2NVTH

Rna polymerase ii elongation complex in 150 mm mg+2 with gmpcpp
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
145
structure length
133
Chain Sequence
b'SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(*AP*AP*GP*AP*CP*CP*AP*GP*GP*C)-3'
molecule tags Transcription,transferase/dna-rna hybrid
publication title Structural basis of transcription: role of the trigger loop in substrate specificity and catalysis
pubmed doi rcsb
total genus 21
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2006-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2nvtH00
2YU9H 4Y52H 2NN6G 4JI7Q 1AE3A 1V9PA 5IP9G 2UUAL 1D7QA 3AYHB 3RZOH 4QJFA 3RR5A 2PNHA 5FLMG 1KL9A 1PYSB 1N34L 3HOYG 4DR4Q 1TWGH 1L1OB 2N78A 1BVSA 2GN5A 2CWAA 3D0FA 5IWAL 3VDYA 4JBWA 3ULLA 1N36L 1Q7YC 1M90C 1E7ZA 4PMWA 5JEAJ 1K8AC 4DR7Q 4JYAL 5JJLA 4GKKL 2CCZA 3E9IA 5FJ8H 3L7ZC 2E5LL 2XGTA 3M3YH 4IOAA 4TVAB 2C35B 4DUZL 2MQHA 2ZJPA 5M5XH 1IL2A 4JV5Q 4A3CG 5BR8L 2YV5A 4AH6A 2K75A 1FJGQ 1XNQQ 5IE8A 1SMXA 3EBEA 1C9OA 1YJNA 3I4NG 1V1QA 3CMAA 4DV0L 3BJUA 3W1GA 1J6QA 2R7FA 3HOXH 1VQMA 3K0XA 1HNWQ 4YHHL 2JA8H 2A8VA 3DM3A 3T1HQ 3I4OA 4HIOA 1QUQA 1Q82C 4B3RQ 3S1QH 4YWLA 4IPDA 5GQOA 5M5WH 4DUYQ 2K52A 4L5SA 3ICEA 2EXDA 4LF4Q 3HOZG 4APVA 1N33Q 1LYLA 2A1AA 4DV1Q 4DK6C 2KCMA 1M1KC 4A93G 1H95A 4L5QA 3S17H 1EYGA 4IFDJ 3CCUA 5LMNQ 1Q12A 2CQOA 4OO1G 3PIOA 4C3JH 1KRSA 4A3LG 4R4CA 2MO0A 3EIVA 4YWMA 4QGUA 4IPCA 5C3EH 4A3FH 2HIXA 4R1JA 4A3KH 1X56A 2NVQH 4BBSH 2IX1A 5IYDG 4OX9Q 1N32L 3L0OA 2UUCL 3PUYA 1X9NA 4GS3A 4A3BH 1VQCA 4A3DH 4MTNA 3HOVG 2PI2A 3FKIH 3J80i 2WB1E 3J80c 1B7YB 2YTYA 1G6PA 2KHIA 1WI5A 1VQPA 1E1OA 2UU9Q 3K8AA 2R93H 3S1MH 1IBLL 4GN3B 1CKNB 1D8LA 4A3EG 4B3ML 4GNXB 4OWXB 2WAQG 3CD6A 1NJIC 3TEHB 1Q8KA 4X65L 3J81j 4GOPB 1XNRQ 2AKWB 2DGYA 4LF7L 3PUVA 2V1CC 1VQAA 2VQFQ 4DV4L 3T1YQ 1XMQL 2VL6A 2PQAB 3I2ZA 4X64Q 4KHZA 2EQSA 2E2JH 3ULJA 2LSSA 4ME3A 3I56A 1NMGA 1NY4A 1JJ2A 4QQBX 3S15H 4LF6Q 1NTGA 2WP8J 1XJVA 1VS0A 4DKAC 1CKMA 1R9TH 5LMUL 1K0RA 2NVXH 1AH9A 1YEZA 3BU2A 2R93G 4X62Q 4KHPL 4P72A 4R4QA 4LFBL 3CCLA 4DV3L 4X66L 5IP9H 1VQJA 3AQQA 1WJJA 1SFOH 4JI6Q 3A0JA 1Y1VH 5IY0A 5AJ3L 1Q1BA 5M3FH 4JI3L 1WFQA 4DR2L 1IBKL 2N3SA 1K73C 5GAEC 4DV7L 1VQNA 3HOZH 2CKZB 2N8NA 1FVIA 3HKZE 4GNXC 3TS0A 2GVBA 1ASYA 3PO2H 1RL2A 2Y0SE 2HHHL 1UE5A 4AIMA 4A3JG 3UDIA 4IPHA 3HKSA 1OXTA 2OCEA 4OXPA 4JBJA 3J81i 1C0AA 2K5VA 4JCVE 2ZM6L 4JI8Q 4BBRH 4IFDI 1QZHA 4DR1Q 2Q2UA 1A8VA 1VQ8A 1PH1A 3S24A 3OTOL 4LF5Q 2UXDQ 1RIPA 1T9HA 1V43A 3CCRA 2VW9A 2JA7H 2R92G 2F4VQ 3OTOQ 1E24A 3KFUA 4K0KL 4RG1A 3TS2A 4A3MG 4YY3L 1B8AA 2ZM6Q 2ZJRA 2VQEQ 3U4VA 2Q2IA 3RLOA 1E22A 4HJ9A 1JMCA 2R7ZG 1EIFA 4A3IH 1I6HH 2Q2HA 2OQ0A 2HQLA 3J7ZC 4GNXA 3CAMA 2LXKA 1KD1C 4GOPA 4H02A 2ID0A 4MZ9A 2QEXA 1FL0A 2MO1A 1SROA 4DV7Q 1NMFA 2IHFA 4DR2Q 1PH5A 1G291 4JI3Q 2I5LX 3GD7A 4A3EH 2MFIA 5AJ3Q 1XTDA 3GTJH 2VUMG 4JI6L 1VQKA 4C2MH 4X66Q 3HOWG 1OXXK 3AFQA 1YITA 4LFBQ 1HZ9A 3CMEA 4L5TA 4X62L 3HOYH 1UE1A 4KHPQ 3F8TA 1SN8A 5IYDH 1Z9FA 2RF4A 2BA0A 3NBHB 3E9HA 3M4OH 3RLNA 2IHEA 2IY5B 3JAMi 4DAMA 5M3MG 4C3HH 1KQSA 1K83H 4IJHA 5LMNW 4XTCS 2WFWA 3B6YA 4NB3A 5M3FG 2FXQA 1PH7A 4X64L 3CP0A 4JC0A 4PZ7A 3PIPA 3KF8B 3T1YL 4ALPA 1XMQQ 2VQFL 1HR0W 4GOPC 1A0IA 4A93H 5IT9c 4LF7Q 4O2DA 4XIGS 3HFZB 5GAHC 5HY6A 3GTQH 4X65Q 3GDEA 1Y1WG 2NVYH 1OXSC 3HOXG 3PF4A 4B3MQ 5IP7H 2K5NA 1P16A 3EN2A 4C3IH 1YVCA 2UU9L 2NN6I 5M5YH 3S1RH 2F3IA 2F52A 1CSQA 2WAQE 2R92H 1N32Q 5HGQA 1FGUA 2AHOB 2PQAA 1IYJB 3MEFA 4QIWE 3HOVH 1L1OC 3FP9A 1C7YA 4BA2I 2I5MX 2RHSB 3PCOB 4P73A 4BA1I 1K8GA 1NE3A 5C0XJ 2RHQB 1JB7A 3KLWA 3G48A 5JEAG 4EX5A 1EQRA 2VQEL 5GROA 4DK3C 5LMNL 5GADC 1EQQA 1KRTA 3PSIA 3ULPA 3CPWA 4YY3Q 3A5UA 1E3PA 1LUZA 1VQFA 2JA5G 1N8RC 1QUQB 4DNIA 4DV1L 1VQLA 2F4VL 4K0KQ 1N33L 5C0XG 2UXDL 1DGSA 2JA9A 4LF5L 2AMCB 4GLXA 1GD7A 4IJLA 4DUYL 4DR1L 1PH2A 1S40A 4UY8C 1VQ6A 4JI8L 4LUOA 5IYCH 3W5OA 4YHHQ 1WCMG 3CCVA 2JA5H 2PI2E 4DV0Q 4A3FG 4AYBE 1Q46A 2ATWA 5GAGC 1XNQL 1FJGL 1GVPA 3KDFB 2HHHQ 1E1TA 1PVOA 4GLVB 5IYCG 4JBKA 5E7NA 1X65A 2I0QA 5C4XH 4DUZQ 3M7NA 1MJCA 2I5HA 3BZKA 1IBKQ 4DPGA 1P8LA 2E5LQ 4WJ3M 3I4MG 1TWCH 4UP8A 3E0EA 2ALYB 4UP7A 1KAWA 2L15A 4YCVA 2IX0A 4DR7L 2B63G 4DV3Q 1YBYA 3HOUH 4JYAQ 2JK8A 3S2DH 1N36Q 4GLAC 4IOCA 2KCTA 5IWAQ 4BY1H 1SE8A 3PUXA 4OWTB 4DR4L 1N34Q 4JOIC 4KLKA 1VQIA 2ZTCA 3KJOA 5LMUQ 3I4NH 1L1OA 1X6OA 2KBNA 4P74A 4LF6L 2UUAQ 2D0PA 1IXRA 4A3IG 2ES2A 3PUWA 4HJ5A 1MKHA 2KENA 3GO5A 1PH3A 4JI7L 3Q8DA 5FLXc 3WWVA 1YJ9A 4LF9L 4DV4Q 3DLLA 3GTPH 4BY7G 2EIFA 2R7DA 3PF5A 4R4OA 1PFSA 1Y1WH 1PH6A 1MJEA 3M4PA 1YZ6A 2GVAA 5M3MH 2OTLA 3I4MH 1XNRL 1Z47A 4A3GH 2K5HA 1TWFH 3ER0A 4LFCL 3A5ZB 4PZ8A 3I7FA 3PGZA 4DAYB 4P71A 3A74A 1VQGA 2VY3A 4JG2A 5EAYA 1XMOL 1IBLQ 1PHJA 1GO3E 3CXCA 3STBC 3HKZG 4LF8L 2B29A 4GN5A 3F2DA 4OO1I 4DR5Q 3KF6B 2KHJA 1S72A 4HJAA 1VQOA 3RN2A 3U50C 4A3KG 2UUCQ 4BBSG 1KIXA 1MIUA 1G51A 4DR6Q 3PV0A 1U5KA 2K14A 4OX9L 5C44H 1W3SA 2BH8A 2IT1A 4JI2Q 3CC4A 2JEAI 3GTLH 1WOCA 2K50A 4RMFA 1WCMH 1HH2P 1I5FA 3GTMH 4O0AA 1SLJA 1O7IA 1HNZL 3CW2C 4KI0A 4X6AH 2QA4A 1TXYA 1EFWA 4OONA 4EQ5A 2NZHA 1QVGA 3ERSX 4LUVA 4IPGA 3H3VH 5IYBH 4POFA 4LF4L 3JAMc 4MNOA 2Z6KC 4AYBG 4B3RL 3UE0A 3CF5A 4DV2L 1Q1EA 4TQUS 3T1HL 4R4IA 3U4ZA 4UPAA 3UDGA 3JC66 4JBMA 1KHIA 2HT1A 3F2BA 1HNWL 2H5XA 3M4QA 1WYDA 2PMZE 4NXML 1EOVA 1S3OA 1X54A 4HJ8A 1N9WA 1A63A 5BR8Q 1UWVA 4R4TA 4HIKA 4B3TL 4A3BG 3G71A 4A3DG 4JV5L 2UUBL 1EWIA 4DR3L 1TWHH 2Y0SG 2D0OA 3G4SA 4GN4B 3CC2A 1YHBA 4LW1A 4GKKQ 1IBML 2A19A 1Y14B 4JI4Q 4YCWA 2QGQA 3NENA 1OXUA 4PG3A 1Q86C 3GTGH 3KJPA 3NEMA 4QL5A 1XPOA 2XTIA 4JI1Q 2JEBI 3KOJA 1YNXA 4BXXG 2ZJQA 1IZ6A 4YWKA 1YI2A 2Z6KA 3L2PA 2JA6H 2UXCL 4A3JH 1W2BA 1YIJA 2VUMH 1OTCA 4JI5Q 4Y7NH 3HOWH 1QVFA 1UEBA 1VQDA 4A3LH 4A3GG 3S2HH 1PV4A 3CCQA 1SR3A 2JA6G 3H0GH 3RN5A 4B3SQ 1K3RA 4UP9A 1L2FA 3K7AH 1VQ9A 1X3GA 3CQZH 3CCEA 2UXBL 1JJGA 2E2IH 1QZGA 1YHAA 2ZTEA 1VQEA 5H1SE 1KXLA 1PH8A 3UE1A 4GKJQ 2WB1G 2R6GA 1U0LA 3TQYA 3CC7A 4A76A 2CWPA 3STBD 1VQHA 1YHQA 1PH4A 4BY7H 5FJ8G 2UXBQ 2VNUD 5JJIA 3GTOH 3S14H 4NXNQ 2OTJA 2DUDA 5C4JH 1CKOA 1JE5A 3M85A 1HR0L 4DV5Q 4HIMA 2ASBA 3W1BA 2CFMA 2B3GA 3CCJA 4LFAQ 1I94L 2D62A 3OW2A 2VS1A 4JI5L 3H0GG 5C3EG 3RLFA 2E8GA 1X55A 4BY1G 2HIVA 2UXCQ 3GTKH 1JJCB 1TWAH 4P75A 4LNQA 2N49A 3TREA 4JI1L 5K36G 1SRUA 1I50H 1UE6A 5C4XG 3F1ZA 2JJQA 3H3VI 3KYHC 1VQBA 2LXJA 1PYBA 4IO9A 2BA1A 5FLMH 1Q81C 4JI4L 1QVCA 1IBMQ 1OXVA 2E2HH 1HNXQ 3AEVA 1Y1VG 1J5EQ 3S1NH 4DV6L 1ASZA 1JT8A 4DR3Q 5ELNA 4AQYQ 3RNUA 2UUBQ 5JJKA 4B3TQ 3S16H 2YYZA 5C44G 4JI0L 1EIYB 1HZAA 4A4IA 2BH2A 1VQ5A 4JI0Q 4LWCA 2OWOA 4NXMQ 1XPRA 3CCSA 3UDFA 4WJ4A 3TRZA 4DV6Q 2AWOA 3D31A 2VZAA 4QY7A 1X3FA 1J5EL 4A3CH 1K9MC 1HNXL 1EUJA 1BBWA 1UE7A 2MNAA 4DV2Q 2Q2TA 1NBWA 2JA8G 3K7UC 3ZJYC 2R7ZH 2JQOA 3SGIA 1X3EA 1CKNA 2YTVA 1CSPA 3IRBA 1AE2A 2JA7G 1VCIA 2Z0SA 1VQ4A 1BBUA 1BKBA 1CUKA 3UDXA 4A3MH 1YJWA 3M9BA 1XPUA 1I3QH 1HJPA 4A75A 5IP7G 1HNZQ 1KC8C 3NELA 3FKIG 2NZOA 3BZCA 2OQKA 4HJ7A 4POGA 1I94Q 4LFAL 2B63H 3HOUG 1PH9A 1GKHA 1L0WA 4L5RC 4IFDG 4BBRG 4JI2L 4NPSA 3OYYA 3LGJA 1HZCA 4DV5L 4OWWB 4LUZA 3CCMA 1LTLA 3K81C 3FHWA 2RCNA 5IYBG 3U58A 1HR0Q 4HIDA 4DR6L 4NXNL 3J81c 3PO2G 3K80C 4FDBA 3I55A 3G6EA 1VQ7A 1A62A 3AFPA 4DR5L 2ZTDA 1LM0A 4LF8Q 5J3BA 4GKJL 2YTXA 2NVTH 3H15A 3PO3G 5DLQE 1XMOQ 4J15A 3RZDH 3F2CA 2JE6I 3KDFA 4AQYL 5ELOA 4JOIA 2K4KA 4LFCQ 1B70B 5C0XI 1PA6A 3MXNB 1HZBA 3J7A5 3PO3H 4BXXH 3PUZA 3KF6A 4PZ6A 4YCUA 1GM5A 4B3SL 3CPFA 2AWNA 4LF9Q
chains in the Genus database with same CATH superfamily
3KLRA 3I90A 1V9PA 1PLFA 5IP9G 4NW2A 3AYHB 1VDZA 5C44B 1U4LA 1DJRD 1PYSB 1TWGH 4IALA 1CQVA 3D0FA 2E74C 4K8JA 1MI2A 2I46A 1CA6A 1E7ZA 1F77A 1EY6A 2IWHA 2IPKD 2RQXA 3Q23A 2CCZA 3NXWA 1FGBD 2XGTA 3CRLC 3K6OA 1QE6A 1EQVA 5M5XH 4JV5Q 1B9NA 1BCPD 3EBEA 1C9OA 3I4NG 3W1GA 1HNWQ 2KCNA 2NTTA 1SE3A 4YHHL 2JA8H 3VA5A 3DM3A 3T1HQ 4ZLTF 3NPPA 1QUQA 4B3RQ 5K5PA 2D9UA 2K52A 2EXDA 3CRKC 3HOZG 1LYLA 5TSSA 1JWUD 3S17H 1XWEA 2A73B 1EYGA 3H94A 5LMNQ 3M7GA 1LT4D 3QO2A 3PIOA 4G4KA 2MO0A 5C3WA 3D4WA 5CBAE 4A3KH 5M5XB 3VYTA 5ELFA 4BBSH 3S2HB 5IYDG 4KKSA 1N32L 1IW7D 2NYZD 4GS3A 3HOVG 2QKIC 2B2TC 2YTYA 1G6PA 1DD2A 2KHIA 2R93H 4GN3B 4OHJA 5L37A 2PPBC 3SDZA 4X65L 1IHZA 2XNAC 5NUCA 2R93B 5G3LF 2HQEA 3GTQB 3DUZA 3ND9A 1AN8A 1PTOC 2QW7A 2PO4A 4DV4L 3T1YQ 2PMZB 1XMQL 1ILQA 1NCVA 3ZYYX 4JW0A 4DF7A 4Y7NB 2Z4IA 1DOMA 2F0JA 4DKAC 3PO3B 4L6TB 2J7ZA 4O42A 4X62Q 3BVGA 2K05A 2O2LD 5IP9H 4DV3L 1VQJA 4F8MA 1Y1VH 3GV6A 1K73C 4TKOB 4DV7L 1SJHD 1PMRA 3HOZH 2N8NA 1HTPA 2N88A 4K8IA 5FK9C 2HHHL 2RVLA 2RCFA 4IPHA 4OXPA 1EYAA 2IJ0A 4JCVE 2EJFC 2RDFA 2HDMA 1A8VA 3QJYA 2WKDA 3S24A 5T1IA 2QF7A 4QB4A 1EEFD 2VW9A 1GJXA 3OTOQ 1E24A 3DXJC 3S2DB 4A3MG 1BCPB 4YY3L 1B8AA 3GQBA 1F2MA 1E22A 4HJ9A 3EA6A 5KGUA 4A3IH 4FP5D 4I65A 1K83B 1I4GA 4H02A 2QDBA 2EYPA 2MO1A 4A3IB 2IHFA 1A3VA 1PH5A 1ILPA 2NB0A 1XTDA 3HZXA 4C2MH 4C2MB 1KTKA 2OEOA 1YITA 3CMEA 5J22A 1HCZA 3EVQA 1UE1A 1VMPA 2CH4A 2K5DA 3F8TA 3DWQA 3NTKA 4DAMA 2BE5D 1K83H 4IJHA 4XTCS 3J80E 4NB3A 2FXQA 1PYWD 5C4HA 4G57A 4X64L 2X69A 1BO0A 4PZ7A 2QILA 2VQFL 5DAUA 1HR0W 1YNND 1A0IA 3TDQA 1STNA 4O2DA 5GAHC 4JK1C 2NVYH 2EDGA 3HOXG 5M3MB 2F0KA 3E5SA 4CDFC 3GTGB 5M5YH 1CSQA 3QIAA 3K5OA 4ULLA 2PQAA 3HOVH 2RHSB 2MJ8A 1SYEA 4GZYC 1K8GA 3C3LA 5JJZA 3V96A 4EX5A 1IL8A 5GROA 4DK3C 5IGFA 1EQQA 1KRTA 3ULPA 1E3PA 4RGMA 4C56C 1ENAA 1ML0D 2UXDL 