2NVTH

Rna polymerase ii elongation complex in 150 mm mg+2 with gmpcpp
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(*AP*AP*GP*AP*CP*CP*AP*GP*GP*C)-3'
publication title Structural basis of transcription: role of the trigger loop in substrate specificity and catalysis
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
total genus 21
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2006-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2nvtH00
4GLAC 1Q82C 1KC8C 5E7NA 4IFDI 2R7FA 2ES2A 4X66Q 4DR5Q 1T9HA 1VQOA 2KCMA 2ATWA 1LM0A 4LW1A 1PH9A 2AWNA 4C3IH 2N3SA 2UXBL 4LF5Q 4QQBX 1IXRA 4KHZA 4Y7NH 1E7ZA 2BH8A 1OXSC 3LGJA 4YWMA 3RR5A 5C0XG 3M85A 3G71A 3CD6A 4XIGS 1L2FA 2BA0A 1J5EQ 2IT1A 5AJ3Q 2IX1A 1QUQA 4NXML 2ZTEA 3K8AA 3H15A 1GKHA 1WFQA 4JI5L 3KF6A 3TQYA 2HQLA 3UDXA 3CQZH 3G6EA 5M3FH 4B3TL 1VCIA 4JI8L 1B70B 3KOJA 1HJPA 2JEAI 1PH6A 2C35B 2CFMA 2VNUD 4RMFA 1HH2P 2NVYH 3BZCA 3NBHB 5BR8Q 5FJ8G 2F4VL 1X3EA 4DV1Q 2UU9L 1VQEA 1U0LA 2KHIA 1IZ6A 2L15A 3CMAA 1I94L 3GTLH 1WJJA 2N8NA 1KHIA 1VQ8A 1HNWL 3KYHC 2OQ0A 1X65A 1PH5A 3PUWA 4GOPC 1HNZQ 4A3EH 3KJPA 4DV0Q 2VL6A 3OTOL 4A3IH 1EYGA 2K5VA 1K8AC 1X6OA 5FLMH 3J81c 4IOCA 3S1NH 3PF5A 2GVAA 3U4ZA 3TS0A 2PQAA 4L5RC 2VUMG 1B8AA 4A3CH 4A3JH 3PUZA 4TVAB 2ZJQA 1K8GA 4A3LH 3K7UC 2VQEL 3F1ZA 3D31A 2I0QA 3HOVH 1K83H 3PUXA 1K9MC 1QZGA 5EAYA 4IFDJ 2UUCL 4JV5L 4R4QA 2MNAA 1MKHA 4A3DG 1WCMG 3AYHB 2UU9Q 1G291 4R4TA 4YCUA 3S2HH 4DR7L 1Q7YC 4HIMA 1ASYA 1HNWQ 2WFWA 4C3JH 1EUJA 1OXXK 1M90C 1K3RA 1NY4A 2UXDL 4WJ3M 5C4XH 5LMNW 4JI3L 3HOYG 2MFIA 3I4MH 1S3OA 1IBML 3CCSA 1N8RC 1NMFA 1PH7A 4LF4L 1VQFA 2HIVA 1KD1C 2WAQG 3UE1A 2VQEQ 1VQLA 3GTKH 4DR6Q 4DR1L 4P73A 3UE0A 4QIWE 4AH6A 4K0KQ 1HR0Q 1PV4A 2IHEA 3HOUH 5IP9H 1V9PA 4L5TA 1Q86C 5IE8A 5M5XH 4RG1A 3KDFB 3ZJYC 2KBNA 3BJUA 1PHJA 1Q81C 2JA8G 4DV5L 1XMOL 4LF7Q 2K50A 4OWXB 1LUZA 2A8VA 3I4NG 1E3PA 1KAWA 3CPFA 2BH2A 2UXDQ 1HZAA 1OXVA 1X55A 3UDGA 4B3SQ 4DUYL 2QGQA 3L7ZC 3RN5A 1VQAA 3OYYA 4JG2A 3U4VA 3I56A 1P16A 3PF4A 4O2DA 4A3EG 1N32L 1X3FA 2VQFL 1G51A 4GLVB 3PIOA 4GOPB 4A3KG 3GTOH 1UE5A 3Q8DA 2B63G 1N34Q 2RHQB 4DPGA 1HNXQ 5FJ8H 2R93G 2EXDA 5J3BA 3A74A 4X64L 4LFAL 1YVCA 5IWAQ 1P8LA 1NBWA 4DKAC 1TWAH 4DV5Q 1XMOQ 1KQSA 1WOCA 3T1HL 1N33L 3M7NA 3S1QH 4A3BG 1IBKQ 1DGSA 1L0WA 3HKZG 4GKJQ 1CKNB 1XPRA 1NJIC 2MO1A 3HKSA 2JA9A 4IFDG 2OTJA 3TS2A 3H3VI 5LMUQ 3K7AH 3L0OA 2E5LL 2VUMH 4GS3A 2JA6G 3HFZB 1E1OA 2YTYA 2VQFQ 4A93G 5IYCG 3CAMA 2XGTA 3S1RH 4UPAA 3AQQA 2DGYA 2DUDA 2JJQA 4P71A 1I5FA 2GVBA 4JI2Q 4YCWA 4A3DH 2ZM6L 1WCMH 2F52A 3W5OA 2HHHL 1KIXA 1AE3A 1BVSA 1JB7A 1YIJA 4HIOA 3PUYA 2VW9A 1MIUA 4IPGA 1CSQA 1G6PA 3KJOA 3A5ZB 4JOIC 5C3EG 1N36L 4OX9L 1IBLQ 5JEAJ 1EIFA 3HOYH 3TEHB 4P74A 1EQRA 3JAMi 1Y1VG 2YV5A 4PMWA 3F2BA 4HJ9A 1VQ9A 1OXUA 2A1AA 3B6YA 1C9OA 2RCNA 1PH3A 4LFBL 4O0AA 1XJVA 4DK3C 4JOIA 3S16H 4GLXA 4J15A 4DV3Q 1L1OB 4LF6Q 2UUAQ 2WP8J 3RZDH 4LFCQ 1UE1A 2HIXA 1HZCA 4JI6Q 4UY8C 3RLNA 4IJHA 1BBUA 1C0AA 1NTGA 5ELOA 3JAMc 2JA8H 4B3RL 2UXCQ 3CCQA 2RF4A 4LF9L 3GD7A 3I4NH 1SE8A 2AKWB 4R4OA 5LMNL 4LUVA 3F8TA 3SGIA 3OW2A 2PI2A 4AIMA 2V1CC 2UXBQ 3CPWA 1BBWA 4X62L 2NVXH 4BY1H 4NXNL 1V43A 3CP0A 4KI0A 3GTJH 4P75A 2WAQE 2NN6G 5IP7G 3T1YL 1H95A 2PMZE 4PZ7A 3ULPA 1JJGA 5GQOA 2PI2E 4NXMQ 4A3KH 2AMCB 3G48A 4IPCA 3AFQA 4EX5A 4JI5Q 2B63H 1VQBA 4B3TQ 2R93H 4JI8Q 3AFPA 3L2PA 4GOPA 3GTPH 1V1QA 2K4KA 4A3MG 1Q12A 3M4PA 1VS0A 2MQHA 3NEMA 2F4VQ 3GTGH 4A3BH 4AYBE 1X3GA 1PYBA 2R92G 1Y14B 4X65L 4HJAA 5IYDG 2D62A 3FKIG 5C0XI 4DV7L 2CWAA 3ERSX 4BXXG 1I94Q 1W2BA 1XNRL 4DUZL 1CKNA 3FHWA 3RNUA 2Q2HA 3DLLA 1FJGL 1YJNA 4NXNQ 3S14H 4KLKA 2AWOA 2B29A 4X6AH 4C2MH 2N49A 3OTOQ 3NENA 2JA6H 5IY0A 1EOVA 3M9BA 4A93H 2R7ZG 5IYCH 2YU9H 3UDIA 4KHPL 1VQJA 2N78A 1VQKA 2I5HA 4QY7A 2K75A 1TWHH 2Z6KC 1MJCA 5HGQA 4HJ8A 1JJ2A 4A4IA 1QVCA 1TWFH 4IJLA 2JA5H 2ZTDA 5JJLA 1BKBA 2F3IA 1I50H 1I3QH 2JQOA 2UUCQ 1YHBA 3CCMA 2QA4A 1R9TH 3HKZE 4JV5Q 1KXLA 2JA7G 2Z6KA 4YHHL 5C3EH 3F2CA 4JYAL 1XNQL 2VZAA 3G4SA 1XNRQ 4DR7Q 1CKMA 3M3YH 4JI4L 3I4OA 1PH2A 3EIVA 2R92H 4AYBG 2JK8A 1Y1VH 2GN5A 3JC66 1KRTA 2OWOA 3GTMH 1QVFA 4DV4L 4GN5A 4JI3Q 3MXNB 1L1OC 2D0PA 1IBMQ 2IX0A 1D8LA 2K5HA 4ME3A 3PCOB 1KRSA 2AHOB 3CC4A 4R1JA 4LF4Q 3HOWG 4BY1G 1X54A 5C4JH 1VQ6A 1GD7A 3STBD 1W3SA 3E9IA 4DNIA 4DR1Q 1Q1EA 2EIFA 2CKZB 3J81j 1K73C 3DM3A 4L5SA 4R4IA 1L1OA 2OTLA 1I6HH 2I5LX 5JJKA 5JJIA 1YHAA 2LXJA 5C0XJ 4GN4B 1M1KC 4YHHQ 4BBSG 4YWKA 1PH4A 1XNQQ 1HR0W 3S2DH 3PGZA 2YTXA 4DAMA 4WJ4A 5IYBG 4Y52H 3KFUA 4MZ9A 4DV4Q 1XPOA 1YHQA 1XMQL 1D7QA 4XTCS 5IP7H 4DUYQ 1KL9A 1O7IA 3CXCA 5H1SE 4HIDA 5M3MG 4DR2L 1WI5A 4JBJA 4JBMA 3U50C 3GDEA 4DV6L 3PUVA 1N32Q 3PIPA 1YJWA 1E22A 4A3MH 2IHFA 4YY3L 1NMGA 5HY6A 3VDYA 2UUBL 1ASZA 4JI0L 2K5NA 4X64Q 2UXCL 5FLXc 4LFAQ 1VQPA 1YITA 1VQ5A 3HOZG 1E24A 5IYDH 3FKIH 2E8GA 1N33Q 3PO2G 3T1HQ 4BXXH 4JI1L 1K0RA 4OO1I 3HOXG 3I2ZA 2E2IH 1FL0A 3ULJA 2JA5G 2HT1A 4X66L 4DR5L 4GNXB 3H0GG 4APVA 4IO9A 3F2DA 4LF5L 4YWLA 2R7ZH 1YJ9A 3RN2A 5M5YH 1Q46A 1RIPA 1WYDA 2E5LQ 3CF5A 4DR3L 2R7DA 4JC0A 4DV6Q 5GAHC 5AJ3L 2RHSB 1TWCH 2I5MX 2ASBA 4UP9A 3CCEA 3S17H 1VQNA 3WWVA 1TWGH 2ZM6Q 1GM5A 2JA7H 2HHHQ 4PZ6A 4LUOA 1HZ9A 4A76A 3IRBA 4LWCA 5BR8L 4GN3B 2WB1E 3J7ZC 2KENA 3KDFA 2ZJRA 2YYZA 4DV1L 3S24A 1N36Q 4OX9Q 1FGUA 4IPDA 3I55A 3ICEA 1Z47A 1VQHA 2ZJPA 1IL2A 1CSPA 4A3FG 1XPUA 3D0FA 3HOWH 3J7A5 1HNZL 4A3GG 4LUZA 2CWPA 2XTIA 4DV0L 4DR3Q 4LFBQ 3ER0A 3J80i 1TXYA 3AEVA 4PG3A 3EN2A 1Z9FA 1EFWA 1GVPA 2PNHA 4B3ML 1FVIA 3KF8B 3EBEA 2OQKA 4BA1I 4HJ5A 3H3VH 1EIYB 5ELNA 1YI2A 5C44G 1YZ6A 4MNOA 1LYLA 2R6GA 3J81i 1VQDA 1N9WA 4BBSH 3MEFA 1B7YB 3A5UA 3PSIA 1PFSA 4B3RQ 1PVOA 4R4CA 3GTQH 1SMXA 5IYBH 1S40A 4LF9Q 3J80c 5LMNQ 1Y1WG 4OWWB 1IYJB 4LNQA 1J6QA 4MTNA 3U58A 2WB1G 3BU2A 1AE2A 4X62Q 3BZKA 3TRZA 3GO5A 3W1GA 5M3MH 3CC2A 1X9NA 3T1YQ 3CCRA 4LF8L 4B3MQ 5GADC 4BBRG 2KHJA 4IPHA 1A63A 3NELA 1SRUA 3CCVA 4HIKA 4DR6L 1PH1A 2QEXA 4YCVA 5JEAG 4QJFA 3CCLA 1HR0L 3HOZH 4JI7L 3PO3G 4K0KL 3PV0A 2ALYB 3M4OH 3PO2H 1YNXA 4GNXC 4BY7G 1RL2A 3HOXH 2BA1A 4X65Q 4H02A 1E1TA 2NZOA 1MJEA 3K80C 2E2HH 4NPSA 4DV7Q 1VQ7A 2NVTH 2NN6I 4QL5A 4POFA 1JMCA 1OTCA 3H0GH 4LF7L 2JEBI 2VY3A 4DK6C 1SR3A 4DUZQ 4GKKL 3E0EA 3RLFA 1FJGQ 3S1MH 2Y0SE 2ZTCA 3CW2C 4L5QA 1EQQA 4GNXA 2JE6I 2LSSA 1YBYA 4LF8Q 4B3SL 2CCZA 4JBWA 1QUQB 4KHPQ 4JBKA 2K14A 3CCJA 1PH8A 3KF6B 1QVGA 2E2JH 3K0XA 4JI7Q 1JT8A 3RLOA 1CKOA 1JJCB 1OXTA 4NB3A 1N34L 3STBC 5GAGC 3CMEA 3K81C 1HNXL 5M3FG 4HJ7A 3FP9A 3E9HA 2Z0SA 5IWAL 4EQ5A 1A8VA 1Q1BA 1SN8A 4JYAQ 2H5XA 4UP8A 1VQGA 5GROA 3UDFA 1IBKL 4JI4Q 4GKKQ 1CUKA 1QZHA 4A3FH 3CCUA 4POGA 4GKJL 4A3GH 2IY5B 3W1BA 3S15H 1SROA 2K52A 4OO1G 1NE3A 1VQMA 1Q8KA 2A19A 1VQCA 1SLJA 5LMUL 2Y0SG 2CQOA 2PQAB 3I7FA 4A3IG 1EWIA 2EQSA 2B3GA 2ID0A 4OONA 1UEBA 2LXKA 4UP7A 1UWVA 4PZ8A 5FLMG 5C44H 4A3CG 4A3JG 4A3LG 1A62A 4IOAA 4DR4L 5GAEC 1LTLA 1JE5A 4JI2L 1XTDA 1X56A 2MO0A 3HOVG 1Y1WH 1GO3E 1HZBA 2OCEA 4DV2L 4AQYL 1PA6A 4OXPA 3A0JA 4QGUA 1U5KA 3TREA 1XMQQ 1IBLL 5IT9c 3M4QA 1C7YA 1YEZA 1AH9A 4JCVE 3ULLA 2Q2TA 3RZOH 4BA2I 1UE6A 2D0OA 2NZHA 1UE7A 2YTVA 5DLQE 4BBRH 4A75A 2Q2UA 5C4XG 4DR2Q 5M5WH 3I4MG 1VQIA 2VS1A 1SFOH 1J5EL 4OWTB 4FDBA 4DAYB 4ALPA 2NVQH 4DV3L 3PO3H 4LF6L 2UUAL 1VQ4A 4YY3Q 4LFCL 4DR4Q 2UUBQ 4JI6L 4JI0Q 4TQUS 5K36G 4BY7H 1S72A 3KLWA 1PYSB 1A0IA 3CC7A 4DV2Q 4C3HH 4AQYQ 4P72A 3HOUG 5IP9G 4JI1Q 2KCTA 2Q2IA 2FXQA
chains in the Genus database with same CATH superfamily
1KC8C 2F3VA 1BUVT 1AFPA 4X66Q 5JAVA 5EBCA 3SXHA 4DK0A 1VQOA 3PIP3 1TWFB 1CTMA 4C3IH 1J9OA 4QQBX 1IXRA 2B8GA 4N9TA 1I50B 1O78A 3CD6A 1LT3D 5AJ3Q 1HTPA 3C46A 4NXML 3K5MA 2KCNA 3KF6A 3GTMB 2F4IA 3TDQA 4CKEA 1HJPA 1PH6A 1GUOA 3MFGA 1HH2P 3NBHB 4JW0A 5BR8Q 2XNAC 2F0KA 1S5BD 1VQEA 1DXMA 1GUSA 4IQZA 4ILWA 4OO1H 3KYHC 1PH5A 1HNZQ 4GOPC 5M9OA 3BDLA 1EYGA 1X6OA 3PF5A 3U4ZA 1MSGA 1BOSA 2L4NA 3LNNA 1FNVA 1K8GA 5IGCA 2BCOA 2AQ1B 1K83H 1K9MC 5EAYA 5FLXL 4R4QA 1WCMG 5A2QE 1T5XD 1F9RA 1DCZA 4YCUA 4CGYB 2A5HA 2WFWA 2UXDL 2PO4A 3HOYG 2MFIA 5CV7A 5CV5A 3I4MH 5FO8B 3KUPA 1H9MA 1NMFA 1LTSD 1B53A 4LF4L 4ZKCB 1K8MA 2HIVA 2XIWA 2WAQG 2VQEQ 3GTKH 4QF4A 3W2DA 4DR6Q 1ZXTA 4P73A 3I8ZA 1LTTD 2HCCA 1EZ8A 3VR6A 1KNEA 2Z9HA 1Y69U 3BJUA 2JA8G 3VYRA 3MXGA 1I4PA 2B2UC 1B3QA 4MIUA 4OEMB 4DUYL 2QGQA 1VQAA 3ZYYX 2PW5A 4O42A 1HUMA 2EYPA 5FK9C 2VQFL 1G51A 4GLVB 4A3KG 3KF8A 2LKVA 1UE5A 2B63G 1N34Q 1SYCA 4HCSA 2EXDA 3A74A 1YVCA 5IWAQ 3DUZA 1NBWA 4DKAC 1XMOQ 2X6LA 2F0EA 3S1QH 4UAIA 1IBKQ 1DGSA 1LTGD 3HKZG 2NUCA 4CDEC 1EIHA 2MO1A 5ELDA 4Q5VA 5DAUA 2RA4A 4IFDG 3IFTA 3TS2A 5LMUQ 3K7AH 3L0OA 2E5LL 3J81L 2JA6G 3CAMA 3S1RH 2XWBB 5LL6X 3VA7A 2DUDA 2C5CA 5JVH3 2RDGA 4JI2Q 1WCMH 3DM1A 2F52A 4ME5A 2HHHL 2G9DA 1GJXA 1AE3A 1YIJA 2VW9A 3OHXC 4IPGA 3A5ZB 5C3EG 4TKOB 3K57A 4J6HA 3HOYH 3TEHB 4P74A 1DM0B 2FHTA 3B6YA 2A1AA 4IUTA 1A3UA 4KN7C 3HOXB 2NVTB 4DA2A 5I9PA 2PPBC 4DXGA 2RSOA 2WP8J 3BG3A 2UUAQ 4LFCQ 3S1MB 4UY8C 1TQOA 3RLNA 1GUGA 5ELOA 1LTAD 2WIIB 2JA8H 3NBIA 4B3RL 4KD4A 1HTLD 1B1ZA 5JPNC 1NR4A 1CQFA 3RD4A 1U4RA 4P2CB 1LLRD 3F8TA 2E2JB 2PI2A 2M9VA 2A73B 3HRZC 4X62L 2NVXH 4BY1H 1V43A 2NN6G 4L8JA 4DU9A 1JWSD 1EL0A 3ERQA 4A3KH 2N88A 5FO7B 4IPCA 4JI5Q 3AFQA 2B63H 1VQBA 4H0LC 3L2PA 4G7OC 1STGA 1TU2B 3EA6A 4A3MG 1Q12A 1VS0A 3NQTA 2ZXRA 1CA5A 4HJAA 4LMQD 3M4YA 2CWAA 1X3PA 3OIQA 4DUZL 1H9KA 2RDHA 3DLLA 4IFDH 1YJNA 5IT9L 4PMBA 4NXNQ 3S14H 2AWOA 4X6AH 4C2MH 2L5TA 3NENA 2JA6H 