2NVTH

Rna polymerase ii elongation complex in 150 mm mg+2 with gmpcpp
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription,transferase/dna-rna hybrid
molecule keywords 5'-R(*AP*AP*GP*AP*CP*CP*AP*GP*GP*C)-3'
publication title Structural basis of transcription: role of the trigger loop in substrate specificity and catalysis
pubmed doi rcsb
total genus 21
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2006-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2nvtH00
4R4IA 2OQKA 4DK6C 3RLOA 3HOUG 4KHPQ 4BA2I 4YHHL 3F2BA 2R7ZH 3EBEA 2I0QA 4JI5L 4ME3A 3CCRA 4HJ9A 1WI5A 2RCNA 1Z47A 2MO1A 3LGJA 1B8AA 3ZJYC 3GTGH 4DR7Q 2UXCL 1LUZA 1OXVA 3A5UA 1WYDA 4QJFA 1SN8A 4JYAQ 4UP9A 3BZCA 4PZ8A 3UE0A 4A75A 1EYGA 1VQKA 2R92H 4L5QA 3W5OA 1XJVA 1MJEA 3J80i 2GN5A 4DAMA 1LM0A 3KLWA 1AE3A 2JA8H 5C3EH 2Q2HA 5FLMH 3JAMc 1HNXL 3RZDH 1QZHA 2Z6KA 4GOPB 3RNUA 2QA4A 5M3FG 4YHHQ 1YHQA 1QZGA 3H3VH 3PSIA 4JI5Q 3K81C 1N8RC 3ER0A 1E24A 1HJPA 3KDFA 1FJGL 3K7UC 2GVAA 1KC8C 2UU9Q 4PZ6A 5IYCH 4GLXA 2OWOA 4NXML 2VQFL 2N8NA 3W1BA 2Y0SG 2JK8A 2I5LX 2N49A 2ZM6L 2CKZB 5IT9c 4X62Q 1PHJA 4BY7H 1N33L 1KL9A 1K9MC 4AH6A 3S16H 3NENA 4DV5L 2F52A 1HNXQ 1X54A 2OTLA 2R92G 3U50C 2PNHA 4GKJL 3CCSA 4AYBE 2Q2UA 2K5VA 4YWLA 4LF6Q 4UY8C 1W2BA 3TRZA 1TWFH 1EQQA 4LWCA 5FJ8G 4DUZL 3D0FA 5JEAJ 4LUOA 3KJPA 1QVGA 4DR4L 1U5KA 1FJGQ 1L1OC 3KF6A 3CC7A 3S1NH 4P71A 1X56A 3GTMH 1IZ6A 1T9HA 1B70B 1KRTA 4NXMQ 3H0GH 4LFAQ 2VQFQ 2DUDA 2YTXA 4JOIC 4GLAC 2A8VA 1OTCA 4NPSA 1IBMQ 3B6YA 1I50H 4IFDI 1Q8KA 1H95A 3PGZA 4P72A 2ZM6Q 2B29A 4BXXH 1HZCA 3PV0A 4PG3A 2HHHQ 2K5NA 1EIFA 4GN4B 1G291 2E5LL 2HIXA 2VUMH 4DV5Q 2N3SA 4HJ5A 1WJJA 3HKZE 3KFUA 3K80C 4X64L 4BY7G 1L2FA 3PUVA 1NE3A 5BR8Q 3L2PA 3CCQA 1KRSA 3ULJA 2A1AA 4LUVA 1P16A 2NZOA 3CMAA 3SGIA 2JA7H 1JJ2A 2IHEA 2R93H 1TWCH 4BA1I 5JJKA 4DR1Q 1YJWA 1VQMA 2L15A 3MEFA 4A93H 5C0XJ 4P73A 2VY3A 1CKOA 4DV6L 1KQSA 4A3DG 3UDFA 3I4NH 4BBSH 3S14H 3I2ZA 4A3CG 1QUQA 4GOPA 4A3KG 4LF9Q 4HJAA 1HZAA 1LYLA 1C0AA 1IBLL 2KHIA 1PH9A 1CSQA 3HOYH 1Y1WG 4X64Q 4BXXG 2LXJA 1JB7A 1GKHA 1VCIA 4BY1H 4R4QA 3J81j 1YIJA 1OXSC 1X3EA 3T1HQ 1HZ9A 3A0JA 3FKIH 1IBKL 1ASZA 2EIFA 2D0PA 2AHOB 4A4IA 5GADC 3CCMA 1UE7A 4LFBL 2IX0A 1PH3A 5M5YH 3ICEA 1GM5A 2NN6I 1PH8A 4QY7A 1N34L 4JI4L 3HOVH 5HGQA 1BBUA 4DV3L 1OXXK 4DV6Q 4B3ML 4PZ7A 1YVCA 1TWAH 2R6GA 2JA7G 2Y0SE 4X65L 2R7DA 2RHSB 4DR6L 3A5ZB 4A93G 3PCOB 4DAYB 5GAGC 3OW2A 1V1QA 4A3EG 4LF5Q 4JI1L 2ZTCA 2VS1A 5IYBH 2ALYB 4DR5Q 1UE1A 1O7IA 4DR7L 1VQBA 1IBKQ 3S15H 3KF8B 4KHZA 4AIMA 3I4NG 3OYYA 4LFBQ 3I56A 3HOZG 4QL5A 3GTJH 3HOYG 2KHJA 2RF4A 3PUXA 5E7NA 3PO2H 4BY1G 1VQIA 2NVXH 1N34Q 4JI4Q 1TXYA 1J6QA 4DV3Q 1KIXA 4B3MQ 3TS2A 1HNWL 3CCLA 3I7FA 5J3BA 4A3JG 2WB1G 2HIVA 4DR6Q 1JE5A 3HOVG 1PH7A 1ASYA 1L1OA 3RN2A 4GOPC 2JA5H 3GTOH 1Z9FA 1I5FA 1A63A 4JI1Q 3CCVA 1SROA 3K7AH 2UU9L 4OXPA 1Y1VH 4JOIA 4TQUS 4A3MG 3M4PA 5IYDH 3HOXH 3I4OA 3UDXA 1S40A 1UE6A 5IE8A 2Q2IA 4OWTB 4YCVA 4OO1G 1EIYB 1WCMH 3BZKA 5IYBG 1VQNA 4X62L 4KLKA 1HNWQ 3CP0A 3DLLA 4IFDJ 3NEMA 1R9TH 5LMNQ 2GVBA 3PO2G 1X3FA 4LF6L 3UDGA 2UXDQ 3GTPH 3ULPA 5EAYA 3D31A 2UUAL 4A3LG 1V43A 4IOAA 2CFMA 1X6OA 1UWVA 1V9PA 2E8GA 1XMOL 2D0OA 1XNQL 4EX5A 4A3BH 3KOJA 1KXLA 4JI3Q 4IPDA 4LFAL 5C4JH 3W1GA 5LMNW 2R7ZG 2CWAA 2YTVA 2CQOA 4XIGS 1IBML 3RN5A 1E22A 2AKWB 4J15A 2DGYA 2HHHL 2HT1A 4JBMA 3M7NA 1CKMA 4POFA 2VW9A 4OWWB 5GQOA 1K73C 4NB3A 1XPOA 1PH2A 1VS0A 5M3MH 1J5EQ 3S2DH 1S72A 4UP7A 3CW2C 1GO3E 4WJ3M 4C2MH 3J7A5 1C7YA 4MTNA 1XMQL 2V1CC 2NVTH 2JA8G 5C3EG 4HIKA 4PMWA 1JJGA 2UUAQ 4ALPA 5ELNA 4DPGA 5BR8L 5FLMG 2OQ0A 3GO5A 1K0RA 5IY0A 4HIDA 1XMOQ 4XTCS 5DLQE 2QEXA 1PH6A 1VQLA 1E3PA 1E7ZA 4DUYL 2B63H 3CCEA 3H15A 4DR1L 1P8LA 4Y52H 3HKSA 3S2HH 1HNZL 1VQ5A 4JI2L 4EQ5A 1HR0Q 4GS3A 4R1JA 1AH9A 1L0WA 1SRUA 1X3GA 5IYCG 3RR5A 2K14A 2VZAA 1NMFA 2AWOA 2VQEL 4LF9L 2ATWA 3U4ZA 3RZOH 1EFWA 4IJHA 1Y14B 1C9OA 1X55A 4HIOA 2K4KA 1XMQQ 1NJIC 2BH8A 2WB1E 1U0LA 3S24A 1HR0W 3T1HL 1CKNB 4JBWA 1VQPA 5M3MG 1I6HH 5JJLA 2XTIA 4DUYQ 5JJIA 1Q12A 1VQEA 4O2DA 3J7ZC 4DKAC 4Y7NH 1HNZQ 1NBWA 4JI2Q 4AQYQ 1BVSA 4BBRH 3K8AA 4A3GH 2CWPA 3VDYA 2OCEA 3J80c 1X9NA 3F1ZA 2BH2A 2NZHA 2VQEQ 3H0GG 2B3GA 3E0EA 3EN2A 1VQOA 4LF4L 1YI2A 1OXTA 4IO9A 2QGQA 4MZ9A 4LF5L 1SFOH 2K5HA 4DV1L 2JEBI 3AQQA 2BA1A 4DR5L 2VUMG 1TWHH 4O0AA 3G71A 4LF7Q 1VQAA 3CC4A 2H5XA 1M90C 1VQGA 3J81c 1IYJB 5JEAG 2F4VQ 4R4OA 3PIOA 1YJ9A 3PF4A 3A74A 3U4VA 3JAMi 1XPUA 3HOWH 1FGUA 4X66L 2ES2A 1XPRA 1VQ8A 1OXUA 2R93G 4JI0Q 1PVOA 3STBC 3KYHC 3RLFA 3CAMA 3CPFA 2F3IA 1A62A 3L7ZC 4JC0A 1CUKA 2WFWA 3M85A 4LF4Q 3F2CA 1VQ6A 1JT8A 2K75A 4BBSG 4DV1Q 1LTLA 4YCUA 2ZTDA 2E2HH 2YTYA 3F8TA 2FXQA 4DR3L 2MQHA 1VQJA 2C35B 5AJ3Q 2YYZA 5IP7H 1I94L 2CCZA 3HOUH 4K0KQ 3GDEA 1NY4A 4OONA 4JCVE 3U58A 2VL6A 2WAQE 5GROA 2ZJPA 3PIPA 3FKIG 3CD6A 4JBKA 3OTOQ 4X66Q 3G4SA 4C3JH 5C0XG 1YNXA 2AWNA 2WP8J 4HIMA 1PA6A 3BU2A 5LMNL 2OTJA 4KI0A 4DV2Q 4OX9Q 1G51A 1NMGA 1N32Q 4JI6L 2UXDL 1CKNA 3ERSX 4B3TQ 4LF8L 2JQOA 3M4OH 1VQFA 1IXRA 4DR3Q 1UE5A 4QIWE 1SMXA 1I94Q 2IHFA 1SR3A 1VQDA 2VNUD 5M3FH 2A19A 1TWGH 1YZ6A 2RHQB 4L5RC 2YV5A 2I5MX 4YY3L 1YHAA 1AE2A 1YJNA 2JA9A 1E1OA 2KCMA 1GVPA 1J5EL 5IP7G 4JI7L 5HY6A 3IRBA 2ZJRA 1KD1C 5IP9H 2Z0SA 4UPAA 2AMCB 2PMZE 4JI6Q 2E2IH 5FLXc 1E1TA 3T1YL 2IX1A 3S1QH 3GD7A 1EUJA 4LF8Q 2JA6H 2MO0A 4R4TA 1VQ7A 1BKBA 2JA5G 4L5TA 1HR0L 2UUBQ 1M1KC 2I5HA 4DV4Q 1W3SA 1Y1VG 5FJ8H 4YY3Q 1HH2P 3AFPA 3E9IA 4H02A 3WWVA 5IYDG 1MKHA 3HOXG 2UUCL 4QQBX 2KCTA 1QUQB 1K83H 1QVCA 4JI7Q 1YEZA 3JC66 3E9HA 3TREA 3CMEA 3EIVA 1SE8A 1WCMG 3M4QA 4FDBA 4JV5L 2BA0A 1WOCA 5ELOA 3J81i 4IJLA 2ID0A 1FL0A 3F2DA 3T1YQ 3NELA 4DV0L 2WAQG 4LFCL 2UXCQ 3M3YH 3NBHB 3CCJA 2XGTA 4C3HH 5IP9G 4TVAB 4B3RL 1Q7YC 4HJ8A 4AQYL 1KAWA 4WJ4A 3UDIA 1A0IA 2PQAB 2JE6I 5IWAL 1VQCA 2NVYH 2JA6G 4A3BG 5C44H 1RL2A 3I55A 3G6EA 4IOCA 1PV4A 3I4MH 2D62A 3FHWA 4GN5A 2UUCQ 4OO1I 4GNXC 2EXDA 1IL2A 1Q1EA 4QGUA 4LNQA 3AYHB 2MNAA 4A3FH 4IFDG 4JV5Q 3H3VI 4JG2A 3PUZA 4MNOA 4A3DH 2HQLA 1S3OA 3PO3G 1PYBA 4APVA 4A3IH 4GLVB 3S1RH 1XNRL 2R7FA 3BJUA 1XTDA 4P75A 4LW1A 4DV0Q 4LF7L 4A3CH 5M5WH 4LFCQ 2F4VL 4YWKA 5C4XH 2PI2A 4A3KH 1RIPA 3L0OA 4B3RQ 4JBJA 3TS0A 4B3SL 2EQSA 4GKKL 3PF5A 4OWXB 1Y1WH 4C3IH 4IPHA 4DK3C 5IWAQ 4JI0L 1N33Q 4GNXB 3AEVA 2IY5B 2B63G 4IPGA 5LMUL 1Q81C 3PUYA 3CC2A 4GKJQ 1D7QA 3PUWA 1L1OB 2Z6KC 4GN3B 4X6AH 4DUZQ 5C44G 3I4MG 2ASBA 1FVIA 4DR4Q 1PH1A 3HFZB 1Q1BA 2N78A 4UP8A 3TQYA 5GAHC 1Q86C 1XNRQ 3ULLA 2UXBL 3CPWA 1PH4A 2ZJQA 5AJ3L 4K0KL 4DR2L 5K36G 4A3FG 4B3SQ 4GKKQ 4DV7L 4A3EH 1G6PA 4JI8L 4A3IG 1N36L 2ZTEA 1SLJA 1UEBA 4JI3L 3OTOL 1VQHA 1DGSA 1YITA 4YWMA 2E5LQ 5C4XG 1YBYA 2JJQA 4R4CA 1A8VA 4IPCA 2NN6G 4LUZA 3CXCA 5LMUQ 4DV2L 4HJ7A 4OX9L 3HOZH 1N32L 3FP9A 4A76A 4BBRG 1D8LA 3UE1A 4L5SA 4A3GG 4B3TL 2PI2E 5H1SE 4P74A 3DM3A 1PFSA 1HZBA 3GTQH 1CSPA 3KDFB 3CCUA 1VQ4A 3S17H 2JEAI 3G48A 4A3JH 2UXBQ 3K0XA 1PH5A 4NXNL 3CF5A 1JMCA 4DR2Q 4RG1A 1YHBA 1K8GA 2PQAA 4DNIA 2YU9H 3GTKH 2E2JH 1JJCB 4DV7Q 3MXNB 1QVFA 4AYBG 1MIUA 4JI8Q 1Q82C 1N36Q 2LXKA 2IT1A 1PYSB 3CQZH 3Q8DA 4KHPL 5M5XH 4A3MH 3RLNA 1K8AC 4POGA 1EQRA 1IBLQ 1GD7A 2K52A 5GAEC 3PO3H 2Q2TA 3HOWG 1K3RA 1NTGA 3STBD 1BBWA 1X65A 2MFIA 3KJOA 1VQ9A 2LSSA 1Q46A 1WFQA 1EWIA 3GTLH 4RMFA 1EOVA 1KHIA 4YCWA 5C0XI 1XNQQ 4JYAL 3KF6B 1N9WA 3TEHB 4NXNQ 2NVQH 2KBNA 1B7YB 2UUBL 3M9BA 3S1MH 2K50A 1I3QH 1MJCA 4DV4L 4GNXA 3HKZG 3AFQA 4A3LH 2KENA 4X65Q
chains in the Genus database with same CATH superfamily
4R4IA 3RLOA 2XVSA 3F2BA 2Z9HA 3SR1A 2I0QA 4JI5L 2RQXA 1AEXA 2Y0SB 1TR5A 2RCNA 4ZKBB 1B8AA 3GTGH 1KLUD 1LUZA 3A5UA 2WKDA 4FP5D 4UP9A 1EYGA 4NMZA 1XJVA 4RHRA 3I3CA 1LM0A 3KLWA 2R92B 1AE3A 1MSGA 2JA8H 5L37A 1EYDA 1IYVA 3BG3A 5FLMH 5C3EB 2H1EA 2FJ2A 1B53A 4K8IA 3RZDH 2Z6KA 4HSPA 1H9KA 1KNAA 1QZGA 4YHHQ 1QCBD 1N8RC 4FXKC 4KKTA 3KDFA 1FJGL 5LL6X 4IUNA 3BYTB 4GLXA 2OWOA 1H9MA 2WACA 4K6DA 1JOQA 1RD9D 4IUPA 1S5CD 1H9SA 4N9PA 3VYRA 1K9MC 4RHSA 1UUPA 4QIWB 3BDOA 3S16B 1X54A 2OTLA 3CCSA 1KAAA 4AYBE 2K5VA 4YWLA 1W2BA 1KDAA 1PZID 1QVGA 4LUOA 1U5KA 2LFNA 3I4LA 3KF6A 1LTGD 3CC7A 1T9HA 4KKUA 4NXMQ 1NSNS 4GLAC 3H0GB 2AQ3B 3QOJA 1HZCA 1I50B 2KHSA 1G291 4OGQC 1MBYA 1MI2A 4C3HG 1O7LA 1SNPA 1LTAD 1WJJA 3HKZE 3I70A 1Y8OB 1L2FA 1KRSA 3MFGA 2A1AA 4LUVA 4RAUC 2JA7H 4KKSA 1TWCH 2R93B 1GHJA 2CW0C 1VQMA 2K32A 1GHKA 2EY1A 2VY3A 4P73A 4A93B 1FNWA 3SK5A 1QUQA 2JYOA 1DOLA 3FDTA 4GOPA 2RDGA 1LYLA 2KHIA 3D8GA 3HG9A 3H94A 3RUZA 4BY1H 3J81j 2KA7A 1CM9A 1D5MC 1IBKL 3K5NA 5GADC 4LFBL 2NB0A 2EDGA 4GZYC 3MXPA 1GM5A 4KN7C 4QY7A 1N34L 4JI4L 5HGQA 1EY7A 4DV3L 4DV6Q 5I4DA 4N8FA 2JA7G 2Y0SE 4OIKA 4X65L 1TWAB 3VA7A 3A5ZB 5K5PA 3JAML 2NUCA 4HCSA 4DAYB 3OW2A 5IYBH 2ALYB 1D5XC 1STHA 3NE5B 3C3LA 2RKSA 3I4NG 4QL5A 4RKLA 4BY1G 2NVXH 1J6QA 4B3MQ 3TS2A 3R2TA 1PTOH 3CCLA 1TKWB 3I7FA 5J3BA 1SNCA 5IT9L 3TZDA 4DR6Q 1U4LA 2B2TA 1BUVT 1ILQA 1L1OA 3RN2A 1Z9FA 3C46A 2JA5B 3ITPA 3ONAB 3K7AH 2UU9L 5IYDH 1Y1VB 1E2VA 2Q2IA 3H6MA 4YCVA 3HOXB 4ZRZA 3BZKA 5I6YA 1G91A 5J39A 5IYBG 4X62L 1V1PA 4UDUC 3DLLA 3NEMA 3DEPA 2A74C 2WV6D 1R9TB 3L3OC 1RKNA 4A3LG 1V43A 1W6KA 1X6OA 1A6XA 1TY2A 4OHJA 3KOJA 1KXLA 1BCPF 2E74C 1U4RA 3URYA 5JOBA 2R7ZG 1NR4A 2CWAA 2O4XA 1IBML 3MXNA 2HT1A 2HHHL 4JBMA 4CBVA 3SVMA 4K2LA 5M3MH 1F9RA 1H9JA 3W3AA 4C2MH 4MTNA 1JJGA 4ALPA 4EQPA 5ELNA 5BR8L 1WTWA 2AUKA 1PH6A 4HIDA 1K0RA 1XMOQ 1VQLA 1XNQQ 4XTCS 4OO1G 2QEXA 3D4DA 4IN3A 3CCEA 5DNFA 2B63B 1HNZL 