2NVTH

Rna polymerase ii elongation complex in 150 mm mg+2 with gmpcpp
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: role of the trigger loop in substrate specificity and catalysis
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
molecule keywords 5'-R(*AP*AP*GP*AP*CP*CP*AP*GP*GP*C)-3'
total genus 21
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2006-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2nvtH00
1U5KA 2JA8H 4A3GH 2JA8G 4DR7Q 5IWAQ 4GLVB 4IJHA 3GTJH 2YU9H 5IP7G 4A3BG 2IT1A 3I2ZA 1VQ6A 2ES2A 1FJGL 2OTJA 1AE3A 4RG1A 2KCMA 4JI2Q 3DM3A 4A3FG 1GVPA 3L0OA 4JV5Q 2WAQE 1WFQA 3KLWA 3PGZA 4JC0A 3CMAA 1VQOA 2EXDA 4YWMA 3GTGH 1LTLA 4X62L 2AWOA 2RF4A 2YTYA 1PH7A 4QQBX 1N36L 4LF4L 1V9PA 1EUJA 5C3EH 5C3EG 3CCEA 1Q81C 2E2JH 2QA4A 2EQSA 3CPWA 4DV4L 2UXBQ 3OYYA 1PYBA 1W3SA 4POFA 4A3CG 3Q8DA 4DPGA 4AQYQ 5ELOA 1VQCA 3OTOL 2ALYB 3I56A 3RN2A 2E2IH 4A3KH 1PH9A 3GD7A 1K73C 4A93G 3U4ZA 1PFSA 1N32Q 1KAWA 3PV0A 1TXYA 1X56A 3PUVA 5C0XG 2WB1E 1MKHA 2JA7H 1D7QA 3UDXA 2F4VQ 4IPHA 2VQEQ 3RLNA 4GNXB 1N34Q 1VQLA 1X3EA 4JOIC 4P73A 3S2DH 5JEAJ 3AQQA 4A3JG 5JJKA 1VQIA 2K5HA 4OWXB 4A3KG 1V1QA 4MNOA 4YCVA 3KJPA 1C9OA 1SRUA 1EIYB 3S17H 4DV5L 3F8TA 1X65A 4JI0L 1YHAA 3FP9A 2N78A 5IYBG 3OTOQ 4DV3L 4X64Q 2N3SA 1VQDA 4DV0Q 1IBMQ 3I7FA 5IYDG 3RN5A 3S14H 3UDFA 4HIOA 2ZTEA 1P8LA 2K4KA 2R92G 3TRZA 4JI4Q 3PO2G 1HNWL 4TQUS 1PVOA 1VQ7A 2QEXA 2UU9Q 1IBKQ 4POGA 1K8AC 1JJ2A 1X55A 4UY8C 1B7YB 3HOWG 2VQFQ 2OQ0A 1YIJA 2KCTA 4LF9L 3HOYH 3NBHB 2HIXA 1E7ZA 3HOYG 3J81j 3S2HH 2YV5A 4LF8Q 4DR3Q 4A93H 4HJ9A 3CF5A 5LMNQ 1IXRA 2VUMG 1XPOA 3HKZE 1BBWA 3HOUG 4DNIA 1GO3E 3CMEA 2OQKA 3CCQA 1Y1WH 1EFWA 4O0AA 3AFPA 4PZ8A 1PH4A 4APVA 5ELNA 1IBLL 4OWWB 1NTGA 5FLMH 1K8GA 4L5TA 1WOCA 4FDBA 2K5NA 2VQFL 1KQSA 1VQPA 1TWCH 4DV2Q 1I94Q 2WFWA 3F2CA 1Z9FA 3LGJA 3H15A 1B8AA 1CSPA 4UP7A 3CPFA 4NXMQ 2MQHA 1OXSC 2NZHA 5IY0A 4B3TQ 4P74A 4DV5Q 4R4OA 3CQZH 1L2FA 3J81c 1XNQL 1XMOQ 3GTQH 4YY3Q 2VW9A 4KHPL 3PUWA 3FKIH 1OXXK 1UE7A 1Q82C 3F2DA 2EIFA 4JYAQ 1MIUA 1VQHA 2OTLA 3I4NH 4DK6C 5FJ8H 5M5YH 1FVIA 5FJ8G 3U4VA 3ULPA 3PUYA 4JI0Q 2B29A 2WP8J 4OX9Q 1OXVA 3VDYA 1RIPA 2MO0A 1JB7A 1IBKL 3JC66 3D0FA 1HNZL 2K75A 2K50A 4NXNL 3UE1A 1QVCA 3DLLA 4QY7A 3A0JA 4K0KQ 1WCMH 5C44H 3E9HA 1JJGA 5AJ3L 3AEVA 3M7NA 2R7ZH 5BR8L 1VQ9A 2I0QA 2ZJPA 1G6PA 1CKOA 1UWVA 3E0EA 2AHOB 2Q2TA 3NELA 2Q2IA 1IZ6A 1NMGA 2PNHA 3HOVG 2ZTDA 3RLFA 4B3ML 3PO2H 1EYGA 4OO1G 2B3GA 4JI8Q 1CKNA 5M3FH 1BKBA 1IBLQ 4IFDI 1SLJA 2I5LX 3H3VH 4DV7L 2UXCL 5IWAL 1AH9A 1A0IA 5GADC 4DR3L 2NN6G 2WAQG 4B3SQ 1NY4A 2GVBA 5IYCG 4Y7NH 1XMQL 3STBC 4OXPA 3STBD 3U50C 4LFAL 2UUBQ 1PA6A 1YHQA 4GKKL 1VQGA 3S16H 3PCOB 4PMWA 2A1AA 1S3OA 1SFOH 3M85A 2E5LL 1L1OC 4DR5Q 3H0GH 3HOWH 1VQBA 4JI8L 5M3MH 4L5SA 4A3CH 4GOPA 4LUZA 4WJ3M 4R4CA 2ZJQA 2UUCQ 4UP8A 1HZCA 4JBMA 4JI6L 4X66L 1YHBA 3PF5A 4DR6Q 2JJQA 4NB3A 4NXML 4YCUA 1XNQQ 1I3QH 4LUOA 5GQOA 2N49A 1PH1A 1X3GA 4A3IH 3J80c 5FLXc 3HOUH 1LM0A 2Q2HA 3KOJA 5AJ3Q 2JQOA 3HFZB 5BR8Q 5M5XH 3G71A 3JAMc 1X54A 1OXUA 1N34L 1IYJB 1XTDA 4Y52H 2DUDA 3HKZG 4BBSG 4YWLA 4BBSH 2OCEA 3BJUA 2ZJRA 5LMUQ 5K36G 1CKNB 2CQOA 4K0KL 4BA2I 3CP0A 3TREA 1N33Q 2R93G 2ZM6L 2VY3A 4R1JA 5M5WH 3S15H 3TEHB 3NEMA 3CW2C 4A3LG 2R6GA 3CXCA 4DR1Q 1WJJA 4B3TL 4YCWA 4KLKA 4P72A 1V43A 1XMQQ 1XMOL 1X6OA 1YVCA 4YY3L 2Q2UA 3GTMH 4HIDA 1HNXL 4X65L 3CCSA 1HR0L 3W1BA 4NPSA 4TVAB 5GAHC 4QIWE 1C7YA 4IFDG 1PH2A 1XNRQ 4KHZA 4C2MH 2AWNA 1VQ8A 1CKMA 1HJPA 4A3JH 5GROA 1YEZA 1X9NA 1L0WA 4DR4L 3PSIA 2VUMH 2KBNA 4H02A 4HJAA 4BY1G 4L5RC 4DR6L 4NXNQ 4EQ5A 4A3FH 4LFAQ 2ATWA 4LUVA 5C4XG 1QUQA 1BBUA 4PZ6A 4A3EG 4A3EH 2JEAI 4B3RQ 1FJGQ 3KFUA 1E1OA 1Y14B 3KDFA 2K5VA 5J3BA 2GVAA 5IP9G 4DUYL 2BH2A 4A3GG 2PMZE 2JA6G 1VCIA 4ALPA 2JA6H 4A3BH 1Q1EA 1YJNA 4GOPC 1XJVA 4BY7G 1HZAA 4IO9A 1K83H 2RHQB 3HOXG 4DUZL 1WI5A 4A3IG 5C0XJ 1YITA 1PV4A 3RLOA 1JE5A 3IRBA 4GN3B 4JG2A 4LNQA 1T9HA 1FGUA 4UP9A 1XPUA 3RZDH 3TS2A 4X6AH 1LYLA 4QJFA 2Y0SE 4DV0L 1M90C 3F2BA 4DR2L 2I5MX 2IHFA 1J5EL 1E3PA 5H1SE 1OTCA 4DAYB 4LFBL 4DR1L 1TWGH 4JI4L 2B63G 2VZAA 1UE1A 4BBRG 3CCJA 5LMNL 1VQ4A 1UE5A 1O7IA 3BZKA 4YWKA 4A3DH 1H95A 1JT8A 5IE8A 4R4QA 1PYSB 2I5HA 1WCMG 5JEAG 5FLMG 2E5LQ 3M4OH 1D8LA 3M9BA 4BA1I 3GTOH 2NN6I 2C35B 3GTPH 1UEBA 3H3VI 3AYHB 2YTVA 2CWAA 4EX5A 3I4NG 1P16A 1Q86C 4GNXC 3ULJA 2YYZA 1Q12A 4A3MG 3UDGA 4A3DG 1HZ9A 5IP9H 2CCZA 3GTLH 2HHHQ 1E24A 1G51A 3SGIA 3KF8B 2K14A 4BXXH 2UXDQ 1KIXA 4HJ7A 1IBML 2V1CC 4B3RL 4GN5A 2KHIA 4MZ9A 1NMFA 4GNXA 5JJLA 3MXNB 2LXJA 1HNWQ 1GD7A 1VQKA 2NVXH 1I50H 3I4OA 4PZ7A 2Z6KC 1KD1C 4DR4Q 5E7NA 4DV4Q 4DUZQ 2UU9L 3T1YL 4JI5Q 4IOAA 1I6HH 2Y0SG 4LFCL 4LF6Q 2CFMA 4BXXG 4HIKA 4BY7H 5C4JH 2HHHL 4P75A 4DUYQ 3KYHC 5HY6A 1IL2A 2JA7G 1DGSA 2Z6KA 4A3MH 1N32L 2NVTH 1KHIA 1Y1WG 4JBKA 2PI2A 3BZCA 2HQLA 1PH6A 2JA9A 4DV6Q 3J7A5 4JCVE 1L1OA 3GDEA 4OONA 4HJ8A 3FKIG 4GKJQ 4OX9L 2LXKA 4DV1L 3CCMA 2UUAL 4ME3A 2E8GA 1A62A 4JI5L 1L1OB 4DV7Q 4GS3A 1SMXA 1VQEA 2IY5B 1Q7YC 2H5XA 4DR7L 1QZGA 4LF6L 2JEBI 4BBRH 1CSQA 5JJIA 3UE0A 1PH5A 2UXCQ 2MFIA 4IPDA 4JOIA 1YJWA 1E1TA 2NZOA 3NENA 1EOVA 3CCVA 3HOZG 2D0OA 1K3RA 1S72A 1C0AA 3MEFA 5IYBH 3PIPA 1CUKA 3CCRA 2PQAB 1BVSA 4A75A 3GO5A 3T1HQ 3K80C 4GKKQ 4JI1L 3S1RH 1OXTA 1N8RC 1N36Q 2UXDL 3E9IA 1NE3A 5EAYA 2PQAA 3AFQA 1X3FA 3CC2A 2Z0SA 3A5ZB 5LMUL 3HKSA 4MTNA 1HR0W 3RZOH 3I4MH 1E22A 4C3IH 4DR5L 3UDIA 3PO3H 1N33L 3F1ZA 4C3JH 2F4VL 3G6EA 4J15A 4KI0A 1HNZQ 1N9WA 1KRTA 3ICEA 1Q8KA 2KHJA 3JAMi 4OO1I 3W5OA 2HT1A 4IPGA 4GN4B 1VS0A 1VQ5A 4JI2L 4AYBG 3G48A 2ZTCA 3D31A 4LWCA 3GTKH 1JJCB 1Q46A 1VQFA 2NVQH 2CWPA 5DLQE 2UUCL 3T1YQ 4XTCS 4UPAA 4B3MQ 1ASYA 3ERSX 4LF7Q 2ASBA 3M4QA 4JBWA 1KL9A 4X64L 3HOZH 4GLAC 4A3LH 3CAMA 1NJIC 1YBYA 2PI2E 4L5QA 4R4IA 1YNXA 3PUXA 1HH2P 5C0XI 3ULLA 4LF8L 1KC8C 2R93H 4DV6L 5GAGC 1TWFH 3TS0A 1R9TH 2UUBL 5C4XH 1G291 4DK3C 4GKJL 5IYCH 4AYBE 2A8VA 2NVYH 4JI3L 3I4MG 2L15A 3PO3G 1NBWA 1EIFA 4JI1Q 4JI7Q 1J6QA 2VL6A 3L7ZC 5M3FG 4RMFA 3CD6A 3K81C 1YZ6A 3BU2A 4AH6A 3K8AA 3CC7A 4IOCA 2E2HH 1KRSA 3B6YA 1B70B 3K7AH 3EIVA 2YTXA 1ASZA 3EN2A 1YJ9A 3A74A 1MJEA 5IYDH 5IT9c 3K0XA 4LFCQ 3S1QH 1GM5A 5LMNW 3J80i 1UE6A 3K7UC 3HOVH 2KENA 3M3YH 4GLXA 1KXLA 1SE8A 4WJ4A 4JI3Q 3HOXH 3H0GG 2BH8A 3A5UA 4QL5A 3WWVA 4JI7L 2IHEA 1VQAA 1A63A 2MO1A 3L2PA 5HGQA 5GAEC 2RHSB 4B3SL 5IP7H 4OWTB 1JMCA 1Y1VH 1QUQB 4LF9Q 2F52A 2ZM6Q 4BY1H 3ZJYC 1QVGA 1PH3A 1PHJA 2GN5A 4KHPQ 2WB1G 3KJOA 3S1MH 4LF5Q 4IFDJ 4JYAL 2JA5H 3M4PA 4P71A 4DAMA 3CCLA 2D0PA 1U0LA 2OWOA 1HNXQ 3EBEA 2D62A 4A76A 3T1HL 1S40A 1WYDA 2BA0A 4LW1A 3OW2A 3S1NH 2XGTA 2IX1A 2JK8A 3J81i 4X66Q 2R7DA 1A8VA 2B63H 2HIVA 2F3IA 5M3MG 1W2BA 3W1GA 1Z47A 4YHHL 4DV2L 2R92H 1EQRA 1I94L 2JA5G 4C3HH 4PG3A 1QZHA 2UXBL 3FHWA 5C44G 3ER0A 3TQYA 4JV5L 4AIMA 2ID0A 4IJLA 4LF5L 2VS1A 1M1KC 2R7ZG 1MJCA 2N8NA 1Q1BA 4IPCA 3PUZA 1GKHA 3U58A 1XPRA 1SN8A 1SROA 4JBJA 2XTIA 3CCUA 4DV1Q 1PH8A 1K9MC 2UUAQ 4A4IA 1YI2A 1QVFA 4HJ5A 4QGUA 1VQNA 4DKAC 4GOPB 2CKZB 2AKWB 2RCNA 1TWHH 1Y1VG 2VQEL 4YHHQ 4LF7L 4AQYL 1EQQA 2QGQA 2IX0A 2MNAA 2R7FA 2AMCB 1I5FA 1EWIA 1AE2A 2LSSA 3I55A 2VNUD 3RNUA 1FL0A 1HZBA 4DR2Q 1VQMA 1K0RA 1SR3A 3J7ZC 4DV3Q 4O2DA 1J5EQ 3CC4A 4X65Q 1HR0Q 4LFBQ 1LUZA 4R4TA 3KDFB 1XNRL 3S24A 2BA1A 3KF6B 4X62Q 3PF4A 4XIGS 4HIMA 4JI6Q 3PIOA 2A19A 2K52A 2FXQA 3KF6A 3RR5A 2JE6I 3G4SA 4LF4Q 1TWAH 1RL2A 2DGYA 1VQJA
chains in the Genus database with same CATH superfamily
1U5KA 2JA8H 3SK4A 5IWAQ 3GTJH 2YU9H 2IT1A 1VQ6A 2KCMA 1SBBB 5ELEA 4KJNA 3ZYYX 2FMMA 2EXDA 4RGNA 4YWMA 4DAYA 4NP5A 4CKEA 2RSNA 1PH7A 4ZCKA 1T5EA 1V9PA 5C3EH 3CCEA 4ZKCB 2QA4A 2EQSA 2BCOA 2F0NA 1VMCA 1W3SA 2QCPX 4POFA 4DPGA 5ELOA 1VQCA 3I56A 3RN2A 2E2IH 3MVVA 1YNJD 4XDXA 2A68C 1N32Q 3SR1A 1KAWA 2Z6BA 4KKUA 5EBDA 1TXYA 1S5CD 2DJFC 2F4VQ 1VQLA 4GNXB 4PMBA 3S2DH 5JEAJ 3AQQA 2K5HA 4A3KG 4MNOA 1EIYB 1F77A 1ESFA 1YHAA 1FYCA 1PTOF 4M1UB 2F0MA 1IBMQ 3AB9A 3UDFA 4HIOA 5C3XA 1EY4A 4K5VA 3TRZA 1NSNS 3URYA 4KY7A 4Q5VA 4JI4Q 2QDBA 5HGTA 1SJHD 4POGA 1PLFA 4BS9A 4KHVA 5ELBA 2VQFQ 1QG7A 1EU3A 3AU7A 4N8FA 3S2HB 2YV5A 1SYEA 1SNOA 2KA7A 1EY5A 2X6LA 5LMNQ 4DFAA 1PTOC 3HOUG 3LWUA 5DM73 3AFPA 1IBLL 3DXJC 5ELNA 4APVA 5JEAH 2WIIB 4L5TA 2RBMA 2AUKA 1KQSA 1TWCH 1I94Q 4WJWA 3F2CA 1Z9FA 3LGJA 3H15A 2VUMB 4OGQC 4R9WA 1GHJA 1OXSC 2NZHA 4B3TQ 3T53B 3CQZB 4P74A 4R4OA 1BCPB 4QUFA 5KNCA 3PUWA 1UE7A 4DAVA 1BXTA 3F2DA 2ICIA 3D4DA 2N88A 3I4NH 5FJ8H 5M5YH 1FVIA 3MXGA 1RIPA 3TZUA 1IBKL 1LTRD 3DLLA 3A0JA 3KBXA 4K0KQ 1WCMH 3E9HA 5AJ3L 1AP0A 5LL6S 1LV9A 2F0IA 4HAEA 1DOKA 1ET6A 3MEHA 2B2TA 4HCSA 5FLXE 2AHOB 5IT9L 3NELA 2Q2IA 1IZ6A 4Q0FA 1SDFA 3HOVG 1IYVA 4B3ML 1K0SA 1EYGA 1BKBA 2C9OA 1SLJA 4X3SA 2OF1A 2D5DA 2EOTA 5EQ0A 2NN6G 3AMUA 3ERQA 4Y7NH 4A3GB 3STBC 4LFAL 1EEID 5M5XB 4NW2A 2I46A 1K3BC 3KLSX 1PA6A 2UUBQ 4GKKL 3S16H 3PCOB 4PMWA 2PO4A 3H3VC 2E5LL 4RGMA 2JA7B 2I07B 3H0GH 4JI8L 5M3MH 4A3CH 2F4IA 1LTGD 2ZJQA 4JBMA 4JI6L 3HGBA 4X66L 4BWGB 1EY9A 4LUOA 5GQOA 1PH1A 5FOBB 1B4OA 3KOJA 1R4QB 4OIKA 5BR8Q 2SNMA 4LMQD 4EVOA 2NYZD 1X54A 5C3EB 1MSHA 3HKZG 4BBSH 2F0QA 3BJUA 5C0XH 4K0KL 1QILA 1RDPD 3TREA 1N33Q 1A2TA 3J80L 3FEWX 2KQ3A 2ZM6L 2G9DA 4R1JA 1Y8NB 3H6MA 4HN7A 3CU7A 2R6GA 3CXCA 4OO1H 5KYLA 2D9UA 3K5NA 4P72A 4X3KA 1V43A 2Q2UA 2FMCA 4HIDA 1HR0L 1C7YA 4DXFA 3N52A 4WFN3 4C2MH 2AWNA 5HURA 1VQ8A 4L6TB 1GHKA 1B9MA 1Q8IA 5GROA 3PSIA 4HJAA 4DR6L 1LLRD 4EQ5A 4LUVA 1QUQA 5NUCA 4A3EH 2JEAI 1E1OA 