1Y1WB 1VQJA 4MN3A 1TWHH 4HAEA 5HGQA 1EY9A 5DM63 4IJLA 1BKBA 1MGSA 1DONA 4HEDA 1R9TH 3D4RA 1KXLA 2JA7G 2K03A 3DEOA 5C3EH 4YHHL 3F2CA 1XNQL 3G4SA 1CKMA 3M3YH 3I73A 2JK8A 3HS0C 1QVFA 1ESRA 4GN5A 4JI3Q 3NPPA 5AFWA 3MXNB 2B2YA 1IBMQ 2B2WC 1D8LA 4ME3A 3HOWG 3PCOB 3BVGA 2AHOB 3MAQA 1X54A 5C4JH 1VQ6A 4DNIA 1F9SA 1H9SA 4DR1Q 3D4DA 5KIXA 3J81j 2CKZB 5D3DA 4CDCC 3LWEA 4C3IB 2OTLA 5JJIA 3DXJC 2IW3A 3IFDA 4K2LA 3KLRA 4RCNA 2E76C 5C4ZA 2F0PA 3S16B 1PH4A 4JK1C 1HR0W 4WJ4A 1TS3A 5D3IB 1IL8A 4KKUA 3I70A 1XMQL 2CH4A 1IKLA 2NN6H 2EPBA 3W3AA 1HUNA 4G4KA 4NW2A 4DR2L 1WI5A 3Q0AA 4JBMA 1RTOA 3PUVA 4IN3A 1YJWA 4A3MH 2IHFA 3J7YW 5CV9A 4H13C 1BNZA 2K5NA 5G3LD 5FLXc 1VQ5A 3HOZG 4H44C 3SK4A 1E24A 3LWUA 2E8GA 3PO2G 4JI1L 3N6RA 2HDMA 2HT1A 5CV6A 4X66L 4GNXB 4QIWB 1K83B 4YWLA 3RN2A 5M5YH 4FXGC 4N8FA 2R7DA 4JC0A 2F3WA 4DV6Q 1PRTD 5EQ0A 5AJ3L 2OEOA 4UP9A 2K33A 1RTNA 2JYOA 3S17H 1QCBD 4K5VA 4FVMA 4K8JA 2JA7H 4PZ6A 3I4MB 1HZ9A 5EBDA 3IRBA 5BR8L 1A15A 3J7ZC 2KENA 3KDFA 2YYZA 3GTKB 2SDFA 3QB3A 4IPDA 1Z47A 1IL2A 4NKLA 4QUFA 3HOWH 1HNZL 3J7A5 5KNBA 4LUZA 4LFBQ 4DR3Q 4PG3A 2B2TC 4B3ML 3H3VH 4HJ5A 1DOLA 1PTOF 2R3ZA 4V0BA 2RQXA 1LYLA 1VQDA 1PFSA 2BDOA 3GTQH 5ELEA 1S40A 4FXDA 5J39A 4HCEA 5LMNQ 2WACA 2AQ2B 4X3SA 1AE2A 1O7LA 2OF1A 3BZKA 1JOOA 3UI2A 4IUVA 1TIID 3S1QB 1K0SA 1CZGA 3SK8A 2KHJA 4IPHA 1A63A 4DR6L 3NE5B 1PH1A 2CH4W 3HOZH 4JI7L 3PO3G 3SK5A 3PO2H 1YNXA 4GNXC 4BY7G 3K7AB 5BN4A 1RDPD 2E2HH 4NPSA 3DMUA 1VQ7A 1JQYD 4QL5A 1JMCA 5E1FA 1SR3A 3S1RB 1BCPD 1FJGQ 4N8X1 2MUYA 2Y0SE 3HP3A 4RWSC 2JE6I 4LF8Q 1WCMB 5J22A 2KA7A 1BF4A 1STNA 1FNWA 1SYDA 4OELB 3HOYB 1JJCB 4NB3A 1N34L 5M3FG 1EWCA 2F0LA 3E9HA 4IZ8A 5IWAL 1A8VA 2WAQB 1I6VC 1SN8A 4JYAQ 2NYZD 1DYQA 2H5XA 1IBKL 4POGA 3W1BA 5KRUA 3S15H 2K52A 1VQCA 2JA8B 5LMUL 2Y0SG 5ELBA 3MXUA 4A3IG 3QG1A 2B3GA 2F0DA 2ID0A 4ZYSA 1PYWD 5I2XA 3Q23A 2M2LA 2D9UA 4A3CG 4A3JG 5IGEA 4IOAA 3VR2A 3QOJA 5GAEC 2ZXPA 1ZYRD 2NVXB 1LTLA 4JI2L 4BY1B 1XTDA 3HOVG 3OOCA 1GO3E 1KDBA 3HGBA 2F1MA 3D3RA 4A3KB 2B63B 3TREA 2PW7A 5IT9c 1A2UA 1C7YA 1WTVA 3RZOH 4BA2I 4RKLA 1UE7A 5EJWA 5DLQE 5M5WH 1LT5D 3HKZB 4OWTB 3V96A 4FDBA 3PO3H 2UUAL 2B2VC 4LFCL 4YY3Q 5K36G 1BCPB 4TQUS 1PRTC 3S14B 5M3MB 4BY7H 4C2MB 4KV6A 3CC7A 2JA6B 2J0TD 4GLAC 1GOZA 5E7NA 1AEXA 1TWHB 2L0CA 4DR5Q 1PZKD 3V2TA 1E7ZA 2BH8A 1OXSC 4YWMA 3M85A 5C0XG 1R9TB 2BA0A 1O7YA 5C3EB 3IAYA 1QUQA 4K5WA 2D2CC 3M3YB 1WFQA 4JI5L 3TQYA 3UDXA 3CQZH 1ET6A 3G6EA 5M3FH 5HGTA 1B70B 3KOJA 1TY0A 3MWYW 3T4AC 2JEAI 1EU4A 2EYMA 2NVYH 3BZCA 4DNTB 3N52A 5FJ8G 1WTPA 5C4JB 2BE5D 4DV1Q 2UU9L 1U0LA 3ND9A 3CMAA 4XDXA 1WJJA 2N8NA 1VQ8A 3OIPA 1X65A 3S2DH 3G6JB 4DV0Q 4A3IH 1STYA 2K5VA 3S1NH 4EGVA 2PQAA 1QWYA 4A3CH 4A3JH 4ID6A 2XSCA 3GV3A 4K5XA 3HOVH 3R2IA 1LT4D 1QZGA 4MTKA 1RD9D 3AU7A 1PZJD 3AYHB 1G291 1BQQT 1LTID 1HNWQ 4A3MB 4KJNA 5I4DA 4WJ3M 3GV6A 2F0HA 4JI3L 2PNRC 1HQMC 1IBML 4K8IA 1BCPC 4RAUC 5K36H 4DR1L 4DAYA 3X3NA 4QIWE 1EYAA 1PV4A 2IHEA 3G7LA 1I4HA 4X3KA 5IE8A 5M5XH 4RG1A 1IW7D 1TKWB 4LF7Q 4OWXB 1LUZA 4ABNA 2A8VA 3I4NG 2AUKA 1B2TA 3S17B 3DWQA 3A54A 5C0XH 2BOSA 4B3SQ 2JA7B 3L7ZC 3U4VA 3I56A 4O2DA 2B2UA 3DHQA 4OIJA 1ILPA 2EYOA 3PIOA 4GOPB 1DZ1A 1QILA 1T5EA 3FEWX 4UDUC 4DPGA 5FJ8H 3HOWB 5J3BA 1CT1D 2PYKA 1P8LA 1LO5D 1TWAH 4M1UB 4DV5Q 1KQSA 3KLSA 4A3BG 4ODGA 1ZYRC 2VXWA 1AN8A 1CKNB 2OT2A 1A3VA 4QB4A 1XWEA 2LS01 4Q0FA 2QKIC 4GS3A 3GTQB 2YTYA 4A93G 3AQQA 2DGYA 4HMJA 5COYA 4HIOA 1XX8A 3PUYA 1MIUA 3CRLC 2IX3A 1BR9A 3VYUA 1EIFA 1ZEQX 3HOZB 2R92G 1EQRA 3JAMi 1Y1VG 2N55A 2YV5A 3F2BA 4H7BA 4HJ9A 1OXUA 3PO2B 4LFBL 2ENBA 3S16H 1QNUA 2E2HB 4GLXA 2A6HD 2O5IC 4DV3Q 1WTXA 1HZCA 1KDAA 4IJHA 3L3OC 5EKIA 5FLXE 3R8BA 3CCQA 3NP8A 3I4NH 1HXYD 5LMNL 1KABA 4LUVA 3SGIA 4XXEA 2Z4IA 2V1CC 2UXBQ 2O4XA 2FMCA 3NK9A 1TR5A 2BE5C 2A68D 1MHWC 4NP5A 1K8OA 4G7ZC 2WAQE 1JJGA 5GQOA 3VYTA 1F9QA 4EX5A 2A6ED 1RCVD 2MJ8A 4JI8Q 3S15B 5E4XA 3H3VC 1VMPA 3U9SA 4A3BH 4AYBE 4G7HC 2CQAA 1PYBA 1Y14B 2WV6D 3DEPA 2D62A 1I94Q 1LTBD 1EIGA 3FHWA 1FJGL 2KEDA 3MTSA 1WD1A 2EDGA 4CKBA 1ENCA 3M9BA 1SYFA 4C1NK 2R7ZG 4A93H 1VQKA 2Z6KC 1MJCA 5L37A 3NQIA 1JJ2A 1WTOA 1QVCA 1U4PA 2Q8RE 1IHZA 1STBA 1I3QH 3RZOB 2UUCQ 1YHBA 4JV5Q 3HKZE 4QUCA 5M5WB 4JYAL 3I90A 4RGOS 2VZAA 1XNRQ 2R92H 4AYBG 4XQJA 1Y1VH 3PO3B 1IW7C 3JC66 3FMCA 3OWEB 4DV4L 4BY7B 1SSOA 4RHSA 3CC4A 3NHHA 1STEA 4BY1G 3J81E 4HSVA 1GD7A 2QEJC 3E9IA 3STBD 1M4VA 1K73C 4R4IA 2B2WA 2I5LX 2Z6BA 5FKAC 1I6HH 4PMCA 2LXJA 5C0XJ 4BBSG 5IODA 2F0GA 2YTXA 2G9HD 1LT6D 3KFUA 3K5NA 4R9WA 3CQZB 4OHJA 5M3FB 4ZLTF 3OMGA 1KL9A 3PQIA 1O7IA 3CXCA 4J1MA 5H1SE 2NVYB 5M3MG 5CV4A 3TP5A 5I9OA 3PIPA 2F0IA 1SE4A 1G2TA 4YY3L 1NMGA 5HY6A 1ASZA 2J4XA 3S2DB 4X64Q 1YITA 3OPOA 2Y0SB 4A3IB 4FNFA 3T1HQ 3S1NB 3KBXA 3C3LA 2E2IH 2JA5G 2F0OA 4A3JB 5CYUA 2X6GA 4B9XA 4DR5L 4IO9A 3F2DA 3HOVB 2R7ZH 1JB3A 1Q46A 1WYDA 1TS5A 2RHSB 1G2SA 1DOMA 1G91A 1B3AA 1RODA 3CRKC 2A6HC 1GM5A 5JVG3 5C3WA 4LWCA 2WB1E 1ENAA 4DV1L 1N36Q 3ICEA 1VQHA 1XPUA 2ZXOA 5IT9E 4OGQC 4DV0L 5M5XB 1AZPA 4ZQ3A 3J80i 1IYVA 2EXZA 3EN2A 2F0WA 2PNHA 2EZVA 2A68C 3KF8B 3TZUA 3HG9A 5C44G 1YZ6A 2ICEC 4MNOA 4BBSH 3MEFA 5D14A 3M7GA 2A6EC 1SMXA 1CA6A 2NZ1D 1JE4A 3J7AF 4FF2A 2KVMA 1IYJB 2IL8A 1BDOA 2WB1G 5EPLA 3TRZA 3GO5A 5M3MH 3T1YQ 2OXPA 5LL6S 1TWAB 5FO9B 2JN4A 3K5OA 4HIKA 3CCVA 1SYEA 4YCVA 4HR7B 4WFN3 3M4OH 1UAPA 2X69A 4X65Q 2JA5H 4H02A 3K80C 4C3HG 4DV7Q 2NN6I 4POFA 4LF7L 1RJTA 4DK6C 2H4OA 4GKKL 3RLFA 2ZTCA 2DNCA 4GNXA 1E2VA 3WOFA 4B3SL 3FKIB 3TMEA 5IGDA 3I4LA 2F0QA 3CCJA 1PH8A 3A8KE 1JT8A 3RLOA 4G57A 3STBC 5GAGC 3CMEA 3FP9A 2Z0SA 5T1GA 3JAML 3P20A 2PMZB 5CC4A 4JI4Q 5G3LF 1CUKA 1VMCA 1EU3A 4DFAA 2IY5B 2KEEA 4CBVA 1SNPA 1SROA 1UEAB 4L6TB 1NE3A 3Q6SA 1Q8KA 2A19A 1QOHA 1SLJA 4CJ0B 1HFGA 3I7FA 3I4NB 1SJED 4OONA 1UEBA 2LXKA 2IPKD 3P75A 5C44H 4FYDA 4RH6A 1DJRD 4DR4L 2XRQD 1X56A 2MO0A 4AQYL 1QG7A 4OXPA 1TS2A 4QGUA 5J1ZA 1JOQA 2EYLA 4S3SA 4ZKBB 2NZHA 2YTVA 4A3BB 2I46A 1Z6HA 1EY0A 4XYQA 3C1EA 4CDDC 1EYDA 4DV3L 4XQQA 2UUBQ 4JI0Q 4M8AA 1NUCA 4C3HH 4DV2Q 2L12A 4A93B 1YNJD 5IP9G 2Q2IA 4GN3B 1Q82C 1F2LA 2B2VA 2R7FA 2ES2A 4BS9A 2ATWA 1LM0A 4LW1A 2AWNA 1F2ZA 3Q24A 2UXBL 4KHZA 4JVZA 1D5XC 1I3QB 3LGJA 5CBAE 3RR5A 3G71A 1R4PB 4XIGS 1L2FA 1J5EQ 1H9SB 4B9WA 2IX1A 1EFID 3K8AA 5KGUA 1GKHA 2R92B 1KLUD 1Y1VB 2HQLA 3SR1A 1CI3M 1GUTA 1MI2A 1SAPA 4JI8L 5LHY1 2C35B 2EY2A 4RA8A 2NTSA 1SE3A 1C8CA 1I94L 3H09A 1I6HB 3PUWA 4A3EH 3BDOA 5ELCA 1K8AC 3J81c 1S5CD 4IOCA 1L0XB 2LY7A 4L5RC 1B8AA 3T51B 3PUZA 4TVAB 2ZJQA 3K7UC 1Y8OB 2HUGA 3GQBA 5IOCA 2VQEL 1EOTA 1WTRA 2I0QA 4E6IA 4XT1B 1LTRD 4IFDJ 2UUCL 4JV5L 2MNAA 1MKHA 1LV9A 2DY7A 4R4TA 3A56A 1PRTB 1ASYA 2TSSA 1M90C 1K3RA 1SEBD 2MPMA 4WJWA 1PMRA 1PTOD 5LMNW 1S3OA 1PH7A 2EJMA 1SNQA 1PDQA 3UE1A 3TP7A 2E2IB 5C5LA 3T53B 1O80A 3UE0A 4AH6A 4ZK9B 4K0KQ 4WRDA 2R7ZB 5IP9H 1Q86C 3KDFB 3ZJYC 4ZUIA 2KBNA 4Z9CB 1Q81C 1XMOL 2K50A 4BWGB 5JOBA 1WD0A 1V1PB 1GUWA 3CPFA 2UXDQ 2DNEA 3SDZA 4KKSA 1OXVA 5CMDA 3NWSA 3UDGA 3NTKA 1A6XA 3RN5A 3OYYA 5BN3A 3URYA 2XWJB 4AYBB 1X3FA 4IUQA 2KJXA 3GTOH 1Y8PB 2RHQB 1HNXQ 1EQVA 4X64L 1MBYA 1ICWA 3MZ5A 1Y8NB 1YNND 5KNCA 3T1HL 3M7NA 1W6JA 4GKJQ 3J80L 1ONLA 5A35A 1XPRA 1NJIC 4PQXA 1D5MC 4X3TA 4BBSB 2OTJA 2K01A 4HN7A 3A8IE 1E2ZA 3HFZB 3TSSA 2VQFQ 4DXFA 5IYCG 2XGTA 3OW7A 3SEBA 1SXTA 1QNKA 2EJGC 4YCWA 1EY4A 1KIXA 1BVSA 5I6YA 1CSQA 4JOIC 1N36L 1WVLA 4CJ1B 1YNJC 3PIO3 1HRJA 3VA5A 4PMWA 1PLFA 3M4OB 1Q8IA 1C9OA 2RCNA 1BO0A 4K6LA 3NTHA 4O0AA 2JA5B 3WDNA 2P5ZX 4J15A 3NTIA 1L1OB 5C4HA 2HIXA 4JI6Q 1V8QA 1C0AA 4KY5A 5IGGA 1HPCA 2A74C 3JAMc 4F88A 2MGSA 2RF4A 4F8MA 3GD7A 3BVZA 1SE8A 1DOKA 1SNCA 1C4QA 5C3XA 4RGMA 4ZUJA 3CPWA 1BBWA 1HHVA 2L11A 4NXNL 4P75A 3VR3A 1LABA 5IP7G 1X3QA 3T1YL 1H95A 2PMZE 2PI2E 2AMCB 4ZRZA 2O2LD 4B3TQ 1RHPA 4GOPA 3GTPH 1WTWA 2K4KA 2MQHA 2F4VQ 1I4QA 3I72A 3SHLA 4X65L 5IYDG 1D6EC 2F0FA 3FKIG 3FRPB 5C0XI 3ERSX 4DV7L 4BXXG 5C44B 2KUMA 1CKNA 2K05A 3RNUA 2Q2HA 5K5PA 4XYOA 3OTOQ 4KJOA 5IYCH 2SEBD 3UDIA 3OMCA 2I5HA 4QY7A 1PTOC 2K75A 2WB1B 3CU7A 4HJ8A 1J8IA 1EQTA 4A4IA 1AW7A 1NCVA 2F3IA 3F2UA 2Z6KA 3SE0A 1F77A 4DR7Q 3H94A 2BDNA 4JI4L 1PH2A 3EIVA 2GN5A 2OWOA 3EQLC 3C2PA 1L1OC 2VB2X 2IX0A 2PZUA 1TY2A 2K5HA 4C3HB 1KRSA 2LFNA 4ZCKA 1QB5D 2CW0D 4NMZA 2KQ3A 1W3SA 1Q1EA 2EIFA 3T16A 1D2BA 3P7JA 3DM3A 4L5SA 4CKCA 2K5QA 1YHAA 1SE2A 4GN4B 4YHHQ 2EVBA 2G5DA 4RCOA 1XNQQ 3R3OA 3NBHA 1V1OA 2K04A 2B39A 4FF4A 4Y52H 4MZ9A 4XT3B 2VB3X 1W6KA 1XPOA 1YHQA 1AP0A 1YNNC 4XTCS 5C6AA 5IP7H 1ET9A 3RUZA 3I3CA 1R4QB 4JBJA 1EY6A 2DJFC 4DV6L 1N32Q 3A8JE 4QCLA 1IKMA 3WOEA 3NUCA 3VDYA 2UUBL 4JI0L 1M8AA 2UXCL 4LFAQ 4A3EB 1VQPA 3TZDA 1GHJA 5IYDH 3FKIH 1N33Q 4BXXH 3QOLA 1O7ZA 1X32A 4OO1I 3J7AV 1FL0A 3H6MA 2EYJA 1I4RA 1KLGD 2M00A 2RCFA 3H0GG 3MXPA 3OWFA 4APVA 5CGKA 1PZID 1Q90A 3T13A 2MHVA 1I4GA 1SNOA 3BDCA 3CF5A 4DR3L 1TWCH 2ASBA 3CCEA 2EY5A 1VQNA 3WWVA 1TWGH 1ZKOA 2ZM6Q 1MSHA 4LAAA 1KTKA 4A76A 1RKNA 2ZJRA 4OX9Q 1FGUA 2Z8LA 3I55A 2F0JA 2ZJPA 5C5MA 4A3FG 4A3GG 2CWPA 2XTIA 1IYUA 1TXYA 2NWGA 1Z9FA 3QWNA 1FVIA 2OQKA 2SNSA 1EIYB 4I7AA 1N9WA 3A5UA 3ONAB 1PVOA 3Q22A 4LF9Q 3AB9A 3J80c 2RSNA 4IUPA 4B08A 4OWWB 1J6QA 2B8FA 2RBMA 3SK6A 3GTOB 4MTNA 4OIKA 2WKCA 2KHSA 3R2TA 3TP8A 3OSOA 2JXMB 4LF8L 4EQNA 1VDZA 1BBXC 4B3MQ 5GADC 4BBRG 1SRUA 3ND8A 2QEXA 5JEAG 4K0KL 3T56B 1LACA 1U4LA 2DJGC 1NNXA 3LX0A 1RL2A 1TS4A 5DEHA 4U673 1B50A 3L9AX 1MJEA 2NZOA 2K7VA 1JOKA 4IALA 1GXDC 3H0GH 5EPKA 2JEBI 2VY3A 3E0EA 