2NVTH

Rna polymerase ii elongation complex in 150 mm mg+2 with gmpcpp
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
145
structure length
133
Chain Sequence
b'SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(*AP*AP*GP*AP*CP*CP*AP*GP*GP*C)-3'
publication title Structural basis of transcription: role of the trigger loop in substrate specificity and catalysis
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
total genus 21
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2006-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2nvtH00
5HY6A 4A3MG 4DV1Q 2WAQE 4J15A 4A3IG 1D8LA 4JBMA 3H0GG 2D0PA 4LFBL 1YI2A 2K14A 1IZ6A 3D31A 3JC66 4Y7NH 4LF7L 2C35B 4DUYQ 4JBWA 2JE6I 2Y0SE 3ER0A 4DV2Q 1FVIA 2K5VA 4EQ5A 2QEXA 5GAGC 5EAYA 1YZ6A 4DK3C 5GAEC 5C3EH 3HOXG 3DLLA 1L0WA 2ATWA 3BU2A 3K7AH 1KIXA 2NVYH 3EN2A 2ZJPA 5IY0A 1XPUA 3GO5A 1LYLA 4TQUS 4DUZQ 3RN5A 3UDFA 4JI8L 3OW2A 4JC0A 3RR5A 4BA2I 1TWGH 5IP7H 1K73C 1VQIA 1C9OA 1RL2A 4MNOA 2WAQG 4DV6Q 4IO9A 2XTIA 4DR1Q 1ASZA 2F4VQ 1J5EL 4NXNL 2UXCQ 4AYBE 2LXJA 5C3EG 1SLJA 2NVQH 1XMOL 2GN5A 4IPGA 4DR3Q 3K81C 3KJPA 4KHPQ 3KOJA 2DGYA 1L1OC 1S40A 3CW2C 1VQMA 3CCUA 2Q2TA 4LUVA 4A93G 1W3SA 1VQDA 1K83H 4JBJA 5IP7G 1SN8A 4GLXA 1X9NA 2JA7H 4DV4L 1RIPA 1O7IA 4DR4Q 3HOUH 4POFA 4HJ8A 2IT1A 3NENA 1I6HH 1YHBA 1Z9FA 2NZOA 4LF9Q 2N78A 4LFCL 2Q2HA 5GADC 4A3GG 3PUXA 2PNHA 5DLQE 4KLKA 4DUYL 3UDIA 4UP8A 2ZM6L 1IBMQ 4JBKA 4YY3L 3RLFA 3KDFA 4IJHA 4DKAC 1V1QA 1YVCA 1PH6A 3PF4A 1HNXL 3PO3G 3HOUG 4KHZA 3CCRA 1YJWA 4GNXA 1VQ9A 1KQSA 1B70B 4A3DH 4JV5Q 2YTXA 3S1QH 5LMNL 4DAMA 1BVSA 3M9BA 4GN5A 4IPHA 2A19A 2R7DA 1E3PA 3BJUA 5H1SE 1FGUA 3I56A 1Q86C 1HH2P 2NN6I 4X65Q 5AJ3Q 2ES2A 2BA1A 1JT8A 3CMAA 2JEBI 2ZJQA 4BY7G 1PYSB 1CKNA 2HT1A 1IBLL 1FJGQ 1YHQA 1UEBA 3A0JA 4A3DG 1VQ8A 4DV3L 4PZ8A 1SE8A 4AQYL 2OQKA 3PUVA 4LFAQ 4JI3L 4DR4L 1UE6A 2YTYA 2N8NA 4OO1I 1HR0W 3GTGH 1AE2A 3PV0A 4GKJL 5C44H 1N9WA 1V43A 4B3MQ 4GN3B 5JEAG 1VQNA 3B6YA 3M4QA 4X66Q 4K0KL 3F1ZA 3PIPA 1A62A 2R7ZH 2NZHA 1KHIA 2Z6KA 2OCEA 2KBNA 4OONA 3HOZG 2AKWB 3KDFB 2CKZB 1M90C 2AWOA 2UU9Q 4IOAA 2V1CC 3M4OH 1YBYA 2VQFQ 2PQAA 4DV0Q 4GNXB 5C44G 4YCUA 3CPFA 4P73A 1W2BA 1TWAH 1HZCA 1Q1BA 1VQGA 4APVA 2IX0A 1LUZA 4IFDG 4JV5L 2JA5G 2Q2UA 1U5KA 3Q8DA 3GTKH 1YIJA 3CC4A 1SMXA 2IX1A 4R4OA 2ALYB 4QQBX 5AJ3L 2JJQA 1P8LA 3M85A 3MEFA 4X64Q 1M1KC 2FXQA 4A3LG 4DV7Q 3KF8B 1JB7A 1CKNB 3CXCA 3NEMA 3I4MG 1SR3A 4IPDA 1K9MC 1HNZL 1IYJB 4TVAB 2D62A 1N32Q 3A74A 2B63H 2QA4A 4A4IA 1PH2A 1PH8A 4JI0Q 1Y1VG 4GS3A 3F2CA 4JI7L 2OWOA 3PUZA 3TRZA 2RF4A 4B3ML 3CAMA 4LF6L 3CC7A 2HQLA 2MO1A 1P16A 5BR8Q 3CD6A 5IWAQ 1K8GA 4C3HH 5C4JH 4JYAQ 1JJ2A 2UXBQ 1XTDA 4QL5A 1YHAA 2I5LX 3FP9A 3STBC 1K0RA 3CF5A 4A3FH 1PA6A 2B63G 1CSPA 2ZTDA 4X62L 1N33L 2PQAB 2CWAA 2VQEQ 4DV0L 5M5YH 1YJ9A 3G48A 2PMZE 1NMGA 4LF4Q 1VQFA 3I4NH 1HJPA 1GD7A 3BZCA 1TWHH 1Y14B 4R4QA 1N34L 1X56A 2WB1E 1EUJA 4B3TQ 1LTLA 4A3FG 1OXUA 3PSIA 3RZDH 2XGTA 3UE0A 4DR2Q 4FDBA 4X64L 5GAHC 4JI1Q 2AHOB 1JJCB 4DV7L 4OWWB 1VQOA 1D7QA 3EIVA 4HIOA 4EX5A 3TQYA 1Q81C 1PH9A 4DNIA 1N36L 2VNUD 3OYYA 1K8AC 2L15A 1QUQA 2ID0A 1E1OA 5FLMH 3I4NG 1Q46A 1VQHA 3K80C 2JQOA 1N8RC 4POGA 2JA6H 1HR0Q 4LUZA 4DV5L 3FHWA 1MKHA 3K8AA 4C2MH 4GLAC 4OO1G 4P72A 2Y0SG 5M5WH 4LF5Q 2EIFA 5FLXc 3PGZA 1XJVA 4A3EH 4UPAA 1I94L 2CWPA 3M3YH 2QGQA 3K7UC 1S72A 1JE5A 4BA1I 4B3RQ 1MIUA 4JYAL 5FLMG 1X65A 2CQOA 2F3IA 4XIGS 2JA6G 1SROA 1YEZA 5ELOA 4NXML 1L1OA 1PFSA 2ZTEA 4YWKA 3UDGA 3S1NH 1VCIA 4DV1L 3U4VA 1EQQA 1VQ4A 3I4OA 1JMCA 5JEAJ 3STBD 4BBRH 3U4ZA 3HOWH 4AYBG 4HIKA 4ME3A 3L0OA 4A3EG 5LMUQ 2PI2A 2YYZA 2UXDQ 4DV2L 1YITA 2HHHQ 4UY8C 3KFUA 3T1YQ 2JA7G 5IYCH 1MJEA 1Y1WH 2K52A 3MXNB 4DR7Q 1XNRQ 1N33Q 4GOPC 4JG2A 4LF8Q 1X3FA 4JI2Q 2E8GA 3FKIH 2A1AA 4KI0A 2HIVA 3PIOA 4DUZL 1OTCA 2I5HA 3E9IA 1SFOH 4IFDJ 3HOWG 3AEVA 4BBSH 2WFWA 5M3MH 1QZHA 3J81c 1KC8C 1EFWA 4DR5Q 1QUQB 2N3SA 2KENA 4DV6L 3ULPA 4DR1L 2F4VL 2UXCL 1C7YA 4YWLA 5IYCG 5J3BA 1Y1WG 1LM0A 3J81i 1CUKA 1UE5A 2K75A 4DR3L 4KHPL 2EQSA 3S1RH 4YWMA 3FKIG 3AQQA 4QY7A 3S17H 3S1MH 1Q12A 4BBSG 5C0XI 3S24A 5M3MG 1XMQQ 3H3VI 1VQBA 1WOCA 4P74A 4B3SQ 3RN2A 3S2DH 2K5NA 1L1OB 3ERSX 1B8AA 4LF9L 2ZTCA 3CQZH 4P75A 3SGIA 2VW9A 1G291 1GVPA 3TS2A 2R93H 2GVAA 2MQHA 4OX9Q 2VL6A 2NVTH 1OXTA 1KAWA 4JI4Q 5ELNA 1IBML 2HHHL 4HIDA 2A8VA 4DR6Q 2BH2A 3GTQH 3JAMc 3A5ZB 1XNQQ 1WCMH 3ZJYC 3CC2A 4DR7L 3PUYA 2HIXA 3LGJA 2K50A 1EQRA 5IYBH 2E5LQ 4H02A 4LW1A 1L2FA 3JAMi 4BXXH 4GKKQ 2IHEA 3T1HQ 2R7FA 1K3RA 2R7ZG 4DR5L 2OTJA 2B3GA 1PVOA 4O2DA 1HZAA 5IYDH 1FL0A 4X65L 4JI5Q 3RNUA 3BZKA 1A8VA 1KL9A 1CSQA 1TWCH 2MO0A 4A3JH 4WJ4A 4L5RC 2AWNA 2KHIA 1FJGL 4YHHQ 1WJJA 5IYBG 2UUCQ 3GTOH 1PH7A 4L5TA 4AH6A 1PH3A 4R1JA 3HKZE 1NE3A 4JOIC 1XMQL 4LFAL 1X6OA 1AE3A 1Z47A 3U58A 5IYDG 4B3SL 4P71A 1I5FA 1IBKQ 4LF7Q 1SRUA 4IOCA 4A3JG 1C0AA 1A0IA 3PF5A 4LWCA 1E1TA 1BBUA 1GKHA 1OXSC 4X66L 4OX9L 5C4XH 1BBWA 4NPSA 2I5MX 4XTCS 5GROA 2E2JH 1WI5A 4QJFA 4JI4L 3W1BA 5M3FH 2UU9L 4JI8Q 1XPRA 4MTNA 4QIWE 1S3OA 2VQFL 1VQLA 4OXPA 4AIMA 1J5EQ 4GKKL 4L5SA 5C4XG 2F52A 3T1HL 1X55A 4LUOA 3A5UA 4DPGA 1XMOQ 2Q2IA 4A3IH 1Q7YC 1VQ7A 1CKMA 2I0QA 2IY5B 1Q8KA 3PCOB 2YU9H 2NN6G 3H3VH 2VZAA 4A76A 4BY1H 2UUBQ 2RCNA 4HJ9A 1MJCA 2LXKA 3KF6A 4YHHL 4PG3A 1B7YB 4A3KH 3CCMA 1VQ6A 5C0XG 1N32L 1HZ9A 1CKOA 3GD7A 4IJLA 4LFCQ 3HOVH 3OTOQ 4JI0L 1WYDA 1IBKL 2GVBA 3UE1A 5GQOA 3K0XA 1GM5A 1WFQA 1AH9A 2PI2E 2ZM6Q 4JI6Q 3KLWA 4BY1G 3U50C 4YY3Q 4GN4B 2WB1G 3PO2H 5BR8L 4A3KG 1HNXQ 3GTLH 5IWAL 3S2HH 2R92H 2UUAQ 4PZ6A 1OXVA 1TWFH 4RMFA 1UWVA 2UXBL 2ASBA 4IFDI 3ICEA 3F2BA 4R4TA 1V9PA 5IT9c 3DM3A 3I2ZA 3TS0A 3HOVG 1EOVA 4A93H 5LMNQ 1VQKA 4QGUA 1BKBA 3UDXA 2VQEL 3M4PA 4YCVA 3GTJH 3PO2G 4LF4L 2E2IH 3J7A5 1PH5A 2R92G 2MFIA 3HOYH 4OWTB 2AMCB 4UP7A 1IBLQ 4B3TL 4A3GH 1VQ5A 2OTLA 1UE1A 1J6QA 4DR2L 4YCWA 4DV3Q 4A3BH 4Y52H 4JI1L 2UUBL 4AQYQ 2IHFA 3KF6B 4BBRG 3PO3H 4JI3Q 1G6PA 3TREA 2VUMH 3ULLA 1NMFA 2JA9A 3AYHB 4OWXB 1PV4A 4GKJQ 3EBEA 3CCQA 1DGSA 2ZJRA 4GOPA 3HOYG 3CMEA 3VDYA 4IPCA 1HR0L 3G71A 3J80c 3OTOL 4GNXC 4K0KQ 1EYGA 3G4SA 4LF5L 3HFZB 1PH1A 4A3BG 4C3IH 1VQJA 4JI6L 4HJAA 3ULJA 3CCLA 1QZGA 1NTGA 3J80i 1PYBA 2Z0SA 3F8TA 2VUMG 3M7NA 1E24A 2KCMA 3CCEA 2UUAL 3WWVA 4B3RL 1HNWQ 4BY7H 4R4IA 2K5HA 4UP9A 2R6GA 1Q1EA 1NJIC 2EXDA 5K36G 1EWIA 3S15H 2JA8H 1KRTA 4O0AA 5E7NA 2MNAA 1HZBA 3NBHB 5IE8A 5JJLA 5LMUL 1VQAA 2UXDL 5HGQA 1GO3E 3E0EA 5JJIA 2DUDA 2K4KA 4GLVB 3T1YL 3S14H 3HOZH 1X3EA 4MZ9A 1IXRA 1XNRL 2VY3A 3W5OA 1VQPA 4JCVE 2RHSB 5LMNW 1KD1C 1NBWA 4JI2L 1HNZQ 4LF8L 2R93G 2JA8G 2JEAI 1U0LA 2Z6KC 4JI7Q 3S16H 1G51A 3RLOA 4GOPB 1OXXK 1E7ZA 1VQEA 1XPOA 3CCSA 4LF6Q 4HJ5A 3GTMH 1WCMG 2JA5H 1UE7A 2KCTA 3NELA 1YJNA 1PHJA 2YTVA 3KYHC 3G6EA 1I50H 5FJ8H 2NVXH 4BXXG 1X3GA 2YV5A 3RZOH 2BH8A 3L2PA 1EIFA 3H15A 3I55A 4A75A 4A3LH 3PUWA 1NY4A 4NB3A 4X62Q 2WP8J 5C0XJ 3KJOA 1KRSA 1VQCA 1TXYA 2H5XA 3IRBA 4LFBQ 4PZ7A 3D0FA 3HKSA 3I4MH 1E22A 2RHQB 3CPWA 4R4CA 2JK8A 1R9TH 1EIYB 1N34Q 2OQ0A 4PMWA 3CCVA 1A63A 5FJ8G 3E9HA 4JOIA 3CCJA 3F2DA 1KXLA 1Y1VH 1QVCA 2N49A 1X54A 1H95A 3GTPH 4DR6L 3TEHB 1T9HA 1XNQL 3AFQA 1ASYA 3CP0A 1N36Q 2E2HH 2VS1A 1Q82C 3HKZG 4A3CH 1HNWL 4WJ3M 2E5LL 4NXNQ 4X6AH 2D0OA 4ALPA 4DK6C 1IL2A 2LSSA 5IP9H 4DV5Q 4DAYB 3L7ZC 3I7FA 4HIMA 3GDEA 4A3MH 3RLNA 3J81j 1PH4A 3H0GH 4C3JH 5M5XH 1QVGA 5M3FG 1JJGA 2CCZA 4JI5L 2KHJA 4HJ7A 1I94Q 4LNQA 1VS0A 4A3CG 1YNXA 5JJKA 1QVFA 3AFPA 4DV4Q 2BA0A 4RG1A 3HOXH 4L5QA 2B29A 3J7ZC 2UUCL 4NXMQ 3W1GA 1I3QH 2CFMA 5IP9G
chains in the Genus database with same CATH superfamily
1A3VA 5HY6A 4DV1Q 4A3IG 3ERQA 3D6CA 2ICIA 2O4XA 1FR3A 4LF7L 4JBWA 4DU9A 2Y0SE 4EQ5A 5GAEC 4DK3C 1YZ6A 5C3EH 1T5XD 1KIXA 3E3XA 1K3BC 3GO5A 1LYLA 4TQUS 4DUZQ 3RN5A 1KDCA 2CH4A 2F0PA 2WAQG 5C6AA 4DV6Q 1PMRA 4K8JA 5KNDA 4DR1Q 4NXNL 2LXJA 3NTKA 1Y8PB 4DR3Q 1MBYA 1L1OC 3CW2C 1GUOA 1W3SA 3C3LA 3GTOB 3EVQA 1K83H 2TSSA 1RCVD 1O7YA 1F2LA 2HQEA 1CM9A 5ELDA 4X3UA 1LLRD 1SYEA 4POFA 4HJ8A 2NZOA 2Q2HA 5GADC 1BUVT 4DUYL 4H0LC 1IBMQ 3RLFA 4DKAC 1V1QA 1YNJD 3PO3G 2WINB 4PMBA 1B70B 4DK0A 4JV5Q 5LMNL 3T16A 4IPHA 2A19A 2R7DA 3OSOA 1Q86C 2NZ1D 3BZDB 4ZYSA 4IUUA 2JEBI 4IUQA 4BY7G 2JXMB 1HHVA 4A3KB 3NP8A 1RF2D 2L12A 4DV3L 1SE8A 3X3MA 4JI3L 3HOVB 1WTOA 1AE2A 3TZDA 2L55A 1D5XC 5C44H 1N9WA 1ESFA 1V43A 5I9PA 5JEAG 3M4QA 4KJNA 2HCIA 2RVLA 4K0KL 3GTLB 3PIPA 2R92B 3HOZG 2Z6KA 3V96A 4ULLA 2V1CC 2RDFA 1DZ1A 3T4AC 3AU7A 4BBRB 1VQGA 2Q2UA 2E2IB 1U5KA 1NAPA 2IX1A 1F9SA 3HOYB 1ICWA 3MEHA 5FO8B 5AJ3L 1P8LA 3M7GA 1IHZA 1JB7A 3CXCA 3NEMA 1SR3A 3VR4A 1ZKOA 1Q8IA 4IN3A 1DM0B 3GV3A 1HNZL 1IYJB 4TVAB 2D62A 4ZQ3A 2AUKA 2QA4A 4A4IA 1PH8A 1BDOA 3EJIA 5FO7B 2L5TA 3F2CA 2RF4A 4C3IB 3DEOA 4LMQD 1K8GA 4C3HH 4V190 2L9HA 1XTDA 1F2ZA 1YHAA 2I5LX 3FP9A 1K0RA 2NN6H 4A3FH 1PA6A 1DOKA 1CSPA 1RJTA 2EE1A 1EY5A 2ZTDA 4X62L 1U4PA 3MWYW 1BO0A 2F0LA 1U4LA 4HMIA 3V05A 1SSOA 5D65A 1EUJA 3S14B 1WCMB 3RZDH 5GAHC 4X64L 2AHOB 1BF4A 1VQOA 3BDOA 2K33A 1B1ZA 3SE0A 1Q81C 1K8AC 1FD7D 5ISRA 1VQHA 3R2IA 1HR0Q 2WKDA 4G7ZC 4P72A 2Y0SG 4LF5Q 3OWEB 2DNEA 1XTCD 1I94L 1FNUA 1S72A 1JE5A 4BA1I 5C4ZA 4JYAL 1X65A 5AFWA 2F3IA 1YEZA 5ELOA 1PTOH 1L1OA 1PFSA 3HKZB 3I4OA 3STBD 4CDDC 3L0OA 5LMUQ 3SK4A 3GTPB 1RD9D 1C48A 1STGA 4ZK9B 4OIJA 1MJEA 1B2TA 4GOPC 2E2HB 1X3FA 4JI2Q 3FKIH 1TKWB 1SFOH 3HOWG 2WFWA 3DUZA 1KC8C 3J81c 3NBIA 4C3JB 1C7YA 3AB9A 4YWLA 5IYCG 1Y1WG 1CUKA 5K36H 2K75A 1LACA 3I72A 4KHVA 3S1RH 1BQQT 4KHPL 3HOXB 