1VQ5A 3J81L 2RBMA 1AH9A 1AN8A 1SRUA 5IYCG 1NMFA 3IL8A 1LT3D 4R9WA 1SNQA 5K36H 3RZOB 1IHZA 1HA5A 2BH8A 1C4QA 3S24A 1ENFA 5M3MG 1K8OA 4DUYQ 4KY6A 1VQEA 5DM73 3IAYA 2P5ZX 4DKAC 4Y7NH 4BBRH 3K8AA 4A3GH 2CWPA 1E0BA 4IUTA 5F2DA 3EN2A 2G5DA 1VQOA 3MFYA 2QGQA 1A15A 2F0TA 5KIXA 4DR5L 4JPBW 2VUMG 4O0AA 3TP6A 4JK1C 2MGSA 3CC4A 3C2PA 1TWHB 5JEAG 1SMYC 1PDQA 1JB3A 2F3WA 3T51B 3PIOA 2O5JC 1HRJA 1ESRA 1I4RA 1EY0A 2EJFC 3SK6A 1OXUA 1KDCA 3STBC 3KYHC 4OIJA 2JP1A 2K75A 4BBSG 5DAUA 2YTYA 4DR3L 1ILPA 4G7HC 4DXFA 4K0KQ 1I94L 2CCZA 3HOUH 1ET9A 3U58A 1STYA 3PIPA 4JBKA 4JI3Q 2E2JB 1LTBD 1TU2B 1RHPA 2TMPA 3HP3A 3R8BA 1GUWA 2OTJA 1YNJD 3Q24A 2PPBC 2UXDL 3J7AV 4F88A 1TVXA 4LF8L 1PTOD 2B8FA 2VNUD 5M3FH 2A19A 4R8NA 2I5MX 4YY3L 4ME5A 4JI7L 3MEHA 1GVPA 1J5EL 3PMFA 3KUPA 1KD1C 2Z0SA 2AMCB 4JI6Q 3VR3A 5FLXc 3T1YL 3TP5A 4QCLA 1EUJA 1Y8NB 2EZVA 2JA6H 3PQIA 5JPMC 3MVVA 1M8AA 5EBCA 3GTGB 1JR0D 2F0QA 2IL8A 4ZCKA 2I5HA 1W3SA 4QQBX 4DF7A 1QUQB 3D4RA 1K83H 1YEZA 3CMEA 3MTSA 1SE8A 3FRPB 4JV5L 4KD3A 3F2DA 2DNCA 4K14A 4DV0L 2OT2A 2PW7A 4IUUA 1HQMC 1KDBA 1HXYD 2XGTA 4I7ZC 4B3RL 4V190 4HN7A 4C3HB 5C4HA 3HEJA 4PMCA 4DA2A 4DGZA 2JA6G 1SDFA 4A3BG 3G6EA 2NVYB 2K05A 5ELDA 2MUYA 3SXHA 1S5BD 2B2UC 4HAEA 4H0LC 4QGUA 1JORA 4A3DH 5EGTA 1PRTC 2E75C 4A3IH 1XNRL 4LW1A 4QB4A 3S1RB 4JBJA 5C4XB 2L9HA 4LMQD 4PMBA 3PF5A 4H13C 2JN4A 4IPHA 4DK3C 4C3IB 4JI0L 2IY5B 3HRZC 3VR4A 3GQBA 4IPGA 5LMUL 1R4QB 1ICWA 3SDZA 3DEOA 1EZ8A 1PRTB 1L1OB 3ND8A 4DUZQ 2KJXA 4X6AH 4DR4Q 1D5ZC 1MGSA 2A6HD 2N78A 3TQYA 1D1IA 3AU7A 1NNXA 1U4MA 2JA7B 4K5VA 2HCCA 4GKKQ 1Y69U 4A3EH 4JI8L 4A3IG 3OTOL 1LV9A 1YBYA 4K6LA 1EU3A 1A8VA 4OX9L 4LUZA 4HJ7A 5M9OA 2B2YC 3HOZH 3I4NB 3UE1A 3QJYA 2XIWA 4BY1B 5EPJA 3S17H 3NBHA 4EGVA 3EQLC 2CHBD 1ZXTA 1VQ4A 1YNND 3GTQB 3K0YA 5EKLA 2UXBQ 3F2UA 4XDXA 4DR2Q 1YHBA 4DNIA 5ELEA 4DV7Q 3MXNB 2EY2A 1CT1D 4WFN3 1JWSD 2E76C 3QOLA 4A3MH 4DAVA 4POGA 5M5XB 5JVG3 3PO3H 1GUTA 4K8JA 3HOWG 1NTGA 1X65A 3KJOA 2LSSA 5G3LF 4RMFA 1EOVA 4YCWA 2PCFB 5C0XI 2F0OA 1B7YB 3M9BA 4C56C 2NVQB 3E0JA 1T5EA 3GV6A 4DV4L 3S1MB 4GNXA 4FXGC 2NVXB 1PTOB 2X6GA 4KHPQ 1IW7D 2BDNA 4YHHL 1BBXC 3N6RA 1I4XA 1RTOA 1RCVD 1DYQA 2NTTA 1WI5A 2BCOA 3EROA 2R7ZB 2MO1A 5IGDA 1CQFA 2UXCL 4JVZA 3K7AB 5FLXE 1EWHA 1WYDA 3PO3G 3BZCA 3UE0A 3G7LA 2XSCA 2I46A 4L5QA 3W5OA 1MJEA 3J80i 2XNAC 3SEBA 4M1UB 3I8ZA 4KN4C 1QZHA 4CJ2C 3K57A 2F0NA 1PLFA 5CBAE 2DJGC 1TS4A 2QCPX 3H3VH 4OEMB 1HJPA 3K7UC 4PZ6A 2Z4HA 4NXML 3NUCA 2EYHA 3IKJA 4XQQA 2I5LX 2EY5A 3WOFA 3S9WA 1LACA 1HUMA 1S5FD 1PHJA 4CDDC 1N33L 4TSSA 4BY7B 3NENA 3X3MA 1HNXQ 5I9OA 3U50C 4ID6A 4ABNA 3TRZA 4LWCA 4FF4A 3KJPA 1GUGA 3TDQA 1TWFB 1R4PB 3VR5A 3S1NH 2F3VA 1X56A 2KVMA 2YTXA 4JOIC 4NPSA 1TY0A 4IFDI 1H95A 2E2DC 2ZM6Q 2R61A 1ZYRC 2K5NA 1EIFA 2HDMA 3P20A 1CQVA 3DXJC 3C1EA 2VUMB 1JWMD 1EL0A 4PQXA 1STBA 3ULJA 4X3SA 1EYAA 2N88A 2NZOA 3SGIA 4U68A 5D65A 5DM63 5C3WA 5C0XJ 4DV6L 1NCVA 2H4OA 4Y7NB 3OIQA 5D3IB 3S14H 4BBSB 1ZEQX 4A3KG 1C0AA 2X69A 4FNFA 4H7BA 1WTVA 3HOYH 4X64Q 1YNNC 2KCNA 4FF2A 1GKHA 3M4YA 3A0JA 1A3TA 3FKIH 2LS01 1UE7A 1TS5A 1PH3A 3ICEA 2NN6I 5HGTA 1PH8A 5M5YB 3HOVH 1BBUA 4B3ML 5FO8B 5I2XA 2RHSB 4DR6L 1A3UA 5EQ0A 3HS0C 4LF5Q 2VS1A 2Q8IB 4XYQA 1CA5A 1UE1A 1O78A 1O7IA 2LKVA 2M9VA 3S15H 4DR7L 4AIMA 1D2BA 3RMHA 3HOYG 2KHJA 3PO2H 3K59A 3GTJB 1KIXA 4A3JG 2WB1G 4RGMA 1A3VA 4ZYSA 3HOVG 3EA6A 3GTOH 1A63A 3OWEB 5CV6A 1SROA 3SE0A 3MHBA 1PXUA 4TQUS 2EXZA 3M4PA 3I4OA 1UE6A 1WCMH 3R3OA 4IFDJ 2BE5C 5LMNQ 2GVBA 3PIO3 3PO2G 1DZ1A 3OOCA 4LF6L 1JOKA 3GTPH 3D31A 1G8ZD 2CFMA 2EY6A 1UWVA 1V9PA 2E8GA 2Z6BA 1XMOL 1XNQL 2AQ1B 3QIAA 4HEDA 4I7AA 1H9RA 4A3BB 4LFAL 1PFMA 2K6AA 3SK8A 2YTVA 4XIGS 4UAIA 1CKMA 4M8AA 5A2QE 1XPOA 1PH2A 1SNOA 2JSOA 3NWSA 2HDLA 4P2CB 3S2DH 2EYFA 1C7YA 2NVTH 3E3XA 3X3NA 5C4ZA 2JA8G 1JQYD 2NZ1D 4PMWA 2RSOA 3PIP3 4FXDA 4DPGA 3KF8A 5FLMG 5ELFA 2HQEA 3EJIA 4DUYL 1E7ZA 2XWJB 1ESFA 4DR1L 4Y52H 2A5HA 3S2HH 1LT4D 1QB5D 4EQ5A 4ULLA 1HR0Q 4FO2A 2AUJD 2DNEA 2IWHA 5KNBA 2Z4IA 2X6LA 1O7ZA 2VZAA 3NXWA 4LF9L 2D2CC 1GUOA 1JC7A 4IJHA 1X55A 1NJIC 3T1HL 1CKNB 3A56A 4KV6A 1GJXA 4OL7A 2WINB 4A3IB 1I6HH 5JJLA 2XTIA 5IGFA 5JJIA 5AFWA 1NBWA 4JI2Q 4AQYQ 5CYUA 1BVSA 2K28A 3VDYA 3F1ZA 1HTPA 5KNDA 2CH4A 1YI2A 4IO9A 3TZUA 4KJOA 2JEBI 2BA1A 1SFOB 1LLRD 4LF7Q 1M90C 1WD1A 1IYJB 2F0VA 2L0CA 4XT1B 2N55A 5D14A 5BN4A 4WORA 3U4VA 2EYMA 1XPUA 3P1HA 4ZQ3A 1FGUA 1TT2A 3HOWB 1PVOA 3D6WA 3GP7A 1A62A 1SE3A 1CUKA 4LF4Q 5JJZA 3M85A 1VQ6A 2ZXRA 1LTLA 4KTAA 4IUVA 5FLXL 2E2HH 2CH4W 2FXQA 4CJ1B 1QE6A 3TMEA 5AJ3Q 4ZUJA 5KYLA 2YYZA 1EIHA 1WTPA 3GDEA 1NY4A 4OONA 1CFMA 2ZJPA 1EY8A 2AWNA 2QW7A 1ML0D 4DV2Q 3OIPA 1G51A 2F0GA 4JI6L 3BVMA 4Z9CB 2PZTA 4XT3B 2KECA 4F8MA 1SNDA 1VQFA 2XN9C 3NBIA 1IXRA 2WIIB 2XRSD 3C1FA 3M4OB 4QIWE 2DJFC 4G7OC 1QOHA 2PQEA 1F2YA 2YV5A 1TWGB 4K5WA 2QKIC 1YHAA 2KCMA 1E1OA 2HCIA 3H91A 5HY6A 4E6IA 5T1GA 2IX1A 2E2IB 1MHWC 3S1QH 4R4TA 1BKBA 2KEDA 1Q90A 1RDPD 5G3LD 2UUBQ 5KRUA 5FJ8H 5IYDG 1SSOA 3E9IA 1TS3A 2F0MA 4O42A 1QVCA 2KCTA 3J80L 3E9HA 3BVZA 3NQIA 3P7JA 3O13A 3KLSA 1FL0A 1G2TA 3NELA 3BDCA 2NTSA 3M3YH 1L0YB 2ZXPA 3A55A 4FF3A 2EYJA 3LWEA 1Q7YC 2FHTA 4WJ4A 2NWGA 1A0IA 2PQAB 4L8JA 5C6AA 1VQCA 3I55A 1ICFB 4IOCA 2D62A 5IODA 4OO1I 4O1NA 5KNCA 3I4MB 1Q1EA 2MNAA 4L63B 2OEOA 4JG2A 3PUZA 4A3FB 3VYTA 1CHPD 1S3OA 1PYBA 1LO5D 4A3CH 1B50A 5M5WH 4LFCQ 2F4VL 2D5DA 2PW5A 1II3A 5J1ZA 4A3KB 4GKKL 2FFKB 1Y1WH 1Y8PB 5IWAQ 4FVMA 3AEVA 3BYYB 2F0EA 3EVQA 1Q81C 3DWAA 4NDXA 4DU9A 2L4NA 1D7QA 3PUWA 2Z6KC 4GN3B 4IUQA 1PH1A 1Q1BA 1Q86C 2I07B 1F9QA 2UXBL 1PH4A 4DR2L 5K36G 1B3AA 4V0BA 4B3SQ 4DV7L 2EPBA 2ZTEA 1DGSA 2F0LA 1TS2A 3SHLA 5CR3A 3NPPA 1N32L 1RODA 2BDOA 4A76A 4BBRG 4L5SA 4A3GG 1ENCA 4B3TL 2PI2E 2K1BA 4CKEA 1PFSA 1HZBA 1AZQA 4TKOB 5D3DA 5J22A 3KDFB 3CCUA 4RKBA 2K5DA 3K0XA 1S5ED 3BDLA 2Q8TA 3CF5A 1PH5A 4A3JB 2WB1B 1K8GA 2M2LA 1XX8A 2YU9H 3GTKH 3N52A 3LNNA 1QVFA 4AYBG 1Q82C 1N36Q 1QNKA 2IT1A 1H9SB 1PYSB 3CQZH 4KHPL 3DWQA 3NWTA 1K8AC 4FF1A 1GD7A 5EKKA 4WJWA 1K3RA 5FK9C 2SEBD 1VQ9A 1WFQA 1GOZA 3GTLB 3K5MA 3S15B 3KF6B 1N9WA 3TEHB 1SXTA 4NXNQ 3NTHA 1B4OA 1SAPA 3PO2B 2K50A 4WRDA 3HKZG 5A2QL 4X65Q 1KNEA 2OQKA 1SYDA 3NHHA 3HOUG 4DNRB 2OXPA 3EBEA 4HJ9A 3LGJA 3V96A 3ZJYC 3Q22A 4QJFA 4MTKA 1VQKA 1TQOA 2R92H 4DAMA 1EFID 3R93A 5C3EH 1DOKA 2JA8B 1GUNA 3K5LA 2A69D 3OW7A 3JAMc 1HNXL 1I4HA 4GOPB 3RNUA 2QA4A 5M3FG 3RZDB 1JICA 3ER0A 3KBXA 1KC8C 2UU9Q 1LTSD 3NSWA 3W1BA 1L0XB 2A68D 2JK8A 2Y0SG 5TSSA 2ZM6L 5IT9c 4X62Q 2K01A 1KL9A 3S16H 1AP0A 1BQQT 2R92G 4J1MA 1IKMA 2PNHA 4KHVA 4GKJL 2Q2UA 4UY8C 1SYGA 3IFTA 2MP1A 5EBDA 5JEAJ 2A73B 1L1OC 3OMGA 4P71A 3GTMH 1IZ6A 1KRTA 3H0GH 2VQFQ 5KEEA 1V8QA 1IBMQ 1I50H 1Q8KA 3PGZA 2O5IC 3BS1A 2HHHQ 3E6ZX 2E5LL 2RSNA 4DV5Q 3K80C 4X64L 1EYCA 3L9AX 2Z1CA 1HFGA 2XWBB 4QUCA 1NE3A 5BR8Q 3L2PA 3CCQA 4CKCA 1P16A 3CU7A 5FOBB 2R93H 4BA1I 3H09A 5JJKA 3R2IA 2L15A 3MEFA 4A93H 1TWCB 3A8IE 4A3DG 1CKOA 1UNSA 2B2WA 1K0SA 5T1IA 4TRDA 1V1PB 3ZYYX 4HJAA 3MZ5A 1IBLL 1CSQA 4LAAA 3TP7A 4R4QA 1YIJA 1OXSC 1HZ9A 4B9WA 1FYCA 2EIFA 2IX0A 1XWEA 2K5WA 1YNJC 5DEHA 1SNMA 3RD4A 4PZ7A 1SBBB 1TWAH 2R6GA 3VR2A 2R7DA 4CHTB 1ENAA 4A93G 1PTOC 1LTRD 5GAGC 2EYLA 1V1QA 4A3EG 4RWSC 2F0WA 2ZTCA 3IFDA 5BN3A 1FD7D 3QWNA 4DR5Q 3MXGA 1VQBA 5E3FA 3OYYA 2ENBA 3I56A 2E2HB 3HOZG 2QDBA 5A35A 1VQIA 2ICIA 3LWUA 1TXYA 2K7VA 5ISRA 5KGUA 1C48A 2HIVA 1JE5A 1O7YA 2JA5H 1GUSA 1I5FA 1B9MA 4JI1Q 2AQ2B 3CCVA 1Y1VH 3UI2A 4A3MG 3HOXH 2EOTA 1PZKD 3UDXA 1S40A 2QEJC 4OWTB 1VQNA 5CV7A 2IW3A 1HNWQ 1AZPA 1QJOA 2EJGC 1R9TH 2F0PA 1EEFD 2FINB 4G7ZC 3UDGA 2UXDQ 3U9SA 2F0UA 5IGEA 2RA4A 4EX5A 2F0HA 3QG1A 4IPDA 1VMPA 5C4JH 4JW0A 5LMNW 4IQZA 2CQOA 4IFDH 3RN5A 1HCZA 1E22A 4J15A 4DFAA 4OWWB 1K73C 2CQAA 1K28A 5IT9E 1VS0A 1DONA 1J5EQ 4DAYA 4UP7A 5CMDA 2JXMB 5M3MB 3J7A5 4WJ3M 2V1CC 1FGBD 4C2MB 4HIKA 3CHBD 2UUAQ 1PRTF 4XYOA 2OQ0A 1D6EC 3GO5A 5IY0A 5DLQE 1E3PA 2B63H 3H15A 2PMZB 1A2TA 3M3YB 3E5SA 3HKSA 4JI2L 4GS3A 1BCPD 1X3GA 4S3SA 4DK1A 1HQRD 2B2VC 2AWOA 3RZOH 2A6HC 4HIOA 1HPCA 1XMQQ 1KTKA 2L5TA 1HR0W 1LT5D 4JBWA 1DXMA 1VQPA 1VF5C 1VF7A 2NN6H 2F0SA 2QF7A 5IGCA 4ZUIA 1S5DD 2F0DA 1EQTA 2OCEA 4BBRB 1KABA 1X9NA 4A3GB 2BH2A 2VQEQ 1EQVA 2B3GA 3E0EA 4LF4L 1OXTA 3D6CA 3T53B 2KUMA 3FMCA 1TWHH 3WDNA 1SJHD 4R4OA 4I65A 1EY9A 4EQOA 1YJ9A 5HURA 2B8GA 1AW7A 3DM1A 4XXEA 1XPRA 1C8CA 1VQ8A 1LTID 1FNVA 4JI0Q 3T4AC 3RLFA 1HFNA 3CPFA 2F3IA 1PTOF 3L7ZC 4JC0A 1BDOA 1JT8A 4DV1Q 3HKZB 2MQHA 1VQJA 2C35B 4R8IA 2K5QA 5IGGA 3HOUB 4JCVE 2VL6A 1IW7C 3KK7A 3CD6A 3FKIG 2RCFA 3OTOQ 4X66Q 4C3JH 1YNXA 3BU2A 4PV1C 3I90A 2ZXOA 4OX9Q 1NUCA 3J7AF 2SOBA 1BF4A 2J4XA 5I6WA 4F7XA 2JQOA 3V05A 1PMRA 1UE5A 2XRQD 2IHFA 2DY8A 2RHQB 5EPLA 1CTMA 5M3FB 3NQTA 1AE2A 2MPMA 1YJNA 1XXGA 4KD4A 3IRBA 4ZLTF 1TIID 4UPAA 2PMZE 1E1TA 4C3JG 3GD7A 2LMCB 2MO0A 1JWUD 2JA6B 3D3RA 4B08A 3K5OA 4L5TA 2ZT9C 3KLSX 4DV4Q 3OHXC 4H02A 1MKHA 2TSSA 1F9PA 3TREA 3EIVA 1PFNA 1K83B 1WCMG 4FDBA 4IURA 1E2ZA 4X3TA 5ELOA 1T5XD 4IJLA 4YIJA 2LY7A 3Q23A 2WAQG 4LFCL 2UXCQ 3NBHB 1BCPC 1EU4A 4C3HH 4ILWA 4BS9A 4G57A 2SDFA 1K3BC 5CV5A 5C5LA 3UDIA 2NBFA 4RCNA 5CGKA 5IWAL 2NVYH 4HTHA 1XYIA 5C44H 3T56B 4CJ0B 1I4QA 3FHWA 4GN5A 2UUCQ 2WKCA 4GNXC 1JCKB 3AYHB 5ELCA 2HQLA 1UEAB 3S1RH 4GLVB 4A3DB 2R7FA 3BJUA 1BCPB 1XTDA 2DY7A 4P75A 1F9SA 4H44C 4KMUC 1CK1A 4RGNA 5C4XH 1RIPA 3GTMB 1QNUA 5CV4A 4HMJA 3TS0A 4B3SL 2EQSA 1WTRA 3EFXD 4C3IH 1N33Q 4GNXB 2EYOA 3PUYA 1WVLA 4QF4A 1MD2D 