5I9OA

Crystal structure of staphylococcal nuclease variant delta+phs l36k l103k at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
b'LHKEPATLIKAIDGDTVKLMYKGQPMTFRKLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEAKVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS L36K L103K at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 35
structure length 129
sequence length 129
chains with identical sequence B
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5i9oA00
2WACA 3SK4A 2OF1A 4MIUA 1STHA 2EY1A 2KHSA 1EYAA 3DMUA 3QOLA 4QMGA 2F0UA 1STAA 3SXHA 5KRUA 4K8IA 1SYFA 3S9WA 1KDAA 2O4XA 3U9OA 4PMBA 5C3XA 3SHLA 5C4HA 5IGDA 5C4ZA 5C6AA 5IGGA 5KIXA 5KYIA 5C5LA 2PW5A 3EROA 2OXPA 3NHHA 3TMEA 2F3WA 1EY4A 4EQNA 4DF7A 5CV7A 5KGUA 2F0IA 1SNDA 1NUCA 1EY0A 1EY7A 1EY9A 5EGTA 2PZTA 4K5WA 5J39A 5KEEA 5J22A 4PMCA 5E3FA 5K5PA 4KHVA 2EY6A 1SYBA 2F0HA 2PYKA 4IUNA 1SNCA 1STNA 2F0SA 1JOOA 3D6CA 4HTHA 4KJNA 1ENCA 1KABA 3SK5A 3VA5A 3P75A 5F2DA 5I9OA 3HZXA 4NMZA 4F8MA 3MHBA 5IGFA 2EYHA 3MEHA 4ID6A 4KV6A 5HGTA 1AEXA 1KAAA 1ENAA 2NUCA 4KY5A 5JAVA 5I9PA 3EVQA 3T16A 3QOJA 2F0TA 3BDCA 4S3SA 3SK6A 5I6WA 4DFAA 4HMJA 4RKLA 1U9RA 2F0KA 3SR1A 4EQOA 4N9TA 2F0EA 1EZ6A 2PQEA 1EYDA 4K6DA 1TQOA 1A2TA 2SNSA 2F0FA 3RUZA 1JOKA 2F0DA 4OL7A 1A2UA 4ZUJA 2LKVA 4K5VA 3C1FA 1TT2A 2KQ3A 1EZ8A 3P1HA 4WRDA 5CV9A 3OWFA 3SK8A 3OMCA 1A3UA 1SNQA 4IZ8A 4I65A 4DGZA 3LX0A 1F2MA 1SNPA 4QF4A 2OEOA 2RBMA 3NQTA 1EY6A 5CGKA 3ITPA 2F0LA 4IALA 4ZUIA 2F0GA 5CC4A 4YIJA 2PZUA 2F0OA 3E5SA 1EY8A 3TP6A 1EQVA 2RKSA 1STBA 2EYOA 4ODGA 3TP5A 3QB3A 4J1MA 2EYMA 5DAUA 3EJIA 1F2ZA 2EYPA 4KTAA 4WORA 5IOCA 2F0PA 5DEHA 3MVVA 4K8JA 5E1FA 4K2KA 5I6YA 1JORA 5HURA 4J6HA 1NSNS 3C1EA 3DHQA 2EY2A 3T13A 5IODA 1SYGA 1SYCA 1TR5A 3D4DA 3NK9A 4G57A 5IGBA 5CV4A 2PZWA 4KD3A 4EQPA 4QB4A 5J1ZA 5ISRA 3NP8A 4ME5A 1JOQA 2F0JA 5KYLA 2F0QA 1EY5A 3BDLA 3H6MA 4B9WA 1RKNA 5CV5A 5CR3A 4LAAA 2F0NA 3MZ5A 4NDXA 2RDFA 5NUCA 5EKKA 3MXPA 4HMIA 2F3VA 1SYEA 3D4WA 4F7XA 5IGCA 1A3VA 5C5MA 3D8GA 1SYDA 4N9PA 4B9XA 4EVOA 5C3WA 5M9OA 4K5XA 2EY5A 2F0WA 4NKLA 2HQEA 1KDCA 1STGA 4K14A 4ZQ3A 3TP8A 2SNMA 4H7BA 4TRDA 5JOBA 3PMFA 2EXZA 3TP7A 1SNOA 3V2TA 4KD4A 2QDBA 2EYLA 1SNMA 3R3OA 4NP5A 5CV8A 4RKBA 1EYCA 3OMGA 1F2YA 4KY6A 4KY7A 2ENBA 5CV6A 1A3TA 4K2LA 5IIFA 3OSOA 4KJOA 5IGEA 1II3A 2EYFA 3NXWA 2EYJA 2M00A 1IHZA 3NUCA 5EKLA 4PNYA 4DU9A 3HEJA 1KDBA 1STYA 2F0MA 4R8NA 4E6IA 3ERQA 2F0VA 2SOBA 2PW7A
chains in the Genus database with same CATH superfamily
1BR9A 3D6WA 3SK4A 2K33A 2QEJC 1AFPA 2JE6I 5IYDG 4KHPQ 1MI2A 2A8VA 3GTJB 4JV5L 2ICIA 4HCSA 4PMBA 4BXXG 2VW9A 2N88A 2QCPX 4IUUA 2B2YC 5I4DA 1Z47A 2UXCQ 2XRSD 2RVLA 1VF7A 1WD0A 1IZ6A 4GLVB 2EJGC 1SDFA 2GVBA 4PMCA 1GUNA 1O80A 1SEBD 3CMAA 4AQYQ 4A3JG 2EY6A 2L4NA 2Z8LA 4P73A 3EA6A 1WJJA 2HHHQ 3I55A 3T4AC 3HGBA 4G7HC 4P75A 1I5FA 3ULPA 5KNBA 4GN5A 4KY5A 4DR3Q 5I9PA 4DV3Q 1IL8A 4KKTA 1V1OA 3RZOH 2IX1A 4N9TA 2F0EA 1WTOA 4IFDG 2PI2E 2H1EA 3JAME 1BOSA 3RZOB 4IOAA 3FP9A 2Q2UA 3DXJC 4BY1G 4DNTB 1KD1C 1RL2A 4JPBW 2R7FA 1E2VA 4DGZA 2UXBL 3Q0AA 4DV2L 1TWCH 4DV1Q 3OTOL 2VS1A 4DR6L 1SAPA 4C3IG 1G6ZA 3E5SA 3DWAA 5E4WC 1XTDA 1F2ZA 4KTAA 5M5WB 3F8TA 3S24A 1IBKQ 1G91A 4K8JA 2AQ3B 4K2KA 1BDOA 5C4XG 1LTID 3TN2A 4BBSH 2B3GA 5IODA 2ZXOA 1Q7YC 4X3TA 4GOPA 2D5DA 4FF4A 1JOQA 2BDNA 4B3SQ 4BBSB 2Z9HA 1RKNA 3RR5A 2EE1A 3J7A5 3MTSA 1SRUA 4HMIA 2XGTA 2XSCA 3UE1A 2LXKA 3M7NA 1GOZA 5ELNA 5C3WA 1X3FA 2UUCQ 1I50B 2HQEA 3GV3A 1G51A 4TRDA 1LT5D 2Q2TA 4JI7L 5LL6X 4C3HH 4P71A 1EYCA 3K57A 5CV6A 3U4VA 4LF4L 1RCVD 1O7LA 3QG1A 2RA4A 2Z1CA 4DU9A 5JVG3 4DV7L 3HOYG 1QJOA 2SOBA 1VS0A 2NN6H 1PA6A 2OF1A 5T1GA 2CW0C 3QOLA 4ILWA 1PTOC 3HFZB 1X3EA 3KDFA 1M8AA 1AE2A 5C3XA 5J3BA 5JPNC 4R4CA 5EBCA 5C5LA 5KNDA 4X65Q 3K6OA 1ET9A 4GLXA 5KGUA 1P8LA 2Z6KA 1RDPD 5G3LF 4KMUC 1AN8A 4F88A 1K73C 1FGUA 3HOWB 1B53A 2N3SA 3IKJA 3TS0A 1Q12A 1SJED 2XWJB 1UNSA 1YJ9A 1CQFA 4HTHA 4GS3A 4LF9Q 1E22A 1L2FA 2MO0A 2AKWB 1Z6HA 3HOZH 2NB0A 1M90C 2KENA 1L0WA 2HT1A 3M4PA 4MZ9A 3HOZB 3CW2C 1T5EA 3GD7A 2WV6D 3SR1A 1NR4A 5CYUA 3R93A 4YCUA 1XNRQ 2CWPA 1OXTA 2IHFA 4CKEA 1EYDA 4PMWA 4LFAL 3J7AF 3I4NG 3T56B 4DXGA 2XVSA 2E76C 4DV5L 1BUVT 4A3CG 1TT2A 3MFYA 1E7ZA 5AJ3Q 3OMCA 1B2TA 3PIOA 4AIMA 1WTHA 2RBMA 2PNHA 3KLSX 5EKIA 1K8MA 4Q5VA 1QILA 1C48A 1FD7D 1S5DD 4J1MA 1YNND 1PTOH 1NBWA 1PFNA 1PYSB 1BCPF 1CM9A 1SN8A 4DR5Q 1DZ1A 1EWHA 4GOPB 1IBLQ 3PCOB 4LK1C 4FF3A 4IPGA 4L6TB 5CV4A 2NN6I 4ABNA 3OW2A 3D31A 3VYSA 5CV5A 5LL6S 1KNEA 3D4WA 2CQAA 3BVZA 2ZTEA 3L0OA 4XYOA 1SNOA 2UUAL 2F52A 5IP9G 1E2ZA 4I7AA 1A3TA 1CSPA 2IWHA 4LF5Q 2K32A 4A3KH 1SMYD 4JI6L 5D65A 3NPPA 2YTVA 1JWUD 3BYTB 3KDFB 3VA7A 4X3SA 4DV0L 4B3RL 3W2DA 4GN4B 4JI2Q 5IGDA 1D5MC 1NR2A 1VQ8A 3U50C 3F2DA 5M3FH 3ULLA 2BCOA 1EY7A 5M3FB 2LFNA 3NTIA 4K5WA 1IBML 4FDBA 3E9HA 4EX5A 3UDIA 2VUMH 3KOJA 2IY5B 2RDGA 1CKOA 1SE2A 1HH2P 1O7YA 1AP0A 3IFTA 4TKOB 1QZGA 2VUMB 2VQFQ 4IFDJ 4F8MA 1W6JA 2GA4B 3CC7A 2K52A 1ENAA 2NUCA 1FL0A 1CFMA 3M4OH 1TS3A 3BZDB 3DM3A 1HR0Q 1X56A 2QW7A 2HCCA 3HKZE 3OIQA 4HEDA 2B63H 3TQYA 2JSOA 1F2MA 4JYAQ 4JI5Q 4NW2A 4ZKBB 1XPUA 4DV4L 2RHQB 4BWGB 2B63B 4DR4Q 1LTSD 2PPBC 1PH4A 2J0TD 2RKSA 1Q90A 3PIP3 5DM73 5C4JH 2NWGA 2VXWA 4OX9L 2EYMA 1H95A 1HZBA 3A56A 1BBXC 1VQ9A 5C4JB 1GKHA 4KLKA 3RLNA 3KUPA 1TVXA 3SGIA 2MPMA 1W6KA 4A3IH 4BS9A 2EZVA 4KI0A 1DCZA 2I5HA 3TBIB 4EQ5A 4K0KQ 4P74A 4A3IB 1N34L 2JP1A 2NVYH 4PG3A 4YHHL 1LT4D 1A6XA 2RDFA 3PQIA 2FFKB 2KECA 3UDGA 2KHJA 2NVYB 3BDOA 5D3DA 4ZQ3A 2X6LA 1GUGA 3C46A 2VL6A 3TP7A 3FKIH 2VB2X 1BO0A 2ZTCA 4KHZA 4HSPA 2A6HD 1XX8A 2XRQD 3BG3A 3FKIB 3HOWG 2JEBI 4PZ8A 4DA2A 3GTQH 2C5CA 2LXJA 1KC8C 3BVMA 4O2DA 3WOFA 3HOUG 1KDBA 1STYA 3AB9A 2UXDQ 3MFGA 3GTQB 1NJIC 1BVSA 1VQAA 4WJ3M 4K6LA 1GXDC 2AWOA 3DEOA 1N33L 1UWVA 1EIYB 2K50A 2JA8G 1ZYRC 1LLRD 3KBGA 2R92B 4RWSC 3PUVA 5GROA 1EL0A 2XIWA 1HNZL 5I9OA 1HFNA 3HZXA 5FO8B 2CKZB 2CVRA 3HKZG 2R3ZA 5HGTA 1H9KA 2MFIA 4BA2I 1VQMA 1VMPA 3T16A 3PO3H 3V05A 4A93G 4XQJA 1TWAH 1EZ6A 2IX0A 1FNUA 3TRZA 3FRPB 1TQOA 3PO3B 5DNFA 1JOKA 2RHSB 1MIUA 1TWAB 1S5FD 3CC2A 2IW3A 2RCNA 2D0PA 4MN3A 1A8VA 5C3EB 3LX0A 4LUVA 4TVAB 2C35B 1PV4A 3NQTA 4B3TL 4FYDA 4JV5Q 4NPSA 1RHPA 4JOIC 1Y1VH 1HNXL 1LT3D 2VQEL 2NVTH 2K5VA 1Y1VB 5C44G 4H44C 2B2VA 1X9NA 1RTNA 3MVVA 3MXNA 2NVTB 1B3QA 4XIGS 3Q8DA 2EY2A 1D2BA 1XPOA 1WYDA 4A3FH 4LNQA 5IY0A 1DGSA 2EPBA 2F3VA 3T1YL 1YITA 4AYBB 4G7OC 1HXYD 2K04A 3KLRA 1ONLA 1S3OA 2UUBL 1GHJA 4B08A 4A3GB 1SNMA 1N8RC 2BOSA 3KF8A 1A62A 4IUQA 1F2YA 1R4PB 5BN4A 3OSOA 5K36G 2UXBQ 4MHEA 4JBMA 2IJ0A 4DV2Q 1KQSA 3OTOQ 3MAQA 1KLGD 4Y7NH 1W2BA 3GP7A 2JA6H 1KDAA 2O4XA 1PH9A 4Y7NB 4ULLA 2B2WC 3G6EA 1B4OA 2IX3A 2B8FA 1J9OA 3NHHA 2JA6B 1CK1A 3CAMA 3E3XA 2HIXA 1CI3M 2PZTA 1VQFA 3BZKA 3M9BA 5J22A 5K5PA 1HA6A 1QB5D 3PUXA 1YZ6A 1K8GA 3DUZA 4KJNA 3PUWA 3PF5A 2K03A 5LMNL 4MTNA 1ENCA 1K0RA 1EWCA 2B63G 1D7QA 3F1ZA 2NTSA 3F2BA 1A15A 2R61A 4JI7Q 2CQOA 5FO9B 3X3MA 2BH2A 1QUQA 4QUFA 1NAPA 1H9MA 4LF4Q 2JN4A 2EXDA 2AQ1B 2KOLA 1DOMA 2PQEA 4UY8C 1A2TA 2F0DA 4DV7Q 4A3MG 2KQ3A 1VQJA 2EVBA 3MXGA 4KKSA 3VR4A 4IALA 5BN5A 3S1RB 4A3BG 4BBRH 2WIIB 3HOXH 1STBA 3I56A 1JC7A 4BBRB 1SROA 3HOXB 4OWWB 2F0PA 1BCPC 4AYBE 2OWOA 1VQEA 5GAGC 1B9MA 1PH7A 1YEZA 1SE8A 2LS01 1ILPA 1QOHA 4ME5A 1ICWA 4Y52H 3A5ZB 2CHBD 2K5HA 4XQNA 5NUCA 3WWVA 4F7XA 3J7ZC 2N78A 4HN7A 4DK6C 3JAML 2KCCA 1VQNA 5M5XH 3KYHC 5M9OA 1SJHD 3AYHB 2EXZA 3KF8B 2E75C 4KD4A 5M5XB 4RKBA 5JEAG 3OMGA 4QY7A 3IFDA 4HIMA 4DV5Q 2TSSA 4C3JH 4I7ZC 5GAEC 1TY2A 2AHOB 3VR6A 2R92G 1EQRA 2WACA 4C3JB 3H3VC 4QMGA 2B2YA 5T1IA 2K7VA 2NZHA 1VQDA 3JAMc 5C0XG 2ZJQA 2WAQB 1YNJD 4J8QA 1EY4A 2OQ0A 1PH2A 2V4DA 3I4OA 1PRTF 4DAMA 2K01A 3U4ZA 1U0LA 3EBEA 3AMUA 1F2LA 1CZGA 2ZJPA 1SNCA 1C4QA 2F0SA 2A6ED 4LJZC 5E7NA 5C3EG 1HZCA 1ASZA 4NB3A 1XMOL 4IOCA 1U5KA 5IGFA 1QUQB 1C7YA 3K8AA 3M4YA 3QWNA 2F0TA 1U9RA 2ALYB 3CF5A 1CSQA 4IJHA 1TWHH 4J15A 2DN8A 4JI6Q 4L5RC 1YHQA 4GN3B 3O13A 4R4QA 4DPGA 1TWHB 5FLMG 1SMXA 1AE3A 1MHWC 3FDTA 3E9IA 2OEOA 4DV0Q 4JK1C 4X3KA 5FJ8H 4B3RQ 4G4KA 1UAPA 2DJGC 1VQIA 4AYBG 2F0OA 4A3DH 3CRLC 1E24A 3H3VH 1VQ5A 3NWTA 4A3GG 1WCMG 4A3DB 1IBMQ 2BH8A 4X62L 1Y1WG 2Q2IA 5EBDA 4DK1A 1PVOA 1JORA 3P7JA 3T13A 1WTRA 1V9PA 1M4VA 4DAYA 1JE4A 1Z9FA 3BDLA 3MC0B 4LFCL 2KBNA 1MD2D 2E2JH 1VCIA 1CKMA 3ONAB 1LTAD 3KLWA 5C5MA 1HA5A 1EOTA 3AEVA 1OXXK 1F9RA 1TWCB 1YI2A 2SNMA 4JCVE 2EYLA 4C1NI 1TXYA 2B8GA 1HZ9A 3KLSA 1Q86C 1U4MA 4G7ZC 3RMHA 2EYJA 2WAQE 1CTMA 3CCUA 4C2MH 1JT8A 4LF8L 2K5NA 5ELEA 4QL5A 3K0XA 4DV4Q 3FVQA 4LF6L 4C2MB 1FR3A 3E6ZX 1HTLD 1R4QB 1AZPA 3CCQA 1GD7A 2XTIA 1TKWB 3UE0A 