3QWNA 3T51B 1LTBD 1O7ZA 4BBSG 5C0XI 1TIID 1XMQQ 1W6KA 5CMDA 4RGMA 1VQBA 1PXUA 3RN2A 1L1OB 3ERSX 5C3WA 2ZTCA 3TS2A 2VW9A 2F0JA 3BDLA 2QW7A 2VL6A 2O5JC 1SYFA 1RODA 3N52A 4IUVA 4ZUJA 1NR2A 2RCFA 4HIDA 2A8VA 4B08A 3UI2A 4CDCC 3MA2B 3A5ZB 4IQZA 4A93B 1STNA 3CRLC 5JVG3 3R8BA 2F0IA 3JAML 3LGJA 5IYBH 2E5LQ 2RQXA 4ME5A 5DAUA 1L2FA 2ZT9C 3GTJB 2HCCA 4GKKQ 2IHEA 2R7FA 1HXYD 2R7ZG 1UEAB 2B3GA 1MI2A 4X65L 4K14A 1TR5A 3DXJC 1PTOD 1WJJA 2UUCQ 1CI3M 3GTOH 2XWBB 1CT1D 1NE3A 2VB3X 5CV8A 3A8JE 4J1MA 4JOIC 1J9OA 1AE3A 3MXPA 5DNFA 1I5FA 4RAUC 4IOCA 1A0IA 3W3AA 1E1TA 1BBUA 4OX9L 4NPSA 2XVSA 4G57A 4OHJA 3I70A 1MHWC 2UU9L 2PZWA 4JI8Q 4A3DB 1S3OA 2VQFL 1A2UA 2E75C 4ZAIA 3BS1A 2Z8LA 4AIMA 4L5SA 4OL7A 4LUOA 4DPGA 1Q8KA 3PCOB 3ZYYX 3GQBA 4CBVA 2LXKA 4A3KH 1B7YB 4FF4A 1L0YB 1VQ6A 2D2CC 2HDLA 1EY9A 4NMZA 2EOTA 3NWTA 3SR1A 3S16B 1N32L 1CKOA 3HOVH 1WYDA 2JA5B 5GQOA 2G5DA 2PI2E 4JI6Q 3LWUA 4GN4B 3RD4A 2EJFC 5BR8L 1HNXQ 3GTLH 2R92H 2RBMA 4PZ6A 1TWFH 4RMFA 2UXBL 3HP3A 2ASBA 1V9PA 3I4MB 5FOBB 3PQIA 5J22A 2JSOA 2VQEL 3GTKB 2A68C 3PO2G 1Y1VB 3E5SA 4LF4L 2E2IH 3I90A 1TT2A 3HOYH 2EVBA 4A3GH 4OIKA 4JK1C 2OTLA 4PMCA 1J6QA 4DR2L 1QE6A 4JI1L 1TVXA 1B44D 2UUBL 3O13A 2Z1CA 2B63B 1KDBA 3D4WA 4GOPA 2ENBA 2ZJRA 3CCQA 4C1NK 4K8IA 3J80c 3OTOL 3HFZB 5T1GA 4C3IH 1EZ6A 1W6JA 4DXFA 1WTQA 3EA6A 3FRPB 1SE4A 2K5HA 1WD0A 5M5YB 3GP7A 5JOBA 3AMUA 2WKCA 1NJIC 1C4QA 1EWIA 3FVQA 1WTHA 1D1KA 3H09A 2K6AA 2BDOA 4O42A 4HTHA 5JJIA 3NXWA 3NK9A 1ESRA 1KAAA 3S14H 2PQEA 1HNWQ 1OO9B 3W5OA 5LMNW 3MZ5A 1WTVA 1FGBD 2XIWA 2JA6B 1GOZA 2QF7A 4CGYB 4C2MB 4XDXA 1B3QA 4GOPB 1ENCA 1S5ED 3U9SA 1FNWA 5EKKA 1WD1A 4BXXG 1IW7D 3L2PA 1EIFA 3H15A 2OT2A 3I55A 1NY4A 1N33Q 1KRSA 3IRBA 1IYVA 2H5XA 2QEJC 2BE5D 2C9OA 3D0FA 1E22A 2EPBA 1EIHA 1A63A 1LO5D 5CYUA 5FO9B 5FJ8G 3E9HA 4TSSA 2A73B 4JOIA 4CKEA 3F2DA 3CCJA 2K03A 4LAAA 3DWQA 1Q90A 3GTPH 2DNCA 4DR6L 3KLRA 5IIFA 1T9HA 3AFQA 3DWAA 4IUTA 4DAPA 2E2HH 4A3CH 5M3MB 2EYFA 2OXPA 1O78A 1V1OA 1JOOA 2F0HA 4X6AH 2D0OA 4RH6A 1SJHD 4DV5Q 4HIMA 3GDEA 4XYOA 4C3JH 1QVGA 1QILA 5M3FG 1JJGA 1VF7A 4LNQA 1C8CA 2RKSA 4ZKCB 5EGTA 3HOXH 2B29A 3K5NA 5A35A 5IP9G 2WAQE 3H0GG 2K14A 1EL0A 3D31A 2NVTB 2JE6I 4DAVA 4KY7A 1FVIA 2K5VA 4FVMA 2PNRC 2EJMA 5GAGC 2QEXA 5COYA 2WACA 3EN2A 2ZJPA 1XPUA 3UDFA 3OW2A 1I4XA 1BCPC 5IP7H 1VQIA 3PIO3 1C9OA 4IO9A 5BN3A 2XTIA 1ASZA 1J5EL 2F0FA 5C3EG 1MGSA 1SLJA 3MAQA 3KOJA 4RFBA 1S40A 1VQMA 1U4RA 2HDMA 2A6ED 1CQVA 1O7IA 1NCVA 2PZUA 3EQLC 4LF9Q 4LFCL 2IPKD 4DK1A 1GHKA 1SE3A 3DEPA 3A56A 5C4XB 2K5QA 4KLKA 4C3HB 3UDIA 2ZM6L 4YY3L 1YVCA 1EQTA 1PH6A 1LTAD 4KHZA 1YJWA 5CV9A 3QOJA 1VQ9A 1LTSD 4XT3B 1EYCA 3KBGA 2R3ZA 4A3DH 2QKIC 3M9BA 1E3PA 4MN3A 5H1SE 1FGUA 2KHSA 3RZDB 2ES2A 1JT8A 1STHA 3CMAA 5FLXE 2SDFA 2F0KA 3KF8A 4BY1B 1FJGQ 4ZLTF 4U673 5CC4A 1H9MA 1SMYC 4KTAA 4AQYL 2OQKA 1HQMC 3A55A 1UE6A 2N8NA 5IGEA 4OO1I 2PW7A 4B3MQ 4GN3B 1VQNA 2BCOA 1EU3A 1JWSD 4G4KA 3S2HB 5ELCA 3F1ZA 2AKWB 4UDUC 2VB2X 2QDLA 3Q24A 1NUCA 3T53B 3NUCA 1YBYA 4DNTB 2L4NA 4DV0Q 5C44G 4YCUA 5CBEE 3CPFA 4IFDG 3C2PA 1Q1BA 4MIUA 2IX0A 1LUZA 4JV5L 3HZXA 3GTKH 4R4OA 4QQBX 3IFDA 3TP5A 2JJQA 3L9AX 3MEFA 4JVZA 2FXQA 2X6LA 3KF8B 1SFOB 5ELFA 1K9MC 1GUTA 2KUMA 5KIXA 5IGCA 2VUMB 4BS9A 1PTOF 2B63H 1PZJD 1PH2A 5G3LF 4JI0Q 2A69C 4GS3A 5J1ZA 4JI7L 2OWOA 3S1RB 1ICFB 5L37A 1TU2B 3EROA 4LF6L 1P16A 1CQFA 3CD6A 5IWAQ 1U4MA 5EPJA 4B9WA 4KV6A 4FNFA 1SNMA 2B2UC 3X3NA 1F9QA 2CWAA 2Q8RE 4N9PA 5M5YH 2JA8B 3SXHA 5F2DA 1K8OA 1VQFA 1BR9A 4C3HG 2WV6D 1TWHH 1X56A 4B3TQ 4A3FG 3PSIA 3HG9A 4L8JA 5C3XA 4OWWB 4C56C 4DXGA 4HIOA 4EX5A 3TQYA 1PH9A 5KYIA 1N36L 5JPMC 1QUQA 5FLMH 1E1OA 1AZPA 1Q46A 2JA6H 2JQOA 1N8RC 4LUZA 3C46A 3FHWA 1MKHA 4C2MH 2A74C 2EIFA 4X3SA 1LT3D 4UPAA 2CWPA 2QGQA 3K7UC 4HN7A 5FLXL 2CQOA 4XIGS 5E4WC 3I8ZA 4YWKA 3S1NH 3U4VA 4B9XA 1VQ4A 5JEAJ 2AQ2B 3U4ZA 2V4DA 4XQJA 5C5MA 2YYZA 4DV2L 4UY8C 2A6HC 3NSWA 2RA4A 2JA7G 4DR7Q 2KA7A 2ZXRA 4ZCKA 1R4PB 1K0SA 4LF8Q 2TMPA 2A1AA 4KI0A 2HIVA 3A7LA 4UAIA 3VYTA 1YNNC 2Q8TA 5M3MH 4A3MB 1QUQB 5K5PA 1CZWA 2N3SA 2F4VL 2UXCL 1VDZA 3J81i 4H7BA 1BCPB 2L1BA 3MXGA 3A54A 3FKIG 2EYLA 4YWMA 1DD2A 1WTPA 2HUGA 1EWCA 3PIP3 1I3QB 2EDGA 3S24A 4PQXA 3K58A 4P74A 1DXMA 2K5NA 1F9PA 2R93H 1LTRD 2NVTH 4JI4Q 1TWFB 1JC7A 1KLUD 4RGTA 2EXZA 4KN4C 2KVMA 3QB3A 3PUYA 1G2SA 1EEID 2PO4A 5E4XA 1SBBB 2G9HD 1SNOA 2NVQB 4EQNA 2OTJA 2JN4A 2JP1A 2K04A 1EY6A 5CBAE 4O2DA 1HZAA 2K5DA 4A3GB 5IYDH 1A8VA 3W2DA 1KL9A 4A3JH 4L5RC 4XQQA 5IYBG 4L5TA 4AH6A 1BOSA 3HKZE 1I6HB 4I7AA 1XMQL 4LFAL 1STYA 1Z47A 1G8ZD 1TY0A 1LTID 5I6WA 4LF7Q 4HR7B 4KJOA 1C0AA 4LWCA 1GKHA 1OXSC 4DFAA 4X66L 5C4XH 1BBWA 2B2YC 2I5MX 1CTMA 4RKBA 3BG3A 5GROA 3RMHA 1SNQA 2Q8IB 4M1UB 1XPRA 1TS3A 3S1QB 1ILQA 3DHQA 2OEOA 1XX8A 4GKKL 1GUGA 2F52A 3SK6A 2B2UA 5C0XH 2Q2IA 4A3IH 4FXDA 2NTTA 1CHQD 4KKSA 4BY1H 1NNXA 2KQ3A 4PG3A 3CCMA 3IL8A 1KNEA 3KLWA 3KK7A 5KYLA 1UAPA 4A3KG 3S2HH 2B39A 4IFDI 3ICEA 2KCNA 3R93A 2PW5A 4ODGA 4R4TA 3DM3A 4RHSA 5IT9c 3TS0A 3HOVG 1JWMD 5LMNQ 4NDXA 4QGUA 1BKBA 3UDXA 3M4PA 5IODA 3LX0A 2EYMA 2FJ2A 2R92G 1TY2A 2K28A 2AMCB 4UP7A 1VQ5A 1WVLA 4XT1B 4DV3Q 4Y52H 3D4DA 3CKIB 2IHFA 1QWYA 4BBRG 3PO3H 5I9OA 4JI3Q 5M9OA 5J39A 3TREA 2VUMH 3ULLA 1VF5C 4TRDA 1NMFA 1PV4A 1RKNA 3HOYG 3VDYA 3G71A 1SAPA 4GNXC 4K0KQ 1ET9A 4TKOB 1PH1A 4QUCA 4DF7A 1VQJA 1JQYD 4JI6L 1QZGA 3J80i 1JOQA 4EQPA 1PYBA 2Z0SA 1PRTC 2EYHA 2KCMA 4Q0FA 4B3RL 4BY7H 2F0OA 2R6GA 1Q1EA 3BVZA 1UNSA 3I4NB 1KDAA 3QR8A 4C3IG 2JA8H 4H44C 2MNAA 2UXDL 3E0EA 2K4KA 3T1YL 2A68D 4GLVB 3F2UA 1EIGA 4IUPA 2RDHA 1XNRL 4FP5D 3HOZH 4JCVE 2RHSB 1HNZQ 2JEAI 3U9OA 1DCZA 3A7AB 4DAYA 5M5WB 3BVMA 4AYBB 4HJ5A 1GUWA 1WCMG 4A3EB 1UE7A 2KCTA 3MTSA 1YJNA 1PHJA 4HEDA 1AZQA 2FMMA 2NVXH 5D3DA 4V0BA 1X3GA 2YV5A 2K05A 5HURA 2BH8A 2MHVA 3IFTA 4A75A 1IYUA 4X62Q 4NB3A 2WP8J 4LFBQ 4IURA 1HTLD 1QNKA 4PZ7A 3HKSA 3OIPA 1SE2A 2RHQB 3CPWA 2JK8A 2F0EA 4NKLA 4QF4A 3J7AV 3MFYA 1KXLA 3Q23A 4N8FA 1X54A 2IL8A 1XNQL 2A5HA 1EEFD 3HKZG 3WOFA 1HNWL 2PCFB 4EGVA 4WJ3M 1A3TA 2NWGA 4DAYB 3I7FA 4A3MH 2GA4B 4JI5L 1I94Q 3S1MB 3BYYB 2KECA 2IJ0A 4A3CG 5JJKA 1GJXA 4DV4Q 2BA0A 4RG1A 4L5QA 3W1GA 1YHQA 4BWGB 1I3QH 3DMUA 2CFMA 4Z9CB 2F3VA 3BDCA 1RTNA 4J15A 4JBMA 4LJZC 4C3JG 1YI2A 1A3UA 3JC66 2C35B 2DJGC 4U68A 3SHLA 2DY7A 3EFXD 3DLLA 3GTQB 3HOXG 1B3AA 1L0WA 3BU2A 2NVYH 5IY0A 1RDPD 4BA2I 2X69A 1TWGH 1K73C 1RL2A 4MNOA 2XN9C 4K2KA 2NVQH 3MHBA 1XMOL 2GN5A 1TWCB 4IPGA 4KHPQ 1HQRD 2Q2TA 4A93G 1BBXC 2P5ZX 5IP7G 2Z6BA 1SN8A 1X32A 3OHXC 4GLXA 1X9NA 1RIPA 4DR4Q 2H4OA 3HOUH 2IT1A 1I6HH 1ENFA 1YHBA 3K5MA 1HFGA 1Z9FA 3DWPA 2N78A 3PUXA 4K5XA 2PNHA 1MD2D 5EKIA 4CKBA 5DLQE 4UP8A 4JBKA 3Q22A 2DY8A 2ICEC 1STAA 4OEMB 4GNXA 1Z7TA 4K2LA 4R8IA 4HMJA 1KQSA 5C4HA 3MXUA 2YTXA 3S1QH 4CHTB 1BVSA 1GUNA 1TWHB 4CJ0B 3BJUA 2PMZB 2YU9B 4X65Q 1BCPD 2BA1A 2ZJQA 2JYOA 2HT1A 2WB1B 1IBLL 3A0JA 4A3DG 1TS4A 5IT9E 3PUVA 3T13A 2YTYA 1HR0W 3GTGH 4RA8A 4GKJL 4RCNA 5I4DA 2CW0C 3BVGA 2R7ZH 1KHIA 4OONA 2OCEA 2KBNA 1G6ZA 3VA7A 2UU9Q 4IOAA 1LT5D 2F4IA 3S1NB 2VQFQ 4GNXB 3H6MA 2Z4HA 4RKLA 1W2BA 1HZCA 4KN7C 3J81E 2JA5G 1EQVA 3Q8DA 3H91A 1YIJA 1PRTB 1SMXA 2F0SA 2I07B 4EVOA 1ENAA 4KMUC 1HFNA 1MSHA 2QDBA 5IGFA 4A3LG 4DV7Q 2MP1A 3N6RA 3I4MG 4IPDA 2E2DC 1U9RA 2MUYA 4WORA 2CH4W 1N32Q 1B4OA 1Y1VG 1SMYD 3K6OA 3VYSA 4B3ML 3CAMA 1S4ZA 2HQLA 1JOKA 4KKUA 5BR8Q 5KRUA 5TSSA 5C4JH 1R4QB 2UXBQ 4QL5A 2LY7A 2B63G 3QIAA 4MTKA 2KJXA 4CJ2C 1CA5A 1CHPD 2PZTA 2VQEQ 4E6IA 4RCOA 4DV0L 2R93B 4CDFC 2PPBC 4LF4Q 1M4VA 3I4NH 3BZCA 1GD7A 4R4QA 1N34L 1DOMA 1KABA 3MXNA 1LTLA 1KTKA 1OXUA 2XGTA 3UE0A 4OO1H 3G6JB 4DR2Q 4JI1Q 1E0BA 1JJCB 1D7QA 3EIVA 4JW0A 4DNIA 3RUZA 2L15A 3IAYA 4WFN3 1AFPA 2ID0A 2KEDA 3D3RA 3K80C 3P1HA 4A3JB 4GLAC 3Q0AA 4HCEA 5M5WH 4O1NA 1X3PA 5BN5A 4KY5A 3OOCA 1D5MC 1XJVA 4A3EH 3M3YH 2A69D 2F1MA 3T56B 5FLMG 3GV6A 4KKTA 3CU7A 2JA6G 4NXML 2ZTEA 3NQTA 2FMCA 4DV1L 1JMCA 1B9NA 5CV5A 4HIKA 4ME3A 4GZYC 2G9DA 1YITA 2HHHQ 1ML0D 2K52A 3MXNB 4X3TA 1D5ZC 1RTOA 3TZUA 2MPMA 3PIOA 2D5DA 4DUZL 1OTCA 2I5HA 3E9IA 4IFDJ 4QIWB 5HGTA 3AEVA 3FPUB 1PLFA 1QZHA 3TMEA 3NTIA 4DR5Q 4A3IB 2KENA 4DV6L 4DR1L 5M5XB 3J81L 2K01A 1SDFA 1UE5A 4DR3L 2EQSA 3CRKC 4ZRZA 4LK1C 3OPOA 3S1MH 4JPBW 5M3MG 5I2XA 2N55A 3H3VI 4B3SQ 4Y7NB 1B8AA 1DYQA 3CQZH 2WAQB 1G291 1GVPA 3SK8A 1OXTA 5D3IB 3K7AB 1DOLA 5CV7A 1IBML 1ONLA 3D6WA 4DR6Q 2BH2A 1H9KA 3GTQH 3JAMc 4DR7L 1M8AA 2LS01 2HIXA 2K50A 5CR3A 1O7LA 1EQRA 2A6HD 4BXXH 4OGQC 1Q3LA 3T1HQ 1K3RA 1Y8OB 1F77A 3J80E 4OELB 2NYZD 3RNUA 3BZKA 1YNND 1XYIA 2O5IC 1CSQA 1TWCH 2AWNA 3MFGA 1CK1A 4YHHQ 3PO3B 1PH3A 3KBXA 3TBIB 3D4RA 1S5FD 1X6OA 1SNCA 3U58A 5IYDG 4P71A 2LMCB 1IBKQ 1BXTA 1PZID 1SRUA 3C1FA 5FKAC 4A3JG 1AN8A 3OW7A 4HAEA 4DGZA 3J7YW 1WI5A 4QJFA 4JI4L 3TP8A 3W1BA 4BY7B 5M3FH 3E0JA 1MSGA 1B50A 1JICA 1EYDA 4OXPA 3ND9A 1J5EQ 4ABNA 5C4XG 2B2TC 2F0UA 5E1FA 1X55A 5KNBA 3A5UA 2M2LA 2SOBA 1Q7YC 2I0QA 1CKMA 2IY5B 3OMGA 2YU9H 2NN6G 2F0VA 3FMCA 1S5CD 1SYDA 2VZAA 3CHBD 4A76A 3HOZB 3NQIA 2RCNA 4HJ9A 1MJCA 5EBDA 2SNSA 4HSVA 5C0XG 3P7JA 3OMCA 3MVVA 4IJLA 4LFCQ 2R61A 3UE1A 1AH9A 2ZM6Q 4YY3Q 4BY1G 4DNRB 2NVXB 2FFKB 3TDQA 3M4OB 2UUAQ 2F0TA 1UWVA 3H3VC 2K32A 2KOLA 1DONA 1TWAB 3I2ZA 1ZYRC 1VQKA 2F3WA 2MGSA 2J7ZA 3ITPA 2DN8A 1PH5A 2MFIA 4OWTB 3I3CA 1WTXA 4YCWA 3VR6A 4A3BH 1K28A 4AQYQ 2K1BA 4G7HC 3AYHB 4IUNA 4OWXB 3TP6A 2D9UA 1DGSA 3CMEA 3OIQA 1HR0L 4RGOS 4LF5L 2F0GA 4F8MA 3J80L 3ULJA 4QUFA 3ND8A 3F8TA 2VUMG 1E24A 3CCEA 1SYBA 4R4IA 