5I9OA

Crystal structure of staphylococcal nuclease variant delta+phs l36k l103k at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRKLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEAKVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS L36K L103K at cryogenic temperature
rcsb
source organism Staphylococcus aureus
total genus 35
structure length 129
sequence length 129
chains with identical sequence B
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5i9oA00
3C1EA 4IZ8A 4J1MA 1JOKA 1A2UA 1TQOA 3MEHA 4WRDA 1JOQA 2F0TA 5CV8A 5EGTA 2RBMA 5J1ZA 4F8MA 4B9WA 4IUNA 2KHSA 5HGTA 5JAVA 2F0MA 2PZWA 2SNSA 3D8GA 4KD4A 5CGKA 1EQVA 5M9OA 1ENCA 2EYJA 5DAUA 4DU9A 1KDCA 2SOBA 3U9OA 5KRUA 1STGA 2EYMA 5IODA 5IGDA 5E3FA 2M00A 3OMCA 2F0LA 5KIXA 1EYAA 5CV4A 2OF1A 4KHVA 5EKKA 5NUCA 3SK8A 4ZQ3A 1EY4A 4EQPA 5HURA 3V2TA 2F3WA 1EYCA 5J39A 4RKLA 1SNPA 1A3VA 5C5MA 1SNCA 5CV6A 4ID6A 3LX0A 2EYPA 2EY5A 4ODGA 4F7XA 5KEEA 4KJNA 1STBA 4KY6A 2PW5A 1SNMA 1SNQA 1II3A 1EY8A 1F2YA 2EY1A 1SYCA 3D4DA 1STNA 3MHBA 3S9WA 1KAAA 5I6YA 3NHHA 4TRDA 4I65A 4KTAA 1RKNA 1A3TA 1EY6A 3QB3A 5IGCA 5EKLA 2F0FA 4NP5A 5I6WA 4ZUIA 2PZTA 3NK9A 2RKSA 2PW7A 2EY2A 4KY7A 3SXHA 1EZ6A 2ENBA 3D6CA 1A3UA 4K2LA 3SK5A 3DMUA 1AEXA 2EYLA 2F0WA 3T16A 5KYLA 3HZXA 5E1FA 2F0VA 1JOOA 3DHQA 3E5SA 1KABA 2PZUA 4KD3A 4NKLA 4EQNA 5C3XA 5CV7A 2F3VA 4NDXA 3NQTA 4KY5A 5IGGA 1U9RA 5KGUA 1EZ8A 2PQEA 3HEJA 1ENAA 2F0JA 2HQEA 2EYOA 4K14A 4K8JA 4WORA 3ERQA 3ITPA 2PYKA 5IGFA 5K5PA 3EVQA 2O4XA 4LAAA 2QDBA 2F0DA 3SR1A 2SNMA 1NSNS 1EYDA 2EXZA 1SNDA 3T13A 2RDFA 4K5WA 1STHA 1STAA 4ME5A 4QMGA 3SHLA 4B9XA 2F0NA 3QOLA 4G57A 4RKBA 2KQ3A 3VA5A 4R8NA 5CV9A 5C6AA 3EROA 1TT2A 3SK4A 5IGEA 5J22A 4PMBA 4E6IA 5I9PA 2OXPA 3EJIA 5CC4A 4DFAA 3TP8A 4PMCA 1IHZA 2F0SA 1SNOA 1TR5A 3NXWA 5CV5A 3TMEA 1A2TA 2EYFA 2F0HA 3D4WA 3QOJA 3OMGA 1EY5A 4K6DA 3SK6A 3PMFA 1EY7A 4DGZA 4EQOA 5C4HA 5IGBA 1KDBA 1SYDA 3TP5A 5IIFA 2EYHA 3BDCA 5KYIA 3OSOA 3TP6A 2F0QA 3TP7A 2F0OA 2F0KA 4HMIA 4HTHA 4IALA 1EY0A 3OWFA 5ISRA 4KJOA 5JOBA 4N9TA 5F2DA 1EY9A 4ZUJA 3H6MA 4HMJA 1SYEA 4QB4A 2F0GA 2EY6A 4NMZA 1STYA 1F2ZA 1NUCA 3MXPA 4S3SA 3RUZA 5C3WA 4K8IA 3MZ5A 3C1FA 1SYBA 3NUCA 4H7BA 4EVOA 5I9OA 1SYFA 2F0UA 3P75A 4J6HA 1F2MA 4K2KA 4MIUA 1SYGA 5C5LA 1KDAA 2F0EA 4KV6A 5DEHA 3BDLA 4N9PA 4DF7A 2LKVA 4YIJA 5CR3A 4QF4A 1JORA 3P1HA 2OEOA 4OL7A 2NUCA 2WACA 5IOCA 4K5VA 4PNYA 4K5XA 3MVVA 5C4ZA 2F0IA 3R3OA 3NP8A 2F0PA
chains in the Genus database with same CATH superfamily
4M1UB 4A3KB 1EYGA 2G9DA 1CKNA 4P73A 5EGTA 1QCBD 2HDMA 2BH2A 1O7LA 1PYBA 3CXCA 2A6EC 1JJGA 3F2UA 1MSHA 1EWIA 4A93G 1PRTF 5CV4A 1IW7D 1XMOQ 3FEWX 2ZJRA 2R92B 4PMWA 1EYCA 2VS1A 2XRSD 4DR2L 3WOEA 4FNFA 5GAHC 2EY5A 5KEEA 1SJHD 4KJNA 5IT9E 4TQUS 3S15H 4BA2I 1W3SA 4KK7A 4GKKL 2R7ZH 3HRZC 2CFMA 4ABNA 3SGIA 2B3GA 1UE1A 4LUZA 2F0WA 2EYLA 3S2DB 3K80C 5E1FA 1VQ9A 1FR3A 1F9SA 4LFBL 3A5ZB 4X64Q 1DOMA 4BBSH 3NBHA 1U9RA 3MC0B 3UDIA 2IW3A 3W2DA 4KHZA 3S1NH 4FDBA 2XSCA 4DAPA 1Y14B 2DNCA 1PYWD 2XN9C 5LMNW 1MGSA 2AHOB 2GN5A 4C1NI 2B63B 3HGBA 3H0GH 4ME5A 4QMGA 5KNDA 5M5XB 1B3QA 2K04A 1XMOL 4OIKA 5FLMG 4BY7B 5EKIA 4LF4L 2DJFC 1Z9FA 5CC4A 1LTSD 3NTHA 4XTCS 1GKHA 3K0XA 4HJ7A 2BCOA 3D0FA 4L5RC 4L5SA 4F88A 1P16A 2L4NA 3TP7A 5FO9B 4OO1H 3CHBD 1Q81C 5T1IA 1WI5A 5DM63 4QB4A 1SMXA 4V0BA 1S40A 1HCZA 5I9OA 2B2UA 4ILWA 4LF5Q 2MUYA 1MBYA 3IAYA 4C3IB 1Y1WH 3E6ZX 4BA1I 1RTNA 4H44C 1IBKL 4DUYL 2B2WC 3D4RA 4DUZQ 1IBKQ 1GUOA 1YJWA 1PH2A 3U4ZA 2MHVA 1U5KA 3C1EA 3I4MH 4UPAA 4JI0Q 4RG1A 2HIXA 3D6WA 3PIO3 2ZTEA 1MJEA 1IXRA 2PNRC 3K6OA 2F0MA 2PZWA 3ICEA 1SE8A 1JE5A 1BOSA 1VQHA 4BXXG 3GTOB 3PO2G 5FO8B 4C2MB 4KHVA 4DV6L 5C0XG 2HQLA 4HEDA 1TWFB 4A3JG 1VQPA 3PUWA 1VQMA 3VA7A 2CKZB 3K5NA 1SNMA 2D2CC 2PQAB 4HJ8A 1WCMB 1DD2A 2ZM6Q 2EJMA 3T1YL 3IFDA 2UUBQ 1D2BA 3A8IE 3VYTA 4IPCA 2VQFL 1O7YA 2KCNA 2D5DA 4LNQA 3ULJA 1BXTA 1YZ6A 4K8JA 4WORA 3H3VC 3BZDB 3NPPA 1HFNA 3ERQA 2ALYB 2F0DA 4ZAIA 3U50C 3VYRA 3UDGA 3MXUA 2JA5H 2A1AA 4DNRB 4UDUC 3AFQA 3I4NB 1CM9A 1WFQA 2ZJPA 2K05A 2R61A 1PMRA 1V43A 3CCMA 2OWOA 3I73A 1WD1A 3BJUA 4LFCL 3JAMc 2B2TA 3BYTB 2R7ZG 2QILA 1LO5D 5CMDA 1JJ2A 4IALA 2DY7A 4JV5Q 4L5TA 2UUBL 1SYEA 4U673 1K28A 2BE5C 5CYUA 3ULLA 4B3RQ 3HOYB 1YNND 4BBSG 1QNUA 2JXMB 2HUGA 1VQ7A 1I6VC 1TWCB 5GAGC 2MFIA 3L3OC 5FLXc 1Q1BA 3G6EA 4DF7A 4TKOB 1D6EC 1I4QA 2OEOA 3M4QA 1J5EL 2C9OA 1G8ZD 3J81c 1TS3A 1EFID 3H0GG 2F0IA 2NVTB 2F0PA 1E3PA 1PRTC 3QWNA 1ILQA 4R8IA 4JC0A 4F8MA 3B6YA 2MO0A 3CF5A 3KLSX 5M9OA 5DAUA 1CT1D 4GN4B 4JI3Q 5KRUA 4P74A 2Z6BA 1GOZA 2F0LA 3KF6B 4JYAQ 3SK8A 3CCQA 3A7LA 2NVXB 4JV5L 2QGQA 2Z0SA 5ELDA 1H9RA 2LSSA 3RZDH 4B3RL 2FFKB 1N9WA 1VQAA 2UXBQ 4LF7Q 2N3SA 3HOVG 5TSSA 1KAAA 2L0CA 4TRDA 2FINB 4I65A 1PH7A 1N33L 1HH2P 1NR4A 1YI2A 4C3HH 1Y1WG 2F1MA 3K5OA 5ELEA 1LTTD 3SXHA 2ENBA 1AEXA 4FF3A 1SEBD 3C2PA 3CCUA 4YWLA 3TN2A 4L6TB 1CK1A 2R93H 4NDXA 2RVLA 3NQTA 2ES2A 2RF4A 1B9MA 1SLJA 2A68C 1H9MA 4BWGB 1VQNA 3K0YA 2B2YC 4A3EB 3S14H 3VYUA 2Z1CA 3H91A 1T5EA 5D3DA 3NQIA 3RNUA 1DYQA 4C3JB 5KNBA 1OO9B 1SDFA 2PI2E 1J9OA 4HAEA 3MAQA 3J7YW 3KLWA 4QIWB 1SSOA 4RH6A 1BCPD 4ME3A 1O78A 1VS0A 2UUAL 4AYBB 5EAYA 2F0KA 3QO2A 2CCZA 1EY0A 2KEEA 3GTQB 4CHTB 1ICFB 3EN2A 3EQLC 1R4QB 3MEFA 4TSSA 2Y0SB 2M2LA 5DM73 3C1FA 4HJAA 3M4OB 1LTBD 4QIWE 3C46A 4J6HA 2E74C 3EA6A 5C3EB 1HQMC 4AYBE 5AFWA 4IOAA 2LFNA 2ATWA 2XTIA 1QVFA 4OL7A 1UUPA 1WTRA 3WOFA 2JA5G 1A15A 4B3TL 5M5YB 1HZBA 4JI5Q 3J7ZC 1S5ED 2MO1A 4IJLA 3W1GA 4IUNA 4X3TA 2EPBA 5CGKA 1PVOA 2B2VC 3A8KE 2VXWA 4N8FA 2FXQA 5LMNL 4J8QA 2K32A 3KF8B 5IODA 1K9MC 3H3VI 4DV0L 2FMCA 1E1OA 3CQZH 2OF1A 4UAIA 1CUKA 3HG9A 1A3VA 2QW7A 4RHRA 2WIIB 4MTNA 1GJXA 1IW7C 5FO7B 3GTLB 4PZ7A 1PTOH 4IPDA 5M5WB 1YNXA 2ASBA 1LLRD 2CVRA 3HS0C 3QB3A 5JPMC 3UE1A 4YHHQ 1XNRQ 4K0KL 1D1IA 3CAMA 1SJED 4K2LA 1ILPA 4EQ5A 2F0VA 1JOOA 3DHQA 1H9KA 2RCNA 3H15A 5IGGA 3I8ZA 1VQLA 5ELNA 5EJWA 4A4IA 2EYOA 1DM0B 2IHFA 4JBMA 2Z9HA 1U4PA 1ZEQX 4YCUA 1TWAH 4DV7L 2YTXA 1EQTA 1STHA 1QOHA 3X3MA 2RQXA 1FNWA 2BDNA 5D65A 3KUPA 1IBLQ 3S2HB 2IPKD 1SBBB 4K6DA 3HKZG 4EQOA 4DGZA 1F9QA 1P8LA 1Y1VG 2F4IA 5COYA 1HZCA 3D31A 1CHQD 1LT5D 4IOCA 2JSOA 4C3HG 5JOBA 1ZKOA 1XNRL 3Q23A 4JI4L 1K83H 1T9HA 2K7VA 2F4VL 2ICIA 2VW9A 3HOUB 4A3GG 3EIVA 4EVOA 4EGVA 2R93G 2E5LQ 4K2KA 5DNFA 4AIMA 3GTMB 2F0EA 1U0LA 1YJNA 1X6OA 2Q8IB 5M3MH 2KUMA 3MTSA 4HR7B 1PH5A 1CQFA 3HOWB 4CKBA 1HFGA 3PIPA 1QJOA 4JBKA 4IUUA 4LFAQ 5HGTA 4B9WA 1TS5A 5L37A 4OONA 1IBLL 1YIJA 2E2HH 2HIVA 4JBWA 1PTOD 4JCVE 1DONA 2EJGC 1B1ZA 4JG2A 2VY3A 1JMCA 2WP8J 1YBYA 1QZGA 1NR2A 2E2JB 2QF7A 2IJ0A 2NTTA 1RTOA 2Z4IA 1K8GA 1UWVA 4GN3B 1U4LA 2L11A 2PO4A 1K3BC 1VCIA 3PCOB 3CD6A 2HDLA 3R2TA 2R7DA 5C4XG 1A3TA 4RGOS 1GUNA 3MWYW 3K7AB 3T16A 1XXGA 2VB2X 2XWJB 4M8AA 4OELB 1BO0A 1KABA 2NN6H 4EQNA 3T4AC 4GOPC 1IBML 5KGUA 5IWAQ 1F9PA 5E4WC 2K5QA 1KIXA 4K14A 5FK9C 5K36G 1KLUD 1PRTB 3STBD 2BA0A 4XYQA 4Q0FA 2A8VA 1L0YB 2A69D 3UDFA 1IL2A 1TVXA 1PFNA 3FKIG 2RDFA 2RDHA 2JA7G 1FGBD 2F52A 4XT3B 4RKBA 2UXDL 4OHJA 3NBIA 1EU4A 5I9PA 2UXCQ 3OOCA 5BR8L 1OXSC 3TMEA 2EYFA 5C4HA 2GVAA 3DEPA 1G91A 1KDBA 2FJ2A 2EYHA 4CJ0B 1QVCA 1X32A 2C35B 2UUCQ 4O2DA 3F8TA 4OWXB 4IUTA 4PZ6A 3IL8A 4OEMB 4JK1C 4NXNL 1HJPA 2NBFA 1Z47A 5C3WA 4JI1Q 1TXYA 3FHWA 1Y8NB 4DR1L 3NUCA 1SYFA 5M3FB 4DNIA 2AKWB 2KCTA 5IWAL 2PCFB 4XYOA 2JA8H 1QB5D 1C4QA 4YY3L 1JT8A 4A3IB 4DV3L 4BXXH 1YNNC 4CDDC 3I91A 4DPGA 5JEAJ 4DN4M 5C4ZA 1V1PB 5C0XH 4IZ8A 3TEHB 3S16B 1E2VA 4A3JH 1FGUA 2PPBC 2K1BA 4DR2Q 2CW0D 4X6AH 3ND8A 2UXCL 4JVZA 4PG3A 2EXDA 1KD1C 1EQVA 4EX5A 1S5BD 2J4XA 1LTLA 2SOBA 2OTJA 4GKKQ 1WTVA 1R9TB 3M7NA 1T5XD 2N78A 5KIXA 2SDFA 3G7LA 2HHHL 2JA6B 4FXDA 1BVSA 1KNAA 2LXJA 3KF6A 4MHEA 3V2TA 2NVYH 2YYZA 4WJWA 1WTXA 5C5MA 1SNCA 2QA4A 1JC7A 2N55A 5ELBA 4B3SQ 1D8LA 4FXKC 4LFBQ 4YIJA 4RMFA 1NAPA 4DV5L 1PTOF 2Q2UA 2IL8A 4NP5A 1XTDA 5I6WA 1PZID 2KENA 3HOXG 4A3MB 5M3MG 3LNNA 1B53A 3D6CA 1Z7TA 4RCOA 3URYA 3BU2A 1DZ1A 2AUKA 1OXXK 2PZUA 4OWWB 2IWHA 4LF4Q 3HEJA 1G6ZA 3S1MB 2F03A 5C4JB 3HOZG 3SR1A 2PI2A 4XXEA 1C48A 3SHLA 2CQOA 3FMCA 2QEJC 1Q82C 1BBUA 2D0PA 2K50A 5IGEA 1GO3E 1G291 4DFAA 4PMCA 2OQ0A 4IFDI 1TR5A 1HNXQ 4B3SL 1Q3LA 4BBRB 2LY7A 5BN4A 1GHKA 5C44B 4G7OC 3MXNB 2K75A 2HT1A 3OSOA 3TRZA 3H94A 3KFUA 1VMPA 1SAPA 1I50H 2X6GA 3CMEA 1RODA 2NZ1D 2L5TA 1PH8A 1BCPC 2C5CA 3AYHB 3GTKB 4DUYQ 2F0GA 3A74A 4A3KG 4DV2Q 3SVMA 2MNAA 5IT9L 1SYBA 2NN6G 1VQDA 2RCFA 4LJZC 4CGYB 4UP9A 2SEBD 1HTPA 1IL8A 1RHPA 4G7ZC 1WTHA 2K14A 1BKBA 3M3YB 4OIJA 1SR3A 3RD4A 3I4NH 2A5HA 2QCPX 3OYYA 2NWGA 3KBGA 1CSQA 3NP8A 1OXTA 4DV6Q 2BH8A 1L2FA 4WRDA 4R9WA 3RR5A 