2JA9A 3D4RA 4ZKCB 1QNKA 4DUYL 4DR1L 1PH2A 1EU4A 4UY8C 1VQ6A 4ZUIA 4JI8L 3KUPA 1SYGA 1XTCD 1FYCA 2LMCB 4AYBE 1EY8A 5GAGC 4FF3A 1FJGL 5ELCA 3KDFB 1JOQA 5E7NA 1X65A 5C4XH 2E5LQ 4WJ3M 1D6EC 1TWCH 2F0EA 3EROA 1FNVA 2VNUD 4YCVA 5EPLA 4JYAQ 3HOUH 1SNCA 2XSCA 5BN4A 1DXMA 4IN3A 2KCTA 5G3LD 3K5MA 1SE8A 2K04A 3ERQA 1N34Q 2ZTCA 1X6OA 4RCNA 4DAVA 4LF6L 2D0PA 3PQIA 4A3IG 3PUWA 2K7VA 3GO5A 3NTIA 1UNSA 1G8ZD 1QJOA 1O7LA 3HRZC 3DLLA 3HOWB 4BY7G 4R4OA 5C5LA 3S1RB 1HA6A 5KNCA 2HUGA 1Z47A 4IUQA 4LFCL 4PZ8A 4AQYQ 1B1ZA 3A74A 1XXGA 2C9OA 4JG2A 3FKIB 3HOUB 3KF6B 3N52A 1S72A 3R8BA 3RN2A 2UUCQ 1KIXA 1G51A 3DEPA 2EYHA 3BDOA 4DR6Q 1GOZA 2K32A 4QUFA 3I8ZA 1HH2P 1I5FA 1STEA 5ISRA 1O7IA 5A2QL 3BZDB 2EY6A 3QWNA 2JYOA 1Y8OB 2A68C 1NSNS 4IPGA 3H3VH 3IL8A 3E6ZX 3I4MB 2NVTB 4AYBG 3GTKB 5E1FA 1PRTC 1K3BC 4TQUS 1WTQA 1IKMA 3TZUA 3JC66 4CGYB 3M4QA 1WYDA 2PMZE 3IAYA 1EOVA 1S3OA 5EPKA 1W6KA 4FO2A 5BR8Q 4HIKA 4B3TL 1GUNA 2RDHA 2NN6H 2A74C 5M3FB 2D0OA 3G4SA 3CC2A 2V4DA 2EYJA 4GKKQ 1Y14B 3SR1A 3BS1A 4YCWA 4JI4Q 3KJPA 4QL5A 1TS4A 1XPOA 1YNXA 2AUKA 3P75A 1IZ6A 1ZYRC 2B2UA 2VUMH 1A15A 1VQDA 2L1BA 3NBIA 2NVQB 4MN3A 5EBCA 2DJGC 1BF4A 1K3RA 4UP9A 3K7AH 1CTMA 4ZUJA 2ZTEA 1V1PB 1VQEA 3UE1A 3CC7A 2L12A 3TQYA 2CWPA 1Y8NB 4A3GB 1ENFA 2DUDA 2A69D 4EGVA 2A69C 2ASBA 1LT6D 2B3GA 3HOVB 3H91A 2XRQD 3OW2A 2IL8A 4P75A 3TREA 1F9PA 2WACA 1I50H 3NWTA 1NR2A 3F1ZA 2C5CA 2JJQA 3MTSA 2DNEA 2KCCA 2JA8B 1GUTA 5JVG3 1JT8A 1EFID 5ELNA 3S16H 3J80L 5C44G 4JI0L 1VF5C 2B8FA 4XT3B 1VQ5A 4JI0Q 4LWCA 4NXMQ 4WJ4A 1LO5D 5IGDA 1O78A 2VZAA 1X3FA 3P1HA 1K9MC 1TS5A 4XYQA 3ZJYC 3SGIA 1LTID 3JAME 4IZ8A 4ZKBB 3K7AB 1VQ4A 1BBUA 2KUMA 2XIWA 1YJWA 1XPUA 1SBBB 1HJPA 2SEBD 4XQJA 3NELA 4POGA 4HMIA 4BBRG 4JI2L 4NPSA 1MD2D 3OSOA 1HHVA 3K81C 2RCNA 4QCLA 4HIDA 3J81c 1RD9D 4FDBA 5T1GA 2D5DA 3V2TA 1LTAD 3OMCA 4F7XA 2PZTA 4DR5L 3A55A 3WOFA 1SJED 5J3BA 4OIKA 3H15A 3N6RA 4J15A 1DYQA 3F2CA 3T16A 2NVXB 1CM9A 3SK6A 1WTWA 3PUZA 1JR0D 3KF6A 1LTBD 4ILWA 3I4LA 3MXPA 1JICA 4AYBB 3HEJA 2YU9H 3R2TA 2NN6G 3PO2B 4JI7Q 2ZXOA 4DXGA 5IGBA 1D7QA 3RZOH 3RR5A 4KHVA 3OWFA 2QDLA 4DR4Q 2B2WA 1AFPA 1L1OB 3I4NB 2GN5A 2FINB 4U673 4JBWA 3ULLA 5F2DA 1N36L 1GUWA 1Q7YC 1M90C 2F0WA 4ODGA 4R8IA 4PMWA 4GKKL 3E9IA 4IOAA 5EJWA 1RF2D 4XT1B 2MQHA 2ZJPA 1QG7A 1IL2A 4A3CG 4BS9A 5BR8L 2E75C 1XNQQ 5IE8A 1SMXA 1SEBD 1YJNA 1TVXA 4DV0L 4K6DA 1J6QA 5LL6S 4YWLA 4L5SA 4XQNA 2F0LA 1E0BA 4RKBA 5ELBA 2A1AA 3HS0C 1M1KC 1PRTD 1Q12A 1SE4A 2CQOA 3LNNA 4A3LG 4QGUA 4A3FH 2HIXA 5E4WC 5LL6X 2IX1A 1K0SA 2H1EA 5DEHA 2AUJD 3OIPA 5C0XH 3L0OA 1E2VA 3PUYA 5KYLA 2UUCL 4MTNA 3HOZB 4CKBA 3A8IE 2WB1E 3I70A 4A3MB 5CBEE 1F2ZA 5EBDA 1I4RA 4B3ML 4H44C 2P5ZX 2WAQG 4LJZC 5EGTA 1ENCA 5IT9E 4CJ2C 2DGYA 3ONAB 4ME5A 4LF7L 2G9DA 1F9RA 3PUVA 5CV7A 2V1CC 1VF7A 5M9OA 2VL6A 4FXDA 3I2ZA 3TP7A 4M1UB 3ULJA 2ENBA 1NY4A 1JJ2A 2KJXA 4LF6Q 1XJVA 1H9SA 4C3HB 1AH9A 3K0YA 2F3VA 1CZGA 3BU2A 3TZDA 3V05A 3EFXD 4P72A 4R4QA 2BOSA 3A0JA 5IY0A 5AJ3L 1Q1BA 3KF8A 4JI3L 4QUCA 1WFQA 4DR2L 2N3SA 1TR5A 5GAEC 1VQNA 1KDBA 1FVIA 2OT2A 1ASYA 1RL2A 4AIMA 1SMYC 3UDIA 3HKSA 1OXTA 2OCEA 2GA4B 1QWYA 3S16B 1PFNA 2XRSD 1F2LA 4JI8Q 4DR1Q 1TS2A 2Q2UA 4X3SA 2UXDQ 1RIPA 3CCRA 2R92G 1H9MA 3BYTB 2ZM6Q 1Z7TA 3U4VA 2M2LA 3RLOA 1JMCA 1I6HH 2Q2HA 2OQ0A 3J7ZC 3DEOA 2LXKA 2ID0A 4MZ9A 2QEXA 1FL0A 3QG1A 1SYDA 1KNEA 1G291 3NQIA 3SHLA 2MFIA 4JI6L 1VQKA 4X66Q 3HOWG 4BY7B 1B2TA 4LFBQ 4KHPQ 3HOYH 1SN8A 4XXEA 5FO7B 3T56B 2RF4A 1TY0A 2B2UC 4E6IA 3E9HA 3M4OH 5D14A 5M3MG 5LMNW 1NNXA 4B9WA 1EY0A 3CP0A 4JC0A 3KF8B 4ALPA 3VR6A 4GOPC 3X3MA 5IT9c 5EKKA 1CZWA 1I3QB 1S5ED 1Y1WG 1EU3A 4IQZA 3PF4A 4DU9A 1ET9A 1JORA 4Z9CB 2K5NA 1P16A 3EN2A 3AMUA 2SNMA 4N8X1 2UU9L 4C1NK 3S1RH 1FR3A 1STYA 2R92H 4HCEA 1ONLA 3FP9A 1C7YA 1JC7A 2NWGA 4P73A 4BA1I 5C0XJ 1SXTA 4J1MA 4A3FB 3KLWA 3G48A 1EQRA 2F0HA 3T53B 4I7ZC 2OXPA 1SSOA 1JOKA 1JWSD 1QOHA 2X6GA 4YY3Q 1VQFA 2JA5G 1QUQB 2LKVA 4DV1L 1VQLA 1N33L 4IUUA 2AMCB 3BDCA 4J6HA 2A6EC 1S40A 1UEAB 4LUOA 5I6WA 3A7AB 2JA5H 3D4DA 5E3FA 1JQYD 1PTOF 5I2XA 4KJOA 2ATWA 2HHHQ 4XYOA 4EQPA 4GLVB 4JBKA 1W6JA 5JEAH 4DUZQ 2I0QA 1MJCA 1EY7A 1P8LA 1STGA 3I4MG 4DR7L 2K01A 4ZRZA 4DV3Q 3S2DH 3NP8A 5IWAQ 2J0TD 4X3UA 4OWTB 2F1MA 4CKCA 4JOIC 4KLKA 1D1KA 1SNQA 3I4NH 1L1OA 3NHHA 2K28A 2OF1A 2UUAQ 1SAPA 1MKHA 2KENA 3FMCA 3R2IA 2O4XA 3WWVA 4LF9L 3SK8A 4DV4Q 1B53A 3GTPH 1FNWA 1MJEA 1Y1WH 3S17B 5M5YB 1YZ6A 5M3MH 3I91A 4OEMB 1PTOB 2K5HA 1TWFH 3ER0A 4DAYB 3LX0A 5EAYA 1XMOL 3K59A 4OO1H 3HKZG 4OO1I 2B29A 4GN5A 3F2DA 3OMGA 5CV5A 1VQOA 3SK5A 3MC0B 1KLUD 1SYBA 2EE1A 1U5KA 2K14A 2IT1A 2K33A 1D5MC 1XX8A 4KJNA 3CW2C 4L63B 4ZCKA 3C2PA 2QA4A 2WB1B 5HURA 1T5EA 4P2CB 4EQ5A 1O7ZA 2NZHA 5C6AA 4POFA 3D6WA 5JPNC 1RTOA 1A3UA 4B3RL 4DV2L 2XWBB 3T1HL 3DWAA 1HNWL 1DOLA 4PQXA 3H09A 2MP1A 1UWVA 4R4TA 3URYA 4A3BG 3G71A 4A3DG 3IFTA 4JV5L 4DR3L 1TWHH 2RSNA 3LWUA 4K14A 3C1FA 2B2TA 1H9RA 3GTGH 1ICFB 4PMBA 2F0NA 4ABNA 3NWSA 1BR9A 1MGSA 5FLXE 3CU7A 2JEBI 3KOJA 2ZJQA 3ND8A 4YWKA 2F0QA 3GTJB 2UXCL 4A3JH 4L8JA 4DAYA 4JI5Q 4KKTA 1QVFA 3NK9A 1LTSD 4KD4A 1SDFA 2VXWA 3CCQA 1MBYA 2JA6G 1HPCA 3RN5A 4B3SQ 1L2FA 4J8QA 1VQ9A 3CQZH 1KLGD 2UXBL 2E2IH 4NP5A 1KXLA 4BY1B 2R6GA 1U0LA 1X3QA 2UXBQ 2TSSA 4HEDA 4RGOS 4BBRB 3Q24A 2L5TA 3FRPB 3NSWA 5C4JH 1CKOA 1RCVD 1GHKA 3O13A 1I94L 2D62A 4PMCA 4JI5L 3H0GG 3TP8A 5C3EG 2UXCQ 1X55A 2PZWA 4BY1G 5FO9B 3GTKH 5JPMC 1JJCB 1TWAH 1I6VC 1K8MA 1PZJD 2N49A 4LNQA 5K36G 2XWJB 2PYKA 1SFOB 1VQBA 2BA1A 1QVCA 2E2HH 2BDNA 4ID6A 3QB3A 1HNXQ 3S1NH 5K36H 1ASZA 3FPUB 4DR3Q 1EY4A 2ZT9C 5JJKA 2EJGC 1EIYB 1BCPC 2BH2A 3H6MA 3TP6A 3W2DA 1H9KA 3TRZA 1HRJA 3D31A 5HGTA 4A3CH 1U4MA 4DK1A 4RGTA 1UE7A 2SNSA 2XN9C 4DV2Q 2JA6B 1S4ZA 1NBWA 2B2WC 3K7UC 1Y1VB 3VA7A 3DMUA 1PTOH 3VR2A 3IFDA 4IURA 1CSPA 3IRBA 2JA7G 1L0YB 2Z1CA 2AQ1B 1BKBA 1I3QH 3MFGA 3FKIG 3BZCA 4G7ZC 2B63H 4LFAL 1BOSA 2EY5A 3R3OA 3OYYA 3LGJA 1STAA 1U9RA 1LTLA 1G2SA 2HDLA 3FHWA 1HR0Q 3M3YB 4NXNL 3I3CA 3K80C 3G6EA 2EPBA 2JA7B 1LM0A 4RWSC 2YTXA 1LT3D 3KK7A 4RAUC 3PO3G 5DLQE 2AQ3B 1XMOQ 2JE6I 4PNYA 1B70B 3J7A5 1PA6A 2R7ZB 1XYIA 2NUCA 5C4XB 4YCUA 4N9PA 3I72A 4WORA 4LF9Q 4Y52H 5ELDA 2UUAL 5D3DA 5FLMG 1KL9A 4CHTB 3HGBA 2BE5C 3Q6SA 3VDYA 2CWAA 5IWAL 3MAQA 3A56A 4H0LC 1K8AC 4DR7Q 3VYRA 1TWFB 4CJ1B 4TVAB 3TBIB 4DUZL 1EWCA 2O5IC 2Q8RE 2RKSA 1TQOA 2RSOA 4N8FA 3TP5A 2G5DA 3NUCA 1BDOA 4CDCC 3CMAA 2R7FA 1VQMA 5LHY1 1EIGA 2A8VA 1UAPA 1Q82C 4IPDA 5C5MA 1NUCA 1L0XB 1N33Q 4N9TA 3G6JB 3SK4A 4DV1Q 4DK6C 2KCMA 4A93G 3W3AA 4FF1A 3R93A 3CCUA 4OL7A 4C3JH 4R4CA 4YWMA 4IPCA 3SVMA 4KK7A 4R1JA 1V8QA 4TSSA 2NVQH 3MXNA 3VYUA 4DN4M 1C4QA 1X9NA 4A3BH 4A3DH 3FKIH 2F0TA 3J80i 2UU9Q 3K8AA 1IBLL 3EQLC 3NTHA 4RCOA 5COYA 3J81L 3TEHB 1Q8KA 3J81j 4GOPB 5JVH3 3HOXB 1C8CA 2M9VA 1B4OA 1VQAA 1WD1A 2PQAB 1IKLA 1JCKB 4ME3A 1NMGA 3I73A 4QQBX 1M4VA 1S5CD 1NTGA 1VS0A 1R9TH 5LMUL 1K0RA 5KYIA 2NVXH 1YEZA 4CKEA 1K28A 4FVMA 2R93G 4KHPL 4FF4A 4LFBL 2PCFB 3CCLA 2KECA 1RHPA 4X66L 2A6ED 3AQQA 4JI6Q 1SFOH 2DN8A 4B9XA 5IODA 1MSHA 1IBKL 1SYFA 4A93B 3TS0A 2E2DC 1TY2A 1X32A 1PDQA 1EZ6A 1UE5A 5ELEA 3RD4A 4A3JG 5J39A 4NDXA 2KEEA 3OWEB 1B3AA 3PIO3 4JBJA 2K5VA 2ZM6L 2NZ1D 5I9OA 2KEDA 1VQ8A 3FVQA 2MPMA 3CKIB 4LF5Q 1V43A 1F9SA 1RDPD 2JA7H 2CQAA 2F4VQ 4K0KL 2F0MA 1FNUA 2DY7A 4IUPA 1AP0A 3CQZB 2ZJRA 2VQEQ 2R3ZA 2R7ZG 2VB3X 4GNXA 4ZK9B 1KD1C 4GOPA 2JXMB 4ZQ3A 1V1OA 4FNFA 4QF4A 1SROA 1NMFA 4DR2Q 4JI3Q 4MHEA 5AJ3Q 4X3KA 3CHBD 3AFQA 2FMMA 5IGCA 4C3HG 4H7BA 1HZ9A 5CYUA 3D8GA 2D2CC 1Y1WB 2IHEA 2IY5B 4DFAA 3JAMi 4C3HH 1WTVA 1KQSA 1EY9A 2WFWA 3B6YA 5E4XA 3PIPA 3S1NB 2B63B 1WTPA 4A93H 2CH4W 4TRDA 4LF7Q 5HY6A 2EXZA 3A8JE 3J7AF 3OIQA 4B3MQ 5IP7H 1CHQD 4C3IH 1YVCA 3J7AV 4CDEC 3JAML 2NVYB 2R61A 1E2ZA 4JPBW 2WAQE 3MA2B 3DM1A 2AHOB 1IYJB 1L1OC 4NKLA 2I5MX 3VR3A 3PCOB 4R9WA 1NE3A 5A2QE 2RHQB 2BCOA 1SMYD 1JB7A 5DM73 5JEAG 1TT2A 3BVMA 5GADC 2EYLA 3PSIA 1LUZA 2WINB 4U68A 2Z9HA 1EYDA 4HAEA 4DNIA 1GD7A 2CVRA 4PV1C 2EOTA 2RA4A 4H13C 2IW3A 1DCZA 2CW0D 3W5OA 4A3EB 4FYDA 1GXDC 4DV0Q 4A3FG 1AZQA 1C48A 4KY5A 1A2TA 1XNQL 2Q8TA 3U9OA 1GVPA 2ICEC 1E1TA 1ICWA 5IYCG 3NQTA 5D3IB 1HTLD 1AEXA 3M7NA 3BZKA 1E2WA 1BNZA 2LFNA 5EPJA 4DPGA 1Q3LA 2LY7A 4F88A 1ZXTA 2ALYB 4UP8A 1ESFA 1KAWA 2L15A 4B08A 4IFDJ 3S1MB 3AB9A 2HD3A 1N36Q 4GLAC 1EOTA 2F0DA 5EKLA 4BY1H 4QMGA 4WFN3 4DR4L 3AU7A 3KJOA 1VQIA 1ZKOA 4P74A 1DZ1A 1IXRA 3P20A 3RZOB 4DAPA 4HJ5A 4JI7L 3PIP3 2ICIA 5FLXc 4LK1C 2EIFA 2R7DA 4HTHA 5CV9A 5C4JB 1H9SB 2GVAA 4A3JB 1DM0B 1XNRL 1ZYRD 5I2YA 1PXUA 3UDGA 3A5ZB 1KC8C 3I7FA 3PGZA 1VQGA 2VY3A 1GO3E 1A6XA 3CXCA 1O80A 3STBC 1LLRD 2E76C 4DR5Q 3KLSA 2E2IB 1B50A 2KHJA 4HJAA 4A3KG 1F2YA 4BBSG 1MIUA 4OX9L 1SNMA 1W3SA 2BH8A 4JI2Q 4YIJA 3CC4A 1WOCA 4ZYSA 3Q0AA 4O0AA 1SLJA 3GTOB 1PZID 4IUNA 4KMUC 4X6AH 1M8AA 1TXYA 2XVSA 3QOLA 4OONA 1EFWA 3K5NA 1QVGA 2WV6D 4LUVA 3OW7A 4OGQC 3TMEA 4LF4L 3MZ5A 4MNOA 1BBXC 4K6LA 1Q1EA 3GTPB 3U4ZA 4UPAA 5BN5A 3Q22A 5AFWA 4JBMA 1KHIA 2CW0C 3F2BA 3BVZA 2HT1A 2H5XA 2B2YC 1G6ZA 4NXML 1BUVT 2NBFA 1X54A 4HJ8A 1N9WA 1Q90A 2J4XA 2JA5B 2F3WA 1EWIA 2Y0SG 3DWPA 4LW1A 2G9HD 2QGQA 3NENA 1OXUA 2F0VA 2XTIA 4BXXG 1R9TB 5CV4A 2F0SA 1YI2A 2Z6KA 4M8AA 2JA6H 3HKZB 1QILA 1UEBA 2Y0SB 4A3GG 4MIUA 4A3KB 3S2HH 1PV4A 5IGGA 4BBSB 1SR3A 2BDOA 1HUNA 1HFGA 2PW5A 4ZAIA 1QZGA 1YHAA 2L0CA 1PH8A 1IYVA 4GKJQ 2WB1G 4A76A 2HCCA 1YHQA 1PH4A 1VQHA 5FOBB 5FJ8G 5CC4A 3S14H 2F0GA 3GTMB 3S15B 1JE5A 4HMJA 4I7AA 4DV5Q 2RDGA 2E2JB 3W1BA 1LABA 