;  2F0K A;  4KN4 C;  1VMC A;  3H3V C;  2LY7 A;  3E0J A;  3I91 A;  3NPP A;  4ZAI A;  3CQZ B;  5CV5 A;  5D3D A;  4C1N I;  2NVQ B;  3NTH A;  2SOB A;  1DD2 A;  2G9H D;  2K33 A;  5EGT A;  4EQP A;  2R7Z B;  2F0O A;  1WTV A;  1L0X B;  1M4V A;  3PUY A;  2NVT B;  2EYM A;  1SND A;  3I4L A;  4QIW B;  4IFD I;  1WTR A;  3OMC A;  3QG1 A;  1CT1 D;  2EE1 A;  4OIJ A;  1RF2 D;  5EPK A;  1MGS A;  5CGK A;  3EA6 A;  2A68 D;  2XWJ B;  5D3I B;  1HA6 A;  5C3W A;  1S5B D;  2HDM A;  5I6W A;  4RGT A;  1BF4 A;  1ONL A;  5IT9 L;  1SE4 A;  4A3B B;  4CGY B;  2PNR C;  2X6L A;  1H9K A;  2AUK A;  1TWG B;  1OXV A;  2WKC A;  5E4X A;  2NVX B;  3NUC A;  5CR3 A;  4N9T A;  2BDO A;  4KKU A;  3K58 A;  1BCP B;  4NMZ A;  3V05 A;  3NBI A;  3PUZ A;  3S15 B;  1SYC A;  4KJN A;  2K32 A;  3D6C A;  3T56 B;  3HGB A;  2NN6 G;  4KHV A;  2B39 A;  2L11 A;  3NE5 B;  2WV6 D;  4XTC S;  2A68 C;  1EEF D;  3K0Y A;  1GXD C;  5I6Y A;  1Z47 A;  1TS4 A;  4F88 A;  1SE2 A;  3QWN A;  2LKV A;  4C3I B;  1D2B A;  1B9M A;  3N6R A;  3T4A C;  1SJE D;  4BA2 I;  3DEP A;  2VNU D;  3MZ5 A;  1EOT A;  1EY8 A;  2PMZ B;  3Q23 A;  3A7L A;  1CHQ D;  5CBA E;  3I4M B;  5I9O A;  1Q8I A;  2XSC A;  1UEA B;  3MTS A;  4X3K A;  4XQN A;  1U4P A;  4DGZ A;  2MUY A;  1UNS A;  1A6X A;  5KYI A;  3OW7 A;  3R2T A;  4RKL A;  2M2L A;  4WRD A;  5C6A A;  3I73 A;  2NTS A;  1KDC A;  4XDX A;  3AU7 A;  2EVB A;  3W2D A;  2L5T A;  4Q0F A;  1D5Z C;  1GUO A;  4XQJ A;  2A74 C;  3PIO 3;  1TS3 A;  5M3M B;  1B2T A;  1ZXT A;  3HOZ B;  2K1B A;  2L12 A;  1EU4 A;  2OEO A;  2MGS A;  2IT1 A;  2WB1 B;  5CMD A;  2QIL A;  2RKS A;  2PCF B;  1MI2 A;  4ZUJ A;  4FXK C;  2EYF A;  4DFA A;  1HQR D;  5LL6 X;  4C3H G;  1E2Z A;  4K8I A;  1GUS A;  1Q3L A;  1V1O A;  3J80 L;  2KVM A;  2VB3 X;  1LT6 D;  2CVR A;  3CHB D;  3EVQ A;  1Q1B A;  1H9J A;  3E5S A;  3MXG A;  3P1H A;  4EVO A;  3WOE A;  3OWE B;  3VYS A;  3EFX D;  4CJ0 B;  2MP1 A;  2OXP A;  2B2W A;  2F0F A;  2B2U A;  2HQE A;  1SYD A;  1LAB A;  2B63 B;  1SNM A;  4X3T A;  5A2Q L;  1VF7 A;  4XT1 B;  4K6L A;  1G2S A;  3M85 A;  1J8I A;  5FK9 C;  1BR9 A;  4LAA A;  1XXG A;  2J4X A;  3HOV B;  3O13 A;  1SE3 A;  2JA7 B;  2ZXR A;  2J0T D;  3CRL C;  1BCP D;  4KY5 A;  3I4N B;  2C9O A;  1F9R A;  1JR0 D;  3QIA A;  5CV9 A;  2IJ0 A;  1LV9 A;  1HTL D;  3K7A B;  4G7Z C;  3GTJ B;  2E75 C;  1I3Q B;  1EY6 A;  4A93 B;  2YU9 B;  2K03 A;  1ET9 A;  1V8Q A;  1YNN D;  3A54 A;  4O42 A;  1HXY D;  2LMC B;  5J22 A;  2I07 B;  2YYZ A;  2F3W A;  4R8N A;  2A69 D;  4O1N A;  2E2H B;  4ID6 A;  2B2U C;  4G57 A;  2VXW A;  1STG A;  3BDL A;  2EZV A;  1EQT A;  5IGB A;  3T51 B;  2E2J B;  5DM7 3;  5KNC A;  1RJT A;  2L0C A;  3A56 A;  3SXH A;  4XIG S;  4PMC A;  1F9Q A;  3FDT A;  3CKI B;  4KMU C;  4MHE A;  1Z6H A;  1EY5 A;  3DWQ A;  1BCP C;  4B9X A;  1I4X A;  1RTO A;  1EYA A;  4ZKC B;  2QF7 A;  4G4K A;  3KF8 A;  1PRT B;  2IPK D;  1O7Z A;  2DNC A;  2RSN A;  4A3G B;  4QB4 A;  2J7Z A;  3BVZ A;  5JEA G;  3QOJ A;  2TSS A;  2KCC A;  2VUM B;  1YNN C;  2HCI A;  4IUV A;  1E2V A;  1Q12 A;  4K5V A;  3DUZ A;  2ID0 A;  4K2K A;  3BVM A;  2PYK A;  4ODG A;  3DMU A;  1FGB D;  3CU7 A;  3BYY B;  3C1E A;  5JEA H;  4IUU A;  1EL0 A;  3MC0 B;  2PW5 A;  1A3V A;  2E74 C;  1RDP D;  4Q5V A;  3VA5 A;  5LHY 1;  4WJW A;  3GTL B;  1JOK A;  4DK0 A;  1QWY A;  4CJ1 B;  3GTK B;  2BCO A;  4PNY A;  5FO7 B;  2Z8L A;  4BA1 I;  1NUC A;  1S5E D;  1B4O A;  4HMI A;  1BBX C;  1G6Z A;  2PQE A;  4BY7 B;  2WAQ B;  1STA A;  1CK1 A;  1U9R A;  4KKT A;  4CHT B;  3S1N B;  3TME A;  2D5D A;  1PZK D;  3KLS A;  4OL7 A;  5I4D A;  3HEJ A;  3C1F A;  1RHP A;  4IUP A;  3C46 A;  1SSO A;  1STY A;  3GO5 A;  5CBE E;  4IUN A;  4V0B A;  2K5D A;  2JE6 I;  1DJR D;  4RA8 A;  4RGN A;  5EQ0 A;  2NYZ D;  3RZO B;  4C3I G;  3NWT A;  2O2L D;  5CYU A;  1WTO A;  1EIH A;  4RKB A;  3SK5 A;  2EY2 A;  2PPB C;  3S2D B;  1ET6 A;  2EOT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...