3K0YA 4NW2A 4UP9A 4WJWA 3NWSA 2K7VA 5T1IA 5I6YA 5K36G 1CFMA 4O0AA 5E7NA 1HZBA 5IE8A 5LMUL 1FNVA 2NVYB 2Y0SB 5HGQA 2DUDA 4QMGA 1BCPF 4MZ9A 4FXKC 1SYGA 1TWGB 1KD1C 4JI2L 1NBWA 3HGBA 2JA8G 1LTTD 3P75A 2B2WC 3KLSX 4JI7Q 3OWFA 2NB0A 2EYJA 1E7ZA 1VQEA 4LF6Q 2KCCA 3CCSA 4IFDH 3VYRA 5IOCA 3G6EA 3VR2A 3HOUB 3HS0C 4YIJA 3PUWA 3KJOA 1EOTA 1TXYA 2EJGC 3HOWB 4X3KA 2N88A 1PRTD 2B8FA 1QJOA 4K5VA 2H1EA 2XNAC 1EIYB 2OQ0A 3CCVA 1A6XA 1O80A 1ET6A 4ZUIA 1Y1WB 4M8AA 3NTHA 1JORA 4FO2A 3TP7A 1CA6A 3TEHB 3CP0A 1N36Q 4BBSB 2VS1A 1Q82C 4NP5A 2QILA 2E5LL 4NXNQ 1IL2A 2E74C 2LSSA 3TN2A 1V1PA 1PH4A 5M5XH 3QG1A 1GHJA 4WRDA 3M4YA 3S17B 5LL6X 2KHJA 4HJ7A 5CGKA 1VS0A 1YNXA 4QCLA 2B2TA 1QVFA 1D6EC 3JAME 1EYAA 3J7ZC 2UUCL 1TQOA 3S2DB 4DK6C 1GUSA 3GTGB 2NUCA 4A3MG 1AP0A 1D8LA 4LFBL 1YNJC 2D0PA 1IZ6A 4J6HA 4Y7NH 1L0XB 2EZVA 4DUYQ 2R7ZB 3ER0A 3VYUA 4DV2Q 1QNUA 1TS5A 5EAYA 2ATWA 3K7AH 3SVMA 4JI8L 4JC0A 3FPPA 3RR5A 2C5CA 2SEBD 2F4VQ 2UXCQ 4AYBE 1IKMA 1JWUD 4KD4A 1V1PB 3K81C 3KJPA 2DGYA 3CCUA 4LUVA 1EY4A 1VQDA 4JBJA 4IZ8A 1QOHA 4S3SA 2JA7H 4DV4L 2RDGA 1G91A 1A15A 1HTPA 3NENA 1F2MA 4L63B 4A3GG 2AQ3B 1HA5A 5C4JB 2E2JB 1JB3A 3KDFA 3A8IE 4IJHA 3PF4A 2B2VC 1HNXL 3HOUG 3CCRA 4N9TA 1JE4A 4FF1A 4DAMA 4GN5A 2KEEA 3LNNA 3I56A 2BOSA 1EU4A 1HH2P 2NN6I 5AJ3Q 3I4LA 4P2CB 5JEAH 4FF3A 1PYSB 1CKNA 2ZXPA 1UEBA 1X3QA 5LHY1 1VQ8A 4DA2A 4PZ8A 1I4HA 3K5OA 5DM63 4LFAQ 4DR4L 1EY8A 5CV6A 3PV0A 5DM73 3B6YA 4X66Q 3PO2B 3HEJA 3M3YB 1A62A 2B2WA 3A8KE 2NZHA 1SYCA 2QCPX 1QG7A 3KDFB 2CKZB 1M90C 2AWOA 3M4OH 4UHVA 2PQAA 2F0WA 1QCBD 4P73A 1II3A 1TWAH 4APVA 4R8NA 5EPLA 3CC4A 2ALYB 4CKCA 3M85A 3DM1A 3MC0B 4X64Q 1M1KC 1CKNB 1I4QA 2B2YA 5G3LD 3A74A 5I2YA 1HUNA 1PFBA 5FK9C 1VMPA 5CV4A 5KEEA 3PUZA 3J7AF 4XQNA 3TRZA 3QO2A 2IWHA 3CC7A 2MO1A 2F0DA 5C5LA 3QOLA 5EPKA 4JYAQ 1EY7A 1JJ2A 2IW3A 3STBC 3CF5A 3E6ZX 4MHEA 5BN4A 2CW0D 1N33L 2PQAB 3CQZB 3S15B 1YJ9A 3G48A 2PMZE 1NMGA 5IGDA 3TSSA 1I4RA 1HJPA 3I73A 3FDTA 1Y14B 1E2WA 2WB1E 4PV1C 4N8X1 4FDBA 4K5WA 4DV7L 3K5LA 1LT4D 2VNUD 4DN4M 3OYYA 4FF2A 3I4NG 2XRQD 5JVH3 4POGA 1D2BA 1E2VA 4DV5L 3K8AA 3GTMB 2F03A 2E76C 4OO1G 2WIIB 3BYTB 1I50B 5FLXc 1JCKB 3PGZA 4G7OC 3QJYA 3RZOB 1FYCA 2SNMA 1H9SA 4F87A 1MIUA 4B3RQ 4F88A 4FYDA 3URYA 1SROA 1EZ8A 4ILWA 1VCIA 5EQ0A 1EQQA 1NSNS 3R2TA 4HSPA 1R9TB 1EFID 2CVRA 4BBRH 5JAVA 3HOWH 4AYBG 4A3EG 1PZKD 2PI2A 2UXDQ 3SDZA 1E2ZA 3VA5A 3KFUA 1J8IA 3T1YQ 5M3FB 3HRZC 5IYCH 1Y1WH 1IL8A 3ONAB 1VMCA 1XNRQ 2ZXOA 2NTSA 3G7LA 4JG2A 3L3OC 2E8GA 1EWHA 1H9JA 4KD3A 1F9RA 4BBSH 4IALA 1EFWA 2B2VA 3ULPA 1PTOC 3H0GB 5J3BA 1AEXA 1LM0A 1SNPA 4CDEC 2LKVA 3AQQA 4QY7A 3S17H 2I46A 2OF1A 1Q12A 1I4PA 1WTWA 5CORA 2RSOA 5IGBA 1H9SB 1XWEA 5EJWA 1WOCA 4EQOA 3S2DH 4LF9L 4P75A 3SGIA 3SEBA 2GVAA 2MQHA 4OX9Q 1B9MA 2NBFA 5C3EB 1KAWA 5ELNA 2HHHL 2O2LD 3NPPA 1XNQQ 1WCMH 3ZJYC 3CC2A 5A2QE 2L0CA 1STBA 4H02A 4LW1A 3JAMi 1A2TA 4DR5L 2EY6A 5JPNC 1PVOA 5IGGA 1FL0A 3IKJA 4JI5Q 2MO0A 2Z4IA 1K83B 4A3BB 3I91A 4WJ4A 5NUCA 2RSNA 4F7XA 2KHIA 2M00A 1FJGL 1LV9A 1PFMA 3K57A 1V8QA 1PH7A 4R1JA 2M9VA 3NHHA 2FINB 3PMFA 4CJ1B 4B3SL 3PF5A 3D8GA 1SEBD 1PRTF 3WOEA 4XTCS 2E2JH 1QB5D 2EY5A 1HPCA 1SNDA 1KNAA 4I7ZC 4MTNA 4QIWE 1ZXTA 1VQLA 1G2TA 3H94A 5EBCA 1TS2A 1ILPA 3T1HL 1XMOQ 1VQ7A 5ELBA 4J8QA 3H3VH 1BNZA 2FHTA 2UUBQ 3C1EA 3KF6A 5D14A 4YHHL 3Q6SA 3VR5A 1KLGD 1HA6A 3VR3A 1HRJA 1LTGD 3V2TA 1DJRD 2LFNA 5C44B 2J0TD 1HZ9A 3GD7A 3NE5B 3OTOQ 4K6DA 4JI0L 3SK5A 1IBKL 2GVBA 2EY1A 1GM5A 3K0XA 1WFQA 1B53A 1LT6D 3U50C 2PYKA 3PO2H 2WB1G 4L6TB 2J4XA 5IWAL 2IX3A 1OXVA 2F0QA 4XYQA 3F2BA 4HCSA 4A93H 2F0MA 1EOVA 5IT9L 4YCVA 1SXTA 3GTJH 1K8MA 3R3OA 1T5EA 2MJ8A 3NBHA 2CQAA 3J7A5 2AQ1B 4ID6A 1IBLQ 4B3TL 1D1IA 1UE1A 2EYOA 2K5WA 3KF6B 1HUMA 5A2QL 1G6PA 3LWEA 4XXEA 2JA9A 1CZGA 4GKJQ 3EBEA 2L11A 2EYPA 1EY0A 1IW7C 4IPCA 1EYGA 3G4SA 4A3BG 4HJAA 3CCLA 1NTGA 2BE5C 5JJZA 4RHRA 4A3FB 4KY6A 2X6GA 3M7NA 2UUAL 3WWVA 3K59A 1ZEQX 1H9RA 2EY2A 1S5BD 2EXDA 4I65A 4RWSC 3S15H 1KRTA 3NBHB 4K6LA 2F0NA 5JJLA 1ZYRD 1VQAA 4QB4A 1AW7A 1GO3E 1X3EA 1IXRA 1WTRA 2XWJB 2VY3A 1VQPA 4FXGC 4LF8L 1F2YA 5DEHA 2R93G 1UUPA 1U0LA 2Z9HA 2Z6KC 2B8GA 1LABA 1I4GA 4Q5VA 2VXWA 1JR0D 3S16H 1G51A 3RLOA 1XPOA 1OXXK 3WDNA 3GTMH 4ZKBB 2XSCA 2JA5H 3NELA 1I6VC 3KLSA 2YTVA 3KYHC 1I50H 1PFNA 2JA7B 5FJ8H 3KUPA 5KGUA 1IKLA 5KNCA 3RZOH 1PTOB 1Y69U 1NR4A 4A3LH 2DJFC 5C0XJ 3UDGA 1VQCA 2HD3A 1PYWD 3FEWX 4RGNA 3I4MH 1Z6HA 4R4CA 4C1NI 3P20A 1R9TH 1N34Q 4PMWA 1STEA 1Y1VH 1QVCA 2N49A 4R9WA 1H95A 3FKIB 5LL6S 1RHPA 1PDQA 3S9WA 1ASYA 4KK7A 1Y8NB 1SJED 4PNYA 2AUJD 4ALPA 5IP9H 1XXGA 1S5DD 3L7ZC 1GXDC 3RLNA 3J81j 2A6EC 3H0GH 2BDNA 5E3FA 5ELEA 2CCZA 5EKLA 4H13C 1HCZA 3AFPA 2XRSD 4NXMQ 2CHBD
chains in the Genus database with same CATH topology
5HY6A 4A3MG 4DV1Q 2WAQE 4J15A 4A3IG 1D8LA 4JBMA 3H0GG 2D0PA 4LFBL 1YI2A 2K14A 1IZ6A 3D31A 3JC66 4Y7NH 4LF7L 2C35B 4DUYQ 4JBWA 2JE6I 2Y0SE 3ER0A 4DV2Q 1FVIA 2K5VA 4EQ5A 2QEXA 5GAGC 5EAYA 1YZ6A 4DK3C 5GAEC 5C3EH 3HOXG 3DLLA 1L0WA 2ATWA 3BU2A 3K7AH 1KIXA 2NVYH 3EN2A 2ZJPA 5IY0A 1XPUA 3GO5A 1LYLA 4TQUS 4DUZQ 3RN5A 3UDFA 4JI8L 3OW2A 4JC0A 3RR5A 4BA2I 1TWGH 5IP7H 1K73C 1VQIA 1C9OA 1RL2A 4MNOA 2WAQG 4DV6Q 4IO9A 2XTIA 4DR1Q 1ASZA 2F4VQ 1J5EL 4NXNL 2UXCQ 4AYBE 2LXJA 5C3EG 1SLJA 2NVQH 1XMOL 2GN5A 4IPGA 4DR3Q 3K81C 3KJPA 4KHPQ 3KOJA 2DGYA 1L1OC 1S40A 3CW2C 1VQMA 3CCUA 2Q2TA 4LUVA 4A93G 1W3SA 1VQDA 1K83H 4JBJA 5IP7G 1SN8A 4GLXA 1X9NA 2JA7H 4DV4L 1RIPA 1O7IA 4DR4Q 3HOUH 4POFA 4HJ8A 2IT1A 3NENA 1I6HH 1YHBA 1Z9FA 2NZOA 4LF9Q 2N78A 4LFCL 2Q2HA 5GADC 4A3GG 3PUXA 2PNHA 5DLQE 4KLKA 4DUYL 3UDIA 4UP8A 2ZM6L 1IBMQ 4JBKA 4YY3L 3RLFA 3KDFA 4IJHA 4DKAC 1V1QA 1YVCA 1PH6A 3PF4A 1HNXL 3PO3G 3HOUG 4KHZA 3CCRA 1YJWA 4GNXA 1VQ9A 1KQSA 1B70B 4A3DH 4JV5Q 2YTXA 3S1QH 5LMNL 4DAMA 1BVSA 3M9BA 4GN5A 4IPHA 2A19A 2R7DA 1E3PA 3BJUA 5H1SE 1FGUA 3I56A 1Q86C 1HH2P 2NN6I 4X65Q 5AJ3Q 2ES2A 2BA1A 1JT8A 3CMAA 2JEBI 2ZJQA 4BY7G 1PYSB 1CKNA 2HT1A 1IBLL 1FJGQ 1YHQA 1UEBA 3A0JA 4A3DG 1VQ8A 4DV3L 4PZ8A 1SE8A 4AQYL 2OQKA 3PUVA 4LFAQ 4JI3L 4DR4L 1UE6A 2YTYA 2N8NA 4OO1I 1HR0W 3GTGH 1AE2A 3PV0A 4GKJL 5C44H 1N9WA 1V43A 4B3MQ 4GN3B 5JEAG 1VQNA 3B6YA 3M4QA 4X66Q 4K0KL 3F1ZA 3PIPA 1A62A 2R7ZH 2NZHA 1KHIA 2Z6KA 2OCEA 2KBNA 4OONA 3HOZG 2AKWB 3KDFB 2CKZB 1M90C 2AWOA 2UU9Q 4IOAA 2V1CC 3M4OH 1YBYA 2VQFQ 2PQAA 4DV0Q 4GNXB 5C44G 4YCUA 3CPFA 4P73A 1W2BA 1TWAH 1HZCA 1Q1BA 1VQGA 4APVA 2IX0A 1LUZA 4IFDG 4JV5L 2JA5G 2Q2UA 1U5KA 3Q8DA 3GTKH 1YIJA 3CC4A 1SMXA 2IX1A 4R4OA 2ALYB 4QQBX 5AJ3L 2JJQA 1P8LA 3M85A 3MEFA 4X64Q 1M1KC 2FXQA 4A3LG 4DV7Q 3KF8B 1JB7A 1CKNB 3CXCA 3NEMA 3I4MG 1SR3A 4IPDA 1K9MC 1HNZL 1IYJB 4TVAB 2D62A 1N32Q 3A74A 2B63H 2QA4A 4A4IA 1PH2A 1PH8A 4JI0Q 1Y1VG 4GS3A 3F2CA 4JI7L 2OWOA 3PUZA 3TRZA 2RF4A 4B3ML 3CAMA 4LF6L 3CC7A 2HQLA 2MO1A 1P16A 5BR8Q 3CD6A 5IWAQ 1K8GA 4C3HH 5C4JH 4JYAQ 1JJ2A 2UXBQ 1XTDA 4QL5A 1YHAA 2I5LX 3FP9A 3STBC 1K0RA 3CF5A 4A3FH 1PA6A 2B63G 1CSPA 2ZTDA 4X62L 1N33L 2PQAB 2CWAA 2VQEQ 4DV0L 5M5YH 1YJ9A 3G48A 2PMZE 1NMGA 4LF4Q 1VQFA 3I4NH 1HJPA 1GD7A 3BZCA 1TWHH 1Y14B 4R4QA 1N34L 1X56A 2WB1E 1EUJA 4B3TQ 1LTLA 4A3FG 1OXUA 3PSIA 3RZDH 2XGTA 3UE0A 4DR2Q 4FDBA 4X64L 5GAHC 4JI1Q 2AHOB 1JJCB 4DV7L 4OWWB 1VQOA 1D7QA 3EIVA 4HIOA 4EX5A 3TQYA 1Q81C 1PH9A 4DNIA 1N36L 2VNUD 3OYYA 1K8AC 2L15A 1QUQA 2ID0A 1E1OA 5FLMH 3I4NG 1Q46A 1VQHA 3K80C 2JQOA 1N8RC 4POGA 2JA6H 1HR0Q 4LUZA 4DV5L 3FHWA 1MKHA 3K8AA 4C2MH 4GLAC 4OO1G 4P72A 2Y0SG 5M5WH 4LF5Q 2EIFA 5FLXc 3PGZA 1XJVA 4A3EH 4UPAA 1I94L 2CWPA 3M3YH 2QGQA 3K7UC 1S72A 1JE5A 4BA1I 4B3RQ 1MIUA 4JYAL 5FLMG 1X65A 2CQOA 2F3IA 4XIGS 2JA6G 1SROA 1YEZA 5ELOA 4NXML 1L1OA 1PFSA 2ZTEA 4YWKA 3UDGA 3S1NH 1VCIA 4DV1L 3U4VA 1EQQA 1VQ4A 3I4OA 1JMCA 5JEAJ 3STBD 4BBRH 3U4ZA 3HOWH 4AYBG 4HIKA 4ME3A 3L0OA 4A3EG 5LMUQ 2PI2A 2YYZA 2UXDQ 4DV2L 1YITA 2HHHQ 4UY8C 3KFUA 3T1YQ 2JA7G 5IYCH 1MJEA 1Y1WH 2K52A 3MXNB 4DR7Q 1XNRQ 1N33Q 4GOPC 4JG2A 4LF8Q 1X3FA 4JI2Q 2E8GA 3FKIH 2A1AA 4KI0A 2HIVA 3PIOA 4DUZL 1OTCA 2I5HA 3E9IA 1SFOH 4IFDJ 3HOWG 3AEVA 4BBSH 2WFWA 5M3MH 1QZHA 3J81c 1KC8C 1EFWA 4DR5Q 1QUQB 2N3SA 2KENA 4DV6L 3ULPA 4DR1L 2F4VL 2UXCL 1C7YA 4YWLA 5IYCG 5J3BA 1Y1WG 1LM0A 3J81i 1CUKA 1UE5A 2K75A 4DR3L 4KHPL 2EQSA 3S1RH 4YWMA 3FKIG 3AQQA 4QY7A 3S17H 3S1MH 1Q12A 4BBSG 5C0XI 3S24A 5M3MG 1XMQQ 3H3VI 1VQBA 1WOCA 4P74A 4B3SQ 3RN2A 3S2DH 2K5NA 1L1OB 3ERSX 1B8AA 4LF9L 2ZTCA 3CQZH 4P75A 3SGIA 2VW9A 1G291 1GVPA 3TS2A 2R93H 2GVAA 2MQHA 4OX9Q 2VL6A 2NVTH 1OXTA 1KAWA 4JI4Q 5ELNA 1IBML 2HHHL 4HIDA 2A8VA 4DR6Q 2BH2A 3GTQH 3JAMc 3A5ZB 1XNQQ 1WCMH 3ZJYC 3CC2A 4DR7L 3PUYA 2HIXA 3LGJA 2K50A 1EQRA 5IYBH 2E5LQ 4H02A 4LW1A 1L2FA 3JAMi 4BXXH 4GKKQ 2IHEA 3T1HQ 2R7FA 1K3RA 2R7ZG 4DR5L 2OTJA 2B3GA 1PVOA 4O2DA 1HZAA 5IYDH 1FL0A 4X65L 4JI5Q 3RNUA 3BZKA 1A8VA 1KL9A 1CSQA 1TWCH 2MO0A 4A3JH 4WJ4A 4L5RC 2AWNA 2KHIA 1FJGL 4YHHQ 1WJJA 5IYBG 2UUCQ 3GTOH 1PH7A 4L5TA 4AH6A 1PH3A 4R1JA 3HKZE 1NE3A 4JOIC 1XMQL 4LFAL 1X6OA 1AE3A 1Z47A 3U58A 5IYDG 4B3SL 4P71A 1I5FA 1IBKQ 4LF7Q 1SRUA 4IOCA 4A3JG 1C0AA 1A0IA 3PF5A 4LWCA 1E1TA 1BBUA 1GKHA 1OXSC 4X66L 4OX9L 5C4XH 1BBWA 4NPSA 2I5MX 4XTCS 5GROA 2E2JH 1WI5A 4QJFA 4JI4L 3W1BA 5M3FH 2UU9L 4JI8Q 1XPRA 4MTNA 4QIWE 1S3OA 2VQFL 1VQLA 4OXPA 4AIMA 1J5EQ 4GKKL 4L5SA 5C4XG 2F52A 3T1HL 1X55A 4LUOA 3A5UA 4DPGA 1XMOQ 2Q2IA 4A3IH 1Q7YC 1VQ7A 1CKMA 2I0QA 2IY5B 1Q8KA 3PCOB 2YU9H 2NN6G 3H3VH 2VZAA 4A76A 4BY1H 2UUBQ 2RCNA 4HJ9A 1MJCA 2LXKA 3KF6A 4YHHL 4PG3A 