3SXHA 2H4OA 1II3A 5DNFA 1KNAA 1U4RA 1SE2A 3KBXA 3T13A 5C4XG 4XQQA 3KYHC 4IO9A 2LXJA 1PYBA 1Q81C 5FLMH 4JI4L 2F03A 1TS3A 1Y1VG 1J5EQ 1TKWB 4DV6L 4S3SA 1TWGB 3RNUA 4B3TQ 2YYZA 1HXYD 5C3EB 2ZXRA 4RFBA 2EZVA 2K6AA 2I07B 1XPRA 3UDFA 3M4OB 4DV6Q 4O1NA 4QY7A 1J5EL 1I4PA 1BBWA 2K1BA 2MNAA 2Q2TA 2JA8G 5C3XA 2JQOA 4FXGC 5IT9L 1I4QA 5IIFA 1VCIA 3QOJA 2Z0SA 3WOEA 3UDXA 1DOKA 1LTRD 2WAQB 5I4DA 4IFDH 3BG3A 3HOUG 3RUZA 5CGKA 1PH9A 1TIID 4L5RC 5I9PA 1HZCA 2B2VA 3D6CA 4DV5L 4LUZA 4LMQD 4OWWB 1YNJC 5IYBG 4DR6L 1QB5D 3PO2G 3I55A 1A62A 1WTRA 3AFPA 5KEEA 1GUGA 5BN3A 4GKJL 3K57A 2NVTH 3HOYB 1TWCB 4AQYL 4LFCQ 5ELOA 3K58A 2K4KA 3S9WA 3PO3H 3MXNB 1HZBA 5FKAC 5KNBA 1GM5A 1PTOD 1KDCA 3KLSX 3TSSA 4K5XA 4RH6A 2F4IA 3OHXC 3VR4A 1AE3A 2VB2X 1LT5D 4DA2A 4QJFA 2PNHA 2WKCA 1N34L 1GUSA 3HOYG 4OELB 2N78A 1BVSA 1EWHA 1CFMA 1RJTA 3J7YW 1T5XD 4HSPA 3LWEA 2N55A 4RA8A 1ET6A 1H9JA 5JEAJ 4JYAL 5JJLA 1R4PB 5FJ8H 3L7ZC 2E5LL 3M3YH 2F0UA 2AQ2B 2C35B 1LACA 1RTNA 3H0GB 4HR7B 2YV5A 4AH6A 2L55A 1D1IA 2K75A 1FJGQ 3IKJA 1WD0A 1EQTA 1V1QA 3ITPA 3BJUA 3DHQA 3HOXH 1WVLA 3K0XA 4KN7C 4FF2A 2RBMA 3MHBA 2E2HB 1J8IA 1AW7A 3I4OA 4HIOA 3S1QH 5GQOA 4DUYQ 5M5WH 3ICEA 1I50B 4LF4Q 2FJ2A 1CQFA 4APVA 2KA7A 1H95A 4L5QA 3NE5B 2A5HA 4KV6A 2A6HD 3J81E 2JN4A 4OO1G 1S5BD 1TU2B 1KRSA 3EIVA 2A68D 5C3EH 3KBGA 4C3JG 1X56A 3OPOA 4OX9Q 3HG9A 2DJFC 1VQCA 3C1EA 2PI2A 3J80c 1CHPD 1B7YB 2Q8IB 1VQPA 1WI5A 1E1OA 3S1MH 1CKNB 1D8LA 4A3EG 4GNXB 1NR4A 4OWXB 4KTAA 3CD6A 1NJIC 3E0JA 1XNRQ 2AKWB 4CJ0B 4F87A 1J9OA 2VQFQ 1SNDA 4K2KA 1UUPA 2LS01 4X64Q 4KHZA 2EQSA 2E2JH 3I56A 2LSSA 2EVBA 2EYMA 2VUMB 3S15H 4K5WA 2WP8J 1CKMA 4XDXA 1SYCA 2TMPA 1O7YA 4IUVA 3EJIA 3K5LA 1WJJA 1S5DD 5M3FH 1TWHB 1KAAA 3D3RA 4DGZA 4DNRB 1JOOA 3P7JA 2CKZB 4GNXC 3HKZE 4LAAA 1I4HA 1HUMA 2GVBA 3PO2H 2Y0SE 1G2TA 1WCMB 5A35A 4EVOA 5KNDA 3MFYA 3J81i 2EY2A 1C0AA 2MGSA 4C3JB 4BBRH 4IFDI 1QZHA 4WJWA 1PH1A 3OTOL 1T9HA 2JP1A 3KFUA 1EEID 4RG1A 3TS2A 1ZEQX 2Q2IA 5I6YA 1EIFA 1CK1A 1NAPA 2HQLA 3CAMA 1BCPF 2X6LA 1I6HB 4DV7Q 1U4PA 1G91A 1Y69U 4C3IB 2I5LX 3GD7A 4OIJA 5CV8A 3TN2A 3GTJH 4A3EH 2VUMG 1OXXK 4K5VA 1FD7D 5CV6A 4L5TA 3X3NA 4X62L 5IYDH 2SOBA 1LV9A 1Z9FA 2BA0A 1HQRD 3NBHB 2EYOA 1GHJA 3RLNA 4G7HC 3L3OC 1S5FD 2IX3A 5M3FG 1PH7A 4RHRA 3T1YL 1XMQQ 1STHA 2YU9B 2B8GA 1X3PA 3M4YA 2KHSA 1RKNA 3HFZB 4XIGS 3GTQH 4X65Q 1V1PA 3GDEA 5D65A 5JOBA 3UI2A 1OXSC 5DM63 2Z4HA 5M5WB 4HN7A 2NN6I 4CDDC 5JAVA 2F3IA 2F52A 1K8OA 3H3VC 3BDLA 1N32Q 5IGEA 5HGQA 2JSOA 1FGUA 4QIWE 3MEFA 1PZKD 3SE0A 4BA2I 2L11A 1YNJD 2F0IA 2VQEL 5LMNL 4UDUC 3L9AX 1Y8PB 3CPWA 3A5UA 2F4VL 4K0KQ 2F0FA 5C0XG 1DGSA 4LF5L 4GLXA 4IJLA 3T4AC 2FHTA 2L9HA 1KDAA 4NMZA 3S1QB 1Z6HA 2KQ3A 5IYCH 4YHHQ 1WCMG 3CCVA 2HCIA 2PI2E 1Q46A 4EQNA 4CBVA 1CA5A 4HSVA 3MWYW 1PVOA 3E3XA 2I5HA 1IBKQ 3MVVA 4V190 3RZDB 3E0EA 4RKLA 4UP7A 2IX0A 4HCSA 2B63G 1YBYA 1STBA 3SEBA 2JK8A 4KD3A 4IOCA 1QCBD 3PUXA 3GP7A 3VR5A 2PNRC 1CI3M 1YNNC 5LMUQ 2KBNA 4Q5VA 2DNCA 2ES2A 2EJMA 1PH3A 2Z8LA 4Q0FA 3Q8DA 1SNOA 1YJ9A 3F2UA 3PF5A 1PFSA 2NTSA 5J1ZA 3M4PA 1PH6A 2OTLA 3I4MH 1EYCA 4A3GH 1N8RC 4P71A 1IBLQ 1PHJA 1Q8IA 2MHVA 4LF8L 2B2YA 1EIHA 3FEWX 3U50C 3HP3A 1OO9B 2EY1A 3PV0A 5C44H 4G7OC 1GUOA 3GTLH 2JEAI 4C1NI 2K50A 4RMFA 1WCMH 1PRTB 3GTMH 3C46A 1KABA 1HNZL 1PFMA 4KI0A 3MEHA 3A54A 2Z6BA 3ERSX 5IYBH 1WTOA 3JAMc 3MXGA 4C3IG 3G7LA 1I4XA 2Z6KC 3FDTA 3UE0A 3CF5A 1RODA 1BXTA 1B44D 2PZUA 4R4IA 3QR8A 2KVMA 5EQ0A 2K5QA 1MHWC 5FO8B 3MXUA 2MUYA 5CMDA 2PW7A 1A63A 2QCPX 3GTLB 1PFBA 1F9QA 2UUBL 1BQQT 3S14B 4KKUA 2QEJC 2PQEA 4GN4B 1R4QB 1YHBA 4DXFA 3A8KE 1IBML 1B3QA 2A19A 1LTTD 4PG3A 2KOLA 4FXKC 1Q86C 3NEMA 4K2LA 1LTGD 4JI1Q 1PRTF 1D5XC 2CHBD 2F0OA 4EQOA 3L2PA 2L4NA 4JVZA 1W2BA 4UHVA 1HA5A 4V0BA 1YIJA 1OTCA 4Y7NH 4A3DB 4A3BB 3HOWH 4A3LH 3A7LA 5IOCA 3FPPA 2WIIB 1JWMD 3H0GH 2SDFA 1X3GA 1JJGA 3CCEA 1VMCA 5EKIA 1SNPA 5H1SE 1DONA 3BYYB 3STBD 1AZPA 5JJIA 4BY7H 3GTOH 5KIXA 4NXNQ 2OTJA 3PMFA 3M85A 1HR0L 4HIMA 4UAIA 2CFMA 1EZ8A 3CCJA 4LFAQ 2VS1A 1CT1D 2B2VC 2E8GA 2DY8A 3RLFA 2HIVA 1MSGA 3WDNA 4JI1L 1ESRA 1SRUA 5KRUA 1UE6A 2K5WA 3H3VI 1TWAB 1IW7C 1IBMQ 1OXVA 4X3TA 2FMCA 4R8NA 3AEVA 5CR3A 2UUBQ 3VYSA 3GV3A 1HZAA 4A4IA 1IYUA 2FFKB 3RMHA 4KN4C 3U9SA 2OWOA 3NBHA 3OOCA 3CCSA 2F0PA 2AWOA 2A6HC 3T51B 1HNXL 1EUJA 4KY6A 4RHSA 2R7ZH 2EYFA 1D2BA 4DNTB 1D5ZC 1HQMC 1CKNA 1X3EA 2YTVA 1AE2A 1A3TA 4A3MH 1CUKA 5FLXL 2ZXPA 4RGNA 3M9BA 4MTKA 4A75A 5IP7G 1QNUA 1HNZQ 1JB3A 2NZOA 4QIWB 1A2UA 2OQKA 4IUTA 4HJ7A 1I94Q 1B9MA 1GKHA 1L0WA 4IFDG 1JE4A 2K03A 3CCMA 4WRDA 4KY7A 3U58A 1VQ7A 2R92B 5C4ZA 1EL0A 2ZTDA 2B39A 2M00A 1WTHA 4LF8Q 1EY5A 5CORA 3RZDH 3KDFA 4JOIA 1HFNA 5C0XI 1WTXA 4BXXH 4PZ6A 4BWGB 4B3SL 3CPFA 2O5JC 2AWNA 4DK0A
chains in the Genus database with same CATH topology
2YU9H 4Y52H 2NN6G 4JI7Q 1AE3A 1V9PA 5IP9G 2UUAL 1D7QA 3AYHB 3RZOH 4QJFA 3RR5A 2PNHA 5FLMG 1KL9A 1PYSB 1N34L 3HOYG 4DR4Q 1TWGH 1L1OB 2N78A 1BVSA 2GN5A 2CWAA 3D0FA 5IWAL 3VDYA 4JBWA 3ULLA 1N36L 1Q7YC 1M90C 1E7ZA 4PMWA 5JEAJ 1K8AC 4DR7Q 4JYAL 5JJLA 4GKKL 2CCZA 3E9IA 5FJ8H 3L7ZC 2E5LL 2XGTA 3M3YH 4IOAA 4TVAB 2C35B 4DUZL 2MQHA 2ZJPA 5M5XH 1IL2A 4JV5Q 4A3CG 5BR8L 2YV5A 4AH6A 2K75A 1FJGQ 1XNQQ 5IE8A 1SMXA 3EBEA 1C9OA 1YJNA 3I4NG 1V1QA 3CMAA 4DV0L 3BJUA 3W1GA 1J6QA 2R7FA 3HOXH 1VQMA 3K0XA 1HNWQ 4YHHL 2JA8H 2A8VA 3DM3A 3T1HQ 3I4OA 4HIOA 1QUQA 1Q82C 4B3RQ 3S1QH 4YWLA 4IPDA 5GQOA 5M5WH 4DUYQ 2K52A 4L5SA 3ICEA 2EXDA 4LF4Q 3HOZG 4APVA 1N33Q 1LYLA 2A1AA 4DV1Q 4DK6C 2KCMA 1M1KC 4A93G 1H95A 4L5QA 3S17H 1EYGA 4IFDJ 3CCUA 5LMNQ 1Q12A 2CQOA 4OO1G 3PIOA 4C3JH 1KRSA 4A3LG 4R4CA 2MO0A 3EIVA 4YWMA 4QGUA 4IPCA 5C3EH 4A3FH 2HIXA 4R1JA 4A3KH 1X56A 2NVQH 4BBSH 2IX1A 5IYDG 4OX9Q 1N32L 3L0OA 2UUCL 3PUYA 1X9NA 4GS3A 4A3BH 1VQCA 4A3DH 4MTNA 3HOVG 2PI2A 3FKIH 3J80i 2WB1E 3J80c 1B7YB 2YTYA 1G6PA 2KHIA 1WI5A 1VQPA 1E1OA 2UU9Q 3K8AA 2R93H 3S1MH 1IBLL 4GN3B 1CKNB 1D8LA 4A3EG 4B3ML 4GNXB 4OWXB 2WAQG 3CD6A 1NJIC 3TEHB 1Q8KA 4X65L 3J81j 4GOPB 1XNRQ 2AKWB 2DGYA 4LF7L 3PUVA 2V1CC 1VQAA 2VQFQ 4DV4L 3T1YQ 1XMQL 2VL6A 2PQAB 3I2ZA 4X64Q 4KHZA 2EQSA 2E2JH 3ULJA 2LSSA 4ME3A 3I56A 1NMGA 1NY4A 1JJ2A 4QQBX 3S15H 4LF6Q 1NTGA 2WP8J 1XJVA 1VS0A 4DKAC 1CKMA 1R9TH 5LMUL 1K0RA 2NVXH 1AH9A 1YEZA 3BU2A 2R93G 4X62Q 4KHPL 4P72A 4R4QA 4LFBL 3CCLA 4DV3L 4X66L 5IP9H 1VQJA 3AQQA 1WJJA 1SFOH 4JI6Q 3A0JA 1Y1VH 5IY0A 5AJ3L 1Q1BA 5M3FH 4JI3L 1WFQA 4DR2L 1IBKL 2N3SA 1K73C 5GAEC 4DV7L 1VQNA 3HOZH 2CKZB 2N8NA 1FVIA 3HKZE 4GNXC 3TS0A 2GVBA 1ASYA 3PO2H 1RL2A 2Y0SE 2HHHL 1UE5A 4AIMA 4A3JG 3UDIA 4IPHA 3HKSA 1OXTA 2OCEA 4OXPA 4JBJA 3J81i 1C0AA 2K5VA 4JCVE 2ZM6L 4JI8Q 4BBRH 4IFDI 1QZHA 4DR1Q 2Q2UA 1A8VA 1VQ8A 1PH1A 3S24A 3OTOL 4LF5Q 2UXDQ 1RIPA 1T9HA 1V43A 3CCRA 2VW9A 2JA7H 2R92G 2F4VQ 3OTOQ 1E24A 3KFUA 4K0KL 4RG1A 3TS2A 4A3MG 4YY3L 1B8AA 2ZM6Q 2ZJRA 2VQEQ 3U4VA 2Q2IA 3RLOA 1E22A 4HJ9A 1JMCA 2R7ZG 1EIFA 4A3IH 1I6HH 2Q2HA 2OQ0A 2HQLA 3J7ZC 4GNXA 3CAMA 2LXKA 1KD1C 4GOPA 4H02A 2ID0A 4MZ9A 2QEXA 1FL0A 2MO1A 1SROA 4DV7Q 1NMFA 2IHFA 4DR2Q 1PH5A 1G291 4JI3Q 2I5LX 3GD7A 4A3EH 2MFIA 5AJ3Q 1XTDA 3GTJH 2VUMG 4JI6L 1VQKA 4C2MH 4X66Q 3HOWG 1OXXK 3AFQA 1YITA 4LFBQ 1HZ9A 3CMEA 4L5TA 4X62L 3HOYH 1UE1A 4KHPQ 3F8TA 1SN8A 5IYDH 1Z9FA 2RF4A 2BA0A 3NBHB 3E9HA 3M4OH 3RLNA 2IHEA 2IY5B 3JAMi 4DAMA 5M3MG 4C3HH 1KQSA 1K83H 4IJHA 5LMNW 4XTCS 2WFWA 3B6YA 4NB3A 5M3FG 2FXQA 1PH7A 4X64L 3CP0A 4JC0A 4PZ7A 3PIPA 3KF8B 3T1YL 4ALPA 1XMQQ 2VQFL 1HR0W 4GOPC 1A0IA 4A93H 5IT9c 4LF7Q 4O2DA 4XIGS 3HFZB 5GAHC 5HY6A 3GTQH 4X65Q 3GDEA 1Y1WG 2NVYH 1OXSC 3HOXG 3PF4A 4B3MQ 5IP7H 2K5NA 1P16A 3EN2A 4C3IH 1YVCA 2UU9L 2NN6I 5M5YH 3S1RH 2F3IA 2F52A 1CSQA 2WAQE 2R92H 1N32Q 5HGQA 1FGUA 2AHOB 2PQAA 1IYJB 3MEFA 4QIWE 3HOVH 1L1OC 3FP9A 1C7YA 4BA2I 2I5MX 2RHSB 3PCOB 4P73A 4BA1I 1K8GA 1NE3A 5C0XJ 2RHQB 1JB7A 3KLWA 3G48A 5JEAG 4EX5A 1EQRA 2VQEL 5GROA 4DK3C 5LMNL 5GADC 1EQQA 1KRTA 3PSIA 3ULPA 3CPWA 4YY3Q 3A5UA 1E3PA 1LUZA 1VQFA 2JA5G 1N8RC 1QUQB 4DNIA 4DV1L 1VQLA 2F4VL 4K0KQ 1N33L 5C0XG 2UXDL 1DGSA 2JA9A 4LF5L 2AMCB 4GLXA 1GD7A 4IJLA 4DUYL 4DR1L 1PH2A 1S40A 4UY8C 1VQ6A 4JI8L 4LUOA 5IYCH 3W5OA 4YHHQ 1WCMG 3CCVA 2JA5H 2PI2E 4DV0Q 4A3FG 4AYBE 1Q46A 2ATWA 5GAGC 1XNQL 1FJGL 1GVPA 3KDFB 2HHHQ 1E1TA 1PVOA 4GLVB 5IYCG 4JBKA 5E7NA 1X65A 2I0QA 5C4XH 4DUZQ 3M7NA 1MJCA 2I5HA 3BZKA 1IBKQ 4DPGA 1P8LA 2E5LQ 4WJ3M 3I4MG 1TWCH 4UP8A 3E0EA 2ALYB 4UP7A 1KAWA 2L15A 4YCVA 2IX0A 4DR7L 2B63G 4DV3Q 1YBYA 3HOUH 4JYAQ 2JK8A 3S2DH 1N36Q 4GLAC 4IOCA 2KCTA 5IWAQ 4BY1H 1SE8A 3PUXA 4OWTB 4DR4L 1N34Q 4JOIC 4KLKA 1VQIA 2ZTCA 3KJOA 5LMUQ 3I4NH 1L1OA 1X6OA 2KBNA 4P74A 4LF6L 2UUAQ 2D0PA 1IXRA 4A3IG 2ES2A 3PUWA 4HJ5A 1MKHA 2KENA 3GO5A 1PH3A 4JI7L 3Q8DA 5FLXc 3WWVA 1YJ9A 4LF9L 4DV4Q 3DLLA 3GTPH 4BY7G 2EIFA 2R7DA 3PF5A 4R4OA 1PFSA 1Y1WH 1PH6A 1MJEA 3M4PA 1YZ6A 2GVAA 5M3MH 2OTLA 3I4MH 1XNRL 1Z47A 4A3GH 2K5HA 1TWFH 3ER0A 4LFCL 3A5ZB 4PZ8A 3I7FA 3PGZA 4DAYB 4P71A 3A74A 1VQGA 2VY3A 4JG2A 5EAYA 1XMOL 1IBLQ 1PHJA 1GO3E 3CXCA 3STBC 3HKZG 4LF8L 2B29A 4GN5A 3F2DA 4OO1I 4DR5Q 3KF6B 2KHJA 1S72A 4HJAA 1VQOA 3RN2A 3U50C 4A3KG 2UUCQ 4BBSG 1KIXA 1MIUA 1G51A 4DR6Q 3PV0A 1U5KA 2K14A 4OX9L 5C44H 1W3SA 2BH8A 2IT1A 4JI2Q 3CC4A 2JEAI 3GTLH 1WOCA 2K50A 4RMFA 1WCMH 1HH2P 1I5FA 3GTMH 4O0AA 1SLJA 1O7IA 1HNZL 3CW2C 4KI0A 4X6AH 2QA4A 1TXYA 1EFWA 4OONA 4EQ5A 2NZHA 1QVGA 3ERSX 4LUVA 4IPGA 3H3VH 5IYBH 4POFA 4LF4L 3JAMc 4MNOA 2Z6KC 4AYBG 4B3RL 3UE0A 3CF5A 4DV2L 1Q1EA 4TQUS 3T1HL 4R4IA 3U4ZA 4UPAA 3UDGA 3JC66 4JBMA 1KHIA 2HT1A 3F2BA 1HNWL 2H5XA 3M4QA 1WYDA 2PMZE 4NXML 1EOVA 1S3OA 1X54A 4HJ8A 1N9WA 1A63A 5BR8Q 1UWVA 4R4TA 4HIKA 4B3TL 4A3BG 3G71A 4A3DG 4JV5L 2UUBL 1EWIA 4DR3L 1TWHH 2Y0SG 2D0OA 3G4SA 4GN4B 3CC2A 1YHBA 4LW1A 4GKKQ 1IBML 2A19A 1Y14B 4JI4Q 4YCWA 2QGQA 3NENA 1OXUA 4PG3A 1Q86C 3GTGH 3KJPA 3NEMA 4QL5A 1XPOA 2XTIA 4JI1Q 2JEBI 3KOJA 1YNXA 4BXXG 2ZJQA 1IZ6A 4YWKA 1YI2A 2Z6KA 3L2PA 2JA6H 2UXCL 4A3JH 1W2BA 1YIJA 2VUMH 1OTCA 4JI5Q 4Y7NH 3HOWH 1QVFA 1UEBA 1VQDA 4A3LH 4A3GG 3S2HH 1PV4A 3CCQA 1SR3A 2JA6G 3H0GH 3RN5A 4B3SQ 1K3RA 4UP9A 1L2FA 3K7AH 1VQ9A 1X3GA 3CQZH 3CCEA 2UXBL 1JJGA 2E2IH 1QZGA 1YHAA 2ZTEA 1VQEA 5H1SE 1KXLA 1PH8A 3UE1A 4GKJQ 2WB1G 2R6GA 1U0LA 3TQYA 3CC7A 4A76A 2CWPA 3STBD 1VQHA 1YHQA 1PH4A 4BY7H 5FJ8G 2UXBQ 2VNUD 5JJIA 3GTOH 3S14H 4NXNQ 2OTJA 2DUDA 5C4JH 1CKOA 1JE5A 3M85A 1HR0L 4DV5Q 4HIMA 2ASBA 3W1BA 2CFMA 2B3GA 3CCJA 4LFAQ 1I94L 2D62A 3OW2A 2VS1A 4JI5L 3H0GG 5C3EG 3RLFA 2E8GA 1X55A 4BY1G 2HIVA 2UXCQ 3GTKH 1JJCB 1TWAH 4P75A 4LNQA 2N49A 3TREA 4JI1L 5K36G 1SRUA 1I50H 1UE6A 5C4XG 3F1ZA 2JJQA 3H3VI 3KYHC 1VQBA 2LXJA 1PYBA 4IO9A 2BA1A 5FLMH 1Q81C 4JI4L 1QVCA 1IBMQ 1OXVA 2E2HH 1HNXQ 3AEVA 1Y1VG 1J5EQ 3S1NH 4DV6L 1ASZA 1JT8A 4DR3Q 5ELNA 4AQYQ 3RNUA 2UUBQ 5JJKA 4B3TQ 3S16H 2YYZA 5C44G 4JI0L 1EIYB 1HZAA 4A4IA 2BH2A 1VQ5A 4JI0Q 4LWCA 2OWOA 4NXMQ 1XPRA 3CCSA 3UDFA 4WJ4A 3TRZA 4DV6Q 2AWOA 3D31A 2VZAA 4QY7A 1X3FA 1J5EL 4A3CH 1K9MC 1HNXL 1EUJA 1BBWA 1UE7A 2MNAA 4DV2Q 2Q2TA 1NBWA 2JA8G 3K7UC 3ZJYC 2R7ZH 2JQOA 3SGIA 1X3EA 1CKNA 2YTVA 1CSPA 3IRBA 1AE2A 2JA7G 1VCIA 2Z0SA 1VQ4A 1BBUA 1BKBA 1CUKA 3UDXA 4A3MH 1YJWA 3M9BA 1XPUA 1I3QH 1HJPA 4A75A 5IP7G 1HNZQ 1KC8C 3NELA 3FKIG 2NZOA 3BZCA 2OQKA 4HJ7A 4POGA 1I94Q 4LFAL 2B63H 3HOUG 1PH9A 1GKHA 1L0WA 4L5RC 4IFDG 4BBRG 4JI2L 4NPSA 3OYYA 3LGJA 1HZCA 4DV5L 4OWWB 4LUZA 3CCMA 1LTLA 3K81C 3FHWA 2RCNA 5IYBG 3U58A 1HR0Q 4HIDA 4DR6L 4NXNL 3J81c 3PO2G 3K80C 4FDBA 3I55A 3G6EA 1VQ7A 1A62A 3AFPA 4DR5L 2ZTDA 1LM0A 4LF8Q 5J3BA 4GKJL 2YTXA 2NVTH 3H15A 3PO3G 5DLQE 1XMOQ 4J15A 3RZDH 3F2CA 2JE6I 3KDFA 4AQYL 5ELOA 4JOIA 2K4KA 4LFCQ 1B70B 5C0XI 1PA6A 3MXNB 1HZBA 3J7A5 3PO3H 4BXXH 3PUZA 3KF6A 4PZ6A 4YCUA 1GM5A 4B3SL 3CPFA 2AWNA 4LF9Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YU9 H;  4Y52 H;  2NN6 G;  4JI7 Q;  1AE3 A;  1V9P A;  5IP9 G;  2UUA L;  1D7Q A;  3AYH B;  3RZO H;  4QJF A;  3RR5 A;  2PNH A;  5FLM G;  1KL9 A;  1PYS B;  1N34 L;  3HOY G;  4DR4 Q;  1TWG H;  1L1O B;  2N78 A;  1BVS A;  2GN5 A;  2CWA A;  3D0F A;  5IWA L;  3VDY A;  4JBW A;  3ULL A;  1N36 L;  1Q7Y C;  1M90 C;  1E7Z A;  4PMW A;  5JEA J;  1K8A C;  4DR7 Q;  4JYA L;  5JJL A;  4GKK L;  2CCZ A;  3E9I A;  5FJ8 H;  3L7Z C;  2E5L L;  2XGT A;  3M3Y H;  4IOA A;  4TVA B;  2C35 B;  4DUZ L;  2MQH A;  2ZJP A;  5M5X H;  1IL2 A;  4JV5 Q;  4A3C G;  5BR8 L;  2YV5 A;  4AH6 A;  2K75 A;  1FJG Q;  1XNQ Q;  5IE8 A;  1SMX A;  3EBE A;  1C9O A;  1YJN A;  3I4N G;  1V1Q A;  3CMA A;  4DV0 L;  3BJU A;  3W1G A;  1J6Q A;  2R7F A;  3HOX H;  1VQM A;  3K0X A;  1HNW Q;  4YHH L;  2JA8 H;  2A8V A;  3DM3 A;  3T1H Q;  3I4O A;  4HIO A;  1QUQ A;  1Q82 C;  4B3R Q;  3S1Q H;  4YWL A;  4IPD A;  5GQO A;  5M5W H;  4DUY Q;  2K52 A;  4L5S A;  3ICE A;  2EXD A;  4LF4 Q;  3HOZ G;  4APV A;  1N33 Q;  1LYL A;  2A1A A;  4DV1 Q;  4DK6 C;  2KCM A;  1M1K C;  4A93 G;  1H95 A;  4L5Q A;  3S17 H;  1EYG A;  4IFD J;  3CCU A;  5LMN Q;  1Q12 A;  2CQO A;  4OO1 G;  3PIO A;  4C3J H;  1KRS A;  4A3L G;  4R4C A;  2MO0 A;  3EIV A;  4YWM A;  4QGU A;  4IPC A;  5C3E H;  4A3F H;  2HIX A;  4R1J A;  4A3K H;  1X56 A;  2NVQ H;  4BBS H;  2IX1 A;  5IYD G;  4OX9 Q;  1N32 L;  3L0O A;  2UUC L;  3PUY A;  1X9N A;  4GS3 A;  4A3B H;  1VQC A;  4A3D H;  4MTN A;  3HOV G;  2PI2 A;  3FKI H;  3J80 i;  2WB1 E;  3J80 c;  1B7Y B;  2YTY A;  1G6P A;  2KHI A;  1WI5 A;  1VQP A;  1E1O A;  2UU9 Q;  3K8A A;  2R93 H;  3S1M H;  1IBL L;  4GN3 B;  1CKN B;  1D8L A;  4A3E G;  4B3M L;  4GNX B;  4OWX B;  2WAQ G;  3CD6 A;  1NJI C;  3TEH B;  1Q8K A;  4X65 L;  3J81 j;  4GOP B;  1XNR Q;  2AKW B;  2DGY A;  4LF7 L;  3PUV A;  2V1C C;  1VQA A;  2VQF Q;  4DV4 L;  3T1Y Q;  1XMQ L;  2VL6 A;  2PQA B;  3I2Z A;  4X64 Q;  4KHZ A;  2EQS A;  2E2J H;  3ULJ A;  2LSS A;  4ME3 A;  3I56 A;  1NMG A;  1NY4 A;  1JJ2 A;  4QQB X;  3S15 H;  4LF6 Q;  1NTG A;  2WP8 J;  1XJV A;  1VS0 A;  4DKA C;  1CKM A;  1R9T H;  5LMU L;  1K0R A;  2NVX H;  1AH9 A;  1YEZ A;  3BU2 A;  2R93 G;  4X62 Q;  4KHP L;  4P72 A;  4R4Q A;  4LFB L;  3CCL A;  4DV3 L;  4X66 L;  5IP9 H;  1VQJ A;  3AQQ A;  1WJJ A;  1SFO H;  4JI6 Q;  3A0J A;  1Y1V H;  5IY0 A;  5AJ3 L;  1Q1B A;  5M3F H;  4JI3 L;  1WFQ A;  4DR2 L;  1IBK L;  2N3S A;  1K73 C;  5GAE C;  4DV7 L;  1VQN A;  3HOZ H;  2CKZ B;  2N8N A;  1FVI A;  3HKZ E;  4GNX C;  3TS0 A;  2GVB A;  1ASY A;  3PO2 H;  1RL2 A;  2Y0S E;  2HHH L;  1UE5 A;  4AIM A;  4A3J G;  3UDI A;  4IPH A;  3HKS A;  1OXT A;  2OCE A;  4OXP A;  4JBJ A;  3J81 i;  1C0A A;  2K5V A;  4JCV E;  2ZM6 L;  4JI8 Q;  4BBR H;  4IFD I;  1QZH A;  4DR1 Q;  2Q2U A;  1A8V A;  1VQ8 A;  1PH1 A;  3S24 A;  3OTO L;  4LF5 Q;  2UXD Q;  1RIP A;  1T9H A;  1V43 A;  3CCR A;  2VW9 A;  2JA7 H;  2R92 G;  2F4V Q;  3OTO Q;  1E24 A;  3KFU A;  4K0K L;  4RG1 A;  3TS2 A;  4A3M G;  4YY3 L;  1B8A A;  2ZM6 Q;  2ZJR A;  2VQE Q;  3U4V A;  2Q2I A;  3RLO A;  1E22 A;  4HJ9 A;  1JMC A;  2R7Z G;  1EIF A;  4A3I H;  1I6H H;  2Q2H A;  2OQ0 A;  2HQL A;  3J7Z C;  4GNX A;  3CAM A;  2LXK A;  1KD1 C;  4GOP A;  4H02 A;  2ID0 A;  4MZ9 A;  2QEX A;  1FL0 A;  2MO1 A;  1SRO A;  4DV7 Q;  1NMF A;  2IHF A;  4DR2 Q;  1PH5 A;  1G29 1;  4JI3 Q;  2I5L X;  3GD7 A;  4A3E H;  2MFI A;  5AJ3 Q;  1XTD A;  3GTJ H;  2VUM G;  4JI6 L;  1VQK A;  4C2M H;  4X66 Q;  3HOW G;  1OXX K;  3AFQ A;  1YIT A;  4LFB Q;  1HZ9 A;  3CME A;  4L5T A;  4X62 L;  3HOY H;  1UE1 A;  4KHP Q;  3F8T A;  1SN8 A;  5IYD H;  1Z9F A;  2RF4 A;  2BA0 A;  3NBH B;  3E9H A;  3M4O H;  3RLN A;  2IHE A;  2IY5 B;  3JAM i;  4DAM A;  5M3M G;  4C3H H;  1KQS A;  1K83 H;  4IJH A;  5LMN W;  4XTC S;  2WFW A;  3B6Y A;  4NB3 A;  5M3F G;  2FXQ A;  1PH7 A;  4X64 L;  3CP0 A;  4JC0 A;  4PZ7 A;  3PIP A;  3KF8 B;  3T1Y L;  4ALP A;  1XMQ Q;  2VQF L;  1HR0 W;  4GOP C;  1A0I A;  4A93 H;  5IT9 c;  4LF7 Q;  4O2D A;  4XIG S;  3HFZ B;  5GAH C;  5HY6 A;  3GTQ H;  4X65 Q;  3GDE A;  1Y1W G;  2NVY H;  1OXS C;  3HOX G;  3PF4 A;  4B3M Q;  5IP7 H;  2K5N A;  1P16 A;  3EN2 A;  4C3I H;  1YVC A;  2UU9 L;  2NN6 I;  5M5Y H;  3S1R H;  2F3I A;  2F52 A;  1CSQ A;  2WAQ E;  2R92 H;  1N32 Q;  5HGQ A;  1FGU A;  2AHO B;  2PQA A;  1IYJ B;  3MEF A;  4QIW E;  3HOV H;  1L1O C;  3FP9 A;  1C7Y A;  4BA2 I;  2I5M X;  2RHS B;  3PCO B;  4P73 A;  4BA1 I;  1K8G A;  1NE3 A;  5C0X J;  2RHQ B;  1JB7 A;  3KLW A;  3G48 A;  5JEA G;  4EX5 A;  1EQR A;  2VQE L;  5GRO A;  4DK3 C;  5LMN L;  5GAD C;  1EQQ A;  1KRT A;  3PSI A;  3ULP A;  3CPW A;  4YY3 Q;  3A5U A;  1E3P A;  1LUZ A;  1VQF A;  2JA5 G;  1N8R C;  1QUQ B;  4DNI A;  4DV1 L;  1VQL A;  2F4V L;  4K0K Q;  1N33 L;  5C0X G;  2UXD L;  1DGS A;  2JA9 A;  4LF5 L;  2AMC B;  4GLX A;  1GD7 A;  4IJL A;  4DUY L;  4DR1 L;  1PH2 A;  1S40 A;  4UY8 C;  1VQ6 A;  4JI8 L;  4LUO A;  5IYC H;  3W5O A;  4YHH Q;  1WCM G;  3CCV A;  2JA5 H;  2PI2 E;  4DV0 Q;  4A3F G;  4AYB E;  1Q46 A;  2ATW A;  5GAG C;  1XNQ L;  1FJG L;  1GVP A;  3KDF B;  2HHH Q;  1E1T A;  1PVO A;  4GLV B;  5IYC G;  4JBK A;  5E7N A;  1X65 A;  2I0Q A;  5C4X H;  4DUZ Q;  3M7N A;  1MJC A;  2I5H A;  3BZK A;  1IBK Q;  4DPG A;  1P8L A;  2E5L Q;  4WJ3 M;  3I4M G;  1TWC H;  4UP8 A;  3E0E A;  2ALY B;  4UP7 A;  1KAW A;  2L15 A;  4YCV A;  2IX0 A;  4DR7 L;  2B63 G;  4DV3 Q;  1YBY A;  3HOU H;  4JYA Q;  2JK8 A;  3S2D H;  1N36 Q;  4GLA C;  4IOC A;  2KCT A;  5IWA Q;  4BY1 H;  1SE8 A;  3PUX A;  4OWT B;  4DR4 L;  1N34 Q;  4JOI C;  4KLK A;  1VQI A;  2ZTC A;  3KJO A;  5LMU Q;  3I4N H;  1L1O A;  1X6O A;  2KBN A;  4P74 A;  4LF6 L;  2UUA Q;  2D0P A;  1IXR A;  4A3I G;  2ES2 A;  3PUW A;  4HJ5 A;  1MKH A;  2KEN A;  3GO5 A;  1PH3 A;  4JI7 L;  3Q8D A;  5FLX c;  3WWV A;  1YJ9 A;  4LF9 L;  4DV4 Q;  3DLL A;  3GTP H;  4BY7 G;  2EIF A;  2R7D A;  3PF5 A;  4R4O A;  1PFS A;  1Y1W H;  1PH6 A;  1MJE A;  3M4P A;  1YZ6 A;  2GVA A;  5M3M H;  2OTL A;  3I4M H;  1XNR L;  1Z47 A;  4A3G H;  2K5H A;  1TWF H;  3ER0 A;  4LFC L;  3A5Z B;  4PZ8 A;  3I7F A;  3PGZ A;  4DAY B;  4P71 A;  3A74 A;  1VQG A;  2VY3 A;  4JG2 A;  5EAY A;  1XMO L;  1IBL Q;  1PHJ A;  1GO3 E;  3CXC A;  3STB C;  3HKZ G;  4LF8 L;  2B29 A;  4GN5 A;  3F2D A;  4OO1 I;  4DR5 Q;  3KF6 B;  2KHJ A;  1S72 A;  4HJA A;  1VQO A;  3RN2 A;  3U50 C;  4A3K G;  2UUC Q;  4BBS G;  1KIX A;  1MIU A;  1G51 A;  4DR6 Q;  3PV0 A;  1U5K A;  2K14 A;  4OX9 L;  5C44 H;  1W3S A;  2BH8 A;  2IT1 A;  4JI2 Q;  3CC4 A;  2JEA I;  3GTL H;  1WOC A;  2K50 A;  4RMF A;  1WCM H;  1HH2 P;  1I5F A;  3GTM H;  4O0A A;  1SLJ A;  1O7I A;  1HNZ L;  3CW2 C;  4KI0 A;  4X6A H;  2QA4 A;  1TXY A;  1EFW A;  4OON A;  4EQ5 A;  2NZH A;  1QVG A;  3ERS X;  4LUV A;  4IPG A;  3H3V H;  5IYB H;  4POF A;  4LF4 L;  3JAM c;  4MNO A;  2Z6K C;  4AYB G;  4B3R L;  3UE0 A;  3CF5 A;  4DV2 L;  1Q1E A;  4TQU S;  3T1H L;  4R4I A;  3U4Z A;  4UPA A;  3UDG A;  3JC6 6;  4JBM A;  1KHI A;  2HT1 A;  3F2B A;  1HNW L;  2H5X A;  3M4Q A;  1WYD A;  2PMZ E;  4NXM L;  1EOV A;  1S3O A;  1X54 A;  