5C44G 4EQNA 2IPKD 2ASBA 1NR2A 5GAHC 2EE1A 3ULLA 3CPWA 2ZJQA 4K0KL 5JAVA 2HUGA 1G6PA 1N36L 4JI3L 1SLJA 1UEBA 1YITA 1M4VA 4A3EB 1JE4A 5C4XG 2JJQA 4R4CA 3I4NH 4IPCA 3CXCA 3FP9A 4CDCC 4C3IG 1D8LA 3HOZB 4ZAIA 5H1SE 4P74A 3DM3A 2J7ZA 3GTQH 5COYA 2JEAI 2C9OA 5IGBA 3S17B 4NXNL 1DOMA 5C3XA 4RG1A 1F2LA 4QUFA 3AMUA 1JJCB 3CKIB 1SMYD 1AFPA 2LXKA 3Q8DA 5M5XH 3RLNA 4LK1C 4A3MB 2IX3A 3STBD 3PO3B 2EJMA 1D1KA 2EVBA 2MFIA 1EWIA 2R3ZA 3Q6SA 4IALA 3T16A 2A6ED 2NVQH 2KBNA 2FMCA 3S1MH 1I3QH 4N9TA 2EYPA 2B2UA 3AFQA 4A3LH 1Z6HA 1PYWD 2Z8LA 4CKBA 2NYZD 4DK6C 4XQNA 4BA2I 3DMUA 4RA8A 2R7ZH 4U673 4ME3A 3CCRA 4ZK9B 1E2WA 1Z47A 3H3VC 4DR7Q 1OXVA 1SN8A 4JYAQ 4A75A 4PZ8A 4HR7B 4HMIA 2GN5A 3A7LA 3VYUA 2Q2HA 2QILA 5E4XA 3FPUB 1LT6D 4OELB 4OO1H 1BOSA 5LHY1 1BNZA 1YHQA 3PSIA 4JI5Q 3K81C 2G9HD 1E24A 3ERQA 2GVAA 5BN5A 3A8KE 4C1NI 5I9PA 5IYCH 4FYDA 4NP5A 2VQFL 1I6VC 2N8NA 3P75A 2N49A 5C4JB 4DN4M 1DJRD 2CKZB 1Q3LA 4BY7H 2B2YA 4AH6A 1SE2A 4G4KA 4DV5L 1BR9A 2F52A 4ZKCB 2IJ0A 3DWPA 4LF6Q 1TWFH 4X3UA 5FJ8G 4DUZL 1EQQA 3D0FA 4DR4L 1FJGQ 1QG7A 2ICEC 1B70B 3S1NB 4LFAQ 2DUDA 2A8VA 1OTCA 4EVOA 3B6YA 4P72A 4BXXH 2B29A 3PV0A 4PG3A 2KQ3A 4GN4B 2VUMH 2HIXA 2N3SA 4C1NK 4HJ5A 5JEAH 2FMMA 3KFUA 1IYUA 1CI3M 4BY7G 3PUVA 1EY4A 4RGTA 5CV9A 1K8MA 3MA2B 1U4PA 3FPPA 3CMAA 1JJ2A 1J9OA 2IHEA 4DR1Q 1YJWA 1PRTD 4F87A 1KQSA 4K5XA 4KK7A 3UDFA 1SEBD 4BBSH 3I2ZA 4A3CG 2Q8RE 3KLRA 1B3QA 1B2TA 3S14B 5JVH3 3I91A 4LF9Q 3NTIA 1HZAA 1NAPA 1PH9A 3T13A 4DXGA 1Y1WG 4BXXG 2LXJA 1WD0A 1VCIA 1JB7A 3HOYB 2F4IA 1X3EA 3T1HQ 2L55A 1SYBA 1ASZA 3DUZA 1DD2A 2D0PA 2AHOB 4A4IA 3CCMA 3FKIB 4RFBA 5M5YH 3D4WA 1EWCA 4DK0A 1RTNA 1GXDC 1OXXK 2K03A 3HOVB 1YVCA 2L11A 1V1OA 3ND9A 3PCOB 2A6EC 3G6JB 2C5CA 4JI1L 2G9DA 1PZJD 1IBKQ 3KF8B 4KHZA 4LFBQ 3GTJH 1Z7TA 2RF4A 5E7NA 3PUXA 1XTCD 2MJ8A 1N34Q 4JI4Q 3K6OA 4DV3Q 5FO9B 1HNWL 3I72A 1F77A 1W6JA 4C3JB 3SK4A 5C5MA 1PH7A 1ASYA 2L1BA 4GOPC 3GTOB 4RH6A 4OXPA 4JOIA 2F0KA 5IE8A 1ZKOA 4K2KA 5IOCA 1EIYB 1CZWA 2B2VA 1CA6A 1WCMB 2F0FA 4CGYB 4KLKA 1VMCA 3CP0A 4J8QA 4Q0FA 1X3FA 2WAQB 2PO4A 4HCEA 1JOOA 3WOEA 3ULPA 4MHEA 5EAYA 2UUAL 4IZ8A 4IOAA 3GTPB 2PNRC 2D0OA 4A3BH 5CORA 1FR3A 3W1GA 1STGA 3TBIB 1Q8IA 3CRKC 1U9RA 2AKWB 3M7NA 2DGYA 2J0TD 4L6TB 1WTHA 4POFA 2VW9A 5GQOA 4NB3A 2KCCA 4HSVA 4CDFC 3Q0AA 3CW2C 1GO3E 1S72A 1XMQL 3S2DB 5C3EG 2NVTB 2B2TC 5EPKA 5FO7B 1I4GA 5ELBA 1P8LA 3VR6A 4X3KA 1X3QA 4R1JA 3S2HB 1L0WA 3OMCA 3RR5A 1DM0B 2O2LD 2F0IA 2K14A 2VQEL 5C44B 2ATWA 3U4ZA 1EFWA 1Y14B 1C9OA 2K4KA 1BXTA 4UHVA 2K33A 2WB1E 1U0LA 2SNMA 5CBEE 4RCOA 4NW2A 1WTOA 3DHQA 3FVQA 1Q12A 3NK9A 1I6HB 4O2DA 1EEID 3J7ZC 1HNZQ 1LABA 2QDLA 2HD3A 3QB3A 3J80c 5EKIA 2NZHA 4DNTB 3H0GG 1EOTA 3U9OA 1ZYRD 4MZ9A 4LF5L 1SFOH 2K5HA 1X3PA 1FNUA 4DV1L 3AQQA 4QMGA 1A2UA 3HGBA 3G71A 1VQAA 5C0XH 2H5XA 1VQGA 4NKLA 3J81c 2F4VQ 3QR8A 1G2SA 5EJWA 3OSOA 5E1FA 3PF4A 3A74A 4DAPA 3JAMi 3HOWH 1EY6A 2SNSA 2PZWA 4X66L 2ES2A 4N8X1 5IIFA 2R93G 2K04A 3CAMA 4KY5A 2WFWA 2RDFA 2L12A 3F2CA 3NTKA 5CC4A 1OO9B 4B9XA 2F1MA 1G6ZA 4YCUA 2ZTDA 3J7YW 5NUCA 3F8TA 1S4ZA 5IP7H 3W2DA 2WAQE 5GROA 3G4SA 5C0XG 4HIMA 3MXUA 2WP8J 1PA6A 1WTXA 4MN3A 5LMNL 1F2MA 4KI0A 2F03A 3TN2A 1NMGA 1N32Q 1CKNA 3MAQA 3ERSX 4B3TQ 1RF2D 1SYEA 1EZ6A 3M4OH 3CRLC 4DR3Q 3QO2A 1I94Q 1SMXA 1SR3A 1VQDA 2A69C 3MWYW 1TWGH 1YZ6A 4RGOS 4L5RC 2CVRA 1EIGA 5LL6S 1I3QB 2VXWA 5CV8A 2JA9A 2KOLA 5IP7G 4KY7A 1HHVA 2ZJRA 3V2TA 2MHVA 1STNA 5IP9H 3BZDB 3JAME 1I4PA 2E2IH 3FEWX 2A68C 1STAA 4CDEC 4LF8Q 1IKLA 1VQ7A 3S1QB 1CHQD 3HZXA 3NP8A 2M00A 1QILA 2JA5G 1HR0L 5FKAC 1M1KC 3VA5A 1Y1VG 4YY3Q 1HH2P 3AFPA 3WWVA 3HOXG 2UUCL 1B9NA 2PZUA 3TP8A 4JI7Q 3KBGA 3JC66 1B1ZA 2GA4B 2VB3X 3M4QA 2VB2X 1EY5A 2BA0A 1QWYA 1WOCA 1CZGA 4ODGA 1O80A 2BE5D 3J81i 2ID0A 3T1YQ 4LJZC 3M7GA 3CCJA 5IP9G 4TVAB 4HJ8A 3OPOA 4AQYL 1KAWA 1HTLD 1HUNA 2JE6I 2F0JA 1RL2A 1PV4A 3I4MH 1WTQA 2EXDA 1IL2A 4LNQA 1SJED 4A3FH 4IFDG 2RDHA 4JV5Q 3H3VI 4MNOA 4APVA 3A7AB 5I2YA 2DN8A 4LF7L 4DV0Q 2RVLA 3A8JE 3MC0B 4YWKA 4BWGB 2PI2A 4A3KH 3L0OA 5M5WB 4B3RQ 4OWXB 1Y1WB 3TSSA 3LX0A 2B63G 2B39A 3J80E 3CC2A 1IL8A 4GKJQ 5E4WC 1ET6A 1SYFA 1VDZA 4J6HA 1FVIA 4MIUA 3I4MG 3HFZB 4UP8A 1XNRQ 2OF1A 4AYBB 1UAPA 5AJ3L 4PNYA 3BVGA 4A3FG 4KJNA 3J81E 1X32A 3AB9A 4Q5VA 1SYCA 1VQHA 1HA6A 2CW0D 1B44D 1F2ZA 4YWMA 2E5LQ 1LTTD 1MSHA 5LMUQ 4DV2L 2NN6G 1ONLA 5JPNC 1RJTA 1CSPA 3G48A 4A3JH 3OWFA 3GV3A 1JMCA 2PQAA 1PFBA 2E2JH 1MIUA 4JI8Q 2YU9B 3GTKB 4XQJA 3CQZB 1EQRA 1IBLQ 2K52A 5GAEC 2KEEA 2Q2TA 1DCZA 1BBWA 2BOSA 2V4DA 1Q46A 5KYIA 3GTLH 1KLGD 1J8IA 1KHIA 1SE4A 2PYKA 4JYAL 3I73A 3A54A 2UUBL 1BO0A 2D9UA 3K58A 1MJCA 1STEA 3VYSA 2KENA 2B2WC
chains in the Genus database with same CATH topology
4R4IA 2OQKA 4DK6C 3RLOA 3HOUG 4KHPQ 4BA2I 4YHHL 3F2BA 2R7ZH 3EBEA 2I0QA 4JI5L 4ME3A 3CCRA 4HJ9A 1WI5A 2RCNA 1Z47A 2MO1A 3LGJA 1B8AA 3ZJYC 3GTGH 4DR7Q 2UXCL 1LUZA 1OXVA 3A5UA 1WYDA 4QJFA 1SN8A 4JYAQ 4UP9A 3BZCA 4PZ8A 3UE0A 4A75A 1EYGA 1VQKA 2R92H 4L5QA 3W5OA 1XJVA 1MJEA 3J80i 2GN5A 4DAMA 1LM0A 3KLWA 1AE3A 2JA8H 5C3EH 2Q2HA 5FLMH 3JAMc 1HNXL 3RZDH 1QZHA 2Z6KA 4GOPB 3RNUA 2QA4A 5M3FG 4YHHQ 1YHQA 1QZGA 3H3VH 3PSIA 4JI5Q 3K81C 1N8RC 3ER0A 1E24A 1HJPA 3KDFA 1FJGL 3K7UC 2GVAA 1KC8C 2UU9Q 4PZ6A 5IYCH 4GLXA 2OWOA 4NXML 2VQFL 2N8NA 3W1BA 2Y0SG 2JK8A 2I5LX 2N49A 2ZM6L 2CKZB 5IT9c 4X62Q 1PHJA 4BY7H 1N33L 1KL9A 1K9MC 4AH6A 3S16H 3NENA 4DV5L 2F52A 1HNXQ 1X54A 2OTLA 2R92G 3U50C 2PNHA 4GKJL 3CCSA 4AYBE 2Q2UA 2K5VA 4YWLA 4LF6Q 4UY8C 1W2BA 3TRZA 1TWFH 1EQQA 4LWCA 5FJ8G 4DUZL 3D0FA 5JEAJ 4LUOA 3KJPA 1QVGA 4DR4L 1U5KA 1FJGQ 1L1OC 3KF6A 3CC7A 3S1NH 4P71A 1X56A 3GTMH 1IZ6A 1T9HA 1B70B 1KRTA 4NXMQ 3H0GH 4LFAQ 2VQFQ 2DUDA 2YTXA 4JOIC 4GLAC 2A8VA 1OTCA 4NPSA 1IBMQ 3B6YA 1I50H 4IFDI 1Q8KA 1H95A 3PGZA 4P72A 2ZM6Q 2B29A 4BXXH 1HZCA 3PV0A 4PG3A 2HHHQ 2K5NA 1EIFA 4GN4B 1G291 2E5LL 2HIXA 2VUMH 4DV5Q 2N3SA 4HJ5A 1WJJA 3HKZE 3KFUA 3K80C 4X64L 4BY7G 1L2FA 3PUVA 1NE3A 5BR8Q 3L2PA 3CCQA 1KRSA 3ULJA 2A1AA 4LUVA 1P16A 2NZOA 3CMAA 3SGIA 2JA7H 1JJ2A 2IHEA 2R93H 1TWCH 4BA1I 5JJKA 4DR1Q 1YJWA 1VQMA 2L15A 3MEFA 4A93H 5C0XJ 4P73A 2VY3A 1CKOA 4DV6L 1KQSA 4A3DG 3UDFA 3I4NH 4BBSH 3S14H 3I2ZA 4A3CG 1QUQA 4GOPA 4A3KG 4LF9Q 4HJAA 1HZAA 1LYLA 1C0AA 1IBLL 2KHIA 1PH9A 1CSQA 3HOYH 1Y1WG 4X64Q 4BXXG 2LXJA 1JB7A 1GKHA 1VCIA 4BY1H 4R4QA 3J81j 1YIJA 1OXSC 1X3EA 3T1HQ 1HZ9A 3A0JA 3FKIH 1IBKL 1ASZA 2EIFA 2D0PA 2AHOB 4A4IA 5GADC 3CCMA 1UE7A 4LFBL 2IX0A 1PH3A 5M5YH 3ICEA 1GM5A 2NN6I 1PH8A 4QY7A 1N34L 4JI4L 3HOVH 5HGQA 1BBUA 4DV3L 1OXXK 4DV6Q 4B3ML 4PZ7A 1YVCA 1TWAH 2R6GA 2JA7G 2Y0SE 4X65L 2R7DA 2RHSB 4DR6L 3A5ZB 4A93G 3PCOB 4DAYB 5GAGC 3OW2A 1V1QA 4A3EG 4LF5Q 4JI1L 2ZTCA 2VS1A 5IYBH 2ALYB 4DR5Q 1UE1A 1O7IA 4DR7L 1VQBA 1IBKQ 3S15H 3KF8B 4KHZA 4AIMA 3I4NG 3OYYA 4LFBQ 3I56A 3HOZG 4QL5A 3GTJH 3HOYG 2KHJA 2RF4A 3PUXA 5E7NA 3PO2H 4BY1G 1VQIA 2NVXH 1N34Q 4JI4Q 1TXYA 1J6QA 4DV3Q 1KIXA 4B3MQ 3TS2A 1HNWL 3CCLA 3I7FA 5J3BA 4A3JG 2WB1G 2HIVA 4DR6Q 1JE5A 3HOVG 1PH7A 1ASYA 1L1OA 3RN2A 4GOPC 2JA5H 3GTOH 1Z9FA 1I5FA 1A63A 4JI1Q 3CCVA 1SROA 3K7AH 2UU9L 4OXPA 1Y1VH 4JOIA 4TQUS 4A3MG 3M4PA 5IYDH 3HOXH 3I4OA 3UDXA 1S40A 1UE6A 5IE8A 2Q2IA 4OWTB 4YCVA 4OO1G 1EIYB 1WCMH 3BZKA 5IYBG 1VQNA 4X62L 4KLKA 1HNWQ 3CP0A 3DLLA 4IFDJ 3NEMA 1R9TH 5LMNQ 2GVBA 3PO2G 1X3FA 4LF6L 3UDGA 2UXDQ 3GTPH 3ULPA 5EAYA 3D31A 2UUAL 4A3LG 1V43A 4IOAA 2CFMA 1X6OA 1UWVA 1V9PA 2E8GA 1XMOL 2D0OA 1XNQL 4EX5A 4A3BH 3KOJA 1KXLA 4JI3Q 4IPDA 4LFAL 5C4JH 3W1GA 5LMNW 2R7ZG 2CWAA 2YTVA 2CQOA 4XIGS 1IBML 3RN5A 1E22A 2AKWB 4J15A 2DGYA 2HHHL 2HT1A 4JBMA 3M7NA 1CKMA 4POFA 2VW9A 4OWWB 5GQOA 1K73C 4NB3A 1XPOA 1PH2A 1VS0A 5M3MH 1J5EQ 3S2DH 1S72A 4UP7A 3CW2C 1GO3E 4WJ3M 4C2MH 3J7A5 1C7YA 4MTNA 1XMQL 2V1CC 2NVTH 2JA8G 5C3EG 4HIKA 4PMWA 1JJGA 2UUAQ 4ALPA 5ELNA 4DPGA 5BR8L 5FLMG 2OQ0A 3GO5A 1K0RA 5IY0A 4HIDA 1XMOQ 4XTCS 5DLQE 2QEXA 1PH6A 1VQLA 1E3PA 1E7ZA 4DUYL 2B63H 3CCEA 3H15A 4DR1L 1P8LA 4Y52H 3HKSA 3S2HH 1HNZL 1VQ5A 4JI2L 4EQ5A 1HR0Q 4GS3A 4R1JA 1AH9A 1L0WA 1SRUA 1X3GA 5IYCG 3RR5A 2K14A 2VZAA 1NMFA 2AWOA 2VQEL 4LF9L 2ATWA 3U4ZA 3RZOH 1EFWA 4IJHA 1Y14B 1C9OA 1X55A 4HIOA 2K4KA 1XMQQ 1NJIC 2BH8A 2WB1E 1U0LA 3S24A 1HR0W 3T1HL 1CKNB 4JBWA 1VQPA 5M3MG 1I6HH 5JJLA 2XTIA 4DUYQ 5JJIA 1Q12A 1VQEA 4O2DA 3J7ZC 4DKAC 4Y7NH 1HNZQ 1NBWA 4JI2Q 4AQYQ 1BVSA 4BBRH 3K8AA 4A3GH 2CWPA 3VDYA 2OCEA 3J80c 1X9NA 3F1ZA 2BH2A 2NZHA 2VQEQ 3H0GG 2B3GA 3E0EA 3EN2A 1VQOA 4LF4L 1YI2A 1OXTA 4IO9A 2QGQA 4MZ9A 4LF5L 1SFOH 2K5HA 4DV1L 2JEBI 3AQQA 2BA1A 4DR5L 2VUMG 1TWHH 4O0AA 3G71A 4LF7Q 1VQAA 3CC4A 2H5XA 1M90C 1VQGA 3J81c 1IYJB 5JEAG 2F4VQ 4R4OA 3PIOA 1YJ9A 3PF4A 3A74A 3U4VA 3JAMi 1XPUA 3HOWH 1FGUA 4X66L 2ES2A 1XPRA 1VQ8A 1OXUA 2R93G 4JI0Q 1PVOA 3STBC 3KYHC 3RLFA 3CAMA 3CPFA 2F3IA 1A62A 3L7ZC 4JC0A 1CUKA 2WFWA 3M85A 4LF4Q 3F2CA 1VQ6A 1JT8A 2K75A 4BBSG 4DV1Q 1LTLA 4YCUA 2ZTDA 2E2HH 2YTYA 3F8TA 2FXQA 4DR3L 2MQHA 1VQJA 2C35B 5AJ3Q 2YYZA 5IP7H 1I94L 2CCZA 3HOUH 4K0KQ 3GDEA 1NY4A 4OONA 4JCVE 3U58A 2VL6A 2WAQE 5GROA 2ZJPA 3PIPA 3FKIG 3CD6A 4JBKA 3OTOQ 4X66Q 3G4SA 4C3JH 5C0XG 1YNXA 2AWNA 2WP8J 4HIMA 1PA6A 3BU2A 5LMNL 2OTJA 4KI0A 4DV2Q 4OX9Q 1G51A 1NMGA 1N32Q 4JI6L 2UXDL 1CKNA 3ERSX 4B3TQ 4LF8L 2JQOA 3M4OH 1VQFA 1IXRA 4DR3Q 1UE5A 4QIWE 1SMXA 1I94Q 2IHFA 1SR3A 1VQDA 2VNUD 5M3FH 2A19A 1TWGH 1YZ6A 2RHQB 4L5RC 2YV5A 2I5MX 4YY3L 1YHAA 1AE2A 1YJNA 2JA9A 1E1OA 2KCMA 1GVPA 1J5EL 5IP7G 4JI7L 5HY6A 3IRBA 2ZJRA 1KD1C 5IP9H 2Z0SA 4UPAA 