1TT2A 4K6DA 4L5QA 1EQQA 1YBYA 1EYCA 1F9PA 4KHPQ 4JBKA 2K14A 5T1IA 1G8ZD 3KF6B 1CM9A 2MP1A 1S5DD 4JI7Q 2CW0C 1OXTA 5EPJA 1HNXL 4HJ7A 3H91A 2AUJD 2R61A 4WORA 4EQ5A 5A2QL 3TP6A 5KNDA 4KMUC 4GKJL 4DAPA 3CCUA 4A3FH 1XYIA 3A7AB 4A3GH 4YIJA 1F2MA 2FFKB 2A69D 1VQMA 3NXWA 1B44D 4HMIA 4UP7A 5FLMG 1BXTA 4R8IA 4A3LG 2K28A 3EROA 3ITPA 3AMUA 3K6OA 1JE5A 1STHA 1CHQD 1CK1A 3A0JA 3HZXA 3GTPB 2AQ3B 2Z1CA 1YEZA 3HEJA 3QO2A 4JCVE 3ULLA 4C3JG 3TBIB 2Q2TA 2D0OA 5C4XG 1UUPA 4A75A 4BBRH 1VQIA 1DD2A 1SFOH 5JEAH 2V4DA 4ALPA 2F0SA 2F0NA 3U9OA 2NVQH 1VQ4A 4L63B 4JI6L 5F2DA 3KLWA 1PYSB 2WKDA 1A0IA 3VR4A 3HOUG 2CCZA 2FXQA 1B9MA 4V190 4IFDI 1K28A 1T9HA 2KCMA 3MEHA 2K1BA 4NDXA 1PH9A 2N3SA 4LF5Q 1JCKB 4GZYC 1S5FD 4Y7NH 2EOTA 4I7ZC 3MXNA 1HFNA 2IT1A 4DGZA 2PZWA 2ZTEA 3H15A 2Z4HA 1HA6A 2EE1A 1D5ZC 1JWUD 2I07B 4B3TL 1VCIA 4R8NA 3KK7A 4F7XA 1HA5A 4KK7A 2CFMA 2VNUD 4RMFA 2F4VL 1SMYD 2B2TA 1X3EA 1AZQA 4IUNA 2KHIA 1IZ6A 2L15A 2XVSA 3GTLH 5JJZA 4F87A 1KHIA 5IGFA 1HNWL 2OQ0A 1Z7TA 3KJPA 2VL6A 3OTOL 3NSWA 1CQVA 1PTOH 1I4XA 3DWPA 5FLMH 5CORA 2GVAA 3TS0A 2VUMG 2HQEA 2ICIA 4A3LH 1CZWA 4IURA 3F1ZA 1VF5C 3D31A 4TSSA 5ELFA 3PUXA 3K0YA 4A3DG 3JAME 2L1BA 4DAVA 2UU9Q 3S2HH 2K5DA 4DR7L 1Q7YC 1MD2D 4HIMA 3NWTA 4C3JH 1EUJA 1OXXK 4PV1C 1NY4A 5C4XH 2CVRA 1FYCA 5E3FA 3CCSA 1N8RC 2EYHA 1VQFA 3K5LA 1KD1C 1GHKA 4KTAA 1FNUA 1VQLA 5BN5A 1L0YB 1SJHD 2F0UA 2F0VA 4DK1A 5FOBB 1HR0Q 3PMFA 3DWAA 2E74C 4KY6A 3EJIA 3HOUH 1V9PA 4L5TA 4I65A 1H9RA 4CJ2C 1PHJA 5TSSA 4DV5L 1TWCB 3BS1A 3D8GA 1E3PA 1KAWA 2BH2A 2EJFC 1HZAA 2L55A 1TWGB 1X55A 1KDCA 4FF1A 2QDLA 1NSNS 1EWHA 2CHBD 4JG2A 1P16A 3PF4A 2C9OA 4A3EG 1CHPD 3MVVA 2KCCA 1F2YA 4J8QA 1N32L 2A69C 1S4ZA 1SNDA 4PNYA 3Q8DA 2R93G 4RKBA 3KBGA 1PRTF 4LFAL 3D4WA 4OL7A 3BVMA 1N33L 2IJ0A 1WOCA 3C1FA 1EZ6A 1L0WA 4CDFC 4QMGA 1SDFA 1NR2A 3I91A 3HKSA 2JA9A 1EY5A 3H3VI 2VUMH 3K58A 4KN4C 1E1OA 2RKSA 3A7LA 1EY7A 4UPAA 4XQNA 3QR8A 2HCIA 1E2WA 4P71A 2JJQA 3RMHA 1I5FA 2GVBA 4A3DH 2ZM6L 3W5OA 3GP7A 1JB7A 4TRDA 1UNSA 4FXKC 2H1EA 3KJOA 1G6PA 3MC0B 4OX9L 3QJYA 1IBLQ 5JEAJ 4ZAIA 2EY6A 1VQ9A 1PH3A 1RF2D 4HTHA 5IIFA 1XJVA 4DK3C 1E0BA 4JOIA 1PFNA 2PZTA 3H0GB 1KAAA 1ICFB 2HDLA 5I2YA 3RZDH 4EQPA 4LF6Q 1UE1A 4DF7A 1BBUA 3D6CA 1NTGA 2UXCQ 4LF9L 2AKWB 2SOBA 4R4OA 4MHEA 2K6AA 1HQRD 3OW2A 4AIMA 1V1PA 1SMYC 2DN8A 3CP0A 4KI0A 3GTJH 1D1KA 2FJ2A 4PZ7A 3ULPA 1WTHA 4NXMQ 2O5JC 1BCPF 1TVXA 2EY1A 3G48A 4A3FB 2R93H 3AFPA 4A3GB 3S9WA 2KECA 1V1QA 3M4PA 4O1NA 3K59A 4FP5D 5IGBA 3NEMA 3GTGH 1II3A 1G6ZA 1X3GA 4K2KA 5DM73 3IKJA 1W2BA 4LJZC 1XNRL 1QE6A 5CR3A 4KLKA 2B29A 2DY8A 2N49A 5IY0A 1EOVA 2YU9H 5ISRA 4KHPL 2N78A 1SYGA 2L9HA 3E5SA 5EKLA 1TWFH 2ZTDA 5JJLA 1PXUA 2JSOA 1I50H 2JQOA 2QA4A 3CCMA 2HD3A 4BBRB 1FD7D 2B2YC 3E3XA 1SFOB 3I4OA 3IL8A 4EVOA 3J80E 2NVQB 3GTMH 2PQEA 2D5DA 3BZDB 1KRTA 4RGTA 3BYYB 2D0PA 3QIAA 4LF4Q 4R1JA 4UHVA 5HURA 2GA4B 1PFMA 2LMCB 1L1OA 4KKTA 4EQOA 1ML0D 1FR3A 2RVLA 1B4OA 3FPPA 4X3UA 1ILQA 4Y7NB 1M1KC 4YWKA 4JPBW 3PGZA 4DAMA 5IYBG 4DV4Q 1D7QA 4FO2A 4DUYQ 2IWHA 4HIDA 2K5WA 1C48A 3CKIB 4LK1C 3U50C 3GDEA 5D65A 1E22A 3GTLB 3FPUB 1A3TA 1JICA 1EEFD 3R93A 1CFMA 4K14A 1PTOB 4KD3A 1K0RA 1SYBA 3HOXG 3I2ZA 3ULJA 3KLSX 4RFBA 2Q8TA 3E0JA 4LF5L 1YJ9A 5EKKA 1RIPA 2E5LQ 2QILA 1GUNA 5GAHC 1PFBA 2KOLA 2EYFA 2I5MX 3S2HB 4C3JB 1Q3LA 2NTTA 5C4XB 2HHHQ 4LUOA 1WTQA 4KHVA 5NUCA 4KY7A 2PCFB 3S24A 2JP1A 1CSPA 2QDBA 5E4WC 3D0FA 3BYTB 3HOUB 2QCPX 3ER0A 3E6ZX 1VF7A 2XRSD 3AEVA 1EFWA 1GVPA 3FVQA 1U4MA 1FGBD 4BA1I 3EBEA 3X3MA 3P1HA 5ELNA 1EY8A 1YI2A 2XN9C 5I6WA 2R6GA 1JR0D 3J81i 1D1IA 1B7YB 3PSIA 4B3RQ 4R4CA 5IYBH 1KNAA 1Y1WG 4LNQA 3U58A 3BU2A 4CHTB 4X62Q 2TMPA 3CC2A 3W1GA 1X9NA 3CCRA 4C1NI 1SNMA 2QF7A 2Q8IB 1NAPA 4C56C 2ZT9C 3NELA 5EGTA 5CBEE 3O13A 2QW7A 3CCLA 4QJFA 1HR0L 3PV0A 2ALYB 5KYLA 2NBFA 1U9RA 2VUMB 3HOXH 2BA1A 2NVTH 1E1TA 5JJKA 1ENFA 1OTCA 1HCZA 2NB0A 5KYIA 4DUZQ 4IUUA 3S1MH 3CW2C 3TN2A 2F0MA 2LSSA 1A2TA 4DN4M 4A3DB 4C3IG 1B9NA 2F0TA 4JBWA 4RGNA 1QUQB 4HSPA 1JC7A 2FMMA 3EFXD 3MHBA 5KEEA 4RHRA 4N9PA 1QVGA 2E2JH 3K0XA 1CKOA 5M5YB 3K81C 1XXGA 2RDFA 3MFYA 1Q1BA 3VR5A 4UP8A 5GROA 1VQGA 3UDFA 4GKKQ 4U68A 1QZHA 3RZDB 1STAA 3VYSA 4OO1G 3EVQA 5JPMC 2J7ZA 1SBBB 2CQOA 2PQAB 1EWIA 2EQSA 1UWVA 4PZ8A 4DNRB 2K32A 1A62A 2E75C 3MA2B 3GTJB 4ULLA 1Y1WH 1PA6A 1HZBA 2OCEA 3SVMA 4DV2L 3FDTA 1U5KA 1K3BC 1S5ED 2E2DC 1QJOA 1XMQQ 1IBLL 2R93B 3M4QA 1H9JA 1AH9A 1ESFA 2WINB 3V05A 3CHBD 1UE6A 5CV8A 3GTGB 2Q2UA 4DR2Q 3I4MG 2FINB 2VS1A 5DNFA 1J5EL 4FF3A 4DAYB 2SNMA 3A55A 4LF6L 4DR4Q 1JWMD 3D6WA 1OO9B 1S72A 4AQYQ 1JORA 2F03A 4P72A 1EEID 4JI1Q 2YU9B 2KCTA 1XTCD
chains in the Genus database with same CATH topology
4GLAC 1Q82C 1KC8C 5E7NA 4IFDI 2R7FA 2ES2A 4X66Q 4DR5Q 1T9HA 1VQOA 2KCMA 2ATWA 1LM0A 4LW1A 1PH9A 2AWNA 4C3IH 2N3SA 2UXBL 4LF5Q 4QQBX 1IXRA 4KHZA 4Y7NH 1E7ZA 2BH8A 1OXSC 3LGJA 4YWMA 3RR5A 5C0XG 3M85A 3G71A 3CD6A 4XIGS 1L2FA 2BA0A 1J5EQ 2IT1A 5AJ3Q 2IX1A 1QUQA 4NXML 2ZTEA 3K8AA 3H15A 1GKHA 1WFQA 4JI5L 3KF6A 3TQYA 2HQLA 3UDXA 3CQZH 3G6EA 5M3FH 4B3TL 1VCIA 4JI8L 1B70B 3KOJA 1HJPA 2JEAI 1PH6A 2C35B 2CFMA 2VNUD 4RMFA 1HH2P 2NVYH 3BZCA 3NBHB 5BR8Q 5FJ8G 2F4VL 1X3EA 4DV1Q 2UU9L 1VQEA 1U0LA 2KHIA 1IZ6A 2L15A 3CMAA 1I94L 3GTLH 1WJJA 2N8NA 1KHIA 1VQ8A 1HNWL 3KYHC 2OQ0A 1X65A 1PH5A 3PUWA 4GOPC 1HNZQ 4A3EH 3KJPA 4DV0Q 2VL6A 3OTOL 4A3IH 1EYGA 2K5VA 1K8AC 1X6OA 5FLMH 3J81c 4IOCA 3S1NH 3PF5A 2GVAA 3U4ZA 3TS0A 2PQAA 4L5RC 2VUMG 1B8AA 4A3CH 4A3JH 3PUZA 4TVAB 2ZJQA 1K8GA 4A3LH 3K7UC 2VQEL 3F1ZA 3D31A 2I0QA 3HOVH 1K83H 3PUXA 1K9MC 1QZGA 5EAYA 4IFDJ 2UUCL 4JV5L 4R4QA 2MNAA 1MKHA 4A3DG 1WCMG 3AYHB 2UU9Q 1G291 4R4TA 4YCUA 3S2HH 4DR7L 1Q7YC 4HIMA 1ASYA 1HNWQ 2WFWA 4C3JH 1EUJA 1OXXK 1M90C 1K3RA 1NY4A 2UXDL 4WJ3M 5C4XH 5LMNW 4JI3L 3HOYG 2MFIA 3I4MH 1S3OA 1IBML 3CCSA 1N8RC 1NMFA 1PH7A 4LF4L 1VQFA 2HIVA 1KD1C 2WAQG 3UE1A 2VQEQ 1VQLA 3GTKH 4DR6Q 4DR1L 4P73A 3UE0A 4QIWE 4AH6A 4K0KQ 1HR0Q 1PV4A 2IHEA 3HOUH 5IP9H 1V9PA 4L5TA 1Q86C 5IE8A 5M5XH 4RG1A 3KDFB 3ZJYC 2KBNA 3BJUA 1PHJA 1Q81C 2JA8G 4DV5L 1XMOL 4LF7Q 2K50A 4OWXB 1LUZA 2A8VA 3I4NG 1E3PA 1KAWA 3CPFA 2BH2A 2UXDQ 1HZAA 1OXVA 1X55A 3UDGA 4B3SQ 4DUYL 2QGQA 3L7ZC 3RN5A 1VQAA 3OYYA 4JG2A 3U4VA 3I56A 1P16A 3PF4A 4O2DA 4A3EG 1N32L 1X3FA 2VQFL 1G51A 4GLVB 3PIOA 4GOPB 4A3KG 3GTOH 1UE5A 3Q8DA 2B63G 1N34Q 2RHQB 4DPGA 1HNXQ 5FJ8H 2R93G 2EXDA 5J3BA 3A74A 4X64L 4LFAL 1YVCA 5IWAQ 1P8LA 1NBWA 4DKAC 1TWAH 4DV5Q 1XMOQ 1KQSA 1WOCA 3T1HL 1N33L 3M7NA 3S1QH 4A3BG 1IBKQ 1DGSA 1L0WA 3HKZG 4GKJQ 1CKNB 1XPRA 1NJIC 2MO1A 3HKSA 2JA9A 4IFDG 2OTJA 3TS2A 3H3VI 5LMUQ 3K7AH 3L0OA 2E5LL 2VUMH 4GS3A 2JA6G 3HFZB 1E1OA 2YTYA 2VQFQ 4A93G 5IYCG 3CAMA 2XGTA 3S1RH 4UPAA 3AQQA 2DGYA 2DUDA 2JJQA 4P71A 1I5FA 2GVBA 4JI2Q 4YCWA 4A3DH 2ZM6L 1WCMH 2F52A 3W5OA 2HHHL 1KIXA 1AE3A 1BVSA 1JB7A 1YIJA 4HIOA 3PUYA 2VW9A 1MIUA 4IPGA 1CSQA 1G6PA 3KJOA 3A5ZB 4JOIC 5C3EG 1N36L 4OX9L 1IBLQ 5JEAJ 1EIFA 3HOYH 3TEHB 4P74A 1EQRA 3JAMi 1Y1VG 2YV5A 4PMWA 3F2BA 4HJ9A 1VQ9A 1OXUA 2A1AA 3B6YA 1C9OA 2RCNA 1PH3A 4LFBL 4O0AA 1XJVA 4DK3C 4JOIA 3S16H 4GLXA 4J15A 4DV3Q 1L1OB 4LF6Q 2UUAQ 2WP8J 3RZDH 4LFCQ 1UE1A 2HIXA 1HZCA 4JI6Q 4UY8C 3RLNA 4IJHA 1BBUA 1C0AA 1NTGA 5ELOA 3JAMc 2JA8H 4B3RL 2UXCQ 3CCQA 2RF4A 4LF9L 3GD7A 3I4NH 1SE8A 2AKWB 4R4OA 5LMNL 4LUVA 3F8TA 3SGIA 3OW2A 2PI2A 4AIMA 2V1CC 2UXBQ 3CPWA 1BBWA 4X62L 2NVXH 4BY1H 4NXNL 1V43A 3CP0A 4KI0A 3GTJH 4P75A 2WAQE 2NN6G 5IP7G 3T1YL 1H95A 2PMZE 4PZ7A 3ULPA 1JJGA 5GQOA 2PI2E 4NXMQ 4A3KH 2AMCB 3G48A 4IPCA 3AFQA 4EX5A 4JI5Q 2B63H 1VQBA 4B3TQ 2R93H 4JI8Q 3AFPA 3L2PA 4GOPA 3GTPH 1V1QA 2K4KA 4A3MG 1Q12A 3M4PA 1VS0A 2MQHA 3NEMA 2F4VQ 3GTGH 4A3BH 4AYBE 1X3GA 1PYBA 2R92G 1Y14B 4X65L 4HJAA 5IYDG 2D62A 3FKIG 5C0XI 4DV7L 2CWAA 3ERSX 4BXXG 1I94Q 1W2BA 1XNRL 4DUZL 1CKNA 3FHWA 3RNUA 2Q2HA 3DLLA 1FJGL 1YJNA 4NXNQ 3S14H 4KLKA 2AWOA 2B29A 4X6AH 4C2MH 2N49A 3OTOQ 3NENA 2JA6H 5IY0A 1EOVA 3M9BA 4A93H 2R7ZG 5IYCH 2YU9H 3UDIA 4KHPL 1VQJA 2N78A 1VQKA 2I5HA 4QY7A 2K75A 1TWHH 2Z6KC 1MJCA 5HGQA 4HJ8A 1JJ2A 4A4IA 1QVCA 1TWFH 4IJLA 2JA5H 2ZTDA 5JJLA 1BKBA 2F3IA 1I50H 1I3QH 2JQOA 2UUCQ 1YHBA 3CCMA 2QA4A 1R9TH 3HKZE 4JV5Q 1KXLA 2JA7G 2Z6KA 4YHHL 5C3EH 3F2CA 4JYAL 1XNQL 2VZAA 3G4SA 1XNRQ 4DR7Q 1CKMA 3M3YH 4JI4L 3I4OA 1PH2A 3EIVA 2R92H 4AYBG 2JK8A 1Y1VH 2GN5A 3JC66 1KRTA 2OWOA 3GTMH 1QVFA 4DV4L 4GN5A 4JI3Q 3MXNB 1L1OC 2D0PA 1IBMQ 2IX0A 1D8LA 2K5HA 4ME3A 3PCOB 1KRSA 2AHOB 3CC4A 4R1JA 4LF4Q 3HOWG 4BY1G 1X54A 5C4JH 1VQ6A 1GD7A 3STBD 1W3SA 3E9IA 4DNIA 4DR1Q 1Q1EA 2EIFA 2CKZB 3J81j 1K73C 3DM3A 4L5SA 4R4IA 1L1OA 2OTLA 1I6HH 2I5LX 5JJKA 5JJIA 1YHAA 2LXJA 5C0XJ 4GN4B 1M1KC 4YHHQ 4BBSG 4YWKA 1PH4A 1XNQQ 1HR0W 3S2DH 3PGZA 2YTXA 4DAMA 4WJ4A 5IYBG 4Y52H 3KFUA 4MZ9A 4DV4Q 1XPOA 1YHQA 1XMQL 1D7QA 4XTCS 5IP7H 4DUYQ 1KL9A 1O7IA 3CXCA 5H1SE 4HIDA 5M3MG 4DR2L 1WI5A 4JBJA 4JBMA 3U50C 3GDEA 4DV6L 3PUVA 1N32Q 3PIPA 1YJWA 1E22A 4A3MH 2IHFA 4YY3L 1NMGA 5HY6A 3VDYA 2UUBL 1ASZA 4JI0L 2K5NA 4X64Q 2UXCL 5FLXc 4LFAQ 1VQPA 1YITA 1VQ5A 3HOZG 1E24A 5IYDH 3FKIH 2E8GA 1N33Q 3PO2G 3T1HQ 4BXXH 4JI1L 1K0RA 4OO1I 3HOXG 3I2ZA 2E2IH 1FL0A 3ULJA 2JA5G 2HT1A 4X66L 4DR5L 4GNXB 3H0GG 4APVA 4IO9A 3F2DA 4LF5L 4YWLA 2R7ZH 1YJ9A 3RN2A 5M5YH 1Q46A 1RIPA 1WYDA 2E5LQ 3CF5A 4DR3L 2R7DA 4JC0A 4DV6Q 5GAHC 5AJ3L 2RHSB 1TWCH 2I5MX 2ASBA 4UP9A 3CCEA 3S17H 1VQNA 3WWVA 1TWGH 2ZM6Q 1GM5A 2JA7H 2HHHQ 4PZ6A 4LUOA 1HZ9A 4A76A 3IRBA 4LWCA 5BR8L 4GN3B 2WB1E 