1Y14B 5J3BA 2BH2A 3QOLA 2QKIC 2PMZE 2JA6G 5FO7B 3ONAB 1YJNA 1BCPF 1K83H 2IW3A 2RDFA 2RHQB 3NWSA 5EPJA 4DUZL 1WI5A 1PV4A 2Z8LA 2NZ1D 3IKJA 1H9SB 2HCCA 3HOYB 1T9HA 2K03A 1SYFA 2VXWA 3TS2A 3GV6A 1M90C 1KLGD 4MHEA 3F2BA 2I5MX 3I3CA 1NCVA 2KCNA 1E2WA 1ONLA 1ZYRC 4BBRG 1D5XC 3CCJA 2F03A 4A3DH 1UE5A 1O7IA 3UI2A 2L9HA 1PYSB 1EEFD 4FXGC 3M4OH 1GOZA 3GTOH 2CWAA 1FD7D 1I50B 4GNXC 1Q12A 1MD2D 3UDGA 2M9VA 3I72A 3GTLH 2K14A 2L12A 1KIXA 1IBML 2V1CC 4NMZA 2KHIA 4MZ9A 1VDZA 1HNWQ 2A5HA 4PZ7A 2KCCA 4DV4Q 2UU9L 4IOAA 1O7LA 2OXPA 2O5IC 1I6HB 3IFDA 4LFCL 2B2YC 1ICWA 4P2CB 4P75A 2Z6KA 1N32L 5FO9B 1STGA 4JBKA 2PI2A 4DV6Q 2QF7A 4OONA 4OX9L 2B2UC 1TS2A 2UUAL 1TT2A 1PTOB 1A62A 2ZXPA 4IURA 1STEA 5L37A 1STAA 1TU2B 4DR7L 1FNVA 4K14A 1QZGA 3Q24A 1RCVD 2A69D 3NQTA 5JJIA 2K05A 1JICA 2D0OA 1K3RA 1C0AA 4U68A 3MEFA 1TY0A 2PQAB 1F2LA 1JT8A 1OXTA 4XXEA 1DD2A 1CI3M 3A5ZB 2M2LA 3HKSA 5C3WA 4DR5L 2JYOA 1CZGA 2F4VL 4C3JG 3G6EA 3I91A 4KI0A 1HNZQ 1K8OA 2B2UA 3ICEA 3A8IE 4GN4B 4Z9CB 1VQ5A 4V0BA 2Z4HA 5EBCA 2ZTCA 3D31A 4LWCA 4C3JB 1VQFA 1HUNA 5DLQE 3X3NA 2UUCL 2RKSA 4O1NA 4RCNA 4RWSC 4B3MQ 1CZWA 4RGOS 1HTPA 4LF7Q 4CDCC 1EIHA 1BDOA 2ASBA 2A69C 3GTLB 1KL9A 4GLAC 4A3LH 2LS01 3CAMA 2JP1A 2PI2E 1NJIC 1YNXA 3PUXA 5C0XI 2R93H 2UUBL 5C4XH 3A55A 1G291 4U673 1V1PA 5C5LA 4HSVA 2NVYH 2RCFA 1EIFA 4JI1Q 4KN7C 2HDLA 4IOCA 3K8AA 5I2YA 3B6YA 1B70B 2WACA 2BOSA 3K0XA 4LFCQ 1I4QA 4UAIA 3K7UC 1KLUD 2DY8A 4BY7B 4B9XA 3SDZA 1CHQD 4C1NI 4GLXA 3M3YH 3KUPA 4JI3Q 4C56C 2ICEC 4I7AA 4L63B 2A6HD 1QB5D 4QF4A 5C4JB 2B2WC 4A3FB 3CRKC 5I6WA 2ZM6Q 3ZJYC 2LY7A 4ZRZA 4KHPQ 3J81L 3KJOA 4IFDJ 2EJMA 2EPBA 4RKBA 5EPKA 1SYDA 4P71A 4DAMA 2OWOA 1U0LA 3VR2A 4A76A 3T1HL 2BA0A 2KEDA 4QB4A 3S1NH 3VR6A 3J81i 1W2BA 4KY5A 2F0VA 4FNFA 3FVQA 3W1GA 1Z47A 4YHHL 4DV2L 2R92H 1EQRA 4C3HH 5FO8B 5C44G 1IKLA 4AIMA 5A2QE 2VS1A 1G2SA 2RQXA 1MJCA 4JK1C 1Y69U 3Q6SA 4G7ZC 1XPRA 4CBVA 2XNAC 1WTXA 1SROA 3DWQA 2UUAQ 4A3JB 4GOPB 2AKWB 4AQYL 4RGTA 1SNPA 1TWCB 2BE5D 4ME5A 1EQQA 2R7FA 1AE2A 3RNUA 4K8JA 2IPKD 1FL0A 1LO5D 1K0RA 1EY6A 2JSOA 5BN4A 4O2DA 1QNKA 3CC4A 1HR0Q 1LUZA 4R4TA 3KDFB 4CHTB 3NTHA 1I4PA 2BA1A 3KF6B 1J9OA 4IUTA 1SAPA 4HIMA 2K52A 3KF6A 2JE6I 1RHPA 3G4SA 1FGBD 1NR2A 2F0JA 4AYBB 4Y7NB 4A3GH 4IN3A 5CGKA 1G8ZD 4A3KB 1JWSD 3DM3A 4J8QA 1TIID 1GVPA 3L0OA 3SXHA 3KLWA 1VQOA 3GTGH 4S3SA 1LTLA 2J4XA 3SE0A 1B2TA 2AWOA 1TWAB 2AUJD 1WTQA 1I6VC 4LF4L 1Q81C 1EUJA 4DV4L 2SEBD 3A7LA 1RTNA 5I9OA 2EY5A 3S2DB 2ALYB 2B2TC 1K73C 3U4ZA 1PFSA 5IGDA 1TQOA 1CTMA 1U4LA 1X56A 3KF8A 3PUVA 4RA8A 5C0XG 3I4NB 3D4RA 3EJIA 4DNTB 1D7QA 3RLNA 5D14A 1N34Q 1SYBA 1X3EA 3SEBA 1VQIA 4IUQA 1SRUA 2XVSA 3FP9A 4I65A 2N78A 1MSGA 2RDGA 2NWGA 3S14H 1TVXA 1P8LA 2K4KA 5KYIA 2R92G 2NBFA 3PO2G 1D1IA 1HNWL 1PVOA 1VQ7A 2UU9Q 1X55A 1FR3A 2L5TA 1YIJA 2KCTA 3Q23A 4CDFC 2E76C 4LF8Q 3MAQA 3TMEA 3CF5A 3QIAA 2VUMG 3HKZB 4ULLA 3HKZE 1BBWA 1PYWD 2EVBA 1EFID 2F0DA 1EFWA 3K58A 5FKAC 5D3IB 4OWWB 3R3OA 1EZ6A 2BDNA 2K04A 1SNQA 1EYAA 5CV6A 4NXMQ 2MQHA 5IY0A 1JOQA 1A3TA 4DV5Q 3GTQH 1EWHA 1CQFA 2KVMA 1YNJC 2EYOA 3FKIH 1OXXK 1Q82C 4JYAQ 2OTLA 1MI2A 4DK6C 5LHY1 3U4VA 1LTSD 3ULPA 3J7AF 3GTGB 4OX9Q 2H4OA 1PMRA 2MO0A 1HNZL 3D0FA 2K50A 4NXNL 2AQ1B 1LTAD 1JJGA 2B8FA 2PZUA 5BR8L 2I0QA 1G6PA 2MJ8A 4PMCA 1EYDA 1QNUA 3PO2H 1PZID 2EJGC 4JI8Q 2EYFA 1PFNA 1CKNA 5M3FH 4IFDI 2F0LA 1A3UA 5IWAL 4DR3L 2E74C 4B3SQ 5DEHA 1DZ1A 3K6OA 1DXMA 1YHQA 4OEMB 1VQGA 2A68D 2PMZB 3HOXB 2A1AA 3TN2A 4TKOB 3HOWH 1JB3A 3VYUA 5EGTA 2ZXOA 2UUCQ 4KD4A 1KAAA 3PF5A 3S15B 4NB3A 4NXML 1B1ZA 5G3LF 2EZVA 1XNQQ 1I3QH 4CKCA 4A3IH 2A74C 4WORA 4KKSA 5BN5A 5M5XH 3NTKA 1TS3A 3HRZC 3C3LA 1N34L 3N6RA 2DUDA 4BBSG 2A6ED 3R93A 5LMUQ 4K6DA 4BA2I 2XWBB 3S15H 3T4AC 3CW2C 5JAVA 3GP7A 4B3TL 5DAUA 4KLKA 4X3TA 1XMQQ 1H9MA 2F3WA 3JAML 3S9WA 4TVAB 5M3MB 3EFXD 1PH2A 1CKMA 1IHZA 2JA6B 1MGSA 3BVMA 3P1HA 1TS4A 3VYTA 1WVLA 2B2VC 2KBNA 2K33A 2EYPA 2ATWA 2WB1B 5C4XG 4A3EG 5IP9G 4A3GG 3V2TA 4HSPA 4ALPA 4RH6A 4GOPC 1XJVA 1HZAA 4IO9A 1D1KA 1JE5A 4GN3B 4JG2A 3T13A 4FF1A 2QDLA 1XPUA 3RZDH 3Q22A 1LYLA 4QJFA 2Y0SE 4CGYB 4DV0L 3TP8A 1E3PA 5H1SE 3HOUB 4DR1L 4NDXA 2B63G 4A3MB 2VZAA 3BZKA 4YWKA 1BCPD 1H95A 2EY2A 5IE8A 1AZQA 5JEAG 2E5LQ 4EQOA 3VYSA 4BA1I 2NN6I 2C35B 3GTPH 1B44D 1UEBA 3H3VI 3AYHB 1EZ8A 1II3A 1STYA 2YYZA 1SNMA 4A3MG 5T1GA 1HZ9A 5IP9H 2CCZA 1E24A 4C3IG 1G51A 1LT6D 5E4WC 4B3RL 4IUVA 1NUCA 2L11A 4GN5A 1H9JA 4GNXA 2NVQB 4F87A 3MXNB 2NVXH 4DR4Q 2Z6KC 4ZQ3A 5E7NA 3MXNA 4JI5Q 1NR4A 2Y0SG 4BXXG 1Y1VB 2F0GA 2HHHL 4DUYQ 1GUOA 3K7AB 3V05A 4FP5D 1QJOA 1KHIA 3MXPA 1WTVA 2HQLA 3J7A5 4JCVE 3LWEA 2K5QA 4GKJQ 4DV1L 1VQEA 4X3UA 2JEBI 4BBRH 3L9AX 4PQXA 3UE0A 1HRJA 2UXCQ 4IPDA 4JOIA 1YJWA 1E1TA 3J7YW 2O4XA 3HEJA 5IYBH 1EL0A 3QR8A 2Z1CA 3GO5A 3K80C 4A3EB 3S1RH 1N8RC 2UXDL 3E9IA 1NE3A 1ENCA 3CC2A 4MTNA 1E22A 4H7BA 1N33L 4CJ0B 4C3JH 2J7ZA 2Q8RE 3WOEA 1Q8KA 4IZ8A 1XWEA 4OO1I 3SHLA 4JI2L 1FNUA 1I4GA 1KDCA 3G48A 3GTKH 2NVQH 3TP6A 4ABNA 3T1YQ 3S1RB 4UPAA 3CHBD 1JORA 3M4QA 4JBWA 1I4XA 3GV3A 5EPLA 2LFNA 1A3VA 1EY0A 1C8CA 1HH2P 4LF8L 1HPCA 2MP1A 4A3DB 3A7AB 4GKJL 4HEDA 2XWJB 1QE6A 3K0YA 2A8VA 1IW7D 1NBWA 1AFPA 1F2YA 4JI7Q 2VL6A 1JE4A 2M00A 4RMFA 3CD6A 4RHSA 3NSWA 5IIFA 3K7AH 1ZXTA 1S5DD 1MJEA 1GM5A 5LMNW 3R8BA 3RZDB 1XXGA 4OL7A 2JA5B 1HXYD 3J81E 1QCBD 3MWYW 1KXLA 1FNWA 1SE8A 1UAPA 4WJ4A 1BNZA 3A5UA 3MFYA 5ISRA 2IHEA 3RZOB 1A63A 5HGQA 3EROA 5GAEC 2RHSB 4B3SL 4LF9Q 2F52A 3DM1A 3MXUA 4XQJA 4BY1H 3MC0B 2DNEA 2F0WA 4B9WA 1PHJA 2WB1G 3OIPA 5C4XB 1SSOA 2P5ZX 2JA5H 5JPNC 3M4PA 4R8NA 3M3YB 1ILQA 1S5BD 3E3XA 2IX1A 1I4RA 4MN3A 5JJZA 2HIVA 1E2VA 2G9HD 3K59A 1Z6HA 3VR3A 1QZHA 1LT4D 2ID0A 4LF5L 2R7ZG 3EA6A 1M1KC 3DUZA 1GKHA 1SE3A 2QW7A 3LNNA 4DV1Q 1QVFA 4HCEA 2K32A 3NE5B 4HJ5A 1VQNA 1I4HA 4FYDA 1UNSA 3D6WA 3QO2A 5KNBA 2JXMB 4LF7L 3V96A 1HA6A 1W6JA 2QGQA 1CA5A 2AMCB 3VYRA 2VNUD 4DV3Q 4LFBQ 1XNRL 2EYHA 2EYMA 3S24A 1C4QA 1Y8OB 4XIGS 1SFOB 3PIOA 2PYKA 3RR5A 3KBGA 4G57A 4V190 3BDCA 3PUZA 1RL2A 4DV7L 4MIUA 2F0KA 4DR7Q 4GLVB 3P7JA 4IJHA 2KEEA 3A54A 2ES2A 2OTJA 1AE3A 4RG1A 4JI2Q 2L4NA 4A3FG 2SNSA 2WAQE 1WFQA 2WAQB 3PGZA 4FXDA 3O13A 3CMAA 4KV6A 4X62L 2R3ZA 4QCLA 4QQBX 4G7OC 3SK5A 1N36L 5CV9A 1PRTD 3CPWA 3DMUA 2UXBQ 3OYYA 1PYBA 3QWNA 2DY7A 1S4ZA 4A3CG 3Q8DA 2FFKB 5A35A 3T16A 3D8GA 4A3KH 3GD7A 1ESRA 3K57A 2B8GA 4UDUC 1EU4A 4I7ZC 1DYQA 1EQVA 2EYJA 3D4WA 2F0UA 4JOIC 3U9OA 5E3FA 4A3JG 5JJKA 2XSCA 1QOHA 1V1QA 4DV5L 1X65A 4JI0L 5I9PA 3OTOQ 5IYBG 1SE4A 4DV3L 1T5XD 4X64Q 5AFWA 1M4VA 1VQDA 4DV0Q 2LMCB 3RN5A 3NBIA 5IYDG 2XIWA 3LX0A 2ZTEA 1R4PB 2SDFA 1TY2A 1CA6A 1EY7A 4H13C 4M8AA 2QEXA 1IBKQ 1K8AC 1JJ2A 5E4XA 1B7YB 3F2UA 5M5YB 4KMUC 2PPBC 5DM63 3HOWG 2OQ0A 4XYOA 1LABA 3MA2B 1TS5A 3NBHB 2HIXA 1E7ZA 1Q90A 2KOLA 3K5MA 3HOYG 3KLSA 4DK1A 4DR3Q 3TP7A 1JQYD 4HJ9A 1CHPD 4BY1B 1GUNA 2NUCA 4J1MA 3PMFA 1PFMA 1TWGB 1GO3E 3CMEA 2OQKA 3CCQA 2KJXA 2O2LD 3FMCA 5FLMH 1WOCA 4FDBA 5CBEE 2K5NA 1TWHB 2VQFL 1VQPA 4DV2Q 2WFWA 1B8AA 1CSPA 2R61A 4UP7A 1RTOA 4FVMA 4FF4A 3CQZH 1L2FA 3J81c 1XNQL 1XMOQ 4YY3Q 4K5WA 4HTHA 2VW9A 4KHPL 1PRTF 2CQAA 2EIFA 1VQHA 4TSSA 3W3AA 2B29A 4G7HC 3NXWA 3VDYA 1JB7A 3JC66 3OHXC 3UE1A 1QVCA 2LKVA 3P75A 4F7XA 1QWYA 4OIJA 5C44H 3EQLC 5ELCA 1VQ9A 1WD0A 5IGGA 2GA4B 2F3VA 1UWVA 3HS0C 4FF3A 1GUSA 1ML0D 2HUGA 4CDDC 1U4RA 1NMGA 2E75C 1IKMA 2MGSA 3TBIB 3K5LA 5GADC 3IFTA 2CH4A 2EYLA 2EY6A 3PIO3 1XMQL 2PZWA 2E2IB 2OT2A 1S3OA 5CBAE 1EYCA 4WRDA 1L1OC 5EKLA 4LUZA 4WJ3M 4UP8A 1HZCA 4DR6Q 3DEPA 4C3IB 4YCUA 1K28A 3VR5A 2N49A 1X3GA 3J80c 5FLXc 2Q2HA 3L3OC 1PDQA 2JQOA 3MFGA 3D6CA 1DONA 3P20A 3JAMc 4K6LA 1XTDA 4IQZA 2ZT9C 4XYQA 2OCEA 2ZJRA 1SYCA 2CQOA 5IOCA 4RKLA 1F9PA 3TEHB 2R92B 4DR1Q 2KHSA 4YCWA 1XMOL 1X6OA 1YVCA 3GTMH 2K1BA 1WTOA 3CCSA 1TWFB 4NPSA 3W1BA 1XNRQ 1WTHA 5C44B 1X9NA 4DR4L 4ZKBB 1RD9D 4NXNQ 4E6IA 4A3FH 1CQVA 4PZ6A 4B3RQ 4DUYL 2K5VA 2GVAA 3C1EA 5F2DA 5KNDA 4BY7G 1K83B 4RAUC 3HOXG 4A3IG 5C0XJ 1YITA 3RLOA 3G7LA 3IRBA 1WCMB 4TRDA 1RJTA 2SOBA 3M4OB 1JOKA 2R7ZB 4X6AH 1IYUA 3OPOA 5KGUA 4N9PA 1F9SA 1V1OA 3D3RA 2IHFA 2E2DC 4HMJA 1HCZA 1OTCA 4DAYB 4LFBL 4K2KA 1TWGH 4JI4L 1HUMA 1HFGA 5CV8A 5LMNL 2F0PA 1SXTA 1WCMG 1BO0A 3M9BA 5C5MA 2YTVA 4EX5A 1O7YA 1P16A 4LJZC 2JN4A 2PQEA 2CH4W 4A3DG 1JCKB 3HOVB 1H9RA 4KKTA 3SGIA 3KF8B 2IWHA 2UXDQ 4HJ7A 3HZXA 1Z7TA 4ZUJA 1S5FD 4PV1C 1GD7A 1KD1C 1X3PA 5D65A 3T1YL 3H09A 4ODGA 1I6HH 3GTPB 1YNND 3PIP3 1LTTD 2CFMA 3VR4A 2EE1A 5HY6A 4BBRB 2JA7G 4A3MH 1PXUA 5I6YA 2Z9HA 5TSSA 1PH6A 3NK9A 1L1OA 2K7VA 3GDEA 4ZK9B 5M3FB 2LXKA 2E8GA 3S1NB 1WD1A 1L1OB 2CHBD 4GS3A 4IALA 2IY5B 1Q7YC 2H5XA 4LF6L 4HR7B 1SYGA 2DJGC 2RDHA 4XT3B 1PH5A 4LK1C 1EOVA 5T1IA 3CCVA 5KIXA 1ENAA 4F88A 5K5PA 5KRUA 1CUKA 4A75A 3VA5A 4GKKQ 4JI1L 2NVXB 2B63B 1BCPC 3AFQA 5LMUL 1HR0W 3I4MH 3PO3H 4C3IH 3UDIA 3F1ZA 4J15A 3H94A 1N9WA 1EOTA 1B3AA 2KHJA 3M4YA 5K36H 3TZDA 3NHHA 1J8IA 5E1FA 4AYBG 2WKDA 3SK8A 4IUNA 3ND8A 1JJCB 3GTKB 1Q46A 1G2TA 5LL6X 1U9RA 3I90A 1HQMC 2E2HB 1ASYA 3ERSX 3OSOA 1RF2D 2PNRC 2XRSD 4KJOA 1O7ZA 3IL8A 3NBHA 1YBYA 2L1BA 4OHJA 3OWEB 1SNDA 4C1NK 1Y8PB 1TWFH 3TS0A 5A2QL 4FO2A 3J7AV 3I4MG 2F0TA 4JI3L 3PO3G 1LT3D 2OEOA 1J6QA 5CV5A 5M3FG 3K81C 5I2XA 3CC7A 4AH6A 1KTKA 4ZLTF 5CV4A 1KRSA 2FHTA 1EQTA 3EN2A 4ILWA 2RA4A 3A74A 1YJ9A 5IT9c 2R93B 5IYDH 3S1QH 1UE6A 1IL8A 1X3QA 4FF2A 4FXKC 3EVQA 1GXDC 4YIJA 3H0GG 2BH8A 4QL5A 3MZ5A 5ELFA 1BBXC 1VQAA 2MO1A 2EDGA 3L2PA 1BQQT 5IGEA 2J0TD 5IP7H 4OWTB 