3J81j 3N6RA 2K01A 5J1ZA 1BF4A 1TWHH 2B2UC 1QG7A 3K59A 5JVG3 1HNXL 4FYDA 3PO2B 4DXFA 3HOVH 1JWSD 4ZKCB 3L0OA 3CCRA 2XNAC 1LYLA 1HNZL 1I94L 3W3AA 4YWMA 3T1YQ 2K5WA 3N52A 5CV6A 3I55A 1LV9A 1XX8A 4DV2L 1TWCH 2VQFQ 3J80i 1IZ6A 1EY8A 1F2YA 3U4VA 3S1RB 4JI2Q 3MHBA 4OO1I 4BY1B 1Y8OB 3OTOL 1V9PA 1I4RA 1S5FD 2A74C 2JA8G 4CDCC 5J3BA 1PLFA 3PO3B 3V96A 1H9SB 2CH4W 2N8NA 2NZHA 3HZXA 4B3ML 1B2TA 3HKSA 4JW0A 2HD3A 3LGJA 5EBDA 4XDXA 3A0JA 2MQHA 1EZ8A 1X9NA 1LUZA 2ZT9C 1PXUA 3L2PA 5JVH3 2EDGA 3DWPA 1EYDA 4LFCQ 4LF6L 1STAA 4N8X1 4X3KA 2E2IH 1V1OA 1TKWB 1K0SA 4PMBA 1W6KA 3S15B 5JEAH 1HUMA 3T51B 3ZJYC 3CC7A 1FNUA 2E8GA 2EOTA 4OX9Q 4A3BB 1N36L 2R7ZB 3CC4A 4JI2L 2F0QA 4DV4L 2UU9L 1CKOA 1I6HH 2K33A 4ZUJA 3MXGA 1J5EQ 2EY6A 3I2ZA 4BBSB 2K52A 3KOJA 3S1NB 4DAYA 1FL0A 1EEID 3CCSA 4PZ8A 4GOPB 1PFSA 4C1NK 3CCVA 4CJ1B 2B2TC 3H0GB 1KTKA 2NUCA 1B44D 1CHPD 2IX3A 2JYOA 1J8IA 1G2TA 1JB7A 3UE0A 4GNXA 4J1MA 1MSGA 1A2UA 2PMZB 3AFPA 1PH3A 1JWUD 3DEOA 3J80E 3KLRA 2AMCB 4OX9L 1WCMG 1ASYA 2KBNA 1O7ZA 3IFTA 1N33Q 1JWMD 2GVBA 1PH6A 2XVSA 1CQVA 1PTOC 1JJCB 4BS9A 1JCKB 1AP0A 1L1OA 2PMZE 4HSVA 4A3LG 4JOIA 2YU9H 1EIYB 4AH6A 1HR0W 1YITA 2EY1A 1AE3A 1PV4A 3GTJH 3JC66 4KTAA 1EY6A 3GV3A 1Q46A 3AMUA 2DY8A 3RZOH 3PIOA 4KY7A 3I72A 2E75C 1DCZA 3K5MA 3J80L 3DMUA 1KAWA 3I4NG 3I4MB 3BYYB 1PFBA 4KI0A 4Y7NH 2G9HD 1CZGA 2DN8A 3ULPA 3KJPA 3OW7A 1SMYD 4HCSA 4H0LC 4LAAA 4ZKBB 1K0RA 2SNMA 2A19A 1Y1VH 1SNDA 4B9XA 3T1HL 2UUAQ 3STBC 2E2DC 1GXDC 5GROA 1GHJA 4NPSA 4DR6L 1PZJD 4B08A 3HOYG 2OXPA 2YV5A 2VZAA 2VNUD 2MJ8A 2F0HA 4I7AA 3EFXD 4HIKA 4A3GH 1TY2A 4QY7A 2L55A 2KJXA 1IYUA 1CKNB 4L63B 5ISRA 4DR5L 1B7YB 4N9TA 4NMZA 3QIAA 2N88A 4QUFA 4B3TQ 1UEAB 3TDQA 3V05A 3BS1A 2NVQH 3HFZB 5IYBG 1XPUA 4G4KA 5DEHA 1MKHA 1WJJA 4A3FH 3BDLA 1M1KC 1JQYD 4UHVA 5CR3A 5LMNQ 4GLXA 4MN3A 4LK1C 4APVA 3MVVA 4J15A 4DV0Q 2OQKA 3P20A 4I7ZC 5FKAC 3BVZA 4PV1C 3PUXA 3MEHA 3VDYA 1YHQA 2B2YA 4XQNA 2IHEA 4IQZA 2R7FA 4GZYC 4RAUC 5JEAG 4UP7A 1NNXA 2J7ZA 5IT9c 1VQJA 1S5CD 5I4DA 1A0IA 5ELOA 2CWAA 3MFYA 4V190 2CW0C 5C4XH 1K8OA 4RGTA 1YJ9A 3E0JA 1OXUA 4K0KQ 1KC8C 1GD7A 1EFWA 3W1BA 2Y0SE 1BR9A 4A3DH 1BCPB 4IN3A 1STBA 3GP7A 4KY6A 1RIPA 4K6LA 1FYCA 2D62A 2D9UA 2E76C 4LMQD 4A3EG 1QVGA 3H3VH 4HIDA 2ZXPA 3OWEB 5EKLA 5K36H 1NMGA 4P75A 5IYCH 1Q90A 2PZTA 2K5DA 4CDFC 1I5FA 3GTPH 4IPHA 2DJGC 4ZYSA 3SK5A 3G71A 1Q12A 1KRSA 3FKIH 3GO5A 4DV7Q 2TSSA 2JA7H 1NMFA 2XRQD 4MTKA 2WKCA 2F0JA 3A7AB 3Q6SA 3LWEA 3F2BA 1S72A 2JP1A 3S24A 4AYBG 4Q5VA 4CDEC 4HSPA 1BQQT 3A56A 4R4QA 1TWGH 1RJTA 3G4SA 5CV9A 5GQOA 5C6AA 3RZDB 1TT2A 4E6IA 3HKZB 4JI4Q 1ESRA 3E9IA 2F4VQ 2F0SA 3TZDA 5C3EG 3D4WA 3OMGA 1YHAA 3SK6A 3T53B 3K81C 4C3HB 1C9OA 1SFOH 5KYIA 4C56C 1VMCA 2F0OA 4HTHA 3MXNA 5CBAE 3F2DA 1N32L 4IO9A 4DR3Q 1F2LA 5F2DA 1EY9A 3HKZE 1X3GA 4U68A 3GQBA 3MXPA 1ET6A 3CRKC 4IUVA 1A8VA 3G48A 4KMUC 4DK6C 1SYGA 1XTCD 1HNWL 3CCJA 3S14B 1GUSA 2LKVA 1JR0D 3F2CA 4YWKA 2I5MX 3P1HA 1X3FA 5DLQE 1UE6A 2PNHA 5FJ8G 2XGTA 3RLOA 1NJIC 1L0WA 1JOKA 2V1CC 3SE0A 1CFMA 3CU7A 4KD4A 1K73C 3D8GA 2MPMA 1WTQA 3S17H 2EYMA 5EBCA 2MGSA 4HCEA 2WB1B 4IFDJ 5A35A 1I4XA 1BCPF 4DR3L 1E2WA 3HOXH 4ZCKA 4DV1L 1Y8PB 1LTGD 1GM5A 4KHPL 2LS01 5KNCA 2A6HD 3PSIA 1VQ6A 2Q2IA 4GLVB 4ULLA 1EUJA 3T13A 3P7JA 1SYCA 4UY8C 2NB0A 2K6AA 1IBMQ 2AUJD 2JK8A 1VF7A 2WB1E 1Q1EA 3AB9A 2F0FA 1KLGD 4A3FG 3HOZH 4R1JA 4NB3A 1TS4A 1UE7A 1I3QH 1H9SA 2UXDQ 2HCCA 1A6XA 2ID0A 3DLLA 1R9TH 2HQEA 3ZYYX 5BR8Q 4CKCA 5IGFA 2JA6H 1EU3A 3NWTA 3S1QB 1UEBA 3CQZB 4TVAB 4K5WA 1AFPA 2PQAA 2KQ3A 3CP0A 3VA5A 2AQ2B 1X3EA 2LXKA 1V8QA 1PTOB 3EJIA 4A3KH 5ELFA 3J80c 4NXNQ 2NYZD 4X3SA 1BDOA 4A3DG 2BDOA 2TMPA 4DR1Q 5IGBA 3TREA 2WV6D 4A3MH 4RWSC 4RA8A 4X62Q 4CBVA 4DR4Q 3HOWG 2WAQB 1VF5C 5IYCG 1VQKA 4G7HC 4YY3Q 3T56B 4DV3Q 2QDLA 2QKIC 1M90C 3DWQA 1HR0L 2R92H 5JJKA 1F2ZA 5E7NA 1BNZA 3MZ5A 1D5ZC 3TS2A 1F2MA 1HZAA 3ND9A 1WTOA 3FVQA 4DA2A 2LMCB 2WAQE 1TWAB 3TS0A 3A54A 1EL0A 4P72A 1J6QA 1PFMA 4K5XA 1FJGL 2O5IC 1Y69U 1XPRA 2HHHQ 4O42A 3S2DH 5ELCA 3OIQA 1C0AA 2VQEL 1JOQA 2RBMA 1DXMA 3MA2B 1EQQA 3G6JB 3BZCA 2Z6KA 3PF4A 5E3FA 3AQQA 3UDXA 4DV5Q 1Q8IA 3GDEA 4X62L 3GTKH 5EKKA 2B63H 4DR4L 2VUMB 1K83B 5M5XH 3M85A 4BY7H 3OHXC 4O1NA 1HUNA 3IRBA 1SNQA 2AWOA 4FF4A 5I6YA 1UNSA 1X65A 5IGCA 5M3MB 2K4KA 3Q22A 4ZUIA 1C8CA 2HCIA 1UAPA 1O7IA 4A3CH 4A93B 1FD7D 3X3NA 3FDTA 1X54A 4R4TA 1EIHA 2JQOA 1VQEA 5C3XA 4NXMQ 5CV7A 4JI8Q 3CC2A 2E2HB 1H95A 3KJOA 1B70B 1KHIA 2JN4A 1ENAA 1M4VA 2KHIA 2Q2HA 1WYDA 2QDBA 4C3IH 5GADC 4JI7L 3C3LA 2OCEA 1SMYC 1TU2B 4DK1A 3FRPB 5C0XI 1F77A 4R8NA 5J22A 3OW2A 4KLKA 1K3RA 2ZTDA 4F87A 5M3FG 4LWCA 2K03A 3I7FA 1GUWA 1UE5A 1W2BA 2O2LD 1SRUA 1XNQQ 1S3OA 1SROA 4FXGC 2IX1A 3PUVA 4RGMA 4QL5A 1VQ5A 3TSSA 5IP7G 4LF9L 1B3AA 1RCVD 3GTOH 2P5ZX 4KJOA 2Z4HA 5EQ0A 4C2MH 1DOKA 3K58A 1E22A 5FOBB 1TWFH 1PA6A 4IFDH 1LTRD 5LL6X 4A75A 2WKDA 1Z6HA 2YTVA 4NXML 4JI8L 4MIUA 2VB3X 3E0EA 1E1TA 1TS2A 2X6LA 2X69A 4DK3C 3KDFB 1AZPA 1QUQB 1WCMH 2JA6G 3A55A 2JEBI 4GKJL 4JPBW 1IYJB 3CW2C 1Q8KA 2B8FA 5HY6A 4AQYL 4KN7C 1HNZQ 4A3BH 1TQOA 1I94Q 4DR7Q 4Y52H 4A3LH 3QJYA 4DAVA 2F0TA 2RHSB 1TIID 5CV8A 1XMQL 3UI2A 1KRTA 2RSNA 3ER0A 5EPLA 2B29A 5GAEC 1XNQL 3J7AF 4DU9A 3I70A 1EQRA 2FHTA 1ONLA 5AJ3L 4A3MG 3W5OA 3K5LA 1PH9A 1D5XC 1KXLA 3OTOQ 1NY4A 3RN2A 1EY4A 5HURA 1AH9A 1SNPA 3DXJC 1SE4A 2RDGA 1ENFA 2EYPA 4F7XA 2R92G 4B3MQ 5IE8A 2JJQA 3NTKA 3RLFA 2I5HA 3BDOA 2RHQB 2ICEC 4LW1A 2JA8B 1EWHA 3NHHA 1RKNA 2IT1A 1SE3A 3GTGB 1KQSA 1A3UA 3VR2A 1HHVA 4LF6Q 1VQIA 4A3JB 1XYIA 4NKLA 3KF8A 2F3VA 4DR7L 1AW7A 3HOYH 4KY5A 4BBRG 2RSOA 5C44G 1FVIA 4RHSA 4ZLTF 2CH4A 1RF2D 1N36Q 2DNEA 4L8JA 1VQGA 2OT2A 4UP8A 5JJZA 4DV4Q 2NVYB 2UU9Q 2B63G 3GV6A 4X64L 1G2SA 3CPWA 2NVTH 2L12A 4BY7G 4JBJA 5CV5A 4FF2A 1A2TA 1G6PA 1R4PB 2VL6A 2Z8LA 5IYBH 2ZTCA 2XIWA 4QUCA 5IIFA 3I4LA 4HMIA 3VYSA 2L1BA 2B2WA 1TY0A 2EQSA 3L7ZC 1C7YA 4ZRZA 4A3CG 1ET9A 2EE1A 3I3CA 2NVXH 1STYA 1NUCA 1SN8A 1BUVT 4LF8Q 2KEDA 1WVLA 3RMHA 5HGQA 1HPCA 5IYDG 5E4XA 5C5LA 3OIPA 1GVPA 3NELA 1V1QA 3WWVA 5I2YA 5D3IB 4IUQA 5CBEE 4C3IG 2WACA 4PNYA 5LHY1 3NENA 4HN7A 4P2CB 5IP9G 3L9AX 3Q0AA 3HP3A 1A62A 4HJ9A 3DM3A 4LF5L 4DAMA 1G51A 1PHJA 4HIMA 2SNSA 4KKUA 4BY1G 3BVMA 3FPPA 2EYJA 1O80A 1STGA 1HA5A 3BG3A 3M4YA 5CORA 3D3RA 5IGDA 2QEXA 4DUZL 1I50B 2M00A 4A3EH 3DWAA 3PO3G 4JI0L 1MD2D 1QILA 2I46A 4ZQ3A 3CCLA 3H09A 4C3JH 3PV0A 4GNXC 3LX0A 3A5UA 4IFDG 4R4IA 1DGSA 4OXPA 4XQQA 2PW5A 3AEVA 4LF8L 3ONAB 1WD0A 2A6HC 4DKAC 4ALPA 1OTCA 1ZYRD 3CMAA 3GTQH 3E3XA 5EPKA 2V4DA 5KYLA 3KBXA 1L1OC 3E9HA 1NBWA 3T1HQ 3E5SA 4KD3A 4JOIC 2BA1A 4A3BG 4DR6Q 1TWHB 3M4OH 3QG1A 1JB3A 4JI6Q 2ZM6L 2PQEA 3HOVB 4H13C 5C3EH 1W6JA 3R8BA 5K5PA 2O4XA 1ZXTA 4QCLA 3AU7A 2EXZA 1Y1WB 4G57A 1X3PA 4DR5Q 4FO2A 3SK4A 5M5YH 4GN5A 5BN5A 1ICWA 3QOJA 1EY5A 2IX0A 1YHBA 1E24A 3J7AV 1QZHA 2KCCA 1E0BA 4DXGA 3PF5A 1E2ZA 3VR5A 3M4PA 1BBWA 2KA7A 3CKIB 3NEMA 1VQ4A 2I07B 5FJ8H 3RUZA 1B4OA 4NW2A 2L9HA 1K8MA 1YEZA 4H7BA 2A69C 4POFA 2K5HA 2KVMA 3GTLH 1SE2A 5M5WH 4JI6L 1YNJD 4OO1G 2H5XA 3VR4A 1LM0A 1F9RA 2DUDA 4RGNA 4QF4A 2E2IB 4WJ3M 4K5VA 1CA6A 2CHBD 3K7UC 5IY0A 3I4OA 2B39A 1LACA 4POGA 1VQOA 2A6ED 4O0AA 1K8AC 1CA5A 4OWTB 1I4HA 1KDCA 2WFWA 1CI3M 5A2QE 1I6HB 2Q8RE 1ASZA 2L15A 3I4MG 2M9VA 3R2IA 2F3WA 3U9SA 4RKLA 2JA5B 1CZWA 3OPOA 1PZKD 2EIFA 2K5VA 4ID6A 3SEBA 2DGYA 3VR3A 1JE4A 5T1GA 4JI3L 3D4DA 3S2HH 1STNA 1IYVA 1M8AA 4JYAL 5JJIA 1V1PA 4ZK9B 1D5MC 3FPUB 1CKMA 1OXVA 1EZ6A 4DK0A 2KCMA 1MI2A 1X55A 3NBHB 2UXBL 4LF7L 1AE2A 1RD9D 1S5DD 3NE5B 4YCWA 1XJVA 3HOUH 5A2QL 4HJ5A 1X56A 2Q2TA 2ZXRA 3EVQA 3GTMH 2Q8TA 3QR8A 2JE6I 1NSNS 3SDZA 4FP5D 4HIOA 3VR6A 2F0NA 3QOLA 3HOWH 1PDQA 2G5DA 1MIUA 1STEA 4R4OA 2YU9B 1N32Q 1LT4D 1N8RC 5G3LD 1EIGA 3TP8A 4OGQC 4C3JG 1IHZA 3GTJB 1EY7A 1MHWC 1SYDA 2OTLA 3RZOB 4GS3A 3PIP3 2D0OA 3TP6A 4RCNA 4WFN3 1HNWQ 5BN3A 2J0TD 2H1EA 4QJFA 2RA4A 4XIGS 3CRLC 4YCVA 3H6MA 3PGZA 2E2JH 4IJHA 4Y7NB 1LT6D 2GA4B 4S3SA 1NCVA 1JICA 2Y0SG 2F0UA 1B9NA 1ML0D 4IURA 2B2VA 3S1QH 1HRJA 1Y1VB 3PQIA 2NTSA 3KDFA 1HXYD 1QUQA 3K7AH 3Q24A 2XWBB 1B8AA 1Q7YC 1B50A 3M9BA 4DV1Q 3GD7A 4KHPQ 1AN8A 1WOCA 1HQRD 4A3GB 5LMUQ 5C0XJ 2R93B 1QWYA 1ENCA 3U9OA 1HZ9A 3WDNA 1FNVA 5LL6S 3OMCA 4FVMA 2AWNA 1U4MA 1EYAA 2CWPA 4JI5L 1S4ZA 4EQPA 1MJCA 1L0XB 1NTGA 2B8GA 3MFGA 3NWSA 4RFBA 2NVQB 2I0QA 2A73B 2NZOA 1II3A 1RDPD 4X65Q 1QE6A 4XQJA 4WJ4A 4A3FB 3O13A 1I4PA 4KKTA 2FMMA 2RKSA 2PW7A 3JAMi 2EY2A 4LUOA 4H02A 2EZVA 1E7ZA 3KLSA 1EOTA 1EOVA 5M3FH 4YHHL 5LMUL 3BZKA 3ITPA 5C4XB 2EVBA 2VUMH 5JPNC 3PUYA 4A3IH 4DAYB 2KOLA 5IP7H 4PQXA 1IKLA 1XPOA 2BOSA 3J81i 5EPJA 4A3DB 3S16H 1HTLD 4DNTB 1HR0Q 1DJRD 1SNOA 3NXWA 