2AMCB 2PMZE 4JI6Q 2E2IH 5FLXc 1E1TA 3T1YL 2IX1A 3S1QH 3GD7A 1EUJA 4LF8Q 2JA6H 2MO0A 4R4TA 1VQ7A 1BKBA 2JA5G 4L5TA 1HR0L 2UUBQ 1M1KC 2I5HA 4DV4Q 1W3SA 1Y1VG 5FJ8H 4YY3Q 1HH2P 3AFPA 3E9IA 4H02A 3WWVA 5IYDG 1MKHA 3HOXG 2UUCL 4QQBX 2KCTA 1QUQB 1K83H 1QVCA 4JI7Q 1YEZA 3JC66 3E9HA 3TREA 3CMEA 3EIVA 1SE8A 1WCMG 3M4QA 4FDBA 4JV5L 2BA0A 1WOCA 5ELOA 3J81i 4IJLA 2ID0A 1FL0A 3F2DA 3T1YQ 3NELA 4DV0L 2WAQG 4LFCL 2UXCQ 3M3YH 3NBHB 3CCJA 2XGTA 4C3HH 5IP9G 4TVAB 4B3RL 1Q7YC 4HJ8A 4AQYL 1KAWA 4WJ4A 3UDIA 1A0IA 2PQAB 2JE6I 5IWAL 1VQCA 2NVYH 2JA6G 4A3BG 5C44H 1RL2A 3I55A 3G6EA 4IOCA 1PV4A 3I4MH 2D62A 3FHWA 4GN5A 2UUCQ 4OO1I 4GNXC 2EXDA 1IL2A 1Q1EA 4QGUA 4LNQA 3AYHB 2MNAA 4A3FH 4IFDG 4JV5Q 3H3VI 4JG2A 3PUZA 4MNOA 4A3DH 2HQLA 1S3OA 3PO3G 1PYBA 4APVA 4A3IH 4GLVB 3S1RH 1XNRL 2R7FA 3BJUA 1XTDA 4P75A 4LW1A 4DV0Q 4LF7L 4A3CH 5M5WH 4LFCQ 2F4VL 4YWKA 5C4XH 2PI2A 4A3KH 1RIPA 3L0OA 4B3RQ 4JBJA 3TS0A 4B3SL 2EQSA 4GKKL 3PF5A 4OWXB 1Y1WH 4C3IH 4IPHA 4DK3C 5IWAQ 4JI0L 1N33Q 4GNXB 3AEVA 2IY5B 2B63G 4IPGA 5LMUL 1Q81C 3PUYA 3CC2A 4GKJQ 1D7QA 3PUWA 1L1OB 2Z6KC 4GN3B 4X6AH 4DUZQ 5C44G 3I4MG 2ASBA 1FVIA 4DR4Q 1PH1A 3HFZB 1Q1BA 2N78A 4UP8A 3TQYA 5GAHC 1Q86C 1XNRQ 3ULLA 2UXBL 3CPWA 1PH4A 2ZJQA 5AJ3L 4K0KL 4DR2L 5K36G 4A3FG 4B3SQ 4GKKQ 4DV7L 4A3EH 1G6PA 4JI8L 4A3IG 1N36L 2ZTEA 1SLJA 1UEBA 4JI3L 3OTOL 1VQHA 1DGSA 1YITA 4YWMA 2E5LQ 5C4XG 1YBYA 2JJQA 4R4CA 1A8VA 4IPCA 2NN6G 4LUZA 3CXCA 5LMUQ 4DV2L 4HJ7A 4OX9L 3HOZH 1N32L 3FP9A 4A76A 4BBRG 1D8LA 3UE1A 4L5SA 4A3GG 4B3TL 2PI2E 5H1SE 4P74A 3DM3A 1PFSA 1HZBA 3GTQH 1CSPA 3KDFB 3CCUA 1VQ4A 3S17H 2JEAI 3G48A 4A3JH 2UXBQ 3K0XA 1PH5A 4NXNL 3CF5A 1JMCA 4DR2Q 4RG1A 1YHBA 1K8GA 2PQAA 4DNIA 2YU9H 3GTKH 2E2JH 1JJCB 4DV7Q 3MXNB 1QVFA 4AYBG 1MIUA 4JI8Q 1Q82C 1N36Q 2LXKA 2IT1A 1PYSB 3CQZH 3Q8DA 4KHPL 5M5XH 4A3MH 3RLNA 1K8AC 4POGA 1EQRA 1IBLQ 1GD7A 2K52A 5GAEC 3PO3H 2Q2TA 3HOWG 1K3RA 1NTGA 3STBD 1BBWA 1X65A 2MFIA 3KJOA 1VQ9A 2LSSA 1Q46A 1WFQA 1EWIA 3GTLH 4RMFA 1EOVA 1KHIA 4YCWA 5C0XI 1XNQQ 4JYAL 3KF6B 1N9WA 3TEHB 4NXNQ 2NVQH 2KBNA 1B7YB 2UUBL 3M9BA 3S1MH 2K50A 1I3QH 1MJCA 4DV4L 4GNXA 3HKZG 3AFQA 4A3LH 2KENA 4X65Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R4I A;  2OQK A;  4DK6 C;  3RLO A;  3HOU G;  4KHP Q;  4BA2 I;  4YHH L;  3F2B A;  2R7Z H;  3EBE A;  2I0Q A;  4JI5 L;  4ME3 A;  3CCR A;  4HJ9 A;  1WI5 A;  2RCN A;  1Z47 A;  2MO1 A;  3LGJ A;  1B8A A;  3ZJY C;  3GTG H;  4DR7 Q;  2UXC L;  1LUZ A;  1OXV A;  3A5U A;  1WYD A;  4QJF A;  1SN8 A;  4JYA Q;  4UP9 A;  3BZC A;  4PZ8 A;  3UE0 A;  4A75 A;  1EYG A;  1VQK A;  2R92 H;  4L5Q A;  3W5O A;  1XJV A;  1MJE A;  3J80 i;  2GN5 A;  4DAM A;  1LM0 A;  3KLW A;  1AE3 A;  2JA8 H;  5C3E H;  2Q2H A;  5FLM H;  3JAM c;  1HNX L;  3RZD H;  1QZH A;  2Z6K A;  4GOP B;  3RNU A;  2QA4 A;  5M3F G;  4YHH Q;  1YHQ A;  1QZG A;  3H3V H;  3PSI A;  4JI5 Q;  3K81 C;  1N8R C;  3ER0 A;  1E24 A;  1HJP A;  3KDF A;  1FJG L;  3K7U C;  2GVA A;  1KC8 C;  2UU9 Q;  4PZ6 A;  5IYC H;  4GLX A;  2OWO A;  4NXM L;  2VQF L;  2N8N A;  3W1B A;  2Y0S G;  2JK8 A;  2I5L X;  2N49 A;  2ZM6 L;  2CKZ B;  5IT9 c;  4X62 Q;  1PHJ A;  4BY7 H;  1N33 L;  1KL9 A;  1K9M C;  4AH6 A;  3S16 H;  3NEN A;  4DV5 L;  2F52 A;  1HNX Q;  1X54 A;  2OTL A;  2R92 G;  3U50 C;  2PNH A;  4GKJ L;  3CCS A;  4AYB E;  2Q2U A;  2K5V A;  4YWL A;  4LF6 Q;  4UY8 C;  1W2B A;  3TRZ A;  1TWF H;  1EQQ A;  4LWC A;  5FJ8 G;  4DUZ L;  3D0F A;  5JEA J;  4LUO A;  3KJP A;  1QVG A;  4DR4 L;  1U5K A;  1FJG Q;  1L1O C;  3KF6 A;  3CC7 A;  3S1N H;  4P71 A;  1X56 A;  3GTM H;  1IZ6 A;  1T9H A;  1B70 B;  1KRT A;  4NXM Q;  3H0G H;  4LFA Q;  2VQF Q;  2DUD A;  2YTX A;  4JOI C;  4GLA C;  2A8V A;  1OTC A;  4NPS A;  1IBM Q;  3B6Y A;  1I50 H;  4IFD I;  1Q8K A;  1H95 A;  3PGZ A;  4P72 A;  2ZM6 Q;  2B29 A;  4BXX H;  1HZC A;  3PV0 A;  4PG3 A;  2HHH Q;  2K5N A;  1EIF A;  4GN4 B;  1G29 1;  2E5L L;  2HIX A;  2VUM H;  4DV5 Q;  2N3S A;  4HJ5 A;  1WJJ A;  3HKZ E;  3KFU A;  3K80 C;  4X64 L;  4BY7 G;  1L2F A;  3PUV A;  1NE3 A;  5BR8 Q;  3L2P A;  3CCQ A;  1KRS A;  3ULJ A;  2A1A A;  4LUV A;  1P16 A;  2NZO A;  3CMA A;  3SGI A;  2JA7 H;  1JJ2 A;  2IHE A;  2R93 H;  1TWC H;  4BA1 I;  5JJK A;  4DR1 Q;  1YJW A;  1VQM A;  2L15 A;  3MEF A;  4A93 H;  5C0X J;  4P73 A;  2VY3 A;  1CKO A;  4DV6 L;  1KQS A;  4A3D G;  3UDF A;  3I4N H;  4BBS H;  3S14 H;  3I2Z A;  4A3C G;  1QUQ A;  4GOP A;  4A3K G;  4LF9 Q;  4HJA A;  1HZA A;  1LYL A;  1C0A A;  1IBL L;  2KHI A;  1PH9 A;  1CSQ A;  3HOY H;  1Y1W G;  4X64 Q;  4BXX G;  2LXJ A;  1JB7 A;  1GKH A;  1VCI A;  4BY1 H;  4R4Q A;  3J81 j;  1YIJ A;  1OXS C;  1X3E A;  3T1H Q;  1HZ9 A;  3A0J A;  3FKI H;  1IBK L;  1ASZ A;  2EIF A;  2D0P A;  2AHO B;  4A4I A;  5GAD C;  3CCM A;  1UE7 A;  4LFB L;  2IX0 A;  1PH3 A;  5M5Y H;  3ICE A;  1GM5 A;  2NN6 I;  1PH8 A;  4QY7 A;  1N34 L;  4JI4 L;  3HOV H;  5HGQ A;  1BBU A;  4DV3 L;  1OXX K;  4DV6 Q;  4B3M L;  4PZ7 A;  1YVC A;  1TWA H;  2R6G A;  2JA7 G;  2Y0S E;  4X65 L;  2R7D A;  2RHS B;  4DR6 L;  3A5Z B;  4A93 G;  3PCO B;  4DAY B;  5GAG C;  3OW2 A;  1V1Q A;  4A3E G;  4LF5 Q;  4JI1 L;  2ZTC A;  2VS1 A;  5IYB H;  2ALY B;  4DR5 Q;  1UE1 A;  1O7I A;  4DR7 L;  1VQB A;  1IBK Q;  3S15 H;  3KF8 B;  4KHZ A;  4AIM A;  3I4N G;  3OYY A;  4LFB Q;  3I56 A;  3HOZ G;  4QL5 A;  3GTJ H;  3HOY G;  2KHJ A;  2RF4 A;  3PUX A;  5E7N A;  3PO2 H;  4BY1 G;  1VQI A;  2NVX H;  1N34 Q;  4JI4 Q;  1TXY A;  1J6Q A;  4DV3 Q;  1KIX A;  4B3M Q;  3TS2 A;  1HNW L;  3CCL A;  3I7F A;  5J3B A;  4A3J G;  2WB1 G;  2HIV A;  4DR6 Q;  1JE5 A;  3HOV G;  1PH7 A;  1ASY A;  1L1O A;  3RN2 A;  4GOP C;  2JA5 H;  3GTO H;  1Z9F A;  1I5F A;  1A63 A;  4JI1 Q;  3CCV A;  1SRO A;  3K7A H;  2UU9 L;  4OXP A;  1Y1V H;  4JOI A;  4TQU S;  4A3M G;  3M4P A;  5IYD H;  3HOX H;  3I4O A;  3UDX A;  1S40 A;  1UE6 A;  5IE8 A;  2Q2I A;  4OWT B;  4YCV A;  4OO1 G;  1EIY B;  1WCM H;  3BZK A;  5IYB G;  1VQN A;  4X62 L;  4KLK A;  1HNW Q;  3CP0 A;  3DLL A;  4IFD J;  3NEM A;  1R9T H;  5LMN Q;  2GVB A;  3PO2 G;  1X3F A;  4LF6 L;  3UDG A;  2UXD Q;  3GTP H;  3ULP A;  5EAY A;  3D31 A;  2UUA L;  4A3L G;  1V43 A;  4IOA A;  2CFM A;  1X6O A;  1UWV A;  1V9P A;  2E8G A;  1XMO L;  2D0O A;  1XNQ L;  4EX5 A;  4A3B H;  3KOJ A;  1KXL A;  4JI3 Q;  4IPD A;  4LFA L;  5C4J H;  3W1G A;  5LMN W;  2R7Z G;  2CWA A;  2YTV A;  2CQO A;  4XIG S;  1IBM L;  3RN5 A;  1E22 A;  2AKW B;  4J15 A;  2DGY A;  2HHH L;  2HT1 A;  4JBM A;  3M7N A;  1CKM A;  4POF A;  2VW9 A;  4OWW B;  5GQO A;  1K73 C;  4NB3 A;  1XPO A;  1PH2 A;  1VS0 A;  5M3M H;  1J5E Q;  3S2D H;  1S72 A;  4UP7 A;  3CW2 C;  1GO3 E;  4WJ3 M;  4C2M H;  3J7A 5;  1C7Y A;  4MTN A;  1XMQ L;  2V1C C;  2NVT H;  2JA8 G;  5C3E G;  4HIK A;  4PMW A;  1JJG A;  2UUA Q;  4ALP A;  5ELN A;  4DPG A;  5BR8 L;  5FLM G;  2OQ0 A;  3GO5 A;  1K0R A;  5IY0 A;  4HID A;  1XMO Q;  4XTC S;  5DLQ E;  2QEX A;  1PH6 A;  1VQL A;  1E3P A;  1E7Z A;  4DUY L;  2B63 H;  3CCE A;  3H15 A;  4DR1 L;  1P8L A;  4Y52 H;  3HKS A;  3S2H H;  1HNZ L;  1VQ5 A;  4JI2 L;  4EQ5 A;  1HR0 Q;  4GS3 A;  4R1J A;  1AH9 A;  1L0W A;  1SRU A;  1X3G A;  5IYC G;  3RR5 A;  2K14 A;  2VZA A;  1NMF A;  2AWO A;  2VQE L;  4LF9 L;  2ATW A;  3U4Z A;  3RZO H;  1EFW A;  4IJH A;  1Y14 B;  1C9O A;  1X55 A;  4HIO A;  2K4K A;  1XMQ Q;  1NJI C;  2BH8 A;  2WB1 E;  1U0L A;  3S24 A;  1HR0 W;  3T1H L;  1CKN B;  4JBW A;  1VQP A;  5M3M G;  1I6H H;  5JJL A;  2XTI A;  4DUY Q;  5JJI A;  1Q12 A;  1VQE A;  4O2D A;  3J7Z C;  4DKA C;  4Y7N H;  1HNZ Q;  1NBW A;  4JI2 Q;  4AQY Q;  1BVS A;  4BBR H;  3K8A A;  4A3G H;  2CWP A;  3VDY A;  2OCE A;  3J80 c;  1X9N A;  3F1Z A;  2BH2 A;  2NZH A;  2VQE Q;  3H0G G;  2B3G A;  3E0E A;  3EN2 A;  1VQO A;  4LF4 L;  1YI2 A;  1OXT A;  4IO9 A;  2QGQ A;  4MZ9 A;  4LF5 L;  1SFO H;  2K5H A;  4DV1 L;  2JEB I;  3AQQ A;  2BA1 A;  4DR5 L;  2VUM G;  1TWH H;  4O0A A;  3G71 A;  4LF7 Q;  1VQA A;  3CC4 A;  2H5X A;  1M90 C;  1VQG A;  3J81 c;  1IYJ B;  5JEA G;  2F4V Q;  4R4O A;  3PIO A;  1YJ9 A;  3PF4 A;  3A74 A;  3U4V A;  3JAM i;  1XPU A;  3HOW H;  1FGU A;  4X66 L;  2ES2 A;  1XPR A;  1VQ8 A;  1OXU A;  2R93 G;  4JI0 Q;  1PVO A;  3STB C;  3KYH C;  3RLF A;  3CAM A;  3CPF A;  2F3I A;  1A62 A;  3L7Z C;  4JC0 A;  1CUK A;  2WFW A;  3M85 A;  4LF4 Q;  3F2C A;  1VQ6 A;  1JT8 A;  2K75 A;  4BBS G;  4DV1 Q;  1LTL A;  4YCU A;  2ZTD A;  2E2H H;  2YTY A;  3F8T A;  2FXQ A;  4DR3 L;  2MQH A;  1VQJ A;  2C35 B;  5AJ3 Q;  2YYZ A;  5IP7 H;  1I94 L;  2CCZ A;  3HOU H;  4K0K Q;  3GDE A;  1NY4 A;  4OON A;  4JCV E;  3U58 A;  2VL6 A;  2WAQ E;  5GRO A;  2ZJP A;  3PIP A;  3FKI G;  3CD6 A;  4JBK A;  3OTO Q;  4X66 Q;  3G4S A;  4C3J H;  5C0X G;  1YNX A;  2AWN A;  2WP8 J;  4HIM A;  1PA6 A;  3BU2 A;  5LMN L;  2OTJ A;  4KI0 A;  4DV2 Q;  4OX9 Q;  1G51 A;  1NMG A;  1N32 Q;  4JI6 L;  2UXD L;  1CKN A;  3ERS X;  4B3T Q;  4LF8 L;  2JQO A;  3M4O H;  1VQF A;  1IXR A;  4DR3 Q;  1UE5 A;  4QIW E;  1SMX A;  1I94 Q;  2IHF A;  1SR3 A;  1VQD A;  2VNU D;  5M3F H;  2A19 A;  1TWG H;  1YZ6 A;  2RHQ B;  4L5R C;  2YV5 A;  2I5M X;  4YY3 L;  1YHA A;  1AE2 A;  1YJN A;  2JA9 A;  1E1O A;  2KCM A;  1GVP A;  1J5E L;  5IP7 G;  4JI7 L;  5HY6 A;  3IRB A;  2ZJR A;  1KD1 C;  5IP9 H;  2Z0S A;  4UPA A;  2AMC B;  2PMZ E;  4JI6 Q;  2E2I H;  5FLX c;  1E1T A;  3T1Y L;  2IX1 A;  3S1Q H;  3GD7 A;  1EUJ A;  4LF8 Q;  2JA6 H;  2MO0 A;  4R4T A;  1VQ7 A;  1BKB A;  2JA5 G;  4L5T A;  1HR0 L;  2UUB Q;  1M1K C;  2I5H A;  4DV4 Q;  1W3S A;  1Y1V G;  5FJ8 H;  4YY3 Q;  1HH2 P;  3AFP A;  3E9I A;  4H02 A;  3WWV A;  5IYD G;  1MKH A;  3HOX G;  2UUC L;  4QQB X;  2KCT A;  1QUQ B;  1K83 H;  1QVC A;  4JI7 Q;  1YEZ A;  3JC6 6;  3E9H A;  3TRE A;  3CME A;  3EIV A;  1SE8 A;  1WCM G;  3M4Q A;  4FDB A;  4JV5 L;  2BA0 A;  1WOC A;  5ELO A;  3J81 i;  4IJL A;  2ID0 A;  1FL0 A;  3F2D A;  3T1Y Q;  3NEL A;  4DV0 L;  2WAQ G;  4LFC L;  2UXC Q;  3M3Y H;  3NBH B;  3CCJ A;  2XGT A;  4C3H H;  5IP9 G;  4TVA B;  4B3R L;  1Q7Y C;  4HJ8 A;  4AQY L;  1KAW A;  4WJ4 A;  3UDI A;  1A0I A;  2PQA B;  2JE6 I;  5IWA L;  1VQC A;  2NVY H;  2JA6 G;  4A3B G;  5C44 H;  1RL2 A;  3I55 A;  3G6E A;  4IOC A;  1PV4 A;  3I4M H;  2D62 A;  3FHW A;  4GN5 A;  2UUC Q;  4OO1 I;  4GNX C;  2EXD A;  1IL2 A;  1Q1E A;  4QGU A;  4LNQ A;  3AYH B;  2MNA A;  4A3F H;  4IFD G;  4JV5 Q;  3H3V I;  4JG2 A;  3PUZ A;  4MNO A;  4A3D H;  2HQL A;  1S3O A;  3PO3 G;  1PYB A;  4APV A;  4A3I H;  4GLV B;  3S1R H;  1XNR L;  2R7F A;  3BJU A;  1XTD A;  4P75 A;  4LW1 A;  4DV0 Q;  4LF7 L;  4A3C H;  5M5W H;  4LFC Q;  2F4V L;  4YWK A;  5C4X H;  2PI2 A;  4A3K H;  1RIP A;  3L0O A;  4B3R Q;  4JBJ A;  3TS0 A;  4B3S L;  2EQS A;  4GKK L;  3PF5 A;  4OWX B;  1Y1W H;  4C3I H;  4IPH A;  4DK3 C;  5IWA Q;  4JI0 L;  1N33 Q;  4GNX B;  3AEV A;  2IY5 B;  2B63 G;  4IPG A;  5LMU L;  1Q81 C;  3PUY A;  3CC2 A;  4GKJ Q;  1D7Q A;  3PUW A;  1L1O B;  2Z6K C;  4GN3 B;  4X6A H;  4DUZ Q;  5C44 G;  3I4M G;  2ASB A;  1FVI A;  4DR4 Q;  1PH1 A;  3HFZ B;  1Q1B A;  2N78 A;  4UP8 A;  3TQY A;  5GAH C;  1Q86 C;  1XNR Q;  3ULL A;  2UXB L;  3CPW A;  1PH4 A;  2ZJQ A;  5AJ3 L;  4K0K L;  4DR2 L;  5K36 G;  4A3F G;  4B3S Q;  4GKK Q;  4DV7 L;  4A3E H;  1G6P A;  4JI8 L;  4A3I G;  1N36 L;  2ZTE A;  1SLJ A;  1UEB A;  4JI3 L;  3OTO L;  1VQH A;  1DGS A;  1YIT A;  4YWM A;  2E5L Q;  5C4X G;  1YBY A;  2JJQ A;  4R4C A;  1A8V A;  4IPC A;  2NN6 G;  4LUZ A;  3CXC A;  5LMU Q;  4DV2 L;  4HJ7 A;  4OX9 L;  3HOZ H;  1N32 L;  3FP9 A;  4A76 A;  4BBR G;  1D8L A;  3UE1 A;  4L5S A;  4A3G G;  4B3T L;  2PI2 E;  5H1S E;  4P74 A;  3DM3 A;  1PFS A;  1HZB A;  3GTQ H;  1CSP A;  3KDF B;  3CCU A;  1VQ4 A;  3S17 H;  2JEA I;  3G48 A;  4A3J H;  2UXB Q;  3K0X A;  1PH5 A;  4NXN L;  3CF5 A;  1JMC A;  4DR2 Q;  4RG1 A;  1YHB A;  1K8G A;  2PQA A;  4DNI A;  2YU9 H;  3GTK H;  2E2J H;  1JJC B;  4DV7 Q;  3MXN B;  1QVF A;  4AYB G;  1MIU A;  4JI8 Q;  1Q82 C;  1N36 Q;  2LXK A;  2IT1 A;  1PYS B;  3CQZ H;  3Q8D A;  4KHP L;  5M5X H;  4A3M H;  3RLN A;  1K8A C;  4POG A;  1EQR A;  1IBL Q;  1GD7 A;  2K52 A;  5GAE C;  3PO3 H;  2Q2T A;  3HOW G;  1K3R A;  1NTG A;  3STB D;  1BBW A;  1X65 A;  2MFI A;  3KJO A;  1VQ9 A;  2LSS A;  1Q46 A;  1WFQ A;  1EWI A;  3GTL H;  4RMF A;  1EOV A;  1KHI A;  4YCW A;  5C0X I;  1XNQ Q;  4JYA L;  3KF6 B;  1N9W A;  3TEH B;  4NXN Q;  2NVQ H;  2KBN A;  1B7Y B;  2UUB L;  3M9B A;  3S1M H;  2K50 A;  1I3Q H;  1MJC A;  4DV4 L;  4GNX A;  3HKZ G;  3AFQ A;  4A3L H;  2KEN A;  4X65 Q; 
#chains in the Genus database with same CATH topology
 4R4I A;  3RLO A;  2XVS A;  3F2B A;  2Z9H A;  3SR1 A;  2I0Q A;  4JI5 L;  2RQX A;  1AEX A;  2Y0S B;  1TR5 A;  2RCN A;  4ZKB B;  1B8A A;  3GTG H;  1KLU D;  1LUZ A;  3A5U A;  2WKD A;  4FP5 D;  4UP9 A;  1EYG A;  4NMZ A;  1XJV A;  4RHR A;  3I3C A;  1LM0 A;  3KLW A;  2R92 B;  1AE3 A;  1MSG A;  2JA8 H;  5L37 A;  1EYD A;  1IYV A;  3BG3 A;  5FLM H;  5C3E B;  2H1E A;  2FJ2 A;  1B53 A;  4K8I A;  3RZD H;  2Z6K A;  4HSP A;  1H9K A;  1KNA A;  1QZG A;  4YHH Q;  1QCB D;  1N8R C;  4FXK C;  4KKT A;  3KDF A;  1FJG L;  5LL6 X;  4IUN A;  3BYT B;  4GLX A;  2OWO A;  1H9M A;  2WAC A;  4K6D A;  1JOQ A;  1RD9 D;  4IUP A;  1S5C D;  1H9S A;  4N9P A;  3VYR A;  1K9M C;  4RHS A;  1UUP A;  4QIW B;  3BDO A;  3S16 B;  1X54 A;  2OTL A;  3CCS A;  1KAA A;  4AYB E;  2K5V A;  4YWL A;  1W2B A;  1KDA A;  1PZI D;  1QVG A;  4LUO A;  1U5K A;  2LFN A;  3I4L A;  3KF6 A;  1LTG D;  3CC7 A;  1T9H A;  4KKU A;  4NXM Q;  1NSN S;  4GLA C;  3H0G B;  2AQ3 B;  3QOJ A;  1HZC A;  1I50 B;  2KHS A;  1G29 1;  4OGQ C;  1MBY A;  1MI2 A;  4C3H G;  1O7L A;  1SNP A;  1LTA D;  1WJJ A;  3HKZ E;  3I70 A;  1Y8O B;  1L2F A;  1KRS A;  3MFG A;  2A1A A;  4LUV A;  4RAU C;  2JA7 H;  4KKS A;  1TWC H;  2R93 B;  1GHJ A;  2CW0 C;  1VQM A;  2K32 A;  1GHK A;  2EY1 A;  2VY3 A;  4P73 A;  4A93 B;  1FNW A;  3SK5 A;  1QUQ A;  2JYO A;  1DOL A;  3FDT A;  4GOP A;  2RDG A;  1LYL A;  2KHI A;  3D8G A;  3HG9 A;  3H94 A;  3RUZ A;  4BY1 H;  3J81 j;  2KA7 A;  1CM9 A;  1D5M C;  1IBK L;  3K5N A;  5GAD C;  4LFB L;  2NB0 A;  2EDG A;  4GZY C;  3MXP A;  1GM5 A;  4KN7 C;  4QY7 A;  1N34 L;  4JI4 L;  5HGQ A;  1EY7 A;  4DV3 L;  4DV6 Q;  5I4D A;  4N8F A;  2JA7 G;  2Y0S E;  4OIK A;  4X65 L;  1TWA B;  3VA7 A;  3A5Z B;  5K5P A;  3JAM L;  2NUC A;  4HCS A;  4DAY B;  3OW2 A;  5IYB H;  2ALY B;  1D5X C;  1STH A;  3NE5 B;  3C3L A;  2RKS A;  3I4N G;  4QL5 A;  4RKL A;  4BY1 G;  2NVX H;  1J6Q A;  4B3M Q;  3TS2 A;  3R2T A;  1PTO H;  3CCL A;  1TKW B;  3I7F A;  5J3B A;  1SNC A;  5IT9 L;  3TZD A;  4DR6 Q;  1U4L A;  2B2T A;  1BUV T;  1ILQ A;  1L1O A;  3RN2 A;  1Z9F A;  3C46 A;  2JA5 B;  3ITP A;  3ONA B;  3K7A H;  2UU9 L;  5IYD H;  1Y1V B;  1E2V A;  2Q2I A;  3H6M A;  4YCV A;  3HOX B;  4ZRZ A;  3BZK A;  5I6Y A;  1G91 A;  5J39 A;  5IYB G;  4X62 L;  1V1P A;  4UDU C;  3DLL A;  3NEM A;  3DEP A;  2A74 C;  2WV6 D;  1R9T B;  3L3O C;  1RKN A;  4A3L G;  1V43 A;  1W6K A;  1X6O A;  1A6X A;  1TY2 A;  4OHJ A;  3KOJ A;  1KXL A;  1BCP F;  2E74 C;  1U4R A;  3URY A;  5JOB A;  2R7Z G;  1NR4 A;  2CWA A;  2O4X A;  1IBM L;  3MXN A;  2HT1 A;  2HHH L;  4JBM A;  4CBV A;  3SVM A;  4K2L A;  5M3M H;  1F9R A;  1H9J A;  3W3A A;  4C2M H;  4MTN A;  1JJG A;  4ALP A;  4EQP A;  5ELN A;  5BR8 L;  1WTW A;  2AUK A;  1PH6 A;  4HID A;  1K0R A;  1XMO Q;  1VQL A;  1XNQ Q;  4XTC S;  4OO1 G;  2QEX A;  3D4D A;  4IN3 A;  3CCE A;  5DNF A;  2B63 B;  1HNZ L;  1VQ5 A;  3J81 L;  2RBM A;  1AH9 A;  1AN8 A;  1SRU A;  5IYC G;  1NMF A;  3IL8 A;  1LT3 D;  4R9W A;  1SNQ A;  5K36 H;  3RZO B;  1IHZ A;  1HA5 A;  2BH8 A;  1C4Q A;  3S24 A;  1ENF A;  5M3M G;  1K8O A;  4DUY Q;  4KY6 A;  1VQE A;  5DM7 3;  3IAY A;  2P5Z X;  4DKA C;  4Y7N H;  4BBR H;  3K8A A;  4A3G H;  2CWP A;  1E0B A;  4IUT A;  5F2D A;  3EN2 A;  2G5D A;  1VQO A;  3MFY A;  2QGQ A;  1A15 A;  2F0T A;  5KIX A;  4DR5 L;  4JPB W;  2VUM G;  4O0A A;  3TP6 A;  4JK1 C;  2MGS A;  3CC4 A;  3C2P A;  1TWH B;  5JEA G;  1SMY C;  1PDQ A;  1JB3 A;  2F3W A;  3T51 B;  3PIO A;  2O5J C;  1HRJ A;  1ESR A;  1I4R A;  1EY0 A;  2EJF C;  3SK6 A;  1OXU A;  1KDC A;  3STB C;  3KYH C;  4OIJ A;  2JP1 A;  2K75 A;  4BBS G;  5DAU A;  2YTY A;  4DR3 L;  1ILP A;  4G7H C;  4DXF A;  4K0K Q;  1I94 L;  2CCZ A;  3HOU H;  1ET9 A;  3U58 A;  1STY A;  3PIP A;  4JBK A;  4JI3 Q;  2E2J B;  1LTB D;  1TU2 B;  1RHP A;  2TMP A;  3HP3 A;  3R8B A;  1GUW A;  2OTJ A;  1YNJ D;  3Q24 A;  2PPB C;  2UXD L;  3J7A V;  4F88 A;  1TVX A;  4LF8 L;  1PTO D;  2B8F A;  2VNU D;  5M3F H;  2A19 A;  4R8N A;  2I5M X;  4YY3 L;  4ME5 A;  4JI7 L;  3MEH A;  1GVP A;  1J5E L;  3PMF A;  3KUP A;  1KD1 C;  2Z0S A;  2AMC B;  4JI6 Q;  3VR3 A;  5FLX c;  3T1Y L;  3TP5 A;  4QCL A;  1EUJ A;  1Y8N B;  2EZV A;  2JA6 H;  3PQI A;  5JPM C;  3MVV A;  1M8A A;  5EBC A;  3GTG B;  1JR0 D;  2F0Q A;  2IL8 A;  4ZCK A;  2I5H A;  1W3S A;  4QQB X;  4DF7 A;  1QUQ B;  3D4R A;  1K83 H;  1YEZ A;  3CME A;  3MTS A;  1SE8 A;  3FRP B;  4JV5 L;  4KD3 A;  3F2D A;  2DNC A;  4K14 A;  4DV0 L;  2OT2 A;  2PW7 A;  4IUU A;  1HQM C;  1KDB A;  1HXY D;  2XGT A;  4I7Z C;  4B3R L;  4V19 0;  4HN7 A;  4C3H B;  5C4H A;  3HEJ A;  4PMC A;  4DA2 A;  4DGZ A;  2JA6 G;  1SDF A;  4A3B G;  3G6E A;  2NVY B;  2K05 A;  5ELD A;  2MUY A;  3SXH A;  1S5B D;  2B2U C;  4HAE A;  4H0L C;  4QGU A;  1JOR A;  4A3D H;  5EGT A;  1PRT C;  2E75 C;  4A3I H;  1XNR L;  4LW1 A;  4QB4 A;  3S1R B;  4JBJ A;  5C4X B;  2L9H A;  4LMQ D;  4PMB A;  3PF5 A;  4H13 C;  2JN4 A;  4IPH A;  4DK3 C;  4C3I B;  4JI0 L;  2IY5 B;  3HRZ C;  3VR4 A;  3GQB A;  4IPG A;  5LMU L;  1R4Q B;  1ICW A;  3SDZ A;  3DEO A;  1EZ8 A;  1PRT B;  1L1O B;  3ND8 A;  4DUZ Q;  2KJX A;  4X6A H;  4DR4 Q;  1D5Z C;  1MGS A;  2A6H D;  2N78 A;  3TQY A;  1D1I A;  3AU7 A;  1NNX A;  1U4M A;  2JA7 B;  4K5V A;  2HCC A;  4GKK Q;  1Y69 U;  4A3E H;  4JI8 L;  4A3I G;  3OTO L;  1LV9 A;  1YBY A;  4K6L A;  1EU3 A;  1A8V A;  4OX9 L;  4LUZ A;  4HJ7 A;  5M9O A;  2B2Y C;  3HOZ H;  3I4N B;  3UE1 A;  3QJY A;  2XIW A;  4BY1 B;  5EPJ A;  3S17 H;  3NBH A;  4EGV A;  3EQL C;  2CHB D;  1ZXT A;  1VQ4 A;  1YNN D;  3GTQ B;  3K0Y A;  5EKL A;  2UXB Q;  3F2U A;  4XDX A;  4DR2 Q;  1YHB A;  4DNI A;  5ELE A;  4DV7 Q;  3MXN B;  2EY2 A;  1CT1 D;  4WFN 3;  1JWS D;  2E76 C;  3QOL A;  4A3M H;  4DAV A;  4POG A;  5M5X B;  5JVG 3;  3PO3 H;  1GUT A;  4K8J A;  3HOW G;  1NTG A;  1X65 A;  3KJO A;  2LSS A;  5G3L F;  4RMF A;  1EOV A;  4YCW A;  2PCF B;  5C0X I;  2F0O A;  1B7Y B;  3M9B A;  4C56 C;  2NVQ B;  3E0J A;  1T5E A;  3GV6 A;  4DV4 L;  3S1M B;  4GNX A;  4FXG C;  2NVX B;  1PTO B;  2X6G A;  4KHP Q;  1IW7 D;  2BDN A;  4YHH L;  1BBX C;  3N6R A;  1I4X A;  1RTO A;  1RCV D;  1DYQ A;  2NTT