1Y1VH 2A6HC 1QUQB 2TMPA 1JC7A 3OW7A 3MHBA 3S1MH 4DAPA 3CCLA 2D0PA 1IW7C 1SNCA 2H1EA 3EBEA 1ET9A 1S40A 5I4DA 3OW2A 1PTOH 2XGTA 2JK8A 1H9SA 2HD3A 2R7DA 2B63H 3SK6A 1ZKOA 2F1MA 1KDAA 2XN9C 3MTSA 2UXBL 3FPUB 3BDOA 3ER0A 3TQYA 3GTJB 4J6HA 2KUMA 4IJLA 1Q1BA 3JAME 3U58A 3NQIA 2XRQD 4JBJA 3HOWB 1PH8A 3CCUA 1JWMD 4C3HG 4DKAC 5J39A 2RCNA 5FLXL 1Y1VG 2VQEL 2AQ3B 3U9SA 3E6ZX 2MPMA 2MNAA 1JWUD 5M9OA 1EWIA 2LSSA 4IFDH 4DR2Q 1J5EQ 3J7ZC 1SR3A 1C48A 4ID6A 4JI6Q 1CT1D 2K5DA 2A19A 3Q0AA 2FXQA 3FRPB 5C6AA 3I4LA 5FK9C 2K6AA 1TWAH 4LF4Q 3CRLC 2DGYA 3I4MB 3PO3B 3BVGA 1PZKD 2K01A 2JA8G 5IP7G 4A3BG 3I2ZA 1GUTA 1FJGL 3A8JE 1TR5A 1U4MA 5D3DA 4JV5Q 4DXGA 3R2TA 4KN4C 5IODA 2NVTB 4JC0A 4EQPA 2RF4A 1B3QA 2YTYA 4DU9A 2KECA 3GTOB 2B2WA 2JA8B 4DN4M 4NKLA 1CFMA 5C3EG 2E2JH 2O5JC 1F2MA 1KDBA 4DA2A 3DEOA 2BE5C 1GUWA 1KABA 3DWAA 3S1MB 2F0OA 2Q8IB 4AQYQ 3OTOL 1PH9A 4A93G 3PV0A 1HFNA 3KK7A 2WB1E 1MKHA 2JA7H 2VB2X 3UDXA 4IPHA 2VQEQ 4P73A 3RMHA 4OWXB 3VA7A 3NTIA 5JVG3 4YCVA 3KJPA 1C9OA 2RVLA 3S17H 4A93B 3F8TA 2ZXRA 1M8AA 2N3SA 3I7FA 3IAYA 1B50A 2Q8TA 3OWFA 1F9RA 5C4ZA 3ITPA 3QG1A 4TQUS 4KK7A 1BOSA 4ZAIA 2FJ2A 4UY8C 3OMGA 2EXZA 2B2YA 4LF9L 1GUGA 3HOYH 3S2HH 3J81j 5IGFA 4A93H 3S17B 4O42A 4EGVA 4A3BB 1BR9A 5J22A 1IXRA 1XPOA 3BS1A 1STHA 1V1PB 2FINB 4DNIA 3H91A 1Y1WH 4O0AA 4PZ8A 1PH4A 1STBA 1NTGA 1K8GA 4N9TA 1JR0D 4EQNA 5G3LD 5JVH3 1F2ZA 5EKIA 1PRTC 2PW5A 3BG3A 4IUUA 3CPFA 5CYUA 3E5SA 2AQ2B 1D6EC 2IX3A 1LT5D 2NTSA 1MIUA 1ILPA 4B08A 5FJ8G 3PUYA 3H0GB 5CMDA 2WP8J 1OXVA 1RODA 2K75A 1E2ZA 4RFBA 3GTQB 1U4PA 4CDEC 5CV7A 4QY7A 1G6ZA 2QILA 3I70A 1XYIA 3KLRA 3AEVA 2E2JB 3M7NA 2R7ZH 2K5WA 3QJYA 2ZJPA 1K8MA 3GTMB 1CKOA 2MHVA 1PFBA 1B9NA 3E0EA 2Q2TA 1ENFA 1WTRA 3BYYB 2PNHA 2ZTDA 3RLFA 1S5ED 4OO1G 2B3GA 1IBLQ 1F9QA 2I5LX 3H3VH 4BBSB 1AH9A 2UXCL 1A0IA 2B39A 2WAQG 1NY4A 2GVBA 5IYCG 1EWCA 4OXPA 3STBD 3U50C 2QEJC 1SFOH 3M85A 1PTOD 2WINB 4DR5Q 3HG9A 1VQBA 4L5SA 4GOPA 4R4CA 1LACA 3BYTB 3E0JA 1YHBA 5KEEA 5M5WB 2JJQA 4JW0A 4QUCA 3HOUH 1LM0A 1D2BA 5AJ3Q 4RHRA 1O78A 2CW0D 3WOFA 3HFZB 3G71A 3NWTA 4C2MB 4H0LC 4KTAA 1OXUA 4Y52H 1IYJB 3OMCA 1H9KA 4YWLA 5K36G 1MBYA 1CKNB 4A3IB 2R93G 3CP0A 1DOLA 2PW7A 2VY3A 5M5WH 3NEMA 2Z4IA 2YU9B 5CR3A 4A3LG 2D2CC 1WJJA 4YY3L 5IGCA 4X65L 4LAAA 1HNXL 1CM9A 1R9TB 5GAHC 4IFDG 4QIWE 3C1FA 1AEXA 4KHZA 3WDNA 1HJPA 4A3JH 2V4DA 1A6XA 4PNYA 5J1ZA 1AW7A 3HOZB 1YEZA 3T51B 1L0WA 2VUMH 4H02A 4L5RC 4BY1G 4LFAQ 4K2LA 1BBUA 1SJED 2EY1A 1FJGQ 3KFUA 3KDFA 1L0XB 1XX8A 1A15A 1D5MC 3NPPA 3FKIB 1VCIA 2JA6H 2NB0A 4A3BH 1Q1EA 2CVRA 4H44C 3RUZA 4IUPA 5CORA 2A73B 2K28A 1WTPA 1OO9B 4LNQA 1FGUA 3PQIA 4UP9A 4MTKA 4DR2L 1PRTB 1J5EL 3J80E 3FDTA 2IL8A 4CJ2C 4UHVA 3S14B 3NP8A 1UE1A 1ZYRD 1VQ4A 1ZEQX 2C5CA 2L55A 1DOMA 4R4QA 2I5HA 5FLMG 1WTWA 2BDOA 2TSSA 1D8LA 4XT1B 2A6EC 3I4NG 4L8JA 1Q86C 3ULJA 1ICFB 2HCIA 2HHHQ 1NAPA 4BXXH 2EJFC 1NMFA 5JJLA 2PCFB 2LXJA 3I73A 1VQKA 1I50H 3I4OA 1UEAB 4DUZQ 1XTCD 5EJWA 1BUVT 4LF6Q 3CKIB 4HIKA 1I3QB 4BY7H 1SE2A 5C4JH 3KYHC 1MHWC 4GZYC 1IL2A 1DGSA 1W6KA 2CW0C 2NN6H 2NVTH 1Y1WG 3BDLA 3BZCA 3K5OA 2JA9A 2B2VA 4HJ8A 1E0BA 2HDMA 3FKIG 2PZTA 3CCMA 1JOOA 4ME3A 3TSSA 4JI5L 4DV7Q 4N8X1 4DF7A 1SMXA 4F8MA 3TP5A 3M7GA 1CSQA 4XQQA 3S1QB 4ZYSA 2WKCA 2MFIA 2NZOA 3NENA 5IT9E 3HOZG 3FPPA 3W2DA 1S72A 1RKNA 3PIPA 3CCRA 4HMIA 1BVSA 4DNRB 3T1HQ 1N36Q 5EAYA 2PQAA 1X3FA 2Z0SA 3RZOH 1B53A 3OIQA 4ZUIA 1KRTA 1KNEA 3T56B 1X32A 3JAMi 3W5OA 2HT1A 4IPGA 1EIGA 1VS0A 3X3MA 5CC4A 4JPBW 1TKWB 4RCOA 1G91A 2F0SA 2CWPA 3BZDB 4K5XA 3ND9A 4XTCS 1AZPA 1STNA 2F0EA 4XQNA 3RD4A 3A56A 1DCZA 4X64L 3HOZH 1YNNC 3HP3A 4R4IA 4L5QA 4QMGA 5JOBA 3ULLA 5C4HA 3QB3A 1KC8C 4DV6L 5GAGC 1R9TH 4DK3C 5IYCH 4AYBE 3NUCA 4KD3A 1Y1WB 1UUPA 2RSOA 2L15A 5COYA 1L0YB 3PO2B 3L7ZC 2F0HA 1YZ6A 3BU2A 2E2HH 1PZJD 3EIVA 2YTXA 4QIWB 1ASZA 1BF4A 5IGBA 1HHVA 3J80i 2DN8A 4R8IA 1VF5C 4DGZA 4OELB 3HOVH 1HA5A 1VMPA 2KENA 3BVZA 3G6JB 1AN8A 1NNXA 1LTBD 1VF7A 3HOXH 1EY8A 2F0FA 1D5ZC 3WWVA 4JI7L 3SVMA 3R2IA 1DJRD 4C3HB 2NTTA 1LTID 1JMCA 1HTLD 5EKKA 2L0CA 1CK1A 1HQRD 4G4KA 5JPMC 1QVGA 1PH3A 2GN5A 4LF5Q 2N55A 2IJ0A 4JYAL 5ELDA 4JVZA 1HNXQ 3C2PA 2D62A 1O80A 4K8IA 1V8QA 1WYDA 2Y0SB 4LW1A 1A2UA 3GQBA 4CKBA 4X66Q 5BN3A 1A8VA 1GJXA 2F3IA 5M3MG 1KNAA 3A8KE 3I8ZA 3DWPA 1I94L 2JA5G 4PG3A 3FHWA 3DHQA 4JV5L 1Q3LA 2WV6D 2N8NA 4IPCA 1SN8A 4DK0A 2VB3X 2X6GA 4KY6A 2XTIA 1K9MC 4A4IA 1YI2A 4QGUA 1SEBD 2CKZB 1TWHH 4YHHQ 2IX0A 1I5FA 3TDQA 3I55A 1HZBA 2DNCA 2ENBA 1VQMA 3OOCA 3QOJA 4X65Q 2NVYB 1SMYC 3C46A 1SMYD 2HQEA 3S16B 3PF4A 4X62Q 4CJ1B 2X69A 2MUYA 2G5DA 5DNFA 1DM0B 4JI0Q 1VQJA
chains in the Genus database with same CATH topology
1U5KA 2JA8H 4A3GH 2JA8G 4DR7Q 5IWAQ 4GLVB 4IJHA 3GTJH 2YU9H 5IP7G 4A3BG 2IT1A 3I2ZA 1VQ6A 2ES2A 1FJGL 2OTJA 1AE3A 4RG1A 2KCMA 4JI2Q 3DM3A 4A3FG 1GVPA 3L0OA 4JV5Q 2WAQE 1WFQA 3KLWA 3PGZA 4JC0A 3CMAA 1VQOA 2EXDA 4YWMA 3GTGH 1LTLA 4X62L 2AWOA 2RF4A 2YTYA 1PH7A 4QQBX 1N36L 4LF4L 1V9PA 1EUJA 5C3EH 5C3EG 3CCEA 1Q81C 2E2JH 2QA4A 2EQSA 3CPWA 4DV4L 2UXBQ 3OYYA 1PYBA 1W3SA 4POFA 4A3CG 3Q8DA 4DPGA 4AQYQ 5ELOA 1VQCA 3OTOL 2ALYB 3I56A 3RN2A 2E2IH 4A3KH 1PH9A 3GD7A 1K73C 4A93G 3U4ZA 1PFSA 1N32Q 1KAWA 3PV0A 1TXYA 1X56A 3PUVA 5C0XG 2WB1E 1MKHA 2JA7H 1D7QA 3UDXA 2F4VQ 4IPHA 2VQEQ 3RLNA 4GNXB 1N34Q 1VQLA 1X3EA 4JOIC 4P73A 3S2DH 5JEAJ 3AQQA 4A3JG 5JJKA 1VQIA 2K5HA 4OWXB 4A3KG 1V1QA 4MNOA 4YCVA 3KJPA 1C9OA 1SRUA 1EIYB 3S17H 4DV5L 3F8TA 1X65A 4JI0L 1YHAA 3FP9A 2N78A 5IYBG 3OTOQ 4DV3L 4X64Q 2N3SA 1VQDA 4DV0Q 1IBMQ 3I7FA 5IYDG 3RN5A 3S14H 3UDFA 4HIOA 2ZTEA 1P8LA 2K4KA 2R92G 3TRZA 4JI4Q 3PO2G 1HNWL 4TQUS 1PVOA 1VQ7A 2QEXA 2UU9Q 1IBKQ 4POGA 1K8AC 1JJ2A 1X55A 4UY8C 1B7YB 3HOWG 2VQFQ 2OQ0A 1YIJA 2KCTA 4LF9L 3HOYH 3NBHB 2HIXA 1E7ZA 3HOYG 3J81j 3S2HH 2YV5A 4LF8Q 4DR3Q 4A93H 4HJ9A 3CF5A 5LMNQ 1IXRA 2VUMG 1XPOA 3HKZE 1BBWA 3HOUG 4DNIA 1GO3E 3CMEA 2OQKA 3CCQA 1Y1WH 1EFWA 4O0AA 3AFPA 4PZ8A 1PH4A 4APVA 5ELNA 1IBLL 4OWWB 1NTGA 5FLMH 1K8GA 4L5TA 1WOCA 4FDBA 2K5NA 2VQFL 1KQSA 1VQPA 1TWCH 4DV2Q 1I94Q 2WFWA 3F2CA 1Z9FA 3LGJA 3H15A 1B8AA 1CSPA 4UP7A 3CPFA 4NXMQ 2MQHA 1OXSC 2NZHA 5IY0A 4B3TQ 4P74A 4DV5Q 4R4OA 3CQZH 1L2FA 3J81c 1XNQL 1XMOQ 3GTQH 4YY3Q 2VW9A 4KHPL 3PUWA 3FKIH 1OXXK 1UE7A 1Q82C 3F2DA 2EIFA 4JYAQ 1MIUA 1VQHA 2OTLA 3I4NH 4DK6C 5FJ8H 5M5YH 1FVIA 5FJ8G 3U4VA 3ULPA 3PUYA 4JI0Q 2B29A 2WP8J 4OX9Q 1OXVA 3VDYA 1RIPA 2MO0A 1JB7A 1IBKL 3JC66 3D0FA 1HNZL 2K75A 2K50A 4NXNL 3UE1A 1QVCA 3DLLA 4QY7A 3A0JA 4K0KQ 1WCMH 5C44H 3E9HA 1JJGA 5AJ3L 3AEVA 3M7NA 2R7ZH 5BR8L 1VQ9A 2I0QA 2ZJPA 1G6PA 1CKOA 1UWVA 3E0EA 2AHOB 2Q2TA 3NELA 2Q2IA 1IZ6A 1NMGA 2PNHA 3HOVG 2ZTDA 3RLFA 4B3ML 3PO2H 1EYGA 4OO1G 2B3GA 4JI8Q 1CKNA 5M3FH 1BKBA 1IBLQ 4IFDI 1SLJA 2I5LX 3H3VH 4DV7L 2UXCL 5IWAL 1AH9A 1A0IA 5GADC 4DR3L 2NN6G 2WAQG 4B3SQ 1NY4A 2GVBA 5IYCG 4Y7NH 1XMQL 3STBC 4OXPA 3STBD 3U50C 4LFAL 2UUBQ 1PA6A 1YHQA 4GKKL 1VQGA 3S16H 3PCOB 4PMWA 2A1AA 1S3OA 1SFOH 3M85A 2E5LL 1L1OC 4DR5Q 3H0GH 3HOWH 1VQBA 4JI8L 5M3MH 4L5SA 4A3CH 4GOPA 4LUZA 4WJ3M 4R4CA 2ZJQA 2UUCQ 4UP8A 1HZCA 4JBMA 4JI6L 4X66L 1YHBA 3PF5A 4DR6Q 2JJQA 4NB3A 4NXML 4YCUA 1XNQQ 1I3QH 4LUOA 5GQOA 2N49A 1PH1A 1X3GA 4A3IH 3J80c 5FLXc 3HOUH 1LM0A 2Q2HA 3KOJA 5AJ3Q 2JQOA 3HFZB 5BR8Q 5M5XH 3G71A 3JAMc 1X54A 1OXUA 1N34L 1IYJB 1XTDA 4Y52H 2DUDA 3HKZG 4BBSG 4YWLA 4BBSH 2OCEA 3BJUA 2ZJRA 5LMUQ 5K36G 1CKNB 2CQOA 4K0KL 4BA2I 3CP0A 3TREA 1N33Q 2R93G 2ZM6L 2VY3A 4R1JA 5M5WH 3S15H 3TEHB 3NEMA 3CW2C 4A3LG 2R6GA 3CXCA 4DR1Q 1WJJA 4B3TL 4YCWA 4KLKA 4P72A 1V43A 1XMQQ 1XMOL 1X6OA 1YVCA 4YY3L 2Q2UA 3GTMH 4HIDA 1HNXL 4X65L 3CCSA 1HR0L 3W1BA 4NPSA 4TVAB 5GAHC 4QIWE 1C7YA 4IFDG 1PH2A 1XNRQ 4KHZA 4C2MH 2AWNA 1VQ8A 1CKMA 1HJPA 4A3JH 5GROA 1YEZA 1X9NA 1L0WA 4DR4L 3PSIA 2VUMH 2KBNA 4H02A 4HJAA 4BY1G 4L5RC 4DR6L 4NXNQ 4EQ5A 4A3FH 4LFAQ 2ATWA 4LUVA 5C4XG 1QUQA 1BBUA 4PZ6A 4A3EG 4A3EH 2JEAI 4B3RQ 1FJGQ 3KFUA 1E1OA 1Y14B 3KDFA 2K5VA 5J3BA 2GVAA 5IP9G 4DUYL 2BH2A 4A3GG 2PMZE 2JA6G 1VCIA 4ALPA 2JA6H 4A3BH 1Q1EA 1YJNA 4GOPC 1XJVA 4BY7G 1HZAA 4IO9A 1K83H 2RHQB 3HOXG 4DUZL 1WI5A 4A3IG 5C0XJ 1YITA 1PV4A 3RLOA 1JE5A 3IRBA 4GN3B 4JG2A 4LNQA 1T9HA 1FGUA 4UP9A 1XPUA 3RZDH 3TS2A 4X6AH 1LYLA 4QJFA 2Y0SE 4DV0L 1M90C 3F2BA 4DR2L 2I5MX 2IHFA 1J5EL 1E3PA 5H1SE 1OTCA 4DAYB 4LFBL 4DR1L 1TWGH 4JI4L 2B63G 2VZAA 1UE1A 4BBRG 3CCJA 5LMNL 1VQ4A 1UE5A 1O7IA 3BZKA 4YWKA 4A3DH 1H95A 1JT8A 5IE8A 4R4QA 1PYSB 2I5HA 1WCMG 5JEAG 5FLMG 2E5LQ 3M4OH 1D8LA 3M9BA 4BA1I 3GTOH 2NN6I 2C35B 3GTPH 1UEBA 3H3VI 3AYHB 2YTVA 2CWAA 4EX5A 3I4NG 1P16A 1Q86C 4GNXC 3ULJA 2YYZA 1Q12A 4A3MG 3UDGA 4A3DG 1HZ9A 5IP9H 2CCZA 3GTLH 2HHHQ 1E24A 1G51A 3SGIA 3KF8B 2K14A 4BXXH 2UXDQ 1KIXA 4HJ7A 1IBML 2V1CC 4B3RL 4GN5A 2KHIA 4MZ9A 1NMFA 4GNXA 5JJLA 3MXNB 2LXJA 1HNWQ 1GD7A 1VQKA 2NVXH 1I50H 3I4OA 4PZ7A 2Z6KC 1KD1C 4DR4Q 5E7NA 4DV4Q 4DUZQ 2UU9L 3T1YL 4JI5Q 4IOAA 1I6HH 2Y0SG 4LFCL 4LF6Q 2CFMA 4BXXG 4HIKA 4BY7H 5C4JH 2HHHL 4P75A 4DUYQ 3KYHC 5HY6A 1IL2A 2JA7G 1DGSA 2Z6KA 4A3MH 1N32L 2NVTH 1KHIA 1Y1WG 4JBKA 2PI2A 3BZCA 2HQLA 1PH6A 2JA9A 4DV6Q 3J7A5 4JCVE 1L1OA 3GDEA 4OONA 4HJ8A 3FKIG 4GKJQ 4OX9L 2LXKA 4DV1L 3CCMA 2UUAL 4ME3A 2E8GA 1A62A 4JI5L 1L1OB 4DV7Q 4GS3A 1SMXA 1VQEA 2IY5B 1Q7YC 2H5XA 4DR7L 1QZGA 4LF6L 2JEBI 4BBRH 1CSQA 5JJIA 3UE0A 1PH5A 2UXCQ 2MFIA 4IPDA 4JOIA 1YJWA 1E1TA 2NZOA 3NENA 1EOVA 3CCVA 3HOZG 2D0OA 1K3RA 1S72A 1C0AA 3MEFA 5IYBH 3PIPA 1CUKA 3CCRA 2PQAB 1BVSA 4A75A 3GO5A 3T1HQ 