3J7ZC 2KENA 3KDFA 2ZJRA 2YYZA 4DV1L 3S24A 1N36Q 4OX9Q 1FGUA 4IPDA 3I55A 3ICEA 1Z47A 1VQHA 2ZJPA 1IL2A 1CSPA 4A3FG 1XPUA 3D0FA 3HOWH 3J7A5 1HNZL 4A3GG 4LUZA 2CWPA 2XTIA 4DV0L 4DR3Q 4LFBQ 3ER0A 3J80i 1TXYA 3AEVA 4PG3A 3EN2A 1Z9FA 1EFWA 1GVPA 2PNHA 4B3ML 1FVIA 3KF8B 3EBEA 2OQKA 4BA1I 4HJ5A 3H3VH 1EIYB 5ELNA 1YI2A 5C44G 1YZ6A 4MNOA 1LYLA 2R6GA 3J81i 1VQDA 1N9WA 4BBSH 3MEFA 1B7YB 3A5UA 3PSIA 1PFSA 4B3RQ 1PVOA 4R4CA 3GTQH 1SMXA 5IYBH 1S40A 4LF9Q 3J80c 5LMNQ 1Y1WG 4OWWB 1IYJB 4LNQA 1J6QA 4MTNA 3U58A 2WB1G 3BU2A 1AE2A 4X62Q 3BZKA 3TRZA 3GO5A 3W1GA 5M3MH 3CC2A 1X9NA 3T1YQ 3CCRA 4LF8L 4B3MQ 5GADC 4BBRG 2KHJA 4IPHA 1A63A 3NELA 1SRUA 3CCVA 4HIKA 4DR6L 1PH1A 2QEXA 4YCVA 5JEAG 4QJFA 3CCLA 1HR0L 3HOZH 4JI7L 3PO3G 4K0KL 3PV0A 2ALYB 3M4OH 3PO2H 1YNXA 4GNXC 4BY7G 1RL2A 3HOXH 2BA1A 4X65Q 4H02A 1E1TA 2NZOA 1MJEA 3K80C 2E2HH 4NPSA 4DV7Q 1VQ7A 2NVTH 2NN6I 4QL5A 4POFA 1JMCA 1OTCA 3H0GH 4LF7L 2JEBI 2VY3A 4DK6C 1SR3A 4DUZQ 4GKKL 3E0EA 3RLFA 1FJGQ 3S1MH 2Y0SE 2ZTCA 3CW2C 4L5QA 1EQQA 4GNXA 2JE6I 2LSSA 1YBYA 4LF8Q 4B3SL 2CCZA 4JBWA 1QUQB 4KHPQ 4JBKA 2K14A 3CCJA 1PH8A 3KF6B 1QVGA 2E2JH 3K0XA 4JI7Q 1JT8A 3RLOA 1CKOA 1JJCB 1OXTA 4NB3A 1N34L 3STBC 5GAGC 3CMEA 3K81C 1HNXL 5M3FG 4HJ7A 3FP9A 3E9HA 2Z0SA 5IWAL 4EQ5A 1A8VA 1Q1BA 1SN8A 4JYAQ 2H5XA 4UP8A 1VQGA 5GROA 3UDFA 1IBKL 4JI4Q 4GKKQ 1CUKA 1QZHA 4A3FH 3CCUA 4POGA 4GKJL 4A3GH 2IY5B 3W1BA 3S15H 1SROA 2K52A 4OO1G 1NE3A 1VQMA 1Q8KA 2A19A 1VQCA 1SLJA 5LMUL 2Y0SG 2CQOA 2PQAB 3I7FA 4A3IG 1EWIA 2EQSA 2B3GA 2ID0A 4OONA 1UEBA 2LXKA 4UP7A 1UWVA 4PZ8A 5FLMG 5C44H 4A3CG 4A3JG 4A3LG 1A62A 4IOAA 4DR4L 5GAEC 1LTLA 1JE5A 4JI2L 1XTDA 1X56A 2MO0A 3HOVG 1Y1WH 1GO3E 1HZBA 2OCEA 4DV2L 4AQYL 1PA6A 4OXPA 3A0JA 4QGUA 1U5KA 3TREA 1XMQQ 1IBLL 5IT9c 3M4QA 1C7YA 1YEZA 1AH9A 4JCVE 3ULLA 2Q2TA 3RZOH 4BA2I 1UE6A 2D0OA 2NZHA 1UE7A 2YTVA 5DLQE 4BBRH 4A75A 2Q2UA 5C4XG 4DR2Q 5M5WH 3I4MG 1VQIA 2VS1A 1SFOH 1J5EL 4OWTB 4FDBA 4DAYB 4ALPA 2NVQH 4DV3L 3PO3H 4LF6L 2UUAL 1VQ4A 4YY3Q 4LFCL 4DR4Q 2UUBQ 4JI6L 4JI0Q 4TQUS 5K36G 4BY7H 1S72A 3KLWA 1PYSB 1A0IA 3CC7A 4DV2Q 4C3HH 4AQYQ 4P72A 3HOUG 5IP9G 4JI1Q 2KCTA 2Q2IA 2FXQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GLA C;  1Q82 C;  1KC8 C;  5E7N A;  4IFD I;  2R7F A;  2ES2 A;  4X66 Q;  4DR5 Q;  1T9H A;  1VQO A;  2KCM A;  2ATW A;  1LM0 A;  4LW1 A;  1PH9 A;  2AWN A;  4C3I H;  2N3S A;  2UXB L;  4LF5 Q;  4QQB X;  1IXR A;  4KHZ A;  4Y7N H;  1E7Z A;  2BH8 A;  1OXS C;  3LGJ A;  4YWM A;  3RR5 A;  5C0X G;  3M85 A;  3G71 A;  3CD6 A;  4XIG S;  1L2F A;  2BA0 A;  1J5E Q;  2IT1 A;  5AJ3 Q;  2IX1 A;  1QUQ A;  4NXM L;  2ZTE A;  3K8A A;  3H15 A;  1GKH A;  1WFQ A;  4JI5 L;  3KF6 A;  3TQY A;  2HQL A;  3UDX A;  3CQZ H;  3G6E A;  5M3F H;  4B3T L;  1VCI A;  4JI8 L;  1B70 B;  3KOJ A;  1HJP A;  2JEA I;  1PH6 A;  2C35 B;  2CFM A;  2VNU D;  4RMF A;  1HH2 P;  2NVY H;  3BZC A;  3NBH B;  5BR8 Q;  5FJ8 G;  2F4V L;  1X3E A;  4DV1 Q;  2UU9 L;  1VQE A;  1U0L A;  2KHI A;  1IZ6 A;  2L15 A;  3CMA A;  1I94 L;  3GTL H;  1WJJ A;  2N8N A;  1KHI A;  1VQ8 A;  1HNW L;  3KYH C;  2OQ0 A;  1X65 A;  1PH5 A;  3PUW A;  4GOP C;  1HNZ Q;  4A3E H;  3KJP A;  4DV0 Q;  2VL6 A;  3OTO L;  4A3I H;  1EYG A;  2K5V A;  1K8A C;  1X6O A;  5FLM H;  3J81 c;  4IOC A;  3S1N H;  3PF5 A;  2GVA A;  3U4Z A;  3TS0 A;  2PQA A;  4L5R C;  2VUM G;  1B8A A;  4A3C H;  4A3J H;  3PUZ A;  4TVA B;  2ZJQ A;  1K8G A;  4A3L H;  3K7U C;  2VQE L;  3F1Z A;  3D31 A;  2I0Q A;  3HOV H;  1K83 H;  3PUX A;  1K9M C;  1QZG A;  5EAY A;  4IFD J;  2UUC L;  4JV5 L;  4R4Q A;  2MNA A;  1MKH A;  4A3D G;  1WCM G;  3AYH B;  2UU9 Q;  1G29 1;  4R4T A;  4YCU A;  3S2H H;  4DR7 L;  1Q7Y C;  4HIM A;  1ASY A;  1HNW Q;  2WFW A;  4C3J H;  1EUJ A;  1OXX K;  1M90 C;  1K3R A;  1NY4 A;  2UXD L;  4WJ3 M;  5C4X H;  5LMN W;  4JI3 L;  3HOY G;  2MFI A;  3I4M H;  1S3O A;  1IBM L;  3CCS A;  1N8R C;  1NMF A;  1PH7 A;  4LF4 L;  1VQF A;  2HIV A;  1KD1 C;  2WAQ G;  3UE1 A;  2VQE Q;  1VQL A;  3GTK H;  4DR6 Q;  4DR1 L;  4P73 A;  3UE0 A;  4QIW E;  4AH6 A;  4K0K Q;  1HR0 Q;  1PV4 A;  2IHE A;  3HOU H;  5IP9 H;  1V9P A;  4L5T A;  1Q86 C;  5IE8 A;  5M5X H;  4RG1 A;  3KDF B;  3ZJY C;  2KBN A;  3BJU A;  1PHJ A;  1Q81 C;  2JA8 G;  4DV5 L;  1XMO L;  4LF7 Q;  2K50 A;  4OWX B;  1LUZ A;  2A8V A;  3I4N G;  1E3P A;  1KAW A;  3CPF A;  2BH2 A;  2UXD Q;  1HZA A;  1OXV A;  1X55 A;  3UDG A;  4B3S Q;  4DUY L;  2QGQ A;  3L7Z C;  3RN5 A;  1VQA A;  3OYY A;  4JG2 A;  3U4V A;  3I56 A;  1P16 A;  3PF4 A;  4O2D A;  4A3E G;  1N32 L;  1X3F A;  2VQF L;  1G51 A;  4GLV B;  3PIO A;  4GOP B;  4A3K G;  3GTO H;  1UE5 A;  3Q8D A;  2B63 G;  1N34 Q;  2RHQ B;  4DPG A;  1HNX Q;  5FJ8 H;  2R93 G;  2EXD A;  5J3B A;  3A74 A;  4X64 L;  4LFA L;  1YVC A;  5IWA Q;  1P8L A;  1NBW A;  4DKA C;  1TWA H;  4DV5 Q;  1XMO Q;  1KQS A;  1WOC A;  3T1H L;  1N33 L;  3M7N A;  3S1Q H;  4A3B G;  1IBK Q;  1DGS A;  1L0W A;  3HKZ G;  4GKJ Q;  1CKN B;  1XPR A;  1NJI C;  2MO1 A;  3HKS A;  2JA9 A;  4IFD G;  2OTJ A;  3TS2 A;  3H3V I;  5LMU Q;  3K7A H;  3L0O A;  2E5L L;  2VUM H;  4GS3 A;  2JA6 G;  3HFZ B;  1E1O A;  2YTY A;  2VQF Q;  4A93 G;  5IYC G;  3CAM A;  2XGT A;  3S1R H;  4UPA A;  3AQQ A;  2DGY A;  2DUD A;  2JJQ A;  4P71 A;  1I5F A;  2GVB A;  4JI2 Q;  4YCW A;  4A3D H;  2ZM6 L;  1WCM H;  2F52 A;  3W5O A;  2HHH L;  1KIX A;  1AE3 A;  1BVS A;  1JB7 A;  1YIJ A;  4HIO A;  3PUY A;  2VW9 A;  1MIU A;  4IPG A;  1CSQ A;  1G6P A;  3KJO A;  3A5Z B;  4JOI C;  5C3E G;  1N36 L;  4OX9 L;  1IBL Q;  5JEA J;  1EIF A;  3HOY H;  3TEH B;  4P74 A;  1EQR A;  3JAM i;  1Y1V G;  2YV5 A;  4PMW A;  3F2B A;  4HJ9 A;  1VQ9 A;  1OXU A;  2A1A A;  3B6Y A;  1C9O A;  2RCN A;  1PH3 A;  4LFB L;  4O0A A;  1XJV A;  4DK3 C;  4JOI A;  3S16 H;  4GLX A;  4J15 A;  4DV3 Q;  1L1O B;  4LF6 Q;  2UUA Q;  2WP8 J;  3RZD H;  4LFC Q;  1UE1 A;  2HIX A;  1HZC A;  4JI6 Q;  4UY8 C;  3RLN A;  4IJH A;  1BBU A;  1C0A A;  1NTG A;  5ELO A;  3JAM c;  2JA8 H;  4B3R L;  2UXC Q;  3CCQ A;  2RF4 A;  4LF9 L;  3GD7 A;  3I4N H;  1SE8 A;  2AKW B;  4R4O A;  5LMN L;  4LUV A;  3F8T A;  3SGI A;  3OW2 A;  2PI2 A;  4AIM A;  2V1C C;  2UXB Q;  3CPW A;  1BBW A;  4X62 L;  2NVX H;  4BY1 H;  4NXN L;  1V43 A;  3CP0 A;  4KI0 A;  3GTJ H;  4P75 A;  2WAQ E;  2NN6 G;  5IP7 G;  3T1Y L;  1H95 A;  2PMZ E;  4PZ7 A;  3ULP A;  1JJG A;  5GQO A;  2PI2 E;  4NXM Q;  4A3K H;  2AMC B;  3G48 A;  4IPC A;  3AFQ A;  4EX5 A;  4JI5 Q;  2B63 H;  1VQB A;  4B3T Q;  2R93 H;  4JI8 Q;  3AFP A;  3L2P A;  4GOP A;  3GTP H;  1V1Q A;  2K4K A;  4A3M G;  1Q12 A;  3M4P A;  1VS0 A;  2MQH A;  3NEM A;  2F4V Q;  3GTG H;  4A3B H;  4AYB E;  1X3G A;  1PYB A;  2R92 G;  1Y14 B;  4X65 L;  4HJA A;  5IYD G;  2D62 A;  3FKI G;  5C0X I;  4DV7 L;  2CWA A;  3ERS X;  4BXX G;  1I94 Q;  1W2B A;  1XNR L;  4DUZ L;  1CKN A;  3FHW A;  3RNU A;  2Q2H A;  3DLL A;  1FJG L;  1YJN A;  4NXN Q;  3S14 H;  4KLK A;  2AWO A;  2B29 A;  4X6A H;  4C2M H;  2N49 A;  3OTO Q;  3NEN A;  2JA6 H;  5IY0 A;  1EOV A;  3M9B A;  4A93 H;  2R7Z G;  5IYC H;  2YU9 H;  3UDI A;  4KHP L;  1VQJ A;  2N78 A;  1VQK A;  2I5H A;  4QY7 A;  2K75 A;  1TWH H;  2Z6K C;  1MJC A;  5HGQ A;  4HJ8 A;  1JJ2 A;  4A4I A;  1QVC A;  1TWF H;  4IJL A;  2JA5 H;  2ZTD A;  5JJL A;  1BKB A;  2F3I A;  1I50 H;  1I3Q H;  2JQO A;  2UUC Q;  1YHB A;  3CCM A;  2QA4 A;  1R9T H;  3HKZ E;  4JV5 Q;  1KXL A;  2JA7 G;  2Z6K A;  4YHH L;  5C3E H;  3F2C A;  4JYA L;  1XNQ L;  2VZA A;  3G4S A;  1XNR Q;  4DR7 Q;  1CKM A;  3M3Y H;  4JI4 L;  3I4O A;  1PH2 A;  3EIV A;  2R92 H;  4AYB G;  2JK8 A;  1Y1V H;  2GN5 A;  3JC6 6;  1KRT A;  2OWO A;  3GTM H;  1QVF A;  4DV4 L;  4GN5 A;  4JI3 Q;  3MXN B;  1L1O C;  2D0P A;  1IBM Q;  2IX0 A;  1D8L A;  2K5H A;  4ME3 A;  3PCO B;  1KRS A;  2AHO B;  3CC4 A;  4R1J A;  4LF4 Q;  3HOW G;  4BY1 G;  1X54 A;  5C4J H;  1VQ6 A;  1GD7 A;  3STB D;  1W3S A;  3E9I A;  4DNI A;  4DR1 Q;  1Q1E A;  2EIF A;  2CKZ B;  3J81 j;  1K73 C;  3DM3 A;  4L5S A;  4R4I A;  1L1O A;  2OTL A;  1I6H H;  2I5L X;  5JJK A;  5JJI A;  1YHA A;  2LXJ A;  5C0X J;  4GN4 B;  1M1K C;  4YHH Q;  4BBS G;  4YWK A;  1PH4 A;  1XNQ Q;  1HR0 W;  3S2D H;  3PGZ A;  2YTX A;  4DAM A;  4WJ4 A;  5IYB G;  4Y52 H;  3KFU A;  4MZ9 A;  4DV4 Q;  1XPO A;  1YHQ A;  1XMQ L;  1D7Q A;  4XTC S;  5IP7 H;  4DUY Q;  1KL9 A;  1O7I A;  3CXC A;  5H1S E;  4HID A;  5M3M G;  4DR2 L;  1WI5 A;  4JBJ A;  4JBM A;  3U50 C;  3GDE A;  4DV6 L;  3PUV A;  1N32 Q;  3PIP A;  1YJW A;  1E22 A;  4A3M H;  2IHF A;  4YY3 L;  1NMG A;  5HY6 A;  3VDY A;  2UUB L;  1ASZ A;  4JI0 L;  2K5N A;  4X64 Q;  2UXC L;  5FLX c;  4LFA Q;  1VQP A;  1YIT A;  1VQ5 A;  3HOZ G;  1E24 A;  5IYD H;  3FKI H;  2E8G A;  1N33 Q;  3PO2 G;  3T1H Q;  4BXX H;  4JI1 L;  1K0R A;  4OO1 I;  3HOX G;  3I2Z A;  2E2I H;  1FL0 A;  3ULJ A;  2JA5 G;  2HT1 A;  4X66 L;  4DR5 L;  4GNX B;  3H0G G;  4APV A;  4IO9 A;  3F2D A;  4LF5 L;  4YWL A;  2R7Z H;  1YJ9 A;  3RN2 A;  5M5Y H;  1Q46 A;  1RIP A;  1WYD A;  2E5L Q;  3CF5 A;  4DR3 L;  2R7D A;  4JC0 A;  4DV6 Q;  5GAH C;  5AJ3 L;  2RHS B;  1TWC H;  2I5M X;  2ASB A;  4UP9 A;  3CCE A;  3S17 H;  1VQN A;  3WWV A;  1TWG H;  2ZM6 Q;  1GM5 A;  2JA7 H;  2HHH Q;  4PZ6 A;  4LUO A;  1HZ9 A;  4A76 A;  3IRB A;  4LWC A;  5BR8 L;  4GN3 B;  2WB1 E;  3J7Z C;  2KEN A;  3KDF A;  2ZJR A;  2YYZ A;  4DV1 L;  3S24 A;  1N36 Q;  4OX9 Q;  1FGU A;  4IPD