4LUVA 4XT1B 3PMFA 4GNXB 3TP5A 4X65L 3BDCA 1GUGA 4A93H 2BE5D 4MZ9A 1X3QA 3GTPB 3FKIB 3R93A 2JA7B 5H1SE 4CJ2C 3NSWA 4QQBX 1FJGQ 5G3LF 1EEFD 2YTYA 3F1ZA 1L1OB 2KHJA 2EJFC 3HOUG 2VQEQ 4P71A 1HA6A 3I56A 1KDAA 4R4CA 4N9PA 3ERSX 1CTMA 2WB1G 1GUTA 1U4RA 1PRTD 1N34Q 3KK7A 1TWGB 4Z9CB 3M7GA 2AQ3B 1LTAD 3R3OA 1EIFA 2E5LL 2R6GA 1KL9A 1DOLA 2KHSA 5JAVA 2CQAA 1SFOB 2O5JC 3S1MH 5C4JH 1IKMA 1LTID 1VQBA 3JAME 3LWUA 2R3ZA 4KKSA 3A8JE 2WINB 5NUCA 2AQ1B 1VQFA 5FLMH 3CCEA 5J39A 1XWEA 4LFAL 1PYSB 4IUPA 4ODGA 4GOPA 1PH1A 2IY5B 4MNOA 2NN6I 3I90A 3S9WA 3NTIA 4BBRH 1SXTA 5C44H 2F3IA 5FLXE 1QNKA 2Z6KC 1H9JA 3TZUA 3NK9A 4L5QA 1N34L 4FF1A 4JI7Q 3FP9A 3TQYA 1WTPA 1VDZA 3J81E 2A68D 3CPFA 4IPGA 1Q86C 1AZQA 1ZYRC 2K28A 1BBXC 1YVCA 3JAML 4CKEA 3S17B 5JJLA 2ZJQA 2PYKA 4QGUA 2WAQG 3K8AA 4X66Q 3M3YH 3TBIB 2JA9A 3RN5A 3HOXB 3J7A5 4LF9Q 3EBEA 2MP1A 3EROA 1NE3A 1WTWA 1CSPA 5FLXL 1D1KA 3PUZA 1LT3D 1VQ8A 1EWCA 2ZXOA 1PH4A 3J81L 3DM1A 3PO2H 5IYDH 3GTGH 1ESFA 3HOZB 3OWFA 1I3QB 4GLAC 4HMJA 5I2XA 3BVGA 4GKJQ 1RL2A 1VQCA 4X3UA 4K8IA 3IKJA 3K57A 4AQYQ 5IP9H 3P75A 1KNEA 3Q8DA 3DUZA 5D14A 1A63A 3S1RH 2UUCL 1XMQQ 4KV6A 1LABA 1D7QA 1I4GA 4BY1H 2K5NA 2N49A 1JORA 4A76A 4KN4C 2KECA 2I5LX 2H4OA 3KYHC 5IOCA 2VUMG 1YNJC 4X66L 3PO3H 5AJ3Q 3RLNA 4A3IG 2JEAI 3U58A 4JI1L
chains in the Genus database with same CATH topology
4M1UB 4A3KB 2G9DA 5EGTA 1QCBD 2HDMA 1O7LA 2A6EC 3F2UA 1MSHA 1PRTF 5CV4A 1IW7D 3FEWX 2R92B 4PMWA 1EYCA 2XRSD 3WOEA 4FNFA 2EY5A 5KEEA 1SJHD 4KJNA 5IT9E 4TQUS 4BA2I 4KK7A 3HRZC 4ABNA 2F0WA 2EYLA 3S2DB 5E1FA 1FR3A 1F9SA 1DOMA 3NBHA 1U9RA 3MC0B 2IW3A 3W2DA 4KHZA 2XSCA 4DAPA 2DNCA 1PYWD 2XN9C 1MGSA 4C1NI 2B63B 3HGBA 4ME5A 4QMGA 5KNDA 5M5XB 2K04A 4OIKA 4BY7B 5EKIA 5CC4A 1LTSD 3NTHA 4XTCS 2BCOA 4F88A 2L4NA 5FO9B 3TP7A 4OO1H 3CHBD 5T1IA 5DM63 4QB4A 4V0BA 1HCZA 5I9OA 2B2UA 4ILWA 2MUYA 1MBYA 3IAYA 4C3IB 3E6ZX 4BA1I 1RTNA 4H44C 2B2WC 3D4RA 1GUOA 2MHVA 3C1EA 3D6WA 3PIO3 3K6OA 2PNRC 2F0MA 2PZWA 1BOSA 3GTOB 5FO8B 4C2MB 4KHVA 5C0XG 4HEDA 1TWFB 3PUWA 3VA7A 3K5NA 1SNMA 2D2CC 1WCMB 1DD2A 2EJMA 3IFDA 1D2BA 3A8IE 3VYTA 1O7YA 2KCNA 2D5DA 1BXTA 4K8JA 4WORA 3H3VC 1HFNA 3BZDB 3NPPA 3ERQA 2F0DA 4ZAIA 3VYRA 3MXUA 4DNRB 4UDUC 3I4NB 1CM9A 2K05A 2R61A 1PMRA 1V43A 3I73A 1WD1A 2B2TA 3BYTB 2QILA 1LO5D 5CMDA 4IALA 2DY7A 1SYEA 4U673 2BE5C 5CYUA 3HOYB 1YNND 1QNUA 2JXMB 2HUGA 1I6VC 1TWCB 3L3OC 1Q1BA 4DF7A 4TKOB 1D6EC 1I4QA 2OEOA 2C9OA 1G8ZD 1TS3A 1EFID 2F0IA 2NVTB 2F0PA 1PRTC 3QWNA 1ILQA 4R8IA 4F8MA 3KLSX 5M9OA 5DAUA 1CT1D 5KRUA 1GOZA 2F0LA 3SK8A 3A7LA 2NVXB 5ELDA 1H9RA 2FFKB 5TSSA 1KAAA 2L0CA 4TRDA 2FINB 4I65A 1NR4A 2F1MA 3K5OA 5ELEA 1LTTD 3SXHA 2ENBA 1AEXA 4FF3A 1SEBD 3C2PA 3TN2A 4L6TB 1CK1A 4NDXA 2RVLA 3NQTA 1B9MA 2A68C 1H9MA 4BWGB 3K0YA 2B2YC 4A3EB 3VYUA 2Z1CA 3H91A 1T5EA 5D3DA 3NQIA 1DYQA 4C3JB 5KNBA 1OO9B 1SDFA 4HAEA 1J9OA 3MAQA 3J7YW 4QIWB 1SSOA 4RH6A 1BCPD 1O78A 4AYBB 2F0KA 3QO2A 1EY0A 2KEEA 3GTQB 4CHTB 3EQLC 1R4QB 4TSSA 2Y0SB 2M2LA 5DM73 3C1FA 3M4OB 1LTBD 3C46A 4J6HA 2E74C 3EA6A 5C3EB 1HQMC 5AFWA 2LFNA 4OL7A 1UUPA 1WTRA 3WOFA 1A15A 5M5YB 1S5ED 4IUNA 4X3TA 2EPBA 5CGKA 2B2VC 3A8KE 2VXWA 4J8QA 2K32A 5IODA 2FMCA 2OF1A 4UAIA 3HG9A 1A3VA 4RHRA 2WIIB 1GJXA 1IW7C 5FO7B 3GTLB 1PTOH 5M5WB 1LLRD 2CVRA 3HS0C 3QB3A 5JPMC 1D1IA 1SJED 4K2LA 1ILPA 2F0VA 1JOOA 3DHQA 1H9KA 5IGGA 3I8ZA 5EJWA 2EYOA 1DM0B 1U4PA 1ZEQX 1EQTA 1STHA 1QOHA 3X3MA 2RQXA 1FNWA 2BDNA 5D65A 3KUPA 3S2HB 2IPKD 1SBBB 4K6DA 4EQOA 4DGZA 1F9QA 2F4IA 5COYA 3D31A 1CHQD 1LT5D 2JSOA 4C3HG 5JOBA 1ZKOA 3Q23A 2K7VA 2ICIA 3HOUB 4EVOA 4EGVA 4K2KA 5DNFA 3GTMB 2F0EA 2Q8IB 2KUMA 3MTSA 4HR7B 1CQFA 3HOWB 4CKBA 1HFGA 1QJOA 4IUUA 5HGTA 4B9WA 1TS5A 4JBWA 1PTOD 1DONA 2EJGC 1B1ZA 2WP8J 1NR2A 2E2JB 2QF7A 2IJ0A 2NTTA 1RTOA 2Z4IA 1U4LA 2L11A 2PO4A 1VCIA 2HDLA 3R2TA 1A3TA 4RGOS 1GUNA 3MWYW 3K7AB 3T16A 1XXGA 2VB2X 2XWJB 4M8AA 1BO0A 1KABA 2NN6H 4EQNA 3T4AC 5KGUA 1F9PA 5E4WC 2K5QA 4K14A 5FK9C 5K36G 1KLUD 1PRTB 2BA0A 4XYQA 4Q0FA 1L0YB 2A69D 1TVXA 1PFNA 2RDFA 2RDHA 1FGBD 4XT3B 4RKBA 4OHJA 3NBIA 1EU4A 5I9PA 3OOCA 1OXSC 3TMEA 2EYFA 5C4HA 3DEPA 1G91A 1KDBA 2FJ2A 2EYHA 4CJ0B 1X32A 4IUTA 3IL8A 4JK1C 2NBFA 1Z47A 5C3WA 1Y8NB 3NUCA 1SYFA 5M3FB 2PCFB 4XYOA 1QB5D 1C4QA 4A3IB 1YNNC 3I91A 5JEAJ 4DN4M 5C4ZA 1V1PB 5C0XH 4IZ8A 3S16B 1E2VA 2PPBC 2K1BA 2CW0D 3ND8A 1EQVA 1S5BD 2J4XA 2SOBA 1WTVA 1R9TB 3M7NA 1T5XD 5KIXA 2SDFA 3G7LA 2JA6B 4FXDA 1KNAA 4MHEA 3V2TA 2YYZA 4WJWA 1WTXA 5C5MA 1SNCA 1JC7A 2N55A 5ELBA 4FXKC 4YIJA 1NAPA 1PTOF 2IL8A 4NP5A 5I6WA 1PZID 4A3MB 3LNNA 1B53A 3D6CA 1Z7TA 4RCOA 3URYA 1DZ1A 2AUKA 1OXXK 2PZUA 2IWHA 3HEJA 1G6ZA 3S1MB 2F03A 5C4JB 3SR1A 4XXEA 1C48A 3SHLA 3FMCA 2QEJC 5IGEA 1G291 4DFAA 4PMCA 4IFDI 1TR5A 1Q3LA 4BBRB 2LY7A 5BN4A 1GHKA 5C44B 4G7OC 3OSOA 3H94A 1VMPA 1SAPA 2X6GA 1RODA 2NZ1D 2L5TA 1BCPC 2C5CA 3GTKB 2F0GA 3SVMA 5IT9L 1SYBA 2NN6G 4LJZC 4CGYB 2SEBD 1HTPA 1IL8A 1RHPA 4G7ZC 3M3YB 4OIJA 3RD4A 2A5HA 2QCPX 2NWGA 3KBGA 3NP8A 1OXTA 4WRDA 4R9WA 3N6RA 2K01A 5J1ZA 1BF4A 2B2UC 1QG7A 3K59A 5JVG3 4FYDA 3PO2B 4DXFA 1JWSD 4ZKCB 2XNAC 3W3AA 2K5WA 3N52A 5CV6A 1LV9A 1XX8A 1EY8A 1F2YA 3S1RB 3MHBA 4OO1I 4BY1B 1Y8OB 1I4RA 1S5FD 2A74C 1PLFA 3PO3B 3V96A 1H9SB 3HZXA 1B2TA 5EBDA 4XDXA 1EZ8A 2ZT9C 1PXUA 5JVH3 2EDGA 3DWPA 1EYDA 1STAA 4X3KA 1V1OA 1TKWB 4PMBA 1W6KA 3S15B 5JEAH 1HUMA 3T51B 1FNUA 2EOTA 4A3BB 2R7ZB 2F0QA 2K33A 4ZUJA 3MXGA 2EY6A 4BBSB 3S1NB 4DAYA 1EEID 4C1NK 4CJ1B 2B2TC 3H0GB 1KTKA 2NUCA 1B44D 1CHPD 2IX3A 2JYOA 1J8IA 1G2TA 4J1MA 1MSGA 1A2UA 2PMZB 1JWUD 3DEOA 3J80E 3KLRA 1O7ZA 3IFTA 1JWMD 2XVSA 1CQVA 1PTOC 4BS9A 1JCKB 1AP0A 4HSVA 2EY1A 4KTAA 1EY6A 3GV3A 3AMUA 2DY8A 4KY7A 3I72A 2E75C 1DCZA 3K5MA 3J80L 3DMUA 3I4MB 3BYYB 1PFBA 4KI0A 2G9HD 1CZGA 2DN8A 3OW7A 1SMYD 4HCSA 4H0LC 4LAAA 4ZKBB 2SNMA 1SNDA 4B9XA 2E2DC 1GXDC 1GHJA 1PZJD 4B08A 2OXPA 2VNUD 2MJ8A 2F0HA 3EFXD 1TY2A 2L55A 2KJXA 1IYUA 4L63B 5ISRA 4N9TA 4NMZA 3QIAA 2N88A 4QUFA 1UEAB 3TDQA 3V05A 3BS1A 4G4KA 5DEHA 3BDLA 1JQYD 5CR3A 4MN3A 4LK1C 3MVVA 4I7ZC 3P20A 5FKAC 3BVZA 4PV1C 3PUXA 3MEHA 2B2YA 4XQNA 4IQZA 4GZYC 4RAUC 5JEAG 2J7ZA 1S5CD 5I4DA 3MFYA 4V190 2CW0C 1K8OA 4RGTA 3E0JA 1OXUA 1BR9A 1BCPB 4IN3A 1STBA 3GP7A 4KY6A 4K6LA 1FYCA 2D62A 2D9UA 2E76C 4LMQD 2ZXPA 3OWEB 5EKLA 5K36H 1Q90A 2PZTA 2K5DA 4ZYSA 3SK5A 1Q12A 3GO5A 2TSSA 2XRQD 2WKCA 2F0JA 3A7AB 3Q6SA 3LWEA 2JP1A 4Q5VA 4HSPA 1BQQT 3A56A 1RJTA 5CV9A 5C6AA 3RZDB 1TT2A 4E6IA 3HKZB 1ESRA 2F0SA 3TZDA 3D4WA 3OMGA 3SK6A 3T53B 4C3HB 5KYIA 4C56C 1VMCA 2F0OA 4HTHA 3MXNA 5CBAE 1F2LA 5F2DA 1EY9A 4U68A 3GQBA 3MXPA 1ET6A 3CRKC 4IUVA 4KMUC 1SYGA 1XTCD 3S14B 1GUSA 2LKVA 1JR0D 3P1HA 1JOKA 3SE0A 1CFMA 3CU7A 4KD4A 3D8GA 2MPMA 1WTQA 2EYMA 5EBCA 2MGSA 4HCEA 2WB1B 4IFDJ 5A35A 1I4XA 1BCPF 1E2WA 1Y8PB 1LTGD 5KNCA 2LS01 2A6HD 4ULLA 3T13A 3P7JA 1SYCA 2NB0A 2K6AA 2AUJD 1VF7A 1Q1EA 3AB9A 2F0FA 1KLGD 1TS4A 1H9SA 2HCCA 1A6XA 2ID0A 2HQEA 3ZYYX 4CKCA 5IGFA 1EU3A 3NWTA 3S1QB 3CQZB 4K5WA 1AFPA 2KQ3A 3VA5A 2AQ2B 1V8QA 1PTOB 3EJIA 5ELFA 2NYZD 4X3SA 1BDOA 2BDOA 2TMPA 5IGBA 2WV6D 4RWSC 4RA8A 4CBVA 2WAQB 1VF5C 4G7HC 3T56B 2QKIC 3DWQA 1F2ZA 1BNZA 3MZ5A 1D5ZC 1F2MA 3ND9A 1WTOA 3FVQA 4DA2A 2LMCB 1TWAB 3A54A 1EL0A 1PFMA 4K5XA 2O5IC 1Y69U 4O42A 5ELCA 3OIQA 1JOQA 2RBMA 1DXMA 3MA2B 3G6JB 5E3FA 1Q8IA 5EKKA 2VUMB 1K83B 3M85A 3OHXC 4O1NA 1HUNA 1SNQA 2AWOA 4FF4A 5I6YA 1UNSA 5IGCA 5M3MB 3Q22A 4ZUIA 1C8CA 2HCIA 1UAPA 4A93B 1FD7D 3X3NA 3FDTA 1EIHA 5C3XA 5CV7A 2E2HB 1ENAA 1M4VA 2QDBA 3C3LA 1SMYC 1TU2B 4DK1A 3FRPB 5C0XI 1F77A 4R8NA 5J22A 4F87A 2K03A 1GUWA 2O2LD 4FXGC 2IX1A 3PUVA 4RGMA 3TSSA 1B3AA 1RCVD 4KJOA 2Z4HA 5EQ0A 1DOKA 3K58A 5FOBB 4IFDH 1LTRD 5LL6X 2WKDA 1Z6HA 4MIUA 2VB3X 1TS2A 2X6LA 2X69A 1AZPA 3A55A 2JEBI 2B8FA 4KN7C 1TQOA 3QJYA 4DAVA 2F0TA 1TIID 5CV8A 3UI2A 2RSNA 5EPLA 3J7AF 4DU9A 3I70A 2FHTA 1ONLA 3K5LA 1D5XC 1EY4A 5HURA 1SNPA 3DXJC 1SE4A 2RDGA 1ENFA 2EYPA 4F7XA 3NTKA 3RLFA 3BDOA 2ICEC 2JA8B 1EWHA 3NHHA 1RKNA 2IT1A 1SE3A 3GTGB 1A3UA 3VR2A 1HHVA 1XYIA 4A3JB 4NKLA 3KF8A 2F3VA 1AW7A 4KY5A 2RSOA 4ZLTF 4RHSA 1RF2D 2DNEA 4L8JA 2OT2A 5JJZA 2NVYB 3GV6A 1G2SA 2L12A 5CV5A 4FF2A 1A2TA 1R4PB 2Z8LA 5IIFA 2XIWA 4QUCA 3I4LA 4HMIA 3VYSA 2L1BA 2B2WA 1TY0A 3L7ZC 4ZRZA 1ET9A 2EE1A 3I3CA 1STYA 1NUCA 1BUVT 2KEDA 1WVLA 3RMHA 1HPCA 5E4XA 5C5LA 3OIPA 5I2YA 5D3IB 4IUQA 5CBEE 4C3IG 2WACA 4PNYA 5LHY1 4HN7A 4P2CB 3L9AX 3Q0AA 3HP3A 2SNSA 4KKUA 3BVMA 3FPPA 2EYJA 1O80A 1STGA 1HA5A 3BG3A 3M4YA 5CORA 3D3RA 5IGDA 1I50B 2M00A 3DWAA 1MD2D 1QILA 2I46A 4ZQ3A 3H09A 3PV0A 3LX0A 4IFDG 4XQQA 2PW5A 3ONAB 1WD0A 2A6HC 1ZYRD 5EPKA 2V4DA 5KYLA 3KBXA 3E5SA 4KD3A 2BA1A 