1B7YB 4A3KH 3CCMA 1VQ6A 5C0XG 1N32L 1HZ9A 1CKOA 3GD7A 4IJLA 4LFCQ 3HOVH 3OTOQ 4JI0L 1WYDA 1IBKL 2GVBA 3UE1A 5GQOA 3K0XA 1GM5A 1WFQA 1AH9A 2PI2E 2ZM6Q 4JI6Q 3KLWA 4BY1G 3U50C 4YY3Q 4GN4B 2WB1G 3PO2H 5BR8L 4A3KG 1HNXQ 3GTLH 5IWAL 3S2HH 2R92H 2UUAQ 4PZ6A 1OXVA 1TWFH 4RMFA 1UWVA 2UXBL 2ASBA 4IFDI 3ICEA 3F2BA 4R4TA 1V9PA 5IT9c 3DM3A 3I2ZA 3TS0A 3HOVG 1EOVA 4A93H 5LMNQ 1VQKA 4QGUA 1BKBA 3UDXA 2VQEL 3M4PA 4YCVA 3GTJH 3PO2G 4LF4L 2E2IH 3J7A5 1PH5A 2R92G 2MFIA 3HOYH 4OWTB 2AMCB 4UP7A 1IBLQ 4B3TL 4A3GH 1VQ5A 2OTLA 1UE1A 1J6QA 4DR2L 4YCWA 4DV3Q 4A3BH 4Y52H 4JI1L 2UUBL 4AQYQ 2IHFA 3KF6B 4BBRG 3PO3H 4JI3Q 1G6PA 3TREA 2VUMH 3ULLA 1NMFA 2JA9A 3AYHB 4OWXB 1PV4A 4GKJQ 3EBEA 3CCQA 1DGSA 2ZJRA 4GOPA 3HOYG 3CMEA 3VDYA 4IPCA 1HR0L 3G71A 3J80c 3OTOL 4GNXC 4K0KQ 1EYGA 3G4SA 4LF5L 3HFZB 1PH1A 4A3BG 4C3IH 1VQJA 4JI6L 4HJAA 3ULJA 3CCLA 1QZGA 1NTGA 3J80i 1PYBA 2Z0SA 3F8TA 2VUMG 3M7NA 1E24A 2KCMA 3CCEA 2UUAL 3WWVA 4B3RL 1HNWQ 4BY7H 4R4IA 2K5HA 4UP9A 2R6GA 1Q1EA 1NJIC 2EXDA 5K36G 1EWIA 3S15H 2JA8H 1KRTA 4O0AA 5E7NA 2MNAA 1HZBA 3NBHB 5IE8A 5JJLA 5LMUL 1VQAA 2UXDL 5HGQA 1GO3E 3E0EA 5JJIA 2DUDA 2K4KA 4GLVB 3T1YL 3S14H 3HOZH 1X3EA 4MZ9A 1IXRA 1XNRL 2VY3A 3W5OA 1VQPA 4JCVE 2RHSB 5LMNW 1KD1C 1NBWA 4JI2L 1HNZQ 4LF8L 2R93G 2JA8G 2JEAI 1U0LA 2Z6KC 4JI7Q 3S16H 1G51A 3RLOA 4GOPB 1OXXK 1E7ZA 1VQEA 1XPOA 3CCSA 4LF6Q 4HJ5A 3GTMH 1WCMG 2JA5H 1UE7A 2KCTA 3NELA 1YJNA 1PHJA 2YTVA 3KYHC 3G6EA 1I50H 5FJ8H 2NVXH 4BXXG 1X3GA 2YV5A 3RZOH 2BH8A 3L2PA 1EIFA 3H15A 3I55A 4A75A 4A3LH 3PUWA 1NY4A 4NB3A 4X62Q 2WP8J 5C0XJ 3KJOA 1KRSA 1VQCA 1TXYA 2H5XA 3IRBA 4LFBQ 4PZ7A 3D0FA 3HKSA 3I4MH 1E22A 2RHQB 3CPWA 4R4CA 2JK8A 1R9TH 1EIYB 1N34Q 2OQ0A 4PMWA 3CCVA 1A63A 5FJ8G 3E9HA 4JOIA 3CCJA 3F2DA 1KXLA 1Y1VH 1QVCA 2N49A 1X54A 1H95A 3GTPH 4DR6L 3TEHB 1T9HA 1XNQL 3AFQA 1ASYA 3CP0A 1N36Q 2E2HH 2VS1A 1Q82C 3HKZG 4A3CH 1HNWL 4WJ3M 2E5LL 4NXNQ 4X6AH 2D0OA 4ALPA 4DK6C 1IL2A 2LSSA 5IP9H 4DV5Q 4DAYB 3L7ZC 3I7FA 4HIMA 3GDEA 4A3MH 3RLNA 3J81j 1PH4A 3H0GH 4C3JH 5M5XH 1QVGA 5M3FG 1JJGA 2CCZA 4JI5L 2KHJA 4HJ7A 1I94Q 4LNQA 1VS0A 4A3CG 1YNXA 5JJKA 1QVFA 3AFPA 4DV4Q 2BA0A 4RG1A 3HOXH 4L5QA 2B29A 3J7ZC 2UUCL 4NXMQ 3W1GA 1I3QH 2CFMA 5IP9G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HY6 A;  4A3M G;  4DV1 Q;  2WAQ E;  4J15 A;  4A3I G;  1D8L A;  4JBM A;  3H0G G;  2D0P A;  4LFB L;  1YI2 A;  2K14 A;  1IZ6 A;  3D31 A;  3JC6 6;  4Y7N H;  4LF7 L;  2C35 B;  4DUY Q;  4JBW A;  2JE6 I;  2Y0S E;  3ER0 A;  4DV2 Q;  1FVI A;  2K5V A;  4EQ5 A;  2QEX A;  5GAG C;  5EAY A;  1YZ6 A;  4DK3 C;  5GAE C;  5C3E H;  3HOX G;  3DLL A;  1L0W A;  2ATW A;  3BU2 A;  3K7A H;  1KIX A;  2NVY H;  3EN2 A;  2ZJP A;  5IY0 A;  1XPU A;  3GO5 A;  1LYL A;  4TQU S;  4DUZ Q;  3RN5 A;  3UDF A;  4JI8 L;  3OW2 A;  4JC0 A;  3RR5 A;  4BA2 I;  1TWG H;  5IP7 H;  1K73 C;  1VQI A;  1C9O A;  1RL2 A;  4MNO A;  2WAQ G;  4DV6 Q;  4IO9 A;  2XTI A;  4DR1 Q;  1ASZ A;  2F4V Q;  1J5E L;  4NXN L;  2UXC Q;  4AYB E;  2LXJ A;  5C3E G;  1SLJ A;  2NVQ H;  1XMO L;  2GN5 A;  4IPG A;  4DR3 Q;  3K81 C;  3KJP A;  4KHP Q;  3KOJ A;  2DGY A;  1L1O C;  1S40 A;  3CW2 C;  1VQM A;  3CCU A;  2Q2T A;  4LUV A;  4A93 G;  1W3S A;  1VQD A;  1K83 H;  4JBJ A;  5IP7 G;  1SN8 A;  4GLX A;  1X9N A;  2JA7 H;  4DV4 L;  1RIP A;  1O7I A;  4DR4 Q;  3HOU H;  4POF A;  4HJ8 A;  2IT1 A;  3NEN A;  1I6H H;  1YHB A;  1Z9F A;  2NZO A;  4LF9 Q;  2N78 A;  4LFC L;  2Q2H A;  5GAD C;  4A3G G;  3PUX A;  2PNH A;  5DLQ E;  4KLK A;  4DUY L;  3UDI A;  4UP8 A;  2ZM6 L;  1IBM Q;  4JBK A;  4YY3 L;  3RLF A;  3KDF A;  4IJH A;  4DKA C;  1V1Q A;  1YVC A;  1PH6 A;  3PF4 A;  1HNX L;  3PO3 G;  3HOU G;  4KHZ A;  3CCR A;  1YJW A;  4GNX A;  1VQ9 A;  1KQS A;  1B70 B;  4A3D H;  4JV5 Q;  2YTX A;  3S1Q H;  5LMN L;  4DAM A;  1BVS A;  3M9B A;  4GN5 A;  4IPH A;  2A19 A;  2R7D A;  1E3P A;  3BJU A;  5H1S E;  1FGU A;  3I56 A;  1Q86 C;  1HH2 P;  2NN6 I;  4X65 Q;  5AJ3 Q;  2ES2 A;  2BA1 A;  1JT8 A;  3CMA A;  2JEB I;  2ZJQ A;  4BY7 G;  1PYS B;  1CKN A;  2HT1 A;  1IBL L;  1FJG Q;  1YHQ A;  1UEB A;  3A0J A;  4A3D G;  1VQ8 A;  4DV3 L;  4PZ8 A;  1SE8 A;  4AQY L;  2OQK A;  3PUV A;  4LFA Q;  4JI3 L;  4DR4 L;  1UE6 A;  2YTY A;  2N8N A;  4OO1 I;  1HR0 W;  3GTG H;  1AE2 A;  3PV0 A;  4GKJ L;  5C44 H;  1N9W A;  1V43 A;  4B3M Q;  4GN3 B;  5JEA G;  1VQN A;  3B6Y A;  3M4Q A;  4X66 Q;  4K0K L;  3F1Z A;  3PIP A;  1A62 A;  2R7Z H;  2NZH A;  1KHI A;  2Z6K A;  2OCE A;  2KBN A;  4OON A;  3HOZ G;  2AKW B;  3KDF B;  2CKZ B;  1M90 C;  2AWO A;  2UU9 Q;  4IOA A;  2V1C C;  3M4O H;  1YBY A;  2VQF Q;  2PQA A;  4DV0 Q;  4GNX B;  5C44 G;  4YCU A;  3CPF A;  4P73 A;  1W2B A;  1TWA H;  1HZC A;  1Q1B A;  1VQG A;  4APV A;  2IX0 A;  1LUZ A;  4IFD G;  4JV5 L;  2JA5 G;  2Q2U A;  1U5K A;  3Q8D A;  3GTK H;  1YIJ A;  3CC4 A;  1SMX A;  2IX1 A;  4R4O A;  2ALY B;  4QQB X;  5AJ3 L;  2JJQ A;  1P8L A;  3M85 A;  3MEF A;  4X64 Q;  1M1K C;  2FXQ A;  4A3L G;  4DV7 Q;  3KF8 B;  1JB7 A;  1CKN B;  3CXC A;  3NEM A;  3I4M G;  1SR3 A;  4IPD A;  1K9M C;  1HNZ L;  1IYJ B;  4TVA B;  2D62 A;  1N32 Q;  3A74 A;  2B63 H;  2QA4 A;  4A4I A;  1PH2 A;  1PH8 A;  4JI0 Q;  1Y1V G;  4GS3 A;  3F2C A;  4JI7 L;  2OWO A;  3PUZ A;  3TRZ A;  2RF4 A;  4B3M L;  3CAM A;  4LF6 L;  3CC7 A;  2HQL A;  2MO1 A;  1P16 A;  5BR8 Q;  3CD6 A;  5IWA Q;  1K8G A;  4C3H H;  5C4J H;  4JYA Q;  1JJ2 A;  2UXB Q;  1XTD A;  4QL5 A;  1YHA A;  2I5L X;  3FP9 A;  3STB C;  1K0R A;  3CF5 A;  4A3F H;  1PA6 A;  2B63 G;  1CSP A;  2ZTD A;  4X62 L;  1N33 L;  2PQA B;  2CWA A;  2VQE Q;  4DV0 L;  5M5Y H;  1YJ9 A;  3G48 A;  2PMZ E;  1NMG A;  4LF4 Q;  1VQF A;  3I4N H;  1HJP A;  1GD7 A;  3BZC A;  1TWH H;  1Y14 B;  4R4Q A;  1N34 L;  1X56 A;  2WB1 E;  1EUJ A;  4B3T Q;  1LTL A;  4A3F G;  1OXU A;  3PSI A;  3RZD H;  2XGT A;  3UE0 A;  4DR2 Q;  4FDB A;  4X64 L;  5GAH C;  4JI1 Q;  2AHO B;  1JJC B;  4DV7 L;  4OWW B;  1VQO A;  1D7Q A;  3EIV A;  4HIO A;  4EX5 A;  3TQY A;  1Q81 C;  1PH9 A;  4DNI A;  1N36 L;  2VNU D;  3OYY A;  1K8A C;  2L15 A;  1QUQ A;  2ID0 A;  1E1O A;  5FLM H;  3I4N G;  1Q46 A;  1VQH A;  3K80 C;  2JQO A;  1N8R C;  4POG A;  2JA6 H;  1HR0 Q;  4LUZ A;  4DV5 L;  3FHW A;  1MKH A;  3K8A A;  4C2M H;  4GLA C;  4OO1 G;  4P72 A;  2Y0S G;  5M5W H;  4LF5 Q;  2EIF A;  5FLX c;  3PGZ A;  1XJV A;  4A3E H;  4UPA A;  1I94 L;  2CWP A;  3M3Y H;  2QGQ A;  3K7U C;  1S72 A;  1JE5 A;  4BA1 I;  4B3R Q;  1MIU A;  4JYA L;  5FLM G;  1X65 A;  2CQO A;  2F3I A;  4XIG S;  2JA6 G;  1SRO A;  1YEZ A;  5ELO A;  4NXM L;  1L1O A;  1PFS A;  2ZTE A;  4YWK A;  3UDG A;  3S1N H;  1VCI A;  4DV1 L;  3U4V A;  1EQQ A;  1VQ4 A;  3I4O A;  1JMC A;  5JEA J;  3STB D;  4BBR H;  3U4Z A;  3HOW H;  4AYB G;  4HIK A;  4ME3 A;  3L0O A;  4A3E G;  5LMU Q;  2PI2 A;  2YYZ A;  2UXD Q;  4DV2 L;  1YIT A;  2HHH Q;  4UY8 C;  3KFU A;  3T1Y Q;  2JA7 G;  5IYC H;  1MJE A;  1Y1W H;  2K52 A;  3MXN B;  4DR7 Q;  1XNR Q;  1N33 Q;  4GOP C;  4JG2 A;  4LF8 Q;  1X3F A;  4JI2 Q;  2E8G A;  3FKI H;  2A1A A;  4KI0 A;  2HIV A;  3PIO A;  4DUZ L;  1OTC A;  2I5H A;  3E9I A;  1SFO H;  4IFD J;  3HOW G;  3AEV A;  4BBS H;  2WFW A;  5M3M H;  1QZH A;  3J81 c;  1KC8 C;  1EFW A;  4DR5 Q;  1QUQ B;  2N3S A;  2KEN A;  4DV6 L;  3ULP A;  4DR1 L;  2F4V L;  2UXC L;  1C7Y A;  4YWL A;  5IYC G;  5J3B A;  1Y1W G;  1LM0 A;  3J81 i;  1CUK A;  1UE5 A;  2K75 A;  4DR3 L;  4KHP L;  2EQS A;  3S1R H;  4YWM A;  3FKI G;  3AQQ A;  4QY7 A;  3S17 H;  3S1M H;  1Q12 A;  4BBS G;  5C0X I;  3S24 A;  5M3M G;  1XMQ Q;  3H3V I;  1VQB A;  1WOC A;  4P74 A;  4B3S Q;  3RN2 A;  3S2D H;  2K5N A;  1L1O B;  3ERS X;  1B8A A;  4LF9 L;  2ZTC A;  3CQZ H;  4P75 A;  3SGI A;  2VW9 A;  1G29 1;  1GVP A;  3TS2 A;  2R93 H;  2GVA A;  2MQH A;  4OX9 Q;  2VL6 A;  2NVT H;  1OXT A;  1KAW A;  4JI4 Q;  5ELN A;  1IBM L;  2HHH L;  4HID A;  2A8V A;  4DR6 Q;  2BH2 A;  3GTQ H;  3JAM c;  3A5Z B;  1XNQ Q;  1WCM H;  3ZJY C;  3CC2 A;  4DR7 L;  3PUY A;  2HIX A;  3LGJ A;  2K50 A;  1EQR A;  5IYB H;  2E5L Q;  4H02 A;  4LW1 A;  1L2F A;  3JAM i;  4BXX H;  4GKK Q;  2IHE A;  3T1H Q;  2R7F A;  1K3R A;  2R7Z G;  4DR5 L;  2OTJ A;  2B3G A;  1PVO A;  4O2D A;  1HZA A;  5IYD H;  1FL0 A;  4X65 L;  4JI5 Q;  3RNU A;  3BZK A;  1A8V A;  1KL9 A;  1CSQ A;  1TWC H;  2MO0 A;  4A3J H;  4WJ4 A;  4L5R C;  2AWN A;  2KHI A;  1FJG L;  4YHH Q;  1WJJ A;  5IYB G;  2UUC Q;  3GTO H;  1PH7 A;  4L5T A;  4AH6 A;  1PH3 A;  4R1J A;  3HKZ E;  1NE3 A;  4JOI C;  1XMQ L;  4LFA L;  1X6O A;  1AE3 A;  1Z47 A;  3U58 A;  5IYD G;  4B3S L;  4P71 A;  1I5F A;  1IBK Q;  4LF7 Q;  1SRU A;  4IOC A;  4A3J G;  1C0A A;  1A0I A;  3PF5 A;  4LWC A;  1E1T A;  1BBU A;  1GKH A;  1OXS C;  4X66 L;  4OX9 L;  5C4X H;  1BBW A;  4NPS A;  2I5M X;  4XTC S;  5GRO A;  2E2J H;  1WI5 A;  4QJF A;  4JI4 L;  3W1B A;  5M3F H;  2UU9 L;  4JI8 Q;  1XPR A;  4MTN A;  4QIW E;  1S3O A;  2VQF L;  1VQL A;  4OXP A;  4AIM A;  1J5E Q;  4GKK L;  4L5S A;  5C4X G;  2F52 A;  3T1H L;  1X55 A;  4LUO A;  3A5U A;  4DPG A;  1XMO Q;  2Q2I A;  4A3I H;  1Q7Y C;  1VQ7 A;  1CKM A;  2I0Q A;  2IY5 B;  1Q8K A;  3PCO B;  2YU9 H;  2NN6 G;  3H3V H;  2VZA A;  4A76 A;  4BY1 H;  2UUB Q;  2RCN A;  4HJ9 A;  1MJC A;  2LXK A;  3KF6 A;  4YHH L;  4PG3 A;  1B7Y B;  4A3K H;  3CCM A;  1VQ6 A;  5C0X G;  1N32 L;  1HZ9 A;  1CKO A;  3GD7 A;  4IJL A;  4LFC Q;  3HOV H;  3OTO Q;  4JI0 L;  1WYD A;  