4HJ8 A;  1N9W A;  1A63 A;  5BR8 Q;  1UWV A;  4R4T A;  4HIK A;  4B3T L;  4A3B G;  3G71 A;  4A3D G;  4JV5 L;  2UUB L;  1EWI A;  4DR3 L;  1TWH H;  2Y0S G;  2D0O A;  3G4S A;  4GN4 B;  3CC2 A;  1YHB A;  4LW1 A;  4GKK Q;  1IBM L;  2A19 A;  1Y14 B;  4JI4 Q;  4YCW A;  2QGQ A;  3NEN A;  1OXU A;  4PG3 A;  1Q86 C;  3GTG H;  3KJP A;  3NEM A;  4QL5 A;  1XPO A;  2XTI A;  4JI1 Q;  2JEB I;  3KOJ A;  1YNX A;  4BXX G;  2ZJQ A;  1IZ6 A;  4YWK A;  1YI2 A;  2Z6K A;  3L2P A;  2JA6 H;  2UXC L;  4A3J H;  1W2B A;  1YIJ A;  2VUM H;  1OTC A;  4JI5 Q;  4Y7N H;  3HOW H;  1QVF A;  1UEB A;  1VQD A;  4A3L H;  4A3G G;  3S2H H;  1PV4 A;  3CCQ A;  1SR3 A;  2JA6 G;  3H0G H;  3RN5 A;  4B3S Q;  1K3R A;  4UP9 A;  1L2F A;  3K7A H;  1VQ9 A;  1X3G A;  3CQZ H;  3CCE A;  2UXB L;  1JJG A;  2E2I H;  1QZG A;  1YHA A;  2ZTE A;  1VQE A;  5H1S E;  1KXL A;  1PH8 A;  3UE1 A;  4GKJ Q;  2WB1 G;  2R6G A;  1U0L A;  3TQY A;  3CC7 A;  4A76 A;  2CWP A;  3STB D;  1VQH A;  1YHQ A;  1PH4 A;  4BY7 H;  5FJ8 G;  2UXB Q;  2VNU D;  5JJI A;  3GTO H;  3S14 H;  4NXN Q;  2OTJ A;  2DUD A;  5C4J H;  1CKO A;  1JE5 A;  3M85 A;  1HR0 L;  4DV5 Q;  4HIM A;  2ASB A;  3W1B A;  2CFM A;  2B3G A;  3CCJ A;  4LFA Q;  1I94 L;  2D62 A;  3OW2 A;  2VS1 A;  4JI5 L;  3H0G G;  5C3E G;  3RLF A;  2E8G A;  1X55 A;  4BY1 G;  2HIV A;  2UXC Q;  3GTK H;  1JJC B;  1TWA H;  4P75 A;  4LNQ A;  2N49 A;  3TRE A;  4JI1 L;  5K36 G;  1SRU A;  1I50 H;  1UE6 A;  5C4X G;  3F1Z A;  2JJQ A;  3H3V I;  3KYH C;  1VQB A;  2LXJ A;  1PYB A;  4IO9 A;  2BA1 A;  5FLM H;  1Q81 C;  4JI4 L;  1QVC A;  1IBM Q;  1OXV A;  2E2H H;  1HNX Q;  3AEV A;  1Y1V G;  1J5E Q;  3S1N H;  4DV6 L;  1ASZ A;  1JT8 A;  4DR3 Q;  5ELN A;  4AQY Q;  3RNU A;  2UUB Q;  5JJK A;  4B3T Q;  3S16 H;  2YYZ A;  5C44 G;  4JI0 L;  1EIY B;  1HZA A;  4A4I A;  2BH2 A;  1VQ5 A;  4JI0 Q;  4LWC A;  2OWO A;  4NXM Q;  1XPR A;  3CCS A;  3UDF A;  4WJ4 A;  3TRZ A;  4DV6 Q;  2AWO A;  3D31 A;  2VZA A;  4QY7 A;  1X3F A;  1J5E L;  4A3C H;  1K9M C;  1HNX L;  1EUJ A;  1BBW A;  1UE7 A;  2MNA A;  4DV2 Q;  2Q2T A;  1NBW A;  2JA8 G;  3K7U C;  3ZJY C;  2R7Z H;  2JQO A;  3SGI A;  1X3E A;  1CKN A;  2YTV A;  1CSP A;  3IRB A;  1AE2 A;  2JA7 G;  1VCI A;  2Z0S A;  1VQ4 A;  1BBU A;  1BKB A;  1CUK A;  3UDX A;  4A3M H;  1YJW A;  3M9B A;  1XPU A;  1I3Q H;  1HJP A;  4A75 A;  5IP7 G;  1HNZ Q;  1KC8 C;  3NEL A;  3FKI G;  2NZO A;  3BZC A;  2OQK A;  4HJ7 A;  4POG A;  1I94 Q;  4LFA L;  2B63 H;  3HOU G;  1PH9 A;  1GKH A;  1L0W A;  4L5R C;  4IFD G;  4BBR G;  4JI2 L;  4NPS A;  3OYY A;  3LGJ A;  1HZC A;  4DV5 L;  4OWW B;  4LUZ A;  3CCM A;  1LTL A;  3K81 C;  3FHW A;  2RCN A;  5IYB G;  3U58 A;  1HR0 Q;  4HID A;  4DR6 L;  4NXN L;  3J81 c;  3PO2 G;  3K80 C;  4FDB A;  3I55 A;  3G6E A;  1VQ7 A;  1A62 A;  3AFP A;  4DR5 L;  2ZTD A;  1LM0 A;  4LF8 Q;  5J3B A;  4GKJ L;  2YTX A;  2NVT H;  3H15 A;  3PO3 G;  5DLQ E;  1XMO Q;  4J15 A;  3RZD H;  3F2C A;  2JE6 I;  3KDF A;  4AQY L;  5ELO A;  4JOI A;  2K4K A;  4LFC Q;  1B70 B;  5C0X I;  1PA6 A;  3MXN B;  1HZB A;  3J7A 5;  3PO3 H;  4BXX H;  3PUZ A;  3KF6 A;  4PZ6 A;  4YCU A;  1GM5 A;  4B3S L;  3CPF A;  2AWN A;  4LF9 Q; 
#chains in the Genus database with same CATH topology
 3KLR A;  3I90 A;  1V9P A;  1PLF A;  5IP9 G;  4NW2 A;  3AYH B;  1VDZ A;  5C44 B;  1U4L A;  1DJR D;  1PYS B;  1TWG H;  4IAL A;  1CQV A;  3D0F A;  2E74 C;  4K8J A;  1MI2 A;  2I46 A;  1CA6 A;  1E7Z A;  1F77 A;  1EY6 A;  2IWH A;  2IPK D;  2RQX A;  3Q23 A;  2CCZ A;  3NXW A;  1FGB D;  2XGT A;  3CRL C;  3K6O A;  1QE6 A;  1EQV A;  5M5X H;  4JV5 Q;  1B9N A;  1BCP D;  3EBE A;  1C9O A;  3I4N G;  3W1G A;  1HNW Q;  2KCN A;  2NTT A;  1SE3 A;  4YHH L;  2JA8 H;  3VA5 A;  3DM3 A;  3T1H Q;  4ZLT F;  3NPP A;  1QUQ A;  4B3R Q;  5K5P A;  2D9U A;  2K52 A;  2EXD A;  3CRK C;  3HOZ G;  1LYL A;  5TSS A;  1JWU D;  3S17 H;  1XWE A;  2A73 B;  1EYG A;  3H94 A;  5LMN Q;  3M7G A;  1LT4 D;  3QO2 A;  3PIO A;  4G4K A;  2MO0 A;  5C3W A;  3D4W A;  5CBA E;  4A3K H;  5M5X B;  3VYT A;  5ELF A;  4BBS H;  3S2H B;  5IYD G;  4KKS A;  1N32 L;  1IW7 D;  2NYZ D;  4GS3 A;  3HOV G;  2QKI C;  2B2T C;  2YTY A;  1G6P A;  1DD2 A;  2KHI A;  2R93 H;  4GN3 B;  4OHJ A;  5L37 A;  2PPB C;  3SDZ A;  4X65 L;  1IHZ A;  2XNA C;  5NUC A;  2R93 B;  5G3L F;  2HQE A;  3GTQ B;  3DUZ A;  3ND9 A;  1AN8 A;  1PTO C;  2QW7 A;  2PO4 A;  4DV4 L;  3T1Y Q;  2PMZ B;  1XMQ L;  1ILQ A;  1NCV A;  3ZYY X;  4JW0 A;  4DF7 A;  4Y7N B;  2Z4I A;  1DOM A;  2F0J A;  4DKA C;  3PO3 B;  4L6T B;  2J7Z A;  4O42 A;  4X62 Q;  3BVG A;  2K05 A;  2O2L D;  5IP9 H;  4DV3 L;  1VQJ A;  4F8M A;  1Y1V H;  3GV6 A;  1K73 C;  4TKO B;  4DV7 L;  1SJH D;  1PMR A;  3HOZ H;  2N8N A;  1HTP A;  2N88 A;  4K8I A;  5FK9 C;  2HHH L;  2RVL A;  2RCF A;  4IPH A;  4OXP A;  1EYA A;  2IJ0 A;  4JCV E;  2EJF C;  2RDF A;  2HDM A;  1A8V A;  3QJY A;  2WKD A;  3S24 A;  5T1I A;  2QF7 A;  4QB4 A;  1EEF D;  2VW9 A;  1GJX A;  3OTO Q;  1E24 A;  3DXJ C;  3S2D B;  4A3M G;  1BCP B;  4YY3 L;  1B8A A;  3GQB A;  1F2M A;  1E22 A;  4HJ9 A;  3EA6 A;  5KGU A;  4A3I H;  4FP5 D;  4I65 A;  1K83 B;  1I4G A;  4H02 A;  2QDB A;  2EYP A;  2MO1 A;  4A3I B;  2IHF A;  1A3V A;  1PH5 A;  1ILP A;  2NB0 A;  1XTD A;  3HZX A;  4C2M H;  4C2M B;  1KTK A;  2OEO A;  1YIT A;  3CME A;  5J22 A;  1HCZ A;  3EVQ A;  1UE1 A;  1VMP A;  2CH4 A;  2K5D A;  3F8T A;  3DWQ A;  3NTK A;  4DAM A;  2BE5 D;  1K83 H;  4IJH A;  4XTC S;  3J80 E;  4NB3 A;  2FXQ A;  1PYW D;  5C4H A;  4G57 A;  4X64 L;  2X69 A;  1BO0 A;  4PZ7 A;  2QIL A;  2VQF L;  5DAU A;  1HR0 W;  1YNN D;  1A0I A;  3TDQ A;  1STN A;  4O2D A;  5GAH C;  4JK1 C;  2NVY H;  2EDG A;  3HOX G;  5M3M B;  2F0K A;  3E5S A;  4CDF C;  3GTG B;  5M5Y H;  1CSQ A;  3QIA A;  3K5O A;  4ULL A;  2PQA A;  3HOV H;  2RHS B;  2MJ8 A;  1SYE A;  4GZY C;  1K8G A;  3C3L A;  5JJZ A;  3V96 A;  4EX5 A;  1IL8 A;  5GRO A;  4DK3 C;  5IGF A;  1EQQ A;  1KRT A;  3ULP A;  1E3P A;  4RGM A;  4C56 C;  1ENA A;  1ML0 D;  2UXD L;  2JA9 A;  3D4R A;  4ZKC B;  1QNK A;  4DUY L;  4DR1 L;  1PH2 A;  1EU4 A;  4UY8 C;  1VQ6 A;  4ZUI A;  4JI8 L;  3KUP A;  1SYG A;  1XTC D;  1FYC A;  2LMC B;  4AYB E;  1EY8 A;  5GAG C;  4FF3 A;  1FJG L;  5ELC A;  3KDF B;  1JOQ A;  5E7N A;  1X65 A;  5C4X H;  2E5L Q;  4WJ3 M;  1D6E C;  1TWC H;  2F0E A;  3ERO A;  1FNV A;  2VNU D;  4YCV A;  5EPL A;  4JYA Q;  3HOU H;  1SNC A;  2XSC A;  5BN4 A;  1DXM A;  4IN3 A;  2KCT A;  5G3L D;  3K5M A;  1SE8 A;  2K04 A;  3ERQ A;  1N34 Q;  2ZTC A;  1X6O A;  4RCN A;  4DAV A;  4LF6 L;  2D0P A;  3PQI A;  4A3I G;  3PUW A;  2K7V A;  3GO5 A;  3NTI A;  1UNS A;  1G8Z D;  1QJO A;  1O7L A;  3HRZ C;  3DLL A;  3HOW B;  4BY7 G;  4R4O A;  5C5L A;  3S1R B;  1HA6 A;  5KNC A;  2HUG A;  1Z47 A;  4IUQ A;  4LFC L;  4PZ8 A;  4AQY Q;  1B1Z A;  3A74 A;  1XXG A;  2C9O A;  4JG2 A;  3FKI B;  3HOU B;  3KF6 B;  3N52 A;  1S72 A;  3R8B A;  3RN2 A;  2UUC Q;  1KIX A;  1G51 A;  3DEP A;  2EYH A;  3BDO A;  4DR6 Q;  1GOZ A;  2K32 A;  4QUF A;  3I8Z A;  1HH2 P;  1I5F A;  1STE A;  5ISR A;  1O7I A;  5A2Q L;  3BZD B;  2EY6 A;  3QWN A;  2JYO A;  1Y8O B;  2A68 C;  1NSN S;  4IPG A;  3H3V H;  3IL8 A;  3E6Z X;  3I4M B;  2NVT B;  4AYB G;  3GTK B;  5E1F A;  1PRT C;  1K3B C;  4TQU S;  1WTQ A;  1IKM A;  3TZU A;  3JC6 6;  4CGY B;  3M4Q A;  1WYD A;  2PMZ E;  3IAY A;  1EOV A;  1S3O A;  5EPK A;  1W6K A;  4FO2 A;  5BR8 Q;  4HIK A;  4B3T L;  1GUN A;  2RDH A;  2NN6 H;  2A74 C;  5M3F B;  2D0O A;  3G4S A;  3CC2 A;  2V4D A;  2EYJ A;  4GKK Q;  1Y14 B;  3SR1 A;  3BS1 A;  4YCW A;  4JI4 Q;  3KJP A;  4QL5 A;  1TS4 A;  1XPO A;  1YNX A;  2AUK A;  3P75 A;  1IZ6 A;  1ZYR C;  2B2U A;  2VUM H;  1A15 A;  1VQD A;  2L1B A;  3NBI A;  2NVQ B;  4MN3 A;  5EBC A;  2DJG C;  1BF4 A;  1K3R A;  4UP9 A;  3K7A H;  1CTM A;  4ZUJ A;  2ZTE A;  1V1P B;  1VQE A;  3UE1 A;  3CC7 A;  2L12 A;  3TQY A;  2CWP A;  1Y8N B;  4A3G B;  1ENF A;  2DUD A;  2A69 D;  4EGV A;  2A69 C;  2ASB A;  1LT6 D;  2B3G A;  3HOV B;  3H91 A;  2XRQ D;  3OW2 A;  2IL8 A;  4P75 A;  3TRE A;  1F9P A;  2WAC A;  1I50 H;  3NWT A;  1NR2 A;  3F1Z A;  2C5C A;  2JJQ A;  3MTS A;  2DNE A;  2KCC A;  2JA8 B;  1GUT A;  5JVG 3;  1JT8 A;  1EFI D;  5ELN A;  3S16 H;  3J80 L;  5C44 G;  4JI0 L;  1VF5 C;  2B8F A;  4XT3 B;  1VQ5 A;  4JI0 Q;  4LWC A;  4NXM Q;  4WJ4 A;  1LO5 D;  5IGD A;  1O78 A;  2VZA A;  1X3F A;  3P1H A;  1K9M C;  1TS5 A;  4XYQ A;  3ZJY C;  3SGI A;  1LTI D;  3JAM E;  4IZ8 A;  4ZKB B;  3K7A B;  1VQ4 A;  1BBU A;  2KUM A;  2XIW A;  1YJW A;  1XPU A;  1SBB B;  1HJP A;  2SEB D;  4XQJ A;  3NEL A;  4POG A;  4HMI A;  4BBR G;  4JI2 L;  4NPS A;  1MD2 D;  3OSO A;  1HHV A;  3K81 C;  2RCN A;  4QCL A;  4HID A;  3J81 c;  1RD9 D;  4FDB A;  5T1G A;  2D5D A;  3V2T A;  1LTA D;  3OMC A;  4F7X A;  2PZT A;  4DR5 L;  3A55 A;  3WOF A;  1SJE D;  5J3B A;  4OIK A;  3H15 A;  3N6R A;  4J15 A;  1DYQ A;  3F2C A;  3T16 A;  2NVX B;  1CM9 A;  3SK6 A;  1WTW A;  3PUZ A;  1JR0 D;  3KF6 A;  1LTB D;  4ILW A;  3I4L A;  3MXP A;  1JIC A;  4AYB B;  3HEJ A;  2YU9 H;  3R2T A;  2NN6 G;  3PO2 B;  4JI7 Q;  2ZXO A;  4DXG A;  5IGB A;  1D7Q A;  3RZO H;  3RR5 A;  4KHV A;  3OWF A;  2QDL A;  4DR4 Q;  2B2W A;  1AFP A;  1L1O B;  3I4N B;  2GN5 A;  2FIN B;  4U67 3;  4JBW A;  3ULL A;  5F2D A;  1N36 L;  1GUW A;  1Q7Y C;  1M90 C;  2F0W A;  4ODG A;  4R8I A;  4PMW A;  4GKK L;  3E9I A;  