A;  1WI5 A;  2BCO A;  3ERO A;  2R7Z B;  2MO1 A;  5IGD A;  1CQF A;  2UXC L;  4JVZ A;  3K7A B;  5FLX E;  1EWH A;  1WYD A;  3PO3 G;  3BZC A;  3UE0 A;  3G7L A;  2XSC A;  2I46 A;  4L5Q A;  3W5O A;  1MJE A;  3J80 i;  2XNA C;  3SEB A;  4M1U B;  3I8Z A;  4KN4 C;  1QZH A;  4CJ2 C;  3K57 A;  2F0N A;  1PLF A;  5CBA E;  2DJG C;  1TS4 A;  2QCP X;  3H3V H;  4OEM B;  1HJP A;  3K7U C;  4PZ6 A;  2Z4H A;  4NXM L;  3NUC A;  2EYH A;  3IKJ A;  4XQQ A;  2I5L X;  2EY5 A;  3WOF A;  3S9W A;  1LAC A;  1HUM A;  1S5F D;  1PHJ A;  4CDD C;  1N33 L;  4TSS A;  4BY7 B;  3NEN A;  3X3M A;  1HNX Q;  5I9O A;  3U50 C;  4ID6 A;  4ABN A;  3TRZ A;  4LWC A;  4FF4 A;  3KJP A;  1GUG A;  3TDQ A;  1TWF B;  1R4P B;  3VR5 A;  3S1N H;  2F3V A;  1X56 A;  2KVM A;  2YTX A;  4JOI C;  4NPS A;  1TY0 A;  4IFD I;  1H95 A;  2E2D C;  2ZM6 Q;  2R61 A;  1ZYR C;  2K5N A;  1EIF A;  2HDM A;  3P20 A;  1CQV A;  3DXJ C;  3C1E A;  2VUM B;  1JWM D;  1EL0 A;  4PQX A;  1STB A;  3ULJ A;  4X3S A;  1EYA A;  2N88 A;  2NZO A;  3SGI A;  4U68 A;  5D65 A;  5DM6 3;  5C3W A;  5C0X J;  4DV6 L;  1NCV A;  2H4O A;  4Y7N B;  3OIQ A;  5D3I B;  3S14 H;  4BBS B;  1ZEQ X;  4A3K G;  1C0A A;  2X69 A;  4FNF A;  4H7B A;  1WTV A;  3HOY H;  4X64 Q;  1YNN C;  2KCN A;  4FF2 A;  1GKH A;  3M4Y A;  3A0J A;  1A3T A;  3FKI H;  2LS0 1;  1UE7 A;  1TS5 A;  1PH3 A;  3ICE A;  2NN6 I;  5HGT A;  1PH8 A;  5M5Y B;  3HOV H;  1BBU A;  4B3M L;  5FO8 B;  5I2X A;  2RHS B;  4DR6 L;  1A3U A;  5EQ0 A;  3HS0 C;  4LF5 Q;  2VS1 A;  2Q8I B;  4XYQ A;  1CA5 A;  1UE1 A;  1O78 A;  1O7I A;  2LKV A;  2M9V A;  3S15 H;  4DR7 L;  4AIM A;  1D2B A;  3RMH A;  3HOY G;  2KHJ A;  3PO2 H;  3K59 A;  3GTJ B;  1KIX A;  4A3J G;  2WB1 G;  4RGM A;  1A3V A;  4ZYS A;  3HOV G;  3EA6 A;  3GTO H;  1A63 A;  3OWE B;  5CV6 A;  1SRO A;  3SE0 A;  3MHB A;  1PXU A;  4TQU S;  2EXZ A;  3M4P A;  3I4O A;  1UE6 A;  1WCM H;  3R3O A;  4IFD J;  2BE5 C;  5LMN Q;  2GVB A;  3PIO 3;  3PO2 G;  1DZ1 A;  3OOC A;  4LF6 L;  1JOK A;  3GTP H;  3D31 A;  1G8Z D;  2CFM A;  2EY6 A;  1UWV A;  1V9P A;  2E8G A;  2Z6B A;  1XMO L;  1XNQ L;  2AQ1 B;  3QIA A;  4HED A;  4I7A A;  1H9R A;  4A3B B;  4LFA L;  1PFM A;  2K6A A;  3SK8 A;  2YTV A;  4XIG S;  4UAI A;  1CKM A;  4M8A A;  5A2Q E;  1XPO A;  1PH2 A;  1SNO A;  2JSO A;  3NWS A;  2HDL A;  4P2C B;  3S2D H;  2EYF A;  1C7Y A;  2NVT H;  3E3X A;  3X3N A;  5C4Z A;  2JA8 G;  1JQY D;  2NZ1 D;  4PMW A;  2RSO A;  3PIP 3;  4FXD A;  4DPG A;  3KF8 A;  5FLM G;  5ELF A;  2HQE A;  3EJI A;  4DUY L;  1E7Z A;  2XWJ B;  1ESF A;  4DR1 L;  4Y52 H;  2A5H A;  3S2H H;  1LT4 D;  1QB5 D;  4EQ5 A;  4ULL A;  1HR0 Q;  4FO2 A;  2AUJ D;  2DNE A;  2IWH A;  5KNB A;  2Z4I A;  2X6L A;  1O7Z A;  2VZA A;  3NXW A;  4LF9 L;  2D2C C;  1GUO A;  1JC7 A;  4IJH A;  1X55 A;  1NJI C;  3T1H L;  1CKN B;  3A56 A;  4KV6 A;  1GJX A;  4OL7 A;  2WIN B;  4A3I B;  1I6H H;  5JJL A;  2XTI A;  5IGF A;  5JJI A;  5AFW A;  1NBW A;  4JI2 Q;  4AQY Q;  5CYU A;  1BVS A;  2K28 A;  3VDY A;  3F1Z A;  1HTP A;  5KND A;  2CH4 A;  1YI2 A;  4IO9 A;  3TZU A;  4KJO A;  2JEB I;  2BA1 A;  1SFO B;  1LLR D;  4LF7 Q;  1M90 C;  1WD1 A;  1IYJ B;  2F0V A;  2L0C A;  4XT1 B;  2N55 A;  5D14 A;  5BN4 A;  4WOR A;  3U4V A;  2EYM A;  1XPU A;  3P1H A;  4ZQ3 A;  1FGU A;  1TT2 A;  3HOW B;  1PVO A;  3D6W A;  3GP7 A;  1A62 A;  1SE3 A;  1CUK A;  4LF4 Q;  5JJZ A;  3M85 A;  1VQ6 A;  2ZXR A;  1LTL A;  4KTA A;  4IUV A;  5FLX L;  2E2H H;  2CH4 W;  2FXQ A;  4CJ1 B;  1QE6 A;  3TME A;  5AJ3 Q;  4ZUJ A;  5KYL A;  2YYZ A;  1EIH A;  1WTP A;  3GDE A;  1NY4 A;  4OON A;  1CFM A;  2ZJP A;  1EY8 A;  2AWN A;  2QW7 A;  1ML0 D;  4DV2 Q;  3OIP A;  1G51 A;  2F0G A;  4JI6 L;  3BVM A;  4Z9C B;  2PZT A;  4XT3 B;  2KEC A;  4F8M A;  1SND A;  1VQF A;  2XN9 C;  3NBI A;  1IXR A;  2WII B;  2XRS D;  3C1F A;  3M4O B;  4QIW E;  2DJF C;  4G7O C;  1QOH A;  2PQE A;  1F2Y A;  2YV5 A;  1TWG B;  4K5W A;  2QKI C;  1YHA A;  2KCM A;  1E1O A;  2HCI A;  3H91 A;  5HY6 A;  4E6I A;  5T1G A;  2IX1 A;  2E2I B;  1MHW C;  3S1Q H;  4R4T A;  1BKB A;  2KED A;  1Q90 A;  1RDP D;  5G3L D;  2UUB Q;  5KRU A;  5FJ8 H;  5IYD G;  1SSO A;  3E9I A;  1TS3 A;  2F0M A;  4O42 A;  1QVC A;  2KCT A;  3J80 L;  3E9H A;  3BVZ A;  3NQI A;  3P7J A;  3O13 A;  3KLS A;  1FL0 A;  1G2T A;  3NEL A;  3BDC A;  2NTS A;  3M3Y H;  1L0Y B;  2ZXP A;  3A55 A;  4FF3 A;  2EYJ A;  3LWE A;  1Q7Y C;  2FHT A;  4WJ4 A;  2NWG A;  1A0I A;  2PQA B;  4L8J A;  5C6A A;  1VQC A;  3I55 A;  1ICF B;  4IOC A;  2D62 A;  5IOD A;  4OO1 I;  4O1N A;  5KNC A;  3I4M B;  1Q1E A;  2MNA A;  4L63 B;  2OEO A;  4JG2 A;  3PUZ A;  4A3F B;  3VYT A;  1CHP D;  1S3O A;  1PYB A;  1LO5 D;  4A3C H;  1B50 A;  5M5W H;  4LFC Q;  2F4V L;  2D5D A;  2PW5 A;  1II3 A;  5J1Z A;  4A3K B;  4GKK L;  2FFK B;  1Y1W H;  1Y8P B;  5IWA Q;  4FVM A;  3AEV A;  3BYY B;  2F0E A;  3EVQ A;  1Q81 C;  3DWA A;  4NDX A;  4DU9 A;  2L4N A;  1D7Q A;  3PUW A;  2Z6K C;  4GN3 B;  4IUQ A;  1PH1 A;  1Q1B A;  1Q86 C;  2I07 B;  1F9Q A;  2UXB L;  1PH4 A;  4DR2 L;  5K36 G;  1B3A A;  4V0B A;  4B3S Q;  4DV7 L;  2EPB A;  2ZTE A;  1DGS A;  2F0L A;  1TS2 A;  3SHL A;  5CR3 A;  3NPP A;  1N32 L;  1ROD A;  2BDO A;  4A76 A;  4BBR G;  4L5S A;  4A3G G;  1ENC A;  4B3T L;  2PI2 E;  2K1B A;  4CKE A;  1PFS A;  1HZB A;  1AZQ A;  4TKO B;  5D3D A;  5J22 A;  3KDF B;  3CCU A;  4RKB A;  2K5D A;  3K0X A;  1S5E D;  3BDL A;  2Q8T A;  3CF5 A;  1PH5 A;  4A3J B;  2WB1 B;  1K8G A;  2M2L A;  1XX8 A;  2YU9 H;  3GTK H;  3N52 A;  3LNN A;  1QVF A;  4AYB G;  1Q82 C;  1N36 Q;  1QNK A;  2IT1 A;  1H9S B;  1PYS B;  3CQZ H;  4KHP L;  3DWQ A;  3NWT A;  1K8A C;  4FF1 A;  1GD7 A;  5EKK A;  4WJW A;  1K3R A;  5FK9 C;  2SEB D;  1VQ9 A;  1WFQ A;  1GOZ A;  3GTL B;  3K5M A;  3S15 B;  3KF6 B;  1N9W A;  3TEH B;  1SXT A;  4NXN Q;  3NTH A;  1B4O A;  1SAP A;  3PO2 B;  2K50 A;  4WRD A;  3HKZ G;  5A2Q L;  4X65 Q;  1KNE A;  2OQK A;  1SYD A;  3NHH A;  3HOU G;  4DNR B;  2OXP A;  3EBE A;  4HJ9 A;  3LGJ A;  3V96 A;  3ZJY C;  3Q22 A;  4QJF A;  4MTK A;  1VQK A;  1TQO A;  2R92 H;  4DAM A;  1EFI D;  3R93 A;  5C3E H;  1DOK A;  2JA8 B;  1GUN A;  3K5L A;  2A69 D;  3OW7 A;  3JAM c;  1HNX L;  1I4H A;  4GOP B;  3RNU A;  2QA4 A;  5M3F G;  3RZD B;  1JIC A;  3ER0 A;  3KBX A;  1KC8 C;  2UU9 Q;  1LTS D;  3NSW A;  3W1B A;  1L0X B;  2A68 D;  2JK8 A;  2Y0S G;  5TSS A;  2ZM6 L;  5IT9 c;  4X62 Q;  2K01 A;  1KL9 A;  3S16 H;  1AP0 A;  1BQQ T;  2R92 G;  4J1M A;  1IKM A;  2PNH A;  4KHV A;  4GKJ L;  2Q2U A;  4UY8 C;  1SYG A;  3IFT A;  2MP1 A;  5EBD A;  5JEA J;  2A73 B;  1L1O C;  3OMG A;  4P71 A;  3GTM H;  1IZ6 A;  1KRT A;  3H0G H;  2VQF Q;  5KEE A;  1V8Q A;  1IBM Q;  1I50 H;  1Q8K A;  3PGZ A;  2O5I C;  3BS1 A;  2HHH Q;  3E6Z X;  2E5L L;  2RSN A;  4DV5 Q;  3K80 C;  4X64 L;  1EYC A;  3L9A X;  2Z1C A;  1HFG A;  2XWB B;  4QUC A;  1NE3 A;  5BR8 Q;  3L2P A;  3CCQ A;  4CKC A;  1P16 A;  3CU7 A;  5FOB B;  2R93 H;  4BA1 I;  3H09 A;  5JJK A;  3R2I A;  2L15 A;  3MEF A;  4A93 H;  1TWC B;  3A8I E;  4A3D G;  1CKO A;  1UNS A;  2B2W A;  1K0S A;  5T1I A;  4TRD A;  1V1P B;  3ZYY X;  4HJA A;  3MZ5 A;  1IBL L;  1CSQ A;  4LAA A;  3TP7 A;  4R4Q A;  1YIJ A;  1OXS C;  1HZ9 A;  4B9W A;  1FYC A;  2EIF A;  2IX0 A;  1XWE A;  2K5W A;  1YNJ C;  5DEH A;  1SNM A;  3RD4 A;  4PZ7 A;  1SBB B;  1TWA H;  2R6G A;  3VR2 A;  2R7D A;  4CHT B;  1ENA A;  4A93 G;  1PTO C;  1LTR D;  5GAG C;  2EYL A;  1V1Q A;  4A3E G;  4RWS C;  2F0W A;  2ZTC A;  3IFD A;  5BN3 A;  1FD7 D;  3QWN A;  4DR5 Q;  3MXG A;  1VQB A;  5E3F A;  3OYY A;  2ENB A;  3I56 A;  2E2H B;  3HOZ G;  2QDB A;  5A35 A;  1VQI A;  2ICI A;  3LWU A;  1TXY A;  2K7V A;  5ISR A;  5KGU A;  1C48 A;  2HIV A;  1JE5 A;  1O7Y A;  2JA5 H;  1GUS A;  1I5F A;  1B9M A;  4JI1 Q;  2AQ2 B;  3CCV A;  1Y1V H;  3UI2 A;  4A3M G;  3HOX H;  2EOT A;  1PZK D;  3UDX A;  1S40 A;  2QEJ C;  4OWT B;  1VQN A;  5CV7 A;  2IW3 A;  1HNW Q;  1AZP A;  1QJO A;  2EJG C;  1R9T H;  2F0P A;  1EEF D;  2FIN B;  4G7Z C;  3UDG A;  2UXD Q;  3U9S A;  2F0U A;  5IGE A;  2RA4 A;  4EX5 A;  2F0H A;  3QG1 A;  4IPD A;  1VMP A;  5C4J H;  4JW0 A;  5LMN W;  4IQZ A;  2CQO A;  4IFD H;  3RN5 A;  1HCZ A;  1E22 A;  4J15 A;  4DFA A;  4OWW B;  1K73 C;  2CQA A;  1K28 A;  5IT9 E;  1VS0 A;  1DON A;  1J5E Q;  4DAY A;  4UP7 A;  5CMD A;  2JXM B;  5M3M B;  3J7A 5;  4WJ3 M;  2V1C C;  1FGB D;  4C2M B;  4HIK A;  3CHB D;  2UUA Q;  1PRT F;  4XYO A;  2OQ0 A;  1D6E C;  3GO5 A;  5IY0 A;  5DLQ E;  1E3P A;  2B63 H;  3H15 A;  2PMZ B;  1A2T A;  3M3Y B;  3E5S A;  3HKS A;  4JI2 L;  4GS3 A;  1BCP D;  1X3G A;  4S3S A;  4DK1 A;  1HQR D;  2B2V C;  2AWO A;  3RZO H;  2A6H C;  4HIO A;  1HPC A;  1XMQ Q;  1KTK A;  2L5T A;  1HR0 W;  1LT5 D;  4JBW A;  1DXM A;  1VQP A;  1VF5 C;  1VF7 A;  2NN6 H;  2F0S A;  2QF7 A;  5IGC A;  4ZUI A;  1S5D D;  2F0D A;  1EQT A;  2OCE A;  4BBR B;  1KAB A;  1X9N A;  4A3G B;  2BH2 A;  2VQE Q;  1EQV A;  2B3G A;  3E0E A;  4LF4 L;  1OXT A;  3D6C A;  3T53 B;  2KUM A;  3FMC A;  1TWH H;  3WDN A;  1SJH D;  4R4O A;  4I65 A;  1EY9 A;  4EQO A;  1YJ9 A;  5HUR A;  2B8G A;  1AW7 A;  3DM1 A;  4XXE A;  1XPR A;  1C8C A;  1VQ8 A;  1LTI D;  1FNV A;  4JI0 Q;  3T4A C;  3RLF A;  1HFN A;  3CPF A;  2F3I A;  1PTO F;  3L7Z C;  4JC0 A;  1BDO A;  1JT8 A;  4DV1 Q;  3HKZ B;  2MQH A;  1VQJ A;  2C35 B;  4R8I A;  2K5Q A;  5IGG A;  3HOU B;  