1IBK L;  2GVB A;  3UE1 A;  5GQO A;  3K0X A;  1GM5 A;  1WFQ A;  1AH9 A;  2PI2 E;  2ZM6 Q;  4JI6 Q;  3KLW A;  4BY1 G;  3U50 C;  4YY3 Q;  4GN4 B;  2WB1 G;  3PO2 H;  5BR8 L;  4A3K G;  1HNX Q;  3GTL H;  5IWA L;  3S2H H;  2R92 H;  2UUA Q;  4PZ6 A;  1OXV A;  1TWF H;  4RMF A;  1UWV A;  2UXB L;  2ASB A;  4IFD I;  3ICE A;  3F2B A;  4R4T A;  1V9P A;  5IT9 c;  3DM3 A;  3I2Z A;  3TS0 A;  3HOV G;  1EOV A;  4A93 H;  5LMN Q;  1VQK A;  4QGU A;  1BKB A;  3UDX A;  2VQE L;  3M4P A;  4YCV A;  3GTJ H;  3PO2 G;  4LF4 L;  2E2I H;  3J7A 5;  1PH5 A;  2R92 G;  2MFI A;  3HOY H;  4OWT B;  2AMC B;  4UP7 A;  1IBL Q;  4B3T L;  4A3G H;  1VQ5 A;  2OTL A;  1UE1 A;  1J6Q A;  4DR2 L;  4YCW A;  4DV3 Q;  4A3B H;  4Y52 H;  4JI1 L;  2UUB L;  4AQY Q;  2IHF A;  3KF6 B;  4BBR G;  3PO3 H;  4JI3 Q;  1G6P A;  3TRE A;  2VUM H;  3ULL A;  1NMF A;  2JA9 A;  3AYH B;  4OWX B;  1PV4 A;  4GKJ Q;  3EBE A;  3CCQ A;  1DGS A;  2ZJR A;  4GOP A;  3HOY G;  3CME A;  3VDY A;  4IPC A;  1HR0 L;  3G71 A;  3J80 c;  3OTO L;  4GNX C;  4K0K Q;  1EYG A;  3G4S A;  4LF5 L;  3HFZ B;  1PH1 A;  4A3B G;  4C3I H;  1VQJ A;  4JI6 L;  4HJA A;  3ULJ A;  3CCL A;  1QZG A;  1NTG A;  3J80 i;  1PYB A;  2Z0S A;  3F8T A;  2VUM G;  3M7N A;  1E24 A;  2KCM A;  3CCE A;  2UUA L;  3WWV A;  4B3R L;  1HNW Q;  4BY7 H;  4R4I A;  2K5H A;  4UP9 A;  2R6G A;  1Q1E A;  1NJI C;  2EXD A;  5K36 G;  1EWI A;  3S15 H;  2JA8 H;  1KRT A;  4O0A A;  5E7N A;  2MNA A;  1HZB A;  3NBH B;  5IE8 A;  5JJL A;  5LMU L;  1VQA A;  2UXD L;  5HGQ A;  1GO3 E;  3E0E A;  5JJI A;  2DUD A;  2K4K A;  4GLV B;  3T1Y L;  3S14 H;  3HOZ H;  1X3E A;  4MZ9 A;  1IXR A;  1XNR L;  2VY3 A;  3W5O A;  1VQP A;  4JCV E;  2RHS B;  5LMN W;  1KD1 C;  1NBW A;  4JI2 L;  1HNZ Q;  4LF8 L;  2R93 G;  2JA8 G;  2JEA I;  1U0L A;  2Z6K C;  4JI7 Q;  3S16 H;  1G51 A;  3RLO A;  4GOP B;  1OXX K;  1E7Z A;  1VQE A;  1XPO A;  3CCS A;  4LF6 Q;  4HJ5 A;  3GTM H;  1WCM G;  2JA5 H;  1UE7 A;  2KCT A;  3NEL A;  1YJN A;  1PHJ A;  2YTV A;  3KYH C;  3G6E A;  1I50 H;  5FJ8 H;  2NVX H;  4BXX G;  1X3G A;  2YV5 A;  3RZO H;  2BH8 A;  3L2P A;  1EIF A;  3H15 A;  3I55 A;  4A75 A;  4A3L H;  3PUW A;  1NY4 A;  4NB3 A;  4X62 Q;  2WP8 J;  5C0X J;  3KJO A;  1KRS A;  1VQC A;  1TXY A;  2H5X A;  3IRB A;  4LFB Q;  4PZ7 A;  3D0F A;  3HKS A;  3I4M H;  1E22 A;  2RHQ B;  3CPW A;  4R4C A;  2JK8 A;  1R9T H;  1EIY B;  1N34 Q;  2OQ0 A;  4PMW A;  3CCV A;  1A63 A;  5FJ8 G;  3E9H A;  4JOI A;  3CCJ A;  3F2D A;  1KXL A;  1Y1V H;  1QVC A;  2N49 A;  1X54 A;  1H95 A;  3GTP H;  4DR6 L;  3TEH B;  1T9H A;  1XNQ L;  3AFQ A;  1ASY A;  3CP0 A;  1N36 Q;  2E2H H;  2VS1 A;  1Q82 C;  3HKZ G;  4A3C H;  1HNW L;  4WJ3 M;  2E5L L;  4NXN Q;  4X6A H;  2D0O A;  4ALP A;  4DK6 C;  1IL2 A;  2LSS A;  5IP9 H;  4DV5 Q;  4DAY B;  3L7Z C;  3I7F A;  4HIM A;  3GDE A;  4A3M H;  3RLN A;  3J81 j;  1PH4 A;  3H0G H;  4C3J H;  5M5X H;  1QVG A;  5M3F G;  1JJG A;  2CCZ A;  4JI5 L;  2KHJ A;  4HJ7 A;  1I94 Q;  4LNQ A;  1VS0 A;  4A3C G;  1YNX A;  5JJK A;  1QVF A;  3AFP A;  4DV4 Q;  2BA0 A;  4RG1 A;  3HOX H;  4L5Q A;  2B29 A;  3J7Z C;  2UUC L;  4NXM Q;  3W1G A;  1I3Q H;  2CFM A;  5IP9 G; 
#chains in the Genus database with same CATH topology
 1A3V A;  5HY6 A;  4DV1 Q;  4A3I G;  3ERQ A;  3D6C A;  2ICI A;  2O4X A;  1FR3 A;  4LF7 L;  4JBW A;  4DU9 A;  2Y0S E;  4EQ5 A;  5GAE C;  4DK3 C;  1YZ6 A;  5C3E H;  1T5X D;  1KIX A;  3E3X A;  1K3B C;  3GO5 A;  1LYL A;  4TQU S;  4DUZ Q;  3RN5 A;  1KDC A;  2CH4 A;  2F0P A;  2WAQ G;  5C6A A;  4DV6 Q;  1PMR A;  4K8J A;  5KND A;  4DR1 Q;  4NXN L;  2LXJ A;  3NTK A;  1Y8P B;  4DR3 Q;  1MBY A;  1L1O C;  3CW2 C;  1GUO A;  1W3S A;  3C3L A;  3GTO B;  3EVQ A;  1K83 H;  2TSS A;  1RCV D;  1O7Y A;  1F2L A;  2HQE A;  1CM9 A;  5ELD A;  4X3U A;  1LLR D;  1SYE A;  4POF A;  4HJ8 A;  2NZO A;  2Q2H A;  5GAD C;  1BUV T;  4DUY L;  4H0L C;  1IBM Q;  3RLF A;  4DKA C;  1V1Q A;  1YNJ D;  3PO3 G;  2WIN B;  4PMB A;  1B70 B;  4DK0 A;  4JV5 Q;  5LMN L;  3T16 A;  4IPH A;  2A19 A;  2R7D A;  3OSO A;  1Q86 C;  2NZ1 D;  3BZD B;  4ZYS A;  4IUU A;  2JEB I;  4IUQ A;  4BY7 G;  2JXM B;  1HHV A;  4A3K B;  3NP8 A;  1RF2 D;  2L12 A;  4DV3 L;  1SE8 A;  3X3M A;  4JI3 L;  3HOV B;  1WTO A;  1AE2 A;  3TZD A;  2L55 A;  1D5X C;  5C44 H;  1N9W A;  1ESF A;  1V43 A;  5I9P A;  5JEA G;  3M4Q A;  4KJN A;  2HCI A;  2RVL A;  4K0K L;  3GTL B;  3PIP A;  2R92 B;  3HOZ G;  2Z6K A;  3V96 A;  4ULL A;  2V1C C;  2RDF A;  1DZ1 A;  3T4A C;  3AU7 A;  4BBR B;  1VQG A;  2Q2U A;  2E2I B;  1U5K A;  1NAP A;  2IX1 A;  1F9S A;  3HOY B;  1ICW A;  3MEH A;  5FO8 B;  5AJ3 L;  1P8L A;  3M7G A;  1IHZ A;  1JB7 A;  3CXC A;  3NEM A;  1SR3 A;  3VR4 A;  1ZKO A;  1Q8I A;  4IN3 A;  1DM0 B;  3GV3 A;  1HNZ L;  1IYJ B;  4TVA B;  2D62 A;  4ZQ3 A;  2AUK A;  2QA4 A;  4A4I A;  1PH8 A;  1BDO A;  3EJI A;  5FO7 B;  2L5T A;  3F2C A;  2RF4 A;  4C3I B;  3DEO A;  4LMQ D;  1K8G A;  4C3H H;  4V19 0;  2L9H A;  1XTD A;  1F2Z A;  1YHA A;  2I5L X;  3FP9 A;  1K0R A;  2NN6 H;  4A3F H;  1PA6 A;  1DOK A;  1CSP A;  1RJT A;  2EE1 A;  1EY5 A;  2ZTD A;  4X62 L;  1U4P A;  3MWY W;  1BO0 A;  2F0L A;  1U4L A;  4HMI A;  3V05 A;  1SSO A;  5D65 A;  1EUJ A;  3S14 B;  1WCM B;  3RZD H;  5GAH C;  4X64 L;  2AHO B;  1BF4 A;  1VQO A;  3BDO A;  2K33 A;  1B1Z A;  3SE0 A;  1Q81 C;  1K8A C;  1FD7 D;  5ISR A;  1VQH A;  3R2I A;  1HR0 Q;  2WKD A;  4G7Z C;  4P72 A;  2Y0S G;  4LF5 Q;  3OWE B;  2DNE A;  1XTC D;  1I94 L;  1FNU A;  1S72 A;  1JE5 A;  4BA1 I;  5C4Z A;  4JYA L;  1X65 A;  5AFW A;  2F3I A;  1YEZ A;  5ELO A;  1PTO H;  1L1O A;  1PFS A;  3HKZ B;  3I4O A;  3STB D;  4CDD C;  3L0O A;  5LMU Q;  3SK4 A;  3GTP B;  1RD9 D;  1C48 A;  1STG A;  4ZK9 B;  4OIJ A;  1MJE A;  1B2T A;  4GOP C;  2E2H B;  1X3F A;  4JI2 Q;  3FKI H;  1TKW B;  1SFO H;  3HOW G;  2WFW A;  3DUZ A;  1KC8 C;  3J81 c;  3NBI A;  4C3J B;  1C7Y A;  3AB9 A;  4YWL A;  5IYC G;  1Y1W G;  1CUK A;  5K36 H;  2K75 A;  1LAC A;  3I72 A;  4KHV A;  3S1R H;  1BQQ T;  4KHP L;  3HOX B;  3QWN A;  3T51 B;  1LTB D;  1O7Z A;  4BBS G;  5C0X I;  1TII D;  1XMQ Q;  1W6K A;  5CMD A;  4RGM A;  1VQB A;  1PXU A;  3RN2 A;  1L1O B;  3ERS X;  5C3W A;  2ZTC A;  3TS2 A;  2VW9 A;  2F0J A;  3BDL A;  2QW7 A;  2VL6 A;  2O5J C;  1SYF A;  1ROD A;  3N52 A;  4IUV A;  4ZUJ A;  1NR2 A;  2RCF A;  4HID A;  2A8V A;  4B08 A;  3UI2 A;  4CDC C;  3MA2 B;  3A5Z B;  4IQZ A;  4A93 B;  1STN A;  3CRL C;  5JVG 3;  3R8B A;  2F0I A;  3JAM L;  3LGJ A;  5IYB H;  2E5L Q;  2RQX A;  4ME5 A;  5DAU A;  1L2F A;  2ZT9 C;  3GTJ B;  2HCC A;  4GKK Q;  2IHE A;  2R7F A;  1HXY D;  2R7Z G;  1UEA B;  2B3G A;  1MI2 A;  4X65 L;  4K14 A;  1TR5 A;  3DXJ C;  1PTO D;  1WJJ A;  2UUC Q;  1CI3 M;  3GTO H;  2XWB B;  1CT1 D;  1NE3 A;  2VB3 X;  5CV8 A;  3A8J E;  4J1M A;  4JOI C;  1J9O A;  1AE3 A;  3MXP A;  5DNF A;  1I5F A;  4RAU C;  4IOC A;  1A0I A;  3W3A A;  1E1T A;  1BBU A;  4OX9 L;  4NPS A;  2XVS A;  4G57 A;  4OHJ A;  3I70 A;  1MHW C;  2UU9 L;  2PZW A;  4JI8 Q;  4A3D B;  1S3O A;  2VQF L;  1A2U A;  2E75 C;  4ZAI A;  3BS1 A;  2Z8L A;  4AIM A;  4L5S A;  4OL7 A;  4LUO A;  4DPG A;  1Q8K A;  3PCO B;  3ZYY X;  3GQB A;  4CBV A;  2LXK A;  4A3K H;  1B7Y B;  4FF4 A;  1L0Y B;  1VQ6 A;  2D2C C;  2HDL A;  1EY9 A;  4NMZ A;  2EOT A;  3NWT A;  3SR1 A;  3S16 B;  1N32 L;  1CKO A;  3HOV H;  1WYD A;  2JA5 B;  5GQO A;  2G5D A;  2PI2 E;  4JI6 Q;  3LWU A;  4GN4 B;  3RD4 A;  2EJF C;  5BR8 L;  1HNX Q;  3GTL H;  2R92 H;  2RBM A;  4PZ6 A;  1TWF H;  4RMF A;  2UXB L;  3HP3 A;  2ASB A;  1V9P A;  3I4M B;  5FOB B;  3PQI A;  5J22 A;  2JSO A;  2VQE L;  3GTK B;  2A68 C;  3PO2 G;  1Y1V B;  3E5S A;  4LF4 L;  2E2I H;  3I90 A;  1TT2 A;  3HOY H;  2EVB A;  4A3G H;  4OIK A;  4JK1 C;  2OTL A;  4PMC A;  1J6Q A;  4DR2 L;  1QE6 A;  4JI1 L;  1TVX A;  1B44 D;  2UUB L;  3O13 A;  2Z1C A;  2B63 B;  1KDB A;  3D4W A;  4GOP A;  2ENB A;  2ZJR A;  3CCQ A;  4C1N K;  4K8I A;  3J80 c;  3OTO L;  3HFZ B;  5T1G A;  4C3I H;  1EZ6 A;  1W6J A;  4DXF A;  1WTQ A;  3EA6 A;  3FRP B;  1SE4 A;  2K5H A;  1WD0 A;  5M5Y B;  3GP7 A;  5JOB A;  3AMU A;  2WKC A;  1NJI C;  1C4Q A;  1EWI A;  3FVQ A;  1WTH A;  1D1K A;  3H09 A;  2K6A A;  2BDO A;  4O42 A;  4HTH A;  5JJI A;  3NXW A;  3NK9 A;  1ESR A;  1KAA A;  3S14 H;  2PQE A;  1HNW Q;  1OO9 B;  3W5O A;  5LMN W;  3MZ5 A;  1WTV A;  1FGB D;  2XIW A;  2JA6 B;  1GOZ A;  2QF7 A;  4CGY B;  4C2M B;  4XDX A;  1B3Q A;  4GOP B;  1ENC A;  1S5E D;  3U9S A;  1FNW A;  5EKK A;  1WD1 A;  4BXX G;  1IW7 D;  3L2P A;  1EIF A;  3H15 A;  2OT2 A;  3I55 A;  1NY4 A;  1N33 Q;  1KRS A;  3IRB A;  1IYV A;  2H5X A;  2QEJ C;  2BE5 D;  2C9O A;  3D0F A;  1E22 A;  2EPB A;  1EIH A;  1A63 A;  1LO5 D;  5CYU A;  5FO9 B;  5FJ8 G;  3E9H A;  4TSS A;  2A73 B;  4JOI A;  4CKE A;  3F2D A;  3CCJ A;  2K03 A;  4LAA A;  3DWQ A;  1Q90 A;  3GTP H;  2DNC A;  4DR6 L;  3KLR A;  5IIF A;  1T9H A;  3AFQ A;  3DWA A;  4IUT A;  4DAP A;  2E2H H;  4A3C H;  5M3M B;  2EYF A;  2OXP A;  1O78 A;  1V1O A;  1JOO A;  2F0H A;  4X6A H;  2D0O A;  4RH6 A;  1SJH D;  4DV5 Q;  4HIM A;  3GDE A;  4XYO A;  4C3J H;  1QVG A;  1QIL A;  5M3F G;  1JJG A;  1VF7 A;  4LNQ A;  1C8C A;  2RKS A;  4ZKC B;  5EGT A;  3HOX H;  2B29 A;  3K5N A;  5A35 A;  5IP9 G;  2WAQ E;  3H0G G;  2K14 A;  1EL0 A;  3D31 A;  2NVT B;  2JE6 I;  4DAV A;  4KY7 A;  1FVI A;  2K5V A;  4FVM A;  2PNR