1BXTA 2CCZA 5HGQA 2JXMB 1YBYA 1JB3A 4C3HB 1LUZA 1SYBA 1N34Q 4IUNA 4YHHQ 4DUYL 4O0AA 1I4PA 2K5WA 4XT3B 1PH5A 3B6YA 1IW7D 3I70A 5EJWA 1HUNA 1PFMA 4DUZL 3H3VI 4QCLA 1PFBA 4PZ7A 1A63A 4BA1I 1W3SA 1P16A 2K4KA 5JAVA 4P72A 4QQBX 2A68D 1SFOH 3QOJA 2DNEA 3LGJA 3SK6A 4DFAA 5LMUL 1E2WA 3KFUA 3CMEA 3N6RA 4CDEC 1KIXA 2VB3X 4WFN3 1SFOB 5DM63 2OTLA 4ZUJA 2LKVA 2B29A 2J4XA 4UP9A 3STBD 1K9MC 3CC4A 4GKJL 1EU3A 4CDDC 3FHWA 1UEBA 1K83H 1QNUA 5FLXL 3F2CA 2LMCB 3S1NH 1K83B 4UP8A 3S1NB 5A2QL 4DK0A 1B70B 4RCOA 2NVXH 5GAHC 2A1AA 5HY6A 2G9HD 4UDUC 1KLUD 1NTGA 2D0OA 1NSNS 3C1EA 3DHQA 1WTWA 1RODA 4DAYB 2NVXB 4IPCA 4MNOA 4JBKA 3I4MG 2L5TA 4NDXA 2K28A 3Q24A 3MXPA 1SYEA 5JEAJ 1Y8PB 4FVMA 1RJTA 2WAQG 5JOBA 4OO1G 3V2TA 1Z7TA 1J5EL 4BY7H 4GKKL 4NP5A 1JJ2A 5IGEA 2A74C 1PTOB 3UDFA 4BY7B 1XNQQ 4Q0FA 4POGA 5JVH3 5C0XJ 4B3TQ 3A5UA 3K5LA 4HCEA 2NYZD 1KRTA 4QGUA 3K5NA 3T1HL 5CMDA 1HNXQ 4LFBL 1HRJA 4DKAC 3S9WA 5KRUA 3HOVH 3CPFA 2VQEQ 1H9JA 5D14A 3NBHA 1ASYA 1JQYD 1X55A 2JA5H 3GTLH 4N8X1 4DF7A 2I07B 3IRBA 4HAEA 3PUYA 1EY0A 4CJ2C 2JA5B 3GTLB 2A69C 4UP7A 4RA8A 1SBBB 1STNA 4FF2A 3D6CA 1MBYA 1ZKOA 4HJ8A 1N9WA 4A3KB 4OWXB 3CXCA 4L63B 1JJGA 1XTCD 4JI1L 2UUBQ 2PQAA 2E5LL 1ML0D 1Y8OB 2N55A 1EUJA 4CGYB 3U58A 2ZM6L 3TREA 1HJPA 1I4HA 3A0JA 3ICEA 3LWEA 4A3DG 4H13C 5FLXE 4HIDA 1EFID 4FNFA 2R93H 3T51B 4JBWA 3PGZA 1SSOA 1RTOA 2WB1B 4P2CB 5ELOA 3CD6A 4K5VA 1KXLA 2ZT9C 4YWKA 1D1IA 4XT1B 3OIPA 4IUPA 5A2QE 3L9AX 2R93B 1G2TA 1UE1A 4IPDA 1DJRD 2P5ZX 2UU9L 3FPPA 4HJ9A 2PMZB 1K3BC 1I94Q 2PZUA 1EQVA 1O78A 1ET6A 4RHRA 4X66Q 4XYQA 4IJLA 1BKBA 2EYPA 2OQKA 5DEHA 4M8AA 1WTVA 4B3ML 1U4LA 2E74C 3H15A 5LHY1 1QNKA 3A54A 3M4OB 5LMNW 1EIHA 1LYLA 1TR5A 3PO2H 1T5XD 1Q8KA 1EEFD 4OELB 5LMNQ 3NE5B 3ER0A 3BU2A 3TS2A 4KN7C 1JJCB 4BBSG 2F1MA 1HFGA 4A76A 3AFPA 2EOTA 4IQZA 5IYCH 3C2PA 1HUMA 1EWIA 4DV6L 2HDLA 3KBXA 1JCKB 2FXQA 1B9NA 1PZJD 4FF1A 1S4ZA 3KK7A 5IIFA 1VQLA 1PMRA 3PIO3 2MUYA 4L5SA 1E1TA 2RF4A 2R7ZH 1QVGA 3HEJA 4C3HG 3CCJA 3ERQA 2QA4A 3SE0A 4JI0Q 2R7ZB 4B3SL 1STHA 1PH8A 1EYAA 1EYGA 4DR7L 1IKLA 4YCVA 3NBHB 3E0JA 2CH4A 2NN6G 3S2HH 4RH6A 5KIXA 2B2TC 2O5IC 2RSOA 3PV0A 1JB7A 4EQNA 2BE5C 2F0IA 5JJKA 4A4IA 1O7IA 1QVCA 4QIWB 1PRTC 5J39A 1LT6D 4TSSA 3W5OA 4JG2A 2FMCA 1I4RA 4HIKA 4DNIA 1K3RA 1TWFH 3DLLA 2J7ZA 3VA5A 2PQAB 4LUOA 5IP7H 4NXML 2MHVA 3NENA 3CRKC 2VY3A 1CUKA 3EVQA 3HOZG 4ZKCB 4HJ5A 4X65L 1HNWQ 2PMZE 3CCLA 1JE5A 3RUZA 3G7LA 3GTOH 5EPJA 4A3LH 1S72A 3J7YW 4JOIA 3I4LA 3H0GH 1F9PA 3P1HA 3DWQA 3A55A 3GTJH 3GTOB 1G6PA 1GJXA 1GUOA 3RD4A 4A3EH 2B2UA 3H0GB 1XJVA 2F0GA 2D62A 1M1KC 2XN9C 3I8ZA 3GTKH 2RSNA 1ICFB 2EYOA 2C9OA 3NEMA 2CW0D 4CBVA 2K05A 1PH3A 1DOKA 1PTOD 3GTKB 5E1FA 1B8AA 3HG9A 2MGSA 1NE3A 1TS2A 2KCNA 1KNAA 3D4DA 2I5MX 1JICA 4QB4A 5J1ZA 2F0QA 3R8BA 2M2LA 1H9SA 1XMOQ 2L15A 2Y0SB 3J81j 3V96A 2DUDA 5GADC 4JI3L 4K14A 1VDZA 1KHIA 2KJXA 4H7BA 3RN5A 3A8IE 3S1MH 5AFWA 2I0QA 3PF4A 4FP5D 3E0EA 3S1MB 2EYFA 1LTLA 2HUGA 3UI2A 1IBLL 5IYDH 1K8OA 4KK7A 3M3YH 1LV9A 4E6IA 4GNXC 4BXXH 2AUJD 3OOCA 2B2WA 4MIUA 2EY1A 3DMUA 1HPCA 3M3YB 4A3KG 4K8IA 4A3FB 2JEAI 1ENFA 2FINB 5C4HA 1TY0A 1ZEQX 1RIPA 1BBUA 3GTMH 4X62Q 1KRSA 4XTCS 5CV7A 4A3JH 1Q46A 1NUCA 1NCVA 5M3FG 2RCFA 1EU4A 4A3JB 3HP3A 4RGOS 2O5JC 5E3FA 2NBFA 1IKMA 2NTTA 1BF4A 2I46A 4OWTB 4DR6Q 4UHVA 1ESRA 3SK5A 1NMGA 2VUMG 3P20A 4IFDH 1L1OC 1O7ZA 4RCNA 4S3SA 4O42A 1G2SA 1HCZA 1B1ZA 4EQOA 4BY1H 1MGSA 3A8JE 1XMQL 1U4PA 5EAYA 2SNSA 2F0FA 1SE4A 4LF8Q 2B2VC 2JA9A 3TDQA 4C3IH 4WRDA 5CV9A 5ISRA 2E2HH 4LF6Q 1A3UA 4I65A 1HQRD 4YY3L 4C3IB 5I2YA 1PXUA 1VQ4A 3H09A 3FMCA 1PYBA 1GHKA 1DM0B 1V8QA 1DD2A 2DY8A 3CCVA 3K81C 3A74A 5C4XH 3EJIA 3L3OC 5ELBA 5JJZA 3W1GA 4WORA 2E8GA 3I91A 2Y0SE 3JC66 5CBEE 2MO1A 4QUCA 5C4XB 1BNZA 1QWYA 1YJNA 5HURA 2EJFC 4DUYQ 1GUTA 2L0CA 1X65A 3PUZA 2PO4A 2H4OA 4RMFA 1S5ED 1H9SB 2LY7A 3Q6SA 1K8AC 1JMCA 5H1SE 4HIOA 2DY7A 4DUZQ 5CR3A 2R7ZG 2F0NA 4A3IG 2JYOA 2YV5A 5L37A 3D8GA 2K1BA 3VYRA 4B9XA 1RD9D 2EY5A 3TP8A 1B50A 2OCEA 1X3GA 3HRZC 1K28A 1GUSA 4IURA 3HOYH 1UEAB 3S17H 4RGNA 5FK9C 4KJOA 2CWAA 3Q23A 3FKIG 2QF7A 3NXWA 3C3LA 4GKJQ 3HS0C 2M00A 3NWSA 3HKSA 3HOYB 3S17B 3IL8A 4ALPA 3Q22A 4ZCKA 2DGYA 1I4GA 1YNNC 4K0KL 1E1OA 1IYVA 4IFDI 1FNVA 3CCSA 1SE3A 2DJFC 5C4ZA 2AUKA 3EROA 1LABA 2VNUD 3GV6A 3VYUA 4LFAQ 1EY9A 4GZYC 3QJYA 4U68A 3J81i 1T9HA 3ULJA 3K5OA 3KJOA 1UUPA 1Q1BA 4C56C 4L5QA 3NTKA 3NELA 3MHBA 3A7LA 3MEHA 2FMMA 4GKKQ 1U4RA 3I4NH 3AU7A 4A3CH 1SMYC 2KUMA 1YIJA 2MNAA 1NY4A 1X6OA 1CHPD 3I4NB 2DNCA 3EIVA 3EQLC 4JVZA 3PO3G 2N8NA 4OL7A 1BQQT 3C1FA 1Q8IA 2XNAC 4OEMB 4DNRB 4LFBQ 1PDQA 1GM5A 4X64L 2OT2A 1MSHA 1EY6A 2QDLA 2Y0SG 3ITPA 2F0LA 1BCPB 2NZOA 2A5HA 1I4XA 1EQQA 2FHTA 2ATWA 3TP5A 2UUAQ 3QB3A 4PQXA 1CKNA 2NZ1D 1Y1VG 2OTJA 3NBIA 2ZXRA 3M7GA 3KJPA 5I6YA 2ZTDA 4J6HA 1D5XC 2JA7H 2RDHA 1D6EC 3NQIA 4DR2L 2F4VL 3QIAA 2JA7B 3ND8A 1Y8NB 1IL2A 1ZYRD 1S5CD 4JI1Q 1Q3LA 1VF5C 2E5LQ 4A3FG 4L8JA 4OIJA 5IP9H 4NKLA 2ZM6Q 1DXMA 2I5LX 3PMFA 4JI8L 3GTGH 2QGQA 5CV8A 3NTHA 3G71A 2Z0SA 1DONA 3GTGB 1MKHA 2EIFA 2EDGA 3K59A 5I2XA 5M5YH 4RGTA 1WI5A 4HJ7A 2UU9Q 4JI4L 1HHVA 4R4OA 2Q8RE 2G9DA 1C0AA 4M1UB 5M5YB 1X32A 1XYIA 3IAYA 3U9OA 1V1PA 4CJ0B 2BDOA 3S2DH 4IO9A 2K5DA 3I90A 1Q82C 4B3MQ 2E2JB 2F3IA 3SEBA 1SNDA 2JA6G 1I3QH 3GTPH 3S2DB 1XWEA 1EIGA 3URYA 1GO3E 1I3QB 2PYKA 3GTPB 4OO1I 1HZAA 1EQTA 4R4TA 2L11A 3P75A 5M5WH 2MP1A 4DV6Q 2A6HC 3KF6A 2FJ2A 5M3MH 4ID6A 5BR8L 3QR8A 1AEXA 4OX9Q 1AZQA 1CA5A 1S40A 4RKLA 2F0KA 3MWYW 5M3MB 4UAIA 4LUZA 1J8IA 1A2UA 2HD3A 4DN4M 1FJGL 4IZ8A 4DR7Q 1I50H 1FGBD 3CU7A 2GN5A 2SDFA 2KEEA 2ASBA 4YIJA 4ME3A 4N8FA 2JJQA 1CKNB 3VR2A 4BBRG 3DM1A 4WJWA 3HOXG 4DXFA 3TZDA 3GDEA 4EGVA 3RNUA 3J81L 3NK9A 2Z4HA 2M9VA 4R1JA 1CQVA 2F0JA 5G3LD 3H6MA 1AW7A 4LW1A 5EKKA 4NXMQ 3BZCA 4GOPC 1SYDA 2WFWA 1PYWD 1AH9A 5FOBB 3HOWH 3R2TA 1N33Q 5IWAL 3HOUH 1TS4A 1FYCA 1II3A 1LTRD 3HOUB 5EKLA 3J81c 5ELDA 4R8NA 2ZJRA 4YWLA 2JQOA 3EN2A 3NSWA 1HNZQ 2ICEC 3SXHA 2F0UA 4C3JG 3L2PA 1PH1A 1V1PB 1SYFA 2K14A 2X69A 5FLXc 4LF7L 3S16H 2MJ8A 3GQBA 3SHLA 2E2IH 1LACA 2JA8H 3I7FA 5IYBH 2PW5A 2OXPA 3TMEA 3S16B 3AFQA 3I2ZA 2E2IB 2JA8B 3PIPA 4NXNL 1NMFA 5KEEA 1YHBA 1L0XB 2Z6KC 4U673 1BCPD 4POFA 1JOOA 2CFMA 3K0YA 3BJUA 1KL9A 3ZJYC 4KN4C 1HQMC 4DR1L 2O2LD 4A93H 3KF6B 5F2DA 1D1KA 4JI3Q 2TMPA 2N49A 3HKZB 2HCIA 5GQOA 2EYHA 1N36L 4R8IA 1EFWA 1N32L 1G291 4A93B 1JWSD 4C1NK 2ID0A 4LMQD 1QCBD 3HOVB 4HMJA 1MJCA 1PFSA 2GVAA 2K75A 1ZXTA 4K6DA 2A73B 4OXPA 1PH6A 1SXTA 3BYYB 4H0LC 3WOEA 5EPKA 1VQHA 3OWFA 2CH4W 1SLJA 2L55A 3T1YQ 2JA7G 4CKCA 5C44H 5CC4A 4KHPL 3J81E 2EQSA 3UDXA 1UE5A 5C44B 5FJ8G 1STEA 2Q2HA 5DAUA 2G5DA 5FKAC 1QG7A 4RHSA 1GUWA 2KEDA 2UXCL 1L0YB 4O1NA 5IGBA 1IYUA 2PZWA 2JK8A 4KD3A 1B7YB 3NP8A 4AQYL 1OXVA 1EY5A 4HJAA 1F9SA 1VQGA 3RZDH 2HHHL 4TQUS 4CKBA 5IGCA 4N9PA 3RZDB 1WD1A 4APVA 5K36H 2B39A 2QDBA 2WKCA 3VDYA 1XMQQ 1XPRA 3G4SA 4DR3L 4DV3L 2YTXA 4KY7A 2D9UA 3CP0A 1Q1EA 1I4QA 5BN3A 2F0MA 1D8LA 2H5XA 4YY3Q 2IT1A 2B2TA 2WP8J 2KHSA 1PZID 5JPMC 4PV1C 4R9WA 3PO2B 1STAA 4DV1L 3BS1A 1EEID 3AQQA 5IGGA 4FXDA 2Q8IB 2ES2A 5D3IB 2QEXA 3GO5A 4Z9CB 2Q8TA 1HR0W 5M3MG 1I6VC 2RQXA 2AMCB 4ZLTF 2E2DC 1IBKL 4X6AH 3G48A 4ZYSA 1E0BA 4KHVA 4UPAA 2V1CC 2F03A 2R7DA 1OXUA 5E4XA 1WOCA 4ZRZA 1TWGH 1KABA 3ERSX 2YU9H 1V43A 4NMZA 4HSVA 4KV6A 1TWGB 2YU9B 4V0BA 3K58A 4A3MH 4IPHA 2UUCL 3CQZH 3S2HB 2BA1A 2LSSA 4A3MB 5CORA 1SR3A 5JJLA 4FO2A 3CQZB 1MJEA 1H9RA 4A3BH 4L5TA 4JBJA 1SNQA 3J80i 4QF4A 2QKIC 1YNJC 4A3BB 4ZUIA 1TWFB 2IL8A 2WB1E 1S5BD 1ILQA 3SDZA 1WVLA 1QZHA 5IOCA 3QO2A 2A6EC 3RN2A 1VQ6A 1SYCA 3K7UC 1CHQD 4DK3C 1JR0D 4B9WA 1PLFA 3VYTA 3MZ5A 3DEPA 4LF9L 2PNRC 1LTBD 1A3VA 4PZ6A 4EVOA 5JEAH 4K5XA 4A3EB 3T53B 4FXKC 1B44D 3S1QH 4GNXA 1OTCA 2R92H 5IYBG 1EOVA 1XNRL 1WTQA 2A19A 1Y14B 4BY7G 3S1QB 3CCEA 3OW7A 4X64Q 1UE6A 5C0XH 2KCTA 1VQCA 1IYJB 1C9OA 1Y69U 1PTOF 5AJ3L 1QVFA 3JAMi 1VQ7A 5A35A 2YTYA 4CHTB 1PRTB 5C6AA 1UE7A 4CDCC 3TEHB 4YCWA 3HOVG 2WINB 2VZAA 4CJ1B 2EJMA 5C3EH 2KHIA 5EGTA 4DR5L 2JA5G 1F9QA 4DR2Q 1XNQL 2F4VQ 3SVMA 1NNXA 4MTKA 3J7AV 2QILA 1L1OA 4OIKA 4KKUA 4FXGC 3MXUA 4QIWE 4RAUC 4JI8Q 3VR5A 2B2UC 1KAAA 2X6GA 3BDCA 3G6JB 3CHBD 1VQOA 2R6GA 1VQBA 5FLMH 2Z4IA 5COYA 1CT1D 1DYQA 3GTMB 4JI4Q 1WTXA 4V190 5EPLA 1RF2D 2K6AA 2WB1G 4LF5L 3SK8A 4DAVA 4LFCQ 2R93G 1MSGA 3K7AH 4JC0A 5CGKA 5IT9L 1C8CA 3S14H 2KVMA 4A3GH 1LM0A 1WCMH 2PI2A 1EY8A 3TP6A 3K7AB 1Y1WH 3LWUA 3S14B 4JI2L 1WCMB 4XXEA 1TIID 1Y1WB 3MEFA 2K5QA 1IW7C 3I73A 2KA7A 3I3CA 2D2CC 1J6QA 3I72A 3LNNA 4BY1B 4G57A 5C0XI 4EQPA 4AH6A 3W3AA 4JW0A 1CZWA 1OXSC 2A68C 3W1BA 2A69D 1VQPA 3K80C 1WFQA 1XXGA 5BR8Q 5IT9c 3PO2G 4WJ4A 