4IOA A;  5EJW A;  1RF2 D;  4XT1 B;  2MQH A;  2ZJP A;  1QG7 A;  1IL2 A;  4A3C G;  4BS9 A;  5BR8 L;  2E75 C;  1XNQ Q;  5IE8 A;  1SMX A;  1SEB D;  1YJN A;  1TVX A;  4DV0 L;  4K6D A;  1J6Q A;  5LL6 S;  4YWL A;  4L5S A;  4XQN A;  2F0L A;  1E0B A;  4RKB A;  5ELB A;  2A1A A;  3HS0 C;  1M1K C;  1PRT D;  1Q12 A;  1SE4 A;  2CQO A;  3LNN A;  4A3L G;  4QGU A;  4A3F H;  2HIX A;  5E4W C;  5LL6 X;  2IX1 A;  1K0S A;  2H1E A;  5DEH A;  2AUJ D;  3OIP A;  5C0X H;  3L0O A;  1E2V A;  3PUY A;  5KYL A;  2UUC L;  4MTN A;  3HOZ B;  4CKB A;  3A8I E;  2WB1 E;  3I70 A;  4A3M B;  5CBE E;  1F2Z A;  5EBD A;  1I4R A;  4B3M L;  4H44 C;  2P5Z X;  2WAQ G;  4LJZ C;  5EGT A;  1ENC A;  5IT9 E;  4CJ2 C;  2DGY A;  3ONA B;  4ME5 A;  4LF7 L;  2G9D A;  1F9R A;  3PUV A;  5CV7 A;  2V1C C;  1VF7 A;  5M9O A;  2VL6 A;  4FXD A;  3I2Z A;  3TP7 A;  4M1U B;  3ULJ A;  2ENB A;  1NY4 A;  1JJ2 A;  2KJX A;  4LF6 Q;  1XJV A;  1H9S A;  4C3H B;  1AH9 A;  3K0Y A;  2F3V A;  1CZG A;  3BU2 A;  3TZD A;  3V05 A;  3EFX D;  4P72 A;  4R4Q A;  2BOS A;  3A0J A;  5IY0 A;  5AJ3 L;  1Q1B A;  3KF8 A;  4JI3 L;  4QUC A;  1WFQ A;  4DR2 L;  2N3S A;  1TR5 A;  5GAE C;  1VQN A;  1KDB A;  1FVI A;  2OT2 A;  1ASY A;  1RL2 A;  4AIM A;  1SMY C;  3UDI A;  3HKS A;  1OXT A;  2OCE A;  2GA4 B;  1QWY A;  3S16 B;  1PFN A;  2XRS D;  1F2L A;  4JI8 Q;  4DR1 Q;  1TS2 A;  2Q2U A;  4X3S A;  2UXD Q;  1RIP A;  3CCR A;  2R92 G;  1H9M A;  3BYT B;  2ZM6 Q;  1Z7T A;  3U4V A;  2M2L A;  3RLO A;  1JMC A;  1I6H H;  2Q2H A;  2OQ0 A;  3J7Z C;  3DEO A;  2LXK A;  2ID0 A;  4MZ9 A;  2QEX A;  1FL0 A;  3QG1 A;  1SYD A;  1KNE A;  1G29 1;  3NQI A;  3SHL A;  2MFI A;  4JI6 L;  1VQK A;  4X66 Q;  3HOW G;  4BY7 B;  1B2T A;  4LFB Q;  4KHP Q;  3HOY H;  1SN8 A;  4XXE A;  5FO7 B;  3T56 B;  2RF4 A;  1TY0 A;  2B2U C;  4E6I A;  3E9H A;  3M4O H;  5D14 A;  5M3M G;  5LMN W;  1NNX A;  4B9W A;  1EY0 A;  3CP0 A;  4JC0 A;  3KF8 B;  4ALP A;  3VR6 A;  4GOP C;  3X3M A;  5IT9 c;  5EKK A;  1CZW A;  1I3Q B;  1S5E D;  1Y1W G;  1EU3 A;  4IQZ A;  3PF4 A;  4DU9 A;  1ET9 A;  1JOR A;  4Z9C B;  2K5N A;  1P16 A;  3EN2 A;  3AMU A;  2SNM A;  4N8X 1;  2UU9 L;  4C1N K;  3S1R H;  1FR3 A;  1STY A;  2R92 H;  4HCE A;  1ONL A;  3FP9 A;  1C7Y A;  1JC7 A;  2NWG A;  4P73 A;  4BA1 I;  5C0X J;  1SXT A;  4J1M A;  4A3F B;  3KLW A;  3G48 A;  1EQR A;  2F0H A;  3T53 B;  4I7Z C;  2OXP A;  1SSO A;  1JOK A;  1JWS D;  1QOH A;  2X6G A;  4YY3 Q;  1VQF A;  2JA5 G;  1QUQ B;  2LKV A;  4DV1 L;  1VQL A;  1N33 L;  4IUU A;  2AMC B;  3BDC A;  4J6H A;  2A6E C;  1S40 A;  1UEA B;  4LUO A;  5I6W A;  3A7A B;  2JA5 H;  3D4D A;  5E3F A;  1JQY D;  1PTO F;  5I2X A;  4KJO A;  2ATW A;  2HHH Q;  4XYO A;  4EQP A;  4GLV B;  4JBK A;  1W6J A;  5JEA H;  4DUZ Q;  2I0Q A;  1MJC A;  1EY7 A;  1P8L A;  1STG A;  3I4M G;  4DR7 L;  2K01 A;  4ZRZ A;  4DV3 Q;  3S2D H;  3NP8 A;  5IWA Q;  2J0T D;  4X3U A;  4OWT B;  2F1M A;  4CKC A;  4JOI C;  4KLK A;  1D1K A;  1SNQ A;  3I4N H;  1L1O A;  3NHH A;  2K28 A;  2OF1 A;  2UUA Q;  1SAP A;  1MKH A;  2KEN A;  3FMC A;  3R2I A;  2O4X A;  3WWV A;  4LF9 L;  3SK8 A;  4DV4 Q;  1B53 A;  3GTP H;  1FNW A;  1MJE A;  1Y1W H;  3S17 B;  5M5Y B;  1YZ6 A;  5M3M H;  3I91 A;  4OEM B;  1PTO B;  2K5H A;  1TWF H;  3ER0 A;  4DAY B;  3LX0 A;  5EAY A;  1XMO L;  3K59 A;  4OO1 H;  3HKZ G;  4OO1 I;  2B29 A;  4GN5 A;  3F2D A;  3OMG A;  5CV5 A;  1VQO A;  3SK5 A;  3MC0 B;  1KLU D;  1SYB A;  2EE1 A;  1U5K A;  2K14 A;  2IT1 A;  2K33 A;  1D5M C;  1XX8 A;  4KJN A;  3CW2 C;  4L63 B;  4ZCK A;  3C2P A;  2QA4 A;  2WB1 B;  5HUR A;  1T5E A;  4P2C B;  4EQ5 A;  1O7Z A;  2NZH A;  5C6A A;  4POF A;  3D6W A;  5JPN C;  1RTO A;  1A3U A;  4B3R L;  4DV2 L;  2XWB B;  3T1H L;  3DWA A;  1HNW L;  1DOL A;  4PQX A;  3H09 A;  2MP1 A;  1UWV A;  4R4T A;  3URY A;  4A3B G;  3G71 A;  4A3D G;  3IFT A;  4JV5 L;  4DR3 L;  1TWH H;  2RSN A;  3LWU A;  4K14 A;  3C1F A;  2B2T A;  1H9R A;  3GTG H;  1ICF B;  4PMB A;  2F0N A;  4ABN A;  3NWS A;  1BR9 A;  1MGS A;  5FLX E;  3CU7 A;  2JEB I;  3KOJ A;  2ZJQ A;  3ND8 A;  4YWK A;  2F0Q A;  3GTJ B;  2UXC L;  4A3J H;  4L8J A;  4DAY A;  4JI5 Q;  4KKT A;  1QVF A;  3NK9 A;  1LTS D;  4KD4 A;  1SDF A;  2VXW A;  3CCQ A;  1MBY A;  2JA6 G;  1HPC A;  3RN5 A;  4B3S Q;  1L2F A;  4J8Q A;  1VQ9 A;  3CQZ H;  1KLG D;  2UXB L;  2E2I H;  4NP5 A;  1KXL A;  4BY1 B;  2R6G A;  1U0L A;  1X3Q A;  2UXB Q;  2TSS A;  4HED A;  4RGO S;  4BBR B;  3Q24 A;  2L5T A;  3FRP B;  3NSW A;  5C4J H;  1CKO A;  1RCV D;  1GHK A;  3O13 A;  1I94 L;  2D62 A;  4PMC A;  4JI5 L;  3H0G G;  3TP8 A;  5C3E G;  2UXC Q;  1X55 A;  2PZW A;  4BY1 G;  5FO9 B;  3GTK H;  5JPM C;  1JJC B;  1TWA H;  1I6V C;  1K8M A;  1PZJ D;  2N49 A;  4LNQ A;  5K36 G;  2XWJ B;  2PYK A;  1SFO B;  1VQB A;  2BA1 A;  1QVC A;  2E2H H;  2BDN A;  4ID6 A;  3QB3 A;  1HNX Q;  3S1N H;  5K36 H;  1ASZ A;  3FPU B;  4DR3 Q;  1EY4 A;  2ZT9 C;  5JJK A;  2EJG C;  1EIY B;  1BCP C;  2BH2 A;  3H6M A;  3TP6 A;  3W2D A;  1H9K A;  3TRZ A;  1HRJ A;  3D31 A;  5HGT A;  4A3C H;  1U4M A;  4DK1 A;  4RGT A;  1UE7 A;  2SNS A;  2XN9 C;  4DV2 Q;  2JA6 B;  1S4Z A;  1NBW A;  2B2W C;  3K7U C;  1Y1V B;  3VA7 A;  3DMU A;  1PTO H;  3VR2 A;  3IFD A;  4IUR A;  1CSP A;  3IRB A;  2JA7 G;  1L0Y B;  2Z1C A;  2AQ1 B;  1BKB A;  1I3Q H;  3MFG A;  3FKI G;  3BZC A;  4G7Z C;  2B63 H;  4LFA L;  1BOS A;  2EY5 A;  3R3O A;  3OYY A;  3LGJ A;  1STA A;  1U9R A;  1LTL A;  1G2S A;  2HDL A;  3FHW A;  1HR0 Q;  3M3Y B;  4NXN L;  3I3C A;  3K80 C;  3G6E A;  2EPB A;  2JA7 B;  1LM0 A;  4RWS C;  2YTX A;  1LT3 D;  3KK7 A;  4RAU C;  3PO3 G;  5DLQ E;  2AQ3 B;  1XMO Q;  2JE6 I;  4PNY A;  1B70 B;  3J7A 5;  1PA6 A;  2R7Z B;  1XYI A;  2NUC A;  5C4X B;  4YCU A;  4N9P A;  3I72 A;  4WOR A;  4LF9 Q;  4Y52 H;  5ELD A;  2UUA L;  5D3D A;  5FLM G;  1KL9 A;  4CHT B;  3HGB A;  2BE5 C;  3Q6S A;  3VDY A;  2CWA A;  5IWA L;  3MAQ A;  3A56 A;  4H0L C;  1K8A C;  4DR7 Q;  3VYR A;  1TWF B;  4CJ1 B;  4TVA B;  3TBI B;  4DUZ L;  1EWC A;  2O5I C;  2Q8R E;  2RKS A;  1TQO A;  2RSO A;  4N8F A;  3TP5 A;  2G5D A;  3NUC A;  1BDO A;  4CDC C;  3CMA A;  2R7F A;  1VQM A;  5LHY 1;  1EIG A;  2A8V A;  1UAP A;  1Q82 C;  4IPD A;  5C5M A;  1NUC A;  1L0X B;  1N33 Q;  4N9T A;  3G6J B;  3SK4 A;  4DV1 Q;  4DK6 C;  2KCM A;  4A93 G;  3W3A A;  4FF1 A;  3R93 A;  3CCU A;  4OL7 A;  4C3J H;  4R4C A;  4YWM A;  4IPC A;  3SVM A;  4KK7 A;  4R1J A;  1V8Q A;  4TSS A;  2NVQ H;  3MXN A;  3VYU A;  4DN4 M;  1C4Q A;  1X9N A;  4A3B H;  4A3D H;  3FKI H;  2F0T A;  3J80 i;  2UU9 Q;  3K8A A;  1IBL L;  3EQL C;  3NTH A;  4RCO A;  5COY A;  3J81 L;  3TEH B;  1Q8K A;  3J81 j;  4GOP B;  5JVH 3;  3HOX B;  1C8C A;  2M9V A;  1B4O A;  1VQA A;  1WD1 A;  2PQA B;  1IKL A;  1JCK B;  4ME3 A;  1NMG A;  3I73 A;  4QQB X;  1M4V A;  1S5C D;  1NTG A;  1VS0 A;  1R9T H;  5LMU L;  1K0R A;  5KYI A;  2NVX H;  1YEZ A;  4CKE A;  1K28 A;  4FVM A;  2R93 G;  4KHP L;  4FF4 A;  4LFB L;  2PCF B;  3CCL A;  2KEC A;  1RHP A;  4X66 L;  2A6E D;  3AQQ A;  4JI6 Q;  1SFO H;  2DN8 A;  4B9X A;  5IOD A;  1MSH A;  1IBK L;  1SYF A;  4A93 B;  3TS0 A;  2E2D C;  1TY2 A;  1X32 A;  1PDQ A;  1EZ6 A;  1UE5 A;  5ELE A;  3RD4 A;  4A3J G;  5J39 A;  4NDX A;  2KEE A;  3OWE B;  1B3A A;  3PIO 3;  4JBJ A;  2K5V A;  2ZM6 L;  2NZ1 D;  5I9O A;  2KED A;  1VQ8 A;  3FVQ A;  2MPM A;  3CKI B;  4LF5 Q;  1V43 A;  1F9S A;  1RDP D;  2JA7 H;  2CQA A;  2F4V Q;  4K0K L;  2F0M A;  1FNU A;  2DY7 A;  4IUP A;  1AP0 A;  3CQZ B;  2ZJR A;  2VQE Q;  2R3Z A;  2R7Z G;  2VB3 X;  4GNX A;  4ZK9 B;  1KD1 C;  4GOP A;  2JXM B;  4ZQ3 A;  1V1O A;  4FNF A;  4QF4 A;  1SRO A;  1NMF A;  4DR2 Q;  4JI3 Q;  4MHE A;  5AJ3 Q;  4X3K A;  3CHB D;  3AFQ A;  2FMM A;  5IGC A;  4C3H G;  4H7B A;  1HZ9 A;  5CYU A;  3D8G A;  2D2C C;  1Y1W B;  2IHE A;  2IY5 B;  4DFA A;  3JAM i;  4C3H H;  1WTV A;  1KQS A;  1EY9 A;  2WFW A;  3B6Y A;  5E4X A;  3PIP A;  3S1N B;  2B63 B;  1WTP A;  4A93 H;  2CH4 W;  4TRD A;  4LF7 Q;  5HY6 A;  2EXZ A;  3A8J E;  3J7A F;  3OIQ A;  4B3M Q;  5IP7 H;  1CHQ D;  4C3I H;  1YVC A;  3J7A V;  4CDE C;  3JAM L;  2NVY B;  2R61 A;  1E2Z A;  4JPB W;  2WAQ E;  3MA2 B;  3DM1 A;  2AHO B;  1IYJ B;  1L1O C;  4NKL A;  2I5M X;  3VR3 A;  3PCO B;  4R9W A;  1NE3 A;  5A2Q E;  2RHQ B;  2BCO A;  1SMY D;  1JB7 A;  5DM7 3;  5JEA G;  1TT2 A;  3BVM A;  5GAD C;  2EYL A;  3PSI A;  1LUZ A;  2WIN B;  4U68 A;  2Z9H A;  1EYD A;  4HAE A;  4DNI A;  1GD7 A;  2CVR A;  4PV1 C;  2EOT A;  2RA4 A;  4H13 C;  2IW3 A;  1DCZ A;  2CW0 D;  3W5O A;  4A3E B;  4FYD A;  1GXD C;  4DV0 Q;  4A3F G;  1AZQ A;  1C48 A;  4KY5 A;  1A2T A;  1XNQ L;  2Q8T A;  3U9O A;  1GVP A;  2ICE C;  1E1T A;  1ICW A;  5IYC G;  3NQT A;  5D3I B;  1HTL D;  1AEX A;  3M7N A;  3BZK A;  1E2W A;  1BNZ A;  2LFN A;  5EPJ A;  4DPG A;  1Q3L A;  2LY7 A;  4F88 A;  1ZXT A;  2ALY B;  4UP8 A;  1ESF A;  1KAW A;  2L15 A;  4B08 A;  4IFD J;  3S1M B;  3AB9 A;  2HD3 A;  1N36 Q;  4GLA C;  1EOT A;  2F0D A;  5EKL A;  4BY1 H;  4QMG A;  4WFN 3;  4DR4 L;  3AU7 A;  3KJO A;  1VQI A;  1ZKO A;  4P74 A;  1DZ1 A;  1IXR A;  3P20 A;  3RZO B;  4DAP A;  4HJ5 A;  4JI7 L;  3PIP 3;  2ICI A;  5FLX c;  4LK1 C;  2EIF A;  2R7D A;  4HTH A;  5CV9 A;  5C4J B;  1H9S B;  2GVA A;  4A3J B;  1DM0 B;  1XNR L;  1ZYR D;  5I2Y A;  1PXU A;  3UDG A;  3A5Z B;  1KC8 C;  3I7F A;  3PGZ A;  1VQG A;  2VY3 A;  1GO3 E;  1A6X