C;  2EJM A;  5GAG C;  2QEX A;  5COY A;  2WAC A;  3EN2 A;  2ZJP A;  1XPU A;  3UDF A;  3OW2 A;  1I4X A;  1BCP C;  5IP7 H;  1VQI A;  3PIO 3;  1C9O A;  4IO9 A;  5BN3 A;  2XTI A;  1ASZ A;  1J5E L;  2F0F A;  5C3E G;  1MGS A;  1SLJ A;  3MAQ A;  3KOJ A;  4RFB A;  1S40 A;  1VQM A;  1U4R A;  2HDM A;  2A6E D;  1CQV A;  1O7I A;  1NCV A;  2PZU A;  3EQL C;  4LF9 Q;  4LFC L;  2IPK D;  4DK1 A;  1GHK A;  1SE3 A;  3DEP A;  3A56 A;  5C4X B;  2K5Q A;  4KLK A;  4C3H B;  3UDI A;  2ZM6 L;  4YY3 L;  1YVC A;  1EQT A;  1PH6 A;  1LTA D;  4KHZ A;  1YJW A;  5CV9 A;  3QOJ A;  1VQ9 A;  1LTS D;  4XT3 B;  1EYC A;  3KBG A;  2R3Z A;  4A3D H;  2QKI C;  3M9B A;  1E3P A;  4MN3 A;  5H1S E;  1FGU A;  2KHS A;  3RZD B;  2ES2 A;  1JT8 A;  1STH A;  3CMA A;  5FLX E;  2SDF A;  2F0K A;  3KF8 A;  4BY1 B;  1FJG Q;  4ZLT F;  4U67 3;  5CC4 A;  1H9M A;  1SMY C;  4KTA A;  4AQY L;  2OQK A;  1HQM C;  3A55 A;  1UE6 A;  2N8N A;  5IGE A;  4OO1 I;  2PW7 A;  4B3M Q;  4GN3 B;  1VQN A;  2BCO A;  1EU3 A;  1JWS D;  4G4K A;  3S2H B;  5ELC A;  3F1Z A;  2AKW B;  4UDU C;  2VB2 X;  2QDL A;  3Q24 A;  1NUC A;  3T53 B;  3NUC A;  1YBY A;  4DNT B;  2L4N A;  4DV0 Q;  5C44 G;  4YCU A;  5CBE E;  3CPF A;  4IFD G;  3C2P A;  1Q1B A;  4MIU A;  2IX0 A;  1LUZ A;  4JV5 L;  3HZX A;  3GTK H;  4R4O A;  4QQB X;  3IFD A;  3TP5 A;  2JJQ A;  3L9A X;  3MEF A;  4JVZ A;  2FXQ A;  2X6L A;  3KF8 B;  1SFO B;  5ELF A;  1K9M C;  1GUT A;  2KUM A;  5KIX A;  5IGC A;  2VUM B;  4BS9 A;  1PTO F;  2B63 H;  1PZJ D;  1PH2 A;  5G3L F;  4JI0 Q;  2A69 C;  4GS3 A;  5J1Z A;  4JI7 L;  2OWO A;  3S1R B;  1ICF B;  5L37 A;  1TU2 B;  3ERO A;  4LF6 L;  1P16 A;  1CQF A;  3CD6 A;  5IWA Q;  1U4M A;  5EPJ A;  4B9W A;  4KV6 A;  4FNF A;  1SNM A;  2B2U C;  3X3N A;  1F9Q A;  2CWA A;  2Q8R E;  4N9P A;  5M5Y H;  2JA8 B;  3SXH A;  5F2D A;  1K8O A;  1VQF A;  1BR9 A;  4C3H G;  2WV6 D;  1TWH H;  1X56 A;  4B3T Q;  4A3F G;  3PSI A;  3HG9 A;  4L8J A;  5C3X A;  4OWW B;  4C56 C;  4DXG A;  4HIO A;  4EX5 A;  3TQY A;  1PH9 A;  5KYI A;  1N36 L;  5JPM C;  1QUQ A;  5FLM H;  1E1O A;  1AZP A;  1Q46 A;  2JA6 H;  2JQO A;  1N8R C;  4LUZ A;  3C46 A;  3FHW A;  1MKH A;  4C2M H;  2A74 C;  2EIF A;  4X3S A;  1LT3 D;  4UPA A;  2CWP A;  2QGQ A;  3K7U C;  4HN7 A;  5FLX L;  2CQO A;  4XIG S;  5E4W C;  3I8Z A;  4YWK A;  3S1N H;  3U4V A;  4B9X A;  1VQ4 A;  5JEA J;  2AQ2 B;  3U4Z A;  2V4D A;  4XQJ A;  5C5M A;  2YYZ A;  4DV2 L;  4UY8 C;  2A6H C;  3NSW A;  2RA4 A;  2JA7 G;  4DR7 Q;  2KA7 A;  2ZXR A;  4ZCK A;  1R4P B;  1K0S A;  4LF8 Q;  2TMP A;  2A1A A;  4KI0 A;  2HIV A;  3A7L A;  4UAI A;  3VYT A;  1YNN C;  2Q8T A;  5M3M H;  4A3M B;  1QUQ B;  5K5P A;  1CZW A;  2N3S A;  2F4V L;  2UXC L;  1VDZ A;  3J81 i;  4H7B A;  1BCP B;  2L1B A;  3MXG A;  3A54 A;  3FKI G;  2EYL A;  4YWM A;  1DD2 A;  1WTP A;  2HUG A;  1EWC A;  3PIP 3;  1I3Q B;  2EDG A;  3S24 A;  4PQX A;  3K58 A;  4P74 A;  1DXM A;  2K5N A;  1F9P A;  2R93 H;  1LTR D;  2NVT H;  4JI4 Q;  1TWF B;  1JC7 A;  1KLU D;  4RGT A;  2EXZ A;  4KN4 C;  2KVM A;  3QB3 A;  3PUY A;  1G2S A;  1EEI D;  2PO4 A;  5E4X A;  1SBB B;  2G9H D;  1SNO A;  2NVQ B;  4EQN A;  2OTJ A;  2JN4 A;  2JP1 A;  2K04 A;  1EY6 A;  5CBA E;  4O2D A;  1HZA A;  2K5D A;  4A3G B;  5IYD H;  1A8V A;  3W2D A;  1KL9 A;  4A3J H;  4L5R C;  4XQQ A;  5IYB G;  4L5T A;  4AH6 A;  1BOS A;  3HKZ E;  1I6H B;  4I7A A;  1XMQ L;  4LFA L;  1STY A;  1Z47 A;  1G8Z D;  1TY0 A;  1LTI D;  5I6W A;  4LF7 Q;  4HR7 B;  4KJO A;  1C0A A;  4LWC A;  1GKH A;  1OXS C;  4DFA A;  4X66 L;  5C4X H;  1BBW A;  2B2Y C;  2I5M X;  1CTM A;  4RKB A;  3BG3 A;  5GRO A;  3RMH A;  1SNQ A;  2Q8I B;  4M1U B;  1XPR A;  1TS3 A;  3S1Q B;  1ILQ A;  3DHQ A;  2OEO A;  1XX8 A;  4GKK L;  1GUG A;  2F52 A;  3SK6 A;  2B2U A;  5C0X H;  2Q2I A;  4A3I H;  4FXD A;  2NTT A;  1CHQ D;  4KKS A;  4BY1 H;  1NNX A;  2KQ3 A;  4PG3 A;  3CCM A;  3IL8 A;  1KNE A;  3KLW A;  3KK7 A;  5KYL A;  1UAP A;  4A3K G;  3S2H H;  2B39 A;  4IFD I;  3ICE A;  2KCN A;  3R93 A;  2PW5 A;  4ODG A;  4R4T A;  3DM3 A;  4RHS A;  5IT9 c;  3TS0 A;  3HOV G;  1JWM D;  5LMN Q;  4NDX A;  4QGU A;  1BKB A;  3UDX A;  3M4P A;  5IOD A;  3LX0 A;  2EYM A;  2FJ2 A;  2R92 G;  1TY2 A;  2K28 A;  2AMC B;  4UP7 A;  1VQ5 A;  1WVL A;  4XT1 B;  4DV3 Q;  4Y52 H;  3D4D A;  3CKI B;  2IHF A;  1QWY A;  4BBR G;  3PO3 H;  5I9O A;  4JI3 Q;  5M9O A;  5J39 A;  3TRE A;  2VUM H;  3ULL A;  1VF5 C;  4TRD A;  1NMF A;  1PV4 A;  1RKN A;  3HOY G;  3VDY A;  3G71 A;  1SAP A;  4GNX C;  4K0K Q;  1ET9 A;  4TKO B;  1PH1 A;  4QUC A;  4DF7 A;  1VQJ A;  1JQY D;  4JI6 L;  1QZG A;  3J80 i;  1JOQ A;  4EQP A;  1PYB A;  2Z0S A;  1PRT C;  2EYH A;  2KCM A;  4Q0F A;  4B3R L;  4BY7 H;  2F0O A;  2R6G A;  1Q1E A;  3BVZ A;  1UNS A;  3I4N B;  1KDA A;  3QR8 A;  4C3I G;  2JA8 H;  4H44 C;  2MNA A;  2UXD L;  3E0E A;  2K4K A;  3T1Y L;  2A68 D;  4GLV B;  3F2U A;  1EIG A;  4IUP A;  2RDH A;  1XNR L;  4FP5 D;  3HOZ H;  4JCV E;  2RHS B;  1HNZ Q;  2JEA I;  3U9O A;  1DCZ A;  3A7A B;  4DAY A;  5M5W B;  3BVM A;  4AYB B;  4HJ5 A;  1GUW A;  1WCM G;  4A3E B;  1UE7 A;  2KCT A;  3MTS A;  1YJN A;  1PHJ A;  4HED A;  1AZQ A;  2FMM A;  2NVX H;  5D3D A;  4V0B A;  1X3G A;  2YV5 A;  2K05 A;  5HUR A;  2BH8 A;  2MHV A;  3IFT A;  4A75 A;  1IYU A;  4X62 Q;  4NB3 A;  2WP8 J;  4LFB Q;  4IUR A;  1HTL D;  1QNK A;  4PZ7 A;  3HKS A;  3OIP A;  1SE2 A;  2RHQ B;  3CPW A;  2JK8 A;  2F0E A;  4NKL A;  4QF4 A;  3J7A V;  3MFY A;  1KXL A;  3Q23 A;  4N8F A;  1X54 A;  2IL8 A;  1XNQ L;  2A5H A;  1EEF D;  3HKZ G;  3WOF A;  1HNW L;  2PCF B;  4EGV A;  4WJ3 M;  1A3T A;  2NWG A;  4DAY B;  3I7F A;  4A3M H;  2GA4 B;  4JI5 L;  1I94 Q;  3S1M B;  3BYY B;  2KEC A;  2IJ0 A;  4A3C G;  5JJK A;  1GJX A;  4DV4 Q;  2BA0 A;  4RG1 A;  4L5Q A;  3W1G A;  1YHQ A;  4BWG B;  1I3Q H;  3DMU A;  2CFM A;  4Z9C B;  2F3V A;  3BDC A;  1RTN A;  4J15 A;  4JBM A;  4LJZ C;  4C3J G;  1YI2 A;  1A3U A;  3JC6 6;  2C35 B;  2DJG C;  4U68 A;  3SHL A;  2DY7 A;  3EFX D;  3DLL A;  3GTQ B;  3HOX G;  1B3A A;  1L0W A;  3BU2 A;  2NVY H;  5IY0 A;  1RDP D;  4BA2 I;  2X69 A;  1TWG H;  1K73 C;  1RL2 A;  4MNO A;  2XN9 C;  4K2K A;  2NVQ H;  3MHB A;  1XMO L;  2GN5 A;  1TWC B;  4IPG A;  4KHP Q;  1HQR D;  2Q2T A;  4A93 G;  1BBX C;  2P5Z X;  5IP7 G;  2Z6B A;  1SN8 A;  1X32 A;  3OHX C;  4GLX A;  1X9N A;  1RIP A;  4DR4 Q;  2H4O A;  3HOU H;  2IT1 A;  1I6H H;  1ENF A;  1YHB A;  3K5M A;  1HFG A;  1Z9F A;  3DWP A;  2N78 A;  3PUX A;  4K5X A;  2PNH A;  1MD2 D;  5EKI A;  4CKB A;  5DLQ E;  4UP8 A;  4JBK A;  3Q22 A;  2DY8 A;  2ICE C;  1STA A;  4OEM B;  4GNX A;  1Z7T A;  4K2L A;  4R8I A;  4HMJ A;  1KQS A;  5C4H A;  3MXU A;  2YTX A;  3S1Q H;  4CHT B;  1BVS A;  1GUN A;  1TWH B;  4CJ0 B;  3BJU A;  2PMZ B;  2YU9 B;  4X65 Q;  1BCP D;  2BA1 A;  2ZJQ A;  2JYO A;  2HT1 A;  2WB1 B;  1IBL L;  3A0J A;  4A3D G;  1TS4 A;  5IT9 E;  3PUV A;  3T13 A;  2YTY A;  1HR0 W;  3GTG H;  4RA8 A;  4GKJ L;  4RCN A;  5I4D A;  2CW0 C;  3BVG A;  2R7Z H;  1KHI A;  4OON A;  2OCE A;  2KBN A;  1G6Z A;  3VA7 A;  2UU9 Q;  4IOA A;  1LT5 D;  2F4I A;  3S1N B;  2VQF Q;  4GNX B;  3H6M A;  2Z4H A;  4RKL A;  1W2B A;  1HZC A;  4KN7 C;  3J81 E;  2JA5 G;  1EQV A;  3Q8D A;  3H91 A;  1YIJ A;  1PRT B;  1SMX A;  2F0S A;  2I07 B;  4EVO A;  1ENA A;  4KMU C;  1HFN A;  1MSH A;  2QDB A;  5IGF A;  4A3L G;  4DV7 Q;  2MP1 A;  3N6R A;  3I4M G;  4IPD A;  2E2D C;  1U9R A;  2MUY A;  4WOR A;  2CH4 W;  1N32 Q;  1B4O A;  1Y1V G;  1SMY D;  3K6O A;  3VYS A;  4B3M L;  3CAM A;  1S4Z A;  2HQL A;  1JOK A;  4KKU A;  5BR8 Q;  5KRU A;  5TSS A;  5C4J H;  1R4Q B;  2UXB Q;  4QL5 A;  2LY7 A;  2B63 G;  3QIA A;  4MTK A;  2KJX A;  4CJ2 C;  1CA5 A;  1CHP D;  2PZT A;  2VQE Q;  4E6I A;  4RCO A;  4DV0 L;  2R93 B;  4CDF C;  2PPB C;  4LF4 Q;  1M4V A;  3I4N H;  3BZC A;  1GD7 A;  4R4Q A;  1N34 L;  1DOM A;  1KAB A;  3MXN A;  1LTL A;  1KTK A;  1OXU A;  2XGT A;  3UE0 A;  4OO1 H;  3G6J B;  4DR2 Q;  4JI1 Q;  1E0B A;  1JJC B;  1D7Q A;  3EIV A;  4JW0 A;  4DNI A;  3RUZ A;  2L15 A;  3IAY A;  4WFN 3;  1AFP A;  2ID0 A;  2KED A;  3D3R A;  3K80 C;  3P1H A;  4A3J B;  4GLA C;  3Q0A A;  4HCE A;  5M5W H;  4O1N A;  1X3P A;  5BN5 A;  4KY5 A;  3OOC A;  1D5M C;  1XJV A;  4A3E H;  3M3Y H;  2A69 D;  2F1M A;  3T56 B;  5FLM G;  3GV6 A;  4KKT A;  3CU7 A;  2JA6 G;  4NXM L;  2ZTE A;  3NQT A;  2FMC A;  4DV1 L;  1JMC A;  1B9N A;  5CV5 A;  4HIK A;  4ME3 A;  4GZY C;  2G9D A;  1YIT A;  2HHH Q;  1ML0 D;  2K52 A;  3MXN B;  4X3T A;  1D5Z C;  1RTO A;  3TZU A;  2MPM A;  3PIO A;  2D5D A;  4DUZ L;  1OTC A;  2I5H A;  3E9I A;  4IFD J;  4QIW B;  5HGT A;  3AEV A;  3FPU B;  1PLF A;  1QZH A;  3TME A;  3NTI A;  4DR5 Q;  4A3I B;  2KEN A;  4DV6 L;  4DR1 L;  5M5X B;  3J81 L;  2K01 A;  1SDF A;  1UE5 A;  4DR3 L;  2EQS A;  3CRK C;  4ZRZ A;  4LK1 C;  3OPO A;  3S1M H;  4JPB W;  5M3M G;  5I2X A;  2N55 A;  3H3V I;  4B3S Q;  4Y7N B;  1B8A A;  1DYQ A;  3CQZ H;  2WAQ B;  1G29 1;  1GVP A;  3SK8 A;  1OXT A;  5D3I B;  3K7A B;  1DOL A;  5CV7 A;  1IBM L;  1ONL A;  3D6W A;  4DR6 Q;  2BH2 A;  1H9K A;  3GTQ H;  3JAM c;  4DR7 L;  1M8A A;  2LS0 1;  2HIX A;  2K50 A;  5CR3 A;  1O7L A;  1EQR A;  2A6H D;  4BXX H;  4OGQ C;  1Q3L A;  3T1H Q;  1K3R A;  1Y8O B;  1F77 A;  3J80 E;  4OEL B;  2NYZ D;  3RNU A;  3BZK A;  1YNN D;  1XYI A;  2O5I C;  1CSQ A;  1TWC H;  2AWN A;  3MFG A;  