2E2HB 3F2UA 1I94L 1LO5D 3R2IA 2VQFL 1LTGD 1KDCA 1G8ZD 1R9TH 5FO7B 4GNXB 3STBC 4X66L 5IYCG 1YNXA 1R9TB 4K2LA 3M4QA 3OYYA 3DWPA 1FJGQ 1X54A 3NUCA 1IHZA 1Q81C 3H94A 2NVQH 1HR0L 1KTKA 3ND9A 3CPWA 3CCMA 3J80L 2MQHA 1VQKA 1YJWA 2NVQB 5DLQE 4JYAL 4JI5L 3OPOA 3D4RA 1FVIA 4R4IA 5KYIA 4DR4L 3OWEB 5LMUQ 1HTPA 2F3WA 1KAWA 1TS5A 1YHAA 4IUTA 3RLFA 3CKIB 3U9SA 3CCRA 5EQ0A 2L12A 2PCFB 1WTPA 5JJIA 3FPUB 1PHJA 2F0HA 3S1RH 4OGQC 1L1OB 2L9HA 2ZXPA 1QE6A 1X3PA 3J80c 1IXRA 1DOLA 3PSIA 4LWCA 4JI0L 2WKDA 3VR3A 1BBWA 2XWBB 1TU2B 5IWAQ 2HQLA 5ELCA 3A7AB 3MXNB 5I6WA 4XDXA 4F87A 3OHXC 3K5MA 3BVGA 4CDFC 5IP7G 4A75A 5IT9E 4RG1A 3D3RA 3TZUA 2KCMA 1ESFA 4HR7B 1EZ8A 1YVCA 4RFBA 4ZAIA 5IE8A 4GLAC 5ELFA 1SNPA 4YWMA 2IPKD 3S15H 4IN3A 4A3LG 2UXDL 3RLOA 4LF7Q 1K0SA 3H0GG 4XQQA 3S15B 3L7ZC 2HDMA 4IUVA 4A3EG 4ODGA 1J5EQ 2F4IA 1GVPA 3D0FA 4H02A 4DAPA 3X3NA 4NXNQ 3M85A 3EFXD 2AWNA 1HNWL 1PZKD 2HIVA 3I4MH 1VMCA 1F77A 3TSSA 4QJFA 1SYGA 1A0IA 2BE5D 4X3UA 4OHJA 3T1HQ 1B3AA 4OONA 4DR1Q 2AQ2B 2IHEA 2BA0A 5KYLA 1LTTD 1OO9B 2Z6BA 3I4MB 4LAAA 3H91A 1PRTD 4OO1H 1EIFA 4RGMA 1N36Q 1N32Q 5TSSA 1E3PA 2F0WA 1X3QA 1STGA 3WDNA 2SEBD 4ZK9B 1I6HH 5KNCA 1D5ZC 3J80E 3R3OA 3FEWX 1V1QA 1FNWA 3N52A 4KY6A 1I6HB 2ENBA 2L1BA 3ZYYX 2YYZA 3MA2B 1JWMD 5CBAE 4PNYA 3A8KE 1CA6A 2F0VA 2PW7A
chains in the Genus database with same CATH topology
1BR9A 3D6WA 3SK4A 2K33A 2QEJC 1AFPA 2JE6I 1MI2A 3GTJB 2ICIA 4HCSA 4PMBA 2N88A 2QCPX 4IUUA 2B2YC 5I4DA 1Z47A 2XRSD 2RVLA 1VF7A 1WD0A 2EJGC 1SDFA 4PMCA 1GUNA 1SEBD 1O80A 2EY6A 2L4NA 2Z8LA 3EA6A 3T4AC 3HGBA 4G7HC 5KNBA 4KY5A 5I9PA 1IL8A 4KKTA 1V1OA 2IX1A 4N9TA 2F0EA 1WTOA 4IFDG 2H1EA 3JAME 1BOSA 3RZOB 3DXJC 4DNTB 4DGZA 1E2VA 3Q0AA 1SAPA 4C3IG 1G6ZA 3E5SA 3DWAA 5E4WC 5M5WB 1F2ZA 4KTAA 1G91A 4K8JA 2AQ3B 4K2KA 1BDOA 1LTID 3TN2A 5IODA 2ZXOA 4X3TA 2D5DA 4FF4A 1JOQA 2BDNA 4BBSB 1RKNA 2EE1A 3MTSA 4HMIA 2XSCA 3M7NA 1GOZA 5C3WA 1I50B 2HQEA 3GV3A 4TRDA 1LT5D 5LL6X 1EYCA 3K57A 5CV6A 1RCVD 1O7LA 3QG1A 2RA4A 2Z1CA 4DU9A 5JVG3 1QJOA 2SOBA 2NN6H 2OF1A 5T1GA 2CW0C 3QOLA 4ILWA 1PTOC 1M8AA 5C3XA 5JPNC 5EBCA 5C5LA 5KNDA 3K6OA 1ET9A 5KGUA 5G3LF 1RDPD 4KMUC 1AN8A 4F88A 3HOWB 1B53A 3IKJA 1Q12A 1SJED 2XWJB 1UNSA 1CQFA 4HTHA 1Z6HA 2NB0A 3HOZB 1T5EA 3GD7A 2WV6D 3SR1A 1NR4A 5CYUA 3R93A 1OXTA 4CKEA 1EYDA 4PMWA 3J7AF 3T56B 4DXGA 2XVSA 2E76C 1BUVT 1TT2A 3MFYA 3OMCA 1B2TA 2RBMA 3KLSX 5EKIA 1K8MA 4Q5VA 1QILA 1C48A 1FD7D 1S5DD 4J1MA 1YNND 1PTOH 1PFNA 1BCPF 1CM9A 1DZ1A 1EWHA 4LK1C 4FF3A 4L6TB 5CV4A 2NN6I 4ABNA 3D31A 3VYSA 5CV5A 5LL6S 1KNEA 3D4WA 2CQAA 3BVZA 4XYOA 1SNOA 1E2ZA 1A3TA 2IWHA 2K32A 1SMYD 5D65A 3NPPA 1JWUD 3BYTB 3VA7A 4X3SA 3W2DA 5IGDA 1D5MC 1NR2A 2BCOA 1EY7A 5M3FB 2LFNA 3NTIA 4K5WA 2RDGA 1SE2A 1O7YA 1AP0A 3IFTA 4TKOB 2VUMB 4IFDJ 4F8MA 1W6JA 2GA4B 1ENAA 2NUCA 1CFMA 1TS3A 3BZDB 2HCCA 3OIQA 4HEDA 2JSOA 1F2MA 4NW2A 4ZKBB 4BWGB 2B63B 1LTSD 2PPBC 2J0TD 2RKSA 1Q90A 3PIP3 5DM73 2NWGA 2VXWA 2EYMA 3A56A 1BBXC 5C4JB 3KUPA 1TVXA 2MPMA 1W6KA 4BS9A 2EZVA 4KI0A 1DCZA 3TBIB 4A3IB 2JP1A 1LT4D 1A6XA 2RDFA 2FFKB 2KECA 5D3DA 2NVYB 3BDOA 4ZQ3A 2X6LA 1GUGA 3C46A 3TP7A 2VB2X 1BO0A 4KHZA 4HSPA 2A6HD 1XX8A 2XRQD 3BG3A 3FKIB 2JEBI 4DA2A 2C5CA 3BVMA 3WOFA 1KDBA 1STYA 3AB9A 3MFGA 3GTQB 4K6LA 1GXDC 2AWOA 3DEOA 1ZYRC 1LLRD 3KBGA 2R92B 4RWSC 3PUVA 1EL0A 2XIWA 5I9OA 1HFNA 3HZXA 5FO8B 2CVRA 2R3ZA 5HGTA 1H9KA 4BA2I 1VMPA 3T16A 3V05A 4XQJA 1EZ6A 2IX0A 1FNUA 3FRPB 1TQOA 3PO3B 5DNFA 1JOKA 1TWAB 1S5FD 2IW3A 4MN3A 5C3EB 3LX0A 4FYDA 3NQTA 1RHPA 1LT3D 1Y1VB 4H44C 2B2VA 1RTNA 3MVVA 3MXNA 2NVTB 4XIGS 2EY2A 1D2BA 2EPBA 2F3VA 4AYBB 4G7OC 1HXYD 2K04A 3KLRA 1ONLA 1GHJA 4B08A 4A3GB 1SNMA 2BOSA 3KF8A 4IUQA 1F2YA 1R4PB 5BN4A 3OSOA 5K36G 4MHEA 2IJ0A 3MAQA 1KLGD 3GP7A 1KDAA 2O4XA 4Y7NB 4ULLA 2B2WC 1B4OA 2IX3A 2B8FA 1J9OA 3NHHA 2JA6B 1CK1A 1CI3M 2PZTA 5J22A 5K5PA 1HA6A 1QB5D 3PUXA 3DUZA 4KJNA 3PUWA 2K03A 1ENCA 1EWCA 2NTSA 1A15A 2R61A 5FO9B 3X3MA 4QUFA 1NAPA 1H9MA 2AQ1B 2KOLA 1DOMA 2PQEA 1A2TA 2F0DA 2KQ3A 2EVBA 3MXGA 4KKSA 3VR4A 4IALA 5BN5A 3S1RB 2WIIB 1STBA 1JC7A 4BBRB 3HOXB 2F0PA 1BCPC 1B9MA 2LS01 1ILPA 1QOHA 4ME5A 1ICWA 2CHBD 4XQNA 5NUCA 4F7XA 3JAML 4HN7A 2KCCA 5M9OA 1SJHD 2EXZA 2E75C 4KD4A 5M5XB 4RKBA 5JEAG 3OMGA 3IFDA 2TSSA 4I7ZC 1TY2A 3VR6A 2WACA 4C3JB 3H3VC 4QMGA 2B2YA 5T1IA 2K7VA 5C0XG 2WAQB 1YNJD 4J8QA 1EY4A 2V4DA 1PRTF 2K01A 3AMUA 1F2LA 1CZGA 1SNCA 1C4QA 2F0SA 2A6ED 4LJZC 5IGFA 3M4YA 3QWNA 2F0TA 1U9RA 2DN8A 3O13A 1TWHB 3FDTA 2OEOA 4JK1C 4X3KA 4G4KA 1UAPA 2F0OA 3CRLC 3NWTA 4A3DB 5EBDA 4DK1A 1JORA 3P7JA 3T13A 1WTRA 1M4VA 4DAYA 1JE4A 3BDLA 3MC0B 1MD2D 1VCIA 5C5MA 1LTAD 3ONAB 1HA5A 1EOTA 1OXXK 1F9RA 1TWCB 2SNMA 2EYLA 4C1NI 2B8GA 3KLSA 1U4MA 4G7ZC 3RMHA 2EYJA 1CTMA 5ELEA 3FVQA 4C2MB 1FR3A 3E6ZX 1HTLD 1R4QB 1AZPA 1TKWB 1BXTA 2JXMB 1JB3A 4C3HB 1SYBA 4IUNA 1I4PA 2K5WA 4XT3B 1IW7D 3I70A 5EJWA 1HUNA 1PFMA 4QCLA 1PFBA 4BA1I 5JAVA 2A68D 3QOJA 2DNEA 3SK6A 4DFAA 1E2WA 3N6RA 2VB3X 4WFN3 1SFOB 5DM63 4ZUJA 2LKVA 2J4XA 1EU3A 1QNUA 5FLXL 2LMCB 1K83B 3S1NB 5A2QL 4DK0A 4RCOA 2G9HD 4UDUC 1KLUD 1NSNS 3C1EA 3DHQA 1WTWA 1RODA 2NVXB 2L5TA 4NDXA 2K28A 3Q24A 3MXPA 1SYEA 5JEAJ 1Y8PB 4FVMA 1RJTA 5JOBA 4OO1G 3V2TA 1Z7TA 4NP5A 5IGEA 2A74C 1PTOB 4BY7B 4Q0FA 5JVH3 5C0XJ 3K5LA 4HCEA 2NYZD 3K5NA 5CMDA 1HRJA 3S9WA 5KRUA 1H9JA 5D14A 3NBHA 1JQYD 4DF7A 2I07B 4HAEA 3PUYA 1EY0A 4CJ2C 2JA5B 3GTLB 2A69C 4RA8A 1SBBB 1STNA 4FF2A 3D6CA 1MBYA 1ZKOA 4A3KB 4L63B 1XTCD 1ML0D 1Y8OB 2N55A 4CGYB 1I4HA 3LWEA 4H13C 5FLXE 1EFID 4FNFA 3T51B 4JBWA 1SSOA 1RTOA 2WB1B 4P2CB 4K5VA 2ZT9C 1D1IA 4XT1B 3OIPA 4IUPA 5A2QE 3L9AX 2R93B 1G2TA 1DJRD 3FPPA 2PMZB 2PZUA 1EQVA 1O78A 1ET6A 4RHRA 4XYQA 2EYPA 5DEHA 4M8AA 1WTVA 1U4LA 2E74C 5LHY1 1QNKA 3A54A 3M4OB 1EIHA 1TR5A 1T5XD 1EEFD 3NE5B 4KN7C 2F1MA 1HFGA 2EOTA 4IQZA 3C2PA 1HUMA 2HDLA 3KBXA 1JCKB 1B9NA 1PZJD 4FF1A 1S4ZA 3KK7A 5IIFA 1PMRA 3PIO3 2MUYA 3HEJA 4C3HG 3ERQA 3SE0A 2R7ZB 1STHA 1EYAA 1IKLA 3E0JA 2NN6G 4RH6A 5KIXA 2B2TC 2O5IC 2RSOA 3PV0A 4EQNA 2BE5C 2F0IA 4QIWB 5J39A 1PRTC 1LT6D 4TSSA 2FMCA 1I4RA 2J7ZA 3VA5A 2MHVA 3CRKC 3EVQA 4ZKCB 3RUZA 3G7LA 5EPJA 3J7YW 3I4LA 1F9PA 3P1HA 3DWQA 3A55A 3GTOB 1GJXA 1GUOA 3RD4A 2B2UA 3H0GB 2F0GA 2D62A 2XN9C 3I8ZA 2RSNA 2EYOA 2C9OA 2CW0D 4CBVA 2K05A 1DOKA 1PTOD 3GTKB 5E1FA 3HG9A 2MGSA 1TS2A 2KCNA 1KNAA 3D4DA 1JICA 4QB4A 5J1ZA 2F0QA 3R8BA 2M2LA 1H9SA 2Y0SB 3V96A 4K14A 1VDZA 2KJXA 4H7BA 3A8IE 5AFWA 4FP5D 3S1MB 2EYFA 2HUGA 3UI2A 1K8OA 4KK7A 1LV9A 4E6IA 2AUJD 3OOCA 2B2WA 4MIUA 2EY1A 3DMUA 1HPCA 3M3YB 4K8IA 4A3FB 2JEAI 1ENFA 2FINB 5C4HA 1TY0A 1ZEQX 4XTCS 5CV7A 1NUCA 1NCVA 1EU4A 4A3JB 3HP3A 4RGOS 2O5JC 5E3FA 2NBFA 1IKMA 2NTTA 1BF4A 2I46A 1ESRA 3SK5A 3P20A 4IFDH 1O7ZA 4RCNA 4S3SA 4O42A 1G2SA 1HCZA 1B1ZA 4EQOA 1MGSA 3A8JE 1U4PA 2SNSA 2F0FA 1SE4A 2B2VC 3TDQA 4WRDA 5CV9A 5ISRA 1A3UA 4I65A 1HQRD 4C3IB 5I2YA 1PXUA 3H09A 3FMCA 1GHKA 1DM0B 1V8QA 1DD2A 2DY8A 3EJIA 3L3OC 5ELBA 5JJZA 4WORA 3I91A 5CBEE 4QUCA 5C4XB 1BNZA 1QWYA 5HURA 2EJFC 1GUTA 2L0CA 3PUZA 2PO4A 2H4OA 1S5ED 1H9SB 2LY7A 3Q6SA 2DY7A 5CR3A 2F0NA 2JYOA 3D8GA 2K1BA 3VYRA 4B9XA 1RD9D 2EY5A 3TP8A 1B50A 3HRZC 1GUSA 4IURA 1UEAB 4RGNA 5FK9C 4KJOA 3Q23A 2QF7A 3NXWA 3C3LA 3HS0C 2M00A 3NWSA 3HOYB 3S17B 3IL8A 3Q22A 1I4GA 1YNNC 1IYVA 4IFDI 1FNVA 1SE3A 5C4ZA 2AUKA 3EROA 1LABA 2VNUD 3GV6A 3VYUA 1EY9A 4GZYC 3QJYA 4U68A 3K5OA 1UUPA 1Q1BA 4C56C 3NTKA 3MHBA 3A7LA 3MEHA 2FMMA 1U4RA 3AU7A 1SMYC 2KUMA 1CHPD 3I4NB 2DNCA 3EQLC 4OL7A 1BQQT 3C1FA 1Q8IA 2XNAC 4DNRB 1PDQA 2OT2A 1MSHA 1EY6A 3ITPA 2F0LA 1BCPB 2A5HA 1I4XA 2FHTA 3TP5A 3QB3A 4PQXA 2NZ1D 3NBIA 2ZXRA 3M7GA 5I6YA 4J6HA 1D5XC 2RDHA 1D6EC 3NQIA 3QIAA 2JA7B 3ND8A 1Y8NB 1ZYRD 1S5CD 1Q3LA 1VF5C 4L8JA 4OIJA 4NKLA 1DXMA 3PMFA 5CV8A 3NTHA 1DONA 3GTGB 2EDGA 3K59A 5I2XA 4RGTA 1HHVA 2Q8RE 2G9DA 4M1UB 5M5YB 1X32A 1XYIA 3IAYA 3U9OA 1V1PA 4CJ0B 2BDOA 2K5DA 3I90A 2E2JB 3SEBA 1SNDA 3S2DB 1XWEA 1EIGA 3URYA 1I3QB 2PYKA 3GTPB 4OO1I 1EQTA 2L11A 3P75A 2MP1A 2A6HC 2FJ2A 4ID6A 1AEXA 1AZQA 1CA5A 4RKLA 2F0KA 3MWYW 5M3MB 4UAIA 1J8IA 1A2UA 4DN4M 4IZ8A 1FGBD 3CU7A 2SDFA 2KEEA 4YIJA 3VR2A 3DM1A 4WJWA 4DXFA 3TZDA 4EGVA 3J81L 3NK9A 2Z4HA 2M9VA 1CQVA 2F0JA 5G3LD 3H6MA 1AW7A 5EKKA 1SYDA 1PYWD 5FOBB 3R2TA 1TS4A 1FYCA 1II3A 1LTRD 3HOUB 5EKLA 5ELDA 4R8NA 3NSWA 2ICEC 3SXHA 2F0UA 4C3JG 1V1PB 1SYFA 2X69A 2MJ8A 3GQBA 3SHLA 1LACA 2PW5A 2OXPA 3TMEA 3S16B 2E2IB 2JA8B 5KEEA 1L0XB 4U673 1BCPD 1JOOA 3K0YA 4KN4C 1HQMC 2O2LD 5F2DA 1D1KA 2TMPA 3HKZB 2HCIA 2EYHA 4R8IA 1G291 4A93B 1JWSD 4C1NK 2ID0A 4LMQD 1QCBD 3HOVB 4HMJA 1ZXTA 4K6DA 2A73B 1SXTA 3BYYB 4H0LC 3WOEA 5EPKA 3OWFA 2L55A 4CKCA 