A;  3I55 A;  3ICE A;  1Z47 A;  1VQH A;  2ZJP A;  1IL2 A;  1CSP A;  4A3F G;  1XPU A;  3D0F A;  3HOW H;  3J7A 5;  1HNZ L;  4A3G G;  4LUZ A;  2CWP A;  2XTI A;  4DV0 L;  4DR3 Q;  4LFB Q;  3ER0 A;  3J80 i;  1TXY A;  3AEV A;  4PG3 A;  3EN2 A;  1Z9F A;  1EFW A;  1GVP A;  2PNH A;  4B3M L;  1FVI A;  3KF8 B;  3EBE A;  2OQK A;  4BA1 I;  4HJ5 A;  3H3V H;  1EIY B;  5ELN A;  1YI2 A;  5C44 G;  1YZ6 A;  4MNO A;  1LYL A;  2R6G A;  3J81 i;  1VQD A;  1N9W A;  4BBS H;  3MEF A;  1B7Y B;  3A5U A;  3PSI A;  1PFS A;  4B3R Q;  1PVO A;  4R4C A;  3GTQ H;  1SMX A;  5IYB H;  1S40 A;  4LF9 Q;  3J80 c;  5LMN Q;  1Y1W G;  4OWW B;  1IYJ B;  4LNQ A;  1J6Q A;  4MTN A;  3U58 A;  2WB1 G;  3BU2 A;  1AE2 A;  4X62 Q;  3BZK A;  3TRZ A;  3GO5 A;  3W1G A;  5M3M H;  3CC2 A;  1X9N A;  3T1Y Q;  3CCR A;  4LF8 L;  4B3M Q;  5GAD C;  4BBR G;  2KHJ A;  4IPH A;  1A63 A;  3NEL A;  1SRU A;  3CCV A;  4HIK A;  4DR6 L;  1PH1 A;  2QEX A;  4YCV A;  5JEA G;  4QJF A;  3CCL A;  1HR0 L;  3HOZ H;  4JI7 L;  3PO3 G;  4K0K L;  3PV0 A;  2ALY B;  3M4O H;  3PO2 H;  1YNX A;  4GNX C;  4BY7 G;  1RL2 A;  3HOX H;  2BA1 A;  4X65 Q;  4H02 A;  1E1T A;  2NZO A;  1MJE A;  3K80 C;  2E2H H;  4NPS A;  4DV7 Q;  1VQ7 A;  2NVT H;  2NN6 I;  4QL5 A;  4POF A;  1JMC A;  1OTC A;  3H0G H;  4LF7 L;  2JEB I;  2VY3 A;  4DK6 C;  1SR3 A;  4DUZ Q;  4GKK L;  3E0E A;  3RLF A;  1FJG Q;  3S1M H;  2Y0S E;  2ZTC A;  3CW2 C;  4L5Q A;  1EQQ A;  4GNX A;  2JE6 I;  2LSS A;  1YBY A;  4LF8 Q;  4B3S L;  2CCZ A;  4JBW A;  1QUQ B;  4KHP Q;  4JBK A;  2K14 A;  3CCJ A;  1PH8 A;  3KF6 B;  1QVG A;  2E2J H;  3K0X A;  4JI7 Q;  1JT8 A;  3RLO A;  1CKO A;  1JJC B;  1OXT A;  4NB3 A;  1N34 L;  3STB C;  5GAG C;  3CME A;  3K81 C;  1HNX L;  5M3F G;  4HJ7 A;  3FP9 A;  3E9H A;  2Z0S A;  5IWA L;  4EQ5 A;  1A8V A;  1Q1B A;  1SN8 A;  4JYA Q;  2H5X A;  4UP8 A;  1VQG A;  5GRO A;  3UDF A;  1IBK L;  4JI4 Q;  4GKK Q;  1CUK A;  1QZH A;  4A3F H;  3CCU A;  4POG A;  4GKJ L;  4A3G H;  2IY5 B;  3W1B A;  3S15 H;  1SRO A;  2K52 A;  4OO1 G;  1NE3 A;  1VQM A;  1Q8K A;  2A19 A;  1VQC A;  1SLJ A;  5LMU L;  2Y0S G;  2CQO A;  2PQA B;  3I7F A;  4A3I G;  1EWI A;  2EQS A;  2B3G A;  2ID0 A;  4OON A;  1UEB A;  2LXK A;  4UP7 A;  1UWV A;  4PZ8 A;  5FLM G;  5C44 H;  4A3C G;  4A3J G;  4A3L G;  1A62 A;  4IOA A;  4DR4 L;  5GAE C;  1LTL A;  1JE5 A;  4JI2 L;  1XTD A;  1X56 A;  2MO0 A;  3HOV G;  1Y1W H;  1GO3 E;  1HZB A;  2OCE A;  4DV2 L;  4AQY L;  1PA6 A;  4OXP A;  3A0J A;  4QGU A;  1U5K A;  3TRE A;  1XMQ Q;  1IBL L;  5IT9 c;  3M4Q A;  1C7Y A;  1YEZ A;  1AH9 A;  4JCV E;  3ULL A;  2Q2T A;  3RZO H;  4BA2 I;  1UE6 A;  2D0O A;  2NZH A;  1UE7 A;  2YTV A;  5DLQ E;  4BBR H;  4A75 A;  2Q2U A;  5C4X G;  4DR2 Q;  5M5W H;  3I4M G;  1VQI A;  2VS1 A;  1SFO H;  1J5E L;  4OWT B;  4FDB A;  4DAY B;  4ALP A;  2NVQ H;  4DV3 L;  3PO3 H;  4LF6 L;  2UUA L;  1VQ4 A;  4YY3 Q;  4LFC L;  4DR4 Q;  2UUB Q;  4JI6 L;  4JI0 Q;  4TQU S;  5K36 G;  4BY7 H;  1S72 A;  3KLW A;  1PYS B;  1A0I A;  3CC7 A;  4DV2 Q;  4C3H H;  4AQY Q;  4P72 A;  3HOU G;  5IP9 G;  4JI1 Q;  2KCT A;  2Q2I A;  2FXQ A; 
#chains in the Genus database with same CATH topology
 1KC8 C;  2F3V A;  1BUV T;  1AFP A;  4X66 Q;  5JAV A;  5EBC A;  3SXH A;  4DK0 A;  1VQO A;  3PIP 3;  1TWF B;  1CTM A;  4C3I H;  1J9O A;  4QQB X;  1IXR A;  2B8G A;  4N9T A;  1I50 B;  1O78 A;  3CD6 A;  1LT3 D;  5AJ3 Q;  1HTP A;  3C46 A;  4NXM L;  3K5M A;  2KCN A;  3KF6 A;  3GTM B;  2F4I A;  3TDQ A;  4CKE A;  1HJP A;  1PH6 A;  1GUO A;  3MFG A;  1HH2 P;  3NBH B;  4JW0 A;  5BR8 Q;  2XNA C;  2F0K A;  1S5B D;  1VQE A;  1DXM A;  1GUS A;  4IQZ A;  4ILW A;  4OO1 H;  3KYH C;  1PH5 A;  1HNZ Q;  4GOP C;  5M9O A;  3BDL A;  1EYG A;  1X6O A;  3PF5 A;  3U4Z A;  1MSG A;  1BOS A;  2L4N A;  3LNN A;  1FNV A;  1K8G A;  5IGC A;  2BCO A;  2AQ1 B;  1K83 H;  1K9M C;  5EAY A;  5FLX L;  4R4Q A;  1WCM G;  5A2Q E;  1T5X D;  1F9R A;  1DCZ A;  4YCU A;  4CGY B;  2A5H A;  2WFW A;  2UXD L;  2PO4 A;  3HOY G;  2MFI A;  5CV7 A;  5CV5 A;  3I4M H;  5FO8 B;  3KUP A;  1H9M A;  1NMF A;  1LTS D;  1B53 A;  4LF4 L;  4ZKC B;  1K8M A;  2HIV A;  2XIW A;  2WAQ G;  2VQE Q;  3GTK H;  4QF4 A;  3W2D A;  4DR6 Q;  1ZXT A;  4P73 A;  3I8Z A;  1LTT D;  2HCC A;  1EZ8 A;  3VR6 A;  1KNE A;  2Z9H A;  1Y69 U;  3BJU A;  2JA8 G;  3VYR A;  3MXG A;  1I4P A;  2B2U C;  1B3Q A;  4MIU A;  4OEM B;  4DUY L;  2QGQ A;  1VQA A;  3ZYY X;  2PW5 A;  4O42 A;  1HUM A;  2EYP A;  5FK9 C;  2VQF L;  1G51 A;  4GLV B;  4A3K G;  3KF8 A;  2LKV A;  1UE5 A;  2B63 G;  1N34 Q;  1SYC A;  4HCS A;  2EXD A;  3A74 A;  1YVC A;  5IWA Q;  3DUZ A;  1NBW A;  4DKA C;  1XMO Q;  2X6L A;  2F0E A;  3S1Q H;  4UAI A;  1IBK Q;  1DGS A;  1LTG D;  3HKZ G;  2NUC A;  4CDE C;  1EIH A;  2MO1 A;  5ELD A;  4Q5V A;  5DAU A;  2RA4 A;  4IFD G;  3IFT A;  3TS2 A;  5LMU Q;  3K7A H;  3L0O A;  2E5L L;  3J81 L;  2JA6 G;  3CAM A;  3S1R H;  2XWB B;  5LL6 X;  3VA7 A;  2DUD A;  2C5C A;  5JVH 3;  2RDG A;  4JI2 Q;  1WCM H;  3DM1 A;  2F52 A;  4ME5 A;  2HHH L;  2G9D A;  1GJX A;  1AE3 A;  1YIJ A;  2VW9 A;  3OHX C;  4IPG A;  3A5Z B;  5C3E G;  4TKO B;  3K57 A;  4J6H A;  3HOY H;  3TEH B;  4P74 A;  1DM0 B;  2FHT A;  3B6Y A;  2A1A A;  4IUT A;  1A3U A;  4KN7 C;  3HOX B;  2NVT B;  4DA2 A;  5I9P A;  2PPB C;  4DXG A;  2RSO A;  2WP8 J;  3BG3 A;  2UUA Q;  4LFC Q;  3S1M B;  4UY8 C;  1TQO A;  3RLN A;  1GUG A;  5ELO A;  1LTA D;  2WII B;  2JA8 H;  3NBI A;  4B3R L;  4KD4 A;  1HTL D;  1B1Z A;  5JPN C;  1NR4 A;  1CQF A;  3RD4 A;  1U4R A;  4P2C B;  1LLR D;  3F8T A;  2E2J B;  2PI2 A;  2M9V A;  2A73 B;  3HRZ C;  4X62 L;  2NVX H;  4BY1 H;  1V43 A;  2NN6 G;  4L8J A;  4DU9 A;  1JWS D;  1EL0 A;  3ERQ A;  4A3K H;  2N88 A;  5FO7 B;  4IPC A;  4JI5 Q;  3AFQ A;  2B63 H;  1VQB A;  4H0L C;  3L2P A;  4G7O C;  1STG A;  1TU2 B;  3EA6 A;  4A3M G;  1Q12 A;  1VS0 A;  3NQT A;  2ZXR A;  1CA5 A;  4HJA A;  4LMQ D;  3M4Y A;  2CWA A;  1X3P A;  3OIQ A;  4DUZ L;  1H9K A;  2RDH A;  3DLL A;  4IFD H;  1YJN A;  5IT9 L;  4PMB A;  4NXN Q;  3S14 H;  2AWO A;  4X6A H;  4C2M H;  2L5T A;  3NEN A;  2JA6 H;  1Y1W B;  1VQJ A;  4MN3 A;  1TWH H;  4HAE A;  5HGQ A;  1EY9 A;  5DM6 3;  4IJL A;  1BKB A;  1MGS A;  1DON A;  4HED A;  1R9T H;  3D4R A;  1KXL A;  2JA7 G;  2K03 A;  3DEO A;  5C3E H;  4YHH L;  3F2C A;  1XNQ L;  3G4S A;  1CKM A;  3M3Y H;  3I73 A;  2JK8 A;  3HS0 C;  1QVF A;  1ESR A;  4GN5 A;  4JI3 Q;  3NPP A;  5AFW A;  3MXN B;  2B2Y A;  1IBM Q;  2B2W C;  1D8L A;  4ME3 A;  3HOW G;  3PCO B;  3BVG A;  2AHO B;  3MAQ A;  1X54 A;  5C4J H;  1VQ6 A;  4DNI A;  1F9S A;  1H9S A;  4DR1 Q;  3D4D A;  5KIX A;  3J81 j;  2CKZ B;  5D3D A;  4CDC C;  3LWE A;  4C3I B;  2OTL A;  5JJI A;  3DXJ C;  2IW3 A;  3IFD A;  4K2L A;  3KLR A;  4RCN A;  2E76 C;  5C4Z A;  2F0P A;  3S16 B;  1PH4 A;  4JK1 C;  1HR0 W;  4WJ4 A;  1TS3 A;  5D3I B;  1IL8 A;  4KKU A;  3I70 A;  1XMQ L;  2CH4 A;  1IKL A;  2NN6 H;  2EPB A;  3W3A A;  1HUN A;  4G4K A;  4NW2 A;  4DR2 L;  1WI5 A;  3Q0A A;  4JBM A;  1RTO A;  3PUV A;  4IN3 A;  1YJW A;  4A3M H;  2IHF A;  3J7Y W;  5CV9 A;  4H13 C;  1BNZ A;  2K5N A;  5G3L D;  5FLX c;  1VQ5 A;  3HOZ G;  4H44 C;  3SK4 A;  1E24 A;  3LWU A;  2E8G A;  3PO2 G;  4JI1 L;  3N6R A;  2HDM A;  2HT1 A;  5CV6 A;  4X66 L;  4GNX B;  4QIW B;  1K83 B;  4YWL A;  3RN2 A;  5M5Y H;  4FXG C;  4N8F A;  2R7D A;  4JC0 A;  2F3W A;  4DV6 Q;  1PRT D;  5EQ0 A;  5AJ3 L;  2OEO A;  4UP9 A;  2K33 A;  1RTN A;  2JYO A;  3S17 H;  1QCB D;  4K5V A;  4FVM A;  4K8J A;  2JA7 H;  4PZ6 A;  3I4M B;  1HZ9 A;  5EBD A;  3IRB A;  5BR8 L;  1A15 A;  3J7Z C;  2KEN A;  3KDF A;  2YYZ A;  3GTK B;  2SDF A;  3QB3 A;  4IPD A;  1Z47 A;  1IL2 A;  4NKL A;  4QUF A;  3HOW H;  1HNZ L;  3J7A 5;  5KNB A;  4LUZ A;  4LFB Q;  4DR3 Q;  4PG3 A;  2B2T C;  4B3M L;  3H3V H;  4HJ5 A;  1DOL A;  1PTO F;  2R3Z A;  4V0B A;  2RQX A;  1LYL A;  1VQD A;  1PFS A;  2BDO A;  3GTQ H;  5ELE A;  1S40 A;  4FXD A;  5J39 A;  4HCE A;  5LMN Q;  2WAC A;  2AQ2 B;  4X3S A;  1AE2 A;  1O7L A;  2OF1 A;  3BZK A;  1JOO A;  3UI2 A;  4IUV A;  1TII D;  3S1Q B;  1K0S A;  1CZG A;  3SK8 A;  2KHJ A;  4IPH A;  1A63 A;  4DR6 L;  3NE5 B;  1PH1 A;  2CH4 W;  3HOZ H;  4JI7 L;  3PO3 G;  3SK5 A;  3PO2 H;  1YNX A;  4GNX C;  4BY7 G;  3K7A B;  5BN4 A;  1RDP D;  2E2H H;  4NPS A;  3DMU A;  1VQ7 A;  1JQY D;  4QL5 A;  1JMC A;  5E1F A;  1SR3 A;  3S1R B;  1BCP D;  1FJG Q;  4N8X 1;  2MUY A;  2Y0S E;  3HP3 A;  4RWS C;  2JE6 I;  4LF8 Q;  1WCM B;  5J22 A;  2KA7 A;  1BF4 A;  1STN A;  1FNW A;  1SYD A;  4OEL B;  3HOY B;  1JJC B;  4NB3 A;  1N34 L;  5M3F G;  1EWC A;  2F0L A;  3E9H A;  4IZ8 A;  5IWA L;  1A8V A;  2WAQ B;  1I6V C;  1SN8 A;  4JYA Q;  2NYZ D;  1DYQ A;  2H5X A;  1IBK L;  4POG A;  3W1B A;  5KRU A;  3S15 H;  2K52 A;  1VQC A;  2JA8 B;  5LMU L;  2Y0S G;  5ELB A;  3MXU A;  4A3I G;  3QG1 A;  2B3G A;  2F0D A;  2ID0 A;  4ZYS A;  1PYW D;  5I2X A;  3Q23 A;  2M2L A;  2D9U A;  4A3C G;  4A3J G;  5IGE A;  4IOA A;  3VR2 A;  3QOJ A;  5GAE C;  2ZXP A;  1ZYR D;  2NVX B;  1LTL A;  4JI2 L;  4BY1 B;  1XTD A;  3HOV G;  3OOC A;  1GO3 E;  1KDB A;  3HGB A;  2F1M A;  3D3R A;  4A3K B;  2B63 B;  3TRE A;  2PW7 A;  5IT9 c;  1A2U A;  1C7Y A;  1WTV A;  3RZO H;  4BA2 I;  4RKL A;  1UE7 A;  5EJW A;  5DLQ E;  5M5W H;  1LT5 D;  3HKZ B;  4OWT B;  3V96 A;  4FDB A;  3PO3 H;  2UUA L;  2B2V C;  4LFC