1CK1 A;  4YHH Q;  3PO3 B;  1PH3 A;  3KBX A;  3TBI B;  3D4R A;  1S5F D;  1X6O A;  1SNC A;  3U58 A;  5IYD G;  4P71 A;  2LMC B;  1IBK Q;  1BXT A;  1PZI D;  1SRU A;  3C1F A;  5FKA C;  4A3J G;  1AN8 A;  3OW7 A;  4HAE A;  4DGZ A;  3J7Y W;  1WI5 A;  4QJF A;  4JI4 L;  3TP8 A;  3W1B A;  4BY7 B;  5M3F H;  3E0J A;  1MSG A;  1B50 A;  1JIC A;  1EYD A;  4OXP A;  3ND9 A;  1J5E Q;  4ABN A;  5C4X G;  2B2T C;  2F0U A;  5E1F A;  1X55 A;  5KNB A;  3A5U A;  2M2L A;  2SOB A;  1Q7Y C;  2I0Q A;  1CKM A;  2IY5 B;  3OMG A;  2YU9 H;  2NN6 G;  2F0V A;  3FMC A;  1S5C D;  1SYD A;  2VZA A;  3CHB D;  4A76 A;  3HOZ B;  3NQI A;  2RCN A;  4HJ9 A;  1MJC A;  5EBD A;  2SNS A;  4HSV A;  5C0X G;  3P7J A;  3OMC A;  3MVV A;  4IJL A;  4LFC Q;  2R61 A;  3UE1 A;  1AH9 A;  2ZM6 Q;  4YY3 Q;  4BY1 G;  4DNR B;  2NVX B;  2FFK B;  3TDQ A;  3M4O B;  2UUA Q;  2F0T A;  1UWV A;  3H3V C;  2K32 A;  2KOL A;  1DON A;  1TWA B;  3I2Z A;  1ZYR C;  1VQK A;  2F3W A;  2MGS A;  2J7Z A;  3ITP A;  2DN8 A;  1PH5 A;  2MFI A;  4OWT B;  3I3C A;  1WTX A;  4YCW A;  3VR6 A;  4A3B H;  1K28 A;  4AQY Q;  2K1B A;  4G7H C;  3AYH B;  4IUN A;  4OWX B;  3TP6 A;  2D9U A;  1DGS A;  3CME A;  3OIQ A;  1HR0 L;  4RGO S;  4LF5 L;  2F0G A;  4F8M A;  3J80 L;  3ULJ A;  4QUF A;  3ND8 A;  3F8T A;  2VUM G;  1E24 A;  3CCE A;  1SYB A;  4R4I A;  3K0Y A;  4NW2 A;  4UP9 A;  4WJW A;  3NWS A;  2K7V A;  5T1I A;  5I6Y A;  5K36 G;  1CFM A;  4O0A A;  5E7N A;  1HZB A;  5IE8 A;  5LMU L;  1FNV A;  2NVY B;  2Y0S B;  5HGQ A;  2DUD A;  4QMG A;  1BCP F;  4MZ9 A;  4FXK C;  1SYG A;  1TWG B;  1KD1 C;  4JI2 L;  1NBW A;  3HGB A;  2JA8 G;  1LTT D;  3P75 A;  2B2W C;  3KLS X;  4JI7 Q;  3OWF A;  2NB0 A;  2EYJ A;  1E7Z A;  1VQE A;  4LF6 Q;  2KCC A;  3CCS A;  4IFD H;  3VYR A;  5IOC A;  3G6E A;  3VR2 A;  3HOU B;  3HS0 C;  4YIJ A;  3PUW A;  3KJO A;  1EOT A;  1TXY A;  2EJG C;  3HOW B;  4X3K A;  2N88 A;  1PRT D;  2B8F A;  1QJO A;  4K5V A;  2H1E A;  2XNA C;  1EIY B;  2OQ0 A;  3CCV A;  1A6X A;  1O80 A;  1ET6 A;  4ZUI A;  1Y1W B;  4M8A A;  3NTH A;  1JOR A;  4FO2 A;  3TP7 A;  1CA6 A;  3TEH B;  3CP0 A;  1N36 Q;  4BBS B;  2VS1 A;  1Q82 C;  4NP5 A;  2QIL A;  2E5L L;  4NXN Q;  1IL2 A;  2E74 C;  2LSS A;  3TN2 A;  1V1P A;  1PH4 A;  5M5X H;  3QG1 A;  1GHJ A;  4WRD A;  3M4Y A;  3S17 B;  5LL6 X;  2KHJ A;  4HJ7 A;  5CGK A;  1VS0 A;  1YNX A;  4QCL A;  2B2T A;  1QVF A;  1D6E C;  3JAM E;  1EYA A;  3J7Z C;  2UUC L;  1TQO A;  3S2D B;  4DK6 C;  1GUS A;  3GTG B;  2NUC A;  4A3M G;  1AP0 A;  1D8L A;  4LFB L;  1YNJ C;  2D0P A;  1IZ6 A;  4J6H A;  4Y7N H;  1L0X B;  2EZV A;  4DUY Q;  2R7Z B;  3ER0 A;  3VYU A;  4DV2 Q;  1QNU A;  1TS5 A;  5EAY A;  2ATW A;  3K7A H;  3SVM A;  4JI8 L;  4JC0 A;  3FPP A;  3RR5 A;  2C5C A;  2SEB D;  2F4V Q;  2UXC Q;  4AYB E;  1IKM A;  1JWU D;  4KD4 A;  1V1P B;  3K81 C;  3KJP A;  2DGY A;  3CCU A;  4LUV A;  1EY4 A;  1VQD A;  4JBJ A;  4IZ8 A;  1QOH A;  4S3S A;  2JA7 H;  4DV4 L;  2RDG A;  1G91 A;  1A15 A;  1HTP A;  3NEN A;  1F2M A;  4L63 B;  4A3G G;  2AQ3 B;  1HA5 A;  5C4J B;  2E2J B;  1JB3 A;  3KDF A;  3A8I E;  4IJH A;  3PF4 A;  2B2V C;  1HNX L;  3HOU G;  3CCR A;  4N9T A;  1JE4 A;  4FF1 A;  4DAM A;  4GN5 A;  2KEE A;  3LNN A;  3I56 A;  2BOS A;  1EU4 A;  1HH2 P;  2NN6 I;  5AJ3 Q;  3I4L A;  4P2C B;  5JEA H;  4FF3 A;  1PYS B;  1CKN A;  2ZXP A;  1UEB A;  1X3Q A;  5LHY 1;  1VQ8 A;  4DA2 A;  4PZ8 A;  1I4H A;  3K5O A;  5DM6 3;  4LFA Q;  4DR4 L;  1EY8 A;  5CV6 A;  3PV0 A;  5DM7 3;  3B6Y A;  4X66 Q;  3PO2 B;  3HEJ A;  3M3Y B;  1A62 A;  2B2W A;  3A8K E;  2NZH A;  1SYC A;  2QCP X;  1QG7 A;  3KDF B;  2CKZ B;  1M90 C;  2AWO A;  3M4O H;  4UHV A;  2PQA A;  2F0W A;  1QCB D;  4P73 A;  1II3 A;  1TWA H;  4APV A;  4R8N A;  5EPL A;  3CC4 A;  2ALY B;  4CKC A;  3M85 A;  3DM1 A;  3MC0 B;  4X64 Q;  1M1K C;  1CKN B;  1I4Q A;  2B2Y A;  5G3L D;  3A74 A;  5I2Y A;  1HUN A;  1PFB A;  5FK9 C;  1VMP A;  5CV4 A;  5KEE A;  3PUZ A;  3J7A F;  4XQN A;  3TRZ A;  3QO2 A;  2IWH A;  3CC7 A;  2MO1 A;  2F0D A;  5C5L A;  3QOL A;  5EPK A;  4JYA Q;  1EY7 A;  1JJ2 A;  2IW3 A;  3STB C;  3CF5 A;  3E6Z X;  4MHE A;  5BN4 A;  2CW0 D;  1N33 L;  2PQA B;  3CQZ B;  3S15 B;  1YJ9 A;  3G48 A;  2PMZ E;  1NMG A;  5IGD A;  3TSS A;  1I4R A;  1HJP A;  3I73 A;  3FDT A;  1Y14 B;  1E2W A;  2WB1 E;  4PV1 C;  4N8X 1;  4FDB A;  4K5W A;  4DV7 L;  3K5L A;  1LT4 D;  2VNU D;  4DN4 M;  3OYY A;  4FF2 A;  3I4N G;  2XRQ D;  5JVH 3;  4POG A;  1D2B A;  1E2V A;  4DV5 L;  3K8A A;  3GTM B;  2F03 A;  2E76 C;  4OO1 G;  2WII B;  3BYT B;  1I50 B;  5FLX c;  1JCK B;  3PGZ A;  4G7O C;  3QJY A;  3RZO B;  1FYC A;  2SNM A;  1H9S A;  4F87 A;  1MIU A;  4B3R Q;  4F88 A;  4FYD A;  3URY A;  1SRO A;  1EZ8 A;  4ILW A;  1VCI A;  5EQ0 A;  1EQQ A;  1NSN S;  3R2T A;  4HSP A;  1R9T B;  1EFI D;  2CVR A;  4BBR H;  5JAV A;  3HOW H;  4AYB G;  4A3E G;  1PZK D;  2PI2 A;  2UXD Q;  3SDZ A;  1E2Z A;  3VA5 A;  3KFU A;  1J8I A;  3T1Y Q;  5M3F B;  3HRZ C;  5IYC H;  1Y1W H;  1IL8 A;  3ONA B;  1VMC A;  1XNR Q;  2ZXO A;  2NTS A;  3G7L A;  4JG2 A;  3L3O C;  2E8G A;  1EWH A;  1H9J A;  4KD3 A;  1F9R A;  4BBS H;  4IAL A;  1EFW A;  2B2V A;  3ULP A;  1PTO C;  3H0G B;  5J3B A;  1AEX A;  1LM0 A;  1SNP A;  4CDE C;  2LKV A;  3AQQ A;  4QY7 A;  3S17 H;  2I46 A;  2OF1 A;  1Q12 A;  1I4P A;  1WTW A;  5COR A;  2RSO A;  5IGB A;  1H9S B;  1XWE A;  5EJW A;  1WOC A;  4EQO A;  3S2D H;  4LF9 L;  4P75 A;  3SGI A;  3SEB A;  2GVA A;  2MQH A;  4OX9 Q;  1B9M A;  2NBF A;  5C3E B;  1KAW A;  5ELN A;  2HHH L;  2O2L D;  3NPP A;  1XNQ Q;  1WCM H;  3ZJY C;  3CC2 A;  5A2Q E;  2L0C A;  1STB A;  4H02 A;  4LW1 A;  3JAM i;  1A2T A;  4DR5 L;  2EY6 A;  5JPN C;  1PVO A;  5IGG A;  1FL0 A;  3IKJ A;  4JI5 Q;  2MO0 A;  2Z4I A;  1K83 B;  4A3B B;  3I91 A;  4WJ4 A;  5NUC A;  2RSN A;  4F7X A;  2KHI A;  2M00 A;  1FJG L;  1LV9 A;  1PFM A;  3K57 A;  1V8Q A;  1PH7 A;  4R1J A;  2M9V A;  3NHH A;  2FIN B;  3PMF A;  4CJ1 B;  4B3S L;  3PF5 A;  3D8G A;  1SEB D;  1PRT F;  3WOE A;  4XTC S;  2E2J H;  1QB5 D;  2EY5 A;  1HPC A;  1SND A;  1KNA A;  4I7Z C;  4MTN A;  4QIW E;  1ZXT A;  1VQL A;  1G2T A;  3H94 A;  5EBC A;  1TS2 A;  1ILP A;  3T1H L;  1XMO Q;  1VQ7 A;  5ELB A;  4J8Q A;  3H3V H;  1BNZ A;  2FHT A;  2UUB Q;  3C1E A;  3KF6 A;  5D14 A;  4YHH L;  3Q6S A;  3VR5 A;  1KLG D;  1HA6 A;  3VR3 A;  1HRJ A;  1LTG D;  3V2T A;  1DJR D;  2LFN A;  5C44 B;  2J0T D;  1HZ9 A;  3GD7 A;  3NE5 B;  3OTO Q;  4K6D A;  4JI0 L;  3SK5 A;  1IBK L;  2GVB A;  2EY1 A;  1GM5 A;  3K0X A;  1WFQ A;  1B53 A;  1LT6 D;  3U50 C;  2PYK A;  3PO2 H;  2WB1 G;  4L6T B;  2J4X A;  5IWA L;  2IX3 A;  1OXV A;  2F0Q A;  4XYQ A;  3F2B A;  4HCS A;  4A93 H;  2F0M A;  1EOV A;  5IT9 L;  4YCV A;  1SXT A;  3GTJ H;  1K8M A;  3R3O A;  1T5E A;  2MJ8 A;  3NBH A;  2CQA A;  3J7A 5;  2AQ1 B;  4ID6 A;  1IBL Q;  4B3T L;  1D1I A;  1UE1 A;  2EYO A;  2K5W A;  3KF6 B;  1HUM A;  5A2Q L;  1G6P A;  3LWE A;  4XXE A;  2JA9 A;  1CZG A;  4GKJ Q;  3EBE A;  2L11 A;  2EYP A;  1EY0 A;  1IW7 C;  4IPC A;  1EYG A;  3G4S A;  4A3B G;  4HJA A;  3CCL A;  1NTG A;  2BE5 C;  5JJZ A;  4RHR A;  4A3F B;  4KY6 A;  2X6G A;  3M7N A;  2UUA L;  3WWV A;  3K59 A;  1ZEQ X;  1H9R A;  2EY2 A;  1S5B D;  2EXD A;  4I65 A;  4RWS C;  3S15 H;  1KRT A;  3NBH B;  4K6L A;  2F0N A;  5JJL A;  1ZYR D;  1VQA A;  4QB4 A;  1AW7 A;  1GO3 E;  1X3E A;  1IXR A;  1WTR A;  2XWJ B;  2VY3 A;  1VQP A;  4FXG C;  4LF8 L;  1F2Y A;  5DEH A;  2R93 G;  1UUP A;  1U0L A;  2Z9H A;  2Z6K C;  2B8G A;  1LAB A;  1I4G A;  4Q5V A;  2VXW A;  1JR0 D;  3S16 H;  1G51 A;  3RLO A;  1XPO A;  1OXX K;  3WDN A;  3GTM H;  4ZKB B;  2XSC A;  2JA5 H;  3NEL A;  1I6V C;  3KLS A;  2YTV A;  3KYH C;  1I50 H;  1PFN A;  2JA7 B;  5FJ8 H;  3KUP A;  5KGU A;  1IKL A;  5KNC A;  3RZO H;  1PTO B;  1Y69 U;  1NR4 A;  4A3L H;  2DJF C;  5C0X J;  3UDG A;  1VQC A;  2HD3 A;  1PYW D;  3FEW X;  4RGN A;  3I4M H;  1Z6H A;  4R4C A;  4C1N I;  3P20 A;  1R9T H;  1N34 Q;  4PMW A;  1STE A;  1Y1V H;  1QVC A;  2N49 A;  4R9W A;  1H95 A;  3FKI B;  5LL6 S;  1RHP A;  1PDQ A;  3S9W A;  1ASY A;  4KK7 A;  1Y8N B;  1SJE D;  4PNY A;  2AUJ D;  4ALP A;  5IP9 H;  1XXG A;  1S5D D;  3L7Z C;  1GXD C;  3RLN A;  3J81 j;  2A6E C;  3H0G H;  2BDN A;  5E3F A;  5ELE A;  2CCZ A;  5EKL A;  4H13 C;  1HCZ A;  3AFP A;  2XRS D;  4NXM Q;  2CHB D; 
#chains in the Genus database with same CATH homology