3K80C 4GKKQ 4JI1L 3S1RH 1OXTA 1N8RC 1N36Q 2UXDL 3E9IA 1NE3A 5EAYA 2PQAA 3AFQA 1X3FA 3CC2A 2Z0SA 3A5ZB 5LMUL 3HKSA 4MTNA 1HR0W 3RZOH 3I4MH 1E22A 4C3IH 4DR5L 3UDIA 3PO3H 1N33L 3F1ZA 4C3JH 2F4VL 3G6EA 4J15A 4KI0A 1HNZQ 1N9WA 1KRTA 3ICEA 1Q8KA 2KHJA 3JAMi 4OO1I 3W5OA 2HT1A 4IPGA 4GN4B 1VS0A 1VQ5A 4JI2L 4AYBG 3G48A 2ZTCA 3D31A 4LWCA 3GTKH 1JJCB 1Q46A 1VQFA 2NVQH 2CWPA 5DLQE 2UUCL 3T1YQ 4XTCS 4UPAA 4B3MQ 1ASYA 3ERSX 4LF7Q 2ASBA 3M4QA 4JBWA 1KL9A 4X64L 3HOZH 4GLAC 4A3LH 3CAMA 1NJIC 1YBYA 2PI2E 4L5QA 4R4IA 1YNXA 3PUXA 1HH2P 5C0XI 3ULLA 4LF8L 1KC8C 2R93H 4DV6L 5GAGC 1TWFH 3TS0A 1R9TH 2UUBL 5C4XH 1G291 4DK3C 4GKJL 5IYCH 4AYBE 2A8VA 2NVYH 4JI3L 3I4MG 2L15A 3PO3G 1NBWA 1EIFA 4JI1Q 4JI7Q 1J6QA 2VL6A 3L7ZC 5M3FG 4RMFA 3CD6A 3K81C 1YZ6A 3BU2A 4AH6A 3K8AA 3CC7A 4IOCA 2E2HH 1KRSA 3B6YA 1B70B 3K7AH 3EIVA 2YTXA 1ASZA 3EN2A 1YJ9A 3A74A 1MJEA 5IYDH 5IT9c 3K0XA 4LFCQ 3S1QH 1GM5A 5LMNW 3J80i 1UE6A 3K7UC 3HOVH 2KENA 3M3YH 4GLXA 1KXLA 1SE8A 4WJ4A 4JI3Q 3HOXH 3H0GG 2BH8A 3A5UA 4QL5A 3WWVA 4JI7L 2IHEA 1VQAA 1A63A 2MO1A 3L2PA 5HGQA 5GAEC 2RHSB 4B3SL 5IP7H 4OWTB 1JMCA 1Y1VH 1QUQB 4LF9Q 2F52A 2ZM6Q 4BY1H 3ZJYC 1QVGA 1PH3A 1PHJA 2GN5A 4KHPQ 2WB1G 3KJOA 3S1MH 4LF5Q 4IFDJ 4JYAL 2JA5H 3M4PA 4P71A 4DAMA 3CCLA 2D0PA 1U0LA 2OWOA 1HNXQ 3EBEA 2D62A 4A76A 3T1HL 1S40A 1WYDA 2BA0A 4LW1A 3OW2A 3S1NH 2XGTA 2IX1A 2JK8A 3J81i 4X66Q 2R7DA 1A8VA 2B63H 2HIVA 2F3IA 5M3MG 1W2BA 3W1GA 1Z47A 4YHHL 4DV2L 2R92H 1EQRA 1I94L 2JA5G 4C3HH 4PG3A 1QZHA 2UXBL 3FHWA 5C44G 3ER0A 3TQYA 4JV5L 4AIMA 2ID0A 4IJLA 4LF5L 2VS1A 1M1KC 2R7ZG 1MJCA 2N8NA 1Q1BA 4IPCA 3PUZA 1GKHA 3U58A 1XPRA 1SN8A 1SROA 4JBJA 2XTIA 3CCUA 4DV1Q 1PH8A 1K9MC 2UUAQ 4A4IA 1YI2A 1QVFA 4HJ5A 4QGUA 1VQNA 4DKAC 4GOPB 2CKZB 2AKWB 2RCNA 1TWHH 1Y1VG 2VQEL 4YHHQ 4LF7L 4AQYL 1EQQA 2QGQA 2IX0A 2MNAA 2R7FA 2AMCB 1I5FA 1EWIA 1AE2A 2LSSA 3I55A 2VNUD 3RNUA 1FL0A 1HZBA 4DR2Q 1VQMA 1K0RA 1SR3A 3J7ZC 4DV3Q 4O2DA 1J5EQ 3CC4A 4X65Q 1HR0Q 4LFBQ 1LUZA 4R4TA 3KDFB 1XNRL 3S24A 2BA1A 3KF6B 4X62Q 3PF4A 4XIGS 4HIMA 4JI6Q 3PIOA 2A19A 2K52A 2FXQA 3KF6A 3RR5A 2JE6I 3G4SA 4LF4Q 1TWAH 1RL2A 2DGYA 1VQJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U5K A;  2JA8 H;  4A3G H;  2JA8 G;  4DR7 Q;  5IWA Q;  4GLV B;  4IJH A;  3GTJ H;  2YU9 H;  5IP7 G;  4A3B G;  2IT1 A;  3I2Z A;  1VQ6 A;  2ES2 A;  1FJG L;  2OTJ A;  1AE3 A;  4RG1 A;  2KCM A;  4JI2 Q;  3DM3 A;  4A3F G;  1GVP A;  3L0O A;  4JV5 Q;  2WAQ E;  1WFQ A;  3KLW A;  3PGZ A;  4JC0 A;  3CMA A;  1VQO A;  2EXD A;  4YWM A;  3GTG H;  1LTL A;  4X62 L;  2AWO A;  2RF4 A;  2YTY A;  1PH7 A;  4QQB X;  1N36 L;  4LF4 L;  1V9P A;  1EUJ A;  5C3E H;  5C3E G;  3CCE A;  1Q81 C;  2E2J H;  2QA4 A;  2EQS A;  3CPW A;  4DV4 L;  2UXB Q;  3OYY A;  1PYB A;  1W3S A;  4POF A;  4A3C G;  3Q8D A;  4DPG A;  4AQY Q;  5ELO A;  1VQC A;  3OTO L;  2ALY B;  3I56 A;  3RN2 A;  2E2I H;  4A3K H;  1PH9 A;  3GD7 A;  1K73 C;  4A93 G;  3U4Z A;  1PFS A;  1N32 Q;  1KAW A;  3PV0 A;  1TXY A;  1X56 A;  3PUV A;  5C0X G;  2WB1 E;  1MKH A;  2JA7 H;  1D7Q A;  3UDX A;  2F4V Q;  4IPH A;  2VQE Q;  3RLN A;  4GNX B;  1N34 Q;  1VQL A;  1X3E A;  4JOI C;  4P73 A;  3S2D H;  5JEA J;  3AQQ A;  4A3J G;  5JJK A;  1VQI A;  2K5H A;  4OWX B;  4A3K G;  1V1Q A;  4MNO A;  4YCV A;  3KJP A;  1C9O A;  1SRU A;  1EIY B;  3S17 H;  4DV5 L;  3F8T A;  1X65 A;  4JI0 L;  1YHA A;  3FP9 A;  2N78 A;  5IYB G;  3OTO Q;  4DV3 L;  4X64 Q;  2N3S A;  1VQD A;  4DV0 Q;  1IBM Q;  3I7F A;  5IYD G;  3RN5 A;  3S14 H;  3UDF A;  4HIO A;  2ZTE A;  1P8L A;  2K4K A;  2R92 G;  3TRZ A;  4JI4 Q;  3PO2 G;  1HNW L;  4TQU S;  1PVO A;  1VQ7 A;  2QEX A;  2UU9 Q;  1IBK Q;  4POG A;  1K8A C;  1JJ2 A;  1X55 A;  4UY8 C;  1B7Y B;  3HOW G;  2VQF Q;  2OQ0 A;  1YIJ A;  2KCT A;  4LF9 L;  3HOY H;  3NBH B;  2HIX A;  1E7Z A;  3HOY G;  3J81 j;  3S2H H;  2YV5 A;  4LF8 Q;  4DR3 Q;  4A93 H;  4HJ9 A;  3CF5 A;  5LMN Q;  1IXR A;  2VUM G;  1XPO A;  3HKZ E;  1BBW A;  3HOU G;  4DNI A;  1GO3 E;  3CME A;  2OQK A;  3CCQ A;  1Y1W H;  1EFW A;  4O0A A;  3AFP A;  4PZ8 A;  1PH4 A;  4APV A;  5ELN A;  1IBL L;  4OWW B;  1NTG A;  5FLM H;  1K8G A;  4L5T A;  1WOC A;  4FDB A;  2K5N A;  2VQF L;  1KQS A;  1VQP A;  1TWC H;  4DV2 Q;  1I94 Q;  2WFW A;  3F2C A;  1Z9F A;  3LGJ A;  3H15 A;  1B8A A;  1CSP A;  4UP7 A;  3CPF A;  4NXM Q;  2MQH A;  1OXS C;  2NZH A;  5IY0 A;  4B3T Q;  4P74 A;  4DV5 Q;  4R4O A;  3CQZ H;  1L2F A;  3J81 c;  1XNQ L;  1XMO Q;  3GTQ H;  4YY3 Q;  2VW9 A;  4KHP L;  3PUW A;  3FKI H;  1OXX K;  1UE7 A;  1Q82 C;  3F2D A;  2EIF A;  4JYA Q;  1MIU A;  1VQH A;  2OTL A;  3I4N H;  4DK6 C;  5FJ8 H;  5M5Y H;  1FVI A;  5FJ8 G;  3U4V A;  3ULP A;  3PUY A;  4JI0 Q;  2B29 A;  2WP8 J;  4OX9 Q;  1OXV A;  3VDY A;  1RIP A;  2MO0 A;  1JB7 A;  1IBK L;  3JC6 6;  3D0F A;  1HNZ L;  2K75 A;  2K50 A;  4NXN L;  3UE1 A;  1QVC A;  3DLL A;  4QY7 A;  3A0J A;  4K0K Q;  1WCM H;  5C44 H;  3E9H A;  1JJG A;  5AJ3 L;  3AEV A;  3M7N A;  2R7Z H;  5BR8 L;  1VQ9 A;  2I0Q A;  2ZJP A;  1G6P A;  1CKO A;  1UWV A;  3E0E A;  2AHO B;  2Q2T A;  3NEL A;  2Q2I A;  1IZ6 A;  1NMG A;  2PNH A;  3HOV G;  2ZTD A;  3RLF A;  4B3M L;  3PO2 H;  1EYG A;  4OO1 G;  2B3G A;  4JI8 Q;  1CKN A;  5M3F H;  1BKB A;  1IBL Q;  4IFD I;  1SLJ A;  2I5L X;  3H3V H;  4DV7 L;  2UXC L;  5IWA L;  1AH9 A;  1A0I A;  5GAD C;  4DR3 L;  2NN6 G;  2WAQ G;  4B3S Q;  1NY4 A;  2GVB A;  5IYC G;  4Y7N H;  1XMQ L;  3STB C;  4OXP A;  3STB D;  3U50 C;  4LFA L;  2UUB Q;  1PA6 A;  1YHQ A;  4GKK L;  1VQG A;  3S16 H;  3PCO B;  4PMW A;  2A1A A;  1S3O A;  1SFO H;  3M85 A;  2E5L L;  1L1O C;  4DR5 Q;  3H0G H;  3HOW H;  1VQB A;  4JI8 L;  5M3M H;  4L5S A;  4A3C H;  4GOP A;  4LUZ A;  4WJ3 M;  4R4C A;  2ZJQ A;  2UUC Q;  4UP8 A;  1HZC A;  4JBM A;  4JI6 L;  4X66 L;  1YHB A;  3PF5 A;  4DR6 Q;  2JJQ A;  4NB3 A;  4NXM L;  4YCU A;  1XNQ Q;  1I3Q H;  4LUO A;  5GQO A;  2N49 A;  1PH1 A;  1X3G A;  4A3I H;  3J80 c;  5FLX c;  3HOU H;  1LM0 A;  2Q2H A;  3KOJ A;  5AJ3 Q;  2JQO A;  3HFZ B;  5BR8 Q;  5M5X H;  3G71 A;  3JAM c;  1X54 A;  1OXU A;  1N34 L;  1IYJ B;  1XTD A;  4Y52 H;  2DUD A;  3HKZ G;  4BBS G;  4YWL A;  4BBS H;  2OCE A;  3BJU A;  2ZJR A;  5LMU Q;  5K36 G;  1CKN B;  2CQO A;  4K0K L;  4BA2 I;  3CP0 A;  3TRE A;  1N33 Q;  2R93 G;  2ZM6 L;  2VY3 A;  4R1J A;  5M5W H;  3S15 H;  3TEH B;  3NEM A;  3CW2 C;  4A3L G;  2R6G A;  3CXC A;  4DR1 Q;  1WJJ A;  4B3T L;  4YCW A;  4KLK A;  4P72 A;  1V43 A;  1XMQ Q;  1XMO L;  1X6O A;  1YVC A;  4YY3 L;  2Q2U A;  3GTM H;  4HID A;  1HNX L;  4X65 L;  3CCS A;  1HR0 L;  3W1B A;  4NPS A;  4TVA B;  5GAH C;  4QIW E;  1C7Y A;  4IFD G;  1PH2 A;  1XNR Q;  4KHZ A;  4C2M H;  2AWN A;  1VQ8 A;  1CKM A;  1HJP A;  4A3J H;  5GRO A;  1YEZ A;  1X9N A;  1L0W A;  4DR4 L;  3PSI A;  2VUM H;  2KBN A;  4H02 A;  4HJA A;  4BY1 G;  4L5R C;  4DR6 L;  4NXN Q;  4EQ5 A;  4A3F H;  4LFA Q;  2ATW A;  4LUV A;  5C4X G;  1QUQ A;  1BBU A;  4PZ6 A;  4A3E G;  4A3E H;  2JEA I;  4B3R Q;  1FJG Q;  3KFU A;  1E1O A;  1Y14 B;  3KDF A;  2K5V A;  5J3B A;  2GVA A;  5IP9 G;  4DUY L;  2BH2 A;  4A3G G;  2PMZ E;  2JA6 G;  1VCI A;  4ALP A;  2JA6 H;  4A3B H;  1Q1E A;  1YJN A;  4GOP C;  1XJV A;  4BY7 G;  1HZA A;  4IO9 A;  1K83 H;  2RHQ B;  3HOX G;  4DUZ L;  1WI5 A;  4A3I G;  5C0X J;  1YIT A;  1PV4 A;  3RLO A;  1JE5 A;  3IRB A;  4GN3 B;  4JG2 A;  4LNQ A;  1T9H A;  1FGU A;  4UP9 A;  1XPU A;  3RZD H;  3TS2 A;  4X6A H;  1LYL A;  4QJF A;  2Y0S E;  4DV0 L;  1M90 C;  3F2B A;  4DR2 L;  2I5M X;  2IHF A;  1J5E L;  1E3P A;  5H1S E;  1OTC A;  4DAY B;  4LFB L;  4DR1 L;  1TWG H;  4JI4 L;  2B63 G;  2VZA A;  1UE1 A;  4BBR G;  3CCJ A;  5LMN L;  1VQ4 A;  1UE5 A;  1O7I A;  3BZK A;  4YWK A;  4A3D H;  1H95 A;  1JT8 A;  5IE8 A;  4R4Q A;  1PYS B;  2I5H A;  1WCM G;  5JEA G;  5FLM G;  2E5L Q;  3M4O H;  1D8L A;  3M9B A;  4BA1 I;  3GTO H;  2NN6 I;  2C35 B;  3GTP H;  1UEB A;  3H3V I;  3AYH B;  2YTV A;  2CWA A;  4EX5 A;  3I4N G;  1P16 A;  1Q86 C;  4GNX C;  3ULJ A;  2YYZ A;  1Q12 A;  4A3M G;  3UDG A;  4A3D G;  1HZ9 A;  5IP9 H;  2CCZ A;  3GTL H;  2HHH Q;  1E24 A;  1G51 A;  3SGI A;  3KF8 B;  2K14 A;  4BXX H;  2UXD Q;  1KIX A;  4HJ7 A;  1IBM L;  2V1C C;  4B3R L;  4GN5 A;  2KHI A;  4MZ9 A;  1NMF A;  4GNX A;  5JJL A;  3MXN B;  2LXJ A;  1HNW Q;  1GD7 A;  1VQK A;  2NVX H;  1I50 H;  3I4O A;  4PZ7 A;  2Z6K C;  1KD1 C;  4DR4 Q;  5E7N A;  4DV4 Q;  4DUZ Q;  2UU9 L;  3T1Y L;  4JI5 Q;  4IOA A;  1I6H H;  2Y0S G;  4LFC L;  4LF6 Q;  2CFM A;  4BXX G;  4HIK A;  4BY7 H;  5C4J H;  2HHH L;  4P75 A;  4DUY Q;  3KYH C;  5HY6 A;  1IL2 A;  2JA7 G;  1DGS A;  2Z6K A;  4A3M H;  1N32 L;  2NVT H;  1KHI A;  1Y1W G;  4JBK A;  2PI2 A;  3BZC A;  2HQL A;  1PH6 A;  2JA9 A;  4DV6 Q;  3J7A 5;  4JCV E;  1L1O A;  3GDE A;  4OON A;  4HJ8 A;  3FKI G;  4GKJ Q;  4OX9 L;  2LXK A;  4DV1 L;  3CCM A;  2UUA L;  4ME3 A;  2E8G A;  1A62 A;  4JI5 L;  1L1O B;  4DV7 Q;  4GS3 A;  1SMX A;  1VQE A;  2IY5 B;  1Q7Y C;  2H5X A;  4DR7 L;  1QZG A;  4LF6 L;  2JEB I;  4BBR H;  1CSQ A;  5JJI A;  3UE0 A;  1PH5 A;  2UXC Q;  2MFI A;  4IPD A;  4JOI A;  1YJW A;  1E1T A;  2NZO A;  3NEN A;  1EOV A;  3CCV A;  3HOZ G;  2D0O A;  1K3R A;  1S72 A;  1C0A A;  3MEF A;  5IYB H;  3PIP A;  1CUK A;  3CCR A;  2PQA B;  1BVS A;  4A75 A;  3GO5 A;  3T1H Q;  3K80 C;  4GKK Q;  4JI1 L;  3S1R H;  1OXT A;  1N8R C;  1N36 Q;  2UXD L;  3E9I A;  