L;  4YY3 Q;  5K36 G;  1BCP B;  4TQU S;  1PRT C;  3S14 B;  5M3M B;  4BY7 H;  4C2M B;  4KV6 A;  3CC7 A;  2JA6 B;  2J0T D;  4GLA C;  1GOZ A;  5E7N A;  1AEX A;  1TWH B;  2L0C A;  4DR5 Q;  1PZK D;  3V2T A;  1E7Z A;  2BH8 A;  1OXS C;  4YWM A;  3M85 A;  5C0X G;  1R9T B;  2BA0 A;  1O7Y A;  5C3E B;  3IAY A;  1QUQ A;  4K5W A;  2D2C C;  3M3Y B;  1WFQ A;  4JI5 L;  3TQY A;  3UDX A;  3CQZ H;  1ET6 A;  3G6E A;  5M3F H;  5HGT A;  1B70 B;  3KOJ A;  1TY0 A;  3MWY W;  3T4A C;  2JEA I;  1EU4 A;  2EYM A;  2NVY H;  3BZC A;  4DNT B;  3N52 A;  5FJ8 G;  1WTP A;  5C4J B;  2BE5 D;  4DV1 Q;  2UU9 L;  1U0L A;  3ND9 A;  3CMA A;  4XDX A;  1WJJ A;  2N8N A;  1VQ8 A;  3OIP A;  1X65 A;  3S2D H;  3G6J B;  4DV0 Q;  4A3I H;  1STY A;  2K5V A;  3S1N H;  4EGV A;  2PQA A;  1QWY A;  4A3C H;  4A3J H;  4ID6 A;  2XSC A;  3GV3 A;  4K5X A;  3HOV H;  3R2I A;  1LT4 D;  1QZG A;  4MTK A;  1RD9 D;  3AU7 A;  1PZJ D;  3AYH B;  1G29 1;  1BQQ T;  1LTI D;  1HNW Q;  4A3M B;  4KJN A;  5I4D A;  4WJ3 M;  3GV6 A;  2F0H A;  4JI3 L;  2PNR C;  1HQM C;  1IBM L;  4K8I A;  1BCP C;  4RAU C;  5K36 H;  4DR1 L;  4DAY A;  3X3N A;  4QIW E;  1EYA A;  1PV4 A;  2IHE A;  3G7L A;  1I4H A;  4X3K A;  5IE8 A;  5M5X H;  4RG1 A;  1IW7 D;  1TKW B;  4LF7 Q;  4OWX B;  1LUZ A;  4ABN A;  2A8V A;  3I4N G;  2AUK A;  1B2T A;  3S17 B;  3DWQ A;  3A54 A;  5C0X H;  2BOS A;  4B3S Q;  2JA7 B;  3L7Z C;  3U4V A;  3I56 A;  4O2D A;  2B2U A;  3DHQ A;  4OIJ A;  1ILP A;  2EYO A;  3PIO A;  4GOP B;  1DZ1 A;  1QIL A;  1T5E A;  3FEW X;  4UDU C;  4DPG A;  5FJ8 H;  3HOW B;  5J3B A;  1CT1 D;  2PYK A;  1P8L A;  1LO5 D;  1TWA H;  4M1U B;  4DV5 Q;  1KQS A;  3KLS A;  4A3B G;  4ODG A;  1ZYR C;  2VXW A;  1AN8 A;  1CKN B;  2OT2 A;  1A3V A;  4QB4 A;  1XWE A;  2LS0 1;  4Q0F A;  2QKI C;  4GS3 A;  3GTQ B;  2YTY A;  4A93 G;  3AQQ A;  2DGY A;  4HMJ A;  5COY A;  4HIO A;  1XX8 A;  3PUY A;  1MIU A;  3CRL C;  2IX3 A;  1BR9 A;  3VYU A;  1EIF A;  1ZEQ X;  3HOZ B;  2R92 G;  1EQR A;  3JAM i;  1Y1V G;  2N55 A;  2YV5 A;  3F2B A;  4H7B A;  4HJ9 A;  1OXU A;  3PO2 B;  4LFB L;  2ENB A;  3S16 H;  1QNU A;  2E2H B;  4GLX A;  2A6H D;  2O5I C;  4DV3 Q;  1WTX A;  1HZC A;  1KDA A;  4IJH A;  3L3O C;  5EKI A;  5FLX E;  3R8B A;  3CCQ A;  3NP8 A;  3I4N H;  1HXY D;  5LMN L;  1KAB A;  4LUV A;  3SGI A;  4XXE A;  2Z4I A;  2V1C C;  2UXB Q;  2O4X A;  2FMC A;  3NK9 A;  1TR5 A;  2BE5 C;  2A68 D;  1MHW C;  4NP5 A;  1K8O A;  4G7Z C;  2WAQ E;  1JJG A;  5GQO A;  3VYT A;  1F9Q A;  4EX5 A;  2A6E D;  1RCV D;  2MJ8 A;  4JI8 Q;  3S15 B;  5E4X A;  3H3V C;  1VMP A;  3U9S A;  4A3B H;  4AYB E;  4G7H C;  2CQA A;  1PYB A;  1Y14 B;  2WV6 D;  3DEP A;  2D62 A;  1I94 Q;  1LTB D;  1EIG A;  3FHW A;  1FJG L;  2KED A;  3MTS A;  1WD1 A;  2EDG A;  4CKB A;  1ENC A;  3M9B A;  1SYF A;  4C1N K;  2R7Z G;  4A93 H;  1VQK A;  2Z6K C;  1MJC A;  5L37 A;  3NQI A;  1JJ2 A;  1WTO A;  1QVC A;  1U4P A;  2Q8R E;  1IHZ A;  1STB A;  1I3Q H;  3RZO B;  2UUC Q;  1YHB A;  4JV5 Q;  3HKZ E;  4QUC A;  5M5W B;  4JYA L;  3I90 A;  4RGO S;  2VZA A;  1XNR Q;  2R92 H;  4AYB G;  4XQJ A;  1Y1V H;  3PO3 B;  1IW7 C;  3JC6 6;  3FMC A;  3OWE B;  4DV4 L;  4BY7 B;  1SSO A;  4RHS A;  3CC4 A;  3NHH A;  1STE A;  4BY1 G;  3J81 E;  4HSV A;  1GD7 A;  2QEJ C;  3E9I A;  3STB D;  1M4V A;  1K73 C;  4R4I A;  2B2W A;  2I5L X;  2Z6B A;  5FKA C;  1I6H H;  4PMC A;  2LXJ A;  5C0X J;  4BBS G;  5IOD A;  2F0G A;  2YTX A;  2G9H D;  1LT6 D;  3KFU A;  3K5N A;  4R9W A;  3CQZ B;  4OHJ A;  5M3F B;  4ZLT F;  3OMG A;  1KL9 A;  3PQI A;  1O7I A;  3CXC A;  4J1M A;  5H1S E;  2NVY B;  5M3M G;  5CV4 A;  3TP5 A;  5I9O A;  3PIP A;  2F0I A;  1SE4 A;  1G2T A;  4YY3 L;  1NMG A;  5HY6 A;  1ASZ A;  2J4X A;  3S2D B;  4X64 Q;  1YIT A;  3OPO A;  2Y0S B;  4A3I B;  4FNF A;  3T1H Q;  3S1N B;  3KBX A;  3C3L A;  2E2I H;  2JA5 G;  2F0O A;  4A3J B;  5CYU A;  2X6G A;  4B9X A;  4DR5 L;  4IO9 A;  3F2D A;  3HOV B;  2R7Z H;  1JB3 A;  1Q46 A;  1WYD A;  1TS5 A;  2RHS B;  1G2S A;  1DOM A;  1G91 A;  1B3A A;  1ROD A;  3CRK C;  2A6H C;  1GM5 A;  5JVG 3;  5C3W A;  4LWC A;  2WB1 E;  1ENA A;  4DV1 L;  1N36 Q;  3ICE A;  1VQH A;  1XPU A;  2ZXO A;  5IT9 E;  4OGQ C;  4DV0 L;  5M5X B;  1AZP A;  4ZQ3 A;  3J80 i;  1IYV A;  2EXZ A;  3EN2 A;  2F0W A;  2PNH A;  2EZV A;  2A68 C;  3KF8 B;  3TZU A;  3HG9 A;  5C44 G;  1YZ6 A;  2ICE C;  4MNO A;  4BBS H;  3MEF A;  5D14 A;  3M7G A;  2A6E C;  1SMX A;  1CA6 A;  2NZ1 D;  1JE4 A;  3J7A F;  4FF2 A;  2KVM A;  1IYJ B;  2IL8 A;  1BDO A;  2WB1 G;  5EPL A;  3TRZ A;  3GO5 A;  5M3M H;  3T1Y Q;  2OXP A;  5LL6 S;  1TWA B;  5FO9 B;  2JN4 A;  3K5O A;  4HIK A;  3CCV A;  1SYE A;  4YCV A;  4HR7 B;  4WFN 3;  3M4O H;  1UAP A;  2X69 A;  4X65 Q;  2JA5 H;  4H02 A;  3K80 C;  4C3H G;  4DV7 Q;  2NN6 I;  4POF A;  4LF7 L;  1RJT A;  4DK6 C;  2H4O A;  4GKK L;  3RLF A;  2ZTC A;  2DNC A;  4GNX A;  1E2V A;  3WOF A;  4B3S L;  3FKI B;  3TME A;  5IGD A;  3I4L A;  2F0Q A;  3CCJ A;  1PH8 A;  3A8K E;  1JT8 A;  3RLO A;  4G57 A;  3STB C;  5GAG C;  3CME A;  3FP9 A;  2Z0S A;  5T1G A;  3JAM L;  3P20 A;  2PMZ B;  5CC4 A;  4JI4 Q;  5G3L F;  1CUK A;  1VMC A;  1EU3 A;  4DFA A;  2IY5 B;  2KEE A;  4CBV A;  1SNP A;  1SRO A;  1UEA B;  4L6T B;  1NE3 A;  3Q6S A;  1Q8K A;  2A19 A;  1QOH A;  1SLJ A;  4CJ0 B;  1HFG A;  3I7F A;  3I4N B;  1SJE D;  4OON A;  1UEB A;  2LXK A;  2IPK D;  3P75 A;  5C44 H;  4FYD A;  4RH6 A;  1DJR D;  4DR4 L;  2XRQ D;  1X56 A;  2MO0 A;  4AQY L;  1QG7 A;  4OXP A;  1TS2 A;  4QGU A;  5J1Z A;  1JOQ A;  2EYL A;  4S3S A;  4ZKB B;  2NZH A;  2YTV A;  4A3B B;  2I46 A;  1Z6H A;  1EY0 A;  4XYQ A;  3C1E A;  4CDD C;  1EYD A;  4DV3 L;  4XQQ A;  2UUB Q;  4JI0 Q;  4M8A A;  1NUC A;  4C3H H;  4DV2 Q;  2L12 A;  4A93 B;  1YNJ D;  5IP9 G;  2Q2I A;  4GN3 B;  1Q82 C;  1F2L A;  2B2V A;  2R7F A;  2ES2 A;  4BS9 A;  2ATW A;  1LM0 A;  4LW1 A;  2AWN A;  1F2Z A;  3Q24 A;  2UXB L;  4KHZ A;  4JVZ A;  1D5X C;  1I3Q B;  3LGJ A;  5CBA E;  3RR5 A;  3G71 A;  1R4P B;  4XIG S;  1L2F A;  1J5E Q;  1H9S B;  4B9W A;  2IX1 A;  1EFI D;  3K8A A;  5KGU A;  1GKH A;  2R92 B;  1KLU D;  1Y1V B;  2HQL A;  3SR1 A;  1CI3 M;  1GUT A;  1MI2 A;  1SAP A;  4JI8 L;  5LHY 1;  2C35 B;  2EY2 A;  4RA8 A;  2NTS A;  1SE3 A;  1C8C A;  1I94 L;  3H09 A;  1I6H B;  3PUW A;  4A3E H;  3BDO A;  5ELC A;  1K8A C;  3J81 c;  1S5C D;  4IOC A;  1L0X B;  2LY7 A;  4L5R C;  1B8A A;  3T51 B;  3PUZ A;  4TVA B;  2ZJQ A;  3K7U C;  1Y8O B;  2HUG A;  3GQB A;  5IOC A;  2VQE L;  1EOT A;  1WTR A;  2I0Q A;  4E6I A;  4XT1 B;  1LTR D;  4IFD J;  2UUC L;  4JV5 L;  2MNA A;  1MKH A;  1LV9 A;  2DY7 A;  4R4T A;  3A56 A;  1PRT B;  1ASY A;  2TSS A;  1M90 C;  1K3R A;  1SEB D;  2MPM A;  4WJW A;  1PMR A;  1PTO D;  5LMN W;  1S3O A;  1PH7 A;  2EJM A;  1SNQ A;  1PDQ A;  3UE1 A;  3TP7 A;  2E2I B;  5C5L A;  3T53 B;  1O80 A;  3UE0 A;  4AH6 A;  4ZK9 B;  4K0K Q;  4WRD A;  2R7Z B;  5IP9 H;  1Q86 C;  3KDF B;  3ZJY C;  4ZUI A;  2KBN A;  4Z9C B;  1Q81 C;  1XMO L;  2K50 A;  4BWG B;  5JOB A;  1WD0 A;  1V1P B;  1GUW A;  3CPF A;  2UXD Q;  2DNE A;  3SDZ A;  4KKS A;  1OXV A;  5CMD A;  3NWS A;  3UDG A;  3NTK A;  1A6X A;  3RN5 A;  3OYY A;  5BN3 A;  3URY A;  2XWJ B;  4AYB B;  1X3F A;  4IUQ A;  2KJX A;  3GTO H;  1Y8P B;  2RHQ B;  1HNX Q;  1EQV A;  4X64 L;  1MBY A;  1ICW A;  3MZ5 A;  1Y8N B;  1YNN D;  5KNC A;  3T1H L;  3M7N A;  1W6J A;  4GKJ Q;  3J80 L;  1ONL A;  5A35 A;  1XPR A;  1NJI C;  4PQX A;  1D5M C;  4X3T A;  4BBS B;  2OTJ A;  2K01 A;  4HN7 A;  3A8I E;  1E2Z A;  3HFZ B;  3TSS A;  2VQF Q;  4DXF A;  5IYC G;  2XGT A;  3OW7 A;  3SEB A;  1SXT A;  1QNK A;  2EJG C;  4YCW A;  1EY4 A;  1KIX A;  1BVS A;  5I6Y A;  1CSQ A;  4JOI C;  1N36 L;  1WVL A;  4CJ1 B;  1YNJ C;  3PIO 3;  1HRJ A;  3VA5 A;  4PMW A;  1PLF A;  3M4O B;  1Q8I A;  1C9O A;  2RCN A;  1BO0 A;  4K6L A;  3NTH A;  4O0A A;  2JA5 B;  3WDN A;  2P5Z X;  4J15 A;  3NTI A;  1L1O B;  5C4H A;  2HIX A;  4JI6 Q;  1V8Q A;  1C0A A;  4KY5 A;  5IGG A;  1HPC A;  2A74 C;  3JAM c;  4F88 A;  2MGS A;  2RF4 A;  4F8M A;  3GD7 A;  3BVZ A;  1SE8 A;  1DOK A;  1SNC A;  1C4Q A;  5C3X A;  4RGM A;  4ZUJ A;  3CPW A;  1BBW A;  1HHV A;  2L11 A;  4NXN L;  4P75 A;  3VR3 A;  1LAB A;  5IP7 G;  1X3Q A;  3T1Y L;  1H95 A;  2PMZ E;  2PI2 E;  2AMC B;  4ZRZ A;  2O2L D;  4B3T Q;  1RHP A;  4GOP A;  3GTP H;  1WTW A;  2K4K A;  2MQH A;  2F4V Q;  1I4Q A;  3I72 A;  3SHL A;  4X65 L;  5IYD G;  1D6E C;  2F0F A;  3FKI G;  3FRP B;  5C0X I;  3ERS X;  4DV7 L;  4BXX G;  5C44 B;  2KUM A;  1CKN A;  2K05 A;  3RNU A;  2Q2H A;  5K5P A;  4XYO A;  3OTO Q;  4KJO A;  5IYC H;  2SEB D;  3UDI A;  3OMC A;  2I5H A;  4QY7 A;  1PTO C;  2K75 A;  2WB1 B;  3CU7 A;  4HJ8 A;  1J8I A;  1EQT A;  4A4I A;  1AW7 A;  1NCV A;  2F3I A;  3F2U A;  2Z6K A;  3SE0 A;  1F77 A;  4DR7 Q;  3H94 A;  2BDN A;  4JI4 L;  1PH2 A;  3EIV A;  2GN5 A;  2OWO A;  3EQL C;  3C2P A;  1L1O C;  2VB2 X;  2IX0 A;  2PZU A;  1TY2 A;  2K5H A;  4C3H B;  1KRS A;  2LFN A;  4ZCK A;  1QB5 D;  2CW0 D;  4NMZ A;  2KQ3 A;  1W3S A;  1Q1E A;  2EIF A;  3T16 A;  1D2B A;  3P7J A;  3DM3 A;  4L5S A;  4CKC A;  2K5Q A;  1YHA A;  1SE2 A;  4GN4 B;  4YHH Q;  2EVB A;  2G5D A;  4RCO A;  1XNQ Q;  3R3O A;  3NBH A;  1V1O A;  2K04 A;  2B39 A;  4FF4 A;  4Y52 H;  4MZ9 A;  4XT3 B;  2VB3 X;  1W6K A;  1XPO A;  1YHQ A;  1AP0 A;  1YNN C;  4XTC S;  5C6A A;  5IP7 