1TWHB 3QG1A 1JB3A 2PQEA 3HOVB 4H13C 1W6JA 3R8BA 5K5PA 2O4XA 1ZXTA 4QCLA 3AU7A 2EXZA 1Y1WB 4G57A 1X3PA 4FO2A 3SK4A 5BN5A 1ICWA 3QOJA 1EY5A 2IX0A 3J7AV 2KCCA 1E0BA 4DXGA 1E2ZA 3VR5A 2KA7A 3CKIB 2I07B 3RUZA 1B4OA 4NW2A 2L9HA 1K8MA 4H7BA 2A69C 2KVMA 1SE2A 1YNJD 4OO1G 3VR4A 1F9RA 4RGNA 4QF4A 2E2IB 4K5VA 1CA6A 2CHBD 2B39A 1LACA 2A6ED 1CA5A 1I4HA 1KDCA 1CI3M 5A2QE 1I6HB 2Q8RE 2M9VA 3R2IA 2F3WA 3U9SA 4RKLA 2JA5B 1CZWA 3OPOA 1PZKD 4ID6A 3SEBA 3VR3A 1JE4A 5T1GA 3D4DA 1STNA 1IYVA 1M8AA 1V1PA 4ZK9B 1D5MC 3FPUB 1OXVA 1EZ6A 4DK0A 1MI2A 1RD9D 1S5DD 3NE5B 5A2QL 2ZXRA 3EVQA 2Q8TA 2JE6I 1NSNS 3SDZA 4FP5D 3VR6A 2F0NA 3QOLA 1PDQA 1STEA 2YU9B 1LT4D 5G3LD 1EIGA 3TP8A 4OGQC 4C3JG 1IHZA 3GTJB 1EY7A 1SYDA 3RZOB 3PIP3 3TP6A 4RCNA 4WFN3 5BN3A 2J0TD 2H1EA 2RA4A 4XIGS 3CRLC 3H6MA 4Y7NB 1LT6D 2GA4B 4S3SA 1NCVA 1JICA 2F0UA 1B9NA 1ML0D 4IURA 2B2VA 1HRJA 1Y1VB 2NTSA 1HXYD 3Q24A 2XWBB 1B50A 3GD7A 4A3GB 1AN8A 1HQRD 5C0XJ 2R93B 1QWYA 1ENCA 3U9OA 3WDNA 1FNVA 5LL6S 3OMCA 4FVMA 2AWNA 1U4MA 1EYAA 1S4ZA 4EQPA 1L0XB 2B8GA 3MFGA 3NWSA 4RFBA 2NVQB 2A73B 1II3A 1RDPD 1QE6A 4XQJA 4A3FB 3O13A 1I4PA 4KKTA 2FMMA 2RKSA 2PW7A 2EY2A 2EZVA 3KLSA 1EOTA 3ITPA 5C4XB 2EVBA 5JPNC 3PUYA 2KOLA 4PQXA 1IKLA 2BOSA 5EPJA 4A3DB 1HTLD 4DNTB 1DJRD 1SNOA 3NXWA 4XT1B 3PMFA 3TP5A 3BDCA 1GUGA 2BE5D 3GTPB 1X3QA 3FKIB 3R93A 2JA7B 4CJ2C 3NSWA 5G3LF 1EEFD 2EJFC 1HA6A 1KDAA 4N9PA 1CTMA 1GUTA 1U4RA 1PRTD 3KK7A 1TWGB 4Z9CB 3M7GA 2AQ3B 1LTAD 3R3OA 2R6GA 1DOLA 2KHSA 5JAVA 2CQAA 1SFOB 2O5JC 1IKMA 1LTID 3JAME 3LWUA 4KKSA 2R3ZA 3A8JE 2WINB 5NUCA 2AQ1B 5J39A 1XWEA 4IUPA 4ODGA 2NN6I 3I90A 3S9WA 3NTIA 1SXTA 5FLXE 1QNKA 1H9JA 3TZUA 3NK9A 4FF1A 1WTPA 1VDZA 3J81E 2A68D 1AZQA 1ZYRC 2K28A 1BBXC 3JAML 4CKEA 3S17B 2PYKA 3TBIB 3HOXB 2MP1A 3EROA 1WTWA 5FLXL 1D1KA 3PUZA 1LT3D 1EWCA 2ZXOA 3J81L 3DM1A 1ESFA 3HOZB 3OWFA 1I3QB 4HMJA 5I2XA 3BVGA 4X3UA 4K8IA 3IKJA 3K57A 3P75A 1KNEA 5D14A 3DUZA 4KV6A 1LABA 1I4GA 1JORA 4KN4C 2KECA 2H4OA 5IOCA 1YNJC 2JEAI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C1E A;  4IZ8 A;  4J1M A;  1JOK A;  1A2U A;  1TQO A;  3MEH A;  4WRD A;  1JOQ A;  2F0T A;  5CV8 A;  5EGT A;  2RBM A;  5J1Z A;  4F8M A;  4B9W A;  4IUN A;  2KHS A;  5HGT A;  5JAV A;  2F0M A;  2PZW A;  2SNS A;  3D8G A;  4KD4 A;  5CGK A;  1EQV A;  5M9O A;  1ENC A;  2EYJ A;  5DAU A;  4DU9 A;  1KDC A;  2SOB A;  3U9O A;  5KRU A;  1STG A;  2EYM A;  5IOD A;  5IGD A;  5E3F A;  2M00 A;  3OMC A;  2F0L A;  5KIX A;  1EYA A;  5CV4 A;  2OF1 A;  4KHV A;  5EKK A;  5NUC A;  3SK8 A;  4ZQ3 A;  1EY4 A;  4EQP A;  5HUR A;  3V2T A;  2F3W A;  1EYC A;  5J39 A;  4RKL A;  1SNP A;  1A3V A;  5C5M A;  1SNC A;  5CV6 A;  4ID6 A;  3LX0 A;  2EYP A;  2EY5 A;  4ODG A;  4F7X A;  5KEE A;  4KJN A;  1STB A;  4KY6 A;  2PW5 A;  1SNM A;  1SNQ A;  1II3 A;  1EY8 A;  1F2Y A;  2EY1 A;  1SYC A;  3D4D A;  1STN A;  3MHB A;  3S9W A;  1KAA A;  5I6Y A;  3NHH A;  4TRD A;  4I65 A;  4KTA A;  1RKN A;  1A3T A;  1EY6 A;  3QB3 A;  5IGC A;  5EKL A;  2F0F A;  4NP5 A;  5I6W A;  4ZUI A;  2PZT A;  3NK9 A;  2RKS A;  2PW7 A;  2EY2 A;  4KY7 A;  3SXH A;  1EZ6 A;  2ENB A;  3D6C A;  1A3U A;  4K2L A;  3SK5 A;  3DMU A;  1AEX A;  2EYL A;  2F0W A;  3T16 A;  5KYL A;  3HZX A;  5E1F A;  2F0V A;  1JOO A;  3DHQ A;  3E5S A;  1KAB A;  2PZU A;  4KD3 A;  4NKL A;  4EQN A;  5C3X A;  5CV7 A;  2F3V A;  4NDX A;  3NQT A;  4KY5 A;  5IGG A;  1U9R A;  5KGU A;  1EZ8 A;  2PQE A;  3HEJ A;  1ENA A;  2F0J A;  2HQE A;  2EYO A;  4K14 A;  4K8J A;  4WOR A;  3ERQ A;  3ITP A;  2PYK A;  5IGF A;  5K5P A;  3EVQ A;  2O4X A;  4LAA A;  2QDB A;  2F0D A;  3SR1 A;  2SNM A;  1NSN S;  1EYD A;  2EXZ A;  1SND A;  3T13 A;  2RDF A;  4K5W A;  1STH A;  1STA A;  4ME5 A;  4QMG A;  3SHL A;  4B9X A;  2F0N A;  3QOL A;  4G57 A;  4RKB A;  2KQ3 A;  3VA5 A;  4R8N A;  5CV9 A;  5C6A A;  3ERO A;  1TT2 A;  3SK4 A;  5IGE A;  5J22 A;  4PMB A;  4E6I A;  5I9P A;  2OXP A;  3EJI A;  5CC4 A;  4DFA A;  3TP8 A;  4PMC A;  1IHZ A;  2F0S A;  1SNO A;  1TR5 A;  3NXW A;  5CV5 A;  3TME A;  1A2T A;  2EYF A;  2F0H A;  3D4W A;  3QOJ A;  3OMG A;  1EY5 A;  4K6D A;  3SK6 A;  3PMF A;  1EY7 A;  4DGZ A;  4EQO A;  5C4H A;  5IGB A;  1KDB A;  1SYD A;  3TP5 A;  5IIF A;  2EYH A;  3BDC A;  5KYI A;  3OSO A;  3TP6 A;  2F0Q A;  3TP7 A;  2F0O A;  2F0K A;  4HMI A;  4HTH A;  4IAL A;  1EY0 A;  3OWF A;  5ISR A;  4KJO A;  5JOB A;  4N9T A;  5F2D A;  1EY9 A;  4ZUJ A;  3H6M A;  4HMJ A;  1SYE A;  4QB4 A;  2F0G A;  2EY6 A;  4NMZ A;  1STY A;  1F2Z A;  1NUC A;  3MXP A;  4S3S A;  3RUZ A;  5C3W A;  4K8I A;  3MZ5 A;  3C1F A;  1SYB A;  3NUC A;  4H7B A;  4EVO A;  5I9O A;  1SYF A;  2F0U A;  3P75 A;  4J6H A;  1F2M A;  4K2K A;  4MIU A;  1SYG A;  5C5L A;  1KDA A;  2F0E A;  4KV6 A;  5DEH A;  3BDL A;  4N9P A;  4DF7 A;  2LKV A;  4YIJ A;  5CR3 A;  4QF4 A;  1JOR A;  3P1H A;  2OEO A;  4OL7 A;  2NUC A;  2WAC A;  5IOC A;  4K5V A;  4PNY A;  4K5X A;  3MVV A;  5C4Z A;  2F0I A;  3R3O A;  3NP8 A;  2F0P A; 
#chains in the Genus database with same CATH topology
 4M1U B;  4A3K B;  1EYG A;  2G9D A;  1CKN A;  4P73 A;  5EGT A;  1QCB D;  2HDM A;  2BH2 A;  1O7L A;  1PYB A;  3CXC A;  2A6E C;  1JJG A;  3F2U A;  1MSH A;  1EWI A;  4A93 G;  1PRT F;  5CV4 A;  1IW7 D;  1XMO Q;  3FEW X;  2ZJR A;  2R92 B;  4PMW A;  1EYC A;  2VS1 A;  2XRS D;  4DR2 L;  3WOE A;  4FNF A;  5GAH C;  2EY5 A;  5KEE A;  1SJH D;  4KJN A;  5IT9 E;  4TQU S;  3S15 H;  4BA2 I;  1W3S A;  4KK7 A;  4GKK L;  2R7Z H;  3HRZ C;  2CFM A;  4ABN A;  3SGI A;  2B3G A;  1UE1 A;  4LUZ A;  2F0W A;  2EYL A;  3S2D B;  3K80 C;  5E1F A;  1VQ9 A;  1FR3 A;  1F9S A;  4LFB L;  3A5Z B;  4X64 Q;  1DOM A;  4BBS H;  3NBH A;  1U9R A;  3MC0 B;  3UDI A;  2IW3 A;  3W2D A;  4KHZ A;  3S1N H;  4FDB A;  2XSC A;  4DAP A;  1Y14 B;  2DNC A;  1PYW D;  2XN9 C;  5LMN W;  1MGS A;  2AHO B;  2GN5 A;  4C1N I;  2B63 B;  3HGB A;  3H0G H;  4ME5 A;  4QMG A;  5KND A;  5M5X B;  1B3Q A;  2K04 A;  1XMO L;  4OIK A;  5FLM G;  4BY7 B;  5EKI A;  4LF4 L;  2DJF C;  1Z9F A;  5CC4 A;  1LTS D;  3NTH A;  4XTC S;  1GKH A;  3K0X A;  4HJ7 A;  2BCO A;  3D0F A;  4L5R C;  4L5S A;  4F88 A;  1P16 A;  2L4N A;  3TP7 A;  5FO9 B;  4OO1 H;  3CHB D;  1Q81 C;  5T1I A;  1WI5 A;  5DM6 3;  4QB4 A;  1SMX A;  4V0B A;  1S40 A;  1HCZ A;  5I9O A;  2B2U A;  4ILW A;  4LF5 Q;  2MUY A;  1MBY A;  3IAY A;  4C3I B;  1Y1W H;  3E6Z X;  4BA1 I;  1RTN A;  4H44 C;  1IBK L;  4DUY L;  2B2W C;  3D4R A;  4DUZ Q;  1IBK Q;  1GUO A;  1YJW A;  1PH2 A;  3U4Z A;  2MHV A;  1U5K A;  3C1E A;  3I4M H;  4UPA A;  4JI0 Q;  4RG1 A;  2HIX A;  3D6W A;  3PIO 3;  2ZTE A;  1MJE A;  1IXR A;  2PNR C;  3K6O A;  2F0M A;  2PZW A;  3ICE A;  1SE8 A;  1JE5 A;  1BOS A;  1VQH A;  4BXX G;  3GTO B;  3PO2 G;  5FO8 B;  4C2M B;  4KHV A;  4DV6 L;  5C0X G;  2HQL A;  4HED A;  1TWF B;  4A3J G;  1VQP A;  3PUW A;  1VQM A;  3VA7 A;  2CKZ B;  3K5N A;  1SNM A;  2D2C C;  2PQA B;  4HJ8 A;  1WCM B;  1DD2 A;  2ZM6 Q;  2EJM A;  3T1Y L;  3IFD A;  2UUB Q;  1D2B A;  3A8I E;  3VYT A;  4IPC A;  2VQF L;  1O7Y A;  2KCN A;  2D5D A;  4LNQ A;  3ULJ A;  1BXT A;  1YZ6 A;  4K8J A;  4WOR A;  3H3V C;  3BZD B;  3NPP A;  1HFN A;  3ERQ A;  2ALY B;  2F0D A;  4ZAI A;  3U50 C;  3VYR A;  3UDG A;  3MXU A;  2JA5 H;  2A1A A;  4DNR B;  4UDU C;  3AFQ A;  3I4N B;  1CM9 A;  1WFQ A;  2ZJP A;  2K05 A;  2R61 A;  1PMR A;  1V43 A;  3CCM A;  2OWO A;  3I73 A;  1WD1 A;  3BJU A;  4LFC L;  3JAM c;  2B2T A;  3BYT B;  2R7Z G;  2QIL A;  1LO5 D;  5CMD A;  1JJ2 A;  4IAL A;  2DY7 A;  4JV5 Q;  4L5T A;  2UUB L;  1SYE A;  4U67 3;  1K28 A;  2BE5 C;  5CYU A;  3ULL A;  4B3R Q;  3HOY B;  1YNN D;  4BBS G;  1QNU A;  2JXM B;  2HUG A;  1VQ7 A;  1I6V C;  1TWC B;  5GAG C;  2MFI A;  3L3O C;  5FLX c;  1Q1B A;  3G6E A;  4DF7 A;  4TKO B;  1D6E C;  1I4Q A;  2OEO A;  3M4Q A;  1J5E L;  2C9O A;  1G8Z D;  3J81 c;  1TS3 A;  1EFI D;  3H0G G;  2F0I A;  2NVT B;  2F0P A;  1E3P A;  1PRT C;  3QWN A;  1ILQ A;  4R8I A;  4JC0 A;  4F8M A;  3B6Y A;  2MO0 A;  3CF5 A;  3KLS X;  5M9O A;  5DAU A;  1CT1 D;  4GN4 B;  4JI3 Q;  5KRU A;  4P74 A;  2Z6B A;  1GOZ A;  2F0L A;  3KF6 B;  4JYA Q;  3SK8 A;  3CCQ A;  3A7L A;  2NVX B;  4JV5 L;  2QGQ A;  2Z0S A;  5ELD A;  1H9R A;  2LSS A;  3RZD H;  4B3R L;  2FFK B;  1N9W A;  1VQA A;  2UXB Q;  4LF7 Q;  2N3S A;  3HOV G;  5TSS A;  1KAA A;  2L0C A;  4TRD A;  2FIN B;  4I65 A;  1PH7 A;  1N33 L;  1HH2 P;  1NR4 A;  1YI2 A;  4C3H H;  1Y1W G;  2F1M A;  3K5O A;  5ELE A;  1LTT D;  3SXH A;  2ENB A;  1AEX A;  4FF3 A;  1SEB D;  3C2P A;  3CCU A;  4YWL A;  3TN2 A;  4L6T B;  1CK1 A;  