1NE3 A;  5EAY A;  2PQA A;  3AFQ A;  1X3F A;  3CC2 A;  2Z0S A;  3A5Z B;  5LMU L;  3HKS A;  4MTN A;  1HR0 W;  3RZO H;  3I4M H;  1E22 A;  4C3I H;  4DR5 L;  3UDI A;  3PO3 H;  1N33 L;  3F1Z A;  4C3J H;  2F4V L;  3G6E A;  4J15 A;  4KI0 A;  1HNZ Q;  1N9W A;  1KRT A;  3ICE A;  1Q8K A;  2KHJ A;  3JAM i;  4OO1 I;  3W5O A;  2HT1 A;  4IPG A;  4GN4 B;  1VS0 A;  1VQ5 A;  4JI2 L;  4AYB G;  3G48 A;  2ZTC A;  3D31 A;  4LWC A;  3GTK H;  1JJC B;  1Q46 A;  1VQF A;  2NVQ H;  2CWP A;  5DLQ E;  2UUC L;  3T1Y Q;  4XTC S;  4UPA A;  4B3M Q;  1ASY A;  3ERS X;  4LF7 Q;  2ASB A;  3M4Q A;  4JBW A;  1KL9 A;  4X64 L;  3HOZ H;  4GLA C;  4A3L H;  3CAM A;  1NJI C;  1YBY A;  2PI2 E;  4L5Q A;  4R4I A;  1YNX A;  3PUX A;  1HH2 P;  5C0X I;  3ULL A;  4LF8 L;  1KC8 C;  2R93 H;  4DV6 L;  5GAG C;  1TWF H;  3TS0 A;  1R9T H;  2UUB L;  5C4X H;  1G29 1;  4DK3 C;  4GKJ L;  5IYC H;  4AYB E;  2A8V A;  2NVY H;  4JI3 L;  3I4M G;  2L15 A;  3PO3 G;  1NBW A;  1EIF A;  4JI1 Q;  4JI7 Q;  1J6Q A;  2VL6 A;  3L7Z C;  5M3F G;  4RMF A;  3CD6 A;  3K81 C;  1YZ6 A;  3BU2 A;  4AH6 A;  3K8A A;  3CC7 A;  4IOC A;  2E2H H;  1KRS A;  3B6Y A;  1B70 B;  3K7A H;  3EIV A;  2YTX A;  1ASZ A;  3EN2 A;  1YJ9 A;  3A74 A;  1MJE A;  5IYD H;  5IT9 c;  3K0X A;  4LFC Q;  3S1Q H;  1GM5 A;  5LMN W;  3J80 i;  1UE6 A;  3K7U C;  3HOV H;  2KEN A;  3M3Y H;  4GLX A;  1KXL A;  1SE8 A;  4WJ4 A;  4JI3 Q;  3HOX H;  3H0G G;  2BH8 A;  3A5U A;  4QL5 A;  3WWV A;  4JI7 L;  2IHE A;  1VQA A;  1A63 A;  2MO1 A;  3L2P A;  5HGQ A;  5GAE C;  2RHS B;  4B3S L;  5IP7 H;  4OWT B;  1JMC A;  1Y1V H;  1QUQ B;  4LF9 Q;  2F52 A;  2ZM6 Q;  4BY1 H;  3ZJY C;  1QVG A;  1PH3 A;  1PHJ A;  2GN5 A;  4KHP Q;  2WB1 G;  3KJO A;  3S1M H;  4LF5 Q;  4IFD J;  4JYA L;  2JA5 H;  3M4P A;  4P71 A;  4DAM A;  3CCL A;  2D0P A;  1U0L A;  2OWO A;  1HNX Q;  3EBE A;  2D62 A;  4A76 A;  3T1H L;  1S40 A;  1WYD A;  2BA0 A;  4LW1 A;  3OW2 A;  3S1N H;  2XGT A;  2IX1 A;  2JK8 A;  3J81 i;  4X66 Q;  2R7D A;  1A8V A;  2B63 H;  2HIV A;  2F3I A;  5M3M G;  1W2B A;  3W1G A;  1Z47 A;  4YHH L;  4DV2 L;  2R92 H;  1EQR A;  1I94 L;  2JA5 G;  4C3H H;  4PG3 A;  1QZH A;  2UXB L;  3FHW A;  5C44 G;  3ER0 A;  3TQY A;  4JV5 L;  4AIM A;  2ID0 A;  4IJL A;  4LF5 L;  2VS1 A;  1M1K C;  2R7Z G;  1MJC A;  2N8N A;  1Q1B A;  4IPC A;  3PUZ A;  1GKH A;  3U58 A;  1XPR A;  1SN8 A;  1SRO A;  4JBJ A;  2XTI A;  3CCU A;  4DV1 Q;  1PH8 A;  1K9M C;  2UUA Q;  4A4I A;  1YI2 A;  1QVF A;  4HJ5 A;  4QGU A;  1VQN A;  4DKA C;  4GOP B;  2CKZ B;  2AKW B;  2RCN A;  1TWH H;  1Y1V G;  2VQE L;  4YHH Q;  4LF7 L;  4AQY L;  1EQQ A;  2QGQ A;  2IX0 A;  2MNA A;  2R7F A;  2AMC B;  1I5F A;  1EWI A;  1AE2 A;  2LSS A;  3I55 A;  2VNU D;  3RNU A;  1FL0 A;  1HZB A;  4DR2 Q;  1VQM A;  1K0R A;  1SR3 A;  3J7Z C;  4DV3 Q;  4O2D A;  1J5E Q;  3CC4 A;  4X65 Q;  1HR0 Q;  4LFB Q;  1LUZ A;  4R4T A;  3KDF B;  1XNR L;  3S24 A;  2BA1 A;  3KF6 B;  4X62 Q;  3PF4 A;  4XIG S;  4HIM A;  4JI6 Q;  3PIO A;  2A19 A;  2K52 A;  2FXQ A;  3KF6 A;  3RR5 A;  2JE6 I;  3G4S A;  4LF4 Q;  1TWA H;  1RL2 A;  2DGY A;  1VQJ A; 
#chains in the Genus database with same CATH topology
 1U5K A;  2JA8 H;  3SK4 A;  5IWA Q;  3GTJ H;  2YU9 H;  2IT1 A;  1VQ6 A;  2KCM A;  1SBB B;  5ELE A;  4KJN A;  3ZYY X;  2FMM A;  2EXD A;  4RGN A;  4YWM A;  4DAY A;  4NP5 A;  4CKE A;  2RSN A;  1PH7 A;  4ZCK A;  1T5E A;  1V9P A;  5C3E H;  3CCE A;  4ZKC B;  2QA4 A;  2EQS A;  2BCO A;  2F0N A;  1VMC A;  1W3S A;  2QCP X;  4POF A;  4DPG A;  5ELO A;  1VQC A;  3I56 A;  3RN2 A;  2E2I H;  3MVV A;  1YNJ D;  4XDX A;  2A68 C;  1N32 Q;  3SR1 A;  1KAW A;  2Z6B A;  4KKU A;  5EBD A;  1TXY A;  1S5C D;  2DJF C;  2F4V Q;  1VQL A;  4GNX B;  4PMB A;  3S2D H;  5JEA J;  3AQQ A;  2K5H A;  4A3K G;  4MNO A;  1EIY B;  1F77 A;  1ESF A;  1YHA A;  1FYC A;  1PTO F;  4M1U B;  2F0M A;  1IBM Q;  3AB9 A;  3UDF A;  4HIO A;  5C3X A;  1EY4 A;  4K5V A;  3TRZ A;  1NSN S;  3URY A;  4KY7 A;  4Q5V A;  4JI4 Q;  2QDB A;  5HGT A;  1SJH D;  4POG A;  1PLF A;  4BS9 A;  4KHV A;  5ELB A;  2VQF Q;  1QG7 A;  1EU3 A;  3AU7 A;  4N8F A;  3S2H B;  2YV5 A;  1SYE A;  1SNO A;  2KA7 A;  1EY5 A;  2X6L A;  5LMN Q;  4DFA A;  1PTO C;  3HOU G;  3LWU A;  5DM7 3;  3AFP A;  1IBL L;  3DXJ C;  5ELN A;  4APV A;  5JEA H;  2WII B;  4L5T A;  2RBM A;  2AUK A;  1KQS A;  1TWC H;  1I94 Q;  4WJW A;  3F2C A;  1Z9F A;  3LGJ A;  3H15 A;  2VUM B;  4OGQ C;  4R9W A;  1GHJ A;  1OXS C;  2NZH A;  4B3T Q;  3T53 B;  3CQZ B;  4P74 A;  4R4O A;  1BCP B;  4QUF A;  5KNC A;  3PUW A;  1UE7 A;  4DAV A;  1BXT A;  3F2D A;  2ICI A;  3D4D A;  2N88 A;  3I4N H;  5FJ8 H;  5M5Y H;  1FVI A;  3MXG A;  1RIP A;  3TZU A;  1IBK L;  1LTR D;  3DLL A;  3A0J A;  3KBX A;  4K0K Q;  1WCM H;  3E9H A;  5AJ3 L;  1AP0 A;  5LL6 S;  1LV9 A;  2F0I A;  4HAE A;  1DOK A;  1ET6 A;  3MEH A;  2B2T A;  4HCS A;  5FLX E;  2AHO B;  5IT9 L;  3NEL A;  2Q2I A;  1IZ6 A;  4Q0F A;  1SDF A;  3HOV G;  1IYV A;  4B3M L;  1K0S A;  1EYG A;  1BKB A;  2C9O A;  1SLJ A;  4X3S A;  2OF1 A;  2D5D A;  2EOT A;  5EQ0 A;  2NN6 G;  3AMU A;  3ERQ A;  4Y7N H;  4A3G B;  3STB C;  4LFA L;  1EEI D;  5M5X B;  4NW2 A;  2I46 A;  1K3B C;  3KLS X;  1PA6 A;  2UUB Q;  4GKK L;  3S16 H;  3PCO B;  4PMW A;  2PO4 A;  3H3V C;  2E5L L;  4RGM A;  2JA7 B;  2I07 B;  3H0G H;  4JI8 L;  5M3M H;  4A3C H;  2F4I A;  1LTG D;  2ZJQ A;  4JBM A;  4JI6 L;  3HGB A;  4X66 L;  4BWG B;  1EY9 A;  4LUO A;  5GQO A;  1PH1 A;  5FOB B;  1B4O A;  3KOJ A;  1R4Q B;  4OIK A;  5BR8 Q;  2SNM A;  4LMQ D;  4EVO A;  2NYZ D;  1X54 A;  5C3E B;  1MSH A;  3HKZ G;  4BBS H;  2F0Q A;  3BJU A;  5C0X H;  4K0K L;  1QIL A;  1RDP D;  3TRE A;  1N33 Q;  1A2T A;  3J80 L;  3FEW X;  2KQ3 A;  2ZM6 L;  2G9D A;  4R1J A;  1Y8N B;  3H6M A;  4HN7 A;  3CU7 A;  2R6G A;  3CXC A;  4OO1 H;  5KYL A;  2D9U A;  3K5N A;  4P72 A;  4X3K A;  1V43 A;  2Q2U A;  2FMC A;  4HID A;  1HR0 L;  1C7Y A;  4DXF A;  3N52 A;  4WFN 3;  4C2M H;  2AWN A;  5HUR A;  1VQ8 A;  4L6T B;  1GHK A;  1B9M A;  1Q8I A;  5GRO A;  3PSI A;  4HJA A;  4DR6 L;  1LLR D;  4EQ5 A;  4LUV A;  1QUQ A;  5NUC A;  4A3E H;  2JEA I;  1E1O A;  1Y14 B;  5J3B A;  2BH2 A;  3QOL A;  2QKI C;  2PMZ E;  2JA6 G;  5FO7 B;  3ONA B;  1YJN A;  1BCP F;  1K83 H;  2IW3 A;  2RDF A;  2RHQ B;  3NWS A;  5EPJ A;  4DUZ L;  1WI5 A;  1PV4 A;  2Z8L A;  2NZ1 D;  3IKJ A;  1H9S B;  2HCC A;  3HOY B;  1T9H A;  2K03 A;  1SYF A;  2VXW A;  3TS2 A;  3GV6 A;  1M90 C;  1KLG D;  4MHE A;  3F2B A;  2I5M X;  3I3C A;  1NCV A;  2KCN A;  1E2W A;  1ONL A;  1ZYR C;  4BBR G;  1D5X C;  3CCJ A;  2F03 A;  4A3D H;  1UE5 A;  1O7I A;  3UI2 A;  2L9H A;  1PYS B;  1EEF D;  4FXG C;  3M4O H;  1GOZ A;  3GTO H;  2CWA A;  1FD7 D;  1I50 B;  4GNX C;  1Q12 A;  1MD2 D;  3UDG A;  2M9V A;  3I72 A;  3GTL H;  2K14 A;  2L12 A;  1KIX A;  1IBM L;  2V1C C;  4NMZ A;  2KHI A;  4MZ9 A;  1VDZ A;  1HNW Q;  2A5H A;  4PZ7 A;  2KCC A;  4DV4 Q;  2UU9 L;  4IOA A;  1O7L A;  2OXP A;  2O5I C;  1I6H B;  3IFD A;  4LFC L;  2B2Y C;  1ICW A;  4P2C B;  4P75 A;  2Z6K A;  1N32 L;  5FO9 B;  1STG A;  4JBK A;  2PI2 A;  4DV6 Q;  2QF7 A;  4OON A;  4OX9 L;  2B2U C;  1TS2 A;  2UUA L;  1TT2 A;  1PTO B;  1A62 A;  2ZXP A;  4IUR A;  1STE A;  5L37 A;  1STA A;  1TU2 B;  4DR7 L;  1FNV A;  4K14 A;  1QZG A;  3Q24 A;  1RCV D;  2A69 D;  3NQT A;  5JJI A;  2K05 A;  1JIC A;  2D0O A;  1K3R A;  1C0A A;  4U68 A;  3MEF A;  1TY0 A;  2PQA B;  1F2L A;  1JT8 A;  1OXT A;  4XXE A;  1DD2 A;  1CI3 M;  3A5Z B;  2M2L A;  3HKS A;  5C3W A;  4DR5 L;  2JYO A;  1CZG A;  2F4V L;  4C3J G;  3G6E A;  3I91 A;  4KI0 A;  1HNZ Q;  1K8O A;  2B2U A;  3ICE A;  3A8I E;  4GN4 B;  4Z9C B;  1VQ5 A;  4V0B A;  2Z4H A;  5EBC A;  2ZTC A;  3D31 A;  4LWC A;  4C3J B;  1VQF A;  1HUN A;  5DLQ E;  3X3N A;  2UUC L;  2RKS A;  4O1N A;  4RCN A;  4RWS C;  4B3M Q;  1CZW A;  4RGO S;  1HTP A;  4LF7 Q;  4CDC C;  1EIH A;  1BDO A;  2ASB A;  2A69 C;  3GTL B;  1KL9 A;  4GLA C;  4A3L H;  2LS0 1;  3CAM A;  2JP1 A;  2PI2 E;  1NJI C;  1YNX A;  3PUX A;  5C0X I;  2R93 H;  2UUB L;  5C4X H;  3A55 A;  1G29 1;  4U67 3;  1V1P A;  5C5L A;  4HSV A;  2NVY H;  2RCF A;  1EIF A;  4JI1 Q;  4KN7 C;  2HDL A;  4IOC A;  3K8A A;  5I2Y A;  3B6Y A;  1B70 B;  2WAC A;  2BOS A;  3K0X A;  4LFC Q;  1I4Q A;  4UAI A;  3K7U C;  1KLU D;  2DY8 A;  4BY7 B;  4B9X A;  3SDZ A;  1CHQ D;  4C1N I;  4GLX A;  3M3Y H;  3KUP A;  4JI3 Q;  4C56 C;  2ICE C;  4I7A A;  4L63 B;  2A6H D;  1QB5 D;  4QF4 A;  5C4J B;  2B2W C;  4A3F B;  3CRK C;  5I6W A;  2ZM6 Q;  3ZJY C;  2LY7 A;  4ZRZ A;  4KHP Q;  3J81 L;  3KJO A;  4IFD J;  2EJM A;  2EPB A;  4RKB A;  5EPK A;  1SYD A;  4P71 A;  4DAM A;  2OWO A;  1U0L A;  3VR2 A;  4A76 A;  3T1H L;  2BA0 A;  2KED A;  4QB4 A;  3S1N H;  3VR6 A;  3J81 i;  1W2B A;  4KY5 A;  2F0V A;  4FNF A;  3FVQ A;  3W1G A;  1Z47 A;  4YHH L;  4DV2 L;  2R92 H;  1EQR A;  4C3H H;  5FO8 B;  5C44 G;  1IKL A;  4AIM A;  5A2Q E;  2VS1 A;  1G2S A;  2RQX A;  1MJC A;  4JK1 C;  1Y69 U;  3Q6S A;  4G7Z C;  1XPR A;  4CBV A;  2XNA C;  1WTX A;  1SRO A;  3DWQ A;  2UUA Q;  4A3J B;  4GOP B;  2AKW B;  4AQY L;  4RGT A;  1SNP A;  1TWC B;  2BE5 D;  4ME5 A;  1EQQ A;  2R7F A;  1AE2 A;  3RNU A;  4K8J A;  2IPK D;  1FL0 A;  1LO5 D;  1K0R A;  1EY6 A;  2JSO A;  5BN4 A;  4O2D A;  1QNK A;  3CC4 A;  1HR0 Q;  1LUZ A;  4R4T A;  3KDF B;  4CHT B;  3NTH A;  1I4P A;  2BA1 