H;  1ET9 A;  3RUZ A;  3I3C A;  1R4Q B;  4JBJ A;  1EY6 A;  2DJF C;  4DV6 L;  1N32 Q;  3A8J E;  4QCL A;  1IKM A;  3WOE A;  3NUC A;  3VDY A;  2UUB L;  4JI0 L;  1M8A A;  2UXC L;  4LFA Q;  4A3E B;  1VQP A;  3TZD A;  1GHJ A;  5IYD H;  3FKI H;  1N33 Q;  4BXX H;  3QOL A;  1O7Z A;  1X32 A;  4OO1 I;  3J7A V;  1FL0 A;  3H6M A;  2EYJ A;  1I4R A;  1KLG D;  2M00 A;  2RCF A;  3H0G G;  3MXP A;  3OWF A;  4APV A;  5CGK A;  1PZI D;  1Q90 A;  3T13 A;  2MHV A;  1I4G A;  1SNO A;  3BDC A;  3CF5 A;  4DR3 L;  1TWC H;  2ASB A;  3CCE A;  2EY5 A;  1VQN A;  3WWV A;  1TWG H;  1ZKO A;  2ZM6 Q;  1MSH A;  4LAA A;  1KTK A;  4A76 A;  1RKN A;  2ZJR A;  4OX9 Q;  1FGU A;  2Z8L A;  3I55 A;  2F0J A;  2ZJP A;  5C5M A;  4A3F G;  4A3G G;  2CWP A;  2XTI A;  1IYU A;  1TXY A;  2NWG A;  1Z9F A;  3QWN A;  1FVI A;  2OQK A;  2SNS A;  1EIY B;  4I7A A;  1N9W A;  3A5U A;  3ONA B;  1PVO A;  3Q22 A;  4LF9 Q;  3AB9 A;  3J80 c;  2RSN A;  4IUP A;  4B08 A;  4OWW B;  1J6Q A;  2B8F A;  2RBM A;  3SK6 A;  3GTO B;  4MTN A;  4OIK A;  2WKC A;  2KHS A;  3R2T A;  3TP8 A;  3OSO A;  2JXM B;  4LF8 L;  4EQN A;  1VDZ A;  1BBX C;  4B3M Q;  5GAD C;  4BBR G;  1SRU A;  3ND8 A;  2QEX A;  5JEA G;  4K0K L;  3T56 B;  1LAC A;  1U4L A;  2DJG C;  1NNX A;  3LX0 A;  1RL2 A;  1TS4 A;  5DEH A;  4U67 3;  1B50 A;  3L9A X;  1MJE A;  2NZO A;  2K7V A;  1JOK A;  4IAL A;  1GXD C;  3H0G H;  5EPK A;  2JEB I;  2VY3 A;  3E0E A;  1TT2 A;  4K6D A;  4L5Q A;  1EQQ A;  1YBY A;  1EYC A;  1F9P A;  4KHP Q;  4JBK A;  2K14 A;  5T1I A;  1G8Z D;  3KF6 B;  1CM9 A;  2MP1 A;  1S5D D;  4JI7 Q;  2CW0 C;  1OXT A;  5EPJ A;  1HNX L;  4HJ7 A;  3H91 A;  2AUJ D;  2R61 A;  4WOR A;  4EQ5 A;  5A2Q L;  3TP6 A;  5KND A;  4KMU C;  4GKJ L;  4DAP A;  3CCU A;  4A3F H;  1XYI A;  3A7A B;  4A3G H;  4YIJ A;  1F2M A;  2FFK B;  2A69 D;  1VQM A;  3NXW A;  1B44 D;  4HMI A;  4UP7 A;  5FLM G;  1BXT A;  4R8I A;  4A3L G;  2K28 A;  3ERO A;  3ITP A;  3AMU A;  3K6O A;  1JE5 A;  1STH A;  1CHQ D;  1CK1 A;  3A0J A;  3HZX A;  3GTP B;  2AQ3 B;  2Z1C A;  1YEZ A;  3HEJ A;  3QO2 A;  4JCV E;  3ULL A;  4C3J G;  3TBI B;  2Q2T A;  2D0O A;  5C4X G;  1UUP A;  4A75 A;  4BBR H;  1VQI A;  1DD2 A;  1SFO H;  5JEA H;  2V4D A;  4ALP A;  2F0S A;  2F0N A;  3U9O A;  2NVQ H;  1VQ4 A;  4L63 B;  4JI6 L;  5F2D A;  3KLW A;  1PYS B;  2WKD A;  1A0I A;  3VR4 A;  3HOU G;  2CCZ A;  2FXQ A;  1B9M A;  4V19 0;  4IFD I;  1K28 A;  1T9H A;  2KCM A;  3MEH A;  2K1B A;  4NDX A;  1PH9 A;  2N3S A;  4LF5 Q;  1JCK B;  4GZY C;  1S5F D;  4Y7N H;  2EOT A;  4I7Z C;  3MXN A;  1HFN A;  2IT1 A;  4DGZ A;  2PZW A;  2ZTE A;  3H15 A;  2Z4H A;  1HA6 A;  2EE1 A;  1D5Z C;  1JWU D;  2I07 B;  4B3T L;  1VCI A;  4R8N A;  3KK7 A;  4F7X A;  1HA5 A;  4KK7 A;  2CFM A;  2VNU D;  4RMF A;  2F4V L;  1SMY D;  2B2T A;  1X3E A;  1AZQ A;  4IUN A;  2KHI A;  1IZ6 A;  2L15 A;  2XVS A;  3GTL H;  5JJZ A;  4F87 A;  1KHI A;  5IGF A;  1HNW L;  2OQ0 A;  1Z7T A;  3KJP A;  2VL6 A;  3OTO L;  3NSW A;  1CQV A;  1PTO H;  1I4X A;  3DWP A;  5FLM H;  5COR A;  2GVA A;  3TS0 A;  2VUM G;  2HQE A;  2ICI A;  4A3L H;  1CZW A;  4IUR A;  3F1Z A;  1VF5 C;  3D31 A;  4TSS A;  5ELF A;  3PUX A;  3K0Y A;  4A3D G;  3JAM E;  2L1B A;  4DAV A;  2UU9 Q;  3S2H H;  2K5D A;  4DR7 L;  1Q7Y C;  1MD2 D;  4HIM A;  3NWT A;  4C3J H;  1EUJ A;  1OXX K;  4PV1 C;  1NY4 A;  5C4X H;  2CVR A;  1FYC A;  5E3F A;  3CCS A;  1N8R C;  2EYH A;  1VQF A;  3K5L A;  1KD1 C;  1GHK A;  4KTA A;  1FNU A;  1VQL A;  5BN5 A;  1L0Y B;  1SJH D;  2F0U A;  2F0V A;  4DK1 A;  5FOB B;  1HR0 Q;  3PMF A;  3DWA A;  2E74 C;  4KY6 A;  3EJI A;  3HOU H;  1V9P A;  4L5T A;  4I65 A;  1H9R A;  4CJ2 C;  1PHJ A;  5TSS A;  4DV5 L;  1TWC B;  3BS1 A;  3D8G A;  1E3P A;  1KAW A;  2BH2 A;  2EJF C;  1HZA A;  2L55 A;  1TWG B;  1X55 A;  1KDC A;  4FF1 A;  2QDL A;  1NSN S;  1EWH A;  2CHB D;  4JG2 A;  1P16 A;  3PF4 A;  2C9O A;  4A3E G;  1CHP D;  3MVV A;  2KCC A;  1F2Y A;  4J8Q A;  1N32 L;  2A69 C;  1S4Z A;  1SND A;  4PNY A;  3Q8D A;  2R93 G;  4RKB A;  3KBG A;  1PRT F;  4LFA L;  3D4W A;  4OL7 A;  3BVM A;  1N33 L;  2IJ0 A;  1WOC A;  3C1F A;  1EZ6 A;  1L0W A;  4CDF C;  4QMG A;  1SDF A;  1NR2 A;  3I91 A;  3HKS A;  2JA9 A;  1EY5 A;  3H3V I;  2VUM H;  3K58 A;  4KN4 C;  1E1O A;  2RKS A;  3A7L A;  1EY7 A;  4UPA A;  4XQN A;  3QR8 A;  2HCI A;  1E2W A;  4P71 A;  2JJQ A;  3RMH A;  1I5F A;  2GVB A;  4A3D H;  2ZM6 L;  3W5O A;  3GP7 A;  1JB7 A;  4TRD A;  1UNS A;  4FXK C;  2H1E A;  3KJO A;  1G6P A;  3MC0 B;  4OX9 L;  3QJY A;  1IBL Q;  5JEA J;  4ZAI A;  2EY6 A;  1VQ9 A;  1PH3 A;  1RF2 D;  4HTH A;  5IIF A;  1XJV A;  4DK3 C;  1E0B A;  4JOI A;  1PFN A;  2PZT A;  3H0G B;  1KAA A;  1ICF B;  2HDL A;  5I2Y A;  3RZD H;  4EQP A;  4LF6 Q;  1UE1 A;  4DF7 A;  1BBU A;  3D6C A;  1NTG A;  2UXC Q;  4LF9 L;  2AKW B;  2SOB A;  4R4O A;  4MHE A;  2K6A A;  1HQR D;  3OW2 A;  4AIM A;  1V1P A;  1SMY C;  2DN8 A;  3CP0 A;  4KI0 A;  3GTJ H;  1D1K A;  2FJ2 A;  4PZ7 A;  3ULP A;  1WTH A;  4NXM Q;  2O5J C;  1BCP F;  1TVX A;  2EY1 A;  3G48 A;  4A3F B;  2R93 H;  3AFP A;  4A3G B;  3S9W A;  2KEC A;  1V1Q A;  3M4P A;  4O1N A;  3K59 A;  4FP5 D;  5IGB A;  3NEM A;  3GTG H;  1II3 A;  1G6Z A;  1X3G A;  4K2K A;  5DM7 3;  3IKJ A;  1W2B A;  4LJZ C;  1XNR L;  1QE6 A;  5CR3 A;  4KLK A;  2B29 A;  2DY8 A;  2N49 A;  5IY0 A;  1EOV A;  2YU9 H;  5ISR A;  4KHP L;  2N78 A;  1SYG A;  2L9H A;  3E5S A;  5EKL A;  1TWF H;  2ZTD A;  5JJL A;  1PXU A;  2JSO A;  1I50 H;  2JQO A;  2QA4 A;  3CCM A;  2HD3 A;  4BBR B;  1FD7 D;  2B2Y C;  3E3X A;  1SFO B;  3I4O A;  3IL8 A;  4EVO A;  3J80 E;  2NVQ B;  3GTM H;  2PQE A;  2D5D A;  3BZD B;  1KRT A;  4RGT A;  3BYY B;  2D0P A;  3QIA A;  4LF4 Q;  4R1J A;  4UHV A;  5HUR A;  2GA4 B;  1PFM A;  2LMC B;  1L1O A;  4KKT A;  4EQO A;  1ML0 D;  1FR3 A;  2RVL A;  1B4O A;  3FPP A;  4X3U A;  1ILQ A;  4Y7N B;  1M1K C;  4YWK A;  4JPB W;  3PGZ A;  4DAM A;  5IYB G;  4DV4 Q;  1D7Q A;  4FO2 A;  4DUY Q;  2IWH A;  4HID A;  2K5W A;  1C48 A;  3CKI B;  4LK1 C;  3U50 C;  3GDE A;  5D65 A;  1E22 A;  3GTL B;  3FPU B;  1A3T A;  1JIC A;  1EEF D;  3R93 A;  1CFM A;  4K14 A;  1PTO B;  4KD3 A;  1K0R A;  1SYB A;  3HOX G;  3I2Z A;  3ULJ A;  3KLS X;  4RFB A;  2Q8T A;  3E0J A;  4LF5 L;  1YJ9 A;  5EKK A;  1RIP A;  2E5L Q;  2QIL A;  1GUN A;  5GAH C;  1PFB A;  2KOL A;  2EYF A;  2I5M X;  3S2H B;  4C3J B;  1Q3L A;  2NTT A;  5C4X B;  2HHH Q;  4LUO A;  1WTQ A;  4KHV A;  5NUC A;  4KY7 A;  2PCF B;  3S24 A;  2JP1 A;  1CSP A;  2QDB A;  5E4W C;  3D0F A;  3BYT B;  3HOU B;  2QCP X;  3ER0 A;  3E6Z X;  1VF7 A;  2XRS D;  3AEV A;  1EFW A;  1GVP A;  3FVQ A;  1U4M A;  1FGB D;  4BA1 I;  3EBE A;  3X3M A;  3P1H A;  5ELN A;  1EY8 A;  1YI2 A;  2XN9 C;  5I6W A;  2R6G A;  1JR0 D;  3J81 i;  1D1I A;  1B7Y B;  3PSI A;  4B3R Q;  4R4C A;  5IYB H;  1KNA A;  1Y1W G;  4LNQ A;  3U58 A;  3BU2 A;  4CHT B;  4X62 Q;  2TMP A;  3CC2 A;  3W1G A;  1X9N A;  3CCR A;  4C1N I;  1SNM A;  2QF7 A;  2Q8I B;  1NAP A;  4C56 C;  2ZT9 C;  3NEL A;  5EGT A;  5CBE E;  3O13 A;  2QW7 A;  3CCL A;  4QJF A;  1HR0 L;  3PV0 A;  2ALY B;  5KYL A;  2NBF A;  1U9R A;  2VUM B;  3HOX H;  2BA1 A;  2NVT H;  1E1T A;  5JJK A;  1ENF A;  1OTC A;  1HCZ A;  2NB0 A;  5KYI A;  4DUZ Q;  4IUU A;  3S1M H;  3CW2 C;  3TN2 A;  2F0M A;  2LSS A;  1A2T A;  4DN4 M;  4A3D B;  4C3I G;  1B9N A;  2F0T A;  4JBW A;  4RGN A;  1QUQ B;  4HSP A;  1JC7 A;  2FMM A;  3EFX D;  3MHB A;  5KEE A;  4RHR A;  4N9P A;  1QVG A;  2E2J H;  3K0X A;  1CKO A;  5M5Y B;  3K81 C;  1XXG A;  2RDF A;  3MFY A;  1Q1B A;  3VR5 A;  4UP8 A;  5GRO A;  1VQG A;  3UDF A;  4GKK Q;  4U68 A;  1QZH A;  3RZD B;  1STA A;  3VYS A;  4OO1 G;  3EVQ A;  5JPM C;  2J7Z A;  1SBB B;  2CQO A;  2PQA B;  1EWI A;  2EQS A;  1UWV A;  4PZ8 A;  4DNR B;  2K32 A;  1A62 A;  2E75 C;  3MA2 B;  3GTJ B;  4ULL A;  1Y1W H;  1PA6 A;  1HZB A;  2OCE A;  3SVM A;  4DV2 L;  3FDT A;  1U5K A;  1K3B C;  1S5E D;  2E2D C;  1QJO A;  1XMQ Q;  1IBL L;  2R93 B;  3M4Q A;  1H9J A;  1AH9 A;  1ESF A;  2WIN B;  3V05 A;  3CHB D;  1UE6 A;  5CV8 A;  3GTG B;  2Q2U A;  4DR2 Q;  3I4M G;  2FIN B;  2VS1 A;  5DNF A;  1J5E L;  4FF3 A;  4DAY B;  2SNM A;  3A55 A;  4LF6 L;  4DR4 Q;  1JWM D;  3D6W A;  1OO9 B;  1S72 A;  4AQY Q;  1JOR A;  2F03 A;  4P72 A;  1EEI D;  4JI1 Q;  2YU9 B;  2KCT A;  1XTC D; 
#chains in the Genus database with same CATH homology