2R93 H;  4NDX A;  2RVL A;  3NQT A;  2ES2 A;  2RF4 A;  1B9M A;  1SLJ A;  2A68 C;  1H9M A;  4BWG B;  1VQN A;  3K0Y A;  2B2Y C;  4A3E B;  3S14 H;  3VYU A;  2Z1C A;  3H91 A;  1T5E A;  5D3D A;  3NQI A;  3RNU A;  1DYQ A;  4C3J B;  5KNB A;  1OO9 B;  1SDF A;  2PI2 E;  1J9O A;  4HAE A;  3MAQ A;  3J7Y W;  3KLW A;  4QIW B;  1SSO A;  4RH6 A;  1BCP D;  4ME3 A;  1O78 A;  1VS0 A;  2UUA L;  4AYB B;  5EAY A;  2F0K A;  3QO2 A;  2CCZ A;  1EY0 A;  2KEE A;  3GTQ B;  4CHT B;  1ICF B;  3EN2 A;  3EQL C;  1R4Q B;  3MEF A;  4TSS A;  2Y0S B;  2M2L A;  5DM7 3;  3C1F A;  4HJA A;  3M4O B;  1LTB D;  4QIW E;  3C46 A;  4J6H A;  2E74 C;  3EA6 A;  5C3E B;  1HQM C;  4AYB E;  5AFW A;  4IOA A;  2LFN A;  2ATW A;  2XTI A;  1QVF A;  4OL7 A;  1UUP A;  1WTR A;  3WOF A;  2JA5 G;  1A15 A;  4B3T L;  5M5Y B;  1HZB A;  4JI5 Q;  3J7Z C;  1S5E D;  2MO1 A;  4IJL A;  3W1G A;  4IUN A;  4X3T A;  2EPB A;  5CGK A;  1PVO A;  2B2V C;  3A8K E;  2VXW A;  4N8F A;  2FXQ A;  5LMN L;  4J8Q A;  2K32 A;  3KF8 B;  5IOD A;  1K9M C;  3H3V I;  4DV0 L;  2FMC A;  1E1O A;  3CQZ H;  2OF1 A;  4UAI A;  1CUK A;  3HG9 A;  1A3V A;  2QW7 A;  4RHR A;  2WII B;  4MTN A;  1GJX A;  1IW7 C;  5FO7 B;  3GTL B;  4PZ7 A;  1PTO H;  4IPD A;  5M5W B;  1YNX A;  2ASB A;  1LLR D;  2CVR A;  3HS0 C;  3QB3 A;  5JPM C;  3UE1 A;  4YHH Q;  1XNR Q;  4K0K L;  1D1I A;  3CAM A;  1SJE D;  4K2L A;  1ILP A;  4EQ5 A;  2F0V A;  1JOO A;  3DHQ A;  1H9K A;  2RCN A;  3H15 A;  5IGG A;  3I8Z A;  1VQL A;  5ELN A;  5EJW A;  4A4I A;  2EYO A;  1DM0 B;  2IHF A;  4JBM A;  2Z9H A;  1U4P A;  1ZEQ X;  4YCU A;  1TWA H;  4DV7 L;  2YTX A;  1EQT A;  1STH A;  1QOH A;  3X3M A;  2RQX A;  1FNW A;  2BDN A;  5D65 A;  3KUP A;  1IBL Q;  3S2H B;  2IPK D;  1SBB B;  4K6D A;  3HKZ G;  4EQO A;  4DGZ A;  1F9Q A;  1P8L A;  1Y1V G;  2F4I A;  5COY A;  1HZC A;  3D31 A;  1CHQ D;  1LT5 D;  4IOC A;  2JSO A;  4C3H G;  5JOB A;  1ZKO A;  1XNR L;  3Q23 A;  4JI4 L;  1K83 H;  1T9H A;  2K7V A;  2F4V L;  2ICI A;  2VW9 A;  3HOU B;  4A3G G;  3EIV A;  4EVO A;  4EGV A;  2R93 G;  2E5L Q;  4K2K A;  5DNF A;  4AIM A;  3GTM B;  2F0E A;  1U0L A;  1YJN A;  1X6O A;  2Q8I B;  5M3M H;  2KUM A;  3MTS A;  4HR7 B;  1PH5 A;  1CQF A;  3HOW B;  4CKB A;  1HFG A;  3PIP A;  1QJO A;  4JBK A;  4IUU A;  4LFA Q;  5HGT A;  4B9W A;  1TS5 A;  5L37 A;  4OON A;  1IBL L;  1YIJ A;  2E2H H;  2HIV A;  4JBW A;  1PTO D;  4JCV E;  1DON A;  2EJG C;  1B1Z A;  4JG2 A;  2VY3 A;  1JMC A;  2WP8 J;  1YBY A;  1QZG A;  1NR2 A;  2E2J B;  2QF7 A;  2IJ0 A;  2NTT A;  1RTO A;  2Z4I A;  1K8G A;  1UWV A;  4GN3 B;  1U4L A;  2L11 A;  2PO4 A;  1K3B C;  1VCI A;  3PCO B;  3CD6 A;  2HDL A;  3R2T A;  2R7D A;  5C4X G;  1A3T A;  4RGO S;  1GUN A;  3MWY W;  3K7A B;  3T16 A;  1XXG A;  2VB2 X;  2XWJ B;  4M8A A;  4OEL B;  1BO0 A;  1KAB A;  2NN6 H;  4EQN A;  3T4A C;  4GOP C;  1IBM L;  5KGU A;  5IWA Q;  1F9P A;  5E4W C;  2K5Q A;  1KIX A;  4K14 A;  5FK9 C;  5K36 G;  1KLU D;  1PRT B;  3STB D;  2BA0 A;  4XYQ A;  4Q0F A;  2A8V A;  1L0Y B;  2A69 D;  3UDF A;  1IL2 A;  1TVX A;  1PFN A;  3FKI G;  2RDF A;  2RDH A;  2JA7 G;  1FGB D;  2F52 A;  4XT3 B;  4RKB A;  2UXD L;  4OHJ A;  3NBI A;  1EU4 A;  5I9P A;  2UXC Q;  3OOC A;  5BR8 L;  1OXS C;  3TME A;  2EYF A;  5C4H A;  2GVA A;  3DEP A;  1G91 A;  1KDB A;  2FJ2 A;  2EYH A;  4CJ0 B;  1QVC A;  1X32 A;  2C35 B;  2UUC Q;  4O2D A;  3F8T A;  4OWX B;  4IUT A;  4PZ6 A;  3IL8 A;  4OEM B;  4JK1 C;  4NXN L;  1HJP A;  2NBF A;  1Z47 A;  5C3W A;  4JI1 Q;  1TXY A;  3FHW A;  1Y8N B;  4DR1 L;  3NUC A;  1SYF A;  5M3F B;  4DNI A;  2AKW B;  2KCT A;  5IWA L;  2PCF B;  4XYO A;  2JA8 H;  1QB5 D;  1C4Q A;  4YY3 L;  1JT8 A;  4A3I B;  4DV3 L;  4BXX H;  1YNN C;  4CDD C;  3I91 A;  4DPG A;  5JEA J;  4DN4 M;  5C4Z A;  1V1P B;  5C0X H;  4IZ8 A;  3TEH B;  3S16 B;  1E2V A;  4A3J H;  1FGU A;  2PPB C;  2K1B A;  4DR2 Q;  2CW0 D;  4X6A H;  3ND8 A;  2UXC L;  4JVZ A;  4PG3 A;  2EXD A;  1KD1 C;  1EQV A;  4EX5 A;  1S5B D;  2J4X A;  1LTL A;  2SOB A;  2OTJ A;  4GKK Q;  1WTV A;  1R9T B;  3M7N A;  1T5X D;  2N78 A;  5KIX A;  2SDF A;  3G7L A;  2HHH L;  2JA6 B;  4FXD A;  1BVS A;  1KNA A;  2LXJ A;  3KF6 A;  4MHE A;  3V2T A;  2NVY H;  2YYZ A;  4WJW A;  1WTX A;  5C5M A;  1SNC A;  2QA4 A;  1JC7 A;  2N55 A;  5ELB A;  4B3S Q;  1D8L A;  4FXK C;  4LFB Q;  4YIJ A;  4RMF A;  1NAP A;  4DV5 L;  1PTO F;  2Q2U A;  2IL8 A;  4NP5 A;  1XTD A;  5I6W A;  1PZI D;  2KEN A;  3HOX G;  4A3M B;  5M3M G;  3LNN A;  1B53 A;  3D6C A;  1Z7T A;  4RCO A;  3URY A;  3BU2 A;  1DZ1 A;  2AUK A;  1OXX K;  2PZU A;  4OWW B;  2IWH A;  4LF4 Q;  3HEJ A;  1G6Z A;  3S1M B;  2F03 A;  5C4J B;  3HOZ G;  3SR1 A;  2PI2 A;  4XXE A;  1C48 A;  3SHL A;  2CQO A;  3FMC A;  2QEJ C;  1Q82 C;  1BBU A;  2D0P A;  2K50 A;  5IGE A;  1GO3 E;  1G29 1;  4DFA A;  4PMC A;  2OQ0 A;  4IFD I;  1TR5 A;  1HNX Q;  4B3S L;  1Q3L A;  4BBR B;  2LY7 A;  5BN4 A;  1GHK A;  5C44 B;  4G7O C;  3MXN B;  2K75 A;  2HT1 A;  3OSO A;  3TRZ A;  3H94 A;  3KFU A;  1VMP A;  1SAP A;  1I50 H;  2X6G A;  3CME A;  1ROD A;  2NZ1 D;  2L5T A;  1PH8 A;  1BCP C;  2C5C A;  3AYH B;  3GTK B;  4DUY Q;  2F0G A;  3A74 A;  4A3K G;  4DV2 Q;  3SVM A;  2MNA A;  5IT9 L;  1SYB A;  2NN6 G;  1VQD A;  2RCF A;  4LJZ C;  4CGY B;  4UP9 A;  2SEB D;  1HTP A;  1IL8 A;  1RHP A;  4G7Z C;  1WTH A;  2K14 A;  1BKB A;  3M3Y B;  4OIJ A;  1SR3 A;  3RD4 A;  3I4N H;  2A5H A;  2QCP X;  3OYY A;  2NWG A;  3KBG A;  1CSQ A;  3NP8 A;  1OXT A;  4DV6 Q;  2BH8 A;  1L2F A;  4WRD A;  4R9W A;  3RR5 A;  3J81 j;  3N6R A;  2K01 A;  5J1Z A;  1BF4 A;  1TWH H;  2B2U C;  1QG7 A;  3K59 A;  5JVG 3;  1HNX L;  4FYD A;  3PO2 B;  4DXF A;  3HOV H;  1JWS D;  4ZKC B;  3L0O A;  3CCR A;  2XNA C;  1LYL A;  1HNZ L;  1I94 L;  3W3A A;  4YWM A;  3T1Y Q;  2K5W A;  3N52 A;  5CV6 A;  3I55 A;  1LV9 A;  1XX8 A;  4DV2 L;  1TWC H;  2VQF Q;  3J80 i;  1IZ6 A;  1EY8 A;  1F2Y A;  3U4V A;  3S1R B;  4JI2 Q;  3MHB A;  4OO1 I;  4BY1 B;  1Y8O B;  3OTO L;  1V9P A;  1I4R A;  1S5F D;  2A74 C;  2JA8 G;  4CDC C;  5J3B A;  1PLF A;  3PO3 B;  3V96 A;  1H9S B;  2CH4 W;  2N8N A;  2NZH A;  3HZX A;  4B3M L;  1B2T A;  3HKS A;  4JW0 A;  2HD3 A;  3LGJ A;  5EBD A;  4XDX A;  3A0J A;  2MQH A;  1EZ8 A;  1X9N A;  1LUZ A;  2ZT9 C;  1PXU A;  3L2P A;  5JVH 3;  2EDG A;  3DWP A;  1EYD A;  4LFC Q;  4LF6 L;  1STA A;  4N8X 1;  4X3K A;  2E2I H;  1V1O A;  1TKW B;  1K0S A;  4PMB A;  1W6K A;  3S15 B;  5JEA H;  1HUM A;  3T51 B;  3ZJY C;  3CC7 A;  1FNU A;  2E8G A;  2EOT A;  4OX9 Q;  4A3B B;  1N36 L;  2R7Z B;  3CC4 A;  4JI2 L;  2F0Q A;  4DV4 L;  2UU9 L;  1CKO A;  1I6H H;  2K33 A;  4ZUJ A;  3MXG A;  1J5E Q;  2EY6 A;  3I2Z A;  4BBS B;  2K52 A;  3KOJ A;  3S1N B;  4DAY A;  1FL0 A;  1EEI D;  3CCS A;  4PZ8 A;  4GOP B;  1PFS A;  4C1N K;  3CCV A;  4CJ1 B;  2B2T C;  3H0G B;  1KTK A;  2NUC A;  1B44 D;  1CHP D;  2IX3 A;  2JYO A;  1J8I A;  1G2T A;  1JB7 A;  3UE0 A;  4GNX A;  4J1M A;  1MSG A;  1A2U A;  2PMZ B;  3AFP A;  1PH3 A;  1JWU D;  3DEO A;  3J80 E;  3KLR A;  2AMC B;  4OX9 L;  1WCM G;  1ASY A;  2KBN A;  1O7Z A;  3IFT A;  1N33 Q;  1JWM D;  2GVB A;  1PH6 A;  2XVS A;  1CQV A;  1PTO C;  1JJC B;  4BS9 A;  1JCK B;  1AP0 A;  1L1O A;  2PMZ E;  4HSV A;  4A3L G;  4JOI A;  2YU9 H;  1EIY B;  4AH6 A;  1HR0 W;  1YIT A;  2EY1 A;  1AE3 A;  1PV4 A;  3GTJ H;  3JC6 6;  4KTA A;  1EY6 A;  3GV3 A;  1Q46 A;  3AMU A;  2DY8 A;  3RZO H;  3PIO A;  4KY7 A;  3I72 A;  2E75 C;  1DCZ A;  3K5M A;  3J80 L;  3DMU A;  1KAW A;  3I4N G;  3I4M B;  3BYY B;  1PFB A;  4KI0 A;  4Y7N H;  2G9H D;  1CZG A;  2DN8 A;  3ULP A;  3KJP A;  3OW7 A;  1SMY D;  4HCS A;  4H0L C;  4LAA A;  4ZKB B;  1K0R A;  2SNM A;  2A19 A;  1Y1V H;  1SND A;  4B9X A;  3T1H L;  2UUA Q;  3STB C;  2E2D C;  1GXD C;  5GRO A;  1GHJ A;  4NPS A;  4DR6 L;  1PZJ D;  4B08 A;  3HOY G;  2OXP A;  2YV5 A;  2VZA A;  2VNU D;  2MJ8 A;  2F0H A;  4I7A A;  3EFX D;  4HIK A;  4A3G H;  1TY2 A;  4QY7 A;  2L55 A;  2KJX A;  1IYU A;  1CKN B;  4L63 B;  5ISR A;  4DR5 L;  1B7Y B;  4N9T A;  4NMZ A;  3QIA A;  2N88 A;  4QUF A;  4B3T Q;  1UEA B;  3TDQ A;  3V05 A;  3BS1 A;  2NVQ H;  3HFZ B;  5IYB G;  1XPU A;  4G4K A;  5DEH A;  1MKH A;  1WJJ A;  4A3F H;  3BDL A;  1M1K C;  1JQY D;  4UHV A;  5CR3 A;  5LMN Q;  4GLX A;  4MN3 A;  4LK1 C;  4APV A;  3MVV A;  4J15 A;  4DV0 Q;  2OQK A;  3P20 A;  4I7Z C;  5FKA C;  3BVZ A;  4PV1 C;  3PUX A;  3MEH A;  3VDY A;  1YHQ A;  2B2Y A;  4XQN A;  2IHE A;  4IQZ A;  2R7F A;  4GZY C;  4RAU C;  5JEA G;  4UP7 A;  1NNX A;  2J7Z A;  5IT9 c;  1VQJ A;  1S5C D;  5I4D A;  1A0I