5CC4A 3J81E 5C44B 1STEA 5DAUA 5FKAC 1QG7A 4RHSA 1GUWA 2KEDA 1L0YB 4O1NA 5IGBA 1IYUA 2PZWA 4KD3A 3NP8A 1OXVA 1EY5A 1F9SA 4TQUS 4CKBA 5IGCA 4N9PA 3RZDB 1WD1A 5K36H 2B39A 2QDBA 2WKCA 4KY7A 2D9UA 1Q1EA 1I4QA 5BN3A 2F0MA 2IT1A 2B2TA 2WP8J 2KHSA 1PZID 5JPMC 4PV1C 4R9WA 3PO2B 1STAA 3BS1A 1EEID 5IGGA 4FXDA 2Q8IB 5D3IB 3GO5A 4Z9CB 2Q8TA 1I6VC 2RQXA 4ZLTF 2E2DC 4ZYSA 1E0BA 4KHVA 2F03A 1OXUA 5E4XA 4ZRZA 1KABA 1V43A 4NMZA 4HSVA 4KV6A 1TWGB 2YU9B 4V0BA 3K58A 3S2HB 2BA1A 4A3MB 5CORA 4FO2A 3CQZB 1H9RA 1SNQA 4QF4A 2QKIC 1YNJC 4A3BB 4ZUIA 1TWFB 2IL8A 1S5BD 1ILQA 3SDZA 1WVLA 5IOCA 3QO2A 2A6EC 1SYCA 1CHQD 1JR0D 4B9WA 1PLFA 3VYTA 3MZ5A 3DEPA 2PNRC 1LTBD 1A3VA 4EVOA 5JEAH 4K5XA 4A3EB 3T53B 4FXKC 1B44D 1WTQA 3S1QB 3OW7A 5C0XH 1Y69U 1PTOF 5A35A 4CHTB 1PRTB 5C6AA 2WINB 4CJ1B 2EJMA 5EGTA 1F9QA 3SVMA 3J7AV 2QILA 4OIKA 4KKUA 4FXGC 3MXUA 4RAUC 3VR5A 2B2UC 1KAAA 2X6GA 3BDCA 3G6JB 3CHBD 2R6GA 2Z4IA 5COYA 1CT1D 1DYQA 3GTMB 4V190 1WTXA 5EPLA 1RF2D 2K6AA 3SK8A 4DAVA 1MSGA 5CGKA 5IT9L 1C8CA 2KVMA 1EY8A 3TP6A 3K7AB 3LWUA 3S14B 1WCMB 4XXEA 1TIID 1Y1WB 2K5QA 1IW7C 3I73A 2KA7A 3I3CA 2D2CC 3I72A 3LNNA 4BY1B 4G57A 5C0XI 4EQPA 3W3AA 1CZWA 1OXSC 2A68C 2A69D 1XXGA 2E2HB 3F2UA 1LO5D 3R2IA 1LTGD 1KDCA 1G8ZD 5FO7B 1R9TB 4K2LA 3DWPA 3NUCA 1IHZA 3H94A 1KTKA 3ND9A 3J80L 2NVQB 3OPOA 3D4RA 5KYIA 3OWEB 1HTPA 2F3WA 1TS5A 3RLFA 4IUTA 3CKIB 3U9SA 5EQ0A 2L12A 2PCFB 1WTPA 3FPUB 2F0HA 4OGQC 2L9HA 2ZXPA 1QE6A 1X3PA 1DOLA 2WKDA 3VR3A 2XWBB 1TU2B 5ELCA 3A7AB 5I6WA 4XDXA 4F87A 3OHXC 3K5MA 3BVGA 5IT9E 3D3RA 3TZUA 1ESFA 4HR7B 1EZ8A 4RFBA 4ZAIA 5ELFA 1SNPA 2IPKD 4IN3A 4XQQA 3S15B 3L7ZC 2HDMA 4IUVA 4ODGA 2F4IA 4DAPA 3X3NA 3M85A 3EFXD 2AWNA 1PZKD 1VMCA 1F77A 3TSSA 1SYGA 2BE5D 4X3UA 4OHJA 1B3AA 2AQ2B 2BA0A 5KYLA 1LTTD 1OO9B 3I4MB 4LAAA 3H91A 1PRTD 4OO1H 4RGMA 5TSSA 2F0WA 1X3QA 1STGA 3WDNA 2SEBD 4ZK9B 5KNCA 1D5ZC 3J80E 3R3OA 3FEWX 1FNWA 3N52A 4KY6A 1I6HB 2ENBA 2L1BA 3ZYYX 2YYZA 3MA2B 1JWMD 5CBAE 4PNYA 3A8KE 1CA6A 2F0VA 2PW7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WAC A;  3SK4 A;  2OF1 A;  4MIU A;  1STH A;  2EY1 A;  2KHS A;  1EYA A;  3DMU A;  3QOL A;  4QMG A;  2F0U A;  1STA A;  3SXH A;  5KRU A;  4K8I A;  1SYF A;  3S9W A;  1KDA A;  2O4X A;  3U9O A;  4PMB A;  5C3X A;  3SHL A;  5C4H A;  5IGD A;  5C4Z A;  5C6A A;  5IGG A;  5KIX A;  5KYI A;  5C5L A;  2PW5 A;  3ERO A;  2OXP A;  3NHH A;  3TME A;  2F3W A;  1EY4 A;  4EQN A;  4DF7 A;  5CV7 A;  5KGU A;  2F0I A;  1SND A;  1NUC A;  1EY0 A;  1EY7 A;  1EY9 A;  5EGT A;  2PZT A;  4K5W A;  5J39 A;  5KEE A;  5J22 A;  4PMC A;  5E3F A;  5K5P A;  4KHV A;  2EY6 A;  1SYB A;  2F0H A;  2PYK A;  4IUN A;  1SNC A;  1STN A;  2F0S A;  1JOO A;  3D6C A;  4HTH A;  4KJN A;  1ENC A;  1KAB A;  3SK5 A;  3VA5 A;  3P75 A;  5F2D A;  5I9O A;  3HZX A;  4NMZ A;  4F8M A;  3MHB A;  5IGF A;  2EYH A;  3MEH A;  4ID6 A;  4KV6 A;  5HGT A;  1AEX A;  1KAA A;  1ENA A;  2NUC A;  4KY5 A;  5JAV A;  5I9P A;  3EVQ A;  3T16 A;  3QOJ A;  2F0T A;  3BDC A;  4S3S A;  3SK6 A;  5I6W A;  4DFA A;  4HMJ A;  4RKL A;  1U9R A;  2F0K A;  3SR1 A;  4EQO A;  4N9T A;  2F0E A;  1EZ6 A;  2PQE A;  1EYD A;  4K6D A;  1TQO A;  1A2T A;  2SNS A;  2F0F A;  3RUZ A;  1JOK A;  2F0D A;  4OL7 A;  1A2U A;  4ZUJ A;  2LKV A;  4K5V A;  3C1F A;  1TT2 A;  2KQ3 A;  1EZ8 A;  3P1H A;  4WRD A;  5CV9 A;  3OWF A;  3SK8 A;  3OMC A;  1A3U A;  1SNQ A;  4IZ8 A;  4I65 A;  4DGZ A;  3LX0 A;  1F2M A;  1SNP A;  4QF4 A;  2OEO A;  2RBM A;  3NQT A;  1EY6 A;  5CGK A;  3ITP A;  2F0L A;  4IAL A;  4ZUI A;  2F0G A;  5CC4 A;  4YIJ A;  2PZU A;  2F0O A;  3E5S A;  1EY8 A;  3TP6 A;  1EQV A;  2RKS A;  1STB A;  2EYO A;  4ODG A;  3TP5 A;  3QB3 A;  4J1M A;  2EYM A;  5DAU A;  3EJI A;  1F2Z A;  2EYP A;  4KTA A;  4WOR A;  5IOC A;  2F0P A;  5DEH A;  3MVV A;  4K8J A;  5E1F A;  4K2K A;  5I6Y A;  1JOR A;  5HUR A;  4J6H A;  1NSN S;  3C1E A;  3DHQ A;  2EY2 A;  3T13 A;  5IOD A;  1SYG A;  1SYC A;  1TR5 A;  3D4D A;  3NK9 A;  4G57 A;  5IGB A;  5CV4 A;  2PZW A;  4KD3 A;  4EQP A;  4QB4 A;  5J1Z A;  5ISR A;  3NP8 A;  4ME5 A;  1JOQ A;  2F0J A;  5KYL A;  2F0Q A;  1EY5 A;  3BDL A;  3H6M A;  4B9W A;  1RKN A;  5CV5 A;  5CR3 A;  4LAA A;  2F0N A;  3MZ5 A;  4NDX A;  2RDF A;  5NUC A;  5EKK A;  3MXP A;  4HMI A;  2F3V A;  1SYE A;  3D4W A;  4F7X A;  5IGC A;  1A3V A;  5C5M A;  3D8G A;  1SYD A;  4N9P A;  4B9X A;  4EVO A;  5C3W A;  5M9O A;  4K5X A;  2EY5 A;  2F0W A;  4NKL A;  2HQE A;  1KDC A;  1STG A;  4K14 A;  4ZQ3 A;  3TP8 A;  2SNM A;  4H7B A;  4TRD A;  5JOB A;  3PMF A;  2EXZ A;  3TP7 A;  1SNO A;  3V2T A;  4KD4 A;  2QDB A;  2EYL A;  1SNM A;  3R3O A;  4NP5 A;  5CV8 A;  4RKB A;  1EYC A;  3OMG A;  1F2Y A;  4KY6 A;  4KY7 A;  2ENB A;  5CV6 A;  1A3T A;  4K2L A;  5IIF A;  3OSO A;  4KJO A;  5IGE A;  1II3 A;  2EYF A;  3NXW A;  2EYJ A;  2M00 A;  1IHZ A;  3NUC A;  5EKL A;  4PNY A;  4DU9 A;  3HEJ A;  1KDB A;  1STY A;  2F0M A;  4R8N A;  4E6I A;  3ERQ A;  2F0V A;  2SOB A;  2PW7 A; 
#chains in the Genus database with same CATH topology
 1BR9 A;  3D6W A;  3SK4 A;  2K33 A;  2QEJ C;  1AFP A;  2JE6 I;  5IYD G;  4KHP Q;  1MI2 A;  2A8V A;  3GTJ B;  4JV5 L;  2ICI A;  4HCS A;  4PMB A;  4BXX G;  2VW9 A;  2N88 A;  2QCP X;  4IUU A;  2B2Y C;  5I4D A;  1Z47 A;  2UXC Q;  2XRS D;  2RVL A;  1VF7 A;  1WD0 A;  1IZ6 A;  4GLV B;  2EJG C;  1SDF A;  2GVB A;  4PMC A;  1GUN A;  1O80 A;  1SEB D;  3CMA A;  4AQY Q;  4A3J G;  2EY6 A;  2L4N A;  2Z8L A;  4P73 A;  3EA6 A;  1WJJ A;  2HHH Q;  3I55 A;  3T4A C;  3HGB A;  4G7H C;  4P75 A;  1I5F A;  3ULP A;  5KNB A;  4GN5 A;  4KY5 A;  4DR3 Q;  5I9P A;  4DV3 Q;  1IL8 A;  4KKT A;  1V1O A;  3RZO H;  2IX1 A;  4N9T A;  2F0E A;  1WTO A;  4IFD G;  2PI2 E;  2H1E A;  3JAM E;  1BOS A;  3RZO B;  4IOA A;  3FP9 A;  2Q2U A;  3DXJ C;  4BY1 G;  4DNT B;  1KD1 C;  1RL2 A;  4JPB W;  2R7F A;  1E2V A;  4DGZ A;  2UXB L;  3Q0A A;  4DV2 L;  1TWC H;  4DV1 Q;  3OTO L;  2VS1 A;  4DR6 L;  1SAP A;  4C3I G;  1G6Z A;  3E5S A;  3DWA A;  5E4W C;  1XTD A;  1F2Z A;  4KTA A;  5M5W B;  3F8T A;  3S24 A;  1IBK Q;  1G91 A;  4K8J A;  2AQ3 B;  4K2K A;  1BDO A;  5C4X G;  1LTI D;  3TN2 A;  4BBS H;  2B3G A;  5IOD A;  2ZXO A;  1Q7Y C;  4X3T A;  4GOP A;  2D5D A;  4FF4 A;  1JOQ A;  2BDN A;  4B3S Q;  4BBS B;  2Z9H A;  1RKN A;  3RR5 A;  2EE1 A;  3J7A 5;  3MTS A;  1SRU A;  4HMI A;  2XGT A;  2XSC A;  3UE1 A;  2LXK A;  3M7N A;  1GOZ A;  5ELN A;  5C3W A;  1X3F A;  2UUC Q;  1I50 B;  2HQE A;  3GV3 A;  1G51 A;  4TRD A;  1LT5 D;  2Q2T A;  4JI7 L;  5LL6 X;  4C3H H;  4P71 A;  1EYC A;  3K57 A;  5CV6 A;  3U4V A;  4LF4 L;  1RCV D;  1O7L A;  3QG1 A;  2RA4 A;  2Z1C A;  4DU9 A;  5JVG 3;  4DV7 L;  3HOY G;  1QJO A;  2SOB A;  1VS0 A;  2NN6 H;  1PA6 A;  2OF1 A;  5T1G A;  2CW0 C;  3QOL A;  4ILW A;  1PTO C;  3HFZ B;  1X3E A;  3KDF A;  1M8A A;  1AE2 A;  5C3X A;  5J3B A;  5JPN C;  4R4C A;  5EBC A;  5C5L A;  5KND A;  4X65 Q;  3K6O A;  1ET9 A;  4GLX A;  5KGU A;  1P8L A;  2Z6K A;  1RDP D;  5G3L F;  4KMU C;  1AN8 A;  4F88 A;  1K73 C;  1FGU A;  3HOW B;  1B53 A;  2N3S A;  3IKJ A;  3TS0 A;  1Q12 A;  1SJE D;  2XWJ B;  1UNS A;  1YJ9 A;  1CQF A;  4HTH A;  4GS3 A;  4LF9 Q;  1E22 A;  1L2F A;  2MO0 A;  2AKW B;  1Z6H A;  3HOZ H;  2NB0 A;  1M90 C;  2KEN A;  1L0W A;  2HT1 A;  3M4P A;  4MZ9 A;  3HOZ B;  3CW2 C;  1T5E A;  3GD7 A;  2WV6 D;  3SR1 A;  1NR4 A;  5CYU A;  3R93 A;  4YCU A;  1XNR Q;  2CWP A;  1OXT A;  2IHF A;  4CKE A;  1EYD A;  4PMW A;  4LFA L;  3J7A F;  3I4N G;  3T56 B;  4DXG A;  2XVS A;  2E76 C;  4DV5 L;  1BUV T;  4A3C G;  1TT2 A;  3MFY A;  1E7Z A;  5AJ3 Q;  3OMC A;  1B2T A;  3PIO A;  4AIM A;  1WTH A;  2RBM A;  2PNH A;  3KLS X;  5EKI A;  1K8M A;  4Q5V A;  1QIL A;  1C48 A;  1FD7 D;  1S5D D;  4J1M A;  1YNN D;  1PTO H;  1NBW A;  1PFN A;  1PYS B;  1BCP F;  1CM9 A;  1SN8 A;  4DR5 Q;  1DZ1 A;  1EWH A;  4GOP B;  1IBL Q;  3PCO B;  4LK1 C;  4FF3 A;  4IPG A;  4L6T B;  5CV4 A;  2NN6 I;  4ABN A;  3OW2 A;  3D31 A;  3VYS A;  5CV5 A;  5LL6 S;  1KNE A;  3D4W A;  2CQA A;  3BVZ A;  2ZTE A;  3L0O A;  4XYO A;  1SNO A;  2UUA L;  2F52 A;  5IP9 G;  1E2Z A;  4I7A A;  1A3T A;  1CSP A;  2IWH A;  4LF5 Q;  2K32 A;  4A3K H;  1SMY D;  4JI6 L;  5D65 A;  3NPP A;  2YTV A;  1JWU D;  3BYT B;  3KDF B;  3VA7 A;  4X3S A;  4DV0 L;  4B3R L;  3W2D A;  4GN4 B;  4JI2 Q;  5IGD A;  1D5M C;  1NR2 A;  1VQ8 A;  3U50 C;  3F2D A;  5M3F H;  3ULL A;  2BCO A;  1EY7 A;  5M3F B;  2LFN A;  3NTI A;  4K5W A;  1IBM L;  4FDB A;  3E9H A;  4EX5 A;  3UDI A;  2VUM H;  3KOJ A;  2IY5 B;  2RDG A;  1CKO A;  1SE2 A;  1HH2 P;  1O7Y