 4GLA C;  1Q82 C;  1KC8 C;  5E7N A;  4IFD I;  2R7F A;  2ES2 A;  4X66 Q;  4DR5 Q;  1T9H A;  1VQO A;  2KCM A;  2ATW A;  1LM0 A;  4LW1 A;  1PH9 A;  2AWN A;  4C3I H;  2N3S A;  2UXB L;  4LF5 Q;  4QQB X;  1IXR A;  4KHZ A;  4Y7N H;  1E7Z A;  2BH8 A;  1OXS C;  3LGJ A;  4YWM A;  3RR5 A;  5C0X G;  3M85 A;  3G71 A;  3CD6 A;  4XIG S;  1L2F A;  2BA0 A;  1J5E Q;  2IT1 A;  5AJ3 Q;  2IX1 A;  1QUQ A;  4NXM L;  2ZTE A;  3K8A A;  3H15 A;  1GKH A;  1WFQ A;  4JI5 L;  3KF6 A;  3TQY A;  2HQL A;  3UDX A;  3CQZ H;  3G6E A;  5M3F H;  4B3T L;  1VCI A;  4JI8 L;  1B70 B;  3KOJ A;  1HJP A;  2JEA I;  1PH6 A;  2C35 B;  2CFM A;  2VNU D;  4RMF A;  1HH2 P;  2NVY H;  3BZC A;  3NBH B;  5BR8 Q;  5FJ8 G;  2F4V L;  1X3E A;  4DV1 Q;  2UU9 L;  1VQE A;  1U0L A;  2KHI A;  1IZ6 A;  2L15 A;  3CMA A;  1I94 L;  3GTL H;  1WJJ A;  2N8N A;  1KHI A;  1VQ8 A;  1HNW L;  3KYH C;  2OQ0 A;  1X65 A;  1PH5 A;  3PUW A;  4GOP C;  1HNZ Q;  4A3E H;  3KJP A;  4DV0 Q;  2VL6 A;  3OTO L;  4A3I H;  1EYG A;  2K5V A;  1K8A C;  1X6O A;  5FLM H;  3J81 c;  4IOC A;  3S1N H;  3PF5 A;  2GVA A;  3U4Z A;  3TS0 A;  2PQA A;  4L5R C;  2VUM G;  1B8A A;  4A3C H;  4A3J H;  3PUZ A;  4TVA B;  2ZJQ A;  1K8G A;  4A3L H;  3K7U C;  2VQE L;  3F1Z A;  3D31 A;  2I0Q A;  3HOV H;  1K83 H;  3PUX A;  1K9M C;  1QZG A;  5EAY A;  4IFD J;  2UUC L;  4JV5 L;  4R4Q A;  2MNA A;  1MKH A;  4A3D G;  1WCM G;  3AYH B;  2UU9 Q;  1G29 1;  4R4T A;  4YCU A;  3S2H H;  4DR7 L;  1Q7Y C;  4HIM A;  1ASY A;  1HNW Q;  2WFW A;  4C3J H;  1EUJ A;  1OXX K;  1M90 C;  1K3R A;  1NY4 A;  2UXD L;  4WJ3 M;  5C4X H;  5LMN W;  4JI3 L;  3HOY G;  2MFI A;  3I4M H;  1S3O A;  1IBM L;  3CCS A;  1N8R C;  1NMF A;  1PH7 A;  4LF4 L;  1VQF A;  2HIV A;  1KD1 C;  2WAQ G;  3UE1 A;  2VQE Q;  1VQL A;  3GTK H;  4DR6 Q;  4DR1 L;  4P73 A;  3UE0 A;  4QIW E;  4AH6 A;  4K0K Q;  1HR0 Q;  1PV4 A;  2IHE A;  3HOU H;  5IP9 H;  1V9P A;  4L5T A;  1Q86 C;  5IE8 A;  5M5X H;  4RG1 A;  3KDF B;  3ZJY C;  2KBN A;  3BJU A;  1PHJ A;  1Q81 C;  2JA8 G;  4DV5 L;  1XMO L;  4LF7 Q;  2K50 A;  4OWX B;  1LUZ A;  2A8V A;  3I4N G;  1E3P A;  1KAW A;  3CPF A;  2BH2 A;  2UXD Q;  1HZA A;  1OXV A;  1X55 A;  3UDG A;  4B3S Q;  4DUY L;  2QGQ A;  3L7Z C;  3RN5 A;  1VQA A;  3OYY A;  4JG2 A;  3U4V A;  3I56 A;  1P16 A;  3PF4 A;  4O2D A;  4A3E G;  1N32 L;  1X3F A;  2VQF L;  1G51 A;  4GLV B;  3PIO A;  4GOP B;  4A3K G;  3GTO H;  1UE5 A;  3Q8D A;  2B63 G;  1N34 Q;  2RHQ B;  4DPG A;  1HNX Q;  5FJ8 H;  2R93 G;  2EXD A;  5J3B A;  3A74 A;  4X64 L;  4LFA L;  1YVC A;  5IWA Q;  1P8L A;  1NBW A;  4DKA C;  1TWA H;  4DV5 Q;  1XMO Q;  1KQS A;  1WOC A;  3T1H L;  1N33 L;  3M7N A;  3S1Q H;  4A3B G;  1IBK Q;  1DGS A;  1L0W A;  3HKZ G;  4GKJ Q;  1CKN B;  1XPR A;  1NJI C;  2MO1 A;  3HKS A;  2JA9 A;  4IFD G;  2OTJ A;  3TS2 A;  3H3V I;  5LMU Q;  3K7A H;  3L0O A;  2E5L L;  2VUM H;  4GS3 A;  2JA6 G;  3HFZ B;  1E1O A;  2YTY A;  2VQF Q;  4A93 G;  5IYC G;  3CAM A;  2XGT A;  3S1R H;  4UPA A;  3AQQ A;  2DGY A;  2DUD A;  2JJQ A;  4P71 A;  1I5F A;  2GVB A;  4JI2 Q;  4YCW A;  4A3D H;  2ZM6 L;  1WCM H;  2F52 A;  3W5O A;  2HHH L;  1KIX A;  1AE3 A;  1BVS A;  1JB7 A;  1YIJ A;  4HIO A;  3PUY A;  2VW9 A;  1MIU A;  4IPG A;  1CSQ A;  1G6P A;  3KJO A;  3A5Z B;  4JOI C;  5C3E G;  1N36 L;  4OX9 L;  1IBL Q;  5JEA J;  1EIF A;  3HOY H;  3TEH B;  4P74 A;  1EQR A;  3JAM i;  1Y1V G;  2YV5 A;  4PMW A;  3F2B A;  4HJ9 A;  1VQ9 A;  1OXU A;  2A1A A;  3B6Y A;  1C9O A;  2RCN A;  1PH3 A;  4LFB L;  4O0A A;  1XJV A;  4DK3 C;  4JOI A;  3S16 H;  4GLX A;  4J15 A;  4DV3 Q;  1L1O B;  4LF6 Q;  2UUA Q;  2WP8 J;  3RZD H;  4LFC Q;  1UE1 A;  2HIX A;  1HZC A;  4JI6 Q;  4UY8 C;  3RLN A;  4IJH A;  1BBU A;  1C0A A;  1NTG A;  5ELO A;  3JAM c;  2JA8 H;  4B3R L;  2UXC Q;  3CCQ A;  2RF4 A;  4LF9 L;  3GD7 A;  3I4N H;  1SE8 A;  2AKW B;  4R4O A;  5LMN L;  4LUV A;  3F8T A;  3SGI A;  3OW2 A;  2PI2 A;  4AIM A;  2V1C C;  2UXB Q;  3CPW A;  1BBW A;  4X62 L;  2NVX H;  4BY1 H;  4NXN L;  1V43 A;  3CP0 A;  4KI0 A;  3GTJ H;  4P75 A;  2WAQ E;  2NN6 G;  5IP7 G;  3T1Y L;  1H95 A;  2PMZ E;  4PZ7 A;  3ULP A;  1JJG A;  5GQO A;  2PI2 E;  4NXM Q;  4A3K H;  2AMC B;  3G48 A;  4IPC A;  3AFQ A;  4EX5 A;  4JI5 Q;  2B63 H;  1VQB A;  4B3T Q;  2R93 H;  4JI8 Q;  3AFP A;  3L2P A;  4GOP A;  3GTP H;  1V1Q A;  2K4K A;  4A3M G;  1Q12 A;  3M4P A;  1VS0 A;  2MQH A;  3NEM A;  2F4V Q;  3GTG H;  4A3B H;  4AYB E;  1X3G A;  1PYB A;  2R92 G;  1Y14 B;  4X65 L;  4HJA A;  5IYD G;  2D62 A;  3FKI G;  5C0X I;  4DV7 L;  2CWA A;  3ERS X;  4BXX G;  1I94 Q;  1W2B A;  1XNR L;  4DUZ L;  1CKN A;  3FHW A;  3RNU A;  2Q2H A;  3DLL A;  1FJG L;  1YJN A;  4NXN Q;  3S14 H;  4KLK A;  2AWO A;  2B29 A;  4X6A H;  4C2M H;  2N49 A;  3OTO Q;  3NEN A;  2JA6 H;  5IY0 A;  1EOV A;  3M9B A;  4A93 H;  2R7Z G;  5IYC H;  2YU9 H;  3UDI A;  4KHP L;  1VQJ A;  2N78 A;  1VQK A;  2I5H A;  4QY7 A;  2K75 A;  1TWH H;  2Z6K C;  1MJC A;  5HGQ A;  4HJ8 A;  1JJ2 A;  4A4I A;  1QVC A;  1TWF H;  4IJL A;  2JA5 H;  2ZTD A;  5JJL A;  1BKB A;  2F3I A;  1I50 H;  1I3Q H;  2JQO A;  2UUC Q;  1YHB A;  3CCM A;  2QA4 A;  1R9T H;  3HKZ E;  4JV5 Q;  1KXL A;  2JA7 G;  2Z6K A;  4YHH L;  5C3E H;  3F2C A;  4JYA L;  1XNQ L;  2VZA A;  3G4S A;  1XNR Q;  4DR7 Q;  1CKM A;  3M3Y H;  4JI4 L;  3I4O A;  1PH2 A;  3EIV A;  2R92 H;  4AYB G;  2JK8 A;  1Y1V H;  2GN5 A;  3JC6 6;  1KRT A;  2OWO A;  3GTM H;  1QVF A;  4DV4 L;  4GN5 A;  4JI3 Q;  3MXN B;  1L1O C;  2D0P A;  1IBM Q;  2IX0 A;  1D8L A;  2K5H A;  4ME3 A;  3PCO B;  1KRS A;  2AHO B;  3CC4 A;  4R1J A;  4LF4 Q;  3HOW G;  4BY1 G;  1X54 A;  5C4J H;  1VQ6 A;  1GD7 A;  3STB D;  1W3S A;  3E9I A;  4DNI A;  4DR1 Q;  1Q1E A;  2EIF A;  2CKZ B;  3J81 j;  1K73 C;  3DM3 A;  4L5S A;  4R4I A;  1L1O A;  2OTL A;  1I6H H;  2I5L X;  5JJK A;  5JJI A;  1YHA A;  2LXJ A;  5C0X J;  4GN4 B;  1M1K C;  4YHH Q;  4BBS G;  4YWK A;  1PH4 A;  1XNQ Q;  1HR0 W;  3S2D H;  3PGZ A;  2YTX A;  4DAM A;  4WJ4 A;  5IYB G;  4Y52 H;  3KFU A;  4MZ9 A;  4DV4 Q;  1XPO A;  1YHQ A;  1XMQ L;  1D7Q A;  4XTC S;  5IP7 H;  4DUY Q;  1KL9 A;  1O7I A;  3CXC A;  5H1S E;  4HID A;  5M3M G;  4DR2 L;  1WI5 A;  4JBJ A;  4JBM A;  3U50 C;  3GDE A;  4DV6 L;  3PUV A;  1N32 Q;  3PIP A;  1YJW A;  1E22 A;  4A3M H;  2IHF A;  4YY3 L;  1NMG A;  5HY6 A;  3VDY A;  2UUB L;  1ASZ A;  4JI0 L;  2K5N A;  4X64 Q;  2UXC L;  5FLX c;  4LFA Q;  1VQP A;  1YIT A;  1VQ5 A;  3HOZ G;  1E24 A;  5IYD H;  3FKI H;  2E8G A;  1N33 Q;  3PO2 G;  3T1H Q;  4BXX H;  4JI1 L;  1K0R A;  4OO1 I;  3HOX G;  3I2Z A;  2E2I H;  1FL0 A;  3ULJ A;  2JA5 G;  2HT1 A;  4X66 L;  4DR5 L;  4GNX B;  3H0G G;  4APV A;  4IO9 A;  3F2D A;  4LF5 L;  4YWL A;  2R7Z H;  1YJ9 A;  3RN2 A;  5M5Y H;  1Q46 A;  1RIP A;  1WYD A;  2E5L Q;  3CF5 A;  4DR3 L;  2R7D A;  4JC0 A;  4DV6 Q;  5GAH C;  5AJ3 L;  2RHS B;  1TWC H;  2I5M X;  2ASB A;  4UP9 A;  3CCE A;  3S17 H;  1VQN A;  3WWV A;  1TWG H;  2ZM6 Q;  1GM5 A;  2JA7 H;  2HHH Q;  4PZ6 A;  4LUO A;  1HZ9 A;  4A76 A;  3IRB A;  4LWC A;  5BR8 L;  4GN3 B;  2WB1 E;  3J7Z C;  2KEN A;  3KDF A;  2ZJR A;  2YYZ A;  4DV1 L;  3S24 A;  1N36 Q;  4OX9 Q;  1FGU A;  4IPD A;  3I55 A;  3ICE A;  1Z47 A;  1VQH A;  2ZJP A;  1IL2 A;  1CSP A;  4A3F G;  1XPU A;  3D0F A;  3HOW H;  3J7A 5;  1HNZ L;  4A3G G;  4LUZ A;  2CWP A;  2XTI A;  4DV0 L;  4DR3 Q;  4LFB Q;  3ER0 A;  3J80 i;  1TXY A;  3AEV A;  4PG3 A;  3EN2 A;  1Z9F A;  1EFW A;  1GVP A;  2PNH A;  4B3M L;  1FVI A;  3KF8 B;  3EBE A;  2OQK A;  4BA1 I;  4HJ5 A;  3H3V H;  1EIY B;  5ELN A;  1YI2 A;  5C44 G;  1YZ6 A;  4MNO A;  1LYL A;  2R6G A;  3J81 i;  1VQD A;  1N9W A;  4BBS H;  3MEF A;  1B7Y B;  3A5U A;  3PSI A;  1PFS A;  4B3R Q;  1PVO A;  4R4C A;  3GTQ H;  1SMX A;  5IYB H;  1S40 A;  4LF9 Q;  3J80 c;  5LMN Q;  1Y1W G;  4OWW B;  1IYJ B;  4LNQ A;  1J6Q A;  4MTN A;  3U58 A;  2WB1 G;  3BU2 A;  1AE2 A;  4X62 Q;  3BZK A;  3TRZ A;  3GO5 A;  3W1G A;  5M3M H;  3CC2 A;  1X9N A;  3T1Y Q;  3CCR A;  4LF8 L;  4B3M Q;  5GAD C;  4BBR G;  2KHJ A;  4IPH A;  1A63 A;  3NEL A;  1SRU A;  3CCV A;  4HIK A;  4DR6 L;  1PH1 A;  2QEX A;  4YCV A;  5JEA G;  4QJF A;  3CCL A;  1HR0 L;  3HOZ H;  4JI7 L;  3PO3 G;  4K0K L;  3PV0 A;  2ALY B;  3M4O H;  3PO2 H;  1YNX A;  4GNX C;  4BY7 G;  1RL2 A;  3HOX H;  2BA1 A;  4X65 Q;  4H02 A;  1E1T A;  2NZO A;  1MJE A;  3K80 C;  2E2H H;  4NPS A;  4DV7 Q;  1VQ7 A;  2NVT H;  2NN6 I;  4QL5 A;  4POF A;  1JMC A;  1OTC A;  3H0G H;  4LF7 L;  2JEB I;  2VY3 A;  4DK6 C;  1SR3 A;  4DUZ Q;  4GKK L;  3E0E A;  3RLF A;  1FJG Q;  3S1M H;  2Y0S E;  2ZTC A;  3CW2 C;  4L5Q A;  1EQQ A;  4GNX A;  2JE6 I;  2LSS A;  1YBY A;  4LF8 Q;  4B3S L;  2CCZ A;  4JBW A;  1QUQ B;  4KHP Q;  4JBK A;  2K14 A;  3CCJ A;  1PH8 A;  3KF6 B;  1QVG A;  2E2J H;  3K0X A;  4JI7 Q;  1JT8 A;  3RLO A;  1CKO A;  1JJC B;  1OXT A;  4NB3 A;  1N34 L;  3STB C;  5GAG C;  3CME A;  3K81 C;  1HNX L;  5M3F G;  4HJ7 A;  3FP9 A;  3E9H A;  2Z0S A;  5IWA L;  4EQ5 A;  1A8V A;  1Q1B A;  1SN8 A;  4JYA Q;  2H5X A;  4UP8 A;  1VQG A;  5GRO A;  3UDF A;  1IBK L;  4JI4 Q;  4GKK Q;  1CUK A;  1QZH A;  4A3F H;  3CCU A;  4POG A;  4GKJ L;  4A3G H;  2IY5 B;  3W1B A;  3S15 H;  1SRO A;  2K52 A;  4OO1 G;  1NE3 A;  1VQM A;  1Q8K A;  2A19 A;  1VQC A;  1SLJ A;  5LMU L;  2Y0S G;  2CQO A;  2PQA B;  3I7F A;  4A3I G;  1EWI A;  2EQS A;  2B3G A;  2ID0 A;  4OON A;  1UEB A;  2LXK A;  4UP7 A;  1UWV A;  4PZ8 A;  5FLM G;  5C44 H;  4A3C G;  4A3J G;  4A3L G;  1A62 A;  4IOA A;  4DR4 L;  5GAE C;  1LTL A;  1JE5 A;  4JI2 L;  1XTD A;  1X56 A;  2MO0 A;  3HOV G;  1Y1W H;  1GO3 E;  1HZB A;  2OCE A;  4DV2 L;  4AQY L;  1PA6 A;  4OXP A;  3A0J A;  4QGU A;  1U5K A;  3TRE A;  1XMQ Q;  1IBL L;  5IT9 c;  3M4Q A;  1C7Y A;  1YEZ A;  1AH9 A;  4JCV E;  3ULL A;  2Q2T A;  3RZO H;  4BA2 I;  1UE6 A;  2D0O A;  2NZH A;  1UE7 A;  2YTV A;  5DLQ E;  4BBR H;  4A75 A;  2Q2U A;  5C4X G;  4DR2 Q;  5M5W H;  3I4M G;  1VQI A;  2VS1 A;  1SFO H;  1J5E L;  4OWT B;  4FDB A;  4DAY B;  4ALP A;  2NVQ H;  4DV3 L;  3PO3 H;  4LF6 L;  2UUA L;  1VQ4 A;  4YY3 Q;  4LFC L;  4DR4 Q;  2UUB Q;  4JI6 L;  4JI0 Q;  4TQU S;  5K36 G;  4BY7 H;  1S72 A;  3KLW A;  1PYS B;  1A0I A;  3CC7 A;  4DV2 Q;  4C3H H;  4AQY Q;  4P72 A;  3HOU G;  5IP9 G;  4JI1 Q;  2KCT A;  2Q2I A;  2FXQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...