A;  3CXC A;  1O80 A;  3STB C;  1LLR D;  2E76 C;  4DR5 Q;  3KLS A;  2E2I B;  1B50 A;  2KHJ A;  4HJA A;  4A3K G;  1F2Y A;  4BBS G;  1MIU A;  4OX9 L;  1SNM A;  1W3S A;  2BH8 A;  4JI2 Q;  4YIJ A;  3CC4 A;  1WOC A;  4ZYS A;  3Q0A A;  4O0A A;  1SLJ A;  3GTO B;  1PZI D;  4IUN A;  4KMU C;  4X6A H;  1M8A A;  1TXY A;  2XVS A;  3QOL A;  4OON A;  1EFW A;  3K5N A;  1QVG A;  2WV6 D;  4LUV A;  3OW7 A;  4OGQ C;  3TME A;  4LF4 L;  3MZ5 A;  4MNO A;  1BBX C;  4K6L A;  1Q1E A;  3GTP B;  3U4Z A;  4UPA A;  5BN5 A;  3Q22 A;  5AFW A;  4JBM A;  1KHI A;  2CW0 C;  3F2B A;  3BVZ A;  2HT1 A;  2H5X A;  2B2Y C;  1G6Z A;  4NXM L;  1BUV T;  2NBF A;  1X54 A;  4HJ8 A;  1N9W A;  1Q90 A;  2J4X A;  2JA5 B;  2F3W A;  1EWI A;  2Y0S G;  3DWP A;  4LW1 A;  2G9H D;  2QGQ A;  3NEN A;  1OXU A;  2F0V A;  2XTI A;  4BXX G;  1R9T B;  5CV4 A;  2F0S A;  1YI2 A;  2Z6K A;  4M8A A;  2JA6 H;  3HKZ B;  1QIL A;  1UEB A;  2Y0S B;  4A3G G;  4MIU A;  4A3K B;  3S2H H;  1PV4 A;  5IGG A;  4BBS B;  1SR3 A;  2BDO A;  1HUN A;  1HFG A;  2PW5 A;  4ZAI A;  1QZG A;  1YHA A;  2L0C A;  1PH8 A;  1IYV A;  4GKJ Q;  2WB1 G;  4A76 A;  2HCC A;  1YHQ A;  1PH4 A;  1VQH A;  5FOB B;  5FJ8 G;  5CC4 A;  3S14 H;  2F0G A;  3GTM B;  3S15 B;  1JE5 A;  4HMJ A;  4I7A A;  4DV5 Q;  2RDG A;  2E2J B;  3W1B A;  1LAB A;  3SXH A;  2H4O A;  1II3 A;  5DNF A;  1KNA A;  1U4R A;  1SE2 A;  3KBX A;  3T13 A;  5C4X G;  4XQQ A;  3KYH C;  4IO9 A;  2LXJ A;  1PYB A;  1Q81 C;  5FLM H;  4JI4 L;  2F03 A;  1TS3 A;  1Y1V G;  1J5E Q;  1TKW B;  4DV6 L;  4S3S A;  1TWG B;  3RNU A;  4B3T Q;  2YYZ A;  1HXY D;  5C3E B;  2ZXR A;  4RFB A;  2EZV A;  2K6A A;  2I07 B;  1XPR A;  3UDF A;  3M4O B;  4DV6 Q;  4O1N A;  4QY7 A;  1J5E L;  1I4P A;  1BBW A;  2K1B A;  2MNA A;  2Q2T A;  2JA8 G;  5C3X A;  2JQO A;  4FXG C;  5IT9 L;  1I4Q A;  5IIF A;  1VCI A;  3QOJ A;  2Z0S A;  3WOE A;  3UDX A;  1DOK A;  1LTR D;  2WAQ B;  5I4D A;  4IFD H;  3BG3 A;  3HOU G;  3RUZ A;  5CGK A;  1PH9 A;  1TII D;  4L5R C;  5I9P A;  1HZC A;  2B2V A;  3D6C A;  4DV5 L;  4LUZ A;  4LMQ D;  4OWW B;  1YNJ C;  5IYB G;  4DR6 L;  1QB5 D;  3PO2 G;  3I55 A;  1A62 A;  1WTR A;  3AFP A;  5KEE A;  1GUG A;  5BN3 A;  4GKJ L;  3K57 A;  2NVT H;  3HOY B;  1TWC B;  4AQY L;  4LFC Q;  5ELO A;  3K58 A;  2K4K A;  3S9W A;  3PO3 H;  3MXN B;  1HZB A;  5FKA C;  5KNB A;  1GM5 A;  1PTO D;  1KDC A;  3KLS X;  3TSS A;  4K5X A;  4RH6 A;  2F4I A;  3OHX C;  3VR4 A;  1AE3 A;  2VB2 X;  1LT5 D;  4DA2 A;  4QJF A;  2PNH A;  2WKC A;  1N34 L;  1GUS A;  3HOY G;  4OEL B;  2N78 A;  1BVS A;  1EWH A;  1CFM A;  1RJT A;  3J7Y W;  1T5X D;  4HSP A;  3LWE A;  2N55 A;  4RA8 A;  1ET6 A;  1H9J A;  5JEA J;  4JYA L;  5JJL A;  1R4P B;  5FJ8 H;  3L7Z C;  2E5L L;  3M3Y H;  2F0U A;  2AQ2 B;  2C35 B;  1LAC A;  1RTN A;  3H0G B;  4HR7 B;  2YV5 A;  4AH6 A;  2L55 A;  1D1I A;  2K75 A;  1FJG Q;  3IKJ A;  1WD0 A;  1EQT A;  1V1Q A;  3ITP A;  3BJU A;  3DHQ A;  3HOX H;  1WVL A;  3K0X A;  4KN7 C;  4FF2 A;  2RBM A;  3MHB A;  2E2H B;  1J8I A;  1AW7 A;  3I4O A;  4HIO A;  3S1Q H;  5GQO A;  4DUY Q;  5M5W H;  3ICE A;  1I50 B;  4LF4 Q;  2FJ2 A;  1CQF A;  4APV A;  2KA7 A;  1H95 A;  4L5Q A;  3NE5 B;  2A5H A;  4KV6 A;  2A6H D;  3J81 E;  2JN4 A;  4OO1 G;  1S5B D;  1TU2 B;  1KRS A;  3EIV A;  2A68 D;  5C3E H;  3KBG A;  4C3J G;  1X56 A;  3OPO A;  4OX9 Q;  3HG9 A;  2DJF C;  1VQC A;  3C1E A;  2PI2 A;  3J80 c;  1CHP D;  1B7Y B;  2Q8I B;  1VQP A;  1WI5 A;  1E1O A;  3S1M H;  1CKN B;  1D8L A;  4A3E G;  4GNX B;  1NR4 A;  4OWX B;  4KTA A;  3CD6 A;  1NJI C;  3E0J A;  1XNR Q;  2AKW B;  4CJ0 B;  4F87 A;  1J9O A;  2VQF Q;  1SND A;  4K2K A;  1UUP A;  2LS0 1;  4X64 Q;  4KHZ A;  2EQS A;  2E2J H;  3I56 A;  2LSS A;  2EVB A;  2EYM A;  2VUM B;  3S15 H;  4K5W A;  2WP8 J;  1CKM A;  4XDX A;  1SYC A;  2TMP A;  1O7Y A;  4IUV A;  3EJI A;  3K5L A;  1WJJ A;  1S5D D;  5M3F H;  1TWH B;  1KAA A;  3D3R A;  4DGZ A;  4DNR B;  1JOO A;  3P7J A;  2CKZ B;  4GNX C;  3HKZ E;  4LAA A;  1I4H A;  1HUM A;  2GVB A;  3PO2 H;  2Y0S E;  1G2T A;  1WCM B;  5A35 A;  4EVO A;  5KND A;  3MFY A;  3J81 i;  2EY2 A;  1C0A A;  2MGS A;  4C3J B;  4BBR H;  4IFD I;  1QZH A;  4WJW A;  1PH1 A;  3OTO L;  1T9H A;  2JP1 A;  3KFU A;  1EEI D;  4RG1 A;  3TS2 A;  1ZEQ X;  2Q2I A;  5I6Y A;  1EIF A;  1CK1 A;  1NAP A;  2HQL A;  3CAM A;  1BCP F;  2X6L A;  1I6H B;  4DV7 Q;  1U4P A;  1G91 A;  1Y69 U;  4C3I B;  2I5L X;  3GD7 A;  4OIJ A;  5CV8 A;  3TN2 A;  3GTJ H;  4A3E H;  2VUM G;  1OXX K;  4K5V A;  1FD7 D;  5CV6 A;  4L5T A;  3X3N A;  4X62 L;  5IYD H;  2SOB A;  1LV9 A;  1Z9F A;  2BA0 A;  1HQR D;  3NBH B;  2EYO A;  1GHJ A;  3RLN A;  4G7H C;  3L3O C;  1S5F D;  2IX3 A;  5M3F G;  1PH7 A;  4RHR A;  3T1Y L;  1XMQ Q;  1STH A;  2YU9 B;  2B8G A;  1X3P A;  3M4Y A;  2KHS A;  1RKN A;  3HFZ B;  4XIG S;  3GTQ H;  4X65 Q;  1V1P A;  3GDE A;  5D65 A;  5JOB A;  3UI2 A;  1OXS C;  5DM6 3;  2Z4H A;  5M5W B;  4HN7 A;  2NN6 I;  4CDD C;  5JAV A;  2F3I A;  2F52 A;  1K8O A;  3H3V C;  3BDL A;  1N32 Q;  5IGE A;  5HGQ A;  2JSO A;  1FGU A;  4QIW E;  3MEF A;  1PZK D;  3SE0 A;  4BA2 I;  2L11 A;  1YNJ D;  2F0I A;  2VQE L;  5LMN L;  4UDU C;  3L9A X;  1Y8P B;  3CPW A;  3A5U A;  2F4V L;  4K0K Q;  2F0F A;  5C0X G;  1DGS A;  4LF5 L;  4GLX A;  4IJL A;  3T4A C;  2FHT A;  2L9H A;  1KDA A;  4NMZ A;  3S1Q B;  1Z6H A;  2KQ3 A;  5IYC H;  4YHH Q;  1WCM G;  3CCV A;  2HCI A;  2PI2 E;  1Q46 A;  4EQN A;  4CBV A;  1CA5 A;  4HSV A;  3MWY W;  1PVO A;  3E3X A;  2I5H A;  1IBK Q;  3MVV A;  4V19 0;  3RZD B;  3E0E A;  4RKL A;  4UP7 A;  2IX0 A;  4HCS A;  2B63 G;  1YBY A;  1STB A;  3SEB A;  2JK8 A;  4KD3 A;  4IOC A;  1QCB D;  3PUX A;  3GP7 A;  3VR5 A;  2PNR C;  1CI3 M;  1YNN C;  5LMU Q;  2KBN A;  4Q5V A;  2DNC A;  2ES2 A;  2EJM A;  1PH3 A;  2Z8L A;  4Q0F A;  3Q8D A;  1SNO A;  1YJ9 A;  3F2U A;  3PF5 A;  1PFS A;  2NTS A;  5J1Z A;  3M4P A;  1PH6 A;  2OTL A;  3I4M H;  1EYC A;  4A3G H;  1N8R C;  4P71 A;  1IBL Q;  1PHJ A;  1Q8I A;  2MHV A;  4LF8 L;  2B2Y A;  1EIH A;  3FEW X;  3U50 C;  3HP3 A;  1OO9 B;  2EY1 A;  3PV0 A;  5C44 H;  4G7O C;  1GUO A;  3GTL H;  2JEA I;  4C1N I;  2K50 A;  4RMF A;  1WCM H;  1PRT B;  3GTM H;  3C46 A;  1KAB A;  1HNZ L;  1PFM A;  4KI0 A;  3MEH A;  3A54 A;  2Z6B A;  3ERS X;  5IYB H;  1WTO A;  3JAM c;  3MXG A;  4C3I G;  3G7L A;  1I4X A;  2Z6K C;  3FDT A;  3UE0 A;  3CF5 A;  1ROD A;  1BXT A;  1B44 D;  2PZU A;  4R4I A;  3QR8 A;  2KVM A;  5EQ0 A;  2K5Q A;  1MHW C;  5FO8 B;  3MXU A;  2MUY A;  5CMD A;  2PW7 A;  1A63 A;  2QCP X;  3GTL B;  1PFB A;  1F9Q A;  2UUB L;  1BQQ T;  3S14 B;  4KKU A;  2QEJ C;  2PQE A;  4GN4 B;  1R4Q B;  1YHB A;  4DXF A;  3A8K E;  1IBM L;  1B3Q A;  2A19 A;  1LTT D;  4PG3 A;  2KOL A;  4FXK C;  1Q86 C;  3NEM A;  4K2L A;  1LTG D;  4JI1 Q;  1PRT F;  1D5X C;  2CHB D;  2F0O A;  4EQO A;  3L2P A;  2L4N A;  4JVZ A;  1W2B A;  4UHV A;  1HA5 A;  4V0B A;  1YIJ A;  1OTC A;  4Y7N H;  4A3D B;  4A3B B;  3HOW H;  4A3L H;  3A7L A;  5IOC A;  3FPP A;  2WII B;  1JWM D;  3H0G H;  2SDF A;  1X3G A;  1JJG A;  3CCE A;  1VMC A;  5EKI A;  1SNP A;  5H1S E;  1DON A;  3BYY B;  3STB D;  1AZP A;  5JJI A;  4BY7 H;  3GTO H;  5KIX A;  4NXN Q;  2OTJ A;  3PMF A;  3M85 A;  1HR0 L;  4HIM A;  4UAI A;  2CFM A;  1EZ8 A;  3CCJ A;  4LFA Q;  2VS1 A;  1CT1 D;  2B2V C;  2E8G A;  2DY8 A;  3RLF A;  2HIV A;  1MSG A;  3WDN A;  4JI1 L;  1ESR A;  1SRU A;  5KRU A;  1UE6 A;  2K5W A;  3H3V I;  1TWA B;  1IW7 C;  1IBM Q;  1OXV A;  4X3T A;  2FMC A;  4R8N A;  3AEV A;  5CR3 A;  2UUB Q;  3VYS A;  3GV3 A;  1HZA A;  4A4I A;  1IYU A;  2FFK B;  3RMH A;  4KN4 C;  3U9S A;  2OWO A;  3NBH A;  3OOC A;  3CCS A;  2F0P A;  2AWO A;  2A6H C;  3T51 B;  1HNX L;  1EUJ A;  4KY6 A;  4RHS A;  2R7Z H;  2EYF A;  1D2B A;  4DNT B;  1D5Z C;  1HQM C;  1CKN A;  1X3E A;  2YTV A;  1AE2 A;  1A3T A;  4A3M H;  1CUK A;  5FLX L;  2ZXP A;  4RGN A;  3M9B A;  4MTK A;  4A75 A;  5IP7 G;  1QNU A;  1HNZ Q;  1JB3 A;  2NZO A;  4QIW B;  1A2U A;  2OQK A;  4IUT A;  4HJ7 A;  1I94 Q;  1B9M A;  1GKH A;  1L0W A;  4IFD G;  1JE4 A;  2K03 A;  3CCM A;  4WRD A;  4KY7 A;  3U58 A;  1VQ7 A;  2R92 B;  5C4Z A;  1EL0 A;  2ZTD A;  2B39 A;  2M00 A;  1WTH A;  4LF8 Q;  1EY5 A;  5COR A;  3RZD H;  3KDF A;  4JOI A;  1HFN A;  5C0X I;  1WTX A;  4BXX H;  4PZ6 A;  4BWG B;  4B3S L;  3CPF A;  2O5J C;  2AWN A;  4DK0 A; 
#chains in the Genus database with same CATH homology