A;  1AP0 A;  3IFT A;  4TKO B;  1QZG A;  2VUM B;  2VQF Q;  4IFD J;  4F8M A;  1W6J A;  2GA4 B;  3CC7 A;  2K52 A;  1ENA A;  2NUC A;  1FL0 A;  1CFM A;  3M4O H;  1TS3 A;  3BZD B;  3DM3 A;  1HR0 Q;  1X56 A;  2QW7 A;  2HCC A;  3HKZ E;  3OIQ A;  4HED A;  2B63 H;  3TQY A;  2JSO A;  1F2M A;  4JYA Q;  4JI5 Q;  4NW2 A;  4ZKB B;  1XPU A;  4DV4 L;  2RHQ B;  4BWG B;  2B63 B;  4DR4 Q;  1LTS D;  2PPB C;  1PH4 A;  2J0T D;  2RKS A;  1Q90 A;  3PIP 3;  5DM7 3;  5C4J H;  2NWG A;  2VXW A;  4OX9 L;  2EYM A;  1H95 A;  1HZB A;  3A56 A;  1BBX C;  1VQ9 A;  5C4J B;  1GKH A;  4KLK A;  3RLN A;  3KUP A;  1TVX A;  3SGI A;  2MPM A;  1W6K A;  4A3I H;  4BS9 A;  2EZV A;  4KI0 A;  1DCZ A;  2I5H A;  3TBI B;  4EQ5 A;  4K0K Q;  4P74 A;  4A3I B;  1N34 L;  2JP1 A;  2NVY H;  4PG3 A;  4YHH L;  1LT4 D;  1A6X A;  2RDF A;  3PQI A;  2FFK B;  2KEC A;  3UDG A;  2KHJ A;  2NVY B;  3BDO A;  5D3D A;  4ZQ3 A;  2X6L A;  1GUG A;  3C46 A;  2VL6 A;  3TP7 A;  3FKI H;  2VB2 X;  1BO0 A;  2ZTC A;  4KHZ A;  4HSP A;  2A6H D;  1XX8 A;  2XRQ D;  3BG3 A;  3FKI B;  3HOW G;  2JEB I;  4PZ8 A;  4DA2 A;  3GTQ H;  2C5C A;  2LXJ A;  1KC8 C;  3BVM A;  4O2D A;  3WOF A;  3HOU G;  1KDB A;  1STY A;  3AB9 A;  2UXD Q;  3MFG A;  3GTQ B;  1NJI C;  1BVS A;  1VQA A;  4WJ3 M;  4K6L A;  1GXD C;  2AWO A;  3DEO A;  1N33 L;  1UWV A;  1EIY B;  2K50 A;  2JA8 G;  1ZYR C;  1LLR D;  3KBG A;  2R92 B;  4RWS C;  3PUV A;  5GRO A;  1EL0 A;  2XIW A;  1HNZ L;  5I9O A;  1HFN A;  3HZX A;  5FO8 B;  2CKZ B;  2CVR A;  3HKZ G;  2R3Z A;  5HGT A;  1H9K A;  2MFI A;  4BA2 I;  1VQM A;  1VMP A;  3T16 A;  3PO3 H;  3V05 A;  4A93 G;  4XQJ A;  1TWA H;  1EZ6 A;  2IX0 A;  1FNU A;  3TRZ A;  3FRP B;  1TQO A;  3PO3 B;  5DNF A;  1JOK A;  2RHS B;  1MIU A;  1TWA B;  1S5F D;  3CC2 A;  2IW3 A;  2RCN A;  2D0P A;  4MN3 A;  1A8V A;  5C3E B;  3LX0 A;  4LUV A;  4TVA B;  2C35 B;  1PV4 A;  3NQT A;  4B3T L;  4FYD A;  4JV5 Q;  4NPS A;  1RHP A;  4JOI C;  1Y1V H;  1HNX L;  1LT3 D;  2VQE L;  2NVT H;  2K5V A;  1Y1V B;  5C44 G;  4H44 C;  2B2V A;  1X9N A;  1RTN A;  3MVV A;  3MXN A;  2NVT B;  1B3Q A;  4XIG S;  3Q8D A;  2EY2 A;  1D2B A;  1XPO A;  1WYD A;  4A3F H;  4LNQ A;  5IY0 A;  1DGS A;  2EPB A;  2F3V A;  3T1Y L;  1YIT A;  4AYB B;  4G7O C;  1HXY D;  2K04 A;  3KLR A;  1ONL A;  1S3O A;  2UUB L;  1GHJ A;  4B08 A;  4A3G B;  1SNM A;  1N8R C;  2BOS A;  3KF8 A;  1A62 A;  4IUQ A;  1F2Y A;  1R4P B;  5BN4 A;  3OSO A;  5K36 G;  2UXB Q;  4MHE A;  4JBM A;  2IJ0 A;  4DV2 Q;  1KQS A;  3OTO Q;  3MAQ A;  1KLG D;  4Y7N H;  1W2B A;  3GP7 A;  2JA6 H;  1KDA A;  2O4X A;  1PH9 A;  4Y7N B;  4ULL A;  2B2W C;  3G6E A;  1B4O A;  2IX3 A;  2B8F A;  1J9O A;  3NHH A;  2JA6 B;  1CK1 A;  3CAM A;  3E3X A;  2HIX A;  1CI3 M;  2PZT A;  1VQF A;  3BZK A;  3M9B A;  5J22 A;  5K5P A;  1HA6 A;  1QB5 D;  3PUX A;  1YZ6 A;  1K8G A;  3DUZ A;  4KJN A;  3PUW A;  3PF5 A;  2K03 A;  5LMN L;  4MTN A;  1ENC A;  1K0R A;  1EWC A;  2B63 G;  1D7Q A;  3F1Z A;  2NTS A;  3F2B A;  1A15 A;  2R61 A;  4JI7 Q;  2CQO A;  5FO9 B;  3X3M A;  2BH2 A;  1QUQ A;  4QUF A;  1NAP A;  1H9M A;  4LF4 Q;  2JN4 A;  2EXD A;  2AQ1 B;  2KOL A;  1DOM A;  2PQE A;  4UY8 C;  1A2T A;  2F0D A;  4DV7 Q;  4A3M G;  2KQ3 A;  1VQJ A;  2EVB A;  3MXG A;  4KKS A;  3VR4 A;  4IAL A;  5BN5 A;  3S1R B;  4A3B G;  4BBR H;  2WII B;  3HOX H;  1STB A;  3I56 A;  1JC7 A;  4BBR B;  1SRO A;  3HOX B;  4OWW B;  2F0P A;  1BCP C;  4AYB E;  2OWO A;  1VQE A;  5GAG C;  1B9M A;  1PH7 A;  1YEZ A;  1SE8 A;  2LS0 1;  1ILP A;  1QOH A;  4ME5 A;  1ICW A;  4Y52 H;  3A5Z B;  2CHB D;  2K5H A;  4XQN A;  5NUC A;  3WWV A;  4F7X A;  3J7Z C;  2N78 A;  4HN7 A;  4DK6 C;  3JAM L;  2KCC A;  1VQN A;  5M5X H;  3KYH C;  5M9O A;  1SJH D;  3AYH B;  2EXZ A;  3KF8 B;  2E75 C;  4KD4 A;  5M5X B;  4RKB A;  5JEA G;  3OMG A;  4QY7 A;  3IFD A;  4HIM A;  4DV5 Q;  2TSS A;  4C3J H;  4I7Z C;  5GAE C;  1TY2 A;  2AHO B;  3VR6 A;  2R92 G;  1EQR A;  2WAC A;  4C3J B;  3H3V C;  4QMG A;  2B2Y A;  5T1I A;  2K7V A;  2NZH A;  1VQD A;  3JAM c;  5C0X G;  2ZJQ A;  2WAQ B;  1YNJ D;  4J8Q A;  1EY4 A;  2OQ0 A;  1PH2 A;  2V4D A;  3I4O A;  1PRT F;  4DAM A;  2K01 A;  3U4Z A;  1U0L A;  3EBE A;  3AMU A;  1F2L A;  1CZG A;  2ZJP A;  1SNC A;  1C4Q A;  2F0S A;  2A6E D;  4LJZ C;  5E7N A;  5C3E G;  1HZC A;  1ASZ A;  4NB3 A;  1XMO L;  4IOC A;  1U5K A;  5IGF A;  1QUQ B;  1C7Y A;  3K8A A;  3M4Y A;  3QWN A;  2F0T A;  1U9R A;  2ALY B;  3CF5 A;  1CSQ A;  4IJH A;  1TWH H;  4J15 A;  2DN8 A;  4JI6 Q;  4L5R C;  1YHQ A;  4GN3 B;  3O13 A;  4R4Q A;  4DPG A;  1TWH B;  5FLM G;  1SMX A;  1AE3 A;  1MHW C;  3FDT A;  3E9I A;  2OEO A;  4DV0 Q;  4JK1 C;  4X3K A;  5FJ8 H;  4B3R Q;  4G4K A;  1UAP A;  2DJG C;  1VQI A;  4AYB G;  2F0O A;  4A3D H;  3CRL C;  1E24 A;  3H3V H;  1VQ5 A;  3NWT A;  4A3G G;  1WCM G;  4A3D B;  1IBM Q;  2BH8 A;  4X62 L;  1Y1W G;  2Q2I A;  5EBD A;  4DK1 A;  1PVO A;  1JOR A;  3P7J A;  3T13 A;  1WTR A;  1V9P A;  1M4V A;  4DAY A;  1JE4 A;  1Z9F A;  3BDL A;  3MC0 B;  4LFC L;  2KBN A;  1MD2 D;  2E2J H;  1VCI A;  1CKM A;  3ONA B;  1LTA D;  3KLW A;  5C5M A;  1HA5 A;  1EOT A;  3AEV A;  1OXX K;  1F9R A;  1TWC B;  1YI2 A;  2SNM A;  4JCV E;  2EYL A;  4C1N I;  1TXY A;  2B8G A;  1HZ9 A;  3KLS A;  1Q86 C;  1U4M A;  4G7Z C;  3RMH A;  2EYJ A;  2WAQ E;  1CTM A;  3CCU A;  4C2M H;  1JT8 A;  4LF8 L;  2K5N A;  5ELE A;  4QL5 A;  3K0X A;  4DV4 Q;  3FVQ A;  4LF6 L;  4C2M B;  1FR3 A;  3E6Z X;  1HTL D;  1R4Q B;  1AZP A;  3CCQ A;  1GD7 A;  2XTI A;  1TKW B;  3UE0 A;  1BXT A;  2CCZ A;  5HGQ A;  2JXM B;  1YBY A;  1JB3 A;  4C3H B;  1LUZ A;  1SYB A;  1N34 Q;  4IUN A;  4YHH Q;  4DUY L;  4O0A A;  1I4P A;  2K5W A;  4XT3 B;  1PH5 A;  3B6Y A;  1IW7 D;  3I70 A;  5EJW A;  1HUN A;  1PFM A;  4DUZ L;  3H3V I;  4QCL A;  1PFB A;  4PZ7 A;  1A63 A;  4BA1 I;  1W3S A;  1P16 A;  2K4K A;  5JAV A;  4P72 A;  4QQB X;  2A68 D;  1SFO H;  3QOJ A;  2DNE A;  3LGJ A;  3SK6 A;  4DFA A;  5LMU L;  1E2W A;  3KFU A;  3CME A;  3N6R A;  4CDE C;  1KIX A;  2VB3 X;  4WFN 3;  1SFO B;  5DM6 3;  2OTL A;  4ZUJ A;  2LKV A;  2B29 A;  2J4X A;  4UP9 A;  3STB D;  1K9M C;  3CC4 A;  4GKJ L;  1EU3 A;  4CDD C;  3FHW A;  1UEB A;  1K83 H;  1QNU A;  5FLX L;  3F2C A;  2LMC B;  3S1N H;  1K83 B;  4UP8 A;  3S1N B;  5A2Q L;  4DK0 A;  1B70 B;  4RCO A;  2NVX H;  5GAH C;  2A1A A;  5HY6 A;  2G9H D;  4UDU C;  1KLU D;  1NTG A;  2D0O A;  1NSN S;  3C1E A;  3DHQ A;  1WTW A;  1ROD A;  4DAY B;  2NVX B;  4IPC A;  4MNO A;  4JBK A;  3I4M G;  2L5T A;  4NDX A;  2K28 A;  3Q24 A;  3MXP A;  1SYE A;  5JEA J;  1Y8P B;  4FVM A;  1RJT A;  2WAQ G;  5JOB A;  4OO1 G;  3V2T A;  1Z7T A;  1J5E L;  4BY7 H;  4GKK L;  4NP5 A;  1JJ2 A;  5IGE A;  2A74 C;  1PTO B;  3UDF A;  4BY7 B;  1XNQ Q;  4Q0F A;  4POG A;  5JVH 3;  5C0X J;  4B3T Q;  3A5U A;  3K5L A;  4HCE A;  2NYZ D;  1KRT A;  4QGU A;  3K5N A;  3T1H L;  5CMD A;  1HNX Q;  4LFB L;  1HRJ A;  4DKA C;  3S9W A;  5KRU A;  3HOV H;  3CPF A;  2VQE Q;  1H9J A;  5D14 A;  3NBH A;  1ASY A;  1JQY D;  1X55 A;  2JA5 H;  3GTL H;  4N8X 1;  4DF7 A;  2I07 B;  3IRB A;  4HAE A;  3PUY A;  1EY0 A;  4CJ2 C;  2JA5 B;  3GTL B;  2A69 C;  4UP7 A;  4RA8 A;  1SBB B;  1STN A;  4FF2 A;  3D6C A;  1MBY A;  1ZKO A;  4HJ8 A;  1N9W A;  4A3K B;  4OWX B;  3CXC A;  4L63 B;  1JJG A;  1XTC D;  4JI1 L;  2UUB Q;  2PQA A;  2E5L L;  1ML0 D;  1Y8O B;  2N55 A;  1EUJ A;  4CGY B;  3U58 A;  2ZM6 L;  3TRE A;  1HJP A;  1I4H A;  3A0J A;  3ICE A;  3LWE A;  4A3D G;  4H13 C;  5FLX E;  4HID A;  1EFI D;  4FNF A;  2R93 H;  3T51 B;  4JBW A;  3PGZ A;  1SSO A;  1RTO A;  2WB1 B;  4P2C B;  5ELO A;  3CD6 A;  4K5V A;  1KXL A;  2ZT9 C;  4YWK A;  1D1I A;  4XT1 B;  3OIP A;  4IUP A;  5A2Q E;  3L9A X;  2R93 B;  1G2T A;  1UE1 A;  4IPD A;  1DJR D;  2P5Z X;  2UU9 L;  3FPP A;  4HJ9 A;  2PMZ B;  1K3B C;  1I94 Q;  2PZU A;  1EQV A;  1O78 A;  1ET6 A;  4RHR A;  4X66 Q;  4XYQ A;  4IJL A;  1BKB A;  2EYP A;  2OQK A;  5DEH A;  4M8A A;  1WTV A;  4B3M L;  1U4L A;  2E74 C;  3H15 A;  5LHY 1;  1QNK A;  3A54 A;  3M4O B;  5LMN W;  1EIH A;  1LYL A;  1TR5 A;  3PO2 H;  1T5X D;  1Q8K A;  1EEF D;  4OEL B;  5LMN Q;  3NE5 B;  3ER0 A;  3BU2 A;  3TS2 A;  4KN7 C;  1JJC B;  4BBS G;  2F1M A;  1HFG A;  4A76 A;  3AFP A;  2EOT A;  4IQZ A;  5IYC H;  3C2P A;  1HUM A;  1EWI A;  4DV6 L;  2HDL A;  3KBX A;  1JCK B;  2FXQ A;  1B9N A;  1PZJ D;  4FF1 A;  1S4Z A;  3KK7 A;  5IIF A;  1VQL A;  1PMR A;  3PIO 3;  2MUY A;  4L5S A;  1E1T A;  2RF4 A;  2R7Z H;  1QVG A;  3HEJ A;  4C3H G;  3CCJ A;  3ERQ A;  2QA4 A;  3SE0 A;  4JI0 Q;  2R7Z B;  