A;  3KF6 B;  1J9O A;  4IUT A;  1SAP A;  4HIM A;  2K52 A;  3KF6 A;  2JE6 I;  1RHP A;  3G4S A;  1FGB D;  1NR2 A;  2F0J A;  4AYB B;  4Y7N B;  4A3G H;  4IN3 A;  5CGK A;  1G8Z D;  4A3K B;  1JWS D;  3DM3 A;  4J8Q A;  1TII D;  1GVP A;  3L0O A;  3SXH A;  3KLW A;  1VQO A;  3GTG H;  4S3S A;  1LTL A;  2J4X A;  3SE0 A;  1B2T A;  2AWO A;  1TWA B;  2AUJ D;  1WTQ A;  1I6V C;  4LF4 L;  1Q81 C;  1EUJ A;  4DV4 L;  2SEB D;  3A7L A;  1RTN A;  5I9O A;  2EY5 A;  3S2D B;  2ALY B;  2B2T C;  1K73 C;  3U4Z A;  1PFS A;  5IGD A;  1TQO A;  1CTM A;  1U4L A;  1X56 A;  3KF8 A;  3PUV A;  4RA8 A;  5C0X G;  3I4N B;  3D4R A;  3EJI A;  4DNT B;  1D7Q A;  3RLN A;  5D14 A;  1N34 Q;  1SYB A;  1X3E A;  3SEB A;  1VQI A;  4IUQ A;  1SRU A;  2XVS A;  3FP9 A;  4I65 A;  2N78 A;  1MSG A;  2RDG A;  2NWG A;  3S14 H;  1TVX A;  1P8L A;  2K4K A;  5KYI A;  2R92 G;  2NBF A;  3PO2 G;  1D1I A;  1HNW L;  1PVO A;  1VQ7 A;  2UU9 Q;  1X55 A;  1FR3 A;  2L5T A;  1YIJ A;  2KCT A;  3Q23 A;  4CDF C;  2E76 C;  4LF8 Q;  3MAQ A;  3TME A;  3CF5 A;  3QIA A;  2VUM G;  3HKZ B;  4ULL A;  3HKZ E;  1BBW A;  1PYW D;  2EVB A;  1EFI D;  2F0D A;  1EFW A;  3K58 A;  5FKA C;  5D3I B;  4OWW B;  3R3O A;  1EZ6 A;  2BDN A;  2K04 A;  1SNQ A;  1EYA A;  5CV6 A;  4NXM Q;  2MQH A;  5IY0 A;  1JOQ A;  1A3T A;  4DV5 Q;  3GTQ H;  1EWH A;  1CQF A;  2KVM A;  1YNJ C;  2EYO A;  3FKI H;  1OXX K;  1Q82 C;  4JYA Q;  2OTL A;  1MI2 A;  4DK6 C;  5LHY 1;  3U4V A;  1LTS D;  3ULP A;  3J7A F;  3GTG B;  4OX9 Q;  2H4O A;  1PMR A;  2MO0 A;  1HNZ L;  3D0F A;  2K50 A;  4NXN L;  2AQ1 B;  1LTA D;  1JJG A;  2B8F A;  2PZU A;  5BR8 L;  2I0Q A;  1G6P A;  2MJ8 A;  4PMC A;  1EYD A;  1QNU A;  3PO2 H;  1PZI D;  2EJG C;  4JI8 Q;  2EYF A;  1PFN A;  1CKN A;  5M3F H;  4IFD I;  2F0L A;  1A3U A;  5IWA L;  4DR3 L;  2E74 C;  4B3S Q;  5DEH A;  1DZ1 A;  3K6O A;  1DXM A;  1YHQ A;  4OEM B;  1VQG A;  2A68 D;  2PMZ B;  3HOX B;  2A1A A;  3TN2 A;  4TKO B;  3HOW H;  1JB3 A;  3VYU A;  5EGT A;  2ZXO A;  2UUC Q;  4KD4 A;  1KAA A;  3PF5 A;  3S15 B;  4NB3 A;  4NXM L;  1B1Z A;  5G3L F;  2EZV A;  1XNQ Q;  1I3Q H;  4CKC A;  4A3I H;  2A74 C;  4WOR A;  4KKS A;  5BN5 A;  5M5X H;  3NTK A;  1TS3 A;  3HRZ C;  3C3L A;  1N34 L;  3N6R A;  2DUD A;  4BBS G;  2A6E D;  3R93 A;  5LMU Q;  4K6D A;  4BA2 I;  2XWB B;  3S15 H;  3T4A C;  3CW2 C;  5JAV A;  3GP7 A;  4B3T L;  5DAU A;  4KLK A;  4X3T A;  1XMQ Q;  1H9M A;  2F3W A;  3JAM L;  3S9W A;  4TVA B;  5M3M B;  3EFX D;  1PH2 A;  1CKM A;  1IHZ A;  2JA6 B;  1MGS A;  3BVM A;  3P1H A;  1TS4 A;  3VYT A;  1WVL A;  2B2V C;  2KBN A;  2K33 A;  2EYP A;  2ATW A;  2WB1 B;  5C4X G;  4A3E G;  5IP9 G;  4A3G G;  3V2T A;  4HSP A;  4ALP A;  4RH6 A;  4GOP C;  1XJV A;  1HZA A;  4IO9 A;  1D1K A;  1JE5 A;  4GN3 B;  4JG2 A;  3T13 A;  4FF1 A;  2QDL A;  1XPU A;  3RZD H;  3Q22 A;  1LYL A;  4QJF A;  2Y0S E;  4CGY B;  4DV0 L;  3TP8 A;  1E3P A;  5H1S E;  3HOU B;  4DR1 L;  4NDX A;  2B63 G;  4A3M B;  2VZA A;  3BZK A;  4YWK A;  1BCP D;  1H95 A;  2EY2 A;  5IE8 A;  1AZQ A;  5JEA G;  2E5L Q;  4EQO A;  3VYS A;  4BA1 I;  2NN6 I;  2C35 B;  3GTP H;  1B44 D;  1UEB A;  3H3V I;  3AYH B;  1EZ8 A;  1II3 A;  1STY A;  2YYZ A;  1SNM A;  4A3M G;  5T1G A;  1HZ9 A;  5IP9 H;  2CCZ A;  1E24 A;  4C3I G;  1G51 A;  1LT6 D;  5E4W C;  4B3R L;  4IUV A;  1NUC A;  2L11 A;  4GN5 A;  1H9J A;  4GNX A;  2NVQ B;  4F87 A;  3MXN B;  2NVX H;  4DR4 Q;  2Z6K C;  4ZQ3 A;  5E7N A;  3MXN A;  4JI5 Q;  1NR4 A;  2Y0S G;  4BXX G;  1Y1V B;  2F0G A;  2HHH L;  4DUY Q;  1GUO A;  3K7A B;  3V05 A;  4FP5 D;  1QJO A;  1KHI A;  3MXP A;  1WTV A;  2HQL A;  3J7A 5;  4JCV E;  3LWE A;  2K5Q A;  4GKJ Q;  4DV1 L;  1VQE A;  4X3U A;  2JEB I;  4BBR H;  3L9A X;  4PQX A;  3UE0 A;  1HRJ A;  2UXC Q;  4IPD A;  4JOI A;  1YJW A;  1E1T A;  3J7Y W;  2O4X A;  3HEJ A;  5IYB H;  1EL0 A;  3QR8 A;  2Z1C A;  3GO5 A;  3K80 C;  4A3E B;  3S1R H;  1N8R C;  2UXD L;  3E9I A;  1NE3 A;  1ENC A;  3CC2 A;  4MTN A;  1E22 A;  4H7B A;  1N33 L;  4CJ0 B;  4C3J H;  2J7Z A;  2Q8R E;  3WOE A;  1Q8K A;  4IZ8 A;  1XWE A;  4OO1 I;  3SHL A;  4JI2 L;  1FNU A;  1I4G A;  1KDC A;  3G48 A;  3GTK H;  2NVQ H;  3TP6 A;  4ABN A;  3T1Y Q;  3S1R B;  4UPA A;  3CHB D;  1JOR A;  3M4Q A;  4JBW A;  1I4X A;  3GV3 A;  5EPL A;  2LFN A;  1A3V A;  1EY0 A;  1C8C A;  1HH2 P;  4LF8 L;  1HPC A;  2MP1 A;  4A3D B;  3A7A B;  4GKJ L;  4HED A;  2XWJ B;  1QE6 A;  3K0Y A;  2A8V A;  1IW7 D;  1NBW A;  1AFP A;  1F2Y A;  4JI7 Q;  2VL6 A;  1JE4 A;  2M00 A;  4RMF A;  3CD6 A;  4RHS A;  3NSW A;  5IIF A;  3K7A H;  1ZXT A;  1S5D D;  1MJE A;  1GM5 A;  5LMN W;  3R8B A;  3RZD B;  1XXG A;  4OL7 A;  2JA5 B;  1HXY D;  3J81 E;  1QCB D;  3MWY W;  1KXL A;  1FNW A;  1SE8 A;  1UAP A;  4WJ4 A;  1BNZ A;  3A5U A;  3MFY A;  5ISR A;  2IHE A;  3RZO B;  1A63 A;  5HGQ A;  3ERO A;  5GAE C;  2RHS B;  4B3S L;  4LF9 Q;  2F52 A;  3DM1 A;  3MXU A;  4XQJ A;  4BY1 H;  3MC0 B;  2DNE A;  2F0W A;  4B9W A;  1PHJ A;  2WB1 G;  3OIP A;  5C4X B;  1SSO A;  2P5Z X;  2JA5 H;  5JPN C;  3M4P A;  4R8N A;  3M3Y B;  1ILQ A;  1S5B D;  3E3X A;  2IX1 A;  1I4R A;  4MN3 A;  5JJZ A;  2HIV A;  1E2V A;  2G9H D;  3K59 A;  1Z6H A;  3VR3 A;  1QZH A;  1LT4 D;  2ID0 A;  4LF5 L;  2R7Z G;  3EA6 A;  1M1K C;  3DUZ A;  1GKH A;  1SE3 A;  2QW7 A;  3LNN A;  4DV1 Q;  1QVF A;  4HCE A;  2K32 A;  3NE5 B;  4HJ5 A;  1VQN A;  1I4H A;  4FYD A;  1UNS A;  3D6W A;  3QO2 A;  5KNB A;  2JXM B;  4LF7 L;  3V96 A;  1HA6 A;  1W6J A;  2QGQ A;  1CA5 A;  2AMC B;  3VYR A;  2VNU D;  4DV3 Q;  4LFB Q;  1XNR L;  2EYH A;  2EYM A;  3S24 A;  1C4Q A;  1Y8O B;  4XIG S;  1SFO B;  3PIO A;  2PYK A;  3RR5 A;  3KBG A;  4G57 A;  4V19 0;  3BDC A;  3PUZ A;  1RL2 A;  4DV7 L;  4MIU A;  2F0K A;  4DR7 Q;  4GLV B;  3P7J A;  4IJH A;  2KEE A;  3A54 A;  2ES2 A;  2OTJ A;  1AE3 A;  4RG1 A;  4JI2 Q;  2L4N A;  4A3F G;  2SNS A;  2WAQ E;  1WFQ A;  2WAQ B;  3PGZ A;  4FXD A;  3O13 A;  3CMA A;  4KV6 A;  4X62 L;  2R3Z A;  4QCL A;  4QQB X;  4G7O C;  3SK5 A;  1N36 L;  5CV9 A;  1PRT D;  3CPW A;  3DMU A;  2UXB Q;  3OYY A;  1PYB A;  3QWN A;  2DY7 A;  1S4Z A;  4A3C G;  3Q8D A;  2FFK B;  5A35 A;  3T16 A;  3D8G A;  4A3K H;  3GD7 A;  1ESR A;  3K57 A;  2B8G A;  4UDU C;  1EU4 A;  4I7Z C;  1DYQ A;  1EQV A;  2EYJ A;  3D4W A;  2F0U A;  4JOI C;  3U9O A;  5E3F A;  4A3J G;  5JJK A;  2XSC A;  1QOH A;  1V1Q A;  4DV5 L;  1X65 A;  4JI0 L;  5I9P A;  3OTO Q;  5IYB G;  1SE4 A;  4DV3 L;  1T5X D;  4X64 Q;  5AFW A;  1M4V A;  1VQD A;  4DV0 Q;  2LMC B;  3RN5 A;  3NBI A;  5IYD G;  2XIW A;  3LX0 A;  2ZTE A;  1R4P B;  2SDF A;  1TY2 A;  1CA6 A;  1EY7 A;  4H13 C;  4M8A A;  2QEX A;  1IBK Q;  1K8A C;  1JJ2 A;  5E4X A;  1B7Y B;  3F2U A;  5M5Y B;  4KMU C;  2PPB C;  5DM6 3;  3HOW G;  2OQ0 A;  4XYO A;  1LAB A;  3MA2 B;  1TS5 A;  3NBH B;  2HIX A;  1E7Z A;  1Q90 A;  2KOL A;  3K5M A;  3HOY G;  3KLS A;  4DK1 A;  4DR3 Q;  3TP7 A;  1JQY D;  4HJ9 A;  1CHP D;  4BY1 B;  1GUN A;  2NUC A;  4J1M A;  3PMF A;  1PFM A;  1TWG B;  1GO3 E;  3CME A;  2OQK A;  3CCQ A;  2KJX A;  2O2L D;  3FMC A;  5FLM H;  1WOC A;  4FDB A;  5CBE E;  2K5N A;  1TWH B;  2VQF L;  1VQP A;  4DV2 Q;  2WFW A;  1B8A A;  1CSP A;  2R61 A;  4UP7 A;  1RTO A;  4FVM A;  4FF4 A;  3CQZ H;  1L2F A;  3J81 c;  1XNQ L;  1XMO Q;  4YY3 Q;  4K5W A;  4HTH A;  2VW9 A;  4KHP L;  1PRT F;  2CQA A;  2EIF A;  1VQH A;  4TSS A;  3W3A A;  2B29 A;  4G7H C;  3NXW A;  3VDY A;  1JB7 A;  3JC6 6;  3OHX C;  3UE1 A;  1QVC A;  2LKV A;  3P75 A;  4F7X A;  1QWY A;  4OIJ A;  5C44 H;  3EQL C;  5ELC A;  1VQ9 A;  1WD0 A;  5IGG A;  2GA4 B;  2F3V A;  1UWV A;  3HS0 C;  4FF3 A;  1GUS A;  1ML0 D;  2HUG A;  4CDD C;  1U4R A;  1NMG A;  2E75 C;  1IKM A;  2MGS A;  3TBI B;  3K5L A;  5GAD C;  3IFT A;  2CH4 A;  2EYL A;  2EY6 A;  3PIO 3;  1XMQ L;  2PZW A;  2E2I B;  2OT2 A;  1S3O A;  5CBA E;  1EYC A;  4WRD A;  1L1O C;  5EKL A;  4LUZ A;  4WJ3 M;  4UP8 A;  1HZC A;  4DR6 Q;  3DEP A;  4C3I B;  4YCU A;  1K28 A;  3VR5 A;  2N49 A;  1X3G A;  3J80 c;  5FLX c;  2Q2H A;  3L3O C;  1PDQ A;  2JQO A;  3MFG A;  3D6C A;  1DON A;  3P20 A;  3JAM c;  4K6L A;  1XTD A;  4IQZ A;  2ZT9 C;  4XYQ A;  2OCE A;  2ZJR A;  1SYC A;  2CQO A;  5IOC A;  4RKL A;  1F9P A;  3TEH B;  2R92 B;  4DR1 Q;  2KHS A;  4YCW A;  1XMO L;  1X6O A;  1YVC A;  3GTM H;  2K1B A;  1WTO A;  3CCS A;  1TWF B;  4NPS A;  3W1B A;  1XNR Q;  1WTH A;  5C44 B;  1X9N A;  4DR4 L;  4ZKB B;  1RD9 D;  4NXN Q;  4E6I A;  4A3F H;  1CQV A;  4PZ6 A;  4B3R Q;  4DUY L;  2K5V A;  2GVA A;  3C1E A;  5F2D A;  5KND A;  4BY7 G;  1K83 B;  4RAU C;  3HOX G;  4A3I G;  5C0X J;  1YIT A;  3RLO A;  3G7L A;  3IRB A;  1WCM B;  4TRD A;  1RJT A;  2SOB A;  3M4O B;  1JOK A;  2R7Z B;  4X6A H;  1IYU A;  3OPO A;  5KGU A;  4N9P A;  1F9S A;  1V1O A;  3D3R A;  2IHF A;  2E2D C;  4HMJ A;  1HCZ A;  1OTC A;  4DAY B;  4LFB L;  4K2K A;  1TWG H;  4JI4 L;  1HUM A;  1HFG A;  5CV8 A;  5LMN L;  2F0P A;  1SXT A;  1WCM G;  1BO0 A;  3M9B A;  5C5M A;  2YTV A;  4EX5 A;  1O7Y A;  1P16 A;  4LJZ C;  2JN4 A;  2PQE A;  2CH4 W;  4A3D G;  1JCK B;  3HOV B;  1H9R A;  4KKT A;  3SGI A;  3KF8 B;  2IWH A;  2UXD Q;  4HJ7 A;  3HZX A;  1Z7T A;  4ZUJ A;  1S5F D;  4PV1 C;  1GD7 A;  1KD1 C;  1X3P A;  5D65 A;  3T1Y L;  3H09 A;  4ODG A;  1I6H H;  3GTP B;  1YNN D;  3PIP 3;  1LTT D;  2CFM A;  3VR4 A;  2EE1 A;  5HY6 A;  4BBR B;  2JA7 G;  4A3M H;  1PXU