 2YU9 H;  4Y52 H;  2NN6 G;  4JI7 Q;  1AE3 A;  1V9P A;  5IP9 G;  2UUA L;  1D7Q A;  3AYH B;  3RZO H;  4QJF A;  3RR5 A;  2PNH A;  5FLM G;  1KL9 A;  1PYS B;  1N34 L;  3HOY G;  4DR4 Q;  1TWG H;  1L1O B;  2N78 A;  1BVS A;  2GN5 A;  2CWA A;  3D0F A;  5IWA L;  3VDY A;  4JBW A;  3ULL A;  1N36 L;  1Q7Y C;  1M90 C;  1E7Z A;  4PMW A;  5JEA J;  1K8A C;  4DR7 Q;  4JYA L;  5JJL A;  4GKK L;  2CCZ A;  3E9I A;  5FJ8 H;  3L7Z C;  2E5L L;  2XGT A;  3M3Y H;  4IOA A;  4TVA B;  2C35 B;  4DUZ L;  2MQH A;  2ZJP A;  5M5X H;  1IL2 A;  4JV5 Q;  4A3C G;  5BR8 L;  2YV5 A;  4AH6 A;  2K75 A;  1FJG Q;  1XNQ Q;  5IE8 A;  1SMX A;  3EBE A;  1C9O A;  1YJN A;  3I4N G;  1V1Q A;  3CMA A;  4DV0 L;  3BJU A;  3W1G A;  1J6Q A;  2R7F A;  3HOX H;  1VQM A;  3K0X A;  1HNW Q;  4YHH L;  2JA8 H;  2A8V A;  3DM3 A;  3T1H Q;  3I4O A;  4HIO A;  1QUQ A;  1Q82 C;  4B3R Q;  3S1Q H;  4YWL A;  4IPD A;  5GQO A;  5M5W H;  4DUY Q;  2K52 A;  4L5S A;  3ICE A;  2EXD A;  4LF4 Q;  3HOZ G;  4APV A;  1N33 Q;  1LYL A;  2A1A A;  4DV1 Q;  4DK6 C;  2KCM A;  1M1K C;  4A93 G;  1H95 A;  4L5Q A;  3S17 H;  1EYG A;  4IFD J;  3CCU A;  5LMN Q;  1Q12 A;  2CQO A;  4OO1 G;  3PIO A;  4C3J H;  1KRS A;  4A3L G;  4R4C A;  2MO0 A;  3EIV A;  4YWM A;  4QGU A;  4IPC A;  5C3E H;  4A3F H;  2HIX A;  4R1J A;  4A3K H;  1X56 A;  2NVQ H;  4BBS H;  2IX1 A;  5IYD G;  4OX9 Q;  1N32 L;  3L0O A;  2UUC L;  3PUY A;  1X9N A;  4GS3 A;  4A3B H;  1VQC A;  4A3D H;  4MTN A;  3HOV G;  2PI2 A;  3FKI H;  3J80 i;  2WB1 E;  3J80 c;  1B7Y B;  2YTY A;  1G6P A;  2KHI A;  1WI5 A;  1VQP A;  1E1O A;  2UU9 Q;  3K8A A;  2R93 H;  3S1M H;  1IBL L;  4GN3 B;  1CKN B;  1D8L A;  4A3E G;  4B3M L;  4GNX B;  4OWX B;  2WAQ G;  3CD6 A;  1NJI C;  3TEH B;  1Q8K A;  4X65 L;  3J81 j;  4GOP B;  1XNR Q;  2AKW B;  2DGY A;  4LF7 L;  3PUV A;  2V1C C;  1VQA A;  2VQF Q;  4DV4 L;  3T1Y Q;  1XMQ L;  2VL6 A;  2PQA B;  3I2Z A;  4X64 Q;  4KHZ A;  2EQS A;  2E2J H;  3ULJ A;  2LSS A;  4ME3 A;  3I56 A;  1NMG A;  1NY4 A;  1JJ2 A;  4QQB X;  3S15 H;  4LF6 Q;  1NTG A;  2WP8 J;  1XJV A;  1VS0 A;  4DKA C;  1CKM A;  1R9T H;  5LMU L;  1K0R A;  2NVX H;  1AH9 A;  1YEZ A;  3BU2 A;  2R93 G;  4X62 Q;  4KHP L;  4P72 A;  4R4Q A;  4LFB L;  3CCL A;  4DV3 L;  4X66 L;  5IP9 H;  1VQJ A;  3AQQ A;  1WJJ A;  1SFO H;  4JI6 Q;  3A0J A;  1Y1V H;  5IY0 A;  5AJ3 L;  1Q1B A;  5M3F H;  4JI3 L;  1WFQ A;  4DR2 L;  1IBK L;  2N3S A;  1K73 C;  5GAE C;  4DV7 L;  1VQN A;  3HOZ H;  2CKZ B;  2N8N A;  1FVI A;  3HKZ E;  4GNX C;  3TS0 A;  2GVB A;  1ASY A;  3PO2 H;  1RL2 A;  2Y0S E;  2HHH L;  1UE5 A;  4AIM A;  4A3J G;  3UDI A;  4IPH A;  3HKS A;  1OXT A;  2OCE A;  4OXP A;  4JBJ A;  3J81 i;  1C0A A;  2K5V A;  4JCV E;  2ZM6 L;  4JI8 Q;  4BBR H;  4IFD I;  1QZH A;  4DR1 Q;  2Q2U A;  1A8V A;  1VQ8 A;  1PH1 A;  3S24 A;  3OTO L;  4LF5 Q;  2UXD Q;  1RIP A;  1T9H A;  1V43 A;  3CCR A;  2VW9 A;  2JA7 H;  2R92 G;  2F4V Q;  3OTO Q;  1E24 A;  3KFU A;  4K0K L;  4RG1 A;  3TS2 A;  4A3M G;  4YY3 L;  1B8A A;  2ZM6 Q;  2ZJR A;  2VQE Q;  3U4V A;  2Q2I A;  3RLO A;  1E22 A;  4HJ9 A;  1JMC A;  2R7Z G;  1EIF A;  4A3I H;  1I6H H;  2Q2H A;  2OQ0 A;  2HQL A;  3J7Z C;  4GNX A;  3CAM A;  2LXK A;  1KD1 C;  4GOP A;  4H02 A;  2ID0 A;  4MZ9 A;  2QEX A;  1FL0 A;  2MO1 A;  1SRO A;  4DV7 Q;  1NMF A;  2IHF A;  4DR2 Q;  1PH5 A;  1G29 1;  4JI3 Q;  2I5L X;  3GD7 A;  4A3E H;  2MFI A;  5AJ3 Q;  1XTD A;  3GTJ H;  2VUM G;  4JI6 L;  1VQK A;  4C2M H;  4X66 Q;  3HOW G;  1OXX K;  3AFQ A;  1YIT A;  4LFB Q;  1HZ9 A;  3CME A;  4L5T A;  4X62 L;  3HOY H;  1UE1 A;  4KHP Q;  3F8T A;  1SN8 A;  5IYD H;  1Z9F A;  2RF4 A;  2BA0 A;  3NBH B;  3E9H A;  3M4O H;  3RLN A;  2IHE A;  2IY5 B;  3JAM i;  4DAM A;  5M3M G;  4C3H H;  1KQS A;  1K83 H;  4IJH A;  5LMN W;  4XTC S;  2WFW A;  3B6Y A;  4NB3 A;  5M3F G;  2FXQ A;  1PH7 A;  4X64 L;  3CP0 A;  4JC0 A;  4PZ7 A;  3PIP A;  3KF8 B;  3T1Y L;  4ALP A;  1XMQ Q;  2VQF L;  1HR0 W;  4GOP C;  1A0I A;  4A93 H;  5IT9 c;  4LF7 Q;  4O2D A;  4XIG S;  3HFZ B;  5GAH C;  5HY6 A;  3GTQ H;  4X65 Q;  3GDE A;  1Y1W G;  2NVY H;  1OXS C;  3HOX G;  3PF4 A;  4B3M Q;  5IP7 H;  2K5N A;  1P16 A;  3EN2 A;  4C3I H;  1YVC A;  2UU9 L;  2NN6 I;  5M5Y H;  3S1R H;  2F3I A;  2F52 A;  1CSQ A;  2WAQ E;  2R92 H;  1N32 Q;  5HGQ A;  1FGU A;  2AHO B;  2PQA A;  1IYJ B;  3MEF A;  4QIW E;  3HOV H;  1L1O C;  3FP9 A;  1C7Y A;  4BA2 I;  2I5M X;  2RHS B;  3PCO B;  4P73 A;  4BA1 I;  1K8G A;  1NE3 A;  5C0X J;  2RHQ B;  1JB7 A;  3KLW A;  3G48 A;  5JEA G;  4EX5 A;  1EQR A;  2VQE L;  5GRO A;  4DK3 C;  5LMN L;  5GAD C;  1EQQ A;  1KRT A;  3PSI A;  3ULP A;  3CPW A;  4YY3 Q;  3A5U A;  1E3P A;  1LUZ A;  1VQF A;  2JA5 G;  1N8R C;  1QUQ B;  4DNI A;  4DV1 L;  1VQL A;  2F4V L;  4K0K Q;  1N33 L;  5C0X G;  2UXD L;  1DGS A;  2JA9 A;  4LF5 L;  2AMC B;  4GLX A;  1GD7 A;  4IJL A;  4DUY L;  4DR1 L;  1PH2 A;  1S40 A;  4UY8 C;  1VQ6 A;  4JI8 L;  4LUO A;  5IYC H;  3W5O A;  4YHH Q;  1WCM G;  3CCV A;  2JA5 H;  2PI2 E;  4DV0 Q;  4A3F G;  4AYB E;  1Q46 A;  2ATW A;  5GAG C;  1XNQ L;  1FJG L;  1GVP A;  3KDF B;  2HHH Q;  1E1T A;  1PVO A;  4GLV B;  5IYC G;  4JBK A;  5E7N A;  1X65 A;  2I0Q A;  5C4X H;  4DUZ Q;  3M7N A;  1MJC A;  2I5H A;  3BZK A;  1IBK Q;  4DPG A;  1P8L A;  2E5L Q;  4WJ3 M;  3I4M G;  1TWC H;  4UP8 A;  3E0E A;  2ALY B;  4UP7 A;  1KAW A;  2L15 A;  4YCV A;  2IX0 A;  4DR7 L;  2B63 G;  4DV3 Q;  1YBY A;  3HOU H;  4JYA Q;  2JK8 A;  3S2D H;  1N36 Q;  4GLA C;  4IOC A;  2KCT A;  5IWA Q;  4BY1 H;  1SE8 A;  3PUX A;  4OWT B;  4DR4 L;  1N34 Q;  4JOI C;  4KLK A;  1VQI A;  2ZTC A;  3KJO A;  5LMU Q;  3I4N H;  1L1O A;  1X6O A;  2KBN A;  4P74 A;  4LF6 L;  2UUA Q;  2D0P A;  1IXR A;  4A3I G;  2ES2 A;  3PUW A;  4HJ5 A;  1MKH A;  2KEN A;  3GO5 A;  1PH3 A;  4JI7 L;  3Q8D A;  5FLX c;  3WWV A;  1YJ9 A;  4LF9 L;  4DV4 Q;  3DLL A;  3GTP H;  4BY7 G;  2EIF A;  2R7D A;  3PF5 A;  4R4O A;  1PFS A;  1Y1W H;  1PH6 A;  1MJE A;  3M4P A;  1YZ6 A;  2GVA A;  5M3M H;  2OTL A;  3I4M H;  1XNR L;  1Z47 A;  4A3G H;  2K5H A;  1TWF H;  3ER0 A;  4LFC L;  3A5Z B;  4PZ8 A;  3I7F A;  3PGZ A;  4DAY B;  4P71 A;  3A74 A;  1VQG A;  2VY3 A;  4JG2 A;  5EAY A;  1XMO L;  1IBL Q;  1PHJ A;  1GO3 E;  3CXC A;  3STB C;  3HKZ G;  4LF8 L;  2B29 A;  4GN5 A;  3F2D A;  4OO1 I;  4DR5 Q;  3KF6 B;  2KHJ A;  1S72 A;  4HJA A;  1VQO A;  3RN2 A;  3U50 C;  4A3K G;  2UUC Q;  4BBS G;  1KIX A;  1MIU A;  1G51 A;  4DR6 Q;  3PV0 A;  1U5K A;  2K14 A;  4OX9 L;  5C44 H;  1W3S A;  2BH8 A;  2IT1 A;  4JI2 Q;  3CC4 A;  2JEA I;  3GTL H;  1WOC A;  2K50 A;  4RMF A;  1WCM H;  1HH2 P;  1I5F A;  3GTM H;  4O0A A;  1SLJ A;  1O7I A;  1HNZ L;  3CW2 C;  4KI0 A;  4X6A H;  2QA4 A;  1TXY A;  1EFW A;  4OON A;  4EQ5 A;  2NZH A;  1QVG A;  3ERS X;  4LUV A;  4IPG A;  3H3V H;  5IYB H;  4POF A;  4LF4 L;  3JAM c;  4MNO A;  2Z6K C;  4AYB G;  4B3R L;  3UE0 A;  3CF5 A;  4DV2 L;  1Q1E A;  4TQU S;  3T1H L;  4R4I A;  3U4Z A;  4UPA A;  3UDG A;  3JC6 6;  4JBM A;  1KHI A;  2HT1 A;  3F2B A;  1HNW L;  2H5X A;  3M4Q A;  1WYD A;  2PMZ E;  4NXM L;  1EOV A;  1S3O A;  1X54 A;  4HJ8 A;  1N9W A;  1A63 A;  5BR8 Q;  1UWV A;  4R4T A;  4HIK A;  4B3T L;  4A3B G;  3G71 A;  4A3D G;  4JV5 L;  2UUB L;  1EWI A;  4DR3 L;  1TWH H;  2Y0S G;  2D0O A;  3G4S A;  4GN4 B;  3CC2 A;  1YHB A;  4LW1 A;  4GKK Q;  1IBM L;  2A19 A;  1Y14 B;  4JI4 Q;  4YCW A;  2QGQ A;  3NEN A;  1OXU A;  4PG3 A;  1Q86 C;  3GTG H;  3KJP A;  3NEM A;  4QL5 A;  1XPO A;  2XTI A;  4JI1 Q;  2JEB I;  3KOJ A;  1YNX A;  4BXX G;  2ZJQ A;  1IZ6 A;  4YWK A;  1YI2 A;  2Z6K A;  3L2P A;  2JA6 H;  2UXC L;  4A3J H;  1W2B A;  1YIJ A;  2VUM H;  1OTC A;  4JI5 Q;  4Y7N H;  3HOW H;  1QVF A;  1UEB A;  1VQD A;  4A3L H;  4A3G G;  3S2H H;  1PV4 A;  3CCQ A;  1SR3 A;  2JA6 G;  3H0G H;  3RN5 A;  4B3S Q;  1K3R A;  4UP9 A;  1L2F A;  3K7A H;  1VQ9 A;  1X3G A;  3CQZ H;  3CCE A;  2UXB L;  1JJG A;  2E2I H;  1QZG A;  1YHA A;  2ZTE A;  1VQE A;  5H1S E;  1KXL A;  1PH8 A;  3UE1 A;  4GKJ Q;  2WB1 G;  2R6G A;  1U0L A;  3TQY A;  3CC7 A;  4A76 A;  2CWP A;  3STB D;  1VQH A;  1YHQ A;  1PH4 A;  4BY7 H;  5FJ8 G;  2UXB Q;  2VNU D;  5JJI A;  3GTO H;  3S14 H;  4NXN Q;  2OTJ A;  2DUD A;  5C4J H;  1CKO A;  1JE5 A;  3M85 A;  1HR0 L;  4DV5 Q;  4HIM A;  2ASB A;  3W1B A;  2CFM A;  2B3G A;  3CCJ A;  4LFA Q;  1I94 L;  2D62 A;  3OW2 A;  2VS1 A;  4JI5 L;  3H0G G;  5C3E G;  3RLF A;  2E8G A;  1X55 A;  4BY1 G;  2HIV A;  2UXC Q;  3GTK H;  1JJC B;  1TWA H;  4P75 A;  4LNQ A;  2N49 A;  3TRE A;  4JI1 L;  5K36 G;  1SRU A;  1I50 H;  1UE6 A;  5C4X G;  3F1Z A;  2JJQ A;  3H3V I;  3KYH C;  1VQB A;  2LXJ A;  1PYB A;  4IO9 A;  2BA1 A;  5FLM H;  1Q81 C;  4JI4 L;  1QVC A;  1IBM Q;  1OXV A;  2E2H H;  1HNX Q;  3AEV A;  1Y1V G;  1J5E Q;  3S1N H;  4DV6 L;  1ASZ A;  1JT8 A;  4DR3 Q;  5ELN A;  4AQY Q;  3RNU A;  2UUB Q;  5JJK A;  4B3T Q;  3S16 H;  2YYZ A;  5C44 G;  4JI0 L;  1EIY B;  1HZA A;  4A4I A;  2BH2 A;  1VQ5 A;  4JI0 Q;  4LWC A;  2OWO A;  4NXM Q;  1XPR A;  3CCS A;  3UDF A;  4WJ4 A;  3TRZ A;  4DV6 Q;  2AWO A;  3D31 A;  2VZA A;  4QY7 A;  1X3F A;  1J5E L;  4A3C H;  1K9M C;  1HNX L;  1EUJ A;  1BBW A;  1UE7 A;  2MNA A;  4DV2 Q;  2Q2T A;  1NBW A;  2JA8 G;  3K7U C;  3ZJY C;  2R7Z H;  2JQO A;  3SGI A;  1X3E A;  1CKN A;  2YTV A;  1CSP A;  3IRB A;  1AE2 A;  2JA7 G;  1VCI A;  2Z0S A;  1VQ4 A;  1BBU A;  1BKB A;  1CUK A;  3UDX A;  4A3M H;  1YJW A;  3M9B A;  1XPU A;  1I3Q H;  1HJP A;  4A75 A;  5IP7 G;  1HNZ Q;  1KC8 C;  3NEL A;  3FKI G;  2NZO A;  3BZC A;  2OQK A;  4HJ7 A;  4POG A;  1I94 Q;  4LFA L;  2B63 H;  3HOU G;  1PH9 A;  1GKH A;  1L0W A;  4L5R C;  4IFD G;  4BBR G;  4JI2 L;  4NPS A;  3OYY A;  3LGJ A;  1HZC A;  4DV5 L;  4OWW B;  4LUZ A;  3CCM A;  1LTL A;  3K81 C;  3FHW A;  2RCN A;  5IYB G;  3U58 A;  1HR0 Q;  4HID A;  4DR6 L;  4NXN L;  3J81 c;  3PO2 G;  3K80 C;  4FDB A;  3I55 A;  3G6E A;  1VQ7 A;  1A62 A;  3AFP A;  4DR5 L;  2ZTD A;  1LM0 A;  4LF8 Q;  5J3B A;  4GKJ L;  2YTX A;  2NVT H;  3H15 A;  3PO3 G;  5DLQ E;  1XMO Q;  4J15 A;  3RZD H;  3F2C A;  2JE6 I;  3KDF A;  4AQY L;  5ELO A;  4JOI A;  2K4K A;  4LFC Q;  1B70 B;  5C0X I;  1PA6 A;  3MXN B;  1HZB A;  3J7A 5;  3PO3 H;  4BXX H;  3PUZ A;  3KF6 A;  4PZ6 A;  4YCU A;  1GM5 A;  4B3S L;  3CPF A;  2AWN A;  4LF9 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...