A;  5ELO A;  2CWA A;  3MFY A;  4V19 0;  2CW0 C;  5C4X H;  1K8O A;  4RGT A;  1YJ9 A;  3E0J A;  1OXU A;  4K0K Q;  1KC8 C;  1GD7 A;  1EFW A;  3W1B A;  2Y0S E;  1BR9 A;  4A3D H;  1BCP B;  4IN3 A;  1STB A;  3GP7 A;  4KY6 A;  1RIP A;  4K6L A;  1FYC A;  2D62 A;  2D9U A;  2E76 C;  4LMQ D;  4A3E G;  1QVG A;  3H3V H;  4HID A;  2ZXP A;  3OWE B;  5EKL A;  5K36 H;  1NMG A;  4P75 A;  5IYC H;  1Q90 A;  2PZT A;  2K5D A;  4CDF C;  1I5F A;  3GTP H;  4IPH A;  2DJG C;  4ZYS A;  3SK5 A;  3G71 A;  1Q12 A;  1KRS A;  3FKI H;  3GO5 A;  4DV7 Q;  2TSS A;  2JA7 H;  1NMF A;  2XRQ D;  4MTK A;  2WKC A;  2F0J A;  3A7A B;  3Q6S A;  3LWE A;  3F2B A;  1S72 A;  2JP1 A;  3S24 A;  4AYB G;  4Q5V A;  4CDE C;  4HSP A;  1BQQ T;  3A56 A;  4R4Q A;  1TWG H;  1RJT A;  3G4S A;  5CV9 A;  5GQO A;  5C6A A;  3RZD B;  1TT2 A;  4E6I A;  3HKZ B;  4JI4 Q;  1ESR A;  3E9I A;  2F4V Q;  2F0S A;  3TZD A;  5C3E G;  3D4W A;  3OMG A;  1YHA A;  3SK6 A;  3T53 B;  3K81 C;  4C3H B;  1C9O A;  1SFO H;  5KYI A;  4C56 C;  1VMC A;  2F0O A;  4HTH A;  3MXN A;  5CBA E;  3F2D A;  1N32 L;  4IO9 A;  4DR3 Q;  1F2L A;  5F2D A;  1EY9 A;  3HKZ E;  1X3G A;  4U68 A;  3GQB A;  3MXP A;  1ET6 A;  3CRK C;  4IUV A;  1A8V A;  3G48 A;  4KMU C;  4DK6 C;  1SYG A;  1XTC D;  1HNW L;  3CCJ A;  3S14 B;  1GUS A;  2LKV A;  1JR0 D;  3F2C A;  4YWK A;  2I5M X;  3P1H A;  1X3F A;  5DLQ E;  1UE6 A;  2PNH A;  5FJ8 G;  2XGT A;  3RLO A;  1NJI C;  1L0W A;  1JOK A;  2V1C C;  3SE0 A;  1CFM A;  3CU7 A;  4KD4 A;  1K73 C;  3D8G A;  2MPM A;  1WTQ A;  3S17 H;  2EYM A;  5EBC A;  2MGS A;  4HCE A;  2WB1 B;  4IFD J;  5A35 A;  1I4X A;  1BCP F;  4DR3 L;  1E2W A;  3HOX H;  4ZCK A;  4DV1 L;  1Y8P B;  1LTG D;  1GM5 A;  4KHP L;  2LS0 1;  5KNC A;  2A6H D;  3PSI A;  1VQ6 A;  2Q2I A;  4GLV B;  4ULL A;  1EUJ A;  3T13 A;  3P7J A;  1SYC A;  4UY8 C;  2NB0 A;  2K6A A;  1IBM Q;  2AUJ D;  2JK8 A;  1VF7 A;  2WB1 E;  1Q1E A;  3AB9 A;  2F0F A;  1KLG D;  4A3F G;  3HOZ H;  4R1J A;  4NB3 A;  1TS4 A;  1UE7 A;  1I3Q H;  1H9S A;  2UXD Q;  2HCC A;  1A6X A;  2ID0 A;  3DLL A;  1R9T H;  2HQE A;  3ZYY X;  5BR8 Q;  4CKC A;  5IGF A;  2JA6 H;  1EU3 A;  3NWT A;  3S1Q B;  1UEB A;  3CQZ B;  4TVA B;  4K5W A;  1AFP A;  2PQA A;  2KQ3 A;  3CP0 A;  3VA5 A;  2AQ2 B;  1X3E A;  2LXK A;  1V8Q A;  1PTO B;  3EJI A;  4A3K H;  5ELF A;  3J80 c;  4NXN Q;  2NYZ D;  4X3S A;  1BDO A;  4A3D G;  2BDO A;  2TMP A;  4DR1 Q;  5IGB A;  3TRE A;  2WV6 D;  4A3M H;  4RWS C;  4RA8 A;  4X62 Q;  4CBV A;  4DR4 Q;  3HOW G;  2WAQ B;  1VF5 C;  5IYC G;  1VQK A;  4G7H C;  4YY3 Q;  3T56 B;  4DV3 Q;  2QDL A;  2QKI C;  1M90 C;  3DWQ A;  1HR0 L;  2R92 H;  5JJK A;  1F2Z A;  5E7N A;  1BNZ A;  3MZ5 A;  1D5Z C;  3TS2 A;  1F2M A;  1HZA A;  3ND9 A;  1WTO A;  3FVQ A;  4DA2 A;  2LMC B;  2WAQ E;  1TWA B;  3TS0 A;  3A54 A;  1EL0 A;  4P72 A;  1J6Q A;  1PFM A;  4K5X A;  1FJG L;  2O5I C;  1Y69 U;  1XPR A;  2HHH Q;  4O42 A;  3S2D H;  5ELC A;  3OIQ A;  1C0A A;  2VQE L;  1JOQ A;  2RBM A;  1DXM A;  3MA2 B;  1EQQ A;  3G6J B;  3BZC A;  2Z6K A;  3PF4 A;  5E3F A;  3AQQ A;  3UDX A;  4DV5 Q;  1Q8I A;  3GDE A;  4X62 L;  3GTK H;  5EKK A;  2B63 H;  4DR4 L;  2VUM B;  1K83 B;  5M5X H;  3M85 A;  4BY7 H;  3OHX C;  4O1N A;  1HUN A;  3IRB A;  1SNQ A;  2AWO A;  4FF4 A;  5I6Y A;  1UNS A;  1X65 A;  5IGC A;  5M3M B;  2K4K A;  3Q22 A;  4ZUI A;  1C8C A;  2HCI A;  1UAP A;  1O7I A;  4A3C H;  4A93 B;  1FD7 D;  3X3N A;  3FDT A;  1X54 A;  4R4T A;  1EIH A;  2JQO A;  1VQE A;  5C3X A;  4NXM Q;  5CV7 A;  4JI8 Q;  3CC2 A;  2E2H B;  1H95 A;  3KJO A;  1B70 B;  1KHI A;  2JN4 A;  1ENA A;  1M4V A;  2KHI A;  2Q2H A;  1WYD A;  2QDB A;  4C3I H;  5GAD C;  4JI7 L;  3C3L A;  2OCE A;  1SMY C;  1TU2 B;  4DK1 A;  3FRP B;  5C0X I;  1F77 A;  4R8N A;  5J22 A;  3OW2 A;  4KLK A;  1K3R A;  2ZTD A;  4F87 A;  5M3F G;  4LWC A;  2K03 A;  3I7F A;  1GUW A;  1UE5 A;  1W2B A;  2O2L D;  1SRU A;  1XNQ Q;  1S3O A;  1SRO A;  4FXG C;  2IX1 A;  3PUV A;  4RGM A;  4QL5 A;  1VQ5 A;  3TSS A;  5IP7 G;  4LF9 L;  1B3A A;  1RCV D;  3GTO H;  2P5Z X;  4KJO A;  2Z4H A;  5EQ0 A;  4C2M H;  1DOK A;  3K58 A;  1E22 A;  5FOB B;  1TWF H;  1PA6 A;  4IFD H;  1LTR D;  5LL6 X;  4A75 A;  2WKD A;  1Z6H A;  2YTV A;  4NXM L;  4JI8 L;  4MIU A;  2VB3 X;  3E0E A;  1E1T A;  1TS2 A;  2X6L A;  2X69 A;  4DK3 C;  3KDF B;  1AZP A;  1QUQ B;  1WCM H;  2JA6 G;  3A55 A;  2JEB I;  4GKJ L;  4JPB W;  1IYJ B;  3CW2 C;  1Q8K A;  2B8F A;  5HY6 A;  4AQY L;  4KN7 C;  1HNZ Q;  4A3B H;  1TQO A;  1I94 Q;  4DR7 Q;  4Y52 H;  4A3L H;  3QJY A;  4DAV A;  2F0T A;  2RHS B;  1TII D;  5CV8 A;  1XMQ L;  3UI2 A;  1KRT A;  2RSN A;  3ER0 A;  5EPL A;  2B29 A;  5GAE C;  1XNQ L;  3J7A F;  4DU9 A;  3I70 A;  1EQR A;  2FHT A;  1ONL A;  5AJ3 L;  4A3M G;  3W5O A;  3K5L A;  1PH9 A;  1D5X C;  1KXL A;  3OTO Q;  1NY4 A;  3RN2 A;  1EY4 A;  5HUR A;  1AH9 A;  1SNP A;  3DXJ C;  1SE4 A;  2RDG A;  1ENF A;  2EYP A;  4F7X A;  2R92 G;  4B3M Q;  5IE8 A;  2JJQ A;  3NTK A;  3RLF A;  2I5H A;  3BDO A;  2RHQ B;  2ICE C;  4LW1 A;  2JA8 B;  1EWH A;  3NHH A;  1RKN A;  2IT1 A;  1SE3 A;  3GTG B;  1KQS A;  1A3U A;  3VR2 A;  1HHV A;  4LF6 Q;  1VQI A;  4A3J B;  1XYI A;  4NKL A;  3KF8 A;  2F3V A;  4DR7 L;  1AW7 A;  3HOY H;  4KY5 A;  4BBR G;  2RSO A;  5C44 G;  1FVI A;  4RHS A;  4ZLT F;  2CH4 A;  1RF2 D;  1N36 Q;  2DNE A;  4L8J A;  1VQG A;  2OT2 A;  4UP8 A;  5JJZ A;  4DV4 Q;  2NVY B;  2UU9 Q;  2B63 G;  3GV6 A;  4X64 L;  1G2S A;  3CPW A;  2NVT H;  2L12 A;  4BY7 G;  4JBJ A;  5CV5 A;  4FF2 A;  1A2T A;  1G6P A;  1R4P B;  2VL6 A;  2Z8L A;  5IYB H;  2ZTC A;  2XIW A;  4QUC A;  5IIF A;  3I4L A;  4HMI A;  3VYS A;  2L1B A;  2B2W A;  1TY0 A;  2EQS A;  3L7Z C;  1C7Y A;  4ZRZ A;  4A3C G;  1ET9 A;  2EE1 A;  3I3C A;  2NVX H;  1STY A;  1NUC A;  1SN8 A;  1BUV T;  4LF8 Q;  2KED A;  1WVL A;  3RMH A;  5HGQ A;  1HPC A;  5IYD G;  5E4X A;  5C5L A;  3OIP A;  1GVP A;  3NEL A;  1V1Q A;  3WWV A;  5I2Y A;  5D3I B;  4IUQ A;  5CBE E;  4C3I G;  2WAC A;  4PNY A;  5LHY 1;  3NEN A;  4HN7 A;  4P2C B;  5IP9 G;  3L9A X;  3Q0A A;  3HP3 A;  1A62 A;  4HJ9 A;  3DM3 A;  4LF5 L;  4DAM A;  1G51 A;  1PHJ A;  4HIM A;  2SNS A;  4KKU A;  4BY1 G;  3BVM A;  3FPP A;  2EYJ A;  1O80 A;  1STG A;  1HA5 A;  3BG3 A;  3M4Y A;  5COR A;  3D3R A;  5IGD A;  2QEX A;  4DUZ L;  1I50 B;  2M00 A;  4A3E H;  3DWA A;  3PO3 G;  4JI0 L;  1MD2 D;  1QIL A;  2I46 A;  4ZQ3 A;  3CCL A;  3H09 A;  4C3J H;  3PV0 A;  4GNX C;  3LX0 A;  3A5U A;  4IFD G;  4R4I A;  1DGS A;  4OXP A;  4XQQ A;  2PW5 A;  3AEV A;  4LF8 L;  3ONA B;  1WD0 A;  2A6H C;  4DKA C;  4ALP A;  1OTC A;  1ZYR D;  3CMA A;  3GTQ H;  3E3X A;  5EPK A;  2V4D A;  5KYL A;  3KBX A;  1L1O C;  3E9H A;  1NBW A;  3T1H Q;  3E5S A;  4KD3 A;  4JOI C;  2BA1 A;  4A3B G;  4DR6 Q;  1TWH B;  3M4O H;  3QG1 A;  1JB3 A;  4JI6 Q;  2ZM6 L;  2PQE A;  3HOV B;  4H13 C;  5C3E H;  1W6J A;  3R8B A;  5K5P A;  2O4X A;  1ZXT A;  4QCL A;  3AU7 A;  2EXZ A;  1Y1W B;  4G57 A;  1X3P A;  4DR5 Q;  4FO2 A;  3SK4 A;  5M5Y H;  4GN5 A;  5BN5 A;  1ICW A;  3QOJ A;  1EY5 A;  2IX0 A;  1YHB A;  1E24 A;  3J7A V;  1QZH A;  2KCC A;  1E0B A;  4DXG A;  3PF5 A;  1E2Z A;  3VR5 A;  3M4P A;  1BBW A;  2KA7 A;  3CKI B;  3NEM A;  1VQ4 A;  2I07 B;  5FJ8 H;  3RUZ A;  1B4O A;  4NW2 A;  2L9H A;  1K8M A;  1YEZ A;  4H7B A;  2A69 C;  4POF A;  2K5H A;  2KVM A;  3GTL H;  1SE2 A;  5M5W H;  4JI6 L;  1YNJ D;  4OO1 G;  2H5X A;  3VR4 A;  1LM0 A;  1F9R A;  2DUD A;  4RGN A;  4QF4 A;  2E2I B;  4WJ3 M;  4K5V A;  1CA6 A;  2CHB D;  3K7U C;  5IY0 A;  3I4O A;  2B39 A;  1LAC A;  4POG A;  1VQO A;  2A6E D;  4O0A A;  1K8A C;  1CA5 A;  4OWT B;  1I4H A;  1KDC A;  2WFW A;  1CI3 M;  5A2Q E;  1I6H B;  2Q8R E;  1ASZ A;  2L15 A;  3I4M G;  2M9V A;  3R2I A;  2F3W A;  3U9S A;  4RKL A;  2JA5 B;  1CZW A;  3OPO A;  1PZK D;  2EIF A;  2K5V A;  4ID6 A;  3SEB A;  2DGY A;  3VR3 A;  1JE4 A;  5T1G A;  4JI3 L;  3D4D A;  3S2H H;  1STN A;  1IYV A;  1M8A A;  4JYA L;  5JJI A;  1V1P A;  4ZK9 B;  1D5M C;  3FPU B;  1CKM A;  1OXV A;  1EZ6 A;  4DK0 A;  2KCM A;  1MI2 A;  1X55 A;  3NBH B;  2UXB L;  4LF7 L;  1AE2 A;  1RD9 D;  1S5D D;  3NE5 B;  4YCW A;  1XJV A;  3HOU H;  5A2Q L;  4HJ5 A;  1X56 A;  2Q2T A;  2ZXR A;  3EVQ A;  3GTM H;  2Q8T A;  3QR8 A;  2JE6 I;  1NSN S;  3SDZ A;  4FP5 D;  4HIO A;  3VR6 A;  2F0N A;  3QOL A;  3HOW H;  1PDQ A;  2G5D A;  1MIU A;  1STE A;  4R4O A;  2YU9 B;  1N32 Q;  1LT4 D;  1N8R C;  5G3L D;  1EIG A;  3TP8 A;  4OGQ C;  4C3J G;  1IHZ A;  3GTJ B;  1EY7 A;  1MHW C;  1SYD A;  2OTL A;  3RZO B;  4GS3 A;  3PIP 