A;  5I6Y A;  2Z9H A;  5TSS A;  1PH6 A;  3NK9 A;  1L1O A;  2K7V A;  3GDE A;  4ZK9 B;  5M3F B;  2LXK A;  2E8G A;  3S1N B;  1WD1 A;  1L1O B;  2CHB D;  4GS3 A;  4IAL A;  2IY5 B;  1Q7Y C;  2H5X A;  4LF6 L;  4HR7 B;  1SYG A;  2DJG C;  2RDH A;  4XT3 B;  1PH5 A;  4LK1 C;  1EOV A;  5T1I A;  3CCV A;  5KIX A;  1ENA A;  4F88 A;  5K5P A;  5KRU A;  1CUK A;  4A75 A;  3VA5 A;  4GKK Q;  4JI1 L;  2NVX B;  2B63 B;  1BCP C;  3AFQ A;  5LMU L;  1HR0 W;  3I4M H;  3PO3 H;  4C3I H;  3UDI A;  3F1Z A;  4J15 A;  3H94 A;  1N9W A;  1EOT A;  1B3A A;  2KHJ A;  3M4Y A;  5K36 H;  3TZD A;  3NHH A;  1J8I A;  5E1F A;  4AYB G;  2WKD A;  3SK8 A;  4IUN A;  3ND8 A;  1JJC B;  3GTK B;  1Q46 A;  1G2T A;  5LL6 X;  1U9R A;  3I90 A;  1HQM C;  2E2H B;  1ASY A;  3ERS X;  3OSO A;  1RF2 D;  2PNR C;  2XRS D;  4KJO A;  1O7Z A;  3IL8 A;  3NBH A;  1YBY A;  2L1B A;  4OHJ A;  3OWE B;  1SND A;  4C1N K;  1Y8P B;  1TWF H;  3TS0 A;  5A2Q L;  4FO2 A;  3J7A V;  3I4M G;  2F0T A;  4JI3 L;  3PO3 G;  1LT3 D;  2OEO A;  1J6Q A;  5CV5 A;  5M3F G;  3K81 C;  5I2X A;  3CC7 A;  4AH6 A;  1KTK A;  4ZLT F;  5CV4 A;  1KRS A;  2FHT A;  1EQT A;  3EN2 A;  4ILW A;  2RA4 A;  3A74 A;  1YJ9 A;  5IT9 c;  2R93 B;  5IYD H;  3S1Q H;  1UE6 A;  1IL8 A;  1X3Q A;  4FF2 A;  4FXK C;  3EVQ A;  1GXD C;  4YIJ A;  3H0G G;  2BH8 A;  4QL5 A;  3MZ5 A;  5ELF A;  1BBX C;  1VQA A;  2MO1 A;  2EDG A;  3L2P A;  1BQQ T;  5IGE A;  2J0T D;  5IP7 H;  4OWT B;  1Y1V H;  2A6H C;  1QUQ B;  2TMP A;  1JC7 A;  3OW7 A;  3MHB A;  3S1M H;  4DAP A;  3CCL A;  2D0P A;  1IW7 C;  1SNC A;  2H1E A;  3EBE A;  1ET9 A;  1S40 A;  5I4D A;  3OW2 A;  1PTO H;  2XGT A;  2JK8 A;  1H9S A;  2HD3 A;  2R7D A;  2B63 H;  3SK6 A;  1ZKO A;  2F1M A;  1KDA A;  2XN9 C;  3MTS A;  2UXB L;  3FPU B;  3BDO A;  3ER0 A;  3TQY A;  3GTJ B;  4J6H A;  2KUM A;  4IJL A;  1Q1B A;  3JAM E;  3U58 A;  3NQI A;  2XRQ D;  4JBJ A;  3HOW B;  1PH8 A;  3CCU A;  1JWM D;  4C3H G;  4DKA C;  5J39 A;  2RCN A;  5FLX L;  1Y1V G;  2VQE L;  2AQ3 B;  3U9S A;  3E6Z X;  2MPM A;  2MNA A;  1JWU D;  5M9O A;  1EWI A;  2LSS A;  4IFD H;  4DR2 Q;  1J5E Q;  3J7Z C;  1SR3 A;  1C48 A;  4ID6 A;  4JI6 Q;  1CT1 D;  2K5D A;  2A19 A;  3Q0A A;  2FXQ A;  3FRP B;  5C6A A;  3I4L A;  5FK9 C;  2K6A A;  1TWA H;  4LF4 Q;  3CRL C;  2DGY A;  3I4M B;  3PO3 B;  3BVG A;  1PZK D;  2K01 A;  2JA8 G;  5IP7 G;  4A3B G;  3I2Z A;  1GUT A;  1FJG L;  3A8J E;  1TR5 A;  1U4M A;  5D3D A;  4JV5 Q;  4DXG A;  3R2T A;  4KN4 C;  5IOD A;  2NVT B;  4JC0 A;  4EQP A;  2RF4 A;  1B3Q A;  2YTY A;  4DU9 A;  2KEC A;  3GTO B;  2B2W A;  2JA8 B;  4DN4 M;  4NKL A;  1CFM A;  5C3E G;  2E2J H;  2O5J C;  1F2M A;  1KDB A;  4DA2 A;  3DEO A;  2BE5 C;  1GUW A;  1KAB A;  3DWA A;  3S1M B;  2F0O A;  2Q8I B;  4AQY Q;  3OTO L;  1PH9 A;  4A93 G;  3PV0 A;  1HFN A;  3KK7 A;  2WB1 E;  1MKH A;  2JA7 H;  2VB2 X;  3UDX A;  4IPH A;  2VQE Q;  4P73 A;  3RMH A;  4OWX B;  3VA7 A;  3NTI A;  5JVG 3;  4YCV A;  3KJP A;  1C9O A;  2RVL A;  3S17 H;  4A93 B;  3F8T A;  2ZXR A;  1M8A A;  2N3S A;  3I7F A;  3IAY A;  1B50 A;  2Q8T A;  3OWF A;  1F9R A;  5C4Z A;  3ITP A;  3QG1 A;  4TQU S;  4KK7 A;  1BOS A;  4ZAI A;  2FJ2 A;  4UY8 C;  3OMG A;  2EXZ A;  2B2Y A;  4LF9 L;  1GUG A;  3HOY H;  3S2H H;  3J81 j;  5IGF A;  4A93 H;  3S17 B;  4O42 A;  4EGV A;  4A3B B;  1BR9 A;  5J22 A;  1IXR A;  1XPO A;  3BS1 A;  1STH A;  1V1P B;  2FIN B;  4DNI A;  3H91 A;  1Y1W H;  4O0A A;  4PZ8 A;  1PH4 A;  1STB A;  1NTG A;  1K8G A;  4N9T A;  1JR0 D;  4EQN A;  5G3L D;  5JVH 3;  1F2Z A;  5EKI A;  1PRT C;  2PW5 A;  3BG3 A;  4IUU A;  3CPF A;  5CYU A;  3E5S A;  2AQ2 B;  1D6E C;  2IX3 A;  1LT5 D;  2NTS A;  1MIU A;  1ILP A;  4B08 A;  5FJ8 G;  3PUY A;  3H0G B;  5CMD A;  2WP8 J;  1OXV A;  1ROD A;  2K75 A;  1E2Z A;  4RFB A;  3GTQ B;  1U4P A;  4CDE C;  5CV7 A;  4QY7 A;  1G6Z A;  2QIL A;  3I70 A;  1XYI A;  3KLR A;  3AEV A;  2E2J B;  3M7N A;  2R7Z H;  2K5W A;  3QJY A;  2ZJP A;  1K8M A;  3GTM B;  1CKO A;  2MHV A;  1PFB A;  1B9N A;  3E0E A;  2Q2T A;  1ENF A;  1WTR A;  3BYY B;  2PNH A;  2ZTD A;  3RLF A;  1S5E D;  4OO1 G;  2B3G A;  1IBL Q;  1F9Q A;  2I5L X;  3H3V H;  4BBS B;  1AH9 A;  2UXC L;  1A0I A;  2B39 A;  2WAQ G;  1NY4 A;  2GVB A;  5IYC G;  1EWC A;  4OXP A;  3STB D;  3U50 C;  2QEJ C;  1SFO H;  3M85 A;  1PTO D;  2WIN B;  4DR5 Q;  3HG9 A;  1VQB A;  4L5S A;  4GOP A;  4R4C A;  1LAC A;  3BYT B;  3E0J A;  1YHB A;  5KEE A;  5M5W B;  2JJQ A;  4JW0 A;  4QUC A;  3HOU H;  1LM0 A;  1D2B A;  5AJ3 Q;  4RHR A;  1O78 A;  2CW0 D;  3WOF A;  3HFZ B;  3G71 A;  3NWT A;  4C2M B;  4H0L C;  4KTA A;  1OXU A;  4Y52 H;  1IYJ B;  3OMC A;  1H9K A;  4YWL A;  5K36 G;  1MBY A;  1CKN B;  4A3I B;  2R93 G;  3CP0 A;  1DOL A;  2PW7 A;  2VY3 A;  5M5W H;  3NEM A;  2Z4I A;  2YU9 B;  5CR3 A;  4A3L G;  2D2C C;  1WJJ A;  4YY3 L;  5IGC A;  4X65 L;  4LAA A;  1HNX L;  1CM9 A;  1R9T B;  5GAH C;  4IFD G;  4QIW E;  3C1F A;  1AEX A;  4KHZ A;  3WDN A;  1HJP A;  4A3J H;  2V4D A;  1A6X A;  4PNY A;  5J1Z A;  1AW7 A;  3HOZ B;  1YEZ A;  3T51 B;  1L0W A;  2VUM H;  4H02 A;  4L5R C;  4BY1 G;  4LFA Q;  4K2L A;  1BBU A;  1SJE D;  2EY1 A;  1FJG Q;  3KFU A;  3KDF A;  1L0X B;  1XX8 A;  1A15 A;  1D5M C;  3NPP A;  3FKI B;  1VCI A;  2JA6 H;  2NB0 A;  4A3B H;  1Q1E A;  2CVR A;  4H44 C;  3RUZ A;  4IUP A;  5COR A;  2A73 B;  2K28 A;  1WTP A;  1OO9 B;  4LNQ A;  1FGU A;  3PQI A;  4UP9 A;  4MTK A;  4DR2 L;  1PRT B;  1J5E L;  3J80 E;  3FDT A;  2IL8 A;  4CJ2 C;  4UHV A;  3S14 B;  3NP8 A;  1UE1 A;  1ZYR D;  1VQ4 A;  1ZEQ X;  2C5C A;  2L55 A;  1DOM A;  4R4Q A;  2I5H A;  5FLM G;  1WTW A;  2BDO A;  2TSS A;  1D8L A;  4XT1 B;  2A6E C;  3I4N G;  4L8J A;  1Q86 C;  3ULJ A;  1ICF B;  2HCI A;  2HHH Q;  1NAP A;  4BXX H;  2EJF C;  1NMF A;  5JJL A;  2PCF B;  2LXJ A;  3I73 A;  1VQK A;  1I50 H;  3I4O A;  1UEA B;  4DUZ Q;  1XTC D;  5EJW A;  1BUV T;  4LF6 Q;  3CKI B;  4HIK A;  1I3Q B;  4BY7 H;  1SE2 A;  5C4J H;  3KYH C;  1MHW C;  4GZY C;  1IL2 A;  1DGS A;  1W6K A;  2CW0 C;  2NN6 H;  2NVT H;  1Y1W G;  3BDL A;  3BZC A;  3K5O A;  2JA9 A;  2B2V A;  4HJ8 A;  1E0B A;  2HDM A;  3FKI G;  2PZT A;  3CCM A;  1JOO A;  4ME3 A;  3TSS A;  4JI5 L;  4DV7 Q;  4N8X 1;  4DF7 A;  1SMX A;  4F8M A;  3TP5 A;  3M7G A;  1CSQ A;  4XQQ A;  3S1Q B;  4ZYS A;  2WKC A;  2MFI A;  2NZO A;  3NEN A;  5IT9 E;  3HOZ G;  3FPP A;  3W2D A;  1S72 A;  1RKN A;  3PIP A;  3CCR A;  4HMI A;  1BVS A;  4DNR B;  3T1H Q;  1N36 Q;  5EAY A;  2PQA A;  1X3F A;  2Z0S A;  3RZO H;  1B53 A;  3OIQ A;  4ZUI A;  1KRT A;  1KNE A;  3T56 B;  1X32 A;  3JAM i;  3W5O A;  2HT1 A;  4IPG A;  1EIG A;  1VS0 A;  3X3M A;  5CC4 A;  4JPB W;  1TKW B;  4RCO A;  1G91 A;  2F0S A;  2CWP A;  3BZD B;  4K5X A;  3ND9 A;  4XTC S;  1AZP A;  1STN A;  2F0E A;  4XQN A;  3RD4 A;  3A56 A;  1DCZ A;  4X64 L;  3HOZ H;  1YNN C;  3HP3 A;  4R4I A;  4L5Q A;  4QMG A;  5JOB A;  3ULL A;  5C4H A;  3QB3 A;  1KC8 C;  4DV6 L;  5GAG C;  1R9T H;  4DK3 C;  5IYC H;  4AYB E;  3NUC A;  4KD3 A;  1Y1W B;  1UUP A;  2RSO A;  2L15 A;  5COY A;  1L0Y B;  3PO2 B;  3L7Z C;  2F0H A;  1YZ6 A;  3BU2 A;  2E2H H;  1PZJ D;  3EIV A;  2YTX A;  4QIW B;  1ASZ A;  1BF4 A;  5IGB A;  1HHV A;  3J80 i;  2DN8 A;  4R8I A;  1VF5 C;  4DGZ A;  4OEL B;  3HOV H;  1HA5 A;  1VMP A;  2KEN A;  3BVZ A;  3G6J B;  1AN8 A;  1NNX A;  1LTB D;  1VF7 A;  3HOX H;  1EY8 A;  2F0F A;  1D5Z C;  3WWV A;  4JI7 L;  3SVM A;  3R2I A;  1DJR D;  4C3H B;  2NTT A;  1LTI D;  1JMC A;  1HTL D;  5EKK A;  2L0C A;  1CK1 A;  1HQR D;  4G4K A;  5JPM C;  1QVG A;  1PH3 A;  2GN5 A;  4LF5 Q;  2N55 A;  2IJ0 A;  4JYA L;  5ELD A;  4JVZ A;  1HNX Q;  3C2P A;  2D62 A;  1O80 A;  4K8I A;  1V8Q A;  1WYD A;  2Y0S B;  4LW1 A;  1A2U A;  3GQB A;  4CKB A;  4X66 Q;  5BN3 A;  1A8V A;  1GJX A;  2F3I A;  5M3M G;  1KNA A;  3A8K E;  3I8Z A;  3DWP A;  1I94 L;  2JA5 G;  4PG3 A;  3FHW A;  3DHQ A;  4JV5 L;  1Q3L A;  2WV6 D;  2N8N A;  4IPC A;  1SN8 A;  4DK0 A;  2VB3 X;  2X6G A;  4KY6 A;  2XTI A;  1K9M C;  4A4I A;  1YI2 A;  4QGU A;  1SEB D;  2CKZ B;  1TWH H;  4YHH Q;  2IX0 A;  1I5F A;  3TDQ A;  3I55 A;  1HZB A;  2DNC A;  2ENB A;  1VQM A;  3OOC A;  3QOJ A;  4X65 Q;  2NVY B;  1SMY C;  3C46 A;  1SMY D;  2HQE A;  3S16 B;  3PF4 A;  4X62 Q;  4CJ1 B;  2X69 A;  2MUY A;  2G5D A;  5DNF A;  1DM0 B;  4JI0 Q;  1VQJ A; 
#chains in the Genus database with same CATH homology