4B3S L;  1STH A;  1PH8 A;  1EYA A;  1EYG A;  4DR7 L;  1IKL A;  4YCV A;  3NBH B;  3E0J A;  2CH4 A;  2NN6 G;  3S2H H;  4RH6 A;  5KIX A;  2B2T C;  2O5I C;  2RSO A;  3PV0 A;  1JB7 A;  4EQN A;  2BE5 C;  2F0I A;  5JJK A;  4A4I A;  1O7I A;  1QVC A;  4QIW B;  1PRT C;  5J39 A;  1LT6 D;  4TSS A;  3W5O A;  4JG2 A;  2FMC A;  1I4R A;  4HIK A;  4DNI A;  1K3R A;  1TWF H;  3DLL A;  2J7Z A;  3VA5 A;  2PQA B;  4LUO A;  5IP7 H;  4NXM L;  2MHV A;  3NEN A;  3CRK C;  2VY3 A;  1CUK A;  3EVQ A;  3HOZ G;  4ZKC B;  4HJ5 A;  4X65 L;  1HNW Q;  2PMZ E;  3CCL A;  1JE5 A;  3RUZ A;  3G7L A;  3GTO H;  5EPJ A;  4A3L H;  1S72 A;  3J7Y W;  4JOI A;  3I4L A;  3H0G H;  1F9P A;  3P1H A;  3DWQ A;  3A55 A;  3GTJ H;  3GTO B;  1G6P A;  1GJX A;  1GUO A;  3RD4 A;  4A3E H;  2B2U A;  3H0G B;  1XJV A;  2F0G A;  2D62 A;  1M1K C;  2XN9 C;  3I8Z A;  3GTK H;  2RSN A;  1ICF B;  2EYO A;  2C9O A;  3NEM A;  2CW0 D;  4CBV A;  2K05 A;  1PH3 A;  1DOK A;  1PTO D;  3GTK B;  5E1F A;  1B8A A;  3HG9 A;  2MGS A;  1NE3 A;  1TS2 A;  2KCN A;  1KNA A;  3D4D A;  2I5M X;  1JIC A;  4QB4 A;  5J1Z A;  2F0Q A;  3R8B A;  2M2L A;  1H9S A;  1XMO Q;  2L15 A;  2Y0S B;  3J81 j;  3V96 A;  2DUD A;  5GAD C;  4JI3 L;  4K14 A;  1VDZ A;  1KHI A;  2KJX A;  4H7B A;  3RN5 A;  3A8I E;  3S1M H;  5AFW A;  2I0Q A;  3PF4 A;  4FP5 D;  3E0E A;  3S1M B;  2EYF A;  1LTL A;  2HUG A;  3UI2 A;  1IBL L;  5IYD H;  1K8O A;  4KK7 A;  3M3Y H;  1LV9 A;  4E6I A;  4GNX C;  4BXX H;  2AUJ D;  3OOC A;  2B2W A;  4MIU A;  2EY1 A;  3DMU A;  1HPC A;  3M3Y B;  4A3K G;  4K8I A;  4A3F B;  2JEA I;  1ENF A;  2FIN B;  5C4H A;  1TY0 A;  1ZEQ X;  1RIP A;  1BBU A;  3GTM H;  4X62 Q;  1KRS A;  4XTC S;  5CV7 A;  4A3J H;  1Q46 A;  1NUC A;  1NCV A;  5M3F G;  2RCF A;  1EU4 A;  4A3J B;  3HP3 A;  4RGO S;  2O5J C;  5E3F A;  2NBF A;  1IKM A;  2NTT A;  1BF4 A;  2I46 A;  4OWT B;  4DR6 Q;  4UHV A;  1ESR A;  3SK5 A;  1NMG A;  2VUM G;  3P20 A;  4IFD H;  1L1O C;  1O7Z A;  4RCN A;  4S3S A;  4O42 A;  1G2S A;  1HCZ A;  1B1Z A;  4EQO A;  4BY1 H;  1MGS A;  3A8J E;  1XMQ L;  1U4P A;  5EAY A;  2SNS A;  2F0F A;  1SE4 A;  4LF8 Q;  2B2V C;  2JA9 A;  3TDQ A;  4C3I H;  4WRD A;  5CV9 A;  5ISR A;  2E2H H;  4LF6 Q;  1A3U A;  4I65 A;  1HQR D;  4YY3 L;  4C3I B;  5I2Y A;  1PXU A;  1VQ4 A;  3H09 A;  3FMC A;  1PYB A;  1GHK A;  1DM0 B;  1V8Q A;  1DD2 A;  2DY8 A;  3CCV A;  3K81 C;  3A74 A;  5C4X H;  3EJI A;  3L3O C;  5ELB A;  5JJZ A;  3W1G A;  4WOR A;  2E8G A;  3I91 A;  2Y0S E;  3JC6 6;  5CBE E;  2MO1 A;  4QUC A;  5C4X B;  1BNZ A;  1QWY A;  1YJN A;  5HUR A;  2EJF C;  4DUY Q;  1GUT A;  2L0C A;  1X65 A;  3PUZ A;  2PO4 A;  2H4O A;  4RMF A;  1S5E D;  1H9S B;  2LY7 A;  3Q6S A;  1K8A C;  1JMC A;  5H1S E;  4HIO A;  2DY7 A;  4DUZ Q;  5CR3 A;  2R7Z G;  2F0N A;  4A3I G;  2JYO A;  2YV5 A;  5L37 A;  3D8G A;  2K1B A;  3VYR A;  4B9X A;  1RD9 D;  2EY5 A;  3TP8 A;  1B50 A;  2OCE A;  1X3G A;  3HRZ C;  1K28 A;  1GUS A;  4IUR A;  3HOY H;  1UEA B;  3S17 H;  4RGN A;  5FK9 C;  4KJO A;  2CWA A;  3Q23 A;  3FKI G;  2QF7 A;  3NXW A;  3C3L A;  4GKJ Q;  3HS0 C;  2M00 A;  3NWS A;  3HKS A;  3HOY B;  3S17 B;  3IL8 A;  4ALP A;  3Q22 A;  4ZCK A;  2DGY A;  1I4G A;  1YNN C;  4K0K L;  1E1O A;  1IYV A;  4IFD I;  1FNV A;  3CCS A;  1SE3 A;  2DJF C;  5C4Z A;  2AUK A;  3ERO A;  1LAB A;  2VNU D;  3GV6 A;  3VYU A;  4LFA Q;  1EY9 A;  4GZY C;  3QJY A;  4U68 A;  3J81 i;  1T9H A;  3ULJ A;  3K5O A;  3KJO A;  1UUP A;  1Q1B A;  4C56 C;  4L5Q A;  3NTK A;  3NEL A;  3MHB A;  3A7L A;  3MEH A;  2FMM A;  4GKK Q;  1U4R A;  3I4N H;  3AU7 A;  4A3C H;  1SMY C;  2KUM A;  1YIJ A;  2MNA A;  1NY4 A;  1X6O A;  1CHP D;  3I4N B;  2DNC A;  3EIV A;  3EQL C;  4JVZ A;  3PO3 G;  2N8N A;  4OL7 A;  1BQQ T;  3C1F A;  1Q8I A;  2XNA C;  4OEM B;  4DNR B;  4LFB Q;  1PDQ A;  1GM5 A;  4X64 L;  2OT2 A;  1MSH A;  1EY6 A;  2QDL A;  2Y0S G;  3ITP A;  2F0L A;  1BCP B;  2NZO A;  2A5H A;  1I4X A;  1EQQ A;  2FHT A;  2ATW A;  3TP5 A;  2UUA Q;  3QB3 A;  4PQX A;  1CKN A;  2NZ1 D;  1Y1V G;  2OTJ A;  3NBI A;  2ZXR A;  3M7G A;  3KJP A;  5I6Y A;  2ZTD A;  4J6H A;  1D5X C;  2JA7 H;  2RDH A;  1D6E C;  3NQI A;  4DR2 L;  2F4V L;  3QIA A;  2JA7 B;  3ND8 A;  1Y8N B;  1IL2 A;  1ZYR D;  1S5C D;  4JI1 Q;  1Q3L A;  1VF5 C;  2E5L Q;  4A3F G;  4L8J A;  4OIJ A;  5IP9 H;  4NKL A;  2ZM6 Q;  1DXM A;  2I5L X;  3PMF A;  4JI8 L;  3GTG H;  2QGQ A;  5CV8 A;  3NTH A;  3G71 A;  2Z0S A;  1DON A;  3GTG B;  1MKH A;  2EIF A;  2EDG A;  3K59 A;  5I2X A;  5M5Y H;  4RGT A;  1WI5 A;  4HJ7 A;  2UU9 Q;  4JI4 L;  1HHV A;  4R4O A;  2Q8R E;  2G9D A;  1C0A A;  4M1U B;  5M5Y B;  1X32 A;  1XYI A;  3IAY A;  3U9O A;  1V1P A;  4CJ0 B;  2BDO A;  3S2D H;  4IO9 A;  2K5D A;  3I90 A;  1Q82 C;  4B3M Q;  2E2J B;  2F3I A;  3SEB A;  1SND A;  2JA6 G;  1I3Q H;  3GTP H;  3S2D B;  1XWE A;  1EIG A;  3URY A;  1GO3 E;  1I3Q B;  2PYK A;  3GTP B;  4OO1 I;  1HZA A;  1EQT A;  4R4T A;  2L11 A;  3P75 A;  5M5W H;  2MP1 A;  4DV6 Q;  2A6H C;  3KF6 A;  2FJ2 A;  5M3M H;  4ID6 A;  5BR8 L;  3QR8 A;  1AEX A;  4OX9 Q;  1AZQ A;  1CA5 A;  1S40 A;  4RKL A;  2F0K A;  3MWY W;  5M3M B;  4UAI A;  4LUZ A;  1J8I A;  1A2U A;  2HD3 A;  4DN4 M;  1FJG L;  4IZ8 A;  4DR7 Q;  1I50 H;  1FGB D;  3CU7 A;  2GN5 A;  2SDF A;  2KEE A;  2ASB A;  4YIJ A;  4ME3 A;  4N8F A;  2JJQ A;  1CKN B;  3VR2 A;  4BBR G;  3DM1 A;  4WJW A;  3HOX G;  4DXF A;  3TZD A;  3GDE A;  4EGV A;  3RNU A;  3J81 L;  3NK9 A;  2Z4H A;  2M9V A;  4R1J A;  1CQV A;  2F0J A;  5G3L D;  3H6M A;  1AW7 A;  4LW1 A;  5EKK A;  4NXM Q;  3BZC A;  4GOP C;  1SYD A;  2WFW A;  1PYW D;  1AH9 A;  5FOB B;  3HOW H;  3R2T A;  1N33 Q;  5IWA L;  3HOU H;  1TS4 A;  1FYC A;  1II3 A;  1LTR D;  3HOU B;  5EKL A;  3J81 c;  5ELD A;  4R8N A;  2ZJR A;  4YWL A;  2JQO A;  3EN2 A;  3NSW A;  1HNZ Q;  2ICE C;  3SXH A;  2F0U A;  4C3J G;  3L2P A;  1PH1 A;  1V1P B;  1SYF A;  2K14 A;  2X69 A;  5FLX c;  4LF7 L;  3S16 H;  2MJ8 A;  3GQB A;  3SHL A;  2E2I H;  1LAC A;  2JA8 H;  3I7F A;  5IYB H;  2PW5 A;  2OXP A;  3TME A;  3S16 B;  3AFQ A;  3I2Z A;  2E2I B;  2JA8 B;  3PIP A;  4NXN L;  1NMF A;  5KEE A;  1YHB A;  1L0X B;  2Z6K C;  4U67 3;  1BCP D;  4POF A;  1JOO A;  2CFM A;  3K0Y A;  3BJU A;  1KL9 A;  3ZJY C;  4KN4 C;  1HQM C;  4DR1 L;  2O2L D;  4A93 H;  3KF6 B;  5F2D A;  1D1K A;  4JI3 Q;  2TMP A;  2N49 A;  3HKZ B;  2HCI A;  5GQO A;  2EYH A;  1N36 L;  4R8I A;  1EFW A;  1N32 L;  1G29 1;  4A93 B;  1JWS D;  4C1N K;  2ID0 A;  4LMQ D;  1QCB D;  3HOV B;  4HMJ A;  1MJC A;  1PFS A;  2GVA A;  2K75 A;  1ZXT A;  4K6D A;  2A73 B;  4OXP A;  1PH6 A;  1SXT A;  3BYY B;  4H0L C;  3WOE A;  5EPK A;  1VQH A;  3OWF A;  2CH4 W;  1SLJ A;  2L55 A;  3T1Y Q;  2JA7 G;  4CKC A;  5C44 H;  5CC4 A;  4KHP L;  3J81 E;  2EQS A;  3UDX A;  1UE5 A;  5C44 B;  5FJ8 G;  1STE A;  2Q2H A;  5DAU A;  2G5D A;  5FKA C;  1QG7 A;  4RHS A;  1GUW A;  2KED A;  2UXC L;  1L0Y B;  4O1N A;  5IGB A;  1IYU A;  2PZW A;  2JK8 A;  4KD3 A;  1B7Y B;  3NP8 A;  4AQY L;  1OXV A;  1EY5 A;  4HJA A;  1F9S A;  1VQG A;  3RZD H;  2HHH L;  4TQU S;  4CKB A;  5IGC A;  4N9P A;  3RZD B;  1WD1 A;  4APV A;  5K36 H;  2B39 A;  2QDB A;  2WKC A;  3VDY A;  1XMQ Q;  1XPR A;  3G4S A;  4DR3 L;  4DV3 L;  2YTX A;  4KY7 A;  2D9U A;  3CP0 A;  1Q1E A;  1I4Q A;  5BN3 A;  2F0M A;  1D8L A;  2H5X A;  4YY3 Q;  2IT1 A;  2B2T A;  2WP8 J;  2KHS A;  1PZI D;  5JPM C;  4PV1 C;  4R9W A;  3PO2 B;  1STA A;  4DV1 L;  3BS1 A;  1EEI D;  3AQQ A;  5IGG A;  4FXD A;  2Q8I B;  2ES2 A;  5D3I B;  2QEX A;  3GO5 A;  4Z9C B;  2Q8T A;  1HR0 W;  5M3M G;  1I6V C;  2RQX A;  2AMC B;  4ZLT F;  2E2D C;  1IBK L;  4X6A H;  3G48 A;  4ZYS A;  1E0B A;  4KHV A;  4UPA A;  2V1C C;  2F03 A;  2R7D A;  1OXU A;  5E4X A;  1WOC A;  4ZRZ A;  1TWG H;  1KAB A;  3ERS X;  2YU9 H;  1V43 A;  4NMZ A;  4HSV A;  4KV6 A;  1TWG B;  2YU9 B;  4V0B A;  3K58 A;  4A3M H;  4IPH A;  2UUC L;  3CQZ H;  3S2H B;  2BA1 A;  2LSS A;  4A3M B;  5COR A;  1SR3 A;  5JJL A;  4FO2 A;  3CQZ B;  1MJE A;  1H9R A;  4A3B H;  4L5T A;  4JBJ A;  1SNQ A;  3J80 i;  4QF4 A;  2QKI C;  1YNJ C;  4A3B B;  4ZUI A;  1TWF B;  2IL8 A;  2WB1 E;  1S5B D;  1ILQ A;  3SDZ A;  1WVL A;  1QZH A;  5IOC A;  3QO2 A;  2A6E C;  3RN2 A;  1VQ6 A;  1SYC A;  3K7U C;  1CHQ D;  4DK3 C;  1JR0 D;  4B9W A;  1PLF A;  3VYT A;  3MZ5 A;  3DEP A;  4LF9 L;  2PNR C;  1LTB D;  1A3V A;  4PZ6 A;  4EVO A;  5JEA H;  4K5X A;  4A3E B;  3T53 B;  4FXK C;  1B44 D;  3S1Q H;  4GNX A;  1OTC A;  2R92 H;  5IYB G;  1EOV A;  1XNR L;  1WTQ A;  2A19 A;  1Y14 B;  4BY7 G;  3S1Q B;  3CCE A;  