4JCV E;  2VL6 A;  1IW7 C;  3KK7 A;  3CD6 A;  3FKI G;  2RCF A;  3OTO Q;  4X66 Q;  4C3J H;  1YNX A;  3BU2 A;  4PV1 C;  3I90 A;  2ZXO A;  4OX9 Q;  1NUC A;  3J7A F;  2SOB A;  1BF4 A;  2J4X A;  5I6W A;  4F7X A;  2JQO A;  3V05 A;  1PMR A;  1UE5 A;  2XRQ D;  2IHF A;  2DY8 A;  2RHQ B;  5EPL A;  1CTM A;  5M3F B;  3NQT A;  1AE2 A;  2MPM A;  1YJN A;  1XXG A;  4KD4 A;  3IRB A;  4ZLT F;  1TII D;  4UPA A;  2PMZ E;  1E1T A;  4C3J G;  3GD7 A;  2LMC B;  2MO0 A;  1JWU D;  2JA6 B;  3D3R A;  4B08 A;  3K5O A;  4L5T A;  2ZT9 C;  3KLS X;  4DV4 Q;  3OHX C;  4H02 A;  1MKH A;  2TSS A;  1F9P A;  3TRE A;  3EIV A;  1PFN A;  1K83 B;  1WCM G;  4FDB A;  4IUR A;  1E2Z A;  4X3T A;  5ELO A;  1T5X D;  4IJL A;  4YIJ A;  2LY7 A;  3Q23 A;  2WAQ G;  4LFC L;  2UXC Q;  3NBH B;  1BCP C;  1EU4 A;  4C3H H;  4ILW A;  4BS9 A;  4G57 A;  2SDF A;  1K3B C;  5CV5 A;  5C5L A;  3UDI A;  2NBF A;  4RCN A;  5CGK A;  5IWA L;  2NVY H;  4HTH A;  1XYI A;  5C44 H;  3T56 B;  4CJ0 B;  1I4Q A;  3FHW A;  4GN5 A;  2UUC Q;  2WKC A;  4GNX C;  1JCK B;  3AYH B;  5ELC A;  2HQL A;  1UEA B;  3S1R H;  4GLV B;  4A3D B;  2R7F A;  3BJU A;  1BCP B;  1XTD A;  2DY7 A;  4P75 A;  1F9S A;  4H44 C;  4KMU C;  1CK1 A;  4RGN A;  5C4X H;  1RIP A;  3GTM B;  1QNU A;  5CV4 A;  4HMJ A;  3TS0 A;  4B3S L;  2EQS A;  1WTR A;  3EFX D;  4C3I H;  1N33 Q;  4GNX B;  2EYO A;  3PUY A;  1WVL A;  4QF4 A;  1MD2 D;  5C44 G;  4EQN A;  2IPK D;  2ASB A;  1NR2 A;  5GAH C;  2EE1 A;  3ULL A;  3CPW A;  2ZJQ A;  4K0K L;  5JAV A;  2HUG A;  1G6P A;  1N36 L;  4JI3 L;  1SLJ A;  1UEB A;  1YIT A;  1M4V A;  4A3E B;  1JE4 A;  5C4X G;  2JJQ A;  4R4C A;  3I4N H;  4IPC A;  3CXC A;  3FP9 A;  4CDC C;  4C3I G;  1D8L A;  3HOZ B;  4ZAI A;  5H1S E;  4P74 A;  3DM3 A;  2J7Z A;  3GTQ H;  5COY A;  2JEA I;  2C9O A;  5IGB A;  3S17 B;  4NXN L;  1DOM A;  5C3X A;  4RG1 A;  1F2L A;  4QUF A;  3AMU A;  1JJC B;  3CKI B;  1SMY D;  1AFP A;  2LXK A;  3Q8D A;  5M5X H;  3RLN A;  4LK1 C;  4A3M B;  2IX3 A;  3STB D;  3PO3 B;  2EJM A;  1D1K A;  2EVB A;  2MFI A;  1EWI A;  2R3Z A;  3Q6S A;  4IAL A;  3T16 A;  2A6E D;  2NVQ H;  2KBN A;  2FMC A;  3S1M H;  1I3Q H;  4N9T A;  2EYP A;  2B2U A;  3AFQ A;  4A3L H;  1Z6H A;  1PYW D;  2Z8L A;  4CKB A;  2NYZ D;  4DK6 C;  4XQN A;  4BA2 I;  3DMU A;  4RA8 A;  2R7Z H;  4U67 3;  4ME3 A;  3CCR A;  4ZK9 B;  1E2W A;  1Z47 A;  3H3V C;  4DR7 Q;  1OXV A;  1SN8 A;  4JYA Q;  4A75 A;  4PZ8 A;  4HR7 B;  4HMI A;  2GN5 A;  3A7L A;  3VYU A;  2Q2H A;  2QIL A;  5E4X A;  3FPU B;  1LT6 D;  4OEL B;  4OO1 H;  1BOS A;  5LHY 1;  1BNZ A;  1YHQ A;  3PSI A;  4JI5 Q;  3K81 C;  2G9H D;  1E24 A;  3ERQ A;  2GVA A;  5BN5 A;  3A8K E;  4C1N I;  5I9P A;  5IYC H;  4FYD A;  4NP5 A;  2VQF L;  1I6V C;  2N8N A;  3P75 A;  2N49 A;  5C4J B;  4DN4 M;  1DJR D;  2CKZ B;  1Q3L A;  4BY7 H;  2B2Y A;  4AH6 A;  1SE2 A;  4G4K A;  4DV5 L;  1BR9 A;  2F52 A;  4ZKC B;  2IJ0 A;  3DWP A;  4LF6 Q;  1TWF H;  4X3U A;  5FJ8 G;  4DUZ L;  1EQQ A;  3D0F A;  4DR4 L;  1FJG Q;  1QG7 A;  2ICE C;  1B70 B;  3S1N B;  4LFA Q;  2DUD A;  2A8V A;  1OTC A;  4EVO A;  3B6Y A;  4P72 A;  4BXX H;  2B29 A;  3PV0 A;  4PG3 A;  2KQ3 A;  4GN4 B;  2VUM H;  2HIX A;  2N3S A;  4C1N K;  4HJ5 A;  5JEA H;  2FMM A;  3KFU A;  1IYU A;  1CI3 M;  4BY7 G;  3PUV A;  1EY4 A;  4RGT A;  5CV9 A;  1K8M A;  3MA2 B;  1U4P A;  3FPP A;  3CMA A;  1JJ2 A;  1J9O A;  2IHE A;  4DR1 Q;  1YJW A;  1PRT D;  4F87 A;  1KQS A;  4K5X A;  4KK7 A;  3UDF A;  1SEB D;  4BBS H;  3I2Z A;  4A3C G;  2Q8R E;  3KLR A;  1B3Q A;  1B2T A;  3S14 B;  5JVH 3;  3I91 A;  4LF9 Q;  3NTI A;  1HZA A;  1NAP A;  1PH9 A;  3T13 A;  4DXG A;  1Y1W G;  4BXX G;  2LXJ A;  1WD0 A;  1VCI A;  1JB7 A;  3HOY B;  2F4I A;  1X3E A;  3T1H Q;  2L55 A;  1SYB A;  1ASZ A;  3DUZ A;  1DD2 A;  2D0P A;  2AHO B;  4A4I A;  3CCM A;  3FKI B;  4RFB A;  5M5Y H;  3D4W A;  1EWC A;  4DK0 A;  1RTN A;  1GXD C;  1OXX K;  2K03 A;  3HOV B;  1YVC A;  2L11 A;  1V1O A;  3ND9 A;  3PCO B;  2A6E C;  3G6J B;  2C5C A;  4JI1 L;  2G9D A;  1PZJ D;  1IBK Q;  3KF8 B;  4KHZ A;  4LFB Q;  3GTJ H;  1Z7T A;  2RF4 A;  5E7N A;  3PUX A;  1XTC D;  2MJ8 A;  1N34 Q;  4JI4 Q;  3K6O A;  4DV3 Q;  5FO9 B;  1HNW L;  3I72 A;  1F77 A;  1W6J A;  4C3J B;  3SK4 A;  5C5M A;  1PH7 A;  1ASY A;  2L1B A;  4GOP C;  3GTO B;  4RH6 A;  4OXP A;  4JOI A;  2F0K A;  5IE8 A;  1ZKO A;  4K2K A;  5IOC A;  1EIY B;  1CZW A;  2B2V A;  1CA6 A;  1WCM B;  2F0F A;  4CGY B;  4KLK A;  1VMC A;  3CP0 A;  4J8Q A;  4Q0F A;  1X3F A;  2WAQ B;  2PO4 A;  4HCE A;  1JOO A;  3WOE A;  3ULP A;  4MHE A;  5EAY A;  2UUA L;  4IZ8 A;  4IOA A;  3GTP B;  2PNR C;  2D0O A;  4A3B H;  5COR A;  1FR3 A;  3W1G A;  1STG A;  3TBI B;  1Q8I A;  3CRK C;  1U9R A;  2AKW B;  3M7N A;  2DGY A;  2J0T D;  4L6T B;  1WTH A;  4POF A;  2VW9 A;  5GQO A;  4NB3 A;  2KCC A;  4HSV A;  4CDF C;  3Q0A A;  3CW2 C;  1GO3 E;  1S72 A;  1XMQ L;  3S2D B;  5C3E G;  2NVT B;  2B2T C;  5EPK A;  5FO7 B;  1I4G A;  5ELB A;  1P8L A;  3VR6 A;  4X3K A;  1X3Q A;  4R1J A;  3S2H B;  1L0W A;  3OMC A;  3RR5 A;  1DM0 B;  2O2L D;  2F0I A;  2K14 A;  2VQE L;  5C44 B;  2ATW A;  3U4Z A;  1EFW A;  1Y14 B;  1C9O A;  2K4K A;  1BXT A;  4UHV A;  2K33 A;  2WB1 E;  1U0L A;  2SNM A;  5CBE E;  4RCO A;  4NW2 A;  1WTO A;  3DHQ A;  3FVQ A;  1Q12 A;  3NK9 A;  1I6H B;  4O2D A;  1EEI D;  3J7Z C;  1HNZ Q;  1LAB A;  2QDL A;  2HD3 A;  3QB3 A;  3J80 c;  5EKI A;  2NZH A;  4DNT B;  3H0G G;  1EOT A;  3U9O A;  1ZYR D;  4MZ9 A;  4LF5 L;  1SFO H;  2K5H A;  1X3P A;  1FNU A;  4DV1 L;  3AQQ A;  4QMG A;  1A2U A;  3HGB A;  3G71 A;  1VQA A;  5C0X H;  2H5X A;  1VQG A;  4NKL A;  3J81 c;  2F4V Q;  3QR8 A;  1G2S A;  5EJW A;  3OSO A;  5E1F A;  3PF4 A;  3A74 A;  4DAP A;  3JAM i;  3HOW H;  1EY6 A;  2SNS A;  2PZW A;  4X66 L;  2ES2 A;  4N8X 1;  5IIF A;  2R93 G;  2K04 A;  3CAM A;  4KY5 A;  2WFW A;  2RDF A;  2L12 A;  3F2C A;  3NTK A;  5CC4 A;  1OO9 B;  4B9X A;  2F1M A;  1G6Z A;  4YCU A;  2ZTD A;  3J7Y W;  5NUC A;  3F8T A;  1S4Z A;  5IP7 H;  3W2D A;  2WAQ E;  5GRO A;  3G4S A;  5C0X G;  4HIM A;  3MXU A;  2WP8 J;  1PA6 A;  1WTX A;  4MN3 A;  5LMN L;  1F2M A;  4KI0 A;  2F03 A;  3TN2 A;  1NMG A;  1N32 Q;  1CKN A;  3MAQ A;  3ERS X;  4B3T Q;  1RF2 D;  1SYE A;  1EZ6 A;  3M4O H;  3CRL C;  4DR3 Q;  3QO2 A;  1I94 Q;  1SMX A;  1SR3 A;  1VQD A;  2A69 C;  3MWY W;  1TWG H;  1YZ6 A;  4RGO S;  4L5R C;  2CVR A;  1EIG A;  5LL6 S;  1I3Q B;  2VXW A;  5CV8 A;  2JA9 A;  2KOL A;  5IP7 G;  4KY7 A;  1HHV A;  2ZJR A;  3V2T A;  2MHV A;  1STN A;  5IP9 H;  3BZD B;  3JAM E;  1I4P A;  2E2I H;  3FEW X;  2A68 C;  1STA A;  4CDE C;  4LF8 Q;  1IKL A;  1VQ7 A;  3S1Q B;  1CHQ D;  3HZX A;  3NP8 A;  2M00 A;  1QIL A;  2JA5 G;  1HR0 L;  5FKA C;  1M1K C;  3VA5 A;  1Y1V G;  4YY3 Q;  1HH2 P;  3AFP A;  3WWV A;  3HOX G;  2UUC L;  1B9N A;  2PZU A;  3TP8 A;  4JI7 Q;  3KBG A;  3JC6 6;  1B1Z A;  2GA4 B;  2VB3 X;  3M4Q A;  2VB2 X;  1EY5 A;  2BA0 A;  1QWY A;  1WOC A;  1CZG A;  4ODG A;  1O80 A;  2BE5 D;  3J81 i;  2ID0 A;  3T1Y Q;  4LJZ C;  3M7G A;  3CCJ A;  5IP9 G;  4TVA B;  4HJ8 A;  3OPO A;  4AQY L;  1KAW A;  1HTL D;  1HUN A;  2JE6 I;  2F0J A;  1RL2 A;  1PV4 A;  3I4M H;  1WTQ A;  2EXD A;  1IL2 A;  4LNQ A;  1SJE D;  4A3F H;  4IFD G;  2RDH A;  4JV5 Q;  3H3V I;  4MNO A;  4APV A;  3A7A B;  5I2Y A;  2DN8 A;  4LF7 L;  4DV0 Q;  2RVL A;  3A8J E;  3MC0 B;  4YWK A;  4BWG B;  2PI2 A;  4A3K H;  3L0O A;  5M5W B;  4B3R Q;  4OWX B;  1Y1W B;  3TSS A;  3LX0 A;  2B63 G;  2B39 A;  3J80 E;  3CC2 A;  1IL8 A;  4GKJ Q;  5E4W C;  1ET6 A;  1SYF A;  1VDZ A;  4J6H A;  1FVI A;  4MIU A;  3I4M G;  3HFZ B;  4UP8 A;  1XNR Q;  2OF1 A;  4AYB B;  1UAP A;  5AJ3 L;  4PNY A;  3BVG A;  4A3F G;  4KJN A;  3J81 E;  1X32 A;  3AB9 A;  4Q5V A;  1SYC A;  1VQH A;  1HA6 A;  2CW0 D;  1B44 D;  1F2Z A;  4YWM A;  2E5L Q;  1LTT D;  1MSH A;  5LMU Q;  4DV2 L;  2NN6 G;  1ONL A;  5JPN C;  1RJT A;  1CSP A;  3G48 A;  4A3J H;  3OWF A;  3GV3 A;  1JMC A;  2PQA A;  1PFB A;  2E2J H;  1MIU A;  4JI8 Q;  2YU9 B;  3GTK B;  4XQJ A;  3CQZ B;  1EQR A;  1IBL Q;  2K52 A;  5GAE C;  2KEE A;  2Q2T A;  1DCZ A;  1BBW A;  2BOS A;  2V4D A;  1Q46 A;  5KYI A;  3GTL H;  1KLG D;  1J8I A;  1KHI A;  1SE4 A;  2PYK A;  4JYA L;  3I73 A;  3A54 A;  2UUB L;  1BO0 A;  2D9U A;  3K58 A;  1MJC A;  1STE A;  3VYS A;  2KEN A;  2B2W C; 
#chains in the Genus database with same CATH homology