 1U5K A;  2JA8 H;  4A3G H;  2JA8 G;  4DR7 Q;  5IWA Q;  4GLV B;  4IJH A;  3GTJ H;  2YU9 H;  5IP7 G;  4A3B G;  2IT1 A;  3I2Z A;  1VQ6 A;  2ES2 A;  1FJG L;  2OTJ A;  1AE3 A;  4RG1 A;  2KCM A;  4JI2 Q;  3DM3 A;  4A3F G;  1GVP A;  3L0O A;  4JV5 Q;  2WAQ E;  1WFQ A;  3KLW A;  3PGZ A;  4JC0 A;  3CMA A;  1VQO A;  2EXD A;  4YWM A;  3GTG H;  1LTL A;  4X62 L;  2AWO A;  2RF4 A;  2YTY A;  1PH7 A;  4QQB X;  1N36 L;  4LF4 L;  1V9P A;  1EUJ A;  5C3E H;  5C3E G;  3CCE A;  1Q81 C;  2E2J H;  2QA4 A;  2EQS A;  3CPW A;  4DV4 L;  2UXB Q;  3OYY A;  1PYB A;  1W3S A;  4POF A;  4A3C G;  3Q8D A;  4DPG A;  4AQY Q;  5ELO A;  1VQC A;  3OTO L;  2ALY B;  3I56 A;  3RN2 A;  2E2I H;  4A3K H;  1PH9 A;  3GD7 A;  1K73 C;  4A93 G;  3U4Z A;  1PFS A;  1N32 Q;  1KAW A;  3PV0 A;  1TXY A;  1X56 A;  3PUV A;  5C0X G;  2WB1 E;  1MKH A;  2JA7 H;  1D7Q A;  3UDX A;  2F4V Q;  4IPH A;  2VQE Q;  3RLN A;  4GNX B;  1N34 Q;  1VQL A;  1X3E A;  4JOI C;  4P73 A;  3S2D H;  5JEA J;  3AQQ A;  4A3J G;  5JJK A;  1VQI A;  2K5H A;  4OWX B;  4A3K G;  1V1Q A;  4MNO A;  4YCV A;  3KJP A;  1C9O A;  1SRU A;  1EIY B;  3S17 H;  4DV5 L;  3F8T A;  1X65 A;  4JI0 L;  1YHA A;  3FP9 A;  2N78 A;  5IYB G;  3OTO Q;  4DV3 L;  4X64 Q;  2N3S A;  1VQD A;  4DV0 Q;  1IBM Q;  3I7F A;  5IYD G;  3RN5 A;  3S14 H;  3UDF A;  4HIO A;  2ZTE A;  1P8L A;  2K4K A;  2R92 G;  3TRZ A;  4JI4 Q;  3PO2 G;  1HNW L;  4TQU S;  1PVO A;  1VQ7 A;  2QEX A;  2UU9 Q;  1IBK Q;  4POG A;  1K8A C;  1JJ2 A;  1X55 A;  4UY8 C;  1B7Y B;  3HOW G;  2VQF Q;  2OQ0 A;  1YIJ A;  2KCT A;  4LF9 L;  3HOY H;  3NBH B;  2HIX A;  1E7Z A;  3HOY G;  3J81 j;  3S2H H;  2YV5 A;  4LF8 Q;  4DR3 Q;  4A93 H;  4HJ9 A;  3CF5 A;  5LMN Q;  1IXR A;  2VUM G;  1XPO A;  3HKZ E;  1BBW A;  3HOU G;  4DNI A;  1GO3 E;  3CME A;  2OQK A;  3CCQ A;  1Y1W H;  1EFW A;  4O0A A;  3AFP A;  4PZ8 A;  1PH4 A;  4APV A;  5ELN A;  1IBL L;  4OWW B;  1NTG A;  5FLM H;  1K8G A;  4L5T A;  1WOC A;  4FDB A;  2K5N A;  2VQF L;  1KQS A;  1VQP A;  1TWC H;  4DV2 Q;  1I94 Q;  2WFW A;  3F2C A;  1Z9F A;  3LGJ A;  3H15 A;  1B8A A;  1CSP A;  4UP7 A;  3CPF A;  4NXM Q;  2MQH A;  1OXS C;  2NZH A;  5IY0 A;  4B3T Q;  4P74 A;  4DV5 Q;  4R4O A;  3CQZ H;  1L2F A;  3J81 c;  1XNQ L;  1XMO Q;  3GTQ H;  4YY3 Q;  2VW9 A;  4KHP L;  3PUW A;  3FKI H;  1OXX K;  1UE7 A;  1Q82 C;  3F2D A;  2EIF A;  4JYA Q;  1MIU A;  1VQH A;  2OTL A;  3I4N H;  4DK6 C;  5FJ8 H;  5M5Y H;  1FVI A;  5FJ8 G;  3U4V A;  3ULP A;  3PUY A;  4JI0 Q;  2B29 A;  2WP8 J;  4OX9 Q;  1OXV A;  3VDY A;  1RIP A;  2MO0 A;  1JB7 A;  1IBK L;  3JC6 6;  3D0F A;  1HNZ L;  2K75 A;  2K50 A;  4NXN L;  3UE1 A;  1QVC A;  3DLL A;  4QY7 A;  3A0J A;  4K0K Q;  1WCM H;  5C44 H;  3E9H A;  1JJG A;  5AJ3 L;  3AEV A;  3M7N A;  2R7Z H;  5BR8 L;  1VQ9 A;  2I0Q A;  2ZJP A;  1G6P A;  1CKO A;  1UWV A;  3E0E A;  2AHO B;  2Q2T A;  3NEL A;  2Q2I A;  1IZ6 A;  1NMG A;  2PNH A;  3HOV G;  2ZTD A;  3RLF A;  4B3M L;  3PO2 H;  1EYG A;  4OO1 G;  2B3G A;  4JI8 Q;  1CKN A;  5M3F H;  1BKB A;  1IBL Q;  4IFD I;  1SLJ A;  2I5L X;  3H3V H;  4DV7 L;  2UXC L;  5IWA L;  1AH9 A;  1A0I A;  5GAD C;  4DR3 L;  2NN6 G;  2WAQ G;  4B3S Q;  1NY4 A;  2GVB A;  5IYC G;  4Y7N H;  1XMQ L;  3STB C;  4OXP A;  3STB D;  3U50 C;  4LFA L;  2UUB Q;  1PA6 A;  1YHQ A;  4GKK L;  1VQG A;  3S16 H;  3PCO B;  4PMW A;  2A1A A;  1S3O A;  1SFO H;  3M85 A;  2E5L L;  1L1O C;  4DR5 Q;  3H0G H;  3HOW H;  1VQB A;  4JI8 L;  5M3M H;  4L5S A;  4A3C H;  4GOP A;  4LUZ A;  4WJ3 M;  4R4C A;  2ZJQ A;  2UUC Q;  4UP8 A;  1HZC A;  4JBM A;  4JI6 L;  4X66 L;  1YHB A;  3PF5 A;  4DR6 Q;  2JJQ A;  4NB3 A;  4NXM L;  4YCU A;  1XNQ Q;  1I3Q H;  4LUO A;  5GQO A;  2N49 A;  1PH1 A;  1X3G A;  4A3I H;  3J80 c;  5FLX c;  3HOU H;  1LM0 A;  2Q2H A;  3KOJ A;  5AJ3 Q;  2JQO A;  3HFZ B;  5BR8 Q;  5M5X H;  3G71 A;  3JAM c;  1X54 A;  1OXU A;  1N34 L;  1IYJ B;  1XTD A;  4Y52 H;  2DUD A;  3HKZ G;  4BBS G;  4YWL A;  4BBS H;  2OCE A;  3BJU A;  2ZJR A;  5LMU Q;  5K36 G;  1CKN B;  2CQO A;  4K0K L;  4BA2 I;  3CP0 A;  3TRE A;  1N33 Q;  2R93 G;  2ZM6 L;  2VY3 A;  4R1J A;  5M5W H;  3S15 H;  3TEH B;  3NEM A;  3CW2 C;  4A3L G;  2R6G A;  3CXC A;  4DR1 Q;  1WJJ A;  4B3T L;  4YCW A;  4KLK A;  4P72 A;  1V43 A;  1XMQ Q;  1XMO L;  1X6O A;  1YVC A;  4YY3 L;  2Q2U A;  3GTM H;  4HID A;  1HNX L;  4X65 L;  3CCS A;  1HR0 L;  3W1B A;  4NPS A;  4TVA B;  5GAH C;  4QIW E;  1C7Y A;  4IFD G;  1PH2 A;  1XNR Q;  4KHZ A;  4C2M H;  2AWN A;  1VQ8 A;  1CKM A;  1HJP A;  4A3J H;  5GRO A;  1YEZ A;  1X9N A;  1L0W A;  4DR4 L;  3PSI A;  2VUM H;  2KBN A;  4H02 A;  4HJA A;  4BY1 G;  4L5R C;  4DR6 L;  4NXN Q;  4EQ5 A;  4A3F H;  4LFA Q;  2ATW A;  4LUV A;  5C4X G;  1QUQ A;  1BBU A;  4PZ6 A;  4A3E G;  4A3E H;  2JEA I;  4B3R Q;  1FJG Q;  3KFU A;  1E1O A;  1Y14 B;  3KDF A;  2K5V A;  5J3B A;  2GVA A;  5IP9 G;  4DUY L;  2BH2 A;  4A3G G;  2PMZ E;  2JA6 G;  1VCI A;  4ALP A;  2JA6 H;  4A3B H;  1Q1E A;  1YJN A;  4GOP C;  1XJV A;  4BY7 G;  1HZA A;  4IO9 A;  1K83 H;  2RHQ B;  3HOX G;  4DUZ L;  1WI5 A;  4A3I G;  5C0X J;  1YIT A;  1PV4 A;  3RLO A;  1JE5 A;  3IRB A;  4GN3 B;  4JG2 A;  4LNQ A;  1T9H A;  1FGU A;  4UP9 A;  1XPU A;  3RZD H;  3TS2 A;  4X6A H;  1LYL A;  4QJF A;  2Y0S E;  4DV0 L;  1M90 C;  3F2B A;  4DR2 L;  2I5M X;  2IHF A;  1J5E L;  1E3P A;  5H1S E;  1OTC A;  4DAY B;  4LFB L;  4DR1 L;  1TWG H;  4JI4 L;  2B63 G;  2VZA A;  1UE1 A;  4BBR G;  3CCJ A;  5LMN L;  1VQ4 A;  1UE5 A;  1O7I A;  3BZK A;  4YWK A;  4A3D H;  1H95 A;  1JT8 A;  5IE8 A;  4R4Q A;  1PYS B;  2I5H A;  1WCM G;  5JEA G;  5FLM G;  2E5L Q;  3M4O H;  1D8L A;  3M9B A;  4BA1 I;  3GTO H;  2NN6 I;  2C35 B;  3GTP H;  1UEB A;  3H3V I;  3AYH B;  2YTV A;  2CWA A;  4EX5 A;  3I4N G;  1P16 A;  1Q86 C;  4GNX C;  3ULJ A;  2YYZ A;  1Q12 A;  4A3M G;  3UDG A;  4A3D G;  1HZ9 A;  5IP9 H;  2CCZ A;  3GTL H;  2HHH Q;  1E24 A;  1G51 A;  3SGI A;  3KF8 B;  2K14 A;  4BXX H;  2UXD Q;  1KIX A;  4HJ7 A;  1IBM L;  2V1C C;  4B3R L;  4GN5 A;  2KHI A;  4MZ9 A;  1NMF A;  4GNX A;  5JJL A;  3MXN B;  2LXJ A;  1HNW Q;  1GD7 A;  1VQK A;  2NVX H;  1I50 H;  3I4O A;  4PZ7 A;  2Z6K C;  1KD1 C;  4DR4 Q;  5E7N A;  4DV4 Q;  4DUZ Q;  2UU9 L;  3T1Y L;  4JI5 Q;  4IOA A;  1I6H H;  2Y0S G;  4LFC L;  4LF6 Q;  2CFM A;  4BXX G;  4HIK A;  4BY7 H;  5C4J H;  2HHH L;  4P75 A;  4DUY Q;  3KYH C;  5HY6 A;  1IL2 A;  2JA7 G;  1DGS A;  2Z6K A;  4A3M H;  1N32 L;  2NVT H;  1KHI A;  1Y1W G;  4JBK A;  2PI2 A;  3BZC A;  2HQL A;  1PH6 A;  2JA9 A;  4DV6 Q;  3J7A 5;  4JCV E;  1L1O A;  3GDE A;  4OON A;  4HJ8 A;  3FKI G;  4GKJ Q;  4OX9 L;  2LXK A;  4DV1 L;  3CCM A;  2UUA L;  4ME3 A;  2E8G A;  1A62 A;  4JI5 L;  1L1O B;  4DV7 Q;  4GS3 A;  1SMX A;  1VQE A;  2IY5 B;  1Q7Y C;  2H5X A;  4DR7 L;  1QZG A;  4LF6 L;  2JEB I;  4BBR H;  1CSQ A;  5JJI A;  3UE0 A;  1PH5 A;  2UXC Q;  2MFI A;  4IPD A;  4JOI A;  1YJW A;  1E1T A;  2NZO A;  3NEN A;  1EOV A;  3CCV A;  3HOZ G;  2D0O A;  1K3R A;  1S72 A;  1C0A A;  3MEF A;  5IYB H;  3PIP A;  1CUK A;  3CCR A;  2PQA B;  1BVS A;  4A75 A;  3GO5 A;  3T1H Q;  3K80 C;  4GKK Q;  4JI1 L;  3S1R H;  1OXT A;  1N8R C;  1N36 Q;  2UXD L;  3E9I A;  1NE3 A;  5EAY A;  2PQA A;  3AFQ A;  1X3F A;  3CC2 A;  2Z0S A;  3A5Z B;  5LMU L;  3HKS A;  4MTN A;  1HR0 W;  3RZO H;  3I4M H;  1E22 A;  4C3I H;  4DR5 L;  3UDI A;  3PO3 H;  1N33 L;  3F1Z A;  4C3J H;  2F4V L;  3G6E A;  4J15 A;  4KI0 A;  1HNZ Q;  1N9W A;  1KRT A;  3ICE A;  1Q8K A;  2KHJ A;  3JAM i;  4OO1 I;  3W5O A;  2HT1 A;  4IPG A;  4GN4 B;  1VS0 A;  1VQ5 A;  4JI2 L;  4AYB G;  3G48 A;  2ZTC A;  3D31 A;  4LWC A;  3GTK H;  1JJC B;  1Q46 A;  1VQF A;  2NVQ H;  2CWP A;  5DLQ E;  2UUC L;  3T1Y Q;  4XTC S;  4UPA A;  4B3M Q;  1ASY A;  3ERS X;  4LF7 Q;  2ASB A;  3M4Q A;  4JBW A;  1KL9 A;  4X64 L;  3HOZ H;  4GLA C;  4A3L H;  3CAM A;  1NJI C;  1YBY A;  2PI2 E;  4L5Q A;  4R4I A;  1YNX A;  3PUX A;  1HH2 P;  5C0X I;  3ULL A;  4LF8 L;  1KC8 C;  2R93 H;  4DV6 L;  5GAG C;  1TWF H;  3TS0 A;  1R9T H;  2UUB L;  5C4X H;  1G29 1;  4DK3 C;  4GKJ L;  5IYC H;  4AYB E;  2A8V A;  2NVY H;  4JI3 L;  3I4M G;  2L15 A;  3PO3 G;  1NBW A;  1EIF A;  4JI1 Q;  4JI7 Q;  1J6Q A;  2VL6 A;  3L7Z C;  5M3F G;  4RMF A;  3CD6 A;  3K81 C;  1YZ6 A;  3BU2 A;  4AH6 A;  3K8A A;  3CC7 A;  4IOC A;  2E2H H;  1KRS A;  3B6Y A;  1B70 B;  3K7A H;  3EIV A;  2YTX A;  1ASZ A;  3EN2 A;  1YJ9 A;  3A74 A;  1MJE A;  5IYD H;  5IT9 c;  3K0X A;  4LFC Q;  3S1Q H;  1GM5 A;  5LMN W;  3J80 i;  1UE6 A;  3K7U C;  3HOV H;  2KEN A;  3M3Y H;  4GLX A;  1KXL A;  1SE8 A;  4WJ4 A;  4JI3 Q;  3HOX H;  3H0G G;  2BH8 A;  3A5U A;  4QL5 A;  3WWV A;  4JI7 L;  2IHE A;  1VQA A;  1A63 A;  2MO1 A;  3L2P A;  5HGQ A;  5GAE C;  2RHS B;  4B3S L;  5IP7 H;  4OWT B;  1JMC A;  1Y1V H;  1QUQ B;  4LF9 Q;  2F52 A;  2ZM6 Q;  4BY1 H;  3ZJY C;  1QVG A;  1PH3 A;  1PHJ A;  2GN5 A;  4KHP Q;  2WB1 G;  3KJO A;  3S1M H;  4LF5 Q;  4IFD J;  4JYA L;  2JA5 H;  3M4P A;  4P71 A;  4DAM A;  3CCL A;  2D0P A;  1U0L A;  2OWO A;  1HNX Q;  3EBE A;  2D62 A;  4A76 A;  3T1H L;  1S40 A;  1WYD A;  2BA0 A;  4LW1 A;  3OW2 A;  3S1N H;  2XGT A;  2IX1 A;  2JK8 A;  3J81 i;  4X66 Q;  2R7D A;  1A8V A;  2B63 H;  2HIV A;  2F3I A;  5M3M G;  1W2B A;  3W1G A;  1Z47 A;  4YHH L;  4DV2 L;  2R92 H;  1EQR A;  1I94 L;  2JA5 G;  4C3H H;  4PG3 A;  1QZH A;  2UXB L;  3FHW A;  5C44 G;  3ER0 A;  3TQY A;  4JV5 L;  4AIM A;  2ID0 A;  4IJL A;  4LF5 L;  2VS1 A;  1M1K C;  2R7Z G;  1MJC A;  2N8N A;  1Q1B A;  4IPC A;  3PUZ A;  1GKH A;  3U58 A;  1XPR A;  1SN8 A;  1SRO A;  4JBJ A;  2XTI A;  3CCU A;  4DV1 Q;  1PH8 A;  1K9M C;  2UUA Q;  4A4I A;  1YI2 A;  1QVF A;  4HJ5 A;  4QGU A;  1VQN A;  4DKA C;  4GOP B;  2CKZ B;  2AKW B;  2RCN A;  1TWH H;  1Y1V G;  2VQE L;  4YHH Q;  4LF7 L;  4AQY L;  1EQQ A;  2QGQ A;  2IX0 A;  2MNA A;  2R7F A;  2AMC B;  1I5F A;  1EWI A;  1AE2 A;  2LSS A;  3I55 A;  2VNU D;  3RNU A;  1FL0 A;  1HZB A;  4DR2 Q;  1VQM A;  1K0R A;  1SR3 A;  3J7Z C;  4DV3 Q;  4O2D A;  1J5E Q;  3CC4 A;  4X65 Q;  1HR0 Q;  4LFB Q;  1LUZ A;  4R4T A;  3KDF B;  1XNR L;  3S24 A;  2BA1 A;  3KF6 B;  4X62 Q;  3PF4 A;  4XIG S;  4HIM A;  4JI6 Q;  3PIO A;  2A19 A;  2K52 A;  2FXQ A;  3KF6 A;  3RR5 A;  2JE6 I;  3G4S A;  4LF4 Q;  1TWA H;  1RL2 A;  2DGY A;  1VQJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...