3OW7 A;  4X64 Q;  1UE6 A;  5C0X H;  2KCT A;  1VQC A;  1IYJ B;  1C9O A;  1Y69 U;  1PTO F;  5AJ3 L;  1QVF A;  3JAM i;  1VQ7 A;  5A35 A;  2YTY A;  4CHT B;  1PRT B;  5C6A A;  1UE7 A;  4CDC C;  3TEH B;  4YCW A;  3HOV G;  2WIN B;  2VZA A;  4CJ1 B;  2EJM A;  5C3E H;  2KHI A;  5EGT A;  4DR5 L;  2JA5 G;  1F9Q A;  4DR2 Q;  1XNQ L;  2F4V Q;  3SVM A;  1NNX A;  4MTK A;  3J7A V;  2QIL A;  1L1O A;  4OIK A;  4KKU A;  4FXG C;  3MXU A;  4QIW E;  4RAU C;  4JI8 Q;  3VR5 A;  2B2U C;  1KAA A;  2X6G A;  3BDC A;  3G6J B;  3CHB D;  1VQO A;  2R6G A;  1VQB A;  5FLM H;  2Z4I A;  5COY A;  1CT1 D;  1DYQ A;  3GTM B;  4JI4 Q;  1WTX A;  4V19 0;  5EPL A;  1RF2 D;  2K6A A;  2WB1 G;  4LF5 L;  3SK8 A;  4DAV A;  4LFC Q;  2R93 G;  1MSG A;  3K7A H;  4JC0 A;  5CGK A;  5IT9 L;  1C8C A;  3S14 H;  2KVM A;  4A3G H;  1LM0 A;  1WCM H;  2PI2 A;  1EY8 A;  3TP6 A;  3K7A B;  1Y1W H;  3LWU A;  3S14 B;  4JI2 L;  1WCM B;  4XXE A;  1TII D;  1Y1W B;  3MEF A;  2K5Q A;  1IW7 C;  3I73 A;  2KA7 A;  3I3C A;  2D2C C;  1J6Q A;  3I72 A;  3LNN A;  4BY1 B;  4G57 A;  5C0X I;  4EQP A;  4AH6 A;  3W3A A;  4JW0 A;  1CZW A;  1OXS C;  2A68 C;  3W1B A;  2A69 D;  1VQP A;  3K80 C;  1WFQ A;  1XXG A;  5BR8 Q;  5IT9 c;  3PO2 G;  4WJ4 A;  2E2H B;  3F2U A;  1I94 L;  1LO5 D;  3R2I A;  2VQF L;  1LTG D;  1KDC A;  1G8Z D;  1R9T H;  5FO7 B;  4GNX B;  3STB C;  4X66 L;  5IYC G;  1YNX A;  1R9T B;  4K2L A;  3M4Q A;  3OYY A;  3DWP A;  1FJG Q;  1X54 A;  3NUC A;  1IHZ A;  1Q81 C;  3H94 A;  2NVQ H;  1HR0 L;  1KTK A;  3ND9 A;  3CPW A;  3CCM A;  3J80 L;  2MQH A;  1VQK A;  1YJW A;  2NVQ B;  5DLQ E;  4JYA L;  4JI5 L;  3OPO A;  3D4R A;  1FVI A;  4R4I A;  5KYI A;  4DR4 L;  3OWE B;  5LMU Q;  1HTP A;  2F3W A;  1KAW A;  1TS5 A;  1YHA A;  4IUT A;  3RLF A;  3CKI B;  3U9S A;  3CCR A;  5EQ0 A;  2L12 A;  2PCF B;  1WTP A;  5JJI A;  3FPU B;  1PHJ A;  2F0H A;  3S1R H;  4OGQ C;  1L1O B;  2L9H A;  2ZXP A;  1QE6 A;  1X3P A;  3J80 c;  1IXR A;  1DOL A;  3PSI A;  4LWC A;  4JI0 L;  2WKD A;  3VR3 A;  1BBW A;  2XWB B;  1TU2 B;  5IWA Q;  2HQL A;  5ELC A;  3A7A B;  3MXN B;  5I6W A;  4XDX A;  4F87 A;  3OHX C;  3K5M A;  3BVG A;  4CDF C;  5IP7 G;  4A75 A;  5IT9 E;  4RG1 A;  3D3R A;  3TZU A;  2KCM A;  1ESF A;  4HR7 B;  1EZ8 A;  1YVC A;  4RFB A;  4ZAI A;  5IE8 A;  4GLA C;  5ELF A;  1SNP A;  4YWM A;  2IPK D;  3S15 H;  4IN3 A;  4A3L G;  2UXD L;  3RLO A;  4LF7 Q;  1K0S A;  3H0G G;  4XQQ A;  3S15 B;  3L7Z C;  2HDM A;  4IUV A;  4A3E G;  4ODG A;  1J5E Q;  2F4I A;  1GVP A;  3D0F A;  4H02 A;  4DAP A;  3X3N A;  4NXN Q;  3M85 A;  3EFX D;  2AWN A;  1HNW L;  1PZK D;  2HIV A;  3I4M H;  1VMC A;  1F77 A;  3TSS A;  4QJF A;  1SYG A;  1A0I A;  2BE5 D;  4X3U A;  4OHJ A;  3T1H Q;  1B3A A;  4OON A;  4DR1 Q;  2AQ2 B;  2IHE A;  2BA0 A;  5KYL A;  1LTT D;  1OO9 B;  2Z6B A;  3I4M B;  4LAA A;  3H91 A;  1PRT D;  4OO1 H;  1EIF A;  4RGM A;  1N36 Q;  1N32 Q;  5TSS A;  1E3P A;  2F0W A;  1X3Q A;  1STG A;  3WDN A;  2SEB D;  4ZK9 B;  1I6H H;  5KNC A;  1D5Z C;  3J80 E;  3R3O A;  3FEW X;  1V1Q A;  1FNW A;  3N52 A;  4KY6 A;  1I6H B;  2ENB A;  2L1B A;  3ZYY X;  2YYZ A;  3MA2 B;  1JWM D;  5CBA E;  4PNY A;  3A8K E;  1CA6 A;  2F0V A;  2PW7 A; 
#chains in the Genus database with same CATH homology
 1BR9 A;  3D6W A;  3SK4 A;  2K33 A;  2QEJ C;  1AFP A;  2JE6 I;  1MI2 A;  3GTJ B;  2ICI A;  4HCS A;  4PMB A;  2N88 A;  2QCP X;  4IUU A;  2B2Y C;  5I4D A;  1Z47 A;  2XRS D;  2RVL A;  1VF7 A;  1WD0 A;  2EJG C;  1SDF A;  4PMC A;  1GUN A;  1SEB D;  1O80 A;  2EY6 A;  2L4N A;  2Z8L A;  3EA6 A;  3T4A C;  3HGB A;  4G7H C;  5KNB A;  4KY5 A;  5I9P A;  1IL8 A;  4KKT A;  1V1O A;  2IX1 A;  4N9T A;  2F0E A;  1WTO A;  4IFD G;  2H1E A;  3JAM E;  1BOS A;  3RZO B;  3DXJ C;  4DNT B;  4DGZ A;  1E2V A;  3Q0A A;  1SAP A;  4C3I G;  1G6Z A;  3E5S A;  3DWA A;  5E4W C;  5M5W B;  1F2Z A;  4KTA A;  1G91 A;  4K8J A;  2AQ3 B;  4K2K A;  1BDO A;  1LTI D;  3TN2 A;  5IOD A;  2ZXO A;  4X3T A;  2D5D A;  4FF4 A;  1JOQ A;  2BDN A;  4BBS B;  1RKN A;  2EE1 A;  3MTS A;  4HMI A;  2XSC A;  3M7N A;  1GOZ A;  5C3W A;  1I50 B;  2HQE A;  3GV3 A;  4TRD A;  1LT5 D;  5LL6 X;  1EYC A;  3K57 A;  5CV6 A;  1RCV D;  1O7L A;  3QG1 A;  2RA4 A;  2Z1C A;  4DU9 A;  5JVG 3;  1QJO A;  2SOB A;  2NN6 H;  2OF1 A;  5T1G A;  2CW0 C;  3QOL A;  4ILW A;  1PTO C;  1M8A A;  5C3X A;  5JPN C;  5EBC A;  5C5L A;  5KND A;  3K6O A;  1ET9 A;  5KGU A;  5G3L F;  1RDP D;  4KMU C;  1AN8 A;  4F88 A;  3HOW B;  1B53 A;  3IKJ A;  1Q12 A;  1SJE D;  2XWJ B;  1UNS A;  1CQF A;  4HTH A;  1Z6H A;  2NB0 A;  3HOZ B;  1T5E A;  3GD7 A;  2WV6 D;  3SR1 A;  1NR4 A;  5CYU A;  3R93 A;  1OXT A;  4CKE A;  1EYD A;  4PMW A;  3J7A F;  3T56 B;  4DXG A;  2XVS A;  2E76 C;  1BUV T;  1TT2 A;  3MFY A;  3OMC A;  1B2T A;  2RBM A;  3KLS X;  5EKI A;  1K8M A;  4Q5V A;  1QIL A;  1C48 A;  1FD7 D;  1S5D D;  4J1M A;  1YNN D;  1PTO H;  1PFN A;  1BCP F;  1CM9 A;  1DZ1 A;  1EWH A;  4LK1 C;  4FF3 A;  4L6T B;  5CV4 A;  2NN6 I;  4ABN A;  3D31 A;  3VYS A;  5CV5 A;  5LL6 S;  1KNE A;  3D4W A;  2CQA A;  3BVZ A;  4XYO A;  1SNO A;  1E2Z A;  1A3T A;  2IWH A;  2K32 A;  1SMY D;  5D65 A;  3NPP A;  1JWU D;  3BYT B;  3VA7 A;  4X3S A;  3W2D A;  5IGD A;  1D5M C;  1NR2 A;  2BCO A;  1EY7 A;  5M3F B;  2LFN A;  3NTI A;  4K5W A;  2RDG A;  1SE2 A;  1O7Y A;  1AP0 A;  3IFT A;  4TKO B;  2VUM B;  4IFD J;  4F8M A;  1W6J A;  2GA4 B;  1ENA A;  2NUC A;  1CFM A;  1TS3 A;  3BZD B;  2HCC A;  3OIQ A;  4HED A;  2JSO A;  1F2M A;  4NW2 A;  4ZKB B;  4BWG B;  2B63 B;  1LTS D;  2PPB C;  2J0T D;  2RKS A;  1Q90 A;  3PIP 3;  5DM7 3;  2NWG A;  2VXW A;  2EYM A;  3A56 A;  1BBX C;  5C4J B;  3KUP A;  1TVX A;  2MPM A;  1W6K A;  4BS9 A;  2EZV A;  4KI0 A;  1DCZ A;  3TBI B;  4A3I B;  2JP1 A;  1LT4 D;  1A6X A;  2RDF A;  2FFK B;  2KEC A;  5D3D A;  2NVY B;  3BDO A;  4ZQ3 A;  2X6L A;  1GUG A;  3C46 A;  3TP7 A;  2VB2 X;  1BO0 A;  4KHZ A;  4HSP A;  2A6H D;  1XX8 A;  2XRQ D;  3BG3 A;  3FKI B;  2JEB I;  4DA2 A;  2C5C A;  3BVM A;  3WOF A;  1KDB A;  1STY A;  3AB9 A;  3MFG A;  3GTQ B;  4K6L A;  1GXD C;  2AWO A;  3DEO A;  1ZYR C;  1LLR D;  3KBG A;  2R92 B;  4RWS C;  3PUV A;  1EL0 A;  2XIW A;  5I9O A;  1HFN A;  3HZX A;  5FO8 B;  2CVR A;  2R3Z A;  5HGT A;  1H9K A;  4BA2 I;  1VMP A;  3T16 A;  3V05 A;  4XQJ A;  1EZ6 A;  2IX0 A;  1FNU A;  3FRP B;  1TQO A;  3PO3 B;  5DNF A;  1JOK A;  1TWA B;  1S5F D;  2IW3 A;  4MN3 A;  5C3E B;  3LX0 A;  4FYD A;  3NQT A;  1RHP A;  1LT3 D;  1Y1V B;  4H44 C;  2B2V A;  1RTN A;  3MVV A;  3MXN A;  2NVT B;  4XIG S;  2EY2 A;  1D2B A;  2EPB A;  2F3V A;  4AYB B;  4G7O C;  1HXY D;  2K04 A;  3KLR A;  1ONL A;  1GHJ A;  4B08 A;  4A3G B;  1SNM A;  2BOS A;  3KF8 A;  4IUQ A;  1F2Y A;  1R4P B;  5BN4 A;  3OSO A;  5K36 G;  4MHE A;  2IJ0 A;  3MAQ A;  1KLG D;  3GP7 A;  1KDA A;  2O4X A;  4Y7N B;  4ULL A;  2B2W C;  1B4O A;  2IX3 A;  2B8F A;  1J9O A;  3NHH A;  2JA6 B;  1CK1 A;  1CI3 M;  2PZT A;  5J22 A;  5K5P A;  1HA6 A;  1QB5 D;  3PUX A;  3DUZ A;  4KJN A;  3PUW A;  2K03 A;  1ENC A;  1EWC A;  2NTS A;  1A15 A;  2R61 A;  5FO9 B;  3X3M A;  4QUF A;  1NAP A;  1H9M A;  2AQ1 B;  2KOL A;  1DOM A;  2PQE A;  1A2T A;  2F0D A;  2KQ3 A;  2EVB A;  3MXG A;  4KKS A;  3VR4 A;  4IAL A;  5BN5 A;  3S1R B;  2WII B;  1STB A;  1JC7 A;  4BBR B;  3HOX B;  2F0P A;  1BCP C;  1B9M A;  2LS0 1;  1ILP A;  1QOH A;  4ME5 A;  1ICW A;  2CHB D;  4XQN A;  5NUC A;  4F7X A;  3JAM L;  4HN7 A;  2KCC A;  5M9O A;  1SJH D;  2EXZ A;  2E75 C;  4KD4 A;  5M5X B;  4RKB A;  5JEA G;  3OMG A;  3IFD A;  2TSS A;  4I7Z C;  1TY2 A;  3VR6 A;  2WAC A;  4C3J B;  3H3V C;  4QMG A;  2B2Y A;  5T1I A;  2K7V A;  5C0X G;  2WAQ B;  1YNJ D;  4J8Q A;  1EY4 A;  2V4D A;  1PRT F;  2K01 A;  3AMU A;  1F2L A;  1CZG A;  1SNC A;  1C4Q A;  2F0S A;  2A6E D;  4LJZ C;  5IGF A;  3M4Y A;  3QWN A;  2F0T A;  1U9R A;  2DN8 A;  3O13 A;  1TWH B;  3FDT A;  2OEO A;  4JK1 C;  4X3K A;  4G4K A;  1UAP A;  2F0O A;  3CRL C;  3NWT A;  4A3D B;  5EBD A;  4DK1 A;  1JOR A;  3P7J A;  3T13 A;  1WTR A;  1M4V A;  4DAY A;  1JE4 A;  3BDL A;  3MC0 B;  1MD2 D;  1VCI A;  5C5M A;  1LTA D;  3ONA B;  1HA5 A;  1EOT A;  1OXX K;  1F9R A;  1TWC B;  2SNM A;  2EYL A;  4C1N I;  2B8G A;  3KLS A;  1U4M A;  4G7Z C;  3RMH A;  2EYJ A;  1CTM A;  5ELE A;  3FVQ A;  4C2M B;  1FR3 A;  3E6Z X;  1HTL D;  1R4Q B;  1AZP A;  1TKW B;  1BXT A;  2JXM B;  1JB3 A;  4C3H B;  1SYB A;  4IUN A;  1I4P A;  2K5W A;  4XT3 B;  1IW7 D;  3I70 A;  5EJW A;  1HUN A;  1PFM A;  4QCL A;  1PFB A;  4BA1 I;  5JAV A;  2A68 D;  3QOJ A;  2DNE