3;  2D0O A;  3TP6 A;  4RCN A;  4WFN 3;  1HNW Q;  5BN3 A;  2J0T D;  2H1E A;  4QJF A;  2RA4 A;  4XIG S;  3CRL C;  4YCV A;  3H6M A;  3PGZ A;  2E2J H;  4IJH A;  4Y7N B;  1LT6 D;  2GA4 B;  4S3S A;  1NCV A;  1JIC A;  2Y0S G;  2F0U A;  1B9N A;  1ML0 D;  4IUR A;  2B2V A;  3S1Q H;  1HRJ A;  1Y1V B;  3PQI A;  2NTS A;  3KDF A;  1HXY D;  1QUQ A;  3K7A H;  3Q24 A;  2XWB B;  1B8A A;  1Q7Y C;  1B50 A;  3M9B A;  4DV1 Q;  3GD7 A;  4KHP Q;  1AN8 A;  1WOC A;  1HQR D;  4A3G B;  5LMU Q;  5C0X J;  2R93 B;  1QWY A;  1ENC A;  3U9O A;  1HZ9 A;  3WDN A;  1FNV A;  5LL6 S;  3OMC A;  4FVM A;  2AWN A;  1U4M A;  1EYA A;  2CWP A;  4JI5 L;  1S4Z A;  4EQP A;  1MJC A;  1L0X B;  1NTG A;  2B8G A;  3MFG A;  3NWS A;  4RFB A;  2NVQ B;  2I0Q A;  2A73 B;  2NZO A;  1II3 A;  1RDP D;  4X65 Q;  1QE6 A;  4XQJ A;  4WJ4 A;  4A3F B;  3O13 A;  1I4P A;  4KKT A;  2FMM A;  2RKS A;  2PW7 A;  3JAM i;  2EY2 A;  4LUO A;  4H02 A;  2EZV A;  1E7Z A;  3KLS A;  1EOT A;  1EOV A;  5M3F H;  4YHH L;  5LMU L;  3BZK A;  3ITP A;  5C4X B;  2EVB A;  2VUM H;  5JPN C;  3PUY A;  4A3I H;  4DAY B;  2KOL A;  5IP7 H;  4PQX A;  1IKL A;  1XPO A;  2BOS A;  3J81 i;  5EPJ A;  4A3D B;  3S16 H;  1HTL D;  4DNT B;  1HR0 Q;  1DJR D;  1SNO A;  3NXW A;  4LUV A;  4XT1 B;  3PMF A;  4GNX B;  3TP5 A;  4X65 L;  3BDC A;  1GUG A;  4A93 H;  2BE5 D;  4MZ9 A;  1X3Q A;  3GTP B;  3FKI B;  3R93 A;  2JA7 B;  5H1S E;  4CJ2 C;  3NSW A;  4QQB X;  1FJG Q;  5G3L F;  1EEF D;  2YTY A;  3F1Z A;  1L1O B;  2KHJ A;  2EJF C;  3HOU G;  2VQE Q;  4P71 A;  1HA6 A;  3I56 A;  1KDA A;  4R4C A;  4N9P A;  3ERS X;  1CTM A;  2WB1 G;  1GUT A;  1U4R A;  1PRT D;  1N34 Q;  3KK7 A;  1TWG B;  4Z9C B;  3M7G A;  2AQ3 B;  1LTA D;  3R3O A;  1EIF A;  2E5L L;  2R6G A;  1KL9 A;  1DOL A;  2KHS A;  5JAV A;  2CQA A;  1SFO B;  2O5J C;  3S1M H;  5C4J H;  1IKM A;  1LTI D;  1VQB A;  3JAM E;  3LWU A;  2R3Z A;  4KKS A;  3A8J E;  2WIN B;  5NUC A;  2AQ1 B;  1VQF A;  5FLM H;  3CCE A;  5J39 A;  1XWE A;  4LFA L;  1PYS B;  4IUP A;  4ODG A;  4GOP A;  1PH1 A;  2IY5 B;  4MNO A;  2NN6 I;  3I90 A;  3S9W A;  3NTI A;  4BBR H;  1SXT A;  5C44 H;  2F3I A;  5FLX E;  1QNK A;  2Z6K C;  1H9J A;  3TZU A;  3NK9 A;  4L5Q A;  1N34 L;  4FF1 A;  4JI7 Q;  3FP9 A;  3TQY A;  1WTP A;  1VDZ A;  3J81 E;  2A68 D;  3CPF A;  4IPG A;  1Q86 C;  1AZQ A;  1ZYR C;  2K28 A;  1BBX C;  1YVC A;  3JAM L;  4CKE A;  3S17 B;  5JJL A;  2ZJQ A;  2PYK A;  4QGU A;  2WAQ G;  3K8A A;  4X66 Q;  3M3Y H;  3TBI B;  2JA9 A;  3RN5 A;  3HOX B;  3J7A 5;  4LF9 Q;  3EBE A;  2MP1 A;  3ERO A;  1NE3 A;  1WTW A;  1CSP A;  5FLX L;  1D1K A;  3PUZ A;  1LT3 D;  1VQ8 A;  1EWC A;  2ZXO A;  1PH4 A;  3J81 L;  3DM1 A;  3PO2 H;  5IYD H;  3GTG H;  1ESF A;  3HOZ B;  3OWF A;  1I3Q B;  4GLA C;  4HMJ A;  5I2X A;  3BVG A;  4GKJ Q;  1RL2 A;  1VQC A;  4X3U A;  4K8I A;  3IKJ A;  3K57 A;  4AQY Q;  5IP9 H;  3P75 A;  1KNE A;  3Q8D A;  3DUZ A;  5D14 A;  1A63 A;  3S1R H;  2UUC L;  1XMQ Q;  4KV6 A;  1LAB A;  1D7Q A;  1I4G A;  4BY1 H;  2K5N A;  2N49 A;  1JOR A;  4A76 A;  4KN4 C;  2KEC A;  2I5L X;  2H4O A;  3KYH C;  5IOC A;  2VUM G;  1YNJ C;  4X66 L;  3PO3 H;  5AJ3 Q;  3RLN A;  4A3I G;  2JEA I;  3U58 A;  4JI1 L; 
#chains in the Genus database with same CATH homology
 4M1U B;  4A3K B;  2G9D A;  5EGT A;  1QCB D;  2HDM A;  1O7L A;  2A6E C;  3F2U A;  1MSH A;  1PRT F;  5CV4 A;  1IW7 D;  3FEW X;  2R92 B;  4PMW A;  1EYC A;  2XRS D;  3WOE A;  4FNF A;  2EY5 A;  5KEE A;  1SJH D;  4KJN A;  5IT9 E;  4TQU S;  4BA2 I;  4KK7 A;  3HRZ C;  4ABN A;  2F0W A;  2EYL A;  3S2D B;  5E1F A;  1FR3 A;  1F9S A;  1DOM A;  3NBH A;  1U9R A;  3MC0 B;  2IW3 A;  3W2D A;  4KHZ A;  2XSC A;  4DAP A;  2DNC A;  1PYW D;  2XN9 C;  1MGS A;  4C1N I;  2B63 B;  3HGB A;  4ME5 A;  4QMG A;  5KND A;  5M5X B;  2K04 A;  4OIK A;  4BY7 B;  5EKI A;  5CC4 A;  1LTS D;  3NTH A;  4XTC S;  2BCO A;  4F88 A;  2L4N A;  5FO9 B;  3TP7 A;  4OO1 H;  3CHB D;  5T1I A;  5DM6 3;  4QB4 A;  4V0B A;  1HCZ A;  5I9O A;  2B2U A;  4ILW A;  2MUY A;  1MBY A;  3IAY A;  4C3I B;  3E6Z X;  4BA1 I;  1RTN A;  4H44 C;  2B2W C;  3D4R A;  1GUO A;  2MHV A;  3C1E A;  3D6W A;  3PIO 3;  3K6O A;  2PNR C;  2F0M A;  2PZW A;  1BOS A;  3GTO B;  5FO8 B;  4C2M B;  4KHV A;  5C0X G;  4HED A;  1TWF B;  3PUW A;  3VA7 A;  3K5N A;  1SNM A;  2D2C C;  1WCM B;  1DD2 A;  2EJM A;  3IFD A;  1D2B A;  3A8I E;  3VYT A;  1O7Y A;  2KCN A;  2D5D A;  1BXT A;  4K8J A;  4WOR A;  3H3V C;  1HFN A;  3BZD B;  3NPP A;  3ERQ A;  2F0D A;  4ZAI A;  3VYR A;  3MXU A;  4DNR B;  4UDU C;  3I4N B;  1CM9 A;  2K05 A;  2R61 A;  1PMR A;  1V43 A;  3I73 A;  1WD1 A;  2B2T A;  3BYT B;  2QIL A;  1LO5 D;  5CMD A;  4IAL A;  2DY7 A;  1SYE A;  4U67 3;  2BE5 C;  5CYU A;  3HOY B;  1YNN D;  1QNU A;  2JXM B;  2HUG A;  1I6V C;  1TWC B;  3L3O C;  1Q1B A;  4DF7 A;  4TKO B;  1D6E C;  1I4Q A;  2OEO A;  2C9O A;  1G8Z D;  1TS3 A;  1EFI D;  2F0I A;  2NVT B;  2F0P A;  1PRT C;  3QWN A;  1ILQ A;  4R8I A;  4F8M A;  3KLS X;  5M9O A;  5DAU A;  1CT1 D;  5KRU A;  1GOZ A;  2F0L A;  3SK8 A;  3A7L A;  2NVX B;  5ELD A;  1H9R A;  2FFK B;  5TSS A;  1KAA A;  2L0C A;  4TRD A;  2FIN B;  4I65 A;  1NR4 A;  2F1M A;  3K5O A;  5ELE A;  1LTT D;  3SXH A;  2ENB A;  1AEX A;  4FF3 A;  1SEB D;  3C2P A;  3TN2 A;  4L6T B;  1CK1 A;  4NDX A;  2RVL A;  3NQT A;  1B9M A;  2A68 C;  1H9M A;  4BWG B;  3K0Y A;  2B2Y C;  4A3E B;  3VYU A;  2Z1C A;  3H91 A;  1T5E A;  5D3D A;  3NQI A;  1DYQ A;  4C3J B;  5KNB A;  1OO9 B;  1SDF A;  4HAE A;  1J9O A;  3MAQ A;  3J7Y W;  4QIW B;  1SSO A;  4RH6 A;  1BCP D;  1O78 A;  4AYB B;  2F0K A;  3QO2 A;  1EY0 A;  2KEE A;  3GTQ B;  4CHT B;  3EQL C;  1R4Q B;  4TSS A;  2Y0S B;  2M2L A;  5DM7 3;  3C1F A;  3M4O B;  1LTB D;  3C46 A;  4J6H A;  2E74 C;  3EA6 A;  5C3E B;  1HQM C;  5AFW A;  2LFN A;  4OL7 A;  1UUP A;  1WTR A;  3WOF A;  1A15 A;  5M5Y B;  1S5E D;  4IUN A;  4X3T A;  2EPB A;  5CGK A;  2B2V C;  3A8K E;  2VXW A;  4J8Q A;  2K32 A;  5IOD A;  2FMC A;  2OF1 A;  4UAI A;  3HG9 A;  1A3V A;  4RHR A;  2WII B;  1GJX A;  1IW7 C;  5FO7 B;  3GTL B;  1PTO H;  5M5W B;  1LLR D;  2CVR A;  3HS0 C;  3QB3 A;  5JPM C;  1D1I A;  1SJE D;  4K2L A;  1ILP A;  2F0V A;  1JOO A;  3DHQ A;  1H9K A;  5IGG A;  3I8Z A;  5EJW A;  2EYO A;  1DM0 B;  1U4P A;  1ZEQ X;  1EQT A;  1STH A;  1QOH A;  3X3M A;  2RQX A;  1FNW A;  2BDN A;  5D65 A;  3KUP A;  3S2H B;  2IPK D;  1SBB B;  4K6D A;  4EQO A;  4DGZ A;  1F9Q A;  2F4I A;  5COY A;  3D31 A;  1CHQ D;  1LT5 D;  2JSO A;  4C3H G;  5JOB A;  1ZKO A;  3Q23 A;  2K7V A;  2ICI A;  3HOU B;  4EVO A;  4EGV A;  4K2K A;  5DNF A;  3GTM B;  2F0E A;  2Q8I B;  2KUM A;  3MTS A;  4HR7 B;  1CQF A;  3HOW B;  4CKB A;  1HFG A;  1QJO A;  4IUU A;  5HGT A;  4B9W A;  1TS5 A;  4JBW A;  1PTO D;  1DON A;  2EJG C;  1B1Z A;  2WP8 J;  1NR2 A;  2E2J B;  2QF7 A;  2IJ0 A;  2NTT A;  1RTO A;  2Z4I A;  1U4L A;  2L11 A;  2PO4 A;  1VCI A;  2HDL A;  3R2T A;  1A3T A;  4RGO S;  1GUN A;  3MWY W;  3K7A B;  3T16 A;  1XXG A;  2VB2 X;  2XWJ B;  4M8A A;  1BO0 A;  1KAB A;  2NN6 H;  4EQN A;  3T4A C;  5KGU A;  1F9P A;  5E4W C;  2K5Q A;  4K14 A;  5FK9 C;  5K36 G;  1KLU D;  1PRT B;  2BA0 A;  4XYQ A;  4Q0F A;  1L0Y B;  2A69 D;  1TVX A;  1PFN A;  2RDF A;  2RDH A;  1FGB D;  4XT3 B;  4RKB A;  4OHJ A;  3NBI A;  1EU4 A;  5I9P A;  3OOC A;  1OXS C;  3TME A;  2EYF A;  5C4H A;  3DEP A;  1G91 A;  1KDB A;  2FJ2 A;  2EYH A;  4CJ0 B;  1X32 A;  4IUT A;  3IL8 A;  4JK1 C;  2NBF A;  1Z47 A;  5C3W A;  1Y8N B;  3NUC A;  1SYF A;  5M3F B;  2PCF B;  4XYO A;  1QB5 D;  1C4Q A;  4A3I B;  1YNN C;  3I91 A;  5JEA J;  4DN4 M;  5C4Z A;  1V1P B;  5C0X H;  4IZ8 A;  3S16 B;  1E2V A;  2PPB C;  2K1B A;  2CW0 D;  3ND8 A;  1EQV A;  1S5B D;  2J4X A;  2SOB A;  1WTV A;  1R9T B;  3M7N A;  1T5X D;  5KIX A;  2SDF A;  3G7L A;  2JA6 B;  4FXD A;  1KNA A;  4MHE A;  3V2T A;  2YYZ A;  4WJW A;  1WTX A;  5C5M A;  1SNC A;  1JC7 A;  2N55 A;  5ELB A;  4FXK C;  4YIJ A;  1NAP A;  1PTO F;  2IL8 A;  4NP5 A;  5I6W A;  1PZI D;  4A3M B;  3LNN A;  1B53 A;  3D6C A;  1Z7T A;  4RCO A;  3URY A;  1DZ1 A;  2AUK A;  1OXX K;  2PZU A;  2IWH A;  3HEJ A;  1G6Z A;  3S1M B;  2F03 A;  5C4J B;  3SR1 A;  4XXE A;  1C48 A;  3SHL A;  3FMC A;  2QEJ C;  5IGE A;  1G29 1;  4DFA A;  4PMC A;  4IFD I;  1TR5 A;  1Q3L A;  4BBR B;  2LY7 A;  5BN4 A;  1GHK A;  5C44 B;  4G7O C;  3OSO A;  3H94 A;  1VMP A;  1SAP A;  2X6G A;  1ROD A;  2NZ1 D;  2L5T A;  1BCP C;  2C5C A;  3GTK B;  2F0G A;  3SVM A;  5IT9 L;  1SYB A;  2NN6 G;  4LJZ C;  4CGY B;  2SEB D;  1HTP A;  1IL8 A;  1RHP