 4R4I A;  2OQK A;  4DK6 C;  3RLO A;  3HOU G;  4KHP Q;  4BA2 I;  4YHH L;  3F2B A;  2R7Z H;  3EBE A;  2I0Q A;  4JI5 L;  4ME3 A;  3CCR A;  4HJ9 A;  1WI5 A;  2RCN A;  1Z47 A;  2MO1 A;  3LGJ A;  1B8A A;  3ZJY C;  3GTG H;  4DR7 Q;  2UXC L;  1LUZ A;  1OXV A;  3A5U A;  1WYD A;  4QJF A;  1SN8 A;  4JYA Q;  4UP9 A;  3BZC A;  4PZ8 A;  3UE0 A;  4A75 A;  1EYG A;  1VQK A;  2R92 H;  4L5Q A;  3W5O A;  1XJV A;  1MJE A;  3J80 i;  2GN5 A;  4DAM A;  1LM0 A;  3KLW A;  1AE3 A;  2JA8 H;  5C3E H;  2Q2H A;  5FLM H;  3JAM c;  1HNX L;  3RZD H;  1QZH A;  2Z6K A;  4GOP B;  3RNU A;  2QA4 A;  5M3F G;  4YHH Q;  1YHQ A;  1QZG A;  3H3V H;  3PSI A;  4JI5 Q;  3K81 C;  1N8R C;  3ER0 A;  1E24 A;  1HJP A;  3KDF A;  1FJG L;  3K7U C;  2GVA A;  1KC8 C;  2UU9 Q;  4PZ6 A;  5IYC H;  4GLX A;  2OWO A;  4NXM L;  2VQF L;  2N8N A;  3W1B A;  2Y0S G;  2JK8 A;  2I5L X;  2N49 A;  2ZM6 L;  2CKZ B;  5IT9 c;  4X62 Q;  1PHJ A;  4BY7 H;  1N33 L;  1KL9 A;  1K9M C;  4AH6 A;  3S16 H;  3NEN A;  4DV5 L;  2F52 A;  1HNX Q;  1X54 A;  2OTL A;  2R92 G;  3U50 C;  2PNH A;  4GKJ L;  3CCS A;  4AYB E;  2Q2U A;  2K5V A;  4YWL A;  4LF6 Q;  4UY8 C;  1W2B A;  3TRZ A;  1TWF H;  1EQQ A;  4LWC A;  5FJ8 G;  4DUZ L;  3D0F A;  5JEA J;  4LUO A;  3KJP A;  1QVG A;  4DR4 L;  1U5K A;  1FJG Q;  1L1O C;  3KF6 A;  3CC7 A;  3S1N H;  4P71 A;  1X56 A;  3GTM H;  1IZ6 A;  1T9H A;  1B70 B;  1KRT A;  4NXM Q;  3H0G H;  4LFA Q;  2VQF Q;  2DUD A;  2YTX A;  4JOI C;  4GLA C;  2A8V A;  1OTC A;  4NPS A;  1IBM Q;  3B6Y A;  1I50 H;  4IFD I;  1Q8K A;  1H95 A;  3PGZ A;  4P72 A;  2ZM6 Q;  2B29 A;  4BXX H;  1HZC A;  3PV0 A;  4PG3 A;  2HHH Q;  2K5N A;  1EIF A;  4GN4 B;  1G29 1;  2E5L L;  2HIX A;  2VUM H;  4DV5 Q;  2N3S A;  4HJ5 A;  1WJJ A;  3HKZ E;  3KFU A;  3K80 C;  4X64 L;  4BY7 G;  1L2F A;  3PUV A;  1NE3 A;  5BR8 Q;  3L2P A;  3CCQ A;  1KRS A;  3ULJ A;  2A1A A;  4LUV A;  1P16 A;  2NZO A;  3CMA A;  3SGI A;  2JA7 H;  1JJ2 A;  2IHE A;  2R93 H;  1TWC H;  4BA1 I;  5JJK A;  4DR1 Q;  1YJW A;  1VQM A;  2L15 A;  3MEF A;  4A93 H;  5C0X J;  4P73 A;  2VY3 A;  1CKO A;  4DV6 L;  1KQS A;  4A3D G;  3UDF A;  3I4N H;  4BBS H;  3S14 H;  3I2Z A;  4A3C G;  1QUQ A;  4GOP A;  4A3K G;  4LF9 Q;  4HJA A;  1HZA A;  1LYL A;  1C0A A;  1IBL L;  2KHI A;  1PH9 A;  1CSQ A;  3HOY H;  1Y1W G;  4X64 Q;  4BXX G;  2LXJ A;  1JB7 A;  1GKH A;  1VCI A;  4BY1 H;  4R4Q A;  3J81 j;  1YIJ A;  1OXS C;  1X3E A;  3T1H Q;  1HZ9 A;  3A0J A;  3FKI H;  1IBK L;  1ASZ A;  2EIF A;  2D0P A;  2AHO B;  4A4I A;  5GAD C;  3CCM A;  1UE7 A;  4LFB L;  2IX0 A;  1PH3 A;  5M5Y H;  3ICE A;  1GM5 A;  2NN6 I;  1PH8 A;  4QY7 A;  1N34 L;  4JI4 L;  3HOV H;  5HGQ A;  1BBU A;  4DV3 L;  1OXX K;  4DV6 Q;  4B3M L;  4PZ7 A;  1YVC A;  1TWA H;  2R6G A;  2JA7 G;  2Y0S E;  4X65 L;  2R7D A;  2RHS B;  4DR6 L;  3A5Z B;  4A93 G;  3PCO B;  4DAY B;  5GAG C;  3OW2 A;  1V1Q A;  4A3E G;  4LF5 Q;  4JI1 L;  2ZTC A;  2VS1 A;  5IYB H;  2ALY B;  4DR5 Q;  1UE1 A;  1O7I A;  4DR7 L;  1VQB A;  1IBK Q;  3S15 H;  3KF8 B;  4KHZ A;  4AIM A;  3I4N G;  3OYY A;  4LFB Q;  3I56 A;  3HOZ G;  4QL5 A;  3GTJ H;  3HOY G;  2KHJ A;  2RF4 A;  3PUX A;  5E7N A;  3PO2 H;  4BY1 G;  1VQI A;  2NVX H;  1N34 Q;  4JI4 Q;  1TXY A;  1J6Q A;  4DV3 Q;  1KIX A;  4B3M Q;  3TS2 A;  1HNW L;  3CCL A;  3I7F A;  5J3B A;  4A3J G;  2WB1 G;  2HIV A;  4DR6 Q;  1JE5 A;  3HOV G;  1PH7 A;  1ASY A;  1L1O A;  3RN2 A;  4GOP C;  2JA5 H;  3GTO H;  1Z9F A;  1I5F A;  1A63 A;  4JI1 Q;  3CCV A;  1SRO A;  3K7A H;  2UU9 L;  4OXP A;  1Y1V H;  4JOI A;  4TQU S;  4A3M G;  3M4P A;  5IYD H;  3HOX H;  3I4O A;  3UDX A;  1S40 A;  1UE6 A;  5IE8 A;  2Q2I A;  4OWT B;  4YCV A;  4OO1 G;  1EIY B;  1WCM H;  3BZK A;  5IYB G;  1VQN A;  4X62 L;  4KLK A;  1HNW Q;  3CP0 A;  3DLL A;  4IFD J;  3NEM A;  1R9T H;  5LMN Q;  2GVB A;  3PO2 G;  1X3F A;  4LF6 L;  3UDG A;  2UXD Q;  3GTP H;  3ULP A;  5EAY A;  3D31 A;  2UUA L;  4A3L G;  1V43 A;  4IOA A;  2CFM A;  1X6O A;  1UWV A;  1V9P A;  2E8G A;  1XMO L;  2D0O A;  1XNQ L;  4EX5 A;  4A3B H;  3KOJ A;  1KXL A;  4JI3 Q;  4IPD A;  4LFA L;  5C4J H;  3W1G A;  5LMN W;  2R7Z G;  2CWA A;  2YTV A;  2CQO A;  4XIG S;  1IBM L;  3RN5 A;  1E22 A;  2AKW B;  4J15 A;  2DGY A;  2HHH L;  2HT1 A;  4JBM A;  3M7N A;  1CKM A;  4POF A;  2VW9 A;  4OWW B;  5GQO A;  1K73 C;  4NB3 A;  1XPO A;  1PH2 A;  1VS0 A;  5M3M H;  1J5E Q;  3S2D H;  1S72 A;  4UP7 A;  3CW2 C;  1GO3 E;  4WJ3 M;  4C2M H;  3J7A 5;  1C7Y A;  4MTN A;  1XMQ L;  2V1C C;  2NVT H;  2JA8 G;  5C3E G;  4HIK A;  4PMW A;  1JJG A;  2UUA Q;  4ALP A;  5ELN A;  4DPG A;  5BR8 L;  5FLM G;  2OQ0 A;  3GO5 A;  1K0R A;  5IY0 A;  4HID A;  1XMO Q;  4XTC S;  5DLQ E;  2QEX A;  1PH6 A;  1VQL A;  1E3P A;  1E7Z A;  4DUY L;  2B63 H;  3CCE A;  3H15 A;  4DR1 L;  1P8L A;  4Y52 H;  3HKS A;  3S2H H;  1HNZ L;  1VQ5 A;  4JI2 L;  4EQ5 A;  1HR0 Q;  4GS3 A;  4R1J A;  1AH9 A;  1L0W A;  1SRU A;  1X3G A;  5IYC G;  3RR5 A;  2K14 A;  2VZA A;  1NMF A;  2AWO A;  2VQE L;  4LF9 L;  2ATW A;  3U4Z A;  3RZO H;  1EFW A;  4IJH A;  1Y14 B;  1C9O A;  1X55 A;  4HIO A;  2K4K A;  1XMQ Q;  1NJI C;  2BH8 A;  2WB1 E;  1U0L A;  3S24 A;  1HR0 W;  3T1H L;  1CKN B;  4JBW A;  1VQP A;  5M3M G;  1I6H H;  5JJL A;  2XTI A;  4DUY Q;  5JJI A;  1Q12 A;  1VQE A;  4O2D A;  3J7Z C;  4DKA C;  4Y7N H;  1HNZ Q;  1NBW A;  4JI2 Q;  4AQY Q;  1BVS A;  4BBR H;  3K8A A;  4A3G H;  2CWP A;  3VDY A;  2OCE A;  3J80 c;  1X9N A;  3F1Z A;  2BH2 A;  2NZH A;  2VQE Q;  3H0G G;  2B3G A;  3E0E A;  3EN2 A;  1VQO A;  4LF4 L;  1YI2 A;  1OXT A;  4IO9 A;  2QGQ A;  4MZ9 A;  4LF5 L;  1SFO H;  2K5H A;  4DV1 L;  2JEB I;  3AQQ A;  2BA1 A;  4DR5 L;  2VUM G;  1TWH H;  4O0A A;  3G71 A;  4LF7 Q;  1VQA A;  3CC4 A;  2H5X A;  1M90 C;  1VQG A;  3J81 c;  1IYJ B;  5JEA G;  2F4V Q;  4R4O A;  3PIO A;  1YJ9 A;  3PF4 A;  3A74 A;  3U4V A;  3JAM i;  1XPU A;  3HOW H;  1FGU A;  4X66 L;  2ES2 A;  1XPR A;  1VQ8 A;  1OXU A;  2R93 G;  4JI0 Q;  1PVO A;  3STB C;  3KYH C;  3RLF A;  3CAM A;  3CPF A;  2F3I A;  1A62 A;  3L7Z C;  4JC0 A;  1CUK A;  2WFW A;  3M85 A;  4LF4 Q;  3F2C A;  1VQ6 A;  1JT8 A;  2K75 A;  4BBS G;  4DV1 Q;  1LTL A;  4YCU A;  2ZTD A;  2E2H H;  2YTY A;  3F8T A;  2FXQ A;  4DR3 L;  2MQH A;  1VQJ A;  2C35 B;  5AJ3 Q;  2YYZ A;  5IP7 H;  1I94 L;  2CCZ A;  3HOU H;  4K0K Q;  3GDE A;  1NY4 A;  4OON A;  4JCV E;  3U58 A;  2VL6 A;  2WAQ E;  5GRO A;  2ZJP A;  3PIP A;  3FKI G;  3CD6 A;  4JBK A;  3OTO Q;  4X66 Q;  3G4S A;  4C3J H;  5C0X G;  1YNX A;  2AWN A;  2WP8 J;  4HIM A;  1PA6 A;  3BU2 A;  5LMN L;  2OTJ A;  4KI0 A;  4DV2 Q;  4OX9 Q;  1G51 A;  1NMG A;  1N32 Q;  4JI6 L;  2UXD L;  1CKN A;  3ERS X;  4B3T Q;  4LF8 L;  2JQO A;  3M4O H;  1VQF A;  1IXR A;  4DR3 Q;  1UE5 A;  4QIW E;  1SMX A;  1I94 Q;  2IHF A;  1SR3 A;  1VQD A;  2VNU D;  5M3F H;  2A19 A;  1TWG H;  1YZ6 A;  2RHQ B;  4L5R C;  2YV5 A;  2I5M X;  4YY3 L;  1YHA A;  1AE2 A;  1YJN A;  2JA9 A;  1E1O A;  2KCM A;  1GVP A;  1J5E L;  5IP7 G;  4JI7 L;  5HY6 A;  3IRB A;  2ZJR A;  1KD1 C;  5IP9 H;  2Z0S A;  4UPA A;  2AMC B;  2PMZ E;  4JI6 Q;  2E2I H;  5FLX c;  1E1T A;  3T1Y L;  2IX1 A;  3S1Q H;  3GD7 A;  1EUJ A;  4LF8 Q;  2JA6 H;  2MO0 A;  4R4T A;  1VQ7 A;  1BKB A;  2JA5 G;  4L5T A;  1HR0 L;  2UUB Q;  1M1K C;  2I5H A;  4DV4 Q;  1W3S A;  1Y1V G;  5FJ8 H;  4YY3 Q;  1HH2 P;  3AFP A;  3E9I A;  4H02 A;  3WWV A;  5IYD G;  1MKH A;  3HOX G;  2UUC L;  4QQB X;  2KCT A;  1QUQ B;  1K83 H;  1QVC A;  4JI7 Q;  1YEZ A;  3JC6 6;  3E9H A;  3TRE A;  3CME A;  3EIV A;  1SE8 A;  1WCM G;  3M4Q A;  4FDB A;  4JV5 L;  2BA0 A;  1WOC A;  5ELO A;  3J81 i;  4IJL A;  2ID0 A;  1FL0 A;  3F2D A;  3T1Y Q;  3NEL A;  4DV0 L;  2WAQ G;  4LFC L;  2UXC Q;  3M3Y H;  3NBH B;  3CCJ A;  2XGT A;  4C3H H;  5IP9 G;  4TVA B;  4B3R L;  1Q7Y C;  4HJ8 A;  4AQY L;  1KAW A;  4WJ4 A;  3UDI A;  1A0I A;  2PQA B;  2JE6 I;  5IWA L;  1VQC A;  2NVY H;  2JA6 G;  4A3B G;  5C44 H;  1RL2 A;  3I55 A;  3G6E A;  4IOC A;  1PV4 A;  3I4M H;  2D62 A;  3FHW A;  4GN5 A;  2UUC Q;  4OO1 I;  4GNX C;  2EXD A;  1IL2 A;  1Q1E A;  4QGU A;  4LNQ A;  3AYH B;  2MNA A;  4A3F H;  4IFD G;  4JV5 Q;  3H3V I;  4JG2 A;  3PUZ A;  4MNO A;  4A3D H;  2HQL A;  1S3O A;  3PO3 G;  1PYB A;  4APV A;  4A3I H;  4GLV B;  3S1R H;  1XNR L;  2R7F A;  3BJU A;  1XTD A;  4P75 A;  4LW1 A;  4DV0 Q;  4LF7 L;  4A3C H;  5M5W H;  4LFC Q;  2F4V L;  4YWK A;  5C4X H;  2PI2 A;  4A3K H;  1RIP A;  3L0O A;  4B3R Q;  4JBJ A;  3TS0 A;  4B3S L;  2EQS A;  4GKK L;  3PF5 A;  4OWX B;  1Y1W H;  4C3I H;  4IPH A;  4DK3 C;  5IWA Q;  4JI0 L;  1N33 Q;  4GNX B;  3AEV A;  2IY5 B;  2B63 G;  4IPG A;  5LMU L;  1Q81 C;  3PUY A;  3CC2 A;  4GKJ Q;  1D7Q A;  3PUW A;  1L1O B;  2Z6K C;  4GN3 B;  4X6A H;  4DUZ Q;  5C44 G;  3I4M G;  2ASB A;  1FVI A;  4DR4 Q;  1PH1 A;  3HFZ B;  1Q1B A;  2N78 A;  4UP8 A;  3TQY A;  5GAH C;  1Q86 C;  1XNR Q;  3ULL A;  2UXB L;  3CPW A;  1PH4 A;  2ZJQ A;  5AJ3 L;  4K0K L;  4DR2 L;  5K36 G;  4A3F G;  4B3S Q;  4GKK Q;  4DV7 L;  4A3E H;  1G6P A;  4JI8 L;  4A3I G;  1N36 L;  2ZTE A;  1SLJ A;  1UEB A;  4JI3 L;  3OTO L;  1VQH A;  1DGS A;  1YIT A;  4YWM A;  2E5L Q;  5C4X G;  1YBY A;  2JJQ A;  4R4C A;  1A8V A;  4IPC A;  2NN6 G;  4LUZ A;  3CXC A;  5LMU Q;  4DV2 L;  4HJ7 A;  4OX9 L;  3HOZ H;  1N32 L;  3FP9 A;  4A76 A;  4BBR G;  1D8L A;  3UE1 A;  4L5S A;  4A3G G;  4B3T L;  2PI2 E;  5H1S E;  4P74 A;  3DM3 A;  1PFS A;  1HZB A;  3GTQ H;  1CSP A;  3KDF B;  3CCU A;  1VQ4 A;  3S17 H;  2JEA I;  3G48 A;  4A3J H;  2UXB Q;  3K0X A;  1PH5 A;  4NXN L;  3CF5 A;  1JMC A;  4DR2 Q;  4RG1 A;  1YHB A;  1K8G A;  2PQA A;  4DNI A;  2YU9 H;  3GTK H;  2E2J H;  1JJC B;  4DV7 Q;  3MXN B;  1QVF A;  4AYB G;  1MIU A;  4JI8 Q;  1Q82 C;  1N36 Q;  2LXK A;  2IT1 A;  1PYS B;  3CQZ H;  3Q8D A;  4KHP L;  5M5X H;  4A3M H;  3RLN A;  1K8A C;  4POG A;  1EQR A;  1IBL Q;  1GD7 A;  2K52 A;  5GAE C;  3PO3 H;  2Q2T A;  3HOW G;  1K3R A;  1NTG A;  3STB D;  1BBW A;  1X65 A;  2MFI A;  3KJO A;  1VQ9 A;  2LSS A;  1Q46 A;  1WFQ A;  1EWI A;  3GTL H;  4RMF A;  1EOV A;  1KHI A;  4YCW A;  5C0X I;  1XNQ Q;  4JYA L;  3KF6 B;  1N9W A;  3TEH B;  4NXN Q;  2NVQ H;  2KBN A;  1B7Y B;  2UUB L;  3M9B A;  3S1M H;  2K50 A;  1I3Q H;  1MJC A;  4DV4 L;  4GNX A;  3HKZ G;  3AFQ A;  4A3L H;  2KEN A;  4X65 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...