 5HY6 A;  4A3M G;  4DV1 Q;  2WAQ E;  4J15 A;  4A3I G;  1D8L A;  4JBM A;  3H0G G;  2D0P A;  4LFB L;  1YI2 A;  2K14 A;  1IZ6 A;  3D31 A;  3JC6 6;  4Y7N H;  4LF7 L;  2C35 B;  4DUY Q;  4JBW A;  2JE6 I;  2Y0S E;  3ER0 A;  4DV2 Q;  1FVI A;  2K5V A;  4EQ5 A;  2QEX A;  5GAG C;  5EAY A;  1YZ6 A;  4DK3 C;  5GAE C;  5C3E H;  3HOX G;  3DLL A;  1L0W A;  2ATW A;  3BU2 A;  3K7A H;  1KIX A;  2NVY H;  3EN2 A;  2ZJP A;  5IY0 A;  1XPU A;  3GO5 A;  1LYL A;  4TQU S;  4DUZ Q;  3RN5 A;  3UDF A;  4JI8 L;  3OW2 A;  4JC0 A;  3RR5 A;  4BA2 I;  1TWG H;  5IP7 H;  1K73 C;  1VQI A;  1C9O A;  1RL2 A;  4MNO A;  2WAQ G;  4DV6 Q;  4IO9 A;  2XTI A;  4DR1 Q;  1ASZ A;  2F4V Q;  1J5E L;  4NXN L;  2UXC Q;  4AYB E;  2LXJ A;  5C3E G;  1SLJ A;  2NVQ H;  1XMO L;  2GN5 A;  4IPG A;  4DR3 Q;  3K81 C;  3KJP A;  4KHP Q;  3KOJ A;  2DGY A;  1L1O C;  1S40 A;  3CW2 C;  1VQM A;  3CCU A;  2Q2T A;  4LUV A;  4A93 G;  1W3S A;  1VQD A;  1K83 H;  4JBJ A;  5IP7 G;  1SN8 A;  4GLX A;  1X9N A;  2JA7 H;  4DV4 L;  1RIP A;  1O7I A;  4DR4 Q;  3HOU H;  4POF A;  4HJ8 A;  2IT1 A;  3NEN A;  1I6H H;  1YHB A;  1Z9F A;  2NZO A;  4LF9 Q;  2N78 A;  4LFC L;  2Q2H A;  5GAD C;  4A3G G;  3PUX A;  2PNH A;  5DLQ E;  4KLK A;  4DUY L;  3UDI A;  4UP8 A;  2ZM6 L;  1IBM Q;  4JBK A;  4YY3 L;  3RLF A;  3KDF A;  4IJH A;  4DKA C;  1V1Q A;  1YVC A;  1PH6 A;  3PF4 A;  1HNX L;  3PO3 G;  3HOU G;  4KHZ A;  3CCR A;  1YJW A;  4GNX A;  1VQ9 A;  1KQS A;  1B70 B;  4A3D H;  4JV5 Q;  2YTX A;  3S1Q H;  5LMN L;  4DAM A;  1BVS A;  3M9B A;  4GN5 A;  4IPH A;  2A19 A;  2R7D A;  1E3P A;  3BJU A;  5H1S E;  1FGU A;  3I56 A;  1Q86 C;  1HH2 P;  2NN6 I;  4X65 Q;  5AJ3 Q;  2ES2 A;  2BA1 A;  1JT8 A;  3CMA A;  2JEB I;  2ZJQ A;  4BY7 G;  1PYS B;  1CKN A;  2HT1 A;  1IBL L;  1FJG Q;  1YHQ A;  1UEB A;  3A0J A;  4A3D G;  1VQ8 A;  4DV3 L;  4PZ8 A;  1SE8 A;  4AQY L;  2OQK A;  3PUV A;  4LFA Q;  4JI3 L;  4DR4 L;  1UE6 A;  2YTY A;  2N8N A;  4OO1 I;  1HR0 W;  3GTG H;  1AE2 A;  3PV0 A;  4GKJ L;  5C44 H;  1N9W A;  1V43 A;  4B3M Q;  4GN3 B;  5JEA G;  1VQN A;  3B6Y A;  3M4Q A;  4X66 Q;  4K0K L;  3F1Z A;  3PIP A;  1A62 A;  2R7Z H;  2NZH A;  1KHI A;  2Z6K A;  2OCE A;  2KBN A;  4OON A;  3HOZ G;  2AKW B;  3KDF B;  2CKZ B;  1M90 C;  2AWO A;  2UU9 Q;  4IOA A;  2V1C C;  3M4O H;  1YBY A;  2VQF Q;  2PQA A;  4DV0 Q;  4GNX B;  5C44 G;  4YCU A;  3CPF A;  4P73 A;  1W2B A;  1TWA H;  1HZC A;  1Q1B A;  1VQG A;  4APV A;  2IX0 A;  1LUZ A;  4IFD G;  4JV5 L;  2JA5 G;  2Q2U A;  1U5K A;  3Q8D A;  3GTK H;  1YIJ A;  3CC4 A;  1SMX A;  2IX1 A;  4R4O A;  2ALY B;  4QQB X;  5AJ3 L;  2JJQ A;  1P8L A;  3M85 A;  3MEF A;  4X64 Q;  1M1K C;  2FXQ A;  4A3L G;  4DV7 Q;  3KF8 B;  1JB7 A;  1CKN B;  3CXC A;  3NEM A;  3I4M G;  1SR3 A;  4IPD A;  1K9M C;  1HNZ L;  1IYJ B;  4TVA B;  2D62 A;  1N32 Q;  3A74 A;  2B63 H;  2QA4 A;  4A4I A;  1PH2 A;  1PH8 A;  4JI0 Q;  1Y1V G;  4GS3 A;  3F2C A;  4JI7 L;  2OWO A;  3PUZ A;  3TRZ A;  2RF4 A;  4B3M L;  3CAM A;  4LF6 L;  3CC7 A;  2HQL A;  2MO1 A;  1P16 A;  5BR8 Q;  3CD6 A;  5IWA Q;  1K8G A;  4C3H H;  5C4J H;  4JYA Q;  1JJ2 A;  2UXB Q;  1XTD A;  4QL5 A;  1YHA A;  2I5L X;  3FP9 A;  3STB C;  1K0R A;  3CF5 A;  4A3F H;  1PA6 A;  2B63 G;  1CSP A;  2ZTD A;  4X62 L;  1N33 L;  2PQA B;  2CWA A;  2VQE Q;  4DV0 L;  5M5Y H;  1YJ9 A;  3G48 A;  2PMZ E;  1NMG A;  4LF4 Q;  1VQF A;  3I4N H;  1HJP A;  1GD7 A;  3BZC A;  1TWH H;  1Y14 B;  4R4Q A;  1N34 L;  1X56 A;  2WB1 E;  1EUJ A;  4B3T Q;  1LTL A;  4A3F G;  1OXU A;  3PSI A;  3RZD H;  2XGT A;  3UE0 A;  4DR2 Q;  4FDB A;  4X64 L;  5GAH C;  4JI1 Q;  2AHO B;  1JJC B;  4DV7 L;  4OWW B;  1VQO A;  1D7Q A;  3EIV A;  4HIO A;  4EX5 A;  3TQY A;  1Q81 C;  1PH9 A;  4DNI A;  1N36 L;  2VNU D;  3OYY A;  1K8A C;  2L15 A;  1QUQ A;  2ID0 A;  1E1O A;  5FLM H;  3I4N G;  1Q46 A;  1VQH A;  3K80 C;  2JQO A;  1N8R C;  4POG A;  2JA6 H;  1HR0 Q;  4LUZ A;  4DV5 L;  3FHW A;  1MKH A;  3K8A A;  4C2M H;  4GLA C;  4OO1 G;  4P72 A;  2Y0S G;  5M5W H;  4LF5 Q;  2EIF A;  5FLX c;  3PGZ A;  1XJV A;  4A3E H;  4UPA A;  1I94 L;  2CWP A;  3M3Y H;  2QGQ A;  3K7U C;  1S72 A;  1JE5 A;  4BA1 I;  4B3R Q;  1MIU A;  4JYA L;  5FLM G;  1X65 A;  2CQO A;  2F3I A;  4XIG S;  2JA6 G;  1SRO A;  1YEZ A;  5ELO A;  4NXM L;  1L1O A;  1PFS A;  2ZTE A;  4YWK A;  3UDG A;  3S1N H;  1VCI A;  4DV1 L;  3U4V A;  1EQQ A;  1VQ4 A;  3I4O A;  1JMC A;  5JEA J;  3STB D;  4BBR H;  3U4Z A;  3HOW H;  4AYB G;  4HIK A;  4ME3 A;  3L0O A;  4A3E G;  5LMU Q;  2PI2 A;  2YYZ A;  2UXD Q;  4DV2 L;  1YIT A;  2HHH Q;  4UY8 C;  3KFU A;  3T1Y Q;  2JA7 G;  5IYC H;  1MJE A;  1Y1W H;  2K52 A;  3MXN B;  4DR7 Q;  1XNR Q;  1N33 Q;  4GOP C;  4JG2 A;  4LF8 Q;  1X3F A;  4JI2 Q;  2E8G A;  3FKI H;  2A1A A;  4KI0 A;  2HIV A;  3PIO A;  4DUZ L;  1OTC A;  2I5H A;  3E9I A;  1SFO H;  4IFD J;  3HOW G;  3AEV A;  4BBS H;  2WFW A;  5M3M H;  1QZH A;  3J81 c;  1KC8 C;  1EFW A;  4DR5 Q;  1QUQ B;  2N3S A;  2KEN A;  4DV6 L;  3ULP A;  4DR1 L;  2F4V L;  2UXC L;  1C7Y A;  4YWL A;  5IYC G;  5J3B A;  1Y1W G;  1LM0 A;  3J81 i;  1CUK A;  1UE5 A;  2K75 A;  4DR3 L;  4KHP L;  2EQS A;  3S1R H;  4YWM A;  3FKI G;  3AQQ A;  4QY7 A;  3S17 H;  3S1M H;  1Q12 A;  4BBS G;  5C0X I;  3S24 A;  5M3M G;  1XMQ Q;  3H3V I;  1VQB A;  1WOC A;  4P74 A;  4B3S Q;  3RN2 A;  3S2D H;  2K5N A;  1L1O B;  3ERS X;  1B8A A;  4LF9 L;  2ZTC A;  3CQZ H;  4P75 A;  3SGI A;  2VW9 A;  1G29 1;  1GVP A;  3TS2 A;  2R93 H;  2GVA A;  2MQH A;  4OX9 Q;  2VL6 A;  2NVT H;  1OXT A;  1KAW A;  4JI4 Q;  5ELN A;  1IBM L;  2HHH L;  4HID A;  2A8V A;  4DR6 Q;  2BH2 A;  3GTQ H;  3JAM c;  3A5Z B;  1XNQ Q;  1WCM H;  3ZJY C;  3CC2 A;  4DR7 L;  3PUY A;  2HIX A;  3LGJ A;  2K50 A;  1EQR A;  5IYB H;  2E5L Q;  4H02 A;  4LW1 A;  1L2F A;  3JAM i;  4BXX H;  4GKK Q;  2IHE A;  3T1H Q;  2R7F A;  1K3R A;  2R7Z G;  4DR5 L;  2OTJ A;  2B3G A;  1PVO A;  4O2D A;  1HZA A;  5IYD H;  1FL0 A;  4X65 L;  4JI5 Q;  3RNU A;  3BZK A;  1A8V A;  1KL9 A;  1CSQ A;  1TWC H;  2MO0 A;  4A3J H;  4WJ4 A;  4L5R C;  2AWN A;  2KHI A;  1FJG L;  4YHH Q;  1WJJ A;  5IYB G;  2UUC Q;  3GTO H;  1PH7 A;  4L5T A;  4AH6 A;  1PH3 A;  4R1J A;  3HKZ E;  1NE3 A;  4JOI C;  1XMQ L;  4LFA L;  1X6O A;  1AE3 A;  1Z47 A;  3U58 A;  5IYD G;  4B3S L;  4P71 A;  1I5F A;  1IBK Q;  4LF7 Q;  1SRU A;  4IOC A;  4A3J G;  1C0A A;  1A0I A;  3PF5 A;  4LWC A;  1E1T A;  1BBU A;  1GKH A;  1OXS C;  4X66 L;  4OX9 L;  5C4X H;  1BBW A;  4NPS A;  2I5M X;  4XTC S;  5GRO A;  2E2J H;  1WI5 A;  4QJF A;  4JI4 L;  3W1B A;  5M3F H;  2UU9 L;  4JI8 Q;  1XPR A;  4MTN A;  4QIW E;  1S3O A;  2VQF L;  1VQL A;  4OXP A;  4AIM A;  1J5E Q;  4GKK L;  4L5S A;  5C4X G;  2F52 A;  3T1H L;  1X55 A;  4LUO A;  3A5U A;  4DPG A;  1XMO Q;  2Q2I A;  4A3I H;  1Q7Y C;  1VQ7 A;  1CKM A;  2I0Q A;  2IY5 B;  1Q8K A;  3PCO B;  2YU9 H;  2NN6 G;  3H3V H;  2VZA A;  4A76 A;  4BY1 H;  2UUB Q;  2RCN A;  4HJ9 A;  1MJC A;  2LXK A;  3KF6 A;  4YHH L;  4PG3 A;  1B7Y B;  4A3K H;  3CCM A;  1VQ6 A;  5C0X G;  1N32 L;  1HZ9 A;  1CKO A;  3GD7 A;  4IJL A;  4LFC Q;  3HOV H;  3OTO Q;  4JI0 L;  1WYD A;  1IBK L;  2GVB A;  3UE1 A;  5GQO A;  3K0X A;  1GM5 A;  1WFQ A;  1AH9 A;  2PI2 E;  2ZM6 Q;  4JI6 Q;  3KLW A;  4BY1 G;  3U50 C;  4YY3 Q;  4GN4 B;  2WB1 G;  3PO2 H;  5BR8 L;  4A3K G;  1HNX Q;  3GTL H;  5IWA L;  3S2H H;  2R92 H;  2UUA Q;  4PZ6 A;  1OXV A;  1TWF H;  4RMF A;  1UWV A;  2UXB L;  2ASB A;  4IFD I;  3ICE A;  3F2B A;  4R4T A;  1V9P A;  5IT9 c;  3DM3 A;  3I2Z A;  3TS0 A;  3HOV G;  1EOV A;  4A93 H;  5LMN Q;  1VQK A;  4QGU A;  1BKB A;  3UDX A;  2VQE L;  3M4P A;  4YCV A;  3GTJ H;  3PO2 G;  4LF4 L;  2E2I H;  3J7A 5;  1PH5 A;  2R92 G;  2MFI A;  3HOY H;  4OWT B;  2AMC B;  4UP7 A;  1IBL Q;  4B3T L;  4A3G H;  1VQ5 A;  2OTL A;  1UE1 A;  1J6Q A;  4DR2 L;  4YCW A;  4DV3 Q;  4A3B H;  4Y52 H;  4JI1 L;  2UUB L;  4AQY Q;  2IHF A;  3KF6 B;  4BBR G;  3PO3 H;  4JI3 Q;  1G6P A;  3TRE A;  2VUM H;  3ULL A;  1NMF A;  2JA9 A;  3AYH B;  4OWX B;  1PV4 A;  4GKJ Q;  3EBE A;  3CCQ A;  1DGS A;  2ZJR A;  4GOP A;  3HOY G;  3CME A;  3VDY A;  4IPC A;  1HR0 L;  3G71 A;  3J80 c;  3OTO L;  4GNX C;  4K0K Q;  1EYG A;  3G4S A;  4LF5 L;  3HFZ B;  1PH1 A;  4A3B G;  4C3I H;  1VQJ A;  4JI6 L;  4HJA A;  3ULJ A;  3CCL A;  1QZG A;  1NTG A;  3J80 i;  1PYB A;  2Z0S A;  3F8T A;  2VUM G;  3M7N A;  1E24 A;  2KCM A;  3CCE A;  2UUA L;  3WWV A;  4B3R L;  1HNW Q;  4BY7 H;  4R4I A;  2K5H A;  4UP9 A;  2R6G A;  1Q1E A;  1NJI C;  2EXD A;  5K36 G;  1EWI A;  3S15 H;  2JA8 H;  1KRT A;  4O0A A;  5E7N A;  2MNA A;  1HZB A;  3NBH B;  5IE8 A;  5JJL A;  5LMU L;  1VQA A;  2UXD L;  5HGQ A;  1GO3 E;  3E0E A;  5JJI A;  2DUD A;  2K4K A;  4GLV B;  3T1Y L;  3S14 H;  3HOZ H;  1X3E A;  4MZ9 A;  1IXR A;  1XNR L;  2VY3 A;  3W5O A;  1VQP A;  4JCV E;  2RHS B;  5LMN W;  1KD1 C;  1NBW A;  4JI2 L;  1HNZ Q;  4LF8 L;  2R93 G;  2JA8 G;  2JEA I;  1U0L A;  2Z6K C;  4JI7 Q;  3S16 H;  1G51 A;  3RLO A;  4GOP B;  1OXX K;  1E7Z A;  1VQE A;  1XPO A;  3CCS A;  4LF6 Q;  4HJ5 A;  3GTM H;  1WCM G;  2JA5 H;  1UE7 A;  2KCT A;  3NEL A;  1YJN A;  1PHJ A;  2YTV A;  3KYH C;  3G6E A;  1I50 H;  5FJ8 H;  2NVX H;  4BXX G;  1X3G A;  2YV5 A;  3RZO H;  2BH8 A;  3L2P A;  1EIF A;  3H15 A;  3I55 A;  4A75 A;  4A3L H;  3PUW A;  1NY4 A;  4NB3 A;  4X62 Q;  2WP8 J;  5C0X J;  3KJO A;  1KRS A;  1VQC A;  1TXY A;  2H5X A;  3IRB A;  4LFB Q;  4PZ7 A;  3D0F A;  3HKS A;  3I4M H;  1E22 A;  2RHQ B;  3CPW A;  4R4C A;  2JK8 A;  1R9T H;  1EIY B;  1N34 Q;  2OQ0 A;  4PMW A;  3CCV A;  1A63 A;  5FJ8 G;  3E9H A;  4JOI A;  3CCJ A;  3F2D A;  1KXL A;  1Y1V H;  1QVC A;  2N49 A;  1X54 A;  1H95 A;  3GTP H;  4DR6 L;  3TEH B;  1T9H A;  1XNQ L;  3AFQ A;  1ASY A;  3CP0 A;  1N36 Q;  2E2H H;  2VS1 A;  1Q82 C;  3HKZ G;  4A3C H;  1HNW L;  4WJ3 M;  2E5L L;  4NXN Q;  4X6A H;  2D0O A;  4ALP A;  4DK6 C;  1IL2 A;  2LSS A;  5IP9 H;  4DV5 Q;  4DAY B;  3L7Z C;  3I7F A;  4HIM A;  3GDE A;  4A3M H;  3RLN A;  3J81 j;  1PH4 A;  3H0G H;  4C3J H;  5M5X H;  1QVG A;  5M3F G;  1JJG A;  2CCZ A;  4JI5 L;  2KHJ A;  4HJ7 A;  1I94 Q;  4LNQ A;  1VS0 A;  4A3C G;  1YNX A;  5JJK A;  1QVF A;  3AFP A;  4DV4 Q;  2BA0 A;  4RG1 A;  3HOX H;  4L5Q A;  2B29 A;  3J7Z C;  2UUC L;  4NXM Q;  3W1G A;  1I3Q H;  2CFM A;  5IP9 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...