A;  4G7Z C;  3M3Y B;  4OIJ A;  3RD4 A;  2A5H A;  2QCP X;  2NWG A;  3KBG A;  3NP8 A;  1OXT A;  4WRD A;  4R9W A;  3N6R A;  2K01 A;  5J1Z A;  1BF4 A;  2B2U C;  1QG7 A;  3K59 A;  5JVG 3;  4FYD A;  3PO2 B;  4DXF A;  1JWS D;  4ZKC B;  2XNA C;  3W3A A;  2K5W A;  3N52 A;  5CV6 A;  1LV9 A;  1XX8 A;  1EY8 A;  1F2Y A;  3S1R B;  3MHB A;  4OO1 I;  4BY1 B;  1Y8O B;  1I4R A;  1S5F D;  2A74 C;  1PLF A;  3PO3 B;  3V96 A;  1H9S B;  3HZX A;  1B2T A;  5EBD A;  4XDX A;  1EZ8 A;  2ZT9 C;  1PXU A;  5JVH 3;  2EDG A;  3DWP A;  1EYD A;  1STA A;  4X3K A;  1V1O A;  1TKW B;  4PMB A;  1W6K A;  3S15 B;  5JEA H;  1HUM A;  3T51 B;  1FNU A;  2EOT A;  4A3B B;  2R7Z B;  2F0Q A;  2K33 A;  4ZUJ A;  3MXG A;  2EY6 A;  4BBS B;  3S1N B;  4DAY A;  1EEI D;  4C1N K;  4CJ1 B;  2B2T C;  3H0G B;  1KTK A;  2NUC A;  1B44 D;  1CHP D;  2IX3 A;  2JYO A;  1J8I A;  1G2T A;  4J1M A;  1MSG A;  1A2U A;  2PMZ B;  1JWU D;  3DEO A;  3J80 E;  3KLR A;  1O7Z A;  3IFT A;  1JWM D;  2XVS A;  1CQV A;  1PTO C;  4BS9 A;  1JCK B;  1AP0 A;  4HSV A;  2EY1 A;  4KTA A;  1EY6 A;  3GV3 A;  3AMU A;  2DY8 A;  4KY7 A;  3I72 A;  2E75 C;  1DCZ A;  3K5M A;  3J80 L;  3DMU A;  3I4M B;  3BYY B;  1PFB A;  4KI0 A;  2G9H D;  1CZG A;  2DN8 A;  3OW7 A;  1SMY D;  4HCS A;  4H0L C;  4LAA A;  4ZKB B;  2SNM A;  1SND A;  4B9X A;  2E2D C;  1GXD C;  1GHJ A;  1PZJ D;  4B08 A;  2OXP A;  2VNU D;  2MJ8 A;  2F0H A;  3EFX D;  1TY2 A;  2L55 A;  2KJX A;  1IYU A;  4L63 B;  5ISR A;  4N9T A;  4NMZ A;  3QIA A;  2N88 A;  4QUF A;  1UEA B;  3TDQ A;  3V05 A;  3BS1 A;  4G4K A;  5DEH A;  3BDL A;  1JQY D;  5CR3 A;  4MN3 A;  4LK1 C;  3MVV A;  4I7Z C;  3P20 A;  5FKA C;  3BVZ A;  4PV1 C;  3PUX A;  3MEH A;  2B2Y A;  4XQN A;  4IQZ A;  4GZY C;  4RAU C;  5JEA G;  2J7Z A;  1S5C D;  5I4D A;  3MFY A;  4V19 0;  2CW0 C;  1K8O A;  4RGT A;  3E0J A;  1OXU A;  1BR9 A;  1BCP B;  4IN3 A;  1STB A;  3GP7 A;  4KY6 A;  4K6L A;  1FYC A;  2D62 A;  2D9U A;  2E76 C;  4LMQ D;  2ZXP A;  3OWE B;  5EKL A;  5K36 H;  1Q90 A;  2PZT A;  2K5D A;  4ZYS A;  3SK5 A;  1Q12 A;  3GO5 A;  2TSS A;  2XRQ D;  2WKC A;  2F0J A;  3A7A B;  3Q6S A;  3LWE A;  2JP1 A;  4Q5V A;  4HSP A;  1BQQ T;  3A56 A;  1RJT A;  5CV9 A;  5C6A A;  3RZD B;  1TT2 A;  4E6I A;  3HKZ B;  1ESR A;  2F0S A;  3TZD A;  3D4W A;  3OMG A;  3SK6 A;  3T53 B;  4C3H B;  5KYI A;  4C56 C;  1VMC A;  2F0O A;  4HTH A;  3MXN A;  5CBA E;  1F2L A;  5F2D A;  1EY9 A;  4U68 A;  3GQB A;  3MXP A;  1ET6 A;  3CRK C;  4IUV A;  4KMU C;  1SYG A;  1XTC D;  3S14 B;  1GUS A;  2LKV A;  1JR0 D;  3P1H A;  1JOK A;  3SE0 A;  1CFM A;  3CU7 A;  4KD4 A;  3D8G A;  2MPM A;  1WTQ A;  2EYM A;  5EBC A;  2MGS A;  4HCE A;  2WB1 B;  4IFD J;  5A35 A;  1I4X A;  1BCP F;  1E2W A;  1Y8P B;  1LTG D;  5KNC A;  2LS0 1;  2A6H D;  4ULL A;  3T13 A;  3P7J A;  1SYC A;  2NB0 A;  2K6A A;  2AUJ D;  1VF7 A;  1Q1E A;  3AB9 A;  2F0F A;  1KLG D;  1TS4 A;  1H9S A;  2HCC A;  1A6X A;  2ID0 A;  2HQE A;  3ZYY X;  4CKC A;  5IGF A;  1EU3 A;  3NWT A;  3S1Q B;  3CQZ B;  4K5W A;  1AFP A;  2KQ3 A;  3VA5 A;  2AQ2 B;  1V8Q A;  1PTO B;  3EJI A;  5ELF A;  2NYZ D;  4X3S A;  1BDO A;  2BDO A;  2TMP A;  5IGB A;  2WV6 D;  4RWS C;  4RA8 A;  4CBV A;  2WAQ B;  1VF5 C;  4G7H C;  3T56 B;  2QKI C;  3DWQ A;  1F2Z A;  1BNZ A;  3MZ5 A;  1D5Z C;  1F2M A;  3ND9 A;  1WTO A;  3FVQ A;  4DA2 A;  2LMC B;  1TWA B;  3A54 A;  1EL0 A;  1PFM A;  4K5X A;  2O5I C;  1Y69 U;  4O42 A;  5ELC A;  3OIQ A;  1JOQ A;  2RBM A;  1DXM A;  3MA2 B;  3G6J B;  5E3F A;  1Q8I A;  5EKK A;  2VUM B;  1K83 B;  3M85 A;  3OHX C;  4O1N A;  1HUN A;  1SNQ A;  2AWO A;  4FF4 A;  5I6Y A;  1UNS A;  5IGC A;  5M3M B;  3Q22 A;  4ZUI A;  1C8C A;  2HCI A;  1UAP A;  4A93 B;  1FD7 D;  3X3N A;  3FDT A;  1EIH A;  5C3X A;  5CV7 A;  2E2H B;  1ENA A;  1M4V A;  2QDB A;  3C3L A;  1SMY C;  1TU2 B;  4DK1 A;  3FRP B;  5C0X I;  1F77 A;  4R8N A;  5J22 A;  4F87 A;  2K03 A;  1GUW A;  2O2L D;  4FXG C;  2IX1 A;  3PUV A;  4RGM A;  3TSS A;  1B3A A;  1RCV D;  4KJO A;  2Z4H A;  5EQ0 A;  1DOK A;  3K58 A;  5FOB B;  4IFD H;  1LTR D;  5LL6 X;  2WKD A;  1Z6H A;  4MIU A;  2VB3 X;  1TS2 A;  2X6L A;  2X69 A;  1AZP A;  3A55 A;  2JEB I;  2B8F A;  4KN7 C;  1TQO A;  3QJY A;  4DAV A;  2F0T A;  1TII D;  5CV8 A;  3UI2 A;  2RSN A;  5EPL A;  3J7A F;  4DU9 A;  3I70 A;  2FHT A;  1ONL A;  3K5L A;  1D5X C;  1EY4 A;  5HUR A;  1SNP A;  3DXJ C;  1SE4 A;  2RDG A;  1ENF A;  2EYP A;  4F7X A;  3NTK A;  3RLF A;  3BDO A;  2ICE C;  2JA8 B;  1EWH A;  3NHH A;  1RKN A;  2IT1 A;  1SE3 A;  3GTG B;  1A3U A;  3VR2 A;  1HHV A;  1XYI A;  4A3J B;  4NKL A;  3KF8 A;  2F3V A;  1AW7 A;  4KY5 A;  2RSO A;  4ZLT F;  4RHS A;  1RF2 D;  2DNE A;  4L8J A;  2OT2 A;  5JJZ A;  2NVY B;  3GV6 A;  1G2S A;  2L12 A;  5CV5 A;  4FF2 A;  1A2T A;  1R4P B;  2Z8L A;  5IIF A;  2XIW A;  4QUC A;  3I4L A;  4HMI A;  3VYS A;  2L1B A;  2B2W A;  1TY0 A;  3L7Z C;  4ZRZ A;  1ET9 A;  2EE1 A;  3I3C A;  1STY A;  1NUC A;  1BUV T;  2KED A;  1WVL A;  3RMH A;  1HPC A;  5E4X A;  5C5L A;  3OIP A;  5I2Y A;  5D3I B;  4IUQ A;  5CBE E;  4C3I G;  2WAC A;  4PNY A;  5LHY 1;  4HN7 A;  4P2C B;  3L9A X;  3Q0A A;  3HP3 A;  2SNS A;  4KKU A;  3BVM A;  3FPP A;  2EYJ A;  1O80 A;  1STG A;  1HA5 A;  3BG3 A;  3M4Y A;  5COR A;  3D3R A;  5IGD A;  1I50 B;  2M00 A;  3DWA A;  1MD2 D;  1QIL A;  2I46 A;  4ZQ3 A;  3H09 A;  3PV0 A;  3LX0 A;  4IFD G;  4XQQ A;  2PW5 A;  3ONA B;  1WD0 A;  2A6H C;  1ZYR D;  5EPK A;  2V4D A;  5KYL A;  3KBX A;  3E5S A;  4KD3 A;  2BA1 A;  1TWH B;  3QG1 A;  1JB3 A;  2PQE A;  3HOV B;  4H13 C;  1W6J A;  3R8B A;  5K5P A;  2O4X A;  1ZXT A;  4QCL A;  3AU7 A;  2EXZ A;  1Y1W B;  4G57 A;  1X3P A;  4FO2 A;  3SK4 A;  5BN5 A;  1ICW A;  3QOJ A;  1EY5 A;  2IX0 A;  3J7A V;  2KCC A;  1E0B A;  4DXG A;  1E2Z A;  3VR5 A;  2KA7 A;  3CKI B;  2I07 B;  3RUZ A;  1B4O A;  4NW2 A;  2L9H A;  1K8M A;  4H7B A;  2A69 C;  2KVM A;  1SE2 A;  1YNJ D;  4OO1 G;  3VR4 A;  1F9R A;  4RGN A;  4QF4 A;  2E2I B;  4K5V A;  1CA6 A;  2CHB D;  2B39 A;  1LAC A;  2A6E D;  1CA5 A;  1I4H A;  1KDC A;  1CI3 M;  5A2Q E;  1I6H B;  2Q8R E;  2M9V A;  3R2I A;  2F3W A;  3U9S A;  4RKL A;  2JA5 B;  1CZW A;  3OPO A;  1PZK D;  4ID6 A;  3SEB A;  3VR3 A;  1JE4 A;  5T1G A;  3D4D A;  1STN A;  1IYV A;  1M8A A;  1V1P A;  4ZK9 B;  1D5M C;  3FPU B;  1OXV A;  1EZ6 A;  4DK0 A;  1MI2 A;  1RD9 D;  1S5D D;  3NE5 B;  5A2Q L;  2ZXR A;  3EVQ A;  2Q8T A;  2JE6 I;  1NSN S;  3SDZ A;  4FP5 D;  3VR6 A;  2F0N A;  3QOL A;  1PDQ A;  1STE A;  2YU9 B;  1LT4 D;  5G3L D;  1EIG A;  3TP8 A;  4OGQ C;  4C3J G;  1IHZ A;  3GTJ B;  1EY7 A;  1SYD A;  3RZO B;  3PIP 3;  3TP6 A;  4RCN A;  4WFN 3;  5BN3 A;  2J0T D;  2H1E A;  2RA4 A;  4XIG S;  3CRL C;  3H6M A;  4Y7N B;  1LT6 D;  2GA4 B;  4S3S A;  1NCV A;  1JIC A;  2F0U A;  1B9N A;  1ML0 D;  4IUR A;  2B2V A;  1HRJ A;  1Y1V B;  2NTS A;  1HXY D;  3Q24 A;  2XWB B;  1B50 A;  3GD7 A;  4A3G B;  1AN8 A;  1HQR D;  5C0X J;  2R93 B;  1QWY A;  1ENC A;  3U9O A;  3WDN A;  1FNV A;  5LL6 S;  3OMC A;  4FVM A;  2AWN A;  1U4M A;  1EYA A;  1S4Z A;  4EQP A;  1L0X B;  2B8G A;  3MFG A;  3NWS A;  4RFB A;  2NVQ B;  2A73 B;  1II3 A;  1RDP D;  1QE6 A;  4XQJ A;  4A3F B;  3O13 A;  1I4P A;  4KKT A;  2FMM A;  2RKS A;  2PW7 A;  2EY2 A;  2EZV A;  3KLS A;  1EOT A;  3ITP A;  5C4X B;  2EVB A;  5JPN C;  3PUY A;  2KOL A;  4PQX A;  1IKL A;  2BOS A;  5EPJ A;  4A3D B;  1HTL D;  4DNT B;  1DJR D;  1SNO A;  3NXW A;  4XT1 B;  3PMF A;  3TP5 A;  3BDC A;  1GUG A;  2BE5 D;  3GTP B;  1X3Q A;  3FKI B;  3R93 A;  2JA7 B;  4CJ2 C;  3NSW A;  5G3L F;  1EEF D;  2EJF C;  1HA6 A;  1KDA A;  4N9P A;  1CTM A;  1GUT A;  1U4R A;  1PRT D;  3KK7 A;  1TWG B;  4Z9C B;  3M7G A;  2AQ3 B;  1LTA D;  3R3O A;  2R6G A;  1DOL A;  2KHS A;  5JAV A;  2CQA A;  1SFO B;  2O5J C;  1IKM A;  1LTI D;  3JAM E;  3LWU A;  4KKS A;  2R3Z A;  3A8J E;  2WIN B;  5NUC A;  2AQ1 B;  5J39 A;  1XWE A;  4IUP A;  4ODG A;  2NN6 I;  3I90 A;  3S9W A;  3NTI A;  1SXT A;  5FLX E;  1QNK A;  1H9J A;  3TZU A;  3NK9 A;  4FF1 A;  1WTP A;  1VDZ A;  3J81 E;  2A68 D;  1AZQ A;  1ZYR C;  2K28 A;  1BBX C;  3JAM L;  4CKE A;  3S17 B;  2PYK A;  3TBI B;  3HOX B;  2MP1 A;  3ERO A;  1WTW A;  5FLX L;  1D1K A;  3PUZ A;  1LT3 D;  1EWC A;  2ZXO A;  3J81 L;  3DM1 A;  1ESF A;  3HOZ B;  3OWF A;  1I3Q B;  4HMJ A;  5I2X A;  3BVG A;  4X3U A;  4K8I A;  3IKJ A;  3K57 A;  3P75 A;  1KNE A;  5D14 A;  3DUZ A;  4KV6 A;  1LAB A;  1I4G A;  1JOR A;  4KN4 C;  2KEC A;  2H4O A;  5IOC A;  1YNJ C;  2JEA I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...