A;  3SK6 A;  4DFA A;  1E2W A;  3N6R A;  2VB3 X;  4WFN 3;  1SFO B;  5DM6 3;  4ZUJ A;  2LKV A;  2J4X A;  1EU3 A;  1QNU A;  5FLX L;  2LMC B;  1K83 B;  3S1N B;  5A2Q L;  4DK0 A;  4RCO A;  2G9H D;  4UDU C;  1KLU D;  1NSN S;  3C1E A;  3DHQ A;  1WTW A;  1ROD A;  2NVX B;  2L5T A;  4NDX A;  2K28 A;  3Q24 A;  3MXP A;  1SYE A;  5JEA J;  1Y8P B;  4FVM A;  1RJT A;  5JOB A;  4OO1 G;  3V2T A;  1Z7T A;  4NP5 A;  5IGE A;  2A74 C;  1PTO B;  4BY7 B;  4Q0F A;  5JVH 3;  5C0X J;  3K5L A;  4HCE A;  2NYZ D;  3K5N A;  5CMD A;  1HRJ A;  3S9W A;  5KRU A;  1H9J A;  5D14 A;  3NBH A;  1JQY D;  4DF7 A;  2I07 B;  4HAE A;  3PUY A;  1EY0 A;  4CJ2 C;  2JA5 B;  3GTL B;  2A69 C;  4RA8 A;  1SBB B;  1STN A;  4FF2 A;  3D6C A;  1MBY A;  1ZKO A;  4A3K B;  4L63 B;  1XTC D;  1ML0 D;  1Y8O B;  2N55 A;  4CGY B;  1I4H A;  3LWE A;  4H13 C;  5FLX E;  1EFI D;  4FNF A;  3T51 B;  4JBW A;  1SSO A;  1RTO A;  2WB1 B;  4P2C B;  4K5V A;  2ZT9 C;  1D1I A;  4XT1 B;  3OIP A;  4IUP A;  5A2Q E;  3L9A X;  2R93 B;  1G2T A;  1DJR D;  3FPP A;  2PMZ B;  2PZU A;  1EQV A;  1O78 A;  1ET6 A;  4RHR A;  4XYQ A;  2EYP A;  5DEH A;  4M8A A;  1WTV A;  1U4L A;  2E74 C;  5LHY 1;  1QNK A;  3A54 A;  3M4O B;  1EIH A;  1TR5 A;  1T5X D;  1EEF D;  3NE5 B;  4KN7 C;  2F1M A;  1HFG A;  2EOT A;  4IQZ A;  3C2P A;  1HUM A;  2HDL A;  3KBX A;  1JCK B;  1B9N A;  1PZJ D;  4FF1 A;  1S4Z A;  3KK7 A;  5IIF A;  1PMR A;  3PIO 3;  2MUY A;  3HEJ A;  4C3H G;  3ERQ A;  3SE0 A;  2R7Z B;  1STH A;  1EYA A;  1IKL A;  3E0J A;  2NN6 G;  4RH6 A;  5KIX A;  2B2T C;  2O5I C;  2RSO A;  3PV0 A;  4EQN A;  2BE5 C;  2F0I A;  4QIW B;  5J39 A;  1PRT C;  1LT6 D;  4TSS A;  2FMC A;  1I4R A;  2J7Z A;  3VA5 A;  2MHV A;  3CRK C;  3EVQ A;  4ZKC B;  3RUZ A;  3G7L A;  5EPJ A;  3J7Y W;  3I4L A;  1F9P A;  3P1H A;  3DWQ A;  3A55 A;  3GTO B;  1GJX A;  1GUO A;  3RD4 A;  2B2U A;  3H0G B;  2F0G A;  2D62 A;  2XN9 C;  3I8Z A;  2RSN A;  2EYO A;  2C9O A;  2CW0 D;  4CBV A;  2K05 A;  1DOK A;  1PTO D;  3GTK B;  5E1F A;  3HG9 A;  2MGS A;  1TS2 A;  2KCN A;  1KNA A;  3D4D A;  1JIC A;  4QB4 A;  5J1Z A;  2F0Q A;  3R8B A;  2M2L A;  1H9S A;  2Y0S B;  3V96 A;  4K14 A;  1VDZ A;  2KJX A;  4H7B A;  3A8I E;  5AFW A;  4FP5 D;  3S1M B;  2EYF A;  2HUG A;  3UI2 A;  1K8O A;  4KK7 A;  1LV9 A;  4E6I A;  2AUJ D;  3OOC A;  2B2W A;  4MIU A;  2EY1 A;  3DMU A;  1HPC A;  3M3Y B;  4K8I A;  4A3F B;  2JEA I;  1ENF A;  2FIN B;  5C4H A;  1TY0 A;  1ZEQ X;  4XTC S;  5CV7 A;  1NUC A;  1NCV A;  1EU4 A;  4A3J B;  3HP3 A;  4RGO S;  2O5J C;  5E3F A;  2NBF A;  1IKM A;  2NTT A;  1BF4 A;  2I46 A;  1ESR A;  3SK5 A;  3P20 A;  4IFD H;  1O7Z A;  4RCN A;  4S3S A;  4O42 A;  1G2S A;  1HCZ A;  1B1Z A;  4EQO A;  1MGS A;  3A8J E;  1U4P A;  2SNS A;  2F0F A;  1SE4 A;  2B2V C;  3TDQ A;  4WRD A;  5CV9 A;  5ISR A;  1A3U A;  4I65 A;  1HQR D;  4C3I B;  5I2Y A;  1PXU A;  3H09 A;  3FMC A;  1GHK A;  1DM0 B;  1V8Q A;  1DD2 A;  2DY8 A;  3EJI A;  3L3O C;  5ELB A;  5JJZ A;  4WOR A;  3I91 A;  5CBE E;  4QUC A;  5C4X B;  1BNZ A;  1QWY A;  5HUR A;  2EJF C;  1GUT A;  2L0C A;  3PUZ A;  2PO4 A;  2H4O A;  1S5E D;  1H9S B;  2LY7 A;  3Q6S A;  2DY7 A;  5CR3 A;  2F0N A;  2JYO A;  3D8G A;  2K1B A;  3VYR A;  4B9X A;  1RD9 D;  2EY5 A;  3TP8 A;  1B50 A;  3HRZ C;  1GUS A;  4IUR A;  1UEA B;  4RGN A;  5FK9 C;  4KJO A;  3Q23 A;  2QF7 A;  3NXW A;  3C3L A;  3HS0 C;  2M00 A;  3NWS A;  3HOY B;  3S17 B;  3IL8 A;  3Q22 A;  1I4G A;  1YNN C;  1IYV A;  4IFD I;  1FNV A;  1SE3 A;  5C4Z A;  2AUK A;  3ERO A;  1LAB A;  2VNU D;  3GV6 A;  3VYU A;  1EY9 A;  4GZY C;  3QJY A;  4U68 A;  3K5O A;  1UUP A;  1Q1B A;  4C56 C;  3NTK A;  3MHB A;  3A7L A;  3MEH A;  2FMM A;  1U4R A;  3AU7 A;  1SMY C;  2KUM A;  1CHP D;  3I4N B;  2DNC A;  3EQL C;  4OL7 A;  1BQQ T;  3C1F A;  1Q8I A;  2XNA C;  4DNR B;  1PDQ A;  2OT2 A;  1MSH A;  1EY6 A;  3ITP A;  2F0L A;  1BCP B;  2A5H A;  1I4X A;  2FHT A;  3TP5 A;  3QB3 A;  4PQX A;  2NZ1 D;  3NBI A;  2ZXR A;  3M7G A;  5I6Y A;  4J6H A;  1D5X C;  2RDH A;  1D6E C;  3NQI A;  3QIA A;  2JA7 B;  3ND8 A;  1Y8N B;  1ZYR D;  1S5C D;  1Q3L A;  1VF5 C;  4L8J A;  4OIJ A;  4NKL A;  1DXM A;  3PMF A;  5CV8 A;  3NTH A;  1DON A;  3GTG B;  2EDG A;  3K59 A;  5I2X A;  4RGT A;  1HHV A;  2Q8R E;  2G9D A;  4M1U B;  5M5Y B;  1X32 A;  1XYI A;  3IAY A;  3U9O A;  1V1P A;  4CJ0 B;  2BDO A;  2K5D A;  3I90 A;  2E2J B;  3SEB A;  1SND A;  3S2D B;  1XWE A;  1EIG A;  3URY A;  1I3Q B;  2PYK A;  3GTP B;  4OO1 I;  1EQT A;  2L11 A;  3P75 A;  2MP1 A;  2A6H C;  2FJ2 A;  4ID6 A;  1AEX A;  1AZQ A;  1CA5 A;  4RKL A;  2F0K A;  3MWY W;  5M3M B;  4UAI A;  1J8I A;  1A2U A;  4DN4 M;  4IZ8 A;  1FGB D;  3CU7 A;  2SDF A;  2KEE A;  4YIJ A;  3VR2 A;  3DM1 A;  4WJW A;  4DXF A;  3TZD A;  4EGV A;  3J81 L;  3NK9 A;  2Z4H A;  2M9V A;  1CQV A;  2F0J A;  5G3L D;  3H6M A;  1AW7 A;  5EKK A;  1SYD A;  1PYW D;  5FOB B;  3R2T A;  1TS4 A;  1FYC A;  1II3 A;  1LTR D;  3HOU B;  5EKL A;  5ELD A;  4R8N A;  3NSW A;  2ICE C;  3SXH A;  2F0U A;  4C3J G;  1V1P B;  1SYF A;  2X69 A;  2MJ8 A;  3GQB A;  3SHL A;  1LAC A;  2PW5 A;  2OXP A;  3TME A;  3S16 B;  2E2I B;  2JA8 B;  5KEE A;  1L0X B;  4U67 3;  1BCP D;  1JOO A;  3K0Y A;  4KN4 C;  1HQM C;  2O2L D;  5F2D A;  1D1K A;  2TMP A;  3HKZ B;  2HCI A;  2EYH A;  4R8I A;  1G29 1;  4A93 B;  1JWS D;  4C1N K;  2ID0 A;  4LMQ D;  1QCB D;  3HOV B;  4HMJ A;  1ZXT A;  4K6D A;  2A73 B;  1SXT A;  3BYY B;  4H0L C;  3WOE A;  5EPK A;  3OWF A;  2L55 A;  4CKC A;  5CC4 A;  3J81 E;  5C44 B;  1STE A;  5DAU A;  5FKA C;  1QG7 A;  4RHS A;  1GUW A;  2KED A;  1L0Y B;  4O1N A;  5IGB A;  1IYU A;  2PZW A;  4KD3 A;  3NP8 A;  1OXV A;  1EY5 A;  1F9S A;  4TQU S;  4CKB A;  5IGC A;  4N9P A;  3RZD B;  1WD1 A;  5K36 H;  2B39 A;  2QDB A;  2WKC A;  4KY7 A;  2D9U A;  1Q1E A;  1I4Q A;  5BN3 A;  2F0M A;  2IT1 A;  2B2T A;  2WP8 J;  2KHS A;  1PZI D;  5JPM C;  4PV1 C;  4R9W A;  3PO2 B;  1STA A;  3BS1 A;  1EEI D;  5IGG A;  4FXD A;  2Q8I B;  5D3I B;  3GO5 A;  4Z9C B;  2Q8T A;  1I6V C;  2RQX A;  4ZLT F;  2E2D C;  4ZYS A;  1E0B A;  4KHV A;  2F03 A;  1OXU A;  5E4X A;  4ZRZ A;  1KAB A;  1V43 A;  4NMZ A;  4HSV A;  4KV6 A;  1TWG B;  2YU9 B;  4V0B A;  3K58 A;  3S2H B;  2BA1 A;  4A3M B;  5COR A;  4FO2 A;  3CQZ B;  1H9R A;  1SNQ A;  4QF4 A;  2QKI C;  1YNJ C;  4A3B B;  4ZUI A;  1TWF B;  2IL8 A;  1S5B D;  1ILQ A;  3SDZ A;  1WVL A;  5IOC A;  3QO2 A;  2A6E C;  1SYC A;  1CHQ D;  1JR0 D;  4B9W A;  1PLF A;  3VYT A;  3MZ5 A;  3DEP A;  2PNR C;  1LTB D;  1A3V A;  4EVO A;  5JEA H;  4K5X A;  4A3E B;  3T53 B;  4FXK C;  1B44 D;  1WTQ A;  3S1Q B;  3OW7 A;  5C0X H;  1Y69 U;  1PTO F;  5A35 A;  4CHT B;  1PRT B;  5C6A A;  2WIN B;  4CJ1 B;  2EJM A;  5EGT A;  1F9Q A;  3SVM A;  3J7A V;  2QIL A;  4OIK A;  4KKU A;  4FXG C;  3MXU A;  4RAU C;  3VR5 A;  2B2U C;  1KAA A;  2X6G A;  3BDC A;  3G6J B;  3CHB D;  2R6G A;  2Z4I A;  5COY A;  1CT1 D;  1DYQ A;  3GTM B;  4V19 0;  1WTX A;  5EPL A;  1RF2 D;  2K6A A;  3SK8 A;  4DAV A;  1MSG A;  5CGK A;  5IT9 L;  1C8C A;  2KVM A;  1EY8 A;  3TP6 A;  3K7A B;  3LWU A;  3S14 B;  1WCM B;  4XXE A;  1TII D;  1Y1W B;  2K5Q A;  1IW7 C;  3I73 A;  2KA7 A;  3I3C A;  2D2C C;  3I72 A;  3LNN A;  4BY1 B;  4G57 A;  5C0X I;  4EQP A;  3W3A A;  1CZW A;  1OXS C;  2A68 C;  2A69 D;  1XXG A;  2E2H B;  3F2U A;  1LO5 D;  3R2I A;  1LTG D;  1KDC A;  1G8Z D;  5FO7 B;  1R9T B;  4K2L A;  3DWP A;  3NUC A;  1IHZ A;  3H94 A;  1KTK A;  3ND9 A;  3J80 L;  2NVQ B;  3OPO A;  3D4R A;  5KYI A;  3OWE B;  1HTP A;  2F3W A;  1TS5 A;  3RLF A;  4IUT A;  3CKI B;  3U9S A;  5EQ0 A;  2L12 A;  2PCF B;  1WTP A;  3FPU B;  2F0H A;  4OGQ C;  2L9H A;  2ZXP A;  1QE6 A;  1X3P A;  1DOL A;  2WKD A;  3VR3 A;  2XWB B;  1TU2 B;  5ELC A;  3A7A B;  5I6W A;  4XDX A;  4F87 A;  3OHX C;  3K5M A;  3BVG A;  5IT9 E;  3D3R A;  3TZU A;  1ESF A;  4HR7 B;  1EZ8 A;  4RFB A;  4ZAI A;  5ELF A;  1SNP A;  2IPK D;  4IN3 A;  4XQQ A;  3S15 B;  3L7Z C;  2HDM A;  4IUV A;  4ODG A;  2F4I A;  4DAP A;  3X3N A;  3M85 A;  3EFX D;  2AWN A;  1PZK D;  1VMC A;  1F77 A;  3TSS A;  1SYG A;  2BE5 D;  4X3U A;  4OHJ A;  1B3A A;  2AQ2 B;  2BA0 A;  5KYL A;  1LTT D;  1OO9 B;  3I4M B;  4LAA A;  3H91 A;  1PRT D;  4OO1 H;  4RGM A;  5TSS A;  2F0W A;  1X3Q A;  1STG A;  3WDN A;  2SEB D;  4ZK9 B;  5KNC A;  1D5Z C;  3J80 E;  3R3O A;  3FEW X;  1FNW A;  3N52 A;  4KY6 A;  1I6H B;  2ENB A;  2L1B A;  3ZYY X;  2YYZ A;  3MA2 B;  1JWM D;  5CBA E;  4PNY A;  3A8K E;  1CA6 A;  2F0V A;  2PW7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...